4GRSA

Crystal structure of a chimeric dah7ps
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
333
structure length
333
Chain Sequence
MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVESVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDISAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering allosteric control to an unregulated enzyme by transfer of a regulatory domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Phospho-2-dehydro-3-deoxyheptonate aldolase, 2-dehydro-3-deo
total genus 106
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18152 DAHP_snth_FXD DAHP synthase ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4grsA02
3.30.70.1140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phospho-2-dehydro-3-deoxyheptonate aldolase; domain 1 4grsA01
3PSVA 4ADUA 2YYTA 4UTIA 3FJLA 5L6UA 8TIMA 3CWOX 3WJXA 3TQKA 1KV5A 3KVLA 2Y63A 4LUIA 4JN6A 1TPFA 3M5YA 3U2OA 4RZ6A 3T4CA 1SFJA 3G1FA 4MFDA 1FXQA 1AW1A 2C3ZA 5D2XA 3A24A 1OX4A 2CLLA 3TSDA 1RQEA 4UR8A 3S5ZA 3W88A 3HMJG 1G7VA 1O4UA 4PODA 4CNNA 3DI0A 2E5CA 1W1ZA 2QCDB 4Z1BA 1G6CA 3LHTA 4A2RA 3IVSA 4UR7A 2VFIA 5TIMA 5HR6A 3SZ8A 3W6YA 4AF0B 5LNWA 1QR7A 1ADOA 3GDKA 4JTIA 4LRTA 5J5RA 4O28A 5LHEA 1BWLA 2ZA1A 3BW3A 5AHNA 3CTLA 2AAMA 3DFQA 3UXAA 1OFOA 4MUZA 3S1VA 2JKEA 4FX6M 1G69A 3NOEA 3UY8A 1UB3A 2NUYA 1SPQA 2C18A 1RZMA 1EEPA 2I1OA 4IPJA 2ZRVA 4A3UA 3OG3A 1D9EA 2V82A 4HNUA 4FX7A 1KM0A 3B03A 3PBVA 3W2NA 3TNOA 3WJWA 2NX1A 4X9SA 3G3MA 3UNDA 5C54A 5HJLA 4PH6A 3VI2A 3KOFA 3TUUA 3HJZA 4YL2A 1EA0A 1FWWA 3GDLA 4Q32A 4JDYA 3B8DA 5AYXA 4EOUA 5MHBA 1W56A 2X1SA 5FI8A 1FCQA 2H8XA 1BWKA 1AL7A 1PHQA 3W85A 4FNPA 4KFPA 1WX0A 2AQWA 3GYEA 2J9XA 3PULA 3A23A 1T8XA 3UD6A 1KFJA 3DHFA 1L2UA 5DBUA 3F1QA 2CLMA 1N8FA 5G2IA 2Y7EA 3CB8A 3S6DA 3LOTA 4WY0A 1H7PA 3E9AA 4XBSA 1FDZA 1LYXA 4K7VA 2GQ8A 4AHOA 4JS3A 3W7KA 1AG1O 5HWMA 4CNPA 1EP3A 3E49A 4TX9A 5AFDA 3W7QA 4N02A 4JY9A 1KFCA 1JUKA 1RQBA 3AJXA 3ELFA 4ZQMA 4UNKA 3TH6A 3S9YA 2YW3A 2PRMA 4FIRA 4FHAA 3UPWA 4DO5A 1S3HA 4RLIA 3TV8A 1JCJA 2A6NA 1LTDA 2ZZ6A 1F6PA 4ML9A 3QEZA 4MY8A 4O10A 4JDBA 3VE9A 5ABTA 3S8HA 4HKPA 1JRCA 3EWXA 4LUJA 4DXVA 3TIMA 3JS3A 4RK8A 2XFWA 3S5YA 4JGDA 1HFBA 1UBSA 3FFSA 3MP4A 1B3OA 1JJKA 3TROA 4X2RA 1Y0EA 3W7RA 2ISSA 5D2TA 5FF3A 1JCXA 1XDMA 3EKLA 3W1XA 4GWEA 4O17A 4WUIA 1XC4A 2B7NA 1X7FA 3GKFA 4RZ5A 3LTYA 4CQAA 3GNNA 1TPDA 3QW3A 5AYYA 1U83A 2ZZ4A 4YMZA 5HULA 1K03A 2ZRYA 3SY5A 2PC4A 5G5IA 1DJNA 3SFKA 3P8JA 1ZJIA 1W5OA 2UV8G 1XBXA 4IOTA 2DJXA 1DV7A 4LW7A 3GNDA 4JEQA 1B9BA 2TSYA 2P1FA 3SI9A 1P0NA 4GUIA 4ZQRA 3ZR4A 2WNZA 1YPFA 3FLUA 1KFEA 1G4PA 2GOUA 3W1NA 3KVJA 3HG4A 3A9IA 1OYBA 2CZFA 1TPEA 1H7OA 1SUXA 4IMEA 5AHIA 1GTEA 1GVQA 4XQ6A 1OG0A 3LV6A 4IUOA 2YCEA 4BWLA 2J24A 3Q37A 1ME9A 4MKNA 3TW6A 3ATZA 2DZTA 4UTLA 1PCWA 1JVNA 3ZWSA 3MHUA 3CM4A 4GBUA 2PCQA 1YTKA 3NQ7A 4EF9A 3L0KA 1WXJA 4JX6A 4XTDA 2CLEA 4O19A 2G97A 3LRLA 4UTWC 4JYDA 1EUNA 4RCXA 5EA9A 4L4MA 3LLDA 1HO4A 3IIXA 5DELA 1NF7A 3BLEA 2Y88A 1AW5A 4MY9A 4E2DA 1R47A 4TR9A 2WKJA 2V5BA 2I14A 3P82A 4R7JA 4NU7A 1LROA 4NNAA 1F76A 3LI1A 3FYPA 5HMSA 4AB4A 3TSMA 3NQGA 4POCA 4MZYA 1G67A 2V5LA 1BTMA 5LHFA 3W2JA 1HUVA 4ZMGA 3GAYA 5K4ZA 4NXKA 3G0UA 1K8XA 1MEHA 4X3ZA 2FDSA 4K8EA 4I9AA 4UXDA 1SQ7A 3EX3A 1QO5A 3R89A 3P60A 4FXSA 2PRLA 4QSHA 4E0CA 2W6RA 1N7KA 2J88A 3NPVA 2E77A 2X2GA 2Z0IA 4M19A 2YFNA 1W37A 4RKAA 3QW4B 2PRHA 2X1UA 4ADTA 5I3HA 1JCMP 4LWWA 3TC7A 4S2CA 3W1MA 4MPQA 3SW6A 4QJ1A 3C2FA 5HWNA 2VFGA 3ABSA 3NM1A 4JYFA 3M44A 1IF2A 2QCGA 1AW2A 1H51A 3W1PA 2GVGA 3M43A 1K8YA 3NQ8A 2G95A 1VYSX 3PC0A 2GQ9A 4WOZA 3NNTA 3PF3A 3C52A 3R8RA 3KRUA 1LBFA 3NQVA 3FOKA 1GG0A 4NUWA 3L67A 4JTJA 4XKYA 5CPMA 1XUZA 2OT0A 2ALDA 2DZWA 5K4XA 3HG3A 3LB0A 2VFFA 2RDUA 2RH9A 5E0KA 4JR5A 2E6AA 5EBUA 2NLIA 3DBPA 1QWGA 2YR1A 3TCEA 4AMAA 3STFA 1THFD 3W7LA 2BX7A 1I2OA 2VEKA 3MBDA 3Q58A 5FF0A 1TTPA 3EX1A 3W22A 4DO4A 1GVOA 5F1VA 4K8HA 3P81A 4RZ4A 1RD5A 3QMTA 3BGGA 2QDHA 1KTCA 4H4IA 2V2HA 1I2NA 1YDOA 2Y7FA 5FF4A 4HPJA 3DFOA 4NZJA 2A21A 3W7PA 3PBYA 3NL2A 3SIZA 4GRSA 1L6YA 1P1XA 4QM1A 1VCGA 4TIMA 3M5VA 3NG3A 1WDWA 4H6KA 1OFQA 1ZFJA 4LVDA 2OMAA 1MZHA 2EAWA 1VLWA 4MYAA 1R2RA 1QCWA 3MHGA 1JRBA 2W79A 3BG9A 2KZHA 5I3IA 3FS2A 3F03K 1TPUA 5D37A 4O13A 2ZZ1A 5U4NA 3HPSA 4GUHA 5AC8A 1GPWA 2C19A 5LNSA 2G96A 5KMYA 4OHQA 1K3UA 1A50A 2GUUA 2YW4A 3NA8A 5DLCA 4AHPA 3GKAA 3W1UA 1ZAIA 5AHMA 3QF0A 3TR2A 4JTUA 3LHVA 2ZA3A 1XBVA 1M5WA 3B0VC 2Y70A 1GEQA 3C4UA 3N9SA 3QQ0A 3M41A 3M47A 3M6YA 3P74A 1NAL1 1OFRA 3GIYA 1G4TA 3L66A 1TV5A 5FEZA 3JRKA 5BW6A 3HF3A 4LTSA 1D3HA 2YXGA 3BW2A 2B7OA 5AHEA 2A6LA 3Q2DA 4FIQA 5T26A 3E02A 2C0AA 3T55A 1LBMA 2VKZG 1IXPA 1JQXA 4JNMA 1OF8A 4E38A 2QUTA 3FYOA 2FLIA 3GXTA 5F4WA 5CSSA 2QCLA 1VCFA 3PUOA 4UTHA 4JTGA 2H90A 3R2GA 3FJ6A 5FEPA 1GWJA 1K7FA 1NVMA 4QISA 5FESA 5C5YA 1SO3A 1FQ0A 2NXGA 3BARA 1OK4A 1TMHA 2ISVA 3LV5A 3QJAA 3TJXA 4ZL1A 3DHDA 3DZ1A 1ALDA 1RR2A 3T78A 1I45A 3C2EA 3F4WA 1IIHA 1EPXA 2XN0A 3M16A 2YFOA 4LV9A 5F4XA 4DPQA 3WK2A 5HWJA 3WJZA 4O8RA 3QZEA 2ZFAA 3TJLA 4N9DA 1IIGA 3G8EA 4OE7A 4DO6A 4OV9A 2RKXA 3BG5A 3DAQA 1KM5A 3PAJA 2Z6IA 3L2IA 