2HBRB

Crystal structure of human caspase-1 (arg286->ala) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2hbrB00
2C1EB 5IC4B 2HBZB 3GJRB 3R5JB 2C2KB 1SC3B 2QLJB 2QL5B 2C2ZB 1I3OB 3EDQB 1RHQB 1NMEB 2QLBB 2H51B 2H5IB 3NS7B 3KJQB 3KJNB 1I51B 3IBCB 2QL9B 2HBRB 2HBYB 2Y0BB 1IBCB 1QTNB 1PYOB 3R7BB 1RWMB 2C2OB 2C2MB 4ZVSB 3GJTB 3P4UB 3GJSB 4DCPB 1RWOB 2CDRB 1RWWB 1RWXB 2H54B 1F9EB 1SC4B 2CNNB 2H4YB 1RHJB 3R7SB 1GFWB 2HBQB 3R6GB 1RWVB 4ZVOB 4DCJB 2DKOB 1RHMB 1RE1B 2QL7B 2CNKB 2XZTB 4LSZB 5IC6B 1QDUB 1RHRB 2FQQB 5K20B 4ZVPB 4ZVQB 1RWKB 3RJMB 3SIPB 1RWPB 1SC1B 2H4WB 1PAUB 2H48B 3P45B 1RHUB 3KJFB 3D6MB 2Y1LB 2XYGB 3D6HB 2XYPB 2XYHB 4ZVTB 1ICEB 4ZVUB 2CNLB 3EDRB 4JB8B 4DCOB 2CNOB 1RHKB 3QNWB 3IBFB 2H5JB 3D6FB 1RWNB 2QLFB 2CJXB 2H65B 3R6LB 1BMQB 3R7NB 2XZDB 4ZVRB 3GJQB 2CJYB 2P2CB
chains in the Genus database with same CATH superfamily
3Q8SB 2WVCA 2HS4A 1U6BA 3ILIA 4UQGA 1IN0A 3H2VE 1U1OA 4FKYA 4OX7A 4WFZA 4NXMJ 2A2CA 2AJ2A 3OUYA 1KC8T 4RWXA 5HROB 4QIGA 1X4FA 1RBOB 2AYMA 2J76E 3W9IA 1BY9A 3MR5A 4DV4J 1RT3B 1T0TV 3M8PB 2KL8A 1VRTA 3M2RB 4P10A 5HQ8A 3CD6S 1FRHA 2PMHA 3ETOA 1G4CA 1UPMB 1ZM4A 4KC5A 3TVYA 1HLWA 3KLHA 5JUMA 4WP9A 3V4IB 3OVBA 3DKDA 1RACB 4PQAA 5E3AA 3UQSA 2N82B 1I51B 4NLOA 5J1PA 5JVHQ 1ZAWA 4DL5A 2A3JA 2HBRB 2LA4A 4X84A 3BR8A 4Q8EA 1ITPA 4F67A 1ZM2A 3IGNA 1X4GA 3HXMA 3EGVA 3H25A 1SI9A 1XMQJ 1DTQB 4BCAA 1OSCA 4MYUA 4YMEA 3PRBA 2CG4A 3G96A 3IM8A 3HVAA 3TO8A 1QLNA 2J8SA 4ZPAA 3GFXA 3OSPA 1U02A 1GT8A 2PA8D 2VFTA 3NRBA 3GFYA 2W24A 3THTA 2FLNA 4WIIA 3IWLA 2GHVC 1XJWB 2UVRA 2LQJA 1SQEA 3BR9A 3WX8A 3V6JA 1YJNS 4NCAA 2IAJA 3WQPA 2LDYA 2PA3A 4J37A 3TYTA 1WOPA 2EFQA 4QWCA 2V67A 4DX6A 2JX2A 3MECA 3BSAA 4KBIA 1RADB 4ITSA 4DR1J 3EGNA 5K9FA 4OJ1A 3ZO7A 4BLGA 4CLFA 1PBUA 4AXIA 4JI1F 1RA6A 2J9DA 2V8VA 2OI2A 2HFUA 4KKOB 4AUKA 3E51A 4C0HA 5EGYA 5CYQB 1NXIA 1YWXA 4WWSA 2JVOA 3RRHA 4ZPDA 1AUDA 5A0YB 1T95A 1RE1B 5J2MB 1XC9A 2PT0A 4F4WA 1HNVA 2DGWA 1OJ4A 1RB0A 2CPZA 3Q8VA 4E8UA 3J81Y 3E01A 3TUIC 4LF6F 3CNQP 1WC6A 2MQLA 1NLKL 1WI6A 2AF6A 2HQFA 3BPDA 3DI6A 3MCNA 2J9EA 2L08A 3LQVA 3D0HE 1M5HA 3WIUA 2VFRA 2C2DA 1RHRB 4O44B 3ZZ0A 3CT9A 2R7RA 2GQCA 4TQRA 4K4YA 2VBZA 2FQQB 3EE3A 5K20B 2UUAF 4IH5A 3AJ2A 3G6ES 2YTCA 4ETZA 1JB0C 2B6AB 3AQOA 1NPKA 1UTAA 1VOMA 2AJ4A 5EX3A 1WHVA 5HMYA 3N01A 1IQZA 2YKQA 2ADBA 4NCGA 2RRBA 1SIWB 2VBXA 1JIHA 3PEJA 3Q83A 3ZTSA 4BHQA 1FWLA 3TQEA 2ZWOA 3THPA 1CC8A 1X0FA 3D4JA 4AT1B 2FYXA 1RT7B 2KJWA 2R2SA 4I4BA 5J2QB 2LMIA 1IBKF 2KHDA 1N33F 2ZKUA 3M30A 4X64F 1BQNB 4AXJA 1I5OB 2DTJA 3GV7B 4ED1A 1S99A 3A8JA 4QR2A 4JB8B 1WTBA 2XI2A 4Q45A 1ZTTA 4ZP7A 3KLGB 4DR6F 1H98A 3BJYA 3RAMA 2AJ1A 2DNPA 2NUUG 2E66A 4ZJLA 4C3LA 4DI6A 4K0KF 3QWUA 2KT3A 3QAEA 4L76A 4N7TA 3C16B 2DNGA 2DPJA 3BPSP 2Z2YB 3MOJB 1LWCB 3O1LA 5KFIA 4NLVA 4QPTA 3J80U 4IR9A 2WRMA 5FLXU 1SH2A 1RTHA 2BXJA 5A6WA 4PG5A 1R0BG 2K06A 2XCAA 3T5LA 4JI5J 4RKUC 3IGVA 3M8YA 1JJ4A 2JJ4D 2AEFA 2CVEA 2QZ8A 2D7SA 5ETVA 4P72A 2LQ9A 5IWAJ 2XY6A 3ETMA 2CPEA 3IS9A 4IQMA 4ZVRB 1AYEA 4DV0J 4TLQA 5DG7A 1S1WB 2QT7A 1FHTA 3NXZA 2XULA 1VQYA 5DETA 4NOHA 3G6XA 1C0TB 3G4SS 1FD2A 2DGSA 1D8ZA 2I1RA 3FBFA 4Y34A 4I2PB 4ECWA 4ECXA 3C3LA 3OXFA 2C2ZB 3SDEB 3QZ7A 3EDQB 1V3RA 2FVCA 1NMEB 3IAS9 4OQJA 4I2QA 1FK9A 1DLOA 4PRFA 2R7UA 1MWYA 1SXLA 3N6MA 1YRUA 3NY0A 4MKBA 3S01A 3TUJC 3DGPB 1RU2A 2VPYB 2UXCF 1E6YB 1WG1A 4RW9B 3NS7B 4LVNP 1FERA 2ZE2A 5F8MA 5D0GA 3NOGA 2W9CA 4G3IA 3EZUA 2J0SD 4GKJF 1J2VA 1CJTB 1W2BR 3HJVA 9RUBA 2IBKA 1JLBB 2E7XA 2VZ9A 2LKZA 4ED0A 1CJUB 2CZ9A 5MAOA 3RW6A 4C8MA 3X3UA 2RQCA 4DV6J 3PO5A 1HYSA 4NMXA 1TQLA 2FZCB 3QRRA 3OTOJ 1IBCB 1UL3A 1R3NA 3KK1A 1W25A 2MSSA 1TL5A 3QZ8A 1Q82T 1SIZA 2IA6A 4LBIA 3NAIA 3AJDA 2DR8A 1E6YA 3BM7A 1S6QA 2ZUAA 2MQ8A 2W2PP 3OD2A 2WVFA 4RW9A 4CH1A 4J91A 4DR4J 2R3VA 4OIXA 3ZTQA 1T3NA 1ZZNA 4LFCF 3EVWA 4I69A 2CDRB 3R9LA 1LKZA 2H54B 4PPDA 1BQMB 2RMLA 2HNYB 1RTJA 1SH0A 2ZD1A 4RPFA 3VAFA 4PQUA 1FFWB 3KG4A 4I2PA 3TVKA 2ZZNA 2VB6A 4DQPA 4B9NA 1C0TA 2BX6A 1RI7A 2B9YA 4P74A 2DK2A 3MM8A 3R6GB 4TY9A 4DFPA 3PEHA 2E5GA 4N76A 4JI6F 1U49A 2FY1A 5FJ4A 2XMMA 5L1JA 1HWJA 1AXQA 2JRSA 3AB2B 3ILOA 3IS9B 4UOFA 5DGBA 3RRGA 1KN6A 3IBCB 1RHMB 1FE0A 2HK2A 2VL1A 1DQ8A 2JFKA 2V4JA 4CO0A 3P49B 3EICA 1SQGA 2Y0SD 1RT6A 3IMQJ 2ZHOA 4XK8C 1PAEX 2KU7A 5ETTA 5I42A 4DV7J 3KYLA 5GVQA 1S7IA 1YJRA 2U1AA 3QGGA 4PWUA 2ZH4A 4DR3F 1N34J 3UD4P 2Y3YA 4ES1A 3CWJA 1WKLA 1BC6A 5I3PA 4UUWA 2HGMA 1L3KA 5CYJA 2YVSA 1F3VA 1CSJA 5HJYA 2W7PA 5KFPA 2OH2A 1S4EA 4CLZA 3FZBA 3OTBA 4CH0S 5KG3A 4ECQA 3B6BA 3QYYA 3GE9A 4LREA 2F5GA 3AFGA 3KJFB 2EBEA 3KUGA 1NK6A 1VQKS 4QOTA 5J2QA 4PWWA 2H1YA 1N5TA 1UKUA 1JLAB 4JI8J 2K1RA 2P6TA 1YLXA 2LEAA 2ALYB 4LQ9A 3VGSA 4B3SF 4FS2A 3NP5A 1CQMA 4IO9Q 1D9FA 2ZE2B 2W9CB 3RBDA 1DJ0A 3KLIA 5LSLA 3OV7A 1JMTA 4M94A 5KFHA 2KYZA 1DLOB 5J1NA 4HVZA 2ILYA 3I9V9 2NSCA 2EK1A 1TKXA 1QAYA 1UJ6A 4C48A 3RBXA 1XWLA 4ES2A 1T9XA 3UR0A 2QLXA 3NKYA 5IQQA 1WOOA 2CQIA 2G13A 2YKMB 2WAQD 3DRSB 3GWCA 5AT1B 3PIPQ 2KI2A 5HANA 1Q8LA 3L7PA 5ETPA 5ETKA 4DG1B 5IWAF 1C0UB 1VBXA 4PUOB 2FLOA 1ZH5A 1RAOA 2ATCB 3QGIA 3ZZPA 3EWGA 2VQEF 1N5YA 2BZ2A 2P2CB 4HHJA 2ZBCA 2UUWA 3C46A 2HHXA 3M6UA 3R5JB 2HVHA 2ZH9A 2RILA 4QQBA 3VAMA 4WXOA 1S9EB 2C2NA 2D74B 4KGKA 4LR9A 3TAPA 4LF9F 3IRWP 2ZOFA 5IT9U 2ROPA 3ZZOA 1CLFA 3F0NA 3DDNA 3HT0A 3DLKB 2RB7A 2XMUA 1U0HA 2ZWPA 3BEGB 3B82A 4LIRA 1X4BA 2MYFA 3RUBL 3GLJA 4FDFA 1TP7A 4A8XA 3OQ2A 2JLFA 1Z2ZA 4KH1B 4KFBA 2QG9B 3PY8A 1X31C 5DS7A 1FDBA 4X64J 3DRRA 3DHWC 1JKHB 2XMJA 1LFWA 2QL9B 3DC2A 3E3XA 2GIFA 1RAJA 4RNHA 3CJKB 3RRKA 4EFAC 4IG0B 1OY6A 3JAMU 2AJQA 1BWVA 1HBOA 1P9YA 4RBTA 2PEBA 4GVBA 3T5JA 5C25B 3R7BB 5DM7Q 1EZZB 4KFBB 1U1RA 4B3RF 2G2ZA 3FMBA 1J5OA 2E5IA 1T9YA 2C2OB 4X4OA 2EG2A 2VDIA 1Q0NA 4NYPA 3AT1B 4NCBA 2NQPA 4WTOB 4NA3A 2CUYA 4CWBA 3PYFA 4X4RA 2JSXA 5HROA 1RWXB 2V8DA 5GAEI 5E7OB 1VI7A 4OZ0A 3R5GA 2N3OA 5KFWA 1TL7A 1U45A 2BEFA 3PACA 3I96A 3R27A 3IR6B 1ZA2B 2RDJA 2HMIB 5J2NA 1EETB 2DNLA 2VODA 2Z56B 2J7UA 4P7VA 1NJIT 4H4MA 4BWMA 4F04B 2L3MA 4K2XA 3OSNA 3CJ8A 4PXEA 4YEAA 4H4OA 1P27B 2GVDA 4RNFA 5KFUA 1HW9A 2FHJD 4DL3A 1YJUA 2OSRA 2HEKA 3M9OB 2YPZA 1G3OA 2ZEJA 2AX1A 4ED6A 4HH1A 5D4PA 4Y2IA 4WCEQ 2A10A 2MXYA 4DV3F 1S6UA 1MWQA 1O8BA 2DNOA 4L75A 1U09A 2HRYA 2G1HA 2WONB 1TL7B 1R6VA 2LLZA 2EEYA 3H8YA 4RLEA 3SFUA 5AXNA 3CCQS 4DL7A 1T94A 4HT7A 2B7BB 3CIMA 3J7Z5 4OZ3A 4J9OA 3J80Y 1VGYA 1IKWB 1OYDA 5ETRA 1NDPA 4DPXA 3SZ2A 1IUJA 1GMUA 2F3JA 3O2IA 5L9NA 4QBUA 3TP2A 3Q2SC 2AYGA 2KRRA 2D3UA 2IYIA 2YNIB 3HVTB 1WC0A 1Q5YA 1S49A 3B4MA 3JXOA 5D3GB 1M5PC 2XYGB 2PC6A 2ZOGA 3IRXA 4CYUA 2F63A 3CJKA 3VF0B 3RB3A 1FD8A 1S97A 1YJVA 4PWDA 4HR2A 3U1LA 4USTA 1X9WA 2AV5A 3BN4A 3CXCR 1RZMA 2KB2A 3C6UB 3MF5A 4LIWA 4U6PA 3KLHB 1UVNA 1HNZJ 3PTWA 2CNOB 4Z2XA 3BSNA 3AD8C 2BJEA 3LP1A 2GO9A 4LVOP 4PG4A 2ZVSA 5CZVA 5D4OA 2ACMA 2VQFJ 5HP1B 3BGLA 3CE8A 2NXCA 2D3O1 4B9MA 2FLLA 1U1NA 3BBFA 4P2SA 2X3GA 2W8LA 2G0IA 3TRGA 2MKCA 1B4SA 1DZ5A 5C5JA 5B0FA 3JQJA 1RTIA 1U26A 4OI2A 4K7QA 2HLUA 4NPOA 4UOHA 3SCJE 2DR9A 3CCMS 3MCOA 1N32F 2M8HA 2IM2A 2XLKA 1FNOA 1NKEA 5LJ3Y 1PC4A 3PCOB 4ZN1A 3OJUA 1QSLA 1FE4A 5C42A 3ISZA 3DRSA 2C28A 3G8SA 3DLLQ 3KDOA 4OHYA 2EWHA 1FJCA 1LWEA 2HRUA 3TZWA 2EI5A 4PKDB 3AJ1A 2C2KB 4O3PA 1F6TA 2RF2B 2D69A 5C2CA 3T5HA 1REVA 3IAM9 1RTJB 2ZD1B 2FZGB 3FBCA 2V8HA 1HW8A 4J9VA 1WHXA 5IS2A 4J9LA 4LFAF 4I7FB 1G2EA 4IKAA 1UVJA 1JQGA 3I32A 2OUGA 2VKZG 4X66J 3Q8PB 4RR5A 4X2BA 1LW2A 1HIYA 2HIYA 1T3OA 1VCTA 2CPJA 1HI1A 1CJKB 5F8IA 5LMNJ 2ERRA 2XNRA 4RO0A 1KFSA 2PGCA 1WHWA 2B8PA 4LBPA 4JI5F 3K58A 1JLAA 3TAMB 1WF2A 4I1TA 5CD4A 2R7TA 2MKKA 2X1AA 1OY8A 3M2VA 4JV2A 1RABB 4MYTA 4QWBA 3GIKA 1HWUA 4JI7F 2LQ8A 4DX8H 1CS4A 4O3QA 1IKXA 3MM5A 4R25A 2BJ3A 1TL4A 2C2MB 4OZ1A 4UY8T 4DN0A 4MKYA 5A2QU 3E8OA 3BYPA 2VONA 2QFIA 3FEZA 3L9ZA 3N0VA 1RWOB 1RP5A 3MMBB 5A8KA 2DRDA 1FK9B 2DYAA 1LXJA 2KKHA 2N7YA 2WVBA 3H2LA 4U95A 4AL5A 1MWZA 3HD2A 1H38A 2A6MA 3PRVA 2M7SA 2VG5B 3TOQA 3MUTP 1WDTA 4LSNA 4K4VA 1Q8IA 3MD3A 2QA1A 1N5QA 2H4YB 3PKYA 4OI4A 2R8HA 4JBCA 2IRYA 3VWSA 3KNGA 5CA5A 1FO1A 4OYBA 1RCXB 1SL2A 2UVUA 4HACB 4URSA 4K5SA 5CAAA 5L9XA 2HVEA 4DXLA 3HM9A 2JH3A 3I0SA 7FDRA 1T9TA 3OR2B 2E44A 4XDCA 4JI3F 4X4PA 2L9DA 2CWKA 4LF8J 2OKQA 4YB5A 5DQGA 1JLQB 3M2UB 3RBEA 2Z30B 3CTRA 1P8GA 4WXWA 3I31A 2Y9HA 4D3HA 2EC2A 3HSJA 1WTFA 1QDUB 1TMJA 1TKTA 4W98A 2ZOMA 3DLGA 4LRDA 3TUPA 1OPZA 2YKAA 3CD5A 3OBIA 2KFYA 1RWKB 1ZPWX 2CADA 3KFWX 3EZOA 3KWMA 1RBAA 2W25A 4MMOA 3BREA 4ANEA 3MAQA 2HHHF 4O0IA 1R89A 1RWPB 4C11A 3R5CA 4WBFA 5B7WA 3GCXP 2EKNA 3M30B 2ZH2A 3M2VB 3BYRA 3G9CA 4O3OA 4B02A 3CJQA 1N5YB 4KV8B 1NHKL 2DRBA 2C3OA 1NK8A 3JSRA 3I55S 1UFLA 3EDRB 3MM7B 3ISND 4USKA 3VAGA 2RRNA 2GZOA 3B4DA 4EK2A 1LWXA 3NGSA 1CJKA 2MKIA 1AFJA 2AP6A 2CKWA 2ZJPQ 1EP4B 2XLJA 4K50A 1FXLA 3D6FB 4ETXA 5HLFA 2A1BA 1N56A 3QT7A 4I2QB 3FFIB 2CVIA 3PRDA 1TR0A 1RAEB 5K8OA 2KXNB 3HHKA 1F9HA 2E7WA 5KFCA 1YQHA 5DZ6A 4ZS6A 4LMZA 1FWPA 3VGUA 3HI9A 2F40A 2HZCA 2MY7A 4WFYA 1HNVB 1R8HA 1RYSA 3UW1A 2F7VA 1UEKA 1GTHA 3OL8A 4HLBA 3K5MA 4ZCKA 3MEGB 5E3CA 1Q7YT 4AE5A 1KFDA 1BD6A 2KHCA 1H7WA 3C66A 4OYIA 4NZ7A 3EZ5A 4U96A 3VVUA 1HQ2A 1R0AB 5IT4A 2JDJA 1VK3A 1WSVA 2KN4A 3PV8A 2C2RA 3MEEA 2YWGA 4WK1A 1JNZB 2KZMA 1V3ZA 4XPCA 4O4GA 2J0WA 1JLFB 1APSA 3BV8A 2LXUA 1LWFB 1SCJB 2CQ4A 3A8EA 1U7LA 4GVLA 2KG0A 2WSEC 2CZ4A 5LMUJ 2RS8A 4OLOA 2HNDA 1RJJA 1C1BB 4CO3A 2IJRA 4NWBA 4ZIWA 4PWDB 2UVWA 1SQFA 3M4XA 3TA1A 1MG7A 4C9DA 3PKMA 1S9FA 2XS5A 3AOCA 1O0PA 2OGUA 3VTIA 2BQUA 1SKRA 1JKHA 2J6TA 2J6SA 4JI1J 1VQNS 3NLCA 4RZRA 3W2VA 2H3EB 2QSFA 3EMTA 1CEZA 2XO6A 2FC8A 2I8EA 4K0KJ 1M1GA 3NCPA 4B9VA 2CQPA 1TELA 2YNHA 2F8HA 2B6AA 2BE2A 3K17A 4LR7A 2UZAA 4RW7B 3NG8A 2MPUA 1UPPA 1F5AA 3PJWA 5GMKa 5LMNF 1S0VA 1UAWA 2V68A 4DUZJ 3AXKA 2GS8A 4IH7A 3OPKA 1RXOB 2CQ3A 3NCRA 2XCPA 2UU9F 1F2GA 4U8VA 3CMAS 1S9EA 2OPRA 2YQ0A 4HTIA 4L3KA 2HNZB 2HWTA 1VHIA 5IT0A 2YKOA 3MUMP 1RHJB 3DXSX 4OHZA 2DHAA 4FYWB 2IBOA 4C8NA 1S9GB 1Q8BA 1UVLA 4U7UD 2CPIA 2V2KA 1AT1B 3S7RA 1N0UA 2GHWA 4DG1A 2E1RA 2LDIA 1N8RT 2BW7A 2BABA 5E3PA 2A6OA 3GSIA 4LF5F 2R7VA 1EETA 4NYOA 2HNZA 3R2DJ 1K47A 4DL0C 5DDOC 4F50A 1CULA 2F4FA 2G2OA 1K1SA 1FEHA 2ASDA 1EIYB 3D1OA 2ASYA 3CJ4A 4LF5J 1HWKA 3GIJA 1S72S 4ED8A 2A0FB 2ZZTA 3N5BA 2CJQA 1MLAA 1DURA 3US5A 2EFPA 3P5BP 2E5LJ 5KG5A 2GGPB 4XPEA 3Q8QB 2OTLS 2POKA 3BBBA 3W61A 3Q2TC 3KUEA 4LFCJ 2FB0A 2LEPA 