4GRSA

Crystal structure of a chimeric dah7ps
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
333
structure length
333
Chain Sequence
MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVESVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDISAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospho-2-dehydro-3-deoxyheptonate aldolase, 2-dehydro-3-deo
publication title Engineering allosteric control to an unregulated enzyme by transfer of a regulatory domain
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 106
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18152 DAHP_snth_FXD DAHP synthase ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4grsA02
3.30.70.1140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phospho-2-dehydro-3-deoxyheptonate aldolase; domain 1 4grsA01
1QPOA 4MJMA 1JJKA 2A4AA 5KSWA 3CLMA 1K8YA 5KITA 5TQLA 4R34A 3KAOA 2ATSA 4ZQNA 3S6DA 3W7NA 2VC6A 4LVAA 1TV8A 2C3ZA 3KFTA 2WV8A 4I7WA 3ATYA 3SZ8A 1SU5A 3B4UA 3NA8A 1F2JA 4BFAA 6TIMA 4JTTA 1ICPA 4YCPA 3GKAA 5F1UA 4UTMA 1MO0A 2ISVA 3L68A 3T7VA 3M6YA 3ZFHA 1ZAHA 1OFBA 1P5BA 3EX4A 3NQCA 3TDFA 1K8XA 1W5MA 5I3FA 1WDWA 3M7WA 2F84A 4XZ9A 1TREA 1TPH1 4JEQA 3RFAA 2X1TA 4HNVA 5D32A 4JDBA 4JY8A 2WSRA 3MYOA 3NO5A 4ORMA 5D37A 1FWTA 1QPNA 5DELA 4UTUA 2ZZ7A 3PVFA 1WA3A 4ZQOA 3QC3A 2CLIA 1XKYA 4LS0A 3O6CA 1LBFA 2X1SA 5FF0A 4ZZ9A 4TR9A 4FXRA 1JCNA 3LGEA 1AMKA 4FX6M 2WNZA 1LRQA 1D3HA 5E1QA 1SO5A 4XTIA 4XKYB 2ZRZA 1M6JA 1G6CA 5BMWA 2PCQA 5EKYA 2DZWA 2DJXA 3GYEA 1JCLA 1FQ0A 3LERA 4ZL1A 2EHHA 3GDRA 1LRNA 3FYOA 5AYZA 4A2SA 5FEXA 4CNPA 4LY8A 3C56A 2J6XA 3L0GA 4ZQMA 3CHVA 4KFPA 2W79A 1I2PA 3V75A 3C4UA 3R2GA 5U4NA 1VHNA 2VKZG 4O4WA 3QF0A 5AYYA 3C6CA 5K7JA 3BARA 1DQWA 3MHFA 2BZNA 3QQ1A 1UUOA 1EUAA 2RDUA 2WSYA 4JTSA 3EKZA 3CEUA 1TV5A 3RU6A 4O16A 4ZMGA 3LHTA 4NJJA 2Y62A 3TUUA 1I8JA 3G22A 2ZDRA 3SFKA 1SO3A 4UIOA 4WOQA 4Y96A 1H1YA 3ABQA 2J27A 1SW7A 1XBYA 3SGUA 3M1ZA 5LZLA 3NPVA 4O57A 3GDTA 1K3UA 2ZFAA 4O10A 3QYQA 3EX3A 3NPWA 1KBIA 2DP3A 1TPWA 1N7KA 1F7BA 4GNJA 3G24A 3NXFA 3W1XA 5HUPA 2QCHA 3BLEA 3IGSA 1TPFA 5FF2A 4X3ZA 4RXGA 4UMBA 3P8JA 2ZCGA 3EX6A 4BWLA 1TPEA 3EXSA 1DKWA 4OV9A 4YMZA 3IIXA 5K2ZA 3FKKA 3NPUA 2X1RA 1PCWA 1YYAA 1QMLA 3O8AA 3WK1A 3NAVA 3QW4B 4IMDA 5BOOA 1JUKA 4DO4A 1WXJA 2YFOA 5HUOA 1G4PA 5HINA 3FLUA 5L6UA 2Y63A 3LRMA 4UFJA 3CIXA 1EWDA 4AXKA 2OCZA 1BWKA 5AHEA 4K38A 4LRSA 3W2UA 3VE9A 1SZGA 2A7RA 1TPVA 3L67A 2WPBA 2LLEA 2R94A 2XFWA 3RK8A 1O5KA 4QITA 3MYPA 3DENA 1ZY9A 1L6WA 5AC8A 1LOLA 4TU1A 4QISA 4KFOA 3LHUA 4JTIA 3E02A 3P81A 3L5AA 2WO5A 4LT9A 5CSSA 1VZWA 3SW6A 3QSTA 3GNNA 5F2GA 2BSLA 1OX6A 5I3IA 1ME8A 4ORIA 4FB7A 3HF3A 4HNUA 1FY6A 3OA3A 3GXTA 3DKLA 3UY8A 5LGXA 3P84A 2CLEA 3S5OA 3C61A 2YCEA 3DFQA 5A8GA 1L2UA 1RZMA 2NLIA 3GLCA 4UR7A 1Z48A 3SI9A 1T8XA 2H8ZA 3C2EA 1LLZA 3D0CA 1AW1A 2NZLA 1LM1A 2YW4A 3EWZA 3FEMA 3W7GA 4AH7A 4EF8A 4CNOA 3R12A 2C6QA 2H90A 3GK0A 4AF0B 1ZENA 2NV1A 4DQWA 3RF9A 2E09A 4MLRA 5LGZA 4TIMA 2QUUA 4O14A 1UJPA 5IBXA 3ZS4A 1QNVA 4QM1A 1A50A 3W7LA 1QOPA 3LV5A 4YL2A 4BI5A 4FO4A 3TR2A 3ATZA 3W85A 2NXIA 3IVTA 2V0TA 3L0NA 3DBPA 3DFPA 4N2YA 3TCEA 3CM4A 4OGZA 1YDVA 4RV8A 3ZWSA 1G4SA 2V82A 4K39A 1F05A 3SGZA 4C1KA 4OBTA 3P74A 3LLFA 1ML1A 4BI7A 3O07A 3TC7A 3NL2A 3G8RA 4NVTA 3P80A 1OFOA 1PIIA 4R53A 4OU1A 3HGSA 4JYFA 1TO3A 1EX5A 4CCEA 1PS9A 1YADA 2B7NA 3CIWA 3H53A 5L9FA 3VNDA 1IIHA 3MP5A 3NYZA 3I7QA 4E38A 2AQWA 1EEPA 1L6SA 3LM7A 3S1XA 3P8IA 8TIMA 4JTUA 1KFLA 2QDHA 4UFHA 1YXCA 1KFJA 1KFCA 1SO6A 2CLLA 3N34A 4LW7A 4JTLA 1G69A 4NJHA 3LV6A 4M6QA 4LUIA 3W7PA 2OMAA 1QOQA 3F4WA 1FXQA 3FOKA 1N55A 5FEPA 3TE9A 1B3OA 1L9WA 1ME7A 3LBCA 1OX4B 1PHWA 5EPDA 3W07A 3LCHA 2OT1A 3TROA 3NVTA 1W0MA 3CWNA 4N9BA 3M5XA 3FIGA 2YDAA 3BV4A 4HT3A 3O6DA 1W3IA 1GVFA 5HNRA 1MEHA 3QPYA 3LOTA 2FJKA 3PBWA 2YR1A 3IGXA 3P7YA 4E2BA 1ZCOA 3PS7A 1RD5A 4NXKA 3S5NA 3HPXA 3M5ZA 5F2LA 1DBTA 3B0VC 3L9CA 3HGRA 2YGYA 2V2DA 2V30A 3JS3A 4IJBA 4OV4A 4FNPA 1H7PA 5G1YA 4A3UA 2NWSA 1S5WA 2WNNA 3PUEA 2V5LA 1OF6A 4RKAA 4K7VA 3W7EA 1KM0A 3FJLA 1G4TA 1XM3A 4JYEA 3Q37A 4D2JA 1RR2A 4QNWA 3SSJA 1F5ZA 3G1YA 3W1AA 4XBKA 3W1UA 2VENA 4IWWA 1RQBA 1P4CA 4O1BA 2WQPA 3W7JA 5CZSA 4NNBA 4K8HA 1JCJA 4GUGA 4UXDA 1R2TA 3MJYA 1LOSA 2FFCA 2GVLA 3R5EA 3OG3A 4LRTA 1JRCA 4Y90A 3BO9A 1DL3A 1HG3A 3G1SA 3MHGA 4EWND 4DF0A 1FWSA 1VYRA 4BI6A 1N8FA 3INPA 1U83A 2OJPA 4L4LA 4O13A 3TFCA 4CCDA 1R30A 1YPIA 3QM3A 1TB3A 5HWJA 4WXYA 4IX2A 4QQ3A 5SWUA 1FWRA 4L4MA 5CPNA 3KRUA 4O17A 4RZ4A 1NSJA 5HJLA 4GUHA 1LDCA 1QDSA 3C2VA 1SFJA 2QF7A 2X16A 4MPQA 3B8DA 1YTEA 1D9EA 4K36A 2GPTA 4FIRA 3Q58A 4JN6A 5DXXA 6ALDA 3NQ7A 2D73A 2C16A 2O7QA 3NEVA 1UBSA 4Q4KA 4FIQA 3W88A 3HIJA 4ALDA 3W1MA 3OVPA 1WOAA 1JCXA 3MI2A 1Y0EA 3LI1A 3O15A 1RVGA 5HMSA 1MEWA 1JULA 5E0KA 4HIBA 4AF0A 4O52A 4PTNA 5H91A 4LV4A 5KMYA 2FIQA 5LHEA 3NQMA 2Y89A 1Z44A 3E49A 1KM5A 3Q2DA 2FDSA 2GJNA 2E6YA 2R14A 3TJLA 4MZYA 3BK0A 1MXSA 2Q8ZA 3CU2A 4UFKA 4ONVA 2JGYA 3W1RA 2PE4A 1GVSA 3PC0A 2HTMA 1DORA 2CLFA 1I4NA 2DZTA 3TXVA 5AC7A 2C14A 1GOXA 3UD6A 3DFNA 3P62A 3E0IA 1EP3A 3U8GA 4X22A 3HO8A 1TRIA 2ZA1A 4GBUA 4MOZA 2DZPA 3FFSA 1W1ZA 