2HBRB

Crystal structure of human caspase-1 (arg286->ala) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2hbrB00
2HBZB 3IBFB 1RWPB 2XZDB 1RWXB 3R7NB 2CJXB 2XYGB 1RE1B 4ZVOB 3D6FB 2XZTB 3GJQB 3P4UB 2H4YB 1I51B 3D6MB 1PAUB 4JB8B 2DKOB 2HBRB 1RHMB 1IBCB 2QL7B 4DCOB 2QLFB 1SC1B 3KJFB 2Y0BB 1QDUB 2C2KB 5IC6B 1I3OB 2Y1LB 3R6LB 1PYOB 3R7BB 3R5JB 3GJTB 1GFWB 2C2MB 4ZVSB 4ZVUB 2XYPB 1RWNB 1SC4B 2P2CB 2CNKB 1RWWB 3IBCB 2H5JB 2QL5B 1NMEB 2CDRB 1F9EB 1RWOB 3QNWB 4DCJB 3D6HB 1RWMB 2QL9B 3KJNB 2HBQB 2CNLB 2CNOB 5IC4B 2FQQB 3EDQB 3SIPB 2CJYB 2QLJB 3KJQB 3GJSB 3P45B 3R7SB 3GJRB 3NS7B 1RHRB 2XYHB 1RWVB 4LSZB 2C2OB 5K20B 4ZVPB 2H48B 2C1EB 2H5IB 4ZVRB 4ZVQB 1RWKB 2H54B 1RHUB 1RHQB 1BMQB 3EDRB 3RJMB 2QLBB 1RHKB 2H4WB 1RHJB 1SC3B 3R6GB 2H65B 1ICEB 4DCPB 2HBYB 2CNNB 2H51B 4ZVTB 2C2ZB 1QTNB
chains in the Genus database with same CATH superfamily
1IKWB 4PXBA 3UD4P 2VU5A 2HIYA 2F5GA 4OI3A 4LREA 4RW8A 3DOLB 4ED6A 4M5MA 3IN5A 3IM8A 2XQCA 3C16B 3GMGA 2BE9B 1ZOTA 5K8PA 2APOA 4JI2J 3K5MA 1RLCL 3QZ7A 3MM9B 2KT3A 4JI6J 2DRAA 1M5HA 5KFCA 1ZZFA 3D3BJ 5DDOC 1WC5A 2QV6A 6AT1B 4RWXA 4MKVA 3UI3A 1OMSA 3LQVA 4OX8A 2FZCB 5JUMA 2IBKA 2RRBA 1WDTA 3ULHA 1QTMA 2DNOA 1Q78A 2YNFB 2G2ZA 4I4BA 2VKRA 1B64A 2FVQA 4W90B 3Q24A 8AT1B 4J9MA 1HNIB 4CQ1A 2V68A 3HD1A 3ET6B 4M95A 2B4OA 3MWBA 1UVJA 1VRQC 3VQSA 4P75A 4IFVB 1RJJA 2MY8A 5GMEA 4O4GB 5JXSA 5G4DA 2B9YA 1HWLA 2UUAF 4C11B 4WYWA 3D6FB 2FJXA 3PYDA 3R9LA 4ZLJA 1KVIA 2VJUA 2G2YA 1FNOA 1CULB 4JI0F 4ZKAA 2OUGA 2Y0BB 1NJIT 3GFHA 3C14A 3KUHA 1RTZA 4LRBA 3QATA 2V6AA 3N4WA 4ED2A 2VFTA 1RWNB 1ZPVA 3DFEA 1WG5A 2W4PA 2I8EA 2Q66A 3IBCB 4X4QA 2L41A 2KZMA 4K2XA 5A8KA 1F9EB 3O8WA 3K8VA 2VG6B 3CCMS 4DS4A 1F60B 1U49A 2M8HA 3MMCB 3I87A 2VONA 2V4QA 4S0MA 4IH6A 1DJ0A 2ZH5A 2OFHX 3D5MA 4ZP7A 3QSIA 2HFUA 2VF3A 2QN6B 4IG3A 4E98A 4USJC 2WVBA 1KQFB 1IXKA 3ZC4A 1TMMA 3LP0A 2YNHA 4DV0F 1ZPWX 2LXUA 2JEIA 3M6XA 3MFIA 1N52B 3HP6A 3UN2A 5EDWA 2RU3A 3DYAA 3O3LA 4RW8B 1RTDA 3GIMA 3VWSA 4DR4J 2BW7A 3D0IE 3CCJS 1F5AA 4PPDA 2ZEJA 2MKHA 2OSRA 2IY5B 1N34F 3SV3A 4FP9A 2W2QP 2QRRA 1VJWA 2CPFA 2WW4A 2J0SD 3HX9A 2HBQB 1TFYA 2W25A 2DHGA 1H2TZ 4U6PA 2E1PA 4X4NA 4LSZB 1VQPS 2OGUA 1ZA1B 4OYOA 1M5VC 1S1WA 4ZIVA 3V6HA 1NK9A 5THWA 2C2ZB 2EFGA 3TJAA 5J1PA 2LEPA 2XY5A 3ILOA 2HS0A 2F65A 1GTEA 5ETMA 4PG5A 2QA4S 5ETTA 2H4YB 2B9XA 4H4KA 3PJXA 4DQQA 4HHJA 3MAHA 1HNXJ 5B0GA 3W65A 5J2MA 3FGVA 4KJIA 3ENWA 4Q45A 3C14B 4ZVEA 2RS8A 3QGGA 4TY9A 4EZ6A 4C8ZA 4F04B 4K0KF 1SKUB 1SIZA 2I6WA 2BE7D 1X5PA 3MCNA 1SBRA 2OHDA 2Q3PA 1RAHB 3MMJA 1N5YB 2GQ2A 3CCTA 2X1FA 1QLNA 2ZNZA 5J1NA 2GC8A 2MGZB 5IOLA 1OPZA 4KPYA 3BSAA 4L76A 5DZ7A 1IKVA 2UUCJ 3KLEA 1JKHA 1U2RA 4NLUA 4LF9J 4PYAA 3KOAA 2J9DE 1RAAB 1V5VA 2UV8G 2DISA 1IBLJ 2H4WB 2MLXA 4IG3B 4JYAF 2BM1A 2FJVA 4EBCA 4CZCA 1IR2A 2B43A 4TQSA 3BO3A 2R4FA 3LP0B 2XSJA 3R1HA 2ZZNA 4LSNA 2YNHB 5LMNJ 3VAIA 1URNA 2R7UA 4NZ6A 4DUZJ 2UU9J 2YWGA 1FRIA 4C0BA 4F26A 2M88A 3MR5A 9RUBA 4UQTA 3MZIA 2FGOA 2DNYA 3PRDA 1RTDB 3SCLE 3A8KA 1SCJB 3ISND 2RQCA 3EXCX 3W66A 3I9ZA 2XO7A 5L1IA 1SUQB 5HL7Q 3AJDA 4AUKA 5KG6A 5AXLA 1S57A 3TUIC 4HH1A 2B6AB 1ITPA 3DRXA 2ZUAA 1HQEA 2EC2A 5KFZA 4PG6A 5LSOA 2A18A 2DYAA 1R8HA 4K7QA 3O2IA 1HKAA 1RZMA 1P1LA 4BHQA 1M1HA 4IUFA 4DCPB 4KHPF 2ZHOA 2MMYA 4M8LA 1S72S 1S1WB 4JI1F 1M5SA 1TL3A 3UW1A 1AFJA 1X4GA 3PW2A 3RGIA 4GVLA 2KFZA 1REGX 2YH1A 1KONA 1S49A 1EARA 1VLOA 3HJFA 3THTA 5CXTA 3KDNA 3OSPA 3C19A 2W9BA 2DR6A 2HIQA 5M2PA 2HZVA 4ZCLA 5J2MB 4ED8A 1IQZA 4OHZA 3BGLA 1R27B 2N7YA 1K0TA 1YBAA 4DEZA 4NI2A 3RB0A 4K5SA 2VC0A 1EQ0A 2CUYA 2WRMA 5MLCV 3UCGA 5KFTA 4KH1B 3EPGA 3NCQA 1S6UA 1IKVB 1X7VA 3KLEB 1JKHB 2XS7A 3ILJA 4MK8A 2E5GA 4K4WA 1WTBA 4O44A 5F9NA 3HVWA 2A2DA 2PC6A 1H74A 3MCMA 5I3QA 4WFAQ 4ATNA 2BBEA 5E7OB 2ZZMA 1Y9OA 1FRLA 1N6QB 3OVSA 2DR7A 2G2OA 2XSJB 4LSNB 1U1RA 3AHPA 2OEMA 3BGUA 3J7Z5 2P9EA 1P9QC 2YPZA 3EZ5A 4HT5A 3JAMU 4USMA 4KIAA 4ANEA 1GMUA 4Z7YA 5IWAF 1MN9A 3VF0B 4RR5A 3OTBA 7AT1B 5A0YA 5C25B 3KLFA 1JJ2R 5GAHU 4C7QA 3DLKA 2AX0A 3HFKA 1DTQA 2W24A 4MFBB 4RW6B 3M6VA 5LJ3Y 3AB4B 3FNNA 1RHQB 5E33A 3HF5A 1HQEB 3WIVA 5CD4H 1QAXA 2ZUGA 4LF5J 4EZ9A 3KK1A 1Z2LA 1JJHA 2X51A 1RWUA 3K5OA 5CYMA 4EFAC 4UUWA 1TL3B 4LFBJ 3KHGA 3H90A 2XM3A 4MAKA 2GVZA 5LT5A 4CO0A 1K0VA 3MD3A 5BXIA 4RUBA 1WF2A 3SZ2A 2J7UA 2PD1A 1QSLA 1X9WA 1WG4A 5ETSA 2MQMA 2CVEA 3DNCA 2GAHC 1SPBP 1F5CA 1RAIB 5AJ3J 4NX9A 5HQ8A 1P8GA 1DBDA 3QBCA 5BYSA 4USHA 4NI2B 3FRZA 4ICLB 4ELUA 2L08A 2P9CA 2F3JA 3EGZA 3MCSA 3OT9A 3EGVA 5ETRA 1JXEA 3PM9A 3PEJA 4C8LA 3NMRA 2O67A 1Q82T 1HWKA 4Y28C 3CCWA 4ED7A 4JI2F 1VCTA 2F40A 2DNKA 4LR9A 4O44B 4CO1A 1TL5A 3HZEA 4NZ7A 4JI6F 1TV6A 4QOTA 4GKKJ 3G82A 4MK7A 2JX2A 3GJQB 3LH2S 4LRDA 1JNRB 4CLWA 4IOBA 2RQMA 1M1GA 2CG8A 2ZITA 2HRYA 3RRHA 2AQ4A 1SJ4P 2N4DA 4BC7A 2W8LA 2P6SA 4OX9J 1Y3JA 1LWFA 2OEKA 1FESA 5A6WA 3R7BB 4ZS6A 5HMWA 2BQUA 5DQGA 2EW9A 2ASLA 1QE1A 4WP8A 4OJ3A 4ECRA 4OFZA 4OYXA 4DSFA 4AXJA 1NJXA 1H98A 4F3MA 3CB4A 2UVRA 1G4CA 5A0YB 3A12A 3ZNJ1 4YY3F 3KLFB 2R2TA 1F9FA 3DLKB 2LQ5A 1DTQB 1D1UA 2E1RA 4FVMA 5GMKa 2IVYA 3UPFA 3MPDA 2R7XA 1VDHA 3EX7B 1WI8A 4PXDA 4TQRA 1HMVB 2HMIB 3G86A 4NASA 1RISA 4NMXA 2GJ2A 2IVFB 3TZYA 3WHIA 3VGUA 3X3UA 3KK1B 3KLIA 2KTQA 5HMZA 2VL1A 3PZPA 4DUTA 3I0RA 4O0NA 5CYMB 2C3PA 2Q79A 2VG7A 3NWGA 2GVZB 2FUG9 3TUZC 4I67A 2MZJA 3GILA 4GO7X 5K8NA 4U8YA 3M6WA 4FF4A 2ZBPA 3GCWP 1OIAA 2DHSA 5ETOA 3OPKA 3NOGA 2HNYA 2R7WA 3TVKA 4IR1A 1HBMA 2BM0A 3TEHB 5LXRA 4PWDA 2BZ2A 2ZJRQ 4DSIA 4A8WA 1PO6A 4G3IA 2MQ8A 4OI1A 1MMLA 3GJRB 4KE5A 2YNIA 1IUJA 2J5AA 3FBCA 4ZVPB 2I5JA 1TP7A 2KG0A 3DDIA 2IMWP 1GXTA 2GQCA 2HFSA 4BBYA 3AD8C 1ICEB 5D6GA 2Z4PA 1NK5A 2JHEA 4ZLLA 2COLA 1YJVA 3D4JA 1J5OB 4DR4F 2OH2A 4DPXA 4QIWD 4JOUA 1NB7A 1EIYB 2UZAA 1TFWA 2V9KA 1TV6B 2HVHA 1RHMB 4QYZJ 3G82B 3HMJG 2Y8WA 2XMUA 2LA4A 2NPIA 4K4TA 4XIUA 4W4MA 2EG1A 3PIOQ 1F5BA 2AP6A 2MZQA 2HGNA 2RNEA 1U0SA 1IBKJ 1LWFB 2XYPB 4Y0FA 3FEYB 3OTEA 4FPIA 4RL1A 2BDPA 1QE1B 1YRXA 5KAKA 2GO9A 1DQ8A 1NPRA 4DCJB 2M8DB 2EK6A 2DH7A 1RU1A 2F63A 3RUBL 3W5YA 4A8FA 1FWPA 3J7YI 3SIPB 2KU7A 3KJQB 3KHHA 4O4RA 2JNJA 1XMQJ 1TK0A 2HLTA 4OHVA 1HHSA 5H1SV 4M5DA 1HQ2A 3TRGA 4ZK7M 1RKIA 4MJKA 1GK8A 1PSDA 5FJ4A 2KHCA 2LVWA 1FWKA 5KFEA 2VBWA 2ZH4A 1HNXF 1S77D 4ZITA 2PN6A 3KLGA 1RT6A 5F8NA 2CPDA 1UPPA 3KLIB 4JB8B 2BOPA 2DO0A 4IH7A 2C3UA 3C66A 4DUYJ 3I0RB 1Q8LA 3ITHA 3G2XA 1TUGB 1M5OC 3CULA 3DLGA 2VG7B 2DGWA 1UETA 1UW9A 4CLSA 1NHKL 5LJ5Y 1VK3A 5E41A 2D9OA 3LAMA 4LIWA 2HHHJ 1S79A 1BQNA 1XK8A 4LF9F 3HHLD 2NCKL 4UY85 2RE1A 1AB8A 2FZKB 1D9FA 1QAYA 3NGTA 1IBLF 2HNYB 5F8LA 1Q7YT 3LPYA 2BJ1A 2ZD1A 1HBMB 1YITS 2HNDA 4WTOB 2R8JA 1HI8A 4PWDB 2OFGX 2HQGA 3OJSA 3VR1A 1X5OA 4R8UA 3CCZA 1Y5IB 3LW5C 1Y5LB 5JVGQ 2YNIB 1SL2A 3EPIA 2I5JB 5LMNF 1N5TA 5B7WA 4DUZF 2UU9F 4NXMF 4FBTA 2X1GA 3DXSX 2XS2A 1N4LA 1KHWA 1XC9A 1NH8A 1UWBA 2MYFA 1VQ5S 4D3GA 3D3CJ 4DPTA 1FDBA 3CMAS 3MGJA 3I56S 4KRWA 2FY1A 3R2CJ 1H38A 2EXUA 1S1XA 3BGFA 3D9BA 2ZHBA 1I6JA 4M1KA 3RYLA 2CDRB 1UP1A 3B82A 1XNRJ 2LQJA 2UP1A 2DVIA 2CNLB 4AQYJ 3F0NA 3GV7B 3G4SS 3UCZP 4F4YA 3R7SB 1LK7A 4HI1A 3ADAC 2X1AA 1VS3A 1RTHA 2QX0A 3TQ1A 2ZM6F 2AZ3A 1WORA 2V67A 2CIMA 1UTAA 4O3OA 3OBIA 2ZOFA 2UV8A 3SBMA 3R6GB 5C2CA 4M5DB 2J6UA 1U1OA 4ED4A 3AODA 1NUEA 5LMUJ 3CIMA 2MKJA 2PA3A 2KL8A 2D69A 4WTYA 4ZJQA 4ECYA 3ISNC 5KFYA 4DR2J 1RT6B 2OLWA 1NKBA 1VQOS 3HPOA 4XAKA 2VQFJ 3TVYA 3MTKA 1YG0A 1KKHA 2BVZA 1CBKA 3ITHB 5HVGA 1KWMA 3CCRS 3DLGB 4EBDA 2HK2A 2DGOA 2HPUA 2EC0A 3L7PA 4WJBA 3TAMA 1BQNB 3DC2A 2GNKA 4Q0BB 5DO2A 2VB6A 2IA6A 4ZPBA 2HNDB 3KNAA 2GX8A 2G0CA 1N32F 3TZWA 3SV4A 1NDLA 2EBEA 4KGKA 3RG6A 4R8UB 2JC0A 2FC8A 3QIDA 2E66A 2DGTA 3UCUP 4JI3J 2R7RA 2HWTA 2RS2A 1XR7A 3E3XA 1S0VA 2NXCA 2C42A 2NS1B 2P5VA 4FKXA 4UUXA 2XI2A 1OWXA 1JLEA 3EGNA 3CGIA 4WF9Q 1S6QA 2MSSA 1KRPA 4MIAA 4FXVA 1UWBB 3R5GA 5F0WA 2VPWB 1V9OA 1PJ6A 2QA4G 4ED5A 1PKUA 2YXLA 1WHYA 2BMBA 1S1XB 2NXUA 3PFEA 4RW7A 1Q0NA 1PBAA 4CLPA 4LF5F 1X31C 1PC5A 3A3PB 1WELA 2IYGA 1WEYA 1RWKB 2H54B 2RKIA 1X4BA 2RDIA 2Y3YA 4RU9A 1JLBA 3B54A 3NKYA 1RTHB 4LFBF 1IR0A 1X0PA 3BBBA 4FPRA 5F41A 4PYDA 1SL1A 1MLAA 1JLAA 2C28A 2AW0A 3GIRA 2I38A 2MY7A 3LO3A 1K47A 1NSKL 1BHNA 3DM2A 2KRBA 1LKZA 3H0PA 4N5SA 1HBUA 3TQEA 4M94A 3NS5A 1EETA 1R31A 4PAAA 4CLUA 2AF6A 1M1KT 2JZ5A 5AJ3F 2ROGA 3B6BA 1K1QA 2CRLA 4HLBA 2UXBJ 4I64A 4MYUA 6FD1A 2VBYA 1Q8KA 5KFRA 3FMBA 2L9WA 5AE1A 3MPYA 3SCIE 2OTJS 2FPHX 3HSGA 1FRMA 1APSA 1R8BA 2CJBA 3AAWB 4KHRA 3D0HE 2FB0A 3L95X 3HSZA 1QM9A 4NZ0A 2KJWA 2J9CA 5HQLA 2VPYB 3QWPA 3TAMB 1T9WA 1RHRB 2GFFA 4XO0A 4JV0A 4DPYA 3B8HA 2V4JA 4ZVRB 2KT2A 3Q22A 2KB2A 1K44A 2QLXA 2PFDA 4GKKF 4I2PB 4DX8H 2AX1A 1MSWD 2XULA 1BC6A 3NRBA 3DN9A 3KMQA 2GHWA 2VA2A 5FIIA 1AYEA 4OV6A 3DRSA 1UPMB 2XLIA 1WEZA 3PV8A 1YJTA 2BRKA 4F0HA 1JQGA 1NK0A 3KNGA 4LSLA 4OYZA 3R5BA 4ZPAA 1LWCA 1JLEB 4DL4A 1IBMJ 1AZSA 1S6QB 3NS6A 1RABB 1SC1B 2MZ1A 3A1YG 1B3TA 2MQOA 2J9DA 3Q89A 4H4MA 2HVZA 5M2RA 4LQ3A 3KK2A 3M30A 3GZ7A 4DPWA 1KLMA 3DLBA 5EWGA 2IM1A 3R97A 2NZ4A 3OV7A 2BR0A 1QAJA 4RW7B 1X0FA 3KKFA 4WFBQ 3GR0A 3GFZA 4USIA 5LOQA 1RYSA 1AW0A 4X4RA 1JMTA 2AU0A 1UCNA 4A8YA 1OPIA 4KGZB 3DRPB 2RKIB 1ZYQA 1P6TA 2HHTA 1JLBB 2YWEA 1S99A 1YJWS 3HM9A 1RWPB 3MECA 4B3RF 1W25A 4BCAA 1WDDA 1JLAB 3LF0A 1U2CA 3IWNC 5KFDA 3NGKA 2MB0B 1H7WA 2MQNA 3M05A 5DLGA 3DM2B 4ENOA 1FXDA 5IS2A 1HBUB 1LXJA 3K58A 3ENQA 1EETB 1UFKA 4J90A 5CYQA 2RQ4A 3HSDA 3EVWA 4U8VA 3J7YU 5GMDA 3FCWA 1FFSB 1GNKA 4NLDA 2MTLA 4FYWB 5D15A 2CZ4A 3CDBA 3R5JB 2AMCB 1VHIA 3R5DA 4ZVSB 3I32A 3PCOB 5KFOA 1VOMA 2W7OA 5KFXA 3L09A 4EUVA 3K5NA 1S5ZA 3JXOA 4U95A 4QJVA 2WONA 1S4FA 4G1PA 4CT9A 4YB1P 4F4AA 3I5CA 2B56A 5KFWA 3EGWB 2MLZA 2A6OA 3WDOA 4LF1A 2VV5A 3V4MA 3VGVA 1LEOA 4OX6A 1DY3A 2DNPA 3F41A 3JS9A 1KEKA 4FYYB 3E51A 2HZCA 3Q23A 2V4JB 4ZCMA 5BR8J 1SV5B 4QWEA 3IR5B 2Q6CA 4CI0B 3MURP 4PKDB 3C3LA 2LA6A 1BGXT 4J9RA 1U45A 2CQ2A 4TXSA 3L9ZA 4IR9A 1IBKF 3DRSB 4QR2A 4DLEA 3I6PA 3UDCA 3BM7A 5BYQA 1U2FA 3M2VA 2GAGC 4LSLB 1GMVA 1PJ7A 4ZPWR 2SXLA 4GVBA 4F25A 1AZSB 2BKPA 4RNMA 1F2GA 4Y00A 5D8HB 2O5DA 1RCOB 2NXJA 1XMQF 1M0SA 2ABYA 4H4MB 4ITSA 3ZFVA 2J8AA 3ENVA 5EX0A 4FF3A 2QL5B 3KK2B 3D6HB 1TR0A 3M30B 1JLGA 1EJ7L 4F0KA 1FJCA 3DLHA 4A8SA 1KLMB 2Y1IA 4WXWA 4C3KA 3S6EA 2W7PA 5ETKA 3HZGA 2BQRA 1VISA 5ETLA 4J9VA 5D4NA 1VIOA 1GT8A 3UR3C 1VQLS 4DUYF 2P6TA 1PYSB 3BR9A 1U24A 2KG1A 4B9VA 4GO5X 3I82A 3M9MB 2ZC3A 2H1YA 3A4TA 3MECB 