4GRSA

Crystal structure of a chimeric dah7ps
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
333
structure length
333
Chain Sequence
b'MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVESVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDISAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospho-2-dehydro-3-deoxyheptonate aldolase, 2-dehydro-3-deo
publication title Engineering allosteric control to an unregulated enzyme by transfer of a regulatory domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 106
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18152 DAHP_snth_FXD DAHP synthase ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4grsA02
3.30.70.1140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phospho-2-dehydro-3-deoxyheptonate aldolase; domain 1 4grsA01
3NQAA 4Y8FA 3W7RA 4GUIA 2HSAA 3ZWSA 3LCHA 5KZMA 1NFBA 1QCWA 4NXKA 3PR2A 4K7YA 4M19A 5L6UA 1BWKA 1GT8A 2GUUA 2Z1BA 4RK8A 1LCOA 1A5SA 1G7VA 4MLJA 2X1SA 3W1AA 3ZFHA 5LHFA 2ZZ7A 3G0XA 4JTGA 1CX9A 1Z41A 4DQWA 1ICSA 2ATSA 1Q45A 3KOFA 4RZ4A 3DH7A 2YW3A 4JTHA 2QCHA 4WXZA 1TMHA 3PBUA 1H1YA 3ELFA 2Y7FA 1I8JA 2R94A 2YFOA 1ICQA 2WV8A 3HIJA 3UWQA 4H3DA 3GDMA 3W70A 3DI0A 2E5BA 3A5FA 4QIUA 3QW4B 4QJ1A 4YMZA 1WOAA 2YCEA 1KM4A 3WK0A 4O17A 1F2JA 2VOMA 3NO5A 1AW1A 1GWJA 3W2LA 1H7OA 3ABQA 4X3ZA 5G1TA 5AYYA 3TAKA 3MW7A 3ABRA 1KFKA 2NX9A 2VEMA 3S1VA 1Z44A 4HPXA 4H6KA 1VYSX 2FJKA 3OVQA 5D38A 1UUOA 2BSLA 5AOUA 3STFA 4K39A 5DLCA 3G1FA 3SECA 3N2XA 3NL2A 4HN4A 2Y7DA 3PULA 3O6CA 3SW6A 3NG3A 2QCGA 3L0KA 3DKLA 3L0GA 3Q37A 4UFJA 3LHZA 3L0NA 3KVLA 3M6YA 3WK3A 1VYPX 4A3UA 1PIIA 2C0AA 5I3JA 3EWXA 1B9BA 4G1KA 4MKNA 1X1ZA 4MVAA 3W1UA 2AGKA 3NYZA 4UNLA 2NWSA 1OX6A 1EP3A 4E0CA 4Y9AA 1HUVA 1JUKA 2NXIA 3RNDA 3EXSA 3W7CA 4JTIA 2JK2A 4NQ1A 1QFEA 3C0JA 4A21A 3EX3A 4JTUA 1SZEA 5G1YA 4MY9A 3B05A 3QMRA 3LV6A 1PCKA 3A24A 3N19B 4IMDA 4QM1A 3I68A 5AC7A 1VCVA 3F4WA 3A5VA 1M6JA 1GPWA 3S6DA 2ZZ3A 4JTEA 2QUVA 1IXPA 2QKFA 1H7PA 2ZRWA 5D2YA 2FPVA 4O1CA 2PRHA 5TQLA 1WA3A 2ISVA 1XXXA 5KZEA 1TPB1 3E02A 2YW4A 3JRKA 4JIPA 3QYQA 3HG5A 3O8AA 5D2TA 2XN2A 5KZDA 2RHGA 3W3OA 3TNOA 3NQDA 3BVJA 4O54A 4LVFA 3DXIA 1VH7A 4XZ9A 2ZBTA 2YFNA 2F7FA 3E0IA 3IGXA 3R12A 2XFWA 5TBOA 3G1AA 1G4TA 2QCCA 3W7OA 3VE9A 4FNPA 2NWRA 3HB9A 1NSJA 3W07A 1OFPA 1RQBA 3GNNA 2VFGA 1PS9A 3W7EA 2ZRYA 3GVGA 4UTWA 4IX2A 4YCOA 1TCDA 2WPBA 3BO9A 1KA9F 1ZCOA 3NL3A 2QJHA 2Y61A 5EL1A 2XN1A 1QNVA 3EWYA 1SU5A 4ALDA 4K38A 1AK5A 3GDKA 4O11A 4YCPA 1DBTA 3N73A 2ZA1A 3QW3A 3DHDA 4ML9A 1LROA 4FNTA 3NOEA 4XKYA 3RLUA 3ZR4A 2Y62A 2DJLA 2P1FA 4DBDA 4CNNA 4DO4A 2CLEA 4GC4A 1AMKA 3PF3A 5F2MA 3C52A 1MSSA 4GXMA 4P61A 4XBKA 3GZ3A 3RF9A 1SO4A 2RFGA 4LVDA 3E49A 1D3GA 4S1FA 3ABSA 3IGSA 4NX5A 5DCEA 5DXYA 3LHYA 4QITA 1K02A 5AB3A 4RXFA 2WSYA 4TU1A 3QJAA 1W5NA 2BTMA 4GWEA 3EWBX 3CHVA 3UWUA 2NUYA 5I3KA 3W7PA 5SWUA 3LCWA 2C16A 1IXOA 1F74A 1VZWA 3BW4A 6ALDA 1ZHAA 4O12A 3FJLA 4EOUA 3EX6A 3PG8A 3LHVA 1EEPA 4LRSA 4DELA 3R2GA 5KITA 3HGSA 2B7OA 2E6DA 4NJKA 1VHNA 3UPWA 3TW7A 4GUFA 3QPYA 2A85A 1SFLA 5DELA 4PODA 1D9EA 2NXGA 1JUEA 1XI3A 3P80A 4N9BA 4FX6M 1TRDA 1EP2A 3TA6A 1OF8A 5A8GA 1FCQA 1W5MA 2Q3OA 1IIHA 3H54A 2DZVA 1I2QA 5I3GA 1FWRA 3DHFA 3DAQA 1XDMA 3BK0A 3S9YA 4LWWA 1G4SA 4DF0A 3HF3A 4NJGA 1KLYA 1GOXA 4DF1A 1H7NA 8TIMA 5CPOA 3UXAA 3MYOA 3LXBA 1LTDA 3WJWA 4O15A 4LTSA 4Y96A 4N6EA 3VNDA 5LGXA 1WV2A 2W79A 1VGAA 5CG7A 3LXAA 1ZALA 3R8RA 4AH7A 1JCNA 1GVOA 3LRKA 2YSWA 3EWZA 5HNRA 4JYEA 2CLLA 1NVMA 2H90A 4JY9A 1SZFA 3P61A 3W1NA 1X6UA 2RDTA 1OYCA 1YYAA 3PG9A 3C6CA 5HUPA 4NVTA 2ZRVA 4O4VA 4O13A 2TRSA 1O4UA 1TTIA 3PUDA 1LZOA 1IGSA 3GKAA 4TMBA 3W23A 4JTLA 1JQVA 4JIQA 4L4MA 5HQEA 4IUOA 3DFQA 4O18A 1R46A 4GUGA 4AF0A 1KW1A 3HPSA 5EMUA 3BPWA 1Q6QA 3W1LA 4U28A 4KKXA 2G5WA 4FNQA 4Q4KA 1BKSA 3FFSA 1T8XA 1W0MA 1CW2A 3IIXA 4ZQMA 3U2OA 3TU9A 5AHIA 4MUZA 3TAOA 3NL6A 3P82A 3PBVA 5FEZA 3VCRA 2FDSA 3W76A 2DORA 4O1DA 1GG1A 2CU0A 4CQ8A 4O28A 3W1XA 1PHWA 2JKEA 4WX2A 3UWYA 4X2RA 5C55A 3CPRA 3TXVA 4HNTA 1JRCA 3UXDA 3TK7A 4MIMA 3TSMA 3L68A 4UNKA 2I1OA 1K8YA 5CPMA 5FF3A 3T55A 1DOSA 1OHLA 4AHOA 1L6SA 2YPIA 3HOJA 1XBZA 3QMTA 1NEYA 1YTDA 4MZ8A 2VEIA 1F7BA 1ONRA 4FO4A 4CCCA 2B4GA 3B03A 3GDTA 4JD4A 5AHLA 1ICPA 1OFDA 4LRTA 4BWLA 1GTHA 1G69A 5D02A 1K3UA 2J24A 2RKXA 2E5DA 3EWUA 3USBA 4TIMA 4UC5A 1A50A 3LI0A 1IXNA 3NZRA 3B0PA 1TSIA 1OF6A 4M6QA 2R14A 4YLWA 3N14A 1EUAA 3LB0A 1K7FA 4KFPA 2GQ8A 3SGUA 2WNZA 1JJKA 1DVJA 3OIXA 2CFFA 4A2SA 2ZQ0A 4MY8A 5HR7A 3W88A 3G1SA 2H8ZA 3C2VA 3C2OA 3PAJA 2B7NA 3UD6A 1VHCA 3BGJA 4N9EA 2V2DA 3M47A 2ZZ5A 1JRBA 1T96A 3T7VA 1KV8A 2B7PA 2FLIA 3W6YA 4FHAA 3DFNA 2ZTJA 5IBXA 1B3OA 3UY7A 5CZJA 1DHPA 4OWGA 1AW5A 5G4EA 1H63A 4K8HA 4RCXA 3CIWA 3QH2A 4JTJA 2HMCA 3BG3A 3ABOA 4I7WA 5F1UA 4JGDA 2W0UA 3TDFA 3TX9A 1H7WA 5FF2A 4MFEA 1TJRA 2QCDB 2OCZA 3S5ZA 5LHEA 4WY0F 4JYFA 3VFLA 3PC0A 1LBMA 3GR8A 4GFSA 2W6RA 1FWTA 4I7UA 4N9DA 3W74A 5FEXA 1EP1A 3TMQA 3NVTA 3W7GA 2FTPA 2BLEA 1OJXA 3NAVA 1X7FA 3NDOA 4M7TA 1N7KA 1RD5A 1WBJA 1PV8A 1TQXA 4Y90A 3LRLA 3F03K 2Z6JA 1GYLA 3EKLA 1DORA 3P62A 3M5XA 4BR1A 1LRQA 2TYSA 4RLIA 3STGA 1W5PA 2A1YA 