1QVGR

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qvgR00
1IQTA 2MKKA 2XSFA 2CPIA 2L08A 1AUDA 2KU7A 4ZKAA 3UCGA 3NNHA 1L3KA 2X1GA 2FC8A 2E5HA 2MZTA 2RNEA 1WTBA 2DHXA 1U1LA 1PGZA 3HHNB 2M7SA 2LMIA 3P5TL 2DIUA 3MURP 2DGWA 2O3DA 2WBRA 2KM8B 3CCUS 2DH8A 2RRAA 3NNAA 1YITS 4PRFA 4A8XA 3TO8A 1N52B 2KYXA 2CQBA 2DNLA 1X4AA 1N88A 1WEXA 2XS7A 3FEYB 3CTRA 2CQ3A 3CULA 2DGQA 4WKRA 2DO0A 3CC2S 1YIJS 2DNZA 1A9NB 2ADBA 2NLWA 2M9KA 2RS8A 4OZ1A 5DDQC 2BZ2A 5CYJA 3UD3P 2FY1A 1CVJA 3MUMP 1VQPS 2RT3A 1N54B 3BS9A 1FJ7A 3NMRA 1R8HA 4ERDA 2CQ4A 1X4EA 1FO1A 1U2FA 1P27B 1VQMS 3G96A 2XS2A 2U1AA 5DETA 3CC4S 2RQCA 2DISA 1VQ6S 2J8AA 4TLQA 1G2EA 2MY8A 1FJEB 4YUDA 2OIHA 5GVQA 3R27A 4U67Q 2KI2A 2E5JA 2LKZA 3CF5Q 1RKJA 2B0GA 4WIIA 2LEAA 4YOEA 3G4SS 3FEXB 4FXWA 2MZ1A 1YJ9S 2DK2A 2U2FA 1K73T 2RU3A 2YH1A 2ZJPQ 1VBYA 2JVOA 4OZ0A 2KRBA 3Q2TC 5LSLA 4Y0FA 2CPYA 3CMES 3VAIA 2M2BA 2N82B 3DLLQ 1VC5A 5H1SV 3RW6A 1UFWA 2MZQA 3MUTP 2KM8C 3MDFA 2QFJA 3V4MA 2MQOA 2RVJA 2DGSA 3CXCR 5DDPC 1OWXA 3MXHP 1WI6A 3LQVA 1FT8A 3N9UC 1VQ9S 1VQKS 2LA4A 2X1AA 3J7YU 2A3JA 4CH0S 3G9CA 1R8PA 2LXIA 1ZZFA 4C7QA 3S8SA 2NZ4A 1A7GE 2KT5A 2VONA 2L9WA 3U1LA 1WWHA 1VC0A 1X4BA 2JX2A 2KG1A 2HGMA 2DGUA 2G0CA 2X1BA 4UY8T 1X5SA 1YHQS 1HD1A 1WF1A 1H2VZ 3I56S 3VAHA 4W92B 5ITHA 3L3CA 2G1DA 1DBDA 2KXHA 2FHOB 1W2BR 2V94A 1F9FA 1FNXH 2M8HA 3PIPQ 2AD9A 1U1MA 3CCES 1KQSR 1U1NA 2YWKA 1HL6A 3SXLA 3BEGB 1WEZA 2DNKA 2KRRA 1NU4A 1X4GA 3VF0B 2CJKA 1WELA 1M90T 2MSSA 1SJ3P 2CQGA 3MD3A 5IFMA 2YKAA 1U1RA 4QPTA 1Q81T 5JVGQ 1D8ZA 1KC8T 2HGNA 3HI9A 2KFYA 1OIAA 3MI7X 3UWTA 2CQHA 3P49B 2Q79A 4TU8A 2MKIA 4IOAQ 2KVIA 3JB9k 2MQMA 2ERRA 1URNA 2ADCA 1WG5A 2J0SD 2MQLA 2K8GA 4CH1A 3S6EA 2MYFA 4C4WA 2MKJA 3TP2A 1X5PA 5D78A 1M1KT 1VQNS 2DGVA 4WF9Q 3MOJB 2ZJRQ 2DNOA 2LQ5A 2RS2A 3SDEB 2CQIA 2M52A 3H2VE 5CXTA 2J76E 2RQ4A 2VOOA 2MZJA 1KOOA 4QU6A 2LYVA 2J0QD 1OPIA 2M4MA 3MUVP 4F26A 4TU7A 1U1QA 1FJCA 4CQ1A 4ED5A 1SJ4P 1VQ8S 3CPWR 2JVRA 2E5IA 1H2UX 2PE8A 1NJIT 2SXLA 2RRBA 4LJMA 4LIRA 3BO4A 5HO4A 4WFBQ 1KOHA 2I2YA 5CA5A 1WG4A 2YTCA 5DDRC 1YWXA 1X4DA 2DIVA 3U1MA 2DGOA 1SXLA 3G71S 3UE2A 3IWNC 1VQLS 2OJ3A 3ZZZA 1DRZA 1HA1A 1QVGR 2GHPA 3CCLS 2OTJS 2DB1A 3K0JA 2DNPA 2DGTA 3UCUP 1M5PC 2MJNA 2ZJQQ 1O0PA 4W90B 2CPFA 5LJ5Y 4RU2A 1JMTA 5MLCV 4WFAQ 2CQCA 3VAMA 2QEXS 1FHTA 3S7RA 3CCVS 2CQ1A 2LCWA 2LXUA 3CCJS 3CCQS 2MZSA 2HYIB 3IRWP 2MSTA 4QQBA 2CPZA 1WHWA 2CQDA 1UAWA 1DHMA 2DNQA 3SMZA 3ULHA 5LSOA 1YI2S 2I38A 1K9MT 1X5OA 3LPYA 2G4BA 4IOCQ 4PKDB 1DZ5A 5DM7Q 2X1FA 3CD6S 4CIOA 2JWNA 4Z2XA 1Q86T 5FJ4A 3R1HA 4Y00A 5BJRA 2LEBA 3NS5A 2KH9A 1N8RT 2DITA 1HD0A 4P6QA 3US5A 5GMKa 3THTA 2CPXA 1WEYA 2KXNB 1X4FA 3EGNA 4C0OC 4FXVA 3G8TA 2F9JA 2LA6A 3ZZYA 5DM6Q 2MKSA 2MPUA 2LECA 2OSRA 5GAGU 2MQNA 3S01A 3EX7B 3B4DA 2CPEA 1JJ4A 1UP1A 5LXYA 3MD1A 1BY9A 4F25A 1X4HA 1VQ5S 2AYBA 1ZZNA 2N7CA 3G8SA 4WFNQ 4V19X 1YJNS 4F02A 3CMAS 2VODA 2MJUA 5IM0B 1OO0B 2L41A 1U1PA 2DH7A 3OW2R 2MY7A 5IM0A 3J7ZT 2MZRA 1M5KC 2D3OR 2XB2D 3VALA 2KXFA 1XN9A 1PO6A 2MQQA 1KD1T 3NNCA 1WG1A 5GADU 1Q82T 4EGLA 1UW4A 2MKCA 4TU9A 1SJRA 2M8DB 1P1TA 2YH0A 3Q2SC 5HL7Q 3EGZA 5DDOC 1U6FA 3BO3A 2VOPA 3H2UB 2HZCA 2MB0B 2DNHA 1FXLA 2K3KA 2N3LA 2E5GA 2MXYA 1QVFR 2DNYA 3UCZP 3TYTA 1H6KX 1B7FA 2DHGA 3THPA 1M5OC 2DGXA 5JVHQ 3B4MA 1QM9A 1VC6A 4IUFA 2DH9A 3R1LA 2FPHX 3CCRS 3VAJA 4WCEQ 2KN4A 1S79A 1VBXA 5LJ3Y 2CPJA 1JJHA 5GAEU 2DNGA 1M5VC 1X4CA 1WI8A 2CQ2A 4QU7A 2OSQA 5GAHU 1U1KA 1WF2A 2E44A 1X0FA 4LMZA 1S72S 4BS2A 1WHYA 2OTLS 4M5DB 2GO9A 2XNRA 5LXRA 3G6ES 1Q7YT 3CCSS 3UD4P 2MQPA 3P3DA 4IO9Q 1X5TA 2CPDA 2AYGA 3PIOQ 3DXBA 3VAGA 2PEHA 2HGLA 3D2WA 3NS6A 1VQOS 2DHSA 2MGZA 2UP1A 2CPHA 2F3JA 1WF0A 1K8AT 2XS5A 1WHXA 2MMYA 2M70A 2MGZB 3CCMS 2AYEA 4YB1P 2EVZA 1YJWS 2N3OA 2DNRA 2F9DA 1D9AA 2M0GB 3SDEA 3CUNA 2QA4S 3P6YC 3BO2A 2DHAA 2CQ0A 2KG0A 2DNNA 3VAKA 1WHVA 1H2TZ 4J5OA 2D9PA 2XNQA 1JJ2R 1U1OA 3CC7S 5EN1A 2EK6A 3RW7A 2DNMA 5IQQA 3VAFA 2EK1A 4UQTA 2M88A 1U6BA 3I55S 5D77A 1NO8A 1VQ4S 2BOPA 2CQPA 2DO4A 2FC9A 1VBZA 1RK8A 1SJQA 1VQ7S 2D9OA 1SJFA 1ZH5A 2KHCA 2HVZA 2JRSA 1YTYA 2MHNA 2MKHA 2AYMA 2RUGA 4PR6A
chains in the Genus database with same CATH superfamily
4JV0A 3CCTA 1IQTA 3R7SB 1OMSA 2CPIA 2L08A 1FKPB 1REVA 2BV3A 3CJSA 3ETMA 5FIIA 3R7NB 3OL6A 3TANA 4QR2A 1NK5A 2ZITA 4AXJA 3FUYA 3B54A 2C3UA 4PAAA 1HNIB 4K7QA 4X4QA 5J2QA 3PV8A 3D0HE 3HSGA 3QWUA 3HLUA 4YR3A 2W24A 4ID5A 3CDUA 1DFDA 1UL3A 1JLBB 1WACA 3HHNB 1C0TB 2DXDA 2GMLA 2M7SA 2GV1A 4AD6A 2JFKA 2A6MA 2FJBB 1ZS6A 3MCNA 2VFVA 2O3DA 3Q8UA 1YVFA 5HK4A 1S12A 4B9SA 3KUHA 3AOBA 1HI0P 5KFLA 1R3NA 2DEJA 4HYKA 5HQMA 4DR7F 3BGRB 3TO8A 1JLGA 3ZNUA 3H40A 3MCSA 3PJWA 1L5UA 1TVRA 1UZDA 3FEYB 2CQ3A 1HIYA 4ALZA 1I1GA 1U8WA 3OXFA 4C97A 1RT7A 1X9WA 4RJVA 2ZEJA 3IMQJ 1QAXA 2HURA 4WKRA 3CD5A 3MPWA 3MOZA 1JWWA 2XSJA 3N01A 4GRSA 1S57A 4NMXA 3WDOA 3M30A 3ZZUA 3GG0A 1EJ7L 2DNZA 2KO1A 2EKYA 2IC3B 2M9KA 2RS8A 2V2VA 4HT5A 4OZ1A 2W25A 2YKOA 3N0VA 4USVA 5CYJA 2AGOA 2IM1A 1R0AA 4DR6F 3AB2B 2VICA 4ZPBA 1MROB 2RT3A 3DOKA 3DHXA 5GMDA 7FD1A 4LFAF 2QSFA 1F0XA 1IWGA 