2HBRB

Crystal structure of human caspase-1 (arg286->ala) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2hbrB00
2CJXB 2H51B 3R7BB 3R6LB 3KJQB 2CNKB 2H5JB 2CJYB 1RHUB 3KJNB 1SC4B 2HBRB 2P2CB 1RE1B 3KJFB 4ZVTB 2HBQB 3RJMB 2CNOB 2H65B 5IC4B 5IC6B 3R7SB 1NMEB 4ZVUB 2XYGB 1RHJB 1SC3B 1ICEB 1RHQB 2H4WB 3SIPB 3R6GB 2HBYB 2C1EB 2QL9B 2H5IB 2XYHB 3GJQB 3D6FB 3GJSB 2C2KB 1RHMB 2DKOB 3GJTB 2C2ZB 2QLFB 1RWKB 3P4UB 3P45B 4ZVSB 1SC1B 1QTNB 2H54B 4JB8B 1F9EB 1RWOB 4ZVPB 1RWPB 2Y0BB 4ZVRB 2H48B 1BMQB 3GJRB 3R5JB 1RWMB 2CDRB 2H4YB 2QL7B 2C2MB 4DCJB 2QLJB 2XYPB 1I3OB 3EDQB 1PAUB 3IBCB 1IBCB 4DCPB 2CNNB 3D6HB 4DCOB 2QL5B 1RHKB 3QNWB 2CNLB 4ZVOB 1RWVB 2XZDB 1QDUB 5K20B 3R7NB 1PYOB 2Y1LB 4LSZB 3EDRB 3NS7B 2HBZB 1RWWB 2XZTB 2C2OB 4ZVQB 1RHRB 3IBFB 3D6MB 1GFWB 1RWXB 2FQQB 1RWNB 2QLBB 1I51B
chains in the Genus database with same CATH superfamily
1CG2A 2EBEA 5KFJA 3DCAA 3I0RA 2JVOA 3MDFA 4ZOSA 3SQGA 4JI0J 1F9FA 2DHSA 4PCQA 2YQ3A 3KJVA 3KJQB 1VJWA 2AGPA 2D41A 5HMZA 3HSGA 3KK3A 3N5FA 4Z37A 4C48A 4O3PA 1K0VA 3UDEA 1HBNA 5G4DA 3U1LA 2DRBA 2HNZA 4EYIB 2H9ZA 2HK2A 2O66A 2YX4A 3MUMP 4C8ZA 3M6VA 1L3KA 2HGLA 2FVSA 4ZITA 3J7A1 2ZJRQ 5GADU 3F41A 4RU9A 3EX7B 6FDRA 1GMWD 3J81Y 2HGMA 1UWBB 1CQNA 2YNHA 4Y2KA 4QWEA 3RB3A 3RRKA 4ANEA 2IC3A 4H4KC 3TQ1A 2JEGA 1CVJA 4N77A 2RAQA 3EYZA 3M30A 1VMBA 1OYEA 2OPRB 2CPXA 3LP2A 3Q8YA 1MMDA 4WP3A 5GMEA 5DLGA 4X65F 2KM8B 4J9NA 5I3UA 3GU0A 3W5XA 4OV1A 1JWWA 4A4JA 2IMWP 3M6UA 5K8MA 4QYZK 5B0CA 9RUBA 4LF8J 4OI3A 2VPYB 1Q7LB 2W25A 5D0RA 1KLMB 2XS7A 1W26A 2CZ4A 1D9FA 4TU8A 3AFGA 2ZVIA 4H4OB 3SSQA 1U47A 1DJ0A 4EZ9A 2Q43A 3MD1A 3LP0A 4JI3J 4N76A 4GKJF 3DYAA 5D77A 1PGZA 3PM9A 4A8OA 2KJVA 3OR1A 1U0HB 4ZLLA 3N6MA 4X4RA 4KHPJ 2RHQB 3HZGA 4CRJA 2UUBF 1FK9B 1RTIB 3TOQA 3GJRB 2YKMA 3A8KA 1RWMB 3IR6B 1HHSA 3HD1A 3VWSA 3C6TB 2PEHA 1KKHA 2AIRB 2YX1A 1ZA1B 3BKFA 4OIXA 1NPPA 2Z2YB 1LNQA 4RW9A 3TAPA 2C28A 3HHNB 4I2PB 5A2QY 4DFMA 3R5DA 2C2MB 5I3PA 5KFHA 4BS2A 3FEYB 1FRJA 1FVQA 4CI0B 1EARA 3A3PB 5T7LA 5KG7A 2RS2A 2CA9A 2MZ1A 3PACA 3JYTB 5KG1A 2MQNA 3A8JA 1HHQA 3C66A 1R8AA 3ZC4A 3M6WA 2BOAA 3Q89A 3SFGA 1JLQB 5CYQA 1RYSA 3X1LB 3JSMA 3TYTA 4YHHF 3MOJB 4YR0A 3FEXB 1P8GA 1S1XB 4OI6A 3IN5A 2DGOA 2GNKA 2YKNB 4KE5A 1HPZA 1KLNA 2G0IA 2J7UA 1D0EA 2CQIA 1FO1A 4QR0A 2JLGA 3VAJA 3F73A 1AUSL 3P8BB 1X9SA 2VFTA 3EGVA 1PBAA 2HQCA 3KLFA 3TANA 3ILOA 1X0FA 1GQEA 2LU2A 1NKCA 1DLOB 2Y1RI 5KT2A 3SCIE 2VG7A 4X4NA 3OL6A 4KGZB 2QV6A 1RAJA 3DI6A 3HX9A 1S79A 1M0SA 4FVCA 4M5DA 5AXMA 5C25B 3PV8A 4IFYA 3AB4B 2FLOA 4LFBJ 1RT3A 3OUYA 2DR7A 4K0KJ 4CM2A 2DHHA 1N48A 3LH2S 4CLZA 4RLEA 4JI6F 1IKYB 2BBEA 2VPZB 3PR4A 1HW8A 1ZPVA 2DYAA 3VHQA 4DLEA 1IVZA 1WSRA 3TVZA 1H2UX 1QUVA 1WC4A 1BD6A 1OY8A 2MB0B 2MJNA 2M7SA 3Q24A 3G86A 2OSRA 3T41A 4RUCA 2YWGA 4GC6A 2A2CA 2YWKA 5EGYA 5KFFA 5BJRA 3GYNA 1KR4A 3FNNA 4JOUA 4C8YA 2HYIB 3CC4S 1IBKJ 3NCQA 2OMOA 4M95A 2MHEA 2XQCA 5JMNA 5A8WA 5F8IA 2J9EA 3ILLA 3L7OA 2FDNA 4O0NA 4OYWA 4RUBA 4O44A 5KOXA 5LJ3Y 1S10A 3HSZA 1QTMA 3IAS9 1MSWD 3PHEA 1FDAA 4DL5A 3PYDA 3W2WA 1HNWF 4RNNA 1GH8A 5IC6B 5C24B 2Y8YA 5IT0A 4J5OA 3IRWP 2QA1A 2QLXA 1TL1A 3AODA 1IR2A 2YH1A 2E44A 3OR2A 2IM2A 4RW6A 3KNAA 4FYXB 3EXYA 4IDKB 2EKYA 4DMZA 2W7AA 2VJUA 1U0HA 3CJ0A 4FPRA 2IAJA 4QPTA 5THWA 3SIPB 1RAEB 1JLFA 3IM9A 4DPXA 2V63A 1SJ3P 2C1EB 2KT3A 3EJMA 1ZAVA 3C16B 1NXIA 1BGXT 1L5UA 4Q8EA 5E3PA 1TKXA 3UD5A 1U7LA 1WEXA 2JC0A 2KU7A 1Q8BA 5HLFB 1FKOA 5E3CA 1PG5B 1NJIT 2HNDB 2GMLA 1FRIA 3JQJA 3MECB 5KFYA 2IMOA 1M5KC 3IWLA 4B17A 4AFFA 3I82A 1GTEA 4BCAA 2DGTA 2WCXA 3ZZOA 1WC6A 1YK9A 2W01A 4MIAA 1F60B 2DHGA 4LQ9A 1J5OA 4F2RA 2HZAA 2CZ9A 4U67Q 2XM3A 2OPQB 1X4AA 2CKWA 3EZ5A 1FNOA 3W61A 2BVZA 5L8RC 2BJ9A 1KRPA 4LF6F 3MEEA 4B3TF 1LEOA 3H2UB 1IJFB 1B64A 4EEYA 3PRDA 4P74A 2PEBA 3A1YG 1RKJA 2WHOA 2MKJA 2PGCA 2ZM6J 2G9OA 1S9EA 3NGDA 3GSIA 3GIJA 2VBWA 2J76E 1IKXA 1EETA 2R7VA 5K5MA 1YLXA 2I38A 2ZHOA 3NNCA 5K14A 3THTA 4Q0BB 3K7RA 2WSCC 1IUJA 2CJAA 3C8YA 1Y11A 3NCRA 5HATA 3ZTRA 4DCJB 2OELA 4NCAA 3MEGB 1JLGB 3V81B 1OQ6A 4RU2A 2KG0A 2OSQA 2HURA 2ZH1A 4YR2A 5DS7A 4OZ0A 1FESA 2R7OA 3NBPA 2XLJA 2R2UA 4ECXA 3KLIA 1A0OB 3BR8A 2QZ8A 4ECZA 4AL5A 1EKRA 3TAQA 1FA0A 1IQTA 4ZVOB 3H4BA 3IMQJ 2DNPA 4IO9Q 2EKNA 4YDXA 3WBZA 2DHXA 4FXWA 2V4RA 3RR8A 1KQKA 4JUZA 2W9CA 1G6BA 2W2OP 3DXSX 4HR2A 5C42A 1S12A 1QSSA 4FKYA 3DLGB 4RX6A 1YJ7A 2VHGA 2WW8A 1VQ5S 2HBZB 2K3IA 5BYSA 5AJ3J 3FSIA 2E9TA 3OW2R 2L3MA 2E1CA 1IM6A 4CDIA 4DR2J 2BRKA 1S1UA 3IBFB 3PJ9A 4TN2A 3CCMS 4IG3B 2G4BA 4I68A 2RH3A 2R7WA 2R8IA 5F9LA 4C4WA 3FSXA 1RISA 1X4HA 2XMTA 2YNIB 3KXDA 2D7SA 3CDBA 1VQSA 2IYGA 2J0SD 2QGFB 4DR5J 4TU9A 1Z2LA 2QT7A 1TL7B 4DX6A 5JUMA 5KFPA 2UV8G 2VDHA 3JAMY 4UQTA 4DFJA 3D66A 1UVNA 4KV8B 3K59A 2HVZA 1P1TA 2MY8A 4L3NA 2DCLA 4NYPA 5HP1A 3DRRB 3KG1A 3BPDA 3SBMA 1UFKA 3S8SA 2VH7A 4C98A 2MGZB 5DG8A 4CIOA 2GVZA 3G8SA 3KJFB 3EZOA 3C15B 1IBMF 3GV8B 2K2PA 3IS9A 2N3OA 2Q6BA 1S6PA 2ZD1A 2PC6A 2J0WA 3HJFA 2FHKA 2H65B 3DHWC 4NPOA 5DZ7A 2Q3PA 4OHVA 4ZVGA 4KBIA 3OXLA 2XMAA 3DN9A 2XMWA 3QFWA 4CO3A 1OJ4A 1S5ZA 1SH0A 2ZH4A 1X5SA 3RU0A 1T03B 1M5OC 1ZM4A 1ZAXA 2B4VA 1NH8A 2O1PA 4QIEA 1YBUA 3M8RA 4PYAA 2QMUB 2XHCA 1K47A 1MN9A 2KDOA 3WIUA 2P6TA 2A6OA 4G3IA 4WZQA 3FDSA 3LGMA 2IM1A 3ADAC 1YTYA 2YWFA 3FC9A 4HKQA 2BJ8A 1RTJB 3LQVA 1M5PC 2LFVA 2WW4A 5B0AA 2ROEA 3DU6A 4C3MA 2BABA 3FCVA 4JI1F 1IKWA 2GQQA 2KXFA 2UXBJ 2H3EB 4ZS6A 1HI0P 1BC6A 4NXMJ 2OAUA 1X60A 1ZOTA 3D1OA 4XPCA 5GAEU 1RHMB 3HMJG 2W7OA 2AMCB 2V6AA 4WP9A 1C0UB 3CDUA 4NXNJ 4ED7A 1MWQA 5IM0B 3SI8A 3GP9A 1Q53A 1VLYA 4M5MA 3D0IE 1S1WA 2PI4A 1BQNA 3MPYA 2XMKA 4EBCA 2OJ3A 1YGYA 3OLBA 1R0BG 4P73A 5C2CA 3KLHA 4OX8A 2HFVA 4A8WA 3HM9A 3L7PA 2LQBA 4AT1B 5L1LA 2VBXA 4WPAA 2RHSB 1TKTB 4YB5A 4R8UA 2ZNZA 2R42A 5LSOA 2ZITA 3R5JB 1XMOJ 5H9FK 4DN9A 1KN6A 2EEYA 3K2YA 4G1PA 3CCVS 3MPWA 3GCXP 3FVYA 3MM7A 3N79A 3R2CJ 3HHLB 2RDIA 4HHJA 3BQ0A 1LWEA 3TUPA 4MMOA 2A1BA 1NPKA 4DL4A 1UVIA 1FJGF 1D1UA 3BGOP 2MHNA 1LW2A 1NLKL 1NM2A 3OLAA 4N47A 3IR5B 1XR6A 2OLWA 3IAM9 1VBKA 4WYLA 2BOPA 4QYZJ 2QMWA 2W8KA 1RLDA 1F5AA 4TY9A 4B3SJ 3D54A 4X2BA 2CPYA 1ULRA 2DTJA 1EHWA 3E51A 5EN1A 2CQDA 1KVKA 3D6TB 4DZ6A 4DR1J 1FXLA 1VR6A 1YRUA 2EG1A 5J1NA 2V9WA 1HHTP 5KT6A 2M8DB 2XTJP 2ZZNA 4KSEB 5IT9U 4A8QA 3C19A 2W2QP 5D78A 1RLCL 1EIYB 1UPMB 3H59A 1M1KT 2BDPA 2DH8A 1OSCA 5AJ3F 3OJSA 1JLEA 2DPIA 4FF2A 5AE2A 3UDCA 4OHZA 3UN3A 4EU0A 3GG1A 3NCPA 2SXLA 3SQOP 1HBOA 4NYZA 3IG1B 3LGNA 3TQEA 1IR0A 4OYAA 2CAJA 3IG1A 3Q83A 4PUOA 2C3YA 4C8MA 4PUOB 1KSPA 2AJ0A 2YKAA 1WKJA 2UUTA 3TARA 3CXCR 3FMWA 3DHXA 3PW0A 2VA2A 4PG5A 3PHTA 4BC7A 3GFXA 2XGQA 5D3GB 3GLJA 3CNQP 3ETMA 4OI4A 1RWXB 2ZOMA 4MTPA 1O0PA 4NLRA 1JKHA 2HWIA 2LP4A 3D1HA 3NOCA 3MM8A 4I2QA 2VG6B 4J9VA 5K8OA 1N33F 1HBUA 2J6SA 4EUVA 3H98A 1TAUA 1YIJS 1C0TB 3MMAA 1WOPA 2FHOB 5G0RB 5D0EA 4U95A 3J81U 1JXEA 4YFUA 4O0IA 2HHHF 3V81A 3VR1A 4LF9F 4OYOA 3FEZA 3H2LA 3HHEA 1RHUB 4F4YA 4DFKA 1S59A 5K14B 1KQGB 2MLXA 2MKKA 1ZTWA 4EBEA 1S9FA 2X1FA 1PCAA 1WG4A 3R5AA 1HNXF 1JLAB 2DITA 1RBLA 3BV8A 3I31A 3VGVA 1RT7B 1RCXB 2YH0A 1F6TA 2DY9A 1TKDA 3EXCX 3ZXWA 5M2RA 4YOEA 3W5YA 5IV3A 2IY5B 3FFIB 3QO9A 1B4SA 3MM5B 3OTOF 3JSBA 2HHWA 2NXEA 1RZMA 4K59A 3F0NA 1QY7A 1CQMA 1EP4A 3GZ7A 1CJKA 2J9DA 1N5SA 3QLHB 4ETZA 1BHNA 2PMZD 4CZCA 1A9NB 2DD8S 2WSEC 1OIAA 3ITHA 3GQCA 1DFDA 5I3QA 1FNMA 3W65A 4K2XA 2F7VA 1P27B 1YVFA 2EI5A 3CO0P 5IWAF 2WOMA 4N7TA 3DXBA 3QO9B 3TWZA 1DTQA 2M8HA 3ENVA 2E5HA 2FVRA 2DNYA 1R8PA 2ILYA 4DV0F 3ISNC 5HMWA 3AAWB 1UP1A 4AXIA 4DOZA 5A6WA 4QOTA 4JV0A 3CMES 4MAKA 3W63A 3PKYA 1WACA 1Q95G 3BGUA 2DNZA 1RUSA 2FVCA 4FNHA 2VB6A 4ANDA 2WZ1A 4DS5A 4CLSA 4FN5A 4MK7A 4B3OB 4FXVA 3JXOA 1TK5A 2HLTA 4AXJA 1CS4B 5AXLA 3JTPA 3Q23A 3AQPA 4NEZA 3M4XA 4DV5F 3KJVB 3HHLC 1MWYA 2MQ8A 1C0TA 2IRYA 1SV5B 4ZLPA 4KGXB 2BE2A 2BW7A 3CDEA 4EWTA 1S0MA 4WFNQ 1V3ZA 4EO6A 1S1VA 3CO9A 3D2WA 4F4ZA 2C2DA 1Q1KA 2ZBRA 3EVMA 3E2EA 3F44A 3LP1A 2QLJB 4QU7A 3RBXA 1OWXA 1FE4A 1HIYA 4DR4J 4HL9A 2HQGA 5D4OA 3UDLA 4Y65A 3E3XA 3B82A 4Y2IA 2RRNA 4LVOP 2VICA 1K1SA 3LWLA 2EFQA 5J2MB 4KHMA 4Y0FA 2KJWA 2UXCJ 2MTLA 2M5YA 1X4CA 2NR0A 3PRVA 2CNLB 2R7XA 3SSSA 1HBOB 3O1LA 4ICLA 2ZHBA 4UOGA 4GO7X 1IWAA 1JX4A 5ETTA 1HQUB 2OUGA 2DNKA 5E33A 3WDOA 1FHTA 1REGX 3MAAB 1RTHB 1V6HA 1KOHA 2E1RA 2CQHA 3Q86A 2G0CA 1HWLA 3K5PA 4NLTA 4TXSA 3RYLA 2HAIA 5C42B 1O6XA 3CULA 1EX8A 4U6PA 1T9VA 2ZDPA 2FB0A 1FEHA 2WVDA 3H90A 4DUZJ 3AD8C 1XIQA 2B43A 2ZH2A 4DX7A 3OHAA 2HHTA 2DNHA 2BJ1A 4DPOA 3NWGA 1ZM2A 2JSXA 3JQKA 2JRSA 5HQLA 1M5VC 3HVWA 1REVB 1X31C 3NAHA 4L75A 3KLIB 4HLBA 3OVBA 4ZK7M 4YUDA 4Q2MA 5K9FA 1NK0A 5JJBA 2M0GB 2DR8A 4DQQA 3KFWX 4B08A 1KOOA 1MU2A 2DXDA 5L38A 3G6YA 2CNKB 2ZZMA 1TKZB 3Q8VA 4ES1A 1DQAA 4E2FB 2KI2A 2LXIA 5IS2A 5FJ4A 4F3MA 4LIRA 1N88A 2BZ2A 1FJGJ 1ZZNA 1HMVA 5EX0A 3RBDA 1SXLA 2Z30B 3KHRA 3T1YJ 2WB1D 1LW0A 2ZC4A 2PA8D 3VF0B 3V4IA 3BF4A 3NS6A 2QLWA 3GYGA 4U7UD 2E7VA 3M32A 2WVFA 5CHCB 5E5NA 2W2MP 1HLWA 1CS4A 3DDNA 2HNYA 2LVWA 2RSQA 5KG3A 4ED6A 1N8RT 3L09A 1L3UA 3HSJA 5H9FJ 3PKMA 2H1YA 2F65A 4I7FA 1OSDA 3KHHA 1RGVA 3HHKA 5ITHA 4K4UA 1GX5A 4F3QA 1U45A 4UZCA 5J2NB 5KFLA 3R8YA 2IDEA 3BREA 4C2MA 5ETLA 2AEFA 1VC0A 1ZH5A 3VGTA 3RB0A 1JLCA 1NAQA 4RBVA 3W9JA 2Y8WA 2XSJB 2PD1A 1EZZB 1KFDA 1R6YA 2ILZA 2MQOA 1WELA 3V6JA 4LFCJ 3OL9A 3P96A 2FUG9 2AYEA 3C14B 4U8YA 4J9RA 3D6FB 3UCZP 1HR0F 1HQ2A 1KLMA 1RTJA 3AB2B 1RAFB 3GB0A 1UEUA 2W4CA 2K3KA 3ISND 3T19A 3BSCA 3MHYA 2E5LJ 2B6AA 3K5OA 2QTWA 2I6WA 4CLKA 2WTFA 3K58A 5LMNJ 4W4MA 4NLGA 2KTQA 1P9QC 1JJ4A 3ET6B 4GVBB 4EK2A 1UVJA 1IN0A 2AYMA 3D68A 1XR7A 3E8OA 5AT1B 2KXNB 3RAQA 3CD6S 2PI5A 3M6XA 1NB2A 1S4EA 2H54B 1T03A 1YJTA 2W24A 4LMZA 2DBBA 1SKUB 3L3CA 5KT7A 2BKPA 3FZBA 3MM5A 3HO1A 3TUZC 3PYFA 4WFZA 5LOQA 4CTAB 3SXLA 1WI6A 4E98A 1TL1B 2FZCB 2XZWA 1E6YB 4O3NA 5L1JA 2J8AA 3EPIA 3OSPA 2MGZA 5C24A 2DR5A 4ZKAA 1WF2A 2EK1A 1RT7A 2B51A 2HQFA 2MSSA 4G1QB 4Q2LA 5H1SV 2W1BA 4X4TA 4TNOA 3T6JA 3TA1A 1S6QA 1OYDA 4LUBA 1XBWA 4P2XA 4TVAB 2UVUA 2FC9A 3CIMA 1X4EA 4ZIWA 4FYYB 2VQFJ 2LYVA 1C1BA 3POTA 1YJ9S 2YNIA 2XYPB 5CCLA 2F5GA 1Q8IA 3MR6A 2OP5A 1VHFA 4OFZA 1U2CA 4ECSA 3I4PA 3K8VA 4NLQA 4RBTA 5CD4H 1SKSA 4KIAA 2YPYA 1RHKB 2GS8A 4I2QB 2AYGA 1H6KX 2FLLA 1FJ7A 2BJEA 4FS2A 2X1AA 2B9YA 2HS3A 1I5OB 1U8WA 2F1FA 3A13A 2J6TA 2UU9J 3FKBA 3H42A 3L95X 3MM6A 1X9WA 2J6UA 2AW0A 1KTVA 3KLEB 2IA0A 3SCKE 3KLEA 4B9TA 1ZM3A 2R3VA 1R6VA 1PYOB 1VC5A 3QAUA 