4GRSA

Crystal structure of a chimeric dah7ps
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
333
structure length
333
Chain Sequence
MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLDCVESVVRVLKPYKLVSREFHPEDTVIDLGDVKIGNGYFTIIAGPCSIESRDQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDISAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phospho-2-dehydro-3-deoxyheptonate aldolase, 2-dehydro-3-deo
publication title Engineering allosteric control to an unregulated enzyme by transfer of a regulatory domain
pubmed doi rcsb
source organism Thermotoga maritima
total genus 106
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.54: 3-deoxy-7-phosphoheptulonate synthase.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18152 DAHP_snth_FXD DAHP synthase ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4grsA02
3.30.70.1140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phospho-2-dehydro-3-deoxyheptonate aldolase; domain 1 4grsA01
5F4WA 1F6KA 1SO6A 2VXNA 2BSLA 4NT0A 1LOLA 4TMCA 1ML1A 3LCWA 3VCRA 1GOXA 1W5MA 2R91A 1NVMA 3N14A 1CI1A 2V5LA 3TX9A 3QQ0A 2Z0IA 3IV3A 4JR5A 4XTIA 3E0IA 4WJEA 3C2FA 3VE9A 1KM3A 3VNDA 5AHFA 3C56A 3W87A 1RD5A 3LXAA 3UZJA 3PF3A 3O1NA 4OHQA 4LW7A 1FXPA 1YTKA 1SZFA 4DBDA 4UTUA 2JGQA 1K3UA 4R34A 4ZQRA 3SIZA 3WJWA 1WX0A 1ICPA 3W7LA 1RVGA 1OYCA 1LLZA 5IBXA 3M1ZA 3TV8A 3UXDA 4NZFA 3M9YA 4KKXA 3NQAA 3P8IA 1GG1A 4NXSA 2Y7GA 3UWQA 1AW5A 3TFXA 2X30A 2X2GA 4IX2A 1W8SA 3NPVA 2F7FA 2QCHA 5G1YA 1H51A 1FWNA 2YYUA 2NX1A 3N73A 5BW6A 4PA8A 3O6DA 3TXZA 3LCGA 1W54A 2QCDB 4BK9A 3TSBA 3QC3A 1KLZA 3HGOA 2QCLA 1K7XA 2JKAA 3G8RA 4EOUA 2ABBA 5CZTA 3W74A 2Y63A 3BGGA 3QFEA 4PC8A 3UWVA 1THFD 2QCFA 5F1VA 1XBVA 4POCA 4N2YA 4JD4A 4OWGA 5BRBA 1IXQA 4O19A 4Y6GA 2CZEA 3L0NA 3R5EA 1V7YA 2DJXA 1PHQA 2ZZ3A 3HO8A 2VFIA 3LV6A 3W7KA 3DI1A 2VFGA 3R8RA 3H53A 1FUYA 1WAUA 2E6YA 4IWWA 4RR4A 3O16A 1K7FA 4N9EA 3E96A 4ZL1A 1OFRA 1JCMP 3HMJG 2ZDRA 3W2MA 1L6YA 3SSJA 1TTQA 3FYPA 1H61A 4A2SA 1FQ0A 3WJYA 3A24A 3C4UA 1E51A 3M0ZA 5LGXA 4MLJA 4UTHA 3CHVA 3IRDA 4YMZA 3S5YA 3S42A 4Z08A 1GTEA 1H7PA 2WO5A 3LCIA 4I9AA 4FX8A 3NO5A 2H3DA 5D33A 4IPJA 1U5JA 5AN7A 1NSJA 3MUXA 1XBXA 1YTDA 3PUDA 2GVJA 1JCJA 2YW4A 5LHEA 3ELFA 3OIXA 3B0UX 4O52A 3K30A 3QMSA 2FFCA 3NR0A 