2HBRB

Crystal structure of human caspase-1 (arg286->ala) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2hbrB00
3R6GB 4DCJB 3GJSB 2QLFB 1SC4B 4ZVOB 1F9EB 3RJMB 2Y0BB 3EDQB 4ZVPB 1RWPB 5IC4B 1I51B 2H51B 2XYGB 3R5JB 1RHMB 3GJRB 1RHUB 2QLJB 4ZVQB 1QTNB 4ZVRB 1RWMB 2H4YB 3NS7B 2CJXB 1RWOB 2CNNB 3QNWB 1RWXB 2CNOB 3R7BB 1PAUB 2H4WB 1NMEB 1RHKB 2P2CB 3R6LB 4ZVSB 3D6MB 1SC1B 1RE1B 3R7SB 5K20B 2H5IB 1ICEB 2XZDB 5IC6B 1RWNB 2XZTB 3KJNB 2DKOB 4JB8B 2H5JB 1RWWB 3IBFB 1RHJB 2QL7B 1RWKB 3P45B 3KJFB 1RHQB 1QDUB 4DCPB 3R7NB 2QL5B 4ZVUB 1GFWB 1PYOB 4DCOB 3EDRB 2C2MB 2C2OB 2CJYB 3SIPB 2QLBB 3KJQB 2XYPB 1RWVB 2QL9B 3GJTB 2XYHB 2HBRB 2C2ZB 2HBZB 3IBCB 2HBYB 1BMQB 2CNLB 4LSZB 2C2KB 3D6FB 3P4UB 2CNKB 2FQQB 1SC3B 1RHRB 2H65B 4ZVTB 2H54B 1IBCB 2CDRB 2H48B 3D6HB 2C1EB 1I3OB 2Y1LB 2HBQB 3GJQB
chains in the Genus database with same CATH superfamily
5DG8A 3P5TL 3QQCD 4QIGA 3W8PA 3B4MA 2VG6A 3HJVA 2CQBA 2DH8A 3IXQA 3MURP 5G4DA 4YHHJ 1RGVA 2SXLA 4DR2F 4I2QB 3MFIA 1HI1A 3DFEA 3LP1A 4M1KA 2UUAF 2DNPA 3CD6S 3R2DJ 2DNYA 2XYGB 4OLOA 3RR8A 4ZVEA 4G3IA 1T3NA 3CJQA 4YR3A 2MPUA 1SKRA 1C0UA 2J7UA 4HEA9 4ED0A 2KB2A 5HATA 3TW0A 1IQZA 4K4YA 2NXNA 2LU2A 3VCDA 2C42A 3DN9A 4U9RA 2FLPA 1HBNB 1U26A 2LA4A 1ZAXA 2X1BA 3V4IA 1OY6A 3UO0A 3CDWA 1RAJA 4YEAA 4ZIVA 3GP9A 1OJ4A 5B08A 2Q3PA 1KTVA 4QYRA 3LQVA 2EFQA 1SL1A 4DX5A 1WI8A 2AF6A 1FDNA 2QRRA 2UV8A 3M8ZA 4M5NA 4X62J 2VONA 2CVIA 1M5SA 3RZAA 2RKIA 3ADAC 2DXEA 3MMCA 4KHRA 5KFLA 3UN3A 2Y8WA 4U95A 2RUSA 2IYIA 1NCLA 1RBLA 1VIXA 4OI6A 4ECVA 1YJVA 1AFJA 3CDUA 2E5LJ 3PW7A 3C2PA 4G1PA 5IS2A 4TYBA 2YKNA 1OYEA 2OPQA 3IA0A 4MT1A 1TL5A 3UVJA 3EVWA 4LF4J 3GCWP 1HL6A 2ZWPA 4C48A 3OPKA 2V5HG 1TFYA 4KHMA 1PC5A 4K59A 4M63A 1SPBP 1U1RA 2QO3A 5EWGA 1X4AA 4G1QA 2RMLA 3FUYA 2GV1A 3S1TA 2V63A 4KPYA 1HPZB 5LXYA 2DNGA 2GQCA 1AA1B 1R0AB 2FVCA 5EHHA 3FNNA 3AXMA 3AJDA 3TRGA 4C97A 4DCOB 3EDRB 2CJQA 4NA2A 3DOMA 3OJSA 4ERDA 1VGYA 5FD1A 1FKPA 4CO0A 2VASA 5EUHA 2QL9B 1C4CA 2QT7A 5D4NA 4DUYJ 1TKTB 2DPIA 1HNIA 2AW0A 4JI2J 3CJ2A 1VQ6S 4Q8FA 2VPWB 4MKBA 4C8YA 2M3DA 3BGFA 3QAUA 4O3QA 1ZA1B 3HK2A 3OFGA 5L46A 1BMQB 3CCES 1Q79A 1S7HA 2K06A 3A4TA 3H0PA 2HVHA 4MIWA 3BGRB 5E41A 3IWLA 2PGCA 2WONA 3BBCA 1B0VA 3D1OA 3VGVA 4IO1A 1UZHA 4K4XA 3ET6B 2RKIB 3MMCB 3WX4A 4ED2A 4Q5VA 1ZM3A 4DV1F 1NUEA 2YPZA 4NYOA 1ZPVA 3QJJA 5DDRC 3B78A 2DRAA 3NMRA 1DURA 3JS9A 2LEBA 2DCUB 1SKSA 2CG4A 1XK8A 2AGOA 1KQFB 4ETXA 2XTJP 2YNIB 5I3PA 5LJ3Y 2VFTA 3JSMB 1RACB 4J90A 2YX1A 4P74A 2H1YA 2JFDA 2PSZA 2JX2A 4OYMA 5CZXA 1RAAB 1S4EA 2GO9A 2MHNA 3IM9A 4S0MA 4ECWA 2PEHA 3RTVA 2KT3A 4ICLB 2XM3A 3WQPA 2DPJA 4LREA 4ANDA 3D1HA 3UCGA 5SZTA 2ZH3A 1JKHB 3R3TA 4NLXA 1SUQA 3F41A 2GHPA 5DDPC 1XNQF 1Q1KA 4KGXB 3W7BA 2ZH5A 2V9WA 1SH3A 1YQHA 2GX8A 4N7TA 4IRCA 1C0UB 3IRXB 4DR4F 3GFHA 4XAKA 3VAKA 3QSYB 1RK8A 1FWPA 2AYBA 5KOXA 2MSTA 1NO8A 4WCEQ 2JLEA 2KJWA 5F41A 4CIOA 1ZTTA 4C11A 4PQUB 1WEYA 3AAWB 4USJC 5A0YA 3G8QA 3KJVB 2KFZA 1HBUB 2QJ3A 1D3WA 2JWNA 3GYXB 3R5JB 1MROA 1NSQA 5CYMB 1SJRA 5GMDA 1VOMA 1HWUA 5DQGA 1NHVA 2GVZB 1M1GA 2E5GA 1TP7A 5HLFB 1XR5A 3ISZA 3NNAA 4RKUC 5C2GA 5D6GA 1T95A 4L76A 3R1HA 1NBEB 4PPZA 1NKEA 3O2IA 2R7UA 4MYUA 4O3OA 1L3VA 1N32F 5C25A 3MD1A 2IYGA 2M0GB 4MFBB 5U47A 1PAUB 1J5OA 4DR1J 2XWYA 3SMZA 1AT1B 3IMQJ 5GMKa 4C0HA 3G4SS 3BO3A 2CQ3A 4Y2IA 1R89A 2YPYA 3MEDB 1UEKA 4NRTA 4USHA 1FJEB 3WIVA 1VQMS 1C0TA 3RYLA 3RBDA 2OPQB 4RNOA 4LQ9A 1P8GA 2PC6A 3BN4A 3MAQA 4EFAC 2BQRA 3U7JA 1E6YB 2VA2A 2HHHF 1IKYA 2B51A 3FK4A 1TU0B 4P2FA 3M2UA 1TKDA 4QQBA 2ASLA 4PYDA 2F4FA 2J9DA 4O4GA 1BUXA 1RP5A 3AHPA 4E2FB 2W9BB 1VC6A 1HQUB 2FPHX 2W4DA 3KDOA 4FS1A 5AE2A 1VQ7S 2W7AA 2ALYB 1J27A 2APOA 2HWTA 2ZUAA 2ZVSA 2RQKA 2B4VA 2B9YA 3DLGA 3EICA 3W2WA 1FKPB 2V2QA 3V5RA 3NS6A 3ILIA 1QDUB 4KHPF 4PG6A 4QWAA 5HJXA 4A8KA 1NJXA 1JNRB 2QL5B 1RA7A 3CDEA 4MIAA 3VQTA 1HNZJ 2DHGA 1REVA 1S7IA 4NRUA 2N3OA 3QBCA 4B9SA 2DNOA 3HX9A 1C1BA 3U1NA 1GX5A 2PFDA 2J5AA 5MAOA 2OP5A 3SCJE 2Z56B 4B3RF 3KK2B 2VBYA 1AB8A 4DR7F 3HHLB 3AT1B 2Z57B 1N34J 1UPPA 3CW2C 2OMOA 3GJTB 1NB2A 2EK1A 2HHPA 2BACA 4G65A 2HBZB 3JTNA 4Y2KA 2W7PA 4I7FB 2IAJA 3MECA 2BJ7A 2MHEA 3KHRA 2ZOFA 1WC3A 3DOLA 1N36J 3Q8QB 2JEGA 4OHYA 4W98A 5HVHA 1WOOA 2XGQA 2HBYB 4L74A 5KT5A 3KHHA 3H5SA 2I1RA 2OD6A 2CRLA 5HMWA 3DLEA 3AD8C 3JAMU 3MM9A 2UU9J 1FKOB 3RB0A 1N6QA 1IBKF 1O0PA 1SIZA 2KM8B 3Q8VA 3GFYA 3MDFA 4RR5A 4B3OA 1VBKA 4J7CA 3OTOF 4I69A 5J2NA 2LDYA 2IJRA 3KG4A 5K9FA 1HW8A 3BSNA 2WONB 4RNHA 4CT8A 2HVIA 1SV5B 5D0GA 1S12A 2XMVA 2GHVC 2EK6A 1C4AA 1WF0A 2H3EB 3AQPA 3PTWA 4XIUA 2YY3A 2CQ4A 4LF6J 1GTEA 1DTQA 3OTBA 4KV8B 2YX4A 3LP2B 1KHVA 1FKAF 4KR0B 2I38A 4LBIA 4ECXA 5FDLB 2W01A 2YNIA 3M8YA 3NBPB 3KLHB 2ILYA 4U8YA 1R6VA 3BQ1A 4DL4A 2CQDA 1N5TA 1REVB 2GIFA 5K5MA 4WFNQ 2XLIA 2WTFA 2JSXA 5IT9U 3KTQA 2MZQA 4OHWA 2BRKA 1NSPA 2CPJA 2KL8A 2OELA 2OLWA 3R6GB 2N4DA 2V68A 4LSLB 3QIDA 4USTA 5CYMA 1CEZA 2OEJA 5B0DA 2MKKA 4UOGA 3CCSS 2ZH9A 3PV8A 3FCHA 1VQPS 1NB7A 1ZYQA 2IHR1 5KFPA 4OJHA 4ZVPB 1N56A 1RT7A 4I67A 1Y3KA 4DV7J 2BQUA 2A18A 3DOLB 4NMXA 3W5YA 2QG9B 4ED3A 2FY1A 5LSRA 1YDLA 2WVCA 1EETB 2K3KA 3GJRB 3ILOA 4O44B 2E5HA 2AJ0A 3H98A 2MQPA 2EFGA 1T9UA 4A8SA 1WJ9A 2P9CA 2NREA 5CXTA 2W4CA 5M2UA 1T94A 4JYAJ 2DNRA 2GNKA 2CNNB 3T9NA 2HURA 4G6VB 2V4RA 1SL2A 4NEYA 4N76A 3DLJA 4LT6A 1QAXA 1VRTA 4O23A 4AXJA 4ZP6A 2X1FA 2RRNA 4HHJA 2H4WB 2HQDA 4ZIWA 1IBMF 1GEHA 1RTJA 1NMEB 1SC6A 2IM3A 2PIIA 1WG4A 4WE1A 1VHFA 2NSCA 4K4TA 3W9HA 2JRSA 6FD1A 1CLFA 4DR5F 4K50A 1M1HA 4USIA 4DSIA 5HN0A 3HVAA 2O5DA 2ZJQQ 5EGYA 1ZZNA 5D8HB 4M5KA 3CO0P 3M8PB 3QRQA 4WP3A 3DYAA 4Y00A 2BJ9A 5KFIA 4ZDNA 1XQIA 1EX8A 1S1VA 4C3MA 4J9QA 1JIHA 1HARA 1MWYA 3BDEA 3TZYA 3TQEA 1LWFB 2XMMA 2VA3A 3JQJA 2VH7A 1DLOA 3V4MA 5KFJA 1ZBTA 3KDNA 1KDNA 5K8OA 2RQCA 2ZH7A 1YK9A 4QWBA 3MR3A 1KFDA 4RLEA 1RKJA 1SCJB 1KFSA 2VB6A 2RJZA 2LXFA 4OHVA 2B4UA 4PABA 1U47A 4OZLA 1YJ7A 2WOMA 1XJWB 4O3NA 4WPAA 4QIVA 3D5MA 4QR0A 1TK5A 2K2PA 2PO4A 2P9GA 2XS5A 4GKJF 3FCVA 3HHLA 5CH7B 3H40A 3I5CA 2LQ9A 3K5MA 4ED1A 2E9ZA 3KUHA 4LF2A 3FGVA 3LP0B 5ITHA 4DX8H 3H2LA 3QT8A 5KT7A 1UW9A 2QMWA 4WFZA 4FN5A 3DM2B 2ZE2B 4DPUA 2VJVA 3TAQA 1JX4A 3MOZA 3MTKA 2HIYA 3PYDA 1Q95G 3NRBA 1EKRA 3SSSA 5F8GA 3T5KA 5D77A 1N32J 2V8PA 1FFWB 4KFBA 2VICA 3O5TB 4NI2B 4X4VA 2MKCA 5KFDA 2ZDOA 1SH0A 3O3LA 3QFWA 3DXSX 3QZ8A 1KTQA 3I32A 1KONA 2RDIA 3G82B 5A8WB 1RTHB 5DG9A 1IKWB 1UTAA 4EK2A 5DETA 7FDRA 3UCUP 4NYZA 4RUCA 1KD1T 1GNKA 5T41A 4FXDA 1VQOS 5AJ3F 4USUA 5BR8F 4DWIA 2AGQA 2G4BA 3CULA 5A8RB 1R8BA 2HHHJ 3OXGA 4HLBA 1MMNA 5DQHA 2R3VA 2VG6B 4WK1A 4EWTA 4YR0A 1S5ZA 1R43A 4RU2A 2ROGA 2HS0A 3NXZA 3X3UA 1CVJA 3MMBA 5IFMA 2YNHA 1AUSL 3D67A 4RW6A 1AROP 2RRAA 3DMJA 1EQMA 2IMWP 4P73A 3ETOA 2H65B 3I9V9 4CLSA 4TU7A 1YHQS 3DLEB 5E3PA 2DGWA 5J1NA 2DJWA 2DY9A 2NYHA 3MPYA 2DHSA 5DLFA 4NLOA 4JI8F 2P6TA 3TJAA 1N5YA 1MG7A 3RU0A 3JYTA 2W9AA 1FRLA 4ITSA 1HNWF 1HNZF 3VGTA 5L1JA 4XDDA 1B7YB 2K1RA 2AD9A 5JJBA 3QGHA 2VZ9A 1X7VA 2FLOA 1N0UA 3DM2A 3C66A 5ETKA 2HBQB 3I31A 4O3PA 4CNZA 4ES3A 2XMAA 2ZJRQ 1M5PC 5DGAA 4OYZA 4RWWA 2K7KA 4ZK7M 2B0GA 3N6LA 2D3ZA 1HR0J 3KLHA 3FMBA 2WK4A 2Y0BB 5DG7A 2R7SA 4PXCA 3A8EA 4BHQA 1KN6A 1G2EA 4ZPBA 4CLUA 3J7ZT 1UMJA 1GMWA 1LFWA 4ZA1A 2XC9A 3PW2A 4JI3F 2HWHA 2VF3A 3V6KA 2IC3A 2QSWA 2WVFA 3M30A 2HWIA 2AEFA 4DR2J 4Y2AA 1PGZA 2XCPA 4F2RA 2BE2B 4PKDB 2Q66A 4USKA 1TZ0A 1RWOB 1DARA 4Y65A 1QE1A 3EVOA 2AX0A 2W8LA 1F9HA 3MM6B 4DPOA 1ZOTA 3K17A 2NXJA 1FRXA 2OFHX 3FBBA 1LWXA 3M32B 4UY8T 3I5BA 3A3NB 2XY5A 4DL3A 1RHKB 5KFKA 3TVZA 3NGSA 1FXRA 1S72S 4FS2A 4GVBB 1N5YB 1T11A 4IDKB 3PACA 1W2IA 4FPIA 4KH0B 2LCWA 4LR8A 2AIRB 4MH8A 1V3SA 3FSYA 3PW4A 1U4BA 1FVQA 1PJ6A 2EG2A 2JFKA 4R5PB 3Q23A 2LA6A 4GO5X 2YKOA 1EIYB 1S1TB 3DRPB 4QYZK 1RLCL 1R27B 2FVPA 3FEYB 4OI2A 6AT1B 1Z4UA 2AJ4A 2NPIA 1N48A 1U1PA 2D41A 4WXOA 1OSDA 3OFFA 1RBAA 5KG0A 2M52A 5ETRA 4ZJOA 4DR5J 1DJ0A 1ZM9A 1RWWB 2J9EA 5T7LA 3CC7S 2L08A 2AZ3A 1DZ5A 1FJGJ 4DR7J 1NSAA 2B5JA 1CJVA 2YBVA 2P5VA 2R8GA 3K5LA 1L5UA 3TA2A 5CCLA 1Q82T 2OIHA 2E1MC 2W4PA 2R2TA 2W1BA 2EKYA 2M88A 4IO9Q 1YI2S 4DQPA 1VYAA 5D4PA 1KNZA 1FF2A 1T9VA 1VI7A 2DGVA 2QLBB 3SIPB 2HIQA 3BQ0A 1I5OB 2G1DA 3MTJA 1BHNA 5A0YB 4KRWA 2BQ3A 5IV4A 2UUBF 2HBRB 2MLZA 4LF1A 1RAOA 3VTIA 1UVLA 4R0JA 3C6UB 3MEDA 3CCLS 2WBRA 4EO8A 2JVRA 4J37A 2CPFA 4OI0A 1U1KA 4KFBB 3QZ7A 1XTZA 1OS5A 1WELA 3GG1A 2JC0A 4UY85 4XDCA 5C25B 4URQU 3W2VA 2HFUA 4FF3A 2OTLS 3M2UB 5D0HA 1YX2A 2VFUA 3CJ5A 3ONQA 4UTGA 1ROFA 1U0SA 1EP4B 3AY0A 1UFWA 3LO3A 3SZ2A 4DF4A 5F3ZA 2E66A 3NOCA 4M95A 1URNA 2HW3A 4DR1F 2WBMA 3MUTP 2VG7A 4WBFA 1S76D 1TKTA 2Z0GA 1H7WA 1S1WA 1UCNA 2RH3A 1TL3A 3DRRB 2CPEA 3C3LA 3T1HJ 2KJVA 3D3CJ 2H54B 3ISNC 4L75A 3MPDA 5ETLA 1PBAA 2HFVA 3VQSA 2KYZA 1DHMA 5HBMB 3IGVA 2GCFA 2JLGA 2AYGA 1RT2A 2QIFA 3R1LA 1OPIA 2W2MP 1F6TA 4U7UK 1HD1A 2I5JB 5KG1A 2V4JA 5IQQA 1FFSB 2CQ1A 3BKTA 2CUYA 1JQGA 2GIQA 3N0VA 4NLPA 4PG4A 4D3HA 2MZJA 2LQBA 1TKXB 3PCOB 3ZTQA 1SC4B 4LRDA 4YMEA 2IAJB 3MECB 3O1LA 3SSQA 1D0EA 2MB0B 3OXFA 2V2KA 4ZITA 1X4GA 2PN6A 2KFYA 2PMWA 2HRTA 2COLA 4NASA 5KFVA 1UKUA 1QVFR 1YZ7A 4I2QA 3Q8RB 2DCLA 4DPTA 4EZ9A 1OSCA 1RHUB 3AODA 4WFXA 5CAAA 1VS3A 1GAOA 5HO4A 3VAMA 4AQYF 4Q0BB 3QO9A 2C2NA 4V1Ak 1SH2A 3NS7B 4DQSA 2WSFC 3J81j 1PJ7A 3PFOA 4LFBF 1HBMA 2FGOA 5IOLA 4DLGA 1WEZA 3DI6B 3CJ4A 3DRSA 4AL6A 2KT5A 1GX6A 3IC1A 1WSVA 3EGWB 2ACYA 4CLZA 3HP6A 1UJ6A 1S1WB 2P2CB 3BS9A 3J7YU 2IRUA 1JLBB 1PKUA 2VFVA 5L39A 5IM0B 2ZKTA 3LWMA 5K20B 1Y11A 2H5IB 3TWZA 3M8QB 2MZ1A 2E7XA 3M32A 3N01A 3W62A 1FDDA 1Y10A 2AV5A 4BC9A 3O6QA 1T03A 2HMIB 1C1CB 1O51A 1SXLA 2HQGA 2VDIA 4OYAA 1S0OA 4FF4A 3ENQA 2ASJA 2DITA 4RBTA 4P2XA 1DTQB 3H2UB 1WF1A 1C2PA 3BYRA 5B7WA 3G8SA 4LMZA 1XMQF 1CJTA 2E7VA 8RUCA 1H2UX 3R2CJ 2HHTA 2QL7B 2G13A 4KPCA 1DBDA 4L3KA 2GGPB 4M5HA 3RBZA 1LW0B 3KJFB 2DGXA 3R5GA 3GV5B 1D1UA 3BREA 2I2YA 3PFEA 4IOAQ 2MGZA 3ITHA 4DUZF 3NEKA 2BM0A 4PG8A 2UXDF 2V94A 4ZCKA 3OV7A 4DSLA 2F4VJ 2ZC4A 3NCRA 4CRJA 2DR8A 3SCLE 1VK3A 4TY8B 5C42B 5GVQA 1FRIA 5KG3A 3BSOA 2MKYA 2DNZA 2LXIA 2XNQA 4PXDA 5D3GB 1IBLJ 1BQXA 4B3MF 1B64A 2FGCA 1Y3JA 3V6JA 1Y9OA 2LLZA 2XYPB 3D7SB 4DU7A 4LBHA 1S0VA 2C3UA 3TA1A 1IKVB 3IAS9 2OPSA 3U1LA 3MF5A 1LFPA 3PXGa 3M6WA 5GADU 2R9LA 1UA0A 4U7UD 3HHLC 1Q8IA 3MFHA 4M5MA 4DR6F 2HFSA 4IH5A 3PW5A 1UVKA 4MK9A 2MXYA 1HBNA 1U02A 1WDTA 1HA1A 2AJFE 2MQMA 3DXBA 1D9FA 2OD4A 1K9MT 4FBTA 2PMHA 2CQ2A 3P4UB 4LSNB 2HNYA 