3JS9A 1FJEB 1CLFA 4JI2J 3RB4A 4FBTA 1WTFA 2ZOGA 4M5NA 4FKXA 4NMXA 3MAAA 3BSNA 2RB7A 3NMRA 3NGRA 3OFHA 3V6KA 2Z4PA 3H7HB 3RAXA 4CLUA 3QGIA 2V8VA 4K2JA 2FZGB 3ZNUA 1WI8A 4CO2A 1QAJA 4ICLB 1R27B 4LF7J 3N9UC 3KYLA 5HK4A 4X66J 5IXUA 5HJYA 1RWNB 1NSAA 2VBZA 5ETPA 5BYRA 4CH7A 3QBCA 2V5HG 4A8SA 3T5KA 4J9OA 7AT1B 1IKXB 2LU1A 1NJWA 2RD5C 2DIUA 4J37A 4F0HA 3P49B 3LOUA 3LP1B 3VZIA 4ZIVA 2H5JB 2CJYB 4A8XA 3CSKA 4E0DA 2KYXA 3DC2A 4I2PA 4PEOA 3G8QA 4J9QA 2CNOB 3J80U 3DRXA 1DZ5A 1D8YA 2DEJA 1VS3A 3I96A 2CVEA 2Z2ZA 4L6V3 4B3TJ 2AZ1A 4DXLA 3T1HJ 2DIVA 4DWIA 2EC0A 4JI8F 1U6FA 4QIWD 5GVQA 2E9RX 2MKHA 1LWCA 3TZZA 3CTRA 2V8GA 1NK4A 2D74B 2LECA 3K17A 3A8IA 3TEHB 2PDAA 1AUDA 4QWBA 3A3NB 1ICEB 4LSLB 2H4WB 1WHXA 1L3SA 1JJCB 2E9ZA 4WFAQ 1ZM9A 1NKEA 1XEZA 2GGPB 5KG0A 2XB2D 1CULA 1H74A 1QE1A 1ZZFA 2BV3A 3PYGA 4H4MA 4CYUA 5KFXA 1IBLF 1DTQB 1GEHA 3KUGA 3VAKA 4PXCA 3AQOA 3IBWA 4M8LA 4ZPVR 1NHVA 4LBHA 5A8RB 2M2BA 4KFBA 4OX6A 1D3WA 1HL6A 3FUYA 3ZO7A 1KTQA 1KFSA 2J9CA 3TR5A 3GJTB 1LFWA 1U1OA 2COLA 2PE8A 1BWVA 2VASA 3T6BA 3K8WA 3G82B 2HRTA 1FKPA 1XMBA 4Y00A 3BJYA 2RUSA 4RKUC 4RW6B 4KHPF 2GO9A 3LUYA 5I3UB 1EP4B 1SJRA 2QA2A 3M8QB 1WORA 2U1AA 4OLOA 3DOMA 4A8KA 1UEVA 1ZYQA 2VFUA 4RL1A 4ZVPB 3RRHA 4JV1A 5A8KA 2HRYA 4B9VA 1Y9OA 2LXFA 2Z56B 1FERA 3K5LA 3V4IB 3DOKA 5H9EK 1LWCB 4F2SA 4O4RA 1IXKA 4DG1B 3GIMA 1JB0C 4K4TA 3HHLD 3SCLE 1TKZA 3TP2A 2ATLA 3BN4A 2HS4A 4YEAA 2QL7B 4OZJA 4NOHA 2HHHJ 4LF9J 2ZKUA 1NH7A 4GC7A 2MMYA 4E8UA 3BGLA 3IRXA 4RNHA 4UT4A 1Q86T 2FJWA 3MOZA 3PDNA 4DL7A 3FBBA 4FS1A 2RILA 4URSA 4ZLNA 3PIPQ 5HN0A 1N34J 1Q82T 1KONA 3M8YA 1N32J 4C9DA 5H9EJ 2ADCA 3K89A 3MR3A 4F4WA 1HWKA 2ZKTA 4KT0C 3PVXA 4QWCA 4DSKA 5EWGA 2YNFA 5HROA 4RWWA 2JFDA 2KT2A 5LSRA 2MKCA 3NP5A 1B0TA 3W60A 3N01A 2M88A 2WVCA 5KFRA 2JNJA 3ENAA 3QZ7A 4R0JA 4DR6F 1H2VZ 4YQWA 1FF2A 1XK8A 3CJTA 4IQMA 1FRHA 4JI2F 2N82B 4FYVB 4F7VA 3O2IA 4DR3J 2CWKA 2R2RA 2I5JA 4JI4F 4FVMA 1HD1A 2UV8A 4C97A 1S1XA 3QT7A 4ZPBA 2PT0A 5DG7A 3JB9k 1QLNA 1YBTA 3G9CA 3U27A 4OZNA 2F8MA 3UN5A 1J5EF 2V68A 3TX0A 1WKKA 3HVTA 4KB7A 1NK6A 3M9NB 1RP5A 1H72C 1U8SA 1WKLA 2NYIA 1F5CA 3E01B 2R9LA 1U1NA 2DNNA 5GADI 1YKWA 2AV5A 3R2DJ 1C2PA 2ZUGA 4YS2A 2QYCA 4DV0J 1I3OB 4TKTA 2GV1A 4UW2A 4N41A 4ZCLA 3TAMB 1PYSB 4TU7A 3R7BB 1E6VA 4F4AA 3UW1A 2DPJA 2FY8A 1LQ9A 1VK3A 1ZPWX 2MZRA 2XI2A 3PW4A 3MI7X 3S01A 4DV3F 2DGUA 3KKFA 1K44A 2CPFA 2D1CA 5I4MA 5DQGA 1RE1B 2QFIA 3AOBA 3I6PA 3FJ2A 3JTNA 4UUXA 1RTIA 2CQ2A 4F4XA 1PC4A 3OT9A 1OPZA 4XO0A 4USUA 2C3PA 3PW7A 1C4CA 2MLYA 3HPOA 1SVDA 1GK8A 1TELA 3MM7B 4J9UE 4C0BA 4KYZA 3LP0B 4DG1A 2ZUAA 2XCAA 3CMQA 3MEEB 4H4KA 1NMEB 2Y3YA 4OX9F 1QAXA 2ZBQA 5D0HA 3KTQA 1TKTA 3ET6A 2NPIA 1RHJB 1SC3B 2XYGB 4R0EA 2B6AB 3LALA 2F8EX 3DOMB 2OO4A 3MCMA 1RT6B 1XNRJ 3HVRA 3T5JA 3A8EA 2YQ1A 4X4VA 4P10A 1G3OA 3MXHP 2QL9B 2EFPA 5CYJA 4LF8F 1AXQA 1U1KA 4GVBA 4NXMF 2B8PA 3G82A 3MZIA 1VRTA 3M8PB 4M5JA 4TLQA 2UXDF 3KUHA 2F9DA 1W2BR 3TUIC 1WEZA 1Q8KA 3MTJA 2YNGB 1JLCB 3CC7S 4IRKA 2DKOB 4JI1J 3RUBL 5ETOA 3NWRA 4RJVA 4FBUA 4LF6J 1HYSA 4F25A 2KFZA 2ATCB 2R4FA 5LSLA 1CULB 2RIJA 3CJ3A 3IXQA 3JSYA 3P45B 4AUKA 2N3LA 4PG8A 1NNDA 1SBRA 4LBIA 4LRCA 3KK2A 4DL3A 4OYZA 4TYBA 5F0UA 2KH9A 4LR8A 1FX2A 4NA3A 5ETSA 3HT3A 2WVEA 4K7QA 3H5YA 1AYEA 2ZH5A 1TR0A 3PX6A 1XNQJ 3MMBB 3TNVA 1ELOA 4NZ7A 4P6QA 1RU1A 2VUGA 1Y10A 3A3OB 4USTA 4D3GA 4O23A 5CCMA 2CG8A 2W8LA 3W8PA 2XY5A 3D4JA 2P9EA 3W2WB 3MCNA 5KAKA 3OPKA 4EYHB 2KHCA 4V1Ak 1HNVB 4NA1A 2R2SA 2ZH8A 2ZH3A 1N5TA 1B7FA 1UZDA 1S1TA 5GAGI 2VKRA 3SQGB 3UI3A 4GVLA 4B02A 1I6JA 2UUAJ 2ACMA 2VBYA 3M7VA 4OJ3A 5F41A 2XY7A 1S0OA 4NWBA 2K06A 5J2PA 3W3SA 5HP1B 2AGQA 4ZCMA 2P6SA 4X4OA 1DQ9A 2OI2A 3GYXB 2QC3A 4ZP9A 4DR1F 4M5HA 1TL7A 1OQ3A 1EAYC 2VD3A 3B6BA 3I5CA 4PG4A 2ROPA 4ZCIA 4QCLA 3OHBA 4B3SF 2C22A 1U4BA 1CEZA 4J90A 5IQQA 2DR6A 3DRPB 4P7TA 4CP5A 1A6LA 2XC9A 1C4AA 1VDHA 1RT3B 3OUYB 2VQFF 2OHDA 3EGZA 3AHPA 4JI4J 5C25A 4WFBQ 2RS8A 2E1AA 4WIIA 5K20B 1NUEA 3IA0A 2GVDB 2LQ5A 3FBCA 2W4PA 1XR5A 4NLVA 3WIVA 2B8QA 5F8LA 3G6ES 2FHMA 3HHDA 1YSJA 3NS7B 3DLGA 2V94A 4AD6A 4NLDA 2C2OB 2MJUA 3HJVA 4NLPA 5EDWA 3J7YU 3MF5A 1N33J 3D6MB 1WD6A 2BKNA 3QIPA 2LDYA 5HI7A 3UPFA 3PW2A 3G2XA 2AJ4A 4LT6A 3VAMA 4WU3A 5J2PB 5DQIA 3RTVA 4V19X 1JNRB 2D3O1 4B3RJ 2DK2A 4I64A 5J1EB 2F3JA 2WB4A 1S1TB 3NOGA 4NASA 3C46A 2K8GA 2OD6A 3BM7A 4Y6IA 1FFSB 2BRLA 2VC0A 1KD1T 4IRCA 2ZBCA 2LDIA 4ATNA 1N56A 3ZNJ1 3CUNA 3QT8A 4JI7F 4HT7A 1NDLA 1JMTA 3QRPA 4Q7AA 4U9RA 3CDAA 1HR0J 2D3ZA 4DEZA 1FVSA 2HBQB 3LO3A 2C2RA 1WHVA 4WTOB 3BYPA 3ILJA 2UVWA 4C8OA 2CWXA 2GHWA 2WAQD 4CLYA 1JXLA 3R27A 3H40A 2VV5A 1CC8A 4WF9Q 2HG4A 4I56A 4ECUA 2IBOA 1UEKA 2A0FB 4TLRA 4USJC 2AP6A 4OI1A 4BLGA 2ZH6A 2YKMB 3US5A 1TVRB 4KPCA 5IQ6A 1QVGR 2M70A 2MYFA 2R7RA 1HWJA 3NL0A 1KVIA 1FDBA 5DM7Q 1FKPB 3WQPA 1HYSB 3UWTA 3VAGA 2KO1A 3J7YI 2QG9B 4IYQA 2YNGA 4MFBA 2UP1A 4KFBB 2VODA 3D1QA 1R0AB 2F63A 1S7HA 4UOFA 3TJ9A 3DKDA 2KYZA 3ETOA 1DHMA 4PQAA 4ZCKA 2A3JA 4KJIA 2E29A 3MUTP 3GTYX 3M9MB 1CJKB 2X7IA 4LBPA 3D67A 2MLZA 5ETRA 2LLZA 5IFMA 2E1MC 1KHVA 2D3UA 4DLGA 1VBYA 5LXYA 4DF8A 2DH7A 5FLXY 4XDDA 1U6ZA 4LSLA 4Y2AA 2QLFB 3BO3A 4I67A 3CE8A 3EZUA 2DGWA 2KZZA 1Q7YT 4Q5VA 4KTQA 1GMUA 2IPOB 4P75A 1TMMA 1SC1B 1VFJA 1X4FA 2BJ3A 5LMUJ 1YJUA 4ZJLA 3OFEA 4OJHA 2ZH7A 1FD8A 3QATA 2Y0BB 4HACA 2HIYA 2Z57B 4YY3F 3Q8PB 2IDLA 1UWBA 2YNHB 3GR0A 3ZTQA 1H3DA 4NXNF 3NNHA 1CSJA 5EX3A 2AJ2A 2U2FA 4CO1A 4QBUA 1ACMB 2A10A 2EVZA 1YJWS 3BPSP 2Z2MA 3OSNA 1K8AT 3RAMA 3M32B 2JFKA 4FZVA 1GNKA 2MEWA 1DQ8A 1YJVA 1XERA 4GO5X 5A8WB 5F0WA 1MWZA 1RAHB 2L9WA 4K8RA 1B0VA 4DSIA 1AZSA 1S77D 1CPZA 1OS5A 3KNGA 2GQCA 2DGSA 4PXBA 2VA3A 4HI1A 1RA7A 5KFQA 2ASJA 3G96A 3QGGA 3VAIA 5F3TA 3Q8UA 1VHIA 3P5BP 3D6HB 2BM0A 1HBUB 4QW8A 2QL5B 2ZOFA 1IKVB 4JP8A 3OVSA 3H4DA 4Z7YA 3HT0A 3LA0A 5M2UA 3T5HA 5I42A 1SL1A 3DRYA 3NEKA 2HGNA 2PFDA 3CDWA 1HNZJ 5B0DA 1VRUA 2E1PA 3QNWB 5IT4A 4ECYA 3SCJE 2IBKA 4LFBF 1N5YA 3PJXA 2DXEA 1V3RA 1B99A 1A7GE 1RWVB 1UMJA 2EG2A 1RT5B 4WK1A 2EFVA 3ULHA 1P6TA 4C7QA 1S7IA 3MD3A 1QDUB 4IQXA 3T1YF 1UVKA 3LGHA 4W92B 3DLJA 3HLUA 1PBUA 5DGBA 1HA1A 1V5IB 2CQ0A 4EO8A 1TK0A 2MZJA 3I5AA 1XQIA 3ZZPA 5KFEA 1NHUA 2DVIA 1KEKA 3M1VB 3IP0A 3W66A 2GVDA 1SPBP 2C2NA 1IKVA 1UWAA 2KRBA 1G1XA 5T14A 3MCOA 1D9DA 2BE9B 3Q8RB 1U1RA 3W5ZA 4U8VA 4ZDNA 4UY85 1ZA2B 4DV6J 2KFNA 3VCDA 4WXWA 4MKYA 1Y4ZB 1NHKL 3A12A 5KFAA 8AT1B 2B5JB 2PN6A 4CCHA 1JLQA 5CYQB 3R6LB 5KG2A 4B9SA 2DO4A 4OHXA 1NEEA 4ILRA 1GX6A 4WWSA 1UCNA 4G1QA 1S9EB 3HHLA 4DR3F 3QJJA 4WYWA 4O3RA 3KJNB 4KRWA 3HSDA 3PY8A 1SV5A 5D4LA 3MM9B 2IYIA 5D6GA 3GE9A 4EZ6A 4IUFA 3C2PA 5KTQA 1PC5A 2APOA 3W9IA 5GAEI 4HEA9 1RT1B 4HT5A 5ETVA 4DQRA 5FDLB 2VDIA 4F0MA 2XWXA 5L39A 2JL9A 3R7SB 1S1WB 3LPYA 2GIFA 4CQ1A 5A6PA 4WXOA 1VISA 2XMMA 3I5BA 4FDFA 4NYOA 4CH1A 3GV7B 2AT1B 4DV7F 4KO0B 1NDKA 2Y1JA 5F8GA 1PAEX 2AWZA 4DU8A 3NGUA 4G6VB 1T02A 4URQU 4JV2A 2Y9HA 2UU9F 1KVJA 2VU5A 1BQXA 2NUHA 2XYHB 2B9EA 4WJBA 2CQGA 2GGPA 3GJSB 4K4XA 1P1LA 5AE1A 2HHSA 1VQYA 1MROB 3OJUA 2GHPA 3W1YC 3PIOQ 2HIQA 2Q79A 2ZE2A 3MEDA 3M8SA 2RRAA 3M8PA 4FF3A 4AE5A 5CZXA 4NLSA 4W98A 2YPZA 4DPTA 3OVAA 1PO6A 2FJVA 1LKZA 3P4UB 3QLHA 4MYTA 1VBZA 4B9NA 3OTCA 4IOAQ 4OYMA 1YHQS 3LP2B 4KR0B 4NZ6A 3R97A 5JVHQ 4B3RF 2RKIA 4TQRA 4OZLA 3CJQA 2JEJA 1K1QA 3FQKA 1BLUA 1CBKA 3BKUA 1S6PB 1VQMS 4OQJA 3DLEB 3U1NA 4LF1A 5J2QB 3DDIA 1WC5A 1U1MA 4H54A 3UD4P 1R3NA 3O8WA 3N0VA 1FKAF 5F8JA 2V4JA 2ABYA 3DU5A 4QR2A 1JLAA 3GIRA 1MU2B 2BEFA 2H5EA 2RRBA 4ZVFA 3R1LA 1HQEA 3HKWA 5J1PA 3OBIA 2PSZA 2MKSA 4AQYJ 1D09B 5DLFA 5FD1A 1U1LA 4JI0F 3HXMA 4WKRA 1REVA 2C42A 2J8SA 1BY9A 1J27A 4HI2A 3W7BA 1T11A 2QX0A 4CLWA 4NA2A 2FY1A 1SIZA 1KP6A 4ZJOA 3SFUA 3QIPB 4J9MA 3SV4A 4K4ZA 2BQ3A 4RWXA 4TY8A 3TAMA 2HW3A 2UUWA 3PRBA 5E0OA 3DI6B 4QWAA 3MM8B 4DQSA 2CPDA 1AFJA 3QMQA 4L3KA 2BX6A 2W9AA 1QSLA 4F8RA 4PXDA 3UE2A 3KLFB 5D3GA 1RTHA 1YITS 3C3LA 1F9HA 2GJFA 2GMJA 3R3TA 2NSBA 4KQZA 2RQCA 2V2ZA 2CQPA 2V8PA 2HEKA 2F8HA 5M2PA 3GFHA 3R7NB 2HZVA 4ID5A 3ZZUA 4JI5F 1HW9A 1EQMA 1HPZB 2DXFA 2WRMA 3MM6B 3M2VA 3X3UA 5KFWA 4DSFA 4UZBA 3K5MA 3UDVA 3CD0A 2F4FA 1JLEB 3ENWA 4A8YA 3SZ2A 3WC0A 2L41A 3UQSA 1XMOF 4ER8A 4PPZA 5DDPC 1Q8LA 5HMXA 4F02A 4X66F 1WDTA 1XNQF 1U25A 3KDOA 1DAXA 1N0UA 1TAQA 4QJVA 3MEGA 5IZHA 5DDOC 2CG4A 2XHWA 2CPZA 2KRRA 2YXLA 3GMGA 3H5SA 1V9OA 2YWWA 4KAIA 5KG6A 3ZZYA 2W9BA 2FD2A 4TY8B 4HDHA 2OEMA 3CCSS 2I2YA 2V0NA 1VBXA 1NK9A 1KC8T 1MLAA 4OZ2A 5AXNA 1LWXA 3GFYA 2ZDOA 2ALYB 2MQLA 2X1BA 5KFZA 4AL6A 1S0NA 1T94A 4JI5J 3QJLA 4OL8A 5DETA 3D0GE 3IFEA 1YX2A 1LW2B 4ZVTB 1NJZA 4PRFA 5ETMA 3A4TA 4DV5J 1RAAB 3MMBA 3RJMB 3DMJA 2MQMA 3CEDA 4CTAA 4IFVB 4LSNB 4GKKF 1FE0A 4YR3A 1HFEL 5A2QU 3MPUB 4X65J 3L4BC 2P9GA 2ADBA 2ERRA 1VQ7S 1RTDA 4B3MF 1FTRA 3KK1B 3SSRA 4KY3A 2HFZA 3CCUS 4BDPA 1VRQC 2BACA 5DM6Q 1N4LA 4ZVUB 3DOKB 3OXFA 4ZN1A 4RNFA 3GFZA 1Z2ZA 5KT4A 5BXIA 4ED0A 1NJXA 1LK5A 2YKPA 2IIHA 4A8MP 1D9AA 4DI6A 2HVHA 3H2VE 5HLFA 4J9LA 2D9PA 5HVFA 1CJTA 1RBAA 4ZPTR 1C1CA 3LANA 1WF1A 2KVIA 2HRUA 3EE3A 3MPDA 4RW8B 4DV1F 2UUAF 3QWUA 2H5IB 4M5GA 1EQ0A 2HNDA 1SJQA 5B09A 2L9NA 1R89A 4DUYF 5KG4A 2UVRA 3W62A 4DUYJ 1IBLJ 1JLFB 3R5BA 4X62J 4LFAF 2OEKA 5DDRC 2C2EA 4IDKA 5D4NA 1WWHA 2MZSA 5J2NA 3RBEA 3OTOJ 1TVRA 4QIGA 1BQMA 1R31A 4KPYA 1QTNB 3N4WA 1XMQJ 4S0MA 4WZMA 1CJUA 4WE1B 2BMBA 2KT5A 1RWPB 4OYBA 1UZHA 1RXOB 2V67A 4USWA 4RNMA 5KFDA 1DRZA 1U49A 4ZPAA 2H48B 3OR2B 4F26A 4A47A 1Q16B 4WTYA 2RU3A 3OFGA 4A46A 1NU4A 4WP8A 3LF0A 5CH7B 2ASDA 1HNXJ 1RT1A 3MCSA 3OTBA 2XO6A 3CCJS 5KG5A 4U7CA 1ZAWA 2HFOA 3ONQA 3I4HX 1E6VB 3MM9A 3NG8A 1HI8A 1N36F 2RT3A 3PO5A 1AB8A 4ZPDA 2DRAA 5EHHA 4FYDA 1LWFB 2X3DA 3GCWP 3GWCA 4HTIA 5RUBA 2MQPA 4X4PA 2OH2A 3CJ2A 1V5VA 4QW9A 2RJZA 3QT5A 4KV8A 4UTGA 5AXKA 4CWBA 4EFAC 2OPPA 5E41A 1N5QA 4OX9J 1G4CA 4PPDA 4ALZA 1U2RA 2C3UA 3CF5Q 1N32F 3QT6A 1UL3A 1N0VC 2FJAB 3CB4A 4RUAA 2ZEJA 2B9XA 3HFZB 4F04B 2FLNA 2AD9A 2R7TA 3M2UB 2RF2A 2OKQA 3TJAA 4OZ1A 2B3TB 4DUTA 3H5XA 4PQUA 4YP3A 3L9ZA 1S1UB 4ENOA 1U48A 1HQUA 4O3SA 4RW4B 2ZHAA 4MKVA 3H25A 1DLOA 3BZQA 4NMLA 5CA5A 5D8HB 2FGCA 3ILIA 2XI3A 2NXCA 3L7UA 5C7PA 2L08A 2R7QA 3VV2B 1VQOS 3N6NA 2XY6A 2HVEA 1RHRB 3UCGA 5LJ5Y 3VQSA 1VQ8S 2LMIA 3FSYA 2DNLA 4CO0A 1WC1A 3RZAA 4J7CA 3CCES 2AHOB 4N56A 2FHJA 1JIHA 2W2NP 2F40A 5CZVA 1GFWB 2Z2LA 4M5LA 3UVJA 3HD2A 3MAHA 4UY8T 1S9GB 2PA3A 2QA4G 5KFBA 1I51B 2GJ2A 1RWUA 2CQ3A 5MAOA 3GIKA 3AA9A 1I94F 3M8ZA 4B9UA 