1QVGR

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qvgR00
4PKDB 4A8XA 1U1OA 1HD0A 2E5GA 2DNGA 4YB1P 3G6ES 1XN9A 4P6QA 2M8DB 2CQ3A 2G4BA 3BS9A 3FEXB 4IO9Q 4IUFA 3VAMA 2DO4A 2F9DA 2N7CA 2CQ0A 2YH0A 3D2WA 2LKZA 2LQ5A 2KI2A 3G96A 2V94A 2RU3A 2N3LA 2DNMA 1VC6A 2M7SA 3CCLS 2DGQA 2MY7A 2DK2A 4CH0S 2RVJA 2HVZA 2U2FA 3ZZZA 1YHQS 3SMZA 1H6KX 5DDPC 2XB2D 2QA4S 2MKIA 2MQNA 5CYJA 3MURP 4PR6A 2HYIB 2DIUA 1U1LA 2I2YA 1B7FA 2B0GA 2CPJA 2J0SD 2MKJA 3CCUS 2UP1A 3CTRA 1VQMS 1H2UX 4WFNQ 2VODA 2CQHA 2DNKA 3Q2TC 4TU9A 2MB0B 2KYXA 2MZSA 2LYVA 1QM9A 2DGSA 2AYGA 4W92B 4TU8A 2MGZA 1FJEB 2YKAA 4UY8T 1X0FA 3BEGB 1DZ5A 2X1FA 3G9CA 3ZZYA 2CPXA 3S6EA 1JJ2R 1VQOS 1K8AT 1UFWA 3UCGA 2GHPA 2DHAA 4OZ0A 4UQTA 1CVJA 2DHSA 1WI6A 1DBDA 3MXHP 3IRWP 5IQQA 3MI7X 1VC0A 2MQMA 4W90B 4V19X 2RS8A 3CF5Q 2RNEA 3OW2R 3VF0B 3BO4A 1X4EA 3H2VE 4TLQA 2I38A 3B4MA 2CQDA 3I55S 3VAJA 5GAGU 2E5HA 3MUTP 1X4CA 1WTBA 1X5OA 3CCQS 5CXTA 2HGLA 2U1AA 3UCUP 1YWXA 1YI2S 2VONA 2X1AA 1N88A 1KC8T 1O0PA 2KXNB 1ZZNA 3G4SS 1SJFA 1P27B 3NNHA 4IOCQ 1WI8A 2DNQA 3G8SA 3THPA 1FJ7A 2MQQA 1M5KC 5GMKa 2FC9A 2AD9A 3US5A 1BY9A 2MYFA 1X5PA 2JRSA 3B4DA 1H2TZ 1YJ9S 2J8AA 5FJ4A 2MGZB 3CC7S 2L9WA 1M1KT 1D8ZA 5DDRC 2CPFA 3UCZP 2M0GB 2RQCA 1URNA 2DGVA 5BJRA 1U2FA 1WG1A 1A9NB 1HD1A 5JVHQ 1X5SA 2DGUA 2DISA 3NNAA 3S7RA 4CH1A 1WF2A 2RQ4A 1DHMA 4M5DB 1X4FA 1U6FA 2DNOA 3K0JA 2LA4A 4Y00A 5LSLA 3DXBA 2DB1A 3CCMS 2FC8A 3UE2A 1VBXA 2VOOA 2MPUA 2KH9A 1VQ7S 1VQ4S 1K73T 1Q81T 4CIOA 4Y0FA 2XNQA 1WHXA 1FXLA 2OTJS 3FEYB 5JVGQ 2PEHA 2MKCA 1U1MA 2DGOA 4OZ1A 2CQCA 1A7GE 2JWNA 2Q79A 1S72S 2CQ2A 2EK6A 1UW4A 3R27A 5CA5A 1VC5A 5H1SV 4EGLA 2MQPA 5LXRA 1QVFR 3CD6S 3MDFA 3P6YC 1D9AA 2DH8A 2KRRA 1U6BA 2MZTA 2KFYA 2DNZA 2YH1A 3LQVA 3U1LA 2OTLS 2OSRA 2CPDA 4J5OA 1M5VC 2HGMA 1ZZFA 2O3DA 3EGZA 1HA1A 1YITS 1KOHA 3VALA 2RRAA 1U1QA 1SJ4P 1WHWA 2HGNA 5DM6Q 4C0OC 1H2VZ 1VQ6S 1WF1A 1Q82T 2ADBA 2DNRA 4F25A 3S8SA 2MZQA 5GADU 4BS2A 4LMZA 2AYMA 2WBRA 3NMRA 2F9JA 2KXFA 2MZRA 2JVRA 3CC2S 4ED5A 2YWKA 1KQSR 3G8TA 5IM0A 2DO0A 3R1LA 1VQ9S 2MJUA 4LJMA 2KN4A 2CJKA 2E5JA 2MKSA 1U1PA 3PIPQ 1FT8A 1RK8A 1VBYA 2JVOA 3N9UC 3S01A 3TO8A 1Q86T 1N54B 3L3CA 2D3OR 2CQPA 2DNNA 1JJHA 2SXLA 3VAFA 2KM8B 2MKKA 2ZJRQ 2X1GA 2X1BA 5MLCV 4YUDA 2MHNA 2DNHA 2DGTA 4QPTA 3MD3A 3MUVP 3IWNC 4Z2XA 2G1DA 2FHOB 2OSQA 2XS7A 1Q7YT 1OWXA 1WEXA 3NS5A 3P3DA 3NS6A 3CCVS 2ZJPQ 5D77A 1M5OC 2AYBA 3DLLQ 1U1NA 1X5TA 2M2BA 2EVZA 2MZJA 2LEAA 3TP2A 4WFBQ 1QVGR 4YOEA 2LXIA 2DNLA 2NLWA 1SJ3P 2K3KA 1VQ5S 3PIOQ 2XSFA 2QEXS 1YJNS 3H2UB 3R1HA 3VAHA 1X4BA 1IQTA 2RT3A 2E5IA 3VAKA 3THTA 1NJIT 5IM0B 1OIAA 3RW7A 1X4DA 5HL7Q 1PO6A 2QFJA 1SJRA 3VAIA 5LJ3Y 1WELA 4WF9Q 2MSSA 2KXHA 2LXUA 3MUMP 1U1KA 1R8PA 4QU6A 2MXYA 1SJQA 2CPYA 3Q2SC 1VQ8S 2DNYA 5EN1A 1PGZA 1K9MT 1S79A 3CCRS 2JX2A 1F9FA 2LMIA 3UD3P 4TU7A 1WEYA 5GAHU 2XS2A 2YTCA 1UP1A 2MSTA 1X4HA 1P1TA 3U1MA 4U67Q 5LXYA 2MZ1A 2ERRA 2MQOA 1JJ4A 2LCWA 2MY8A 1N52B 2OJ3A 5DDOC 3CXCR 3ULHA 3UWTA 3CCJS 2LEBA 2XNRA 3EGNA 5HO4A 2CQ4A 2ADCA 2D9PA 1NU4A 2RRBA 2NZ4A 2RS2A 1YIJS 1N8RT 3SXLA 3HI9A 1FJCA 1DRZA 2J0QD 2CPZA 3TYTA 1L3KA 2KRBA 1OO0B 2DHXA 1OPIA 2MJNA 2EK1A 2KU7A 4F26A 2N3OA 5DM7Q 1JMTA 1U1RA 1WF0A 1FNXH 1W2BR 3RW6A 5LJ5Y 3J7YU 2ZJQQ 3I56S 1VBZA 2KG1A 2DIVA 2J76E 1KD1T 3SDEA 4FXWA 1VQKS 3VAGA 1WWHA 1YJWS 2F3JA 2K8GA 4WIIA 2KHCA 2DH7A 1WG4A 1WEZA 4WCEQ 2BZ2A 2CQBA 2CQGA 1WHYA 3BO2A 4WKRA 1KOOA 2N82B 3MD1A 5D78A 2FY1A 2OIHA 4QQBA 2MQLA 2CPHA 1X4AA 2PE8A 2KT5A 5DETA 4WFAQ 3CMAS 1RKJA 4PRFA 3UD4P 1WHVA 2M70A 1R8HA 3CCES 2A3JA 3CUNA 2XS5A 1FHTA 4ZKAA 2AYEA 3EX7B 5IFMA 4LIRA 3JB9k 1M90T 3BO3A 1G2EA 2L08A 4ERDA 1VQPS 2HZCA 2CPEA 3MOJB 1ZH5A 2M9KA 4RU2A 2MKHA 1SXLA 3J7ZT 2MMYA 4F02A 2M4MA 1VQNS 2GO9A 4FXVA 3CC4S 1YTYA 4C4WA 5DDQC 4IOAQ 1X4GA 2FPHX 5LSOA 3LPYA 2M88A 1M5PC 2LECA 4C7QA 2CPIA 2G0CA 1HL6A 2M8HA 4QU7A 2DH9A 2DNPA 2VOPA 2DITA 2LA6A 2RUGA 2L41A 1VQLS 5GVQA 2CQIA 3HHNB 3CPWR 3P5TL 1AUDA 3SDEB 3V4MA 4CQ1A 2BOPA 3CULA 3P49B 1FO1A 1UAWA 3G71S 2DGWA 2E44A 3CCSS 2DHGA 2KG0A 2D9OA 3CMES 2DGXA 5ITHA 2M52A 2KM8C 2KVIA 3NNCA 1NO8A 1WG5A 2CQ1A 5GAEU
chains in the Genus database with same CATH superfamily
2PIIA 3M1VB 1GK8A 2HAFA 2WVDA 3AODA 2BBEA 1NKEA 3MTJA 3KLFB 1CJUA 2ZFHA 3N5BA 1FXDA 2G2ZA 4UZCA 2DNMA 2FJAB 3PHTA 3KUHA 4CH0S 2WAQD 3ISZA 2Z2LA 3BN7A 4TY8B 2QLXA 5ETSA 3MURP 2ZH1A 3T5KA 1U1LA 2I2YA 1TAUA 4MIBA 4BWMA 3AD7C 3MEKA 5KG5A 3MM8B 2DGSA 4FNIA 5GMDA 3LH2S 2CJQA 2YKAA 4NASA 2X1FA 3TX0A 3W63A 2QLWA 3U7JA 2KHDA 2FVPA 4OHWA 2OLWA 4R25A 3SFUA 2AMCB 3G6YA 4HHHA 2YBVA 2DHSA 1DBDA 3GP9A 1CJUB 3MEGA 4A8KA 4W90B 1KS2A 2GAHC 3DRPA 2ZZNA 3LF0A 4J37A 3VR1A 1WTBA 1T0TV 3CCQS 5I3UB 2R7SA 3TVYA 2HFVA 2J0XA 2J7KA 1MMDA 5T7LA 5D6GA 3R7NB 3LAKA 2I6WA 5BYRA 2MYFA 1RISA 2O67A 3M8RA 2ZEJA 1VMBA 5ETTA 4OJ3A 1Z1ZA 2FVRA 3AD8C 4YS2A 3PZPA 4Q2MA 1U26A 1Z2LA 1WF2A 2V68A 3BN4A 1EQ0A 4RLEA 1RJJA 2GIQA 4Y00A 1K1QA 3MEGB 2ZM6F 3DRPB 3OLBA 1IR0A 3BF4A 4CIOA 2PEHA 1U1MA 4OZ1A 3DGPA 3HDSA 2WB4A 4DSLA 4C8ZA 4K7QA 4XTTA 2VPZB 1EETA 2B7CB 5T7LB 2Z58B 2KRRA 