4GRSA

Crystal structure of a chimeric dah7ps
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
333
structure length
333
Chain Sequence
MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVESVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDISAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering allosteric control to an unregulated enzyme by transfer of a regulatory domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Phospho-2-dehydro-3-deoxyheptonate aldolase, 2-dehydro-3-deo
total genus 106
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18152 DAHP_snth_FXD DAHP synthase ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4grsA02
3.30.70.1140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phospho-2-dehydro-3-deoxyheptonate aldolase; domain 1 4grsA01
2F7FA 4ADUA 1WAUA 2OMAA 5K2ZA 4A3UA 3FJLA 1PV8A 4N4QA 2AGKA 4KFNA 3M7WA 3DU0A 1LOSA 3AO0A 3TKFA 3ZR4A 4UR8A 2ABBA 3O6CA 3PF3A 1RD5A 3QC3A 4TIMA 4AXKA 4GWEA 1GVOA 5HJLA 2CLEA 4BI5A 1P0NA 5FF7A 5CGQA 3TFXA 1JQXA 5G1TA 3CQ0A 1DBTA 2J6XA 4U4MA 3QW4B 1VLWA 3G8RA 1FWWA 1GVQA 3NQAA 1XDMA 4JR5A 5DLCA 4HHPA 3W86A 1TCDA 3NZRA 3MI3A 1DKWA 1GQNA 3W2NA 4YMZA 4O54A 1K8YA 1SUXA 4M7TA 2BSLA 5D33A 2RDWA 2G96A 2G5WA 3BK0A 3W1RA 3PY2A 1B3OA 3R13A 3E02A 4QAIA 4LVGA 4MY1A 4ALDA 2Y88A 2A85A 3A21A 3M16A 2GQAA 3KFTA 1I8JA 3W2JA 3CEPA 1JVNA 2E6DA 4BFAA 1OJXA 2B7QA 4CNOA 1TPEA 2QUVA 3BV4A 4FXRA 2YSWA 3HPSA 2ZYFA 5F2LA 4ZQOA 3L21A 2TRSA 3N14A 4RZ4A 3L0GA 3WJWA 1AG1O 3SZ8A 3QW3A 1FBAA 2OX1A 1SO6A 1KTCA 4UMCA 3FJ6A 2KZHA 4JTTA 1RV8A 4UTWA 3QH2A 3B8DA 2VC6A 5E0KA 2FFCA 2AAMA 5AFDA 3R12A 4A21A 5LNSA 3P8IA 3CHVA 1SPQA 1WBHA 4XTDA 3B0VC 1S5TA 1QPNA 3TCEA 4Y8FA 2E77A 2FLIA 4UCGA 4C1LA 1SW7A 1X1ZA 3BLFA 3BG5A 1UJPA 5HQEA 4BK9A 3L9CA 1FCQA 1FDZA 3EX1A 3TC6A 4YXGA 1FWTA 2A7PA 4G1KA 3GIYA 3TJLA 4UMBA 5D03A 3DENA 1TRIA 3W7IA 1KTNA 3GXTA 1SO3A 1OX5A 3NL6A 3KVLA 3LI1A 3CC1A 1EA0A 3EKZA 4RJEA 3V75A 3B4UA 4IMGA 4OWGA 2WNZA 3A22A 3M9YA 3KVKA 3TUUA 1SO5A 3C2RA 3MO7A 3MYPA 4XKYA 3UWZA 1EIXA 3L68A 4LTSA 2C15A 4R33A 3NQCA 4XBSA 1QWGA 4GUHA 3I6RA 1OFPA 3W7HA 1NVMA 1O95A 1W54A 1W31A 1SW0A 2QEZA 3W7NA 2I9EA 3CIXA 2VEIA 1FY6A 1R2TA 4A22A 1NF7A 3M41A 3QFEA 3INPA 5AC8A 1WXJA 1ZAHA 4FX8A 3TFCA 3W70A 3RLUA 2ISSA 2J9ZA 4IGHA 2J9YA 1W5NA 3LCGA 2GVGA 1X1OA 3M6YA 5AHNA 4XWUA 4CCEA 2AQWA 1J5TA 4S1FA 1VRDA 4RR4A 2VFIA 4JICA 4ZL1A 1R46A 5KSWA 1LLZA 1FCVA 4FO4A 2YXGA 1D3GA 4WX2A 4KWWA 3IRDA 4HNUA 1LYXA 1JUBA 4RX0A 3D0CA 4QM1A 1XFBA 4HNTA 1KFEA 2I14A 4M6QA 1OVDA 1KM1A 4UTUA 5HWJA 2NX9A 2VEPA 4NXKA 1TV5A 3QMTA 1SSGA 4LV9A 2A4AA 2Z6IA 2B7NA 3TE9A 1C8VA 3DKLA 1G69A 2X30A 1M6JA 1TTPA 1WOAA 2J9XA 4U28A 1GZGA 3ZFHA 3NOEA 3W7PA 5AYYA 1JUEA 2ZZ4A 1PIIA 1TO3A 3SW6A 5HINA 2A6LA 1EP3A 5HR6A 3NG3A 2Y85A 3UWUA 4LY8A 4O52A 3LHZA 2YPIA 1UASA 2QUTA 4UFIA 2ZZ3A 2V8ZA 4UTMA 4HKPA 1Q3NA 3STCA 4WY0A 4MPQA 1OHLA 4QJ1A 5EMUA 5F2MA 1ONRA 1YYAA 2QCDA 1RQHA 2JBMA 4DPQA 4EVZA 1K7FA 1KM5A 3DFQA 4S2BA 3UXDA 3NZ1A 1H60A 3TNOA 1OX4A 2NXHA 1N7KA 1QO5A 3HGRA 3N3MA 3YPIA 1B4KA 1X7FA 4QITA 2X1UA 3RLVA 4O4WA 4N9BA 4ZQRA 3PSVA 2E5DA 3NL5A 4GE8A 3N34A 4L4LA 3S5ZA 1LP6A 1G4TA 5EY5A 5KTLA 4DELA 4OGZA 3G1YA 1O4UA 3HO8A 1MXSA 1XI3A 3S5YA 4EWND 5D09A 3M5ZA 1HTIA 1K02A 1XKYA 5F4SA 2H3DA 4JTKA 3MBDA 4JTSA 2H8XA 1OYAA 4TU1A 1OABA 2X1SA 1XL9A 2DZSA 3FS2A 5H2ZA 3HBLA 2DZXA 3LXCA 1CW2A 2QR6A 3MP5A 3KOFA 3NO5A 2GOUA 4E2DA 1T96A 5CG7A 2E68A 3UZ5A 4BWLC 4NZFA 2E5BA 3FFSA 1F73A 1IF2A 4O1CA 1KV8A 2EAWA 1XUZA 3DXIA 3PM6A 4O1BA 4GUIA 3ANYA 3GNNA 4WY0B 5GVJA 1TRDA 2NUWA 4X3ZA 3PAJA 3LRMA 2GPTA 3UWYA 5G1YA 1R30A 3P60A 5C6MA 2ZFAA 3P81A 1ZAJA 2NWRA 3S6DA 1W37A 3T40A 3TX9A 3NQEA 3O15A 1AW1A 1VCVA 4UTWC 3L0KA 3MHFA 1H7OA 3M5YA 2R8WA 3CEUA 1TPVA 3NL2A 2VEMA 2Q8LA 3G1HA 1IXNA 1H7NA 5DY3A 3K30A 3C56A 1R47A 2RFGA 5HR7A 4Q33A 4NJJA 1I2RA 1D9EA 4GRSA 5E93A 3TQ0A 2GQ8A 3MYOA 1EEPA 4HPXA 3W1UA 5TQLA 3W83A 2CLOA 4FNTA 1PE1A 3GZ3A 3PB0A 1VHNA 2EKCA 2JK2A 2VFEA 3UNDA 3W1MA 3W7CA 4GUGA 4Z1AA 3DFTA 3W7EA 2QJGA 1QOPA 1F05A 1OF6A 3ABSA 5H91A 5HNRA 5D2YA 5AYXA 1TTJA 3PG9A 4A2SA 3O8AA 3LLDA 1GYLA 1G67A 5CSSA 2DZVA 1FDJA 4ML9A 3UY7A 4PA8A 1G4SA 1W3NA 2EPHA 4WXZA 4Z0SA 4YCOA 3DHDA 3NQDA 3BARA 4UXDA 2OZ0A 4UTIA 2FB2A 2WO5A 3QPZA 1D3HA 3P7YA 4Y9AA 3U8GA 5KITA 4NU7A 1G4PA 1RR2A 1QR7A 5K9DA 1TIMA 2WJZA 3LBCA 1FDYA 3C6CA 2ZTKA 4MKNA 2V2CA 3S8HA 1C9DA 2V5LA 1W0MA 2Y61A 3DHFA 3ABOA 5EYWA 1ZY9A 3VE7A 2HSAA 3PUDA 4WJEA 3B06A 2C0AA 4HIBA 3TK7A 3HJZA 4CQ9A 1TPUA 4FB7A 5HULA 1XBYA 2A5HA 1OFRA 1OX4B 3N2XA 1EPXA 3IVTA 3B05A 2ZZ1A 2WNNA 1MEIA 1W3TA 4JNMA 4X22A 3W85A 3QSTA 4MLJA 2C13A 4EIVA 2YDAA 3BO9A 4PODA 1P0KA 4WUIA 2A1YA 3BG3A 1NF0A 4UMAA 3SECA 1TPH1 3MHUA 2H90A 4S2CA 2X2GA 1GEQA 4LRSA 3PG8A 2J27A 4OBTA 3EX4A 5EPDA 2QCFA 3OBKA 3HIJA 4RZ6A 1KFLA 4IMCA 2PRMA 4ZQNA 3U2OA 3T7VA 3S42A 4TR9A 4JIPA 1KLYA 2Z1BA 4K36A 3MP4A 4GNJA 3IIPA 3UWQA 2V82A 5FEZA 2CLHA 4H4IA 1J2WA 5C54A 3OEXA 4NT0A 1W5PA 1QOQA 2HS6A 3W74A 1RVGA 3GNDA 1Q6LA 3TC7A 3IIXA 4GFSA 1PHQA 5FF4A 3P84A 4LOCA 4A2RA 1QPQA 4RXFA 4JTHA 3F03K 3LHUA 5D37A 1Z42A 3SGUA 2ZTJA 3DFPA 