1QVGR

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1qvgR00
3J7YU 3BS9A 4TLQA 3UD4P 5LSOA 2KVIA 1WTBA 1VQNS 2DO0A 2DNRA 1M5VC 1YJWS 3CC4S 1U1NA 4EGLA 1HD1A 5LXRA 5BJRA 2CQHA 3UD3P 2KH9A 1U1KA 2MB0B 1U1RA 1H2UX 2LXIA 2JVOA 1ZZNA 3Q2SC 2MQLA 1WHXA 1ZH5A 1HL6A 2MKKA 2LCWA 1Q86T 2ADCA 2LA6A 3IWNC 3J7ZT 5IM0A 4QU6A 3IRWP 2MZQA 2N82B 1YITS 2D9PA 2LQ5A 4F25A 4F02A 2EVZA 2DNKA 3FEXB 4CH1A 5GMKa 2CJKA 5H1SV 3P49B 4TU8A 1M5KC 2CPDA 1FJCA 2KT5A 1FJ7A 3N9UC 2VOOA 3D2WA 1JJHA 2X1GA 2DGQA 2M52A 4ED5A 3MD3A 2RU3A 3I55S 4IO9Q 1PGZA 2X1BA 3HI9A 2DNPA 2SXLA 2M7SA 3MURP 2M9KA 2E5IA 1KOOA 3DLLQ 3CC7S 3CCJS 3H2VE 2DITA 3DXBA 1S79A 1RK8A 3P3DA 5HO4A 2M4MA 2DH8A 4W90B 2BZ2A 3UE2A 2B0GA 4YOEA 2MZJA 3ULHA 4QPTA 2OTLS 2M2BA 2Q79A 3OW2R 2UP1A 2DNQA 1VQLS 1IQTA 2MMYA 3G6ES 1KC8T 4PRFA 3UCUP 2EK1A 2DISA 1WG4A 1X5OA 5DDOC 2CQ0A 2RQCA 4QU7A 1X5TA 4PR6A 1U1PA 4LMZA 2PE8A 1VQ6S 2RT3A 2MKJA 2KRRA 1YJ9S 2AYMA 1S72S 2G4BA 4OZ1A 2VOPA 2I38A 5GAGU 1WF1A 2MKSA 2L9WA 3BEGB 1KOHA 2M8HA 2RS8A 1YHQS 3VALA 2JRSA 1CVJA 1VQ5S 1U2FA 2E44A 3B4MA 2U2FA 2RVJA 1R8HA 5MLCV 5D77A 2DNOA 1SJ3P 2KRBA 1DZ5A 1VQ7S 2KI2A 2CQIA 3CF5Q 5IFMA 1PO6A 2HZCA 3PIPQ 2KG1A 3ZZZA 2KYXA 5LJ3Y 1VC0A 1WHVA 3EX7B 4LJMA 2CPEA 5ITHA 1B7FA 2JWNA 1OO0B 1BY9A 1U1MA 1X4DA 4V19X 4W92B 2KM8C 1Q82T 4Y0FA 4ERDA 2MSTA 2LECA 3CCSS 1U1OA 1N54B 2D3OR 3S6EA 4UQTA 1VQKS 5FJ4A 1UFWA 2FC9A 2MPUA 5DM7Q 2VONA 1OWXA 4BS2A 1D8ZA 3CD6S 3L3CA 3H2UB 2MKIA 1M90T 2MQPA 2RNEA 3VAFA 3VAJA 3CMAS 3U1LA 2XS7A 1DRZA 1WI8A 1JJ2R 2RUGA 2MY7A 2KHCA 2DH7A 2KU7A 4WFNQ 4P6QA 3R1LA 3VAHA 4IOAQ 2I2YA 1X4HA 3MD1A 1JJ4A 3CULA 2X1FA 3RW7A 1RKJA 1P1TA 1K73T 2CPIA 2VODA 1H6KX 1WWHA 1KQSR 1YIJS 2DNLA 2M0GB 2CPXA 2MYFA 1VQPS 3G8TA 3G9CA 2OSQA 1WF2A 2DIVA 2JX2A 2MZSA 3S7RA 1SXLA 4WFBQ 1N52B 1WEXA 1H2VZ 5LXYA 2XNQA 2MXYA 2LYVA 2DHXA 2L08A 1VBXA 2AD9A 1WG5A 3MUVP 4IUFA 2NZ4A 2PEHA 3BO3A 1VQ9S 2HGMA 2KXFA 3MI7X 2D9OA 2N7CA 1YI2S 4FXVA 3ZZYA 1VQ4S 3NNHA 2DHGA 3P5TL 5GADU 5GAEU 2DGUA 1DBDA 1R8PA 4YUDA 2AYBA 2J76E 2GHPA 2G1DA 1OPIA 3EGNA 2MQNA 1X4CA 2L41A 2CQCA 2FC8A 1JMTA 2MJNA 1YWXA 1NJIT 2RQ4A 1X5PA 2HYIB 5D78A 1M1KT 3THPA 2K8GA 3NS5A 1N8RT 3NNCA 2G0CA 1VC5A 2MKHA 5IQQA 1VQ8S 2KXHA 2N3LA 3U1MA 3G71S 2MQQA 1VBZA 3RW6A 1Q7YT 1U6FA 4WFAQ 3CCQS 2AYGA 3K0JA 3VAIA 2DGTA 3LQVA 1P27B 4CIOA 3BO2A 2DNYA 3UWTA 1FXLA 1X4FA 4ZKAA 2MKCA 1K9MT 1QM9A 4C7QA 3CPWR 3MOJB 2E5HA 1AUDA 5EN1A 3TP2A 3VAKA 2U1AA 1L3KA 1Q81T 1QVGR 2XS5A 4C0OC 1NU4A 2F9DA 3THTA 4F26A 2CPZA 5DDRC 3LPYA 2FY1A 1FO1A 4WF9Q 4C4WA 3V4MA 2LEAA 2CQDA 3G96A 1X4GA 1WHWA 5DDQC 2DK2A 2AYEA 2KM8B 3CCMS 2MGZB 4TU7A 2QFJA 1URNA 2QA4S 2ADBA 2JVRA 2EK6A 2M88A 4TU9A 3CTRA 3NS6A 1X4BA 2LKZA 3CUNA 2WBRA 2CQ1A 2MSSA 4YB1P 1UAWA 4M5DB 2CQBA 2LEBA 3MUMP 2XS2A 3R27A 1SJFA 2KG0A 2XSFA 2BOPA 4J5OA 2LXUA 3TO8A 3MDFA 2N3OA 2KXNB 2XB2D 4PKDB 1X4AA 3P6YC 1WEZA 1WG1A 1ZZFA 2DNGA 3Q2TC 2GO9A 3PIOQ 5DM6Q 1DHMA 3CCUS 1X5SA 1YTYA 4LIRA 3S8SA 4Z2XA 3CCLS 2OIHA 5GAHU 2DGVA 3VF0B 1U1LA 2YH0A 2CPFA 1A7GE 2NLWA 1U1QA 2F9JA 1K8AT 3CCRS 2OJ3A 5CYJA 4U67Q 2MQMA 1N88A 2M70A 2FPHX 3R1HA 3SDEB 2DNMA 2KN4A 1SJRA 2DGWA 5DETA 2CQ4A 3FEYB 1WELA 4UY8T 3EGZA 2CPYA 2MGZA 5JVHQ 2LMIA 1UP1A 2LA4A 1WEYA 3US5A 3CCES 2CQ3A 5CXTA 1H2TZ 2DGOA 5LJ5Y 2DIUA 3UCZP 3G4SS 2ZJRQ 3SXLA 2X1AA 2OSRA 1W2BR 4RU2A 1KD1T 2YKAA 2J0SD 3S01A 2DHSA 1SJQA 1D9AA 2DGSA 1UW4A 2MZ1A 2DNNA 3NNAA 2DHAA 2E5JA 5HL7Q 1F9FA 1X0FA 1WHYA 4CH0S 1XN9A 1FNXH 1G2EA 2DB1A 2DNHA 2QEXS 1X4EA 3MUTP 1OIAA 2FHOB 3BO4A 2MY8A 4WCEQ 1M5PC 2K3KA 5DDPC 4IOCQ 2XNRA 2MZTA 2MHNA 2CQPA 2RRAA 3VAMA 3TYTA 2CPHA 2CQ2A 2O3DA 3JB9k 1A9NB 3B4DA 2KFYA 2CPJA 2YWKA 4WIIA 2YH1A 2J0QD 1VBYA 2DGXA 1SJ4P 2A3JA 1QVFR 3SDEA 1FJEB 2MQOA 5JVGQ 3NMRA 2HGNA 1U6BA 3I56S 2YTCA 1HA1A 1WF0A 2M8DB 2CQGA 5GVQA 2MZRA 2RS2A 2ERRA 1WI6A 2MJUA 1FT8A 1VC6A 3MXHP 3VAGA 4A8XA 4Y00A 3G8SA 4FXWA 2J8AA 4QQBA 2HGLA 2ZJPQ 3UCGA 1YJNS 3CMES 1FHTA 2ZJQQ 2F3JA 3SMZA 2DH9A 1VQOS 4CQ1A 2DNZA 1VQMS 5IM0B 2DO4A 5LSLA 1HD0A 3CXCR 2E5GA 3CC2S 1O0PA 2OTJS 1M5OC 4OZ0A 1NO8A 5CA5A 3CCVS 2V94A 2HVZA 2RRBA 3HHNB 4WKRA
chains in the Genus database with same CATH superfamily
4BCAA 4CLZA 4LFBF 2EFNA 5CZVA 2E7XA 3KXDA 5GADI 1CQNA 4RW9A 1RJJA 4MKVA 3H40A 1ZAWA 3D9BA 5THWA 3I87A 3FVYA 1AB8A 2LXIA 3D3BJ 3OR2B 2XY6A 4NWBA 3WQPA 4JUZA 1UWBB 2LA6A 1WOSA 3TX0A 4A8WA 5EDWA 4F25A 3M7VA 4KPYA 2VQFJ 4FYDA 2KTQA 1M5KC 3GV7B 3MD3A 3KKFA 2SXLA 3MR6A 2E5IA 3N6LA 4DL6A 1XTZA 2I9SA 3OR2A 1SIZA 2RQMA 2BZ2A 3F41A 4URSA 4ANCA 1UWBA 4K8RA 5BYRA 2ZC4A 2IAJB 1KC8T 4MT1A 5G4DA 1KQFB 1X5TA 5FLXU 5KOWA 4OZ1A 4PAAA 1KOHA 1VK8A 1SL2A 5HSPA 2E44A 3MGJA 4DQQA 3M8QB 2EG2A 1NXIA 3TR5A 3TJ8A 1SC6A 3D0GE 3LP2B 5ETSA 4WYWA 4DV5J 3H90A 2XMTA 1XBWA 1MN7A 1EB0A 5EX3A 3MEEB 5KFEA 2IAJA 3HHLD 2MKIA 1IBCB 1JLAB 2GIRA 2QZ8A 2QSWA 5D0HA 3BSNA 1YJVA 4CT9A 1S6OA 1WI8A 1U25A 4TLRA 2MY7A 1UVLA 5HMYA 2ILZA 4LFCJ 3M8QA 4DR6J 2Z2ZA 3G86A 1RKJA 1T9UA 1T9TA 2V6AA 1YIJS 3LP2A 5A2QY 3DGPB 4KJIA 4CLTA 2WVCA 2ZHAA 4WFBQ 2MXYA 2FGCA 2LYVA 4F4YA 4Y2IA 3MEEA 