3I0RA 4UQGA 5E5NA 4X62J 2A0FB 4O4GA 5CYQA 2R8GA 4LFBF 3DRRA 4X65J 4LSNA 2IPOB 2RQKA 2CRLA 1NEEA 3G96A 3PO4A 1VK8A 5K9FA 3W63A 2Y1IA 2XZWA 5D0HA 5KFTA 5DETA 2EFPA 2DY1A 2DISA 1VQ6S 3W65A 1RHUB 1G2EA 3CWJA 1FJEB 2ZE2B 3QBCA 1FDDA 3OJUA 4LBPA 2OIHA 4MJKA 1GX6A 1V5VA 2LKZA 2OELA 4KGXB 3VGSA 3L9ZA 3TW0A 5A2QU 4MKAA 2FHJD 2W7AA 2E1AA 2QA4G 1S4EA 3G4SS 5F8NA 4PABA 3NGKA 2RE1A 3K5PA 2BE9B 2F7VA 4FXWA 2DK2A 4KFBB 4KO0B 4RWXA 3BSOA 2U2FA 1DARA 3QATA 3BQ2A 1K73T 3ETOA 2RU3A 4X4UA 4ED2A 1VYAA 1UVNA 3MF5A 1JB0C 2R2RA 1FRXA 1RGVA 3FBBA 4RBVA 4K4WA 2HQGA 1D9DA 3DLKB 5HBMA 5HMYA 1U45A 3EJMA 3WIVA 3DRSA 1T0TV 3N5FA 1TKDA 2M2BA 4RL1A 3EYZA 2N82B 1VC5A 1NPPA 1S0MA 4ECSA 1UFWA 1XWLA 2ZHOA 3RW6A 1RUSA 3KLHB 5HBMB 5LOQA 2QA1A 4QR0A 1T8EA 4WFZA 2V5HG 3I5CA 2WOMA 2KZMA 3C6TA 4ELTA 3M2VA 2DGSA 3LW5C 4UZCA 4EFAC 4KPYA 1OWXA 4N76A 1VQ9S 2WONB 2R7WA 1EETA 1JLCB 2JJ4D 2JZ5A 3IO1A 2LA4A 4CO0A 1R6YA 5B0DA 1JKHB 1HYSA 2BM0A 3D1HA 3A8IA 4CLSA 4J9NA 3VVUA 3KLEA 3J7AN 1HQ2A 1G4CA 4X64J 4K50A 5KFYA 2JEIA 1BE4A 5L9XA 3PX0A 4URSA 1R8PA 3LP1A 3V5RA 1H38A 2HLUA 3DXSX 4C2MA 2OPQB 3OSNA 2L9DA 3FK4A 4IDKA 2XLJA 1C0UB 1RHJB 4OYPA 3VCDA 2VONA 2L9WA 3U1LA 2HHTA 5KFAA 1XR5A 1VMBA 2ASYA 3IAS9 2WAQD 3WX4A 1U0HA 2DGUA 2NXJA 3OTDA 3QLHA 2W2OP 4D3HA 3D5MA 4LFBJ 4TN2A 4OJHA 1HHQA 1WC6A 2G2YA 5KFWA 4JI5J 1HD1A 4OZ2A 1HW9A 2FUG9 3M32B 4P7VA 1ZAVA 3FDSA 1YDLA 3TUJC 3MM6A 5ITHA 2G1DA 5D4NA 3L3CA 3O1LA 1W2BR 4Q7AA 1IKVA 1IR1A 4RW4A 2HHVA 2DD8S 3OUYA 4USWA 4OZ3A 3MM6B 4CLFA 2QLFB 3DMJB 1AW0A 4ZVQB 1NLKL 3EGWB 1KQSR 4B3MJ 2ZH2A 2P9CA 2WCXA 1HL6A 3M8QA 4I4BA 4YY3J 1F9EB 2C2EA 1RQ0A 1HLWA 3SXLA 4KHRA 1X4GA 1T11A 3OR2B 2QLXA 3LALA 3VF0B 3OFFA 1WELA 3TJ8A 4QW9A 2CJKA 1RTIA 5EX3A 2P9GA 2RHSB 4DV7F 4WPAA 1M90T 2DXEA 1SJ3P 1VHFA 1N5TA 1FERA 2HRTA 3PEJA 2CQGA 1B99A 2EG2A 3MD3A 3F56A 5DRKA 4PG5A 5A8KB 1DQ8A 4DU8A 3DM2B 5IFMA 2HBRB 3QZ8A 4DL2A 4MIWA 4IG0B 4U7UK 5KG3A 3GV7B 2Z56B 1RACB 2DKOB 2OEMA 1FXRA 8AT1B 2YVSA 2CG4A 3ET6A 3MI7X 3U1NA 4OX6A 2QV6A 3MM9B 1HBOA 2VG5B 1ZPWX 3HHLD 3UO0A 4DFMA 3A8KA 5D8HB 5AXMA 2O5DA 3UWTA 1QSLA 1S10A 3PNIA 4TU8A 4IOAQ 1ZM4A 3BB5A 2CKWA 3M6UA 3HDSA 1TAQA 1DQAA 4ZK7M 2QTWA 2DCUB 4DPUA 1TELA 2QL7B 2NXEA 4A8YA 4R8UB 3E8OA 3MMBB 4PZVA 1HNZF 3RTVA 1DTTB 1YKWA 5JXSA 3E51A 9RUBA 2HNYB 4DV1F 3M6WA 3S6EA 2AIRB 2XMMA 3SYZA 4I67A 2MYFA 2AJ4A 3E2EA 2VG7B 4WU2A 4C4WA 3TA0A 1GFWB 5HATA 3X3UA 3IN5A 2BJ1A 1KLMA 3KHHA 2NXNA 3M4XA 3P96A 5EUHA 1Y0HA 4OJ1A 1FFWB 3MOJB 2ZJRQ 3CJ0A 2QX0A 4JBCA 5DGAA 3GB0A 3HVTA 3SDEB 1EB0A 4JI6F 3OT9A 4HLBA 1XNRF 2V9KA 2IRXA 3FBCA 4LRCA 2CQIA 2M52A 2QO3A 1HWUA 1IM6A 3H90A 3M1VB 4WYLA 5CHCB 4X65F 1C0TA 1KS2A 4TQRA 4NLGA 3MPYA 1KTQA 1FRKA 2DT9A 4JI1F 2W9BA 2VOOA 2R7UA 3OBIA 5HP1B 2JFDA 1RTHB 1RE1B 4EU0A 1RWMB 3GYNA 5DS7A 2W01A 1OPIA 3H25A 1IJEB 2B43A 4YS2A 1QSSA 1Q7LB 2KKHA 2OFHX 1R6VA 5A8RA 4DG1A 1JLFB 4XPCA 4KKOB 2BRKA 4MIBA 1RT5B 5EWFA 4TU7A 3K2YA 4K4TA 1LV5A 1QSYA 1P9QC 3D28A 3NGSA 1O5JA 5AXKA 1SC3B 4CQ1A 5C5JA 3C2PA 2G0JA 5L8RC 1VQ8S 4IFYB 5A8RB 1SQFA 4LR9A 2UV8A 1FJGJ 4Q2LA 1FEEA 1NDPA 5IC6B 2KDOA 2J8SA 2F4VF 2RRBA 2B9YA 4LF9F 3BO4A 4G6VB 1Y5LB 2VDIA 4F0KA 4C6AA 2CZ4A 4WXOA 3DI6A 3KJVB 1RWVB 4LF4J 5HLFA 3CJKB 3V2UC 4J9MA 4ZOSA 2FJEB 2BJ7A 4X66F 1KWMA 3QO9B 2C3OA 4M5NA 4LRBA 3U1MA 3OTOJ 3H4DA 1J5OA 2OJ3A 1LK5A 1HA1A 2B51A 1XJWB 1NK4A 2Z2LA 4NLSA 2GHPA 1RT1A 4HI2A 4QWEA 4DFPA 2FLNA 1RCOB 2NZCA 1NJZA 4ECZA 1N4LA 1DAXA 1N36J 2ZE2A 2HQDA 2C1EB 5KFSA 3J80U 4DR1J 4F04B 2N4DA 4K5SA 4FP9A 2B4UA 4W90B 3IFEA 2E5LF 5M2PA 4X64F 2VKZG 4TNOA 1JMTA 4FN5A 5K20B 4J37A 4OI0A 2GAHC 4WFAQ 3VAMA 1GX5A 1IKXA 2QEXS 4DL4A 3DNCA 1IVZA 1F2HA 2CIMA 1UZHA 1CJUA 1OQ6A 1KONA 2GJFA 2LXUA 3CCQS 1T05A 2MZSA 3BDPA 4HKQA 2GVZA 5KT2A 2MTLA 1LNQA 4TLRA 2UXDJ 2CPZA 2ALYB 4M5KA 5EDWA 4JI6J 3KMQA 2HS4A 1UAWA 1VQYA 3MMCA 4DUZJ 1KEKA 1LQ9A 4PWUA 4ETZA 4F4ZA 3N79A 4LVNP 1HR0F 2IVYA 1LXNA 3G82A 1KSPA 1D8YA 2ZNYA 3OTBA 2YX7A 1TL4A 3OFGA 4ZVUB 4D3GA 4OYAA 4DLEA 4PKDB 5DLFA 3AQPA 4I6AA 3FQKA 4LR8A 3FEZA 1ZTTA 2GC8A 3I4HX 5DM7Q 4LF2A 3AOAA 1DY3A 2X1FA 1IBKF 4RWWA 1U8SA 2V4JA 1S1WB 3PEHA 1KR4A 4ZIWA 3P49B 4KHPF 2G0IA 4Z2XA 2PC6A 3CD7A 3QWPA 4I2PA 1Q53A 3UQSA 4X4PA 3R1HA 2GW8A 4N47A 3T1YJ 1FRHA 1UEKA 2DITA 1N33F 1FX4A 4P6QA 3US5A 2LEPA 1WOOA 4RNNA 3D0IE 2AKWB 1AXQA 1WEYA 2BKOA 2CJXB 2IDEA 2MLXA 2JL9A 3NKYA 1X4FA 5K14A 1ZM9A 1RWPB 3PXGa 3ITHB 2P6TA 4RU9A 1FX2A 4FYDA 4QZVB 1JLEA 3D6MB 4XDCA 2LA6A 1NDKA 4ZVTB 2MKSA 3ZZYA 2B5JB 5DM6Q 1HQEB 4KGZB 3R5JB 1NCLA 4X66J 3HVRA 4OHYA 5AXNA 1RTJA 1T9VA 4ANCA 3UN2A 4QOTA 1IUJA 2OSRA 5KFNA 3EX7B 5D0RA 3J81Y 2CPEA 5J2MA 1JJ4A 4K4VA 3I87A 1HBMB 1XEZA 1X4HA 2VFSA 1SJ1A 1VQ5S 2HKEA 2EC2A 3M2UB 3TVKA 2RDJA 3KLFA 4K4XA 2XY5A 4FVMA 5KFUA 4IH6A 4RW4B 4IG3A 5D4OA 3QJJA 4U8YA 3UD5A 1JNRB 1Z1ZA 3V4IB 1YJNS 2HK2A 3W1YC 3CMAS 4I69A 2KVQE 4NCAA 4HTIA 2XYHB 4C11B 4M5JA 1GK8A 1O6XA 2V34A 3IS9A 1U1PA 2DH7A 4GKJF 4KE5A 4ZLJA 2FZCB 3OVSA 1WC0A 2MY7A 5B0GA 3KLHA 4B3OB 2VF3A 3C16A 4GKKF 3HKZD 2OD4A 2XC9A 3KUGA 1B70B 2MZRA 3M8YA 1TTHB 4DL7A 