2TSYA 3LXBA 1KBIA 3C8FA 3DFNA 4BI6A 4L4LA 2C19A 2RDWA 1Q45A 3L0GA 4O13A 3B4UA 3DI0A 2ZA3A 5CGQA 3STEA 1L9WA 5DLCA 3HF3A 2B7QA 2OZ0A 3L9CA 2P10A 1I2PA 1VCGA 3DFOA 4JGDA 4WY0B 4JYDA 3W72A 1D3HA 2JGYA 4UTJA 3W7EA 1P5BA 3VKJA 4PH6A 1XBZA 3NXFA 5GVJA 5BOOA 3QPYA 1LOSA 3RU6A 4LC6A 1W5QA 4JTJA 1A5BA 1XBYA 2A2IA 5HJLA 2VEIA 3G1XA 3NEVA 4HSOA 3UY7A 3TE9A 1D3GA 3VFLA 1JR1A 1GVFA 1LORA 1JUEA 4R33A 4K37A 1O94A 3ABRA 3W70A 2WNNA 4OGZA 3STCA 4IMDA 1TV8A 3W7RA 2V8ZA 3W75A 1TPFA 3TAKA 1GVOA 3IIZA 5LGZA 3IGUA 5HUPA 2VEPA 2ZBTA 4LVGA 4CQ9A 2ZRZA 5D02A 1G69A 5F4SA 5D30A 3BO9A 3HGJA 2ZRWA 1MXSA 1QDSA 1O4UA 4HNVA 3UXAA 2XN0A 1SU5A 1WBJA 3W1UA 1HO1A 4IMCA 4GRSA 3L2IA 5K9CA 3W1XA 5CPMA 2ZQ0A 5DCEA 3MP3A 2HSAA 1SFLA 1M7PA 2ZFAA 5I3FA 4M6PA 1OJXA 4O0KA 2Q3OA 1FDZA 3EX4A 4NVTA 3TMQA 3BW4A 4MVAA 3CIWA 3HGSA 1KA9F 2A6LA 1U83A 3UZ5A 2QJHA 2J9YA 2VEKA 1R2TA 4P61A 3LHZA 2ZRYA 3W22A 2BLEA 3ZR4A 5HMSA 2FPTA 3THQA 5C6MA 3QSRA 1FX6A 4WY0F 4GNJA 3A21A 4BI5A 1KV5A 3OVQA 2QF7A 3KX6A 3P60A 5DXYA 3DKJA 4WZHA 3P74A 3G1AA 2B0MA 4GC4A 3G1YA 2FDSA 3IIOA 5DELA 5C55A 1SUXA 1GG0A 5AB3A 1G7UA 1OABA 3LHTA 3W7QA 3O6YX 1K03A 1SO4A 1Z42A 4I7WA 1ZAHA 2EPHA 5D2XA 3WFAA 1PHWA 4MJZA 2QDHA 2Y7DA 1KM1A 4GJ1A 3SECA 2DU2A 2X1TA 1FWWA 4KFNA 3NQ2A 4FIRA 4HHPA 3W7GA 4LVAA 4YLWA 5U7SA 4PTNA 3PVFA 5HINA 1GPWA 1W5PA 5EL1A 2NV1A 1FBAA 1V5XA 3W7MA 3CTLA 3W1RA 1MSSA 3PUOA 1FXQA 3EB2A 4JIQA 3USBA 1LM1A 4UFKA 1OVDA 5D05A 2RDUA 3I7RA 3UD6A 3EKLA 4A21A 2FPYA 2AQWA 4N9BA 1LBLA 2ZRVA 2QAFA 1TTJA 3M7WA 1A5CA 3EXSA 4AWTA 3MYOA 4ZQOA 7TIMA 1LCOA 3LCLA 2NX9A 1GVSA 5KTLA 2G95A 3MI6A 5AC7A 1UCWA 1I2RA 5L6UA 3ZWSA 2ZA2A 1HO4A 5I3HA 5D38A 3HGRA 3TC6A 2EHHA 1YLVA 2WNZA 1GWJA 5D2VA 5K4XA 3PSWA 3P80A 4NJKA 3DHDA 3G24A 4Y90A 4TO8A 1ONRA 1SSDA 2GVLA 4JYFA 2YR1A 2J9XA 2ZYFA 3P82A 2J6XA 1VPXA 3G0SA 4ZQMA 4IOTA 2XFWA 3BLIA 5I3IA 3QYQA 3S1VA 3GR8A 1OFEA 2PCQA 1IXOA 1NF7A 4JTLA 3C52A 3PB0A 1Q6RA 1T96A 2V2DA 3EWZA 3NPUA 2NLIA 3IGSA 3IIVA 3LBCA 3B03A 4NZJA 1SW3A 3MW7A 4LOCA 3S6DA 3BW2A 4NNAA 1SW0A 3BARA 3STFA 4AWUA 3SJ3A 1IXPA 1W0MA 1JVNA 2QJIA 3DBPA 3T78A 3B0VC 5KZMA 3DFSA 4HNNA 3CT7A 2H6RA 3PAJA 1S5VA 4C1LA 2NWSA 4KWWA 1QOPA 4R7JA 3VE7A 3RMJA 4GUIA 2VFDA 4MUZA 1PIIA 2DZUA 4O1BA 4IJBA 3TSDA 4ORIA 2VENA 1KM4A 1OX4A 5F2GA 3LTYA 