4LNYA 1LOSA 4HNNA 1S5WA 3LBCA 2NXHA 1EWEA 1TPEA 1GQNA 4B5NA 1XUUA 4QQ3A 4GBUA 2C1HA 2ZYFA 5FF4A 1H7RA 2A0NA 2QAFA 5T26A 3SR7A 3NM1A 2Y7EA 2A21A 4NZFA 2ZDRA 3NPUA 2FPTA 2UV8G 4DXVA 2P0OA 3W1TA 3N2MA 5HINA 3LCXA 1T99A 4IXXA 4MY1A 3NPXA 2ZZ2A 1GYNA 2EF9A 2FPYA 3QSRA 1QO5A 3W2KA 1R47A 3D0CA 1FDYA 5CGQA 2PURA 3LLFA 4WY0B 4IMGA 1BWLA 5H2ZA 1W3TA 3G22A 2VKZG 4JTKA 1YPFA 3FEMA 3WJXA 1Z48A 5D32A 1J2WA 5D33A 1P5BA 1FX6A 5G4WA 4A29A 3CT7A 2QCDA 1PHQA 1VPXA 3W7DA 3AJXA 1P4CA 5HMSA 5BMWA 5G5IA 4ADUA 3KRSA 2VFHA 4IPIA 1OFBA 5AYXA 3HQ1A 4UMCA 1I4NA 5AN7A 3GXPA 3RU6A 3LTSA 4IGHA 4JX6A 3A23A 2E6AA 3W86A 3BG5A 3GYEA 4MPQA 3I6RA 4U4MA 4FEZA 1U5JA 3DENA 1ME9A 2OJPA 4Z1BA 3HMJG 3LTYA 2VELA 3I7SA 1WQ5A 3S8HA 1SSDA 1QDSA 3IIVA 2X1RA 3W7MA 2RH9A 3OEXA 1I2NA 1S3HA 1DL3A 2PC4A 2QCFA 1G6CA 2GVGA 1G7UA 1KM1A 1OABA 1VRDA 1W37A 3W71A 2WSQA 2BX7A 3IIPA 2EGZA 1KM2A 3IVTA 3PUEA 1LRTA 1ZNNA 5AFDA 1TPUA 4MJMA 1W3NA 4FIQA 4IOTA 3L21A 1A5BA 2E77A 2Y6ZA 5D2VA 4IX0A 5LNRA 3B8DA 3GIYA 3WJSA 1UCWA 5GVJA 4AHQA 3MUXA 1N55A 3G8RA 4NJJA 4NJIA 3QQ1A 4JDYA 2QR6A 3LERA 1JCJA 1QR7A 1XKYA 2A7RA 2V9DA 3MP5A 1NAL1 1AG1O 4FIRA 3FLUA 4X9SA 4PL1A 5K2ZA 4XBSA 5LNSA 3FKKA 4O0ZA 1YADA 1UB3A 1ALDA 4LV9A 3WJYA 5AC8A 2BWGA 1LP6A 4FNRA 3BLFA 4JICA 1L6WA 3M44A 4C1KA 5C2XA 4O53A 1UBSA 3PM6A 5IM51 5A5WA 3G3DA 1ZAJA 4UUIA 4RKAA 4OQVA 3L5LA 4TMCA 2NX1A 3WK2A 1JCMP 4R53A 4WXYA 1FXPA 1PVNA 2A7NA 3G3MA 1S5VA 1ADOA 4HSOA 3LCFA 1ZENA 3N9RA 1W1ZA 3CTLA 3LHWA 4UTLA 1VJIA 2Y70A 4Z1CA 3MHFA 1SW3A 3LCLA 1LM1A 2ISWA 3UNDA 3HPXA 3B0UX 1OX5A 1YXDA 3MO7A 5K9CA 5D05A 2QEZA 1SPQA 4DPQA 3O06A 4N4PA 4UTWC 3TJXA 3A22A 1AL7A 3DFPA 4HT3A 3SSJA 1EB3A 1KM6A 4UMBA 1THFD 4UTKA 4CCDA 3U8GA 2NV2A 1K7EA 3MJYA 4O14A 3M43A 5K9XA 3ZWTA 2JGYA 5LNVA 2QAPA 1SO3A 3IVUA 4JY8A 3KVJA 1K7XA 1ZAIA 4NT0A 1MZHA 3IVSA 4DBEA 1LORA 5CSSA 2B0MA 2TPSA 3W73A 3OHIA 3KAOA 4KFOA 1T0OA 2GJNA 2QJIA 2WKJA 5FI8A 3NPVA 2Q8LA 4JN6A 3NZ1A 2RDUA 3W83A 1FDZA 2V81A 3NNTA 3V75A 1H61A 2R8WA 1E51A 3BW2A 4O16A 3PSWA 4AAJA 1GVSA 2VEPA 4IMCA 3WFAA 3C2RA 4LS1A 5BOOA 1OYBA 2CZEA 1JCLA 1F6PA 3N9SA 3P8IA 3SIZA 3O07A 3DFTA 4ZVJA 2E6FA 1LRNA 1KTBA 1SUXA 2J9ZA 3C61A 4UFKA 3CLMA 2BXVA 1BEUA 4JTFA 5EY5A 2ISSA 3TQVA 1KFJA 2DJXA 3L2IA 1MO0A 3NA8A 4JYDA 3A9IA 4NUWA 1YDNA 2QUTA 4MYAA 4D2JA 1G67A 4HSNA 3L66A 3S1UA 1O94A 4K37A 4JNMA 4ZL1A 1R2SA 3QC3A 3B4UA 1I2PA 4DEFA 5CZSA 2P10A 1X8FA 4O1AA 2C6QA 1PE1A 3BG9A 4JX4A 1VC4A 1QOQA 5AHFA 1FY6A 4WUIA 2JBMA 2EPHA 3KRZA 3DU0A 3RFAA 1M5WA 3G0SA 4DO5A 4IMFA 2LLEA 2TMDA 3UWVA 3ANYA 4TR9A 1W8SA 3C3NA 1GG0A 1RZMA 3W84A 5FEPA 3O15A 3SFKA 3EX2A 3P74A 1GVQA 4WD0A 4QNWA 4RZ6A 4AXKA 2QCLA 5G2WA 3STCA 4BI5A 5E93A 2DZXA 1OFOA 3FIGA 4CLMA 3F4NA 3I7RA 3UY8A 4S2CA 2CW6A 4IMEA 1H51A 3W1MA 4UTTA 5CPNA 4ORIA 1RVGA 2CLKA 1OFQA 2Y63A 2X16A 2QCNA 4ONVA 3INPA 4UTJA 1OYAA 1KFLA 3NQ6A 5HR6A 1OVDA 1GVFA 5E1QA 4BI7A 4Q32A 1W3IA 4C1LA 4YWIA 4IQLA 5F2LA 2CLOA 3W7HA 5G2HA 3EX4A 1M7OA 3FYPA 1C9DA 3H55A 1RPXA 1TPWA 3W72A 4RXGA 1EPXA 4A2RA 3AO0A 2Y7GA 2BZNA 3IIOA 1KTCA 2HTMA 5LKYA 1H5YA 4UTMA 2ZA2A 2TSYA 4GNJA 1WXJA 3LV5A 3NPWA 4EIVA 2WQPA 4ZMGA 1QOPA 5G2IA 3HG4A 3IEBA 3W85A 4WJEA 2QDHA 3FA5A 4BK9A 3ZS4A 1MEWA 1B57A 1YLVA 2CZ5A 2PRMA 2DZTA 4UTHA 3KVKA 2O7SA 1YXCA 4JR5A 3LRMA 5CZ0A 4RX0A 2R91A 2C15A 1QO2A 2CWNA 5AYZA 1LDCA 5D37A 1WOBA 2H8XA 5K9DA 5LNWA 2QDGA 4UIOA 1F6KA 1OFEA 1A5CA 2QF7A 4ICNA 3HO8A 1JCYA 3T40A 3DZ1A 4UR8A 4JS3A 4QAIA 1TIMA 2J9YA 3TV8A 5DBTA 5LNUA 4HIBA 5EPDA 4BWLC 3P5YA 3LDVA 5DCDA 4LUJA 1G4EA 1U83A 5DCBA 1F76A 1RQHA 2NUWA 3BW3A 3TKFA 3IRDA 3GXNA 3M5ZA 1A5AA 3IV3A 2EKCA 3NQGA 1IIGA 3VKJA 2CZFA 2H3DA 4JDBA 5K4ZA 1QPRA 4MFDA 3QPZA 1SFJA 1FDJA 3KXQA 5KSWA 1KM3A 4KWWA 1OFRA 1KM0A 4AB4A 2J6XA 2J27A 3OBKA 1SSGA 3M5VA 5AHNA 4Q33A 1N8FA 1P0NA 2JKAA 2ZA3A 1Y0EA 4N6FA 2A6LA 3OA3A 5IBXC 1R30A 5FEWA 1UASA 3G1DA 4ZQPA 4Z08A 2A5HA 1VR6A 5I3IA 4LS2A 3I7QA 2WOQA 4J9JA 1TV5A 1HO4A 1QAPA 3NQ8A 3TSDA 5FF7A 3RK8A 3C2EA 4DF2A 2YX0A 4AVFA 3NEVA 1ZJIA 2ZTKA 2YGYA 5EKYA 3CEUA 1O5KA 4JTSA 3IGUA 4DO6A 1X1OA 1UUMA 2HS6A 1TPH1 2GVLA 4P2VA 3G1HA 1WDWA 1WYIA 5EA9A 3CEPA 1W31A 1SW7A 4N4QA 3EXTA 3W9ZA 2X30A 1KFEA 4I7VA 5HWMA 3TQKA 3S5YA 4RV8A 1NF7A 5D30A 2OT0A 5BW6A 4OE7A 1TQJA 2V2HA 4LVGA 3GXTA 1UJPA 4ZQCA 4Z0SA 1TB3A 3FJ6A 1G4PA 2H6RA 3FKRA 4O10A 1SW0A 3MP4A 2CLFA 5F4WA 2ZRUA 3SI9A 4X22A 3THQA 3MHGA 4CQ9A 1OG0A 4OV9A 3BLEA 2JKPA 2C18A 4NNBA 2JGQA 4YXGA 4O4WA 2QCEA 1FCVA 3L9CA 2FB3A 4AHPA 3TR2A 2Z2UA 1TO3A 4XUGA 1K8ZA 4DPPA 3QZEA 5EBUA 4CQAA 3L67A 4MZYA 4E2DA 5KMYA 2X1TA 2C14A 1TPFA 4OHQA 3OVPA 2EAWA 5U4NA 3BARA 1XDLA 2YXGA 3E12A 4ORMA 3HGOA 1GVRA 3YPIA 3NL5A 3P5ZA 3UWZA 1BTMA 2NUXA 3W2UA 4UTUA 2DP3A 3P7YA 3B0VC 4O57A 4ZZ9A 4OT7A 3GB6A 4LS0A 2Y88A 3TXZA 4N2YA 4PH6A 3UYCA 1CI1A 5LGZA 2V5BA 2C19A 4KFNA 1KM5A 1VYRA 1VLWA 1I2RA 2D73A 3B06A 1YPIA 3S1XA 1NF0A 1GEQA 1HL2A 3E9AA 3UZ5A 2YZRA 4FB7A 3TMLA 4OGZA 2YYTA 3QSTA 2ZZ4A 2G95A 2KZHA 1FXQA 5BMXA 1TREA 4PC8A 2WNQA 1XBYA 2ZFAA 2WNNA 3MP3A 4IJBA 1Q6OA 4UFMA 4FXRA 2I9EA 1SQ7A 3UQNA 1LBLA 5AC6A 2NV1A 1W5QA 3PWAA 1V7YA 3M16A 2CLMA 3GDLA 3W7LA 3GX9A 3STEA 3GAKA 1W5OA 