4K4YA 2HHVA 4QR1A 2EK6A 3WX4A 2XGPA 1YJNS 1SJ4P 2XBPA 1HNVA 4XIUA 2CPEA 4M5KA 4RW9B 3TZWA 2V9KA 2IJFA 1HBMB 1RT2A 3C6TA 2V50A 4BWMA 3V5RA 4PWUA 2ZH9A 2R8HA 3C6UA 5MLCV 1OY9A 4PG7A 2X51A 2DJWA 2HVIA 2D9OA 5F9NA 3LAKA 2RQMA 2KZMA 4RO0A 5GMKa 1U02A 3G8TA 4WE1A 4DN0A 5F8NA 4U7UK 3QRQA 3KK2B 4JYAF 1W2IA 1QVFR 2ROGA 1PIEA 4WFYA 5E3AA 5B0EA 4ANCA 4DPWA 5CD4A 4TQSA 3QZ8A 3BO4A 2EFOA 2F9JA 4I69A 4ED5A 2NXNA 5IM0A 4HACB 1SC6A 2XWYA 3VAHA 1M1HA 4DV4F 4ED8A 4WKYA 2UVVA 1IJEB 2I8EA 2XMUA 2HSEB 3HKZD 4RNOA 3DLHA 1RQ0A 2BJ7A 4RPFA 1UJ4A 3DM2A 2G2ZA 1FRXA 3EVOA 3TZXA 4NCGA 3ITHB 4F50A 2HQDA 1TV6B 1QE1B 2N4DA 3GJQB 2OFHX 2KVQE 4LF5F 3DLKA 1C1CB 4NLUA 1D8ZA 4K5RA 3KMSA 2UXBF 4LF5J 2OMLA 1DTTA 1FI4A 2EC2A 4C3KA 4N8OA 1IBKF 3JTOA 4N5SA 1Y7PA 5EWEA 3CJKB 2CVIA 2KG1A 2GIQA 2B9WA 4MH8A 4HH1A 3SMZA 1BWEA 4NCGB 4DSEA 2CJQA 4OX7A 3OL8A 5CYMB 2GC8A 3C16A 1EKSA 1EB0A 3JSRA 2KHDA 4ZP6A 2I9SA 2PO4A 4JI6J 1NKBA 2O67A 4JYAJ 2IC3B 2QRRA 2IFXA 4DL6A 3KWMA 2BQRA 2LQ8A 3QSYB 2JEIA 1BMQB 3VTIA 5DGAA 3BGFA 4I7FB 2O5DA 4QZVB 4WIQA 1Z1ZA 2CJKA 1FX4A 2ZWOA 4LF2A 3I9ZA 4FXDA 1JJHA 1KHWA 4OHYA 1F3VA 1HNIA 2GFFA 2FJXA 1B3TA 2HNZB 3CD5A 4IR1A 3J80Y 1T9TA 3O3LA 3QPIA 3O6QA 3W2VA 5KOWA 1WSVA 3O5TB 5IV4A 2NZCA 1RT4A 2RQ4A 1UFLA 3M8WA 5HAOA 4Y2MA 3DOLA 3SV3A 4DCPB 1S48A 3I0RB 1LV5A 1GXLA 1XTZA 2KXHA 5T41A 4DHVA 1OMSA 4DU7A 2G2OA 4R5PA 1S9GA 2BE7D 1WTBA 4DUZF 1R8HA 2C3MA 4BHQA 3N6LA 4ILLA 1HNWJ 2DNGA 3UVJB 3M2VB 5F3ZA 1VIXA 1NSQA 2VC1A 2AF6A 1M5HA 2WSFC 2IJRA 2JX2A 3EGWB 4IFYB 2OPSB 2AZ3A 3BS9A 2W9CB 4M5DB 1I1GA 4DFPA 1R8CA 1SL2A 1IM4A 1X4DA 4KGVB 2Y1LB 4LSZB 2VG5B 5GAHI 3CCQS 3K0JA 2CADA 4HDGA 2NZ4A 1O5JA 2AX1A 3PXGa 4JI7J 2FVPA 2IRUA 3U7JA 5KFOA 3ELHA 4QIVA 2FJDB 2D3OR 4PQUB 2WONA 2B4UA 4O3OA 1SH3A 3M2UA 1RA6A 4C11A 3UR0A 2X3GA 4IO1A 4CLTA 2BM1A 2HS0A 1Q0NA 3W64A 3KG0A 1PJ5A 5F8MA 4ZJQA 5L1IA 1H98A 4LF4J 2DH9A 3DGPA 3KG4A 2YVSA 3OXGA 1OPIA 2BJDA 4OYIA 7FD1A 3I55S 4AL7A 1X0PA 3DOLB 3WHIA 5U47A 2GX8A 2J7WA 3ZZRA 4DS4A 3HF5A 3JYTA 2DHAA 4DDFA 2AKWB 2LCWA 1RT4B 3CT9A 2CQBA 4ED3A 1X4BA 1NK8A 5A0YA 1SCJB 2E5LF 1H73A 2HBRB 4EMDA 2VF3A 3V6DA 3MMCA 4NE9C 2KFYA 2EXUA 5ETNA 1QJHA 4ID8A 2OPQA 4A8FA 4ZHRA 1YJRA 5B0FA 2NREA 5HSPA 2IA6A 4IKAA 1X5OA 4LREA 4J9SA 2DNRA 1NDCA 4DZDA 2MY7A 4URGA 3MECA 4DBQA 1X8DA 1RAOA 3M2RB 3I9V9 3RGIA 3THPA 3ZZTA 5BR8J 1UVLA 4NL5A 1SIWB 1QD1A 3TVKA 1FKOB 4WFXA 3VZHA 2RDJA 2DO0A 2WK4A 3R6GB 2NUUG 2HBYB 1UA0A 5CQGA 2IVFB 3FCWA 2CXEA 4LFAJ 2VZ9A 1L3TA 3EM1A 3J7ZT 3QSIA 1S6UA 4H4MB 2WOMB 3NGKA 2DNOA 1NCLA 2P5VA 4CNZA 5C5JA 2P9CA 3AXMA 1PJ7A 1SQGA 1JLBB 3IM8A 5HQMA 3MURP 2UZAA 1NK5A 4ILMA 4OYXA 2KB2A 2M3DA 4RW8A 4DX5A 2MKIA 1WG5A 1WNEA 2GQ2A 2QE5A 4J9KA 1N52B 5DG9A 2AGOA 4Q45A 4K5SA 2FYXA 3M30B 4IH7A 1RWOB 1KWMA 4ZHRB 3MR2A 2YKOA 4C8LA 1S6OA 3D7SB 4QIFA 4USVA 4O44B 2CQ4A 1U0SA 2Q6CA 3QIDA 1UW4A 2CFXA 2Z0GA 1YWXA 4P52A 4ECWA 4CO5A 2IHR1 2CDRB 2CJ9A 3OFFA 1JK9B 4L73A 1RTDB 3O44A 4RW7A 2BUNA 1VK8A 4OLPA 4ZLJA 2E5JA 4DQIA 1KDNA 1SJ1A 4RBUA 2ALZA 4K4VA 2J5AA 1IWGA 1WJ9A 4R25A 4DX8H 5B7WA 1JQGA 5FIIA 3UN2A 2XULA 4FP9A 3I56S 3LPEA 4DV7J 2E5IA 1MG7A 2XS2A 3TA0A 2VL1A 3AJDA 6AT1B 2Y1IA 2G2YA 1IR1A 4USMA 4USIA 1NZ8A 2CNNB 2RE1A 2XEXA 5CAAA 4K0KF 2BA9A 3QYYA 2JWNA 1JKHB 2JZ5A 3HI9A 2ASLA 5E2QA 3SYZA 3G71S 1SKRA 2LQJA 2BXJA 4G65A 1U2FA 5KFGA 2HMIA 3J7AN 1SL0A 2D69A 4EGLA 2XNRA 4FF1A 3HVTB 2KKHA 1CC7A 2LXUA 1V3SA 1LOUA 4Y28C 1UVMA 2A2DA 2YQ0A 1P9YA 1RT5A 4DPUA 4NLXA 3KHLA 1N5YB 1TFYA 1TP7A 5DJBA 2HHQA 5E3QA 3ZTOA 1T3NA 2DR9A 4ETXA 4OI0A 4ID5B 2DT9A 2J7KA 2HK3A 1RWWB 1CJVB 2XZTB 4C0OC 3I0SA 4F36A 4Z7CA 3BDPA 1GXUA 3LW5C 2J0QD 4C6AA 1WHWA 4DV6F 3CJRA 3IR7B 3F56A 2HHPA 4O4GA 3U1MA 3LAMA 3BQ2A 1C1BB 2FQQB 3H0PA 2CUYA 5T7LB 2YNFB 4L76A 5HROB 2FPHX 1GT8A 3T5LA 1XMQF 4L74A 2XSFA 3WX8A 2OIHA 3KDNA 4MJKA 1S6QB 5KFCA 2QEXS 4OI2A 1IQZA 1LWFA 3PFOA 5EUHA 3RW7A 2AX0A 3AD9C 1RCOB 5E7OB 1T05B 4B9MA 4IR9A 4K4SA 3IRXB 4UOCA 1N6QA 4ERDA 3H8YA 1SC4B 3G6XA 3D9BA 2DRDA 4Q44A 4NI2A 4XDCA 1FK9A 3HDSA 3TRGA 3RR7A 2LEPA 1YRTA 4NRTA 4RW7B 5HVHA 1U1QA 2J9DE 1Q78A 2HKEA 5IOLA 3PJWA 3DYAB 2B4OA 1M1GA 4F67A 2QJ3A 4Q43A 1TMJA 1FWPA 1O8BA 2UUCJ 1Q5VA 3R1HA 4OZ3A 1F5BA 2M52A 4I6AA 2LEBA 5A8KB 4DSLA 2P8IA 2RKIB 3KLHB 4DV2J 4B3MJ 1DARA 1DTTB 2HZCA 1X4GA 2R2TA 3M8QA 5HBMB 1H38A 2EWHA 4PR6A 1N54B 2M4MA 2I0XA 2XMVA 2G1DA 2N7YA 4WU2A 5KFSA 4F4KA 3CJSA 3SDEB 3HCXA 3QRRA 2R7SA 2QSFA 4ZMMA 2F4VF 2NXJA 1RADB 2ZE2B 3MEDB 5LM7E 2ZM6F 1T9WA 3P5TL 4NLWA 2FLPA 1RYRA 5CXTA 1GAOA 3W9HA 3SDEA 3ZTSA 3AY0A 4DV4J 4EI2A 2A18A 5KFKA 1URNA 1RWKB 3IGVA 4ZVSB 4QPXA 1RI7A 2QA4S 1M90T 1X5TA 2FHJD 5LMUF 4C8KA 3TUJC 2XS5A 1TFWA 2DY1A 1URRA 4X64F 5K8PA 3PZPA 2RU9A 1Z4UA 3CVKA 1YQHA 3PYEA 2OD4A 2QIFA 3K5NA 4LRFA 2VKZG 5JVGQ 2GA7A 3BSAA 5HANA 2L9DA 5D15A 4QWDA 5FDLA 1Y5IB 2VFVA 4YN3B 1HBMA 1RT2B 5ADZA 1IBMJ 2R8KA 2G1HA 2GJIA 2RVJA 4IH5A 4CT9A 2H4YB 1VLOA 2CPIA 4Z2XA 3KLGB 2ZJQQ 3C15A 3K57A 1K0TA 3UD3P 4C3LA 3QAEA 4CNYA 2ZC3A 2VG6A 2OTLS 1ROFA 4IH6A 4PYDA 5A0YB 4XPEA 4KH1B 2GO8A 3GIIA 1Q81T 1IKYA 1JJ2R 4IRDA 2POKA 1FD2A 2DB1A 2JLEA 1R0CB 4I1TA 2MPUA 1MNEA 3BH7B 1RK8A 3Q2SC 4QYRA 4NZ0A 3IBCB 5HMYA 2VONA 3EGNA 4DCOB 3MFHA 2Q1LA 1F1BB 1RTZA 1RABB 2BW2A 4JV5J 4USHA 3CCRS 2FIUA 1FTCA 2HWTA 4X84A 1RJJA 5DZ6A 4DR2F 4RR5A 4C11B 3PEJA 3BBFA 4OJ1A 1LXNA 3OV7A 3H20A 4NCBA 2OTJS 1T9YA 1WDDA 2VPWB 1FXRA 3G87A 1UA1A 2XZDB 2PMHA 2WBRA 2V8HA 2VOOA 3M05A 2RF2B 3B4MA 3OTDA 2B0GA 2BYCA 4ZP8A 2YY3A 4X4SA 1FT8A 2JOQA 1T3OA 2ZFHA 4P7VA 1NSPA 1U6BA 1FXDA 4M1KA 2EFGA 2OPSA 4LF4F 4Q8FA 4LVNP 1S57A 3OD2A 2HMIB 1VGYA 2E7XA 3FK4A 4LF7F 2JDJA 2DNQA 1TL3B 2EFNA 3KUEA 5DO2A 1WOOA 3UO0A 4ECQA 3RBZA 4UQGA 4DJBA 4R5PB 2QLBB 2CJXB 4NLYA 1BUXA 3T9NA 4P2FA 1MMNA 5KFMA 2H51B 3T1AA 5KFTA 3UR3C 1N34F 2QYGA 3NXZA 4ZP7A 1N36J 2VFSA 3GR1A 3ISZA 4PKDB 3NNAA 2FC8A 2NQPA 5LMNF 3CGIA 2V34A 3DFEA 3POTB 2EPIA 4ELUA 1AZSB 2E5GA 2CPJA 3HFVA 1X7VA 2V2QA 3PTWA 4CLLA 3M9OB 3W2VB 2DNMA 2P2CB 2AJFE 1Y5LB 1HD0A 3CCWA 3BN7A 5B0BA 5LL6d 3JAMU 3MTKA 1S76D 4LFCF 1G2EA 4P2SA 1HNIB 2Y0SD 2MKYA 3FBFA 3OR1B 3CD7A 1CJUB 5IC4B 3TJ8A 3J81j 4IOCQ 1TK8A 3WC2A 2V4JB 1MMLA 4HTJA 1NBEB 1VJQA 1SUQA 4F3OA 3CCZA 1X9MA 2GZOA 2O01C 2YBVA 2DGVA 1O51A 3DLEA 4UF4A 1RHQB 1L3VA 4PWDA 3BSOA 4ES2A 3FRYA 2K7JA 2FZKB 4DR7J 4ITSA 1HKAA 2Z58B 3FRZA 2G0JA 4XAKA 2OFGX 1QM9A 3DNCA 5JXSA 5IWAJ 1NSKL 5FLXU 1IKWB 3Q0AA 4K4WA 2NYHA 1R7IA 2FJEB 4M63A 1VQ4S 2JHEA 3CJ8A 1SB6A 1UPPA 4PABA 5HBMA 3T3FA 5KT3A 3NMAA 1CJTB 1JLBA 3NGTA 2C2KB 4DV1J 2K1RB 1FJCA 1LXJA 4I4BA 3PW5A 2VQEJ 2C2ZB 3RG6A 4Y3CA 1NRKA 1TKXB 2HQ3A 3I87A 2O3DA 3P6YC 2A6MA 2VJVA 2UUBJ 2ZJPQ 1HWUA 2XSJA 3UFCX 3DM2B 3VVUA 3CJ5A 5BR8F 3MR5A 1VIOA 1T8EA 3KK1A 4QQBA 1Y5NB 3MEKA 1TUVA 4OYPA 1AROP 1OY6A 4KH0B 3TX8A 2EBGA 3CMAS 4W90B 3DMJB 3T1HF 3IS9B 5HVGA 4JI8J 3EMTA 4NI2B 4O3QA 3QFHA 1VQLS 1FRLA 1UTAA 4PG6A 3QJPA 4IOBA 3FMBA 4I0WA 2IJNA 3LWMA 4KC5A 2AJ1A 2RMLA 4F0KA 2FVQA 2PIIA 3B78A 3UNYA 2XNQA 4A48A 2G13A 5F8HA 4ELTA 4CLFA 2R8JA 3FQLA 1JXVA 3MMAB 5G0RA 3V2UC 6FD1A 1FNXH 1LW0B 1KNZA 1LFPA 3NKYA 4LJMA 1PKUA 3J7Z5 3HZEA 2KM8C 1KBRA 2W9BB 4LQ3A 4ZVHA 2LKZA 3SEOA 3HFKA 1UJ5A 1YBAA 1GMWA 4TYAA 1W25A 3EPGA 4MK9A 1HNZF 2UUCF 2JVRA 5D4PA 5GMDA 3AA8A 3NAIA 5KFIA 3I0SB 3ZZ0A 5GAGU 4YB1P 1K9MT 1UJ6A 4BWJA 3Q22A 3N28A 1F2GA 4PXEA 4B9LA 3CCTA 3EVWA 1VYAA 3BB5A 3TA2A 5L9NA 4KGMA 1ZTTA 1G7CB 4IG0A 1TQLA 1YG0A 3PFEA 1RBOB 1FWKA 4M5IA 4DF4A 2VG7B 4ZA1A 1EJ7L 3HVAA 1YI2S 1SJFA 3H5UA 4P72A 3IC1A 3VGSA 5A76A 1S0VA 4LIWA 2CJBA 3BGRB 8RUCA 4ZVEA 3THVA 3TW0A 4ZVQB 3ZTPA 1M5SA 1TTHB 2ZZTA 1YRXA 4IG0B 2GIRA 2W4DA 5B0GA 1UKUA 1S99A 3AOAA 4CT8A 3HP6A 3MAQA 3VALA 4USKA 1VQ6S 1TL5A 3R5CA 4FF4A 3DRPA 1T95A 1VRUB 4YHHJ 5KFNA 1JLGA 2CRLA 2VFRA 4JBCA 1XN9A 1T9UA 2VPXB 4CH0S 3ZZZA 5J2MA 1DBDA 3NRBA 1H7XA 5SUHA 3FCHA 5HO4A 2W2PP 2OPPB 1VQ9S 4WCEQ 2HWHA 1HQEB 3ZFVA 1WF0A 2XO7A 4RUHA 1JNZB 3BDEA 4AQYF 2V2KA 1T7PA 2GHVC 2HFNA 2ZBPA 2JLFA 3B8HA 5E3RA 4YB7A 2UXDJ 1APSA 3EUNA 4BBYA 4NEYA 2IM3A 2BE2B 3KLGA 2NLWA 2JC1A 1WG1A 1PYTA 4R8UB 1OO0B 4DPYA 3MUVP 1BXNA 1RACB 1NDPA 2CQCA 3IGNA 3MR7A 1H0HB 5LT5A 2MQQA 1J5OB 4XTTA 2JH3A 2MSTA 1SQFA 3S7RA 1FDDA 2DISA 2XCPA 4ED4A 3BQ1A 4B3OA 3G6VA 1RDRA 2CPHA 1TUWA 3RRGA 4JI3F 4GKJJ 3PNIA 5DDQC 1KS2A 2AQ4A 4DR4F 1R43A 1PSDA 1RKIA 3AJ1A 3IWXA 2CDQA 3CW2C 4UOHA 4K50A 5A8RA 3D3CJ 2ASYA 1NB7A 2HFSA 3I32A 3VVTA 4ECTA 4GKKJ 2YTCA 1X5PA 4H4OA 1S4FA 3DRSB 4OMFG 1U1PA 3MPVA 3DRSA 3TZYA 4DSJA 5DRKA 1UAWA 3KOAA 2HAFA 2YKQA 3B4DA 3TO8A 2K1RA 4Y2CA 3V6HA 2NCKL 4I6YA 5IT9Y 2HFUA 4D3HA 2IAJB 1FWLA 3ENQA 1XNRF 5L46A 1VRTB 2MDAA 1TV6A 4MYUA 3FGVA 1Q4RA 3PCOB 1NJYA 2L48A 2LQ9A 4WK3A 2M9KA 4NX9A 2C3OA 4LRBA 1RT6A 1F3FA 1YZ6A 2HVDA 5AE3A 1Y3JA 1TU0B 2V69A 5B08A 5C2GA 4V19J 4PWDB 3AOCA 1T0TV 1U09A 2ZD1B 4ZVRB 4LR7A 3PX4A 3FFIA 1Y00A 4RZRA 3QWPA 2PFFB 1SUQB 1WOSA 2BR0A 2BQUA 2GVZB 2HHXA 1AA1B 3OTEA 5SZTA 1J2VA 5EWFA 1H2TZ 3DRRA 2XLKA 1S97A 1VQNS 2DGXA 3TVYA 2E66A 1Y3KA 2LEAA 2HPUA 1S72S 4MKAA 3GG0A 3TI0A 4DQPA 1DURA 1PILA 4UUWA 3BO2A 1N6QB 2Q66A 1GXTA 3D0HE 2ZBIA 3FZ2A 2I1RA 2YWEA 2V2VA 4P2MA 3KK3B 3EDQB 4OHWA 2OEJA 1WHYA 1I94J 4GRSA 1F0XA 1TL4A 3AJ2A 3PG9A 4OV6A 1NK7A 2QMXA 3U02A 2R8GA 4IG3A 5J1EA 5HL7Q 2NSCA 1BE4A 3S6EA 4LR9A 4HVZA 2V4QA 3M1VA 1FDNA 3OQ2A 3DLBA 2FJBB 1FRKA 2VG5A 2XMJA 4KKOA 4U96A 3PX0A 1VQPS 1J5EJ 1QSYA 5KFUA 4MIWA 2AU0A 3AXKA 3QGPA 4KHRA 3S1TA 3VAFA 2RNEA 2JEFA 2J0XA 5HJXA 2YKNA 2I5JB 1VQKS 2HQIA 3CWJA 1N5VA 2DCUB 2PMWA 4RW4A 1NPRA 3D5MA 3AH6A 3UNGC 4G1IA 1ZS6A 2DEIA 3NBPB 3JSMB 2E7WA 3B54A 4NLOA 3DDKA 3NLCA 4C8NA 1GMVA 4HYKA 3NY0A 3JQMA 3PEHA 2GAGC 3R5GA 2VIHA 4X64J 1Q79A 1H7WA 3G4SS 5KFVA 1HWIA 1XJWB 4C0HA 3KMQA 2RQKA 1WUUA 2BKOA 1ZBTA 3V4MA 4QU6A 3RB6A 4Q0BA 1F2HA 3IO1A 2BANA 4CM0A 1U24A 3W8GA 3GV5B 1AW0A 2IRXA 4ED1A 1EETB 2IVYA 4Y34A 4M94A 3BKTA 2W7PA 4DL2A 3BEGB 4DL0C 1HI1A 5LXRA 2NS1B 2ZNYA 3GSDA 1VCTA 1T9XA 2K7KA 3OL7A 1E6YA 3BBBA 2F4VJ 5BYQA 3Q8SB 1RSCA 3MMJA 3KHGA 1ZETA 3HK2A 1LWEB 9ATCB 4J91A 4YY3J 3EWGA 4I6WA 5ETQA 4X4UA 1FRMA 2B7BB 4JV5F 5J2QA 3PR5B 2ACYA 5CYMA 3VQTA 1SQEA 2AYBA 2ZWPA 4MIBA 4BC9A 1QUPA 2RUGA 4GMKA 3CJKA 2IM0A 2Z8QA 1YDLA 1GTHA 3MFIA 3UCUP 4FNIA 1FCAA 2NPFA 3CPWR 1BQMB 4MK8A 3DLKB 1BQNB 2GMHA 1XC9A 4ELVA 2R7UA 3C14A 2VQEF 1RU2A 2CYYA 2B4PA 1FFGB 4X62F 3GPAA 1VC6A 2QO3A 1B7YB 1C0UA 3AD7C 1UETA 5HQ8A 1R0AA 3VGUA 4DV3J 1MROA 2AEMA 1MN7A 3QQCD 2OPRA 4L72B 4MFBB 4ED2A 1QAIA 3IWNC 1DY3A 3GONA 2XLIA 3Q8QB 4XK8C 4DR7F 3BR9A 8ATCB 4CYUB 2DGQA 2YWHA 1S49A 4CLPA 3CJ4A 5D0GA 4AYBD 1NO8A 1RAIB 4ZPWR 4JB8B 1FFWB 5K8NA 2CIMA 4KO0A 4DR5F 2AJQA 1F9EB 2MZQA 2HNYB 4ZN3A 2FGOA 3DLLQ 1U26A 3NGSA 3M2RA 3WZ0A 2ZVSA 3CCLS 2B56A 1HBNB 3BYRA 3V6DB 3C6UB 1HMVB 4HHUA 1WC3A 2QSWA 2GW8A 2FTRA 3HULA 3QGHA 2WVBA 4N8NA 4CO4A 7FDRA 4PZVA 4WBFA 2AEJA 4IFVA 4KGKA 4LSNA 4P9SA 1Y0HA 3T9ZA 2X1GA 2VOPA 2KL8A 4YMEA 2B7CB 1K73T 1LK7A 2KN4A 2QFJA 4J9PA 3MMCB 2GAHC 3N5BA 4FPIA 4FYWB 1VI7A 2GCFA 2CZVC 3CIZA 4LRAA 4MT1A 4PAAA 3PO4A 2N4CA 4DR6J 3EICA 1HARA 4DV2F 2CQ1A 4ECVA 3CC2S 5L1KA 1AFIA 1TL3A 2WBMA 1NZAA 1R8BA 1UFWA 4P71A 2EW9A 5GAHU 2MZTA 3GILA 1T05A 1PAUB 5L9XA 3D3BJ 1IBCB 2LA4A 4HH0A 1VOMA 2BANB 2UXCF 3RW6A 2B5JA 1KQSR 3DGPB 4OJGA 5CABA 1MW7A 1QAYA 3BGRA 1WEYA 4PWWA 4O4GB 3E01A 3D28A 3TEGA 1RB0A 2V8DA 2RDDA 4LRDA 2HLUA 2WONB 3FBEA 3Q2TC 4ZPCA 1RAGB 4YDDB 3AT1B 3BBCA 1TUGB 2LA6A 2N7CA 2XG8A 1CJVA 4EBDA 2HHUA 2IVMA 1SI9A 4YB6A 1SH2A 1Q5YA 3P3DA 4MKBA 3KLVA 1KQFB 3EDRB 1FEEA 4ECRA 1B70B 2JJ4D 4NRUA 1W7WA 1AT1B 1SKWA 4ES3A 2OGUA 3BH6B 4OZ5A 3LTOA 1PJ6A 3DGVA 1UW9A 1B0PA 1WC0A 2MXYA 4X4QA 4KKOB 1XWLA 2QN6B 5ETKA 1TZ0A 3NS5A 2NXUA 3R9LA 5DQHA 3MWBA 1ITPA 3ICLA 3MGJA 5I42B 1YZ7A 4HHHA 2YX7A 1S1VB 5KT5A
