4GRSA

Crystal structure of a chimeric dah7ps
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
333
structure length
333
Chain Sequence
MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVESVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDISAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering allosteric control to an unregulated enzyme by transfer of a regulatory domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Phospho-2-dehydro-3-deoxyheptonate aldolase, 2-dehydro-3-deo
total genus 106
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18152 DAHP_snth_FXD DAHP synthase ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4grsA02
3.30.70.1140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phospho-2-dehydro-3-deoxyheptonate aldolase; domain 1 4grsA01
1FUYA 2FJKA 4O0KA 3SGUA 4OQVA 1EWDA 3F1QA 6ALDA 5F4SA 3G1SA 3PG8A 2ZA2A 5AYYA 3MI2A 4Q4KA 5K7JA 3T7VA 1PL9A 3DKJA 3G0XA 5EA9A 3NQAA 3W7DA 5CGQA 3CM4A 5K9XA 1TCDA 3U6WA 3PS7A 2ZA3A 5DLCA 5I3HA 3V1PA 1GWJA 2HMCA 1ZHAA 4R33A 2ZRUA 4ZMGA 1MXSA 4UIOA 1G4PA 4N6EA 4Y6GA 4NX0A 4KFPA 3GNDA 1O60A 4XTIA 1K7XA 1VR6A 3BARA 1X7FA 1VLIA 5D05A 4RR4A 1KTCA 3BV4A 1KLYA 1SZGA 3E02A 3HOJA 4UR8A 1KFEA 3QMSA 3T55A 4RZ5A 3T4CA 1PCWA 2Y7EA 4GNJA 3O16A 2E77A 2YFOA 2QCHA 5K4ZA 1W5OA 2YW4A 3L0NA 3O06A 1OG0A 1YLVA 4UTJA 3LGEA 4RJEA 1LDCA 2QCDA 3HG3A 2X1TA 3W87A 5G1YA 4HT3A 3ZS4A 4NJIA 1OX6A 5FI8A 4A22A 2C0AA 3STFA 3U2OA 4WOZA 4E2DA 3W7RA 3I7RA 1LBMA 3C3NA 3B0UX 1EUAA 2Y6ZA 1H7OA 2RDWA 3TQVA 4FNTA 2NX3A 1TPC1 3G22A 2DZUA 5C55A 1EP3A 5EL1A 3KRSA 3LTPA 1W3NA 2ABAA 1QWGA 4UNKA 1KM3A 5CPNA 3LI1A 3C2FA 2XN1A 4DPPA 4K37A 3MW7A 5FF0A 1SFLA 4O15A 1PCKA 4FNQA 2YCEA 1U83A 3UD6A 2TPSA 4K8EA 3PSWA 4MY8A 1L6WA 2AGKA 3G1VA 4N9CA 1BEUA 3MYPA 3HPSA 3LRLA 3KAOA 3CIWA 2V81A 3BG5A 3GLCA 4O16A 5L9FA 5D32A 3UZJA 5FF7A 3DXIA 3G24A 3TC6A 3UWZA 4JIPA 1GEQA 2QCGA 4Q32A 4O50A 4PODA 4MKNA 3A22A 3P7YA 3O07A 3BVJA 2Z1BA 3OVQA 3HG4A 3G1XA 4JD4A 2DZPA 3IIVA 1MEWA 3THQA 1G69A 1YDVA 4RXFA 5LKYA 4UTUA 5HR6A 1M5WA 4MJZA 3BO9A 3AO0A 2Y85A 3LTSA 3P5ZA 3IIPA 1OFQA 1LBFA 1AW5A 2A21A 1KFCA 3A21A 3RF9A 3NQMA 5LNSA 3C52A 2YW3A 5AOUA 4KWWA 5FEPA 3IIZA 1EB3A 4GUFA 3CC1A 1YXDA 1XXXA 2V0TA 3G1AA 2O7QA 1TV8A 3W2LA 4OBTA 2CZDA 4YCPA 1EA0A 3GAKA 2ALDA 2X16A 3ELFA 1MEIA 3OEXA 3UPWA 2IQTA 1DKWA 4YLWA 2NWSA 5D30A 3LCIA 2NUWA 3LLDA 2DP3A 4DBEA 3R89A 4JR5A 2V2HA 2PRMA 3GDMA 4IPJA 3LLFA 3TCEA 1M6JA 1JVNA 4BR1A 1ICSA 3GIYA 4HIBA 4JDBA 1ZAJA 4OV9A 4NU7A 1GVFA 2NV2A 1X1OA 1B3OA 3MJYA 2GVJA 4JTHA 4L4MA 4BWLA 5I3FA 1KLZA 4JY9A 1VYRA 2AQWA 1IXPA 1JCXA 1G4SA 4EOUA 4E0CA 3BG3A 1OX5A 2I14A 2X30A 5D37A 3S1VA 4XZ9A 3W1PA 3EEGA 5DCBA 3MWAA 5CPLA 1RZMA 3OIXA 1GG1A 1NEYA 2HSAA 2JKAA 2V5BA 4ZQMA 3PR2A 3G1HA 3S42A 2VFHA 1SW3A 5AHMA 5HINA 3QMRA 3M5VA 5FF4A 1C29A 5TQLA 1VPXA 3C6CA 4BK9A 3TSMA 3NQDA 4M7SA 4MVAA 4I9AA 4CCCA 1I2PA 1SZEA 1VYPX 2ZCGA 3TW7A 2W6RA 3TU9A 3HGOA 4LUJA 1SO4A 3MHFA 3UWWA 3MP4A 3AJXA 1LZOA 4FB7A 3GXPA 4UTTA 4WY0B 5AHIA 4GBUA 3TC7A 3KRZA 3NQ7A 4AB4A 2DZSA 4O19A 2NXHA 1FXPA 1WDWA 3A5VA 3W2MA 1TV5A 3LHTA 1YXCA 2CZFA 1ICQA 2TRSA 1XL9A 3HIJA 2J88A 5AN7A 3GR7A 3QW3A 3NAVA 4UFJA 4XUGA 3EX3A 5F2LA 5G4WA 1YPIA 2YX0A 3HF3A 1OF8A 3GVGA 3IEBA 3PB0A 4WXZA 4E38A 1P0KA 1DORA 3O05A 3GKAA 5CG7A 1FWNA 1ZY9A 2DZWA 1DQWA 4POCA 4X22A 1C8VA 4M5PA 4O54A 3SW6A 1P0NA 2HS8A 3P82A 3KX6A 2ZFAA 3O15A 2Y62A 1G67A 2QAPA 2E5CA 4XKYB 3NQVA 1SO3A 3HGSA 1SO6A 3CB8A 2NZLA 1ML1A 5AHEA 4WOQA 4YCOA 2HTMA 3C61A 3W2UA 1AK5A 3BLFA 2V2CA 4IMFA 2EKCA 1GJPA 2P1FA 3IGUA 1VHCA 1XDMA 4ZQOA 4UTLA 1EX5A 3VE9A 5LZLA 3FYPA 1F74A 3L21A 3FJ6A 4OT7A 3ATYA 2CLOA 1H50A 2W79A 4XWUA 5L6UA 4YMZA 3DAQA 1GVSA 5HQEA 4O1AA 3HPXA 2V5LA 1GG0A 3EX4A 3TK7A 3N34A 3PG9A 3DGRA 1QPOA 1OFAA 4TU1A 3NGJA 4AEOA 3I6RA 1O5XA 3LCFA 5BNKA 4DF0A 4RLIA 5AYZA 3WK2A 2V9DA 1KBIA 1TPUA 3ZWTA 4RCXA 1H1YA 3QEZA 4ADUA 1IIGA 4AHQA 1C9DA 5D04C 1VLWA 5I3GA 4PH6A 3GDLA 2QKFA 3G8RA 1VYSX 2WNZA 4UTWA 3W74A 1I2RA 4JNMA 1TV7A 1DL3A 4QIUA 4XQ6A 4UTWC 4FEZA 3TQKA 2YYUA 5ABTA 2NXIA 1SR9A 3M0ZA 3NVTA 2QDHA 1FCBA 3W1RA 1OK4A 1A53A 1YTEA 3CEPA 1RQEA 1JRCA 3W76A 1OFDA 2PC4A 4CLMA 3B8DA 1W54A 5KMYA 4RZ4A 3M5ZA 1X6UA 2QCCA 5EPDA 1EP1A 5DXYA 1O4UA 1S5VA 5E0KA 3HJZA 5DCDA 1XFBA 1S5WA 4NXSA 2XN0A 4GJ1A 2ZRZA 3CQ0A 3TXZA 4Z08A 2X1UA 3W7EA 3NZRA 4DEFA 5AFDA 2Z2UA 4K6AA 1WBJA 3M7WA 2WJZA 2J9XA 3A9IA 2GUUA 4JTGA 4K7VA 5CZJA 1R47A 5IBXC 4M19A 3N19B 3O63A 1JUBA 4FIRA 4AF0A 1KFKA 3EX1A 3W7MA 4UTKA 1YTKA 4XKYA 5K9DA 4NJGA 1A50A 2Y70A 3HPZA 2GQ9A 3NZ1A 3LHWA 1QCWA 2YSWA 4D2JA 2EPHA 2QJHA 5D38A 1OYCA 4IWWA 1H7PA 4O4VA 1RQBA 1RPXA 3FA5A 2YPIA 3L5AA 4PA8A 2FFCA 1R46A 2P10A 2NUYA 5G2WA 1FY6A 2FB3A 4N6FA 1XDLA 4IGHA 2XFWA 5EYWA 1K7FA 2VFIA 1FBAA 4OGZA 4A2RA 4UFMA 5KTLA 1QFEA 3VNDA 3LB0A 3E49A 4PTNA 4Z1DA 1B57A 4UFHA 2NX1A 3QRHA 4CQAA 4MLJA 5BW6A 1LOSA 3BK0A 3PC0A 4FX8A 4FIQA 4C1KA 4GC4A 3MHUA 3N2MA 4IX2A 2RDTA 1TB3A 1W5NA 5HUOA 3TIMA 3KVJA 1HUVA 4DF2A 4NUWA 1TJPA 3DU0A 3TSBA 1QPRA 1FQ0A 1L6SA 4LW7A 1YXYA 3Q94A 1AL8A 2ZZ1A 1HO4A 2R91A 4HNNA 4ORMA 3NR0A 2JGQA 1H7RA 1RQHA 3NG3A 