2XYGB

Caspase-3:cas329306
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CASPASE-3 SUBUNIT P17
total genus 19
structure length 93
sequence length 93
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2xygB00
2QLJB 1RHUB 3EDRB 3R5JB 2CDRB 1SC3B 1ICEB 2H51B 3RJMB 2C2ZB 1GFWB 2H54B 2HBQB 2XZTB 3IBCB 3R7SB 1NMEB 4ZVUB 1I51B 3EDQB 3P4UB 3KJFB 4ZVPB 1RWPB 2CNNB 2C2MB 1F9EB 1BMQB 2QL7B 3R7BB 1RHQB 3R7NB 1RWKB 2XYHB 4ZVTB 2XYPB 5IC4B 1RE1B 4ZVSB 1RWNB 2XYGB 1I3OB 2CJYB 2H4YB 2H5JB 2HBRB 1RWVB 2H48B 2P2CB 1RWWB 4LSZB 3IBFB 2CNKB 4ZVQB 1RWXB 2C2OB 1PAUB 2H65B 1RHMB 3D6FB 1PYOB 3KJQB 2QL5B 2QLBB 3P45B 2H5IB 1RHJB 3QNWB 1RWMB 2DKOB 4DCPB 2HBYB 2Y0BB 3GJTB 3R6GB 1SC4B 5K20B 3GJRB 2XZDB 3R6LB 1RWOB 3D6HB 1IBCB 2QLFB 4ZVOB 1QTNB 2C1EB 4ZVRB 2CNLB 1RHRB 2H4WB 1SC1B 1QDUB 5IC6B 3GJQB 3NS7B 1RHKB 2C2KB 4DCOB 2QL9B 3GJSB 2FQQB 2Y1LB 2CJXB 4JB8B 3SIPB 4DCJB 2CNOB 2HBZB 3KJNB 3D6MB
chains in the Genus database with same CATH superfamily
4OV6A 3TA2A 4Y2MA 2Y0SD 4GMKA 2BJDA 2VKZG 1RHUB 2FZGB 1Y00A 2GMLA 4ECQA 1DLOB 2MKIA 3RRGA 5A8RA 3MMBB 1J5EJ 4L74A 4CO1A 4CT8A 1DZ5A 1FJGJ 4KGMA 5I42A 3IP0A 2B7BB 1F9HA 2GVDA 3CCTA 4GO7X 2OFHX 4OI6A 3VTIA 4F4ZA 1VQPS 4QW8A 5CD4A 3PW2A 1JLAA 2HQCA 2XZTB 3VWSA 3NMRA 4B3OA 2MQPA 1T02A 3BKUA 2H3EB 3BR8A 3FNNA 4FP9A 4CLFA 5HMYA 1N56A 2UXBJ 4JI8J 4CIOA 2W9CB 1IQZA 2DY9A 1NH7A 3T1HF 1Q8LA 2ASJA 4DPYA 4EUVA 3IS9A 3MMCA 1OYEA 1JMTA 2WVEA 2XSFA 1Q7LB 2GV1A 3I0SA 4JBCA 1A6LA 5GMEA 4J9LA 3OVSA 3T5KA 2VODA 4HKQA 4TLRA 2AF6A 2R9LA 3TNVA 3HHLB 3T6BA 1AZSA 3PG9A 3QWUA 2P5VA 4ZCLA 2FGOA 5HJXA 4U95A 2HURA 2XYHB 1BUXA 3DGPB 3GFYA 1C0UB 2FJAB 2V9WA 4L72B 2RDIA 5A6WA 3CCVS 2IVYA 1VJQA 4WFNQ 4DV2J 1T0TV 4ETZA 1XMQF 3X1LB 4V19X 1U26A 2IJRA 4LUBA 3I56S 2UZAA 3A8JA 4DL0C 1JLQA 4J9MA 2RS2A 5J2QA 1YJRA 3ET6A 4CM2A 3RGIA 1SKRA 3AJ2A 1R6VA 1X5PA 1YIJS 4UY8T 1HL6A 1BGXT 3C14B 4MTPA 3UR0A 3OVBA 2Y8YA 3ILIA 3UR3C 1TK8A 3KLGA 4HH1A 2B5JB 1H2UX 5GAGI 1FX4A 1KBRA 1M5VC 3RB6A 5KFNA 4JP8A 1QLNA 3DYAA 2EEYA 4FS2A 1D9FA 1VRUB 4NLWA 3EYZA 3CO0P 2FDNA 5KFJA 1H98A 2WW8A 4ELUA 4LF8J 1J27A 4LRFA 2V0NA 3SQOP 3E2EA 5AE1A 5D6GA 1A0OB 1H0HB 3OFEA 4OZ0A 3KK2B 1T8EA 1N34F 1XNRF 3TUJC 2HWIA 5HN0A 2UVUA 1M5KC 1SJ1A 3DXSX 3PXGa 4B3TJ 5I4MA 4LF9J 3W8PA 3UNYA 4J7CA 3KFWX 3W60A 3PX0A 1RUSA 3LANA 1C4CA 3BN4A 3QO9B 3IGVA 5HO4A 2ZVIA 1S9FA 1T05B 2HQFA 5C24A 3CCES 4ED8A 4I2QB 1GMVA 3KHRA 1RT7A 5D0EA 3US5A 2H4WB 4JYAF 1N0UA 2C3UA 5AT1B 2V4QA 4AXJA 5LT5A 1SH3A 3T41A 3MPUB 4JI6J 1LK5A 3H25A 3I9V9 2MY7A 3G96A 1SJ4P 1VISA 2OGUA 3G82A 4P2FA 3WIVA 3T5HA 2AWZA 1PJ5A 3AB4B 1FESA 3L09A 3NGRA 4NXNF 1TAUA 2QL9B 1IVZA 2MY8A 3H0PA 1E6VB 1U1LA 3GJSB 1YJ7A 4DQPA 3GFZA 1U1MA 5EDWA 1T9XA 4CM0A 1MWQA 1DARA 4NYPA 3W2VB 2GCFA 5L8RC 3HZGA 3R8YA 3UN5A 3G8TA 3J7A1 5D4PA 4K5SA 2PFFB 2DNQA 2V94A 3T5JA 1WORA 3KJNB 5K8OA 1IUJA 2KU7A 2XY7A 3EZOA 3QLHB 3KNAA 2ZDOA 2NXEA 2Z58B 2HFZA 4CLYA 4DUYF 4F0MA 1WOOA 1G3OA 3ZTRA 1RT6A 3QJJA 3B54A 3VAMA 1WEXA 4J37A 2ZOMA 3CVKA 3MR3A 4M95A 3U1LA 2IBKA 3OR1B 2GIQA 4OJHA 5D4OA 2KRRA 2WONB 1N54B 4URGA 5ETNA 5EX0A 3HK2A 4KGVB 1HNWF 5KG6A 5H9FJ 4O0IA 1PO6A 4LFCJ 2F4VJ 4WU3A 4K5RA 1LW2A 2NXNA 4ZPTR 3ULHA 1NB7A 4QJVA 4QU7A 4C8LA 4DOZA 4UQGA 1CSJA 3V6DB 1O0PA 2UUTA 3UDEA 2E9ZA 2J7WA 2RILA 3TUZC 3GIIA 4C4WA 2QFJA 2RU3A 4HACB 4NPOA 2F40A 2ZH2A 3LP2B 1FI4A 2KJVA 4EI2A 2VUGA 2XCPA 3J7ZT 4V19J 1SL2A 2DBBA 2F9JA 5CZVA 4X64F 2CQPA 2PGCA 3RW7A 2DXFA 3KG0A 3QIDA 3R27A 4G6VB 1F3FA 3DLBA 3M8QB 1TV6A 1KLMB 4C8ZA 1N5SA 2YQ0A 4KSEB 3KLHA 1H38A 4DSEA 5J2QB 3BSCA 3DLEB 2IVFB 2WZ1A 2MZ1A 2H48B 1MROB 1NJIT 1RWWB 3R2DJ 1FJCA 3BGUA 3HKWA 3IBFB 2RRAA 3R5AA 5BYQA 3PX4A 1PG5B 1Z2ZA 1RAOA 2M2BA 3MMBA 4DPWA 2UVRA 1SIZA 3H20A 1NO8A 1QY7A 4ECXA 4DV5F 2IDEA 2MLXA 5AXLA 3KK2A 2CPFA 1VC0A 2XTJP 4ZPCA 3JTNA 2ZH9A 3UO0A 1KWMA 2BOAA 2QC3A 4TU8A 2B9EA 4YHHJ 4MKYA 3N5FA 3UCZP 2O3DA 4IH6A 1VQSA 3TJ8A 3GIRA 4PXDA 3KUEA 4HH0A 4KFBB 5L39A 5CHCB 4DUZF 3M8WA 4F4YA 1YJWS 4JV5J 1F1BB 2ZBCA 1V6HA 4PAAA 5IQQA 5AJ3J 4YB7A 4CO0A 1L5UA 4YB6A 1SJ3P 1HPZA 4H4KA 3Q8PB 2UV8G 1RKIA 1IBCB 2W2PP 3Q8YA 4I6YA 3BBBA 4L73A 1RA6A 4DBQA 3T3FA 2UXDF 4IG0B 4YUDA 4Q2LA 3HT0A 4ID5A 5THWA 3U1MA 2VONA 4F25A 1S77D 4LT6A 3E51A 3JTOA 1S4EA 4PQUB 3IS9B 1NU4A 3MMCB 3G6XA 5GAHI 5HBMA 2XQCA 5ETQA 5BJRA 4Q7AA 1M1GA 2ZKTA 1ZTTA 4FYYB 2QYCA 1T3OA 2IJNA 2LQ5A 1QJHA 2HEKA 1O51A 4P7TA 4WK1A 1SH2A 4FBUA 4L3NA 5CAAA 2E5LF 1L3SA 1NBEB 2HK3A 3KUGA 3UNGC 2W9AA 4KGKA 1FDDA 4LF7F 2XS5A 1EHWA 2YXLA 3A4TA 3Q2SC 5HROB 2NSCA 3I5AA 1EP4B 3MPDA 3ZZOA 2E9TA 2R4FA 1U2CA 4WYLA 3M8YA 1NHKL 3CPWR 4ILMA 1CG2A 4DL7A 2QV6A 3PNIA 1GAOA 3FCWA 4DR4F 4DL3A 3KWMA 4JUZA 4X64J 1C1BA 3EUNA 4B9SA 3NNAA 1AFIA 2YKNA 3C6TB 2XO6A 1N8RT 2RDDA 3J80Y 1R0CB 3R5JB 5HLFA 3MM9B 1SC3B 1RT1B 5KFTA 3W9IA 2C2DA 2D69A 7FDRA 1WC1A 2FJWA 2MKJA 1KP6A 2DYAA 4CTAA 4DN9A 3BSNA 4MYTA 3HVRA 1G7CB 2EK1A 2W2MP 2ZD1A 1HWKA 1GFWB 1VFJA 2B8PA 1XK8A 4S0MA 1RXOB 2D3O1 1LXJA 2F1FA 3SCKE 3O1LA 4E98A 1S5ZA 5FIIA 1YI2S 4M94A 3CDAA 1AT1B 1QUVA 1G6BA 1KHVA 4DR2F 2ZBIA 1I51B 1VQMS 1KFDA 2HNDA 2DR8A 2V2VA 3GFXA 1PC4A 2DCUB 2YNFB 3NGUA 1HKAA 2QX0A 4OYXA 4IH5A 4U8YA 3MWBA 1RAJA 4J5OA 3IR6B 4USTA 3AT1B 1NZAA 4L75A 4CRJA 2XLKA 1N33J 1RP5A 2WSEC 3VAKA 2ZZNA 3HHLD 3W64A 3MM7B 3KLHB 4Q45A 2NYIA 2C22A 4F3OA 2W2NP 1T11A 3QZ7A 2XYPB 5I3PA 3PYDA 3FZBA 1S1VB 3CJ2A 4Y0FA 3J81U 4YHHF 2KHCA 1IBMF 2PD1A 3ELHA 5IC4B 4TQSA 4IQMA 2R7UA 1JXEA 1HBMB 1R3NA 4P6QA 4ZVSB 5KFDA 1GTHA 3MD1A 3J7AN 2IRUA 2K3IA 1Y5NB 2B51A 2RQ4A 2KL8A 3A12A 4QYRA 4AE5A 4R25A 1R89A 4D3GA 9ATCB 5KFPA 3Q0AA 4PR6A 4J9QA 4KPYA 3HJFA 2P2CB 3FBCA 1RU1A 3I87A 5BR8J 2EWHA 5DO2A 2MXYA 4JOUA 1NK9A 1YX2A 4AQYF 3CC2S 2V69A 3UCGA 1TK5A 1NKEA 2AYBA 3V6JA 1RTHA 3BF4A 3IMQJ 1DTTA 1RHMB 4X4OA 3SI8A 3AQOA 4DHVA 4CI0B 3LGNA 4LJMA 3L3CA 1B7FA 3TQEA 1IQTA 3ZFVA 3I0SB 1FD8A 3N6NA 4XPCA 4P52A 4LF5F 3K8VA 2HMIA 3VAJA 2AEMA 2BE2A 3DHWC 1PILA 5H9EJ 3VQSA 1CVJA 2AJFE 2L9NA 2VFVA 3LALA 1B4SA 2LA4A 2QSFA 3HJVA 1Q4RA 4ZCKA 5K20B 4CO3A 1FKOB 2B9YA 2I5JB 4KE5A 4WP8A 5A76A 1IJEB 2HHUA 1WUUA 2CWXA 3FEYB 3AOCA 5DZ6A 3NCPA 3W7BA 2E1RA 2KZMA 2UVWA 1M5OC 4LF6F 3D6HB 3BQ2A 2DXDA 2XSJB 1U1NA 1LXNA 4RW6B 3TVZA 2ZVSA 1NK6A 4Q5VA 3VF0B 1M1HA 5KT4A 2HKEA 2V6AA 2P9EA 4H4MA 3T6JA 2IBOA 2MKKA 2GHPA 4WZQA 2QA1A 3JSRA 2FC9A 2A6MA 2YX7A 3D67A 2APOA 2G2OA 3HSGA 1YVFA 2B5JA 3KG1A 4ZPDA 3RB0A 4DV2F 2RHQB 1VQNS 4CYUB 5FJ4A 4KQZA 1MU2A 2A18A 2M4MA 4PYDA 2Q6BA 4WIIA 3GIMA 4LVOP 1UEUA 1DTQB 4BBYA 2DXEA 3GR0A 3OFHA 3BH7B 2B8QA 1S12A 4M5KA 4WWSA 1N34J 1KLMA 4DCJB 3QSYB 1GMUA 1X4FA 3KOAA 1H6KX 3TQ1A 3VHQA 4HDGA 4FVMA 3PZPA 2HHPA 3F73A 5DM7Q 3QGIA 4RUCA 4ZVFA 3MHYA 4DZDA 2XC9A 2FHMA 1Z2LA 1ZBTA 5IS2A 4X66F 1FEEA 1VCTA 1WJ9A 3ISNC 2GJFA 4JI6F 1KVJA 1EAYC 4M5DA 4CDIA 5KFEA 4OHYA 1VBZA 3PJXA 2ZZTA 2B7CB 1X5OA 3T1YF 3FMBA 3RZAA 3Q8UA 1WTBA 2HFOA 3LAMA 1TUGB 3D54A 3EWGA 4RW4B 4N56A 1FJEB 4P71A 4RR5A 1RKJA 2CQ2A 4EU0A 2HIYA 4O44A 2C2ZB 3ONQA 2Z2ZA 5KT5A 5F8JA 3IFEA 2BDPA 4WYWA 2DY1A 2MQQA 4IG0A 3KMQA 1VQYA 3LOUA 3SQGA 4ZJQA 6FD1A 4IFYA 1TL7A 2KYZA 3AB2B 4KBIA 4OYOA 4X4QA 4DL4A 4HT7A 2MJUA 5L9NA 2OJ3A 4ZPVR 3M9OB 4DSJA 4FS1A 4B9TA 4TVAB 1N32F 5IM0B 4TXSA 1UVMA 3MMAB 2ZM6F 3T1HJ 3IBWA 2V8VA 5IT4A 1H7XA 2GQ2A 2CPJA 4NI2A 3OTDA 1S1UB 4NX9A 3UDVA 1U02A 1MWYA 2J7KA 1JNZB 1NHVA 2ROPA 2ASLA 2GIFA 2UUAF 1X4GA 2K1RB 1K9MT 2MKHA 3SMZA 1VC5A 5T7LA 1TKTA 2CQBA 5ETVA 4ZKAA 2AJ1A 3OR1A 1B0VA 1MN7A 4LFCF 3DRYA 2E5JA 3TRGA 2G0IA 4LSNB 1UWBA 4MK8A 1LWXA 1RSCA 3PRDA 2CJKA 4IRKA 4TYAA 5LOQA 2HVZA 2NXCA 3MOZA 1Q7YT 1CULA 3M6WA 3W62A 2H5EA 4IR1A 2GA7A 3GB0A 1TFWA 4C11B 2XG8A 1SV5B 3HFKA 2PI5A 4ITSA 2HFVA 2MJNA 4MKAA 3VALA 2R7SA 1MG7A 4UUWA 4NLOA 5AE3A 5BYSA 3C6TA 2OEMA 3BYRA 1VQOS 3SCIE 3R5BA 5B7WA 4B3OB 1NK7A 4I6AA 4CLLA 2YX4A 4DV4F 1C0TB 1MWZA 1RT4A 1RTDA 3D0IE 5E3AA 2XWYA 1NDKA 2DNPA 4FKXA 2ZDPA 1S9EB 5F8NA 2MTLA 2X1BA 4OZ2A 4QYZK 3LPEA 2DNLA 2QLWA 3S01A 4DR1J 1MSWD 2E1PA 2Y0BB 3AA8A 3MPYA 1PCAA 4A4JA 2YQ1A 1JX4A 3R6GB 4NL5A 2HLUA 5M2PA 3DLHA 4ZP8A 1FKOA 1UETA 1WF0A 3N01A 3EM1A 4IOCQ 4DV6F 4A8SA 1Y9OA 2RUGA 3FUYA 1ACMB 1FX2A 2DIUA 1VGYA 2GMJA 2XMVA 4F7VA 2IMWP 3N79A 1G2EA 3MCSA 1E6YA 4K4SA 2O5DA 3DLEA 2ZBPA 3B82A 2B6AB 3CJ5A 3D0HE 2RJZA 3MM7A 3QGPA 4K0KF 3G87A 2VPYB 5C5JA 3Q83A 4U96A 3PRVA 3J81j 3WBZA 1U2RA 2KM8B 1RT5B 2W1BA 4Y34A 4F4KA 3DLKA 4K4VA 4NRUA 1WG4A 4BCAA 4MJKA 5CQGA 2FLNA 1MLAA 1UP1A 4Z37A 3M2VA 1J5EF 1KEKA 4OV1A 4JYAJ 2ZNZA 4MIAA 3CJRA 2AZ1A 2IAJB 3M1VA 5C42A 2ZE2A 3DOKA 4F4AA 1RHKB 2DGTA 5A0YB 4DQRA 3D6TB 4ELTA 1D8ZA 3DOLA 4M5GA 5KFVA 2JC1A 4IO1A 3ET6B 2VJUA 2DNYA 3DYAB 2YVSA 5B0CA 1TU0B 4JV0A 2VPZB 4KFBA 3SSQA 4ZIVA 1RTJA 3B6BA 5DG7A 2YNHA 3OD2A 1XMOF 2UXBF 3Q22A 5E3CA 4ZVHA 4ICLB 4NZ6A 1S7HA 2R7QA 1U8WA 4P9SA 2AV5A 3NS5A 3AQPA 3V2UC 2P9CA 4ZLNA 5ETRA 2K3KA 1VIXA 2CZ9A 1P27B 1CQNA 2ZUAA 5EUHA 3L95X 4OI0A 1URNA 2VFSA 3FFIA 2RF2A 1J5OA 4KGZB 2HVHA 2W2OP 1M5SA 3BPSP 2V8DA 4M5MA 1IM4A 4LRDA 2YPYA 1VMBA 4RO0A 1MMDA 4ZPAA 1Z4UA 2R7TA 2H51B 1TELA 5AJ3F 3ZXWA 1NH8A 2AIRB 8RUCA 5DS7A 1TL3B 3QATA 4WPAA 2HQIA 3QT5A 4C8YA 3QMQA 1NCLA 3E01B 1KQKA 4TY8A 5L1IA 2HNYA 5D8HB 2WVDA 3MAAB 3QO9A 2JDJA 3AHPA 1TL7B 2J6TA 4YR0A 5JJBA 2ABYA 2DJWA 1RWPB 1YRTA 4NLTA 5GADU 1BMQB 4F3QA 2N4CA 4MIWA 1VK8A 1W2BR 2NS1B 3HX9A 3POTB 4QIFA 2FZKB 2JHEA 1ZOTA 4JI3J 3H5SA 3OVAA 3ITHA 1RHQB 1RBAA 1ZM3A 3MCMA 1RWKB 5LMUJ 1NJZA 2Q66A 1S1TB 4FYWB 2CPXA 2KFYA 4B3MJ 1TKTB 4R0EA 4U6PA 3J7YU 2RKIA 2PMWA 2DNZA 4K2XA 3KLEA 1URRA 1LQ9A 3W2VA 4ATNA 4OI2A 3KKFA 3A8IA 1WSRA 1X4BA 5I3UB 4NZ7A 2BJ1A 4UZCA 1RWVB 4GKKF 5D0GA 2GJ2A 3GWCA 3OR2B 4KKOA 4OLPA 2CQIA 2E5IA 2MHEA 2VG7B 2CG8A 3L4BC 4NMXA 5KT6A 4K50A 3JYTB 2HK2A 4K0KJ 4NZ0A 1FCAA 2ZWPA 1N33F 2C2OB 4OYMA 1NSKL 2WW4A 1B0PA 1NDCA 2C3OA 2V67A 2YNGA 2B9WA 2J9DE 3BH6B 1XQIA 1CBKA 4D3HA 3NP5A 4EMDA 2QLBB 2RT3A 3P45B 3MUVP 3SV3A 3EGZA 4DFPA 3EMTA 4F36A 2M8DB 1Y10A 2CZVC 4O44B 4UOHA 1SPBP 2KT3A 3QNWB 2MGZB 1LFWA 2CYYA 5L1LA 1X9MA 2XB2D 1XC9A 1XNRJ 4M5DB 2JLEA 5F8IA 1FA0A 3SCLE 1XMBA 1JB0C 1SB6A 2W7PA 3MM6A 1YBTA 2R42A 3JSYA 2Z57B 2W8LA 4P10A 1F6TA 1RT3B 2XZDB 5KOXA 1VBYA 4P2XA 1WDTA 2DNKA 2X3DA 4XAKA 5E41A 1F5BA 2VJVA 4DX5A 4OZ5A 2V2QA 2F65A 3NCQA 1S57A 3Q86A 2AW0A 2LXUA 3LP0A 3MTJA 1OSCA 5F9LA 2XWXA 1LFPA 2CQ1A 4OX9F 2CRLA 3SDEB 2GVZB 3EXYA 1DLOA 2QT7A 1E6VA 5DM6Q 1WEYA 3D0GE 4U9RA 1DTTB 