chains in the Genus database with same CATH topology
2CJXB 2H51B 3R7BB 3R6LB 3KJQB 2CNKB 2H5JB 2CJYB 1RHUB 3KJNB 1SC4B 2HBRB 2P2CB 1RE1B 3KJFB 4ZVTB 2HBQB 3RJMB 2CNOB 2H65B 5IC4B 5IC6B 3R7SB 1NMEB 4ZVUB 2XYGB 1RHJB 1SC3B 1ICEB 1RHQB 2H4WB 3SIPB 3R6GB 2HBYB 2C1EB 2QL9B 2H5IB 2XYHB 3GJQB 3D6FB 3GJSB 2C2KB 1RHMB 2DKOB 3GJTB 2C2ZB 2QLFB 1RWKB 3P4UB 3P45B 4ZVSB 1SC1B 1QTNB 2H54B 4JB8B 1F9EB 1RWOB 4ZVPB 1RWPB 2Y0BB 4ZVRB 2H48B 1BMQB 3GJRB 3R5JB 1RWMB 2CDRB 2H4YB 2QL7B 2C2MB 4DCJB 2QLJB 2XYPB 1I3OB 3EDQB 1PAUB 3IBCB 1IBCB 4DCPB 2CNNB 3D6HB 4DCOB 2QL5B 1RHKB 3QNWB 2CNLB 4ZVOB 1RWVB 2XZDB 1QDUB 5K20B 3R7NB 1PYOB 2Y1LB 4LSZB 3EDRB 3NS7B 2HBZB 1RWWB 2XZTB 2C2OB 4ZVQB 1RHRB 3IBFB 3D6MB 1GFWB 1RWXB 2FQQB 1RWNB 2QLBB 1I51B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJX B;  2H51 B;  3R7B B;  3R6L B;  3KJQ B;  2CNK B;  2H5J B;  2CJY B;  1RHU B;  3KJN B;  1SC4 B;  2HBR B;  2P2C B;  1RE1 B;  3KJF B;  4ZVT B;  2HBQ B;  3RJM B;  2CNO B;  2H65 B;  5IC4 B;  5IC6 B;  3R7S B;  1NME B;  4ZVU B;  2XYG B;  1RHJ B;  1SC3 B;  1ICE B;  1RHQ B;  2H4W B;  3SIP B;  3R6G B;  2HBY B;  2C1E B;  2QL9 B;  2H5I B;  2XYH B;  3GJQ B;  3D6F B;  3GJS B;  2C2K B;  1RHM B;  2DKO B;  3GJT B;  2C2Z B;  2QLF B;  1RWK B;  3P4U B;  3P45 B;  4ZVS B;  1SC1 B;  1QTN B;  2H54 B;  4JB8 B;  1F9E B;  1RWO B;  4ZVP B;  1RWP B;  2Y0B B;  4ZVR B;  2H48 B;  1BMQ B;  3GJR B;  3R5J B;  1RWM B;  2CDR B;  2H4Y B;  2QL7 B;  2C2M B;  4DCJ B;  2QLJ B;  2XYP B;  1I3O B;  3EDQ B;  1PAU B;  3IBC B;  1IBC B;  4DCP B;  2CNN B;  3D6H B;  4DCO B;  2QL5 B;  1RHK B;  3QNW B;  2CNL B;  4ZVO B;  1RWV B;  2XZD B;  1QDU B;  5K20 B;  3R7N B;  1PYO B;  2Y1L B;  4LSZ B;  3EDR B;  3NS7 B;  2HBZ B;  1RWW B;  2XZT B;  2C2O B;  4ZVQ B;  1RHR B;  3IBF B;  3D6M B;  1GFW B;  1RWX B;  2FQQ B;  1RWN B;  2QLB B;  1I51 B; 
#chains in the Genus database with same CATH topology
 1CG2 A;  2EBE A;  5KFJ A;  3DCA A;  3I0R A;  2JVO A;  3MDF A;  4ZOS A;  3SQG A;  4JI0 J;  1F9F A;  2DHS A;  4PCQ A;  2YQ3 A;  3KJV A;  3KJQ B;  1VJW A;  2AGP A;  2D41 A;  5HMZ A;  3HSG A;  3KK3 A;  3N5F A;  4Z37 A;  4C48 A;  4O3P A;  1K0V A;  3UDE A;  1HBN A;  5G4D A;  3U1L A;  2DRB A;  2HNZ A;  4EYI B;  2H9Z A;  2HK2 A;  2O66 A;  2YX4 A;  3MUM P;  4C8Z A;  3M6V A;  1L3K A;  2HGL A;  2FVS A;  4ZIT A;  3J7A 1;  2ZJR Q;  5GAD U;  3F41 A;  4RU9 A;  3EX7 B;  6FDR A;  1GMW D;  3J81 Y;  2HGM A;  1UWB B;  1CQN A;  2YNH A;  4Y2K A;  4QWE A;  3RB3 A;  3RRK A;  4ANE A;  2IC3 A;  4H4K C;  3TQ1 A;  2JEG A;  1CVJ A;  4N77 A;  2RAQ A;  3EYZ A;  3M30 A;  1VMB A;  1OYE A;  2OPR B;  2CPX A;  3LP2 A;  3Q8Y A;  1MMD A;  4WP3 A;  5GME A;  5DLG A;  4X65 F;  2KM8 B;  4J9N A;  5I3U A;  3GU0 A;  3W5X A;  4OV1 A;  1JWW A;  4A4J A;  2IMW P;  3M6U A;  5K8M A;  4QYZ K;  5B0C A;  9RUB A;  4LF8 J;  4OI3 A;  2VPY B;  1Q7L B;  2W25 A;  5D0R A;  1KLM B;  2XS7 A;  1W26 A;  2CZ4 A;  1D9F A;  4TU8 A;  3AFG A;  2ZVI A;  4H4O B;  3SSQ A;  1U47 A;  1DJ0 A;  4EZ9 A;  2Q43 A;  3MD1 A;  3LP0 A;  4JI3 J;  4N76 A;  4GKJ F;  3DYA A;  5D77 A;  1PGZ A;  3PM9 A;  4A8O A;  2KJV A;  3OR1 A;  1U0H B;  4ZLL A;  3N6M A;  4X4R A;  4KHP J;  2RHQ B;  3HZG A;  4CRJ A;  2UUB F;  1FK9 B;  1RTI B;  3TOQ A;  3GJR B;  2YKM A;  3A8K A;  1RWM B;  3IR6 B;  1HHS A;  3HD1 A;  3VWS A;  3C6T B;  2PEH A;  1KKH A;  2AIR B;  2YX1 A;  1ZA1 B;  3BKF A;  4OIX A;  1NPP A;  2Z2Y B;  1LNQ A;  4RW9 A;  3TAP A;  2C28 A;  3HHN B;  4I2P B;  5A2Q Y;  4DFM A;  3R5D A;  2C2M B;  5I3P A;  5KFH A;  4BS2 A;  3FEY B;  1FRJ A;  1FVQ A;  4CI0 B;  1EAR A;  3A3P B;  5T7L A;  5KG7 A;  2RS2 A;  2CA9 A;  2MZ1 A;  3PAC A;  3JYT B;  5KG1 A;  2MQN A;  3A8J A;  1HHQ A;  3C66 A;  1R8A A;  3ZC4 A;  3M6W A;  2BOA A;  3Q89 A;  3SFG A;  1JLQ B;  5CYQ A;  1RYS A;  3X1L B;  3JSM A;  3TYT A;  4YHH F;  3MOJ B;  4YR0 A;  3FEX B;  1P8G A;  1S1X B;  4OI6 A;  3IN5 A;  2DGO A;  2GNK A;  2YKN B;  4KE5 A;  1HPZ A;  1KLN A;  2G0I A;  2J7U A;  1D0E A;  2CQI A;  1FO1 A;  4QR0 A;  2JLG A;  3VAJ A;  3F73 A;  1AUS L;  3P8B B;  1X9S A;  2VFT A;  3EGV A;  1PBA A;  2HQC A;  3KLF A;  3TAN A;  3ILO A;  1X0F A;  1GQE A;  2LU2 A;  1NKC A;  1DLO B;  2Y1R I;  5KT2 A;  3SCI E;  2VG7 A;  4X4N A;  3OL6 A;  4KGZ B;  2QV6 A;  1RAJ A;  3DI6 A;  3HX9 A;  1S79 A;  1M0S A;  4FVC A;  4M5D A;  5AXM A;  5C25 B;  3PV8 A;  4IFY A;  3AB4 B;  2FLO A;  4LFB J;  1RT3 A;  3OUY A;  2DR7 A;  4K0K J;  4CM2 A;  2DHH A;  1N48 A;  3LH2 S;  4CLZ A;  4RLE A;  4JI6 F;  1IKY B;  2BBE A;  2VPZ B;  3PR4 A;  1HW8 A;  1ZPV A;  2DYA A;  3VHQ A;  4DLE A;  1IVZ A;  1WSR A;  3TVZ A;  1H2U X;  1QUV A;  1WC4 A;  1BD6 A;  1OY8 A;  2MB0 B;  2MJN A;  2M7S A;  3Q24 A;  3G86 A;  2OSR A;  3T41 A;  4RUC A;  2YWG A;  4GC6 A;  2A2C A;  2YWK A;  5EGY A;  5KFF A;  5BJR A;  3GYN A;  1KR4 A;  3FNN A;  4JOU A;  4C8Y A;  2HYI B;  3CC4 S;  1IBK J;  3NCQ A;  2OMO A;  4M95 A;  2MHE A;  2XQC A;  5JMN A;  5A8W A;  5F8I A;  2J9E A;  3ILL A;  3L7O A;  2FDN A;  4O0N A;  4OYW A;  4RUB A;  4O44 A;  5KOX A;  5LJ3 Y;  1S10 A;  3HSZ A;  1QTM A;  3IAS 9;  1MSW D;  3PHE A;  1FDA A;  4DL5 A;  3PYD A;  3W2W A;  1HNW F;  4RNN A;  1GH8 A;  5IC6 B;  5C24 B;  2Y8Y A;  5IT0 A;  4J5O A;  3IRW P;  2QA1 A;  2QLX A;  1TL1 A;  3AOD A;  1IR2 A;  2YH1 A;  2E44 A;  3OR2 A;  2IM2 A;  4RW6 A;  3KNA A;  4FYX B;  3EXY A;  4IDK B;  2EKY A;  4DMZ A;  2W7A A;  2VJU A;  1U0H A;  3CJ0 A;  4FPR A;  2IAJ A;  4QPT A;  5THW A;  3SIP B;  1RAE B;  1JLF A;  3IM9 A;  4DPX A;  2V63 A;  1SJ3 P;  2C1E B;  2KT3 A;  3EJM A;  1ZAV A;  3C16 B;  1NXI A;  1BGX T;  1L5U A;  4Q8E A;  5E3P A;  1TKX A;  3UD5 A;  1U7L A;  1WEX A;  2JC0 A;  2KU7 A;  1Q8B A;  5HLF B;  1FKO A;  5E3C A;  1PG5 B;  1NJI T;  2HND B;  2GML A;  1FRI A;  3JQJ A;  3MEC B;  5KFY A;  2IMO A;  1M5K C;  3IWL A;  4B17 A;  4AFF A;  3I82 A;  1GTE A;  4BCA A;  2DGT A;  2WCX A;  3ZZO A;  1WC6 A;  1YK9 A;  2W01 A;  4MIA A;  1F60 B;  2DHG A;  4LQ9 A;  1J5O A;  4F2R A;  2HZA A;  2CZ9 A;  4U67 Q;  2XM3 A;  2OPQ B;  1X4A A;  2CKW A;  3EZ5 A;  1FNO A;  3W61 A;  2BVZ A;  5L8R C;  2BJ9 A;  1KRP A;  4LF6 F;  3MEE A;  4B3T F;  1LEO A;  3H2U B;  1IJF B;  1B64 A;  4EEY A;  3PRD A;  4P74 A;  2PEB A;  3A1Y G;  1RKJ A;  2WHO A;  2MKJ A;  2PGC A;  2ZM6 J;  2G9O A;  1S9E A;  3NGD A;  3GSI A;  3GIJ A;  2VBW A;  2J76 E;  1IKX A;  1EET A;  2R7V A;  5K5M A;  1YLX A;  2I38 A;  2ZHO A;  3NNC A;  5K14 A;  3THT A;  4Q0B B;  3K7R A;  2WSC C;  1IUJ A;  2CJA A;  3C8Y A;  1Y11 A;  3NCR A;  5HAT A;  3ZTR A;  4DCJ B;  2OEL A;  4NCA A;  3MEG B;  1JLG B;  3V81 B;  1OQ6 A;  4RU2 A;  2KG0 A;  2OSQ A;  2HUR A;  2ZH1 A;  4YR2 A;  5DS7 A;  4OZ0 A;  1FES A;  2R7O A;  3NBP A;  2XLJ A;  2R2U A;  4ECX A;  3KLI A;  1A0O B;  3BR8 A;  2QZ8 A;  4ECZ A;  4AL5 A;  1EKR A;  3TAQ A;  1FA0 A;  1IQT A;  4ZVO B;  3H4B A;  3IMQ J;  2DNP A;  4IO9 Q;  2EKN A;  4YDX A;  3WBZ A;  2DHX A;  4FXW A;  2V4R A;  3RR8 A;  1KQK A;  4JUZ A;  2W9C A;  1G6B A;  2W2O P;  3DXS X;  4HR2 A;  5C42 A;  1S12 A;  1QSS A;  4FKY A;  3DLG B;  4RX6 A;  1YJ7 A;  2VHG A;  2WW8 A;  1VQ5 S;  2HBZ B;  2K3I A;  5BYS A;  5AJ3 J;  3FSI A;  2E9T A;  3OW2 R;  2L3M A;  2E1C A;  1IM6 A;  4CDI A;  4DR2 J;  2BRK A;  1S1U A;  3IBF B;  3PJ9 A;  4TN2 A;  3CCM S;  4IG3 B;  2G4B A;  4I68 A;  2RH3 A;  2R7W A;  2R8I A;  5F9L A;  4C4W A;  3FSX A;  1RIS A;  1X4H A;  2XMT A;  2YNI B;  3KXD A;  2D7S A;  3CDB A;  1VQS A;  2IYG A;  2J0S D;  2QGF B;  4DR5 J;  4TU9 A;  1Z2L A;  2QT7 A;  1TL7 B;  4DX6 A;  5JUM A;  5KFP A;  2UV8 G;  2VDH A;  3JAM Y;  4UQT A;  4DFJ A;  3D66 A;  1UVN A;  4KV8 B;  3K59 A;  2HVZ A;  1P1T A;  2MY8 A;  4L3N A;  2DCL A;  4NYP A;  5HP1 A;  3DRR B;  3KG1 A;  3BPD A;  3SBM A;  1UFK A;  3S8S A;  2VH7 A;  4C98 A;  2MGZ B;  5DG8 A;  4CIO A;  2GVZ A;  3G8S A;  3KJF B;  3EZO A;  3C15 B;  1IBM F;  3GV8 B;  2K2P A;  3IS9 A;  2N3O A;  2Q6B A;  1S6P A;  2ZD1 A;  2PC6 A;  2J0W A;  3HJF A;  2FHK A;  2H65 B;  3DHW C;  4NPO A;  5DZ7 A;  2Q3P A;  4OHV A;  4ZVG A;  4KBI A;  3OXL A;  2XMA A;  3DN9 A;  2XMW A;  3QFW A;  4CO3 A;  1OJ4 A;  1S5Z A;  1SH0 A;  2ZH4 A;  1X5S A;  3RU0 A;  1T03 B;  1M5O C;  1ZM4 A;  1ZAX A;  2B4V A;  1NH8 A;  2O1P A;  4QIE A;  1YBU A;  3M8R A;  4PYA A;  2QMU B;  2XHC A;  1K47 A;  1MN9 A;  2KDO A;  3WIU A;  2P6T A;  2A6O A;  4G3I A;  4WZQ A;  3FDS A;  3LGM A;  2IM1 A;  3ADA C;  1YTY A;  2YWF A;  3FC9 A;  4HKQ A;  2BJ8 A;  1RTJ B;  3LQV A;  1M5P C;  2LFV A;  2WW4 A;  5B0A A;  2ROE A;  3DU6 A;  4C3M A;  2BAB A;  3FCV A;  4JI1 F;  1IKW A;  2GQQ A;  2KXF A;  2UXB J;  2H3E B;  4ZS6 A;  1HI0 P;  1BC6 A;  4NXM J;  2OAU A;  1X60 A;  1ZOT A;  3D1O A;  4XPC A;  5GAE U;  1RHM B;  3HMJ G;  2W7O A;  2AMC B;  2V6A A;  4WP9 A;  1C0U B;  3CDU A;  4NXN J;  4ED7 A;  1MWQ A;  5IM0 B;  3SI8 A;  3GP9 A;  1Q53 A;  1VLY A;  4M5M A;  3D0I E;  1S1W A;  2PI4 A;  1BQN A;  3MPY A;  2XMK A;  4EBC A;  2OJ3 