5HULA 3W7IA 3L67A 1X8FA 2CZ5A 2C6QA 4UFKA 3W7GA 3W7JA 4NXKA 3MBFA 1PIIA 2VXNA 3TMQA 1WYIA 2E1DA 3C0JA 4I7UA 3QPYA 4GWEA 5CZTA 4TR9A 1Q6RA 3G3MA 1U5JA 3WK1A 1HTIA 4LVBA 2PRLA 4U28A 4UTMA 4N02A 2YXGA 4HPJA 4OHQA 3O1NA 1KM5A 3FYOA 4JYEA 4JYDA 3G0UA 1K8YA 2EF9A 3IVUA 3W70A 1QDSA 1H51A 1H1ZA 1TPB1 4FXRA 2B7NA 3M5XA 1I8JA 1PHWA 4UTTC 3SGZA 4IJBA 1DHPA 2FB2A 2WKJA 2C19A 2W0UA 3EWBX 5TBOA 3L0GA 2BLEA 3LCXA 1T99A 2ISSA 3IIOA 3MP3A 4PCFA 4X3ZA 3TUUA 4IQLA 5CSSA 3L66A 1M7OA 3W7NA 5H2ZA 3W07A 3VI2A 4ONVA 3DH7A 3QZEA 3B05A 3LHVA 3VE7A 1K7EA 4BF9A 3OHIA 1CI1A 2ZA1A 4NQ1A 4AAJA 5KSWA 5BRBA 5DCEA 2WNQA 3W7LA 3IVSA 2G96A 4OU1A 3N9RA 3LBCA 3MO7A 1GTEA 2A2IA 2VEKA 1TPWA 2F84A 3CHVA 4JICA 3C2RA 8TIMA 1FX6A 3NEVA 1UB3A 2WO5A 1OYAA 4O11A 2A0NA 1RD5A 4LU0A 1H7WA 5G5IA 3TAKA 3W7PA 3GB6A 5KITA 3UZ5A 3HGJA 4Y90A 4BFAA 1ONRA 1W5QA 3W1NA 3TA6A 3GXNA 3DI0A 1SFJA 3QFEA 3NQFA 3SR7A 4QNEA 4JX6A 4LRTA 1AMKA 1LM1A 2QUTA 4HN4A 5E1QA 5F4XA 4P2VA 3QW4B 2CLEA 1HFBA 3QM3A 5LGXA 1JQVA 3NPWA 1B4KA 1LRTA 4UMCA 3MI6A 3KXQA 3THAA 1OFEA 2NV1A 4LS2A 3S5YA 2GQ8A 2C14A 4XBKA 2Y7GA 1Y0EA 5CPMA 2ISVA 1HG3A 3NL5A 3LXBA 3RK8A 2AAMA 3W1TA 1TJRA 1O5KA 4UTHA 4TO8A 3DFQA 4WZHA 3EX6A 3EWUA 2J9ZA 4FNSA 4XTDA 5HR7A 3L68A 4GUIA 1QO5A 2RHGA 1I2QA 5D03A 2P0OA 4O18A 1W8SA 2CW6A 4WXYA 5KZMA 1QOPA 4ZQRA 2JKEA 3GDTA 2D73A 3SECA 1XBVA 1PVNA 3LTYA 3USBA 3DHFA 1YADA 1IXOA 1LLWA 4AH7A 5C2XA 1NAL1 1G7UA 4N4QA 1AW2A 1JCYA 1Q6QA 1BTMA 3P84A 4AWUA 1TREA 1ZFJA 1LORA 2JK2A 5CKSA 1QMLA 3M9YA 4K36A 4DQWA 4MFEA 1FDZA 3OBKA 1ME7A 3K30A 1VCVA 3UY7A 4S2CA 1TRIA 3A24A 3NL6A 3ABSA 4Y96A 3SY5A 3W9ZA 3NL2A 4QJ1A 1QPQA 1DVJA 2ZTJA 2ZRVA 4IXHA 4AMAA 2EGZA 2RKXA 4GUJA 4CNOA 2QF7A 3D0CA 2GJNA 3LHUA 2GOUA 3BLIA 1R2TA 3W1XA 3TXVA 3UQNA 1FCVA 4B5NA 4ZL1A 1Z42A 5BMXA 2ZBTA 1W0MA 4I7WA 2GQAA 4FO4A 3F4WA 1OF6A 1G7VA 2DZTA 2WOQA 3S1XA 3NL3A 3BGJA 1TPH1 2C18A 4Y9AA 4KFOA 4UMAA 3TNOA 2V30A 1QNVA 2E6AA 1R2SA 1VRDA 1PV8A 1SU5A 3W71A 4UMBA 4EF8A 5BMWA 2FIQA 4LVDA 4EVZA 3JS3A 4ZQCA 3HMJG 3L9CA 3PF3A 3R2GA 1ICPA 4IOTA 1QPNA 3UPBA 3M1ZA 3TE9A 3W7OA 2X1RA 4BWLC 2VKZG 2A6NA 3GYEA 4GFSA 3UWUA 2PE4A 2QCFA 4MY9A 4Z1CA 1L2UA 5DBUA 2QAFA 2OX1A 3W22A 2BTMA 3SI9A 5D02A 4X2RA 3T44A 1NSJA 3M6YA 3HBLA 2CLFA 1LROA 2WSRA 1EPXA 2CLLA 3PSVA 3QC3A 1RVGA 4HKPA 3NPXA 2TSYA 2E6DA 1XCFA 3O6DA 4CQ9A 3NNTA 5MHBA 3PBUA 1BKSA 4O53A 3FKKA 3TJXA 1H5YA 4JXCA 1Z41A 2CLHA 1DJQA 1NF7A 4RX0A 2RH9A 1ZAIA 1RV8A 5HWJA 5EY5A 3JRKA 4LS1A 2UV8G 4N9BA 1GYNA 4LVAA 5HMSA 3TW6A 3W7QA 4WY0A 3N3MA 3TSDA 3EX2A 3S1UA 2BX7A 3TFXA 4CCDA 3A5FA 3IVTA 3M5YA 4O14A 4KKXA 4IXXA 1P1XA 3W7KA 5I3IA 4J9JA 2B7OA 1WAUA 1K3UA 4I7VA 5A8GA 3HQ1A 3T40A 4DBDA 4O4WA 4MPQA 3QPZA 2J27A 3ANYA 1OX4B 2LLEA 3SFKA 1W1ZA 1HO1A 1KA9F 1MSSA 2H6RA 3VFLA 5KZDA 3L5LA 2CU0A 3FS2A 2PRHA 4A2SA 4Z0SA 1ZJIA 1G4EA 1OHLA 1DBTA 2Z0IA 4QQ3A 3MI3A 1S3HA 4O1DA 1W3TA 2QEZA 1YDOA 3STEA 1EP2A 2B7QA 4FX6M 4ADTA 1LRNA 1LBLA 3N73A 4LVGA 1H63A 1LOLA 3E9AA 1KM4A 2Y89A 2QJGA 1MZHA 4LV9A 5CSRA 3SZ8A 1YDNA 4DELA 2I9EA 3CT7A 4ADSA 1OFBA 3GKFA 1F5ZA 5EBUA 1OYBA 2Y61A 3BG9A 4NNAA 3E0IA 3S0CA 4WY0F 3QJAA 4NT0A 5DELA 4HNUA 1F2JA 3R5EA 3RMJA 3CIXA 4FHAA 3LCWA 5D09A 2BSLA 3C56A 1YYAA 1BWLA 1UUOA 4KFNA 1F6PA 4PL2A 1IIHA 2GJLA 4R53A 3P81A 1I45A 3NO5A 1OVDA 1TTQA 3PWAA 2DJXA 3CLMA 1TQJA 5U7SA 1VS1A 2X1SA 5G2HA 4UC5A 4ZZ9A 3EXSA 2O7SA 3NDOA 3KRUA 3NOEA 3HO8A 3ZFHA 1D3HA 2EAWA 2E5BA 2QCMA 1KM0A 3L5MA 1OFOA 2WV8A 3MHGA 4LRSA 1JCMP 3W1MA 3EKZA 3QYQA 2VELA 3QH2A 3NQ2A 2CLMA 5AHNA 2E6YA 2F7FA 3LHYA 3TAOA 1K03A 4O8RA 2Y7DA 4NJKA 1ZENA 3SJ3A 1N7KA 3A23A 2C1HA 1GVQA 1AL7A 3LERA 3P74A 1CX9A 1FDJA 3FKRA 3GDKA 2V8ZA 4RK8A 1SZFA 3H54A 4JS3A 3MMTA 2QDGA 3P5YA 3C2VA 1CW2A 2ZZ3A 1MO0A 2E09A 1DQXA 5GVJA 5EMUA 3GDRA 3FLUA 4NNCA 2J24A 1KM6A 2YR1A 5F1VA 3PB2A 1WA3A 3LCGA 1GZGA 5IBXA 1SUXA 2XN2A 5E93A 3B4UA 3TKFA 2J6XA 3MP5A 1W5MA 4M6QA 2H3BA 3UXDA 3S9YA 5AB3A 1DJNA 2OZ0A 3EWZA 4DO6A 3S8HA 1ADOA 4UR7A 4LV4A 2ZZ4A 5F2IA 3DFOA 2BWGA 3NQGA 1FDYA 4GUGA 4S2BA 2CFFA 3WK3A 3LI0A 1X1ZA 1LRQA 3ABRA 4XBSA 1MEHA 3MYOA 4UFLA 1R30A 4FXSA 4YWIA 1AG1O 2B0MA 4A29A 3G8EA 1GQNA 5D2VA 2BZNA 6TIMA 2H3DA 2ISWA 2FPVA 4RV8A 4H6KA 1O94A 2X2GA 1H62A 1XUUA 3EXTA 2DU2A 3L0KA 2RFGA 3P8IA 3CEUA 3BW3A 3OVPA 3QMTA 1F7BA 1G6CA 3G3DA 3N2XA 3IGSA 1TTPA 1XM3A 5DBTA 3IIXA 3EB2A 1GPWA 4O28A 3PY2A 4R34A 5H91A 4LY8A 3YPIA 1F6KA 5D2YA 4OWGA 3WJZA 3LBMA 1VC4A 1E51A 1SZNA 1VZWA 1Z44A 1M7PA 4M6PA 1A5CA 1W31A 2V2DA 2ZZ5A 4NJHA 1R2RA 1JUKA 5AC8A 1P4CA 1QAPA 5LSMA 2NUXA 5U4NA 1N8FA 1W5PA 4TIMA 3W2JA 5AYXA 1G4TA 3LM7A 3LOTA 3PBWA 5FF3A 1Q45A 1VCGA 1VGAA 2DJLA 4HSNA 2TMDA 3GAYA 1TTJA 4LNYA 3W7CA 4JTSA 4C1LA 2PCQA 4RXGA 3NPUA 4JIQA 1TIMA 3I65A 4JY8A 3WJYA 1B9BA 4N9EA 4OE7A 4NX5A 5CZ0A 1W3IA 3ZWSA 4P61A 3QF0A 3G1DA 5D2XA 2YFNA 3UWYA 2A85A 4JTJA 2C3ZA 2CLIA 2EHHA 2VFEA 1FCUA 4UFIA 5EKYA 4WD0A 2A1YA 1JUEA 3OG3A 2R8WA 5FESA 3EWXA 5T26A 2WSQA 3DFSA 3KFTA 1KFJA 4LTSA 3P80A 4N9DA 2NWRA 2VC6A 1EIXA 2VFFA 3BW4A 2CZEA 3MBDA 3VKJA 1I4NA 1OABA 3M43A 1W37A 1ZCOA 1VH7A 4QITA 3IRDA 5LNUA 4MUZA 1SO5A 2G97A 2GVLA 4AWSA 1FWSA 4RKAA 1OJXA 3RU6A 1OK6A 3W1AA 