4QR0A 5T7LA 1Q81T 4O0NA 2HWHA 1FVSA 2ZC3A 1FJ7A 2AZ3A 3MM7A 1RUSA 5KFOA 3OVSA 3HFZB 2E7VA 4P2MA 2IYGA 5EUHA 4DQSA 2K3IA 3GCWP 2IJFA 4MIBA 2BKOA 5IZHA 2YWHA 2FVRA 2GJFA 1KVJA 1V9OA 4YUDA 4NEYA 4FF4A 3MHYA 3KHGA 2CAJA 4GC6A 2ZH1A 4B3RJ 2W9AA 4X65J 3HHDA 2W9BA 1FRKA 3K5OA 2M70A 1U47A 1R0CB 2QC3A 8AT1B 3GG1A 2ZDPA 3IN5A 3T3FA 1VQ5S 1QE1A 3IFEA 2GQ2A 2LXFA 3OUYB 3I0RA 1GMWD 2UV8A 5HL7Q 2RJZA 4TQSA 1OSDA 3WHIA 2CJXB 3CSKA 5HVFA 4CDIA 2P6SA 1NDKA 5THWA 2VUGA 3BH7B 4E2FB 5JMNA 4DSFA 3QQCD 4Y2CA 2ADCA 3ZC4A 4DMZA 3BH6B 1H74A 1E6VB 3GJQB 4ZITA 5M2UA 1S1UB 3BSOA 4DL6A 1Q7LB 1WEYA 1KQSR 1HWLA 2OAUA 3MM8B 3VQSA 4QIFA 4YDDB 4K4XA 4DUYJ 1JJ2R 2C1EB 2O01C 1S1VB 2FGOA 4F02A 5AE1A 1YG0A 2VPZB 5EWFA 1D0EA 4LBHA 1VQ7S 3HZGA 2WW8A 1VR6A 5E3QA 1BQMA 2FPHX 5HI7A 1FEEA 2VA3A 2XMTA 2GMJA 3MR3A 1OQ6A 5IFMA 1N36F 3H4BA 3PJ9A 3LO3A 4JI0F 2HHWA 4M63A 3CCSS 4ZCIA 2DNNA 5KT3A 5J2PA 3SBMA 1PG5B 4NLUA 4TY8B 1B99A 5U47A 2VICA 1GH8A 2BDPA 2F9JA 3HMJG 2VJVA 4AQYF 3FDSA 1NHVA 2AX0A 3IO1A 4Y2KA 3T9ZA 4DHVA 2HQGA 4UOCA 4ANDA 3FC9A 5KT5A 3QGHA 3MMJA 3K5LA 2YH0A 1QTNB 4FBTA 5KFYA 1UA1A 3MAAA 1B0VA 1SJ1A 4FYVB 2BKPA 2OEJA 3GV5B 4RJVA 4M5MA 4J9NA 1VQ9S 3BQ1A 1S1XB 3HHLA 1RWMB 1TUVA 4CLYA 1HL6A 1Y5LB 2B43A 2A2DA 3FK4A 4A8QA 3NNAA 2RDDA 3MEDB 2CYYA 4P2FA 4URQU 2SXLA 2RE1A 4UW2A 3SXLA 3C8YA 3W2WA 3DGPA 1J5EJ 3K2YA 2N4DA 1D3WA 1KOHA 1TKTB 1WD6A 2W2QP 2XHWA 2XWYA 4I7FA 3V4MA 4V19J 3MR7A 3MCMA 1J5EF 1ROFA 2KRBA 3QIPA 1VJWA 5K8MA 4K4WA 4LR8A 2M5YA 4M5NA 4RU9A 2CNNB 1FKOB 3D3BJ 4GKKJ 1I1GA 2FHJA 4M8LA 1AROP 5C2GA 1SKWA 1XN9A 1JK9B 1Q5VA 1S59A 3LTOA 2JHEA 2M52A 3CCWA 2MKSA 3DOLA 2ALZA 4MFBA 3IWXA 1I6JA 1QSYA 4QW9A 1S1UA 2UUAJ 3W9HA 2AHOB 2LU1A 4PCQA 3SCLE 5AE3A 4DL4A 1YZ7A 3AA8A 3H59A 2F8EX 4CO2A 2R8IA 3I56S 3EXYA 3U02A 1JLEA 1N5SA 2ZNYA 3DOKA 3MMCB 4FKXA 3Q22A 1BWEA 1NK9A 3DYAB 3TZXA 1TK5A 2XWXA 1XNQF 1WHYA 2RIJA 5J1EA 3THVA 5KFEA 1IBKJ 3EJMA 3T6BA 1U6ZA 4JUZA 3I4PA 4DWIA 3CCZA 2QA4G 1ZS6A 3DNCA 4Z37A 1NBEB 3LGMA 4OYOA 1UW9A 3TW0A 1L3SA 2C22A 4MKAA 3AA9A 1SB6A 1Z1ZA 2H4WB 3JYTB 1JNRB 4ZN3A 2MZTA 4OLPA 3GSDA 3CJ2A 2GA7A 4MIWA 1EB0A 5AXMA 1ICEB 4Q44A 4DV0F 1S10A 1CJUA 4KT0C 1KBRA 4NZ6A 4QJVA 4YR2A 2ATLA 2BOPA 3D1HA 4ZPVR 5HQLA 5JVGQ 3MTKA 1KVIA 4KQZA 2R7WA 2G1DA 3HSDA 3CDUA 5BYRA 4FYDA 2OPPB 2W7AA 3OFHA 4JI4J 3LGNA 2KZZA 1DY3A 3GB0A 3RYLA 4DUTA 1M90T 1MN7A 2YWKA 1GXUA 1RAAB 3A3PB 3EUNA 3MOZA 4Y2MA 2RSQA 2FZKB 3EVMA 2DR7A 1WKJA 1S79A 1BE4A 2IRXA 3QLHA 3SDEA 3A8KA 4CT9A 1W26A 3GZ7A 1F5CA 4J9KA 4H4KC 5J2MA 3VHQA 4OI3A 2X1GA 3BKFA 3QFWA 2XMWA 4IRCA 1E6VA 1U1MA 1TKDA 4IFYA 1OO0B 2YKNA 2I38A 1NK7A 2V9WA 4C3KA 4EBCA 3J7AN 5B0GA 2MKJA 2AGQA 4M5JA 2OEMA 1T05A 4K4ZA 3K8VA 3DM2B 2HHHJ 4WYWA 1NDLA 4K2JA 3ONQA 5AJ3J 1OPIA 3PR5B 4NMLA 3H2UB 1RHQB 1JXLA 4FYXB 3Q24A 2QO3A 1LWCA 1VHFA 3LWLA 4IDKB 2H5IB 3HLUA 1AB8A 2NPIA 2C2EA 3H5SA 4DU8A 2KT2A 2E9TA 3TEGA 4F2RA 1ZZFA 2CRLA 1MMLA 4ID5B 1K1QA 5DDRC 2I0XA 5KFNA 3DRPB 3KLGA 2HHSA 4WFXA 1UFWA 5IV3A 1ZA1B 3A3OB 3QGPA 4CLUA 3CEDA 1UZHA 4USIA 3GR1A 3G6YA 3FBEA 3DMJB 5B0AA 3CCRS 2DRAA 2B9EA 3EGWB 1RYRA 2XBPA 3DRPA 1FXDA 1WC1A 1ELOA 2MLXA 3UCZP 2Q3PA 3K5PA 3AY0A 4IR1A 1B0TA 2EC0A 3P4UB 1NSPA 3FCVA 3Q8UA 3HVWA 1HPZB 2I6WA 3DLKA 1HMVB 3J7YU 1VQSA 2ZBIA 4DV4F 4JV5J 3NNCA 1DHMA 2ZUGA 2Q79A 1VQPS 3NCQA 3NEKA 4ZPWR 1KVKA 2RHQB 1QAJA 3D66A 4LSLB 3R1HA 3ZFVA 2EFNA 1N48A 5LT5A 1SL0A 1L3UA 2HKEA 2GW8A 2M0GB 1KHVA 1GFWB 5D0RA 1S6PB 2LQ5A 5HMZA 3DLEA 4RBUA 4DUYF 2GIRA 2HQCA 3LP0B 4ZVOB 1YRXA 1C0UA 5AXKA 3TA2A 2Y8WA 5IM0B 4NXNJ 3M32A 2KVQE 2QMUB 1QSSA 2HVZA 2YWFA 1VYAA 1TMMA 2HMIA 2ZJQQ 2HRTA 1IKVB 2AQ4A 5IV4A 4YQWA 3TVZA 3QAUA 3QLHB 4ZKAA 2NS1B 5RUBA 4F4XA 2VG7B 4MAKA 4CLSA 4O4RA 4X66F 2GJIA 3KJVA 1YJ7A 2IVYA 1UW4A 4NLDA 4RWWA 4ECTA 1GEHA 3PW2A 1NH7A 1H73A 3H5UA 3FJ2A 4YFUA 4G1PA 1GTEA 5IT9Y 4CM0A 2GNKA 4DR7F 1VRUB 5KFDA 2HHUA 3OVAA 1PILA 3HT3A 5LXRA 4DR1F 1T03B 2FD2A 1IM6A 5H9EJ 4L6V3 1PAUB 1FCAA 3W63A 3V2UC 3WC2A 1FVQA 2CQDA 1YJTA 1KOOA 2IA0A 2R7OA 5F0UA 1UFKA 2RU9A 4WU2A 4IG0A 3W5YA 1KNZA 4WFBQ 4FXWA 2JLGA 2DGVA 2ZVIA 4DUZF 1M5KC 4QIVA 1N32J 1H72C 3IP0A 4F4KA 1WJ9A 4NA1A 3D3CJ 4CCHA 4UY85 5A2QY 3WC0A 4C8YA 1G6BA 2AJFE 2F4VF 1Y3JA 3FGVA 4AD6A 2KM8C 1PC5A 1L5UA 3KLVA 1GMWA 2AYEA 4K4SA 3HFVA 4MK8A 1RHKB 2LFVA 4PG6A 1VRTB 2UUBF 4DSKA 2DY9A 2LQBA 2DNZA 2R2RA 1AW0A 1LOUA 3W9JA 1RTDB 4YP3A 4M5KA 3TEHB 1VJQA 1PJ5A 3HD1A 4LFAJ 1Y3KA 3HSZA 3LOUA 2MQQA 4DFMA 1FRIA 2CQCA 2BJ8A 4OHXA 3Q8YA 1JLQA 1SV5B 2Q6CA 3M2UA 1JLEB 3IG1A 1HHTP 2F9DA 3KHRA 2MQOA 2V4JB 3A8IA 1C2PA 4OYAA 3U27A 5K14B 3L7UA 3LALA 3ZNUA 4ZHRA 2WVEA 5BYQA 2JEGA 3FUYA 1F3FA 3PHTA 4ZIVA 1HA1A 1U24A 3HPOA 3I5AA 1N33J 4HACA 5M2RA 3TQ1A 3I4HX 3GFZA 5HMWA 2CJYB 4G1IA 5I3UA 2PEHA 1NPRA 2W2MP 3M8QB 1HI0P 5KT2A 4PG8A 3LPEA 4M5IA 2WOMA 4F4YA 3BBCA 1RT5A 3CDAA 4A8OA 1LFPA 1MU2A 2YWWA 3SQGA 2FJBB 1HQEA 1MMDA 5HSPA 2NYIA 4Q5VA 3MTJA 1KD1T 2PMZD 4NLRA 3MEDA 1X60A 4RW6B 3KJQB 3MI7X 3OHBA 2ZH5A 3V6DA 4J9PA 1UVMA 1S57A 4RUBA 2KTQA 4ZLPA 3C15B 1T7PA 2CQ2A 1UVIA 2JOQA 2VFSA 1N5VA 3EX7B 1QTMA 3GV8B 1LW0B 4X4VA 5D4LA 3ILLA 1R31A 2HBYB 3UDCA 2B9WA 3FMWA 5CH7B 2JC1A 2W2OP 3ADAC 2M3DA 3LP2B 4JI4F 5D77A 1SL1A 4O23A 2OMLA 3C15A 3LAKA 5HMXA 4USVA 1N4LA 4OHVA 3OFEA 5DDQC 2VJUA 4J7CA 4RBVA 1IR0A 4Q43A 1BQXA 4KH0B 2RH3A 3GJTB 3DCAA 3VVTA 1CC7A 1FTRA 2DB1A 4WTYA 1LNQA 4JV5F 4BBYA 2L9WA 4P6QA 4DQQA 3QFHA 2XY5A 4CH7A 3DYAA 7AT1B 3P5TL 1F0XA 3PXGa 1XMOJ 2WOMB 2DHGA 4ZVEA 2B3TB 2GJ2A 3LW5C 2OO4A 4B3MJ 3FQKA 2MZSA 3HX9A 4I64A 3I0SB 5BJRA 3ULHA 3V6KA 4A47A 4B3TF 5KFFA 1WI8A 2YXLA 3MMAA 4KAIA 2EPIA 5JXSA 4MFBB 1QAXA 2GHPA 1YI2S 3KUHA 2JZ5A 4B9LA 2CNKB 4S0MA 3IR7B 4EO6A 3DLJA 3BGRB 3J7A1 4X4UA 2BE9B 1SJ3P 3VCDA 2YQ3A 4DN9A 4CLPA 1VC0A 2IM1A 1IR1A 3MMBA 4Y28C 2DHHA 1YHQS 1N36J 1RTDA 5D78A 4ZVQB 2MHNA 1EHWA 4I6WA 3QT6A 5HK4A 1M5OC 5AXLA 1FF2A 1ZOTA 2CPYA 3U1NA 4OZLA 4A46A 4IRDA 1X5SA 2IFXA 3CJ0A 1VFJA 2CFXA 1NNDA 2QTWA 4NLQA 4USJC 3SSSA 4RNMA 4GKKF 3L4BC 1FFGB 5A76A 4A8WA 4AYBD 3UNYA 3SSRA 4OX6A 4R5PA 2CQHA 4OZ2A 2FC9A 3MFHA 3LH2S 3P96A 1UZDA 3BDPA 4OMFG 3BF4A 3PW7A 3RB4A 2P9GA 2AMCB 5A8RB 1V3SA 4C8KA 3G87A 5CCLA 4ZCLA 5T7LB 2JEIA 1S0MA 1VRUA 2IRUA 1LW2B 1B7YB 1GX5A 1D1UA 1NB7A 3LPYA 3JSMB 3KHLA 2QRRA 2OD6A 1X4CA 2CXEA 4WE1B 1Y7PA 3GIRA 2I2YA 4XIUA 3OLAA 1JXEA 1Q53A 1MU2B 2FJAB 3SQGB 4LF4F 1VS3A 2MQNA 1X4AA 2YNFB 1KHWA 2CPHA 3ENAA 4DV7F 3SYZA 3UVJB 1VQMS 1VISA 2DGQA 3M8QA 1JLCA 1F1BB 1NK5A 4C2MA 2VIHA 4KE5A 3M32B 5DO2A 2B51A 1DTTA 3UD5A 1RK8A 3UWTA 2J0QD 4B9UA 4C0OC 2DGUA 4ZP6A 5L38A 3W5XA 2BACA 3FEYB 5K14A 1FESA 4ZHRB 4YOEA 2OMOA 5DG9A 3IG1B 3GJRB 2I5JA 1FTCA 2XM3A 5CCMA 1SC3B 3EPGA 2OP5A 4KR0B 2DVIA 1I3OB 2G4BA 1PJ6A 2X7IA 2XMKA 3PM9A 5GAEU 3MM9B 1QE1B 1PBAA 2Y1RI 1BUXA 3T19A 2HGLA 1FDNA 4DU7A 2FVQA 1TVRA 4UQTA 4IRKA 2HFNA 3HO1A 4IFVA 1H7XA 3GTYX 1IWAA 3NAHA 4LFBF 3OW2R 2EFVA 1TU0B 1LK5A 3I9ZA 3D2WA 2BJDA 3KJNB 4NLSA 1F9FA 1U6FA 3J81j 1TUWA 4DZ6A 2EBGA 2QV6A 2OFGX 3G82A 4KGZB 3C2PA 1NJYA 1DAXA 2AKWB 4PR6A 2QA4S 2R9LA 1KQKA 4CNZA 2P8IA 2D9PA 4C3MA 2HNDB 4EO8A 2X51A 1U0SA 2B56A 2CPFA 4CO5A 4EBEA 3PYEA 2WSFC 2WVDA 3ZZRA 4LRAA 3RB0A 4QIEA 2IDEA 4WP8A 1TVRB 1NRKA 3VV2B 3KG0A 3GU0A 2P5VA 2LEBA 1R8AA 3DDIA 5CYMB 5E41A 3KJVB 3NOCA 2WONA 3C14B 2R7SA 4J90A 3MZIA 2NYHA 3HP6A 3ZZUA 4LRBA 5L8RC 2WHOA 3CPWR 1Q8KA 4BC7A 1SKSA 1KTVA 4IYQA 4X62F 1H0HB 2V2ZA 4MJKA 4B3TJ 3MEGA 4A8YA 4R8UB 4KKOA 4CLKA 1CVJA 4DCJB 1TTHB 2MJNA 3O44A 1VBYA 2RAQA 4HDGA 2PE8A 2QL7B 1SH3A 1Q79A 2V0NA 1PKUA 5LM7E 4N5SA 3DRXA 5GMDA 3UVJA 4DOZA 3BO2A 2O66A 2DXFA 3U1MA 2YNFA 4LF2A 1FX2A 2VDHA 4LSZB 3HFKA 2CQGA 1KQGB 2QLWA 1X4HA 2MHEA 2YNGB 3T41A 3Q89A 2VD3A 3CCJS 4CP5A 3S8SA 4USHA 4CZCA 2JLEA 2OPPA 3FZ2A 1XEZA 5D0EA 1RKIA 2FHKA 5KTQA 3FVYA 1FDDA 4R0JA 4IG3B 2CJAA 4FVMA 1F2HA 4D3GA 2BQ3A 2HYIB 2NXUA 2HHTA 3F41A 5F9LA 2K1RB 3M05A 4OX9J 3BO4A 2KVIA 3H20A 1YX2A 5HVHA 4AL6A 3W64A 1FI4A 2UUCJ 2JNJA 2VU5A 3KK3A 4U8YA 2QMWA 2IC3B 2ZBRA 2DO4A 4DV3J 3V4IA 4IOCQ 4OYZA 3VAKA 3O8WA 1IQTA 2ZHBA 5CABA 2N3LA 2V8PA 2FJDB 2W4DA 4CTAB 5FLXY 1H6KX 4O4GB 2IMOA 3TAQA 2G9OA 2ZKTA 3OL7A 2CIMA 3DDKA 1AUSL 1WWHA 3BKUA 5ITHA 4NXMF 4KHPF 1TKZB 5D15A 5SZTA 1RT4A 4I68A 2E5JA 5KFBA 3T1HJ 5LMUF 4HDHA 3CJ5A 3NL0A 1D09B 3R6LB 2QMXA 2C3MA 3T9NA 3H5XA 1TL1A 1FX4A 3KLFA 1NUEA 3OTDA 3L3CA 2AWZA 1SKUB 2G0CA 5D4NA 4J9MA 5CD4H 4DL2A 4YB7A 2O1PA 2RVJA 4X4QA 4CI0B 2FVSA 4DPOA 1HNXJ 1K73T 2ZNZA 3GIIA 5KFAA 2H5EA 3QT5A 5KFMA 2HNYA 4P2XA 2GCFA 3WDOA 1K44A 5HQMA 3UFCX 5HLFB 4HTJA 3JSBA 3QPIA 4ZPCA 3GFHA 1H3DA 2BV3A 2UUBJ 4TU7A 3B54A 4KGXB 1WC5A 2NPFA 5HATA 2Z2MA 2MMYA 4LF7J 4Q2MA 1JJHA 4MT1A 4KSEB 2QA2A 5IOLA 2ROEA 4KO0A 1TL3A 2G2YA 1Q86T 3T5KA 3C19A 3LP2A 3MCSA 2PI5A 4KIAA 1XR7A 3RAQA 5KFQA 3TWZA 3VAHA 2NUHA 2PFFB 2HQ3A 4ENOA 1HYSB 3D7SB 3NBPB 3SMZA 4WYLA 1B0PA 5K8NA 4ZPTR 4QYZJ 2BQRA 4I6AA 3CD0A 3D0GE 3N4WA 2V2QA 2WBMA 3PZPA 3DLHA 3NMRA 5FD1A 1UETA 5GMEA 2VHGA 2BANB 4F2SA 1GXTA 1PJ7A 1UJ5A 3POTB 4DBQA 4FNIA 5KG1A 2YY3A 5HN0A 3CUNA 2KDOA 1VMBA 1FKAF 3T1AA 2OJ3A 1U4BA 1HI8A 2DEIA 1WELA 3NGUA 2ZM6J 5GAHI 1IKYB 3DN9A 3RBZA 9ATCB 4IUFA 3CJTA 1RT5B 2VKRA 1NJZA 3OFFA 1NSKL 3IM9A 3VR1A 2MDAA 5F8HA 3TJ9A 2XY7A 3CCES 1RAFB 2ZDOA 3L7OA 1LEOA 3PHEA 2VASA 3NWRA 5B0EA 1O51A 1S1WA 2IM3A 3FRYA 3UI3A 3CJ3A 5CHCB 4PPZA 4X62J 1I94J 1URNA 3QMQA 1XNRJ 4NA2A 1HKAA 1CBKA 2QN6B 4ICLB 2O3DA 5H9FJ 5KOXA 4HHUA 1WC4A 1MMNA 3OTCA 3JSYA 3KOAA 2L9NA 5KFZA 3F73A 1KQFB 1FKOA 2DNMA 5KFXA 4F36A 1RT4B 2VFVA 2W2NP 2XZTB 4JP8A 4A8FA 4PXCA 3BKTA 3MPYA 4GRSA 4U9RA 1XMBA 2IVFB 5AE2A 2JL9A 2PN6A 4M5DA 5GAHU 3KKFA 3RW7A 2CJ9A 3G6VA 2YPYA 3DGVA 4CTAA 1S6QB 2NZCA 1YBAA 4LRFA 4CLTA 4ZOSA 2NLWA 3CIZA 4J9RA 2QEXS 2E9RX 2C42A 4A4JA 4X65F 3M8SA 1WF0A 3C6UA 1S1XA 2FIUA 3HHLB 4DPUA 2IC3A 2JVRA 4HEA9 1XMOF 2H48B 4NI2A 4QPXA 3K57A 1FJEB 2F8MA 4B3OB 3NBPA 3D6HB 4CYUB 4WKYA 1RT7A 1RKJA 2J6UA 1NK0A 4RW8B 1C4AA 1VRQC 1S12A 2DJWA 2CZVC 2JWNA 1T03A 2HSEB 4M1KA 1CG2A 5KG7A 3M8RA 1S4FA 2LCWA 2V8GA 3SSQA 2MSTA 3MEKA 1C1CB 2HW3A 2OFHX 2OD4A 2Y8YA 1XIQA 3IA0A 2BKNA 4CRJA 1FRMA 5EDWA 4UUXA 3CC4S 3AD9C 3K8WA 4NRTA 3JS9A 3FSYA 1D9AA 1HQEB 1F5BA 1N52B 2QLFB 1RISA 2HFSA 4GMKA 3UDLA 2UXBF 2MGZB 3OXLA 3BDEA 1X4EA 2PIIA 3DU6A 2NR0A 4PXDA 3UCUP 1V5VA 4AQYJ 2XO7A 2VBYA 2VC1A 1VDHA 1QVFR 2R42A 5I3UB 2MKHA 1UWBB 3R7NB 4ATNA 5C42B 3LA0A 2BUNA 4A8SA 4JI0J 4ZPBA 