2XYGB

Caspase-3:cas329306
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2xygB00
2C2MB 2C2KB 2H4YB 2QLJB 1RHKB 1RWVB 3R7NB 2QLBB 4ZVTB 2H51B 1RWXB 3D6MB 1BMQB 3IBCB 3R5JB 3KJQB 2XZDB 3D6HB 4ZVRB 2CJXB 1RHRB 2CNLB 2C2OB 1IBCB 4ZVPB 2HBYB 2XYPB 2CJYB 2QL7B 4ZVUB 1GFWB 5IC6B 3R7SB 1RWPB 3EDRB 1ICEB 2XYHB 3NS7B 1I3OB 1RWMB 1PAUB 4DCPB 4DCJB 2CNNB 2CNKB 1RHQB 1RE1B 3QNWB 2H65B 3P4UB 1F9EB 4DCOB 2P2CB 2Y1LB 3P45B 1RWNB 2H5IB 1I51B 1RWKB 1RWWB 1SC4B 2FQQB 2HBQB 2H5JB 2H4WB 3GJQB 2C1EB 2CDRB 2QL9B 2C2ZB 1QTNB 2XYGB 1QDUB 2H48B 2HBRB 1RHUB 4ZVOB 2HBZB 3GJSB 3R6GB 3EDQB 3RJMB 3IBFB 3GJTB 2QLFB 2DKOB 1NMEB 1RWOB 4JB8B 5IC4B 3GJRB 3R7BB 3KJFB 2QL5B 3KJNB 3SIPB 4ZVQB 1RHMB 4LSZB 2XZTB 1PYOB 3R6LB 2Y0BB 3D6FB 2CNOB 5K20B 1SC1B 4ZVSB 2H54B 1SC3B 1RHJB
chains in the Genus database with same CATH superfamily
2U1AA 1TKZB 3OR2A 3R27A 2F3JA 4I2QB 2BJDA 4ZMMA 3HT0A 3W5XA 1U8SA 2OFHX 4DV7F 2NZ4A 4JV2A 4MFBB 2M9KA 5CCLA 1VLYA 3O1LA 2DEJA 3IN5A 3OW2R 1QUVA 1MWZA 2QIFA 3SQOP 1H73A 4Q8EA 2MSTA 4WZQA 1DRZA 4G3IA 3LP0B 1T9YA 1UWBA 3T9ZA 2AT1B 1FWKA 4HLBA 1H7XA 4XTTA 2HMIA 4QW8A 1PJ7A 2O3DA 4Q7AA 2GZOA 4KC5A 3MD1A 4FS2A 2R2SA 3NGDA 2K3KA 4R8UA 1U2CA 1UP1A 5KFCA 3KKFA 1K44A 2X1GA 4HYKA 4JI6F 3CCTA 1JJCB 1X4BA 3EVMA 4ZJOA 2YQ0A 1VRTA 2G2ZA 5EN1A 3HD1A 3K8VA 1U1MA 3R9LA 2VA2A 1N0UA 3PW2A 4LRDA 4DQPA 3FBFA 4KGKA 5K8PA 2XMKA 2VIHA 2MKIA 4LFAF 3MM5B 4LQ9A 5EUHA 3I9V9 4USKA 4IRCA 4CLSA 2ZH3A 1RKIA 1U2RA 3QJPA 4NA2A 2VQEJ 2VC0A 1GMWD 1WEYA 2XI2A 3FFIA 3TQEA 2NPIA 5KFQA 3MM8A 3HKZD 1IBLF 2H65B 3QT5A 1RSCA 1NSKL 1CEZA 1KVKA 3DLLQ 2XTJP 3DI6A 3QO9B 4BLGA 4ILLA 4OV6A 5LMNF 4R25A 1YRXA 1RCXB 2N4CA 4U67Q 2VDIA 5KFYA 1RAGB 5KT7A 4GKJJ 1D3WA 1DTTB 5F3TA 3RRHA 3DLKB 2RU3A 2C2EA 5G0RB 2W2NP 2NZCA 2MMYA 2YKNA 3C6TB 2BE7D 5EWGA 4DSLA 3QRQA 1NKCA 3JQKA 1LW0B 3VHQA 1S9FA 5KFPA 2HS4A 2G2OA 1ACMB 4KKOA 3V6DB 1LXNA 5A6PA 4USUA 3OTCA 4RU2A 2I6WA 3BO4A 3OL7A 4O0IA 2XS5A 4HACA 3QFHA 3C46A 2RSQA 2WONA 2B6AA 4C8NA 1Q16B 2WVFA 2VFRA 2GA7A 2HVDA 5CYJA 2ZD1A 3ADAC 5E2QA 4NLXA 4DPOA 4FF4A 3HCXA 3KHRA 5D4LA 4YP3A 2HS3A 2X3GA 1TL4A 1FJGJ 3T5HA 1I94J 2J0XA 1VRQC 2FHMA 1FRHA 2DNHA 4ELTA 2K8GA 4JB8B 1DLOA 3QAUA 4JI3J 3FK4A 3JB9k 4DG1B 2G0IA 1HQUA 2Z30B 1H0HB 3I0SA 2Y0BB 4ES1A 2VONA 1DFDA 2KXNB 1X4AA 3KXDA 1REVB 4J9MA 3DKDA 4CT9A 4K4VA 3P49B 4USVA 3R5JB 4FBTA 4JI0F 2N4DA 3A8JA 1NK8A 4DR6J 2F8EX 3MM6A 3ZZPA 3CCRS 4QU7A 3OFEA 1D8YA 2CADA 4DX6A 4C8MA 1P9YA 2ZH1A 4GKJF 3CJ2A 4YDDB 1FX2A 3OLAA 4V19J 1G7CB 2FB0A 4DSJA 1HNVA 4DR3J 2VOPA 1MROA 3UCZP 4TXSA 1T11A 4QYZK 2XMVA 4K7QA 2EG1A 2WW4A 3U02A 1MG7A 5F8MA 2R7TA 3OBIA 3RB6A 3C15B 4ED2A 3P8BB 2B51A 1RTHB 3MAAB 4F04B 3UN2A 4N5SA 3A4TA 4JI7F 4NLYA 1JLFA 4KH1B 4XDCA 1X9SA 4QBUA 1HW8A 1EZZB 2FC8A 2HLTA 1Q79A 5A8KA 3NMRA 2HGMA 3OHBA 2XY7A 4NWBA 3IBCB 5AJ3F 4NCBA 2IDEA 2D41A 3Q8UA 1UZDA 4OX7A 2QEXS 4X62F 3DDNA 4NYOA 4Y28C 5GADI 4KFBB 1XEZA 2CQ0A 2VUGA 2Q1LA 4IFYB 1VQ8S 4L72B 5JMNA 3OUYA 2ZZNA 3K57A 4JI3F 5B0CA 3CD5A 3ET6A 4L75A 1LQ9A 5DM7Q 4A8FA 1KS2A 4LF8J 1H6KX 2GHVC 4C3MA 2XSJB 3MFIA 4DN9A 5E3AA 1NMEB 4RBTA 3UI3A 4CDIA 3GSIA 4TKTA 4P2FA 5L1KA 5EX3A 1ZM9A 2HAFA 1APSA 4I68A 1X4FA 7FD1A 3HHLD 1VIXA 2IC3A 2HPUA 2NSBA 4BC7A 1JLQA 2R7RA 3ZZYA 4DR7F 2J8SA 1JLBA 4X4RA 2IIHA 2XMUA 4CLUA 2VKRA 1VS3A 4C11B 9RUBA 2DR8A 4ED1A 2BW7A 4LRBA 1P27B 1HNWJ 3UD5A 3WC2A 3VVTA 3BJYA 3HFZB 1PCAA 1S48A 4NEZA 2J7UA 4RW8A 3DRYA 1RHQB 3I9ZA 3AT1B 5HSPA 2MY7A 2OEJA 5RUBA 5L9XA 1UEUA 2IRUA 1Q95G 4RW9A 3RZAA 4HDHA 2XY6A 1KFSA 1FI4A 2XQCA 4IG3A 5E3QA 1CULB 4JYAJ 1XR7A 1JQGA 1SKWA 3R5GA 4G65A 1S10A 4OMFG 5ITHA 1VOMA 3F73A 3OFGA 1IWAA 4ECZA 1QJHA 3VAHA 3ITHA 4YR2A 3DLJA 4A8QA 1S1UA 2JDJA 3D68A 3C6UA 3M6XA 5KFDA 3CDEA 1L3KA 1F2GA 2MZQA 2ASLA 5F8GA 1UFKA 2V5HG 3LTOA 3ZZRA 1GXUA 2Q43A 2YKPA 1R8PA 3TARA 4NYZA 4DPUA 2Z4PA 2QZ8A 3KHHA 3NS6A 3ZNJ1 1TK0A 3DOLA 2MLXA 2RRNA 1F0XA 4ZP7A 3CCES 2CDQA 1D9AA 1IBCB 4TQRA 2D7SA 4ICLB 5A76A 2HBYB 4FXDA 1X7VA 1ZZNA 1TUWA 2YNHA 4FPRA 4TY8A 3IC1A 3M8RA 3MCSA 1SKUB 4DCPB 4L74A 5L38A 1NJIT 3FSYA 3P4UB 5ETNA 3CO0P 5DZ6A 4OX6A 1SL0A 4ED0A 2KDOA 2Q6BA 2FHJD 2KJWA 2IM0A 3WIUA 1U6BA 1S57A 3K0JA 2KH9A 3BGFA 2GJFA 4WE1A 2DNYA 4ZLPA 3PYGA 2E9RX 2HURA 5J2MB 2XB2D 1S0VA 4OIXA 3R3TA 4DPXA 3G8TA 4UOCA 3DXSX 1IXKA 2Q66A 1GAOA 3EM1A 1EETB 3PHEA 1BWVA 2ROGA 4LF6F 5LXRA 3M2RA 2DO4A 2FJXA 4KGXB 1C4AA 2QMUB 3TZXA 4B3RJ 2VL1A 3TP2A 2DPIA 2OSRA 1N5TA 2IJRA 2ZBCA 3AOCA 3HULA 3H2LA 4GVBA 4JYAF 1B0PA 2WSCC 1PKUA 3CDAA 2HWTA 3ETMA 2DH7A 1Q7LB 1JLAA 2XC9A 1RE1B 4TLQA 1E6YB 1KQFB 4OFZA 1TFWA 1N8RT 4RNFA 4P10A 2BQRA 4M5DA 4QWDA 2NXUA 3GG0A 3MEGB 4Q0BB 3UN3A 2G13A 4YY3J 3ILIA 2VBWA 2C2ZB 5J2QB 3T9NA 3F41A 4LF9F 1AROP 2NREA 4YB7A 4ZPDA 4F0MA 3AD9C 4JI8F 2KYXA 5C25B 2ZM6F 5E0OA 3A8EA 4DPTA 2HW3A 1LWEB 3NGUA 2FGOA 3HVRA 3T5LA 2WBMA 2Q3PA 4ECQA 3EZUA 2PE8A 4K5SA 2JFDA 5CYQA 4LBHA 3OLBA 2F4FA 2EKNA 1S6PA 5IQ6A 4U95A 5KFNA 1TP7A 4ZKAA 4CO5A 3QRPA 2PN6A 1TMMA 4ALZA 4F4KA 4WIIA 2E5IA 1Q1KA 5DGBA 1WI8A 3KUEA 1F3FA 3GQCA 1RT4A 1SC4B 3PEHA 3I82A 1YJNS 4NLTA 1Y4ZB 2R7XA 1FXDA 1FE0A 4W4MA 2HBZB 4AYBD 4DL2A 5F0UA 2AX1A 5HJYA 2C28A 2AF6A 2EFQA 2LXFA 2HZVA 1Y3KA 3IRWP 1VLOA 3MEDA 2VFVA 2R2UA 3TYTA 3LGNA 1X0FA 3IBWA 5L1IA 2RRBA 4CZCA 3CIZA 5E5NA 1X31C 2VZ9A 2I5JB 1JXVA 2MZ1A 5I3UA 4C8KA 2E5JA 1XQIA 3HHLA 2BMBA 2IDLA 2BJ7A 3BN4A 5LMUJ 4GVLA 4OI1A 1S99A 3OFFA 3GFYA 3AJDA 2G1DA 2DGTA 3WBZA 4B9VA 1HW9A 1PYTA 3UCGA 4DR2J 4IO1A 1AZSB 2YX1A 2GFFA 1C1CB 3DHWC 5DG9A 2I38A 3W8GA 1VQ4S 5HO4A 4F4YA 2V8GA 2HHUA 1JLCB 1RABB 1A7GE 1EP4B 1S9GA 2ZFHA 1X0PA 5BR8J 3W2VA 4X65J 3OR1B 1RI7A 1WTFA 2PMWA 4WFXA 1U8WA 2H9ZA 4OZ3A 3T1AA 3AB4B 3POTA 1RYSA 1S1XA 2R8JA 5KFZA 1FFWB 2YWHA 3HVAA 1UW9A 3PEJA 4C0OC 2JRSA 3K5MA 1N52B 4B3TF 2PMHA 4LIRA 5AE1A 2MKJA 3I4HX 2DHSA 2ZC4A 1NHVA 2EC2A 1XR5A 4MIBA 1EKRA 5L46A 4OI4A 4O4RA 5DQGA 4R5PA 1M5SA 1C2PA 3N6MA 1GMVA 4DL3A 3DCAA 4NX9A 4CO3A 2BJEA 5HN0A 4QPXA 4NLQA 1C0UA 4K4SA 3CDWA 3QGIA 4DR4J 2LQBA 3G71S 2ILZA 4Z2XA 4ZPTR 2K3IA 2GGPA 4WU3A 3BSNA 2DGXA 1IBMJ 2KT3A 3JSMB 4JV1A 1RWWB 2ZE2A 3KLHB 3IM9A 3TA0A 4MAKA 4OJ3A 2JLEA 5JJBA 5C7PA 3CCQS 3ZTPA 4H4OA 4CLLA 3ETOA 3HXMA 4CRJA 2FLNA 4IH5A 3W64A 2ASDA 5MLCV 1KWMA 2R8GA 1IJFB 1R8CA 5ETSA 5KFXA 1QAIA 1T9XA 1C1BA 1BC6A 5F9NA 4K2XA 2FZCB 2P6TA 1NRKA 2DY1A 2HHHJ 5SUHA 4KJIA 3QBCA 3PY8A 2OH2A 3P6YC 4DV4F 2ZBPA 3J7ZT 2CZVC 3A1YG 2CJKA 4I0WA 2UV8A 3D6HB 3AFGA 1NUEA 3QLHB 3HO1A 2X1FA 3QWPA 2LLZA 2OEMA 2OD6A 5FIIA 1IQTA 3JXOA 3OXLA 3H7HB 1PC5A 3L95X 2DHHA 3AOBA 4J9NA 5LSRA 4LF1A 2EI5A 1V9OA 2BABA 1N34J 1R7IA 1BE4A 2ATCB 2H48B 5DQHA 1VQNS 3TOQA 5B0DA 2Z57B 5IC4B 4Y2MA 1HPZB 4B9TA 4EZ9A 1NM2A 2W1BA 3IO1A 1FESA 1O8BA 2DD8S 1WI6A 4GO7X 1S1WA 1FERA 4U96A 5D0HA 1Q4RA 5GAEI 3UQSA 3NOCA 1QSSA 1UETA 3TJ8A 2J0WA 3B82A 4NPOA 2H1YA 1UAWA 4Z7YA 2F8MA 3RW6A 3D0IE 2C2OB 4HH1A 1N32J 4MK8A 3UDEA 4HH0A 4TNOA 4B3MJ 3EDRB 2R4FA 3PRVA 3H2VE 2BBEA 1NK9A 2C2RA 5FLXY 1L5UA 2AHOB 4DV5F 2N82B 4LF7J 4OYMA 2XNRA 2DY9A 6FDRA 4N77A 3SQGB 3ZFVA 1DTQA 1IKVA 1HL6A 5THWA 3CJSA 4RW7A 2VG5A 3N0VA 2W7PA 3IRXA 1RT2A 3KHGA 1OSCA 3FVYA 5KT5A 2HHHF 2DGSA 2HNZA 1HNIA 3VVUA 1LV5A 4YN3B 2QTWA 4H4MA 3KJFB 2U2FA 4LRCA 4O4GB 3SIPB 3WDOA 1XMOF 4QIGA 2BUNA 2K2PA 1KQGB 2EFVA 3VZIA 4NLWA 2YWWA 4UW2A 4UOHA 1NHUA 3I5CA 2N3LA 2EFGA 4ZLNA 4YR3A 3G82B 3K5PA 1RT1A 3VCDA 2RDJA 3AB2B 1HWJA 4IUFA 3UWTA 2CNLB 1U1QA 1UWBB 3NNCA 2AV5A 5KFSA 2GCFA 2YNIA 2AWZA 3VGUA 4DBQA 4MYUA 3MECA 3HSZA 2C3OA 2V9KA 4DUYJ 3SFGA 3TJAA 4R8UB 1YRUA 5KFEA 1M1GA 1R6YA 3MR5A 2E44A 2MQQA 5T7LA 1VRTB 3DMJA 4ZDNA 4YHHJ 1Q8LA 1ELOA 4NLRA 3TR5A 2LQ5A 1NDCA 1FKPB 1FVSA 2MY8A 1R0BG 1N33J 1FVQA 1N32F 4ED4A 2XLKA 1RDRA 2HWIA 2RKIA 4B3MF 3HLUA 1QY7A 4CNZA 1TL7A 2MKCA 2OIHA 2C42A 4MKYA 2B9WA 3MM8B 1FFSB 4X4VA 2WCXA 3C16A 4F25A 5HANA 5JXSA 2V2KA 5CCMA 3AXKA 3DLEB 3S6EA 3DI6B 1MW7A 4JV5J 3KLFA 3CE8A 5E3RA 1NH8A 4ER8A 2OO4A 1A9NB 1UA0A 2RQCA 4ZVGA 1T02A 2CFXA 1KRPA 4XIUA 1OJ4A 4ECWA 4M94A 3DNCA 2DGQA 1NSQA 3QIPA 4NL5A 2GO9A 3A3NB 3C66A 4I2PB 5HMYA 2BKPA 1N6QA 5LJ3Y 3B4MA 2YKNB 3GJTB 4PQUA 2KZMA 1RT5B 2WB4A 3E2EA 1NJZA 1DY3A 1OS5A 2A3JA 4HHHA 3OTDA 5KFJA 4OX8A 3KLGA 1SC1B 3M1VB 2ZHAA 1W25A 1RT7B 3D9BA 1MWYA 4EEYA 4ECTA 3Q24A 4NI2B 5F8IA 3KLEB 2P8IA 2ZD1B 4HDGA 4DV0J 2YVSA 2G1HA 4LRFA 1X4DA 3G8QA 2ZBQA 4M95A 5FLXU 4O3NA 2VPZB 5IC6B 1QE1B 1SXLA 1CJTA 4YHHF 1ITPA 3MTJA 1RAFB 1WHVA 5B0AA 1RWMB 1L3SA 1RBAA 3MUVP 1BD6A 3UDLA 4JI1F 5HQMA 3U27A 4ZP9A 5D77A 5D4OA 5LM7E 2DB1A 4UY8T 1N33F 2Y8WA 3TAQA 1WF2A 4IO9Q 2JX2A 1HQUB 3OJSA 3TI0A 3IBFB 1OYEA 3M8YA 5AT1B 1FK9A 2B43A 4O23A 3A13A 3T1HJ 5L39A 1WEXA 2N3OA 1AXQA 1MMNA 4DV3J 4CWBA 3W1YC 2W4PA 1FDAA 1IM6A 1M1KT 1LXJA 2AEMA 3RBEA 3OVAA 3MM6B 2CQDA 4I6AA 2PIIA 4ZP6A 3SSQA 4Z37A 2WBRA 4N41A 2L3MA 3O44A 4EU0A 2V8VA 4L3KA 1SL2A 4NCGA 3UFCX 1RHRB 5F8JA 4ANEA 3RGIA 4KHPF 1HNVB 3I5BA 4DV6J 4X2BA 1F5CA 2QT7A 3GONA 3AODA 3BH6B 1ZM4A 2AJ0A 3DHXA 5LL6d 1FE4A 2CAJA 2GHPA 2Z56B 1L3TA 4K4TA 1WUUA 1SUQA 3PX4A 3OSPA 1LWXA 3NBPA 3QQCD 3EJMA 3PKMA 2ADCA 1YJVA 2RQMA 2L9WA 4LRAA 5HVGA 1QSYA 1FTRA 3MD3A 1S0NA 3H2UB 2AYGA 2CUYA 3GB0A 3Q8PB 2DNQA 2BQ3A 4DV0F 5A8KB 3MMAA 1RK8A 1KBRA 4KR0B 1FD8A 2VDHA 3QSYB 2W24A 3IAS9 1SC3B 4BBYA 3PR4A 2UUCF 1VHFA 3C14B 2C2KB 4J9QA 3M9OB 3BR8A 3LO3A 4C97A 2HNYA 4DQIA 5HBMB 2DXFA 1HBUA 5CABA 4F8RA 3AJ1A 3KG0A 2Y1RI 3HVTA 2CQ2A 4Q43A 2R7UA 5EDWA 1S0MA 5HP1B 3JTNA 1DQ9A 2DO0A 5E33A 2UP1A 2IM2A 1VFJA 4OJGA 2DPJA 2QV6A 3U7JA 4YOEA 3TNVA 1RTIB 2JSXA 5HMXA 2UUWA 4D3HA 3CT9A 2BM1A 1GXTA 4M63A 2V9WA 3T19A 4W98A 2IC3B 2MZRA 2QX0A 5LOQA 1JLQB 1HBOA 2PMZD 1CJVB 4MKVA 4WP9A 1PYSB 2K1RA 1JLBB 3JQMA 4F4XA 5HROA 4LR9A 3T5KA 4K4UA 3ONQA 4RW4A 1R27B 4DV6F 1UJ6A 4YUDA 4GMKA 1I1GA 2AD9A 5T14A 2IRXA 3Q2SC 2P5VA 5KTQA 3TWZA 4LVNP 5D6GA 1JJ4A 1B7FA 2AJ4A 4RW8B 1HNXF 2E5LJ 3CCMS 1PGZA 3N9UC 1U47A 3H5SA 3ZNUA 3TAMB 4BHQA 1VK3A 3ENQA 3UNGC 5K14B 1NJXA 2Y9HA 5HQLA 3SXLA 2NXEA 2HVIA 1FHTA 4ANCA 1IJEB 1SB6A 4OHXA 1PILA 4P7TA 4IH7A 4Q2LA 5C2GA 2UUAJ 2UU9J 3DRPA 4K0KJ 2VU5A 2F9JA 4O44B 3CTRA 2HVEA 3BQ2A 2XLIA 4KYZA 2CYYA 3MM9A 3C6UB 1RCOB 2I2YA 4IRDA 1QDUB 5DDOC 2W9AA 3W5ZA 3LA0A 1S79A 3D54A 3HI9A 2A2CA 1FA0A 2UXBJ 3EVWA 1E6VB 4MKAA 4OYPA 4ANDA 2KRBA 4ILMA 4OZNA 1VK8A 3ZXWA 2BJ3A 5KT3A 4PABA 4Q8FA 3EPGA 4IR9A 1OYDA 3OV7A 1CVJA 1DHMA 5B0FA 4DFPA 6AT1B 2YX7A 3CCLS 2HFOA 