3TQ0A 4DQWA 4RJEA 1W3NA 4N6FA 3EWZA 4R53A 4JD4A 3STGA 2JBMA 1OVDA 3IIZA 4UFMA 4XKYB 2VFEA 3L65A 5J5DA 1K7XA 1B4EA 3PBWA 1RQHA 4A22A 3OVQA 1TTQA 3E12A 3LRMA 4IXHA 2JKAA 1I4NA 4UNLA 3W72A 4AF0A 1MXSA 4XBKA 1IGSA 1DQXA 4O57A 1HTIA 2VFDA 2JGQA 5KZEA 1H7WA 1MEWA 3G1SA 3MYPA 5F2GA 4O12A 3YPIA 4FNUA 4CCCA 3QH2A 3HPZA 3I68A 4FF7A 1IXQA 1GYNA 3G24A 3H55A 5AHFA 3S1XA 4XUGA 3MUXA 4E2BA 1M6JA 4W9TA 2E5BA 2TRSA 2BWGA 2PURA 4Z1AA 1FDJA 4UUIA 3M5ZA 1SW3A 1DBTA 2QJHA 3W74A 2X30A 4UC5A 3BO9A 3M0ZA 3ATYA 3CQ0A 4M6PA 3ZFHA 4WJEA 5LKYA 4WQ6A 5K3VA 1N55A 2B0MA 1KFKA 4ONVA 1KW1A 3G1YA 1TREA 3TMQA 3W2LA 2TPSA 5BOOA 3LTSA 2CLOA 4AH7A 1TCDA 4UFIA 1Z42A 2B7QA 5D30A 2YZRA 2RDWA 1KBIA 3NL5A 4L4LA 5BMWA 3IGUA 3NL3A 1XBZA 5U7SA 4MOZA 3B4UA 1PCKA 3L68A 3L9CA 4GUJA 4C1KA 3QPZA 1KM4A 5HNRA 1IXOA 3QSTA 1FXPA 3PSWA 4EF8A 4WD0A 4Y96A 3N3MA 1CW2A 3N73A 1CI1A 4LC8A 3PBUA 5K9DA 3KHJA 1O95A 1JR1A 3GX9A 3QYQA 1LRNA 4Z1CA 4GE8A 4Z0JA 3W71A 3TFCA 3LCWA 4KWVA 2LLEA 2W0UA 4YLWA 3P61A 1K7EA 5FF7A 2FPYA 3S42A 4Z0SA 4Y9AA 2RDTA 2CFFA 3TX9A 3T44A 2ZTKA 3W7NA 4DELA 3C56A 4TO8A 2NWRA 1A5BA 1WQ5A 1QPNA 5I3JA 1EB3A 4FB7A 3TDFA 4MJZA 3MBFA 5G2WA 3W7HA 4WXZA 4PEKA 3UXDA 2EHHA 3NZRA 5EKYA 3RK8A 4HSOA 3LCHA 2CZ5A 1TV8A 3LLFA 3LRKA 2X16A 4BF9A 4FO4A 5DXXA 2X1RA 1C8VA 1ML1A 2ABBA 2V0TA 3RLVA 1H62A 2H3BA 5IM51 3LHWA 4NJJA 3VE7A 3LXCA 4ZQOA 3TK7A 2YSWA 3OVRA 3BG3A 1GYLA 5CPNA 4UCGA 1VR6A 2VENA 3D0CA 5EL1A 1UUOA 3LTPA 2A85A 2A5HA 3N34A 3G1VA 4QIUA 3O05A 5I3KA 1TJRA 1TPH1 4O4VA 1AK5A 1FBAA 3HO8A 1VQTA 4M6VA 4K6AA 5LGZA 2BLEA 3W86A 4JICA 1KM2A 1H1YA 3P5ZA 3HQ1A 3EXTA 3CIWA 2E6YA 5TQLA 3I7RA 5AB3A 4LV4A 3FKKA 1UCWA 4JTEA 2JK2A 2QDGA 1LM1A 3BPWA 2Y7DA 4RXFA 1RVGA 4ZZ9A 4JTKA 4AVFA 3WJSA 4UMBA 3ZS4A 4HPXA 5D33A 3W07A 2E1DA 1TV7A 4U4MA 1VLIA 2ZZ3A 3QC3A 4AAJA 3UWVA 1OFEA 1ICQA 3NGJA 4ZQPA 3W7OA 4IX2A 4JX5A 3W1LA 3QRHA 4PTNA 2E6FA 2ZZ5A 4BI5A 2EF9A 3O6DA 1HL2A 3WK3A 1C9DA 3OEXA 3LCGA 3OA3A 4ZQNA 4DF0A 1A53A 3NEVA 4MLRA 1YXDA 5KZMA 2XN1A 1VJIA 2A0NA 2J9ZA 3GXPA 3THAA 1LORA 1OK6A 1RV8A 3MO7A 2ZTJA 3IIVA 3NAVA 4UTJA 1F73A 5D38A 3TAOA 2CW6A 3NQDA 4LS2A 4WY0B 4BWLC 1WYIA 5D02A 5DXYA 2BXVA 1QAPA 3C2VA 3RLUA 1WOAA 3G22A 1T96A 2Q3OA 3DGRA 1K8ZA 4HHPA 2RHGA 4O52A 2Z2UA 5GVJA 2FB3A 4RR4A 4XWUA 1TB3A 2A1YA 1SR9A 2QCFA 2WNQA 4JY8A 3SJ3A 1EWDA 3W3OA 4OT7A 3O6YX 2GJNA 1H50A 2BZNA 5G4EA 3FKRA 4NVTA 3MI3A 5LNVA 4YCOA 1OABA 2QCEA 3QMRA 1ME8A 2NUXA 1B57A 2X1TA 1Q6QA 5D2VA 3M5XA 5HR7A 1LLWA 1PVNA 3DFNA 1H1ZA 4X22A 4Q33A 1YPIA 1R2TA 3GDRA 1MO0A 4AWSA 1W0MA 4OGZA 5F1UA 1P0KA 2B4GA 3P67A 5HUPA 3HG5A 4JX4A 4HNVA 2NXHA 3IIPA 3NQMA 3LM7A 2FJKA 3EEGA 2CLFA 4JIQA 1WV2A 3B0PA 3NL6A 4IXXA 4FEZA 3OHIA 4H3DA 3M9YA 4LS1A 2QKFA 3L5MA 3L0GA 4MJMA 2FTPA 4DEFA 5BRBA 2E5DA 3CEUA 3IVUA 3RF9A 3NQEA 4BR1A 3LCXA 1E51A 1H5YA 3NR0A 3DFSA 4NJHA 4N9CA 4UTWA 4NJIA 3LHUA 3W7IA 1ICSA 3WK1A 2CLHA 4O16A 4O4WA 1GTHA 1L6WA 1TYGA 2DZPA 2V2CA 3W2UA 4EIVA 3PVFA 4JTTA 2VEMA 4O1BA 1FWNA 5G1YA 3V1PA 4ORMA 3CHVA 3O6CA 1P4CA 3NZ1A 3S5NA 2NV2A 1GZGA 3BGJA 1YDNA 2WNNA 1I2RA 4JYEA 4N2YA 2NV1A 4NT0A 4MIMA 2DZUA 2ATSA 2ZRWA 4A29A 5LNUA 3PWAA 3SR7A 3NXFA 2J9YA 1L6SA 4QITA 3N2MA 2QEZA 3USBA 1JULA 2YYUA 5G2HA 4O1DA 4IMCA 1GJPA 4LT9A 1S5WA 1LRTA 2ZQ0A 4AEOA 4IQLA 1VH7A 2B7PA 1UASA 3O1NA 2R14A 3ABRA 4CNOA 1ONRA 2XN2A 4CQ8A 5C2XA 4LU0A 3GXNA 1KLZA 1Q6LA 1KM6A 5CPOA 1G4EA 3WK0A 3A5FA 1LRQA 4M6QA 3GLCA 4KFOA 2HMCA 2TYSA 3E96A 3L5LA 4ALDA 4CQ9A 4FXRA 5DN1A 2C1HA 1SZNA 4HSNA 4PA8A 3QMSA 3CU2A 2Z1BA 4C1LA 3IGXA 3LX9A 1FCBA 3I6RA 2Q8LA 3PS7A 3C0JA 5EMUA 3F4NA 1F05A 3U8GA 5BNKA 4ICNA 1FCVA 5EPDA 3GK0A 4UFKA 4CLMA 3GZ3A 1XKYA 4TU1A 2FQIA 1W54A 2GVLA 4GUGA 4YWIA 1VHNA 4UFJA 3TFXA 3UWZA 3UYCA 2GJLA 2CU0A 3KVKA 3L5AA 1OFAA 3DFTA 1YTEA 3BLIA 4HNNA 5K7JA 1OFPA 4FNRA 1TRDA 1JUEA 1DVJA 1PV8A 3VNDA 3S5OA 5CZSA 1DL3A 3NM3A 3WJYA 3MI2A 5KINA 2D73A 2FB2A 1MEIA 3E0IA 2OX1A 1OX4B 4S1FA 2Y62A 4Z1DA 1LZOA 1TIMA 3G8RA 4QQ3A 4NX5A 3TAKA 1TPB1 1VRDA 1QOQA 4TMBA 1FDYA 2BTMA 3O07A 4N6EA 2WSRA 3STCA 3HGOA 4M7SA 1BEUA 2FFCA 3PG9A 3LERA 1UUMA 3HBLA 4OU1A 1M7OA 4AWTA 1V5XA 3P8IA 3JR2A 2NX9A 5A8GA 3PUDA 1YADA 4LRSA 2NXIA 5LNRA 4O11A 4PCFA 2WSYA 3S1WA 2IQTA 4N4PA 3NDOA 3LBMA 1ZENA 4JIPA 5F4SA 3LHYA 3W75A 2GVJA 1W5QA 2BSLA 6ALDA 2A7RA 2HS6A 3L21A 4MVAA 3VKJA 1A5AA 1D3GA 3BK0A 4K37A 2TMDA 3EB2A 5C55A 4N9EA 5K9XA 2OZ0A 2A4AA 3M1ZA 5HUOA 3MP5A 4LVGA 3TMLA 3DI1A 2H6RA 1K02A 4Z08A 3RMJA 4LNYA 1XL9A 1QFEA 1JCNA 4P2VA 3TU9A 3M7WA 1PIIA 1KTBA 4DF1A 5FEWA 3LCIA 4EVZA 3CT7A 4P61A 4MZ8A 5CPLA 1H61A 1VS1A 2Y61A 1WBHA 4FNSA 3LGEA 3MHFA 3STEA 2VXNA 3LXAA 2WV8A 1H7XA 1GVRA 2A7PA 1I2QA 4GFSA 1NSJA 4JXCA 4UTTA 2AGKA 4OV4A 3IEBA 1WA3A 4M7TA 2HS8A 3VFLA 4FX8A 4DPPA 1SO5A 1R46A 3W23A 2C6QA 3LCLA 3HB9A 5AHLA 1T99A 1LP6A 1ZAHA 2OCZA 4I7UA 2QJIA 4IJBA 1S5VA 4GJ1A 2ZA2A 1Z48A 2Y7GA 1BKSA 4K38A 1TTIA 1QO2A 3TSBA 4IWWA 5BMXA 1H7RA 2ZCGA 3T40A 3W87A 3FA5A 5D32A 1ZAJA 1T0OA 1AMKA 3PB2A 3BLFA 3CLMA 3W2KA 3U6WA 3UWYA 1VYPX 1UJPA 2QCCA 1XCFA 5DCDA 1ZNNA 1GOXA 1WAUA 2FPVA 4OBTA 3SECA 4R33A 3INPA 2ZZ7A 3GDTA 2ZBTA 4IMDA 5H91A 4JTSA 2RFGA 5EYWA 1VC4A 1FY6A 3C8FA 