1OFPA 1V7YA 3GK0A 1P5BA 4CQ8A 3DFPA 3B03A 3S1WA 3NA8A 4BI5A 4JX5A 5DXXA 3OVRA 4LUIA 4LOCA 2FLIA 3DZ1A 1A5SA 1LTDA 3LRKA 4FNPA 3BLEA 5KZEA 5I3JA 3I7QA 3N14A 3W73A 2ZDRA 2ZZ7A 5FEWA 2WPBA 2YZRA 3F4NA 1J2WA 3TMLA 1GVOA 4IPIA 3PUDA 1LYXA 2FDSA 3IGXA 1EEPA 1K8XA 1LP6A 3NYZA 5D33A 4Q33A 2FPTA 2WSYA 1JRBA 1LCOA 3H55A 2WQPA 5DY3A 2TYSA 4GUHA 3INPA 3LX9A 4FX7A 2A7NA 1OX4A 4LWWA 4DPQA 1JCNA 2ABBA 5F2GA 2Y63A 3CWOX 5IM51 4H3DA 3UWVA 2FPYA 2VEPA 4M6VA 5J5DA 5LNVA 1A5BA 3DHDA 3E12A 3TR2A 3VCRA 4BI7A 4MZYA 3BGGA 4AHPA 1TTIA 4LC8A 4GXMA 3ABOA 1ZALA 3PUOA 3FIGA 2QR6A 4WQ6A 4MY1A 2QCEA 3M16A 2E5DA 1EUNA 1Q3NA 1KM1A 4MOZA 5DN1A 3TJLA 4MYXA 1QOQA 1Q6OA 1XBXA 2C16A 3W6YA 4W9TA 1F05A 4O12A 3B0VC 1BWKA 1WOBA 3L65A 7TIMA 3S5NA 3IV3A 1XBZA 3B0PA 4K7YA 1L6YA 2CLKA 4O0ZA 4AXKA 3W2NA 3EWYA 4PFMA 3FFSA 3ATZA 4Z1AA 3DENA 3B06A 5A5WA 3HGRA 1FXQA 2DORA 5AHFA 1H61A 5LHFA 3LXAA 3FEMA 1KV5A 2JBMA 3Q37A 3PVFA 2ATMA 3QQ0A 5I3KA 4DXVA 2A4AA 1OFRA 2H8XA 4YXGA 4ICNA 3L2IA 3S5ZA 5K4XA 5KINA 3O8AA 4AWTA 2Q8ZA 3UNDA 2A6LA 5AHLA 3DI1A 2V82A 1LLZA 1I2NA 5SWUA 2ZYFA 1GYLA 1ME8A 4PC8A 1F76A 1TO3A 1V5XA 3W83A 1JCLA 3JR2A 3W2KA 1UBSA 4JTTA 1EWEA 3PUEA 2VEIA 4CCEA 5AC6A 4K39A 3C4UA 2OJPA 2OMAA 4JTIA 4JTKA 3GR8A 1JULA 4A3UA 3W1UA 1KTBA 4LC6A 5G1TA 4PEKA 1XKYA 4MYAA 1WQ5A 5DY2A 5HUPA 2R14A 2QCNA 2PURA 4E2BA 4L4LA 3PULA 4QISA 3W23A 3LDVA 4NZFA 1PE1A 1D3GA 4IMCA 5C5YA 3UXAA 4MJMA 1WX0A 1H7XA 1QR7A 1VJIA 5D2WA 3G1YA 4EWND 1TYGA 4DO5A 4RZ6A 3STGA 2Q3OA 3W72A 1KW1A 4JYFA 2DZVA 1WBHA 3NQ8A 1GOXA 3O6CA 1GT8A 1K02A 3NM3A 4Z1BA 3NXFA 4JDYA 1D9EA 1KBJA 1ME9A 3EWWA 1KV8A 4WX2A 2DZXA 2OT1A 1PHQA 2VOMA 2H90A 4UCGA 2Y88A 4TMBA 4QAIA 1UJPA 5J5RA 3U8GA 3LCLA 4JTEA 3W3OA 2YDAA 3TH6A 3C2EA 3P67A 4NNBA 5TIMA 3I7SA 4TMCA 3KVLA 1SSGA 2ZZ6A 4AHOA 1XC4A 4MLRA 1TQXA 1ZAHA 2A7RA 1TRDA 3R12A 5BOOA 3W88A 3PM6A 3CTLA 5F4WA 1S5TA 1T0OA 2Q3RA 3FOKA 1FWWA 3RFAA 1IXQA 4O13A 1IF2A 4MIMA 3W86A 4FNRA 3DFTA 1Z48A 3LV6A 3HG5A 2QCLA 3N9SA 2Y7FA 3P8JA 5FEZA 3R13A 3ABQA 1NFBA 3UYCA 4N4PA 5C54A 1VHNA 1A5AA 2G5WA 3KOFA 2ZTKA 5AC7A 3G18A 5FEXA 2ZRXA 1KFBA 4CNPA 5D2TA 4ORIA 4GE8A 4JGDA 3NQ6A 4HNTA 3CWNA 1PS9A 3Q2DA 1XUZA 2GVGA 5HWNA 2GPTA 4LVFA 3ZR4A 3W7HA 3I68A 3HB9A 3P61A 4NZJA 3W85A 3WJXA 3MUXA 4K8HA 1SW0A 4MFDA 1WXJA 2YGYA 1SSDA 3M47A 2ATSA 4ALDA 1FWRA 1VCFA 2KZHA 3GNNA 2CWNA 3S6DA 3STCA 4HHPA 2R94A 3TFCA 3S5OA 3RNDA 3CU2A 4H4IA 4NJJA 3H53A 1T96A 3WK0A 1UUMA 3W1LA 4ML9A 1ZNNA 3T78A 4DO4A 3TQ0A 3TX9A 3G1FA 4FNUA 4O1CA 4UXDA 3SSJA 3QSTA 2JKPA 2Q8LA 3WJWA 3LXCA 3R8RA 4EIVA 3PBYA 2HS6A 3PAJA 3W84A 2OT0A 2J9YA 2C13A 3GXTA 2Z6IA 4JN6A 3TROA 1UCWA 4LT9A 1I2OA 3HG2A 1N55A 3DKLA 1T8XA 2YYTA 3F03K 4R7JA 4MZ1A 5HNRA 4M7TA 4UNLA 4IMEA 4WUIA 5LNRA 2OCZA 2QJIA 4ZVJA 3NQCA 5CPOA 1FCQA 3M41A 3RLVA 1WOAA 1XI3A 1YTDA 5K2ZA 2VFGA 1W56A 1TSIA 1TPFA 4HPXA 2ZZ2A 1NF0A 1YPFA 2QUVA 2ZRYA 3UWQA 4O57A 1J4EA 4KWVA 1GTHA 5C6MA 1LOQA 1Q6LA 2NXGA 5F1UA 4S1FA 5HWMA 3G0SA 4G1KA 1JJKA 3CPRA 5LNWA 4QSHA 4Y8FA 3LHZA 2FQIA 1UASA 4OV4A 1XBYA 4PL1A 4O10A 4BI6A 1TMHA 1HL2A 1JR1A 1IXNA 4GRSA 4JTUA 1KTNA 4TX9A 5K9CA 2RDUA 3WFAA 4AVFA 2A5HA 2QUUA 5G2IA 3RLUA 3W75A 5F2MA 2QCDB 1SQ7A 4IX0A 4QM1A 1TPDA 4UTIA 4MZ8A 2VENA 1GVRA 1NVMA 3GZ3A 3O6YX 2ZQ0A 3M44A 3KVMA 3B04A 3W1QA 1RR2A 1JQXA 3QSRA 4ZQNA 1K8ZA 1ALDA 2B7PA 2C15A 3EXRA 5FF2A 1H60A 4YL2A 4JEQA 4AF0B 3V75A 4QNWA 4DF1A 3E96A 2ZRWA 4O52A 4CNNA 3TV8A 1J5TA 4JTFA 4IMGA 1AW1A 2NX9A 2I1OA 4IMDA 5CZSA 3Q58A 4ZQPA 1VQTA 4LS0A 2FTPA 1QO2A 4JTLA 4O17A 1DOSA 2E6FA 3C8FA 1H7NA 4U4MA 1DV7A 3LCHA 2E68A 4X9SA 4EF9A 3PBVA 1SW7A 1FWTA 3FJLA 1WV2A 3NPVA 4A21A 1KFLA 5K3VA 3WJSA 2NLIA 2WNNA 4WJEA 1TPVA 1O95A 5HJLA 5LHEA 4IUOA 3NM1A 3P60A 3TDFA 3SIZA 3LRMA 1F73A 4K38A 1TPEA 3KHJA 4HNVA 3LV5A 3BW2A 3QQ1A 3P62A 3UY8A 2Z6JA 2H8ZA 3DBPA 4JX4A 4FF7A 1SPQA 3NQEA 4HSOA 3EKLA 5G4EA 1B4EA 2JGYA 4Z0JA 4NVTA 2BXVA 2A7PA 1THFD 3GX9A 1KM2A 2VFDA 4UUIA 5LGZA 2G95A 2B4GA 3DFNA 2VEMA 4N2YA 1IGSA 1JCJA 4O1BA 3OA3A 3KVKA 1L9WA 3BPWA 3C2OA
chains in the Genus database with same CATH superfamily
2FJKA 2GVEA 4M5LA 3SGUA 4K2SA 2K3IA 3R2DJ 1EWDA 1TKTA 2YWFA 2Q1LA 2OPJA 4Q8QA 4MKYA 6ALDA 4TVDA 1YVFA 4B3MF 1X4FA 2GGPA 4I9JA 3BKFA 2VQTA 3PG8A 2X51A 3AIBA 4IR1A 5AYYA 3S2CA 2V94A 2G3MA 5K7JA 4HMDA 5AXKA 3MR3A 1BGXT 1NP2A 3LPYA 2IM1A 4QP0A 2OWXA 4K4SA 4Y34A 3CXOA 2WONB 2XMTA 3A4TA 3DKJA 3G0XA 3F5LA 1S9FA 3BMVA 3GTXA 3MEEA 3OPKA 2JEQA 1TCDA 3BBCA 4IGNA 3U6WA 4HNLA 4AL6A 2JRSA 3M30A 4P9SA 1F9HA 4O44A 5CSYA 4REQB 1Q63A 1WF0A 2LLZA 2ZRUA 4ZMGA 4CVUA 1SKSA 1RVKA 3LEPA 4N6EA 3APGA 3Q23A 3TJ9A 3RX2A 4H9UA 4WDUA 1K7XA 2CHOA 4XTIA 1UVIA 4ACYA 2PC8A 4LCQA 1VLIA 4U5KA 3VK5A 1WUFA 2J7BA 2HVDA 4ZVGA 2V34A 4EPEC 1BHNA 2V8GA 2W9CB 4CNZA 3OU8A 1OCNA 3ARXA 4KT2A 4OHYA 2CZVA 3T55A 1EGMA 2OFHX 4LQ3A 3T4CA 1PCWA 1R8CA 1U1QA 3O16A 3ZTPA 1JNEA 2V5KA 1GX5A 2YW4A 3O06A 3L0NA 1QNSA 1OG0A 4QLKA 3H4WA 5E70A 4I68A 2OTDA 1TR1A 3TTOA 5KFVA 2IM0A 2X1TA 5G1YA 4HT3A 2V8VA 1JLEB 1TX2A 4NILA 4NJIA 1G01A 1TP7A 2MANA 2CBJA 1QTWA 2HNYA 1EAYC 1TKDA 4HK6A 4PUKA 3CCJS 4WOZA 1WACA 1LBMA 2Y8WA 4OUIA 3KBWA 4OBSA 3AZSA 1YNQA 