2V69A 2BYCA 2D9PA 4D3HA 1N5VA 2HHHF 3R5CA 3K59A 2DR5A 4F50A 4UY8T 4J91A 5DZ6A 4ERDA 5IFMA 5CYQB 4CTAA 2LU2A 2DBBA 4LUBA 2KH9A 5DG7A 1U8WA 2BJ3A 1O8BA 2M3DA 2LYVA 5EHHA 4MTPA 4OZLA 4FF1A 3J81U 3IRWP 2QJ3A 4V1Ak 3QJLA 5KT2A 2WONB 4MYTA 4ID8A 4P52A 2BJ7A 2JLEA 2R8KA 3BH6B 4ED3A 2KO1A 4LQ9A 3D1HA 2CJ9A 2VQEJ 2QLBB 3H42A 2EFVA 4X65J 1JLCA 2NSCA 3H4BA 3MEKA 3P8BB 3H20A 1W7WA 4ELVA 5B08A 3WC0A 2XCAA 1Y5NB 2H9ZA 2DNLA 1WOSA 4KAIA 4M5IA 3IR6B 2HHSA 4DX6A 2R2UA 3EE3A 1KVKA 1S0NA 2QL7B 5J2PA 3HHLC 1XNRF 2DH8A 3RAXA 3QO9A 4DN0A 2B8QA 4FS1A 4PEOA 3M2VB 4GMKA 4LRAA 4QYRA 4PXCA 4GVBB 5LSRA 1B0PA 4ZVUB 2XI3A 2MQPA 2N3LA 2VFVA 4KY3A 2E9RX 4K5RA 3U1MA 5T41A 2XEXA 3TUPA 1LNQA 1YGYA 5HVFA 3CJSA 5T14A 2XNRA 3DU6A 3R2DJ 3Q8UA 3QAEA 3UWTA 1JLGB 5LMUF 4OI6A 2YWKA 2GMHA 1FNMA 3TA1A 4PR6A 4NL5A 1V3ZA 1PILA 4H4OA 4DR2F 4NA1A 3MEGA 4USTA 1V3RA 2VQFF 2HS4A 3PEHA 4UOCA 4DDFA 2GVDA 3MM8A 5HN0A 4G65A 1U6BA 3Q8SB 3NWRA 1NK4A 4IRCA 3P3DA 5HP1A 2CQIA 3B4DA 3MAQA 2K8GA 4KPCA 5AE3A 5KFBA 3CJ5A 1WC3A 3QT5A 5AT1B 4CLTA 4ECQA 2JL9A 4QW8A 3PYGA 5LSLA 3KHLA 4IH5A 1FDNA 3PR5B 5KFJA 3T5HA 4F2RA 4F67A 3JTOA 4K4VA 2HHQA 1WF0A 1HPZA 4AFFA 4A46A 4OZ5A 1EZZB 1HWIA 4M5KA 4TU7A 4M5NA 4X64J 4M5GA 2I1RA 4BLGA 5K8MA 4YEAA 1Y7PA 1SQEA 2QMXA 2IM3A 1KQKA 2VOPA 4G1IA 1IM6A 5GADI 4P72A 2ZVSA 1FEEA 2KVQE 5LXYA 2KXNB 4TYBA 1JLCB 2XMKA 5KT3A 4J9KA 3FZ2A 3AOCA 1NJYA 4ZVOB 2HVIA 2XZTB 4NEYA 3BO4A 1CS4A 1C1BA 4OJHA 5FLXU 2NXNA 3PFOA 3ZTOA 4HYKA 4QIGA 5GAGI 1HI1A 4IO1A 1RKJA 3NBPA 2Z0GA 5J2PB 2K06A 2U1AA 4IQMA 1M90T 3QO9B 4DR6J 2LXFA 3OTDA 2V94A 3TNVA 4NLTA 2HG4A 1X5TA 3HJVA 1H3DA 4CP5A 1LXNA 4L73A 2B7CB 3H40A 1URRA 4C4WA 4IO9Q 3VCDA 1C4AA 1G1XA 2ADBA 1PCAA 4CH0S 1TKZA 2X7IA 3PNIA 2BJ8A 4F02A 3DRRA 4YR0A 5I3PA 1OO0B 2PIIA 1HD1A 3FZBA 1LW2A 3FSYA 4H4OB 2DNGA 4IDKA 3MEGB 4DOZA 3UNYA 1Y3KA 3DKDA 3OLBA 4B9MA 4DFJA 1XMOJ 5HAOA 5I3UA 2GVDB 3MM8B 2K7KA 3BYRA 5KT7A 2YTCA 4KFBB 4ZPTR 2HQIA 2I2YA 2VG5A 5HP1B 2CA9A 3HCXA 3JTNA 4M5HA 1RUSA 1Q53A 4YDXA 1SVDA 3IM9A 1SL0A 1RT5A 2ZFHA 3RW7A 3J80U 3PJWA 1YWXA 3QSYB 2ALYB 5DDRC 1HPZB 2ASYA 2RMLA 2E5LJ 4U67Q 3LOUA 2XBPA 3MI7X 5E3AA 2WBMA 1RT1B 1RP5A 4AE5A 3TW0A 1Z4UA 1ZS6A 1DFDA 2JSXA 4I69A 3RTVA 1WOOA 2LLZA 4JBCA 1BQXA 3JAMY 1IBMF 5KG2A 2NR0A 3PYFA 1OSCA 4N41A 2IJNA 1UVMA 4JV2A 3MHYA 4FXWA 4CRJA 1QTNB 4N47A 1NKEA 4L72B 3GYXB 5CAAA 1K9MT 2XG8A 3MR3A 5K8OA 1P1TA 4UT4A 1SJQA 3CJ3A 1HBNA 1HNZJ 3OSNA 1CLFA 1CS4B 2R7VA 2R8IA 3BGOP 2N82B 4A8OA 2M2BA 1C1BB 3LP2A 1VQ4S 2Z2YB 1WKLA 1G3OA 4DL2A 3OL9A 4KTQA 1RCXB 2C3YA 3CJ2A 3NBPB 1GFWB 1T05A 5DM7Q 4PUOA 3UD5A 1HNVA 2HHPA 2CZVC 2VPZB 4R0EA 2J8SA 4DXLA 2BUNA 4HEA9 4B9SA 2OPRA 3W7BA 3BH7B 3V6KA 3M8RA 2LXIA 4AT1B 3KHRA 2YKPA 1D8YA 2DXFA 4C8MA 4WE1A 1JLQA 4WFXA 4CDIA 1R6YA 1TKZB 3JSBA 3GR1A 5JJBA 5DRKA 3DRRB 1LFPA 3DHXA 2FYXA 2FHOB 4J5OA 1LW2B 1U02A 4R0JA 1H2UX 4EU0A 1PGZA 4NRTA 2Z30B 1B7YB 3LAKA 1GXUA 1S9GA 2RB7A 2XS5A 2R3VA 2BRLA 5D78A 5I3UB 2DEIA 2VG5B 5B0AA 1J2VA 2J76E 1YQHA 2U2FA 2QTWA 4HI2A 5GAEI 3Q8VA 4CCHA 3VGSA 2FIUA 3ZTRA 2H5JB 4FN5A 2DT9A 3M8QA 4C3LA 1EX8A 2WVDA 1RT5B 5HK4A 1VQ9S 3H7HB 5BR8F 2GMJA 4IRKA 3WX4A 1SJ3P 5L9NA 3CCES 3GFXA 4K4XA 3AXKA 1HYSA 3FBEA 2HFVA 4F4WA 4QIEA 2W4DA 2WHOA 1VC0A 1H0HB 3T1HJ 4WFYA 3IG1B 2LMIA 2RH3A 3QQCD 5B0CA 2UUBJ 4DHVA 2QYGA 2XGQA 1X5SA 4DV6J 5AE2A 3N9UC 3FCVA 4C8YA 1SXLA 1SB6A 4DG1A 4DCOB 4DR5J 1QDUB 1HBNB 3ZTSA 4LIRA 1FD2A 5HATA 2V2ZA 1YZ7A 3LP2B 2LFVA 3A8JA 3GSDA 4MKAA 5EUHA 4ES1A 1KOOA 5SUHA 3ZZUA 4WP9A 1CG2A 4DJBA 4QWBA 1T05B 4PUOB 1Q16B 1HNVB 4DR3J 4AXIA 5HI7A 1EAYC 1UEVA 3KUEA 2ZE2A 2PMZD 3VZIA 1H7XA 3PYEA 5KG5A 3PW4A 1T8EA 1R8PA 4ZA1A 1S0OA 3PO4A 1BLUA 2C1EB 1ZA2B 4OYAA 4PG7A 4ETXA 2MKCA 1HR0J 3EM1A 2CYYA 1AT1B 3AY0A 2ZKTA 3D1OA 1T94A 4YP3A 4CNZA 1KTQA 3NNAA 4JI5J 3CMQA 1JLQB 3RBXA 4Y2CA 3LWMA 4QR1A 2QT7A 3WC2A 1NSPA 3T3FA 5KFLA 4DL6A 1IWGA 4B3SJ 3TWZA 1T0TV 3KJVA 3UFCX 1UJ5A 2J7KA 2A6MA 1KD1T 1S9GB 3TJ8A 4N8NA 1TQLA 1S4EA 4A48A 3EUNA 1I3OB 3RR7A 2J6TA 4TNOA 3V2UC 1HWUA 4ZCKA 4ECVA 1UFLA 4IG0A 4K4SA 2DRDA 4DQRA 1R7IA 4YFUA 2FC9A 4ILRA 3S7RA 2VQEF 2ZH8A 4X65F 2BANA 3HHDA 4DQIA 2BE2B 3M8QB 5CA5A 5L38A 4RX6A 2R7TA 4RW4A 1F6TA 2UVVA 1Q5YA 5J2QA 2JLGA 3VGTA 3TR5A 1ZM9A 4I6WA 1TTHB 1HYSB 1RADB 5KFKA 4HL9A 1YZ6A 3AA8A 2AJ2A 4DS5A 3IR7B 3IP0A 1RT3A 4ECSA 2EWHA 4ZN3A 1LV5A 3DMJA 3FDSA 1NK8A 1B0VA 2J0QD 2E29A 2F4VJ 4FZVA 3M8YA 1S12A 4QYZK 3V4IA 3H5XA 3OQ2A 1RDRA 1FO1A 4DG1B 3UD3P 2N4CA 1FF2A 3BV8A 2KHDA 3QRPA 2ADCA 1N36J 2W2MP 2ZH3A 1KQGB 1FD8A 5E5NA 2JEJA 3K8WA 4Y2AA 1NSQA 2DNMA 5AXMA 3SI8A 3I55S 1HD0A 1Q86T 2AYEA 3ZZYA 1S10A 1F3FA 2OPPA 4EI2A 4KB7A 3C6UA 2CJYB 2ASDA 1HW8A 2UUWA 1J5EJ 1AUDA 2ZE2B 3W3SA 5KFQA 3Q8RB 4LF4J 2HAIA 3OHBA 1TMJA 3BKFA 5KFFA 2R9LA 2POKA 3Q2SC 4C6AA 3AB2B 2IPOB 3VAFA 3OL7A 1T95A 5KFAA 1PG5B 1ULRA 4O3NA 3PVXA 3EWGA 1N88A 3B4MA 4IRDA 2AT1B 4DV2J 3DOKA 5DDQC 3N6MA 3KJVB 4X64F 2AEJA 3OL6A 2BKNA 1CJVA 2GZOA 4RWWA 3QMQA 4RBUA 1TKTA 3L4BC 3WQPA 1SC4B 4OYIA 3HT0A 2O01C 3D6TB 4DR1J 3M9OB 4UTGA 5D4LA 4IG0B 1XMBA 1UVIA 3T1YJ 1Q8BA 3AFGA 1VQ7S 1S76D 4RJVA 4LT6A 2V9WA 4R5PA 1EB0A 2BANB 3FRYA 1N5SA 2VICA 1PBUA 4WCEQ 4DL5A 4LBIA 4RW4B 1BMQB 4B08A 3NMAA 1RT7A 3BKTA 5J2QB 1RTJA 4YDDB 2BJ9A 4URQU 2KKHA 2EI5A 4ZDNA 5IT4A 4E0DA 1U4BA 1FJGJ 5F0UA 4CNYA 4N8OA 4DR6F 1U1LA 1RT3B 2BJEA 2G0JA 3EVMA 3HKWA 5A2QU 3DMJB 1XWLA 2FHMA 5C5JA 5ETQA 2IM0A 2F8HA 1VMBA 2UUTA 3LALA 1BWVA 3TARA 5A8KB 3V4IB 3SEOA 3CVKA 2QG9B 2D3ZA 2FVRA 3FSXA 4U7UD 3MF5A 3BKUA 3Q0AA 3GG1A 4JV1A 3O44A 5A6PA 1RAEB 4RUAA 1UVKA 2NQPA 1P27B 2PSZA 2CQ1A 4FYDA 2I9SA 1VC5A 1UMJA 7FDRA 3TAQA 2WAQD 3OXGA 1U1KA 2IBOA 3W8GA 2GIRA 2M0GB 1FXLA 1RLDA 1YBUA 2IC3A 3W2VA 3DLJA 2OPPB 4B9LA 4RNHA 4DL7A 2C2OB 7FD1A 2ZH2A 3LP1A 2E9ZA 1UW4A 3U7JA 3GV5B 2ZKUA 3W5XA 4USVA 2B7BB 2IIHA 1QJHA 2JEFA 2MPUA 3KFWX 1DHMA 1TUVA 2L9DA 1EKSA 2DXDA 2Z8QA 3R7NB 2HQDA 3DYAB 1VRTA 1DURA 1ELOA 4ES3A 1XQIA 1NAQA 2G1HA 3GYGA 3MOZA 1X60A 1IKYA 1E6VA 4WU3A 4NYOA 3C8YA 5DDPC 3FEXB 5HSPA 3DOKB 3IGVA 1GEHA 1SC6A 4OZNA 3S1TA 1RAGB 3NAIA 4XDCA 3NCRA 2E5LF 1O5JA 1TL4A 2Z57B 4ZN1A 5KFSA 2B51A 3HHLA 1FKAF 3SFUA 1UZHA 2CNKB 1PIEA 1TKTB 1TU0B 4DBQA 2KFYA 4EO6A 1SH0A 2DEJA 2AGOA 1KQSR 2EG2A 1JJ4A 1WWHA 1ZTWA 2DNNA 2XNQA 2XWXA 1QUVA 4R5PB 3I4HX 4CYUA 4YHHJ 1HNZF 3I4PA 3MPUB 1R8AA 1MROA 5L1LA 1RT7B 1R3NA 1N34J 1RTJB 2VODA 2H3EB 1MMDA 5A8WA 3OVAA 4YOEA 3AD7C 3M8SA 1NNDA 2BKOA 4ZP9A 4W92B 4DL3A 4ZP8A 4WU2A 2AYGA 1U8SA 3BZQA 3PHEA 4X2BA 5KFMA 1NPKA 3NLCA 3K0JA 1PYOB 4ZOSA 3NXZA 3QRRA 5LL6d 4AD6A 4CLFA 2XMVA 3KG4A 4YB7A 5A76A 1DTTA 1NZ8A 2GMLA 4WBFA 2CQ3A 5HJYA 4LFCJ 2BJDA 2BXJA 2DHAA 1X4FA 3THPA 1H73A 4XPEA 1C0UA 1DZ5A 5KT6A 2KXHA 1VBKA 2ZC4A 4ZPCA 2IC3B 1U1MA 2A10A 3W2VB 3G8QA 3QFHA 3W63A 1ZETA 3THVA 4OHYA 2GJIA 1AA1B 2KYXA 4ID5A 3LP1B 3LUYA 2HK3A 5HO4A 2CWKA 3FJ2A 3G8SA 2CPHA 2ZDPA 2DITA 3P6YC 3PW7A 3ILLA 2V34A 3R27A 4X4TA 1T03A 1KS2A 4JI7J 3RU0A 1IKYB 1E6VB 1DARA 2C2KB 3UR0A 4KBIA 5A8RA 4WWSA 4P2XA 3KLHA 4NXNF 3CSKA 2HQCA 2MLYA 1CEZA 1HHTP 4LR8A 3OW2R 4I2QA 2R8GA 3HHLB 3P5TL 2HFZA 5CCLA 2PI4A 2VH7A 2XHCA 2XWYA 1FNXH 1MU2A 1T3OA 3Q8QB 2UUBF 4OZJA 5IT9Y 4LVNP 4DV6F 2QFIA 4ETZA 1YI2S 2HHUA 3O1LA 1OY8A 4KO0A 2MHEA 2IAJA 2ZVIA 1RSCA 4QCLA 2GIFA 1WG1A 5IQ6A 2YX7A 3QGIA 4CYUB 3O6QA 5KFVA 5F9LA 3JQMA 2FVSA 4QPXA 3SFGA 1MROB 4O3SA 5ETNA 3DHWC 2PFFB 5A8WB 1IBCB 2W9BB 1SJ1A 4V19J 2IJRA 1MMNA 2XCPA 4DR3F 1D9AA 2ZWPA 3GFYA 2DNHA 3VVTA 2NREA 2OEJA 5F3TA 2DHXA 3MOJB 2KVIA 2Z2LA 8RUCA 1U1NA 4KHPJ 4MIBA 3TVZA 4ZHRA 2AYBA 1JB0C 1YHQS 4F4KA 1HR0F 2HWHA 1VQNS 2IYIA 1DTTB 3T41A 2V0NA 1WSVA 5DM6Q 2EFOA 2FQQB 4NLVA 3FVYA 4JI5F 3SQOP 4K4YA 1C0UB 4QR0A 2ZBRA 5HLFA 1NJZA 3PR4A 1N0VC 2B9WA 5B0EA 4B3SF 4A4JA 5LM7E 5F8HA 2PDAA 1KLNA 5KOXA 1HLWA 2D74B 4URSA 3SYZA 5D0RA 1TAUA 3BN4A 2M5YA 4ID5B 2QC3A 1WHXA 2V2KA 1WNEA 2WCXA 2GHPA 2WW8A 2HAFA 1ZTTA 1Q81T 4WP3A 5KFHA 1U6ZA 2OI2A 2AJ1A 3HFZB 5J1EA 3W8PA 1SH3A 4OI2A 3SMZA 2Y1JA 1T03B 2RQKA 4CO3A 3QT6A 2A0FB 1FK9A 4ZJLA 4CLZA 1Q79A 5SZTA 3CEDA 1RXOB 5A8RB 4RPFA 5DGAA 1B99A 3OXLA 3ZNUA 4J9LA 3ISZA 2RDDA 3CD0A 3KLHB 1GQEA 1FJEB 1SJRA 3PXGa 1DQAA 4I2QB 1REVA 3TAPA 3CCSS 4P74A 2CWXA 1CQMA 3TI0A 3DGPA 3G71S 1NCLA 5HROA 3UNGC 1B7FA 4LJMA 1MU2B 2C2EA 2GIQA 1UJ4A 2ALZA 3W2WA 2R2RA 3BR8A 1WD6A 4MKBA 3H2UB 4FXDA 2QGFB 1RHJB 2F4VF 2FHJD 2K1RA 2DIVA 4C0OC 2DCLA 2ZHAA 4KO0B 1HL6A 1WI6A 2IAJB 4B9NA 1VQ6S 5EGYA 1GAOA 4NOHA 3CF5Q 2ATLA 5F3ZA 1SH2A 1N36F 2MKSA 3MR2A 4HTJA 2G9OA 4X4UA 2VJVA 1JWWA 2QIFA 1NDPA 2DHHA 2BX6A 3H4DA 4XPCA 1UEUA 4A8QA 2ZBIA 3TOQA 4LRFA 4J9NA 3MFHA 2DXEA 4KR0B 1J5EF 1D0EA 5L39A 3PTWA 3DXBA 4LF4F 2DGVA 1R0AA 2FVCA 4R25A 2E7VA 4DL0C 4ZHRB 1G6BA 3KMSA 3LA0A 1K1SA 5IV3A 4L74A 2YH0A 1SKWA 2V8PA 2EPIA 2UXDJ 4CT8A 1XN9A 4DV2F 5HLFB 3PW0A 2CQDA 1TELA 1CC7A 2LQ8A 4OL8A 3FQKA 3G6XA 3OJUA 4YR2A 2BA9A 4DLGA 3DGVA 3J81Y 1ACMB 3U1NA 1FTRA 3NL0A 3TYTA 1U09A 3G6YA 1WKJA 4DR1F 2W4CA 4ZCIA 2CPZA 5GAHI 2FJBB 3VV2B 3T1YF 3GIJA 1T02A 2DRBA 4F8RA 5J1EB 3G87A 2BOAA 2DNZA 4CLKA 3NGSA 3HD2A 1YSJA 2CQBA 4EGLA 2J7WA 1FK9B 2ZH7A 2YWFA 3FBBA 3GONA 3OFGA 3LGMA 3WIUA 3MXHP 4JI8J 2PO4A 1N5QA 1XERA 3D0GE 2OTLS 1CPZA 4UOGA 3OLAA 3BBFA 1NDKA 1REVB 1HNWJ 3FKBA 5KG4A 1FJGF 3DGPB 2LDIA 5HROB 4M5LA 3MUVP 4TY8A 3FFIA 3W2WB 4YB5A 2EKNA 4RNNA 2H65B 2HBYB 5E2QA 1HW9A 1ZBTA 2B5JA 2IHR1 1S6PA 1L3UA 4KGVB 2K1RB 5H9EK 2D1CA 4OZ1A 3BREA 3CPWR 2RVJA 1IWAA 3G6VA 2GQQA 2UUCF 3K5LA 3HLUA 3QIPA 4KSEB 1BUXA 4YY3J 3CCLS 4Z2XA 2IA0A 3E2EA 2PA8D 1JX4A 4Y34A 4EYIB 2PGCA 1F1BB 2OMOA 4OMFG 1A9NB 1NM2A 3KUGA 1SIWB 2X3GA 5IQQA 4BDPA 3SCKE 4FF2A 2UXCJ 4ZP6A 3I5BA 1Y10A 3PG9A 4CO4A 3GLJA 2HHXA 1R0AB 1YLXA 1IKXA 3C2PA 1C1CA 4URGA 4DV3J 2EBGA 4KHMA 1RBAA 1UZDA 1IM4A 3M8ZA 3QGPA 1N5YA 3W61A 4X4PA 1V6HA 1IJFB 2MGZA 2V4RA 5B0FA 1YTYA 2DGXA 1U47A 5HANA 3E8OA 2F8MA 2J6SA 5E3CA 4NLWA 1NJWA 3VZHA 4MT1A 1RT4A 1UL3A 1Y0HA 1S7IA 1FI4A 3T9NA 4OI4A 2HZAA 4WFZA 1RYRA 2QLFB 4HHUA 5KFNA 4RU2A 3NCPA 4RBVA 2BQ3A 2ZH9A 2YX1A 1F3VA 4RLEA 3J81j 3X1LB 1X8DA 5DETA 4Q8FA 2OIHA 2F7VA 2VIHA 2JFDA 4U7UK 2WSFC 3CO9A 2RSQA 3HHKA 4YHHF 3IRXA 3M7VA 4DPUA 5FLXY 3UO0A 5CZVA 1WEXA 1R0CB 3M8WA 1NLKL 1SUQA 4RW9A 1O6XA 2H48B 4DFMA 4TYAA 2VFUA 3F73A 5CHCB 4LF7J 5M2UA 4NCBA 3RJMB 2C22A 3KLGB 4RNFA 2B6AA 1XEZA 5JVHQ 4X66J 2F9DA 3FFIB 4TY8B 4A47A 4F4XA 5CABA 2MHNA 1UJ6A 1VBZA 4ZJOA 2CDQA 2CJXB 4DSKA 