4GRSA

Crystal structure of a chimeric dah7ps
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
333
structure length
333
Chain Sequence
MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVESVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDISAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospho-2-dehydro-3-deoxyheptonate aldolase, 2-dehydro-3-deo
publication title Engineering allosteric control to an unregulated enzyme by transfer of a regulatory domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 106
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18152 DAHP_snth_FXD DAHP synthase ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4grsA02
3.30.70.1140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phospho-2-dehydro-3-deoxyheptonate aldolase; domain 1 4grsA01
5A8GA 2DZXA 3W07A 2E5CA 4HSOA 5D05A 3W84A 4CNOA 1L6SA 1TRIA 4FIQA 3Q58A 4MYAA 3HG3A 3EXTA 4Z1CA 2NX9A 1V5XA 3TAKA 4E2BA 2ZA1A 2VXNA 1MO0A 2G97A 5HINA 2H8XA 1FWWA 4DEFA 1WX0A 2Y7GA 1X7FA 3EWUA 5D03A 3G3DA 5HMSA 2AQWA 4IXXA 3SY5A 3W1TA 3UXDA 1KM5A 4O14A 1DQWA 3PUEA 4CNPA 2ISVA 1G67A 3ZWSA 5U7SA 1OF8A 3UD6A 5LNUA 4OV9A 3FYPA 3QW4B 5CPLA 2VFDA 1K7XA 1FWSA 1K3UA 1J5TA 4WY0F 2NZLA 5DCDA 3SIZA 5D2YA 5FEXA 2YXGA 3G18A 4MJZA 2EKCA 4GXMA 3KAOA 3ZWTA 4IJBA 4IX0A 2QCMA 4UFHA 3TJLA 4S1FA 2C19A 2E6AA 3GDMA 5E0KA 2DZSA 4KFNA 3LHTA 4AF0A 3LTPA 2GJLA 2J9YA 2DORA 3IVTA 3GXNA 3KVLA 5DBTA 2J88A 5C5YA 2BXVA 4OU1A 1X8FA 1P4CA 1WA3A 3G1XA 1H7OA 1L2UA 2X1UA 3GDTA 5DXYA 2ZRVA 3M0ZA 1OK6A 3STGA 4Q32A 3HPZA 3VE9A 2R94A 3EWZA 4NNCA 4MZ1A 5TQLA 4YWIA 4C1KA 4LTSA 4K37A 1TTQA 2QCFA 1OYBA 3NXFA 1YXYA 4I7WA 3M5VA 2B4GA 3DAQA 4YLWA 3HF3A 1W5NA 4M6QA 3M43A 2DZUA 2YW3A 3FS2A 4LUIA 4QJ1A 4FX6M 3W2NA 3P82A 3ABRA 1GQNA 4HNNA 4LVDA 2DZWA 3PBYA 4XWUA 2NUXA 3NA8A 3O6DA 4O54A 2OT0A 2NLIA 1XKYA 2CW6A 2E6YA 2QAPA 4D2JA 4FB7A 3GLCA 4JEQA 1L9WA 2OZ0A 1A53A 3NQ6A 5EMUA 3QPYA 5FF3A 4LUJA 4AWSA 4N4QA 1DL3A 4M7SA 2V30A 4JR5A 3O06A 3A9IA 3PB0A 1QCWA 4U28A 1TQXA 2OCZA 3B0PA 3KVJA 4O15A 4LRSA 3C2RA 3O07A 1GG0A 4UTKA 1K8YA 3NQ2A 2ISWA 4UXDA 3VFLA 3CIXA 5G2HA 3UQNA 4R33A 2JGYA 3GB6A 4UCGA 1HO1A 4DBEA 4FNTA 1UJPA 3B4UA 1NSJA 1TTIA 1G69A 1SU5A 2ZYFA 1GTHA 2Y89A 3S1UA 2Y7DA 1VYSX 4QISA 4RX0A 3BPWA 3JR2A 4E38A 1OFDA 1H63A 1P0NA 1SO4A 3ATZA 4M6VA 3SGUA 5AC8A 4ALDA 3BW2A 1UASA 1OFEA 1W5MA 1IGSA 2Y6ZA 1Y0EA 1VHNA 4JYDA 4RXGA 1OFBA 4AEOA 4ORIA 2Z2UA 4MJMA 5F2IA 5FEZA 3DFNA 3B0UX 3ATYA 2ZRYA 2QCDA 3C56A 1H5YA 1W56A 2QCHA 5HNRA 3WJYA 1SFLA 5F4WA 5F1VA 3TCEA 3M5XA 1TJPA 3EB2A 2BZNA 2NX3A 4PH6A 2YYTA 3OBKA 1VPXA 3VNDA 3PSVA 4JTLA 2H90A 1TPFA 3GDLA 2BWGA 2CLFA 2YFNA 4UFIA 1EP2A 3NQAA 3OA3A 2Q3OA 3CEUA 4UTWC 5GVJA 3EKLA 4IUOA 4L4LA 4O1BA 4ZQNA 4GUFA 1JUEA 1NAL1 4YXGA 3KVMA 1OABA 3CEPA 2E09A 3R89A 1TRDA 4FEZA 1F2JA 3TQ0A 4IWWA 5G4EA 3GX9A 1JUBA 3SGZA 3GAKA 4TO8A 4X9SA 3QJAA 4UTHA 3W7IA 4HSNA 1TPEA 1VYPX 2TRSA 3P62A 5D30A 4O16A 2WSYA 4N02A 5AC6A 3EKZA 1VR6A 5LHFA 4JS3A 3IIOA 1F5ZA 4IMFA 1JCLA 3LHVA 3L2IA 4UR7A 1OFOA 5CSSA 3QMRA 3LDVA 2HS6A 2X30A 4LS2A 1EWEA 4PL2A 2QUVA 3LCIA 7TIMA 2BSLA 3QPZA 3MHGA 4MIMA 4ONVA 5FF2A 4ZMGA 4O1DA 3MUXA 4Y90A 2A1YA 4K7VA 3L67A 1KFLA 3BG5A 3P8JA 5AHIA 3DGRA 3MO7A 3S9YA 2YW4A 4O1AA 3P84A 3IGSA 4JX6A 4BWLC 3NEVA 3BO9A 3LBMA 3L0KA 3R5EA 4BR1A 1OG0A 3VE7A 3B0VC 3DI0A 3FA5A 1YTKA 3FOKA 4OHQA 1JQVA 3PG8A 3W7DA 1DQXA 3E12A 4GUJA 3FJ6A 2A7RA 1EIXA 4W9TA 2ZDRA 3E9AA 1TO3A 4FNPA 5LGXA 3SW6A 1LP6A 4GBUA 5CSRA 3BLEA 3O6YX 3GNNA 5HJLA 1FBAA 2QJHA 4UTIA 4BWLA 3BLIA 5I3FA 3JS3A 4HIBA 2ATMA 1LRTA 3C2VA 4K8HA 5C6MA 5EYWA 2D73A 5DXXA 1X1OA 2WNQA 5F2LA 4S2BA 3LHWA 3G1AA 2JKPA 1LYXA 2PURA 3NL2A 2QR6A 2HS8A 4YCOA 5DCBA 1I8JA 2Y85A 1ZCOA 1RD5A 3E96A 3BGJA 2V2DA 2RHGA 4CLMA 3MHUA 2WJZA 1JVNA 1T96A 3S42A 3PBVA 3LHUA 2ZQ0A 4LU0A 5HULA 2C0AA 3SFKA 3M5ZA 3CHVA 2P0OA 1H60A 3ZS4A 1H1YA 4QAIA 3N2XA 4JIQA 2ZTJA 5AHMA 4O18A 3FLUA 3S6DA 1Q6LA 5ABTA 2QAFA 3DKLA 3H54A 5D38A 3W2KA 1PV8A 4AHPA 3W73A 4EVZA 1BWKA 4NXKA 3IV3A 3SI9A 4HKPA 1VGAA 3WJWA 5CZTA 1ICQA 2ZFAA 3TFCA 3PB2A 5FESA 1OFAA 1KFJA 4OE7A 5I3IA 3L21A 4O17A 1K7EA 3G1YA 3I68A 4WUIA 3M16A 1U83A 3PY2A 1TB3A 3S5OA 3UZ5A 4Q33A 1ONRA 4O4WA 1PHWA 3A5FA 3THQA 2DU2A 3TW6A 4X3ZA 2YCEA 4DBDA 6TIMA 3TJXA 1R46A 4AF0B 1R47A 3S5NA 3NR0A 4PODA 1V7YA 3MP4A 4JTSA 1AW2A 3H55A 5AYYA 5E1QA 1F6KA 2Y7FA 4NX5A 3BG9A 1WXJA 2GQ9A 2FLIA 3W2UA 4Z1AA 2Q8ZA 4BI5A 3A21A 1W3TA 3KRUA 4JTKA 4Y6GA 3S0CA 2C14A 1QO2A 3UXAA 5D2VA 1EUNA 3ZFHA 2QEZA 3N3MA 4OQVA 4PL1A 2GUUA 2VEIA 2JK2A 2ISSA 2H8ZA 3O1NA 1HTIA 4WOQA 4PFMA 5EA9A 2Y63A 3OVPA 1JCNA 3OVQA 5DY3A 3RFAA 2A6NA 3EXRA 3W23A 5HWMA 1O95A 3OHIA 4UR8A 1UB3A 3M7WA 4NU7A 3PF3A 1SO3A 3EX6A 1Z42A 1THFD 1XCFA 2ZZ6A 4LVBA 1AMKA 4UMCA 5LNVA 3L66A 3NQFA 4ADSA 3DH7A 4EF9A 3N9RA 3MBFA 2AAMA 4FO4A 1C9DA 3NPWA 4K6AA 4LOCA 2Z6JA 3W1PA 3HMJG 5FF4A 1GWJA 1VHCA 3G1HA 3DHDA 2PCQA 3ABSA 3C6CA 1QAPA 2GOUA 3UYCA 3W88A 3HPXA 4DO4A 4IMEA 4X22A 1EB3A 3AO0A 3M41A 1N55A 3T44A 1KM4A 3T7VA 2QJGA 5AN7A 1KW1A 3W22A 4EWND 3EWBX 1LOSA 1GG1A 4LVGA 3W1XA 1T0OA 4Y8FA 4O0KA 2EGZA 3F4NA 3L5AA 2E77A 4GRSA 