1OFBA 4JTUA 4ADSA 3STEA 3GLCA 3UYCA 5CPLA 1PL9A 1KBJA 2PRHA 4IX0A 1DOSA 1VHCA 2DORA 1TB3A 3NPVA 4DBEA 1JCYA 4H6KA 2YX0A 1YXYA 1HL2A 4QIUA 2Y6ZA 2ATSA 1GOXA 2P0OA 1KFKA 3ZWSA 2TYSA 3CWNA 5AHIA 2RHGA 1ZNNA 3L5LA 2NUXA 2VELA 4RLIA 3HMJG 3NXFA 4DQWA 4NUWA 3LHWA 2QCGA 5F1UA 4LRTA 4GJ1A 3C2OA 1BEUA 3GB6A 2QF7A 1RZMA 2E1DA 4ZZ9A 1PVNA 2F84A 3P80A 3H53A 3CTLA 4UFMA 3C2FA 2CZEA 1KM4A 3A5VA 5F4WA 4R7JA 5AN7A 3LCXA 1FXQA 1AK5A 1W5OA 5BOOA 2CW6A 4N9DA 4A29A 4DO6A 5D30A 1EP1A 1W1ZA 2Y7DA 3EEGA 4K8EA 5A8GA 3LGEA 4JX4A 1I2QA 2YFOA 1YTKA 4JTGA 4ONVA 3W7OA 4GXMA 1UCWA 5K4XA 3FA5A 4NNCA 2A0NA 4NXSA 3W7GA 1DV7A 4QQ3A 5IBXC 1F76A 4LT9A 5G4EA 2QDGA 3N73A 5BMWA 3EXSA 3LDVA 3O1NA 2FPYA 3WJYA 3IIVA 2CLFA 3A23A 4N02A 3KX6A 3W1PA 4Z0JA 1ZENA 3TW7A 2Y63A 1SU5A 4E2BA 1IXPA 2VFDA 3W2LA 4YWIA 3W7JA 2C16A 2G97A 3O07A 1J4EA 1JCJA 3GR7A 4O15A 4UUIA 2V5BA 5BMXA 4ZQCA 3LBMA 3TXVA 5FESA 4K7YA 5EKYA 3LRKA 3QSRA 2QCMA 3PSWA 5IM51 3SI9A 3FYOA 4IUOA 1TJRA 2GJLA 4FHAA 1WDWA 3LERA 3DZ1A 1KW1A 5DCEA 3N19B 1L6SA 3ATZA 3AJXA 1JUKA 3GKAA 4O8RA 5I3FA 3NA8A 4LUJA 2QCEA 4PFMA 4AHOA 3ZWTA 1H7PA 2G95A 2NZLA 4CQAA 4UTTC 1KM2A 4Q4KA 1V7YA 1JQVA 3B0UX 1TTQA 3IGXA 1W5MA 1IXOA 1SO4A 4JX6A 3TAOA 3EX2A 2P10A 4GC4A 2A6NA 1ICSA 5CZSA 4UFKA 1AW2A 3GVGA 3A5FA 1VCFA 1YPFA 4OV4A 3W2MA 3FKKA 4UFLA 4CNNA 3GX9A 3G1FA 3TSDA 4NZJA 2Z6JA 3W3OA 3PB2A 5C2XA 3P8JA 4O0KA 4EOUA 3GDTA 2Z0IA 3I7QA 3Q94A 1VYPX 3W1NA 5D38A 2VOMA 3TW6A 3NGJA 1UUOA 3M0ZA 3IV3A 4IPIA 1VYRA 4IJBA 1ZFJA 3W84A 1RQBA 1ZAIA 1O94A 4PC8A 3MI2A 1LBLA 2CLIA 2Y70A 5LKYA 4O10A 3LB0A 4OHQA 3IGUA 3W1XA 2ZA1A 1QPRA 1IXQA 4AHPA 3I7SA 1Q45A 1K7EA 1TPWA 1WA3A 3ELFA 3MMTA 2FIQA 3W23A 1B57A 3IVSA 5KZDA 3QPYA 1LRTA 1WV2A 2PC4A 4O0ZA 5AB3A 3PBVA 2IQTA 4HT3A 4JYFA 3HGJA 4MZ8A 2BLEA 4DEFA 1F74A 3G8EA 1LBFA 3C8FA 3R2GA 3TDFA 4CCCA 3W2UA 1LROA 4LNYA 1EWEA 4ADTA 5D32A 3S1XA 2WPBA 3P82A 1TPFA 1A5BA 3GXPA 1A53A 2JGYA 2GVLA 2ZZ6A 4NX5A 4O28A 4WOZA 5LNUA 1DJQA 3NPWA 4I9AA 2RH9A 2A2IA 3GAKA 4HNVA 4K38A 5DN1A 2ZZ7A 1G7VA 5BRBA 4OT7A 5KZEA 1L2UA 3KAOA 3E0IA 3HOJA 2QJIA 4AEOA 5LHFA 1F2JA 5K9CA 3QM3A 1K03A 3DH7A 3NPUA 2HMCA 1TMHA 1Z48A 2B7PA 3TH6A 2Z2UA 6ALDA 3G1DA 1QPOA 3PBWA 3QJAA 1T8XA 1SFJA 1O5KA 4PL2A 3S1WA 3M43A 3N2MA 1H1ZA 1VH7A 3FIGA 1GYNA 4K7VA 5CZJA 2ISVA 2ZDRA 3NR0A 4XZ9A 3OA3A 4YLWA 4AF0B 2R94A 3F4NA 1I2PA 4AWUA 5I3GA 5AHFA 1G6CA 3L2IA 2CU0A 2ZBTA 1YLVA 2UV8G 5HWMA 2QCCA 3NDOA 1OF8A 1OYCA 3UWWA 5F1VA 3KRZA 3UWVA 4UIOA 4MOZA 3MJYA 1GWJA 4LVFA 1FCBA 5D04C 2YYTA 4N6FA 1LCOA 4ORIA 3O6YX 5AYZA 3S0CA 3LHYA 1NFBA 2PCQA 1U83A 3QMSA 2Q8ZA 5FI8A 1WOBA 3UQNA 1GVSA 3NEVA 1NEYA 3PWAA 3THAA 4BR1A 4P2VA 4RV8A 4IMDA 2OCZA 3EWYA 4O16A 1GVRA 1LRQA 1V5XA 1SFLA 3EXTA 2Y89A 5F2IA 5K9XA 3T4CA 3DAQA 1PS9A 1KTBA 1OFOA 4AF0A 3F4WA 1UB3A 5CPOA 1ME9A 3GR8A 3S1UA 2WSRA 4O14A 2VFHA 3W2KA 3W1LA 4O1AA 1EP2A 3CT7A 5DCBA 1TTIA 5LGXA 4FNSA 5G2IA 5AC6A 4LVBA 3TU9A 1I4NA 2V30A 1ADOA 1GTEA 1K3UA 3KXQA 1HFBA 1OK4A 3P62A 4OQVA 3OVRA 3BLIA 2B0MA 4DXVA 3CWOX 5HUOA 2ZRXA 4LW7A 5G4WA 3WJXA 2WSYA 1N8FA 4HPJA 1FUYA 4O11A 1AL8A 5FF0A 4M5PA 4WY0F 1QFEA 3W6YA 2WV8A 5U7SA 4KKXA 3W9ZA 1KLZA 1SSDA 2GQ9A 3MI6A 4CCDA 4X2RA 1W3IA 3TXZA 4IMEA 4GBUA 2Q3RA 4JS3A 1OX6A 2WKJA 1MZHA 3P61A 5AHMA 3E96A 3N9SA 5SWUA 5I3IA 2LLEA 3C2VA 5LZLA 4QISA 3VFLA 3L0NA 4JEQA 4OE7A 1JJKA 3LTSA 4DO4A 1ZALA 1LLWA 4MY8A 3R8RA 2C6QA 3GDMA 1EX5A 3QQ0A 5TBOA 5FF3A 3LV5A 3M44A 5CPMA 1PCWA 4AB4A 4K39A 3S5OA 2QCDB 2Y7EA 4CLMA 3EXRA 4OV9A 4PL1A 5CPNA 4AWTA 3LV6A 3BLEA 3M5XA 3DBPA 4NJIA 1M7PA 1IGSA 3I68A 5HWNA 1YDNA 2NV2A 1QCWA 1FX6A 1VC4A 3EWXA 2QAFA 3C3NA 4MUZA 1QMLA 3HGSA 3TJXA 3W72A 2TPSA 2OT0A 3RNDA 3WK0A 1Z44A 2RKXA 2O7SA 4NJHA 4LC6A 1KA9F 4MFDA 2B7OA 5AC7A 3NQMA 3BVJA 2H8ZA 1L6YA 2NUYA 1KFBA 4PCFA 3B04A 2V0TA 2WNQA 1VPXA 3U6WA 4DF2A 1F5ZA 1TV8A 2X16A 1I2NA 3E9AA 1EUNA 4FEZA 1M7OA 3HQ1A 4UNKA 3O05A 1H1YA 3W07A 5D2XA 3O6DA 4M19A 4O12A 2CLKA 4JX5A 4MJMA 3GYEA 5LSMA 3UPWA 2ZCGA 4AH7A 1TJPA 4I7VA 3T44A 1Q6RA 5K4ZA 1TYGA 3NQGA 4LVAA 4MYXA 1GG1A 4UTHA 1YPIA 3L5AA 4WZHA 3HGOA 1TSIA 4MYAA 1YDOA 4TMCA 4AHQA 1JCXA 5E1QA 3CB8A 3LRLA 5T26A 3EWUA 5HMSA 3NAVA 2FB3A 1JRCA 4JTEA 3TA6A 4HSOA 1ZHAA 3OVPA 1AL7A 2J88A 1L6WA 4D2JA 1BWKA 4HSNA 2QAPA 1MO0A 1WYIA 4FNRA 3RK8A 2X1TA 3EX6A 2ZQ0A 4NVTA 1H5YA 1OFDA 3NM3A 1RPXA 1SZEA 2WQPA 2CLMA 5CZ0A 1DQWA 4DF0A 3VCRA 3DKJA 3HPZA 3TR2A 4IMFA 4EF9A 4N2YA 2TSYA 2ISWA 3MP3A 2DZTA 4PTNA 4NQ1A 3GXNA 1VZWA 3PC0A 3IGSA 2D73A 3I7RA 3G0SA 1OFAA 3W7LA 5KMYA 4JTLA 4N9CA 1JCLA 3W73A 3NQVA 3QZEA 1H63A 2EF9A 5ABTA 3IIZA 4LV4A 4EF8A 1P5BA 1SZNA 3DFOA 5L9FA 5MHBA 2V2HA 3FEMA 4RKAA 3W7MA 4WD0A 3O16A 4Y90A 2GJNA 1FCUA 1XBZA 1XBVA 3M5VA 5BW6A 4K8HA 3TMQA 1GT8A 1SQ7A 1UUMA 4NJGA 1OFQA 4IXXA 3Q37A 3G1AA 3MUXA 4JGDA 3PS7A 3C2EA 4R53A 3W7DA 4BI7A 2ZZ5A 2YCEA 1ME7A 1VYSX 1P4CA 5CZTA 2NV1A 5FEPA 5K7JA 4I7WA 2I1OA 3KRUA 4JN6A 3STGA 3G1SA 2QKFA 3HG2A 3OIXA 4O13A 1IIHA 3QF0A 1JRBA 4UFJA 1IIGA 2DU2A 4O57A 5G2WA 3P67A 2W0UA 3C4UA 2Q3OA 3EWBX 2P1FA 3NL3A 4QNWA 1L9WA 5TIMA 1ZJIA 2ZZ2A 3NQ8A 2FQIA 1YXCA 1WQ5A 2A7NA 1WX0A 2HS8A 4CQ8A 3BGJA 5D2TA 4GUJA 1YADA 3WFAA 4JIQA 