2HBRB

Crystal structure of human caspase-1 (arg286->ala) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2hbrB00
4LSZB 3D6FB 2XZTB 2FQQB 4ZVTB 1RHRB 1SC3B 1PYOB 1RHUB 3R7NB 1RHKB 1SC4B 2CNNB 1F9EB 3R7SB 2CJXB 1RWKB 2HBYB 3P45B 3D6HB 5IC6B 2QL9B 1RHJB 5K20B 2H5IB 1RWNB 1IBCB 4ZVSB 1RHMB 5IC4B 1RWPB 2XYGB 2DKOB 2XYHB 3SIPB 4ZVRB 3D6MB 2H65B 4ZVUB 4DCJB 2CDRB 1RWVB 3IBFB 4JB8B 2CJYB 2HBZB 2C2OB 1SC1B 2C1EB 2QLBB 2XYPB 2C2KB 2XZDB 1QDUB 2QLFB 3R6GB 2CNOB 4DCOB 1ICEB 3KJFB 2P2CB 1I51B 1BMQB 2H4YB 2H54B 3GJTB 1QTNB 3R5JB 1RWOB 1RE1B 3P4UB 2HBQB 1NMEB 1RWMB 3GJQB 2CNLB 3GJRB 3NS7B 2H51B 2QLJB 4ZVPB 4DCPB 1PAUB 2QL5B 3KJQB 1I3OB 3QNWB 1GFWB 2Y1LB 1RWXB 3GJSB 2C2ZB 3R7BB 3EDRB 2H48B 3KJNB 3R6LB 2QL7B 1RHQB 2H5JB 1RWWB 2HBRB 4ZVOB 2Y0BB 2CNKB 3IBCB 4ZVQB 2H4WB 2C2MB 3RJMB 3EDQB
chains in the Genus database with same CATH superfamily
1IUJA 2F9JA 3BO3A 2F1FA 2E7VA 4P75A 1VBYA 1FE4A 2P6SA 3E8OA 1ZPWX 5CAAA 1JLGA 3OD2A 1IWGA 2VC0A 1RQ0A 5HI7A 4ERDA 3DRXA 3P5BP 2PEBA 2VDHA 2FJDB 4MKYA 1RAFB 4TXSA 5LJ3Y 2ZE2A 2V94A 2KT5A 2RS8A 1HWKA 4ZVUB 3BQ0A 4WKYA 5LSLA 1U26A 2XZDB 2W4DA 5C24B 2Q3PA 1N33F 1WNEA 2AMCB 2V8VA 3M32A 4G1PA 2V5HG 1TMMA 2W9BA 1SV5A 3WC2A 1YKWA 1T7PA 3K59A 1REGX 3U27A 4I7FB 5THWA 1FNOA 1MMDA 4EBEA 2MGZA 3MF5A 2LMIA 5CZVA 4RU2A 2F4VF 4FS1A 2DISA 1KLMB 2YNFA 1T9UA 1VQ4S 3CIZA 2OLWA 1RTDA 2RRBA 4Q44A 1NXIA 1AZSA 3FRZA 4PG6A 3CDBA 2YWFA 1PIEA 2N7YA 5F8HA 2W7AA 2G13A 3T1YJ 1ZAVA 2E44A 5T7LA 5K5MA 1ACMB 4PQUB 1RHJB 4ETZA 2XSJA 4M5LA 1Z2LA 4WZMA 1RT4A 2IYGA 2GO8A 5B0DA 1S99A 2XYHB 1FF2A 1KTVA 1XQIA 1KHVA 1UMJA 2BQRA 4OX8A 4RUBA 1T3NA 4ZCIA 1HI8A 5E7OB 5HQMA 2VH7A 5A0YB 2G2ZA 2APOA 1ZYQA 2XHCA 3NWRA 1R8PA 2GCFA 2PA8D 3J7A1 4QR1A 2M4MA 2EFVA 2WBMA 4NLSA 3VAGA 4HTIA 1RT7A 2JRSA 3CO9A 1X9SA 3B6BA 2ZKTA 1FRKA 2G4BA 1X4HA 3KLEB 5EDWA 3MPDA 3IN5A 3B54A 4F7VA 1B64A 4CO2A 4QWEA 1IKVA 2JC1A 3MM6B 2NXEA 4KO0A 1PC4A 2R7WA 2XZWA 4WU3A 3KDOA 1NHUA 2VZ9A 1FRJA 1UW4A 3F41A 2XHWA 4MK7A 1BWVA 3D9BA 2XLJA 3HHEA 4LF4J 3JB9k 2VONA 2J6UA 1F9EB 5KFRA 1JLAA 3QGGA 2WSFC 1DY3A 1NU4A 2CQ4A 2GV1A 2ZDOA 3HD1A 1VQ7S 5BR8F 3KK2A 1U1KA 1I1GA 2C3PA 3RBDA 4FF4A 4B3OA 4NLXA 4OI3A 4QPXA 4WFZA 3A3NB 2GVDB 1F3FA 3MEEB 1NB7A 1VQKS 1SL1A 3J7ZT 4TLRA 4DV0F 3IS9B 4YEAA 1C0TB 3G6XA 3IRXB 3W3SA 3IWXA 3DHWC 1RBOB 1N36J 1KVIA 4TVAB 2KXNB 3BZQA 3TAMA 4ZVGA 3QNWB 4OFZA 3HVRA 1WG1A 4OHZA 3HFVA 2MZJA 3UR3C 9ATCB 4DR2J 4DQIA 4EFAC 4DPTA 2UV8G 2RMLA 2YKAA 1E6VA 1S49A 4BC9A 2FQQB 4PEOA 4CDIA 3GONA 1Q5YA 2JFDA 2ZWOA 3EGZA 1UFLA 2VQFJ 4FNHA 2N3OA 4OJ3A 5K14B 4NLPA 2R7TA 5IC4B 2IAJB 3L7PA 3NXZA 2B9YA 1FNXH 3BQ2A 1H7WA 2IVFB 3ZZ0A 2AYGA 4WE1B 4ECRA 4XAKA 5K8NA 4ZPVR 2HQGA 1FE0A 2W2QP 4C0HA 5ETTA 2RILA 1EQ0A 4LF9F 4WKRA 2AV5A 2JVOA 3KKFA 4DMZA 2JOQA 1SQFA 2R7SA 2AWZA 3P5TL 2HWHA 3RW7A 2DHXA 4P10A 3VTIA 1JJHA 5E3RA 5H9EK 1EETA 2R2RA 2RRNA 1DLOB 3RB4A 4ZJQA 2KI2A 1YJTA 4EYHB 2H4WB 1HW8A 3QT7A 1NNDA 4G1QB 2C2EA 1FKAF 2D9OA 4OYMA 1GEHA 2K3IA 4HACA 3H2LA 1Q8LA 2V0NA 1GTEA 1MN9A 2BW2A 3AA9A 3I0SB 5DETA 2QA4S 5E3QA 4OJ1A 2HNYA 4MKVA 4DZDA 3RAXA 1FX2A 2QFJA 1PBUA 4ZVEA 1OYDA 5HP1B 3MMAB 4WFNQ 4F2SA 3M8ZA 3G96A 1VJQA 2QLBB 2QX0A 1YIJS 5CYJA 2VPZB 2ZM6F 2MY7A 4W4MA 5CH7B 3PW0A 4M5HA 4AXJA 3UWTA 1C4CA 1LXJA 2CNLB 2Z56B 1FEHA 3GYGA 2AGQA 3M2RA 3PX6A 3OR2A 4UQTA 1RT2A 1ZPVA 4DX6A 3UNYA 2XO7A 4KC5A 2CQ3A 3CXCR 4DUZF 1FVSA 4ZVQB 1JLFA 2ADCA 3C15A 2MKIA 3D6FB 3JTNA 4M95A 3R1LA 3QRRA 2QSWA 4Q45A 1WWHA 4UZCA 7AT1B 6AT1B 1BQNA 1TUWA 3RGIA 4L72B 4RJVA 2V9KA 2A2DA 5IT4A 4OJGA 4PXBA 4EK2A 3CD6S 2PFFB 3HZGA 2UXBJ 2ACYA 2WVEA 3CD7A 1G2EA 3CMAS 1T8EA 1WEZA 2E1AA 5FIIA 2P9EA 4RBTA 4ED6A 4M5MA 3DRSA 4A8YA 5C2CA 5AXMA 1R0AA 1Y4ZB 1KNZA 1CQNA 4RKUC 2DNGA 1PAEX 2YH0A 2JWNA 4R25A 4QJVA 4I2PB 1SJ1A 4HLBA 2X1GA 1XR7A 4I69A 1XIQA 3J80U 4DR1J 1H0HB 4KBIA 2N82B 5C5JA 3CCSS 6FD1A 2CPFA 3CDAA 2FY1A 2P5VA 1LOUA 3MEKA 4TU7A 4H4MA 2W9CA 3BDEA 4D3HA 4KY3A 3T6JA 2LEPA 3SCJE 3EX7B 3MM9A 4PYDA 1RXOB 2RHQB 3NWGA 1HHQA 1RWNB 4RX6A 4Q0BA 2HYIB 2DGSA 1W2BR 2MZRA 2KM8B 3T41A 3D5MA 4U9RA 2EXUA 4BHQA 2I8EA 5SUHA 3OSNA 2MPUA 4WP3A 2Z30B 1DQAA 3KHGA 4KR0B 3MDFA 4IFYB 2HHTA 3R5AA 3W9HA 4KH0B 2KU7A 2PN6A 1FNMA 3GFHA 1HNVA 1R0CB 3CCTA 2R8JA 2P8IA 4QPTA 1V3RA 3KUGA 3CULA 4U7UD 1GFWB 1IN0A 4TYAA 1N6QA 1U2RA 3OTBA 1MMNA 3OJSA 3N0VA 3CGIA 3QQCD 3HVTB 3M8YA 4K4SA 5ETMA 1RK8A 3PFOA 1IR2A 1SH0A 1D0EA 4NX9A 2I1RA 1PJ5A 1N0UA 4X65F 2R42A 1K8AT 4Y6IA 5LSRA 2VBZA 3FSIA 2WVBA 2BRLA 4AYBD 1TVRA 1X4AA 2B4PA 2E29A 4ED2A 2QMWA 2ZVIA 2DKOB 2VU5A 2HPUA 1RTIB 2RRAA 5A8RB 4DV3J 4F8RA 4ES3A 2FVPA 3OL7A 4RNMA 3UDVA 2ZD1B 2AJFE 4N41A 2L08A 3NCRA 4K0KJ 1HPZB 3NS7B 2R7VA 1CS4B 5D0HA 1WG4A 4G65A 2NYHA 4JV1A 4WFYA 2KG0A 1S1TB 4NWBA 4C0BA 3TZWA 3RBZA 3IBCB 1TKXB 2OTJS 4DEZA 4K4UA 1CEZA 1HBMB 3PRBA 4QIFA 5KG6A 3NAHA 3HO1A 3ADAC 1JJ4A 4AXIA 1VRTA 4JP8A 1H98A 2FZGB 5H1SV 3CTRA 1X5PA 1IKWA 2AHOB 4P52A 1NLKL 1Y10A 2VL1A 2G2YA 3WX4A 3SCLE 3TI0A 1YWXA 3MAQA 3DLBA 5L9XA 2YKMB 5CD4A 1X0PA 3C6UA 3DI6B 4DV1F 3MPWA 3C2PA 3UDEA 3DRPA 3QRQA 2C1EB 2DH7A 5GAHU 1HARA 3FUYA 3EE3A 3WHIA 3OTOJ 5IQ6A 3QZ7A 2C3MA 2HRUA 4WJBA 4IRKA 2FHKA 2PMHA 4ELVA 3EXYA 2ZBCA 5HLFA 4NLDA 2MQOA 4K2XA 3GJSB 2EKNA 4RW7A 4CQ1A 2C2ZB 4Z2XA 4WCEQ 4Y2KA 3HSJA 2HGMA 1GXLA 3MCOA 2V8HA 4C6AA 4Q5VA 2F65A 2HG4A 2FC8A 3HHNB 1P6TA 3JQKA 1NDPA 1EARA 4OJHA 2QYGA 1FA0A 1VGYA 5F9NA 3AA8A 2AYBA 1Z2ZA 2FHJA 4JYAJ 2W4CA 1CJVB 4PPZA 1FKOB 2DK2A 4BBYA 4N56A 2G0JA 2CPEA 5ETQA 3H4DA 4J7CA 2Q1LA 2RU9A 4DS5A 2KT2A 2C2RA 2P9CA 3MTKA 4M5IA 3TQEA 3NMRA 5C2GA 2W2PP 3CVKA 1NH7A 4R0JA 4HH0A 2E7WA 4MIWA 1BWEA 3LP2B 3BQ1A 3THVA 3T19A 2BDPA 1U0HB 2IY5B 1U48A 5HVFA 3NMAA 2LDYA 3E01B 1BQMB 1MMLA 1AFJA 1S7IA 2HHQA 4C8LA 4ED7A 3T9ZA 2QT7A 2EEYA 4NOHA 3BBCA 2LU2A 1GX5A 1SIWB 1KLMA 3S7RA 2HHUA 2W7PA 1S4EA 2HVDA 2BKNA 3QGIA 1UAWA 2HNDB 1XMQF 3GFXA 3GU0A 4ED3A 1YSJA 1RWVB 4C9DA 2PDAA 1CJUB 2VJVA 4RL1A 3UN3A 2YNHB 4CO1A 2J76E 1U47A 4HL9A 2ZH8A 2O67A 1B70B 4NA2A 1DTQB 3R5DA 2V6AA 4OQJA 4USKA 1QY7A 1RT6B 1XMOF 1F2HA 4WF9Q 3FBBA 2ZH3A 3RTVA 4IO1A 1U1LA 1OY9A 4DOZA 3BV8A 2HAFA 5A0YA 4PYAA 2DRBA 3GP9A 3VAIA 3UCZP 1QAIA 2FD2A 1RI7A 1WHXA 2DVIA 1NDCA 5H9FJ 4Z7CA 3KLEA 3NGUA 3BN7A 1BXNA 1Q53A 2LVWA 8AT1B 2BV3A 3BBBA 5KG3A 2ZBPA 1C1CA 5KG0A 5KFHA 5BYSA 4TYBA 2IJNA 4ZCLA 3N79A 2XGQA 4J9NA 4M5GA 3MR6A 4DFPA 3P6YC 1SPBP 4NLYA 1FERA 3OHBA 3BGLA 3CCWA 5E33A 4FYYB 2YX1A 1K1SA 4YR0A 4BDPA 3W62A 4OYIA 4OZ1A 4L76A 1N32J 5DLFA 1PKUA 1R6VA 4DLEA 4QW9A 4PABA 2VDIA 1D3WA 3V6HA 2V67A 2HFSA 2FUG9 2M5YA 2BW7A 3VZIA 3F56A 3GMGA 2QMXA 2HEKA 3CPWR 2NSCA 3P4UB 5J1NA 3MEEA 4YQWA 5HK4A 1WC3A 4P71A 4PUOB 1ZM3A 5IWAJ 3OUYB 2VKZG 1F5CA 3G87A 5B0FA 1DTTB 3IS9A 3PM9A 5HBMA 1C0TA 4OX9F 4C8ZA 1HNXJ 4ZLPA 1M90T 3AXMA 4KKOA 1MLAA 4O3NA 5ITHA 5EWFA 4X4UA 1IXKA 3HMJG 3SSQA 3S6EA 5ETKA 2R8HA 3TR5A 4USTA 5D0RA 4Y2CA 1M5PC 4NLQA 5GVQA 5B0CA 5EHHA 5IS2A 4ZVSB 1LWXA 4OI2A 3HT0A 4LT6A 5E5NA 4MJKA 5I42B 2PC6A 4LBIA 3T5JA 3VGSA 4J9OA 3D6MB 2RD5C 4ZPDA 1HYSB 4F4AA 2KRBA 4ATNA 5EX0A 2HBZB 1FXLA 3A13A 1M5HA 2CZ9A 5FD1A 1PYSB 3PO5A 4USIA 5J1EB 3OQ2A 3N9UC 2BKOA 4XTTA 2IAJA 2JLFA 2W2MP 1O8BA 4MMOA 4K4ZA 2YKPA 2XMJA 2UUAJ 5ETSA 3D3BJ 4WE1A 1YBAA 3L95X 4J90A 1I5OB 1XJWB 2AZ1A 4P7TA 2RB7A 2XMMA 3TAPA 5GAEI 4ZVOB 1SKWA 2GQQA 3DLGB 4L3NA 1IR1A 2E1RA 4X4OA 4O3QA 1QD1A 4M5JA 4Y2IA 4JI3J 4I6YA 3R5BA 1DLOA 2R8KA 4NLUA 5K20B 2M3DA 4RUHA 1FFSB 1UCNA 4LIRA 1X9WA 4G1QA 2IRUA 3KK3A 2PO4A 4FBUA 2QA2A 4CZCA 3VAKA 4UUWA 4DSKA 3IBFB 5ETNA 3TNVA 3U1LA 2R4FA 3KNGA 1JWWA 1M0SA 5F8JA 1I51B 3PRDA 4O3SA 3H4BA 2UUWA 1XN9A 2DNYA 1GTHA 1VFJA 3TYTA 2K8GA 3K57A 3K0JA 3Q86A 5JJBA 3MMAA 3T1HF 2CPJA 4FF1A 3D54A 1HBNA 1Q79A 1FI4A 4OL8A 1TFYA 5JVGQ 1XNQF 5HMXA 3HK2A 2NREA 2C3OA 3OXLA 3NLCA 5D4LA 3GFYA 3FCWA 3DU5A 2AJ0A 2M2BA 3B4MA 3MPVA 2B6AB 1T05B 2PD1A 4MH8A 3LPEA 3M6XA 4X62J 4FKXA 3FMWA 3LWMA 3HD2A 4PG4A 3BEGB 2JEGA 4OYOA 1TK8A 4QW8A 3U1NA 3TJAA 5B0EA 2HGLA 3AXKA 3FDSA 2HFZA 4Y65A 2BANB 3DYAB 1HW9A 4DV7J 3BM7A 1U1PA 3ZZRA 1U6BA 1J5EF 3TEGA 3ZZZA 2GJ2A 4XO0A 3ILIA 3UD5A 2HBQB 3CMQA 1TQLA 2FJAB 2FZKB 3LA0A 3DLKB 4PG8A 1HIYA 2MKKA 5DRKA 4DF4A 5JUMA 1PJ7A 2EK1A 3KK1B 2BE2B 1O5JA 2CNKB 4YB5A 1CQMA 2A3JA 3QIPB 2JLGA 2BJ8A 4U8VA 3PV8A 1AUDA 2ZUAA 4DL7A 3QO9B 4I1TA 1XEZA 1RHUB 1RAIB 4J9MA 3S8SA 3VV2B 3T5HA 3SFGA 2W2OP 3DDIA 4JOUA 1NO8A 3MM5A 4KV8B 5D77A 1FJEB 3BBFA 3VQSA 4LF2A 3SV3A 3W9JA 4YDXA 5JXSA 4NZ6A 3EZ5A 2RQKA 2DR5A 4B3MJ 2MSTA 4OYXA 1NEEA 3M9OB 3ITHB 3DMJB 4N77A 4C3MA 1WELA 2YKOA 3R8YA 2HWTA 5ETRA 4BWMA 4IRDA 4C98A 3SQGA 3FNNA 1FRHA 3M8PB 2FLOA 3SCKE 3EVOA 3KUHA 2OGUA 4PG7A 2QL7B 2V4QA 2MQ8A 1CULB 2B51A 2OJ3A 4JV5F 3BGRA 2GIFA 4AFFA 2MTLA 3KMSA 3PO4A 4USUA 4ANCA 1FHTA 2GGPB 3HHLD 3IM9A 2KH9A 1F9FA 2NUUG 4P6QA 3LF0A 3PDNA 3Q8YA 2DGQA 2I6WA 1NPRA 3TP2A 1RAOA 4M5DB 5F3TA 2MZTA 4DWIA 3UD4P 2KFZA 1S72S 4QQBA 4IQMA 4NCGA 5L38A 5FJ4A 4FNIA 3EMTA 3DRRB 3LQVA 1RAEB 1HBUB 1UEKA 3KYLA 2B4OA 2ZBQA 5A8RA 1BD6A 1URRA 4HH1A 3DNCA 3CCJS 1SL0A 3KJVB 2XNQA 3OPKA 2PMZD 4X66J 3KTQA 3DM2B 1IQTA 3RUBL 2ZD1A 2IVYA 3IP0A 4IH5A 1CVJA 5CHCB 3OFEA 1HPZA 3RRHA 4BC7A 1CS4A 5DZ7A 4EO6A 4B08A 2CJXB 1S1TA 1WUUA 2OEKA 3C8YA 3PR5B 1WTBA 4OHWA 4ZOSA 4F2RA 1T03B 5B08A 1SVDA 3JSMA 2BABA 3BPSP 4DFMA 1RKIA 4NLRA 4C8MA 3OTOF 1QDUB 1ZH5A 2OPRB 3MM8B 1JLGB 4KH1B 4EMDA 2X3DA 4E98A 3DI6A 3AD7C 5ETVA 4CLZA 3RR8A 2WOMB 2VD3A 4YB1P 4HEA9 4AE5A 4CLWA 3B4DA 3CC4S 3P49B 1RTHB 4YFUA 1N88A 2CPYA 1HQ2A 3G9CA 3J80Y 2IC3B 4LFAF 2E5GA 4FN5A 1SBRA 3M32B 3O2IA 2HKEA 4JI6J 2GX8A 4GO7X 4IYQA 2CQ2A 4WTYA 4LF7F 3IWLA 2E1PA 3A3PB 1TTHB 2MGZB 3QIDA 2CVEA 5GMEA 4NXNJ 4ECQA 4FDFA 2QZ8A 1NBEB 4HT5A 2XGPA 1H74A 2CRLA 3MOZA 2FIUA 3HCXA 4CLFA 3KWMA 1RTJB 2F63A 1CJVA 1WDTA 2F8HA 4IR9A 1MN7A 1FKOA 4NLOA 4WTOB 2GNKA 3AY0A 3EYZA 3N6NA 2F5GA 1JJ2R 3DU6A 1RT4B 2AF6A 1VC0A 3MWBA 5BJRA 3VCDA 4GKKF 3CJ8A 5DDRC 5G0RB 4MIAA 5LM7E 1SKSA 1VLYA 1IBLF 3H90A 3LP2A 2JC0A 1JXLA 4DG1B 4WP8A 4GKJF 1U0HA 4F36A 2MEWA 1HQUB 2ZUGA 3E01A 1BQMA 1JQGA 1QJHA 1KLNA 1OY8A 2CIMA 4XPCA 3CUNA 4ED4A 4DV2J 2IA6A 5BXIA 1IKVB 4JI2F 2VFVA 2W1BA 3D2WA 1AXQA 2FLNA 3GR1A 1BQXA 4OV1A 1SIZA 2OD4A 2NXCA 2W24A 3LPYA 3VAJA 3GYXB 3KJFB 1GNKA 3CCRS 2AW0A 1UEUA 1MSWD 3VALA 1LW2B 1B0TA 3AOAA 4QWAA 3NKYA 4KAIA 3DOLA 1CG2A 1FD8A 3ENQA 4XDDA 3I5CA 5LXRA 4B3SJ 1CJUA 2HURA 1SCJB 2Q79A 1BC6A 2R7OA 