4MYXA 4PL2A 2Z0IA 3EXRA 2DZSA 1HO1A 1EUNA 5DY3A 5D2XA 3T78A 3TH6A 2QUUA 1FUYA 1L6YA 2RDWA 4E38A 4HNVA 5CSRA 2OZ0A 4RR4A 1TPVA 4HNUA 1FCBA 3GNDA 3QRHA 3CQ0A 1VCFA 3TIMA 5K7JA 4LOCA 3S5NA 5E0KA 3PSVA 2V30A 2ATMA 3TSBA 3R13A 3NXFA 1F73A 1Z42A 1K03A 3O1NA 3QMSA 3PB0A 1H7XA 3PBWA 4O19A 1OK6A 3W1QA 3TW6A 4WY0A 4XKYB 3C4UA 5HULA 3UZJA 3HJZA 1VLIA 4LC6A 1O95A 3P8JA 1YTEA 3FS2A 3G18A 4K8EA 4IPJA 2Q3RA 3HGRA 1C29A 4LU0A 4FXSA 1FWSA 1I2OA 2Z6IA 2ALDA 4BI6A 2EHHA 1Q3NA 5F4XA 2YR1A 1XBXA 4POCA 4UFLA 3DGRA 4IXHA 4O52A 2ABBA 3LHTA 4PCFA 1LYXA 4WOZA 3U6WA 4Z1AA 4A22A 2WO5A 5HUOA 3W7NA 3S1WA 1QPQA 4AWUA 3JR2A 3C56A 3LBMA 3THAA 5ABTA 5C6MA 2VFFA 1DJNA 3TJLA 4OBTA 1MEIA 2PE4A 4CNPA 1D3HA 1F05A 1OFAA 2IQTA 3NGJA 3SJ3A 4GUHA 1EA0A 1SZGA 3PUOA 5KTLA 4ZQRA 3KVMA 4Y6GA 1XM3A 5L9FA 2AAMA 3LGEA 4AMAA 1KLZA 1JVNA 4HPJA 5D04C 3QEZA 4K7VA 2GJLA 2X2GA 1QPNA 1DKWA 3NQVA 1V5XA 4NX0A 5LSMA 2PRLA 1H50A 1W54A 3PBYA 4O1BA 5J5RA 3W75A 4RZ5A 5HJLA 3W2NA 3TQ0A 3EB2A 3W1RA 1C8VA 2VENA 1SO5A 3MBFA 4KWVA 1WX0A 3W87A 3GDRA 2A2IA 2OT1A 3G1VA 1J4EA 4HHPA 3I65A 1K8XA 4QISA 3GR7A 1AW2A 1TTQA 2FFCA 1XL9A 4LV4A 3LX9A 1DQXA 1B4KA 4O50A 3WK1A 2Y89A 5F2GA 5MHBA 5FESA 5D03A 1XC4A 4PTNA 3OVRA 5C54A 4PFMA 3NQEA 1KFCA 5U7SA 3DFSA 3Q58A 1PCWA 3FOKA 2CZDA 4BF9A 3MWAA 4AEOA 1P1XA 4OV4A 1L2UA 5AHMA 3M41A 2NLIA 3EKZA 1QMLA 1ME8A 3H53A 4LVAA 3VI2A 3GKFA 4UXDA 1SR9A 1TJPA 2GQAA 3G0UA 2E1DA 1FBAA 5CKSA 4UR7A 2A6NA 1A53A 1RR2A 2GQ9A 2VFIA 1VCGA 2F84A 5HWJA 4FNUA 2XN0A 3P60A 4GRSA 3EWWA 3MYPA 4NU7A 3SZ8A 1KFBA 4JTTA 5DN1A 1QPOA 3N34A 1P0KA 1GZGA 1MEHA 4O8RA 3MHUA 3RMJA 3T4CA 5HWNA 3MI3A 4QNEA 3DFOA 1TPC1 1HFBA 4LT9A 1I45A 4AF0B 3BLIA 2Y85A 4IWWA 2HS8A 1H1ZA 4UCGA 1PL9A 4UFIA 4EWND 3O05A 4M6VA 3MMTA 1SZNA 1KBJA 3IIZA 4W9TA 4E2BA 4Z0JA 3UWWA 1SO6A 3QM3A 2J9XA 5J5DA 3PB2A 2E5CA 3LM7A 4XQ6A 1LOLA 1OK4A 4UMAA 1R2TA 3DI1A 3O16A 3LCGA 2ZRZA 4N9CA 2DZWA 2C3ZA 4O0KA 3R89A 4WOQA 5BRBA 1TV8A 3M7WA 1AL8A 3LXCA 3NQ2A 3HG2A 3DBPA 3G24A 1F5ZA 3QQ0A 1ML1A 3NQCA 6TIMA 1GJPA 1HG3A 4QSHA 5D09A 1ZFJA 4NZJA 1R2RA 2FQIA 3Q2DA 3CU2A 1EIXA 2DZUA 4NNAA 2A4AA 2VFEA 1OX4B 1GTEA 1KV5A 4LY8A 4LUIA 1TTPA 2WJZA 2CLIA 3TE9A 1XBVA 3ATZA 5KINA 3S42A 1ME7A 3ATYA 4PEKA 4JXCA 1YDOA 2VXNA 4R34A 4UTTC 4CNOA 3L5MA 4K36A 4EVZA 3NR0A 2QCMA 5BNKA 3LI1A 3P81A 3SY5A 3O6DA 1ZY9A 3GK0A 4ADSA 1WAUA 4GJ1A 4HKPA 3W7QA 1FWNA 2GOUA 3CIXA 1YTKA 4MZ1A 3W7JA 4UTIA 5F2IA 3CB8A 4PA8A 3HG3A 3SGZA 2CLHA 3TUUA 3LTPA 4M7SA 1QWGA 3L5AA 4M5PA 3VE7A 3W22A 2FB2A 4BFAA 1TPDA 4TO8A 2E09A 3LLDA 4WQ6A 1J5TA 4XTIA 4TX9A 2E68A 4JEQA 3HPZA 3CWOX 4MJZA 3W7IA 4L4LA 3HGJA 1B4EA 3NM3A 2GVJA 5CPLA 1FWWA 2C13A 2OMAA 1H60A 4NXSA 1LOQA 4NNCA 1RV8A 1XUZA 4S2BA 3O63A 3F1QA 1XFBA 1TRIA 2V0TA 4YL2A 3QF0A 2O7QA 1ZAHA 4GUJA 1W56A 2YDAA 1VS1A 3JS3A 4LVBA 3N3MA 5TIMA 1JR1A 4LC8A 1EWDA 1Q6LA 1VQTA 1YXYA 4AWTA 3T44A 1LLWA 3DKJA 3K30A 5AHEA 1OX4A 3R5EA 3G1XA 3PY2A 5EYWA 4MOZA 4WZHA 3FYOA 4EF8A 3WJZA 4AWSA 2FIQA 5FF0A 3KRUA 3UPBA 3TROA 5DY2A 3HBLA 3PS7A 1EX5A 4N02A 5F4SA 3O6YX 3TC6A 3C8FA 3W1PA 2NZLA 3E96A 4RJEA 3M1ZA 1WBHA 1FCUA 5DBUA 3EX1A 4XWUA 3TFCA 1S5TA 2ABAA 2ZCGA 3OG3A 1DV7A 3KHJA 5K4XA 1MXSA 1TV7A 4NJHA 3CWNA 3MBDA 3M9YA 1O5XA 3LCIA 4GE8A 3NQ7A 2X1UA 3TCEA 1L9WA 3W2JA 1FQ0A 4ZQNA 3M0ZA 1DQWA 5I3HA 1TYGA 2A7PA 2QJGA 4JX5A 2Q8ZA 3S5OA 4K6AA 2YYUA 2GPTA 5C5YA 4M6PA 3W2MA 1LBFA 4FX8A 3P67A 3TC7A 2E6YA 4XTDA 4FF7A 2WSRA 1JULA 4CCEA 5I3FA 2ZRXA 1IF2A 3B04A 4ZQOA 4LW7A 3PVFA 7TIMA 1O60A 2VFDA 3BV4A 4FX7A 3S0CA 2G97A 2J88A 4R33A 1XCFA 1JQXA 3M5YA 3MI6A 3TFXA 1M7PA 1LLZA 1H62A 2B7QA 3G8EA 5D2WA 2ZZ1A 4H4IA 5K3VA 3A21A 1YDVA 2OX1A 2V2CA 4FNSA 1JUBA 1DJQA 3CM4A 1KBIA 2VEKA 3KX6A 5H91A 3GAYA 1TTJA 3NQFA 2H3BA 4I9AA 2V8ZA 2PCQA 3QFEA 2I14A 5DXXA 5LZLA 2V5LA 5F1VA 1KTNA 2VC6A 4UFHA 4EF9A 1IXQA 4MLRA 1JCXA 4R7JA 3L65A 4Z1DA 3KFTA 1Q6RA 1HTIA 2V82A 3C2FA 3P84A 4ADTA 3W7KA 3GLCA 3V1PA 3Q94A 3NQMA 3MI2A 3CC1A 1RQEA 3G1YA 2G96A 4OU1A 2DZPA 5CZTA 2DU2A 2AQWA 3RLVA 2ZZ6A 3BGGA 2NX3A 3LOTA 3EEGA 3LHUA
chains in the Genus database with same CATH superfamily
2P8IA 4O44B 2QIWA 1V0KA 4Y8FA 2GC8A 3W7RA 1KVIA 3HMCA 3M07A 3GXMA 4M8UA 3SDOA 3EPMA 3SQMA 3CMJA 2PDKA 3LCHA 1KTVA 1DWIM 1NFBA 4QQUA 1QCWA 2C2NA 5HXMA 1BWKA 3FSUA 4NI3A 3ZFHA 2X1SA 3H2FA 5LT5A 4AQYF 4F0HA 2CLPA 3NAHA 3IAM9 3WF0A 1JLFA 3PX4A 4IQXA 5DQHA 1TIWA 1UPMB 2Z26A 4WPAA 4IICA 6FDRA 3DH7A 3FMBA 2YW3A 2QF8A 1A3WA 1NO8A 4NILA 4FYXB 3WDRA 4G65A 2Q1LA 2AEMA 1QI5A 4RBTA 1Q79A 3CCUS 1Z3NA 1R0CB 4JBCA 1ICQA 2WV8A 4TU8A 3MPDA 3L4XA 3BSAA 1N6QB 4ZCKA 2IPWA 4TX8A 2E5BA 2FTWA 4G1QA 3QW4B 2ZDOA 3T5LA 3LH2S 1BXNA 1KM4A 3KBVA 4O17A 3WK0A 1F2JA 2VOMA 3OFGA 1E1FA 1WDSA 2LQ5A 1VEMA 5M2UA 1AW1A 1GWJA 4A35A 5DM7Q 3FRYA 4V19X 4WEVX 2MJNA 3ABQA 4X3ZA 5AYYA 2FC8A 3OODA 3TAKA 1SKUB 3PJ9A 4DV3J 4F4RA 2COLA 3FUYA 2VEMA 3JSMA 4WJBA 5D0RA 1Q8JA 1F60B 4IG0A 4L3NA 4LF4F 3FRZA 4HPXA 1ZJBA 4O3OA 1CT5A 3OVQA 2KN4A 3GC5A 5AOUA 3QSIA 1BQCA 2NREA 1E71M 4WCEQ 3G96A 2DRAA 2QMKA 3N2XA 3NL2A 4PMQA 1W9UA 2WRMA 3PULA 4EP8C 3UWEA 1HIYA 3TEHB 2BE7D 3EYZA 2OYMA 4OHYA 3UXKA 2E66A 4CRJA 3NKYA 2IXVA 2JEIA 3OFFA 