2XFWA 4O4VA 1KFJA 1X6UA 3LCFA 3W88A 4H3DA 4AVFA 3QRHA 4O50A 3DGRA 3LCLA 4JY8A 5D2VA 3NQFA 1FWRA 3CIWA 1TREA 3SIZA 2QCNA 3USBA 5DBTA 1QO2A 3BPWA 1P1XA 2Y7GA 1FQ0A 1XC4A 2X1RA 1LOLA 3ABQA 5FEWA 5AHLA 1G7UA 3LHTA 2VKZG 4MZYA 1RQEA 4X9SA 3NYZA 4WOQA 4JYEA 3UPBA 4UTTA 1UBSA 1HG3A 1SZGA 1W56A 1I2OA 4NNBA 1Z41A 3H55A 1BKSA 1QAPA 2BX7A 4M6PA 3NQ2A 1XCFA 3G3MA 4ZQMA 1GPWA 1ICPA 1EUAA 1TPB1 3NM1A 3ABRA 1ME8A 3WK2A 3P5ZA 5F2GA 3S9YA 4Y6GA 1KM0A 3TV8A 4CNPA 4E0CA 1JR1A 2CFFA 4O53A 3SY5A 4MIMA 1H7RA 3IEBA 2V9DA 3T55A 5D02A 3ATYA 3ZS4A 4LS2A 5D05A 4TX9A 5DXYA 4N6EA 1K7XA 3RFAA 2O7QA 2BWGA 3LX9A 5LNWA 3W87A 5DXXA 1HUVA 3LXAA 3QYQA 4AMAA 2ZA2A 2E6AA 1GVFA 2DZPA 2ZRVA 1H61A 1LM1A 4FX6M 4KWVA 2YYUA 4LU0A 2ZRYA 1X8FA 1E51A 5DCDA 2FPTA 2ZA3A 2VENA 3LTPA 4P61A 1G4EA 1LRNA 4POCA 5EBUA 2QDHA 5LNRA 2BXVA 5J5RA 5C55A 1LBMA 3SFKA 1H62A 2DJXA 2DZUA 1NAL1 2CZ5A 5D2WA 3LCHA 1LZOA 3JR2A 2YFNA 1XM3A 2PRLA 4YL2A 4Z1DA 1W5QA 4UC5A 4JTIA 4IXHA 2RDUA 2QJHA 4LC8A 4K37A 5LHEA 3IIOA 4FNUA 2W6RA 4XKYB 2NWSA 3W7RA 4C1KA 5EL1A 5LNVA 1OYBA 3W76A 3PULA 4XQ6A 2C18A 4XUGA 3MBFA 2FDSA 1WBJA 2V81A 2ATMA 3HB9A 1BWLA 3TMLA 3GDRA 3FKRA 2R14A 3WK3A 2XN2A 3BG9A 3NQ6A 3NPXA 4Y96A 4AWSA 3B0PA 1QNVA 3VNDA 5FEXA 3S5NA 1T0OA 1O5XA 4JTJA 4L4MA 3M1ZA 4RZ5A 3NNTA 4KFPA 4UTKA 4YCPA 5G5IA 5CKSA 1AMKA 5KINA 2C1HA 3MHGA 4TMBA 2CZDA 4LUIA 3UZJA 2QUUA 3CM4A 1B4EA 4RXGA 2RDTA 2FTPA 1SZFA 1JCMP 3PBUA 2C3ZA 1K8ZA 2NX1A 2Y62A 3DFNA 1MEWA 4FNPA 1YTEA 4MLRA 2OT1A 1YXDA 3WK1A 1GJPA 4IOTA 1GG0A 3CLMA 4MZ1A 3PUEA 3DFSA 4XBKA 3PR2A 3A9IA 2VEKA 3L67A 2CLLA 2BZNA 1KFCA 2E09A 3FLUA 1VJIA 4NNAA 5K3VA 1YDVA 3L65A 1ZCOA 2CZFA 1AW5A 3Q2DA 1ML1A 4MFEA 4OU1A 4NX0A 4QSHA 3VI2A 2R91A 5I3JA 2XN0A 1R2SA 2PE4A 2ZRWA 1M5WA 1FWSA 5DELA 1S5VA 2EGZA 2H3BA 4B5NA 3RMJA 3G1VA 4IPJA 3EWWA 2FJKA 3F1QA 1VLIA 3QMRA 3GKFA 2DP3A 3EWZA 4JD4A 3LCWA 3KRSA 4LVDA 5DBUA 1ALDA 2YGYA 5LGZA 1TV7A 3E12A 2XN1A 3T78A 3C61A 3HPXA 3C0JA 3G18A 3G3DA 3TROA 3BGGA 3GDKA 2YW4A 1XDLA 1XXXA 2JKAA 3EX3A 3TQKA 1O60A 4BWLA 3W75A 5CSRA 7TIMA 1KM3A 5A5WA 4QNEA 3G0XA 1YTDA 1PCKA 3GDLA 1F6PA 4WQ6A 2B4GA 2YZRA 2VFFA 4IX2A 1SR9A 3SSJA 3KHJA 1A5CA 1LTDA 1VR6A 3UXAA 5DY2A 3JRKA 3HG3A 3MW7A 3LTYA 4M6VA 4M7SA 1QDSA 2ZRUA 1H7XA 3JS3A 3L66A 2A21A 2TMDA 3KVJA 2A7RA 4IQLA 1XUUA 4ORMA 1N55A 5C5YA 3IVUA 5IBXA 5I3HA 4GUFA 1DVJA 1OG0A 1DL3A 3LOTA 3TAKA 3PBYA 1Q6QA 1U5JA 3GAYA 3E49A 3UD6A 2DJLA 4FIRA 2EHHA 4PEKA 1GTHA 2NXIA 3G24A 5U4NA 3G1XA 3HF3A 3N9RA 2GVJA 4O18A 4O19A 1K8XA 1C29A 4Z1CA 1EWDA 3P5YA 3M47A 2NX3A 4W9TA 5FF2A 1T99A 4FF7A 4R34A 2CWNA 1KBIA 2BTMA 2QCHA 1LORA 5F4XA 1PHWA 5G2HA 3TSBA 4E38A 2W79A 4FX7A 3I65A 3W7KA 3DI0A 4N9EA 4JDYA 3B03A 1S3HA 1HO1A 3C52A 2ZRZA 4NJKA 2E5CA 4Q32A 3LXBA 4UR7A 1VGAA 3BW4A 3BW2A 2DZWA 4ZVJA 4BF9A 1NSJA 3PVFA 3NVTA 4Z1BA 8TIMA 3QQ1A 2NXGA 4KFOA 4JDBA 1EB3A 3H54A 1FXPA 1KM6A 1KV5A 3EB2A 2YW3A 3VKJA 4JXCA 3W7QA 3THQA 5AHEA 1SW3A 3LLFA 1CX9A 3R5EA 1TPDA 3HG5A 1JCNA 2HTMA 3FOKA 4MJZA 3TQVA 2WOQA 4LS0A 4ZQPA 3RU6A 2VXNA 4UTJA 5BNKA 2E6FA 4FXSA 2C19A 2JGQA 3P74A 4AAJA 1LDCA 5HUPA 3KVMA 2V2DA 4HN4A 4MVAA 3FYPA 3V1PA 3VE9A 1H50A 1Y0EA 3LM7A 4DPPA 4DF1A 1TPC1 1H7WA 4UFHA 2H6RA 3PUOA 5AOUA 1VQTA 2WSQA 4DO5A 2ABAA 4ICNA 2VFGA 2PURA 4FIQA 5KZMA 2ALDA 1HO4A 1LOQA 3CU2A 3SR7A 1ICQA 3SJ3A 6TIMA 4LS1A 1DORA 1OK6A 1DHPA 2GUUA 4HNNA 4WXYA 3W1QA 5EA9A 1Q6OA 2E6YA 3STFA 2C14A 1F6KA 2J24A 3G22A 1BTMA 4FNQA 4O1DA 1MEHA 2NLIA 4IWWA 4MY9A 4UTLA 3GK0A 3NQ7A 1H51A 4JYDA 3A24A 4BI6A 3LI0A 1I45A 3HG4A 3UY8A 3W71A 5J5DA 4LWWA 2JKPA 1DQXA 4K6AA 5L6UA 4DBDA 4JY9A 4RK8A 4TO8A 1TQXA 3W22A 4ZMGA 3LCIA 4I7UA 3OVQA 1R2RA 3BW3A 1B9BA 3W1TA 3L5MA 4PH6A 1W8SA 1TQJA 1A5SA 3OHIA 3G0UA 2JKEA 1FWNA 3CPRA 3R89A 3W1AA 2OJPA 4J9JA 1DJNA 1THFD 2FPVA 3RF9A 1VS1A 1A5AA 3EKLA 3QEZA 3O06A 4Z08A 4N4PA 3TSMA 4XTIA 4JTFA 3WJZA 4RCXA 3MWAA 2QCLA 1A50A 1OFEA 4UNLA 1F7BA 3Q58A 1VCGA 1CI1A 3OG3A 1MSSA 1S5WA 1XBXA 2YR1A 3LHVA 3SGZA 5I3KA 3O63A 3TIMA 2Y7FA 3WJSA 1JULA 4O17A 3S1VA 3DI1A
chains in the Genus database with same CATH superfamily
2AT1B 1NIUA 2X41A 1WAUA 2OMAA 2ZICA 5K2ZA 2PBOA 4PQUA 3SCVA 4NILA 3LUTA 1FHVA 1YBAA 3OTBA 3RAXA 4FR6A 3N6HA 3N9UC 5KFXA 2DW7A 2NQZA 2HVMA 4KFNA 3M7WA 4JKKA 2XMWA 1H74A 1LOSA 2H1YA 3AO0A 4B92A 3A3NB 1V3KA 4Z1YA 3O6CA 3PF3A 2M7SA 4ZLNA 1RD5A 4JTQA 4BC7A 4IOAQ 2KM8B 2DCLA 3GVWA 4GWEA 2CBVA 1M5VC 3BDPA 2PIIA 4OYWA 1KKOA 2Y1JA 3QW4B 3AB2B 1FWWA 3NQAA 3B9NA 1G7CB 3ARPA 2V68A 1TIWA 1FTRA 1DKWA 1GXLA 4ECUA 1AA1B 2E25A 1TUGB 5AZ0A 3KJVB 1U5HA 4WFXA 4X4RA 1KRAC 3UESA 1K8YA 1RAAB 4V19J 1PYFA 4F3OA 2BSLA 3VIGA 2NYIA 1IBLF 2G5WA 3TUJC 2QV6A 5LOQA 5C70A 1SGJA 3BK0A 3TAPA 3PY2A 1B3OA 3DDKA 3TONA 3MO4A 3AHXA 3LP1A 1ITPA 1U6FA 2ZUAA 4MY1A 3GW0A 1ISYA 4WFYA 2GIRA 2X3GA 2A85A 4NYYA 1LF1A 4XZLX 1C1BB 1C1CB 1P1LA 1U6BA 3D28A 4TVAB 4L61A 3ZJ7A 2X40A 3E2EA 4C7QA 2PMWA 3BV4A 3LM3A 2RD5C 2W9AA 2D1CA 2ASJA 1E5JA 5F2LA 1FWAC 2PEVA 2W8LA 4J9LA 2TRSA 3OYXA 2Y1RI 3TN5A 3UQSA 3MJMA 1YJNS 4KGJA 2ATCB 5D9NA 2PC6A 1GPFA 3GFZA 3N79A 4MGGA 3KLEA 4C7GA 2DPEA 5LIKX 2VQFF 4EZ6A 1HHTP 5I09A 3QH2A 3B8DA 4LY4A 3B9AA 4H2HA 