1X0FA 4EFAC 4RNOA 3DRPB 3RYLA 2WOMB 4C3KA 3BQ0A 3GYNA 2VC1A 2HGNA 3A8EA 4H4KC 4OZ1A 4ZPWR 3BV8A 3BSAA 2LXFA 2EKYA 3DRSB 2DHSA 4DX7A 3PM9A 4ZCIA 4C48A 3GP9A 3MM5B 5DETA 3MURP 4DS5A 1W2IA 3IR5B 3VGUA 5HMXA 1RLDA 2VBZA 3M7VA 2CJXB 4DPUA 3M05A 3M32B 4YS2A 1Q16B 2ACYA 2JJ4D 4ZS6A 2R8IA 1YQHA 1W25A 5IT0A 3QT7A 3NG8A 4OLOA 2DNGA 4CLUA 3CMAS 3L9ZA 3AD7C 3DRXA 4KPCA 5LXRA 2A6OA 4NYZA 2D3OR 2DISA 2KKHA 2NZ4A 3TZWA 1S6PB 1PYTA 4RWWA 2XEXA 4URQU 2SXLA 2V9KA 4HHJA 1EETB 3C16B 4NEYA 3NAIA 1JNRB 1OO0B 4W92B 1BY9A 1P1LA 1FKPA 3P5BP 2Z0GA 1JKHB 3TX0A 4OHWA 1HW9A 1QE1A 1YJTA 3QFHA 4ALZA 1RWUA 3OQ2A 1TMMA 2V8PA 3V5RA 2QA4S 2HZCA 5LJ3Y 1WC3A 3D1QA 2ASDA 1RJJA 4JI1J 4G1QA 5IWAF 1UA0A 2BABA 1OY6A 1B70B 1YK9A 3H5UA 4NLVA 4A8QA 2DO0A 1HA1A 2RHSB 2MZSA 2PN6A 3F56A 1LW2B 1ZPVA 3HHLC 3HP6A 2GAHC 3R7SB 5HI7A 3OLBA 2DPIA 2BR0A 4KV8A 2B6AA 5KG7A 2W9BA 5A8WB 3M9NB 1VQ7S 5J1EB 1X31C 4FNIA 3KXDA 5GAEU 4DV0F 2BQ3A 3RR7A 1N88A 3G2XA 4IRDA 3RBXA 3EVOA 2LQ9A 3QPIA 2BV3A 3Q23A 2EC2A 1UCNA 4OYWA 2BRLA 3U7JA 3IM9A 3GLJA 4OHZA 3MECB 3TYTA 3DXBA 3KMSA 3BEGB 3C46A 4ZA1A 1X7VA 3D1OA 3CJ0A 4OHXA 4DR6J 1TKXB 4AL7A 4GKJF 2DGUA 3OT9A 4MIBA 4QR1A 2BKNA 1RT2A 4O4RA 4Y2CA 1X5SA 3MM8A 4ZJLA 3RRHA 1RE1B 3BO2A 4K2JA 1IKXB 1RWNB 1PJ7A 1S1WA 4N7TA 4J9OA 1A9NB 5DG8A 3OJUA 1PIEA 4KH1B 3WIUA 3K5NA 5JUMA 3QFWA 3QYYA 1FFSB 2UXDJ 1BWVA 1JJHA 1MN9A 2VG7A 4OYPA 1S9GA 2VBXA 3P5TL 4XDDA 2ZJRQ 4B3SJ 4PUOA 2RQCA 2W9CA 4UTGA 4RUBA 4GC6A 2J0SD 1XNQJ 4DU7A 2IJFA 2V2KA 4Z2XA 1OWXA 1S1XA 4BHQA 2N7CA 5ETPA 3GIJA 3MR7A 4UQTA 3IAM9 1WHWA 3CT9A 5KFLA 2DKOB 4DR5J 3MFIA 1GXUA 2YX1A 3THPA 1P9QC 2ZHBA 5IQ6A 3K57A 2VQFJ 2DR5A 1N36F 2E5LJ 5EWFA 3DI6A 4O3OA 2VA2A 3GPAA 5DDPC 5D15A 4C98A 1VQ4S 2KXNB 1F2GA 1S4FA 1SUQB 3I31A 4KY3A 3J7Z5 4DX6A 2GVZA 4IOBA 4B9LA 1PJ6A 2CZ4A 4C3LA 4A8YA 3CC7S 3P49B 5AXMA 2MYFA 1ULRA 5K14B 1IWAA 2HFSA 1RYRA 2LMIA 1CULB 4OQJA 4M63A 4PZVA 2W7OA 4H54A 2GX8A 2PDAA 3POTA 2C1EB 3FK4A 4RW7B 3ZZRA 1ZM9A 1G4CA 2OEKA 4FN5A 3WC2A 2YY3A 4RW9A 1LEOA 2VFUA 5A8KB 4L3KA 4ECVA 2ZOFA 1VRTB 1SCJB 1R8CA 1EARA 1KS2A 2AJQA 3W5YA 2RUSA 5KFQA 1IXKA 3JTPA 1WF2A 2FZCB 2R7OA 1U7LA 1KHWA 2B3TB 2DHGA 1NPKA 3NS6A 5HMZA 3W9HA 5I42B 2JRSA 5I3UA 2BVZA 3P6YC 3D3BJ 3W65A 4N76A 2WHOA 2A1BA 1ZAXA 2YKAA 4HDHA 3T9NA 4ES1A 5LSLA 2O67A 5G4DA 1WI8A 3BBCA 3CIMA 3FCVA 4QWEA 2BJ3A 1R0AA 3C66A 3DOMB 4LRAA 3ZZUA 3MM9A 5L9XA 4ZVEA 2B4VA 2DITA 3MCNA 2V63A 2PIIA 4X4PA 4KIAA 3R1LA 2GQQA 2Y1JA 5E0OA 4NASA 2HS4A 3MMJA 4I2QA 5SZTA 3C19A 2XHCA 2BE9B 2XMAA 5F9NA 1LW0B 1HNXF 2Y1RI 3UN2A 2CJQA 4ZCMA 4EK2A 3QJLA 1YRUA 4QBUA 3AFGA 4ES3A 3OV7A 2OFGX 3TO8A 4ECWA 3A3NB 2CXEA 5ADZA 1CPZA 2DR9A 2H54B 2AEJA 1IBMJ 3FDSA 1J2VA 2HG4A 1N5QA 2GFFA 1UPMB 2FJBB 3IO1A 4QU6A 3CCZA 3Q8QB 3DOLB 2E5GA 2WB4A 3C15B 5ETLA 3EXCX 3LP0B 5K5MA 3V6HA 2A10A 1OYDA 3EZUA 1MU2B 2F4FA 3FC9A 3ZTSA 2MQOA 2UXCJ 2PFDA 4USWA 4B3SF 1S72S 2EFOA 2V4JA 3MEGB 4P72A 5CCMA 1FNMA 4XDCA 1F9EB 4LR9A 4WXWA 1KTQA 3EX7B 4ZJOA 1VQLS 1YBUA 1VOMA 3HHEA 2HFUA 1S1WB 3H42A 3HKZD 2M3DA 2BANB 2DHAA 3KDNA 3MPVA 4NA2A 1CS4B 4NCGB 3R7NB 1M0SA 3H4DA 1R6YA 2CVEA 4DS4A 5KFXA 4CO2A 2VQFF 4NLGA 5C2CA 2A3JA 4X4TA 1TQLA 3CCMS 1Y11A 2KXFA 4PWWA 2FVPA 4NXMJ 2U1AA 3LWMA 1JLGB 1PBAA 2FGCA 2Z8QA 2Z2YB 4PWUA 2IFXA 3HSJA 1RAHB 3DGVA 3DRRB 3U1NA 2H5JB 3CTRA 5J1NA 2EW9A 3CD5A 1WELA 1AB8A 4JI0F 3W61A 5D3GB 1UEKA 2HHHJ 4DUYJ 2HMIB 4NE9C 3W8GA 4RZRA 4B02A 4J9RA 1SQGA 1TR0A 4LIRA 4HYKA 2RS8A 4KGXB 1WKJA 1B7YB 3WQPA 3UDLA 1QAYA 3JSBA 5FLXY 1AFJA 3CCRS 2IY5B 2L9WA 3FKBA 2Z56B 2LU2A 3HVTA 1WHXA 4MT1A 4DFMA 4B3RF 1DY3A 2H5IB 2J5AA 2I8EA 1BE4A 2LQJA 3I5CA 3ZZYA 3JSMA 2M5YA 3KYLA 2E7WA 3BREA 3VR1A 1HIYA 2V50A 3NCRA 5D78A 2FHOB 4F8RA 5LXYA 1S1UA 4DX8H 3A1YG 5HQLA 2ADBA 2XI3A 2HYIB 2ALYB 5D77A 3SCJE 4PABA 2KH9A 1QAXA 1FNXH 3EPGA 1YZ6A 4LREA 4Y28C 5KFBA 4N41A 2CJ9A 3LGHA 3M9MB 4TN2A 1ROFA 4ETXA 1I6JA 4O3RA 3FCHA 2XO7A 3BDEA 1K8AT 4X4UA 2QLFB 1QTNB 2VFRA 4ZVRB 5A8WA 5DGAA 3MD3A 3O5TB 3SEOA 2X1AA 4KHPJ 3V6KA 4LQ3A 1Q82T 2JX2A 1C1BB 1RHRB 2AKWB 1ELOA 2J8SA 3CSKA 5A8KA 3HMJG 2UU9F 2FUG9 4X2BA 2HHTA 1HQEA 2KDOA 2YNGB 1HI8A 3NBPB 4DEZA 3QRPA 2CPZA 1OQ6A 3NS7B 1JIHA 2AYEA 5F8MA 1FJGF 2ZJQQ 2DIVA 5LJ5Y 3GYXB 1HFEL 2XLJA 4K4ZA 2IYGA 1U1KA 1U0HB 1F2HA 1ZM2A 3CULA 2V2ZA 3UD5A 4GKKJ 2NCKL 3ENVA 5KG2A 2F8EX 2X7IA 3UWTA 4A8OA 1VQ5S 2HRTA 3CJQA 4JB8B 4YB5A 3V4IB 2IRYA 1WHYA 2HNDB 4NOHA 2BYCA 2GO9A 2KO1A 2KN4A 3GZ7A 1F60B 4I2PA 4UF4A 3VVTA 1YJUA 9RUBA 2WCXA 3K58A 2ZJPQ 3EGNA 4LF1A 4OJ1A 4X66J 2AU0A 4U7CA 3BR9A 1FJ7A 3TR5A 3IG1A 2ZZMA 2GGPB 5KG0A 4ED1A 2LEAA 2YKPA 2CAJA 3K89A 3Q8RB 3H40A 3SDEA 3LP2A 3JXOA 2CDRB 4YR3A 1TL1B 1VDHA 3FEZA 4NMLA 4G1PA 2VB6A 1OPZA 1HR0F 5B0DA 4JV5F 5IT9U 1KVIA 1KOHA 1GMWD 2CQCA 3DRPA 3ILOA 3RJMB 2XLIA 4C8KA 2ZBRA 3SXLA 3RTVA 1G1XA 2JLFA 3CCJS 3DLKB 4LF4J 2YNIA 4JI5J 4DR7J 3OSPA 2W4PA 2DH8A 3UDCA 3TWZA 3OTEA 3BPDA 1TV6B 5F0UA 4DN0A 4J9KA 5E3PA 2QO3A 2AQ4A 4ED7A 2JEFA 2DGXA 1V3RA 1R8BA 2PEHA 2RU9A 3E3XA 1WSVA 2PA8D 1RCXB 4G1IA 4N8NA 1CS4A 4NCGA 6FDRA 2PA3A 1EP4A 2R3VA 3GSDA 3MUTP 4P74A 1WF1A 5KG5A 3OTCA 3DLLQ 1RBLA 3FSXA 1FRHA 1PSDA 4F4XA 1X60A 5KFSA 4IR9A 1BQNA 1DQ8A 3EVWA 3OJSA 3LWLA 3NY0A 1FTCA 3H4BA 5A0YA 1LWCB 1HBOB 2GHWA 2N3OA 5LSRA 4OZJA 2RAQA 3GR1A 1JK9B 3UPFA 5AXNA 1VHFA 1UAWA 2VBYA 1SV5A 5E5NA 3PTWA 2F8MA 2JWNA 1QTMA 2YKOA 2OPQA 3HI9A 5MAOA 3CXCR 5LMUF 2HHWA 1K0TA 4WCEQ 4JI1F 4ZP6A 4C8NA 3CDBA 1RDRA 2K7KA 2ZD1B 2AMCB 1K47A 1XR6A 3NMAA 2HPUA 3D9BA 2EKNA 3QBCA 1NXIA 2EI5A 3LO3A 4ZP7A 2HQ3A 1GH8A 2I2YA 2I9SA 4ZN3A 1VLOA 4IO9Q 1RCOB 2X1GA 2RF2B 2V8HA 2H65B 1VIOA 1T9UA 1HBNB 1SKUB 2QLXA 2DCLA 1YGYA 1P8GA 4TY8B 4ANEA 2AGOA 1GQEA 3D68A 3W63A 1U45A 2MLYA 2DT9A 1RI7A 4HTIA 1UWAA 2G0JA 3FQLA 4DMZA 4M5IA 3AJ1A 1IWGA 3DM2B 3I4PA 2KT2A 4MFBA 4KT0C 1RWMB 4DV5J 4ILLA 5C7PA 4QR2A 1TKZA 2ILZA 2DNOA 3QIPB 5DLGA 5KT7A 1LWEA 1LW0A 1MW7A 3WHIA 3OUYB 3CMQA 5KTQA 3CCLS 3G6VA 5IV3A 4LR8A 1XMOJ 3DKDA 4ECZA 4Q8EA 1N5YA 1SIWB 4FF2A 2F7VA 3MM8B 5DDRC 2JC0A 4OL8A 3R6LB 2MDAA 2LXIA 1S1TA 4DV7J 4XTTA 2BX6A 4H4OB 3ZNJ1 1QUPA 3N5BA 5KFMA 2HSEB 1R8AA 3TAMB 5HROA 2O01C 1S0NA 5BXIA 6AT1B 2R2UA 4NCAA 2CNLB 1YBAA 3TANA 4C6AA 5A8RB 1AW0A 1K1QA 1IKVB 1KVKA 2GQCA 2ZNYA 1RTHB 1WC6A 2CFXA 3MEGA 4RL1A 5KFUA 3W5ZA 1R27B 4J9PA 1WNEA 4DR5F 1EX8A 3GG0A 4WP9A 1D3WA 1S0MA 2MB0B 1NSAA 1U6BA 2YKMA 1ZA1B 2DVIA 2EFQA 2ZE2B 4DU8A 3VAGA 5H9EK 4MMOA 1TP7A 2I1RA 1D1UA 2FQQB 2NUHA 3I5BA 1TTHB 5J2PB 4EYIB 2YPZA 3PW5A 3R2CJ 1ITPA 2RMLA 1M90T 2R2SA 4TNOA 4PXEA 1XMQJ 5D0HA 4DXLA 2QE5A 1R7IA 4ZLPA 3CUNA 1YTYA 5GAHU 1CJUB 1NKBA 2DNHA 1VQKS 1CEZA 5HMWA 1TFYA 3PX6A 5F8LA 3AD9C 3PR4A 4YN3B 3MPWA 4URSA 5KFIA 3KK3A 1JLBA 5BYRA 3IWNC 3DC2A 1REVA 2Q1LA 1C4AA 2Y1IA 4O3QA 4ECUA 2LECA 3MAQA 3QGGA 2QEXS 4DV1F 2MKYA 3CEDA 1NZ8A 2N4DA 5LL6d 2NPFA 4TU9A 3NGTA 3O44A 3K5LA 2OPPA 1KRPA 3FBEA 4OFZA 3TEGA 1U1OA 4PQUA 1P1TA 1CJTB 2MQ8A 2RH3A 4Y2KA 2WVFA 5L46A 1DAXA 1DTQA 2KVIA 1S6QB 5IOLA 4GO5X 3HT3A 3NKYA 1D9DA 1T03B 2GJIA 3V4MA 2VDHA 3I82A 1HBOA 1EJ7L 3A8KA 4HHUA 2Z30B 4WJBA 4DR2J 4A8KA 3N4WA 2NZCA 3VV2B 3BDPA 4EZ9A 1MNEA 1X0PA 2JL9A 4RBTA 2FHJD 2ATLA 1I94F 4LFAF 2CQHA 4OZNA 1FERA 2LU1A 2L3MA 4N47A 2BJEA 1GX5A 2MLZA 1N4LA 4K4UA 4DL5A 2CQGA 3OTBA 3FSIA 2OTJS 3S6EA 1LK7A 2F63A 3S8SA 3RBZA 1HQEB 3NBPA 4QIWD 3FJ2A 3M2UB 4A8XA 2HRUA 4CLKA 4MAKA 1FNOA 1NHUA 1P9YA 2QTWA 4DUTA 1UFKA 2XYGB 5I3QA 4DUZJ 1HHTP 4FVCA 3PY8A 5AE2A 4NXNJ 4O3SA 1N5YB 3DMJB 4U7UK 4DV7F 1S99A 3D1HA 2NXUA 3NGDA 4ED2A 1JJCB 4X4VA 2QIFA 2XGQA 3PFEA 3DM2A 4MFBB 5B08A 3JAMY 2VIHA 2OD6A 3KK1B 3C3LA 1LNQA 4JI8F 4IFYB 1JLFB 1HBUB 4IH7A 3X3UA 2YKNB 2MSSA 4AFFA 1KD1T 4B9NA 4PKDB 1RISA 4Q43A 4A8FA 3KJQB 3E8OA 1WTFA 2D41A 1HMVA 2JFDA 4OMFG 4TLQA 4K4TA 3ZTOA 3M8QA 2FY8A 2YTCA 3P8BB 2R7VA 1S7IA 2AX1A 3AODA 3AOBA 1VJWA 3DOKB 4X62F 3VZIA 1WEZA 1YSJA 3CIZA 3DLGA 1SXLA 4ZMMA 4KV8B 2J0WA 1ZPWX 3GCWP 2DGVA 1HQUA 3CD7A 3QZ8A 5LMNF 2J0QD 3MM6B 1JLGA 2AT1B 3LH2S 3TI0A 1RWOB 2PMZD 2AEFA 4ANDA 3QAUA 3QGHA 3WDOA 1FO1A 4CLZA 2JSXA 4DFJA 3PJWA 4H4OA 4GC7A 5J1PA 2AGQA 3IA0A 2W8KA 1TAQA 4ER8A 4QWAA 2LP4A 3O3LA 3TZYA 2RD5C 3FFIB 3HZEA 3MM5A 3QAEA 3A3OB 4FYXB 4OHVA 1RYSA 2UUAJ 1QDUB 2V8GA 1IKWA 1MMNA 8ATCB 1S59A 1S1VA 1WD6A 5KFFA 1O6XA 1S9GB 5DJBA 2WOMA 4ECTA 1HNVA 3G8SA 2VFTA 5E7OB 3IRWP 1CJUA 1WOSA 2EK6A 1HI1A 1NAQA 1S9EA 3H2UB 2HQDA 4K7QA 5U47A 3VZHA 2VOPA 3HCXA 4B3MF 1FD2A 3P3DA 1VK3A 3FZ2A 2HVDA 1N52B 5HVFA 2D9OA 1EETA 3C16A 4I56A 4DL6A 2HWTA 3NAHA 1A7GE 3HD1A 2OI2A 1F5CA 4I0WA 4OI1A 2QSWA 1NK0A 2BE2B 2CDQA 3Q2TC 4IYQA 2DH7A 3W9JA 2HBZB 4ZHRB 3NGSA 2J0XA 4HHHA 4BDPA 3BGRB 4IFVA 2BQRA 4KTQA 4PEOA 5EX3A 2W25A 4NLQA 1SBRA 2VQEJ 4Q0BB 5HBMB 2I5JA 1KOOA 2WSCC 3H2LA 5F41A 5DGBA 3FMWA 3CMES 2DHHA 2CKWA 3OXGA 2LFVA 4P75A 1I5OB 4TYBA 5D0RA 3KLFB 5IT9Y 2VKRA 1T9YA 2HQGA 1AXQA 1RTIA 4IDKA 4W4MA 5HSPA 2J9DA 2Z2LA 2MKCA 4CH7A 5CYQA 2KG1A 4EBCA 1RLCL 1CJVA 5ETMA 1WDDA 4KJIA 4WTOB 2DGSA 1FXLA 4NLRA 3TARA 2VA3A 2ZFHA 3SFUA 3DDKA 3V81B 5CZXA 2Q3PA 4BWJA 3IC1A 3MEDB 1NMEB 4ZVUB 1GMWA 1NJWA 4ZLLA 5C2GA 1Q8BA 2RE1A 2JNJA 3JQJA 2FIUA 4NEZA 1RB0A 2M8HA 2CQ0A 1TVRA 3KJFB 3GE9A 3P96A 3F44A 3HVWA 1U0SA 4KO0A 3BJYA 3RR8A 2XMMA 1VRTA 2CNNB 4K8RA 5C25A 2C2MB 5KG1A 5HLFB 2QL7B 4OYAA 1NM2A 2KFZA 3IWLA 2ZH6A 3FEXB 2FVRA 1YZ7A 2ZKUA 3IG1B 2QMWA 1O5JA 1U25A 2QMUB 2IM2A 2PE8A 4X4NA 1KN6A 1N5TA 2V5HG 3W2WA 4FF1A 2R7WA 4QWBA 1T94A 1U8SA 2PT0A 1LV5A 3CJKB 2ZH1A 4WK3A 4WE1B 5LMNJ 1R8PA 4NLPA 1X4EA 2CJYB 4FYVB 1UJ5A 3CJ3A 2ILYA 4ECYA 1Q5VA 4CLPA 2UUWA 2QJ3A 1IKYA 2ACMA 4LSZB 4ECSA 3MAAA 1U47A 2WRMA 4DI6A 4TU7A 4BC9A 1FE4A 1YJ9S 2W7AA 1QVFR 2MEWA 4QR0A 3CW2C 5B09A 4LSLA 3D5MA 1HARA 3FRYA 3DI6B 4J9NA 4A8MP 4DQIA 4ILRA 4LF5J 4QWCA 4LBIA 3A13A 3ZZ0A 1N48A 3PIPQ 1V3ZA 2BW2A 5E3QA 1GEHA 2CPEA 3BS9A 3W5XA 1TUVA 1FVSA 2V4JB 1ZH5A 3BGOP 1U24A 3UVJB 4K4XA 2BUNA 2F3JA 5CA5A 1UA1A 3AAWB 5FLXU 3PKMA 1C2PA 2VD3A 4BC7A 2NSBA 4DR1F 4O0NA 3FGVA 1HQUB 4O3PA 2B9XA 3AOAA 3H5XA 1QSYA 2YKQA 2F5GA 3NXZA 3TAQA 4NCBA 2IVMA 1B64A 4DV3J 1IBLJ 5K14A 4JI3F 5B0BA 2OUGA 2VG5B 1ZS6A 2KHDA 3AA9A 3BKFA 4FDFA 4RLEA 4KKOB 4DF4A 3K0JA 2ZH3A 4DR6F 1B3TA 1O8BA 3CO9A 4LFBJ 1YLXA 1DBDA 1FWPA 3DRRA 2IM0A 4PCQA 4RW9B 4XPEA 2OPRB 4RW8A 1JLAB 4KB7A 4A46A 3L7PA 1NUEA 2MKSA 4PXBA 3M2UA 1KKHA 4ED5A 2M52A 1RAIB 3CDWA 3CDUA 2PMHA 1N0VC 3LUYA 5GAGU 4OZLA 3DOMA 3GV8B 4RKUC 3THVA 1YJVA 2VBWA 