1U6BA 4PG7A 2OSRA 3GJTB 4DQQA 4G1IA 1U2CA 1M5VC 5B0GA 3QO9A 1UFKA 4MK7A 1ZZFA 4WJBA 4ZJQA 4IFYA 3HF5A 2JHEA 1XNQF 1U1QA 1W26A 1RBLA 2DNRA 1RT3A 2FLOA 3G8TA 1N6QA 2RE1A 1XNRJ 2VDIA 4ZN1A 4JUZA 5CCMA 3DGPB 1Q86T 3OFEA 4QWDA 2V6AA 2OPRA 2VPXB 4X62F 1HQ2A 2ZKUA 1Y4ZB 1E6YB 4HTJA 2DEJA 2QSFA 4UW2A 3QO9B 4K5SA 2EW9A 3EPIA 1R0AB 3PKMA 2ASDA 4KGXB 2PO4A 4B08A 2IA0A 3KMSA 1RT3B 1DQ9A 5C25B 2VU5A 5K20B 1S48A 2RDIA 2V8VA 2OPRB 2NXJA 1VLYA 4JV5J 5F9NA 2LMIA 2GHWA 1NJXA 4WU2A 2GCFA 1RZMA 4ILLA 2JEJA 3C6UA 1DRZA 4UUXA 3EDQB 3PRBA 3OD2A 4LF7F 4Z7YA 2XWYA 4BDPA 4KHPF 2XMJA 1NPKA 1EQMA 2R2TA 2F4VF 4WKRA 2F4FA 2EC0A 1NUEA 2P6TA 1MROA 1IR2A 1WHVA 1JB0C 4NZ7A 2Y8YA 2FVCA 4ZOSA 2ZH4A 4TY9A 4PPDA 1YTYA 3MPYA 2NPIA 1HNWJ 2GAGC 2JH3A 3K7RA 3QT8A 2M3DA 4JB8B 2B5JA 1S4EA 1FO1A 1UAWA 1O8BA 5C24A 4CM0A 1UEVA 2FIUA 4ZVSB 2HBZB 1VRTA 2B4OA 5EHHA 3NNCA 1MROB 3M8QB 2PEBA 2V0NA 1NHUA 5B7WA 2XMWA 1SH2A 5KFBA 1SH0A 3AQOA 2F9DA 3JYTA 2NUHA 4K4XA 3A4TA 5RUBA 1Y5LB 1FWKA 3QPIA 1SBRA 3EM1A 3H90A 1PILA 3RAQA 3DOKA 1S0NA 2HPUA 1BUXA 3NGDA 2J6TA 3OTEA 2PD1A 2VODA 3Q2TC 1H0HB 4LRBA 4I7FA 5KT7A 3R9LA 3BPDA 1KVJA 1HNZF 4UY8T 1NJYA 4RR5A 1UEUA 2VG7B 4I67A 3AA9A 4ZDNA 4L74A 2FLNA 4ED0A 4Q0BB 4RBVA 2HSEB 3MXHP 4B3MF 5D0RA 1HR0F 3HMJG 1HIYA 2YQ0A 4JOUA 1U09A 4L73A 3VF0B 3K57A 2R8KA 1XMOJ 5C7PA 5B0FA 1H3DA 1K0VA 3DOKB 1KSPA 5I3QA 1O0PA 2GIRA 3PXGa 1CULA 3RZAA 5GMKa 3D0GE 3NKYA 3BSOA 1L3TA 4I7FB 3DLKA 2I0XA 2VDHA 4EUVA 1MSWD 3D0IE 1V3ZA 3QWPA 1IM6A 1A9NB 3M2VA 4KT0C 4CH1A 1FX2A 5IWAF 2LA4A 3O1LA 2A18A 2UVRA 5A6PA 3HSJA 2O66A 2D3ZA 3ENVA 2ZH3A 4ZCKA 3UD5A 5BR8J 2WOMA 3GCWP 2DRBA 2WVCA 2RIJA 1KQKA 3R2CJ 1VC5A 3HX9A 4JI8F 4ZIWA 1CULB 1D9AA 4RUBA 2CNNB 1TV6B 2KFYA 1NDKA 1GXLA 1IKVB 2YQ3A 4ENOA 3DLKB 3ZZTA 3A3PB 4LSZB 3J80Y 2AJ1A 4FS1A 4NX9A 1U8WA 2HKEA 3DLHA 2VQEF 3VALA 1SJ4P 2CUYA 3M2VB 1TKDA 1HWUA 1CPZA 2C3YA 3NMRA 1EB0A 3CJ0A 4UQGA 4J9SA 2WOMB 1NPRA 2VFRA 3BYRA 3RGIA 1QSLA 4DG1B 1KRPA 1NDLA 2BKNA 1RHMB 1DY3A 3I6PA 1ELOA 4YUDA 3IWNC 3DI6B 4Z2XA 3EVOA 1HI1A 1Q7YT 2BABA 2BEFA 5D77A 2WSCC 1YSJA 1BQMA 2ZNYA 4DPWA 2LXIA 4URQU 2E5LJ 3KK1A 2YNHA 3RTVA 1EARA 1YJNS 2DYAA 2XQCA 1VISA 4ECTA 1S1VB 4O3OA 1T8EA 2VBYA 2FY8A 4KTQA 1U47A 3D5MA 3D66A 3M05A 1K9MT 2A0FB 3SV4A 1H74A 4LVOP 3NCPA 4DR5F 1P1TA 2HBYB 3TWZA 3MM9A 2ADCA 2D9PA 3BV8A 5HAOA 1FJCA 5EGYA 5IZHA 1R0BG 5GADI 3KK1B 3KLGA 4UOGA 2YNHB 4HH0A 4KAIA 3TZZA 3I96A 2VKZG 1W2BR 2Y0SD 3DRXA 2VBXA 2AEMA 3SDEA 1D0EA 1TU0B 4GKKJ 4HEA9 4HR2A 2K8GA 3TQ1A 4A47A 2F8HA 1B7YB 4OZ2A 2CZVC 1KBRA 4JI7F 2NREA 1SC6A 4P52A 2F65A 2XULA 3H4BA 4OI2A 5ETKA 2QLBB 4CLSA 3C8YA 1JJCB 3TRGA 3PO5A 4C4WA 3KLGB 4IOAQ 3IAS9 2HRUA 1FF2A 4FF4A 1PYTA 3PACA 2RUGA 4DR7J 3ITHB 7FDRA 2IM3A 4JI0J 3G2XA 3SDEB 2X3DA 1RXOB 3CCSS 4HKQA 2KG0A 1WACA 2KVIA 4EO6A 2HMIB 3I5CA 3D4JA 3GQCA 1DTTA 4LF4J 1XN9A 3G6VA 3JSRA 4DR1F 4DCPB 3FEXB 2HHVA 2GA7A 4LF6J 4YEAA 4FPRA 2QL5B 4ITSA 1R31A 3NMAA 3OPKA 2C2KB 2N3LA 1FD8A 3NP5A 3L9ZA 2HVZA 3OXLA 4E2FB 4K4TA 3ILLA 1U4BA 4I2QB 1NJWA 4LFBF 2HHWA 3M32A 4OYAA 4X64J 3KYLA 1ZM2A 1NB7A 3SBMA 4W92B 2MGZA 2H5IB 1WUUA 3BEGB 1F2HA 5DJBA 3GG0A 3ZXWA 5CH7B 1DTTB 2DHAA 3UDLA 2E1MC 2FZKB 3FRYA 3X3UA 5F3ZA 4ES1A 4DX5A 3LWLA 4V19X 3OW2R 2I38A 3I55S 2BRKA 4NA3A 3PX4A 5C2GA 2J9DA 2X1AA 4CH7A 1VIXA 4ID8A 1XWLA 5HMWA 2MQQA 3UQSA 1PCAA 4UTGA 5E5NA 2B51A 2APOA 2MGZB 5J1NA 1H38A 1ACMB 1OYDA 3BBFA 4NWBA 2ASLA 4AE5A 4MT1A 2XMVA 1HQUA 1X4FA 1HWIA 2FGCA 3I4PA 5HQLA 1HARA 3J80U 3KNAA 3GE9A 1Q7LB 4XDDA 4JI3J 2XNQA 1AROP 4X4OA 2IVYA 4F4YA 2OMOA 2HQGA 4QYZK 4J91A 1S10A 2LU2A 3HZEA 2B9EA 2MZTA 3NOCA 2JLFA 1MN7A 2OD4A 5KFXA 9ATCB 2AJ0A 2FHJA 1XMQF 3FKBA 5F0WA 1HQUB 1JKHA 4R5PA 3LAMA 2W9CA 2MJUA 5KOWA 1U1PA 4DN9A 3TO8A 1UA0A 3K5PA 2H9ZA 4NRUA 1SV5A 1JLFA 2Z2ZA 1I6JA 2MKKA 2R7TA 3AQPA 3BR9A 3NXZA 1XIQA 2GC8A 4MIWA 3EVMA 1TAQA 4X66J 2FHOB 2OFHX 2XS7A 4O3PA 2KVQE 2H54B 4FVCA 2UVUA 3TZXA 1ZA2B 2MZJA 4CYUB 4OYOA 3RR8A 5HBMA 1N5SA 4ECYA 1XTZA 2IRUA 3J81j 4DL2A 4R5PB 1NMEB 2ZUAA 1NJIT 4O44A 2W9CB 3QATA 3HHLC 3KDNA 2O01C 2POKA 5HL7Q 4YP3A 3DLEA 4MTPA 2DT9A 2MSSA 2KXHA 4OZJA 4QU6A 2CPYA 1JLFB 3DU6A 2XMUA 4NXNF 1S9GB 1XR7A 3C2PA 4QW9A 2CAJA 2FDNA 3VTIA 4G3IA 3MWBA 2ASJA 2CQ4A 6AT1B 4FF3A 1RACB 2D1CA 3GIJA 5K8PA 1YIJS 3HI9A 1AZSB 2GX8A 5HBMB 4IOBA 3LTOA 3H40A 1FKPB 4M5JA 3J7YU 1N5VA 1TL3B 1Q5VA 1CJTA 1RBOB 5L9XA 2EBGA 2MDAA 1WEZA 2R7QA 3CJ2A 3DLEB 1KOOA 1RQ0A 2W7PA 3OFHA 2KT3A 2MQLA 2OHDA 4RW9A 1LXNA 2KT5A 5DETA 1RT2A 4ECRA 1KN6A 1WC5A 2DXDA 4O23A 4WK1A 3OFGA 3NGRA 4JV2A 4M5IA 4L3KA 3T41A 4Q43A 4RU2A 3R5DA 4UY85 2GO9A 5KT5A 1RHJB 2FQQB 5LSOA 2VHGA 2M88A 3DN9A 1MG7A 2OPPA 4ICLA 2VOPA 2NZCA 3AT1B 4YQWA 2L41A 1CJTB 3UN2A 1RWKB 4CQ1A 2AJ2A 4DF4A 2Y3YA 3W5ZA 3W65A 3V2UC 2G9OA 4F4AA 3HJFA 4QIFA 4P2XA 3D7SB 3HJVA 4RW9B 5D0GA 2OI2A 3RG6A 4YB1P 1UVJA 4P6QA 1RAHB 3RU0A 3Q8VA 4IO9Q 3K89A 1FA0A 2HK2A 2UXDJ 2RU3A 4DJBA 3CWJA 1LOUA 2ALYB 2Z0GA 3QSIA 4C3MA 2HYIB 2MTLA 5HN0A 2L9NA 3JQJA 4RBTA 1S12A 2R42A 3MM5A 2ALZA 1UPMB 4B17A 3M9MB 3L7PA 2HNDA 1T05A 1TK8A 3ZNJ1 