1WC4A 2W2NP 4JI6J 3P6YC 4XO0A 2ACMA 3PEJA 4TLRA 1LK5A 1S48A 2GVDB 4NWBA 5HI7A 2BJ3A 2GJFA 3BPSP 4HDGA 4GMKA 3L7PA 4CI0B 1X9SA 4BWMA 1H6KX 4HVZA 2CJBA 5DJBA 1CS4B 2XO6A 2HPUA 1U24A 2GQQA 5DS7A 1U09A 3VVUA 5RUBA 2H9ZA 2W7OA 1BQMA 2FZCB 4DMZA 2J6UA 1G3OA 4ZPTR 2UUCF 2ZZNA 3TUPA 1FDAA 4DV1J 4TVAB 1Y0HA 4LQ3A 2ZZTA 3UDEA 3OFEA 2OHDA 2AEJA 4WFBQ 4X66F 4QR2A 1S1UB 2PD1A 3CB4A 3LF0A 3MEKA 4CO1A 4UOCA 4NLQA 3UDLA 3BJYA 5CD4A 3PX6A 3ET6A 3EZUA 4U7CA 4OIXA 4Q0BA 3CIMA 2ASYA 2YQ0A 3QT7A 3H4BA 2A3JA 5HBMA 3KLGA 2NSBA 4KT0C 2XLKA 3CJKA 3LP0A 1G7CB 1RYSA 5B0BA 2AMCB 3W60A 1Q7LB 2RU9A 3MUMP 1M5HA 4NZ6A 4WU2A 5CA5A 1F5AA 2Z58B 1UA1A 2IA6A 2EC0A 3DI6A 1SVDA 3DLKB 3DOMB 5F8NA 1KP6A 2LQJA 1TKXA 4RJVA 2OEMA 3JQKA 3SEOA 3US5A 1B7FA 3CCWA 3J81U 1YJ9S 4BWJA 3W9JA 4IKAA 2XS7A 1DLOB 3QIPA 1WI6A 2GVZA 4MIBA 4QPXA 3B6BA 3M9MB 4DV6F 1RTZA 2HNYB 1VQNS 3ENVA 4RW4B 3SV4A 1V5VA 1SUQB 4X64F 3LGNA 1NK4A 1I94J 2E1CA 3UWTA 1KLMA 3A12A 4YDDB 3W9IA 4NZ7A 4ATNA 1HI8A 4URSA 1VBYA 4KGKA 2XHWA 2ZOMA 3VF0B 5HQ8A 3SDEA 1RZMA 3CPWR 4ER8A 2DEJA 3NGUA 4DFJA 1DAXA 1U2CA 4OZ5A 3G6YA 1NK9A 5E2QA 1VQ8S 2UZAA 2ADCA 2E5LF 3Q86A 2B8QA 1HLWA 3D0GE 1CJTB 3BYPA 1MMDA 1WC0A 2WB4A 3FCWA 4Q2MA 4TYAA 5E7OB 2HHXA 4NA3A 2AEMA 4B08A 1R31A 1UETA 4I2PA 2E5IA 5A76A 4ZLNA 3OHAA 2C3YA 3GPAA 1U2FA 2F63A 4FKYA 2YWFA 2W25A 5KFCA 3G96A 2BDPA 3J7AN 4KJIA 3TANA 2BABA 3T9ZA 3LANA 1Q53A 4BC7A 3JYTB 2DKOB 4QW8A 1N33F 2RUGA 2CWKA 1MNEA 2YKQA 9RUBA 3H2VE 1Q0NA 3H20A 3VAHA 4ELTA 1TK0A 2Y9HA 4RBUA 1RISA 5ETSA 3TUZC 2DEIA 6FDRA 3HFZB 5AXMA 4ZP8A 3JB9k 3R27A 2EFPA 4URGA 1LW2A 4QWCA 3PR4A 4YB6A 3FVYA 2IBKA 2VPZB 2HRYA 1YRXA 4CZCA 3G71S 1M5KC 3DRXA 1MN7A 1R0BG 5L1LA 4GC6A 2EFVA 2E9RX 3PHTA 1JXLA 1Y00A 4W4MA 1HBUA 3KJQB 5M2RA 3L3CA 4CH1A 2J7WA 4DV4F 4ZMMA 1XNRF 4RW7B 3SQGB 2GJIA 2IC3B 2RSQA 3M30B 1S6OA 3MCMA 1K1SA 5B09A 2FLNA 5L9XA 1OWXA 3G9CA 3AH6A 4CDIA 3MM5B 1BE4A 1HD0A 1OQ3A 5D78A 1EARA 4X4OA 2XG8A 3VVTA 1XMOF 1JMTA 4DX7A 4F0HA 2GC8A 4C8ZA 3NCPA 2FHOB 1OIAA 2IVFB 4B02A 4DX6A 2ATLA 1U8WA 4IRDA 3CD7A 4F3QA 1MWZA 1CBKA 4A47A 4WFYA 4A48A 4RX6A 2BX6A 1J5EF 4LFAF 5GAHI 1DTTA 4WU3A 2KI2A 1VRUA 3KK3A 4HDHA 4JV5J 5FJ4A 5HL7Q 1FXDA 1RYRA 3ZNUA 5JMNA 1VK8A 4KGVB 2ZHOA 2YWKA 3M4XA 2B9WA 4H54A 1E6VA 1JLCA 5LMNF 4P7TA 1H74A 1TL1A 4CLFA 3K58A 4Q2LA 3C6TB 3M9OB 1NK8A 3I0RB 3CJSA 4RO0A 3Q0AA 1T05B 3L7UA 4B3TF 3TVYA 4X65F 1RTDA 4ECZA 1IKWA 3K59A 3GLJA 4PG5A 3V6DB 4WTOB 5KFHA 4DPWA 1NK6A 3CD0A 1TFWA 1I1GA 2CJAA 2R42A 1KLNA 1K44A 1FRHA 5KFEA 2YWHA 3HHEA 3M1VB 1RAFB 3MAAA 4K5SA 4CM0A 4DSKA 3D0HE 2O67A 4KO0A 1HKAA 5F8JA 1XWLA 1KBRA 2KG0A 2UXBJ 4FXWA 1NZAA 3ZNJ1 1YVFA 5T14A 2MQNA 1CPZA 5FLXU 1XERA 5LL6d 2QLXA 3RJMB 3HZGA 2ZD1B 4KIAA 2KFNA 4A8XA 2DGTA 2IJFA 2M9KA 5LMUJ 2Z2YB 3UR0A 2GIRA 3WC0A 1LNQA 3TUIC 4CP5A 3RW6A 3GONA 1KLMB 4MJKA 3HVRA 1NJYA 3IO1A 3PVXA 1IVZA 2BJ1A 4UOFA 3MCSA 4K2XA 4QPTA 1N36F 1QTNB 2GMLA 2X3GA 3FRZA 3F56A 4MYTA 4QJVA 1S10A 4L3NA 1G6BA 1U6FA 4ZOSA 4QU6A 1QM9A 2HZAA 4JI5J 4UQGA 2IVMA 4H4OA 4B3SF 2DT9A 3HHKA 3D68A 4O3SA 5EX0A 1UPMB 4L72B 4K4SA 1NEEA 2ATCB 2YKPA 1FRMA 1S9FA 2LVWA 3QATA 4ED6A 1TL1B 3HLUA 2B7CB 4CO2A 1PILA 2YH1A 4OZ2A 2EXUA 4O3RA 3D4JA 1KQSR 1A0OB 1SC1B 3DGVA 4I0WA 3R7SB 4QWEA 1RAIB 2CAJA 2C2DA 2GJ2A 3NNCA 1NHKL 3T1YJ 2EG1A 1JLFA 1DY3A 1ZPWX 4ZVFA 2CQHA 1O6XA 1YLXA 1QTMA 2J6TA 4WK3A 1FTCA 3GU0A 4WP9A 2F8EX 1RU1A 3EZOA 3HT3A 1Y7PA 2JDJA 2U2FA 4DR3J 4JI1J 4X2BA 3OT9A 3KKFA 3SV3A 3SYZA 3KJNB 2NUUG 3DLHA 2HK3A 2RHSB 4DV3F 2DR6A 1U48A 3VAGA 2B6AB 3R9LA 1RA6A 2XZWA 2M5YA 2YQ1A 1LK7A 1RWKB 2GZOA 4DN0A 2HQCA 4L73A 4AD6A 1F60B 2WOMB 2DNMA 4HH1A 3TOQA 4B3RJ 4WE1B 4KE5A 4UUWA 1VISA 3VWSA 4AL5A 4ED5A 2V4JB 4MK8A 4F4YA 4EZ6A 2E5JA 3R7NB 4B3OB 1WKKA 4NPOA 4IG0B 2FJXA 2RQMA 1ZM2A 1F0XA 5CYQA 1PYOB 3KUEA 4B9VA 4H4OB 5J2PA 3FFIA 4ZKAA 1YJRA 2BEFA 2M7SA 1DQ8A 3I4PA 3KYLA 4V19X 4M5JA 2BKNA 1TL3B 3IWXA 4DZ6A 1RADB 1CC8A 1R3NA 4F0KA 5D0EA 4W90B 1AW0A 5FDLA 1OQ6A 4ID8A 2AWZA 2XULA 3QWUA 4WJBA 4CLTA 2N82B 4WZMA 1TVRB 2CNLB 1WKLA 5HMZA 3OR1A 3OL8A 3BZQA 4EEYA 1TUGB 1U6ZA 2DY1A 3L4BC 3EGZA 2CQPA 1T7PA 2PDAA 1X0FA 4GKKF 5KFSA 5LSOA 1EAYC 4NEZA 1MSWD 2DO0A 3H5XA 3LALA 2HHWA 4PWDA 3U1MA 3NAHA 2XO7A 2EI5A 1FEEA 1KEKA 4DSEA 2UU9F 2MKIA 5GAEI 2UVWA 1KVJA 4UT4A 2V67A 3FDSA 4IH7A 5DLGA 4N56A 2YQ3A 2MLYA 4RW9B 3HXMA 3KLIB 3GFXA 2UXCF 2L9WA 2MKHA 3I5AA 3BEGB 3QMQA 3FQKA 4JV5F 3EX7B 2BW7A 5LSLA 4QOTA 2XLJA 3OL7A 1R0AA 1WHWA 4LRCA 4F4ZA 4ZLJA 1QUVA 4LR7A 2BV3A 3CXCR 1VQ5S 2UUWA 3FFIB 2C28A 4CLYA 3BDPA 4NXNJ 1G4CA 5J1PA 1ITPA 5KFGA 4DV0J 4P75A 3B82A 4Q7AA 2HSEB 2QE5A 4WP8A 1K73T 2OPSB 2ZWOA 5KFBA 1U49A 1VFJA 3MOJB 3G87A 1TAQA 2W9CB 4JI0J 1RBOB 4QZVB 2VBXA 1KS2A 2L48A 3Q2TC 2ZH4A 2G0IA 2VKRA 4YFUA 4ZVQB 1VR6A 2R2SA 1N33J 1IWAA 1NNDA 3UN5A 1WHVA 2BANA 1L3TA 2QMXA 2J8AA 1OPZA 2UUTA 3NCQA 4N8NA 4NA1A 3OSNA 4B9LA 2HFNA 3A8KA 1YSJA 2UVUA 1HW9A 3S8SA 2K1RB 1JWWA 3HF5A 4ZPVR 4HI2A 1B0TA 1IN0A 2R7QA 1JLFB 5A8RA 5HANA 3GIMA 4JI4F 4PXEA 4P72A 2P8IA 2Z30B 1APSA 1TMMA 2FJAB 2V69A 8ATCB 1P6TA 4Y2CA 5F9NA 4C9DA 2KHDA 4L6V3 3WBZA 1K47A 2QLWA 3PIOQ 1RABB 3UVJB 3NLCA 2RRBA 1IBKJ 3BH6B 1WDDA 2VFSA 4Y0FA 1ZETA 3SQOP 3CJ3A 4X64J 1M5VC 2GAGC 3IBWA 4LFBJ 5HMYA 2HLUA 3QGPA 1XR7A 3K8VA 2NPFA 3TA0A 1U1OA 2O01C 4JI6F 4FYVB 4FYYB 2J6SA 4IG0A 4I56A 2H5JB 5KFTA 4P9SA 3DLBA 4PQUA 3N6NA 1RHJB 5J2MB 3V81B 3TNVA 1QVGR 1S6QB 3ZTOA 1N34F 1B4SA 3RBXA 1FJCA 3ICLA 1RCOB 2ALZA 2OKQA 4FP9A 1HNIB 3R5DA 2IRXA 3M8SA 1RAEB 2L41A 2CVEA 2YNHB 4MKVA 3H5YA 4LF9J 3PJWA 3MAHA 3T5LA 1AZSA 3F44A 1KWMA 3KLFA 1IWGA 3GWCA 1BWEA 3H7HB 1C1BB 3Q8SB 2RHQB 5IT9Y 2C2OB 2F9JA 2K3IA 2N3LA 4HT5A 3T6JA 2L3MA 4LRBA 1TL4A 3AOAA 5DO2A 2R8IA 1MLAA 4DV7F 1K1QA 2F4VF 3W1YC 4B9TA 2CDQA 2DGSA 4OJGA 4ZN1A 3GZ7A 4NLDA 3IG1B 3UDVA 1S99A 2AP6A 3SI8A 4PG7A 1RT1B 1F5BA 4PWDB 2RAQA 1FX4A 1QD1A 1S1UA 3V2UC 2XB2D 3MPWA 1PYSB 3W64A 4LIWA 2DGOA 2LYVA 4ZS6A 5F0UA 3D28A 2DRBA 1FKOA 2DIVA 1F1BB 1GMUA 1VLOA 1L3SA 3M2RB 4P7VA 1WEXA 3FSXA 5KT6A 1HMVB 1N0VC 1TVRA 7AT1B 2DVIA 4OL8A 4C8MA 2KXNB 2V2ZA 5HK4A 4DJBA 4QYZJ 2G0JA 1BY9A 4ZVTB 5IWAJ 3B54A 1IXKA 5ETVA 3GILA 3CNQP 1HWLA 4I68A 3MMAA 2DD8S 1OMSA 1A7GE 1XMBA 3PM9A 1R6YA 4DR6J 2B7BB 2YNFB 1TK8A 4QU7A 1N8RT 1B0PA 1WG5A 5IQ6A 2PFFB 4K5RA 5CABA 3K8WA 2BJDA 2VJUA 2BM1A 3DHXA 4M8LA 2LDIA 3Q2SC 3MM6A 4DPXA 3MUVP 3I82A 4M5GA 2Q6CA 2HFOA 2LKZA 3TVKA 2C2ZB 2ABYA 1WG1A 1S6PA 4B3MJ 3KK2A 2M4MA 1DQAA 2WW8A 4ELUA 1YZ6A 3MGJA 2HYIB 4JI7J 5HLFA 3O8WA 2RU3A 3NWGA 3BO4A 4IH6A 3N6MA 5H9EJ 3RB3A 2NZ4A 2X51A 2UV8G 3P49B 2WB1D 3I87A 5B0AA 1OY9A 1RWPB 5IC4B 1I51B 2GO8A 5AXKA 2D3O1 2B43A 2WW4A 4MFBA 3E2EA 1W25A 2NXCA 4P10A 3AOBA 4AYBD 3NKYA 2VG7B 3MPUB 3VR1A 1Y5LB 1TELA 4F50A 2QLJB 2B56A 4NLSA 1YJUA 1Q86T 4CQ1A 3Q24A 4TQRA 1RXOB 2JJ4D 4OZ1A 2VUGA 1S9EB 3EVMA 4E8UA 3Q8PB 3KK3B 5EDWA 1SL0A 2EFOA 3BGUA 1HPZA 3WIUA 1WUUA 1WC6A 4OX9J 3OD2A 5EWFA 4OYOA 3ETMA 3ILJA 3C15A 1NZ8A 3FJ2A 4K8RA 3MMAB 1IUJA 2FJEB 2XMKA 1XMQJ 1I94F 4ZVSB 1UL3A 2D1CA 2VOPA 2A2DA 2V8DA 2MY7A 2DTJA 1TMJA 3JTOA 4USMA 5E3RA 1EHWA 9ATCB 4J9SA 3KMQA 2XZDB 2D9OA 3CMES 2Z2LA 4P2MA 4OQJA 5DZ6A 1AYEA 1ZAWA 2J8SA 4KKOB 1U8SA 3J80U 2KH9A 3J81Y 4LJMA 3BSCA 2VQEF 2CZVC 1N6QB 1QSSA 4A8FA 1O8BA 3R5AA 1BC6A 4IRKA 3CTRA 2ZH1A 3PRVA 1TTHB 2ZJPQ 5HMXA 4A8MP 4AQYJ 1NDPA 4A4JA 2A6OA 2F65A 3CCTA 4B9UA 1A9NB 2XWXA 1FK9B 1FA0A 1T9TA 2W24A 2CQ0A 3HSJA 4OI4A 5B0CA 2QC3A 4JI3J 3CEDA 2ZH8A 1RHQB 1ZH5A 3C16B 4TXSA 1EP4A 3PDNA 2OSRA 5KT3A 1BXNA 1LWCA 1JLAB 3P96A 2C3PA 4I6WA 4ZJQA 2UUBJ 1XEZA 2HNDA 2KT2A 4OX9F 2POKA 4NXMF 3DDIA 2F3JA 3OJUA 2ZM6F 2CPDA 2DNKA 2HMIA 2ZNZA 2K7JA 3ZTPA 3OTEA 4Y6IA 2O3DA 2J76E 3DU6A 1CC7A 5BJRA 4DV2J 2Z4PA 2HS4A 1RT5B 2GMJA 2KDOA 5CCMA 3OW2R 1Y5IB 4N77A 4ZHRB 4Q43A 1NKCA 4ZP7A 2XS2A 2J9DE 2LU1A 3D0IE 1UZDA 4CTAB 4N8OA 5ADZA 1JLEB 1D9AA 2JEJA 1IKXB 2VV5A 4OZNA 3WC2A 3HSZA 3D9BA 4DQIA 5KFMA 3BO2A 2XMJA 3BSAA 2XMTA 1X4EA 2QA2A 3CJRA 2W2OP 4JBCA 4KKOA 1GXLA 3N28A 2B4OA 1CULA 2YX7A 4R8UA 2MZTA 1SBRA 2CPHA 2OUGA 2Z2ZA 4LSNA 1RHRB 4ECTA 1JKHA 3A13A 3SCKE 1FCAA 1REGX 4C0OC 2XSJA 2C2EA 1N5VA 3GIJA 5AJ3J 2RT3A 5EX3A 2FLLA 4IR1A 4KH1B 1JLQB 3EPGA 1TV6B 3DC2A 4Q44A 1IBLF 5F8LA 3MM5A 4RU9A 1S9GA 4RWXA 3RAMA 2QSFA 3FBEA 3LH2S 3JSBA 3CCJS 3UD3P 5E3QA 4Y28C 4DUZJ 1D09B 3N9UC 1M90T 3BM7A 3AA9A 3MR7A 4AFFA 3HKWA 1H2VZ 3M6VA 3P45B 1X5TA 1DFDA 2RDDA 3GJSB 3TJ8A 5KT2A 2OO4A 3CMQA 1LWEB 3K7RA 3W61A 2W2PP 3CCMS 2AJ2A 2HEKA 1X8DA 1RT5A 2L9NA 4QIFA 4A8OA 5JVHQ 3KOAA 2XY6A 2H51B 1FHTA 5KFWA 3HHNB 1U25A 2IM0A 1V3RA 3CJKB 2W9BA 1KQKA 3OLAA 3C6TA 5KG6A 5AXNA 1JJ2R 4JI7F 2HHVA 2HGNA 5J2PB 4HTJA 1EKSA 4HT7A 4F4XA 4FYWB 4OYPA 1WHXA 4DG1A 4OV6A 3EE3A 2H4YB 3DHWC 3A8JA 3LTOA 4PEOA 2HGLA 4RW6B 5ETQA 3T41A 3TARA 3DOKA 4DV0F 4B9MA 3M1VA 3MAAB 1BLUA 1MMLA 3FQLA 1F2GA 1SB6A 2VQFJ 2LFVA 2ZOGA 4DV5F 2KVQE 1WC1A 2CZ9A 3KJVA 2DISA 3GV7B 4HR2A 4O0IA 3UPFA 1HWIA 1WC5A 1QAYA 3CVKA 4FZVA 1JJ4A 4FKXA 2VFRA 3KLIA 1CSJA 4ZPAA 5A6WA 4C8NA 1PYTA 3DGPB 3R6LB 3ZZTA 3KLGB 3T1HF 3D6MB 2OH2A 4NLVA 2C22A 2GVDA 4N47A 4QCLA 4GVLA 3R5BA 2G0CA 1PCAA 5A6PA 4X4RA 3FZBA 3P3DA 2IMOA 4QR1A 5L1KA 4HL9A 1CQNA 1WOSA 2CQCA 4HACB 2MJUA 4J91A 3QIPB 4I6AA 3MM8B 4EO6A 1Q7YT 2RB7A 4LFAJ 2OPPA 2D69A 1JXEA 1V5IB 2BOAA 4IQMA 3C46A 2JOQA 3W5ZA 1HHSA 2F8MA 3BBBA 1ZS6A 3LAMA 1T3OA 2Z2MA 1UAWA 3DRYA 3S6EA 3H4DA 3NGTA 5B0GA 2YXLA 4F3OA 1XC9A 2UVRA 3D1QA 1DRZA 2BVZA 1FTRA 2V34A 3E01B 3QLHB 1P1LA 3QYYA 3G6ES 4O4GB 1FNOA 1X4DA 1WD6A 2QN6B 3M05A 4KC5A 2V8GA 4OFZA 4P52A 4DZDA 1QE1B 4CWBA 2RNEA 3NBPA 2NXEA 2G1HA 2YH0A 3M2VA 3HJFA 2CJYB 3FBFA 1VRQC 3DLKA 4I2PB 3TP2A 1GMWD 1R8PA 3GR0A 3ZC4A 2RE1A 2LEAA 2ZDPA 4U96A 2R4FA 1U1QA 1R8HA 3PY8A 1C0TB 2A6MA 2CPXA 3DGPA 1FE4A 2PA8D 3GTYX 4NLWA 4UW2A 4O0NA 1URRA 2J0XA 2MDAA 3LP1B 5GAHU 4LFCJ 1KHWA 5LMNJ 2WAQD 5JUMA 2E1RA 3DDNA 2KG1A 1WNEA 5DGBA 1Q5VA 1RKIA 1RT4A 3NGRA 4YQWA 3GG0A 1RT3A 2AYMA 2EVZA 3IR5B 4NLUA 3T19A 4HHHA 1B99A 1F3VA 1WF2A 2Y1RI 4I1TA 5F0WA 4DR3F 1X4BA 2VIHA 1LV5A 2RVJA 4DLEA 3W3SA 5C24B 4C3LA 1HQEA 3EJMA 1YJTA 3QAEA 1U0HB 3CJTA 3K2YA 5G0RB 5BR8J 4OYIA 2BE7D 5DQIA 2J0QD 4RNFA 1BGXT 2BRLA 4RW7A 2QMUB 1KR4A 1F3FA 3V4IB 1T05A 4KGMA 3AA8A 1FI4A 1A6LA 2YKMA 1RI7A 3H59A 2C1EB 1Q8KA 1Q8LA 4WIQA 2LEPA 1XNRJ 1TL7B 3MMJA 4MKAA 5J2NB 2IJNA 4YB7A 2RDJA 5A8KA 3GJQB 3POTA 1HNXJ 1LOUA 3FKBA 3HFVA 3VAIA 3M2VB 1X0PA 3UCZP 4DCJB 