2QLBB 4OHVA 2H51B 3KJQB 3G6ES 2KM8B 2PSZA 3SSSA 3CMQA 3MEKA 1U49A 1U0SA 2EC0A 2RDIA 5B0BA 4C0HA 2O5DA 2R7QA 2ZVSA 4ID5B 3D66A 4F4ZA 2LVWA 2LEAA 2XMAA 3TX0A 4WE1B 1HQEB 1T3NA 2NYIA 4NZ6A 2RD5C 2CPYA 1XJWB 2F7VA 3HM9A 2OD4A 3O3LA 3NKYA 3IP0A 3SFUA 3VAFA 2CQ3A 4CT8A 4X66F 1N5SA 1Y5IB 3Q0AA 3PW5A 2RDDA 2KVIA 3CJ5A 2ZUGA 2QLFB 3Q23A 2OLWA 1CBKA 1Q8IA 1HHSA 1LNQA 1XBWA 1PBAA 1JXLA 1JK9B 4CH1A 2VG6B 4IQXA 1QAYA 4NYPA 1FEHA 1R8AA 4FF2A 2OP5A 4GVBB 5K8OA 2GVDB 5A8RA 5CD4A 4FS1A 2VHGA 2LQ9A 1RWVB 1VBYA 1WF0A 3MAQA 2WVCA 1Q86T 4K0KF 3UPFA 2DH9A 3EWGA 2KL8A 3PTWA 2QLXA 1U02A 1FTCA 5ETKA 1M5VC 3MMBA 1TUGB 4O3SA 1O51A 1HHQA 1UTAA 3QNWB 3MR6A 1PJ5A 2BYCA 2RU9A 2DNOA 3OD2A 3OXFA 4XPEA 4GKKF 4LFBF 2JEIA 4TU9A 2BE2A 2NSCA 2BOAA 4EYIB 2DR7A 2MQPA 4JI5J 2AEJA 4X64J 4ED7A 2YH1A 3W2WA 2IHR1 2VFTA 1F9FA 3PO5A 4DUZJ 1RAIB 3SCLE 2HK2A 4LSNB 1IWGA 1S6PB 1UPMB 4USWA 2FTRA 5CH7B 4TLRA 2V8DA 1TUVA 5KG5A 3EGNA 4IOAQ 2K7JA 4ZVPB 2E7WA 5JVGQ 3GV8B 1GEHA 1RT4B 1Q5YA 2W25A 2KRRA 3FEZA 3W62A 2R2RA 1YBTA 4NLSA 3DLHA 3FMBA 1YIJS 4IKAA 1TKTB 5AE3A 3R5DA 3N6LA 2MXYA 1S97A 4F26A 2DISA 1RACB 3EZOA 3MEDB 2CQIA 5HVHA 2C1EB 3KUGA 5I42B 4C4WA 2B3TB 3D67A 1VRUA 2OMOA 2LECA 3E8OA 1S72S 5I3QA 1S0OA 3R8YA 3HHLB 2XCAA 2XO6A 1FRKA 1WTBA 2VF3A 4B08A 2RB7A 5BJRA 3N01A 3J81Y 4WP3A 2E29A 5HLFA 2JEJA 2VB6A 3FNNA 4DR5J 3LP1A 4K4YA 2WAQD 4MKBA 3FSIA 2HHPA 3R7NB 2GQ2A 1WC3A 3KOAA 2IYGA 4E98A 4O3PA 1M0SA 3RTVA 3QT8A 4EBCA 2DXEA 4N8NA 3FSXA 2VG7B 3PIPQ 1RWPB 3CJKA 3RRGA 1N36J 5K5MA 1BQMA 3W2VB 4CLKA 2DNKA 2UXDJ 2F8HA 5KFVA 1EB0A 4OQJA 2KN4A 3QT7A 2V2QA 2DIUA 4U7UK 3R2CJ 3BQ0A 2DR9A 1RQ0A 3LH2S 3HFKA 4D3GA 4KHRA 1OQ3A 3POTB 1WOPA 2QL9B 2ZUAA 3M05A 2AYBA 4I7FA 1CJKA 4M5GA 1EIYB 3AQOA 1RAAB 1IBKF 4AD6A 5ETOA 1M5HA 1HR0J 3VZHA 1D9DA 2KFZA 3L7UA 1X5PA 4NXMJ 3W9HA 1M1HA 1U0HB 4BC9A 3HD2A 4USMA 1HARA 3SSRA 2BJ8A 1T3OA 1TQLA 1HWIA 2YKAA 5LJ5Y 1IKXB 1P8GA 3DU5A 1C0UB 4N7TA 5B0EA 3EE3A 2L41A 4J9LA 2GJ2A 2PFDA 4LSLA 5DS7A 2GAHC 4ZVRB 3NLCA 2LDYA 1TL5A 2OHDA 5G4DA 1T05A 4U7CA 4F67A 2ZE2B 3DDKA 2DR6A 5IM0B 1NU4A 3DRRA 3MF5A 3TZWA 2C3PA 2HZCA 5F8NA 1YWXA 1WNEA 1WSRA 4ZLLA 3NGRA 4NLDA 5HL7Q 1HBNB 2NCKL 1U2FA 1G2EA 3S7RA 2D69A 3CCVS 2ZWOA 1TVRA 4DR5F 3CC4S 1N0VC 5KFIA 2GVZA 3MEEA 1X5TA 2ACMA 1FKAF 5KOXA 1YBUA 1F9HA 2WHOA 3NGKA 2UV8G 4MYTA 5A8WA 3X3UA 1R8BA 3QPIA 3D1QA 1N48A 4JP8A 5KOWA 1WOOA 1S1VA 4OJ1A 3OSNA 3OTBA 2YNFB 4RKUC 2B4UA 1TFYA 2VQFF 3NAIA 3CPWR 3H90A 2F4VF 1MN7A 2M8HA 3TVZA 4ELUA 4RUAA 3V4IA 2NUHA 4OHYA 2DVIA 4NE9C 3Q2TC 1TL3B 4L3NA 3TUZC 2YPZA 1WHXA 5KFRA 1FJ7A 4LREA 5EHHA 3OXGA 2IJNA 3LP2A 4LFCJ 3DM2A 5CHCB 3VQTA 1KQSR 1BLUA 2R7VA 3ZTOA 2XS2A 8RUCA 3KK1B 1B4SA 3D2WA 2OEKA 3UO0A 1RP5A 4A46A 1TKZA 1S4EA 4PPDA 4NXMF 4CM0A 4PG7A 3B8HA 1CQNA 4PR6A 5D4NA 4PRFA 4MFBA 1BHNA 2V6AA 3UVJB 2R7OA 4R0EA 2ZOFA 5A0YA 1QVGR 3GV5B 1FRIA 2JEGA 4RJVA 3J81U 3QMQA 4NA3A 3CF5Q 1WDTA 4LR8A 4FNHA 3JTPA 3LPEA 1I5OB 2UUTA 2QA2A 2ZBIA 2ADBA 1VQYA 4YS2A 1YX2A 3R1HA 1IR1A 3Q8SB 2JOQA 4K4WA 1WEZA 2FZGB 5AXKA 2ZH2A 3RB0A 3D7SB 1DTQB 1C0TA 4RW7B 4ECSA 3L09A 4CLZA 4S0MA 3NS7B 3M8QB 2HNZB 1HNIB 1T9TA 3JQJA 4LF4F 3DOKA 3VV2B 2HFZA 3GCWP 4OL8A 2F65A 1AA1B 3KNGA 2CDRB 2EBGA 5L8RC 4CM2A 3I6PA 1WC1A 3H59A 1SH3A 1RT6A 1I6JA 2XI3A 2LFVA 2HQ3A 2DKOB 1RA6A 5CAAA 5AXNA 1WC5A 2AMCB 2HEKA 1ZETA 1QAXA 1Z2ZA 2XCPA 1SIZA 4DL4A 3I55S 4WXOA 1W7WA 5KFLA 4JI6J 1NJWA 4ETXA 4K59A 3K2YA 2MTLA 5J1EA 4HKQA 2K06A 3JYTA 1GX6A 3EZ5A 4FZVA 1FX4A 4CTAB 2HQGA 3QIDA 2YNIB 1WACA 3HZEA 3MECB 4NLOA 4LFAJ 3M8PA 3DLBA 2VFUA 2BR0A 2GIQA 4RL1A 1HA1A 2MZJA 4AFFA 3T3FA 2N7YA 2B4VA 1DTTA 4LIWA 1ZZFA 1Q8KA 2VPXB 5C42B 3KJVB 5G0RA 4H54A 1LFPA 3IM8A 4FNIA 3DMJB 1NK6A 3C6TA 2P2CB 4DSFA 3OQ2A 4PAAA 1TK8A 4C8LA 1KN6A 1FF2A 1LW0A 3AD7C 1IBLJ 4R0JA 1TR0A 3NOGA 1RWKB 1PJ6A 5JUMA 5EWEA 4PG4A 3I31A 4K50A 4WFZA 3M2VA 4PWDB 3V6DA 1RTZA 3L9ZA 5LT5A 4N56A 4U9RA 5LMNJ 2BEFA 1LWCB 5E41A 1U1OA 1UJ4A 3IS9B 4RLEA 2YWFA 4OI3A 1X5SA 2RHQB 4OHWA 4NEYA 1MMLA 2G9OA 4OX9F 2AIRB 2MQOA 3M6WA 4E2FB 3PZPA 5IS2A 2IVFB 3S01A 2R7WA 3LWLA 3EXYA 1N88A 2ZOGA 3KLFB 5T41A 1EQ0A 3G86A 3TO8A 1R43A 1GTEA 5F41A 1CPZA 3J7Z5 1Y00A 3IGNA 4F3MA 1UVLA 1NSAA 2M4MA 3CMES 2LQJA 2Q6CA 2RVJA 2XY5A 4J91A 4A8KA 1T03B 2GO8A 4PCQA 1R6VA 4PQUB 4DN0A 4DZ6A 1DURA 1REVA 3B54A 1PSDA 4KQZA 1B0VA 3VAJA 1HMVB 1FRXA 2HHQA 1U1NA 4G1IA 4OZ1A 3CJRA 3KLGB 3US5A 4DX8H 1NKBA 3AA9A 3IA0A 4C98A 1CG2A 4X4OA 3GILA 2E9TA 1VQ6S 4RPFA 5E3CA 3K5LA 2KB2A 3NCPA 1VQ9S 5KFWA 2EG2A 4NZ7A 2MKHA 3PXGa 5B7WA 3PO4A 1ULRA 3ELHA 3QAEA 2RAQA 4PYAA 2HHXA 2ZKTA 5DG7A 1HBMB 3CC7S 1LWFB 1NB2A 5IT9Y 1PC4A 2CVEA 4DR1F 9ATCB 3N6NA 4ZP8A 4JI0J 4PXDA 1RTHA 5KFFA 3MAAA 3MZIA 1HHTP 2RILA 2A0FB 1TKXA 4OYIA 5IXUA 3EMTA 2KG0A 3P5TL 2BA9A 2BDPA 2MSSA 3NAHA 4MMOA 3BB5A 3P45B 3E01B 2LQ8A 3K58A 1QTMA 1XTZA 1ZPWX 3LOUA 4URQU 3UN5A 1RXOB 3X1LB 2BV3A 3MPDA 1M5OC 4RNMA 1F6TA 3O8WA 3H20A 4DS5A 4RNNA 4HHJA 2KKHA 1SQFA 4KFBA 1UVNA 2CPZA 4F4WA 3RG6A 4DFKA 1DZ5A 4EUVA 1UWAA 2QA1A 2HSEB 4JI7J 4CH0S 4AE5A 1AUDA 4QR0A 5MAOA 5KFAA 1OY9A 2UZAA 2CQPA 2QG9B 2QMXA 4B9NA 4QIEA 5GAHI 3I56S 5D0GA 1VJWA 5AJ3J 5CYMB 2ZH7A 4X62J 2XWXA 1YZ6A 2R7SA 2JC0A 4USJC 5D0EA 2FY1A 1AUSL 2KM8C 4F2RA 2FLOA 2J6UA 4JI2F 3GIKA 1SQEA 3M8WA 4RZRA 4JI4F 2YKOA 3W66A 4C8ZA 1F1BB 2J9EA 2KO1A 4C11A 1NH7A 2PO4A 3RR7A 2CQ4A 2IVYA 2OAUA 4QCLA 5ETTA 1XMQF 2P6SA 2KZZA 5ETPA 4UF4A 3W7BA 2RE1A 2HNYB 2W01A 3M2UA 3IXQA 4KPCA 2J7KA 3NNHA 4PG6A 3V81B 2VPWB 4ZHRB 4OHZA 2J9DE 1SBRA 4OYBA 5GAHU 2M52A 2EK1A 1WG1A 1V3ZA 1CULA 3SCKE 2VPYB 1S1TB 4F3OA 3QJLA 3VAKA 2BZ2A 2MKYA 4DR7J 1ZOTA 3D6MB 3JS9A 4J90A 4ZN3A 3FZBA 1FDNA 2AEFA 3QGHA 5BYRA 2ZH4A 3CD0A 4GRSA 1FRMA 4MIAA 3CJTA 1WHYA 2C3UA 2W4DA 2FVPA 3WZ0A 2MDAA 2W7AA 4TYAA 4ID8A 5KT4A 1URNA 3W9IA 4IDKA 4I56A 8ATCB 3OT9A 3PFOA 3TA2A 1B7YB 4ZCLA 1LOUA 2HGNA 4AT1B 1Y9OA 3GJSB 3H4DA 3LPYA 4U6PA 4ICLA 2HLUA 2ZDPA 2QGFB 2A1BA 1B99A 4DS4A 2CKWA 2WZ1A 4QWEA 3GLJA 2JZ5A 2V2VA 4IG0A 3MPVA 4IR1A 4DX7A 3PIOQ 3AA8A 1VR6A 3FBCA 4WZMA 5L1JA 5IT9U 4JV0A 1N5QA 1IR0A 4IH6A 4RWXA 4K2JA 4DV2F 1FKOB 4AQYF 2B0GA 3W60A 3DRPB 2RF2B 1YJWS 2HNDB 4EK2A 3EGVA 3D0HE 1EETA 4RW6B 4HT7A 3A3PB 1RU1A 3HMJG 4CIOA 2HGLA 1MLAA 1Y0HA 2C22A 1RWNB 4X84A 2VD3A 1NHKL 2IAJB 3DYAB 1U45A 1RTJB 2GQCA 1V5VA 2M0GB 3Q8YA 1UZHA 2BJ1A 4FYWB 1JB0C 3BO2A 1KVJA 2FJEB 2GC8A 4IOBA 1V3RA 5D0RA 5GADU 3R1LA 4F36A 3PCOB 2B7BB 1WC4A 2XZTB 3O5TB 1E6YA 2XGPA 1REGX 3GFZA 2VODA 2YQ3A 3MEGA 5E7OB 4LF6J 2FJDB 3PG9A 3HHLC 2CVIA 2L9DA 4E8UA 5BYQA 4ITSA 3IG1A 1LW2B 1SPBP 2X1AA 3CC2S 5F9LA 5D78A 1OIAA 2XYHB 5C25A 1LWEA 1VGYA 2UXCF 1JWWA 3K8WA 4NXNF 2DITA 1TK5A 2XNQA 5KFKA 1YITS 4DCOB 3DOMB 2YQ1A 2JJ4D 2LP4A 2CZ4A 3IR6B 2QE5A 2V4QA 1Q82T 2QJ3A 4L6V3 4ZVOB 3BZQA 3R6GB 2EKYA 2E1CA 2KU7A 2WVBA 3M8SA 1BQNA 1P9QC 2LDIA 4CNYA 4UZCA 1S7HA 3OPKA 4LF9J 3LGHA 4PWUA 2E66A 4DMZA 2RQ4A 3KNAA 4JI8J 2ZM6J 3DGPA 2VA3A 1RBLA 1IUJA 3LAKA 3RUBL 4GO5X 3HJFA 3MMBB 2EW9A 3PW0A 3DLGA 2GMHA 2YXLA 2LA4A 5DDRC 4Y6IA 1RJJA 1JLEA 2D74B 2XZWA 2FZKB 5KG7A 3KK3A 2YKMA 2EFPA 2ZC3A 2BE2B 1QUPA 1S6OA 4RWWA 2V8HA 4Y3CA 4A8MP 3CCUS 5K8NA 3NP5A 1OY6A 5J1PA 2Y1LB 4M5KA 1U7LA 1G1XA 2NLWA 1F5AA 3Q86A 2GNKA 4L76A 1CS4B 3RAMA 1JIHA 2UUBF 2YX4A 4QIWD 4HI2A 2WSFC 4X4QA 4Y34A 2O01C 1SH2A 3MPUB 4Z7CA 2GJIA 2X3DA 5SZTA 1AZSA 4RNOA 3LW5C 3KMSA 5DGAA 1C1CA 4M5MA 1R0AA 2Y3YA 4ZIWA 3O6QA 4CP5A 5GAGI 3N4WA 1X4CA 2CZ9A 1JLCA 5J2NB 3GR1A 1EP4A 1FNOA 3LAMA 2BJ9A 2HQDA 1WDDA 4DF8A 3OR1A 2RIJA 1GXLA 1N54B 2KHDA 2XULA 2V94A 4WYLA 2XYPB 4ZJQA 3AQPA 2QL7B 4A8YA 3CCWA 1HNZF 2XHCA 5LXYA 1ZBTA 1I3OB 3EICA 5I4MA 2HRUA 2CA9A 2D3UA 1S76D 3EGZA 5D3GB 5FDLB 3PW4A 2COLA 1TAQA 3PYDA 4GC7A 4Y2CA 4C3LA 2VBYA 1EAYC 1O0PA 1ZM3A 1UFLA 4NLVA 3ILLA 4KGMA 3LP1B 3A12A 2GIRA 3MMCA 4KE5A 1L3UA 4DLGA 5IOLA 4LSZB 4Q5VA 1KLMB 2FJAB 2QMWA 2Q79A 3H98A 4J9UE 5M2UA 2OKQA 1UJ5A 1EJ7L 2Z2LA 3JSMA 3D6TB 3KLHA 2JEFA 2MLYA 3CJKB 4AL6A 2CQCA 2IYIA 4B3TJ 1U6FA 1BQMB 1D0EA 1RTDA 1RWXB 4CLPA 1NDLA 4C6AA 4YFUA 1NPPA 3RBZA 1T9UA 2FPHX 4DQSA 1X9MA 3HT3A 3J80U 4PUOB 4G6VB 1EKSA 5B08A 3HPOA 3CWJA 1CLFA 2RNEA 4YB6A 2CNNB 1VC0A 2ZZMA 4EO6A 5IWAF 2AU0A 4G1QB 2DK2A 2J7WA 4DSEA 3GU0A 4YDXA 4HL9A 3PYFA 3QLHA 2WB1D 1IVZA 2NXNA 2F63A 1WORA 4CO1A 3R7BB 3VTIA 1WELA 4B3SJ 1Z1ZA 2OPQA 2NXCA 4F0HA 3ZZTA 4HT5A 4M5NA 3BGRA 2V2ZA 2OJ3A 4DU8A 3KLIB 4BS2A 1VQKS 3HSDA 4WFNQ 2OGUA 4RBVA 2V69A 1LK7A 1YVFA 2L9NA 2LU2A 2DGWA 1FJCA 3P3DA 4MH8A 4WWSA 4DV4J 3FJ2A 3CSKA 1UMJA 2FVRA 3RB3A 4TY9A 1MSWD 4FBUA 1TL1B 3R5AA 1TVRB 4XPCA 2HFSA 4J37A 3RW7A 1QVFR 1Y7PA 2J6TA 2RUGA 4TQSA 2KI2A 3GV7B 2KT5A 2OPSB 1PG5B 4K8RA 1UFWA 1S1VB 3T1YF 4ZPAA 5DO2A 1QTNB 1RHUB 2DCUB 4KV8B 3CD6S 2AGPA 3RB4A 2IMOA 4DL7A 1Y5LB 3THVA 3B78A 4GC6A 2BX6A 3WHIA 1CSJA 2ACYA 2SXLA 3SQGA 2AYMA 3KK2B 4AXJA 4IFVB 4ZS6A 2NR0A 3WQPA 4P7VA 3CMAS 3PV8A 3MI7X 4FXVA 1MU2B 3KLVA 4ZVTB 3HK2A 2Z2MA 1YSJA 2GS8A 2OMLA 3VAGA 3PX6A 4P71A 2V67A 1NJYA 2AJ1A 2BOPA 1Y10A 2V63A 3SCIE 3NEKA 1A6LA 2A18A 3HHNB 4LF5J 4O4GA 2R2TA 2LEPA 3DRSB 1VBKA 3D5MA 3BDEA 2PEHA 4B3SF 3KYLA 2ZJRQ 5IV4A 4DV5J 1RAHB 1SV5B 2YWEA 1NXIA 2J9DA 2AGOA 1HI1A 5A0YB 3G82A 1HI0P 2E5GA 3M32B 5K9FA 4A4JA 2ZVIA 3RRKA 1T7PA 1S49A 4L73A 2ZDOA 2FJBB 4JOUA 3F56A 4ECRA 4C3KA 3KHLA 4WCEQ 4J9PA 1CJUB 1XMOJ 2CPXA 4OZJA 1GQEA 4KY3A 4NOHA 1HWLA 1C0TB 3M30B 3MMJA 3D28A 1S6QB 2GMLA 2KFNA 3EGWB 3MR7A 3TJ9A 3GE9A 1XNRF 1FKPA 2H3EB 2CJYB 4J9KA 3FDSA 1YQHA 2R9LA 3QGGA 3NL0A 3DOKB 1ZS6A 2EBEA 3GSDA 1IKYA 2XMMA 1J5EF 2R8KA 2YNGB 2KHCA 1Z2LA 4EMDA 1RT6B 2LYVA 1SJ3P 2ZWPA 5HMZA 3DC2A 2J0QD 3N5BA 2JH3A 1VBZA 2YKQA 3GIJA 2W9BB 1JMTA 4MK9A 3WX4A 2EVZA 3I4PA 3J7YI 1K47A 1AYEA 4NRUA 3C19A 3BSCA 3TAPA 5J1EB 1RT3B 3CIMA 3JYTB 1CC8A 3DLEA 3GJRB 3VAMA 2BANB 1QD1A 5ETRA 1N56A 2MJUA 2B5JB 1IN0A 4X4NA 3TEHB 1UA1A 3EX7B 4M5LA 1H2UX 4MJKA 4KGVB 2AYEA 2AKWB 1YHQS 2AJQA 3M8PB 4LF5F 3MXHP 5KG2A 2ALZA 5B0GA 3E51A 2KT2A 4A8SA 2ZNYA 3QATA 2HQIA 2DNZA 4I2PA 2CPJA 3UNYA 3ISZA 1J5OA 4C8YA 5KAKA 1AFJA 4WFBQ 3K59A 2DHXA 1RT5A 2XLJA 4P2SA 4ZVUB 3CULA 1A0OB 3GMGA 4ES2A 1H2TZ 2BE9B 4ECUA 3UW1A 3M6VA 3M2VB 3J7YU 3EXCX 2FDNA 3CCSS 2ZBRA 1NPKA 2Y1JA 3M1VA 3IAM9 5LSOA 2RHSB 5GAEU 1RT7A 3OR2B 3QRRA 1KTQA 4ZPCA 4EZ6A 2NQPA 2DEIA 5KFMA 4NI2A 3UR3C 5DG8A 3KLEA 4LF2A 1FXRA 2HFNA 1FXLA 1HD1A 1ZTTA 1ZTWA 1QE1A 3CDUA 3JSBA 4Y2KA 1U6ZA 2CPDA 3RBDA 3NY0A 1FEEA 