3TAPA 4USMA 3HVTB 2V2ZA 1RTHA 3IRWP 3NBPA 2E7XA 2RSQA 5CABA 3H2VE 2CQDA 4OFZA 4N47A 4I2PA 4P7VA 3GFHA 4H54A 3VCDA 3GSDA 2J9DE 4B9MA 4USTA 4DR2F 1YX2A 3MM5B 3R7SB 4DV0J 1VR6A 5ETPA 1IBMF 4DZ6A 3HHDA 2HNDB 2OD6A 1GX6A 5LMNF 2HVIA 1T05B 2CJXB 3DOLA 4O3RA 1URNA 5D0HA 3PTWA 4ZPVR 4CRJA 3NBPB 4DV4F 3FMBA 2WCXA 2R7OA 5HJYA 2J5AA 4DSKA 3T1HJ 4B3TJ 2XZDB 2R7VA 2NUUG 3U1NA 4M5LA 1ZAWA 4OZ5A 3FQKA 4DV7F 3DM2B 4DV2F 1RAJA 1QVFR 2W4CA 3CD6S 1ZM3A 4K5RA 2DH8A 3X1LB 1RAGB 4NLXA 2IY5B 5HATA 3MAAB 3D28A 3D9BA 2YQ1A 3ICLA 4Q8FA 4EYHB 4QIEA 3OQ2A 4HYKA 2RRAA 4RUAA 2FTRA 2BYCA 2XY7A 1WF1A 2F9JA 2MZRA 4YR3A 1EZZB 3GV7B 2G13A 4J9QA 4RL1A 2JVOA 2BR0A 4PXBA 3WIUA 2CQPA 4RW7A 4G1QB 4L3NA 4YDDB 4KRWA 5F8IA 4M1KA 2G1DA 4ELUA 1IM4A 5HP1B 2XO7A 3T5HA 1XBWA 3W61A 3TQEA 2V9WA 3DLLQ 2CADA 1UPPA 2DNLA 4BLGA 3ONQA 1VQ5S 3HVAA 3PIOQ 1JLCA 1FE0A 3PYFA 1UMJA 1Q8BA 3VV2B 2QEXS 4CO2A 4K2JA 2OPQA 3M8SA 3E2EA 2BA9A 2ZZTA 1FRHA 3OL9A 4HL9A 3KXDA 3V5RA 1T9XA 4ZP6A 4RW7B 2BOAA 3UD3P 4TVAB 3D6FB 4WE1A 4I6WA 4CLPA 2QLFB 4ZPTR 2C2EA 3AOBA 2EFVA 4O0NA 4ECQA 2RS2A 2FJWA 3G8QA 2BDPA 2DHXA 1T9VA 1A0OB 4W4MA 4TXSA 4Z37A 3DHWC 1OYEA 2W9BB 4OLOA 1VLOA 2OPQB 1C0TA 4L72B 4IQMA 3ENAA 1F0XA 2D7SA 5D78A 4MAKA 4QW8A 3CDWA 3CDUA 2ZH2A 4JYAJ 3MEDA 1FJGJ 1XERA 4AFFA 2NXUA 4MMOA 4YN3B 4LIRA 2WVBA 3TX8A 1VK8A 1T9TA 1UVKA 2CPEA 4USHA 4QR2A 3HHLB 4XK8C 1DLOA 2DVIA 5F0UA 4C0BA 3V6HA 1EIYB 3UN3A 2DH9A 2DNPA 3FEZA 1N56A 4WXWA 1FCAA 1RAAB 3QZ8A 4K4VA 5KFWA 5E3QA 2HVHA 3MEDB 3LP2A 4YHHF 5GAEU 3RBDA 1HWKA 3G6ES 2DNGA 2VPYB 3OHAA 3FFIA 3CIMA 4XIUA 4AXJA 4JI4J 2LQ5A 4ZVEA 4KY3A 4LR7A 3JTPA 4U7CA 3K59A 3PM9A 2HHQA 3O3LA 4MYTA 3IN5A 5E33A 1RAOA 4OIXA 2DR6A 2CQHA 1U0HA 3RBXA 1YJ7A 4ECUA 3I9ZA 4FBTA 2IJRA 4NLWA 4NYPA 3NEKA 3MMBB 1F60B 1CG2A 1VQOS 3GV8B 3B78A 3EXYA 3ILJA 3DCAA 4M8LA 5A76A 3H7HB 3HO1A 1SPBP 2MQMA 3AH6A 3FFIB 3BKUA 4OV6A 4WBFA 3T6BA 4CZCA 3PV8A 3PNIA 5HVGA 4M5KA 2ZH6A 4V19J 3D0HE 2Y8WA 5D15A 5KG3A 4J9KA 3BQ1A 2XCPA 1IWAA 2BRLA 3NOGA 3KHRA 3UPFA 1H2TZ 1IJEB 1LKZA 3F44A 2BX6A 4A48A 1S57A 4GO5X 3UCZP 2AEFA 5B0CA 5C5JA 1I94J 3SCIE 3NGSA 1H73A 2C2OB 2DNOA 1L3VA 2C3OA 4A8SA 4ZCLA 4FXDA 1F5CA 3QZ7A 1I3OB 2E7WA 3M8YA 1PJ5A 2MPUA 1SIZA 3NWRA 1VQ7S 1S6OA 2JNJA 2OTJS 5H9FJ 4IRDA 4C8OA 1IKXA 2E1CA 3E3XA 2UXBF 4LBPA 2K7KA 3KLEB 1R43A 4RNMA 2ACMA 1NPPA 1FNMA 1YRUA 5F9LA 1RYSA 1KHWA 4P9SA 2A10A 3ENQA 4N76A 1LW2B 4I69A 1JNRB 3I82A 5A0YA 4X4UA 4BS2A 3FCHA 1KQSR 4NZ6A 1RK8A 2GZOA 5KFPA 1VHFA 2BUNA 1IKXB 2VQFJ 3R97A 4LRAA 1PYSB 4ZJOA 4UUWA 1NSQA 2MHNA 2CJBA 3TVKA 1QJHA 1A6LA 3NS5A 3P3DA 4BC7A 1M5OC 3W9HA 3L7UA 2EEYA 2PN6A 4RZRA 2ZVSA 5A0YB 1YLXA 3CMQA 3NCQA 4L6V3 3B54A 3UW1A 1OIAA 5H9FK 3K2YA 5AXKA 5EWGA 3ILOA 2ACYA 1TR0A 4HLBA 4DV6F 2RKIA 4FYDA 1WELA 2CDRB 4XDCA 1R8PA 4YY3J 4B9NA 1SJQA 2DD8S 3IAM9 1Q79A 4X4VA 3V6DA 5KFZA 2FJEB 4K4ZA 1NSKL 3LGNA 5D0EA 1IBCB 1LQ9A 4QR0A 3EGNA 2FJVA 1LWEA 3HFKA 3BGFA 4DUZF 1WC0A 4IG0A 4DQSA 1ZPVA 1FDDA 1V5VA 1JLEA 1JMTA 1U1RA 2AJFE 2PMZD 4ZVPB 4NA2A 3RW6A 2Q43A 1NK8A 2DEIA 2RU9A 1KD1T 4Y6IA 3KHLA 1D09B 2V50A 4H4MA 2RKIB 4DV3F 5AE3A 4CO5A 3T19A 5HJXA 8ATCB 4U9RA 4CDIA 2M70A 3JSBA 3NGUA 3M6XA 1RTDB 4WIQA 4BHQA 2AYEA 3OJUA 2ZM6J 4ZN3A 1LWEB 2M9KA 4AYBD 4IQXA 3SSRA 4IG0B 5DDQC 4DBQA 1RP5A 4C7QA 2FHJD 3HHNB 3C3LA 4NCBA 3CULA 5L46A 3P49B 3NAHA 2D9OA 1Q16B 4C9DA 1TKTA 4D3HA 1RHQB 1OY9A 2GJFA 1XNQJ 1DQ8A 4A8XA 2XYGB 2M8DB 5A8KA 3BGRA 1GMWD 4E0DA 4PQAA 2CDQA 4IUFA 3ZNUA 2LKZA 1UVLA 1IN0A 1YK9A 2ROEA 3QT7A 2B6AA 3ZZZA 5T41A 2A6MA 4M94A 2V8DA 2V2KA 3KWMA 4X62J 3KNGA 4QR1A 3MZIA 5F8LA 2B0GA 2DPIA 3CTRA 2YNGB 2ZBCA 3S1TA 3H98A 4PYAA 2H3EB 4DPXA 1UETA 1SKWA 1TKTB 1WSRA 1X0FA 1NHVA 3WC0A 1PC4A 3MGJA 3KJNB 3QJJA 1JJ2R 3OV7A 4ZK7M 3GIKA 4NCGA 2JLEA 3BGRB 1HBMA 4DV1F 2RDJA 4P75A 2V63A 3R2DJ 1FESA 1N5TA 4OX9F 1X4EA 5ETQA 2UUTA 1FRKA 1GNKA 2W8LA 4QPXA 3NAIA 1F3VA 2BM0A 3RAXA 1YI2S 2VONA 3G8SA 2HS3A 3UVJB 2YX7A 1M5KC 3Q8PB 4OI1A 1ZETA 2D69A 2NSCA 4ETZA 1QUPA 2YNIA 3E51A 4DL4A 5DDRC 1HW9A 2CPFA 2I5JA 3GLJA 5DGBA 5IV4A 4LVNP 3KLIA 4LF7J 1RWPB 1Q0NA 2DGVA 1UCNA 4U6PA 2DISA 1TFWA 4BBYA 5M2PA 1U2RA 4NCGB 3MAQA 1HBMB 3FC9A 4KHPJ 3GV5B 2QE5A 2HVDA 2F4VJ 1Q81T 4X4NA 1Y10A 5JVGQ 2KFZA 3PX6A 2HS4A 3DLGA 4KYZA 1S72S 2VG6A 1SIWB 4KH0B 1GQEA 1RWMB 2IIHA 3A8IA 3DRSA 1D1UA 4O4RA 2YNIB 5DZ6A 2OELA 4P72A 2I5JB 5B09A 1F9EB 2WBMA 3KLIB 2AT1B 3J81Y 1HYSA 4A8MP 2HGNA 5CAAA 4EK2A 3DOMA 2BW7A 5C2CA 1TELA 1B0PA 1VI7A 1RGVA 4NXMF 3QJPA 3VGUA 3T1HF 5K9FA 1RKIA 3DLGB 4D3GA 1Q4RA 2HW3A 1JJHA 2VG6B 2ZBPA 2EXUA 4QWCA 1KHVA 3C16A 2X1GA 1FKOB 2DGTA 2J6UA 3MUVP 4PXEA 1N5YA 3DRSB 5L1IA 1PBAA 4U7UD 1HW8A 3N6MA 4X4RA 1QVGR 5JMNA 1HYSB 5G4DA 3FZ2A 1ICEB 2EKNA 3TZWA 2KFNA 1ZTTA 2PMWA 1P9QC 3DOMB 1X4BA 5GMEA 1IQTA 1E6VA 1R7IA 2RD5C 3VAKA 4F4ZA 3QT5A 3EUNA 2OEJA 5DG8A 3JSYA 1HNZJ 3KK3A 1FVQA 1FFWB 4IG3A 3C16B 2BJ9A 2XCAA 1IBKF 2HHTA 1AW0A 1R8BA 4B3MJ 2NS1B 2HHSA 2PI4A 1N5YB 5DDOC 3CXCR 2ZVIA 2Y1LB 3MM7A 1HBOA 4IH5A 4ED8A 2GNKA 2YPYA 1WF0A 1IUJA 2OPSA 3BGUA 1UA1A 1TZ0A 2W2MP 1E6VB 3AXMA 2KG1A 