2Y1IA 3IWNC 4A8QA 3X1LB 2MEWA 4MAKA 2BYCA 4XTTA 4H4KC 3MM7B 2M70A 1RTIB 3J7Z5 3KFWX 2KZZA 1BWVA 4CNYA 1SJ1A 3EDQB 1N88A 2QEXS 1VBZA 3MWBA 1KVKA 4PZVA 2X1AA 1BD6A 1XBWA 2YTCA 4RL1A 4NXNF 1RHMB 1JJHA 1W7WA 2VBZA 4YUDA 2GQ2A 2YWWA 2V2VA 5KFZA 2FB0A 4FDFA 3EGNA 5J1EB 4J9LA 4ZVRB 2DRDA 5EN1A 1MU2A 1UEVA 4NOHA 4Y2MA 1HR0F 1JB0C 3LPYA 1X4FA 4LRFA 3CCQS 4LF7J 2CPYA 4IG3B 4ZN3A 4ECYA 5BXIA 2K8GA 5CD4H 3FEZA 3QNWB 3OHBA 4C4WA 2ZE2A 4ED7A 1P9QC 3CJ0A 5F8HA 1CG2A 2QFIA 4H4MB 3IRWP 1D8YA 2G2YA 3C19A 5AXLA 1TQLA 1H73A 1S1XB 2DGUA 2IIHA 2UXCJ 8AT1B 3FSIA 4PRFA 1HQ2A 4YB5A 2JZ5A 2WVBA 3KK1B 2N4CA 4R25A 2QZ8A 1RQ0A 5LJ5Y 3PZPA 1N4LA 1TUWA 5DDQC 2ZVIA 3TZXA 1U1NA 2AJ1A 4X4TA 5DM7Q 4X4NA 4OV1A 1U1LA 4B9NA 3M7VA 1Q5YA 3S01A 4DN9A 1GTHA 2I9SA 1Q81T 4M94A 1FESA 3DKDA 4BDPA 5KG7A 3CUNA 3SSRA 4GKKJ 2NS1B 2XEXA 2J9CA 2WCXA 1GK8A 3QJLA 3BR9A 3I96A 3SFGA 4J9NA 3NMAA 1AXQA 4FNIA 1EETA 3JSYA 2LMIA 1LXNA 1FWKA 1LW0A 2CWXA 3ELHA 4RPFA 4CLLA 5IT4A 4X4PA 1UFLA 3TQ1A 1HIYA 3M2RA 4NE9C 2FY8A 3QO9B 4GRSA 5AE3A 4P71A 1NDLA 2LQ5A 3NP5A 1BQNB 4ECRA 3D2WA 1NRKA 1WTFA 3AD7C 1IR0A 1HBMB 4ZPCA 4AT1B 3M8RA 1HHTP 4IG3A 1TUVA 2MLXA 5CYQB 3BBFA 5KFXA 4WFAQ 2YNGA 3AJ1A 3THTA 3KNGA 4B3SJ 5D15A 2QA4G 4CLKA 2XYHB 2DH7A 3W2WB 5L38A 5KG2A 4X4SA 3K5NA 2HAFA 4PWUA 1S1XA 1NH8A 3M6UA 4Y34A 5GAGI 1HQEB 2B6AA 4JI1F 3VAFA 2DXDA 4TLQA 2HFZA 2HNZB 4PYAA 4DL2A 3RAQA 4WYWA 5G0RA 4YY3F 2GAHC 2XNRA 1KOOA 3LGMA 4ANCA 4DV3J 1C1CA 3Q8UA 4NL5A 4O4RA 4CCHA 3ZZPA 3TEGA 2HG4A 4F8RA 4ZVHA 1AZSB 2OEKA 3D6FB 1FDBA 1XMOJ 1FWLA 4WIIA 3ZTRA 2AYEA 2DHAA 3RGIA 2BE2A 2Y1JA 4JV2A 1TL7A 2Q1LA 3ZFVA 1S59A 1RT4B 2NYIA 3LOUA 5L8RC 4FXVA 4QIWD 4Q45A 4TU9A 3EGVA 1HYSA 3PEHA 1H72C 1U45A 1JLGA 3C14A 1TAUA 3IG1A 1LEOA 1R7IA 4KY3A 4DDFA 5LOQA 1RAHB 3HSDA 2CDRB 1YRUA 1Y4ZB 1O5JA 3MMBB 4Z7CA 5L1IA 3FRYA 4A46A 2RS8A 2AKWB 4TY8A 5C42A 7FD1A 4DPYA 3GYNA 4ED8A 3TAMA 4PR6A 2D7SA 1FT8A 2VC1A 1FERA 4NI2A 5K14B 4ENOA 4F7VA 3KLVA 4EYHB 2AGPA 4F2SA 2CIMA 1H7XA 4R5PA 1GQEA 2FC9A 4KTQA 3EMTA 3HM9A 1VQKS 1PC4A 4DV6J 3L7OA 3CIZA 2HZVA 2AHOB 3M8WA 3QRPA 5H9FK 3EYZA 1U7LA 2PA3A 2G2OA 2FZGB 4OZ3A 4FVMA 2R7TA 1HQUA 4X4UA 1KC8T 2XMWA 4F4WA 2V8HA 2DHXA 2UXBF 1YRTA 4P6QA 5LT5A 3I0SA 5FIIA 2ZZMA 1TKZB 3EWGA 3EPIA 4F67A 2KN4A 4OYBA 3ZZOA 4N5SA 2YWEA 4YR2A 1KSPA 2FUG9 5K8PA 3CE8A 1F9FA 2I0XA 2IDEA 3O44A 4DV4J 4DR4J 3TZWA 1CJUB 3PO5A 3EXCX 3KK1A 3KMSA 1U2RA 4N41A 3H90A 2XCAA 2A0FB 4DL7A 1UJ4A 1CS4A 4F26A 1JLQA 1SQEA 3C16A 2DR5A 4EGLA 3HPOA 2LQ8A 4KB7A 2RS2A 2HHUA 1VQLS 1UWAA 1IJEB 2B9EA 4X65J 1HNVA 1NLKL 3U02A 4U6PA 3PR5B 4CM2A 1VQ9S 4ILLA 5D0RA 2VHGA 1ICEB 5KAKA 2FJBB 3CSKA 2VPXB 5CZVA 5IC6B 2KYXA 4FF2A 4NMLA 2NZCA 2EEYA 2E1PA 3FMWA 3TAMB 2F7VA 4PPDA 3QRRA 3D3BJ 2W8KA 5K8MA 3MD3A 2HQIA 3TEHB 3W2VB 2ZH6A 4ECSA 2JNJA 1WORA 3B8HA 4IDKA 4EMDA 2WSCC 3HI9A 1YBUA 5BYQA 1UVMA 3PKMA 1Q8BA 3HHLD 3DLGB 3IR7B 4ILRA 1EB0A 2FYXA 2LP4A 4AXIA 3R5CA 4X4QA 4ECUA 4FNHA 2CJ9A 2CZ4A 3LUYA 3N5BA 4GO7X 4OJ3A 1MW7A 1D8ZA 1WACA 2GW8A 4DCPB 2Q6BA 2D3UA 1M5OC 4OX7A 2QYGA 4XK8C 4OI1A 4ES1A 1LWFA 2ZHBA 1Q16B 4ZPWR 4AL7A 4J9PA 1Q78A 3AXKA 2HNZA 3TI0A 3PO4A 1FX2A 4ZCIA 1FE0A 1NPKA 4ETZA 5K8NA 4I7FA 1KRPA 4JV0A 3PJ9A 2I8EA 3LGHA 4LF9F 3IAM9 5KG4A 4ZCMA 2UVVA 3PYEA 5DZ7A 1OYDA 1V3ZA 4J9KA 1RT7B 3V81A 4ILMA 3AFGA 2QFJA 2YKAA 2YKNB 1X9WA 1ZZFA 3BPDA 1RJJA 5D4LA 2C2KB 2FHKA 3MCNA 1VQSA 4UUXA 5KFQA 2DK2A 3PNIA 1JLAA 4OLPA 5I3UB 1LXJA 1YBAA 2D9PA 1TR0A 2EPIA 4QIEA 3CDBA 2V8VA 2YVSA 1Z2LA 1QLNA 2CFXA 3OR2A 4E98A 4C7QA 1SC3B 3BV8A 1KVIA 2CKWA 1RT2B 3OL6A 1YWXA 2Q79A 2B5JB 4JOUA 4XPCA 4X66J 1SV5A 2OJ3A 4UZCA 1IQTA 3W65A 3KG0A 4Z2XA 2ZC3A 2C3OA 2KXHA 3MR6A 4EI2A 1SJQA 1IBCB 3D6HB 4K7QA 1X31C 1FRJA 2FJDB 4NYPA 2IY5B 3DMJB 1S0MA 2P6SA 1FVSA 2GA7A 3NG8A 2AQ4A 1NJZA 4P2SA 2XQCA 4IOBA 1F2HA 2A10A 3D54A 5CHCB 2FVQA 3NAIA 1UJ5A 2QLFB 1FD8A 2AX1A 4LFCF 1S57A 3GE9A 3N79A 3OUYA 4Z7YA 2HLTA 2DO4A 4ZVOB 4YB1P 2FJVA 1FJ7A 3TJ9A 5HROA 4C2MA 4RUAA 1YTYA 1YIJS 1NJIT 2M8DB 4KQZA 3D66A 3DU5A 2R7RA 2IM2A 2KRBA 3QWPA 2R7WA 4LRAA 4JI0F 2BZ2A 3P5BP 1GMVA 3WDOA 2HVEA 2ZH2A 2J7KA 4BS2A 1RWMB 4K4UA 3AJ2A 2ZUGA 2J0WA 3GYGA 2P9EA 3MM8A 4M5DA 3UNYA 3EUNA 2IA0A 2CJXB 3A3PB 3ITHB 5KFFA 2F1FA 2ZHAA 3PW0A 1NK7A 3OBIA 1TKZA 4C8LA 2CNOB 5KFUA 5THWA 1T02A 4KGZB 3UI3A 3AD9C 3BGRA 1NJWA 3HVWA 3OTCA 1QUPA 3I0RA 2ZBPA 3B4DA 2HQFA 3L9ZA 5IWAF 1RTDB 3ISND 4OI3A 3C15B 1J2VA 2VC0A 2GMHA 2DNNA 1WOPA 4X84A 3G8TA 3GQCA 3IRXA 1NHUA 3GSIA 1VJWA 2QYCA 4NZ0A 3TR5A 1IKVA 4CLWA 4ZPDA 5A8WA 2JHEA 5BYSA 2ADBA 2CJKA 2VKZG 2G2ZA 3JTPA 4OX6A 5KFNA 1NKBA 2GS8A 5IXUA 4I6YA 4F02A 3POTB 2ERRA 3PRBA 2BMBA 1N54B 3DRSB 4DFMA 4WKYA 1Z2ZA 1X5OA 4DBQA 4DG1B 4W92B 4IFYA 4DUTA 2Y3YA 5JXSA 3IN5A 2BR0A 3CWJA 2IBOA 3RRKA 1MROB 5KT4A 3J7A1 1KOHA 3DOKB 3RRHA 4IUFA 1VC0A 5J2QB 2XBPA 1AUDA 1F5CA 4DL5A 4JB8B 1CQMA 4FVCA 3MEGA 4I4BA 5HROB 4WF9Q 1QJHA 4DV2F 4B3TJ 2AU0A 3VGSA 3QGGA 5F9LA 2UUAJ 1FNMA 2IFXA 3OSPA 3SCIE 4RNNA 2HS3A 4CYUA 1FFGB 4Q8EA 3PG9A 4J9UE 5KFRA 3KUGA 1WWHA 4ALZA 1SQFA 4AE5A 5KFAA 5CQGA 3OVAA 3MR5A 1HBOA 1RUSA 1SIWB 3QFHA 2LXUA 1RTIA 4RW8A 3KLEB 2UUCJ 5LXRA 1YG0A 4DSFA 2A2CA 3PJXA 2MQOA 2KKHA 4CT9A 3PIPQ 1VQ4S 1WKJA 4FPRA 2MYFA 4QWDA 1FNXH 4OYWA 1VJQA 2FIUA 3W5XA 1M0SA 4PUOA 4KYZA 2HVZA 2PI4A 2DB1A 2I6WA 2ROPA 3MR2A 5IM0A 2YKMB 1GH8A 3IM8A 4ICLA 1H0HB 2PMZD 1RWUA 1KKHA 3HHDA 2E1AA 4NCAA 3TYTA 1V6HA 1NK0A 2VQEJ 4EYIB 4FF1A 3RB4A 4FBUA 2WVDA 2HHSA 1J5OB 3JAMY 4YS2A 3K89A 3CF5Q 4LUBA 3ZO7A 5B0FA 4HH0A 2DNQA 4CLPA 4I64A 5ETOA 2RIJA 3GIRA 2CNKB 2MMYA 3OFHA 3H25A 1BQMB 4J9MA 1Y5NB 4UOHA 4ZLPA 2OGUA 2D74B 1RDRA 3PRDA 5F3TA 4K0KF 3SFUA 3SXLA 1NAQA 3OXLA 4DS4A 2ZBIA 1X60A 4IQXA 4J5OA 2HAIA 4TY9A 4LF5F 3CCUS 1T8EA 3I56S 3MEGB 2KU7A 4DSJA 2XSJB 1SQGA 4F25A 2VQFF 3ENWA 3M6XA 4RW9A 1VCTA 3QPIA 3UDCA 1NH7A 1YBTA 2FHMA 2NQPA 3ZZYA 2ZKUA 3FEXB 1I3OB 2FHJD 1LQ9A 1YGYA 1PG5B 2HKEA 2XI3A 4TU8A 1K0VA 2VG5A 1X5PA 2HZCA 2R7OA 1FO1A 1T9YA 5KFYA 4GC7A 2ZITA 1IKXA 3BR8A 4TQSA 3RRGA 1PBUA 4CO5A 1UVJA 2XMUA 1H2TZ 4WKRA 1NSKL 1HWJA 2JEFA 2IVYA 1K0TA 4M5LA 2EBEA 3QJPA 5E3AA 4RNMA 5KFOA 1NK5A 2R2UA 5FLXY 1F9EB 1LWCB 1NPPA 3Q8YA 1GXUA 3T3FA 2W9CA 2R2RA 5T7LB 4NCBA 4D3GA 2JC1A 1IJFB 2Y8YA 4DHVA 3HO1A 2C2RA 2KTQA 4LVOP 1R0CB 3BKFA 3IS9A 4ID5A 1ZTWA 3OUYB 3OVBA 3OVSA 4X62F 2HK2A 1ZA2B 2EFNA 1VLYA 1MN9A 4J9VA 2CXEA 2FZKB 3AQOA 2MZRA 3U27A 5A8KB 4C8OA 2AJQA 1PSDA 1EZZB 1N52B 4IFVB 4CH7A 1VQYA 1RWXB 1UEUA 4CO3A 5IZHA 3HKZD 2KM8C 1UFKA 3PYFA 1VMBA 3A3OB 4HHUA 5CYJA 1YITS 4DQQA 4XPEA 1SKWA 4YOEA 2MQLA 2C3MA 3ZZ0A 1T0TV 3LW5C 4LF4F 3GMGA 4OMFG 2VDHA 4TKTA 2XGPA 4QW9A 4EUVA 2Z8QA 1JJCB 3HFKA 3LAKA 1RE1B 2WSEC 3HVTA 3HT0A 4OZ0A 4RW4A 4AUKA 4DL6A 3RBEA 3OL9A 5A2QU 1IKYB 4F36A 1WTBA 5K14A 1CJKB 3WZ0A 2QX0A 2VG5B 3PYGA 3VZHA 1MU2B 1VIOA 4DL0C 5DDOC 4MMOA 1ELOA 2BXJA 3RUBL 2FJWA 4IR9A 3ILLA 3OTOJ 3W8GA 4RUHA 3G2XA 1S9GB 4J9OA 3CC4S 1JLGB 1HBOB 4RW8B 4DEZA 2J0SD 1U1MA 4YHHF 1JLEA 4NLRA 3TUJC 4C6AA 2HQ3A 3OLBA 3GB0A 1OY8A 4PWWA 1K8AT 2V6AA 1RU2A 2V4QA 3T1YF 3GIKA 1H3DA 1VRTB 5ETNA 1X5SA 2BJEA 4NXMJ 3MZIA 4LSLA 5D4OA 3SQGA 4PUOB 1CULB 4USVA 2V9KA 3I9ZA 4ZVUB 4C0BA 4OYXA 4RZRA 4NLTA 1HNWJ 2VODA 4JI4J 1UWBB 2MSSA 4DXLA 3E51A 1XN9A 4PAAA 3T5JA 1V9OA 3H8YA 2C2MB 2XI2A 5C7PA 2ZBRA 2VOOA 2EBGA 4CYUB 4HTIA 4KBIA 3M8PA 1SJFA 3KG1A 1HI0P 1FJGF 3G6VA 4IYQA 3AB2B 5E3CA 1NDCA 2DGQA 1IR2A 3IBCB 3PX0A 3EZ5A 2ILZA 3DDKA 2AT1B 1HNVB 2EC2A 2MZSA 3THPA 4KHPJ 2OPPB 2CG8A 3BN7A 3HSGA 3GFZA 5M2PA 2ROEA 3W66A 5I42B 2ZD1A 3NGKA 5BYRA 3UR3C 1H38A 2R7VA 2QV6A 1E6VB 1JLCB 3D6TB 2N7YA 3NGDA 5D3GA 3T5HA 4F4KA 1LWEA 2MQ8A 2DNLA 3TAPA 1R8AA 3NWRA 5H9EK 1ACMB 1SJ4P 2OMLA 3QLHA 4JV1A 2NUHA 1NPRA 2FQQB 1S77D 2VD3A 2WRMA 3LWLA 5ETPA 2MTLA 3I4HX 4PCQA 1Q4RA 3VGUA 4TNOA 4YDXA 4YY3J 2ASDA 4WWSA 4OHZA 1W26A 1GT8A 3CT9A 1U0HA 4ZVGA 4KV8A 1B70B 4HYKA 2Q43A 3TX8A 2B3TB 4KSEB 2BW2A 4HACA 2E9TA 1DTTB 2H48B 4YN3B 5IV3A 4ECQA 2HHQA 3KHLA 1CJUA 2XY7A 3QSIA 3G6XA 2FHJA 2BKPA 1NM2A 1XIQA 2I5JA 3NY0A 2MKJA 2F8HA 2VL1A 1JK9B 1N5SA 2O1PA 5DRKA 4JYAF 1RB0A 2DHHA 2A1BA 3PX4A 2OI2A 4OX8A 5E33A 3MXHP 3E01A 4ED4A 4LVNP 5HP1B 4LF8J 1PAEX 4F0MA 2R8HA 3T6BA 3KWMA 1RT1A 3VHQA 2OSQA 3BKUA 5AE1A 3UNGC 2HRUA 1HYSB 3AOCA 2GGPA 2KO1A 3IFEA 1UP1A 1S1VB 2BUNA 4NX9A 3H42A 5GMEA 3SBMA 4MK7A 1S9EA 1HMVA 2VBWA 3I6PA 3IP0A 2BA9A 3OTDA 2F9DA 2BE9B 3P8BB 4CH0S 2NXUA 3ENAA 4M5IA 4OHXA 2N7CA 2G9OA 4EBCA 1X9MA 3R7BB 2VPYB 2FVSA 4C8KA 4PQAA 1CJKA 4FYXB 2OAUA 3JQMA 1IM6A 4ES2A 3IR6B 5IT0A 3AB4B 2YNFA 4H4MA 3LA0A 1L3KA 2V0NA 1JLBA 2L9DA 4JI5F 3ZTSA 4LF6F 3GSDA 5I4MA 3JSMA 2EKNA 5C24A 3S7RA 3I55S 4GKJJ 3IGNA 3OR2B 2IRYA 3GR1A 3V6DA 3VAJA 1S6PB 3GIIA 1RT6A 3EXYA 1X4CA 3J7YI 1RWNB 1QSYA 4LR9A 4DI6A 3ZZZA 1P9YA 3HMJG 3CCZA 3K5PA 3UN2A 3KLFB 4ZCLA 3T1AA 1U6BA 3JSRA 2XSFA 2OFGX 3LPEA 2RF2B 3CC2S 4EBEA 3RW7A 4MKYA 1SJ3P 3MHYA 3NNHA 2OPRA 3BF4A 3ZZRA 3DNCA 1VHIA 1ZAVA 1UVIA 4OJ1A 3VZIA 1LKZA 4ELVA 4USWA 2KRRA 4HKQA 1R8CA 1S6UA 5HSPA 2RD5C 2PT0A 2WHOA 2MQQA 4DFKA 4A8YA 4M5DB 3TZZA 4NLYA 2HGMA 1IBMJ 2AZ1A 1SKUB 5AT1B 1BQNA 2HNDB 5GAEU 2R8KA 1HNXF 3FZ2A 3H5UA 3PHEA 1E6YA 3BQ2A 1N5QA 4ZJLA 1RWVB 1S1TA 3DRPA 1WHYA 2JEIA 3V6HA 3G82A 5I3QA 4LBPA 1UW4A 1NDKA 2ZNYA 3MCOA 4LF8F 5J2QA 3NS5A 2KZMA 3LP2A 3RAXA 1OO0B 1HHQA 1QY7A 1ZM4A 2YWGA 4KAIA 3VV2B 4C11B 5HQLA 4IOCQ 2DH9A 1J5EJ 3CGIA 2RQ4A 4RUBA 2FVRA 1YKWA 4MTPA 4F04B 1FRKA 2EW9A 2F40A 3W63A 4LF5J 3MM7A 5I42A 3TO8A 3UD5A 4U8VA 4ANEA 4PXBA 2LECA 3UW1A 2R7XA 4NCGA 3WX8A 2X7IA 3R97A 1FK9A 5J1EA 2B8PA 3M9NB 3F73A 3OR1B 2OPRB 2XHCA 3JXOA 5F8MA 1P27B 1X4HA 2ZBCA 3QT6A 3Q22A 1YJNS 3CD5A 1L3UA 1FXLA 2R8JA 4OZJA 4G1IA 3Q89A 2KVIA 5HP1A 4DU8A 1S79A 1SI9A 2BBEA 2Y1LB 3A8IA 5MLCV 2CYYA 1QAIA 3CJ8A 3GCXP 5KG5A 3PKYA 4LIRA 2B4PA 2ZEJA 3RB6A 2GHWA 4BBYA 1EJ7L 5I3UA 3NL0A 1DQ9A 4BLGA 2IPOB 3DLLQ 2BANB 3N4WA 3A1YG 3OQ2A 5LMUF 3BGLA 4V19J 4GVBA 5B0EA 4ZHRA 1I6JA 3QGIA 2DR9A 2GFFA 3VALA 1RAGB 1VDHA 1Z1ZA 2F5GA 2VU5A 3E3XA 4CTAA 5HQMA 3CCVS 4JP8A 4ZP9A 5H9FJ 3MPVA 4EU0A 2RILA 5GADI 2WZ1A 2YNGB 1D9DA 1S6QA 2JVOA 2NLWA 1RSCA 4UF4A 1NXIA 2U1AA 4KO0B 4RBVA 3HCXA 1VC5A 4F4AA 1LW2B 2DXFA 4R8UB 1WSRA 3BH7B 5HAOA 4A8WA 3HD1A 2DR7A 2E44A 1P1TA 2CA9A 2E7WA 2IM1A 3RG6A 4JI8J 3MM9B 3F0NA 5C5JA 1RT6B 4DFPA 1IR1A 1GXTA 1TV6A 1ULRA 4WXWA 3SDEB 5KTQA 3GV8B 1VBXA 3TX0A 3ULHA 1AFIA 1MWQA 3L09A 1JNZB 4DOZA 1JXVA 3N5FA 2FDNA 4R0EA 4UQTA 4ZLLA 4FYDA 5KOWA 3DCAA 5J2MA 2DNHA 2MJNA 3G86A 1H98A 3HDSA 4Y3CA 5A2QY 1QSLA 3RR7A 4DV5J 1S0NA 3MEEB 4E0DA 2KHCA 5ETTA 2W2QP 5C2CA 5DM6Q 3J80Y 2JL9A 4Z37A 2IDLA 3KHGA 1G1XA 2M2BA 3ZXWA 1S4FA 3CMAS 2XZTB 4K4ZA 3CCRS 4G1QB 3K57A 2B9XA 3E8OA 5JVGQ 1PIEA 2Y0SD 3IBFB 1RTHA 1S97A 3L95X 2QA1A 3MI7X 3ZZUA 2PI5A 1CJVB 1T9XA 1RCXB 3K0JA 2E29A 4CO4A 3UQSA 5E5NA 2BJ8A 2RF2A 3NOGA 4JI2F 4DUYF 2FC8A 5L9NA 1IM4A 1GFWB 4QBUA 1RLDA 4C3KA 4DS5A 4LF7F 2WVEA 1UVNA 3HD2A 2FTRA 1S49A 2BKOA 4H4KA 4BCAA 5GAGU 5EWEA 2ZBQA 4UZBA 2UP1A 4O44A 3UE2A 4DQRA 2QGFB 4IFYB 3I0SB 1B3TA 5SUHA 4EBDA 3C8YA 3DYAB 4F3MA 2M8HA 3C14B 4K4VA 1T03B 3THVA 3DRRA 2JH3A 3C6UA 2UXDJ 3IS9B 4ID5B 5E0OA 3UD4P 4NLGA 2HVDA 2ZFHA 3R8YA 4K4WA 4B17A 2NR0A 3EM1A 4J9RA 2CQIA 2JLFA 4K2JA 5HJYA 4DF8A 1EQ0A 1W2BR 1FD2A 4NCGB 2DYAA 2CPIA 2DBBA 2X3DA 3WHIA 1M1KT 2KXFA 2DIUA 2CADA 4LSZB 4K0KJ 1YJWS 2QA4S 2X1GA 2PEBA 3QT5A 2NCKL 1PO6A 1RT3B 5HVFA 3MEEA 3KLEA 3HULA 4TN2A 1VRUB 3KXDA 2MGZB 1XR6A 1FEHA 1HFEL 1T9WA 3FBCA 5F8IA 3M8QA 2H5EA 4C98A 1KQGB 2O66A 3CDAA 3HVTB 5ETMA 1XNQJ 2CQGA 2OTJS 1QAJA 3FC9A 1PJ5A 3CO9A 1RTJB 2EWHA 5LM7E 3Q83A 3K5OA 2MY8A 3BGOP 2CPZA 1NU4A 3BB5A 4WYLA 4JUZA 4U67Q 4YP3A 2QTWA 4WTYA 2D3OR 3KNAA 2V50A 2BOPA 5HVGA 2PE8A 4WZQA 4HI1A 1UWBA 5H1SV 4IFVA 2FD2A 2MKSA 1HWKA 3HZEA 2ZM6J 3UFCX