1RT5B 1VHFA 1O0PA 2EK6A 4ZPCA 2VICA 1IKXB 2ZH2A 1K47A 1RT6A 3IR6B 5HJYA 1SC3B 1VOMA 3X3UA 2OD6A 5KG7A 2MQPA 5DM7Q 2K3KA 4BCAA 2MZQA 7FD1A 2ASLA 1NHKL 3NG8A 1S1VB 3P3DA 1S6PB 5KFKA 3VGVA 4LF5F 1NSPA 1V5VA 2AX1A 1HWUA 1O51A 5DLGA 4DL5A 3T3FA 4CO0A 4F4WA 3ZZPA 5J2QB 2ZKUA 8ATCB 2ALYB 3D6TB 1D09B 3KG4A 4X64F 4J9UE 2FGCA 4U96A 4TKTA 3PG9A 4OV6A 4DFKA 5FLXU 5KT2A 3PJ9A 4CTAB 1S7HA 3MR2A 1Q8KA 2I0XA 4AQYJ 3TZXA 5IWAF 3D0GE 2LEAA 3ZO7A 2ALZA 3DLHA 1KVKA 5HATA 1MNEA 1BHNA 3MCSA 4CH1A 2Z58B 3EGNA 3WZ0A 5HROA 4NE9C 4O3RA 4DSJA 2PEHA 3JXOA 4X2BA 1FK9A 2C2NA 2L3MA 4DR7J 2UUBF 4DSFA 3V81B 1S9GB 4QCLA 3Q83A 4PUOA 1KP6A 4LR8A 4FXDA 5MAOA 1IKYB 4EZ6A 1G6BA 2IPOB 2E5IA 4RW8B 2AD9A 2RQ4A 1RCXB 2WVDA 1V3SA 2V8DA 1K0TA 3GCXP 4KIAA 4K2JA 5D4NA 2HK2A 2A6MA 4ILLA 4O0IA 2QG9B 2DJWA 4G6VB 4K4YA 2D3O1 2CA9A 2MJNA 2EFPA 3TVZA 1SB6A 3GTYX 4NRUA 2VOOA 3VR1A 5HAOA 4DL3A 3DLJA 1HYSA 2HHHJ 3L4BC 5IOLA 1SJQA 2QFIA 3F73A 2HNYB 5I3PA 3M7VA 2VASA 3M2UA 4QU7A 3K5MA 3NOGA 3EICA 2DNKA 5J1EA 4JI1J 1SH3A 2PE8A 2DCLA 4F4ZA 3NP5A 1DURA 2ZC3A 4OHVA 3PIOQ 4CIOA 1HNZF 3JYTB 3TWZA 4JI7F 3JS9A 2WVFA 4PR6A 4LBHA 2HZVA 1FWLA 4IQXA 2J5AA 1VQNS 3M8RA 1N48A 2QC3A 1SUQB 4EI2A 3I87A 2GIRA 1RT2B 2HVZA 3FEXB 2FDNA 2ROEA 2DPJA 4J5OA 1VQ8S 1IBKJ 2YVSA 1UP1A 1JLFB 4OIXA 1Q8IA 2CPIA 1KFSA 3T9NA 1J2VA 3MUMP 3J7YU 4HI2A 5LMNJ 2HHVA 1OPZA 2DPIA 3PHEA 2EBEA 1S5ZA 3BF4A 4X4PA 4IFVB 1TK0A 3IO1A 1NRKA 1P27B 3H20A 1MWZA 1NDLA 2R8GA 2QTWA 3RZAA 2XM3A 4B02A 4PXEA 4V19X 3SZ2A 3MD3A 3VWSA 1SKRA 5KG5A 1PGZA 4LRAA 2RUSA 4JI5J 4QIGA 2BJ7A 2PIIA 3ONQA 1BE4A 4KSEB 1MU2A 2IDEA 1UVKA 4DPUA 4B9SA 1XNRJ 4RWXA 1R7IA 2LP4A 4AL7A 1FJGJ 1LK7A 2EBGA 4R8UB 2M8DB 2HLTA 3I0RB 5C42B 3QJJA 1SQGA 1AUSL 4OZJA 1F60B 2ZOGA 3J81j 5KFVA 2UP1A 2MMYA 2R8IA 4DV5J 2QJ3A 4F26A 4DCJB 4DQRA 3H40A 4H4MB 2FJVA 3NY0A 3QBCA 4UTGA 5LMUJ 1YITS 4Q8EA 2XQCA 4DR4F 1VBKA 2AJ1A 1IJFB 1X4EA 3EWGA 3BS9A 4U8YA 1SJ4P 4B3RF 5A8KB 2L41A 3ENWA 5E3PA 3W7BA 2YKQA 2YX4A 3GJQB 4LFBJ 3GG0A 3DYAA 1L3VA 4ZPWR 5GMKa 4URSA 5L39A 2LQ8A 4BWJA 2E5HA 1AROP 2OPPA 4CH0S 2VFSA 1W26A 4Q43A 2DBBA 3PYDA 1FEEA 1MW7A 2HNZB 3ILJA 2Y8YA 2XB2D 4M5NA 4OI4A 1IJEB 2R9LA 4LVOP 2QYCA 1ZZFA 2VPWB 3M2VA 2YNGB 3A1YG 1SKUB 3QGPA 2G9OA 3KK1A 2DR6A 2J7KA 2D3UA 4IOBA 2OAUA 2H5IB 3HVAA 2DNNA 3FQKA 1R8HA 3OVSA 1N6QB 3PKMA 2RF2A 3I5AA 4GVBB 2CWKA 4AL5A 3V5RA 1N34F 1U8SA 2QRRA 1GX6A 2ZJRQ 4X84A 4NXMJ 4M63A 2W7OA 1CPZA 4DU7A 5CYQB 2RE1A 3AB4B 4HDGA 3GIKA 1TKTB 2L48A 2GA7A 2YTCA 2E5JA 1RAAB 2MLZA 1S10A 3KHHA 2O3DA 5M2UA 2LXUA 4NCBA 1S1UB 3VVUA 1N5VA 4EWTA 4YR2A 1RU2A 3EDQB 3I4PA 4A48A 1Q16B 2E9RX 9RUBA 4OHXA 2KXFA 2WONB 3M8PA 3H8YA 4TLQA 4QU6A 3RRKA 2R2TA 4MFBB 1HWJA 4LIWA 2IIHA 4RBVA 1CULA 4N7TA 2IM3A 1S0VA 5B7WA 1A0OB 3V4MA 3AB2B 2CPZA 4U95A 4QOTA 1VR6A 3L7UA 2KXHA 4QWBA 2GGPA 2AYMA 4C8OA 1RYSA 1E6YB 1LK5A 2BE7D 3NNAA 1RJJA 1TKZB 4M5DA 3CMES 3OFFA 2H3EB 1VQ5S 4FBTA 3SMZA 3N6MA 1Y9OA 2R7UA 2HZAA 3BDPA 1SI9A 2BJ1A 3PXGa 4EGLA 1X4BA 1FFGB 1OMSA 3SQOP 1RWXB 2ASJA 4ZCKA 3RB0A 1NJYA 3DRPB 1UETA 1HBUA 2CJAA 3MR5A 5D15A 1OIAA 3ELHA 4DQPA 2HLUA 3FRYA 5H9EJ 2XY7A 1FD2A 2FHMA 3KJVA 1FRLA 1WDDA 3HKZD 3SDEB 3VGTA 2IMWP 1S4FA 2X1AA 3L09A 2EFQA 5HLFB 2MB0B 4ZIWA 1RKJA 4CLPA 1CC8A 3KDNA 3M6VA 1FX4A 3DN9A 1T3OA 4RW7B 5KT6A 3PKYA 4LQ9A 5CCMA 3M05A 2U2FA 2H1YA 1M5VC 4A46A 2EFOA 2OO4A 3AOBA 3TX8A 4A8QA 3AT1B 4QIWD 4J9KA 2F7VA 5L9NA 1U1NA 2GJFA 2DNRA 3B82A 2XS7A 1NJZA 1K44A 3LGNA 2ZZMA 2ZOMA 5AJ3F 1U49A 1QSLA 3PRVA 2UVWA 1RISA 4OYZA 1T03A 2E66A 1X60A 1QUPA 2V8PA 4ELTA 3PCOB 4KHPF 1HNWJ 5DG7A 2M0GB 2N7CA 3OXGA 5KT5A 4Z7YA 1Y11A 1ZAXA 2MSSA 5D3GA 2OPRA 3MM8A 1RADB 1IVZA 5KTQA 2DCUB 4DUYF 2UUCJ 1CJKB 5MLCV 4KGMA 2OKQA 3FEZA 3X1LB 3K5OA 1ZS6A 2WOMA 3MEDB 1QAYA 1T94A 1U1RA 4TY9A 3VQTA 2CPHA 2HRYA 3Q0AA 1D9FA 4NL5A 3P45B 1RTHA 1A6LA 1ZAWA 4M1KA 5IC6B 1TELA 2HIYA 4F4XA 5B0BA 3TVKA 1G7CB 2IC3A 3PHTA 2RUGA 2JFKA 2VG6A 4NASA 3OV7A 4NZ0A 2ZJQQ 1D8YA 3AD9C 3O6QA 4YR3A 5CYMB 2B8QA 1KR4A 4FXVA 5J2MB 2U1AA 1XMBA 2V68A 3IXQA 2C42A 3CC2S 1RWOB 3QATA 5CCLA 5K8MA 4PWDB 1GMWD 2E5LF 3DDNA 1RTJA 1REVB 1RA6A 5E2QA 2WTFA 4LF6J 2GJIA 5DDPC 4DL2A 3W5XA 5KFTA 5KFOA 2DB1A 1YTYA 3Q8QB 3MUTP 4DQSA 1U8WA 1A7GE 2D7SA 4DR5F 3MCNA 2JLEA 1Y0HA 3I56S 4ZVFA 5G0RA 3TA0A 2GO9A 1YDLA 4HTJA 3VAMA 1K9MT 2WBRA 4DV2F 4F50A 2CJBA 2CQ1A 5D6GA 1ELOA 3ET6B 4DG1A 4YY3F 4JUZA 1HQEB 2Y3YA 1HQUA 2Z2MA 3PNIA 4Y34A 1VQYA 1OJ4A 5E41A 3CSKA 3LWLA 4A8SA 4M8LA 2DGVA 4ZHRB 3D68A 1C1CB 3LW5C 2CADA 1VRUB 1NHVA 2OMLA 2BXJA 4JV2A 2GHPA 2QV6A 4RO0A 1FESA 1C4AA 1X4FA 2XMAA 1O6XA 2K2PA 4YN3B 1IBMF 3C66A 1GQEA 3QAUA 3JQJA 4ILMA 5KFZA 5E0OA 4V19J 4N47A 1LW2A 1N33J 2R7QA 3QT8A 1VK3A 5F8NA 2WW4A 5D4OA 1VIXA 2ZH1A 2LYVA 1WACA 3FKBA 1FDBA 2OUGA 5A6PA 2UXCJ 4URGA 3VGUA 3NGTA 4XK8C 4JI4F 2VC1A 1RT5A 3QWUA 5HSPA 2KJVA 5KFXA 4OYBA 4CLYA 2I5JB 3GV8B 3OR1B 2F4VJ 5HN0A 1IKXA 2NPIA 2XBPA 1JKHA 2J0WA 3KLVA 1DZ5A 4WIQA 1LWFA 3K5PA 5HBMB 5A76A 4TY8A 4DFJA 4KKOB 1S1VA 1N5YA 3HJVA 1S6PA 2B9XA 3T5KA 1KQKA 4HT7A 3ZC4A 1FJCA 4XIUA 3Q2SC 3OVBA 5KFMA 2Q6CA 4Y28C 5J2QA 2V9WA 1FXDA 1ZETA 1SJFA 4P72A 2QL5B 1I3OB 2NZCA 1PSDA 3TZZA 2JEFA 3EPGA 4UQGA 4CTAA 2OMOA 4CH7A 2JJ4D 3G2XA 4B9MA 5IV4A 1TL7B 4TQRA 2FVRA 2HMIB 4PZVA 2DXFA 1UKUA 2OPSA 3HJFA 2DGUA 3I82A 4NLVA 2V2ZA 1WG5A 3CF5Q 3MTJA 3V81A 1IBCB 1S9GA 3TUPA 1OWXA 1M5OC 1HL6A 5HQLA 5HMYA 3QPIA 1IKYA 4DR3F 4RW8A 3UDLA 3M8WA 1T9WA 4NYPA 4FVMA 2FC9A 1PYTA 1SL2A 2XC9A 3NNCA 2ASYA 5BR8J 2H4YB 1I6JA 3AH6A 1DARA 2VKRA 3PW4A 4MYTA 2I38A 3KLHB 1VQ9S 2DHHA 3ZTRA 3GJRB 4DSEA 3KK3B 2MLXA 2BVZA 4OMFG 2YY3A 4ZPTR 4DV0J 3SSRA 1FVQA 2VQEF 2N3LA 3Q22A 3RJMB 3HFKA 3ISZA 4LSZB 2M9KA 2OSQA 3KG1A 2BA9A 3ISND 3GB0A 1X5SA 1Q7YT 4PCQA 4LQ3A 1GH8A 2K7JA 1KC8T 2ROGA 3AHPA 3W8PA 5HL7Q 2NUHA 1QVFR 1HBNB 2DXEA 2DITA 2ZNZA 1XERA 1F2GA 3KHRA 3T5LA 6FDRA 2PFDA 3V2UC 3JYTA 3ETMA 2NXUA 4GO5X 3D28A 4X4NA 2CPXA 2Y9HA 2HHWA 1G4CA 4YHHF 1SUQA 3G82B 2BZ2A 1JB0C 2UZAA 2GAGC 3DXBA 4DCOB 5EN1A 1YJVA 3NS5A 3I5BA 2DNMA 2SXLA 5HMWA 3FMBA 5GADU 4JI0F 1X4DA 2AEFA 2Y8WA 2AJQA 3HSZA 4B3TF 1JLBA 4CYUB 1HR0F 2X1FA 5CABA 1TU0B 4F04B 3L3CA 4LF9J 4F4YA 2VV5A 1GXTA 4IFVA 5F8GA 5HVGA 3ZTOA 5KFSA 2FB0A 4WFAQ 4NMLA 4O4GB 1XNRF 3RB3A 1VC5A 1N5QA 2GMJA 2DGXA 2D3OR 2OI2A 4ES2A 3D66A 2Z8QA 3QZ8A 1RAJA 3P96A 3JAMU 1F6TA 4KGKA 3PTWA 5C25B 2ROPA 3CJ2A 3ENAA 1FRIA 1WC0A 2RT3A 1P9QC 4R8UA 3CJRA 4JV0A 1XC9A 3I0RA 2LXFA 1YJUA 2AZ3A 4USWA 5C42A 1Q0NA 3IMQJ 4C8KA 4ECWA 2LLZA 2HQCA 3MM5B 1VQOS 4L75A 2IJRA 3QRPA 3LH2S 4LFCJ 5A8WA 5FLXY 3US5A 3QSYB 1FCAA 4EZ9A 2MKHA 2GMHA 1LKZA 3OBIA 1RT1B 4YMEA 3HHDA 4RW4A 3HULA 2ZM6J 1LFPA 5A8KA 1TL1B 3U7JA 1R89A 4CO3A 4O4RA 4D3GA 2KVIA 3A8JA 1FFWB 3OVAA 4J9PA 3QLHB 3MR3A 3BO4A 1YZ7A 2JZ5A 3A8KA 1PCAA 2DNZA 2PSZA 5DQIA 3SQGB 4DUZJ 3Q8UA 3I9V9 2HNZA 2J8AA 2ZHOA 2ZITA 4UOHA 1RZMA 1S6QB 3CNQP 4ECSA 2HFNA 3K7RA 3BJYA 4OX7A 4ZCMA 2XY6A 4FPRA 2YNGA 3H7HB 2XNRA 4DQQA 1UVIA 3BGRB 3RBEA 1EHWA 3KMQA 1N5SA 3GPAA 2ZBRA 2BQ3A 3R6GB 1RLCL 1IM6A 1F9HA 4GVBA 2RVJA 3KLGB 1RSCA 2FVCA 4DF8A 4ECYA 3S1TA 4PG5A 1VMBA 1F5AA 2BMBA 1DBDA 3GG1A 2IHR1 2B43A 3EM1A 2KYXA 2AGOA 1XBWA 1H6KX 2CQ0A 5CYQA 4Q8FA 4NCGB 1N4LA 1TKTA 1Q7LB 2CDQA 1YJRA 4CWBA 1M5KC 1RHRB 4MAKA 4AD6A 2DR9A 2MQNA 1S1UA 1SC4B 5L1LA 2D3ZA 2BJ9A 4BLGA 4J9SA 2BOAA 2JSXA 2K7KA 3JTOA 3ZZOA 3PZPA 3MURP 4N76A 2AEMA 1NJIT 1RBAA 1AYEA 5E3CA 2MLYA 2J9CA 1UA1A 2WONA 1I94F 2D74B 4PWUA 2YBVA 1P8GA 2F8EX 2G2OA 4LRDA 1OQ3A 1S57A 3I6PA 2BM1A 4MFBA 5GAHI 1URNA 4NEYA 2VPXB 1YJWS 4R0EA 2H9ZA 3C6TB 3GV7B 1Q1KA 1YK9A 4YOEA 2KYZA 3OL9A 4X4QA 1PO6A 5JMNA 5KFAA 3MMBB 3PW2A 4RW6A 2GHVC 1J5OA 1E6YA 4WK3A 1UJ4A 1FDAA 1UWBB 4KYZA 3V6DB 1TKZA 5KFBA 2GVZB 3FGVA 3PJXA 2HS0A 2Q6BA 4RZRA 5KFFA 3JSMB 4DX8H 2UVRA 2MKYA 5A2QU 4FYVB 2C2MB 2GQ2A 1KQFB 4R5PA 4CLTA 4P9SA 4AT1B 1WOOA 2HZCA 2HHSA 1KVJA 2C3YA 1ZM9A 5ETOA 3RRGA 1HA1A 3GYNA 1WI6A 4ZDNA 3J7AN 2A10A 4LREA 1VRQC 3GQCA 5KFPA 3SDEA 4USHA 2UVUA 4X65J 1KTQA 3KG0A 3OTCA 4OYWA 2RAQA 3FFIB 5HQ8A 4RPFA 2JX2A 3PACA 3HHKA 4ZJLA 2V50A 2QIFA 2LECA 2DTJA 4NI2B 4DV4F 4CP5A 2CNOB 2Z0GA 3CJKB 5DQGA 2RNEA 2CZ4A 1WHYA 1JLCA 3MFIA 1HNWF 4OZ0A 4RBUA 1WHVA 1D1UA 2RHSB 3K5LA 3PIPQ 2A18A 1H7XA 3HVWA 1TL3B 4DI6A 4QYZK 4F25A 3NBPB 1UVJA 4NPOA 1WI8A 1WOPA 1SH2A 2RQMA 2CQHA 1YI2S 2O1PA 2A6OA 4NA3A 2OEJA 3G8SA 2YWHA 2IVMA 2YWEA 4QYRA 2VFUA 4E0DA 1XK8A 1CJKA 2DNPA 4IDKB 1UWAA 3BN4A 3LGHA 4HHUA 1S76D 3SSSA 3MEDA 4DPOA 2OFGX 3GIMA 2H65B 1OO0B 1VLOA 2L9NA 1AW0A 3JTPA 3M1VA 1S1XB 1AT1B 2HHPA 2UV8A 4GC7A 1M1KT 2OSRA 4I56A 1BMQB 4M94A 2EFNA 1ZZNA 1R8AA 5CYMA 4DV1J 3CIMA 3T1YF 2NZ4A 2GC8A 5J2MA 3DLLQ 2J9DE 4RNHA 2E9ZA 4MYUA 2LA6A 3C19A 3TANA 3HXMA 3SEOA 1VQMS 4PWDA 2KZZA 2LQBA 3WDOA 3EXCX 2DHGA 5EWEA 3R7NB 1REVA 1JNZB 2AT1B 3DOLB 4I2QB 4I68A 4ZITA 4IH6A 3HPOA 4CO4A 1NK7A 3IR5B 1Q5VA 4EUVA 1UA0A 1YLXA 4DPXA 4ZVRB 1WTFA 1WC6A 3EPIA 2RDIA 2BJEA 3LANA 5AT1B 2BM0A 3ET6A 4XDCA 4CCHA 2DO0A 2H54B 5KT7A 5IXUA 1HQEA 5I3UA 2B5JB 2VIHA 2Z2ZA 3TUJC 1VC6A 4LF4F 2AU0A 1PAUB 1IR0A 3OTDA 5T14A 2I9SA 3OJUA 1YBUA 4ZHRA 2VHGA 4C7QA 5L1KA 1N0VC 4KPYA 1VRUA 2DHAA 4Y0FA 1NB2A 2KJWA 2Y0SD 3K17A 2HQDA 2O66A 3NGKA 5SZTA 2UXCF 3KOAA 1VISA 1UVLA 3IC1A 3VF0B 3EZUA 3N4WA 3BB5A 1PC5A 2YQ0A 1CBKA 4ZKAA 4ZP9A 1WC5A 5DG9A 3CCZA 2DNQA 3ISNC 2YWGA 4KB7A 4DU8A 4F3OA 3GZ7A 5HROB 1RA7A 2AX0A 2LKZA 2D1CA 3LALA 5L1JA 3A12A 1CLFA 3FJ2A 1B99A 1N36F 1FK9B 1NZ8A 4AUKA 5D0EA 3GV5B 3KLIB 2I5JA 2XMTA 3R3TA 3OR1A 2P9GA 2DGOA 4ICLB 4QBUA 2B7BB 3GWCA 1TMJA 4DR2F 4C11B 3JSRA 4K4XA 5D0GA 4C3KA 1QTNB 1KONA 3W2VB 5D78A 5J2PA 1XMQJ 2WW8A 1T9TA 1C0UA 1S97A 3DOMB 4YDDB 3CCMS 2HWIA 1YBTA 4YB7A 3KJQB 3IM8A 2XSFA 1UFWA 2AEJA 2DD8S 3HHLB 2VQFF 2WZ1A 5ETLA 1ZOTA 2WB1D 3J7Z5 3TAQA 3MZIA 3RU0A 3FBCA 1XMOJ 3JQMA 2CYYA 2NPFA 3O44A 5HJXA 4ZJOA 3R7SB 1HHTP 3R97A 1KOHA 1M1HA 1VS3A 3TARA 2ZH7A 3D0HE 2RU3A 3IGVA 1G3OA 3M2UB 1V6HA 1TL7A 2NSBA 4IO9Q 4KQZA 5DM6Q 2HMIA 4ALZA 2C2OB 2ADBA 2WVCA 2IBOA 1HLWA 4DL0C 2EC2A 2ILYA 3BYRA 4NMXA 2QMUB 4QIEA 4EBCA 3IFEA 2CG8A 3R5GA 3VAFA 3G8QA 2MYFA 4X4VA 1FDDA 2DNOA 5DS7A 4HVZA 3ZXWA 1V5IB 3HF5A 2C28A 2PT0A 2HAIA 1YZ6A 4DJBA 2EG2A 2XY5A 4UOGA 2CG4A 3K89A 4ZLJA 1R27B 3ZTSA 4UT4A 3MEGA 2NCKL 4KFBB 3KLHA 2I2YA 3HKWA 4ETXA 3D1QA 4QZVB 2B9WA 4FYXB 1YQHA 1NM2A 4DX7A 1BLUA 1RACB 5DZ6A 5M2PA 4K5RA 4QR0A 4ECUA 4ILRA 5CQGA 4OX9J 1U0SA 2XTJP 2CXEA 4A47A 