1H1YA 4O28A 3LTPA 3TJLA 1RQHA 2YGYA 1LLWA 4DELA 3TCEA 4E38A 4XTDA 3GVGA 3L5AA 1TV5A 1TRIA 3BLFA 2DZPA 1YDOA 4RXFA 4DPQA 2PRMA 2C13A 3B05A 3W7CA 4FNTA 3NQGA 3W23A 5ABTA 3B0PA 3LCFA 3M5YA 4S2BA 3NAVA 1GEQA 1RPXA 1TYGA 4ONVA 1OK4A 3L21A 4NNBA 1WA3A 3S9YA 2Z1BA 1XC4A 4KFOA 5BMWA 4UFIA 1P0KA 1JUBA 4O4VA 1MEIA 3LRKA 4UCGA 2E77A 4K8EA 1EP3A 4NX5A 3NGJA 1XFBA 3W88A 4E2DA 4GUGA 5E0KA 3W1LA 2RKXA 3NG3A 1YYAA 5TQLA 1O5XA 1DBTA 1UB3A 4TU1A 3OA3A 5G4EA 4DO5A 5HR6A 3G22A 4JS3A 4NJHA 1PV8A 3N9RA 4Q32A 5AFDA 2RFGA 4DF0A 1HL2A 2QCNA 3F03K 5LZLA 1B3OA 2OT0A 3LHUA 3SR7A 4HNTA 3TIMA 4JTHA 4HSNA 5KZEA 5K4ZA 4HN4A 2Y85A 3F1QA 3S1XA 1N55A 1OF8A 3B8DA 3S0CA 3L5LA 1SZEA 1F76A 5F2IA 3DU0A 1KFCA 3LHVA 4O16A 2YSWA 3F4NA 3A5FA 3BPWA 4JIPA 5AHMA 6TIMA 5J5DA 5D2TA 3HG4A 3E9AA 1DV7A 1OYAA 1OFAA 4IPIA 3L66A 3S1WA 1EP2A 3GXPA 4CCEA 3SFKA 2DZTA 2V2HA 2LLEA 3LGEA 4X3ZA 3IEBA 3LCHA 4ORMA 2A7RA 5HR7A 5LHFA 1JRBA 4UTIA 4ADSA 2V2CA 3PS7A 1H1ZA 4OBTA 1XUZA 3LBMA 1SSGA 1DJQA 2C18A 1OHLA 2IQTA 3YPIA 4JDYA 2G96A 1IF2A 3FOKA 5FF7A 4GBUA 1SQ7A 1G4PA 4MLRA 4M7SA 5I3KA 4Y96A 4AF0B 1UUMA 2FTPA 3GIYA 4FXSA 4O15A 4CCDA 2CZ5A 1VYSX 1PVNA 4NNCA 4DF2A 2VELA 3NPWA 4JTIA 1VJIA 2QUUA 4WOQA 5AYXA 4QSHA 3M16A 3OEXA 1ZAJA 3P7YA 1TPC1 3EWYA 2GVGA 3G1FA 4TR9A 4IMEA 4JTTA 5G5IA 2E6FA 1P4CA 1EWEA 2E1DA 3M47A 2EKCA 1JRCA 3EWBX 1DQXA 2B7NA 3NDOA 4UXDA 4UTTC 4NJIA 1TRDA 5TIMA 1J4EA 1F2JA 5C54A 4FO4A 4FB7A 4DEFA 1DVJA 3CU2A 4EWND 4YXGA 4QM1A 3KRSA 1W1ZA 3FEMA 3W9ZA 1EB3A 2Y88A 4UTWC 2QR6A 1T99A 1OG0A 1HTIA 1K8ZA 1JCXA 4FNUA 5CZJA 5K9DA 1KFJA 3TFCA 1Q6QA 3A5VA 3Q37A 1LBFA 3C3NA 5CKSA 4UIOA 1ICSA 3ABSA 3LLDA 2A6NA 4YL2A 5HUOA 5FEPA 3W7PA 2OX1A 4A2RA 5HNRA 3JRKA 3KOFA 3S1UA 1X6UA 2ZZ2A 3OHIA 3RLVA 3ZWTA 4JX5A 3U6WA 4QNWA 3RK8A 2DP3A 1FCUA 2A7PA 3NQVA 2V81A 1ZALA 3G1HA 3G3DA 4O4WA 3W73A 4BWLA 1W3NA 1XM3A 1LYXA 1ME8A 4NQ1A 3C2EA 1OFDA 3W84A 3WK2A 2FB3A 3BV4A 2QJGA 1H7XA 2V30A 5FESA 1X1ZA 2E09A 3W1QA 3P62A 2V0TA 3UYCA 3C61A 3UWUA 3W6YA 1M6JA 3DH7A 4XBSA 3PM6A 4JTGA 1PL9A 3EX2A 4JTSA 3QPZA 4MY1A 3C2OA 1H50A 1DORA 3GDLA 1RQBA 4FNSA 1GTHA 2NUYA 3NQEA 3TU9A 3WK1A 2OT1A 4Z0JA 1LP6A 3I7SA 4FNQA 5D04C 3RLUA 3LOTA 4MKNA 3NM3A 3HBLA 5DN1A 5HWMA 4LV9A 2C15A 1YXYA 2OCZA 4OE7A 5EPDA 4O50A 1XL9A 1VR6A 3TQKA 3CPRA 4AH7A 1OFOA 