chains in the Genus database with same CATH topology
3R6GB 4DCJB 3GJSB 2QLFB 1SC4B 4ZVOB 1F9EB 3RJMB 2Y0BB 3EDQB 4ZVPB 1RWPB 5IC4B 1I51B 2H51B 2XYGB 3R5JB 1RHMB 3GJRB 1RHUB 2QLJB 4ZVQB 1QTNB 4ZVRB 1RWMB 2H4YB 3NS7B 2CJXB 1RWOB 2CNNB 3QNWB 1RWXB 2CNOB 3R7BB 1PAUB 2H4WB 1NMEB 1RHKB 2P2CB 3R6LB 4ZVSB 3D6MB 1SC1B 1RE1B 3R7SB 5K20B 2H5IB 1ICEB 2XZDB 5IC6B 1RWNB 2XZTB 3KJNB 2DKOB 4JB8B 2H5JB 1RWWB 3IBFB 1RHJB 2QL7B 1RWKB 3P45B 3KJFB 1RHQB 1QDUB 4DCPB 3R7NB 2QL5B 4ZVUB 1GFWB 1PYOB 4DCOB 3EDRB 2C2MB 2C2OB 2CJYB 3SIPB 2QLBB 3KJQB 2XYPB 1RWVB 2QL9B 3GJTB 2XYHB 2HBRB 2C2ZB 2HBZB 3IBCB 2HBYB 1BMQB 2CNLB 4LSZB 2C2KB 3D6FB 3P4UB 2CNKB 2FQQB 1SC3B 1RHRB 2H65B 4ZVTB 2H54B 1IBCB 2CDRB 2H48B 3D6HB 2C1EB 1I3OB 2Y1LB 2HBQB 3GJQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6G B;  4DCJ B;  3GJS B;  2QLF B;  1SC4 B;  4ZVO B;  1F9E B;  3RJM B;  2Y0B B;  3EDQ B;  4ZVP B;  1RWP B;  5IC4 B;  1I51 B;  2H51 B;  2XYG B;  3R5J B;  1RHM B;  3GJR B;  1RHU B;  2QLJ B;  4ZVQ B;  1QTN B;  4ZVR B;  1RWM B;  2H4Y B;  3NS7 B;  2CJX B;  1RWO B;  2CNN B;  3QNW B;  1RWX B;  2CNO B;  3R7B B;  1PAU B;  2H4W B;  1NME B;  1RHK B;  2P2C B;  3R6L B;  4ZVS B;  3D6M B;  1SC1 B;  1RE1 B;  3R7S B;  5K20 B;  2H5I B;  1ICE B;  2XZD B;  5IC6 B;  1RWN B;  2XZT B;  3KJN B;  2DKO B;  4JB8 B;  2H5J B;  1RWW B;  3IBF B;  1RHJ B;  2QL7 B;  1RWK B;  3P45 B;  3KJF B;  1RHQ B;  1QDU B;  4DCP B;  3R7N B;  2QL5 B;  4ZVU B;  1GFW B;  1PYO B;  4DCO B;  3EDR B;  2C2M B;  2C2O B;  2CJY B;  3SIP B;  2QLB B;  3KJQ B;  2XYP B;  1RWV B;  2QL9 B;  3GJT B;  2XYH B;  2HBR B;  2C2Z B;  2HBZ B;  3IBC B;  2HBY B;  1BMQ B;  2CNL B;  4LSZ B;  2C2K B;  3D6F B;  3P4U B;  2CNK B;  2FQQ B;  1SC3 B;  1RHR B;  2H65 B;  4ZVT B;  2H54 B;  1IBC B;  2CDR B;  2H48 B;  3D6H B;  2C1E B;  1I3O B;  2Y1L B;  2HBQ B;  3GJQ B; 
#chains in the Genus database with same CATH topology
 5DG8 A;  3P5T L;  3QQC D;  4QIG A;  3W8P A;  3B4M A;  2VG6 A;  3HJV A;  2CQB A;  2DH8 A;  3IXQ A;  3MUR P;  5G4D A;  4YHH J;  1RGV A;  2SXL A;  4DR2 F;  4I2Q B;  3MFI A;  1HI1 A;  3DFE A;  3LP1 A;  4M1K A;  2UUA F;  2DNP A;  3CD6 S;  3R2D J;  2DNY A;  2XYG B;  4OLO A;  3RR8 A;  4ZVE A;  4G3I A;  1T3N A;  3CJQ A;  4YR3 A;  2MPU A;  1SKR A;  1C0U A;  2J7U A;  4HEA 9;  4ED0 A;  2KB2 A;  5HAT A;  3TW0 A;  1IQZ A;  4K4Y A;  2NXN A;  2LU2 A;  3VCD A;  2C42 A;  3DN9 A;  4U9R A;  2FLP A;  1HBN B;  1U26 A;  2LA4 A;  1ZAX A;  2X1B A;  3V4I A;  1OY6 A;  3UO0 A;  3CDW A;  1RAJ A;  4YEA A;  4ZIV A;  3GP9 A;  1OJ4 A;  5B08 A;  2Q3P A;  1KTV A;  4QYR A;  3LQV A;  2EFQ A;  1SL1 A;  4DX5 A;  1WI8 A;  2AF6 A;  1FDN A;  2QRR A;  2UV8 A;  3M8Z A;  4M5N A;  4X62 J;  2VON A;  2CVI A;  1M5S A;  3RZA A;  2RKI A;  3ADA C;  2DXE A;  3MMC A;  4KHR A;  5KFL A;  3UN3 A;  2Y8W A;  4U95 A;  2RUS A;  2IYI A;  1NCL A;  1RBL A;  1VIX A;  4OI6 A;  4ECV A;  1YJV A;  1AFJ A;  3CDU A;  2E5L J;  3PW7 A;  3C2P A;  4G1P A;  5IS2 A;  4TYB A;  2YKN A;  1OYE A;  2OPQ A;  3IA0 A;  4MT1 A;  1TL5 A;  3UVJ A;  3EVW A;  4LF4 J;  3GCW P;  1HL6 A;  2ZWP A;  4C48 A;  3OPK A;  2V5H G;  1TFY A;  4KHM A;  1PC5 A;  4K59 A;  4M63 A;  1SPB P;  1U1R A;  2QO3 A;  5EWG A;  1X4A A;  4G1Q A;  2RML A;  3FUY A;  2GV1 A;  3S1T A;  2V63 A;  4KPY A;  1HPZ B;  5LXY A;  2DNG A;  2GQC A;  1AA1 B;  1R0A B;  2FVC A;  5EHH A;  3FNN A;  3AXM A;  3AJD A;  3TRG A;  4C97 A;  4DCO B;  3EDR B;  2CJQ A;  4NA2 A;  3DOM A;  3OJS A;  4ERD A;  1VGY A;  5FD1 A;  1FKP A;  4CO0 A;  2VAS A;  5EUH A;  2QL9 B;  1C4C A;  2QT7 A;  5D4N A;  4DUY J;  1TKT B;  2DPI A;  1HNI A;  2AW0 A;  4JI2 J;  3CJ2 A;  1VQ6 S;  4Q8F A;  2VPW B;  4MKB A;  4C8Y A;  2M3D A;  3BGF A;  3QAU A;  4O3Q A;  1ZA1 B;  3HK2 A;  3OFG A;  5L46 A;  1BMQ B;  3CCE S;  1Q79 A;  1S7H A;  2K06 A;  3A4T A;  3H0P A;  2HVH A;  4MIW A;  3BGR B;  5E41 A;  3IWL A;  2PGC A;  2WON A;  3BBC A;  1B0V A;  3D1O A;  3VGV A;  4IO1 A;  1UZH A;  4K4X A;  3ET6 B;  2RKI B;  3MMC B;  3WX4 A;  4ED2 A;  4Q5V A;  1ZM3 A;  4DV1 F;  1NUE A;  2YPZ A;  4NYO A;  1ZPV A;  3QJJ A;  5DDR C;  3B78 A;  2DRA A;  3NMR A;  1DUR A;  3JS9 A;  2LEB A;  2DCU B;  1SKS A;  2CG4 A;  1XK8 A;  2AGO A;  1KQF B;  4ETX A;  2XTJ P;  2YNI B;  5I3P A;  5LJ3 Y;  2VFT A;  3JSM B;  1RAC B;  4J90 A;  2YX1 A;  4P74 A;  2H1Y A;  2JFD A;  2PSZ A;  2JX2 A;  4OYM A;  5CZX A;  1RAA B;  1S4E A;  2GO9 A;  2MHN A;  3IM9 A;  4S0M A;  4ECW A;  2PEH A;  3RTV A;  2KT3 A;  4ICL B;  2XM3 A;  3WQP A;  2DPJ A;  4LRE A;  4AND A;  3D1H A;  3UCG A;  5SZT A;  2ZH3 A;  1JKH B;  3R3T A;  4NLX A;  1SUQ A;  3F41 A;  2GHP A;  5DDP C;  1XNQ F;  1Q1K A;  4KGX B;  3W7B A;  2ZH5 A;  2V9W A;  1SH3 A;  1YQH A;  2GX8 A;  4N7T A;  4IRC A;  1C0U B;  3IRX B;  4DR4 F;  3GFH A;  4XAK A;  3VAK A;  3QSY B;  1RK8 A;  1FWP A;  2AYB A;  5KOX A;  2MST A;  1NO8 A;  4WCE Q;  2JLE A;  2KJW A;  5F41 A;  4CIO A;  1ZTT A;  4C11 A;  4PQU B;  1WEY A;  3AAW B;  4USJ C;  5A0Y A;  3G8Q A;  3KJV B;  2KFZ A;  1HBU B;  2QJ3 A;  1D3W A;  2JWN A;  3GYX B;  3R5J B;  1MRO A;  1NSQ A;  5CYM B;  1SJR A;  5GMD A;  1VOM A;  1HWU A;  5DQG A;  1NHV A;  2GVZ B;  1M1G A;  2E5G A;  1TP7 A;  5HLF B;  1XR5 A;  3ISZ A;  3NNA A;  4RKU C;  5C2G A;  5D6G A;  1T95 A;  4L76 A;  3R1H A;  1NBE B;  4PPZ A;  1NKE A;  3O2I A;  2R7U A;  4MYU A;  4O3O A;  1L3V A;  1N32 F;  5C25 A;  3MD1 A;  2IYG A;  2M0G B;  4MFB B;  5U47 A;  1PAU B;  1J5O A;  4DR1 J;  2XWY A;  3SMZ A;  1AT1 B;  3IMQ J;  5GMK a;  4C0H A;  3G4S S;  3BO3 A;  2CQ3 A;  4Y2I A;  1R89 A;  2YPY A;  3MED B;  1UEK A;  4NRT A;  4USH A;  1FJE B;  3WIV A;  1VQM S;  1C0T A;  3RYL A;  3RBD A;  2OPQ B;  4RNO A;  4LQ9 A;  1P8G A;  2PC6 A;  3BN4 A;  3MAQ A;  4EFA C;  2BQR A;  3U7J A;  1E6Y B;  2VA2 A;  2HHH F;  1IKY A;  2B51 A;  3FK4 A;  1TU0 B;  4P2F A;  3M2U A;  1TKD A;  4QQB A;  2ASL A;  4PYD A;  2F4F A;  2J9D A;  4O4G A;  1BUX A;  1RP5 A;  3AHP A;  4E2F B;  2W9B B;  1VC6 A;  1HQU B;  2FPH X;  2W4D A;  3KDO A;  4FS1 A;  5AE2 A;  1VQ7 S;  2W7A A;  2ALY B;  1J27 A;  2APO A;  2HWT A;  2ZUA A;  2ZVS A;  2RQK A;  2B4V A;  2B9Y A;  3DLG A;  3EIC A;  3W2W A;  1FKP B;  2V2Q A;  3V5R A;  3NS6 A;  3ILI A;  1QDU B;  4KHP F;  4PG6 A;  4QWA A;  5HJX A;  4A8K A;  1NJX A;  1JNR B;  2QL5 B;  1RA7 A;  3CDE A;  4MIA A;  3VQT A;  1HNZ J;  2DHG A;  1REV A;  1S7I A;  4NRU A;  2N3O A;  3QBC A;  4B9S A;  2DNO A;  3HX9 A;  1C1B A;  3U1N A;  1GX5 A;  2PFD A;  2J5A A;  5MAO A;  2OP5 A;  3SCJ E;  2Z56 B;  4B3R F;  3KK2 B;  2VBY A;  1AB8 A;  4DR7 F;  3HHL B;  3AT1 B;  2Z57 B;  1N34 J;  1UPP A;  3CW2 C;  2OMO A;  3GJT B;  1NB2 A;  2EK1 A;  2HHP A;  2BAC A;  4G65 A;  2HBZ B;  3JTN A;  4Y2K A;  2W7P A;  4I7F B;  2IAJ A;  3MEC A;  2BJ7 A;  2MHE A;  3KHR A;  2ZOF A;  1WC3 A;  3DOL A;  1N36 J;  3Q8Q B;  2JEG A;  4OHY A;  4W98 A;  5HVH A;  1WOO A;  2XGQ A;  2HBY B;  4L74 A;  5KT5 A;  3KHH A;  3H5S A;  2I1R A;  2OD6 A;  2CRL A;  5HMW A;  3DLE A;  3AD8 C;  3JAM U;  3MM9 A;  2UU9 J;  1FKO B;  3RB0 A;  1N6Q A;  1IBK F;  1O0P A;  1SIZ A;  2KM8 B;  3Q8V A;  3GFY A;  3MDF A;  4RR5 A;  4B3O A;  1VBK A;  4J7C A;  3OTO F;  4I69 A;  5J2N A;  2LDY A;  2IJR A;  3KG4 A;  5K9F A;  1HW8 A;  3BSN A;  2WON B;  4RNH A;  4CT8 A;  2HVI A;  1SV5 B;  5D0G A;  1S12 A;  2XMV A;  2GHV C;  2EK6 A;  1C4A A;  1WF0 A;  2H3E B;  3AQP A;  3PTW A;  4XIU A;  2YY3 A;  2CQ4 A;  4LF6 J;  1GTE A;  1DTQ A;  3OTB A;  4KV8 B;  2YX4 A;  3LP2 B;  1KHV A;  1FKA F;  4KR0 B;  2I38 A;  4LBI A;  4ECX A;  5FDL B;  2W01 A;  2YNI A;  3M8Y A;  3NBP B;  3KLH B;  2ILY A;  4U8Y A;  1R6V A;  3BQ1 A;  4DL4 A;  2CQD A;  1N5T A;  1REV B;  2GIF A;  5K5M A;  4WFN Q;  2XLI A;  2WTF A;  2JSX A;  5IT9 U;  3KTQ A;  2MZQ A;  4OHW A;  2BRK A;  1NSP A;  2CPJ A;  2KL8 A;  2OEL A;  2OLW A;  3R6G B;  2N4D A;  2V68 A;  4LSL B;  3QID A;  4UST A;  5CYM A;  1CEZ A;  2OEJ A;  5B0D A;  2MKK A;  4UOG A;  3CCS S;  2ZH9 A;  3PV8 A;  3FCH A;  1VQP S;  1NB7 A;  1ZYQ A;  2IHR 1;  5KFP A;  4OJH A;  4ZVP B;  1N56 A;  1RT7 A;  4I67 A;  1Y3K A;  4DV7 J;  2BQU A;  2A18 A;  3DOL B;  4NMX A;  3W5Y A;  2QG9 B;  4ED3 A;  2FY1 A;  5LSR A;  1YDL A;  2WVC A;  1EET B;  2K3K A;  3GJR B;  3ILO A;  4O44 B;  2E5H A;  2AJ0 A;  3H98 A;  2MQP A;  2EFG A;  1T9U A;  4A8S A;  1WJ9 A;  2P9C A;  2NRE A;  5CXT A;  2W4C A;  5M2U A;  1T94 A;  4JYA J;  2DNR A;  2GNK A;  2CNN B;  3T9N A;  2HUR A;  4G6V B;  2V4R A;  1SL2 A;  4NEY A;  4N76 A;  3DLJ A;  4LT6 A;  1QAX A;  1VRT A;  4O23 A;  4AXJ A;  4ZP6 A;  2X1F A;  2RRN A;  4HHJ A;  2H4W B;  2HQD A;  4ZIW A;  1IBM F;  1GEH A;  1RTJ A;  1NME B;  1SC6 A;  2IM3 A;  2PII A;  1WG4 A;  4WE1 A;  1VHF A;  2NSC A;  4K4T A;  3W9H A;  2JRS A;  6FD1 A;  1CLF A;  4DR5 F;  4K50 A;  1M1H A;  4USI A;  4DSI A;  5HN0 A;  3HVA A;  2O5D A;  2ZJQ Q;  5EGY A;  1ZZN A;  5D8H B;  4M5K A;  3CO0 P;  3M8P B;  3QRQ A;  4WP3 A;  3DYA A;  4Y00 A;  2BJ9 A;  5KFI