1QVGR

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qvgR00
2X1FA 3G8SA 3SDEB 3MURP 1ZH5A 1YI2S 2CQPA 2J8AA 3U1LA 2DNHA 2O3DA 2XB2D 1FHTA 1BY9A 3CCRS 2M52A 4UQTA 2OTLS 2MZRA 1NU4A 2JVOA 1XN9A 2HYIB 5MLCV 3U1MA 3UD4P 4C4WA 5GMKa 1WF1A 1X5PA 2DNLA 2FY1A 2RRBA 2DIVA 2LXIA 2KG1A 1NJIT 3J7ZT 2F9JA 1U1NA 2X1BA 3EX7B 3R1HA 3MUVP 2QFJA 4QPTA 2FC9A 3P49B 1H2UX 3V4MA 2KVIA 1R8HA 2JWNA 2CQ4A 3CCQS 2DGVA 5IM0A 1UAWA 2MQPA 3SDEA 2LKZA 2VOOA 3THTA 2MSSA 3H2UB 3VF0B 2G0CA 2QA4S 3VAHA 4FXVA 4TU7A 1OIAA 4OZ0A 4UY8T 1Q82T 1QVFR 1WWHA 2MZSA 2DGXA 2RU3A 1VQ9S 2XS2A 2CPZA 2KU7A 2YKAA 3BO2A 3SXLA 2GO9A 4A8XA 1WEZA 1RKJA 2KRBA 2N3LA 3MI7X 1X4GA 4C0OC 1U6BA 3MD3A 3ULHA 1DHMA 2MQQA 3CC2S 1VBZA 2CPJA 2LA6A 1WHXA 2MKCA 2DHXA 2E5IA 5CYJA 1YWXA 1X4BA 2LQ5A 3R1LA 1U1QA 2RS8A 2PEHA 2K8GA 5DDOC 1X4AA 1U2FA 3CCSS 1FNXH 1WELA 2YH0A 3H2VE 5DDRC 1SJQA 1HA1A 4F25A 4WCEQ 4C7QA 3VALA 3NS5A 1OWXA 2E5GA 2N3OA 1NO8A 2X1AA 2DNKA 3B4DA 2AYEA 2MKJA 1P27B 3ZZYA 5HL7Q 1VQ7S 4CH0S 1VQMS 3RW7A 3NNHA 1WG5A 1SJ4P 3NNCA 1VC0A 1VQPS 2MQLA 1X4HA 4IOAQ 1WI8A 1KOOA 2M9KA 3P6YC 1X4DA 2MMYA 3IWNC 2HGLA 4CQ1A 2DH9A 1N52B 2FC8A 2LA4A 2DISA 1W2BR 3MXHP 2OJ3A 2M4MA 2MZJA 2DH8A 3CCES 1YJWS 1WHYA 4WKRA 2LEAA 2KT5A 2CQ3A 2FHOB 5CA5A 2NZ4A 1FJ7A 4F26A 1UFWA 2DITA 2CQBA 5DM6Q 2KM8B 5LXRA 4YOEA 2DGSA 2DK2A 4WFBQ 1K8AT 1X5SA 1S79A 2DHSA 3CUNA 2SXLA 4F02A 2MY7A 2DGQA 4QU7A 1PO6A 5DETA 3I56S 2MJUA 3CCJS 3UCUP 3NMRA 1QM9A 2E44A 1F9FA 4V19X 1CVJA 1WHVA 3J7YU 3UD3P 2AD9A 2RRAA 3MUMP 3LPYA 3P5TL 1KOHA 5GADU 1IQTA 2MKSA 4IO9Q 2CQIA 2HGMA 2RNEA 2MHNA 4TU8A 2MKHA 2MQNA 4WFAQ 2CQGA 2KRRA 3CPWR 1VQ6S 5DDPC 2VOPA 3EGZA 3G9CA 5FJ4A 2D3OR 3US5A 5LJ5Y 2M70A 1HD0A 2JVRA 1R8PA 2E5JA 2ZJQQ 1VC5A 1X5OA 3LQVA 3I55S 4PRFA 5EN1A 3NS6A 1M5KC 2G4BA 1O0PA 3CXCR 3MD1A 1VQNS 3MUTP 2YTCA 1YJ9S 2J76E 2YWKA 5IQQA 1L3KA 3VAMA 1X4EA 3CD6S 2KXFA 1YIJS 2DO4A 5ITHA 2DB1A 4IUFA 1FJCA 4Z2XA 1URNA 5IFMA 1DZ5A 4YB1P 2DH7A 2CPDA 3OW2R 1N54B 3G71S 1SJFA 2MSTA 3R27A 1U1LA 2DIUA 4IOCQ 1WTBA 3CCMS 1Q81T 5LSLA 4PR6A 1JJ4A 1K9MT 4LIRA 2I38A 1JMTA 1VQ8S 2JRSA 1X4CA 2U1AA 2WBRA 5DM7Q 4QU6A 1WG1A 2XS5A 2XNRA 3SMZA 1X0FA 1KD1T 4W92B 2I2YA 2HZCA 2RT3A 5BJRA 3THPA 1KC8T 2FPHX 1WG4A 2M88A 1YJNS 2DGTA 2MJNA 1WEYA 2M2BA 2OSRA 1PGZA 4QQBA 4U67Q 1K73T 5H1SV 3ZZZA 4TU9A 3BO3A 1M1KT 2MQOA 1N88A 1VQ5S 3PIPQ 1FO1A 2L41A 2MKIA 1ZZNA 2RUGA 1M5OC 1A9NB 1U1OA 1HD1A 3NNAA 2HVZA 2MZQA 2N82B 1S72S 2L9WA 2N7CA 1VQKS 2DNPA 2DHGA 5GVQA 3JB9k 3VAIA 1RK8A 2BZ2A 3CCVS 2MB0B 3CF5Q 5LJ3Y 3Q2SC 3CCUS 1OPIA 1M5VC 1WF0A 3L3CA 1WI6A 2EVZA 3N9UC 2F3JA 1U1MA 5GAHU 1YTYA 1WEXA 3TP2A 1VQLS 3TO8A 2CPIA 2G1DA 2DO0A 1M90T 2BOPA 5JVHQ 3S7RA 1U1KA 1Q7YT 5LXYA 2VONA 4ED5A 2NLWA 2MY8A 3S8SA 5IM0B 2DNZA 2XSFA 3S01A 5HO4A 3DXBA 3FEXB 2CQ1A 2D9PA 2ADBA 2Q79A 3UCZP 5D78A 2OSQA 3HHNB 1VQ4S 2LMIA 1B7FA 1X4FA 2DNGA 2MPUA 3CULA 2DNOA 4ZKAA 2MZ1A 2DNQA 2KN4A 5GAEU 3B4MA 2ADCA 2KXHA 3CMAS 4WFNQ 5CXTA 1UP1A 2EK6A 1U1RA 2RVJA 4Y00A 1U1PA 2LYVA 2XNQA 2OTJS 1ZZFA 1VQOS 2DGUA 1SXLA 2KYXA 2DGOA 1D9AA 2HGNA 2KM8C 2KHCA 2CQCA 5D77A 1JJHA 1U6FA 4LJMA 2AYMA 2YH1A 4LMZA 4CIOA 3CCLS 3RW6A 3G6ES 2RQ4A 4J5OA 2KG0A 2CPHA 3D2WA 2MZTA 2MGZB 4WF9Q 3DLLQ 3MDFA 1DRZA 2D9OA 1A7GE 2LECA 3UWTA 2CPXA 2B0GA 2LXUA 4WIIA 1HL6A 3VAKA 3CC7S 3G8TA 4BS2A 1VBYA 1YITS 4CH1A 2OIHA 2AYGA 2MYFA 2LEBA 2ERRA 1H2VZ 1H6KX 2CQ0A 3TYTA 2JX2A 4M5DB 2U2FA 2CQDA 1SJ3P 1FXLA 2CPYA 3P3DA 1QVGR 2GHPA 1YHQS 3VAJA 3UCGA 2L08A 2J0QD 2XS7A 1VC6A 3G96A 4RU2A 2CJKA 3VAFA 1OO0B 3CMES 1WF2A 2LCWA 1G2EA 2A3JA 1H2TZ 2MGZA 1KQSR 2VODA 3S6EA 2QEXS 1DBDA 1UW4A 2X1GA 2J0SD 2MXYA 2DNNA 2KXNB 3IRWP 3FEYB 2MQMA 1AUDA 3BO4A 2M8DB 2UP1A 5JVGQ 2M8HA 1Q86T 1JJ2R 3HI9A 4Y0FA 1P1TA 3CTRA 2DGWA 2V94A 2PE8A 4W90B 2ZJPQ 4PKDB 5GAGU 1WHWA 1X5TA 2DNYA 2M0GB 4ERDA 4P6QA 2DNRA 2CQHA 4FXWA 3CC4S 3MOJB 3Q2TC 2CPEA 1FJEB 2DNMA 2M7SA 1SJRA 2AYBA 2RS2A 1M5PC 2K3KA 3UE2A 1D8ZA 4EGLA 2ZJRQ 1VBXA 2KFYA 3BEGB 2F9DA 1FT8A 4YUDA 3VAGA 2CPFA 2EK1A 2KI2A 4TLQA 2KH9A 5DDQC 5LSOA 3K0JA 2RQCA 4OZ1A 3PIOQ 1N8RT 2DHAA 3BS9A 3G4SS 2CQ2A 3EGNA 2E5HA 2MKKA
chains in the Genus database with same CATH superfamily
2XB2D 2M52A 5MLCV 1B64A 5GMKa 4DHVA 2UUWA 5EWGA 2DIVA 3PX4A 2P2CB 5J1NA 2XY6A 3MMBB 2JFKA 1U1NA 1ZAXA 9RUBA 2E7XA 1HNZF 2DBBA 4A48A 2W7OA 5LMUF 3P49B 4KSEB 2RJZA 2HHVA 2YKQA 3AD8C 2XI2A 4I0WA 2IRUA 5IM0A 5AXMA 3M8QA 4IQMA 4FXDA 2BEFA 1WOPA 2QA4S 4CLSA 2RF2B 2ZBCA 1OIAA 3ZTOA 3MEEB 2XZTB 2YQ1A 5K5MA 4UW2A 3D6HB 2IVYA 3TI0A 1RKJA 1G6BA 1DHMA 1F5CA 5E3RA 3MEDA 1MROB 2WVFA 2RS8A 1VGYA 4EYHB 1FK9B 3HFKA 4B3OB 4O4RA 1EKSA 4DS5A 3EICA 4DMZA 2N3OA 1XNQF 1RHKB 2WHOA 3P96A 2ZH2A 3H25A 3EMTA 4F04B 1KN6A 1EARA 2MMYA 2DISA 3QAEA 1J2VA 2B8QA 2LDIA 4IG3B 4HVZA 3WQPA 3M2RA 2CVEA 1CSJA 1Q1KA 1S79A 1X5SA 4ATNA 3DLGB 1L3VA 1NSKL 3UD5A 4ED0A 3MFIA 1UJ6A 4HHUA 3VVUA 3M9NB 1UEKA 4K4ZA 3C16B 1MMLA 5SUHA 1H7WA 2HNDA 3ZTPA 4NZ0A 2XEXA 3G9CA 5FJ4A 1TL1A 2MLXA 2JVRA 3Q24A 2E5JA 2WAQD 3IGNA 3I55S 1HHTP 3F73A 4DG1B 3MD1A 4L3KA 2YNFB 4FYYB 3ZTQA 2B4UA 2IJNA 