1NB7A 3DRXA 2CQBA 3L7OA 5C2CA 2HMIB 3JAMY 1XC9A 2V8PA 4F4AA 2OELA 1Q0NA 2R3VA 1SJ1A 1AT1B 2QC3A 2VQEF 3NGSA 3BPDA 5DLFA 3FUYA 3NRBA 1GFWB 4TU8A 4NRTA 3U1MA 3PRDA 3WC0A 4B3OA 4UQTA 2D9PA 1IR2A 3M9MB 4YB1P 1XWLA 3D3BJ 4CLFA 1PO6A 3CEDA 5FD1A 4JI1J 3Q89A 2H4WB 2J5AA 2IRYA 4CO0A 4OLOA 3HJVA 4WBFA 1D8ZA 1AFIA 2HKEA 1VI7A 1N4LA 2CPEA 3VALA 2RS2A 4QZVB 1PBUA 1T8EA 2O1PA 6FD1A 3FFIB 3KWMA 3GIIA 3LF0A 3BDPA 3D1HA 4QR1A 5DDPC 3W61A 3FBBA 3RYLA 5K8MA 3SI8A 1IQZA 4CI0B 4DZDA 3TANA 1WD6A 2ASYA 5GMDA 4C8OA 2MKSA 1TKXB 2YBVA 2RUSA 1Q81T 2IBKA 2OPPA 3BV8A 2E9ZA 1RGVA 1RB0A 2VFSA 1QM9A 3QZ8A 3CUNA 2CWKA 1URRA 3CCJS 1N5YA 2HIYA 4KHPJ 4OLPA 5A2QY 5F8HA 4OV1A 3C14A 1L3VA 1FJGF 3BKTA 4WTOB 1I94F 3UCUP 2DYAA 4ERDA 4KKOB 5HBMA 1S9EA 1FRLA 4QYRA 4WP8A 1WHWA 5HP1A 4HACB 3H5XA 3OL9A 2M3DA 2WONB 3LQVA 3W5YA 2FVCA 2B6AB 3PDNA 1KR4A 3NWRA 2LXIA 1U24A 1VC6A 3THPA 1M90T 1FRJA 2JHEA 1RTIA 2IJFA 2QYGA 4DR6F 2UUCJ 1EQMA 1B64A 3MCNA 4CQ1A 2GV1A 4I64A 3CCZA 4ED8A 1P1TA 2B4PA 4ETZA 2ROPA 2IPOB 4PEOA 1RBOB 1IKWA 1DLOB 8AT1B 1CJVA 1TELA 4IOCQ 3H4BA 4DI6A 3N5FA 1PAUB 4DFJA 3K5OA 3I0SB 4DR3F 3D1OA 2HAIA 3H42A 4ILRA 4QWCA 1RKJA 4QR2A 3M4XA 2OTJS 2N7CA 4URSA 4M5HA 3BO3A 3AXMA 1W2BR 2D1CA 3KMQA 2W2MP 1OPZA 1FCAA 2E1PA 3Q83A 2HFVA 1GMWA 3M2UB 3MPWA 4YB5A 4USTA 3BKUA 2KJVA 3TAMA 2E5HA 5K14A 3RAQA 3HVWA 2YWGA 2W8KA 3S1TA 3MAHA 1Z4UA 1RUSA 5H1SV 5C5JA 1PYOB 1SC6A 2WRMA 2YY3A 3JAMU 1DQAA 1F60B 4PQAA 2V4RA 2C2MB 4FN5A 1MROB 3CJ4A 4F02A 4O44A 3TX8A 4C2MA 3IFEA 4ZIVA 2FHOB 4NMXA 3CGIA 4RO0A 2F40A 4Q44A 1HNXJ 4IDKB 1E6VA 3MDFA 2JVRA 4MTPA 1U09A 4JBCA 1JLFB 1U25A 5IQQA 3CDBA 1RADB 1SCJB 5EX0A 5A6WA 1HYSA 4LF8F 1N5VA 3K17A 4FVMA 3NWGA 3AAWB 5GMEA 2HHTA 3G2XA 3AY0A 1FT8A 4EWTA 3TQ1A 4KHMA 4NLUA 4TVAB 4J9OA 2KVQE 1WJ9A 1ZM2A 3MTKA 2WTFA 2UVRA 4ID5A 4IG0B 4M5IA 4WKYA 2PI5A 1G3OA 5B09A 2WSEC 1WG4A 1UW4A 3FC9A 3G6XA 2PD1A 3OUYB 1HQEA 3KG4A 2FHKA 3FCHA 1YTYA 4FYDA 3ET6B 1M5PC 1YJ7A 1NBEB 1WKJA 3OFHA 1LKZA 2MGZA 4ZVEA 1VHIA 3QZ7A 2C2NA 2XZDB 1U48A 4DFMA 1HNWF 1UPPA 3FRZA 2ZJQQ 2AJFE 1JXEA 1XIQA 4PPZA 2ILYA 4KSEB 5KG6A 3PFEA 4J7CA 2FY8A 2VG6A 1V3SA 5A2QU 1JKHA 4DCJB 2QA4S 4B02A 1XR6A 2Z2ZA 1NDKA 4M1KA 4I69A 3OJUA 4K4ZA 2GVDA 2XM3A 2VKZG 3GJQB 3M6UA 2GMJA 4HTJA 2MLZA 3B4DA 2APOA 4X66J 1P1LA 2XSFA 2DNPA 1SH0A 3IWXA 2JLFA 3V4MA 4Y00A 4V19X 3H5UA 5L1LA 3O2IA 2B9XA 4IYQA 4I6WA 1K1SA 4WU2A 1U1PA 4PXEA 3KFWX 4ELVA 4LBPA 3L4BC 3IG1B 4RW9B 1U4BA 4FF3A 1RHKB 4IG3B 4OZ2A 4ED6A 4URGA 3MUTP 1DBDA 3HP6A 2XEXA 1R3NA 2G0JA 5DM6Q 2A10A 3FEYB 1OO0B 1SJRA 3ITHB 4KBIA 2DBBA 3MM7A 4ZCIA 1S1UB 3UR0A 3F0NA 5HATA 5KG1A 1RAEB 4U8YA 4CCHA 3VF0B 1R0CB 2CPFA 1VBXA 4LSNA 3PX0A 3ZO7A 4FPIA 1ZAXA 1H2VZ 4UOFA 2PI4A 1BQNB 1FJEB 2DGOA 3NCRA 3FMWA 2ZH5A 4X4UA 3N79A 3DOLB 1DJ0A 4B9UA 1K9MT 4GKKJ 4LFBJ 2ZOMA 2HRYA 2MEWA 3DGPB 4LVOP 3MHYA 2W9CA 4EFAC 1UVKA 2FLLA 1X4GA 2YNHB 2EFOA 4TY8B 3M7VA 4C7QA 3DLGB 4UZBA 1SKSA 1TKTA 3U1LA 5EWFA 4PXBA 1TMJA 2OFGX 4B3RF 1JLEB 1S6UA 3KK3B 3D3CJ 2YKMB 2DNRA 1YLXA 5I42A 4CYUA 1BY9A 4EBDA 4DEZA 4BDPA 4ZPVR 2G4BA 1TV6A 1FNMA 4OZLA 4W92B 3DXBA 3C3LA 4I6YA 2J8AA 3CJ3A 3QJJA 4QJVA 4ZJLA 2E1AA 2CJQA 3G6VA 1HKAA 2J76E 3GCXP 2M5YA 1K1QA 4YY3F 3M2RB 3ZTQA 2DH8A 3CW2C 2MB0B 2FIUA 1ZA1B 4WTYA 1W2IA 5CZXA 1R0AB 2WOMA 3NS5A 1F2HA 2HQCA 5F3ZA 4EO8A 3M9NB 2VG7A 2M8DB 2BKNA 2Y1IA 1NNDA 2B7CB 2ZJPQ 5J2PA 1JLAB 3R5BA 4U7UD 3W63A 4NMLA 1YK9A 1NK4A 1AB8A 1EHWA 3DGVA 2EPIA 4M5DB 3VR1A 4UOGA 1RAOA 3BKFA 3IWLA 2EEYA 1WKLA 1KOHA 5ADZA 2CQHA 4ZVHA 3PRBA 4BCAA 4PWWA 2W4CA 1FWLA 1TTHB 1UCNA 1U0HA 5FJ4A 3D0GE 4B9MA 2YH0A 2IM3A 3TW0A 4B9LA 1GMUA 2H5IB 5H9EJ 2FQQB 1FNXH 1FDDA 3MMCB 2F5GA 1IKXA 4QIVA 4P2XA 2Z8QA 5CYQB 2WK4A 1VQPS 2RH3A 2DT9A 3IR5B 4E0DA 4ZVFA 4F3QA 3DU6A 2XGQA 1EARA 3E3XA 1IBKJ 1HIYA 1ZPVA 5IM0A 2OPRA 1AW0A 3PNIA 2MZTA 2ZHBA 1T95A 2FHJA 1RTDB 4LQ3A 4W90B 3HF5A 4U8VA 5IFMA 1HBNA 5LMUF 1BXNA 1NLKL 3HHKA 3A8IA 3I0RA 1NPRA 3U1NA 1X9WA 4OYZA 1FDBA 1BMQB 2CJXB 4DR2F 3ISND 1TKDA 2PT0A 4V1Ak 5D15A 4DSIA 5HJXA 4FDFA 2YNFA 2DNMA 1YGYA 5U47A 4DL5A 4DF4A 4PYDA 4B9SA 5I3UB 3IR7B 5BR8F 2ZH8A 4DXLA 4X65F 1OQ6A 2OPQB 4Y2AA 1TL3A 1QSLA 1MMDA 3BGRB 4DPWA 3BBCA 3ISNC 4IQMA 3ULHA 3T5JA 2BACA 3Q22A 5DRKA 1JJHA 4KIAA 2QSWA 2HVZA 1HQ2A 3H40A 1H74A 3KK1A 4ECVA 3LALA 4ZITA 3MR3A 1NEEA 1D1UA 2NUUG 5C24A 2W2OP 2VQFJ 7AT1B 4CO4A 2CRLA 1S9GB 1RAJA 4WXWA 2F4VJ 3BGOP 4H4KC 2DNLA 2HFUA 2RRAA 1RA7A 2HRTA 4RX6A 1OPIA 2LMIA 1T9WA 2JVOA 3UVJA 3T41A 4DR4F 1S1XB 4LBIA 1S77D 4USHA 4TYBA 1IBMF 3J7A1 3SDEA 1XMBA 1QAJA 1YJUA 3GG1A 1D9FA 3VGTA 1H38A 2RQKA 3ENWA 3BEGB 3FRYA 3BH7B 3QGPA 2IVMA 4R5PB 5EGYA 4HTIA 1JLGA 5KFBA 2DRBA 2GQQA 2K7KA 3AD8C 5DZ7A 1RHMB 4UT4A 3IMQJ 3T6BA 3ILJA 3M8QA 2V68A 3CJ0A 3J7AN 3UE2A 2IBOA 2GGPB 5HMWA 3CO9A 2ERRA 1R89A 3DDIA 3HX9A 3CNQP 5DETA 3CXCR 1B70B 3RBXA 3D4JA 2UVVA 1U1LA 1V6HA 3BSAA 3GTYX 3MFHA 4LT6A 4FYXB 4H4OB 1T94A 4MT1A 2VJVA 4LR7A 2BRKA 4A8WA 3OHAA 4USIA 1NSPA 4OYAA 3PVXA 3TUIC 1C1BB 3W65A 4P74A 4ZA1A 1XNQJ 2DRAA 1JNZB 4OJHA 4ZN1A 2CPHA 1YJRA 1N34F 2RT3A 1UL3A 3SCJE 4CTAA 2PEBA 2LA6A 2MYFA 4LF4J 4KO0A 5H9FJ 4QQBA 2XO7A 2CG4A 1UKUA 3PJ9A 1XN9A 1RWOB 5HAOA 4ENOA 2ZITA 5C42A 3KJVA 3RU0A 3KJNB 2HIQA 1SJ4P 2MQLA 4BWJA 1WC0A 1T9VA 3DFEA 5K20B 2H54B 3VQSA 2FYXA 3GFXA 4N8OA 5CD4H 2UVWA 3TUPA 4ECXA 2MHNA 1XERA 3ZZOA 4DPYA 3BBFA 2HQFA 1G6BA 1KLNA 5DQIA 1KTVA 4PWDA 1IKYB 4F7VA 2V4JA 2QYCA 5AXLA 1LWCA 2VV5A 4DV1J 1Q78A 3IS9A 4LF7F 2VBZA 2BW2A 4I2QA 3EUNA 3WX8A 3DN9A 3W3SA 1X8DA 1S1WB 2JFKA 3OVSA 4WKRA 1YJTA 1HWUA 2OUGA 1NDPA 1VISA 3MCMA 4O3OA 5HVFA 2WW8A 3NCQA 3FEXB 2CWXA 3MR2A 2J0SD 5KFGA 3GYGA 2DHAA 3AJ2A 3OTEA 3LP0A 2HYIB 2W2QP 3ZZ0A 1VQ5S 1OSDA 1OMSA 1J5OB 2V0NA 1VQOS 1MN9A 1T03A 3JTOA 4PG5A 1IKVB 4OX9J 1PIEA 3B6BA 3PYEA 5ETLA 2VG5B 3IRXB 1XNQF 1RT2B 1HMVA 4OYOA 1JNRB 3LGMA 1S5ZA 2VASA 3CB4A 4H4MB 2AZ3A 3OL6A 5D8HB 4DUYF 1VQMS 4UUWA 1YI2S 3MM5A 2CQ1A 2CJBA 3TUJC 1LFWA 2LCWA 4OYWA 5H9EK 3I32A 3G4SS 5CXTA 4OYXA 1NAQA 1JJ2R 1RT1B 4DQRA 1LEOA 2XS7A 1HBMA 2DXDA 2XYGB 3N28A 1LWFA 3RJMB 3HHEA 3FKBA 2X7IA 2Z58B 4N76A 2D3O1 5ETMA 3QO9A 4XO0A 1GX5A 5BXIA 4J9RA 3R6LB 4DV1F 2D3ZA 2CNOB 4M5JA 4LJMA 3E01A 2Z2YB 1U26A 3EPIA 4NCAA 4FKXA 2XHWA 3DLKA 2JLGA 5KFTA 4EGLA 2QRRA 2HS0A 3IWNC 5T7LB 4B3OB 4KTQA 3PJWA 3FBEA 3G8SA 1VDHA 3UDVA 3SMZA 1WF1A 3ENAA 4PG8A 4FXWA 4JV5F 2Y8YA 2CJ9A 4YR0A 3BR9A 2JL9A 1J2VA 5AXMA 2A6MA 4DR1J 3NG8A 2FC9A 4ZCKA 2PFFB 1KONA 1EX8A 4WYWA 2A6OA 2RKIB 2MQ8A 1TL7B 1UVIA 4ES3A 4I4BA 4P6QA 3WIVA 3C16B 3A3OB 2AP6A 4A8XA 4YMEA 3ILOA 5CZVA 5CYMA 1S7IA 3AOAA 1ROFA 1H7WA 3PJXA 3ZZUA 2OPPB 1HWKA 2BM0A 2FJWA 1MNEA 1HD0A 4P73A 4OI0A 2E1MC 1KOOA 2B8QA 4WPAA 1SL1A 3QIPB 2ALYB 2W7OA 4DG1A 1V5IB 1N5YB 4C0BA 4B17A 3H5YA 4HVZA 3MUMP 1N6QB 4FP9A 3TA1A 1DQ8A 5D4PA 4QOTA 4Y0FA 1Q53A 1NK7A 2AGQA 2LEBA 2QSFA 4P52A 3NNAA 1HFEL 1VC5A 2HVHA 3BPSP 1YRTA 4RBUA 2OSQA 2ZNZA 2HHWA 4UQGA 1KVIA 4FVCA 4RNHA 3M8ZA 1S9EB 3K7RA 3V81A 2VICA 4ZHRA 4LMZA 4JUZA 2YTCA 2R8IA 1YKWA 1I51B 1CQMA 4ED5A 2DRDA 2HG4A 5IV3A 3ENVA 5CQGA 1S1TA 1YBAA 1OY8A 4KAIA 1PAEX 3BYRA 4JI2J 4ZCMA 3R5CA 4J9VA 4JI4J 3T1HF 1XK8A 2B9YA 3GIRA 2ASJA 1K8AT 2YPYA 1H3DA 4NLPA 2MQMA 3EYZA 4DV3F 5I3PA 1CJTB 2F9DA 5KT2A 1KEKA 2C3YA 3ICLA 1DARA 3CD7A 2C3MA 4WFAQ 1KNZA 3OL8A 2PA3A 1VCTA 1XMQJ 3C15A 1GK8A 3JSRA 4O3QA 4QIFA 1RHJB 2Z0GA 3K89A 1IKWB 4FYVB 1T0TV 2I9SA 3LUYA 4FF1A 2EXUA 1G4CA 1UEVA 4KRWA 2VC1A 2FGCA 3G96A 2XWYA 4HHUA 4ZPWR 3H0PA 3VAIA 1FK9B 4WF9Q 4P9SA 3AHPA 4DQQA 2XMTA 4DL6A 2NXJA 1H98A 4O3RA 2UVUA 4I1TA 4EBEA 2JNJA 1ZH5A 3AH6A 2AZ1A 4F2SA 4PKDB 2JWNA 2KXHA 3S8SA 2X1BA 5H9FK 1BQXA 4IFYA 3SZ2A 3GPAA 3NMAA 3GZ7A 1K73T 2B8PA 2F1FA 2ZHOA 3R2DJ 2DIVA 3PKYA 2B4OA 1FKOA 5LSLA 4NCGB 3HDSA 2ZKUA 2I0XA 2KXFA 2RF2A 2CG8A 4WK3A 2HNDA 2W2PP 3GP9A 4QWBA 5KG0A 4RW6A 1HI8A 2XSJA 4ATNA 1YDLA 2M88A 3TZZA 1TU0B 4DJBA 1B0TA 3LWMA 2FUG9 2R42A 2IAJA 3DYAA 1SUQB 4HR2A 4FYYB 1RTJA 3TEGA 4QPTA 1HLWA 3NBPB 2RJZA 1KHWA 3BSOA 5IT0A 3K5NA 1Q8BA 1HYSB 2XMJA 3QYYA 2ZZTA 4DV2J 4AQYJ 4K5RA 2P9CA 2DCLA 1BUXA 3MMAB 2QFIA 2DR5A 2CNKB 2RMLA 4RUHA 3PR5B 4RR5A 2KTQA 1YG0A 2BVZA 3V6KA 4CH7A 3HSGA 4OI6A 4CO2A 2FVQA 4RU9A 1HBUB 5IT4A 2GW8A 2IFXA 1LW2A 4KB7A 3HVTB 3RR8A 2I1RA 2FD2A 3LANA 4UTGA 3HFVA 1YZ7A 2J9CA 2NPFA 4G1PA 5BYSA 2MGZB 4AL7A 3TZYA 4KT0C 2D3OR 3DOMA 3KDOA 2MPUA 4YEAA 2IMWP 2DGUA 4J5OA 1ZAWA 2AW0A 2E5LF 2PA8D 4X4TA 4AL5A 2QA4G 1JKHB 2PDAA 2BKOA 1KC8T 1GT8A 4RUBA 4CLYA 1HBOB 1R8HA 2P9EA 3GIMA 3ZTSA 4WJBA 3RAXA 1KKHA 5HQ8A 2K1RB 2UUAF 2UU9F 5HROB 3GFHA 4Q45A 4DDFA 4NLGA 4O0NA 2G2YA 2HHVA 2CXEA 4RW4B 2UXCJ 1D09B 4NXNJ 4XK8C 4P72A 1CC7A 3TVKA 4TU7A 2E7VA 2GHWA 2HWHA 2B9EA 4HI1A 1X5OA 1NK5A 4TN2A 5J1NA 2J6SA 2UXBF 1X4HA 2WVEA 3EVOA 3SBMA 3OTOJ 3QWUA 4WFYA 4NASA 2HHSA 2H5EA 1VQSA 2VOOA 3ZC4A 4A47A 4DWIA 3KDNA 1Y3JA 4A8OA 1NK0A 5J2MA 5L9NA 3W8PA 3MM7B 2KG1A 2GIFA 4F0KA 3MM9B 5HK4A 1NKEA 2FVSA 1LK5A 1RLCL 3KUHA 1CS4A 2CJAA 1NZAA 1SIWB 2QFJA 1K0TA 5M2RA 4IRKA 1JX4A 1ICEB 4UY85 3W9JA 2VBXA 2QLWA 2L08A 4Y65A 4EI2A 4X4SA 1FO1A 2W9CB 3HHDA 5AE2A 5J2NA 3BM7A 1BWEA 2IY5B 3SV4A 3QFWA 4OI2A 1Q5VA 2IA0A 2BXJA 4C48A 2MHEA 1KDNA 3EDQB 4CLWA 3QSIA 1FD2A 1VIOA 1S4FA 4J9SA 4Q0BA 2UUBJ 2M70A 2O66A 1R31A 1YJ9S 5J2QA 2V34A 4K4XA 3THTA 3BYPA 4CYUB 4P2MA 1RWUA 5D3GA 1KD1T 4ZVSB 3I5AA 3IGVA 1TV6B 5FDLA 3V2UC 5HI7A 5M2PA 1VQ7S 1QLNA 3J80Y 4DL0C 1RLDA 5ETQA 1U1RA 1Y5NB 4I67A 2RS8A 2KFYA 2DTJA 2A2DA 4P75A 3H8YA 3R7SB 1GTHA 3FQLA 4EYHB 3FGVA 3MOJB 3L7PA 1S12A 1DAXA 1WWHA 2POKA 2ABYA 1KLMA 3OTOF 1HNZJ 1FFGB 2X51A 1TAUA 2WOMB 3NXZA 1SQGA 3GWCA 1NCLA 4Y2IA 1WOSA 4JI5F 5A8RB 3BF4A 3BGLA 4KGZB 1SJQA 3MGJA 4ZOSA 5KG3A 5GVQA 4ZK7M 1VQLS 2HBRB 5J2PB 5DDQC 4X64F 1NZ8A 3KG1A 5IZHA 2QO3A 3H25A 2XG8A 3I96A 2NYHA 1X60A 2ZH9A 4PUOA 4RUCA 1S59A 2QL5B 3FCWA 2EFNA 4DUZF 1F5BA 3G6YA 1C4CA 3PM9A 5GMKa 2C2DA 4Q2MA 3FQKA 1P6TA 2DJWA 4N47A 1KSPA 5E3PA 2H4YB 2B56A 1SKRA 2OTLS 4G1QA 1RYRA 4CLTA 1O5JA 2I5JA 2LXUA 2AJ2A 4QW9A 3A8KA 4DU7A 1F3VA 7FDRA 2PGCA 5KFUA 3BN7A 3W2WB 1WSVA 2IA6A 3KLIA 5JVHQ 2P9GA 2I8EA 2M2BA 4XAKA 2LKZA 2PC6A 5IWAJ 1W26A 1VYAA 2ZH6A 2OPRB 2VH7A 4XDDA 4WIQA 2E1RA 2BRLA 2DHGA 5KFOA 1FWPA 4PXCA 3TRGA 1TL1A 3Q8VA 4ZVQB 3I0RB 3PACA 3HSJA 3ZTRA 5KT6A 3MURP 2OPSA 3V5RA 3MCOA 2DGVA 4DSKA 1UEKA 3KTQA 3PHTA 4YQWA 2HK3A 1VRUB 4KV8A 3UD3P 1N36F 1IM4A 3L3CA 2D9OA 4MIWA 4NA1A 4LUBA 2UXDF 2MZSA 4DOZA 3ZZZA 4QU6A 3UD4P 4F50A 4PZVA 3OVBA 3C2PA 4DX5A 2AX0A 2GX8A 5HLFB 2ATLA 3KK2A 2R8HA 4IFVA 3QT6A 5GAGU 4MK7A 3HKWA 1Y11A 1MU2A 1M5KC 3NGTA 4HEA9 3UDCA 1RZMA 2MQNA 3T1YJ 1K0VA 2QN6B 4NZ0A 4DUTA 2XMWA 5C24B 1HR0F 2NS1B 3VGSA 3BS9A 1J27A 2FLPA 3F44A 2FJVA 3I87A 3DRSA 4A48A 2BQUA 2CQGA 1WC6A 2CIMA 2MKKA 4M8LA 1SV5A 1UVMA 4OZ0A 2QLJB 3VGVA 4AUKA 2XBPA 4FKYA 4X4PA 3M32A 1VMBA 5KG4A 1MWQA 4I7FB 1ZYQA 1CJKB 4DHVA 4ZLJA 1GNKA 3SDEB 2Y0SD 1KFDA 5F8LA 3SV3A 3GYXB 3SYZA 3TVYA 1WG5A 1F9EB 1CJUA 4ZPBA 3J81j 1ZA2B 2VJUA 3P5BP 2MJNA 1JLGB 4DLEA 3M30A 4DV7J 2YWKA 2O67A 1RISA 1S6QA 1X4EA 2WVDA 3V6JA 3BREA 5DJBA 4QYZJ 2G0CA 4LSLB 4AXIA 2DNGA 1T05B 4QWAA 2ROEA 3DRRB 3MWBA 3BBBA 2YNGA 4BWMA 4OZ5A 1O6XA 3GYNA 1HPZA 2E7XA 3V6HA 2ZEJA 2EWHA 2W9BA 1BGXT 3T6JA 5DLGA 5ETVA 5F0WA 1NO8A 2GVZB 2JC1A 3MEEB 1RT3A 4ECYA 3GR0A 3BGUA 3CVKA 4LFCF 1OWXA 3P96A 4ED3A 1RU2A 2EK6A 5A8WB 2BANA 1Q7YT 1U1KA 2KYZA 2W8LA 3JSYA 4C9DA 1XNRJ 4H4KA 3Q8RB 3C8YA 3HZGA 1TZ0A 2B5JA 3CJQA 2GAGC 2OI2A 3SEOA 4KO0B 2V50A 3MPYA 1ZAVA 2CPIA 2DNNA 3R97A 2LU1A 1J5EJ 2L48A 3V4IB 1UVJA 3BQ1A 4WK1A 2HBQB 2H5JB 1B3TA 3MOZA 2HZAA 2AQ4A 1GH8A 1KQKA 1KHVA 1H72C 3FZ2A 3VWSA 2IM1A 3LP2B 3G87A 3PW7A 3DM2B 3CJ8A 3FCVA 4UUXA 1KP6A 4KH0B 3G9CA 1SVDA 5KFHA 5CA5A 3D6FB 2V4JB 1VJQA 2M7SA 1SJFA 3Q8QB 1WKKA 4KPYA 1SI9A