4TIMA 1F7BA 1KM6A 2R14A 5K2ZA 4FIQA 4FXRA 5DY2A 3PB2A 3NL2A 5CSRA 5J5RA 5I3GA 4O11A 1LTDA 2X1UA 3TXVA 3LX9A 3V1PA 3QRHA 5CPNA 4GFSA 4DQWA 3CLMA 1SO3A 4AAJA 3N19B 2B7PA 3C0JA 3L0KA 4CQ8A 2CLLA 3WJXA 3OVPA 3P5ZA 1BTMA 2HS8A 3WJSA 1RV8A 1JQXA 5CSSA 3PBUA 4UR8A 3TW7A 3HPXA 5LKYA 4XBKA 1K8YA 3I7QA 1KTCA 5FF3A 4JY8A 3MYPA 1YXDA 1QPQA 3P81A 4MY9A 3QMRA 3U2OA 3PULA 2E6DA 1WOBA 3O63A 2NXHA 4RZ4A 4JYEA 1QAPA 8TIMA 3AJXA 4Z1CA 1S3HA 3A9IA 4LRTA 2GJNA 4I7UA 1A50A 2H3BA 1M7OA 3INPA 1B4KA 4HIBA 3S8HA 3U8GA 2QCDA 1TPDA 3ZS4A 3M41A 1KFLA 4M6QA 4LVBA 1L6SA 1FWSA 4XKYB 4OV9A 4K6AA 1DOSA 1W5NA 2C3ZA 2Z6JA 4IXXA 5CG7A 2I1OA 2RHGA 2ZRUA 4UMBA 3LV5A 3I65A 4H6KA 2WJZA 4WUIA 5D2WA 2GQ9A 3UY8A 1LBMA 3BGJA 3FFSA 3T55A 3TK7A 2H90A 4W9TA 4LT9A 4UTMA 3C6CA 4FHAA 4PL2A 1YADA 2HTMA 3UWYA 5AHNA 1T8XA 2J27A 2DZXA 1GYNA 1PCKA 3EXRA 3LRLA 3QMTA 3NZ1A 2QUTA 4UNKA 4MFEA 2DORA 1UASA 3ATYA 4JNMA 4AMAA 1DL3A 3AO0A 4YWIA 4N6FA 4MPQA 2R8WA 1OX6A 3CC1A 4PFMA 1XUUA 2DJLA 1TPVA 3MWAA 4MYAA 3WK3A 1I2OA 1R30A 3W7HA 1OYBA 1H63A 1SFJA 2JK2A 5E1QA 5EMUA 2RH9A 5AC6A 1VCVA 2PE4A 1SR9A 4O14A 3CIXA 4L4MA 4WQ6A 4Z1DA 3LI0A 3DHFA 1S5TA 2C1HA 4OV4A 3T4CA 1G6CA 3EXTA 2A21A 4XQ6A 1KBJA 1DQWA 1TIMA 2A4AA 3QF0A 4M5PA 3GKAA 2E5BA 3S5NA 1EWDA 3W71A 4LS1A 1PE1A 5LSMA 5D09A 3CEUA 4K8HA 3MBFA 4GUHA 2ZCGA 2YDAA 1F74A 1TQXA 1QCWA 2ZZ5A 3QSTA 4X22A 4RCXA 3DKLA 4RX0A 4Q4KA 4NUWA 1H7WA 3GDMA 4NJJA 3NPXA 5DCBA 4AXKA 4LTSA 4ZQCA 4NX0A 2C14A 4EVZA 3IGXA 3TJXA 1DHPA 2F84A 2CLKA 4PCFA 5KSWA 4WY0A 1CW2A 4KWVA 3W7OA 3BG9A 3KFTA 3G1VA 1OFBA 1F73A 2TPSA 2TMDA 1FCBA 1JULA 1EIXA 3FKRA 1OFQA 3HJZA 3KVJA 1DJNA 4JTFA 1FWTA 1A5AA 1MZHA 4O57A 1FDYA 3QH2A 3D0CA 4LS2A 4RK8A 5FF0A 3P84A 2JKPA 3DXIA 4M6VA 4N6EA 3E12A 3M5XA 1YDNA 2CW6A 2Y6ZA 4QNEA 4DO6A 4OU1A 5F2LA 1ZCOA 4MZ8A 5F4XA 1SW7A 2CFFA 4R53A 2W79A 1K7EA 1AK5A 1VZWA 3CB8A 1AW2A 1PS9A 3NL3A 4PL1A 5G1TA 1AL8A 2WKJA 1TJPA 1S5WA 3UNDA 3C2RA 2QCMA 4K7VA 3TAOA 1RQEA 4FNPA 2O7SA 1NAL1 1EEPA 3Q58A 4O8RA 5EYWA 2ISWA 2CLIA 1YTEA 2QDGA 3OBKA 1G4EA 2GUUA 1QO2A 3GXNA 4CNNA 3P67A 3PBWA 3LHYA 3MJYA 2BTMA 2JKEA 2OJPA 4Y9AA 1X8FA 3DFTA 3W86A 1HG3A 2ZZ7A 5AOUA 4UFHA 2DZSA 3F4WA 1YDVA 3KVLA 3GX9A 2PC4A 4ZQNA 3M43A 4FX7A 4NXKA 3NZRA 5I3JA 4K39A 3ANYA 3W1MA 4WOZA 3TQVA 5CPLA 4MZ1A 3JS3A 1WYIA 