2B5JB 4ILMA 1S6PB 5KG3A 3QZ8A 5KT4A 3MPVA 3GWCA 3W9HA 4OZ3A 4LFCF 3NNCA 2B9EA 1DAXA 3H5UA 2XC9A 1DLOA 3OTOJ 3QIPB 3C6TA 4EYHB 2PMWA 4RO0A 5T7LA 2XLJA 3P49B 3PACA 2D3O1 4DR7J 2HW3A 2JWNA 2DNRA 4CLLA 1A6LA 2ZD1B 1F2HA 4ALZA 2O66A 2UVUA 1D09B 3BYPA 4UF4A 1RWMB 5IV4A 1X9SA 5IXUA 3PX4A 4LBPA 2IVMA 3R1LA 1VGYA 1CVJA 5D0EA 1EHWA 3GV8B 4NLYA 3UDEA 1IKXB 3ZZRA 1HWJA 1C1CB 1HIYA 3TZXA 4LF2A 2QA1A 3WZ0A 2DR9A 3J7ZT 3HHEA 5BJRA 1ZM4A 3CJ4A 4DF4A 1O51A 4JI7F 1NK6A 4B3OA 2LEAA 3MMAA 4DFKA 4ZVTB 2KT5A 3CC2S 1SKSA 3J80Y 2LEBA 1RWXB 4NLXA 2QSFA 2A3JA 1RT4B 1I1GA 2PT0A 4PWUA 4KQZA 5D0GA 2NYHA 4P71A 2EVZA 2CPJA 3GIKA 2Y8YA 3CD5A 5H9FK 1T3NA 4CM2A 3T6BA 3QGHA 2AHOB 4HDGA 1OQ3A 3KG0A 1KN6A 4USKA 3D54A 3R6LB 1N6QA 3JB9k 4MH8A 3VAGA 2C2MB 3SSSA 4EWTA 3CD6S 1RTIA 2QE5A 2ZOMA 4NCAA 3ENAA 4NXMJ 1U0HA 2QLWA 2V8GA 2Y9HA 2G0IA 3BPSP 4CO5A 3MM5A 5EN1A 3IGNA 2XB2D 4LF6J 3Q8PB 2OAUA 4KYZA 3IRXB 1ZAWA 3Q2TC 5JMNA 1Y00A 3I31A 3KG1A 4B17A 5C25A 4ED1A 2B4VA 4MFBA 4RW6A 2ACMA 4RW9B 1VYAA 2D7SA 2V8DA 3W60A 2ZNYA 1FFGB 2AYMA 2FLNA 4DWIA 4EMDA 2HRUA 1GMWD 4DSJA 4UOHA 1KBRA 1VJQA 3FQLA 2C2NA 1NXIA 2RU9A 3KYLA 4WZQA 2LQ9A 4P2MA 4Q7AA 1FXRA 3U27A 2RRAA 2DO4A 2VOOA 1XR5A 3A8IA 4QWAA 3CE8A 5K9FA 1L3KA 4OJ1A 1FDDA 3R8YA 3QLHA 3TUJC 4OZ0A 3BS9A 2WOMA 2ZM6J 5KFIA 2CQCA 1DLOB 4DQPA 4Y2KA 3C6TB 4MIWA 1M5PC 3TZZA 3KK3A 5T7LB 4YUDA 1YBTA 4WKRA 1WHVA 4HR2A 3JSRA 3V6JA 1HHQA 4NRUA 5GVQA 4BWJA 3CTRA 2WSEC 3DRYA 4OYBA 4OX9F 4M5JA 2VUGA 2HKEA 2X1BA 4DV1J 4ICLA 4HH0A 2RUGA 1RACB 5B0BA 1QVGR 3GPAA 3J7A1 2NUHA 3F56A 1CSJA 1W2IA 4BC9A 3UVJA 3A3OB 6FDRA 2CJQA 4B3OB 2M52A 3MMAB 3FC9A 2XLKA 4AL6A 1XNQJ 3HVAA 3AH6A 4TU8A 2AZ1A 4DF8A 2K2PA 4C9DA 1WJ9A 5ETVA 2BACA 1FCAA 1N32J 2HFOA 4KKOA 4J37A 1D3WA 1VQMS 1RI7A 4RUHA 2J0WA 3GJTB 4OZ2A 2E7XA 3U1LA 2V8VA 3VAHA 2Q43A 1RTIB 2ASJA 1CJUA 3FMWA 1U0HB 3S8SA 2EFNA 3QJPA 4TVAB 3MM5B 3H8YA 3AT1B 2YBVA 2CJAA 4C97A 2KI2A 1VQSA 4JUZA 3BQ1A 3BGRA 3QJJA 1UKUA 4W98A 2RAQA 5KOWA 4ZVQB 3CJ8A 4QU7A 4X4SA 1FX4A 3QWUA 2HHWA 4CO2A 9ATCB 4DV4J 1IVZA 2QMWA 3T19A 3W1YC 4U7CA 4GRSA 2KYZA 5KFPA 2MDAA 2DGSA 2IRXA 5D77A 1E6YA 1RB0A 1HMVA 2CQPA 5IZHA 2HMIA 2PI5A 1BWEA 3JSYA 5EX3A 1H6KX 2ZBCA 4AL5A 1X4CA 4A8KA 2XSFA 3AOAA 2AJFE 3AXMA 3MCOA 4P6QA 2LDYA 2CAJA 4P7TA 5L46A 1TKXA 3C46A 4EK2A 3OVBA 2AJ0A 1KOHA 4TU9A 4P2FA 1JK9B 2KZZA 3QLHB 2HLUA 2MZRA 3QYYA 2WOMB 5G0RA 3MTJA 3FBFA 3RZAA 3P96A 1Q4RA 3M4XA 2UXDF 1HA1A 2MJNA 3KK3B 2D41A 1UA0A 3KJNB 3ELHA 1RA6A 1JLFA 1WC1A 2HVDA 2OMLA 1U1PA 4NMLA 2GJFA 2W2PP 1VQYA 3P45B 3PKYA 4CWBA 3SQGA 2L9NA 2V63A 3N5FA 4C2MA 2N7CA 2JDJA 2YKMA 1VR6A 4QPTA 3A13A 1U6FA 3HSJA 1I94J 4ED0A 1ZAXA 4ECUA 1LWCB 2XZDB 2YY3A 3ZO7A 2ZH1A 3EICA 3GQCA 4QIVA 3UVJB 1I5OB 1J5OA 3TEGA 4IYQA 3PRVA 3FCHA 3KJFB 4JI8F 1NBEB 3DLLQ 4RBTA 2HQFA 4J7CA 2AWZA 2VFSA 4J9UE 1HNWF 4DX7A 4KKOB 3JYTA 4NYZA 2LP4A 2W2OP 1Q8IA 4ZIWA 3HXMA 2XY7A 4WIQA 3R3TA 3RB3A 2V5HG 3V81A 4X84A 1CJUB 3SDEA 1SKRA 1JXVA 1AUSL 3M9NB 1RAJA 4DU7A 5HMXA 2GO8A 4NE9C 2KN4A 3BGRB 3H59A 1NK7A 1FJ7A 3H25A 3FSIA 3OXFA 4C8KA 3LANA 4NLSA 4N77A 5CH7B 1NEEA 1LW0A 2GW8A 2Q1LA 1DQ9A 2DPIA 1KR4A 4NPOA 1RAOA 5CD4A 3CC4S 1E6YB 4RNOA 3VAJA 3D67A 1HI0P 2UXCF 2XO6A 1R6VA 4ZVHA 1VC6A 3A8EA 3NEKA 2ILZA 4DV3F 3D66A 1RBOB 1TKXB 1HBOA 3CJRA 3FUYA 4IOAQ 3CIZA 2CXEA 2IMOA 1NHVA 5HJXA 3QNWB 5G0RB 3PX0A 4X62J 2MSTA 2VD3A 4YMEA 4B3RJ 5F8MA 3TANA 2FDNA 1Q95G 4NLOA 1JLFB 5I4MA 3QPIA 4QZVB 4OYWA 1RT2A 4WYLA 3SQGB 1XR6A 2CPEA 1G2EA 1VRUA 3SCJE 4CM0A 4Y65A 3BO2A 2XMTA 2HS3A 3OFHA 2YKMB 3EZOA 2LU1A 4C3MA 4J9QA 4AQYF 1RE1B 2WVCA 4MKYA 3H2LA 2F1FA 3M32A 2HQ3A 1PAUB 1WUUA 2MKKA 1R43A 4X4VA 3M2RA 3GSIA 2RT3A 2H5EA 2CG4A 4CLYA 1V3SA 2FGCA 3NOCA 2ZJPQ 2CFXA 1VHFA 5B09A 1OSDA 4FNHA 4P9SA 3HI9A 2DTJA 2FZGB 4LF7F 4ZPDA 4A8XA 3JYTB 3HHNB 4IKAA 4YN3B 5E3PA 5IC4B 5A2QY 4X66F 1FTCA 3T1AA 4ZLPA 3V81B 3SDEB 1ZH5A 1YRUA 1R8CA 3OHAA 3KDOA 2HBZB 1OJ4A 3OTOF 3HKZD 2GHVC 1LW0B 4JV5J 3QRQA 4DR7F 1TKDA 2OPSA 1A0OB 2WBRA 2JOQA 2E44A 4Q44A 3D6MB 2W2NP 4OIXA 4CTAB 3G6ES 2IFXA 3ZZTA 3R5AA 1NRKA 3IC1A 4JI3F 1CQNA 3BEGB 2GCFA 1PAEX 3MMBA 3Q83A 1BQMA 2NLWA 4KC5A 3VALA 3J7AN 1HBOB 4LFAJ 4P73A 3TJ9A 1X4DA 1F0XA 3E01A 1NZAA 2AEMA 2MZSA 1LFWA 5IM0A 2NZCA 2FJWA 3GG0A 1B0TA 4DX5A 2E1MC 1RWVB 4USWA 4DZDA 4ZLNA 3O5TB 3NGRA 4Q0BA 1TVRA 4NLRA 3QAUA 3K7RA 1R89A 1RT2B 2ILYA 1FHTA 1EKRA 4CH1A 3CWJA 1FKPA 2QZ8A 3PX6A 3W64A 1VRUB 4WXOA 4CIOA 3IBFB 4EEYA 2WVFA 2RIJA 3SSQA 1FKOA 4ES2A 5F8IA 2AJ4A 3AQPA 1L3VA 3WBZA 3AQOA 2CADA 1A7GE 2E5JA 1I51B 4J9OA 4K8RA 4RZRA 3ZTPA 4Q2MA 4I56A 3M32B 4C98A 2IDEA 4A8MP 3M2RB 4WKYA 4PABA 4C8OA 3JTPA 3NGDA 4LF6F 1FDAA 1KSPA 3BBCA 5RUBA 1OY6A 4K59A 5C2GA 3MM7A 2KM8C 4X4OA 1T9VA 4P2SA 4O3RA 1U26A 3GE9A 2ZH6A 4LRCA 1F9HA 3OUYA 3EYZA 3UQSA 2HGMA 2NYIA 2BV3A 2UXBF 4PQUA 4PXEA 3NGUA 1TK8A 2FD2A 3AOBA 1LOUA 1K8AT 3EDRB 4DQSA 1J27A 3GP9A 2DPJA 4L3KA 2HNZA 3IBWA 3UE2A 3I5AA 1KVJA 3RBEA 4LF8J 3IAM9 2KDOA 3KLVA 4XK8C 3TP2A 1B4SA 3IFEA 1LQ9A 2OPSB 3PY8A 1QUPA 4B3TJ 2ZOGA 1X4AA 2ROPA 3GTYX 1OS5A 2M9KA 4MMOA 1RBLA 3BDPA 4OYMA 2UVWA 1LK5A 3CCQS 5D3GA 3LTOA 4DV1F 1SJFA 3W9JA 3ZZOA 3AA9A 2XZWA 3MMBB 3HVTA 1BQMB 2Z58B 2JLFA 2D3OR 5AXNA 1XBWA 2JRSA 2J0XA 4Y6IA 3M2UA 3H5YA 2QLJB 4DSEA 2JH3A 3E01B 1FFWB 5IM0B 1TAQA 2JEGA 4V19X 1XNQF 4FYVB 3TA2A 4PZVA 2PE8A 2DY9A 4G6VB 2J9EA 4YB6A 3OL8A 1FEHA 3HULA 1TVRB 1W26A 4I2PA 1FKPB 1MNEA 5K5MA 2M7SA 2P9GA 1FKOB 3HK2A 2AJQA 1JJCB 1U48A 2QYCA 4DV5J 1YRTA 2Y1RI 2IJFA 3ICLA 4HKQA 2HRTA 1FRXA 4O0IA 1KTVA 4KGMA 1Y4ZB 2F8EX 3MEEA 3MDFA 5KFGA 3VAKA 1S59A 2CVIA 2FJDB 4DV4F 3MM7B 2QMUB 3RRKA 3CCUS 2VBXA 2XMAA 2CNOB 2QSWA 2DR8A 1JIHA 1OYEA 5MAOA 3EZUA 5D4PA 2R2SA 4ZPVR 4F7VA 4I7FA 3OUYB 1VLYA 1HFEL 3AJ1A 1UFWA 4PQUB 4IDKB 4B3MJ 3EVOA 2PEHA 5KG1A 4PG8A 3ZZPA 1S6OA 1MWQA 1OY9A 4ZVGA 2OKQA 3UDVA 3L3CA 3DRPA 3V5RA 1TL1A 2B8PA 3JQJA 2HNZB 1FRJA 1N33J 1QVFR 2K3KA 5HVHA 2KFNA 3I9V9 3S01A 1S7HA 4TN2A 4GKJJ 4F2SA 2B3TB 1YJ9S 3B78A 1N8RT 2Y1LB 3MR7A 4AYBD 4OV1A 3NY0A 4OLPA 3SXLA 3MM6A 4UW2A 2AEFA 1NSAA 4NLGA 4FYXB 3G9CA 1GX6A 4UOFA 1VBYA 2DH9A 1RWOB 3IS9A 1U1QA 2GGPA 1MW7A 4HVZA 5D3GB 2M4MA 1C0TA 2RHQB 2X3DA 3HVTB 2MXYA 3KTQA 3PDNA 1I94F 3GJSB 3D68A 4I68A 2RRNA 4TLQA 1D8ZA 2CKWA 5HMYA 2DD8S 2LECA 3PJ9A 3RW6A 3M2UB 4OYPA 1MWZA 1YX2A 3HFVA 1FE4A 4OHWA 1T11A 1SC3B 5ITHA 2FHKA 5KFUA 4KGXB 4K50A 3LWLA 3ETMA 3K89A 2MZTA 4BWMA 4QW9A 3BJYA 3SSRA 1VI7A 1SV5A 1EP4A 1XIQA 2W9CA 1S0MA 4QWCA 4RUCA 1FX2A 1Y11A 4Y2MA 3CJKA 4HACA 4GC7A 3N5BA 4U9RA 2GA7A 2MQQA 1YIJS 4DV7J 3RB4A 4IQXA 1P9YA 1AXQA 3AD9C 4XDDA 1VQKS 4DFPA 2E1AA 2OPRB 1GH8A 1NMEB 5IT9U 2NSBA 2C3MA 4Q43A 4ER8A 3MEEB 4JI4J 3QT8A 1CJKA 4WK3A 2EKYA 2E5HA 5IT0A 2XHWA 3ZTQA 3ZZ0A 1X4EA 4WE1B 3CXCR 1FA0A 3TA0A 3K5PA 2O3DA 4J9PA 1VFJA 3BSNA 2F9JA 1YDLA 4TKTA 4I7FB 4BS2A 2XMJA 1WTFA 2CQGA 5CQGA 3I0SA 4Z7CA 3HO1A 2AIRB 2IRUA 3MEDA 3RAQA 3MUTP 5L1JA 2H51B 3L7UA 1ROFA 1S9EA 1UVLA 2FVPA 2DGQA 2JC1A 2KRRA 3EMTA 4K4ZA 4OJGA 3G96A 3BQ0A 3K57A 2DNQA 3BDEA 4K4UA 1TL1B 3Q86A 4AL7A 3HT3A 5CCMA 3N6NA 2YWWA 1NB2A 4X62F 1YJ7A 1FVQA 2WTFA 1H2VZ 4Y2IA 2YKAA 4NLPA 2HYIB 4QU6A 1KHVA 3CW2C 5DLFA 1L3TA 3HDSA 2MKIA 3M6UA 3MM6B 4O23A 3U02A 4I0WA 2QA2A 4WK1A 4I6AA 4ECWA 3BSOA 2CJKA 3IS9B 2XMWA 1QSYA 2ZBQA 2GGPB 1FRHA 2JVOA 2AV5A 2G4BA 4YS2A 1C0TB 3JSMA 2ACYA 3M1VA 2NPFA 2VASA 4QWDA 2FLPA 1WOPA 2K3IA 3RBDA 4XTTA 1JXLA 4HT7A 3G8TA 1WC0A 4ZMMA 3D28A 2DJWA 2R7OA 3NAHA 2RF2A 3T5JA 1PJ5A 2ROEA 5EWEA 2W9AA 1FE0A 2OPQA 2E9TA 2OD6A 3CMES 5GADU 1EP4B 3MAAA 4O3PA 2W9CB 4L3NA 2CPXA 1TZ0A 3CJKB 2EEYA 4HACB 4DSLA 3F44A 2Z56B 1UWAA 3D1QA 4OLOA 1KFSA 4PPZA 5AXKA 3Q8YA 2P2CB 2C3OA 1MN7A 3PKMA 3K17A 3OFEA 4U96A 1ZZNA 2C2RA 4ANCA 4UQGA 2IDLA 4GC6A 3PRBA 5GAGU 4OI0A 1NH7A 4WZMA 2FJEB 3IMQJ 3BSCA 1NU4A 2OO4A 2VKZG 1CJKB 2FHJA 2YWHA 2BABA 3POTA 4OQJA 2D3UA 3KWMA 2NXEA 2AKWB 4JV5F 4YQWA 5C24A 1M5KC 1VIXA 2ZWOA 1GTHA 2CNNB 2V50A 2VBZA 2WK4A 3I0SB 3ZZZA 1WACA 2VPXB 3JQKA 1CJTA 4H4KC 5B0DA 3MEDB 4ANDA 2XYGB 1S9EB 5DQHA 3IXQA 3ETOA 2DK2A 3CD7A 2YKQA 3P4UB 1FWLA 3MR6A 2DB1A 3AJ2A 2RILA 1X4HA 4DU8A 4LFAF 1WSRA 2R7SA 4PWWA 1SI9A 3H98A 4FKYA 1Z2ZA 2ZJQQ 2ZZTA 3HVRA 4WFNQ 1RU2A 1RWWB 3CDEA 2AGQA 4QBUA 2YKOA 1PC4A 2OJ3A 4PCQA 4NWBA 3VAMA 3DU5A 5KG0A 4EO8A 3KXDA 3VTIA 3US5A 2QEXS 1PYTA 5K20B 5CYJA 1YJUA 1ZAVA 1TK5A 3JSMB 4C8NA 3M1VB 3OR1A 1NHUA 3W62A 1OQ6A 2G13A 1N48A 2W8KA 3UN3A 4HTIA 2FY8A 5DG8A 1T9TA 4I1TA 2RF2B 3CDAA 4LVOP 2HBRB 2RUSA 4LMZA 3IWLA 1YKWA 1KP6A 2OPQB 3ZXWA 1AROP 5H9EJ 8ATCB 3N79A 2YNGA 5FDLA 3MAAB 3UDLA 5HQMA 4F3QA 2YQ1A 3CNQP 2UUAJ 2E7WA 1QSSA 2XTJP 3DDNA 4JI0J 1TL7A 2EFQA 5D0HA 1V5IB 2ERRA 3C6UB 1EQMA 1XMOF 3NG8A 5HBMA 1T7PA 5BYRA 3BB5A 3BN7A 3NNHA 4Y3CA 1YJRA 1S1VA 2FLLA 2LQBA 4F0MA 4L6V3 4PQAA 3NP5A 3LGNA 1RK8A 4MK9A 4KH0B 1RHUB 4LF8F 1KFDA 1B70B 3POTB 1S1UA 4LBHA 4K2JA 1L5UA 2YQ0A 5C24B 4B3TF 4O3QA 4PRFA 1OYDA 1UA1A 3N28A 2E1CA 1YK9A 1N0UA 1JNZB 3C15A 4QIFA 1CJTB 1CJVB 5F8JA 4G1QA 1UEKA 2M70A 2YPYA 2VC1A 4NYPA 4DV0J 2RJZA 4ZVFA 3DOMA 1C4CA 4KFBA 1U25A 3N0VA 3RBZA 1HARA 1RAFB 1UVNA 4DPOA 3W9IA 5J2NA 1T9UA 3EXYA 2W01A 3BPDA 2OP5A 4IOCQ 1H72C 3TX0A 3OD2A 5DQIA 4YR3A 3WX8A 1Q7LB 2VFRA 3OTCA 2XY6A 2LCWA 4IFYA 5F8GA 1HQUA 5DGBA 2YQ3A 5GAEU 1RT1A 1VK8A 5L8RC 1RHKB 4C0HA 2XGPA 1IJEB 3P5BP 3T9ZA 1FRKA 1NDCA 4B9TA 3OR1B 2JJ4D 4DV5F 2IRYA 3MPWA 5EWFA 2B4UA 1WF1A 2OD4A 2OELA 3V6DA 2Z2MA 5C42A 5C7PA 5U47A 4FNIA 1TUWA 4E2FB 3N6LA 2G1DA 5E0OA 4KT0C 2GV1A 1L3SA 4H54A 1RA7A 2YNGB 5FDLB 4NA2A 1N54B 1ZM2A 3FEZA 2A1BA 2WB1D 1MG7A 3CT9A 1TL7B 4B3MF 2JVRA 1S97A 1KNZA 3VVUA 5HBMB 4ECTA 4FS2A 2P8IA 2FTRA 1S9FA 3NS7B 4K0KJ 1AFIA 4P7VA 3LPEA 1S1VB 4Q5VA 3PIPQ 1IN0A 1N33F 3CCVS 1XTZA 2WZ1A 2ZDOA 1IR1A 3OR2A 1VRTB 2HSEB 4ECXA 2VZ9A 2BEFA 2DGUA 4FBUA 4GKJF 3GCXP 2E5IA 1S1UB 2CQ0A 1FERA 2HWIA 4F3OA 5ETPA 4NCGA 4UZBA 2DCUB 3T6JA 2HEKA 4QQBA 2ATCB 2C2DA 4ECZA 3C15B 2R42A 4JP8A 3CUNA 1SQGA 4JYAJ 3IA0A 3DI6A 2MJUA 4J9SA 3T1HF 4G1QB 3CDUA 5DS7A 1G7CB 5FD1A 2YX4A 4USUA 3ONQA 3D7SB 3TO8A 3DCAA 2A2CA 3PHTA 5K14A 1D9DA 5H9FJ 3RR8A 3DOMB 2JFKA 4N7TA 3CJ0A 1U7LA 4NEZA 5J2NB 3M8PA 4Z37A 2HGLA 3CO0P 5KT5A 3EDQB 1BD6A 5DG9A 4DR5F 3BF4A 4N56A 2XYHB 4DMZA 3GB0A 1RQ0A 5L9XA 4IFYB 1WHWA 4ILLA 3UN5A 3VQTA 2Q6BA 1HQUB 5DJBA 1X9MA 4NA3A 4HDHA 2CQHA 4PG4A 2GS8A 1RGVA 3CJQA 3DLEA 1LWEA 4DV7F 3L7OA 1IQTA 3IG1A 3CC7S 2EFPA 2N3OA 3T5KA 2KJVA 2V8HA 5I42A 4DI6A 3V6DB 2HHVA 3W5ZA 5C42B 1FT8A 1N56A 5IC6B 3MD1A 4JI4F 4JI1J 4NLQA 1DRZA 3A3NB 3RAMA 2Y0SD 2QO3A 4N76A 2V2QA 1LWXA 1W2BR 4B9UA 3IWXA 4KV8A 2YKNA 2V2VA 1S1TA 4CH7A 4UZCA 1Q5VA 4LR7A 4TLRA 3H5SA 2L48A 4WIIA 2O1PA 1MWYA 1O0PA 2HFNA 1GMWA 2MEWA 1XJWB 1Z1ZA 4I6YA 2WSCC 2R8HA 1IKWA 1KC8T 3T5LA 3N01A 3OR2B 5L1KA 2AD9A 2CPYA 1CC8A 3DOLA 2L3MA 1VQ8S 4WPAA 3C16A 1K73T 1BE4A 2IM2A 1S48A 2EK1A 3GIIA 1VBXA 4NCGB 1BXNA 1WC6A 1GX5A 2NUUG 3GYNA 1NKCA 2K7JA 2VA3A 3MM9A 1FVSA 2DIUA 2OSQA 2HVEA 3DI6B 1WC4A 5E3RA 2VHGA 2W7AA 5KG7A 1T9XA 1YJNS 1NPPA 4OX7A 5D4OA 5K14B 2CPIA 2YNFA 2AGPA 3QT7A 2QL9B 4ELTA 3TX8A 4F36A 1HNIA 3M8PB 1ZM3A 3ET6A 2MKYA 2DY1A 4L75A 2MQLA 4F4ZA 2CZ9A 3RRGA 2RD5C 2KM8B 1QAIA 2BE2A 2H5IB 2YVSA 4IFVA 5IWAJ 2KXFA 4O4GA 4B02A 3PW5A 2I0XA 5E3QA 4NXNJ 2WVEA 4C11A 3QFWA 3ILIA 2FJAB 1CULA 3DLEB 2XMMA 3MUMP 1GXLA 1LWEB 4M63A 2VDIA 1T9YA 3RB6A 5KTQA 2RHSB 4Q8EA 1YVFA 4FVCA 2FLOA 3D2WA 3CJTA 1Q1KA 3DDKA 2DKOB 2R7QA 4HHHA 2WB4A 3H2VE 4RKUC 2B0GA 5I42B 2LKZA 2Z2ZA 2VDHA 3FK4A 5ADZA 1QY7A 1NO8A 4E8UA 3K2YA 3BQ2A 4P10A 3LGHA 2F4FA 1KDNA 4DN9A 1R0BG 2B4PA 2VG6A 2PEBA 3I96A 3IAS9 2PMHA 1UAWA 1C2PA 3PO5A 4OHXA 1SQFA 2HURA 3IO1A 3VHQA 3MMCA 3GU0A 4Q2LA 1BY9A 2CQ4A 3EJMA 3OFFA 4KV8B 2YKNB 1S1TB 1WKKA 5CZXA 2BW2A 2W1BA 2RDJA 4C48A 3CDWA 4FDFA 2QFJA 4DZ6A 4EBEA 1QD1A