3DGPA 2W4CA 4USVA 2NQPA 4N5SA 1RTDB 2FJDB 3G9CA 2VDIA 2CQ4A 2ZEJA 3IM8A 2ZC4A 3G8QA 1LWEB 3OUYA 2BQUA 2J9CA 1HBUA 1JLFA 2VH7A 3HM9A 4DQQA 1CC7A 2ALZA 2AGPA 1EIYB 2NR0A 3RBEA 2JVRA 3I4HX 4CH0S 3D4JA 4JV2A 3ENQA 2X1FA 1KNZA 2YWGA 2MZRA 1HMVB 1RAEB 3T1AA 2LLZA 3HVTB 3D66A 2IPOB 2RIJA 2XI2A 1U09A 1RA7A 1X4AA 4DPTA 3FQKA 2HS0A 2EC0A 3R3TA 1M1KT 3AH6A 1XNQF 1PBUA 1SI9A 3QJPA 1CC8A 4NYOA 1T3NA 4JI4J 2ZOGA 3HPOA 3ZTPA 1N6QA 2ADCA 4M5NA 2OPSA 1HR0J 1IKXA 2AYGA 1HNIA 4V1Ak 3ICLA 1FE0A 4RWXA 5ETTA 2YWKA 1OMSA 3DLGB 5K8NA 2G13A 1APSA 3D3CJ 2J7UA 2EBEA 2FYXA 2MSTA 3P4UB 3FBFA 3TJAA 2FHKA 1FVQA 2OKQA 2V68A 5KFYA 4ELVA 4PUOB 4J91A 5IZHA 1NLKL 1MROA 2K2PA 4X4SA 5J2MB 2HAIA 3TAPA 4PG6A 3K2YA 2IM1A 1U1RA 3KK3B 4OYZA 2KJWA 4CWBA 1D9AA 3PO4A 2VZ9A 5DDOC 1HNZJ 2FJXA 3RAMA 3ILJA 2AD9A 1ZTWA 4E2FB 1KQFB 2RSQA 4PYAA 4PXCA 1IKWB 4CCHA 1HNWJ 2F9DA 1ZAWA 2FLOA 3K8WA 2E7VA 3I9ZA 1VHIA 1WOPA 2YNHB 5GAEI 3HF5A 4WXOA 4LF9F 2MQNA 4JI0J 2AX0A 4EZ6A 1NK5A 1S0VA 2DHXA 2H4YB 4WFZA 1YRXA 4Q0BA 3LF0A 5IM0A 1CLFA 2HGLA 5HP1A 5A2QY 4FXVA 1FEHA 2QGFB 4KC5A 2HHVA 3NEKA 2W9BB 3A3PB 2YQ3A 4ZVQB 5FDLA 2DRBA 1R8HA 1SJFA 1HPZB 2HIQA 1AZSB 1VS3A 1WG1A 2QA2A 3GG1A 3Q8VA 4QPTA 2RDJA 3BBFA 1J5OB 3QWPA 2FY1A 2R8HA 2AZ3A 3VQTA 2YWEA 2R8GA 4LRCA 2WVBA 3SYZA 4Y65A 4WZMA 5KFOA 3RW6A 3N6MA 5ETKA 1NPPA 1XBWA 4C2MA 4YQWA 3SV4A 1VR6A 4UZBA 1XR5A 3OFFA 1UVNA 1DQ9A 1U48A 3KDOA 1DRZA 2QN6B 3DDIA 2OELA 3NL0A 4QIVA 4B3TF 4DG1A 3CD0A 4USKA 5KT2A 1D8YA 2UP1A 5KG4A 2PI4A 3ZTQA 4PQAA 2HZVA 4F2RA 5F8GA 1YJNS 1JLEB 2ZITA 5HL7Q 3EJMA 4RUAA 4DR3J 4ZVGA 4BWMA 1IBKJ 3V6DA 3QT8A 2UUCF 2EG1A 3HHDA 4DF8A 1UJ6A 1VRUA 1U6ZA 1ZA2B 1Q78A 4I69A 4F3MA 2D74B 1WI6A 2QYGA 1X5TA 2D9PA 2XNQA 2E44A 2OIHA 2L08A 1Y7PA 2J8AA 3ENWA 5IC6B 2XS2A 3OLAA 3GJQB 2FJVA 4RW4A 1KFSA 4EO6A 1YHQS 1T95A 3DCAA 4I2PB 5KFRA 2M9KA 1JWWA 4OX7A 3MCOA 1UVLA 3CDEA 3EICA 4OX6A 5GMDA 2ZH8A 3CJ4A 5KFZA 1N36J 1BWEA 3RUBL 1VQ6S 5DDQC 1RQ0A 2Y1LB 4ZLJA 5HATA 1JXLA 2NUUG 2OMLA 1T05A 1GXLA 4WE1A 3JYTA 1YKWA 3W3SA 5HANA 3PR5B 2G9OA 2OO4A 4RW6A 2AHOB 4LBPA 2CWKA 3D6MB 1FKAF 3DFEA 1DURA 4NLXA 2QLJB 2MZJA 2GGPA 1RT3A 4NI2B 5EWEA 1F0XA 3PYEA 3PVXA 3M6VA 5KG3A 3S7RA 3CF5Q 2Q43A 3HFZB 3TAMA 1TK0A 3LW5C 1H72C 1HNZF 4CYUA 2GMHA 4B17A 1HYSA 2G2YA 1B0TA 1X4CA 3GQCA 4PPDA 1HW8A 4R8UA 2VASA 1FF2A 1FFWB 1WHVA 2XBPA 4USMA 2HBQB 3UN3A 3OTOJ 4WIQA 1FHTA 5D4LA 1LWFB 3G86A 2Z2MA 4RPFA 1X4HA 4P2MA 2VICA 2XGPA 4U7UD 4ZPBA 2YWWA 1X8DA 2W4DA 4J9VA 2IHR1 3QT6A 3TJ9A 3TVYA 5L38A 3CE8A 3LA0A 4DR4J 1C1CB 1FWLA 2C3YA 3I32A 4NLYA 5F8HA 4YR2A 3J7YI 4DV0J 1OJ4A 2JOQA 3G6ES 1RT4B 2LDIA 1YITS 3PACA 1NRKA 2RQKA 1SL0A 8AT1B 2BW7A 1WKKA 4LF2A 4PG7A 1RZMA 4F26A 4ZK7M 2R7RA 1X9WA 1I94J 3M30A 3MEEA 3DRSA 7FD1A 2FJEB 5GADI 4PG5A 2OSRA 3RB4A 5KAKA 1HNXJ 1NB2A 5KFAA 2EVZA 3MTKA 5B0EA 1W26A 3HDSA 2M0GB 3ZZPA 3C2PA 4DWIA 4RBUA 4GKJJ 4PG4A 1AA1B 1RACB 5EGYA 3GV5B 2RQMA 2P6TA 1QAIA 4IRCA 4MKBA 1NK4A 2GO8A 5CD4H 1S6OA 3MR5A 4HR2A 3AD8C 2F4VF 2GZOA 3ISZA 3PRBA 3CCUS 1F3VA 2GC8A 2BM1A 4C3MA 3ITHB 1V3SA 1PAUB 4R5PB 1HBNA 1PYOB 4Y3CA 4I6WA 3PHTA 3R97A 4DG1B 1GTEA 5KT3A 2LCWA 2O1PA 4EEYA 1S48A 2XMWA 2RKIB 1BQMA 1UJ4A 3JS9A 5H1SV 1VQ9S 1P6TA 1SC6A 4NA1A 4WFBQ 1PYSB 5CXTA 1UKUA 3GONA 3PDNA 4JI2J 3OHAA 3BO3A 3UD4P 3BB5A 4WKYA 5L1KA 4ED3A 1SC4B 3M2RA 1UWBB 2VF3A 3C6UB 4KR0B 3PKYA 4F2SA 2C2RA 1UVIA 3HO1A 2MPUA 4KH0B 3KLIB 2N82B 2IC3B 2KT5A 2D3UA 2OPSB 3EGVA 2K06A 5CABA 1TKXA 4L6V3 3VGVA 3PW4A 1BC6A 4C11A 2H9ZA 2JEGA 1JLEA 4OX9J 2KG0A 3HHNB 1S97A 3QSIA 1R0AB 4KAIA 4WFAQ 4FZVA 3DMJA 1RADB 2G2ZA 1WC4A 5CCLA 3H7HB 2DGQA 2M7SA 4ED4A 4LSLB 3B4DA 3UW1A 2V4RA 2KTQA 1VI7A 4DL2A 1ZZFA 3KK1A 2CPIA 1L3TA 3MXHP 2PO4A 3N0VA 3G71S 2WBRA 4B9UA 4LF7J 3L7OA 2BJ9A 3AXMA 3KUHA 2HHQA 3SFGA 4RUHA 3TUPA 1QSSA 3M6UA 4J90A 5DRKA 1FRXA 1TZ0A 4AXIA 2VC0A 4TQRA 1XJWB 1XWLA 2CADA 4WFXA 2ZH7A 4ID5B 4GVLA 4ANCA 2POKA 2HVIA 4MH8A 4MKVA 2OAUA 1S49A 4M5LA 5CYMA 1ZYQA 3RU0A 1SUQA 2GAGC 3M8ZA 2CVIA 2L9DA 1JLBB 4ZIWA 4B3RJ 1IN0A 2VU5A 1NJXA 1VRQC 4LFBF 3HSDA 2VQEF 1AUDA 4F67A 3MMAA 2NLWA 3PJ9A 2DEJA 4KYZA 4RW7A 3M1VB 4G3IA 2OEJA 1T03A 1Q8KA 3PYGA 3MDFA 4OZ3A 4WBFA 3K59A 2FVCA 2CJAA 2KM8C 1SVDA 2HWHA 2RVJA 4BS2A 1HWIA 5G0RA 2RNEA 4KHMA 1LWFA 2PEBA 3PEJA 2BOPA 4OIXA 1YWXA 4OI4A 4TY9A 4USJC 3KHGA 3WZ0A 3O8WA 3BYPA 3EVMA 5CYJA 2L48A 4ID8A 5HQMA 1IM6A 1FRLA 2DGWA 2DTJA 1UTAA 1K1SA 3M6XA 4ZVPB 3KLGB 4J9SA 1NEEA 2B43A 4UOFA 3HHKA 1N32J 3UQSA 2OSQA 2CPHA 4F50A 4DFKA 4C0HA 2G1DA 1RT6B 1N5VA 1FK9B 1LKZA 3JQMA 2FVSA 2QMXA 2ZM6J 4RNMA 2DNMA 1WKLA 2HS3A 4ZVTB 3MEEB 4M5HA 2BA9A 5EN1A 3TW0A 3OPKA 5F0WA 4C8MA 4A47A 4Y2AA 3Q8SB 4DQSA 1RK8A 4O23A 3BM7A 1H73A 4WFYA 4YDDB 1V5VA 3TUIC 4ZN1A 3KLFA 1UZHA 2C3PA 1DJ0A 1TL3A 1I3OB 1RGVA 2WSFC 2XMTA 4H4MB 2EG2A 2O66A 5AXKA 1SKWA 3TEHB 3OXLA 1QSLA 3W1YC 2ZC3A 4HI1A 1DFDA 4RNNA 5CYQB 4F4WA 2V34A 4GRSA 2QA4G 4HT5A 1SL1A 2R8JA 2KRBA 2GIRA 4OI3A 4NA3A 4AYBD 1SH0A 3BO4A 4DSIA 3K7RA 4IOAQ 2ZH4A 1XN9A 2I38A 2P9GA 4Q44A 4R5PA 1FXDA 2QL5B 3IR7B 5EWGA 5J2MA 2E9RX 1HYSB 1R43A 3FBBA 1CJVB 3LPYA 3O6QA 3PYFA 4P7VA 3C14A 4R8UB 5M2UA 5H9FK 2DRAA 2D1CA 2YKMB 4F0KA 3PO5A 4FF3A 2E66A 4WTYA 1Z1ZA 2HZAA 4L76A 4YEAA 3MEKA 1UW9A 3G6YA 4I7FB 2YH1A 1M5HA 2CJBA 3RB3A 3C15A 1L3KA 2ROEA 3PIOQ 4ED6A 2EPIA 5J2PA 4LF6J 2WBMA 3M2RB 5E2QA 2OPQB 3ETOA 5IWAJ 2MMYA 1VBXA 1GX6A 4FYDA 1OPIA 2FC8A 2LA6A 3KHHA 3ISND 4CP5A 1BLUA 4MK7A 4ZITA 2P8IA 3H2VE 5ITHA 3LP1A 1Q8IA 2HAFA 3OR2A 5DQIA 2J6UA 4X4RA 2AJ0A 2GVDB 4B08A 3V4IA 3SQGB 4UUXA 3NWGA 2WTFA 2QG9B 4I68A 1RT7B 4RNHA 2VOOA 4PWDB 3DLJA 1REVB 5HK4A 1S0OA 1FKPB 1BD6A 4QW9A 1C1CA 2OD4A 1UEVA 2C28A 5HVGA 2E5HA 3G82B 2JH3A 3LTOA 4ZDNA 3R9LA 2UUBF 1Q1KA 2MGZA 3RRKA 1FWKA 3MF5A 4CO4A 1HNVB 4MK9A 1X9SA 2BM0A 3D2WA 3J80U 2G0CA 3IWXA 2K1RA 1TL1A 3BZQA 3GTYX 3DU6A 4A48A 4DCOB 2MZQA 3QRQA 5K8MA 2EXUA 2I0XA 1HWJA 2LQ8A 2X3GA 1PAEX 4CLTA 3DDNA 2MQMA 5IFMA 1RTIB 4IDKB 4ZHRA 3FSYA 3HD2A 3EPIA 2IM3A 1PGZA 2HNYB 5KFGA 4U8VA 5CH7B 1FDAA 1KSPA 4OJGA 2ROGA 2IMOA 3N9UC 3IN5A 1Q86T 1UVJA 4WKRA 1M5PC 1FXRA 2FD2A 1XERA 3OXFA 4LSNA 3CJTA 3D28A 4FXWA 3JSMB 4JI7F 4HL9A 2LYVA 4O4GA 2Y9HA 1Y3KA 1ZAVA 4OYBA 3PW0A 2C3MA 1W7WA 2OH2A 1LWCA 3MI7X 1U49A 4N77A 5JMNA 3EGWB 5IV4A 1KQSR 3GU0A 2R2TA 4B9VA 4FKYA 3CNQP 4N8OA 3TX8A 4Z7CA 3MR6A 4DLGA 2FVQA 4LMZA 1H3DA 3EDQB 4NWBA 5SUHA 3CJSA 1X4DA 2R8KA 5D4NA 3OBIA 2ASYA 1TKDA 2RRBA 2HHHF 3HFVA 2XMJA 1FFGB 2UVVA 1IJFB 3T9ZA 2W01A 1S1XB 3GILA 4CO5A 5C24B 2GHVC 2QRRA 4X65F 5KFHA 2NPIA 2OP5A 2BBEA 2GNKA 4CNZA 1K44A 1U0HA 3NRBA 3UFCX 1K73T 4DV1J 3M2VB 2XHWA 1OSDA 2D7SA 3R5CA 3K5OA 4EBDA 1CJKB 1V9OA 3R5DA 1FT8A 4CLSA 4NLSA 1BHNA 4O3NA 1MMLA 2HNZA 2BMBA 3UCUP 1RBOB 1Q95G 4OJ3A 2HBRB 2YBVA 4EYHB 4A8WA 4BLGA 3M4XA 2LVWA 4PRFA 1EZZB 1IKYB 1KQGB 2RRNA 3THTA 1FRKA 3ZO7A 1YDLA 2IAJA 1XIQA 3NOCA 4QOTA 1ZETA 4Y6IA 2M88A 4RU2A 1PC5A 2D3ZA 1HNIB 3D7SB 4AD6A 1D0EA 3MECA 2E1MC 4FPIA 3S1TA 2P6SA 2YH0A 1FRJA 3WX8A 3B4MA 1N6QB 2FHJA 4C0BA 3M8RA 3OL9A 1D09B 3IRXB 4ICLA 2WB1D 4P2SA 3OTOF 3LP1B 4Z7YA 2CQDA 3SZ2A 2XY5A 3OSNA 2BKOA 2DNRA 3GJTB 1HBMA 1NSQA 5FD1A 4JV1A 3BGLA 4DSKA 3JAMU 1OQ3A 2CIMA 4HVZA 4LBHA 4GVBA 3DHXA 2ZWOA 4YP3A 1B99A 1AROP 2U2FA 3ADAC 4Y2IA 5KFWA 2AJ4A 1SKSA 4CT9A 5DLFA 4ZVOB 5DG9A 1HWUA 1FK9A 2B4OA 2UXCF 2KZZA 1VQ8S 2FPHX 5LSOA 3KHLA 1UVKA 4W90B 2Q79A 3CCWA 4PWDA 1Y0HA 2HLTA 2BZ2A 4XIUA 2COLA 2ZBQA 3CWJA 1S6PA 4NLDA 3T1YJ 2FLPA 1T7PA 2HRYA 2EFNA 4QWDA 1FTRA 4I64A 1BQMB 2BEFA 1EKSA 2FTRA 1QE1B 5E3RA 4JI4F 1DQAA 2BJ7A 5HAOA 4QPXA 2E1CA 4JI2F 4RU9A 2ERRA 2E1AA 3C8YA 2HVEA 3AY0A 3V81A 4C9DA 3W66A 3KLEB 2WVCA 3NLCA 3SIPB 3TZZA 1IR0A 2VPWB 1QM9A 5FDLB 3OL7A 1RABB 4DZ6A 3TP2A 4UW2A 2IC3A 4DJBA 3VGTA 3G4SS 2JEJA 4CZCA 3HHLA 4EBEA 2I6WA 3M8SA 4CLWA 3VVUA 1TUWA 2HHSA 3RAQA 1TL5A 4HLBA 1RAAB 3EDRB 2IRXA 2LDYA 2DD8S 4AL6A 1TKZB 3QIPA 3BQ1A 3GYGA 3CCSS 7AT1B 3L7UA 4IKAA 4UOGA 2NREA 2Z4PA 3SSRA 1S10A 2BRKA 4LF4F 2ZHAA 5ETSA 2IIHA 2E7XA 4B9MA 1TL4A 4JI5F 4Y00A 3NGKA 4CNYA 4M5JA 3PV8A 1Q0NA 1IKVA 3BSOA 4F0HA 3MFHA 2HW3A 1H2VZ 1R31A 2DNNA 2VG6B 3F41A 1SJQA 3IBCB 1RT2B 3IXQA 4EWTA 3H8YA 5HQ8A 5MLCV 3K5MA 2IA6A 2ATCB 3M8PB 3O2IA 1KTVA 3GCXP 2DK2A 3ILLA 2B4PA 2YNFA 2HFNA 4ZP9A 2MHNA 3ZZTA 1I1GA 4K4WA 1QAJA 2BJ8A 4DV4J 3Q89A 1JJ4A 2JEIA 1GT8A 3FRZA 2N7YA 3MAHA 4KHPF 2W24A 4I4BA 2Q6CA 1RAGB 1U4BA 3OW2R 2UU9J 4DDFA 3UVJA 2RB7A 3SSSA 1JLCB 2OTLS 2BXJA 4CH1A 1KR4A 1NPRA 1H7WA 5HP1B 1L3UA 3AXKA 5T14A 4LF8F 4Q8FA 4ZOSA 1IR2A 1Y3JA 3IAS9 3KJVA 2G1HA 3EZ5A 3MUMP 2OLWA 3OFGA 3KNGA 1NNDA 3I6PA 2HNZB 2C2EA 2VV5A 3H5YA 1HD1A 2OHDA 3CGIA 3MZIA 4UY85 1KONA 2MZTA 3LGMA 5J2NA 1GNKA 2VG5A 2DH9A 2CA9A 2KI2A 2J6SA 3BN7A 1Y5LB 2DR6A 1RWXB 2JZ5A 1RAFB 4FPRA 4IG3A 1UPPA 4K59A 3MR2A 4DR3F 1NJYA 2LEBA 1IBKF 3CCQS 1OIAA 1Y5IB 2OPRA 4RW8B 4FBTA 3GV7B 4M1KA 3TA0A 2LEPA 2VPXB 3CB4A 3Q24A 3HLUA 5IXUA 4DCPB 5K8PA 3BKTA 4J9UE 1WACA 5T7LB 2HBYB 3GSIA 3IRXA 1KDNA 4FNHA 3VAFA 2ZHOA 4NLUA 2DR7A 4RJVA 3TA1A 1EQ0A 1RTJB 3VCDA 4AL5A 1S6QA 1HHSA 4E8UA 2XCAA 3GJRB 2BKPA 3I0RA 3ZZZA 1H74A 3VAIA 3NNHA 4QCLA 5M2RA 3U02A 1XTZA 1OY8A 4ECRA 1UMJA 1WWHA 1Q5YA 3JB9k 4JI7J 1T9VA 3QLHA 4YDXA 2XSJA 2FB0A 3SBMA 4UT4A 3ZC4A 1RT1A 2J76E 3WC0A 1NSPA 5J1EA 3RBDA 4QIEA 1U1QA 2NYHA 4AQYJ 1JXVA 2A2CA 2QFIA 3KG4A 3KLVA 4DSFA 4KHRA 3K5PA 3PHEA 2G4BA 1BQXA 3I96A 1SC1B 4LQ9A 1TMJA 1HI0P 2A0FB 4RBVA 3U27A 4UOCA 4CQ1A 1REGX 1RU2A 1VBKA 1VC6A 2WONA 1OS5A 2XMUA 2GS8A 3RG6A 1BXNA 3PCOB 5KFKA 2HGMA 4NRTA 4QIGA 4AT1B 2C2KB 2H1YA 3CJ8A 4ES2A 2B0GA 4C8OA 2WK4A 3E01A 3ETMA 3LAKA 2C42A 2YNIB 4WP3A 2XM3A 1HLWA 1SJRA 3UD3P 1QD1A 1H2TZ 4K4YA 4I7FA 3PW7A 5KFCA 3H90A 1WC5A 4TKTA 5HVHA 2L41A 1FDBA 1GXTA 2A2DA 3I55S 5DZ7A 3WX4A 5GMKa 2DPJA 2EFVA 1S79A 2BACA 2CPYA 1QVGR 1S6UA 3H98A 3OL6A 4USIA 5RUBA 3MOJB 4W98A 1BQNB 2MQLA 1RT5A 3N6LA 4I1TA 2M70A 1EB0A 2CQ3A 3GMGA 2IYIA 1FDNA 3HVAA 3IGNA 4HEA9 4R0JA 4QQBA 5C25B 5F3ZA 5A2QU 3UE2A 1Y4ZB 3DN9A 5B0GA 2W2QP 5C42B 1ICEB 2XS7A 2CPDA 3HSZA 3B8HA 2UUBJ 3T19A 1OY9A 2BANA 3M32A 4YY3F 3ENAA 3KLIA 4QZVB 3EE3A 5JXSA 4YB1P 3VAHA 4DPXA 1UZDA 1AUSL 2EBGA 2F8HA 2VG6A 4DV3F 4X84A 1IBLF 3CJKA 3TVKA 3J81Y 1Q53A 3AJDA 3RAXA 4YOEA 2KVQE 2N3LA 2QZ8A 4EO8A 1NK8A 3GIKA 1NKCA 1U6FA 4ED0A 4F02A 1NDPA 2VL1A 3M30B 3R5GA 4LFAJ 4XO0A 4GVBB 4OX8A 3PFOA 1F9FA 2BE7D 3KTQA 5K9FA 5T41A 3F0NA 5D3GA 1ZM4A 3QRRA 3R7BB 2XULA 1V5IB 2GW8A 2YWFA 1L3VA 2X51A 5GVQA 2XY6A 5DQHA 3R1HA 2UUCJ 1UL3A 2EFGA 2OPPB 1HQ2A 3NNCA 4G1QB 4Q2MA 3K17A 4FF4A 1K0VA 1C0UA 3BGRA 4IFVB 1HWLA 1T9TA 5CYMB 1FRMA 2B56A 3B78A 2JLGA 1JLCA 1GK8A 1JJ2R 1T9WA 4X62J 4O4GB 1FRIA 3HULA 3N28A 3PEHA 4P73A 2FLLA 2HHXA 4LRBA 2Y8WA 1HHQA 3BGFA 4WU2A 4ENOA 4F04B 5BR8F 4NXMF 4E0DA 2YWHA 2KFNA 4USUA 1PKUA 5A6PA 5B0FA 3MGJA 5J2NB 1HD0A 1SQEA 2CNKB 4XK8C 1IR1A 1KLNA 2K7JA 5G0RB 4OYIA 2DEIA 1JLQB 3D6FB 2CUYA 2B4UA 1EQMA 3UI3A 2ZUGA 3LQVA 1UFLA 3QQCD 2AP6A 5EHHA 3HXMA 4RX6A 3I0RB 2LKZA 1YG0A 2R2RA 3TOQA 1S76D 4MYUA 3OHBA 5B0AA 3CD6S 1WC0A 1RHJB 1TVRB 4KO0B 2NXJA 4AUKA 1XEZA 2XMKA 4C7QA 1JQGA 1SQFA 4YMEA 4DR7F 4QYZJ 3T5LA 1C0TA 2ZH5A 3MEDA 4HTJA 4DLEA 2KYXA 4LR7A 4EGLA 3NWRA 1R0BG 1Q79A 1CJKA 3C6UA 1EKRA 1VLYA 2OMOA 3DU5A 5KOWA 4HACA 4KRWA 5L1JA 2DGOA 2JVOA 4M8LA 5E33A 1E6YB 1U2FA 1AYEA 4RNFA 4PPZA 4YFUA 1UW4A 4G65A 4C0OC 2J9EA 2UV8A 3H59A 3NOGA 5F3TA 4ERDA 3M8PA 2IA0A 4X65J 4U67Q 2R7XA 1JKHA 4USHA 1Q81T 1VYAA 2AJ2A 2IDLA 2K8GA 2PC6A 3GFHA 2CG4A 4LVNP 1UFWA 2C2NA 5LM7E 3DNCA 5HJYA 5ETOA 4LIWA 3W2WB 1WG5A 1F5AA 1DHMA 2EFPA 4CTAB 3TZXA 5DQGA 4C97A 1RTZA 2DRDA 2DB1A 2DO4A 4YY3J 2WAQD 4HI2A 2PSZA 4PG8A 4IQXA 1NDLA 5JVGQ 4DPOA 2E29A 1KC8T 4IUFA 1CQMA 2KXHA 3VGSA 1CJTA 1U1PA 4FXDA 2LQBA 2XNRA 4DV6J 3OL8A 4DSLA 1ZZNA 4WF9Q 1LOUA 2KB2A 2Y3YA 3FVYA 2AYMA 3KJVB 4IG3B 5JVHQ 3CC4S 2CNOB 1XR7A 3JQKA 4I67A 2JFKA 2XZWA 2VHGA 3ZNUA