2AQ4A 1FWLA 1VQKS 4OI3A 2F3JA 4ZP9A 5DO2A 1WG4A 2DRAA 2H4YB 4FKXA 3KK3B 2YXLA 4DFKA 3UDVA 4F8RA 1AB8A 3MEEA 4N56A 4PRFA 1RTIA 3PYEA 3UD4P 5J1PA 5IWAJ 1W25A 2LDYA 2ZKTA 3BO3A 5KFLA 3MCSA 4QIVA 1XR6A 1GTHA 4QYRA 3HP6A 5LMUF 4JP8A 3MM7B 2W2QP 1PC5A 3TW0A 1HBOB 2FPHX 3SEOA 2VFSA 4JI8J 4DEZA 4DR3F 2HAIA 4OJ1A 2QIFA 1FRJA 1Y9OA 1G3OA 2RUSA 3PHEA 1SC1B 4DI6A 5F8NA 4MKYA 2VQEJ 3MEEB 1CC7A 2ILYA 2LQJA 1RTIB 5CZXA 1WTFA 2QFIA 2E5GA 3I5BA 1LWXA 4JI2F 5CD4A 2YWHA 5B0AA 3D2WA 2ZH8A 3CJ8A 1MW7A 2DGQA 5F8GA 4OHZA 5C42A 7AT1B 1LNQA 1PBUA 3QMQA 2BXJA 1WC6A 1KP6A 4G1PA 2VA3A 1VJQA 1CSJA 3MM6B 5I42A 3CGIA 2HFSA 4BWJA 2CFXA 1BQNA 2FB0A 3IBFB 3HSZA 3TJAA 1IR1A 4WFXA 3OBIA 2Z2MA 3MOZA 2EFQA 2RHQB 5ETLA 5GAGU 3C19A 3P96A 3M9OB 1N33F 2Y1JA 4GMKA 1ZZNA 5E0OA 1N34F 1RA6A 1JLQA 3Q8QB 3D6HB 3BKTA 2H4WB 2FC9A 1HNVA 2J7UA 5I42B 4AUKA 2L9WA 3GJQB 2PFFB 2GMHA 4JBCA 2LVWA 5IS2A 2A2CA 2IJNA 5BJRA 2C2NA 2DGUA 1BQNB 3NNAA 3S7RA 1EKRA 1GFWB 2VC1A 3TEGA 1S9EA 3CCMS 4DSJA 3Q8SB 2VOOA 3PEJA 2WVFA 2DR7A 2XY6A 1FXLA 3DGVA 3J81U 3M8ZA 2Q6BA 2YKMA 2C3UA 4JI7J 2H5EA 4LREA 2UUWA 3QLHA 1UW4A 1WD6A 2GGPA 1S4FA 1JLQB 4C8MA 2IM1A 1HNVB 4CI0B 2HZAA 1RAIB 3NS7B 3SQOP 4J90A 3MMAA 4RU9A 4OYBA 4RWXA 1HA1A 1H98A 1YITS 4KJIA 1U7LA 3B8HA 4CLUA 4K50A 2CIMA 3S8SA 2RDDA 3QQCD 2VKRA 1W2IA 2F5GA 4P10A 3GZ7A 4NLTA 1HPZA 2E5JA 4WWSA 1HNIA 2NXNA 3QLHB 1SC3B 2GGPB 2SXLA 2ZWPA 3QRQA 1Q5YA 4ZLNA 4DR1J 4QPTA 1NCLA 1C1BA 4MKAA 3KFWX 3NS6A 4B9VA 4NLPA 3MMAB 4B3RF 2LEAA 2UZAA 3CCTA 2R2UA 4LFBJ 3ET6B 1NHKL 3QIPA 1AUSL 5AT1B 2RT3A 1OY6A 4LFAF 3PR4A 1FX4A 4DU7A 3MPUB 2ATCB 3TZYA 3VHQA 4PG6A 3ZTPA 3KKFA 1K47A 3OTBA 5HMYA 3TAMB 3EGVA 3JQMA 4DQIA 4NPOA 3DRRA 5CYQB 3FCWA 2PFDA 2AX1A 1X4HA 3U1MA 2GQQA 1N52B 1GXTA 2W01A 5JUMA 2ZE2A 3ULHA 3CCJS 1HNXF 4EI2A 2V67A 2W7OA 3FK4A 4LF9F 4ZVUB 3UNYA 5E3CA 3QIPB 4HHUA 3K5MA 1TQLA 5I3PA 1G6BA 1VBZA 4KGMA 1VRQC 1JX4A 2AJQA 2NPFA 1RDRA 1YJWS 1TK5A 1VIOA 4NOHA 3OTOF 3OXFA 2V8GA 2ZD1A 2N82B 4KFBA 4RW6A 2FLPA 3OLAA 4YY3F 1FK9A 3L95X 5KFOA 4Y2CA 4KHRA 4WK3A 4OMFG 5IQ6A 3DRRB 2P5VA 4RW4A 2XTJP 4DS5A 4J9UE 3JB9k 2ZE2B 4TYAA 3CDAA 4V1Ak 1N32F 1G7CB 4LRDA 2GVZA 2Z4PA 3GIMA 4O3QA 2P8IA 5CQGA 2XMKA 1SUQA 4O4GA 3B82A 2DHGA 5L8RC 4GKJF 2DGXA 2HFZA 4KFBB 4RW6B 3TUPA 1XMQJ 4AT1B 1C4CA 5IT0A 2KDOA 3UR3C 3ISND 1PJ7A 2AGPA 3L4BC 1TVRA 1FDAA 4DL0C 2KI2A 2M7SA 4O3SA 2RVJA 2U2FA 4P2FA 4HI2A 4GVBA 1D3WA 1GX5A 5KT3A 2GVZB 4H4KC 1KWMA 2DIUA 3TUJC 3OTDA 1SUQB 3BREA 2UV8A 3TJ9A 6FD1A 4CLWA 5KG7A 2IAJA 4M5MA 2LYVA 4QIWD 3P4UB 4PWUA 2J7WA 2F7VA 1I1GA 2CNOB 2RF2A 1S1UA 2H51B 1K8AT 4LQ9A 3UCGA 1FTCA 4UQTA 3CB4A 1CBKA 1TVRB 2FZGB 4DV5F 3L7OA 4X4SA 1X31C 2RS8A 3Q8UA 2FD2A 4ED3A 5E7OB 3R8YA 3T6JA 3MPDA 4GVBB 1RLCL 4QZVB 2U1AA 2ZC3A 2G1HA 1RT4A 4ED4A 1EETB 4NXNJ 1Y3JA 2EFOA 4WZQA 1UJ6A 3MR3A 2HHPA 1B70B 4DCOB 2IJFA 1S1WA 1X9MA 1DJ0A 4IFYB 3SCKE 1B4SA 3IG1A 2BJ3A 3AD9C 4C8YA 1OSCA 3IR6B 1NDPA 2IBOA 3T5LA 2CG4A 2QV6A 4TKTA 1N6QB 4RNOA 4FKYA 2KH9A 3FDSA 4ZJLA 4DWIA 1G4CA 1S5ZA 2LFVA 2PA3A 5KFNA 3OVAA 1FTRA 3IA0A 2HBRB 1SL2A 1RT4B 1TUVA 4WU3A 5H1SV 5DG9A 3H59A 3LQVA 1FRMA 4ZIVA 1UJ4A 4MIAA 4CO4A 4L76A 1S1WB 3KK2A 5HI7A 4EYIB 4NEYA 2ZH5A 5KFRA 5KFMA 4KBIA 3BDPA 3IG1B 4LBIA 3CO9A 4LUBA 2DJWA 1WHWA 2DCUB 3DDIA 1T11A 1H2VZ 2D3O1 3W2VA 3Q89A 2AYMA 3CC2S 2N4CA 2L48A 1FEEA 2QMWA 2XC9A 1JNZB 1N54B 3SI8A 2IMOA 5DQIA 1YVFA 1VCTA 5KG2A 5IOLA 3M30A 3BKFA 3C6UB 1NH8A 2WVEA 3N4WA 2ZJPQ 2AYBA 2YNFA 4PWDA 2HEKA 3HCXA 1D8YA 5AJ3F 1YBTA 5SUHA 4ZCIA 1N0UA 4P2MA 2KZZA 3W2VB 4YDXA 1QSYA 3I0SA 2W4DA 1PAUB 4J9PA 2GVDA 5E41A 1NKCA 3RW7A 2B9WA 3EWGA 3HZGA 4J9VA 3VGTA 3K58A 2HQCA 4AL7A 2R8IA 1PGZA 1S79A 3CE8A 2Q6CA 4A8OA 2R7RA 3M30B 2MY8A 4ATNA 2OJ3A 3UWTA 1WNEA 2YNFB 4PWDB 1HHSA 5E3RA 4Q7AA 4U7UK 4Y2KA 2EK1A 5D4NA 5DM7Q 1RHRB 2B5JB 1QDUB 2WZ1A 3CD5A 3LGMA 2VD3A 2V4RA 4DR2J 5C24B 4FYVB 2GVDB 3RBEA 5EWFA 4WIIA 4C8LA 1VRTB 2BZ2A 1IBMJ 2JJ4D 5LMNJ 2VJVA 4KV8A 2XMMA 4B9UA 4OJGA 3OSPA 4PYDA 2FY1A 2CPHA 5DLGA 4J7CA 4L75A 3F0NA 3QGPA 5FLXY 5DZ7A 5DGAA 2KYZA 1U02A 4DV4J 3JYTB 3OFFA 2HZCA 2IVFB 3I5AA 4C48A 5IT4A 4B9TA 3THVA 4DV7J 2JLGA 4DV2J 4QU7A 1WSVA 3M6WA 3P5TL 1AUDA 4UT4A 2WSFC 3PYGA 4B9LA 4QCLA 1KVKA 4KV8B 2H5JB 1NM2A 4DZDA 4AXIA 2BVZA 1HQEA 4NCAA 3TUIC 5KFSA 4GVLA 4DN0A 4EBDA 4S0MA 4DFPA 3VAMA 4RX6A 2QMXA 3G96A 2QO3A 3LW5C 2MQNA 1JXLA 4AQYF 2CPJA 4WFNQ 1T94A 2KYXA 2DTJA 4OZ3A 1QM9A 4DQRA 2C2RA 4PUOA 2DKOB 2BJ7A 2HHHF 1YJRA 3J7AN 1HQEB 1RAFB 1J5OA 4RPFA 1CVJA 2KTQA 3BSCA 4OYPA 2KT2A 4H4KA 4KGZB 2ABYA 2W1BA 3W64A 5KFJA 2J9EA 2OGUA 4GO7X 4NLVA 3B4MA 2E5HA 3QJLA 1X4CA 4DSFA 4RKUC 5KG6A 4P74A 1KVIA 5KOXA 1N88A 1H72C 2W2PP 2DNQA 3GU0A 5IC4B 1FJ7A 4C97A 4ZITA 4RWWA 3LPEA 4ZPBA 1VBKA 4F4XA 3PJXA 3MPWA 2J8AA 1QAXA 3CCWA 4PUOB 3Q23A 2F8MA 3PW5A 1ZOTA 4J9NA 1UWAA 3JSMA 5KFYA 3PW2A 1AT1B 1J5OB 4KO0A 2R8HA 3N79A 3TA1A 1CJVA 5L38A 1U6FA 2RQKA 3A1YG 2FVSA 1L3UA 2DB1A 1TUWA 1HKAA 1YJTA 1Y5NB 3Q86A 1YG0A 3NG8A 2G2OA 4ZVGA 4F2RA 1A7GE 3G82A 2CQ2A 1OS5A 1HHQA 1B3TA 3U27A 2LXFA 4Y2IA 3KLHA 1D9FA 1I51B 5JXSA 