2KZZA 4Q43A 2LQ8A 2WONA 4KB7A 2Z4PA 1F1BB 4J9RA 1QAIA 2XB2D 1XN9A 2APOA 2HAIA 5I3PA 1CPZA 2EEYA 4IG0A 2ZH4A 4X62F 2PEBA 2C3YA 4ZITA 3QJPA 2VA3A 3ENAA 1GXLA 2ZBPA 4ZP6A 5GADU 4TU9A 3ZTRA 3R97A 1G3OA 2E1RA 3W2WA 1NK8A 3JTPA 4OMFG 3D0GE 2VPXB 5HL7Q 5I42A 2IMOA 2FLOA 1Y5NB 4K2JA 1C0UA 3EGZA 4CZCA 2VOPA 5DJBA 4KHPJ 2HZCA 4PXBA 3UDLA 4DPYA 1Q1KA 1HHSA 3DGPA 3QRPA 1IKYA 1FXLA 2VG6B 3JAMY 3RBEA 1WSRA 5K5MA 1FCAA 2E5GA 5KFEA 3UCZP 4O3NA 4CYUA 6FD1A 4DL5A 3DGPB 2E1MC 3SCIE 3J81j 2AJQA 1B7FA 1BMQB 2EKNA 1U0SA 2DHGA 3M32A 3THPA 2ZDPA 4NWBA 4DV2J 5ETRA 1VC6A 4ETXA 1RBAA 4PWDA 2HWIA 2KB2A 4HVZA 1S9GB 2FPHX 1LFPA 3CJ2A 3VAJA 2DR9A 3EZOA 2KN4A 3TOQA 3DLEA 1S79A 2J9CA 5JJBA 1MMLA 4RW6A 3PR5B 3VGUA 3W9IA 1WC1A 4UOFA 2Q43A 3C66A 3BPDA 2Q6BA 3LGMA 1FI4A 4M8LA 2ZZNA 4TY8B 3HULA 2B6AB 1JJHA 4G1IA 4Y6IA 1IKWA 3A1YG 1UA1A 3PM9A 4DQRA 1X4CA 3RB3A 3BSNA 4RUAA 3TZWA 1RT6A 4KGMA 2OSQA 3DDKA 5GAHU 3IR6B 4IFVA 1Q95G 4TY8A 2E44A 4ZLNA 2BANA 2HHHJ 1BD6A 2G13A 3CD0A 4O23A 3J81U 4N56A 8RUCA 3MGJA 4H4MA 3MCOA 3G6ES 3G6YA 1YBTA 1WKKA 4ZMMA 4KSEB 2ZH5A 2D3O1 3QSIA 1Y00A 1S6QA 3UVJA 2V2ZA 4IO9Q 2MHEA 2NS1B 1JX4A 2YWEA 3JXOA 1AROP 5J2PB 3PIOQ 3OHBA 1RHMB 2PEHA 3H0PA 3ZTOA 4B3RF 2XCAA 2L48A 3MFHA 1GQEA 2NSBA 2DHSA 2MGZA 3GONA 1BLUA 3KYLA 2F3JA 2OEKA 3A3OB 4K5RA 4ZVGA 2B3TB 3QT5A 1K8AT 2OFGX 2HZAA 2ZFHA 3FJ2A 5FD1A 2M70A 5K8PA 4RO0A 2W4PA 3KUEA 4P52A 3MECB 4FPRA 5DZ6A 4YB1P 2MGZB 3CCMS 4PUOA 4CTAB 5BYRA 4NXMF 1ZAXA 4J9VA 4JV2A 2DNRA 1VRTA 3GZ7A 3R7BB 2CA9A 2W9AA 1OJ4A 1D9AA 1NH8A 2HFVA 2M0GB 2R42A 2VPWB 3HVTB 3PG9A 3SDEA 1TUGB 3NOCA 2DHAA 4DR3F 4C48A 3FVYA 4ZPCA 4NI2A 1N34J 1RTZA 4Q0BA 3HSJA 1WHVA 5HJYA 3V6DB 3MWBA 2HFZA 4J5OA 4OJ3A 4F50A 4ICLB 1YRXA 2IM3A 4GO7X 1HBNA 1NHKL 1JJ2R 3WX8A 3PYGA 1AFIA 1H0HB 4M5HA 5AE1A 3A13A 5EN1A 1YK9A 5C42B 3LP0B 3GCWP 3VAFA 2RUSA 2EK1A 3DOLB 2KHDA 2EBGA 4UQTA 3MMCB 3I9V9 3TZYA 2C2RA 5D77A 4FXDA 4FF2A 2HEKA 3A8EA 4WP3A 1U2RA 5F41A 4AQYJ 2EC0A 3BM7A 2ZZMA 1MLAA 1FFGB 5E0OA 2IC3A 4YEAA 4OYMA 3TAMA 2FC9A 3QAUA 1VBZA 2H5JB 1RT2B 1TL1A 2ROGA 3QIPA 2CNLB 3UN5A 1RK8A 2HBQB 1VQ7S 3R5BA 3RBXA 3W9HA 3KLGA 1JLQB 2JSXA 2KHCA 1ZH5A 2WB1D 2IFXA 2MHNA 5F8HA 2RKIA 4DUYJ 1NK6A 2UUCJ 1TL1B 3PYEA 1T9TA 2AYMA 4I2PB 3VAHA 3RBZA 5AE2A 5U47A 2RKIB 2OPPA 3T9NA 3BYRA 3H42A 1AUDA 4Q8EA 1BQMB 4ZKAA 2BRLA 4OHXA 1GNKA 3GMGA 4PQAA 3CJ5A 3PCOB 4RUCA 4JI4J 3C14A 4Y2CA 4ES2A 4MK9A 1RLCL 2MZTA 2RNEA 4LF7F 1WTBA 2DHXA 2GQCA 3FC9A 5D6GA 2AV5A 1U1LA 2NQPA 2LMIA 1NJWA 5HQ8A 4L6V3 4B3RJ 3KK2A 1HQEA 3AA9A 4NLRA 3K89A 2KM8B 2RRAA 4AL5A 4PRFA 4LF6F 1URNA 1RKIA 3NAIA 5IOLA 2FY8A 5HAOA 1S9FA 2IBKA 2RF2A 3VR1A 1N52B 2LQJA 4B3SF 3KG4A 4L3KA 2DNLA 3GFZA 1N88A 1IKXB 1WEXA 4Q5VA 2EFGA 2CADA 2V2KA 3MMJA 5I4MA 2RF2B 4OI6A 4IRDA 3FQLA 2XS7A 2QA2A 2QLJB 3M9MB 2BE2B 4I68A 4OYIA 1HW8A 4ZN3A 2V67A 5J1NA 3Q23A 3JQKA 1B64A 2ZDOA 1NUEA 5L9NA 2CNOB 2H5IB 4FYXB 2JOQA 5C2GA 3CC2S 4XPEA 3V81B 1L3TA 2FY1A 1A9NB 2HWHA 2BE2A 4ATNA 4Z7CA 2NPIA 3DRPB 4WYWA 3MUMP 1IM4A 2B9XA 2MKYA 2QC3A 2BW7A 3BS9A 1BQNB 2K1RB 2HVDA 3M7VA 4N8OA 4AUKA 4CWBA 4EI2A 4IR9A 1FE0A 3CIMA 4LF8J 4NXNF 3NMRA 3NP5A 3OFEA 1KVKA 4WBFA 2VB6A 3W3SA 4XO0A 2GVDA 4OZNA 3T5JA 3H98A 1SQGA 3Q8RB 1UETA 2U1AA 3BKUA 3ICLA 3RAMA 4CLYA 4ECTA 2RQCA 3CC4S 4JV5J 2V6AA 2J8AA 4IO1A 5B0FA 2QZ8A 1W26A 4IDKB 4YUDA 1H3DA 4N8NA 3KK3B 5L38A 1UTAA 2CYYA 2E5JA 2FJAB 2HBZB 2ZKUA 4TY9A 3U7JA 2F1FA 3W60A 3GIKA 4WP9A 4YOEA 2VD3A 2NPFA 2XGQA 4OI1A 3KK3A 5K8OA 2MZ1A 1S76D 1SB6A 1SPBP 4FF4A 4ED0A 1TMJA 1X7VA 4DR1F 1XMOF 1IKYB 4YDXA 4LFAJ 4DPXA 2YH1A 1VBYA 2FVQA 2JVOA 4FDFA 2HHSA 3MEDB 2HS3A 1LW2B 5BYSA 4DEZA 5KFDA 2FJXA 1W7WA 2FGCA 3V6KA 2CPYA 3CMES 1VJQA 3ZTPA 1RT7B 5J2QB 4NLWA 1K0TA 1BWEA 4OZ5A 4DV0J 1ROFA 2AW0A 2MZQA 5CAAA 3PO5A 3I0SB 3D6TB 2KM8C 4PWDB 1NXIA 3H8YA 2RDIA 4DSEA 2QFJA 2UXCF 3V4MA 1RISA 4P71A 2NSCA 3CJRA 3QPIA 3RYLA 4BCAA 4CNZA 5J2NA 3LQVA 1BGXT 3OL7A 4H4KC 2ZUAA 3T6BA 3QGIA 3L4BC 3E01A 1H72C 4CO3A 4CT8A 5A8WA 1RTIB 3IS9B 3QFHA 2X1AA 3CDWA 2RB7A 3BDEA 1J5EF 5J2NB 4PQUB 2B6AA 2V8HA 2YBVA 3D54A 3R3TA 4KC5A 3BJYA 4K4YA 5D3GB 2ASJA 4ZJQA 1LWFA 2BJ9A 4CH0S 5L1JA 1TK8A 4DSLA 1QTMA 2EW9A 3H20A 1TKTA 3GIRA 3IWLA 3EZ5A 3V6HA 1BXNA 1RT3A 4NXMJ 4PQUA 1APSA 1ZZFA 4DQPA 3G2XA 3GQCA 3PDNA 4NZ6A 2R7XA 2HK3A 2YNHB 1A7GE 3IXQA 5FDLA 3FSYA 3MM9A 1X60A 2B9EA 1N34F 1WWHA 1YRTA 2JX2A 2O66A 2QYGA 3ILLA 5C24B 2KG1A 3RRGA 5LSRA 2GA7A 3BGUA 5IC4B 2R7TA 2O67A 2A18A 3KKFA 3W2WB 1F9HA 2H48B 4USUA 1ZM3A 3OLBA 5C24A 1M5SA 1PJ7A 1H2VZ 3QIDA 4DCJB 1UKUA 4WK1A 1FKOA 1WKLA 1FESA 1NSPA 2PO4A 3GFHA 3K5NA 2Z8QA 4OL8A 2XHCA 4I64A 2VG7A 1QJHA 2H65B 4HACA 1S9EA 1EP4A 2XHWA 3Q8VA 2FHOB 2VG6A 1ICEB 2IAJB 5E33A 3ZNJ1 3RB0A 4JI8J 4GKJJ 4O4RA 1F9FA 2QYCA 4J9KA 1RTDB 2UUBF 2RAQA 1U1MA 2GJIA 2R7OA 4DXLA 2ZOFA 3M2VB 2A1BA 1CG2A 1RAHB 3P8BB 4WWSA 4O3QA 3RR7A 3C3LA 1WEZA 2DNKA 4DV6J 5LMNJ 2HG4A 1FRJA 4JI7F 3UI3A 3THVA 3K8VA 2ZBQA 1JKHA 3LAKA 1HYSB 3A3NB 3DLEB 3FCWA 4P9SA 2CNKB 4ICLA 2VQEF 2DR8A 4ZPTR 5HJXA 3LOUA 2LDIA 4M5DA 4UOGA 2XLIA 1Q81T 5JVGQ 1KC8T 