3EX1A 1OABA 2NXHA 2QCCA 1KFKA 3WK0A 4P2VA 3STFA 3QFEA 1OYBA 3AJXA 1W31A 3W23A 5CPMA 5AFDA 3MWAA 4JIQA 2ZQ0A 4O1CA 3M9YA 1WYIA 4RZ5A 3G1XA 1W8SA 2QUTA 3L5LA 1L6YA 3QMRA 4DPQA 3NL3A 4DPPA 3DI1A 3IIVA 3W86A 4QSHA 3P82A 3QW3A 3GR7A 3WK2A 4A21A 2A6NA 3TH6A 3PF3A 2YW3A 3GKFA 3N14A 3MMTA 1V5XA 3GNDA 4DBEA 2PURA 2WOQA 1W56A 4DXVA 3HOJA 1PL9A 3MW7A 1QWGA 4FX7A 3LCIA 5DCDA 3W1PA 5D30A 5HWNA 1HTIA 4Z1AA 2CLOA 1F74A 3UY7A 3VFLA 5F4SA 1A5SA 2Y7GA 3W1TA 1NF7A 4A2RA 3STEA 2CWNA 3C2OA 4N9DA 3W2JA 2WJZA 3G0XA 4HN4A 2C0AA 3EX2A 5E93A 4DF2A 1HFBA 3PR2A 2GQ8A 3T40A 3GXNA 3W7RA 1WAUA 1H7NA 3MUXA 2ZZ6A 5K3VA 5I3GA 1XBVA 4JDYA 2JKAA 4GC4A 1XBXA 5D04C 1NF0A 4R33A 1JRBA 3UXAA 2VEPA 4HNNA 2ZYFA 1XUZA 4O0ZA 1YLVA 1QPQA 3OVRA 1SO4A 5FF4A 1F6KA 4KWVA 4Y6GA 4MY8A 3RNDA 3T78A 2ZZ2A 1LP6A 2P1FA 3G1DA 2X30A 4GUFA 3NQ8A 1H51A 1GVQA 3MP3A 5EMUA 2TMDA 4WY0B 3CB8A 1CW2A 2NX9A 1G67A 3NGJA 4K6AA 1LBLA 4S2BA 3F03K 4I7UA 2C1HA 3BG5A 4PEKA 2CZEA 1Q6OA 2V5BA 4JTJA 2DZVA 2DU2A 3ZWTA 4IMFA 3YPIA 1M7OA 1TQXA 3TW7A 4OQVA 3HGOA 2E6AA 2QAPA 3W74A 4IOTA 1HL2A 3QZEA 2Y70A 3S1WA 3TMLA 1TTIA 2I14A 3O6YX 1FCUA 1VYPX 1W54A 4PH6A 3G1VA 1AW5A 1OHLA 3IVUA 4GFSA 4H3DA 3ELFA 5LNRA 1FXPA 2BLEA 2V8ZA 3OBKA 3WJWA 1W37A 1YDOA 3WJSA 1Z41A 2ZZ3A 2NUWA 3AO0A 3GZ3A 3HMJG 3W7DA 1YTDA 4IMEA 5CPOA 3QEZA 1KV8A 3WJZA 1LLWA 3G1HA 4DO5A 1X8FA 1K03A 3TXZA 3LXCA 4HPJA 5D2XA 3G0UA 3SECA 3BW3A 1PCKA 4LC6A 1EIXA 1B4EA 3QRHA 3TKFA 3BG9A 1FX6A 1P0NA 2QCDB 1JR1A 5F4XA 3QMSA 3A9IA 3PUOA 2VEIA 3TMQA 1B4KA 3TAOA 1AK5A 3EEGA 1LOQA 1XC4A 1EP2A 1VH7A 2YFNA 4GJ1A 5J5DA 1OFAA 1QO5A 4FHAA 1I2RA 5GVJA 2WKJA 1P0KA 2ATMA 2G5WA 2P10A 2XN0A 5T26A 3M5YA 1GVOA 1IXOA 3LCXA 3C2RA 1S3HA 4AHOA 2JKPA 3LRLA 4OE7A 4TMBA 5F1VA 4QIUA 3UZ5A 2ZTJA 4MY1A 3LRKA 2DZUA 3THAA 2NUYA 3ANYA 3PB2A 1GG0A 2VFFA 2NXGA 5AYXA 1VR6A 3NOEA 3BGGA 1ZHAA 4Z1BA 4YLWA 3SJ3A 5EYWA 3NNTA 4NXSA 1UCWA 2I1OA 1SQ7A 2PRMA 4NZFA 5AC6A 3STCA 4HNTA 5AOUA 2IQTA 2HMCA 3EWYA 1OF8A 3ZR4A 3HPSA 5HWMA 1FCQA 5F2IA 2Q3RA 4RZ6A 3PAJA 3IVSA 1OK4A 3HJZA 4H4IA 4Q32A 3DFSA 4N6EA 1I2NA 4OWGA 4XUGA 4Z0SA 4O8RA 5D2YA 3QQ0A 3LLDA 1EP1A 1S5VA 3GB6A 5FF7A 4UC5A 3OIXA 4MFDA 3BW4A 3TSDA 1NFBA 2ZA3A 1X6UA 2I9EA 4AWSA 4FEZA 1LZOA 3MBFA 1PE1A 2Y7DA 5BW6A 2Z6JA 1U5JA 3STGA 1A53A 4M6PA 5BRBA 1Q6QA 1QFEA 1TYGA 5F2MA 4WUIA 2E5DA 1W3NA 3ABOA 3UWVA 1HO1A 1AL7A 2DJLA 4MZ8A 1SZNA 1OFDA 2A7PA 1GVRA 3QMTA 2TRSA 4BK9A 2OX1A 3R13A 4UR8A 1Q6RA 5BNKA 1QO2A 1QR7A 4PODA 5AHLA 3VKJA 5BMXA 3LTSA 3R8RA 3EWXA 4UTTC 3G18A 2QCFA 3LX9A 1TJPA 5FEZA 1OG0A 1VLWA 1LBMA 1M5WA 3W2LA 3N19B 3TX9A 4LTSA 3CC1A 5AHIA 3MI6A 4LVGA 3E96A 5MHBA 5EA9A 3FJ6A 1B9BA 3C2FA 3PB0A 4CCCA 4Z08A 1ALDA 2ZTKA 1TRDA 2QAFA 1VYSX 1TPDA 3L5MA 5FI8A 3GDLA 4AWTA 2E68A 3VCRA 5IBXC 4XKYA 3LDVA 4RJEA 1IF2A 1PHQA 3B05A 4MUZA 4JS3A 4JTEA 3GDMA 1I45A 3HQ1A 4NU7A 3LXBA 2J88A 2YSWA 1R47A 2H8XA 5K9XA 3A21A 3P61A 1IXQA 3HG4A 3HG2A 4UMCA 1YDNA 4IPIA 4JTFA 3PG9A 4NJGA 4UTIA 1IXPA 3IIPA 3EWBX 1WV2A 2B7OA 2H6RA 4FXSA 5K4ZA 4WQ6A 4Z1CA 3DZ1A 2FPTA 4RK8A 2ZRVA 3NQGA 1OVDA 4O54A 4P61A 4GWEA 2Y61A 5CG7A 3A22A 5DCBA 4NUWA 4BR1A 4S1FA 4AVFA 3E12A 4MFEA 2VEKA 3N2MA 3USBA 4FF7A 1ME9A 4WZHA 1I2OA 4K37A 5HULA 5G5IA 3A23A 3NL6A 3TIMA 2Z6IA 2OZ0A 4O0KA 2ZRUA 3W1NA 3TU9A 2QCEA 1THFD 3NQEA 3L0KA 3C3NA 5DY2A 1K7XA 3PWAA 1HUVA 1TQJA 3UPWA 4UUIA 1SW3A 4A22A 3S5YA 2E77A 5KZMA 5G2HA 4N02A 5CPLA 4LC8A 2PRLA 3G0SA 1GZGA 4X9SA 1Z42A 2A21A 1H50A 2R91A 4RR4A 1M7PA 3M0ZA 3DHFA 4UTKA 3GX9A 1SW0A 5HQEA 1KTBA 3NQFA 4NNCA 2CW6A 1WBJA 2OT0A 3W83A 1YXYA 5D09A 1X1OA 2ALDA 3CT7A 4O1DA 1JCYA 4ML9A 1GYNA 4E0CA 1LORA 2E5BA 1YTKA 2A1YA 2GOUA 5CGQA 1LYXA 2Z1BA 4GXMA 3DKJA 3U6WA 3BGJA 1ICSA 2FPVA 2AAMA 1ZNNA 3PSWA 2CZ5A 1H7RA 3G3MA 4XTDA 4UFLA 2EPHA 2TSYA 3KOFA 3T4CA 3DU0A 1F6PA 4N4PA 3NZRA 4UTLA 3P5ZA 2DORA 3B04A 3SIZA 4POCA 3G3DA 4KKXA 4JX4A 4ZQPA 3HPZA 3PM6A 3T55A 3W7KA 1XXXA 2GQ9A 5HR7A 1VHCA 4I7VA 2C18A 1KA9F 2ABAA 1FCBA 2Z0IA 3MBDA 3P67A 3H54A 1WBHA 4WJEA 2CZDA 5AHFA 3UQNA 1WOBA 4XBSA 5G2WA 3M41A 5DBUA 2V9DA 3LXAA 5F4WA 3VI2A 1NAL1 4LV9A 3UYCA 1SPQA 4PFMA 3C52A 3RMJA 4ZVJA 4PC8A 1RQHA 2CLMA 3W1LA 5IM51 4JR5A 1F76A 2E6FA 3E9AA 1LCOA 1DVJA 2Q3OA 1YPFA 1ZAIA 2G95A 4IX0A 3CQ0A 1GT8A 3NQDA 5FEWA 3IV3A 1A5CA 2TYSA 2HS6A 4WOZA 1Q3NA 1O94A 4UTWC 2VOMA 2P0OA 2GVJA 2A5HA 4UNLA 1W5PA 4HSOA 5EBUA 1KM2A 3S8HA 2B7QA 3F4NA 4IGHA 1JVNA 2YZRA 1JQXA 1ZJIA 5LNUA 5AHMA 4G1KA 3W9ZA 4ICNA 1EPXA 4M19A 4W9TA 5LNVA 1K8ZA 5KINA 4JICA 4GE8A 1FDYA 2NWRA 2UV8G 3V1PA 4ZQCA 1TPC1 3W2NA 4RCXA 1XL9A 3A5FA 3JRKA 3PG8A 2QR6A 4M5PA 2Y7FA 1FDZA 4HSNA 1XDLA 3M16A 3UWQA 3NG3A 1HO4A 3OHIA 5D03A 1P1XA 3GIYA 3G8EA 5G4WA 1SSDA 4FX8A 4PL2A 1GWJA 1T0OA 5FESA 2QCMA 1O95A 3LCWA 3KHJA 2QCGA 3LB0A 2R8WA 4Z1DA 4O4VA 3G1FA 1PVNA 4DEFA 4AAJA 2W6RA 5LNWA 1O60A 4QJ1A 2XN2A 2QUVA 1KM1A 4RLIA 5ABTA 5D02A 2JK2A 4O1AA 1BTMA 4JXCA 2X2GA 4AB4A 3BVJA 3LTPA 2HS8A 3H55A 3KVKA 2YPIA 5C6MA 1OFPA 4O12A 5CZ0A 3M44A 4IMGA 2NV2A 4IXXA 4O53A 3HG3A 3MI3A 3O06A 3TSBA 1A5BA 3EWWA 3LBMA 2ZZ1A 2BTMA 4MLJA 1OX4A 3LHVA 3UXDA 2FTPA 1H5YA 3ABRA 2EGZA 2RH9A 3TJXA 1TMHA 2BXVA 2XN1A 1AW2A 1EWEA 1MEIA 