2XYGB

Caspase-3:cas329306
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
b'HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 19
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2xygB00
1PYOB 3R7SB 1RHJB 3IBCB 3KJQB 2XYHB 2H5IB 2C2MB 2QLJB 1NMEB 2C2ZB 1RWMB 2H5JB 2C2OB 2CNKB 1RWNB 1RWWB 2XZDB 3D6MB 4ZVRB 2C2KB 3GJQB 3R7BB 1RHUB 3SIPB 2HBZB 2Y1LB 1RHMB 1QTNB 3D6HB 3GJTB 1RHRB 2QLBB 1RHKB 2DKOB 3GJSB 3EDQB 2FQQB 2H54B 1F9EB 2H4YB 4ZVSB 2QL5B 3R6LB 3RJMB 4DCPB 1RWPB 2CNLB 1GFWB 2QL7B 2QL9B 4ZVTB 2XYGB 4ZVUB 4DCJB 1RWKB 1RE1B 4ZVPB 1QDUB 2CNNB 5IC6B 2CNOB 1SC4B 2XZTB 3EDRB 2CJYB 2C1EB 2P2CB 2HBQB 1BMQB 2H51B 1ICEB 3KJFB 1RWXB 4JB8B 2H65B 4DCOB 3IBFB 1SC3B 3R6GB 1SC1B 2XYPB 3R5JB 2H48B 5K20B 2CDRB 4LSZB 1IBCB 4ZVQB 1RHQB 3GJRB 2H4WB 3NS7B 1PAUB 3QNWB 3D6FB 2HBYB 2QLFB 2Y0BB 3P4UB 5IC4B 4ZVOB 1RWOB 1RWVB 3KJNB 1I51B 3P45B 1I3OB 2CJXB 2HBRB 3R7NB
chains in the Genus database with same CATH superfamily
2DO0A 2GFFA 3PRBA 4L74A 4BDPA 2B56A 2KL8A 3UN5A 1Q8LA 3OBIA 4M5KA 4DS4A 1WC6A 4DQIA 3WBZA 4URQU 2KM8C 2DCUB 3PYGA 2DIVA 1EETA 1UA1A 1WF1A 2HHHJ 1J5EJ 3BZQA 2AEFA 2ZWPA 2GIQA 1ZETA 3M8PB 1KFDA 4C48A 5KFRA 1RSCA 5AE2A 2AYGA 1SXLA 3C19A 2J9DE 2UUBF 5A6WA 5K8PA 4ZPWR 3OR2A 2H3EB 1WDTA 1QD1A 2HGMA 1JLAA 3VHQA 2HWHA 1EETB 4JI1F 1TK8A 2MZSA 5D4PA 4DR3J 3M05A 1N36J 1U45A 2KXNB 7FDRA 5HROA 3IP0A 2DPJA 4NLRA 4B3TJ 3ZNUA 1N56A 4NI2A 4UZBA 2M2BA 1YRTA 1RAFB 5KFMA 1VRUB 3JQJA 1FNOA 1CLFA 1AZSB 3R7BB 4L72B 2QA1A 4OJ1A 3J7YI 4LF7J 3J81Y 3HZEA 1FDBA 3OR2B 3SV4A 3PJ9A 1U6ZA 1JLAB 2Z2YB 1XNQF 4J9LA 4B3RJ 1D9FA 2ILYA 4MKBA 2UVWA 1ICEB 2BJ3A 2XY5A 4NI2B 2AGOA 3ZZZA 2YKNB 2CPEA 1PAEX 2BR0A 2CA9A 2FJWA 2CADA 4OHXA 3CD7A 2VA3A 1KC8T 2OTLS 3DLJA 4X2BA 4HL9A 3NS7B 1ZBTA 3DI6B 1UJ5A 1JXVA 2JRSA 4ECZA 1KOOA 3TX0A 1ZOTA 2WK4A 3HHLD 5IQ6A 5DJBA 4GVBB 1LW2A 4DSLA 2MHEA 3OFHA 3T5LA 2GA7A 4GO5X 2XYHB 2BOAA 1RI7A 2R8KA 1BD6A 4IG3B 2DY9A 3GPAA 5KT2A 3PO4A 1UVIA 3QAUA 3OLAA 1AXQA 1N6QB 2K3KA 2RAQA 3BBCA 2CVIA 3H4DA 3LH2S 3T9ZA 5K14A 1QSLA 4O4GA 3W8GA 2NR0A 2F7VA 4ZVTB 2A6OA 3OUYA 2XS5A 2G2OA 2HS3A 1UWAA 1LW2B 2W9CB 2UUCJ 5DZ7A 2B7CB 2CG4A 2XTJP 5F8NA 3B8HA 2OSRA 5CYQB 3GV7B 3UDLA 2DGOA 2VG5A 3MOZA 2HRYA 1MWZA 1D9DA 4ZLPA 3PXGa 4Q43A 1YRUA 1NBEB 2FJEB 4A8SA 5K14B 4O4GB 2MY7A 2AJ1A 3S8SA 3OUYB 3U7JA 2OHDA 3PM9A 3WQPA 2BUNA 1XTZA 1ULRA 4F0KA 1S49A 3QIPA 3HZGA 4JYAJ 2I1RA 2WHOA 3EYZA 2AT1B 5ETMA 1WELA 3N28A 1S79A 1LWEA 1FA0A 1DURA 2PFFB 3KHGA 4B9VA 3IM8A 3JTPA 3IGNA 4OZ3A 4LIRA 4RNMA 3ETMA 3H5SA 4NLGA 2BVZA 4ZJQA 1HBUA 4JI7F 4WKRA 2CNOB 4KQZA 1MW7A 3HLUA 4OHYA 2VICA 3OFEA 1RTJB 4QU6A 4IFVA 2DGSA 2CZVC 1S99A 3NGUA 2PMZD 4U7UK 3VGUA 2K1RA 3UR3C 3FBCA 2IDLA 1DJ0A 3LUYA 1WG5A 2WB4A 1LWEB 1T02A 3DLHA 3O1LA 5H1SV 1Q7LB 2XMJA 4FF4A 1F9HA 2XZWA 2BRLA 2CQ1A 2Q43A 4OYAA 3GG1A 3TZYA 3V4IA 4DV6J 5IXUA 2ZNZA 3DOMA 4CO2A 4J9RA 2JH3A 3ET6A 3IAS9 1HA1A 4O3SA 3FBEA 3G71S 2HHPA 4K4UA 5C25A 1HMVB 2LECA 4F4KA 4KPCA 3O8WA 4DX7A 2K1RB 2NXCA 2J9CA 5KFYA 1F0XA 4DN0A 1VLOA 1Q82T 2HZCA 1DY3A 3T6BA 2MTLA 2CNLB 5DO2A 3BN7A 3NS6A 3H2VE 4K4ZA 3BR8A 2HFZA 2YY3A 3V4IB 3O3LA 1FRKA 1YZ6A 1U7LA 4LSNA 3DOMB 1XMOF 1ZA2B 1XWLA 2GHVC 3ET6B 4P52A 3DC2A 2D74B 1VQOS 4EZ9A 5C25B 3CCJS 4CNYA 2IYIA 3QGHA 2DNKA 2D69A 3MAHA 4DR7F 2KDOA 4EU0A 2A3JA 1IWGA 4ECXA 4UOFA 1P9QC 4ES1A 3QNWB 3TVYA 3MI7X 4NA2A 5LSOA 1TL3A 1TFWA 1JXLA 2VFRA 5EHHA 3M8QA 1X31C 2FZKB 2XS7A 6AT1B 4Y2IA 2WSEC 3BDEA 2KN4A 2DJWA 3UNYA 1S1VB 4WKYA 3GMGA 4BS2A 4J9KA 1VLYA 2CZ9A 1OIAA 4X62F 1IJEB 1Y10A 2E1MC 2SXLA 5F3TA 2FHJD 4YN3B 2PI5A 2VFUA 4ZP8A 2G9OA 1VFJA 4DCPB 2YWKA 3D66A 1FRHA 4PCQA 3BKTA 1N32F 2KFNA 1EP4A 3DM2A 2XMVA 7FD1A 1DTTA 3VR1A 4EBDA 1RT4A 2YQ3A 4USVA 4PR6A 3VAFA 3BB5A 5K8OA 1LWXA 3GE9A 3E01A 7AT1B 2V63A 4DLEA 1S0MA 4DX8H 4RX6A 3NNAA 3QGPA 3RBZA 2AZ1A 2UVUA 2R2TA 3GYGA 2E9RX 4ECQA 3HFKA 4YMEA 1TP7A 2H1YA 3QFWA 1EP4B 1HNVB 1I3OB 2CQGA 2LDIA 2IAJA 2MXYA 2JC1A 1RT4B 3TWZA 4C11B 3HPOA 2ATLA 1L3UA 1VQ5S 3KUHA 5IM0A 1CULB 3E01B 5HBMA 4C97A 1IKXA 2VL1A 3ILOA 4DMZA 5HQ8A 1N5TA 3BN4A 2PC6A 4XTTA 1CJKA 1XK8A 3K89A 3RAXA 4ZN1A 3B54A 4GMKA 3CCTA 3VZHA 2VV5A 2F1FA 2XZTB 3J80U 4WU3A 3MOJB 2ZOMA 2IAJB 4R5PB 4DL3A 2B0GA 1UVNA 3RU0A 2YWGA 4XO0A 4ZKAA 5IM0B 5HBMB 5KFOA 1IKXB 3GCWP 4LR7A 4TLRA 2HFVA 4JI1J 4M94A 2X51A 3ZTRA 3ZTPA 2HK2A 4TYAA 4DSEA 2FVRA 2V50A 3BV8A 5LMUF 5JVHQ 1BWEA 2KJVA 4JI2F 1UFLA 5K9FA 2IM2A 2CJXB 3I5AA 2UUAF 3QFHA 5KAKA 2MQMA 3W9JA 2I8EA 1PC4A 1U47A 2IM0A 1N88A 2GS8A 1JKHB 1YJTA 2HBZB 1U0SA 4DR5F 2MQPA 4NLWA 2QA2A 4RUCA 3TUZC 2BQUA 1WHYA 3SXLA 2UP1A 2R8HA 1IBKF 5AXLA 3NMRA 2J0QD 3DOKA 1N0VC 1S1WB 3V4MA 3BO4A 2ZH2A 4PXEA 4CIOA 3Q8SB 2ALZA 2ZC3A 1U1MA 1JLQA 5I4MA 4B3SF 4WIIA 3N79A 3TZXA 2FY1A 3OVAA 2IM3A 1JXEA 2B5JA 2JJ4D 3G86A 5D0GA 1RTZA 4M5HA 1E6VB 2F9DA 3HHKA 1CG2A 2DISA 2W2NP 3DOKB 3PTWA 3A8KA 3QRQA 2DR7A 2N4CA 1TKZA 2W7AA 1PYOB 4PWWA 4ZVGA 3SSSA 1N33F 5C42A 4ELTA 3Q83A 4YY3F 1JLQB 3D6MB 4X4UA 4DV3F 3AOAA 3V81B 3RB6A 5LSRA 2BJ1A 4DX5A 2HRTA 1EKSA 2B5JB 3T5JA 2Z2MA 4UUWA 3CJ4A 4CLUA 3NNCA 4C98A 1T9WA 2RRNA 4N47A 3KHRA 1NKCA 4RLEA 1VQ9S 2FD2A 5CD4A 1M5KC 2H51B 1YRXA 4PXDA 3SDEA 4OLPA 3M2VA 5C42B 2HNYA 2U1AA 3CJKB 1ZAWA 2GCFA 1OWXA 5A76A 1FDNA 3R6GB 4HHJA 4DL6A 3IRWP 3KLGA 1NJWA 2ZBPA 4FPIA 3CIMA 1MMDA 4F3MA 1Y00A 2QTWA 2GGPA 2MJNA 1P27B 2Z8QA 3PX6A 4OX6A 1FXLA 2MQLA 2ZDOA 2VQFF 3UNGC 3D6HB 2DR5A 2NREA 2DH7A 3C6TA 3HP6A 3DRSA 4L75A 2ZBIA 2YH0A 3M2VB 1H2UX 2HNYB 1I1GA 3UW1A 2MLXA 2VBWA 2HVIA 2XMTA 4TNOA 3UPFA 4HTIA 1Y11A 5EDWA 2FLLA 3DYAA 4AUKA 4LF6F 4W4MA 2YKMA 3TA1A 3VAHA 2HNDA 2J5AA 4LRDA 1AA1B 2O3DA 3DDKA 1FXRA 1NKBA 2MKSA 3C6TB 2Z0GA 3DRSB 3VAMA 1LK5A 1HNZF 1JLFA 4JI5F 2CWXA 4KR0B 3SCKE 3LWLA 3TYTA 1RU1A 3AHPA 1EJ7L 2DH8A 3LWMA 3CT9A 1RBAA 3DYAB 3MUVP 4C7QA 1S48A 2RF2A 3AQOA 2YKMB 5L38A 1JLBA 3M8WA 1FI4A 2HNDB 3U27A 2KH9A 4X4VA 3DFEA 3DLLQ 1VCTA 2LEPA 2KFZA 4HTJA 1BQXA 3SV3A 5C5JA 5BR8F 3ZZYA 1YBTA 3FDSA 4CRJA 1JLFB 3C2PA 1T9VA 5A8KA 3R97A 3G96A 4YB1P 1X7VA 2WTFA 2R7VA 1BC6A 1F9FA 3A8IA 1HKAA 1U6FA 4DFKA 2QO3A 1NPKA 1LWCA 1H2VZ 1XMOJ 3MR3A 2I9SA 1VYAA 3P5BP 2RF2B 5C7PA 4UTGA 3OHAA 2C3PA 3E8OA 2AYEA 2OPQB 2DGXA 2VG6A 1NUEA 2MJUA 1LFPA 3R3TA 3CW2C 3D28A 4DBQA 1BY9A 5KT6A 2IRUA 4F3OA 4P2MA 1IR1A 1V9OA 1ACMB 2PT0A 4NLXA 2WRMA 4NLQA 1WEYA 4CH1A 1HBMB 1LWFA 1RYRA 2M8HA 1MMLA 1S9EA 2YTCA 1VC5A 1PJ6A 1F3VA 1S0OA 1VQNS 2B7BB 2L48A 1R31A 1LWCB 3QGIA 4X64J 3JYTA 1SVDA 3QRPA 3FC9A 2RU9A 3JS9A 2G13A 2XM3A 4AQYF 1WKKA 4LF5J 1UWBA 3HK2A 2JLEA 4WWSA 3TZWA 1SKWA 4U7CA 1TTHB 1ZA1B 2KT5A 1RAOA 1RU2A 1NSPA 1W25A 4LF2A 5ETSA 3HMJG 2VUGA 1N32J 3AB2B 1LWFB 2BE7D 2NYIA 4NWBA 1BWVA 3VWSA 1KQGB 2LA4A 3EZOA 3CO9A 3OQ2A 4DI6A 1B3TA 3S6EA 2PFDA 1UWBB 4PAAA 4ANEA 3G6ES 1WF0A 2ZBQA 2JFDA 5E2QA 4CO5A 2QA4S 1DFDA 1GTEA 3ZZTA 3D0HE 3I6PA 4TQRA 1FKPA 1YTYA 5D4NA 4ZVQB 1UCNA 4ZCMA 4YHHJ 1RHQB 1S1XA 3TUPA 4DS5A 4DL0C 2VDIA 3DKDA 3FQKA 5J1EB 3U02A 4HVZA 4FS2A 4OYIA 1EHWA 3H98A 4OX7A 2KO1A 3PNIA 3K5MA 3M6UA 2B9XA 2H5EA 1HARA 1ITPA 3N9UC 1SUQB 3ZO7A 2PIIA 5KT7A 5GAGI 1FKPB 2EWHA 2ADBA 1EIYB 3IC1A 2YNIB 2HQGA 2QYCA 4O0IA 2QV6A 1LW0A 4IG0A 2IA6A 4B9LA 2Q66A 1KWMA 4D3HA 4MKVA 5KFUA 2VH7A 2QIFA 3FUYA 3K0JA 6FD1A 3FFIA 5BJRA 1S6PB 3NAIA 5F8LA 3DRPA 1M1HA 2ZJPQ 2V69A 3OTBA 5EGYA 5EWEA 1RABB 3T1HF 4YR3A 5KG3A 4KYZA 4ZVHA 1IKVA 3ZZUA 1LW0B 4IG0B 1URNA 4XPEA 3F44A 2HWIA 5GAHI 2QGFB 2ROPA 2NYHA 1RXOB 4DV0J 3CJ3A 4FS1A 2QE5A 4A8WA 1X5SA 2VBZA 1J5OB 2BJDA 4EYIB 3FKBA 3HVTA 1JNZB 4XAKA 1I94F 4A8XA 5U47A 4LFBF 2HVZA 1GMVA 1RJJA 1CSJA 3JSMA 4MKAA 2RU3A 4C8LA 1IKVB 2XLJA 2EG1A 1BLUA 2C3UA 3OTDA 1BMQB 4B3SJ 4J9NA 4Q45A 3A8EA 1ELOA 4TYBA 1N34F 1W7WA 4LMZA 4CZCA 2DB1A 4TU8A 2RIJA 1SC3B 3CF5Q 3NY0A 4ZA1A 1R0BG 3A1YG 1RLCL 1IBCB 5EWFA 2C42A 4DQSA 3JSMB 2BE2B 2K2PA 1RTIA 2FJVA 1HHQA 4C2MA 3D1OA 3CD0A 4M8LA 1X8DA 4DV3J 4PUOA 1RWWB 3GZ7A 1OS5A 1RT1A 4GKJF 2X1BA 1QAXA 2V2QA 2HNZA 2UV8A 4ZVEA 5CYMA 2ZBCA 4EMDA 2W2OP 2N3LA 3H40A 2BMBA 1FJGF 2NXEA 3N6MA 4Z7CA 2HQ3A 4LBHA 2R2SA 4NX9A 2IBOA 3UD4P 2YWWA 4FN5A 1S6OA 4PUOB 3QIDA 1YDLA 5FLXY 5IT0A 1UFKA 1OQ6A 4DF8A 4AYBD 2HNZB 4QIWD 4K4TA 4CWBA 4Q8EA 5CYMB 4OZNA 4PG6A 2JNJA 1QSSA 2A0FB 3GP9A 3M6WA 1MN7A 2R7UA 2DXFA 3ADAC 1U1PA 3GSDA 3OW2R 1JLEB 1ZS6A 1RA6A 1FXDA 1O6XA 2O01C 2KVIA 3IWXA 1LK7A 2DBBA 1X9SA 3D54A 4M5GA 3OV7A 3BQ1A 1MWYA 4EFAC 3OTEA 3TVKA 3P6YC 4ZLNA 2DEIA 2NSBA 5CXTA 1WSVA 3NRBA 2ZE2A 1HNZJ 3D4JA 4ED0A 4DV2F 2LA6A 4FZVA 5AXMA 3R5GA 2DXDA 2DGVA 1FE0A 5C24A 2X1GA 1FJEB 4OYOA 1G2EA 4C3LA 1CS4A 1PJ7A 4MKYA 2KRBA 3MPYA 4C8NA 2KFYA 2G0JA 4ZPCA 4LR9A 4EBCA 4N8OA 2ZE2B 4ZPVR 3R7NB 4DR4F 3NCRA 3W65A 2C2ZB 5AXKA 4ZVRB 3AAWB 2KHCA 2FYXA 2CJ9A 3KUGA 3GJTB 1CS4B 1QLNA 2P9EA 5A6PA 4RW7A 3UVJA 1IN0A 5ADZA 2CPFA 4RW6A 3QYYA 4IH5A 1S0NA 2CQ0A 5F9NA 2DNGA 3WC2A 3UR0A 4CLZA 2DH9A 1X60A 1F1BB 2M52A 1YZ7A 2VC1A 3JXOA 1SL2A 5FJ4A 4I2PA 4JB8B 4P10A 5CABA 3BGUA 3IO1A 2YNHA 2MPUA 4DV1J 2J0WA 4I1TA 5DG7A 3BGLA 3FK4A 3N6NA 3TEGA 1FWPA 2AF6A 4CO3A 2AJFE 4OZ0A 2J7WA 3Q2TC 4ECVA 4RW7B 3UVJB 3TANA 3B4DA 1G7CB 3C46A 5KOWA 1FVQA 2W25A 2VKZG 2AJ4A 2OSQA 5HAOA 4LBPA 4P73A 3H8YA 3Q22A 2PEBA 3KMQA 3GFZA 3SYZA 3TUJC 1U1LA 2EK6A 4LF8F 1VR6A 2YNHB 3FJ2A 3THVA 1VQYA 2HHQA 1UA0A 2ZH4A 1PBUA 1TMMA 4CLLA 3HI9A 1RTHB 3SBMA 1A9NB 4DPUA 2BBEA 2FHOB 1QAIA 3ENQA 2PGCA 1NEEA 4B9TA 1HR0F 2MLYA 3UN3A 1ZZFA 2DHGA 4LBIA 4ER8A 1P9YA 2A18A 2XS2A 3QPIA 4CP5A 1XNRJ 4ITSA 1KFSA 2RD5C 4O3QA 2BYCA 4ECWA 2GMLA 1TVRA 3A3NB 5LT5A 1H0HB 4ED2A 3CPWR 2MGZA 1BXNA 3DCAA 3IM9A 4B9NA 5GADU 2J0SD 3LANA 2XI3A 4U8VA 2FIUA 4D3GA 1MMNA 5DQGA 1H72C 4TY8A 3RYLA 1YGYA 2R8IA 3I55S 1ZM3A 1TVRB 4K5RA 3GIRA 5HMWA 4N8NA 1NK8A 3UQSA 2V8GA 2IYGA 2Y0SD 3ILJA 2MGZB 4QYZK 4FXDA 4PABA 2OPPB 3OL6A 1QDUB 1YJUA 5B0GA 3EMTA 3HJVA 3TEHB 2PI4A 1TKTA 1KQFB 3NAHA 2X7IA 3FCVA 2W1BA 2YWFA 3MPUB 2GC8A 1M90T 4Y28C 4KC5A 9RUBA 2Y9HA 3QATA 4CI0B 4TY8B 1RBLA 4L73A 5KFFA 3NGRA 3T1HJ 4U9RA 3G82B 2F4FA 2RB7A 4DJBA 4ENOA 4DR2J 1NK7A 2ZHAA 5HP1A 2APOA 3P4UB 1SPBP 1A0OB 1PIEA 1QSYA 3Q86A 3P45B 3HCXA 3V5RA 1TU0B 3HFVA 2RQCA 2OMOA 1KLMB 1UL3A 1X4CA 5ITHA 4V19J 3G8TA 3MM9A 1I94J 4LFBJ 3IR6B 1SH2A 4A47A 1Z2LA 4NLSA 2W9BA 5DGBA 2C2EA 2RKIA 3BSNA 2IA0A 2EKNA 2W24A 3IS9B 4NA1A 3GIMA 4ZCKA 4TN2A 4DR6F 2E7VA 2MZQA 1F6TA 2HRUA 4KY3A 4YB7A 2DT9A 2IHR1 1N34J 1SIWB 4F36A 2CPXA 1RAHB 4DV5F 4WYWA 2HLTA 