chains in the Genus database with same CATH topology
2HBZB 3IBFB 1RWPB 2XZDB 1RWXB 3R7NB 2CJXB 2XYGB 1RE1B 4ZVOB 3D6FB 2XZTB 3GJQB 3P4UB 2H4YB 1I51B 3D6MB 1PAUB 4JB8B 2DKOB 2HBRB 1RHMB 1IBCB 2QL7B 4DCOB 2QLFB 1SC1B 3KJFB 2Y0BB 1QDUB 2C2KB 5IC6B 1I3OB 2Y1LB 3R6LB 1PYOB 3R7BB 3R5JB 3GJTB 1GFWB 2C2MB 4ZVSB 4ZVUB 2XYPB 1RWNB 1SC4B 2P2CB 2CNKB 1RWWB 3IBCB 2H5JB 2QL5B 1NMEB 2CDRB 1F9EB 1RWOB 3QNWB 4DCJB 3D6HB 1RWMB 2QL9B 3KJNB 2HBQB 2CNLB 2CNOB 5IC4B 2FQQB 3EDQB 3SIPB 2CJYB 2QLJB 3KJQB 3GJSB 3P45B 3R7SB 3GJRB 3NS7B 1RHRB 2XYHB 1RWVB 4LSZB 2C2OB 5K20B 4ZVPB 2H48B 2C1EB 2H5IB 4ZVRB 4ZVQB 1RWKB 2H54B 1RHUB 1RHQB 1BMQB 3EDRB 3RJMB 2QLBB 1RHKB 2H4WB 1RHJB 1SC3B 3R6GB 2H65B 1ICEB 4DCPB 2HBYB 2CNNB 2H51B 4ZVTB 2C2ZB 1QTNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBZ B;  3IBF B;  1RWP B;  2XZD B;  1RWX B;  3R7N B;  2CJX B;  2XYG B;  1RE1 B;  4ZVO B;  3D6F B;  2XZT B;  3GJQ B;  3P4U B;  2H4Y B;  1I51 B;  3D6M B;  1PAU B;  4JB8 B;  2DKO B;  2HBR B;  1RHM B;  1IBC B;  2QL7 B;  4DCO B;  2QLF B;  1SC1 B;  3KJF B;  2Y0B B;  1QDU B;  2C2K B;  5IC6 B;  1I3O B;  2Y1L B;  3R6L B;  1PYO B;  3R7B B;  3R5J B;  3GJT B;  1GFW B;  2C2M B;  4ZVS B;  4ZVU B;  2XYP B;  1RWN B;  1SC4 B;  2P2C B;  2CNK B;  1RWW B;  3IBC B;  2H5J B;  2QL5 B;  1NME B;  2CDR B;  1F9E B;  1RWO B;  3QNW B;  4DCJ B;  3D6H B;  1RWM B;  2QL9 B;  3KJN B;  2HBQ B;  2CNL B;  2CNO B;  5IC4 B;  2FQQ B;  3EDQ B;  3SIP B;  2CJY B;  2QLJ B;  3KJQ B;  3GJS B;  3P45 B;  3R7S B;  3GJR B;  3NS7 B;  1RHR B;  2XYH B;  1RWV B;  4LSZ B;  2C2O B;  5K20 B;  4ZVP B;  2H48 B;  2C1E B;  2H5I B;  4ZVR B;  4ZVQ B;  1RWK B;  2H54 B;  1RHU B;  1RHQ B;  1BMQ B;  3EDR B;  3RJM B;  2QLB B;  1RHK B;  2H4W B;  1RHJ B;  1SC3 B;  3R6G B;  2H65 B;  1ICE B;  4DCP B;  2HBY B;  2CNN B;  2H51 B;  4ZVT B;  2C2Z B;  1QTN B; 
#chains in the Genus database with same CATH topology
 1IKW B;  4PXB A;  3UD4 P;  2VU5 A;  2HIY A;  2F5G A;  4OI3 A;  4LRE A;  4RW8 A;  3DOL B;  4ED6 A;  4M5M A;  3IN5 A;  3IM8 A;  2XQC A;  3C16 B;  3GMG A;  2BE9 B;  1ZOT A;  5K8P A;  2APO A;  4JI2 J;  3K5M A;  1RLC L;  3QZ7 A;  3MM9 B;  2KT3 A;  4JI6 J;  2DRA A;  1M5H A;  5KFC A;  1ZZF A;  3D3B J;  5DDO C;  1WC5 A;  2QV6 A;  6AT1 B;  4RWX A;  4MKV A;  3UI3 A;  1OMS A;  3LQV A;  4OX8 A;  2FZC B;  5JUM A;  2IBK A;  2RRB A;  1WDT A;  3ULH A;  1QTM A;  2DNO A;  1Q78 A;  2YNF B;  2G2Z A;  4I4B A;  2VKR A;  1B64 A;  2FVQ A;  4W90 B;  3Q24 A;  8AT1 B;  4J9M A;  1HNI B;  4CQ1 A;  2V68 A;  3HD1 A;  3ET6 B;  4M95 A;  2B4O A;  3MWB A;  1UVJ A;  1VRQ C;  3VQS A;  4P75 A;  4IFV B;  1RJJ A;  2MY8 A;  5GME A;  4O4G B;  5JXS A;  5G4D A;  2B9Y A;  1HWL A;  2UUA F;  4C11 B;  4WYW A;  3D6F B;  2FJX A;  3PYD A;  3R9L A;  4ZLJ A;  1KVI A;  2VJU A;  2G2Y A;  1FNO A;  1CUL B;  4JI0 F;  4ZKA A;  2OUG A;  2Y0B B;  1NJI T;  3GFH A;  3C14 A;  3KUH A;  1RTZ A;  4LRB A;  3QAT A;  2V6A A;  3N4W A;  4ED2 A;  2VFT A;  1RWN B;  1ZPV A;  3DFE A;  1WG5 A;  2W4P A;  2I8E A;  2Q66 A;  3IBC B;  4X4Q A;  2L41 A;  2KZM A;  4K2X A;  5A8K A;  1F9E B;  3O8W A;  3K8V A;  2VG6 B;  3CCM S;  4DS4 A;  1F60 B;  1U49 A;  2M8H A;  3MMC B;  3I87 A;  2VON A;  2V4Q A;  4S0M A;  4IH6 A;  1DJ0 A;  2ZH5 A;  2OFH X;  3D5M A;  4ZP7 A;  3QSI A;  2HFU A;  2VF3 A;  2QN6 B;  4IG3 A;  4E98 A;  4USJ C;  2WVB A;  1KQF B;  1IXK A;  3ZC4 A;  1TMM A;  3LP0 A;  2YNH A;  4DV0 F;  1ZPW X;  2LXU A;  2JEI A;  3M6X A;  3MFI A;  1N52 B;  3HP6 A;  3UN2 A;  5EDW A;  2RU3 A;  3DYA A;  3O3L A;  4RW8 B;  1RTD A;  3GIM A;  3VWS A;  4DR4 J;  2BW7 A;  3D0I E;  3CCJ S;  1F5A A;  4PPD A;  2ZEJ A;  2MKH A;  2OSR A;  2IY5 B;  1N34 F;  3SV3 A;  4FP9 A;  2W2Q P;  2QRR A;  1VJW A;  2CPF A;  2WW4 A;  2J0S D;  3HX9 A;  2HBQ B;  1TFY A;  2W25 A;  2DHG A;  1H2T Z;  4U6P A;  2E1P A;  4X4N A;  4LSZ B;  1VQP S;  2OGU A;  1ZA1 B;  4OYO A;  1M5V C;  1S1W A;  4ZIV A;  3V6H A;  1NK9 A;  5THW A;  2C2Z B;  2EFG A;  3TJA A;  5J1P A;  2LEP A;  2XY5 A;  3ILO A;  2HS0 A;  2F65 A;  1GTE A;  5ETM A;  4PG5 A;  2QA4 S;  5ETT A;  2H4Y B;  2B9X A;  4H4K A;  3PJX A;  4DQQ A;  4HHJ A;  3MAH A;  1HNX J;  5B0G A;  3W65 A;  5J2M A;  3FGV A;  4KJI A;  3ENW A;  4Q45 A;  3C14 B;  4ZVE A;  2RS8 A;  3QGG A;  4TY9 A;  4EZ6 A;  4C8Z A;  4F04 B;  4K0K F;  1SKU B;  1SIZ A;  2I6W A;  2BE7 D;  1X5P A;  3MCN A;  1SBR A;  2OHD A;  2Q3P A;  1RAH B;  3MMJ A;  1N5Y B;  2GQ2 A;  3CCT A;  2X1F A;  1QLN A;  2ZNZ A;  5J1N A;  2GC8 A;  2MGZ B;  5IOL A;  1OPZ A;  4KPY A;  3BSA A;  4L76 A;  5DZ7 A;  1IKV A;  2UUC J;  3KLE A;  1JKH A;  1U2R A;  4NLU A;  4LF9 J;  4PYA A;  3KOA A;  2J9D E;  1RAA B;  1V5V A;  2UV8 G;  2DIS A;  1IBL J;  2H4W B;  2MLX A;  4IG3 B;  4JYA F;  2BM1 A;  2FJV A;  4EBC A;  4CZC A;  1IR2 A;  2B43 A;  4TQS A;  3BO3 A;  2R4F A;  3LP0 B;  2XSJ A;  3R1H A;  2ZZN A;  4LSN A;  2YNH B;  5LMN J;  3VAI A;  1URN A;  2R7U A;  4NZ6 A;  4DUZ J;  2UU9 J;  2YWG A;  1FRI A;  4C0B A;  4F26 A;  2M88 A;  3MR5 A;  9RUB A;  4UQT A;  3MZI A;  2FGO A;  2DNY A;  3PRD A;  1RTD B;  3SCL E;  3A8K A;  1SCJ B;  3ISN D;  2RQC A;  3EXC X;  3W66 A;  3I9Z A;  2XO7 A;  5L1I A;  1SUQ B;  5HL7 Q;  3AJD A;  4AUK A;  5KG6 A;  5AXL A;  1S57 A;  3TUI C;  4HH1 A;  2B6A B;  1ITP A;  3DRX A;  2ZUA A;  1HQE A;  2EC2 A;  5KFZ A;  4PG6 A;  5LSO A;  2A18 A;  2DYA A;  1R8H A;  4K7Q A;  3O2I A;  1HKA A;  1RZM A;  1P1L A;  4BHQ A;  1M1H A;  4IUF A;  4DCP B;  4KHP F;  2ZHO A;  2MMY A;  4M8L A;  1S72 S;  1S1W B;  4JI1 F;  1M5S A;  1TL3 A;  3UW1 A;  1AFJ A;  1X4G A;  3PW2 A;  3RGI A;  4GVL A;  2KFZ A;  1REG X;  2YH1 A;  1KON A;  1S49 A;  1EAR A;  1VLO A;  3HJF A;  3THT A;  5CXT A;  3KDN A;  3OSP A;  3C19 A;  2W9B A;  2DR6 A;  2HIQ A;  5M2P A;  2HZV A;  4ZCL A;  5J2M B;  4ED8 A;  1IQZ A;  4OHZ A;  3BGL A;  1R27 B;  2N7Y A;  1K0T A;  1YBA A;  4DEZ A;  4NI2 A;  3RB0 A;  4K5S A;  2VC0 A;  1EQ0 A;  2CUY A;  2WRM A;  5MLC V;  3UCG A;  5KFT A;  4KH1 B;  3EPG A;  3NCQ A;  1S6U A;  1IKV B;  1X7V A;  3KLE B;  1JKH B;  2XS7 A;  3ILJ A;  4MK8 A;  2E5G A;  4K4W A;  1WTB A;  4O44 A;  5F9N A;  3HVW A;  2A2D A;  2PC6 A;  1H74 A;  3MCM A;  5I3Q A;  4WFA Q;  4ATN A;  2BBE A;  5E7O B;  2ZZM A;  1Y9O A;  1FRL A;  1N6Q B;  3OVS A;  2DR7 A;  2G2O A;  2XSJ B;  4LSN B;  1U1R A;  3AHP A;  2OEM A;  3BGU A;  3J7Z 5;  2P9E A;  1P9Q C;  2YPZ A;  3EZ5 A;  4HT5 A;  3JAM U;  4USM A;  4KIA A;  4ANE A;  1GMU A;  4Z7Y A;  5IWA F;  1MN9 A;  3VF0 B;  4RR5 A;  3OTB A;  7AT1 B;  5A0Y A;  5C25 B;  3KLF A;  1JJ2 R;  5GAH U;  4C7Q A;  3DLK A;  2AX0 A;  3HFK A;  1DTQ A;  2W24 A;  4MFB B;  4RW6 B;  3M6V A;  5LJ3 Y;  3AB4 B;  3FNN A;  1RHQ B;  5E33 A;  3HF5 A;  1HQE B;  3WIV A;  5CD4 H;  1QAX A;  2ZUG A;  4LF5 J;  4EZ9 A;  3KK1 A;  1Z2L A;  1JJH A;  2X51 A;  1RWU A;  3K5O A;  5CYM A;  4EFA C;  4UUW A;  1TL3 B;  4LFB J;  3KHG A;  3H90 A;  2XM3 A;  4MAK A;  2GVZ A;  5LT5 A;  4CO0 A;  1K0V A;  3MD3 A;  5BXI A;  4RUB A;  1WF2 A;  3SZ2 A;  2J7U A;  2PD1 A;  1QSL A;  1X9W A;  1WG4 A;  5ETS A;  2MQM A;  2CVE A;  3DNC A;  2GAH C;  1SPB P;  1F5C A;  1RAI B;  5AJ3 J;  4NX9 A;  5HQ8 A;  1P8G A;  1DBD A;  3QBC A;  5BYS A;  4USH A;  4NI2 B;  3FRZ A;  4ICL B;  4ELU A;  2L08 A;  2P9C A;  2F3J A;  3EGZ A;  3MCS A;  3OT9 A;  3EGV A;  5ETR A;  1JXE A;  3PM9 A;  3PEJ A;  4C8L A;  3NMR A;  2O67 A;  1Q82 T;  1HWK A;  4Y28 C;  3CCW A;  4ED7 A;  4JI2 F;  1VCT A;  2F40 A;  2DNK A;  4LR9 A;  4O44 B;  4CO1 A;  1TL5 A;  3HZE A;  4NZ7 A;  4JI6 F;  1TV6 A;  4QOT A;  4GKK J;  3G82 A;  4MK7 A;  2JX2 A;  3GJQ B;  3LH2 S;  4LRD A;  1JNR B;  4CLW A;  4IOB A;  2RQM A;  1M1G A;  2CG8 A;  2ZIT A;  2HRY A;  3RRH A;  2AQ4 A;  1SJ4 P;  2N4D A;  4BC7 A;  2W8L A;  2P6S A;  4OX9 J;  1Y3J A;  1LWF A;  2OEK A;  1FES A;  5A6W A;  3R7B B;  4ZS6 A;  5HMW A;  2BQU A;  5DQG A;  2EW9 A;  2ASL A;  1QE1 A;  4WP8 A;  4OJ3 A;  4ECR A;  4OFZ A;  4OYX A;  4DSF A;  4AXJ A;  1NJX A;  1H98 A;  4F3M A;  3CB4 A;  2UVR A;  1G4C A;  5A0Y B;  3A12 A;  3ZNJ 1;  4YY3 F;  3KLF B;  2R2T A;  1F9F A;  3DLK B;  2LQ5 A;  1DTQ B;  1D1U A;  2E1R A;  4FVM A;  5GMK a;  2IVY A;  3UPF A;  3MPD A;  2R7X A;  1VDH A;  3EX7 B;  1WI8 A;  4PXD A;  4TQR A;  1HMV B;  2HMI B;  3G86 A;  4NAS A;  1RIS A;  4NMX A;  2GJ2 A;  2IVF B;  3TZY A;  3WHI A;  3VGU A;  3X3U A;  3KK1 B;  3KLI A;  2KTQ A;  5HMZ A;  2VL1 A;  3PZP A;  4DUT A;  3I0R A;  4O0N A;  5CYM B;  2C3P A;  2Q79 A;  2VG7 A;  3NWG A;  2GVZ B;  2FUG 9;  3TUZ C;  4I67 A;  2MZJ A;  3GIL A;  4GO7 X;  5K8N A;  4U8Y A;  3M6W A;  4FF4 A;  2ZBP A;  3GCW P;  1OIA A;  2DHS A;  5ETO A;  3OPK A;  3NOG A;  2HNY A;  2R7W A;  3TVK A;  4IR1 A;  1HBM A;  2BM0 A;  3TEH B;  5LXR A;  4PWD A;  2BZ2 A;  2ZJR Q;  4DSI A;  4A8W A;  1PO6 A;  4G3I A;  2MQ8 A;  4OI1 A;  1MML A;  3GJR B;  4KE5 A;  2YNI A;  1IUJ A;  2J5A A;  3FBC A;  4ZVP B;  2I5J A;  1TP7 A;  2KG0 A;  3DDI A;  2IMW P;  1GXT A;  2GQC