2HGNA 4IH5A 3U27A 1S7IA 2OPQA 3C6UA 4ENOA 3GILA 2VU5A 4HEA9 2R7VA 5AT1B 2E9ZA 4XDDA 3M8RA 1SUQA 1UWBB 2E7XA 4IFVB 3PZPA 2J7WA 3VWSA 5F8IA 4ED1A 2Q79A 1GMWA 1AB8A 1E6VB 1HBUA 5I3QA 4FF3A 4JYAF 1EQMA 4AL7A 1B0PA 2ADCA 1WG5A 3HFKA 2J0SD 5J1EA 2R9LA 2Y9HA 1TL3B 4NLQA 2K8GA 1FF2A 5F8LA 1FNOA 2B7CB 1F60B 1JLAA 1NDLA 2PMWA 3KXDA 5DO2A 5HROB 2J6TA 3D3BJ 3P5BP 1CEZA 2FLLA 2MKJA 1TL3A 2Y1RI 3SI8A 3DYAB 1RWKB 3TP2A 1FWPA 4R0JA 4EYIB 3OHAA 1N5YA 2V63A 4DR5J 1RHKB 1VQNS 1RT1B 3SEOA 4WE1B 4PCQA 3RAQA 4PYDA 4AE5A 4LT6A 1SKUB 1N5QA 2YXLA 1Q8BA 1RAFB 5KG7A 3EVMA 5L46A 3I9ZA 4IRKA 2WHOA 4U96A 2HFSA 3HD1A 2ZHBA 3TA2A 3EPGA 4F8RA 2J6UA 2IIHA 4ECRA 4OFZA 3NLCA 1VS3A 4CTAA 3DU6A 3GSIA 2LYVA 3NGDA 3G6VA 1KFSA 4DSKA 2WVDA 3BBBA 4QU6A 2VHGA 4DWIA 1UJ4A 4S0MA 3MUVP 1Q78A 3OL9A 5B0AA 4BC9A 5H9FK 3ENQA 2CXEA 5ETTA 3BGLA 1SJ4P 5CH7B 3QYYA 2O01C 3NS7B 1VK3A 2IJNA 3JSRA 4KV8B 2W4DA 1RCXB 2HIQA 3NY0A 2JVRA 4MFBA 2PE8A 1XMQJ 2LP4A 3J7A1 2SXLA 1XK8A 3MM8B 3G82B 1N32J 4MKBA 4LJMA 2UV8G 4P74A 5HO4A 1S1VB 4WFBQ 2YKNA 5KT7A 2ASDA 5LM7E 4ZHRB 5CA5A 1NM2A 4FYWB 3FZ2A 5KFVA 4JI1J 2YTCA 4JV1A 1DLOB 4DI6A 2XMVA 4RW9B 2G2OA 4K0KF 1UJ6A 2R4FA 1X4DA 5A76A 2EWHA 2IYGA 1SXLA 2BMBA 2HNDA 3UE2A 3G71S 4DV0F 2QN6B 5ETNA 2ZH3A 2XM3A 3PRVA 4HHUA 4LR7A 4NLTA 3GTYX 3X1LB 1PYTA 5H9FJ 1VFJA 4KIAA 2D69A 3TI0A 1TK0A 1TUWA 2DNPA 3JSBA 4ANEA 4DQQA 2MJNA 1O0PA 5KFHA 4O44B 2VC0A 3D1OA 3A3PB 4PPZA 2CPFA 3BF4A 1MMNA 3BGRA 1JLGB 3ISNC 4Y2AA 4R5PA 3M9OB 4RU2A 3MAAA 5MLCV 3HX9A 1SI9A 2PFFB 1LWEA 2RSQA 1FRMA 4NLVA 2EBEA 1YBUA 2CQ1A 2QT7A 1RWOB 2H1YA 4I0WA 4OYWA 2W8KA 4A8QA 3OTOF 1RT5A 1VLYA 2XQCA 1CULA 2MSTA 2JC1A 4DR3J 3AB4B 4KAIA 4KHMA 1NHVA 2ZOMA 2CQDA 3ZXWA 1NK0A 2DNQA 1XBWA 4MKVA 4RX6A 2BYCA 4ZVSB 4F67A 3ENWA 1UEVA 2I38A 2V68A 3V4IA 1D9FA 2YKMB 4DX7A 3E3XA 1K9MT 1N36F 4OYZA 2BDPA 3KG0A 3KHLA 2OPSA 5KFRA 1QTNB 2XG8A 3FSXA 5CZVA 4DPTA 2G4BA 5HLFB 1CC8A 2X51A 4JI8F 4B3OA 3DLBA 4FBTA 3CDBA 1PC4A 4Q8FA 2W9CB 1HQUB 2V8VA 1CQMA 1GXTA 2MLYA 3UR0A 1RYRA 3TVYA 4QJVA 2BM1A 3WBZA 1ACMB 7AT1B 4P2SA 4JI4F 3IC1A 3POTB 2C2KB 4Y00A 5BJRA 1S5ZA 2VC1A 4ED7A 4QWCA 3LTOA 3O44A 4LF7J 2BBEA 4ED4A 1K1SA 1HD0A 3CJ8A 3CSKA 3AH6A 2HIYA 3HXMA 1HNIA 4OX7A 1UMJA 1V5IB 1F5AA 2CPXA 3NWRA 3P45B 3QT7A 3TQEA 1L3VA 4C0OC 2CDQA 3GU0A 4MK7A 4DOZA 1KP6A 2K2PA 3BSCA 4FXVA 4OX9F 4F4XA 2IJFA 4C98A 1Y11A 1O8BA 4KPCA 4JI5F 3KDOA 1RU2A 1QY7A 2WRMA 3KJNB 4CO2A 3PRBA 4F7VA 2R8IA 1M1HA 2ZWPA 5GAGU 2OMLA 2WBMA 2AJ2A 3S01A 3MHYA 3B4DA 4DL0C 2W7OA 3ZZOA 3GIMA 1N56A 4J7CA 5LXYA 4OZLA 1YQHA 2HHUA 3MD1A 1BY9A 1Q79A 3MM7A 3FSIA 4IRCA 2FHKA 2GVZB 2HVIA 3GJSB 4CYUB 2AYBA 4DL6A 1ZZNA 4X4VA 2FJVA 3LWLA 4MYUA 2ILZA 3C6TB 3AAWB 2PMZD 5SZTA 3EVOA 3OQ2A 3KOAA 4YY3F 4F02A 1NH7A 1SBRA 3NCQA 4FYVB 3UPFA 3LAMA 4USMA 1OO0B 2C22A 2YWWA 1R8AA 2UZAA 1KHWA 4ED6A 3MTJA 4OLPA 5HMXA 3CJ4A 1ZA1B 4LFCF 2OEJA 1T3OA 3VZHA 2KYZA 3F0NA 3QGPA 1IKWB 1FA0A 3D1QA 3VALA 2KXFA 4Q44A 3H2LA 1LKZA 5ETOA 2XGPA 2CJ9A 4FS1A 1B0TA 2Y3YA 1EZZB 4NLYA 3T1HJ 2YX1A 2L9NA 2W2NP 2HW3A 2YQ1A 1Q82T 4EGLA 2H54B 5HSPA 2I1RA 2OPRB 4USTA 2M8DB 1P1TA 3MPUB 1UW9A 4ELVA 2YH0A 1R0BG 3CGIA 2XMWA 5ETLA 2B5JA 3D6FB 4F0HA 2Q66A 1S0OA 1GXUA 5J1EB 4FPIA 4DV1J 2MB0B 2KJVA 2DNHA 2J9DE 2BUNA 4X84A 4ZVFA 3TX0A 3D3CJ 4Z37A 5T14A 2V69A 1GMVA 3QT6A 2N3LA 4X4RA 3SCLE 3OVAA 4Q45A 2DNYA 5BYQA 3ILOA 2GNKA 3D66A 3VTIA 4CO5A 4IR1A 3T19A 1U09A 5LT5A 1BC6A 2K06A 4YB7A 1CJTA 1NPKA 2V50A 3NCRA 1M5OC 2DGXA 4K4ZA 1RAIB 1Y10A 1BHNA 4HL9A 1YJVA 4IG3B 2KFNA 3L7UA 4HACB 1HWIA 1TKZB 3FMWA 4B9VA 3QGGA 2WOMB 2CZ9A 1AT1B 4WCEQ 4DV4F 1FKAF 1R31A 1J5EJ 4L72B 2IM0A 1FFSB 3C16B 4NLPA 1TV6B 2F8EX 2HRUA 2LQ9A 4ZPVR 1VCTA 1LOUA 2K7KA 2BQ3A 4I7FB 5CQGA 2CPJA 2YNGA 4FNHA 4I6YA 3KLEB 4WU3A 5GAEU 3ZFVA 4DSJA 1HBNB 2AEJA 2GMHA 3MM5A 1NKEA 2Z2YB 3HVWA 2AHOB 4P2XA 2FVCA 4EWTA 3IG1B 3W5ZA 1F6TA 3EXYA 2JEJA 1NK9A 4LQ3A 2AEFA 4B08A 4LMZA 5HVGA 3R5CA 4BS2A 4EO6A 4Y34A 2OTLS 2CWKA 2GIQA 4KV8A 3BN7A 2FGOA 2V8PA 4WTOB 2RH3A 2Y1LB 5IS2A 1ZPVA 3M6XA 1AUSL 1U0HB 3PHTA 2PA3A 4GMKA 5GADI 2OMOA 3QLHB 3MR3A 1IWAA 3MR5A 5GMEA 1UEUA 2Y8YA 4RPFA 1X5TA 2CPDA 2GHWA 4RNOA 1IBMJ 4URGA 4YFUA 2C2MB 3R8YA 2HGLA 1HI1A 4RW9A 4DPOA 5KT6A 3JSYA 1YZ6A 2DY9A 1OY6A 4NEZA 3CCWA 5M2RA 5T41A 1FRIA 4DS4A 4UT4A 3BN4A 2DEIA 1HWKA 1MWYA 3IGNA 3OUYB 2MMYA 4CDIA 1EKRA 5CYMB 1N5YB 5KT5A 2AYEA 2VBWA 4F2SA 1S77D 1JNZB 1XR6A 1L3UA 2CZVC 2N3OA 5G0RA 3L7OA 1KBRA 5IV3A 1PIEA 3JYTB 4KGKA 3SIPB 3AJ2A 1I94F 2F9DA 3HFVA 5GAEI 5DQGA 5E3RA 2OP5A 3CUNA 2HFNA 3FGVA 4KH1B 3IGVA 2IRYA 2CQ0A 3R6GB 2KG0A 5A6WA 2IDLA 5DQIA 4MT1A 4PXCA 4ER8A 3OVBA 1KTVA 2XNQA 1TAUA 1U1OA 1V9OA 1MWZA 5KFGA 3DM2A 3IRXB 2BA9A 1NSKL 4B9TA 3CVKA 1QE1B 1U25A 3RW7A 3VZIA 2DNMA 2W1BA 5IQQA 4C9DA 1RYSA 1E6YA 3KJFB 1B4SA 2J7UA 3ADAC 3TR5A 4H4MB 2VQEJ 4K2XA 3I55S 3KJVA 1VQ4S 2FZKB 2BABA 2UXBF 1REGX 4DJBA 2F5GA 3MMAB 5JMNA 1IN0A 3QO9A 4I1TA 2ACYA 3QZ7A 1J5OB 3FRZA 3K8WA 2FD2A 2C3MA 1SJQA 2OUGA 3DRPA 2IY5B 1KVJA 2XMJA 2JRSA 1P1LA 1P9YA 3TJAA 1YTYA 3I82A 1FKPA 1REVB 1PKUA 1Y4ZB 3FCHA 3OPKA 