1TJRA 5D2TA 3IIOA 5AB3A 1I2QA 3RLVA 2F7FA 1IIGA 4O15A 4JYDA 3NZ1A 3LI0A 4YWIA 1LRTA 1W5OA 1OK6A 1OX5A 3UWUA 1R2RA 4TMCA 1J5TA 2EF9A 3TA6A 3LTYA 3KVJA 3S5ZA 3KRZA 1G7VA 4LS2A 2RDTA 1IGSA 1FWWA 4PL1A 1ZALA 1UB3A 2RDWA 3N73A 3A5VA 1H60A 3TQKA 3I6RA 2BX7A 3GAKA 4XWUA 4NX5A 3P60A 4H6KA 1ZAJA 1ICQA 4N6FA 2RHGA 4O19A 1KBJA 2QJHA 2YYTA 3FA5A 3NPXA 4LVDA 1QPRA 4J9JA 5DN1A 4AHPA 3HGJA 1TV7A 3WK3A 7TIMA 3W6YA 1H1ZA 4JTKA 3DFTA 3EXRA 5A5WA 3F1QA 2J9YA 4DO6A 3QPZA 4LOCA 3LHWA 1K7EA 3N3MA 2VFIA 2CLHA 2FLIA 4IPJA 3PULA 1YXDA 4HHPA 2Z2UA 3N9SA 3W71A 1QCWA 2JKEA 3S1UA 3M47A 1FBAA 3OEXA 3W2KA 3UWZA 2H3BA 3NQ2A 3TC6A 4E2DA 4EIVA 1XI3A 1RQEA 1TTPA 2RFGA 2DZSA 3K30A 5J5RA 3NQ6A 5AHNA 3A24A 1GEQA 1C9DA 4EOUA 1IXNA 1VCFA 3LHZA 2QEZA 5KTLA 3DGRA 1TIMA 4UFIA 1OYCA 4X2RA 1C8VA 1Q45A 3NL5A 5HR6A 5H2ZA 3UZJA 2FB2A 1KM3A 1SSGA 1X7FA 1VRDA 4FNQA 3WFAA 4MYXA 2VXNA 4EVZA 4IMCA 1TPB1 4RXFA 4ADSA 4JGDA 4NQ1A 5K9DA 1W5NA 3HG5A 1EUNA 1LTDA 3DHDA 4HPXA 2CLKA 4TX9A 1R2SA 2ABBA 3W3OA 1E51A 4M6VA 4OHQA 2E6DA 4UNKA 3KX6A 5DLCA 1J4EA 3TFXA 4MZ1A 5CKSA 3DAQA 2GUUA 3KVMA 2ZRXA 2V2HA 4FNUA 2NUXA 1WQ5A 1OFQA 3VE7A 4FNRA 3T44A 2ZZ4A 4LU0A 2J9ZA 2C13A 4K8EA 4MY9A 1RV8A 3CTLA 3KXQA 3I65A 4BWLC 2ZBTA 5DY3A 1W3TA 1UUMA 1F73A 2FB3A 1XUUA 4MKNA 1KV5A 1WX0A 3QSRA 3PBUA 5G1TA 1G7UA 2X1UA 4MYAA 4Y9AA 4LVFA 4JIPA 1ONRA 3B06A 2QDGA 4C1LA 4EF9A 1NVMA 3TSMA 4ZQRA 1EA0A 1OFEA 4PA8A 2RKXA 5LNSA 1SFLA 3GDKA 5TIMA 5LHFA 3MP4A 1O5XA 2A85A 1D3GA 4AEOA 2KZHA 1GQNA 1H7OA 2VFEA 4LS1A 3TAKA 3TW6A 1FUYA 3UWWA 3W1QA 3UWYA 4M7TA 2QJIA 5AN7A 3FYPA 2CZFA 2A6LA 4GUJA 1J2WA 1A5AA 1CX9A 1V7YA 4IQLA 1DJNA 1VS1A 4CQ9A 2QJGA 3DH7A 3LCLA 4JTHA 2G96A 2QCNA 3O63A 4UTTA 3WJXA 1KTCA 4KFNA 1GTEA 1B57A 1DHPA 3EKLA 4LWWA 4UTJA 3W84A 3PBYA 5LKYA 1OFRA 2B4GA 1R46A 2DZXA 2A7NA 3I7SA 4DELA 4IUOA 1H61A 4NT0A 5U7SA 1XFBA 1LROA 2B0MA 3DI0A 3W72A 1SZFA 4WD0A 1VCGA 3EB2A 3KVLA 1VJIA 3C8FA 1VC4A 3SR7A 3I7RA 3LHYA 4BF9A 4WY0F 3W70A 3OVQA 3O16A 5I3JA 1JUEA 3P5YA 4CNNA 1O4UA 3L65A 1K02A 4LUJA 1XCFA 4JY9A 2C15A 4RX0A 3NR0A 1X1ZA 3G1AA 3U2OA 3QH2A 4JD4A 1XBZA 5D2VA 5D05A 4NJKA 2YXGA 1SR9A 4A29A 5G4EA 1VPXA 1BKSA 1UASA 3IIZA 3L2IA 1OYAA 3QJAA 2WSQA 3W7QA 4S2CA 1GG1A 3B03A 4O11A 4WY0A 4U4MA 4NZJA 4WX2A 5D2WA 2H3DA 3W7IA 5CZJA 3PSVA 1GPWA 3KRSA 1Q6LA 4NNAA 3CPRA 5C2XA 3CWOX 4KWWA 3M43A 2Y88A 4NJIA 4GRSA 4FNSA 2PRHA 1TPUA 1KFEA 1AG1O 1TCDA 3BLIA 5CZTA 2CU0A 3N9RA 2VEMA 4YCOA 3R89A 2C19A 2Y85A 2YYUA 1FCVA 2AGKA 2B7PA 1TSIA 4DBDA 4N4QA 1K7FA 1TTJA 2GVGA 4O50A 4JX6A 1QAPA 5DBTA 3I68A 1KLYA 5DCEA 4R7JA 1KW1A 1ZFJA 4AHQA 4GUIA 2J24A 3W22A 3BW2A 3Q94A 3S42A 4MVAA 4UTHA 3FKRA 4PCFA 3SY5A 4HKPA 2VFHA 2W0UA 3MO7A 4QNEA 4JTGA 1JCMP 5I3HA 1T99A 2A2IA 3IEBA 3W2MA 3W7OA 1H7XA 3BG3A 4TO8A 3S0CA 3BPWA 2E5CA 2TPSA 3WJYA 3S1VA 1KFBA 3W87A 1BEUA 4MIMA 2E1DA 1PV8A 2GQAA 5G2IA 3GVGA 4XQ6A 2QCDA 1S5TA 4U28A 1DJQA 3B0PA 1H63A 2BWGA 3GXPA 2FQIA 5KZEA 2Y6ZA 4N9EA 3TV8A 2PC4A 5I3KA 1SZEA 1H7WA 3BLFA 1OJXA 3DFOA 4UMAA 3W73A 3LCFA 5D33A 4ADTA 4Z0JA 1NEYA 2J9XA 4IXHA 3NM1A 2ISSA 4DF1A 3O1NA 3DXIA 4LNYA 3TK7A 1CI1A 3ABSA 4O18A 3O05A 1GTHA 4AMAA 3HB9A 2WNQA 5FF3A 4WXZA 1KTNA 2G97A 4O28A 5CSRA 1GJPA 4AWUA 4Y8FA 2EAWA 4I9AA 3PUDA 3RLUA 1MZHA 3IGUA 3EXTA 1SUXA 3GAYA 1VLIA 5D38A 3W76A 2NX1A 2A0NA 4CQ8A 3C0JA 2Q8LA 4UTWA 2EKCA 3TNOA 1TTQA 1XDMA 3W7CA 4K7YA 1VCVA 4M7SA 1DV7A 1GYLA 1KM6A 4FNTA 5K4XA 4OT7A 3IRDA 2VFGA 3TQVA 2ISWA 4QAIA 3UNDA 1RPXA 2ZZ5A 3B0UX 1JUBA 5C5YA 1DQXA 3FS2A 3S9YA 2ZRWA 2GJLA 2ZA2A 1MSSA 1JQVA 5C54A 5LSMA 1DOSA 4NX0A 3L66A 2YX0A 5DXYA 4MJZA 4UCGA 5C55A 3MHUA 1C29A 2VFDA 1W5QA 1G4EA 2HSAA 5TBOA 2ZRYA 2JGQA 4YXGA 4UFMA 4N9CA 3PY2A 5EL1A 4LVBA 1VGAA 3W7HA 3CEPA 4ADUA 1KM4A 3NDOA 3TQ0A 4B5NA 4Q33A 1FDJA 1ADOA 5KZDA 3LCGA 1FWNA 3L21A 1BWLA 3W75A 2Y7EA 2QCLA 2V81A 3N2XA 1H62A 4CLMA 3NM3A 3M5VA 2QKFA 4JNMA 5EY5A 3GR8A 3PBVA 3JR2A 3HBLA 3NQAA 2V2CA 2NX3A 2JBMA 3EWUA 2FPYA 1KLZA 4CQAA 2O7SA 1EB3A 3NQVA 2VELA 3W7MA 3UPBA 1AL8A 1T96A 5K9CA 1VQTA 4JX5A 3THQA 2CFFA
chains in the Genus database with same CATH superfamily
2JE8A 4LF9F 2AYEA 2WSFC 3MKKA 4MJMA 1JJKA 1TV2A 4DU8A 4IG3A 2HEJA 4DYEA 5LIKX 3AIBA 1SC6A 3OO2A 3BSHA 1K8YA 3CLMA 5KITA 4R34A 4HI2A 2ATSA 2BDPA 1RBOB 2J7FA 3WFZA 2R9RA 2CIPA 2L3MA 4G1QB 1IGWA 4M0XA 5EMMA 2BW7A 1R87A 3ATYA 1CJUB 4OL8A 1IYXA 1SU5A 3B4UA 3T09A 3HURA 4JTTA 4DCJB 2UZAA 2J75A 1S77D 1NEEA 1CXKA 5GQBA 5F1UA 4LRFA 4DY1A 1RT3A 1QK2A 4NI2B 2ASJA 4RNHA 2BW2A 4S3GA 1S6QB 3WQGA 5M17A 1TL5A 4X84A 2PBGA 1ZAHA 3NQCA 5CYQA 4AIOA 2HRTA 2CQ4A 2ZNYA 4DWDA 4ECSA 2KM8C 3M7WA 2F84A 3TNBA 3SQGA 2CG4A 4Q4OA 1TREA 2Z57B 4Q43A 3MUMP 4KO0A 1REQB 2X1TA 5C71A 2PTYA 1JPDX 3RMEA 1U1RA 3B8VA 3NO5A 4ORMA 4U96A 4A4JA 4ZP6A 4JFTA 5D37A 1TL4A 1D8YA 4GZEA 2WB4A 1XWLA 4JQAA 2C8NA 5F8GA 2ZZ7A 3SCWA 2FJBB 2DBBA 1M5KC 1JDAA 1WA3A 5ETQA 4YEAA 1VP5A 4LS0A 5JMNA 4HTYA 4DR7F 1LBFA 4GYFA 2GJXA 4QR0A 2CJQA 5KFQA 4I90A 3DOKA 4USWA 4KEMA 2BZ2A 3SO7A 2WNZA 2ESCA 1KRBC 2DGVA 2JSXA 4XTIA 3UQSA 3H8YA 4F67A 3MTKA 1M6JA 5MAOA 1L3SA 1S2TA 3R3TA 2DZWA 5D3GB 1FQ0A 1P1MA 4NX9A 3P45B 4L72B 4DV7F 2BV3A 5LIUX 4A2SA 