3RRHA 3HT3A 1URNA 2JL9A 3QRRA 4P75A 5MAOA 1Y3JA 1NK8A 2JRSA 5KFRA 2WBRA 4KQZA 2XC9A 1MLAA 3NL0A 2IBKA 5BJRA 3QZ8A 1WG4A 2GVZB 1N33F 3CCZA 3PJ9A 5H1SV 3B6BA 2AZ3A 4Q7AA 2MQOA 4ZIVA 1VBKA 2L41A 4WFXA 2QV6A 3MMJA 4TY8B 3NNAA 4LF4F 3VZHA 3VGTA 4USHA 1WSRA 3EVWA 2HNZA 2ZNYA 2DNPA 3UDCA 1RQ0A 1RK8A 4KYZA 3M32A 4LF8J 1GTEA 1RHQB 4HHJA 4C11B 2RQMA 4DX8H 2F5GA 1S6OA 3BSAA 5LM7E 2VG5B 3H0PA 4G1QA 3V81B 2GJIA 5HO4A 2QE5A 3HCXA 3TZYA 5KFCA 3DLKA 4QR1A 5HJXA 2KYZA 3B4MA 3ZTSA 2ADCA 4EI2A 1N36J 1UP1A 1SCJB 1Y9OA 5AXLA 3U7JA 4R8UB 4QIFA 1U6FA 2ALZA 2YH1A 4CIOA 1SH2A 2Q3PA 1VRTA 5DQIA 1EX8A 3B54A 2W2PP 4PYDA 2CNLB 3GG0A 5D3GA 1YITS 3D6TB 1JX4A 1M1GA 4IRCA 2XBPA 1FKOB 2IYIA 2Q1LA 2Y1RI 4DSLA 3I5AA 1TKTA 4ZOSA 1G2EA 4WE1B 1DBDA 1XBWA 4ZJOA 2ZBPA 5AT1B 4PQUA 2W01A 2KO1A 3C6TA 1P1TA 3SV3A 2RILA 2PE8A 3D5MA 3HSGA 5A2QU 2ZUAA 3UPFA 1ZA1B 2ROPA 3Q8VA 1NSQA 4N8NA 1VBXA 4ZN3A 4OV1A 3EPIA 5HMYA 4A8SA 2CPFA 1WC6A 1RT3A 2OEMA 3W2VB 5J2PA 5L38A 3BS9A 3UQSA 5G4DA 4DXLA 4FYXB 2R7VA 1XR6A 3BREA 5IV3A 4CTAB 2XYPB 2BOAA 2KT2A 3LPEA 4DSEA 2V2ZA 5HP1B 5HVFA 2FJDB 2ZC3A 4X4NA 1X5PA 1FRHA 3RB4A 3KK1A 2RRBA 2I8EA 3QATA 3HKZD 4OI6A 3QGHA 4MIAA 3GIIA 2X1BA 2HEKA 1FDBA 4L76A 1QY7A 1RHUB 2B5JB 4K7QA 3FFIA 3W3SA 2HFNA 5CCLA 3UO0A 2HFSA 3EGWB 3EJMA 5DQGA 2MQPA 2WONA 4DV2F 3CDAA 3VGSA 1UA1A 3HVTB 1WC1A 4F0MA 2HRYA 4IYQA 4RW8B 3MCSA 2AT1B 2Z2LA 3MMBA 2IHR1 3PR4A 3MD3A 4C8KA 4ED7A 2YWEA 2XZWA 3DYAA 1IJFB 1FVQA 2YH0A 1HA1A 2ZDOA 2FHKA 2RF2A 3JXOA 5KFWA 2OAUA 4OHXA 3MCNA 3MEEA 3KNAA 3JTPA 1F6TA 3QGIA 4DUZF 3HM9A 2XMWA 1ZM9A 1WG5A 5DQHA 3LANA 2OKQA 4YDXA 1EETB 3P6YC 1X4DA 3TA1A 4ER8A 1FFGB 3GIMA 2O5DA 2IC3B 1FK9A 1TKXB 4B3OA 1K0VA 3JQMA 4DFKA 3V5RA 2DPJA 4J9SA 2CQBA 2DK2A 2RD5C 2DHSA 4DCPB 4I2QB 2RRAA 4JI4F 4DUYF 3M05A 1FRKA 1NDCA 1NK9A 1PYTA 3CDUA 5AXKA 5B08A 3H90A 2WB1D 2VOPA 2DD8S 2Y3YA 4IG3A 4O0NA 4PG4A 3KOAA 1GH8A 3PACA 1Z4UA 2IRYA 3GSIA 1T7PA 1CC8A 2C1EB 4ILRA 1JLGB 3K5PA 3DLGA 2XQCA 4USJC 4MFBB 4DU8A 1C0UB 4OYZA 2YXLA 3W63A 3ISZA 3GYGA 4MKAA 4URQU 3C16A 4JI1J 2CPDA 1SJFA 2MSTA 1RACB 3PTWA 4O44B 3BPSP 1RWXB 2V8HA 1RE1B 3FZBA 2GIFA 3HMJG 5ETKA 4NLXA 2HZCA 1KWMA 1KC8T 1TFYA 2BKPA 2MJNA 4DG1A 1U49A 2LVWA 3DFEA 3PYGA 3DMJB 2YNFA 5KOXA 1XTZA 2XMKA 4DLGA 2G0IA 2PFDA 5A8KB 5HSPA 5KFPA 2ZE2B 4DQPA 3RYLA 4F67A 2CNNB 3LUYA 4RNNA 2FVCA 4IH6A 1M5VC 2GVZA 1I6JA 2GA7A 3ZZTA 2AEFA 2F3JA 4F3OA 5GAHU 4Q8EA 1WEXA 1VQLS 4ILLA 3W61A 1YG0A 3W5ZA 3BDPA 3M8PB 4TY8A 1HBNB 4X64J 3S8SA 3GYXB 3T5JA 4NYOA 3W65A 3PXGa 2B56A 4WXWA 5E0OA 2ZZNA 4KR0B 4NLRA 2Z4PA 3MM6B 4C11A 1I5OB 4FYVB 4W4MA 2VG5A 3R8YA 4NA2A 2AYMA 4JV0A 4OI1A 2YWFA 4JI3F 1KONA 3V81A 5E41A 2IFXA 3DLLQ 4K0KF 2CPXA 1RHMB 3BSNA 2DY9A 1T11A 4OJHA 4BS2A 1Q7LB 3I0RB 1SH3A 3RBEA 1H2VZ 4HLBA 4LFAJ 4USUA 4YR3A 4FYDA 2L08A 1ZBTA 1KVJA 3IS9B 2AJ0A 1VRUB 2BQUA 1KEKA 1KQSR 4BDPA 2XMMA 3S6EA 4A8YA 3FEYB 4OZJA 2N4CA 2UP1A 4CNYA 3CCTA 4KGZB 1CS4B 4PCQA 2WVBA 3KTQA 3MM9A 4KT0C 1FKOA 2KDOA 2ZZTA 1RWMB 3AJ1A 2EEYA 4LF1A 4DLEA 1D8ZA 1Q95G 3BEGB 4CT9A 4F4KA 2ZWOA 3PW7A 4DV6F 1DLOB 3PX0A 1YK9A 4OI0A 4KBIA 2X7IA 4WKYA 4EFAC 4L73A 2CRLA 4DQQA 1DAXA 1ZM3A 3SDEB 3H5YA 1YI2S 2OD4A 2V34A 3FJ2A 5CD4A 2QLJB 3B78A 2FY1A 3KHGA 5L9NA 4KO0B 1W25A 2J9CA 4DR7J 3W2VA 2EI5A 1NLKL 1GTHA 2HWIA 5B0GA 3KMQA 4CTAA 5HP1A 1EB0A 1MWQA 3LWMA 4TU7A 3LGHA 1S99A 2A10A 3SZ2A 4OZ0A 4OFZA 1VS3A 1PYSB 1JLCB 4PWUA 4A8XA 1LK7A 4DFMA 4TQRA 1E6YB 2B5JA 3A8JA 1ITPA 1S9FA 2G2YA 2LQ5A 2E5LJ 2C2ZB 1FNOA 4PWWA 1NPPA 3HVTA 3AD7C 3KUEA 4RW8A 4JBCA 2XM3A 3M8WA 1GX5A 2JOQA 2P9CA 1TAQA 2BANB 1SJ4P 3OT9A 4IOAQ 1WI8A 2HGLA 3BF4A 1LQ9A 5CYQB 2OJ3A 3RJMB 1PILA 1BD6A 4NLGA 4NZ7A 4HH1A 4PZVA 1UKUA 3JAMY 3OJSA 1QTMA 1ZM4A 1HNWF 2DGQA 3WIVA 4DSFA 4CLFA 3P5BP 3DLJA 1EETA 4IO9Q 3ITHB 1NSAA 4H4MB 1URRA 2HGMA 2RNEA 2W2QP 2IC3A 4WFAQ 3J80Y 2HKEA 4GC6A 1TL4A 4DL0C 4M5GA 4WK1A 4CZCA 2R2TA 1R8PA 3KJFB 1E6VB 1VC5A 3HSZA 1S9GB 1X5OA 4DZ6A 3F41A 4IDKB 4F3QA 1N0UA 3MUTP 2RH3A 3THVA 4I2QA 5D0RA 2PEBA 1NH8A 1HPZB 1X9WA 3E51A 4YB1P 4F4XA 1FWLA 3D66A 3I0SB 2HHHJ 4FF2A 3CCMS 2W1BA 3M9OB 5A76A 1TZ0A 4ED6A 1WG1A 1JLGA 3KFWX 1C4CA 1RGVA 1WEYA 4RBVA 1JXLA 4I56A 4MFBA 1C0UA 3A8IA 5KG7A 2K7KA 1PAEX 4IH7A 5J1PA 1FRIA 3PRBA 2JNJA 3ET6B 1W2IA 1HD1A 4O44A 3AHPA 2MZQA 1XMOJ 4B9SA 1ACMB 2QSFA 4L72B 4M5IA 2DVIA 3UNGC 4C2MA 1R8AA 1WC5A 4DV7J 1RHJB 2AJ2A 1I1GA 3FK4A 4ZP6A 4KE5A 4DOZA 2AJFE 1F2HA 2XZDB 3TX8A 2V5HG 2IPOB 4P10A 5C25B 3FEZA 5ETTA 3AD9C 2UUAJ 3IGVA 5LXYA 4ENOA 1NEEA 4DDFA 1RDRA 2WVEA 1UJ4A 5A8KA 1A0OB 5E3CA 2NS1B 3T6BA 2DEJA 2CA9A 2IDLA 2ZE2A 2Q79A 1TL3B 1X4FA 2GGPB 2J7WA 4C3LA 1HWUA 3QGGA 4KY3A 3SCKE 3H40A 4LF5J 2FQQB 1U1PA 2R7XA 3AXMA 4CO3A 5F9NA 4ETZA 2FVSA 1JJHA 3C3LA 1S6QB 4PG8A 4Q5VA 3M8PA 3RBXA 5KG1A 4GKKF 3QWUA 1HBNA 3PZPA 3RW6A 3BKUA 2NYHA 2IM2A 5GAEI 1C0TB 4NXNF 1Y10A 2E7VA 1R31A 4OZLA 1TL7B 1YJVA 3ZZRA 3F44A 3W9IA 3MM6A 1RTDA 1RJJA 3FCWA 1T9YA 3EE3A 1KQGB 4NWBA 2XS7A 2FJAB 1H3DA 4LIWA 2H5IB 1CQMA 3Q23A 3BQ2A 3GJRB 3DHXA 3I0RA 3M8RA 2QJ3A 1IM6A 4J37A 4K59A 3BZQA 3FRYA 3PDNA 