1NZAA 1MWQA 4RUHA 1IR0A 1UJ5A 2XMUA 4XAKA 1KLMB 4ZVOB 2NUUG 2XMAA 3FFIB 1CJVB 2FYXA 3M8WA 4LBHA 1FK9B 3MTKA 3EPIA 4B3MF 1RAGB 4BBYA 3NNHA 2PT0A 2X1GA 2FC8A 4LF5F 3U02A 3OFHA 2P6SA 3AFGA 1PGZA 3I96A 1OYDA 4DV7J 2B4VA 2DIUA 2E29A 3TA1A 4WIQA 6AT1B 3L09A 2ACMA 2JNJA 3VQTA 1T05B 3CCUS 1SC1B 4USHA 2ZBIA 1RTHA 2POKA 4HH0A 3NNAA 2YX4A 2VPZB 1DJ0A 1S6OA 4A8XA 3HM9A 4P2FA 2V8GA 1ELOA 1PAUB 1XTZA 3PW2A 4AT1B 1LW2A 3SSRA 5A0YB 1X4AA 4W4MA 4QIFA 2DBBA 4DUYF 5DG8A 2QLWA 2E1PA 1KDNA 2CJAA 2K7JA 1Y3KA 3CTRA 3CULA 2IVMA 3KWMA 1RAJA 2DGQA 2E5LJ 1N32F 5HMWA 5KFOA 3HK2A 1I94J 1GT8A 1SVDA 2HRYA 1VRUA 1T3NA 3JTOA 1KFDA 2FZGB 2HPUA 3H5SA 2WVBA 4UTGA 4ZIVA 3ISZA 2NLWA 4RUBA 4URQU 3K5LA 3UD3P 2ADBA 3AXMA 3C8YA 3SQOP 1B3TA 4DR2F 3CJTA 2A2DA 1VRUB 1VQPS 4AFFA 4TVAB 3ZTSA 1FJ7A 1EARA 4RBUA 2AGPA 4E2FB 3TJ9A 1I3OB 1R8HA 3SBMA 5IXUA 2JLGA 4DQSA 1R0AB 4LF6J 4FF1A 1S48A 1X4EA 1FO1A 1U2FA 3EE3A 4FNIA 4U8VA 1VQMS 4B3SJ 3NMAA 1RZMA 4U9RA 4YDDB 2XS2A 4ZP7A 3RZAA 1NKCA 2OPPB 3GP9A 1M1GA 1BQMA 4JUZA 4MH8A 1D0EA 4F4AA 5GVQA 3POTA 3I5BA 4ZJLA 4U67Q 1T95A 1FE4A 1X9SA 4ZVEA 4USKA 2ASLA 3CF5Q 1RKJA 2RD5C 2N7YA 2WB4A 4WIIA 1VDHA 3GIIA 5J2MB 4JI0F 5CZXA 1GAOA 2J0WA 1HBMA 3AY0A 3Q86A 4R0EA 3BH7B 1YJ9S 4EEYA 3W5XA 2QJ3A 1YBAA 3DLKA 5BXIA 2CDRB 4UZBA 9ATCB 2KRBA 4B17A 2L3MA 4L74A 4RW8A 2FVPA 5LSLA 3Q2TC 1NK7A 1KLNA 3WIUA 5C2CA 3QRRA 2PDAA 1WJ9A 4M5GA 2UVRA 5ETMA 1LXJA 1N48A 1D09B 2GFFA 3DLLQ 2VBZA 3L95X 4RW8B 5F3TA 5H1SV 4JV5F 1TUVA 4CRJA 3QSYB 1NNDA 4FZVA 1N0VC 1TKZA 3MDFA 1C1BA 3SSQA 2MQOA 1FDBA 1W25A 1RHRB 2D1CA 1RAEB 1RI7A 5DDPC 1FT8A 5DLGA 4M5LA 5KFZA 1VQKS 5KAKA 3SSSA 2WVEA 2H4WB 3ONQA 4I6WA 1NB7A 2YNGB 1VR6A 2HQIA 2V4JB 4H4OA 3D6HB 2P2CB 3QGHA 1VHIA 1YX2A 2A3JA 2DTJA 1WC5A 3CO0P 4GO5X 2FDNA 4J90A 3FCVA 4EBEA 4RW7B 4MAKA 2D3UA 4LQ9A 4U95A 5KFQA 4ECQA 3G9CA 1Q8KA 2LXIA 2CG8A 4DX6A 2UUAJ 3S8SA 2NZ4A 3JSMA 1UFLA 1GEHA 2KT5A 4WZQA 1F3FA 2B9WA 5D0GA 4GKKJ 3PX6A 3GG1A 1R8BA 3LP1B 4PWWA 1X4BA 1OSCA 2XYGB 5EWEA 2AU0A 1VC0A 2UXCJ 3M9NB 4TKTA 2KL8A 2VV5A 3LO3A 1S1TB 2G0CA 2X1BA 3DOMA 1UVIA 3AD8C 3VGTA 1X5SA 5F0WA 3ILIA 3PX4A 3J80Y 3ENVA 2AEMA 4OX9J 2WZ1A 4EK2A 5F0UA 1OY8A 4ZP8A 2RIJA 4W92B 1SH0A 3DC2A 2KXHA 2BR0A 1CS4B 1OSDA 1IQZA 3ISND 3FZBA 1HR0J 4UY85 5JUMA 2Y8WA 4F4YA 1CBKA 2QL5B 2M8HA 2JHEA 1U24A 1AFJA 3FRYA 4P2MA 4ZPAA 4PEOA 2VJUA 2YWKA 1U1NA 5E3AA 4C8KA 3W64A 2VKRA 2HQCA 3DRXA 3BEGB 3R5AA 4RNFA 3KK1A 4LFCJ 1I5OB 2W8LA 1N5VA 1NU4A 4A4JA 3TAQA 4E98A 3TQ1A 2LFVA 1FVSA 2R7QA 1T03B 3KK1B 2BW2A 4HDHA 3T1YF 4IQXA 2FQQB 3O5TB 2R3VA 1XIQA 3IA0A 4B9UA 4DS5A 1F2GA 1JJCB 4ZCMA 1HBOB 2VG5A 1FWKA 4QPTA 5T7LA 4EBDA 2QFIA 4CLTA 1WUUA 2BE7D 3KMSA 1NJYA 3GSDA 4QIEA 4AL6A 1E6YB 1OIAA 1SC4B 3IBWA 2KTQA 4AQYF 1Y3JA 1S6QB 4MFBB 3HHDA 4OLOA 1QUVA 4R8UA 2CQHA 2IA6A 3SQGB 5E2QA 3WHIA 4Y2IA 2YQ0A 4ZLLA 2MKIA 4NLXA 4HH1A 2KVIA 3DRYA 4PG7A 2HNYA 4ZA1A 4DDFA 4JP8A 3HPOA 3JB9k 3W9JA 4KBIA 2UU9F 4EBCA 1RXOB 4YN3B 2F40A 1SV5B 2MQLA 1RA6A 3RG6A 4F3QA 1QAYA 1EIYB 4YR0A 1JK9B 2YKQA 3DLGA 1K0VA 3T41A 3GWCA 1QUPA 4F0MA 3PVXA 1MN7A 1S9EB 1T9UA 1Y9OA 2NYIA 1X5PA 3MECA 1M1KT 3ZZPA 2DGVA 5CCLA 3DLGB 1MU2A 5ETVA 5BR8F 4H54A 2IMWP 2PA8D 2WSCC 4DZDA 4DMZA 2DNOA 2XBPA 2UUWA 1XR7A 3M8PB 3RUBL 3EICA 3PACA 4F3MA 3OLAA 1FD8A 2RS2A 5D0EA 1HNWF 1P6TA 1HPZB 3AJ1A 3GFXA 1FD2A 2JLFA 3FMBA 3HCXA 4FVCA 4NI2B 1JLBA 3HT0A 1S1XA 4ITSA 4RW6B 1GTEA 5CXTA 3QRQA 3DLJA 2RQ4A 2MZJA 4JYAJ 3MEEA 1HPZA 4ECWA 4V1Ak 2BJ8A 5G0RB 5CD4H 2E9RX 4DR4F 2J0QD 2M4MA 5L1LA 3DFEA 3TAPA 2GMJA 4F26A 4UUWA 1CQNA 1EKSA 1FJCA 3M6VA 1WDDA 1T9XA 2Y0SD 2BANB 3M8SA 4X2BA 4DSFA 1S6PA 1JXVA 4JI0J 1WOSA 3EDQB 4KKOA 3CDAA 4K4UA 2F63A 5B0CA 1BUXA 2HQFA 3QIPB 2C28A 1Q16B 3KFWX 1NJIT 4CM0A 1IBCB 2J7KA 4ZP9A 4YP3A 1E6VA 4LIRA 3TARA 1RB0A 2H4YB 4Y28C 1WTFA 2RILA 1OYEA 3CEDA 3BH6B 3UVJB 3I32A 4BWMA 4ES1A 5J2PA 1WG4A 1MROA 3DOKB 4UUXA 1H7XA 1VISA 3NXZA 4CLWA 4EZ6A 2XLKA 3BBFA 1FXDA 1U7LA 2DGOA 2DIVA 2ZZTA 4O4GB 4NYPA 3IWNC 1VQLS 4CLLA 3ZZZA 1HWJA 4MTPA 1QVGR 1IBMF 2IYIA 2VBYA 3CCLS 2IA0A 2GJ2A 2PN6A 3W5YA 3NGUA 3C15A 4RKUC 4K59A 3OL8A 4QR1A 2FJDB 4ECXA 4PUOB 3FFIA 1M5PC 3TNVA 1SL1A 3TVZA 2DR6A 4J9OA 4TQSA 3C15B 1VRTB 2ZC3A 3Q8YA 3UN3A 5LJ5Y 1QLNA 2LXFA 4USJC 2ZNZA 3NGTA 4KFBA 4QYZK 1FHTA 3CO9A 4P72A 4K0KJ 2AMCB 2LCWA 4A47A 5B09A 2XULA 1I6JA 2XWXA 3PRDA 1R0CB 2AZ3A 4OX8A 1FRLA 5E7OB 3M2RB 1WHWA 3HVAA 2UXBJ 3G87A 1H73A 1NBEB 4KGVB 5HQLA 1DHMA 5KG5A 3SMZA 1BWVA 1IXKA 4PG6A 5LSOA 1YI2S 1UFKA 1V3RA 3M2RA 5KG6A 5CD4A 2VZ9A 3LPYA 3ZZRA 3R2DJ 4WZMA 1S1VA 2J5AA 2RJZA 4IOCQ 4QWDA 3PY8A 4BDPA 4JB8B 3D7SB 4KJIA 2GAGC 2GVDB 3W8GA 1EETB 1TFYA 1FDAA 4L3NA 1C4CA 4Y65A 4ILLA 2EFVA 3CD6S 2ZVSA 4CIOA 2JWNA 3QAEA 4M94A 2PMHA 4QYZJ 2UVUA 2BKPA 1Q86T 1IBLF 2D7SA 2OD6A 5FJ4A 2FLPA 4YHHJ 3IBFB 2VA2A 4RW7A 2XZDB 2LEBA 4CT9A 2ATLA 1ZBTA 1AA1B 1N8RT 4LF5J 3IAM9 3DRRB 4KH0B 4YMEA 1YZ7A 4KRWA 3BR8A 5LMUF 1S49A 3CNQP 1YLXA 1NHUA 3THTA 4HTJA 4NA2A 4XTTA 3GJRB 3K5OA 3EGNA 2D3ZA 4CI0B 3FBEA 3PW5A 3C46A 1HNVA 2DRDA 4O44A 4CNYA 2J9DA 2F9JA 4ILRA 5THWA 