2P6TA 3ZZYA 4INFA 3TQVA 4FNTA 2XEXA 2DVUA 3GFYA 2VC1A 4NCGB 2IPFA 4KWOA 3G22A 1OC5A 2DZUA 1CG2A 1JNRB 3TUJC 4WKHA 2QLBB 2HISA 2MMYA 4QIWD 4JP8A 2DUAA 2ROGA 2ZM6J 4QLLA 1QWGA 3RCNA 1TL1A 3LANA 3AUJA 1KM3A 5CPNA 1VJZA 2XN1A 1ZPVA 3WELA 4K37A 5F0UA 3LENA 3WQ5A 2L41A 4F4YA 1PUDA 1YJUA 2B43A 1SFLA 3AWOA 4PTWA 4O15A 1CECA 4PAAA 1LK7A 2DHGA 2D3ZA 3CS2A 4WHBA 2Y24A 4FNQA 3C0SA 4RW7A 5C8BB 4ZCKA 4JFUA 1UP3A 3UD6A 4K8EA 1M5SA 4IIFA 4XUYA 2IC3A 2QLFB 4O3PA 3EICA 1AB8A 1EPVA 3MMJA 4X62J 4DQQA 4RDVA 2B8PA 2FY1A 3KUHA 3ALFA 4XK2A 3VKCA 2AYBA 3HPSA 1E72M 4TTUA 4W84A 1JZ3A 5L8RC 2FZBA 4O16A 5L9FA 3UZJA 1U1MA 4CLTA 2PUZA 3G77A 1J96A 2OYMA 3R7MA 2BY1A 2QCGA 2VL4A 4C8KA 4MKSA 1GMUA 5KFBA 3BUVA 1XYZA 3M46A 2CUYA 3WHIA 1XG4A 2Z1BA 3HT0A 3OVQA 3G82B 4DRSA 1PKYA 2DZPA 4X0NA 2C2KB 3THQA 4PTMA 4KFBA 3CIMA 3D4JA 1FCAA 4S3CA 1R3NA 1XMQF 5LKYA 4UTUA 1BGGA 1V02A 5B7YA 2GVZB 1UA3A 2GJIA 3JYTA 3GRIA 4YR0A 1PYTA 4GKKJ 1C8QA 1XGZA 3OR2A 1K0TA 4Q7NA 3BO9A 3AO0A 1T9XA 4LQ1A 2B7BB 1WG1A 4JV2A 1IT8A 4IIHA 3CJSA 3DXBA 2N3LA 1JGIA 4AUBA 1T9TA 3UR0A 3EPGA 1VBRA 3JU2A 1N5YA 1OFQA 1BF2A 1AW5A 2A21A 3UR7A 3K5PA 1QXLA 4KO0B 3UD5A 5LNSA 3VOGA 3IANA 1U8WA 2YWEA 1UJQA 4H4KA 4KWWA 3FYYA 1EB3A 3MV01 1UWBA 5DGAA 1XYAA 1K1SA 1P0BA 3WC0A 3VZHA 4N56A 4CO5A 1QRQA 3NO3A 1K4GA 1EOMA 4RE3A 3T0TA 3BANA 3MAHA 3CMJA 2XZDB 1KC8T 4O3QA 2ALDA 2X16A 3ELFA 4GABA 4EGLA 3W3SA 4J3ZA 4V27A 4LANA 3POTB 3RRHA 2VX4A 1HW6A 4K4UA 3DU6A 4OHZA 2MEWA 1VFFA 3LLDA 3RAQA 4DBEA 2YH0A 1EQMA 3I0RB 4DJFC 3GDMA 4PTVA 4J9PA 3LLFA 2HWGA 3GIYA 1TZ0A 4GPNA 1ZAJA 3W00A 4KW2A 4I6WA 4C6IA 1B3OA 1EIBA 4J4KA 3UYIA 3WCZA 3CGTA 4L4MA 2HRYA 2IW0A 2CQ3A 3VVUA 4BWLA 2J9DA 5I3FA 1CSJA 1VYRA 3OYZA 3E6EA 2AQWA 4NRRA 1JCXA 1G4SA 4EOUA 3P5BP 4ZOCA 1NOUA 3DRSA 3SCQA 2I14A 2X30A 3RX4A 3ZM8A 3C8YA 2UU9J 2Z7KA 5DCBA 1RB0A 5C25A 4F0SA 2XG9A 3MMAB 3FMWA 2PGRA 3FQKA 4LCSA 3U1LA 3CHDA 5I2UA 4ZQMA 4JI0J 3G1HA 3H8YA 1HHSA 1C90A 1X60A 4C6BA 4Y65A 3QMRA 4A8OA 3T2OA 3M5VA 4MWAE 1YZ6A 2EW9A 2E67A 1W7WA 3C6CA 2AGPA 1AW0A 2B7CB 3TSMA 4GH1A 1J10A 2INEA 1QU4A 1UP0A 1CULA 4US5A 4K1WA 2E7WA 1Y5LB 4MVAA 4FKXA 2FYXA 2GO9A 2J6SA 1SZEA 5DRIA 3T0CA 1VK3A 1TE1A 4C90A 3BOLA 4Q8WA 3UWWA 4AD1A 4NL5A 4Q7AA 2AGOA 2EG1A 4MAVA 3GXPA 4I6YA 5HLFB 3HQNA 1RAJA 2MQ8A 4CN6A 3REQB 4A3HA 5AHIA 2NLYA 4L1GA 4U8VA 5J8LA 4LVNP 3HFVA 2NXHA 4B5WA 1ZZMA 1JYXA 1WDWA 1KONA 2E1CA 1T95A 2DZAA 2VZUA 3QR1A 1ICQA 1DHKA 4I56A 2TRSA 4KBIA 4AY7A 4YUDA 3QW3A 1CS4A 4HOZA 1RBAA 2A3JA 4YTTA 4XBJA 2YX0A 3SCWA 2LA4A 2EFVA 3HF3A 3QAUA 2UUBJ 1FDAA 3T1HF 2PDQA 1BQNA 4YNGA 2YKMB 1VQLS 1P6BA 3OLEA 5C9UA 1ZY9A 4CLZA 3P14A 1FVSA 5LIYX 4CUCA 1ZU8A 3CCUS 3BEGB 4GK8A 4POCA 5E0OA 3CHFA 4O54A 3SW6A 4DR1J 3SB0A 3P82A 2RGLA 2Y62A 3NO1A 1QW9A 1RTIA 2QZ8A 2XS7A 4XKYB 3HFKA 4OUEA 1J5EJ 2AEMA 3V0SA 4HHJA 3ILOA 1KQGB 4JTRA 1NH8A 3RYLA 4LFAF 1LWEB 1RPKA 4C11B 2ZH1A 2WBKA 1EH9A 5AHEA 4Z2HA 2OSRA 4MADA 4ZXOA 3W2UA 4DY1A 2VC7A 4TVCA 1GJPA 2V2QA 1VHCA 3GYXB 2W9AA 4M8UA 3VE9A 3Q8RB 2FH6A 4LSBA 3FYPA 4M81A 5DGBA 1SC3B 2J47A 2VR5A 3FJ6A 3AYTA 4DU7A 4F3QA 4F8XA 4OT7A 2UBPC 3ATYA 2CLOA 2DD8S 4XWUA 4YMZA 1RISA 1WOOA 3DAQA 2BEFA 1GVSA 4O1AA 3HPXA 5D4LA 1AROP 2MYFA 3ET6A 1SV5B 1Y0HA 1FWCC 2ACSA 2XM3A 3EX4A 2YKQA 2BR0A 2BOPA 4A8RA 1DRZA 4AEOA 3THCA 3BB5A 3CZLA 4LRDA 4DL3A 4ZPBA 1O5XA 2E8ZA 3OB8A 1RT1B 3SIPB 2Z2YB 1ZZNA 1K9FA 1KBIA 3H90A 3KK3A 4N41A 4XX6A 1E1CA 1NELA 2XIOA 4ADUA 4AHQA 1OCBA 4TYBA 5J1NA 5E6YA 1E71M 2QKFA 2FZ8A 3CB4A 2VC0A 1H98A 1JXLA 2A10A 4UTWA 2R7SA 2ISFA 1BE4A 1M3UA 1I2RA 5HJXA 2W4CA 4JNMA 4FEZA 3CJ4A 4OZ5A 1XQLA 4MB4A 3S46A 1UA1A 2CPEA 4Y2MA 1NJXA 4XZLX 1SR9A 1ELSA 3GWCA 2YBUA 1YTEA 3EDDA 4WXOA 3SCRA 2B51A 2UXCF 2BANA 5AC4A 4OJYA 1FRBA 1JRCA 3AXXA 3M0XA 2PC4A 5IQQA 3OL6A 3SUTA 4NYPA 3IGVA 1X6UA 2QCCA 3EVWA 1REVB 1EBHA 1EC9A 3THUA 1EP1A 1RHMB 4PUJA 1DE5A 5DXYA 3URAA 3PW7A 3QGAC 5DCDA 2VRJA 3ARUA 3CL8A 4FF4A 2ZD1A 2ZRZA 4CZCA 4IPNB 3UR5A 2X1UA 3U4FA 1TKKA 4QLJA 1YJWS 2Z2UA 4M0XA 1WBJA 3M7WA 3CQKA 2VUYA 2WJZA 2J9XA 3RRXA 4K7VA 4GGBA 3OG2A 1LF1A 5CZJA 2D24A 3CCES 4GC3A 3KLLA 4UQ9A 2J7GA 5IBXC 4CU7A 4Y9OA 3QMQA 4FIRA 3VIHA 3I55S 3EX1A 3VD5A 4UTKA 3MEKA 1M5OC 2WXDM 4U95A 3CMQA 3QGHA 2IKJA 5C9ZA 1ZOTA 2CITA 4YIWA 3Q8YA 3OTOF 4NZ1A 2RS8A 1NDVA 2D41A 4HN8A 3MPYA 4OI3A 1RJJA 4J1OA 1CVJA 1ODZA 1Y9OA 1H7PA 3XISA 4O4VA 2QN6B 1NFPA 1RQBA 4LSNA 1QK0A 1WXZA 3A4XA 4QRNA 1EZZB 1PBAA 2ZXBA 3U9IA 1Y7PA 3PZMA 2XSFA 4KQNA 2Z2LA 4QS5A 4XAGA 5A6AA 4N6FA 1JYVA 2NLWA 1XDLA 4I9MA 5J2MB 1K6AA 2HEKA 2XH7A 2XIQA 2F6XA 2XY6A 2VFIA 4UFMA 2K7KA 2CPUA 4JKMA 3BQ2A 4URSA 3E3XA 1JDAA 3CPUA 4KPYA 1UVMA 4B92A 3MD3A 4Z1DA 1B57A 2PGFA 4RW7B 4C8YA 2HE5A 3O6QA 4NSBA 5BW6A 2AIRB 1MWQA 3BK0A 3PC0A 4C1KA 3NJ3A 2ZFHA 2PP1A 1E1FA 4IG2B 3N2MA 4IX2A 3SUUA 1S1WA 1M1KT 2DNQA 5HUOA 3GIIA 1RYRA 5FJIA 4ZPWR 3XINA 4X4SA 1Q13A 4AZHA 1ZBVA 2FVQA 2XIBA 5JMUA 1EHWA 3GC2A 3ZVHB 4AISA 5E7OB 5FAGA 1YITS 3B8IA 1AL8A 3VABA 2HVIA 3R8HA 4BWJA 1HO4A 2AF6A 4NLDA 4ORMA 1XNQF 1B0IA 4K68A 3NG3A 2UVRA 2VDGA 1YRRA 1G5AA 4HJFA 2D9PA 1PIIA 2VXNA 3SJNA 4X0VA 8CGTA 3W38A 2HHPA 4YS2A 1OQFA 1US3A 1T9VA 1RTDB 