4J7CA 2B7BB 1RP5A 1H74A 3C14B 5B0FA 4H9VA 4S3JA 3L0GA 1OPZA 1W9BM 2DRBA 2GGHA 2R4FA 3F0NA 2OJ3A 2HHXA 3Q22A 9XIAA 3B0XA 3VDGA 2VGBA 5J2QA 5A8RB 3ID7A 4G2DA 3WG6A 2OGYA 2JF7A 1XYLA 2RDUA 4JTSA 2WC3A 1UVLA 3EKZA 4O16A 4WRHA 4NJJA 3QRRA 4RW4A 5M2FX 3N5FA 2XH0A 1RTHA 2ZDRA 3SFKA 4MNJA 2HGNA 1S6OA 4KWUA 4GBDA 5T91A 1E6XM 5A8NA 2GLKA 3UA3A 2O01C 2DY1A 2AL1A 3LYEA 3NWGA 1TIWA 3SGUA 1EETB 3GY1A 2HAFA 4PUOA 1J5EJ 3SN1A 3QYQA 4WGXA 3KLGB 1GJUA 2PP1A 3TUIC 2ZZTA 4EPDC 4USJC 3NXFA 2HZAA 1UP0A 2KT3A 4WHBA 1FJ7A 3W1XA 2OPQB 3K5LA 5E9AA 4XDCA 4C2MA 3SURA 3LM3A 3IGSA 5FF2A 4UMBA 3P8JA 2ZOMA 4MYTA 4NEZA 1UVNA 1TPEA 3EXSA 5CZXA 5A2CA 2CKRA 1Q95G 4Q0BB 4YMZA 1IT8A 1C0TA 3FKKA 2MKKA 2X1RA 1YYAA 4YN3B 3CCZA 5BOOA 3OXGA 4K68A 1RJJA 1OY0A 4CRJA 1RT6B 2YFOA 4A8NA 1DE5A 1URNA 5EMKA 3T9NA 3WDHA 3FLUA 3MDFA 5L6UA 4UFJA 4A3RA 1YIXA 3TZFA 3J81Y 4BC7A 1NJJA 4K38A 1U2RA 2PZNA 1M0SA 4K5SA 3N13A 4DUZJ 4C6QA 2F63A 4OI2A 4TLQA 1SZGA 3VIGA 4PYAA 2DJWA 5SUHA 1BFNA 2EKGA 3OL7A 3C3LA 2PDUA 4QITA 3QR3A 1PKNA 1RE1B 1X5TA 1M5VC 1LOLA 1OZMA 1WEZA 1P6CA 4KFOA 4JTIA 1LOUA 3OXLA 2I2YA 2WO5A 5B7ZA 1SJQA 3E01B 1VZWA 1I1WA 2F4VJ 2HFUA 3L7OA 2W7PA 5I78A 2BSLA 1OX6A 5I3IA 1R0AA 4MMOA 2VJUA 2JLEA 3VQSA 3AYTA 4OUIA 3BSCA 3KCOA 1FE0A 4O44A 1VQ5S 3NNHA 1R85A 5AE3A 1EDGA 3UY8A 5LGXA 2KG0A 3GNOA 3P84A 2EKNA 5K8PA 3DGVA 3KUEA 1WD6A 4YR2A 3P4UB 1M5HA 1VFLA 3WN6A 2EW9A 3AQOA 4CP5A 3BAYA 4OKDA 2VURA 6XIAA 1RZMA 1NMEB 3APYA 2NYHA 3GLCA 3RW7A 5LA1A 3Q24A 2IM0A 3H2NA 3C2EA 2OSRA 2JH3A 4TKTA 4JPGA 3D0CA 2V94A 3TYZA 3D67A 3DYMA 4M3PA 3RLHA 4AZBA 3TZXA 2NZLA 4MJKA 2XLJA 1ZZMA 4NZ6A 1LWFB 1CTNA 4AH7A 2C6QA 3S2JA 4PCNA 2H90A 4TNOA 1O0PA 4AF0B 4GKKJ 5LGZA 4MLRA 4NI2A 3PK7A 1RTDB 1WHXA 3NLCA 5C9RA 4NYOA 4EPEC 1QNVA 3VX0A 2PN6A 2I8EA 3LV5A 2NV9A 1YIJS 3GVWA 4C6KA 4G1IA 2QJJA 7TAAA 3S01A 1YPXA 3TCEA 2ZKUA 3OV7A 1YDVA 3WL0A 1GAOA 3C15A 4GO5X 4Y2IA 2XIJA 4KF1A 3DC2A 2XC9A 4JI0J 2QA4S 3I6PA 1UIPA 1Q7MA 3PR5B 3T5HA 2ADCA 4BI7A 2UY5A 3I32A 3M8RA 5ETTA 2INEA 4C6FA 5J04A 1O6XA 1ZZNA 1OFOA 2IY5B 1XD1A 1RK6A 1PIGA 3SSQA 1YDYA 4CQDA 2D74B 2V5CA 1DWJM 2GZOA 1JIBA 3G6MA 4AD4A 4CCEA 3CS2A 4OZ5A 2YWFA 5L1JA 5FJOA 2W8KA 3CIWA 3QZ7A 4UBPC 2IW0A 2Y1HA 3I6TA 4B3SJ 3Q0AA 4PQAA 2KM8B 3M32B 3G6LA 2QXWA 1AJ2A 1XIIA 2R7QA 1BYAA 3P8IA 4JFUA 4ZLNA 1RAHB 4JTUA 3TJ4A 1HNXF 3S1GA 1KFLA 3WBZA 1YXCA 3CD0A 1LT8A 1MZRA 1U48A 5D78A 1UD6A 1KFCA 1LKZA 1HA1A 3RJYA 1V5IB 2CLLA 4DUVA 3WLTA 3TAPA 3MUY1 2F8MA 3P3BA 1JXLA 3URNA 3LV6A 4M6QA 2ATLA 2JEGA 3W7PA 2OMAA 2BJ1A 3F4WA 4HOZA 3IWLA 4M8LA 4DL4A 2WJEA 2H9AB 4KIEA 1H5VA 4E3TA 1CXEA 4LIWA 1B3OA 1L9WA 1YHTA 3S2MA 4IQJA 1OX4B 1ENUA 3LCHA 3NVTA 5HJXA 2PTWA 4GVHA 1DIOA 1Y11A 2J8FA 4N9BA 3CXOA 2SXLA 1K9MT 1XD0A 1CVJA 1K4HA 2WJFA 3FIGA 2NPFA 4M95A 4HT3A 3O6DA 2FZMA 4J9MA 4FKXA 1ZM9A 3GP9A 1O6IA 3AB4B 2J76E 1CYGA 3TQPA 2UUBJ 3LOTA 2HGLA 4E2BA 9XIMA 3GHRA 1RD5A 1V51A 5B7YA 3SFGA 1J2VA 3KLGA 1R7AA 3QC0A 1B0VA 3L9CA 1AMYA 3URQA 2YGYA 1TUVA 3T8LA 3IBWA 2JRSA 1NWUA 2ZE3A 1SJCA 3ZLFA 1W26A 1SZRA 4IG2A 1H7PA 3N04A 4LBRA 5G1YA 4P10A 4RPQA 4A05A 3T08A 3M2VB 2NWSA 1RU1A 2WNNA 1GMWD 3E8OA 1HKMA 1OF6A 1S39A 2V5LA 2YL9A 3CJ4A 1FHLA 4TYAA 3WLKX 4RR5A 4ES1A 3ORWA 4RKAA 4K7VA 1J8VA 3KUHA 1KM0A 3K1DA 3PIPQ 5I3UA 4Q0BA 2FGOA 1JPHA 4KIAA 3G8SA 1BUXA 1BMQB 1ZPWX 1U0HB 3I0RB 2DVUA 1NWSA 3KKFA 4D2JA 3WMBA 5THWA 3UDLA 4PKDB 4QNWA 3SSJA 3ZQ9A 4WBFA 4ERDA 3U9IA 2K7KA 3B8IA 3PCOB 2CFXA 3CCUS 2KT5A 2VENA 4IWWA 3GNXA 2YZ5A 1J12A 4JIHA 2WQPA 1U1LA 3N28A 1TVRA 4NNBA 4K8HA 2HZCA 4WIQA 4X64J 3T6CA 2J13A 2IS7A 2GVLA 1UKOA 1F1BB 1AJ0A 1HJVA 3OG3A 5GJPA 1GVEA 4QQUA 1HL8A 2ACQA 1R6YA 3LPEA 4C48A 2DGSA 1GVIA 4IH7A 5AYBA 4D6FA 1GKPA 3K2GA 4ZENA 5JUVA 4LUSA 3E01A 2IBOA 4ES2A 4B9SA 2WWDA 4C7QA 4CCDA 1R30A 1YPIA 4UY8T 1NOUA 4LVOP 1PC4A 2CIMA 3M6UA 1FNMA 4RNNA 1RP8A 5F7UA 3D7SB 1QE1B 5IM0B 1GOMA 1ZP3A 1EX1A 2P5NA 4YTUA 3SDEB 3KRUA 1NRKA 4O3SA 3WO8A 2HK3A 5HJLA 5KFBA 3SQOP 2A6MA 5JVGQ 2Y8YA 4DRSA 5LMNF 4B9YA 4JYAF 5LXEA 1QDSA 4KCWA 4FYWB 3OLDA 3C2VA 2O1PA 2RQKA 2BY3A 2F65A 3CJ5A 4IFVB 1YTEA 1EBGA 2D9OA 3SCLE 2X1IA 3IR5B 3VIJA 3MUZ1 5KFXA 3SYZA 4Z37A 2QL5B 3OGSA 4HU8A 2ALYB 3AI0A 1A6LA 2XS5A 2C16A 5E33A 3UR5A 1GONA 4K50A 3VKDA 2RF2B 4CM0A 3W88A 3SN4A 4S38A 3DOMB 2WMGA 3PEHA 3LI1A 2XZ9A 1FO1A 5KFWA 4HYRA 3CL8A 2Q09A 5HMSA 2W1BA 3MU7A 1C2PA 1R8CA 1H2JA 3LQGA 2CBJA 4HIBA 3WELA 1GQIA 4AF0A 3F56A 3W64A 5IRPA 4JI8J 3DESA 4O52A 3SCVA 4PTNA 2DDXA 3PYFA 1Z9AA 4DPTA 4JI3J 1RTDA 4MAZA 3PW4A 3IGHX 1V3MA 3BICA 1GNKA 3VILA 2FDSA 5DT7A 2E6YA 4LUTB 2R14A 3BK0A 5TAOA 2Q01A 2MSTA 2XB2D 2ZUSA 2Z58B 4XAFA 3RYSA 1QJHA 1IBLF 2D3NA 4NXNJ 1U1MA 2DZAA 3OPSA 1Q78A 2MEWA 1R0MA 1SKUB 4TU8A 1L3TA 1DWHM 4KEUA 1NK8A 2YXOA 1KXHA 1CIUA 2MQOA 3A64A 1PB0A 2W9BB 3P62A 1KR4A 4KR0B 1YRRA 3HX9A 3ITOA 4PABA 3WEMA 3E0IA 3ABXA 3U8GA 3WD1A 4X22A 3LGNA 5IV4A 1TRIA 3DXBA 3VMPA 4MOZA 2QJMA 5KFEA 1OABA 5ETVA 5AVHA 3BBCA 2V4QA 3T0AA 5B09A 1WELA 1OYBA 3HVRA 2QEXS 1NM9A 1W31A 1FP9A 4Q8MA 3EUNA 4NLRA 5IFTA 4DV5F 4Y2MA 3ZVHB 2UUAJ 2A3CA 2ZQ0A 4K8GA 4L4PA 2E7VA 2QUTA 2KHCA 2VEGA 3QMRA 3AMDA 1DJZA 1EO7A 3KZPA 1S7IA 3M32A 