1YXCA 3EWWA 2NX3A 1ZHAA 2OT1A 1F5ZA 3UZ5A 1TTJA 3LI0A 1EUAA 3THQA 1J2WA 3W7JA 5CZTA 5AN7A 3NO5A 3R13A 1KM3A 3G3DA 2R91A 1O94A 3MI6A 2Y6ZA 3UY7A 1F7BA 4B5NA 4K7YA 4YCPA 4PL2A 1X1ZA 4ADSA 3IIOA 2J27A 1W5MA 3KX6A 4O50A 2P10A 4RX0A 2Y85A 3G18A 1A5SA 3NPXA 4O14A 2J6XA 2C15A 3W1TA 4BK9A 3GAKA 1LCOA 2HTMA 1TQXA 3HGSA 1AL8A 3R12A 1O5KA 3W73A 3TQVA 2V9DA 1XBYA 2WPBA 2F7FA 4BI7A 5LZLA 4LVAA 2NUWA 5KTLA 4KKXA 4NQ1A 4UTKA 2HSAA 3UWWA 2C16A 2DP3A 1YTDA 1J4EA 5CZJA 1EIXA 4O1AA 2QUVA 1Q3NA 5F2IA 4DBEA 5DY3A 3KAOA 5K9CA 4NXSA 5EY5A 1OX5A 5F2MA 3G0SA 3BVJA 5I3GA 1PHWA 4UTMA 1TO3A 3W1RA 4DBDA 1LOSA 6TIMA 2E09A 3TW7A 1B4KA 3G1AA 1TRIA 5D03A 5KITA 4RXGA 3N2XA 1R30A 3NYZA 3ZWTA 1W8SA 3KRZA 3W2MA 1Q45A 4NJGA 3NQ2A 2CZEA 1I2PA 1LLZA 2WSQA 1OF6A 2Y89A 2YX0A 4Y8FA 4O0ZA 4N9BA 4XZ9A 5AC6A 4NJKA 4AXKA 4GNJA 1GVSA 3KRSA 3CIXA 4LC6A 3UWUA 3P84A 4BFAA 2QR6A 1EWEA 1QPOA 1MSSA 2QCDA 1JCLA 4U28A 3MJYA 2CLIA 2QF7A 2JKPA 3GR7A 3IRDA 2V2DA 3GB6A 3LBCA 4MLJA 3SGUA 1VYRA 4MYXA 1RPXA 1J5TA 3TXVA 5KZDA 1OJXA 2ZRZA 2ISWA 3HG2A 4I7WA 1W5PA 1KLYA 5LSMA 1TQJA 3DXIA 3HIJA 4CCEA 2V81A 1KM1A 3B06A 1QMLA 2O7SA 4A21A 4LS0A 4LVFA 5H2ZA 1TSIA 4GUFA 1X6UA 2EPHA 4CCDA 3W7GA 2DZXA 2CLKA 3KFTA 3RNDA 3O8AA 3AO0A 4K36A 1SO6A 1Q6OA 1F6KA 3NPWA 4NNCA 3EXRA 1WBJA 2VEPA 1L9WA 4FNQA 2NZLA 5AYZA 4UIOA 3EX2A 3G0XA 2WOQA 1NEYA 2VELA 2GQAA 4IMFA 1QDSA 1SU5A 2A7NA 4HT3A 4EWND 4LOCA 4AHQA 1W5NA 3R5EA 1OFBA 2R8WA 3I7QA 5E93A 3CEPA 2Q8ZA 5D09A 3LCFA 1V7YA 3G1HA 1KFLA 3P62A 1LOLA 3P7YA 4M5PA 4Q4KA 3O15A 1SW0A 1TPC1 3W7DA 5SWUA 4OQVA 3OVPA 1KBJA 1TJPA 1G4SA 1O60A 4ORIA 4MY1A 1TPWA 2GPTA 4HIBA 4YXGA 3L0NA 2E6DA 4N4QA 4TMCA 3K30A 4WY0F 3TKFA 4GXMA 5A5WA 3RFAA 2EKCA 4UTTC 1H63A 5G1TA 1ICPA 2ABAA 2FPTA 1GQNA 2CZDA 3EWYA 3DKJA 2NWSA 3CPRA 3W9ZA 1GG1A 3MW7A 1JUBA 3C3NA 5DCBA 2FIQA 4K39A 2QUUA 4PC8A 3W1AA 3UPBA 1OYAA 3S1UA 2PE4A 3I7SA 4IGHA 3NQCA 3OIXA 4KWWA 1PE1A 2E68A 5FEXA 3O63A 5AOUA 4NX0A 1DKWA 4BI6A 2QAPA 3QQ1A 4O0KA 1R2SA 1X1OA 1W31A 3N9RA 5D05A 1XI3A 3ABOA 3UWQA 1SFLA 4UFLA 3EWBX 3IGSA 1OX6A 4UMAA 1QPQA 3A21A 2DJLA 3RU6A 3TXZA 1CX9A 1W3IA 2VOMA 3C2RA 4S2BA 2QAFA 4Y90A 1HO1A 4A2SA 3CC1A 1DQWA 3A22A 1SZFA 1FUYA 1SSDA 1FWTA 1XM3A 3WFAA 3LXBA 2WQPA 3MMTA 5DCEA 2G5WA 3PG8A 3CWNA 2WO5A 3MYOA 3V75A 1O5XA 1OFDA 3UZJA 5L9FA 4O54A 3H54A 4MFEA 4NZFA 2I9EA 1U5JA 2ZYFA 2OJPA 4DF2A 1H60A 3GR8A 3IVTA 1QPRA 4XTIA 1HG3A 1EP2A 5CZ0A 5I3FA 4JTHA 2QJGA 2C13A 1FX6A 3B04A 7TIMA 5DY2A 1XXXA 1QOPA 4ZVJA 1VPXA 3NQ6A 1FCUA 2ZZ2A 4HN4A 5FF2A 4QAIA 1C29A 5TBOA 2YPIA 1LBLA 1NFBA 1YYAA 3GVGA 3HGRA 3PM6A 1YLVA 1F74A 1YDVA 1TPVA 1FWSA 1JQVA 3NVTA 3B0UX 1SW7A 4Y6GA 5C6MA 5E1QA 1S5TA 5K2ZA 4KFNA 4D2JA 3HPXA 3QM3A 3UQNA 1ME7A 4FNTA 3LHZA 4AWUA 5AC7A 1VGAA 3PR2A 1Q6RA 4R34A 3W70A 4NNBA 1SO4A 1WOBA 3GDMA 2V8ZA 1LDCA 4O1CA 2DORA 3FEMA 1SZEA 3EWUA 3N19B 2QCHA 3G1XA 3W84A 3SGZA 3S0CA 3TA6A 2EGZA 3W76A 1ZY9A 3DKLA 2Q3RA 3PUEA 4WOQA 1PS9A 5CSRA 3W1QA 1GT8A 3T7VA 4I7VA 2DZVA 2YGYA 3W7CA 1G7UA 3DENA 3QSRA 3BW4A 3VCRA 2ZRUA 2ATMA 3Q94A 2O7QA 1KA9F 4QNWA 2VC6A 3C61A 1XUUA 1SZGA 1ZALA 3G1DA 3DH7A 2A2IA 3I65A 1GVFA 3HOJA 4WZHA 1ZCOA 2DU2A 4J9JA 1PL9A 4RV8A 3EX4A 3W7EA 3BV4A 5F2LA 1OHLA 5KSWA 3KVMA 4UFHA 4LY8A 3PB0A 4PL1A 1FWRA 5DBTA 3NQFA 2ZDRA 3FIGA 1KTNA 2V30A 2DZSA 1VCVA 4O53A 3NPUA 1DOSA 4WXYA 4IX0A 3H53A 1YXYA 4IMGA 1XFBA 1W3TA 2VEIA 1DJQA 3QPYA 3W83A 3C6CA 4IPIA 3EKZA 1H7NA 1QNVA 3SSJA 4HNTA 3A5VA 4O18A 4JTLA 4G1KA 1EX5A 1SSGA 5CGQA 2QCNA 4PFMA 1Z41A 2F84A 3ANYA 4QNEA 5IBXC 4MZ1A 4UMCA 2R94A 3NQAA 5HINA 3W7MA 3ABQA 2VFHA 1P5BA 3P5YA 3DFPA 5D2YA 2JGYA 3MWAA 2CWNA 1KFBA 3B05A 3LDVA 5IBXA 5D04C 3N14A 4ZQCA 1I8JA 3KXQA 4OWGA 1JCYA 3PY2A 2WJZA 1VHCA 4O15A 3P80A 5HQEA 3EX6A 3OBKA 1Z44A 3O16A 5D2WA 1OYCA 3C2OA 2H3DA 3O06A 4LVBA 5CG7A 3HGJA 1EP1A 1M7PA 5CKSA 3TE9A 3MP3A 3QFEA 2QCMA 1KV8A 1LOQA 1F2JA 4JTFA 2H8ZA 1VZWA 3DU0A 4WX2A 1X8FA 2Z6JA 5LGXA 2YDAA 4GC4A 2ZRXA 5G4WA 1XDLA 1DORA 1IXNA 1A5CA 2C14A 3TC6A 3IV3A 1NF0A 3EXSA 2P0OA 1DHPA 4UTUA
chains in the Genus database with same CATH superfamily
3IK2A 3VX0A 2P9GA 4CLYA 4UTIA 3FJLA 1U1KA 3TQKA 1KV5A 3KM8A 4QJ5B 4JUZA 1IT8A 2E40A 3VK5A 4OV1A 4O0NA 2EC2A 3G1FA 3TNBA 3VMPA 1VPYA 1CXLA 1WEXA 3WUEA 2QV6A 3PAOA 3WELA 5D2XA 1OX4A 2CLLA 3HMJG 4HU0A 3H25A 3MTJA 3AJ2A 1ITPA 3DI0A 1W1ZA 2QCDB 2XGIA 3O0KA 2DFAA 4UR7A 2VFIA 5C9WA 4LVOP 2Y8VA 3PFRA 4MMOA 2JC0A 3EZ4A 3GU0A 1EP4B 2OQLA 4AF0B 2J7EA 2WSEC 3OR2A 3GILA 3PJUA 1BSLA 2ZH5A 4LRTA 3IAPA 4URSA 4GVBB 3QN3A 4OX9F 5KFAA 4O28A 1R0MA 4XD5A 1GOQA 3ARXA 2XWEA 4PGLA 4OJHA 1N8WA 2RUSA 3DFQA 3SFWA 4MUZA 2V0NA 1PYMA 2JKEA 1Z8AA 1G69A 3UG3A 1FRKA 3W7BA 1U1RA 4JI6F 2NUYA 1J11A 3MMCA 1RZMA 2PB1A 4AQYF 1XIBA 1KWGA 1RT2B 3JAMY 4A3UA 3OG3A 4GXPA 2MKJA 4JPGA 1D9EA 3KG4A 4MH8A 4F36A 4PQUB 1NB7A 1WKEA 2KB2A 2IRYA 2HMIA 3TNOA 1KEKA 3WUGA 1SH0A 1A4LA 3UNDA 5C54A 1FKWA 4WKAA 3VI2A 3Q86A 4NZ7A 5LJ5Y 3VUSA 1FF2A 3NGKA 4DLGA 3VKAA 2QNEA 2X1SA 1UMJA 4HB7A 4C6BA 1BWKA 1D9FA 4FNPA 3M2VA 2QO3A 1T8XA 1AFSA 1KFJA 3DHFA 3F5JA 1L2UA 3WBWA 2B8QA 4WE1A 4RDVA 3H5YA 2DNZA 1M41A 1PO9A 2UY5A 3UD3P 2FHJD 4ERAA 4XBSA 3QV6A 