4WZMA 2J0XA 4B08A 3A3NB 3HHLD 2ROGA 3QSYB 1UVKA 1RT1B 4FVCA 1DARA 5G0RB 4LSLA 2P9EA 4RL1A 3GILA 2QL5B 1RTHB 5LOQA 2XC9A 1XTZA 1IBLF 2GV1A 1ZETA 2DT9A 1U2FA 2RU3A 4OZNA 1GMVA 1OMSA 3TZZA 3CD7A 2IPOB 2ILZA 4P7TA 1N88A 2NSBA 3N28A 4P9SA 2JEJA 2IHR1 2BRKA 1SUQA 2M2BA 1PYTA 4OYPA 4RW7A 5F8NA 1SJ4P 2YNHB 1R7IA 2XS7A 3W8PA 3DLBA 1N54B 3CC2S 4K5RA 3MGJA 5J1EB 1PO6A 2UUCF 3D5MA 1HFEL 1B7FA 1X4DA 1HBOB 2YQ1A 4L72B 2VPWB 4OZJA 3TNVA 2Y0BB 1RSCA 4NL5A 2XI3A 4F8RA 1WDDA 3GONA 3GYNA 3ZTOA 1PYOB 2YNIA 3HVTA 4FP9A 4NCGB 2J5AA 3A12A 3K7RA 4FN5A 5KFVA 5KT7A 4DSEA 2FJXA 1Y9OA 1PCAA 4ID5A 4DS4A 2E9ZA 3OTEA 4Q7AA 2XSJB 3KDNA 3D6TB 4MKVA 4Q0BA 5H1SV 2GGPA 1RT3A 3M8PA 1FRJA 2AEJA 4WJBA 2YNGA 3L95X 1X7VA 4ZVGA 3FBBA 4RU2A 4NLYA 1FWKA 2JFDA 5GAGU 2B0GA 3MEEB 4K4TA 2M88A 3G86A 4DR3J 1H2TZ 3UR3C 3HHLC 1CULB 2BM1A 1R0AA 2MTLA 2D3OR 2AD9A 4DLGA 4Y3CA 3BB5A 3D67A 1YRTA 5G0RA 2BA9A 3PX4A 3N5FA 1GQEA 1FNXH 2HBQB 3BS9A 2GVDB 3TJAA 2DGTA 1URRA 3FNNA 3GR0A 1DTTB 3UNGC 4F4AA 1NZAA 3TARA 2QIFA 1JLCB 4J9SA 3MD1A 1ZPVA 3QO9B 4QU6A 3V5RA 4DR6J 4RNNA 2HZVA 2GQQA 2OPRB 1EARA 2GX8A 5EX0A 4WFAQ 4LFBJ 3LAMA 1WORA 2FHMA 4ELTA 5F3ZA 1UMJA 5GAGI 2JEFA 2OPSA 1HMVA 3CO0P 2Q6BA 2HS3A 2VF3A 3OR1B 4ZVPB 4PAAA 4F0HA 4TU9A 1F60B 1ULRA 2E1MC 3KLIB 1KLNA 2DBBA 1NPPA 4M95A 3CB4A 3N6NA 3W66A 4DPYA 3T6JA 2HFZA 3SI8A 1ZYQA 2VOOA 1KLMB 3P45B 4PYAA 4RW8A 4KV8A 4YDXA 3A13A 3D6MB 1DTQA 2Y1LB 3LGHA 5EHHA 3AB4B 2UU9J 3C6TB 4IOBA 1SJQA 2AEMA 4ZDNA 4CIOA 4NI2B 1FT8A 3ELHA 3I6PA 2DY1A 4ZP9A 3HK2A 1T9UA 2DO0A 3UDVA 1BHNA 1WEXA 4Y6IA 1KKHA 1JJCB 1YTYA 3H5YA 2Q66A 4MTPA 3R97A 2OELA 3F56A 3FRZA 4IFVB 2WCXA 1JWWA 3QNWB 1SUQB 1LWFA 3CJSA 1EKRA 2UXDF 2H5JB 2GC8A 4IDKA 1KTQA 4KHRA 3ZTRA 3MFIA 1N6QB 2E5LF 4USUA 1S1TB 3OLBA 3MM9A 1UA0A 4DV6F 4LF9J 4ED2A 1K8AT 1KONA 4NLPA 4FPRA 3SCKE 4EUVA 1U1KA 4GC7A 1NJXA 1NSAA 4GKJJ 1TUGB 1RT1A 1B70B 2R8KA 3OR2A 4XTTA 1R8CA 1M1HA 2XZDB 3HF5A 5JJBA 3JB9k 3CMQA 4FBUA 4PUOA 1IBMJ 2ACYA 1HD0A 2OIHA 4ZMMA 1UWBA 3AD7C 3QJLA 1NKBA 4YR0A 2HBZB 2QFJA 4IQXA 2DHXA 4U7CA 3V81A 2UUTA 3NGKA 4ZK7M 1TKXB 2KXFA 3QIPB 4B17A 2MGZA 1IKYA 3IWNC 3ZNJ1 2WTFA 3MXHP 1EX8A 4LT6A 1HBMA 1TV6B 4C8LA 2H51B 2MQPA 3OL9A 1NO8A 1Q78A 4WE1A 4WK3A 4FZVA 4BDPA 3EM1A 1EP4A 4NRUA 3TZYA 2DISA 2KFZA 1LK7A 3ENQA 1VBZA 3Q23A 2Z4PA 5KG4A 3N79A 4DV5J 3GP9A 1XQIA 4FXDA 2ABYA 3W3SA 3OFGA 1XK8A 4NLGA 2BRLA 1LXNA 2Q43A 6FD1A 7FD1A 3I5CA 1GAOA 3AH6A 1X5TA 3JAMY 4DR5F 2VV5A 3EYZA 3UN2A 4OX9F 1HBUA 2BJ7A 1V5IB 2ZJRQ 4U7UK 3PW0A 2BYCA 5DZ7A 4C11B 4OZ5A 2R2UA 4C6AA 4DSLA 1VLOA 4JI2J 3UO0A 2EKYA 4TY8A 1SJRA 1SPBP 2AIRB 3O3LA 3X1LB 2V63A 2DEJA 4LF1A 4ZVSB 3M9NB 4V1Ak 3DLGB 4XO0A 4W92B 4DCPB 1K0TA 5KFLA 2B7CB 4KTQA 4M5GA 1AZSB 1CJVA 1Q16B 5D0HA 2LU2A 3H7HB 1W2IA 4FPIA 4KPCA 5KFRA 2OPQA 5L39A 4NLWA 2MLZA 2ZITA 4E98A 2HGNA 2K8GA 3DU5A 5B09A 3DOKB 5I42B 1G7CB 2MZJA 2W7OA 3T1HF 1VC6A 3E2EA 4YHHJ 1S1VA 4LJMA 2KYXA 2N4CA 2NXEA 1R27B 2PSZA 4ZP8A 4F26A 2IM0A 5B08A 3G8TA 3LWMA 4DV1F 1TK0A 4NXNF 5DM6Q 1S76D 3VALA 2HG4A 3DRYA 2DKOB 1HQUA 5ETMA 3DOLB 1RTIB 3VGTA 2F4VJ 4EWTA 4B3SJ 2DR6A 4LSNB 1NB2A 4O3SA 4LF7F 6AT1B 5FDLA 3TX8A 1P1LA 2OPQB 2RS2A 2HQDA 2LP4A 3MWBA 3I0RB 1AZSA 1CJVB 2FGCA 3W65A 4CO1A 3M8ZA 2NREA 2PFDA 1N0VC 1N6QA 1HNIA 2DCUB 4G65A 2BM0A 3W2WB 4WFNQ 1HBNB 4DS5A 1Q95G 2BANA 2FJEB 2C3UA 2IVMA 5T41A 5L1LA 1EAYC 2BJ1A 3M1VA 1YKWA 1SC1B 2YH1A 2GAGC 5F0WA 4C97A 4PEOA 1FRLA 1IR2A 3MAAB 2O67A 3VQTA 4DF4A 3LANA 4ED7A 1DQ9A 3C6TA 3MR6A 1P1TA 3IRXB 3TAMA 4C8OA 5D3GA 4WPAA 4QIWD 1KLMA 2K2PA 2EVZA 3K59A 5ETLA 1JLBA 1Y4ZB 2CNLB 1S77D 3MURP 4F3OA 2F65A 4OYWA 2DIVA 3P3DA 4IG3A 5LXYA 1A0OB 2APOA 4X4SA 4DCOB 4H4KA 4EGLA 4ILMA 2HHVA 1U1PA 4L74A 2RKIA 3FSXA 3EGZA 3IBFB 2W8KA 3FQLA 5LSOA 2CJKA 1Y5IB 3DOMA 1TV6A 2O5DA 2XMAA 3PW5A 1SJFA 1QM9A 1REVB 3ILJA 4NX9A 3TJ8A 4TKTA 2KM8B 4XDDA 4FF1A 3QJJA 1C4CA 5E33A 3T1YF 4L73A 1IKVA 1OYEA 4MK7A 1YBUA 5L46A 4IH6A 1RLDA 2A18A 4KHMA 2C3YA 4I6YA 2VOPA 2MLYA 3W1YC 2EFGA 3KG1A 1NAQA 1MNEA 1ZTWA 4EZ6A 3FEXB 5CYQA 4N41A 2CQ0A 5BR8J 5F8JA 1H2VZ 1I94F 3DLEB 2HHPA 1MW7A 4DSJA 4H4MB 3PO4A 2CJBA 4K8RA 1QY7A 2HURA 3BSCA 5J2NB 3AOBA 2FTRA 1O5JA 1T02A 1IXKA 1SV5A 2DITA 2KJVA 4JI7J 1QUVA 2GMHA 3J7YI 3HJFA 3N6LA 2K7JA 2VFUA 2X1FA 2W1BA 4TVAB 2IAJB 1RCOB 5LSRA 1LV5A 2R7XA 2YX7A 4C4WA 5KFJA 4Q0BB 2CG8A 3U7JA 4DQRA 4ERDA 1IM4A 1P6TA 4HKQA 2XSJA 2BE2B 1M5SA 2IDLA 3DHXA 5T14A 4DV2F 1X8DA 2GMLA 5DLFA 2KFNA 3W60A 4CO4A 4DV5F 1L3VA 2WB1D 4QWDA 3ISNC 5C25A 4N8OA 1BQNA 1HR0F 4TN2A 2CA9A 5DLGA 3M9MB 1LQ9A 3R5DA 5KFGA 4OL8A 4TU8A 1VIOA 1UJ4A 4QW8A 2UXDJ 4RW4A 4KPYA 4B3MF 5CXTA 3SV3A 3PVXA 2WSCC 1R6YA 4A8KA 8ATCB 4DZDA 1HNWJ 3D28A 4O44A 2OPSB 4ZJQA 4WKRA 2BVZA 3QSIA 2FVPA 4DR4F 2FDNA 2MZ1A 4PQUB 2VG7A 1ZM3A 1F9EB 2K3KA 4YY3F 2VBWA 2RUSA 3DM2A 2BBEA 4PZVA 5C7PA 3B78A 5A8WB 2DHSA 3FCWA 2X3DA 2HK3A 4K4UA 3GYGA 1B64A 2MKYA 4R8UA 2R4FA 2V4RA 2HVIA 4ZVFA 2VQFF 5L1KA 1J27A 3KMSA 5B0BA 1KP6A 1X5OA 1YSJA 3DXBA 3MR2A 2V9KA 4QU7A 5A8WA 1U25A 2BJ9A 4HH0A 1CQNA 4KY3A 5E3RA 2W4CA 5LJ5Y 1G1XA 3MECB 5IXUA 4F7VA 2IY5B 5CYMA 3FFIA 4LQ3A 3OL6A 2H9ZA 1QJHA 2XGPA 2GAHC 1HPZA 1V6HA 1JLGA 5I3QA 3GIMA 2D1CA 1KDNA 2J9DE 2KG1A 2RUGA 2XGQA 4LUBA 3LF0A 2DNQA 3SIPB 1YDLA 2LYVA 4V19X 4OFZA 4RW4B 2RQ4A 2YWEA 1WNEA 1XNQJ 1FFSB 3DMJA 1RHUB 1T9VA 2EFOA 4UZBA 1YBTA 2KXHA 3HULA 4NASA 3OHAA 4KGMA 5HJXA 4OV1A 1P9QC 3G82B 4P52A 4EI2A 2KH9A 1FA0A 4R5PB 2Y1JA 2E1CA 2N7CA 1C1BA 4OJHA 5L1IA 1VQLS 3JQMA 2DNKA 1WC3A 2NXJA 1UP1A 2FY8A 4C7QA 3CGIA 2BOAA 4C0BA 3CF5Q 4ID8A 2EW9A 1M0SA 2LVWA 1HBNA 2YBVA 3FCHA 3R3TA 4NEZA 2VC0A 2LECA 2DH8A 3CMES 4Z7CA 1U0HB 4DLEA 1FNMA 1FKPA 3IR5B 1RWNB 1U2CA 2Z8QA 4M5DB 4ED3A 1A9NB 1Y10A 4G1QA 5KFSA 3BGOP 3KMQA 5DGAA 2D9OA 3MM6B 3Q86A 5ETQA 3SEOA 1JXVA 2DPIA 1RA7A 2NXNA 1YGYA 2H65B 4KGVB 5KOWA 1T05B 2V69A 2HIQA 3DFEA 2E29A 2YKNB 3ZZYA 3QJPA 4ELVA 4J5OA 3FSIA 4I0WA 2ZBQA 4P71A 4UF4A 4PXBA 2Z58B 2B4OA 3BGFA 3QT8A 2DH7A 1Q4RA 2AGPA 1VQ4S 3B8HA 3PYDA 4QR1A 4J9UE 2QX0A 5IC4B 4DJBA 3PFOA 5GADU 4ECYA 3BGUA 4YB1P 1S0NA 8RUCA 2VH7A 2LXIA 3ZZZA 2CPDA 3P8BB 3GG0A 2QLJB 2DNYA 3KK2B 3BQ2A 4EYHB 2GVZB 1NSQA 3RB6A 4C98A 3BN7A 2AU0A 2XTJP 4N77A 3JQKA 1FDAA 3DOMB 4ZCMA 5A8KB 4N8NA 3A1YG 3ITHA 5F3TA 3W62A 1NU4A 3JSMA 1QAIA 3H0PA 1WACA 2VA2A 2OHDA 4Y00A 2NZ4A 3M8WA 1REGX 2HVDA 4R0EA 4RNOA 1EQ0A 1IKXB 5B0DA 2G0JA 4ECSA 2BE7D 2M4MA 4JV1A 1CS4B 1Z4UA 1OQ3A 2NCKL 3CCTA 4O3NA 2QE5A 5DG8A 4OHWA 3AOAA 3PX0A 5D8HB 4TYAA 1YK9A 1GNKA 5GADI 4C8ZA 3TI0A 5KFKA 5KFTA 2RQKA 4UTGA 5AJ3F 1O6XA 3JYTA 2B4UA 2DGOA 3O6QA 4KO0B 3K0JA 2YX4A 3TX0A 4CM2A 3CCUS 3F44A 4K59A 4NLTA 5F41A 4USWA 1K9MT 4OYMA 4F3MA 5ADZA 5M2PA 1TZ0A 3D0IE 4XAKA 1FJGF 1T8EA 4CLLA 1D8YA 2UXCJ 1BGXT 3I82A 3RAXA 3QRPA 3TR5A 4WZQA 1HBMB 2OSQA 2B8QA 5KT6A 3PW4A 3GQCA 2AT1B 2RDIA 3PR4A 5FDLB 2IJNA 4E0DA 1SC4B 1TK8A 1YJ9S 3HKZD 4BS2A 1NH8A 1BXNA 3QRQA 3I87A 2HHQA 2U2FA 3JTOA 3R7SB 1OS5A 1D9DA 4ICLA 2E1AA 2MQMA 5BXIA 3PIOQ 4FS1A 1GK8A 3QWPA 4ED4A 5H9EK 3MMAB 3KLFB 4M5LA 4DQIA 2MZQA 4OYXA 4W90B 5ETSA 5A6PA 1OWXA 5EWEA 3D68A 3VZHA 4UOGA 2Q1LA 3HDSA 4YN3B 3KLEA 5DJBA 5E0OA 2XB2D 1TKZA 4P75A 4ECVA 5SUHA 5IC6B 4DF8A 3HCXA 2V4QA 1RLCL 5CQGA 2R7QA 2AGOA 4HT5A 4ECRA 3C16A 1N34F 4ES3A 2QYCA 2WW4A 1VBKA 2W9BB 3NS5A 5EWGA 4ELUA 1QD1A 2LA6A 2XQCA 4M5HA 5K8PA 4DPWA 4ZA1A 1JX4A 1U1LA 3AODA 4CT8A 5B0CA 1A7GE 5KAKA 4F3QA 2BMBA 2HWIA 4DR5J 2XYHB 2RNEA 1KR4A 1ZAVA 2FHOB 4X4NA 4EU0A 1M5VC 3WIVA 1HWIA 2BR0A 3BZQA 3L09A 2ASJA 1RU1A 2V34A 2KO1A 1VC5A 1B3TA 4JI2F 1MROA 4F0KA 2F1FA 4RW6A 1AA1B 3V6DB 2HFOA 4X4TA 1IKWA 4DR7J 3OR1A 3NNHA 2AZ1A 3S6EA 4DV1J 4HYKA 2FJWA 2W4PA 4FNHA 3UN3A 1R43A 2XG8A 2RD5C 3BO3A 1RT2A 1OY9A 1T9WA 2QYGA 3E01B 4FF3A 2C3PA 2CDQA 3D54A 1RDRA 3HKWA 3QO9A 5D6GA 2J7WA 1BMQB 1SVDA 3PYGA 4LRCA 4JI8F 3HHEA 3OJSA 2B4PA 3GMGA 4ILRA 3WBZA 5DQHA 4H4OB 3G8QA 3M7VA 2DNHA 5F8LA 1S6PA 3MUVP 3SCIE 4JI6J 2WZ1A 1RAHB 4Z7YA 3R1LA 2R8GA 3I5BA 4JOUA 3MAHA 4P73A 2EG1A 2UV8G 3WX4A 2V5HG 5DDPC 1YIJS 3R2CJ 2WK4A 1ACMB 4U67Q 3MM6A 3C14A 1H2UX 1HARA 4L3NA 4DDFA 5IQ6A 4G1QB 3NGTA 1FKPB 1EKSA 1XR5A 3KNAA 1U48A 3NWGA 2W01A 3HSGA 3LP1B 3K89A 5DRKA 4NE9C 1EJ7L 4LF6J 1J5OB 1PSDA 4GO5X 4WP3A 3AAWB 4YS2A 4QCLA 2HFVA 3KXDA 4H54A 2Y1IA 1YZ6A 3HZEA 3W2VB 3R8YA 3NMAA 1EQMA 4CLWA 2OLWA 2CPXA 3UDEA 4OI0A 2QGFB 4ER8A 1NJWA 4FXVA 2B9XA 4FYYB 3UE2A 4BWJA 2ASLA 3W8GA 2FLPA 1WF1A 3PJXA 4Q2LA 3ZXWA 2DH9A 1Y11A 3JTNA 5G4DA 1QVGR 4QYRA 1NEEA 2Z57B 2QSWA 1L3TA 1FXRA 4DR2J 4QWAA 2XS2A 3ICLA 3M2RA 2ZM6F 1JLFA 1NK4A 3N9UC 3GJSB 4HL9A 3VAJA 4HI2A 4ED5A 4JYAJ 3MPDA 1FRXA 2HZAA 1DRZA 1RWWB 3O5TB 4ALZA 4DR2F 2CQBA 1Q1KA 2OEKA 4IOAQ 3GPAA 4WF9Q 4EZ9A 1DFDA 2OTJS 1RAGB 3ET6A 3MPUB 3MPVA 3V6HA 1K0VA 1MSWD 1BLUA 5A0YA 4JV0A 4IFYB 1RWVB 1TAQA 5IM0A 1NZ8A 2M9KA 4KYZA 5C24A 4RUCA 3LP0A 3UD3P 1WKKA 2ZFHA 1S9GA 5BR8F 1HR0J 2MJUA 1KWMA 1NHUA 2YKMA 3M6XA 3NS6A 4KB7A 3CDBA 5HVGA 3KTQA 2JC0A 5E2QA 4ILLA 2R8JA 3RTVA 3ET6B 1X5PA 2RT3A 4MH8A 5CZXA 3RG6A 2XLIA 1Z2LA 1IWGA 1RT2B 4JI3J 1RBLA 5E5NA 3RZAA 2PMWA 1SC6A 3D9BA 2L48A 4ZLJA 2E5HA 4W4MA 4ECZA 2XSFA 1X9MA 4DX7A 2ZH8A 3H90A 2AJ0A 2GO8A 2FJVA 2RKIB 1C1CA 3OXGA 3PFEA 1SBRA 4IO1A 3RGIA 3TA0A 4EYIB 1XR6A 4OV6A 5A8RA 2MB0B 4DSIA 2L41A 3VZIA 4YY3J 3R5AA 3CVKA 4GVBB 1R8BA 4I67A 4Q8FA 1VLYA 2XEXA 4MIAA 2WB4A 1S7HA 1WEZA 4ZVTB 3CDWA 1HNWF 4EBDA 4ZVHA 1WUUA 3DRRB 3G71S 1FJGJ 1DQAA 3AHPA 1A6LA 4WIQA 2CQ1A 2J7KA 1S6OA 3J81U 5DQIA 4AL7A 4LF8F 4UZCA 2HAFA 4A48A 3S1TA 3SFGA 3M6VA 1T11A 5KG6A 2UXBJ 3ZTPA 1HNIB 1PIEA 1W7WA 3OTOF 3CCVS 4F4ZA 3HHNB 4N56A 4YB6A 5HO4A 5KG2A 5KT4A 2ZH3A 1TFYA 2HS0A 4YHHF 1QUPA 3H42A 2RRAA 3Q8RB 1HNZF 1HHSA 3KLEB 2V94A 1PGZA 1RT6B 1S5ZA 2I5JB 3NGRA 2DCLA 1UWAA 1RWUA 1ZAXA 3MDFA 2D3ZA 1WG5A 1HQUB 3JTPA 3K5NA 2IIHA 5F9NA 2DIUA 1IJFB 4Y2AA 2P9CA 1PYSB 3IC1A 2V2VA 4URGA 1KS2A 3KK3B 5I4MA 2VG6A 2M8DB 2DGXA 1IBLJ 3CC7S 2IMWP 4CQ1A 4QYZK 4N47A 2DD8S 3RR7A 2DR5A 3W7BA 1Y0HA 1GXLA 4MK9A 4ZJOA 2QLBB 3BQ0A 4J9QA 3PG9A 4CNYA 4USMA 3QIDA 4KJIA 3TANA 1CPZA 4WU3A 2ZC4A 1NM2A 1MN9A 3POTA 4OI6A 3HVRA 2ZH6A 3P6YC 1MROB 2BW2A 1VQOS 1NDCA 4Y65A 1NCLA 2B5JA 1KRPA 4LF4J 2PO4A 1UEVA 2XZWA 3KK1B 2GFFA 2Z2LA 3QBCA 1HBUB 4HHHA 4KHPJ 1TAUA 1WOSA 1XMQF 4OJ3A 4B3OA 4O3RA 6FDRA 2B5JB 4G6VB 3EVOA 2ZH7A 2K7KA 5HBMA 5H9FK 3UPFA 1RGVA 1HNXF 4UT4A 3M1VB 1M1KT 4TXSA 4AFFA 4KRWA 4YR3A 4ANCA 5J2PB 1Y00A 1WG4A 4QZVB 1Y5NB 2J9CA 2PDAA 3ITHB 1YITS 2Z0GA 3GYXB 4JYAF 2ZHAA 1U8WA 4OI1A 3ENVA 4FF2A 3BGRA 2RF2A 2V6AA 2YKPA 3MMCA 3KK2A 1IJEB 2AYBA 2FUG9 3TUZC 3D1QA 3SV4A 4BC9A 2RHSB 1ZM9A 2XMVA 1R8PA 3VGVA 3CJRA 4RUHA 3V81B 4F0MA 4TYBA 2RQMA 1OIAA 1VQ6S 2MZRA 4OX8A 4RUAA 5LL6d 3H98A 3G2XA 3J7ZT 2AW0A 2J8AA 4QWEA 2XHCA 1TL1B 3QATA 4B9TA 4DX5A 4PG7A 3SQOP 2CWXA 3ZZTA 1S48A 3CDEA 2HPUA 1HHQA 1RAIB 3CW2C 4DFKA 1YJWS 1X0PA 2VG5A 3A4TA 3ENWA 1WSRA 4NLXA 3CULA 3IXQA 4TNOA 2ZZMA 4NZ0A 1S1TA 1YVFA 3UN5A 1XERA 2R2TA 2PI4A 5HP1A 2ZBPA 1XBWA 1GX6A 2QJ3A 3CO9A 5ETOA 5HAOA 3FKBA 3RJMB 3RU0A 2UVVA 2MY8A 2HAIA 3H40A 4F25A 3MM5B 4TLRA 3NGDA 2I9SA 5HBMB 4PABA 1UCNA 3AXMA 4ZLNA 5EN1A 2VPXB 1UEUA 2GIQA 3M6WA 2VQEJ 1VK8A 4GO7X 5KG0A 4EMDA 3MPWA 2EXUA 2XYPB 4RX6A 1IBMF 3OT9A 4ZVUB 4NYZA 1U8SA 3W5ZA 4ZLLA 3Q0AA 1LW0A 2HLTA 4DFJA 1U1QA 1TL3B 2EK6A 1VIXA 1CJTA 2DNRA 4A8MP 1ZBTA 1TFWA 5ETNA 3AQPA 2KT5A 4HI1A 3EXCX 3IBWA 3T1YJ 1X9SA 4B9SA 3RR8A 3H4DA 4DEZA 1DBDA 4ECUA 1U2RA 1JLGB 2D41A 3WZ0A 1KSPA 1XNRF 2MEWA 3PX6A 2UP1A 3PDNA 2YX1A 4DPTA 2COLA 2HQIA 1NKCA 5MLCV 2V50A 5F8GA 2X1BA 5BYSA 2B4VA 2GVZA 2XNQA 3PNIA 1KEKA 3EPIA 3DI6B 4EEYA 1VQ8S 5K5MA 2PD1A 1HD1A 1LWEB 4OJGA 2E1PA 3CCLS 2VG6B 3KHHA 1RQ0A 4DV2J 2WBRA 3LUYA 4Y0FA 3R5BA 1IVZA 4PYDA 1RTZA 3VAIA 5FIIA 1AFIA 5C24B 1S0OA 4I56A 3UCGA 2Z2ZA 2DXDA 2DXEA