4M6UA 4QSHA 3LALA 3PIOQ 1XSJA 2Y5EA 1OGGA 1S2VA 4Z2LA 4Q4MA 3L7PA 5ETSA 5HK4A 3WH7A 1XIFA 2DEIA 1RBAA 3PF3A 2YW3A 3GKFA 2IMOA 3F4DA 3W6MA 1N6QB 7AT1B 3GNDA 2Z7GA 4QR6A 2PURA 5EUHA 4CLPA 1E15A 3HOJA 2QGHA 3HSZA 3HFZB 2H9AA 3LCIA 1R3YA 1BQGA 2ZWOA 4YY3J 1DIDA 5D30A 2CLOA 1F74A 1FESA 5AT1B 1EHWA 1SM9A 3DU5A 4MMWA 3PTQA 2WJZA 2CYGA 2PWUA 4FXWA 4JI1J 2Z2YB 1KHVA 4CIOA 1XKJA 1O5QA 1BGGA 3GXNA 5HQMA 2POKA 3W7RA 2VX4A 4BHQA 1H7NA 5I02A 4DR3J 2ZZ6A 5I3GA 1T3OA 2RQCA 2JKAA 1G0CA 2HAIA 3SRHA 5A6JA 2DQWA 3VIHA 3ZSTA 1R8BA 2Y24A 5LA2A 4WFNQ 2NT1A 4RDYA 4O0ZA 1DQ8A 4CD5A 2FJEB 3POCA 3K59A 3CCMS 1JZ8A 1EJWC 1FVQA 1XIJA 2NQPA 3OVRA 2BKPA 3ITGA 3M2VA 1SO4A 1B3VA 1RA0A 4D6EA 4NF7A 3MD1A 4HD5A 3H2OA 3AIVA 1JKHB 4QIVA 2NVAA 2VC5A 3BWWA 3SCUA 4D72A 4MY8A 3RNDA 4B9LA 2Y8WA 2HRUA 4TV6A 3ZNJ1 4GUFA 3DI6B 2RU3A 1U0HA 1FP8A 1RAEB 1UR0A 3AICA 2YKPA 1P6BA 2QS8A 3WD3A 1LBLA 3FY1A 5HOSA 4IKAA 5E5NA 1WO2A 4S2BA 1CXFA 3BGAA 3F03K 4I7UA 6ENLA 1FTRA 3ENWA 1X6LA 2V3DA 1MG7A 4PEKA 2CZEA 1Q6OA 3HT3A 2WM1A 2DZVA 5DDRC 2VD9A 2HYIB 3BLPX 4IMFA 2IM3A 5REQA 4OFZA 3TW7A 4D6JA 4IRCA 2E9TA 3NEHA 5FJRA 2AMXA 3HHKA 1RCOB 1QVBA 2LEBA 3W38A 2YB1A 4KRUA 1F9EB 5I3QA 1UWBA 3FJNA 4HHMA 3W74A 3I4PA 2QDEA 1HL2A 3S1WA 3TMLA 1JPMA 4EGLA 2I14A 3D5HA 4M5NA 2GDVA 1R3NA 3AXMA 4PH6A 1S4EA 2FHMA 1KBKA 3T41A 3IVUA 1XRSA 5EMJA 5H9EK 3CJ0A 4GJIA 1QE1A 2ZFHA 3THDA 4YHHJ 2V8ZA 2NVDA 3CMQA 2IKHA 2G1DA 1GHRA 4X4OA 2IMRA 3AO0A 2WBMA 3GZ3A 3CBWA 2RRAA 3ARRA 2J8AA 1YTDA 3QEZA 2VZSA 1S9EB 1C7TA 4IFVA 4KQZA 4L5ZA 2W01A 5T9BG 4ZEPA 1XIEA 1FT8A 1TV6A 2RJHA 1QM9A 3G1HA 3KRBA 4DO5A 4YQWA 2GQQA 1T95A 5CGTA 2VONA 2D3O1 4HPJA 3G0UA 3C16B 4LF4J 3T0DA 1L3KA 3SQSA 4CKQA 1SJ1A 2JC1A 4LC6A 1PCKA 4ALZA 3FDGA 2QJ3A 1B4EA 2RF2A 5L9NA 3LMZA 3QRHA 3J7YU 1G9HA 2DKOB 3DOMA 2QCDB 2YKOA 3QMSA 2BM0A 3PUOA 4BQ5A 2VEIA 3TMQA 1YWXA 2YCJA 3LLXA 1LOQA 2YX7A 4DUYF 4L1XA 4E0DA 4XZHA 3SUTA 1YQHA 5TNVA 1OFAA 2Z30B 3HM9A 3GD6A 2AF6A 1P0KA 3K8MA 3RAOA 3ZTPA 4CD6A 1C1BB 4ZS6A 4J27A 3C2RA 1S3HA 3CV7A 3EGWB 4AHOA 4S3CA 5DS7A 5IDIA 3TOQA 1TFWA 4OE7A 3PV8A 3MD3A 3QTPA 1F8IA 4LUTA 3LRKA 2XULA 4OYBA 3GFZA 2CJAA 2R7OA 3PB2A 5F8HA 3B0YA 1B31A 4NYUA 2NXGA 4Z2GA 1S1VB 3DLGB 2MZQA 5AYXA 2QLXA 4ROPA 3NOEA 1JJ4A 1ZHAA 1FWLA 1HD1A 3DHUA 1CJVA 4GOAA 2QIIA 3NNTA 4QJ4B 1UCWA 4S3AA 1QI2A 3VGBA 1SQ7A 3OBEA 4OQJA 3SRFA 1UBPC 3STCA 1XNQF 2HNEA 1S1WA 4ZB0A 3H25A 3EWYA 3ELHA 2PP3A 3WLHA 2ROGA 2EEXA 4KRTA 3ZR4A 1YE4A 5HWMA 1TMJA 2E9LA 2NT0A 5B80A 3PAJA 2KAUC 2IKIA 3HJZA 2RAQA 4P73A 1EHNA 3IM8A 1U24A 5B0EA 3ZVHA 3A6OA 2JEJA 1I6NA 3QQ0A 5FF7A 4IJRA 4B16A 4UC5A 4DYJA 8XIMA 4PB4A 4BBYA 2F9RA 3EA1A 3POTA 1NFBA 2N7YA 1KTVA 1VFUA 2BG5A 1ZBCA 3B9DA 4PCTA 2INFA 2I9EA 3LQLA 2DUXA 2F4FA 3GV8B 4RZBA 1EC9A 1LZOA 4FEZA 1FERA 1MNEA 2J5AA 1PE1A 2Y7DA 3M8PA 4UZUA 3UVJB 2BXYA 3W81A 1FFWB 1A53A 4M6PA 1I1GA 1QFEA 1KFDA 4QWEA 2M8HA 4QAWA 2HSEB 2FJWA 3CUGA 2E5DA 2LQJA 1KTQA 2C2DA 3UG3A 1D0EA 4Q5VA 2CQBA 3R5AA 4U8VA 4KGJA 3VZHA 4BK9A 1IXKA 4ZDNA 1UEVA 3T1YJ 4PODA 3VKJA 2EXOA 3HSJA 3NBPB 2DXDA 3VKKA 3VGGA 4LSLA 3AMLA 3KLVA 1VOMA 1ONEA 1MU2A 3LX9A 1X96A 1JLEB 4F0LA 5KT6A 2YBTA 1LBMA 1M5WA 4RNJA 1JZ2A 4S3KA 3MM7B 1KC7A 2VDIA 5A8KB 4O23A 4IRDA 1UFKA 2QYCA 4ES4A 1XMOJ 3EMZA 3R0KA 4LVGA 4PTXA 1YEYA 3PB0A 1S99A 3PBGA 2V50A 2HHQA 1VYSX 5J1EB 5ITHA 2BJ3A 2V2VA 1TPDA 4PMJA 4ILSA 2B51A 2DUAA 5FI8A 2OG9A 3GDLA 2OGJA 2ZBIA 3R5GA 2YL6A 4JS3A 5LA0A 1S76D 4UQGA 3WLRA 3CJSA 1K6AA 1JKHA 4I4BA 1RGVA 2VHGA 1M41A 1HVQA 3MI7X 4P9SA 2YSWA 1ZQ5A 2H8XA 1NPPA 3P61A 4UQAA 3WDJA 6CGTA 4UMCA 3RW6A 3TZYA 3OUYB 1DE6A 1RT4A 1X5SA 2XO7A 4YB1P 4JKLA 1E6PA 5M3WA 3IJ9A 3MM5A 2H6RA 1YBAA 1WKKA 3TAMB 4FXSA 1S1UA 1EF3A 4FI4A 3EAUA 5U47A 4Z1YA 2HVHA 3M64A 4REQB 4RK8A 4DFPA 2BVZA 3AYSA 4PG4A 5LJ5Y 1OVDA 8AT1B 2BQRA 3MECB 4H54A 3DFYA 1H2VZ 3A22A 1KKRA 4NUWA 3VGHA 4BR1A 4S1FA 2DR9A 1KKHA 3TO8A 4EBCA 1QTNB 2CHRA 4WZHA 2I5IA 3AJ7A 1I2OA 3HFYA 2VBZA 1HGYA 5AJ3F 4OHVA 2CJ9A 3C0LA 2VRKA 1FWGC 2J0QD 4EO8A 3LPYA 3ARVA 1K8CA 1S1XA 1T8EA 3L0KA 4DXKA 3FDSA 3D0HE 4X4QA 4D1IA 1HUVA 1TQJA 4UUIA 3UCZP 1SW3A 2E77A 3ARXA 5KZMA 1ZL1A 3FHAA 1U1UA 3WFLA 2OU4A 1E6ZA 2O55A 2B5JB 2A1BA 4JI4F 4LF2A 1S9EA 3GJSB 1KCZA 2NXNA 1FWPA 3KMQA 1WDRA 1SW0A 5HQEA 4CUCA 4L64A 2SFPA 2BJ7A 1U4BA 3KLFB 3C16A 3NQFA 4TVAB 4JKKA 2HWIA 4MH8A 4KGXB 1M53A 2CQIA 3PW2A 2MKSA 2I38A 2ALDA 1JCYA 3W02A 4N56A 4QX4A 3NOGA 5DG8A 1A9NB 3JYTB 2FHJA 2DO0A 4X9YA 1WEXA 1XIGA 1GQEA 1MRAA 5CGQA 2I16A 3JQMA 4Q8EA 3SM0A 3U6WA 1OCBA 4ZSTA 4CNSA 4FZIA 4NL1A 2AAMA 1OC5A 1ZNNA 2LEAA 4B5SA 4OTKA 2CZ5A 4JP8A 3KL0A 2EPHA 5B08A 3COTA 3IAPA 1S6PA 3M8YA 2W7OA 1F6PA 4YDDB 2WSEC 3NZRA 4IM4A 2I5GA 5FCZA 3B04A 4PPDA 5I4MA 5K20B 3G3DA 4DL7A 3ZZ1A 3MUVP 1WOSA 4LRDA 3T55A 5H1WA 2FYMA 2QLFB 2X0SA 3DLGA 3FEXB 1N34J 1BWEA 2ABAA 2HHHF 4B9MA 2PT0A 2Z0IA 3P67A 2KVIA 5IC4B 3ZO7A 3H54A 4FF1A 3MAHA 1WOBA 2AL2B 3N2CA 4B92A 4XBSA 3F5LA 3B9NA 3M41A 5FLXU 1HMVA 4G1PA 2HZVA 4KGVB 4KGMA 4CVUA 5A0YB 3H2FA 3A3OB 3VXGA 1Z2ZA 1NAL1 1HKWA 5GMDA 1MQQA 1HHTP 2ZC8A 3VPLA 4ZVJA 3TC3A 1YRUA 3LGHA 1UJQA 3PHEA 2R2TA 1E0TA 2ILZA 1UHVA 1C8XA 4AQYJ 2DW6A 1HI8A 