chains in the Genus database with same CATH topology
2QLJB 1RHUB 3EDRB 3R5JB 2CDRB 1SC3B 1ICEB 2H51B 3RJMB 2C2ZB 1GFWB 2H54B 2HBQB 2XZTB 3IBCB 3R7SB 1NMEB 4ZVUB 1I51B 3EDQB 3P4UB 3KJFB 4ZVPB 1RWPB 2CNNB 2C2MB 1F9EB 1BMQB 2QL7B 3R7BB 1RHQB 3R7NB 1RWKB 2XYHB 4ZVTB 2XYPB 5IC4B 1RE1B 4ZVSB 1RWNB 2XYGB 1I3OB 2CJYB 2H4YB 2H5JB 2HBRB 1RWVB 2H48B 2P2CB 1RWWB 4LSZB 3IBFB 2CNKB 4ZVQB 1RWXB 2C2OB 1PAUB 2H65B 1RHMB 3D6FB 1PYOB 3KJQB 2QL5B 2QLBB 3P45B 2H5IB 1RHJB 3QNWB 1RWMB 2DKOB 4DCPB 2HBYB 2Y0BB 3GJTB 3R6GB 1SC4B 5K20B 3GJRB 2XZDB 3R6LB 1RWOB 3D6HB 1IBCB 2QLFB 4ZVOB 1QTNB 2C1EB 4ZVRB 2CNLB 1RHRB 2H4WB 1SC1B 1QDUB 5IC6B 3GJQB 3NS7B 1RHKB 2C2KB 4DCOB 2QL9B 3GJSB 2FQQB 2Y1LB 2CJXB 4JB8B 3SIPB 4DCJB 2CNOB 2HBZB 3KJNB 3D6MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLJ B;  1RHU B;  3EDR B;  3R5J B;  2CDR B;  1SC3 B;  1ICE B;  2H51 B;  3RJM B;  2C2Z B;  1GFW B;  2H54 B;  2HBQ B;  2XZT B;  3IBC B;  3R7S B;  1NME B;  4ZVU B;  1I51 B;  3EDQ B;  3P4U B;  3KJF B;  4ZVP B;  1RWP B;  2CNN B;  2C2M B;  1F9E B;  1BMQ B;  2QL7 B;  3R7B B;  1RHQ B;  3R7N B;  1RWK B;  2XYH B;  4ZVT B;  2XYP B;  5IC4 B;  1RE1 B;  4ZVS B;  1RWN B;  2XYG B;  1I3O B;  2CJY B;  2H4Y B;  2H5J B;  2HBR B;  1RWV B;  2H48 B;  2P2C B;  1RWW B;  4LSZ B;  3IBF B;  2CNK B;  4ZVQ B;  1RWX B;  2C2O B;  1PAU B;  2H65 B;  1RHM B;  3D6F B;  1PYO B;  3KJQ B;  2QL5 B;  2QLB B;  3P45 B;  2H5I B;  1RHJ B;  3QNW B;  1RWM B;  2DKO B;  4DCP B;  2HBY B;  2Y0B B;  3GJT B;  3R6G B;  1SC4 B;  5K20 B;  3GJR B;  2XZD B;  3R6L B;  1RWO B;  3D6H B;  1IBC B;  2QLF B;  4ZVO B;  1QTN B;  2C1E B;  4ZVR B;  2CNL B;  1RHR B;  2H4W B;  1SC1 B;  1QDU B;  5IC6 B;  3GJQ B;  3NS7 B;  1RHK B;  2C2K B;  4DCO B;  2QL9 B;  3GJS B;  2FQQ B;  2Y1L B;  2CJX B;  4JB8 B;  3SIP B;  4DCJ B;  2CNO B;  2HBZ B;  3KJN B;  3D6M B; 
#chains in the Genus database with same CATH topology
 4OV6 A;  3TA2 A;  4Y2M A;  2Y0S D;  4GMK A;  2BJD A;  2VKZ G;  1RHU B;  2FZG B;  1Y00 A;  2GML A;  4ECQ A;  1DLO B;  2MKI A;  3RRG A;  5A8R A;  3MMB B;  1J5E J;  4L74 A;  4CO1 A;  4CT8 A;  1DZ5 A;  1FJG J;  4KGM A;  5I42 A;  3IP0 A;  2B7B B;  1F9H A;  2GVD A;  3CCT A;  4GO7 X;  2OFH X;  4OI6 A;  3VTI A;  4F4Z A;  1VQP S;  4QW8 A;  5CD4 A;  3PW2 A;  1JLA A;  2HQC A;  2XZT B;  3VWS A;  3NMR A;  4B3O A;  2MQP A;  1T02 A;  3BKU A;  2H3E B;  3BR8 A;  3FNN A;  4FP9 A;  4CLF A;  5HMY A;  1N56 A;  2UXB J;  4JI8 J;  4CIO A;  2W9C B;  1IQZ A;  2DY9 A;  1NH7 A;  3T1H F;  1Q8L A;  2ASJ A;  4DPY A;  4EUV A;  3IS9 A;  3MMC A;  1OYE A;  1JMT A;  2WVE A;  2XSF A;  1Q7L B;  2GV1 A;  3I0S A;  4JBC A;  1A6L A;  5GME A;  4J9L A;  3OVS A;  3T5K A;  2VOD A;  4HKQ A;  4TLR A;  2AF6 A;  2R9L A;  3TNV A;  3HHL B;  3T6B A;  1AZS A;  3PG9 A;  3QWU A;  2P5V A;  4ZCL A;  2FGO A;  5HJX A;  4U95 A;  2HUR A;  2XYH B;  1BUX A;  3DGP B;  3GFY A;  1C0U B;  2FJA B;  2V9W A;  4L72 B;  2RDI A;  5A6W A;  3CCV S;  2IVY A;  1VJQ A;  4WFN Q;  4DV2 J;  1T0T V;  4ETZ A;  1XMQ F;  3X1L B;  4V19 X;  1U26 A;  2IJR A;  4LUB A;  3I56 S;  2UZA A;  3A8J A;  4DL0 C;  1JLQ A;  4J9M A;  2RS2 A;  5J2Q A;  1YJR A;  3ET6 A;  4CM2 A;  3RGI A;  1SKR A;  3AJ2 A;  1R6V A;  1X5P A;  1YIJ S;  4UY8 T;  1HL6 A;  1BGX T;  3C14 B;  4MTP A;  3UR0 A;  3OVB A;  2Y8Y A;  3ILI A;  3UR3 C;  1TK8 A;  3KLG A;  4HH1 A;  2B5J B;  1H2U X;  5GAG I;  1FX4 A;  1KBR A;  1M5V C;  3RB6 A;  5KFN A;  4JP8 A;  1QLN A;  3DYA A;  2EEY A;  4FS2 A;  1D9F A;  1VRU B;  4NLW A;  3EYZ A;  3CO0 P;  2FDN A;  5KFJ A;  1H98 A;  2WW8 A;  4ELU A;  4LF8 J;  1J27 A;  4LRF A;  2V0N A;  3SQO P;  3E2E A;  5AE1 A;  5D6G A;  1A0O B;  1H0H B;  3OFE A;  4OZ0 A;  3KK2 B;  1T8E A;  1N34 F;  1XNR F;  3TUJ C;  2HWI A;  5HN0 A;  2UVU A;  1M5K C;  1SJ1 A;  3DXS X;  3PXG a;  4B3T J;  5I4M A;  4LF9 J;  3W8P A;  3UNY A;  4J7C A;  3KFW X;  3W60 A;  3PX0 A;  1RUS A;  3LAN A;  1C4C A;  3BN4 A;  3QO9 B;  3IGV A;  5HO4 A;  2ZVI A;  1S9F A;  1T05 B;  2HQF A;  5C24 A;  3CCE S;  4ED8 A;  4I2Q B;  1GMV A;  3KHR A;  1RT7 A;  5D0E A;  3US5 A;  2H4W B;  4JYA F;  1N0U A;  2C3U A;  5AT1 B;  2V4Q A;  4AXJ A;  5LT5 A;  1SH3 A;  3T41 A;  3MPU B;  4JI6 J;  1LK5 A;  3H25 A;  3I9V 9;  2MY7 A;  3G96 A;  1SJ4 P;  1VIS A;  2OGU A;  3G82 A;  4P2F A;  3WIV A;  3T5H A;  2AWZ A;  1PJ5 A;  3AB4 B;  1FES A;  3L09 A;  3NGR A;  4NXN F;  1TAU A;  2QL9 B;  1IVZ A;  2MY8 A;  3H0P A;  1E6V B;  1U1L A;  3GJS B;  1YJ7 A;  4DQP A;  3GFZ A;  1U1M A;  5EDW A;  1T9X A;  4CM0 A;  1MWQ A;  1DAR A;  4NYP A;  3W2V B;  2GCF A;  5L8R C;  3HZG A;  3R8Y A;  3UN5 A;  3G8T A;  3J7A 1;  5D4P A;  4K5S A;  2PFF B;  2DNQ A;  2V94 A;  3T5J A;  1WOR A;  3KJN B;  5K8O A;  1IUJ A;  2KU7 A;  2XY7 A;  3EZO A;  3QLH B;  3KNA A;  2ZDO A;  2NXE A;  2Z58 B;  2HFZ A;  4CLY A;  4DUY F;  4F0M A;  1WOO A;  1G3O A;  3ZTR A;  1RT6 A;  3QJJ A;  3B54 A;  3VAM A;  1WEX A;  4J37 A;  2ZOM A;  3CVK A;  3MR3 A;  4M95 A;  3U1L A;  2IBK A;  3OR1 B;  2GIQ A;  4OJH A;  5D4O A;  2KRR A;  2WON B;  1N54 B;  4URG A;  5ETN A;  5EX0 A;  3HK2 A;  4KGV B;  1HNW F;  5KG6 A;  5H9F J;  4O0I A;  1PO6 A;  4LFC J;  2F4V J;  4WU3 A;  4K5R A;  1LW2 A;  2NXN A;  4ZPT R;  3ULH A;  1NB7 A;  4QJV A;  4QU7 A;  4C8L A;  4DOZ A;  4UQG A;  1CSJ A;  3V6D B;  1O0P A;  2UUT A;  3UDE A;  2E9Z A;  2J7W A;  2RIL A;  3TUZ C;  3GII A;  4C4W A;  2QFJ A;  2RU3 A;  4HAC B;  4NPO A;  2F40 A;  2ZH2 A;  3LP2 B;  1FI4 A;  2KJV A;  4EI2 A;  2VUG A;  2XCP A;  3J7Z T;  4V19 J;  1SL2 A;  2DBB A;  2F9J A;  5CZV A;  4X64 F;  2CQP A;  2PGC A;  3RW7 A;  2DXF A;  3KG0 A;  3QID A;  3R27 A;  4G6V B;  1F3F A;  3DLB A;  3M8Q B;  1TV6 A;  1KLM B;  4C8Z A;  1N5S A;  2YQ0 A;  4KSE B;  3KLH A;  1H38 A;  4DSE A;  5J2Q B;  3BSC A;  3DLE B;  2IVF B;  2WZ1 A;  2MZ1 A;  2H48 B;  1MRO B;  1NJI T;  1RWW B;  3R2D J;  1FJC A;  3BGU A;  3HKW A;  3IBF B;  2RRA A;  3R5A A;  5BYQ A;  3PX4 A;  1PG5 B;  1Z2Z A;  1RAO A;  2M2B A;  3MMB A;  4DPW A;  2UVR A;  1SIZ A;  3H20 A;  1NO8 A;  1QY7 A;  4ECX A;  4DV5 F;  2IDE A;  2MLX A;  5AXL A;  3KK2 A;  2CPF A;  1VC0 A;  2XTJ P;  4ZPC A;  3JTN A;  2ZH9 A;  3UO0 A;  1KWM A;  2BOA A;  2QC3 A;  4TU8 A;  2B9E A;  4YHH J;  4MKY A;  3N5F A;  3UCZ P;  2O3D A;  4IH6 A;  1VQS A;  3TJ8 A;  3GIR A;  4PXD A;  3KUE A;  4HH0 A;  4KFB B;  5L39 A;  5CHC B;  4DUZ F;  3M8W A;  4F4Y A;  1YJW S;  4JV5 J;  1F1B B;  2ZBC A;  1V6H A;  4PAA A;  5IQQ A;  5AJ3 J;  4YB7 A;  4CO0 A;  1L5U A;  4YB6 A;  1SJ3 P;  1HPZ A;  4H4K A;  3Q8P B;  2UV8 G;  1RKI A;  1IBC B;  2W2P P;  3Q8Y A;  4I6Y A;  3BBB A;  4L73 A;  1RA6 A;  4DBQ A;  3T3F A;  2UXD F;  4IG0 B;  4YUD A;  4Q2L A;  3HT0 A;  4ID5 A;  5THW A;  3U1M A;  2VON A;  4F25 A;  1S77 D;  4LT6 A;  3E51 A;  3JTO A;  1S4E A;  4PQU B;  3IS9 B;  1NU4 A;  3MMC B;  3G6X A;  5GAH I;  5HBM A;  2XQC A;  5ETQ A;  5BJR A;  4Q7A A;  1M1G A;  2ZKT A;  1ZTT A;  4FYY B;  2QYC A;  1T3O A;  2IJN A;  2LQ5 A;  1QJH A;  2HEK A;  1O51 A;  4P7T A;  4WK1 A;  1SH2 A;  4FBU A;  4L3N A;  5CAA A;  2E5L F;  1L3S A;  1NBE B;  2HK3 A;  3KUG A;  3UNG C;  2W9A A;  4KGK A;  1FDD A;  4LF7 F;  2XS5 A;  1EHW A;  2YXL A;  3A4T A;  3Q2S C;  5HRO B;  2NSC A;  3I5A A;  1EP4 B;  3MPD A;  3ZZO A;  2E9T A;  2R4F A;  1U2C A;  4WYL A;  3M8Y A;  1NHK L;  3CPW R;  4ILM A;  1CG2 A;  4DL7 A;  2QV6 A;  3PNI A;  1GAO A;  3FCW A;  4DR4 F;  4DL3 A;  3KWM A;  4JUZ A;  4X64 J;  1C1B A;  3EUN A;  4B9S A;  3NNA A;  1AFI A;  2YKN A;  3C6T B;  2XO6 A;  1N8R T;  2RDD A;  3J80 Y;  1R0C B;  3R5J B;  5HLF A;  3MM9 B;  1SC3 B;  1RT1 B;  5KFT A;  3W9I A;  2C2D A;  2D69 A;  7FDR A;  1WC1 A;  2FJW A;  2MKJ A;  1KP6 A;  2DYA A;  4CTA A;  4DN9 A;  3BSN A;  4MYT A;  3HVR A;  1G7C B;  2EK1 A;  2W2M P;  2ZD1 A;  1HWK A;  1GFW B;  1VFJ A;  2B8P A;  1XK8 A;  4S0M A;  1RXO B;  2D3O 1;  1LXJ A;  2F1F A;  3SCK E;  3O1L A;  4E98 A;  1S5Z A;  5FII A;  1YI2 S;  4M94 A;  3CDA A;  1AT1 B;  1QUV A;  1G6B A;  1KHV A;  4DR2 F;  2ZBI A;  1I51 B;  1VQM S;  1KFD A;  2HND A;  2DR8 A;  2V2V A;  3GFX A;  1PC4 A;  2DCU B;  2YNF B;  3NGU A;  1HKA A;  2QX0 A;  4OYX A;  4IH5 A;  4U8Y A;  3MWB A;  1RAJ A;  4J5O A;  3IR6 B;  4UST A;  3AT1 B;  1NZA A;  4L75 A;  4CRJ A;  2XLK A;  1N33 J;  1RP5 A;  2WSE C;  3VAK A;  2ZZN A;  3HHL D;  3W64 A;  3MM7 B;  3KLH B;  4Q45 A;  2NYI A;  2C22 A;  4F3O A;  2W2N P;  1T11 A;  3QZ7 A;  2XYP B;  5I3P A;  3PYD A;  3FZB A;  1S1V B;  3CJ2 A;  4Y0F A;  3J81 U;  4YHH F;  2KHC A;  1IBM F;  2PD1 A;  3ELH A;  5IC4 B;  4TQS A;  4IQM A;  2R7U A;  1JXE A;  1HBM B;  1R3N A;  4P6Q A;  4ZVS B;  5KFD A;  1GTH A;  3MD1 A;  3J7A N;  2IRU A;  2K3I A;  1Y5N B;  2B51 A;  2RQ4 A;  2KL8 A;  3A12 A;  4QYR A;  4AE5 A;  4R25 A;  1R89 A;  4D3G A;  9ATC B;  5KFP A;  3Q0A A;  4PR6 A;  4J9Q A;  4KPY A;  3HJF A;  2P2C B;  3FBC A;  1RU1 A;  3I87 A;  5BR8 J;  2EWH A;  5DO2 A;  