chains in the Genus database with same CATH topology
2C2MB 2C2KB 2H4YB 2QLJB 1RHKB 1RWVB 3R7NB 2QLBB 4ZVTB 2H51B 1RWXB 3D6MB 1BMQB 3IBCB 3R5JB 3KJQB 2XZDB 3D6HB 4ZVRB 2CJXB 1RHRB 2CNLB 2C2OB 1IBCB 4ZVPB 2HBYB 2XYPB 2CJYB 2QL7B 4ZVUB 1GFWB 5IC6B 3R7SB 1RWPB 3EDRB 1ICEB 2XYHB 3NS7B 1I3OB 1RWMB 1PAUB 4DCPB 4DCJB 2CNNB 2CNKB 1RHQB 1RE1B 3QNWB 2H65B 3P4UB 1F9EB 4DCOB 2P2CB 2Y1LB 3P45B 1RWNB 2H5IB 1I51B 1RWKB 1RWWB 1SC4B 2FQQB 2HBQB 2H5JB 2H4WB 3GJQB 2C1EB 2CDRB 2QL9B 2C2ZB 1QTNB 2XYGB 1QDUB 2H48B 2HBRB 1RHUB 4ZVOB 2HBZB 3GJSB 3R6GB 3EDQB 3RJMB 3IBFB 3GJTB 2QLFB 2DKOB 1NMEB 1RWOB 4JB8B 5IC4B 3GJRB 3R7BB 3KJFB 2QL5B 3KJNB 3SIPB 4ZVQB 1RHMB 4LSZB 2XZTB 1PYOB 3R6LB 2Y0BB 3D6FB 2CNOB 5K20B 1SC1B 4ZVSB 2H54B 1SC3B 1RHJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2M B;  2C2K B;  2H4Y B;  2QLJ B;  1RHK B;  1RWV B;  3R7N B;  2QLB B;  4ZVT B;  2H51 B;  1RWX B;  3D6M B;  1BMQ B;  3IBC B;  3R5J B;  3KJQ B;  2XZD B;  3D6H B;  4ZVR B;  2CJX B;  1RHR B;  2CNL B;  2C2O B;  1IBC B;  4ZVP B;  2HBY B;  2XYP B;  2CJY B;  2QL7 B;  4ZVU B;  1GFW B;  5IC6 B;  3R7S B;  1RWP B;  3EDR B;  1ICE B;  2XYH B;  3NS7 B;  1I3O B;  1RWM B;  1PAU B;  4DCP B;  4DCJ B;  2CNN B;  2CNK B;  1RHQ B;  1RE1 B;  3QNW B;  2H65 B;  3P4U B;  1F9E B;  4DCO B;  2P2C B;  2Y1L B;  3P45 B;  1RWN B;  2H5I B;  1I51 B;  1RWK B;  1RWW B;  1SC4 B;  2FQQ B;  2HBQ B;  2H5J B;  2H4W B;  3GJQ B;  2C1E B;  2CDR B;  2QL9 B;  2C2Z B;  1QTN B;  2XYG B;  1QDU B;  2H48 B;  2HBR B;  1RHU B;  4ZVO B;  2HBZ B;  3GJS B;  3R6G B;  3EDQ B;  3RJM B;  3IBF B;  3GJT B;  2QLF B;  2DKO B;  1NME B;  1RWO B;  4JB8 B;  5IC4 B;  3GJR B;  3R7B B;  3KJF B;  2QL5 B;  3KJN B;  3SIP B;  4ZVQ B;  1RHM B;  4LSZ B;  2XZT B;  1PYO B;  3R6L B;  2Y0B B;  3D6F B;  2CNO B;  5K20 B;  1SC1 B;  4ZVS B;  2H54 B;  1SC3 B;  1RHJ B; 
#chains in the Genus database with same CATH topology
 2U1A A;  1TKZ B;  3OR2 A;  3R27 A;  2F3J A;  4I2Q B;  2BJD A;  4ZMM A;  3HT0 A;  3W5X A;  1U8S A;  2OFH X;  4DV7 F;  2NZ4 A;  4JV2 A;  4MFB B;  2M9K A;  5CCL A;  1VLY A;  3O1L A;  2DEJ A;  3IN5 A;  3OW2 R;  1QUV A;  1MWZ A;  2QIF A;  3SQO P;  1H73 A;  4Q8E A;  2MST A;  4WZQ A;  1DRZ A;  4G3I A;  3LP0 B;  1T9Y A;  1UWB A;  3T9Z A;  2AT1 B;  1FWK A;  4HLB A;  1H7X A;  4XTT A;  2HMI A;  4QW8 A;  1PJ7 A;  2O3D A;  4Q7A A;  2GZO A;  4KC5 A;  3MD1 A;  4FS2 A;  2R2S A;  3NGD A;  2K3K A;  4R8U A;  1U2C A;  1UP1 A;  5KFC A;  3KKF A;  1K44 A;  2X1G A;  4HYK A;  4JI6 F;  3CCT A;  1JJC B;  1X4B A;  3EVM A;  4ZJO A;  2YQ0 A;  1VRT A;  2G2Z A;  5EN1 A;  3HD1 A;  3K8V A;  1U1M A;  3R9L A;  2VA2 A;  1N0U A;  3PW2 A;  4LRD A;  4DQP A;  3FBF A;  4KGK A;  5K8P A;  2XMK A;  2VIH A;  2MKI A;  4LFA F;  3MM5 B;  4LQ9 A;  5EUH A;  3I9V 9;  4USK A;  4IRC A;  4CLS A;  2ZH3 A;  1RKI A;  1U2R A;  3QJP A;  4NA2 A;  2VQE J;  2VC0 A;  1GMW D;  1WEY A;  2XI2 A;  3FFI A;  3TQE A;  2NPI A;  5KFQ A;  3MM8 A;  3HKZ D;  1IBL F;  2H65 B;  3QT5 A;  1RSC A;  1NSK L;  1CEZ A;  1KVK A;  3DLL Q;  2XTJ P;  3DI6 A;  3QO9 B;  4BLG A;  4ILL A;  4OV6 A;  5LMN F;  4R25 A;  1YRX A;  1RCX B;  2N4C A;  4U67 Q;  2VDI A;  5KFY A;  1RAG B;  5KT7 A;  4GKJ J;  1D3W A;  1DTT B;  5F3T A;  3RRH A;  3DLK B;  2RU3 A;  2C2E A;  5G0R B;  2W2N P;  2NZC A;  2MMY A;  2YKN A;  3C6T B;  2BE7 D;  5EWG A;  4DSL A;  3QRQ A;  1NKC A;  3JQK A;  1LW0 B;  3VHQ A;  1S9F A;  5KFP A;  2HS4 A;  2G2O A;  1ACM B;  4KKO A;  3V6D B;  1LXN A;  5A6P A;  4USU A;  3OTC A;  4RU2 A;  2I6W A;  3BO4 A;  3OL7 A;  4O0I A;  2XS5 A;  4HAC A;  3QFH A;  3C46 A;  2RSQ A;  2WON A;  2B6A A;  4C8N A;  1Q16 B;  2WVF A;  2VFR A;  2GA7 A;  2HVD A;  5CYJ A;  2ZD1 A;  3ADA C;  5E2Q A;  4NLX A;  4DPO A;  4FF4 A;  3HCX A;  3KHR A;  5D4L A;  4YP3 A;  2HS3 A;  2X3G A;  1TL4 A;  1FJG J;  3T5H A;  1I94 J;  2J0X A;  1VRQ C;  2FHM A;  1FRH A;  2DNH A;  4ELT A;  2K8G A;  4JB8 B;  1DLO A;  3QAU A;  4JI3 J;  3FK4 A;  3JB9 k;  4DG1 B;  2G0I A;  1HQU A;  2Z30 B;  1H0H B;  3I0S A;  2Y0B B;  4ES1 A;  2VON A;  1DFD A;  2KXN B;  1X4A A;  3KXD A;  1REV B;  4J9M A;  3DKD A;  4CT9 A;  4K4V A;  3P49 B;  4USV A;  3R5J B;  4FBT A;  4JI0 F;  2N4D A;  3A8J A;  1NK8 A;  4DR6 J;  2F8E X;  3MM6 A;  3ZZP A;  3CCR S;  4QU7 A;  3OFE A;  1D8Y A;  2CAD A;  4DX6 A;  4C8M A;  1P9Y A;  2ZH1 A;  4GKJ F;  3CJ2 A;  4YDD B;  1FX2 A;  3OLA A;  4V19 J;  1G7C B;  2FB0 A;  4DSJ A;  1HNV A;  4DR3 J;  2VOP A;  1MRO A;  3UCZ P;  4TXS A;  1T11 A;  4QYZ K;  2XMV A;  4K7Q A;  2EG1 A;  2WW4 A;  3U02 A;  1MG7 A;  5F8M A;  2R7T A;  3OBI A;  3RB6 A;  3C15 B;  4ED2 A;  3P8B B;  2B51 A;  1RTH B;  3MAA B;  4F04 B;  3UN2 A;  4N5S A;  3A4T A;  4JI7 F;  4NLY A;  1JLF A;  4KH1 B;  4XDC A;  1X9S A;  4QBU A;  1HW8 A;  1EZZ B;  2FC8 A;  2HLT A;  1Q79 A;  5A8K A;  3NMR A;  2HGM A;  3OHB A;  2XY7 A;  4NWB A;  3IBC B;  5AJ3 F;  4NCB A;  2IDE A;  2D41 A;  3Q8U A;  1UZD A;  4OX7 A;  2QEX S;  4X62 F;  3DDN A;  4NYO A;  4Y28 C;  5GAD I;  4KFB B;  1XEZ A;  2CQ0 A;  2VUG A;  2Q1L A;  4IFY B;  1VQ8 S;  4L72 B;  5JMN A;  3OUY A;  2ZZN A;  3K57 A;  4JI3 F;  5B0C A;  3CD5 A;  3ET6 A;  4L75 A;  1LQ9 A;  5DM7 Q;  4A8F A;  1KS2 A;  4LF8 J;  1H6K X;  2GHV C;  4C3M A;  2XSJ B;  3MFI A;  4DN9 A;  5E3A A;  1NME B;  4RBT A;  3UI3 A;  4CDI A;  3GSI A;  4TKT A;  4P2F A;  5L1K A;  5EX3 A;  1ZM9 A;  2HAF A;  1APS A;  4I68 A;  1X4F A;  7FD1 A;  3HHL D;  1VIX A;  2IC3 A;  2HPU A;  2NSB A;  4BC7 A;  1JLQ A;  2R7R A;  3ZZY A;  4DR7 F;  2J8S A;  1JLB A;  4X4R A;  2IIH A;  2XMU A;  4CLU A;  2VKR A;  1VS3 A;  4C11 B;  9RUB A;  2DR8 A;  4ED1 A;  2BW7 A;  4LRB A;  1P27 B;  1HNW J;  3UD5 A;  3WC2 A;  3VVT A;  3BJY A;  3HFZ B;  1PCA A;  1S48 A;  4NEZ A;  2J7U A;  4RW8 A;  3DRY A;  1RHQ B;  3I9Z A;  3AT1 B;  5HSP A;  2MY7 A;  2OEJ A;  5RUB A;  5L9X A;  1UEU A;  2IRU A;  1Q95 G;  4RW9 A;  3RZA A;  4HDH A;  2XY6 A;  1KFS A;  1FI4 A;  2XQC A;  4IG3 A;  5E3Q A;  1CUL B;  4JYA J;  1XR7 A;  1JQG A;  1SKW A;  3R5G A;  4G65 A;  1S10 A;  4OMF G;  5ITH A;  1VOM A;  3F73 A;  3OFG A;  1IWA A;  4ECZ A;  1QJH A;  3VAH A;  3ITH A;  4YR2 A;  3DLJ A;  4A8Q A;  1S1U A;  2JDJ A;  3D68 A;  3C6U A;  3M6X A;  5KFD A;  3CDE A;  1L3K A;  1F2G A;  2MZQ A;  2ASL A;  5F8G A;  1UFK A;  2V5H G;  3LTO A;  3ZZR A;  1GXU A;  2Q43 A;  2YKP A;  1R8P A;  3TAR A;  4NYZ A;  4DPU A;  2Z4P A;  2QZ8 A;  3KHH A;  3NS6 A;  3ZNJ 1;  1TK0 A;  3DOL A;  2MLX A;  2RRN A;  1F0X A;  4ZP7 A;  3CCE S;  2CDQ A;  1D9A A;  1IBC B;  4TQR A;  2D7S A;  4ICL B;  5A76 A;  2HBY B;  4FXD A;  1X7V A;  1ZZN A;  1TUW A;  2YNH A;  4FPR A;  4TY8 A;  3IC1 A;  3M8R A;  3MCS A;  1SKU B;  4DCP B;  4L74 A;  5L38 A;  1NJI T;  3FSY A;  3P4U B;  5ETN A;  3CO0 P;  5DZ6 A;  4OX6 A;  1SL0 A;  4ED0 A;  2KDO A;  2Q6B A;  2FHJ D;  2KJW A;  2IM0 A;  3WIU A;  1U6B A;  1S57 A;  3K0J A;  2KH9 A;  3BGF A;  2GJF A;  4WE1 A;  2DNY A;  4ZLP A;  3PYG A;  2E9R X;  2HUR A;  5J2M B;  2XB2 D;  1S0V A;  4OIX A;  3R3T A;  4DPX A;  3G8T A;  4UOC A;  3DXS X;  1IXK A;  2Q66 A;  1GAO A;  3EM1 A;  1EET B;  3PHE A;  1BWV A;  2ROG A;  4LF6 F;  5LXR A;  3M2R A;  2DO4 A;  2FJX A;  4KGX B;  1C4A A;  2QMU B;  3TZX A;  4B3R J;  2VL1 A;  3TP2 A;  2DPI A;  2OSR A;  1N5T A;  2IJR A;  2ZBC A;  3AOC A;  3HUL A;  3H2L A;  4GVB A;  4JYA F;  1B0P A;  2WSC C;  1PKU A;  3CDA A;  2HWT A;  3ETM A;  2DH7 A;  1Q7L B;  1JLA A;  2XC9 A;  1RE1 B;  4TLQ A;  1E6Y B;  1KQF B;  4OFZ A;  1TFW A;  1N8R T;  4RNF A;  4P10 A;  2BQR A;  4M5D A;  4QWD A;  2NXU A;  3GG0 A;  3MEG B;  4Q0B B;  3UN3 A;  2G13 A;  4YY3 J;  3ILI A;  2VBW A;  2C2Z B;  5J2Q B;  3T9N A;  3F41 A;  4LF9 F;  1ARO P;  2NRE A;  4YB7 A;  4ZPD A;  4F0M A;  3AD9 C;  4JI8 F;  2KYX A;  5C25 B;  2ZM6 F;  5E0O A;  3A8E A;  4DPT A;  2HW3 A;  1LWE B;  3NGU A;  2FGO A;  3HVR A;  3T5L A;  2WBM A;  2Q3P A;  4ECQ A;  3EZU A;  2PE8 A;  4K5S A;  2JFD A;  5CYQ A;  4LBH A;  3OLB A;  2F4F A;  2EKN A;  1S6P A;  5IQ6 A;  4U95 A;  5KFN A;  1TP7 A;  4ZKA A;  4CO5 A;  3QRP A;  2PN6 A;  1TMM A;  4ALZ A;  4F4K A;  4WII A;  2E5I A;  1Q1K A;  5DGB A;  1WI8 A;  3KUE A;  1F3F A;  3GQC A;  1RT4 A;  1SC4 B;  3PEH A;  3I82 A;  1YJN S;  4NLT A;  1Y4Z B;  2R7X A;  1FXD A;  1FE0 A;  4W4M A;  2HBZ B;  4AYB D;  4DL2 A;  5F0U A;  2AX1 A;  5HJY A;  2C28 A;  2AF6 A;  2EFQ A;  2LXF A;  2HZV A;  1Y3K A;  3IRW P;  1VLO A;  3MED A;  2VFV A;  2R2U A;  3TYT A;  3LGN A;  1X0F A;  3IBW A;  5L1I A;  2RRB A;  4CZC A;  3CIZ A;  5E5N A;  1X31 C;  2VZ9 A;  2I5J B;  1JXV A;  2MZ1 A;  5I3U A;  4C8K A;  2E5J A;  1XQI A;  3HHL A;  2BMB A;  2IDL A;  2BJ7 A;  3BN4 A;  5LMU J;  4GVL A;  4OI1 A;  1S99 A;  3OFF A;  3GFY A;  3AJD A;  2G1D A;  2DGT A;  3WBZ A;  4B9V A;  1HW9 A;  1PYT A;  3UCG A;  4DR2 J;  4IO1 A;  1AZS B;  2YX1 A;  2GFF A;  1C1C B;  3DHW C;  5DG9 A;  2I38 A;  3W8G A;  1VQ4 S;  5HO4 A;  4F4Y A;  2V8G A;  2HHU A;  1JLC B;  1RAB B;  1A7G E;  1EP4 B;  