1CJUA 2FJBB 5JU6A 3GP9A 4DR4F 2P8CA 3A6OA 1K1DA 1X97A 1MDRA 1VFOA 4HPJA 4PMXA 3N15A 1KM5A 4RE4A 3TWBA 3W8PA 1H2VZ 3TTQA 5GNXA 2X1IA 3G0UA 1RAAB 3WC2A 1TVNA 1KP6A 2EF9A 4GNVA 2DJWA 1IYXA 2XY7A 2ZX8A 3WYZA 2LEAA 1QDSA 3R6LB 2PDIA 1H1ZA 4DV2F 1DIDA 3OO2A 4ZEPA 3M9MB 1QI4A 1S2UA 3BTNA 4NASA 1PDYA 1S2WA 4WIIA 4K5SA 4QE5A 4NYOA 4MF4A 5FIPA 2ISSA 2OSYA 3MP3A 4KIRA 4PCFA 1F8MA 3TUUA 6REQB 3W7NA 4ED3A 2R1NA 4US5D 5LIXX 2HS4A 4XAZA 1S1WB 4DUWA 3LHVA 3HSGA 3CO9A 2PFHA 2C3PA 1K7EA 3RB0A 4DF8A 4MNKA 4QSFA 1Z1ZA 4IG3B 1VQMS 2V5CA 1MN9A 4NAEB 2EQDA 2FJUB 2ZA1A 4NQ1A 2IM2A 3FDKA 3TZXA 1XNQJ 2XTKA 3N6QA 4QYRA 2OD4A 3KJNB 2PP0A 3MO7A 1YRTA 2KI2A 4B3TF 3R3TA 1GTEA 2DQWA 2F84A 3CHVA 3C2RA 4BQ4A 1FX6A 1FXDA 4ZTXA 4DV6F 1UB3A 2VI0A 1XJBA 3E5BA 1R86A 3IC1A 5LOQA 2VZ9A 4AVNA 3FDGA 4LU0A 5ETLA 5ETVA 2FVCA 3CF5Q 2MKCA 4PE8A 1N8WA 3GB6A 3BAYA 2AWZA 2YJQA 4BFAA 4PUEA 3GTFA 1PZ2A 1W5QA 4OYBA 4ED8A 5C42B 1SR0A 3EGWB 4YYCA 1W91A 3R25A 4F2BA 4EP8C 3CAVA 4JX6A 4LRTA 4NLGA 3GG1A 1PDZA 2ALRA 2BY3A 2QUTA 4HN4A 5E1QA 1HI1A 3UCUP 4FPSA 4LBRA 4JI6J 4QJ4B 1UR8A 4JI8F 4K5RA 3NPWA 3I5AA 4UMCA 1LRTA 3MI6A 2BM0A 3S5YA 3RAXA 5J2QB 3R7SB 4HHLA 2V2KA 4M5MA 1EEXA 1Y0EA 5CPMA 1VIZA 3W53A 2ISVA 1HG3A 3MPWA 4G1QB 3OUYA 4NOHA 3NL5A 2C2MB 2FB0A 2ODOA 1O5KA 5DM6Q 4IKAA 4TO8A 4LPCA 3EX6A 3Q2SC 3EWUA 4XTDA 1PIEA 2WSCC 3ZC4A 5HR7A 1QO5A 5D03A 3EBVA 3V0TA 3V6KA 1MFVA 2P0OA 1OT1A 4L80A 4FOKA 4H04A 3W01A 4B5UA 3M2VB 2F2HA 5HLFA 1OGBA 1QOPA 2JKEA 3GDTA 2D73A 2XWXA 2HHWA 4GX9A 2BDPA 1IXOA 1MRQA 3TW9A 1HBUB 1NDWA 2M9KA 4QDWA 3DU5A 1ESWA 2RD5C 1F6TA 2CQ1A 3P84A 1ZFJA 4U67Q 4PXBA 1KHWA 1QMLA 4OOUA 2CPJA 2QIFA 3KLEA 2ROEA 1S59A 4CLYA 3USZA 2W1BA 1FDZA 1NSPA 5I77A 1TUFA 1SQGA 1MI3A 3UY7A 3ENLA 1TRIA 2Z25A 3UCDA 3MPUB 4Y96A 2QIIA 3E2VA 4QJ1A 3N5BA 3KK1B 1DVJA 4C1NB 4CD5A 2ZTJA 5HXMA 3F0NA 1TV4A 1ZUAX 4AMAA 2EC2A 2ZOXA 3NXLA 4ZJQA 1S1XA 3AJ7A 4HHMA 2U1AA 2WCAA 1H6KX 3WIJA 2GJNA 1R2TA 1DPMA 1WC6A 3W1XA 2P6SA 4G8TA 4J3SA 3MC5A 3TXVA 1HNVA 2PTYA 1Q7MA 1BQGA 4B5NA 3ELHA 3N79A 1YJ7A 4DV3F 5GAGI 3I6TA 4J9MA 4CLFA 1TV3A 4W86A 1KOHA 4WYLA 4CU8A 2CQHA 2G0CA 4FO4A 4MGGA 1F3VA 2DNPA 1EETA 1OF6A 2WOQA 4CD7A 1FRMA 4LFCJ 4CLKA 2GJXA 3NL3A 3QC0A 3BGJA 4GXPA 4BCEA 4DJDD 1C1CA 2OLAA 1M65A 2BQRA 1ZL1A 2C18A 4Y9AA 4KFOA 3PJTA 4UMAA 3V6HA 1ZB5A 4W98A 1R2SA 4XO6A 1VRDA 1PV8A 4QX4A 1SU5A 4JTDA 3LO3A 3RHGA 1V3JA 4GINA 4AMCA 3EXYA 2MKKA 5LXYA 4YHHF 4BEUA 3GTNA 4E8DA 1ICPA 3OV7A 4JI4F 3MUVP 2ZBRA 4I8YA 5K14B 1XLJA 1QBBA 1UR9A 2VWSA 4BWLC 2XMJA 1RAGB 2A6NA 2HXTA 3GYEA 4D6CA 1BF6A 2PE4A 2E0PA 1OZQA 5THWA 4Z1CA 1L2UA 1L6GA 5DBUA 2Z2ZA 1Q4RA 3GJSB 2OX1A 3Q45A 2PP3A 3SY8A 2GK1B 2PTDA 5DRCA 3TN6A 3CMAS 1NDPA 1LJYA 1APSA 1XLBA 3N4WA 3T3FA 1NSJA 1HNWJ 3M6YA 3AOBA 3LOUA 2CLFA 3NEKA 1N6QA 1JI1A 4JQ4A 3HJVA 3I3DA 2ZC1A 4ZO8A 1U0SA 4HKPA 2O55A 3NPXA 1EARA 1RHUB 1URRA 4XD5A 3C66A 1S9GA 4DUYJ 3VD3A 1X0FA 3O6DA 3NNTA 3H12A 5FJTA 1T03B 1WDQA 4JXCA 4HA4A 3KK2B 1XIDA 2CLHA 1DJQA 2C7FA 2XSXA 5HROA 1Z2LA 3EDRB 2VD9A 3OTEA 3GNPA 1RV8A 4M95A 2VFRA 4H4KC 3D46A 4YU1A 3B9OA 3PR4A 1Q6DA 4PCQA 4DSJA 3FGVA 1YG0A 2HVEA 4ZO6A 2WWCA 3UW6A 3FBEA 1E4NA 3QKEA 4LVAA 2W9MA 1QOXA 4AIOA 1ZJHA 4NA2A 2XM1A 5J2PA 4UQAA 1UPPA 3WBAA 3T2QA 3MWBA 4RV3A 2C1GA 1L8PA 3AOFA 2H3EB 4M6UA 4O14A 3IVTA 2J7FA 1WKLA 1N4LA 2XVLA 5DJBA 2MZQA 2LQ8A 4DR3J 4J9JA 2B7OA 4IYQA 1K3UA 3DLEB 2DISA 1NSAA 3F2DA 3P96A 4K8GA 4ZOBA 5DO2A 4LYKA 4TVAB 4MPQA 1JIHA 4JN7A 3BBBA 3A9BA 3ULHA 3QPZA 1ZTVA 1B99A 3HHDA 5HL7Q 3ZQ9A 2LLEA 4AD6A 2BXJA 5EWFA 4TX6A 3FBFA 2DVIA 3K7RA 4US6A 4C6LA 3VFLA 2LMIA 1EXPA 2H5EA 5KZDA 2E40A 2XS2A 1MNSA 2GMJA 1XLEA 1IM4A 4A2SA 4H6RA 4ZFCA 2DNKA 1KNZA 1IT0A 3C0LA 4GVGA 1E6VB 4QQ3A 4I7FA 1GMWA 4RBUA 4JYAF 1ZS6A 1W3TA 1QI0A 2MDAA 1YDOA 3FCPA 1EP2A 3GH5A 2YNFB 4B9UA 2B7QA 4WJ8A 1CGVA 4O3NA 2R7UA 4FX6M 3AQOA 1LBLA 1M9HA 3N73A 3S8SA 2B31A 3ORWA 1Q6GA 1KM4A 2QJGA 4LF2A 4D71A 1MZHA 2VZSA 5CSRA 3RJYA 4PSPA 2ZUNA 3R8GA 3ZO7A 1OFBA 4WU2A 1F5ZA 1SH2A 4GYFA 2CAJA 1G9HA 4UF4A 3UXKA 1M01A 4NNAA 3S0CA 2QULA 1QTNB 3LP0B 1XHGA 4WY0F 2J7EA 1HWJA 2RSQA 1QVGR 5ITHA 1F5CA 3KJFB 1PGZA 3M8ZA 1QNRA 3BO3A 2PF0A 3H8AA 2J76E 1S79A 3KG4A 2DHAA 4KQZA 2H48B 3CIXA 4KCVA 1GVEA 3WDPP 2J9DE 3GIJA 3C56A 3TA9A 5D0GA 2EWHA 1S48A 4KAIA 1IBLJ 1U48A 3V5RA 4B3OA 3P81A 3ZMRA 2JOQA 2XB2D 2DJXA 3D1QA 3VAKA 4BDPA 2NSXA 2ACYA 4ZZ9A 2D1ZA 3KWXA 2DCLA 2WONA 1Z8AA 4AL7A 1M90T 3RCYA 1CEZA 1AZSA 3WF2A 1X6NA 3OL9A 3WD1A 4NI8A 3IM8A 3POCA 3IARA 1FRKA 2E5BA 1KM0A 1XYFA 2B0GA 1JCMP 4MB1A 3TYBA 4XAKA 5E0CA 4FALA 1FFGB 3NQ2A 4W90B 4H9VA 2CLMA 5EMMA 4RZRA 1JD9A 4O8RA 2Y7DA 5D8WA 3W02A 1EQPA 2PDGA 2WHLA 3TONA 3FVYA 1I94F 1P27B 3OFHA 4DI6A 3B8UA 3CJ8A 3P74A 3PIOQ 1CX9A 2KHDA 3GDKA 2FPHX 1NKBA 2VP8A 4F7VA 3H54A 2DSKA 3P3BA 4NAEA 2BB0A 4DPUA 3MM5A 2EPOA 3C2VA 2DT3A 3SDEA 1RA5A 2ZZ3A 3QVQA 3KLGB 1MO0A 4FS2A 1BVWA 1DQXA 5GVJA 1E0WA 1X39A 5EMUA 2F8QA 3CQIA 4NNCA 2J24A 3D0GE 3AHPA 4DM2A 1PSCA 2B56A 2HROA 1VP5A 2OEJA 4DBQA 3OSPA 2VRQA 1BRLA 2P9EA 3K46A 1LWIA 4DI8A 1J0KA 2FHFA 2UUBF 1OINA 1YPXA 2J6XA 5LIWX 2EVZA 2YL5A 3D3CJ 4RU2A 2MY8A 1YE6A 2VWTA 3UXDA 2OZ0A 2RDIA 