4YP3A 3G71S 1TV6B 1EP4B 1RWPB 1X5OA 2XYGB 4PAAA 4EYIB 4USVA 3OFGA 4OX6A 1RP5A 2ZVSA 2WK4A 4DS4A 2ZH9A 1S9EA 4LSNA 3DFEA 2QLXA 1EQMA 3CWJA 2WCXA 4NLWA 4A4JA 3TUZC 4K8RA 1MU2B 2RDJA 2BJ3A 2QN6B 4ZP6A 2A1BA 2W2NP 2K1RB 3H42A 2J0XA 1RWMB 4I4BA 2DO4A 1PILA 5J1PA 1NK8A 3G82A 1Z4UA 1NAQA 1ZA2B 2IA0A 1S0MA 4UOFA 3EJMA 4MK8A 2DEJA 3D7SB 4O44B 3QGHA 1FJ7A 1RAGB 5A6WA 4DPYA 1H72C 2F8MA 3BSAA 1U24A 3I9ZA 4U6PA 2LQ5A 3FBFA 2UXBF 1F3VA 3FSXA 4CYUA 2Q66A 3UW1A 2ERRA 1WKJA 2FHJD 2MZSA 1JX4A 4PQAA 2QL9B 3MM7B 1P1LA 2EC0A 4KHRA 3TA1A 1WC4A 4CT9A 2OPPB 4N5SA 4O4GA 3QWPA 2CZVC 1J27A 3K5NA 1NK0A 4DR1F 3M2VB 1UFKA 1HBOA 1HI1A 4LMZA 3Q24A 2YX7A 3KXDA 1Q78A 2ZBIA 5KG4A 3J81U 4BS2A 5C25A 3OL6A 2ZEJA 4A8FA 4LFCF 1H2UX 3Q8VA 1QSSA 2RF2B 4NEZA 3CJ3A 5DG8A 3QMQA 3DKDA 1NDKA 5AE2A 1JLEB 3G6YA 4ECXA 3BKTA 1NKEA 1R8CA 3RYLA 3K2YA 3PJWA 2VUGA 1VQLS 3R6LB 1QAJA 1C1BA 2MQQA 3IRWP 4HHJA 2GIQA 3BSOA 4FYDA 4ZVHA 1NK9A 1K1QA 3TVYA 1GMVA 3T1HJ 4FVCA 2KG1A 3MFHA 1RT1A 5DJBA 3RBXA 1AA1B 1XNQJ 4E8UA 1RYRA 1TL1A 2EG1A 3JSBA 2RQCA 4A8KA 1VYAA 1RBLA 1YRTA 4P2MA 3CJ4A 3QLHA 1LW0B 4DX5A 1MWYA 4ID5B 2EPIA 3UVJB 4DSLA 3ZZYA 5DGBA 4ZP7A 8RUCA 1U2FA 1FDNA 1S6QA 3MD1A 1UJ6A 3UQSA 4W98A 3D1HA 3WC0A 5K8OA 3LP0B 1QE1A 1UEVA 2C2DA 1X31C 3MAAB 5IM0A 3KLFA 4PPDA 3OFHA 2JHEA 3TW0A 1J5EJ 3TJ9A 2NLWA 3KLGA 1LWCB 4WYLA 1TL4A 2VA3A 5EUHA 2KL8A 3PVXA 3S01A 4DV3F 3W66A 5CA5A 4RUAA 2VJUA 3A8IA 3ZTQA 5DDQC 1U25A 1WKKA 3E51A 3I96A 5IT9U 2KFYA 2BKPA 3C14B 3ILLA 4K0KF 3WBZA 5M2RA 2DH9A 4CRJA 3IWNC 4CI0B 3DLEB 2A2CA 3MCMA 1T95A 1RE1B 3IR7B 3IBWA 4DR6J 3R27A 4PRFA 2QLJB 2Z4PA 3C6TA 3GFZA 2DEIA 1BUXA 2PMWA 1HWLA 4O3OA 4ES1A 4LRBA 5GAGI 3MMBA 2VA2A 2OPQB 2ACMA 3NS6A 1IQZA 1UWBA 3V6DA 4KTQA 2N4DA 1H73A 1RCOB 3ZFVA 3M9MB 2CNNB 2GVZA 1S12A 3FZ2A 2J7UA 4OLOA 4I6AA 4JV5J 5D3GB 2YNIA 4ED5A 3PW5A 4JI8J 1IWAA 1FO1A 3IA0A 2VFTA 2VFRA 3CJTA 4MTPA 1D9DA 4LR7A 2CQPA 3TOQA 3MOJB 3RAQA 3NAIA 3K8VA 2LQ9A 3JAMY 1TAQA 1VQSA 1RABB 4UF4A 2XMKA 2YH1A 2JDJA 4GVLA 4FYWB 1LWEB 2COLA 2UVVA 3R5JB 3TUIC 3CE8A 3TEHB 3FFIA 1FKPB 2VG5A 2WHOA 3M8SA 1U45A 1UVNA 2M7SA 3SYZA 4ZN1A 4Y00A 2VG6B 4G3IA 4NI2A 3N5BA 1N5TA 4MIBA 1NK5A 3H5YA 3CC7S 4HDHA 3CJKA 4JYAF 4K7QA 5JVHQ 2HK3A 4CO5A 4PXDA 3EUNA 3BSNA 4RNNA 3N6LA 1OPIA 2WSCC 4PWWA 3CCES 4RW9B 2ZC4A 3ICLA 1TL3A 3D6HB 4ANEA 4ZN3A 3HT3A 3NBPA 4KT0C 1FWKA 4WYWA 4ECTA 1X5TA 3LAKA 3R2DJ 3CJSA 4Y3CA 2FGOA 3O3LA 3NGRA 4IDKA 1WF1A 2ZH6A 2R2SA 1QLNA 1LQ9A 1TFWA 3O8WA 1W25A 4J9RA 4ZP8A 1ZBTA 4QWCA 2H51B 2CUYA 4RLEA 4ZVPB 2MJUA 4ED1A 3SBMA 3UFCX 1HNIB 1S1XA 3MPYA 2NXJA 4QWDA 3H98A 4CLUA 3KJNB 5D4PA 2D9PA 2NYIA 3I32A 2DY1A 2XS2A 2AIRB 1VI7A 3CEDA 2BRKA 3B78A 2MKJA 2FZCB 5HMZA 1U09A 2B56A 1WKLA 1DJ0A 3GSIA 4LSLB 4WWSA 2O01C 2PI5A 4IUFA 3QAEA 2KO1A 2FY8A 1OYEA 3POTA 4RU9A 1WSRA 4N8OA 4DUTA 1RHMB 2FJBB 2XEXA 4LFAJ 5F8IA 2MHEA 4YB6A 3MI7X 4NCAA 5L46A 4I2QA 4CM2A 1SC1B 3RW6A 4LF7J 3PYEA 2AGPA 1S1WB 5F41A 4ZIVA 4C8YA 1JKHB 4TNOA 1LWFB 3UNGC 1S0NA 1WJ9A 2XS5A 1VCTA 3IAS9 2L9WA 4OLPA 4TY8B 2B8PA 2CFXA 2XMUA 2MY8A 1ZA1B 1MROB 2OEMA 1DHMA 3OTEA 1N5YB 1U4BA 5J2NB 7FDRA 2B5JA 2N4CA 2R3VA 4O0NA 3BH6B 3BO2A 2ZZNA 1N32F 2Z2YB 1WC1A 1CJTB 2W4PA 4P2FA 2UUTA 2ZJPQ 5C24A 5A2QY 4M5KA 4HR2A 4GKKJ 4FKYA 3AJDA 3Q23A 3A8EA 4I7FA 1IBLJ 1Q8BA 1AB8A 1N52B 3PY8A 4LUBA 1Y3JA 2V4JB 3SIPB 4GKJJ 4O3PA 3DOKB 4CM0A 2PGCA 4B9NA 3H5SA 2DGWA 3M6UA 4W92B 5AXLA 5F0UA 1HNXF 2OPSB 3MHYA 4OI0A 1KBRA 5F0WA 3CT9A 2CJ9A 4JI2J 2VBXA 2F40A 4LVNP 3KLIA 4PQUA 3L7OA 2AP6A 4ICLA 4USJC 1KOOA 1ROFA 1B0VA 5AXNA 4LBPA 4C11A 4ENOA 4UW2A 3HX9A 2BR0A 1LV5A 3W2VA 3CDEA 3C46A 5F8MA 1X9MA 4UOCA 2YKNB 3EGVA 1MG7A 3DOMA 3DGVA 2XZTB 3QYYA 4NYZA 3QJLA 4WBFA 1D9AA 4PKDB 4K5SA 4DPWA 2OIHA 3HHLA 1WHWA 2FLPA 2EW9A 1RWKB 2ATCB 3M30B 3MMCB 3W2WB 1WSVA 2MQMA 1U7LA 5CZXA 2GMLA 2VBWA 2JNJA 2DXDA 3OW2R 3TZYA 2UUAF 4DV6J 3J7YI 1Y7PA 5EX3A 2BQUA 3MM6A 1RT3B 4OHYA 3VAHA 3WQPA 5IV3A 3QFWA 3HI9A 4LF5J 5DDOC 2IDLA 2YQ3A 3EZOA 1RWUA 2HS3A 1G1XA 4ZK7M 3C16B 2LU1A 2M70A 4JI3F 1T9VA 4OZLA 4RNOA 1K0VA 4X64J 2MZ1A 3R7BB 5HANA 3CCLS 2AJ2A 2GVDA 3LTOA 2EWHA 3W8GA 2LCWA 4C2MA 4YS2A 3BR8A 3IAM9 5G4DA 1UTAA 5EGYA 1RGVA 1GAOA 4CLSA 3IRXA 1R31A 4HYKA 1UPPA 2QEXS 1UVMA 2XMVA 4KFBA 2UUBJ 2IRXA 2HFOA 2NS1B 4A8XA 1JLBB 4L6V3 4J9QA 4GC6A 4DDFA 4K4TA 2JH3A 1L3SA 2XI2A 2POKA 3EGWB 1PJ6A 1DFDA 4CNZA 5KFYA 2Y1RI 5LT5A 2VG7B 2WSEC 3ZZUA 2HVHA 1TV6A 2KRRA 1XWLA 1EP4A 3OLBA 3T6BA 1ZM2A 1PBAA 3D67A 2W25A 3UDCA 1PG5B 2DH8A 2CPDA 4X62F 1QAXA 4FF3A 1Q4RA 4OI6A 1L3TA 5I3QA 3W5YA 1B0PA 1NZAA 5K14A 2K1RA 3V6KA 4C48A 3W63A 3TO8A 3A3OB 3TQ1A 3LP1B 5FDLB 3HHLC 2UU9J 2CQCA 2W8LA 4Y2AA 1P1TA 3CCQS 1NJXA 1KQGB 4DV7F 1HHSA 4O44A 4Q7AA 3I31A 1WOSA 5A8WB 1K73T 1U1MA 2BJDA 1EB0A 3RR7A 2J6SA 4UY8T 1FT8A 1Q86T 1HNZJ 4RW4B 4A8OA 2VODA 2HQFA 3P8BB 4JI7J 2HW3A 3SI8A 3RB6A 1W2IA 2ZH4A 3MUVP 1RTZA 3FZBA 2JEJA 2V69A 5T41A 2BYCA 3MM7A 2DNLA 4FZVA 4NZ7A 1VQPS 1JNRB 4K4WA 5DO2A 5ADZA 3K58A 3UO0A 2LQJA 1QSYA 5KT4A 1VBXA 4KGZB 3I0SA 4MT1A 3DDKA 3U1MA 4K50A 4GMKA 2OH2A 1NH8A 3UI3A 1R8BA 4NYOA 5GAEU 4F3MA 4MK9A 5HP1A 4Q2MA 5D8HB 1L3UA 2RKIB 4I67A 3QSIA 4B9TA 1B4SA 3DC2A 3BYPA 4B3MF 2HIQA 3U02A 1JLEA 3AFGA 2YPZA 3MECB 5B0AA 3BGOP 1JXVA 3HZEA 3OT9A 1RDRA 4I0WA 5KG1A 1LNQA 2DT9A 4IR1A 5U47A 2V4RA 2FJXA 2KHCA 4NLTA 4QIVA 2C2KB 3AD8C 4WPAA 4H4KA 1LW0A 2GAHC 3GILA 4ID5A 2BE9B 2CWXA 2KVQE 1EIYB 3HP6A 3V4IB 2WB4A 4MKBA 3W65A 3UVJA 2R2UA 2F3JA 3O1LA 2DR8A 1LXNA 4P74A 3UN5A 4J37A 3V6JA 3GR0A 2WAQD 4DR4J 2ZWPA 3EDRB 5LL6d 2IM0A 1NUEA 1RLDA 3PYGA 5KAKA 1H2VZ 5AXKA 2M52A 4B3RJ 4HI1A 1TK5A 1S0OA 3LP0A 3ZTPA 4OYPA 2Y1JA 4U7CA 2HSEB 3MAAA 3G4SS 1YJ9S 1ZTTA 1TKDA 2NXNA 4S0MA 2XLKA 4U67Q 4RW6B 1NPKA 4RUCA 1J5OB 1UPMB 2B9EA 3M9NB 5ETPA 1LWCA 1YJNS 1OSDA 3PX0A 5K9FA 4Q2LA 1WF2A 4IG3B 2KZMA 3M6WA 4I2PA 2HFVA 5KOWA 5IQQA 1QVGR 3TX0A 4KJIA 3G86A 1YG0A 5LJ5Y 3H2UB 1YJ7A 4P2XA 4R5PB 1KDNA 3LO3A 4X66F 3R9LA 2OTLS 2J8SA 1HFEL 2FJEB 4WU2A 5LOQA 3C14A 4DR6F 4UUXA 2GW8A 4LF8J 1UL3A 3IGNA 2XCAA 1N34J 3D1OA 1JK9B 4B9LA 3NCPA 4KRWA 4DLGA 2CQBA 3LGMA 5KOXA 2MKSA 4Z37A 5H9FK 3OXFA 3MPUB 4F67A 5CD4H 3ILOA 1P9YA 3DLEA 3H2VE 2VB6A 4L74A 4ED0A 2YXLA 3T1AA 4DHVA 3PW7A 4K4VA 2IFXA 1KQSR 3IG1B 1BGXT 3HSDA 1JLCB 4IFYA 1GT8A 1JLQB 3K8WA 4DSIA 2KN4A 1SJ3P 5HO4A 2OPQA 1JMTA 5DQHA 2ZH5A 1ULRA 4ED8A 4JI8F 2FLLA 2UXDJ 2J7WA 3Q2TC 2Z57B 1H2TZ 2RH3A 2J0SD 2W9AA 3HVTA 1R3NA 3BSCA 4J9VA 1RU1A 5AE3A 3GIIA 1OS5A 4H4KC 3FCVA 2QLFB 3Q8RB 2E7XA 2XG8A 2E1CA 4IG0B 1NKCA 2F4FA 1D8ZA 1Q95G 2RIJA 4L73A 2ASDA 1NKBA 2HS4A 1YRXA 3G6VA 2RS2A 4RWWA 2FVSA 1NJWA 1U1QA 2HGNA 1Q82T 4JI6F 4H4OB 3NRBA 3J81Y 3OSPA 4YUDA 1RHQB 1LWEA 3H5XA 4TQSA 1RTIA 4EEYA 4NXNF 2HHXA 3M1VB 4GRSA 2E9TA 1C2PA 2XI3A 1FKPA 3QT5A 4F3QA 4IOAQ 4ECVA 2C3UA 4H54A 3C3LA 1TAUA 1RB0A 3F0NA 2P6TA 3M8QB 1HMVB 2DRAA 1TR0A 1L5UA 3PEHA 4TU9A 1H3DA 4WIIA 3LAMA 2ATLA 1HI0P 1VIOA 1ZTWA 3ULHA 2PA3A 3AAWB 4FXWA 5KFWA 5KFDA 2AJ4A 4FS2A 4RW9A 1TKXA 2IRYA 1AFIA 4ANDA 4DXLA 1HBMA 1TZ0A 1HKAA 5F3ZA 3QJPA 4WXWA 2XCPA 2KT3A 1ICEB 1EJ7L 1EKRA 3NGDA 2LA4A 4ZPBA 2K06A 2ZFHA 3UCUP 3CCUS 4CNYA 3DGPB 1KKHA 4W90B 3B8HA 3KFWX 5LSOA 5GMDA 3FK4A 3RAMA 4X4RA 4G1IA 2IJFA 3Q8SB 2KM8C 4DZ6A 4UZBA 3LUYA 4HKQA 1YVFA 1N54B 2YKMA 3I4HX 2NQPA 4C0OC 5AJ3J 3ZNUA 3HLUA 1FTRA 2ABYA 1WORA 4Y2MA 2V34A 3SV4A 3EVWA 2ZE2B 1HNIA 4KHPJ 2IM1A 5I3UB 2J9DA 2BUNA 3RG6A 2XLIA 3W61A 4DUYJ 2F9DA 1JXEA 2QSFA 1UZDA 5GAGU 1KWMA 2HQ3A 3L9ZA 4LR9A 1KEKA 2W9BB 1SV5B 4LRFA 2VPYB 4B3SF 4WXOA 4LSLA 3AOCA 3VVTA 4N8NA 3MR7A 5IT9Y 1YGYA 5F9LA 2E1MC 4ITSA 4L3KA 2B4UA 4RNFA 1FWPA 4U7UK 2YNFB 2DHSA 3PX4A 2DR7A 1NSQA 4OYAA 1RTDB 1U6ZA 4OZ3A 2XWXA 2YPYA 5KFIA 1AZSB 2CKWA 1RUSA 1EZZB 2Y1LB 2W8KA 2KB2A 1T02A 3DCAA 5T7LB 1S1WA 3A4TA 3HFZB 1U1OA 3FCHA 3G8TA 2IBKA 2L9DA 3NCQA 2XSJB 3BKFA 4IRCA 4FPIA 2E5LJ 4TN2A 3D0IE 3KUEA 5J2PB 3UD3P 1C0UB 3N5FA 1MROA 2GHWA 3SCIE 2XMWA 1QUVA 5J2NA 3R1HA 2V2VA 2KKHA 2DNHA 2V2QA 2YWKA 2ZDPA 1CJTA 4AQYF 2J9EA 1RT7B 1BY9A 3D4JA 3G6ES 3D3CJ 3AQPA 4DR5J 2DY9A 3AJ2A 2MKCA 2GZOA 4C3LA 1OY6A 5BYRA 3GIRA 3R5CA 3UN2A 2R7RA 1LFWA 4DR7F 4YY3J 4KO0B 2V4JA 2KFNA 3DOKA 3W5ZA 5RUBA 2KHDA 3BGUA 2AQ4A 2FJWA 2J0QD 2M8HA 2YWWA 2X1BA 1F0XA 1JLAB 4F4KA 2HNDA 2O5DA 4ZLLA 2FTRA 5KG2A 2ZZTA 4OI1A 2VOPA 3KK2B 1OQ6A 2G1DA 5KFGA 1VJWA 2YNHA 4B3OB 1VHIA 1IBMJ 1X7VA 2YQ1A 1DTQA 4FF2A 1JIHA 2LDIA 2YKNA 1HWIA 4E2FB 1S48A 3F44A 5DGAA 3AQOA 1DQ8A 4DV6F 3MEGB 2HHHF 4JI4J 2ILZA 2DIVA 2OELA 3TAMB 1IM4A 4NRTA 3M30A 3MMCA 5B09A 1SC6A 5KT3A 1N56A 4PXCA 2VBYA 2ZHAA 3W2WA 5CXTA 3HDSA 1F1BB 1U2CA 4JI1F 1R43A 1Y00A 3FSYA 3PYFA 3H0PA 3GIJA 4KGXB 5GADI 3Q8PB 3WIVA 2MQLA 1E6VB 2CJQA 1NK6A 2EVZA 1RT3A 3FBEA 2DIUA 4KGVB 1JJCB 2GQCA 3UE2A 3FVYA 3BR9A 3QFHA 3N01A 1RWWB 1S9EB 5K8PA 2PI4A 4LSNB 2GS8A 4JBCA 4EO8A 3BH7B 3C16A 1KSPA 2ZOFA 1IBKF 1PYOB 2X7IA 4QYZJ 1RHKB 2W01A 4KHMA 2AYEA 2IM2A 5EWGA 3Q89A 1U02A 5LMNF 2Q43A 5BYQA 2HVEA 1QTMA 4DN0A 2XULA 5KFLA 3HSGA 3OUYA 2J6TA 4ZMMA 2H5EA 3NEKA 1X8DA 2JEIA 1DTTA 2CQGA 1KFDA 2CJYB 1XR5A 4ER8A 4DL4A 5KFCA 3N28A 3CJQA 1EETB 1Y3KA 3GSDA 4JI5F 4LJMA 4NLGA 1H38A 3FEYB 4WFXA 3GE9A 3FQLA 1HD1A 4V1Ak 4DR3J 3PEJA 1SXLA 4HACB 1YRUA 2VG7A 1TUGB 1YHQS 4C97A 4A8MP 2MHNA 1FJGF 4O23A 3CD0A 4F0KA 4B9VA 1Y5NB 5I42A 4WZQA 1NCLA 5I4MA 5L1IA 5E3AA 1TUVA 2UU9F 3GLJA 1HBOB 1Z1ZA 1DRZA 1X4GA 1VBZA 4DV5F 3AODA 2B3TB 2JVRA 1L3KA 3PFEA 1GXUA 2QGFB 1T0TV 4X4SA 5IZHA 5LMUF 4P7VA 1W7WA 3OHAA 2X3GA 2VQEJ 4ECZA 2CVIA 3CJ5A 3LP1A 5FDLA 4OZNA 3ZNJ1 2B7CB 1C1BB 4IOCQ 1ITPA 4LFBF 4C4WA 3QT6A 1HD0A 4I6WA 2CJKA 4NA1A 3DLGA 1CC7A 3M2RB 1UW9A 2QA1A 3O5TB 3OR2B 2HRTA 3WIUA 1S79A 2BACA 2FPHX 2WRMA 2EI5A 3MGJA 2AKWB 1SQEA 2IMOA 3SXLA 2CAJA 1S6OA 3C15B 1DAXA 3MMJA 1T11A 4J91A 4KE5A 1GMWA 4IKAA 1M5SA 1KN6A 3UCGA 4ZS6A 1S59A 3CO0P 4LF1A 4A8WA 4YHHJ 2KDOA 1R0BG 3BKUA 1BQNB 1FRXA 2H5JB 2Y0BB 1WEYA 4UY85 2VF3A 1CSJA 4X4TA 4JI0J 1FRMA 1V9OA 2G1HA 1EAYC 1NSKL 4B3TJ 1Q81T 2ZHBA 3H25A 5IFMA 1B7FA 4ZA1A 1QE1B 4NXMF 1HR0J 1B7YB 2QE5A 1TP7A 1KS2A 5IM0B 5C7PA 3KLFB 3HM9A 4TU8A 3BGFA 3DRSB 2D69A 2RSQA 4B9UA 2RKIA 2CQIA 1GK8A 1R0AB 3W9IA 4DBQA 1NK4A 2FYXA 2C22A 2G0IA 3JSYA 5KFUA 3ETOA 1U6FA 3MECA 2V8GA 2MDAA 3CB4A 1NSAA 1V3ZA 4ID8A 4KPCA 4FP9A 2B6AA 1T05A 2HFUA 1VQ6S 4F0MA 2BOPA 3CJ0A 4CLKA 2XWYA 4K59A 2W9CB 3CDWA 5KFQA 2CQDA 3MM9B 3DHXA 3TA2A 2RDDA 1RAHB 1GMUA 3OLAA 3BREA 2Z2LA 1KHWA 2BANA 3V4IA 4Q0BB 3VZHA 3WX8A 2BX6A 4CLLA 2RJZA 1XTZA 4F02A 2R7XA 4F0HA 1VDHA 2QO3A 3VHQA 1DQ9A 2LFVA 3CDUA 3DLKA 1MWQA 2IYIA 4DN9A 5KFNA 1HNVB 2BE2A 4CT8A 4I64A 3QIPA 4P2SA 3E2EA 4ZLNA 3SFUA 4WP9A 2B0GA 3FC9A 3QO9A 1Y5LB 4USMA 1WEXA 4IG3A 2P2CB 1NPPA 2HVIA 3TJ8A 3ENVA 3GJTB 1EX8A 4LF8F 1X4CA 5F8LA 2V2KA 4WK1A 4HHHA 3W64A 1NMEB 1B3TA 4MKAA 2QA4G 2EFGA 4LRCA 3PR4A 2LEBA 1LEOA 1QM9A 2MXYA 4KV8A 2YNIB 1M1GA 3OL8A 3DXSX 2XO6A 4ELUA 2OP5A 2HBRB 3NL0A 1A9NB 2Y1IA 4AL6A 5KFEA 1TVRB 5AE1A 3MXHP 3CD5A 2B4VA 2M88A 1KRPA 4IH7A 3ZZTA 3W1YC 1WF0A 3ITHA 5LXYA 4QR2A 3E3XA 3DMJA 1APSA 5B0GA 4EU0A 2KTQA 2VG5B 1EKSA 2UXDF 4C8NA 5L8RC 3LOUA 4RR5A 3NGSA 3CW2C 1Y5IB 4OZ5A 2GFFA 3IG1A 1R6YA 1UZHA 1F5BA 2CDRB 4JB8B 1JLQA 1X0FA 3NOCA 2A0FB 1N8RT 3BPDA 2X51A 1UJ5A 2UUCF 3THTA 4URQU 2QLWA 3M4XA 1I94J 2HQIA 4WFBQ 2JL9A 1S6UA 3I55S 3NNHA 1VRTB 3DRYA 2OHDA 1ZM4A 1IKWB 2H48B 3H59A 4IG0A 2EKYA 5IT0A 2NR0A 1SJRA 2BEFA 2D41A 2BBEA 1T9YA 4ZVTB 1WD6A 3MAHA 3C6UB 4H4OA 3DRRA 4J9LA 4EBDA 3EVMA 2HBYB 3THPA 4B17A 4XPEA 1XR6A 2ZNYA 1FXRA 3R2CJ 3DM2A 3GCWP 2FHOB 3W60A 1T9XA 1S9FA 3M8QA 1HMVA 2OFHX 2XYPB 3UR0A 2LXIA 1OSCA 4LF6F 1S77D 4OZ2A 2DRDA 1KD1T 2V63A 4DL6A 3UPFA 1VK8A 3AJ1A 2FVQA 3POTB 1TL5A 2DGTA 4DCPB 4P73A 4ZPAA 2DYAA 3CCVS 3KHLA 1FTCA 4DV4J 3H5UA 3KNAA 1YX2A 5HVHA 2G0CA 5KFJA 3DGPA 3TRGA