4U8YA 3CIZA 5IWAJ 2JDJA 3A12A 5M2PA 2HFVA 3GTYX 3MCSA 2QL5B 1Z4UA 3QWUA 4LF9F 1JLAA 7FD1A 1FRXA 3R7SB 3IO1A 2YQ0A 3NGKA 4ZLPA 3FC9A 5IC6B 1TZ0A 2FC8A 4ZLLA 5HVGA 4ICLB 4ATNA 1N32F 2ZZMA 4DEZA 2DXEA 4GC7A 5LMNJ 4Y65A 1VC5A 3OVAA 3R3TA 2VV5A 3DGPA 3VAIA 1SQEA 2G0IA 3PG9A 4P2XA 3BO2A 1FXLA 4FF3A 2B56A 2LFVA 4A8FA 1T95A 4CLPA 5DZ6A 1FRHA 3I4HX 2CPZA 3LPYA 3OHBA 4ECWA 4I6AA 4ZVUB 4KC5A 3V2UC 1FWKA 3CJTA 2QFJA 1S6PB 2YBVA 4ICLA 4KHRA 4ZPAA 2LKZA 1W2IA 4GVLA 4ECYA 4QR2A 1HMVB 4OZJA 4WU3A 4ZITA 2Y0BB 1DHMA 4O3PA 2YX4A 2QLBB 1A7GE 1BE4A 3T3FA 4I6YA 2MQMA 4U67Q 2VL1A 1B64A 2R8HA 2IY5B 3EGZA 3HDSA 4ZVHA 3BYRA 2WSCC 2HVHA 2CQ3A 3QAEA 2J0SD 3OXFA 4B3TF 3K5NA 1SJQA 2QA2A 1HMVA 4OYAA 3H8YA 2J0XA 1HWJA 2W01A 1JXEA 1N56A 1H72C 1VRQC 5ETMA 4KGXB 3Q89A 2FQQB 2DXDA 3T19A 2BEFA 1NSPA 2BVZA 1HA1A 2C22A 5GVQA 2RS2A 1FT8A 1S59A 1QDUB 4A8XA 4DV3F 4Q8FA 3K89A 4OHYA 2FY8A 5C5JA 1YJNS 4PWWA 2XG8A 2EBGA 3D6TB 3HT3A 3QT8A 1VQMS 1PJ5A 5DO2A 4ZCLA 1RCXB 1UWAA 4K2JA 1KKHA 4DV1F 2DEIA 2RRBA 1FF2A 3QGHA 3O8WA 5AXKA 1WSRA 2CQHA 1S76D 1J2VA 2YWHA 2BX6A 3ITHB 1CSJA 4K4SA 5IT4A 2OELA 2QYCA 3UI3A 2V2VA 3Q8QB 2MQLA 4LF8J 2YWWA 3KJVB 2ZKTA 3P45B 1JX4A 4FNHA 3MAAB 4Q7AA 1KDNA 2MZQA 2Y0SD 3R6LB 4HHHA 3W61A 1SC4B 3BF4A 3LAKA 1PJ6A 2ZVSA 3D4JA 4DQIA 4TQSA 1FJCA 1ZM3A 4ED5A 4K50A 4E0DA 2IPOB 3HI9A 3MURP 2AMCB 1R27B 4FKXA 1NH7A 4O0NA 3IWXA 2UXBF 2E9RX 4QWCA 2WBMA 3ITHA 3CB4A 3A4TA 5HO4A 3Q86A 3MPVA 3K59A 3KMSA 3KJVA 4LFAF 4XTTA 3QPIA 2Q79A 1ELOA 3MAAA 3MMAB 2UP1A 1RXOB 3H5UA 1CULB 1HNZJ 2DJWA 2ALZA 2GNKA 1EP4B 2OAUA 3FRZA 1IN0A 3HVRA 3BEGB 1RT4B 5HN0A 3C2PA 5AXMA 3T5KA 4Q8EA 4DFPA 1NNDA 2KYXA 3EXYA 1X4DA 4DPOA 4V19X 4ERDA 3BZQA 1TFYA 2BJ3A 4KGMA 3PEJA 1M0SA 3MMAA 2VF3A 2A2DA 4X62F 1N5YB 4BBYA 1CULA 3CCWA 1EP4A 3QWPA 3PR5B 2UU9F 3PO4A 2O67A 1UZDA 3HVWA 5KFZA 1VMBA 1RT4A 5CD4H 2I8EA 2GGPB 2BQUA 3QLHB 2D3O1 4J9PA 2X1FA 1XC9A 2QT7A 2BJ9A 4H4KC 1HNWF 2A1BA 4KT0C 1WF2A 4JI7J 4HHJA 1HWUA 1N52B 3ZZTA 2QYGA 5B0AA 2HRUA 1VQ9S 2R2SA 2EC0A 2AZ3A 1N5YA 3P5TL 5B0CA 3NY0A 5F3TA 3MM6B 4RNFA 3A3OB 2V69A 3TJAA 4RWXA 2XY7A 2GGPA 1REGX 3QLHA 4ZP7A 2CJQA 1KNZA 2HHUA 2BW2A 2K8GA 3NS5A 2B7CB 2AGOA 3W8PA 4LR8A 3TQEA 3RBXA 2DGTA 3LQVA 4J9KA 3AHPA 4ZVQB 3N6MA 1QM9A 1HHSA 3VAKA 2HFOA 2D41A 1KFDA 1FI4A 4OX7A 2HVEA 3GIIA 4FXDA 3MM6A 2G2YA 2RU9A 2DK2A 2HFZA 1IJFB 2WSFC 3DGVA 4TU9A 3QRRA 1X4BA 3FSXA 1J5OB 1I3OB 2WVEA 1PBUA 4YB1P 2CZ4A 4TYBA 5GMEA 3L7UA 1FE0A 2OUGA 3PIOQ 3ENVA 3SSRA 3UW1A 3CCUS 2VJUA 2LU2A 4R0EA 4B9MA 1M5HA 1UPMB 2CRLA 1C1CB 1SJRA 3ELHA 2GQ2A 4PEOA 1FWLA 2FLLA 2DGOA 3CO9A 1J5OA 4UQGA 4QZVB 4MAKA 3FBCA 3PJWA 2DHSA 2VFVA 3NNAA 1R43A 4Q5VA 3LO3A 3C15B 2NPIA 2RUSA 4F0HA 4ETZA 4F2SA 2RHQB 3M9MB 2CQ2A 5KFGA 4ZCIA 2QSFA 4DX5A 1C1CA 5JJBA 3O6QA 1Q1KA 4H4MB 3EVWA 4U7CA 2R7OA 3Q8VA 3FFIB 5FIIA 2ZBIA 3W9IA 2AW0A 2COLA 5FLXY 1UVKA 4ZPVR 3M8RA 2C2OB 1UA0A 4B3SJ 1S0NA 3IMQJ 3CC2S 5LOQA 5D4NA 3C15A 3GJRB 3OJUA 1ZYQA 2MDAA 3QAUA 3QYYA 4HKQA 3KUHA 1UFKA 5IT9U 1U0HB 3BKFA 4RBTA 2GFFA 1Q79A 1F3VA 1M5VC 2FZGB 1OJ4A 3CC4S 1U1NA 1N33J 5L39A 1SQFA 2Y8YA 1YJ7A 1AT1B 4H4MA 3DRSB 1VGYA 1P9QC 2AEMA 3LOUA 2BE7D 3FFIA 1UEUA 2WZ1A 3OXLA 3ISZA 1Q86T 3KK2B 3IWNC 2OLWA 3HT0A 4OJHA 3BDEA 1GMVA 2VA3A 3UR3C 4F02A 1T7PA 1QY7A 2PFDA 2ZUAA 1RQ0A 3ZFVA 1TFWA 5H1SV 4TU8A 3KLIB 1PAUB 3NAHA 1U0HA 4JI2J 4LSNB 4ZDNA 4NZ7A 1S48A 4EO8A 4FZVA 4RZRA 1KP6A 2M3DA 1MLAA 4USKA 3DRSA 2YPZA 5C24B 2M4MA 1PSDA 2G1HA 3TUPA 3CDBA 4X4QA 1WOOA 3GMGA 2C3YA 3E8OA 3KK2A 2JEFA 4IRCA 4DV0F 2VJVA 2H9ZA 4PR6A 2QMUB 2PIIA 1S72S 3KLIA 4NLTA 2MKSA 2NXCA 2NYHA 1BQNB 4DG1B 4X65F 4LSNA 2DNOA 2IYGA 2KVQE 5IFMA 4IO1A 4GC6A 2XQCA 3ZZZA 3A8EA 2VICA 2P9GA 1U1MA 2CAJA 5C24A 2ZZTA 1KTQA 3HJVA 2ROGA 2MSTA 2FHKA 2EKNA 1RDRA 2XYHB 3GIMA 3MFIA 1RT6B 3H2UB 2ZUGA 2AT1B 1M90T 1NUEA 4ANEA 4D3GA 1UW9A 3QGGA 4EYHB 3GSIA 2ALYB 1LW0B 3TX8A 2EFOA 1BQNA 1X4HA 4DG1A 5KG3A 4MYTA 4WK1A 3GFZA 2VODA 5F8LA 4FS2A 2VPXB 1VJQA 1ZOTA 2HQDA 4TY9A 1VQPS 4DV7F 3CT9A 2CNOB 2HK3A 4F4KA 1H2VZ 4OI2A 3EM1A 4GO7X 1UETA 4XIUA 1SKRA 3AODA 1RT6A 3R5DA 3JQKA 2UUBJ 4DV6J 4M5KA 1RZMA 2AYBA 3B82A 1V5VA 4NYOA 1X4CA 3CCZA 1S49A 4NRUA 2KKHA 2Z57B 2GJ2A 1N8RT 1HW8A 1CJKB 2KXHA 3SYZA 1YRXA 3MCMA 1P27B 2CZVC 5F3ZA 1VRTB 1Q16B 3OV7A 1I94F 1YRTA 4MYUA 5DQGA 2QJ3A 2IDEA 2GMJA 2DCUB 1YLXA 1IWAA 1U4BA 1HBUB 3N6NA 1TL7B 4DCOB 4N8NA 4C0HA 2QA4S 4OI1A 3JTOA 1LEOA 3NS6A 4Y28C 4BWMA 1FERA 4N8OA 1CJKA 2FVPA 3MUMP 2E29A 1FDDA 2AJ0A 4UT4A 1OPZA 2HMIB 3UVJB 3FK4A 1N5TA 1URRA 1WC3A 4USMA 1VRTA 3T1YJ 1NK5A 3K7RA 3VGSA 1XMOJ 2Y3YA 4HDHA 2NLWA 3CCRS 1HLWA 5GAGI 4CM0A 2EXUA 2M70A 3PYFA 3ZZPA 2FPHX 3SDEB 2DNMA 2DGWA 4DR2F 1HBUA 2CQ4A 1TL7A 2LMIA 3BSCA 2P8IA 2W9CB 1IKXB 2C2NA 1NLKL 1W2BR 4KY3A 5AJ3J 1KD1T 1TUGB 1T03B 1HNXJ 1S1WB 2DHAA 1WHYA 4M5HA 2HMIA 3UVJA 1OIAA 4JI4F 3BO4A 2XULA 4IOCQ 1NK7A 3TEHB 2ZDOA 5E3PA 2HIQA 6FDRA 3MEGB 1RAAB 3SDEA 4XK8C 4CNYA 4QW9A 2NXEA 4O3RA 1S4EA 1WACA 2BJ1A 2W9CA 3R7NB 1IKXA 4LF7F 3PRBA 1T03A 2DXFA 1FNOA 1S1WA 1H7XA 4Y6IA 4DV2F 1Z2LA 3SQGB 4C8YA 2OTJS 2H4WB 