4XSMA 3S8HA 1ADOA 5A8WA 4LV4A 2QF8A 2ZZ4A 2CPHA 3VTIA 2CQIA 4F04B 4NXMJ 4CO3A 2Q6ZA 2MQQA 2PAJA 4ALZA 3NOYA 1V3HA 1FWAC 4H54A 1KWGA 3PW4A 3TJAA 4OHXA 3PK7A 1X1ZA 4GFIA 2D22A 4DR7F 1MEHA 1TUXA 1R85A 2OPPB 3BSNA 1R30A 5ETMA 3PZQA 1VHFA 1AG1O 1OY0A 5FJUA 4XIMA 1HBNB 4ZK7M 1U6ZA 2BZNA 2H3DA 2Y8UA 3RAMA 2CFXA 2AL2A 2FJXA 1RHQB 2DU2A 2XVKA 1MU2B 3CEUA 3MPDA 3H22A 3ARTA 3QMTA 2W92A 4RUAA 4RUHA 4KCWA 1G6CA 2FZDA 3BSMA 3TN5A 1V3SA 1OD0A 2Y9HA 2PZNA 1MROB 1TTPA 2CIMA 5DBTA 2D2OA 1SM9A 4MWAB 2JFDA 4IO1A 4QG9A 1UKQA 3DFEA 4LUYA 3DOMA 4O28A 1EJUC 4B3TJ 3CE8A 4LF7F 1S4FA 5H91A 1MXGA 2H4YB 2YQ3A 4W4QA 1F6KA 5D2YA 3WJZA 4DR2J 1A3XA 3MV11 3LBMA 1WD6A 3GW0A 3N9KA 1M7PA 3K5MA 4OJGA 2V2DA 2ZEJA 4KGJA 1LWXA 1P4CA 3Q67A 1E4MM 3TA1A 1PX8A 2X05A 4GBDA 3SYZA 1F2HA 4PUNA 4AZCA 5HI7A 1WI6A 2RRNA 1WUEA 4IG0A 3W2WB 4QBUA 5AYXA 1G4TA 1GMWD 5FF3A 4O23A 3KLVA 4PKDB 4F4WA 3BSOA 1VCGA 3L4BC 8XIAA 1YZ7A 3MJMA 2KB2A 3AMCA 3GAYA 2PBOA 2NYHA 1R89A 4XVDA 3NUKA 3HDSA 4LIWA 3M6VA 2IA6A 3T2PA 1B3ZA 9XIAA 1B0PA 2PCQA 1UIOA 4RXGA 1FKAF 3BDEA 3I65A 1PWLA 1GOWA 4NL1A 3GVVA 1B9BA 3N25A 4GACA 5ETSA 4NX5A 1W3IA 2PDHA 5F7UA 3WD2A 2FDNA 3KOZA 1RK6A 2HQDA 3BPSP 4X84A 4IP7A 3SQOP 4NE9C 1UH2A 4JTJA 1WZKA 2K8GA 2YA1A 2EHHA 2VFEA 1M5VC 3MUCA 1FF2A 1FCUA 1XIJA 1M03A 5GMDA 3QLLA 4OJ1A 2QFJA 1DYSA 1LWCB 1JUEA 5LIUX 1PG5B 4KRWA 1RACB 4EMDA 3SRKA 1QUMA 5FESA 3F2BA 1ZBTA 4IOCQ 2FVLA 3K5LA 1RT3A 3WMLA 4HI2A 4N0RA 5D4OA 5D78A 3CCZA 3R1LA 1I1XA 2NVAA 2V5JA 2YNGB 2XVPA 3P80A 1BQNB 1YQ2A 3ZOAA 2NWRA 3K8LA 3UN2A 4K2XA 1EIXA 1H74A 3BW4A 3SAZA 4RL1A 1B54A 1KQSR 3MBDA 2GJXB 1MWZA 2ZBCA 5DMLA 4J90A 3VKJA 4ZB2A 4MNMA 1ZCOA 3W26A 1FNOA 2VJUA 4PG7A 4QITA 1P0DA 1UCNA 4DUXA 4WP9A 4JI7F 4Z17A 2G97A 2GVLA 3RILA 1FEHA 4MIWA 4RKAA 4TY9A 2XMMA 3W1AA 1OFPA 1V7YA 5CCMA 4PG6A 3L3CA 5ABFB 1FKPB 3UJ2A 1T8EA 1MYRA 4JX5A 2WCGA 2GSJA 1OY6A 3OVRA 4LF9F 3PZNA 4LOCA 4IOBA 4DV7F 5A6BA 4B9ZA 3TOYA 3DZ1A 1MW0A 3MHYA 3IG1B 2ZOMA 5KZEA 4UTFA 4EPDC 4I67A 2NQZA 2PODA 2DDXA 3R10A 4IJCA 1QE1A 3WDQA 3I7QA 1YEYA 2G2YA 3DRRB 5A8OA 1AYEA 5FEWA 4DIAA 2DH7A 1QHOA 4TQTA 3TMLA 1Q2RA 4IPIA 1GKPA 1B31A 1KR4A 5A6SA 1EEPA 1M41A 4JFVA 3QKZA 4Q4MA 2D3OR 2PWGA 1LP6A 4IISA 3DLGB 5AXMA 1NH6A 2D74B 1T03A 1TL3B 1SKUB 2CG4A 3DG6A 2CPDA 2BVTA 2TYSA 3DDMA 5M2UA 2EPKX 3LX9A 4PXCA 2HPIA 1Y10A 4CQCA 5CYQB 2O9OA 3MMBA 2VIHA 1GOQA 2ABBA 1HMVB 3NCRA 5F2GA 2ZIDA 3MAAA 3H4DA 3WL1A 3T1YF 1BGAA 2Y63A 5IM51 1NJZA 3VNLA 4BQ2A 2AQOA 3VNJA 1DTNA 3SGGA 1X5PA 1GOMA 3SQSA 3EDEA 3WQOA 2MUCA 5A6PA 4DWSB 3E12A 4ACZB 5LA0A 1VFUA 2ZVIA 3R43A 3TR2A 4EI2A 2CJYB 4BI7A 2EJ1A 5H9EJ 1TUVA 1TTIA 1NARA 4LYQA 2J66A 2DW7A 3FJ2A 1VD6A 3PUOA 3TX0A 3ME3A 4V1Ak 2PD5A 4EX4A 2VFUA 1F9EB 2BUNA 3KBVA 2E5DA 2XJ7A 1SIZA 1EUNA 3QT8A 1Q3NA 2D23A 4HD5A 2UUCF 3WMSA 3TUPA 1F4HA 1M5PC 2RUSA 4FI4A 2OVLA 3TJLA 3EE3A 3RB4A 2CZ4A 3W6YA 4O12A 4OMFG 4B02A 3S5NA 3UXIA 2ZH9A 3HQPA 2YCJA 3IRXB 5KFDA 2N7YA 1XBZA 5L1LA 1S12A 4K7YA 3WDHA 4UZCA 1XC9A 8A3HA 5CC7A 1E6VA 4DUTA 3N3TA 2IS7A 3MMBB 3A47A 2CPZA 1RTHB 5HMXA 3QLHB 1V3MA 4HQVA 4DXLA 3VDBA 5LA1A 2LXIA 4GO8A 3LZ3A 4F9DA 3B06A 4LSLB 1KXVA 2GO8A 3HGRA 2C3UA 3HZGA 1H61A 5KFWA 2WZTA 3IAS9 3D5MA 1H72C 1MQQA 1XDJA 1XCXA 3BCJA 1FJ7A 3WLSA 3QQ0A 1EYWA 1W3HA 5J1EB 2KVIA 2I38A 4DXVA 2XBPA 1XNRJ 3AD8C 4NXMF 2MTLA 1EA9C 1HNZF 3G82A 4KR0B 1R3TA 2BDQA 2O67A 4RPFA 1YRXA 3ZFVA 1FRLA 2D0HA 2CJBA 1HVQA 2LU1A 2V82A 2QPSA 4D6JA 1JZ8A 3CW2C 4JV0A 1EB0A 1NFGA 5G0RB 1ME8A 1AODA 1W1TA 1AT1B 3W62A 4PC8A 2P3EA 5JMNA 1V5XA 2R7QA 3W2KA 4NLVA 4HEA9 4RW4A 4PUOA 2OJ3A 4DJBA 4J40A 2Y1IA 2VEIA 1ADSA 4K39A 3C4UA 4F2RA 2ALYB 2YWGA 2RDJA 3P2VA 2DSVA 1VQNS 4Y8EA 5CCZA 2J0QD 2YKMA 2R9RA 5BRPA 3DRPB 4Y2CA 5HUPA 2IUZA 4HU3A 2XVNA 4L4LA 1Y8BA 2R8IA 3L9ZA 1HKIA 2E44A 1TCMA 2AQ4A 1H2JA 2FKPA 4Y00A 4V19X 4HGXA 1PE1A 3UJSA 4OYWA 1VBKA 2R2SA 1S3TC 5K8NA 4MJMA 2L9DA 5G4HC 3OVGA 1FVPA 2ONEA 3VU2A 3NWGA 2FVMA 3LUTA 2IRXA 3JSBA 2XY5A 1RXOB 4DO5A 3WO8A 1IXKA 3STGA 3CLWA 1GOIA 3GQCA 4AIBA 1I6NA 2LA6A 6FD1A 4ZA0A 3UPMA 3GIKA 3OSNA 4ENOA 3HA1A 1WBHA 4I5RA 4ROQA 2EG2A 4MKAA 1H09A 2PD9A 3I0RA 1K02A 1NLKL 2PI5A 2OO4A 3BH6B 4J9QA 1D9EA 4PBEA 1ME9A 1S1TB 1KV8A 2J4GA 3OFEA 5B08A 2JEGA 3V6DB 1Q1KA 1WORA 4YTRA 4WX2A 4ECXA 2DZXA 1HBUA 1W1A1 2YCIX 1WF1A 4MDPA 4JI7J 2AJQA 4UCGA 3DECA 2I56A 4TMBA 3QGIA 4P73A 1PEZA 5J5RA 2L48A 4JTEA 2GMLA 2YDAA 3P67A 3I7SA 2GDQA 4V2XA 5KG3A 1AZ1A 2ZZ6A 3BDKA 1F0XA 2A7RA 3IGHX 4HK7A 2ICSA 1WI8A 1TRDA 3S4TA 3T07A 4IFOA 4NLXA 1F5BA 3CTLA 2PLKA 1GQEA 2A3LA 3OR1A 4JFWA 5I42B 3TEGA 2VBYA 2M2BA 2A79A 4P2SA 3K1GA 2HVZA 2V63A 1X8DA 5A69A 1QATA 3J81Y 3HJFA 3KOYA 3TYCA 3O5TB 5FEZA 3R13A 2BM1A 1NFBA 3OLBA 1JYWA 3RR7A 4QCEA 2CQDA 4FNIA 1JJCB 4ERGA 4PXEA 1HI8A 1EGZA 1HW9A 5CLTA 3IFEA 2ZH3A 2G5WA 1W32A 3W60A 3WBZA 4KKOA 3G18A 4EYIB 3L4UA 3CV2A 3GHRA 1U2CA 3MVTA 2B6AB 1VKFA 4OI4A 4ORIA 1TG7A 4L4OA 4HNTA 3N13A 2XSBA 2X1BA 3Q2DA 2GVGA 3LSBA 3WEZA 3W7HA 4DJDC 4LBHA 2H54B 3WY1A 3HB9A 1H2TZ 4NZJA 3ARWA 5AC5A 4H8HA 5D4YA 1CXHA 1L5UA 2B3TB 1Q5MA 3C16B 1WXJA 2YGYA 2XDFA 3QPIA 1SSDA 5H8PA 1FKXA 9CGTA 5HBMB 1VCFA 4HACB 2RQKA 2X0SA 4GQQA 