2MXY A;  4JOU A;  1NK9 A;  1YX2 A;  4AQY F;  3CC2 S;  2V69 A;  3UCG A;  1TK5 A;  1NKE A;  2AYB A;  3V6J A;  1RTH A;  3BF4 A;  3IMQ J;  1DTT A;  1RHM B;  4X4O A;  3SI8 A;  3AQO A;  4DHV A;  4CI0 B;  3LGN A;  4LJM A;  3L3C A;  1B7F A;  3TQE A;  1IQT A;  3ZFV A;  3I0S B;  1FD8 A;  3N6N A;  4XPC A;  4P52 A;  4LF5 F;  3K8V A;  2HMI A;  3VAJ A;  2AEM A;  2BE2 A;  3DHW C;  1PIL A;  5H9E J;  3VQS A;  1CVJ A;  2AJF E;  2L9N A;  2VFV A;  3LAL A;  1B4S A;  2LA4 A;  2QSF A;  3HJV A;  1Q4R A;  4ZCK A;  5K20 B;  4CO3 A;  1FKO B;  2B9Y A;  2I5J B;  4KE5 A;  4WP8 A;  5A76 A;  1IJE B;  2HHU A;  1WUU A;  2CWX A;  3FEY B;  3AOC A;  5DZ6 A;  3NCP A;  3W7B A;  2E1R A;  2KZM A;  2UVW A;  1M5O C;  4LF6 F;  3D6H B;  3BQ2 A;  2DXD A;  2XSJ B;  1U1N A;  1LXN A;  4RW6 B;  3TVZ A;  2ZVS A;  1NK6 A;  4Q5V A;  3VF0 B;  1M1H A;  5KT4 A;  2HKE A;  2V6A A;  2P9E A;  4H4M A;  3T6J A;  2IBO A;  2MKK A;  2GHP A;  4WZQ A;  2QA1 A;  3JSR A;  2FC9 A;  2A6M A;  2YX7 A;  3D67 A;  2APO A;  2G2O A;  3HSG A;  1YVF A;  2B5J A;  3KG1 A;  4ZPD A;  3RB0 A;  4DV2 F;  2RHQ B;  1VQN S;  4CYU B;  5FJ4 A;  4KQZ A;  1MU2 A;  2A18 A;  2M4M A;  4PYD A;  2Q6B A;  4WII A;  3GIM A;  4LVO P;  1UEU A;  1DTQ B;  4BBY A;  2DXE A;  3GR0 A;  3OFH A;  3BH7 B;  2B8Q A;  1S12 A;  4M5K A;  4WWS A;  1N34 J;  1KLM A;  4DCJ B;  3QSY B;  1GMU A;  1X4F A;  3KOA A;  1H6K X;  3TQ1 A;  3VHQ A;  4HDG A;  4FVM A;  3PZP A;  2HHP A;  3F73 A;  5DM7 Q;  3QGI A;  4RUC A;  4ZVF A;  3MHY A;  4DZD A;  2XC9 A;  2FHM A;  1Z2L A;  1ZBT A;  5IS2 A;  4X66 F;  1FEE A;  1VCT A;  1WJ9 A;  3ISN C;  2GJF A;  4JI6 F;  1KVJ A;  1EAY C;  4M5D A;  4CDI A;  5KFE A;  4OHY A;  1VBZ A;  3PJX A;  2ZZT A;  2B7C B;  1X5O A;  3T1Y F;  3FMB A;  3RZA A;  3Q8U A;  1WTB A;  2HFO A;  3LAM A;  1TUG B;  3D54 A;  3EWG A;  4RW4 B;  4N56 A;  1FJE B;  4P71 A;  4RR5 A;  1RKJ A;  2CQ2 A;  4EU0 A;  2HIY A;  4O44 A;  2C2Z B;  3ONQ A;  2Z2Z A;  5KT5 A;  5F8J A;  3IFE A;  2BDP A;  4WYW A;  2DY1 A;  2MQQ A;  4IG0 A;  3KMQ A;  1VQY A;  3LOU A;  3SQG A;  4ZJQ A;  6FD1 A;  4IFY A;  1TL7 A;  2KYZ A;  3AB2 B;  4KBI A;  4OYO A;  4X4Q A;  4DL4 A;  4HT7 A;  2MJU A;  5L9N A;  2OJ3 A;  4ZPV R;  3M9O B;  4DSJ A;  4FS1 A;  4B9T A;  4TVA B;  1N32 F;  5IM0 B;  4TXS A;  1UVM A;  3MMA B;  2ZM6 F;  3T1H J;  3IBW A;  2V8V A;  5IT4 A;  1H7X A;  2GQ2 A;  2CPJ A;  4NI2 A;  3OTD A;  1S1U B;  4NX9 A;  3UDV A;  1U02 A;  1MWY A;  2J7K A;  1JNZ B;  1NHV A;  2ROP A;  2ASL A;  2GIF A;  2UUA F;  1X4G A;  2K1R B;  1K9M T;  2MKH A;  3SMZ A;  1VC5 A;  5T7L A;  1TKT A;  2CQB A;  5ETV A;  4ZKA A;  2AJ1 A;  3OR1 A;  1B0V A;  1MN7 A;  4LFC F;  3DRY A;  2E5J A;  3TRG A;  2G0I A;  4LSN B;  1UWB A;  4MK8 A;  1LWX A;  1RSC A;  3PRD A;  2CJK A;  4IRK A;  4TYA A;  5LOQ A;  2HVZ A;  2NXC A;  3MOZ A;  1Q7Y T;  1CUL A;  3M6W A;  3W62 A;  2H5E A;  4IR1 A;  2GA7 A;  3GB0 A;  1TFW A;  4C11 B;  2XG8 A;  1SV5 B;  3HFK A;  2PI5 A;  4ITS A;  2HFV A;  2MJN A;  4MKA A;  3VAL A;  2R7S A;  1MG7 A;  4UUW A;  4NLO A;  5AE3 A;  5BYS A;  3C6T A;  2OEM A;  3BYR A;  1VQO S;  3SCI E;  3R5B A;  5B7W A;  4B3O B;  1NK7 A;  4I6A A;  4CLL A;  2YX4 A;  4DV4 F;  1C0T B;  1MWZ A;  1RT4 A;  1RTD A;  3D0I E;  5E3A A;  2XWY A;  1NDK A;  2DNP A;  4FKX A;  2ZDP A;  1S9E B;  5F8N A;  2MTL A;  2X1B A;  4OZ2 A;  4QYZ K;  3LPE A;  2DNL A;  2QLW A;  3S01 A;  4DR1 J;  1MSW D;  2E1P A;  2Y0B B;  3AA8 A;  3MPY A;  1PCA A;  4A4J A;  2YQ1 A;  1JX4 A;  3R6G B;  4NL5 A;  2HLU A;  5M2P A;  3DLH A;  4ZP8 A;  1FKO A;  1UET A;  1WF0 A;  3N01 A;  3EM1 A;  4IOC Q;  4DV6 F;  4A8S A;  1Y9O A;  2RUG A;  3FUY A;  1ACM B;  1FX2 A;  2DIU A;  1VGY A;  2GMJ A;  2XMV A;  4F7V A;  2IMW P;  3N79 A;  1G2E A;  3MCS A;  1E6Y A;  4K4S A;  2O5D A;  3DLE A;  2ZBP A;  3B82 A;  2B6A B;  3CJ5 A;  3D0H E;  2RJZ A;  3MM7 A;  3QGP A;  4K0K F;  3G87 A;  2VPY B;  5C5J A;  3Q83 A;  4U96 A;  3PRV A;  3J81 j;  3WBZ A;  1U2R A;  2KM8 B;  1RT5 B;  2W1B A;  4Y34 A;  4F4K A;  3DLK A;  4K4V A;  4NRU A;  1WG4 A;  4BCA A;  4MJK A;  5CQG A;  2FLN A;  1MLA A;  1UP1 A;  4Z37 A;  3M2V A;  1J5E F;  1KEK A;  4OV1 A;  4JYA J;  2ZNZ A;  4MIA A;  3CJR A;  2AZ1 A;  2IAJ B;  3M1V A;  5C42 A;  2ZE2 A;  3DOK A;  4F4A A;  1RHK B;  2DGT A;  5A0Y B;  4DQR A;  3D6T B;  4ELT A;  1D8Z A;  3DOL A;  4M5G A;  5KFV A;  2JC1 A;  4IO1 A;  3ET6 B;  2VJU A;  2DNY A;  3DYA B;  2YVS A;  5B0C A;  1TU0 B;  4JV0 A;  2VPZ B;  4KFB A;  3SSQ A;  4ZIV A;  1RTJ A;  3B6B A;  5DG7 A;  2YNH A;  3OD2 A;  1XMO F;  2UXB F;  3Q22 A;  5E3C A;  4ZVH A;  4ICL B;  4NZ6 A;  1S7H A;  2R7Q A;  1U8W A;  4P9S A;  2AV5 A;  3NS5 A;  3AQP A;  3V2U C;  2P9C A;  4ZLN A;  5ETR A;  2K3K A;  1VIX A;  2CZ9 A;  1P27 B;  1CQN A;  2ZUA A;  5EUH A;  3L95 X;  4OI0 A;  1URN A;  2VFS A;  3FFI A;  2RF2 A;  1J5O A;  4KGZ B;  2HVH A;  2W2O P;  1M5S A;  3BPS P;  2V8D A;  4M5M A;  1IM4 A;  4LRD A;  2YPY A;  1VMB A;  4RO0 A;  1MMD A;  4ZPA A;  1Z4U A;  2R7T A;  2H51 B;  1TEL A;  5AJ3 F;  3ZXW A;  1NH8 A;  2AIR B;  8RUC A;  5DS7 A;  1TL3 B;  3QAT A;  4WPA A;  2HQI A;  3QT5 A;  4C8Y A;  3QMQ A;  1NCL A;  3E01 B;  1KQK A;  4TY8 A;  5L1I A;  2HNY A;  5D8H B;  2WVD A;  3MAA B;  3QO9 A;  2JDJ A;  3AHP A;  1TL7 B;  2J6T A;  4YR0 A;  5JJB A;  2ABY A;  2DJW A;  1RWP B;  1YRT A;  4NLT A;  5GAD U;  1BMQ B;  4F3Q A;  2N4C A;  4MIW A;  1VK8 A;  1W2B R;  2NS1 B;  3HX9 A;  3POT B;  4QIF A;  2FZK B;  2JHE A;  1ZOT A;  4JI3 J;  3H5S A;  3OVA A;  3ITH A;  1RHQ B;  1RBA A;  1ZM3 A;  3MCM A;  1RWK B;  5LMU J;  1NJZ A;  2Q66 A;  1S1T B;  4FYW B;  2CPX A;  2KFY A;  4B3M J;  1TKT B;  4R0E A;  4U6P A;  3J7Y U;  2RKI A;  2PMW A;  2DNZ A;  4K2X A;  3KLE A;  1URR A;  1LQ9 A;  3W2V A;  4ATN A;  4OI2 A;  3KKF A;  3A8I A;  1WSR A;  1X4B A;  5I3U B;  4NZ7 A;  2BJ1 A;  4UZC A;  1RWV B;  4GKK F;  5D0G A;  2GJ2 A;  3GWC A;  3OR2 B;  4KKO A;  4OLP A;  2CQI A;  2E5I A;  2MHE A;  2VG7 B;  2CG8 A;  3L4B C;  4NMX A;  5KT6 A;  4K50 A;  3JYT B;  2HK2 A;  4K0K J;  4NZ0 A;  1FCA A;  2ZWP A;  1N33 F;  2C2O B;  4OYM A;  1NSK L;  2WW4 A;  1B0P A;  1NDC A;  2C3O A;  2V67 A;  2YNG A;  2B9W A;  2J9D E;  3BH6 B;  1XQI A;  1CBK A;  4D3H A;  3NP5 A;  4EMD A;  2QLB B;  2RT3 A;  3P45 B;  3MUV P;  3SV3 A;  3EGZ A;  4DFP A;  3EMT A;  4F36 A;  2M8D B;  1Y10 A;  2CZV C;  4O44 B;  4UOH A;  1SPB P;  2KT3 A;  3QNW B;  2MGZ B;  1LFW A;  2CYY A;  5L1L A;  1X9M A;  2XB2 D;  1XC9 A;  1XNR J;  4M5D B;  2JLE A;  5F8I A;  1FA0 A;  3SCL E;  1XMB A;  1JB0 C;  1SB6 A;  2W7P A;  3MM6 A;  1YBT A;  2R42 A;  3JSY A;  2Z57 B;  2W8L A;  4P10 A;  1F6T A;  1RT3 B;  2XZD B;  5KOX A;  1VBY A;  4P2X A;  1WDT A;  2DNK A;  2X3D A;  4XAK A;  5E41 A;  1F5B A;  2VJV A;  4DX5 A;  4OZ5 A;  2V2Q A;  2F65 A;  3NCQ A;  1S57 A;  3Q86 A;  2AW0 A;  2LXU A;  3LP0 A;  3MTJ A;  1OSC A;  5F9L A;  2XWX A;  1LFP A;  2CQ1 A;  4OX9 F;  2CRL A;  3SDE B;  2GVZ B;  3EXY A;  1DLO A;  2QT7 A;  1E6V A;  5DM6 Q;  1WEY A;  3D0G E;  4U9R A;  1DTT B;  1X0F A;  4EFA C;  4RNO A;  3DRP B;  3RYL A;  2WOM B;  4C3K A;  3BQ0 A;  3GYN A;  2VC1 A;  2HGN A;  3A8E A;  4H4K C;  4OZ1 A;  4ZPW R;  3BV8 A;  3BSA A;  2LXF A;  2EKY A;  3DRS B;  2DHS A;  4DX7 A;  3PM9 A;  4ZCI A;  4C48 A;  3GP9 A;  3MM5 B;  5DET A;  3MUR P;  4DS5 A;  1W2I A;  3IR5 B;  3VGU A;  5HMX A;  1RLD A;  2VBZ A;  3M7V A;  2CJX B;  4DPU A;  3M05 A;  3M32 B;  4YS2 A;  1Q16 B;  2ACY A;  2JJ4 D;  4ZS6 A;  2R8I A;  1YQH A;  1W25 A;  5IT0 A;  3QT7 A;  3NG8 A;  4OLO A;  2DNG A;  4CLU A;  3CMA S;  3L9Z A;  3AD7 C;  3DRX A;  4KPC A;  5LXR A;  2A6O A;  4NYZ A;  2D3O R;  2DIS A;  2KKH A;  2NZ4 A;  3TZW A;  1S6P B;  1PYT A;  4RWW A;  2XEX A;  4URQ U;  2SXL A;  2V9K A;  4HHJ A;  1EET B;  3C16 B;  4NEY A;  3NAI A;  1JNR B;  1OO0 B;  4W92 B;  1BY9 A;  1P1L A;  1FKP A;  3P5B P;  2Z0G A;  1JKH B;  3TX0 A;  4OHW A;  1HW9 A;  1QE1 A;  1YJT A;  3QFH A;  4ALZ A;  1RWU A;  3OQ2 A;  1TMM A;  2V8P A;  3V5R A;  2QA4 S;  2HZC A;  5LJ3 Y;  1WC3 A;  3D1Q A;  2ASD A;  1RJJ A;  4JI1 J;  4G1Q A;  5IWA F;  1UA0 A;  2BAB A;  1OY6 A;  1B70 B;  1YK9 A;  3H5U A;  4NLV A;  4A8Q A;  2DO0 A;  1HA1 A;  2RHS B;  2MZS A;  2PN6 A;  3F56 A;  1LW2 B;  1ZPV A;  3HHL C;  3HP6 A;  2GAH C;  3R7S B;  5HI7 A;  3OLB A;  2DPI A;  2BR0 A;  4KV8 A;  2B6A A;  5KG7 A;  2W9B A;  5A8W B;  3M9N B;  1VQ7 S;  5J1E B;  1X31 C;  4FNI A;  3KXD A;  5GAE U;  4DV0 F;  2BQ3 A;  3RR7 A;  1N88 A;  3G2X A;  4IRD A;  3RBX A;  3EVO A;  2LQ9 A;  3QPI A;  2BV3 A;  3Q23 A;  2EC2 A;  1UCN A;  4OYW A;  2BRL A;  3U7J A;  3IM9 A;  3GLJ A;  4OHZ A;  3MEC B;  3TYT A;  3DXB A;  3KMS A;  3BEG B;  3C46 A;  4ZA1 A;  1X7V A;  3D1O A;  3CJ0 A;  4OHX A;  4DR6 J;  1TKX B;  4AL7 A;  4GKJ F;  2DGU A;  3OT9 A;  4MIB A;  4QR1 A;  2BKN A;  1RT2 A;  4O4R A;  4Y2C A;  1X5S A;  3MM8 A;  4ZJL A;  3RRH A;  1RE1 B;  3BO2 A;  4K2J A;  1IKX B;  1RWN B;  1PJ7 A;  1S1W A;  4N7T A;  4J9O A;  1A9N B;  5DG8 A;  3OJU A;  1PIE A;  4KH1 B;  3WIU A;  3K5N A;  5JUM A;  3QFW A;  3QYY A;  1FFS B;  2UXD J;  1BWV A;  1JJH A;  1MN9 A;  2VG7 A;  4OYP A;  1S9G A;  2VBX A;  3P5T L;  4XDD A;  2ZJR Q;  4B3S J;  4PUO A;  2RQC A;  2W9C A;  4UTG A;  4RUB A;  4GC6 A;  2J0S D;  1XNQ J;  4DU7 A;  2IJF A;  2V2K A;  4Z2X A;  1OWX A;  1S1X A;  4BHQ A;  2N7C A;  5ETP A;  3GIJ A;  3MR7 A;  4UQT A;  3IAM 9;  1WHW A;  3CT9 A;  5KFL A;  2DKO B;  4DR5 J;  3MFI A;  1GXU A;  2YX1 A;  3THP A;  1P9Q C;  2ZHB A;  5IQ6 A;  3K57 A;  2VQF J;  2DR5 A;  1N36 F;  2E5L J;  5EWF A;  3DI6 A;  4O3O A;  2VA2 A;  3GPA A;  5DDP C;  5D15 A;  4C98 A;  1VQ4 S;  2KXN B;  1F2G A;  1S4F A;  1SUQ B;  3I31 A;  4KY3 A;  3J7Z 5;  4DX6 A;  2GVZ A;  4IOB A;  4B9L A;  1PJ6 A;  2CZ4 A;  4C3L A;  4A8Y A;  3CC7 S;  3P49 B;  5AXM A;  2MYF A;  1ULR A;  5K14 B;  1IWA A;  2HFS A;  1RYR A;  2LMI A;  1CUL B;  4OQJ A;  4M63 A;  4PZV A;  2W7O A;  4H54 A;  2GX8 A;  2PDA A;  3POT A;  2C1E B;  3FK4 A;  4RW7 B;  3ZZR A;  1ZM9 A;  1G4C A;  2OEK A;  4FN5 A;  3WC2 A;  2YY3 A;  4RW9 A;  1LEO A;  2VFU A;  5A8K B;  4L3K A;  4ECV A;  2ZOF A;  1VRT B;  1SCJ B;  1R8C A;  1EAR A;  1KS2 A;  2AJQ A;  3W5Y A;  2RUS A;  5KFQ A;  1IXK A;  3JTP A;  1WF2 A;  2FZC B;  2R7O A;  1U7L A;  1KHW A;  2B3T B;  2DHG A;  1NPK A;  3NS6 A;  5HMZ A;  3W9H A;  5I42 B;  