chains in the Genus database with same CATH topology
2C1EB 5IC4B 2HBZB 3GJRB 3R5JB 2C2KB 1SC3B 2QLJB 2QL5B 2C2ZB 1I3OB 3EDQB 1RHQB 1NMEB 2QLBB 2H51B 2H5IB 3NS7B 3KJQB 3KJNB 1I51B 3IBCB 2QL9B 2HBRB 2HBYB 2Y0BB 1IBCB 1QTNB 1PYOB 3R7BB 1RWMB 2C2OB 2C2MB 4ZVSB 3GJTB 3P4UB 3GJSB 4DCPB 1RWOB 2CDRB 1RWWB 1RWXB 2H54B 1F9EB 1SC4B 2CNNB 2H4YB 1RHJB 3R7SB 1GFWB 2HBQB 3R6GB 1RWVB 4ZVOB 4DCJB 2DKOB 1RHMB 1RE1B 2QL7B 2CNKB 2XZTB 4LSZB 5IC6B 1QDUB 1RHRB 2FQQB 5K20B 4ZVPB 4ZVQB 1RWKB 3RJMB 3SIPB 1RWPB 1SC1B 2H4WB 1PAUB 2H48B 3P45B 1RHUB 3KJFB 3D6MB 2Y1LB 2XYGB 3D6HB 2XYPB 2XYHB 4ZVTB 1ICEB 4ZVUB 2CNLB 3EDRB 4JB8B 4DCOB 2CNOB 1RHKB 3QNWB 3IBFB 2H5JB 3D6FB 1RWNB 2QLFB 2CJXB 2H65B 3R6LB 1BMQB 3R7NB 2XZDB 4ZVRB 3GJQB 2CJYB 2P2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1E B;  5IC4 B;  2HBZ B;  3GJR B;  3R5J B;  2C2K B;  1SC3 B;  2QLJ B;  2QL5 B;  2C2Z B;  1I3O B;  3EDQ B;  1RHQ B;  1NME B;  2QLB B;  2H51 B;  2H5I B;  3NS7 B;  3KJQ B;  3KJN B;  1I51 B;  3IBC B;  2QL9 B;  2HBR B;  2HBY B;  2Y0B B;  1IBC B;  1QTN B;  1PYO B;  3R7B B;  1RWM B;  2C2O B;  2C2M B;  4ZVS B;  3GJT B;  3P4U B;  3GJS B;  4DCP B;  1RWO B;  2CDR B;  1RWW B;  1RWX B;  2H54 B;  1F9E B;  1SC4 B;  2CNN B;  2H4Y B;  1RHJ B;  3R7S B;  1GFW B;  2HBQ B;  3R6G B;  1RWV B;  4ZVO B;  4DCJ B;  2DKO B;  1RHM B;  1RE1 B;  2QL7 B;  2CNK B;  2XZT B;  4LSZ B;  5IC6 B;  1QDU B;  1RHR B;  2FQQ B;  5K20 B;  4ZVP B;  4ZVQ B;  1RWK B;  3RJM B;  3SIP B;  1RWP B;  1SC1 B;  2H4W B;  1PAU B;  2H48 B;  3P45 B;  1RHU B;  3KJF B;  3D6M B;  2Y1L B;  2XYG B;  3D6H B;  2XYP B;  2XYH B;  4ZVT B;  1ICE B;  4ZVU B;  2CNL B;  3EDR B;  4JB8 B;  4DCO B;  2CNO B;  1RHK B;  3QNW B;  3IBF B;  2H5J B;  3D6F B;  1RWN B;  2QLF B;  2CJX B;  2H65 B;  3R6L B;  1BMQ B;  3R7N B;  2XZD B;  4ZVR B;  3GJQ B;  2CJY B;  2P2C B; 
#chains in the Genus database with same CATH topology
 3Q8S B;  2WVC A;  2HS4 A;  1U6B A;  3ILI A;  4UQG A;  1IN0 A;  3H2V E;  1U1O A;  4FKY A;  4OX7 A;  4WFZ A;  4NXM J;  2A2C A;  2AJ2 A;  3OUY A;  1KC8 T;  4RWX A;  5HRO B;  4QIG A;  1X4F A;  1RBO B;  2AYM A;  2J76 E;  3W9I A;  1BY9 A;  3MR5 A;  4DV4 J;  1RT3 B;  1T0T V;  3M8P B;  2KL8 A;  1VRT A;  3M2R B;  4P10 A;  5HQ8 A;  3CD6 S;  1FRH A;  2PMH A;  3ETO A;  1G4C A;  1UPM B;  1ZM4 A;  4KC5 A;  3TVY A;  1HLW A;  3KLH A;  5JUM A;  4WP9 A;  3V4I B;  3OVB A;  3DKD A;  1RAC B;  4PQA A;  5E3A A;  3UQS A;  2N82 B;  1I51 B;  4NLO A;  5J1P A;  5JVH Q;  1ZAW A;  4DL5 A;  2A3J A;  2HBR B;  2LA4 A;  4X84 A;  3BR8 A;  4Q8E A;  1ITP A;  4F67 A;  1ZM2 A;  3IGN A;  1X4G A;  3HXM A;  3EGV A;  3H25 A;  1SI9 A;  1XMQ J;  1DTQ B;  4BCA A;  1OSC A;  4MYU A;  4YME A;  3PRB A;  2CG4 A;  3G96 A;  3IM8 A;  3HVA A;  3TO8 A;  1QLN A;  2J8S A;  4ZPA A;  3GFX A;  3OSP A;  1U02 A;  1GT8 A;  2PA8 D;  2VFT A;  3NRB A;  3GFY A;  2W24 A;  3THT A;  2FLN A;  4WII A;  3IWL A;  2GHV C;  1XJW B;  2UVR A;  2LQJ A;  1SQE A;  3BR9 A;  3WX8 A;  3V6J A;  1YJN S;  4NCA A;  2IAJ A;  3WQP A;  2LDY A;  2PA3 A;  4J37 A;  3TYT A;  1WOP A;  2EFQ A;  4QWC A;  2V67 A;  4DX6 A;  2JX2 A;  3MEC A;  3BSA A;  4KBI A;  1RAD B;  4ITS A;  4DR1 J;  3EGN A;  5K9F A;  4OJ1 A;  3ZO7 A;  4BLG A;  4CLF A;  1PBU A;  4AXI A;  4JI1 F;  1RA6 A;  2J9D A;  2V8V A;  2OI2 A;  2HFU A;  4KKO B;  4AUK A;  3E51 A;  4C0H A;  5EGY A;  5CYQ B;  1NXI A;  1YWX A;  4WWS A;  2JVO A;  3RRH A;  4ZPD A;  1AUD A;  5A0Y B;  1T95 A;  1RE1 B;  5J2M B;  1XC9 A;  2PT0 A;  4F4W A;  1HNV A;  2DGW A;  1OJ4 A;  1RB0 A;  2CPZ A;  3Q8V A;  4E8U A;  3J81 Y;  3E01 A;  3TUI C;  4LF6 F;  3CNQ P;  1WC6 A;  2MQL A;  1NLK L;  1WI6 A;  2AF6 A;  2HQF A;  3BPD A;  3DI6 A;  3MCN A;  2J9E A;  2L08 A;  3LQV A;  3D0H E;  1M5H A;  3WIU A;  2VFR A;  2C2D A;  1RHR B;  4O44 B;  3ZZ0 A;  3CT9 A;  2R7R A;  2GQC A;  4TQR A;  4K4Y A;  2VBZ A;  2FQQ B;  3EE3 A;  5K20 B;  2UUA F;  4IH5 A;  3AJ2 A;  3G6E S;  2YTC A;  4ETZ A;  1JB0 C;  2B6A B;  3AQO A;  1NPK A;  1UTA A;  1VOM A;  2AJ4 A;  5EX3 A;  1WHV A;  5HMY A;  3N01 A;  1IQZ A;  2YKQ A;  2ADB A;  4NCG A;  2RRB A;  1SIW B;  2VBX A;  1JIH A;  3PEJ A;  3Q83 A;  3ZTS A;  4BHQ A;  1FWL A;  3TQE A;  2ZWO A;  3THP A;  1CC8 A;  1X0F A;  3D4J A;  4AT1 B;  2FYX A;  1RT7 B;  2KJW A;  2R2S A;  4I4B A;  5J2Q B;  2LMI A;  1IBK F;  2KHD A;  1N33 F;  2ZKU A;  3M30 A;  4X64 F;  1BQN B;  4AXJ A;  1I5O B;  2DTJ A;  3GV7 B;  4ED1 A;  1S99 A;  3A8J A;  4QR2 A;  4JB8 B;  1WTB A;  2XI2 A;  4Q45 A;  1ZTT A;  4ZP7 A;  3KLG B;  4DR6 F;  1H98 A;  3BJY A;  3RAM A;  2AJ1 A;  2DNP A;  2NUU G;  2E66 A;  4ZJL A;  4C3L A;  4DI6 A;  4K0K F;  3QWU A;  2KT3 A;  3QAE A;  4L76 A;  4N7T A;  3C16 B;  2DNG A;  2DPJ A;  3BPS P;  2Z2Y B;  3MOJ B;  1LWC B;  3O1L A;  5KFI A;  4NLV A;  4QPT A;  3J80 U;  4IR9 A;  2WRM A;  5FLX U;  1SH2 A;  1RTH A;  2BXJ A;  5A6W A;  4PG5 A;  1R0B G;  2K06 A;  2XCA A;  3T5L A;  4JI5 J;  4RKU C;  3IGV A;  3M8Y A;  1JJ4 A;  2JJ4 D;  2AEF A;  2CVE A;  2QZ8 A;  2D7S A;  5ETV A;  4P72 A;  2LQ9 A;  5IWA J;  2XY6 A;  3ETM A;  2CPE A;  3IS9 A;  4IQM A;  4ZVR B;  1AYE A;  4DV0 J;  4TLQ A;  5DG7 A;  1S1W B;  2QT7 A;  1FHT A;  3NXZ A;  2XUL A;  1VQY A;  5DET A;  4NOH A;  3G6X A;  1C0T B;  3G4S S;  1FD2 A;  2DGS A;  1D8Z A;  2I1R A;  3FBF A;  4Y34 A;  4I2P B;  4ECW A;  4ECX A;  3C3L A;  3OXF A;  2C2Z B;  3SDE B;  3QZ7 A;  3EDQ B;  1V3R A;  2FVC A;  1NME B;  3IAS 9;  4OQJ A;  4I2Q A;  1FK9 A;  1DLO A;  4PRF A;  2R7U A;  1MWY A;  1SXL A;  3N6M A;  1YRU A;  3NY0 A;  4MKB A;  3S01 A;  3TUJ C;  3DGP B;  1RU2 A;  2VPY B;  2UXC F;  1E6Y B;  1WG1 A;  4RW9 B;  3NS7 B;  4LVN P;  1FER A;  2ZE2 A;  5F8M A;  5D0G A;  3NOG A;  2W9C A;  4G3I A;  3EZU A;  2J0S D;  4GKJ F;  1J2V A;  1CJT B;  1W2B R;  3HJV A;  9RUB A;  2IBK A;  1JLB B;  2E7X A;  2VZ9 A;  2LKZ A;  4ED0 A;  1CJU B;  2CZ9 A;  5MAO A;  3RW6 A;  4C8M A;  3X3U A;  2RQC A;  4DV6 J;  3PO5 A;  1HYS A;  4NMX A;  1TQL A;  2FZC B;  3QRR A;  3OTO J;  1IBC B;  1UL3 A;  1R3N A;  3KK1 A;  1W25 A;  2MSS A;  1TL5 A;  3QZ8 A;  1Q82 T;  1SIZ A;  2IA6 A;  4LBI A;  3NAI A;  3AJD A;  2DR8 A;  1E6Y A;  3BM7 A;  1S6Q A;  2ZUA A;  2MQ8 A;  2W2P P;  3OD2 A;  2WVF A;  4RW9 A;  4CH1 A;  4J91 A;  4DR4 J;  2R3V A;  4OIX A;  3ZTQ A;  1T3N A;  1ZZN A;  4LFC F;  3EVW A;  4I69 A;  2CDR B;  3R9L A;  1LKZ A;  2H54 B;  4PPD A;  1BQM B;  2RML A;  2HNY B;  1RTJ A;  1SH0 A;  2ZD1 A;  4RPF A;  3VAF A;  4PQU A;  1FFW B;  3KG4 A;  4I2P A;  3TVK A;  2ZZN A;  2VB6 A;  4DQP A;  4B9N A;  1C0T A;  2BX6 A;  1RI7 A;  2B9Y A;  4P74 A;  2DK2 A;  3MM8 A;  3R6G B;  4TY9 A;  4DFP A;  3PEH A;  2E5G A;  4N76 A;  4JI6 F;  1U49 A;  2FY1 A;  5FJ4 A;  2XMM A;  5L1J A;  1HWJ A;  1AXQ A;  2JRS A;  3AB2 B;  3ILO A;  3IS9 B;  4UOF A;  5DGB A;  3RRG A;  1KN6 A;  3IBC B;  1RHM B;  1FE0 A;  2HK2 A;  2VL1 A;  1DQ8 A;  2JFK A;  2V4J A;  4CO0 A;  3P49 B;  3EIC A;  1SQG A;  2Y0S D;  1RT6 A;  3IMQ J;  2ZHO A;  4XK8 C;  1PAE X;  2KU7 A;  5ETT A;  5I42 A;  4DV7 J;  3KYL A;  5GVQ A;  1S7I A;  1YJR A;  2U1A A;  3QGG A;  4PWU A;  2ZH4 A;  4DR3 F;  1N34 J;  3UD4 P;  2Y3Y A;  4ES1 A;  3CWJ A;  1WKL A;  1BC6 A;  5I3P A;  4UUW A;  2HGM A;  1L3K A;  5CYJ A;  2YVS A;  1F3V A;  1CSJ A;  5HJY A;  2W7P A;  5KFP A;  2OH2 A;  1S4E A;  4CLZ A;  3FZB A;  3OTB A;  4CH0 S;  5KG3 A;  4ECQ A;  3B6B A;  3QYY A;  3GE9 A;  4LRE A;  2F5G A;  3AFG A;  3KJF B;  2EBE A;  3KUG A;  1NK6 A;  1VQK S;  4QOT A;  5J2Q A;  4PWW A;  2H1Y A;  1N5T A;  1UKU A;  1JLA B;  4JI8 J;  2K1R A;  2P6T A;  1YLX A;  2LEA A;  2ALY B;  4LQ9 A;  3VGS A;  4B3S F;  4FS2 A;  3NP5 A;  1CQM A;  4IO9 Q;  1D9F A;  2ZE2 B;  2W9C B;  3RBD A;  1DJ0 A;  3KLI A;  5LSL A;  3OV7 A;  1JMT A;  4M94 A;  5KFH A;  2KYZ A;  1DLO B;  5J1N A;  4HVZ A;  2ILY A;  3I9V 9;  2NSC A;  2EK1 A;  1TKX A;  1QAY A;  1UJ6 A;  4C48 A;  3RBX A;  1XWL A;  4ES2 A;  1T9X A;  3UR0 A;  2QLX A;  3NKY A;  5IQQ A;  1WOO A;  2CQI A;  2G13 A;  2YKM B;  2WAQ D;  3DRS B;  3GWC A;  5AT1 B;  3PIP Q;  2KI2 A;  5HAN A;  1Q8L A;  3L7P A;  5ETP A;  5ETK A;  4DG1 B;  5IWA F;  1C0U B;  1VBX A;  4PUO B;  2FLO A;  1ZH5 A;  1RAO A;  2ATC B;  3QGI A;  3ZZP A;  3EWG A;  2VQE F;  1N5Y A;  2BZ2 A;  2P2C B;  4HHJ A;  2ZBC A;  2UUW A;  3C46 A;  2HHX A;  3M6U A;  3R5J B;  2HVH A;  2ZH9 A;  2RIL A;  4QQB A;  3VAM A;  4WXO A;  1S9E B;  2C2N A;  2D74 B;  4KGK A;  4LR9 A;  3TAP A;  4LF9 F;  3IRW P;  2ZOF A;  5IT9 U;  2ROP A;  3ZZO A;  1CLF A;  3F0N A;  3DDN A;  3HT0 A;  3DLK B;  2RB7 A;  2XMU A;  1U0H A;  2ZWP A;  3BEG B;  3B82 A;  4LIR A;  1X4B A;  2MYF A;  3RUB L;  3GLJ A;  4FDF A;  1TP7 A;  4A8X A;  3OQ2 A;  2JLF A;  1Z2Z A;  4KH1 B;  4KFB A;  2QG9 B;  3PY8 A;  1X31 C;  5DS7 A;  1FDB A;  4X64 J;  3DRR A;  3DHW C;  1JKH B;  2XMJ A;  1LFW A;  2QL9 B;  3DC2 A;  3E3X A;  2GIF A;  1RAJ A;  4RNH A;  3CJK B;  3RRK A;  4EFA C;  4IG0 B;  1OY6 A;  3JAM U;  2AJQ A;  1BWV