1YQHA 5KT5A 3IS9A 5DZ6A 1JIHA 1Q16B 5FLXU 4HTIA 3PG9A 3G82B 2CQ2A 4JOUA 3U1NA 1FHTA 3IG1B 1CS4A 2DPIA 3ZZOA 1UVNA 4PPDA 3UDEA 4C4WA 3FBEA 1D09B 4CO5A 4ANEA 5LMNJ 4J9VA 5AE3A 2KG1A 4JI1F 1ZOTA 3LALA 3J7ZT 3TAQA 4KB7A 3PJWA 3CE8A 5C42B 3K7RA 4DSKA 1DLOA 2VZ9A 2ASYA 4CLWA 2IIHA 1TV6B 3OL7A 3SDEA 3FKBA 1C1BA 1DURA 3W5YA 3H2UB 4M63A 4IH5A 1R8CA 2AMCB 4XTTA 2ILYA 5HQLA 1U0SA 3Q22A 4KO0A 3OLBA 2VPZB 2B43A 3MI7X 1F5BA 2ZOMA 4RO0A 1RT7B 2IY5B 1FTRA 4QYRA 1DFDA 1SQGA 2P6SA 2PMWA 5AJ3F 2NXCA 1VLOA 3OR2B 3B4DA 1P27B 2FJEB 4A46A 1JLCA 4LFBF 2R8IA 2HQCA 3RW7A 3NNHA 3HO1A 2HFOA 1E6YA 4NLVA 1XR7A 3FUYA 1AB8A 2FC8A 4ZMMA 3OVBA 2MZJA 1GXTA 5HLFB 2UVUA 2FHOB 2NZ4A 4ELVA 1BXNA 4QWEA 2Y0BB 2IAJB 4AL7A 2J7UA 2KM8B 2YKPA 3FSXA 2R7TA 1QAYA 4OX7A 4O3SA 3ICLA 3T41A 4QCLA 3DOLB 4CRJA 3SSQA 3CD5A 2RDJA 5KFGA 2BANA 1QDUB 4L3NA 1IR1A 1KOHA 2MKSA 3VTIA 3NAHA 5CYQA 2MHNA 2MQNA 2C2NA 2CJYB 2PA3A 3V6DA 1S76D 1RADB 2XMAA 1BQMB 4UQGA 3EGZA 2ZITA 5LJ5Y 4NLQA 4CYUB 3PW5A 5EN1A 2H48B 2GIQA 2ASLA 3T3FA 4C8MA 3VVTA 5AXNA 4OLPA 4X4SA 1MWZA 3GWCA 2KZZA 2XHCA 3CO9A 3ITHA 4H4MA 1N54B 1F1BB 4K4YA 2DIUA 5KG0A 1K9MT 1TU0B 4DL5A 4LRAA 1M5SA 1E6VA 8AT1B 2RB7A 1CULB 1S9GA 2CNKB 2V68A 2WW4A 4ZVOB 1HNVB 1N48A 4IDKA 4AXIA 9ATCB 3FZ2A 5KAKA 4ZVSB 2JLFA 2QL5B 2AEMA 5A6PA 1REVB 2MKIA 4HKQA 1HPZA 3KK2B 1A9NB 3I0SA 1GMWD 4P73A 4DL4A 4QZVB 4ZPAA 3IBFB 2MB0B 3Q2SC 3CCUS 2HMIB 4KPYA 1LW2B 1R6VA 1H38A 1YTYA 2FGCA 3OXFA 1SPBP 2C2KB 3U27A 3ET6A 1WKJA 4GO5X 1GXUA 3RAQA 3S01A 3HT0A 2R4FA 2D9PA 3MAAB 4DV1J 5BR8F 3CULA 5L9XA 3M2VB 5CH7B 3FC9A 2PMHA 1LW0B 4FVCA 2ALYB 5M2PA 3EZ5A 1T9VA 2W2MP 3I31A 2DGOA 4HI2A 2VFUA 5C25A 3LO3A 1FEEA 3Q8SB 4J5OA 4F4WA 2W25A 1F9EB 2CPHA 4QOTA 2MZTA 1R7IA 3GE9A 1RAJA 1TL3A 4MYUA 4I6YA 3UWTA 4DFPA 3KUHA 2GGPA 2CJXB 2BRLA 3OTBA 1VIXA 2BW7A 3HZGA 3TZWA 2ERRA 3CD7A 2U2FA 2BA9A 1FXLA 1S6QA 4RWWA 3UCGA 2J0QD 5CYMB 3GJQB 3N28A 2AP6A 3E2EA 2R2SA 1UW4A 2ZKUA 1HR0F 2J0SD 1NKEA 1C0TA 2IM1A 3HX9A 5F41A 1TL7A 2XO7A 4Q2MA 1N5VA 4URGA 2JZ5A 1R89A 4X2BA 5LSRA 2UU9J 2M0GB 4P6QA 3IC1A 4FXWA 2R7SA 2CPEA 3MMCB 2M7SA 5A8WB 2RS2A 3QRQA 1HBUB 2F9DA 3HDSA 3CJ2A 1RXOB 2EWHA 5LSOA 2GZOA 1PJ5A 2E5HA 2MKKA 2O3DA 1JLBB 4ZVEA 4X62F 4ECYA 4K8RA 3JTOA 3UD4P 4J9OA 2UV8A 1GNKA 3MAQA 1HMVB 5E5NA 1VISA 1TL5A 2RAQA 4Y65A 4EBEA 4PG7A 2B6AB 3NS7B 3KDNA 3HXMA 4J9NA 1R8HA 3KJVA 3G82A 1RLCL 3OFHA 5F0WA 3T1YJ 4UOCA 2VFSA 1TAUA 4LQ3A 3MR5A 2V9WA 3IG1A 4DPOA 3VAHA 3D0IE 2BXJA 5F3ZA 3A3NB 4DR3J 3GFHA 4RUBA 3MPUB 4Y2CA 4QYZK 4M94A 4KGMA 1SUQB 4A8WA 5C42A 4NX9A 1WEZA 3EYZA 2G0JA 3H20A 4DV7F 4NXMJ 4IFYA 2W2OP 4ZPBA 1TV6A 3R1LA 2UXBJ 2KKHA 2VPWB 1WELA 1SC4B 4ZPVR 3M8YA 1ZPWX 1BUXA 4OI4A 2PA8D 3HK2A 4CH0S 2FLLA 2KJVA 3IA0A 4DV4J 3KLVA 3KK3B 3ZXWA 4J9LA 4AUKA 4LBIA 1N52B 1RT7A 1G1XA 3M6UA 1TKZB 1F60B 4LF5F 1YDLA 1FFWB 3OR2A 4YOEA 3NEKA 1Y11A 5KFUA 2QIFA 1CJKB 3CUNA 2P5VA 4CT8A 5DETA 4UUWA 2VASA 1GQEA 3MWBA 4D3HA 2CIMA 2J0XA 1FWKA 3OFFA 4J9UE 5HLFA 2DKOB 2B9EA 4QYZJ 3C14B 2XWXA 2NPFA 3US5A 4XDCA 2IAJA 1X7VA 4KGKA 5K14B 4PRFA 3JQJA 4NLOA 3CJKB 3DOLA 3IO1A 2G4BA 4DSJA 1X60A 5J2NB 1NJWA 3LW5C 4RUHA 2HRTA 4OV6A 2C2MB 1YIJS 2DB1A 1EAYC 2M3DA 3KHLA 1VHIA 1IBMJ 3J81j 4G1IA 3R27A 4ZVQB 3R5AA 1GMUA 5L1KA 2FJWA 5IOLA 4ES3A 4LF9J 1G7CB 4Z7CA 4CYUA 3MGJA 2YX7A 3PR5B 1VR6A 3SBMA 4QQBA 2BJ3A 8ATCB 1K73T 1M1KT 4TU9A 1EHWA 3PRDA 4DV3F 2HK3A 1PJ7A 3ENVA 2LFVA 5E3PA 2BE9B 5BYSA 4ZP8A 1KKHA 4DJBA 3FNNA 1PSDA 3KJQB 4DR5J 1F3VA 5E33A 2HW3A 2H1YA 4C98A 1CULA 1RCXB 3NGTA 3W66A 3L3CA 2VQEF 1TFWA 1AT1B 3QRPA 4AYBD 1C2PA 4M5LA 4YY3F 3NGDA 4G65A 3WDOA 1JNZB 1REVA 4DI6A 2CPIA 2XYHB 3BQ0A 3KK2A 2NLWA 5K8OA 4XDDA 2HVHA 5CZXA 1UWAA 1RTHB 3Q8YA 2QYCA 1CBKA 4KH0B 1LWXA 4J9RA 1GMWA 1TK0A 1BQNB 3SYZA 4ALZA 1UETA 3FMWA 2HMIA 4CDIA 1LW2A 4RU9A 1H0HB 2UXCF 4DCJB 4NMLA 3T1HF 2CQCA 4UZCA 2QZ8A 1RWOB 1A6LA 2A6MA 3CO0P 3D2WA 2BRKA 2J9DA 3MAAA 2O1PA 2JEJA 4O3RA 3M2VA 1VBYA 1LW0A 3JSRA 2XLIA 1YZ6A 5IZHA 1JXVA 1B3TA 2OMOA 4Y28C 2GHPA 4M5MA 3ILLA 3HJFA 3G96A 4RX6A 3CMES 3ISNC 2DCLA 2LEPA 3O6QA 2O67A 3GFYA 2DNNA 3EZOA 3Q86A 3K57A 4HI1A 4C3KA 1CJVB 1RU2A 1T03B 4W90B 2HQIA 4ZVTB 3GU0A 1X5TA 3VQTA 1VFJA 5B0FA 3UE2A 1KFDA 1TUWA 5CYMA 2FUG9 1FT8A 4DV0J 4YUDA 2EK1A 5DDQC 3UNYA 4OZ1A 2WOMB 2UXDF 3EGNA 2CAJA 4ETXA 2W4DA 1S1VA 3V6JA 3KHHA 1UEUA 4ZVUB 2BVZA 3U1MA 5EX3A 3KG1A 2B9YA 3HF5A 5C24B 3NGSA 3MMCA 3BR8A 5A8WA 1H74A 1R27B 3R97A 3EDRB 1HBUA 3QSIA 3A3OB 2HHWA 4B3SJ 2DCUB 2IMOA 1KRPA 2CQ4A 1JK9B 2OPRB 4I6WA 2DGVA 2XI3A 4QPXA 4OJ3A 5KFHA 2EXUA 3UR0A 1JLBA 5A8RB 4OX6A 3E8OA 2QGFB 4DPYA 5KG2A 5EWEA 4OX8A 1RCOB 4UY85 1Q82T 1IM4A 2QSWA 3D1HA 2CPZA 1DQ8A 1HMVA 2F1FA 3DGPB 1NNDA 2B6AA 2H9ZA 1WHXA 4OI2A 5CYJA 1HNZJ 2V8PA 2ZH6A 5J2QB 5LMUJ 4LVOP 3FQLA 1KR4A 4ED4A 3DU6A 1UTAA 5DDRC 1YRTA 2BE2B 2ILZA 4JV1A 1IKYB 4G1PA 4OHZA 1S1UB 1SUQA 1OPZA 4NYZA 1L3TA 3BGRB 4MIWA 3FDSA 2ZVIA 1KOOA 4H4KA 4R25A 1W2BR 4B9UA 2ZZMA 2ATLA 2OEKA 2ZH9A 4P52A 2CKWA 4OZ5A 3VHQA 3QIPB 1UFWA 1BWEA 5KOWA 2AGQA 1Q78A 4U7UD 3TZZA 1Y5NB 5T14A 1XNQJ 4V19X 1EZZB 4Q8FA 