A;  2HFS A;  4BBY A;  3AD8 C;  1ICE B;  5D6G A;  2Z4P A;  1NK5 A;  2JHE A;  4ZLL A;  2COL A;  1YJV A;  3D4J A;  1J5O B;  4DR4 F;  2OH2 A;  4DPX A;  4QIW D;  4JOU A;  1NB7 A;  1EIY B;  2UZA A;  1TFW A;  2V9K A;  1TV6 B;  2HVH A;  1RHM B;  4QYZ J;  3G82 B;  3HMJ G;  2Y8W A;  2XMU A;  2LA4 A;  2NPI A;  4K4T A;  4XIU A;  4W4M A;  2EG1 A;  3PIO Q;  1F5B A;  2AP6 A;  2MZQ A;  2HGN A;  2RNE A;  1U0S A;  1IBK J;  1LWF B;  2XYP B;  4Y0F A;  3FEY B;  3OTE A;  4FPI A;  4RL1 A;  2BDP A;  1QE1 B;  1YRX A;  5KAK A;  2GO9 A;  1DQ8 A;  1NPR A;  4DCJ B;  2M8D B;  2EK6 A;  2DH7 A;  1RU1 A;  2F63 A;  3RUB L;  3W5Y A;  4A8F A;  1FWP A;  3J7Y I;  3SIP B;  2KU7 A;  3KJQ B;  3KHH A;  4O4R A;  2JNJ A;  1XMQ J;  1TK0 A;  2HLT A;  4OHV A;  1HHS A;  5H1S V;  4M5D A;  1HQ2 A;  3TRG A;  4ZK7 M;  1RKI A;  4MJK A;  1GK8 A;  1PSD A;  5FJ4 A;  2KHC A;  2LVW A;  1FWK A;  5KFE A;  2VBW A;  2ZH4 A;  1HNX F;  1S77 D;  4ZIT A;  2PN6 A;  3KLG A;  1RT6 A;  5F8N A;  2CPD A;  1UPP A;  3KLI B;  4JB8 B;  2BOP A;  2DO0 A;  4IH7 A;  2C3U A;  3C66 A;  4DUY J;  3I0R B;  1Q8L A;  3ITH A;  3G2X A;  1TUG B;  1M5O C;  3CUL A;  3DLG A;  2VG7 B;  2DGW A;  1UET A;  1UW9 A;  4CLS A;  1NHK L;  5LJ5 Y;  1VK3 A;  5E41 A;  2D9O A;  3LAM A;  4LIW A;  2HHH J;  1S79 A;  1BQN A;  1XK8 A;  4LF9 F;  3HHL D;  2NCK L;  4UY8 5;  2RE1 A;  1AB8 A;  2FZK B;  1D9F A;  1QAY A;  3NGT A;  1IBL F;  2HNY B;  5F8L A;  1Q7Y T;  3LPY A;  2BJ1 A;  2ZD1 A;  1HBM B;  1YIT S;  2HND A;  4WTO B;  2R8J A;  1HI8 A;  4PWD B;  2OFG X;  2HQG A;  3OJS A;  3VR1 A;  1X5O A;  4R8U A;  3CCZ A;  1Y5I B;  3LW5 C;  1Y5L B;  5JVG Q;  2YNI B;  1SL2 A;  3EPI A;  2I5J B;  5LMN F;  1N5T A;  5B7W A;  4DUZ F;  2UU9 F;  4NXM F;  4FBT A;  2X1G A;  3DXS X;  2XS2 A;  1N4L A;  1KHW A;  1XC9 A;  1NH8 A;  1UWB A;  2MYF A;  1VQ5 S;  4D3G A;  3D3C J;  4DPT A;  1FDB A;  3CMA S;  3MGJ A;  3I56 S;  4KRW A;  2FY1 A;  3R2C J;  1H38 A;  2EXU A;  1S1X A;  3BGF A;  3D9B A;  2ZHB A;  1I6J A;  4M1K A;  3RYL A;  2CDR B;  1UP1 A;  3B82 A;  1XNR J;  2LQJ A;  2UP1 A;  2DVI A;  2CNL B;  4AQY J;  3F0N A;  3GV7 B;  3G4S S;  3UCZ P;  4F4Y A;  3R7S B;  1LK7 A;  4HI1 A;  3ADA C;  2X1A A;  1VS3 A;  1RTH A;  2QX0 A;  3TQ1 A;  2ZM6 F;  2AZ3 A;  1WOR A;  2V67 A;  2CIM A;  1UTA A;  4O3O A;  3OBI A;  2ZOF A;  2UV8 A;  3SBM A;  3R6G B;  5C2C A;  4M5D B;  2J6U A;  1U1O A;  4ED4 A;  3AOD A;  1NUE A;  5LMU J;  3CIM A;  2MKJ A;  2PA3 A;  2KL8 A;  2D69 A;  4WTY A;  4ZJQ A;  4ECY A;  3ISN C;  5KFY A;  4DR2 J;  1RT6 B;  2OLW A;  1NKB A;  1VQO S;  3HPO A;  4XAK A;  2VQF J;  3TVY A;  3MTK A;  1YG0 A;  1KKH A;  2BVZ A;  1CBK A;  3ITH B;  5HVG A;  1KWM A;  3CCR S;  3DLG B;  4EBD A;  2HK2 A;  2DGO A;  2HPU A;  2EC0 A;  3L7P A;  4WJB A;  3TAM A;  1BQN B;  3DC2 A;  2GNK A;  4Q0B B;  5DO2 A;  2VB6 A;  2IA6 A;  4ZPB A;  2HND B;  3KNA A;  2GX8 A;  2G0C A;  1N32 F;  3TZW A;  3SV4 A;  1NDL A;  2EBE A;  4KGK A;  3RG6 A;  4R8U B;  2JC0 A;  2FC8 A;  3QID A;  2E66 A;  2DGT A;  3UCU P;  4JI3 J;  2R7R A;  2HWT A;  2RS2 A;  1XR7 A;  3E3X A;  1S0V A;  2NXC A;  2C42 A;  2NS1 B;  2P5V A;  4FKX A;  4UUX A;  2XI2 A;  1OWX A;  1JLE A;  3EGN A;  3CGI A;  4WF9 Q;  1S6Q A;  2MSS A;  1KRP A;  4MIA A;  4FXV A;  1UWB B;  3R5G A;  5F0W A;  2VPW B;  1V9O A;  1PJ6 A;  2QA4 G;  4ED5 A;  1PKU A;  2YXL A;  1WHY A;  2BMB A;  1S1X B;  2NXU A;  3PFE A;  4RW7 A;  1Q0N A;  1PBA A;  4CLP A;  4LF5 F;  1X31 C;  1PC5 A;  3A3P B;  1WEL A;  2IYG A;  1WEY A;  1RWK B;  2H54 B;  2RKI A;  1X4B A;  2RDI A;  2Y3Y A;  4RU9 A;  1JLB A;  3B54 A;  3NKY A;  1RTH B;  4LFB F;  1IR0 A;  1X0P A;  3BBB A;  4FPR A;  5F41 A;  4PYD A;  1SL1 A;  1MLA A;  1JLA A;  2C28 A;  2AW0 A;  3GIR A;  2I38 A;  2MY7 A;  3LO3 A;  1K47 A;  1NSK L;  1BHN A;  3DM2 A;  2KRB A;  1LKZ A;  3H0P A;  4N5S A;  1HBU A;  3TQE A;  4M94 A;  3NS5 A;  1EET A;  1R31 A;  4PAA A;  4CLU A;  2AF6 A;  1M1K T;  2JZ5 A;  5AJ3 F;  2ROG A;  3B6B A;  1K1Q A;  2CRL A;  4HLB A;  2UXB J;  4I64 A;  4MYU A;  6FD1 A;  2VBY A;  1Q8K A;  5KFR A;  3FMB A;  2L9W A;  5AE1 A;  3MPY A;  3SCI E;  2OTJ S;  2FPH X;  3HSG A;  1FRM A;  1APS A;  1R8B A;  2CJB A;  3AAW B;  4KHR A;  3D0H E;  2FB0 A;  3L95 X;  3HSZ A;  1QM9 A;  4NZ0 A;  2KJW A;  2J9C A;  5HQL A;  2VPY B;  3QWP A;  3TAM B;  1T9W A;  1RHR B;  2GFF A;  4XO0 A;  4JV0 A;  4DPY A;  3B8H A;  2V4J A;  4ZVR B;  2KT2 A;  3Q22 A;  2KB2 A;  1K44 A;  2QLX A;  2PFD A;  4GKK F;  4I2P B;  4DX8 H;  2AX1 A;  1MSW D;  2XUL A;  1BC6 A;  3NRB A;  3DN9 A;  3KMQ A;  2GHW A;  2VA2 A;  5FII A;  1AYE A;  4OV6 A;  3DRS A;  1UPM B;  2XLI A;  1WEZ A;  3PV8 A;  1YJT A;  2BRK A;  4F0H A;  1JQG A;  1NK0 A;  3KNG A;  4LSL A;  4OYZ A;  3R5B A;  4ZPA A;  1LWC A;  1JLE B;  4DL4 A;  1IBM J;  1AZS A;  1S6Q B;  3NS6 A;  1RAB B;  1SC1 B;  2MZ1 A;  3A1Y G;  1B3T A;  2MQO A;  2J9D A;  3Q89 A;  4H4M A;  2HVZ A;  5M2R A;  4LQ3 A;  3KK2 A;  3M30 A;  3GZ7 A;  4DPW A;  1KLM A;  3DLB A;  5EWG A;  2IM1 A;  3R97 A;  2NZ4 A;  3OV7 A;  2BR0 A;  1QAJ A;  4RW7 B;  1X0F A;  3KKF A;  4WFB Q;  3GR0 A;  3GFZ A;  4USI A;  5LOQ A;  1RYS A;  1AW0 A;  4X4R A;  1JMT A;  2AU0 A;  1UCN A;  4A8Y A;  1OPI A;  4KGZ B;  3DRP B;  2RKI B;  1ZYQ A;  1P6T A;  2HHT A;  1JLB B;  2YWE A;  1S99 A;  1YJW S;  3HM9 A;  1RWP B;  3MEC A;  4B3R F;  1W25 A;  4BCA A;  1WDD A;  1JLA B;  3LF0 A;  1U2C A;  3IWN C;  5KFD A;  3NGK A;  2MB0 B;  1H7W A;  2MQN A;  3M05 A;  5DLG A;  3DM2 B;  4ENO A;  1FXD A;  5IS2 A;  1HBU B;  1LXJ A;  3K58 A;  3ENQ A;  1EET B;  1UFK A;  4J90 A;  5CYQ A;  2RQ4 A;  3HSD A;  3EVW A;  4U8V A;  3J7Y U;  5GMD A;  3FCW A;  1FFS B;  1GNK A;  4NLD A;  2MTL A;  4FYW B;  5D15 A;  2CZ4 A;  3CDB A;  3R5J B;  2AMC B;  1VHI A;  3R5D A;  4ZVS B;  3I32 A;  3PCO B;  5KFO A;  1VOM A;  2W7O A;  5KFX A;  3L09 A;  4EUV A;  3K5N A;  1S5Z A;  3JXO A;  4U95 A;  4QJV A;  2WON A;  1S4F A;  4G1P A;  4CT9 A;  4YB1 P;  4F4A A;  3I5C A;  2B56 A;  5KFW A;  3EGW B;  2MLZ A;  2A6O A;  3WDO A;  4LF1 A;  2VV5 A;  3V4M A;  3VGV A;  1LEO A;  4OX6 A;  1DY3 A;  2DNP A;  3F41 A;  3JS9 A;  1KEK A;  4FYY B;  3E51 A;  2HZC A;  3Q23 A;  2V4J B;  4ZCM A;  5BR8 J;  1SV5 B;  4QWE A;  3IR5 B;  2Q6C A;  4CI0 B;  3MUR P;  4PKD B;  3C3L A;  2LA6 A;  1BGX T;  4J9R A;  1U45 A;  2CQ2 A;  4TXS A;  3L9Z A;  4IR9 A;  1IBK F;  3DRS B;  4QR2 A;  4DLE A;  3I6P A;  3UDC A;  3BM7 A;  5BYQ A;  1U2F A;  3M2V A;  2GAG C;  4LSL B;  1GMV A;  1PJ7 A;  4ZPW R;  2SXL A;  4GVB A;  4F25 A;  1AZS B;  2BKP A;  4RNM A;  1F2G A;  4Y00 A;  5D8H B;  2O5D A;  1RCO B;  2NXJ A;  1XMQ F;  1M0S A;  2ABY A;  4H4M B;  4ITS A;  3ZFV A;  2J8A A;  3ENV A;  5EX0 A;  4FF3 A;  2QL5 B;  3KK2 B;  3D6H B;  1TR0 A;  3M30 B;  1JLG A;  1EJ7 L;  4F0K A;  1FJC A;  3DLH A;  4A8S A;  1KLM B;  2Y1I A;  4WXW A;  4C3K A;  3S6E A;  2W7P A;  5ETK A;  3HZG A;  2BQR A;  1VIS A;  5ETL A;  4J9V A;  5D4N A;  1VIO A;  1GT8 A;  3UR3 C;  1VQL S;  4DUY F;  2P6T A;  1PYS B;  3BR9 A;  1U24 A;  2KG1 A;  4B9V A;  4GO5 X;  3I82 A;  3M9M B;  2ZC3 A;  2H1Y A;  3A4T A;  3MEC B;  2V69 A;  2BYC A;  2D9P A;  4D3H A;  1N5V A;  2HHH F;  3R5C A;  3K59 A;  2DR5 A;  4F50 A;  4UY8 T;  4J91 A;  5DZ6 A;  4ERD A;  5IFM A;  5CYQ B;  4CTA A;  2LU2 A;  2DBB A;  4LUB A;  2KH9 A;  5DG7 A;  1U8W A;  2BJ3 A;  1O8B A;  2M3D A;  2LYV A;  5EHH A;  4MTP A;  4OZL A;  4FF1 A;  3J81 U;  3IRW P;  2QJ3 A;  4V1A k;  3QJL A;  5KT2 A;  2WON B;  4MYT A;  4ID8 A;  4P52 A;  2BJ7 A;  2JLE A;  2R8K A;  3BH6 B;  4ED3 A;  2KO1 A;  4LQ9 A;  3D1H A;  2CJ9 A;  2VQE J;  2QLB B;  3H42 A;  2EFV A;  4X65 J;  1JLC A;  2NSC A;  3H4B A;  3MEK A;  3P8B B;  3H20 A;  1W7W A;  4ELV A;  5B08 A;  3WC0 A;  2XCA A;  1Y5N B;  2H9Z A;  2DNL A;  1WOS A;  4KAI A;  4M5I A;  3IR6 B;  2HHS A;  4DX6 A;  2R2U A;  3EE3 A;  1KVK A;  1S0N A;  2QL7 B;  5J2P A;  3HHL C;  1XNR F;  2DH8 A;  3RAX A;  3QO9 A;  4DN0 A;  2B8Q A;  4FS1 A;  4PEO A;  3M2V B;  4GMK A;  4LRA A;  4QYR A;  4PXC A;  4GVB B;  5LSR A;  1B0P A;  4ZVU B;  2XI3 A;  2MQP A;  2N3L A;  2VFV A;  4KY3 A;  2E9R X;  4K5R A;  3U1M A;  5T41 A;  2XEX A;  3TUP A;  1LNQ A;  1YGY A;  5HVF A;  3CJS A;  5T14 A;  2XNR A;  3DU6 A;  3R2D J;  3Q8U A;  3QAE A;  3UWT A;  1JLG B;  5LMU F;  4OI6 A;  2YWK A;  2GMH A;  1FNM A;  3TA1 A;  4PR6 A;  4NL5 A;  1V3Z A;  1PIL A;  4H4O A;  4DR2 F;  4NA1 A;  3MEG A;  4UST A;  1V3R A;  2VQF F;  2HS4 A;  3PEH A;  4UOC A;  4DDF A;  2GVD A;  3MM8 A;  5HN0 A;  4G65 A;  1U6B A;  3Q8S B;  3NWR A;  1NK4 A;  4IRC A;  3P3D A;  5HP1 A;  2CQI A;  3B4D A;  3MAQ A;  2K8G A;  4KPC A;  5AE3 A;  5KFB A;  3CJ5 A;  1WC3 A;  3QT5 A;  5AT1 B;  4CLT A;  4ECQ A;  2JL9 A;  4QW8 A;  3PYG A;  5LSL A;  3KHL A;  4IH5 A;  1FDN A;  3PR5 B;  5KFJ A;  3T5H A;  4F2R A;  4F67 A;  3JTO A;  4K4V A;  2HHQ A;  1WF0 A;  1HPZ A;  4AFF A;  4A46 A;  4OZ5 A;  1EZZ B;  1HWI A;  4M5K A;  4TU7 A;  4M5N A;  4X64 J;  4M5G A;  2I1R A;  4BLG A;  5K8M A;  4YEA A;  1Y7P A;  1SQE A;  2QMX A;  2IM3 A;  1KQK A;  2VOP A;  4G1I A;  1IM6 A;  5GAD I;  4P72 A;  2ZVS A;  1FEE A;  2KVQ E;  5LXY A;  2KXN B;  4TYB A;  1JLC B;  2XMK A;  5KT3 A;  4J9K A;  3FZ2 A;  3AOC A;  1NJY A;  4ZVO B;  2HVI A;  2XZT B;  4NEY A;  3BO4 A;  1CS4 A;  1C1B A;  4OJH A;  5FLX U;  2NXN A;  3PFO A;  3ZTO A;  4HYK A;  4QIG A;  5GAG I;  1HI1 A;  4IO1 A;  1RKJ A;  3NBP A;  2Z0G A;  5J2P B;  2K06 A;  2U1A A;  4IQM A;  1M90 T;  3QO9 B;  4DR6 J;  2LXF A;  3OTD A;  2V94 A;  3TNV A;  4NLT A;  2HG4 A;  1X5T A;  3HJV A;  1H3D A;  4CP5 A;  1LXN A;  4L73 A;  2B7C B;  3H40 A;  1URR A;  4C4W A;  4IO9 Q;  3VCD A;  1C4A A;  1G1X A;  2ADB A;  1PCA A;  4CH0 S;  1TKZ A;  2X7I A;  3PNI A;  2BJ8 A;  4F02 A;  3DRR A;  4YR0 A;  5I3P A;  1OO0 B;  2PII A;  1HD1 A;  3FZB A;  1LW2 A;  3FSY A;  4H4O B;  2DNG A;  4IDK A;  3MEG B;  4DOZ A;  3UNY A;  1Y3K A;  3DKD A;  3OLB A;  4B9M A;  4DFJ A;  1XMO J;  5HAO A;  5I3U A;  2GVD B;  3MM8 B;  2K7K A;  3BYR A;  5KT7 A;  2YTC A;  4KFB B;  4ZPT R;  2HQI A;  2I2Y A;  2VG5 A;  5HP1 B;  2CA9 A;  3HCX A;  3JTN A;  4M5H A;  1RUS A;  1Q53 A;  4YDX A;  1SVD A;  3IM9 A;  1SL0 A;  1RT5 A;  2ZFH A;  3RW7 A;  3J80 U;  3PJW A;  1YWX A;  3QSY B;  2ALY B;  5DDR C;  1HPZ B;  2ASY A;  2RML A;  2E5L J;  4U67 Q;  3LOU A;  2XBP A;  