4Z08A 3PM6A 1S5WA 2J9ZA 3I7SA 3V75A 2HMCA 3TR2A 3CC1A 4IX2A 1XXXA 2Z1BA 2R14A 3FYOA 1AW5A 1I4NA 4XTDA 4HNUA 5BW6A 4UTTA 1TPDA 1P1XA 5AOUA 3W7QA 5I3JA 4RV8A 3LLDA 3WJZA 5E93A 3GDKA 3TKFA 3Q37A 4RLIA 1ME7A 1IXPA 3N14A 1YPFA 3PG9A 1KFKA 5HWNA 4LWWA 1W5PA 3NNTA 1FWTA 1VQTA 2RDUA 1DJNA 2DZTA 3N34A 5IM51 1B4EA 3TQKA 3F4WA 2QCDB 2Y7EA 3EXSA 2B0MA 3C3NA 1MEWA 3MI6A 3NOEA 4Q4KA 1QOQA 1DBTA 1OFPA 1YYAA 5A5WA 2C18A 1A5BA 4XKYB 4LVAA 1XM3A 2C1HA 3CT7A 3IGUA 1JCJA 1QPRA 1W31A 4O13A 1TPB1 3DHFA 4RK8A 1OYCA 3I6RA 4CQ9A 3LXBA 3MJYA 1M6JA 5EPDA 4GNJA 1ZNNA 1LORA 3W86A 3UWYA 1G4SA 1TV7A 3FEMA 3F03K 3VCRA 4N4PA 2NUYA 4ZVJA 3P61A 8TIMA 3TIMA 1TPWA 3TX9A 3CPRA 2EF9A 3NG3A 1H50A 3W9ZA 5BOOA 3LI1A 2YFOA 1JR1A 3GR7A 5G1YA 5G5IA 5CGQA 4PA8A 1HUVA 4CCDA 3DXIA 4GUHA 1SSGA 4JDBA 3KRZA 4ZQOA 4XBKA 2A7PA 1KM1A 2YPIA 3LOTA 4H4IA 3UWVA 1FDZA 4O57A 2WV8A 3DBPA 4BFAA 2A2IA 1NEYA 3W76A 1FDYA 3BG3A 3NQ7A 1DKWA 1FUYA 3EEGA 1WBJA 1RR2A 5MHBA 1YADA 1F05A 3R13A 3W3OA 1B57A 4HNTA 3G0XA 4M6PA 1IXOA 3G1VA 3GAYA 3NGJA 3G3MA 3NQGA 4NXSA 3M1ZA 2PRMA 2J24A 3KRSA 3IIVA 2EPHA 4Y96A 4IXHA 4MZ8A 3MYOA 3MI3A 3BGGA 4UC5A 3IIPA 3C2EA 1GVOA 4JN6A 3STEA 1KBJA 3HGJA 1PIIA 4FF7A 2J6XA 1EP1A 4JYFA 4O28A 5LZLA 4PEKA 2EHHA 3W7MA 3VI2A 3TA6A 4DF1A 2GQ8A 3HOJA 3W1RA 3THAA 2W6RA 2ATSA 1T8XA 4KFOA 4UTJA 1ZALA 3KVKA 3PUOA 1OX4A 3SZ8A 2W0UA 1PL9A 3P80A 4IMDA 3FFSA 3TW7A 2ZRZA 4FHAA 1GYLA 4O12A 5D2WA 3UNDA 2VEMA 4WXYA 4CQAA 2J9XA 2ZZ3A 4RXFA 1LDCA 1RZMA 2Q8LA 5AHNA 4O10A 3TQVA 4MLJA 3S1WA 4I9AA 3CWNA 5C2XA 1DV7A 2RFGA 2E5DA 2GVJA 5DN1A 2X2GA 1LBFA 4JTIA 1F6PA 3P5ZA 1H62A 2CLLA 1H1ZA 1SO5A 4WJEA 2GQAA 4FX8A 2C13A 3WK3A 3QH2A 5G2WA 1FWNA 5I3KA 5CG7A 1B4KA 4O1CA 4PTNA 2TMDA 4NNAA 4EIVA 3USBA 4DO6A 1G7UA 3G8EA 3R12A 3NPUA 3MWAA 4YCPA 2PE4A 3W1UA 4KWVA 4ZQRA 1G6CA 3HO8A 2CLEA 1YDOA 2XN2A 3L5LA 3IEBA 5LSMA 2A5HA 3NQDA 5I3GA 1TMHA 4LW7A 3UWUA 2PC4A 3W7JA 1AL8A 5KZMA 3UZJA 1TIMA 5AFDA 3BLFA 4AH7A 4AHQA 2X16A 3W75A 3M9YA 4HPJA 1T99A 2CLIA 2OMAA 4CNNA 3QEZA 3LERA 3SECA 3IVUA 3MMTA 4KKXA 3ELFA 4I7VA 2QCGA 5LKYA 4K7YA 1DJQA 1OX5A 1IXNA 1Q6QA 4RCXA 1SZGA 3DI1A 1Z41A 3NAVA 1ZHAA 1I2QA 4NJKA 4LT9A 2VFIA 1M7OA 2NX1A 3TAOA 2KZHA 1JQXA 3GNDA 3C4UA 5AHEA 1H7XA 2E5BA 4UFMA 3SR7A 5CKSA 3GKFA 3W7EA 2CZ5A 1L6WA 1O94A 1JCXA 2QDGA 3LBCA 1R2SA 4ORMA 4XUGA 5F2MA 2VEKA 3NZRA 1KLZA 3BW3A 4DPQA 4UFJA 2C16A 3TSBA 1KM0A 3O16A 4A21A 3TSMA 2VEPA 2CZEA 3W7CA 4AXKA 1VJIA 1OFRA 1OJXA 4NUWA 1DVJA 1OFQA 3OVRA 3GXTA 3NL6A 1TSIA 1AW1A 3RMJA 1R2TA 2TSYA 3IIXA 4K36A 5DCEA 3ABOA 2FB3A 3LCHA 4RZ6A 4JTJA 1YPIA 5HWJA 2HTMA 4JY9A 4JYEA 3NDOA 1OX6A 3W7PA 2WNZA 1H7RA 4U4MA 3PR2A 3GIYA 4ZQCA 2VELA 2IQTA 3W1MA 5KSWA 2RH9A 1G7VA 3PBWA 1KTNA 2Y88A 1S5VA 2E68A 3NM3A 1FDJA 5K9XA 1BKSA 1KFCA 2DP3A 3CLMA 1W0MA 4GWEA 5H91A 3ZR4A 2JKAA 3SJ3A 3M6YA 1I2RA 1XBYA 2VFGA 3MP5A 3TDFA 2Z0IA 3HPSA 2AGKA 1F74A 5LNWA 4Z1BA 1KM2A 4H6KA 3A23A 3C52A 3TXZA 2JGQA 3NQCA 3YPIA 1QFEA 4PC8A 2H6RA 4JY8A 4WX2A 4EF8A 3TSDA 4GUGA 3W7KA 4UMBA 4O4VA 5K7JA 2QCNA 4G1KA 4TX9A 2DZVA 3B05A 3HGOA 3LCGA 4HPXA 1ZY9A 3CWOX 3LCFA 1X6UA 5K3VA 1RQHA 4NZFA 1B9BA 1QPOA 2DJXA 2E1DA 1FWRA 1UUMA 3N9SA 4O50A 1KFBA 5KTLA 3E49A 1VLIA 3DKJA 6ALDA 2WPBA 4QQ3A 2R91A 1Q3NA 3JRKA 3W7GA 1XC4A 3W2JA 3PUDA 2FPTA 5K4ZA 3C2FA 3QC3A 3GKAA 4NJHA 4N6EA 2XN0A 1HL2A 4ZZ9A 3T55A 3B03A 5HUOA 1W37A 3N73A 5HQEA 1WAUA 1XDLA 2QDHA 3L9CA 3LV6A 1W5QA 4WY0A 5L9FA 4FNRA 3O8AA 2O7QA 3P81A 1TREA 2E6DA 3K30A 1VCFA 1G4EA 4OBTA 4AHOA 2FJKA 3L0NA 3FIGA 4EOUA 4KWWA 2I1OA 4M19A 4QIUA 1FCVA 1TQJA 2WNNA 4LY8A 3TC7A 3CQ0A 3GVGA 4K8EA 2F7FA 1KFEA 1DHPA 3HG4A 2HSAA 2CLKA 3GK0A 3P60A 3LRLA 1EWDA 4OWGA 1QPNA 1LBMA 2QJIA 4JX4A 1HFBA 1JCYA 3Q94A 2B7PA 3R8RA 1QMLA 3NQ8A 3P7YA 3HBLA 4JTFA 1O4UA 4UNLA 4MYXA 3BW4A 4BF9A 2CFFA 4HT3A 1F7BA 2QF7A 2CLOA 5CZJA 2V81A 5LGZA 4DXVA 1LM1A 2V0TA 1GEQA 4MY1A 1SZEA 5D37A 4JGDA 3TV8A 1SR9A 2WOQA 2YYUA 1RV8A 3LCWA 1GPWA 3UWQA 5BNKA 3P5YA 2G96A 1WYIA 1KM3A 4UNKA 3CM4A 1N8FA 4HHPA 1PCKA 3BVJA 1QDSA 1MEIA 1H61A 2H3BA 2YX0A 1EEPA 3W7HA 2RKXA 1W5OA 2XN1A 1ZAIA 3NQEA 1BWLA 1TTJA 5HR6A 5SWUA 3EX1A 1O5XA 2F84A 3NPVA 4RR4A 3T40A 4UTMA 5D04C 4O0ZA 2NUWA 3LI0A 4LS1A 4R34A 3KOFA 1IIGA 4IMGA 4BI7A 2C15A 2GJNA 2FPYA 4JIPA 1GOXA 5FI8A 2LLEA 2RDWA 4Y9AA 3S1XA 1J2WA 4FXRA 3TE9A 3QQ0A 1IXQA 1CI1A 4XTIA 3IVSA 1SZFA 1CW2A 3W83A 3LTYA 3TMLA 2CZDA 3EX4A 4UTTC 3B04A 4DF2A 3STCA 1XBXA 2WSQA 3KX6A 4WOZA 1H51A 3TC6A 1FCBA 2H3DA 4ZL1A 3UY7A 4L4MA 4JXCA 2FTPA 1QR7A 3H53A 4M5PA 1UUOA 1ZAJA 3C2OA 5AHLA 4CCCA 1A5CA 4S2CA 1MSSA 2Z6IA 1GJPA 3S8HA 1ME9A 1G4TA 3NQMA 5KITA 3G1FA 3NL5A 3INPA 4AMAA 4UTLA 1ICSA 4RZ5A 4TMCA 3C0JA 3U2OA 2CLMA 2CZFA 4YL2A 5I3HA 1PHQA 1ADOA 4CCEA 1WDWA 2ZRWA 4MPQA 4OV4A 3W1LA 3MHFA 5T26A 3I7QA 4ZQPA 3LHZA 4Z0JA 2P1FA 5LNRA 1CX9A 3W6YA 2WO5A 4JD4A 3QMSA 4NZJA 3L68A 3N2MA 1TV5A 1KTBA 2PRHA 3UPBA 1XBVA 3NPXA 4LS0A 1K03A 2VFFA 4IPJA 1M5WA 3OEXA 1H7NA 1LTDA 1KLYA 4XBSA 3A22A 5K9CA 4KFPA 5G4WA 3T78A 1KBIA 2WSRA 2GPTA 3W7RA 2X1TA 5TIMA 5FEPA 4K39A 5D33A 2W79A 2OX1A 2VFEA 3UPWA 3QMTA 3KHJA 1XL9A 1WQ5A 4N2YA 4MY9A 4JTGA 1RPXA 1JUKA 4MZYA 2TPSA 3CIWA 3WJSA 