4YEAA 3KK3A 1N5YB 4X66F 2FVQA 4ECRA 2OGUA 4MMOA 3K2YA 4K2XA 1TKZA 3FGVA 2CJAA 3K89A 4ICLB 1PAUB 2QX0A 5DDPC 1B0PA 1CJKA 1R0BG 1ZPVA 1PIEA 1VMBA 5CHCB 4FS2A 2IYGA 2AGOA 2YWKA 2PT0A 2CG8A 1B99A 2BKNA 4YB6A 2XWYA 3EXYA 1QAJA 5J2MB 3GZ7A 1KVIA 2E9RX 3C14A 3GP9A 3RB0A 2MDAA 2I38A 2Y1JA 1VQ8S 1X4CA 2VH7A 5K14A 4LF6J 4OL8A 3KDOA 4P2SA 1FESA 2R2RA 3CJKA 3I6PA 2M88A 2BBEA 5J2NA 3MM7B 2B4OA 2ZBRA 3HHEA 4ZA1A 4FPIA 2PSZA 4NCGB 2BJ7A 5GMEA 4ED2A 3J7A1 5IT9Y 2ZM6F 2OD6A 1S12A 1VI7A 2Q66A 2DHHA 4IG0B 2B9WA 5GVQA 4KIAA 4XAKA 2NXEA 4O3QA 2ZHBA 3N9UC 5M2RA 4V19J 4LFCF 1APSA 1FRXA 4CLLA 1TK5A 1N33J 2BOPA 5JVHQ 2JEIA 5IM0B 4UTGA 1OYDA 3PHTA 4DR3F 4K4SA 4U8YA 4RUCA 3NXZA 4HTJA 4LF4J 4QR2A 2VF3A 5E3QA 2AEJA 4GO7X 3ENWA 3MR7A 1N56A 4ES1A 3BSCA 2DGUA 4HH0A 1SXLA 3CJ8A 5D77A 2UXBF 3G87A 3OR1B 4BBYA 1RTHA 1BQNA 1S7HA 4PAAA 4WIIA 3I9V9 5C5JA 2BJDA 1B7YB 2ZBQA 1U8WA 4F2RA 2JX2A 1XWLA 4EZ9A 1SH0A 2WCXA 3BN4A 3PY8A 2E1RA 2ROGA 3QQCD 4EMDA 1JLQB 1S1WB 1N5QA 2RE1A 3CJ4A 4ES2A 1FX2A 1T05B 2KZMA 1X0PA 2M8DB 4M8LA 4H4KC 2V94A 2YKMB 2RSQA 2ZWPA 4KRWA 4OX9F 3D6MB 3BH6B 4KV8B 2YWHA 2V69A 3TQ1A 3CJQA 2KFYA 1FD8A 1K1QA 4L6V3 3OUYB 1TK8A 3VAGA 1UWBB 5EWFA 2MQ8A 2X51A 3IP0A 4BCAA 3RAMA 3FMBA 2BM0A 2YKOA 1FCAA 5GAGI 4DQRA 1CJVA 3CCRS 4U7UK 1S48A 2P9EA 1T03A 3VZIA 1NU4A 3IRXB 2OPSB 2C3YA 1LXJA 5IT4A 1ZTTA 2EC2A 1R43A 3CCWA 1DQ9A 1VK8A 3QYYA 2FC9A 3K58A 1RUSA 3AT1B 3L7UA 4NYPA 2WOMA 3BB5A 5KFFA 2PDAA 2DXDA 3V2UC 2XMTA 3AJ2A 1RB0A 1TVRB 1I94J 5C24A 1R0CB 1Y4ZB 4FZVA 4USKA 2MZSA 5KFKA 2JLGA 2XY5A 3VWSA 4C0OC 1WDTA 2MQQA 4TVAB 5HBMB 2OPRA 4LT6A 1U45A 1X4AA 5A8RA 5T7LB 1FDAA 5B7WA 4WCEQ 4M5NA 3BPDA 2WZ1A 4DV2J 1U02A 2K06A 2DNKA 3Q0AA 7FDRA 1QLNA 5H9FJ 2A2DA 1RKIA 4AL6A 1S6PB 2FYXA 3DGPA 5HVGA 1X4HA 3VR1A 3HZEA 1P6TA 4CQ1A 4MH8A 5J2QA 2D3ZA 3SQOP 3C46A 1IJEB 4OJ1A 3CSKA 2IVFB 1W26A 2BE2A 4F26A 4FDFA 5H9EK 3KLFB 3GMGA 1S1UA 4EYIB 5KFOA 3CCJS 3W8GA 1F9FA 3BGRA 4DL7A 4DUZJ 3RRGA 2J6UA 1IQTA 2ZVSA 2UUTA 3MM8B 4OI3A 2V8VA 1M5HA 2HQDA 2G13A 2CNOB 1LKZA 2MKHA 4KHPF 4HT7A 1SV5B 2HLUA 1OY9A 2HBQB 3QIPA 4CLZA 2G1HA 4FF1A 3KKFA 4CM0A 3PO5A 4WYWA 1SVDA 4URSA 1L5UA 3NWGA 3CD0A 2HQGA 3AH6A 3D7SB 1N5YA 2CG4A 4IUFA 2AHOB 2UVWA 4JI4J 3EVOA 4ICLA 5LSLA 4DUYJ 4PR6A 4LIRA 3C6TB 1MWYA 1FWPA 5KG4A 2U1AA 2EC0A 4N56A 1T3OA 2VC0A 4DV0F 4DR2F 2RQKA 3A3PB 4PABA 2OSRA 3C2PA 5D0GA 4MTPA 1D1UA 3TARA 1LOUA 3PIPQ 2RUGA 1M5OC 3R2CJ 1DTTB 2HFUA 5J2MA 4JV5F 1RAAB 1FI4A 5E2QA 3MEKA 2BYCA 3CCVS 3A13A 2KVQE 3GPAA 4B3SF 1WF0A 1WI6A 4P2XA 3MM7A 4J9MA 4NCGA 3GQCA 2BX6A 1QTNB 4HR2A 2Z8QA 3GCXP 5IV4A 3FEXB 2ADBA 2WONB 4IG0A 1B7FA 3Q89A 4LBHA 3CIZA 1IKVB 2VBXA 4MYTA 4JI5F 1CJUB 2EK6A 1XR5A 3SFGA 1LWCB 2LYVA 2OTJS 1VQOS 1HBOB 3V6KA 3IWXA 3N0VA 3DM2B 3G6VA 4RL1A 4NCBA 1G4CA 3FBFA 3DYAB 4JI8F 2B0GA 3PEHA 4ELUA 3QNWB 4RZRA 3M7VA 5IS2A 2CQ0A 2LQ8A 4F4AA 2R2UA 2VDHA 5IXUA 3OR1A 1S4FA 4C0HA 4A8OA 2C2DA 2VB6A 4JI3J 2XLKA 1DTQB 2X1GA 4PXCA 3GV5B 2F8EX 2EKNA 2M5YA 1GAOA 5A0YB 2V6AA 4DN9A 4K0KJ 3DRYA 3A8KA 5HMXA 1IVZA 3AAWB 3CC4S 4QW9A 2C28A 4YR2A 1JLQA 1S1WA 4TLQA 2VG6B 3K0JA 2RQCA 2J7KA 1T05A 3R9LA 1VOMA 2AWZA 5KFLA 5HVHA 3TWZA 4DL6A 3KWMA 4UQTA 1BWVA 2JVOA 2YKMA 4MAKA 1RU1A 2HVEA 2ZH1A 4KV8A 1HYSB 1HQUB 4EEYA 2Z30B 3D67A 3R1HA 4QPTA 4ZN1A 3OUYA 1UWBA 4LF6F 3ENQA 4M5KA 4E2FB 5I3PA 4HDGA 4P9SA 4DV6J 1UEVA 2P9GA 2BV3A 2G0CA 2I9SA 3IRXA 4OQJA 2OPSA 3CMQA 1WWHA 4RW7B 3BSOA 2HQ3A 1YZ7A 2YKAA 5HI7A 6AT1B 2HHTA 2GO8A 2CPJA 4OZ2A 2DXEA 4U6PA 2YPZA 1U2FA 3CCSS 2A2CA 3FQKA 4CLPA 4N5SA 2HHPA 4B9NA 5DG9A 1TVRA 3TAPA 4FKYA 3ELHA 2VBYA 2GQCA 2K2PA 2IBOA 4L74A 2QA2A 2Z2MA 5HBMA 1VQYA 4QIEA 5K8MA 1S10A 1GT8A 2VD3A 5T7LA 3Q8UA 1SKUB 4DZDA 3SV4A 3J7AN 1DY3A 4B9VA 4PXDA 4WFZA 1LNQA 2QL7B 1O8BA 1S6PA 3NMRA 1RA7A 1FKAF 1YBUA 5KFNA 3MUMP 1N6QA 4O23A 5GADU 2RU9A 2VA2A 2K3IA 2DRAA 1ZTWA 4M1KA 4WTOB 3GR1A 4OJGA 4OZNA 2M70A 1OMSA 3BKFA 4JI7F 1JWWA 3KLFA 3PW4A 2OH2A 2HVDA 1M5KC 3L4BC 3KG4A 2K1RB 3J7YI 4LF7F 3RZAA 1L3KA 2JHEA 2RKIB 1HNWJ 3MM8A 3A1YG 2VBWA 4IOCQ 1SV5A 2HBYB 4QIGA 4X4UA 3PKMA 3UDVA 1SKWA 3MOZA 3MM9B 1JKHB 3K5MA 2R3VA 2FVRA 2PD1A 4DR1F 4AL5A 5I3UB 3N4WA 4YR0A 4JI6F 5IC6B 1RTIB 5KFJA 1PC4A 3TVYA 3MEGB 2OMLA 3OBIA 3LF0A 1OJ4A 2L9WA 2N7CA 4U95A 1O51A 3VAIA 2R7RA 2GCFA 3TJ9A 5KFEA 1BMQB 2YWWA 1NUEA 1H73A 5D4OA 1Q7YT 3ILOA 4QWAA 1DTTA 4O4GB 3QMQA 1WKKA 2XHWA 4OYBA 1L3UA 1I94F 4M5HA 1VQ4S 3NP5A 3SFUA 2R8JA 2E1MC 2C3MA 5L46A 3CMAS 1KFSA 1SI9A 5CXTA 1U25A 2HHUA 1WSVA 2C2OB 1HNXF 2V50A 2WK4A 4LJMA 2Q6CA 4B3MF 1NK0A 3R7SB 1BQXA 1XMQF 2HFVA 1XQIA 1WC3A 1LFPA 3DKDA 2RQ4A 2KG0A 4F50A 4WU2A 4YHHF 3KLHB 1DRZA 2UUCF 3LP1A 4ECVA 2RDDA 3ENAA 1HL6A 2F40A 3QBCA 2E66A 1IKVA 2EFQA 5IQ6A 3CIMA 4OYWA 3DRPB 1CJUA 4NI2B 1LWCA 5B0AA 1HBOA 2XY7A 3DM2A 2CJKA 4JYAF 2NR0A 3BGOP 1Q0NA 1HNIB 2LU1A 4GKKJ 3Q83A 1C4AA 3CJ3A 4NEZA 3M2UA 1JJ2R 2E1AA 4NXNJ 4ZP7A 3BR9A 1WHWA 2DNYA 1NMEB 5F8JA 4D3GA 2W24A 3MOJB 2KTQA 1MMNA 4J91A 4WIQA 3OHBA 3LWLA 1FA0A 1RWUA 2UV8G 4BLGA 1TKDA 1DTQA 4FKXA 1KSPA 2CFXA 5CZVA 4GMKA 1FDNA 5A0YA 2CQPA 2OPQB 