3CCTA 2XLKA 3LTOA 3D7SB 4C3MA 3UD4P 5LSOA 4UTGA 5ETKA 3MEGA 1GXTA 2BUNA 4M8LA 4LIWA 2DR9A 5KG6A 5J2NB 1RSCA 4URGA 2VFSA 2LCWA 1KHVA 2ZD1B 3HJFA 4IKAA 1N5QA 1HNVB 3SQGA 4C8NA 3MAHA 4CLFA 4NOHA 4CLYA 2X1GA 2UUCJ 1NSQA 3TUIC 5F0WA 2P2CB 5FD1A 3MWBA 3MEKA 1S79A 1X0PA 2D69A 1CG2A 3LUYA 2ATLA 2EW9A 5J2NA 2ZD1A 3ENAA 2ACYA 4QPXA 3CE8A 2VFTA 1VQLS 1HNVA 4LREA 5F8MA 3PW5A 2CQ0A 2QIFA 3OLAA 2UXCJ 1NHVA 2HNDB 1UJ6A 2G4BA 4KKOB 1KONA 2OFGX 5B0BA 4F4XA 2M8HA 3O5TB 4X4OA 3N01A 3NP5A 2FJVA 1VQ5S 3KLFA 2U2FA 5L1JA 1NK9A 2JFKA 1JXVA 3DHWC 3C16B 4IH6A 1PO6A 3H5YA 4WE1B 2KG1A 4I68A 2Z58B 1KLMB 2H65B 4W92B 4DFMA 2Q1LA 3BGUA 3OL9A 3I31A 4WKYA 2K7JA 3R5BA 1RBOB 5B7WA 3M6XA 4LF5J 2EPIA 3RRKA 4K2XA 3VAFA 3CMAS 2HNDA 2XS7A 3RAMA 4KKOA 4K4VA 2HQCA 1U02A 1YGYA 3CDWA 3W60A 2KFNA 1RE1B 3UQSA 4W98A 4K4XA 3C16A 1SJ1A 1E6YB 1P1TA 4WE1A 5LM7E 1LKZA 1C2PA 1KLMA 2E1CA 4Q44A 3JAMY 1WEXA 3SQOP 5LXYA 4A8OA 1T9WA 3HMJG 3M32B 4KTQA 2YX7A 1FJGJ 3J7YI 1X9SA 2H5IB 1CPZA 2G1DA 3KDNA 2VQFF 3BB5A 5IV4A 1N5SA 3BKUA 3Q22A 3FDSA 3JXOA 5HP1B 1E6YA 2YY3A 2N3LA 2YVSA 5KFLA 4ZPBA 1KVIA 2WW4A 1AUDA 2G2OA 5EGYA 1U48A 1REVB 3M32A 4LF1A 5HBMB 4KRWA 4GKJJ 1SIWB 1C1BA 2JNJA 2GAGC 1FXDA 1S1TB 3CDUA 2Y9HA 1WHWA 7AT1B 3TZYA 3CCMS 3FQLA 4HT5A 3NGRA 2BABA 4WYLA 2GVZB 4ITSA 3HZGA 2PMWA 2ZH7A 2AV5A 4ZVOB 4F04B 3FSYA 3RJMB 2Q43A 3MDFA 2RE1A 1JLFB 1S12A 1REVA 4X4RA 2DGVA 2J8SA 5HBMA 4L3NA 4B9UA 1K8AT 4OX9F 1WNEA 1J5EF 1NPRA 4CNZA 1S97A 2WVFA 1S1TA 4DF4A 1TL3B 1O8BA 2N7YA 1VLYA 3N5BA 4G1QB 2GVZA 5KFXA 3OFFA 3G4SS 1FWPA 1WKJA 4LF6J 4DXLA 2QMWA 1GX6A 1UW4A 3VZHA 1JLFA 1RP5A 3TAMB 1G2EA 5AE2A 4C3KA 4ES1A 1HR0F 2Q66A 1ZPVA 3K58A 4EYIB 2HHSA 1LFPA 3E3XA 2HVDA 2KFYA 1W26A 4WIIA 1XWLA 3DLEB 2J0QD 2IVMA 2QE5A 3OJSA 2C2DA 3IFEA 1TL3A 1QLNA 2YTCA 2M8DB 2XTJP 3LW5C 4GKKJ 4QR0A 2V68A 3A1YG 5A8WB 4G1QA 1RTDB 4NLVA 4MH8A 3R97A 4OHVA 4DUTA 2BJDA 2J5AA 3PR4A 1Q0NA 3EZOA 3PYDA 4DLGA 3RB4A 1YJRA 1SUQB 3TAMA 2KJWA 2ZNYA 3HSZA 1AUSL 3BGLA 1CJVB 1WKLA 1P8GA 3S1TA 2P6TA 5DLGA 3CJ8A 4TYAA 3DLEA 1HYSB 4FPIA 1NJYA 1HQUB 1YVFA 2DR7A 4OV1A 1N34J 2KH9A 1IQZA 1ZZNA 1VOMA 5A8WA 4USVA 3LGHA 1HL6A 1YBAA 5AT1B 5F8IA 1UVIA 5B09A 4IR1A 1O6XA 1SUQA 4X4TA 4ECZA 2EVZA 2IRYA 2BR0A 4RWWA 2CJKA 5EUHA 2IBOA 1CJVA 3MCOA 2VOOA 5A6WA 6AT1B 5HQLA 4UZBA 2RJZA 4I67A 1FRIA 2J6UA 2R2TA 3OLBA 1HYSA 1HQUA 3DXBA 1OQ3A 1UEKA 4W90B 2APOA 1TK0A 2V8DA 2V8GA 2EFGA 5E33A 1Y5IB 3CW2C 4DHVA 2ZH5A 2UZAA 4LMZA 2VBWA 4EWTA 3BQ1A 2RS8A 1APSA 4I0WA 1C0TB 2RVJA 3CIMA 2CQIA 2QG9B 3PIPQ 4OL8A 1IWGA 1IR1A 1KTVA 2B7BB 1WHVA 1VC0A 1LWFB 3D3CJ 4DL3A 3V6DB 1T3NA 1EETB 4KV8B 3NLCA 2FUG9 2WHOA 2Y1JA 4RNNA 4DI6A 2HW3A 3IS9B 2VONA 4OYXA 2CUYA 4P7TA 3HD2A 2B4VA 1RWKB 4QIVA 5D4LA 3KK1B 1T9XA 2HBYB 4ZPDA 1R0CB 3V6HA 3CD0A 4P6QA 1C0TA 1IBMJ 1S77D 4ZOSA 5ETQA 4DJBA 2XSJB 1IJEB 4WXOA 5F8HA 1LWFA 3N79A 2AF6A 3V6DA 1EETA 2CG8A 4KV8A 2KYZA 1FE4A 2AJ4A 4AL7A 3IS9A 3DFEA 4DR5F 3BO3A 5F8JA 1RU1A 1F2HA 3PHEA 4L6V3 2N7CA 1TL5A 1UPPA 2KB2A 4RBUA 3PFOA 3KK1A 3V6JA 3C3LA 3ZZRA 4ECTA 5HQMA 3G6VA 1JNZB 2MJNA 2W2PP 4LSZB 5D78A 2ZH1A 4M5NA 4ED0A 2OPRB 2XSJA 1YRUA 1G3OA 4I2QB 3V5RA 1ZM2A 2BKNA 3D67A 4GMKA 5CZXA 3IM8A 5EHHA 1NHUA 1NDLA 2B8PA 3HVAA 2L48A 2XCAA 4DFKA 2ZBCA 1Q81T 3D68A 2HZAA 3QFWA 1PYSB 3M9OB 1VYAA 3O2IA 3BR9A 3HHKA 3GB0A 4JI6J 2FGOA 1N48A 1RHKB 2GMLA 1VRUB 4OI0A 2OPRA 2CQBA 2RRNA 4I2QA 3EYZA 2BOPA 2LXUA 2ZH6A 1Q8BA 4ID8A 4DR7J 2CVEA 3PKMA 4Z2XA 2OMOA 3GU0A 1VCTA 3O3LA 2JEJA 3EGVA 3ETOA 4EBDA 4JB8B 2QMXA 1DFDA 4BWJA 2GV1A 2FJDB 4HHUA 1DLOB 1WELA 4RL1A 4B3OB 4JI8J 4MK8A 1RYSA 1UP1A 3AJ2A 4YB6A 4NLWA 2KZMA 1VBKA 3SSSA 5RUBA 4PG8A 2HKEA 2DIUA 1HARA 1VRUA 4RU2A 2C1EB 2OSRA 2V50A 4KGZB 2IM1A 2W25A 4P74A 2GS8A 2EFQA 3JTPA 4ECUA 2FHJA 3HFVA 1F5CA 3T5LA 3QSYB 2PSZA 3DKDA 4LRAA 1QE1B 1XNQF 2XWYA 3W8GA 4DU7A 2ZOMA 5KT5A 1FFSB 1D1UA 2B5JB 3DDNA 1SJ4P 3OVSA 7FDRA 1DLOA 1VC6A 4B3OA 2LVWA 2AJ2A 5KFYA 1T94A 2N4CA 1IKYB 2GQQA 4ANDA 3DCAA 3ADAC 1NJWA 4IYQA 5A8KB 4UOGA 1DJ0A 1S99A 2E5GA 5AXNA 1MROB 4F3OA 2OMLA 3G87A 3QT6A 2FJEB 3HHDA 4C3LA 2ZZNA 2B5JA 4NXMF 1Q7LB 4NCAA 4F4AA 3BSOA 1FFWB 1XEZA 5T7LB 2XWXA 1IKYA 1TMMA 2XMVA 2HRYA 2IM2A 3CSKA 5A8KA 2N82B 2A18A 3ZZUA 2RILA 1MROA 3T9NA 3BBBA 2V2ZA 3PO5A 1NB2A 3PW0A 3KHGA 3QQCD 2L3MA 2ZHOA 5BR8F 4F0MA 4X64J 1TUWA 4DR4F 1XK8A 3LWLA 1KOOA 1DURA 5IT0A 4UOFA 2OPQB 2Y1RI 5T7LA 3MMJA 3CD7A 5CABA 1L3UA 2B4UA 3TZZA 4CTAB 1ITPA 2M2BA 1IQTA 4QIFA 3TNVA 5E0OA 3G6ES 1NAQA 5C7PA 3R5CA 5DS7A 4DQPA 4ELVA 2NSCA 4U9RA 4QWAA 4WFYA 5CYMB 4AD6A 4ZHRB 3B4MA 1WTFA 2C28A 1JJCB 1MMDA 1YKWA 4P71A 1S9FA 1JLBB 2DR6A 3AD8C 4RUHA 2OPQA 2ZOFA 1Q82T 4NLDA 5C25B 4DPUA 1VISA 4CTAA 3QRPA 4J9LA 4MIBA 1SKUB 3TUJC 4BS2A 4B9TA 4CO0A 3KG0A 1EQ0A 2XZWA 4NXNJ 1QAXA 4L72B 3UDLA 3NXZA 5B0DA 4OZ5A 2CNKB 2B8QA 5I3PA 4WZQA 2F65A 3NS7B 4OFZA 3MHYA 5CYMA 4KQZA 3TANA 4ZHRA 4PPZA 1HQ2A 1Q8IA 1ZAXA 4HYKA 5A2QU 4TVAB 1K73T 3AJDA 2CPXA 3ZO7A 1JLBA 3G8TA 3ILIA 2DIVA 5ETTA 2F63A 2V4JB 1O51A 5KFQA 2DHXA 1N36J 3PY8A 5KOXA 4LQ9A 4EI2A 4QYZK 5I42B 3MPDA 1TVRB 4OMFG 