3HIJA 1A5SA 2CLHA 2JBMA 1NVMA 1DOSA 4LRTA 5HUPA 4NVTA 3DFTA 3UY8A 1I2OA 3MBDA 5D09A 1FCUA 3MI2A 2A85A 2NWRA 4JDYA 2Y61A 1OF6A 3PC0A 1YTDA 1U5JA 3LRKA 2NWSA 5EBUA 1AK5A 1GYNA 1GVFA 1SZNA 3RNDA 2GVGA 2RDTA 1JJKA 3C61A 4WZHA 3L5MA 1O60A 5CZSA 2VENA 4RKAA 3TUUA 1OK4A 3LGEA 3PS7A 3HJZA 4M7TA 3E02A 3O63A 1ML1A 1FY6A 3R2GA 2V2CA 3S5ZA 3EWYA 2E6FA 4AWUA 4POCA 3GXPA 5AC7A 3LXAA 3QSTA 4H3DA 1BEUA 5AYZA 5AB3A 1GVQA 5DLCA 4QNWA 3QF0A 1WOBA 2XFWA 2V2HA 1K02A 1JRBA 1P0KA 4AVFA 3ANYA 3WJXA 2DJLA 2QCEA 3O05A 4MFDA 1VH7A 1JRCA 1SFJA 2ZZ7A 3MP3A 3WFAA 1XI3A 3IIZA 3W1QA 2YZRA 3NL3A 5D2TA 3QSRA 3T4CA 3CB8A 1LROA 4BK9A 4ZQMA 2VFHA 3P8IA 1GZGA 4WXZA 5DY2A 3BK0A 5BRBA 2FFCA 1K8ZA 3W7OA 1H7PA 1N7KA 4E2DA 1PE1A 5EY5A 1TJRA 2YDAA 5IBXC 1QOPA 3FKRA 1Q6RA 5AHFA 4JICA 1VCGA 1EP3A 1ZAHA 2ZBTA 3OIXA 2A21A 2Y70A 4WY0B 2NXIA 3W71A 1S5TA 2NV1A 3M47A 3U6WA 4NJIA 1ALDA 1ZJIA 4O11A 5U4NA 1VC4A 4DF0A 1IIHA 3LRMA 2NV2A 5IBXA 4N9EA 3V1PA 1SW3A 1GVSA 3LCLA 3C8FA 2QUUA 1R2RA 3EX2A 1W3NA 3IRDA 4DQWA 1E51A 2NXHA 1XDMA 4AB4A 3BARA 5FEWA 1NFBA 2B7OA 2NXGA 4A3UA 1SSDA 3RLVA 4AWTA 1WV2A 3QFEA 1EUAA 3HB9A 1SPQA 1W54A 3LHYA 4PCFA 3STFA 2VC6A 5C54A 1QPQA 4N6FA 4HN4A 3DFSA 3DZ1A 3AJXA 4QSHA 2ZTKA 4O19A 4A29A 3NZ1A 1TYGA 1TCDA 4UFKA 3CTLA 1LOQA 1J4EA 1K8XA 4IPIA 3PVFA 3W70A 3VKJA 4E0CA 3P74A 5KMYA 3LLFA 2UV8G 1RVGA 3PWAA 1LBLA 1C29A 4IOTA 4JTHA 1FQ0A 2P10A 2Q3RA 2FIQA 2O7SA 2J27A 1Z48A 3IGXA 2C6QA 1PVNA 5KZEA 1OYAA 4YMZA 4ML9A 4LC8A 2VOMA 2X1SA 2G95A 4FNUA 3WK2A 5KZDA 1VCVA 3GR8A 4XKYA 3TXVA 1QNVA 4MFEA 1JULA 3P67A 4QITA 3EX3A 5C55A 2C3ZA 4FNSA 4X2RA 3WK0A 4N9DA 1NF7A 1AG1O 3EWXA 3G8RA 5D32A 4OGZA 4K38A 1HO4A 2FDSA 4N9BA 4ADTA 1TPC1 3N19B 2FPVA 3QRHA 2QKFA 3W74A 1LOLA 1I2PA 2WQPA 4NJGA 3QW3A 3HGRA 4GFSA 1TPVA 3LXCA 3DFOA 5G1TA 4Z1DA 4GE8A 3A5VA 4UTWA 5HR7A 3W7LA 4QNEA 2V9DA 4LV9A 4LVFA 3L65A 3LTSA 3W72A 1Z44A 4MVAA 4TR9A 2V82A 3G0SA 3W2LA 2BTMA 1PS9A 1FCQA 1VLWA 4P2VA 1TPUA 1QO5A 1LRNA 3I7RA 3G1SA 4FNQA 1ME8A 4LNYA 1GVRA 1FXPA 2ALDA 4XQ6A 2GVLA 1WBHA 1YXDA 4A22A 3W7NA 2VKZG 3TU9A 3NQVA 2ABAA 4LC6A 2ZZ2A 4MUZA 1LLWA 1O5KA 5DELA 2QUTA 5FF7A 1I45A 1VYRA 2YGYA 2BLEA 2WKJA 5K9DA 1XUZA 2A6LA 3KFTA 1YTEA 2CU0A 3D0CA 3O6CA 2OT1A 4Z0SA 2ZZ4A 2YR1A 1SW7A 1LRQA 1P5BA 1GTEA 3L0GA 4GC4A 1BTMA 5CPOA 2V5BA 3PSWA 2ZRXA 3RLUA 3I65A 1NF0A 1YDVA 3U8GA 4JNMA 5D02A 4MLRA 5D2XA 1SO6A 5AYXA 4A2SA 4ADUA 4IGHA 5EKYA 2CWNA 3LCXA 3S1VA 3GZ3A 5BMXA 1OVDA 5DBUA 4XZ9A 3TFXA 5G2IA 1W8SA 1MEHA 3MW7A 2B7QA 4O52A 4BI6A 3EWWA 2QCLA 4OT7A 3DENA 2A0NA 5L6UA 3G24A 5H2ZA 1OHLA 1SQ7A 3NVTA 3HGSA 2V8ZA 3DU0A 1LCOA 1UCWA 1C8VA 3DFPA 4JX5A 5TBOA 1MZHA 3TMQA 2B7NA 1YDNA 4UMAA 4UIOA 3ABQA 4DPPA 1FX6A 4MOZA 1KV5A 1AL7A 1R30A 3Q2DA 3FKKA 4R7JA 4AAJA 2QCCA 2Y62A 2I9EA 2DZPA 3GYEA 1YLVA 4UTUA 3W1AA 3PULA 4HNVA 1KTCA 4WD0A 1IF2A 1F76A 2ZCGA 4TIMA 1D9EA 1LLZA 1RQEA 3G1DA 5CPMA 1XUUA 1H7WA 3SSJA 3FJLA 2TYSA 3UWZA 2YSWA 1I2NA 2I14A 3TH6A 3NYZA 3LV5A 4IMCA 4TMBA 2FB2A 1PCWA 1TPH1 2ZA2A 5FF0A 2A4AA 4LV4A 1RQBA 1KV8A 1SUXA 1A5AA 1VS1A 1VZWA 2ZZ5A 4NJJA 1QWGA 3HG5A 1EX5A 3W1NA 3NM1A 5F4XA 4TU1A 5F4SA 3S5YA 1XFBA 2R8WA 3KXQA 4R53A 2OJPA 2X1RA 4P61A 1F73A 1OX4B 3O15A 3UWWA 3F1QA 1X1ZA 4B5NA 5BMWA 1G4PA 1WOAA 3TNOA 3PAJA 1XBZA 3B8DA 4GUIA 4JTTA 4JTUA 4DO5A 2ABBA 3HQ1A 1EPXA 4NNBA 2FQIA 3M44A 4NQ1A 3W2MA 4CQ8A 4GJ1A 1D3GA 4FX7A 4NT0A 2JKEA 5LNSA 4WQ6A 5LHEA 3LM7A 1D3HA 3W87A 2ZA3A 3TK7A 3G0UA 1UBSA 1EA0A 3HG2A 3PBUA 1LZOA 4FIRA 3LB0A 2ZRUA 4MKNA 1SW0A 1TV8A 5KINA 1YXCA 1MXSA 1S3HA 1K7FA 1ZENA 2A7NA 2ZZ1A 1VRDA 1FXQA 3A24A 3DFQA 3RF9A 3TROA 3M5YA 1JCMP 4N9CA 4UUIA 1B3OA 4UFLA 3G22A 3RK8A 5K2ZA 1W3IA 3W85A 5J5RA 4O8RA 4ICNA 4JTEA 4DELA 3CU2A 4C1LA 1M7PA 1HG3A 2EAWA 3OG3A 1Q6OA 2BX7A 4RZ4A 1Q45A 3B06A 5CPNA 1GT8A 1KA9F 3QYQA 4NX0A 3RU6A 4QM1A 5J5DA 3QZEA 5F1UA 3GDRA 1ICPA 1L6YA 5K4XA 5CZ0A 5EL1A 4FXSA 4A2RA 4O53A 3BV4A 3QM3A 3WK1A 5F2GA 1A50A 4J9JA 3NO5A 1KM6A 3MYPA 2PRLA 3LX9A 4I7UA 2G5WA 3E0IA 3QQ1A 4MY8A 1TTPA 1DORA 1W1ZA 4IQLA 1ZFJA 2V5LA 4RJEA
chains in the Genus database with same CATH superfamily
3DN5A 5A8GA 1FWLA 1JL8A 4ZO8A 1VBZA 3DC2A 1K4HA 4F0LA 1S48A 5D05A 2ZUGA 3IAM9 1JNDA 1TRIA 4FIQA 4TX6A 1A3WA 1YK9A 3WUFA 1WI6A 2G9OA 4CO3A 4I7FB 3HHLA 1I0DA 1Z4UA 1PO6A 3HD1A 1W9DM 2POKA 8XIAA 1UQZA 2RAGA 4AZHA 1W2VA 4IIBA 1UVKA 2WC4A 2XI2A 3IMQJ 1X7FA 3MEDA 4PXDA 1AUSL 2OODA 3B4MA 3CZEA 4D1JA 4J40A 4UOGA 1E6ZA 4ERAA 2YPZA 5TAOA 1QBBA 4F9JA 3SY5A 3UXDA 3E0FA 1QM9A 3N29A 1K73T 1Q86T 4C97A 4L6V3 2HBQB 4DL7A 1LWCB 1YLXA 4JI5J 1V3IA 1S6QB 1D2KA 3LP0B 3KWMA 3OPKA 2G0IA 4LAMA 1WDRA 4QX4A 4F48A 3QHMA 4TYAA 3ZZZA 4F40A 4LUTA 3DNCA 1C4CA 3GE7A 3BZJA 1XYMA 3FYPA 2VIHA 3B4DA 5CPLA 5CABA 3ARQA 4CN4A 2LYVA 1FWSA 4IFVB 1B0TA 5DCDA 2W2PP 1NJWA 1E5JA 3DFEA 4U3CA 2KRRA 2XSAA 2GJPA 3QJJA 3G86A 1TR9A 2GQQA 1UIPA 1FTXA 3KAOA 4QQUA 1UH3A 2EBEA 4IJBA 2QCMA 5LXYA 1BRLB 3NGSA 3TJ4A 3Q89A 4WHBA 4W90B 1R6YA 2RJZA 2C19A 4DR1J 1TVNA 3EDKA 5E0KA 2CDRB 4KFNA 5IM0B 5F8JA 4RE0A 2PDQA 4I8YA 1L5UA 4IPNB 3R97A 1LQ0A 1J0ZA 4UOJA 1JEZA 3PTKA 3CO4A 2RSQA 3M2RB 4P74A 5DBTA 1Q4WA 4OU1A 3T0DA 2BVDA 1EA9C 1H7OA 