1S9G A;  2ZFH A;  1X0P A;  5BR8 J;  3W2V A;  4X65 J;  3OR1 B;  1RI7 A;  1WTF A;  2PMW A;  4WFX A;  1U8W A;  2H9Z A;  4OZ3 A;  3T1A A;  3AB4 B;  3POT A;  1RYS A;  1S1X A;  2R8J A;  5KFZ A;  1FFW B;  2YWH A;  3HVA A;  1UW9 A;  3PEJ A;  4C0O C;  2JRS A;  3K5M A;  1N52 B;  4B3T F;  2PMH A;  4LIR A;  5AE1 A;  2MKJ A;  3I4H X;  2DHS A;  2ZC4 A;  1NHV A;  2EC2 A;  1XR5 A;  4MIB A;  1EKR A;  5L46 A;  4OI4 A;  4O4R A;  5DQG A;  4R5P A;  1M5S A;  1C2P A;  3N6M A;  1GMV A;  4DL3 A;  3DCA A;  4NX9 A;  4CO3 A;  2BJE A;  5HN0 A;  4QPX A;  4NLQ A;  1C0U A;  4K4S A;  3CDW A;  3QGI A;  4DR4 J;  2LQB A;  3G71 S;  2ILZ A;  4Z2X A;  4ZPT R;  2K3I A;  2GGP A;  4WU3 A;  3BSN A;  2DGX A;  1IBM J;  2KT3 A;  3JSM B;  4JV1 A;  1RWW B;  2ZE2 A;  3KLH B;  3IM9 A;  3TA0 A;  4MAK A;  4OJ3 A;  2JLE A;  5JJB A;  5C7P A;  3CCQ S;  3ZTP A;  4H4O A;  4CLL A;  3ETO A;  3HXM A;  4CRJ A;  2FLN A;  4IH5 A;  3W64 A;  2ASD A;  5MLC V;  1KWM A;  2R8G A;  1IJF B;  1R8C A;  5ETS A;  5KFX A;  1QAI A;  1T9X A;  1C1B A;  1BC6 A;  5F9N A;  4K2X A;  2FZC B;  2P6T A;  1NRK A;  2DY1 A;  2HHH J;  5SUH A;  4KJI A;  3QBC A;  3PY8 A;  2OH2 A;  3P6Y C;  4DV4 F;  2ZBP A;  3J7Z T;  2CZV C;  3A1Y G;  2CJK A;  4I0W A;  2UV8 A;  3D6H B;  3AFG A;  1NUE A;  3QLH B;  3HO1 A;  2X1F A;  3QWP A;  2LLZ A;  2OEM A;  2OD6 A;  5FII A;  1IQT A;  3JXO A;  3OXL A;  3H7H B;  1PC5 A;  3L95 X;  2DHH A;  3AOB A;  4J9N A;  5LSR A;  4LF1 A;  2EI5 A;  1V9O A;  2BAB A;  1N34 J;  1R7I A;  1BE4 A;  2ATC B;  2H48 B;  5DQH A;  1VQN S;  3TOQ A;  5B0D A;  2Z57 B;  5IC4 B;  4Y2M A;  1HPZ B;  4B9T A;  4EZ9 A;  1NM2 A;  2W1B A;  3IO1 A;  1FES A;  1O8B A;  2DD8 S;  1WI6 A;  4GO7 X;  1S1W A;  1FER A;  4U96 A;  5D0H A;  1Q4R A;  5GAE I;  3UQS A;  3NOC A;  1QSS A;  1UET A;  3TJ8 A;  2J0W A;  3B82 A;  4NPO A;  2H1Y A;  1UAW A;  4Z7Y A;  2F8M A;  3RW6 A;  3D0I E;  2C2O B;  4HH1 A;  1N32 J;  4MK8 A;  3UDE A;  4HH0 A;  4TNO A;  4B3M J;  3EDR B;  2R4F A;  3PRV A;  3H2V E;  2BBE A;  1NK9 A;  2C2R A;  5FLX Y;  1L5U A;  2AHO B;  4DV5 F;  2N82 B;  4LF7 J;  4OYM A;  2XNR A;  2DY9 A;  6FDR A;  4N77 A;  3SQG B;  3ZFV A;  1DTQ A;  1IKV A;  1HL6 A;  5THW A;  3CJS A;  4RW7 A;  2VG5 A;  3N0V A;  2W7P A;  3IRX A;  1RT2 A;  3KHG A;  1OSC A;  3FVY A;  5KT5 A;  2HHH F;  2DGS A;  2HNZ A;  1HNI A;  3VVU A;  1LV5 A;  4YN3 B;  2QTW A;  4H4M A;  3KJF B;  2U2F A;  4LRC A;  4O4G B;  3SIP B;  3WDO A;  1XMO F;  4QIG A;  2BUN A;  2K2P A;  1KQG B;  2EFV A;  3VZI A;  4NLW A;  2YWW A;  4UW2 A;  4UOH A;  1NHU A;  3I5C A;  2N3L A;  2EFG A;  4ZLN A;  4YR3 A;  3G82 B;  3K5P A;  1RT1 A;  3VCD A;  2RDJ A;  3AB2 B;  1HWJ A;  4IUF A;  3UWT A;  2CNL B;  1U1Q A;  1UWB B;  3NNC A;  2AV5 A;  5KFS A;  2GCF A;  2YNI A;  2AWZ A;  3VGU A;  4DBQ A;  4MYU A;  3MEC A;  3HSZ A;  2C3O A;  2V9K A;  4DUY J;  3SFG A;  3TJA A;  4R8U B;  1YRU A;  5KFE A;  1M1G A;  1R6Y A;  3MR5 A;  2E44 A;  2MQQ A;  5T7L A;  1VRT B;  3DMJ A;  4ZDN A;  4YHH J;  1Q8L A;  1ELO A;  4NLR A;  3TR5 A;  2LQ5 A;  1NDC A;  1FKP B;  1FVS A;  2MY8 A;  1R0B G;  1N33 J;  1FVQ A;  1N32 F;  4ED4 A;  2XLK A;  1RDR A;  2HWI A;  2RKI A;  4B3M F;  3HLU A;  1QY7 A;  4CNZ A;  1TL7 A;  2MKC A;  2OIH A;  2C42 A;  4MKY A;  2B9W A;  3MM8 B;  1FFS B;  4X4V A;  2WCX A;  3C16 A;  4F25 A;  5HAN A;  5JXS A;  2V2K A;  5CCM A;  3AXK A;  3DLE B;  3S6E A;  3DI6 B;  1MW7 A;  4JV5 J;  3KLF A;  3CE8 A;  5E3R A;  1NH8 A;  4ER8 A;  2OO4 A;  1A9N B;  1UA0 A;  2RQC A;  4ZVG A;  1T02 A;  2CFX A;  1KRP A;  4XIU A;  1OJ4 A;  4ECW A;  4M94 A;  3DNC A;  2DGQ A;  1NSQ A;  3QIP A;  4NL5 A;  2GO9 A;  3A3N B;  3C66 A;  4I2P B;  5HMY A;  2BKP A;  1N6Q A;  5LJ3 Y;  3B4M A;  2YKN B;  3GJT B;  4PQU A;  2KZM A;  1RT5 B;  2WB4 A;  3E2E A;  1NJZ A;  1DY3 A;  1OS5 A;  2A3J A;  4HHH A;  3OTD A;  5KFJ A;  4OX8 A;  3KLG A;  1SC1 B;  3M1V B;  2ZHA A;  1W25 A;  1RT7 B;  3D9B A;  1MWY A;  4EEY A;  4ECT A;  3Q24 A;  4NI2 B;  5F8I A;  3KLE B;  2P8I A;  2ZD1 B;  4HDG A;  4DV0 J;  2YVS A;  2G1H A;  4LRF A;  1X4D A;  3G8Q A;  2ZBQ A;  4M95 A;  5FLX U;  4O3N A;  2VPZ B;  5IC6 B;  1QE1 B;  1SXL A;  1CJT A;  4YHH F;  1ITP A;  3MTJ A;  1RAF B;  1WHV A;  5B0A A;  1RWM B;  1L3S A;  1RBA A;  3MUV P;  1BD6 A;  3UDL A;  4JI1 F;  5HQM A;  3U27 A;  4ZP9 A;  5D77 A;  5D4O A;  5LM7 E;  2DB1 A;  4UY8 T;  1N33 F;  2Y8W A;  3TAQ A;  1WF2 A;  4IO9 Q;  2JX2 A;  1HQU B;  3OJS A;  3TI0 A;  3IBF B;  1OYE A;  3M8Y A;  5AT1 B;  1FK9 A;  2B43 A;  4O23 A;  3A13 A;  3T1H J;  5L39 A;  1WEX A;  2N3O A;  1AXQ A;  1MMN A;  4DV3 J;  4CWB A;  3W1Y C;  2W4P A;  1FDA A;  1IM6 A;  1M1K T;  1LXJ A;  2AEM A;  3RBE A;  3OVA A;  3MM6 B;  2CQD A;  4I6A A;  2PII A;  4ZP6 A;  3SSQ A;  4Z37 A;  2WBR A;  4N41 A;  2L3M A;  3O44 A;  4EU0 A;  2V8V A;  4L3K A;  1SL2 A;  4NCG A;  3UFC X;  1RHR B;  5F8J A;  4ANE A;  3RGI A;  4KHP F;  1HNV B;  3I5B A;  4DV6 J;  4X2B A;  1F5C A;  2QT7 A;  3GON A;  3AOD A;  3BH6 B;  1ZM4 A;  2AJ0 A;  3DHX A;  5LL6 d;  1FE4 A;  2CAJ A;  2GHP A;  2Z56 B;  1L3T A;  4K4T A;  1WUU A;  1SUQ A;  3PX4 A;  3OSP A;  1LWX A;  3NBP A;  3QQC D;  3EJM A;  3PKM A;  2ADC A;  1YJV A;  2RQM A;  2L9W A;  4LRA A;  5HVG A;  1QSY A;  1FTR A;  3MD3 A;  1S0N A;  3H2U B;  2AYG A;  2CUY A;  3GB0 A;  3Q8P B;  2DNQ A;  2BQ3 A;  4DV0 F;  5A8K B;  3MMA A;  1RK8 A;  1KBR A;  4KR0 B;  1FD8 A;  2VDH A;  3QSY B;  2W24 A;  3IAS 9;  1SC3 B;  4BBY A;  3PR4 A;  2UUC F;  1VHF A;  3C14 B;  2C2K B;  4J9Q A;  3M9O B;  3BR8 A;  3LO3 A;  4C97 A;  2HNY A;  4DQI A;  5HBM B;  2DXF A;  1HBU A;  5CAB A;  4F8R A;  3AJ1 A;  3KG0 A;  2Y1R I;  3HVT A;  2CQ2 A;  4Q43 A;  2R7U A;  5EDW A;  1S0M A;  5HP1 B;  3JTN A;  1DQ9 A;  2DO0 A;  5E33 A;  2UP1 A;  2IM2 A;  1VFJ A;  4OJG A;  2DPJ A;  2QV6 A;  3U7J A;  4YOE A;  3TNV A;  1RTI B;  2JSX A;  5HMX A;  2UUW A;  4D3H A;  3CT9 A;  2BM1 A;  1GXT A;  4M63 A;  2V9W A;  3T19 A;  4W98 A;  2IC3 B;  2MZR A;  2QX0 A;  5LOQ A;  1JLQ B;  1HBO A;  2PMZ D;  1CJV B;  4MKV A;  4WP9 A;  1PYS B;  2K1R A;  1JLB B;  3JQM A;  4F4X A;  5HRO A;  4LR9 A;  3T5K A;  4K4U A;  3ONQ A;  4RW4 A;  1R27 B;  4DV6 F;  1UJ6 A;  4YUD A;  4GMK A;  1I1G A;  2AD9 A;  5T14 A;  2IRX A;  3Q2S C;  2P5V A;  5KTQ A;  3TWZ A;  4LVN P;  5D6G A;  1JJ4 A;  1B7F A;  2AJ4 A;  4RW8 B;  1HNX F;  2E5L J;  3CCM S;  1PGZ A;  3N9U C;  1U47 A;  3H5S A;  3ZNU A;  3TAM B;  4BHQ A;  1VK3 A;  3ENQ A;  3UNG C;  5K14 B;  1NJX A;  2Y9H A;  5HQL A;  3SXL A;  2NXE A;  2HVI A;  1FHT A;  4ANC A;  1IJE B;  1SB6 A;  4OHX A;  1PIL A;  4P7T A;  4IH7 A;  4Q2L A;  5C2G A;  2UUA J;  2UU9 J;  3DRP A;  4K0K J;  2VU5 A;  2F9J A;  4O44 B;  3CTR A;  2HVE A;  3BQ2 A;  2XLI A;  4KYZ A;  2CYY A;  3MM9 A;  3C6U B;  1RCO B;  2I2Y A;  4IRD A;  1QDU B;  5DDO C;  2W9A A;  3W5Z A;  3LA0 A;  1S79 A;  3D54 A;  3HI9 A;  2A2C A;  1FA0 A;  2UXB J;  3EVW A;  1E6V B;  4MKA A;  4OYP A;  4AND A;  2KRB A;  4ILM A;  4OZN A;  1VK8 A;  3ZXW A;  2BJ3 A;  5KT3 A;  4PAB A;  4Q8F A;  3EPG A;  4IR9 A;  1OYD A;  3OV7 A;  1CVJ A;  1DHM A;  5B0F A;  4DFP A;  6AT1 B;  2YX7 A;  3CCL S;  2HFO A;  2QLB B;  4OHV A;  2H51 B;  3KJQ B;  3G6E S;  2KM8 B;  2PSZ A;  3SSS A;  3CMQ A;  3MEK A;  1U49 A;  1U0S A;  2EC0 A;  2RDI A;  5B0B A;  4C0H A;  2O5D A;  2R7Q A;  2ZVS A;  4ID5 B;  3D66 A;  4F4Z A;  2LVW A;  2LEA A;  2XMA A;  3TX0 A;  4WE1 B;  1HQE B;  1T3N A;  2NYI A;  4NZ6 A;  2RD5 C;  2CPY A;  1XJW B;  2F7V A;  3HM9 A;  2OD4 A;  3O3L A;  3NKY A;  3IP0 A;  3SFU A;  3VAF A;  2CQ3 A;  4CT8 A;  4X66 F;  1N5S A;  1Y5I B;  3Q0A A;  3PW5 A;  2RDD A;  2KVI A;  3CJ5 A;  2ZUG A;  2QLF B;  3Q23 A;  2OLW A;  1CBK A;  1Q8I A;  1HHS A;  1LNQ A;  1XBW A;  1PBA A;  1JXL A;  1JK9 B;  4CH1 A;  2VG6 B;  4IQX A;  1QAY A;  4NYP A;  1FEH A;  1R8A A;  4FF2 A;  2OP5 A;  4GVB B;  5K8O A;  2GVD B;  5A8R A;  5CD4 A;  4FS1 A;  2VHG A;  2LQ9 A;  1RWV B;  1VBY A;  1WF0 A;  3MAQ A;  2WVC A;  1Q86 T;  4K0K F;  3UPF A;  2DH9 A;  3EWG A;  2KL8 A;  3PTW A;  2QLX A;  1U02 A;  1FTC A;  5ETK A;  1M5V C;  3MMB A;  1TUG B;  4O3S A;  1O51 A;  1HHQ A;  1UTA A;  3QNW B;  3MR6 A;  1PJ5 A;  2BYC A;  2RU9 A;  2DNO A;  3OD2 A;  3OXF A;  4XPE A;  4GKK F;  4LFB F;  2JEI A;  4TU9 A;  2BE2 A;  2NSC A;  2BOA A;  4EYI B;  2DR7 A;  2MQP A;  4JI5 J;  2AEJ A;  4X64 J;  4ED7 A;  2YH1 A;  3W2W A;  2IHR 1;  2VFT A;  1F9F A;  3PO5 A;  4DUZ J;  1RAI B;  3SCL E;  2HK2 A;  4LSN B;  1IWG A;  1S6P B;  1UPM B;  4USW A;  2FTR A;  5CH7 B;  4TLR A;  2V8D A;  1TUV A;  5KG5 A;  3EGN A;  4IOA Q;  2K7J A;  4ZVP B;  2E7W A;  5JVG Q;  3GV8 B;  1GEH A;  1RT4 B;  1Q5Y A;  2W25 A;  2KRR A;  3FEZ A;  3W62 A;  2R2R A;  1YBT A;  4NLS A;  3DLH A;  3FMB A;  1YIJ S;  4IKA A;  1TKT B;  5AE3 A;  3R5D A;  3N6L A;  2MXY A;  1S97 A;  4F26 A;  2DIS A;  1RAC B;  3EZO A;  3MED B;  2CQI A;  5HVH A;  2C1E B;  3KUG A;  5I42 B;  4C4W A;  2B3T B;  3D67 A;  1VRU A;  2OMO A;  2LEC A;  3E8O A;  1S72 S;  5I3Q A;  1S0O A;  3R8Y A;  3HHL B;  2XCA A;  2XO6 A;  1FRK A;  1WTB A;  2VF3 A;  4B08 A;  2RB7 A;  5BJR A;  3N01 A;  3J81 Y;  4WP3 A;  2E29 A;  5HLF A;  2JEJ A;  2VB6 A;  3FNN A;  4DR5 J;  3LP1 A;  4K4Y A;  2WAQ D;  4MKB A;  3FSI A;  2HHP A;  3R7N B;  2GQ2 A;  1WC3 A;  3KOA A;  2IYG A;  4E98 A;  4O3P A;  1M0S A;  3RTV A;  3QT8 A;  4EBC A;  2DXE A;  4N8N A;  3FSX A;  2VG7 B;  3PIP Q;  1RWP B;  3CJK A;  3RRG A;  1N36 J;  5K5M A;  1BQM A;  3W2V B;  4CLK A;  2DNK A;  2UXD J;  2F8H A;  5KFV A;  1EB0 A;  4OQJ A;  2KN4 A;  3QT7 A;  2V2Q A;  2DIU A;  4U7U K;  3R2C J;  3BQ0 A;  2DR9 A;  1RQ0 A;  3LH2 S;  3HFK A;  4D3G A;  4KHR A;  1OQ3 A;  3POT B;  1WOP A;  2QL9 B;  2ZUA A;  3M05 A;  2AYB A;  4I7F A;  1CJK A;  4M5G A;  1EIY B;  3AQO A;  1RAA B;  1IBK F;  4AD6 A;  5ETO A;  1M5H A;  1HR0 J;  3VZH A;  1D9D A;  2KFZ A;  3L7U A;  1X5P A;  4NXM J;  3W9H A;  1M1H A;  1U0H B;  4BC9 A;  3HD2 A;  4USM A;  1HAR A;  3SSR A;  2BJ8 A;  1T3O A;  1TQL A;  1HWI A;  2YKA A;  5LJ5 Y;  1IKX B;  1P8G A;  3DU5 A;  1C0U B;  4N7T A;  5B0E A;  3EE3 A;  2L41 A;  4J9L A;  2GJ2 A;  2PFD A;  4LSL A;  5DS7 A;  2GAH C;  4ZVR B;  3NLC A;  2LDY A;  1TL5 A;  2OHD A;  5G4D A;  1T05 A;  4U7C A;  4F67 A;  2ZE2 B;  3DDK A;  2DR6 A;  5IM0 B;  1NU4 A;  3DRR A;  3MF5 A;  3TZW A;  2C3P A;  2HZC