2JRS A;  5I3U A;  2BVZ A;  3P6Y C;  3D3B J;  3W65 A;  4N76 A;  2WHO A;  2A1B A;  1ZAX A;  2YKA A;  4HDH A;  3T9N A;  4ES1 A;  5LSL A;  2O67 A;  5G4D A;  1WI8 A;  3BBC A;  3CIM A;  3FCV A;  4QWE A;  2BJ3 A;  1R0A A;  3C66 A;  3DOM B;  4LRA A;  3ZZU A;  3MM9 A;  5L9X A;  4ZVE A;  2B4V A;  2DIT A;  3MCN A;  2V63 A;  2PII A;  4X4P A;  4KIA A;  3R1L A;  2GQQ A;  2Y1J A;  5E0O A;  4NAS A;  2HS4 A;  3MMJ A;  4I2Q A;  5SZT A;  3C19 A;  2XHC A;  2BE9 B;  2XMA A;  5F9N A;  1LW0 B;  1HNX F;  2Y1R I;  3UN2 A;  2CJQ A;  4ZCM A;  4EK2 A;  3QJL A;  1YRU A;  4QBU A;  3AFG A;  4ES3 A;  3OV7 A;  2OFG X;  3TO8 A;  4ECW A;  3A3N B;  2CXE A;  5ADZ A;  1CPZ A;  2DR9 A;  2H54 B;  2AEJ A;  1IBM J;  3FDS A;  1J2V A;  2HG4 A;  1N5Q A;  2GFF A;  1UPM B;  2FJB B;  3IO1 A;  4QU6 A;  3CCZ A;  3Q8Q B;  3DOL B;  2E5G A;  2WB4 A;  3C15 B;  5ETL A;  3EXC X;  3LP0 B;  5K5M A;  3V6H A;  2A10 A;  1OYD A;  3EZU A;  1MU2 B;  2F4F A;  3FC9 A;  3ZTS A;  2MQO A;  2UXC J;  2PFD A;  4USW A;  4B3S F;  1S72 S;  2EFO A;  2V4J A;  3MEG B;  4P72 A;  5CCM A;  1FNM A;  4XDC A;  1F9E B;  4LR9 A;  4WXW A;  1KTQ A;  3EX7 B;  4ZJO A;  1VQL S;  1YBU A;  1VOM A;  3HHE A;  2HFU A;  1S1W B;  3H42 A;  3HKZ D;  2M3D A;  2BAN B;  2DHA A;  3KDN A;  3MPV A;  4NA2 A;  1CS4 B;  4NCG B;  3R7N B;  1M0S A;  3H4D A;  1R6Y A;  2CVE A;  4DS4 A;  5KFX A;  4CO2 A;  2VQF F;  4NLG A;  5C2C A;  2A3J A;  4X4T A;  1TQL A;  3CCM S;  1Y11 A;  2KXF A;  4PWW A;  2FVP A;  4NXM J;  2U1A A;  3LWM A;  1JLG B;  1PBA A;  2FGC A;  2Z8Q A;  2Z2Y B;  4PWU A;  2IFX A;  3HSJ A;  1RAH B;  3DGV A;  3DRR B;  3U1N A;  2H5J B;  3CTR A;  5J1N A;  2EW9 A;  3CD5 A;  1WEL A;  1AB8 A;  4JI0 F;  3W61 A;  5D3G B;  1UEK A;  2HHH J;  4DUY J;  2HMI B;  4NE9 C;  3W8G A;  4RZR A;  4B02 A;  4J9R A;  1SQG A;  1TR0 A;  4LIR A;  4HYK A;  2RS8 A;  4KGX B;  1WKJ A;  1B7Y B;  3WQP A;  3UDL A;  1QAY A;  3JSB A;  5FLX Y;  1AFJ A;  3CCR S;  2IY5 B;  2L9W A;  3FKB A;  2Z56 B;  2LU2 A;  3HVT A;  1WHX A;  4MT1 A;  4DFM A;  4B3R F;  1DY3 A;  2H5I B;  2J5A A;  2I8E A;  1BE4 A;  2LQJ A;  3I5C A;  3ZZY A;  3JSM A;  2M5Y A;  3KYL A;  2E7W A;  3BRE A;  3VR1 A;  1HIY A;  2V50 A;  3NCR A;  5D78 A;  2FHO B;  4F8R A;  5LXY A;  1S1U A;  4DX8 H;  3A1Y G;  5HQL A;  2ADB A;  2XI3 A;  2HYI B;  2ALY B;  5D77 A;  3SCJ E;  4PAB A;  2KH9 A;  1QAX A;  1FNX H;  3EPG A;  1YZ6 A;  4LRE A;  4Y28 C;  5KFB A;  4N41 A;  2CJ9 A;  3LGH A;  3M9M B;  4TN2 A;  1ROF A;  4ETX A;  1I6J A;  4O3R A;  3FCH A;  2XO7 A;  3BDE A;  1K8A T;  4X4U A;  2QLF B;  1QTN B;  2VFR A;  4ZVR B;  5A8W A;  5DGA A;  3MD3 A;  3O5T B;  3SEO A;  2X1A A;  4KHP J;  3V6K A;  4LQ3 A;  1Q82 T;  2JX2 A;  1C1B B;  1RHR B;  2AKW B;  1ELO A;  2J8S A;  3CSK A;  5A8K A;  3HMJ G;  2UU9 F;  2FUG 9;  4X2B A;  2HHT A;  1HQE A;  2KDO A;  2YNG B;  1HI8 A;  3NBP B;  4DEZ A;  3QRP A;  2CPZ A;  1OQ6 A;  3NS7 B;  1JIH A;  2AYE A;  5F8M A;  1FJG F;  2ZJQ Q;  2DIV A;  5LJ5 Y;  3GYX B;  1HFE L;  2XLJ A;  4K4Z A;  2IYG A;  1U1K A;  1U0H B;  1F2H A;  1ZM2 A;  3CUL A;  2V2Z A;  3UD5 A;  4GKK J;  2NCK L;  3ENV A;  5KG2 A;  2F8E X;  2X7I A;  3UWT A;  4A8O A;  1VQ5 S;  2HRT A;  3CJQ A;  4JB8 B;  4YB5 A;  3V4I B;  2IRY A;  1WHY A;  2HND B;  4NOH A;  2BYC A;  2GO9 A;  2KO1 A;  2KN4 A;  3GZ7 A;  1F60 B;  4I2P A;  4UF4 A;  3VVT A;  1YJU A;  9RUB A;  2WCX A;  3K58 A;  2ZJP Q;  3EGN A;  4LF1 A;  4OJ1 A;  4X66 J;  2AU0 A;  4U7C A;  3BR9 A;  1FJ7 A;  3TR5 A;  3IG1 A;  2ZZM A;  2GGP B;  5KG0 A;  4ED1 A;  2LEA A;  2YKP A;  2CAJ A;  3K89 A;  3Q8R B;  3H40 A;  3SDE A;  3LP2 A;  3JXO A;  2CDR B;  4YR3 A;  1TL1 B;  1VDH A;  3FEZ A;  4NML A;  4G1P A;  2VB6 A;  1OPZ A;  1HR0 F;  5B0D A;  4JV5 F;  5IT9 U;  1KVI A;  1KOH A;  1GMW D;  2CQC A;  3DRP A;  3ILO A;  3RJM B;  2XLI A;  4C8K A;  2ZBR A;  3SXL A;  3RTV A;  1G1X A;  2JLF A;  3CCJ S;  3DLK B;  4LF4 J;  2YNI A;  4JI5 J;  4DR7 J;  3OSP A;  2W4P A;  2DH8 A;  3UDC A;  3TWZ A;  3OTE A;  3BPD A;  1TV6 B;  5F0U A;  4DN0 A;  4J9K A;  5E3P A;  2QO3 A;  2AQ4 A;  4ED7 A;  2JEF A;  2DGX A;  1V3R A;  1R8B A;  2PEH A;  2RU9 A;  3E3X A;  1WSV A;  2PA8 D;  1RCX B;  4G1I A;  4N8N A;  1CS4 A;  4NCG A;  6FDR A;  2PA3 A;  1EP4 A;  2R3V A;  3GSD A;  3MUT P;  4P74 A;  1WF1 A;  5KG5 A;  3OTC A;  3DLL Q;  1RBL A;  3FSX A;  1FRH A;  1PSD A;  4F4X A;  1X60 A;  5KFS A;  4IR9 A;  1BQN A;  1DQ8 A;  3EVW A;  3OJS A;  3LWL A;  3NY0 A;  1FTC A;  3H4B A;  5A0Y A;  1LWC B;  1HBO B;  2GHW A;  2N3O A;  5LSR A;  4OZJ A;  2RAQ A;  3GR1 A;  1JK9 B;  3UPF A;  5AXN A;  1VHF A;  1UAW A;  2VBY A;  1SV5 A;  5E5N A;  3PTW A;  2F8M A;  2JWN A;  1QTM A;  2YKO A;  2OPQ A;  3HI9 A;  5MAO A;  3CXC R;  5LMU F;  2HHW A;  1K0T A;  4WCE Q;  4JI1 F;  4ZP6 A;  4C8N A;  3CDB A;  1RDR A;  2K7K A;  2ZD1 B;  2AMC B;  1K47 A;  1XR6 A;  3NMA A;  2HPU A;  3D9B A;  2EKN A;  3QBC A;  1NXI A;  2EI5 A;  3LO3 A;  4ZP7 A;  2HQ3 A;  1GH8 A;  2I2Y A;  2I9S A;  4ZN3 A;  1VLO A;  4IO9 Q;  1RCO B;  2X1G A;  2RF2 B;  2V8H A;  2H65 B;  1VIO A;  1T9U A;  1HBN B;  1SKU B;  2QLX A;  2DCL A;  1YGY A;  1P8G A;  4TY8 B;  4ANE A;  2AGO A;  1GQE A;  3D68 A;  3W63 A;  1U45 A;  2MLY A;  2DT9 A;  1RI7 A;  4HTI A;  1UWA A;  2G0J A;  3FQL A;  4DMZ A;  4M5I A;  3AJ1 A;  1IWG A;  3DM2 B;  3I4P A;  2KT2 A;  4MFB A;  4KT0 C;  1RWM B;  4DV5 J;  4ILL A;  5C7P A;  4QR2 A;  1TKZ A;  2ILZ A;  2DNO A;  3QIP B;  5DLG A;  5KT7 A;  1LWE A;  1LW0 A;  1MW7 A;  3WHI A;  3OUY B;  3CMQ A;  5KTQ A;  3CCL S;  3G6V A;  5IV3 A;  4LR8 A;  1XMO J;  3DKD A;  4ECZ A;  4Q8E A;  1N5Y A;  1SIW B;  4FF2 A;  2F7V A;  3MM8 B;  5DDR C;  2JC0 A;  4OL8 A;  3R6L B;  2MDA A;  2LXI A;  1S1T A;  4DV7 J;  4XTT A;  2BX6 A;  4H4O B;  3ZNJ 1;  1QUP A;  3N5B A;  5KFM A;  2HSE B;  1R8A A;  3TAM B;  5HRO A;  2O01 C;  1S0N A;  5BXI A;  6AT1 B;  2R2U A;  4NCA A;  2CNL B;  1YBA A;  3TAN A;  4C6A A;  5A8R B;  1AW0 A;  1K1Q A;  1IKV B;  1KVK A;  2GQC A;  2ZNY A;  1RTH B;  1WC6 A;  2CFX A;  3MEG A;  4RL1 A;  5KFU A;  3W5Z A;  1R27 B;  4J9P A;  1WNE A;  4DR5 F;  1EX8 A;  3GG0 A;  4WP9 A;  1D3W A;  1S0M A;  2MB0 B;  1NSA A;  1U6B A;  2YKM A;  1ZA1 B;  2DVI A;  2EFQ A;  2ZE2 B;  4DU8 A;  3VAG A;  5H9E K;  4MMO A;  1TP7 A;  2I1R A;  1D1U A;  2FQQ B;  2NUH A;  3I5B A;  1TTH B;  5J2P B;  4EYI B;  2YPZ A;  3PW5 A;  3R2C J;  1ITP A;  2RML A;  1M90 T;  2R2S A;  4TNO A;  4PXE A;  1XMQ J;  5D0H A;  4DXL A;  2QE5 A;  1R7I A;  4ZLP A;  3CUN A;  1YTY A;  5GAH U;  1CJU B;  1NKB A;  2DNH A;  1VQK S;  1CEZ A;  5HMW A;  1TFY A;  3PX6 A;  5F8L A;  3AD9 C;  3PR4 A;  4YN3 B;  3MPW A;  4URS A;  5KFI A;  3KK3 A;  1JLB A;  5BYR A;  3IWN C;  3DC2 A;  1REV A;  2Q1L A;  1C4A A;  2Y1I A;  4O3Q A;  4ECU A;  2LEC A;  3MAQ A;  3QGG A;  2QEX S;  4DV1 F;  2MKY A;  3CED A;  1NZ8 A;  2N4D A;  5LL6 d;  2NPF A;  4TU9 A;  3NGT A;  3O44 A;  3K5L A;  2OPP A;  1KRP A;  3FBE A;  4OFZ A;  3TEG A;  1U1O A;  4PQU A;  1P1T A;  1CJT B;  2MQ8 A;  2RH3 A;  4Y2K A;  2WVF A;  5L46 A;  1DAX A;  1DTQ A;  2KVI A;  1S6Q B;  5IOL A;  4GO5 X;  3HT3 A;  3NKY A;  1D9D A;  1T03 B;  2GJI A;  3V4M A;  2VDH A;  3I82 A;  1HBO A;  1EJ7 L;  3A8K A;  4HHU A;  2Z30 B;  4WJB A;  4DR2 J;  4A8K A;  3N4W A;  2NZC A;  3VV2 B;  3BDP A;  4EZ9 A;  1MNE A;  1X0P A;  2JL9 A;  4RBT A;  2FHJ D;  2ATL A;  1I94 F;  4LFA F;  2CQH A;  4OZN A;  1FER A;  2LU1 A;  2L3M A;  4N47 A;  2BJE A;  1GX5 A;  2MLZ A;  1N4L A;  4K4U A;  4DL5 A;  2CQG A;  3OTB A;  3FSI A;  2OTJ S;  3S6E A;  1LK7 A;  2F63 A;  3S8S A;  3RBZ A;  1HQE B;  3NBP A;  4QIW D;  3FJ2 A;  3M2U B;  4A8X A;  2HRU A;  4CLK A;  4MAK A;  1FNO A;  1NHU A;  1P9Y A;  2QTW A;  4DUT A;  1UFK A;  2XYG B;  5I3Q A;  4DUZ J;  1HHT P;  4FVC A;  3PY8 A;  5AE2 A;  4NXN J;  4O3S A;  1N5Y B;  3DMJ B;  4U7U K;  4DV7 F;  1S99 A;  3D1H A;  2NXU A;  3NGD A;  4ED2 A;  1JJC B;  4X4V A;  2QIF A;  2XGQ A;  3PFE A;  3DM2 A;  4MFB B;  5B08 A;  3JAM Y;  2VIH A;  2OD6 A;  3KK1 B;  3C3L A;  1LNQ A;  4JI8 F;  4IFY B;  1JLF B;  1HBU B;  4IH7 A;  3X3U A;  2YKN B;  2MSS A;  4AFF A;  1KD1 T;  4B9N A;  4PKD B;  1RIS A;  4Q43 A;  4A8F A;  3KJQ B;  3E8O A;  1WTF A;  2D41 A;  1HMV A;  2JFD A;  4OMF G;  4TLQ A;  4K4T A;  3ZTO A;  3M8Q A;  2FY8 A;  2YTC A;  3P8B B;  2R7V A;  1S7I A;  2AX1 A;  3AOD A;  3AOB A;  1VJW A;  3DOK B;  4X62 F;  3VZI A;  1WEZ A;  1YSJ A;  3CIZ A;  3DLG A;  1SXL A;  4ZMM A;  4KV8 B;  2J0W A;  1ZPW X;  3GCW P;  2DGV A;  1HQU A;  3CD7 A;  3QZ8 A;  5LMN F;  2J0Q D;  3MM6 B;  1JLG A;  2AT1 B;  3LH2 S;  3TI0 A;  1RWO B;  2PMZ D;  2AEF A;  4AND A;  3QAU A;  3QGH A;  3WDO A;  1FO1 A;  4CLZ A;  2JSX A;  4DFJ A;  3PJW A;  4H4O A;  4GC7 A;  5J1P A;  2AGQ A;  3IA0 A;  2W8K A;  1TAQ A;  4ER8 A;  4QWA A;  2LP4 A;  3O3L A;  3TZY A;  2RD5 C;  3FFI B;  3HZE A;  3MM5 A;  3QAE A;  3A3O B;  4FYX B;  4OHV A;  1RYS A;  2UUA J;  1QDU B;  2V8G A;  1IKW A;  1MMN A;  8ATC B;  1S59 A;  1S1V A;  1WD6 A;  5KFF A;  1O6X A;  1S9G B;  5DJB A;  2WOM A;  4ECT A;  1HNV A;  3G8S A;  2VFT A;  5E7O B;  3IRW P;  1CJU A;  1WOS A;  2EK6 A;  1HI1 A;  1NAQ A;  1S9E A;  3H2U B;  2HQD A;  4K7Q A;  5U47 A;  3VZH A;  2VOP A;  3HCX A;  4B3M F;  1FD2 A;  3P3D A;  1VK3 A;  3FZ2 A;  2HVD A;  1N52 B;  5HVF A;  2D9O A;  1EET A;  3C16 A;  4I56 A;  4DL6 A;  2HWT A;  3NAH A;  1A7G E;  3HD1 A;  2OI2 A;  1F5C A;  4I0W A;  4OI1 A;  2QSW A;  1NK0 A;  2BE2 B;  2CDQ A;  3Q2T C;  4IYQ A;  2DH7 A;  3W9J A;  2HBZ B;  4ZHR B;  3NGS A;  2J0X A;  4HHH A;  4BDP A;  3BGR B;  4IFV A;  2BQR A;  4KTQ A;  4PEO A;  5EX3 A;  2W25 A;  4NLQ A;  1SBR A;  2VQE J;  4Q0B B;  5HBM B;  2I5J A;  1KOO A;  2WSC C;  3H2L A;  5F41 A;  5DGB A;  3FMW A;  3CME S;  2DHH A;  2CKW A;  3OXG A;  2LFV A;  4P75 A;  1I5O B;  4TYB A;  5D0R A;  3KLF B;  5IT9 Y;  2VKR A;  1T9Y A;  2HQG A;  1AXQ A;  1RTI A;  4IDK A;  4W4M A;  5HSP A;  2J9D A;  2Z2L A;  2MKC A;  4CH7 A;  5CYQ A;  2KG1 A;  4EBC A;  1RLC L;  1CJV A;  5ETM A;  1WDD A;  4KJI A;  4WTO B;  2DGS A;  1FXL A;  4NLR A;  3TAR A;  2VA3 A;  2ZFH A;  3SFU A;  3DDK A;  3V81 B;  5CZX A;  2Q3P A;  4BWJ A;  3IC1 A;  3MED B;  1NME B;  4ZVU B;  1GMW A;  1NJW A;  4ZLL A;  5C2G A;  1Q8B A;  2RE1 A;  2JNJ A;  3JQJ A;  2FIU A;  4NEZ A;  1RB0 A;  2M8H A;  2CQ0 A;  1TVR A;  3KJF B;  3GE9 A;  