4X4TA 1QAIA 2FJVA 1NHVA 3ONQA 2DY1A 4DBQA 4B3RF 6FD1A 4B9MA 3IBCB 2G2ZA 5KFIA 1KBRA 2QFJA 3DLHA 1HBMB 2VG6A 1T94A 2KVIA 2JWNA 1P9YA 2HAFA 2KFZA 4WFYA 1Y0HA 3CJ0A 3HLUA 2OELA 3IR6B 4DV5F 1HYSA 1QVFR 1HQUA 2RU3A 2XS2A 3P8BB 4ZVGA 5ETPA 2I1RA 2KRBA 2N3LA 3WIUA 3CC2S 2LA6A 2VBZA 2DHXA 3I5BA 1SL1A 2AJ4A 5L1JA 1U1QA 3GSDA 3PO4A 4DR4F 2AGPA 2K8GA 2RRNA 4WZQA 4C7QA 1OWXA 1HHQA 1NO8A 4RW7A 5HMWA 1X9MA 1VQ7S 1GEHA 4U8VA 2NUUG 5F8IA 3M6XA 3GB0A 2VFVA 4Q44A 1U2RA 3Q8RB 1NDKA 5BYRA 2VIHA 1IBKF 4A4JA 5C7PA 5CA5A 2P8IA 2KJWA 4ZCLA 2UVVA 1D9DA 1HFEL 5EUHA 5AJ3J 2Q43A 2SXLA 4F02A 2AJQA 4Q43A 2E44A 4IRDA 4LFBJ 4ZDNA 3R5BA 1F5AA 2ZH8A 4C6AA 2NUHA 3ZC4A 2LQJA 4W98A 5HROB 1RTDB 2ZJQQ 5ETRA 2QFIA 3NS6A 3CXCR 3V4IB 2L9DA 2YTCA 2EG2A 1UZDA 2NYIA 4A47A 1X4EA 4B3TF 1JXEA 3O3LA 2DO4A 4B9TA 3PYEA 4I2PB 4FBUA 3AQOA 4DPXA 2B7BB 1X0FA 3BQ1A 1WORA 2VQFJ 2WSFC 2K1RA 4ANDA 2PC6A 2GAGC 1AUSL 4TY9A 2I5JB 2POKA 2RKIA 3OD2A 1ZZNA 5I4MA 4Q0BB 3SEOA 2GIRA 4J9KA 1U1OA 4Z37A 3TA0A 2ZH5A 3IN5A 1TTHB 1HIYA 5B0DA 3TR5A 4CO1A 1JKHA 5LJ3Y 4Y2IA 1RAOA 2NXUA 1CEZA 1SC3B 4XPCA 2EVZA 3MR6A 3GV8B 5I3UA 3D9BA 1RT4B 2Y0SD 3TO8A 2BW2A 1M90T 2E9TA 1RTIA 1NHKL 4UZBA 3MEGA 2DNZA 3WHIA 4EBDA 1KS2A 2LMIA 1C1BB 1G3OA 2DNGA 4CO0A 5ETNA 3ZTRA 1PC5A 1NRKA 4OIXA 1WDDA 2D3UA 2GVDB 1U6ZA 3WC0A 3AOAA 1KLMB 2WBMA 3CCLS 2QLBB 4Z7YA 4O4GA 4Y2MA 4O3OA 3G6ES 4Y3CA 2EFGA 1LV5A 1S1XB 5HN0A 1KP6A 4ZJQA 2D41A 3D3BJ 2D9OA 1A7GE 1KTVA 5G0RB 2LXUA 2Y1IA 3POTB 1NZ8A 3AOBA 4CLUA 2AYGA 4DU7A 2QRRA 2LEBA 4ZVPB 5BR8J 3W9JA 3TYTA 4BHQA 1U24A 3G8QA 4LUBA 1T0TV 4WBFA 3VAFA 2LCWA 5D6GA 1S49A 5ETSA 3KLHA 2VODA 2QEXS 4I69A 2CZ4A 1JNRB 4N76A 5JVGQ 3BKTA 2C3OA 3DRPA 4NI2A 2WSCC 1L3SA 2IM3A 3O8WA 2QL9B 1UVLA 2KT3A 2VPXB 4X65F 4ERDA 3HD2A 3Q2TC 1BLUA 3MM5B 3WC2A 3DCAA 1WC4A 2RMLA 3R6GB 1JLEA 8RUCA 2KH9A 3QGPA 3V6DB 5IC4B 3KHRA 1FEHA 1HNIA 2DHAA 2YQ0A 2R7UA 2CJQA 1HW8A 2X1FA 5CCMA 2DNHA 1HR0J 2VPYB 3MR3A 3BBFA 3T5HA 2PGCA 5C2GA 4DFJA 2DNLA 4JI0F 1U47A 2HS4A 3OTDA 3GV7B 2QTWA 3RGIA 4RW6B 2ATCB 1KNZA 1KLNA 3M9MB 1ZETA 4H54A 1U7LA 2HWHA 3SQGB 2OPQA 3V6HA 4WU3A 4P7VA 1REGX 5ETMA 2MLZA 4KJIA 3WX4A 4FXVA 4ZHRB 2ZBIA 5HATA 2MLYA 4X62J 1JJCB 3HJVA 2HHQA 2VU5A 5HAOA 4HDHA 3RR8A 3SIPB 3T6JA 1HBMA 5RUBA 1QUPA 1X4BA 4YB5A 3JAMU 3DHWC 4V1Ak 2R42A 3BGLA 4F25A 1U0HB 1CQNA 1NK5A 4UOGA 3OSPA 3IM9A 3ZO7A 3RR7A 1XNRJ 3TEGA 5BXIA 4XO0A 1IBLJ 3OVSA 3UDLA 3J80U 2IDEA 4DQIA 3G86A 2M9KA 3IWNC 4Q2LA 1TMJA 2M4MA 1UPPA 2DH8A 1R6YA 4LRFA 2DR7A 4JV2A 5FD1A 2J9DE 3RB3A 3QT8A 3CJTA 4USMA 3D4JA 4MKYA 1ZAVA 1PO6A 3QWPA 2AIRB 5CD4H 3T19A 1WHVA 2OO4A 3UD3P 2CQIA 4J90A 2HURA 4UF4A 1Y3KA 1N5SA 2IA6A 5LL6d 1RSCA 2KRRA 3TUJC 4OYAA 2D3OR 4MKBA 1GMVA 1NZAA 4OYPA 2BDPA 3OTOJ 1YJ9S 3H5SA 1K47A 2KXFA 4WTYA 1VK3A 5ITHA 4I68A 3SSRA 4Z2XA 1NHUA 1S7IA 4DR6F 4RKUC 1XMBA 1T02A 1NKCA 2N4DA 4KH1B 5HROA 2Y8YA 4ILMA 4N8OA 3BH7B 2FPHX 1VCTA 3LGMA 4U67Q 3V4IA 3G6XA 2FZCB 1N88A 2QA1A 2LDYA 3MAHA 3K5NA 4EUVA 4I2PA 1MSWD 3OPKA 5KFTA 3GFXA 1NAQA 5F3TA 2PO4A 2R9LA 1S72S 1Z1ZA 4B08A 1XIQA 2YKNB 1OSDA 4DN0A 1PJ6A 3W2WB 2AQ4A 2ABYA 2CJBA 4X4RA 1XEZA 3I5CA 5E7OB 2I5JA 2QLWA 3TP2A 4K5RA 5KFAA 2CVIA 2W9AA 4Q0BA 3KJVB 3JQKA 2MY8A 4DV3J 3OSNA 3QJJA 2MPUA 3GONA 1YJTA 4LSNB 4USWA 1KQFB 3UFCX 2XYGB 5GAHI 2H4YB 1RT4A 2KYXA 2VQEJ 2OHDA 3RB6A 4YY3J 4IFYB 1HARA 1FE0A 5KFQA 3ILIA 1IKWB 2YNHB 1U2CA 4OZ3A 3JSBA 1YVFA 1DJ0A 1T3NA 3VAKA 2MYFA 4EZ6A 4Y2AA 2GVDA 3HFZB 4LRDA 2ZDPA 4TQSA 1FVSA 3R5GA 2BMBA 1CG2A 1KLMA 2UXCJ 1YKWA 2YNGB 3HD1A 3T1HJ 1OQ3A 1S1XA 2A3JA 2OFGX 3GG1A 1RHRB 5G0RA 3POTA 2V4JB 3N5FA 1KHVA 4WP8A 3GIRA 3TUPA 2CQHA 4DSIA 2AKWB 1SJRA 3KMSA 4ED8A 2K3KA 1HWJA 3MR2A 3AA8A 4AFFA 2KB2A 1N8RT 2FTRA 1S77D 4ELTA 1BY9A 2LP4A 4F36A 1WF1A 4AQYF 2LQBA 3J7Z5 3MM5A 2JJ4D 2F9JA 4ID8A 3BJYA 2Y1LB 2Q6BA 4NE9C 5A2QY 3T5LA 5IWAF 4GKJJ 1HHSA 3RRKA 2VQFF 3CCQS 3MHYA 3GYNA 3GTYX 2XGPA 2HPUA 4NLWA 2VOOA 2VJVA 3H59A 2D74B 1QSLA 2BACA 2UXDJ 4NPOA 3WBZA 5L1LA 1XERA 1V3RA 1RWVB 3BO2A 4C0BA 3SXLA 3JTNA 3NLCA 2AZ1A 3TJ8A 1X4GA 4RW6A 2UUBF 3LH2S 3SQGA 1TMMA 4TYBA 1UW9A 4CLKA 4A8FA 2GQ2A 3HSJA 4ZHRA 1AXQA 1GXLA 3NY0A 2MKJA 5CABA 4S0MA 1RTJB 1P1LA 1VC0A 1K1SA 4RNMA 4LREA 5DZ7A 1FF2A 3VV2B 4DCOB 1N32F 3CCES 1Q5YA 2F4FA 3L9ZA 1U0HA 1VLYA 3OXGA 1R0AB 5D8HB 1UFLA 5DM6Q 2QG9B 1WACA 2F4VF 2MY7A 3AB2B 3UCUP 1MN9A 1H72C 3Q8QB 2HNYB 3CJ5A 3BM7A 3J81Y 1UPMB 6FDRA 3BGFA 2MEWA 3FCHA 4FN5A 1UVJA 2CQGA 4BC9A 3CPWR 1VQ6S 1V9OA 2ROEA 1B0VA 3MECB 4XPEA 4ITSA 2W4PA 4NCAA 4YS2A 3LTOA 4A8QA 5EHHA 3FRZA 3DDKA 1OS5A 1RAGB 3QLHB 1XK8A 3NKYA 2IA0A 1FJCA 4O3NA 4DL3A 5I3QA 2E7WA 4KAIA 3OW2R 1RAFB 1U1LA 5D4NA 1WTBA 1Q81T 1S6UA 4X66J 3OL8A 2FLNA 2AX0A 2NQPA 3C15B 2O01C 2XS5A 1KD1T 3QFHA 4W92B 2X3DA 5EX0A 3TRGA 4LQ9A 1SBRA 5HK4A 3J81U 2DRBA 1FO1A 3TUIC 3MTJA 3CDBA 1UZHA 2NXNA 1CC7A 1Q53A 4X4PA 1MROA 5IT0A 1GFWB 2N82B 1S1VB 1LFWA 2J6SA 2B3TB 2QLXA 3E01B 2AJ1A 5KFYA 3DI6B 1OPIA 1QJHA 2VC1A 3PHEA 4CLYA 1U1MA 2HVIA 2IRXA 1S57A 2ACMA 2VONA 2CZ9A 2XG8A 4ED5A 4K5SA 3I4PA 2XSFA 3A12A 2HZAA 2C3PA 1I51B 