4CQAA 4AWSA 3N34A 1SO5A 4O12A 2NUXA 2X16A 2J88A 3N2MA 3W7NA 1KM0A 3G8EA 5AHLA 4IMGA 3DENA 2EF9A 3GK0A 3NQ6A 2BWGA 3S5OA 4UFMA 4YCOA 3TR2A 4FX6M 4DBEA 2EGZA 1EUNA 1OF6A 1QOQA 5C2XA 3L5MA 4HPJA 5IBXC 3LDVA 3SY5A 3THAA 2WSRA 4N9DA 5K9XA 1TV7A 3KAOA 3NOEA 4PEKA 3MHGA 1NFBA 4U4MA 3NL5A 3TNOA 3WK0A 5EKYA 4HKPA 1EUAA 1JUKA 3L68A 5AYYA 2J24A 1K02A 2NX3A 1KTNA 4IUOA 4BR1A 1N8FA 4B5NA 4AVFA 2I9EA 2QKFA 4UTKA 2ATMA 3SW6A 2ZTJA 3LRMA 1LZOA 4IGHA 2HS6A 3LERA 3RNDA 4E2BA 1W3IA 3PWAA 1I2NA 1O95A 2ISSA 4UFLA 3M44A 3EX1A 4UFJA 1BEUA 3GYEA 2FLIA 3LCXA 2WV8A 4HT3A 5G2WA 4O53A 1VHNA 1GVRA 3GNNA 4QJ1A 1TTIA 4RZ6A 1JCNA 2YW3A 4CNOA 3RF9A 2WNQA 4LNYA 4G1KA 1C29A 3ZFHA 1B4EA 1JQVA 1F5ZA 2NV2A 4FNRA 3SZ8A 4OQVA 1C9DA 4GUFA 2Z6IA 1QWGA 1ZHAA 1L2UA 1G7VA 1VYPX 3MMTA 1UBSA 4KFPA 4PODA 1ALDA 3W2KA 1TJRA 3W7IA 4E0CA 1TPB1 2YPIA 3BVJA 3LXCA 4K38A 4JTKA 4N9CA 3W1TA 3SGUA 1X1OA 4Z1BA 4DO4A 2X1SA 1QPNA 3M5VA 4NU7A 5FF4A 3NM1A 5H91A 1R2RA 1OX5A 5EA9A 1WDWA 1EA0A 4JY9A 2NZLA 4TX9A 3W85A 1TCDA 3TUUA 4UTLA 5HWJA 4N4PA 4Z0SA 1VRDA 5L9FA 2CLFA 5G2HA 4LY8A 1TSIA 1FDJA 4Q33A 2CLEA 3W1NA 4ZQPA 3TROA 5SWUA 2CLOA 3MP5A 5D03A 2CZFA 2A7NA 1Q6OA 4MOZA 1Q3NA 1SZNA 1XCFA 5LNUA 3EKZA 4IQLA 4MYXA 2QCCA 2A5HA 5AHIA 3MI2A 1YXCA 3UQNA 5LNRA 4M19A 5K7JA 3NQDA 1GZGA 3R13A 4HNUA 2YYTA 3I6RA 5E93A 1DKWA 2Y61A 1A5SA 2UV8G 4EF9A 3G18A 1FCQA 2E6AA 3O06A 4MZYA 3O07A 2QAPA 4ADTA 4C1KA 3GAKA 4JXCA 1B57A 3H54A 3PSVA 3TDFA 2FB2A 4JEQA 4RV8A 2GOUA 3QZEA 3GXTA 3MBDA 3TA6A 1G4SA 1MEHA 3EX3A 4TMBA 1KW1A 4UNLA 1ME7A 1Y0EA 5U4NA 2DZVA 3W7JA 3G1SA 3QW3A 4RKAA 1TPWA 4GUJA 1QO5A 1LRNA 1O60A 3TW6A 3GR7A 3NNTA 4AHPA 1J5TA 2KZHA 1QMLA 4GWEA 4X2RA 3BW3A 2Y89A 2PRHA 4S2CA 1RZMA 2ATSA 4I7VA 3N2XA 3S5ZA 4K36A 1FWRA 4O17A 1ME9A 3DAQA 1GT8A 1OK6A 1BWKA 1J2WA 2E5CA 2E5DA 2V9DA 3B06A 2TRSA 1N7KA 3NQCA 1ZY9A 5AC8A 2Y7FA 2CLMA 1KLYA 1ZJIA 1H5YA 4O54A 1G67A 1QNVA 2AGKA 3KRZA 4JDBA 4O1CA 1WV2A 2PURA 3ABQA 4GXMA 4LUIA 3O8AA 3W2JA 4UUIA 2RDTA 1YPIA 5KMYA 2A85A 5A8GA 4A22A 1XDMA 1EX5A 5MHBA 3HOJA 1VS1A 2ZZ6A 1ICQA 3TMLA 2B4GA 1W5OA 2A1YA 1JJKA 3PC0A 3W83A 2P1FA 4BI7A 2YFNA 1XI3A 2ZRXA 3OG3A 5DBTA 4AF0A 4UTTA 3EWXA 2GQ8A 1JCYA 3C2VA 3DFPA 3O15A 1W56A 2XN1A 3GZ3A 1TPEA 3R2GA 1AG1O 1QPRA 1IXNA 1HUVA 4LS0A 1ADOA 3OVRA 1OFPA 3A23A 