A;  1HBO A;  1P9Y A;  4RBT A;  2PEB A;  4GVB A;  3T5J A;  5C25 B;  3R7B B;  5DM7 Q;  1EZZ B;  4KFB B;  1U1R A;  4B3R F;  2G2Z A;  3FMB A;  1J5O A;  2E5I A;  1T9Y A;  2C2O B;  4X4O A;  2EG2 A;  2VDI A;  1Q0N A;  4NYP A;  3AT1 B;  4NCB A;  2NQP A;  4WTO B;  4NA3 A;  2CUY A;  4CWB A;  3PYF A;  4X4R A;  2JSX A;  5HRO A;  1RWX B;  2V8D A;  5GAE I;  5E7O B;  1VI7 A;  4OZ0 A;  3R5G A;  2N3O A;  5KFW A;  1TL7 A;  1U45 A;  2BEF A;  3PAC A;  3I96 A;  3R27 A;  3IR6 B;  1ZA2 B;  2RDJ A;  2HMI B;  5J2N A;  1EET B;  2DNL A;  2VOD A;  2Z56 B;  2J7U A;  4P7V A;  1NJI T;  4H4M A;  4BWM A;  4F04 B;  2L3M A;  4K2X A;  3OSN A;  3CJ8 A;  4PXE A;  4YEA A;  4H4O A;  1P27 B;  2GVD A;  4RNF A;  5KFU A;  1HW9 A;  2FHJ D;  4DL3 A;  1YJU A;  2OSR A;  2HEK A;  3M9O B;  2YPZ A;  1G3O A;  2ZEJ A;  2AX1 A;  4ED6 A;  4HH1 A;  5D4P A;  4Y2I A;  4WCE Q;  2A10 A;  2MXY A;  4DV3 F;  1S6U A;  1MWQ A;  1O8B A;  2DNO A;  4L75 A;  1U09 A;  2HRY A;  2G1H A;  2WON B;  1TL7 B;  1R6V A;  2LLZ A;  2EEY A;  3H8Y A;  4RLE A;  3SFU A;  5AXN A;  3CCQ S;  4DL7 A;  1T94 A;  4HT7 A;  2B7B B;  3CIM A;  3J7Z 5;  4OZ3 A;  4J9O A;  3J80 Y;  1VGY A;  1IKW B;  1OYD A;  5ETR A;  1NDP A;  4DPX A;  3SZ2 A;  1IUJ A;  1GMU A;  2F3J A;  3O2I A;  5L9N A;  4QBU A;  3TP2 A;  3Q2S C;  2AYG A;  2KRR A;  2D3U A;  2IYI A;  2YNI B;  3HVT B;  1WC0 A;  1Q5Y A;  1S49 A;  3B4M A;  3JXO A;  5D3G B;  1M5P C;  2XYG B;  2PC6 A;  2ZOG A;  3IRX A;  4CYU A;  2F63 A;  3CJK A;  3VF0 B;  3RB3 A;  1FD8 A;  1S97 A;  1YJV A;  4PWD A;  4HR2 A;  3U1L A;  4UST A;  1X9W A;  2AV5 A;  3BN4 A;  3CXC R;  1RZM A;  2KB2 A;  3C6U B;  3MF5 A;  4LIW A;  4U6P A;  3KLH B;  1UVN A;  1HNZ J;  3PTW A;  2CNO B;  4Z2X A;  3BSN A;  3AD8 C;  2BJE A;  3LP1 A;  2GO9 A;  4LVO P;  4PG4 A;  2ZVS A;  5CZV A;  5D4O A;  2ACM A;  2VQF J;  5HP1 B;  3BGL A;  3CE8 A;  2NXC A;  2D3O 1;  4B9M A;  2FLL A;  1U1N A;  3BBF A;  4P2S A;  2X3G A;  2W8L A;  2G0I A;  3TRG A;  2MKC A;  1B4S A;  1DZ5 A;  5C5J A;  5B0F A;  3JQJ A;  1RTI A;  1U26 A;  4OI2 A;  4K7Q A;  2HLU A;  4NPO A;  4UOH A;  3SCJ E;  2DR9 A;  3CCM S;  3MCO A;  1N32 F;  2M8H A;  2IM2 A;  2XLK A;  1FNO A;  1NKE A;  5LJ3 Y;  1PC4 A;  3PCO B;  4ZN1 A;  3OJU A;  1QSL A;  1FE4 A;  5C42 A;  3ISZ A;  3DRS A;  2C28 A;  3G8S A;  3DLL Q;  3KDO A;  4OHY A;  2EWH A;  1FJC A;  1LWE A;  2HRU A;  3TZW A;  2EI5 A;  4PKD B;  3AJ1 A;  2C2K B;  4O3P A;  1F6T A;  2RF2 B;  2D69 A;  5C2C A;  3T5H A;  1REV A;  3IAM 9;  1RTJ B;  2ZD1 B;  2FZG B;  3FBC A;  2V8H A;  1HW8 A;  4J9V A;  1WHX A;  5IS2 A;  4J9L A;  4LFA F;  4I7F B;  1G2E A;  4IKA A;  1UVJ A;  1JQG A;  3I32 A;  2OUG A;  2VKZ G;  4X66 J;  3Q8P B;  4RR5 A;  4X2B A;  1LW2 A;  1HIY A;  2HIY A;  1T3O A;  1VCT A;  2CPJ A;  1HI1 A;  1CJK B;  5F8I A;  5LMN J;  2ERR A;  2XNR A;  4RO0 A;  1KFS A;  2PGC A;  1WHW A;  2B8P A;  4LBP A;  4JI5 F;  3K58 A;  1JLA A;  3TAM B;  1WF2 A;  4I1T A;  5CD4 A;  2R7T A;  2MKK A;  2X1A A;  1OY8 A;  3M2V A;  4JV2 A;  1RAB B;  4MYT A;  4QWB A;  3GIK A;  1HWU A;  4JI7 F;  2LQ8 A;  4DX8 H;  1CS4 A;  4O3Q A;  1IKX A;  3MM5 A;  4R25 A;  2BJ3 A;  1TL4 A;  2C2M B;  4OZ1 A;  4UY8 T;  4DN0 A;  4MKY A;  5A2Q U;  3E8O A;  3BYP A;  2VON A;  2QFI A;  3FEZ A;  3L9Z A;  3N0V A;  1RWO B;  1RP5 A;  3MMB B;  5A8K A;  2DRD A;  1FK9 B;  2DYA A;  1LXJ A;  2KKH A;  2N7Y A;  2WVB A;  3H2L A;  4U95 A;  4AL5 A;  1MWZ A;  3HD2 A;  1H38 A;  2A6M A;  3PRV A;  2M7S A;  2VG5 B;  3TOQ A;  3MUT P;  1WDT A;  4LSN A;  4K4V A;  1Q8I A;  3MD3 A;  2QA1 A;  1N5Q A;  2H4Y B;  3PKY A;  4OI4 A;  2R8H A;  4JBC A;  2IRY A;  3VWS A;  3KNG A;  5CA5 A;  1FO1 A;  4OYB A;  1RCX B;  1SL2 A;  2UVU A;  4HAC B;  4URS A;  4K5S A;  5CAA A;  5L9X A;  2HVE A;  4DXL A;  3HM9 A;  2JH3 A;  3I0S A;  7FDR A;  1T9T A;  3OR2 B;  2E44 A;  4XDC A;  4JI3 F;  4X4P A;  2L9D A;  2CWK A;  4LF8 J;  2OKQ A;  4YB5 A;  5DQG A;  1JLQ B;  3M2U B;  3RBE A;  2Z30 B;  3CTR A;  1P8G A;  4WXW A;  3I31 A;  2Y9H A;  4D3H A;  2EC2 A;  3HSJ A;  1WTF A;  1QDU B;  1TMJ A;  1TKT A;  4W98 A;  2ZOM A;  3DLG A;  4LRD A;  3TUP A;  1OPZ A;  2YKA A;  3CD5 A;  3OBI A;  2KFY A;  1RWK B;  1ZPW X;  2CAD A;  3KFW X;  3EZO A;  3KWM A;  1RBA A;  2W25 A;  4MMO A;  3BRE A;  4ANE A;  3MAQ A;  2HHH F;  4O0I A;  1R89 A;  1RWP B;  4C11 A;  3R5C A;  4WBF A;  5B7W A;  3GCX P;  2EKN A;  3M30 B;  2ZH2 A;  3M2V B;  3BYR A;  3G9C A;  4O3O A;  4B02 A;  3CJQ A;  1N5Y B;  4KV8 B;  1NHK L;  2DRB A;  2C3O A;  1NK8 A;  3JSR A;  3I55 S;  1UFL A;  3EDR B;  3MM7 B;  3ISN D;  4USK A;  3VAG A;  2RRN A;  2GZO A;  3B4D A;  4EK2 A;  1LWX A;  3NGS A;  1CJK A;  2MKI A;  1AFJ A;  2AP6 A;  2CKW A;  2ZJP Q;  1EP4 B;  2XLJ A;  4K50 A;  1FXL A;  3D6F B;  4ETX A;  5HLF A;  2A1B A;  1N56 A;  3QT7 A;  4I2Q B;  3FFI B;  2CVI A;  3PRD A;  1TR0 A;  1RAE B;  5K8O A;  2KXN B;  3HHK A;  1F9H A;  2E7W A;  5KFC A;  1YQH A;  5DZ6 A;  4ZS6 A;  4LMZ A;  1FWP A;  3VGU A;  3HI9 A;  2F40 A;  2HZC A;  2MY7 A;  4WFY A;  1HNV B;  1R8H A;  1RYS A;  3UW1 A;  2F7V A;  1UEK A;  1GTH A;  3OL8 A;  4HLB A;  3K5M A;  4ZCK A;  3MEG B;  5E3C A;  1Q7Y T;  4AE5 A;  1KFD A;  1BD6 A;  2KHC A;  1H7W A;  3C66 A;  4OYI A;  4NZ7 A;  3EZ5 A;  4U96 A;  3VVU A;  1HQ2 A;  1R0A B;  5IT4 A;  2JDJ A;  1VK3 A;  1WSV A;  2KN4 A;  3PV8 A;  2C2R A;  3MEE A;  2YWG A;  4WK1 A;  1JNZ B;  2KZM A;  1V3Z A;  4XPC A;  4O4G A;  2J0W A;  1JLF B;  1APS A;  3BV8 A;  2LXU A;  1LWF B;  1SCJ B;  2CQ4 A;  3A8E A;  1U7L A;  4GVL A;  2KG0 A;  2WSE C;  2CZ4 A;  5LMU J;  2RS8 A;  4OLO A;  2HND A;  1RJJ A;  1C1B B;  4CO3 A;  2IJR A;  4NWB A;  4ZIW A;  4PWD B;  2UVW A;  1SQF A;  3M4X A;  3TA1 A;  1MG7 A;  4C9D A;  3PKM A;  1S9F A;  2XS5 A;  3AOC A;  1O0P A;  2OGU A;  3VTI A;  2BQU A;  1SKR A;  1JKH A;  2J6T A;  2J6S A;  4JI1 J;  1VQN S;  3NLC A;  4RZR A;  3W2V A;  2H3E B;  2QSF A;  3EMT A;  1CEZ A;  2XO6 A;  2FC8 A;  2I8E A;  4K0K J;  1M1G A;  3NCP A;  4B9V A;  2CQP A;  1TEL A;  2YNH A;  2F8H A;  2B6A A;  2BE2 A;  3K17 A;  4LR7 A;  2UZA A;  4RW7 B;  3NG8 A;  2MPU A;  1UPP A;  1F5A A;  3PJW A;  5GMK a;  5LMN F;  1S0V A;  1UAW A;  2V68 A;  4DUZ J;  3AXK A;  2GS8 A;  4IH7 A;  3OPK A;  1RXO B;  2CQ3 A;  3NCR A;  2XCP A;  2UU9 F;  1F2G A;  4U8V A;  3CMA S;  1S9E A;  2OPR A;  2YQ0 A;  4HTI A;  4L3K A;  2HNZ B;  2HWT A;  1VHI A;  5IT0 A;  2YKO A;  3MUM P;  1RHJ B;  3DXS X;  4OHZ A;  2DHA A;  4FYW B;  2IBO A;  4C8N A;  1S9G B;  1Q8B A;  1UVL A;  4U7U D;  2CPI A;  2V2K A;  1AT1 B;  3S7R A;  1N0U A;  2GHW A;  4DG1 A;  2E1R A;  2LDI A;  1N8R T;  2BW7 A;  2BAB A;  5E3P A;  2A6O A;  3GSI A;  4LF5 F;  2R7V A;  1EET A;  4NYO A;  2HNZ A;  3R2D J;  1K47 A;  4DL0 C;  5DDO C;  4F50 A;  1CUL A;  2F4F A;  2G2O A;  1K1S A;  1FEH A;  2ASD A;  1EIY B;  3D1O A;  2ASY A;  3CJ4 A;  4LF5 J;  1HWK A;  3GIJ A;  1S72 S;  4ED8 A;  2A0F B;  2ZZT A;  3N5B A;  2CJQ A;  1MLA A;  1DUR A;  3US5 A;  2EFP A;  3P5B P;  2E5L J;  5KG5 A;  2GGP B;  4XPE A;  3Q8Q B;  2OTL S;  2POK A;  3BBB A;  3W61 A;  3Q2T C;  3KUE A;  4LFC J;  2FB0 A;  2LEP A;  4QR0 A;  5T7L A;  1Q81 T;  4O0N A;  2HWH A;  1FVS A;  2ZC3 A;  1FJ7 A;  2AZ3 A;  3MM7 A;  1RUS A;  5KFO A;  3OVS A;  3HFZ B;  2E7V A;  4P2M A;  2IYG A;  5EUH A;  4DQS A;  2K3I A;  3GCW P;  2IJF A;  4MIB A;  2BKO A;  5IZH A;  2YWH A;  2FVR A;  2GJF A;  1KVJ A;  1V9O A;  4YUD A;  4NEY A;  4FF4 A;  3MHY A;  3KHG A;  2CAJ A;  4GC6 A;  2ZH1 A;  4B3R J;  2W9A A;  4X65 J;  3HHD A;  2W9B A;  1FRK A;  3K5O A;  2M70 A;  1U47 A;  1R0C B;  2QC3 A;  8AT1 B;  3GG1 A;  2ZDP A;  3IN5 A;  3T3F A;  1VQ5 S;  1QE1 A;  3IFE A;  2GQ2 A;  2LXF A;  3OUY B;  3I0R A;  1GMW D;  2UV8 A;  5HL7 Q;  2RJZ A;  4TQS A;  1OSD A;  3WHI A;  2CJX B;  3CSK A;  5HVF A;  4CDI A;  2P6S A;  1NDK A;  5THW A;  2VUG A;  3BH7 B;  4E2F B;  5JMN A;  4DSF A;  3QQC D;  4Y2C A;  2ADC A;  3ZC4 A;  4DMZ A;  3BH6 B;  1H74 A;  1E6V B;  3GJQ B;  4ZIT A;  5M2U A;  1S1U B;  3BSO A;  4DL6 A;  1Q7L B;  1WEY A;  1KQS R;  1HWL A;  2OAU A;  3MM8 B;  3VQS A;  4QIF A;  4YDD B;  4K4X A;  4DUY J;  1JJ2 R;  2C1E B;  2O01 C;  1S1V B;  2FGO A;  4F02 A;  5AE1 A;  1YG0 A;  2VPZ B;  5EWF A;  1D0E A;  4LBH A;  1VQ7 S;  3HZG A;  2WW8 A;  1VR6 A;  5E3Q A;  1BQM A;  2FPH X;  5HI7 A;  1FEE A;  2VA3 A;  2XMT A;  2GMJ A;  3MR3 A;  1OQ6 A;  5IFM A;  1N36 F;  3H4B A;  3PJ9 A;  3LO3 A;  4JI0 F;  2HHW A;  4M63 A;  3CCS S;  4ZCI A;  2DNN A;  5KT3 A;  5J2P A;  3SBM A;  1PG5 B;  4NLU A;  4TY8 B;  1B99 A;  5U47 A;  2VIC A;  1GH8 A;  2BDP A;  2F9J A;  3HMJ G;  2VJV A;  4AQY F;  3FDS A;  1NHV A;  2AX0 A;  3IO1 A;  4Y2K A;  3T9Z A;  4DHV A;  2HQG A;  4UOC A;  4AND A;  3FC9 A;  5KT5 A;  3QGH A;  3MMJ A;  3K5L A;  2YH0 A;  1QTN B;  4FBT A;  5KFY A;  1UA1 A;  3MAA A;  1B0V A;  1SJ1 A;  4FYV B;  2BKP A;  2OEJ A;  3GV5 B;  4RJV A;  4M5M A;  4J9N A;  1VQ9 S;  3BQ1 A;  1S1X B;  3HHL A;  1RWM B;  1TUV A;  4CLY A;  1HL6 A;  1Y5L B;  2B43 A;  2A2D A;  3FK4 A;  4A8Q A;  3NNA A;  2RDD A;  3MED B;  2CYY A;  4P2F A;  4URQ U;  2SXL A;  2RE1 A;  4UW2 A;  3SXL A;  3C8Y A;  3W2W A;  3DGP A;  1J5E J;  3K2Y A;  2N4D A;  1D3W A;  1KOH A;  1TKT B;  1WD6 A;  2W2Q P;  2XHW A;  2XWY A;  4I7F A;  3V4M A;  4V19 J;  3MR7 A;  3MCM A;  1J5E F;  1ROF A;  2KRB A;  3QIP A;  1VJW A;  5K8M A;  4K4W A;  4LR8 A;  2M5Y A;  4M5N A;  4RU9 A;  2CNN B;  1FKO B;  3D3B J;  4GKK J;  1I1G A;  2FHJ A;  4M8L A;  1ARO P;  5C2G A;  1SKW A;  1XN9 A;  1JK9 B;  1Q5V A;  1S59 A;  3LTO A;  2JHE A;  2M52 A;  3CCW A;  2MKS A;  3DOL A;  2ALZ A;  4MFB A;  3IWX A;  1I6J A;  1QSY A;  4QW9 A;  1S1U A;  2UUA J;  3W9H A;  2AHO B;  2LU1 A;  4PCQ A;  3SCL E;  5AE3 A;  4DL4 A;  1YZ7 A;  3AA8 A;  3H59 A;  2F8E X;  4CO2 A;  2R8I A;  3I56 S;  3EXY A;  3U02 A;  1JLE A;  1N5S A;  2ZNY A;  3DOK A;  3MMC B;  4FKX A;  3Q22 A;  1BWE A;  1NK9 A;  3DYA B;  3TZX A;  1TK5 A;  2XWX A;  1XNQ F;  1WHY A;  2RIJ A;  5J1E A;  3THV A;  5KFE A;  1IBK J;  3EJM A;  3T6B A;  1U6Z A;  4JUZ A;  3I4P A;  4DWI A;  3CCZ A;  2QA4 G;  1ZS6 A;  3DNC A;  4Z37 A;  1NBE B;  3LGM A;  4OYO A;  1UW9 A;  3TW0 A;  1L3S A;  2C22 A;  4MKA A;  3AA9 A;  1SB6 A;  1Z1Z A;  2H4W B;  3JYT B;  1JNR B;  4ZN3 A;  2MZT A;  4OLP A;  3GSD A;  3CJ2 A;  2GA7 A;  4MIW A;  1EB0 A;  5AXM A;  