2A1BA 1BWEA 3TUZC 4YB7A 2AWZA 2KJWA 2J9CA 1BQMB 1HBNA 4DL3A 4NI2A 4NE9C 2PA8D 3JSMB 4RBUA 3W9JA 2ZBRA 2V69A 1WKKA 1HBUA 1CJVB 3T1YF 1LK5A 2MZQA 1IJFB 5F8HA 2I8EA 1RYRA 4KPCA 4ED5A 2C3MA 1QD1A 5ADZA 2MKSA 3VQTA 3RBZA 1SC4B 3MCNA 3ELHA 3LWMA 1K44A 1X9WA 4YHHJ 2AHOB 2J8SA 3DLBA 2LQBA 2XI2A 5KT4A 1N0VC 1JLGA 2DXEA 4KIAA 3MM9B 1UVNA 3C6TA 1UVIA 5KT6A 3UR0A 3QBCA 3ZO7A 3KG4A 4NMLA 3CJSA 1N36F 4NI2B 2VIHA 1LXJA 3KTQA 3F56A 4HVZA 3PJ9A 3MR2A 1FE4A 1CJKA 1HBUB 2BKOA 3GONA 4U96A 5KG0A 4F3MA 3QGIA 3I0RA 3ADAC 2YVSA 4ANDA 2B4UA 1RTJA 1FD2A 4OYIA 1RSCA 2QFJA 2X3GA 3BQ2A 1NNDA 1ZAXA 2W8KA 2QN6B 4X65F 3HHEA 1JLGB 4TU7A 1SL0A 1YKWA 3C6TB 2QG9B 4TQRA 3D6TB 1O51A 3V81A 3KJFB 1NU4A 1VHIA 1N8RT 3R3TA 4LQ3A 4Y34A 4NMXA 3IP0A 4WXOA 2NCKL 4X4QA 1OPIA 2Z8QA 7FD1A 2CZ4A 2N3OA 5FLXU 4NLYA 1CJKB 5U47A 1PYOB 5LJ5Y 2QA1A 3I0RB 3W66A 2DIVA 5KT2A 2BQ3A 3T5JA 1RTJB 2DH7A 4K2XA 4XPCA 3KJVA 3WC2A 4ZP7A 3QAEA 2B56A 2J6SA 4EWTA 2BKPA 5CYMA 4KR0B 1S59A 2XS5A 1FHTA 4QWBA 4ZKAA 1GMUA 4YB6A 1QY7A 1FFGB 3V81B 4CO1A 1X7VA 5E2QA 2HFNA 2UXBJ 3CW2C 5AXMA 3GIIA 2CPIA 3M32B 4URGA 4K59A 1WC1A 2AW0A 3CPWR 1KLMA 1J27A 1S99A 4R0JA 1GT8A 3KJVB 3QWUA 1RE1B 4FYYB 4EZ6A 1H7WA 4KGVB 5CYMB 2VICA 3M2RA 1RCOB 3TA0A 4NLSA 4DPTA 4ED1A 2HZVA 4NYZA 3IM8A 3IWXA 4CT8A 3RAMA 2F63A 1NJZA 4LSLA 1S0VA 4FF2A 5DDPC 1R6VA 4NLDA 1S7HA 4RW8A 3I4HX 1RT5A 3GFZA 3LO3A 4NL5A 1C0UA 1KLMB 2DNKA 2GS8A 2BE9B 5DQGA 3ZC4A 4TU8A 4IKAA 1HWJA 3R5BA 4ER8A 1ZYQA 1U24A 1EP4A 4WP8A 3LA0A 2BJDA 3EGWB 2B7BB 4OZ0A 3M2RB 3T3FA 3M1VA 1T03A 4ECXA 3MCOA 1VC0A 2RJZA 4ZMMA 2QA2A 5CZVA 4DV6J 1Y5IB 3RB0A 3VAJA 4LSLB 3M9NB 1GMWA 1PIEA 4RW8B 1YWXA 3EXCX 4B3SF 1RT5B 4FN5A 1C0UB 3DLJA 2JEGA 1WORA 3R5AA 2GIFA 5EWEA 2IM2A 4F2SA 5FJ4A 2ILZA 5KFGA 4DUZJ 2EG2A 1M1KT 3DRYA 2VPWB 4K0KF 1EP4B 2RQCA 1OSDA 1JKHB 3D54A 4HTIA 4EBEA 1T03B 1JXVA 2W2NP 2IDLA 3K0JA 3IXQA 2O1PA 4CO3A 4UOFA 3CO0P 2XM3A 2ZBIA 4PZVA 2WW8A 1IXKA 1S1XA 1VQ4S 2MLYA 3AA8A 3OL6A 3OVBA 2B3TB 1WHXA 4DV3J 1RUSA 1IBLF 1MLAA 3A3NB 1SV5B 4DR4F 1GMVA 3OXGA 5I3UA 4EO8A 4RUHA 2BJ8A 4Q8EA 4LF2A 4USKA 2DNZA 3T9ZA 2CJAA 3GIRA 3EYZA 4ANCA 1R3NA 2HGMA 2V4JA 1AXQA 3IWLA 4URSA 5HROA 2LQ9A 1NZ8A 4ZVOB 1Q82T 1B64A 1LFWA 5EUHA 4F25A 4O44B 1EHWA 1T7PA 1UWBA 2Y0BB 1KTQA 3W8GA 1KFDA 3PR5B 2DO0A 3BGLA 4Y28C 1S1XB 1V5IB 3AB2B 4NEZA 4EEYA 4G6VB 4OX8A 2KB2A 2EC2A 3GFYA 2QL9B 3L3CA 4LRCA 1J5EF 3PY8A 4LBHA 3VAFA 2KM8B 3WIVA 4ZHRA 1KKHA 4YB5A 1Y0HA 4QOTA 5G0RA 4FNHA 2V4JB 4MK9A 2K3IA 2QGFB 3D1HA 3H25A 5THWA 5HROB 2VA2A 1X8DA 5B0EA 1QTNB 3IGNA 3TOQA 3P5BP 3H2UB 5M2UA 1UWBB 4ED2A 1KLNA 3W9IA 1VS3A 1EKSA 4DL6A 5A6WA 2VB6A 2VBWA 3GR1A 2XBPA 1U1KA 3MUMP 1RT2B 5ETNA 3Q2SC 2EWHA 3V4IA 4F7VA 4C0HA 2UVWA 3AJDA 1WOSA 4ZHRB 2HNYA 4DV1J 3CD0A 2HQ3A 2ERRA 1E6YA 5G0RB 2HLTA 4DPYA 2LEBA 1NSAA 4OX9J 2NZ4A 1NXIA 3GYGA 3W62A 4PPZA 4USWA 2OPPB 4ICLB 1R0AA 4LF8F 5K8NA 3PRDA 3DNCA 1NK5A 2C28A 4F0MA 2MKYA 2GO8A 5D4PA 2GQ2A 2CQBA 5C25A 2CQGA 1WHYA 2BACA 1QAJA 4Z7CA 3RB6A 3QFWA 4FYXB 4LT6A 3V4IB 4DUTA 1R8HA 5A2QY 4PWWA 2HNYB 1GXUA 5IFMA 1M90T 3HM9A 2MKHA 5EDWA 4ED6A 2HK3A 1U25A 3MECA 2M4MA 4DPOA 3T1AA 3UDEA 4LF5F 3PJWA 3CSKA 2XMTA 3SFGA 2PT0A 1L5UA 1B0VA 3OSNA 4M63A 4U8VA 2CZ9A 1AFIA 3O5TB 1U1OA 2I9SA 4ECVA 1RTHB 2KJVA 3I31A 1HI8A 2UV8G 3FNNA 4NXMJ 2G2YA 1T9UA 1OMSA 3E8OA 4N77A 3GR0A 1RABB 5BYQA 3FMWA 4I2PB 3MECB 2Q1LA 2V94A 2PDAA 4OI6A 4QBUA 3J7YI 1TKZA 1VQSA 1UZHA 4F67A 3ZZOA 3HK2A 2QLJB 4NA1A 2YPZA 2K7JA 2MKJA 2NXEA 3N6LA 1H2UX 2HHUA 3ISNC 4CT9A 4IH7A 2DR8A 3LP1A 4DUYF 2ZOFA 2HFOA 3DOLB 4NRTA 5DG7A 3NWGA 3RRKA 1YJVA 3M8QA 3Q83A 4LR9A 4FF1A 3JQKA 2LP4A 4R8UA 3MI7X 4LFCF 4CLTA 2EI5A 3CEDA 2OMLA 1TKZB 3MUTP 4KC5A 5CXTA 2WB1D 3WHIA 1NK0A 4NLOA 1O6XA 1IBKJ 4DMZA 5KFQA 2KXNB 3FZBA 2W7AA 4CM2A 4IYQA 3BDEA 4I0WA 3IGVA 1RCXB 3FBBA 3US5A 1BY9A 3QFHA 1YZ6A 3PW0A 1X5PA 3K5OA 3D3CJ 1YJ9S 4EBCA 3LP1B 3QT6A 3NGTA 2RAQA 2ZC4A 1TKXA 5KFAA 3ZTQA 2YWWA 4HDHA 1U6ZA 5LM7E 1WG1A 3M4XA 4DSEA 3Q22A 2VG7A 2RQ4A 1DHMA 4DR6F 4A4JA 4R8UB 4KH1B 4Q0BA 2IVMA 1VBXA 1S77D 1FDBA 4I6AA 3H42A 2JWNA 8AT1B 2UUBF 3RR7A 5EX0A 1VOMA 4OHXA 5L9NA 4WZMA 2UUAF 3P6YC 3QIDA 1UTAA 2YH1A 2CPDA 2JC1A 2VFTA 1Q1KA 5LMUJ 1RU2A 3FGVA 3TAQA 3K8WA 4ES3A 1TKXB 2XLIA 1JLCB 1ZS6A 1KOHA 3SCJE 4C0OC 1VQ6S 4DR3J 5GADU 4LMZA 5J2MA 2WBRA 1Y7PA 2JVRA 4RNHA 2EG1A 2ZDOA 2CJKA 5BXIA 1RHKB 1FT8A 2DY9A 1D9DA 2R9LA 3S01A 5KFCA 5EX3A 2QC3A 2C2DA 2HFUA 3PO4A 2FJBB 4WE1B 4JI2J 2DHHA 1TV6A 1IKVA 4JV1A 5HANA 1OWXA 3BB5A 3KMQA 8RUCA 1X9SA 4KHMA 1WOOA 3EZUA 2EVZA 1F5AA 2K3KA 1C4AA 2XHCA 2VJUA 1KEKA 1HLWA 2Z57B 4RNFA 2R8GA 4MKVA 5J2MB 1FNOA 4OHYA 2WHOA 3THTA 3H5UA 1OPZA 1C0TB 1Q8KA 3N0VA 4X2BA 4KQZA 4F3QA 3C14A 1FRIA 3PKYA 4B9SA 4OYMA 2FJDB 4DG1A 3SV3A 2DNYA 4LR8A 4MKBA 1KONA 1NH7A 2V9KA 3J7A1 3DI6A 2XNRA 4XO0A 1DLOB 2QRRA 4JI5F 1HMVA 1WOPA 2F40A 1N33J 2KU7A 5A2QU 3CJ5A 1FNXH 1TFYA 1N34J 1NK7A 3DXSX 3GJSB 2NYIA 4FXWA 4P2SA 3C14B 2JL9A 2KHCA 4J9MA 1S1VA 3CCZA 3PG9A 3MR5A 3LP2B 4USIA 1UZDA 4ZP8A 4QQBA 3HSGA 1FI4A 4LRFA 2AP6A 3TVZA 3CUNA 2P6SA 4FVMA 