3MI7 X;  5E3A A;  2WBM A;  1RT1 B;  1RP5 A;  4AE5 A;  3TW0 A;  1Z4U A;  1ZS6 A;  1DFD A;  2JSX A;  4I69 A;  3RTV A;  1WOO A;  2LLZ A;  4JBC A;  1BQX A;  3JAM Y;  1IBM F;  5KG2 A;  2NR0 A;  3PYF A;  1OSC A;  4N41 A;  2IJN A;  1UVM A;  4JV2 A;  3MHY A;  4FXW A;  4CRJ A;  1QTN B;  4N47 A;  1NKE A;  4L72 B;  3GYX B;  5CAA A;  1K9M T;  2XG8 A;  3MR3 A;  5K8O A;  1P1T A;  4UT4 A;  1SJQ A;  3CJ3 A;  1HBN A;  1HNZ J;  3OSN A;  1CLF A;  1CS4 B;  2R7V A;  2R8I A;  3BGO P;  2N82 B;  4A8O A;  2M2B A;  1C1B B;  3LP2 A;  1VQ4 S;  2Z2Y B;  1WKL A;  1G3O A;  4DL2 A;  3OL9 A;  4KTQ A;  1RCX B;  2C3Y A;  3CJ2 A;  3NBP B;  1GFW B;  1T05 A;  5DM7 Q;  4PUO A;  3UD5 A;  1HNV A;  2HHP A;  2CZV C;  2VPZ B;  4R0E A;  2J8S A;  4DXL A;  2BUN A;  4HEA 9;  4B9S A;  2OPR A;  3W7B A;  3BH7 B;  3V6K A;  3M8R A;  2LXI A;  4AT1 B;  3KHR A;  2YKP A;  1D8Y A;  2DXF A;  4C8M A;  4WE1 A;  1JLQ A;  4WFX A;  4CDI A;  1R6Y A;  1TKZ B;  3JSB A;  3GR1 A;  5JJB A;  5DRK A;  3DRR B;  1LFP A;  3DHX A;  2FYX A;  2FHO B;  4J5O A;  1LW2 B;  1U02 A;  4R0J A;  1H2U X;  4EU0 A;  1PGZ A;  4NRT A;  2Z30 B;  1B7Y B;  3LAK A;  1GXU A;  1S9G A;  2RB7 A;  2XS5 A;  2R3V A;  2BRL A;  5D78 A;  5I3U B;  2DEI A;  2VG5 B;  5B0A A;  1J2V A;  2J76 E;  1YQH A;  2U2F A;  2QTW A;  4HI2 A;  5GAE I;  3Q8V A;  4CCH A;  3VGS A;  2FIU A;  3ZTR A;  2H5J B;  4FN5 A;  2DT9 A;  3M8Q A;  4C3L A;  1EX8 A;  2WVD A;  1RT5 B;  5HK4 A;  1VQ9 S;  3H7H B;  5BR8 F;  2GMJ A;  4IRK A;  3WX4 A;  1SJ3 P;  5L9N A;  3CCE S;  3GFX A;  4K4X A;  3AXK A;  1HYS A;  3FBE A;  2HFV A;  4F4W A;  4QIE A;  2W4D A;  2WHO A;  1VC0 A;  1H0H B;  3T1H J;  4WFY A;  3IG1 B;  2LMI A;  2RH3 A;  3QQC D;  5B0C A;  2UUB J;  4DHV A;  2QYG A;  2XGQ A;  1X5S A;  4DV6 J;  5AE2 A;  3N9U C;  3FCV A;  4C8Y A;  1SXL A;  1SB6 A;  4DG1 A;  4DCO B;  4DR5 J;  1QDU B;  1HBN B;  3ZTS A;  4LIR A;  1FD2 A;  5HAT A;  2V2Z A;  1YZ7 A;  3LP2 B;  2LFV A;  3A8J A;  3GSD A;  4MKA A;  5EUH A;  4ES1 A;  1KOO A;  5SUH A;  3ZZU A;  4WP9 A;  1CG2 A;  4DJB A;  4QWB A;  1T05 B;  4PUO B;  1Q16 B;  1HNV B;  4DR3 J;  4AXI A;  5HI7 A;  1EAY C;  1UEV A;  3KUE A;  2ZE2 A;  2PMZ D;  3VZI A;  1H7X A;  3PYE A;  5KG5 A;  3PW4 A;  1T8E A;  1R8P A;  4ZA1 A;  1S0O A;  3PO4 A;  1BLU A;  2C1E B;  1ZA2 B;  4OYA A;  4PG7 A;  4ETX A;  2MKC A;  1HR0 J;  3EM1 A;  2CYY A;  1AT1 B;  3AY0 A;  2ZKT A;  3D1O A;  1T94 A;  4YP3 A;  4CNZ A;  1KTQ A;  3NNA A;  4JI5 J;  3CMQ A;  1JLQ B;  3RBX A;  4Y2C A;  3LWM A;  4QR1 A;  2QT7 A;  3WC2 A;  1NSP A;  3T3F A;  5KFL A;  4DL6 A;  1IWG A;  4B3S J;  3TWZ A;  1T0T V;  3KJV A;  3UFC X;  1UJ5 A;  2J7K A;  2A6M A;  1KD1 T;  1S9G B;  3TJ8 A;  4N8N A;  1TQL A;  1S4E A;  4A48 A;  3EUN A;  1I3O B;  3RR7 A;  2J6T A;  4TNO A;  3V2U C;  1HWU A;  4ZCK A;  4ECV A;  1UFL A;  4IG0 A;  4K4S A;  2DRD A;  4DQR A;  1R7I A;  4YFU A;  2FC9 A;  4ILR A;  3S7R A;  2VQE F;  2ZH8 A;  4X65 F;  2BAN A;  3HHD A;  4DQI A;  2BE2 B;  3M8Q B;  5CA5 A;  5L38 A;  4RX6 A;  2R7T A;  4RW4 A;  1F6T A;  2UVV A;  1Q5Y A;  5J2Q A;  2JLG A;  3VGT A;  3TR5 A;  1ZM9 A;  4I6W A;  1TTH B;  1HYS B;  1RAD B;  5KFK A;  4HL9 A;  1YZ6 A;  3AA8 A;  2AJ2 A;  4DS5 A;  3IR7 B;  3IP0 A;  1RT3 A;  4ECS A;  2EWH A;  4ZN3 A;  1LV5 A;  3DMJ A;  3FDS A;  1NK8 A;  1B0V A;  2J0Q D;  2E29 A;  2F4V J;  4FZV A;  3M8Y A;  1S12 A;  4QYZ K;  3V4I A;  3H5X A;  3OQ2 A;  1RDR A;  1FO1 A;  4DG1 B;  3UD3 P;  2N4C A;  1FF2 A;  3BV8 A;  2KHD A;  3QRP A;  2ADC A;  1N36 J;  2W2M P;  2ZH3 A;  1KQG B;  1FD8 A;  5E5N A;  2JEJ A;  3K8W A;  4Y2A A;  1NSQ A;  2DNM A;  5AXM A;  3SI8 A;  3I55 S;  1HD0 A;  1Q86 T;  2AYE A;  3ZZY A;  1S10 A;  1F3F A;  2OPP A;  4EI2 A;  4KB7 A;  3C6U A;  2CJY B;  2ASD A;  1HW8 A;  2UUW A;  1J5E J;  1AUD A;  2ZE2 B;  3W3S A;  5KFQ A;  3Q8R B;  4LF4 J;  2HAI A;  3OHB A;  1TMJ A;  3BKF A;  5KFF A;  2R9L A;  2POK A;  3Q2S C;  4C6A A;  3AB2 B;  2IPO B;  3VAF A;  3OL7 A;  1T95 A;  5KFA A;  1PG5 B;  1ULR A;  4O3N A;  3PVX A;  3EWG A;  1N88 A;  3B4M A;  4IRD A;  2AT1 B;  4DV2 J;  3DOK A;  5DDQ C;  3N6M A;  3KJV B;  4X64 F;  2AEJ A;  3OL6 A;  2BKN A;  1CJV A;  2GZO A;  4RWW A;  3QMQ A;  4RBU A;  1TKT A;  3L4B C;  3WQP A;  1SC4 B;  4OYI A;  3HT0 A;  2O01 C;  3D6T B;  4DR1 J;  3M9O B;  4UTG A;  5D4L A;  4IG0 B;  1XMB A;  1UVI A;  3T1Y J;  1Q8B A;  3AFG A;  1VQ7 S;  1S76 D;  4RJV A;  4LT6 A;  2V9W A;  4R5P A;  1EB0 A;  2BAN B;  3FRY A;  1N5S A;  2VIC A;  1PBU A;  4WCE Q;  4DL5 A;  4LBI A;  4RW4 B;  1BMQ B;  4B08 A;  3NMA A;  1RT7 A;  3BKT A;  5J2Q B;  1RTJ A;  4YDD B;  2BJ9 A;  4URQ U;  2KKH A;  2EI5 A;  4ZDN A;  5IT4 A;  4E0D A;  1U4B A;  1FJG J;  5F0U A;  4CNY A;  4N8O A;  4DR6 F;  1U1L A;  1RT3 B;  2BJE A;  2G0J A;  3EVM A;  3HKW A;  5A2Q U;  3DMJ B;  1XWL A;  2FHM A;  5C5J A;  5ETQ A;  2IM0 A;  2F8H A;  1VMB A;  2UUT A;  3LAL A;  1BWV A;  3TAR A;  5A8K B;  3V4I B;  3SEO A;  3CVK A;  2QG9 B;  2D3Z A;  2FVR A;  3FSX A;  4U7U D;  3MF5 A;  3BKU A;  3Q0A A;  3GG1 A;  4JV1 A;  3O44 A;  5A6P A;  1RAE B;  4RUA A;  1UVK A;  2NQP A;  1P27 B;  2PSZ A;  2CQ1 A;  4FYD A;  2I9S A;  1VC5 A;  1UMJ A;  7FDR A;  3TAQ A;  2WAQ D;  3OXG A;  1U1K A;  2IBO A;  3W8G A;  2GIR A;  2M0G B;  1FXL A;  1RLD A;  1YBU A;  2IC3 A;  3W2V A;  3DLJ A;  2OPP B;  4B9L A;  4RNH A;  4DL7 A;  2C2O B;  7FD1 A;  2ZH2 A;  3LP1 A;  2E9Z A;  1UW4 A;  3U7J A;  3GV5 B;  2ZKU A;  3W5X A;  4USV A;  2B7B B;  2IIH A;  1QJH A;  2JEF A;  2MPU A;  3KFW X;  1DHM A;  1TUV A;  2L9D A;  1EKS A;  2DXD A;  2Z8Q A;  3R7N B;  2HQD A;  3DYA B;  1VRT A;  1DUR A;  1ELO A;  4ES3 A;  1XQI A;  1NAQ A;  2G1H A;  3GYG A;  3MOZ A;  1X60 A;  1IKY A;  1E6V A;  4WU3 A;  4NYO A;  3C8Y A;  5DDP C;  3FEX B;  5HSP A;  3DOK B;  3IGV A;  1GEH A;  1SC6 A;  4OZN A;  3S1T A;  1RAG B;  3NAI A;  4XDC A;  3NCR A;  2E5L F;  1O5J A;  1TL4 A;  2Z57 B;  4ZN1 A;  5KFS A;  2B51 A;  3HHL A;  1FKA F;  3SFU A;  1UZH A;  2CNK B;  1PIE A;  1TKT B;  1TU0 B;  4DBQ A;  2KFY A;  4EO6 A;  1SH0 A;  2DEJ A;  2AGO A;  1KQS R;  2EG2 A;  1JJ4 A;  1WWH A;  1ZTW A;  2DNN A;  2XNQ A;  2XWX A;  1QUV A;  4R5P B;  3I4H X;  4CYU A;  4YHH J;  1HNZ F;  3I4P A;  3MPU B;  1R8A A;  1MRO A;  5L1L A;  1RT7 B;  1R3N A;  1N34 J;  1RTJ B;  2VOD A;  2H3E B;  1MMD A;  5A8W A;  3OVA A;  4YOE A;  3AD7 C;  3M8S A;  1NND A;  2BKO A;  4ZP9 A;  4W92 B;  4DL3 A;  4ZP8 A;  4WU2 A;  2AYG A;  1U8S A;  3BZQ A;  3PHE A;  4X2B A;  5KFM A;  1NPK A;  3NLC A;  3K0J A;  1PYO B;  4ZOS A;  3NXZ A;  3QRR A;  5LL6 d;  4AD6 A;  4CLF A;  2XMV A;  3KG4 A;  4YB7 A;  5A76 A;  1DTT A;  1NZ8 A;  2GML A;  4WBF A;  2CQ3 A;  5HJY A;  4LFC J;  2BJD A;  2BXJ A;  2DHA A;  1X4F A;  3THP A;  1H73 A;  4XPE A;  1C0U A;  1DZ5 A;  5KT6 A;  2KXH A;  1VBK A;  2ZC4 A;  4ZPC A;  2IC3 B;  1U1M A;  2A10 A;  3W2V B;  3G8Q A;  3QFH A;  3W63 A;  1ZET A;  3THV A;  4OHY A;  2GJI A;  1AA1 B;  2KYX A;  4ID5 A;  3LP1 B;  3LUY A;  2HK3 A;  5HO4 A;  2CWK A;  3FJ2 A;  3G8S A;  2CPH A;  2ZDP A;  2DIT A;  3P6Y C;  3PW7 A;  3ILL A;  2V34 A;  3R27 A;  4X4T A;  1T03 A;  1KS2 A;  4JI7 J;  3RU0 A;  1IKY B;  1E6V B;  1DAR A;  2C2K B;  3UR0 A;  4KBI A;  5A8R A;  4WWS A;  4P2X A;  3KLH A;  4NXN F;  3CSK A;  2HQC A;  2MLY A;  1CEZ A;  1HHT P;  4LR8 A;  3OW2 R;  4I2Q A;  2R8G A;  3HHL B;  3P5T L;  2HFZ A;  5CCL A;  2PI4 A;  2VH7 A;  2XHC A;  2XWY A;  1FNX H;  1MU2 A;  1T3O A;  3Q8Q B;  2UUB F;  4OZJ A;  5IT9 Y;  4LVN P;  4DV6 F;  2QFI A;  4ETZ A;  1YI2 S;  2HHU A;  3O1L A;  1OY8 A;  4KO0 A;  2MHE A;  2IAJ A;  2ZVI A;  1RSC A;  4QCL A;  2GIF A;  1WG1 A;  5IQ6 A;  2YX7 A;  3QGI A;  4CYU B;  3O6Q A;  5KFV A;  5F9L A;  3JQM A;  2FVS A;  4QPX A;  3SFG A;  1MRO B;  4O3S A;  5ETN A;  3DHW C;  2PFF B;  5A8W B;  1IBC B;  2W9B B;  1SJ1 A;  4V19 J;  2IJR A;  1MMN A;  2XCP A;  4DR3 F;  1D9A A;  2ZWP A;  3GFY A;  2DNH A;  3VVT A;  2NRE A;  2OEJ A;  5F3T A;  2DHX A;  3MOJ B;  2KVI A;  2Z2L A;  8RUC A;  1U1N A;  4KHP J;  4MIB A;  3TVZ A;  4ZHR A;  2AYB A;  1JB0 C;  1YHQ S;  4F4K A;  1HR0 F;  2HWH A;  1VQN S;  2IYI A;  1DTT B;  3T41 A;  2V0N A;  1WSV A;  5DM6 Q;  2EFO A;  2FQQ B;  4NLV A;  3FVY A;  4JI5 F;  3SQO P;  4K4Y A;  1C0U B;  4QR0 A;  2ZBR A;  5HLF A;  1NJZ A;  3PR4 A;  1N0V C;  2B9W A;  5B0E A;  4B3S F;  4A4J A;  5LM7 E;  5F8H A;  2PDA A;  1KLN A;  5KOX A;  1HLW A;  2D74 B;  4URS A;  3SYZ A;  5D0R A;  1TAU A;  3BN4 A;  2M5Y A;  4ID5 B;  2QC3 A;  1WHX A;  2V2K A;  1WNE A;  2WCX A;  2GHP A;  2WW8 A;  2HAF A;  1ZTT A;  1Q81 T;  4WP3 A;  5KFH A;  1U6Z A;  2OI2 A;  2AJ1 A;  3HFZ B;  5J1E A;  3W8P A;  1SH3 A;  4OI2 A;  3SMZ A;  2Y1J A;  1T03 B;  2RQK A;  4CO3 A;  3QT6 A;  2A0F B;  1FK9 A;  4ZJL A;  4CLZ A;  1Q79 A;  5SZT A;  3CED A;  1RXO B;  5A8R B;  4RPF A;  5DGA A;  1B99 A;  3OXL A;  3ZNU A;  4J9L A;  3ISZ A;  2RDD A;  3CD0 A;  3KLH B;  1GQE A;  1FJE B;  1SJR A;  3PXG a;  1DQA A;  4I2Q B;  1REV A;  3TAP A;  3CCS S;  4P74 A;  2CWX A;  1CQM A;  3TI0 A;  3DGP A;  3G71 S;  1NCL A;  5HRO A;  3UNG C;  1B7F A;  4LJM A;  1MU2 B;  2C2E A;  2GIQ A;  1UJ4 A;  2ALZ A;  3W2W A;  2R2R A;  3BR8 A;  1WD6 A;  4MKB A;  3H2U B;  4FXD A;  2QGF B;  1RHJ B;  2F4V F;  2FHJ D;  2K1R A;  2DIV A;  4C0O C;  2DCL A;  2ZHA A;  4KO0 B;  1HL6 A;  1WI6 A;  2IAJ B;  4B9N A;  1VQ6 S;  5EGY A;  1GAO A;  4NOH A;  3CF5 Q;  2ATL A;  5F3Z A;  1SH2 A;  1N36 F;  2MKS A;  3MR2 A;  4HTJ A;  2G9O A;  4X4U A;  2VJV A;  1JWW A;  2QIF A;  1NDP A;  2DHH A;  2BX6 A;  3H4D A;  4XPC A;  1UEU A;  4A8Q A;  2ZBI A;  3TOQ A;  4LRF A;  4J9N A;  3MFH A;  2DXE A;  4KR0 B;  1J5E F;  1D0E A;  5L39 A;  3PTW A;  3DXB A;  4LF4 F;  2DGV A;  1R0A A;  2FVC A;  4R25 A;  2E7V A;  4DL0 C;  4ZHR B;  1G6B A;  3KMS A;  3LA0 A;  1K1S A;  5IV3 A;  4L74 A;  2YH0 A;  1SKW A;  2V8P A;  2EPI A;  2UXD J;  4CT8 A;  1XN9 A;  4DV2 F;  5HLF B;  3PW0 A;  2CQD A;  1TEL A;  1CC7 A;  2LQ8 A;  4OL8 A;  3FQK A;  3G6X A;  3OJU A;  4YR2 A;  2BA9 A;  4DLG A;  3DGV A;  3J81 Y;  1ACM B;  3U1N A;  1FTR A;  3NL0 A;  3TYT A;  1U09 A;  3G6Y A;  1WKJ A;  4DR1 F;  2W4C A;  4ZCI A;  2CPZ A;  5GAH I;  2FJB B;  3VV2 B;  3T1Y F;  3GIJ A;  1T02 A;  2DRB A;  4F8R A;  5J1E B;  3G87 A;  2BOA A;  2DNZ A;  4CLK A;  3NGS A;  3HD2 A;  1YSJ A;  2CQB A;  4EGL A;  2J7W