A;  1YGY A;  3OLB A;  1R0B G;  4P73 A;  5C2C A;  3KLH A;  4OX8 A;  2HFV A;  4A8W A;  3HM9 A;  3L7P A;  2LQB A;  4AT1 B;  5L1L A;  2VBX A;  4WPA A;  2RHS B;  1TKT B;  4YB5 A;  4R8U A;  2ZNZ A;  2R42 A;  5LSO A;  2ZIT A;  3R5J B;  1XMO J;  5H9F K;  4DN9 A;  1KN6 A;  2EEY A;  3K2Y A;  4G1P A;  3CCV S;  3MPW A;  3GCX P;  3FVY A;  3MM7 A;  3N79 A;  3R2C J;  3HHL B;  2RDI A;  4HHJ A;  3BQ0 A;  1LWE A;  3TUP A;  4MMO A;  2A1B A;  1NPK A;  4DL4 A;  1UVI A;  1FJG F;  1D1U A;  3BGO P;  2MHN A;  1LW2 A;  1NLK L;  1NM2 A;  3OLA A;  4N47 A;  3IR5 B;  1XR6 A;  2OLW A;  3IAM 9;  1VBK A;  4WYL A;  2BOP A;  4QYZ J;  2QMW A;  2W8K A;  1RLD A;  1F5A A;  4TY9 A;  4B3S J;  3D54 A;  4X2B A;  2CPY A;  1ULR A;  2DTJ A;  1EHW A;  3E51 A;  5EN1 A;  2CQD A;  1KVK A;  3D6T B;  4DZ6 A;  4DR1 J;  1FXL A;  1VR6 A;  1YRU A;  2EG1 A;  5J1N A;  2V9W A;  1HHT P;  5KT6 A;  2M8D B;  2XTJ P;  2ZZN A;  4KSE B;  5IT9 U;  4A8Q A;  3C19 A;  2W2Q P;  5D78 A;  1RLC L;  1EIY B;  1UPM B;  3H59 A;  1M1K T;  2BDP A;  2DH8 A;  1OSC A;  5AJ3 F;  3OJS A;  1JLE A;  2DPI A;  4FF2 A;  5AE2 A;  3UDC A;  4OHZ A;  3UN3 A;  4EU0 A;  3GG1 A;  3NCP A;  2SXL A;  3SQO P;  1HBO A;  4NYZ A;  3IG1 B;  3LGN A;  3TQE A;  1IR0 A;  4OYA A;  2CAJ A;  3IG1 A;  3Q83 A;  4PUO A;  2C3Y A;  4C8M A;  4PUO B;  1KSP A;  2AJ0 A;  2YKA A;  1WKJ A;  2UUT A;  3TAR A;  3CXC R;  3FMW A;  3DHX A;  3PW0 A;  2VA2 A;  4PG5 A;  3PHT A;  4BC7 A;  3GFX A;  2XGQ A;  5D3G B;  3GLJ A;  3CNQ P;  3ETM A;  4OI4 A;  1RWX B;  2ZOM A;  4MTP A;  1O0P A;  4NLR A;  1JKH A;  2HWI A;  2LP4 A;  3D1H A;  3NOC A;  3MM8 A;  4I2Q A;  2VG6 B;  4J9V A;  5K8O A;  1N33 F;  1HBU A;  2J6S A;  4EUV A;  3H98 A;  1TAU A;  1YIJ S;  1C0T B;  3MMA A;  1WOP A;  2FHO B;  5G0R B;  5D0E A;  4U95 A;  3J81 U;  1JXE A;  4YFU A;  4O0I A;  2HHH F;  3V81 A;  3VR1 A;  4LF9 F;  4OYO A;  3FEZ A;  3H2L A;  3HHE A;  1RHU B;  4F4Y A;  4DFK A;  1S59 A;  5K14 B;  1KQG B;  2MLX A;  2MKK A;  1ZTW A;  4EBE A;  1S9F A;  2X1F A;  1PCA A;  1WG4 A;  3R5A A;  1HNX F;  1JLA B;  2DIT A;  1RBL A;  3BV8 A;  3I31 A;  3VGV A;  1RT7 B;  1RCX B;  2YH0 A;  1F6T A;  2DY9 A;  1TKD A;  3EXC X;  3ZXW A;  5M2R A;  4YOE A;  3W5Y A;  5IV3 A;  2IY5 B;  3FFI B;  3QO9 A;  1B4S A;  3MM5 B;  3OTO F;  3JSB A;  2HHW A;  2NXE A;  1RZM A;  4K59 A;  3F0N A;  1QY7 A;  1CQM A;  1EP4 A;  3GZ7 A;  1CJK A;  2J9D A;  1N5S A;  3QLH B;  4ETZ A;  1BHN A;  2PMZ D;  4CZC A;  1A9N B;  2DD8 S;  2WSE C;  1OIA A;  3ITH A;  3GQC A;  1DFD A;  5I3Q A;  1FNM A;  3W65 A;  4K2X A;  2F7V A;  1P27 B;  1YVF A;  2EI5 A;  3CO0 P;  5IWA F;  2WOM A;  4N7T A;  3DXB A;  3QO9 B;  3TWZ A;  1DTQ A;  2M8H A;  3ENV A;  2E5H A;  2FVR A;  2DNY A;  1R8P A;  2ILY A;  4DV0 F;  3ISN C;  5HMW A;  3AAW B;  1UP1 A;  4AXI A;  4DOZ A;  5A6W A;  4QOT A;  4JV0 A;  3CME S;  4MAK A;  3W63 A;  3PKY A;  1WAC A;  1Q95 G;  3BGU A;  2DNZ A;  1RUS A;  2FVC A;  4FNH A;  2VB6 A;  4AND A;  2WZ1 A;  4DS5 A;  4CLS A;  4FN5 A;  4MK7 A;  4B3O B;  4FXV A;  3JXO A;  1TK5 A;  2HLT A;  4AXJ A;  1CS4 B;  5AXL A;  3JTP A;  3Q23 A;  3AQP A;  4NEZ A;  3M4X A;  4DV5 F;  3KJV B;  3HHL C;  1MWY A;  2MQ8 A;  1C0T A;  2IRY A;  1SV5 B;  4ZLP A;  4KGX B;  2BE2 A;  2BW7 A;  3CDE A;  4EWT A;  1S0M A;  4WFN Q;  1V3Z A;  4EO6 A;  1S1V A;  3CO9 A;  3D2W A;  4F4Z A;  2C2D A;  1Q1K A;  2ZBR A;  3EVM A;  3E2E A;  3F44 A;  3LP1 A;  2QLJ B;  4QU7 A;  3RBX A;  1OWX A;  1FE4 A;  1HIY A;  4DR4 J;  4HL9 A;  2HQG A;  5D4O A;  3UDL A;  4Y65 A;  3E3X A;  3B82 A;  4Y2I A;  2RRN A;  4LVO P;  2VIC A;  1K1S A;  3LWL A;  2EFQ A;  5J2M B;  4KHM A;  4Y0F A;  2KJW A;  2UXC J;  2MTL A;  2M5Y A;  1X4C A;  2NR0 A;  3PRV A;  2CNL B;  2R7X A;  3SSS A;  1HBO B;  3O1L A;  4ICL A;  2ZHB A;  4UOG A;  4GO7 X;  1IWA A;  1JX4 A;  5ETT A;  1HQU B;  2OUG A;  2DNK A;  5E33 A;  3WDO A;  1FHT A;  1REG X;  3MAA B;  1RTH B;  1V6H A;  1KOH A;  2E1R A;  2CQH A;  3Q86 A;  2G0C A;  1HWL A;  3K5P A;  4NLT A;  4TXS A;  3RYL A;  2HAI A;  5C42 B;  1O6X A;  3CUL A;  1EX8 A;  4U6P A;  1T9V A;  2ZDP A;  2FB0 A;  1FEH A;  2WVD A;  3H90 A;  4DUZ J;  3AD8 C;  1XIQ A;  2B43 A;  2ZH2 A;  4DX7 A;  3OHA A;  2HHT A;  2DNH A;  2BJ1 A;  4DPO A;  3NWG A;  1ZM2 A;  2JSX A;  3JQK A;  2JRS A;  5HQL A;  1M5V C;  3HVW A;  1REV B;  1X31 C;  3NAH A;  4L75 A;  3KLI B;  4HLB A;  3OVB A;  4ZK7 M;  4YUD A;  4Q2M A;  5K9F A;  1NK0 A;  5JJB A;  2M0G B;  2DR8 A;  4DQQ A;  3KFW X;  4B08 A;  1KOO A;  1MU2 A;  2DXD A;  5L38 A;  3G6Y A;  2CNK B;  2ZZM A;  1TKZ B;  3Q8V A;  4ES1 A;  1DQA A;  4E2F B;  2KI2 A;  2LXI A;  5IS2 A;  5FJ4 A;  4F3M A;  4LIR A;  1N88 A;  2BZ2 A;  1FJG J;  1ZZN A;  1HMV A;  5EX0 A;  3RBD A;  1SXL A;  2Z30 B;  3KHR A;  3T1Y J;  2WB1 D;  1LW0 A;  2ZC4 A;  2PA8 D;  3VF0 B;  3V4I A;  3BF4 A;  3NS6 A;  2QLW A;  3GYG A;  4U7U D;  2E7V A;  3M32 A;  2WVF A;  5CHC B;  5E5N A;  2W2M P;  1HLW A;  1CS4 A;  3DDN A;  2HNY A;  2LVW A;  2RSQ A;  5KG3 A;  4ED6 A;  1N8R T;  3L09 A;  1L3U A;  3HSJ A;  5H9F J;  3PKM A;  2H1Y A;  2F65 A;  4I7F A;  1OSD A;  3KHH A;  1RGV A;  3HHK A;  5ITH A;  4K4U A;  1GX5 A;  4F3Q A;  1U45 A;  4UZC A;  5J2N B;  5KFL A;  3R8Y A;  2IDE A;  3BRE A;  4C2M A;  5ETL A;  2AEF A;  1VC0 A;  1ZH5 A;  3VGT A;  3RB0 A;  1JLC A;  1NAQ A;  4RBV A;  3W9J A;  2Y8W A;  2XSJ B;  2PD1 A;  1EZZ B;  1KFD A;  1R6Y A;  2ILZ A;  2MQO A;  1WEL A;  3V6J A;  4LFC J;  3OL9 A;  3P96 A;  2FUG 9;  2AYE A;  3C14 B;  4U8Y A;  4J9R A;  3D6F B;  3UCZ P;  1HR0 F;  1HQ2 A;  1KLM A;  1RTJ A;  3AB2 B;  1RAF B;  3GB0 A;  1UEU A;  2W4C A;  2K3K A;  3ISN D;  3T19 A;  3BSC A;  3MHY A;  2E5L J;  2B6A A;  3K5O A;  2QTW A;  2I6W A;  4CLK A;  2WTF A;  3K58 A;  5LMN J;  4W4M A;  4NLG A;  2KTQ A;  1P9Q C;  1JJ4 A;  3ET6 B;  4GVB B;  4EK2 A;  1UVJ A;  1IN0 A;  2AYM A;  3D68 A;  1XR7 A;  3E8O A;  5AT1 B;  2KXN B;  3RAQ A;  3CD6 S;  2PI5 A;  3M6X A;  1NB2 A;  1S4E A;  2H54 B;  1T03 A;  1YJT A;  2W24 A;  4LMZ A;  2DBB A;  1SKU B;  3L3C A;  5KT7 A;  2BKP A;  3FZB A;  3MM5 A;  3HO1 A;  3TUZ C;  3PYF A;  4WFZ A;  5LOQ A;  4CTA B;  3SXL A;  1WI6 A;  4E98 A;  1TL1 B;  2FZC B;  2XZW A;  1E6Y B;  4O3N A;  5L1J A;  2J8A A;  3EPI A;  3OSP A;  2MGZ A;  5C24 A;  2DR5 A;  4ZKA A;  1WF2 A;  2EK1 A;  1RT7 A;  2B51 A;  2HQF A;  2MSS A;  4G1Q B;  4Q2L A;  5H1S V;  2W1B A;  4X4T A;  4TNO A;  3T6J A;  3TA1 A;  1S6Q A;  1OYD A;  4LUB A;  1XBW A;  4P2X A;  4TVA B;  2UVU A;  2FC9 A;  3CIM A;  1X4E A;  4ZIW A;  4FYY B;  2VQF J;  2LYV A;  1C1B A;  3POT A;  1YJ9 S;  2YNI A;  2XYP B;  5CCL A;  2F5G A;  1Q8I A;  3MR6 A;  2OP5 A;  1VHF A;  4OFZ A;  1U2C A;  4ECS A;  3I4P A;  3K8V A;  4NLQ A;  4RBT A;  5CD4 H;  1SKS A;  4KIA A;  2YPY A;  1RHK B;  2GS8 A;  4I2Q B;  2AYG A;  1H6K X;  2FLL A;  1FJ7 A;  2BJE A;  4FS2 A;  2X1A A;  2B9Y A;  2HS3 A;  1I5O B;  1U8W A;  2F1F A;  3A13 A;  2J6T A;  2UU9 J;  3FKB A;  3H42 A;  3L95 X;  3MM6 A;  1X9W A;  2J6U A;  2AW0 A;  1KTV A;  3KLE B;  2IA0 A;  3SCK E;  3KLE A;  4B9T A;  1ZM3 A;  2R3V A;  1R6V A;  1PYO B;  1VC5 A;  3QAU A;  3JS9 A;  1FJE B;  1CLF A;  4JI2 J;  3RB4 A;  4FBT A;  1WTF A;  2ZOG A;  4M5N A;  4FKX A;  4NMX A;  3MAA A;  3BSN A;  2RB7 A;  3NMR A;  3NGR A;  3OFH A;  3V6K A;  2Z4P A;  3H7H B;  3RAX A;  4CLU A;  3QGI A;  2V8V A;  4K2J A;  2FZG B;  3ZNU A;  1WI8 A;  4CO2 A;  1QAJ A;  4ICL B;  1R27 B;  4LF7 J;  3N9U C;  3KYL A;  5HK4 A;  4X66 J;  5IXU A;  5HJY A;  1RWN B;  1NSA A;  2VBZ A;  5ETP A;  5BYR A;  4CH7 A;  3QBC A;  2V5H G;  4A8S A;  3T5K A;  4J9O A;  7AT1 B;  1IKX B;  2LU1 A;  1NJW A;  2RD5 C;  2DIU A;  4J37 A;  4F0H A;  3P49 B;  3LOU A;  3LP1 B;  3VZI A;  4ZIV A;  2H5J B;  2CJY B;  4A8X A;  3CSK A;  4E0D A;  2KYX A;  3DC2 A;  4I2P A;  4PEO A;  3G8Q A;  4J9Q A;  2CNO B;  3J80 U;  3DRX A;  1DZ5 A;  1D8Y A;  2DEJ A;  1VS3 A;  3I96 A;  2CVE A;  2Z2Z A;  4L6V 3;  4B3T J;  2AZ1 A;  4DXL A;  3T1H J;  2DIV A;  4DWI A;  2EC0 A;  4JI8 F;  1U6F A;  4QIW D;  5GVQ A;  2E9R X;  2MKH A;  1LWC A;  3TZZ A;  3CTR A;  2V8G A;  1NK4 A;  2D74 B;  2LEC A;  3K17 A;  3A8I A;  3TEH B;  2PDA A;  1AUD A;  4QWB A;  3A3N B;  1ICE B;  4LSL B;  2H4W B;  1WHX A;  1L3S A;  1JJC B;  2E9Z A;  4WFA Q;  1ZM9 A;  1NKE A;  1XEZ A;  2GGP B;  5KG0 A;  2XB2 D;  1CUL A;  1H74 A;  1QE1 A;  1ZZF A;  2BV3 A;  3PYG A;  4H4M A;  4CYU A;  5KFX A;  1IBL F;  1DTQ B;  1GEH A;  3KUG A;  3VAK A;  4PXC A;  3AQO A;  3IBW A;  4M8L A;  4ZPV R;  1NHV A;  4LBH A;  5A8R B;  2M2B A;  4KFB A;  4OX6 A;  1D3W A;  1HL6 A;  3FUY A;  3ZO7 A;  1KTQ A;  1KFS A;  2J9C A;  3TR5 A;  3GJT B;  1LFW A;  1U1O A;  2COL A;  2PE8 A;  1BWV A;  2VAS A;  3T6B A;  3K8W A;  3G82 B;  2HRT A;  1FKP A;  1XMB A;  4Y00 A;  3BJY A;  2RUS A;  4RKU C;  4RW6 B;  4KHP F;  2GO9 A;  3LUY A;  5I3U B;  1EP4 B;  1SJR A;  2QA2 A;  3M8Q B;  1WOR A;  2U1A A;  4OLO A;  3DOM A;  4A8K A;  1UEV A;  1ZYQ A;  2VFU A;  4RL1 A;  4ZVP B;  3RRH A;  4JV1 A;  5A8K A;  2HRY A;  4B9V A;  1Y9O A;  2LXF A;  2Z56 B;  1FER A;  3K5L A;  3V4I B;  3DOK A;  5H9E K;  1LWC B;  4F2S A;  4O4R A;  1IXK A;  4DG1 B;  3GIM A;  1JB0 C;  4K4T A;  3HHL D;  3SCL E;  1TKZ A;  3TP2 A;  2ATL A;  3BN4 A;  2HS4 A;  4YEA A;  2QL7 B;  4OZJ A;  4NOH A;  2HHH J;  4LF9 J;  2ZKU A;  1NH7 A;  4GC7 A;  2MMY A;  4E8U A;  3BGL A;  3IRX A;  4RNH A;  4UT4 A;  1Q86 T;  2FJW A;  3MOZ A;  3PDN A;  4DL7 A;  3FBB A;  4FS1 A;  2RIL A;  4URS A;  4ZLN A;  3PIP Q;  5HN0 A;  1N34 J;  1Q82 T;  1KON A;  3M8Y A;  1N32 J;  4C9D A;  5H9E J;  2ADC A;  3K89 A;  3MR3 A;  4F4W A;  1HWK A;  2ZKT A;  4KT0 C;  3PVX A;  4QWC A;  4DSK A;  5EWG A;  2YNF A;  5HRO A;  4RWW A;  2JFD A;  2KT2 A;  5LSR A;  2MKC A;  3NP5 A;  1B0T A;  3W60 A;  3N01 A;  2M88 A;  2WVC A;  5KFR A;  2JNJ A;  3ENA A;  3QZ7 A;  4R0J A;  4DR6 F;  1H2V Z;  4YQW A;  1FF2 A;  1XK8 A;  3CJT A;  4IQM A;  1FRH A;  4JI2 F;  2N82 B;  4FYV B;  4F7V A;  3O2I A;  4DR3 J;  2CWK A;  2R2R A;  2I5J A;  4JI4 F;  4FVM A;  1HD1 A;  2UV8 A;  4C97 A;  1S1X A;  3QT7 A;  4ZPB A;  2PT0 A;  5DG7 A;  3JB9 k;  1QLN A;  1YBT A;  3G9C A;  3U27 A;  4OZN A;  2F8M A;  3UN5 A;  1J5E F;  2V68 A;  3TX0 A;  1WKK A;  3HVT A;  4KB7 A;  1NK6 A;  3M9N B;  1RP5 A;  1H72 C;  1U8S A;  1WKL A;  2NYI A;  1F5C A;  3E01 B;  2R9L A;  