1ICE B;  4Q44 A;  4DV0 F;  1S10 A;  1CJU A;  4KT0 C;  1KBR A;  4NZ6 A;  4QJV A;  4YR2 A;  2ATL A;  2BOP A;  3D1H A;  4ZPV R;  5HQL A;  5JVG Q;  3MTK A;  1KVI A;  4KQZ A;  2R7W A;  2G1D A;  3HSD A;  3CDU A;  5BYR A;  4FYD A;  2OPP B;  2W7A A;  3OFH A;  4JI4 J;  3LGN A;  2KZZ A;  1DY3 A;  3GB0 A;  3RYL A;  4DUT A;  1M90 T;  1MN7 A;  2YWK A;  1GXU A;  1RAA B;  3A3P B;  3EUN A;  3MOZ A;  4Y2M A;  2RSQ A;  2FZK B;  3EVM A;  2DR7 A;  1WKJ A;  1S79 A;  1BE4 A;  2IRX A;  3QLH A;  3SDE A;  3A8K A;  4CT9 A;  1W26 A;  3GZ7 A;  1F5C A;  4J9K A;  4H4K C;  5J2M A;  3VHQ A;  4OI3 A;  2X1G A;  3BKF A;  3QFW A;  2XMW A;  4IRC A;  1E6V A;  1U1M A;  1TKD A;  4IFY A;  1OO0 B;  2YKN A;  2I38 A;  1NK7 A;  2V9W A;  4C3K A;  4EBC A;  3J7A N;  5B0G A;  2MKJ A;  2AGQ A;  4M5J A;  2OEM A;  1T05 A;  4K4Z A;  3K8V A;  3DM2 B;  2HHH J;  4WYW A;  1NDL A;  4K2J A;  3ONQ A;  5AJ3 J;  1OPI A;  3PR5 B;  4NML A;  3H2U B;  1RHQ B;  1JXL A;  4FYX B;  3Q24 A;  2QO3 A;  1LWC A;  1VHF A;  3LWL A;  4IDK B;  2H5I B;  3HLU A;  1AB8 A;  2NPI A;  2C2E A;  3H5S A;  4DU8 A;  2KT2 A;  2E9T A;  3TEG A;  4F2R A;  1ZZF A;  2CRL A;  1MML A;  4ID5 B;  1K1Q A;  5DDR C;  2I0X A;  5KFN A;  3DRP B;  3KLG A;  2HHS A;  4WFX A;  1UFW A;  5IV3 A;  1ZA1 B;  3A3O B;  3QGP A;  4CLU A;  3CED A;  1UZH A;  4USI A;  3GR1 A;  3G6Y A;  3FBE A;  3DMJ B;  5B0A A;  3CCR S;  2DRA A;  2B9E A;  3EGW B;  1RYR A;  2XBP A;  3DRP A;  1FXD A;  1WC1 A;  1ELO A;  2MLX A;  3UCZ P;  2Q3P A;  3K5P A;  3AY0 A;  4IR1 A;  1B0T A;  2EC0 A;  3P4U B;  1NSP A;  3FCV A;  3Q8U A;  3HVW A;  1HPZ B;  2I6W A;  3DLK A;  1HMV B;  3J7Y U;  1VQS A;  2ZBI A;  4DV4 F;  4JV5 J;  3NNC A;  1DHM A;  2ZUG A;  2Q79 A;  1VQP S;  3NCQ A;  3NEK A;  4ZPW R;  1KVK A;  2RHQ B;  1QAJ A;  3D66 A;  4LSL B;  3R1H A;  3ZFV A;  2EFN A;  1N48 A;  5LT5 A;  1SL0 A;  1L3U A;  2HKE A;  2GW8 A;  2M0G B;  1KHV A;  1GFW B;  5D0R A;  1S6P B;  2LQ5 A;  5HMZ A;  3DLE A;  4RBU A;  4DUY F;  2GIR A;  2HQC A;  3LP0 B;  4ZVO B;  1YRX A;  1C0U A;  5AXK A;  3TA2 A;  2Y8W A;  5IM0 B;  4NXN J;  3M32 A;  2KVQ E;  2QMU B;  1QSS A;  2HVZ A;  2YWF A;  1VYA A;  1TMM A;  2HMI A;  2ZJQ Q;  2HRT A;  1IKV B;  2AQ4 A;  5IV4 A;  4YQW A;  3TVZ A;  3QAU A;  3QLH B;  4ZKA A;  2NS1 B;  5RUB A;  4F4X A;  2VG7 B;  4MAK A;  4CLS A;  4O4R A;  4X66 F;  2GJI A;  3KJV A;  1YJ7 A;  2IVY A;  1UW4 A;  4NLD A;  4RWW A;  4ECT A;  1GEH A;  3PW2 A;  1NH7 A;  1H73 A;  3H5U A;  3FJ2 A;  4YFU A;  4G1P A;  1GTE A;  5IT9 Y;  4CM0 A;  2GNK A;  4DR7 F;  1VRU B;  5KFD A;  2HHU A;  3OVA A;  1PIL A;  3HT3 A;  5LXR A;  4DR1 F;  1T03 B;  2FD2 A;  1IM6 A;  5H9E J;  4L6V 3;  1PAU B;  1FCA A;  3W63 A;  3V2U C;  3WC2 A;  1FVQ A;  2CQD A;  1YJT A;  1KOO A;  2IA0 A;  2R7O A;  5F0U A;  1UFK A;  2RU9 A;  4WU2 A;  4IG0 A;  3W5Y A;  1KNZ A;  4WFB Q;  4FXW A;  2JLG A;  2DGV A;  2ZVI A;  4DUZ F;  1M5K C;  4QIV A;  1N32 J;  1H72 C;  3IP0 A;  4F4K A;  1WJ9 A;  4NA1 A;  3D3C J;  4CCH A;  4UY8 5;  5A2Q Y;  3WC0 A;  4C8Y A;  1G6B A;  2AJF E;  2F4V F;  1Y3J A;  3FGV A;  4AD6 A;  2KM8 C;  1PC5 A;  1L5U A;  3KLV A;  1GMW A;  2AYE A;  4K4S A;  3HFV A;  4MK8 A;  1RHK B;  2LFV A;  4PG6 A;  1VRT B;  2UUB F;  4DSK A;  2DY9 A;  2LQB A;  2DNZ A;  2R2R A;  1AW0 A;  1LOU A;  3W9J A;  1RTD B;  4YP3 A;  4M5K A;  3TEH B;  1VJQ A;  1PJ5 A;  3HD1 A;  4LFA J;  1Y3K A;  3HSZ A;  3LOU A;  2MQQ A;  4DFM A;  1FRI A;  2CQC A;  2BJ8 A;  4OHX A;  3Q8Y A;  1JLQ A;  1SV5 B;  2Q6C A;  3M2U A;  1JLE B;  3IG1 A;  1HHT P;  2F9D A;  3KHR A;  2MQO A;  2V4J B;  3A8I A;  1C2P A;  4OYA A;  3U27 A;  5K14 B;  3L7U A;  3LAL A;  3ZNU A;  4ZHR A;  2WVE A;  5BYQ A;  2JEG A;  3FUY A;  1F3F A;  3PHT A;  4ZIV A;  1HA1 A;  1U24 A;  3HPO A;  3I5A A;  1N33 J;  4HAC A;  5M2R A;  3TQ1 A;  3I4H X;  3GFZ A;  5HMW A;  2CJY B;  4G1I A;  5I3U A;  2PEH A;  1NPR A;  2W2M P;  3M8Q B;  1HI0 P;  5KT2 A;  4PG8 A;  3LPE A;  4M5I A;  2WOM A;  4F4Y A;  3BBC A;  1RT5 A;  3CDA A;  4A8O A;  1LFP A;  1MU2 A;  2YWW A;  3SQG A;  2FJB B;  1HQE A;  1MMD A;  5HSP A;  2NYI A;  4Q5V A;  3MTJ A;  1KD1 T;  2PMZ D;  4NLR A;  3MED A;  1X60 A;  4RW6 B;  3KJQ B;  3MI7 X;  3OHB A;  2ZH5 A;  3V6D A;  4J9P A;  1UVM A;  1S57 A;  4RUB A;  2KTQ A;  4ZLP A;  3C15 B;  1T7P A;  2CQ2 A;  1UVI A;  2JOQ A;  2VFS A;  1N5V A;  3EX7 B;  1QTM A;  3GV8 B;  1LW0 B;  4X4V A;  5D4L A;  3ILL A;  1R31 A;  2HBY B;  3UDC A;  2B9W A;  3FMW A;  5CH7 B;  2JC1 A;  2W2O P;  3ADA C;  2M3D A;  3LP2 B;  4JI4 F;  5D77 A;  1SL1 A;  4O23 A;  2OML A;  3C15 A;  3LAK A;  5HMX A;  4USV A;  1N4L A;  4OHV A;  3OFE A;  5DDQ C;  2VJU A;  4J7C A;  4RBV A;  1IR0 A;  4Q43 A;  1BQX A;  4KH0 B;  2RH3 A;  3GJT B;  3DCA A;  3VVT A;  1CC7 A;  1FTR A;  2DB1 A;  4WTY A;  1LNQ A;  4JV5 F;  4BBY A;  2L9W A;  4P6Q A;  4DQQ A;  3QFH A;  2XY5 A;  4CH7 A;  3DYA A;  7AT1 B;  3P5T L;  1F0X A;  3PXG a;  1XMO J;  2WOM B;  2DHG A;  4ZVE A;  2B3T B;  2GJ2 A;  3LW5 C;  2OO4 A;  4B3M J;  3FQK A;  2MZS A;  3HX9 A;  4I64 A;  3I0S B;  5BJR A;  3ULH A;  3V6K A;  4A47 A;  4B3T F;  5KFF A;  1WI8 A;  2YXL A;  3MMA A;  4KAI A;  2EPI A;  5JXS A;  4MFB B;  1QAX A;  2GHP A;  1YI2 S;  3KUH A;  2JZ5 A;  4B9L A;  2CNK B;  4S0M A;  3IR7 B;  4EO6 A;  3DLJ A;  3BGR B;  3J7A 1;  4X4U A;  2BE9 B;  1SJ3 P;  3VCD A;  2YQ3 A;  4DN9 A;  4CLP A;  1VC0 A;  2IM1 A;  1IR1 A;  3MMB A;  4Y28 C;  2DHH A;  1YHQ S;  1N36 J;  1RTD A;  5D78 A;  4ZVQ B;  2MHN A;  1EHW A;  4I6W A;  3QT6 A;  5HK4 A;  1M5O C;  5AXL A;  1FF2 A;  1ZOT A;  2CPY A;  3U1N A;  4OZL A;  4A46 A;  4IRD A;  1X5S A;  2IFX A;  3CJ0 A;  1VFJ A;  2CFX A;  1NND A;  2QTW A;  4NLQ A;  4USJ C;  3SSS A;  4RNM A;  4GKK F;  3L4B C;  1FFG B;  5A76 A;  4A8W A;  4AYB D;  3UNY A;  3SSR A;  4OX6 A;  4R5P A;  2CQH A;  4OZ2 A;  2FC9 A;  3MFH A;  3LH2 S;  3P96 A;  1UZD A;  3BDP A;  4OMF G;  3BF4 A;  3PW7 A;  3RB4 A;  2P9G A;  2AMC B;  5A8R B;  1V3S A;  4C8K A;  3G87 A;  5CCL A;  4ZCL A;  5T7L B;  2JEI A;  1S0M A;  1VRU A;  2IRU A;  1LW2 B;  1B7Y B;  1GX5 A;  1D1U A;  1NB7 A;  3LPY A;  3JSM B;  3KHL A;  2QRR A;  2OD6 A;  1X4C A;  2CXE A;  4WE1 B;  1Y7P A;  3GIR A;  2I2Y A;  4XIU A;  3OLA A;  1JXE A;  1Q53 A;  1MU2 B;  2FJA B;  3SQG B;  4LF4 F;  1VS3 A;  2MQN A;  1X4A A;  2YNF B;  1KHW A;  2CPH A;  3ENA A;  4DV7 F;  3SYZ A;  3UVJ B;  1VQM S;  1VIS A;  2DGQ A;  3M8Q A;  1JLC A;  1F1B B;  1NK5 A;  4C2M A;  2VIH A;  4KE5 A;  3M32 B;  5DO2 A;  2B51 A;  1DTT A;  3UD5 A;  1RK8 A;  3UWT A;  2J0Q D;  4B9U A;  4C0O C;  2DGU A;  4ZP6 A;  5L38 A;  3W5X A;  2BAC A;  3FEY B;  5K14 A;  1FES A;  4ZHR B;  4YOE A;  2OMO A;  5DG9 A;  3IG1 B;  3GJR B;  2I5J A;  1FTC A;  2XM3 A;  5CCM A;  1SC3 B;  3EPG A;  2OP5 A;  4KR0 B;  2DVI A;  1I3O B;  2G4B A;  1PJ6 A;  2X7I A;  2XMK A;  3PM9 A;  5GAE U;  3MM9 B;  1QE1 B;  1PBA A;  2Y1R I;  1BUX A;  3T19 A;  2HGL A;  1FDN A;  4DU7 A;  2FVQ A;  1TVR A;  4UQT A;  4IRK A;  2HFN A;  3HO1 A;  4IFV A;  1H7X A;  3GTY X;  1IWA A;  3NAH A;  4LFB F;  3OW2 R;  2EFV A;  1TU0 B;  1LK5 A;  3I9Z A;  3D2W A;  2BJD A;  3KJN B;  4NLS A;  1F9F A;  1U6F A;  3J81 j;  1TUW A;  4DZ6 A;  2EBG A;  2QV6 A;  2OFG X;  3G82 A;  4KGZ B;  3C2P A;  1NJY A;  1DAX A;  2AKW B;  4PR6 A;  2QA4 S;  2R9L A;  1KQK A;  4CNZ A;  2P8I A;  2D9P A;  4C3M A;  2HND B;  4EO8 A;  2X51 A;  1U0S A;  2B56 A;  2CPF A;  4CO5 A;  4EBE A;  3PYE A;  2WSF C;  2WVD A;  3ZZR A;  4LRA A;  3RB0 A;  4QIE A;  2IDE A;  4WP8 A;  1TVR B;  1NRK A;  3VV2 B;  3KG0 A;  3GU0 A;  2P5V A;  2LEB A;  1R8A A;  3DDI A;  5CYM B;  5E41 A;  3KJV B;  3NOC A;  2WON A;  3C14 B;  2R7S A;  4J90 A;  3MZI A;  2NYH A;  3HP6 A;  3ZZU A;  4LRB A;  5L8R C;  2WHO A;  3CPW R;  1Q8K A;  4BC7 A;  1SKS A;  1KTV A;  4IYQ A;  4X62 F;  1H0H B;  2V2Z A;  4MJK A;  4B3T J;  3MEG A;  4A8Y A;  4R8U B;  4KKO A;  4CLK A;  1CVJ A;  4DCJ B;  1TTH B;  2MJN A;  3O44 A;  1VBY A;  2RAQ A;  4HDG A;  2PE8 A;  2QL7 B;  1SH3 A;  1Q79 A;  2V0N A;  1PKU A;  5LM7 E;  4N5S A;  3DRX A;  5GMD A;  3UVJ A;  4DOZ A;  3BO2 A;  2O66 A;  2DXF A;  3U1M A;  2YNF A;  4LF2 A;  1FX2 A;  2VDH A;  4LSZ B;  3HFK A;  2CQG A;  1KQG B;  2QLW A;  1X4H A;  2MHE A;  2YNG B;  3T41 A;  3Q89 A;  2VD3 A;  3CCJ S;  4CP5 A;  3S8S A;  4USH A;  4CZC A;  2JLE A;  2OPP A;  3FZ2 A;  1XEZ A;  5D0E A;  1RKI A;  2FHK A;  5KTQ A;  3FVY A;  1FDD A;  4R0J A;  4IG3 B;  2CJA A;  4FVM A;  1F2H A;  4D3G A;  2BQ3 A;  2HYI B;  2NXU A;  2HHT A;  3F41 A;  5F9L A;  2K1R B;  3M05 A;  4OX9 J;  3BO4 A;  2KVI A;  3H20 A;  1YX2 A;  5HVH A;  4AL6 A;  3W64 A;  1FI4 A;  2UUC J;  2JNJ A;  2VU5 A;  3KK3 A;  4U8Y A;  2QMW A;  2IC3 B;  2ZBR A;  2DO4 A;  4DV3 J;  3V4I A;  4IOC Q;  4OYZ A;  3VAK A;  3O8W A;  1IQT A;  2ZHB A;  5CAB A;  2N3L A;  2V8P A;  2FJD B;  2W4D A;  4CTA B;  5FLX Y;  1H6K X;  4O4G B;  2IMO A;  3TAQ A;  2G9O A;  2ZKT A;  3OL7 A;  2CIM A;  3DDK A;  1AUS L;  1WWH A;  3BKU A;  5ITH A;  4NXM F;  4KHP F;  1TKZ B;  5D15 A;  5SZT A;  1RT4 A;  4I68 A;  2E5J A;  5KFB A;  3T1H J;  5LMU F;  4HDH A;  3CJ5 A;  3NL0 A;  1D09 B;  3R6L B;  2QMX A;  2C3M A;  3T9N A;  3H5X A;  1TL1 A;  1FX4 A;  3KLF A;  1NUE A;  3OTD A;  3L3C A;  2AWZ A;  1SKU B;  2G0C A;  5D4N A;  4J9M A;  5CD4 H;  4DL2 A;  4YB7 A;  2O1P A;  2RVJ A;  4X4Q A;  4CI0 B;  2FVS A;  4DPO A;  1HNX J;  1K73 T;  2ZNZ A;  3GII A;  5KFA A;  2H5E A;  3QT5 A;  5KFM A;  2HNY A;  4P2X A;  2GCF A;  3WDO A;  1K44 A;  5HQM A;  3UFC X;  5HLF B;  4HTJ A;  3JSB A;  3QPI A;  4ZPC A;  3GFH A;  1H3D A;  2BV3 A;  2UUB J;  4TU7 A;  3B54 A;  4KGX B;  1WC5 A;  2NPF A;  5HAT A;  2Z2M A;  2MMY A;  4LF7 J;  4Q2M A;  1JJH A;  4MT1 A;  4KSE B;  2QA2 A;  5IOL A;  2ROE A;  4KO0 A;  1TL3 A;  2G2Y A;  1Q86 T;  3T5K A;  3C19 A;  3LP2 A;  3MCS A;  2PI5 A;  4KIA A;  1XR7 A;  3RAQ A;  5KFQ A;  3TWZ A;  3VAH A;  2NUH A;  2PFF B;  2HQ3 A;  4ENO A;  1HYS B;  3D7S B;  3NBP B;  3SMZ A;  4WYL A;  1B0P A;  5K8N A;  4ZPT R;  4QYZ J;  2BQR A;  4I6A A;  3CD0 A;  3D0G E;  3N4W A;  2V2Q A;  2WBM A;  3PZP A;  3DLH A;  3NMR A;  5FD1 A;  1UET A;  5GME A;  2VHG A;  2BAN B;  4F2S A;  1GXT A;  1PJ7 A;  1UJ5 A;  3POT B;  4DBQ A;  4FNI A;  5KG1 A;  2YY3 A;  5HN0 A;  3CUN A;  2KDO A;  1VMB A;  1FKA F;  3T1A A;  2OJ3 A;  1U4B A;  1HI8 A;  2DEI