3L0NA 4R5EA 4IFKB 1HWKA 2J0WA 3M6YA 2DSUA 3ISIX 5LJ3Y 1CLXA 2QEXS 4P7RA 1UP0A 1M1GA 3VZXA 2JRSA 3NSNA 4DY1A 5I3JA 5A2QY 1B9BA 1N2VA 2QSWA 2OKTA 2OFJA 3W1UA 1UPPA 4FN5A 1YIXA 3W63A 2HROA 3NYZA 3R4IA 3UFCX 3URAA 1X97A 5TNVA 2O0TA 1H2TZ 4E0CA 2NXIA 4AD6A 3W7CA 3GWCA 4IG3A 5LSRA 3WX4A 3EX3A 1RHKB 2VGIA 4IOAQ 1WHVA 5G1YA 2ZWZA 5EX3A 3B05A 2XMVA 3MSRA 3A24A 3D3FA 3K1GA 2EBGA 1FOBA 2J8GA 5AC7A 2ZEJA 1OGGA 1FWBC 4C7DA 3A5VA 3S6DA 5I24A 1MW7A 3O2IA 1IXPA 4I8DA 1QT1A 4D3GA 2MQNA 3W0KA 3J81j 4JAWA 3FSIA 4DO7A 3OFHA 7ODCA 2FPVA 2PRHA 5TQLA 4DR6F 1XXXA 4XIMA 2KXFA 1R85A 2XBPA 1TPB1 2JQXA 5KT4A 3E02A 2YW4A 5IHRA 1C2PA 3O8AA 2G0JA 5D2TA 3WLOA 4Q8WA 2OO6A 5KZDA 4LF9F 3HPFA 2HNZA 2QA4G 4KIAA 5HA7A 2XCPA 1VQ5S 4XZ9A 1DJXA 2YFNA 2F7FA 1J5OA 3UPFA 2HZVA 4CQBA 4DJFD 3S01A 1QHZA 1C4CA 5FSDC 3MC5A 2GMLA 4DLFA 5AC5A 1YDLA 1PS9A 3ET6B 2BACA 5T7LA 4OZ3A 2UVUA 1DHKA 1TCDA 3OTEA 4AEEA 5JUVA 4PBEA 3M6WA 2GVYA 1XYZA 5EL1A 2XN1A 1QNVA 1E0WA 4QIGA 2UXBJ 4HZ7A 2ZUTA 3WIVA 4O11A 3M1VA 1DBTA 4GQGA 2XG9A 3T9PA 2XMUA 2RDIA 3QHNA 1LROA 3ZSTA 3NOEA 5K20B 4N47A 2BJ3A 2CWXA 1UD4A 2CLEA 4GC4A 3PF3A 4OQJA 4D6HA 1VJWA 4PG5A 1MSSA 4P61A 4J1OA 3VKKA 2RFGA 5LA0A 4NYOA 4QWAA 3ABSA 2Y8KA 4GQQA 2CQIA 3W9IA 3VIPA 2E1AA 1NJWA 1K02A 2AJQA 1FWHC 5B0AA 1KLMB 3VC5A 3V1HA 2BTMA 5IC6B 2JSXA 3EWBX 4ZCWA 3RX2A 1HNZF 3UWUA 2XCAA 2EJ1A 3W7PA 1E1EA 1MXGA 3V0SA 5SWUA 5CPQA 1I6NA 2EFQA 2XTJP 3LCWA 1ISYA 1VZWA 2NXNA 1RK8A 4C0HA 2GDVA 3FJLA 3QGGA 1DTUA 3AFBA 4EOUA 2OPJA 1DZ5A 1Y7VA 4PEEA 1T7LA 4LRDA 1EJTC 2YWFA 3LHVA 1EEPA 4A8XA 1FH9A 4N5SA 3WUFA 3R2GA 3SN4A 2LP4A 3HGSA 4IUGA 3DBNA 4RL3A 1VHNA 3ULHA 1PTDA 5J1PA 5CPTA 2ZH4A 3WDHA 3QPYA 2D2JA 1T8EA 2MZ1A 1SFLA 4OFZA 4S3KA 1TKZA 3ZC4A 4DJDD 2UZ9A 3P80A 3WSUA 4N9BA 1CNVA 2GVDB 1E6PA 2WC4A 4MT1A 3T9NA 5I3UA 4XZBA 3KTCA 3TA6A 5A8GA 3NNAA 3O3RA 1ISZA 1IEQA 2QMXA 4DR5J 1NKBA 1W5MA 1G01A 1HNXF 3OTDA 3IR6B 5DO2A 3N2CA 4FDFA 1IV8A 1HW6A 1FWRA 1FXDA 5JVLA 3DHFA 1HF6A 2Z2AA 3SY1A 3DAQA 5JIPA 1LOUA 2A18A 2V9KA 3MFHA 3PO5A 1FJ7A 3PZTA 4HMEA 3S9YA 4C2MA 3SDEB 4MADA 5D4PA 3IR5B 1T7PA 2ZX9A 8TIMA 2JL9A 2WSEC 5A8OA 3AT1B 4JNZA 4AYGA 3UXAA 4F2TA 4K4WA 1LTDA 1MUMA 1OWXA 2Y2WA 1DIDA 4DYEA 4O15A 2BJEA 2WZIA 4HI2A 4N6EA 4ELTA 3BH7B 3VGHA 2PDGA 3VNDA 4A8IA 3MMCA 1NWSA 4O8AA 2ZH2A 2YLAA 3R3TA 1WV2A 1EOMA 5CG7A 4DL0C 2VA2A 4FXVA 2PEHA 4WK1A 4OOUA 1LFWA 3NGRA 3A8IA 1JCNA 5FL1A 3FCWA 1GVOA 3PTWA 4M95A 5HNRA 4WDTA 1N0UA 2NQZA 4N42A 2GSEA 2HVEA 1REQB 4NHVA 4O0QA 2V69A 4LF4J 2J4GA 4RW7A 3GZAA 2RDTA 3UFYA 3R43A 3TTEA 3GFZA 3GFXA 4USTA 2V8DA 2FZBA 4AVNA 1W9VA 2MZQA 4H8NA 1IQZA 5H9FJ 4Q8MA 2J6VA 2CYYA 4O13A 4GO9A 2V34A 2WVCA 3DFEA 4B5SA 2DIUA 5I42B 1LZOA 3TAMA 1P0BA 4YYCA 5CC5A 2W9AA 1V6XA 5FJOA 2D3UA 3MUVP 2JH3A 4RNHA 4R5PB 4JTLA 1JQVA 2GQ3A 1YG0A 4IUOA 1RWWB 2FVMA 2E5JA 4RDVA 4U3CA 1R46A 4GUGA 4AF0A 3CCWA 1K9TA 1TWSA 3BPWA 1PG5B 4WU3A 3N6JA 4XK8C 3JSYA 4FNQA 2EEYA 4Q4KA 1SQFA 2OODA 3QSYB 1L8NA 1NHUA 2AOSA 1T8XA 3T2OA 3QT6A 3MDWA 1W1IE 1CW2A 1LV5A 2Z2BA 2C3UA 1RWNB 2HURA 2XG8A 3FGVA 4MUZA 4DJBA 5JVHQ 5GQBA 3C0QA 6A3HA 2IQ0A 4O4RA 3KUHA 1Q6DA 4RU9A 4PKDB 2FDSA 5DG9A 3W76A 2VO5A 3MCSA 2OB3A 3PBGA 1MW0A 2WVBA 2J9DE 3OHAA 2E8ZA 3CL6A 3MMBA 4OOZA 1S6PB 3EMCA 5F8MA 1GNXA 1XIQA 3TXVA 4IP5A 3T1GA 4MIMA 4LXFA 2ZNZA 2I1OA 2V3GA 2NS1B 4O3RA 1BY9A 4Q43A 3T55A 3BMWA 4GYPA 1RHCA 4DPTA 1DXIA 1UJ5A 1EOKA 2KZZA 2YPIA 1M1HA 1UVNA 2N82B 4LF9J 1XBZA 4JHZA 2EPIA 3KTXA 1XLJA 1YTDA 3TA9A 1HQUA 2G4JA 1RY8A 3D68A 1LQAA 3G82B 1F2GA 1VBHA 1Q1KA 3L23A 3OBAA 1ZL1A 4DEZA 4CCCA 4XAGA 2C2OB 2VQEF 2VG7A 3I3DA 3ZOAA 1CXLA 1M5OC 3DOLA 4GI6A 1WEXA 1LL6A 1VS3A 1E40A 4ICCX 1CXKA 2VC1A 4NRUA 3WNMA 1JX4A 3DG6A 1K3UA 9XIMA 1E4IA 1WC6A 1F5CA 1UZ4A 5DX7A 1SJFA 3A3HA 1GORA 1J0KA 2PGEA 4HK6A 3T09A 1ZA1B 1XYMA 1IXNA 3RU0A 4HT7A 2ZKMX 3MR3A 1Q8KA 3CV6A 4S3AA 3LM3A 2CWKA 2R7QA 1TX2A 2W3ZA 3N14A 4KPCA 1DPMA 3UR7A 4LQ9A 3WDOA 3LB0A 3GR4A 1VBKA 1V6HA 4J9MA 3R94A 1IZJA 1DVJA 3OIXA 1MUWA 1KOHA 3T41A 5KFAA 5CSUA 4A2SA 4DX8H 2R2UA 5HR7A 3W88A 1SJBA 2QQ6A 1RPKA 2VZ9A 3AZRA 3C2OA 4F2SA 3K89A 1N0VC 1GQIA 3SB0A 2CPJA 1G6BA 1A5OC 4NLRA 3BAYA 4V15A 2ZZ5A 2H5JB 4CO5A 3MUMP 1J96A 3L4TA 1UWAA 1OB0A 4L1WA 2JIWA 1KV8A 2B7PA 1KR1A 2BKNA 4KRZA 1HNZJ 1K77A 3SCWA 3JQMA 1EX1A 3VZHA 1DJGA 1B3OA 3FBBA 3NZGA 3QMQA 1IQ8A 1A5UA 3WLPA 1SMAA 4DNHA 3QH2A 2HMCA 3RCMA 4IG2A 5ETLA 3OW2R 1SQGA 4JGDA 1HBMA 2RRAA 3S2MA 3TX9A 2YIHA 2DSZA 2FVLA 4I9TA 4UZSA 4MFEA 1TJRA 1IXKA 4PWUA 3DDNA 1A9NB 1VI7A 5LHEA 1W26A 5ABFA 4R7OA 4PQAA 2X42A 2LFVA 2RQ4A 4Q8NA 2DVIA 3M6DA 3EB3A 1S1VB 3IWNC 2XISA 1UR1A 1XLAA 1XR7A 3M9OB 3VVGA 3LN3A 2W6RA 3R11A 4I7UA 3W74A 5FEXA 1EP1A 5A2AA 3RCYA 5F3TA 2FTPA 1JIHA 4GVHA 1EIYB 3O9NA 1DE5A 3NAVA 4YTQA 3M2RB 4ZITA 2P76A 2AGQA 5BWAA 1HNXJ 1W2VA 1K1SA 3BJSA 1JB0C 3D6MB 2Z6JA 3PFEA 4BQ5A 3KK1A 1AFJA 3V3WA 5E33A 3EKLA 1ROFA 2J9DA 3ITXA 3M5XA 1X7VA 1LRQA 2RGMA 3WBZA 5KFVA 4QW9A 3STGA 4AZBA 2DHSA 1W5PA 4CLPA 3BQ5A 2A1YA 4LNYA 1LOSA 2W62A 1VQNS 2V3DA 1IM4A 1CECA 4DR2F 3GH7A 4B5NA 5KFCA 4IL2A 1YJNS 4UOCA 3GIQA 4KRUA 3D5HA 1RHUB 2J7WA 1DJIA 2ZYFA 5FF4A 1FWKA 2QAFA 4JI0F 3M32A 4HQVA 