1U1N A;  2DNN A;  5GAD I;  1YKW A;  2AV5 A;  3R2D J;  1C2P A;  2ZUG A;  4YS2 A;  2QYC A;  4DV0 J;  1I3O B;  4TKT A;  2GV1 A;  4UW2 A;  4N41 A;  4ZCL A;  3TAM B;  1PYS B;  4TU7 A;  3R7B B;  1E6V A;  4F4A A;  3UW1 A;  2DPJ A;  2FY8 A;  1LQ9 A;  1VK3 A;  1ZPW X;  2MZR A;  2XI2 A;  3PW4 A;  3MI7 X;  3S01 A;  4DV3 F;  2DGU A;  3KKF A;  1K44 A;  2CPF A;  2D1C A;  5I4M A;  5DQG A;  1RE1 B;  2QFI A;  3AOB A;  3I6P A;  3FJ2 A;  3JTN A;  4UUX A;  1RTI A;  2CQ2 A;  4F4X A;  1PC4 A;  3OT9 A;  1OPZ A;  4XO0 A;  4USU A;  2C3P A;  3PW7 A;  1C4C A;  2MLY A;  3HPO A;  1SVD A;  1GK8 A;  1TEL A;  3MM7 B;  4J9U E;  4C0B A;  4KYZ A;  3LP0 B;  4DG1 A;  2ZUA A;  2XCA A;  3CMQ A;  3MEE B;  4H4K A;  1NME B;  2Y3Y A;  4OX9 F;  1QAX A;  2ZBQ A;  5D0H A;  3KTQ A;  1TKT A;  3ET6 A;  2NPI A;  1RHJ B;  1SC3 B;  2XYG B;  4R0E A;  2B6A B;  3LAL A;  2F8E X;  3DOM B;  2OO4 A;  3MCM A;  1RT6 B;  1XNR J;  3HVR A;  3T5J A;  3A8E A;  2YQ1 A;  4X4V A;  4P10 A;  1G3O A;  3MXH P;  2QL9 B;  2EFP A;  5CYJ A;  4LF8 F;  1AXQ A;  1U1K A;  4GVB A;  4NXM F;  2B8P A;  3G82 A;  3MZI A;  1VRT A;  3M8P B;  4M5J A;  4TLQ A;  2UXD F;  3KUH A;  2F9D A;  1W2B R;  3TUI C;  1WEZ A;  1Q8K A;  3MTJ A;  2YNG B;  1JLC B;  3CC7 S;  4IRK A;  2DKO B;  4JI1 J;  3RUB L;  5ETO A;  3NWR A;  4RJV A;  4FBU A;  4LF6 J;  1HYS A;  4F25 A;  2KFZ A;  2ATC B;  2R4F A;  5LSL A;  1CUL B;  2RIJ A;  3CJ3 A;  3IXQ A;  3JSY A;  3P45 B;  4AUK A;  2N3L A;  4PG8 A;  1NND A;  1SBR A;  4LBI A;  4LRC A;  3KK2 A;  4DL3 A;  4OYZ A;  4TYB A;  5F0U A;  2KH9 A;  4LR8 A;  1FX2 A;  4NA3 A;  5ETS A;  3HT3 A;  2WVE A;  4K7Q A;  3H5Y A;  1AYE A;  2ZH5 A;  1TR0 A;  3PX6 A;  1XNQ J;  3MMB B;  3TNV A;  1ELO A;  4NZ7 A;  4P6Q A;  1RU1 A;  2VUG A;  1Y10 A;  3A3O B;  4UST A;  4D3G A;  4O23 A;  5CCM A;  2CG8 A;  2W8L A;  3W8P A;  2XY5 A;  3D4J A;  2P9E A;  3W2W B;  3MCN A;  5KAK A;  3OPK A;  4EYH B;  2KHC A;  4V1A k;  1HNV B;  4NA1 A;  2R2S A;  2ZH8 A;  2ZH3 A;  1N5T A;  1B7F A;  1UZD A;  1S1T A;  5GAG I;  2VKR A;  3SQG B;  3UI3 A;  4GVL A;  4B02 A;  1I6J A;  2UUA J;  2ACM A;  2VBY A;  3M7V A;  4OJ3 A;  5F41 A;  2XY7 A;  1S0O A;  4NWB A;  2K06 A;  5J2P A;  3W3S A;  5HP1 B;  2AGQ A;  4ZCM A;  2P6S A;  4X4O A;  1DQ9 A;  2OI2 A;  3GYX B;  2QC3 A;  4ZP9 A;  4DR1 F;  4M5H A;  1TL7 A;  1OQ3 A;  1EAY C;  2VD3 A;  3B6B A;  3I5C A;  4PG4 A;  2ROP A;  4ZCI A;  4QCL A;  3OHB A;  4B3S F;  2C22 A;  1U4B A;  1CEZ A;  4J90 A;  5IQQ A;  2DR6 A;  3DRP B;  4P7T A;  4CP5 A;  1A6L A;  2XC9 A;  1C4A A;  1VDH A;  1RT3 B;  3OUY B;  2VQF F;  2OHD A;  3EGZ A;  3AHP A;  4JI4 J;  5C25 A;  4WFB Q;  2RS8 A;  2E1A A;  4WII A;  5K20 B;  1NUE A;  3IA0 A;  2GVD B;  2LQ5 A;  3FBC A;  2W4P A;  1XR5 A;  4NLV A;  3WIV A;  2B8Q A;  5F8L A;  3G6E S;  2FHM A;  3HHD A;  1YSJ A;  3NS7 B;  3DLG A;  2V94 A;  4AD6 A;  4NLD A;  2C2O B;  2MJU A;  3HJV A;  4NLP A;  5EDW A;  3J7Y U;  3MF5 A;  1N33 J;  3D6M B;  1WD6 A;  2BKN A;  3QIP A;  2LDY A;  5HI7 A;  3UPF A;  3PW2 A;  3G2X A;  2AJ4 A;  4LT6 A;  3VAM A;  4WU3 A;  5J2P B;  5DQI A;  3RTV A;  4V19 X;  1JNR B;  2D3O 1;  4B3R J;  2DK2 A;  4I64 A;  5J1E B;  2F3J A;  2WB4 A;  1S1T B;  3NOG A;  4NAS A;  3C46 A;  2K8G A;  2OD6 A;  3BM7 A;  4Y6I A;  1FFS B;  2BRL A;  2VC0 A;  1KD1 T;  4IRC A;  2ZBC A;  2LDI A;  4ATN A;  1N56 A;  3ZNJ 1;  3CUN A;  3QT8 A;  4JI7 F;  4HT7 A;  1NDL A;  1JMT A;  3QRP A;  4Q7A A;  4U9R A;  3CDA A;  1HR0 J;  2D3Z A;  4DEZ A;  1FVS A;  2HBQ B;  3LO3 A;  2C2R A;  1WHV A;  4WTO B;  3BYP A;  3ILJ A;  2UVW A;  4C8O A;  2CWX A;  2GHW A;  2WAQ D;  4CLY A;  1JXL A;  3R27 A;  3H40 A;  2VV5 A;  1CC8 A;  4WF9 Q;  2HG4 A;  4I56 A;  4ECU A;  2IBO A;  1UEK A;  2A0F B;  4TLR A;  4USJ C;  2AP6 A;  4OI1 A;  4BLG A;  2ZH6 A;  2YKM B;  3US5 A;  1TVR B;  4KPC A;  5IQ6 A;  1QVG R;  2M70 A;  2MYF A;  2R7R A;  1HWJ A;  3NL0 A;  1KVI A;  1FDB A;  5DM7 Q;  1FKP B;  3WQP A;  1HYS B;  3UWT A;  3VAG A;  2KO1 A;  3J7Y I;  2QG9 B;  4IYQ A;  2YNG A;  4MFB A;  2UP1 A;  4KFB B;  2VOD A;  3D1Q A;  1R0A B;  2F63 A;  1S7H A;  4UOF A;  3TJ9 A;  3DKD A;  2KYZ A;  3ETO A;  1DHM A;  4PQA A;  4ZCK A;  2A3J A;  4KJI A;  2E29 A;  3MUT P;  3GTY X;  3M9M B;  1CJK B;  2X7I A;  4LBP A;  3D67 A;  2MLZ A;  5ETR A;  2LLZ A;  5IFM A;  2E1M C;  1KHV A;  2D3U A;  4DLG A;  1VBY A;  5LXY A;  4DF8 A;  2DH7 A;  5FLX Y;  4XDD A;  1U6Z A;  4LSL A;  4Y2A A;  2QLF B;  3BO3 A;  4I67 A;  3CE8 A;  3EZU A;  2DGW A;  2KZZ A;  1Q7Y T;  4Q5V A;  4KTQ A;  1GMU A;  2IPO B;  4P75 A;  1TMM A;  1SC1 B;  1VFJ A;  1X4F A;  2BJ3 A;  5LMU J;  1YJU A;  4ZJL A;  3OFE A;  4OJH A;  2ZH7 A;  1FD8 A;  3QAT A;  2Y0B B;  4HAC A;  2HIY A;  2Z57 B;  4YY3 F;  3Q8P B;  2IDL A;  1UWB A;  2YNH B;  3GR0 A;  3ZTQ A;  1H3D A;  4NXN F;  3NNH A;  1CSJ A;  5EX3 A;  2AJ2 A;  2U2F A;  4CO1 A;  4QBU A;  1ACM B;  2A10 A;  2EVZ A;  1YJW S;  3BPS P;  2Z2M A;  3OSN A;  1K8A T;  3RAM A;  3M32 B;  2JFK A;  4FZV A;  1GNK A;  2MEW A;  1DQ8 A;  1YJV A;  1XER A;  4GO5 X;  5A8W B;  5F0W A;  1MWZ A;  1RAH B;  2L9W A;  4K8R A;  1B0V A;  4DSI A;  1AZS A;  1S77 D;  1CPZ A;  1OS5 A;  3KNG A;  2GQC A;  2DGS A;  4PXB A;  2VA3 A;  4HI1 A;  1RA7 A;  5KFQ A;  2ASJ A;  3G96 A;  3QGG A;  3VAI A;  5F3T A;  3Q8U A;  1VHI A;  3P5B P;  3D6H B;  2BM0 A;  1HBU B;  4QW8 A;  2QL5 B;  2ZOF A;  1IKV B;  4JP8 A;  3OVS A;  3H4D A;  4Z7Y A;  3HT0 A;  3LA0 A;  5M2U A;  3T5H A;  5I42 A;  1SL1 A;  3DRY A;  3NEK A;  2HGN A;  2PFD A;  3CDW A;  1HNZ J;  5B0D A;  1VRU A;  2E1P A;  3QNW B;  5IT4 A;  4ECY A;  3SCJ E;  2IBK A;  4LFB F;  1N5Y A;  3PJX A;  2DXE A;  1V3R A;  1B99 A;  1A7G E;  1RWV B;  1UMJ A;  2EG2 A;  1RT5 B;  4WK1 A;  2EFV A;  3ULH A;  1P6T A;  4C7Q A;  1S7I A;  3MD3 A;  1QDU B;  4IQX A;  3T1Y F;  1UVK A;  3LGH A;  4W92 B;  3DLJ A;  3HLU A;  1PBU A;  5DGB A;  1HA1 A;  1V5I B;  2CQ0 A;  4EO8 A;  1TK0 A;  2MZJ A;  3I5A A;  1XQI A;  3ZZP A;  5KFE A;  1NHU A;  2DVI A;  1KEK A;  3M1V B;  3IP0 A;  3W66 A;  2GVD A;  1SPB P;  2C2N A;  1IKV A;  1UWA A;  2KRB A;  1G1X A;  5T14 A;  3MCO A;  1D9D A;  2BE9 B;  3Q8R B;  1U1R A;  3W5Z A;  4U8V A;  4ZDN A;  4UY8 5;  1ZA2 B;  4DV6 J;  2KFN A;  3VCD A;  4WXW A;  4MKY A;  1Y4Z B;  1NHK L;  3A12 A;  5KFA A;  8AT1 B;  2B5J B;  2PN6 A;  4CCH A;  1JLQ A;  5CYQ B;  3R6L B;  5KG2 A;  4B9S A;  2DO4 A;  4OHX A;  1NEE A;  4ILR A;  1GX6 A;  4WWS A;  1UCN A;  4G1Q A;  1S9E B;  3HHL A;  4DR3 F;  3QJJ A;  4WYW A;  4O3R A;  3KJN B;  4KRW A;  3HSD A;  3PY8 A;  1SV5 A;  5D4L A;  3MM9 B;  2IYI A;  5D6G A;  3GE9 A;  4EZ6 A;  4IUF A;  3C2P A;  5KTQ A;  1PC5 A;  2APO A;  3W9I A;  5GAE I;  4HEA 9;  1RT1 B;  4HT5 A;  5ETV A;  4DQR A;  5FDL B;  2VDI A;  4F0M A;  2XWX A;  5L39 A;  2JL9 A;  3R7S B;  1S1W B;  3LPY A;  2GIF A;  4CQ1 A;  5A6P A;  4WXO A;  1VIS A;  2XMM A;  3I5B A;  4FDF A;  4NYO A;  4CH1 A;  3GV7 B;  2AT1 B;  4DV7 F;  4KO0 B;  1NDK A;  2Y1J A;  5F8G A;  1PAE X;  2AWZ A;  4DU8 A;  3NGU A;  4G6V B;  1T02 A;  4URQ U;  4JV2 A;  2Y9H A;  2UU9 F;  1KVJ A;  2VU5 A;  1BQX A;  2NUH A;  2XYH B;  2B9E A;  4WJB A;  2CQG A;  2GGP A;  3GJS B;  4K4X A;  1P1L A;  5AE1 A;  2HHS A;  1VQY A;  1MRO B;  3OJU A;  2GHP A;  3W1Y C;  3PIO Q;  2HIQ A;  2Q79 A;  2ZE2 A;  3MED A;  3M8S A;  2RRA A;  3M8P A;  4FF3 A;  4AE5 A;  5CZX A;  4NLS A;  4W98 A;  2YPZ A;  4DPT A;  3OVA A;  1PO6 A;  2FJV A;  1LKZ A;  3P4U B;  3QLH A;  4MYT A;  1VBZ A;  4B9N A;  3OTC A;  4IOA Q;  4OYM A;  1YHQ S;  3LP2 B;  4KR0 B;  4NZ6 A;  3R97 A;  5JVH Q;  4B3R F;  2RKI A;  4TQR A;  4OZL A;  3CJQ A;  2JEJ A;  1K1Q A;  3FQK A;  1BLU A;  1CBK A;  3BKU A;  1S6P B;  1VQM S;  4OQJ A;  3DLE B;  3U1N A;  4LF1 A;  5J2Q B;  3DDI A;  1WC5 A;  1U1M A;  4H54 A;  3UD4 P;  1R3N A;  3O8W A;  3N0V A;  1FKA F;  5F8J A;  2V4J A;  2ABY A;  3DU5 A;  4QR2 A;  1JLA A;  3GIR A;  1MU2 B;  2BEF A;  2H5E A;  2RRB A;  4ZVF A;  3R1L A;  1HQE A;  3HKW A;  5J1P A;  3OBI A;  2PSZ A;  2MKS A;  4AQY J;  1D09 B;  5DLF A;  5FD1 A;  1U1L A;  4JI0 F;  3HXM A;  4WKR A;  1REV A;  2C42 A;  2J8S A;  1BY9 A;  1J27 A;  4HI2 A;  3W7B A;  1T11 A;  2QX0 A;  4CLW A;  4NA2 A;  2FY1 A;  1SIZ A;  1KP6 A;  4ZJO A;  3SFU A;  3QIP B;  4J9M A;  3SV4 A;  4K4Z A;  2BQ3 A;  4RWX A;  4TY8 A;  3TAM A;  2HW3 A;  2UUW A;  3PRB A;  5E0O A;  3DI6 B;  4QWA A;  3MM8 B;  4DQS A;  2CPD A;  1AFJ A;  3QMQ A;  4L3K A;  2BX6 A;  2W9A A;  1QSL A;  4F8R A;  4PXD A;  3UE2 A;  3KLF B;  5D3G A;  1RTH A;  1YIT S;  3C3L A;  1F9H A;  2GJF A;  2GMJ A;  3R3T A;  2NSB A;  4KQZ A;  2RQC A;  2V2Z A;  2CQP A;  2V8P A;  2HEK A;  2F8H A;  5M2P A;  3GFH A;  3R7N B;  2HZV A;  4ID5 A;  3ZZU A;  4JI5 F;  1HW9 A;  1EQM A;  1HPZ B;  2DXF A;  2WRM A;  3MM6 B;  3M2V A;  3X3U A;  5KFW A;  4DSF A;  4UZB A;  3K5M A;  3UDV A;  3CD0 A;  2F4F A;  1JLE B;  3ENW A;  4A8Y A;  3SZ2 A;  3WC0 A;  2L41 A;  3UQS A;  1XMO F;  4ER8 A;  4PPZ A;  5DDP C;  1Q8L A;  5HMX A;  4F02 A;  4X66 F;  1WDT A;  1XNQ F;  1U25 A;  3KDO A;  1DAX A;  1N0U A;  1TAQ A;  4QJV A;  3MEG A;  5IZH A;  5DDO C;  2CG4 A;  2XHW A;  2CPZ A;  2KRR A;  2YXL A;  3GMG A;  3H5S A;  1V9O A;  2YWW A;  4KAI A;  5KG6 A;  3ZZY A;  2W9B A;  2FD2 A;  4TY8 B;  4HDH A;  2OEM A;  3CCS S;  2I2Y A;  2V0N A;  1VBX A;  1NK9 A;  1KC8 T;  1MLA A;  4OZ2 A;  5AXN A;  1LWX A;  3GFY A;  2ZDO A;  2ALY B;  2MQL A;  2X1B A;  5KFZ A;  4AL6 A;  1S0N A;  1T94 A;  4JI5 J;  3QJL A;  4OL8 A;  5DET A;  3D0G E;  3IFE A;  1YX2 A;  1LW2 B;  4ZVT B;  1NJZ A;  4PRF A;  5ETM A;  3A4T A;  4DV5 J;  1RAA B;  3MMB A;  3RJM B;  3DMJ A;  2MQM A;  3CED A;  4CTA A;  4IFV B;  4LSN B;  4GKK F;  1FE0 A;  4YR3 A;  1HFE L;  5A2Q U;  3MPU B;  4X65 J;  3L4B C;  2P9G A;  2ADB A;  2ERR A;  1VQ7 S;  1RTD A;  4B3M F;  1FTR A;  3KK1 B;  3SSR A;  4KY3 A;  2HFZ A;  3CCU S;  4BDP A;  1VRQ C;  2BAC A;  5DM6 Q;  1N4L A;  4ZVU B;  3DOK B;  3OXF A;  4ZN1 A;  4RNF A;  3GFZ A;  1Z2Z A;  5KT4 A;  5BXI A;  4ED0 A;  1NJX A;  1LK5 A;  2YKP A;  2IIH A;  4A8M P;  1D9A A;  4DI6 A;  2HVH A;  3H2V E;  5HLF A;  4J9L A;  2D9P A;  5HVF A;  1CJT A;  1RBA A;  4ZPT R;  1C1C A;  3LAN A;  1WF1 A;  2KVI A;  2HRU A;  3EE3 A;  3MPD A;  4RW8 B;  4DV1 F;  2UUA F;  3QWU A;  2H5I B;  4M5G A;  1EQ0 A;  2HND A;  1SJQ A;  5B09 A;  2L9N A;  1R89 