chains in the Genus database with same CATH topology
4LSZB 3D6FB 2XZTB 2FQQB 4ZVTB 1RHRB 1SC3B 1PYOB 1RHUB 3R7NB 1RHKB 1SC4B 2CNNB 1F9EB 3R7SB 2CJXB 1RWKB 2HBYB 3P45B 3D6HB 5IC6B 2QL9B 1RHJB 5K20B 2H5IB 1RWNB 1IBCB 4ZVSB 1RHMB 5IC4B 1RWPB 2XYGB 2DKOB 2XYHB 3SIPB 4ZVRB 3D6MB 2H65B 4ZVUB 4DCJB 2CDRB 1RWVB 3IBFB 4JB8B 2CJYB 2HBZB 2C2OB 1SC1B 2C1EB 2QLBB 2XYPB 2C2KB 2XZDB 1QDUB 2QLFB 3R6GB 2CNOB 4DCOB 1ICEB 3KJFB 2P2CB 1I51B 1BMQB 2H4YB 2H54B 3GJTB 1QTNB 3R5JB 1RWOB 1RE1B 3P4UB 2HBQB 1NMEB 1RWMB 3GJQB 2CNLB 3GJRB 3NS7B 2H51B 2QLJB 4ZVPB 4DCPB 1PAUB 2QL5B 3KJQB 1I3OB 3QNWB 1GFWB 2Y1LB 1RWXB 3GJSB 2C2ZB 3R7BB 3EDRB 2H48B 3KJNB 3R6LB 2QL7B 1RHQB 2H5JB 1RWWB 2HBRB 4ZVOB 2Y0BB 2CNKB 3IBCB 4ZVQB 2H4WB 2C2MB 3RJMB 3EDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSZ B;  3D6F B;  2XZT B;  2FQQ B;  4ZVT B;  1RHR B;  1SC3 B;  1PYO B;  1RHU B;  3R7N B;  1RHK B;  1SC4 B;  2CNN B;  1F9E B;  3R7S B;  2CJX B;  1RWK B;  2HBY B;  3P45 B;  3D6H B;  5IC6 B;  2QL9 B;  1RHJ B;  5K20 B;  2H5I B;  1RWN B;  1IBC B;  4ZVS B;  1RHM B;  5IC4 B;  1RWP B;  2XYG B;  2DKO B;  2XYH B;  3SIP B;  4ZVR B;  3D6M B;  2H65 B;  4ZVU B;  4DCJ B;  2CDR B;  1RWV B;  3IBF B;  4JB8 B;  2CJY B;  2HBZ B;  2C2O B;  1SC1 B;  2C1E B;  2QLB B;  2XYP B;  2C2K B;  2XZD B;  1QDU B;  2QLF B;  3R6G B;  2CNO B;  4DCO B;  1ICE B;  3KJF B;  2P2C B;  1I51 B;  1BMQ B;  2H4Y B;  2H54 B;  3GJT B;  1QTN B;  3R5J B;  1RWO B;  1RE1 B;  3P4U B;  2HBQ B;  1NME B;  1RWM B;  3GJQ B;  2CNL B;  3GJR B;  3NS7 B;  2H51 B;  2QLJ B;  4ZVP B;  4DCP B;  1PAU B;  2QL5 B;  3KJQ B;  1I3O B;  3QNW B;  1GFW B;  2Y1L B;  1RWX B;  3GJS B;  2C2Z B;  3R7B B;  3EDR B;  2H48 B;  3KJN B;  3R6L B;  2QL7 B;  1RHQ B;  2H5J B;  1RWW B;  2HBR B;  4ZVO B;  2Y0B B;  2CNK B;  3IBC B;  4ZVQ B;  2H4W B;  2C2M B;  3RJM B;  3EDQ B; 
#chains in the Genus database with same CATH topology
 1IUJ A;  2F9J A;  3BO3 A;  2F1F A;  2E7V A;  4P75 A;  1VBY A;  1FE4 A;  2P6S A;  3E8O A;  1ZPW X;  5CAA A;  1JLG A;  3OD2 A;  1IWG A;  2VC0 A;  1RQ0 A;  5HI7 A;  4ERD A;  3DRX A;  3P5B P;  2PEB A;  2VDH A;  2FJD B;  4MKY A;  1RAF B;  4TXS A;  5LJ3 Y;  2ZE2 A;  2V94 A;  2KT5 A;  2RS8 A;  1HWK A;  4ZVU B;  3BQ0 A;  4WKY A;  5LSL A;  1U26 A;  2XZD B;  2W4D A;  5C24 B;  2Q3P A;  1N33 F;  1WNE A;  2AMC B;  2V8V A;  3M32 A;  4G1P A;  2V5H G;  1TMM A;  2W9B A;  1SV5 A;  3WC2 A;  1YKW A;  1T7P A;  3K59 A;  1REG X;  3U27 A;  4I7F B;  5THW A;  1FNO A;  1MMD A;  4EBE A;  2MGZ A;  3MF5 A;  2LMI A;  5CZV A;  4RU2 A;  2F4V F;  4FS1 A;  2DIS A;  1KLM B;  2YNF A;  1T9U A;  1VQ4 S;  3CIZ A;  2OLW A;  1RTD A;  2RRB A;  4Q44 A;  1NXI A;  1AZS A;  3FRZ A;  4PG6 A;  3CDB A;  2YWF A;  1PIE A;  2N7Y A;  5F8H A;  2W7A A;  2G13 A;  3T1Y J;  1ZAV A;  2E44 A;  5T7L A;  5K5M A;  1ACM B;  4PQU B;  1RHJ B;  4ETZ A;  2XSJ A;  4M5L A;  1Z2L A;  4WZM A;  1RT4 A;  2IYG A;  2GO8 A;  5B0D A;  1S99 A;  2XYH B;  1FF2 A;  1KTV A;  1XQI A;  1KHV A;  1UMJ A;  2BQR A;  4OX8 A;  4RUB A;  1T3N A;  4ZCI A;  1HI8 A;  5E7O B;  5HQM A;  2VH7 A;  5A0Y B;  2G2Z A;  2APO A;  1ZYQ A;  2XHC A;  3NWR A;  1R8P A;  2GCF A;  2PA8 D;  3J7A 1;  4QR1 A;  2M4M A;  2EFV A;  2WBM A;  4NLS A;  3VAG A;  4HTI A;  1RT7 A;  2JRS A;  3CO9 A;  1X9S A;  3B6B A;  2ZKT A;  1FRK A;  2G4B A;  1X4H A;  3KLE B;  5EDW A;  3MPD A;  3IN5 A;  3B54 A;  4F7V A;  1B64 A;  4CO2 A;  4QWE A;  1IKV A;  2JC1 A;  3MM6 B;  2NXE A;  4KO0 A;  1PC4 A;  2R7W A;  2XZW A;  4WU3 A;  3KDO A;  1NHU A;  2VZ9 A;  1FRJ A;  1UW4 A;  3F41 A;  2XHW A;  4MK7 A;  1BWV A;  3D9B A;  2XLJ A;  3HHE A;  4LF4 J;  3JB9 k;  2VON A;  2J6U A;  1F9E B;  5KFR A;  1JLA A;  3QGG A;  2WSF C;  1DY3 A;  1NU4 A;  2CQ4 A;  2GV1 A;  2ZDO A;  3HD1 A;  1VQ7 S;  5BR8 F;  3KK2 A;  1U1K A;  1I1G A;  2C3P A;  3RBD A;  4FF4 A;  4B3O A;  4NLX A;  4OI3 A;  4QPX A;  4WFZ A;  3A3N B;  2GVD B;  1F3F A;  3MEE B;  1NB7 A;  1VQK S;  1SL1 A;  3J7Z T;  4TLR A;  4DV0 F;  3IS9 B;  4YEA A;  1C0T B;  3G6X A;  3IRX B;  3W3S A;  3IWX A;  3DHW C;  1RBO B;  1N36 J;  1KVI A;  4TVA B;  2KXN B;  3BZQ A;  3TAM A;  4ZVG A;  3QNW B;  4OFZ A;  3HVR A;  1WG1 A;  4OHZ A;  3HFV A;  2MZJ A;  3UR3 C;  9ATC B;  4DR2 J;  4DQI A;  4EFA C;  4DPT A;  2UV8 G;  2RML A;  2YKA A;  1E6V A;  1S49 A;  4BC9 A;  2FQQ B;  4PEO A;  4CDI A;  3GON A;  1Q5Y A;  2JFD A;  2ZWO A;  3EGZ A;  1UFL A;  2VQF J;  4FNH A;  2N3O A;  4OJ3 A;  5K14 B;  4NLP A;  2R7T A;  5IC4 B;  2IAJ B;  3L7P A;  3NXZ A;  2B9Y A;  1FNX H;  3BQ2 A;  1H7W A;  2IVF B;  3ZZ0 A;  2AYG A;  4WE1 B;  4ECR A;  4XAK A;  5K8N A;  4ZPV R;  2HQG A;  1FE0 A;  2W2Q P;  4C0H A;  5ETT A;  2RIL A;  1EQ0 A;  4LF9 F;  4WKR A;  2AV5 A;  2JVO A;  3KKF A;  4DMZ A;  2JOQ A;  1SQF A;  2R7S A;  2AWZ A;  3P5T L;  2HWH A;  3RW7 A;  2DHX A;  4P10 A;  3VTI A;  1JJH A;  5E3R A;  5H9E K;  1EET A;  2R2R A;  2RRN A;  1DLO B;  3RB4 A;  4ZJQ A;  2KI2 A;  1YJT A;  4EYH B;  2H4W B;  1HW8 A;  3QT7 A;  1NND A;  4G1Q B;  2C2E A;  1FKA F;  2D9O A;  4OYM A;  1GEH A;  2K3I A;  4HAC A;  3H2L A;  1Q8L A;  2V0N A;  1GTE A;  1MN9 A;  2BW2 A;  3AA9 A;  3I0S B;  5DET A;  2QA4 S;  5E3Q A;  4OJ1 A;  2HNY A;  4MKV A;  4DZD A;  3RAX A;  1FX2 A;  2QFJ A;  1PBU A;  4ZVE A;  1OYD A;  5HP1 B;  3MMA B;  4WFN Q;  4F2S A;  3M8Z A;  3G96 A;  1VJQ A;  2QLB B;  2QX0 A;  1YIJ S;  5CYJ A;  2VPZ B;  2ZM6 F;  2MY7 A;  4W4M A;  5CH7 B;  3PW0 A;  4M5H A;  4AXJ A;  3UWT A;  1C4C A;  1LXJ A;  2CNL B;  2Z56 B;  1FEH A;  3GYG A;  2AGQ A;  3M2R A;  3PX6 A;  3OR2 A;  4UQT A;  1RT2 A;  1ZPV A;  4DX6 A;  3UNY A;  2XO7 A;  4KC5 A;  2CQ3 A;  3CXC R;  4DUZ F;  1FVS A;  4ZVQ B;  1JLF A;  2ADC A;  3C15 A;  2MKI A;  3D6F B;  3JTN A;  4M95 A;  3R1L A;  3QRR A;  2QSW A;  4Q45 A;  1WWH A;  4UZC A;  7AT1 B;  6AT1 B;  1BQN A;  1TUW A;  3RGI A;  4L72 B;  4RJV A;  2V9K A;  2A2D A;  5IT4 A;  4OJG A;  4PXB A;  4EK2 A;  3CD6 S;  2PFF B;  3HZG A;  2UXB J;  2ACY A;  2WVE A;  3CD7 A;  1G2E A;  3CMA S;  1T8E A;  1WEZ A;  2E1A A;  5FII A;  2P9E A;  4RBT A;  4ED6 A;  4M5M A;  3DRS A;  4A8Y A;  5C2C A;  5AXM A;  1R0A A;  1Y4Z B;  1KNZ A;  1CQN A;  4RKU C;  2DNG A;  1PAE X;  2YH0 A;  2JWN A;  4R25 A;  4QJV A;  4I2P B;  1SJ1 A;  4HLB A;  2X1G A;  1XR7 A;  4I69 A;  1XIQ A;  3J80 U;  4DR1 J;  1H0H B;  4KBI A;  2N82 B;  5C5J A;  3CCS S;  6FD1 A;  2CPF A;  3CDA A;  2FY1 A;  2P5V A;  1LOU A;  3MEK A;  4TU7 A;  4H4M A;  2W9C A;  3BDE A;  4D3H A;  4KY3 A;  3T6J A;  2LEP A;  3SCJ E;  3EX7 B;  3MM9 A;  4PYD A;  1RXO B;  2RHQ B;  3NWG A;  1HHQ A;  1RWN B;  4RX6 A;  4Q0B A;  2HYI B;  2DGS A;  1W2B R;  2MZR A;  2KM8 B;  3T41 A;  3D5M A;  4U9R A;  2EXU A;  4BHQ A;  2I8E A;  5SUH A;  3OSN A;  2MPU A;  4WP3 A;  2Z30 B;  1DQA A;  3KHG A;  4KR0 B;  3MDF A;  4IFY B;  2HHT A;  3R5A A;  3W9H A;  4KH0 B;  2KU7 A;  2PN6 A;  1FNM A;  3GFH A;  1HNV A;  1R0C B;  3CCT A;  2R8J A;  2P8I A;  4QPT A;  1V3R A;  3KUG A;  3CUL A;  4U7U D;  1GFW B;  1IN0 A;  4TYA A;  1N6Q A;  1U2R A;  3OTB A;  1MMN A;  3OJS A;  3N0V A;  3CGI A;  3QQC D;  3HVT B;  3M8Y A;  4K4S A;  5ETM A;  1RK8 A;  3PFO A;  1IR2 A;  1SH0 A;  1D0E A;  4NX9 A;  2I1R A;  1PJ5 A;  1N0U A;  4X65 F;  2R42 A;  1K8A T;  4Y6I A;  5LSR A;  2VBZ A;  3FSI A;  2WVB A;  2BRL A;  4AYB D;  1TVR A;  1X4A A;  2B4P A;  2E29 A;  4ED2 A;  2QMW A;  2ZVI A;  2DKO B;  2VU5 A;  2HPU A;  1RTI B;  2RRA A;  5A8R B;  4DV3 J;  4F8R A;  4ES3 A;  2FVP A;  3OL7 A;  4RNM A;  3UDV A;  2ZD1 B;  2AJF E;  4N41 A;  2L08 A;  3NCR A;  4K0K J;  1HPZ B;  3NS7 B;  2R7V A;  1CS4 B;  5D0H A;  1WG4 A;  4G65 A;  2NYH A;  4JV1 A;  4WFY A;  2KG0 A;  1S1T B;  4NWB A;  4C0B A;  3TZW A;  3RBZ A;  3IBC B;  1TKX B;  2OTJ S;  4DEZ A;  4K4U A;  1CEZ A;  1HBM B;  3PRB A;  4QIF A;  5KG6 A;  3NAH A;  3HO1 A;  3ADA C;  1JJ4 A;  4AXI A;  1VRT A;  4JP8 A;  1H98 A;  2FZG B;  5H1S V;  3CTR A;  1X5P A;  1IKW A;  2AHO B;  4P52 A;  1NLK L;  1Y10 A;  2VL1 A;  2G2Y A;  3WX4 A;  3SCL E;  3TI0 A;  1YWX A;  3MAQ A;  3DLB A;  5L9X A;  2YKM B;  5CD4 A;  1X0P A;  3C6U A;  3DI6 B;  4DV1 F;  3MPW A;  3C2P A;  3UDE A;  3DRP A;  3QRQ A;  2C1E B;  2DH7 A;  5GAH U;  1HAR A;  3FUY A;  3EE3 A;  3WHI A;  3OTO J;  5IQ6 A;  3QZ7 A;  2C3M A;  2HRU A;  4WJB A;  4IRK A;  2FHK A;  2PMH A;  4ELV A;  3EXY A;  2ZBC A;  5HLF A;  4NLD A;  2MQO A;  4K2X A;  3GJS B;  2EKN A;  4RW7 A;  4CQ1 A;  2C2Z B;  4Z2X A;  4WCE Q;  4Y2K A;  3HSJ A;  2HGM A;  1GXL A;  3MCO A;  2V8H A;  4C6A A;  4Q5V A;  2F65 A;  2HG4 A;  2FC8 A;  3HHN B;  1P6T A;  3JQK A;  1NDP A;  1EAR A;  4OJH A;  2QYG A;  1FA0 A;  1VGY A;  5F9N A;  3AA8 A;  2AYB A;  1Z2Z A;  2FHJ A;  4JYA J;  2W4C A;  1CJV B;  4PPZ A;  1FKO B;  2DK2 A;  4BBY A;  4N56 A;  2G0J A;  2CPE A;  5ETQ A;  3H4D A;  4J7C A;  2Q1L A;  2RU9 A;  4DS5 A;  2KT2 A;  2C2R A;  2P9C A;  3MTK A;  4M5I A;  3TQE A;  3NMR A;  5C2G A;  2W2P P;  3CVK A;  1NH7 A;  4R0J A;  4HH0 