2XYLA 3R12A 5CAHA 4AY8A 1QAIA 3CHVA 3GR1A 3UR3C 3CCQS 2XFYA 4XTDA 1KONA 5DM7Q 2XHYA 3CZEA 1QPNA 2W2PP 2E0PA 1E6ZA 2HURA 2ZE2B 3G8QA 3W9IA 2QA4G 1KOHA 4LREA 2WCAA 4C1LA 3RILA 2G50A 4PUOA 1FRBA 1UJPA 2VX6A 5HQEA 4DR3F 1FDZA 4M5HA 4YXGA 4UUWA 4HACA 2OU4A 3TZNA 3HULA 4G1KA 4NZ7A 4AL7A 4ECTA 4RW9A 4ZHRA 4V28A 3S6EA 2B8QA 5D03A 3RUBL 3EOUA 3GONA 1TRIA 4IL2A 1YG0A 2ZC3A 4KHMA 2R6OA 1KTNA 3GXTA 1SO3A 2D9PA 2WBMA 2XZDB 4FALA 2CYYA 3NS5A 3CC1A 3O6AA 2V69A 3MZIA 4IP4A 1CZ1A 2N4CA 4U33A 5K8MA 1Y10A 3MKKA 4LYPA 4D3HA 1Q8BA 1XLBA 3DLKA 4A8QA 3I4KA 4DL6A 3MS8A 4D3GA 4YQWA 2VONA 1C0UB 1CLKA 4O1EA 1OYEA 1UVKA 3IARA 3CDUA 3UWZA 2HWIA 1NH6A 1XMOF 3L68A 1QBBA 4B9TA 4FA3A 3I6RA 1XD0A 3IO1A 4MWAA 2JVOA 4Y28C 4UQ9A 4KBXA 2DSUA 4OJYA 2YWFA 1XLCA 3K5XA 4DU8A 3C3LA 1R2TA 1NF7A 1GMVA 3CV1A 3QFEA 5JJBA 3INPA 1WXJA 3ARQA 3M9MB 5KFZA 3EX7B 4MF4A 5HBFA 3CPWR 1W5NA 2EO7A 1WKLA 1R89A 1CLVA 3R8HA 3F2CA 4PUNA 4C5ZA 5KEZA 5BYSA 1EDTA 3M6YA 5E41A 4RU9A 4PB3A 5C7HA 4CCEA 2XSXA 1J5TA 2EPMX 1DTQA 3ZZPA 1VRDA 4XDCA 2QJNA 2VFIA 3EDKA 3GMGA 2GAGC 2Z1SA 4H01A 5HO4A 1H2TZ 4ZL1A 5KSWA 1OGGA 3D9BA 1EDQA 4D6FA 2M88A 4QJ5B 4RZBA 3SN1A 2YXOA 2YX1A 4DQSA 2ZE3A 1I94F 2YXGA 1FWCC 4AIBA 1EO5A 3SSRA 3IRDA 4GI9A 3D0CA 2VF3A 4IH5A 5I7GA 2YKOA 2I14A 4GQQA 3LPFA 2PU1A 3DN5A 4G1QB 4UTUA 4ZVUB 2DBBA 2RQKA 1AH0A 3MMCA 1MDRA 2PZNA 3LGNA 5B0CA 1TV5A 1TAUA 1EZ2A 4YN3B 2Z25A 1FE0A 4HKQA 2Z6IA 4HPGA 1XLMA 4DG1A 4RPQA 1WOAA 2J9XA 3PPFA 3KW3A 2V2ZA 6REQB 1JUEA 3PTQA 2HRTA 3SW6A 1EP3A 3J80U 2Y85A 1V3ZA 2VFTA 1US0A 1JGMA 3B0XA 3IWPA 4G2DA 3A12A 3CO8A 4LY8A 3LHZA 3CCJS 4IO9Q 4NZ5A 2QUTA 5K8OA 3I55S 2YKAA 3EOOA 2HVDA 2XDFA 4UTMA 2DY3A 5B08A 2E1CA 1K9DA 1KBKA 3FA4A 1HQEA 2PLJA 3BPSP 2GFTA 3OBEA 4DPQA 1UD2A 3RGTA 3PZVA 1AD4A 2AX1A 1K7FA 2EBEA 2CPIA 1GGOA 1NDCA 4LAKA 3W27A 2YWHA 4IDKB 5I02A 1MMFA 2BKOA 3ABZA 1N7KA 2B4VA 3GP9A 3N3MA 1VBGA 4P7TA 1X7FA 4QITA 1FOBA 2I57A 2R1NA 4OX9J 2J13A 3GW3A 1JIBA 3VALA 1OCNA 3HQOA 3M0XA 2DH9A 4KSEB 1ZTTA 4QWAA 1XDJA 4ZQRA 1UJ6A 2BKNA 3AYVA 3GG7A 3RJYA 1EX1A 1G4TA 4FAMA 4USUA 3N3TA 1MFUA 4JHMA 4Q7NA 3VUSA 1OCBA 3M5ZA 1HTIA 1XKYA 3TANA 3W5ZA 2QDDA 2DGWA 1XHGA 3GIQA 2ESCA 1VQ5S 1G9HA 4XD4A 2H8XA 1RLCL 3LALA 1HT6A 4TU1A 4EUVA 1XL9A 1V8EA 2DZSA 1AROP 4LRBA 2MGZB 1EQCA 2DZXA 3WH6A 4PMJA 2KH9A 3F2BA 2QR6A 1FWGC 1DE6A 4JQ3A 1UQYA 1WG4A 4ECLA 4Q8EA 2VOOA 1KR1A 3UZ5A 3U2EA 4BWLC 3OUYA 1JCTA 3BDEA 3BO2A 1F73A 4O1CA 1KV8A 3MMBA 4B17A 2HBYB 2O55A 2VUNA 4MMWA 3GNNA 2BX6A 3KL3A 3TCSA 3WN6A 3ET6A 4F04B 3PAJA 1XNQF 3ENWA 4R25A 1D9FA 4HVZA 3OLGA 1EAYC 2VT0A 3P60A 3NZPA 4I9TA 5C6MA 3JTNA 4DPUA 3K89A 2CADA 5KFDA 4NXMF 4OZ0A 2E3ZA 3C14B 1ZAJA 2ZBIA 3OFHA 2NWRA 3EGVA 2C1GA 2QA1A 5CG0A 2VYOA 3NQEA 3O15A 1AW1A 3HQNA 4UTWC 4L1WA 4C9DA 4IGNA 2KT5A 3ARVA 3O44A 3M5YA 1RPKA 2R8WA 4B5UA 1PYSB 2CQ3A 1CQNA 3BGRA 4AEFA 2P2CB 5B7ZA 2O9TA 1XQIA 1TMJA 3N12A 2M70A 2Q8LA 2YH1A 3A4JA 2JLEA 2ICSA 2GJRA 1H7NA 2MLYA 3C56A 3W26A 4WDUA 1RA7A 2DZAA 5XIMA 1H41A 4WHBA 4DHGA 2Q79A 3I96A 3TQ0A 3F41A 4M82A 3MYOA 3MMAB 3W1UA 2CLOA 2L9NA 1BVZA 4GXWA 1PE1A 3GZ3A 3UDCA 3IJ7A 3PB0A 5KTQA 2JIEA 4J3WA 3W1MA 3CO9A 3GILA 3K8WA 2WZTA 1CXHA 2ZE0A 1K9TA 5LSRA 2VR4A 5C24B 4JI6F 1J79A 5AYXA 5CPQA 4KQZA 1UOKA 4DM2A 2WLZA 1W8GA 5AE1A 3EB4A 4I0WA 4XPEA 3OBAA 1JLEB 4X66F 2VX5A 1Q4NX 3DRSB 1JLGB 2CJBA 2JIWA 4WSJA 4BY3A 1PXGA 1QBAA 3O2IA 1KLNA 2DZVA 4B3SJ 3RYLA 1FDJA 3W6MA 2V34A 4PA8A 5I06A 3NFUA 1W3NA 3VDGA 3MPVA 3V2UC 2EPHA 3ELHA 2PDIA 2OEKA 2QDEA 5T8GA 4ZLPA 4DV4F 4B9MA 2OZ0A 4C97A 2WB1D 2WO5A 1D3HA 1FP8A 4PB5A 1MLAA 4KGZB 3U8GA 5KITA 2RT3A 4NU7A 5GAHI 1T40A 4NG3A 1RR2A 5K9DA 2GGPB 2YDSA 5JVHQ 4ED8A 1ZJAA 2E5LF 3BH7B 4M5LA 3C6CA 3WEMA 1PTGA 4DZ5A 1PSDA 3OW2R 1JLCB 3VGFA 1U0HA 5A76A 3BZGA 2AHOB 2OD4A 4HI2A 2IMRA 5EYWA 1ZY9A 1X5PA 3T08A 2MQMA 3JSBA 3BLPX 1RP8A 4LF7F 4NA1A 2UXBF 2P8BA 4HIBA 2HWHA 3HJZA 3I4HX 5DQGA 3T1HF 4JBRA 3CJSA 1E6XM 1Q6FA 1V5VA 1HJQA 1P6BA 5HULA 1R9XA 2VGGA 5CD4H 3SQOP 2RAQA 3TTOA 2IJRA 2F7VA 2EG1A 1GAOA 4YHGA 1UEKA 2B9EA 3QMQA 1OX4B 4D6GA 5B0BA 5DFAA 4OKDA 5G0RA 2AEFA 2WNNA 1MEIA 4X22A 1FWDC 2QIWA 2CXEA 4IISA 3RCMA 4XPCA 4CQDA 4OHYA 2OSWA 3BO9A 3SXLA 4PODA 3C46A 3HCXA 3BH6B 4DCJB 2Y0SD 4WUIA 1C8YA 1FH9A 1EF2A 4UMAA 3SECA 1AQFA 2QVNA 1AQ0A 5EMLA 2WANA 2QJ3A 3H4WA 3MKVA 3PFOA 3KK3A 3UU0A 1PBGA 3C16A 2BP1A 1GEQA 5HMFA 4NLDA 4N77A 1JNEA 4USTA 3K57A 1WEYA 2QCFA 2Z30B 3P8BB 4R88A 1IKVB 4W93A 5BZAA 4JQAA 3MCNA 1K4GA 3LPGA 2JEJA 4ZQNA 2H4YB 1RK5A 4JOMA 4JIPA 1KLYA 4AX6A 2OPRB 2C71A 3MP4A 4F2RA 2W9BA 4HOZA 3IIPA 2C2ZB 5FEZA 2GAHC 4ILLA 5IHRA 1GVIA 2F5GA 3UGRA 3WQ6A 3CJ4A 3R79A 2XSBA 4M5MA 1OM0A 1QOQA 2HS6A 3W74A 2CQBA 2HZAA 3GNDA 3U3HA 2FH6A 3LF0A 4X4OA 1BQCA 4YU1A 3P84A 4QTGA 3W0KA 4LOCA 4X66J 1MNZA 3JTPA 1ZH5A 1LWXA 2PCEA 2Z4PA 4IFVB 1M1KT 3NSMA 4QDWA 1RLDA 3WF0A 4IYQA 4OX8A 1JDDA 3DFPA 2CJXB 3ABXA 3AIUA 4OX6A 2RHQB 4NYZA 5CAKA 2WM1A 3VOCA 3T0DA 1U1MA 1N5YB 2B43A 1JLGA 1QSLA 4N47A 3WQDA 1AODA 2GDVA 2QC3A 3NGRA 2L9WA 1HBNA 4DUYJ 4ML4A 4DBEA 4HOXA 3VOGA 4O1FA 4QWCA 1ONXA 2XZWA 3QJLA 4K1GA 2Y6ZA 2ATSA 2I2YA 3ILLA 2P0OA 1KFKA 4TY8A 2TYSA 3LP0B 2ZBPA 