3KJFB 4CLPA 1HNIB 4HKQA 5KFCA 1N5VA 4ECTA 3I32A 4BLGA 2XYPB 3M2UB 2MZTA 2EFVA 4LVNP 4YFUA 3ICLA 1NRKA 2W9BB 1TELA 2RKIB 4NA3A 2AZ3A 4QPXA 4K4SA 2KG1A 1TL4A 2ERRA 3DXBA 3ENWA 3TX8A 3MXHP 4JV0A 1W2BR 4DFJA 1EB0A 4K0KF 3AB4B 2JVOA 1TL5A 2C2MB 3CIZA 3HHLC 2AJQA 3CMES 3D3CJ 2LQBA 2R42A 2FY8A 4FKXA 4NLPA 1FJGJ 3BDPA 1GH8A 4X4RA 2BKNA 2M7SA 4AL5A 3KTQA 4DL5A 3EGNA 2UU9F 4URSA 3D1QA 3CCQS 4C8OA 1V3RA 1JK9B 1NDCA 1WTBA 3MUTP 1IXKA 4OMFG 2Z30B 1CPZA 3GYXB 2W8LA 4J90A 4I2QA 3MDFA 3AD7C 3K17A 1B0VA 2UVRA 3PV8A 2BX6A 1WI8A 3R5JB 1APSA 2OFHX 2L9NA 3CE8A 1YJNS 3PEHA 1K9MT 3W5XA 4Y2AA 2AYBA 2HS0A 2E29A 4CLYA 4IOBA 3TRGA 4M5MA 2POKA 1P1TA 4R8UA 4JI4F 5ETLA 3DDNA 1RT2A 4I2QB 4FVMA 2Y1IA 3W2VA 1ROFA 2CAJA 2QMWA 2ZDPA 2YX7A 3AD9C 3MUMP 4MK8A 5M2UA 4CCHA 2CPZA 3TAPA 1IQZA 2VPWB 3U1MA 1N5YA 1TZ0A 3HKWA 2QL9B 4WZQA 3RUBL 3RTVA 1Y4ZB 3SMZA 4I68A 3T1AA 1S1UA 3J7Z5 2MLZA 4A8YA 4KGVB 2G0IA 4R8UB 1NJZA 4J9QA 1D1UA 3VVTA 2C2NA 3W2VB 3FBBA 4O4RA 5A2QY 3BKFA 5HATA 3KJVA 5CZXA 2UXCF 4M5JA 3HVRA 1TAQA 2BZ2A 4QJVA 1N5YB 3IR7B 4OZJA 1IKYA 1O51A 2R9LA 3DHWC 2BJ7A 4FYXB 2ZH7A 3AY0A 4TU7A 1S1UB 3EUNA 1UZHA 5KFPA 4NMXA 4OJHA 4XIUA 5J2NA 2B3TB 5KFIA 4DSIA 2V9KA 4G1QB 4PXCA 2LXFA 8RUCA 4ES2A 1RHKB 3M1VA 3GSIA 2J9DA 4AT1B 1F9EB 4KBIA 5D8HB 3KJVB 3UCZP 3G8SA 2Q1LA 5ETKA 2V4RA 4JV1A 5KFGA 5ETRA 2RDJA 1U2RA 2OPRA 1IKYB 2V8VA 3BKUA 4KKOB 3QMQA 2FLPA 1K0VA 1RCOB 2JEIA 3MWBA 4DUZJ 2MKIA 3NBPA 2VPYB 4B3MF 1X4EA 4UZCA 3BS9A 1KD1T 4FF3A 1R0AB 1KOHA 2O1PA 2WVCA 1X5TA 5J2NB 5KFWA 5KFHA 4RUBA 2OEKA 1S72S 2Q6CA 3C16B 3CB4A 4DPTA 4KFBA 3PDNA 3T6JA 4PPDA 2LU2A 1HW8A 2CQPA 2MZ1A 2CQIA 2DNLA 2MY8A 1FD2A 1T0TV 4LR8A 2OPRB 5E0OA 1VIOA 2RUGA 5KFJA 2V68A 3LTOA 3BQ2A 4OHWA 4LF8J 2IBKA 4L6V3 1TKXB 4F4XA 3DDIA 2LQ5A 3GR1A 2KXHA 4ECUA 3K8WA 4PG4A 4KFBB 3FRYA 5L1IA 4J5OA 3ILLA 2A1BA 1YITS 2CWKA 4RBUA 2MQOA 3MECA 1HWIA 2D3ZA 1HR0J 3KKFA 4DL7A 4OZ1A 3UWTA 2ZZNA 2XCPA 3RAMA 3UCUP 3BSCA 1FEEA 2V4JA 2F9JA 3CCRS 2J8SA 4IOAQ 4DCOB 1VJQA 3I0RB 5B0EA 4JI0F 1F5CA 2LCWA 3KXDA 1TK0A 1D8ZA 5B0FA 3BF4A 2F65A 1U02A 3A3OB 3MECB 2RS2A 5LMNF 1CVJA 4C0BA 2XLIA 5LM7E 2G1DA 2IM1A 2IVFB 3H7HB 1SJ4P 5KG6A 2V4JB 3G6VA 1KRPA 3T5HA 2HURA 4ED4A 2ZVSA 2DHSA 5KFDA 3Q8RB 4HACA 4OLOA 4ZPTR 2V2ZA 2VF3A 2ACYA 5D6GA 3MAQA 3CJ5A 3POTA 2ZH1A 3GTYX 3NG8A 1H2TZ 1BQNA 4FNIA 3W9HA 2GMHA 3ETOA 3J7YU 3LALA 4LRAA 2LP4A 2R7SA 1VQ6S 1Q53A 4FYWB 2PA8D 1JJ2R 1NCLA 1B0TA 1FDAA 5J2PB 3JSRA 1HWJA 4NLDA 3PG9A 1Q8KA 1L3SA 2IIHA 5CD4H 4ELUA 4ATNA 2JLFA 3CJ8A 2V67A 1M5PC 4O44A 1YJRA 5E3QA 4JI8J 2P9CA 3M2RB 2E1RA 2VBXA 1BQNB 3GV5B 1WOOA 3OHBA 1B4SA 4RPFA 3E3XA 4F25A 3K5OA 1B99A 4AL6A 4PG8A 5B08A 2A2CA 1LOUA 4J9VA 2EFNA 2DD8S 4P9SA 4A8KA 4HT5A 3MM5A 3R5CA 2E9ZA 2PE8A 5H9EJ 1RHUB 3T3FA 2GAHC 1T9YA 4ZP9A 3CCVS 4DR6J 3ZXWA 3I31A 1BQMA 1KONA 2R2UA 3P3DA 4GKKJ 2D9PA 3VV2B 2ZM6J 3VCDA 5BYSA 4IOCQ 2CYYA 1SC4B 2HAFA 4ZCLA 1NB2A 5L39A 2PO4A 4B08A 4Q44A 1RT7A 2YPYA 2D9OA 2KYZA 1N48A 2VA2A 2X1FA 4UQGA 4ZP7A 4F4YA 2AP6A 1VGYA 3IRXA 2LDYA 1T9TA 1XN9A 2WCXA 3Q8QB 4DV7F 2NS1B 2WONB 4DU7A 4DWIA 3DOLB 2H4WB 2RNEA 2FJAB 5M2RA 3KOAA 1WEXA 5D77A 3MM6A 3C6UA 4K0KJ 4DV4F 4NE9C 1XJWB 3CCZA 3GQCA 1UKUA 5L46A 5MLCV 1V5IB 1RT7B 2JOQA 1RK8A 3LP2A 3GJQB 3MEGA 5K5MA 4OYZA 3SIPB 2OKQA 3R1HA 3MFHA 1REVA 2ZWOA 3KHLA 3CCES 1WHVA 2UU9J 1KVJA 4AE5A 1M5VC 3EZ5A 1K1SA 4MAKA 1TUVA 3WX8A 1S77D 1GNKA 3MM6B 3VAJA 4M5DB 4ZVPB 5K8MA 4ZJLA 2DGTA 3VTIA 1UEKA 4OI1A 4PWDB 4WFZA 3EVWA 3MM8A 3WC0A 3FEZA 1SJQA 1T94A 1IR2A 3T1YJ 3LP2B 3M8PA 2M88A 1REVB 2ZEJA 4DU8A 4X4TA 5CH7B 4AFFA 1KS2A 1RQ0A 1HNWF 2HBYB 1SL1A 4CO1A 5G4DA 4JI4J 2CUYA 2FZGB 5HMYA 2ZKUA 3BGRA 2KXFA 2HSEB 1URRA 2M70A 3G2XA 3MM8B 2UUTA 2DXEA 3KHHA 3AXKA 2LEAA 1OPIA 4FVCA 3QZ8A 4CH7A 3T19A 2WVDA 4USJC 1YIJS 3NL0A 5HJYA 1FD8A 2ROGA 1VRUA 1RWPB 3NKYA 3GU0A 4W92B 1AZSA 2PSZA 2WB1D 4MFBB 4U96A 3KNGA 1FRXA 4ZVUB 2VFVA 1VC6A 4NLOA 3BGRB 5ETVA 1DZ5A 3IMQJ 3US5A 3GWCA 1MU2B 2HGNA 2RT3A 2CPYA 2XGQA 5IWAF 1LKZA 2HKEA 4LF4J 3MR2A 4CQ1A 1FK9B 5E5NA 1Y5IB 4I7FB 3ZZPA 4Y3CA 2YKNA 5I3PA 4X65J 3IWNC 1JMTA 4OV6A 1RT5B 3KK3B 1TUGB 3DLGB 4OIXA 1M5HA 3IBCB 4IO9Q 4ALZA 3W63A 1T8EA 3DI6A 3ZFVA 3H0PA 4RNNA 3KMSA 2HFUA 8AT1B 4GVBA 4EBEA 1Z1ZA 1D3WA 4CDIA 2CG8A 2DKOB 3NCQA 3IAM9 2W2PP 4ZLJA 1N52B 2V8DA 3BGOP 3IWLA 4IG3A 4B3MJ 1HNXF 5D0EA 2FGCA 1N6QA 3RG6A 2W2MP 2IJNA 1X4DA 4ED5A 2HVHA 1D0EA 4IUFA 4ZIVA 2Y3YA 4TY9A 3CVKA 3OTOJ 1PYSB 3UFCX 2DVIA 1E6YA 2B9WA 3BPDA 4CLTA 1N5QA 2DEJA 1S1TB 1FF2A 2W9CA 2MKKA 3IR5B 4ANCA 2QFJA 4IH7A 1UTAA 2IRXA 2XBPA 5CYQA 3N4WA 3D6TB 5M2PA 1U1RA 3OSPA 4G6VB 3GFHA 4JI6F 4K4VA 4U8YA 2ZH9A 4NRTA 2AEJA 3THPA 2KZZA 4IO1A 2VHGA 4DUYJ 4W98A 4LF9F 1UW9A 1UVJA 3SEOA 3JAMU 1E6YB 3X1LB 1UVMA 3TAQA 4J37A 1S76D 2C22A 3A3PB 3H2UB 2HHVA 2W2QP 2V34A 3Q89A 2Q79A 4XPCA 2BJ9A 2CQDA 2H54B 4KPYA 4I56A 4CT8A 2N7CA 4ICLB 2OAUA 1RACB 1UEVA 1WSRA 3OSNA 1ZTWA 2DRBA 2QEXS 2DITA 1HD1A 2ZHBA 2A6MA 2CDQA 2CQBA 5THWA 2UXBF 1OY6A 2KRRA 4OYXA 3R2CJ 3BJYA 2F40A 2GVZA 3JQMA 5C2GA 1RTJA 4RNHA 4A46A 1OPZA 5KOXA 1FNMA 2CFXA 5CQGA 3LGNA 2YH1A 2OMLA 3DMJB 1EKRA 2YKQA 3CSKA 4ZVOB 4PG5A 3CMAS 1Q78A 4ZITA 5DQHA 1JQGA 2EFPA 2ZD1B 2ZBRA 1KKHA 1YWXA 2RJZA 3NOCA 4UOHA 5E3CA 4WFNQ 2GVZB 2OH2A 4K4XA 1Y7PA 4KGKA 2HHSA 1GEHA 1GFWB 1PGZA 2LKZA 1HMVA 3L7OA 4TLQA 5BYRA 5CYJA 2NLWA 4DSJA 4YDXA 4QW9A 3QZ7A 4BCAA 2N3OA 4RW9B 2AV5A 5B7WA 3TQ1A 1V6HA 4NMLA 3W1YC 1P1LA 5AE3A 1S4EA 2W7PA 1QVGR 3DGPA 3MEEB 1U6BA 2K8GA 3HSZA 3NEKA 1QE1A 1CJTA 3V6DA 1WHWA 3ZZOA 2MMYA 3LAKA 1J2VA 2HEKA 1JJ4A 2RE1A 4ETXA 4GRSA 1TL1A 2ZITA 4LJMA 3VAIA 1UVLA 4X84A 4IRDA 1GTHA 3WIVA 3KLVA 2BV3A 1YG0A 3NS5A 1Y0HA 2DNMA 2R8GA 1U2CA 2X1AA 4PEOA 3HDSA 5CCLA 1CJUA 2KT2A 3DLKA 3DGPB 3U1NA 1QE1B 1CJTB 1S1VA 4BBYA 2OPSA 3OXFA 1L3KA 4DR1F 3V6DB 1KVKA 1IBLJ 2V94A 1XR7A 4KTQA 3QJPA 5DQIA 1T9UA 1F2GA 5D0RA 5HVHA 2VOPA 1TL1B 3EDRB 4DZDA 3CJQA 2COLA 1IKWB 3ONQA 2C28A 4DV7J 4LREA 2QRRA 3MAAA 1LXNA 5KG0A 3D2WA 4ZK7M 4N56A 5LJ5Y 2XY7A 1CJUB 1J5EF 3DLKB 4RBVA 2CQCA 4Z2XA 2HHWA 2AX1A 3L9ZA 2OPSB 4MTPA 2B4PA 3FGVA 2YNGB 2AQ4A 1H73A 2AMCB 2XLKA 4KGXB 1LV5A 3MMCA 3R8YA 3VVUA 4AL7A 1CQNA 2R7RA 2F63A 5GMDA 1HNVA 3MAAB 5F0WA 1RHMB 3B82A 4Q2LA 4DR3F 2G0CA 1WG1A 4C11A 2ASJA 2FLNA 4X66J 2LMIA 1RAIB 2AKWB 1CULA 4BWMA 4OJGA 1KN6A 4KHRA 1XERA 3FEXB 2MQQA 4IKAA 3LPYA 1JWWA 3MMCB 3PX0A 5ETTA 4B9UA 2PMWA 1YK9A 4C8MA 2MKYA 1VMBA 5FIIA 3H20A 1VHIA 2H9ZA 2I5JA 4A4JA 5B0CA 2VJUA 3RBDA 4E2FB 4H54A 1H98A 4R5PA 2AD9A 4LQ9A 4NLUA 2HMIB 1QY7A 1X9WA 1IM6A 2DNPA 3GYNA 1N8RT 1AYEA 3CDWA 2OELA 4EYHB 2EK1A 1RTDA 4ILLA 2ZZTA 3HULA 1KNZA 5EX0A 2IVMA 3M9NB 3VGSA 5FD1A 2BQ3A 4Q2MA 2MSSA 2EBEA 1RDRA 4LVOP 3AJDA 3HFZB 2I5JB 4JOUA 4N7TA 2VKRA 4MJKA 3CC7S 1Y3KA 5AT1B 1YI2S 2QLBB 4YR0A 3GJSB 1DRZA 2QL5B 2FVCA 3QLHA 1OY8A 2P6SA 4RWWA 2UUBJ 4RUAA 2QC3A 1JKHA 2L3MA 2EPIA 4V1Ak 3MCMA 1SJ3P 4H4OA 1S7HA 3L4BC 1AW0A 1FJCA 1EQMA 1RTDB 2Y8YA 2XO6A 1HPZB 2GV1A 5IV3A 1S1WA 4OI2A 2BJ8A 2LQ9A 1HHTP 1VBKA 3ENVA 3AJ1A 3GCXP 4M5NA 1VQ7S 4I64A 1YX2A 1M0SA 3EZUA 3HJFA 3J80Y 3QLHB 3IXQA 4UOGA 3E51A 2IC3A 4H4OB 2JC0A 5KT4A 3CEDA 2VB6A 1XNQJ 5ETQA 4X4NA 1E6VA 3KJQB 4O3PA 5DDOC 2H5IB 2DYAA 2QLJB 3RBEA 3I96A 1XMQF 2DRDA 5KFAA 5G0RA 3VQSA 3NWGA 1S12A 1HQUB 4FYYB 2Z4PA 3M30B 1FKOB 3BREA 5B0DA 3C8YA 3LF0A 3V81A 2IC3B 4CO4A 1NLKL 2W9AA 4K2XA 4KH1B 2DRAA 2KTQA 4M5LA 4XDCA 3SCJE 1C0UA 2JL9A 2ZJQQ 1T3OA 4AD6A 4J9OA 3HM9A 1NPPA 4MIWA 4Z7YA 3CTRA 5H9FJ 2DCLA 4JI3F 5IT4A 5G0RB 4DN9A 2QLWA 2PA3A 1ZM2A 3W62A 1C1BA 2CJBA 2FVSA 4CLFA 3C14A 2HVEA 4DOZA 2E5LF 3CJKA 1SB6A 2MEWA 3H4BA 4PWUA 3G4SS 2R7OA 3D6FB 3FSIA 4OX9F 2HIQA 4JI6J 5D3GB 1FE4A 2JEGA 5I3UB 1P6TA 1VHFA 3RB4A 1HYSA 4LF9J 1RGVA 1C0UB 2G4BA 4QOTA 1NK0A 5F8MA 3H5XA 3HD2A 4IH6A 1M1KT 5D78A 1NXIA 4QU7A 3DU5A 2VIHA 3GFXA 2OIHA 2KHDA 2J0XA 5IV4A 2IJRA 3CJ2A 3K7RA 2X3DA 3RW6A 1VJWA 1ZYQA 1C1BB 3C14B 5KFXA 2GMJA 3GFYA 4DV6F 2OI2A 4O3RA 5LL6d 2LVWA 3PJXA 3GIKA 5GAGU 2MB0B 4J9PA 2KM8B 5T7LA 4WFYA 2UXBJ 4OI0A 4LSLA 3OJSA 1HYSB 3AJ2A 1GXUA 2I2YA 1FRLA 3TW0A 4OHVA 4ZHRB 1GMWD 3S1TA 1XC9A 4DL4A 3HHDA 2DGQA 4F04B 4E8UA 4YR2A 4QPTA 5HMZA 3DRRA 5T7LB 2FVQA 1VQ8S 4LSLB 3FVYA 3FRZA 5I42B 4CYUB 4JI7J 4IQMA 1NSQA 2N4DA 1FESA 4OQJA 5HVGA 1YKWA 3TI0A 2JFKA 3V2UC 4NXMF 5GAHU 1T7PA 3Q8YA 1WC1A 4I0WA 2DR8A 4ZVFA 3FBFA 4WTYA 4URGA 2XSJB 1HHSA 3EGZA 4RL1A 1NDKA 1FWKA 2XNRA 2HQIA 3ITHA 2FLOA 1LNQA 1HQEA 1L5UA 1QM9A 2F4VF 3KLFB 1YVFA 3DRRB 2DHHA 1SV5A 4F4WA 1M5OC 1U1NA 5H9EK 2QA4G 1D9AA 2OO4A 2W4CA 2CZ4A 2OPQA 4AXIA 1X4BA 3F0NA 1NB7A 2XB2D 5LOQA 2RILA 1D8YA 2OD4A 4R0EA 4X4QA 2DIUA 3BBFA 3M8ZA 4RW4B 3CXCR 1RAAB 4C8YA 4YDDB 3ITHB 4C0OC 2NSCA 3OFFA 3LP1A 3CCUS 1HQEB 1HWKA 5RUBA 2DPIA 4B17A 3QO9B 2KVQE 3Q2SC 1SV5B 4CM0A 1HBMA 3SFUA 5SUHA 2Y8WA 2HQCA 1VBYA 3EWGA 1UW4A 1X4GA 3NGDA 2OJ3A 3V6KA 3GONA 4MIAA 3KK1A 2OTJS 4L3KA 4RW8A 1O8BA 1AUDA 3BYRA 1FO1A 3NMAA 3ELHA 3L7UA 4P7VA 1V3SA 4DR7J 2Q3PA 3LP1B 4ELVA 3RRKA 2ZUAA 3KYLA 2EBGA 3QQCD 1B7YB 1DARA 4JBCA 2AGQA 4FKYA 2C2RA 3K5LA 4DEZA 2ZH3A 2GVDA 2BANA 2BKPA 3SQGA 3KK1B 5D4LA 1NAQA 1NJYA 4RW8B 2XO7A 4WXWA 3UO0A 2J9EA 2XSFA 4X62J 5IOLA 2DNNA 5KFNA 2RVJA 3F73A 1R6YA 2RDDA 2QLFB 3I4PA 3J81U 2MKCA 3OFGA 4WZMA 2HG4A 3HSJA 5KFLA 5KFBA 3H90A 1M1GA 2RHQB 2GO8A 2R7XA 2ASLA 2ASYA 1UPMB 2L9DA 2LU1A 2GVDB 2BANB 5J1EA 5L1KA 4TVAB 2XZDB 3SQGB 3IG1A 3D67A 2KJWA 1I5OB 1WG4A 5E7OB 5HK4A 4E98A 3TJ9A 2Y1JA 5F8HA 3AA9A 3HKZD 2HIYA 2YX4A 1KLNA 3LGMA 1MWQA 1A7GE 1SUQA 2GO9A 4EEYA 2MHNA 4FXVA 2XEXA 2N82B 3MEKA 3CCLS 1OO0B 4ZMMA 2B8PA 2YNIA 2GJIA 2VD3A 3RR7A 3IG1B 4YEAA 2E1PA 3PFEA 2UXDF 4DSFA 4ZP6A 5HROB 1GXLA 4QWDA 3R5DA 3KG0A 3QSYB 2AEMA 1S6PA 1S6UA 1ZAXA 1Z4UA 2QN6B 4S0MA 4B9SA 4AXJA 1Q7YT 1R8AA 2LLZA 2Z56B 1FRMA 1YHQS 1WC0A 1ZM9A 1F5BA 3CDAA 4JUZA 4YUDA 4C6AA 4HI1A 1Q0NA 5GMEA 4UT4A 5GAEI 3K58A 4B02A 1SCJB 3W66A 3DNCA 1J5OA 3QSIA 1FNXH 1RE1B 4FBTA 2HFNA 2FPHX 3PR4A 2UV8G 1FTRA 2PN6A 3BGFA 2RQMA 2JHEA 4G65A 2WZ1A 4RWXA 1XEZA 5LMUJ 4OZLA 4A48A 5J2MA 4JI2J 1SKSA 2UUAJ 1RWXB 1NPRA 4K7QA 1RKJA 4QWEA 2LQJA 4CT9A 2HYIB 3MTJA 3HT3A 2AJ0A 1RBOB 4DFMA 3LO3A 4F7VA 4DR5J 1K73T 2XC9A 5DETA 4PPZA 1SQGA 3ISND 4OHZA 1IBKJ 5F41A 1XMQJ 4TKTA 3SCIE 2HHUA 1UP1A 2BE2A 5J2MB 1U24A 5DZ6A 4FXWA 1S6QA 4DX6A 5DG8A 1OJ4A 5KFKA 2JEFA 2L41A 2IMWP 1NKEA 4MYUA 3FNNA 5ETOA 1P8GA 4RNOA 5F8IA 4ILRA 3NCPA 4HH0A 3RZAA 3NWRA 4YP3A 2HFOA 4K4WA 