A;  2E7W A;  4MIW A;  1BWE A;  3LP2 B;  3BQ1 A;  3THV A;  3T19 A;  2BDP A;  1U0H B;  2IY5 B;  1U48 A;  5HVF A;  3NMA A;  2LDY A;  3E01 B;  1BQM B;  1MML A;  1AFJ A;  1S7I A;  2HHQ A;  4C8L A;  4ED7 A;  3T9Z A;  2QT7 A;  2EEY A;  4NOH A;  3BBC A;  2LU2 A;  1GX5 A;  1SIW B;  1KLM A;  3S7R A;  2HHU A;  2W7P A;  1S4E A;  2HVD A;  2BKN A;  3QGI A;  1UAW A;  2HND B;  1XMQ F;  3GFX A;  3GU0 A;  4ED3 A;  1YSJ A;  1RWV B;  4C9D A;  2PDA A;  1CJU B;  2VJV A;  4RL1 A;  3UN3 A;  2YNH B;  4CO1 A;  2J76 E;  1U47 A;  4HL9 A;  2ZH8 A;  2O67 A;  1B70 B;  4NA2 A;  1DTQ B;  3R5D A;  2V6A A;  4OQJ A;  4USK A;  1QY7 A;  1RT6 B;  1XMO F;  1F2H A;  4WF9 Q;  3FBB A;  2ZH3 A;  3RTV A;  4IO1 A;  1U1L A;  1OY9 A;  4DOZ A;  3BV8 A;  2HAF A;  5A0Y A;  4PYA A;  2DRB A;  3GP9 A;  3VAI A;  3UCZ P;  1QAI A;  2FD2 A;  1RI7 A;  1WHX A;  2DVI A;  1NDC A;  5H9F J;  4Z7C A;  3KLE A;  3NGU A;  3BN7 A;  1BXN A;  1Q53 A;  2LVW A;  8AT1 B;  2BV3 A;  3BBB A;  5KG3 A;  2ZBP A;  1C1C A;  5KG0 A;  5KFH A;  5BYS A;  4TYB A;  2IJN A;  4ZCL A;  3N79 A;  2XGQ A;  4J9N A;  4M5G A;  3MR6 A;  4DFP A;  3P6Y C;  1SPB P;  4NLY A;  1FER A;  3OHB A;  3BGL A;  3CCW A;  5E33 A;  4FYY B;  2YX1 A;  1K1S A;  4YR0 A;  4BDP A;  3W62 A;  4OYI A;  4OZ1 A;  4L76 A;  1N32 J;  5DLF A;  1PKU A;  1R6V A;  4DLE A;  4QW9 A;  4PAB A;  2VDI A;  1D3W A;  3V6H A;  2V67 A;  2HFS A;  2FUG 9;  2M5Y A;  2BW7 A;  3VZI A;  3F56 A;  3GMG A;  2QMX A;  2HEK A;  3CPW R;  2NSC A;  3P4U B;  5J1N A;  3MEE A;  4YQW A;  5HK4 A;  1WC3 A;  4P71 A;  4PUO B;  1ZM3 A;  5IWA J;  3OUY B;  2VKZ G;  1F5C A;  3G87 A;  5B0F A;  1DTT B;  3IS9 A;  3PM9 A;  5HBM A;  1C0T A;  4OX9 F;  4C8Z A;  1HNX J;  4ZLP A;  1M90 T;  3AXM A;  4KKO A;  1MLA A;  4O3N A;  5ITH A;  5EWF A;  4X4U A;  1IXK A;  3HMJ G;  3SSQ A;  3S6E A;  5ETK A;  2R8H A;  3TR5 A;  4UST A;  5D0R A;  4Y2C A;  1M5P C;  4NLQ A;  5GVQ A;  5B0C A;  5EHH A;  5IS2 A;  4ZVS B;  1LWX A;  4OI2 A;  3HT0 A;  4LT6 A;  5E5N A;  4MJK A;  5I42 B;  2PC6 A;  4LBI A;  3T5J A;  3VGS A;  4J9O A;  3D6M B;  2RD5 C;  4ZPD A;  1HYS B;  4F4A A;  2KRB A;  4ATN A;  5EX0 A;  2HBZ B;  1FXL A;  3A13 A;  1M5H A;  2CZ9 A;  5FD1 A;  1PYS B;  3PO5 A;  4USI A;  5J1E B;  3OQ2 A;  3N9U C;  2BKO A;  4XTT A;  2IAJ A;  2JLF A;  2W2M P;  1O8B A;  4MMO A;  4K4Z A;  2YKP A;  2XMJ A;  2UUA J;  5ETS A;  3D3B J;  4WE1 A;  1YBA A;  3L95 X;  4J90 A;  1I5O B;  1XJW B;  2AZ1 A;  4P7T A;  2RB7 A;  2XMM A;  3TAP A;  5GAE I;  4ZVO B;  1SKW A;  2GQQ A;  3DLG B;  4L3N A;  1IR1 A;  2E1R A;  4X4O A;  4O3Q A;  1QD1 A;  4M5J A;  4Y2I A;  4JI3 J;  4I6Y A;  3R5B A;  1DLO A;  2R8K A;  4NLU A;  5K20 B;  2M3D A;  4RUH A;  1FFS B;  1UCN A;  4LIR A;  1X9W A;  4G1Q A;  2IRU A;  3KK3 A;  2PO4 A;  4FBU A;  2QA2 A;  4CZC A;  3VAK A;  4UUW A;  4DSK A;  3IBF B;  5ETN A;  3TNV A;  3U1L A;  2R4F A;  3KNG A;  1JWW A;  1M0S A;  5F8J A;  1I51 B;  3PRD A;  4O3S A;  3H4B A;  2UUW A;  1XN9 A;  2DNY A;  1GTH A;  1VFJ A;  3TYT A;  2K8G A;  3K57 A;  3K0J A;  3Q86 A;  5JJB A;  3MMA A;  3T1H F;  2CPJ A;  4FF1 A;  3D54 A;  1HBN A;  1Q79 A;  1FI4 A;  4OL8 A;  1TFY A;  5JVG Q;  1XNQ F;  5HMX A;  3HK2 A;  2NRE A;  2C3O A;  3OXL A;  3NLC A;  5D4L A;  3GFY A;  3FCW A;  3DU5 A;  2AJ0 A;  2M2B A;  3B4M A;  3MPV A;  2B6A B;  1T05 B;  2PD1 A;  4MH8 A;  3LPE A;  3M6X A;  4X62 J;  4FKX A;  3FMW A;  3LWM A;  3HD2 A;  4PG4 A;  3BEG B;  2JEG A;  4OYO A;  1TK8 A;  4QW8 A;  3U1N A;  3TJA A;  5B0E A;  2HGL A;  3AXK A;  3FDS A;  2HFZ A;  4Y65 A;  2BAN B;  3DYA B;  1HW9 A;  4DV7 J;  3BM7 A;  1U1P A;  3ZZR A;  1U6B A;  1J5E F;  3TEG A;  3ZZZ A;  2GJ2 A;  4XO0 A;  3ILI A;  3UD5 A;  2HBQ B;  3CMQ A;  1TQL A;  2FJA B;  2FZK B;  3LA0 A;  3DLK B;  4PG8 A;  1HIY A;  2MKK A;  5DRK A;  4DF4 A;  5JUM A;  1PJ7 A;  2EK1 A;  3KK1 B;  2BE2 B;  1O5J A;  2CNK B;  4YB5 A;  1CQM A;  2A3J A;  3QIP B;  2JLG A;  2BJ8 A;  4U8V A;  3PV8 A;  1AUD A;  2ZUA A;  4DL7 A;  3QO9 B;  4I1T A;  1XEZ A;  1RHU B;  1RAI B;  4J9M A;  3S8S A;  3VV2 B;  3T5H A;  3SFG A;  2W2O P;  3DDI A;  4JOU A;  1NO8 A;  3MM5 A;  4KV8 B;  5D77 A;  1FJE B;  3BBF A;  3VQS A;  4LF2 A;  3SV3 A;  3W9J A;  4YDX A;  5JXS A;  4NZ6 A;  3EZ5 A;  2RQK A;  2DR5 A;  4B3M J;  2MST A;  4OYX A;  1NEE A;  3M9O B;  3ITH B;  3DMJ B;  4N77 A;  4C3M A;  1WEL A;  2YKO A;  3R8Y A;  2HWT A;  5ETR A;  4BWM A;  4IRD A;  4C98 A;  3SQG A;  3FNN A;  1FRH A;  3M8P B;  2FLO A;  3SCK E;  3EVO A;  3KUH A;  2OGU A;  4PG7 A;  2QL7 B;  2V4Q A;  2MQ8 A;  1CUL B;  2B51 A;  2OJ3 A;  4JV5 F;  3BGR A;  2GIF A;  4AFF A;  2MTL A;  3KMS A;  3PO4 A;  4USU A;  4ANC A;  1FHT A;  2GGP B;  3HHL D;  3IM9 A;  2KH9 A;  1F9F A;  2NUU G;  4P6Q A;  3LF0 A;  3PDN A;  3Q8Y A;  2DGQ A;  2I6W A;  1NPR A;  3TP2 A;  1RAO A;  4M5D B;  5F3T A;  2MZT A;  4DWI A;  3UD4 P;  2KFZ A;  1S72 S;  4QQB A;  4IQM A;  4NCG A;  5L38 A;  5FJ4 A;  4FNI A;  3EMT A;  3DRR B;  3LQV A;  1RAE B;  1HBU B;  1UEK A;  3KYL A;  2B4O A;  2ZBQ A;  5A8R A;  1BD6 A;  1URR A;  4HH1 A;  3DNC A;  3CCJ S;  1SL0 A;  3KJV B;  2XNQ A;  3OPK A;  2PMZ D;  4X66 J;  3KTQ A;  3DM2 B;  1IQT A;  3RUB L;  2ZD1 A;  2IVY A;  3IP0 A;  4IH5 A;  1CVJ A;  5CHC B;  3OFE A;  1HPZ A;  3RRH A;  4BC7 A;  1CS4 A;  5DZ7 A;  4EO6 A;  4B08 A;  2CJX B;  1S1T A;  1WUU A;  2OEK A;  3C8Y A;  3PR5 B;  1WTB A;  4OHW A;  4ZOS A;  4F2R A;  1T03 B;  5B08 A;  1SVD A;  3JSM A;  2BAB A;  3BPS P;  4DFM A;  1RKI A;  4NLR A;  4C8M A;  3OTO F;  1QDU B;  1ZH5 A;  2OPR B;  3MM8 B;  1JLG B;  4KH1 B;  4EMD A;  2X3D A;  4E98 A;  3DI6 A;  3AD7 C;  5ETV A;  4CLZ A;  3RR8 A;  2WOM B;  2VD3 A;  4YB1 P;  4HEA 9;  4AE5 A;  4CLW A;  3B4D A;  3CC4 S;  3P49 B;  1RTH B;  4YFU A;  1N88 A;  2CPY A;  1HQ2 A;  3G9C A;  3J80 Y;  2IC3 B;  4LFA F;  2E5G A;  4FN5 A;  1SBR A;  3M32 B;  3O2I A;  2HKE A;  4JI6 J;  2GX8 A;  4GO7 X;  4IYQ A;  2CQ2 A;  4WTY A;  4LF7 F;  3IWL A;  2E1P A;  3A3P B;  1TTH B;  2MGZ B;  3QID A;  2CVE A;  5GME A;  4NXN J;  4ECQ A;  4FDF A;  2QZ8 A;  1NBE B;  4HT5 A;  2XGP A;  1H74 A;  2CRL A;  3MOZ A;  2FIU A;  3HCX A;  4CLF A;  3KWM A;  1RTJ B;  2F63 A;  1CJV A;  1WDT A;  2F8H A;  4IR9 A;  1MN7 A;  1FKO A;  4NLO A;  4WTO B;  2GNK A;  3AY0 A;  3EYZ A;  3N6N A;  2F5G A;  1JJ2 R;  3DU6 A;  1RT4 B;  2AF6 A;  1VC0 A;  3MWB A;  5BJR A;  3VCD A;  4GKK F;  3CJ8 A;  5DDR C;  5G0R B;  4MIA A;  5LM7 E;  1SKS A;  1VLY A;  1IBL F;  3H90 A;  3LP2 A;  2JC0 A;  1JXL A;  4DG1 B;  4WP8 A;  4GKJ F;  1U0H A;  4F36 A;  2MEW A;  1HQU B;  2ZUG A;  3E01 A;  1BQM A;  1JQG A;  1QJH A;  1KLN A;  1OY8 A;  2CIM A;  4XPC A;  3CUN A;  4ED4 A;  4DV2 J;  2IA6 A;  5BXI A;  1IKV B;  4JI2 F;  2VFV A;  2W1B A;  3D2W A;  1AXQ A;  2FLN A;  3GR1 A;  1BQX A;  4OV1 A;  1SIZ A;  2OD4 A;  2NXC A;  2W24 A;  3LPY A;  3VAJ A;  3GYX B;  3KJF B;  1GNK A;  3CCR S;  2AW0 A;  1UEU A;  1MSW D;  3VAL A;  1LW2 B;  1B0T A;  3AOA A;  4QWA A;  3NKY A;  4KAI A;  3DOL A;  1CG2 A;  1FD8 A;  3ENQ A;  4XDD A;  3I5C A;  5LXR A;  4B3S J;  1CJU A;  2HUR A;  1SCJ B;  2Q79 A;  1BC6 A;  2R7O A;  1RT5 B;  1VHF A;  1O0P A;  2EK6 A;  4ZPC A;  2VIC A;  1IKX B;  2ZH2 A;  1K47 A;  1RT6 A;  3IR6 B;  5HJY A;  1SC3 B;  1VOM A;  3X3U A;  2OD6 A;  5KG7 A;  2MQP A;  5DM7 Q;  2K3K A;  4BCA A;  2MZQ A;  7FD1 A;  2ASL A;  1NHK L;  3NG8 A;  1S1V B;  3P3D A;  1S6P B;  5KFK A;  3VGV A;  4LF5 F;  1NSP A;  1V5V A;  2AX1 A;  1HWU A;  1O51 A;  5DLG A;  4DL5 A;  3T3F A;  4CO0 A;  4F4W A;  3ZZP A;  5J2Q B;  2ZKU A;  8ATC B;  2ALY B;  3D6T B;  1D09 B;  3KG4 A;  4X64 F;  4J9U E;  2FGC A;  4U96 A;  4TKT A;  3PG9 A;  4OV6 A;  4DFK A;  5FLX U;  5KT2 A;  3PJ9 A;  4CTA B;  1S7H A;  3MR2 A;  1Q8K A;  2I0X A;  4AQY J;  3TZX A;  5IWA F;  3D0G E;  2LEA A;  3ZO7 A;  2ALZ A;  3DLH A;  1KVK A;  5HAT A;  1MNE A;  1BHN A;  3MCS A;  4CH1 A;  2Z58 B;  3EGN A;  3WZ0 A;  5HRO A;  4NE9 C;  4O3R A;  4DSJ A;  2PEH A;  3JXO A;  4X2B A;  1FK9 A;  2C2N A;  2L3M A;  4DR7 J;  2UUB F;  4DSF A;  3V81 B;  1S9G B;  4QCL A;  3Q83 A;  4PUO A;  1KP6 A;  4LR8 A;  4FXD A;  5MAO A;  1IKY B;  4EZ6 A;  1G6B A;  2IPO B;  2E5I A;  4RW8 B;  2AD9 A;  2RQ4 A;  1RCX B;  2WVD A;  1V3S A;  2V8D A;  1K0T A;  3GCX P;  4KIA A;  4K2J A;  5D4N A;  2HK2 A;  2A6M A;  4ILL A;  4O0I A;  2QG9 B;  2DJW A;  4G6V B;  4K4Y A;  2D3O 1;  2CA9 A;  2MJN A;  2EFP A;  3TVZ A;  1SB6 A;  3GTY X;  4NRU A;  2VOO A;  3VR1 A;  5HAO A;  4DL3 A;  3DLJ A;  1HYS A;  2HHH J;  3L4B C;  5IOL A;  1SJQ A;  2QFI A;  3F73 A;  2HNY B;  5I3P A;  3M7V A;  2VAS A;  3M2U A;  4QU7 A;  3K5M A;  3NOG A;  3EIC A;  2DNK A;  5J1E A;  4JI1 J;  1SH3 A;  2PE8 A;  2DCL A;  4F4Z A;  3NP5 A;  1DUR A;  2ZC3 A;  4OHV A;  3PIO Q;  4CIO A;  1HNZ F;  3JYT B;  3TWZ A;  4JI7 F;  3JS9 A;  2WVF A;  4PR6 A;  4LBH A;  2HZV A;  1FWL A;  4IQX A;  2J5A A;  1VQN S;  3M8R A;  1N48 A;  2QC3 A;  1SUQ B;  4EI2 A;  3I87 A;  2GIR A;  1RT2 B;  2HVZ A;  3FEX B;  2FDN A;  2ROE A;  2DPJ A;  4J5O A;  1VQ8 S;  1IBK J;  2YVS A;  1UP1 A;  1JLF B;  4OIX A;  1Q8I A;  2CPI A;  1KFS A;  3T9N A;  1J2V A;  3MUM P;  3J7Y U;  4HI2 A;  5LMN J;  2HHV A;  1OPZ A;  2DPI A;  3PHE A;  2EBE A;  1S5Z A;  3BF4 A;  4X4P A;  4IFV B;  1TK0 A;  3IO1 A;  1NRK A;  1P27 B;  3H20 A;  1MWZ A;  1NDL A;  2R8G A;  2QTW A;  3RZA A;  2XM3 A;  4B02 A;  4PXE A;  4V19 X;  3SZ2 A;  3MD3 A;  3VWS A;  1SKR A;  5KG5 A;  1PGZ A;  4LRA A;  2RUS A;  4JI5 J;  4QIG A;  2BJ7 A;  2PII A;  3ONQ A;  1BE4 A;  4KSE B;  1MU2 A;  2IDE A;  1UVK A;  4DPU A;  4B9S A;  1XNR J;  4RWX A;  1R7I A;  2LP4 A;  4AL7 A;  1FJG J;  1LK7 A;  2EBG A;  4R8U B;  2M8D B;  2HLT A;  3I0R B;  5C42 B;  3QJJ A;  1SQG A;  1AUS L;  4OZJ A;  1F60 B;  2ZOG A;  3J81 j;  5KFV A;  2UP1 A;  2MMY A;  2R8I A;  4DV5 J;  2QJ3 A;  4F26 A;  4DCJ B;  4DQR A;  3H40 A;  4H4M B;  2FJV A;  3NY0 A;  3QBC A;  4UTG A;  5LMU J;  1YIT S;  4Q8E A;  2XQC A;  4DR4 F;  1VBK A;  2AJ1 A;  1IJF B;  1X4E A;  3EWG A;  3BS9 A;  4U8Y A;  1SJ4 P;  4B3R F;  5A8K B;  2L41 A;  3ENW A;  5E3P A;  3W7B A;  2YKQ A;  2YX4 A;  3GJQ B;  4LFB J;  3GG0 A;  3DYA A;  1L3V A;  4ZPW R;  5GMK a;  4URS A;  5L39 A;  2LQ8 A;  4BWJ A;  2E5H A;  1ARO P;  2OPP A;  4CH0 S;  2VFS A;  1W26 A;  4Q43 A;  2DBB A;  3PYD A;  1FEE A;  1MW7 A;  2HNZ B;  3ILJ A;  