A;  1WEL A;  3NGU A;  2ZM6 J;  5GAH I;  1IKY B;  3DN9 A;  3RBZ A;  9ATC B;  4IUF A;  3CJT A;  1RT5 B;  2VKR A;  1NJZ A;  3OFF A;  1NSK L;  3IM9 A;  3VR1 A;  2MDA A;  5F8H A;  3TJ9 A;  2XY7 A;  3CCE S;  1RAF B;  2ZDO A;  3L7O A;  1LEO A;  3PHE A;  2VAS A;  3NWR A;  5B0E A;  1O51 A;  1S1W A;  2IM3 A;  3FRY A;  3UI3 A;  3CJ3 A;  5CHC B;  4PPZ A;  4X62 J;  1I94 J;  1URN A;  3QMQ A;  1XNR J;  4NA2 A;  1HKA A;  1CBK A;  2QN6 B;  4ICL B;  2O3D A;  5H9F J;  5KOX A;  4HHU A;  1WC4 A;  1MMN A;  3OTC A;  3JSY A;  3KOA A;  2L9N A;  5KFZ A;  3F73 A;  1KQF B;  1FKO A;  2DNM A;  5KFX A;  4F36 A;  1RT4 B;  2VFV A;  2W2N P;  2XZT B;  4JP8 A;  4A8F A;  4PXC A;  3BKT A;  3MPY A;  4GRS A;  4U9R A;  1XMB A;  2IVF B;  5AE2 A;  2JL9 A;  2PN6 A;  4M5D A;  5GAH U;  3KKF A;  3RW7 A;  2CJ9 A;  3G6V A;  2YPY A;  3DGV A;  4CTA A;  1S6Q B;  2NZC A;  1YBA A;  4LRF A;  4CLT A;  4ZOS A;  2NLW A;  3CIZ A;  4J9R A;  2QEX S;  2E9R X;  2C42 A;  4A4J A;  4X65 F;  3M8S A;  1WF0 A;  3C6U A;  1S1X A;  2FIU A;  3HHL B;  4DPU A;  2IC3 A;  2JVR A;  4HEA 9;  1XMO F;  2H48 B;  4NI2 A;  4QPX A;  3K57 A;  1FJE B;  2F8M A;  4B3O B;  3NBP A;  3D6H B;  4CYU B;  4WKY A;  1RT7 A;  1RKJ A;  2J6U A;  1NK0 A;  4RW8 B;  1C4A A;  1VRQ C;  1S12 A;  2DJW A;  2CZV C;  2JWN A;  1T03 A;  2HSE B;  4M1K A;  1CG2 A;  5KG7 A;  3M8R A;  1S4F A;  2LCW A;  2V8G A;  3SSQ A;  2MST A;  3MEK A;  1C1C B;  2HW3 A;  2OFH X;  2OD4 A;  2Y8Y A;  1XIQ A;  3IA0 A;  2BKN A;  4CRJ A;  1FRM A;  5EDW A;  4UUX A;  3CC4 S;  3AD9 C;  3K8W A;  4NRT A;  3JS9 A;  3FSY A;  1D9A A;  1HQE B;  1F5B A;  1N52 B;  2QLF B;  1RIS A;  2HFS A;  4GMK A;  3UDL A;  2UXB F;  2MGZ B;  3OXL A;  3BDE A;  1X4E A;  2PII A;  3DU6 A;  2NR0 A;  4PXD A;  3UCU P;  1V5V A;  4AQY J;  2XO7 A;  2VBY A;  2VC1 A;  1VDH A;  1QVF R;  2R42 A;  5I3U B;  2MKH A;  1UWB B;  3R7N B;  4ATN A;  5C42 B;  3LA0 A;  2BUN A;  4A8S A;  4JI0 J;  4ZPB A;  4WZM A;  2J0X A;  4B08 A;  3A3N B;  3HHL D;  2ROG A;  3QSY B;  1UVK A;  1RT1 B;  4FVC A;  1DAR A;  5G0R B;  4LSL A;  2P9E A;  4RL1 A;  3GIL A;  2QL5 B;  1RTH B;  5LOQ A;  2XC9 A;  1XTZ A;  1IBL F;  2GV1 A;  1ZET A;  2DT9 A;  1U2F A;  2RU3 A;  4OZN A;  1GMV A;  1OMS A;  3TZZ A;  3CD7 A;  2IPO B;  2ILZ A;  4P7T A;  1N88 A;  2NSB A;  3N28 A;  4P9S A;  2JEJ A;  2IHR 1;  2BRK A;  1SUQ A;  2M2B A;  1PYT A;  4OYP A;  4RW7 A;  5F8N A;  1SJ4 P;  2YNH B;  1R7I A;  2XS7 A;  3W8P A;  3DLB A;  1N54 B;  3CC2 S;  4K5R A;  3MGJ A;  5J1E B;  1PO6 A;  2UUC F;  3D5M A;  1HFE L;  1B7F A;  1X4D A;  1HBO B;  2YQ1 A;  4L72 B;  2VPW B;  4OZJ A;  3TNV A;  2Y0B B;  1RSC A;  4NL5 A;  2XI3 A;  4F8R A;  1WDD A;  3GON A;  3GYN A;  3ZTO A;  1PYO B;  2YNI A;  3HVT A;  4FP9 A;  4NCG B;  2J5A A;  3A12 A;  3K7R A;  4FN5 A;  5KFV A;  5KT7 A;  4DSE A;  2FJX A;  1Y9O A;  1PCA A;  4ID5 A;  4DS4 A;  2E9Z A;  3OTE A;  4Q7A A;  2XSJ B;  3KDN A;  3D6T B;  4MKV A;  4Q0B A;  5H1S V;  2GGP A;  1RT3 A;  3M8P A;  1FRJ A;  2AEJ A;  4WJB A;  2YNG A;  3L95 X;  1X7V A;  4ZVG A;  3FBB A;  4RU2 A;  4NLY A;  1FWK A;  2JFD A;  5GAG U;  2B0G A;  3MEE B;  4K4T A;  2M88 A;  3G86 A;  4DR3 J;  1H2T Z;  3UR3 C;  3HHL C;  1CUL B;  2BM1 A;  1R0A A;  2MTL A;  2D3O R;  2AD9 A;  4DLG A;  4Y3C A;  3BB5 A;  3D67 A;  1YRT A;  5G0R A;  2BA9 A;  3PX4 A;  3N5F A;  1GQE A;  1FNX H;  2HBQ B;  3BS9 A;  2GVD B;  3TJA A;  2DGT A;  1URR A;  3FNN A;  3GR0 A;  1DTT B;  3UNG C;  4F4A A;  1NZA A;  3TAR A;  2QIF A;  1JLC B;  4J9S A;  3MD1 A;  1ZPV A;  3QO9 B;  4QU6 A;  3V5R A;  4DR6 J;  4RNN A;  2HZV A;  2GQQ A;  2OPR B;  1EAR A;  2GX8 A;  5EX0 A;  4WFA Q;  4LFB J;  3LAM A;  1WOR A;  2FHM A;  4ELT A;  5F3Z A;  1UMJ A;  5GAG I;  2JEF A;  2OPS A;  1HMV A;  3CO0 P;  2Q6B A;  2HS3 A;  2VF3 A;  3OR1 B;  4ZVP B;  4PAA A;  4F0H A;  4TU9 A;  1F60 B;  1ULR A;  2E1M C;  3KLI B;  1KLN A;  2DBB A;  1NPP A;  4M95 A;  3CB4 A;  3N6N A;  3W66 A;  4DPY A;  3T6J A;  2HFZ A;  3SI8 A;  1ZYQ A;  2VOO A;  1KLM B;  3P45 B;  4PYA A;  4RW8 A;  4KV8 A;  4YDX A;  3A13 A;  3D6M B;  1DTQ A;  2Y1L B;  3LGH A;  5EHH A;  3AB4 B;  2UU9 J;  3C6T B;  4IOB A;  1SJQ A;  2AEM A;  4ZDN A;  4CIO A;  4NI2 B;  1FT8 A;  3ELH A;  3I6P A;  2DY1 A;  4ZP9 A;  3HK2 A;  1T9U A;  2DO0 A;  3UDV A;  1BHN A;  1WEX A;  4Y6I A;  1KKH A;  1JJC B;  1YTY A;  3H5Y A;  2Q66 A;  4MTP A;  3R97 A;  2OEL A;  3F56 A;  3FRZ A;  4IFV B;  2WCX A;  1JWW A;  3QNW B;  1SUQ B;  1LWF A;  3CJS A;  1EKR A;  2UXD F;  2H5J B;  2GC8 A;  4IDK A;  1KTQ A;  4KHR A;  3ZTR A;  3MFI A;  1N6Q B;  2E5L F;  4USU A;  1S1T B;  3OLB A;  3MM9 A;  1UA0 A;  4DV6 F;  4LF9 J;  4ED2 A;  1K8A T;  1KON A;  4NLP A;  4FPR A;  3SCK E;  4EUV A;  1U1K A;  4GC7 A;  1NJX A;  1NSA A;  4GKJ J;  1TUG B;  1RT1 A;  1B70 B;  2R8K A;  3OR2 A;  4XTT A;  1R8C A;  1M1H A;  2XZD B;  3HF5 A;  5JJB A;  3JB9 k;  3CMQ A;  4FBU A;  4PUO A;  1IBM J;  2ACY A;  1HD0 A;  2OIH A;  4ZMM A;  1UWB A;  3AD7 C;  3QJL A;  1NKB A;  4YR0 A;  2HBZ B;  2QFJ A;  4IQX A;  2DHX A;  4U7C A;  3V81 A;  2UUT A;  3NGK A;  4ZK7 M;  1TKX B;  2KXF A;  3QIP B;  4B17 A;  2MGZ A;  1IKY A;  3IWN C;  3ZNJ 1;  2WTF A;  3MXH P;  1EX8 A;  4LT6 A;  1HBM A;  1TV6 B;  4C8L A;  2H51 B;  2MQP A;  3OL9 A;  1NO8 A;  1Q78 A;  4WE1 A;  4WK3 A;  4FZV A;  4BDP A;  3EM1 A;  1EP4 A;  4NRU A;  3TZY A;  2DIS A;  2KFZ A;  1LK7 A;  3ENQ A;  1VBZ A;  3Q23 A;  2Z4P A;  5KG4 A;  3N79 A;  4DV5 J;  3GP9 A;  1XQI A;  4FXD A;  2ABY A;  3W3S A;  3OFG A;  1XK8 A;  4NLG A;  2BRL A;  1LXN A;  2Q43 A;  6FD1 A;  7FD1 A;  3I5C A;  1GAO A;  3AH6 A;  1X5T A;  3JAM Y;  4DR5 F;  2VV5 A;  3EYZ A;  3UN2 A;  4OX9 F;  1HBU A;  2BJ7 A;  1V5I B;  2ZJR Q;  4U7U K;  3PW0 A;  2BYC A;  5DZ7 A;  4C11 B;  4OZ5 A;  2R2U A;  4C6A A;  4DSL A;  1VLO A;  4JI2 J;  3UO0 A;  2EKY A;  4TY8 A;  1SJR A;  1SPB P;  2AIR B;  3O3L A;  3X1L B;  2V63 A;  2DEJ A;  4LF1 A;  4ZVS B;  3M9N B;  4V1A k;  3DLG B;  4XO0 A;  4W92 B;  4DCP B;  1K0T A;  5KFL A;  2B7C B;  4KTQ A;  4M5G A;  1AZS B;  1CJV A;  1Q16 B;  5D0H A;  2LU2 A;  3H7H B;  1W2I A;  4FPI A;  4KPC A;  5KFR A;  2OPQ A;  5L39 A;  4NLW A;  2MLZ A;  2ZIT A;  4E98 A;  2HGN A;  2K8G A;  3DU5 A;  5B09 A;  3DOK B;  5I42 B;  1G7C B;  2MZJ A;  2W7O A;  3T1H F;  1VC6 A;  3E2E A;  4YHH J;  1S1V A;  4LJM A;  2KYX A;  2N4C A;  2NXE A;  1R27 B;  2PSZ A;  4ZP8 A;  4F26 A;  2IM0 A;  5B08 A;  3G8T A;  3LWM A;  4DV1 F;  1TK0 A;  4NXN F;  5DM6 Q;  1S76 D;  3VAL A;  2HG4 A;  3DRY A;  2DKO B;  1HQU A;  5ETM A;  3DOL B;  1RTI B;  3VGT A;  2F4V J;  4EWT A;  4B3S J;  2DR6 A;  4LSN B;  1NB2 A;  4O3S A;  4LF7 F;  6AT1 B;  5FDL A;  3TX8 A;  1P1L A;  2OPQ B;  2RS2 A;  2HQD A;  2LP4 A;  3MWB A;  3I0R B;  1AZS A;  1CJV B;  2FGC A;  3W65 A;  4CO1 A;  3M8Z A;  2NRE A;  2PFD A;  1N0V C;  1N6Q A;  1HNI A;  2DCU B;  4G65 A;  2BM0 A;  3W2W B;  4WFN Q;  1HBN B;  4DS5 A;  1Q95 G;  2BAN A;  2FJE B;  2C3U A;  2IVM A;  5T41 A;  5L1L A;  1EAY C;  2BJ1 A;  3M1V A;  1YKW A;  1SC1 B;  2YH1 A;  2GAG C;  5F0W A;  4C97 A;  4PEO A;  1FRL A;  1IR2 A;  3MAA B;  2O67 A;  3VQT A;  4DF4 A;  3LAN A;  4ED7 A;  1DQ9 A;  3C6T A;  3MR6 A;  1P1T A;  3IRX B;  3TAM A;  4C8O A;  5D3G A;  4WPA A;  4QIW D;  1KLM A;  2K2P A;  2EVZ A;  3K59 A;  5ETL A;  1JLB A;  1Y4Z B;  2CNL B;  1S77 D;  3MUR P;  4F3O A;  2F65 A;  4OYW A;  2DIV A;  3P3D A;  4IG3 A;  5LXY A;  1A0O B;  2APO A;  4X4S A;  4DCO B;  4H4K A;  4EGL A;  4ILM A;  2HHV A;  1U1P A;  4L74 A;  2RKI A;  3FSX A;  3EGZ A;  3IBF B;  2W8K A;  3FQL A;  5LSO A;  2CJK A;  1Y5I B;  3DOM A;  1TV6 A;  2O5D A;  2XMA A;  3PW5 A;  1SJF A;  1QM9 A;  1REV B;  3ILJ A;  4NX9 A;  3TJ8 A;  4TKT A;  2KM8 B;  4XDD A;  4FF1 A;  3QJJ A;  1C4C A;  5E33 A;  3T1Y F;  4L73 A;  1IKV A;  1OYE A;  4MK7 A;  1YBU A;  5L46 A;  4IH6 A;  1RLD A;  2A18 A;  4KHM A;  2C3Y A;  4I6Y A;  2VOP A;  2MLY A;  3W1Y C;  2EFG A;  3KG1 A;  1NAQ A;  1MNE A;  1ZTW A;  4EZ6 A;  3FEX B;  5CYQ A;  4N41 A;  2CQ0 A;  5BR8 J;  5F8J A;  1H2V Z;  1I94 F;  3DLE B;  2HHP A;  1MW7 A;  4DSJ A;  4H4M B;  3PO4 A;  2CJB A;  4K8R A;  1QY7 A;  2HUR A;  3BSC A;  5J2N B;  3AOB A;  2FTR A;  1O5J A;  1T02 A;  1IXK A;  1SV5 A;  2DIT A;  2KJV A;  4JI7 J;  1QUV A;  2GMH A;  3J7Y I;  3HJF A;  3N6L A;  2K7J A;  2VFU A;  2X1F A;  2W1B A;  4TVA B;  2IAJ B;  1RCO B;  5LSR A;  1LV5 A;  2R7X A;  2YX7 A;  4C4W A;  5KFJ A;  4Q0B B;  2CG8 A;  3U7J A;  4DQR A;  4ERD A;  1IM4 A;  1P6T A;  4HKQ A;  2XSJ A;  2BE2 B;  1M5S A;  2IDL A;  3DHX A;  5T14 A;  4DV2 F;  1X8D A;  2GML A;  5DLF A;  2KFN A;  3W60 A;  4CO4 A;  4DV5 F;  1L3V A;  2WB1 D;  4QWD A;  3ISN C;  5C25 A;  4N8O A;  1BQN A;  1HR0 F;  4TN2 A;  2CA9 A;  5DLG A;  3M9M B;  1LQ9 A;  3R5D A;  5KFG A;  4OL8 A;  4TU8 A;  1VIO A;  1UJ4 A;  4QW8 A;  2UXD J;  4RW4 A;  4KPY A;  4B3M F;  5CXT A;  3SV3 A;  3PVX A;  2WSC C;  1R6Y A;  4A8K A;  8ATC B;  4DZD A;  1HNW J;  3D28 A;  4O44 A;  2OPS B;  4ZJQ A;  4WKR A;  2BVZ A;  3QSI A;  2FVP A;  4DR4 F;  2FDN A;  2MZ1 A;  4PQU B;  2VG7 A;  1ZM3 A;  1F9E B;  2K3K A;  4YY3 F;  2VBW A;  2RUS A;  3DM2 A;  2BBE A;  4PZV A;  5C7P A;  3B78 A;  5A8W B;  2DHS A;  3FCW A;  2X3D A;  2HK3 A;  4K4U A;  3GYG A;  1B64 A;  2MKY A;  4R8U A;  2R4F A;  2V4R A;  2HVI A;  4ZVF A;  2VQF F;  5L1K A;  1J27 A;  3KMS A;  5B0B A;  1KP6 A;  1X5O A;  1YSJ A;  3DXB A;  3MR2 A;  2V9K A;  4QU7 A;  5A8W A;  1U25 A;  2BJ9 A;  4HH0 A;  1CQN A;  4KY3 A;  5E3R A;  2W4C A;  5LJ5 Y;  1G1X A;  3MEC B;  5IXU A;  4F7V A;  2IY5 B;  5CYM A;  3FFI A;  4LQ3 A;  3OL6 A;  2H9Z A;  1QJH A;  2XGP A;  2GAH C;  1HPZ A;  1V6H A;  1JLG A;  5I3Q A;  3GIM A;  2D1C A;  1KDN A;  2J9D E;  2KG1 A;  2RUG A;  2XGQ A;  4LUB A;  3LF0 A;  2DNQ A;  3SIP B;  1YDL A;  2LYV A;  4V19 X;  4OFZ A;  4RW4 B;  2RQ4 A;  2YWE A;  1WNE A;  1XNQ J;  1FFS B;  3DMJ A;  1RHU B;  1T9V A;  2EFO A;  4UZB A;  1YBT A;  2KXH A;  3HUL A;  4NAS A;  3OHA A;  4KGM A;  5HJX A;  4OV1 A;  1P9Q C;  3G82 B;  4P52 A;  4EI2 A;  2KH9 A;  1FA0 A;  4R5P B;  2Y1J A;  2E1C A;  2N7C A;  1C1B A;  4OJH A;  5L1I A;  1VQL S;  3JQM A;  2DNK A;  1WC3 A;  2NXJ A;  1UP1 A;  2FY8 A;  4C7Q A;  3CGI A;  2BOA A;  4C0B A;  3CF5 Q;  4ID8 A;  2EW9 A;  1M0S A;  2LVW A;  1HBN A;  2YBV A;  3FCH A;  3R3T A;  4NEZ A;  2VC0 A;  