2YKNA 2ZM6J 2DNQA 4LF2A 5KT3A 4MJKA 5GAEU 3W2WA 1UVMA 1SKRA 1T9TA 3MMAB 5DG8A 2VDIA 4Y00A 1LK5A 2VA3A 1UL3A 2HBRB 1AW0A 2D69A 5LT5A 2QN6B 4LMZA 2C3UA 4K4XA 4LFCJ 1YJ7A 2HRUA 2EW9A 3ZFVA 1RWNB 3MDFA 1YSJA 2YVSA 1NB7A 1XNRF 3IR5B 4LSNA 4M5JA 4PG6A 1IBLF 3CC7S 4L75A 4K4WA 4DF8A 2AU0A 2J8SA 1BGXT 4M5DB 1SJ3P 4ID5B 4X4OA 3PV8A 2BM1A 5D15A 3TVKA 1V6HA 4ZLJA 3ZZPA 1IKWA 2YNHA 2HFZA 4ZLNA 1U4BA 2VL1A 1YGYA 1YLXA 2B4PA 3LAMA 3LP2B 3OJUA 1YRUA 1P8GA 2ZJPQ 3PEJA 2A18A 4N77A 1FJEB 3R7NB 2AYBA 5U47A 2XSJB 4NLYA 4EGLA 2ZJRQ 2YNGA 3MTKA 2H3EB 3HVWA 1NCLA 5AE1A 4FF3A 1EP4B 3QT6A 1S9EB 1M1HA 1PBAA 4CH7A 3OTOF 2V4JA 3FCVA 2BR0A 3EM1A 2HYIB 3KXDA 4ZK7M 1YRXA 3QO9B 3GCWP 3F0NA 2PMZD 3HKWA 2DR5A 2V2QA 2H4WB 3K5OA 1NH7A 2GQQA 3KLEB 3EX7B 4OX9J 1FRMA 3PRVA 4USTA 5J1EB 4ECQA 4RNFA 4ZVHA 1TQLA 2V8DA 4E98A 4P72A 3THTA 1T9WA 3NAIA 1QUVA 4TKTA 1IBCB 3QAUA 1WKLA 2JLEA 2W7AA 3PFOA 5DJBA 4QJVA 3UN2A 5E3AA 3ETOA 3AA9A 3DGVA 1RWKB 4LSLB 4R8UA 4YDDB 3PVXA 4LRBA 1PYOB 3BBCA 3IMQJ 3W62A 1HQEB 3EVMA 1AYEA 4C97A 1GX6A 4YMEA 3PW0A 3CJSA 2GX8A 3TUZC 2YPYA 3N01A 2AF6A 2CYYA 1ZAWA 2HHXA 2ZNZA 2WVCA 1NJZA 3QT5A 2Z58B 2NCKL 3OVAA 1RAIB 1JLFB 4CO2A 2WB4A 2OFHX 4KFBB 3O1LA 1QSSA 4WE1A 1AFIA 3UN3A 1YJWS 4QW8A 2XMUA 4PYAA 4F4YA 1D9FA 3RAXA 1RTJA 2EG1A 4M95A 3O44A 2GAHC 4RW4B 3H4DA 4N41A 3DLEB 2FLOA 2HHSA 4NLSA 3M6WA 3E3XA 5FIIA 2W8LA 1R0AA 3UI3A 3CEDA 1N4LA 3AB4B 3G6YA 1FKPB 7AT1B 2F65A 4J9PA 3W5XA 5KG3A 2HNYA 4RNHA 3C6UB 5KFSA 1SKSA 5IFMA 4PWDB 1WTFA 1BE4A 3AFGA 1HI8A 2C2RA 4C48A 1RYRA 3MECA 4LF8F 3NOCA 1RP5A 2HZVA 5KFZA 4KHPJ 2E29A 1F3FA 3THPA 2CJ9A 5DGBA 1YJNS 2DGTA 1YBAA 2GJFA 4QWCA 1NXIA 3QLHA 1F0XA 2IJFA 2BJEA 1IUJA 3NG8A 2GW8A 1RT1B 3FSIA 3R5DA 4A8MP 1RAEB 2UZAA 5F8MA 4DEZA 1HKAA 3T1AA 1N36F 3C15A 4YN3B 3VCDA 1IKXB 3OL9A 2RIJA 1ZM2A 2ZHAA 3W64A 4TLRA 4GKJF 1NK7A 4WYLA 4UOFA 3K8VA 4DR2J 4U9RA 3QJLA 2R7WA 2F63A 5ETQA 1FJGJ 2YWGA 1ULRA 5DLFA 1TKXA 3E01A 4JV5J 3SCJE 2RHSB 1V5IB 2KXHA 3DI6A 1IWGA 1YBTA 2XNQA 4B17A 1HW9A 4MK9A 2KM8C 3IR7B 4QBUA 1X9SA 1CLFA 2IM0A 3W8PA 2DTJA 4DS4A 2QYGA 3L7OA 2MGZB 4CP5A 4RJVA 3TVZA 4CH1A 2HSEB 3AJDA 4NLTA 3MMAA 3CDEA 2GFFA 2HAIA 2CQDA 2ZFHA 1NB2A 4HEA9 2OPPB 2H51B 4JI5J 2F7VA 4DWIA 3G2XA 1OO0B 1RWPB 3P4UB 3JSMB 1XJWB 3IBWA 3GFZA 2W7PA 1Q8KA 3SSSA 2NSCA 4JI8J 5ETVA 3EDQB 3D1QA 4EWTA 4M5DA 4ID5A 4HHHA 3TW0A 3I9ZA 3D0HE 2B51A 3DMJA 4KTQA 2GMHA 3VGUA 2AX1A 5ETLA 3KG0A 3L95X 5F8NA 3O5TB 3PIOQ 4OYIA 1ZH5A 2BJ8A 3U1LA 2HS0A 4NMXA 3LP2A 2C2EA 4DL2A 1XN9A 2WW8A 4FNIA 2LU2A 2XGQA 1QE1B 1D8YA 4KHRA 2BE7D 2D1CA 4X4QA 2XSJA 4FS1A 2K7JA 1TUVA 4ZJLA 2F8HA 1VQSA 4LBPA 4FF4A 1EP4A 2ZH4A 4WP9A 1FRLA 1S9EA 1J5OB 1MG7A 5FLXY 3FBCA 5KT2A 3O2IA 3QO9A 1WOSA 3PM9A 4OYMA 4F2SA 3RTVA 2DGXA 1VQ9S 4IFVB 1UVKA 3KLEA 4LR9A 2GHWA 2GO9A 5J1EA 3ULHA 7FD1A 1YWXA 2YX4A 1FNXH 5B09A 2FZGB 1PCAA 3H5XA 1JQGA 5KT6A 4X84A 1S0OA 3H42A 3MPWA 2GC8A 3FVYA 5HL7Q 4LSLA 3GILA 3QIDA 3I87A 3CNQP 1HQEA 2IVMA 2WSEC 2MQLA 4ZP9A 3LAKA 2LA4A 1VRUA 4F8RA 2RDIA 2B8PA 3VGVA 2FGOA 2JEFA 2V2VA 2A6OA 2CQ3A 1DQAA 2HK2A 3K59A 4QWBA 4HL9A 1V5VA 3OFGA 4WFBQ 2CWXA 3TA2A 1B4SA 4JP8A 4QU7A 2JSXA 3I56S 4P7TA 3QPIA 1SJ1A 1JLFA 1YJUA 1RBOB 3T9ZA 2C42A 4KFBA 5D0EA 4LR8A 2BQRA 3KJNB 2BABA 2V8GA 1Q8IA 2BUNA 3JYTB 3W9HA 4BC7A 1I3OB 2ZOGA 2YX1A 3LQVA 3ISND 4PXEA 5ETOA 5K8NA 4A8KA 5IT9U 4RW4A 3VAMA 2GS8A 5HQMA 4KKOB 2LLZA 3DLEA 4DX7A 4EO6A 2ASDA 2DH7A 3G71S 3D3CJ 4K2JA 4ANCA 4UUXA 1V3ZA 4IOBA 1JMTA 1SC1B 2J9EA 2XNRA 4F4ZA 2PI4A 1LWFB 5K8PA 3ADAC 4JI7J 3DDNA 2M2BA 1FKPA 5F8LA 3BO3A 4X64F 4JUZA 3T9NA 4MT1A 3C6UA 2QC3A 4LF7J 3CJRA 4PWDA 2JDJA 4RWXA 2FJBB 1IQZA 1HWIA 1IXKA 2DR8A 4NASA 1S5ZA 2DHGA 3L7PA 3MPYA 3QFWA 3A8EA 3CF5Q 2GJ2A 3NGUA 4FYWB 5HJYA 2Z0GA 3B82A 1KVKA 2G9OA 1Y5IB 4PQAA 3TX0A 4DR1J 1RT1A 3HFVA 1RYSA 5H9FK 5KFBA 2B9XA 2KHDA 3DRXA 1LWEB 4JI6J 3OHAA 3UCZP 5D78A 2Y8WA 1IKXA 1QSYA 2PIIA 4DUTA 1NPKA 1Y5LB 4R0JA 4LFAF 4WFNQ 1IN0A 2V4RA 5KT7A 1U1RA 2YBVA 2JC0A 3AODA 2KHCA 4H4OB 2MTLA 2V63A 2XMVA 1N5TA 2EBGA 3MCOA 1EQ0A 4K4TA 1U48A 5F9LA 3QSYB 2OIHA 4JI2J 4C8NA 2W9CB 3CW2C 2PI5A 3LA0A 1H6KX 1U26A 1AFJA 2AV5A 1FXRA 2CPYA 1EIYB 1J27A 2DJWA 1HNXJ 1EKRA 1VC6A 3AQPA 3R5JB 1AZSB 1D3WA 1WF2A 3TAMB 2G2OA 4B3MJ 2MGZA 5KTQA 1XMQJ 4GRSA 5K20B 1ELOA 5KG6A 2M8HA 4YHHJ 3HP6A 2ZD1B 2UUCJ 3BDEA 2Z57B 4PKDB 1FNMA 3HHKA 5K9FA 2OPPA 1YJRA 4IQXA 4CI0B 4DR7F 1N6QB 5L39A 3QT7A 1EJ7L 3JSMA 3MPDA 3IXQA 3G4SS 4LRCA 4JYAJ 2ZUGA 1S4EA 3MURP 2J8AA 3PCOB 4EBCA 2OTLS 4AXJA 2FHJD 1MMDA 2EFVA 1NJIT 4JB8B 1GK8A 3NWRA 4PUOB 1VJQA 3MUVP 1MW7A 1H2UX 3V4MA 2E5LF 1LXNA 5T41A 4NLDA 3KNGA 1NM2A 5KFDA 2WRMA 4ZPWR 1VIOA 1NBEB 1PG5B 2XTJP 1QE1A 4EK2A 2EFNA 4ZCMA 1W7WA 1T9XA 1WD6A 3JS9A 2GMJA 3MCMA 4B3RJ 1RISA 4ZPTR 3NBPB 1O6XA 2MKCA 2E5IA 3C19A 1J5OA 2CADA 3FSYA 2PEHA 3H2VE 1SJQA 5M2UA 2CZVC 5DRKA 3C66A 4AD6A 4OHVA 1EQMA 3IWLA 4MIBA 4GVBB 4IFVA 1FJGF 4DV5J 1RT2B 3NNCA 3M4XA 3FBBA 1WUUA 4FBTA 1RLDA 2P6TA 2W2NP 3GJSB 1C1CB 1WHYA 4WKRA 2FJXA 2V9KA 5D4PA 4DR4J 3EZUA 2DGSA 1FRJA 3D1OA 3CVKA 1HLWA 3PYFA 2HHHF 1OYEA 