A;  5F8N A;  1YWX A;  1WNE A;  1WSR A;  4ZLL A;  3NGR A;  4NLD A;  5HL7 Q;  1HBN B;  2NCK L;  1U2F A;  1G2E A;  3S7R A;  2D69 A;  3CCV S;  2ZWO A;  1TVR A;  4DR5 F;  3CC4 S;  1N0V C;  5KFI A;  2GVZ A;  3MEE A;  1X5T A;  2ACM A;  1FKA F;  5KOX A;  1YBU A;  1F9H A;  2WHO A;  3NGK A;  2UV8 G;  4MYT A;  5A8W A;  3X3U A;  1R8B A;  3QPI A;  3D1Q A;  1N48 A;  4JP8 A;  5KOW A;  1WOO A;  1S1V A;  4OJ1 A;  3OSN A;  3OTB A;  2YNF B;  4RKU C;  2B4U A;  1TFY A;  2VQF F;  3NAI A;  3CPW R;  3H90 A;  2F4V F;  1MN7 A;  2M8H A;  3TVZ A;  4ELU A;  4RUA A;  3V4I A;  2NUH A;  4OHY A;  2DVI A;  4NE9 C;  3Q2T C;  1TL3 B;  4L3N A;  3TUZ C;  2YPZ A;  1WHX A;  5KFR A;  1FJ7 A;  4LRE A;  5EHH A;  3OXG A;  2IJN A;  3LP2 A;  4LFC J;  3DM2 A;  5CHC B;  3VQT A;  1KQS R;  1BLU A;  2R7V A;  3ZTO A;  2XS2 A;  8RUC A;  3KK1 B;  1B4S A;  3D2W A;  2OEK A;  3UO0 A;  1RP5 A;  4A46 A;  1TKZ A;  1S4E A;  4PPD A;  4NXM F;  4CM0 A;  4PG7 A;  3B8H A;  1CQN A;  4PR6 A;  5D4N A;  4PRF A;  4MFB A;  1BHN A;  2V6A A;  3UVJ B;  2R7O A;  4R0E A;  2ZOF A;  5A0Y A;  1QVG R;  3GV5 B;  1FRI A;  2JEG A;  4RJV A;  3J81 U;  3QMQ A;  4NA3 A;  3CF5 Q;  1WDT A;  4LR8 A;  4FNH A;  3JTP A;  3LPE A;  1I5O B;  2UUT A;  2QA2 A;  2ZBI A;  2ADB A;  1VQY A;  4YS2 A;  1YX2 A;  3R1H A;  1IR1 A;  3Q8S B;  2JOQ A;  4K4W A;  1WEZ A;  2FZG B;  5AXK A;  2ZH2 A;  3RB0 A;  3D7S B;  1DTQ B;  1C0T A;  4RW7 B;  4ECS A;  3L09 A;  4CLZ A;  4S0M A;  3NS7 B;  3M8Q B;  2HNZ B;  1HNI B;  1T9T A;  3JQJ A;  4LF4 F;  3DOK A;  3VV2 B;  2HFZ A;  3GCW P;  4OL8 A;  2F65 A;  1AA1 B;  3KNG A;  2CDR B;  2EBG A;  5L8R C;  4CM2 A;  3I6P A;  1WC1 A;  3H59 A;  1SH3 A;  1RT6 A;  1I6J A;  2XI3 A;  2LFV A;  2HQ3 A;  2DKO B;  1RA6 A;  5CAA A;  5AXN A;  1WC5 A;  2AMC B;  2HEK A;  1ZET A;  1QAX A;  1Z2Z A;  2XCP A;  1SIZ A;  4DL4 A;  3I55 S;  4WXO A;  1W7W A;  5KFL A;  4JI6 J;  1NJW A;  4ETX A;  4K59 A;  3K2Y A;  2MTL A;  5J1E A;  4HKQ A;  2K06 A;  3JYT A;  1GX6 A;  3EZ5 A;  4FZV A;  1FX4 A;  4CTA B;  2HQG A;  3QID A;  2YNI B;  1WAC A;  3HZE A;  3MEC B;  4NLO A;  4LFA J;  3M8P A;  3DLB A;  2VFU A;  2BR0 A;  2GIQ A;  4RL1 A;  1HA1 A;  2MZJ A;  4AFF A;  3T3F A;  2N7Y A;  2B4V A;  1DTT A;  4LIW A;  1ZZF A;  1Q8K A;  2VPX B;  5C42 B;  3KJV B;  5G0R A;  4H54 A;  1LFP A;  3IM8 A;  4FNI A;  3DMJ B;  1NK6 A;  3C6T A;  2P2C B;  4DSF A;  3OQ2 A;  4PAA A;  1TK8 A;  4C8L A;  1KN6 A;  1FF2 A;  1LW0 A;  3AD7 C;  1IBL J;  4R0J A;  1TR0 A;  3NOG A;  1RWK B;  1PJ6 A;  5JUM A;  5EWE A;  4PG4 A;  3I31 A;  4K50 A;  4WFZ A;  3M2V A;  4PWD B;  3V6D A;  1RTZ A;  3L9Z A;  5LT5 A;  4N56 A;  4U9R A;  5LMN J;  2BEF A;  1LWC B;  5E41 A;  1U1O A;  1UJ4 A;  3IS9 B;  4RLE A;  2YWF A;  4OI3 A;  1X5S A;  2RHQ B;  4OHW A;  4NEY A;  1MML A;  2G9O A;  4OX9 F;  2AIR B;  2MQO A;  3M6W A;  4E2F B;  3PZP A;  5IS2 A;  2IVF B;  3S01 A;  2R7W A;  3LWL A;  3EXY A;  1N88 A;  2ZOG A;  3KLF B;  5T41 A;  1EQ0 A;  3G86 A;  3TO8 A;  1R43 A;  1GTE A;  5F41 A;  1CPZ A;  3J7Z 5;  1Y00 A;  3IGN A;  4F3M A;  1UVL A;  1NSA A;  2M4M A;  3CME S;  2LQJ A;  2Q6C A;  2RVJ A;  2XY5 A;  4J91 A;  4A8K A;  1T03 B;  2GO8 A;  4PCQ A;  1R6V A;  4PQU B;  4DN0 A;  4DZ6 A;  1DUR A;  1REV A;  3B54 A;  1PSD A;  4KQZ A;  1B0V A;  3VAJ A;  1HMV B;  1FRX A;  2HHQ A;  1U1N A;  4G1I A;  4OZ1 A;  3CJR A;  3KLG B;  3US5 A;  4DX8 H;  1NKB A;  3AA9 A;  3IA0 A;  4C98 A;  1CG2 A;  4X4O A;  3GIL A;  2E9T A;  1VQ6 S;  4RPF A;  5E3C A;  3K5L A;  2KB2 A;  3NCP A;  1VQ9 S;  5KFW A;  2EG2 A;  4NZ7 A;  2MKH A;  3PXG a;  5B7W A;  3PO4 A;  1ULR A;  3ELH A;  3QAE A;  2RAQ A;  4PYA A;  2HHX A;  2ZKT A;  5DG7 A;  1HBM B;  3CC7 S;  1LWF B;  1NB2 A;  5IT9 Y;  1PC4 A;  2CVE A;  4DR1 F;  9ATC B;  3N6N A;  4ZP8 A;  4JI0 J;  4PXD A;  1RTH A;  5KFF A;  3MAA A;  3MZI A;  1HHT P;  2RIL A;  2A0F B;  1TKX A;  4OYI A;  5IXU A;  3EMT A;  2KG0 A;  3P5T L;  2BA9 A;  2BDP A;  2MSS A;  3NAH A;  4MMO A;  3BB5 A;  3P45 B;  3E01 B;  2LQ8 A;  3K58 A;  1QTM A;  1XTZ A;  1ZPW X;  3LOU A;  4URQ U;  3UN5 A;  1RXO B;  3X1L B;  2BV3 A;  3MPD A;  1M5O C;  4RNM A;  1F6T A;  3O8W A;  3H20 A;  4DS5 A;  4RNN A;  4HHJ A;  2KKH A;  1SQF A;  4KFB A;  1UVN A;  2CPZ A;  4F4W A;  3RG6 A;  4DFK A;  1DZ5 A;  4EUV A;  1UWA A;  2QA1 A;  2HSE B;  4JI7 J;  4CH0 S;  4AE5 A;  1AUD A;  4QR0 A;  5MAO A;  5KFA A;  1OY9 A;  2UZA A;  2CQP A;  2QG9 B;  2QMX A;  4B9N A;  4QIE A;  5GAH I;  3I56 S;  5D0G A;  1VJW A;  5AJ3 J;  5CYM B;  2ZH7 A;  4X62 J;  2XWX A;  1YZ6 A;  2R7S A;  2JC0 A;  4USJ C;  5D0E A;  2FY1 A;  1AUS L;  2KM8 C;  4F2R A;  2FLO A;  2J6U A;  4JI2 F;  3GIK A;  1SQE A;  3M8W A;  4RZR A;  4JI4 F;  2YKO A;  3W66 A;  4C8Z A;  1F1B B;  2J9E A;  2KO1 A;  4C11 A;  1NH7 A;  2PO4 A;  3RR7 A;  2CQ4 A;  2IVY A;  2OAU A;  4QCL A;  5ETT A;  1XMQ F;  2P6S A;  2KZZ A;  5ETP A;  4UF4 A;  3W7B A;  2RE1 A;  2HNY B;  2W01 A;  3M2U A;  3IXQ A;  4KPC A;  2J7K A;  3NNH A;  4PG6 A;  3V81 B;  2VPW B;  4ZHR B;  4OHZ A;  2J9D E;  1SBR A;  4OYB A;  5GAH U;  2M52 A;  2EK1 A;  1WG1 A;  1V3Z A;  1CUL A;  3SCK E;  2VPY B;  1S1T B;  4F3O A;  3QJL A;  3VAK A;  2BZ2 A;  2MKY A;  4DR7 J;  1ZOT A;  3D6M B;  3JS9 A;  4J90 A;  4ZN3 A;  3FZB A;  1FDN A;  2AEF A;  3QGH A;  5BYR A;  2ZH4 A;  3CD0 A;  4GRS A;  1FRM A;  4MIA A;  3CJT A;  1WHY A;  2C3U A;  2W4D A;  2FVP A;  3WZ0 A;  2MDA A;  2W7A A;  4TYA A;  4ID8 A;  5KT4 A;  1URN A;  3W9I A;  4IDK A;  4I56 A;  8ATC B;  3OT9 A;  3PFO A;  3TA2 A;  1B7Y B;  4ZCL A;  1LOU A;  2HGN A;  4AT1 B;  1Y9O A;  3GJS B;  3H4D A;  3LPY A;  4U6P A;  4ICL A;  2HLU A;  2ZDP A;  2QGF B;  2A1B A;  1B99 A;  4DS4 A;  2CKW A;  2WZ1 A;  4QWE A;  3GLJ A;  2JZ5 A;  2V2V A;  4IG0 A;  3MPV A;  4IR1 A;  4DX7 A;  3PIO Q;  3AA8 A;  1VR6 A;  3FBC A;  4WZM A;  5L1J A;  5IT9 U;  4JV0 A;  1N5Q A;  1IR0 A;  4IH6 A;  4RWX A;  4K2J A;  4DV2 F;  1FKO B;  4AQY F;  2B0G A;  3W60 A;  3DRP B;  2RF2 B;  1YJW S;  2HND B;  4EK2 A;  3EGV A;  3D0H E;  1EET A;  4RW6 B;  4HT7 A;  3A3P B;  1RU1 A;  3HMJ G;  4CIO A;  2HGL A;  1MLA A;  1Y0H A;  2C22 A;  1RWN B;  4X84 A;  2VD3 A;  1NHK L;  2IAJ B;  3DYA B;  1U45 A;  1RTJ B;  2GQC A;  1V5V A;  2M0G B;  3Q8Y A;  1UZH A;  2BJ1 A;  4FYW B;  1JB0 C;  3BO2 A;  1KVJ A;  2FJE B;  2GC8 A;  4IOB A;  1V3R A;  5D0R A;  5GAD U;  3R1L A;  4F36 A;  3PCO B;  2B7B B;  1WC4 A;  2XZT B;  3O5T B;  1E6Y A;  2XGP A;  1REG X;  3GFZ A;  2VOD A;  2YQ3 A;  3MEG A;  5E7O B;  4LF6 J;  2FJD B;  3PG9 A;  3HHL C;  2CVI A;  2L9D A;  4E8U A;  5BYQ A;  4ITS A;  3IG1 A;  1LW2 B;  1SPB P;  2X1A A;  3CC2 S;  5F9L A;  5D78 A;  1OIA A;  2XYH B;  5C25 A;  1LWE A;  1VGY A;  2UXC F;  1JWW A;  3K8W A;  4NXN F;  2DIT A;  1TK5 A;  2XNQ A;  5KFK A;  1YIT S;  4DCO B;  3DOM B;  2YQ1 A;  2JJ4 D;  2LP4 A;  2CZ4 A;  3IR6 B;  2QE5 A;  2V4Q A;  1Q82 T;  2QJ3 A;  4L6V 3;  4ZVO B;  3BZQ A;  3R6G B;  2EKY A;  2E1C A;  2KU7 A;  2WVB A;  3M8S A;  1BQN A;  1P9Q C;  2LDI A;  4CNY A;  4UZC A;  1S7H A;  3OPK A;  4LF9 J;  3LGH A;  4PWU A;  2E66 A;  4DMZ A;  2RQ4 A;  3KNA A;  4JI8 J;  2ZM6 J;  3DGP A;  2VA3 A;  1RBL A;  1IUJ A;  3LAK A;  3RUB L;  4GO5 X;  3HJF A;  3MMB B;  2EW9 A;  3PW0 A;  3DLG A;  2GMH A;  2YXL A;  2LA4 A;  5DDR C;  4Y6I A;  1RJJ A;  1JLE A;  2D74 B;  2XZW A;  2FZK B;  5KG7 A;  3KK3 A;  2YKM A;  2EFP A;  2ZC3 A;  2BE2 B;  1QUP A;  1S6O A;  4RWW A;  2V8H A;  4Y3C A;  4A8M P;  3CCU S;  5K8N A;  3NP5 A;  1OY6 A;  5J1P A;  2Y1L B;  4M5K A;  1U7L A;  1G1X A;  2NLW A;  1F5A A;  3Q86 A;  2GNK A;  4L76 A;  1CS4 B;  3RAM A;  1JIH A;  2UUB F;  2YX4 A;  4QIW D;  4HI2 A;  2WSF C;  4X4Q A;  4Y34 A;  2O01 C;  1SH2 A;  3MPU B;  4Z7C A;  2GJI A;  2X3D A;  5SZT A;  1AZS A;  4RNO A;  3LW5 C;  3KMS A;  5DGA A;  1C1C A;  4M5M A;  1R0A A;  2Y3Y A;  4ZIW A;  3O6Q A;  4CP5 A;  5GAG I;  3N4W A;  1X4C A;  2CZ9 A;  1JLC A;  5J2N B;  3GR1 A;  1EP4 A;  1FNO A;  3LAM A;  2BJ9 A;  2HQD A;  1WDD A;  4DF8 A;  3OR1 A;  2RIJ A;  1GXL A;  1N54 B;  2KHD A;  2XUL A;  2V94 A;  4WYL A;  2XYP B;  4ZJQ A;  3AQP A;  2QL7 B;  4A8Y A;  3CCW A;  1HNZ F;  2XHC A;  5LXY A;  1ZBT A;  1I3O B;  3EIC A;  5I4M A;  2HRU A;  2CA9 A;  2D3U A;  1S76 D;  3EGZ A;  5D3G B;  5FDL B;  3PW4 A;  2COL A;  1TAQ A;  3PYD A;  4GC7 A;  4Y2C A;  4C3L A;  2VBY A;  1EAY C;  1O0P A;  1ZM3 A;  1UFL A;  4NLV A;  3ILL A;  4KGM A;  3LP1 B;  3A12 A;  2GIR A;  3MMC A;  4KE5 A;  1L3U A;  4DLG A;  5IOL A;  4LSZ B;  4Q5V A;  1KLM B;  2FJA B;  2QMW A;  2Q79 A;  3H98 A;  4J9U E;  5M2U A;  2OKQ A;  1UJ5 A;  1EJ7 L;  2Z2L A;  3JSM A;  3D6T B;  3KLH A;  2JEF A;  2MLY A;  3CJK B;  4AL6 A;  2CQC A;  2IYI A;  4B3T J;  1U6F A;  1BQM B;  1D0E A;  1RTD A;  1RWX B;  4CLP A;  1NDL A;  4C6A A;  4YFU A;  1NPP A;  3RBZ A;  1T9U A;  2FPH X;  4DQS A;  1X9M A;  3HT3 A;  3J80 U;  4PUO B;  4G6V B;  1EKS A;  5B08 A;  3HPO A;  3CWJ A;  1CLF A;  2RNE A;  4YB6 A;  2CNN B;  1VC0 A;  2ZZM A;  4EO6 A;  5IWA F;  2AU0 A;  4G1Q B;  2DK2 A;  2J7W A;  4DSE A;  3GU0 A;  4YDX A;  4HL9 A;  3PYF A;  3QLH A;  2WB1 D;  1IVZ A;  2NXN A;  2F63 A;  1WOR A;  4CO1 A;  3R7B B;  3VTI A;  1WEL A;  4B3S J;  1Z1Z A;  2OPQ A;  2NXC A;  4F0H A;  3ZZT A;  4HT5 A;  4M5N A;  3BGR A;  2V2Z A;  2OJ3 A;  4DU8 A;  3KLI B;  4BS2 A;  1VQK S;  3HSD A;  4WFN Q;  2OGU A;  4RBV A;  2V69 A;  1LK7 A;  1YVF A;  2L9N A;  2LU2 A;  2DGW A;  1FJC A;  3P3D A;  4MH8 A;  4WWS A;  4DV4 J;  3FJ2 A;  3CSK A;  1UMJ A;  2FVR A;  3RB3 A;  4TY9 A;  1MSW D;  4FBU A;  1TL1 B;  3R5A A;  1TVR B;  4XPC A;  2HFS A;  4J37 A;  3RW7 A;  1QVF R;  1Y7P A;  2J6T A;  2RUG A;  4TQS A;  2KI2 A;  3GV7 B;  2KT5 A;  2OPS B;  1PG5 B;  4K8R A;  1UFW A;  1S1V B;  3T1Y F;  4ZPA A;  5DO2 A;  1QTN B;  1RHU B;  2DCU B;  4KV8 B;  3CD6 S;  2AGP A;  3RB4 A;  2IMO A;  4DL7 A;  1Y5L B;  3THV A;  3B78 A;  4GC6 A;  2BX6 A;  3WHI A;  1CSJ A;  2ACY A;  2SXL A;  3SQG A;  2AYM A;  3KK2 B;  4AXJ A;  4IFV B;  4ZS6 A;  2NR0 A;  3WQP A;  4P7V A;  3CMA S;  3PV8 A;  3MI7 X;  4FXV A;  1MU2 B;  3KLV A;  4ZVT B;  3HK2 A;  2Z2M A;  1YSJ A;  2GS8 A;  2OML A;  3VAG A;  3PX6 A;  4P71 A;  2V67 A;  1NJY A;  2AJ1 A;  2BOP A;  1Y10 A;  2V63 A;  3SCI E;  3NEK A;  1A6L A;  2A18 A;  3HHN B;  4LF5 J;  4O4G A;  2R2T A;  2LEP A;  3DRS B;  1VBK A;  3D5M