4FOJA 4NZFA 1VQ4S 3GD6A 3W2VA 2WMIB 1ZM9A 2UV8G 3PWGA 3N12A 3W1TA 2ZH1A 1NCLA 3N2MA 2E44A 2VHGA 4WSJA 1LW2B 2QS8A 6REQA 1GYNA 2EF9A 4HH1A 2ZVRA 1VFMA 1XCXA 2XWEA 1R47A 1N88A 4DLMA 3H2UB 2Y1RI 3FEQA 4C11B 4I2PA 1XERA 4IMGA 3MECA 2REQA 1I6JA 4DI6A 1BWLA 5PTDA 5ENLA 4DWSB 2VX7A 5H2ZA 1JLEB 1WHXA 2DNYA 2GZOA 3BGLA 4JTKA 4CYUA 1YPFA 4Z42C 4WIIA 2WZ1A 4M80A 4MKBA 4YR0A 1VC0A 2R7TA 1FX6A 1HWIA 5G4WA 3TOYA 1T0TV 2BGQA 3EJMA 3CT7A 2PS2A 4JI1J 1ZBTA 1P4CA 5KFXA 3W8PA 4TV5A 3AIRA 1R27B 2IDLA 1R9ZA 4U7UK 2VFHA 1KRMA 1AD4A 1RTJA 1VQLS 4IPIA 3BYPA 1NU5A 1OSDA 4H8UA 1M41A 3Q23A 1K9DA 1FD2A 2EC0A 2CADA 4CQ1A 4I6WA 4I5XA 3U1LA 4UMCA 3GXPA 3MA8A 5E3QA 3LTSA 1TUGB 4JX6A 3A23A 5KFYA 5HK4A 2XINA 1NH8A 4RW6B 3ICJA 3BJFA 1KCXA 1WXYA 3EGVA 3ZR5A 3BG5A 4CO0A 3M30A 5EMJA 3LUTA 3BSMA 3WELA 1DRZA 3WF1A 4JI4F 3HMJG 1J9YA 3LTYA 2VELA 3HT0A 3I7SA 1WQ5A 1ADSA 4Q4SA 5AE3A 3BCDA 5IZHA 1GAOA 4M63A 1P6CA 2VFSA 2IJRA 2Z1XA 4LFAF 4ER8A 2DEIA 3OEXA 1I2NA 3UG4A 3CCVS 2ZWYA 4CNUA 2D3NA 2U2FA 3EDEA 1VB9A 1ELOA 4HOZA 1B3ZA 1OABA 2BGSA 1JMTA 1RVKA 3IIPA 2WBRA 2Y5JA 2RKIA 4J7CA 5I0DA 1ONWA 1VPYA 3PUEA 2J77A 1LRTA 4D6DA 4NYYA 1TPUA 1JL8A 2VM8A 3KFWX 4GLEA 2BJ9A 4IOTA 3L21A 2DNHA 2VQEJ 2HGNA 2Y6ZA 5CG0A 2Q09A 3VNMA 4LBSA 1WF0A 2PTWA 4EX4A 3T1AA 5CYMA 5HANA 4TLRA 1N55A 4C6LA 3ZT6A 4NJJA 3MAQA 2EWHA 3NIYA 4QFUA 2DB1A 4UQAA 3HKWA 5A1AA 3SN1A 3RX4A 1W32A 2KXHA 4X9SA 3NCRA 1U2CA 3QJLA 1VPQA 1W1YA 1HQEA 2NLWA 2VBXA 1QVFR 4O0ZA 1NPPA 2QE5A 4NLQA 3HV9A 3OPKA 5M2RA 2OXNA 2DNZA 4DJFA 4LV9A 4GC7A 1DTTA 4HNCA 1MN9A 4EWJA 3NMAA 4KR0B 4P8UA 1EAYC 1TKXA 3TN6A 2BJ8A 4C1KA 4DXXA 5C2XA 4TVCA 3PM6A 1ECQA 2WK4A 3T6JA 3G3DA 4B92A 1VJSA 1RADB 2CKSA 5JH2A 4PCTA 4YHGA 2GQ2A 3FEZA 1QSYA 1ZBVA 4MGGA 3GTFA 4WXOA 4D9PA 3UP8A 1KWGA 3PEJA 4WGXA 3WQVA 2JC0A 3N9RA 1SFTA 1FDDA 3LHWA 3IS4A 4YOEA 1E73M 1VJIA 3FDGA 2NSCA 5A8KB 4DQSA 2ISWA 1EZZB 1TL3B 4YB1P 3FEXB 3UNDA 3CJKB 4H7VA 5HMFA 4NRTA 1AQMA 4YB5A 2BVDA 1OX5A 4C60A 3MO7A 1GKRA 4LPCA 2EFNA 4Q7AA 5K9CA 4XDDA 3VTIA 1NDCA 1EZWA 1RD6A 3O06A 4N4PA 5IDIA 1B3XA 1WWHA 3BS9A 3QHMA 2ILYA 4ZLLA 4O3QA 2G3NA 4XZLX 2HRUA 3DRRB 4C8NA 1K8AT 4HDGA 4HT3A 1KRPA 1RT2A 1KM6A 4U31A 1THFD 4UTKA 4B9ZA 1NDLA 2NQJA 1F9FA 3VGVA 3CAVA 2V5JA 3DXSX 4P2SA 1WNEA 3RRHA 2QJ3A 3IGHX 3ZWTA 4DR4F 2I5JA 3EPNA 3AWOA 1K0TA 4JY8A 1FEEA 3DDIA 1S2CA 3EAUA 2XC9A 3AQPA 3IVSA 1M1BA 1XKJA 4DBEA 2ZUWA 5CSSA 2WM0A 4F3HA 2E7WA 5KFBA 3K8MA 1N8RT 2AGPA 4OZ5A 1WP6A 1SUQA 3W73A 1PO9A 1E0UA 3OHIA 3KAOA 1UWQA 2A3EA 4IF2A 2BJ1A 4WDUA 4F8RA 2GJNA 2QJIA 2WKJA 4DJDA 3NPVA 2J0QD 4LBRA 3LGMA 3UN2A 3G6VA 2OR2A 1X9SA 1QI2A 3VX0A 1JQGA 2FGZA 2QMWA 4IMAA 4WLCA 4DR2J 2NZ4A 5C5JA 3WLMA 3EA1A 3V75A 3MAAA 3W66A 3FBFA 4J2MA 4WR3A 3UCQA 3MCNA 1OINA 4ZHRB 2A10A 3BL3A 1O1HA 4Y9NA 1GVSA 4AAJA 2FGCA 1CGTA 8AT1B 4IMCA 4LS1A 1IBKF 3IJ8A 2HNDA 2ALZA 4CD4A 1KEKA 1WZLA 2E7XA 1FWDC 3THTA 2PP1A 1JLGA 2J13A 1B90A 4GY1A 3DFTA 4ZVJA 2J66A 4F4XA 3IJLA 1SUXA 3IBWA 4ID5A 1X4FA 3CLMA 5F8IA 2W2NP 3PRDA 3H12A 4ZR8A 2OSXA 2XZTB 2BOAA 1PDYA 1GOIA 1MO0A 3NA8A 1T03A 2YA1A 2HEKA 3PHAA 4WIWA 2EFVA 4N76A 1XX1A 4HSNA 3LD5A 2BJDA 3L66A 3S1UA 4LJ3A 3M8YA 3I87A 1J01A 2OUGA 1SQEA 3I0RB 3RRKA 3O8WA 1EB0A 1FHTA 3V4MA 3HN3A 1O5RA 3WFZA 2YDSA 2QX0A 1R0AB 3CGTA 3Q65A 4KH1B 2GLKA 2WOMA 1C1CA 4IKAA 1SJDA 2ASLA 4O1AA 5J2NB 3OP2A 2CFXA 1V3HA 2I56A 4DR1F 4AIOA 3TYTA 4WUIA 3VM7A 5E3CA 2EPHA 1URNA 3PR5B 1M5WA 3DOKB 2XIQA 4IMFA 1J0YA 2BQ3A 1HNYA 1TTHB 4GO8A 4V33A 1NK5A 5DMNA 3WH7A 1KWKA 2XFYA 3C3NA 3SCKE 2XWYA 4QYZJ 3QRQA 1HJSA 1ITXA 2AKZA 1OJ4A 2BDQA 1ITQA 3SFKA 1TP7A 3P74A 1XN9A 2AZ3A 4CLKA 4C7FA 2D0HA 4PAAA 4JI4J 4AXKA 4OZOA 3Q2TC 3ZYZA 5AE1A 3MANA 2DR7A 1CEOA 1ITUA 3GXFA 4LRAA 2DZXA 3WY1A 2VQUA 2DO4A 3QWUA 4ZK7M 3FIGA 3DOMA 5KT7A 4CLMA 3F4NA 3I7RA 2ZZMA 3QLDA 2CQBA 3AHZA 4S2CA 1ODUA 1WSVA 3IUDA 2I5IA 1T9YA 2Y5EA 2HFVA 1S1WA 4Q44A 3UQSA 1ENUA 5L39A 2J7BA 4GC3A 3WQ8A 3BGFA 4ORIA 3WD0A 1VYAA 4ETXA 2VC9A 2Y63A 3G4SS 3LW5C 4I6AA 2QCNA 5E5CA 1RE1B 4NF7A 1CJTB 4UTJA 2PTXA 5BROA 4FP9A 2HMIB 1FA2A 3HXMA 1JXLA 2ATCB 2ZH6A 1WPCA 4LSLB 3OZOA 4WKFA 4UQCA 3ALFA 4OV6A 1BRLA 5HLFB 2U1AA 1O66A 1F8MA 1YE4A 3SADA 4Y34A 1TA3B 2KYZA 4NXNJ 1M7OA 2OX4A 1JF5A 4JI3J 1H2VZ 4CTAA 2OEKA 1TPWA 1XYAA 3GNRA 4TVAB 4A2RA 3K59A 2XSAA 1BQMA 3RRGA 1UKTA 3CCZA 2BZNA 1KTCA 2C1IA 1KKRA 3CASA 1J2BA 2RE1A 3R7SB 2UY4A 1EJRC 1W9XA 2VTFA 1FRLA 2W01A 1U25A 4MJKA 1OY9A 4GNJA 2FZCB 3M8PA 3NPWA 3D47A 3T4WA 4I6YA 4TQSA 3GCWP 2R7WA 2FPHX 4M0XA 1XH2A 4BCEA 4F3MA 2OGYA 5HMEA 3GU0A 5A8RB 3FA5A 2ZH5A 3KOYA 4BK9A 4GKKF 3E74A 2YKMB 1B57A 4UTHA 2ZH3A 3WDIA 3E2VA 2O7SA 3HVRA 1EO5A 4R27A 2IIHA 4ZLNA 2OWCA 3LRMA 1CJVB 4NZ3A 1YNQA 1KQYA 1K73T 2VA3A 2FKPA 3GU2A 3VZZA 1TFYA 4UR9A 1NU4A 2D23A 4YWSA 2J7HA 5AYZA 3GIMA 2DUZA 3OL8A 4JP8A 2KZMA 2FGLA 4A8NA 2QDGA 3W5YA 5KFOA 1IZKA 5GMKa 2M52A 3E0LA 1A5CA 2HDJA 2QF7A 1QAIA 2PC8A 2WBGA 4PCQA 1QE1A 1U26A 4E8CA 2QLXA 2ZJQQ 5XINA 3LP2A 3U7JA 2VVNA 1TIMA 3TV8A 4OVXA 3VAFA 2FJDB 2FJAB 2YBTA 4HIBA 2PWEA 2ZE3A 3P5YA 3LDVA 5DCDA 2FZGB 5ETOA 4DFKA 2BODX 5RUBA 1G4EA 4QZVB 5DCBA 3HHLC 1F76A 1IE7C 2V0NA 5C42B 4X4QA 2J78A 1AODA 