5IQ6A 4YFUA 4KHPF 2DVIA 2G9OA 2UUWA 1YJTA 2ATCB 2BQ3A 2FLOA 2B51A 5KT6A 3H2LA 3MR5A 5A6PA 3U1NA 2H51B 1D9DA 1RT1B 2G0CA 4CDIA 2F40A 4NL5A 3U1MA 4QWEA 2VBYA 1VBZA 3CMQA 2XBPA 3VGTA 2P9CA 1B7YB 3LP1B 2V4JA 2Z8QA 2VC1A 3CPWR 1IKWB 4JV5F 4OJ3A 5I42A 1TVRA 5H9EK 4F26A 1FO1A 2BJEA 2E5LJ 4ZVEA 4DDFA 2XLIA 2GMHA 4NLRA 2HNZB 4A48A 2RIJA 2RH3A 3OTDA 3CVKA 2EK6A 2KHDA 5L38A 1R31A 2E9ZA 3CUNA 1RT1A 2WBRA 2IRUA 5I4MA 3JSYA 3D6MB 1X9MA 2GJIA 3BREA 2CJAA 2OH2A 3LP1A 1RHQB 3J80Y 3W65A 5IS2A 1IKWA 1WDTA 3CJ3A 5GAHU 1RA7A 1JLGB 2RF2B 4L76A 3R1HA 2KN4A 3BQ0A 1YK9A 3TVKA 3UFCX 2HNZA 1TP7A 4JV1A 5CXTA 2GAHC 1RISA 1TMJA 2W4DA 2AGPA 1NB7A 1NCLA 5E2QA 3SXLA 4F50A 2DNNA 4RW4B 1NKCA 1UVMA 4YDDB 3NKYA 4G3IA 3IGNA 5E3AA 1KN6A 2K7KA 1WC6A 2OI2A 1KRPA 1WORA 3D1QA 1JLGA 2RF2A 3N4WA 1C4AA 3GP9A 5GMDA 4YY3J 4YR3A 1RKIA 5K8PA 1Y7PA 2HGNA 3KDOA 4DV6F 1SV5B 5T41A 2PI4A 4LFBJ 2AZ1A 3GLJA 3HLUA 3SSQA 2ZJQQ 3BQ2A 5D8HB 3NRBA 1G1XA 5IM0B 4RW4A 1O0PA 3OTEA 1NRKA 2AP6A 4O3QA 4QIGA 3SI8A 2KVIA 1RAFB 3P5BP 1ICEB 3FGVA 3SBMA 5LXRA 4DPXA 1GMWA 1P1LA 1RCOB 3UD3P 1H2UX 4DUZF 5B08A 4GRSA 5DRKA 4WBFA 4XPCA 4RX6A 3J7ZT 1HWLA 4NE9C 5IM0A 4JI5F 4NZ6A 4URQU 2O5DA 2W9AA 3X1LB 2BBEA 5HK4A 4PG4A 1TV6B 3CDAA 2R7TA 4YN3B 4Y3CA 3K5MA 2KT5A 1RHMB 3OT9A 4USIA 4B3RF 4L3KA 4Q45A 1SCJB 1AFIA 5L9XA 3FMBA 3RG6A 1M1GA 3VQSA 4I64A 3CC7S 1BWEA 2DITA 1RK8A 2XLJA 1ZA1B 5FDLB 4ZK7M 2QA4G 1NDPA 2XMUA 2OTLS 2OO4A 3CGIA 4OYIA 2ZH9A 1L3SA 3VR1A 3TAPA 5DDOC 4ER8A 2V2QA 3WBZA 3VVTA 2PE8A 1TV6A 5F8GA 2VOPA 1WF1A 3ET6B 5IC4B 1RBLA 1OYEA 2ZH4A 1NBEB 3KOAA 2UVUA 2N4DA 1RU2A 2WVBA 2VQEF 4OLPA 4K4UA 2XI3A 4C97A 4ELTA 1RBAA 1BY9A 2FJWA 2OPPB 4I69A 4U7UD 4PWDB 5FDLA 3FRYA 4ED6A 1VQKS 2V0NA 4C8ZA 2RDDA 3JQJA 5F8NA 1M5SA 4MIWA 1QSSA 4UF4A 3R5AA 3U1LA 2BV3A 2HS4A 3H98A 3UNYA 4CLWA 5L46A 2F4VF 3ET6A 2MTLA 2KZZA 4UZCA 1TKTB 4LF9J 2QLJB 3VWSA 4HH1A 5L1KA 4RKUC 2R7UA 1G6BA 2GQCA 3KHRA 2BJ7A 2M0GB 2VDIA 2IYIA 2OPPA 1VJWA 1N32J 1KSPA 4ED1A 4PWDA 3RUBL 2OPSB 2EG1A 2XZTB 4C0BA 4C98A 2R2RA 3ZTOA 4M94A 3MR7A 5DG8A 1WG5A 3QIDA 2GCFA 2F4FA 2QA1A 2BM1A 4A47A 3WIUA 3AY0A 4PXBA 3NL0A 5L1LA 3D5MA 3QBCA 3QGPA 2Z2YB 5KFCA 2D74B 3KHHA 3J81U 1K44A 3TZWA 5KFHA 1OPIA 3K5LA 2EWHA 2CQCA 1TKTA 3NGSA 2FVCA 3FZ2A 2HRTA 1LNQA 4PG5A 2KFZA 3RRHA 2UUAJ 3GE9A 3T5HA 4WFAQ 1SI9A 3G6XA 3W5XA 1QTNB 4P75A 2OPSA 4CIOA 2KL8A 1HBOB 2JZ5A 1UVJA 2AKWB 2U1AA 2NXNA 2UVWA 2W9BB 2BYCA 3V4MA 2CQDA 5KFNA 4U7UK 4UY85 4O3NA 1Z1ZA 3RB3A 3PFEA 4K4TA 2NUUG 4ED7A 2JVRA 2ACMA 3G2XA 2QV6A 1NPPA 5DJBA 2LEBA 3W63A 5ETNA 4X4UA 4ZJOA 4WP8A 3GFYA 3AB2B 3ZZ0A 4DQRA 3P6YC 1WEZA 2BOAA 4OI3A 4FYWB 2GO9A 2C2ZB 2Q6BA 2PA3A 5KFPA 3KFWX 3S8SA 1HBOA 3HSJA 1MNEA 1B99A 2W9BA 4JI3F 2RDJA 2HK2A 2VB6A 2V67A 3M2UB 4K0KF 3CCES 1VIOA 2IMOA 1CEZA 2YKAA 3R7BB 2JJ4D 4H54A 4LRDA 4TN2A 4DV3J 2HHTA 1EX8A 2UXDF 3IA0A 4DZ6A 3T9ZA 5KAKA 3WC2A 1RB0A 1H0HB 2CPJA 4EBCA 1QVFR 4L73A 4KE5A 2Q6CA 2VG6B 5D6GA 4FNIA 4NYPA 2LU1A 4QYRA 1Y4ZB 3M2UA 4USHA 3G8SA 1WUUA 3CJ4A 3CMES 1VLOA 1F6TA 2R8IA 5J2MB 1RLDA 2E9TA 1QD1A 5LSLA 1BHNA 4HI2A 2UV8A 4OZ0A 2R7VA 3AD9C 2C2MB 2FVSA 2VG7B 3IBCB 2I1RA 4O44B 2C42A 4EGLA 5JUMA 2PC6A 1EKSA 4WZMA 2AJFE 2VG6A 4S0MA 2HNYB 2VD3A 2ZH3A 4B17A 5CHCB 4NA1A 3PZPA 1WHXA 5LT5A 2WOMB 3L95X 2UXBJ 1FDNA 5J2MA 1U8SA 4Z7CA 3OL6A 4ZVTB 2MHEA 2LP4A 1H38A 3FCWA 2NXJA 3HX9A 4XPEA 4Y2MA 4LFAJ 3FEXB 3M8SA 4DSJA 2IM3A 3I0SB 1K0TA 2VG7A 4IOBA 4LRBA 4ECXA 1KVJA 3M4XA 2GJFA 4O44A 4TQRA 3ZNUA 3Q83A 3H2VE 1WC0A 1WD6A 3IBWA 3M8WA 2HNYA 1GX5A 2XGPA 1GT8A 1S5ZA 2WOMA 1UEVA 3QJLA 2EK1A 3KLGB 5IZHA 2WRMA 2RQCA 4QU7A 5KFBA 2RT3A 2I38A 2VPYB 4X62J 4LR7A 1GMUA 3I0SA 4RPFA 4HLBA 5MLCV 2MLZA 2R7RA 3E01B 5KTQA 1NJXA 4DR1F 1NKEA 2UU9J 4J37A 2H1YA 2CPEA 2F7VA 3O44A 4DSKA 2R8GA 3FEZA 4Y0FA 3WZ0A 4R8UB 1HNWJ 1RT3B 3KLGA 5F41A 4P73A 2MQPA 1T0TV 3OQ2A 4O4RA 2HWTA 4J7CA 2YNHB 1B4SA 2BACA 2VG5B 5IOLA 4IOAQ 3MD1A 2GHVC 3E01A 3V81B 3DOMB 3OUYB 1H6KX 1QSLA 4DN0A 3G9CA 2EI5A 3S7RA 2E66A 4V19J 4R8UA 2NCKL 1RT3A 1HWIA 2WB4A 4BC9A 2ZNZA 3Q8SB 4FXVA 3QJPA 1U09A 4JYAJ 3LA0A 2DHGA 1MWYA 1ZAVA 1Q78A 5GADU 3LWMA 3IXQA 5B0EA 2YX1A 5KFTA 3SV4A 1R8BA 2MQNA 2P5VA 2YNHA 4N41A 2VG5A 2F8MA 3NOGA 1TAQA 3V81A 1DAXA 3ZZOA 2DBBA 3NNCA 4B02A 4WU2A 3DOMA 4DR3F 2NS1B 3OUYA 4LVNP 1IUJA 2ZM6F 2VPZB 2RD5C 4B9SA 4U95A 1K9MT 2MLXA 2FIUA 4ZA1A 3QRQA 3TP2A 4QWBA 2VFUA 2XS5A 3GZ7A 4RR5A 2AGQA 3MOZA 2FY1A 2JLGA 2LEAA 4F4ZA 1QTMA 1EZZB 4X4PA 3FKBA 1G4CA 4J9RA 2M88A 5KG4A 2Z56B 2MSSA 4RNHA 4F4WA 3EICA 4Q2MA 3CJKB 3TARA 2JFDA 3M9NB 4ZP8A 2CJ9A 3VCDA 5HAOA 3J7AN 2D7SA 3FJ2A 3C46A 2YH0A 4QYZJ 4DF8A 1TU0B 3RAQA 3GWCA 3D66A 2QX0A 4CO5A 2NUHA 1J27A 5E3CA 3JYTB 3RB0A 3PYGA 5LL6d 3HM9A 2HBRB 2CFXA 5HANA 5K20B 5LSRA 3BJYA 4ZP9A 5CCLA 3BDPA 4DN9A 4Z7YA 3T6JA 3CJKA 1F2GA 2IC3B 2YWKA 5H9EJ 1PC5A 2R4FA 4PG6A 1VBYA 1JXLA 2AX1A 1HQEB 3JYTA 2BRLA 1YZ6A 1WI6A 2ERRA 2JEGA 3KUGA 4ILLA 2ZJPQ 4RW8B 1TELA 4L75A 3TZXA 4CQ1A 1HIYA 3JS9A 1FA0A 4DPTA 1I51B 1VQSA 2ILYA 3HKZD 3I32A 2DPJA 8ATCB 2FZKB 2IC3A 1KR4A 2I0XA 2B9WA 1D3WA 4ZN3A 