A;  1FK9 B;  2ZH7 A;  2YWF A;  3FBB A;  3GON A;  3OFG A;  3LGM A;  3WIU A;  3MXH P;  4JI8 J;  2PO4 A;  1N5Q A;  1XER A;  3D0G E;  2OTL S;  1CPZ A;  4UOG A;  3OLA A;  3BBF A;  1NDK A;  1REV B;  1HNW J;  3FKB A;  5KG4 A;  1FJG F;  3DGP B;  2LDI A;  5HRO B;  4M5L A;  3MUV P;  4TY8 A;  3FFI A;  3W2W B;  4YB5 A;  2EKN A;  4RNN A;  2H65 B;  2HBY B;  5E2Q A;  1HW9 A;  1ZBT A;  2B5J A;  2IHR 1;  1S6P A;  1L3U A;  4KGV B;  2K1R B;  5H9E K;  2D1C A;  4OZ1 A;  3BRE A;  3CPW R;  2RVJ A;  1IWA A;  3G6V A;  2GQQ A;  2UUC F;  3K5L A;  3HLU A;  3QIP A;  4KSE B;  1BUX A;  4YY3 J;  3CCL S;  4Z2X A;  2IA0 A;  3E2E A;  2PA8 D;  1JX4 A;  4Y34 A;  4EYI B;  2PGC A;  1F1B B;  2OMO A;  4OMF G;  1A9N B;  1NM2 A;  3KUG A;  1SIW B;  2X3G A;  5IQQ A;  4BDP A;  3SCK E;  4FF2 A;  2UXC J;  4ZP6 A;  3I5B A;  1Y10 A;  3PG9 A;  4CO4 A;  3GLJ A;  2HHX A;  1R0A B;  1YLX A;  1IKX A;  3C2P A;  1C1C A;  4URG A;  4DV3 J;  2EBG A;  4KHM A;  1RBA A;  1UZD A;  1IM4 A;  3M8Z A;  3QGP A;  1N5Y A;  3W61 A;  4X4P A;  1V6H A;  1IJF B;  2MGZ A;  2V4R A;  5B0F A;  1YTY A;  2DGX A;  1U47 A;  5HAN A;  3E8O A;  2F8M A;  2J6S A;  5E3C A;  4NLW A;  1NJW A;  3VZH A;  4MT1 A;  1RT4 A;  1UL3 A;  1Y0H A;  1S7I A;  1FI4 A;  3T9N A;  4OI4 A;  2HZA A;  4WFZ A;  1RYR A;  2QLF B;  4HHU A;  5KFN A;  4RU2 A;  3NCP A;  4RBV A;  2BQ3 A;  2ZH9 A;  2YX1 A;  1F3V A;  4RLE A;  3J81 j;  3X1L B;  1X8D A;  5DET A;  4Q8F A;  2OIH A;  2F7V A;  2VIH A;  2JFD A;  4U7U K;  2WSF C;  3CO9 A;  2RSQ A;  3HHK A;  4YHH F;  3IRX A;  3M7V A;  4DPU A;  5FLX Y;  3UO0 A;  5CZV A;  1WEX A;  1R0C B;  3M8W A;  1NLK L;  1SUQ A;  4RW9 A;  1O6X A;  2H48 B;  4DFM A;  4TYA A;  2VFU A;  3F73 A;  5CHC B;  4LF7 J;  5M2U A;  4NCB A;  3RJM B;  2C22 A;  3KLG B;  4RNF A;  2B6A A;  1XEZ A;  5JVH Q;  4X66 J;  2F9D A;  3FFI B;  4TY8 B;  4A47 A;  4F4X A;  5CAB A;  2MHN A;  1UJ6 A;  1VBZ A;  4ZJO A;  2CDQ A;  2CJX B;  4DSK A;  2B5J B;  4ILM A;  1S6P B;  5KG3 A;  3QZ8 A;  5KT4 A;  3MPV A;  3GWC A;  3W9H A;  4OZ3 A;  4LFC F;  3NNC A;  2B9E A;  1DAX A;  3H5U A;  2XC9 A;  1DLO A;  3OTO J;  3QIP B;  3C6T A;  4EYH B;  2PMW A;  4RO0 A;  5T7L A;  2XLJ A;  3P49 B;  3PAC A;  2D3O 1;  4DR7 J;  2HW3 A;  2JWN A;  2DNR A;  4CLL A;  1A6L A;  2ZD1 B;  1F2H A;  4ALZ A;  2O66 A;  2UVU A;  1D09 B;  3BYP A;  4UF4 A;  1RWM B;  5IV4 A;  1X9S A;  5IXU A;  3PX4 A;  4LBP A;  2IVM A;  3R1L A;  1VGY A;  1CVJ A;  5D0E A;  1EHW A;  3GV8 B;  4NLY A;  3UDE A;  1IKX B;  3ZZR A;  1HWJ A;  1C1C B;  1HIY A;  3TZX A;  4LF2 A;  2QA1 A;  3WZ0 A;  2DR9 A;  3J7Z T;  3HHE A;  5BJR A;  1ZM4 A;  3CJ4 A;  4DF4 A;  1O51 A;  4JI7 F;  1NK6 A;  4B3O A;  2LEA A;  3MMA A;  4DFK A;  4ZVT B;  2KT5 A;  3CC2 S;  1SKS A;  3J80 Y;  2LEB A;  1RWX B;  4NLX A;  2QSF A;  2A3J A;  1RT4 B;  1I1G A;  2PT0 A;  4PWU A;  4KQZ A;  5D0G A;  2NYH A;  4P71 A;  2EVZ A;  2CPJ A;  3GIK A;  2Y8Y A;  3CD5 A;  5H9F K;  1T3N A;  4CM2 A;  3T6B A;  3QGH A;  2AHO B;  4HDG A;  1OQ3 A;  3KG0 A;  1KN6 A;  4USK A;  3D54 A;  3R6L B;  1N6Q A;  3JB9 k;  4MH8 A;  3VAG A;  2C2M B;  3SSS A;  4EWT A;  3CD6 S;  1RTI A;  2QE5 A;  2ZOM A;  4NCA A;  3ENA A;  4NXM J;  1U0H A;  2QLW A;  2V8G A;  2Y9H A;  2G0I A;  3BPS P;  4CO5 A;  3MM5 A;  5EN1 A;  3IGN A;  2XB2 D;  4LF6 J;  3Q8P B;  2OAU A;  4KYZ A;  3IRX B;  1ZAW A;  3Q2T C;  5JMN A;  1Y00 A;  3I31 A;  3KG1 A;  4B17 A;  5C25 A;  4ED1 A;  2B4V A;  4MFB A;  4RW6 A;  2ACM A;  4RW9 B;  1VYA A;  2D7S A;  2V8D A;  3W60 A;  2ZNY A;  1FFG B;  2AYM A;  2FLN A;  4DWI A;  4EMD A;  2HRU A;  1GMW D;  4DSJ A;  4UOH A;  1KBR A;  1VJQ A;  3FQL A;  2C2N A;  1NXI A;  2RU9 A;  3KYL A;  4WZQ A;  2LQ9 A;  4P2M A;  4Q7A A;  1FXR A;  3U27 A;  2RRA A;  2DO4 A;  2VOO A;  1XR5 A;  3A8I A;  4QWA A;  3CE8 A;  5K9F A;  1L3K A;  4OJ1 A;  1FDD A;  3R8Y A;  3QLH A;  3TUJ C;  4OZ0 A;  3BS9 A;  2WOM A;  2ZM6 J;  5KFI A;  2CQC A;  1DLO B;  4DQP A;  4Y2K A;  3C6T B;  4MIW A;  1M5P C;  3TZZ A;  3KK3 A;  5T7L B;  4YUD A;  1YBT A;  4WKR A;  1WHV A;  4HR2 A;  3JSR A;  3V6J A;  1HHQ A;  4NRU A;  5GVQ A;  4BWJ A;  3CTR A;  2WSE C;  3DRY A;  4OYB A;  4OX9 F;  4M5J A;  2VUG A;  2HKE A;  2X1B A;  4DV1 J;  4ICL A;  4HH0 A;  2RUG A;  1RAC B;  5B0B A;  1QVG R;  3GPA A;  3J7A 1;  2NUH A;  3F56 A;  1CSJ A;  1W2I A;  4BC9 A;  3UVJ A;  3A3O B;  6FDR A;  2CJQ A;  4B3O B;  2M52 A;  3MMA B;  3FC9 A;  2XLK A;  4AL6 A;  1XNQ J;  3HVA A;  3AH6 A;  4TU8 A;  2AZ1 A;  4DF8 A;  2K2P A;  4C9D A;  1WJ9 A;  5ETV A;  2BAC A;  1FCA A;  1N32 J;  2HFO A;  4KKO A;  4J37 A;  1D3W A;  1VQM S;  1RI7 A;  4RUH A;  2J0W A;  3GJT B;  4OZ2 A;  2E7X A;  3U1L A;  2V8V A;  3VAH A;  2Q43 A;  1RTI B;  2ASJ A;  1CJU A;  3FMW A;  1U0H B;  3S8S A;  2EFN A;  3QJP A;  4TVA B;  3MM5 B;  3H8Y A;  3AT1 B;  2YBV A;  2CJA A;  4C97 A;  2KI2 A;  1VQS A;  4JUZ A;  3BQ1 A;  3BGR A;  3QJJ A;  1UKU A;  4W98 A;  2RAQ A;  5KOW A;  4ZVQ B;  3CJ8 A;  4QU7 A;  4X4S A;  1FX4 A;  3QWU A;  2HHW A;  4CO2 A;  9ATC B;  4DV4 J;  1IVZ A;  2QMW A;  3T19 A;  3W1Y C;  4U7C A;  4GRS A;  2KYZ A;  5KFP A;  2MDA A;  2DGS A;  2IRX A;  5D77 A;  1E6Y A;  1RB0 A;  1HMV A;  2CQP A;  5IZH A;  2HMI A;  2PI5 A;  1BWE A;  3JSY A;  5EX3 A;  1H6K X;  2ZBC A;  4AL5 A;  1X4C A;  4A8K A;  2XSF A;  3AOA A;  2AJF E;  3AXM A;  3MCO A;  4P6Q A;  2LDY A;  2CAJ A;  4P7T A;  5L46 A;  1TKX A;  3C46 A;  4EK2 A;  3OVB A;  2AJ0 A;  1KOH A;  4TU9 A;  4P2F A;  1JK9 B;  2KZZ A;  3QLH B;  2HLU A;  2MZR A;  3QYY A;  2WOM B;  5G0R A;  3MTJ A;  3FBF A;  3RZA A;  3P96 A;  1Q4R A;  3M4X A;  2UXD F;  1HA1 A;  2MJN A;  3KK3 B;  2D41 A;  1UA0 A;  3KJN B;  3ELH A;  1RA6 A;  1JLF A;  1WC1 A;  2HVD A;  2OML A;  1U1P A;  4NML A;  2GJF A;  2W2P P;  1VQY A;  3P45 B;  3PKY A;  4CWB A;  3SQG A;  2L9N A;  2V63 A;  3N5F A;  4C2M A;  2N7C A;  2JDJ A;  2YKM A;  1VR6 A;  4QPT A;  3A13 A;  1U6F A;  3HSJ A;  1I94 J;  4ED0 A;  1ZAX A;  4ECU A;  1LWC B;  2XZD B;  2YY3 A;  3ZO7 A;  2ZH1 A;  3EIC A;  3GQC A;  4QIV A;  3UVJ B;  1I5O B;  1J5O A;  3TEG A;  4IYQ A;  3PRV A;  3FCH A;  3KJF B;  4JI8 F;  1NBE B;  3DLL Q;  4RBT A;  2HQF A;  4J7C A;  2AWZ A;  2VFS A;  4J9U E;  1HNW F;  4DX7 A;  4KKO B;  3JYT A;  4NYZ A;  2LP4 A;  2W2O P;  1Q8I A;  4ZIW A;  3HXM A;  2XY7 A;  4WIQ A;  3R3T A;  3RB3 A;  2V5H G;  3V81 A;  4X84 A;  1CJU B;  3SDE A;  1SKR A;  1JXV A;  1AUS L;  3M9N B;  1RAJ A;  4DU7 A;  5HMX A;  2GO8 A;  4NE9 C;  2KN4 A;  3BGR B;  3H59 A;  1NK7 A;  1FJ7 A;  3H25 A;  3FSI A;  3OXF A;  4C8K A;  3LAN A;  4NLS A;  4N77 A;  5CH7 B;  1NEE A;  1LW0 A;  2GW8 A;  2Q1L A;  1DQ9 A;  2DPI A;  1KR4 A;  4NPO A;  1RAO A;  5CD4 A;  3CC4 S;  1E6Y B;  4RNO A;  3VAJ A;  3D67 A;  1HI0 P;  2UXC F;  2XO6 A;  1R6V A;  4ZVH A;  1VC6 A;  3A8E A;  3NEK A;  2ILZ A;  4DV3 F;  3D66 A;  1RBO B;  1TKX B;  1HBO A;  3CJR A;  3FUY A;  4IOA Q;  3CIZ A;  2CXE A;  2IMO A;  1NHV A;  5HJX A;  3QNW B;  5G0R B;  3PX0 A;  4X62 J;  2MST A;  2VD3 A;  4YME A;  4B3R J;  5F8M A;  3TAN A;  2FDN A;  1Q95 G;  4NLO A;  1JLF B;  5I4M A;  3QPI A;  4QZV B;  4OYW A;  1RT2 A;  4WYL A;  3SQG B;  1XR6 A;  2CPE A;  1G2E A;  1VRU A;  3SCJ E;  4CM0 A;  4Y65 A;  3BO2 A;  2XMT A;  2HS3 A;  3OFH A;  2YKM B;  3EZO A;  2LU1 A;  4C3M A;  4J9Q A;  4AQY F;  1RE1 B;  2WVC A;  4MKY A;  3H2L A;  2F1F A;  3M32 A;  2HQ3 A;  1PAU B;  1WUU A;  2MKK A;  1R43 A;  4X4V A;  3M2R A;  3GSI A;  2RT3 A;  2H5E A;  2CG4 A;  4CLY A;  1V3S A;  2FGC A;  3NOC A;  2ZJP Q;  2CFX A;  1VHF A;  5B09 A;  1OSD A;  4FNH A;  4P9S A;  3HI9 A;  2DTJ A;  2FZG B;  4LF7 F;  4ZPD A;  4A8X A;  3JYT B;  3HHN B;  4IKA A;  4YN3 B;  5E3P A;  5IC4 B;  5A2Q Y;  4X66 F;  1FTC A;  3T1A A;  4ZLP A;  3V81 B;  3SDE B;  1ZH5 A;  1YRU A;  1R8C A;  3OHA A;  3KDO A;  2HBZ B;  1OJ4 A;  3OTO F;  3HKZ D;  2GHV C;  1LW0 B;  4JV5 J;  3QRQ A;  4DR7 F;  1TKD A;  2OPS A;  1A0O B;  2WBR A;  2JOQ A;  2E44 A;  4Q44 A;  3D6M B;  2W2N P;  4OIX A;  4CTA B;  3G6E S;  2IFX A;  3ZZT A;  3R5A A;  1NRK A;  3IC1 A;  4JI3 F;  1CQN A;  3BEG B;  2GCF A;  1PAE X;  3MMB A;  3Q83 A;  1BQM A;  2NLW A;  4KC5 A;  3VAL A;  3J7A N;  1HBO B;  4LFA J;  4P73 A;  3TJ9 A;  1X4D A;  1F0X A;  3E01 A;  1NZA A;  2AEM A;  2MZS A;  1LFW A;  5IM0 A;  2NZC A;  2FJW A;  3GG0 A;  1B0T A;  4DX5 A;  2E1M C;  1RWV B;  4USW A;  4DZD A;  4ZLN A;  3O5T B;  3NGR A;  4Q0B A;  1TVR A;  4NLR A;  3QAU A;  3K7R A;  1R89 A;  1RT2 B;  2ILY A;  1FHT A;  1EKR A;  4CH1 A;  3CWJ A;  1FKP A;  2QZ8 A;  3PX6 A;  3W64 A;  1VRU B;  4WXO A;  4CIO A;  3IBF B;  4EEY A;  2WVF A;  2RIJ A;  3SSQ A;  1FKO A;  4ES2 A;  5F8I A;  2AJ4 A;  3AQP A;  1L3V A;  3WBZ A;  3AQO A;  2CAD A;  1A7G E;  2E5J A;  1I51 B;  4J9O A;  4K8R A;  4RZR A;  3ZTP A;  4Q2M A;  4I56 A;  3M32 B;  4C98 A;  2IDE A;  4A8M P;  3M2R B;  4WKY A;  4PAB A;  4C8O A;  3JTP A;  3NGD A;  4LF6 F;  1FDA A;  1KSP A;  3BBC A;  5RUB A;  1OY6 A;  4K59 A;  5C2G A;  3MM7 A;  2KM8 C;  4X4O A;  1T9V A;  4P2S A;  4O3R A;  1U26 A;  3GE9 A;  2ZH6 A;  4LRC A;  1F9H A;  3OUY A;  3EYZ A;  3UQS A;  2HGM A;  2NYI A;  2BV3 A;  2UXB F;  4PQU A;  4PXE A;  3NGU A;  1TK8 A;  2FD2 A;  3AOB A;  1LOU A;  1K8A T;  3EDR B;  4DQS A;  1J27 A;  3GP9 A;  2DPJ A;  4L3K A;  2HNZ A;  3IBW A;  3UE2 A;  3I5A A;  1KVJ A;  3RBE A;  4LF8 J;  3IAM 9;  2KDO A;  3KLV A;  4XK8 C;  3TP2 A;  1B4S A;  3IFE A;  1LQ9 A;  2OPS B;  3PY8 A;  1QUP A;  4B3T J;  2ZOG A;  1X4A A;  2ROP A;  3GTY X;  1OS5 A;  2M9K A;  4MMO A;  1RBL A;  3BDP A;  4OYM A;  2UVW A;  1LK5 A;  3CCQ S;  5D3G A;  3LTO A;  4DV1 F;  1SJF A;  3W9J A;  3ZZO A;  3AA9 A;  2XZW A;  3MMB B;  3HVT A;  1BQM B;  2Z58 B;  2JLF A;  2D3O R;  5AXN A;  1XBW A;  2JRS A;  2J0X A;  4Y6I A;  3M2U A;  3H5Y A;  2QLJ B;  4DSE A;  2JH3 A;  3E01 B;  1FFW B;  5IM0 B;  1TAQ A;  2JEG A;  4V19 X;  1XNQ F;  4FYV B;  3TA2 A;  4PZV A;  2PE8 A;  2DY9 A;  4G6V B;  2J9E A;  4YB6 A;  3OL8 A;  1FEH A;  3HUL A;  1TVR B;  1W26 A;  4I2P A;  1FKP B;  1MNE A;  5K5M A;  2M7S A;  2P9G A;  1FKO B;  3HK2 A;  2AJQ A;  1JJC B;  1U48 A;  2QYC A;  4DV5 J;  1YRT A;  2Y1R I;  2IJF A;  3ICL A;  4HKQ A;  2HRT A;  1FRX A;  4O0I A;  1KTV A;  4KGM A;  1Y4Z B;  2F8E X;  3MEE A;  3MDF A;  5KFG A;  3VAK A;  1S59 A;  2CVI A;  2FJD B;  4DV4 F;  3MM7 B;  2QMU B;  