2LEC A;  2DH8 A;  3CME S;  4Z7C A;  1U0H B;  4DLE A;  1FNM A;  1FKP A;  3IR5 B;  1RWN B;  1U2C A;  2Z8Q A;  4M5D B;  4ED3 A;  1A9N B;  1Y10 A;  4G1Q A;  5KFS A;  3BGO P;  3KMQ A;  5DGA A;  2D9O A;  3MM6 B;  3Q86 A;  5ETQ A;  3SEO A;  1JXV A;  2DPI A;  1RA7 A;  2NXN A;  1YGY A;  2H65 B;  4KGV B;  5KOW A;  1T05 B;  2V69 A;  2HIQ A;  3DFE A;  2E29 A;  2YKN B;  3ZZY A;  3QJP A;  4ELV A;  4J5O A;  3FSI A;  4I0W A;  2ZBQ A;  4P71 A;  4UF4 A;  4PXB A;  2Z58 B;  2B4O A;  3BGF A;  3QT8 A;  2DH7 A;  1Q4R A;  2AGP A;  1VQ4 S;  3B8H A;  3PYD A;  4QR1 A;  4J9U E;  2QX0 A;  5IC4 B;  4DJB A;  3PFO A;  5GAD U;  4ECY A;  3BGU A;  4YB1 P;  1S0N A;  8RUC A;  2VH7 A;  2LXI A;  3ZZZ A;  2CPD A;  3P8B B;  3GG0 A;  2QLJ B;  2DNY A;  3KK2 B;  3BQ2 A;  4EYH B;  2GVZ B;  1NSQ A;  3RB6 A;  4C98 A;  3BN7 A;  2AU0 A;  2XTJ P;  4N77 A;  3JQK A;  1FDA A;  3DOM B;  4ZCM A;  5A8K B;  4N8N A;  3A1Y G;  3ITH A;  5F3T A;  3W62 A;  1NU4 A;  3JSM A;  1QAI A;  3H0P A;  1WAC A;  2VA2 A;  2OHD A;  4Y00 A;  2NZ4 A;  3M8W A;  1REG X;  2HVD A;  4R0E A;  4RNO A;  1EQ0 A;  1IKX B;  5B0D A;  2G0J A;  4ECS A;  2BE7 D;  2M4M A;  4JV1 A;  1CS4 B;  1Z4U A;  1OQ3 A;  2NCK L;  3CCT A;  4O3N A;  2QE5 A;  5DG8 A;  4OHW A;  3AOA A;  3PX0 A;  5D8H B;  4TYA A;  1YK9 A;  1GNK A;  5GAD I;  4C8Z A;  3TI0 A;  5KFK A;  5KFT A;  2RQK A;  4UTG A;  5AJ3 F;  1O6X A;  3JYT A;  2B4U A;  2DGO A;  3O6Q A;  4KO0 B;  3K0J A;  2YX4 A;  3TX0 A;  4CM2 A;  3CCU S;  3F44 A;  4K59 A;  4NLT A;  5F41 A;  4USW A;  1K9M T;  4OYM A;  4F3M A;  5ADZ A;  5M2P A;  1TZ0 A;  3D0I E;  4XAK A;  1FJG F;  1T8E A;  4CLL A;  1D8Y A;  2UXC J;  1BGX T;  3I82 A;  3RAX A;  3QRP A;  3TR5 A;  4WZQ A;  1HBM B;  2OSQ A;  2B8Q A;  5KT6 A;  3PW4 A;  3GQC A;  2AT1 B;  2RDI A;  3PR4 A;  5FDL B;  2IJN A;  4E0D A;  1SC4 B;  1TK8 A;  1YJ9 S;  3HKZ D;  4BS2 A;  1NH8 A;  1BXN A;  3QRQ A;  3I87 A;  2HHQ A;  2U2F A;  3JTO A;  3R7S B;  1OS5 A;  1D9D A;  4ICL A;  2E1A A;  2MQM A;  5BXI A;  3PIO Q;  4FS1 A;  1GK8 A;  3QWP A;  4ED4 A;  5H9E K;  3MMA B;  3KLF B;  4M5L A;  4DQI A;  2MZQ A;  4OYX A;  4W90 B;  5ETS A;  5A6P A;  1OWX A;  5EWE A;  3D68 A;  3VZH A;  4UOG A;  2Q1L A;  3HDS A;  4YN3 B;  3KLE A;  5DJB A;  5E0O A;  2XB2 D;  1TKZ A;  4P75 A;  4ECV A;  5SUH A;  5IC6 B;  4DF8 A;  3HCX A;  2V4Q A;  1RLC L;  5CQG A;  2R7Q A;  2AGO A;  4HT5 A;  4ECR A;  3C16 A;  1N34 F;  4ES3 A;  2QYC A;  2WW4 A;  1VBK A;  2W9B B;  3NS5 A;  5EWG A;  4ELU A;  1QD1 A;  2LA6 A;  2XQC A;  4M5H A;  5K8P A;  4DPW A;  4ZA1 A;  1JX4 A;  1U1L A;  3AOD A;  4CT8 A;  5B0C A;  1A7G E;  5KAK A;  4F3Q A;  2BMB A;  2HWI A;  4DR5 J;  2XYH B;  2RNE A;  1KR4 A;  1ZAV A;  2FHO B;  4X4N A;  4EU0 A;  1M5V C;  3WIV A;  1HWI A;  2BR0 A;  3BZQ A;  3L09 A;  2ASJ A;  1RU1 A;  2V34 A;  2KO1 A;  1VC5 A;  1B3T A;  4JI2 F;  1MRO A;  4F0K A;  2F1F A;  4RW6 A;  1AA1 B;  3V6D B;  2HFO A;  4X4T A;  1IKW A;  4DR7 J;  3OR1 A;  3NNH A;  2AZ1 A;  3S6E A;  4DV1 J;  4HYK A;  2FJW A;  2W4P A;  4FNH A;  3UN3 A;  1R43 A;  2XG8 A;  2RD5 C;  3BO3 A;  1RT2 A;  1OY9 A;  1T9W A;  2QYG A;  3E01 B;  4FF3 A;  2C3P A;  2CDQ A;  3D54 A;  1RDR A;  3HKW A;  3QO9 A;  5D6G A;  2J7W A;  1BMQ B;  1SVD A;  3PYG A;  4LRC A;  4JI8 F;  3HHE A;  3OJS A;  2B4P A;  3GMG A;  4ILR A;  3WBZ A;  5DQH A;  4H4O B;  3G8Q A;  3M7V A;  2DNH A;  5F8L A;  1S6P A;  3MUV P;  3SCI E;  4JI6 J;  2WZ1 A;  1RAH B;  4Z7Y A;  3R1L A;  2R8G A;  3I5B A;  4JOU A;  3MAH A;  4P73 A;  2EG1 A;  2UV8 G;  3WX4 A;  2V5H G;  5DDP C;  1YIJ S;  3R2C J;  2WK4 A;  1ACM B;  4U67 Q;  3MM6 A;  3C14 A;  1H2U X;  1HAR A;  4L3N A;  4DDF A;  5IQ6 A;  4G1Q B;  3NGT A;  1FKP B;  1EKS A;  1XR5 A;  3KNA A;  1U48 A;  3NWG A;  2W01 A;  3HSG A;  3LP1 B;  3K89 A;  5DRK A;  4NE9 C;  1EJ7 L;  4LF6 J;  1J5O B;  1PSD A;  4GO5 X;  4WP3 A;  3AAW B;  4YS2 A;  4QCL A;  2HFV A;  3KXD A;  4H54 A;  2Y1I A;  1YZ6 A;  3HZE A;  3W2V B;  3R8Y A;  3NMA A;  1EQM A;  4CLW A;  2OLW A;  2CPX A;  3UDE A;  4OI0 A;  2QGF B;  4ER8 A;  1NJW A;  4FXV A;  2B9X A;  4FYY B;  3UE2 A;  4BWJ A;  2ASL A;  3W8G A;  2FLP A;  1WF1 A;  3PJX A;  4Q2L A;  3ZXW A;  2DH9 A;  1Y11 A;  3JTN A;  5G4D A;  1QVG R;  4QYR A;  1NEE A;  2Z57 B;  2QSW A;  1L3T A;  1FXR A;  4DR2 J;  4QWA A;  2XS2 A;  3ICL A;  3M2R A;  2ZM6 F;  1JLF A;  1NK4 A;  3N9U C;  3GJS B;  4HL9 A;  3VAJ A;  4HI2 A;  4ED5 A;  4JYA J;  3MPD A;  1FRX A;  2HZA A;  1DRZ A;  1RWW B;  3O5T B;  4ALZ A;  4DR2 F;  2CQB A;  1Q1K A;  2OEK A;  4IOA Q;  3GPA A;  4WF9 Q;  4EZ9 A;  1DFD A;  2OTJ S;  1RAG B;  3ET6 A;  3MPU B;  3MPV A;  3V6H A;  1K0V A;  1MSW D;  1BLU A;  5A0Y A;  4JV0 A;  4IFY B;  1RWV B;  1TAQ A;  5IM0 A;  1NZ8 A;  2M9K A;  4KYZ A;  5C24 A;  4RUC A;  3LP0 A;  3UD3 P;  1WKK A;  2ZFH A;  1S9G A;  5BR8 F;  1HR0 J;  2MJU A;  1KWM A;  1NHU A;  2YKM A;  3M6X A;  3NS6 A;  4KB7 A;  3CDB A;  5HVG A;  3KTQ A;  2JC0 A;  5E2Q A;  4ILL A;  2R8J A;  3RTV A;  3ET6 B;  1X5P A;  2RT3 A;  4MH8 A;  5CZX A;  3RG6 A;  2XLI A;  1Z2L A;  1IWG A;  1RT2 B;  4JI3 J;  1RBL A;  5E5N A;  3RZA A;  2PMW A;  1SC6 A;  3D9B A;  2L48 A;  4ZLJ A;  2E5H A;  4W4M A;  4ECZ A;  2XSF A;  1X9M A;  4DX7 A;  2ZH8 A;  3H90 A;  2AJ0 A;  2GO8 A;  2FJV A;  2RKI B;  1C1C A;  3OXG A;  3PFE A;  1SBR A;  4IO1 A;  3RGI A;  3TA0 A;  4EYI B;  1XR6 A;  4OV6 A;  5A8R A;  2MB0 B;  4DSI A;  2L41 A;  3VZI A;  4YY3 J;  3R5A A;  3CVK A;  4GVB B;  1R8B A;  4I67 A;  4Q8F A;  1VLY A;  2XEX A;  4MIA A;  2WB4 A;  1S7H A;  1WEZ A;  4ZVT B;  3CDW A;  1HNW F;  4EBD A;  4ZVH A;  1WUU A;  3DRR B;  3G71 S;  1FJG J;  1DQA A;  3AHP A;  1A6L A;  4WIQ A;  2CQ1 A;  2J7K A;  1S6O A;  3J81 U;  5DQI A;  4AL7 A;  4LF8 F;  4UZC A;  2HAF A;  4A48 A;  3S1T A;  3SFG A;  3M6V A;  1T11 A;  5KG6 A;  2UXB J;  3ZTP A;  1HNI B;  1PIE A;  1W7W A;  3OTO F;  3CCV S;  4F4Z A;  3HHN B;  4N56 A;  4YB6 A;  5HO4 A;  5KG2 A;  5KT4 A;  2ZH3 A;  1TFY A;  2HS0 A;  4YHH F;  1QUP A;  3H42 A;  2RRA A;  3Q8R B;  1HNZ F;  1HHS A;  3KLE B;  2V94 A;  1PGZ A;  1RT6 B;  1S5Z A;  2I5J B;  3NGR A;  2DCL A;  1UWA A;  1RWU A;  1ZAX A;  3MDF A;  2D3Z A;  1WG5 A;  1HQU B;  3JTP A;  3K5N A;  2IIH A;  5F9N A;  2DIU A;  1IJF B;  4Y2A A;  2P9C A;  1PYS B;  3IC1 A;  2V2V A;  4URG A;  1KS2 A;  3KK3 B;  5I4M A;  2VG6 A;  2M8D B;  2DGX A;  1IBL J;  3CC7 S;  2IMW P;  4CQ1 A;  4QYZ K;  4N47 A;  2DD8 S;  3RR7 A;  2DR5 A;  3W7B A;  1Y0H A;  1GXL A;  4MK9 A;  4ZJO A;  2QLB B;  3BQ0 A;  4J9Q A;  3PG9 A;  4CNY A;  4USM A;  3QID A;  4KJI A;  3TAN A;  1CPZ A;  4WU3 A;  2ZC4 A;  1NM2 A;  1MN9 A;  3POT A;  4OI6 A;  3HVR A;  2ZH6 A;  3P6Y C;  1MRO B;  2BW2 A;  1VQO S;  1NDC A;  4Y65 A;  1NCL A;  2B5J A;  1KRP A;  4LF4 J;  2PO4 A;  1UEV A;  2XZW A;  3KK1 B;  2GFF A;  2Z2L A;  3QBC A;  1HBU B;  4HHH A;  4KHP J;  1TAU A;  1WOS A;  1XMQ F;  4OJ3 A;  4B3O A;  4O3R A;  6FDR A;  2B5J B;  4G6V B;  3EVO A;  2ZH7 A;  2K7K A;  5HBM A;  5H9F K;  3UPF A;  1RGV A;  1HNX F;  4UT4 A;  3M1V B;  1M1K T;  4TXS A;  4AFF A;  4KRW A;  4YR3 A;  4ANC A;  5J2P B;  1Y00 A;  1WG4 A;  4QZV B;  1Y5N B;  2J9C A;  2PDA A;  3ITH B;  1YIT S;  2Z0G A;  3GYX B;  4JYA F;  2ZHA A;  1U8W A;  4OI1 A;  3ENV A;  4FF2 A;  3BGR A;  2RF2 A;  2V6A A;  2YKP A;  3MMC A;  3KK2 A;  1IJE B;  2AYB A;  2FUG 9;  3TUZ C;  3D1Q A;  3SV4 A;  4BC9 A;  2RHS B;  1ZM9 A;  2XMV A;  1R8P A;  3VGV A;  3CJR A;  4RUH A;  3V81 B;  4F0M A;  4TYB A;  2RQM A;  1OIA A;  1VQ6 S;  2MZR A;  4OX8 A;  4RUA A;  5LL6 d;  3H98 A;  3G2X A;  3J7Z T;  2AW0 A;  2J8A A;  4QWE A;  2XHC A;  1TL1 B;  3QAT A;  4B9T A;  4DX5 A;  4PG7 A;  3SQO P;  2CWX A;  3ZZT A;  1S48 A;  3CDE A;  2HPU A;  1HHQ A;  1RAI B;  3CW2 C;  4DFK A;  1YJW S;  1X0P A;  2VG5 A;  3A4T A;  3ENW A;  1WSR A;  4NLX A;  3CUL A;  3IXQ A;  4TNO A;  2ZZM A;  4NZ0 A;  1S1T A;  1YVF A;  3UN5 A;  1XER A;  2R2T A;  2PI4 A;  5HP1 A;  2ZBP A;  1XBW A;  1GX6 A;  2QJ3 A;  3CO9 A;  5ETO A;  5HAO A;  3FKB A;  3RJM B;  3RU0 A;  2UVV A;  2MY8 A;  2HAI A;  3H40 A;  4F25 A;  3MM5 B;  4TLR A;  3NGD A;  2I9S A;  5HBM B;  4PAB A;  1UCN A;  3AXM A;  4ZLN A;  5EN1 A;  2VPX B;  1UEU A;  2GIQ A;  3M6W A;  2VQE J;  1VK8 A;  4GO7 X;  5KG0 A;  4EMD A;  3MPW A;  2EXU A;  2XYP B;  4RX6 A;  1IBM F;  3OT9 A;  4ZVU B;  4NYZ A;  1U8S A;  3W5Z A;  4ZLL A;  3Q0A A;  1LW0 A;  2HLT A;  4DFJ A;  1U1Q A;  1TL3 B;  2EK6 A;  1VIX A;  1CJT A;  2DNR A;  4A8M P;  1ZBT A;  1TFW A;  5ETN A;  3AQP A;  2KT5 A;  4HI1 A;  3EXC X;  3IBW A;  3T1Y J;  1X9S A;  4B9S A;  3RR8 A;  3H4D A;  4DEZ A;  1DBD A;  4ECU A;  1U2R A;  1JLG B;  2D41 A;  3WZ0 A;  1KSP A;  1XNR F;  2MEW A;  3PX6 A;  2UP1 A;  3PDN A;  2YX1 A;  4DPT A;  2COL A;  2HQI A;  1NKC A;  5MLC V;  2V50 A;  5F8G A;  2X1B A;  5BYS A;  2B4V A;  2GVZ A;  2XNQ A;  3PNI A;  1KEK A;  3EPI A;  3DI6 B;  4EEY A;  1VQ8 S;  5K5M A;  2PD1 A;  1HD1 A;  1LWE B;  4OJG A;  2E1P A;  3CCL S;  2VG6 B;  3KHH A;  1RQ0 A;  4DV2 J;  2WBR A;  3LUY A;  4Y0F A;  3R5B A;  1IVZ A;  4PYD A;  1RTZ A;  3VAI A;  5FII A;  1AFI A;  5C24 B;  1S0O A;  4I56 A;  3UCG A;  2Z2Z A;  2DXD A;  2DXE A; 
#chains in the Genus database with same CATH homology
 2C1E B;  5IC4 B;  2HBZ B;  3GJR B;  3R5J B;  2C2K B;  1SC3 B;  2QLJ B;  2QL5 B;  2C2Z B;  1I3O B;  3EDQ B;  1RHQ B;  1NME B;  2QLB B;  2H51 B;  2H5I B;  3NS7 B;  3KJQ B;  3KJN B;  1I51 B;  3IBC B;  2QL9 B;  2HBR B;  2HBY B;  2Y0B B;  1IBC B;  1QTN B;  1PYO B;  3R7B B;  1RWM B;  2C2O B;  2C2M B;  4ZVS B;  3GJT B;  3P4U B;  3GJS B;  4DCP B;  1RWO B;  2CDR B;  1RWW B;  1RWX B;  2H54 B;  1F9E B;  1SC4 B;  2CNN B;  2H4Y B;  1RHJ B;  3R7S B;  1GFW B;  2HBQ B;  3R6G B;  1RWV B;  4ZVO B;  4DCJ B;  2DKO B;  1RHM B;  1RE1 B;  2QL7 B;  2CNK B;  2XZT B;  4LSZ B;  5IC6 B;  1QDU B;  1RHR B;  2FQQ B;  5K20 B;  4ZVP B;  4ZVQ B;  1RWK B;  3RJM B;  3SIP B;  1RWP B;  1SC1 B;  2H4W B;  1PAU B;  2H48 B;  3P45 B;  1RHU B;  3KJF B;  3D6M B;  2Y1L B;  2XYG B;  3D6H B;  2XYP B;  2XYH B;  4ZVT B;  1ICE B;  4ZVU B;  2CNL B;  3EDR B;  4JB8 B;  4DCO B;  2CNO B;  1RHK B;  3QNW B;  3IBF B;  2H5J B;  3D6F B;  1RWN B;  2QLF B;  2CJX B;  2H65 B;  3R6L B;  1BMQ B;  3R7N B;  2XZD B;  4ZVR B;  3GJQ B;  2CJY B;  2P2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...