1TFYA 1N54B 1DAXA 2VG5B 4JI3J 2R4FA 3O5TB 3M9MB 1RA7A 2NXJA 1NHVA 1S6QB 2E5LJ 1N33J 4K5SA 2EKYA 4J9UE 1Q1KA 2IDEA 4YY3J 2ZH5A 5AJ3F 2GNKA 1R7IA 1G4CA 1KP6A 4OX9J 5E33A 1JIHA 4LRBA 2NPIA 1L3VA 1NDLA 1GMUA 3QIPB 3GR0A 4X4PA 3CCWA 2HK3A 2JDJA 1IWAA 2GQCA 2H5JB 2B4VA 3D5MA 3Q0AA 3CWJA 2LXIA 2R2RA 1T3NA 4F02A 3NLCA 1YJ7A 3OXGA 1HBUB 1JLEA 3JQKA 2HVDA 4PQAA 4BWJA 3K8VA 4IFVB 1VOMA 3IA0A 2V4QA 2RMLA 1AFJA 5A8WA 3MR7A 3BM7A 1SQEA 5F3ZA 2Q6BA 4Y65A 4FYVB 1SI9A 5KT3A 1FRIA 1SJRA 4ZDNA 2EXUA 2R7QA 3OVBA 2NZ4A 2E9TA 4WFXA 5HI7A 1FJ7A 4TQSA 2A2DA 5KG1A 4LRCA 4G1IA 2VQFJ 1XQIA 1HIYA 1SL0A 1OSDA 4RNFA 3W5YA 5BYQA 3OL9A 4RU2A 1U1QA 1FERA 1T9XA 3HHEA 2ZC4A 5ETNA 2YQ1A 4UY85 3T5KA 4IQXA 4R25A 3P8BB 4LFAF 3LPEA 5A8WB 3S7RA 2L08A 2WW4A 4LF6J 1W2IA 3C15A 3DN9A 4NXMJ 2OP5A 4NOHA 4UF4A 3QT7A 3CJ0A 1YSJA 4HHHA 2GZOA 4F50A 2FHKA 4KAIA 4MMOA 3UI3A 4JI5J 2AIRB 4X64F 3CJSA 4LSNB 1CJVA 2H4YB 2RQ4A 2F4VJ 2IJFA 4LF5F 2QFIA 4IRKA 4P7TA 5DLFA 4H4KA 2B6AA 1LQ9A 3C15B 3A13A 3VF0B 1UEUA 3SSQA 4HHUA 2H65B 1GQEA 1NZ8A 5ETPA 2ZFHA 3MMJA 1VQSA 5BR8J 1WACA 1TL3B 4PG7A 1T11A 2WVBA 1PBAA 3HX9A 3M8QB 1CJVB 4L3NA 2XMKA 2I0XA 4KV8A 5DDQC 2JSXA 2RHSB 3KLHA 5GVQA 3C66A 2B6AB 4C8ZA 4ZJOA 1FFGB 4QIEA 5C2CA 4OX8A 4LT6A 3T9NA 3Q8PB 2AWZA 4CH0S 1UJ4A 4NYPA 3I5CA 4NASA 4YHHF 1DQAA 2VOOA 4PKDB 1SBRA 2B43A 2HHXA 2Y1LB 4A8QA 1WOPA 4KSEB 1QTNB 2FC9A 3ISZA 3DM2B 4FNHA 1DTTB 1OYDA 3FEYB 4OI6A 1JNRB 2K06A 2D3OR 2XYGB 4KV8B 2F8HA 2KB2A 1DQ9A 1CQMA 4NLVA 2V5HG 3F41A 4DQPA 3W5ZA 3KLHB 2K3IA 4NRUA 2XNQA 3PIPQ 1RTHA 3PW7A 3HSDA 2WSFC 3N0VA 2MYFA 4M5IA 5F8GA 3PCOB 4AQYJ 2NQPA 2P5VA 3ZTOA 1DLOA 2XMWA 1VBZA 1NH7A 3A4TA 1IUJA 3BSOA 3G6XA 3HVAA 1FX4A 3O44A 5E3RA 2OEJA 3TUIC 4UY8T 2G2ZA 1OSCA 4DPXA 4NYZA 3CCSS 3PEJA 3V6HA 5DDPC 4ES3A 2QZ8A 1XR5A 1S5ZA 2HBRB 4QR1A 1T95A 3W3SA 3NXZA 1R6VA 1RHJB 3PYEA 2DGWA 3FSXA 2W7OA 2RDIA 1CJKB 3FZ2A 4QYZJ 1AFIA 4OI4A 1DLOB 2BW7A 1VRTA 2CKWA 3LOUA 3D0GE 1KR4A 3M8YA 2FQQB 3G6YA 4F0HA 3K5NA 3RJMB 2DNRA 1NK6A 4DV0F 3C3LA 2ZJRQ 2CJYB 2J7KA 1H7XA 4DL2A 1S9GA 3NGSA 3N6LA 3DLEA 5DM7Q 2UXDJ 2OPPA 1U8WA 1JJCB 4QIGA 1KTVA 2H48B 1B7FA 2YKPA 3PYFA 2XHWA 3CGIA 2ZZMA 1VRTB 4Y34A 3ZTSA 2HQFA 1KQSR 4FPRA 4X4OA 4HDHA 1HWLA 2Y0BB 2HZVA 3SFGA 3KG1A 1UVKA 3KJNB 5HQMA 2KI2A 3G82A 1Q81T 1BE4A 4JV5F 2CPJA 4FDFA 3TJ8A 2AX0A 3CC4S 1S9GB 1MLAA 4H4KC 2ALYB 3DLEB 5AE1A 3TA2A 3M32A 2JZ5A 2DHAA 4HYKA 2HWTA 4PQUA 3MD1A 1NK9A 4NLYA 2RRAA 2DY1A 2F8EX 1VIXA 1KLMA 4HEA9 5EN1A 1X4HA 2NZCA 3NOGA 3RB0A 1YBUA 3MD3A 2EG2A 5KFZA 2WAQD 2FDNA 2V2KA 2C3YA 4ZPBA 4ERDA 4U7UD 3UD3P 1Y5NB 3IS9A 3PW2A 5DDRC 3M32B 2V2VA 2X3GA 4PQUB 3N5BA 4QBUA 3HSGA 1TKZB 1X4FA 1HNIA 4FF2A 4F26A 2OGUA 2KU7A 4NCGA 4USTA 4F4AA 2XHCA 3M2UA 3BO3A 4O3NA 1V5VA 2ACMA 2WOMA 5H9FK 1FT8A 2NCKL 4EO8A 2B51A 2GQ2A 4OJ3A 1NK5A 2NUUG 2G1HA 2FJDB 2FJBB 4WYLA 1B64A 4IDKA 2B4UA 2VZ9A 3SDEB 2M0GB 2YBVA 2Y1RI 2OFGX 3H2LA 4WK3A 1GK8A 4KH0B 3JTOA 1CBKA 1WC4A 1S9FA 4NCGB 2VFSA 3EE3A 2EW9A 4CLSA 4Y6IA 1U8SA 4WF9Q 3BR9A 4FF1A 2OLWA 3KLGB 1U2FA 2B8QA 5HLFA 1SH0A 2WOMB 4ECSA 3EXCX 3MPVA 4MK9A 1K8AT 2WBRA 5AJ3J 2XCAA 2GGPB 2LXUA 3QGGA 2FTRA 3SSRA 2DTJA 5JXSA 4F2SA 4RR5A 3DU6A 2BJEA 5F0UA 1HW9A 5DM6Q 4EUVA 1YQHA 2L9WA 3MFIA 4GKJJ 4IDKB 1RZMA 1FVSA 1HBOA 2ZH6A 5CZVA 1HD0A 4G3IA 5DG9A 4OYMA 1KSPA 5L1JA 3KFWX 1YJ9S 2JLGA 4Q0BA 1RP5A 5HLFB 2XMMA 1YJWS 1PCAA 2XG8A 1BUXA 1PJ5A 1RWNB 2RSQA 3P96A 1X4AA 1FFWB 2YKOA 2VFTA 3FSYA 4ED6A 3MR5A 1WD6A 2D3UA 1TQLA 4YOEA 1S59A 1VC0A 1OQ3A 4TXSA 3KUEA 3NNHA 3R5AA 1U26A 5HO4A 2QL7B 2HW3A 1HBOB 2PMHA 1F2HA 2QSWA 3I87A 2QT7A 4GC6A 4TU9A 2EFQA 1EAYC 1WTFA 4J7CA 2P9GA 5GMKa 1Q5VA 2HZAA 4KJIA 1KHVA 4Q0BB 1FFSB 3OTCA 2JVRA 1JLGA 1C4CA 3I5BA 5IFMA 4OYPA 2JEJA 1FEHA 5E3PA 4BC9A 4HI2A 1JLBB 3VGTA 4DG1A 3R1LA 4QW8A 3PVXA 2EC0A 3MGJA 4DHVA 4LFAJ 5T41A 1Q95G 2Z2LA 2XWXA 3CNQP 3LW5C 3I9ZA 3EGWB 3OPKA 4HR2A 5A8KB 5HL7Q 3MM7A 2F5GA 1S4FA 1PC5A 4J91A 1TK5A 2DNZA 2C2DA 4PYAA 2UUWA 4X4SA 2ZHOA 4A8MP 4DV1F 3KG4A 3K2YA 1CEZA 1JLGB 1NJXA 1RWMB 4WFAQ 2B9YA 4DV2J 3LAMA 3K5PA 4HT7A 4EK2A 3PKYA 3VAKA 4QQBA 1FWLA 1CC7A 2EI5A 1AUSL 4DG1B 2MDAA 2J6TA 4ILMA 2QYGA 1TMJA 2VG6B 3F56A 2J6SA 3MEDA 1AROP 3AODA 3CO0P 3JB9k 1MNEA 1Q5YA 4G1QA 2YQ0A 4M95A 5J1PA 3EVOA 1BHNA 3KK2A 1X5OA 5HQLA 1GX5A 1WOSA 1SKUB 3MM7B 4USUA 3FZBA 1G1XA 4OV1A 4DZ6A 1ZM4A 2AU0A 4LUBA 1R43A 1S9EB 1TUWA 1U4BA 4KKOA 4PXBA 4ED8A 4DR4J 3CMQA 1VBXA 1SC1B 5KG2A 3JYTB 1I6JA 3QAEA 3TR5A 1R0AA 2K7KA 1K44A 3MEDB 3N01A 2VASA 4MH8A 2B4OA 3JSBA 5KG5A 4WJBA 1U49A 3C16A 1S7IA 3EPGA 3NGKA 1WJ9A 4KHPF 4XDDA 3KK2B 4PYDA 4ID5A 2W8KA 1J27A 2DO4A 1WF2A 3BH6B 1XNRF 3RW7A 1IVZA 2ROEA 3Q8VA 2GIFA 1S0VA 3MF5A 1FX2A 2JWNA 2DGUA 3PKMA 1ZZNA 4DSKA 3GLJA 4DPOA 3MMAA 4JP8A 2XMAA 1TKXA 1EX8A 3CD6S 1RWUA 1WKLA 2E1CA 2V8HA 3GG0A 1WEZA 1HI8A 1F5AA 5J1NA 4ID5B 2CVEA 1Q79A 1QTMA 4ZS6A 3GILA 4WBFA 5JVGQ 1S1XB 3FCHA 1ZPWX 5LXRA 3WZ0A 1Z2ZA 4MYTA 2O5DA 1FCAA 4Y00A 2QG9B 2XULA 3MMAB 3RRHA 2IY5B 2BM1A 3I0RA 3D9BA 1WHXA 4LFCF 4OYBA 5KFVA 3M7VA 2VODA 3KWMA 2WW8A 4P2FA 4HH1A 1SQFA 1NMEB 4P75A 2CPDA 2BE9B 2D7SA 1VK3A 1KBRA 1QUVA 3OR1A 2KT3A 3CD5A 4Y2CA 1R8BA 4DR2F 1VQ4S 1VS3A 3WX4A 3I82A 1NK4A 3PO5A 5L9XA 1HFEL 2M5YA 5MAOA 1DHMA 2FGOA 3D7SB 2DNQA 1RWKB 1YJVA 3QT5A 3FFIB 1GXTA 2CNNB 2GJ2A 3DRPB 1HL6A 4QCLA 3IBWA 3MZIA 3M8SA 2E5IA 3OR1B 4KGZB 2G2YA 4R0JA 4C3MA 2V9WA 2CDRB 5J2PA 1MSWD 2FHMA 5DS7A 1Q4RA 3CDBA 1OMSA 2VJVA 4JV5J 1RAGB 1XR6A 2V8PA 3TJAA 1CC8A 2KZMA 3HVTB 4M1KA 2ABYA 5DLGA 3M2RA 3THTA 4DDFA 3MTKA 1OY9A 3TVZA 4KE5A 4DQRA 1V3ZA 1DTQA 3H59A 4GVLA 3BO2A 3FMBA 4USMA 5T14A 2MZRA 2R7WA 2XY6A 1RUSA 2BM0A 1NSAA 1WWHA 1SJ1A 5FLXU 4CLKA 1EQ0A 3EM1A 2CJQA 3TAMA 1GMWA 2VQEF 1RB0A 4QR0A 3VZIA 2F3JA 3EICA 1R8CA 3CULA 1Q8IA 1JB0C 3S01A 4MT1A 4UUXA 2VG7A 2CQ2A 4CLWA 1DTQB 4OI3A 3IBFB 2HQDA 4P6QA 1RTIB 4OFZA 1HI0P 3HVWA 3TAMB 3L3CA 1WDDA 1PILA 4P71A 4I67A 1RT1B 2C3OA 3UN2A 2WONA 4ID8A 1HLWA 3R7SB 3DOLA 5L1LA 3DXSX 2VG7B 4J9SA 3KDOA 4MIBA 4IFYA 2MKJA 5HJXA 4CNZA 4ED3A 4DV5J 3TNVA 1AB8A 1UETA 1VRQC 3FQLA 4WP8A 3G8QA 5F9LA 3EDQB 3PX4A 2J8AA 1LFWA 4I4BA 3MURP 1VI7A 2ZOGA 1FRJA 4ANDA 3M8RA 2CXEA 1FHTA 1RLDA 2E1AA 5IS2A 1YBAA 4OYWA 2M3DA 3MCNA 3UD5A 3LP0A 1ZPVA 3HHNB 1W26A 3IFEA 4M5DA 4IFYB 3CJTA 5LXYA 1WUUA 4EWTA 2DNHA 4PWDA 2DR9A 5K20B 2P8IA 1PSDA 1Q16B 3W64A 2MZJA 2NXNA 5DGAA 3AQPA 2R3VA 1VQMS 3PACA 4OZ5A 3W2WA 4B3OA 2D1CA 4NXNF 3R27A 3QRRA 5A8RA 3R5BA 4C8KA 3HXMA 4V19X 2V6AA 1WKJA 1KDNA 1WI6A 3W60A 3KNAA 3LP0B 2C2KB 2VC0A 4NYOA 3BYPA 3GIIA 5IT9U 2CPIA 1K1QA 3QWUA 2XI2A 3ZZRA 1NO8A 1K47A 3PY8A 3OXLA 3SZ2A 3VGVA 2MQNA 3W2WB 2E44A 2DNYA 4KRWA 1HQ2A 3MPDA 3W8PA 4B3OB 1NHUA 2ZNYA 5C24B 5A8RB 1Y5LB 3AT1B 4OZ2A 2FUG9 3QT8A 3PYDA 4MFBA 1UPPA 4CO0A 4O3OA 2DR6A 2RS8A 3MR6A 4I69A 3AOCA 1MU2A 1RISA 1U48A 3UDCA 5D15A 2AW0A 1XIQA 5IT9Y 4DUZF 1VISA 2XQCA 4IR9A 1D09B 4QWAA 1F60B 4DLGA 9ATCB 1FK9A 4I7FA 2GHWA 3I0SA 4WU2A 1B70B 2BRKA 1RT5A 1NDPA 4YS2A 3KK3A 2B9EA 4RW6B 4RKUC 2FJXA 5E3AA 2R7TA 4CTAA 1TL7A 3DLGA 3P5TL 4DXLA 1X0PA 1KHWA 4I6WA 1LXJA 1YLXA 2GX8A 3ZZ0A 3AOBA 6FDRA 4QZVB 5KG7A 2ILZA 4I2PB 1RKIA 2UXCJ 2J7UA 2ADCA 1U0HA 4KGMA 2P2CB 1TKDA 1H6KX 3I0SB 3PW0A 2FVPA 3BQ0A 2MQ8A 4QR2A 1K0TA 4CTAB 1TL7B 3HHLA 3B6BA 2BA9A 4KHPJ 1EARA 1UJ6A 4USIA 2D3O1 2NUHA 3P49B 1C1CA 2UZAA 1S1TA 1U0HB 2AHOB 3GB0A 1IBMF 2IRYA 3CDUA 2YWEA 3TARA 3X3UA 1SC6A 3BEGB 4RBTA 3M6XA 1XBWA 3O2IA 3RB3A 4DPYA 4NEZA 3QJLA 2E5JA 3UCGA 3ENAA 1SJFA 3HHLB 4EO6A 2E7WA 3R6LB 1EZZB 3ZNJ1 3SCLE 1G6BA 3ZC4A 1QUPA 1B0PA 4WCEQ 4BHQA 1C1CB 5J2QA 3UDEA 2EFOA 1C4AA 3EGVA 3PR5B 1HI1A 1IR0A 4ICLA 4NZ6A 2EC2A 1NZAA 3J81j 3TO8A 4ECRA 4ZLLA 4KO0A 4LIWA 4P72A 4OL8A 4LSZB 2PEHA 4U67Q 4PZVA 2O67A 5IQQA 3GJRB 4LFCJ 2RRBA 2I6WA 1U09A 2QJ3A 2J6UA 1SKRA 1FTCA 1RWVB 4NZ7A 4WE1A 4IRCA 3G9CA 4WP3A 5J2QB 1Y9OA 4GO7X 3DMJA 2CRLA 2F8MA 4B9MA 2CNKB 1R89A 4WFBQ 3IGVA 4JI8F 4NEYA 4KO0B 1UFWA 3NGTA 2I38A 3EX7B 2KG0A 2ZD1A 2FB0A 1X9MA 4ZVSB 4CM2A 4JI0J 2OEMA 3D68A 1TKTB 1JJHA 4HDGA 1H38A 4ETZA 2WSCC 4DCJB 2BQRA 1DQ8A 1JLCA 4WE1B 1VDHA 2NPFA 3JAMY 5LMNJ 4WPAA 2YNFA 3OJUA 4ED7A 1R3NA 2AGPA 4EGLA 3FMWA 3K57A 5HP1B 2FC8A 3ULHA 5HSPA 5L9NA 4RO0A 2YPZA 4GKKF 3Q23A 4A8FA 4RW9A 4BC7A 5HVFA 3E2EA 2CIMA 1WC3A 4LF1A 2ZM6F 1HBNA 4H4MA 1S10A 4C0HA 2MKHA 2WVFA 4N76A 2M4MA 3MM9B 5K8NA 4UW2A 2GW8A 2ZVIA 4N41A 5D0HA 3OVSA 3MEEA 1I51B 2CPHA 1HWUA 1JLCB 1IM4A 4YQWA 2YX1A 2ATCB 2YNFB 4N77A 3H42A 2BXJA 1QAJA 5KFTA 4Z37A 4ED1A 2VQEJ 2W4DA 3MCSA 1XMBA 2HS4A 4ZPAA 5KFQA 1HBNB 4H4MB 3SQOP 2HFSA 1S57A 5EX3A 5B0BA 1SIZA 1A6LA 2JX2A 1ZH5A 4ZIWA 4P2SA 1BGXT 2XGPA 2VPZB 2BABA 1WC5A 2BEFA 3R9LA 4RJVA 5HANA 1UAWA 1REGX 3RAQA 1ZTTA 3L09A 2ZUGA 2BKOA 1IKWA 4LRFA 5FDLA 2DNOA 5E41A 2LYVA 4Y2MA 3EVMA 3AA8A 2W01A 3LA0A 3T1YF 2D41A 4RU9A 2DK2A 4E0DA 2O66A 2FHJA 3RRGA 2OD6A 5DRKA 3BSAA 1GX6A 3ISNC 2YNGA 2VBYA 3GIJA 1JX4A 1FKAF 5KFEA 3VAGA 3MCOA 4DFPA 2M9KA 4F4ZA 5JUMA 5FDLB 4RUHA 5A2QU 2GIRA 5LSLA 2HHHF 5CAAA 3I4HX 5L8RC 5KTQA 2BOPA 2HGLA 2Z2ZA 1R27B 4DV4J 2IVYA 4HLBA 3PW4A 4USWA 1NM2A 5D4OA 4U95A 3ZTQA 1AT1B 2AYMA 4QIVA 1U1OA 4EZ6A 3WHIA 2PD1A 4FP9A 5GADI 5EWGA 5BXIA 2BACA 3DGVA 1VQPS 2CQHA 3H25A 4NXNJ 1IJFB 3UE2A 1RT2B 1TR0A 1X5PA 1KQKA 1RT6A 5IZHA 1MN9A 3OL8A 1QJHA 3H5YA 3V6JA 1N36F 4LF4F 1U1KA 4EI2A 2HMIA 3CDEA 4QIFA 1N4LA 3J7AN 4B3TF 3I9V9 2GAGC 1H3DA 4X65F 5CA5A 5KT5A 4ZOSA 4WIQA 3QJJA 4KHMA 2V0NA 5LJ3Y 2LQ8A 4YB6A 5AXNA 4LF7F 2KKHA 1PO6A 3AXMA 4FBUA 1R8HA 1RT6B 3CCMS 1HNWJ 3DRYA 3D0IE 4G1PA 4USHA 3OLBA 4K2JA 4N5SA 4B3RF 1NH8A 4J9MA 4K50A 1QVFR 4ZPDA 1NSKL 3AD8C 2YWHA 4P2XA 4FYDA 3EJMA 1UZDA 4QWCA 4IR1A 3GV8B 4A8OA 1KEKA 3O6QA 1U25A 4NZ0A 2U2FA 2CQ3A 3HD1A 2BDPA 2ZKTA 2QMXA 3FCWA 3TP2A 1HPZA 1RAJA 2NXUA 4Q5VA 5HN0A 1N0UA 4NL5A 4Q8FA 1C0TA 3JSYA 2ZOFA 2RH3A 3OTOF 4YB5A 3H5UA 3SI8A 3M1VB 4XK8C 2VU5A 2MSTA 4PRFA 1ZAVA 3UDVA 1NJIT 4I6YA 5B0AA 2K7JA 4F3QA 1F3FA 2IFXA 4U6PA 3HT0A 1RADB 2A10A 3NBPB 5IWAJ 1IQTA 4M63A 3HO1A 5SZTA 1M5SA 1WNEA 1MG7A 3EPIA 4WP9A 5JMNA 1C0TB 2R8JA 4QYRA 1HQUA 1PG5B 1VK8A 3DRXA 4DUYF 3M30A 4MK7A 4ZN3A 2ASDA 1FKOA 3MHYA 4K4YA 2FZCB 3VALA 2UUCF 3MMBA 4WTOB 3TZZA 4Q7AA 3TA0A 3J7ZT 2IPOB 3L95X 4USKA 3EXYA 2GJFA 2IMOA 1PYTA 1DBDA 3RBXA 5KG4A 4O23A 3R2DJ 1IBMJ 2GQQA 2M8DB 3A12A 3RR8A 1RWOB 4RZRA 5CHCB 3OL7A 2N7YA 2PDAA 4NPOA 1HNXJ 3AFGA 4IYQA 5JJBA 4K8RA 1GT8A 3M9OB 3WDOA 1L3TA 3W61A 3MPWA 5D3GA 1C2PA 2VPXB 5I3UA 1NNDA 2E7XA 3OD2A 3MMBB 4KIAA 4JYAF 3HF5A 2QLXA 1RAEB 3PW5A 3L7PA 4WXOA 1N5SA 2VDHA 4NLTA 4W90B 3RGIA 3LQVA 3PHTA 5IC6B 3W9IA 1PKUA 2YKAA 4K59A 3PJWA 1H74A 2RUSA 4WK1A 1H7WA 3U1LA 3OT9A 2EFGA 2P6TA 3KLEA 1T03A 1S97A 4UOCA 1GAOA 1RT3A 2QSFA 4LQ3A 2E5GA 3CUNA 2W4PA 2WVEA 1VQKS 2CJKA 2YXLA 3QT6A 1PAUB 3BPSP 3TOQA 1OYEA 2AJ2A 1FDDA 3VQTA 4HACB 5B09A 3G87A 4ZHRA 3M4XA 5I3QA 3QBCA 4DPWA 3POTB 1TAUA 4NCBA 3B4MA 3I56S 3CC2S 4L76A 2KYXA 3K59A 2HLUA 4KB7A 1O5JA 1VQLS 3KLEB 5F8JA 1T03B 2Z58B 1RT3B 3PZPA 1RHRB 5I42A 1WORA 4CYUA 5A0YA 2QMUB 4O0NA 3PHEA 1UMJA 5GAEU 3PIOQ 2LFVA 2XSJA 1NHKL 2EEYA 4O44B 3CJRA 5HMXA 2YVSA 3IN5A 4F67A 4ZCIA 4DQQA 4DUTA 3WIUA 2ZH8A 3KLFA 3KLIA 2DHXA 1TV6A 3BH7B 3PRDA 2CQ4A 1IBLF 4F0MA 1G3OA 3QWPA 4P74A 3BBBA 5KFSA 1NU4A 5A0YB 2E66A 1X0FA 3MM5B 4JV2A 1Q86T 3D1HA 4C4WA 2GHPA 4F8RA 5IC4B 2UVVA 4GC7A 2CJAA 3D3BJ 3NP5A 8ATCB 1MROA 1R0CB 2J76E 1KVIA 2C3MA 3ILIA 4Y0FA 3T41A 4RW4A 2HAIA 3M6VA 4UQTA 1O0PA 1R8PA 1BQMB 2XMUA 2C2OB 3PRVA 1Y3JA 3QO9A 4NCAA 3KLIB 1RYSA 1TV6B 1KTQA 4F2RA 2Z57B 3DLBA 3PFOA 2EVZA 2VONA 4QWBA 2QX0A 3Q8UA 3JTNA 1T05A 2RQKA 3LGHA 1MROB 2C1EB 2HBQB 3IRXB 5CCMA 2XWYA 1LEOA 2BW2A 2LEBA 3C6UB 2OUGA 4X66F 2WBMA 3Q24A 4ECYA 4C9DA 3W7BA 3N5FA 3DHXA 1SH3A 3A8JA 2HPUA 1RCXB 3KDNA 3J7A1 2E5HA 4I6AA 2HHTA 4Y2KA 3AH6A 3MEGB 4C3KA 3B78A 1T05B 3TQEA 1QAYA 5EUHA 4DR1J 1Q8BA 4KT0C 4DF4A