A;  3BDE A;  2PEH A;  4B3S F;  3KYL A;  2ZJR Q;  5IV4 A;  4DV5 J;  1RAH B;  1SV5 B;  2YWE A;  1NXI A;  2J9D A;  2AGO A;  1HI1 A;  5A0Y B;  3G82 A;  1HI0 P;  2E5G A;  3M32 B;  5K9F A;  4A4J A;  2ZVI A;  3RRK A;  1T7P A;  1S49 A;  4L73 A;  2ZDO A;  2FJB B;  4JOU A;  3F56 A;  4ECR A;  4C3K A;  3KHL A;  4WCE Q;  4J9P A;  1CJU B;  1XMO J;  2CPX A;  4OZJ A;  1GQE A;  4KY3 A;  4NOH A;  1HWL A;  1C0T B;  3M30 B;  3MMJ A;  3D28 A;  1S6Q B;  2GML A;  2KFN A;  3EGW B;  3MR7 A;  3TJ9 A;  3GE9 A;  1XNR F;  1FKP A;  2H3E B;  2CJY B;  4J9K A;  3FDS A;  1YQH A;  2R9L A;  3QGG A;  3NL0 A;  3DOK B;  1ZS6 A;  2EBE A;  3GSD A;  1IKY A;  2XMM A;  1J5E F;  2R8K A;  2YNG B;  2KHC A;  1Z2L A;  4EMD A;  1RT6 B;  2LYV A;  1SJ3 P;  2ZWP A;  5HMZ A;  3DC2 A;  2J0Q D;  3N5B A;  2JH3 A;  1VBZ A;  2YKQ A;  3GIJ A;  2W9B B;  1JMT A;  4MK9 A;  3WX4 A;  2EVZ A;  3I4P A;  3J7Y I;  1K47 A;  1AYE A;  4NRU A;  3C19 A;  3BSC A;  3TAP A;  5J1E B;  1RT3 B;  3CIM A;  3JYT B;  1CC8 A;  3DLE A;  3GJR B;  3VAM A;  2BAN B;  1QD1 A;  5ETR A;  1N56 A;  2MJU A;  2B5J B;  1IN0 A;  4X4N A;  3TEH B;  1UA1 A;  3EX7 B;  4M5L A;  1H2U X;  4MJK A;  4KGV B;  2AYE A;  2AKW B;  1YHQ S;  2AJQ A;  3M8P B;  4LF5 F;  3MXH P;  5KG2 A;  2ALZ A;  5B0G A;  3E51 A;  2KT2 A;  4A8S A;  2ZNY A;  3QAT A;  2HQI A;  2DNZ A;  4I2P A;  2CPJ A;  3UNY A;  3ISZ A;  1J5O A;  4C8Y A;  5KAK A;  1AFJ A;  4WFB Q;  3K59 A;  2DHX A;  1RT5 A;  2XLJ A;  4P2S A;  4ZVU B;  3CUL A;  1A0O B;  3GMG A;  4ES2 A;  1H2T Z;  2BE9 B;  4ECU A;  3UW1 A;  3M6V A;  3M2V B;  3J7Y U;  3EXC X;  2FDN A;  3CCS S;  2ZBR A;  1NPK A;  2Y1J A;  3M1V A;  3IAM 9;  5LSO A;  2RHS B;  5GAE U;  1RT7 A;  3OR2 B;  3QRR A;  1KTQ A;  4ZPC A;  4EZ6 A;  2NQP A;  2DEI A;  5KFM A;  4NI2 A;  3UR3 C;  5DG8 A;  3KLE A;  4LF2 A;  1FXR A;  2HFN A;  1FXL A;  1HD1 A;  1ZTT A;  1ZTW A;  1QE1 A;  3CDU A;  3JSB A;  4Y2K A;  1U6Z A;  2CPD A;  3RBD A;  3NY0 A;  1FEE A;  1NB7 A;  3DRX A;  2CQB A;  3L7O A;  5C2C A;  2HMI B;  3JAM Y;  1XC9 A;  2V8P A;  4F4A A;  2OEL A;  1Q0N A;  2R3V A;  1SJ1 A;  1AT1 B;  2QC3 A;  2VQE F;  3NGS A;  3BPD A;  5DLF A;  3FUY A;  3NRB A;  1GFW B;  4TU8 A;  4NRT A;  3U1M A;  3PRD A;  3WC0 A;  4B3O A;  4UQT A;  2D9P A;  1IR2 A;  3M9M B;  4YB1 P;  1XWL A;  3D3B J;  4CLF A;  1PO6 A;  3CED A;  5FD1 A;  4JI1 J;  3Q89 A;  2H4W B;  2J5A A;  2IRY A;  4CO0 A;  4OLO A;  3HJV A;  4WBF A;  1D8Z A;  1AFI A;  2HKE A;  1VI7 A;  1N4L A;  2CPE A;  3VAL A;  2RS2 A;  4QZV B;  1PBU A;  1T8E A;  2O1P A;  6FD1 A;  3FFI B;  3KWM A;  3GII A;  3LF0 A;  3BDP A;  3D1H A;  4QR1 A;  5DDP C;  3W61 A;  3FBB A;  3RYL A;  5K8M A;  3SI8 A;  1IQZ A;  4CI0 B;  4DZD A;  3TAN A;  1WD6 A;  2ASY A;  5GMD A;  4C8O A;  2MKS A;  1TKX B;  2YBV A;  2RUS A;  1Q81 T;  2IBK A;  2OPP A;  3BV8 A;  2E9Z A;  1RGV A;  1RB0 A;  2VFS A;  1QM9 A;  3QZ8 A;  3CUN A;  2CWK A;  1URR A;  3CCJ S;  1N5Y A;  2HIY A;  4KHP J;  4OLP A;  5A2Q Y;  5F8H A;  4OV1 A;  3C14 A;  1L3V A;  1FJG F;  3BKT A;  4WTO B;  1I94 F;  3UCU P;  2DYA A;  4ERD A;  4KKO B;  5HBM A;  1S9E A;  1FRL A;  4QYR A;  4WP8 A;  1WHW A;  5HP1 A;  4HAC B;  3H5X A;  3OL9 A;  2M3D A;  2WON B;  3LQV A;  3W5Y A;  2FVC A;  2B6A B;  3PDN A;  1KR4 A;  3NWR A;  2LXI A;  1U24 A;  1VC6 A;  3THP A;  1M90 T;  1FRJ A;  2JHE A;  1RTI A;  2IJF A;  2QYG A;  4DR6 F;  2UUC J;  1EQM A;  1B64 A;  3MCN A;  4CQ1 A;  2GV1 A;  4I64 A;  3CCZ A;  4ED8 A;  1P1T A;  2B4P A;  4ETZ A;  2ROP A;  2IPO B;  4PEO A;  1RBO B;  1IKW A;  1DLO B;  8AT1 B;  1CJV A;  1TEL A;  4IOC Q;  3H4B A;  4DI6 A;  3N5F A;  1PAU B;  4DFJ A;  3K5O A;  3I0S B;  4DR3 F;  3D1O A;  2HAI A;  3H42 A;  4ILR A;  4QWC A;  1RKJ A;  4QR2 A;  3M4X A;  2OTJ S;  2N7C A;  4URS A;  4M5H A;  3BO3 A;  3AXM A;  1W2B R;  2D1C A;  3KMQ A;  2W2M P;  1OPZ A;  1FCA A;  2E1P A;  3Q83 A;  2HFV A;  1GMW A;  3M2U B;  3MPW A;  4YB5 A;  4UST A;  3BKU A;  2KJV A;  3TAM A;  2E5H A;  5K14 A;  3RAQ A;  3HVW A;  2YWG A;  2W8K A;  3S1T A;  3MAH A;  1Z4U A;  1RUS A;  5H1S V;  5C5J A;  1PYO B;  1SC6 A;  2WRM A;  2YY3 A;  3JAM U;  1DQA A;  1F60 B;  4PQA A;  2V4R A;  2C2M B;  4FN5 A;  1MRO B;  3CJ4 A;  4F02 A;  4O44 A;  3TX8 A;  4C2M A;  3IFE A;  4ZIV A;  2FHO B;  4NMX A;  3CGI A;  4RO0 A;  2F40 A;  4Q44 A;  1HNX J;  4IDK B;  1E6V A;  3MDF A;  2JVR A;  4MTP A;  1U09 A;  4JBC A;  1JLF B;  1U25 A;  5IQQ A;  3CDB A;  1RAD B;  1SCJ B;  5EX0 A;  5A6W A;  1HYS A;  4LF8 F;  1N5V A;  3K17 A;  4FVM A;  3NWG A;  3AAW B;  5GME A;  2HHT A;  3G2X A;  3AY0 A;  1FT8 A;  4EWT A;  3TQ1 A;  4KHM A;  4NLU A;  4TVA B;  4J9O A;  2KVQ E;  1WJ9 A;  1ZM2 A;  3MTK A;  2WTF A;  2UVR A;  4ID5 A;  4IG0 B;  4M5I A;  4WKY A;  2PI5 A;  1G3O A;  5B09 A;  2WSE C;  1WG4 A;  1UW4 A;  3FC9 A;  3G6X A;  2PD1 A;  3OUY B;  1HQE A;  3KG4 A;  2FHK A;  3FCH A;  1YTY A;  4FYD A;  3ET6 B;  1M5P C;  1YJ7 A;  1NBE B;  1WKJ A;  3OFH A;  1LKZ A;  2MGZ A;  4ZVE A;  1VHI A;  3QZ7 A;  2C2N A;  2XZD B;  1U48 A;  4DFM A;  1HNW F;  1UPP A;  3FRZ A;  2ZJQ Q;  2AJF E;  1JXE A;  1XIQ A;  4PPZ A;  2ILY A;  4KSE B;  5KG6 A;  3PFE A;  4J7C A;  2FY8 A;  2VG6 A;  1V3S A;  5A2Q U;  1JKH A;  4DCJ B;  2QA4 S;  4B02 A;  1XR6 A;  2Z2Z A;  1NDK A;  4M1K A;  4I69 A;  3OJU A;  4K4Z A;  2GVD A;  2XM3 A;  2VKZ G;  3GJQ B;  3M6U A;  2GMJ A;  4HTJ A;  2MLZ A;  3B4D A;  2APO A;  4X66 J;  1P1L A;  2XSF A;  2DNP A;  1SH0 A;  3IWX A;  2JLF A;  3V4M A;  4Y00 A;  4V19 X;  3H5U A;  5L1L A;  3O2I A;  2B9X A;  4IYQ A;  4I6W A;  1K1S A;  4WU2 A;  1U1P A;  4PXE A;  3KFW X;  4ELV A;  4LBP A;  3L4B C;  3IG1 B;  4RW9 B;  1U4B A;  4FF3 A;  1RHK B;  4IG3 B;  4OZ2 A;  4ED6 A;  4URG A;  3MUT P;  1DBD A;  3HP6 A;  2XEX A;  1R3N A;  2G0J A;  5DM6 Q;  2A10 A;  3FEY B;  1OO0 B;  1SJR A;  3ITH B;  4KBI A;  2DBB A;  3MM7 A;  4ZCI A;  1S1U B;  3UR0 A;  3F0N A;  5HAT A;  5KG1 A;  1RAE B;  4U8Y A;  4CCH A;  3VF0 B;  1R0C B;  2CPF A;  1VBX A;  4LSN A;  3PX0 A;  3ZO7 A;  4FPI A;  1ZAX A;  1H2V Z;  4UOF A;  2PI4 A;  1BQN B;  1FJE B;  2DGO A;  3NCR A;  3FMW A;  2ZH5 A;  4X4U A;  3N79 A;  3DOL B;  1DJ0 A;  4B9U A;  1K9M T;  4GKK J;  4LFB J;  2ZOM A;  2HRY A;  2MEW A;  3DGP B;  4LVO P;  3MHY A;  2W9C A;  4EFA C;  1UVK A;  2FLL A;  1X4G A;  2YNH B;  2EFO A;  4TY8 B;  3M7V A;  4C7Q A;  3DLG B;  4UZB A;  1SKS A;  1TKT A;  3U1L A;  5EWF A;  4PXB A;  1TMJ A;  2OFG X;  4B3R F;  1JLE B;  1S6U A;  3KK3 B;  3D3C J;  2YKM B;  2DNR A;  1YLX A;  5I42 A;  4CYU A;  1BY9 A;  4EBD A;  4DEZ A;  4BDP A;  4ZPV R;  2G4B A;  1TV6 A;  1FNM A;  4OZL A;  4W92 B;  3DXB A;  3C3L A;  4I6Y A;  2J8A A;  3CJ3 A;  3QJJ A;  4QJV A;  4ZJL A;  2E1A A;  2CJQ A;  3G6V A;  1HKA A;  2J76 E;  3GCX P;  2M5Y A;  1K1Q A;  4YY3 F;  3M2R B;  3ZTQ A;  2DH8 A;  3CW2 C;  2MB0 B;  2FIU A;  1ZA1 B;  4WTY A;  1W2I A;  5CZX A;  1R0A B;  2WOM A;  3NS5 A;  1F2H A;  2HQC A;  5F3Z A;  4EO8 A;  3M9N B;  2VG7 A;  2M8D B;  2BKN A;  2Y1I A;  1NND A;  2B7C B;  2ZJP Q;  5J2P A;  1JLA B;  3R5B A;  4U7U D;  3W63 A;  4NML A;  1YK9 A;  1NK4 A;  1AB8 A;  1EHW A;  3DGV A;  2EPI A;  4M5D B;  3VR1 A;  4UOG A;  1RAO A;  3BKF A;  3IWL A;  2EEY A;  1WKL A;  1KOH A;  5ADZ A;  2CQH A;  4ZVH A;  3PRB A;  4BCA A;  4PWW A;  2W4C A;  1FWL A;  1TTH B;  1UCN A;  1U0H A;  5FJ4 A;  3D0G E;  4B9M A;  2YH0 A;  2IM3 A;  3TW0 A;  4B9L A;  1GMU A;  2H5I B;  5H9E J;  2FQQ B;  1FNX H;  1FDD A;  3MMC B;  2F5G A;  1IKX A;  4QIV A;  4P2X A;  2Z8Q A;  5CYQ B;  2WK4 A;  1VQP S;  2RH3 A;  2DT9 A;  3IR5 B;  4E0D A;  4ZVF A;  4F3Q A;  3DU6 A;  2XGQ A;  1EAR A;  3E3X A;  1IBK J;  1HIY A;  1ZPV A;  5IM0 A;  2OPR A;  1AW0 A;  3PNI A;  2MZT A;  2ZHB A;  1T95 A;  2FHJ A;  1RTD B;  4LQ3 A;  4W90 B;  3HF5 A;  4U8V A;  5IFM A;  1HBN A;  5LMU F;  1BXN A;  1NLK L;  3HHK A;  3A8I A;  3I0R A;  1NPR A;  3U1N A;  1X9W A;  4OYZ A;  1FDB A;  1BMQ B;  2CJX B;  4DR2 F;  3ISN D;  1TKD A;  2PT0 A;  4V1A k;  5D15 A;  4DSI A;  5HJX A;  4FDF A;  2YNF A;  2DNM A;  1YGY A;  5U47 A;  4DL5 A;  4DF4 A;  4PYD A;  4B9S A;  5I3U B;  3IR7 B;  5BR8 F;  2ZH8 A;  4DXL A;  4X65 F;  1OQ6 A;  2OPQ B;  4Y2A A;  1TL3 A;  1QSL A;  1MMD A;  3BGR B;  4DPW A;  3BBC A;  3ISN C;  4IQM A;  3ULH A;  3T5J A;  2BAC A;  3Q22 A;  5DRK A;  1JJH A;  4KIA A;  2QSW A;  2HVZ A;  1HQ2 A;  3H40 A;  1H74 A;  3KK1 A;  4ECV A;  3LAL A;  4ZIT A;  3MR3 A;  1NEE A;  1D1U A;  2NUU G;  5C24 A;  2W2O P;  2VQF J;  7AT1 B;  4CO4 A;  2CRL A;  1S9G B;  1RAJ A;  4WXW A;  2F4V J;  3BGO P;  4H4K C;  2DNL A;  2HFU A;  2RRA A;  1RA7 A;  2HRT A;  4RX6 A;  1OPI A;  2LMI A;  1T9W A;  2JVO A;  3UVJ A;  3T41 A;  4DR4 F;  1S1X B;  4LBI A;  1S77 D;  4USH A;  4TYB A;  1IBM F;  3J7A 1;  3SDE A;  1XMB A;  1QAJ A;  1YJU A;  3GG1 A;  1D9F A;  3VGT A;  1H38 A;  2RQK A;  3ENW A;  3BEG B;  3FRY A;  3BH7 B;  3QGP A;  2IVM A;  4R5P B;  5EGY A;  4HTI A;  1JLG A;  5KFB A;  2DRB A;  2GQQ A;  2K7K A;  3AD8 C;  5DZ7 A;  1RHM B;  4UT4 A;  3IMQ J;  3T6B A;  3ILJ A;  3M8Q A;  2V68 A;  3CJ0 A;  3J7A N;  3UE2 A;  2IBO A;  2GGP B;  5HMW A;  3CO9 A;  2ERR A;  1R89 A;  3DDI A;  3HX9 A;  3CNQ P;  5DET A;  3CXC R;  1B70 B;  3RBX A;  3D4J A;  2UVV A;  1U1L A;  1V6H A;  3BSA A;  3GTY X;  3MFH A;  4LT6 A;  4FYX B;  4H4O B;  1T94 A;  4MT1 A;  2VJV A;  4LR7 A;  2BRK A;  4A8W A;  3OHA A;  4USI A;  1NSP A;  4OYA A;  3PVX A;  3TUI C;  1C1B B;  3W65 A;  4P74 A;  4ZA1 A;  1XNQ J;  2DRA A;  1JNZ B;  4OJH A;  4ZN1 A;  2CPH A;  1YJR A;  1N34 F;  2RT3 A;  1UL3 A;  3SCJ E;  4CTA A;  2PEB A;  2LA6 A;  2MYF A;  4LF4 J;  4KO0 A;  5H9F J;  4QQB A;  2XO7 A;  2CG4 A;  1UKU A;  3PJ9 A;  1XN9 A;  1RWO B;  5HAO A;  4ENO A;  2ZIT A;  5C42 A;  3KJV A;  3RU0 A;  3KJN B;  2HIQ A;  1SJ4 P;  2MQL A;  4BWJ A;  1WC0 A;  1T9V A;  3DFE A;  5K20 B;  2H54 B;  3VQS A;  2FYX A;  3GFX A;  4N8O A;  5CD4 H;  2UVW A;  3TUP A;  4ECX A;  2MHN A;  1XER A;  3ZZO A;  4DPY A;  3BBF A;  2HQF A;  1G6B A;  1KLN A;  5DQI A;  1KTV A;  4PWD A;  1IKY B;  4F7V A;  2V4J A;  2QYC A;  5AXL A;  1LWC A;  2VV5 A;  4DV1 J;  1Q78 A;  3IS9 A;  4LF7 F;  2VBZ A;  2BW2 A;  4I2Q A;  3EUN A;  3WX8 A;  3DN9 A;  3W3S A;  1X8D A;  1S1W B;  2JFK A;  3OVS A;  4WKR A;  1YJT A;  1HWU A;  2OUG A;  1NDP A;  1VIS A;  3MCM A;  4O3O A;  5HVF A;  2WW8 