4GYPC 3U4FA 4A8XA 3CLWA 1HQEB 1VRXA 1X7IA 4BY3A 3E9AA 3ITLA 1LCOA 5H6HA 3L4BC 4FDFA 1T05B 1NK6A 3MMUA 4A3YA 8A3HA 1F0XA 2WVBA 2XMAA 2X41A 1FRBA 3WSUA 4OJ1A 1S0OA 4IX0A 2XMVA 5IWAF 3H26A 2NSCA 4DR2F 1O94A 4LEQA 3PZMA 2VOMA 3SIPB 1HL9A 2NZ4A 4GQGA 4WF9Q 4P74A 3GH7A 3C6TB 3UVJA 1XG3A 1SFTA 1YQ2A 1JVNA 2Y8VA 3OQEA 8ATCB 5F0UA 1R5YA 2J7BA 3UJRA 3PX4A 4JAWA 4G1KA 1SI9A 5CQGA 1OSDA 4OVXA 1EPXA 4E5TA 4M19A 2PGCA 4DLEA 1K8ZA 3HI9A 1UWUA 1KXTA 4XKMA 2NWRA 4KWSA 3HFTA 3RHGA 2HNZA 3NBPA 2UV8G 3MMDA 4XD3A 4DLFA 1YJ7A 1GOWA 2XIIA 1VQMS 1U09A 4HCLA 4R9OA 3TP4A 5DMLA 4LR8A 4B3TJ 2D0GA 3W2NA 4DLMA 4RCXA 1T5AA 3JRKA 3PG8A 2J7UA 2D1ZA 2HNHA 1BY9A 3W2VB 3RBEA 4M5PA 5E41A 4HSNA 4ZVGA 4W4QA 1UD8A 3UWQA 5A8KA 1N33J 2PDPA 5XIMA 2GVZA 1J0YA 4QHRA 2R42A 1B7FA 4BQ2A 3OJUA 1SSDA 2OLAA 1NWRA 1E5NA 2G8ZA 3E5PA 4LCQA 5J1EA 2FVCA 4GGHA 1IT0A 3CB4A 4B5UA 3KHJA 2QCGA 4BS2A 3UXIA 2ALZA 4HK7A 2KJVA 4MUPA 5L1KA 2EG1A 2ZE2B 3D6MB 1PVNA 4GINA 1RD6A 4AAJA 3A8JA 2VQEJ 2DYAA 5LNWA 4J3SA 4B02A 4EEYA 4HL9A 2JK2A 3GIIA 2DEJA 3AFGA 3OUYA 3QO9B 1DJIA 1HPZA 5B0AA 4AB4A 3LTPA 2XCAA 2A6OA 1HL6A 3GJRB 1E4IA 2FJAB 3SQLA 1XICA 4I8YA 5CZ0A 3TAMA 2NV2A 4XAYA 2MHEA 2UY3A 1HW9A 2O9PA 4HVXA 9CGTA 3O06A 4ZE4A 3HKZD 4X61A 3EDDA 3LBMA 3T0TA 2CJYB 5HI7A 2IVFB 1KC8T 4REQA 4WR3A 4AL5A 1HHSA 3W1YC 1N5QA 3MECA 4MT1A 5FIPA 3AOCA 4LF7F 1H5YA 2H51B 3CJ2A 1VC6A 2EGZA 3PJXA 2RH9A 4NP7A 2H4WB 4C11B 2QDDA 1KRMA 3TJXA 1EWEA 2F38A 1V3ZA 4W4MA 1VCTA 2ZUUA 2OUGA 5DETA 3H70A 1V3JA 2ZX8A 1P9YA 4I9TA 2DGOA 4IGNA 2EG8A 4DOZA 4YWIA 2B9XA 1YBQB 4EXQA 2Y0FA 3KMSA 1XIMA 4XG1A 3WQWA 4OZ3A 1C0UB 4M5DB 1MQPA 3N73A 3TQKA 1VQ9S 4PUKA 4CCZA 2HWGA 1QSYA 1EJVC 1LWCB 1ZTTA 4DR6J 3AT1B 4ML4A 1BE4A 3KLFA 4XWUA 3TEHB 2GJIA 2VTFA 1B4SA 1HFEL 4NA2A 1ZAJA 3EM1A 4KCUA 4E8CA 4N6FA 1I94F 2RHGA 2WMFA 4O19A 4X4UA 3CWHA 2K7JA 1BC6A 3BAXA 1KSPA 3FA5A 5BXIA 4ANDA 2KG1A 3OSNA 2QW5A 1PKLA 3CL6A 3M8QB 2BYCA 3DM2A 1Q8LA 2MKHA 5BOFA 2LYVA 3GNPA 3CD7A 4H4OB 3CNQP 3CXCR 3F1QA 4O3OA 4DO6A 3QPZA 3PEJA 3PJWA 3W4RA 3N3MA 4XAZA 1U33A 2VFIA 1LW0A 2V5KA 1ZM2A 4IPJA 1YRTA 3HSGA 2W8LA 2F2KA 3EPOA 2FC9A 1MDRA 3PZIA 4DV4F 2PDIA 1V03A 3W71A 5A6SA 3AS0A 4PULA 4DR1J 2EO7A 1LL4A 4Q7AA 1J5SA 3G1RA 1Q16B 2NZCA 1FBAA 3OEXA 1XLEA 2O92A 1TELA 4PBEA 3NQ2A 3TC6A 1KR0A 1BF6A 3Q86A 3T1HJ 1TTPA 1XSIA 1CXIA 1XDJA 4MB1A 4EK7A 5BU6A 4H04A 3K30A 5J5RA 1FX2A 3A24A 3I4HX 2R82A 5D4YA 1IXNA 1VCFA 5A2BA 1CULA 2Y1RI 3BO2A 5A0YA 2FZ9A 2QEZA 1CECA 3PZGA 1ZAXA 1TIMA 5F41A 4H41A 3K5PA 3ABZA 1Q45A 3NL5A 2J6SA 4YB6A 2E0PA 2PDJA 4N47A 4FMVA 3IS9B 1W9VA 3R0UA 1HQEA 1WUUA 3PZUA 2ZBQA 1T05A 2VXNA 3UYIA 3PFRA 3W62A 4DHVA 3BQ2A 3V7PA 1R3WA 1WAWA 4RXFA 4ADSA 1K73T 2GGJA 3I4KA 1LTDA 4G65A 3WHIA 2CLKA 4OZ2A 1R2SA 4M6VA 2ZDSA 2OPRA 4Q4QA 4DJED 3C6TA 3TFXA 1UEUA 3O2LA 3DAQA 3D68A 3KVMA 4N42A 3CHCA 4ZSUA 3TUZC 2XVPA 1U30A 1R8AA 4FNUA 1RAKA 1TU0B 4FNRA 1OJ4A 3U57A 1UH4A 1YJRA 5HBMA 4ED3A 4O3NA 2C13A 4DHGA 3TOPA 1KGWA 2VZ9A 2NXUA 3I65A 3K8LA 2Z8QA 1S9GB 1W3TA 2CJBA 5BR8J 2FB3A 3DMJB 4LFCF 3MM6B 2WZIA 1J0ZA 1RKJA 3N12A 1G7UA 1MRQA 3CO8A 5T9CE 2Z7KA 1JG9A 4MSSA 2XMWA 4JIPA 1FFSB 4LF8F 4PUWA 3W2VA 1XPGA 4AFYA 4OX6A 1F4AA 2EBEA 1E9IA 1J0KA 1ISXA 4ZO6A 4GYKA 2X1GA 5FJPA 5DG7A 3KEHA 4ZQRA 4QCEA 1EA0A 1X4CA 3HFKA 1NELA 5GMEA 2WVVB 2RSQA 3MP4A 3MSRA 2XSJA 2M52A 4R0JA 3BDEA 1K9EA 4QIWD 4ZVTB 2W61A 1EFZA 3I5CA 3FC9A 1GQNA 1UQZA 3LZ3A 3CC7S 1ZPTA 3TW6A 2C2ZB 1FUYA 2IKGA 3FBBA 2OD6A 1XG4A 3UWWA 1JDEA 4CDIA 2ZE2A 2QA2A 2A6LA 5JU6A 4GUJA 2ODOA 2YKKA 4GZIA 4GO7X 1TA3A 4QBXA 3KBMA 1NH8A 1VS1A 4FR1A 3DH7A 4EBEA 1E6YB 2G96A 1CNVA 1N5YA 4CO5A 3WJXA 1KTCA 4KFNA 5CD4H 5L39A 3EKLA 4I64A 4LWWA 4NZ1A 2RQ4A 3A4WA 3W84A 2VL4A 1UZHA 2H54B 2YXLA 1DRZA 3Q8PB 2NXJA 3PX0A 1RWUA 1FJCA 3NZQA 2D9PA 3DGPB 1V5VA 4C0BA 4HTIA 4OI0A 1G1XA 2MGZB 1VI7A 3S46A 4ICCX 3AD7C 4B9TA 1RT7A 1PO6A 4YVPA 1E6RA 3KOYA 2PODA 1XN9A 1H61A 3Q8RB 3I3DA 2PDBA 1WKLA 3W0KA 5MLCV 4D6HA 4CLTA 3CJ3A 2N3LA 2QGFB 5JXSA 1OPIA 2FLOA 5J2PA 4HEA9 4TY8B 4ETXA 4DQIA 2E4TA 3CAWA 1US0A 3KVLA 3D5MA 3URAA 2Y8KA 3GXIA 4RE4A 2Z25A 3LP0B 5FIIA 4BWMA 3K8KA 2UY4A 4AYGA 2VU5A 3G6YA 4WY0F 3W28A 1RWXB 5I3JA 2DB1A 1SV5A 3P5YA 1G94A 4LXFA 3L65A 3DHPA 1K02A 1J2BA 3JXOA 4MIBA 3GLJA 4MJ4A 3HULA 1M7XA 1YBQA 2NLYA 3IJ7A 3JSMB 3G1AA 1D3CA 2GJ2A 3VNYA 3U2OA 2VZUA 1EF2A 2O9RA 3EEZA 4ZPDA 4YHEA 3PFOA 4QQBA 4M5DA 3O6AA 4B3MJ 1Z1ZA 2GMJA 2XZTB 2J66A 2DNOA 1CBKA 2GVEA 1KVKA 3U27A 3M9MB 2IKJA 3K5XA 1BKSA 5ETKA 3H2VE 1PBAA 3IIZA 3QJAA 3DLKB 3D6NA 3W7QA 1U45A 3TP2A 3LA4A 3B03A 4O11A 1RHRB 2ZUTA 2ZXBA 4NZJA 3FFIB 1DY3A 2H3DA 4LEFA 2VX5A 4IFRA 5CZJA 4D9PA 3ARYA 3BJFA 2D2GA 3PSVA 3KRSA 4NNAA 1UEKA 1X4DA 3CPRA 3FSIA 5AYIA 2Y88A 3H20A 3M8QA 1W1YA 1AG1O 2IDLA 1EAYC 1APSA 1EQPA 3G96A 1UR8A 3BLIA 3MGJA 4DUWA 2AQ4A 2CU0A 1UQYA 1XYBA 3DG6A 4LFBJ 1B99A 4YCOA 3R89A 3W5YA 2YYUA 3FCWA 1T7PA 2FD2A 4AC7C 4GJJA 2AGKA 4H8UA 4DBDA 2E1PA 2QMJA 1A5LC 1ZYQA 2INZA 1QAPA 2XWYA 3I68A 1DWFM 1JD9A 5DMYA 3VTRA 5HDRA 3W9JA 3G8TA 2PWVA 3AH6A 2PSZA 2J24A 5BRPA 2HQAA 1J5OA 2O56A 3QOKA 5E3QA 3BUVA 4AZ6A 3AY0A 5GNZA 4IP4A 2VFHA 2W0UA 4A8IA 4D6CA 1RISA 