A;  4ZDN A;  1XQI A;  1EX8 A;  1S1V A;  4C3M A;  4J9Q A;  1JIH A;  1HAR A;  1MWY A;  3BDE A;  3TZY A;  3TQE A;  1LWF B;  2XMM A;  2VA3 A;  3JQJ A;  2VH7 A;  1DLO A;  3V4M A;  5KFJ A;  1ZBT A;  3KDN A;  1KDN A;  5K8O A;  2RQC A;  2ZH7 A;  1YK9 A;  4QWB A;  3MR3 A;  1KFD A;  4RLE A;  1RKJ A;  1SCJ B;  1KFS A;  2VB6 A;  2RJZ A;  2LXF A;  4OHV A;  2B4U A;  4PAB A;  1U47 A;  4OZL A;  1YJ7 A;  2WOM A;  1XJW B;  4O3N A;  4WPA A;  4QIV A;  3D5M A;  4QR0 A;  1TK5 A;  2K2P A;  2PO4 A;  2P9G A;  2XS5 A;  4GKJ F;  3FCV A;  3HHL A;  5CH7 B;  3H40 A;  3I5C A;  2LQ9 A;  3K5M A;  4ED1 A;  2E9Z A;  3KUH A;  4LF2 A;  3FGV A;  3LP0 B;  5ITH A;  4DX8 H;  3H2L A;  3QT8 A;  5KT7 A;  1UW9 A;  2QMW A;  4WFZ A;  4FN5 A;  3DM2 B;  2ZE2 B;  4DPU A;  2VJV A;  3TAQ A;  1JX4 A;  3MOZ A;  3MTK A;  2HIY A;  3PYD A;  1Q95 G;  3NRB A;  1EKR A;  3SSS A;  5F8G A;  3T5K A;  5D77 A;  1N32 J;  2V8P A;  1FFW B;  4KFB A;  2VIC A;  3O5T B;  4NI2 B;  4X4V A;  2MKC A;  5KFD A;  2ZDO A;  1SH0 A;  3O3L A;  3QFW A;  3DXS X;  3QZ8 A;  1KTQ A;  3I32 A;  1KON A;  2RDI A;  3G82 B;  5A8W B;  1RTH B;  5DG9 A;  1IKW B;  1UTA A;  4EK2 A;  5DET A;  7FDR A;  3UCU P;  4NYZ A;  4RUC A;  1KD1 T;  1GNK A;  5T41 A;  4FXD A;  1VQO S;  5AJ3 F;  4USU A;  5BR8 F;  4DWI A;  2AGQ A;  2G4B A;  3CUL A;  5A8R B;  1R8B A;  2HHH J;  3OXG A;  4HLB A;  1MMN A;  5DQH A;  2R3V A;  2VG6 B;  4WK1 A;  4EWT A;  4YR0 A;  1S5Z A;  1R43 A;  4RU2 A;  2ROG A;  2HS0 A;  3NXZ A;  3X3U A;  1CVJ A;  3MMB A;  5IFM A;  2YNH A;  1AUS L;  3D67 A;  4RW6 A;  1ARO P;  2RRA A;  3DMJ A;  1EQM A;  2IMW P;  4P73 A;  3ETO A;  2H65 B;  3I9V 9;  4CLS A;  4TU7 A;  1YHQ S;  3DLE B;  5E3P A;  2DGW A;  5J1N A;  2DJW A;  2DY9 A;  2NYH A;  3MPY A;  2DHS A;  5DLF A;  4NLO A;  4JI8 F;  2P6T A;  3TJA A;  1N5Y A;  1MG7 A;  3RU0 A;  3JYT A;  2W9A A;  1FRL A;  4ITS A;  1HNW F;  1HNZ F;  3VGT A;  5L1J A;  4XDD A;  1B7Y B;  2K1R A;  2AD9 A;  5JJB A;  3QGH A;  2VZ9 A;  1X7V A;  2FLO A;  1N0U A;  3DM2 A;  3C66 A;  5ETK A;  2HBQ B;  3I31 A;  4O3P A;  4CNZ A;  4ES3 A;  2XMA A;  2ZJR Q;  1M5P C;  5DGA A;  4OYZ A;  4RWW A;  2K7K A;  4ZK7 M;  2B0G A;  3N6L A;  2D3Z A;  1HR0 J;  3KLH A;  3FMB A;  2WK4 A;  2Y0B B;  5DG7 A;  2R7S A;  4PXC A;  3A8E A;  4BHQ A;  1KN6 A;  1G2E A;  4ZPB A;  4CLU A;  3J7Z T;  1UMJ A;  1GMW A;  1LFW A;  4ZA1 A;  2XC9 A;  3PW2 A;  4JI3 F;  2HWH A;  2VF3 A;  3V6K A;  2IC3 A;  2QSW A;  2WVF A;  3M30 A;  2HWI A;  2AEF A;  4DR2 J;  4Y2A A;  1PGZ A;  2XCP A;  4F2R A;  2BE2 B;  4PKD B;  2Q66 A;  4USK A;  1TZ0 A;  1RWO B;  1DAR A;  4Y65 A;  1QE1 A;  3EVO A;  2AX0 A;  2W8L A;  1F9H A;  3MM6 B;  4DPO A;  1ZOT A;  3K17 A;  2NXJ A;  1FRX A;  2OFH X;  3FBB A;  1LWX A;  3M32 B;  4UY8 T;  3I5B A;  3A3N B;  2XY5 A;  4DL3 A;  1RHK B;  5KFK A;  3TVZ A;  3NGS A;  1FXR A;  1S72 S;  4FS2 A;  4GVB B;  1N5Y B;  1T11 A;  4IDK B;  3PAC A;  1W2I A;  4FPI A;  4KH0 B;  2LCW A;  4LR8 A;  2AIR B;  4MH8 A;  1V3S A;  3FSY A;  3PW4 A;  1U4B A;  1FVQ A;  1PJ6 A;  2EG2 A;  2JFK A;  4R5P B;  3Q23 A;  2LA6 A;  4GO5 X;  2YKO A;  1EIY B;  1S1T B;  3DRP B;  4QYZ K;  1RLC L;  1R27 B;  2FVP A;  3FEY B;  4OI2 A;  6AT1 B;  1Z4U A;  2AJ4 A;  2NPI A;  1N48 A;  1U1P A;  2D41 A;  4WXO A;  1OSD A;  3OFF A;  1RBA A;  5KG0 A;  2M52 A;  5ETR A;  4ZJO A;  4DR5 J;  1DJ0 A;  1ZM9 A;  1RWW B;  2J9E A;  5T7L A;  3CC7 S;  2L08 A;  2AZ3 A;  1DZ5 A;  1FJG J;  4DR7 J;  1NSA A;  2B5J A;  1CJV A;  2YBV A;  2P5V A;  2R8G A;  3K5L A;  1L5U A;  3TA2 A;  5CCL A;  1Q82 T;  2OIH A;  2E1M C;  2W4P A;  2R2T A;  2W1B A;  2EKY A;  2M88 A;  4IO9 Q;  1YI2 S;  4DQP A;  1VYA A;  5D4P A;  1KNZ A;  1FF2 A;  1T9V A;  1VI7 A;  2DGV A;  2QLB B;  3SIP B;  2HIQ A;  3BQ0 A;  1I5O B;  2G1D A;  3MTJ A;  1BHN A;  5A0Y B;  4KRW A;  2BQ3 A;  5IV4 A;  2UUB F;  2HBR B;  2MLZ A;  4LF1 A;  1RAO A;  3VTI A;  1UVL A;  4R0J A;  3C6U B;  3MED A;  3CCL S;  2WBR A;  4EO8 A;  2JVR A;  4J37 A;  2CPF A;  4OI0 A;  1U1K A;  4KFB B;  3QZ7 A;  1XTZ A;  1OS5 A;  1WEL A;  3GG1 A;  2JC0 A;  4UY8 5;  4XDC A;  5C25 B;  4URQ U;  3W2V A;  2HFU A;  4FF3 A;  2OTL S;  3M2U B;  5D0H A;  1YX2 A;  2VFU A;  3CJ5 A;  3ONQ A;  4UTG A;  1ROF A;  1U0S A;  1EP4 B;  3AY0 A;  1UFW A;  3LO3 A;  3SZ2 A;  4DF4 A;  5F3Z A;  2E66 A;  3NOC A;  4M95 A;  1URN A;  2HW3 A;  4DR1 F;  2WBM A;  3MUT P;  2VG7 A;  4WBF A;  1S76 D;  1TKT A;  2Z0G A;  1H7W A;  1S1W A;  1UCN A;  2RH3 A;  1TL3 A;  3DRR B;  2CPE A;  3C3L A;  3T1H J;  2KJV A;  3D3C J;  2H54 B;  3ISN C;  4L75 A;  3MPD A;  5ETL A;  1PBA A;  2HFV A;  3VQS A;  2KYZ A;  1DHM A;  5HBM B;  3IGV A;  2GCF A;  2JLG A;  2AYG A;  1RT2 A;  2QIF A;  3R1L A;  1OPI A;  2W2M P;  1F6T A;  4U7U K;  1HD1 A;  2I5J B;  5KG1 A;  2V4J A;  5IQQ A;  1FFS B;  2CQ1 A;  3BKT A;  2CUY A;  1JQG A;  2GIQ A;  3N0V A;  4NLP A;  4PG4 A;  4D3H A;  2MZJ A;  2LQB A;  1TKX B;  3PCO B;  3ZTQ A;  1SC4 B;  4LRD A;  4YME A;  2IAJ B;  3MEC B;  3O1L A;  3SSQ A;  1D0E A;  2MB0 B;  3OXF A;  2V2K A;  4ZIT A;  1X4G A;  2PN6 A;  2KFY A;  2PMW A;  2HRT A;  2COL A;  4NAS A;  5KFV A;  1UKU A;  1QVF R;  1YZ7 A;  4I2Q A;  3Q8R B;  2DCL A;  4DPT A;  4EZ9 A;  1OSC A;  1RHU B;  3AOD A;  4WFX A;  5CAA A;  1VS3 A;  1GAO A;  5HO4 A;  3VAM A;  4AQY F;  4Q0B B;  3QO9 A;  2C2N A;  4V1A k;  1SH2 A;  3NS7 B;  4DQS A;  2WSF C;  3J81 j;  1PJ7 A;  3PFO A;  4LFB F;  1HBM A;  2FGO A;  5IOL A;  4DLG A;  1WEZ A;  3DI6 B;  3CJ4 A;  3DRS A;  4AL6 A;  2KT5 A;  1GX6 A;  3IC1 A;  1WSV A;  3EGW B;  2ACY A;  4CLZ A;  3HP6 A;  1UJ6 A;  1S1W B;  2P2C B;  3BS9 A;  3J7Y U;  2IRU A;  1JLB B;  1PKU A;  2VFV A;  5L39 A;  5IM0 B;  2ZKT A;  3LWM A;  5K20 B;  1Y11 A;  2H5I B;  3TWZ A;  3M8Q B;  2MZ1 A;  2E7X A;  3M32 A;  3N01 A;  3W62 A;  1FDD A;  1Y10 A;  2AV5 A;  4BC9 A;  3O6Q A;  1T03 A;  2HMI B;  1C1C B;  1O51 A;  1SXL A;  2HQG A;  2VDI A;  4OYA A;  1S0O A;  4FF4 A;  3ENQ A;  2ASJ A;  2DIT A;  4RBT A;  4P2X A;  1DTQ B;  3H2U B;  1WF1 A;  1C2P A;  3BYR A;  5B7W A;  3G8S A;  4LMZ A;  1XMQ F;  1CJT A;  2E7V A;  8RUC A;  1H2U X;  3R2C J;  2HHT A;  2QL7 B;  2G13 A;  4KPC A;  1DBD A;  4L3K A;  2GGP B;  4M5H A;  3RBZ A;  1LW0 B;  3KJF B;  2DGX A;  3R5G A;  3GV5 B;  1D1U A;  3BRE A;  2I2Y A;  3PFE A;  4IOA Q;  2MGZ A;  3ITH A;  4DUZ F;  3NEK A;  2BM0 A;  4PG8 A;  2UXD F;  2V94 A;  4ZCK A;  3OV7 A;  4DSL A;  2F4V J;  2ZC4 A;  3NCR A;  4CRJ A;  2DR8 A;  3SCL E;  1VK3 A;  4TY8 B;  5C42 B;  5GVQ A;  1FRI A;  5KG3 A;  3BSO A;  2MKY A;  2DNZ A;  2LXI A;  2XNQ A;  4PXD A;  5D3G B;  1IBL J;  1BQX A;  4B3M F;  1B64 A;  2FGC A;  1Y3J A;  3V6J A;  1Y9O A;  2LLZ A;  2XYP B;  3D7S B;  4DU7 A;  4LBH A;  1S0V A;  2C3U A;  3TA1 A;  1IKV B;  3IAS 9;  2OPS A;  3U1L A;  3MF5 A;  1LFP A;  3PXG a;  3M6W A;  5GAD U;  2R9L A;  1UA0 A;  4U7U D;  3HHL C;  1Q8I A;  3MFH A;  4M5M A;  4DR6 F;  2HFS A;  4IH5 A;  3PW5 A;  1UVK A;  4MK9 A;  2MXY A;  1HBN A;  1U02 A;  1WDT A;  1HA1 A;  2AJF E;  2MQM A;  3DXB A;  1D9F A;  2OD4 A;  1K9M T;  4FBT A;  2PMH A;  2CQ2 A;  3P4U B;  4LSN B;  2HNY A;  1WC4 A;  2W2N P;  4JI6 J;  3P6Y C;  4XO0 A;  2ACM A;  3PEJ A;  4TLR A;  1LK5 A;  1S48 A;  2GVD B;  4NWB A;  5HI7 A;  2BJ3 A;  2GJF A;  3BPS P;  4HDG A;  4GMK A;  3L7P A;  4CI0 B;  1X9S A;  4BWM A;  1H6K X;  4HVZ A;  2CJB A;  5DJB A;  1CS4 B;  2XO6 A;  2HPU A;  1U24 A;  2GQQ A;  5DS7 A;  1U09 A;  3VVU A;  5RUB A;  2H9Z A;  2W7O A;  1BQM A;  2FZC B;  4DMZ A;  2J6U A;  1G3O A;  4ZPT R;  2UUC F;  2ZZN A;  3TUP A;  1FDA A;  4DV1 J;  4TVA B;  1Y0H A;  4LQ3 A;  2ZZT A;  3UDE A;  3OFE A;  2OHD A;  2AEJ A;  4WFB Q;  4X66 F;  4QR2 A;  1S1U B;  2PD1 A;  3CB4 A;  3LF0 A;  3MEK A;  4CO1 A;  4UOC A;  4NLQ A;  3UDL A;  3BJY A;  5CD4 A;  3PX6 A;  3ET6 A;  3EZU A;  4U7C A;  4OIX A;  4Q0B A;  3CIM A;  2ASY A;  2YQ0 A;  3QT7 A;  3H4B A;  2A3J A;  5HBM A;  3KLG A;  2NSB A;  4KT0 C;  2XLK A;  3CJK A;  3LP0 A;  1G7C B;  1RYS A;  5B0B A;  2AMC B;  3W60 A;  1Q7L B;  2RU9 A;  3MUM P;  1M5H A;  4NZ6 A;  4WU2 A;  5CA5 A;  1F5A A;  2Z58 B;  1UA1 A;  2IA6 A;  2EC0 A;  3DI6 A;  1SVD A;  3DLK B;  3DOM B;  5F8N A;  1KP6 A;  2LQJ A;  1TKX A;  4RJV A;  2OEM A;  3JQK A;  3SEO A;  3US5 A;  1B7F A;  3CCW A;  3J81 U;  1YJ9 S;  4BWJ A;  3W9J A;  4IKA A;  2XS7 A;  1DLO B;  3QIP A;  1WI6 A;  2GVZ A;  4MIB A;  4QPX A;  3B6B A;  3M9M B;  4DV6 F;  1RTZ A;  2HNY B;  1VQN S;  3ENV A;  4RW4 B;  3SV4 A;  1V5V A;  1SUQ B;  4X64 F;  3LGN A;  1NK4 A;  1I94 J;  2E1C A;  3UWT A;  1KLM A;  3A12 A;  4YDD B;  3W9I A;  4NZ7 A;  4ATN A;  1HI8 A;  4URS A;  1VBY A;  4KGK A;  2XHW A;  2ZOM A;  3VF0 B;  5HQ8 A;  3SDE A;  1RZM A;  3CPW R;  4ER8 A;  2DEJ A;  3NGU A;  4DFJ A;  1DAX A;  1U2C A;  4OZ5 A;  3G6Y A;  1NK9 A;  5E2Q A;  1VQ8 S;  2UZA A;  2ADC A;  2E5L F;  3Q86 A;  2B8Q A;  1HLW A;  3D0G E;  1CJT B;  3BYP A;  1MMD A;  1WC0 A;  2WB4 A;  3FCW A;  4Q2M A;  4TYA A;  5E7O B;  2HHX A;  4NA3 A;  2AEM A;  4B08 A;  1R31 A;  1UET A;  4I2P A;  2E5I A;  5A76 A;  4ZLN A;  3OHA A;  2C3Y A;  3GPA A;  1U2F A;  2F63 A;  4FKY A;  2YWF A;  2W25 A;  5KFC A;  3G96 A;  2BDP A;  3J7A N;  4KJI A;  3TAN A;  2BAB A;  3T9Z A;  3LAN A;  1Q53 A;  4BC7 A;  3JYT B;  2DKO B;  4QW8 A;  1N33 F;  2RUG A;  2CWK A;  1MNE A;  2YKQ A;  9RUB A;  3H2V E;  1Q0N A;  3H20 A;  3VAH A;  4ELT A;  1TK0 A;  2Y9H A;  4RBU A;  1RIS A;  5ETS A;  3TUZ C;  2DEI A;  6FDR A;  3HFZ B;  5AXM A;  4ZP8 A;  3JB9 k;  3R27 A;  2EFP A;  4URG A;  1LW2 A;  4QWC A;  3PR4 A;  4YB6 A;  3FVY A;  2IBK A;  2VPZ B;  2HRY A;  1YRX A;  4CZC A;  3G71 S;  1M5K C;  3DRX A;  1MN7 A;  1R0B G;  5L1L A;  4GC6 A;  2EFV A;  2E9R X;  3PHT A;  1JXL A;  1Y00 A;  4W4M A;  1HBU A;  3KJQ B;  5M2R A;  3L3C A;  4CH1 A;  2J7W A;  4DV4 F;  4ZMM A;  1XNR F;  4RW7 B;  3SQG B;  2GJI A;  2IC3 B;  2RSQ A;  3M30 B;  1S6O A;  3MCM A;  1K1S A;  5B09 A;  2FLN A;  5L9X A;  1OWX A;  3G9C A;  3AH6 A;  4CDI A;  3MM5 B;  1BE4 A;  1HD0 A;  1OQ3 A;  5D78 A;  1EAR A;  4X4O A;  2XG8 A;  3VVT A;  1XMO F;  1JMT A;  4DX7 A;  4F0H A;  2GC8 A;  4C8Z A;  3NCP A;  2FHO B;  1OIA A;  2IVF B;  4B02 A;  4DX6 A;  2ATL A;  1U8W A;  4IRD A;  3CD7 A;  4F3Q A;  1MWZ A;  1CBK A;  4A47 A;  4WFY A;  4A48 A;  4RX6 A;  2BX6 A;  1J5E F;  4LFA F;  5GAH I;  1DTT A;  