A;  4DUY F;  5KG4 A;  2UVR A;  3W62 A;  4DUY J;  1IBL J;  1JLF B;  3R5B A;  4X62 J;  4LFA F;  2OEK A;  5DDR C;  2C2E A;  4IDK A;  5D4N A;  1WWH A;  2MZS A;  5J2N A;  3RBE A;  3OTO J;  1TVR A;  4QIG A;  1BQM A;  1R31 A;  4KPY A;  1QTN B;  3N4W A;  1XMQ J;  4S0M A;  4WZM A;  1CJU A;  4WE1 B;  2BMB A;  2KT5 A;  1RWP B;  4OYB A;  1UZH A;  1RXO B;  2V67 A;  4USW A;  4RNM A;  5KFD A;  1DRZ A;  1U49 A;  4ZPA A;  2H48 B;  3OR2 B;  4F26 A;  4A47 A;  1Q16 B;  4WTY A;  2RU3 A;  3OFG A;  4A46 A;  1NU4 A;  4WP8 A;  3LF0 A;  5CH7 B;  2ASD A;  1HNX J;  1RT1 A;  3MCS A;  3OTB A;  2XO6 A;  3CCJ S;  5KG5 A;  4U7C A;  1ZAW A;  2HFO A;  3ONQ A;  3I4H X;  1E6V B;  3MM9 A;  3NG8 A;  1HI8 A;  1N36 F;  2RT3 A;  3PO5 A;  1AB8 A;  4ZPD A;  2DRA A;  5EHH A;  4FYD A;  1LWF B;  2X3D A;  3GCW P;  3GWC A;  4HTI A;  5RUB A;  2MQP A;  4X4P A;  2OH2 A;  3CJ2 A;  1V5V A;  4QW9 A;  2RJZ A;  3QT5 A;  4KV8 A;  4UTG A;  5AXK A;  4CWB A;  4EFA C;  2OPP A;  5E41 A;  1N5Q A;  4OX9 J;  1G4C A;  4PPD A;  4ALZ A;  1U2R A;  2C3U A;  3CF5 Q;  1N32 F;  3QT6 A;  1UL3 A;  1N0V C;  2FJA B;  3CB4 A;  4RUA A;  2ZEJ A;  2B9X A;  3HFZ B;  4F04 B;  2FLN A;  2AD9 A;  2R7T A;  3M2U B;  2RF2 A;  2OKQ A;  3TJA A;  4OZ1 A;  2B3T B;  4DUT A;  3H5X A;  4PQU A;  4YP3 A;  3L9Z A;  1S1U B;  4ENO A;  1U48 A;  1HQU A;  4O3S A;  4RW4 B;  2ZHA A;  4MKV A;  3H25 A;  1DLO A;  3BZQ A;  4NML A;  5CA5 A;  5D8H B;  2FGC A;  3ILI A;  2XI3 A;  2NXC A;  3L7U A;  5C7P A;  2L08 A;  2R7Q A;  3VV2 B;  1VQO S;  3N6N A;  2XY6 A;  2HVE A;  1RHR B;  3UCG A;  5LJ5 Y;  3VQS A;  1VQ8 S;  2LMI A;  3FSY A;  2DNL A;  4CO0 A;  1WC1 A;  3RZA A;  4J7C A;  3CCE S;  2AHO B;  4N56 A;  2FHJ A;  1JIH A;  2W2N P;  2F40 A;  5CZV A;  1GFW B;  2Z2L A;  4M5L A;  3UVJ A;  3HD2 A;  3MAH A;  4UY8 T;  1S9G B;  2PA3 A;  2QA4 G;  5KFB A;  1I51 B;  2GJ2 A;  1RWU A;  2CQ3 A;  5MAO A;  3GIK A;  3AA9 A;  1I94 F;  3M8Z A;  4B9U A;  4K4Y A;  2HHV A;  4QR1 A;  2EK6 A;  3WX4 A;  2XGP A;  1YJN S;  1SJ4 P;  2XBP A;  1HNV A;  4XIU A;  2CPE A;  4M5K A;  4RW9 B;  3TZW A;  2V9K A;  2IJF A;  1HBM B;  1RT2 A;  3C6T A;  2V50 A;  4BWM A;  3V5R A;  4PWU A;  2ZH9 A;  2R8H A;  3C6U A;  5MLC V;  1OY9 A;  4PG7 A;  2X51 A;  2DJW A;  2HVI A;  2D9O A;  5F9N A;  3LAK A;  2RQM A;  2KZM A;  4RO0 A;  5GMK a;  1U02 A;  3G8T A;  4WE1 A;  4DN0 A;  5F8N A;  4U7U K;  3QRQ A;  3KK2 B;  4JYA F;  1W2I A;  1QVF R;  2ROG A;  1PIE A;  4WFY A;  5E3A A;  5B0E A;  4ANC A;  4DPW A;  5CD4 A;  4TQS A;  3QZ8 A;  3BO4 A;  2EFO A;  2F9J A;  4I69 A;  4ED5 A;  2NXN A;  5IM0 A;  4HAC B;  1SC6 A;  2XWY A;  3VAH A;  1M1H A;  4DV4 F;  4ED8 A;  4WKY A;  2UVV A;  1IJE B;  2I8E A;  2XMU A;  2HSE B;  3HKZ D;  4RNO A;  3DLH A;  1RQ0 A;  2BJ7 A;  4RPF A;  1UJ4 A;  3DM2 A;  2G2Z A;  1FRX A;  3EVO A;  3TZX A;  4NCG A;  3ITH B;  4F50 A;  2HQD A;  1TV6 B;  1QE1 B;  2N4D A;  3GJQ B;  2OFH X;  2KVQ E;  4LF5 F;  3DLK A;  1C1C B;  4NLU A;  1D8Z A;  4K5R A;  3KMS A;  2UXB F;  4LF5 J;  2OML A;  1DTT A;  1FI4 A;  2EC2 A;  4C3K A;  4N8O A;  1IBK F;  3JTO A;  4N5S A;  1Y7P A;  5EWE A;  3CJK B;  2CVI A;  2KG1 A;  2GIQ A;  2B9W A;  4MH8 A;  4HH1 A;  3SMZ A;  1BWE A;  4NCG B;  4DSE A;  2CJQ A;  4OX7 A;  3OL8 A;  5CYM B;  2GC8 A;  3C16 A;  1EKS A;  1EB0 A;  3JSR A;  2KHD A;  4ZP6 A;  2I9S A;  2PO4 A;  4JI6 J;  1NKB A;  2O67 A;  4JYA J;  2IC3 B;  2QRR A;  2IFX A;  4DL6 A;  3KWM A;  2BQR A;  2LQ8 A;  3QSY B;  2JEI A;  1BMQ B;  3VTI A;  5DGA A;  3BGF A;  4I7F B;  2O5D A;  4QZV B;  4WIQ A;  1Z1Z A;  2CJK A;  1FX4 A;  2ZWO A;  4LF2 A;  3I9Z A;  4FXD A;  1JJH A;  1KHW A;  4OHY A;  1F3V A;  1HNI A;  2GFF A;  2FJX A;  1B3T A;  2HNZ B;  3CD5 A;  4IR1 A;  3J80 Y;  1T9T A;  3O3L A;  3QPI A;  3O6Q A;  3W2V A;  5KOW A;  1WSV A;  3O5T B;  5IV4 A;  2NZC A;  1RT4 A;  2RQ4 A;  1UFL A;  3M8W A;  5HAO A;  4Y2M A;  3DOL A;  3SV3 A;  4DCP B;  1S48 A;  3I0R B;  1LV5 A;  1GXL A;  1XTZ A;  2KXH A;  5T41 A;  4DHV A;  1OMS A;  4DU7 A;  2G2O A;  4R5P A;  1S9G A;  2BE7 D;  1WTB A;  4DUZ F;  1R8H A;  2C3M A;  4BHQ A;  3N6L A;  4ILL A;  1HNW J;  2DNG A;  3UVJ B;  3M2V B;  5F3Z A;  1VIX A;  1NSQ A;  2VC1 A;  2AF6 A;  1M5H A;  2WSF C;  2IJR A;  2JX2 A;  3EGW B;  4IFY B;  2OPS B;  2AZ3 A;  3BS9 A;  2W9C B;  4M5D B;  1I1G A;  4DFP A;  1R8C A;  1SL2 A;  1IM4 A;  1X4D A;  4KGV B;  2Y1L B;  4LSZ B;  2VG5 B;  5GAH I;  3CCQ S;  3K0J A;  2CAD A;  4HDG A;  2NZ4 A;  1O5J A;  2AX1 A;  3PXG a;  4JI7 J;  2FVP A;  2IRU A;  3U7J A;  5KFO A;  3ELH A;  4QIV A;  2FJD B;  2D3O R;  4PQU B;  2WON A;  2B4U A;  4O3O A;  1SH3 A;  3M2U A;  1RA6 A;  4C11 A;  3UR0 A;  2X3G A;  4IO1 A;  4CLT A;  2BM1 A;  2HS0 A;  1Q0N A;  3W64 A;  3KG0 A;  1PJ5 A;  5F8M A;  4ZJQ A;  5L1I A;  1H98 A;  4LF4 J;  2DH9 A;  3DGP A;  3KG4 A;  2YVS A;  3OXG A;  1OPI A;  2BJD A;  4OYI A;  7FD1 A;  3I55 S;  4AL7 A;  1X0P A;  3DOL B;  3WHI A;  5U47 A;  2GX8 A;  2J7W A;  3ZZR A;  4DS4 A;  3HF5 A;  3JYT A;  2DHA A;  4DDF A;  2AKW B;  2LCW A;  1RT4 B;  3CT9 A;  2CQB A;  4ED3 A;  1X4B A;  1NK8 A;  5A0Y A;  1SCJ B;  2E5L F;  1H73 A;  2HBR B;  4EMD A;  2VF3 A;  3V6D A;  3MMC A;  4NE9 C;  2KFY A;  2EXU A;  5ETN A;  1QJH A;  4ID8 A;  2OPQ A;  4A8F A;  4ZHR A;  1YJR A;  5B0F A;  2NRE A;  5HSP A;  2IA6 A;  4IKA A;  1X5O A;  4LRE A;  4J9S A;  2DNR A;  1NDC A;  4DZD A;  2MY7 A;  4URG A;  3MEC A;  4DBQ A;  1X8D A;  1RAO A;  3M2R B;  3I9V 9;  3RGI A;  3THP A;  3ZZT A;  5BR8 J;  1UVL A;  4NL5 A;  1SIW B;  1QD1 A;  3TVK A;  1FKO B;  4WFX A;  3VZH A;  2RDJ A;  2DO0 A;  2WK4 A;  3R6G B;  2NUU G;  2HBY B;  1UA0 A;  5CQG A;  2IVF B;  3FCW A;  2CXE A;  4LFA J;  2VZ9 A;  1L3T A;  3EM1 A;  3J7Z T;  3QSI A;  1S6U A;  4H4M B;  2WOM B;  3NGK A;  2DNO A;  1NCL A;  2P5V A;  4CNZ A;  5C5J A;  2P9C A;  3AXM A;  1PJ7 A;  1SQG A;  1JLB B;  3IM8 A;  5HQM A;  3MUR P;  2UZA A;  1NK5 A;  4ILM A;  4OYX A;  2KB2 A;  2M3D A;  4RW8 A;  4DX5 A;  2MKI A;  1WG5 A;  1WNE A;  2GQ2 A;  2QE5 A;  4J9K A;  1N52 B;  5DG9 A;  2AGO A;  4Q45 A;  4K5S A;  2FYX A;  3M30 B;  4IH7 A;  1RWO B;  1KWM A;  4ZHR B;  3MR2 A;  2YKO A;  4C8L A;  1S6O A;  3D7S B;  4QIF A;  4USV A;  4O44 B;  2CQ4 A;  1U0S A;  2Q6C A;  3QID A;  1UW4 A;  2CFX A;  2Z0G A;  1YWX A;  4P52 A;  4ECW A;  4CO5 A;  2IHR 1;  2CDR B;  2CJ9 A;  3OFF A;  1JK9 B;  4L73 A;  1RTD B;  3O44 A;  4RW7 A;  2BUN A;  1VK8 A;  4OLP A;  4ZLJ A;  2E5J A;  4DQI A;  1KDN A;  1SJ1 A;  4RBU A;  2ALZ A;  4K4V A;  2J5A A;  1IWG A;  1WJ9 A;  4R25 A;  4DX8 H;  5B7W A;  1JQG A;  5FII A;  3UN2 A;  2XUL A;  4FP9 A;  3I56 S;  3LPE A;  4DV7 J;  2E5I A;  1MG7 A;  2XS2 A;  3TA0 A;  2VL1 A;  3AJD A;  6AT1 B;  2Y1I A;  2G2Y A;  1IR1 A;  4USM A;  4USI A;  1NZ8 A;  2CNN B;  2RE1 A;  2XEX A;  5CAA A;  4K0K F;  2BA9 A;  3QYY A;  2JWN A;  1JKH B;  2JZ5 A;  3HI9 A;  2ASL A;  5E2Q A;  3SYZ A;  3G71 S;  1SKR A;  2LQJ A;  2BXJ A;  4G65 A;  1U2F A;  5KFG A;  2HMI A;  3J7A N;  1SL0 A;  2D69 A;  4EGL A;  2XNR A;  4FF1 A;  3HVT B;  2KKH A;  1CC7 A;  2LXU A;  1V3S A;  1LOU A;  4Y28 C;  1UVM A;  2A2D A;  2YQ0 A;  1P9Y A;  1RT5 A;  4DPU A;  4NLX A;  3KHL A;  1N5Y B;  1TFY A;  1TP7 A;  5DJB A;  2HHQ A;  5E3Q A;  3ZTO A;  1T3N A;  2DR9 A;  4ETX A;  4OI0 A;  4ID5 B;  2DT9 A;  2J7K A;  2HK3 A;  1RWW B;  1CJV B;  2XZT B;  4C0O C;  3I0S A;  4F36 A;  4Z7C A;  3BDP A;  1GXU A;  3LW5 C;  2J0Q D;  4C6A A;  1WHW A;  4DV6 F;  3CJR A;  3IR7 B;  3F56 A;  2HHP A;  4O4G A;  3U1M A;  3LAM A;  3BQ2 A;  1C1B B;  2FQQ B;  3H0P A;  2CUY A;  5T7L B;  2YNF B;  4L76 A;  5HRO B;  2FPH X;  1GT8 A;  3T5L A;  1XMQ F;  4L74 A;  2XSF A;  3WX8 A;  2OIH A;  3KDN A;  4MJK A;  1S6Q B;  5KFC A;  2QEX S;  4OI2 A;  1IQZ A;  1LWF A;  3PFO A;  5EUH A;  3RW7 A;  2AX0 A;  3AD9 C;  1RCO B;  5E7O B;  1T05 B;  4B9M A;  4IR9 A;  4K4S A;  3IRX B;  4UOC A;  1N6Q A;  4ERD A;  3H8Y A;  1SC4 B;  3G6X A;  3D9B A;  2DRD A;  4Q44 A;  4NI2 A;  4XDC A;  1FK9 A;  3HDS A;  3TRG A;  3RR7 A;  2LEP A;  1YRT A;  4NRT A;  4RW7 B;  5HVH A;  1U1Q A;  2J9D E;  1Q78 A;  2HKE A;  5IOL A;  3PJW A;  3DYA B;  2B4O A;  1M1G A;  4F67 A;  2QJ3 A;  4Q43 A;  1TMJ A;  1FWP A;  1O8B A;  2UUC J;  1Q5V A;  3R1H A;  4OZ3 A;  1F5B A;  2M52 A;  4I6A A;  2LEB A;  5A8K B;  4DSL A;  2P8I A;  2RKI B;  3KLH B;  4DV2 J;  4B3M J;  1DAR A;  1DTT B;  2HZC A;  1X4G A;  2R2T A;  3M8Q A;  5HBM B;  1H38 A;  2EWH A;  4PR6 A;  1N54 B;  2M4M A;  2I0X A;  2XMV A;  2G1D A;  2N7Y A;  4WU2 A;  5KFS A;  4F4K A;  3CJS A;  3SDE B;  3HCX A;  3QRR A;  2R7S A;  2QSF A;  4ZMM A;  2F4V F;  2NXJ A;  1RAD B;  2ZE2 B;  3MED B;  5LM7 E;  2ZM6 F;  1T9W A;  3P5T L;  4NLW A;  2FLP A;  1RYR A;  5CXT A;  1GAO A;  3W9H A;  3SDE A;  3ZTS A;  3AY0 A;  4DV4 J;  4EI2 A;  2A18 A;  5KFK A;  1URN A;  1RWK B;  3IGV A;  4ZVS B;  4QPX A;  1RI7 A;  2QA4 S;  1M90 T;  1X5T A;  2FHJ D;  5LMU F;  4C8K A;  3TUJ C;  2XS5 A;  1TFW A;  2DY1 A;  1URR A;  4X64 F;  5K8P A;  3PZP A;  2RU9 A;  1Z4U A;  3CVK A;  1YQH A;  3PYE A;  2OD4 A;  2QIF A;  3K5N A;  4LRF A;  2VKZ G;  5JVG Q;  2GA7 A;  3BSA A;  5HAN A;  2L9D A;  5D15 A;  4QWD A;  5FDL A;  1Y5I B;  2VFV A;  4YN3 B;  1HBM A;  1RT2 B;  5ADZ A;  1IBM J;  2R8K A;  2G1H A;  2GJI A;  2RVJ A;  4IH5 A;  4CT9 A;  2H4Y B;  1VLO A;  2CPI A;  4Z2X A;  3KLG B;  2ZJQ Q;  3C15 A;  3K57 A;  1K0T A;  3UD3 P;  4C3L A;  3QAE A;  4CNY A;  2ZC3 A;  2VG6 A;  2OTL S;  1ROF A;  4IH6 A;  4PYD A;  5A0Y B;  4XPE A;  4KH1 B;  2GO8 A;  3GII A;  1Q81 T;  1IKY A;  1JJ2 R;  4IRD A;  2POK A;  1FD2 A;  2DB1 A;  2JLE A;  1R0C B;  4I1T A;  2MPU A;  1MNE A;  3BH7 B;  1RK8 A;  3Q2S C;  4QYR A;  4NZ0 A;  3IBC B;  5HMY A;  2VON A;  3EGN A;  4DCO B;  3MFH A;  2Q1L A;  1F1B B;  1RTZ A;  1RAB B;  2BW2 A;  4JV5 J;  4USH A;  3CCR S;  2FIU A;  1FTC A;  2HWT A;  4X84 A;  1RJJ A;  5DZ6 A;  4DR2 F;  4RR5 A;  4C11 B;  3PEJ A;  3BBF A;  4OJ1 A;  1LXN A;  3OV7 A;  3H20 A;  4NCB A;  2OTJ S;  1T9Y A;  1WDD A;  2VPW B;  1FXR A;  3G87 A;  1UA1 A;  2XZD B;  2PMH A;  2WBR A;  2V8H A;  2VOO A;  3M05 A;  2RF2 B;  3B4M A;  3OTD A;  2B0G A;  2BYC A;  4ZP8 A;  2YY3 A;  4X4S A;  1FT8 A;  2JOQ A;  1T3O A;  2ZFH A;  4P7V A;  1NSP A;  1U6B A;  1FXD A;  4M1K A;  2EFG A;  2OPS A;  4LF4 F;  4Q8F A;  4LVN P;  1S57 A;  3OD2 A;  2HMI B;  1VGY