4Z2XA 4PMRA 1LYXA 4K7VA 4AHOA 1ZRQA 2CZVC 2HAFA 5FL0A 2V50A 4TX9A 4OZLA 3UW6A 4PR6A 4ZQMA 2HROA 3S9YA 1W3HA 5C9ZA 4CLZA 4B9VA 3EPMA 3E8OA 3UPWA 4XTTA 1U8WA 7ENLA 3CQKA 4GFIA 2OPQA 1AD4A 2RUGA 1RT6B 3U4AA 2EKNA 3CO8A 4TVUA 4L64A 2QMUB 4RUHA 4DFMA 2AEFA 4WDWA 1JF6A 3SDEB 4ML9A 4JHMA 3HU7A 4H6QA 2OX4A 1XLGA 2HEKA 5HNNA 5ABTA 1EC8A 3S8HA 4ZLNA 1JRCA 2LEAA 5D8WA 3TIMA 3U02A 3NO3A 5CBBA 4XX6A 3VKDA 4GH3A 5HPCA 2CPEA 1I75A 3FFSA 4OUIA 3QQCD 3RX2A 1LEOA 4ZPVR 3N9KA 3DG3A 4EMDA 2EFPA 4FF5A 4N7QA 3SN4A 3H7HB 4NPOA 2UZ9A 2ISSA 2V9WA 2GUYA 2XHYA 1WC5A 2Q6CA 5C7VA 3LW5C 2XIBA 2LXFA 6FD1A 4DHVA 1FJEB 3TYCA 3GKFA 4J3VA 1TPDA 3QW3A 3DYAB 4Y9NA 4GC6A 4UF4A 2J0WA 3ONBA 5I23A 2GGJA 2EBGA 2XNRA 2I8EA 2ZD1B 3O9NA 2HXTA 4Q4MA 3QQWA 1GQJA 3DG7A 4M0XA 3SFKA 3WDJA 3P8JA 3L9ZA 4US5A 1S46A 5J2NB 7REQA 4CLWA 1JNDA 2MKSA 1XBXA 1I3OB 3IUDA 3KOAA 3PHTA 2QZ8A 5C25A 3AHTA 3ITOA 2MZJA 3E51A 1TKZB 4QYRA 4ES3A 2Y8WA 2V8PA 3H2VE 3TYDA 3DRSB 5E5NA 3BAYA 4DCJB 1VJWA 2ILZA 4P2FA 3FSUA 4OLOA 3ZTOA 1YPFA 3FLUA 4V19J 3W1NA 2AYGA 3I3BA 5I07A 1U47A 5FJPA 1KKOA 3H42A 3V35A 4GIYA 1CENA 3A9IA 4ID8A 4IKAA 2CZFA 3RAMA 3O6AA 4Y2IA 4JKKA 1ZBKA 3NNAA 4J35A 3PTDA 3I9ZA 4A8OA 4ZFCA 1OG0A 3CDBA 5IHSA 4LREA 1D7FA 4LQ3A 3HO1A 3N2BA 2YCEA 4RW6B 4BWLA 2XISA 2IMRA 4DJDD 4U9RA 3R2DJ 3WLMA 2BQRA 4BA0A 2IVMA 3CNYA 3ATZA 2QJJA 4BS0A 1AJ0A 2DZTA 2XS5A 1UJQA 4RUBA 5ABHA 3OGRA 1B3XA 2YX7A 4AVOA 2XULA 1SJQA 4QDWA 5BU9A 3PX4A 4EF9A 4XZNX 1S1RA 1WXJA 1VQYA 1PILA 1SGJA 3WLHA 1IBLJ 2DRBA 3MEGB 4W84A 3H26A 1US3A 4UTWC 4JYDA 1EUNA 3SCPA 5EA9A 4L4MA 1XMBA 3ITHA 2A2DA 3K8VA 1URNA 2ACMA 3IIXA 3VOFA 2HHWA 2K06A 1PSCA 1AW5A 4WKHA 2BKNA 5KFOA 1M9HA 2QLYA 1OIFA 3QLHB 2WMGA 3ZJ8A 1S48A 2AYMA 4R7JA 1T9UA 4LBSA 2VYOA 3VIMA 2HQ3A 3DLJA 4LF6F 2HPMA 1NDYA 3Q0AA 4MZYA 1R7AA 2M8HA 3DLKA 1G67A 1ZUAX 3AWNA 3RYSA 5LHFA 1ZOTA 1UVJA 3ULHA 4JV5J 3ZC4A 4NKCA 4UY85 2DSVA 2EPKX 2W7PA 3WEMA 3C2YA 1SKUB 2P8BA 2Z1KA 2KXHA 5D4OA 1JL8A 1Z7AA 3QGIA 1FHVA 1R5YA 3UVJA 2CFXA 4HH1A 4H1ZA 2GL5A 4K8EA 1XR2A 4MWAE 1JLQB 2IVFB 2RDXA 2XWXA 3WBAA 5CC3A 1XINA 5C24A 2XZ7A 3R89A 5GJMA 2C2MB 4E0CA 3WF0A 2J88A 2CPHA 2X2GA 3E6EA 1RH9A 4RKAA 1W37A 1S9GA 4MAVA 2GW8A 1HR0J 2UVWA 4AW7A 2I5QA 4I6KA 4LWWA 1L3KA 4S2CA 2HBQB 3KJQB 1XR5A 3M05A 1F0XA 4WIIA 3VNLA 1QSLA 3ABXA 3VGUA 4JOUA 3RZAA 3HTWA 1R6VA 1CXKA 4JYFA 3GH5A 1IF2A 1SZRA 2IM3A 3H7UA 1AW2A 1DPMA 3WMLA 3KYLA 3WLNA 3IWPA 3W1PA 4QE5A 2GVGA 2RILA 3M43A 1W2PA 3H2OA 5ADZA 1B5TA 3OVSA 1ADDA 4GO5X 4CLSA 4DLEA 1LOUA 2BA9A 4Q3MA 4KGXB 1A3XA 3DLEA 3W81A 3CJQA 3IG1A 8CGTA 3PF3A 1P9QC 2YBVA 3V1HA 3ZXWA 1NCLA 2K3KA 1GG0A 4JI2F 3LZ5A 3L67A 4A8WA 3VAVA 1TVRA 1ADSA 2FH6A 4NCGA 4PQUA 4LF5J 1LFWA 2W01A 3NKYA 3AAWB 5ETTA 3VX1A 2A3LA 2GJ2A 1OCJA 3G96A 3W5YA 4RPFA 3QT6A 3WQVA 3JXOA 2R8HA 2BVZA 2AHOB 1S4EA 2FYXA 3MMCB 3K4WA 4DSEA 5L1JA 5EBUA 1B30A 4H00A 3ALGA 3FAXA 3KKFA 3HZ3A 1THFD 2ZUWA 1NAQA 1OIMA 3DDNA 3PYGA 2I2YA 2ACYA 3UVAA 3Q58A 4JNYA 2F8MA 2Y1IA 3DEQA 4DO4A 2RHQB 5F1VA 3BN7A 3LP0A 4DZAA 4F0RA 3SV3A 3J81Y 3K8MA 2NSBA 2FZNA 4WEVX 5LXEA 3SIPB 4DXXA 3GTIA 3QMTA 1UD4A 2V6AA 2QDHA 4LCQA 3PEJA 2V2HA 3TJ4A 1I2NA 2ZWYA 1YDOA 2Y7FA 2GHVC 3GRIA 1QAXA 1UEKA 4GD0A 5GAGI 2A21A 3N6JA 4USKA 3PBYA 2GJRA 3A4JA 4ZCLA 4DV0F 3IBFB 4J3UA 1FWLA 3D67A 1L6YA 1EC7A 3EUNA 2HHUA 4MM1A 2Y4SA 3DC2A 4UTGA 1GQKA 3MSGA 4B9TA 1Q8IA 1UZHA 1OFQA 4JQ4A 1FFGB 4IGSA 2RDDA 3UXKA 1ZFJA 1BD6A 1Q86T 2QJMA 4P8VA 4LUTB 4XZIA 1CC7A 2ASLA 2QSFA 1WKLA 1VLWA 4MK8A 1ZQ5A 1QCWA 2BANB 3RGIA 3BG9A 4LF9J 2CNOB 3MVTA 4A8YA 5I3IA 1GKQA 1TPUA 1DARA 2EI5A 3W25A 1EZZB 2DH3A 4QCLA 2VX6A 3WLLA 3VOCA 3WF2A 2PWHA 5AC8A 4OZ3A 3UERA 3WIJA 2FVMA 1BKHA 5KMYA 2CXEA 1BXCA 1HL6A 1E43A 1XR6A 3TVAA 1XYMA 4P7NA 5CG0A 4A8FA 2YW4A 4TQRA 2VGIA 3L4ZA 4IL0A 3NA8A 4QWBA 3U27A 3M0HA 4ZPBA 2Z56B 1PIFA 4WK9A 3LP2B 1WOOA 2CWXA 3KLHA 3LHVA 3GJQB 3LS9A 1XNQF 2VUYA 2CDRB 4PPZA 3TZZA 1GEQA 3K59A 3M41A 4NYOA 3UZXA 3IAM9 4DFKA 1UH4A 2PLCA 4YOEA 4D3HA 1ELOA 3T0CA 4DAFA 1TV5A 1GAOA 2HWIA 1A5OC 4GC7A 3I96A 3HF3A 1V4YA 5DRCA 3WSUA 1LWHA 2OD4A 3S5SA 3ILLA 4L5ZA 5GAEI 3PM9A 1R3VA 3MM5B 4L1WA 2Z26A 3Q2DA 4CH0S 5HMXA 3EZUA 1HBNB 4QR6A 3OZPA 2YQ0A 2H5EA 4JNMA 2E7WA 4WPAA 1YPXA 3KWXA 2QUTA 4I6AA 2D9PA 5F4WA 4WIQA 4IG0A 3VDAA 3ZZZA 4XSMA 4YPJA 3Q8UA 1ZS2A 1QU4A 1VBZA 1FHUA 4B5VA 3HVTA 1R0BG 1S1TB 4ZHRB 1DYSA 2A3HA 3E3XA 4JBRA 3BARA 2NYIA 3KLIA 1ZBVA 3UPFA 3CYVA 3QJAA 1HNIB 3GCWP 1HW8A 2WB1D 1SJDA 3C15B 3BANA 2LXUA 2CAJA 3AJ7A 3L7PA 1VQNS 1ALDA 3T78A 5IWAF 1I45A 1J01A 1VS3A 3VAMA 3LY0A 5AKQA 2DXDA 1GMUA 4I5XA 2PTDA 2BQUA 2YFOA 2E9BA 2XB2D 5F4XA 5EMLA 1X97A 3WK2A 4FYYB 2ZFAA 3TJLA 1LXJA 3QLHA 1IIGA 2NSXA 1IYXA 4OE7A 1BWEA 1HKMA 3UCUP 3DAQA 1KM5A 2X1GA 4C6FA 5JMNA 3ZTSA 1LQ0A 1QI3A 1O0PA 3PW7A 2E9MA 1Q5YA 2XMWA 4MF4A 2V4JB 3CUGA 1F2GA 1OVDA 1E0VA 4UFMA 1JKHB 2VFEA 4YHEA 3I4EA 1J12A 2VQUA 3PBWA 3QT5A 1EJWC 3S4TA 4DX8H 4RU9A 3OVQA 3LRMA 2DGAA 5J2QB 2JKAA 3PZPA 1XPGA 1MXSA 3MHYA 4W88A 1IGSA 1DQXA 2ROEA 2VFDA 3GSMA 4A47A 1PIEA 3OLGA 2BJEA 2J0XA 4M8UA 5HQ8A 1KWMA 1T9WA 5F2GA 4R88A 1Q7ZA 2FZMA 4BHQA 1UJ5A 4IRCA 4OL8A 1S7HA 3LGMA 1XN9A 4NRSA 