4WU3 A;  2KI2 A;  1VRU A;  3KK3 A;  4HDH A;  4JV5 J;  5FJ4 A;  5HL7 Q;  1FXD A;  1RYR A;  3ZNU A;  5JMN A;  1VK8 A;  4KGV B;  2ZHO A;  2YWK A;  3M4X A;  2B9W A;  4H54 A;  1E6V A;  1JLC A;  5LMN F;  4P7T A;  1H74 A;  1TL1 A;  4CLF A;  3K58 A;  4Q2L A;  3C6T B;  3M9O B;  1NK8 A;  3I0R B;  3CJS A;  4RO0 A;  3Q0A A;  1T05 B;  3L7U A;  4B3T F;  3TVY A;  4X65 F;  1RTD A;  4ECZ A;  1IKW A;  3K59 A;  3GLJ A;  4PG5 A;  3V6D B;  4WTO B;  5KFH A;  4DPW A;  1NK6 A;  3CD0 A;  1TFW A;  1I1G A;  2CJA A;  2R42 A;  1KLN A;  1K44 A;  1FRH A;  5KFE A;  2YWH A;  3HHE A;  3M1V B;  1RAF B;  3MAA A;  4K5S A;  4CM0 A;  4DSK A;  3D0H E;  2O67 A;  4KO0 A;  1HKA A;  5F8J A;  1XWL A;  1KBR A;  2KG0 A;  2UXB J;  4FXW A;  1NZA A;  3ZNJ 1;  1YVF A;  5T14 A;  2MQN A;  1CPZ A;  5FLX U;  1XER A;  5LL6 d;  2QLX A;  3RJM B;  3HZG A;  2ZD1 B;  4KIA A;  2KFN A;  4A8X A;  2DGT A;  2IJF A;  2M9K A;  5LMU J;  2Z2Y B;  3UR0 A;  2GIR A;  3WC0 A;  1LNQ A;  3TUI C;  4CP5 A;  3RW6 A;  3GON A;  1KLM B;  4MJK A;  3HVR A;  1NJY A;  3IO1 A;  3PVX A;  1IVZ A;  2BJ1 A;  4UOF A;  3MCS A;  4K2X A;  4QPT A;  1N36 F;  1QTN B;  2GML A;  2X3G A;  3FRZ A;  3F56 A;  4MYT A;  4QJV A;  1S10 A;  4L3N A;  1G6B A;  1U6F A;  4ZOS A;  4QU6 A;  1QM9 A;  2HZA A;  4JI5 J;  4UQG A;  2IVM A;  4H4O A;  4B3S F;  2DT9 A;  3HHK A;  3D68 A;  4O3S A;  5EX0 A;  1UPM B;  4L72 B;  4K4S A;  1NEE A;  2ATC B;  2YKP A;  1FRM A;  1S9F A;  2LVW A;  3QAT A;  4ED6 A;  1TL1 B;  3HLU A;  2B7C B;  4CO2 A;  1PIL A;  2YH1 A;  4OZ2 A;  2EXU A;  4O3R A;  3D4J A;  1KQS R;  1A0O B;  1SC1 B;  3DGV A;  4I0W A;  3R7S B;  4QWE A;  1RAI B;  2CAJ A;  2C2D A;  2GJ2 A;  3NNC A;  1NHK L;  3T1Y J;  2EG1 A;  1JLF A;  1DY3 A;  1ZPW X;  4ZVF A;  2CQH A;  1O6X A;  1YLX A;  1QTM A;  2J6T A;  4WK3 A;  1FTC A;  3GU0 A;  4WP9 A;  2F8E X;  1RU1 A;  3EZO A;  3HT3 A;  1Y7P A;  2JDJ A;  2U2F A;  4DR3 J;  4JI1 J;  4X2B A;  3OT9 A;  3KKF A;  3SV3 A;  3SYZ A;  3KJN B;  2NUU G;  3DLH A;  2HK3 A;  2RHS B;  4DV3 F;  2DR6 A;  1U48 A;  3VAG A;  2B6A B;  3R9L A;  1RA6 A;  2XZW A;  2M5Y A;  2YQ1 A;  1LK7 A;  1RWK B;  2GZO A;  4DN0 A;  2HQC A;  4L73 A;  4AD6 A;  1F60 B;  2WOM B;  2DNM A;  4HH1 A;  3TOQ A;  4B3R J;  4WE1 B;  4KE5 A;  4UUW A;  1VIS A;  3VWS A;  4AL5 A;  4ED5 A;  2V4J B;  4MK8 A;  4F4Y A;  4EZ6 A;  2E5J A;  3R7N B;  4B3O B;  1WKK A;  4NPO A;  4IG0 B;  2FJX A;  2RQM A;  1ZM2 A;  1F0X A;  5CYQ A;  1PYO B;  3KUE A;  4B9V A;  4H4O B;  5J2P A;  3FFI A;  4ZKA A;  1YJR A;  2BEF A;  2M7S A;  1DQ8 A;  3I4P A;  3KYL A;  4V19 X;  4M5J A;  2BKN A;  1TL3 B;  3IWX A;  4DZ6 A;  1RAD B;  1CC8 A;  1R3N A;  4F0K A;  5D0E A;  4W90 B;  1AW0 A;  5FDL A;  1OQ6 A;  4ID8 A;  2AWZ A;  2XUL A;  3QWU A;  4WJB A;  4CLT A;  2N82 B;  4WZM A;  1TVR B;  2CNL B;  1WKL A;  5HMZ A;  3OR1 A;  3OL8 A;  3BZQ A;  4EEY A;  1TUG B;  1U6Z A;  2DY1 A;  3L4B C;  3EGZ A;  2CQP A;  1T7P A;  2PDA A;  1X0F A;  4GKK F;  5KFS A;  5LSO A;  1EAY C;  4NEZ A;  1MSW D;  2DO0 A;  3H5X A;  3LAL A;  2HHW A;  4PWD A;  3U1M A;  3NAH A;  2XO7 A;  2EI5 A;  1FEE A;  1KEK A;  4DSE A;  2UU9 F;  2MKI A;  5GAE I;  2UVW A;  1KVJ A;  4UT4 A;  2V67 A;  3FDS A;  4IH7 A;  5DLG A;  4N56 A;  2YQ3 A;  2MLY A;  4RW9 B;  3HXM A;  3KLI B;  3GFX A;  2UXC F;  2L9W A;  2MKH A;  3I5A A;  3BEG B;  3QMQ A;  3FQK A;  4JV5 F;  3EX7 B;  2BW7 A;  5LSL A;  4QOT A;  2XLJ A;  3OL7 A;  1R0A A;  1WHW A;  4LRC A;  4F4Z A;  4ZLJ A;  1QUV A;  4LR7 A;  2BV3 A;  3CXC R;  1VQ5 S;  2UUW A;  3FFI B;  2C28 A;  4CLY A;  3BDP A;  4NXN J;  1G4C A;  5J1P A;  1ITP A;  5KFG A;  4DV0 J;  4P75 A;  3B82 A;  4Q7A A;  2HSE B;  2QE5 A;  4WP8 A;  1K73 T;  2OPS B;  2ZWO A;  5KFB A;  1U49 A;  1VFJ A;  3MOJ B;  3G87 A;  1TAQ A;  2W9C B;  4JI0 J;  1RBO B;  4QZV B;  2VBX A;  1KS2 A;  2L48 A;  3Q2T C;  2ZH4 A;  2G0I A;  2VKR A;  4YFU A;  4ZVQ B;  1VR6 A;  2R2S A;  1N33 J;  1IWA A;  1NND A;  3UN5 A;  1WHV A;  2BAN A;  1L3T A;  2QMX A;  2J8A A;  1OPZ A;  2UUT A;  3NCQ A;  4N8N A;  4NA1 A;  3OSN A;  4B9L A;  2HFN A;  3A8K A;  1YSJ A;  2UVU A;  1HW9 A;  3S8S A;  2K1R B;  1JWW A;  3HF5 A;  4ZPV R;  4HI2 A;  1B0T A;  1IN0 A;  2R7Q A;  1JLF B;  5A8R A;  5HAN A;  3GIM A;  4JI4 F;  4PXE A;  4P72 A;  2P8I A;  2Z30 B;  1APS A;  1TMM A;  2FJA B;  2V69 A;  8ATC B;  1P6T A;  4Y2C A;  5F9N A;  4C9D A;  2KHD A;  4L6V 3;  3WBZ A;  1K47 A;  2QLW A;  3PIO Q;  1RAB B;  3UVJ B;  3NLC A;  2RRB A;  1IBK J;  3BH6 B;  1WDD A;  2VFS A;  4Y0F A;  1ZET A;  3SQO P;  3CJ3 A;  4X64 J;  1M5V C;  2GAG C;  3IBW A;  4LFB J;  5HMY A;  2HLU A;  3QGP A;  1XR7 A;  3K8V A;  2NPF A;  3TA0 A;  1U1O A;  2O01 C;  4JI6 F;  4FYV B;  4FYY B;  2J6S A;  4IG0 A;  4I56 A;  2H5J B;  5KFT A;  4P9S A;  3DLB A;  4PQU A;  3N6N A;  1RHJ B;  5J2M B;  3V81 B;  3TNV A;  1QVG R;  1S6Q B;  3ZTO A;  1N34 F;  1B4S A;  3RBX A;  1FJC A;  3ICL A;  1RCO B;  2ALZ A;  2OKQ A;  4FP9 A;  1HNI B;  3R5D A;  2IRX A;  3M8S A;  1RAE B;  2L41 A;  2CVE A;  2YNH B;  4MKV A;  3H5Y A;  4LF9 J;  3PJW A;  3MAH A;  3T5L A;  1AZS A;  3F44 A;  1KWM A;  3KLF A;  1IWG A;  3GWC A;  1BWE A;  3H7H B;  1C1B B;  3Q8S B;  2RHQ B;  5IT9 Y;  2C2O B;  2F9J A;  2K3I A;  2N3L A;  4HT5 A;  3T6J A;  2L3M A;  4LRB A;  1TL4 A;  3AOA A;  5DO2 A;  2R8I A;  1MLA A;  4DV7 F;  1K1Q A;  2F4V F;  3W1Y C;  4B9T A;  2CDQ A;  2DGS A;  4OJG A;  4ZN1 A;  3GZ7 A;  4NLD A;  3IG1 B;  3UDV A;  1S99 A;  2AP6 A;  3SI8 A;  4PG7 A;  1RT1 B;  1F5B A;  4PWD B;  2RAQ A;  1FX4 A;  1QD1 A;  1S1U A;  3V2U C;  2XB2 D;  3MPW A;  1PYS B;  3W64 A;  4LIW A;  2DGO A;  2LYV A;  4ZS6 A;  5F0U A;  3D28 A;  2DRB A;  1FKO A;  2DIV A;  1F1B B;  1GMU A;  1VLO A;  1L3S A;  3M2R B;  4P7V A;  1WEX A;  3FSX A;  5KT6 A;  1HMV B;  1N0V C;  1TVR A;  7AT1 B;  2DVI A;  4OL8 A;  4C8M A;  2KXN B;  2V2Z A;  5HK4 A;  4DJB A;  4QYZ J;  2G0J A;  1BY9 A;  4ZVT B;  5IWA J;  3B54 A;  1IXK A;  5ETV A;  3GIL A;  3CNQ P;  1HWL A;  4I68 A;  3MMA A;  2DD8 S;  1OMS A;  1A7G E;  1XMB A;  3PM9 A;  1R6Y A;  4DR6 J;  2B7B B;  2YNF B;  1TK8 A;  4QU7 A;  1N8R T;  1B0P A;  1WG5 A;  5IQ6 A;  2PFF B;  4K5R A;  5CAB A;  3K8W A;  2BJD A;  2VJU A;  2BM1 A;  3DHX A;  4M8L A;  2LDI A;  3Q2S C;  3MM6 A;  4DPX A;  3MUV P;  3I82 A;  4M5G A;  2Q6C A;  2HFO A;  2LKZ A;  3TVK A;  2C2Z B;  2ABY A;  1WG1 A;  1S6P A;  4B3M J;  3KK2 A;  2M4M A;  1DQA A;  2WW8 A;  4ELU A;  1YZ6 A;  3MGJ A;  2HYI B;  4JI7 J;  5HLF A;  3O8W A;  2RU3 A;  3NWG A;  3BO4 A;  4IH6 A;  3N6M A;  5H9E J;  3RB3 A;  2NZ4 A;  2X51 A;  2UV8 G;  3P49 B;  2WB1 D;  3I87 A;  5B0A A;  1OY9 A;  1RWP B;  5IC4 B;  1I51 B;  2GO8 A;  5AXK A;  2D3O 1;  2B43 A;  2WW4 A;  4MFB A;  3E2E A;  1W25 A;  2NXC A;  4P10 A;  3AOB A;  4AYB D;  3NKY A;  2VG7 B;  3MPU B;  3VR1 A;  1Y5L B;  1TEL A;  4F50 A;  2QLJ B;  2B56 A;  4NLS A;  1YJU A;  1Q86 T;  4CQ1 A;  3Q24 A;  4TQR A;  1RXO B;  2JJ4 D;  4OZ1 A;  2VUG A;  1S9E B;  3EVM A;  4E8U A;  3Q8P B;  3KK3 B;  5EDW A;  1SL0 A;  2EFO A;  3BGU A;  1HPZ A;  3WIU A;  1WUU A;  1WC6 A;  4OX9 J;  3OD2 A;  5EWF A;  4OYO A;  3ETM A;  3ILJ A;  3C15 A;  1NZ8 A;  3FJ2 A;  4K8R A;  3MMA B;  1IUJ A;  2FJE B;  2XMK A;  1XMQ J;  1I94 F;  4ZVS B;  1UL3 A;  2D1C A;  2VOP A;  2A2D A;  2V8D A;  2MY7 A;  2DTJ A;  1TMJ A;  3JTO A;  4USM A;  5E3R A;  1EHW A;  9ATC B;  4J9S A;  3KMQ A;  2XZD B;  2D9O A;  3CME S;  2Z2L A;  4P2M A;  4OQJ A;  5DZ6 A;  1AYE A;  1ZAW A;  2J8S A;  4KKO B;  1U8S A;  3J80 U;  2KH9 A;  3J81 Y;  4LJM A;  3BSC A;  2VQE F;  2CZV C;  1N6Q B;  1QSS A;  4A8F A;  1O8B A;  3R5A A;  1BC6 A;  4IRK A;  3CTR A;  2ZH1 A;  3PRV A;  1TTH B;  2ZJP Q;  5HMX A;  4A8M P;  4AQY J;  1NDP A;  4A4J A;  2A6O A;  2F65 A;  3CCT A;  4B9U A;  1A9N B;  2XWX A;  1FK9 B;  1FA0 A;  1T9T A;  2W24 A;  2CQ0 A;  3HSJ A;  4OI4 A;  5B0C A;  2QC3 A;  4JI3 J;  3CED A;  2ZH8 A;  1RHQ B;  1ZH5 A;  3C16 B;  4TXS A;  1EP4 A;  3PDN A;  2OSR A;  5KT3 A;  1BXN A;  1LWC A;  1JLA B;  3P96 A;  2C3P A;  4I6W A;  4ZJQ A;  2UUB J;  1XEZ A;  2HND A;  2KT2 A;  4OX9 F;  2POK A;  4NXM F;  3DDI A;  2F3J A;  3OJU A;  2ZM6 F;  2CPD A;  2DNK A;  2HMI A;  2ZNZ A;  2K7J A;  3ZTP A;  3OTE A;  4Y6I A;  2O3D A;  2J76 E;  3DU6 A;  1CC7 A;  5BJR A;  4DV2 J;  2Z4P A;  2HS4 A;  1RT5 B;  2GMJ A;  2KDO A;  5CCM A;  3OW2 R;  1Y5I B;  4N77 A;  4ZHR B;  4Q43 A;  1NKC A;  4ZP7 A;  2XS2 A;  2J9D E;  2LU1 A;  3D0I E;  1UZD A;  4CTA B;  4N8O A;  5ADZ A;  1JLE B;  1D9A A;  2JEJ A;  1IKX B;  2VV5 A;  4OZN A;  3WC2 A;  3HSZ A;  3D9B A;  4DQI A;  5KFM A;  3BO2 A;  2XMJ A;  3BSA A;  2XMT A;  1X4E A;  2QA2 A;  3CJR A;  2W2O P;  4JBC A;  4KKO A;  1GXL A;  3N28 A;  2B4O A;  1CUL A;  2YX7 A;  4R8U A;  2MZT A;  1SBR A;  2CPH A;  2OUG A;  2Z2Z A;  4LSN A;  1RHR B;  4ECT A;  1JKH A;  3A13 A;  3SCK E;  1FCA A;  1REG X;  4C0O C;  2XSJ A;  2C2E A;  1N5V A;  3GIJ A;  5AJ3 J;  2RT3 A;  5EX3 A;  2FLL A;  4IR1 A;  4KH1 B;  1JLQ B;  3EPG A;  1TV6 B;  3DC2 A;  4Q44 A;  1IBL F;  5F8L A;  3MM5 A;  4RU9 A;  1S9G A;  4RWX A;  3RAM A;  2QSF A;  3FBE A;  3LH2 S;  3JSB A;  3CCJ S;  3UD3 P;  5E3Q A;  4Y28 C;  4DUZ J;  1D09 B;  3N9U C;  1M90 T;  3BM7 A;  3AA9 A;  3MR7 A;  4AFF A;  3HKW A;  1H2V Z;  3M6V A;  3P45 B;  1X5T A;  1DFD A;  2RDD A;  3GJS B;  3TJ8 A;  5KT2 A;  2OO4 A;  3CMQ A;  1LWE B;  3K7R A;  3W61 A;  2W2P P;  3CCM S;  2AJ2 A;  2HEK A;  1X8D A;  1RT5 A;  2L9N A;  4QIF A;  4A8O A;  5JVH Q;  3KOA A;  2XY6 A;  2H51 B;  1FHT A;  5KFW A;  3HHN B;  1U25 A;  2IM0 A;  1V3R A;  3CJK B;  2W9B A;  1KQK A;  3OLA A;  3C6T A;  5KG6 A;  5AXN A;  1JJ2 R;  4JI7 F;  2HHV A;  2HGN A;  5J2P B;  4HTJ A;  1EKS A;  4HT7 A;  4F4X A;  4FYW B;  4OYP A;  1WHX A;  4DG1 A;  4OV6 A;  3EE3 A;  2H4Y B;  3DHW C;  3A8J A;  3LTO A;  4PEO A;  2HGL A;  4RW6 B;  5ETQ A;  3T41 A;  3TAR A;  3DOK A;  4DV0 F;  4B9M A;  3M1V A;  3MAA B;  1BLU A;  1MML A;  3FQL A;  1F2G A;  1SB6 A;  2VQF J;  2LFV A;  2ZOG A;  4DV5 F;  2KVQ E;  1WC1 A;  2CZ9 A;  3KJV A;  2DIS A;  3GV7 B;  4HR2 A;  4O0I A;  3UPF A;  1HWI A;  1WC5 A;  1QAY A;  3CVK A;  4FZV A;  1JJ4 A;  4FKX A;  2VFR A;  3KLI A;  1CSJ A;  4ZPA A;  5A6W A;  4C8N A;  1PYT A;  3DGP B;  3R6L B;  3ZZT A;  3KLG B;  3T1H F;  3D6M B;  2OH2 A;  4NLV A;  2C22 A;  2GVD A;  4N47 A;  4QCL A;  4GVL