chains in the Genus database with same CATH topology
1PYOB 3R7SB 1RHJB 3IBCB 3KJQB 2XYHB 2H5IB 2C2MB 2QLJB 1NMEB 2C2ZB 1RWMB 2H5JB 2C2OB 2CNKB 1RWNB 1RWWB 2XZDB 3D6MB 4ZVRB 2C2KB 3GJQB 3R7BB 1RHUB 3SIPB 2HBZB 2Y1LB 1RHMB 1QTNB 3D6HB 3GJTB 1RHRB 2QLBB 1RHKB 2DKOB 3GJSB 3EDQB 2FQQB 2H54B 1F9EB 2H4YB 4ZVSB 2QL5B 3R6LB 3RJMB 4DCPB 1RWPB 2CNLB 1GFWB 2QL7B 2QL9B 4ZVTB 2XYGB 4ZVUB 4DCJB 1RWKB 1RE1B 4ZVPB 1QDUB 2CNNB 5IC6B 2CNOB 1SC4B 2XZTB 3EDRB 2CJYB 2C1EB 2P2CB 2HBQB 1BMQB 2H51B 1ICEB 3KJFB 1RWXB 4JB8B 2H65B 4DCOB 3IBFB 1SC3B 3R6GB 1SC1B 2XYPB 3R5JB 2H48B 5K20B 2CDRB 4LSZB 1IBCB 4ZVQB 1RHQB 3GJRB 2H4WB 3NS7B 1PAUB 3QNWB 3D6FB 2HBYB 2QLFB 2Y0BB 3P4UB 5IC4B 4ZVOB 1RWOB 1RWVB 3KJNB 1I51B 3P45B 1I3OB 2CJXB 2HBRB 3R7NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYO B;  3R7S B;  1RHJ B;  3IBC B;  3KJQ B;  2XYH B;  2H5I B;  2C2M B;  2QLJ B;  1NME B;  2C2Z B;  1RWM B;  2H5J B;  2C2O B;  2CNK B;  1RWN B;  1RWW B;  2XZD B;  3D6M B;  4ZVR B;  2C2K B;  3GJQ B;  3R7B B;  1RHU B;  3SIP B;  2HBZ B;  2Y1L B;  1RHM B;  1QTN B;  3D6H B;  3GJT B;  1RHR B;  2QLB B;  1RHK B;  2DKO B;  3GJS B;  3EDQ B;  2FQQ B;  2H54 B;  1F9E B;  2H4Y B;  4ZVS B;  2QL5 B;  3R6L B;  3RJM B;  4DCP B;  1RWP B;  2CNL B;  1GFW B;  2QL7 B;  2QL9 B;  4ZVT B;  2XYG B;  4ZVU B;  4DCJ B;  1RWK B;  1RE1 B;  4ZVP B;  1QDU B;  2CNN B;  5IC6 B;  2CNO B;  1SC4 B;  2XZT B;  3EDR B;  2CJY B;  2C1E B;  2P2C B;  2HBQ B;  1BMQ B;  2H51 B;  1ICE B;  3KJF B;  1RWX B;  4JB8 B;  2H65 B;  4DCO B;  3IBF B;  1SC3 B;  3R6G B;  1SC1 B;  2XYP B;  3R5J B;  2H48 B;  5K20 B;  2CDR B;  4LSZ B;  1IBC B;  4ZVQ B;  1RHQ B;  3GJR B;  2H4W B;  3NS7 B;  1PAU B;  3QNW B;  3D6F B;  2HBY B;  2QLF B;  2Y0B B;  3P4U B;  5IC4 B;  4ZVO B;  1RWO B;  1RWV B;  3KJN B;  1I51 B;  3P45 B;  1I3O B;  2CJX B;  2HBR B;  3R7N B; 
#chains in the Genus database with same CATH topology
 2DO0 A;  2GFF A;  3PRB A;  4L74 A;  4BDP A;  2B56 A;  2KL8 A;  3UN5 A;  1Q8L A;  3OBI A;  4M5K A;  4DS4 A;  1WC6 A;  4DQI A;  3WBZ A;  4URQ U;  2KM8 C;  2DCU B;  3PYG A;  2DIV A;  1EET A;  1UA1 A;  1WF1 A;  2HHH J;  1J5E J;  3BZQ A;  2AEF A;  2ZWP A;  2GIQ A;  1ZET A;  3M8P B;  1KFD A;  4C48 A;  5KFR A;  1RSC A;  5AE2 A;  2AYG A;  1SXL A;  3C19 A;  2J9D E;  2UUB F;  5A6W A;  5K8P A;  4ZPW R;  3OR2 A;  2H3E B;  1WDT A;  1QD1 A;  2HGM A;  1JLA A;  3VHQ A;  2HWH A;  1EET B;  4JI1 F;  1TK8 A;  2MZS A;  5D4P A;  4DR3 J;  3M05 A;  1N36 J;  1U45 A;  2KXN B;  7FDR A;  5HRO A;  3IP0 A;  2DPJ A;  4NLR A;  4B3T J;  3ZNU A;  1N56 A;  4NI2 A;  4UZB A;  2M2B A;  1YRT A;  1RAF B;  5KFM A;  1VRU B;  3JQJ A;  1FNO A;  1CLF A;  1AZS B;  3R7B B;  4L72 B;  2QA1 A;  4OJ1 A;  3J7Y I;  4LF7 J;  3J81 Y;  3HZE A;  1FDB A;  3OR2 B;  3SV4 A;  3PJ9 A;  1U6Z A;  1JLA B;  2Z2Y B;  1XNQ F;  4J9L A;  4B3R J;  1D9F A;  2ILY A;  4MKB A;  2UVW A;  1ICE B;  2BJ3 A;  2XY5 A;  4NI2 B;  2AGO A;  3ZZZ A;  2YKN B;  2CPE A;  1PAE X;  2BR0 A;  2CA9 A;  2FJW A;  2CAD A;  4OHX A;  3CD7 A;  2VA3 A;  1KC8 T;  2OTL S;  3DLJ A;  4X2B A;  4HL9 A;  3NS7 B;  1ZBT A;  3DI6 B;  1UJ5 A;  1JXV A;  2JRS A;  4ECZ A;  1KOO A;  3TX0 A;  1ZOT A;  2WK4 A;  3HHL D;  5IQ6 A;  5DJB A;  4GVB B;  1LW2 A;  4DSL A;  2MHE A;  3OFH A;  3T5L A;  2GA7 A;  4GO5 X;  2XYH B;  2BOA A;  1RI7 A;  2R8K A;  1BD6 A;  4IG3 B;  2DY9 A;  3GPA A;  5KT2 A;  3PO4 A;  1UVI A;  3QAU A;  3OLA A;  1AXQ A;  1N6Q B;  2K3K A;  2RAQ A;  3BBC A;  2CVI A;  3H4D A;  3LH2 S;  3T9Z A;  5K14 A;  1QSL A;  4O4G A;  3W8G A;  2NR0 A;  2F7V A;  4ZVT B;  2A6O A;  3OUY A;  2XS5 A;  2G2O A;  2HS3 A;  1UWA A;  1LW2 B;  2W9C B;  2UUC J;  5DZ7 A;  2B7C B;  2CG4 A;  2XTJ P;  5F8N A;  3B8H A;  2OSR A;  5CYQ B;  3GV7 B;  3UDL A;  2DGO A;  2VG5 A;  3MOZ A;  2HRY A;  1MWZ A;  1D9D A;  4ZLP A;  3PXG a;  4Q43 A;  1YRU A;  1NBE B;  2FJE B;  4A8S A;  5K14 B;  4O4G B;  2MY7 A;  2AJ1 A;  3S8S A;  3OUY B;  3U7J A;  2OHD A;  3PM9 A;  3WQP A;  2BUN A;  1XTZ A;  1ULR A;  4F0K A;  1S49 A;  3QIP A;  3HZG A;  4JYA J;  2I1R A;  2WHO A;  3EYZ A;  2AT1 B;  5ETM A;  1WEL A;  3N28 A;  1S79 A;  1LWE A;  1FA0 A;  1DUR A;  2PFF B;  3KHG A;  4B9V A;  3IM8 A;  3JTP A;  3IGN A;  4OZ3 A;  4LIR A;  4RNM A;  3ETM A;  3H5S A;  4NLG A;  2BVZ A;  4ZJQ A;  1HBU A;  4JI7 F;  4WKR A;  2CNO B;  4KQZ A;  1MW7 A;  3HLU A;  4OHY A;  2VIC A;  3OFE A;  1RTJ B;  4QU6 A;  4IFV A;  2DGS A;  2CZV C;  1S99 A;  3NGU A;  2PMZ D;  4U7U K;  3VGU A;  2K1R A;  3UR3 C;  3FBC A;  2IDL A;  1DJ0 A;  3LUY A;  1WG5 A;  2WB4 A;  1LWE B;  1T02 A;  3DLH A;  3O1L A;  5H1S V;  1Q7L B;  2XMJ A;  4FF4 A;  1F9H A;  2XZW A;  2BRL A;  2CQ1 A;  2Q43 A;  4OYA A;  3GG1 A;  3TZY A;  3V4I A;  4DV6 J;  5IXU A;  2ZNZ A;  3DOM A;  4CO2 A;  4J9R A;  2JH3 A;  3ET6 A;  3IAS 9;  1HA1 A;  4O3S A;  3FBE A;  3G71 S;  2HHP A;  4K4U A;  5C25 A;  1HMV B;  2LEC A;  4F4K A;  4KPC A;  3O8W A;  4DX7 A;  2K1R B;  2NXC A;  2J9C A;  5KFY A;  1F0X A;  4DN0 A;  1VLO A;  1Q82 T;  2HZC A;  1DY3 A;  3T6B A;  2MTL A;  2CNL B;  5DO2 A;  3BN7 A;  3NS6 A;  3H2V E;  4K4Z A;  3BR8 A;  2HFZ A;  2YY3 A;  3V4I B;  3O3L A;  1FRK A;  1YZ6 A;  1U7L A;  4LSN A;  3DOM B;  1XMO F;  1ZA2 B;  1XWL A;  2GHV C;  3ET6 B;  4P52 A;  3DC2 A;  2D74 B;  1VQO S;  4EZ9 A;  5C25 B;  3CCJ S;  4CNY A;  2IYI A;  3QGH A;  2DNK A;  2D69 A;  3MAH A;  4DR7 F;  2KDO A;  4EU0 A;  2A3J A;  1IWG A;  4ECX A;  4UOF A;  1P9Q C;  4ES1 A;  3QNW B;  3TVY A;  3MI7 X;  4NA2 A;  5LSO A;  1TL3 A;  1TFW A;  1JXL A;  2VFR A;  5EHH A;  3M8Q A;  1X31 C;  2FZK B;  2XS7 A;  6AT1 B;  4Y2I A;  2WSE C;  3BDE A;  2KN4 A;  2DJW A;  3UNY A;  1S1V B;  4WKY A;  3GMG A;  4BS2 A;  4J9K A;  1VLY A;  2CZ9 A;  1OIA A;  4X62 F;  1IJE B;  1Y10 A;  2E1M C;  2SXL A;  5F3T A;  2FHJ D;  4YN3 B;  2PI5 A;  2VFU A;  4ZP8 A;  2G9O A;  1VFJ A;  4DCP B;  2YWK A;  3D66 A;  1FRH A;  4PCQ A;  3BKT A;  1N32 F;  2KFN A;  1EP4 A;  3DM2 A;  2XMV A;  7FD1 A;  1DTT A;  3VR1 A;  4EBD A;  1RT4 A;  2YQ3 A;  4USV A;  4PR6 A;  3VAF A;  3BB5 A;  5K8O A;  1LWX A;  3GE9 A;  3E01 A;  7AT1 B;  2V63 A;  4DLE A;  1S0M A;  4DX8 H;  4RX6 A;  3NNA A;  3QGP A;  3RBZ A;  2AZ1 A;  2UVU A;  2R2T A;  3GYG A;  2E9R X;  4ECQ A;  3HFK A;  4YME A;  1TP7 A;  2H1Y A;  3QFW A;  1EP4 B;  1HNV B;  1I3O B;  2CQG A;  2LDI A;  2IAJ A;  2MXY A;  2JC1 A;  1RT4 B;  3TWZ A;  4C11 B;  3HPO A;  2ATL A;  1L3U A;  1VQ5 S;  3KUH A;  5IM0 A;  1CUL B;  3E01 B;  5HBM A;  4C97 A;  1IKX A;  2VL1 A;  3ILO A;  4DMZ A;  5HQ8 A;  1N5T A;  3BN4 A;  2PC6 A;  4XTT A;  1CJK A;  1XK8 A;  3K89 A;  3RAX A;  4ZN1 A;  3B54 A;  4GMK A;  3CCT A;  3VZH A;  2VV5 A;  2F1F A;  2XZT B;  3J80 U;  4WU3 A;  3MOJ B;  2ZOM A;  2IAJ B;  4R5P B;  4DL3 A;  2B0G A;  1UVN A;  3RU0 A;  2YWG A;  4XO0 A;  4ZKA A;  5IM0 B;  5HBM B;  5KFO A;  1IKX B;  3GCW P;  4LR7 A;  4TLR A;  2HFV A;  4JI1 J;  4M94 A;  2X51 A;  3ZTR A;  3ZTP A;  2HK2 A;  4TYA A;  4DSE A;  2FVR A;  2V50 A;  3BV8 A;  5LMU F;  5JVH Q;  1BWE A;  2KJV A;  4JI2 F;  1UFL A;  5K9F A;  2IM2 A;  2CJX B;  3I5A A;  2UUA F;  3QFH A;  5KAK A;  2MQM A;  3W9J A;  2I8E A;  1PC4 A;  1U47 A;  2IM0 A;  1N88 A;  2GS8 A;  1JKH B;  1YJT A;  2HBZ B;  1U0S A;  4DR5 F;  2MQP A;  4NLW A;  2QA2 A;  4RUC A;  3TUZ C;  2BQU A;  1WHY A;  3SXL A;  2UP1 A;  2R8H A;  1IBK F;  5AXL A;  3NMR A;  2J0Q D;  3DOK A;  1N0V C;  1S1W B;  3V4M A;  3BO4 A;  2ZH2 A;  4PXE A;  4CIO A;  3Q8S B;  2ALZ A;  2ZC3 A;  1U1M A;  1JLQ A;  5I4M A;  4B3S F;  4WII A;  3N79 A;  3TZX A;  2FY1 A;  3OVA A;  2IM3 A;  1JXE A;  2B5J A;  2JJ4 D;  3G86 A;  5D0G A;  1RTZ A;  4M5H A;  1E6V B;  2F9D A;  3HHK A;  1CG2 A;  2DIS A;  2W2N P;  3DOK B;  3PTW A;  3A8K A;  3QRQ A;  2DR7 A;  2N4C A;  1TKZ A;  2W7A A;  1PYO B;  4PWW A;  4ZVG A;  3SSS A;  1N33 F;  5C42 A;  4ELT A;  3Q83 A;  4YY3 F;  1JLQ B;  3D6M B;  4X4U A;  4DV3 F;  3AOA A;  3V81 B;  3RB6 A;  5LSR A;  2BJ1 A;  4DX5 A;  2HRT A;  1EKS A;  2B5J B;  3T5J A;  2Z2M A;  4UUW A;  3CJ4 A;  4CLU A;  3NNC A;  4C98 A;  1T9W A;  2RRN A;  4N47 A;  3KHR A;  1NKC A;  4RLE A;  1VQ9 S;  2FD2 A;  5CD4 A;  1M5K C;  2H51 B;  1YRX A;  4PXD A;  3SDE A;  4OLP A;  3M2V A;  5C42 B;  2HNY A;  2U1A A;  3CJK B;  1ZAW A;  2GCF A;  1OWX A;  5A76 A;  1FDN A;  3R6G B;  4HHJ A;  4DL6 A;  3IRW P;  3KLG A;  1NJW A;  2ZBP A;  4FPI A;  3CIM A;  1MMD A;  4F3M A;  1Y00 A;  2QTW A;  2GGP A;  2MJN A;  1P27 B;  2Z8Q A;  3PX6 A;  4OX6 A;  1FXL A;  2MQL A;  2ZDO A;  2VQF F;  3UNG C;  3D6H B;  2DR5 A;  2NRE A;  2DH7 A;  3C6T A;  3HP6 A;  3DRS A;  4L75 A;  2ZBI A;  2YH0 A;  3M2V B;  1H2U X;  2HNY B;  1I1G A;  3UW1 A;  2MLX A;  2VBW A;  2HVI A;  2XMT A;  4TNO A;  3UPF A;  4HTI A;  1Y11 A;  5EDW A;  2FLL A;  3DYA A;  4AUK A;  4LF6 F;  4W4M A;  2YKM A;  3TA1 A;  3VAH A;  2HND A;  2J5A A;  4LRD A;  1AA1 B;  2O3D A;  3DDK A;  1FXR A;  1NKB A;  2MKS A;  