4U8YA 2X1UA 3ZJKA 4D1IA 2QA2A 2HRTA 2ZRVA 1Q0NA 3BEGB 1OK6A 2UUAJ 2YOCA 4Q32A 4EPDC 5C24A 3USZA 3GG0A 2R9LA 5EFDA 3KJVA 5A8OA 5BCAA 2R94A 1WUUA 4MZ1A 1TUFA 4C1KA 2XGIA 4LTSA 4OBSA 3MAQA 3K46A 4OLOA 3NXFA 3GH7A 1Q53A 4WGHA 3T5KA 1U25A 4QR0A 3H2FA 3PTQA 4G7EA 5GAGI 4KV8B 4ZS6A 3ICJA 2VASA 2B4GA 4HA1A 4ZEPA 1XYBA 2DK2A 2XNQA 3IGNA 4HK6A 2HAFA 2DD8S 4M6QA 1WDTA 2DZUA 3H8AA 4LUIA 4QJ1A 3E2EA 3P82A 1VRUA 4QWAA 4QTGA 2HE5A 5HVHA 2MKJA 2P6TA 4O3QA 3LSCA 1UD8A 2CNNB 3EPOA 1XKYA 3X3UA 4CN6A 4EK7A 2QAPA 5J2PB 2BGQA 1VFFA 2VC0A 4D2JA 4FB7A 3GLCA 2RU9A 4ITSA 3DRRB 4JEQA 1ZL1A 3VIJA 4DJDA 1XQIA 3O5TB 1LUCA 1JGIA 4CLYA 1A53A 3APGA 3G8QA 1X4AA 3H4BA 1WP6A 2AL2A 3GQCA 2HZCA 5AC4A 5FF3A 4J27A 4LUJA 1FF2A 4RDZA 4AWSA 4UZSA 4B3OB 3QWUA 1TFYA 4BWMA 1F2GA 4LCQA 3K2GA 1VQ4S 3B0PA 2IM1A 1CXIA 3ORWA 4O15A 3C2RA 1KGUA 1HFEL 4UTKA 1RTZA 1LWJA 2JF6A 1K8YA 3NQ2A 2ISWA 1IM6A 3CUGA 3DLKB 2QUNA 1H49A 1WI8A 4C7QA 2DXEA 2FH6A 1Y7VA 3BAIA 1HO1A 3VD3A 4FNTA 5AVNA 4J5NA 1TTIA 1G69A 2VYOA 3AFGA 2K1RB 2ZYFA 5JUVA 3L4UA 3RM8A 3S1UA 2DISA 4S3DA 1PX8A 4BDPA 3JR2A 3U2ZA 4E38A 2VG7A 1P7TB 3P45B 4IFKA 3PYDA 2BODX 3BW2A 2IMOA 1GJWA 4J9SA 4RW7B 1VHNA 1JLEA 1LWHA 4ORIA 4PMQA 1V77A 4L3NA 4MJMA 5FEZA 4DLEA 1QSSA 1YQ2A 4KERA 2MJNA 5ETQA 3SZ2A 3CMES 1K6WA 1R6WA 1HLWA 3NAHA 4JOUA 4HGXA 3WD0A 2KXNB 3WJYA 4DQSA 1X9WA 1XPYA 4GZJA 4QPTA 5F1VA 4M24A 4PMDA 3D68A 5JIWA 1CIUA 4F4AA 2NQJA 5D4PA 2WHLA 3BO3A 1S1TB 1J0HA 2YYTA 3EZOA 3OBKA 3NKYA 4JI0F 2H90A 5JBDA 1FNOA 1KHVA 2AL1A 4NAEB 1W1A1 2AIRB 4KGLA 4J91A 3L9ZA 4L4LA 3T19A 4C8LA 2PPGA 4DNHA 1JDFA 3H2VE 4QEHA 5C9RA 4GUFA 1HBOB 3BCDA 2G2OA 2D9PA 2O67A 3TO8A 3TJAA 3WKZA 4CLFA 3CEPA 2E09A 4C11B 2BGNE 1BE4A 1F2JA 4DO7A 1JXLA 4DJED 1X5PA 1CB2A 3F2BA 1JUBA 4IIHA 5A0YA 3GUWA 4LAUA 5EWGA 3DGPB 3BJTA 3WH5A 1UWAA 4DLMA 4GFIA 5IWAJ 3CT2A 5FKYA 3WF3A 5HP1A 4KCVA 1TPEA 2F40A 3ZJ7A 4IIEA 5HVFA 4JKLA 4XZBA 1U6FA 3C6UA 2ZX5A 3CHCA 3GFXA 4KGZB 4KFBB 1N56A 4WXWA 3VKBA 2ZBRA 3K13A 3OBIA 3SSZA 1JGMA 2D0GA 5AC6A 3EKZA 1E4LA 4A35A 2BJ9A 2QA1A 3MVIA 3DUGA 2A3JA 2LXIA 4EYIB 1F5ZA 3D46A 4OECA 1V0KA 3WIVA 3ZTQA 3QMRA 3GC4A 3QFHA 1IBMF 4LS2A 3LCIA 4XIAA 2BSLA 1JMTA 1PZ2A 4K7VA 1Q79A 3MOJB 4XZLX 4B9UA 4GK8A 4G1QB 3TA1A 4DFMA 5IZHA 4O1AA 1XYZA 3P84A 1EB0A 3G6VA 3MWBA 2YKMA 5T7LB 3L0KA 3FHAA 3JQJA 1UOKA 1ZLPA 2PDBA 1OG0A 1LLOA 2ZH1A 4OHQA 3DEQA 1BF6A 2W9BA 1DQXA 4H9TA 3CAQA 3N2TA 4GUJA 4S3AA 3T07A 2OTJS 3FJ6A 4PRRA 4W9TA 4DUZJ 2D24A 3T6CA 2ZDRA 3D6HB 4FNPA 4NYOA 2IM0A 3TOQA 3SW6A 4DWSD 3UT0A 1RJPA 4GBUA 1V9OA 1YBUA 2K8GA 5CSRA 3O6YX 1MG7A 1PUDA 3C19A 5SUHA 4OOZA 4PG5A 2HNZB 1XDJA 2QMKA 2FVSA 2FHFA 2VRKA 4BWLA 3NL0A 3BLIA 1EO7A 5I3FA 3CYJA 4P8XA 2JLGA 4HIBA 4IOAQ 2ATMA 1LG2A 4ZE5A 4DWDA 2SFPA 4I68A 1N33J 5C6MA 1JKHB 5EYWA 3WNPA 4LUSB 3DRSB 3MEGB 4F79A 2WNQA 1HNZF 3UG8A 2HNYB 3LHWA 4MJKA 3W63A 3EDJA 5BJRA 1TKZB 4C6MA 5IFTA 4YCOA 5DCBA 3JAMY 2X7VA 2Y85A 4ATWA 5E5NA 1ONEA 3REQA 1BC6A 4GKJJ 1E6NA 3KBVA 4NLUA 2RHGA 2VGIA 1UR3M 2FY1A 2I57A 2MPUA 2D23A 2WJZA 4DI9A 1T96A 3VYLA 2EFGA 3LHUA 2VWSA 4IH7A 2FY8A 2MZRA 1QUVA 2C0AA 2BX6A 3KHHA 1V6XA 3PN8A 4H9YA 1TU0B 3M5ZA 2Z27A 4IFYB 1H60A 3R6LB 1H1YA 3AYRA 1RAAB 2LEPA 4PMRA 2WK4A 2ZTJA 3KZSA 4DN0A 3VDGA 5EN1A 5ABTA 3L2LA 4GGBA 2CBUA 3H54A 3QGVA 1PV8A 2E9LA 1RT6A 1YJNS 3HDSA 3QKZA 1QNRA 3IV3A 4GISA 4P7TA 3UJSA 3PJ9A 3NNAA 4HKPA 1C92A 5CZTA 1G9HA 4MGGA 2CJAA 1JF6A 4IRCA 4O4GA 3PB2A 3I10A 3GIQA 2G8ZA 3RXZA 1N8RT 1JLGA 3L21A 3N04A 3PNZA 4OHZA 1XRVA 4R5PB 3PY8A 1Q8JA 1XFCA 3DU6A 3UZ5A 1U1NA 4AX6A 3R94A 2DW7A 3D0GE 3THQA 3ES8A 3TW6A 1N2VA 2XYLA 2YQ0A 2YCEA 2UU9J 3SI8A 1R47A 5MLCV 3S5NA 3OYZA 4S0MA 3U02A 1N5YB 3EWDA 1V7YA 5E2QA 2J7HA 4OVXA 4YTTA 4K0KF 4GQQA 3TN4A 2SXLA 1XR5A 3MP4A 2QX0A 3AQUA 5LMUF 5E1QA 3MUIA 3UG4A 1F6KA 2HVNA 2PTWA 3MCSA 2Y7FA 4FBTA 3H7UA 4AZIA 3ITHA 4OYWA 2A1BA 1KFDA 4LR8A 4IJRA 4CLTA 4LALA 4RW6B 2CRLA 5EMJA 2A3BA 1GOWA 3ITYA 4ZPAA 2C14A 4HTYA 3UXAA 5CG0A 1EHWA 1HKAA 1WUEA 2CQGA 1S2CA 2ISSA 3UI3A 5IDZA 3KOXA 2WMGA 1RLCL 2WSKA 2Y63A 1RT3B 3D54A 2O92A 4AMCA 4KH0B 5J2NB 3AA8A 1KNWA 3M7WA 4HVXA 4XD6A 3PYEA 2GGJA 2JFEX 1Z42A 4ZJLA 3ARPA 4YN5A 2LMIA 5J2MB 4ETZA 1F8MA 2YBTA 4LBRA 3DH7A 4ADSA 3CDWA 1W9XA 3N9RA 3LO3A 4HYVA 3CC7S 4W88A 1C9DA 3NPWA 4HTBA 5E5CA 2Z6JA 2CIPA 3TWZA 3KLHB 2VDGA 4GO7X 2GJXB 1REVA 2A6MA 3ID7A 2PCQA 3ABSA 3UYCA 4WR3A 4EKJA 1FWHC 3FA3A 4DO4A 3VNMA 1S99A 2OYLA 2DGUA 1YJWS 4PMVA 3KG0A 5KT5A 1NFPA 2PLKA 3QBCA 3T7VA 2GK1A 3ETMA 3W22A 4EWND 5HROB 2FJAB 1EC8A 1JLBB 4O3NA 4ZIWA 1JZ3A 1Q7ZA 4Y8FA 1XNQJ 3J7ZT 2E77A 1VRTA 3T0BA 2V8VA 2Y8KA 4GRSA 3M8QA 5KG5A 4J9MA 4Z08A 2FVRA 1RAOA 1FWBC 4G7FA 3I9V9 3PM6A 5FL1A 2B9YA 1RHQB 1S5WA 3DDNA 4ERGA 3DRPB 3TR2A 1E4NA 4MF4A 3E74A 3RJXA 1C9WA 3CS2A 1VHIA 4IX2A 4Z42C 2XY5A 3FYOA 5CC7A 1T03A 4XTDA 5BW6A 3RU0A 1S12A 3HHLC 4PG8A 2L5HA 3UCUP 3S9ZA 1KKHA 1J5OB 2AQOA 4H6RA 1TK0A 3LLDA 4MDPA 2J9DE 2MKKA 2MDAA 1X4FA 3G8SA 1ME7A 3IJIA 4UWMA 1IXPA 3QGIA 2W2QP 1FWTA 2GGEA 2VDHA 1PB0A 3BL3A 1FJEB 5KFAA 3URBA 3SDEA 5ECVA 1B4EA 1HL8A 1RACB 3NO3A 3TQKA 3F4WA 3MSDA 3ZFVA 2DSKA 2NQHA 2VOOA 3KL0A 1VC0A 4YR2A 3N0VA 1F3WA 2ZADA 