2Y8Y A;  2XB2 D;  4M5N A;  4OI4 A;  1IJE B;  2R9L A;  4LVO P;  2QYC A;  1ZZF A;  2VPW B;  3M2V A;  2YNG B;  3A1Y G;  1SKU B;  3QGP A;  2G9O A;  3KK1 A;  2DR6 A;  2J7K A;  2D3U A;  4IOB A;  2OAU A;  2H5I B;  3HVA A;  2DNN A;  3FQK A;  1R8H A;  3OVS A;  1N6Q B;  3PKM A;  2RF2 A;  3I5A A;  4GVB B;  2CWK A;  4AL5 A;  3V5R A;  1N34 F;  1U8S A;  2QRR A;  1GX6 A;  2ZJR Q;  4X84 A;  4NXM J;  4M63 A;  2W7O A;  1CPZ A;  4DU7 A;  5CYQ B;  2RE1 A;  3AB4 B;  4HDG A;  3GIK A;  1TKT B;  2L48 A;  2GA7 A;  2YTC A;  2E5J A;  1RAA B;  2MLZ A;  1S10 A;  3KHH A;  2O3D A;  5M2U A;  2LXU A;  4NCB A;  1S1U B;  3VVU A;  1N5V A;  4EWT A;  4YR2 A;  1RU2 A;  3EDQ B;  3I4P A;  4A48 A;  1Q16 B;  2E9R X;  9RUB A;  4OHX A;  2KXF A;  2WON B;  3M8P A;  3H8Y A;  4TLQ A;  4QU6 A;  3RRK A;  2R2T A;  4MFB B;  1HWJ A;  4LIW A;  2IIH A;  4RBV A;  1CUL A;  4N7T A;  2IM3 A;  1S0V A;  5B7W A;  1A0O B;  3V4M A;  3AB2 B;  2CPZ A;  4U95 A;  4QOT A;  1VR6 A;  3L7U A;  2KXH A;  4QWB A;  2GGP A;  2AYM A;  4C8O A;  1RYS A;  1E6Y B;  1LK5 A;  2BE7 D;  3NNA A;  1RJJ A;  1TKZ B;  4M5D A;  3CME S;  3OFF A;  2H3E B;  1VQ5 S;  4FBT A;  3SMZ A;  3N6M A;  1Y9O A;  2R7U A;  2HZA A;  3BDP A;  1SI9 A;  2BJ1 A;  3PXG a;  4EGL A;  1X4B A;  1FFG B;  1OMS A;  3SQO P;  1RWX B;  2ASJ A;  4ZCK A;  3RB0 A;  1NJY A;  3DRP B;  1UET A;  1HBU A;  2CJA A;  3MR5 A;  5D15 A;  1OIA A;  3ELH A;  4DQP A;  2HLU A;  3FRY A;  5H9E J;  2XY7 A;  1FD2 A;  2FHM A;  3KJV A;  1FRL A;  1WDD A;  3HKZ D;  3SDE B;  3VGT A;  2IMW P;  1S4F A;  2X1A A;  3L09 A;  2EFQ A;  5HLF B;  2MB0 B;  4ZIW A;  1RKJ A;  4CLP A;  1CC8 A;  3KDN A;  3M6V A;  1FX4 A;  3DN9 A;  1T3O A;  4RW7 B;  5KT6 A;  3PKY A;  4LQ9 A;  5CCM A;  3M05 A;  2U2F A;  2H1Y A;  1M5V C;  4A46 A;  2EFO A;  2OO4 A;  3AOB A;  3TX8 A;  4A8Q A;  3AT1 B;  4QIW D;  4J9K A;  2F7V A;  5L9N A;  1U1N A;  2GJF A;  2DNR A;  3B82 A;  2XS7 A;  1NJZ A;  1K44 A;  3LGN A;  2ZZM A;  2ZOM A;  5AJ3 F;  1U49 A;  1QSL A;  3PRV A;  2UVW A;  1RIS A;  4OYZ A;  1T03 A;  2E66 A;  1X60 A;  1QUP A;  2V8P A;  4ELT A;  3PCO B;  4KHP F;  1HNW J;  5DG7 A;  2M0G B;  2N7C A;  3OXG A;  5KT5 A;  4Z7Y A;  1Y11 A;  1ZAX A;  2MSS A;  5D3G A;  2OPR A;  3MM8 A;  1RAD B;  1IVZ A;  5KTQ A;  2DCU B;  4DUY F;  2UUC J;  1CJK B;  5MLC V;  4KGM A;  2OKQ A;  3FEZ A;  3X1L B;  3K5O A;  1ZS6 A;  2WOM A;  3MED B;  1QAY A;  1T94 A;  1U1R A;  4TY9 A;  3VQT A;  2CPH A;  2HRY A;  3Q0A A;  1D9F A;  4NL5 A;  3P45 B;  1RTH A;  1A6L A;  1ZAW A;  4M1K A;  5IC6 B;  1TEL A;  2HIY A;  4F4X A;  5B0B A;  3TVK A;  1G7C B;  2IC3 A;  3PHT A;  2RUG A;  2JFK A;  2VG6 A;  4NAS A;  3OV7 A;  4NZ0 A;  2ZJQ Q;  1D8Y A;  3AD9 C;  3O6Q A;  4YR3 A;  5CYM B;  2B8Q A;  1KR4 A;  4FXV A;  5J2M B;  2U1A A;  1XMB A;  2V68 A;  3IXQ A;  2C42 A;  3CC2 S;  1RWO B;  3QAT A;  5CCL A;  5K8M A;  4PWD B;  1GMW D;  2E5L F;  3DDN A;  1RTJ A;  1REV B;  1RA6 A;  5E2Q A;  2WTF A;  4LF6 J;  2GJI A;  5DDP C;  4DL2 A;  3W5X A;  5KFT A;  5KFO A;  2DB1 A;  1YTY A;  3Q8Q B;  3MUT P;  4DQS A;  1U8W A;  1A7G E;  2D7S A;  4DR5 F;  3MCN A;  2JLE A;  1Y0H A;  3I56 S;  4ZVF A;  5G0R A;  3TA0 A;  2GO9 A;  1YDL A;  4HTJ A;  3VAM A;  1K9M T;  2WBR A;  4DV2 F;  4F50 A;  2CJB A;  2CQ1 A;  5D6G A;  1ELO A;  3ET6 B;  4DG1 A;  4YY3 F;  4JUZ A;  1HQE B;  2Y3Y A;  1HQU A;  2Z2M A;  3PNI A;  4Y34 A;  1VQY A;  1OJ4 A;  5E41 A;  3CSK A;  3LWL A;  4A8S A;  4M8L A;  2DGV A;  4ZHR B;  3D68 A;  1C1C B;  3LW5 C;  2CAD A;  1VRU B;  1NHV A;  2OML A;  2BXJ A;  4JV2 A;  2GHP A;  2QV6 A;  4RO0 A;  1FES A;  1C4A A;  1X4F A;  2XMA A;  1O6X A;  2K2P A;  4YN3 B;  1IBM F;  3C66 A;  1GQE A;  3QAU A;  3JQJ A;  4ILM A;  5KFZ A;  5E0O A;  4V19 J;  4N47 A;  1LW2 A;  1N33 J;  2R7Q A;  3QT8 A;  1VK3 A;  5F8N A;  2WW4 A;  5D4O A;  1VIX A;  2ZH1 A;  2LYV A;  1WAC A;  3FKB A;  1FDB A;  2OUG A;  5A6P A;  2UXC J;  4URG A;  3VGU A;  3NGT A;  4XK8 C;  4JI4 F;  2VC1 A;  1RT5 A;  3QWU A;  5HSP A;  2KJV A;  5KFX A;  4OYB A;  4CLY A;  2I5J B;  3GV8 B;  3OR1 B;  2F4V J;  5HN0 A;  1IKX A;  2NPI A;  2XBP A;  1JKH A;  2J0W A;  3KLV A;  1DZ5 A;  4WIQ A;  1LWF A;  3K5P A;  5HBM B;  5A76 A;  4TY8 A;  4DFJ A;  4KKO B;  1S1V A;  1N5Y A;  3HJV A;  1S6P A;  2B9X A;  3T5K A;  1KQK A;  4HT7 A;  3ZC4 A;  1FJC A;  4XIU A;  3Q2S C;  3OVB A;  5KFM A;  2Q6C A;  4Y28 C;  5J2Q A;  2V9W A;  1FXD A;  1ZET A;  1SJF A;  4P72 A;  2QL5 B;  1I3O B;  2NZC A;  1PSD A;  3TZZ A;  2JEF A;  3EPG A;  4UQG A;  4CTA A;  2OMO A;  4CH7 A;  2JJ4 D;  3G2X A;  4B9M A;  5IV4 A;  1TL7 B;  4TQR A;  2FVR A;  2HMI B;  4PZV A;  2DXF A;  1UKU A;  2OPS A;  3HJF A;  2DGU A;  3I82 A;  4NLV A;  2V2Z A;  1WG5 A;  3CF5 Q;  3MTJ A;  3V81 A;  1IBC B;  1S9G A;  3TUP A;  1OWX A;  1M5O C;  1HL6 A;  5HQL A;  5HMY A;  3QPI A;  1IKY A;  4DR3 F;  4RW8 A;  3UDL A;  3M8W A;  1T9W A;  4NYP A;  4FVM A;  2FC9 A;  1PYT A;  1SL2 A;  2XC9 A;  3NNC A;  2ASY A;  5BR8 J;  2H4Y B;  1I6J A;  3AH6 A;  1DAR A;  2VKR A;  3PW4 A;  4MYT A;  2I38 A;  3KLH B;  1VQ9 S;  2DHH A;  3ZTR A;  3GJR B;  4DSE A;  3KK3 B;  2MLX A;  2BVZ A;  4OMF G;  2YY3 A;  4ZPT R;  4DV0 J;  3SSR A;  1FVQ A;  2VQE F;  2N3L A;  3Q22 A;  3RJM B;  3HFK A;  3ISZ A;  4LSZ B;  2M9K A;  2OSQ A;  3KG1 A;  2BA9 A;  3ISN D;  3GB0 A;  1X5S A;  1Q7Y T;  4PCQ A;  4LQ3 A;  1GH8 A;  2K7J A;  1KC8 T;  2ROG A;  3AHP A;  3W8P A;  5HL7 Q;  2NUH A;  1QVF R;  1HBN B;  2DXE A;  2DIT A;  2ZNZ A;  1XER A;  1F2G A;  3KHR A;  3T5L A;  6FDR A;  2PFD A;  3V2U C;  3JYT A;  3ETM A;  2NXU A;  4GO5 X;  3D28 A;  4X4N A;  2CPX A;  2Y9H A;  2HHW A;  1G4C A;  4YHH F;  1SUQ A;  3G82 B;  2BZ2 A;  1JB0 C;  2UZA A;  2GAG C;  3DXB A;  4DCO B;  5EN1 A;  1YJV A;  3NS5 A;  3I5B A;  2DNM A;  2SXL A;  5HMW A;  3FMB A;  5GAD U;  4JI0 F;  1X4D A;  2AEF A;  2Y8W A;  2AJQ A;  3HSZ A;  4B3T F;  1JLB A;  4CYU B;  1HR0 F;  2X1F A;  5CAB A;  1TU0 B;  4F04 B;  3L3C A;  4LF9 J;  4F4Y A;  2VV5 A;  1GXT A;  4IFV A;  5F8G A;  5HVG A;  3ZTO A;  5KFS A;  2FB0 A;  4WFA Q;  4NML A;  4O4G B;  1XNR F;  3RB3 A;  1VC5 A;  1N5Q A;  2GMJ A;  2DGX A;  2D3O R;  2OI2 A;  4ES2 A;  3D66 A;  2Z8Q A;  3QZ8 A;  1RAJ A;  3P96 A;  3JAM U;  1F6T A;  4KGK A;  3PTW A;  5C25 B;  2ROP A;  3CJ2 A;  3ENA A;  1FRI A;  1WC0 A;  2RT3 A;  1P9Q C;  4R8U A;  3CJR A;  4JV0 A;  1XC9 A;  3I0R A;  2LXF A;  1YJU A;  2AZ3 A;  4USW A;  5C42 A;  1Q0N A;  3IMQ J;  4C8K A;  4ECW A;  2LLZ A;  2HQC A;  3MM5 B;  1VQO S;  4L75 A;  2IJR A;  3QRP A;  3LH2 S;  4LFC J;  5A8W A;  5FLX Y;  3US5 A;  3QSY B;  1FCA A;  4EZ9 A;  2MKH A;  2GMH A;  1LKZ A;  3OBI A;  1RT1 B;  4YME A;  3HHD A;  4RW4 A;  3HUL A;  2ZM6 J;  1LFP A;  5A8K A;  1TL1 B;  3U7J A;  1R89 A;  4CO3 A;  4O4R A;  4D3G A;  2KVI A;  3A8J A;  1FFW B;  3OVA A;  4J9P A;  3QLH B;  3MR3 A;  3BO4 A;  1YZ7 A;  2JZ5 A;  3A8K A;  1PCA A;  2DNZ A;  2PSZ A;  5DQI A;  3SQG B;  4DUZ J;  3Q8U A;  3I9V 9;  2HNZ A;  2J8A A;  2ZHO A;  2ZIT A;  4UOH A;  1RZM A;  1S6Q B;  3CNQ P;  4ECS A;  2HFN A;  3K7R A;  3BJY A;  4OX7 A;  4ZCM A;  2XY6 A;  4FPR A;  2YNG A;  3H7H B;  2XNR A;  4DQQ A;  1UVI A;  3BGR B;  3RBE A;  1EHW A;  3KMQ A;  1N5S A;  3GPA A;  2ZBR A;  2BQ3 A;  3R6G B;  1RLC L;  1IM6 A;  1F9H A;  4GVB A;  2RVJ A;  3KLG B;  1RSC A;  2FVC A;  4DF8 A;  4ECY A;  3S1T A;  4PG5 A;  1VMB A;  1F5A A;  2BMB A;  1DBD A;  3GG1 A;  2IHR 1;  2B43 A;  3EM1 A;  2KYX A;  2AGO A;  1XBW A;  1H6K X;  2CQ0 A;  5CYQ A;  4Q8F A;  4NCG B;  1N4L A;  1TKT A;  1Q7L B;  2CDQ A;  1YJR A;  4CWB A;  1M5K C;  1RHR B;  4MAK A;  4AD6 A;  2DR9 A;  2MQN A;  1S1U A;  1SC4 B;  5L1L A;  2D3Z A;  2BJ9 A;  4BLG A;  4J9S A;  2BOA A;  2JSX A;  2K7K A;  3JTO A;  3ZZO A;  3PZP A;  3MUR P;  4N76 A;  2AEM A;  1NJI T;  1RBA A;  1AYE A;  5E3C A;  2MLY A;  2J9C A;  1UA1 A;  2WON A;  1I94 F;  2D74 B;  4PWU A;  2YBV A;  1P8G A;  2F8E X;  2G2O A;  4LRD A;  1OQ3 A;  1S57 A;  3I6P A;  2BM1 A;  4MFB A;  5GAH I;  1URN A;  4NEY A;  2VPX B;  1YJW S;  4R0E A;  2H9Z A;  3C6T B;  3GV7 B;  1Q1K A;  1YK9 A;  4YOE A;  2KYZ A;  3OL9 A;  4X4Q A;  1PO6 A;  5JMN A;  5KFA A;  3MMB B;  3PW2 A;  4RW6 A;  2GHV C;  1J5O A;  1E6Y A;  4WK3 A;  1UJ4 A;  1FDA A;  1UWB B;  4KYZ A;  3V6D B;  1TKZ A;  5KFB A;  2GVZ B;  3FGV A;  3PJX A;  2HS0 A;  2Q6B A;  4RZR A;  5KFF A;  3JSM B;  4DX8 H;  2UVR A;  2MKY A;  5A2Q U;  4FYV B;  2C2M B;  2GQ2 A;  1KQF B;  4R5P A;  4CLT A;  4P9S A;  4AT1 B;  1WOO A;  2HZC A;  2HHS A;  1KVJ A;  2C3Y A;  1ZM9 A;  5ETO A;  3RRG A;  1HA1 A;  3GYN A;  1WI6 A;  4ZDN A;  3J7A N;  2A10 A;  4LRE A;  1VRQ C;  3GQC A;  5KFP A;  3SDE A;  4USH A;  2UVU A;  4X65 J;  1KTQ A;  3KG0 A;  3OTC A;  4OYW A;  2RAQ A;  3FFI B;  5HQ8 A;  4RPF A;  2JX2 A;  3PAC A;  3HHK A;  4ZJL A;  2V50 A;  2QIF A;  2LEC A;  2DTJ A;  4NI2 B;  4DV4 F;  4CP5 A;  2CNO B;  2Z0G A;  3CJK B;  5DQG A;  2RNE A;  2CZ4 A;  1WHY A;  1JLC A;  3MFI A;  1HNW F;  4OZ0 A;  4RBU A;  1WHV A;  1D1U A;  2RHS B;  3K5L A;  3PIP Q;  2A18 A;  1H7X A;  3HVW A;  1TL3 B;  4DI6 A;  4QYZ K;  4F25 A;  3NBP B;  1UVJ A;  4NPO A;  1WI8 A;  1WOP A;  1SH2 A;  2RQM A;  2CQH A;  1YI2 S;  2O1P A;  2A6O A;  4NA3 A;  2OEJ A;  3G8S A;  2YWH A;  2IVM A;  2YWE A;  4QYR A;  2VFU A;  4E0D A;  1XK8 A;  1CJK A;  2DNP A;  4IDK B;  1UWA A;  3BN4 A;  3LGH A;  4HHU A;  1S76 D;  3SSS A;  3MED A;  4DPO A;  2OFG X;  3GIM A;  2H65 B;  1OO0 B;  1VLO A;  2L9N A;  1AW0 A;  3JTP A;  3M1V A;  1S1X B;  1AT1 B;  2HHP A;  2UV8 A;  4GC7 A;  1M1K T;  2OSR A;  4I56 A;  1BMQ B;  4M94 A;  2EFN A;  1ZZN A;  1R8A A;  5CYM A;  4DV1 J;  3CIM A;  3T1Y F;  2NZ4 A;  2GC8 A;  5J2M A;  3DLL Q;  2J9D E;  4RNH A;  2E9Z A;  4MYU A;  2LA6 A;  3C19 A;  3TAN A;  3HXM A;  3SEO A;  1VQM S;  4PWD A;  2KZZ A;  2LQB A;  3WDO A;  3EXC X;  2DHG A;  5EWE A;  3R7N B;  1REV A;  1JNZ B;  2AT1 B;  3DOL B;  4I2Q B;  4I68 A;  4ZIT A;  4IH6 A;  3HPO A;  4CO4 A;  1NK7 A;  3IR5 B;  1Q5V A;  4EUV A;  1UA0 A;  1YLX A;  4DPX A;  4ZVR B;  1WTF A;  1WC6 A;  3EPI A;  2RDI A;  2BJE A;  3LAN A;  5AT1 B;  2BM0 A;  3ET6 A;  4XDC A;  4CCH A;  2DO0 A;  2H54 B;  5KT7 A;  5IXU A;  1HQE A;  5I3U A;  2B5J B;  2VIH A;  2Z2Z A;  3TUJ C;  1VC6 A;  4LF4 F;  2AU0 A;  1PAU B;  1IR0 A;  3OTD A;  5T14 A;  2I9S A;  3OJU A;  1YBU A;  4ZHR