3C6T B;  2Z0G A;  3DRS B;  3VAM A;  1LK5 A;  1HNZ F;  1JLF A;  4JI5 F;  2CWX A;  4KR0 B;  3SCK E;  3LWL A;  3TYT A;  1RU1 A;  3AHP A;  1EJ7 L;  2DH8 A;  3LWM A;  3CT9 A;  1RBA A;  3DYA B;  3MUV P;  4C7Q A;  1S48 A;  2RF2 A;  3AQO A;  2YKM B;  5L38 A;  1JLB A;  3M8W A;  1FI4 A;  2HND B;  3U27 A;  2KH9 A;  4X4V A;  3DFE A;  3DLL Q;  1VCT A;  2LEP A;  2KFZ A;  4HTJ A;  1BQX A;  3SV3 A;  5C5J A;  5BR8 F;  3ZZY A;  1YBT A;  3FDS A;  4CRJ A;  1JLF B;  3C2P A;  1T9V A;  5A8K A;  3R97 A;  3G96 A;  4YB1 P;  1X7V A;  2WTF A;  2R7V A;  1BC6 A;  1F9F A;  3A8I A;  1HKA A;  1U6F A;  4DFK A;  2QO3 A;  1NPK A;  1LWC A;  1H2V Z;  1XMO J;  3MR3 A;  2I9S A;  1VYA A;  3P5B P;  2RF2 B;  5C7P A;  4UTG A;  3OHA A;  2C3P A;  3E8O A;  2AYE A;  2OPQ B;  2DGX A;  2VG6 A;  1NUE A;  2MJU A;  1LFP A;  3R3T A;  3CW2 C;  3D28 A;  4DBQ A;  1BY9 A;  5KT6 A;  2IRU A;  4F3O A;  4P2M A;  1IR1 A;  1V9O A;  1ACM B;  2PT0 A;  4NLX A;  2WRM A;  4NLQ A;  1WEY A;  4CH1 A;  1HBM B;  1LWF A;  1RYR A;  2M8H A;  1MML A;  1S9E A;  2YTC A;  1VC5 A;  1PJ6 A;  1F3V A;  1S0O A;  1VQN S;  2B7B B;  2L48 A;  1R31 A;  1LWC B;  3QGI A;  4X64 J;  3JYT A;  1SVD A;  3QRP A;  3FC9 A;  2RU9 A;  3JS9 A;  2G13 A;  2XM3 A;  4AQY F;  1WKK A;  4LF5 J;  1UWB A;  3HK2 A;  2JLE A;  4WWS A;  3TZW A;  1SKW A;  4U7C A;  1TTH B;  1ZA1 B;  2KT5 A;  1RAO A;  1RU2 A;  1NSP A;  1W25 A;  4LF2 A;  5ETS A;  3HMJ G;  2VUG A;  1N32 J;  3AB2 B;  1LWF B;  2BE7 D;  2NYI A;  4NWB A;  1BWV A;  3VWS A;  1KQG B;  2LA4 A;  3EZO A;  3CO9 A;  3OQ2 A;  4DI6 A;  1B3T A;  3S6E A;  2PFD A;  1UWB B;  4PAA A;  4ANE A;  3G6E S;  1WF0 A;  2ZBQ A;  2JFD A;  5E2Q A;  4CO5 A;  2QA4 S;  1DFD A;  1GTE A;  3ZZT A;  3D0H E;  3I6P A;  4TQR A;  1FKP A;  1YTY A;  5D4N A;  4ZVQ B;  1UCN A;  4ZCM A;  4YHH J;  1RHQ B;  1S1X A;  3TUP A;  4DS5 A;  4DL0 C;  2VDI A;  3DKD A;  3FQK A;  5J1E B;  3U02 A;  4HVZ A;  4FS2 A;  4OYI A;  1EHW A;  3H98 A;  4OX7 A;  2KO1 A;  3PNI A;  3K5M A;  3M6U A;  2B9X A;  2H5E A;  1HAR A;  1ITP A;  3N9U C;  1SUQ B;  3ZO7 A;  2PII A;  5KT7 A;  5GAG I;  1FKP B;  2EWH A;  2ADB A;  1EIY B;  3IC1 A;  2YNI B;  2HQG A;  2QYC A;  4O0I A;  2QV6 A;  1LW0 A;  4IG0 A;  2IA6 A;  4B9L A;  2Q66 A;  1KWM A;  4D3H A;  4MKV A;  5KFU A;  2VH7 A;  2QIF A;  3FUY A;  3K0J A;  6FD1 A;  3FFI A;  5BJR A;  1S6P B;  3NAI A;  5F8L A;  3DRP A;  1M1H A;  2ZJP Q;  2V69 A;  3OTB A;  5EGY A;  5EWE A;  1RAB B;  3T1H F;  4YR3 A;  5KG3 A;  4KYZ A;  4ZVH A;  1IKV A;  3ZZU A;  1LW0 B;  4IG0 B;  1URN A;  4XPE A;  3F44 A;  2HWI A;  5GAH I;  2QGF B;  2ROP A;  2NYH A;  1RXO B;  4DV0 J;  3CJ3 A;  4FS1 A;  2QE5 A;  4A8W A;  1X5S A;  2VBZ A;  1J5O B;  2BJD A;  4EYI B;  3FKB A;  3HVT A;  1JNZ B;  4XAK A;  1I94 F;  4A8X A;  5U47 A;  4LFB F;  2HVZ A;  1GMV A;  1RJJ A;  1CSJ A;  3JSM A;  4MKA A;  2RU3 A;  4C8L A;  1IKV B;  2XLJ A;  2EG1 A;  1BLU A;  2C3U A;  3OTD A;  1BMQ B;  4B3S J;  4J9N A;  4Q45 A;  3A8E A;  1ELO A;  4TYB A;  1N34 F;  1W7W A;  4LMZ A;  4CZC A;  2DB1 A;  4TU8 A;  2RIJ A;  1SC3 B;  3CF5 Q;  3NY0 A;  4ZA1 A;  1R0B G;  3A1Y G;  1RLC L;  1IBC B;  5EWF A;  2C42 A;  4DQS A;  3JSM B;  2BE2 B;  2K2P A;  1RTI A;  2FJV A;  1HHQ A;  4C2M A;  3D1O A;  3CD0 A;  4M8L A;  1X8D A;  4DV3 J;  4PUO A;  1RWW B;  3GZ7 A;  1OS5 A;  1RT1 A;  4GKJ F;  2X1B A;  1QAX A;  2V2Q A;  2HNZ A;  2UV8 A;  4ZVE A;  5CYM A;  2ZBC A;  4EMD A;  2W2O P;  2N3L A;  3H40 A;  2BMB A;  1FJG F;  2NXE A;  3N6M A;  4Z7C A;  2HQ3 A;  4LBH A;  2R2S A;  4NX9 A;  2IBO A;  3UD4 P;  2YWW A;  4FN5 A;  1S6O A;  4PUO B;  3QID A;  1YDL A;  5FLX Y;  5IT0 A;  1UFK A;  1OQ6 A;  4DF8 A;  4AYB D;  2HNZ B;  4QIW D;  4K4T A;  4CWB A;  4Q8E A;  5CYM B;  4OZN A;  4PG6 A;  2JNJ A;  1QSS A;  2A0F B;  3GP9 A;  3M6W A;  1MN7 A;  2R7U A;  2DXF A;  3ADA C;  1U1P A;  3GSD A;  3OW2 R;  1JLE B;  1ZS6 A;  1RA6 A;  1FXD A;  1O6X A;  2O01 C;  2KVI A;  3IWX A;  1LK7 A;  2DBB A;  1X9S A;  3D54 A;  4M5G A;  3OV7 A;  3BQ1 A;  1MWY A;  4EFA C;  3OTE A;  3TVK A;  3P6Y C;  4ZLN A;  2DEI A;  2NSB A;  5CXT A;  1WSV A;  3NRB A;  2ZE2 A;  1HNZ J;  3D4J A;  4ED0 A;  4DV2 F;  2LA6 A;  4FZV A;  5AXM A;  3R5G A;  2DXD A;  2DGV A;  1FE0 A;  5C24 A;  2X1G A;  1FJE B;  4OYO A;  1G2E A;  4C3L A;  1CS4 A;  1PJ7 A;  4MKY A;  2KRB A;  3MPY A;  4C8N A;  2KFY A;  2G0J A;  4ZPC A;  4LR9 A;  4EBC A;  4N8O A;  2ZE2 B;  4ZPV R;  3R7N B;  4DR4 F;  3NCR A;  3W65 A;  2C2Z B;  5AXK A;  4ZVR B;  3AAW B;  2KHC A;  2FYX A;  2CJ9 A;  3KUG A;  3GJT B;  1CS4 B;  1QLN A;  2P9E A;  5A6P A;  4RW7 A;  3UVJ A;  1IN0 A;  5ADZ A;  2CPF A;  4RW6 A;  3QYY A;  4IH5 A;  1S0N A;  2CQ0 A;  5F9N A;  2DNG A;  3WC2 A;  3UR0 A;  4CLZ A;  2DH9 A;  1X60 A;  1F1B B;  2M52 A;  1YZ7 A;  2VC1 A;  3JXO A;  1SL2 A;  5FJ4 A;  4I2P A;  4JB8 B;  4P10 A;  5CAB A;  3BGU A;  3IO1 A;  2YNH A;  2MPU A;  4DV1 J;  2J0W A;  4I1T A;  5DG7 A;  3BGL A;  3FK4 A;  3N6N A;  3TEG A;  1FWP A;  2AF6 A;  4CO3 A;  2AJF E;  4OZ0 A;  2J7W A;  3Q2T C;  4ECV A;  4RW7 B;  3UVJ B;  3TAN A;  3B4D A;  1G7C B;  3C46 A;  5KOW A;  1FVQ A;  2W25 A;  2VKZ G;  2AJ4 A;  2OSQ A;  5HAO A;  4LBP A;  4P73 A;  3H8Y A;  3Q22 A;  2PEB A;  3KMQ A;  3GFZ A;  3SYZ A;  3TUJ C;  1U1L A;  2EK6 A;  4LF8 F;  1VR6 A;  2YNH B;  3FJ2 A;  3THV A;  1VQY A;  2HHQ A;  1UA0 A;  2ZH4 A;  1PBU A;  1TMM A;  4CLL A;  3HI9 A;  1RTH B;  3SBM A;  1A9N B;  4DPU A;  2BBE A;  2FHO B;  1QAI A;  3ENQ A;  2PGC A;  1NEE A;  4B9T A;  1HR0 F;  2MLY A;  3UN3 A;  1ZZF A;  2DHG A;  4LBI A;  4ER8 A;  1P9Y A;  2A18 A;  2XS2 A;  3QPI A;  4CP5 A;  1XNR J;  4ITS A;  1KFS A;  2RD5 C;  4O3Q A;  2BYC A;  4ECW A;  2GML A;  1TVR A;  3A3N B;  5LT5 A;  1H0H B;  4ED2 A;  3CPW R;  2MGZ A;  1BXN A;  3DCA A;  3IM9 A;  4B9N A;  5GAD U;  2J0S D;  3LAN A;  2XI3 A;  4U8V A;  2FIU A;  4D3G A;  1MMN A;  5DQG A;  1H72 C;  4TY8 A;  3RYL A;  1YGY A;  2R8I A;  3I55 S;  1ZM3 A;  1TVR B;  4K5R A;  3GIR A;  5HMW A;  4N8N A;  1NK8 A;  3UQS A;  2V8G A;  2IYG A;  2Y0S D;  3ILJ A;  2MGZ B;  4QYZ K;  4FXD A;  4PAB A;  2OPP B;  3OL6 A;  1QDU B;  1YJU A;  5B0G A;  3EMT A;  3HJV A;  3TEH B;  2PI4 A;  1TKT A;  1KQF B;  3NAH A;  2X7I A;  3FCV A;  2W1B A;  2YWF A;  3MPU B;  2GC8 A;  1M90 T;  4Y28 C;  4KC5 A;  9RUB A;  2Y9H A;  3QAT A;  4CI0 B;  4TY8 B;  1RBL A;  4L73 A;  5KFF A;  3NGR A;  3T1H J;  4U9R A;  3G82 B;  2F4F A;  2RB7 A;  4DJB A;  4ENO A;  4DR2 J;  1NK7 A;  2ZHA A;  5HP1 A;  2APO A;  3P4U B;  1SPB P;  1A0O B;  1PIE A;  1QSY A;  3Q86 A;  3P45 B;  3HCX A;  3V5R A;  1TU0 B;  3HFV A;  2RQC A;  2OMO A;  1KLM B;  1UL3 A;  1X4C A;  5ITH A;  4V19 J;  3G8T A;  3MM9 A;  1I94 J;  4LFB J;  3IR6 B;  1SH2 A;  4A47 A;  1Z2L A;  4NLS A;  2W9B A;  5DGB A;  2C2E A;  2RKI A;  3BSN A;  2IA0 A;  2EKN A;  2W24 A;  3IS9 B;  4NA1 A;  3GIM A;  4ZCK A;  4TN2 A;  4DR6 F;  2E7V A;  2MZQ A;  1F6T A;  2HRU A;  4KY3 A;  4YB7 A;  2DT9 A;  2IHR 1;  1N34 J;  1SIW B;  4F36 A;  2CPX A;  1RAH B;  4DV5 F;  4WYW A;  2HLT A;  3KJF B;  4CLP A;  1HNI B;  4HKQ A;  5KFC A;  1N5V A;  4ECT A;  3I32 A;  4BLG A;  2XYP B;  3M2U B;  2MZT A;  2EFV A;  4LVN P;  4YFU A;  3ICL A;  1NRK A;  2W9B B;  1TEL A;  2RKI B;  4NA3 A;  2AZ3 A;  4QPX A;  4K4S A;  2KG1 A;  1TL4 A;  2ERR A;  3DXB A;  3ENW A;  3TX8 A;  3MXH P;  4JV0 A;  1W2B R;  4DFJ A;  1EB0 A;  4K0K F;  3AB4 B;  2JVO A;  1TL5 A;  2C2M B;  3CIZ A;  3HHL C;  2AJQ A;  3CME S;  3D3C J;  2LQB A;  2R42 A;  2FY8 A;  4FKX A;  4NLP A;  1FJG J;  3BDP A;  1GH8 A;  4X4R A;  2BKN A;  2M7S A;  4AL5 A;  3KTQ A;  4DL5 A;  3EGN A;  2UU9 F;  4URS A;  3D1Q A;  3CCQ S;  4C8O A;  1V3R A;  1JK9 B;  1NDC A;  1WTB A;  3MUT P;  1IXK A;  4OMF G;  2Z30 B;  1CPZ A;  3GYX B;  2W8L A;  4J90 A;  4I2Q A;  3MDF A;  3AD7 C;  3K17 A;  1B0V A;  2UVR A;  3PV8 A;  2BX6 A;  1WI8 A;  3R5J B;  1APS A;  2OFH X;  2L9N A;  3CE8 A;  1YJN S;  3PEH A;  1K9M T;  3W5X A;  4Y2A A;  2AYB A;  2HS0 A;  2E29 A;  4CLY A;  4IOB A;  3TRG A;  4M5M A;  2POK A;  1P1T A;  4R8U A;  4JI4 F;  5ETL A;  3DDN A;  1RT2 A;  4I2Q B;  4FVM A;  2Y1I A;  3W2V A;  1ROF A;  2CAJ A;  2QMW A;  2ZDP A;  2YX7 A;  3AD9 C;  3MUM P;  4MK8 A;  5M2U A;  4CCH A;  2CPZ A;  3TAP A;  1IQZ A;  2VPW B;  3U1M A;  1N5Y A;  1TZ0 A;  3HKW A;  2QL9 B;  4WZQ A;  3RUB L;  3RTV A;  1Y4Z B;  3SMZ A;  4I68 A;  3T1A A;  1S1U A;  3J7Z 5;  2MLZ A;  4A8Y A;  4KGV B;  2G0I A;  4R8U B;  1NJZ A;  4J9Q A;  1D1U A;  3VVT A;  2C2N A;  3W2V B;  3FBB A;  4O4R A;  5A2Q Y;  3BKF A;  5HAT A;  3KJV A;  5CZX A;  2UXC F;  4M5J A;  3HVR A;  1TAQ A;  2BZ2 A;  4QJV A;  1N5Y B;  3IR7 B;  4OZJ A;  1IKY A;  1O51 A;  2R9L A;  3DHW C;  2BJ7 A;  4FYX B;  2ZH7 A;  3AY0 A;  4TU7 A;  1S1U B;  3EUN A;  1UZH A;  5KFP A;  4NMX A;  4OJH A;  4XIU A;  5J2N A;  2B3T B;  5KFI A;  4DSI A;  2V9K A;  4G1Q B;  4PXC A;  2LXF A;  8RUC A;  4ES2 A;  1RHK B;  3M1V A;  3GSI A;  2J9D A;  4AT1 B;  1F9E B;  4KBI A;  5D8H B;  3KJV B;  3UCZ P;  3G8S A;  2Q1L A;  5ETK A;  2V4R A;  4JV1 A;  5KFG A;  5ETR A;  2RDJ A;  1U2R A;  2OPR A;  1IKY B;  2V8V A;  3BKU A;  4KKO B;  3QMQ A;  2FLP A;  1K0V A;  1RCO B;  2JEI A;  3MWB A;  4DUZ J;  2MKI A;  3NBP A;  2VPY B;  4B3M F;  1X4E A;  4UZC A;  3BS9 A;  1KD1 T;  4FF3 A;  1R0A B;  1KOH A;  2O1P A;  2WVC A;  1X5T A;  5J2N B;  5KFW A;  5KFH A;  4RUB A;  2OEK A;  1S72 S;  2Q6C A;  3C16 B;  3CB4 A;  4DPT A;  4KFB A;  3PDN A;  3T6J A;  4PPD A;  2LU2 A;  1HW8 A;  2CQP A;  2MZ1 A;  2CQI A;  2DNL A;  2MY8 A;  1FD2 A;  1T0T V;  4LR8 A;  2OPR B;  5E0O A;  1VIO A;  2RUG A;  5KFJ A;  2V68 A;  3LTO A;  3BQ2 A;  4OHW A;  4LF8 J;  2IBK A;  4L6V 3;  1TKX B;  4F4X A;  3DDI A;  2LQ5 A;  3GR1 A;  2KXH A;  4ECU A;  3K8W A;  4PG4 A;  4KFB B;  3FRY A;  5L1I A;  4J5O A;  3ILL A;  2A1B A;  1YIT S;  2CWK A;  4RBU A;  2MQO A;  3MEC A;  1HWI A;  2D3Z A;  1HR0 J;  3KKF A;  4DL7 A;  4OZ1 A;  3UWT A;  2ZZN A;  2XCP A;  3RAM A;  3UCU P;  3BSC A;  1FEE A;  2V4J A;  2F9J A;  3CCR S;  2J8S A;  4IOA Q;  4DCO B;  1VJQ A;  3I0R B;  5B0E A;  4JI0 F;  1F5C A;  2LCW A;  3KXD A;  1TK0 A;  1D8Z A;  5B0F A;  3BF4 A;  2F65 A;  1U02 A;  3A3O B;  3MEC B;  2RS2 A;  5LMN F;  1CVJ A;  4C0B A;  2XLI A;  5LM7 E;  2G1D A;  2IM1 A;  2IVF B;  3H7H B;  1SJ4 P;  5KG6 A;  2V4J B;  3G6V A;  1KRP A;  3T5H