3EX7B 3QGHA 5KG1A 2MQ8A 3GTYX 4MFBA 1SXLA 4F02A 3ZFVA 1VJWA 2P9EA 1VQNS 1HMVB 3TEHB 2HWTA 1IWGA 4G65A 2ZHAA 2LECA 2C2ZB 2BJ1A 1XEZA 4J9OA 4CP5A 2D74B 1U0HB 2RH3A 4USUA 1XMBA 1JWWA 2BOPA 4ED7A 3G71S 2DGWA 5KFVA 4OX7A 5ITHA 2XHWA 4DQPA 4PQUA 4OYXA 5KAKA 1WG5A 2IFXA 2CQ3A 4ZPWR 5FIIA 2C1EB 2R7XA 3N01A 3BH7B 2DO4A 4MFBB 2G0IA 4A8FA 1GAOA 2MY7A 3O2IA 4ZLPA 2QA4S 2XGPA 1QAYA 4WKYA 3HT3A 4P7TA 3CCUS 4ILMA 3ITHA 2UU9F 2CJYB 2BW2A 2YX1A 1Z4UA 2V8PA 2MZSA 3A8KA 4OQJA 4PCQA 4B3RJ 1DZ5A 1GH8A 4PQUB 3S6EA 2E29A 2HMIA 4FS2A 2F1FA 1QUVA 4PXCA 3HD2A 2Z56B 2R7WA 4LFAJ 2GHVC 3R5CA 2PGCA 4PG4A 2XY5A 2ZNZA 3M8PA 4Y3CA 2GJ2A 2OAUA 1KC8T 1F2GA 3LUYA 3G4SS 4I2QA 2UUCF 3G87A 3IS9A 3WQPA 4HH1A 5IXUA 1HNXJ 5F8JA 5GAEI 4AL5A 3KLVA 1LWCA 3D3BJ 3OR1A 3ETMA 1ZTWA 2M0GB 4LF9J 3D67A 1U2FA 5IC6B 2H65B 1TL1A 3CDEA 3N6NA 3VGVA 1RAEB 4AD6A 3A3OB 3LALA 3OTOJ 2FHMA 4I56A 3M8PB 3TR5A 2HURA 2MKCA 1RA7A 4JI1F 2Q79A 4ID5A 3PVXA 2O5DA 2A2DA 4F04B 3C46A 3IRXA 1Y11A 2IYIA 3PFOA 2GJIA 3IS9B 2OTLS 3Q8YA 4CLKA 4QYZJ 1T95A 4EZ9A 1LWCB 3OR1B 1FXRA 4DX7A 1N32J 1BHNA 3RUBL 1TL1B 1QAIA 3MTKA 1IKWA 2OKQA 4IRKA 4DCJB 4DHVA 2H1YA 4GKJJ 3W7BA 5ETMA 1TUGB 3N9UC 1SL1A 4DXLA 4ID5B 3V6DB 1WC4A 3BPSP 1SQGA 2BJEA 2RB7A 4KSEB 3JAMY 3IRXB 2EKYA 9RUBA 1VRUA 4A8QA 4TLRA 3GMGA 4ELTA 3R7BB 5F41A 4ZPDA 3KHGA 2Y9HA 3PDNA 4F4KA 1REGX 1JLEB 2CXEA 3GFXA 3BYPA 2HQFA 2XYHB 3SSSA 4Y65A 1KTVA 2XSFA 3HVRA 3R1HA 3VAHA 1IKWB 3B6BA 3PW4A 1QTMA 4NLGA 4NLRA 2UXCJ 3MHYA 4H4MB 2QT7A 3MR7A 2BQRA 1RADB 3HULA 4I6YA 2E7VA 2MXYA 1S76D 4HACA 2ZOMA 1VRUB 3TI0A 4U67Q 3IM9A 4DV5J 4ZVTB 2MEWA 1JK9B 3VZIA 2BV3A 1TL7A 2XSJA 5SZTA 3O8WA 3I87A 2CPZA 1OO0B 4DPUA 4CYUA 3KG0A 3G6XA 1FFSB 2MJNA 3KG1A 3PX0A 3OVSA 2ZJQQ 1L3SA 3WBZA 2R8JA 1HI0P 3EJMA 2GQCA 2AGQA 2K06A 4I1TA 4HI1A 1BE4A 1SH3A 2HQDA 3E01A 1T9WA 3AY0A 4HACB 4IR9A 1RWVB 3CCES 2A3JA 2JC0A 1WDTA 5A8KB 4DX8H 3LGHA 3JXOA 4JV0A 1S9GA 2JFKA 3KJQB 2K2PA 1VQPS 1ZH5A 4UOCA 3UFCX 4CNZA 2B6AB 3TA2A 1TL7B 2XSJB 1AZSA 3LPYA 1M5PC 3I32A 3CJQA 1FKPA 3DKDA 1U48A 1DURA 1VQLS 1Q78A 5GVQA 4YR2A 1TL3A 1XR5A 1FRXA 2AX0A 3CT9A 1NEEA 1WDDA 4DOZA 1XNRF 3SIPB 4PXDA 4OZLA 1FDNA 3E01B 1YGYA 2CQ1A 4PEOA 5D4LA 1HD0A 1OQ6A 3BS9A 3HPOA 1S1TA 3JTOA 3SZ2A 3ILIA 2CQ0A 2YH0A 1RLDA 2W9AA 4ECWA 2XYPB 2CVIA 2PI5A 5M2RA 4OI0A 2Q3PA 2WTFA 2XB2D 2MKIA 3UN5A 4WP3A 3LP0A 4DL7A 3IBCB 3OHBA 2UP1A 1SKRA 2DBBA 4CWBA 4DS4A 4UOHA 5K8MA 2AYGA 4DSIA 5J2PA 1HHTP 1NAQA 3FVYA 5AJ3J 1S97A 5ETVA 1UFWA 4FDFA 2GHPA 4ETXA 4Q5VA 4JV5F 1S1TB 3BSNA 4OX6A 2RHSB 4J9LA 2R3VA 3KOAA 5E3PA 1OQ3A 5J1EA 2XLJA 1NK6A 2BANA 2HGLA 1P9YA 3R5GA 1HFEL 3NCRA 3LP0B 4UZBA 3R6GB 3NNHA 4IOCQ 1WI8A 3R6LB 3THPA 5DQHA 2QTWA 3DC2A 2JRSA 3B4DA 1XK8A 2EFPA 5J2PB 1U0SA 2MLXA 3NY0A 1V3RA 3AAWB 2GFFA 2CWXA 4IR1A 3PCOB 1KQFB 1HD1A 1SQFA 3GCXP 1X5SA 5AE2A 5JVHQ 2OFGX 1RWNB 3HVTA 5LSLA 1V6HA 2COLA 2LU1A 3ETOA 4ZVHA 1KDNA 4WYLA 4XPEA 4Y0FA 3RRGA 2LDIA 1WKLA 2IC3A 5J1EB 2BM1A 2DGOA 2BANB 4ECZA 2B8QA 4CLFA 1HNWF 1NBEB 3D1OA 2KL8A 4K8RA 1ITPA 1MN9A 4PAAA 2GW8A 4ZVFA 2MQPA 3QRRA 2ASYA 4IH6A 4F36A 4Q45A 2KKHA 2OP5A 3HFZB 3AHPA 3GPAA 3U1LA 5AE1A 1SKSA 2B8PA 4H4OA 4J5OA 2AGOA 1IVZA 2V4QA 3EMTA 2AZ3A 2O3DA 3CJRA 3EGZA 2WRMA 3W60A 1S7IA 4NLQA 3EVWA 3WX8A 3JAMU 2JEFA 4JI6J 4ILRA 1Q8LA 1NRKA 2OO4A 3UI3A 2ADBA 4DLGA 3AB4B 3IR7B 2AF6A 4E8UA 4CLLA 5IM0A 3RYLA 3R1LA 3HD1A 5BYSA 2R2RA 5KFHA 3H2LA 1RB0A 5LOQA 2ZZMA 2IC3B 1UVMA 4K4WA 3M6UA 4IG3B 1BLUA 2MLZA 3O44A 1N48A 4ECSA 2D41A 3EDRB 4YMEA 3DM2A 2X1BA 4F0HA 3MD3A 4J9RA 2OSQA 4C11A 2DCLA 4H4OB 4ZLJA 3VVTA 3FBCA 1KR4A 3MAAA 3FSIA 3IBWA 4ZLLA 5I4MA 3P45B 2YWFA 3H5XA 3AOCA 4I68A 2OPSB 4AQYJ 1BWVA 2AIRB 4RUCA 5IM0B 4O3NA 1S9FA 4UF4A 2ZH7A 1SJRA 4WF9Q 2BMBA 2HHHJ 4FP9A 1XMOF 2IMWP 2R4FA 3EZ5A 2V2QA 4NZ0A 2IDEA 2FHKA 5EN1A 4RJVA 4G1QA 2HRYA 2JX2A 2ATLA 2VG5A 4MYUA 2WSEC 1UP1A 5LXYA 2LCWA 1ZM9A 4C11B 1ULRA 4ZS6A 5HO4A 2RRBA 2QSWA 5HP1A 1F3FA 3A8EA 1I5OB 3TYTA 1ZBTA 2D3UA 1IQZA 3R5JB 4U95A 2HLUA 1LW0A 3SQGA 3BH6B 4OYWA 2RRNA 1F5BA 3EZOA 5HSPA 2RMLA 2OUGA 3I9V9 2J76E 3GYNA 1ZPWX 2L3MA 2B9XA 1JQGA 3M2UA 5BR8F 1U8SA 3EE3A 2OIHA 3IMQJ 1MMNA 2VG5B 4TQSA 1PJ6A 1YRTA 1P6TA 4OLPA 5D4OA 3TJ8A 4N5SA 2C22A 4ANEA 1RHUB 5C42B 4CCHA 3AFGA 1VK3A 3CD7A 2DRDA 4USJC 2VUGA 1QE1A 4RO0A 5K8OA 1LW0B 3SQGB 2M8HA 2ZH9A 4KPYA 1S0OA 2W9BA 2X7IA 1ROFA 2V34A 3M2UB 1VFJA 1C1CA 5HQ8A 2PMHA 3F41A 3PEHA 2QA4G 3SYZA 1DQAA 3MCMA 3T1YJ 3VQSA 3GYXB 3H20A 2N7CA 2N4DA 2LEPA 1VC6A 1UL3A 3NL0A 3H4DA 3VGSA 4E98A 2YY3A 3HHLA 5HK4A 3W5YA 2E5LF 4OZNA 1QE1B 1X0PA 4PR6A 1B7FA 3WZ0A 2WONA 3V6JA 1VQMS 3OTCA 4TU9A 4IRCA 2W2OP 2QYGA 1V3SA 4KGKA 2XZWA 1N36J 6FDRA 1UKUA 1C1CB 2IA6A 1XC9A 2CPXA 3FSXA 3RB3A 5HVHA 5J2NA 1S9EB 1CEZA 4M5DA 2YKQA 3GG1A 1S6QA 1LV5A 3CF5Q 2UVVA 4TLQA 2YKMB 3UDCA 1K1SA 4HDGA 4R0EA 5KFTA 1BD6A 4X65J 2QJ3A 1P27B 2WONB 3IFEA 3K5LA 1CS4A 1LFPA 1YDLA 3BSAA 4GKKF 5LT5A 4C6AA 2QMUB 5T14A 3CC7S 2JDJA 4ZCMA 2YKNA 1REVA 1T02A 3U02A 3MMBA 5J2NB 2NYHA 1BQXA 4M5DB 4KKOA 3CJ3A 1DARA 1SCJB 2CA9A 3DXBA 1S6QB 1HPZB 1Q8IA 5CCLA 1K73T 