4ZTYA 2AYEA 4B5UA 4G1NA 4PRRA 4RW9B 2RHQB 1AZSA 4FXDA 4QYRA 4V28A 2XFFA 3N4FA 1YJRA 1J11A 4US5D 4DR4J 3LBOA 3W6MA 1QPRA 3QPZA 4Y8EA 3CLWA 2ZD1A 3T05A 3M64A 1WSRA 1VRTB 3CIZA 2F8MA 1KM0A 4AB4A 4BLGA 2J27A 1I94F 3E1F1 5AHNA 5A6MA 1NOFA 1PILA 1HP4A 1Q8IA 4WP8A 5HBMB 4JNYA 1C7TA 1U45A 1IT7A 2OPPA 4H9XA 3CJTA 3JS9A 3ZLFA 1CQMA 3DRPB 5HROB 2O9RA 5IBXC 4K4SA 4H6EA 1UASA 3ITTA 4ZQPA 3GVVA 3KOWA 3E3XA 2EO7A 4BC7A 1VR6A 2RDJA 4K0KF 4Y0FA 1ZYQA 1E70M 4KQZA 3I7QA 2BRKA 1IBKJ 1YNYA 4TXSA 2J9CA 4E4PA 5KT3A 1RAAB 5D77A 3C2EA 4DF2A 3LQVA 1U8SA 5E0OA 3KBJA 2FYMA 1ZJIA 2ZTKA 4MB4A 5D4YA 3CMES 1O5KA 2ODOA 4JTSA 3ONCA 2HBVA 4ZODA 3IGUA 1L3UA 3P6YC 4ZO6A 4DO6A 3QYSA 1X1OA 3CAQA 1UVJA 4NZ6A 1UUMA 2M9KA 3VIOA 4USWA 3RMEA 1MWQA 1WDWA 1EJWC 2K7JA 4TY8A 1SW7A 1NQ6A 4N4QA 1DJYA 2F9RA 4P8XA 6XIMA 4HYVA 3W9ZA 3H42A 4F0RA 3TQKA 4RWWA 2W9BA 4E2FB 1QWKA 1NF7A 2FMNA 5BW6A 4NLXA 2GGPA 3CCTA 2GDUA 4C0OC 1UJPA 3RPDA 3M8QA 3MP4A 2EPNA 4HU8A 1NK9A 6XIAA 4DR1J 4CQ9A 3CCSS 2C18A 4NNBA 4NLGA 2VJXA 2JGQA 4YXGA 4ZE4A 2W4XA 4IIBA 2FB3A 3S2NA 1IKXA 2Z2UA 3BKFA 4XUGA 3CC7S 4L6V3 1T94A 1GX6A 1U1MA 4E2DA 2OH2A 1US2A 4MF4A 1TWWA 3TR5A 1R3WA 2MKHA 2H5IB 1EBGA 4DL3A 3DLKB 4A8LA 1XDLA 5IC4B 2OAUA 1MW2A 3YPIA 2DGVA 2NT1A 2X09A 3GG8A 1BTMA 3KHDA 1DTQA 3W2UA 1E6SM 2WVUA 4UTUA 4C3MA 1NTHA 3ARVA 2X1AA 2RAGA 2X41A 2CAJA 2WBKA 4HHJA 4URSA 4N8NA 3SIMA 1XICA 1KCKA 1ZTWA 5LM7E 3TVYA 4ZENA 1Y5VA 4ZPVR 3PTKA 5IT9U 3JQJA 4AVOA 2C19A 1NM9A 3R0UA 4QLKA 1S2UA 4NL1A 4LAUA 3AXMA 3F2BA 4JV2A 2X1IA 4AL5A 4EWTA 2ZIDA 1DP0A 1DIOA 5F41A 3Q8VA 4NE9C 1V02E 3H59A 4C4WA 3VOHA 1TG7A 4GGHA 2ZHOA 4KIEA 2FTYA 2DEJA 3AS1A 1ZQ5A 2IVMA 4NCBA 1WCGA 3QSTA 4OZ0A 4ALZA 2N7CA 3FCHA 1Q7LB 1SPBP 1A47A 1FXQA 5BMXA 3NGUA 4KERA 2UY5A 1M5KC 1EX8A 2GSHA 3RBEA 1KDNA 1XBYA 5HVFA 4Q8FA 1ZOTA 3BSOA 2EG2A 4FXRA 4LNCA 3SM0A 3US5A 2G9OA 4QJ4B 4ECYA 4I2QA 3GDLA 3VYLA 4CLZA 1W5OA 3U0HA 4JHOA 4PL2A 3SSZA 2VASA 4ROQA 5BXPA 4IM4A 1VQPS 1LWHA 5DY3A 1HGWA 3T78A 2KT5A 3KLFA 4PG6A 3ALGA 4WGHA 2N7YA 3V4BA 1J12A 4DJEC 2RDWA 4OJ1A 2VURA 2DGTA 1XEZA 2DHGA 2YJQA 2QLFB 2RJHA 4LB3A 1AUSL 1SH3A 2OZ0A 2VB6A 1TPVA 2PBOA 4AZHA 1FCBA 3BLPX 3GNDA 4HNUA 3NOYA 3S1TA 4DL5A 3QRHA 1MNSA 4JEJA 1UZHA 4N41A 4M5LA 3S5NA 4I9JA 4ZCMA 3MM9B 4OYXA 2NQPA 3W2WB 3PSVA 4K68A 2HISA 2RAQA 3UVAA 1U2YA 3QY7A 2VQFF 4AXNA 3KCJA 2DK2A 4C3LA 1K03A 2WKGA 3O1NA 2IMWP 1J0ZA 2MHNA 3HQOA 2VX5A 2CPXA 1H7XA 1XLMA 1OK6A 1V3LA 1VQYA 1HNVB 1ZS2A 3W1QA 4WY0A 5HULA 4A3RA 1YJTA 3MM5B 3E2RA 4PB3A 2D7SA 3DM2B 1HQTA 1W2PA 3MSYA 5KG5A 1KOOA 1O95A 3P8JA 2BOPA 1B0IA 1AFIA 1CJKB 2G4FA 4X2PA 3NNHA 1TZ7A 2WVDA 3WZ0E 3IJ7A 3NO3A 3MEGA 1C29A 3OO2A 3TQEA 1VLYA 4PTVA 2X1BA 3HV8A 1OPZA 1J0HA 3IRXA 5I77A 4W93A 4XISA 2EHHA 5F4XA 1FHVA 4POCA 3LYEA 4UFLA 1ICEB 4IXHA 3GU1A 4P7QA 2CERA 4QEEA 3KUMA 2JZ5A 4URIA 3U3HA 1LYXA 4WOZA 2VD3A 1VRUB 2ADBA 2R4FA 4Z1AA 3WH5A 1S76D 2DIVA 1K4HA 4AWUA 4QRNA 5BOEA 3JR2A 2DGAA 2ZUVA 4HJFA 3VOFA 3C56A 1I94J 4I64A 2JEPA 2J47A 2VOTA 4ZB5A 4OBTA 1JZ4A 2RS8A 3DNCA 2ZNYA 4MB3A 1F05A 1EA0A 2IQTA 2DJWA 1X6LA 3PPFA 1X9WA 2BS9A 3PUOA 4LGXA 2C3YA 4EBCA 2LEBA 4ZQRA 3WIJA 4Y6GA 1RWVB 5AXLA 1Z7AA 4L1GA 2AAMA 3K8LA 3ZO7A 4X0NA 3CJ4A 3QEZA 3N6QA 2XSXA 1OCNA 2FJWA 2XS2A 2ASHA 2X2GA 2WCAA 5CJ5A 3KOAA 2WAGA 1DKWA 1KN6A 1XSKA 3SCJE 3TOPA 2HEJA 5J5RA 2JWNA 3W75A 2IM3A 4PN2A 3VFCA 3NXLA 4K4ZA 3P2VA 4RZ5A 4Q8UA 5HJLA 1QD1A 4KEVA 1VFSA 3RB4A 3G87A 1EEXA 4N7TA 5MF5A 5CGMA 3D1QA 1C8VA 3W7BA 1YKWA 1SZRA 1IBLF 3QFHA 5GMDA 2JEGA 2RDXA 2IPOB 3EDFA 2A2IA 3BJYA 4FNIA 1J4EA 3OZMA 3DI6A 3NGKA 1NWRA 4F26A 1JLCB 1KGXA 3GR7A 3AYVA 2BHZA 1TTQA 2FFCA 3UA3A 1DQXA 1TV6B 2CRLA 4B9SA 4ZS6A 2ZH8A 2QV5A 1IKVB 1SI9A 4PR4A 1B4KA 4O50A 1PGZA 2VKRA 5F2GA 4BBYA 4LVOP 1GQLA 1C90A 5FESA 5D03A 4PTNA 2IDEA 4Q0BA 3GR1A 3WH9A 2X7WA 4ZO7A 2OZ3A 2R1NA 3H20A 4DOZA 1ISXA 2EKNA 3H2EA 1UOKA 2CZDA 4M5DA 3B9OA 1VLOA 3MWAA 2MGZB 4GX8A 1XLIA 5DMLA 1GOOA 1EGVA 1UCNA 4OV4A 2R2RA 2KFZA 2NLIA 3H53A 3BAIA 4LVAA 3V6HA 3GKFA 4UXDA 3V36A 1HWLA 2B9XA 4Z37A 2HVNA 5HDRA 2GQAA 3FHAA 3WQPA 4RW3A 2QFIA 4LH8A 2J25A 2E1DA 5CKSA 4UR7A 4BHYA 2VFIA 3SV4A 6AT1B 4J9LA 2R9RA 1XDJA 4FNUA 3MYPA 4B9TA 4MFBB 3N6HA 1S1TB 4JTTA 4OX9F 1YBUA 2BE2A 1GZGA 2E7VA 3RMJA 4I7FB 4AZCA 4DBUA 1F1BB 3DFOA 4LT9A 3VINA 4H9VA 1I45A 4NY2A 4IPPA 3R8GA 1TQLA 1EJUC 5C0QA 1BQNA 4FOUA 1E6RA 1VC6A 1HKMA 3N6NA 1UFKA 1H1ZA 1PTGA 4EWND 1YZ7A 4KCWA 4M6VA 3MMTA 2AEFA 4GQ0A 3O5TB 1KBJA 3M2UB 4E2BA 4WXWA 5HVGA 3VC6A 3MEEA 2QPXA 5BXSA 5ECVA 4MWAC 4UQBA 2H4YB 4RW5A 3LM7A 4XQ6A 1N5VA 1LOLA 1TR0A 4UMAA 1RDRA 1R2TA 1E6YA 3CGIA 3VAGA 4F0LA 4DWDA 2B6AB 3PW2A 3SXLA 5FLXU 3FW6A 4W8AA 4GVBA 2ZKUA 4Q8OA 3H5YA 1QI0A 3R6GB 2C3ZA 3VAMA 4XVEA 1C0TB 1GQKA 3TYZA 2C7FA 2ZC1A 1TV8A 3M7WA 4KMQA 2ZBQA 2BMBA 3LXCA 2VL4A 5K9FA 4NZ7A 1J0IA 3XINA 4B3LA 3MM8A 3UNGC 3RG6A 3EDRB 3PY8A 3QQ0A 1V5VA 3N01A 3DMJA 1GJPA 1HG3A 4H6QA 3Q2DA 1OADA 2WZEA 2PDHA 4NNAA 2C2ZB 2DNPA 2A4AA 3AFGA 2DITA 4C90A 1OX4B 4PABA 2GGJA 4LY8A 2WJZA 1XBVA 1TX0A 4RDWA 5KINA 4IQDA 3S6TA 2JVRA 2YNIB 2I0XA 3OV7A 4MWAD 2LQ8A 3OQ8A 2PLCA 3WEMA 3GYNA 1CBGA 1WG4A 3LF0A 4DN0A 4HMDA 1XYBA 