4C91A 3HV8A 1X31C 1EYWA 2IPJA 2NUXA 3AA8A 2FZ9A 4C2MA 4OUEA 3SRHA 4DQWA 4OJGA 5EMJA 3HT3A 5A2AA 3WNOA 1I0DA 1EETA 2H5IB 3H2CA 4GJ1A 5CHCB 1YNQA 2ASDA 3OR1A 3R94A 4ECVA 4EBDA 3I4PA 4V15A 1PVNA 1HL9A 2F84A 3D5HA 2YQ0A 1DYSA 4ZR8A 4C48A 5A94A 2WMJA 3O3RA 5AN7A 3LCXA 4RNFA 1AK5A 1O5RA 5BOOA 4DX5A 1NUEA 4N9DA 4GA8A 1XIIA 3WLNA 3C6TA 1V3SA 3LGHA 4JX4A 3KLFA 1I2QA 3VR1A 5DG7A 3H5XA 4ATNA 1OIAA 3RW6A 4GXMA 5KFKA 2A0NA 2VGBA 4R5PA 2WW4A 2ZOGA 4H4KA 3Q8PB 4A05A 2GGHA 2ZDSA 1M1HA 2JLGA 1X4AA 2QDGA 1WP6A 3N73A 2Q6CA 3EXSA 3H40A 5AJ3J 1BQMB 4F4RA 4QW9A 1P7TB 1I9CB 3IIVA 2BVTA 2CLFA 5FSEC 4RW8B 4CO2A 3NO1A 2HHSA 4XO6A 2FHOB 4F66A 1UR3M 2Y63A 2R8KA 1MW0A 1IBMJ 4US6A 3ANVA 4NXNF 4HDHA 3U1MA 4Y9PA 1EP4B 3PW2A 4O15A 4DV7F 3GR0A 4YR0A 1S57A 4GH3A 3K46A 3WLOA 5CQGA 3SCUA 2YA1A 3C86A 3V5OA 5FESA 2D3OR 3B8SA 3IMQJ 2X7VA 4S3DA 3GG0A 3QSRA 4ZCMA 3FYOA 4L9ZA 1VENA 1TJRA 5BR8F 1IWPA 1MRQA 2GJLA 1U47A 1T11A 2R42A 1WDWA 2DIJA 3LERA 2M0GB 4X62F 3GJQB 5DCEA 2YKNA 1L6SA 3N19B 2IKIA 3ATZA 1JUKA 3GKAA 3VDHA 3GHUA 4O8RA 3UFYA 3MM9A 4EYHB 3R9LA 4A4JA 4AHOA 3BQ6A 1M7XA 4S38A 1KM2A 4ZCWA 4DEZA 2BE2B 4ZO7A 3O7UA 1HWKA 2FGZA 1IM4A 2BVZA 4K4XA 3CMES 1CPUA 3EX2A 3HSGA 3FDGA 1HWIA 2WKGA 4HP5A 4GC4A 5CZSA 1ICSA 4PPZA 2Q3PA 4MAZA 1RA6A 3T05A 3GVGA 3TEHB 3A5FA 1VCFA 1LWCB 4CLPA 4JYAF 1YPFA 3W2MA 2WVFA 2D74B 3TVZA 3AT1B 3FKKA 4UFLA 4GYKA 1KDNA 4EANA 3QC0A 1N88A 2BZ2A 3TSDA 1TR0A 2Z6JA 1E6SM 3CDWA 3U4FA 1RAOA 1NJZA 3V6DA 2AF6A 4EOUA 3GDTA 1UPPA 4LF5F 4R7OA 4U67Q 3SBFA 2VOMA 1TR1A 1QJHA 3FX4A 3NGJA 1S6PB 1UUOA 1JNZB 1M1GA 4ELVA 4NY2A 4QHRA 3W84A 4F0MA 2G41A 3F4VA 4P73A 1O94A 1LBLA 3AD9C 2CLIA 1XBWA 3PRBA 1QOXA 1HBUB 2CPXA 4LR9A 4NLQA 4H2CA 1JF5A 3RO8A 2UUBJ 2CETA 3LB0A 4CQCA 1PKUA 1F4HA 3W1XA 3BQ5A 3P96A 3VNIA 3ZFVA 1WDRA 3MMTA 1WA3A 1WUFA 2FIQA 2PS2A 3CAKA 1DFDA 1V02A 3H59A 1ISXA 1T7PA 1LRTA 4GI8A 3TYAA 4ZLLA 3FHAA 3PBVA 5ETTA 1T9UA 2WMFA 4JN7A 3LENA 1Y5LB 3HHLB 1RHJB 1UZ1A 4KETA 2DQXA 3QT6A 4L64A 1NPRA 1X8CA 1VISA 3RRAA 1F74A 5TAOA 5D9OA 3TDFA 4CCCA 3OBIA 2DIEA 2IXVA 1CBKA 4RBTA 2EK6A 3TUZC 2C3YA 1EWEA 4OJHA 3PJUA 1PPIA 4ADTA 2VQTA 3S1XA 2WPBA 3WC2A 5DT5A 3A4AA 1JLCA 4HH0A 1YE6A 2XEXA 2ZZ6A 1S76D 4R0JA 1DJQA 4PEEA 1IEIA 1EIYB 2P6TA 4HNVA 2UZ9A 5EGYA 1XLFA 2W7PA 3UN2A 3CJRA 4OT7A 1UWBB 3JAMU 1EOKA 4PCSA 1CPZA 1SJCA 2UU9J 3JZEA 4C6IA 4AMCA 2CZ4A 2DZBA 3LH2S 2QJIA 1JXKA 1RY8A 2CLPA 2IDEA 4YB5A 3MUCA 2GIFA 5K9CA 3G6LA 4W84A 3QM3A 1VPQA 3DH7A 1X4GA 3OZPA 1Z48A 4H00A 5HANA 2E66A 4GYPA 6ALDA 5LM7E 4QLKA 1QPOA 3PBWA 3DM2B 2LVWA 4UZBA 3P6YC 2W62A 2B5JA 5IV3A 1UR2A 1T8XA 1CJVB 1MROA 1SFJA 3B4DA 3UR0A 1O5KA 4OVXA 2DY1A 3VAKA 4PL2A 3JS9A 4NYPA 1ZZMA 1V3LA 4OL8A 5I3UA 1VH7A 3RR1A 3TVAA 2DNHA 1DJIA 1GYNA 1XEZA 4QZVB 1I5OB 1FX4A 2XGPA 2ISVA 4LF1A 5CZKA 3VNYA 4XZ9A 3OA3A 3FFIB 4ID5B 2E8YA 4YLWA 1H98A 1BXNA 2BBEA 2DIVA 4ZSUA 1KOOA 3F4NA 4LQ1A 2VM8A 3G9CA 5AHFA 6REQA 3R1ZA 5T41A 1G6CA 5D4NA 1BSIA 3VC5A 4NRTA 2CU0A 3TQPA 2I17A 1YLVA 2FHCA 3JQMA 4Q0BA 3DRXA 1OF8A 1OYCA 2VUYA 3KLLA 5C7VA 2HBXA 3KRZA 3UWVA 4DJBA 4WDXA 4UIOA 1AJ2A 3EEZA 2ZHAA 5DT7A 4DV3J 1S12A 1GK8A 1XW8A 1W1PA 1WZKA 2PD1A 2YYTA 2XB2D 4C90A 1GNKA 2H5EA 3O6YX 5AYZA 4ELTA 4G7EB 4B9YA 4OYXA 1NFBA 2PCQA 4NZCA 4ACZA 3CV7A 2H9AB 4ICCX 1FHTA 1EHNA 4DUTA 4Y9NA 1IBLJ 4BR1A 3NDZA 4NHVA 4P2VA 4RV8A 4HH1A 2OCZA 3LO3A 3EWYA 2X1AA 5E3RA 4CVWA 2IA6A 1LRQA 1V5XA 3DHPA 2CQ1A 1F60B 5K9XA 1DPMA 1UC5A 1LV5A 1YJ7A 3DYAB 1A4LA 2WMGA 1CXIA 4CN4A 3S2MA 4I5XA 1FXRA 1UB3A 4CNZA 1S48A 4WDTA 1O66A 5XIAA 1Y5NB 3E0VA 1W1A1 4O14A 2YB4A 3PKYA 4DSEA 4ROPA 3KLEB 3PHTA 3GIIA 3BAXA 1U1KA 4F0HA 4FNSA 4LVBA 1ADOA 3MZNA 3F73A 3SQMA 4J9UE 2ZXQA 3QN3A 2PMZD 3ISNC 5FA5A 1OK4A 2CA9A 3P62A 4OQVA 3DC0A 1VC5A 4DXVA 3WDHA 2AGQA 2V3DA 2AKMA 5HUOA 3MWCA 2A0FB 4KPYA 4PGLA 1AMYA 4N76A 1R3WA 1JD9A 3PTKA 1VGYA 1TL4A 1JX4A 1FUYA 4G7FA 3WL1A 3PRDA 1QRQA 3CJ5A 3I0SA 5KFLA 3LAMA 2Y8VA 3TZZA 1J2VA 2ISFA 2WV8A 3RB4A 3ARXA 3IK4A 3W9ZA 1SSDA 1HR0J 4FYDA 5FIIA 3TZWA 2EEXA 1KP6A 4CCDA 2U1AA 1UFKA 3GHTA 2OLSA 3R10A 4OI0A 5HI7A 5GADI 3MCOA 2XJ7A 4JS3A 1OX6A 1JDEA 1MZHA 4XAFA 3SYZA 1KWMA 3GU2A 5AHMA 3BL3A 3SADA 3E96A 1HW8A 2DHSA 2PA8D 3HHLA 1E6QM 3QGPA 1XR7A 3C2VA 1LWFA 5LZLA 4QISA 4NZ0A 3WLIA 2D3UA 2AYGA 4JEQA 5DQHA 1TK0A 2QT3A 4IJCA 3KKFA 4C6MA 1UD6A 3NOYA 1TVPA 3S1GA 4DO4A 3MT1A 1ZALA 1R8HA 4Y2AA 1LLWA 4MY8A 2HPUA 1K9MT 1GH8A 4A3YA 2A3EA 2J79A 4AB4A 3KWSA 4H04A 2QCDB 4KCTA 4CLMA 2Z2LA 4OV9A 1W3HA 3PX4A 3LV6A 3WNPA 4QLLA 4F79A 1FDAA 3TJIA 4Q8MA 4QGCA 3OTEA 2NV2A 2O5DA 1FX6A 2XU2A 3EWXA 4JOUA 3C3NA 1W9VA 2XWEA 1QMLA 3HGSA 1C90A 3DU5A 3PR5B 2C8NA 4X9YA 5REQA 4EEYA 3XISA 2ZHOA 1J5EF 1XGDA 3SN0A 4DBQA 1RTIB 2W5FA 1X39A 3AA9A 1HHSA 2HISA 4NJHA 3BZJA 4RNOA 1LQAA 3NVDA 3U57A 3H2NA 3UT0A 2OFGX 5AC7A 3BLOA 3BVJA 2H8ZA 1G3OA 9CGTA 2NUYA 5ETVA 3B04A 2ZUNA 1R0BG 2OX4A 2XZTB 3OR2B 4IIFA 1SI9A 4AD3A 3PX0A 1URNA 5L8RC 3HQ1A 4UNKA 3W07A 1B90A 3VQSA 5LSOA 4M19A 4O12A 4J27A 5JVLA 4WJ8A 2E5IA 3CC7S 4M8LA 3H26A 4USMA 1MW1A 3OJUA 2OOFA 1YSJA 1KLMA 2UXCF 1EC7A 3K2YA 1TJPA 5AVHA 4ED3A 3T44A 3H5YA 2B56A 4GVHA 1Q2SA 5LXXA 4M5JA 4HLBA 2D3LA 1T9TA 