1TPUA 3W3OA 4UTWA 3W1PA 3M5ZA 1Z41A 2XN2A 3W2UA 2ABAA 3UWZA 2BXVA 5FF2A 1HFBA 4ZZ9A 1AMKA 3PG8A 4ALDA 1H62A 5C5YA 3P5YA 1KFKA 3CM4A 2P0OA 4AHQA 2BZNA 1Z44A 5CPOA 1CX9A 3PBVA 2YFOA 1GQNA 2QUVA 3CWNA 3IVTA 3LM7A 4UMAA 3MI3A 3PY2A 4UR7A 5F1UA 4FEZA 3TSMA 3O6CA 2OMAA 3L67A 4MIMA 1KTBA 3G1DA 3BLEA 4WX2A 3N3MA 3PG9A 5BMXA 5FEZA 1C8VA 1K8XA 3P8JA 2DZWA 4DXVA 4QAIA 2WSQA 4AB4A 2V82A 3TKFA 2Q8LA 2ALDA 4RLIA 2GPTA 3FLUA 3LI1A 2A0NA 4M7TA 3Q2DA 1H7NA 1GJPA 3FJLA 1UUOA 3WJZA 5D37A 3GDRA 4LU0A 4O1DA 1EPXA 1LRTA 1WXJA 5CZSA 3RFAA 1KFBA 5G4WA 2GQAA 2NXIA 3T40A 3LHWA 1I4NA 3G0XA 4MJMA 4MFDA 3TC7A 2ZTKA 3W2NA 4LUJA 1KV8A 3E49A 3HPSA 2WQPA 1R2SA 1VYRA 4GE8A 3FKKA 2C6QA 2QCEA 3W07A 1KM2A 1OX4B 4K7YA 4QITA 5AYZA 3KRUA 1IIHA 4XZ9A 3GDTA 3E02A 1TPH1 1GYLA 2VC6A 3HG5A 4ADUA 3GDKA 1R47A 2QEZA 2NWRA 2NUWA 2G97A 2Q8ZA 4A3UA 5DXXA 4O10A 1BWLA 2ISVA 4N02A 2D73A 1TB3A 3PBYA 1AL7A 3NQFA 3LTSA 3BK0A 2VEMA 1QR7A 2C0AA 3NVTA 3R89A 3N9SA 4IX0A 4WXZA 2W0UA 1VCFA 3QJAA 4UMCA 1WQ5A 3W76A 3KHJA 3NL6A 4N4QA 2H8ZA 3A22A 2JBMA 3EWWA 3KVKA 2X1RA 3SI9A 4QQ3A 4A29A 5LNWA 4LV4A 4QIUA 4IXHA 2NXGA 1WBHA 3MHFA 1LDCA 1I2QA 1G4TA 3LB0A 5D32A 3QW4B 1VLWA 3GKFA 2Y62A 4UC5A 2H8XA 4JX4A 3UWWA 4EIVA 1VC4A 2YXGA 3QQ1A 4JN6A 1XXXA 3DGRA 3MO7A 3I68A 1AW1A 2VFHA 1H60A 2AAMA 4DPPA 1KFEA 2Q3RA 1FCVA 3GNDA 2J9ZA 1KM5A 1ZENA 3H55A 5KITA 1X7FA 1BKSA 1YPFA 1P1XA 4XWUA 3BG5A 4LC8A 2EAWA 3NQ8A 1MO0A 3CWOX 4JICA 4CLMA 1TTPA 3EX6A 3G3MA 3W2LA 1L6WA 2ZZ1A 3JR2A 1GVQA 2FJKA 2YCEA 5FI8A 2WOQA 3FS2A 4Y8FA 1B9BA 1UJPA 4DF1A 4OT7A 3CEPA 3V75A 1TMHA 4RJEA 1SPQA 3DZ1A 2B7OA 1ZAIA 1WOAA 4XUGA 4CNPA 5LNVA 3GB6A 3KVMA 1F05A 2ZZ4A 3HG3A 4RZ5A 3PR2A 1LROA 2ZA1A 5IM51 5BNKA 2FPVA 4WD0A 5T26A 4NJGA 2WSYA 1XKYA 3LLFA 2C16A 1PCWA 1W37A 1ZFJA 1I8JA 3G0UA 2Y70A 5DY3A 5HULA 1VHCA 4H4IA 3L65A 2GJLA 2BX7A 1VQTA 3VI2A 3M6YA 1FY6A 4LWWA 2VFFA 1TO3A 5D2YA 3NQMA 4XKYA 4S1FA 4WXYA 1TREA 1O5KA 4AEOA 1NEYA 3IIXA 5HQEA 3EEGA 3HQ1A 3STGA 4RXGA 5F2MA 3MP4A 4X9SA 3T44A 3R12A 4LVFA 1LOQA 2V5BA 4JTUA 5CZ0A 3GLCA 2G5WA 5K3VA 1P0NA 1QPOA 5A5WA 1RR2A 3IVSA 4IMFA 3HG2A 1Q6LA 4Z1AA 2R94A 3B04A 1M5WA 3FJ6A 5TBOA 1D9EA 4O0ZA 4BF9A 2YZRA 3HIJA 2TYSA 4QISA 4JTEA 4JX6A 1LRQA 4FF7A 2CWNA 4HPXA 1W31A 3SGZA 1VLIA 4YCPA 1EP1A 5AHEA 3W7DA 1TQJA 3ATZA 3NQ7A 