3P96 A;  3F44 A;  3HVW A;  1U0S A;  4KO0 A;  3BJY A;  3RR8 A;  2XMM A;  1VRT A;  2CNN B;  4K8R A;  5C25 A;  2C2M B;  5KG1 A;  5HLF B;  2QL7 B;  4OYA A;  1NM2 A;  2KFZ A;  3IWL A;  2ZH6 A;  3FEX B;  2FVR A;  1YZ7 A;  2ZKU A;  3IG1 B;  2QMW A;  1O5J A;  1U25 A;  2QMU B;  2IM2 A;  2PE8 A;  4X4N A;  1KN6 A;  1N5T A;  2V5H G;  3W2W A;  4FF1 A;  2R7W A;  4QWB A;  1T94 A;  1U8S A;  2PT0 A;  1LV5 A;  3CJK B;  2ZH1 A;  4WK3 A;  4WE1 B;  5LMN J;  1R8P A;  4NLP A;  1X4E A;  2CJY B;  4FYV B;  1UJ5 A;  3CJ3 A;  2ILY A;  4ECY A;  1Q5V A;  4CLP A;  2UUW A;  2QJ3 A;  1IKY A;  2ACM A;  4LSZ B;  4ECS A;  3MAA A;  1U47 A;  2WRM A;  4DI6 A;  4TU7 A;  4BC9 A;  1FE4 A;  1YJ9 S;  2W7A A;  1QVF R;  2MEW A;  4QR0 A;  3CW2 C;  5B09 A;  4LSL A;  3D5M A;  1HAR A;  3FRY A;  3DI6 B;  4J9N A;  4A8M P;  4DQI A;  4ILR A;  4LF5 J;  4QWC A;  4LBI A;  3A13 A;  3ZZ0 A;  1N48 A;  3PIP Q;  1V3Z A;  2BW2 A;  5E3Q A;  1GEH A;  2CPE A;  3BS9 A;  3W5X A;  1TUV A;  1FVS A;  2V4J B;  1ZH5 A;  3BGO P;  1U24 A;  3UVJ B;  4K4X A;  2BUN A;  2F3J A;  5CA5 A;  1UA1 A;  3AAW B;  5FLX U;  3PKM A;  1C2P A;  2VD3 A;  4BC7 A;  2NSB A;  4DR1 F;  4O0N A;  3FGV A;  1HQU B;  4O3P A;  2B9X A;  3AOA A;  3H5X A;  1QSY A;  2YKQ A;  2F5G A;  3NXZ A;  3TAQ A;  4NCB A;  2IVM A;  1B64 A;  4DV3 J;  1IBL J;  5K14 A;  4JI3 F;  5B0B A;  2OUG A;  2VG5 B;  1ZS6 A;  2KHD A;  3AA9 A;  3BKF A;  4FDF A;  4RLE A;  4KKO B;  4DF4 A;  3K0J A;  2ZH3 A;  4DR6 F;  1B3T A;  1O8B A;  3CO9 A;  4LFB J;  1YLX A;  1DBD A;  1FWP A;  3DRR A;  2IM0 A;  4PCQ A;  4RW9 B;  4XPE A;  2OPR B;  4RW8 A;  1JLA B;  4KB7 A;  4A46 A;  3L7P A;  1NUE A;  2MKS A;  4PXB A;  3M2U A;  1KKH A;  4ED5 A;  2M52 A;  1RAI B;  3CDW A;  3CDU A;  2PMH A;  1N0V C;  3LUY A;  5GAG U;  4OZL A;  3DOM A;  3GV8 B;  4RKU C;  3THV A;  1YJV A;  2VBW A;  3DGP A;  2W4C A;  4USV A;  2NQP A;  4N5S A;  1RTD B;  2FJD B;  3G9C A;  2VDI A;  2CQ4 A;  2ZEJ A;  3IM8 A;  2ZC4 A;  3G8Q A;  1LWE B;  3OUY A;  2BQU A;  2J9C A;  1HBU A;  1JLF A;  2VH7 A;  3HM9 A;  4DQQ A;  1CC7 A;  2ALZ A;  2AGP A;  1EIY B;  2NR0 A;  3RBE A;  2JVR A;  3I4H X;  4CH0 S;  3D4J A;  4JV2 A;  3ENQ A;  2X1F A;  1KNZ A;  2YWG A;  2MZR A;  1HMV B;  1RAE B;  3T1A A;  2LLZ A;  3HVT B;  3D66 A;  2IPO B;  2RIJ A;  2XI2 A;  1U09 A;  1RA7 A;  1X4A A;  4DPT A;  3FQK A;  2HS0 A;  2EC0 A;  3R3T A;  1M1K T;  3AH6 A;  1XNQ F;  1PBU A;  1SI9 A;  3QJP A;  1CC8 A;  4NYO A;  1T3N A;  4JI4 J;  2ZOG A;  3HPO A;  3ZTP A;  1N6Q A;  2ADC A;  4M5N A;  2OPS A;  1HR0 J;  1IKX A;  2AYG A;  1HNI A;  4V1A k;  3ICL A;  1FE0 A;  4RWX A;  5ETT A;  2YWK A;  1OMS A;  3DLG B;  5K8N A;  2G13 A;  1APS A;  3D3C J;  2J7U A;  2EBE A;  2FYX A;  2MST A;  3P4U B;  3FBF A;  3TJA A;  2FHK A;  1FVQ A;  2OKQ A;  2V68 A;  5KFY A;  4ELV A;  4PUO B;  4J91 A;  5IZH A;  1NLK L;  1MRO A;  2K2P A;  4X4S A;  5J2M B;  2HAI A;  3TAP A;  4PG6 A;  3K2Y A;  2IM1 A;  1U1R A;  3KK3 B;  4OYZ A;  2KJW A;  4CWB A;  1D9A A;  3PO4 A;  2VZ9 A;  5DDO C;  1HNZ J;  2FJX A;  3RAM A;  3ILJ A;  2AD9 A;  1ZTW A;  4E2F B;  1KQF B;  2RSQ A;  4PYA A;  4PXC A;  1IKW B;  4CCH A;  1HNW J;  2F9D A;  1ZAW A;  2FLO A;  3K8W A;  2E7V A;  3I9Z A;  1VHI A;  1WOP A;  2YNH B;  5GAE I;  3HF5 A;  4WXO A;  4LF9 F;  2MQN A;  4JI0 J;  2AX0 A;  4EZ6 A;  1NK5 A;  1S0V A;  2DHX A;  2H4Y B;  4WFZ A;  1YRX A;  4Q0B A;  3LF0 A;  5IM0 A;  1CLF A;  2HGL A;  5HP1 A;  5A2Q Y;  4FXV A;  1FEH A;  2QGF B;  4KC5 A;  2HHV A;  3NEK A;  2W9B B;  3A3P B;  2YQ3 A;  4ZVQ B;  5FDL A;  2DRB A;  1R8H A;  1SJF A;  1HPZ B;  2HIQ A;  1AZS B;  1VS3 A;  1WG1 A;  2QA2 A;  3GG1 A;  3Q8V A;  4QPT A;  2RDJ A;  3BBF A;  1J5O B;  3QWP A;  2FY1 A;  2R8H A;  2AZ3 A;  3VQT A;  2YWE A;  2R8G A;  4LRC A;  2WVB A;  3SYZ A;  4Y65 A;  4WZM A;  5KFO A;  3RW6 A;  3N6M A;  5ETK A;  1NPP A;  1XBW A;  4C2M A;  4YQW A;  3SV4 A;  1VR6 A;  4UZB A;  1XR5 A;  3OFF A;  1UVN A;  1DQ9 A;  1U48 A;  3KDO A;  1DRZ A;  2QN6 B;  3DDI A;  2OEL A;  3NL0 A;  4QIV A;  4B3T F;  4DG1 A;  3CD0 A;  4USK A;  5KT2 A;  1D8Y A;  2UP1 A;  5KG4 A;  2PI4 A;  3ZTQ A;  4PQA A;  2HZV A;  4F2R A;  5F8G A;  1YJN S;  1JLE B;  2ZIT A;  5HL7 Q;  3EJM A;  4RUA A;  4DR3 J;  4ZVG A;  4BWM A;  1IBK J;  3V6D A;  3QT8 A;  2UUC F;  2EG1 A;  3HHD A;  4DF8 A;  1UJ6 A;  1VRU A;  1U6Z A;  1ZA2 B;  1Q78 A;  4I69 A;  4F3M A;  2D74 B;  1WI6 A;  2QYG A;  1X5T A;  2D9P A;  2XNQ A;  2E44 A;  2OIH A;  2L08 A;  1Y7P A;  2J8A A;  3ENW A;  5IC6 B;  2XS2 A;  3OLA A;  3GJQ B;  2FJV A;  4RW4 A;  1KFS A;  4EO6 A;  1YHQ S;  1T95 A;  3DCA A;  4I2P B;  5KFR A;  2M9K A;  1JWW A;  4OX7 A;  3MCO A;  1UVL A;  3CDE A;  3EIC A;  4OX6 A;  5GMD A;  2ZH8 A;  3CJ4 A;  5KFZ A;  1N36 J;  1BWE A;  3RUB L;  1VQ6 S;  5DDQ C;  1RQ0 A;  2Y1L B;  4ZLJ A;  5HAT A;  1JXL A;  2NUU G;  2OML A;  1T05 A;  1GXL A;  4WE1 A;  3JYT A;  1YKW A;  3W3S A;  5HAN A;  3PR5 B;  2G9O A;  2OO4 A;  4RW6 A;  2AHO B;  4LBP A;  2CWK A;  3D6M B;  1FKA F;  3DFE A;  1DUR A;  4NLX A;  2QLJ B;  2MZJ A;  2GGP A;  1RT3 A;  4NI2 B;  5EWE A;  1F0X A;  3PYE A;  3PVX A;  3M6V A;  5KG3 A;  3S7R A;  3CF5 Q;  2Q43 A;  3HFZ B;  3TAM A;  1TK0 A;  3LW5 C;  1H72 C;  1HNZ F;  4CYU A;  2GMH A;  4B17 A;  1HYS A;  2G2Y A;  1B0T A;  1X4C A;  3GQC A;  4PPD A;  1HW8 A;  4R8U A;  2VAS A;  1FF2 A;  1FFW B;  1WHV A;  2XBP A;  4USM A;  2HBQ B;  3UN3 A;  3OTO J;  4WIQ A;  1FHT A;  5D4L A;  1LWF B;  3G86 A;  2Z2M A;  4RPF A;  1X4H A;  4P2M A;  2VIC A;  2XGP A;  4U7U D;  4ZPB A;  2YWW A;  1X8D A;  2W4D A;  4J9V A;  2IHR 1;  3QT6 A;  3TJ9 A;  3TVY A;  5L38 A;  3CE8 A;  3LA0 A;  4DR4 J;  1C1C B;  1FWL A;  2C3Y A;  3I32 A;  4NLY A;  5F8H A;  4YR2 A;  3J7Y I;  4DV0 J;  1OJ4 A;  2JOQ A;  3G6E S;  1RT4 B;  2LDI A;  1YIT S;  3PAC A;  1NRK A;  2RQK A;  1SL0 A;  8AT1 B;  2BW7 A;  1WKK A;  4LF2 A;  4PG7 A;  1RZM A;  4F26 A;  4ZK7 M;  2R7R A;  1X9W A;  1I94 J;  3M30 A;  3MEE A;  3DRS A;  7FD1 A;  2FJE B;  5GAD I;  4PG5 A;  2OSR A;  3RB4 A;  5KAK A;  1HNX J;  1NB2 A;  5KFA A;  2EVZ A;  3MTK A;  5B0E A;  1W26 A;  3HDS A;  2M0G B;  3ZZP A;  3C2P A;  4DWI A;  4RBU A;  4GKJ J;  4PG4 A;  1AA1 B;  1RAC B;  5EGY A;  3GV5 B;  2RQM A;  2P6T A;  1QAI A;  4IRC A;  4MKB A;  1NK4 A;  2GO8 A;  5CD4 H;  1S6O A;  3MR5 A;  4HR2 A;  3AD8 C;  2F4V F;  2GZO A;  3ISZ A;  3PRB A;  3CCU S;  1F3V A;  2GC8 A;  2BM1 A;  4C3M A;  3ITH B;  1V3S A;  1PAU B;  4R5P B;  1HBN A;  1PYO B;  4Y3C A;  4I6W A;  3PHT A;  3R97 A;  4DG1 B;  1GTE A;  5KT3 A;  2LCW A;  2O1P A;  4EEY A;  1S48 A;  2XMW A;  2RKI B;  1BQM A;  1UJ4 A;  3JS9 A;  5H1S V;  1VQ9 S;  1P6T A;  1SC6 A;  4NA1 A;  4WFB Q;  1PYS B;  5CXT A;  1UKU A;  3GON A;  3PDN A;  4JI2 J;  3OHA A;  3BO3 A;  3UD4 P;  3BB5 A;  4WKY A;  5L1K A;  4ED3 A;  1SC4 B;  3M2R A;  1UWB B;  2VF3 A;  3C6U B;  4KR0 B;  3PKY A;  4F2S A;  2C2R A;  1UVI A;  3HO1 A;  2MPU A;  4KH0 B;  3KLI B;  2N82 B;  2IC3 B;  2KT5 A;  2D3U A;  2OPS B;  3EGV A;  2K06 A;  5CAB A;  1TKX A;  4L6V 3;  3VGV A;  3PW4 A;  1BC6 A;  4C11 A;  2H9Z A;  2JEG A;  1JLE A;  4OX9 J;  2KG0 A;  3HHN B;  1S97 A;  3QSI A;  1R0A B;  4KAI A;  4WFA Q;  4FZV A;  3DMJ A;  1RAD B;  2G2Z A;  1WC4 A;  5CCL A;  3H7H B;  2DGQ A;  2M7S A;  4ED4 A;  4LSL B;  3B4D A;  3UW1 A;  2V4R A;  2KTQ A;  1VI7 A;  4DL2 A;  1ZZF A;  3KK1 A;  2CPI A;  1L3T A;  3MXH P;  2PO4 A;  3N0V A;  3G71 S;  2WBR A;  4B9U A;  4LF7 J;  3L7O A;  2BJ9 A;  3AXM A;  3KUH A;  2HHQ A;  3SFG A;  4RUH A;  3TUP A;  1QSS A;  3M6U A;  4J90 A;  5DRK A;  1FRX A;  1TZ0 A;  4AXI A;  2VC0 A;  4TQR A;  1XJW B;  1XWL A;  2CAD A;  4WFX A;  2ZH7 A;  4ID5 B;  4GVL A;  4ANC A;  2POK A;  2HVI A;  4MH8 A;  4MKV A;  2OAU A;  1S49 A;  4M5L A;  5CYM A;  1ZYQ A;  3RU0 A;  1SUQ A;  2GAG C;  3M8Z A;  2CVI A;  2L9D A;  1JLB B;  4ZIW A;  4B3R J;  1IN0 A;  2VU5 A;  1NJX A;  1VRQ C;  4LFB F;  3HSD A;  2VQE F;  1AUD A;  4F67 A;  3MMA A;  2NLW A;  3PJ9 A;  2DEJ A;  4KYZ A;  4RW7 A;  3M1V B;  4G3I A;  2OEJ A;  1T03 A;  1Q8K A;  3PYG A;  3MDF A;  4OZ3 A;  4WBF A;  3K59 A;  2FVC A;  2CJA A;  2KM8 C;  1SVD A;  2HWH A;  2RVJ A;  4BS2 A;  1HWI A;  5G0R A;  2RNE A;  4KHM A;  1LWF A;  2PEB A;  3PEJ A;  2BOP A;  4OIX A;  1YWX A;  4OI4 A;  4TY9 A;  4USJ C;  3KHG A;  3WZ0 A;  3O8W A;  3BYP A;  3EVM A;  5CYJ A;  2L48 A;  4ID8 A;  5HQM A;  1IM6 A;  1FRL A;  2DGW A;  2DTJ A;  1UTA A;  1K1S A;  3M6X A;  4ZVP B;  3KLG B;  4J9S A;  1NEE A;  2B43 A;  4UOF A;  3HHK A;  1N32 J;  3UQS A;  2OSQ A;  2CPH A;  4F50 A;  4DFK A;  4C0H A;  2G1D A;  1RT6 B;  1N5V A;  1FK9 B;  1LKZ A;  3JQM A;  2FVS A;  2QMX A;  2ZM6 J;  4RNM A;  2DNM A;  1WKL A;  2HS3 A;  4ZVT B;  3MEE B;  4M5H A;  2BA9 A;  5EN1 A;  3TW0 A;  3OPK A;  5F0W A;  4C8M A;  4A47 A;  4Y2A A;  3Q8S B;  4DQS A;  1RK8 A;  4O23 A;  3BM7 A;  1H73 A;  4WFY A;  4YDD B;  1V5V A;  3TUI C;  4ZN1 A;  3KLF A;  1UZH A;  2C3P A;  1DJ0 A;  1TL3 A;  1I3O B;  1RGV A;  2WSF C;  2XMT A;  4H4M B;  2EG2 A;  2O66 A;  5AXK A;  1SKW A;  3TEH B;  3OXL A;  1QSL A;  3W1Y C;  2ZC3 A;  4HI1 A;  1DFD A;  4RNN A;  5CYQ B;  4F4W A;  2V34 A;  4GRS A;  2QA4 G;  4HT5 A;  1SL1 A;  2R8J A;  2KRB A;  2GIR A;  4OI3 A;  4NA3 A;  4AYB D;  1SH0 A;  3BO4 A;  4DSI A;  3K7R A;  4IOA Q;  2ZH4 A;  1XN9 A;  2I38 A;  2P9G A;  4Q44 A;  4R5P A;  1FXD A;  2QL5 B;  3IR7 B;  5EWG A;  5J2M A;  2E9R X;  1HYS B;  1R43 A;  3FBB A;  1CJV B;  3LPY A;  3O6Q A;  3PYF A;  4P7V A;  3C14 A;  4R8U B;  5M2U A;  5H9F K;  2DRA A;  2D1C A;  2YKM B;  4F0K A;  3PO5 A;  4FF3 A;  2E66 A;  4WTY A;  1Z1Z A;  2HZA A;  4L76 A;  4YEA A;  3MEK A;  1UW9 A;  3G6Y A;  4I7F B;  2YH1 A;  1M5H A;  2CJB A;  3RB3 A;  3C15 A;  1L3K A;  2ROE A;  3PIO Q;  4ED6 A;  2EPI A;  5J2P A;  4LF6 J;  2WBM A;  3M2R B;  5E2Q A;  2OPQ B;  3ETO A;  5IWA J;  2MMY A;  1VBX A;  1GX6 A;  4FYD A;  1OPI A;  2FC8 A;  2LA6 A;  3KHH A;  3ISN D;  4CP5 A;  1BLU A;  4MK7 A;  4ZIT A;  2P8I A;  3H2V E;  5ITH A;  3LP1 A;  1Q8I A;  2HAF A;  3OR2 A;  5DQI A;  2J6U A;  4X4R A;  2AJ0 A;  2GVD B;  4B08 A;  3V4I A;  3SQG B;  4UUX A;  3NWG A;  2WTF A;  2QG9 B;  4I68 A;  1RT7 B;  4RNH A;  2VOO A;  4PWD B;  3DLJ A;  1REV B;  5HK4 A;  1S0O A;  1FKP B;  1BD6 A;  4QW9 A;  1C1C A;  2OD4 A;  1UEV A;  2C28 A;  5HVG A;  2E5H A;  3G82 B;  2JH3 A;  