2P2CB 1HNIB 3OL8A 1RWWB 3FEYB 1QLNA 2QYCA 2LQ8A 1C1BB 2ZHOA 4DR7F 1CS4B 4JI0F 4WTOB 4HT5A 5L1LA 1WJ9A 2YKNB 4X4PA 2G0JA 1REVB 4B02A 2HIQA 1YBAA 1T3NA 3QAUA 1YZ7A 4LF4F 1FRLA 1R6YA 4KKOB 1FVSA 5KFUA 5GAGI 5HQMA 3MMCA 1U49A 1RWOB 2RILA 4OI4A 4LF6F 4LJMA 1GEHA 5IV3A 2E1AA 2XO6A 3M6VA 2D3OR 2IBKA 2DNNA 4HHJA 2VC0A 4N8NA 5ETOA 2YX4A 4X64F 3BZQA 3BM7A 3KLEA 4F4WA 3MMJA 2QZ8A 2KO1A 2E9TA 2P9CA 3CCVS 1X5TA 3TP2A 4WFBQ 2HIYA 1MMLA 1SJ3P 1CQNA 1LW2A 2FJXA 4N41A 5IT9Y 1B0TA 3HVWA 1KFSA 3MMCB 3H0PA 3QYYA 2ZD1B 1PO6A 2JFDA 4GC7A 2VFUA 5LJ3Y 1FK9B 4P71A 3W2WA 5FDLA 2Q66A 2ROPA 4RW4B 2DPJA 4QIGA 3HKWA 2AJ4A 2R2SA 5F8MA 3PYDA 1JJ4A 1R0CB 2XZTB 3CJ4A 3MAHA 1VYAA 4B3OA 3A8JA 2J0QD 2DR5A 1L3KA 3BJYA 3DYAA 3MPVA 4B3SJ 5HLFA 1UFLA 1OY8A 4M5HA 4O4GB 2OEMA 2ZDPA 2HWHA 2UXCF 4NYOA 1ZAVA 2DR9A 4F3OA 3W1YC 2B4PA 3V6KA 4JI3F 3W2WB 3KDOA 2FUG9 3ZZPA 5FDLB 4K0KJ 2PE8A 2FGOA 5A8WA 2L9DA 3WX4A 1RBAA 2CNLB 5KTQA 4X84A 4DF8A 1W7WA 4WFZA 3HKZD 4C3LA 1Q95G 3CJKA 3MOJB 4B3OB 3J7ZT 2AV5A 1IBLJ 2E1PA 4FXVA 3DYAB 4DR4J 4QJVA 2B4VA 3N28A 5HLFB 3M8WA 4FBUA 1WKJA 4KB7A 1JXEA 2AZ1A 3LOUA 2IAJB 3V4MA 3MR6A 3EICA 2EPIA 1R89A 3AJ2A 3CMES 3K17A 2GMJA 3W8PA 2QX0A 2RF2B 1S1UB 2IRYA 1NO8A 2IHR1 3W5XA 4MJKA 4PKDB 5A8WB 2G4BA 2ZWOA 1GTEA 1RTDA 4MK8A 3WDOA 3M7VA 4X66F 1NSPA 5D3GA 3CJKB 2EFNA 1NB2A 3FBEA 3F73A 4KE5A 3CCLS 4ZPAA 1YHQS 3SMZA 2ZOGA 1J5EJ 2CYYA 4IO1A 1F1BB 5CYJA 1KNZA 3HXMA 5KFDA 2Y1RI 2CKWA 2HNZA 2NSBA 3TNVA 2M5YA 3SSQA 1NK9A 2HHXA 2DY1A 1FERA 4DFMA 4BC9A 2P9GA 3BBCA 2XWXA 2IPOB 1TMJA 1UW9A 2B9YA 4K4YA 2VBZA 3A13A 2XI3A 5D3GB 3CDBA 3CVKA 2EBEA 2RNEA 1SJ1A 5K14A 3OUYA 2JEIA 3KUGA 1X5OA 1ZM4A 5J2QA 3DMJA 1RT7A 1BGXT 3UCUP 4C98A 1R27B 1SJFA 2HNZB 5L39A 2VH7A 3OL7A 3AJ1A 4HT7A 2AD9A 2YNGA 5KFIA 3KK2B 5KG4A 2XMAA 5CD4H 1URRA 4F0KA 1TK0A 2CG8A 3OT9A 3UO0A 2PSZA 3BGOP 4A46A 2W4PA 1YQHA 4LF8J 1M0SA 1PAEX 2YWGA 3ZZ0A 2NXCA 3VZHA 3N5FA 1B99A 2ZHBA 2IYGA 5K14B 2HWIA 2JOQA 3OUYB 2CQCA 5HMXA 2JSXA 5J2QB 3DMJB 1RT7B 4QWAA 2E1RA 5CA5A 3FQLA 4GC6A 3MDFA 3HT0A 4I64A 3QSYB 1UJ5A 3UVJA 4WFYA 1Y00A 4M5NA 4ZA1A 2NQPA 2ROGA 4ZVQB 1SB6A 2J0WA 5D8HB 3OR2A 1TL4A 4Q44A 1M1HA 4LF5J 5DM6Q 1FEHA 4Y2AA 3I0SB 2ZUGA 4CTAA 2KXFA 2FLLA 3ENWA 4IFVA 2YWKA 1BXNA 2FVQA 2MHEA 1VQ9S 2KN4A 2UXDF 5MAOA 3GJRB 3A12A 2N7YA 2V2VA 5IT9U 4W98A 1DFDA 3TARA 1P1LA 1V9OA 2FYXA 2DNHA 3H8YA 2C3PA 2AU0A 1NLKL 4OV1A 1SI9A 3GWCA 1F6TA 1DTQA 1U1NA 2M2BA 4YOEA 5AXNA 3H5SA 2NLWA 3HLUA 2W25A 4JI6F 3OR2B 2OEKA 3G86A 2VASA 2AEJA 2VZ9A 4ELVA 4TN2A 5H9EJ 3GSIA 4NLUA 4CTAB 2E5IA 4DDFA 4IFVB 1M5HA 4C8NA 5FD1A 1X4DA 4DUYJ 1AA1B 1PG5B 3HSDA 5L1JA 5E3AA 2LXUA 3VVUA 1P8GA 4LSNA 1YJUA 4CO0A 3TANA 5GAHU 2XS2A 3JTNA 5B0BA 3Q24A 2MSTA 1H7XA 4LFCJ 1FKOA 2MQOA 1APSA 1JLBA 4O0IA 1BMQB 4EMDA 3FCVA 4DV0F 1DTQB 3SXLA 2PC6A 2KRBA 3MFIA 4F26A 1MWQA 5ETRA 3NRBA 3Q0AA 3I56S 1RI7A 4BCAA 2WK4A 4OYZA 3ZZRA 2XEXA 2CRLA 5KFEA 3VAGA 4DL5A 4WCEQ 4B3TF 4LSNB 3IO1A 2BQUA 3NLCA 4WFAQ 4DR6J 1Q53A 2L08A 5AXLA 1JLBB 1PKUA 4ERDA 3GB0A 3NGKA 1JIHA 4DFJA 1UEKA 1MWZA 4ALZA 2K1RA 2MMYA 1QSSA 2W24A 2VF3A 2C2MB 3CC4S 4IDKA 2UUBJ 4FPIA 2XG8A 5H9EK 5DRKA 2CWKA 3POTA 2G0CA 1HL6A 2GV1A 2UUAJ 4ES2A 2CQIA 3DDNA 1LWFA 2Z30B 1XJWB 1HWLA 3QNWB 3CNQP 4QWEA 2E44A 4WTYA 5KFKA 1XQIA 3CIZA 4DLEA 1DAXA 2M52A 4Q2LA 2KM8C 4OL8A 5KFFA 2HG4A 1J2VA 1EX8A 4ZPCA 1HR0J 4CLZA 2C42A 2XGQA 1YRXA 2K1RB 2LLZA 2DK2A 4IDKB 3T9NA 1H6KX 3K8VA 4DU8A 5HVFA 3C15A 4N7TA 3POTB 1MWYA 1S6PA 2BE7D 3ZZUA 2J0SD 4K4UA 2Y1IA 1LWFB 1SQEA 2AKWB 1AFJA 4EFAC 2MB0B 1BC6A 4K4SA 1FJEB 1CLFA 1M1GA 3H5YA 1NZAA 3G9CA 1M5SA 4OHVA 3DU5A 3ZZYA 1JLAA 4KO0B 2Z2YB 2ZBQA 1CC8A 1AYEA 3OJSA 1WI6A 1MU2A 1N5QA 5IQQA 3AXKA 1C2PA 3KUEA 1RTZA 3UNGC 1S6UA 3BO4A 4FZVA 1TMMA 3G82B 2BE2A 3ZTSA 3BR8A 4Y2MA 3C15B 1R8CA 3D6MB 1EAYC 5A8RA 4DX6A 1PSDA 1S6PB 2X51A 3KLHB 2A6OA 4LF1A 3O6QA 5F3TA 1TTHB 4C3KA 2QL7B 2IM0A 1HBNB 3RB4A 3MM6A 4JI5J 1D8ZA 5L1KA 3DDKA 1JLAB 1S49A 5GAHI 3L09A 1X60A 4JYAF 1FJGF 1WC3A 5LSRA 5DLFA 1MU2B 4TYBA 2FC8A 3UE2A 1FWPA 3HFVA 4X4TA 4I4BA 4N8OA 1Y3KA 2BE2B 1RT6A 4PG8A 3PRVA 3FRZA 2EK6A 3FSYA 5A8RB 3R27A 3QRPA 2WW4A 4EGLA 5LXRA 4USVA 2OH2A 4C8KA 1T9YA 1IKYA 2E9RX 4XAKA 2KZMA 1G1XA 5CHCB 4M5GA 4WYWA 1S0MA 1F9HA 3W3SA 3PFEA 4CLYA 2CJ9A 3LANA 2V5HG 4PG5A 4LIWA 2HQIA 3ZTOA 2GMLA 3PIPQ 4JI4F 4FYWB 1VBYA 2HS0A 2RQMA 4EU0A 1RT6B 2FZCB 2R7UA 2V8HA 4F50A 3ZTRA 3RRHA 2ZJRQ 1NKBA 3HHLD 1FKAF 5MLCV 1IKYB 1RT1A 4DR5J 4C2MA 1N4LA 1WEXA 1U45A 2IRXA 5DS7A 5JJBA 3IR5B 1ZA1B 3BBBA 1RWXB 3AOAA 2VFVA 1R8AA 1VQYA 4GRSA 2HVEA 4WPAA 3KHHA 2UU9J 1CQMA 2VV5A 3P8BB 3J7Z5 2VL1A 1Z2ZA 3FJ2A 3VAIA 4A8YA 3GILA 4A8WA 2NR0A 4YFUA 1VQ8S 3CCRS 2E66A 1F9FA 3RJMB 2F8EX 1LK7A 2HBQB 1WEYA 3MF5A 3EPGA 2YTCA 3DHXA 1RT1B 3QGGA 1VDHA 2MZ1A 4WP9A 2XLKA 2HRTA 3SCLE 3D1QA 3C66A 4U8YA 1OJ4A 1RU1A 3CJTA 3MFHA 4RNNA 4OJHA 1I94F 1MNEA 3ET6A 1NK4A 1SKUB 4CNYA 3DFEA 2EFGA 2UUCJ 3D68A 2YKPA 1LEOA 2B43A 3BQ0A 5HMZA 1WWHA 2E9ZA 1RWUA 3FBFA 2JZ5A 3BO2A 3HHKA 2YKOA 3MD1A 5K5MA 4MH8A 2CNKB 1X4AA 3CMAS 1RKJA 2I1RA 1NDCA 3JS9A 2ZITA 4YR0A 3FUYA 3TAMA 1EJ7L 3IC1A 5CYQA 4M95A 3K5NA 1G2EA 1YBUA 4P73A 5LL6d 1KQGB 3KLFA 2YWEA 1TL5A 1O5JA 2DXFA 4ZVRB 1SVDA 4TNOA 1T3OA 4JI1J 5B08A 1X4GA 4TY8A 3Q8RB 2CVEA 4PABA 4AL6A 2DITA 2H48B 2LA6A 3PW7A 3VWSA 3MM8A 1VGYA 5B0DA 2VQFF 1TP7A 1K0TA