A;  2VHG A;  4C7Q A;  5L1K A;  1N0V C;  4KPY A;  1VRU A;  2DHA A;  4Y0F A;  1NB2 A;  2KJW A;  2Y0S D;  3K17 A;  2HQD A;  2O66 A;  3NGK A;  5SZT A;  2UXC F;  3KOA A;  1VIS A;  1UVL A;  3IC1 A;  3VF0 B;  3EZU A;  3N4W A;  3BB5 A;  1PC5 A;  2YQ0 A;  1CBK A;  4ZKA A;  4ZP9 A;  1WC5 A;  5DG9 A;  3CCZ A;  2DNQ A;  3ISN C;  2YWG A;  4KB7 A;  4DU8 A;  4F3O A;  3GZ7 A;  5HRO B;  1RA7 A;  2AX0 A;  2LKZ A;  2D1C A;  3LAL A;  5L1J A;  3A12 A;  1CLF A;  3FJ2 A;  1B99 A;  1N36 F;  1FK9 B;  1NZ8 A;  4AUK A;  5D0E A;  3GV5 B;  3KLI B;  2I5J A;  2XMT A;  3R3T A;  3OR1 A;  2P9G A;  2DGO A;  4ICL B;  4QBU A;  2B7B B;  3GWC A;  1TMJ A;  4DR2 F;  4C11 B;  3JSR A;  4K4X A;  5D0G A;  4C3K A;  1QTN B;  1KON A;  3W2V B;  5D78 A;  5J2P A;  1XMQ J;  2WW8 A;  1T9T A;  1C0U A;  1S97 A;  3DOM B;  4YDD B;  3CCM S;  2HWI A;  1YBT A;  4YB7 A;  3KJQ B;  3IM8 A;  2XSF A;  1UFW A;  2AEJ A;  2DD8 S;  3HHL B;  2VQF F;  2WZ1 A;  5ETL A;  1ZOT A;  2WB1 D;  3J7Z 5;  3TAQ A;  3MZI A;  3RU0 A;  3FBC A;  1XMO J;  3JQM A;  2CYY A;  2NPF A;  3O44 A;  5HJX A;  4ZJO A;  3R7S B;  1HHT P;  3R97 A;  1KOH A;  1M1H A;  1VS3 A;  3TAR A;  2ZH7 A;  3D0H E;  2RU3 A;  3IGV A;  1G3O A;  3M2U B;  1V6H A;  1TL7 A;  2NSB A;  4IO9 Q;  4KQZ A;  5DM6 Q;  2HMI A;  4ALZ A;  2C2O B;  2ADB A;  2WVC A;  2IBO A;  1HLW A;  4DL0 C;  2EC2 A;  2ILY A;  3BYR A;  4NMX A;  2QMU B;  4QIE A;  4EBC A;  3IFE A;  2CG8 A;  3R5G A;  3VAF A;  3G8Q A;  2MYF A;  4X4V A;  1FDD A;  2DNO A;  5DS7 A;  4HVZ A;  3ZXW A;  1V5I B;  3HF5 A;  2C28 A;  2PT0 A;  2HAI A;  1YZ6 A;  4DJB A;  2EG2 A;  2XY5 A;  4UOG A;  2CG4 A;  3K89 A;  4ZLJ A;  1R27 B;  3ZTS A;  4UT4 A;  3MEG A;  2NCK L;  4KFB B;  3KLH A;  2I2Y A;  3HKW A;  4ETX A;  3D1Q A;  4QZV B;  2B9W A;  4FYX B;  1YQH A;  1NM2 A;  4DX7 A;  1BLU A;  1RAC B;  5DZ6 A;  5M2P A;  4K5R A;  4QR0 A;  4ECU A;  4ILR A;  5CQG A;  4OX9 J;  1U0S A;  2XTJ P;  2CXE A;  4A47 A;  4YP3 A;  3G71 S;  1TV6 B;  1EP4 B;  1RWP B;  1X5O A;  2XYG B;  4PAA A;  4EYI B;  4USV A;  3OFG A;  4OX6 A;  1RP5 A;  2ZVS A;  2WK4 A;  4DS4 A;  2ZH9 A;  1S9E A;  4LSN A;  3DFE A;  2QLX A;  1EQM A;  3CWJ A;  2WCX A;  4NLW A;  4A4J A;  3TUZ C;  4K8R A;  1MU2 B;  2RDJ A;  2BJ3 A;  2QN6 B;  4ZP6 A;  2A1B A;  2W2N P;  2K1R B;  3H42 A;  2J0X A;  1RWM B;  4I4B A;  2DO4 A;  1PIL A;  5J1P A;  1NK8 A;  3G82 A;  1Z4U A;  1NAQ A;  1ZA2 B;  2IA0 A;  1S0M A;  4UOF A;  3EJM A;  4MK8 A;  2DEJ A;  3D7S B;  4O44 B;  3QGH A;  1FJ7 A;  1RAG B;  5A6W A;  4DPY A;  1H72 C;  2F8M A;  3BSA A;  1U24 A;  3I9Z A;  4U6P A;  2LQ5 A;  3FBF A;  2UXB F;  1F3V A;  3FSX A;  4CYU A;  2Q66 A;  3UW1 A;  2ERR A;  1WKJ A;  2FHJ D;  2MZS A;  1JX4 A;  4PQA A;  2QL9 B;  3MM7 B;  1P1L A;  2EC0 A;  4KHR A;  3TA1 A;  1WC4 A;  4CT9 A;  2OPP B;  4N5S A;  4O4G A;  3QWP A;  2CZV C;  1J27 A;  3K5N A;  1NK0 A;  4DR1 F;  3M2V B;  1UFK A;  1HBO A;  1HI1 A;  4LMZ A;  3Q24 A;  2YX7 A;  3KXD A;  1Q78 A;  2ZBI A;  5KG4 A;  3J81 U;  4BS2 A;  5C25 A;  3OL6 A;  2ZEJ A;  4A8F A;  4LFC F;  1H2U X;  3Q8V A;  1QSS A;  2RF2 B;  4NEZ A;  3CJ3 A;  5DG8 A;  3QMQ A;  3DKD A;  1NDK A;  5AE2 A;  1JLE B;  3G6Y A;  4ECX A;  3BKT A;  1NKE A;  1R8C A;  3RYL A;  3K2Y A;  3PJW A;  2VUG A;  1VQL S;  3R6L B;  1QAJ A;  1C1B A;  2MQQ A;  3IRW P;  4HHJ A;  2GIQ A;  3BSO A;  4FYD A;  4ZVH A;  1NK9 A;  1K1Q A;  3TVY A;  1GMV A;  3T1H J;  4FVC A;  2KG1 A;  3MFH A;  1RT1 A;  5DJB A;  3RBX A;  1AA1 B;  1XNQ J;  4E8U A;  1RYR A;  1TL1 A;  2EG1 A;  3JSB A;  2RQC A;  4A8K A;  1VYA A;  1RBL A;  1YRT A;  4P2M A;  3CJ4 A;  3QLH A;  1LW0 B;  4DX5 A;  1MWY A;  4ID5 B;  2EPI A;  3UVJ B;  4DSL A;  3ZZY A;  5DGB A;  4ZP7 A;  8RUC A;  1U2F A;  1FDN A;  1S6Q A;  3MD1 A;  1UJ6 A;  3UQS A;  4W98 A;  3D1H A;  3WC0 A;  5K8O A;  3LP0 B;  1QE1 A;  1UEV A;  2C2D A;  1X31 C;  3MAA B;  5IM0 A;  3KLF A;  4PPD A;  3OFH A;  2JHE A;  3TW0 A;  1J5E J;  3TJ9 A;  2NLW A;  3KLG A;  1LWC B;  4WYL A;  1TL4 A;  2VA3 A;  5EUH A;  2KL8 A;  3PVX A;  3S01 A;  4DV3 F;  3W66 A;  5CA5 A;  4RUA A;  2VJU A;  3A8I A;  3ZTQ A;  5DDQ C;  1U25 A;  1WKK A;  3E51 A;  3I96 A;  5IT9 U;  2KFY A;  2BKP A;  3C14 B;  3ILL A;  4K0K F;  3WBZ A;  5M2R A;  2DH9 A;  4CRJ A;  3IWN C;  4CI0 B;  3DLE B;  2A2C A;  3MCM A;  1T95 A;  1RE1 B;  3IR7 B;  3IBW A;  4DR6 J;  3R27 A;  4PRF A;  2QLJ B;  2Z4P A;  3C6T A;  3GFZ A;  2DEI A;  1BUX A;  2PMW A;  1HWL A;  4O3O A;  4ES1 A;  4LRB A;  5GAG I;  3MMB A;  2VA2 A;  2OPQ B;  2ACM A;  3NS6 A;  1IQZ A;  1UWB A;  3V6D A;  4KTQ A;  2N4D A;  1H73 A;  1RCO B;  3ZFV A;  3M9M B;  2CNN B;  2GVZ A;  1S12 A;  3FZ2 A;  2J7U A;  4OLO A;  4I6A A;  4JV5 J;  5D3G B;  2YNI A;  4ED5 A;  3PW5 A;  4JI8 J;  1IWA A;  1FO1 A;  3IA0 A;  2VFT A;  2VFR A;  3CJT A;  4MTP A;  1D9D A;  4LR7 A;  2CQP A;  3TOQ A;  3MOJ B;  3RAQ A;  3NAI A;  3K8V A;  2LQ9 A;  3JAM Y;  1TAQ A;  1VQS A;  1RAB B;  4UF4 A;  2XMK A;  2YH1 A;  2JDJ A;  4GVL A;  4FYW B;  1LWE B;  2COL A;  2UVV A;  3R5J B;  3TUI C;  3CE8 A;  3TEH B;  3FFI A;  1FKP B;  2VG5 A;  2WHO A;  3M8S A;  1U45 A;  1UVN A;  2M7S A;  3SYZ A;  4ZN1 A;  4Y00 A;  2VG6 B;  4G3I A;  4NI2 A;  3N5B A;  1N5T A;  4MIB A;  1NK5 A;  3H5Y A;  3CC7 S;  4HDH A;  3CJK A;  4JYA F;  4K7Q A;  5JVH Q;  2HK3 A;  4CO5 A;  4PXD A;  3EUN A;  3BSN A;  4RNN A;  3N6L A;  1OPI A;  2WSC C;  4PWW A;  3CCE S;  4RW9 B;  2ZC4 A;  3ICL A;  1TL3 A;  3D6H B;  4ANE A;  4ZN3 A;  3HT3 A;  3NBP A;  4KT0 C;  1FWK A;  4WYW A;  4ECT A;  1X5T A;  3LAK A;  3R2D J;  3CJS A;  4Y3C A;  2FGO A;  3O3L A;  3NGR A;  4IDK A;  1WF1 A;  2ZH6 A;  2R2S A;  1QLN A;  1LQ9 A;  1TFW A;  3O8W A;  1W25 A;  4J9R A;  4ZP8 A;  1ZBT A;  4QWC A;  2H51 B;  2CUY A;  4RLE A;  4ZVP B;  2MJU A;  4ED1 A;  3SBM A;  3UFC X;  1HNI B;  1S1X A;  3MPY A;  2NXJ A;  4QWD A;  3H98 A;  4CLU A;  3KJN B;  5D4P A;  2D9P A;  2NYI A;  3I32 A;  2DY1 A;  2XS2 A;  2AIR B;  1VI7 A;  3CED A;  2BRK A;  3B78 A;  2MKJ A;  2FZC B;  5HMZ A;  1U09 A;  2B56 A;  1WKL A;  1DJ0 A;  3GSI A;  4LSL B;  4WWS A;  2O01 C;  2PI5 A;  4IUF A;  3QAE A;  2KO1 A;  2FY8 A;  1OYE A;  3POT A;  4RU9 A;  1WSR A;  4N8O A;  4DUT A;  1RHM B;  2FJB B;  2XEX A;  4LFA J;  5F8I A;  2MHE A;  4YB6 A;  3MI7 X;  4NCA A;  5L46 A;  4I2Q A;  4CM2 A;  1SC1 B;  3RW6 A;  4LF7 J;  3PYE A;  2AGP A;  1S1W B;  5F41 A;  4ZIV A;  4C8Y A;  1JKH B;  4TNO A;  1LWF B;  3UNG C;  1S0N A;  1WJ9 A;  2XS5 A;  1VCT A;  3IAS 9;  2L9W A;  4OLP A;  4TY8 B;  2B8P A;  2CFX A;  2XMU A;  2MY8 A;  1ZA1 B;  1MRO B;  2OEM A;  1DHM A;  3OTE A;  1N5Y B;  1U4B A;  5J2N B;  7FDR A;  2B5J A;  2N4C A;  2R3V A;  4O0N A;  3BH6 B;  3BO2 A;  2ZZN A;  1N32 F;  2Z2Y B;  1WC1 A;  1CJT B;  2W4P A;  4P2F A;  2UUT A;  2ZJP Q;  5C24 A;  5A2Q Y;  4M5K A;  4HR2 A;  4GKK J;  4FKY A;  3AJD A;  3Q23 A;  3A8E A;  4I7F A;  1IBL J;  1Q8B A;  1AB8 A;  1N52 B;  3PY8 A;  4LUB A;  1Y3J A;  2V4J B;  3SIP B;  4GKJ J;  4O3P A;  3DOK B;  4CM0 A;  2PGC A;  4B9N A;  3H5S A;  2DGW A;  3M6U A;  4W92 B;  5AXL A;  5F0U A;  1HNX F;  2OPS B;  3MHY A;  4OI0 A;  1KBR A;  5F0W A;  3CT9 A;  2CJ9 A;  4JI2 J;  2VBX A;  2F40 A;  4LVN P;  3KLI A;  4PQU A;  3L7O A;  2AP6 A;  4ICL A;  4USJ C;  1KOO A;  1ROF A;  1B0V A;  5AXN A;  4LBP A;  4C11 A;  4ENO A;  4UW2 A;  3HX9 A;  2BR0 A;  1LV5 A;  3W2V A;  3CDE A;  3C46 A;  5F8M A;  1X9M A;  4UOC A;  2YKN B;  3EGV A;  1MG7 A;  3DOM A;  3DGV A;  2XZT B;  3QYY A;  4NYZ A;  3QJL A;  4WBF A;  1D9A A;  4PKD B;  4K5S A;  4DPW A;  2OIH A;  3HHL A;  1WHW A;  2FLP A;  2EW9 A;  1RWK B;  2ATC B;  3M30 B;  3MMC B;  3W2W B;  1WSV A;  2MQM A;  1U7L A;  5CZX A;  2GML A;  2VBW A;  2JNJ A;  2DXD A;  3OW2 R;  3TZY A;  2UUA F;  4DV6 J;  3J7Y I;  1Y7P A;  5EX3 A;  2BQU A;  3MM6 A;  1RT3 B;  4OHY A;  3VAH A;  3WQP A;  5IV3 A;  3QFW A;  3HI9 A;  4LF5 J;  5DDO C;  2IDL A;  2YQ3 A;  3EZO A;  1RWU A;  2HS3 A;  1G1X A;  4ZK7 M;  3C16 B;  2LU1 A;  2M70 A;  4JI3 F;  1T9V A;  4OZL A;  4RNO A;  1K0V A;  4X64 J;  2MZ1 A;  3R7B B;  5HAN A;  3CCL S;  2AJ2 A;  2GVD A;  3LTO A;  2EWH A;  3W8G A;  2LCW A;  4C2M A;  4YS2 A;  3BR8 A;  3IAM 9;  5G4D A;  1UTA A;  5EGY A;  1RGV A;  1GAO A;  4CLS A;  3IRX A;  1R31 A;  4HYK A;  1UPP A;  2QEX S;  1UVM A;  2XMV A;  4KFB A;  2UUB J;  2IRX A;  2HFO A;  2NS1 B;  4A8X A;  1JLB B;  4L6V 3;  4J9Q A;  4GC6 A;  4DDF A;  4K4T A;  2JH3 A;  1L3S A;  2XI2 A;  2POK A;  3EGW B;  1PJ6 A;  1DFD A;  4CNZ A;  5KFY A;  2Y1R I;  5LT5 A;  2VG7 B;  2WSE C;  3ZZU A;  2HVH A;  1TV6 A;  2KRR A;  1XWL A;  1EP4 A;  3OLB A;  3T6B A;  1ZM2 A;  1PBA A;  3D67 A;  2W25 A;  3UDC A;  1PG5 B;  2DH8 A;  2CPD A;  4X62 F;  1QAX A;  4FF3 A;  1Q4R A;  4OI6 A;  1L3T A;  5I3Q A;  3W5Y A;  1B0P A;  1NZA A;  5K14 A;  2K1R A;  3V6K A;  4C48 A;  3W63 A;  3TO8 A;  3A3O B;  3TQ1 A;  3LP1 B;  5FDL B;  3HHL C;  2UU9 J;  2CQC A;  2W8L A;  4Y2A A;  1P1T A;  3CCQ S;  1NJX A;  1KQG B;  4DV7 F;  1HHS A;  4O44 A;  4Q7A A;  3I31 A;  1WOS A;  5A8W B;  1K73 T;  1U1M A;  2BJD A;  1EB0 A;  3RR7 A;  2J6S A;  4UY8 T;  1FT8 A;  1Q86 T;  1HNZ J;  4RW4 B;  4A8O A;  2VOD A;  2HQF A;  3P8B B;  4JI7 J;  2HW3 A;  3SI8 A;  3RB6 A;  1W2I A;  2ZH4 A;  3MUV P;  1RTZ A;  3FZB A;  2JEJ A;  2V69 A;  5T41 A;  2BYC A;  3MM7 A;  2DNL A;  4FZV A;  4NZ7 A;  1VQP S;  1JNR B;  4K4W A;  5DO2 A;  5ADZ A;  3K58 A;  3UO0 A;  2LQJ A;  1QSY A;  5KT4 A;  1VBX A;  4KGZ B;  3I0S A;  4MT1 A;  3DDK A;  3U1M A;  4K50 A;  4GMK A;  2OH2 A;  1NH8 A;  3UI3 A;  1R8B A;  4NYO A;  5GAE U;  4F3M A;  4MK9 A;  5HP1 A;  4Q2M A;  5D8H B;  1L3U A;  2RKI B;  4I67 A;  3QSI A;  4B9T A;  1B4S A;  3DC2 A;  3BYP A;  4B3M F;  2HIQ A;  3U02 A;  1JLE A;  3AFG A;  2YPZ A;  3MEC B;  5B0A A;  3BGO P;  1JXV A;  3HZE A;  3OT9 A;  1RDR A;  4I0W A;  5KG1 A;  1LNQ A;  2DT9 A;  4IR1 A;  5U47 A;  2V4R A;  2FJX A;  2KHC A;  4NLT A;  4QIV A;  2C2K B;  3AD8 C;  4WPA A;  4H4K A;  1LW0 A;  2GAH C;  3GIL A;  4ID5 A;  2BE9 B;  2CWX A;  2KVQ E;  1EIY B;  3HP6 A;  3V4I B;  2WB4 A;  4MKB A;  3W65 A;  3UVJ A;  2R2U A;  2F3J A;  3O1L A;  2DR8 A;  1LXN A;  4P74 A;  3UN5 A;  4J37 A;  3V6J A;  3GR0 A;  2WAQ D;  4DR4 J;  2ZWP A;  3EDR B;  5LL6 d;  2IM0 A;  1NUE A;  1RLD A;  3PYG A;  5KAK A;  1H2V Z;  5AXK A;  2M52 A;  4B3R J;  4HI1 A;  1TK5 A;  