4Y2KA 4ES2A 2GVDB 1HQEA 3OD2A 2DYAA 4K7QA 1U1KA 3KLHB 2VUGA 2AJQA 4RW8A 1ZH5A 1L3TA 2ADCA 1RGVA 2C3UA 2RAQA 3POTB 1YZ7A 2FD2A 3SIPB 4OZLA 1LXNA 3A13A 3W66A 2D9PA 4RO0A 2LQ5A 5KFKA 3ETMA 5E41A 4LF4F 1PJ7A 1I5OB 3P49B 2VC0A 1U0SA 4DV0J 1JJHA 2C2EA 1RT5B 4DS4A 2ZWOA 2WK4A 3RTVA 3OR1B 2HEKA 1NZ8A 4WP3A 2GW8A 2GVDA 3DLLQ 1HFEL 1V3ZA 2MQ8A 4N76A 4G65A 2F8HA 1FFGB 4X65J 3KLHA 1OSCA 3I82A 1FVSA 4MFBB 5HJXA 1LFWA 3POTA 3J81Y 4PRFA 3DU6A 3M8ZA 5C2CA 3TAQA 3NEKA 3F73A 1YJ9S 2CADA 3DMJB 1XMBA 4OJGA 1RT5A 3KJQB 4USTA 3OR1A 4BC7A 1DZ5A 4ID5A 3Q8YA 4QIEA 3DRYA 5LJ3Y 4YHHF 3F0NA 4YB7A 2IA6A 2YXLA 1IR0A 4Q43A 5J1NA 3IC1A 4MFBA 1QUPA 4UQTA 2FC9A 3D1OA 1IKVB 1D8ZA 3DN9A 4DV7J 4GO5X 2VKRA 3EVOA 1NJZA 1X7VA 1RLCL 1S1UB 3R5GA 1T02A 1FD8A 3DMJA 1BQXA 2KU7A 3MM9B 2C2RA 3L7PA 1JJ4A 3Q0AA 3CULA 3AOCA 1MN9A 1NK8A 1NMEB 2J9CA 3JAMU 1KQSR 5DLFA 2MYFA 4DUYJ 4X66J 4USUA 2XNQA 5HMZA 3T41A 3FBBA 3UO0A 2NZ4A 2CDQA 2PEHA 4F67A 1ZTWA 1IKVA 3GR1A 1MW7A 4LQ3A 3MM8B 4ALZA 2YKQA 2QTWA 2P9EA 3W9JA 4DL4A 2CDRB 4CM2A 1S1UA 3CJRA 1I94J 4JI1F 1KS2A 3J81j 1C4CA 3MM9A 1NJIT 2CXEA 1WC1A 2ZC3A 3GSDA 1UZHA 3H4BA 1F0XA 3B78A 3HO1A 4CO4A 1Q7YT 3CCQS 3A8KA 4OHWA 3K0JA 3C14B 4B08A 3LPEA 1K1QA 2FHJD 8AT1B 4B3MJ 3MM8A 1S7HA 1HWKA 1SKWA 1Y11A 2QLFB 3GFXA 2OD4A 3RBZA 2HBZB 4M5GA 3PDNA 2CQ1A 4DR2J 4M95A 3KJFB 3TQ1A 1BC6A 1RWNB 4I2PB 3SFGA 1KQKA 2N3OA 4EO6A 3C14A 1RHRB 4OQJA 5D4PA 5D15A 4JV0A 1U1LA 3H42A 1RUSA 4JI4J 4NCBA 3ENWA 3QT5A 1PG5B 4QR1A 3SEOA 4DX8H 4NXNF 1SB6A 1XR5A 4IDKB 1YJUA 3IR6B 1KFSA 1RACB 1S57A 3UCZP 2PT0A 1A6LA 2R7WA 4A8KA 4MTPA 2MZ1A 4Q2LA 1F9FA 4I2PA 4C8KA 3G6YA 1BD6A 1X4EA 5E5NA 3I9V9 1M5PC 3N28A 1Y00A 2RRAA 4DV2J 1HI0P 3U27A 1H7WA 2ROPA 1BGXT 3DRRB 3TVYA 3WX8A 1U6BA 1IXKA 3I56S 4IDKA 3VAGA 2QFIA 4RNOA 4FXWA 1U2RA 3UCGA 4YB5A 4K59A 2F3JA 3SMZA 3NMAA 4P2FA 4NASA 3QFHA 1NO8A 5CA5A 3U7JA 1SQGA 3BYPA 2KO1A 2PGCA 2IDLA 4M1KA 1U6ZA 2YKPA 3LGMA 2CJYB 2CA9A 4OIXA 1GAOA 3DRRA 2NZCA 1OMSA 2E5LF 4M5MA 4NLUA 4Z37A 3IAM9 5D0GA 3EMTA 4Y2CA 5KFUA 2VBZA 1FEEA 3GQCA 5I3UB 2IVYA 1RWXB 3D28A 5GMKa 4ZVGA 3LF0A 1FD2A 3SCKE 4DSIA 4IO9Q 4MKYA 3FBFA 1Q8LA 3KTQA 3FZBA 2V8PA 3TEGA 2XYPB 1R0BG 4ECVA 3V6KA 3CD5A 4QPTA 1PKUA 1IBLF 4LBPA 1L3VA 3FCVA 5I3UA 4U8VA 2HIYA 4J9OA 2KRRA 4PWUA 1VQYA 3M1VB 2L9WA 2YKNB 3CO0P 1Y3KA 5JXSA 4R0JA 3GONA 4DL0C 2D3ZA 4OHXA 5D77A 3DXSX 2KI2A 3ONQA 2Z2MA 4LBHA 1Y5LB 2HZCA 1PYTA 4J9NA 1OO0B 4FN5A 2H5EA 1U1OA 2D3OR 3RR8A 3WDOA 3TJ9A 1FKAF 3J7A1 4J9SA 2XEXA 4MK9A 2J9DA 2BKPA 3M1VA 2ZKUA 4XAKA 2RUGA 2YKNA 1FESA 1YX2A 3ZTQA 3AAWB 1DQ8A 3HFZB 2YNGB 1R0AB 4G1IA 3RU0A 2PMHA 2ZOGA 4N5SA 3D1HA 3M6VA 4F2RA 1D09B 1VBXA 4F3MA 1FRKA 1FX4A 3GR0A 4OYBA 2V34A 3GYNA 4NLOA 3NNHA 1R89A 1RAEB 2FJBB 3MCNA 1R8PA 1R7IA 3I0RB 3D6FB 4X84A 1TK5A 5J1EB 3B8HA 4HL9A 2DTJA 2YNGA 3CDEA 2G2ZA 4ETXA 1R0AA 3K17A 1RTHB 2O66A 3PJXA 3U02A 2R8KA 2ZBPA 2AHOB 1U26A 5KG5A 3UWTA 3W5YA 1M1HA 5EN1A 4ES3A 1QVGR 3IR7B 4ELUA 5HVHA 3W9HA 4CRJA 4C4WA 1Q53A 1OY8A 3I0RA 2HLUA 2AYEA 2MGZB 4WFXA 1UJ5A 4OX9J 5J1EA 1URNA 1LOUA 2XZDB 1J5EJ 3CTRA 2XI2A 6FD1A 2XMJA 1RTHA 3ZTSA 3KLVA 3TO8A 1BQMB 2OHDA 3R6GB 1GXUA 3IRXB 4LT6A 3QNWB 5M2RA 5EWEA 3VF0B 1Y10A 2CPFA 1IBKF 4NLPA 2O1PA 3JSRA 2W7AA 1HR0J 2K3IA 3EZUA 1O5JA 4R25A 4X4SA 2CPYA 2MGZA 1GMWD 2CIMA 2JC1A 2R7QA 4ZN1A 1XMQJ 2LQBA 1ZTTA 2J6TA 3GCWP 3KLFB 1FVQA 3MM5B 1BQMA 3GJSB 1V3SA 2DB1A 3BGRB 1SC1B 3MUTP 3IRXA 2FHOB 4NLYA 3D0HE 1EHWA 2K3KA 3DOKB 3RRGA 3TYTA 3RGIA 5T14A 2EEYA 2MQOA 4X4VA 4DBQA 1U49A 2Z4PA 3QT7A 3KWMA 1HBMB 4NZ0A 1LV5A 1FHTA 3H5XA 4DPWA 2IHR1 1PC4A 2DO4A 3MM5A 2K1RB 3BSAA 2UUAF 2A10A 2HS0A 3TRGA 5LMUF 4C2MA 3BGRA 1YBUA 2V94A 1NDCA 3UDVA 3EUNA 2WTFA 2HLTA 3DOKA 3IM9A 4P10A 3R9LA 2YWGA 1F9EB 3T1HF 5CAAA 3OTOF 3NCPA 2LDIA 4M63A 4NA3A 3H20A 1HBMA 1KEKA 3Q2SC 4LR9A 3VGUA 1WSVA 1DQ9A 3X3UA 4ECQA 2K1RA 4PQUB 1Y5NB 2QLXA 2XHWA 2DRDA 1S6PA 2WCXA 3HF5A 4CH1A 5B0FA 4C6AA 4OV6A 2M52A 1DTQB 5CD4A 4DOZA 2X1BA 1F5AA 3PHTA 4OHZA 2DNPA 3TW0A 3GG1A 5L9NA 5E3QA 4ZVFA 3HFKA 3CCJS 1C1BB 4CT8A 3P3DA 4CLLA 4DX7A 4AYBD 3DI6B 4YP3A 3MEDB 3EJMA 3UCUP 2JOQA 3OPKA 1PILA 4PQUA 3Q8PB 1VHFA 1B0TA 4C8LA 2A6MA 2MKJA 1HHQA 4IH5A 5GAGU 3PX6A 2PEBA 3AFGA 1NEEA 1V6HA 2E1MC 2JRSA 2PI5A 3PRVA 2AJ1A 1DTQA 1DARA 1JB0C 1P6TA 1R8HA 5KFOA 4MJKA 4G6VB 4IQMA 3OXGA 3MMCB 1LXJA 4RLEA 4JI0J 2EFPA 1S0VA 4K5RA 5KFWA 2G13A 4IFVB 2KM8C 2PA8D 1RTJB 3DI6A 3HVTB 1N54B 1RT7B 5FJ4A 2V8VA 3DLJA 3MEDA 4CLSA 1RA6A 1GTHA 2FDNA 1HPZB 3DLBA 3PM9A 2RNEA 3HKWA 4DR5J 1DRZA 4FBTA 3DLGB 3UNGC 3OL8A 2HQIA 4DL7A 4H4OB 4C8MA 2I2YA 4DV5F 2WAQD 3EDRB 1FKPB 3MMCA 3N5FA 4UOHA 3SCLE 1S9EB 2RHSB 2M5YA 1CLFA 2DNLA 3IP0A 4ZPTR 1HI1A 1T9YA 4IFVA 4RBVA 1RTJA 3HVTA 4PZVA 1RT7A 2JC0A 4EZ9A 5CYQB 3CNQP 2IBKA 4B9NA 1XERA 2D9OA 1HPZA 4DU8A 4DV4J 4LFCF 4DR6F 4HR2A 2YWFA 4FF1A 4PXEA 3DLGA 5DQIA 4YUDA 1V5IB 1NPKA 3EGNA 3B54A 4N77A 2K06A 2L41A 1T8EA 2HFNA 2FVRA 4H4OA 3MMBB 2HYIB 1RAIB 4NCGB 1FKPA 2AQ4A 1P9YA 4RW6B 1S9EA 3G71S 4OYZA 4P2SA 3MZIA 5IWAF 3I96A 2VA2A 3DLHA 5U47A 4EMDA 3LH2S 4ZKAA 3OBIA 4JOUA 