3R6LB 1T94A 2HEKA 4QWBA 3NURA 1T99A 1REGX 3V2UC 3RCNA 3C0QA 3TCSA 2LA4A 4RWWA 3PTMA 3W2MA 3W7OA 2WZMA 2XIOA 2BB0A 4DL6A 4U5IA 3WDOA 2PDGA 4GKKF 2OLWA 2TPSA 3S1VA 3NWRA 1U1OA 1KFBA 5G0RB 1SQEA 1VRTB 2H5JB 4J9UE 1OG6A 1ZP4A 1HNZJ 2E1DA 3J7YI 1HWIA 2GQAA 2XY5A 3LSCA 1WTBA 5G2IA 4C6NA 4ZITA 1B2YA 2JFEX 4U28A 4PXCA 1E0UA 1VQ4S 2KX9A 3GXPA 3R7BB 4WTOB 4E6MA 4M82A 1UA1A 1R27B 2GFTA 2WB5A 3BLFA 1RXOB 1YJNS 4Y9MA 2J6TA 2FUG9 2IJRA 5D33A 4ADTA 4K4WA 5IQ6A 3E2SA 3A47A 3GU1A 2B0GA 4DF1A 3E38A 3Q2SC 4L9XA 3DXIA 3WUEA 2VCAA 3ABSA 1SQFA 1DPMA 3PKYA 5EFDA 3O05A 3HB9A 1EKSA 2MY7A 1IHIA 4O28A 2G97A 3FBFA 3MM9B 1S9GA 3GPAA 3DFEA 4RX6A 1GGOA 3H12A 2CDRB 4PG5A 1R86A 4AG0A 5C0QA 2EAWA 3PO5A 1K4GA 3PUDA 3RLUA 4C60A 2EC0A 4AY8A 2FZBA 2BABA 1UKUA 3IGUA 4QU7A 4GVFA 3QJPA 4ROQA 1RT5B 4J37A 4KC5A 4UOFA 4CQ8A 4GLEA 2WVSA 2P3ZA 4WFZA 2CQGA 3W53A 3N1AA 4MGGA 2F3JA 2WVVA 3H8AA 1K47A 1VCVA 4DV6J 4M7SA 2XG8A 3KG0A 1N5TA 4PG7A 4OT7A 3MMWA 2PGRA 2IJFA 2D22A 2PDQA 4HA0A 3UNDA 1E0XA 1PXGA 1RPXA 4C8ZA 1PYOB 5C5YA 1DQXA 4JUZA 1JLCB 1C8QA 1VFMA 1TUWA 4OI1A 2QYGA 5JIWA 2GJLA 2W9MA 2LDYA 3OLGA 1AFSA 5C54A 5LSMA 4NX0A 3L66A 1FWIC 4MJZA 4MWAE 1LFPA 2O5DA 3MHUA 4FBTA 2VFDA 4RE2A 1UMYA 5TBOA 1TKTA 2RT3A 3QT5A 1JQGA 2JGQA 3CMGA 5BYSA 3CIMA 4F3OA 3PY2A 5EL1A 5AXLA 2FQQB 3H4XA 2HS4A 1LT7A 4ZIWA 3VIIA 4ADUA 2K2PA 1NKBA 4FALA 4PAAA 3QLLA 2DVXA 3AODA 3DDMA 1FDJA 3GIRA 5E6ZA 2MANA 2CHOA 3LCGA 3FGVA 1GMWA 2EK1A 1XPYA 4Y8EA 3N2OA 3R8GA 3TTSA 3B4DA 3JTNA 1BWLA 2P50A 1S2CA 1LXNA 3W6LA 4F48A 3U3HA 3V18A 5IT9U 5CYMA 4WSKA 4UUXA 3NM3A 3OLIA 3LP0A 4XO0A 3HBLA 1XW8A 1BYCA 3KLLA 1ZAVA 1S12A 3NQAA 4WKAA 2V2CA 3VINA 4AIEA 4HPHA 4AY7A 2DGTA 5E70A 3PPCA 2L5HA 3IUHA 1ZA2B 4BCAA 3EWUA 4CN6A 1KLZA 3BGLA 1C91A 5HMDA 3FXYA 3ZMRA 4NAFB 5CLTA 3JSMA 1DBDA 3UBPC 4IPPA 1RALA 2V9KA 3HVTB 4PTWA 1F5CA 3I0SA 3ZTQA 1VQTA 3VNIA 2P5VA 3THQA 3G8QA 3NKYA 2QL9B 5KFNA 4X64F 2A4AA 1F9CA 4DL2A 1HLWA 5KSWA 4ZR8A 3DLKA 1H3GA 2N7CA 3FNNA 4ZPVR 3CAVA 3VIFA 4WDWA 1X9SA 2VM8A 4P7LA 4LVAA 3BV8A 3N9UC 3NGDA 1Q6FA 3T4WA 1FTCA 3AALA 1HI0P 3R79A 2C3ZA 3KFTA 2RUGA 4ILMA 2BNJA 2RVJA 3RPMA 4EBDA 3PVXA 1U2CA 3SZ8A 1B30A 1WB0A 4BFAA 4CNZA 1TZZA 3T0CA 1Q4WA 2DHGA 1ICPA 1BD0A 3GKAA 3K1GA 5DM6Q 4ZVSB 1MO0A 4KKOA 2HVNA 3H5UA 3SV3A 1J79A 3RM8A 4X66F 4J3WA 3T7VA 3M6YA 1NZ8A 4I3GA 3ZFHA 2FGCA 1UZDA 2J62A 2ON3A 2OX4A 3AS3A 4B5WA 2WAGA 3KUGA 1P5BA 3TDFA 2FHCA 5LT5A 4GCXA 1WDWA 3UGRA 1XK8A 4IZGA 3IUIA 1KLMA 4IIDA 4YTRA 4UTFA 1NNDA 1U1JA 4OBRA 2M5YA 4WSHA 4DJBA 1CEOA 4JEQA 5CJMA 3RFAA 2YNFB 3M2UA 3E2RA 2WSRA 4DM2A 1MMDA 4Y3CA 1ITXA 2ZIDA 5LIYX 3D9BA 1V3RA 1FWTA 1QPNA 3HKWA 4UTUA 1MXDA 4ZXLA 3NRBA 1H41A 3PVFA 2OMOA 2QVHA 1US2A 3QC3A 4LANA 5EX3A 1L3VA 2OFHX 3QV9A 1OT2A 3OOQA 4WDXA 1POJA 3GCXP 4WP9A 4ZCLA 2X1AA 5EN1A 1KWKA 3D28A 5FF0A 2E1AA 3CULA 3UCUP 1B0IA 3LGEA 3P3DA 3A3HA 1AMKA 2ASYA 2QUMA 2IPFA 2AHOB 2YKQA 5FAJA 3W00A 1HBUB 3N6QA 4QPTA 1X4GA 2DIKA 4JQ4A 3D54A 2E1WA 5BMWA 1NXIA 4WCEQ 3GYEA 1JCLA 4OMFG 3BZQA 3NZPA 3UA4A 1UD3A 3ONQA 2XSXA 3O2IA 2YDRA 3GDRA 5FJTA 5B7WA 2UXDF 4YS2A 4CNPA 1BHNA 5HROB 2RDJA 4HDHA 5BJRA 2FPHX 1U02A 1LV5A 4TX6A 4F8XA 3CHVA 4Z2XA 1UH2A 2I1RA 2W79A 2J9CA 3ZJ6A 1HNIB 1T9XA 1GJWA 3WQPA 1LWEB 1FJEB 2DT9A 8RUCA 2VKZG 3QF0A 3UG5A 4KMQA 3AAWB 5AYYA 3MM9A 3C6CA 5K7JA 4OX7A 1DQWA 2FTYA 1YX2A 3MHFA 2BZNA 1UUOA 2GC8A 1EUAA 1HF6A 2X7VA 3LOUA 5LL6d 4K4UA 4JI6J 3CEUA 4C98A 4E2VA 5DT5A 1M68A 2UUAF 4ICLB 1JI1A 4ZVRB 1WXYA 1KRAC 5E6YA 2YNGB 3MTWA 3QY8A 2DH7A 4ID5A 1LQ0A 2VZTA 3L4XA 1NDZA 2I0XA 2R8GA 4M1KA 3LQVA 1SO3A 1NU4A 3N0VA 4Y96A 2HFNA 2QPXA 1V3KA 3DBNA 4ZP7A 2VPYB 1XBYA 5LZLA 3NPVA 4O57A 3PRDA 1K3UA 2ZFAA 4O10A 1YKWA 2QUNA 3GSDA 4N41A 1RWNB 3HK2A 1YNQA 4JBRA 1F7BA 4DDFA 3G24A 2D41A 2BOFX 4AXNA 2WKGA 3AD9C 1V79A 4FS2A 3QV6A 3RR4A 4FXVA 1IJEB 1RBLA 4H9ZA 2VD3A 1JLGB 3FZ2A 2CRLA 3D3CJ 2ZCGA 1DKWA 4QOTA 4IYQA 2JDJA 5JH1A 4A8MP 1GOIA 3IIXA 2LLZA 2RU9A 1UL3A 1WP6A 2BGQA 3NAVA 3O8AA 4IMDA 1HBNB 4LCRA 1T8QA 1WXJA 1Z32X 1G4PA 4W5UA 3GW3A 1UPMB 2WSCC 2Y63A 3LRMA 2Z0GA 4DR3F 1WKEA 3ZZTA 4WU2A 1AZSB 3SCRA 1E1CB 4BCEA 1SJAA 4J9KA 2Q6ZA 3VE9A 1RWKB 4NA1A 1PYMA 4JTRA 1HQUB 1UG6A 2A7RA 4M8UA 1TPVA 4ER8A 2NXCA 2WPBA 3NZGA 3OTBA 4LFAJ 4NXMJ 3QPIA 2PEVA 2YWHA 2A3BA 1EP4B 1I75A 4JQ2A 4G6CA 4HACA 2G9OA 4ZB5A 1L6WA 5AC8A 4QISA 3EGNA 4B9ZA 3E02A 3P81A 1PSDA 2AU0A 1SUQB 4QBUA 3UW6A 4BEQA 5CSSA 3SW6A 2G0WA 2YA0A 4PRWA 1I5OB 2GAHC 4H4KA 3BEGB 3SCOA 2DIVA 3GNNA 4PYSA 4G1NA 5C24B 5F2GA 4LR7A 1J0JA 4J9QA 1XRVA 2BVTA 3M7VA 4NAEB 3MWBA 1PAMA 3HHLA 4FB7A 1DJWA 2HXUA 4H4MB 3W82A 3Q45A 4H1ZA 4QLJA 3GXTA 5BWFA 4HT5A 3HVTA 1Q7QA 4L75A 4ZVFA 4UF4A 3G6VA 5LSLA 1GW1A 2PDHA 3M1VB 4AX6A 5ETLA 1HT6A 4CH0S 3CZKA 4CEXC 2DT3A 5DDQC 3F2DA 2ZNZA 1E4MM 1Q8IA 1E73M 3R5BA 3MMCB 1SL0A 3BAJA 2CWXA 2RB7A 3FAXA 2K3KA 1L3UA 2DR7A 2WK4A 3H42A 2PI6A 2C1EB 1VHIA 3O44A 4DV3J 3VD3A 1LM1A 4OZNA 3UN5A 4KB7A 1YSJA 4PUMA 3AFBA 3EWZA 1DJGA 1L6GA 3CJQA 1TWSA 2C0HA 4NY2A 3NG8A 3R12A 3EPGA 4CLZA 4YHHF 3PP7A 1EGMA 1ZENA 3FSTA 3RB3A 3T05A 2REQB 1QSSA 2CQDA 4NLUA 1H0IA 1ISVA 2BP1A 1UROA 2RRNA 1EQMA 4QM1A 1EBHA 4QS6A 1XLMA 2B9YA 