3G8TA 2R7SA 3PFEA 3LA0A 3DGVA 3LGNA 4R5PB 4WK3A 2UVWA 3GR0A 5B08A 1PILA 2FTRA 2MPUA 3OR1A 2LECA 2YNFB 1O51A 1OQ3A 3M8ZA 4Y3CA 4F4WA 3GV8B 3LPEA 2V4QA 4DR7J 2NREA 2HBYB 3MFIA 1U6ZA 4TYAA 6FDRA 1T9YA 2R8HA 3W66A 1CJTB 4V19X 5MAOA 3TEGA 3D67A 1UVJA 3ELHA 2XTJP 2Z2ZA 2AX0A 1R7IA 2XI3A 3OTEA 2R2UA 3UFCX 3DMJA 2VODA 3EM1A 1XNQJ 1NDCA 3E01B 5IM0B 1W2IA 3TZXA 3OW2R 2R2TA 2ZC4A 3OD2A 2LLZA 3P4UB 4CLUA 3TZZA 2CJBA 5M2UA 5IM0A 2UUCF 4PYAA 2AX1A 4JOUA 3RRHA 3IWXA 1MSWD 1M5KC 1CSJA 1RABB 2D3OR 1XERA 1URRA 4YQWA 2W2MP 1PO6A 1QDUB 2V4RA 2FIUA 4WP8A 2MQQA 4C8MA 4IYQA 2HHWA 1IR2A 1JIHA 4J9PA 2F4VJ 1PAEX 4OHZA 1WG1A 4C8OA 1UW4A 2MKCA 3D68A 3GFYA 3R5DA 2BX6A 4NPOA 5G4DA 3BZQA 3IP0A 5HN0A 1WDTA 2B8QA 2AWZA 3JSMB 2ABYA 2CFXA 2P9EA 4WXWA 5DDOC 4OV1A 2OI2A 1U6FA 3Q89A 4G1PA 4B9NA 3KLVA 3MMBA 1SV5A 2ZKTA 2XY6A 1T7PA 2RHQB 5I42B 4N77A 5F8MA 2HHPA 3W61A 3MM7B 1QVFR 1S1TA 3DOMB 3TYTA 2AJ0A 1HNXJ 2I0XA 5C25B 2HNZA 5F8GA 2A6OA 3C19A 1DTQB 2ZH6A 1JXLA 4CLZA 5JVHQ 4ZVHA 4J9QA 4OI2A 1Z2ZA 3T1HF 4IUFA 1WD6A 2XWYA 5KT4A 3GIJA 3B78A 2DH9A 1SL2A 3R1LA 1QAJA 2ILYA 2F65A 3BQ1A 3T5HA 3SCKE 1VQSA 1ZOTA 5HI7A 2UUTA 1YGYA 2YWGA 4NZ0A 3IR7B 4TXSA 5F9NA 4B3TF 5GAHI 5DG9A 1TFWA 5A8WB 3O6QA 5LJ3Y 1U26A 4CLKA 1TKXB 3IBCB 4NA1A 3HT3A 2DNGA 2AT1B 3TUIC 2C2NA 1WI8A 3BREA 4LBIA 5E3CA 4QU7A 3GCXP 4DG1B 3IRXA 1EHWA 1ZAWA 3BPSP 4OV6A 4NMLA 1FTRA 1QE1A 5AE3A 4YR2A 1CLFA 1WF2A 3T5LA 1X0FA 1UCNA 4FKXA 3TX8A 1XNQF 1HBUB 1SIWB 1Q8IA 4YB5A 4JI7J 1RWUA 5FLXY 1Q5VA 3CT9A 4LF1A 4WFYA 2XNRA 1Q7YT 1RADB 4F2RA 3EXCX 4GC6A 4BHQA 2J9EA 2YNIB 4M5IA 1VRQC 3MMAA 2UUAF 1XMOJ 2OGUA 3DI6B 4AYBD 3W62A 4DV4J 3A8JA 3VVTA 4USIA 3DXBA 1FDNA 1H98A 2JC0A 2V0NA 2WSEC 5J1PA 3D2WA 1VQOS 4NCGA 2W2PP 4O0NA 3UDCA 3HSDA 1IBKJ 3A4TA 1EP4B 2CJYB 1DTTA 5AXLA 2QL9B 3UR3C 1RA7A 4A48A 2UP1A 4C8LA 3EDRB 4O3RA 1F5BA 2CPHA 5B7WA 1TL5A 2Z58B 5F3ZA 1AYEA 1OY9A 2XS5A 3PJ9A 1H74A 2CNNB 5B0EA 2JH3A 3FBFA 5GAGI 2ZBRA 3RAXA 2DRAA 2B8PA 2EVZA 3KHGA 2B4PA 2ATCB 5KFXA 5KFMA 1YJWS 2GO8A 3V6DA 5H9EK 2OH2A 1HI8A 4ZCIA 1XC9A 1UVMA 1T94A 1YRUA 4IKAA 2QA4S 2BJEA 4OQJA 1RAAB 2D74B 3CJQA 1F5CA 3BO2A 3KNAA 5KG2A 3R6LB 2VFUA 4NLUA 1NZ8A 2EG1A 3M1VA 4CP5A 4DR5F 1H2TZ 3LP0A 2A10A 4X4TA 5LMUJ 2D9PA 1RLDA 4PXEA 2DJWA 4C0BA 3DOLA 4ZPDA 3I5AA 3R9LA 1SKRA 3CC7S 1IJFB 2ROPA 5HP1A 3HMJG 5A0YA 4W98A 1WNEA 4PPDA 1TVRB 1G7CB 4IOBA 2FVRA 2AD9A 1V6HA 3K5MA 2Z30B 3T3FA 3V6JA 2M88A 1WORA 2EPIA 1HMVA 2OO4A 4NA3A 3NEKA 1UPMB 1SUQB 1DQ9A 1UWBA 2MEWA 2F8HA 5C42A 1N0UA 1NO8A 3PJXA 5IT9Y 3BKTA 2XO7A 3N28A 1JLQA 2CQPA 2DO4A 2C2OB 1C1CB 3OSPA 3F73A 1HMVB 1PSDA 2LDYA 5K14B 4LRFA 4MKYA 2WW8A 1SJFA 1KVIA 2ZH8A 3H7HB 1NAQA 5HROA 3TAMB 1CJKA 3MZIA 2HWTA 2NXUA 4C8ZA 3PR4A 3R2CJ 4ANDA 1X0PA 4NX9A 1PC5A 4GC7A 2HAFA 2WVCA 1T02A 1HNWJ 2IVFB 2MKKA 2XSFA 2UUBJ 2KU7A 3QJLA 1LEOA 4DX8H 3UCGA 3D9BA 1HWLA 1L3KA 2PIIA 2ALZA 2OKQA 4DSIA 3DHWC 2E5HA 2G2ZA 2J0XA 5LMNF 1LWEB 1HNVB 2GHVC 1TMMA 3P5TL 4DZ6A 4DUZF 3MURP 3TRGA 2DGWA 3HJVA 4KR0B 3TUZC 2WBRA 4H4KA 2MDAA 4K8RA 4DN9A 2DH8A 1YITS 5CCMA 4KO0A 1CULB 2HHXA 3NG8A 4UF4A 3B6BA 4M1KA 5ETKA 4KYZA 2EI5A 2ZD1B 2KYXA 3PKYA 2CQBA 2NXCA 4QWAA 3GYXB 3GYGA 5KFPA 4A8SA 2BQRA 3KTQA 1R89A 2PI5A 5KT3A 2NYHA 4FYYB 1NSQA 1D3WA 2JEGA 3CIZA 2YWFA 3IR5B 3AHPA 4GVLA 2VJVA 1RWWB 3PHEA 4DV5J 2DO0A 2HS0A 4UW2A 1BQXA 4C11A 4DFKA 1N5SA 2GGPA 1YIJS 1N33J 3RU0A 1FJGF 5DDQC 5IV4A 2G1HA 3KLIB 2BZ2A 2I9SA 1HNXF 1CVJA 3RBDA 4ZHRA 1S1UB 2XO6A 2WSFC 5HMZA 2ZH7A 1JLCA 1DLOA 1N54B 3GLJA 4HHHA 1YJUA 2XEXA 5KFFA 3V81A 1KRPA 3KG1A 4CM2A 4EMDA 3LH2S 2CQ4A 4CO1A 4ERDA 2A2CA 3L7PA 1P27B 2AJ1A 4DHVA 1BQNA 2K1RA 4G1QA 4HI1A 2CVEA 4OHVA 1LFWA 1CJVA 2BJ3A 3ZZTA 5KFJA 2GIRA 3UW1A 1S97A 4TLQA 2MY8A 1AZSB 2GZOA 2DCLA 3MEGA 3R27A 3R5GA 5EX0A 4RNHA 2CAJA 2CWXA 2KI2A 1XMBA 4ID5B 2JEFA 5EGYA 2B0GA 2LEAA 3CDEA 2I6WA 1S0NA 2Y0BB 3FNNA 1MN9A 4P73A 1KN6A 4LREA 3MEDA 3FEXB 3OJSA 1VLOA 1B0VA 1VGYA 2ZJPQ 2GQQA 1K1QA 3QQCD 5D4LA 3G86A 3VGVA 3W8PA 3TWZA 4OZ0A 3UDVA 2KT2A 4LIWA 1RTJB 1YJ7A 4Y0FA 4RZRA 5IT9U 1SKWA 1WKJA 2B4OA 2DPJA 5F9LA 2ZM6F 4C8NA 3VAIA 2C2DA 1PJ5A 4M95A 4ZDNA 2YKPA 3B82A 4DV3J 1VOMA 3M2UA 3MUTP 3EWGA 2ZBCA 1R8CA 3BR9A 4AXIA 5EHHA 2ZUGA 1S9GA 2WW4A 2PGCA 4QCLA 2F8MA 2RVJA 1T9WA 3CW2C 1SCJB 3CXCR 3N6LA 1V3ZA 3MXHP 2KJWA 1WI6A 4BC7A 2VH7A 3N9UC 5D3GA 1GTHA 1TU0B 5D15A 4CCHA 3ILJA 2B56A 3W7BA 4F36A 2Q3PA 3I6PA 3I0RB 4DCOB 1TK5A 5DG7A 1OS5A 3O8WA 4N41A 1X31C 2HVHA 3KNGA 2QLBB 3J7YU 2EFNA 1RBOB 4R25A 2NR0A 4E0DA 1RT6B 1WC3A 1DURA 5LL6d 2IHR1 3M05A 4DV5F 2Z0GA 3LWMA 1HHTP 4C7QA 1KNZA 4NL5A 1S7HA 1Z2LA 3OV7A 4FS2A 3PW0A 1D1UA 5KG0A 4ZLPA 4V19J 2DXFA 3NWGA 3EZUA 4KT0C 3TEHB 2RU9A 4I56A 3MAQA 4E8UA 4OYBA 2E7VA 4M5MA 1ZM2A 5ETQA 1MW7A 2HGMA 4DPWA 2DR5A 3MR7A 4NRUA 4LSZB 1UVLA 2DYAA 5KFBA 4UY8T 2EFQA 4M63A 1X8DA 4QIGA 1YHQS 1WF1A 2M3DA 3I56S 3W2VA 4F3OA 4NCGB 1K47A 1RTDA 4WFXA 1DBDA 2WK4A 1LW0B 3NBPA 5HVHA 3BQ0A 1PJ6A 3RGIA 4FBUA 2VASA 3QFWA 2E7WA 4A8OA 5KFCA 4B02A 4WJBA 2V94A 4UOCA 1FNXH 2J6SA 3KLFB 4DQIA 3PIPQ 3BV8A 1EX8A 1LW0A 1RDRA 1TV6A 