3RRK A;  3CCU S;  2VBX A;  2XMA A;  2CNO B;  2QSW A;  2DR8 A;  1JIH A;  1OYE A;  5MAO A;  3EZU A;  5D4P A;  2R2S A;  4ZPV R;  4F7V A;  4I7F A;  3OUY B;  1VLY A;  1HFE L;  3AJ1 A;  1UFW A;  4PQU B;  4IDK B;  4B3M J;  3EVO A;  2PEH A;  5KG1 A;  4PG8 A;  3ZZP A;  1S6O A;  1MWQ A;  1OY9 A;  4ZVG A;  2OKQ A;  3UDV A;  3L3C A;  3DRP A;  3V5R A;  1TL1 A;  2B8P A;  3JQJ A;  2HNZ B;  1FRJ A;  1N33 J;  1QVF R;  2K3K A;  5HVH A;  2KFN A;  3I9V 9;  3S01 A;  1S7H A;  4TN2 A;  4GKJ J;  4F2S A;  2B3T B;  1YJ9 S;  3B78 A;  1N8R T;  2Y1L B;  3MR7 A;  4AYB D;  4OV1 A;  3NY0 A;  4OLP A;  3SXL A;  3MM6 A;  4UW2 A;  2AEF A;  1NSA A;  4NLG A;  4FYX B;  3G9C A;  1GX6 A;  4UOF A;  1VBY A;  2DH9 A;  1RWO B;  3IS9 A;  1U1Q A;  2GGP A;  1MW7 A;  4HVZ A;  5D3G B;  2M4M A;  1C0T A;  2RHQ B;  2X3D A;  3HVT B;  2MXY A;  3KTQ A;  3PDN A;  1I94 F;  3GJS B;  3D68 A;  4I68 A;  2RRN A;  4TLQ A;  1D8Z A;  2CKW A;  5HMY A;  2DD8 S;  2LEC A;  3PJ9 A;  3RW6 A;  3M2U B;  4OYP A;  1MWZ A;  1YX2 A;  3HFV A;  1FE4 A;  4OHW A;  1T11 A;  1SC3 B;  5ITH A;  2FHK A;  5KFU A;  4KGX B;  4K50 A;  3LWL A;  3ETM A;  3K89 A;  2MZT A;  4BWM A;  4QW9 A;  3BJY A;  3SSR A;  1VI7 A;  1SV5 A;  1EP4 A;  1XIQ A;  2W9C A;  1S0M A;  4QWC A;  4RUC A;  1FX2 A;  1Y11 A;  4Y2M A;  3CJK A;  4HAC A;  4GC7 A;  3N5B A;  4U9R A;  2GA7 A;  2MQQ A;  1YIJ S;  4DV7 J;  3RB4 A;  4IQX A;  1P9Y A;  1AXQ A;  3AD9 C;  4XDD A;  1VQK S;  4DFP A;  2E1A A;  2OPR B;  1GH8 A;  1NME B;  5IT9 U;  2NSB A;  2C3M A;  4Q43 A;  4ER8 A;  3MEE B;  4JI4 J;  3QT8 A;  1CJK A;  4WK3 A;  2EKY A;  2E5H A;  5IT0 A;  2XHW A;  3ZTQ A;  3ZZ0 A;  1X4E A;  4WE1 B;  3CXC R;  1FA0 A;  3TA0 A;  3K5P A;  2O3D A;  4J9P A;  1VFJ A;  3BSN A;  2F9J A;  1YDL A;  4TKT A;  4I7F B;  4BS2 A;  2XMJ A;  1WTF A;  2CQG A;  5CQG A;  3I0S A;  4Z7C A;  3HO1 A;  2AIR B;  2IRU A;  3MED A;  3RAQ A;  3MUT P;  5L1J A;  2H51 B;  3L7U A;  1ROF A;  1S9E A;  1UVL A;  2FVP A;  2DGQ A;  2JC1 A;  2KRR A;  3EMT A;  4K4Z A;  4OJG A;  3G96 A;  3BQ0 A;  3K57 A;  2DNQ A;  3BDE A;  4K4U A;  1TL1 B;  3Q86 A;  4AL7 A;  3HT3 A;  5CCM A;  3N6N A;  2YWW A;  1NB2 A;  4X62 F;  1YJ7 A;  1FVQ A;  2WTF A;  1H2V Z;  4Y2I A;  2YKA A;  4NLP A;  2HYI B;  4QU6 A;  1KHV A;  3CW2 C;  5DLF A;  1L3T A;  3HDS A;  2MKI A;  3M6U A;  3MM6 B;  4O23 A;  3U02 A;  4I0W A;  2QA2 A;  4WK1 A;  4I6A A;  4ECW A;  3BSO A;  2CJK A;  3IS9 B;  2XMW A;  1QSY A;  2ZBQ A;  2GGP B;  1FRH A;  2JVO A;  2AV5 A;  2G4B A;  4YS2 A;  1C0T B;  3JSM A;  2ACY A;  3M1V A;  2NPF A;  2VAS A;  4QWD A;  2FLP A;  1WOP A;  2K3I A;  3RBD A;  4XTT A;  1JXL A;  4HT7 A;  3G8T A;  1WC0 A;  4ZMM A;  3D28 A;  2DJW A;  2R7O A;  3NAH A;  2RF2 A;  3T5J A;  1PJ5 A;  2ROE A;  5EWE A;  2W9A A;  1FE0 A;  2OPQ A;  2E9T A;  2OD6 A;  3CME S;  5GAD U;  1EP4 B;  3MAA A;  4O3P A;  2W9C B;  4L3N A;  2CPX A;  1TZ0 A;  3CJK B;  2EEY A;  4HAC B;  4DSL A;  3F44 A;  2Z56 B;  1UWA A;  3D1Q A;  4OLO A;  1KFS A;  4PPZ A;  5AXK A;  3Q8Y A;  2P2C B;  2C3O A;  1MN7 A;  3PKM A;  3K17 A;  3OFE A;  4U96 A;  1ZZN A;  2C2R A;  4ANC A;  4UQG A;  2IDL A;  4GC6 A;  3PRB A;  5GAG U;  4OI0 A;  1NH7 A;  4WZM A;  2FJE B;  3IMQ J;  3BSC A;  1NU4 A;  2OO4 A;  2VKZ G;  1CJK B;  2FHJ A;  2YWH A;  2BAB A;  3POT A;  4OQJ A;  2D3U A;  3KWM A;  2NXE A;  2AKW B;  4JV5 F;  4YQW A;  5C24 A;  1M5K C;  1VIX A;  2ZWO A;  1GTH A;  2CNN B;  2V50 A;  2VBZ A;  2WK4 A;  3I0S B;  3ZZZ A;  1WAC A;  2VPX B;  3JQK A;  1CJT A;  4H4K C;  5B0D A;  3MED B;  4AND A;  2XYG B;  1S9E B;  5DQH A;  3IXQ A;  3ETO A;  2DK2 A;  3CD7 A;  2YKQ A;  3P4U B;  1FWL A;  3MR6 A;  2DB1 A;  3AJ2 A;  2RIL A;  1X4H A;  4DU8 A;  4LFA F;  1WSR A;  2R7S A;  4PWW A;  1SI9 A;  3H98 A;  4FKY A;  1Z2Z A;  2ZJQ Q;  2ZZT A;  3HVR A;  4WFN Q;  1RU2 A;  1RWW B;  3CDE A;  2AGQ A;  4QBU A;  2YKO A;  1PC4 A;  2OJ3 A;  4PCQ A;  4NWB A;  3VAM A;  3DU5 A;  5KG0 A;  4EO8 A;  3KXD A;  3VTI A;  3US5 A;  2QEX S;  1PYT A;  5K20 B;  5CYJ A;  1YJU A;  1ZAV A;  1TK5 A;  3JSM B;  4C8N A;  3M1V B;  3OR1 A;  1NHU A;  3W62 A;  1OQ6 A;  2G13 A;  1N48 A;  2W8K A;  3UN3 A;  4HTI A;  2FY8 A;  5DG8 A;  1T9T A;  4I1T A;  2RF2 B;  3CDA A;  4LVO P;  2HBR B;  2RUS A;  4LMZ A;  3IWL A;  1YKW A;  1KP6 A;  2OPQ B;  3ZXW A;  1ARO P;  5H9E J;  8ATC B;  3N79 A;  2YNG A;  5FDL A;  3MAA B;  3UDL A;  5HQM A;  4F3Q A;  2YQ1 A;  3CNQ P;  2UUA J;  2E7W A;  1QSS A;  2XTJ P;  3DDN A;  4JI0 J;  1TL7 A;  2EFQ A;  5D0H A;  1V5I B;  2ERR A;  3C6U B;  1EQM A;  1XMO F;  3NG8 A;  5HBM A;  1T7P A;  5BYR A;  3BB5 A;  3BN7 A;  3NNH A;  4Y3C A;  1YJR A;  1S1V A;  2FLL A;  2LQB A;  4F0M A;  4L6V 3;  4PQA A;  3NP5 A;  3LGN A;  1RK8 A;  4MK9 A;  4KH0 B;  1RHU B;  4LF8 F;  1KFD A;  1B70 B;  3POT B;  1S1U A;  4LBH A;  4K2J A;  1L5U A;  2YQ0 A;  5C24 B;  4B3T F;  4O3Q A;  4PRF A;  1OYD A;  1UA1 A;  3N28 A;  2E1C A;  1YK9 A;  1N0U A;  1JNZ B;  3C15 A;  4QIF A;  1CJT B;  1CJV B;  5F8J A;  4G1Q A;  1UEK A;  2M70 A;  2YPY A;  2VC1 A;  4NYP A;  4DV0 J;  2RJZ A;  4ZVF A;  3DOM A;  1C4C A;  4KFB A;  1U25 A;  3N0V A;  3RBZ A;  1HAR A;  1RAF B;  1UVN A;  4DPO A;  3W9I A;  5J2N A;  1T9U A;  3EXY A;  2W01 A;  3BPD A;  2OP5 A;  4IOC Q;  1H72 C;  3TX0 A;  3OD2 A;  5DQI A;  4YR3 A;  3WX8 A;  1Q7L B;  2VFR A;  3OTC A;  2XY6 A;  2LCW A;  4IFY A;  5F8G A;  1HQU A;  5DGB A;  2YQ3 A;  5GAE U;  1RT1 A;  1VK8 A;  5L8R C;  1RHK B;  4C0H A;  2XGP A;  1IJE B;  3P5B P;  3T9Z A;  1FRK A;  1NDC A;  4B9T A;  3OR1 B;  2JJ4 D;  4DV5 F;  2IRY A;  3MPW A;  5EWF A;  2B4U A;  1WF1 A;  2OD4 A;  2OEL A;  3V6D A;  2Z2M A;  5C42 A;  5C7P A;  5U47 A;  4FNI A;  1TUW A;  4E2F B;  3N6L A;  2G1D A;  5E0O A;  4KT0 C;  2GV1 A;  1L3S A;  4H54 A;  1RA7 A;  2YNG B;  5FDL B;  4NA2 A;  1N54 B;  1ZM2 A;  3FEZ A;  2A1B A;  2WB1 D;  1MG7 A;  3CT9 A;  1TL7 B;  4B3M F;  2JVR A;  1S97 A;  1KNZ A;  3VVU A;  5HBM B;  4ECT A;  4FS2 A;  2P8I A;  2FTR A;  1S9F A;  3NS7 B;  4K0K J;  1AFI A;  4P7V A;  3LPE A;  1S1V B;  4Q5V A;  3PIP Q;  1IN0 A;  1N33 F;  3CCV S;  1XTZ A;  2WZ1 A;  2ZDO A;  1IR1 A;  3OR2 A;  1VRT B;  2HSE B;  4ECX A;  2VZ9 A;  2BEF A;  2DGU A;  4FBU A;  4GKJ F;  3GCX P;  2E5I A;  1S1U B;  2CQ0 A;  1FER A;  2HWI A;  4F3O A;  5ETP A;  4NCG A;  4UZB A;  2DCU B;  3T6J A;  2HEK A;  4QQB A;  2ATC B;  2C2D A;  4ECZ A;  3C15 B;  2R42 A;  4JP8 A;  3CUN A;  1SQG A;  4JYA J;  3IA0 A;  3DI6 A;  2MJU A;  4J9S A;  3T1H F;  4G1Q B;  3CDU A;  5DS7 A;  1G7C B;  5FD1 A;  2YX4 A;  4USU A;  3ONQ A;  3D7S B;  3TO8 A;  3DCA A;  2A2C A;  3PHT A;  5K14 A;  1D9D A;  5H9F J;  3RR8 A;  3DOM B;  2JFK A;  4N7T A;  3CJ0 A;  1U7L A;  4NEZ A;  5J2N B;  3M8P A;  4Z37 A;  2HGL A;  3CO0 P;  5KT5 A;  3EDQ B;  1BD6 A;  5DG9 A;  4DR5 F;  3BF4 A;  4N56 A;  2XYH B;  4DMZ A;  3GB0 A;  1RQ0 A;  5L9X A;  4IFY B;  1WHW A;  4ILL A;  3UN5 A;  3VQT A;  2Q6B A;  1HQU B;  5DJB A;  1X9M A;  4NA3 A;  4HDH A;  2CQH A;  4PG4 A;  2GS8 A;  1RGV A;  3CJQ A;  3DLE A;  1LWE A;  4DV7 F;  3L7O A;  1IQT A;  3IG1 A;  3CC7 S;  2EFP A;  2N3O A;  3T5K A;  2KJV A;  2V8H A;  5I42 A;  4DI6 A;  3V6D B;  2HHV A;  3W5Z A;  5C42 B;  1FT8 A;  1N56 A;  5IC6 B;  3MD1 A;  4JI4 F;  4JI1 J;  4NLQ A;  1DRZ A;  3A3N B;  3RAM A;  2Y0S D;  2QO3 A;  4N76 A;  2V2Q A;  1LWX A;  1W2B R;  4B9U A;  3IWX A;  4KV8 A;  2YKN A;  2V2V A;  1S1T A;  4CH7 A;  4UZC A;  1Q5V A;  4LR7 A;  4TLR A;  3H5S A;  2L48 A;  4WII A;  2O1P A;  1MWY A;  1O0P A;  2HFN A;  1GMW A;  2MEW A;  1XJW B;  1Z1Z A;  4I6Y A;  2WSC C;  2R8H A;  1IKW A;  1KC8 T;  3T5L A;  3N01 A;  3OR2 B;  5L1K A;  2AD9 A;  2CPY A;  1CC8 A;  3DOL A;  2L3M A;  1VQ8 S;  4WPA A;  3C16 A;  1K73 T;  1BE4 A;  2IM2 A;  1S48 A;  2EK1 A;  3GII A;  1VBX A;  4NCG B;  1BXN A;  1WC6 A;  1GX5 A;  2NUU G;  3GYN A;  1NKC A;  2K7J A;  2VA3 A;  3MM9 A;  1FVS A;  2DIU A;  2OSQ A;  2HVE A;  3DI6 B;  1WC4 A;  5E3R A;  2VHG A;  2W7A A;  5KG7 A;  1T9X A;  1YJN S;  1NPP A;  4OX7 A;  5D4O A;  5K14 B;  2CPI A;  2YNF A;  2AGP A;  3QT7 A;  2QL9 B;  4ELT A;  3TX8 A;  4F36 A;  1HNI A;  3M8P B;  1ZM3 A;  3ET6 A;  2MKY A;  2DY1 A;  4L75 A;  2MQL A;  4F4Z A;  2CZ9 A;  3RRG A;  2RD5 C;  2KM8 B;  1QAI A;  2BE2 A;  2H5I B;  2YVS A;  4IFV A;  5IWA J;  2KXF A;  4O4G A;  4B02 A;  3PW5 A;  2I0X A;  5E3Q A;  4NXN J;  2WVE A;  4C11 A;  3QFW A;  3ILI A;  2FJA B;  1CUL A;  3DLE B;  2XMM A;  3MUM P;  1GXL A;  1LWE B;  4M63 A;  2VDI A;  1T9Y A;  3RB6 A;  5KTQ A;  2RHS B;  4Q8E A;  1YVF A;  4FVC A;  2FLO A;  3D2W A;  3CJT A;  1Q1K A;  3DDK A;  2DKO B;  2R7Q A;  4HHH A;  2WB4 A;  3H2V E;  4RKU C;  2B0G A;  5I42 B;  2LKZ A;  2Z2Z A;  2VDH A;  3FK4 A;  5ADZ A;  1QY7 A;  1NO8 A;  4E8U A;  3K2Y A;  3BQ2 A;  4P10 A;  3LGH A;  2F4F A;  1KDN A;  4DN9 A;  1R0B G;  2B4P A;  2VG6 A;  2PEB A;  3I96 A;  3IAS 9;  2PMH A;  1UAW A;  1C2P A;  3PO5 A;  4OHX A;  1SQF A;  2HUR A;  3IO1 A;  3VHQ A;  3MMC A;  3GU0 A;  4Q2L A;  1BY9 A;  2CQ4 A;  3EJM A;  3OFF A;  4KV8 B;  2YKN B;  1S1T B;  1WKK A;  5CZX A;  2BW2 A;  2W1B A;  2RDJ A;  4C48 A;  3CDW A;  4FDF A;  2QFJ A;  4DZ6 A;  4EBE A;  1QD1 A; 
#chains in the Genus database with same CATH homology
 2HBZ B;  3IBF B;  1RWP B;  2XZD B;  1RWX B;  3R7N B;  2CJX B;  2XYG B;  1RE1 B;  4ZVO B;  3D6F B;  2XZT B;  3GJQ B;  3P4U B;  2H4Y B;  1I51 B;  3D6M B;  1PAU B;  4JB8 B;  2DKO B;  2HBR B;  1RHM B;  1IBC B;  2QL7 B;  4DCO B;  2QLF B;  1SC1 B;  3KJF B;  2Y0B B;  1QDU B;  2C2K B;  5IC6 B;  1I3O B;  2Y1L B;  3R6L B;  1PYO B;  3R7B B;  3R5J B;  3GJT B;  1GFW B;  2C2M B;  4ZVS B;  4ZVU B;  2XYP B;  1RWN B;  1SC4 B;  2P2C B;  2CNK B;  1RWW B;  3IBC B;  2H5J B;  2QL5 B;  1NME B;  2CDR B;  1F9E B;  1RWO B;  3QNW B;  4DCJ B;  3D6H B;  1RWM B;  2QL9 B;  3KJN B;  2HBQ B;  2CNL B;  2CNO B;  5IC4 B;  2FQQ B;  3EDQ B;  3SIP B;  2CJY B;  2QLJ B;  3KJQ B;  3GJS B;  3P45 B;  3R7S B;  3GJR B;  3NS7 B;  1RHR B;  2XYH B;  1RWV B;  4LSZ B;  2C2O B;  5K20 B;  4ZVP B;  2H48 B;  2C1E B;  2H5I B;  4ZVR B;  4ZVQ B;  1RWK B;  2H54 B;  1RHU B;  1RHQ B;  1BMQ B;  3EDR B;  3RJM B;  2QLB B;  1RHK B;  2H4W B;  1RHJ B;  1SC3 B;  3R6G B;  2H65 B;  1ICE B;  4DCP B;  2HBY B;  2CNN B;  2H51 B;  4ZVT B;  2C2Z B;  1QTN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...