chains in the Genus database with same CATH topology
2PIIA 3RBDA 5D4LA 4AXIA 2BVZA 1HD0A 1HWKA 3G6ES 1HQEA 2DNGA 3M1VB 1OQ6A 3BS9A 3HPOA 3TUIC 4NCAA 1S1TA 5KFSA 4DN0A 2BBEA 4EBDA 3JTOA 2VPYB 1NKEA 3SZ2A 3MTJA 3KLFB 4DFPA 3OHAA 3VAMA 2ZFHA 3FFIA 4RX6A 2CQ0A 2YH0A 2QMXA 3CIMA 4XIUA 4AXJA 2W9AA 3N5BA 4ECWA 1FXDA 2LQ5A 2QO3A 4ZVEA 3G96A 2CVIA 2DNMA 2PI5A 3LW5C 2FJAB 5M2RA 4CH0S 2WAQD 3ISZA 2Z2LA 3JTPA 4OI0A 2Q3PA 3BN7A 2WTFA 4TY8B 2QLXA 4U7CA 2XB2D 2MKIA 3K59A 2MQNA 3PM9A 1JXLA 2HHQA 3O3LA 3MURP 2ZH1A 3T5KA 4MYTA 4AQYF 3IN5A 1U1LA 2I2YA 5E33A 2CPJA 3LP0A 4DL7A 4OIXA 3OHBA 1TAUA 2UP1A 1SKRA 4MIBA 2DBBA 4BWMA 4WFNQ 2CQHA 4DS4A 3MEKA 5KG5A 1T94A 2KYXA 2DTJA 3MM8B 5K8MA 1QM9A 2DGSA 4FNIA 4DQRA 2AYGA 4DSIA 3LH2S 5J2PA 1HHTP 2CJQA 2C2RA 2YKAA 4PUOA 1NAQA 4ECUA 3I9ZA 4FBTA 4NLWA 2X1FA 4NYPA 3FVYA 2QLWA 3U7JA 2HHHF 2KHDA 3MMBB 1F60B 2FVPA 1CG2A 1S97A 1YJRA 1VQOS 3GV8B 3B78A 1UFWA 4OHWA 2OLWA 4R25A 1HQEB 3SFUA 2GHPA 4ETXA 3G6YA 1J5OA 4Q5VA 3EXYA 3DCAA 4M8LA 2DHSA 3BSCA 1CVJA 4JV5F 2KTQA 1S1TB 2KT2A 3HO1A 1DBDA 4H4KA 3BSNA 4OX6A 2ABYA 5KFJA 3MEGA 2MQMA 3AH6A 4A8KA 3FFIB 4W90B 1KS2A 3DRPA 2J9EA 4J9LA 4GO7X 4NLVA 3T6BA 3B4MA 2ZZNA 4CZCA 3KOAA 5E3PA 3LF0A 1OQ3A 3PV8A 2E5HA 5J1EA 2XLJA 4J37A 3PNIA 1NK6A 3VR1A 2BANA 1X4CA 4DSFA 1WTBA 3QJLA 4RKUC 3CCQS 5KG6A 5I3UB 2ZH6A 2HGLA 4V19J 3D0HE 2R7SA 1KVIA 3TVYA 5KOXA 1N88A 1HFEL 3NCRA 2J0XA 5KG3A 4J9KA 3LP0B 2J7KA 3BQ1A 3NNHA 2XCPA 1WI8A 2DNQA 4IOCQ 1MMDA 5T7LA 5D6GA 3THPA 1FJ7A 2BRLA 4C97A 3LAKA 4RWWA 5BYRA 4ZPBA 2MYFA 5DQHA 4F4XA 1RISA 2O67A 3M8RA 3DC2A 2JRSA 3B4DA 3UPFA 1H2TZ 3KHRA 1XK8A 2EFPA 3MPWA 3PJXA 2J8AA 5J2PB 1IJEB 1LKZA 1QAXA 3F44A 3CCWA 4PUOB 3Q23A 1VMBA 4A48A 2F8MA 3PW5A 4GO5X 1V3RA 3AAWB 2GFFA 3UCZP 1ZOTA 4J9NA 4IR1A 5B0CA 5C5JA 4OJ3A 1Z1ZA 1KQFB 3JSMA 2FVRA 3PZPA 3SCIE 5KFYA 1HD1A 4Q2MA 3PW2A 1U26A 1Z2LA 1X5SA 5AE2A 5JVHQ 1J5OB 4KO0A 2OFGX 2R8HA 1WF2A 3N79A 3BN4A 3TA1A 5L38A 4RLEA 1U6FA 1RJJA 2DNOA 3HVTA 2GIQA 1L3VA 2C3OA 2RQKA 4Y00A 4A8SA 1K1QA 3A1YG 3MEGB 5LSLA 2FVSA 1L3UA 2DB1A 4ZCLA 4FXDA 1F5CA 1V6HA 2COLA 2E7WA 2LU1A 3QZ7A 2ZM6F 3ETOA 3DRPB 4ZVHA 3OLBA 2MPUA 1IR0A 1SIZA 3BF4A 1YJTA 1VQ7S 1Y5NB 4WYLA 4XPEA 4CIOA 1S6OA 4Y0FA 1YG0A 3NG8A 3RRGA 2OTJS 5H9FJ 2LDIA 4IRDA 2IC3A 2PEHA 5J1EB 2BM1A 2DGOA 4OZ1A 2BANB 4ZVGA 4ECZA 3DGPA 1IKXA 1U1MA 1A7GE 3HDSA 4C8OA 4F2RA 2WB4A 4DSLA 2E1CA 2CQ2A 1OS5A 1HNWF 4C8ZA 3E3XA 3D1OA 2UXBF 2VPZB 2GW8A 4ZVFA 2MQPA 2K7KA 1EETA 2B7CB 2ASYA 4IH6A 4Q45A 5T7LB 3KLEB 1R43A 2KKHA 2OP5A 2LXFA 4Y2IA 3U27A 3KLHA 3AHPA 5JXSA 2KRRA 1D9FA 1U6BA 2A1BA 4RNMA 3U1LA 5AE1A 1BWEA 4PG7A 2OSRA 4DQQA 4G1IA 3TUZC 1FNMA 1SKSA 4YB7A 4J5OA 4H4OA 1M5VC 2AWZA 1YRUA 5F9LA 2KJWA 5B0GA 2AGOA 1RYSA 3QO9A 1KHWA 2J9CA 4MK7A 1BQMB 1HBNA 1ZZFA 2A10A 4WJBA 2V4QA 2O3DA 4DL3A 3ENQA 4N76A 3EGZA 2WRMA 2PA8D 4IFYA 1LW2B 4NLQA 3JSMB 4I69A 3HF5A 4RBUA 2JHEA 1XNQF 2JEFA 1U1QA 1JNRB 3I82A 4ILRA 1Q8LA 1HBUA 1NRKA 5A0YA 4X4UA 2OO4A 3T1YF 1LK5A 3UI3A 2ADBA 2DNRA 4BS2A 2MZQA 3FCHA 1IJFB 5F8HA 4DLGA 2I8EA 3AB4B 1RT3A 3IR7B 1RYRA 4ED5A 2FLOA 2AF6A 4E8UA 1KQSR 3G8TA 5IM0A 3RYLA 2C3MA 3R1LA 1N6QA 2RE1A 5BYSA 2R2RA 5ADZA 2MKSA 4NZ6A 3VQTA 5KFHA 3H2LA 1RK8A 2ZZMA 5KFPA 1VHFA 2IC3B 4JUZA 2BUNA 5CCMA 1UVMA 4K4WA 1IKXB 3M6UA 4IG3B 1Q86T 3LWMA 1BLUA 3OFEA 1X9WA 4QWDA 2OPRA 3O44A 2VPXB 4X62F 1N48A 3DLBA 4ECSA 2D41A 2LQBA 4YMEA 2XI2A 3DM2A 4UUWA 2ZKUA 5KT4A 1N0VC 1JLGA 2X1BA 1Y4ZB 2MHNA 1E6YB 4KIAA 3MD3A 3MM9B 2CJBA 4HTJA 1UVNA 4J9RA 3C6TA 2OSQA 3TVKA 1QJHA 1UVIA 5KT6A 4C11A 2DCLA 2QSFA 3UR0A 1A6LA 3KG4A 4H4OB 3NS5A 3P3DA 4BC7A 4UW2A 3QO9B 4NMLA 4K5SA 1KR4A 1M5OC 3FSIA 1N36F 3IBWA 2EW9A 5I4MA 1LXJA 3KTQA 3EPIA 3F56A 1R0AB 2YWFA 3H5XA 4HVZA 4I68A 2OPSB 2PN6A 3PKMA 3MR2A 4RZRA 1FE4A 2ASDA 2ZVSA 1HBUB 5A0YB 2PO4A 4B08A 5KG0A 4F3MA 3QGIA 2IA0A 3NCQA 3I0RA 4L6V3 3KMSA 1RT3B 2YVSA 4RUCA 2B4UA 3UW1A 1OIAA 5IM0B 4O3NA 1DQ9A 1RTJA 1FD2A 3K2YA 5C25B 5AXKA 5EWGA 1S9FA 2ACYA 1TR0A 4HLBA 2ZH7A 2QFJA 1SJRA 2X3GA 3BQ2A 4DV6F 1NNDA 2RKIA 4FYDA 1WELA 4WF9Q 1ZAXA 1S48A 4XDCA 1R8PA 2RDIA 2W8KA 2V8VA 4FP9A 1XMOF 4B9NA 2IMWP 2R4FA 2OPRB 1SJQA 2DD8S 3IAM9 3EZ5A 4NZ0A 1Q79A 4X4VA 2FHKA 5EN1A 3V6DA 1VLYA 4G1QA 5KFZA 2FJEB 5F9NA 2HRYA 2JX2A 3HHEA 1JLGB 2LMIA 2VG5A 4X65F 2ATLA 4MYUA 2GHWA 2WSEC 4TU7A 1SL0A 1UP1A 5LXYA 3C6TB 3LGNA 2LCWA 1NJXA 4WU2A 2GCFA 1ZM9A 4TQRA 4C11B 1LQ9A 1O51A 3V81A 4QR0A 1ULRA 4ZS6A 3EGNA 5HO4A 4ILLA 2JEJA 2FJVA 1LWEA 1NU4A 2RRBA 2QSWA 3HFKA 3C6UA 3BGFA 5HP1A 3R3TA 1N8RT 4DUZF 3A8EA 4LQ3A 4Y34A 1DRZA 4WXOA 4IG0A 4UUXA 3TYTA 4X4QA 4DQSA 1ZPVA 1FDDA 3PRBA 1JLEA 1OPIA 2Z8QA 4LF7F 1ZBTA 2CZ4A 7FD1A 1JMTA 2D3UA 1IQZA 2N3OA 1U1RA 2AJFE 2PMZD 2HLUA 4NLYA 1LW0A 3SQGA 2XWYA 5U47A 4BDPA 4NA2A 3RW6A 5LJ5Y 2Q43A 2QA1A 1NK8A 2RRNA 3I0RB 1F5BA