4DS5A 1FERA 4TLRA 4KWSA 3M7VA 2PDMA 3TFCA 2XCPA 1QAIA 3RNDA 4H4IA 1FXRA 2PO4A 1R3WA 2YBVA 2KT2A 3H53A 2UUAJ 3GG7A 3SSQA 4H8NA 4FR1A 3T78A 2V9WA 1BQCA 2W2OP 1DJIA 3TX9A 2QZRA 4RNMA 1QD1A 4G7FA 4FS1A 4UXDA 3LWMA 2VYOA 1HYSB 2ZZTA 4V28A 2Q8LA 3SQLA 3WDRA 5KFQA 2Y1LB 3VAVA 4JI0F 2CXGA 1OY8A 4YY3F 1AQ0A 3QWUA 3P8BB 3G6YA 3LXCA 3A13A 2E1PA 3TRGA 3QHMA 3MUMP 1O0PA 3DBNA 3KHHA 4LBUA 3TC3A 2OT0A 3GXTA 2C13A 2Z6IA 2QL9B 4CM2A 2D1CA 3SM0A 5DFAA 3BJYA 4LSLA 4S0MA 1D8WA 4DG1A 4N77A 4IQDA 2YYTA 3REQA 4ID5B 2XIIA 3J7HA 4MZ1A 2KU7A 5HNRA 2VQUA 4M7TA 1IBMF 1LWJA 1K4HA 3NQCA 3MEDB 3MA8A 5IT0A 1E5NA 4MIBA 2GQ2A 4PRRA 3DFHA 2H9ZA 1LWFA 5D3GB 3CIVA 4PRFA 1XQKA 2ZX6A 1NSKL 3WH9A 1L3KA 2VFGA 3T42A 1P6TA 3ITHA 4ECTA 4A8NA 1TPFA 4FLSA 2ZOGA 3CC4S 4JIHA 3WNLA 2IVYA 2FJEB 3S83A 1X5OA 2QUVA 3UWQA 4LEQA 2OYKA 4C6PA 1AXQA 2XGQA 1Q6LA 4YR3A 5F1UA 1JPKA 3H23A 1A5UA 4S1FA 3SV4A 1ZA1B 4D6GA 1RQ0A 5BRQA 3RO6A 3C14B 5D8ZA 1MXDA 1T7LA 1EDTA 3T5LA 1XLLA 2LYVA 1RBLA 3ICJA 5LNWA 1C3FA 3EPMA 4Y8FA 3TAMB 4NWBA 3VQSA 1F8IA 1J0ZA 5T9CE 3LHZA 4KGXB 1TL5A 1T9WA 5E3PA 4G3IA 4DSEA 2YDSA 5E3CA 2QQ6A 5HPCA 2R7WA 4JTUA 4TX9A 5K9CA 4LREA 1E6XM 4ATNA 1B9ZA 1JXJA 3RW6A 4B3ZA 2XZTB 4MWAC 2Z58B 1UMJA 4ECWA 4UQTA 1POKA 5H8MA 2RUGA 3TR9A 5G2IA 3VCDA 3WUFA 2OR2A 5EMYA 5F2MA 2G1HA 2VBXA 2QCDB 3UCCA 2YKOA 1QK2A 4UUWA 1SH0A 3CTRA 4MZ8A 2UUWA 3KLHA 5IM0B 1NVMA 4YFUA 1Q53A 4YEAA 3M44A 5M03A 4G7EB 4N76A 1RDRA 2QMJA 2ASHA 3C14A 2R9LA 3B04A 4M56A 2QXWA 1IZKA 2N4DA 1ALDA 1VDHA 2PWDA 2CQCA 3I82A 5DM7Q 1KFDA 4YL2A 3M8YA 4JEQA 3I4KA 2X3GA 4Y9NA 4TLQA 5CBJA 3ZZRA 2W2PP 4Q22A 4NMXA 2XLKA 5H9EK 4IMGA 2V68A 3UF9A 4DX6A 3V1HA 1GUVA 3AQUA 3AS0A 3JSYA 3Q58A 3W66A 1VQTA 4HPNA 2RHQB 2J79A 4LS0A 1CULB 3WLQA 2ZC8A 5D77A 3C8FA 4QIFA 1KB3A 1DV7A 1SV5A 1Z89A 2HLUA 3UR2A 1NJWA 3OQEA 3KLFA 3MTWA 2DCUB 2XMVA 1XYBA 3NPVA 4A21A 4DI9A 1KFLA 1R9XA 1UJ4A 4I1TA 3UNYA 1XH2A 2WNNA 3AICA 1XYCA 3R7BB 5HJLA 1PBGA 1J18A 3GC5A 3NSXA 1YJRA 1GJUA 3OZPA 5DDQC 3H4XA 3ISIX 5BXRA 3AHYA 3PYGA 4K2JA 4JI1J 4XKMA 4ZE4A 3IUDA 3QSIA 3LV5A 3VX0A 2W9BB 3O44A 3QQ1A 3VZZA 3OGVA 1D09B 2DRDA 3UESA 1NEEA 2ZNZA 4CNYA 1RAHB 2ACQA 4LYRA 2RQMA 3SMZA 2V4JA 4LAKA 3UR8A 4FZVA 2G4FA 5C7VA 1UEKA 1RT4A 2ZBQA 2GHWA 4P8XA 2KDOA 4E2FB 3PTQA 2INZA 2G95A 3G96A 1SMDA 4ES4A 3JSRA 1W3JA 2WOMB 3FJNA 1JCJA 1LG1A 1BAGA 4P2MA 3OA3A 5CGMA 1FUYA 5FDLA 4Q8MA 5FLXY 3VNIA 3D6MB 5G4DA 5F4SA 5JBDA 3F4DA 1PTAA 4USWA 3G1SA 2V3GA 2ZA2A 1H0GA 4Q4KA 3WLJA 3SI8A 1DQUA 2XHWA 3D66A 2R24A 1UP2A 3WLPA 1NZAA 4ES2A 4A8QA 3UN5A 2RJGA 4B9VA 2ZUMA 3KE0A 1J79A 2J6TA 2R1MA 1ISYA 4NYUA 4DMZA 1RT3B 3O8WA 1DAXA 4YVXA 4AD4A 1KKRA 1U1OA 1CLKA 1DIOA 1RHKB 2MZTA 1JPMA 3PS7A 2ZA3A 5DLCA 1TWZA 2BJ9A 3KL3A 2W4XA 4UIOA 5H9FJ 1G4PA 1XC6A 2UUCJ 1SB6A 3J80U 2J78A 1GNXA 4Y6GA 3QR3A 1NPPA 3EWCA 1RTJA 4KFPA 3M0VA 4UZUA 1OCQA 1RWNB 4B90A 3BARA 1X7FA 3CK5A 3ITYA 5C42A 4OI6A 4NF7A 5I23A 5J2MA 4EBDA 1SZGA 3E02A 4Z7YA 4UR8A 1KFEA 3QGVA 3QMSA 1WKKA 2KRRA 4WF9Q 1QT1A 4DX5A 1RT2A 1ISVA 2Y7EA 4ZO9A 4GNJA 2QLYA 1C8YA 2BP1A 4E4UA 1FESA 4OV6A 2YFOA 2NPIA 1XYMA 1W5OA 1YLVA 1NQKA 2DV0A 2QCDA 3GW3A 4WK1A 4WXWA 1K73T 1QSLA 1VMBA 4HHHA 4F02A 3JW7A 1XBWA 4QYZJ 1OX6A 2J0SD 1WCGA 4H00A 5FI8A 3UGVA 1UKUA 3PZIA 2C0AA 3STFA 2QL5B 3U2OA 1NK7A 3I7RA 3ZSTA 1MMLA 1U02A 1H7OA 5DQHA 1U1PA 3M0LA 1A9NB 4E4PA 1TR0A 4FPIA 1BVNP 5CXTA 1TPC1 3URBA 3S1TA 1EP3A 4FLOA 4IOAQ 3LTPA 1W3NA 3WQDA 3PZTA 3N11A 1XIMA 4LF4F 2TAAA 4YQWA 5HOSA 2G0WA 1AA1B 4ZP6A 5C71A 5BWFA 3FZBA 3LI1A 3C2FA 1T6MA 5LMUF 2OQLA 3EAUA 5FF0A 4M94A 1C92A 1TWIA 3LPOA 3FMBA 3ZZPA 1X8CA 1RJQA 2IHR1 1PCKA 2PWEA 1MMNA 1RHCA 1RTIB 1UVLA 2BVWA 4DSFA 2FJDB 3KJVA 3PSWA 4MY8A 1L6WA 2AGKA 2DEIA 3VHQA 4O1FA 3NS7B 2B8QA 2HGLA 2F9DA 3C8NA 1YBQB 1ECQA 2V81A 2AKZA 1R8PA 4OZ2A 1VLYA 3GR0A 4ZDNA 3R58A 3TC6A 1T40A 4JIPA 1SZRA 4PYSA 2HBQB 1WKDA 4F67A 3WLMA 4O50A 2VJVA 2CERA 4MKNA 2YX1A 3OR2B 3EB3A 4ELUA 1DTTB 4JD4A 3H24A 1RT6A 3IIVA 4RL3A 4KFBB 1G69A 2J7WA 3QZ8A 1KGUA 5IWAJ 4KJIA 3WNMA 1RA0A 1V08A 5HR6A 4ED1A 1O5RA 4AZCB 3QO9B 2WJEA 2UY5A 1Y5NB 5EHHA 1A3WA 1VIXA 2PEHA 2XO6A 3KL5A 1A0CA 4FMVA 3HHLD 2LFVA 5C9RA 3LTSA 4KGVB 1JQGA 4GKTA 3T09A 1REQB 4Y7EA 1X98A 2J8SA 3RF9A 1U25A 4M24A 4DPXA 2YW3A 3FSUA 4XO7A 1O7AA 5FEPA 3IIZA 3Q65A 1YXDA 1P7TB 4QQUA 4ROPA 1XXXA 4KEVA 3BPDA 4H7CA 3G1AA 4PUWA 1CJTB 2OLSA 3K8WA 4C8NA 2V4RA 1MROA 2CPIA 1TV8A 4JIIX 3W64A 1OD8A 4UQCA 1WC5A 3BJTA 5A2QY 4Y3CA 2ASJA 4E2VA 1EA0A 3GAKA 4GHRA 1VQ9S 1DWAM 3SCTA 3OEXA 3UPWA 2IQTA 1DKWA 3HHLA 3CCLS 2ZVRA 2NWSA 5J2PB 3VKAA 1OT2A 2X1AA 4TNOA 4DWSD 5A6MA 5MLCV 3R89A 1JLQA 4EBCA 4JR5A 3KMSA 3TCEA 1KRPA 1M6JA 1JVNA 4BR1A 3VCCA 1F07A 3DOKB 4I0WA 5E09A 4JDBA 3U2CA 3LGHA 3SCUA 1Q8BA 3T8QA 3TLLA 3T6BA 2NS1B 1X1OA 3MJYA 2Y4SA 2GVJA 4P72A 4JTHA 3AROA 3WQPA 2P76A 1RWPB 4GKJJ 1KLZA 3CNYA 3UVIA 3UZWA 3C2PA 1JF6A 4D6FA 4JI4J 3NNAA 3J81j 4AX7A 3TVAA 3BMXA 1CQNA 2HS0A 5CC3A 4RW6A 3BG3A 4M5IA 1OX5A 4IL0A 4LCRA 1KVJA 3PR5B 5D37A 4LF6F 2NQPA 3C86A 4GCAA 3V5CA 4IPLA 3W1PA 3LLXA 5LSOA 3EEGA 3IACA 1RAEB 1IEWA 1IKWA 2KXNB 3MO4A 4PRTA 3ZXWA 3K5NA 3TAMA 1GG1A 4ZOAA 1X4BA 3CJ5A 3S42A 