2QE5A 3U2CA 4F36A 5DDOC 4NI2A 1SJ4P 4MYAA 3CTTA 4TMCA 4R0EA 4DL2A 3LRLA 3CJ8A 3CL8A 4NL5A 3TC3A 3NAVA 4ZBCA 1W3KA 4KW2A 2VRQA 4V1XA 4HSOA 1ZHAA 4K68A 2E7WA 3CYJA 1TE6A 3G6MA 2D20A 1SB6A 2GQ2A 4UOGA 5AXNA 2BJ8A 2CBIA 1K1QA 3GD6A 2CDQA 2J7KA 1Q7QA 1K6AA 4L7ZA 3GYNA 3D0IE 1XMOJ 4WF7A 1MO0A 3DYOA 1N5YA 2F6UA 3WQ4A 2GVDB 2X1TA 1FX2A 2ZQ0A 4NVTA 1H5YA 2W4XA 3ITTA 4WFBQ 3FBBA 2I5GA 1ZL1A 4LBIA 1V0KA 2X09A 1HVQA 1NSQA 4M51A 1DQWA 1WHYA 2DV0A 3CCWA 1I75A 2R1KA 3B8IA 2YL6A 4AX7A 4IFKA 4GACA 4A8SA 5IZHA 5E9XA 1CXKA 2CJQA 2ISWA 2MB0B 1N32F 3DI6A 5ECUA 3GZAA 1TR9A 4NQ1A 2JFDA 4I2QA 3CTRA 4M63A 3OTOF 3HN3A 5C9RA 1RK6A 4PMXA 3W7LA 2DEIA 2GVZB 1FWPA 4N9CA 4B4FA 1YRTA 4NZ1A 4XBJA 3QZEA 4CZCA 2ZX5A 1FKOA 1VBKA 3PX6A 3K4WA 4E8UA 1K6WA 1KHVA 4LV4A 5KAKA 3DFOA 5M1TA 2ZX8A 4LX4A 4Y2CA 4B3SF 3MA8A 2K06A 1WAWA 2D3O1 2OGYA 4KH2A 2HGNA 1XBZA 1XBVA 3L7UA 4GIRA 4K8HA 4Q8WA 1E6NA 2VO5A 1SQ7A 1UUMA 2ACQA 3HZ3A 3IAQA 1FK9A 3W00A 3ZXWA 2VV5A 2C28A 3QIPB 2QXWA 3T3FA 2HRUA 1XR5A 4I67A 2CITA 5A8KA 3P3BA 3CQKA 3POCA 1TL7A 3PS7A 3SRFA 3UO0A 2G3MA 4I68A 4X65J 3H4DA 4BI7A 2ZZ5A 2NQHA 3B8WA 4Q8FA 4AZCB 1VYSX 4LBUA 2KJWA 5JVGQ 2NS1B 4IFRA 5BYQA 5FD1A 1KXQA 3BSAA 2VB6A 1J93A 4YTRA 2KRBA 1V0LA 3LBOA 1XR2A 1QHZA 4N8OA 5IRPA 4TV5A 1S99A 2C22A 2I7GA 5KFQA 1K0VA 1Y7PA 3O3LA 1HJUA 4WFZA 5EFDA 3OIXA 3O2LA 4CGTA 2WK4A 1T3NA 1HKIA 2ACRA 2DSWA 3SMZA 3CUIA 1IIGA 5G2WA 3QRPA 2W0UA 3P67A 1HJVA 4F3QA 4DR6F 3RJXA 4DG1B 2Q3OA 3HSDA 3LW5C 3EWBX 4QNWA 1Y5XA 4DAFA 3QTPA 2ACSA 4LH8A 2AL2B 4MNLA 4CUCA 5CYJA 5KG3A 4WP9A 1UWUA 1VFHA 5GADU 4ES3A 2ZUMA 3MANA 3DMJB 3TX8A 6FD1A 2AX0A 1X4HA 1WX0A 2HS8A 4CQ8A 1NRKA 2ZH2A 2HHQA 2UUAF 1RCOB 4GNKB 1JYNA 4J91A 1VFFA 3L95X 1J0ZA 2XFWA 3UNTA 4O4VA 1KFJA 2D3ZA 4ZCKA 4B3TF 2HHWA 3GE7A 3GIMA 1RT7A 2XO7A 1CNVA 3DGRA 4Y6IA 2PF8A 4JY8A 3K8MA 3NQFA 2IBKA 1JLFB 3CIWA 5DQPA 2RDDA 2FGOA 3BPWA 2ZJPQ 3MTJA 1UH3A 5GJMA 4QR6A 4Q4SA 1XC4A 3ZJ6A 1S97A 3U7BA 1VIZA 4HBKA 3GTYX 4WZQA 1OS5A 3ITXA 5IT0A 3ANUA 5FEWA 2YBUA 3UJSA 2DUZA 3AROA 3N13A 2LDIA 3D1QA 1G7UA 3RM9A 3CSKA 4MZYA 3V5FA 1G0CA 2Z0GA 1YTYA 1J5OB 5CYMB 1PYMA 4AZGA 2Z2ZA 2VWTA 2XH7A 4ZB2A 3WHIA 1HKWA 3H55A 3OPSA 2FJVA 1TKTB 2JSXA 1EGMA 3G3MA 1CEZA 1NOWA 1XC6A 1EKRA 2XMUA 3GV7B 1EUAA 3PUGA 3NGSA 1QM9A 1PDZA 1DHMA 4J3ZA 3MM7B 1TL1B 3TV8A 1JR1A 2ANUA 1DWIM 1GZJA 3S83A 3HZGA 4RWWA 2NUUG 3NGDA 4JL1A 2B7CB 4HU0A 2LCWA 2QLXA 4CNUA 3RBXA 1R38A 4X63A 1XLKA 1NK5A 1QI2A 4LF5J 2CVEA 1CGUA 3RFAA 2O7QA 3CJKB 4LFCF 3MURP 5LNWA 1FXLA 2GYIA 1TVRB 3W87A 1VIOA 2WZHA 3RX4A 1SJDA 3QYQA 3D46A 4H6QA 4LAMA 3J81Y 2DZPA 3KOZA 2NCKL 4FX6M 3QT8A 5K8NA 3UJFA 4JTAA 2B8PA 2HHXA 2PDFA 3ZO9A 1J2BA 3EDEA 4CTAA 1J5OA 4QYZK 3PFEA 4F67A 1E51A 3DRYA 5DCDA 1DXFA 5EX0A 2FPTA 2B6AA 2VENA 2ZKMX 3PYGA 4P61A 4NAEB 3M8ZA 4UQBA 1Q6CA 3MCMA 3GWQA 1TTHB 2Z2YB 4X4VA 1TJ2A 1X4DA 2Z24A 1WEZA 3KK2A 2BXVA 1BF2A 2PWUA 3SFKA 3KOAA 1WDPA 2DJXA 3I3EA 4QSFA 5FJPA 2KN4A 5FLXY 1RT3A 4CWBA 1BPLB 4WDWA 1VB9A 3TOPA 1JLAA 5AECA 3JR2A 2YFNA 4V19X 1JPMA 4GVGA 4CU7A 2PRLA 2ALRA 1O68A 2MKSA 1BHGA 5T9BG 1MWZA 4Q7BA 4UC5A 2WHJA 3FZ2A 4ER8A 2PO4A 4JTIA 4LC8A 1E9YB 4K37A 5AE2A 2MQQA 3S6OA 1GW1A 4PUWA 3CJ3A 3K17A 5CSUA 4B91A 2Y0FA 3VX1A 1P8GA 1OMSA 1QJWA 4P71A 4LANA 7AT1B 5LNVA 1OYBA 4DR5J 3KL5A 2QZRA 1UG6A 2V81A 3EA3A 4H7ZA 4E8GA 5I79A 2ATMA 2D2HA 3F4CA 2FDNA 1ZQ5A 2IRYA 2OR2A 3GDRA 3FKRA 4Z2JA 4I4BA 1KRBC 3WK3A 5DMMA 1XD1A 1NNDA 2F2KA 1X98A 3GU1A 2OPQA 4Y96A 3NPXA 4TVCA 4Z2IA 1AH4A 3T0AA 1QNVA 3VNDA 1C1BA 4CD7A 4U2ZA 3GQCA 1T0OA 1L6GA 4F0RA 2D0HA 3Q8SB 4KB7A 4QQBA 3L4UA 4RV3A 3THPA 4DF4A 2AMCB 1K1SA 4RZ5A 1BYCA 3WD1A 4UTKA 2OPRA 4YCPA 1ZU8A 5G5IA 4L74A 1JI1A 2YKPA 3EDFA 3MHGA 5M2FX 2CZDA 4ED2A 1A5OC 3ZZ0A 1B4EA 4RXGA 3D5MA 2RDTA 2FTPA 3SCNA 4ED0A 4K2XA 1RGVA 1C9WA 3ADAC 2BXZA 3EUNA 1FHDA 2L9DA 4KHPF 2C3ZA 1K8ZA 3PDNA 4IOTA 4MTVA 3W8PA 3DFSA 2Y5SA 3FNNA 1RT6B 4XBKA 5BXSA 3VZXA 2CLLA 1OSEA 2ZM6J 3OVGA 2HFNA 1D1UA 4ZOAA 4LRDA 2O9PA 3UW6A 2VVNA 4RW4A 1UKPA 4OU1A 2CHNA 1WXYA 3VI2A 2NREA 3GNPA 1IQTA 2R91A 5I42B 1US2A 3WQOA 2HGMA 4I7FA 6TAAA 3M6WA 4JL2A 2YLAA 2ZRWA 4MH8A 1SC6A 5DELA 3R7SB 1S5VA 2XH2A 3N25A 1PBAA 3AIWA 5CEWA 4MWAE 2DHHA 2VX4A 4DL0C 3EWWA 2FJKA 3R4IA 1VLIA 1WI8A 2DP3A 4JD4A 3KRSA 2EG2A 4I3GA 3T81A 2BUNA 1KSPA 1FWIC 3E1F1 3RDKA 1ONEA 2PF0A 3BGGA 5DGBA 2FYMA 2EFPA 3PW0A 3G71S 1DWJM 4DUXA 2OH2A 4DV2J 4RWXA 4A8LA 3PKMA 2PDGA 3TQKA 1O60A 1XLDA 5CSRA 1WNEA 1KM3A 2PP0A 5A5WA 2G0CA 2QIIA 4HCLA 4QNEA 3GDLA 1PCKA 1EGVA 2YH0A 2PGRA 4WQ6A 2B4GA 3CNQP 2YZRA 5ETOA 2RDJA 4IX2A 4IH7A 1UR1A 3VM7A 1PAMA 4WGHA 4DS4A 3SSJA 3KHJA 3DOLB 2PI4A 2JEQA 2BNJA 4BF5A 3VIMA 3UXAA 2D69A 3MEGB 1GONA 2RGLA 3HG3A 3WNLA 1N33J 4M5KA 1QDSA 3QPEA 1XNQJ 1ONWA 4HYVA 1S1XA 2A21A 2DGXA 4QPTA 4U7UK 4IQLA 1Q8LA 5LIUX 1N55A 1UKTA 1SYTA 1UD4A 4HZ7A 2MKKA 1RAIB 1BRLB 3L9ZA 1DVJA 3I3BA 1ZA1B 1ZRQA 3DOLA 2AZ3A 4ENLA 3LOTA 4MYTA 2E1MC 2INFA 3MEGA 3PBYA 5KFIA 1JZ8A 3P0XA 1WHWA 3GAYA 4USJC 3BKUA 3UD6A 4FIRA 4PEKA 5BWFA 2BE2A 4GVBA 5GJPA 4PSPA 2WAQD 4QE5A 3HF3A 4HNOA 3KLIA 2EJAA 2GVJA 4F4ZA 1YPXA 2N82B 5CCZA 3BEGB 3P5YA 3PZQA 2ZNZA 1HVXA 2PDXA 4L56A 