A;  2HUR A;  4ED4 A;  2ZVS A;  2DHS A;  5KFD A;  3Q8R B;  4HAC A;  4OLO A;  4ZPT R;  2V2Z A;  2VF3 A;  2ACY A;  5D6G A;  3MAQ A;  3CJ5 A;  3POT A;  2ZH1 A;  3GTY X;  3NG8 A;  1H2T Z;  1BQN A;  4FNI A;  3W9H A;  2GMH A;  3ETO A;  3J7Y U;  3LAL A;  4LRA A;  2LP4 A;  2R7S A;  1VQ6 S;  1Q53 A;  4FYW B;  2PA8 D;  1JJ2 R;  1NCL A;  1B0T A;  1FDA A;  5J2P B;  3JSR A;  1HWJ A;  4NLD A;  3PG9 A;  1Q8K A;  1L3S A;  2IIH A;  5CD4 H;  4ELU A;  4ATN A;  2JLF A;  3CJ8 A;  2V67 A;  1M5P C;  4O44 A;  1YJR A;  5E3Q A;  4JI8 J;  2P9C A;  3M2R B;  2E1R A;  2VBX A;  1BQN B;  3GV5 B;  1WOO A;  3OHB A;  1B4S A;  4RPF A;  3E3X A;  4F25 A;  3K5O A;  1B99 A;  4AL6 A;  4PG8 A;  5B08 A;  2A2C A;  1LOU A;  4J9V A;  2EFN A;  2DD8 S;  4P9S A;  4A8K A;  4HT5 A;  3MM5 A;  3R5C A;  2E9Z A;  2PE8 A;  5H9E J;  1RHU B;  3T3F A;  2GAH C;  1T9Y A;  4ZP9 A;  3CCV S;  4DR6 J;  3ZXW A;  3I31 A;  1BQM A;  1KON A;  2R2U A;  3P3D A;  4GKK J;  2D9P A;  3VV2 B;  2ZM6 J;  3VCD A;  5BYS A;  4IOC Q;  2CYY A;  1SC4 B;  2HAF A;  4ZCL A;  1NB2 A;  5L39 A;  2PO4 A;  4B08 A;  4Q44 A;  1RT7 A;  2YPY A;  2D9O A;  2KYZ A;  1N48 A;  2VA2 A;  2X1F A;  4UQG A;  4ZP7 A;  4F4Y A;  2AP6 A;  1VGY A;  3IRX A;  2LDY A;  1T9T A;  1XN9 A;  2WCX A;  3Q8Q B;  4DV7 F;  2NS1 B;  2WON B;  4DU7 A;  4DWI A;  3DOL B;  2H4W B;  2RNE A;  2FJA B;  5M2R A;  3KOA A;  1WEX A;  5D77 A;  3MM6 A;  3C6U A;  4K0K J;  4DV4 F;  4NE9 C;  1XJW B;  3CCZ A;  3GQC A;  1UKU A;  5L46 A;  5MLC V;  1V5I B;  1RT7 B;  2JOQ A;  1RK8 A;  3LP2 A;  3GJQ B;  3MEG A;  5K5M A;  4OYZ A;  3SIP B;  2OKQ A;  3R1H A;  3MFH A;  1REV A;  2ZWO A;  3KHL A;  3CCE S;  1WHV A;  2UU9 J;  1KVJ A;  4AE5 A;  1M5V C;  3EZ5 A;  1K1S A;  4MAK A;  1TUV A;  3WX8 A;  1S77 D;  1GNK A;  3MM6 B;  3VAJ A;  4M5D B;  4ZVP B;  5K8M A;  4ZJL A;  2DGT A;  3VTI A;  1UEK A;  4OI1 A;  4PWD B;  4WFZ A;  3EVW A;  3MM8 A;  3WC0 A;  3FEZ A;  1SJQ A;  1T94 A;  1IR2 A;  3T1Y J;  3LP2 B;  3M8P A;  2M88 A;  1REV B;  2ZEJ A;  4DU8 A;  4X4T A;  5CH7 B;  4AFF A;  1KS2 A;  1RQ0 A;  1HNW F;  2HBY B;  1SL1 A;  4CO1 A;  5G4D A;  4JI4 J;  2CUY A;  2FZG B;  5HMY A;  2ZKU A;  3BGR A;  2KXF A;  2HSE B;  1URR A;  2M70 A;  3G2X A;  3MM8 B;  2UUT A;  2DXE A;  3KHH A;  3AXK A;  2LEA A;  1OPI A;  4FVC A;  3QZ8 A;  4CH7 A;  3T19 A;  2WVD A;  4USJ C;  1YIJ S;  3NL0 A;  5HJY A;  1FD8 A;  2ROG A;  1VRU A;  1RWP B;  3NKY A;  3GU0 A;  4W92 B;  1AZS A;  2PSZ A;  2WB1 D;  4MFB B;  4U96 A;  3KNG A;  1FRX A;  4ZVU B;  2VFV A;  1VC6 A;  4NLO A;  3BGR B;  5ETV A;  1DZ5 A;  3IMQ J;  3US5 A;  3GWC A;  1MU2 B;  2HGN A;  2RT3 A;  2CPY A;  2XGQ A;  5IWA F;  1LKZ A;  2HKE A;  4LF4 J;  3MR2 A;  4CQ1 A;  1FK9 B;  5E5N A;  1Y5I B;  4I7F B;  3ZZP A;  4Y3C A;  2YKN A;  5I3P A;  4X65 J;  3IWN C;  1JMT A;  4OV6 A;  1RT5 B;  3KK3 B;  1TUG B;  3DLG B;  4OIX A;  1M5H A;  3IBC B;  4IO9 Q;  4ALZ A;  3W63 A;  1T8E A;  3DI6 A;  3ZFV A;  3H0P A;  4RNN A;  3KMS A;  2HFU A;  8AT1 B;  4GVB A;  4EBE A;  1Z1Z A;  1D3W A;  4CDI A;  2CG8 A;  2DKO B;  3NCQ A;  3IAM 9;  2W2P P;  4ZLJ A;  1N52 B;  2V8D A;  3BGO P;  3IWL A;  4IG3 A;  4B3M J;  1HNX F;  5D0E A;  2FGC A;  1N6Q A;  3RG6 A;  2W2M P;  2IJN A;  1X4D A;  4ED5 A;  2HVH A;  1D0E A;  4IUF A;  4ZIV A;  2Y3Y A;  4TY9 A;  3CVK A;  3OTO J;  1PYS B;  3UFC X;  2DVI A;  1E6Y A;  2B9W A;  3BPD A;  4CLT A;  1N5Q A;  2DEJ A;  1S1T B;  1FF2 A;  2W9C A;  2MKK A;  3IR5 B;  4ANC A;  2QFJ A;  4IH7 A;  1UTA A;  2IRX A;  2XBP A;  5CYQ A;  3N4W A;  3D6T B;  5M2P A;  1U1R A;  3OSP A;  4G6V B;  3GFH A;  4JI6 F;  4K4V A;  4U8Y A;  2ZH9 A;  4NRT A;  2AEJ A;  3THP A;  2KZZ A;  4IO1 A;  2VHG A;  4DUY J;  4W98 A;  4LF9 F;  1UW9 A;  1UVJ A;  3SEO A;  3JAM U;  1E6Y B;  3X1L B;  1UVM A;  3TAQ A;  4J37 A;  1S76 D;  2C22 A;  3A3P B;  3H2U B;  2HHV A;  2W2Q P;  2V34 A;  3Q89 A;  2Q79 A;  4XPC A;  2BJ9 A;  2CQD A;  2H54 B;  4KPY A;  4I56 A;  4CT8 A;  2N7C A;  4ICL B;  2OAU A;  1RAC B;  1UEV A;  1WSR A;  3OSN A;  1ZTW A;  2DRB A;  2QEX S;  2DIT A;  1HD1 A;  2ZHB A;  2A6M A;  2CDQ A;  2CQB A;  5THW A;  2UXB F;  1OY6 A;  2KRR A;  4OYX A;  3R2C J;  3BJY A;  2F40 A;  2GVZ A;  3JQM A;  5C2G A;  1RTJ A;  4RNH A;  4A46 A;  1OPZ A;  5KOX A;  1FNM A;  2CFX A;  5CQG A;  3LGN A;  2YH1 A;  2OML A;  3DMJ B;  1EKR A;  2YKQ A;  3CSK A;  4ZVO B;  4PG5 A;  3CMA S;  1Q78 A;  4ZIT A;  5DQH A;  1JQG A;  2EFP A;  2ZD1 B;  2ZBR A;  1KKH A;  1YWX A;  2RJZ A;  3NOC A;  4UOH A;  5E3C A;  4WFN Q;  2GVZ B;  2OH2 A;  4K4X A;  1Y7P A;  4KGK A;  2HHS A;  1GEH A;  1GFW B;  1PGZ A;  2LKZ A;  1HMV A;  3L7O A;  4TLQ A;  5BYR A;  5CYJ A;  2NLW A;  4DSJ A;  4YDX A;  4QW9 A;  3QZ7 A;  4BCA A;  2N3O A;  4RW9 B;  2AV5 A;  5B7W A;  3TQ1 A;  1V6H A;  4NML A;  3W1Y C;  1P1L A;  5AE3 A;  1S4E A;  2W7P A;  1QVG R;  3DGP A;  3MEE B;  1U6B A;  2K8G A;  3HSZ A;  3NEK A;  1QE1 A;  1CJT A;  3V6D A;  1WHW A;  3ZZO A;  2MMY A;  3LAK A;  1J2V A;  2HEK A;  1JJ4 A;  2RE1 A;  4ETX A;  4GRS A;  1TL1 A;  2ZIT A;  4LJM A;  3VAI A;  1UVL A;  4X84 A;  4IRD A;  1GTH A;  3WIV A;  3KLV A;  2BV3 A;  1YG0 A;  3NS5 A;  1Y0H A;  2DNM A;  2R8G A;  1U2C A;  2X1A A;  4PEO A;  3HDS A;  5CCL A;  1CJU A;  2KT2 A;  3DLK A;  3DGP B;  3U1N A;  1QE1 B;  1CJT B;  1S1V A;  4BBY A;  2OPS A;  3OXF A;  1L3K A;  4DR1 F;  3V6D B;  1KVK A;  1IBL J;  2V94 A;  1XR7 A;  4KTQ A;  3QJP A;  5DQI A;  1T9U A;  1F2G A;  5D0R A;  5HVH A;  2VOP A;  1TL1 B;  3EDR B;  4DZD A;  3CJQ A;  2COL A;  1IKW B;  3ONQ A;  2C28 A;  4DV7 J;  4LRE A;  2QRR A;  3MAA A;  1LXN A;  5KG0 A;  3D2W A;  4ZK7 M;  4N56 A;  5LJ5 Y;  2XY7 A;  1CJU B;  1J5E F;  3DLK B;  4RBV A;  2CQC A;  4Z2X A;  2HHW A;  2AX1 A;  3L9Z A;  2OPS B;  4MTP A;  2B4P A;  3FGV A;  2YNG B;  2AQ4 A;  1H73 A;  2AMC B;  2XLK A;  4KGX B;  1LV5 A;  3MMC A;  3R8Y A;  3VVU A;  4AL7 A;  1CQN A;  2R7R A;  2F63 A;  5GMD A;  1HNV A;  3MAA B;  5F0W A;  1RHM B;  3B82 A;  4Q2L A;  4DR3 F;  2G0C A;  1WG1 A;  4C11 A;  2ASJ A;  2FLN A;  4X66 J;  2LMI A;  1RAI B;  2AKW B;  1CUL A;  4BWM A;  4OJG A;  1KN6 A;  4KHR A;  1XER A;  3FEX B;  2MQQ A;  4IKA A;  3LPY A;  1JWW A;  3MMC B;  3PX0 A;  5ETT A;  4B9U A;  2PMW A;  1YK9 A;  4C8M A;  2MKY A;  1VMB A;  5FII A;  3H20 A;  1VHI A;  2H9Z A;  2I5J A;  4A4J A;  5B0C A;  2VJU A;  3RBD A;  4E2F B;  4H54 A;  1H98 A;  4R5P A;  2AD9 A;  4LQ9 A;  4NLU A;  2HMI B;  1QY7 A;  1X9W A;  1IM6 A;  2DNP A;  3GYN A;  1N8R T;  1AYE A;  3CDW A;  2OEL A;  4EYH B;  2EK1 A;  1RTD A;  4ILL A;  2ZZT A;  3HUL A;  1KNZ A;  5EX0 A;  2IVM A;  3M9N B;  3VGS A;  5FD1 A;  2BQ3 A;  4Q2M A;  2MSS A;  2EBE A;  1RDR A;  4LVO P;  3AJD A;  3HFZ B;  2I5J B;  4JOU A;  4N7T A;  2VKR A;  4MJK A;  3CC7 S;  1Y3K A;  5AT1 B;  1YI2 S;  2QLB B;  4YR0 A;  3GJS B;  1DRZ A;  2QL5 B;  2FVC A;  3QLH A;  1OY8 A;  2P6S A;  4RWW A;  2UUB J;  4RUA A;  2QC3 A;  1JKH A;  2L3M A;  2EPI A;  4V1A k;  3MCM A;  1SJ3 P;  4H4O A;  1S7H A;  3L4B C;  1AW0 A;  1FJC A;  1EQM A;  1RTD B;  2Y8Y A;  2XO6 A;  1HPZ B;  2GV1 A;  5IV3 A;  1S1W A;  4OI2 A;  2BJ8 A;  2LQ9 A;  1HHT P;  1VBK A;  3ENV A;  3AJ1 A;  3GCX P;  4M5N A;  1VQ7 S;  4I64 A;  1YX2 A;  1M0S A;  3EZU A;  3HJF A;  3J80 Y;  3QLH B;  3IXQ A;  4UOG A;  3E51 A;  2IC3 A;  4H4O B;  2JC0 A;  5KT4 A;  3CED A;  2VB6 A;  1XNQ J;  5ETQ A;  4X4N A;  1E6V A;  3KJQ B;  4O3P A;  5DDO C;  2H5I B;  2DYA A;  2QLJ B;  3RBE A;  3I96 A;  1XMQ F;  2DRD A;  5KFA A;  5G0R A;  3VQS A;  3NWG A;  1S12 A;  1HQU B;  4FYY B;  2Z4P A;  3M30 B;  1FKO B;  3BRE A;  5B0D A;  3C8Y A;  3LF0 A;  3V81 A;  2IC3 B;  4CO4 A;  1NLK L;  2W9A A;  4K2X A;  4KH1 B;  2DRA A;  2KTQ A;  4M5L A;  4XDC A;  3SCJ E;  1C0U A;  2JL9 A;  2ZJQ Q;  1T3O A;  4AD6 A;  4J9O A;  3HM9 A;  1NPP A;  4MIW A;  4Z7Y A;  3CTR A;  5H9F J;  2DCL A;  4JI3 F;  5IT4 A;  5G0R B;  4DN9 A;  2QLW A;  2PA3 A;  1ZM2 A;  3W62 A;  1C1B A;  2CJB A;  2FVS A;  4CLF A;  3C14 A;  2HVE A;  4DOZ A;  2E5L F;  3CJK A;  1SB6 A;  2MEW A;  3H4B A;  4PWU A;  3G4S S;  2R7O A;  3D6F B;  3FSI A;  4OX9 F;  2HIQ A;  4JI6 J;  5D3G B;  1FE4 A;  2JEG A;  5I3U B;  1P6T A;  1VHF A;  3RB4 A;  1HYS A;  4LF9 J;  1RGV A;  1C0U B;  2G4B A;  4QOT A;  1NK0 A;  5F8M A;  3H5X A;  3HD2 A;  4IH6 A;  1M1K T;  5D78 A;  1NXI A;  4QU7 A;  3DU5 A;  2VIH A;  3GFX A;  2OIH A;  2KHD A;  2J0X A;  5IV4 A;  2IJR A;  3CJ2 A;  3K7R A;  2X3D A;  3RW6 A;  1VJW A;  1ZYQ A;  1C1B B;  3C14 B;  5KFX A;  2GMJ A;  3GFY A;  4DV6 F;  2OI2 A;  4O3R A;  5LL6 d;  2LVW A;  3PJX A;  3GIK A;  5GAG U;  2MB0 B;  4J9P A;  2KM8 B;  5T7L A;  4WFY A;  2UXB J;  4OI0 A;  4LSL A;  3OJS A;  1HYS B;  3AJ2 A;  1GXU A;  2I2Y A;  1FRL A;  3TW0 A;  4OHV A;  4ZHR B;  1GMW D;  3S1T A;  1XC9 A;  4DL4 A;  3HHD A;  2DGQ A;  4F04 B;  4E8U A;  4YR2 A;  4QPT A;  5HMZ A;  3DRR A;  5T7L B;  2FVQ A;  1VQ8 S;  4LSL B;  3FVY A;  3FRZ A;  5I42 B;  4CYU B;  4JI7 J;  4IQM A;  1NSQ A;  2N4D A;  1FES A;  4OQJ A;  5HVG A;  1YKW A;  3TI0 A;  2JFK A;  3V2U C;  4NXM F;  5GAH U;  1T7P A;  3Q8Y A;  1WC1 A;  4I0W A;  2DR8 A;  4ZVF A;  3FBF A;  4WTY A;  4URG A;  2XSJ B;  1HHS A;  3EGZ A;  4RL1 A;  1NDK A;  1FWK A;  2XNR A;  2HQI A;  3ITH A;  2FLO A;  1LNQ A;  1HQE A;  1L5U A;  1QM9 A;  2F4V F;  3KLF B;  1YVF A;  3DRR B;  2DHH A;  1SV5 A;  4F4W A;  1M5O C;  1U1N A;  5H9E K;  2QA4 G;  1D9A A;  2OO4 A;  2W4C A;  2CZ4 A;  2OPQ A;  4AXI A;  1X4B A;  3F0N A;  1NB7 A;  2XB2 D;  5LOQ A;  2RIL A;  1D8Y A;  2OD4 A;  4R0E A;  4X4Q A;  2DIU A;  3BBF A;  3M8Z A;  4RW4 B;  3CXC R;  1RAA B;  4C8Y A;  4YDD B;  3ITH B;  4C0O C;  2NSC A;  3OFF A;  3LP1 A;  3CCU S;  1HQE B;  1HWK A;  5RUB A;  2DPI A;  4B17 A;  3QO9 B;  2KVQ E;  3Q2S C;  1SV5 B;  4CM0 A;  1HBM A;  3SFU A;  5SUH A;  2Y8W A;  2HQC A;  1VBY A;  3EWG A;  1UW4 A;  1X4G A;  3NGD A;  2OJ3 A;  3V6K A;  3GON A;  4MIA A;  3KK1 A;  2OTJ S;  4L3K A;  4RW8 A;  1O8B A;  1AUD A;  3BYR A;  1FO1 A;  3NMA A;  3ELH A;  3L7U A;  4P7V A;  1V3S A;  4DR7 J;  2Q3P A;  3LP1 B;  4ELV A;  3RRK A;  2ZUA A;  3KYL A;  2EBG A;  3QQC D;  1B7Y B;  1DAR A;  4JBC A;  2AGQ A;  4FKY A;  2C2R A;  3K5L A;  4DEZ A;  2ZH3 A;  2GVD A;  2BAN A;  2BKP A;  3SQG A;  3KK1 B;  5D4L A;  1NAQ A;  1NJY A;  4RW8 B;  2XO7 A;  4WXW A;  3UO0 A;  2J9E A;  2XSF A;  4X62 J;  5IOL