1VRUA 5DQPA 1U2CA 2JVOA 4XUGA 3G86A 1YTYA 4NXMJ 1RVKA 4P7TA 3ITYA 4L1XA 4JZ5A 4OHYA 1HR0F 1X0PA 1U1PA 1FDJA 3M5ZA 4LAUA 2QJHA 1T7LA 3WQWA 4X4SA 3CCSS 1Q65A 1DQUA 1KXHA 1ZGDA 4JQ1A 3BO9A 1V3MA 2BGNE 1FHLA 1G7CB 4M6PA 3ZFHA 3FDKA 1H5VA 3A3HA 5LKYA 1A6LA 2Z0GA 4F4XA 4P6QA 3BSNA 4OMFG 4FN5A 2NXJA 1KFKA 4AL6A 5FACA 3W2LA 4KT0C 5BOOA 4DWSB 2ZEJA 1SL1A 2VP8A 3TONA 4X64J 4RNMA 2YKNB 1FP8A 3GNRA 3RRGA 2OFGX 2B7QA 3GS6A 3A4XA 2YZRA 3FBEA 3NL5A 1KBIA 5BMWA 2R8GA 3IGUA 5U7SA 2KT5A 4NCAA 1QUPA 5T8GA 2HV5A 2CQ1A 2BRLA 2G50A 1S57A 3B4UA 1PCKA 2B4PA 4ERDA 3T6BA 3JW7A 3QHNA 4W87A 4HOWA 2J9DA 1TR1A 3VXGA 3PSWA 1EF3A 5J8LA 4OTKA 2A6OA 4DR3F 4Y96A 1MROB 3WNPA 2GZOA 1CW2A 1SR0A 4JIRA 3AXHA 3I82A 1AUDA 1O1ZA 4R27A 3M8QB 1PTDA 1KOHA 4V2XA 4P9SA 3IRXA 5A6AA 2VX7A 3GX9A 2J76E 3A13A 5CHCB 1KBKA 2OQHA 4GE8A 3LCWA 4KWVA 4QLKA 2DVIA 2W0UA 4YLWA 3P61A 4PTWA 2FGOA 1CLFA 3H23A 2VQEF 2PWFA 3SCKE 2UVRA 2UUCJ 5JXSA 3QIPB 4LSNA 3U9IA 2P50A 4Y9AA 1S1PA 2J79A 3W60A 3THTA 2LQJA 3TX9A 1M5PC 1KQZA 4HMDA 4DELA 2H4WB 1YRXA 4OYMA 3C56A 3CJ5A 2E9RX 4DZIA 5D6GA 5GNYA 5ECVA 2XMTA 5E3CA 1UKQA 4L9XA 4AFFA 3ZQ9A 1AH4A 2OWXA 4CO0A 2XZ9A 4V1YA 4KEUA 2G1HA 4HK7A 6CGTA 3WY1A 3UXDA 5EKYA 1KNZA 1R9YA 1FWBC 3OZMA 1FRHA 2CVIA 3LCHA 2BGSA 1WD6A 4PCQA 1N34F 1FFWB 2V8HA 4Z7CA 4DVOA 5LIXX 3HP6A 4EACA 4GX8A 4IFKB 4KGLA 3U7VA 1H62A 2H3BA 1SCJB 1F1BB 4NEYA 2POTA 1BGGA 3LHWA 3T0BA 4NJJA 4NYZA 2XSBA 4OIFA 1HN1A 3VE7A 4ZQOA 2RDJA 2CPUA 1Q0NA 4NLVA 5E6YA 3E5PA 3TK7A 3OVRA 3BG3A 5J04A 3M2RB 1UW9A 1TUWA 3RRAA 4WFAQ 3RR4A 2VENA 1IJFB 3D0CA 4B90A 1UUOA 1TVPA 1D1UA 2A85A 2A5HA 3CJTA 5LSOA 2PTXA 3L4UA 1QI4A 3R5GA 1R89A 5I3KA 4F4AA 3BOLA 1AK5A 2PS2A 3R8HA 1VQTA 4PMQA 4WR3A 3DI6B 3EMTA 4XAPA 3ZT7A 1F3FA 2J5AA 3R2CJ 1T8QA 3OP2A 1H1YA 3IRSA 1CXEA 4RE3A 1TU0B 3RM4A 4Q8WA 1WZKA 3ZZYA 1CJUB 1YIJS 2ZC4A 2DUZA 3FKKA 3M0VA 2F8EX 1HBUB 1W3KA 4Q7AA 2RS8A 1B3VA 3UNYA 4ZLPA 1RA7A 2QDGA 5BOEA 3BPWA 2Y7DA 2ASDA 2ZOGA 2JF7A 2YA2A 3ARPA 3OW2R 3S01A 1F6TA 4JTKA 3RR7A 4CNUA 1CCWB 1VFMA 3RR8A 3R7NB 2PO4A 3ZS4A 2E29A 5AVNA 4RWXA 3W07A 2RMLA 4FXVA 1LT8A 1TV7A 2VZ9A 4XAYA 4HPGA 3ITVA 2AJ4A 3PXGa 3NGJA 3QIDA 3PYFA 3NDYA 4PTNA 3WF1A 3L7OA 2E6FA 4ZPTR 2HISA 2EF9A 5FJIA 1HI8A 1HL2A 2I9UA 4ZSTA 2Q8XA 3WK3A 1FJ7A 4RW4A 3OEXA 3LCGA 3WMSA 7REQB 5KZ6A 3PANA 1ISYA 4DF0A 4NAFB 3EWGA 2E1CA 1REVB 4M24A 3VD5A 3BPDA 1VJIA 5ETQA 4MB4A 4CQCA 2DPJA 1XWLA 1OK6A 1VFUA 3TTSA 1R7OA 2ZTJA 3IIVA 3NAVA 4UTJA 5KG3A 1F2HA 1F73A 4DJFC 1W32A 4WY0B 3BE7A 1WYIA 5L9XA 3VR1A 1ZPWX 3C2VA 3ES8A 3QJJA 2AX0A 2FUG9 1FDBA 2LP4A 2ZICA 5FJTA 4J9LA 1T96A 4KGVB 1IQTA 3F7JA 4FXDA 1IBKJ 1K8ZA 3GC5A 2XWYA 3HI9A 4HHPA 2U1AA 3PPFA 1NU4A 3P49B 4O52A 1NK7A 2FB3A 3OTOJ 4XWUA 1TB3A 4JY8A 2WNQA 3TCSA 3W3OA 1OO0B 4Z2KA 2DVUA 4BY3A 1SL2A 3W24A 3O6YX 1X39A 2LXIA 4E6MA 5G4EA 4QIFA 1SB6A 4NVTA 3SAZA 1WHVA 3HVTB 1OABA 1ME8A 2QXWA 4CD6A 1B57A 3GVRA 1Q6QA 4YJ5A 4PCPA 3GTFA 3M5XA 4RW7B 1D2KA 1EHNA 1LLWA 9CGTA 2VR5A 5DMNA 1I1GA 4P73A 4I5UA 1VBGA 2C42A 5F41A 1X0FA 1FHTA 2O67A 1OJ4A 1FNOA 2GAGC 5CEWA 1R2TA 3GDRA 4DSFA 1FJGF 4HCDA 1S6QB 1S2AA 4OGZA 2B4GA 1RQ0A 1XLEA 1MI3A 1GOMA 2ZX7A 4RDYA 2VBXA 2DKOB 3NGUA 3EEGA 2PEBA 2W9AA 1JXEA 2XI2A 4C8YA 3NL6A 1CQMA 3MS8A 3QRPA 3OHIA 2UBPC 3M9YA 3Q8VA 3L5MA 4DEFA 2FTPA 1HPZB 2BABA 4ZKAA 4F2RA 2ZKMX 3C66A 3MPWA 4D6EA 4JOMA 3CEUA 4BR1A 2KH9A 3QT8A 4DUWA 2OU4A 4K5SA 1JXVA 5J1PA 3KXDA 4NJHA 4E3VA 2CVEA 4CLPA 1FVQA 2NXUA 3B9OA 3VIJA 2CLHA 2W9BA 3V6JA 1LG1A 4ZCWA 2GMJA 2F9DA 2MQMA 3MA8A 3ENVA 4C0BA 1U2RA 4LR8A 3VD7A 5MLCV 1B54A 4YHGA 5DFAA 2DZPA 4A8IA 3V6DB 2V2CA 3GU9A 3H6OA 3L23A 3W2UA 4EIVA 1NDLA 3PVFA 2VEMA 2F6KA 1UP0A 3VQTA 2DEJA 3V1PA 3CE8A 2UXBJ 4HACA 1ZPTA 2RH3A 1P4CA 1US2A 5HQMA 5H1WA 4PAAA 2ANUA 2DISA 9ATCB 1Q85A 3E2VA 4JTDA 4QROA 5IFPA 1HWJA 4JYEA 4DMZA 4QE1A 2WKGA 2KFNA 1W1YA 3RU0A 3ARVA 1RCOB 2JC1A 2ZRWA 4RX6A 4D6CA 3PWAA 1E4MM 4C6IA 2QA4G 4KFBB 4LYPA 4QITA 3KCLA 1JULA 2BODX 2YYUA 4WVXA 2F9JA 4LT9A 1S5WA 1V6XA 2UZAA 2ZQ0A 3J81U 4BWJA 5I7GA 2B7PA 3PO5A 1NXIA 1KWKA 1DJZA 1HI0P 2W24A 2R14A 1WOSA 3MM7B 5BRQA 3A4AA 2R8IA 2DZAA 1C92A 5I0DA 1VMBA 4M95A 1Q7MA 2GDVA 2J78A 4CQ8A 2CNNB 1UIPA 3TARA 1Q6LA 1WKJA 3W9JA 1H38A 1E55A 3W5ZA 2E4TA 2BJ9A 1OADA 4HPNA 1FWAC 4K2XA 5ETVA 4E3TA 4IRKA 3H2AA 2ZHBA 3VZHA 3L5LA 3V2UC 5HPOA 4K4TA 4OYZA 3P5BP 5B80A 2CYGA 5DN1A 3OQEA 2VWSA 3HMCA 2V4QA 4TTUA 2Z1BA 4L7ZA 4C1LA 1U6FA 3LX9A 1FCBA 1LV5A 1EZWA 4CO1A 2GVDA 4DLMA 5A2AA 3U8GA 2DY3A 1HJXA 1AZSB 1DJHA 1FCVA 4AZGA 3FBFA 4UFKA 4FNHA 3UN2A 1HKAA 2ZZMA 3MM5A 3MTWA 2GVLA 4Q6XA 1JPMA 3Q89A 1UFLA 4YWIA 2HE5A 3D2WA 3ZTRA 5LIYX 2ZITA 3TEVA 1DXEA 2PFHA 3O1LA 4ZR8A 3GCXP 2CU0A 3AHYA 4G1QA 5K14A 3TAMA 3DFTA 4URIA 3BLIA 1CB2A 3DIPA 4K3ZA 4QEEA 1RY0A 2DT2A 1TRDA 1US0A 3EM1A 4MDPA 3MUY1 1KC8T 2ZDOA 3LUTA 1IUJA 3S5OA 1JGMA 1QW7A 2KX9A 2C91A 5D9OA 1KFDA 3EE3A 1AROP 5DX7A 1RY8A 3T81A 3HD2A 1DL3A 1C7TA 3W9HA 3KW3A 1JLAB 3U3HA 3JAMU 2OX1A 1OX4B 1ZB5A 4S1FA 1Y7PA 1YQHA 2Y62A 3RDKA 1C1CA 5D4NA 1LJYA 4JFTA 4B3RF 1OY6A 4B3SF 4ECRA 3C6UA 3O07A 3Q22A 4N6EA 1N6QA 3MKKA 3HK2A 3STCA 3HGOA 4PYSA 1E6QM 4M7SA 3UP8A 1BEUA 4ZEPA 1XEZA 