2IAJA 3HFZB 3CCES 4J9LA 4A8MP 3NCPA 1JXEA 2C2ZB 2HHHF 3MR2A 4O0IA 1SKSA 3AJDA 1S1XB 4CLPA 3HHLB 2KRRA 4OJGA 3SFGA 1NKBA 2IJRA 2RDDA 3DDNA 4IH7A 1HNZJ 2QSWA 2DR7A 1KQKA 3RJMB 3GJTB 4DLGA 2W2QP 2AP6A 4P7TA 2H9ZA 4UOHA 4H4OB 1KQFB 3T9ZA 3TUPA 1A6LA 1Q8LA 2MSSA 4ECYA 4OYOA 4ES3A 4O3PA 2YKAA 2MQ8A 1Q0NA 2I5JB 3LP2A 4KY3A 4DUTA 3J7Z5 4N5SA 4DV3F 4CH7A 1TKXA 2RQMA 4OIXA 1U1RA 3O2IA 1LWCB 1D8ZA 2C42A 3HI9A 4TYBA 5K8MA 4GVBA 2KFYA 1S6PB 5L1IA 1GMUA 2OLWA 2I5JA 2LVWA 2XZTB 4IFYA 3HHKA 2FHMA 3NRBA 3Q8QB 3G8QA 4I2QA 5D4PA 3SCJE 3C6UB 2BXJA 1Y5IB 2MQMA 1C1CA 2EFOA 4WTYA 3BKFA 2XMKA 1RHQB 2CUYA 4A46A 2ERRA 4JI2J 1YG0A 4I2QB 2C3PA 2R8JA 2VPYB 4OI3A 3KLGB 4CH1A 3BBCA 4X4OA 4ZPWR 5KTQA 4U6PA 4HHJA 2BVZA 3Q22A 1NRKA 3Q8SB 4NXNJ 5D78A 4JI3J 1CS4A 1JLAB 2RRNA 2PFDA 5IT4A 4WF9Q 5B0BA 2LQ5A 2HLTA 4QPXA 1ULRA 1LWXA 4B9LA 4NCBA 4B3TJ 3HP6A 2NUHA 4IQMA 5EWGA 1HARA 3H2VE 2AJFE 2H5EA 1MG7A 2WTFA 3MEKA 4MYTA 1YSJA 4A8WA 1SH2A 2J76E 2VIHA 3RB6A 4QIWD 1NPRA 4ZVRB 4C3MA 3NOGA 1KOOA 3CB4A 4QIVA 4ECVA 1EQ0A 4LRDA 5DGBA 1G1XA 2HVEA 5HANA 1T03A 5L39A 3Q8PB 2UU9J 1Q4RA 3N6NA 5A8KA 2PD1A 3HJFA 4LSLB 1U1QA 5T7LB 4Q0BB 3IG1A 1NSAA 4OI4A 2V9WA 2VL1A 1VBKA 3ZZ0A 3SZ2A 4LF9J 1S59A 1S0VA 4ED5A 3AT1B 1ITPA 3GR1A 3CPWR 1U02A 3HHLC 4LSLA 1MMDA 2E5IA 1RP5A 1H2UX 2P5VA 4J9UE 4P75A 4PG8A 2OAUA 4NASA 4DR2J 2V2QA 3VHQA 1WC4A 3BYPA 1F3VA 5I3UB 1KOHA 3EGVA 2I2YA 3HO1A 4OYXA 4QYRA 4RNMA 4EZ9A 1Y7PA 4F4KA 5DDRC 2Z57B 1YWXA 3AXKA 1SH3A 3AQOA 3Q24A 1NMEB 2X7IA 2GQ2A 1TR0A 2YKNB 1J2VA 2GX8A 1HFEL 1PBUA 2AF6A 1FK9A 3HD2A 3K17A 1U49A 5K8NA 1X9MA 1DRZA 2UXDF 4Q2MA 5ETPA 1P8GA 4G1QB 1RWNB 1MU2B 3JQMA 4QBUA 4L73A 2OTJS 2DB1A 3K0JA 2HMIA 5KFIA 2HSEB 4DX5A 3DLHA 4J9SA 1EAYC 2DGTA 1RSCA 3AD9C 3UCUP 4A8KA 4HR2A 2ZJQQ 2M5YA 2YPYA 1VI7A 1ZETA 5C7PA 3HSZA 3JYTA 2F4FA 1RU1A 2XYPB 4C3KA 1JLEB 1OPZA 1UWAA 2W9BB 2Z2MA 2ZH9A 2FHJA 3VV2B 2I8EA 2XY7A 2CQCA 3OR1B 2BKNA 4OZJA 3S7RA 4L75A 3CCVS 2YNFA 1HKAA 4JI3F 4J91A 4PXDA 3HF5A 3UNGC 3CCJS 3O3LA 2HYIB 4MMOA 3IRWP 3JS9A 4QQBA 2ZH1A 3UDEA 4LF8F 2QRRA 3LANA 3LUYA 4P10A 1N6QB 2VFRA 2CJQA 1GH8A 2ZD1A 3A12A 3ZO7A 2AQ4A 3ULHA 2FJWA 1WOPA 2LU2A 5A2QY 4ZJOA 3PYDA 1SL0A 3PFOA 1X5OA 4O3OA 1KQGB 1YJTA 1XQIA 2GIFA 2W9CA 4X4SA 1S4FA 4FKYA 2QMUB 2YQ3A 3CCZA 3H59A 4O3SA 2E1CA 2LQBA 1RBLA 4KQZA 3T6JA 4LVOP 1DZ5A 2OPSB 2GGPB 4DV6F 2BQUA 2ZHAA 2VBXA 3KLIA 2G9OA 5E3QA 5IWAF 5AJ3J 4ILMA 5H9EJ 4DU7A 1ZYQA 2Y1JA 2XCPA 5ADZA 3JTNA 3KJQB 2MLZA 2AZ1A 3NS5A 2KH9A 4BWJA 1RT3B 4QWBA 1Q5YA 2YWHA 3GPAA 4NZ7A 3GV5B 1CC7A 5GMKa 3HKWA 2KXNB 3LF0A 2XMTA 3MAHA 1FWLA 2IBOA 2D41A 5KOWA 2H3EB 1TZ0A 4NEYA 4RLEA 4ZS6A 1AZSA 3MEGB 1M0SA 1U48A 2GS8A 1RJJA 1TL7A 4DL3A 2HFUA 1B7YB 2LU1A 2R8KA 3PKMA 2XI2A 2BOAA 2MQNA 2DPIA 1U4BA 2KFZA 1FEHA 1UP1A 3NAHA 1CJUB 1PCAA 1FKOB 3T1AA 4F25A 1TL7B 2QMWA 1PG5B 3UNYA 1RWXB 2BEFA 3PTWA 3MCMA 2X3DA 3NBPB 3OXGA 2W4CA 2N7CA 4XIUA 4YHHF 5HVFA 3RR8A 3G8SA 4WFNQ 5KFKA 1TQLA 3IM9A 4JI2F 2Q1LA 2XSJB 3KDNA 2JLEA 2MJUA 3QMQA 5CABA 3OTCA 3M30B 5IZHA 2L41A 1NB2A 4DFJA 1J27A 3Q83A 3RB4A 3VQSA 2OHDA 2V8DA 2VQFF 3DDIA 5KG1A 3H5XA 4K4SA 3HHLA 3I0SA 1FTCA 1ZTWA 4DBQA 3J7ZT 2H51B 3WQPA 4EYHB 1PYSB 3GE9A 5CYQB 1S1WA 2DVIA 4LSNB 2R7RA 1ZA2B 4ZN1A 3H5YA 2WVFA 3LP2B 4YB6A 3G6XA 2IRUA 2OPRA 3AA8A 1KD1T 1VIOA 4L76A 2QMXA 4DV2F 4C3LA 3NNCA 3MPDA 2HQ3A 2X3GA 2YPZA 3S1TA 2FVSA 2PI4A 2PSZA 1LWFB 2ZWOA 1M5HA 3FKBA 4B9MA 1TKTB 1SJRA 4NE9C 5FLXU 3SV3A 3ITHA 2FB0A 1SIZA 3Q2SC 2BACA 2DRBA 2YNHA 1PYOB 2VFTA 2YNIA 2E66A 5FDLB 5KG4A 1XMQF 3IM8A 3K57A 3H2UB 5IWAJ 3BO3A 3SFUA 4ED3A 2R2SA 4Y2KA 4ZCLA 8ATCB 5IQ6A 2K3KA 4DCPB 1SQEA 4MK8A 2ZM6J 1H7WA 5KOXA 1IKVB 4BLGA 2MXYA 4CO4A 2QE5A 3CMQA 3OXLA 4DR6J 1U47A 2BJDA 3N4WA 1H6KX 3DYAA 3EMTA 1Z4UA 4RR5A 3DRSB 3W2VB 3M8QB 1KHVA 1YJRA 3GJQB 3B4MA 1QM9A 3PW4A 4ECUA 2IM2A 2QIFA 3CJ3A 2ZVIA 3DU5A 3AODA 3CCRS 1C1BB 4LUBA 3I31A 2ROEA 3NGRA 3I4PA 1FNMA 1C2PA 4RBTA 1LK7A 2HFOA 1XNRJ 1U2CA 3BSAA 4OHWA 3MM5B 3ZTQA 4DR4J 3N6MA 1VBXA 4PG4A 3BGFA 3DCAA 2O1PA 4ZVPB 2N4CA 1M5VC 3DKDA 2COLA 2CQ2A 3CE8A 3ET6B 7FDRA 3Q0AA 4I7FA 4NYOA 3WZ0A 1MNEA 2HHQA 1UVKA 1JQGA 3QNWB 1U1KA 4HDGA 3RRKA 3K59A 3PYFA 1S72S 1UPPA 2P8IA 2QG9B 1S99A 5ETSA 3KHRA 4NRTA 1WHYA 4M5DB 1G6BA 2VQFJ 1A0OB 2GO9A 3HZGA 1LWCA 5LXRA 2UVVA 4HT7A 4U7CA 3EVWA 3CCSS 4A8FA 4GVBB 4ID8A 3JQJA 2W7PA 3HHEA 2HZVA 3UD4P 2VUGA 1RT4B 4NOHA 2MQPA 3B8HA 3BGOP 3P3DA 5I3UA 3HZEA 4EO8A 1RT2A 2AYGA 3NL0A 5SUHA 4NLOA 5L1KA 3VAGA 1KKHA 1RT4A 2NCKL 1WSVA 3NS6A 3MPVA 1L3SA 1CJKB 1TP7A 2HNDB 2JDJA 5C25A 3WC2A 4NYZA 4X4NA 3M8PA 2HNZB 5CYMA 1DTQA 5E3PA 4XK8C 3ZC4A 1WF0A 1C4AA 4ZCKA 2EXUA 1WHXA 1FVQA 4N7TA 4Y2MA 2YY3A 2HMIB 3N5BA 3K7RA 4C0HA 3C14B 3MEEB 5IT0A 2ZOGA 4DN0A 5AJ3F 4WE1A 3QT8A 5RUBA 2K3IA 3OR2A 5E41A 2Q6CA 2RMLA 3KK2B 3P6YC 3MAAB 1SC6A 1JLFA 3VAKA 2DNNA 1R43A 1S6UA 2KT3A 5BR8J 3T5KA 4U7UD 1GMWD 4G3IA 2QGFB 1RAOA 3AD7C 4MIAA 3PW7A 2E9TA 4LRAA 3D4JA 1PBAA 4EUVA 1UA0A 4Z7YA 2GCFA 2EK6A 1NJXA 4DF8A 4ED8A 3H5UA 1K44A 1N6QA 4KTQA 4C8YA 1QD1A 3JAMU 5DQHA 2DHHA 1U6BA 5F8JA 3F41A 2VDHA 4NLDA 1VIXA 3DN9A 2YKMA 3SQGA 2AGQA 3CJKA 2BOPA 2B7BB 4G65A 1V3SA 3WC0A 4DF4A 5A6PA 3F44A 3MR6A 1S1UA 3EUNA 3MM8A 3H4BA 2D9OA 3AOCA 4WKYA 1IBLJ 2HVZA 1HQUA 1I51B 3SV4A 5DZ7A 2MKHA 4LF4F 1R27B 1VJWA 4ELUA 4QW8A 3J7YI 3LGHA 2RUGA 2CVIA 3K58A 4PR6A