A;  3NCQ A;  3FEX B;  2CWX A;  3MR2 A;  2J0S D;  5KFG A;  3GYG A;  2DHA A;  3AJ2 A;  3OTE A;  3LP0 A;  2HYI B;  2W2Q P;  3ZZ0 A;  1VQ5 S;  1OSD A;  1OMS A;  1J5O B;  2V0N A;  1VQO S;  1MN9 A;  1T03 A;  3JTO A;  4PG5 A;  1IKV B;  4OX9 J;  1PIE A;  3B6B A;  3PYE A;  5ETL A;  2VG5 B;  3IRX B;  1XNQ F;  1RT2 B;  1HMV A;  4OYO A;  1JNR B;  3LGM A;  1S5Z A;  2VAS A;  3CB4 A;  4H4M B;  2AZ3 A;  3OL6 A;  5D8H B;  4DUY F;  1VQM S;  4UUW A;  1YI2 S;  3MM5 A;  2CQ1 A;  2CJB A;  3TUJ C;  1LFW A;  2LCW A;  4OYW A;  5H9E K;  3I32 A;  3G4S S;  5CXT A;  4OYX A;  1NAQ A;  1JJ2 R;  1RT1 B;  4DQR A;  1LEO A;  2XS7 A;  1HBM A;  2DXD A;  2XYG B;  3N28 A;  1LWF A;  3RJM B;  3HHE A;  3FKB A;  2X7I A;  2Z58 B;  4N76 A;  2D3O 1;  5ETM A;  3QO9 A;  4XO0 A;  1GX5 A;  5BXI A;  4J9R A;  3R6L B;  4DV1 F;  2D3Z A;  2CNO B;  4M5J A;  4LJM A;  3E01 A;  2Z2Y B;  1U26 A;  3EPI A;  4NCA A;  4FKX A;  2XHW A;  3DLK A;  2JLG A;  5KFT A;  4EGL A;  2QRR A;  2HS0 A;  3IWN C;  5T7L B;  4B3O B;  4KTQ A;  3PJW A;  3FBE A;  3G8S A;  1VDH A;  3UDV A;  3SMZ A;  1WF1 A;  3ENA A;  4PG8 A;  4FXW A;  4JV5 F;  2Y8Y A;  2CJ9 A;  4YR0 A;  3BR9 A;  2JL9 A;  1J2V A;  5AXM A;  2A6M A;  4DR1 J;  3NG8 A;  2FC9 A;  4ZCK A;  2PFF B;  1KON A;  1EX8 A;  4WYW A;  2A6O A;  2RKI B;  2MQ8 A;  1TL7 B;  1UVI A;  4ES3 A;  4I4B A;  4P6Q A;  3WIV A;  3C16 B;  3A3O B;  2AP6 A;  4A8X A;  4YME A;  3ILO A;  5CZV A;  5CYM A;  1S7I A;  3AOA A;  1ROF A;  1H7W A;  3PJX A;  3ZZU A;  2OPP B;  1HWK A;  2BM0 A;  2FJW A;  1MNE A;  1HD0 A;  4P73 A;  4OI0 A;  2E1M C;  1KOO A;  2B8Q A;  4WPA A;  1SL1 A;  3QIP B;  2ALY B;  2W7O A;  4DG1 A;  1V5I B;  1N5Y B;  4C0B A;  4B17 A;  3H5Y A;  4HVZ A;  3MUM P;  1N6Q B;  4FP9 A;  3TA1 A;  1DQ8 A;  5D4P A;  4QOT A;  4Y0F A;  1Q53 A;  1NK7 A;  2AGQ A;  2LEB A;  2QSF A;  4P52 A;  3NNA A;  1HFE L;  1VC5 A;  2HVH A;  3BPS P;  1YRT A;  4RBU A;  2OSQ A;  2ZNZ A;  2HHW A;  4UQG A;  1KVI A;  4FVC A;  4RNH A;  3M8Z A;  1S9E B;  3K7R A;  3V81 A;  2VIC A;  4ZHR A;  4LMZ A;  4JUZ A;  2YTC A;  2R8I A;  1YKW A;  1I51 B;  1CQM A;  4ED5 A;  2DRD A;  2HG4 A;  5IV3 A;  3ENV A;  5CQG A;  1S1T A;  1YBA A;  1OY8 A;  4KAI A;  1PAE X;  3BYR A;  4JI2 J;  4ZCM A;  3R5C A;  4J9V A;  4JI4 J;  3T1H F;  1XK8 A;  2B9Y A;  3GIR A;  2ASJ A;  1K8A T;  2YPY A;  1H3D A;  4NLP A;  2MQM A;  3EYZ A;  4DV3 F;  5I3P A;  1CJT B;  2F9D A;  5KT2 A;  1KEK A;  2C3Y A;  3ICL A;  1DAR A;  3CD7 A;  2C3M A;  4WFA Q;  1KNZ A;  3OL8 A;  2PA3 A;  1VCT A;  1XMQ J;  3C15 A;  1GK8 A;  3JSR A;  4O3Q A;  4QIF A;  1RHJ B;  2Z0G A;  3K89 A;  1IKW B;  4FYV B;  1T0T V;  2I9S A;  3LUY A;  4FF1 A;  2EXU A;  1G4C A;  1UEV A;  4KRW A;  2VC1 A;  2FGC A;  3G96 A;  2XWY A;  4HHU A;  4ZPW R;  3H0P A;  3VAI A;  1FK9 B;  4WF9 Q;  4P9S A;  3AHP A;  4DQQ A;  2XMT A;  4DL6 A;  2NXJ A;  1H98 A;  4O3R A;  2UVU A;  4I1T A;  4EBE A;  2JNJ A;  1ZH5 A;  3AH6 A;  2AZ1 A;  4F2S A;  4PKD B;  2JWN A;  2KXH A;  3S8S A;  2X1B A;  5H9F K;  1BQX A;  4IFY A;  3SZ2 A;  3GPA A;  3NMA A;  3GZ7 A;  1K73 T;  2B8P A;  2F1F A;  2ZHO A;  3R2D J;  2DIV A;  3PKY A;  2B4O A;  1FKO A;  5LSL A;  4NCG B;  3HDS A;  2ZKU A;  2I0X A;  2KXF A;  2RF2 A;  2CG8 A;  4WK3 A;  2HND A;  2W2P P;  3GP9 A;  4QWB A;  5KG0 A;  4RW6 A;  1HI8 A;  2XSJ A;  4ATN A;  1YDL A;  2M88 A;  3TZZ A;  1TU0 B;  4DJB A;  1B0T A;  3LWM A;  2FUG 9;  2R42 A;  2IAJ A;  3DYA A;  1SUQ B;  4HR2 A;  4FYY B;  1RTJ A;  3TEG A;  4QPT A;  1HLW A;  3NBP B;  2RJZ A;  1KHW A;  3BSO A;  5IT0 A;  3K5N A;  1Q8B A;  1HYS B;  2XMJ A;  3QYY A;  2ZZT A;  4DV2 J;  4AQY J;  4K5R A;  2P9C A;  2DCL A;  1BUX A;  3MMA B;  2QFI A;  2DR5 A;  2CNK B;  2RML A;  4RUH A;  3PR5 B;  4RR5 A;  2KTQ A;  1YG0 A;  2BVZ A;  3V6K A;  4CH7 A;  3HSG A;  4OI6 A;  4CO2 A;  2FVQ A;  4RU9 A;  1HBU B;  5IT4 A;  2GW8 A;  2IFX A;  1LW2 A;  4KB7 A;  3HVT B;  3RR8 A;  2I1R A;  2FD2 A;  3LAN A;  4UTG A;  3HFV A;  1YZ7 A;  2J9C A;  2NPF A;  4G1P A;  5BYS A;  2MGZ B;  4AL7 A;  3TZY A;  4KT0 C;  2D3O R;  3DOM A;  3KDO A;  2MPU A;  4YEA A;  2IMW P;  2DGU A;  4J5O A;  1ZAW A;  2AW0 A;  2E5L F;  2PA8 D;  4X4T A;  4AL5 A;  2QA4 G;  1JKH B;  2PDA A;  2BKO A;  1KC8 T;  1GT8 A;  4RUB A;  4CLY A;  1HBO B;  1R8H A;  2P9E A;  3GIM A;  3ZTS A;  4WJB A;  3RAX A;  1KKH A;  5HQ8 A;  2K1R B;  2UUA F;  2UU9 F;  5HRO B;  3GFH A;  4Q45 A;  4DDF A;  4NLG A;  4O0N A;  2G2Y A;  2HHV A;  2CXE A;  4RW4 B;  2UXC J;  1D09 B;  4NXN J;  4XK8 C;  4P72 A;  1CC7 A;  3TVK A;  4TU7 A;  2E7V A;  2GHW A;  2HWH A;  2B9E A;  4HI1 A;  1X5O A;  1NK5 A;  4TN2 A;  5J1N A;  2J6S A;  2UXB F;  1X4H A;  2WVE A;  3EVO A;  3SBM A;  3OTO J;  3QWU A;  4WFY A;  4NAS A;  2HHS A;  2H5E A;  1VQS A;  2VOO A;  3ZC4 A;  4A47 A;  4DWI A;  3KDN A;  1Y3J A;  4A8O A;  1NK0 A;  5J2M A;  5L9N A;  3W8P A;  3MM7 B;  2KG1 A;  2GIF A;  4F0K A;  3MM9 B;  5HK4 A;  1NKE A;  2FVS A;  1LK5 A;  1RLC L;  3KUH A;  1CS4 A;  2CJA A;  1NZA A;  1SIW B;  2QFJ A;  1K0T A;  5M2R A;  4IRK A;  1JX4 A;  1ICE B;  4UY8 5;  3W9J A;  2VBX A;  2QLW A;  2L08 A;  4Y65 A;  4EI2 A;  4X4S A;  1FO1 A;  2W9C B;  3HHD A;  5AE2 A;  5J2N A;  3BM7 A;  1BWE A;  2IY5 B;  3SV4 A;  3QFW A;  4OI2 A;  1Q5V A;  2IA0 A;  2BXJ A;  4C48 A;  2MHE A;  1KDN A;  3EDQ B;  4CLW A;  3QSI A;  1FD2 A;  1VIO A;  1S4F A;  4J9S A;  4Q0B A;  2UUB J;  2M70 A;  2O66 A;  1R31 A;  1YJ9 S;  5J2Q A;  2V34 A;  4K4X A;  3THT A;  3BYP A;  4CYU B;  4P2M A;  1RWU A;  5D3G A;  1KD1 T;  4ZVS B;  3I5A A;  3IGV A;  1TV6 B;  5FDL A;  3V2U C;  5HI7 A;  5M2P A;  1VQ7 S;  1QLN A;  3J80 Y;  4DL0 C;  1RLD A;  5ETQ A;  1U1R A;  1Y5N B;  4I67 A;  2RS8 A;  2KFY A;  2DTJ A;  2A2D A;  4P75 A;  3H8Y A;  3R7S B;  1GTH A;  3FQL A;  4EYH B;  3FGV A;  3MOJ B;  3L7P A;  1S12 A;  1DAX A;  1WWH A;  2POK A;  2ABY A;  1KLM A;  3OTO F;  1HNZ J;  1FFG B;  2X51 A;  1TAU A;  2WOM B;  3NXZ A;  1SQG A;  3GWC A;  1NCL A;  4Y2I A;  1WOS A;  4JI5 F;  5A8R B;  3BF4 A;  3BGL A;  4KGZ B;  1SJQ A;  3MGJ A;  4ZOS A;  5KG3 A;  5GVQ A;  4ZK7 M;  1VQL S;  2HBR B;  5J2P B;  5DDQ C;  4X64 F;  1NZ8 A;  3KG1 A;  5IZH A;  2QO3 A;  3H25 A;  2XG8 A;  3I96 A;  2NYH A;  1X60 A;  2ZH9 A;  4PUO A;  4RUC A;  1S59 A;  2QL5 B;  3FCW A;  2EFN A;  4DUZ F;  1F5B A;  3G6Y A;  1C4C A;  3PM9 A;  5GMK a;  2C2D A;  4Q2M A;  3FQK A;  1P6T A;  2DJW A;  4N47 A;  1KSP A;  5E3P A;  2H4Y B;  2B56 A;  1SKR A;  2OTL S;  4G1Q A;  1RYR A;  4CLT A;  1O5J A;  2I5J A;  2LXU A;  2AJ2 A;  4QW9 A;  3A8K A;  4DU7 A;  1F3V A;  7FDR A;  2PGC A;  5KFU A;  3BN7 A;  3W2W B;  1WSV A;  2IA6 A;  3KLI A;  5JVH Q;  2P9G A;  2I8E A;  2M2B A;  4XAK A;  2LKZ A;  2PC6 A;  5IWA J;  1W26 A;  1VYA A;  2ZH6 A;  2OPR B;  2VH7 A;  4XDD A;  4WIQ A;  2E1R A;  2BRL A;  2DHG A;  5KFO A;  1FWP A;  4PXC A;  3TRG A;  1TL1 A;  3Q8V A;  4ZVQ B;  3I0R B;  3PAC A;  3HSJ A;  3ZTR A;  5KT6 A;  3MUR P;  2OPS A;  3V5R A;  3MCO A;  2DGV A;  4DSK A;  1UEK A;  3KTQ A;  3PHT A;  4YQW A;  2HK3 A;  1VRU B;  4KV8 A;  3UD3 P;  1N36 F;  1IM4 A;  3L3C A;  2D9O A;  4MIW A;  4NA1 A;  4LUB A;  2UXD F;  2MZS A;  4DOZ A;  3ZZZ A;  4QU6 A;  3UD4 P;  4F50 A;  4PZV A;  3OVB A;  3C2P A;  4DX5 A;  2AX0 A;  2GX8 A;  5HLF B;  2ATL A;  3KK2 A;  2R8H A;  4IFV A;  3QT6 A;  5GAG U;  4MK7 A;  3HKW A;  1Y11 A;  1MU2 A;  1M5K C;  3NGT A;  4HEA 9;  3UDC A;  1RZM A;  2MQN A;  3T1Y J;  1K0V A;  2QN6 B;  4NZ0 A;  4DUT A;  2XMW A;  5C24 B;  1HR0 F;  2NS1 B;  3VGS A;  3BS9 A;  1J27 A;  2FLP A;  3F44 A;  2FJV A;  3I87 A;  3DRS A;  4A48 A;  2BQU A;  2CQG A;  1WC6 A;  2CIM A;  2MKK A;  4M8L A;  1SV5 A;  1UVM A;  4OZ0 A;  2QLJ B;  3VGV A;  4AUK A;  2XBP A;  4FKY A;  4X4P A;  3M32 A;  1VMB A;  5KG4 A;  1MWQ A;  4I7F B;  1ZYQ A;  1CJK B;  4DHV A;  4ZLJ A;  1GNK A;  3SDE B;  2Y0S D;  1KFD A;  5F8L A;  3SV3 A;  3GYX B;  3SYZ A;  3TVY A;  1WG5 A;  1F9E B;  1CJU A;  4ZPB A;  3J81 j;  1ZA2 B;  2VJU A;  3P5B P;  2MJN A;  1JLG B;  4DLE A;  3M30 A;  4DV7 J;  2YWK A;  2O67 A;  1RIS A;  1S6Q A;  1X4E A;  2WVD A;  3V6J A;  3BRE A;  5DJB A;  4QYZ J;  2G0C A;  4LSL B;  4AXI A;  2DNG A;  1T05 B;  4QWA A;  2ROE A;  3DRR B;  3MWB A;  3BBB A;  2YNG A;  4BWM A;  4OZ5 A;  1O6X A;  3GYN A;  1HPZ A;  2E7X A;  3V6H A;  2ZEJ A;  2EWH A;  2W9B A;  1BGX T;  3T6J A;  5DLG A;  5ETV A;  5F0W A;  1NO8 A;  2GVZ B;  2JC1 A;  3MEE B;  1RT3 A;  4ECY A;  3GR0 A;  3BGU A;  3CVK A;  4LFC F;  1OWX A;  3P96 A;  4ED3 A;  1RU2 A;  2EK6 A;  5A8W B;  2BAN A;  1Q7Y T;  1U1K A;  2KYZ A;  2W8L A;  3JSY A;  4C9D A;  1XNR J;  4H4K A;  3Q8R B;  3C8Y A;  3HZG A;  1TZ0 A;  2B5J A;  3CJQ A;  2GAG C;  2OI2 A;  3SEO A;  4KO0 B;  2V50 A;  3MPY A;  1ZAV A;  2CPI A;  2DNN A;  3R97 A;  2LU1 A;  1J5E J;  2L48 A;  3V4I B;  1UVJ A;  3BQ1 A;  4WK1 A;  2HBQ B;  2H5J B;  1B3T A;  3MOZ A;  2HZA A;  2AQ4 A;  1GH8 A;  1KQK A;  1KHV A;  1H72 C;  3FZ2 A;  3VWS A;  2IM1 A;  3LP2 B;  3G87 A;  3PW7 A;  3DM2 B;  3CJ8 A;  3FCV A;  4UUX A;  1KP6 A;  4KH0 B;  3G9C A;  1SVD A;  5KFH A;  5CA5 A;  3D6F B;  2V4J B;  1VJQ A;  2M7S A;  1SJF A;  3Q8Q B;  1WKK A;  4KPY A;  1SI9 A; 
#chains in the Genus database with same CATH homology
 2C2M B;  2C2K B;  2H4Y B;  2QLJ B;  1RHK B;  1RWV B;  3R7N B;  2QLB B;  4ZVT B;  2H51 B;  1RWX B;  3D6M B;  1BMQ B;  3IBC B;  3R5J B;  3KJQ B;  2XZD B;  3D6H B;  4ZVR B;  2CJX B;  1RHR B;  2CNL B;  2C2O B;  1IBC B;  4ZVP B;  2HBY B;  2XYP B;  2CJY B;  2QL7 B;  4ZVU B;  1GFW B;  5IC6 B;  3R7S B;  1RWP B;  3EDR B;  1ICE B;  2XYH B;  3NS7 B;  1I3O B;  1RWM B;  1PAU B;  4DCP B;  4DCJ B;  2CNN B;  2CNK B;  1RHQ B;  1RE1 B;  3QNW B;  2H65 B;  3P4U B;  1F9E B;  4DCO B;  2P2C B;  2Y1L B;  3P45 B;  1RWN B;  2H5I B;  1I51 B;  1RWK B;  1RWW B;  1SC4 B;  2FQQ B;  2HBQ B;  2H5J B;  2H4W B;  3GJQ B;  2C1E B;  2CDR B;  2QL9 B;  2C2Z B;  1QTN B;  2XYG B;  1QDU B;  2H48 B;  2HBR B;  1RHU B;  4ZVO B;  2HBZ B;  3GJS B;  3R6G B;  3EDQ B;  3RJM B;  3IBF B;  3GJT B;  2QLF B;  2DKO B;  1NME B;  1RWO B;  4JB8 B;  5IC4 B;  3GJR B;  3R7B B;  3KJF B;  2QL5 B;  3KJN B;  3SIP B;  4ZVQ B;  1RHM B;  4LSZ B;  2XZT B;  1PYO B;  3R6L B;  2Y0B B;  3D6F B;  2CNO B;  5K20 B;  1SC1 B;  4ZVS B;  2H54 B;  1SC3 B;  1RHJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...