4YY3J 1Q85A 3RB0A 2ZUVA 1R3YA 3GNXA 4K4YA 1R0AB 3IWLA 2ADAA 5D78A 1N48A 4R34A 1BQXA 1WG1A 2QTWA 2BTMA 3KG4A 2W9CA 4GZ7A 4P8XA 2DNZA 2E9RX 2XY5A 5HMDA 4H9YA 4K4TA 3LN3A 4C8KA 4W4MA 2J7WA 1L2QA 5GJNA 4MYUA 2J7CA 5SZTA 4XZMX 4ZVQB 4FX7A 1B3YA 2W79A 1TZZA 2CHRA 4N9EA 4CN1A 3B03A 2CQHA 3KMQA 1CB2A 1CECA 1S3HA 1FWEC 2V9WA 3M8WA 2HEJA 5K20B 1N8WA 1QPKA 2E5CA 2RUSA 4UR7A 5DRIA 1VS3A 3BW4A 4JI3F 3OFFA 4ZXOA 4USWA 3ZVIA 2P8CA 1YZ7A 1NSJA 4NYUA 3HVTB 3KLGA 3CO0P 2WMKA 3QIPA 4B3RJ 1EB3A 3VKJA 3EB2A 2JHEA 5DANA 2EXUA 1WCGA 4QIEA 1CEOA 1TU0B 2FVQA 3G6XA 1SW3A 3LLFA 1CX9A 4H1ZA 3V7PA 1W32A 4ATDA 2A6MA 4A3RA 2PD9A 1JLBB 1MU2B 2MZJA 3CAQA 4A8IA 3MDFA 4LS0A 4FOJA 1U5VA 2YXLA 5IFMA 3PTWA 3RU6A 2NQJA 2FC9A 3FSUA 3S3GA 1QTMA 4UTJA 2ABYA 5BNKA 4ES2A 1ZLPA 1NEEA 2U2FA 4FXSA 1ZBWA 3H4GA 2VUGA 2IM3A 2YKMA 1OIFA 3KOYA 2QLBB 5IT9Y 4AAJA 4C7FA 1J5SA 4HN4A 4JZ5A 3TP2A 2C3PA 4IFKB 5CH7B 3BBFA 5HOSA 3WF1A 3IBCB 1H7WA 1AH3A 2HK0A 3PUOA 2V67A 5AOUA 2GGEA 2O3DA 3GJSB 5C9XA 1PX4A 2ABAA 4JI6J 4ICNA 3O8WA 3VX0A 2LQ8A 2XYGB 5A6PA 1RACB 3PEHA 2H4WB 3MM8B 1AZ2A 3SR7A 3VTIA 5EHHA 3W65A 4S3JA 6TIMA 1HNXJ 1DHPA 4DWSD 1T95A 4HNNA 1PYTA 3HFTA 3TNVA 3GNRA 4NXMJ 4WXYA 2XMMA 2DR8A 2PWHA 2E6YA 3CV2A 1BYBA 3KBVA 3D6HB 1XH2A 4UWMA 4WFAQ 5D6GA 2C14A 2HXTA 3EA2A 2DGAA 4I8DA 4O1DA 1MEHA 4CM0A 4ZVEA 1KHWA 1UMLA 3NQ7A 3VNMA 1MI3A 1MROB 1XYFA 4ZOEA 1GYMA 5HAOA 1CENA 3I5CA 3CQIA 6FDRA 4DBDA 2XYHB 4HK6A 4FYVB 4KFBB 3D66A 4RK8A 4HK5A 2HWGA 1KLMB 3N0VA 2KTQA 2RKIA 1PWMA 4I7UA 1EQMA 2GLKA 3UA4A 4E4PA 1P6WA 2D7SA 2X8RA 4KJIA 1W8SA 1TQJA 4NAFB 5JH1A 2XVLA 2QMJA 4AW7A 3WUEA 2DR9A 1HBMB 2VI0A 3R89A 2L5HA 4J9JA 3P0WA 1RDRA 4HZMA 4UW2A 1VQ8S 3CMJA 4JIEA 3SV4A 2P9EA 4C11B 3O06A 5CXTA 3NO3A 4A35A 5JIPA 1Q79A 3KNGA 3PW5A 4PKDB 3NAIA 3C6TB 3MWAA 1KWGA 1FF2A 4BZYA 4WVXA 4H9MA 3H7UA 3XINA 2YX7A 2ZM6F 4KRTA 5KFFA 3OG3A 1MSSA 2FJWA 2PSNA 4LF6F 1Q7ZA 3WQWA 4KKOA 5REQB 4JFVA 1VFMA 3RRHA 5I3KA 3O63A 2Y7FA 4G1QA 1JULA 4ACYA 1WZAA 3NUKA 3S1VA 1H2VZ 3GYXB 1HKVA 4N7TA 4LQ9A 1IYXA 2O9OA 2XZ7A 5EFFA 1AJZA 3WQFA 5GPRA 1PV8A 4NP7A 3AHPA 3PW7A 4N4QA 1U02A 3MGJA 4Z37A 3DU0A 3QOKA 1TV2A 2F61A 4DVOA 4HMCA 3K5MA 4Q8OA 2XO6A 3ZR4A 4HTJA 2FJAB 2QPUA 3WX7A 2P6SA 4H7VA 1R8PA 2EPOA 3SCIE 3GB0A 4NEZA 4BI5A 5FF7A 3ICLA 1JQXA 5G1TA 3CQ0A 5G1MA 3QZ6A 1OB0A 1UL3A 2JC1A 4REQB 2G0JA 3T9NA 3NOCA 3UZZA 3BN4A 2AYEA 3MI3A 1R7AA 1GQNA 3OODA 1VQKS 3M7VA 2HCVA 1UFWA 3WH8A 4GO8A 2AGTA 2OWXA 2G96A 3MM8A 2I38A 3F7JA 3ZSTA 2Z1XA 1VFJA 3W5YA 3E02A 3WDRA 1FKPA 3FRZA 1IZJA 2OWWA 4LVGA 2HFVA 1WD6A 4ALDA 3ISIX 4C6CA 2GGPA 3I82A 4F8RA 2IA0A 3KFTA 4GKJJ 3OQ8A 1S1VB 5M17A 3W2JA 1S2UA 1JVNA 4BFAA 2Z29A 2I8EA 4W5UA 3IBWA 4H9ZA 4WKHA 1SC4B 3K7RA 1XMBA 1OQFA 2RB7A 5M5DA 2YA2A 4OBRA 2WQDA 4ZQOA 2REQA 4OI3A 2FVMA 3K4DA 3L21A 2W8KA 1FHLA 2VGIA 1SQEA 5EX3A 4RZ4A 2HKEA 4PR6A 3WJWA 4GX9A 1UTAA 1AG1O 3K5LA 3VCDA 4B9SA 2RJGA 1NJJA 4AXNA 3CMQA 2UWFA 4UMCA 3FJ6A 1SZRA 2KZHA 4JTTA 4S39A 4ZVFA 1TMQA 3OU8A 4TX6A 5E0KA 1A0EA 3TYBA 3TYCA 3U2ZA 3FXYA 3G6VA 4A21A 1NXIA 2C2NA 5LNSA 3P8IA 4ZVRB 1SPQA 4DMZA 1NZAA 3KLHB 2A2DA 1KFSA 4GKJF 3BQ2A 2E77A 3CUXA 1IR1A 4UCGA 1JFHA 4HT5A 4QWDA 3A3XA 3BLFA 4CH1A 1I51B 2PU0A 4MFBB 2HHPA 3TR5A 1XRSA 3NRBA 4DQQA 1FCQA 2J7DA 3WH7A 3U1NA 4LF7J 1P7TA 4FP9A 1M5OC 1EH9A 4XIAA 1GHRA 2OZ8A 1RJJA 4C98A 5GAGU 2ZEJA 2DK2A 2AEMA 4I56A 3R6GB 3T6BA 1EJVC 3TYUA 5A6TC 5C42A 1EOMA 2RIJA 3DENA 3B8VA 4CNTA 4MAVA 3L4ZA 3VGSA 3FUYA 3R7NB 1FWHC 2W9CB 4ILMA 4X4SA 5D8WA 4EPKA 3A4XA 2YQ1A 2GGIA 3NL6A 4ERIA 5FSDC 2PDYA 4RJEA 3B4UA 4IMGA 4Q0BB 3ETOA 4KV8B 2R1LA 3MM9B 3A22A 3M9YA 4IG3B 3KVKA 4X0NA 3EPMA 1UA7A 2PLKA 1SO5A 1RAJA 2CPYA 1F2HA 3AAMA 3ZJKA 4NMXA 1N6QA 1E6YA 2W2MP 3AAWB 1RTHB 1BVNP 4ZKAA 4TLRA 3IAPA 1RWVB 2OZTA 1LWEA 4LSNB 1YRUA 2C2KB 4OHVA 2CNOB 4LTSA 3DEQA 1SVDA 2W7AA 4R33A 3NQCA 3KG1A 2QVHA 3Q4DA 4DRSA 1TL1A 2W4DA 3W7HA 3E3XA 3OL7A 4OJ1A 1RABB 5J2MA 5BROA 1MN9A 4FS2A 3GSMA 4L1GA 3K1GA 3K0JA 3RCNA 5EMMA 1D8ZA 4XZNX 2C2OB 3C6UB 4NLSA 1U33A 2OB3A 2XISA 3DLGA 1M90T 4ECYA 4HMDA 1HBOA 5AC8A 2DT2A 4P8UA 3TFCA 3W70A 3RLUA 2ISSA 2J9ZA 2V2QA 1X4CA 5AZ1A 2BQRA 3BMXA 4WEVX 1OC5A 2JFEX 2F8QA 2HRWA 1OSCA 3P14A 4M5DA 3GIPA 2VVSA 2WWCA 2DPIA 1VBRA 1WDSA 3W82A 3RCYA 4AC1X 3NGFA 4B2DD 2P8IA 4OYIA 2AQWA 1DJHA 3HVRA 4RR4A 2GVEA 1HYSB 5HVHA 3CWJA 4OHWA 1F3TA 5IQ6A 3PY8A 3E6EA 2IPFA 3EDJA 4NRRA 3SZ2A 2FZKB 3BPDA 4IOBA 3HXMA 2EPLX 1I1WA 4KWWA 5AJ3F 2LMIA 3KK1A 2HQDA 2XI3A 1JUBA 4AL6A 4QM1A 4I90A 3Q8VA 1XFBA 3AC0A 1UMJA 2AKZA 4UOQA 4A8YA 3DX5A 1KM1A 1O6XA 2F3JA 2FHJA 5HWJA 3PIOQ 4B3ZA 3ZR6A 4DIAA 4CNYA 3QMTA 3SCRA 1SSGA 1S2AA 4DV7J 2RHSB 3PNZA 2XWXA 3VGVA 4JPGA 1C8VA 4CD4A 1VQNS 2X30A 3DN9A 1FERA 3AH6A 1Z2ZA 3W7PA 4KC5A 1XPGA 5E5NA 3KBSA 5AYYA 1EHAA 2V94A 3PWGA 4E6MA 1TO3A 3AS1A 4JFSA 5D0RA 5KFVA 2JF6A 5HINA 1J11A 2A6LA 4JHOA 3PZGA 4PMYA 3VAVA 3DFYA 5HR6A 3KLHA 4DJEC 1S9EA 2BOEX 2ADBA 5FJUA 4PMNA 1S6OA 4GXPA 2WBRA 1E0XA 2XGIA 4N7QA 1FHUA 4YB6A 3DKDA 2C79A 5B09A 4ZIVA 3JW7A 1VIWA 1HWJA 4IG2A 2V8ZA 1F2GA 4E2FB 3DFHA 3EBVA 1QVBA 1LEOA 1OHLA 4QJ1A 3T5HA 1TX2A 2EPNA 1KFDA 4DFJA 4Q8UA 3SUWA 2GMJA 4BCEA 