3CO4A 2PDUA 3V5OA 4D8LA 3LERA 3GDBA 4ENLA 2EO7A 4C6MA 5KFJA 3S9IA 2OMOA 1RT5B 3M0MA 1P8GA 3OFHA 2CJAA 3AB2B 3OSNA 2PLMA 3HN3A 1Q8BA 4A3QA 1YKWA 2FTYA 4DPXA 3BGOP 5J1EB 3BN4A 3EGWB 2DT9A 2JEQA 4HSHA 4HMNA 1QWKA 1VQ7S 3CCQS 2X40A 4MG4A 4C6CA 4O11A 4G1IA 3HCXA 1B99A 3OLIA 2IQTA 4N4PA 3LBMA 1C2PA 2QPSA 5CH9A 2QFIA 1TZ7A 1W5QA 5ETLA 4F50A 3SB0A 1R3RA 2A7RA 1NDPA 1O68A 4W7VA 1A5AA 4HK6A 1DHMA 4EX4A 4OIXA 1NFPA 3BK0A 3BAKA 1S5MA 5HMDA 3HJFA 3EB2A 4ZE5A 2YL8A 5F9NA 1IXKA 5BYSA 1PIGA 3B9DA 1V03A 3MP5A 1CEOA 1B0IA 3RGTA 4I2PB 2B51A 3K89A 2OYLA 1FH7A 2ZNZA 4Z08A 2HZGA 3PUGA 2D0HA 5LOQA 1QFEA 1XQKA 3TAPA 1VBRA 3IBCB 2HE8A 4OUEA 2VJXA 1WB0A 4O0IA 1KTBA 2VHLA 1NZ8A 1E15A 4P61A 3Q23A 4DS5A 2AKZA 4PN2A 3MHFA 1OSDA 3STEA 2VGGA 2WV8A 1H7XA 2XVKA 1KGXA 2UY3A 2I1RA 3T5KA 2DNOA 1ISVA 1KHWA 4ZJQA 4M7TA 1H2VZ 4B9ZA 3GWCA 2XVGA 4UOJA 1P9YA 1R46A 5CYQA 4MT1A 2C1EB 2C6QA 1CLXA 3UR8A 3HFVA 4QJ3B 3LCLA 2GQ2A 1NTHA 2WYSA 2J7BA 4BEQA 2OPSB 3JUGA 4DBUA 4G6VB 2OCZA 4U2ZA 3CMJA 5DZ7A 1T94A 4XIAA 2EC0A 2QJIA 3MUAA 4CM0A 1QHOA 1S5VA 4D8ZA 2ZJQQ 2OLSA 1XCXA 2J7CA 1WJ9A 3GJSB 1Z48A 4ZOAA 2KRBA 3T4WA 4NRRA 2CITA 4AD5A 5BMXA 1H7RA 2MPUA 2ZCGA 1ODZA 4TV5A 3W87A 3IGNA 3FA5A 3KLEB 5FOOA 1RHKB 1WDDA 3FCHA 1DQ9A 4WFXA 5IS2A 4FF1A 1GH8A 1R85A 2XQCA 3ARRA 3UWYA 3KZPA 1LWFB 2YNHA 3TP2A 1VYPX 1XCFA 2W2QP 5DCDA 5A6BD 3ZR6A 2FPVA 3E0WA 1MYRA 3KUEA 4OBTA 3P3DA 3SECA 4J5NA 2IA0A 2GGHA 4AIUA 3IAQA 4DZDA 3PX6A 2WJDA 3CJ2A 3VOIA 1WKKA 1VC4A 2J74A 1PX4A 2NXCA 2Z2ZA 5FKYA 3M0KA 4NXNJ 4B3OA 1B0TA 4RW7A 1KDNA 3FV9A 3SRFA 2H3EB 5H9FJ 2R8KA 1F7BA 4RZRA 2DNQA 2DT0A 4F3MA 1X1ZA 2ZM6J 4ADSA 1XGZA 2FVLA 1SH2A 5HXMA 3KTQA 3VZZA 2HFUA 1HQTA 4AUBA 5CH7B 2P10A 2H1YA 3PZIA 4D71A 2W9CA 2NREA 2ZXAA 4O14A 3W1TA 5KFBA 3N6NA 3GAKA 1PC4A 4EZ6A 1AL8A 2HK1A 1O5KA 4QIVA 3W73A 1KQSR 3CB3A 4BJHA 2A3CA 1AUSL 4LVAA 1CZ1A 3VFCA 1X7IA 2J7KA 1GNXA 2MQQA 2G3NA 4DL0C 4OZOA 1MSWD 4XK8C 1DLOB 5CZJA 3CJPA 3LK6A 4EK2A 3HSZA 3P0XA 4B3MJ 2CKRA 5K9CA 4NXSA 1FRLA 3I6TA 2VU5A 2XLKA 4EWJA 3NSMA 4GKLA 4IG3B 2MKKA 4LFCJ 3P2VA 3W53A 3CNQP 5AYIA 4Q8NA 4Y3CA 1Q78A 1TO3A 4AZIA 2DH9A 4LEFA 3R6IA 1JWWA 3SCVA 1V02E 2GZXA 5J2NA 4DV1J 3TW7A 1UOZA 4KH2A 4YVVA 3M8PA 1TRIA 1DRZA 4HJWA 4RXGA 5CXPA 1R30A 3NYZA 2NUUG 4GMKA 3CMFA 3ZWTA 1W1IE 1W8SA 2WNWA 3IO1A 1Q45A 3IUIA 1KC7A 4YY3J 4DO7A 3NQ2A 4Q0BA 2FH8A 4HYWA 3SUTA 4LF7J 4GACA 2WSQA 2XCAA 4KEZA 1N5VA 1CC8A 4MTVA 1HNYA 4O0ZA 2VMFA 3NS6A 4PTMA 3T0TA 2Z4PA 4XZ9A 5JIWA 4NJKA 4AXKA 1GVSA 2A3EA 3AIVA 3CIXA 4LC6A 2BM0A 1QNSA 2BX6A 3KG0A 1CNVA 1W3LA 3P84A 3M30B 4PTDA 2PDNA 4C7QA 1JCLA 3J7AN 3MJYA 3O5TB 3V36A 4ZVOB 5A6TC 2WLYA 4AIBA 2V2DA 3GB6A 2GGGA 1CGUA 2Z2BA 3TXVA 1XNRJ 5HK4A 2ISWA 4GKJJ 4WKYA 4C0HA 1KLYA 2PMHA 2PI5A 1Y5XA 2RAGA 2V81A 3APGA 3HJVA 3E0VA 4A21A 4DPYA 1L5UA 7TAAA 1FEEA 4GUFA 5U47A 2E9ZA 3NLCA 2EPHA 3K46A 4CCDA 2VG7A 5A8MA 4MJ2A 1TV6A 3P8BB 4AIOA 4RW9A 4GXWA 3O8AA 2P8CA 4ES1A 1SO6A 3UG5A 4G56A 4URGA 1Q6OA 1F6KA 4NMXA 5TD4A 1WBJA 3SSRA 3MAHA 4IPLA 2NZLA 5AYZA 3UCGA 3AAMA 2HWTA 3RCYA 4HGXA 3IS4A 5KFUA 2WOQA 2VELA 2LU2A 4ES2A 1UWIA 3F4VA 2BUNA 3G82A 4FYXB 2HLUA 2A7NA 2PU1A 4HT3A 5C25B 4LOCA 1X4CA 1W5NA 3H5UA 2ZJRQ 1UR8A 2XTKA 4CU7A 4ZPAA 3RB0A 5E93A 3PACA 2CDQA 3CEPA 4I7FB 2CQGA 5HNTA 3LCFA 4DUVA 7FD1A 4LBHA 3IJDA 3P62A 2WAGA 3B0YA 3M0XA 1IZJA 4M5PA 2CQ2A 2RHSB 4V1XA 1TPC1 3RITA 2D20A 3PX0A 4OQVA 3OVPA 1KBJA 2UU9F 4B92A 3KLFA 1RACB 1G4SA 3HVWA 4Y2MA 4MY1A 1EBHA 3DU6A 3D3FA 4HIBA 4LFBJ 4YXGA 3L0NA 4DFJA 2QA1A 1AMYA 3MCOA 3I10A 3B6BA 3DGBA 3TKFA 3OR1B 2IM0A 4GXMA 1E9ZB 4H6EA 1E4IA 4UTTC 4JI1J 3D1OA 1TL5A 5TAOA 4QS6A 1ICPA 3DLBA 1UR4A 2ABAA 1W17A 3ZZRA 4IISA 1U0HA 4DV6J 2NWSA 1LW2A 4B9LA 3TUPA 3W9ZA 1KRBC 1RWVB 1P7TB 3KMQA 3NGFA 4JYAJ 1P0DA 1RADB 3RPTA 2B4VA 3EB3A 4FXFA 4I9MA 4K39A 2QUUA 4L4PA 3KP0A 1S6PB 2W7AA 4PC8A 3O8WA 3UPBA 2VFUA 1OYAA 4HR2A 3QR1A 1RP8A 3GFHA 3H4DA 4JV2A 1U1QA 1FKXA 1XJBA 4J9RA 4PRTA 4FMVA 2VV5A 3K1GA 3PJTA 1PE1A 4DR5F 4ZVFA 4KBIA 4NCGB 1L3SA 3COTA 2J7FA 5E9XA 1DHKA 4JIIX 5BXTA 2OPSA 1OGBA 3MUZ1 3BQ2A 2O0TA 3GYCA 2OD6A 4TNOA 5KT6A 3BSGA 2A2CA 4UFLA 4K50A 3C14B 2OPPA 5F7UA 1WF2A 3H20A 3FGCB 3GFYA 4UMAA 1XV8A 1NY1A 4GY7A 1V79A 2C3UA 2B6AA 3RU6A 1IGWA 4MAZA 3R6LB 2E1PA 1CX9A 1W3IA 3REQA 2VOMA 4S3DA 4L73A 4DUOA 1TAQA 4S2BA 1U0HB 4Y90A 4KO0B 2QVHA 4J4KA 4F9JA 4HVXA 2MJUA 2M5YA 1XH2A 3WCZA 3R9LA 4H8VA 1WPCA 5DRKA 1SZFA 1XM3A 4B5XA 1FWTA 2PZ0A 3N2CA 2CPYA 3GV8B 3POTA 2J8GA 1U48A 2B4OA 3VD3A 3QTGA 5HROA 3MMTA 3WBZA 1IEWA 5JU6A 1K1QA 4PYDA 4B3TJ 2WHJA 2DEPA 3V75A 4ZOSA 1O5XA 1Q8JA 2GDUA 4IQEA 5I5RA 3UZJA 4O54A 4GGBA 5C42A 3F2DA 4RW4B 4OZ5A 4Y0FA 2GUBA 3GR8A 1XK8A 4HT5A 4XPCA 3DYMA 1CGWA 1PWMA 3BH7B 4JI3J 5DG8A 3OYXA 3K8KA 5E41A 3G2GA 3A9BA 1QTMA 1I1XA 3HXMA 5M2PA 2C13A 3SZ2A 2PP3A 3KL0A 4EPKA 4AD2A 2VQEJ 5L9NA 1S2VA 5EUHA 3WDIA 1VPXA 3UCQA 2HMIB 5F8MA 5TBOA 4CGTA 5C9XA 2HPUA 4ECVA 3NMAA 1LBLA 2PDMA 3GVGA 5A8KA 3HGRA 4G5DA 1T41A 1Y7VA 3PM6A 4ED6A 1QAJA 2B9XA 3P6YC 1EH9A 1F74A 2IKIA 4YTSA 2CIPA 1FWSA 4QLJA 1UKPA 3B0UX 4OX7A 5KFCA 3NMRA 1SW7A 1DJYA 4YNGA 3GV7B 4Y6GA 1QT1A 3BC9A 4HTBA 5E1QA 5C6MA 1VQKS 