1UWBA 1YNPA 3F4CA 4IMAA 1WC5A 4WFYA 3OO2A 1OFPA 4GVBA 1YYAA 3BV8A 2IPWA 2EVZA 2IDEA 2BRKA 4QSFA 2QL7B 4WK1A 5IOBA 1XM3A 3IGUA 1ZPVA 1W31A 2KU7A 1TPB1 3U2CA 2O4MA 4RK8A 2VCAA 1UP2A 2UZ9A 3CJ3A 1BSIA 1LWEB 4OIFA 1Q65A 3BLKA 3FCWA 1NKEA 4IR9A 1CJUA 5B7WA 3OTCA 2LLZA 1IQ8A 2Z7KA 4OHYA 3W86A 1E3ZA 3E3XA 4C5ZA 1XCWA 4K2XA 3IM8A 3ZZPA 3NGRA 2PDPA 2NQZA 3F03K 5DO8A 4N4PA 4Q8TA 1XLKA 2G0WA 3AB2B 3TIMA 3ZJ6A 1TPWA 2Y8WA 3L4WA 1GYMA 3B8IA 1HJQA 1O1HA 4ZLPA 2EF9A 3NG3A 2CG8A 1PYOB 5A3HA 3VNJA 5BOOA 3UD5A 5C25A 2YFOA 4A8XA 3LPFA 1CNVA 4PPDA 4P8UA 4C98A 3OLDA 2B9EA 1HUVA 4CLPA 2GL5A 5FOOA 2P2CB 2ZUAA 4JDBA 1FNMA 7XIMA 1ECQA 1J9YA 2ZC3A 2LXUA 4XZHA 5H1WA 1KM1A 1E9IA 4YB7A 3I0RB 4FI4A 5FJUA 3DMJA 3BGUA 4GIYA 1E6RA 1GK8A 2MHEA 2YA0A 1NEYA 3W76A 1WHVA 5E41A 4CNZA 4Z7CA 3NQ7A 3CUHA 5EMLA 2J8SA 2BY0A 5MHBA 2JLFA 2YLLA 3CZKA 2J47A 3VZXA 4OV1A 3LOUA 4LBHA 1XLAA 1B4SA 3OP2A 4ZPCA 1ZYQA 1I6JA 1IXOA 2FJBB 2DR5A 4B91A 2PRMA 2VG6A 1CVJA 3TOYA 5C42B 3WQGA 5A8WA 3NZQA 2O9PA 4X0VA 4GI9A 1P6TA 3UGVA 3HZEA 3X1LB 4F0SA 2LDIA 1GVOA 1R0MA 1FH9A 3LQGA 2CKRA 5DG8A 1KWGA 4S3BA 1HBNA 1NDLA 2GZOA 2G0JA 3DOMB 1EP1A 4FPSA 1RAEB 4IQEA 3U57A 2GVEA 3OVGA 3TA6A 4DF1A 1J0IA 3US5A 3DG6A 2CFXA 4RWXA 3JYTA 1A0EA 1VEPA 1YNYA 1T8XA 3BZGA 4JYAF 1NPKA 4DJDC 1VYAA 3PUOA 3W6LA 3G9CA 4CVUA 3P80A 1RHJB 1BQXA 2VBYA 3C6TB 3FX4A 2MANA 2ZRZA 3TW7A 4DL0C 4O12A 4CH7A 2VEMA 1IKXA 4WXYA 1OYEA 4NIRA 2J9XA 4I69A 3PZMA 3N6NA 5AHNA 1EO5A 3TQVA 1M1HA 4HR2A 3M9NB 3IV8A 4N8OA 1NUEA 2RFGA 1D9DA 1JFHA 2XSBA 1H62A 1R3RA 3WD4A 1TUXA 3E0WA 4DX5A 1ELOA 2GQAA 1R8PA 5DJBA 3AHXA 1Q8LA 4MYUA 2C13A 2AYMA 3WK3A 2CKWA 1KWKA 2GGIA 1FWNA 1XIFA 4H4KA 3SO7A 1RWXB 5T14A 3ALFA 4NNAA 3VAGA 4EIVA 5I06A 4CGTA 4DO6A 4DUOA 4FS2A 1G7UA 3G8EA 3R12A 2ZH7A 3KUGA 3NPUA 3M8SA 2ISFA 2CWKA 3K4AA 3M0KA 4KWVA 3ENWA 2XCPA 3OIHA 1G6CA 3GNXA 3MKVA 3V6JA 3PKMA 2CLEA 5L1IA 2XN2A 5A8RA 3CIMA 4J5OA 2XVLA 2A5HA 2VWTA 4W8AA 2C22A 3OBEA 3EGNA 2IPJA 2QT7A 3W7JA 3M0JA 1AL8A 2I9SA 5A2AA 1TIMA 1IKVA 2WMFA 1U4BA 4QGCA 1FKAF 3OTBA 2XYHB 2V5JA 4O0IA 1X7IA 2X16A 1F5BA 4C8YA 4DSKA 3RW7A 3NS6A 6PTDA 3QEZA 4WZMA 3NXLA 3SECA 3JTOA 3IVUA 4KKXA 1IZKA 2R7VA 2XO7A 1NWTA 3ELFA 2PFHA 3C3LA 2KAUC 4DU8A 5B0GA 1ZP3A 1Q6QA 3K2YA 1OQFA 2V5KA 1BVZA 3DI1A 4D6IA 4ZMMA 4EYHB 1NK0A 1ZHAA 3MM8B 5C9XA 2JDJA 5ABHA 4Y2KA 1NK5A 4NJKA 4W92B 3NGFA 1M7OA 3HF5A 5EB8A 1JLFA 1J11A 4JI3J 2I56A 3C4UA 1FRMA 5AHEA 1UBPC 5BWFA 3M9MB 2Z2AA 3HHDA 2DEPA 4USUA 4GA8A 5HAOA 2PDAA 3W7EA 2GO8A 1O94A 1NKBA 4Y9PA 3AIEA 1OT1A 4JQ4A 2DEJA 2BOPA 2Q6ZA 1VEOA 4C3MA 1OT2A 4GI4A 4UFJA 3P14A 5CCZA 2MHNA 4A21A 3TSMA 3PW5A 2VEPA 4YFUA 2FB0A 1SJRA 3HVTB 3N4FA 3DXSX 3UE2A 1VJIA 3QMQA 2KB2A 4P2SA 5L9NA 3VHQA 3GXTA 3F56A 3QYSA 3RPMA 3VO0A 3RMJA 2JE8A 3VM7A 2HXUA 2HQAA 3R1LA 5DCEA 5CYQB 1SM9A 3MM9A 3VDCA 2FB3A 3VAKA 5T9BG 1GEHA 2C2KB 4MYTA 3UERA 5ETMA 3G82A 4EXBA 4L4OA 3WLRA 2VP8A 4USVA 1ADDA 3NYDA 4EX4A 5HWJA 3W01A 1MSWD 4WE1A 1QTNB 2J0XA 2Y5JA 1H7RA 4ZQCA 3W24A 3PO4A 4KIRA 1H0GA 4P8WA 3MHYA 4QG8A 1G7VA 5I23A 3IJQA 2BE2A 1XLDA 4JL1A 5F41A 4B3SF 1Y5VA 4LVNP 2GMHA 4YDDB 1JPHA 3NCOA 3L4VA 3FFIA 1FDJA 2PMZD 1BKSA 1TJ0A 3GS6A 3H4GA 6FDRA 2QYCA 3VV2B 1TL5A 4O8AA 1JXKA 1W0MA 4UQ9A 2F4VJ 1YZ7A 5D3GB 2VNCA 3M6YA 4LYKA 2OPPB 4ATNA 2UXCJ 1S10A 1WEXA 4RPPA 1WF2A 4A3QA 2V5HG 2I5QA 2Z0IA 3Q2TC 1HL9A 3I6TA 3QGKC 2E5JA 5K20B 2FJXA 3FEQA 1DLOB 1U1KA 2W92A 2QMUB 1R27B 4Z1BA 3SUSA 2WSCC 1VLOA 2KYXA 2I16A 2VPXB 4AQLA 3CASA 3TXZA 1EBGA 3GSDA 3NQCA 4DV3F 3TZFA 4XUYA 1FH8A 3K8MA 4XTTA 4S23A 2HFSA 1IKWB 5E6ZA 4DV4J 1DJIA 1UKTA 4Q4OA 1TUWA 4KR0B 3H24A 3AXHA 1PJ9A 3OSPA 4O3SA 1HVQA 4GUGA 1J8VA 1FH7A 3BLPX 4CIOA 5H8MA 2B4PA 1K9MT 4EP8C 2ZXAA 3W7KA 3T5JA 2RF2A 2MQMA 1RBAA 1CXLA 3KHRA 4TX9A 3HGOA 3LCGA 2A10A 2Z1XA 3CWOX 5K3VA 1JIHA 2GSEA 1B9BA 4NZFA 1J2VA 2CPXA 1QPOA 3V6DB 1OIMA 1UUMA 3H5YA 1SR0A 1FJGJ 1RY0A 1PAMA 1EOKA 1VLIA 2ACRA 3E49A 3CJ4A 3DKJA 3QZ7A 4X4NA 2OG9A 2R91A 1C0TA 2MSSA 1Q3NA 2HBVA 2J8TA 4A48A 1U1RA 1FO1A 1QK0A 1HHSA 1RTDA 3M8PB 3U3HA 2VPWB 2W62A 1VFLA 3FBEA 1HL2A 3B03A 1HKJA 2ASJA 2QLJB 3SDOA 1CC8A 4C90A 1W26A 5L38A 5HQEA 1WAUA 3RDKA 3RJYA 1PJ7A 1TTHB 4WY0A 5IS2A 3THUA 2EG7A 1VBKA 1BGAA 4OBTA 5HSPA 1WUFA 1IBKF 4QCEA 4M19A 4QIUA 1FCVA 2B4VA 2G1DA 1AUDA 2QL9B 5E7OB 2DT2A 3AJDA 1R3QA 4IH6A 2DIVA 3TC7A 3CQ0A 3GVGA 5D9MA 2DR9A 2YNIA 4V28A 2DIJA 5REQB 3OT9A 2W67A 2HQ3A 2WZEA 3QFWA 3LRLA 2DGOA 4OWGA 4FKXA 1EPVA 4QYZK 4KGXB 4H9XA 4XAKA 2QJIA 5F3ZA 3CCZA 1JCYA 4NLQA 3R8RA 4LJMA 2DUXA 1S4FA 3GU1A 3M64A 4JTFA 1RAFB 1X4DA 1QNPA 2DPIA 4BF9A 2DCUB 4CNYA 4QU7A 2CFFA 5I0DA 1F7BA 3CZLA 5EX0A 4NAFA 1RK8A 3FQLA 4M5NA 4X4QA 3VGEA 2V0TA 1QK2A 3WDRA 5D37A 3TV8A 1SZEA 4AZCB 4JGDA 1UFKA 1FRLA 2F2HA 2BV3A 3W02A 3QV7A 1RB0A 4J7RA 2D74B 3FRZA 3PNIA 1GAOA 1KN6A 2H9AB 1RWOB 5BNKA 2XVNA 3P5YA 2IYGA 3OFFA 5AXKA 3S6OA 3MECB 2B5JA 5KG0A 3CJSA 3CM4A 2REQB 1RAJA 3A3WA 4KH2A 3H42A 4HHPA 3WNKA 3M8YA 4NASA 3UN5A 1HNIA 1LG1A 1XRFA 4HZ7A 3EJMA 4YYCA 3W7HA 2YNFA 3O2IA 1S5ZA 2E5GA 4OJGA 2GHWA 2CXEA 5H1SV 2V3GA 3WDQA 1I3OB 5DRIA 1TTJA 5AE1A 4RL1A 4IRKA 3EX1A 1EJVC 3NPVA 2VODA 2VFTA 3M32B 3G6XA 