2E5HA 5CYQA 3M8PB 1ZS6A 3K8WA 4KSEB 2V63A 1GQEA 3DRPB 1XIQA 4A8MP 3IG1B 4C0OC 4ED4A 2F5GA 5LMNF 3B6BA 4PXCA 2EC2A 2VFRA 2KM8B 4TU7A 4P52A 1TR0A 4GVBB 4HTIA 3MMBA 1U45A 2ZHBA 4NCGA 4A8YA 4AUKA 3EPGA 4RW6A 1XR6A 2XS2A 4PPDA 2XB2D 3J80U 4LF2A 5BYQA 4X4NA 1X4AA 1F5BA 3BH7B 4FF4A 2D3UA 2ABYA 2B9YA 2OIHA 3GFHA 3M8PA 3UDCA 3EE3A 3DRPA 3TOQA 3VTIA 2DR8A 3NAIA 3IG1A 4P9SA 3I5CA 2XHCA 3CEDA 3DRXA 3K5OA 2W24A 1XNQJ 2Z30B 1LWCB 4KO0B 4GVBA 1WC5A 1EJ7L 1H2TZ 1LW2B 4ZPWR 3ZTRA 3NWGA 2YWEA 2F8EX 1R8CA 2E5JA 3Q23A 2V4QA 4JBCA 1DTTB 2XO6A 4FYVB 2W2QP 2JLFA 1FK9B 4KAIA 1X9WA 3KHLA 4DWIA 5IXUA 2CQPA 1A9NB 2HPUA 3B4DA 3BGFA 1N0VC 2CWKA 4BHQA 2V9KA 1JLEB 1JWWA 4JYAF 1LWCA 1Y3JA 4KO0A 3W5ZA 4NXMJ 2IRXA 1LW2A 1VQOS 4IRDA 2DNZA 2A6OA 1SL0A 2Y1IA 4RW7B 1JIHA 5ETVA 1DTTA 1M5OC 5A0YB 8RUCA 4OZNA 1FK9A 1PAEX 2HVZA 2QRRA 2IJFA 5H9FK 3J7YU 2OP5A 4O3SA 2XMKA 2DO0A 5K8MA 1CJUB 2LEPA 1TL4A 2FLPA 1YQHA 4DSEA 4F0KA 4DSLA 1JLEA 3BH6B 4ZP6A 2BM0A 1U2CA 2MB0B 1FTRA 3AQOA 3D6HB 2JVOA 3R8YA 1RWWB 5BR8J 4ZVPB 4MKBA 2KDOA 4DR4J 3K2YA 1NDKA 2MKKA 3MFHA 3KJNB 4B9LA 1AYEA 3AXKA 4ZVRB 5DG9A 4RW7A 5A0YA 4QBUA 4XDDA 5SUHA 1SH2A 2DGQA 1GEHA 2RU3A 1ULRA 1IM6A 3LP0B 1CJUA 4C9DA 3WHIA 3L9ZA 4LF8F 3Q8RB 1N5VA 2W2MP 3L09A 2HHHJ 1JK9B 3BM7A 4YOEA 3QIPB 3HK2A 2CVIA 3ZNJ1 4H4KA 3R2CJ 4ZPCA 2HQGA 2DISA 4WPAA 1WG4A 3RR7A 1VQ6S 1KLNA 3GCXP 5D4OA 3NBPB 2PFFB 2VIHA 3PX0A 2HHXA 4IR9A 4A4JA 3LP0A 2W4PA 2KRBA 4ILRA 3M6UA 2OFHX 1PBAA 3BN4A 3TI0A 1RWVB 2R8JA 1HNZF 1MG7A 4AQYJ 3QIPA 3S6EA 3DC2A 2HS3A 1G7CB 1ROFA 4EU0A 4A8SA 3NBPA 4KBIA 1VHIA 4KR0B 4KFBB 2DH7A 4KHPJ 3VAHA 3EDQB 4EEYA 5HMWA 1NM2A 5L1IA 2QGFB 4J91A 1W7WA 4KYZA 4NLGA 1XNRJ 2H5JB 2NQPA 1LWXA 1SXLA 4OYMA 4CH7A 2WVDA 3JSMB 4CO1A 4JV5J 4KFBA 1JMTA 4CP5A 5KFMA 2JHEA 3R5JB 4JI7F 1BUXA 1L5UA 4DFJA 1RWPB 2MKHA 1TTHB 2R7SA 3RW6A 4Y34A 2AYGA 5HROB 3PTWA 4FYXB 4YR0A 5ADZA 3UPFA 2OEKA 1L3KA 1UFLA 4ZLJA 2FTRA 2V8HA 3QZ8A 1IVZA 4CYUB 3JSMA 4AT1B 4CZCA 5DDQC 4LUBA 1OYDA 1QAYA 2LQ8A 1FX2A 4BDPA 1LQ9A 3MR3A 2W8KA 4WTYA 3MECB 3W1YC 4WWSA 3C8YA 5J2PB 1RAOA 1NK0A 4EUVA 4HTJA 5HROA 3UR0A 5BYSA 1OSDA 1ZZFA 1T9VA 4LIRA 1VDHA 1LK5A 1ZM4A 2HHWA 2LDYA 5HVFA 1XJWB 1W25A 3TVZA 1IR2A 2Z0GA 1N88A 2L9NA 1UKUA 4CYUA 2ZBRA 3JTNA 5ETOA 2D1CA 5KFSA 2QL9B 1TUVA 3WC0A 1WEYA 4HDGA 3RZAA 5C2GA 2X3GA 3MECA 1X8DA 2DY9A 5J2PA 2QC3A 1BLUA 1NHKL 1LW0A 1XN9A 1NKBA 1FNXH 4DUYF 1AROP 3DHXA 4LBIA 3KUEA 4X66F 1D0EA 5DDPC 3CJ5A 2MHNA 4UUWA 1PYOB 2CPHA 4OYWA 2WB1D 3PYEA 5KG2A 2AU0A 2DGXA 4FPRA 1FJEB 1SL1A 3THVA 1RYRA 1HW9A 3IBFB 2CG4A 1NSAA 3IAS9 1B0PA 4E98A 1OQ6A 3TWZA 4QQBA 2QLWA 1MSWD 1UMJA 4ZJQA 3NGDA 1HD0A 4JV2A 3CXCR 2IJNA 4DUZJ 1RI7A 5DQHA 3LANA 4WKRA 4WXWA 4NYZA 4JI5J 1KWMA 3GIKA 4FYYB 4WIQA 2PD1A 2XM3A 4B3MF 5BJRA 1UA1A 4O3OA 2C3OA 1OY9A 4ED8A 1TKDA 4B3RJ 1EKRA 4CO3A 4B3SF 4OJ1A 3UN3A 1RABB 4NMLA 3DLKB 4N47A 1Q95G 1FDBA 3Q8UA 3NWRA 1N33F 2CPDA 1FKOB 4KIAA 3HHLC 3HSDA 5DG7A 2ASYA 3DDKA 1UVNA 1N0UA 4CWBA 5EX0A 3HXMA 3MPYA 1HHTP 2VQEJ 1BWVA 3DLKA 5BXIA 1AFJA 2HSEB 1QSYA 1EQMA 2IJRA 4JI2F 4IG3B 1B0VA 1U1PA 4C8OA 3N0VA 3CWJA 2DY1A 2IIHA 1FKOA 2CJBA 2R42A 2FB0A 4F7VA 1CVJA 3KNAA 3AJ1A 2ZDPA 3ZC4A 4ENOA 1VQ7S 3G82B 4LVOP 1SPBP 5HJYA 4DCPB 3KMQA 2F4VJ 2V9WA 2YNIB 5KT4A 4LJMA 1UTAA 4MKAA 2R2UA 2H4YB 4TY8B 1OS5A 3BBFA 2AEFA 2ZE2B 1UFWA 2MPUA 3C6UB 2K2PA 3BN7A 4CCHA 3DOLB 1SH0A 4XO0A 4IG3A 2VH7A 3GG0A 3EZ5A 2W2OP 1FCAA 1H73A 4WFNQ 2DHHA 3R1LA 2JEIA 5C42B 1I6JA 2A0FB 9RUBA 3G82A 3RW7A 4X2BA 1FRMA 1SBRA 2GIFA 2YNIA 3IN5A 2GA7A 4TY8A 2LXFA 3ISND 2W4CA 1R6VA 1FXRA 4C11B 2XMAA 2ZE2A 3PCOB 2CZ9A 3HHLB 3C6UA 1RAJA 3H0PA 1Q8KA 3DOLA 1DY3A 1R3NA 9ATCB 2XMMA 5GAEU 1WJ9A 2DGUA 5J2QB 1RAHB 3RYLA 2CKWA 2WW8A 5C42A 1YWXA 1SC3B 3H59A 3E2EA 3QZ7A 4L74A 1M1KT 3THPA 1VQ8S 4J90A 2Y1LB 3HD1A 2MQQA 3AT1B 1AXQA 4TNOA 3GYXB 2XGQA 4MMOA 4QCLA 2DKOB 3P96A 2UUBF 4USWA 4C11A 1X4FA 4C7QA 1R8AA 3HHLA 3KLEB 2W7OA 4EK2A 4FVMA 2F9DA 3THTA 4WF9Q 4DZDA 4KH0B 4CO2A 5J2QA 3H7HB 3CJSA 4IH7A 1LWEB 4JI3J 1RADB 4KGVB 1UAWA 3AB4B 5A76A 4K0KJ 2KXNB 4NRTA 2IM0A 2CNNB 2EBEA 1YTYA 2E1AA 4CLUA 5F9LA 4DL2A 3KLEA 4E8UA 1D9FA 3ZTPA 2OJ3A 5CYJA 2UXDJ 1FNMA 2ZFHA 2NXUA 2KJVA 2FZCB 4UY8T 2HWIA 3HP6A 3W62A 1ZM9A 4HVZA 3BPSP 2ZITA 1LWEA 1YSJA 2E7WA 2ZJRQ 2VDHA 2W8LA 4FDFA 4K4WA 3T1YF 3PXGa 1XMOF 3T6BA 1Y0HA 2QL7B 3CJ2A 3C6TB 2R3VA 3NGTA 2QEXS 4WCEQ 3GYGA 2HAIA 4YR2A 4QIWD 4FS1A 4J9UE 2YH1A 3GIRA 4DL5A 1VFJA 2A3JA 2RQKA 1GTEA 4WK3A 5AJ3F 4RJVA 1HNXF 2MZRA 5CCMA 1FTCA 4M5JA 2ZVIA 2C3PA 1CBKA 2QO3A 1S9GB 5HMXA 2HG4A 2HFUA 1MU2B 2XO7A 2V2KA 2V4RA 3C6TA 4AXIA 4NX9A 5K14B 3DU5A 5HP1A 2DR5A 3A8IA 4I1TA 2R7XA 1WTBA 5IT9Y 4QW8A 4OZ2A 3IWLA 2J9EA 2FJAB 1AW0A 4HT7A 2NSBA 2JSXA 5HLFB 2Y8WA 3W64A 3QJJA 2BW7A 4LSLB 2OKQA 4RUAA 2RB7A 1S9GA 5EWFA 1S7IA 2VKZG 4U96A 3PW2A 2XYGB 1RT2B 4IQXA 5KT3A 1MU2A 5F0UA 1VIXA 1YITS 2PO4A 3OSNA 2UUTA 3NGUA 1UCNA 3QGIA 2H54B 4DCJB 5K14A 1S4FA 3NOCA 2B43A 4PYDA 2VU5A 3PEHA 3N9UC 5J1PA 3FMWA 3I55S 1PGZA 2HQFA 1CC8A 3HCXA 4N7TA 2M7SA 4NMXA 1EIYB 3W2WB 3VZIA 2E7VA 1XR7A 3BR8A 