chains in the Genus database with same CATH topology
4JV0A 3CCTA 1IQTA 2CPIA 2L08A 1FKPB 1REVA 2BV3A 3OL6A 5FIIA 3TANA 4QR2A 1NK5A 2ZITA 4AXJA 2C3UA 1HNIB 5J2QA 4X4QA 3PV8A 3D0HE 3QWUA 4YR3A 3HLUA 1DFDA 2W24A 4ID5A 3CDUA 1UL3A 1JLBB 1WACA 3HHNB 1C0TB 2GMLA 2M7SA 2GV1A 2JFKA 2FJBB 2VFVA 2O3DA 1YVFA 4B9SA 1HI0P 5KFLA 1R3NA 4HYKA 4DR7F 3BGRB 3TO8A 1JLGA 3H40A 3MCSA 3PJWA 1L5UA 1TVRA 3FEYB 2CQ3A 4ALZA 1I1GA 3OXFA 4C97A 1X9WA 1RT7A 1QAXA 4WKRA 3CD5A 3MPWA 3MOZA 1JWWA 2XSJA 3N01A 3WDOA 3M30A 3ZZUA 3GG0A 2DNZA 2KO1A 2EKYA 2IC3B 2M9KA 2RS8A 4HT5A 4OZ1A 5CYJA 2W25A 2YKOA 3N0VA 3Q8PB 2AGOA 1R0AA 2IM1A 4DR6F 3AB2B 4ZPBA 1MROB 2RT3A 3DOKA 3DHXA 7FD1A 4LFAF 2QSFA 1F0XA 3I0RA 4UQGA 5E5NA 2R8GA 4O4GA 5CYQA 4LFBF 3DRRA 4LSNA 2RQKA 2CRLA 1NEEA 3G96A 3PO4A 1VK8A 5K9FA 2Y1IA 2XZWA 5KFTA 5DETA 2EFPA 2DISA 1VQ6S 1G2EA 3CWJA 1FJEB 2ZE2B 3OJUA 1FDDA 2OIHA 4MJKA 1GX6A 2LKZA 3TW0A 4MKAA 2FHJD 2W7AA 2E1AA 2QA4G 5F8NA 3G4SS 3NGKA 2RE1A 3K5PA 2F7VA 4FXWA 4KFBB 2DK2A 4RWXA 4KO0B 3BSOA 4X4UA 2U2FA 1DARA 3BQ2A 1K73T 3ETOA 2RU3A 4ED2A 1UVNA 3MF5A 1JB0C 2R2RA 1RGVA 1FRXA 4RBVA 4K4WA 1D9DA 3DLKB 5HBMA 5HMYA 1U45A 3DRSA 3N5FA 1TKDA 2M2BA 3EYZA 2N82B 1VC5A 1S0MA 4ECSA 1UFWA 2ZHOA 1XWLA 3RW6A 3KLHB 5HBMB 2QA1A 4QR0A 1T8EA 4WFZA 2V5HG 3I5CA 2WOMA 2KZMA 3C6TA 4ELTA 3M2VA 2DGSA 3LW5C 4EFAC 4KPYA 1OWXA 4N76A 1VQ9S 2WONB 2R7WA 1EETA 1JLCB 2JJ4D 2JZ5A 3IO1A 2LA4A 4CO0A 1R6YA 5B0DA 1JKHB 1HYSA 2BM0A 3D1HA 4J9NA 3KLEA 4K50A 5KFYA 2JEIA 5L9XA 3PX0A 4URSA 1R8PA 3LP1A 3V5RA 1H38A 2HLUA 3DXSX 4C2MA 2OPQB 3OSNA 2L9DA 4IDKA 2XLJA 1C0UB 3VCDA 2VONA 2L9WA 3U1LA 2HHTA 5KFAA 1XR5A 1VMBA 2ASYA 3IAS9 2WAQD 3WX4A 2DGUA 3OTDA 3QLHA 4D3HA 3D5MA 4TN2A 4OJHA 5KFWA 1HD1A 1HW9A 2FUG9 3M32B 4P7VA 1ZAVA 3FDSA 5ITHA 3TUJC 3MM6A 3L3CA 2G1DA 5D4NA 3O1LA 1W2BR 4Q7AA 1IKVA 4RW4A 2HHVA 2DD8S 3OUYA 3MM6B 3DMJB 1AW0A 3EGWB 1KQSR 2P9CA 2WCXA 1HL6A 3M8QA 4I4BA 2C2EA 1RQ0A 3SXLA 4KHRA 1X4GA 3OR2B 2QLXA 3LALA 3VF0B 3OFFA 1WELA 4QW9A 2CJKA 1RTIA 5EX3A 2P9GA 4DV7F 1M90T 1SJ3P 1VHFA 1N5TA 1FERA 3PEJA 2CQGA 2EG2A 5DRKA 3MD3A 3F56A 5A8KB 4PG5A 5IFMA 1DQ8A 1NJWA 3DM2B 3QZ8A 4DL2A 4MIWA 4IG0B 4U7UK 5KG3A 3GV7B 1FXRA 2YVSA 2CG4A 3U1NA 3MI7X 4OX6A 2QV6A 3MM9B 1HBOA 2VG5B 1ZPWX 3HHLD 4DFMA 5D8HB 5AXMA 2O5DA 3UWTA 1QSLA 1S10A 3PNIA 4TU8A 4IOAQ 1ZM4A 3BB5A 2CKWA 3M6UA 3HDSA 1TAQA 1DQAA 4ZK7M 2DCUB 4A8YA 4R8UB 3E8OA 3MMBB 1HNZF 3RTVA 1DTTB 5JXSA 3E51A 2HNYB 4DV1F 3M6WA 3S6EA 4I67A 2XMMA 3SYZA 2MYFA 2AJ4A 3E2EA 2VG7B 4WU2A 4C4WA 3TA0A 3X3UA 3IN5A 3KHHA 1KLMA 3M4XA 3P96A 5EUHA 1Y0HA 4OJ1A 3MOJB 2ZJRQ 3CJ0A 4JBCA 5DGAA 3GB0A 3HVTA 3SDEB 1XNRF 4JI6F 4HLBA 2V9KA 2IRXA 2CQIA 2M52A 2QO3A 1HWUA 3M1VB 4WYLA 5CHCB 4X65F 4XPCA 1C0TA 1KS2A 4TQRA 4NLGA 3MPYA 1KTQA 1FRKA 2DT9A 4JI1F 2W9BA 2VOOA 3OBIA 5HP1B 2JFDA 1RTHB 4EU0A 3GYNA 5DS7A 1OPIA 3H25A 1IJEB 2B43A 1QSSA 1Q7LB 2KKHA 2OFHX 4DG1A 5A8RA 4TU7A 1JLFB 2F4VF 4KKOB 2BRKA 4MIBA 1RT5B 5EWFA 4K4TA 3K2YA 1LV5A 1QSYA 1P9QC 3D28A 5AXKA 1O5JA 4CQ1A 5C5JA 3C2PA 5L8RC 1VQ8S 4IFYB 5A8RB 2UV8A 4Q2LA 1FEEA 2KDOA 2RRBA 2B9YA 4LF9F 3BO4A 4G6VB 1Y5LB 2CZ4A 4WXOA 3DI6A 3KJVB 5HLFA 3CJKB 3V2UC 4ZOSA 2FJEB 4X66F 3QO9B 3U1MA 2C3OA 3H4DA 1J5OA 2OJ3A 1LK5A 1HA1A 2B51A 1NK4A 2Z2LA 4NLSA 2GHPA 1RT1A 4HI2A 4QWEA 4DFPA 2FLNA 1NJZA 4ECZA 1N4LA 1DAXA 2ZE2A 5KFSA 2N4DA 4K5SA 2B4UA 4W90B 3IFEA 2E5LF 5M2PA 4X64F 2VKZG 4TNOA 1JMTA 4FN5A 4J37A 4OI0A 4WFAQ 3VAMA 2QEXS 1GX5A 1IKXA 4DL4A 3DNCA 2CIMA 2LXUA 1OQ6A 3CCQS 1KONA 3RRGA 1T05A 2MZSA 3BDPA 4HKQA 5KT2A 4TLRA 2CPZA 5EDWA 3KMQA 2HS4A 1UAWA 1VQYA 3MMCA 1KEKA 1LQ9A 4PWUA 4ETZA 4F4ZA 3N79A 4LVNP 1HR0F 2IVYA 1LXNA 1KSPA 1D8YA 2ZNYA 3OTBA 2YX7A 1TL4A 3OFGA 4D3GA 4DLEA 4PKDB 5DLFA 3AQPA 4I6AA 3FQKA 1ZTTA 3FEZA 2GC8A 3I4HX 5DM7Q 2X1FA 1IBKF 4RWWA 1U8SA 2V4JA 1S1WB 3PEHA 1KR4A 4KHPF 4Z2XA 4X4PA 2PC6A 3CD7A 3QWPA 4I2PA 1Q53A 3UQSA 3R1HA 2GW8A 4N47A 1FRHA 2DITA 1N33F 4P6QA 3US5A 2LEPA 4RNNA 3D0IE 4FP9A 1AXQA 1WEYA 2JL9A 3NKYA 1X4FA 3PXGa 1ZM9A 4RU9A 3ITHB 2P6TA 4FYDA 4QZVB 1JLEA 4CCHA 4XDCA 2LA6A 3ZZYA 5DM6Q 2MKSA 2E1CA 2B5JB 1HQEB 3HVRA 4OHYA 5AXNA 1RTJA 4QOTA 1IUJA 2OSRA 5KFNA 3EX7B 3J81Y 2CPEA 5J2MA 1JJ4A 3I87A 1HBMB 1XEZA 1X4HA 2VFSA 1SJ1A 1VQ5S 3M2UB 3TVKA 2RDJA 4K4XA 2XY5A 4FVMA 5KFUA 4IH6A 4RW4B 4IG3A 5D4OA 3QJJA 1JNRB 1Z1ZA 3V4IB 1YJNS 3CMAS 4I69A 4NCAA 4HTIA 4C11B 3IS9A 1U1PA 2DH7A 4GKJF 4KE5A 3OVSA 2MY7A 3KLHA 5B0GA 4B3OB 4GKKF 3HKZD 2OD4A 2XC9A 2MZRA 2KZZA 4DL7A 4Q43A 2WONA 4J9RA 4KB7A 2Z4PA 1QAIA 2XB2D 1XN9A 2APOA 2HAIA 5I3PA 1CPZA 4IG0A 2ZH4A 4X62F 2C3YA 3QJPA 2VA3A 5GADU 1GXLA 4ZP6A 4TU9A 1G3OA 2E1RA 3W2WA 1NK8A 3JTPA 4OMFG 3D0GE 2VPXB 5HL7Q 5I42A 2IMOA 2FLOA 1Y5NB 3EGZA 1C0UA 4CZCA 2VOPA 5DJBA 2HZCA 4PXBA 3UDLA 1Q1KA 1HHSA 3DGPA 1IKYA 1FXLA 2VG6B 3JAMY 3RBEA 5K5MA