4UTMA 4O0ZA 3RR4A 3TN6A 4LR7A 2VD3A 2F9RA 3FMWA 5ECUA 3UA4A 3B9AA 2FHJD 1CULB 1KFWA 2GJNA 2FPYA 2N3LA 1RK5A 4WSKA 4K50A 3OUYA 5DGBA 3NEHA 2A18A 4IG3B 1J0YA 5FI8A 2HVZA 1FKOB 2HHPA 1TP7A 2W2MP 3L7RA 3HKZD 4QR1A 2GLKA 1RDRA 4O1FA 3M0VA 5KFRA 2XSFA 1AQHA 3AS3A 4DV1F 3T2OA 1EKRA 1CI1A 3OODA 4XTIA 1CW2A 1RAHB 4Q7AA 4CQ1A 3LTYA 5DT7A 4D8ZA 2CZDA 1E6VB 3B04A 1CENA 4DF2A 3STCA 4BC7A 2QPUA 1JDEA 3RW6A 4CNTA 4DLGA 4ZCIA 1UEUA 4WOZA 4DWSB 5JJBA 3TC6A 4XPCA 3T8LA 1JXJA 1S1VB 4K4ZA 3UY7A 4WDUA 1XYCA 1R3SA 3ISZA 4WKHA 2Y2WA 1XH2A 3FJ2A 1IEQA 5FAJA 1XLMA 1V03A 3CZ8A 1ZAJA 3C2OA 1H73A 4CCCA 2E9ZA 2ACYA 5KG2A 1A5CA 1UMYA 5HQ8A 2AYEA 4S2CA 1GOKA 1MSSA 4QIVA 3S8HA 4CQDA 4QQBA 5KITA 3NL5A 3INPA 4P2MA 2MZSA 5FJPA 3QNWB 3DBNA 4IKAA 1L8NA 2PMQA 4REQA 2CLMA 3KCLA 1BF2A 3BXWA 4PXCA 2PC6A 2W01A 4DQQA 1PHQA 5M2FX 1XIBA 4OV4A 4KHMA 3LH2S 2XH0A 4W87A 1U0HA 1SGJA 2D3UA 4KIAA 4QIFA 3I7QA 4L65A 2P1FA 3W6YA 1OBAA 2WO5A 3PFRA 2FJDB 4JD4A 3QMSA 2D2OA 1BXNA 3CZJA 3PPHA 3GU0A 3OW2R 4IISA 3BSAA 3OVAA 3UPBA 1ZBTA 4QG9A 3R0KA 1TAQA 3VILA 4F26A 3AWNA 3BGRA 1M5WA 4WP8A 2OD6A 3MR2A 4Y34A 1QSLA 1NQ6A 4DCPB 4AZ5A 2VQEF 1LTDA 1LFPA 2RDIA 1S39A 1SQFA 4XBSA 1HQEA 4A4AA 4ZSUA 4KFPA 5G4WA 1RALA 1UMLA 1ZM2A 2WMIA 1UH2A 4LR9A 3OTEA 3W7RA 4TTUA 2LQ5A 2X1TA 1LT7A 3QKEA 2OX1A 3LGMA 2Z2YB 1CLFA 2VFEA 1VB9A 3DLHA 1QNQA 3N6HA 4UQTA 4C8NA 1F9CA 1AW0A 4QW9A 1JUKA 4ML4A 3ADAC 4MZYA 4F3HA 2AKWB 2BUNA 3TP2A 2A3AA 2DNZA 2JBMA 3KHGA 3TX0A 4JTQA 4YB1P 1EYEA 4JI0J 4P7NA 3UDCA 1DRZA 1VEMA 4LRTA 3DDKA 5HUPA 3UY8A 3DFTA 3KZPA 2DY1A 2MKYA 5SZTA 2A3LA 3T2PA 4EBEA 2D2GA 2WBKA 1EP4B 1DYSA 2NWRA 1E6YA 4GQ0A 1MNEA 1S6PA 2LXFA 3BAJA 4WVXA 4XZWA 1YIXA 5M17A 3VX1A 3LRKA 3GRIA 3WQWA 1BKHA 1JXEA 1TKXB 1GVFA 5TF0A 1S79A 1Y7PA 1XLFA 2RDTA 1EHNA 4YHEA 4IO1A 3C61A 1FD8A 2W9CB 4Q7NA 2YX7A 1BG9A 4I2PA 1HR0F 5A6BD 2I17A 4DRSA 2GIRA 2HMIB 3O63A 1FY6A 2CPEA 1YVFA 1U45A 3R2GA 4OIXA 2QMJA 2E6FA 3KDNA 4LSBA 2GJFA 4OX6A 2IJNA 4QDPA 4FSAA 3W53A 4OX9F 1FRHA 4K1WA 5AE2A 1UJ5A 2PDLA 4HACB 2JQXA 3AYTA 2KO1A 4WKAA 2W4CA 4CT8A 4J3TA 4QNWA 3TEVA 2MQQA 3QF0A 3RRGA 1JRBA 2PFDA 4P52A 1IBMJ 4UTGA 4LB4A 5AYBA 4QJ3B 3PZUA 1S4EA 2PA3A 5IV4A 1WKDA 4DF4A 3ANYA 7A3HA 1RA7A 2XYPB 1VH7A 2HFOA 3EDRB 3H2UB 2XVPA 3Q8PB 4B15A 3IIZA 1RJQA 3MPDA 2PTYA 2VGBA 2XHWA 1CXFA 3TYBA 2WK2A 3MB9A 3H2OA 1UWSA 4KWOA 4GYKA 1EJTC 3N2OA 1HXJA 1Y3JA 3QSRA 2V68A 1WC4A 3CB8A 2C2DA 1LROA 1X9MA 1E6XM 2WJFA 1F0XA 2J8AA 4O1EA 5CZKA 4BS2A 3P8IA 2W91A 4WXZA 4KC5A 2NS1B 4PTMA 4RDWA 4E2DA 2C1GA 4GBDA 1YGYA 5CC5A 2GQ2A 3FKRA 1Q6RA 4BBYA 2GUYA 3GJTB 4E8GA 1LK5A 5AJ3F 3LBOA 3WNLA 1RISA 4GC7A 4K5RA 1O6IA 2ZBTA 1H98A 4K1GA 5CAHA 4BCAA 4AISA 4LRFA 3GIIA 3U6WA 1CSJA 3TAMA 2DVIA 3MPVA 3NGUA 4EPEC 1JLQA 1KO0A 1B1YA 4H83A 4AUKA 2JLEA 2QMXA 3M1VA 5J2QB 1VC4A 1QAJA 1QW8A 2E9TA 2F1FA 3MM7A 4LRDA 3OZOA 1QVGR 2BR0A 2Q43A 2WBRA 2WZMA 2W7OA 1GVSA 4MJ2A 3W5YA 4DZ6A 3MMAA 1HNZJ 2NR0A 5BXSA 1XDMA 4KHPF 4AB4A 5FEWA 1OY0A 3CQHA 1WTBA 4ZP9A 3RLVA 5A2QY 2IA0A 1J2BA 4HHLA 3TVKA 5DMLA 3HB9A 3WD1A 3FYYA 1T5AA 4Z2IA 2VC6A 1HWLA 2OJ3A 1FFQA 1QPQA 5K14A 2LU2A 1K0TA 1HN1A 3DZ1A 3AJXA 1MMFA 1UC4A 4KS0A 1S0NA 3TN5A 1W1YA 3DI6A 4A29A 3QRRA 4BHYA 5I78A 2HZVA 3AMLA 5C71A 4Z2KA 3CTLA 3DDMA 1NDYA 1N5VA 5M1TA 4IPIA 3D47A 4L64A 3PCOB 3W70A 3PFOA 2QE5A 4GQGA 4E0CA 2QSWA 2WLYA 3UO0A 3LLFA 3CPWR 3EA3A 1E73M 4MAKA 3F2DA 4IOTA 1TX2A 1KR4A 1FQ0A 3IA0A 3KJFB 5L9XA 2OH2A 5GADU 2BY3A 4C1NB 3WY1A 4TVDA 5HOSA 2C6QA 3VGTA 1PVNA 3H2AA 1TL1B 1OYAA 2OO6A 1HMVB 1Z69A 4YR3A 1NQKA 1I6NA 3F5JA 4I7FA 2O5DA 4LC8A 4KWSA 2G95A 3IG1B 3WK2A 1XMOJ 4NLRA 4XKYA 4JIIX 4J4KA 3TXVA 3CPGA 1JQGA 2D1CA 3WLOA 3SQLA 4MFEA 1HNXJ 2XTJP 3EX3A 5IC6B 3HD2A 1IQTA 2HRWA 3DYMA 4LIRA 1RWVB 1FRIA 4PCNA 4FNSA 3NBPB 4X2RA 2WVCA 4K0KJ 1P43A 5F8LA 5D4OA 2GQ3A 4ZP6A 6A3HA 4QJ4B 1HO4A 4ZB5A 3WNNA 5KT4A 4TXSA 5LMUJ 1JZ8A 2CC0A 4OZ2A 4EI2A 1S6QA 1OZMA 1LXJA 2AKMA 3ET6B 4L9XA 2IKJA 2O55A 4GFSA 2V2ZA 1NOWA 4N41A 1ZBKA 5HR7A 3ZTPA 4IFVA 1C1CA 1TAUA 1WORA 2MTLA 4M5IA 4YP3A 3AIVA 4LVFA 4AIBA 3LTSA 3G2XA 2BKPA 3BKUA 4RU2A 6CGTA 1SL0A 3A8JA 4TVAB 2V4RA 2GOKA 2B8PA 2DH7A 1S2VA 4DS4A 5DQHA 4FNQA 5CPTA 4JEJA 3T0AA 3FGVA 4TOQA 3R5BA 3URAA 1BRLA 3DHXA 4NI2A 4RBVA 4FLRA 2W7AA 1GMWA 4FF1A 5JXQA 2VZSA 4CD7A 5J04A 3AS2A 2G13A 3CQIA 4PB5A 5A76A 2CHNA 5IM0A 3TNBA 4XZMX 3RCYA 4FF3A 4XB3A 3KBMA 2M8HA 3ABXA 1XLBA 1WAWA 2ABAA 4DBSA 4P71A 2PDJA 2FDMA 4AU0A 3OPSA 3CV2A 4NRRA 2AMCB 2VPZB 3KOWA 4WKFA 4PQUB 2J7DA 5IRPA 5H6HA 4YJ5A 5K8NA 1RBOB 1XNRF 4DX6A 4YNGA 3LMYA 5K9DA 3R7SB 2QVHA 4TLQA 1YTEA 1FE0A 1OGBA 4X4UA 1W1PA 2OPJA 2ASLA 3U4FA 2Z2BA 2AX0A 1CT5A 3EPIA 1M3UA 1LRQA 3CV1A 1YJVA 1GTEA 2GV1A 3GB0A 4WCEQ 1S2TA 2V5BA 1PIGA 4Y2CA 4IDKB 5B7YA 1NF0A 5E3QA 3RAQA 3GH4A 1W3KA 3CJKA 3U8GA 1GFWB 1SC6A 4MLRA 2DNNA 2Q79A 1QUPA 3KUMA 4DYJA 5D2XA 5AYXA 2DRAA 4ADUA 3EA2A 5EKYA 3O0KA 2VZVA 2J0QD 1U2FA 2X7IA 1B7FA 5BMXA 1VDHA 5GAHI 1V3RA 3TFXA 5G2IA 3LPPA 1MEHA 2B7QA 3ECQA 2VKRA 2VBWA 5KOXA 5L6UA 3I4HX 5H2ZA 1OHLA 3CXCR 2PP0A 3AXIA 2DHGA 4M3PA 1RTJB 3SV4A 1P0EA 4KJIA 5GNZA 4E8DA 4B3OA 1UCWA 3HHKA 4ED2A 2WHOA 1U1QA 4PRFA 3THPA 