2KT3A 5HLFA 1ZBTA 4LSLA 1SKSA 4DR1J 2J9DE 3UE2A 2MZJA 5D0EA 3ULHA 1XMQF 2BQRA 5DGAA 4A8QA 3OW2R 1RT2A 2MMYA 5AE3A 1X5OA 2B6AB 2UUCF 3AOBA 4M5LA 1FDAA 5H9FJ 3GPAA 2MEWA 4HH0A 2BXJA 1U2FA 1SJ3P 3SFUA 3W2WA 4NEYA 4OZ3A 1U8WA 3HZEA 4AL6A 2E1PA 4Y2AA 2O01C 5EWGA 1AZSB 1RAGB 4QJVA 2UXCF 2NYIA 5DM7Q 1N6QB 2Q3PA 1OWXA 1KVKA 4OYOA 2B6AA 3M30B 4FP9A 3PJ9A 1RTDA 1EAYC 1S1XB 2OEJA 4FKYA 4HACB 1A0OB 3SV3A 1RWMB 2JL9A 3HPOA 4B3TJ 2HHPA 4U6PA 2ZEJA 1TL1B 2CPIA 3OL7A 1WWHA 1B70B 1V3RA 2RSQA 2P6SA 2JX2A 3JQMA 4LF5F 1AZSA 3FNNA 4DR3J 5KT2A 2AD9A 2BDPA 1N6QA 3L4BC 3GJQB 5KFIA 2ZM6J 2KXFA 2UV8G 3MI7X 3M30A 1EARA 2QN6B 2ZH8A 4PQAA 1S1XA 2J76E 2GHPA 4HACA 3K8VA 5KFVA 3VHQA 5K8OA 2XC9A 3I4PA 3M8YA 1QAJA 3K5PA 1TL1A 3G8QA 2JH3A 4E2FB 4DV1J 3AA8A 1FJGF 1BMQB 3NCRA 3AD7C 2HHVA 1VK3A 4IRKA 3LGNA 4ZVSB 4PUOB 3GILA 5DDRC 4PG7A 3NG8A 5KT7A 5JMNA 4ILMA 3SCIE 1VR6A 2ADBA 3IR5B 1BXNA 1CS4B 3QSIA 4JI0F 4GKJF 2HZVA 4PKDB 3FUYA 1WG1A 2DNGA 3T1AA 1X5SA 3CCLS 4ZIWA 1K1SA 1U1QA 3R2DJ 2F9JA 3CJ0A 4PUOA 2DT9A 4RUCA 4PCQA 2J7KA 3FEYB 2J6SA 3ILOA 3HHEA 3OHAA 3PVXA 5LJ5Y 2GHWA 2L9DA 4OX6A 1CS4A 2DGSA 3OFGA 2GIQA 2GO8A 3SCJE 1GFWB 4PXDA 4RU9A 2XNRA 2OEMA 2BE9B 1GXLA 3JB9k 2O3DA 3W2VB 4EZ6A 1U24A 2B9XA 2HQ3A 4I4BA 5ETLA 4N56A 4DS5A 1RHJB 4DV4F 4LF6F 5K9FA 3HSGA 2R9LA 1T3OA 2CQGA 2MJUA 4K4YA 3KYLA 1JKHB 1GNKA 2BKOA 2J8AA 3QO9B 1RWOB 2W2NP 2DH9A 1WKKA 2B9EA 1RTZA 4I6WA 2XCPA 4P7VA 3BGOP 5E3RA 3PRDA 5KFFA 2BE2B 2IMWP 3MTJA 4TLQA 4LRCA 3W2VA 1VQNS 4GKKF 2DNRA 2VPWB 5D3GB 1YJWS 2ZH2A 4LF4J 3VVUA 3M2VB 1TKZB 4XDCA 2B3TB 3VGVA 1H74A 3DDIA 1JKHA 1YBTA 3RAXA 3DM2B 3QO9A 4FF2A 2V5HG 3PW4A 3OFHA 2I5JB 4QU6A 3IRWP 4IFYB 5IV3A 4YQWA 4ZIVA 4DQSA 1Q5VA 2IVFB 1TAUA 3K57A 3EXCX 2BE2A 1FJ7A 3FBEA 1N34F 5KFJA 5D3GA 4NLQA 1HBNB 4NPOA 2M9KA 3M2VA 1S10A 3OSPA 2LQJA 1CJTB 1NK6A 1TKZA 3QMQA 4YDXA 3DM2A 3C19A 2B0GA 3RB6A 1HI8A 4YHHJ 4RNMA 2I5JA 2DNQA 2J7UA 3I5AA 4IFYA 3QATA 1KQGB 2X7IA 3E51A 5GAHI 1KHWA 4ZMMA 3BKTA 1WC4A 1YHQS 4KHMA 4FBUA 3PX4A 2POKA 3ENQA 2JLEA 3UN5A 3CF5Q 4Q0BB 1HBNA 3TA2A 4J9MA 1CJTA 3EX7B 4IG0B 5ITHA 2JWNA 2DD8S 1QE1A 3I9ZA 4OYPA 2BJ8A 4JP8A 2LECA 1HKAA 5GAEI 4YEAA 2BA9A 5HATA 2ASLA 4USJC 2IA0A 1NK4A 3CD6S 2FHMA 3L3CA 2WONB 1V9OA 2VHGA 1H98A 1WOPA 3AOAA 5KFDA 2VBXA 3CJQA 4TKTA 1JJ2R 1XQIA 1AA1B 2KHCA 2GX8A 4J9VA 3BV8A 1C0UB 2CNLB 1TKXB 4Q0BA 3GV5B 4ED3A 4JI1J 4IG0A 5HI7A 4P2MA 2UVRA 2X3DA 2L08A 4IUFA 4MK7A 4FVCA 2WONA 2W7PA 4OI4A 3ZZYA 2ZBQA 4EFAC 2XY5A 1IBMF 2AIRB 4D3HA 3SZ2A 2HAFA 1RHUB 2B4PA 2RMLA 1PIEA 1C0UA 2RQ4A 3TA0A 1LK7A 1TQLA 1TKXA 2I6WA 3AA9A 2GC8A 4DX6A 2WSEC 5ETRA 3W3SA 2DNYA 1NSKL 2HHHF 2YNFB 3H5SA 4ZLNA 2DEJA 4I7FB 3A8JA 4LRFA 5G0RB 5F9NA 4F3QA 4DSFA 3V4IB 2RDIA 5M2UA 2NREA 4BLGA 3H25A 4OI6A 2BMBA 4A46A 2GZOA 3H4DA 4K4ZA 3UN2A 4AFFA 3BBCA 1SJFA 4NA2A 2XSFA 2VASA 3C66A 1K0VA 5DM6Q 1R6YA 1YG0A 4QWDA 3PNIA 1QJHA 3KG4A 2C3MA 3EWGA 4AQYF 2YNFA 2IFXA 4B9VA 3O1LA 4C48A 5KG1A 4I7FA 4W4MA 4F36A 5G0RA 1IM4A 4JI6F 1U47A 5C25A 2XMWA 3M05A 2ASDA 1TK8A 3V4IA 5DETA 5JVHQ 2LA4A 4ZJLA 2PMZD 4NEZA 1CC7A 5SZTA 4DR7F 2X1AA 4P72A 5K5MA 4O0IA 3S01A 2YKOA 4EBEA 4OX8A 3A3NB 5HL7Q 1X0FA 4CH0S 4ID5B 1XNRF 3MM7B 3UD5A 2ROEA 4ECRA 2MY8A 3VQTA 2MZTA 4JI8F 2EKYA 5KG0A 2NR0A 1MMLA 5JVGQ 3NMRA 3ISNC 5CH7B 1E6VB 1WF0A 2G0JA 4ZCKA 2HVIA 2HBQB 2HGLA 4AXJA 2FVQA 1JQGA 3W7BA 3I5BA 4CLKA 2C2KB 1JNRB 3MM7A 1KBRA 3OTCA 3HHNB 5KG7A 3ILJA 3BS9A 2H48B 2H3EB 3OFEA 1U7LA 1JLCB 2CWXA 1HD1A 4CI0B 1E6VA 5DZ7A 1U1RA 2LLZA 3LAMA 4NLXA 3WX4A 2AX0A 2UVVA 4KGKA 1RWUA 4R5PB 4UOCA 3I6PA 1CQMA 1F1BB 3WIVA 3DYAB 2DNKA 2LQ9A 1IBLJ 2AEJA 2FLNA 2J7WA 2VZ9A 4DMZA 3D2WA 4YMEA 3M2RB 1S6QB 1JLCA 1T05B 3L7OA 5AXLA 2OD6A 1JLQB 1SH3A 3OTBA 5E7OB 5K8NA 4AL5A 4KPCA 2DH8A 3UDEA 2MKYA 1QAIA 3EGWB 2DPIA 3RBEA 4R5PA 2PDAA 4ZCMA 3DYAA 4X64F 2AYMA 3ZXWA 3TUZC 3VALA 4OLOA 3KG1A 2J0WA 2W1BA 5I3QA 3GIJA 3F44A 3M2RA 1S6QA 1T05A 2DCLA 1MWZA 4YS2A 1JLQA 3MPWA 1OY6A 1B7FA 3BPDA 1F60B 3AQPA 2FYXA 5L8RC 3MF5A 3CCSS 2NPFA 3P8BB 5MAOA 2BANB 1Q4RA 2ASJA 4I56A 1SV5A 2F1FA 3VAJA 1H3DA 4WTOB 4O23A 3T5JA 1MWQA 4J9QA 1HNIB 1T11A 1NH8A 5D0RA 4K5SA 4UUXA 3MR2A 5KFRA 4TXSA 2OSQA 1FRLA 2MZSA 1F3FA 1S0OA 3MUVP 3KK3B 4M5IA 2A2CA 5CQGA 2BANA 2HGMA 3PV8A 1YDLA 2RKIB 3F56A 1YI2S 3FSIA 1VQ4S 1NZAA 4KH1B 3JSBA 1DBDA 4HEA9 1ACMB 1UL3A 2AWZA 5ETPA 1Q5YA 3AXMA 1HNIA 4LF7J 1GH8A 2YQ1A 1X5PA 2ZWPA 3Q24A 1X60A 1N36F 5IQQA 4RUBA 1U6FA 3EVMA 1S6UA 1S1VB 3VV2B 1B3TA 2MKCA 1F9HA 4QOTA 3MOJB 3KK3A 1QUVA 3D54A 3FQKA 3LALA 3GJTB 3MTKA 3MPUB 2RKIA 4NI2B 1NU4A 4V1Ak 2PN6A 3G96A 1X4GA 2E1RA 1S0MA 1IBKJ 3OVBA 3FCHA 4KB7A 1WDDA 1Y9OA 2FJXA 1SVDA 4ECSA 4UW2A 1ZA2B 4M5DB 4PYAA 3TA1A 2Z2LA 3R27A 2KG0A 4J5OA 4WJBA 3IGVA 4WP9A 1S1VA 3Q2TC 3GV8B 4O4GB 5KFAA 4DPYA 3M6WA 4NI2A 2HFSA 4G1PA 4NLSA 2HWHA 1MMNA 3RBDA 1I1GA 4MIAA 2MLYA 1DQAA 1RTIB 1ZPWX 2DRBA 2KT2A 2B4OA 3US5A 3P4UB 5A8RB 3NCQA 3DNCA 4M5DA 4HI1A 1PCAA 2EFVA 1UJ4A 1D9AA 4AE5A 4ED2A 2YKMB 1Z2ZA 2CJXB 3ICLA 1K47A 2DNHA 4DLEA 3HULA 3PW7A 4O4GA 1GK8A 2CYYA 1N4LA 5HQ8A 2HHQA 2HURA 2X51A 4WFZA 1FRJA 3VAMA 3PACA 2OGUA 2YQ3A 5LMUJ 5B0GA 4RW9B 2BRKA 4ZS6A 3A3PB 1VI7A 1RTIA 3MXHP 1ZETA 4Y00A 1X31C 2DRAA 3PKYA 3T1HJ 3KNGA 1VS3A 3OTOJ 5A8RA 2YPYA 5AE1A 3AH6A 3J7Z5 3MAQA 3D0IE 3ILLA 1FEHA 2YKMA 1D8YA 3EPIA 4PABA 3CCVS 4F8RA 4YY3F 5DGBA