1HBUA 2C2KB 1YDOA 2VXNA 2WVVA 3E6EA 2YL9A 4CNOA 4K36A 4EVZA 4W7VA 2VC7A 3Q8UA 1IKWA 1XRSA 3B4MA 2QCMA 5BNKA 3JTNA 4WZQA 2DZBA 3N1AA 3J81Y 4CI0B 1O7AA 3O6DA 1IHIA 1ZY9A 3DERA 4GI8A 3THUA 2CIMA 4X65J 1WAUA 4ZVSB 3CIVA 4KW2A 5AJ3J 1FWNA 2GOUA 3A8KA 1YTKA 3W7JA 4PG4A 5F2IA 1FE0A 4O3NA 4PA8A 3OSNA 1D9DA 4LFYA 3LTPA 2HSEB 3F7JA 4OBSA 4Y65A 1WORA 3FXGA 5J2QB 2NSXA 2UVWA 2YX7A 2WSPA 4TO8A 3M8ZA 1T3NA 3JSBA 4WQ6A 1CQNA 4HCLA 2YNGB 2A0FB 2XSJA 3MKKA 4Y2MA 3M4HA 4ES2A 4R0EA 2UBPC 3K46A 5ETSA 4RDYA 1JI1A 2CQ1A 1V6WA 4JB8B 4F9DA 2VP8A 5B0EA 2V5KA 3A4WA 1P7TB 4LUYA 2C13A 2HWGA 1N8IA 1RP8A 1FESA 1OS5A 4G7FA 1LWCA 4Z2GA 3TUIC 3O63A 4LYKA 3F1QA 4YS2A 3PDNA 1TRIA 1WB0A 2VIHA 5E0FA 3BDKA 4US5A 2V0TA 4JTDA 5KFZA 1SJAA 3QF0A 3H4DA 2O7QA 4GUJA 1NDZA 3IK2A 3SUTA 2H54B 3QQWA 2WW5A 1W56A 4DSEA 2YDAA 1VS1A 4HZMA 2VJUA 2D2OA 3M6XA 2FJEB 3R7BB 4OV1A 1OY0A 3N3MA 1TL5A 1T9WA 3EICA 3ZM8A 1CXEA 4ZVEA 1GXUA 2J9EA 4RW4B 4IH3A 4EU0A 2MJUA 1AFSA 1LLWA 1NK6A 4LUSA 5AHEA 2YQ0A 1TL1A 2B43A 2AAAA 1RLCL 4WZHA 5LIYX 3WJZA 2OQYA 5EX0A 5BR8F 4ZOCA 4LBHA 3CZKA 3RAXA 4P2FA 1IBLJ 3UPBA 3PS7A 5D0HA 1EX5A 4N02A 3TZNA 4XB3A 4PMZA 4LCRA 1D8CA 2EPOA 2I57A 2PF0A 3SFWA 2IYGA 3K1DA 3W1PA 2FUG9 2IPJA 3E96A 2QPSA 3M1ZA 2ZE2A 3DGPA 4PMVA 3TFCA 4E5TA 4B3OB 3PWIA 3VDBA 5AXNA 1XMOJ 2GX8A 2ZCGA 4NAFB 2ZX8A 5EFDA 4YQWA 3OG3A 2LVWA 1O12A 1FVPA 1DV7A 2BGNE 3QZ6A 4FBUA 1MXSA 4L9YA 2MSSA 3MBDA 2UVVA 2RQCA 4D8AA 4QIEA 5CYQA 4GE8A 1B70B 4DHVA 3TCEA 1UWUA 2LQJA 1R89A 3M0ZA 5A6KA 1Y9OA 2DNKA 4J3UA 5E5NA 1TVNA 2IA0A 4X63A 1NK8A 3KDOA 5HMZA 5I03A 4LUTA 1ZRQA 1LL7A 1XIBA 1NXIA 3GUGA 3K7RA 3KK2A 3EPGA 5C5YA 3D5MA 4H19A 2QIFA 3BICA 3SFGA 4P7OA 1Z4UA 3EPOA 4FX8A 3P67A 5C9ZA 2RUSA 2W7AA 3E01A 2VZTA 5C2GA 3DU5A 2DUAA 4L4OA 1FXLA 4FF7A 1JULA 2WPGA 5I3FA 2XWXA 3FMWA 4OX9J 1JLFB 3POTA 1NK4A 2VG5A 1EP4B 1YVFA 3WDQA 3ZTOA 3KJVA 1X0FA 1O60A 3BV4A 3APYA 2G97A 5I4MA 3J80U 2J88A 2WYSA 4KAIA 4DR3F 1N5YB 1AH3A 1M7PA 5IT0A 2BEFA 4PCPA 2B7QA 1H62A 2Z2ZA 3WX8A 4B5TA 5D2WA 4IRDA 2VZOA 3H6OA 5CD4A 5K3VA 2IM2A 2LXUA 5BXIA 3GE7A 3M0MA 2XU2A 4YFUA 4GJJA 3CCJS 1T9UA 4G1QB 2D3OR 2FTRA 5H91A 3DHUA 2EW9A 3NQBA 1TTJA 4I9AA 4WF9Q 2V8ZA 4HNLA 1TCMA 2PCQA 3CJQA 4ASTA 2CXGA 4D1IA 1RJRA 2V5LA 1YGYA 1YTYA 1XLLA 1GQJA 2WW8A 4RUHA 2GVEA 4LAOA 3TVKA 5CA5A 2VEFA 1SGJA 2VC6A 4UFHA 4HTBA 2P88A 2G2OA 2HWIA 3L65A 2AJ2A 5CJNA 5FJRA 1WELA 5DRCA 4ADTA 2E1WA 1HYSA 4ZOAA 3ZJ7A 3CAKA 2XDFA 3RN6A 2YB4A 4HU0A 2X2YA 3NQMA 4J3XA 3VVTA 5BYQA 3G6LA 2PI6A 3G1YA 5IWAJ 3MWCA 2XSBA 3L12A 2DU2A 2AQWA 5F8GA 3JAMY 4OZ1A 1Z2LA 3HK2A 3J7YI 2ZZ6A 4C5ZA 4D1JA 2YA2A 4KCVA 4L64A 3LOTA 3EEGA 1R3VA 3MHYA 3WL1A 4F0MA 2YXXA 3ZVHB 3QQCD 1JDCA 1WC5A 3RRAA 3ZZ1A 2PC6A 1VFUA 1ZAWA 4GUIA 2HSAA 3SQGB 2FDNA 2QHAA 1H74A 3IS9A 2Q02A 5KZMA 2LQ9A 4NZ5A 4NXKA 4IG3B 5L6UA 4GACA 3F0NA 1T3OA 2GUUA 4RK8A 5A6JA 1A5SA 3GVWA 3W1AA 5LHFA 3DLHA 4DB7A 2WJEA 4QQBA 3LQGA 2ZZ7A 2XZWA 4YHHJ 4JTGA 1CX9A 2ATSA 3WNLA 4DZ6A 2AJFE 4RZ4A 3IO1A 4B5WA 1R8BA 3CYJA 1GVIA 1NWTA 4H9MA 4GH1A 5BXTA 4S0MA 1ELSA 1V0LA 4B9NA 3EGJA 3KHRA 3KMSA 5BJRA 1DWGM 4WXZA 2YQ1A 3DLBA 1S3TC 4PB4A 2HVIA 3G6XA 1H1YA 2GJXA 1I8JA 2Y7FA 3MKVA 2O56A 2BW7A 2ERRA 5ECUA 3LK6A 5KT5A 3D6HB 3W02A 2OVLA 4H3DA 1X4HA 3GDMA 3OXFA 4EZ6A 2UXDJ 3W70A 3BOLA 2XM3A 4G7EA 4CGTA 4CD8A 4QJ1A 5AZ1A 1UWIA 4K2SA 4OHZA 1NHKL 3FN9A 4FK9A 4IPNB 3VCNA 3VMOA 3KBMA 3EKGA 2HYIB 1LXNA 2WB4A 2YKNB 4YNGA 1TJ0A 3BH6B 3MW7A 4L80A 3E0FA 3JZEA 2NX9A 3A3OB 1KNZA 3S1VA 5B0BA 2XLIA 1V93A 1Z44A 2GJIA 4UQEA 2NUHA 2FJKA 1HR0F 1E4MM 3GJQB 3CH9A 1HI0P 2UUAF 2OPRB 5T7LB 3FC9A 1YE6A 1HVXA 3CV7A 3G1FA 3W8GA 4S3BA 4ZKAA 1UKQA 2MKJA 4REQA 4HGXA 3U2CA 4C6IA 3M1VB 3DKLA 3CZJA 3DLGB 3J81U 1HI8A 5L9NA 2WCSA 2AMXA 3ERPA 1MRQA 3Q37A 1NBEB 2NZCA 4GA8A 2YDQA 1V0MA 3VR1A 5I78A 3Q0AA 1EKSA 2F3JA 3TZYA 3WK3A 3NOCA 5ETTA 2XGPA 1ZP3A 4JBRA 3LP0A 2C2DA 2C0AA 3AXKA 3EUNA 3R79A 4G1KA 1UH4A 4U7UD 1L6GA 1X1ZA 2R24A 4M5JA 4USHA 4NA2A 5BR8J 4UNLA 2NWSA 4X4PA 3TZXA 3VAIA 1F3FA 1TUFA 3TN5A 5ETQA 3SI8A 4B4HA 5KFMA 3RO6A 4GI4A 2JK2A 4X64F 3AROA 2Z2MA 1Y5LB 1IKYA 4E6MA 3TJ9A 3CL8A 1H72C 4JTUA 2NSOA 5G0RA 3OTBA 2RD5C 2A79A 4LY4A 4C9DA 2HFUA 2HZGA 2GWGA 3K8VA 2WHLA 3PANA 2RT3A 3DECA 4C5YA 4IMDA 4QM1A 3S6OA 3R5BA 3QV7A 3SEOA 4XAPA 3I68A 3M0LA 2JVOA 4OI3A 1VCVA 3KLEA 3HTWA 3L7RA 4YHEA 1VMBA 3HM7A 2ZZ3A 3U2ZA 1D2KA 5CLTA 2PD5A 3O44A 4MWAE 2O4MA 2PFHA 5HVHA 1QNOA 5D2YA 4FALA 4QWBA 4O1CA 4C91A 1WA3A 5KZEA 4A6GA 2R3VA 1O8BA 3N4WA 3JRKA 1IWAA 3W61A 1M3UA 3ECQA 2XN2A 4USKA 2QUNA 3KP0A 2HK0A 3TN4A 3PV8A 4LVFA 2QL7B 3DXIA 3RXZA 4BQ2A 1VH7A 5FKYA 3Q83A 2IJNA 3CTTA 3PFMA 1EF2A 1LL4A 3UR8A 5TBOA 3BGRB 3W7OA 1PUDA 3VE9A 2WSCC 2NWRA 4DG1A 1J5EF 4NI2A 3G2XA 3W07A 2X7VA 3SCPA 2VFGA 3KE0A 1WXZA 3TZZA 1WUEA 4EUVA 3LENA 3W65A 4OZNA 4ED1A 4UTWA 4IX2A 5CD4H 1RYRA 1KA9F 2G2YA 4AZ7A 2QJHA 1XISA 3JTOA 2Y61A 5TAOA 3CJPA 3V18A 4ALDA 1AK5A 3GDKA 1KQGB 3PR4A 3A3WA 3N73A 2ZA1A 3QW3A 3AD8C 3UD4P 4JIRA 3TYEA 3K5OA 4LRBA 4ES1A 2O9OA 4FNTA 1I1WA 4IGNA 5FDLA 1I5OB 4DS5A 4I67A 2Y62A 4DBDA 2IKJA 2P1FA 1PB0A 4O1EA 1UQYA 2CJBA 2INFA 4AC7C 1AMKA 5JXQA 3MMCB 3GZ3A 2ZUGA 3BQ6A 