A;  2DNN A;  5KFN A;  2RVJ A;  3F73 A;  1R6Y A;  2RDD A;  2QLF B;  3I4P A;  3J81 U;  2MKC A;  3OFG A;  4WZM A;  2HG4 A;  3HSJ A;  5KFL A;  5KFB A;  3H90 A;  1M1G A;  2RHQ B;  2GO8 A;  2R7X A;  2ASL A;  2ASY A;  1UPM B;  2L9D A;  2LU1 A;  2GVD B;  2BAN B;  5J1E A;  5L1K A;  4TVA B;  2XZD B;  3SQG B;  3IG1 A;  3D67 A;  2KJW A;  1I5O B;  1WG4 A;  5E7O B;  5HK4 A;  4E98 A;  3TJ9 A;  2Y1J A;  5F8H A;  3AA9 A;  3HKZ D;  2HIY A;  2YX4 A;  1KLN A;  3LGM A;  1MWQ A;  1A7G E;  1SUQ A;  2GO9 A;  4EEY A;  2MHN A;  4FXV A;  2XEX A;  2N82 B;  3MEK A;  3CCL S;  1OO0 B;  4ZMM A;  2B8P A;  2YNI A;  2GJI A;  2VD3 A;  3RR7 A;  3IG1 B;  4YEA A;  2E1P A;  3PFE A;  2UXD F;  4DSF A;  4ZP6 A;  5HRO B;  1GXL A;  4QWD A;  3R5D A;  3KG0 A;  3QSY B;  2AEM A;  1S6P A;  1S6U A;  1ZAX A;  1Z4U A;  2QN6 B;  4S0M A;  4B9S A;  4AXJ A;  1Q7Y T;  1R8A A;  2LLZ A;  2Z56 B;  1FRM A;  1YHQ S;  1WC0 A;  1ZM9 A;  1F5B A;  3CDA A;  4JUZ A;  4YUD A;  4C6A A;  4HI1 A;  1Q0N A;  5GME A;  4UT4 A;  5GAE I;  3K58 A;  4B02 A;  1SCJ B;  3W66 A;  3DNC A;  1J5O A;  3QSI A;  1FNX H;  1RE1 B;  4FBT A;  2HFN A;  2FPH X;  3PR4 A;  2UV8 G;  1FTR A;  2PN6 A;  3BGF A;  2RQM A;  2JHE A;  4G65 A;  2WZ1 A;  4RWX A;  1XEZ A;  5LMU J;  4OZL A;  4A48 A;  5J2M A;  4JI2 J;  1SKS A;  2UUA J;  1RWX B;  1NPR A;  4K7Q A;  1RKJ A;  4QWE A;  2LQJ A;  4CT9 A;  2HYI B;  3MTJ A;  3HT3 A;  2AJ0 A;  1RBO B;  4DFM A;  3LO3 A;  4F7V A;  4DR5 J;  1K73 T;  2XC9 A;  5DET A;  4PPZ A;  1SQG A;  3ISN D;  4OHZ A;  1IBK J;  5F41 A;  1XMQ J;  4TKT A;  3SCI E;  2HHU A;  1UP1 A;  2BE2 A;  5J2M B;  1U24 A;  5DZ6 A;  4FXW A;  1S6Q A;  4DX6 A;  5DG8 A;  1OJ4 A;  5KFK A;  2JEF A;  2L41 A;  2IMW P;  1NKE A;  4MYU A;  3FNN A;  5ETO A;  1P8G A;  4RNO A;  5F8I A;  4ILR A;  3NCP A;  4HH0 A;  3RZA A;  3NWR A;  4YP3 A;  2HFO A;  4K4W A;  1TFY A;  1N54 B;  1DAX A;  2VG5 B;  4JI3 J;  2R4F A;  3O5T B;  3M9M B;  1RA7 A;  2NXJ A;  1NHV A;  1S6Q B;  2E5L J;  1N33 J;  4K5S A;  2EKY A;  4J9U E;  1Q1K A;  2IDE A;  4YY3 J;  2ZH5 A;  5AJ3 F;  2GNK A;  1R7I A;  1G4C A;  1KP6 A;  4OX9 J;  5E33 A;  1JIH A;  4LRB A;  2NPI A;  1L3V A;  1NDL A;  1GMU A;  3QIP B;  3GR0 A;  4X4P A;  3CCW A;  2HK3 A;  2JDJ A;  1IWA A;  2GQC A;  2H5J B;  2B4V A;  3D5M A;  3Q0A A;  3CWJ A;  2LXI A;  2R2R A;  1T3N A;  4F02 A;  3NLC A;  1YJ7 A;  3OXG A;  1HBU B;  1JLE A;  3JQK A;  2HVD A;  4PQA A;  4BWJ A;  3K8V A;  4IFV B;  1VOM A;  3IA0 A;  2V4Q A;  2RML A;  1AFJ A;  5A8W A;  3MR7 A;  3BM7 A;  1SQE A;  5F3Z A;  2Q6B A;  4Y65 A;  4FYV B;  1SI9 A;  5KT3 A;  1FRI A;  1SJR A;  4ZDN A;  2EXU A;  2R7Q A;  3OVB A;  2NZ4 A;  2E9T A;  4WFX A;  5HI7 A;  1FJ7 A;  4TQS A;  2A2D A;  5KG1 A;  4LRC A;  4G1I A;  2VQF J;  1XQI A;  1HIY A;  1SL0 A;  1OSD A;  4RNF A;  3W5Y A;  5BYQ A;  3OL9 A;  4RU2 A;  1U1Q A;  1FER A;  1T9X A;  3HHE A;  2ZC4 A;  5ETN A;  2YQ1 A;  4UY8 5;  3T5K A;  4IQX A;  4R25 A;  3P8B B;  4LFA F;  3LPE A;  5A8W B;  3S7R A;  2L08 A;  2WW4 A;  4LF6 J;  1W2I A;  3C15 A;  3DN9 A;  4NXM J;  2OP5 A;  4NOH A;  4UF4 A;  3QT7 A;  3CJ0 A;  1YSJ A;  4HHH A;  2GZO A;  4F50 A;  2FHK A;  4KAI A;  4MMO A;  3UI3 A;  4JI5 J;  2AIR B;  4X64 F;  3CJS A;  4LSN B;  1CJV A;  2H4Y B;  2RQ4 A;  2F4V J;  2IJF A;  4LF5 F;  2QFI A;  4IRK A;  4P7T A;  5DLF A;  4H4K A;  2B6A A;  1LQ9 A;  3C15 B;  3A13 A;  3VF0 B;  1UEU A;  3SSQ A;  4HHU A;  2H65 B;  1GQE A;  1NZ8 A;  5ETP A;  2ZFH A;  3MMJ A;  1VQS A;  5BR8 J;  1WAC A;  1TL3 B;  4PG7 A;  1T11 A;  2WVB A;  1PBA A;  3HX9 A;  3M8Q B;  1CJV B;  4L3N A;  2XMK A;  2I0X A;  4KV8 A;  5DDQ C;  2JSX A;  2RHS B;  3KLH A;  5GVQ A;  3C66 A;  2B6A B;  4C8Z A;  4ZJO A;  1FFG B;  4QIE A;  5C2C A;  4OX8 A;  4LT6 A;  3T9N A;  3Q8P B;  2AWZ A;  4CH0 S;  1UJ4 A;  4NYP A;  3I5C A;  4NAS A;  4YHH F;  1DQA A;  2VOO A;  4PKD B;  1SBR A;  2B43 A;  2HHX A;  2Y1L B;  4A8Q A;  1WOP A;  4KSE B;  1QTN B;  2FC9 A;  3ISZ A;  3DM2 B;  4FNH A;  1DTT B;  1OYD A;  3FEY B;  4OI6 A;  1JNR B;  2K06 A;  2D3O R;  2XYG B;  4KV8 B;  2F8H A;  2KB2 A;  1DQ9 A;  1CQM A;  4NLV A;  2V5H G;  3F41 A;  4DQP A;  3W5Z A;  3KLH B;  2K3I A;  4NRU A;  2XNQ A;  3PIP Q;  1RTH A;  3PW7 A;  3HSD A;  2WSF C;  3N0V A;  2MYF A;  4M5I A;  5F8G A;  3PCO B;  4AQY J;  2NQP A;  2P5V A;  3ZTO A;  1DLO A;  2XMW A;  1VBZ A;  1NH7 A;  3A4T A;  1IUJ A;  3BSO A;  3G6X A;  3HVA A;  1FX4 A;  3O44 A;  5E3R A;  2OEJ A;  3TUI C;  4UY8 T;  2G2Z A;  1OSC A;  4DPX A;  4NYZ A;  3CCS S;  3PEJ A;  3V6H A;  5DDP C;  4ES3 A;  2QZ8 A;  1XR5 A;  1S5Z A;  2HBR B;  4QR1 A;  1T95 A;  3W3S A;  3NXZ A;  1R6V A;  1RHJ B;  3PYE A;  2DGW A;  3FSX A;  2W7O A;  2RDI A;  1CJK B;  3FZ2 A;  4QYZ J;  1AFI A;  4OI4 A;  1DLO B;  2BW7 A;  1VRT A;  2CKW A;  3LOU A;  3D0G E;  1KR4 A;  3M8Y A;  2FQQ B;  3G6Y A;  4F0H A;  3K5N A;  3RJM B;  2DNR A;  1NK6 A;  4DV0 F;  3C3L A;  2ZJR Q;  2CJY B;  2J7K A;  1H7X A;  4DL2 A;  1S9G A;  3NGS A;  3N6L A;  3DLE A;  5DM7 Q;  2UXD J;  2OPP A;  1U8W A;  1JJC B;  4QIG A;  1KTV A;  2H48 B;  1B7F A;  2YKP A;  3PYF A;  2XHW A;  3CGI A;  2ZZM A;  1VRT B;  4Y34 A;  3ZTS A;  2HQF A;  1KQS R;  4FPR A;  4X4O A;  4HDH A;  1HWL A;  2Y0B B;  2HZV A;  3SFG A;  3KG1 A;  1UVK A;  3KJN B;  5HQM A;  2KI2 A;  3G82 A;  1Q81 T;  1BE4 A;  4JV5 F;  2CPJ A;  4FDF A;  3TJ8 A;  2AX0 A;  3CC4 S;  1S9G B;  1MLA A;  4H4K C;  2ALY B;  3DLE B;  5AE1 A;  3TA2 A;  3M32 A;  2JZ5 A;  2DHA A;  4HYK A;  2HWT A;  4PQU A;  3MD1 A;  1NK9 A;  4NLY A;  2RRA A;  2DY1 A;  2F8E X;  1VIX A;  1KLM A;  4HEA 9;  5EN1 A;  1X4H A;  2NZC A;  3NOG A;  3RB0 A;  1YBU A;  3MD3 A;  2EG2 A;  5KFZ A;  2WAQ D;  2FDN A;  2V2K A;  2C3Y A;  4ZPB A;  4ERD A;  4U7U D;  3UD3 P;  1Y5N B;  3IS9 A;  3PW2 A;  5DDR C;  3M32 B;  2V2V A;  2X3G A;  4PQU B;  3N5B A;  4QBU A;  3HSG A;  1TKZ B;  1X4F A;  1HNI A;  4FF2 A;  4F26 A;  2OGU A;  2KU7 A;  4NCG A;  4UST A;  4F4A A;  2XHC A;  3M2U A;  3BO3 A;  4O3N A;  1V5V A;  2ACM A;  2WOM A;  5H9F K;  1FT8 A;  2NCK L;  4EO8 A;  2B51 A;  2GQ2 A;  4OJ3 A;  1NK5 A;  2NUU G;  2G1H A;  2FJD B;  2FJB B;  4WYL A;  1B64 A;  4IDK A;  2B4U A;  2VZ9 A;  3SDE B;  2M0G B;  2YBV A;  2Y1R I;  2OFG X;  3H2L A;  4WK3 A;  1GK8 A;  4KH0 B;  3JTO A;  1CBK A;  1WC4 A;  1S9F A;  4NCG B;  2VFS A;  3EE3 A;  2EW9 A;  4CLS A;  4Y6I A;  1U8S A;  4WF9 Q;  3BR9 A;  4FF1 A;  2OLW A;  3KLG B;  1U2F A;  2B8Q A;  5HLF A;  1SH0 A;  2WOM B;  4ECS A;  3EXC X;  3MPV A;  4MK9 A;  1K8A T;  2WBR A;  5AJ3 J;  2XCA A;  2GGP B;  2LXU A;  3QGG A;  2FTR A;  3SSR A;  2DTJ A;  5JXS A;  4F2S A;  4RR5 A;  3DU6 A;  2BJE A;  5F0U A;  1HW9 A;  5DM6 Q;  4EUV A;  1YQH A;  2L9W A;  3MFI A;  4GKJ J;  4IDK B;  1RZM A;  1FVS A;  1HBO A;  2ZH6 A;  5CZV A;  1HD0 A;  4G3I A;  5DG9 A;  4OYM A;  1KSP A;  5L1J A;  3KFW X;  1YJ9 S;  2JLG A;  4Q0B A;  1RP5 A;  5HLF B;  2XMM A;  1YJW S;  1PCA A;  2XG8 A;  1BUX A;  1PJ5 A;  1RWN B;  2RSQ A;  3P96 A;  1X4A A;  1FFW B;  2YKO A;  2VFT A;  3FSY A;  4ED6 A;  3MR5 A;  1WD6 A;  2D3U A;  1TQL A;  4YOE A;  1S59 A;  1VC0 A;  1OQ3 A;  4TXS A;  3KUE A;  3NNH A;  3R5A A;  1U26 A;  5HO4 A;  2QL7 B;  2HW3 A;  1HBO B;  2PMH A;  1F2H A;  2QSW A;  3I87 A;  2QT7 A;  4GC6 A;  4TU9 A;  2EFQ A;  1EAY C;  1WTF A;  4J7C A;  2P9G A;  5GMK a;  1Q5V A;  2HZA A;  4KJI A;  1KHV A;  4Q0B B;  1FFS B;  3OTC A;  2JVR A;  1JLG A;  1C4C A;  3I5B A;  5IFM A;  4OYP A;  2JEJ A;  1FEH A;  5E3P A;  4BC9 A;  4HI2 A;  1JLB B;  3VGT A;  4DG1 A;  3R1L A;  4QW8 A;  3PVX A;  2EC0 A;  3MGJ A;  4DHV A;  4LFA J;  5T41 A;  1Q95 G;  2Z2L A;  2XWX A;  3CNQ P;  3LW5 C;  3I9Z A;  3EGW B;  3OPK A;  4HR2 A;  5A8K B;  5HL7 Q;  3MM7 A;  2F5G A;  1S4F A;  1PC5 A;  4J91 A;  1TK5 A;  2DNZ A;  2C2D A;  4PYA A;  2UUW A;  4X4S A;  2ZHO A;  4A8M P;  4DV1 F;  3KG4 A;  3K2Y A;  1CEZ A;  1JLG B;  1NJX A;  1RWM B;  4WFA Q;  2B9Y A;  4DV2 J;  3LAM A;  3K5P A;  4HT7 A;  4EK2 A;  3PKY A;  3VAK A;  4QQB A;  1FWL A;  1CC7 A;  2EI5 A;  1AUS L;  4DG1 B;  2MDA A;  2J6T A;  4ILM A;  2QYG A;  1TMJ A;  2VG6 B;  3F56 A;  2J6S A;  3MED A;  1ARO P;  3AOD A;  3CO0 P;  3JB9 k;  1MNE A;  1Q5Y A;  4G1Q A;  2YQ0 A;  4M95 A;  5J1P A;  3EVO A;  1BHN A;  3KK2 A;  1X5O A;  5HQL A;  1GX5 A;  1WOS A;  1SKU B;  3MM7 B;  4USU A;  3FZB A;  1G1X A;  4OV1 A;  4DZ6 A;  1ZM4 A;  2AU0 A;  4LUB A;  1R43 A;  1S9E B;  1TUW A;  1U4B A;  4KKO A;  4PXB A;  4ED8 A;  4DR4 J;  3CMQ A;  1VBX A;  1SC1 B;  5KG2 A;  3JYT B;  1I6J A;  3QAE A;  3TR5 A;  1R0A A;  2K7K A;  1K44 A;  3MED B;  3N01 A;  2VAS A;  4MH8 A;  2B4O A;  3JSB A;  5KG5 A;  4WJB A;  1U49 A;  3C16 A;  1S7I A;  3EPG A;  3NGK A;  1WJ9 A;  4KHP F;  4XDD A;  3KK2 B;  4PYD A;  4ID5 A;  2W8K A;  1J27 A;  2DO4 A;  1WF2 A;  3BH6 B;  1XNR F;  3RW7 A;  1IVZ A;  2ROE A;  3Q8V A;  2GIF A;  1S0V A;  3MF5 A;  1FX2 A;  2JWN A;  2DGU A;  3PKM A;  1ZZN A;  4DSK A;  3GLJ A;  4DPO A;  3MMA A;  4JP8 A;  2XMA A;  1TKX A;  1EX8 A;  3CD6 S;  1RWU A;  1WKL A;  2E1C A;  2V8H A;  3GG0 A;  1WEZ A;  1HI8 A;  1F5A A;  5J1N A;  4ID5 B;  2CVE A;  1Q79 A;  1QTM A;  4ZS6 A;  3GIL A;  4WBF A;  5JVG Q;  1S1X B;  3FCH A;  1ZPW X;  5LXR A;  3WZ0 A;  1Z2Z A;  4MYT A;  2O5D A;  1FCA A;  4Y00 A;  2QG9 B;  2XUL A;  3MMA B;  3RRH A;  2IY5 B;  2BM1 A;  3I0R A;  3D9B A;  1WHX A;  4LFC F;  4OYB A;  5KFV A;  3M7V A;  2VOD A;  3KWM A;  2WW8 A;  4P2F A;  4HH1 A;  1SQF A;  1NME B;  4P75 A;  2CPD A;  2BE9 B;  2D7S A;  1VK3 A;  1KBR A;  1QUV A;  3OR1 A;  2KT3 A;  3CD5 A;  4Y2C A;  1R8B A;  4DR2 F;  1VQ4 S;  1VS3 A;  3WX4 A;  3I82 A;  1NK4 A;  3PO5 A;  5L9X A;  1HFE L;  2M5Y A;  5MAO A;  1DHM A;  2FGO A;  3D7S B;  2DNQ A;  1RWK B;  1YJV A;  3QT5 A;  3FFI B;  1GXT A;  2CNN B;  2GJ2 A;  3DRP B;  1HL6 A;  4QCL A;  3IBW A;  3MZI A;  3M8S A;  2E5I A;  3OR1 B;  4KGZ B;  2G2Y A;  4R0J A;  4C3M A;  2V9W A;  2CDR B;  5J2P A;  1MSW D;  2FHM A;  5DS7 A;  1Q4R A;  3CDB A;  1OMS A;  2VJV A;  4JV5 J;  1RAG B;  1XR6 A;  2V8P A;  3TJA A;  1CC8 A;  2KZM A;  3HVT B;  4M1K A;  2ABY A;  5DLG A;  3M2R A;  3THT A;  4DDF A;  3MTK A;  1OY9 A;  3TVZ A;  4KE5 A;  4DQR A;  1V3Z A;  1DTQ A;  3H59 A;  4GVL A;  3BO2 A;  3FMB A;  4USM A;  5T14 A;  2MZR A;  2R7W A;  2XY6 A;  1RUS A;  2BM0 A;  1NSA A;  1WWH A;  1SJ1 A;  5FLX U;  4CLK A;  