4DL4A 3O0FA 3UZZA 2GS8A 3K1GA 1A5KC 3PZOA 4PBEA 2H4YB 4CYUB 4DPPA 1FX6A 4MOZA 3ARVA 1NK7A 3FAXA 9XIAA 2DJWA 3D28A 4EMDA 1IYXA 1JZ6A 4N42A 4R7JA 4Q22A 4KSEB 4AAJA 1P0DA 1UZHA 1U33A 1SL2A 2OGUA 4WIIA 3NFUA 2OKOA 2AMGA 2K1RA 2QCCA 4BF5A 3GV7B 4ZVPB 2DZPA 4UTUA 3PULA 3IBFB 3AHPA 2Q01A 3IK2A 2QLYA 4WD0A 4ZOBA 3AU6A 1ZM4A 1IF2A 2QV4A 4ROQA 3VX0A 4U7UD 4CU8A 2HXTA 4YY3J 1FXLA 3KW3A 3G1DA 4ZO7A 1H7WA 2TYSA 3RBXA 1Y5LB 2YSWA 1VIZA 4LBUA 1R9ZA 1BQCA 3LK6A 4NLSA 3NYZA 4IMCA 4NXNF 1S9EB 1I60A 4LV4A 1VZWA 2V5DA 3K8WA 3FEYB 3AMKA 4NJJA 1QWGA 3HG5A 3W1NA 1DHKA 4DN1A 4FF2A 3ZM8A 1NOUA 4NYPA 1NOFA 2R8WA 4QCLA 2NZ4A 4R53A 2DNGA 2IVMA 4P61A 3VOFA 1OX4B 3O15A 2HFUA 3F1QA 1Y4ZB 3RILA 2ZUWA 4DPWA 6REQB 2XCAA 4NAEA 4DCOB 4TXEA 1VS3A 1UKPA 2BYCA 1YX1A 5GQBA 3MUZ1 3I6EA 1FFSB 1QDUB 4DO5A 2ABBA 1RT5B 4CNUA 1M7XA 2PLMA 1HBOA 3P96A 3I55S 3W2MA 1CXHA 3JAMU 5K8PA 5HJXA 2ZNYA 4HSHA 1T9XA 2JSXA 4C11A 4NT0A 2JKEA 5HNTA 4WQ6A 2AW0A 3WL0A 1LQ2A 2UVVA 5CBJA 3W87A 1S6OA 2N3OA 2ZA3A 3TK7A 1DWJM 3G1RA 4PXBA 1EA0A 4C6EA 1UP0A 1LZOA 1CJVA 1K4GA 4MKNA 3THVA 1SW0A 2HRYA 3QQWA 1FKPB 1SPBP 1XRSA 4U33A 4JYAJ 1YXCA 3VTRA 4K4YA 1HQUA 4JV0A 2RHQB 3SCUA 3MMBB 3RAOA 1V08A 2DUZA 2RQMA 2W2NP 3DFQA 4RE4A 2A2CA 3TROA 3EOOA 4RE3A 4U6PA 4ENLA 2CJBA 4FF4A 4V33A 3HZGA 4TN2A 5A8QA 4UUIA 3CAWA 4DPYA 3G22A 1ZA2B 2ALRA 2OMLA 3DOPA 2UXDF 4O8RA 4ICNA 3U7VA 1RHMB 3NGKA 4DELA 1V7AA 4H9VA 4C1LA 2VHLA 5RUBA 1KBRA 2B43A 3T1AA 4GHRA 5IDIA 3LUYA 3C15B 1X38A 1Q45A 4G1QA 3B06A 3TQEA 1E72M 4E2FB 1IQZA 3I96A 1OCJA 1JJ2R 3PJXA 4FS1A 1XH0A 5H8PA 3QYQA 3DRYA 4R9OA 2WOMB 1GX5A 3B8VA 3OQ8A 5J5DA 3QZEA 3SCIE 1ZSXA 4DL2A 3GJSB 1ICPA 2WMKA 4Y9MA 3BOLA 2DR6A 4WXOA 4AD2A 4FXSA 3P8BB 3F2CA 1B3VA 2GVZA 4Y7EA 3LX9A 2G5WA 3E0IA 1JF5A 1OADA 2A3HA 2DQWA 2WVDA 1XW8A 4IQLA 1DURA 1ITQA 3DM2B 2PBOA 1FJCA 4H1ZA 1C91A 2UY5A 4BC9A 2P0IA 3OHAA 3Q86A 5I42B 3O3RA 2HNZA 2HNHA 7ENLA 3W84A 2CJXB 1L6SA 1X4HA 4DV7F 1SJCA 5CXPA 2XI3A 3EXTA 1XHGA 2GYIA 1QY7A 3I4KA 1EQ0A 1V5XA 1JCTA 1TV3A 1S1XA 4LUSA 4Q8UA 4W7WA 5HINA 2G97A 2ZM6F 2O1PA 1ESWA 5AKQA 3VAVA 3H23A 3WQOA 3UG3A 1S6UA 2HNYA 1QAIA 4LFBJ 4FVCA 1FWWA 1TR1A 5IT0A 1URRA 4X2PA 1TKZA 3EWUA 5FDLB 1UVJA 2O9RA 1MZRA 2HKEA 4E8CA 1GORA 3C5QA 4WF7A 4FDFA 4IGSA 4GH3A 5CXTA 3AH6A 3V7PA 4JI2F 1CB7B 1DQWA 5CCMA 3W7BA 3PUEA 5FA5A 4CNPA 2H3EB 2VCBA 3EDFA 2ISVA 2VFRA 4PULA 4DR3F 4QROA 1CGVA 3N25A 4IFYA 3GD6A 5U7SA 3W0KA 3J7Z5 1KRCC 3S47A 1Y3KA 4X65F 2UY2A 1QHPA 5LNUA 4OV9A 4Q8MA 3M46A 3DKDA 3KLFB 3QW4B 2K3KA 1OMSA 3PW4A 2RHSB 3BN7A 4DIAA 4NL5A 1X4EA 3CAKA 4GPNA 1K3UA 5C2GA 2YQ3A 2UVWA 4B5SA 4RNNA 3QJLA 5LL6d 1IEWA 2ZVIA 5D2YA 4LX4A 3WLTA 4URSA 4MJZA 3UVJA 4FLSA 4X61A 5D0RA 1G94A 1ZZFA 1UKOA 1UFLA 4A8NA 2HG4A 2EKCA 3PVXA 2YZ5A 2AAAA 1JB0C 3ZWTA 4R5PA 2PDXA 3GJQB 2XJ7A 1TFVA 3VIPA 1SH2A 3NNCA 4S1FA 4L1GA 3GIRA 3GDMA 5GJMA 1VQYA 3LHTA 3CLWA 3VZYA 4Q8PA 2YWFA 2ZD1B 2GJLA 3ZLFA 1N5YA 2J9YA 4CO0A 1D8WA 3KVLA 2RS2A 2DFAA 3WC2A 1JNRB 4KESA 4Z37A 3HULA 4EACA 1P4CA 3G1XA 3EXCX 1L2UA 3IS4A 1IV8A 1F4HA 2QV5A 4A8MP 1FI4A 2ZHBA 4NZ5A 1XWLA 4B3SJ 2K06A 4CLZA 3G4SS 2RJGA 4KKOB 3EWZA 4MKBA 5TQLA 1C8QA 4YWIA 4ZKAA 3MM5B 3CCES 2QGYA 2ZWYA 2WKLA 1HW8A 4KY3A 1WSVA 2QCFA 1KQZA 1ITUA 3GIMA 3UDEA 1DAXA 1RVKA 1YXYA 2UXBF 1RT3A 2LVWA 1GHRA 2ZUNA 2PWUA 4O44B 3ZC4A 4PUMA 3DAQA 3HF3A 2EPLX 2XZ7A 1ZETA 3M43A 5I03A 2YNHB 2YW3A 3FS2A 4L76A 4FX6M 3VQSA 3W2NA 3SYZA 2JWNA 3NOCA 2X40A 1T11A 1GQNA 1NIUA 4HNOA 1TWIA 3URNA 3SQGB 2XG9A 2NUXA 2AJ0A 4DV3J 2KYZA 3NA8A 1RTHB 3ANVA 3AIWA 1EHAA 1V0LA 2OT0A 2NLIA 3QSIA 5KFTA 2X2YA 5FLXY 2E6YA 9XIMA 1CJKA 2GHPA 4Q8VA 4DF8A 4OZ5A 2GJXA 3VXGA 1SC1B 4MWAB 2C3MA 4EUVA 2OXNA 4QJ5B 3NQ6A 5EMUA 5AXLA 3EWGA 3ZVHA 2GW8A 5LXEA 3BANA 1VBJA 1ZP4A 3IJ9A 4NI3A 1Y8BA 3VOHA 1QAXA 4M7SA 2FZGB 3M30B 2V30A 1C4AA 2RUSA 2PWVA 1FP9A 3A9IA 2XBPA 3EICA 4IHCA 4QDMA 2AEMA 2OCZA 2A3CA 1JLBA 4LYPA 1PC4A 4OTKA 1ZOTA 1NU5A 1BWVA 4UXDA 2BVYA 1T8QA 5G2HA 1JD9A 3PX4A 5CBIA 4ZHRB 4R33A 2WCXA 2J75A 3FCPA 3CW2C 3T0CA 3DRPA 4DBEA 1UJPA 2HVOA 3B4UA 1BY9A 1IWPA 4M1RA 1YHQS 1XYAA 4NHVA 2Y89A 5I09A 2PMHA 2OOFA 2IHR1 2VCCA 5BYRA 4RX0A 4GVGA 1OFDA 3RO6A 1H63A 1J5OA 3ATZA 1SI9A 3OR1B 2V67A 3EXYA 4ALDA 1E5NA 3VKCA 1OFEA 1W5MA 1IGSA 1Y0EA 3WLMA 2Z2UA 4PUWA 3TUJC 4PTWA 1Y5WA 5C7HA 2KL8A 3DFNA 2PDIA 2AEFA 2CG4A 3B0UX 3G2GA 3VCNA 2I1RA 1K0VA 2QCHA 2FGZA 3SM0A 3TCEA 3M5XA 4FALA 3ITVA 4UZUA 3HURA 1V6YA 1KXTA 2ERRA 3L09A 4PKDB 4ECYA 1KBLA 2C71A 2CQHA 1UUQA 3CVKA 3ZSSA 4J9KA 3GSMA 4MIAA 3VABA 3LPGA 3TYTA 1G4CA 3GDLA 4EPKA 2CLFA 3NLCA 2YFNA 1LWEA 4HD5A 4O0NA 2Q3OA 3JB9k 3KLKA 4C60A 4O1BA 2BJ8A 1KDNA 3IAQA 3D6MB 5KFEA 4PTVA 4ZQNA 2UUCJ 1NAL1 4PMOA 4I1TA 4LQ3A 4YXGA 5I6SA 5M03A 3K8VA 4ZIVA 1NB2A 3NMAA 1EIYB 5E3AA 1EJWC 1UOZA 1TRDA 5C9WA 2VJUA 4JI7F 4F4ZA 2EFOA 3HSZA 4L1XA 5G4EA 3HA1A 3LGNA 2FUG9 1FESA 3V4MA 1QWKA 3L2MA 4GACA 4TO8A 1NDCA 2DXDA 1EKSA 3HJEA 2DT0A 2HNEA 3H90A 3ULHA 2DCLA 5CD4H 3P62A 1R9XA 1PG5B 4DI6A 2WSYA 3PYFA 3RCMA 2D20A 1W9PA 2Z1KA 2GFTA 2HHQA 3IIOA 3VC5A 2QLXA 1Q16B 1T6MA 3AJ2A 2HWTA 4ECUA 4IMFA 4GC6A 5E33A 4HYKA 3L2IA 2YL5A 4M82A 1FDAA 3PRDA 1ADSA 1NWUA 5IQQA 