1S0O A;  3LP0 A;  3ZTP A;  4OYP A;  2Y1J A;  4U7C A;  2HSE B;  3MAA A;  3G4S S;  1YJ9 S;  1ZTT A;  1TKD A;  2NXN A;  4S0M A;  2XLK A;  4U67 Q;  4RW6 B;  1NPK A;  4RUC A;  1J5O B;  1UPM B;  2B9E A;  3M9N B;  5ETP A;  1LWC A;  1YJN S;  1OSD A;  3PX0 A;  5K9F A;  4Q2L A;  1WF2 A;  4IG3 B;  2KZM A;  3M6W A;  4I2P A;  2HFV A;  5KOW A;  5IQQ A;  1QVG R;  3TX0 A;  4KJI A;  3G86 A;  1YG0 A;  5LJ5 Y;  3H2U B;  1YJ7 A;  4P2X A;  4R5P B;  1KDN A;  3LO3 A;  4X66 F;  3R9L A;  2OTL S;  2J8S A;  1HFE L;  2FJE B;  4WU2 A;  5LOQ A;  3C14 A;  4DR6 F;  4UUX A;  2GW8 A;  4LF8 J;  1UL3 A;  3IGN A;  2XCA A;  1N34 J;  3D1O A;  1JK9 B;  4B9L A;  3NCP A;  4KRW A;  4DLG A;  2CQB A;  3LGM A;  5KOX A;  2MKS A;  4Z37 A;  5H9F K;  3OXF A;  3MPU B;  4F67 A;  5CD4 H;  3ILO A;  1P9Y A;  3DLE A;  3H2V E;  2VB6 A;  4L74 A;  4ED0 A;  2YXL A;  3T1A A;  4DHV A;  3PW7 A;  4K4V A;  2IFX A;  1KQS R;  3IG1 B;  1BGX T;  3HSD A;  1JLC B;  4IFY A;  1GT8 A;  1JLQ B;  3K8W A;  4DSI A;  2KN4 A;  1SJ3 P;  5HO4 A;  2OPQ A;  1JMT A;  5DQH A;  2ZH5 A;  1ULR A;  4ED8 A;  4JI8 F;  2FLL A;  2UXD J;  2J7W A;  3Q2T C;  2Z57 B;  1H2T Z;  2RH3 A;  2J0S D;  2W9A A;  3HVT A;  1R3N A;  3BSC A;  4J9V A;  1RU1 A;  5AE3 A;  3GII A;  1OS5 A;  4H4K C;  3FCV A;  2QLF B;  3Q8R B;  2E7X A;  2XG8 A;  2E1C A;  4IG0 B;  1NKC A;  2F4F A;  1D8Z A;  1Q95 G;  2RIJ A;  4L73 A;  2ASD A;  1NKB A;  2HS4 A;  1YRX A;  3G6V A;  2RS2 A;  4RWW A;  2FVS A;  1NJW A;  1U1Q A;  2HGN A;  1Q82 T;  4JI6 F;  4H4O B;  3NRB A;  3J81 Y;  3OSP A;  4YUD A;  1RHQ B;  1LWE A;  3H5X A;  4TQS A;  1RTI A;  4EEY A;  4NXN F;  2HHX A;  3M1V B;  4GRS A;  2E9T A;  1C2P A;  2XI3 A;  1FKP A;  3QT5 A;  4F3Q A;  4IOA Q;  4ECV A;  2C3U A;  4H54 A;  3C3L A;  1TAU A;  1RB0 A;  3F0N A;  2P6T A;  3M8Q B;  1HMV B;  2DRA A;  1TR0 A;  1L5U A;  3PEH A;  4TU9 A;  1H3D A;  4WII A;  3LAM A;  2ATL A;  1HI0 P;  1VIO A;  1ZTW A;  3ULH A;  2PA3 A;  3AAW B;  4FXW A;  5KFW A;  5KFD A;  2AJ4 A;  4FS2 A;  4RW9 A;  1TKX A;  2IRY A;  1AFI A;  4AND A;  4DXL A;  1HBM A;  1TZ0 A;  1HKA A;  5F3Z A;  3QJP A;  4WXW A;  2XCP A;  2KT3 A;  1ICE B;  1EJ7 L;  1EKR A;  3NGD A;  2LA4 A;  4ZPB A;  2K06 A;  2ZFH A;  3UCU P;  3CCU S;  4CNY A;  3DGP B;  1KKH A;  4W90 B;  3B8H A;  3KFW X;  5LSO A;  5GMD A;  3FK4 A;  3RAM A;  4X4R A;  4G1I A;  2IJF A;  3Q8S B;  2KM8 C;  4DZ6 A;  4UZB A;  3LUY A;  4HKQ A;  1YVF A;  1N54 B;  2YKM A;  3I4H X;  2NQP A;  4C0O C;  5AJ3 J;  3ZNU A;  3HLU A;  1FTR A;  2ABY A;  1WOR A;  4Y2M A;  2V34 A;  3SV4 A;  3EVW A;  2ZE2 B;  1HNI A;  4KHP J;  2IM1 A;  5I3U B;  2J9D A;  2BUN A;  3RG6 A;  2XLI A;  3W61 A;  4DUY J;  2F9D A;  1JXE A;  2QSF A;  1UZD A;  5GAG U;  1KWM A;  2HQ3 A;  3L9Z A;  4LR9 A;  1KEK A;  2W9B B;  1SV5 B;  4LRF A;  2VPY B;  4B3S F;  4WXO A;  4LSL A;  3AOC A;  3VVT A;  4N8N A;  3MR7 A;  5IT9 Y;  1YGY A;  5F9L A;  2E1M C;  4ITS A;  4L3K A;  2B4U A;  4RNF A;  1FWP A;  4U7U K;  2YNF B;  2DHS A;  3PX4 A;  2DR7 A;  1NSQ A;  4OYA A;  1RTD B;  1U6Z A;  4OZ3 A;  2XWX A;  2YPY A;  5KFI A;  1AZS B;  2CKW A;  1RUS A;  1EZZ B;  2Y1L B;  2W8K A;  2KB2 A;  1T02 A;  3DCA A;  5T7L B;  1S1W A;  3A4T A;  3HFZ B;  1U1O A;  3FCH A;  3G8T A;  2IBK A;  2L9D A;  3NCQ A;  2XSJ B;  3BKF A;  4IRC A;  4FPI A;  2E5L J;  4TN2 A;  3D0I E;  3KUE A;  5J2P B;  3UD3 P;  1C0U B;  3N5F A;  1MRO A;  2GHW A;  3SCI E;  2XMW A;  1QUV A;  5J2N A;  3R1H A;  2V2V A;  2KKH A;  2DNH A;  2V2Q A;  2YWK A;  2ZDP A;  1CJT A;  4AQY F;  2J9E A;  1RT7 B;  1BY9 A;  3D4J A;  3G6E S;  3D3C J;  3AQP A;  4DR5 J;  2DY9 A;  3AJ2 A;  2MKC A;  2GZO A;  4C3L A;  1OY6 A;  5BYR A;  3GIR A;  3R5C A;  3UN2 A;  2R7R A;  1LFW A;  4DR7 F;  4YY3 J;  4KO0 B;  2V4J A;  2KFN A;  3DOK A;  3W5Z A;  5RUB A;  2KHD A;  3BGU A;  2AQ4 A;  2FJW A;  2J0Q D;  2M8H A;  2YWW A;  2X1B A;  1F0X A;  1JLA B;  4F4K A;  2HND A;  2O5D A;  4ZLL A;  2FTR A;  5KG2 A;  2ZZT A;  4OI1 A;  2VOP A;  3KK2 B;  1OQ6 A;  2G1D A;  5KFG A;  1VJW A;  2YNH A;  4B3O B;  1VHI A;  1IBM J;  1X7V A;  2YQ1 A;  1DTQ A;  4FF2 A;  1JIH A;  2LDI A;  2YKN A;  1HWI A;  4E2F B;  1S48 A;  3F44 A;  5DGA A;  3AQO A;  1DQ8 A;  4DV6 F;  3MEG B;  2HHH F;  4JI4 J;  2ILZ A;  2DIV A;  2OEL A;  3TAM B;  1IM4 A;  4NRT A;  3M30 A;  3MMC A;  5B09 A;  1SC6 A;  5KT3 A;  1N56 A;  4PXC A;  2VBY A;  2ZHA A;  3W2W A;  5CXT A;  3HDS A;  1F1B B;  1U2C A;  4JI1 F;  1R43 A;  1Y00 A;  3FSY A;  3PYF A;  3H0P A;  3GIJ A;  4KGX B;  5GAD I;  3Q8P B;  3WIV A;  2MQL A;  1E6V B;  2CJQ A;  1NK6 A;  2EVZ A;  1RT3 A;  3FBE A;  2DIU A;  4KGV B;  1JJC B;  2GQC A;  3UE2 A;  3FVY A;  3BR9 A;  3QFH A;  3N01 A;  1RWW B;  1S9E B;  5K8P A;  2PI4 A;  4LSN B;  2GS8 A;  4JBC A;  4EO8 A;  3BH7 B;  3C16 A;  1KSP A;  2ZOF A;  1IBK F;  1PYO B;  2X7I A;  4QYZ J;  1RHK B;  2W01 A;  4KHM A;  2AYE A;  2IM2 A;  5EWG A;  3Q89 A;  1U02 A;  5LMN F;  2Q43 A;  5BYQ A;  2HVE A;  1QTM A;  4DN0 A;  2XUL A;  5KFL A;  3HSG A;  3OUY A;  2J6T A;  4ZMM A;  2H5E A;  3NEK A;  1X8D A;  2JEI A;  1DTT A;  2CQG A;  1KFD A;  2CJY B;  1XR5 A;  4ER8 A;  4DL4 A;  5KFC A;  3N28 A;  3CJQ A;  1EET B;  1Y3K A;  3GSD A;  4JI5 F;  4LJM A;  4NLG A;  1H38 A;  3FEY B;  4WFX A;  3GE9 A;  3FQL A;  1HD1 A;  4V1A k;  4DR3 J;  3PEJ A;  1SXL A;  4HAC B;  1YRU A;  2VG7 A;  1TUG B;  1YHQ S;  4C97 A;  4A8M P;  2MHN A;  1FJG F;  4O23 A;  3CD0 A;  4F0K A;  4B9V A;  1Y5N B;  5I42 A;  4WZQ A;  1NCL A;  5I4M A;  5L1I A;  5E3A A;  1TUV A;  2UU9 F;  3GLJ A;  1HBO B;  1Z1Z A;  1DRZ A;  1X4G A;  1VBZ A;  4DV5 F;  3AOD A;  2B3T B;  2JVR A;  1L3K A;  3PFE A;  1GXU A;  2QGF B;  1T0T V;  4X4S A;  5IZH A;  5LMU F;  4P7V A;  1W7W A;  3OHA A;  2X3G A;  2VQE J;  4ECZ A;  2CVI A;  3CJ5 A;  3LP1 A;  5FDL A;  4OZN A;  3ZNJ 1;  2B7C B;  1C1B B;  4IOC Q;  1ITP A;  4LFB F;  4C4W A;  3QT6 A;  1HD0 A;  4I6W A;  2CJK A;  4NA1 A;  3DLG A;  1CC7 A;  3M2R B;  1UW9 A;  2QA1 A;  3O5T B;  3OR2 B;  2HRT A;  3WIU A;  1S79 A;  2BAC A;  2FPH X;  2WRM A;  2EI5 A;  3MGJ A;  2AKW B;  1SQE A;  2IMO A;  3SXL A;  2CAJ A;  1S6O A;  3C15 B;  1DAX A;  3MMJ A;  1T11 A;  4J91 A;  4KE5 A;  1GMW A;  4IKA A;  1M5S A;  1KN6 A;  3UCG A;  4ZS6 A;  1S59 A;  3CO0 P;  4LF1 A;  4A8W A;  4YHH J;  2KDO A;  1R0B G;  3BKU A;  1BQN B;  1FRX A;  2H5J B;  2Y0B B;  1WEY A;  4UY8 5;  2VF3 A;  1CSJ A;  4X4T A;  4JI0 J;  1FRM A;  1V9O A;  2G1H A;  1EAY C;  1NSK L;  4B3T J;  1Q81 T;  2ZHB A;  3H25 A;  5IFM A;  1B7F A;  4ZA1 A;  1QE1 B;  4NXM F;  1HR0 J;  1B7Y B;  2QE5 A;  1TP7 A;  1KS2 A;  5IM0 B;  5C7P A;  3KLF B;  3HM9 A;  4TU8 A;  3BGF A;  3DRS B;  2D69 A;  2RSQ A;  4B9U A;  2RKI A;  2CQI A;  1GK8 A;  1R0A B;  3W9I A;  4DBQ A;  1NK4 A;  2FYX A;  2C22 A;  2G0I A;  3JSY A;  5KFU A;  3ETO A;  1U6F A;  3MEC A;  2V8G A;  2MDA A;  3CB4 A;  1NSA A;  1V3Z A;  4ID8 A;  4KPC A;  4FP9 A;  2B6A A;  1T05 A;  2HFU A;  1VQ6 S;  4F0M A;  2BOP A;  3CJ0 A;  4CLK A;  2XWY A;  4K59 A;  2W9C B;  3CDW A;  5KFQ A;  2CQD A;  3MM9 B;  3DHX A;  3TA2 A;  2RDD A;  1RAH B;  1GMU A;  3OLA A;  3BRE A;  2Z2L A;  1KHW A;  2BAN A;  3V4I A;  4Q0B B;  3VZH A;  3WX8 A;  2BX6 A;  4CLL A;  2RJZ A;  1XTZ A;  4F02 A;  2R7X A;  4F0H A;  1VDH A;  2QO3 A;  3VHQ A;  1DQ9 A;  2LFV A;  3CDU A;  3DLK A;  1MWQ A;  2IYI A;  4DN9 A;  5KFN A;  1HNV B;  2BE2 A;  4CT8 A;  4I64 A;  3QIP A;  4P2S A;  3E2E A;  4ZLN A;  3SFU A;  4WP9 A;  2B0G A;  3FC9 A;  3QO9 A;  1Y5L B;  4USM A;  1WEX A;  4IG3 A;  2P2C B;  1NPP A;  2HVI A;  3TJ8 A;  3ENV A;  3GJT B;  1EX8 A;  4LF8 F;  1X4C A;  5F8L A;  2V2K A;  4WK1 A;  4HHH A;  3W64 A;  1NME B;  1B3T A;  4MKA A;  2QA4 G;  2EFG A;  4LRC A;  3PR4 A;  2LEB A;  1LEO A;  1QM9 A;  2MXY A;  4KV8 A;  2YNI B;  1M1G A;  3OL8 A;  3DXS X;  2XO6 A;  4ELU A;  2OP5 A;  2HBR B;  3NL0 A;  1A9N B;  2Y1I A;  4AL6 A;  5KFE A;  1TVR B;  5AE1 A;  3MXH P;  3CD5 A;  2B4V A;  2M88 A;  1KRP A;  4IH7 A;  3ZZT A;  3W1Y C;  1WF0 A;  3ITH A;  5LXY A;  4QR2 A;  3E3X A;  3DMJ A;  1APS A;  5B0G A;  4EU0 A;  2KTQ A;  2VG5 B;  1EKS A;  2UXD F;  4C8N A;  5L8R C;  3LOU A;  4RR5 A;  3NGS A;  3CW2 C;  1Y5I B;  4OZ5 A;  2GFF A;  3IG1 A;  1R6Y A;  1UZH A;  1F5B A;  2CDR B;  4JB8 B;  1JLQ A;  1X0F A;  3NOC A;  2A0F B;  1N8R T;  3BPD A;  2X51 A;  1UJ5 A;  2UUC F;  3THT A;  4URQ U;  2QLW A;  3M4X A;  1I94 J;  2HQI A;  4WFB Q;  2JL9 A;  1S6U A;  3I55 S;  3NNH A;  1VRT B;  3DRY A;  2OHD A;  1ZM4 A;  1IKW B;  2H48 B;  3H59 A;  4IG0 A;  2EKY A;  5IT0 A;  2NR0 A;  1SJR A;  2BEF A;  2D41 A;  2BBE A;  1T9Y A;  4ZVT B;  1WD6 A;  3MAH A;  3C6U B;  4H4O A;  3DRR A;  4J9L A;  4EBD A;  3EVM A;  2HBY B;  3THP A;  4B17 A;  4XPE A;  1XR6 A;  2ZNY A;  1FXR A;  3R2C J;  3DM2 A;  3GCW P;  2FHO B;  3W60 A;  1T9X A;  1S9F A;  3M8Q A;  1HMV A;  2OFH X;  2XYP B;  3UR0 A;  2LXI A;  1OSC A;  4LF6 F;  1S77 D;  4OZ2 A;  2DRD A;  1KD1 T;  2V63 A;  4DL6 A;  3UPF A;  1VK8 A;  3AJ1 A;  2FVQ A;  3POT B;  1TL5 A;  2DGT A;  4DCP B;  4P73 A;  4ZPA A;  2DYA A;  3CCV S;  3KHL A;  1FTC A;  4DV4 J;  3H5U A;  3KNA A;  1YX2 A;  5HVH A;  2G0C A;  5KFJ A;  3DGP A;  3TRG A; 
#chains in the Genus database with same CATH homology
 4LSZ B;  3D6F B;  2XZT B;  2FQQ B;  4ZVT B;  1RHR B;  1SC3 B;  1PYO B;  1RHU B;  3R7N B;  1RHK B;  1SC4 B;  2CNN B;  1F9E B;  3R7S B;  2CJX B;  1RWK B;  2HBY B;  3P45 B;  3D6H B;  5IC6 B;  2QL9 B;  1RHJ B;  5K20 B;  2H5I B;  1RWN B;  1IBC B;  4ZVS B;  1RHM B;  5IC4 B;  1RWP B;  2XYG B;  2DKO B;  2XYH B;  3SIP B;  4ZVR B;  3D6M B;  2H65 B;  4ZVU B;  4DCJ B;  2CDR B;  1RWV B;  3IBF B;  4JB8 B;  2CJY B;  2HBZ B;  2C2O B;  1SC1 B;  2C1E B;  2QLB B;  2XYP B;  2C2K B;  2XZD B;  1QDU B;  2QLF B;  3R6G B;  2CNO B;  4DCO B;  1ICE B;  3KJF B;  2P2C B;  1I51 B;  1BMQ B;  2H4Y B;  2H54 B;  3GJT B;  1QTN B;  3R5J B;  1RWO B;  1RE1 B;  3P4U B;  2HBQ B;  1NME B;  1RWM B;  3GJQ B;  2CNL B;  3GJR B;  3NS7 B;  2H51 B;  2QLJ B;  4ZVP B;  4DCP B;  1PAU B;  2QL5 B;  3KJQ B;  1I3O B;  3QNW B;  1GFW B;  2Y1L B;  1RWX B;  3GJS B;  2C2Z B;  3R7B B;  3EDR B;  2H48 B;  3KJN B;  3R6L B;  2QL7 B;  1RHQ B;  2H5J B;  1RWW B;  2HBR B;  4ZVO B;  2Y0B B;  2CNK B;  3IBC B;  4ZVQ B;  2H4W B;  2C2M B;  3RJM B;  3EDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...