1OSCA 2ZHOA 4WZMA 1FD2A 2R7QA 3GIJA 4ECUA 3LP1B 2XULA 1SIWB 4X4VA 3R3TA 3K5LA 1N0VC 4EU0A 2WVDA 1HD0A 3OFEA 1IBKJ 2BJ9A 4AT1B 4ZLLA 5HQ8A 1HI1A 1FERA 3ETMA 3D6FB 2IJRA 1UA0A 4F7VA 1VQNS 3HVAA 3ZNJ1 2DR9A 1XMOF 3CT9A 2GHVC 2BJ1A 4XIUA 2QO3A 3JYTA 4UT4A 4Y6IA 3M2UB 2DEIA 4U7CA 4OYOA 2JEGA 1ZA2B 3DU5A 2FB0A 3SMZA 2I2YA 3QZ7A 3A4TA 4FVMA 2UUAF 3PX6A 4KC5A 4NLUA 1NJXA 1BHNA 1QAXA 4KKOA 1VYAA 1JB0C 4TYAA 2ZEJA 1SIZA 4B3TJ 3DOKB 4QIWD 1TELA 2FD2A 4R5PB 1TP7A 3M1VB 2BZ2A 1LWFA 2VG7B 3DDIA 4I7FB 4GC7A 3HHLD 1Y7PA 2DO0A 3HHLB 3S7RA 1U1KA 2ACYA 1RT6B 1UMJA 3K8WA 2CQ1A 2Z2ZA 4ZCIA 3HHNB 4Y34A 1RWWB 3DC2A 2BQ3A 2QA4G 2DNOA 4CO4A 3M8SA 4P2MA 2KN4A 3MF5A 2CDRB 1OY6A 4PPZA 3I96A 3H4BA 4NRUA 2RVJA 1ICEB 2YNIB 1RA6A 2QT7A 2HGNA 4C3MA 4OHYA 2B7CB 4FNHA 1LWEA 3GJTB 1S1TB 4WWSA 1WC0A 1KTQA 3RBZA 3N6LA 2RHQB 3I4HX 1BQMA 3AOCA 1BC6A 2F8MA 4G6VB 2LQ9A 3M8ZA 4ZVFA 3EGVA 4I67A 1QVGR 3EUNA 1YHQS 4H4OA 3LOUA 3EWGA 1NJYA 4RU2A 3PW2A 4KGVB 1AA1B 1B0TA 3OTEA 3UW1A 5KFMA 2GV1A 2MQMA 3W7BA 4Y2KA 2GNKA 3H98A 4WPAA 5LMNF 1NPRA 3M6VA 2W9CA 1NK6A 1RTZA 5GAGU 3GR0A 1Y00A 2HS3A 2CDQA 2C22A 2DNMA 1HNVA 3GLJA 3RU0A 4NA1A 1M5PC 2EPIA 3D0GE 1AZSA 1VJWA 1PBUA 3TAMA 1S59A 5B0EA 4QIVA 2KI2A 1RBLA 3DOMB 1RI7A 3C8YA 3HVRA 3TZXA 3PKYA 2ZD1A 3OV7A 1N34J 2EFOA 1ZS6A 2DT9A 2Y9HA 4RLEA 2W4CA 2LXIA 3MPVA 1J5EJ 5D4LA 4B02A 5BYQA 4X65J 3CB4A 4C8LA 1H98A 2JC1A 4OMFG 4PEOA 3NCPA 5JMNA 1UAWA 2H65B 5JJBA 2LKZA 2VKRA 5HMZA 2QMXA 3VF0B 2O66A 3R2DJ 5KFXA 4O3PA 2Z56B 2FHJA 2OEJA 4UY8T 2N7YA 3WZ0A 2DXFA 2KU7A 1OY8A 2W9BB 5I42B 2V4QA 4PUOA 4JI0J 1FFSB 2VKZG 4FPRA 3TJAA 1IR0A 2FIUA 1SQEA 2DYAA 2ZOFA 3BYPA 4MK8A 5DDOC 3R6LB 4QR0A 3KLIB 2I6WA 1FX4A 4U96A 3VALA 3NS5A 1P9QC 2E5GA 2NREA 5A6WA 2X1AA 2ZH7A 2NZCA 4RBTA 1AROP 3ZZYA 3OL6A 1MU2B 3NBPA 2RUSA 2QMWA 3MXHP 4ECWA 3KLGB 2LEAA 1DARA 2OUGA 1FJ7A 1VDHA 4F3MA 5ADZA 3CDWA 4P74A 4GVBA 4J9QA 2E1PA 4K4VA 1MNEA 2MJUA 4I6AA 3DXSX 4USVA 3UR3C 1RT2A 3BBBA 1IWAA 3D28A 3N5BA 2AD9A 1M0SA 3LPYA 2VFRA 1UVIA 3NRBA 2XMJA 3I82A 4JI2F 1C1CA 2H54B 2HLTA 5SZTA 4AE5A 2MKYA 1HI0P 1B70B 3JSYA 3L09A 3P45B 2OP5A 3HHDA 3CGIA 4HT5A 4R0EA 2AW0A 3TEHB 3Q8PB 1NDPA 1FXDA 3DRSB 3IFEA 2J76E 3CD6S 1U8SA 4RR5A 3LGNA 1IR2A 5FDLB 1JJ4A 1UFKA 2EBEA 3DRRB 1F9HA 1TR0A 3PNIA 1FTCA 3EPGA 1PGZA 2CUYA 4E0DA 3ZZZA 1SL2A 1VQ5S 3LP0B 1JLEB 4NL5A 4DV1F 1RT5B 5DG7A 3BYRA 2HVZA 2CXEA 5B0CA 1NK4A 1VQKS 4ECSA 4IKAA 3JB9k 4DR6J 1H7XA 5THWA 4CWBA 2XLJA 2JH3A 1PKUA 4NEYA 2V67A 3UVJB 2XCAA 4RBUA 4LSZB 5L8RC 4YFUA 4N7TA 4G3IA 1SB6A 3NCQA 2DR6A 1JLAB 4HACB 4WJBA 1Q5VA 1SC6A 3VQSA 2WTFA 1CJTB 3DXBA 1T8EA 2FVPA 3DOKA 3N79A 3M30B 4IRKA 3TANA 4ECTA 4R5PA 3M1VA 4C9DA 2IMWP 3H2LA 5F0UA 2VG7A 3PJXA 2ZH3A 4I7FA 4FP9A 2APOA 1ZZFA 4F0HA 3BV8A 1FDDA 1D9AA 3HHLA 4NZ6A 1RT6A 4ED1A 2BKOA 2LECA 5F8GA 3OTCA 1YX2A 1SQFA 4IR1A 2UU9F 4ZPCA 1LEOA 4NRTA 5D0HA 2YQ3A 1KQKA 5LOQA 4ECZA 3TNVA 2YNIA 1TUGB 4K50A 2A0FB 3P3DA 2OLWA 3D68A 1T95A 4YQWA 2D3O1 2COLA 4RW9B 1S1TA 3ZNUA 2MXYA 3IRWP 2VUGA 3BO4A 1Q86T 4NLPA 4Y0FA 3ILJA 2JFDA 1K0TA 2EKYA 5JXSA 4IO1A 3NGKA 2EFPA 3PFEA 2VHGA 4XK8C 1O5JA 3KUGA 3T1YF 1RBAA 2FDNA 1HWKA 4N47A 4CNZA 4HYKA 2D7SA 2KFNA 3M8QB 3F56A 4I64A 2XCPA 3G8SA 5CAAA 2MZRA 4OYXA 5C2CA 2GMLA 4BWMA 4ZVRB 4RNOA 1Q4RA 4NXMF 2OI2A 2W8KA 2HWTA 2R8HA 4I1TA 3DOMA 3MEDB 2J5AA 3H5UA 1NDLA 2PN6A 3WX8A 5JUMA 2MSSA 4MK7A 5KT4A 2HQFA 1NKBA 5KG5A 4KHMA 4YB7A 3DLBA 3R5CA 5DLGA 4C8ZA 4J7CA 1KDNA 3T5KA 4I4BA 2NSBA 4DV4F 4DPTA 1ROFA 4ZIWA 4AQYJ 4WXOA 1Z2ZA 5KFVA 1U6BA 1R8BA 5F8HA 1VBZA 1RABB 1MN7A 3AXKA 3D54A 4P71A 2ZC4A 2E1CA 2HIYA 3RG6A 1HQ2A 5IWAJ 2HIQA 3K17A 4LVNP 2FLPA 3TQEA 4CCHA 4PG5A 1Q79A 3M2RB 5L1IA 1K44A 3B8HA 2AYEA 3TOQA 3H8YA 1NSPA 2W9BA 5I42A 1VHFA 1VQMS 2NPIA 5B0BA 4OHWA 3X1LB 1VQPS 4OLOA 3S1TA 2DH9A 4C8YA 3BGUA 2L3MA 2UUBJ 2HNDB 3KLIA 5HANA 1S0NA 2KT5A 4P2FA 1TL1B 2DITA 1Q8LA 3NCRA 5CQGA 5LXRA 2I0XA 3MZIA 4CM2A 1K8AT 3OXLA 1QM9A 1IBMF 1MU2A 1CVJA 2E9ZA 3J7YU 3W60A 3P5TL 5EGYA 4ZCKA 4TU8A 4LF9F 4RPFA 1S97A 3KLGA 3UN5A 1ZYQA 3HHLC 3IM8A 2PFFB 2VFTA 3IAS9 1FE4A 1N32J 5EDWA 1UJ5A 2QMUB 1XC9A 2QLFB 1O0PA 5DS7A 2FZKB 2HBZB 1WJ9A 5GADI 5IQQA 4DR5F 1T9UA 4YP3A 1CPZA 4TN2A 4ZLPA 4PXBA 2F4VJ 4ED3A 1DZ5A 4WK3A 1UCNA 2V2KA 2HNZB 5DM7Q 1KHWA 3M32B 4QU6A 2HG4A 2RT3A 4NOHA 4O0IA 2FY8A 3DRSA 3NOGA 1Z2LA 4K4UA 4Q45A 4G1QB 3SCLE 4ZS6A 4DF4A 4TNOA 4LR7A 5FDLA 2H5EA 1QD1A 1N34F 4USIA 1RZMA 4ZITA 2R7OA 3DRRA 1R3NA 2CWKA 2B4VA 1J5EF 1F2GA 3DLKB 1S0MA 4NA3A 4KPCA 2VV5A 2Z2YB 3I32A 1OQ6A 1X8DA 1SL0A 1X31C 2R8GA 2VICA 3OLAA 1IKYA 3QJPA 3LP0A 4DPWA 2L9NA 3PYDA 3RUBL 4UOHA 2G1DA 3W1YC 3DNCA 1RT5A 4E8UA 3NGRA 3RBDA 4BWJA 1VRTB 4DPUA 2J6TA 4DX6A 2H5JB 3HPOA 4F0KA 1WOOA 2OSQA 2UVRA 3X3UA 4ZKAA 4RUAA 2MZ1A 1RAHB 1U09A 3R7BB 5D3GB 3UVJA 5AE2A 1WNEA 5DO2A 3IAM9 2FHMA 4ZPDA 1JLAA 4HACA 4TXSA 3CWJA 4EO8A 1TKTB 1CJTA 4IR9A 4WF9Q 3M30A 3N6NA 4DQSA 3N6MA 2YY3A 2R8KA 1Q8BA 3DN9A 4PQUB 3G8TA 4WP3A 3SCIE 2A1BA 3OQ2A 2KL8A 2L48A 3H7HB 4GVLA 3MFHA 1V3SA 3VAJA 4KGXB 4MKVA 2DRDA 2ZKTA 1D0EA 3SI8A 5GMDA 3ZZUA 1H2TZ 1RT3B 5H9EJ 2LXFA 3KYLA 5J2PB 3GIKA 2KXNB 1AUDA 2MHEA 4ECXA 4QWDA 2ASJA 4B9LA 3HI9A 3AY0A 2VJUA 3CTRA 3BN7A 5DGAA 2DGWA 1HWLA 2DNRA 3HSDA 3NMAA 2NXJA 3ZZ0A 3KK1B 4CLTA 1S0VA 4C8OA 2J0WA 4RW9A 2XO6A 3EXCX 3HULA 3FFIB 2X3GA 2V0NA 4DX5A 1VRQC 3U02A