1EQ0 A;  3EM1 A;  2CJQ A;  3TAM A;  1GMW A;  2VQE F;  1RB0 A;  4QR0 A;  3VZI A;  2F3J A;  3EIC A;  1R8C A;  3CUL A;  1Q8I A;  1JB0 C;  3S01 A;  4MT1 A;  4UUX A;  2VG7 A;  2CQ2 A;  4CLW A;  1DTQ B;  4OI3 A;  3IBF B;  2HQD A;  4P6Q A;  1RTI B;  4OFZ A;  1HI0 P;  3HVW A;  3TAM B;  3L3C A;  1WDD A;  1PIL A;  4P71 A;  4I67 A;  1RT1 B;  2C3O A;  3UN2 A;  2WON A;  4ID8 A;  1HLW A;  3R7S B;  3DOL A;  5L1L A;  3DXS X;  2VG7 B;  4J9S A;  3KDO A;  4MIB A;  4IFY A;  2MKJ A;  5HJX A;  4CNZ A;  4ED3 A;  4DV5 J;  3TNV A;  1AB8 A;  1UET A;  1VRQ C;  3FQL A;  4WP8 A;  3G8Q A;  5F9L A;  3EDQ B;  3PX4 A;  2J8A A;  1LFW A;  4I4B A;  3MUR P;  1VI7 A;  2ZOG A;  1FRJ A;  4AND A;  3M8R A;  2CXE A;  1FHT A;  1RLD A;  2E1A A;  5IS2 A;  1YBA A;  4OYW A;  2M3D A;  3MCN A;  3UD5 A;  3LP0 A;  1ZPV A;  3HHN B;  1W26 A;  3IFE A;  4M5D A;  4IFY B;  3CJT A;  5LXY A;  1WUU A;  4EWT A;  2DNH A;  4PWD A;  2DR9 A;  5K20 B;  2P8I A;  1PSD A;  1Q16 B;  3W64 A;  2MZJ A;  2NXN A;  5DGA A;  3AQP A;  2R3V A;  1VQM S;  3PAC A;  4OZ5 A;  3W2W A;  4B3O A;  2D1C A;  4NXN F;  3R27 A;  3QRR A;  5A8R A;  3R5B A;  4C8K A;  3HXM A;  4V19 X;  2V6A A;  1WKJ A;  1KDN A;  1WI6 A;  3W60 A;  3KNA A;  3LP0 B;  2C2K B;  2VC0 A;  4NYO A;  3BYP A;  3GII A;  5IT9 U;  2CPI A;  1K1Q A;  3QWU A;  2XI2 A;  3ZZR A;  1NO8 A;  1K47 A;  3PY8 A;  3OXL A;  3SZ2 A;  3VGV A;  2MQN A;  3W2W B;  2E44 A;  2DNY A;  4KRW A;  1HQ2 A;  3MPD A;  3W8P A;  4B3O B;  1NHU A;  2ZNY A;  5C24 B;  5A8R B;  1Y5L B;  3AT1 B;  4OZ2 A;  2FUG 9;  3QT8 A;  3PYD A;  4MFB A;  1UPP A;  4CO0 A;  4O3O A;  2DR6 A;  2RS8 A;  3MR6 A;  4I69 A;  3AOC A;  1MU2 A;  1RIS A;  1U48 A;  3UDC A;  5D15 A;  2AW0 A;  1XIQ A;  5IT9 Y;  4DUZ F;  1VIS A;  2XQC A;  4IR9 A;  1D09 B;  4QWA A;  1F60 B;  4DLG A;  9ATC B;  1FK9 A;  4I7F A;  2GHW A;  3I0S A;  4WU2 A;  1B70 B;  2BRK A;  1RT5 A;  1NDP A;  4YS2 A;  3KK3 A;  2B9E A;  4RW6 B;  4RKU C;  2FJX A;  5E3A A;  2R7T A;  4CTA A;  1TL7 A;  3DLG A;  3P5T L;  4DXL A;  1X0P A;  1KHW A;  4I6W A;  1LXJ A;  1YLX A;  2GX8 A;  3ZZ0 A;  3AOB A;  6FDR A;  4QZV B;  5KG7 A;  2ILZ A;  4I2P B;  1RKI A;  2UXC J;  2J7U A;  2ADC A;  1U0H A;  4KGM A;  2P2C B;  1TKD A;  1H6K X;  3I0S B;  3PW0 A;  2FVP A;  3BQ0 A;  2MQ8 A;  4QR2 A;  1K0T A;  4CTA B;  1TL7 B;  3HHL A;  3B6B A;  2BA9 A;  4KHP J;  1EAR A;  1UJ6 A;  4USI A;  2D3O 1;  2NUH A;  3P49 B;  1C1C A;  2UZA A;  1S1T A;  1U0H B;  2AHO B;  3GB0 A;  1IBM F;  2IRY A;  3CDU A;  2YWE A;  3TAR A;  3X3U A;  1SC6 A;  3BEG B;  4RBT A;  3M6X A;  1XBW A;  3O2I A;  3RB3 A;  4DPY A;  4NEZ A;  3QJL A;  2E5J A;  3UCG A;  3ENA A;  1SJF A;  3HHL B;  4EO6 A;  2E7W A;  3R6L B;  1EZZ B;  3ZNJ 1;  3SCL E;  1G6B A;  3ZC4 A;  1QUP A;  1B0P A;  4WCE Q;  4BHQ A;  1C1C B;  5J2Q A;  3UDE A;  2EFO A;  1C4A A;  3EGV A;  3PR5 B;  1HI1 A;  1IR0 A;  4ICL A;  4NZ6 A;  2EC2 A;  1NZA A;  3J81 j;  3TO8 A;  4ECR A;  4ZLL A;  4KO0 A;  4LIW A;  4P72 A;  4OL8 A;  4LSZ B;  2PEH A;  4U67 Q;  4PZV A;  2O67 A;  5IQQ A;  3GJR B;  4LFC J;  2RRB A;  2I6W A;  1U09 A;  2QJ3 A;  2J6U A;  1SKR A;  1FTC A;  1RWV B;  4NZ7 A;  4WE1 A;  4IRC A;  3G9C A;  4WP3 A;  5J2Q B;  1Y9O A;  4GO7 X;  3DMJ A;  2CRL A;  2F8M A;  4B9M A;  2CNK B;  1R89 A;  4WFB Q;  3IGV A;  4JI8 F;  4NEY A;  4KO0 B;  1UFW A;  3NGT A;  2I38 A;  3EX7 B;  2KG0 A;  2ZD1 A;  2FB0 A;  1X9M A;  4ZVS B;  4CM2 A;  4JI0 J;  2OEM A;  3D68 A;  1TKT B;  1JJH A;  4HDG A;  1H38 A;  4ETZ A;  2WSC C;  4DCJ B;  2BQR A;  1DQ8 A;  1JLC A;  4WE1 B;  1VDH A;  2NPF A;  3JAM Y;  5LMN J;  4WPA A;  2YNF A;  3OJU A;  4ED7 A;  1R3N A;  2AGP A;  4EGL A;  3FMW A;  3K57 A;  5HP1 B;  2FC8 A;  3ULH A;  5HSP A;  5L9N A;  4RO0 A;  2YPZ A;  4GKK F;  3Q23 A;  4A8F A;  4RW9 A;  4BC7 A;  5HVF A;  3E2E A;  2CIM A;  1WC3 A;  4LF1 A;  2ZM6 F;  1HBN A;  4H4M A;  1S10 A;  4C0H A;  2MKH A;  2WVF A;  4N76 A;  2M4M A;  3MM9 B;  5K8N A;  4UW2 A;  2GW8 A;  2ZVI A;  4N41 A;  5D0H A;  3OVS A;  3MEE A;  1I51 B;  2CPH A;  1HWU A;  1JLC B;  1IM4 A;  4YQW A;  2YX1 A;  2ATC B;  2YNF B;  4N77 A;  3H42 A;  2BXJ A;  1QAJ A;  5KFT A;  4Z37 A;  4ED1 A;  2VQE J;  2W4D A;  3MCS A;  1XMB A;  2HS4 A;  4ZPA A;  5KFQ A;  1HBN B;  4H4M B;  3SQO P;  2HFS A;  1S57 A;  5EX3 A;  5B0B A;  1SIZ A;  1A6L A;  2JX2 A;  1ZH5 A;  4ZIW A;  4P2S A;  1BGX T;  2XGP A;  2VPZ B;  2BAB A;  1WC5 A;  2BEF A;  3R9L A;  4RJV A;  5HAN A;  1UAW A;  1REG X;  3RAQ A;  1ZTT A;  3L09 A;  2ZUG A;  2BKO A;  1IKW A;  4LRF A;  5FDL A;  2DNO A;  5E41 A;  2LYV A;  4Y2M A;  3EVM A;  3AA8 A;  2W01 A;  3LA0 A;  3T1Y F;  2D41 A;  4RU9 A;  2DK2 A;  4E0D A;  2O66 A;  2FHJ A;  3RRG A;  2OD6 A;  5DRK A;  3BSA A;  1GX6 A;  3ISN C;  2YNG A;  2VBY A;  3GIJ A;  1JX4 A;  1FKA F;  5KFE A;  3VAG A;  3MCO A;  4DFP A;  2M9K A;  4F4Z A;  5JUM A;  5FDL B;  4RUH A;  5A2Q U;  2GIR A;  5LSL A;  2HHH F;  5CAA A;  3I4H X;  5L8R C;  5KTQ A;  2BOP A;  2HGL A;  2Z2Z A;  1R27 B;  4DV4 J;  2IVY A;  4HLB A;  3PW4 A;  4USW A;  1NM2 A;  5D4O A;  4U95 A;  3ZTQ A;  1AT1 B;  2AYM A;  4QIV A;  1U1O A;  4EZ6 A;  3WHI A;  2PD1 A;  4FP9 A;  5GAD I;  5EWG A;  5BXI A;  2BAC A;  3DGV A;  1VQP S;  2CQH A;  3H25 A;  4NXN J;  1IJF B;  3UE2 A;  1RT2 B;  1TR0 A;  1X5P A;  1KQK A;  1RT6 A;  5IZH A;  1MN9 A;  3OL8 A;  1QJH A;  3H5Y A;  3V6J A;  1N36 F;  4LF4 F;  1U1K A;  4EI2 A;  2HMI A;  3CDE A;  4QIF A;  1N4L A;  3J7A N;  4B3T F;  3I9V 9;  2GAG C;  1H3D A;  4X65 F;  5CA5 A;  5KT5 A;  4ZOS A;  4WIQ A;  3QJJ A;  4KHM A;  2V0N A;  5LJ3 Y;  2LQ8 A;  4YB6 A;  5AXN A;  4LF7 F;  2KKH A;  1PO6 A;  3AXM A;  4FBU A;  1R8H A;  1RT6 B;  3CCM S;  1HNW J;  3DRY A;  3D0I E;  4G1P A;  4USH A;  3OLB A;  4K2J A;  4N5S A;  4B3R F;  1NH8 A;  4J9M A;  4K50 A;  1QVF R;  4ZPD A;  1NSK L;  3AD8 C;  2YWH A;  4P2X A;  4FYD A;  3EJM A;  1UZD A;  4QWC A;  4IR1 A;  3GV8 B;  4A8O A;  1KEK A;  3O6Q A;  1U25 A;  4NZ0 A;  2U2F A;  2CQ3 A;  3HD1 A;  2BDP A;  2ZKT A;  2QMX A;  3FCW A;  3TP2 A;  1HPZ A;  1RAJ A;  2NXU A;  4Q5V A;  5HN0 A;  1N0U A;  4NL5 A;  4Q8F A;  1C0T A;  3JSY A;  2ZOF A;  2RH3 A;  3OTO F;  4YB5 A;  3H5U A;  3SI8 A;  3M1V B;  4XK8 C;  2VU5 A;  2MST A;  4PRF A;  1ZAV A;  3UDV A;  1NJI T;  4I6Y A;  5B0A A;  2K7J A;  4F3Q A;  1F3F A;  2IFX A;  4U6P A;  3HT0 A;  1RAD B;  2A10 A;  3NBP B;  5IWA J;  1IQT A;  4M63 A;  3HO1 A;  5SZT A;  1M5S A;  1WNE A;  1MG7 A;  3EPI A;  4WP9 A;  5JMN A;  1C0T B;  2R8J A;  4QYR A;  1HQU A;  1PG5 B;  1VK8 A;  3DRX A;  4DUY F;  3M30 A;  4MK7 A;  4ZN3 A;  2ASD A;  1FKO A;  3MHY A;  4K4Y A;  2FZC B;  3VAL A;  2UUC F;  3MMB A;  4WTO B;  3TZZ A;  4Q7A A;  3TA0 A;  3J7Z T;  2IPO B;  3L95 X;  4USK A;  3EXY A;  2GJF A;  2IMO A;  1PYT A;  1DBD A;  3RBX A;  5KG4 A;  4O23 A;  3R2D J;  1IBM J;  2GQQ A;  2M8D B;  3A12 A;  3RR8 A;  1RWO B;  4RZR A;  5CHC B;  3OL7 A;  2N7Y A;  2PDA A;  4NPO A;  1HNX J;  3AFG A;  4IYQ A;  5JJB A;  4K8R A;  1GT8 A;  3M9O B;  3WDO A;  1L3T A;  3W61 A;  3MPW A;  5D3G A;  1C2P A;  2VPX B;  5I3U A;  1NND A;  2E7X A;  3OD2 A;  3MMB B;  4KIA A;  4JYA F;  3HF5 A;  2QLX A;  1RAE B;  3PW5 A;  3L7P A;  4WXO A;  1N5S A;  2VDH A;  4NLT A;  4W90 B;  3RGI A;  3LQV A;  3PHT A;  5IC6 B;  3W9I A;  1PKU A;  2YKA A;  4K59 A;  3PJW A;  1H74 A;  2RUS A;  4WK1 A;  1H7W A;  3U1L A;  3OT9 A;  2EFG A;  2P6T A;  3KLE A;  1T03 A;  1S97 A;  4UOC A;  1GAO A;  1RT3 A;  2QSF A;  4LQ3 A;  2E5G A;  3CUN A;  2W4P A;  2WVE A;  1VQK S;  2CJK A;  2YXL A;  3QT6 A;  1PAU B;  3BPS P;  3TOQ A;  1OYE A;  2AJ2 A;  1FDD A;  3VQT A;  4HAC B;  5B09 A;  3G87 A;  4ZHR A;  3M4X A;  5I3Q A;  3QBC A;  4DPW A;  3POT B;  1TAU A;  4NCB A;  3B4M A;  3I56 S;  3CC2 S;  4L76 A;  2KYX A;  3K59 A;  2HLU A;  4KB7 A;  1O5J A;  1VQL S;  3KLE B;  5F8J A;  1T03 B;  2Z58 B;  1RT3 B;  3PZP A;  1RHR B;  5I42 A;  1WOR A;  4CYU A;  5A0Y A;  2QMU B;  4O0N A;  3PHE A;  1UMJ A;  5GAE U;  3PIO Q;  2LFV A;  2XSJ A;  1NHK L;  2EEY A;  4O44 B;  3CJR A;  5HMX A;  2YVS A;  3IN5 A;  4F67 A;  4ZCI A;  4DQQ A;  4DUT A;  3WIU A;  2ZH8 A;  3KLF A;  3KLI A;  2DHX A;  1TV6 A;  3BH7 B;  3PRD A;  2CQ4 A;  1IBL F;  4F0M A;  1G3O A;  3QWP A;  4P74 A;  3BBB A;  5KFS A;  1NU4 A;  5A0Y B;  2E66 A;  1X0F A;  3MM5 B;  4JV2 A;  1Q86 T;  3D1H A;  4C4W A;  2GHP A;  4F8R A;  5IC4 B;  2UVV A;  4GC7 A;  2CJA A;  3D3B J;  3NP5 A;  8ATC B;  1MRO A;  1R0C B;  2J76 E;  1KVI A;  2C3M A;  3ILI A;  4Y0F A;  3T41 A;  4RW4 A;  2HAI A;  3M6V A;  4UQT A;  1O0P A;  1R8P A;  1BQM B;  2XMU A;  2C2O B;  3PRV A;  1Y3J A;  3QO9 A;  4NCA A;  3KLI B;  1RYS A;  1TV6 B;  1KTQ A;  4F2R A;  2Z57 B;  3DLB A;  3PFO A;  2EVZ A;  2VON A;  4QWB A;  2QX0 A;  3Q8U A;  3JTN A;  1T05 A;  2RQK A;  3LGH A;  1MRO B;  2C1E B;  2HBQ B;  3IRX B;  5CCM A;  2XWY A;  1LEO A;  2BW2 A;  2LEB A;  3C6U B;  2OUG A;  4X66 F;  2WBM A;  3Q24 A;  4ECY A;  4C9D A;  3W7B A;  3N5F A;  3DHX A;  1SH3 A;  3A8J A;  2HPU A;  1RCX B;  3KDN A;  3J7A 1;  2E5H A;  4I6A A;  2HHT A;  4Y2K A;  3AH6 A;  3MEG B;  4C3K A;  3B78 A;  1T05 B;  3TQE A;  1QAY A;  5EUH A;  4DR1 J;  1Q8B A;  4KT0 C;  4DF4 A; 
#chains in the Genus database with same CATH homology
 1PYO B;  3R7S B;  1RHJ B;  3IBC B;  3KJQ B;  2XYH B;  2H5I B;  2C2M B;  2QLJ B;  1NME B;  2C2Z B;  1RWM B;  2H5J B;  2C2O B;  2CNK B;  1RWN B;  1RWW B;  2XZD B;  3D6M B;  4ZVR B;  2C2K B;  3GJQ B;  3R7B B;  1RHU B;  3SIP B;  2HBZ B;  2Y1L B;  1RHM B;  1QTN B;  3D6H B;  3GJT B;  1RHR B;  2QLB B;  1RHK B;  2DKO B;  3GJS B;  3EDQ B;  2FQQ B;  2H54 B;  1F9E B;  2H4Y B;  4ZVS B;  2QL5 B;  3R6L B;  3RJM B;  4DCP B;  1RWP B;  2CNL B;  1GFW B;  2QL7 B;  2QL9 B;  4ZVT B;  2XYG B;  4ZVU B;  4DCJ B;  1RWK B;  1RE1 B;  4ZVP B;  1QDU B;  2CNN B;  5IC6 B;  2CNO B;  1SC4 B;  2XZT B;  3EDR B;  2CJY B;  2C1E B;  2P2C B;  2HBQ B;  1BMQ B;  2H51 B;  1ICE B;  3KJF B;  1RWX B;  4JB8 B;  2H65 B;  4DCO B;  3IBF B;  1SC3 B;  3R6G B;  1SC1 B;  2XYP B;  3R5J B;  2H48 B;  5K20 B;  2CDR B;  4LSZ B;  1IBC B;  4ZVQ B;  1RHQ B;  3GJR B;  2H4W B;  3NS7 B;  1PAU B;  3QNW B;  3D6F B;  2HBY B;  2QLF B;  2Y0B B;  3P4U B;  5IC4 B;  4ZVO B;  1RWO B;  1RWV B;  3KJN B;  1I51 B;  3P45 B;  1I3O B;  2CJX B;  2HBR B;  3R7N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...