2WZMA 3CUIA 5AHMA 1BG4A 3AA8A 3KWSA 4HCDA 4QE1A 1VPXA 2M88A 2O9PA 1UTAA 1EJSC 4DR6F 4MMWA 4Z2JA 2HLTA 3NQDA 4OYMA 1BYDA 3PYFA 3GXDA 3LPFA 4KCTA 5GNYA 4XPEA 3V5FA 4C65A 3PW5A 2EBEA 1U1HA 1N32F 3QWPA 1NB2A 4KO0A 1SO4A 2GGHA 2XC9A 1LZOA 4FB7A 4AT1B 1U8SA 2LQ9A 2AEJA 3C2YA 4UTTA 1HNYA 1TWWA 1KEKA 5A8PA 5CYJA 2WJDA 4CLUA 4DG1B 3SCIE 3CH0A 2NQHA 3B4MA 3UZYA 5DZ6A 3W24A 4KWUA 1W2IA 1ISXA 3KRZA 2DZSA 1OC7A 4O19A 3QY8A 1HJUA 1FXPA 3A5VA 3W2MA 2WSEC 2AJ1A 1OB0A 1FWGC 2CZFA 4OX6A 1NJYA 7ODCA 3HIJA 4MG4A 5AN7A 3AQPA 3GR7A 2J62A 3GSMA 3NAVA 1W1YA 2HRUA 2PFFB 4KSEB 4DZAA 3GHSA 1HIYA 3NTYA 2VEGA 4FXFA 1FVQA 3GNRA 4OX9F 1JPHA 4KF1A 2VONA 3GVGA 4IR9A 3ISNC 1JB0C 1E5JA 1LW2B 4WXZA 1BFNA 3O05A 4F2SA 3GKAA 3K13A 2HRTA 5CG7A 3WF0A 3PBMA 4QW8A 5EGRA 3M8WA 3AIQA 3DG3A 3HU7A 1DQWA 3WX4A 1FKOB 4X22A 1C8VA 1RCQA 4ZVSB 4M5PA 4QW9A 2V5DA 3GXFA 2XMKA 3H70A 3BR9A 4DFMA 1QAYA 3MR6A 4GJIA 1JG9A 4OL8A 2Q02A 1SO3A 1CYGA 1U1KA 3HGSA 4TQSA 3CB8A 3A3XA 5T9BG 2MZJA 4HOWA 2DNHA 4YCOA 1JNZB 2HTMA 1AK5A 1XRSA 2E5GA 3BLFA 4IMFA 3IGUA 2J8FA 3PTKA 2P2CB 4ZQOA 3AMKA 2I9SA 5EMJA 1X4GA 1O5QA 3GIPA 5DT5A 5LZLA 4X4NA 2JVRA 4RNJA 1F74A 5HMYA 3MUZ1 2HBXA 2NXNA 4G1IA 1H50A 2W79A 2GGPB 1XCWA 1XSIA 3UCQA 2IJNA 4JL2A 1R0BG 2P50A 3ZZOA 1GG0A 3ZTRA 3VIGA 3TK7A 4DZ6A 3SSZA 2PN6A 3PG9A 2IM3A 1DWHM 1FT8A 4AD2A 4C7DA 5BNKA 3WZ0E 1AFJA 4DF0A 3GU1A 4C48A 1VBYA 4IM4A 4JQ2A 4HMNA 1TPUA 1OGSA 2VZVA 3AMDA 4RCXA 3JSMB 1E6YB 3UJRA 1HYSA 1A7GE 1H1YA 3QEZA 1K8AT 3VYLA 1V3KA 5I3GA 4PH6A 3GDLA 4HH1A 3G8RA 3Q24A 1R6YA 4A8KA 3CCMS 3CYVA 1O8BA 4QWAA 3HV8A 4MT1A 2WVEA 3W74A 2XMWA 4H9MA 4QEHA 2QV5A 2BVZA 1TV7A 1DXEA 4XQ6A 4UTWC 1C1CB 4DQRA 4GA8A 3TYDA 1VGYA 5ABTA 2BJDA 2NXIA 3CXCR 4WSKA 3S6EA 2FJWA 3NVTA 1FCBA 4J5OA 4H2CA 3H2EA 2ADCA 1S77D 1RQEA 3PWIA 2VT0A 1EKSA 3N1AA 4H1ZA 4ZVEA 4DX8H 4JB8B 2KFZA 3M5ZA 1P9QC 3VGDA 4ZVFA 1O4UA 3AIUA 3M0MA 4RWXA 2WW8A 2QIWA 3DFYA 2QEXS 2DSZA 2VKRA 3EMCA 1MG7A 2YTCA 3EDQB 4WIQA 4MJKA 1FJCA 1XFBA 1S5WA 2XN0A 4GJ1A 4F36A 2BJ8A 2RIJA 3S7RA 1ITUA 4X9YA 1TL1B 4USTA 2RDDA 1FHLA 4UY85 2A3HA 5I24A 2B6AA 4G1QA 3U4AA 3VDGA 1N6QB 3M4XA 4NCGA 3D3AA 3BSCA 3PX4A 1CCWB 2DY3A 2EPLX 4ATLA 3GFZA 5BOFA 1TVPA 1TMJA 1F3WA 1MNEA 1W9DM 1H49A 3QLDA 4XKYA 5K9DA 2Z7GA 2PGCA 5F8IA 1A50A 2BS9A 1DY3A 3HPZA 2GQ9A 3NZ1A 3LHWA 1QCWA 2R1KA 2DH2A 2AMXA 2NQ9A 5D38A 4J3XA 1OYCA 1KTVA 1TJ0A 5AYIA 5D0EA 1T9YA 3H2CA 3D6NA 1IUJA 3HVTA 1OG6A 3GCXP 5B7ZA 2MQMA 4PA8A 4I64A 1R31A 3TEHB 1R46A 2X0HA 2P10A 2NUYA 5G2WA 1XR2A 4E98A 3ENQA 2E29A 3MUY1 4O3OA 1DQ8A 1FKOA 2XI2A 2W9CA 3SBFA 3K5OA 1GX6A 3MF5A 1K7FA 4C3KA 4A2RA 3U57A 1N5TA 5IOLA 1P6WA 4ER8A 4OHVA 2PB1A 2GIQA 2CQ4A 2X2YA 4XDDA 4RUCA 5HO4A 2E5LF 2EI5A 3QT7A 1R7AA 1W2VA 5FA5A 4CLPA 2HZVA 4CQAA 2NX1A 3R5DA 5E2QA 5GAHI 3DDNA 3TCSA 1GKRA 1W9PA 2OUGA 2DRBA 3GV7B 3IJ6A 1J5OB 3ILIA 1NHKL 4YDDB 5FJ4A 1W5NA 1CZ1A 3KVJA 2JQXA 1HUVA 3KUGA 5FD1A 3W9HA 4EXAA 2DITA 4B08A 4DVOA 3CUNA 3DU0A 3MDWA 4Q8UA 3SY1A 3D1OA 3TSBA 1QPRA 4JCLA 2EC0A 1UYQA 1YXYA 3Q94A 3QGKC 2ZZ1A 3MZNA 3H7HB 2E3ZA 2JGQA 4OYOA 3OJSA 4AFYA 4X61A 1RQHA 4NCAA 2XULA 1X8FA 3JTNA 2C6QA 4UFKA 5FLXU 2HK0A 3WF1A 3ZR6A 2QLXA 3ZVIA 1U1NA 3P49B 3PO4A 1RBOB 4Q8VA 2OU4A 2CNKB 5CZTA 3E0FA 4CNSA 2PGWA 1Q6RA 4M3PA 4I4BA 3G3MA 4NPOA 4M29A 4C6CA 4U28A 4UTMA 2CNLB 4LB3A 5BR8F 2ASDA 4DPYA 4QCLA 3O1NA 1EP4B 4JI3F 3FYOA 2RHSB 2IPWA 4ZLNA 1LL6A 1FWEC 1E0XA 3V4BA 1SI9A 3RAOA 1E70M 4LYPA 2V3EA 3W70A 5FL1A 5ENLA 2HCVA 3TJIA 2W8KA 2ANUA 1FX2A 3AA9A 1PHWA 4UTTC 4TKTA 4DLFA 1RKIA 1WXYA 2FB2A 2EG7A 4XD3A 4JHZA 1MWYA 5LXEA 1SUQA 2WKJA 1VRQC 2DNMA 3EWBX 3Q4DA 5BXIA 6XIAA 2WMIA 1DJZA 3LCXA 1A0OB 2FH8A 3FVMA 1LFWA 1H3GA 1XLAA 2VG5B 3ANVA 3L66A 4JKLA 2MKIA 3W07A 2YX7A 3DHXA 3VI2A 3N6MA 2HWIA 4ONVA 2OP5A 3QZEA 3S5SA 3VE7A 2WCXA 2OPQA 3KYLA 3DOKA 4RNOA 2MKJA 4BF9A 1U09A 1RE1B 4L72B 3OHIA 3KJQB 1NBEB 1S76D 2RJZA 1ZJBA 3W6MA 4AAJA 5DS7A 5BRBA 5DCEA 4JI5F 1HKAA 4Q3MA 2V69A 4Q7BA 1QLNA 5IRPA 4QZVB 3R5BA 2G96A 5IZHA 4HTJA 2CG8A 4I3GA 2VEKA 3MEDA 1MW1A 2DNZA 3HMCA 2QFIA 3NEVA 3Q83A 1C0UA 1VQSA 3HO1A 3TUZC 4O11A 4FYVB 2QL7B 4A8WA 3SUSA 4ZE5A 2E1MC 1UIPA 1H7WA 3OVSA 2YH1A 4ECRA 3W7PA 5I3QA 3UZ5A 5CAKA 4Y90A 5DG9A 1V4YA 2HNZA 3E2EA 2YXXA 3TA6A 4GYKA 3GXNA 4LR8A 2FVRA 2XZ7A 3VD7A 3VWSA 3L7RA 4C0BA 2CBUA 3F2CA 1BLUA 1FO1A 2EXOA 4JYAJ 3JZEA 1AMKA 4IG0B 1LM1A 3PPFA 5I42A 2VG5A 3MMUA 3QN3A 2M8HA 3NY0A 3TWZA 2CLEA 1EYEA 4YS1A 2WMGA 1JQVA 1FWBC 5LL6d 2C3YA 3SN0A 3ZO9A 3KDNA 4LS2A 2GQ8A 4P8UA 1KGWA 2Y7GA 4ZO7A 4QIEA 5BWAA 3LP2A 4KPCA 5D0HA 1BYAA 3H2LA 3I9ZA 1QASA 5C70A 3V4IA 4KMQA 4Q2MA 2GV1A 3W1TA 2H5JB 4C2MA 3J81U 2IKGA 1FDDA 4KIAA 2OOFA 4FNSA 2D0GA 1B3TA 3T81A 2HKEA 4WFYA 3SDEB 2CW6A 4WXYA 2QPUA 3IRWP 4G6VB 1PILA 4O3SA 3SECA 4X66F 1PVNA 3K17A 2WVFA 1SJQA 1YADA 5CG0A 2KYZA 3DLHA 2A18A 4P7RA 4B9YA 4R7WA 1CQMA 1G7UA 2GHVC 2PA3A 1JCYA 1QDUB 1Q6QA 1VK8A 1TREA 2C0HA 3WBWA 3U02A 3HP6A 1VEMA 1DWIM 5CKSA 5I09A 2E9TA 3M9YA 4J3WA 4HPGA 4IRDA 3NL0A 2B4OA 2QVNA 4K4ZA 1UD6A 3LTOA 5I3PA 3VIKA 3NL6A 4CKQA 3SY5A 4NI3A 2FC8A 3W9ZA 1QPQA 4PCSA 1WDRA 1ZP3A 2UVWA 4IH7A 5BYRA 2BYCA 2XSJB 2YKNA 2EGZA 2EK1A 2QF7A