5H2ZA 3TQ0A 2VKZG 1F6PA 2YX0A 3CQ0A 6ALDA 1VGAA 4EF8A 1ZNNA 2Y7EA 2HMCA 1H7OA 4U28A 4ICNA 5KINA 3MHUA 2VOMA 5DCDA 5LNSA 3FIGA 3KXQA 4ML9A 4D2JA 5G2IA 5KZDA 4P2VA 3NA8A 1H7RA 3TH6A 5DBUA 3O05A 4O18A 3QEZA 2CZDA 4LVDA 4CCCA 2FIQA 1W3TA 1NF0A 4H3DA 4ZMGA 3W1AA 4LRSA 2PRLA 2E68A 4ZVJA 2Z2UA 3GAYA 5EBUA 4BFAA 5FEXA 4MY8A 2QCGA 1QFEA 2CU0A 4J9JA 1JCLA 1I45A 3ABOA 4O1AA 5HWNA 3HPZA 2I14A 5FEWA 3DFQA 1Z48A 3PUEA 3P61A 5EY5A 3FYOA 3UPBA 4BWLC 2WPBA 4AHOA 3T7VA 3EWUA 2W6RA 1XDLA 2VFEA 3IIPA 3Q94A 1R46A 3HB9A 1SZGA 1A53A 1VH7A 3IVUA 1MEWA 3FA5A 2CLHA 3NYZA 3QM3A 1IGSA 3BG3A 1IIGA 2O7QA 2FQIA 3UPWA 1T0OA
chains in the Genus database with same CATH superfamily
5F4WA 2EG7A 3AZTA 2QJJA 2NSOA 1RU1A 1YBUA 3CC4S 4TMCA 2V8GA 5HLFB 3QRRA 4ZA1A 1KQYA 2DR6A 1F3FA 1QW8A 2R91A 1TL1B 4UNIA 1UJQA 4EBCA 1SVDA 3SURA 1P7TB 3N14A 3R2DJ 1EPVA 4PGLA 4ZOCA 4XVEA 3QQ0A 3B4DA 3O0KA 3I3DA 4UOFA 1YHQS 4KHPF 5IOBA 1OY9A 1O5RA 1NQ6A 1KRBC 3BCFA 5U47A 1MFVA 2CG4A 2DGWA 1N34F 3MCMA 3QGAC 1D09B 2XLKA 1KCLA 1BRLB 5GJNA 1S12A 2I5IA 3PF3A 4QFUA 3O1NA 3UZJA 4QR2A 2QPUA 3OZYA 1HNVB 4OQJA 1RALA 4OHQA 4LW7A 2OFHX 8XIMA 1GFWB 3CE8A 2XFFA 4PRTA 4O23A 4IGMA 3U1MA 1US3A 5KFOA 1WX0A 4PXCA 4G1NA 2R7SA 2BR0A 3W7LA 2K3KA 1PX4A 1LLZA 3NGKA 1L6FA 3RU8X 1RUSA 3M1ZA 4NAEB 1F5CA 4JHOA 2KG0A 1KRMA 3BQ6A 4PFHA 4GZIA 2Y7GA 1HKIA 5I6SA 1G1XA 4P7RA 2X05A 4XD6A 3AXKA 3WQWA 4GQQA 3TC3A 2JEIA 5K8OA 3OPSA 3W2VA 3WC0A 2R2SA 2YYUA 2KU7A 1E9ZB 1OC5A 3UXIA 3GE7A 3LCGA 4CM0A 2BJ7A 4WZQA 1VDHA 1A3HA 5BXTA 1AXQA 3IRXB 1D1UA 3VCNA 1U6ZA 4C8LA 3TN4A 1FRMA 4EOUA 4EWJA 2VFSA 3JAMU 3NO1A 3QQCD 2ABBA 1PBGA 4B3KA 4ZVEA 4EYIB 2H1YA 3W74A 3RIKA 1FFSB 5FD1A 2Y63A 3EICA 4L73A 4UT4A 3FXYA 1DAXA 3GTHA 2VFVA 4FXWA 4RW8B 3ARTA 3CHFA 1XBVA 4POCA 4N2YA 4JD4A 1EHAA 3I4KA 2D1CA 4PR6A 3ARYA 4O19A 4Y6GA 3L0NA 2MKCA 2ZH8A 1V7YA 2DSKA 4P8XA 1RY0A 3SUSA 2AWZA 3EA2A 1YE6A 2QYGA 3W7KA 3NDZA 1KHVA 3PV8A 4NXMF 4QRNA 4RNFA 3KDOA 1IE7C 2AMGA 3AYVA 4O1EA 1WAUA 2E6YA 5DLFA 3RW6A 4KRUA 4ECVA 2WMIB 2HVOA 1FHUA 1OFRA 1JCMP 4RLEA 3AAWB 3HMJG 4F4YA 2AGPA 1V3JA 4J28A 3LZ3A 3RHGA 1H61A 4A2SA 2XWYA 5DANA 5CEWA 1Y3JA 4L1WA 1YHTA 1DJZA 1AJZA 5A6LA 3OHBA 2Z30B 4MLJA 4UTHA 5A8KA 1AYEA 3B82A 3IRDA 4YMZA 4O4GB 3OVAA 1VBGA 3N5FA 2V4JA 2HIYA 1UH4A 2MNRA 4I9AA 