3LTO A;  4ZDN A;  3R9L A;  2UUB F;  1Q1K A;  2MGZ A;  3RRK A;  1FWK A;  3MF5 A;  4CO4 A;  1HNV B;  4MK9 A;  1X9S A;  2BM0 A;  3D2W A;  3J80 U;  2G0C A;  3IWX A;  2K1R A;  1TL1 A;  3BZQ A;  3GTY X;  3DU6 A;  4A48 A;  4DCO B;  2MZQ A;  3QRQ A;  5K8M A;  2EXU A;  2I0X A;  1HWJ A;  2LQ8 A;  2X3G A;  1PAE X;  4CLT A;  3DDN A;  2MQM A;  5IFM A;  1RTI B;  4IDK B;  4ZHR A;  3FSY A;  3HD2 A;  3EPI A;  2IM3 A;  1PGZ A;  2HNY B;  5KFG A;  4U8V A;  5CH7 B;  1FDA A;  1KSP A;  4OJG A;  2ROG A;  2IMO A;  3N9U C;  3IN5 A;  1Q86 T;  1UVJ A;  4WKR A;  1M5P C;  1FXR A;  2FD2 A;  1XER A;  3OXF A;  4LSN A;  3CJT A;  3D28 A;  4FXW A;  3JSM B;  4JI7 F;  4HL9 A;  2LYV A;  4O4G A;  2Y9H A;  1Y3K A;  1ZAV A;  4OYB A;  3PW0 A;  2C3M A;  1W7W A;  2OH2 A;  1LWC A;  3MI7 X;  1U49 A;  4N77 A;  5JMN A;  3EGW B;  5IV4 A;  1KQS R;  3GU0 A;  2R2T A;  4B9V A;  4FKY A;  3CNQ P;  4N8O A;  3TX8 A;  4Z7C A;  3MR6 A;  4DLG A;  2FVQ A;  4LMZ A;  1H3D A;  3EDQ B;  4NWB A;  5SUH A;  3CJS A;  1X4D A;  2R8K A;  5D4N A;  3OBI A;  2ASY A;  1TKD A;  2RRB A;  2HHH F;  3HFV A;  2XMJ A;  1FFG B;  2UVV A;  1IJF B;  3T9Z A;  2W01 A;  1S1X B;  3GIL A;  4CO5 A;  5C24 B;  2GHV C;  2QRR A;  4X65 F;  5KFH A;  2NPI A;  2OP5 A;  2BBE A;  2GNK A;  4CNZ A;  1K44 A;  1U0H A;  3NRB A;  3UFC X;  1K73 T;  4DV1 J;  3M2V B;  2XHW A;  1OSD A;  2D7S A;  3R5C A;  3K5O A;  4EBD A;  1CJK B;  1V9O A;  3R5D A;  1FT8 A;  4CLS A;  4NLS A;  1BHN A;  4O3N A;  1MML A;  2HNZ A;  2BMB A;  3UCU P;  1RBO B;  1Q95 G;  4OJ3 A;  2HBR B;  2YBV A;  4EYH B;  4A8W A;  4BLG A;  3M4X A;  2LVW A;  4PRF A;  1EZZ B;  1IKY B;  1KQG B;  2RRN A;  3THT A;  1FRK A;  3ZO7 A;  1YDL A;  2IAJ A;  1XIQ A;  3NOC A;  4QOT A;  1ZET A;  4Y6I A;  2M88 A;  4RU2 A;  1PC5 A;  2D3Z A;  1HNI B;  3D7S B;  4AD6 A;  1D0E A;  3MEC A;  2E1M C;  4FPI A;  3S1T A;  2P6S A;  2YH0 A;  1FRJ A;  3WX8 A;  3B4M A;  1N6Q B;  2FHJ A;  4C0B A;  3M8R A;  3OL9 A;  1D09 B;  3IRX B;  4ICL A;  2WB1 D;  4P2S A;  3OTO F;  3LP1 B;  4Z7Y A;  2CQD A;  3SZ2 A;  2XY5 A;  3OSN A;  2BKO A;  2DNR A;  3GJT B;  1HBM A;  1NSQ A;  5FD1 A;  4JV1 A;  3BGL A;  4DSK A;  3JAM U;  1OQ3 A;  2CIM A;  4HVZ A;  4LBH A;  4GVB A;  3DHX A;  2ZWO A;  4YP3 A;  1B99 A;  1ARO P;  2U2F A;  3ADA C;  4Y2I A;  5KFW A;  2AJ4 A;  1SKS A;  4CT9 A;  5DLF A;  4ZVO B;  5DG9 A;  1HWU A;  1FK9 A;  2B4O A;  2UXC F;  2KZZ A;  1VQ8 S;  2FPH X;  5LSO A;  3KHL A;  1UVK A;  4W90 B;  2Q79 A;  3CCW A;  4PWD A;  1Y0H A;  2HLT A;  2BZ2 A;  4XIU A;  2COL A;  2ZBQ A;  3CWJ A;  1S6P A;  4NLD A;  3T1Y J;  2FLP A;  1T7P A;  2HRY A;  2EFN A;  4QWD A;  1FTR A;  4I64 A;  1BQM B;  2BEF A;  1EKS A;  2FTR A;  1QE1 B;  5E3R A;  4JI4 F;  1DQA A;  2BJ7 A;  5HAO A;  4QPX A;  2E1C A;  4JI2 F;  4RU9 A;  2ERR A;  2E1A A;  3C8Y A;  2HVE A;  3AY0 A;  3V81 A;  4C9D A;  3W66 A;  3KLE B;  2WVC A;  3NLC A;  3SIP B;  3TZZ A;  1IR0 A;  2VPW B;  1QM9 A;  5FDL B;  3OL7 A;  1RAB B;  4DZ6 A;  3TP2 A;  4UW2 A;  2IC3 A;  4DJB A;  3VGT A;  3G4S S;  2JEJ A;  4CZC A;  3HHL A;  4EBE A;  2I6W A;  3M8S A;  4CLW A;  3VVU A;  1TUW A;  2HHS A;  3RAQ A;  1TL5 A;  4HLB A;  1RAA B;  3EDR B;  2IRX A;  2LDY A;  2DD8 S;  4AL6 A;  1TKZ B;  3QIP A;  3BQ1 A;  3GYG A;  3CCS S;  7AT1 B;  3L7U A;  4IKA A;  4UOG A;  2NRE A;  2Z4P A;  3SSR A;  1S10 A;  2BRK A;  4LF4 F;  2ZHA A;  5ETS A;  2IIH A;  2E7X A;  4B9M A;  1TL4 A;  4JI5 F;  4Y00 A;  3NGK A;  4CNY A;  4M5J A;  3PV8 A;  1Q0N A;  1IKV A;  3BSO A;  4F0H A;  3MFH A;  2HW3 A;  1H2V Z;  1R31 A;  2DNN A;  2VG6 B;  3F41 A;  1SJQ A;  3IBC B;  1RT2 B;  3IXQ A;  4EWT A;  3H8Y A;  5HQ8 A;  5MLC V;  3K5M A;  2IA6 A;  2ATC B;  3M8P B;  3O2I A;  1KTV A;  3GCX P;  2DK2 A;  3ILL A;  2B4P A;  2YNF A;  2HFN A;  4ZP9 A;  2MHN A;  3ZZT A;  1I1G A;  4K4W A;  1QAJ A;  2BJ8 A;  4DV4 J;  3Q89 A;  1JJ4 A;  2JEI A;  1GT8 A;  3FRZ A;  2N7Y A;  3MAH A;  4KHP F;  2W24 A;  4I4B A;  2Q6C A;  1RAG B;  1U4B A;  3OW2 R;  2UU9 J;  4DDF A;  3UVJ A;  2RB7 A;  3SSS A;  1JLC B;  2OTL S;  2BXJ A;  4CH1 A;  1KR4 A;  1NPR A;  1H7W A;  5HP1 B;  1L3U A;  3AXK A;  5T14 A;  4LF8 F;  4Q8F A;  4ZOS A;  1IR2 A;  1Y3J A;  3IAS 9;  3KJV A;  2G1H A;  3EZ5 A;  3MUM P;  2OLW A;  3OFG A;  3KNG A;  1NND A;  3I6P A;  2HNZ B;  2C2E A;  2VV5 A;  3H5Y A;  1HD1 A;  2OHD A;  3CGI A;  3MZI A;  4UY8 5;  1KON A;  2MZT A;  3LGM A;  5J2N A;  1GNK A;  2VG5 A;  2DH9 A;  2CA9 A;  2KI2 A;  2J6S A;  3BN7 A;  1Y5L B;  2DR6 A;  1RWX B;  2JZ5 A;  1RAF B;  4FPR A;  4IG3 A;  1UPP A;  4K59 A;  3MR2 A;  4DR3 F;  1NJY A;  2LEB A;  1IBK F;  3CCQ S;  1OIA A;  1Y5I B;  2OPR A;  4RW8 B;  4FBT A;  3GV7 B;  4M1K A;  3TA0 A;  2LEP A;  2VPX B;  3CB4 A;  3Q24 A;  3HLU A;  5IXU A;  4DCP B;  5K8P A;  3BKT A;  4J9U E;  1WAC A;  5T7L B;  2HBY B;  3GSI A;  3IRX A;  1KDN A;  4FNH A;  3VAF A;  2ZHO A;  4NLU A;  2DR7 A;  4RJV A;  3TA1 A;  1EQ0 A;  1RTJ B;  3VCD A;  4AL5 A;  1S6Q A;  1HHS A;  4E8U A;  2XCA A;  3GJR B;  2BKP A;  3I0R A;  3ZZZ A;  1H74 A;  3VAI A;  3NNH A;  4QCL A;  5M2R A;  3U02 A;  1XTZ A;  1OY8 A;  4ECR A;  1UMJ A;  1WWH A;  1Q5Y A;  3JB9 k;  4JI7 J;  1T9V A;  3QLH A;  4YDX A;  2XSJ A;  2FB0 A;  3SBM A;  4UT4 A;  3ZC4 A;  1RT1 A;  2J76 E;  3WC0 A;  1NSP A;  5J1E A;  3RBD A;  4QIE A;  1U1Q A;  2NYH A;  4AQY J;  1JXV A;  2A2C A;  2QFI A;  3KG4 A;  3KLV A;  4DSF A;  4KHR A;  3K5P A;  3PHE A;  2G4B A;  1BQX A;  3I96 A;  1SC1 B;  4LQ9 A;  1TMJ A;  1HI0 P;  2A0F B;  4RBV A;  3U27 A;  4UOC A;  4CQ1 A;  1REG X;  1RU2 A;  1VBK A;  1VC6 A;  2WON A;  1OS5 A;  2XMU A;  2GS8 A;  3RG6 A;  1BXN A;  3PCO B;  5KFK A;  2HGM A;  4NRT A;  4QIG A;  4AT1 B;  2C2K B;  2H1Y A;  3CJ8 A;  4ES2 A;  2B0G A;  4C8O A;  2WK4 A;  3E01 A;  3ETM A;  3LAK A;  2C42 A;  2YNI B;  4WP3 A;  2XM3 A;  1HLW A;  1SJR A;  3UD3 P;  1QD1 A;  1H2T Z;  4K4Y A;  4I7F A;  3PW7 A;  5KFC A;  3H90 A;  1WC5 A;  4TKT A;  5HVH A;  2L41 A;  1FDB A;  1GXT A;  2A2D A;  3I55 S;  5DZ7 A;  3WX4 A;  5GMK a;  2DPJ A;  2EFV A;  1S79 A;  2BAC A;  2CPY A;  1QVG R;  1S6U A;  3H98 A;  3OL6 A;  4USI A;  5RUB A;  3MOJ B;  4W98 A;  1BQN B;  2MQL A;  1RT5 A;  3N6L A;  4I1T A;  2M70 A;  1EB0 A;  2CQ3 A;  3GMG A;  2IYI A;  1FDN A;  3HVA A;  3IGN A;  4HEA 9;  4R0J A;  4QQB A;  5C25 B;  5F3Z A;  5A2Q U;  3UE2 A;  1Y4Z B;  3DN9 A;  5B0G A;  2W2Q P;  5C42 B;  1ICE B;  2XS7 A;  2CPD A;  3HSZ A;  3B8H A;  2UUB J;  3T19 A;  1OY9 A;  2BAN A;  3M32 A;  4YY3 F;  3ENA A;  3KLI A;  4QZV B;  3EE3 A;  5JXS A;  4YB1 P;  3VAH A;  4DPX A;  1UZD A;  1AUS L;  2EBG A;  2F8H A;  2VG6 A;  4DV3 F;  4X84 A;  1IBL F;  3CJK A;  3TVK A;  3J81 Y;  1Q53 A;  3AJD A;  3RAX A;  4YOE A;  2KVQ E;  2N3L A;  2QZ8 A;  4EO8 A;  1NK8 A;  3GIK A;  1NKC A;  1U6F A;  4ED0 A;  4F02 A;  1NDP A;  2VL1 A;  3M30 B;  3R5G A;  4LFA J;  4XO0 A;  4GVB B;  4OX8 A;  3PFO A;  1F9F A;  2BE7 D;  3KTQ A;  5K9F A;  5T41 A;  3F0N A;  5D3G A;  1ZM4 A;  3QRR A;  3R7B B;  2XUL A;  1V5I B;  2GW8 A;  2YWF A;  1L3V A;  2X51 A;  5GVQ A;  2XY6 A;  5DQH A;  3R1H A;  2UUC J;  1UL3 A;  2EFG A;  2OPP B;  1HQ2 A;  3NNC A;  4G1Q B;  4Q2M A;  3K17 A;  4FF4 A;  1K0V A;  1C0U A;  3BGR A;  4IFV B;  1HWL A;  1T9T A;  5CYM B;  1FRM A;  2B56 A;  3B78 A;  2JLG A;  1JLC A;  1GK8 A;  1JJ2 R;  1T9W A;  4X62 J;  4O4G B;  1FRI A;  3HUL A;  3N28 A;  3PEH A;  4P73 A;  2FLL A;  2HHX A;  4LRB A;  2Y8W A;  1HHQ A;  3BGF A;  4WU2 A;  4ENO A;  4F04 B;  5BR8 F;  4NXM F;  4E0D A;  2YWH A;  2KFN A;  4USU A;  1PKU A;  5A6P A;  5B0F A;  3MGJ A;  5J2N B;  1HD0 A;  1SQE A;  2CNK B;  4XK8 C;  1IR1 A;  1KLN A;  2K7J A;  5G0R B;  4OYI A;  2DEI A;  1JLQ B;  3D6F B;  2CUY A;  2B4U A;  1EQM A;  3UI3 A;  2ZUG A;  3LQV A;  1UFL A;  3QQC D;  2AP6 A;  5EHH A;  3HXM A;  4RX6 A;  3I0R B;  2LKZ A;  1YG0 A;  2R2R A;  3TOQ A;  1S76 D;  4MYU A;  3OHB A;  5B0A A;  3CD6 S;  1WC0 A;  1RHJ B;  1TVR B;  4KO0 B;  2NXJ A;  4AUK A;  1XEZ A;  2XMK A;  4C7Q A;  1JQG A;  1SQF A;  4YME A;  4DR7 F;  4QYZ J;  3T5L A;  1C0T A;  2ZH5 A;  3MED A;  4HTJ A;  4DLE A;  2KYX A;  4LR7 A;  4EGL A;  3NWR A;  1R0B G;  1Q79 A;  1CJK A;  3C6U A;  1EKR A;  1VLY A;  2OMO A;  3DU5 A;  5KOW A;  4HAC A;  4KRW A;  5L1J A;  2DGO A;  2JVO A;  4M8L A;  5E33 A;  1E6Y B;  1U2F A;  1AYE A;  4RNF A;  4PPZ A;  4YFU A;  1UW4 A;  4G65 A;  4C0O C;  2J9E A;  2UV8 A;  3H59 A;  3NOG A;  5F3T A;  4ERD A;  3M8P A;  2IA0 A;  4X65 J;  4U67 Q;  2R7X A;  1JKH A;  4USH A;  1Q81 T;  1VYA A;  2AJ2 A;  2IDL A;  2K8G A;  2PC6 A;  3GFH A;  2CG4 A;  4LVN P;  1UFW A;  2C2N A;  5LM7 E;  3DNC A;  5HJY A;  5ETO A;  4LIW A;  3W2W B;  1WG5 A;  1F5A A;  1DHM A;  2EFP A;  4CTA B;  3TZX A;  5DQG A;  4C97 A;  1RTZ A;  2DRD A;  2DB1 A;  2DO4 A;  4YY3 J;  2WAQ D;  4HI2 A;  2PSZ A;  4PG8 A;  4IQX A;  1NDL A;  5JVG Q;  4DPO A;  2E29 A;  1KC8 T;  4IUF A;  1CQM A;  2KXH A;  3VGS A;  1CJT A;  1U1P A;  4FXD A;  2LQB A;  2XNR A;  4DV6 J;  3OL8 A;  4DSL A;  1ZZN A;  4WF9 Q;  1LOU A;  2KB2 A;  2Y3Y A;  3FVY A;  2AYM A;  3KJV B;  4IG3 B;  5JVH Q;  3CC4 S;  2CNO B;  1XR7 A;  3JQK A;  4I67 A;  2JFK A;  2XZW A;  2VHG A;  3ZNU A; 
#chains in the Genus database with same CATH homology
 2QLJ B;  1RHU B;  3EDR B;  3R5J B;  2CDR B;  1SC3 B;  1ICE B;  2H51 B;  3RJM B;  2C2Z B;  1GFW B;  2H54 B;  2HBQ B;  2XZT B;  3IBC B;  3R7S B;  1NME B;  4ZVU B;  1I51 B;  3EDQ B;  3P4U B;  3KJF B;  4ZVP B;  1RWP B;  2CNN B;  2C2M B;  1F9E B;  1BMQ B;  2QL7 B;  3R7B B;  1RHQ B;  3R7N B;  1RWK B;  2XYH B;  4ZVT B;  2XYP B;  5IC4 B;  1RE1 B;  4ZVS B;  1RWN B;  2XYG B;  1I3O B;  2CJY B;  2H4Y B;  2H5J B;  2HBR B;  1RWV B;  2H48 B;  2P2C B;  1RWW B;  4LSZ B;  3IBF B;  2CNK B;  4ZVQ B;  1RWX B;  2C2O B;  1PAU B;  2H65 B;  1RHM B;  3D6F B;  1PYO B;  3KJQ B;  2QL5 B;  2QLB B;  3P45 B;  2H5I B;  1RHJ B;  3QNW B;  1RWM B;  2DKO B;  4DCP B;  2HBY B;  2Y0B B;  3GJT B;  3R6G B;  1SC4 B;  5K20 B;  3GJR B;  2XZD B;  3R6L B;  1RWO B;  3D6H B;  1IBC B;  2QLF B;  4ZVO B;  1QTN B;  2C1E B;  4ZVR B;  2CNL B;  1RHR B;  2H4W B;  1SC1 B;  1QDU B;  5IC6 B;  3GJQ B;  3NS7 B;  1RHK B;  2C2K B;  4DCO B;  2QL9 B;  3GJS B;  2FQQ B;  2Y1L B;  2CJX B;  4JB8 B;  3SIP B;  4DCJ B;  2CNO B;  2HBZ B;  3KJN B;  3D6M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...