1S5TA 4DWDA 4MTPA 4KV8A 4F3HA 4KFNA 3CV1A 4D2JA 2DB1A 2C3YA 4OYPA 2ZX6A 2QG9B 3AC0A 3UQNA 4PCNA 4XAZA 3DCAA 4U96A 3ETOA 1NKBA 3H2UB 4LEQA 1EKRA 1Q79A 1JYWA 4J3WA 1Q6RA 2L08A 4R34A 4ED4A 3AYRA 5CJMA 4ZPCA 2BB0A 4IPNB 1T0TV 4MKYA 2O9PA 2V8ZA 4QWAA 4HP5A 4O1CA 4JNZA 3EDKA 1MXGA 5ETSA 3O3LA 3EWUA 2OQYA 1E5NA 1LQAA 3G1XA 3UZZA 2BYCA 1QXLA 5I3UA 1TL3B 1PB0A 2YKMA 1S5NA 5K8OA 4GJJA 1CS4B 3OLDA 3KMSA 3W76A 4MGGA 5AT1B 3ENLA 4DR5J 1TUGB 2X7IA 3PUEA 1PS9A 1QVBA 2I0XA 3T7VA 4IHCA 3UEQA 3UN3A 4I7FA 4UTFA 2LA4A 4F8XA 1W3JA 3QSRA 3FHQA 3GBDA 3OL8A 1ZM2A 2ATMA 3Q94A 3M2UA 4QNWA 1WE5A 2HGMA 1DE6A 4AD3A 3DH7A 3I65A 1VBKA 5IC6B 4JI8F 4WZHA 4QIGA 4CTAA 1JNEA 1R8BA 2DU2A 2CBUA 1U8SA 2FLOA 3IJQA 3PHEA 4CVWA 3N2TA 3MXHP 8RUCA 1YK9A 4IFYA 1YHTA 2MYFA 2PFDA 3BKUA 3RIKA 3NQFA 1U1NA 2AYBA 3R8GA 3NDZA 2GIQA 4ES4A 4I67A 1KTNA 3QGVA 2OG9A 2VTFA 4O53A 1VCVA 3BO3A 1VJQA 4QG6A 1X98A 4TLQA 1JLGA 4IX0A 2QVNA 4AXJA 4IMGA 1XIQA 1UP2A 2IRXA 4YTTA 2J9CA 4DWSD 3BXWA 1XRTA 2XMMA 2WVVB 2GVZA 4XO7A 3A5VA 4NZ4A 5CGQA 1EX5A 1QOXA 1SSGA 3GYNA 3CIZA 2IKJA 4QNEA 2FZDA 5IBXC 4W86A 2VCBA 1ZBTA 3U5UA 2HKEA 4I68A 1M5SA 4PPDA 1IKWB 1E5JA 2F4FA 3CXCR 4KQZA 2GSEA 1N0VC 3CVKA 1OQ6A 4LSZB 3B05A 2F40A 5D04C 2QLJB 5T14A 3QOKA 1UKTA 4ZQCA 1I8JA 4DV5F 3EDJA 4S3FA 4AXNA 1FD8A 2K8GA 1HNXF 2WJZA 5K8NA 3VGSA 4W8BA 2Z27A 3WL0A 1HQUB 5B0GA 4NL1A 3VIPA 3P80A 3D4JA 3DRPA 3T5LA 1OY8A 3DHXA 3ZSSA 2IQDA 2RIJA 3O16A 1JK9B 3C2OA 4B9SA 2ZUGA 5CG7A 2V9KA 4AD4A 2CHOA 3TE9A 3PYDA 1NK8A 3CHDA 1LOQA 2CETA 3LP1A 4KKOA 1UUQA 3MEDB 4ZVEA 4JTFA 1UZ4A 3SUVA 3DU0A 2GMHA 4Y28C 1PAEX 2Z6JA 3DXSX 2VD9A 3G6YA 1QTNB 4GC4A 2XHCA 1GVEA 3VMNA 1XDLA 4CUCA 4EPEC 4F2SA 3WD1A 2VD3A 1IXNA 1BVNP 1F9CA 2C14A 1FWKA 1UQYA 2P0IA 1YBTA 3R5DA 3C86A 1R8AA 1F07A 3DLHA 1QJHA 4JI5J 4BQ4A 2JIWA 5KG5A 4G7EA 2YYTA 1FD2A 2HW3A 5L6UA 3CWOX 1YSJA 1EYEA 4AZCB 5LYRA 4HLBA 1U1LA 3M5YA 4RZ6A 5KG0A 4MKBA 1XNQJ 3T4CA 5ETOA 3S7RA 2ZOFA 4MFDA 3CUIA 5MF5A 2ZH3A 1S77D 2AMCB 4AX6A 1V8EA 1VD6A 3DFHA 2IPFA 2EJAA 2IPWA 3TSDA 4UR8A 3S5ZA 3W88A 3R6GB 2HBYB 1TZ0A 5JQ9A 4FLRA 1B70B 3UJ2A 3BYRA 3W28A 5A6JA 2MEWA 3GPAA 4Z1BA 4LYKA 1TMJA 2XEXA 4L1GA 3Q8PB 4A2RA 3HHKA 5A6BA 5TIMA 3UVIA 4OHXA 1GQLA 3TUZC 1X5SA 2O66A 4XAKA 3JYTB 4ACZA 1PG5B 3QY8A 4W8AA 1TKXB 2CA9A 1EJTC 5J5RA 2D0GA 3H40A 3S1TA 3EZOA 1BWLA 3BW3A 1KTVA 4NG3A 5AHNA 1Q8AA 2AL2A 1MWOA 3CTLA 4O1EA 2AAMA 3EKGA 2F8QA 2G0IA 2JEIA 4FX6M 3NOEA 4U5KA 4K7QA 1UB3A 3FFIB 2I1OA 1EEPA 4C8OA 3GJRB 4P8WA 4IPJA 4H01A 5IT4A 2GGPA 4I4BA 1E6ZA 1GQIA 4JL1A 3FHAA 1J5SA 4A8MP 3B03A 2CXGA 1U4BA 5TNVA 4ER8A 1DWHM 3CZEA 2NX1A 1EARA 4CU8A 5CLTA 3G3MA 4DRSA 1AH0A 5REQB 4DL6A 3F2BA 2QGYA 3KOFA 3HJZA 3GQYA 3GDLA 1HWUA 3B8DA 4R3UA 4Z42C 1W56A 1J9YA 2H8XA 3W2WA 1AL7A 1Y5LB 2BMBA 1PHQA 3H2CA 2O9TA 1T03B 3MM9A 3MAQA 1WX0A 2UWFA 2AQWA 5KG4A 3PULA 2GJIA 3UD6A 1ZAWA 2PDXA 4I9JA 4P8UA 2CRLA 2ZBQA 2HHPA 3PR5B 3CB8A 4WFZA 4QW9A 3MUTP 1RCQA 4OZ1A 4WY0A 3TA9A 4DJED 1KCZA 4DG1B 4BQ2A 4UZSA 2DGWA 1AG1O 5HWMA 1S97A 1L3UA 2AX1A 3R8YA 4F3QA 2DNLA 4JY9A 3GR4A 3WQEA 3ELFA 2EBEA 4UNKA 2F8HA 4NI2B 1M3UA 5M3WA 4U6PA 1S3HA 2OZ8A 4RLIA 5B08A 4YN5A 2L41A 1XLMA 2WCGA 4UCFA 1TG7A 1FKOB 5XIAA 3NEHA 1LTDA 2G3FA 3QLLA 3WQGA 1MMDA 3IACA 3T07A 5CZVA 5D4YA 3EZ5A 4JV0A 4Q8UA 4MY8A 5JVLA 4O10A 1XMQF 2NQ5A 1FCAA 1WG1A 2OEMA 2MDAA 4D9PA 4HKPA 3M0YA 3EWXA 4DXVA 1AT1B 1CPUA 3OTOF 3JS3A 4RK8A 2XFWA 3S5YA 5D77A 4QQBA 1TMQA 5GJPA 3S9ZA 4G1NA 4PRRA 5BXRA 1HFBA 4LSLB 4R8UB 5L1LA 5BOFA 3UE2A 3QJPA 3ONQA 4JBCA 3GUWA 4G8TA 1F3WA 2X05A 3LO3A 3CCTA 1VQ9S 5D2TA 4MYUA 5FF3A 3SURA 5EWGA 3RUBL 3GTHA 3TJAA 4GHRA 1OYEA 4DSIA 3JSYA 2VGBA 3SUSA 4CQAA 1IM6A 4QPXA 1UMYA 3KJFB 2ZBRA 4LIRA 4DV5J 2ZZ4A 4NA1A 3NWRA 4YWSA 5A8RB 4AUKA 2FY1A 4XBJA 3SY5A 5G5IA 4IIHA 3MZ2A 1RHJB 1GHRA 2ACRA 1UJ6A 1S4FA 1TUXA 1VBJA 3KBWA 4MUPA 4XISA 2ZH2A 1IKXB 3BGAA 1Q4RA 1QHPA 4QIWD 1BG4A 3QY7A 1RTDA 3BF4A 4DDFA 1K4GA 4NZCA 1DV7A 3S6EA 5C7PA 4G3IA 1DTNA 2GGEA 3TR9A 4IP5A 5A8NA 1VF8A 3GNDA 4L75A 1U7LA 4H19A 3MUCA 2WHOA 5HMWA 1HNWF 2H51B 1U6BA 2D2JA 2R1NA 4ZQRA 3SBMA 3HQOA 2IXUA 2HIYA 3M8ZA 1G4PA 3G6ES 2WSCC 2CPJA 2XS2A 3T41A 5CABA 1O5RA 1R38A 3E74A 1H7OA 4Q7IA 2FLNA 3K5NA 2IA6A 4U33A 4PB3A 3LGNA 4XQ6A 1BLUA 1NJXA 3LV6A 3DX5A 3BBBA 2XZDB 2XIMA 4IUOA 4DV3F 1C3FA 2XGBA 2RJZA 1S0OA 2J24A 4MKNA 4PE8A 2HG4A 1WC3A 1N48A 5KFEA 1PCWA 1R8PA 4I6YA 7XIMA 5CBJA 3AIRA 5AXLA 3LQVA 1PJ9A 3MHUA 2BEFA 3BCDA 3ZZTA 1KR0A 9XIMA 4HZ7A 3V0TA 3CM4A 3ITXA 4GBUA 1BHNA 3CC2S 1RKJA 4CN4A 4I56A 1YDYA 5EHHA 1YJ9S 4XTDA 2ACUA 4NI8A 2G97A 4ED0A 2PGEA 4PMZA 3PDNA 5D0HA 3LRLA 3X3UA 1KTQA 3LLDA 1HO4A 4WDUA 2YJQA 3N6LA 2Y88A 4E2DA 2CQPA 4HNCA 4TR9A 4K2SA 2V5BA 4GYPA 2V3GA 2BDPA 4UZUA 1X8CA 1TJ0A 2RGLA 3SIMA 3CJ4A 3CCLS 3QRRA 4J5OA 1F76A 3QFWA 1FX4A 5HMSA 4CTAB 2H48B 3TSMA 3MAAA 3AS2A 3FBCA 2XGQA 4DR6J 5JH1A 4B91A 4AG0A 1FVSA 1BTMA 1X38A 1DIDA 3SUUA 1HUVA 5B7YA 1K73T 2LU1A 2MKHA 4FNIA 4PRFA 1IN0A 1C0TB 2POZA 2PDIA 4X3ZA 2HVEA 1YNPA 5E9AA 3NP5A 4RLEA 3TTEA 4DUYJ 1SJCA 3AZTA 1NDWA 3I4PA 3CJKB 5F8LA 4JHZA 3RCNA 3RTVA 2WCSA 3HKZD 2AQ4A 2Z0IA 4KHRA 4M8LA 3DN5A 1EOKA 3CZJA 1TK5A 