2HBYB 3LDVA 5EUHA 4URGA 4U5IA 3T9PA 1TG7A 1WOSA 1E0VA 3B8WA 4ZMGA 4ONVA 4ZA1A 1HWKA 4O1DA 3MUXA 1WOOA 1V6UA 3J7AN 3TEHB 1SKSA 5C42A 1LQ9A 1IZJA 5AHIA 4ATDA 3HM9A 4IPPA 3WDIA 5JUMA 2BRLA 4JX6A 4I9JA 4A8WA 2XM1A 4DV1J 4IRDA 1MW0A 3NEVA 3IR6B 4FPIA 3BO9A 3LBMA 4NCGA 2E1CA 3DOMA 4XO0A 3VE7A 2LEBA 2E5LF 5LOQA 1SMDA 1FWJC 4HI2A 5ITHA 1JQVA 1TELA 2A79A 3AMDA 4JIEA 1TX0A 6FD1A 3GP9A 3SUTA 1T41A 3EB4A 1E0UA 2WW8A 3PJWA 1RUSA 1RT4B 4A8LA 1OEPA 2MJUA 2WNWA 2B31A 1X4BA 5LGXA 3K5OA 1AFJA 4FBUA 3GNNA 3OVBA 1Q6GA 4BJHA 4B5UA 1TMMA 4X66F 4QS6A 2BHYA 3WDPP 3KK2B 4WK3A 1DIKA 2YQ1A 5HMYA 1KLNA 4PYAA 4E8UA 2IKGA 1HJSA 4K8HA 1YJUA 5A6PA 1DZ5A 4JCLA 5DXXA 1NP0A 5F2LA 4S2BA 1JZ4A 4US5A 3UNYA 3G1AA 2JKPA 3XISA 4DZIA 1LYXA 2OVLA 3OL7A 2PURA 3CSKA 4WZQA 2G3JA 1JDCA 3ILIA 1RJJA 4Q8FA 1IJFB 1ZCOA 3V5FA 3E96A 3BGJA 4F2SA 5DFAA 1RAGB 1ZS6A 4P7OA 1JDAA 4AXIA 3S42A 2EBNA 5GMKa 3MUMP 5HULA 1VK8A 2J74A 4JIHA 1VP5A 4BQ2A 1CGXA 2L9NA 5JXSA 2BB0A 4O18A 1RGVA 2MMYA 3QO9B 3IJ8A 3LALA 5D38A 4ZBCA 1ICEB 3KG4A 2D0HA 3DLEB 5L39A 4AHPA 1UW4A 3W73A 4EVZA 4NXKA 4MB4A 5AVHA 1Q8KA 3CL7A 1BYDA 2C2RA 3WJWA 1AJZA 1X98A 5A94A 4XDDA 1ICQA 1HBUB 4DV6F 1X39A 1HNVB 4H8UA 3CJ0A 5CYMB 4J9PA 7TAAA 2X42A 4QZVB 5I3IA 1BFNA 4OYMA 3G8TA 4WUIA 2BANB 4CU6A 3M16A 3FA4A 3EPMA 2WLZA 4ECSA 1S2WA 1U83A 4QR2A 3S5OA 4Q33A 1ONRA 2CETA 1PBUA 4C6PA 3UJFA 3OLAA 4X3ZA 3CD7A 3UCQA 3CQJA 3WQCA 4ED4A 3MM8A 6TIMA 3TA0A 5KFWA 2D22A 3NR0A 3TX8A 2Y5EA 1U2CA 5BWAA 4NEYA 2R1KA 3WX8A 1V79A 3ISIX 1UKUA 4UY85 4JTSA 5E9XA 3H55A 2YNGA 3CD0A 2X1GA 3C2PA 2WKGA 4NZ6A 3O7UA 2IXUA 1PTGA 5JH2A 2PWGA 5HPOA 4FNHA 4NMLA 1JYWA 4ERDA 2FLIA 2O4QA 5FD0A 4NZ3A 3B0XA 2XM2A 3A21A 5LJ3Y 1FWFC 5ETSA 3JSBA 1FK9A 4JTKA 1CQMA 2CZVA 1QO2A 1UL3A 5D2VA 1XLJA 5XIMA 3R7MA 4R85A 3N3MA 3J7A1 4PL1A 3EEZA 4JTDA 1JYVA 2H8ZA 1E0XA 4E4FA 1LWXA 1UKQA 3OVQA 1HR0J 1F4AA 2HHHJ 1AQ0A 2PSNA 3SGGA 1YRRA 3SADA 4NXMF 3W23A 5KFMA 5HWMA 1O95A 3BUVA 3OHIA 3OLGA 4UR8A 3TR9A 4DI8A 3CHDA 4NU7A 3PF3A 1SO3A 3EX6A 3KHLA 2QLWA 3WF0A 2N7YA 4GYFA 8CGTA 2J78A 2Z28A 2MKSA 1GMWD 1BWEA 4OX9J 5HPCA 1HT6A 4EF9A 5EWEA 3BC9A 2VX7A 3MBFA 2ZDOA 4DXLA 4FO4A 2LQ8A 3W2WB 3D2WA 5L1LA 3IO1A 2Z26A 4K6AA 4KYZA 3G6MA 1PKMA 2LQ9A 4KAIA 1VHCA 3C3UA 3DHDA 2CQ1A 4ECQA 3OV7A 2GDUA 1AJ2A 1W9VA 2GOUA 3MR7A 4DV2J 2W27A 5DDQC 2QQ6A 4A8QA 3AO0A 2V5CA 3N3TA 2PE8A 1XR6A 1HQTA 2D3ZA 1KM4A 3I32A 2QJGA 3CGTA 3SCPA 2XC9A 4ZSTA 2DNKA 4H2CA 1GG1A 4LVGA 3RM4A 1WJ9A 4PYSA 1HPZB 5C9UA 1I1GA 4QFUA 4DG1B 2EGZA 2ZOFA 3PBMA 1SFSA 3H0PA 2OPPA 2XDFA 2BM1A 4PWDB 2HMCA 3GSIA 1K47A 2YJQA 2XFYA 3CC1A 3KFWX 2DNLA 4C6JA 1XSKA 2K7KA 5AJ3J 2Z1BA 2ZJPQ 2R14A 3BJFA 1RSCA 1TV2A 1AW5A 4L9ZA 1I4NA 2V3DA 3MI7X 2IC3A 4HT5A 1AJ0A 2IJFA 3D9BA 4RNJA 4X64F 3AAMA 4ZP7A 1P1XA 1WXYA 4ZK7M 3RB0A 3DLJA 1OINA 1KXQA 1XTZA 4RLIA 2L08A 3BSGA 1YPFA 4C5YA 3IBCB 3A47A 3OR2B 3GHTA 4LWWA 3H5UA 1LL4A 4NZ7A 1G01A 2Y5SA 1VQTA 1T3OA 1NEEA 2Y1HA 4J3VA 2DZTA 3C86A 1MDRA 1PSDA 3D1QA 3FDKA 2E3ZA 4JAWA 5IM51 4ACZB 2Y7EA 3HFTA 2OX4A 2E4TA 2PDHA 1YDYA 1MEWA 3NOEA 4Q4KA 1EOMA 1VOMA 3SCOA 4KHPJ 2XMMA 1EFZA 4M29A 1WZAA 3VKAA 3V6DA 3WYZA 2A0FB 1OC5A 4JV5F 2PDUA 1L8PA 3T6JA 1Q5VA 1VD6A 3DYAA 3BBBA 4IM4A 3CT7A 3EMTA 1N6QB 1QPRA 4O13A 3MV11 3DHFA 1OYCA 3GO2A 3FGCB 3VNIA 4ZLJA 3R5AA 3PZNA 1S7IA 2LECA 1J10A 5JBFA 2UZAA 3M8PA 2H1YA 1ZNNA 4KEVA 1LORA 3UCCA 5A6JA 1TCMA 5A6WA 3M2UB 3KOZA 4PZVA 1KSPA 2CJKA 1G4SA 3QRQA 1UD4A 2GGPB 3VAMA 3POCA 2XIQA 3FEMA 3VCRA 2RRAA 3CD5A 4GG9A 3UR8A 1NM9A 2CQ4A 1S3TC 3PZQA 4W8BA 1H50A 3W9ZA 4LF7J 1O68A 1XSIA 3M07A 4RW8B 4MPKA 5G1YA 2G1HA 2ZWOA 3ABZA 4X4VA 3SY8A 2LCWA 1KS2A 3KK3B 3IUHA 5G4DA 1DXEA 1PKUA 2XY7A 2A7PA 5KFIA 2RS8A 1FDZA 1S2AA 2WV8A 3DBPA 2VFSA 3VNYA 4TYBA 3C16B 3GNRA 3WBEA 1DKWA 4ZVOB 1FUYA 1M5OC 2HQIA 4B90A 1V6WA 3M0IA 4DR2F 1UFWA 2AT1B 2HDJA 2CNLB 4LPCA 4ICLB 1YADA 3H70A 3GH5A 2GAGC 1FVSA 3W3OA 1B90A 2INZA 1AH0A 3H22A 2VR4A 4AIUA 4GYPC 1NMEB 3O3LA 3J7YU 3WMSA 4DPUA 2DHAA 3NGJA 3G3MA 1RD6A 4H4MA 4DXXA 2J24A 3KRSA 2XMJA 4LSNB 4H00A 3E6EA 3GIJA 3LNMA 4AZCA 1CG2A 3CTTA 2PDCA 3FSTA 3A3HA 1QW7A 1N54B 3STEA 3RG6A 1PIIA 4ZPTR 1TKDA 4FF7A 1FDNA 2Z29A 1XYLA 4JYFA 4YU1A 3MECA 2REQA 2EHHA 2WQDA 5JMUA 3N9KA 2GQ8A 3HOJA 3W1RA 2EJAA 1P48A 3THAA 1T05B 3VGGA 3BWWA 4KFOA 2Z57B 4UTJA 2DY9A 4U96A 1ZALA 4Z2JA 3CWJA 3J80Y 4PYDA 3AHTA 3OTRA 5KFXA 4PCTA 3SZ8A 3MDUA 4G65A 1A5MC 3M32A 2VA2A 4FHAA 2NXJA 2H5JB 4OYIA 3R43A 2ZKTA 2VZUA 2HAIA 4KRWA 4QJVA 3AFBA 4CQAA 1U2RA 1KVKA 2ZZ3A 3RLHA 1EDGA 1RZMA 2DSZA 4O10A 1JFXA 5ETNA 1SC4B 1AD4A 4MLJA 1DV7A 1CULA 1LW2B 2OZ3A 2E5DA 2GVJA 5DN1A 2X2GA 1LBFA 4M5DB 1RTIB 4X84A 2DDXA 4Q45A 3MU7A 5FAGA 2R7UA 1FKOA 3BURA 4RUBA 4FX8A 2QJ3A 3GBDA 2CPJA 1R86A 3GG1A 3HHEA 1K9EA 3QH2A 3KBJA 3JSMB 1Q2SA 1WG5A 3L7OA 1WHXA 3R1HA 3HJVA 4Y28C 2PWHA 4MIBA 5CG7A 3VGVA 1KKOA 1B4KA 3GTIA 1WDQA 3WMCA 3AISA 4PTNA 2TMDA 1FXDA 3USBA 3DCAA 3IR7B 4WP3A 2KG1A 4CZCA 5C70A 4QYRA 2P9CA 1A3XA 2XIJA 2QC3A 3J81U 2FZ8A 2CBJA 3KLIB 2H54B 1TZ7A 3AQOA 3BOXA 3HO8A 3EDQB 1RP8A 2V38A 3ENLA 3KP1A 4DWSA 5DQGA 4TKTA 4GX9A 1S1VA 3KJNB 4XX6A 4XAFA 3CDEA 4HYWA 2FDNA 4V1Ak 3NQDA 5I3GA 4L75A