A;  3R5B A;  2G0C A;  1PCA A;  5A6P A;  4X4R A;  3FZB A;  3P3D A;  2IMO A;  4QR1 A;  5L1K A;  4HL9 A;  1CQN A;  1WOS A;  2CQC A;  4HAC B;  2MJU A;  4J91 A;  3QIP B;  4I6A A;  3MM8 B;  4EO6 A;  1Q7Y T;  2RB7 A;  4LFA J;  2OPP A;  2D69 A;  1JXE A;  1V5I B;  2BOA A;  4IQM A;  3C46 A;  2JOQ A;  3W5Z A;  1HHS A;  2F8M A;  3BBB A;  1ZS6 A;  3LAM A;  1T3O A;  2Z2M A;  1UAW A;  3DRY A;  3S6E A;  3H4D A;  3NGT A;  5B0G A;  2YXL A;  4F3O A;  1XC9 A;  2UVR A;  3D1Q A;  1DRZ A;  2BVZ A;  1FTR A;  2V34 A;  3E01 B;  3QLH B;  1P1L A;  3QYY A;  3G6E S;  4O4G B;  1FNO A;  1X4D A;  1WD6 A;  2QN6 B;  3M05 A;  4KC5 A;  2V8G A;  4OFZ A;  4P52 A;  4DZD A;  1QE1 B;  4CWB A;  2RNE A;  3NBP A;  2NXE A;  2G1H A;  2YH0 A;  3M2V A;  3HJF A;  2CJY B;  3FBF A;  1VRQ C;  3DLK A;  4I2P B;  3TP2 A;  1GMW D;  1R8P A;  3GR0 A;  3ZC4 A;  2RE1 A;  2LEA A;  2ZDP A;  4U96 A;  2R4F A;  1U1Q A;  1R8H A;  3PY8 A;  1C0T B;  2A6M A;  2CPX A;  3DGP A;  1FE4 A;  2PA8 D;  3GTY X;  4NLW A;  4UW2 A;  4O0N A;  1URR A;  2J0X A;  2MDA A;  3LP1 B;  5GAH U;  4LFC J;  1KHW A;  5LMN J;  2WAQ D;  5JUM A;  2E1R A;  3DDN A;  2KG1 A;  1WNE A;  5DGB A;  1Q5V A;  1RKI A;  1RT4 A;  3NGR A;  4YQW A;  3GG0 A;  1RT3 A;  2AYM A;  2EVZ A;  3IR5 B;  4NLU A;  3T19 A;  4HHH A;  1B99 A;  1F3V A;  1WF2 A;  2Y1R I;  4I1T A;  5F0W A;  4DR3 F;  1X4B A;  2VIH A;  1LV5 A;  2RVJ A;  4DLE A;  3W3S A;  5C24 B;  4C3L A;  1HQE A;  3EJM A;  1YJT A;  3QAE A;  1U0H B;  3CJT A;  3K2Y A;  5G0R B;  5BR8 J;  4OYI A;  2BE7 D;  5DQI A;  2J0Q D;  4RNF A;  1BGX T;  2BRL A;  4RW7 A;  2QMU B;  1KR4 A;  1F3F A;  3V4I B;  1T05 A;  4KGM A;  3AA8 A;  1FI4 A;  1A6L A;  2YKM A;  1RI7 A;  3H59 A;  2C1E B;  1Q8K A;  1Q8L A;  4WIQ A;  2LEP A;  1XNR J;  1TL7 B;  3MMJ A;  4MKA A;  5J2N B;  2IJN A;  4YB7 A;  2RDJ A;  5A8K A;  3GJQ B;  3POT A;  1HNX J;  1LOU A;  3FKB A;  3HFV A;  3VAI A;  3M2V B;  1X0P A;  3UCZ P;  4DCJ B;  2Y1I A;  3IWN C;  4A8Q A;  3X1L B;  2MEW A;  4MAK A;  2BYC A;  4XTT A;  4H4K C;  3MM7 B;  2M70 A;  1RTI B;  3J7Z 5;  3KFW X;  2KZZ A;  1BWV A;  4CNY A;  1SJ1 A;  3EDQ B;  1N88 A;  2QEX S;  1VBZ A;  3MWB A;  1KVK A;  4PZV A;  2X1A A;  1BD6 A;  1XBW A;  2YTC A;  4RL1 A;  4NXN F;  1RHM B;  1JJH A;  1W7W A;  2VBZ A;  4YUD A;  2GQ2 A;  2YWW A;  2V2V A;  5KFZ A;  2FB0 A;  4FDF A;  3EGN A;  5J1E B;  4J9L A;  4ZVR B;  2DRD A;  5EN1 A;  1MU2 A;  1UEV A;  4NOH A;  4Y2M A;  1HR0 F;  1JB0 C;  3LPY A;  1X4F A;  4LRF A;  3CCQ S;  4LF7 J;  2CPY A;  4IG3 B;  4ZN3 A;  4ECY A;  5BXI A;  2K8G A;  5CD4 H;  3FEZ A;  3QNW B;  3OHB A;  4C4W A;  2ZE2 A;  4ED7 A;  1P9Q C;  3CJ0 A;  5F8H A;  1CG2 A;  2QFI A;  4H4M B;  3IRW P;  1D8Y A;  2G2Y A;  3C19 A;  5AXL A;  1TQL A;  1H73 A;  1S1X B;  2DGU A;  2IIH A;  2UXC J;  8AT1 B;  3FSI A;  4PRF A;  1HQ2 A;  4YB5 A;  2JZ5 A;  2WVB A;  3KK1 B;  2N4C A;  4R25 A;  2QZ8 A;  1RQ0 A;  5LJ5 Y;  3PZP A;  1N4L A;  1TUW A;  5DDQ C;  2ZVI A;  3TZX A;  1U1N A;  2AJ1 A;  4X4T A;  5DM7 Q;  4X4N A;  4OV1 A;  1U1L A;  4B9N A;  3M7V A;  1Q5Y A;  3S01 A;  4DN9 A;  1GTH A;  2I9S A;  1Q81 T;  4M94 A;  1FES A;  3DKD A;  4BDP A;  5KG7 A;  3CUN A;  3SSR A;  4GKK J;  2NS1 B;  2XEX A;  2J9C A;  2WCX A;  1GK8 A;  3QJL A;  3BR9 A;  3I96 A;  3SFG A;  4J9N A;  3NMA A;  1AXQ A;  4FNI A;  1EET A;  3JSY A;  2LMI A;  1LXN A;  1FWK A;  1LW0 A;  2CWX A;  3ELH A;  4RPF A;  4CLL A;  5IT4 A;  4X4P A;  1UFL A;  3TQ1 A;  1HIY A;  3M2R A;  4NE9 C;  2FY8 A;  3QO9 B;  4GRS A;  5AE3 A;  4P71 A;  1NDL A;  2LQ5 A;  3NP5 A;  1BQN B;  4ECR A;  3D2W A;  1NRK A;  1WTF A;  3AD7 C;  1IR0 A;  1HBM B;  4ZPC A;  4AT1 B;  3M8R A;  1HHT P;  4IG3 A;  1TUV A;  2MLX A;  5CYQ B;  3BBF A;  5KFX A;  4WFA Q;  2YNG A;  3AJ1 A;  3THT A;  3KNG A;  4B3S J;  5D15 A;  2QA4 G;  4CLK A;  2XYH B;  2DH7 A;  3W2W B;  5L38 A;  5KG2 A;  4X4S A;  3K5N A;  2HAF A;  4PWU A;  1S1X A;  1NH8 A;  3M6U A;  4Y34 A;  5GAG I;  1HQE B;  2B6A A;  4JI1 F;  3VAF A;  2DXD A;  4TLQ A;  2HFZ A;  2HNZ B;  4PYA A;  4DL2 A;  3RAQ A;  4WYW A;  5G0R A;  4YY3 F;  2GAH C;  2XNR A;  1KOO A;  3LGM A;  4ANC A;  4DV3 J;  1C1C A;  3Q8U A;  4NL5 A;  4O4R A;  4CCH A;  3ZZP A;  3TEG A;  2HG4 A;  4F8R A;  4ZVH A;  1AZS B;  2OEK A;  3D6F B;  1FDB A;  1XMO J;  1FWL A;  4WII A;  3ZTR A;  2AYE A;  2DHA A;  3RGI A;  2BE2 A;  2Y1J A;  4JV2 A;  1TL7 A;  2Q1L A;  3ZFV A;  1S59 A;  1RT4 B;  2NYI A;  3LOU A;  5L8R C;  4FXV A;  4QIW D;  4Q45 A;  4TU9 A;  3EGV A;  1HYS A;  3PEH A;  1H72 C;  1U45 A;  1JLG A;  3C14 A;  1TAU A;  3IG1 A;  1LEO A;  1R7I A;  4KY3 A;  4DDF A;  5LOQ A;  1RAH B;  3HSD A;  2CDR B;  1YRU A;  1Y4Z B;  1O5J A;  3MMB B;  4Z7C A;  5L1I A;  3FRY A;  4A46 A;  2RS8 A;  2AKW B;  4TY8 A;  5C42 A;  7FD1 A;  4DPY A;  3GYN A;  4ED8 A;  3TAM A;  4PR6 A;  2D7S A;  1FT8 A;  2VC1 A;  1FER A;  4NI2 A;  5K14 B;  4ENO A;  4F7V A;  3KLV A;  4EYH B;  2AGP A;  4F2S A;  2CIM A;  1H7X A;  4R5P A;  1GQE A;  2FC9 A;  4KTQ A;  3EMT A;  3HM9 A;  1VQK S;  1PC4 A;  4DV6 J;  3L7O A;  3CIZ A;  2HZV A;  2AHO B;  3M8W A;  3QRP A;  5H9F K;  3EYZ A;  1U7L A;  2PA3 A;  2G2O A;  2FZG B;  4OZ3 A;  4FVM A;  2R7T A;  1HQU A;  4X4U A;  1KC8 T;  2XMW A;  4F4W A;  2V8H A;  2DHX A;  2UXB F;  1YRT A;  4P6Q A;  5LT5 A;  3I0S A;  5FII A;  2ZZM A;  1TKZ B;  3EWG A;  3EPI A;  4F67 A;  2KN4 A;  4OYB A;  3ZZO A;  4N5S A;  2YWE A;  4YR2 A;  1KSP A;  2FUG 9;  5K8P A;  3CE8 A;  1F9F A;  2I0X A;  2IDE A;  3O44 A;  4DV4 J;  4DR4 J;  3TZW A;  1CJU B;  3PO5 A;  3EXC X;  3KK1 A;  3KMS A;  1U2R A;  4N41 A;  3H90 A;  2XCA A;  2A0F B;  4DL7 A;  1UJ4 A;  1CS4 A;  4F26 A;  1JLQ A;  1SQE A;  3C16 A;  2DR5 A;  4EGL A;  3HPO A;  2LQ8 A;  4KB7 A;  2RS2 A;  2HHU A;  1VQL S;  1UWA A;  1IJE B;  2B9E A;  4X65 J;  1HNV A;  1NLK L;  3U02 A;  4U6P A;  3PR5 B;  4CM2 A;  1VQ9 S;  4ILL A;  5D0R A;  2VHG A;  1ICE B;  5KAK A;  2FJB B;  3CSK A;  2VPX B;  5CZV A;  5IC6 B;  2KYX A;  4FF2 A;  4NML A;  2NZC A;  2EEY A;  2E1P A;  3FMW A;  3TAM B;  2F7V A;  4PPD A;  3QRR A;  3D3B J;  2W8K A;  5K8M A;  3MD3 A;  2HQI A;  3TEH B;  3W2V B;  2ZH6 A;  4ECS A;  2JNJ A;  1WOR A;  3B8H A;  4IDK A;  4EMD A;  2WSC C;  3HI9 A;  1YBU A;  5BYQ A;  1UVM A;  3PKM A;  1Q8B A;  3HHL D;  3DLG B;  3IR7 B;  4ILR A;  1EB0 A;  2FYX A;  2LP4 A;  4AXI A;  3R5C A;  4X4Q A;  4ECU A;  4FNH A;  2CJ9 A;  2CZ4 A;  3LUY A;  3N5B A;  4GO7 X;  4OJ3 A;  1MW7 A;  1D8Z A;  1WAC A;  2GW8 A;  4DCP B;  2Q6B A;  2D3U A;  1M5O C;  4OX7 A;  2QYG A;  4XK8 C;  4OI1 A;  4ES1 A;  1LWF A;  2ZHB A;  1Q16 B;  4ZPW R;  4AL7 A;  4J9P A;  1Q78 A;  3AXK A;  2HNZ A;  3TI0 A;  3PO4 A;  1FX2 A;  4ZCI A;  1FE0 A;  1NPK A;  4ETZ A;  5K8N A;  4I7F A;  1KRP A;  4JV0 A;  3PJ9 A;  2I8E A;  3LGH A;  4LF9 F;  3IAM 9;  5KG4 A;  4ZCM A;  2UVV A;  3PYE A;  5DZ7 A;  1OYD A;  1V3Z A;  4J9K A;  1RT7 B;  3V81 A;  4ILM A;  3AFG A;  2QFJ A;  2YKA A;  2YKN B;  1X9W A;  1ZZF A;  3BPD A;  1RJJ A;  5D4L A;  2C2K B;  2FHK A;  3MCN A;  1VQS A;  4UUX A;  5KFQ A;  2DK2 A;  3PNI A;  1JLA A;  4OLP A;  5I3U B;  1LXJ A;  1YBA A;  2D9P A;  1TR0 A;  2EPI A;  4QIE A;  3CDB A;  2V8V A;  2YVS A;  1Z2L A;  1QLN A;  2CFX A;  3OR2 A;  4E98 A;  4C7Q A;  1SC3 B;  3BV8 A;  1KVI A;  2CKW A;  1RT2 B;  3OL6 A;  1YWX A;  2Q79 A;  2B5J B;  4JOU A;  4XPC A;  4X66 J;  1SV5 A;  2OJ3 A;  4UZC A;  1IQT A;  3W65 A;  3KG0 A;  4Z2X A;  2ZC3 A;  2C3O A;  2KXH A;  3MR6 A;  4EI2 A;  1SJQ A;  1IBC B;  3D6H B;  4K7Q A;  1X31 C;  1FRJ A;  2FJD B;  4NYP A;  2IY5 B;  3DMJ B;  1S0M A;  2P6S A;  1FVS A;  2GA7 A;  3NG8 A;  2AQ4 A;  1NJZ A;  4P2S A;  2XQC A;  4IOB A;  1F2H A;  2A10 A;  3D54 A;  5CHC B;  2FVQ A;  3NAI A;  1UJ5 A;  2QLF B;  1FD8 A;  2AX1 A;  4LFC F;  1S57 A;  3GE9 A;  3N79 A;  3OUY A;  4Z7Y A;  2HLT A;  2DO4 A;  4ZVO B;  4YB1 P;  2FJV A;  1FJ7 A;  3TJ9 A;  5HRO A;  4C2M A;  4RUA A;  1YTY A;  1YIJ S;  1NJI T;  2M8D B;  4KQZ A;  3D66 A;  3DU5 A;  2R7R A;  2IM2 A;  2KRB A;  3QWP A;  2R7W A;  4LRA A;  4JI0 F;  2BZ2 A;  3P5B P;  1GMV A;  3WDO A;  2HVE A;  2ZH2 A;  2J7K A;  4BS2 A;  1RWM B;  4K4U A;  3AJ2 A;  2ZUG A;  2J0W A;  3GYG A;  2P9E A;  3MM8 A;  4M5D A;  3UNY A;  3EUN A;  2IA0 A;  2CJX B;  3A3P B;  3ITH B;  5KFF A;  2F1F A;  2ZHA A;  3PW0 A;  1NK7 A;  3OBI A;  1TKZ A;  4C8L A;  2CNO B;  5KFU A;  5THW A;  1T02 A;  4KGZ B;  3UI3 A;  3AD9 C;  3BGR A;  1NJW A;  3HVW A;  3OTC A;  1QUP A;  3I0R A;  2ZBP A;  3B4D A;  2HQF A;  3L9Z A;  5IWA F;  1RTD B;  3ISN D;  4OI3 A;  3C15 B;  1J2V A;  2VC0 A;  2GMH A;  2DNN A;  1WOP A;  4X84 A;  3G8T A;  3GQC A;  3IRX A;  1NHU A;  3GSI A;  1VJW A;  2QYC A;  4NZ0 A;  3TR5 A;  1IKV A;  4CLW A;  4ZPD A;  5A8W A;  2JHE A;  5BYS A;  2ADB A;  2CJK A;  2VKZ G;  2G2Z A;  3JTP A;  4OX6 A;  5KFN A;  1NKB A;  2GS8 A;  5IXU A;  4I6Y A;  4F02 A;  3POT B;  2ERR A;  3PRB A;  2BMB A;  1N54 B;  3DRS B;  4DFM A;  4WKY A;  1Z2Z A;  1X5O A;  4DBQ A;  4DG1 B;  4W92 B;  4IFY A;  4DUT A;  2Y3Y A;  5JXS A;  3IN5 A;  2BR0 A;  3CWJ A;  2IBO A;  3RRK A;  1MRO B;  5KT4 A;  3J7A 1;  1KOH A;  3DOK B;  3RRH A;  4IUF A;  1VC0 A;  5J2Q B;  2XBP A;  1AUD A;  1F5C A;  4DL5 A;  4JB8 B;  1CQM A;  4FVC A;  3MEG A;  4I4B A;  5HRO B;  4WF9 Q;  1QJH A;  4DV2 F;  4B3T J;  2AU0 A;  3VGS A;  3QGG A;  5F9L A;  2UUA J;  1FNM A;  2IFX A;  3OSP A;  3SCI E;  4RNN A;  2HS3 A;  4CYU A;  1FFG B;  4Q8E A;  3PG9 A;  4J9U E;  5KFR A;  3KUG A;  1WWH A;  4ALZ A;  1SQF A;  4AE5 A;  5KFA A;  5CQG A;  3OVA A;  3MR5 A;  1HBO A;  1RUS A;  1SIW B;  3QFH A;  2LXU A;  1RTI A;  4RW8 A;  3KLE B;  2UUC J;  5LXR A;  1YG0 A;  4DSF A;  2A2C A;  3PJX A;  2MQO A;  2KKH A;  4CT9 A;  3PIP Q;  1VQ4 S;  1WKJ A;  4FPR A;  2MYF A;  4QWD A;  1FNX H;  4OYW A;  1VJQ A;  2FIU A;  3W5X A;  1M0S A;  4PUO A;  4KYZ A;  2HVZ A;  2PI4 A;  2DB1 A;  2I6W A;  2ROP A;  3MR2 A;  5IM0 A;  2YKM B;  1GH8 A;  3IM8 A;  4ICL A;  1H0H B;  2PMZ D;  1RWU A;  1KKH A;  3HHD A;  2E1A A;  4NCA A;  3TYT A;  1V6H A;  1NK0 A;  2VQE J;  4EYI B;  4FF1 A;  3RB4 A;  4FBU A;  2WVD A;  2HHS A;  1J5O B;  3JAM Y;  4YS2 A;  3K89 A;  3CF5 Q;  4LUB A;  3ZO7 A;  5B0F A;  4HH0 A;  2DNQ A;  4CLP A;  4I64 A;  5ETO A;  2RIJ A;  3GIR A;  2CNK B;  2MMY A;  3OFH A;  3H25 A;  1BQM B;  4J9M A;  1Y5N B;  4UOH A;  4ZLP A;  