2KI2A 5I3HA 5FDLB 3QGHA 3W1MA 4MPQA 3SW6A 1JLFA 4DPUA 3C2FA 3OQ2A 3T1YJ 5D0RA 3O7UA 3UJRA 1XIMA 3NM1A 5CCMA 4GKKJ 3KP1A 1RJQA 3A8JA 1NJIT 2PMWA 1CGTA 4U3CA 3IS9B 4CD7A 2JL9A 3KWSA 3NQ8A 3CUZA 2BG5A 5DM7Q 2G95A 2PODA 4WOZA 2X41A 1X4FA 3CL7A 2KN4A 2HYIB 1DJGA 5LA1A 4DR1F 1UWAA 2J62A 3NQVA 2Y0FA 1E6YA 4NUWA 2RVJA 2EPLX 4IG2B 4KSEB 2P8IA 5CPMA 1PDYA 3THUA 2H65B 2IQ0A 5K4XA 1VDHA 2OKTA 2W92A 4IIGA 2DIVA 3ARWA 3PZUA 2C3PA 4JQAA 3LB0A 1WHYA 2VFFA 2RDUA 2Z7GA 3F5KA 2HNHA 5E0KA 2EG1A 3V4MA 4JR5A 5L46A 1UA1A 3KOZA 2DYAA 2NLIA 2YZ5A 2YR1A 3DBPA 2E44A 3STFA 3NGSA 3GBEA 2YWHA 2AGTA 1I2OA 1EF2A 3MBDA 4NAEA 5FF0A 2K1RB 1T03A 4ZA0A 3PIOQ 4KRTA 1SC4B 3PTWA 1J8VA 3AMGA 2BM1A 4QIEA 1RD5A 4TYBA 1P0EA 3ME3A 3PEHA 1X8DA 1KTCA 1YITS 5HQLA 3W00A 2MUCA 5FF4A 1D7KA 1VHIA 2F6UA 4OYAA 1UETA 2YH0A 1V77A 5GJNA 3KJVB 3RO6A 3KRBA 3AALA 2YKOA 1RAKA 3CULA 2D24A 4AD1A 2JRSA 2UXDF 3EPIA 4B16A 3E3HA 2WW5A 3OBIA 4PMXA 4TIMA 2R1PA 5LXRA 3M5VA 3MEEA 4ZO6A 3NG3A 1Z4UA 1WDWA 4MDOA 2QDDA 1D8ZA 1QAIA 2V2VA 1JJ2R 3ILOA 3R25A 2A1BA 2UXCF 1F61A 3U7BA 2J0QD 1N54B 2Y1HA 1A3WA 4MYAA 1R2RA 4PXDA 4L6OA 1W91A 3GSIA 1XMQJ 1CJKB 3BJTA 1PXGA 3TO8A 3MHGA 1C91A 3WQOA 2QN6B 1JRBA 3BGLA 2CLPA 2OIHA 3SY8A 4XDDA 1QNRA 3F03K 1V5VA 3S2NA 4ZDNA 4O13A 2UUBF 2OLWA 1V6VA 2X1FA 5FJJA 4XIMA 1LKZA 2C19A 1TL7B 4UQDA 4X4RA 3H7RA 1S99A 1CG2A 4M51A 1QPKA 4PTVA 2GUUA 1XH0A 3ZVIA 1HJQA 4LBUA 4D6GA 1E0WA 1HVXA 1ZAIA 4JN7A 3TR2A 4OZ0A 2NVAA 2KTQA 2DH2A 1VK3A 1JLBB 3VVUA 1OB0A 3ZR5A 1M5WA 3I0RB 3MM7A 2IY5B 1ZAVA 4CT8A 2C8NA 1J2BA 2C3OA 3CAKA 4O44B 2WK2A 4XV0A 4W5UA 4CRJA 3GIYA 4JI2J 3CQJA 3HHDA 4JI7J 4H54A 4WSHA 4KE5A 2B6AB 4ILRA 2Z00A 4M82A 4PFHA 3QGAC 1ZM9A 1VQOS 3B8HA 4CNYA 1EGMA 3BW2A 2B7OA 2F2HA 4NYUA 5I4MA 2VNCA 4ZIWA 1IWPA 3K5XA 4OX6A 1RLDA 1MMFA 3T55A 3TVZA 4F25A 1W1TA 1VFHA 5KFXA 4E38A 3CJRA 3LSBA 1V93A 4HOZA 1K8CA 4Q45A 3PUOA 2FHOB 4DIAA 3I56S 4DPTA 4C6EA 2KU7A 5FEPA 1GWJA 2YQ1A 2YDQA 1FKAF 4QISA 5ENLA 2ZUAA 2W1BA 3WNOA 1SO3A 2Z1WA 3CYJA 5E3AA 4ZVUB 4YB5A 4J9SA 1OK4A 2P3EA 7FDRA 4MAKA 3LV5A 3VNYA 1W9XA 4B5UA 3RHGA 3QYSA 2X0YA 2LDIA 3T05A 5IV3A 3DZ1A 1RR2A 3C2EA 1IIHA 3QYYA 1EPXA 2YKPA 4PMYA 2XN0A 1L6GA 3M16A 1X5TA 2SFPA 4I2QB 3LPYA 4DPQA 1Z9AA 2YXXA 1HW9A 3D3AA 4GQBA 5E0FA 1T3OA 2YNGA 3TOQA 4BBYA 1XGEA 2MLXA 1FKPB 3AMLA 3UJEA 2Z6IA 3TQ0A 4QXIA 3JSMA 1LT7A 1TUFA 2PPGA 4DQWA 4J9UE 3T9NA 3PKYA 5M17A 2DIKA 8XIAA 2DHGA 3NGTA 2MKYA 4R53A 3NZPA 3Q8RB 1BXBA 3SQGA 2EG6A 4JD4A 4AXIA 3CT9A 3STGA 1EO7A 2XH0A 2YLAA 1NLKL 2C2ZB 3UR3C 3RJMB 2O56A 4UQTA 4OVXA 1K7XA 1E6SM 4KW2A 2FGBA 2VRKA 1IWGA 1RQHA 3F56A 2PEHA 2OP5A 1TTQA 1EFZA 3E12A 1EKOA 4IXHA 2V2QA 3OLBA 2KG0A 4UNLA 1R43A 3HHLB 4MNLA 3NGRA 4GYJA 2GJXA 4BQ5A 2JGQA 1BD0A 3NS7B 4WK1A 3W2VB 3AHZA 3QLDA 3DG6A 3M8PB 1MEWA 3G1SA 3URAA 2V34A 4ZCIA 4O12A 4USUA 4FNUA 4CCCA 2I57A 3QH2A 5IQ6A 5JIPA 4LPCA 4FBUA 4PG4A 1GYNA 3H55A 2CPZA 5A8OA 5KFFA 4K4SA 1RUSA 4KMQA 2AJQA 3ZJ7A 2XIJA 4H9TA 5DO8A 2CJKA 1O5JA 4FF4A 1ZTVA 2IMOA 2F3JA 2TRSA 3IRWP 2EQDA 4JCMA 4ETZA 4D6JA 2J7UA 1E72M 3V4IB 1OM0A 1W9VA 2X8RA 2ZADA 2ODOA 3K5PA 2VEGA 3CQ0A 1EHWA 3OJUA 1XGDA 1XIEA 2AOSA 2DZBA 3TI0A 4WQ6A 1VBUA 4N8NA 4IIDA 4X66J 4BQ3A 1NDCA 2WM1A 2C2KB 5FLXU 2O3DA 3VNIA 2CLOA 4AH7A 1TCDA 4UFIA 2MTLA 3VAKA 2MSTA 5AZ0A 1UEVA 3SSQA 3CMAS 1Z42A 1YVFA 3OXFA 5GMKa 3ZJKA 4L4LA 4OI0A 3DXBA 1XBZA 4F2TA 1NELA 4EBCA 1Q13A 1UWBB 3KUHA 3BQ5A 3L68A 3FVYA 1XIHA 3TWZA 4QWCA 3VDBA 5BYRA 2P2CB 3ZZOA 5KAKA 4EF8A 4DUZJ 1BF2A 3WQPA 3T1GA 1ONEA 1JXLA 3MMWA 4CH7A 2KFZA 4F4RA 4DBQA 5IM0A 1CI1A 3S2JA 1G94A 3PZMA 4LC8A 4GPNA 1E9YB 1DIOA 2GIRA 2XNQA 3SY1A 3R97A 2WZMA 3BQ1A 1E3XA 3HV9A 4AZHA 3GTNA 1CEZA 4Q4SA 4ICLA 1JR1A 3C16A 3HHNB 4F79A 4JI3F 3QYQA 4LIWA 4J9PA 2ZE0A 3TFCA 3BAIA 4JI8J 1WELA 3RB4A 1XD1A 3LA0A 1UWTA 3C0QA 1K7EA 4YMEA 2PF0A 7AT1B 3WMCA 2VG6B 1XIDA 4YS2A 2RNEA 2FPYA 3L09A 2EFQA 3MEGA 2GCFA 2ZTKA 1UVMA 1EJXC 2NWRA 3ITHB 1YDLA 1JJHA 1P6TA 5I3JA 2QYCA 4WJ8A 3W29A 5C9UA 4FB7A 4HU4A 2H54B 4JI0J 3TDFA 2WBGA 1OGGA 2BKOA 4MJZA 1BMQB 3W7HA 1HD0A 2HWGA 3MM8B 3DC0A 3U5YA 3ZM8A 4NX9A 3RK8A 2D2GA 2CZ5A 3LRKA 3LPOA 4HTJA 1YBAA 4TOQA 3B82A 1FP9A 1J27A 1R3SA 3T9ZA 2Y8UA 1MW3A 3V81B 1K0TA 1C8VA 3RLVA 1O51A 1TVRB 3QSIA 1YWXA 5IM51 2I56A 3SXLA 4WIWA 1WTFA 2Z30B 4O4RA 2O92A 1RDRA 3CB4A 1QK2A 5B09A 1WKDA 1XLAA 3A8IA 3LXCA 1GYLA 4IR1A 4AYBD 5CPNA 3ANUA 4UCGA 4BEUA 2V67A 1EQ0A 3IJ8A 4ZIVA 5IT0A 3TAMB 3UR7A 2WMKA 4GVHA 5EL1A 2AIRB 3LTPA 2G4FA 2QGHA 1UMLA 4D6IA 3T8LA 3WD0A 1TJRA 1TPH1 3CJ8A 4E98A 1J0IA 2BLEA 4JICA 5F3ZA 4IPPA 1VENA 3HQ1A 4X4QA 1SKRA 2HAIA 3SO7A 4G2DA 3ELHA 3DRSA 1VJZA 4OKDA 1Y0HA 1CLKA 1RWPB 3FDGA 3B8VA 1B9ZA 1OEPA 1TUVA 3FFIA 2PDFA 1CQNA 2CPFA 2GS8A 3M8QA 1IJEB 3FCVA 5H9EJ 4FZIA 3CGTA 2JK2A 3MMAB 1VFFA 2MQNA 1SIZA 4LAZA 5KETA 1CECA 2V68A 2WONB 4KCUA 1NMEB 2WVEA 1HHTP 1S1XB 4LY4A 5H9FK 3FNNA 4X0NA 2PN6A 3UZYA 1PKLA 5D33A 3LWMA 4AD6A 1V6TA 5AZ1A 2E1DA 3U2EA 1Y4ZB 4WSJA 3F73A 2DVXA 3QC3A 4AAJA 3UWVA 4ZQPA 3TLLA 3W7OA 3P0WA 3R27A 3QRHA 1D9AA 1NO8A 1I51B 2ZXDA 3VPLA 4EZ9A 2CCRA 1F4HA 3GIQA 2CIMA 1HFEL 5K9FA 5M5DA 3MM8A 4CEUC 3RLGA 5K20B 4ZQNA 4HYVA 1KB3A