3VKAA 4UZUA 1SO4A 3V6KA 2DT3A 1D3GA 4S1FA 1CG2A 3IGSA 4X9YA 5E41A 3LHYA 3SCRA 2N4CA 4BCAA 3GTIA 2P9EA 2Z57B 1VGYA 3CHVA 1S1PA 2CZVC 4L75A 4W89A 3RB0A 1C3FA 2C16A 5GNYA 4B3SF 1F74A 2ZUAA 5M2FX 4CH1A 4O12A 1SC4B 1ZZMA 2E1MC 5J2PA 2YZ5A 3GBDA 3VKDA 2R82A 4Q8QA 2HLUA 2FZNA 2IC3A 1IQTA 1V08A 2DVXA 2LEPA 2A3CA 1FKWA 4IP4A 2NXCA 4LRSA 4DELA 5KEZA 5KITA 1TZ0A 2B7OA 4TLQA 1XYLA 2R7VA 4JFWA 3WMSA 4DZAA 4MK8A 2F6UA 2HE8A 1UVIA 4GUFA 1ZS6A 2DGQA 4YS1A 4HZ8A 1D9FA 1N33F 5DELA 3KL3A 3HZGA 3DIPA 4XAKA 1D9EA 2NXGA 4FF2A 4IGSA 1DEDA 4FX6M 1N56A 4XD6A 2F4VJ 2ZFHA 5GJPA 5EDWA 4ECRA 2IAJA 1D3WA 1IIHA 3AIUA 3WBXA 3F4DA 4D6IA 4O1FA 1RT3A 4FVMA 1J27A 5J2MB 1XDMA 3GP9A 2FHOB 3BCJA 1Q4NX 3MMBB 1GXTA 1G4SA 4QE5A 1JDAA 4OLPA 4Y9OA 3AJ2A 1Q7QA 1EBHA 1P48A 4XZIA 4DF1A 3UD5A 2JE8A 1K47A 1RSCA 3QGIA 3QWPA 2D74B 4LF5F 2EG8A 3FCPA 2WHOA 2CPYA 1AH0A 2QYGA 3WJWA 8XIAA 4X4NA 4Y96A 1P9YA 3F44A 2BNJA 1HQUB 2CBJA 1HL8A 3MUZ1 4R7WA 2W79A 1X9MA 4C48A 5F8NA 3LXAA 4CKQA 3VOJA 1S99A 3OBEA 4AH7A 3CDWA 4CNZA 3KOZA 2L9DA 3DLLQ 2IQDA 3FJ2A 2YSWA 5C7HA 1VEOA 5I2UA 2VODA 2CLLA 1NVMA 1SZFA 3P61A 1NNDA 4XV0A 3W1NA 2OI2A 3BSCA 1X6UA 1MW1A 1V7AA 4V27A 3KLIA 5DDRC 2B9YA 3MEDB 2UUAJ 4P74A 1T41A 1HKVA 1JLBA 3PG9A 4W87A 3AD9C 2X3GA 4DUZJ 5HUPA 4NVTA 2XNQA 2E29A 2DT2A 4J9OA 1R8HA 1BQXA 2TRSA 4PUDA 3H4WA 4DQRA 1O4UA 3RBXA 3LP1B 1U5VA 2CCRA 1HW8A 3VGUA 4WFXA 1TUVA 3VD3A 4NZ0A 3GKAA 1C4AA 2BE9B 4TMBA 3MO4A 3W23A 3TOQA 3L7PA 3QGAC 1FH7A 2XI3A 1KW1A 4H9YA 1KO0A 1Q6QA 3W1LA 2Z1VA 3PPGA 4B5VA 4ELUA 4KKXA 1XIHA 1G2EA 2G5WA 1JZ6A 2HVZA 4X64J 3VAVA 3WCZA 4WYWA 1JPKA 3KK3A 3ABZA 3U2OA 1HNWF 1A5LC 2KRBA 1J5SA 3P82A 5L1LA 4ZMMA 2PBGA 2IKGA 1S9FA 2E28A 3VCRA 1F9CA 1J2VA 3GXIA 2L3MA 5D15A 2CU0A 3APGA 4O28A 3W1XA 1PHWA 4QWCA 4WX2A 5C9WA 1S1UA 3H4XA 1JFHA 4WE1A 3CPRA 2CPFA 1OGSA 3NFUA 3L68A 3CQJA 4QEHA 4ZO9A 1K8YA 4QBUA 5ABFB 1RK5A 1L6SA 4OI0A 2DDXA 2G3IA 3DLEB 3EEZA 4HH0A 3A8EA 5KFFA 2WB5A 4PMUA 4GY7A 4MZ8A 3A12A 2VEIA 1EA9C 1F7BA 1KRAC 1M65A 4PUEA 3S5SA 3SCOA 3QC0A 5K8PA 4FO4A 3WKZA 3F5KA 2HPMA 1UOZA 3B03A 1TL7A 3V5FA 3GDTA 4QE4A 1KQFB 1ICPA 2HVHA 4J3SA 1QY7A 3KK1B 3EDQB 5KFGA 4RPPA 4NL5A 2EC2A 3MURP 5D02A 3IM9A 1RTZA 4PG8A 1RAGB 2V3EA 3TNBA 1FKOB 3SURA 1RT6A 1L3SA 2CHNA 3NZRA 3MDUA 3SQLA 4PYAA 8A3HA 3MPWA 3B0PA 4M6QA 3GQCA 1BAGA 2LQBA 4K8RA 3I5BA 4HI1A 4D6CA 1K7FA 2CESA 2GQ8A 2QDEA 2WNZA 3VIKA 3WNKA 1IBCB 2HBQB 4RNMA 1RJQA 2CFFA 2K3IA 3ZVIA 3M32B 3P8BB 4DR7F 4MY8A 2WTFA 1X4BA 4IIDA 1V8EA 4CD5A 2H8ZA 4QWEA 5JBDA 2WWCA 4X62F 2BZ2A 3PAJA 3GTXA 1YBQA 4DL4A 1VHCA 2JFEX 2X40A 3BGJA 2QC3A 4N9EA 3WF2A 2V2DA 1XGZA 2ZM6F 3STPA 4GZ7A 1ZAVA 4KT2A 4DCPB 3HPAA 3BN7A 4USVA 2ASYA 2FLIA 2QGHA 3BMXA 4FHAA 3DFNA 4KY3A 4M8LA 4CD7A 4HTJA 2KTQA 3UY7A 1DHPA 2M7SA 5G4EA 2MANA 2REQB 4B3SJ 5BZAA 4JI5F 3AU6A 4CYUB 5LXXA 3CIWA 2QA4S 1QJWA 4ZE5A 4JFSA 1EPVA 3MQTA 2MDAA 3NLCA 5F1UA 1S77D 2WMFA 3TA1A 3AXHA 1H7WA 1Q7YT 1WE5A 4RJVA 2OCZA 1TKKA 4OJGA 1TKTB 1RT5A 3CSKA 1HARA 3EOOA 4TXEA 2Y1IA 1H0HB 4S38A 2G41A 1N33J 1RTJB 3ILLA 1W3KA 3VFLA 1RT7A 1OCJA 4FLSA 3LGNA 1E0XA 2B56A 4GFSA 2I17A 1ZSXA 4PWWA 2W2PP 1HBNA 3TMQA 2PTZA 3OSPA 5I06A 2CUYA 1OJXA 3GG1A 1UWRA 1LWIA 4PWDA 3N13A 4M7TA 1RD5A 4XK2A 1WBJA 1PV8A 2O1PA 2W24A 3OHBA 2CNLB 1TQXA 4Y90A 3W38A 3CUJA 4NWBA 1PWLA 2FVSA 1GYLA 3CDAA 2PWFA 1JZ7A 4JOUA 1DORA 3AYTA 3P62A 4J5NA 2DXDA 1CCWB 1FWEC 2TYSA 1FWAC 3NGFA 1RWOB 1WZKA 1WKLA 5U47A 1VOMA 1S5WA 1U6BA 3VDGA 3HX9A 3LBCA 1RALA 1U48A 1EWEA 1TPEA 3E0VA 2CNKB 4W4QA 1CYGA 4GBUA 5IXEA 3UR0A 3L4VA 1KRCC 1FTRA 1S57A 3M2VA 2OQLA 2FHKA 1K70A 2A0NA 3GHUA 1KVKA 5L46A 2A21A 2K8GA 4ENOA 3FSYA 2FPTA 4AX6A 1MDLA 3EA3A 3PM9A 2D3LA 1U02A 1RB0A 3FGCA 2ZBPA 4RBVA 3BCFA 1WUUA 3TWAA 2FPYA 4CNSA 3QSRA 4J7RA 3LPGA 3D3BJ 3VWSA 3W2KA 3BREA 2QW5A 4XPEA 3WQEA 1S9EA 4JI6F 3I55S 2WVFA 2PURA 3LLFA 1E5JA 4I6VA 5HP1B 1TV2A 2YL6A 3PCOB 2VHLA 2VKZG 4EO6A 3QKZA 1KQSR 1Z48A 5D32A 3OR1A 4RNNA 1RT4A 4A3YA 1NIUA 3AYRA 5HL7Q 1HQEB 2M70A 4UQGA 2NVCA 5H1SV 3W9HA 1VK8A 4CH0S 3LPFA 4HHHA 3W7DA 4H8VA 3V4IB 3KZPA 1H4PA 4QDWA 3KRSA 1C0UA 1U0HA 3CCQS 2MZJA 2YPZA 3PW5A 1KXVA 3OJUA 4G8TA 4EO8A 4GYJA 3KBNA 4Q4RA 5JVGQ 2HBZB 2CQDA 1MWOA 4OL8A 3WQDA 4LCSA 1DLOB 1SJ3P 2Q66A 4MPQA 1BYAA 2PTYA 4PMJA 3I6RA 4U4MA 1RA6A 3VALA 4FEZA 1NM2A 1U5JA 3DENA 4S3DA 2QN6B 3FBCA 1Y7PA 2X0SA 1NZAA 3CDEA 5IV3A 3WLNA 1QK2A 1SSDA 4JPGA 1QDSA 3CNYA 3IIVA 3UR2A 3VKBA 3W7MA 1VBYA 2UUCF 3ZTRA 2HNYA 5LIWX 2BKOA 1S3HA 1DL3A 1TMMA 4OYMA 5DZ7A 2NYHA 4XIUA 3DHXA 2WSQA 5T9CE 3JYTA 4I56A 2FLPA 2EFGA 1GHSA 3KNGA 4H8HA 5HMYA 1ZNNA 2CETA 1E6QM 1PBAA 1J8VA 3C2PA 4FIQA 3QZAA 5BRPA 1C8XA 2DVTA 2NLYA 1A5BA 6ENLA 4YIWA 2RB7A 3AIQA 3B8DA 4M24A 5LNRA 2I5JB 1FRBA 4RNFA 3AJ1A 4O44A 1PPIA 3G8SA 4AHQA 3MUXA 1FDNA 5A69A 4ATDA 4OJHA 2M2BA 3B9NA 3QQ1A 4JDYA 2QR6A 1FNMA 4BEQA 3IWLA 3MM7B 3TYAA 4G5DA 1RHJB 3ILJA 5DT7A 4F25A 2BY2A 5ETPA 2HHVA 1WDPA 4Q8TA 4YP3A 5K2ZA 3DC0A 5IQ6A 2EG1A 1C93A 4ZJOA 4RBUA 4DFMA 1ALDA 2ZVSA 3WJYA 5AC8A 2Z1WA 4C1NB 2GIRA 4UF4A 1VBUA 5I79A 3DG7A 4JICA 2B8QA 3BAKA 2HNDB 4E8DA 5HQMA 1UWBA 3O3LA 4C8ZA 3CK5A 2AX0A 1UBSA 2FQQB 2VDIA 1IT0A 5AECA 5A5W