2W62A 4BI5A 1U8WA 2YQ3A 1F6TA 3TR2A 2KJWA 1KBLA 2GJRA 3BH7B 4BHYA 4LPCA 3W85A 3L4TA 2V0TA 4IO9Q 3DBPA 4N2YA 4LF4F 2JLGA 2PLCA 1DXIA 2YNFA 4LVNP 3EOLA 3P49B 4RV8A 3ZWSA 1G4SA 2DT0A 3EOUA 3IR6B 3W27A 4G6VB 1RJRA 1N32F 4C1KA 3TN4A 3P74A 1BWVA 4HJFA 4FPRA 2HBXA 2IPJA 5LM7E 3VGTA 3WF1A 9RUBA 3QVQA 3TC7A 2HRWA 3NL2A 4X2BA 1NJZA 1D1UA 3FMBA 2EG2A 2X3GA 3QLHB 4HZMA 3VO0A 4JV5J 4C6BA 5E2QA 1M90T 1PIIA 2H3EB 3HO1A 3BM7A 4R53A 3OYXA 3MVIA 1NLKL 1WOOA 4GPNA 4HDGA 5KG7A 1EX5A 1W1A1 1MUMA 3EPIA 2QO3A 1N56A 1R7IA 3QWPA 4MYUA 4R5PB 3OVBA 5I24A 1VMBA 3M0IA 3N4AA 1TJ1A 5ECUA 3EDRB 3DGBA 1CQNA 2W2PP 2KB2A 3PM9A 2QG9B 4AD2A 4DJEC 4W98A 1QNSA 3AHTA 3S1XA 8TIMA 2WWCA 4G9PA 4ZN3A 5T8GA 3ARQA 4QCLA 1FJGF 5HROA 3VAFA 1HQ2A 1U0SA 5I03A 4UFHA 2AW0A 4JBCA 2KFZA 2XEXA 1TKZA 4P71A 4P2MA 2FGZA 4RL3A 1Z89A 1AVAA 3N34A 2OWWA 4LW7A 2BVWA 4Y28C 1HNIA 3BO3A 1LWEA 4UUWA 4JTLA 4LUIA 2XSFA 3L7RA 1NKCA 3FOKA 3TE9A 5FEPA 1O5RA 3U1LA 1BQNA 2HGMA 2HBRB 3DRYA 4WXOA 5CABA 7FDRA 4Z2KA 2P8BA 3CUZA 4ICLA 5E3RA 4B2DA 3T9ZA 1TR9A 2YNGA 3M5XA 3PANA 1JAEA 4ZIVA 3BV4A 5BRQA 1W3IA 5H9FJ 2DSVA 3DDIA 4L61A 3QPYA 2G13A 1WG5A 1D8WA 2FJKA 1SJFA 3PBWA 2OH2A 3IGXA 5DDOC 3SJNA 2HE8A 3S5NA 3MPUB 1S48A 3RRGA 5A2QY 2Z1XA 4B3ZA 1SCJB 1DBTA 3MURP 5DLFA 3TYUA 3B0VC 3P5BP 3AJ1A 2CPUA 3WMSA 1MW7A 1LNQA 4IJBA 4OV4A 1W3JA 4YR3A 2CESA 4MG4A 4DSEA 1A80A 1RAGB 3MEEB 1S5WA 1JLGA 3PUEA 2R7RA 1UTAA 2XMUA 3LA0A 1CWYA 1KS2A 1TP7A 2RJGA 2CETA 3ITVA 2ZICA 4AIBA 1VFTA 3SFWA 1RAJA 5DZ6A 3DYAB 3QV7A 3MV01 3R10A 4LF1A 5I07A 3BC9A 5I2UA 2DR6A 3LP1A 1VEPA 1HBNA 2VV5A 1PKMA 1VAHA 1PZ2A 1F5ZA 1O12A 2MJNA 3SGGA 4DJFC 1RQBA 4PB3A 3WBXA 2VGFA 1HZYA 5CZSA 4KERA 1AZSA 1E1CA 2ZUNA 2IRXA 4UXDA 3ZT5A 2GAGC 4PXDA 3EVWA 2A3LA 4ZVPB 2FFCA 1NY1A 5FSDC 1SR0A 3R5EA 4LGXA 4YIWA 2J0WA 4L73A 3OL6A 1UVMA 2GX8A 4LRTA 5G4DA 3VM5A 1RCQA 4B3KA 3KG1A 4MWAA 3SUUA 4TY9A 1NARA 3TN5A 4E4UA 4DF0A 4BI6A 1XIBA 1FKPA 1X9WA 4KE5A 1N8FA 4GI8A 5A6BD 1SUQA 2OJPA 4W87A 4O13A 2GFFA 3P6LA 4XAKA 3SCQA 1TJ0A 1NH7A 2GK1B 4IQXA 4C6OA 1R3RA 3AXXA 5SWUA 5BXPA 1FWRA 4NAEA 1FK9A 4UOCA 3EMTA 4O17A 4RZ4A 4H4MA 4V1Ak 4DV0J 4CO4A 4K4YA 3O6QA 1SH3A 2RAGA 1UFLA 2QF7A 2X16A 3KNGA 3GWQA 4MPQA 1CPUA 3M1VA 3E2VA 3B8DA 4ZCIA 1D9EA 4WE1B 1HR0J 3QAUA 2GPTA 1F3XA 2RUSA 4FIRA 2U1AA 5DXXA 6ALDA 4WIIA 4GI4A 2DVTA 3OB8A 3MMCA 4M5GA 3NEVA 2HQDA 1FVSA 4Q4KA 2R2SA 1W3LA 2XVNA 3IWPA 4FIQA 1PEZA 1OO0B 4ERIA 2DGUA 3W1MA 3CCES 1WOAA 1QI0A 1JCXA 3MI2A 1Y0EA 4C0HA 1QATA 3KS6A 1DJYA 1RVGA 1G4CA 3OBAA 2CADA 1FWDC 2RH3A 4USTA 3VOHA 3JAMU 3MSGA 1X38A 4CN1A 3ZFVA 2LXIA 4ED4A 5HVFA 4TUFA 4B3RJ 3WNPA 3IO1A 3L7UA 1VFOA 3WQOA 3MR5A 1Z44A 2XM3A 2XGBA 3EMCA 2EFQA 3Q2DA 4HU3A 2PF0A 5K14B 3FX4A 4MZYA 1MXSA 2Q8ZA 4QEHA 2QLWA 3CU2A 3SMZA 1J01A 1W2IA 4C65A 2M7SA 4ECVA 2JGYA 2IQ0A 2Z2BA 3W1RA 3RN6A 3PC0A 3WLNA 2ADBA 5GAEU 4Z2JA 1PTDA 2WHOA 2MY8A 3FVMA 4LF6J 1I4NA 3S3GA 1FD2A 1V6WA 4DWSD 4QG6A 4U3AA 1UJ4A 2C14A 2DH3A 4WK3A 3K57A 1J18A 3DFNA 3UD6A 1XBWA 1R31A 1XV8A 3H4BA 2QQ6A 4ATNA 5CLWA 3CDAA 3QLHA 1WHWA 3HO8A 3LWMA 2DZPA 2XY6A 3PPHA 2DR8A 4RW7B 5HN0A 2MXYA 1IR1A 2QCCA 3BPDA 4HT7A 3STFA 3QFEA 1H72C 4PCPA 2GSHA 2WVDA 1WG1A 4A3HA 3AHPA 4KYZA 5AFDA 7XIMA 1TL1B 2QSFA 4O1CA 3M9YA 1A0OB 2WCAA 1IE7C 4HNCA 4RZ5A 1EXPA 4FBUA 1W8SA 3SDOA 3PZNA 3DI1A 1VQPS 4WKHA 3IIVA 3W86A 2BMBA 3V5FA 2YPZA 3KL3A 3OJSA 4ILLA 2DIJA 1LQ9A 1EZWA 4LF5F 1HNWJ 1FOBA 1DIKA 4A21A 4LH8A 1Z2LA 4YS1A 1S2UA 2EVZA 2OZ3A 4F4WA 4W92B 3TH6A 3KTSA 4IT1A 3KJVB 5EHHA 3N14A 3TLQA 4JOMA 3UVAA 1R6VA 2V5HG 1AYEA 3MMTA 4QLLA 1XYMA 4DF4A 4H6EA 3PJUA 2BKNA 3CAQA 2R9LA 1JYNA 3UE2A 3MW7A 1QWGA 2YX4A 3N11A 3VOFA 2MZ1A 2XFRA 2ACUA 1JNZB 4PN2A 1UZ1A 3F5KA 1S2WA 3C0SA 1ITUA 3W1PA 3EDEA 1A5SA 1REVA 2YCLA 4MNMA 2DNMA 2CWNA 3GRIA 3E1F1 1OBAA 1VRUA 2MKIA 4U7UD 4DF2A 3REQB 2GQ8A 2X40A 5HMZA 1B3ZA 3I4EA 2F8EX 3WH9A 5I7GA 1S4FA 3A13A 3W26A 1WAUA 2KN4A 4FVMA 5HLFB 3MUXA 4DSJA 5K3VA 1NK4A 2WONB 1XBVA 4UW2A 5SZTA 4GC4A 2H48B 1XBXA 2XI3A 2GJFA 1F2GA 1DHKA 5E3PA 4DNMA 2DHXA 4BWJA 2PWEA 4AISA 1BG9A 2VEPA 3UNYA 4RU2A 2D3LA 1XUZA 4PMVA 2XZDB 3RGIA 5XINA 2KH9A 1QJWA 3V0SA 1YK9A 2PIIA 2R8IA 4PBFA 4KWVA 2AOSA 4Y6GA 1HNVB 1PIEA 2DD8S 4Z7CA 3T78A 4P2SA 3GIMA 1FHTA 3MVTA 1AB8A 1JXJA 4ZODA 2P1FA 1EGZA 3N6HA 2BS9A 2C2OB 2ZVIA 3NQ8A 3DYAA 3J80Y 3R7NB 3EGZA 1NP0A 2PTXA 4B3TF 1H51A 1E6QM 1Q66A 4WY0B 3TZWA 1G67A 3TVAA 3VOIA 2VGGA 4RDVA 3AMCA 4KETA 5JH2A 4DZDA 3BG5A 1N33F 1E9LA 2V5BA 4JTJA 1Q7LB 2LCWA 2DU2A 5A6KA 5BXSA 1M7OA 1BQXA 1U25A 3CSKA 4V2XA 4XVEA 1IEXA 2CNCA 3TONA 4OHXA 4C90A 4Y7EA 4URQU 3FAWA 1XJWB 4YUDA 3HGOA 1JFXA 5CC5A 2I9UA 2OYKA 4IOTA 2GYIA 3DX5A 2AZ3A 4B9VA 5ETOA 4AX7A 1H6KX 1B3YA 5D4PA 3P93A 1LF1A 1ZOTA 4MADA 2BBEA 1VYPX 1W54A 3KK1A 3G1VA 2VI0A 4CN4A 2LU1A 3ZO9A 4GFSA 2GK1A 4H3DA 4GIYA 2FTRA 3U5YA 2BXZA 3KFWX 1KFWA 2BLEA 2HW3A 1LEOA 1W37A 3WJSA 2ZZ3A 2E66A 3STPA 3HMJG 3CT9A 1S5ZA 4LMZA 3W7DA 4IMEA 4ZOEA 2EBGA 1XGZA 3PPFA 1XR6A 2MHNA 1Q86T 3IRXB 1OCJA 3QFWA 3R43A 5GJNA 2CPXA 3UDVA 5AXNA 3LXCA 5BU9A 1M3UA 1KCXA 3GXDA 4BEUA 1RP9A 2VPXB 3OTCA 2QFJA 3WF2A 3P5TL 2DNPA 3BG9A 3L2LA 4I5UA 1FX6A 4LYQA 1WACA 2PMQA