A;  2E7X A;  3FK4 A;  4LF7 F;  2JDJ A;  2DNQ A;  1TL3 B;  2EFN A;  3KUE A;  5DO2 A;  1WOO A;  3UO0 A;  4ECQ A;  3RBZ A;  4UQG A;  4DJB A;  4R5P B;  2QLB B;  2CJX B;  4NLY A;  1BUX A;  3T9N A;  4P2F A;  1MMN A;  5KFM A;  2H51 B;  3T1A A;  5KFT A;  3UR3 C;  1N34 F;  2QYG A;  3NXZ A;  4ZP7 A;  1N36 J;  2VFS A;  3GR1 A;  3ISZ A;  4PKD B;  3NNA A;  2FC8 A;  2NQP A;  5LMN F;  3CGI A;  2V34 A;  3DFE A;  3POT B;  2EPI A;  4ELU A;  1AZS B;  2E5G A;  2CPJ A;  3HFV A;  1X7V A;  2V2Q A;  3PTW A;  4CLL A;  3M9O B;  3W2V B;  2DNM A;  2P2C B;  2AJF E;  1Y5L B;  1HD0 A;  3CCW A;  3BN7 A;  5B0B A;  5LL6 d;  3JAM U;  3MTK A;  1S76 D;  4LFC F;  1G2E A;  4P2S A;  1HNI B;  2Y0S D;  2MKY A;  3FBF A;  3OR1 B;  3CD7 A;  1CJU B;  5IC4 B;  3TJ8 A;  3J81 j;  4IOC Q;  1TK8 A;  3WC2 A;  2V4J B;  1MML A;  4HTJ A;  1NBE B;  1VJQ A;  1SUQ A;  4F3O A;  3CCZ A;  1X9M A;  2GZO A;  2O01 C;  2YBV A;  2DGV A;  1O51 A;  3DLE A;  4UF4 A;  1RHQ B;  1L3V A;  4PWD A;  3BSO A;  4ES2 A;  3FRY A;  2K7J A;  2FZK B;  4DR7 J;  4ITS A;  1HKA A;  2Z58 B;  3FRZ A;  2G0J A;  4XAK A;  2OFG X;  1QM9 A;  3DNC A;  5JXS A;  5IWA J;  1NSK L;  5FLX U;  1IKW B;  3Q0A A;  4K4W A;  2NYH A;  1R7I A;  2FJE B;  4M63 A;  1VQ4 S;  2JHE A;  3CJ8 A;  1SB6 A;  1UPP A;  4PAB A;  5HBM A;  3T3F A;  5KT3 A;  3NMA A;  1CJT B;  1JLB A;  3NGT A;  2C2K B;  4DV1 J;  2K1R B;  1FJC A;  1LXJ A;  4I4B A;  3PW5 A;  2VQE J;  2C2Z B;  3RG6 A;  4Y3C A;  1NRK A;  1TKX B;  2HQ3 A;  3I87 A;  2O3D A;  3P6Y C;  2A6M A;  2VJV A;  2UUB J;  2ZJP Q;  1HWU A;  2XSJ A;  3UFC X;  3DM2 B;  3VVU A;  3CJ5 A;  5BR8 F;  3MR5 A;  1VIO A;  1T8E A;  3KK1 A;  4QQB A;  1Y5N B;  3MEK A;  1TUV A;  4OYP A;  1ARO P;  1OY6 A;  4KH0 B;  3TX8 A;  2EBG A;  3CMA S;  4W90 B;  3DMJ B;  3T1H F;  3IS9 B;  5HVG A;  4JI8 J;  3EMT A;  4NI2 B;  4O3Q A;  3QFH A;  1VQL S;  1FRL A;  1UTA A;  4PG6 A;  3QJP A;  4IOB A;  3FMB A;  4I0W A;  2IJN A;  3LWM A;  4KC5 A;  2AJ1 A;  2RML A;  4F0K A;  2FVQ A;  2PII A;  3B78 A;  3UNY A;  2XNQ A;  4A48 A;  2G13 A;  5F8H A;  4ELT A;  4CLF A;  2R8J A;  3FQL A;  1JXV A;  3MMA B;  5G0R A;  3V2U C;  6FD1 A;  1FNX H;  1LW0 B;  1KNZ A;  1LFP A;  3NKY A;  4LJM A;  1PKU A;  3J7Z 5;  3HZE A;  2KM8 C;  1KBR A;  2W9B B;  4LQ3 A;  4ZVH A;  2LKZ A;  3SEO A;  3HFK A;  1UJ5 A;  1YBA A;  1GMW A;  4TYA A;  1W25 A;  3EPG A;  4MK9 A;  1HNZ F;  2UUC F;  2JVR A;  5D4P A;  5GMD A;  3AA8 A;  3NAI A;  5KFI A;  3I0S B;  3ZZ0 A;  5GAG U;  4YB1 P;  1K9M T;  1UJ6 A;  4BWJ A;  3Q22 A;  3N28 A;  1F2G A;  4PXE A;  4B9L A;  3CCT A;  3EVW A;  1VYA A;  3BB5 A;  3TA2 A;  5L9N A;  4KGM A;  1ZTT A;  1G7C B;  4IG0 A;  1TQL A;  1YG0 A;  3PFE A;  1RBO B;  1FWK A;  4M5I A;  4DF4 A;  2VG7 B;  4ZA1 A;  1EJ7 L;  3HVA A;  1YI2 S;  1SJF A;  3H5U A;  4P72 A;  3IC1 A;  3VGS A;  5A76 A;  1S0V A;  4LIW A;  2CJB A;  3BGR B;  8RUC A;  4ZVE A;  3THV A;  3TW0 A;  4ZVQ B;  3ZTP A;  1M5S A;  1TTH B;  2ZZT A;  1YRX A;  4IG0 B;  2GIR A;  2W4D A;  5B0G A;  1UKU A;  1S99 A;  3AOA A;  4CT8 A;  3HP6 A;  3MAQ A;  3VAL A;  4USK A;  1VQ6 S;  1TL5 A;  3R5C A;  4FF4 A;  3DRP A;  1T95 A;  1VRU B;  4YHH J;  5KFN A;  1JLG A;  2CRL A;  2VFR A;  4JBC A;  1XN9 A;  1T9U A;  2VPX B;  4CH0 S;  3ZZZ A;  5J2M A;  1DBD A;  3NRB A;  1H7X A;  5SUH A;  3FCH A;  5HO4 A;  2W2P P;  2OPP B;  1VQ9 S;  4WCE Q;  2HWH A;  1HQE B;  3ZFV A;  1WF0 A;  2XO7 A;  4RUH A;  1JNZ B;  3BDE A;  4AQY F;  2V2K A;  1T7P A;  2GHV C;  2HFN A;  2ZBP A;  2JLF A;  3B8H A;  5E3R A;  4YB7 A;  2UXD J;  1APS A;  3EUN A;  4BBY A;  4NEY A;  2IM3 A;  2BE2 B;  3KLG A;  2NLW A;  2JC1 A;  1WG1 A;  1PYT A;  4R8U B;  1OO0 B;  4DPY A;  3MUV P;  1BXN A;  1RAC B;  1NDP A;  2CQC A;  3IGN A;  3MR7 A;  1H0H B;  5LT5 A;  2MQQ A;  1J5O B;  4XTT A;  2JH3 A;  2MST A;  1SQF A;  3S7R A;  1FDD A;  2DIS A;  2XCP A;  4ED4 A;  3BQ1 A;  4B3O A;  3G6V A;  1RDR A;  2CPH A;  1TUW A;  3RRG A;  4JI3 F;  4GKJ J;  3PNI A;  5DDQ C;  1KS2 A;  2AQ4 A;  4DR4 F;  1R43 A;  1PSD A;  1RKI A;  3AJ1 A;  3IWX A;  2CDQ A;  3CW2 C;  4UOH A;  4K50 A;  5A8R A;  3D3C J;  2ASY A;  1NB7 A;  2HFS A;  3I32 A;  3VVT A;  4ECT A;  4GKK J;  2YTC A;  1X5P A;  4H4O A;  1S4F A;  3DRS B;  4OMF G;  1U1P A;  3MPV A;  3DRS A;  3TZY A;  4DSJ A;  5DRK A;  1UAW A;  3KOA A;  2HAF A;  2YKQ A;  3B4D A;  3TO8 A;  2K1R A;  4Y2C A;  3V6H A;  2NCK L;  4I6Y A;  5IT9 Y;  2HFU A;  4D3H A;  2IAJ B;  1FWL A;  3ENQ A;  1XNR F;  5L46 A;  1VRT B;  2MDA A;  1TV6 A;  4MYU A;  3FGV A;  1Q4R A;  3PCO B;  1NJY A;  2L48 A;  2LQ9 A;  4WK3 A;  2M9K A;  4NX9 A;  2C3O A;  4LRB A;  1RT6 A;  1F3F A;  1YZ6 A;  2HVD A;  5AE3 A;  1Y3J A;  1TU0 B;  2V69 A;  5B08 A;  5C2G A;  4V19 J;  4PWD B;  3AOC A;  1T0T V;  1U09 A;  2ZD1 B;  4ZVR B;  4LR7 A;  3PX4 A;  3FFI A;  1Y00 A;  4RZR A;  3QWP A;  2PFF B;  1SUQ B;  1WOS A;  2BR0 A;  2BQU A;  2GVZ B;  2HHX A;  1AA1 B;  3OTE A;  5SZT A;  1J2V A;  5EWF A;  1H2T Z;  3DRR A;  2XLK A;  1S97 A;  1VQN S;  2DGX A;  3TVY A;  2E66 A;  1Y3K A;  2LEA A;  2HPU A;  1S72 S;  4MKA A;  3GG0 A;  3TI0 A;  4DQP A;  1DUR A;  1PIL A;  4UUW A;  3BO2 A;  1N6Q B;  2Q66 A;  1GXT A;  3D0H E;  2ZBI A;  3FZ2 A;  2I1R A;  2YWE A;  2V2V A;  4P2M A;  3KK3 B;  3EDQ B;  4OHW A;  2OEJ A;  1WHY A;  1I94 J;  4GRS A;  1F0X A;  1TL4 A;  3AJ2 A;  3PG9 A;  4OV6 A;  1NK7 A;  2QMX A;  3U02 A;  2R8G A;  4IG3 A;  5J1E A;  5HL7 Q;  2NSC A;  1BE4 A;  3S6E A;  4LR9 A;  4HVZ A;  2V4Q A;  3M1V A;  1FDN A;  3OQ2 A;  3DLB A;  2FJB B;  1FRK A;  2VG5 A;  2XMJ A;  4KKO A;  4U96 A;  3PX0 A;  1VQP S;  1J5E J;  1QSY A;  5KFU A;  4MIW A;  2AU0 A;  3AXK A;  3QGP A;  4KHR A;  3S1T A;  3VAF A;  2RNE A;  2JEF A;  2J0X A;  5HJX A;  2YKN A;  2I5J B;  1VQK S;  2HQI A;  3CWJ A;  1N5V A;  2DCU B;  2PMW A;  4RW4 A;  1NPR A;  3D5M A;  3AH6 A;  3UNG C;  4G1I A;  1ZS6 A;  2DEI A;  3NBP B;  3JSM B;  2E7W A;  3B54 A;  4NLO A;  3DDK A;  3NLC A;  4C8N A;  1GMV A;  4HYK A;  3NY0 A;  3JQM A;  3PEH A;  2GAG C;  3R5G A;  2VIH A;  4X64 J;  1Q79 A;  1H7W A;  3G4S S;  5KFV A;  1HWI A;  1XJW B;  4C0H A;  3KMQ A;  2RQK A;  1WUU A;  2BKO A;  1ZBT A;  3V4M A;  4QU6 A;  3RB6 A;  4Q0B A;  1F2H A;  3IO1 A;  2BAN A;  4CM0 A;  1U24 A;  3W8G A;  3GV5 B;  1AW0 A;  2IRX A;  4ED1 A;  1EET B;  2IVY A;  4Y34 A;  4M94 A;  3BKT A;  2W7P A;  4DL2 A;  3BEG B;  4DL0 C;  1HI1 A;  5LXR A;  2NS1 B;  2ZNY A;  3GSD A;  1VCT A;  1T9X A;  2K7K A;  3OL7 A;  1E6Y A;  3BBB A;  2F4V J;  5BYQ A;  3Q8S B;  1RSC A;  3MMJ A;  3KHG A;  1ZET A;  3HK2 A;  1LWE B;  9ATC B;  4J91 A;  4YY3 J;  3EWG A;  4I6W A;  5ETQ A;  4X4U A;  1FRM A;  2B7B B;  4JV5 F;  5J2Q A;  3PR5 B;  2ACY A;  5CYM A;  3VQT A;  1SQE A;  2AYB A;  2ZWP A;  4MIB A;  4BC9 A;  1QUP A;  2RUG A;  4GMK A;  3CJK A;  2IM0 A;  2Z8Q A;  1YDL A;  1GTH A;  3MFI A;  3UCU P;  4FNI A;  1FCA A;  2NPF A;  3CPW R;  1BQM B;  4MK8 A;  3DLK B;  1BQN B;  2GMH A;  1XC9 A;  4ELV A;  2R7U A;  3C14 A;  2VQE F;  1RU2 A;  2CYY A;  2B4P A;  1FFG B;  4X62 F;  3GPA A;  1VC6 A;  2QO3 A;  1B7Y B;  1C0U A;  3AD7 C;  1UET A;  5HQ8 A;  1R0A A;  3VGU A;  4DV3 J;  1MRO A;  2AEM A;  1MN7 A;  3QQC D;  2OPR A;  4L72 B;  4MFB B;  4ED2 A;  1QAI A;  3IWN C;  1DY3 A;  3GON A;  2XLI A;  3Q8Q B;  4XK8 C;  4DR7 F;  3BR9 A;  8ATC B;  4CYU B;  2DGQ A;  2YWH A;  1S49 A;  4CLP A;  3CJ4 A;  5D0G A;  4AYB D;  1NO8 A;  1RAI B;  4ZPW R;  4JB8 B;  1FFW B;  5K8N A;  2CIM A;  4KO0 A;  4DR5 F;  2AJQ A;  1F9E B;  2MZQ A;  2HNY B;  4ZN3 A;  2FGO A;  3DLL Q;  1U26 A;  3NGS A;  3M2R A;  3WZ0 A;  2ZVS A;  3CCL S;  2B56 A;  1HBN B;  3BYR A;  3V6D B;  3C6U B;  1HMV B;  4HHU A;  1WC3 A;  2QSW A;  2GW8 A;  2FTR A;  3HUL A;  3QGH A;  2WVB A;  4N8N A;  4CO4 A;  7FDR A;  4PZV A;  4WBF A;  2AEJ A;  4IFV A;  4KGK A;  4LSN A;  4P9S A;  1Y0H A;  3T9Z A;  2X1G A;  2VOP A;  2KL8 A;  4YME A;  2B7C B;  1K73 T;  1LK7 A;  2KN4 A;  2QFJ A;  4J9P A;  3MMC B;  2GAH C;  3N5B A;  4FPI A;  4FYW B;  1VI7 A;  2GCF A;  2CZV C;  3CIZ A;  4LRA A;  4MT1 A;  4PAA A;  3PO4 A;  2N4C A;  4DR6 J;  3EIC A;  1HAR A;  4DV2 F;  2CQ1 A;  4ECV A;  3CC2 S;  5L1K A;  1AFI A;  1TL3 A;  2WBM A;  1NZA A;  1R8B A;  1UFW A;  4P71 A;  2EW9 A;  5GAH U;  2MZT A;  3GIL A;  1T05 A;  1PAU B;  5L9X A;  3D3B J;  1IBC B;  2LA4 A;  4HH0 A;  1VOM A;  2BAN B;  2UXC F;  3RW6 A;  2B5J A;  1KQS R;  3DGP B;  4OJG A;  5CAB A;  1MW7 A;  1QAY A;  3BGR A;  1WEY A;  4PWW A;  4O4G B;  3E01 A;  3D28 A;  3TEG A;  1RB0 A;  2V8D A;  2RDD A;  4LRD A;  2HLU A;  2WON B;  3FBE A;  3Q2T C;  4ZPC A;  1RAG B;  4YDD B;  3AT1 B;  3BBC A;  1TUG B;  2LA6 A;  2N7C A;  2XG8 A;  1CJV A;  4EBD A;  2HHU A;  2IVM A;  1SI9 A;  4YB6 A;  1SH2 A;  1Q5Y A;  3P3D A;  4MKB A;  3KLV A;  1KQF B;  3EDR B;  1FEE A;  4ECR A;  1B70 B;  2JJ4 D;  4NRU A;  1W7W A;  1AT1 B;  1SKW A;  4ES3 A;  2OGU A;  3BH6 B;  4OZ5 A;  3LTO A;  1PJ6 A;  3DGV A;  1UW9 A;  1B0P A;  1WC0 A;  2MXY A;  4X4Q A;  4KKO B;  1XWL A;  2QN6 B;  5ETK A;  1TZ0 A;  3NS5 A;  2NXU A;  3R9L A;  5DQH A;  3MWB A;  1ITP A;  3ICL A;  3MGJ A;  5I42 B;  1YZ7 A;  4HHH A;  2YX7 A;  1S1V B;  5KT5 A; 
#chains in the Genus database with same CATH homology
 2CJX B;  2H51 B;  3R7B B;  3R6L B;  3KJQ B;  2CNK B;  2H5J B;  2CJY B;  1RHU B;  3KJN B;  1SC4 B;  2HBR B;  2P2C B;  1RE1 B;  3KJF B;  4ZVT B;  2HBQ B;  3RJM B;  2CNO B;  2H65 B;  5IC4 B;  5IC6 B;  3R7S B;  1NME B;  4ZVU B;  2XYG B;  1RHJ B;  1SC3 B;  1ICE B;  1RHQ B;  2H4W B;  3SIP B;  3R6G B;  2HBY B;  2C1E B;  2QL9 B;  2H5I B;  2XYH B;  3GJQ B;  3D6F B;  3GJS B;  2C2K B;  1RHM B;  2DKO B;  3GJT B;  2C2Z B;  2QLF B;  1RWK B;  3P4U B;  3P45 B;  4ZVS B;  1SC1 B;  1QTN B;  2H54 B;  4JB8 B;  1F9E B;  1RWO B;  4ZVP B;  1RWP B;  2Y0B B;  4ZVR B;  2H48 B;  1BMQ B;  3GJR B;  3R5J B;  1RWM B;  2CDR B;  2H4Y B;  2QL7 B;  2C2M B;  4DCJ B;  2QLJ B;  2XYP B;  1I3O B;  3EDQ B;  1PAU B;  3IBC B;  1IBC B;  4DCP B;  2CNN B;  3D6H B;  4DCO B;  2QL5 B;  1RHK B;  3QNW B;  2CNL B;  4ZVO B;  1RWV B;  2XZD B;  1QDU B;  5K20 B;  3R7N B;  1PYO B;  2Y1L B;  4LSZ B;  3EDR B;  3NS7 B;  2HBZ B;  1RWW B;  2XZT B;  2C2O B;  4ZVQ B;  1RHR B;  3IBF B;  3D6M B;  1GFW B;  1RWX B;  2FQQ B;  1RWN B;  2QLB B;  1I51 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...