chains in the Genus database with same CATH topology
5A0YA 1ZH5A 2CQPA 3U1LA 2HS0A 2OPQB 2O3DA 1JLBB 4ZVEA 4X4TA 3LP2A 2XB2D 4X62F 4ECYA 2C2EA 1QAIA 4DL2A 2M52A 2FJVA 3JTOA 1XN9A 5MLCV 1B64A 1NHVA 2WW8A 2LU2A 3ONQA 4FNIA 2XGQA 3UD4P 5GMKa 4J9OA 1QE1B 4DHVA 4DBQA 1D8YA 2UUWA 5EWGA 4KHRA 2UV8A 2DIVA 4B3RF 1GNKA 6FD1A 3PX4A 2D1CA 4X4QA 4B9MA 5J1NA 2XSJA 2XY6A 3MAQA 5KFIA 3MMBB 4FS1A 1HMVB 2JFKA 5E5NA 1U1NA 1ZAXA 2K7JA 1TUVA 2E7XA 1HNZF 2DBBA 1TL5A 2F8HA 4A48A 2QFJA 2W7OA 3DLHA 4Y65A 1VQSA 5LMUF 1HBMB 4EBEA 3P49B 4KSEB 4PG7A 4FF4A 1EP4A 2B6AB 1T94A 2KVIA 2RJZA 2VG6A 2ZH4A 4J9NA 2YKQA 3HXMA 1FRLA 1R8HA 3KJVA 2HHVA 2JWNA 1S9EA 2XI2A 3OFHA 5F0WA 4I0WA 2IRUA 5IM0A 1J5OB 4UOCA 5AXMA 3M8QA 2KFZA 2VFSA 4WFYA 1Y0HA 4IQMA 4LQ3A 1TAUA 3CJ0A 5FLXY 4FXDA 3MR5A 5KT2A 2V9WA 3O2IA 3IG1A 3HLUA 2QA4S 4DPOA 2RF2B 3VAHA 3D0IE 3IR6B 2ZBCA 2BXJA 3QO9A 4DV5F 5F3ZA 1OIAA 1HYSA 3MEEB 1QVFR 1HQUA 3GFHA 3PM9A 4Y2CA 4F2SA 3RTVA 2DGXA 2RU3A 1VQ9S 2XS2A 4IFVB 5K5MA 1UVKA 4UW2A 2IVYA 4M94A 4ZVGA 4KGMA 3KLEA 1SUQB 3TI0A 4A8WA 2GHWA 2GO9A 2I1RA 5C42A 4NX9A 1WEZA 1RKJA 2KRBA 2N3LA 3EYZA 1G6BA 5J1EA 3ULHA 1DHMA 1F5CA 3H20A 5E3RA 3CC2S 2LA6A 4DV7F 3MEDA 2VBZA 7FD1A 2DHXA 4IFYA 1MROB 3I5BA 1SL1A 1YWXA 2YX4A 2AJ4A 4ZPBA 1TV6A 3R1LA 5L1JA 1U1QA 3GSDA 3PO4A 4DR4F 2RS8A 2AGPA 1VGYA 2K8GA 2KKHA 2VPWB 1FK9B 4EYHB 3HFKA 1FNXH 1WELA 2RRNA 4B3OB 4O4RA 4DS5A 4ZPVR 5B09A 4WZQA 4C7QA 3H5XA 1OWXA 5KT6A 4X84A 4DMZA 2N3OA 1NO8A 1XNQF 1ZPWX 1S0OA 4RW7A 3MPWA 4OI4A 2WHOA 5HMWA 2PA8D 1X9MA 2GC8A 3P96A 2ZH2A 3FVYA 5HL7Q 3H25A 4CH0S 1VQ7S 4LSLA 3HK2A 3GILA 3QIDA 3I87A 2FLLA 2NUUG 2KJVA 1HQEA 2IVMA 2WSEC 3IA0A 2MQLA 5F8IA 3M6XA 3GB0A 3KLVA 3KK3B 2VFVA 1KN6A 2MMYA 4J9LA 4ZP9A 3LAKA 4AUKA 1N52B 2LA4A 1RT7A 1U2RA 1VRUA 2DISA 4Q44A 3Q8RB 5BYRA 4F8RA 1G1XA 3M6UA 2RDIA 1IBKF 1TKZB 1F60B 4LF5F 4A4JA 2FGOA 2JEFA 3QAEA 1J2VA 2LDIA 2CQ3A 5CA5A 2KJWA 1DQAA 4IG3B 4HVZA 3K59A 4ZCLA 4QWBA 4HL9A 3M2RA 3OR2A 4YOEA 2CVEA 2UVVA 1D9DA 3OFGA 5KFUA 4WFBQ 2QIFA 1HFEL 5EUHA 1CSJA 3TA2A 1Q1KA 1S79A 1X5SA 4ATNA 2Q43A 3CUNA 2P5VA 2SXLA 4F02A 2AJQA 4QU7A 4CT8A 3DLGB 5DETA 2JSXA 3I56S 4Q43A 4P7TA 2E44A 1L3VA 4UUWA 2VASA 3QPIA 1GQEA 1SJ1A 4ED0A 1JLFA 3MFIA 1UJ6A 3MWBA 1YJUA 4IRDA 3M9NB 3T9ZA 2C42A 4D3HA 2CIMA 4KFBA 4ZDNA 4K4ZA 2BQRA 2J0XA 2BABA 3R5BA 1MMLA 3OFFA 2V8GA 5SUHA 1Q8IA 1F5AA 1H7WA 5HLFA 2BUNA 4QYZJ 2HNDA 2ZH8A 4NZ0A 2XEXA 2XWXA 3JYTB 2NUHA 2NPFA 2LQJA 1TL1A 3ZC4A 3G9CA 5FJ4A 3US5A 4XDCA 5HROB 4BC7A 2IAJA 2ZOGA 1X7VA 2JVRA 3Q24A 2E5JA 2WAQD 2YX1A 2ZJQQ 4KGKA 5K14B 1RTDB 3IGNA 3LQVA 3I55S 1HHTP 3ISND 4PXEA 4PRFA 3NS6A 4NLOA 3CJKB 3DOLA 3IO1A 5K8NA 3F73A 4A8KA 4DSJA 2G4BA 4DG1B 3CXCR 3MD1A 3V4IB 2L9DA 2YTCA 5J2NB 2YNFB 2EG2A 3LW5C 4RUHA 2NYIA 4RW4A 1NJWA 4A47A 3VAMA 1X4EA 4KKOB 4B3TF 1JXEA 2LLZA 3O3LA 2DO4A 1YIJS 3DLEA 2DB1A 4B9TA 2B4UA 2IJNA 4EO6A 3RRHA 2M3DA 4I2PB 3KHLA 3HT3A 1URNA 2JL9A 2ASDA 2DH7A 4G1IA 3G71S 3R27A 5MAOA 3R5AA 1Y3JA 4UUXA 1NK8A 5L1KA 1V3ZA 4FBUA 4IOBA 1JMTA 2JRSA 2FJWA 5KFRA 3AQOA 4ES3A 2WBRA 2J9EA 1G7CB 4KQZA 2XC9A 2B7BB 2XNRA 1X0FA 3NL0A 3BQ1A 3MGJA 2IBKA 2YX7A 3PR5B 5BJRA 3QZ8A 4F4ZA 2PI4A 1LWFB 1WG4A 5K8PA 2WSFC 1N33F 2K1RA 3DDNA 2M2BA 2PC6A 1FKPA 4QQBA 3CCZA 5F8LA 1K73T 5H1SV 4TU9A 3BO3A 1M1KT 4TY9A 3PRDA 4Q7AA 4X64F 2I5JB 2MQOA 4JUZA 4DV3F 2POKA 2RKIA 3T9NA 3ENVA 5E3PA 2L41A 1ZZNA 4WFXA 2QV6A 3C6UA 5I4MA 4Q0BB 3SEOA 5BYSA 2GIRA 3MMJA 4TY8B 4ZP8A 4J9KA 4DJBA 1U1OA 4PWDA 2JDJA 3FNNA 4RWXA 3NNAA 4LF4F 2FJBB 1PSDA 3VZHA 4Z37A 1IQZA 4USHA 3TA0A 2ZH5A 1HWIA 1IXKA 3IN5A 2HNZA 2ZNYA 5E33A 2DR8A 2DNPA 2DHGA 3UDCA 3L7PA 1RQ0A 3MPYA 2HW3A 1RK8A 3M32A 3A8EA 4C98A 5B0DA 3TR5A 4CO1A 3CF5Q 1JKHA 5LJ3Y 2GJ2A 1GTEA 4Y2IA 2NXUA 3L3CA 2VQEF 4HHJA 1CEZA 4C11B 1TFWA 2Z0GA 4XPCA 2EVZA 2RQMA 3B82A 4AYBD 4DX8H 3MR6A 3GV8B 1C2PA 5I3UA 1S6OA 4YY3F 3NGDA 2G9OA 3BSAA 1RT4B 1Y5IB 4PQAA 2Y0SD 3WDOA 2VG5B 1JNZB 1REVA 3TO8A 2BW2A 2CPIA 3BQ0A 1M90T 1RT1A 4G1QA 2E9TA 1RTIA 3KK2A 3V81B 2NLWA 1RYSA 5K8OA 2GJIA 3MEGA 4XDDA 2HVHA 5CZXA 5KFBA 2B9XA 1RTHB 2DNZA 2KHDA 1LWEB 3DRXA 2QE5A 5HO4A 2QYCA 3OHAA 4EBDA 1KS2A 3UCZP 5D78A 4J9RA 2LMIA 1C1BB 1TK0A 1BQNB 1G3OA 5KFCA 2DNGA 4CO0A 1IKXA 3SYZA 1QSYA 4ALZA 3DLKA 2PIIA 4QR1A 1UETA 2KYZA 3B4MA 2ADCA 1PC5A 1Y5LB 3FMWA 1NRKA 4R0JA 2HMIA 4LFAF 4WFNQ 1LW2A 1UP1A 1IN0A 4RU9A 4OIXA 1H0HB 2V4RA 1Y9OA 5KT7A 1U1RA 5AXLA 2UXCF 2JC0A 3U7JA 4R8UB 4NMLA 3T1HF 2D3UA 4QIFA 2KHCA 2CQCA 1U6FA 1U6ZA 3WC0A 2ALZA 2YH1A 4H4OB 2QZ8A 4CIOA 1KLMB 2WBMA 3CCLS 2XMVA 1N5TA 1A6LA 1SH2A 4O4GA 4Y2MA 2Q3PA 4O3OA 1VRTA 3G6ES 4Y3CA 2EFGA 1LV5A 3D2WA 2EBGA 1S1XB 2BRKA 5HN0A 2J9DA 2D41A 2O1PA 2D9OA 1A7GE 5DQIA 1KTVA 4K4TA 5G0RB 2JEJA 1U48A 2LXUA 2Y1IA 4O3RA 5F9LA 3POTB 3GG0A 3M2VA 5D3GA 1VBYA 1YITS 1LW0A 2OIHA 2AYGA 3JSRA