3VAMA 1FRIA 4EVZA 4UQTA 1RHQB 1UQZA 1UEVA 1KM5A 3ALFA 3DFQA 3IJQA 4S2BA 1WDTA 2YXXA 4LEQA 1OX4A 2UUAJ 2HNEA 4ZFMA 4RUBA 1G4CA 2KT2A 3OL8A 2NXHA 1VJWA 1IT8A 3YPIA 3AS3A 2PODA 2CWXA 3VNJA 3RLVA 4USKA 2CPZA 5KFMA 2HQFA 1BQNB 3L23A 3D6TB 5KT2A 3ITCA 1GQKA 1M04A 1OADA 1JDFA 3NL5A 2KHCA 3ONCA 4L4LA 1UD3A 1YBTA 1LP6A 1KRMA 1DXEA 2PDCA 1HD1A 3G1YA 7ENLA 3VGGA 1U6ZA 4J2MA 3SO7A 4LR8A 1K02A 1JZ5A 3CC4S 2H3DA 3LGDA 1ZJHA 1IKVA 2FUG9 1WKKA 2Z56B 2XBPA 3F4DA 3LPYA 3MBDA 4JTSA 3H0PA 4RL1A 1OYAA 5DLFA 1T7LA 1RH9A 4LGXA 1R3NA 5DG8A 3LXCA 3OVBA 1CW2A 1SH2A 3QY7A 3IJ8A 2AJ1A 3Q8UA 3DRPA 4FR1A 4E2DA 2GOUA 2P3EA 3ITLA 4NA2A 2J6VA 4NZFA 4PXDA 3FFSA 3GG8A 4UOZA 4ZP6A 3UE2A 2UUBF 2QL5B 2ACMA 1FA0A 2J8AA 3R7MA 4GUIA 1HBUA 4CLFA 1J5EJ 4OIFA 1NTHA 2QMWA 1UVNA 4PQUB 1VJZA 2PB1A 1JYVA 4IRCA 4PYDA 5G1YA 1R30A 4FF5A 3GYCA 3VGBA 4WE1B 3M30A 2RS8A 4MT1A 3W2VA 2QG9B 4ATWA 3EPNA 3M8SA 2VDHA 4DAIA 3J7YI 1EARA 2PDQA 3H2AA 2FVRA 2W91A 2PWGA 1JPHA 2XIMA 2XC9A 3MSRA 4H8UA 4OI4A 3MHFA 3IRXA 4XZBA 1E4MM 7XIMA 3MHYA 3V35A 1C8XA 3IS4A 3CHCA 4IFYA 4NZ3A 4KRUA 3G1HA 4DPTA 2WONB 2RFGA 4WBFA 4NJJA 4PCPA 2PDNA 4OYZA 1D9EA 1KQZA 5ABGA 3A13A 2GQ8A 2D9OA 3PW4A 3H6OA 4JIHA 2PDPA 1VRTB 4KWUA 1VFOA 3TA0A 1S72S 4FNTA 4PYAA 4NCGA 3M6VA 1R8LA 1NSKL 1S0MA 1QSSA 2JK2A 2VFEA 3BH4A 3W7CA 4IIDA 4YHEA 4LRAA 4LF4F 2GJXA 2PAJA 3QV7A 4PBGA 2OTJS 3OB8A 1UA1A 1QOPA 4FXWA 4ZPBA 1F05A 1CJTA 4WP8A 5D2YA 3UPMA 3GDBA 1TTJA 1I1GA 3R5JB 4AIUA 3PZIA 1RT4A 4ZVTB 1V03A 3BAIA 3B97A 4GNVA 1UZDA 3I5BA 3VNZA 2V2KA 4PG7A 3ARYA 4O0QA 1IR0A 1GYLA 4LUTB 4H54A 1SQGA 1UZHA 5IC6B 2DUAA 1XLLA 3LWMA 1Q65A 3KOWA 3MDUA 4Q5VA 4C6AA 3WIVA 3LZ3A 3PZNA 3MTKA 5EWFA 2JC0A 2KM8C 4YCOA 1E6RA 1Y5IB 3N4WA 4NKCA 1WOPA 2ZDOA 3P3DA 3BARA 4PWWA 4NCAA 3VAGA 4Y9AA 3DMJA 2E1WA 4PPDA 4I2PA 1QR7A 2FHBA 4NAEA 3AJDA 5M2RA 2HVHA 1C7TA 3MR5A 2MLZA 3AODA 3PZOA 2GGJA 1FDYA 3LP1B 3S2LA 2ZTKA 4MKNA 1C9DA 3M46A 3GCWP 1W0MA 1VEMA 4S3GA 2OKTA 2LA4A 3QLHB 3DHFA 2W24A 1XIBA 4LFAJ 2HHVA 3BV7A 2MHEA 2QN6B 4DR2F 4YDXA 2ZVRA 3PUDA 4PMZA 4WJEA 2C0AA 2E67A 1ZA2B 3MUTP 2OI2A 2KG1A 1F0XA 1H0GA 2FLNA 1DWGM 4WCJA 1RXOB 1NCLA 4TQSA 2J0SD 5MKGA 4UTFA 2DEPA 3LD5A 3UDEA 1XBYA 2QLFB 2A5HA 1VLOA 3OZOA 4B90A 2PTWA 5HPCA 1EPXA 3B05A 3VM5A 3SCKE 4PRWA 3PAOA 1W3TA 3W85A 4O4GB 1Y3JA 3QSTA 2G4JA 3KG0A 4OYAA 3EB3A 2YDAA 4Q8TA 4YVPA 3BG3A 1NF0A 2ISDA 3SDEA 4M1RA 3N29A 3ARTA 1A49A 2H90A 4JQ4A 3KLVA 4NCBA 4PG4A 3H2EA 1PC4A 5HL7Q 4HNLA 3HZEA 1SFTA 3WUGA 5L9NA 2OJ3A 2A3JA 3IR5B 2ADCA 4QAWA 4U3CA 2W9MA 2VZVA 4F4YA 1ESWA 1E4IA 4LCSA 2W63A 3UN3A 5LSLA 3BN7A 2DW6A 2WMIA 3H24A 5HMXA 4RZ6A 4AD2A 2IVFB 2FLPA 2PRMA 1XTZA 3U2OA 3T7VA 4HTBA 5E2QA 3CL7A 2Z1BA 4GNJA 1KQGB 1W2BR 1R85A 4ITSA 5C54A 3VZIA 4XZHA 4XX6A 1TWWA 1BGXT 3DLJA 3ZLFA 4ZEPA 1Q6LA 4ANEA 2AP6A 5FD0A 4GFSA 1W9PA 1PHQA 1JZ2A 1V3RA 1TVLA 4A2RA 3DHUA 4RXFA 1PAEX 1UH2A 1P43A 4GQ0A 4HCDA 1BRLA 3GFYA 2B3TB 4P7QA 5D37A 2IXUA 3CHEA 4JTUA 4ADSA 1OFBA 1S5MA 1D7FA 4HMEA 1G1XA 3STEA 3UF9A 1GMUA 2FZGB 1XIEA 5C2CA 2ZWZA 2GGGA 3AU6A 2V0NA 5A6BA 1E1CA 3R2CJ 2KT3A 1F3EA 5KZ6A 2WSFC 4C8OA 1UD5A 1YJ9S 1NDVA 1DOSA 2WWDA 2EK1A 2AJFE 3VKDA 2DORA 3NPVA 2R2RA 1Q86T 1JCYA 1ADDA 2WAGA 1MUWA 1D9DA 2CPUA 4IP7A 4QDPA 5KFRA 4C0HA 3UJEA 1RHRB 2CJYB 1A4MA 4EBCA 5IT9U 5AHIA 2B4PA 3QBUA 5BOEA 2XYPB 3EWCA 3SCJE 4HPNA 3CEDA 1TMMA 3K5PA 5LMNF 3Q24A 3UJRA 1N34F 3LHWA 2IUZA 2QCGA 2KVIA 2V8DA 3T0CA 3GB6A 1BEUA 3S9ZA 4HZ8A 2BKPA 2HRYA 4WIIA 2WHKA 2E1DA 3C2YA 3WCZA 3AIEA 4IFVA 2Y5JA 1B0VA 4YS2A 3U27A 4HHUA 1UWBA 3I31A 1KM4A 3A5VA 1GXTA 2VJXA 4R7JA 2Y8YA 4L1XA 3WZ0E 4GKKJ 1PILA 2ZWOA 3KOXA 3NKYA 3V5CA 3GZ7A 1V3HA 3MR7A 5KG1A 2NYHA 4DR4J 3CL6A 2WOMB 1S4FA 4A29A 5FL1A 2H65B 2HW3A 5D30A 3C8YA 1N5TA 2GHPA 1EF3A 3R2DJ 1EP1A 4OZLA 2JQXA 1TQLA 2E5HA 1R7OA 4NE9C 3LGEA 4DWSB 3CJKA 4JI1J 5I07A 5D4LA 2C3OA 1LL7A 4IJRA 1WORA 3W7OA 2DXDA 3PR4A 1IKXB 1DV7A 4QQ3A 2HBVA 3THUA 4H6EA 1F76A 2FJUB 2UVVA 4LT9A 5G4EA 2V2VA 2ZX7A 4QCLA 3LDVA 3I5AA 1XIGA 2IBOA 4WYLA 5B0AA 2X2YA 3O1NA 3MM6B 3HURA 3FK4A 1REQA 3WJYA 2AYBA 3TLLA 3PRVA 3KX6A 2HAFA 1ZUAX 3TW7A 4TY9A 3CJTA 1QD1A 4YWIA 4DUWA 3K4AA 3H42A 2XLJA 2RRNA 1CJUA 2KFZA 2G97A 1ZAXA 5DMLA 4PMRA 1MW3A 3IACA 1JCJA 3GR7A 2A3HA 4DR4F 3WSUA 3UG8A 1BMQB 1C8QA 3EGNA 3TXVA 4QIGA 3H22A 1R8CA 4K7YA 1LXNA 3AJ2A 3QWUA 3LRKA 4M8UA 4W86A 1LJYA 2OPSA 1S6UA 5HLFB 1H11A 1RA0A 3OQ2A 2BDQA 2GJPA 3WQ8A 3DZ1A 3R0KA 1PZ0A 1J12A 2ZUWA 4B5TA 4CM2A 3R7BB 5I00A 3NLCA 4LUJA 4JQ1A 4JI7F 4PFMA 5D9PA 2CQDA 2V50A 2VICA 3AHTA 1VRTA 2X0HA 4MJKA 1B3VA 1AQHA 1VK3A 2P53A 2RMLA 2KDOA 2JH3A 3TAOA 4LYRA 3IG1B 2A6NA 1UR4A 1A5KC 1LUCB 1AW2A 1NQ6A 4D1IA 1UR0A 4NSBA 2DT3A 3I4EA 4ZTXA 4YFUA 2W9BB 4JTDA 2W1BA 1R27B 2MZ1A 3BAYA 3D0GE 1EL3A 3AXHA 1QHOA 3IBFB 4J9VA 1N34J 4FVMA 1PGZA 1R3QA 4DSIA 3G1FA 3D6FB 2MSTA 3GXDA 5EWEA 1PTAA 2J76E 1YJRA 3PB2A 4XZIA 3P8JA 1XWLA 2CRLA 4OUIA 4OYMA 2Z0IA 2WJEA 2CQ2A 4FXVA 3HQPA 4CLLA 3DBNA 5CC5A 2NSBA 2OPJA 3W1NA 1CG2A 1XYBA 2XM1A 5IOBA 2PE8A 1RISA 3S01A 4AQYF 1H4PA 3IV3A 3VOJA 5A2CA 1ZFJA 2RGMA 3FSXA 1W3JA 4M0XA 4AFYA 3KK3B 3BCJA 3MI2A 5A95A 4NZ4A 1EP4A 3PYFA 5K14A 1TX0A 2VPYB 3AMLA