chains in the Genus database with same CATH topology
1KR4A 1P8GA 2I0XA 3S1TA 2P6TA 4BCAA 3GIKA 2EFNA 5CZVA 4LFBF 2E7XA 5DLGA 5GADI 2B9WA 1D3WA 1CQNA 2PD1A 4B3MF 4TYAA 4Y2KA 3DLEA 4RW9A 1HYSB 1RJJA 4ES2A 5BJRA 1UA1A 1NJYA 4O3OA 3H40A 1HQUB 1YVFA 2DR7A 2C3OA 1ZAWA 4OV1A 1HQEA 5THWA 4ED8A 1TKDA 3I87A 2KH9A 3FVYA 4CO3A 1IQZA 1U1KA 2LXIA 3KLHB 1ZZNA 4B3SF 4OJ1A 2VUGA 3OR2B 2XY6A 1VOMA 5A8WA 4NMLA 2AJQA 4RW8A 1ZH5A 3DLKB 4NWBA 1HL6A 1L3TA 4N47A 2ADCA 1RGVA 1YBAA 2C3UA 4JUZA 1UWBB 2LA6A 3POTB 2FD2A 5F8IA 1UVIA 1FDBA 5B09A 4OZLA 1LXNA 4IR1A 2D9PA 4A8WA 5EDWA 2LQ5A 4F25A 1SUQA 5KFKA 4KPYA 4X4TA 4ECZA 2EVZA 5E41A 4LF4F 1N33F 4FYDA 2IRYA 2BR0A 4RWWA 2CJKA 2KTQA 3P49B 1M5KC 5EUHA 2IBOA 2CPDA 3GV7B 1FKOB 2VC0A 4KIAA 2VOOA 5A6WA 1JJHA 2C2EA 1RT5B 3HHLC 4DS4A 5DG7A 3MD3A 2ASYA 3DDKA 1UVNA 2RJZA 4I67A 2WK4A 1FRIA 3RTVA 2J6UA 1N0UA 3OR1B 2R2TA 3OLBA 3KKFA 1HYSA 2SXLA 3MR6A 5EX0A 2E5IA 1HQUA 3HXMA 2GW8A 3MPYA 3DLLQ 1HFEL 1V3ZA 1HHTP 3N6LA 4N76A 3DXBA 2F8HA 4DL6A 1XTZA 1OQ3A 2I9SA 3KLHA 1OSCA 3I82A 1FVSA 3OR2A 1SIZA 4MFBB 4W90B 2RQMA 2BZ2A 3F41A 2APOA 1TK0A 1LFWA 3DLKA 4URSA 2V8DA 2V8GA 1UWBA 3POTA 5BYRA 1AFJA 1QSYA 3J81Y 2ZC4A 2EFGA 2IAJB 1KC8T 4PRFA 3DU6A 4JI2F 5E33A 4IG3B 1B0VA 1Y5IB 5G4DA 1KQFB 1X5TA 1U1PA 4C8OA 4DHVA 2ZH5A 2UZAA 4LMZA 3TAQA 3F73A 1YJ9S 5KOWA 3N0VA 4OZ1A 2VBWA 3CWJA 3DMJB 4EWTA 3BQ1A 1XMBA 1KOHA 1VK8A 4OJGA 1FKOA 2CJBA 2RS8A 2FB0A 1APSA 1SL2A 4I0WA 1RT5A 1CVJA 2E44A 1C0TB 2RVJA 3MGJA 4DQQA 3KNAA 3M8QB 3AJ1A 2ZDPA 3CIMA 3ZC4A 2EG2A 3OR1A 4BC7A 1DZ5A 3TR5A 1VQ7S 4ID5A 2CQIA 4LVOP 3PIPQ 3KMQA 1SC6A 2V9WA 4OL8A 4QIEA 2YNIB 3DRYA 5LJ3Y 1KTVA 2B7BB 1WHVA 3D0GE 3LP2B 4LJMA 5KT4A 4YHHF 1LWFB 4MKAA 4YB7A 2IA6A 2R2UA 1IR0A 4DL3A 4TY8B 3V6DB 1EETB 1T3NA 4Q43A 4WYWA 4KV8B 5J1NA 3NLCA 3IC1A 4MFBA 1OS5A 2FUG9 2XMTA 1QUPA 1XBWA 2WHOA 2Y1JA 2ZE2B 4RNNA 4UQTA 2HW3A 1UFWA 3IS9B 2FC9A 2MPUA 3D1OA 2VONA 5EX3A 4P7TA 3C6UB 2K2PA 3BN7A 1IKVB 1D8ZA 3MEEB 5KFEA 3DN9A 2IAJA 2B4VA 4CCHA 4GO5X 2VKRA 3DOLB 1SH0A 4QIVA 4XO0A 3HHLD 4IG3A 2MKIA 2VH7A 5D4LA 3GG0A 1NJZA 3EZ5A 3KK1B 1X7VA 1JLAB 2GIRA 2QZ8A 2QSWA 4ZPDA 1S1UB 3BSNA 3V6HA 1T02A 1FCAA 1YJVA 4CT9A 1S6OA 1FD8A 1WI8A 3DMJA 1U25A 4TLRA 2MY7A 1UVLA 1BQXA 3CD0A 2KU7A 4WFNQ 3MM9B 5HMYA 4P6QA 3R1LA 1C0TA 2ILZA 5C42B 2C2RA 2JEIA 1I6JA 3L7PA 3M8QA 1JJ4A 3Q0AA 3CULA 1S77D 3G86A 4ZOSA 1NK8A 4DJBA 3RW7A 1RKJA 4X2BA 1FRMA 1SBRA 2J9CA 2XSJB 1IJEB 1KQSR 2YNIA 3IN5A 4WXOA 5DLFA 2MYFA 1YIJS 3LP2A 5F8HA 1LWFA 3N79A 2AF6A 2GA7A 5A2QY 4KJIA 4TY8A 3V6DA 1EETA 2LXFA 3ISND 2W4CA 2KYZA 4KV8A 1FE4A 2ZHAA 1FXRA 4WFBQ 4C11B 2MXYA 2XNQA 2FGCA 2LYVA 2AJ4A 5HMZA 2ZE2A 4F4YA 4AL7A 3IS9A 2NZ4A 3DFEA 3HHLB 4Y2IA 4DR5F 2CDQA 2PEHA 3C6UA 3BO3A 4F67A 3MEEA 3PHEA 1IKVA 3GR1A 1RAJA 4L6V3 3CIZA 1ZTWA 1MW7A 4LQ3A 2JDJA 3MM8B 3DOLA 5M2PA 2N7CA 1TL5A 3MCSA 2KB2A 1R3NA 4RBUA 1Z4UA 3QWUA 4LF9F 3PFOA 4ALZA 3KK1A 2YKQA 1JLAA 7FD1A 2P9EA 4DL4A 3V6JA 1FRXA 3C3LA 2XMMA 1S1UA 5GAEU 3ZZRA 2DGUA 4ECTA 5J2QB 3IO1A 4JI1F 3G6VA 3NGKA 4ZLPA 1JNZB 3RYLA 2CKWA 1KS2A 1TZ0A 2FC8A 2MJNA 1C4CA 3MM9A 4ICLB 2WW8A 4ATNA 5C42A 1YWXA 1NJIT 3H59A 3E2EA 2ZZMA 4DEZA 1N32F 5F8JA 3QZ7A 5D78A 4GC7A 1M1KT 2ZC3A 4Y65A 3THPA 3GSDA 2ZH1A 3H4BA 4ED0A 2OPRB 1VC5A 1F0XA 1VQ8S 3B78A 3OVAA 3HO1A 3R3TA 2XSJA 1YRUA 1G3OA 4CO4A 4I2QB 2MQQA 3V5RA 1Q7YT 1ZM2A 1AXQA 4TNOA 3GYXB 2VV5A 3DGPA 2XGQA 3CCQS 4MMOA 4QCLA 4OHWA 3K0JA 3VAIA 4B08A 1SQEA 3P96A 3BO2A 2UUBF 4C11A 4GMKA 1FXLA 1K1QA 1X4FA 5CZXA 2FHJD 4C7QA 5EHHA 1R8AA 4FF3A 1NHUA 2B56A 3HHLA 4A8FA 3KLEB 2W7OA 3HVAA 2L48A 1T95A 2XCAA 4DFKA 2ZBCA 1Q81T 4FVMA 3MM8A 1FRHA 3I4HX 1S7HA 2F9DA 3THTA 2CPZA 1HWKA 3LPYA 4WF9Q 3M9OB 3OHBA 3O2IA 3BR9A 4ECWA 1SKWA 4I6AA 4KC5A 3HHKA 4CO2A 5J2QA 3V2UC 3GFXA 2OD4A 2QFJA 1S6PB 3GB0A 4ICLA 4IH7A 4KHRA 1LWEB 4ZPAA 3PDNA 2FGOA 1N48A 2LKZA 2GMLA 1W2IA 1VRUB 2CQ1A 4ECYA 1UAWA 4OI0A 2OPRA 2CQBA 4M95A 3TQ1A 1BC6A 2RRNA 4QR2A 3AB4B 1HMVB 4I2QA 3EYZA 2BOPA 4I2PB 3SFGA 1KQKA 2LXUA 2N3OA 2KXNB 4NRTA 4OZJA 4EO6A 2ZH6A 2IM0A 4WU3A 2EBEA 1Q8BA 4OQJA 4ID8A 5D4PA 2CVEA 1DHMA 3PKMA 1YTYA 4Z2XA 2E1AA 4O3PA 5F9LA 4JV0A 2OMOA 4DL2A 3KLEA 2YX4A 4E8UA 1U1LA 1A7GE 3O3LA 2JEJA 3T3FA 3ETOA 1D9FA 2OJ3A 4EBDA 5CYJA 4I6YA 1FNMA 2MQMA 4U67Q 2QMXA 2VL1A 4NCBA 2ZFHA 1DFDA 1B64A 4BWJA 3ENWA 2R8HA 2NXUA 2KJVA 2GV1A 2FJDB 4QR1A 3SEOA 4DX8H 4NXNF 1DLOB 1WELA 2HWIA 1SB6A 1XR5A 4IDKB 1YJUA 3HP6A 4UY8T 3IR6B 3EGZA 4B3OB 3HDSA 1KFSA 4MK8A 1RYSA 1UP1A 1ZM9A 3AJ2A 4ZVHA 4YB6A 2WSCC 4NLWA 4HVZA 2HVHA 2ZITA 2CQ3A 1LWEA 2KZMA 3QAEA 1YSJA 3SSSA 2E7WA 4PG8A 2DIUA 3UCZP 1HARA 1VRUA 2PT0A 2ZJRQ 1A6LA 4RU2A 2OSRA 2IM1A 2R7WA 2J0SD 3OXFA 2W25A 2W8LA 4B3TF 4K4WA 4A8KA 3K5NA 3T1YF 4MTPA 1SJQA 2QA2A 1HMVA 3PXGa 2MZ1A 1XMOF 2EFQA 4Q2LA 1F9FA 3JTPA 4ECUA 4I2PA 3T6BA