2OGU A;  2D74 B;  1RDR A;  3PRD A;  5F3T A;  4K0K F;  3SFU A;  3SXL A;  1NAQ A;  3OXL A;  4DS4 A;  2ZBI A;  1X60 A;  4IQX A;  4J5O A;  2HAI A;  4TY9 A;  4LF5 F;  3CCU S;  1T8E A;  3I56 S;  3MEG B;  2KU7 A;  4DSJ A;  2XSJ B;  1SQG A;  4F25 A;  2VQF F;  3ENW A;  3M6X A;  4RW9 A;  1VCT A;  3QPI A;  3UDC A;  1NH7 A;  1YBT A;  2FHM A;  2NQP A;  3ZZY A;  2ZKU A;  3FEX B;  1I3O B;  2FHJ D;  1LQ9 A;  1YGY A;  1PG5 B;  2HKE A;  2XI3 A;  4TU8 A;  1K0V A;  2VG5 A;  1X5P A;  2HZC A;  2R7O A;  1FO1 A;  1T9Y A;  5KFY A;  4GC7 A;  2ZIT A;  1IKX A;  3BR8 A;  4TQS A;  3RRG A;  1PBU A;  4CO5 A;  1UVJ A;  2XMU A;  1H2T Z;  4WKR A;  1NSK L;  1HWJ A;  2JEF A;  2IVY A;  1K0T A;  4M5L A;  2EBE A;  3QJP A;  5E3A A;  4RNM A;  5KFO A;  1NK5 A;  2R2U A;  5FLX Y;  1F9E B;  1LWC B;  1NPP A;  3Q8Y A;  1GXU A;  3T3F A;  2W9C A;  2R2R A;  5T7L B;  4NCB A;  4D3G A;  2JC1 A;  1IJF B;  2Y8Y A;  4DHV A;  3HO1 A;  2C2R A;  2KTQ A;  4LVO P;  1R0C B;  3BKF A;  3IS9 A;  4ID5 A;  1ZTW A;  3OUY B;  3OVB A;  3OVS A;  4X62 F;  2HK2 A;  1ZA2 B;  2EFN A;  1VLY A;  1MN9 A;  4J9V A;  2CXE A;  2FZK B;  3AQO A;  2MZR A;  3U27 A;  5A8K B;  4C8O A;  2AJQ A;  1PSD A;  1EZZ B;  1N52 B;  4IFV B;  4CH7 A;  1VQY A;  1RWX B;  1UEU A;  4CO3 A;  5IZH A;  3HKZ D;  2KM8 C;  1UFK A;  3PYF A;  1VMB A;  3A3O B;  4HHU A;  5CYJ A;  1YIT S;  4DQQ A;  4XPE A;  1SKW A;  4YOE A;  2MQL A;  2C3M A;  3ZZ0 A;  1T0T V;  3LW5 C;  4LF4 F;  3GMG A;  4OMF G;  2VDH A;  4TKT A;  2XGP A;  4QW9 A;  4EUV A;  2Z8Q A;  1JJC B;  3HFK A;  3LAK A;  1RE1 B;  2WSE C;  3HVT A;  3HT0 A;  4OZ0 A;  4RW4 A;  4AUK A;  4DL6 A;  3RBE A;  3OL9 A;  5A2Q U;  1IKY B;  4F36 A;  1WTB A;  5K14 A;  1CJK B;  3WZ0 A;  2QX0 A;  2VG5 B;  3PYG A;  3VZH A;  1MU2 B;  1VIO A;  4DL0 C;  5DDO C;  4MMO A;  1ELO A;  2BXJ A;  3RUB L;  2FJW A;  4IR9 A;  3ILL A;  3OTO J;  3W8G A;  4RUH A;  3G2X A;  1S9G B;  4J9O A;  3CC4 S;  1JLG B;  1HBO B;  4RW8 B;  4DEZ A;  2J0S D;  1U1M A;  4YHH F;  1JLE A;  4NLR A;  3TUJ C;  4C6A A;  2HQ3 A;  3OLB A;  3GB0 A;  1OY8 A;  4PWW A;  1K8A T;  2V6A A;  1RU2 A;  2V4Q A;  3T1Y F;  3GIK A;  1H3D A;  1VRT B;  5ETN A;  1X5S A;  2BJE A;  4NXM J;  3MZI A;  4LSL A;  5D4O A;  3SQG A;  4PUO B;  1CUL B;  4USV A;  2V9K A;  3I9Z A;  4ZVU B;  4C0B A;  4OYX A;  4RZR A;  4NLT A;  1HNW J;  2VOD A;  4JI4 J;  1UWB B;  2MSS A;  4DXL A;  3E51 A;  1XN9 A;  4PAA A;  3T5J A;  1V9O A;  3H8Y A;  2C2M B;  2XI2 A;  5C7P A;  2ZBR A;  2VOO A;  2EBG A;  4CYU B;  4HTI A;  4KBI A;  3M8P A;  1SJF A;  3KG1 A;  1HI0 P;  1FJG F;  3G6V A;  4IYQ A;  3AB2 B;  5E3C A;  1NDC A;  2DGQ A;  1IR2 A;  3IBC B;  3PX0 A;  3EZ5 A;  2ILZ A;  3DDK A;  2AT1 B;  1HNV B;  2EC2 A;  2MZS A;  3THP A;  4KHP J;  2OPP B;  2CG8 A;  3BN7 A;  3HSG A;  3GFZ A;  5M2P A;  2ROE A;  3W66 A;  5I42 B;  2ZD1 A;  3NGK A;  5BYR A;  3UR3 C;  1H38 A;  2R7V A;  2QV6 A;  1E6V B;  1JLC B;  3D6T B;  2N7Y A;  3NGD A;  5D3G A;  3T5H A;  4F4K A;  1LWE A;  2MQ8 A;  2DNL A;  3TAP A;  1R8A A;  3NWR A;  5H9E K;  1ACM B;  1SJ4 P;  2OML A;  3QLH A;  4JV1 A;  2NUH A;  1NPR A;  2FQQ B;  1S77 D;  2VD3 A;  2WRM A;  3LWL A;  5ETP A;  2MTL A;  3I4H X;  4PCQ A;  1Q4R A;  3VGU A;  4TNO A;  4YDX A;  4YY3 J;  2ASD A;  4WWS A;  4OHZ A;  1W26 A;  1GT8 A;  3CT9 A;  1U0H A;  4ZVG A;  4KV8 A;  1B70 B;  4HYK A;  2Q43 A;  3TX8 A;  2B3T B;  4KSE B;  2BW2 A;  4HAC A;  2E9T A;  1DTT B;  2H48 B;  4YN3 B;  5IV3 A;  4ECQ A;  2HHQ A;  3KHL A;  1CJU A;  2XY7 A;  3QSI A;  3G6X A;  2FHJ A;  2BKP A;  1NM2 A;  1XIQ A;  2I5J A;  3NY0 A;  2MKJ A;  2F8H A;  2VL1 A;  1JK9 B;  1N5S A;  2O1P A;  5DRK A;  4JYA F;  1RB0 A;  2DHH A;  2A1B A;  3PX4 A;  2OI2 A;  4OX8 A;  5E33 A;  3MXH P;  3E01 A;  4ED4 A;  4LVN P;  5HP1 B;  4LF8 J;  1PAE X;  4F0M A;  2R8H A;  3T6B A;  3KWM A;  1RT1 A;  3VHQ A;  2OSQ A;  3BKU A;  5AE1 A;  3UNG C;  2HRU A;  1HYS B;  3AOC A;  2GGP A;  2KO1 A;  3IFE A;  1UP1 A;  1S1V B;  2BUN A;  4NX9 A;  3H42 A;  5GME A;  3SBM A;  4MK7 A;  1S9E A;  1HMV A;  2VBW A;  3I6P A;  3IP0 A;  2BA9 A;  3OTD A;  2F9D A;  2BE9 B;  3P8B B;  4CH0 S;  2NXU A;  3ENA A;  4M5I A;  4OHX A;  2N7C A;  2G9O A;  4EBC A;  1X9M A;  3R7B B;  2VPY B;  2FVS A;  4C8K A;  4PQA A;  1CJK A;  4FYX B;  2OAU A;  3JQM A;  1IM6 A;  4ES2 A;  3IR6 B;  5IT0 A;  3AB4 B;  2YNF A;  4H4M A;  3LA0 A;  1L3K A;  2V0N A;  1JLB A;  2L9D A;  4JI5 F;  3ZTS A;  4LF6 F;  3GSD A;  5I4M A;  3JSM A;  2EKN A;  5C24 A;  3S7R A;  3I55 S;  4GKJ J;  3IGN A;  3OR2 B;  2IRY A;  3GR1 A;  3V6D A;  3VAJ A;  1S6P B;  3GII A;  1RT6 A;  3EXY A;  1X4C A;  3J7Y I;  1RWN B;  1QSY A;  4LR9 A;  4DI6 A;  3ZZZ A;  1P9Y A;  3HMJ G;  3CCZ A;  3K5P A;  3UN2 A;  3KLF B;  4ZCL A;  3T1A A;  1U6B A;  3JSR A;  2XSF A;  2OFG X;  3LPE A;  2RF2 B;  3CC2 S;  4EBE A;  3RW7 A;  4MKY A;  1SJ3 P;  3MHY A;  3NNH A;  2OPR A;  3BF4 A;  3ZZR A;  3DNC A;  1VHI A;  1ZAV A;  1UVI A;  4OJ1 A;  3VZI A;  1LKZ A;  4ELV A;  4USW A;  2KRR A;  4HKQ A;  1R8C A;  1S6U A;  5HSP A;  2RD5 C;  2PT0 A;  2WHO A;  2MQQ A;  4DFK A;  4A8Y A;  4M5D B;  3TZZ A;  4NLY A;  2HGM A;  1IBM J;  2AZ1 A;  1SKU B;  5AT1 B;  1BQN A;  2HND B;  5GAE U;  2R8K A;  1HNX F;  3FZ2 A;  3H5U A;  3PHE A;  1E6Y A;  3BQ2 A;  1N5Q A;  4ZJL A;  1RWV B;  1S1T A;  3DRP A;  1WHY A;  2JEI A;  3V6H A;  3G82 A;  5I3Q A;  4LBP A;  1UW4 A;  1NDK A;  2ZNY A;  3MCO A;  4LF8 F;  5J2Q A;  3NS5 A;  2KZM A;  3LP2 A;  3RAX A;  1OO0 B;  1HHQ A;  1QY7 A;  1ZM4 A;  2YWG A;  4KAI A;  3VV2 B;  4C11 B;  5HQL A;  4IOC Q;  2DH9 A;  1J5E J;  3CGI A;  2RQ4 A;  4RUB A;  2FVR A;  1YKW A;  4MTP A;  4F04 B;  1FRK A;  2EW9 A;  2F40 A;  3W63 A;  4LF5 J;  3MM7 A;  5I42 A;  3TO8 A;  3UD5 A;  4U8V A;  4ANE A;  4PXB A;  2LEC A;  3UW1 A;  2R7X A;  4NCG A;  3WX8 A;  2X7I A;  3R97 A;  1FK9 A;  5J1E A;  2B8P A;  3M9N B;  3F73 A;  3OR1 B;  2OPR B;  2XHC A;  3JXO A;  5F8M A;  1P27 B;  1X4H A;  2ZBC A;  3QT6 A;  3Q22 A;  1YJN S;  3CD5 A;  1L3U A;  1FXL A;  2R8J A;  4OZJ A;  4G1I A;  3Q89 A;  2KVI A;  5HP1 A;  4DU8 A;  1S79 A;  1SI9 A;  2BBE A;  2Y1L B;  3A8I A;  5MLC V;  2CYY A;  1QAI A;  3CJ8 A;  3GCX P;  5KG5 A;  3PKY A;  4LIR A;  2B4P A;  2ZEJ A;  3RB6 A;  2GHW A;  4BBY A;  1EJ7 L;  5I3U A;  3NL0 A;  1DQ9 A;  4BLG A;  2IPO B;  3DLL Q;  2BAN B;  3N4W A;  3A1Y G;  3OQ2 A;  5LMU F;  3BGL A;  4V19 J;  4GVB A;  5B0E A;  4ZHR A;  1I6J A;  3QGI A;  2DR9 A;  2GFF A;  3VAL A;  1RAG B;  1VDH A;  1Z1Z A;  2F5G A;  2VU5 A;  3E3X A;  4CTA A;  5HQM A;  3CCV S;  4JP8 A;  4ZP9 A;  5H9F J;  3MPV A;  4EU0 A;  2RIL A;  5GAD I;  2WZ1 A;  2YNG B;  1D9D A;  1S6Q A;  2JVO A;  2NLW A;  1RSC A;  4UF4 A;  1NXI A;  2U1A A;  4KO0 B;  4RBV A;  3HCX A;  1VC5 A;  4F4A A;  1LW2 B;  2DXF A;  4R8U B;  1WSR A;  3BH7 B;  5HAO A;  4A8W A;  3HD1 A;  2DR7 A;  2E44 A;  1P1T A;  2CA9 A;  2E7W A;  2IM1 A;  3RG6 A;  4JI8 J;  3MM9 B;  3F0N A;  5C5J A;  1RT6 B;  4DFP A;  1IR1 A;  1GXT A;  1TV6 A;  1ULR A;  4WXW A;  3SDE B;  5KTQ A;  3GV8 B;  1VBX A;  3TX0 A;  3ULH A;  1AFI A;  1MWQ A;  3L09 A;  1JNZ B;  4DOZ A;  1JXV A;  3N5F A;  2FDN A;  4R0E A;  4UQT A;  4ZLL A;  4FYD A;  5KOW A;  3DCA A;  5J2M A;  2DNH A;  2MJN A;  3G86 A;  1H98 A;  3HDS A;  4Y3C A;  5A2Q Y;  1QSL A;  3RR7 A;  4DV5 J;  1S0N A;  3MEE B;  4E0D A;  2KHC A;  5ETT A;  2W2Q P;  5C2C A;  5DM6 Q;  3J80 Y;  2JL9 A;  4Z37 A;  2IDL A;  3KHG A;  1G1X A;  2M2B A;  3ZXW A;  1S4F A;  3CMA S;  2XZT B;  4K4Z A;  3CCR S;  4G1Q B;  3K57 A;  2B9X A;  3E8O A;  5JVG Q;  1PIE A;  2Y0S D;  3IBF B;  1RTH A;  1S97 A;  3L95 X;  2QA1 A;  3MI7 X;  3ZZU A;  2PI5 A;  1CJV B;  1T9X A;  1RCX B;  3K0J A;  2E29 A;  4CO4 A;  3UQS A;  5E5N A;  2BJ8 A;  2RF2 A;  3NOG A;  4JI2 F;  4DUY F;  2FC8 A;  5L9N A;  1IM4 A;  1GFW B;  4QBU A;  1RLD A;  4C3K A;  4DS5 A;  4LF7 F;  2WVE A;  1UVN A;  3HD2 A;  2FTR A;  1S49 A;  2BKO A;  4H4K A;  4BCA A;  5GAG U;  5EWE A;  2ZBQ A;  4UZB A;  2UP1 A;  4O44 A;  3UE2 A;  4DQR A;  2QGF B;  4IFY B;  3I0S B;  1B3T A;  5SUH A;  4EBD A;  3C8Y A;  3DYA B;  4F3M A;  2M8H A;  3C14 B;  4K4V A;  1T03 B;  3THV A;  3DRR A;  2JH3 A;  3C6U A;  2UXD J;  3IS9 B;  4ID5 B;  5E0O A;  3UD4 P;  4NLG A;  2HVD A;  2ZFH A;  3R8Y A;  4K4W A;  4B17 A;  2NR0 A;  3EM1 A;  4J9R A;  2CQI A;  2JLF A;  4K2J A;  5HJY A;  4DF8 A;  1EQ0 A;  1W2B R;  1FD2 A;  4NCG B;  2DYA A;  2CPI A;  2DBB A;  2X3D A;  3WHI A;  1M1K T;  2KXF A;  2DIU A;  2CAD A;  4LSZ B;  4K0K J;  1YJW S;  2QA4 S;  2X1G A;  2PEB A;  3QT5 A;  2NCK L;  1PO6 A;  1RT3 B;  5HVF A;  3MEE A;  3KLE A;  3HUL A;  4TN2 A;  1VRU B;  3KXD A;  2MGZ B;  1XR6 A;  1FEH A;  1HFE L;  1T9W A;  3FBC A;  5F8I A;  3M8Q A;  2H5E A;  4C98 A;  1KQG B;  2O66 A;  3CDA A;  3HVT B;  5ETM A;  1XNQ J;  2CQG A;  2OTJ S;  1QAJ A;  3FC9 A;  1PJ5 A;  3CO9 A;  1RTJ B;  2EWH A;  5LM7 E;  3Q83 A;  3K5O A;  2MY8 A;  3BGO P;  2CPZ A;  1NU4 A;  3BB5 A;  4WYL A;  4JUZ A;  4U67 Q;  4YP3 A;  2QTW A;  4WTY A;  2D3O R;  3KNA A;  2V50 A;  2BOP A;  5HVG A;  2PE8 A;  4WZQ A;  4HI1 A;  1UWB A;  5H1S V;  4IFV A;  2FD2 A;  2MKS A;  1HWK A;  3HZE A;  2ZM6 J;  3UFC X; 
#chains in the Genus database with same CATH homology
 3R6G B;  4DCJ B;  3GJS B;  2QLF B;  1SC4 B;  4ZVO B;  1F9E B;  3RJM B;  2Y0B B;  3EDQ B;  4ZVP B;  1RWP B;  5IC4 B;  1I51 B;  2H51 B;  2XYG B;  3R5J B;  1RHM B;  3GJR B;  1RHU B;  2QLJ B;  4ZVQ B;  1QTN B;  4ZVR B;  1RWM B;  2H4Y B;  3NS7 B;  2CJX B;  1RWO B;  2CNN B;  3QNW B;  1RWX B;  2CNO B;  3R7B B;  1PAU B;  2H4W B;  1NME B;  1RHK B;  2P2C B;  3R6L B;  4ZVS B;  3D6M B;  1SC1 B;  1RE1 B;  3R7S B;  5K20 B;  2H5I B;  1ICE B;  2XZD B;  5IC6 B;  1RWN B;  2XZT B;  3KJN B;  2DKO B;  4JB8 B;  2H5J B;  1RWW B;  3IBF B;  1RHJ B;  2QL7 B;  1RWK B;  3P45 B;  3KJF B;  1RHQ B;  1QDU B;  4DCP B;  3R7N B;  2QL5 B;  4ZVU B;  1GFW B;  1PYO B;  4DCO B;  3EDR B;  2C2M B;  2C2O B;  2CJY B;  3SIP B;  2QLB B;  3KJQ B;  2XYP B;  1RWV B;  2QL9 B;  3GJT B;  2XYH B;  2HBR B;  2C2Z B;  2HBZ B;  3IBC B;  2HBY B;  1BMQ B;  2CNL B;  4LSZ B;  2C2K B;  3D6F B;  3P4U B;  2CNK B;  2FQQ B;  1SC3 B;  1RHR B;  2H65 B;  4ZVT B;  2H54 B;  1IBC B;  2CDR B;  2H48 B;  3D6H B;  2C1E B;  1I3O B;  2Y1L B;  2HBQ B;  3GJQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...