1W9PA 4FX8A 2W4DA 3NO5A 1K9MT 3UJSA 1JPHA 1U5JA 1YJWS 2DO4A 2ZH5A 1HD0A 3MUXA 3WLRA 5FACA 3SUUA 2AKZA 2BB0A 1YTDA 2GVJA 3LPFA 5KFYA 4AX7A 2VL1A 1YNQA 3WDRA 1J6PA 3QSYB 4Z2KA 4B3TF 4ZVUB 1RDRA 4LF1A 3QMSA 2PC8A 2J9DA 2TSYA 4BEQA 2BE2B 4GINA 2HSEB 3WFZA 1TKDA 2VUGA 5CC5A 4Z7CA 1HBMA 4GKKF 4Y7EA 3T6BA 4A8FA 4BI6A 2CPZA 4BA0A 4D6GA 4MPKA 2RDWA 3GU9A 1Q45A 3L0GA 4YEAA 2FFIA 4Y2AA 3S01A 3CHEA 3DI0A 3STEA 4AD3A 2X0HA 2MTLA 5LSOA 3WQCA 2CESA 4NCGB 3UN5A 4RNOA 3A3PB 5RUBA 2N4DA 4DLGA 4JYDA 1S9EA 3V5RA 2NW0A 3IO1A 3VKJA 4PH6A 2L9DA 3OL7A 3NXFA 2VRQA 2O9OA 3BR8A 4B4FA 2V2QA 3QPYA 1YJUA 2VKRA 3TUPA 2OTJS 2QYCA 1JXKA 4DUXA 1IKVA 1W5QA 1A5BA 3T41A 1XBYA 1Q6FA 1FD8A 3WBYA 4TKTA 1IT8A 5HJLA 2MKKA 2YDRA 4WIIA 3UY7A 1X31C 5D9MA 3RJYA 3VK5A 1JR1A 1BWVA 2RJHA 4QWDA 3RJMB 2YKOA 1ONEA 1FRBA 3ARPA 2KFYA 2OPPB 5HMZA 3OW2R 2VD3A 4CO1A 5MLCV 3VMOA 2GDVA 2HFZA 3S9IA 2ZM6J 4ERGA 1E4LA 1F3WA 3GH7A 5HP1B 2QUNA 5CCMA 3BJSA 2WVCA 4HTIA 1N0VC 3I56S 4RWWA 1KD0A 2PF0A 3V7PA 5DO2A 4OX9J 2VEPA 3EWDA 4NZ1A 4CQ9A 2W7AA 5KT7A 4BBYA 2NQJA 1NK4A 4KPLA 5D30A 3L4WA 3BQ2A 2ZRWA 3B8WA 2WKLA 4F2BA 2FDNA 3VIKA 3HX9A 3W1UA 2ZWZA 3TOYA 5I03A 1H3DA 1UP1A 4IMCA 3MANA 4J3SA 3REQB 1QHZA 3W1XA 5CPMA 4INFA 5DCEA 1WZKA 2L48A 1N33J 4LQ1A 4ZIWA 4TQSA 4WF7A 1UJ4A 3GY1A 2J9EA 4D1JA 2W2MP 3L4UA 2MHNA 2O66A 3TMQA 3LAKA 1IEVA 4ZN1A 1ZS2A 1RT1B 4FMVA 2GQ3A 3K5OA 3CCJS 3ENAA 4DX7A 3CWJA 2B8PA 4XVDA 1Q86T 1NK8A 2J9YA 2VEKA 1VK8A 4DV1J 1BLIA 3LHZA 4S3EA 4AWEA 3W22A 4GC6A 5B0BA 5EMLA 2BLEA 3GIMA 5C6MA 4GNJA 4K0KF 3A21A 4GCAA 3M2VA 4N42A 4UB9A 3S6TA 3KX6A 3P60A 4NPOA 4DJED 4C97A 2D2OA 2UUAJ 2B0MA 4U10A 4LFCF 2NUHA 2BM1A 1IVZA 3IIOA 5DELA 4CNZA 1UR3M 1GG0A 3TA1A 4Y00A 1N5YB 3LHTA 2M70A 1SO4A 2PGRA 1Z42A 1M9HA 2UY5A 4DV0F 2BS9A 1YJRA 3GYCA 1O7AA 1KM1A 3SECA 4TXEA 3VABA 2DU2A 2P8IA 4ED1A 2X1TA 1FWIC 5M1TA 1KSPA 4EFAC 1KFSA 3WQ5A 5BYQA 4WTOB 3OR1A 3UG5A 3W7GA 1W1A1 4J37A 3E2VA 3H40A 3DDKA 5LJ3Y 5HINA 2LA4A 1W5PA 2BE9B 4H04A 3VD3A 5FOOA 5A8RB 3M6DA 1FBAA 4B3OB 3PRBA 3O1LA 2RAQA 4DR2F 4GFIA 4NF7A 4S38A 4ACYA 2DUXA 4RE0A 1WG4A 2WZMA 3USBA 3SN4A 3FK4A 5A3HA 1U26A 5D05A 2XMWA 1SJAA 1CZ1A 1GZJA 1NWTA 2PLMA 4J7RA 1WXZA 3VQSA 5T8GA 3FCPA 1RACB 2CNKB 1Z4UA 3CPGA 1H4PA 4NI2A 4MNKA 3I0RB 2J8TA 2IKHA 2ZRVA 1TTJA 5J1PA 2WTFA 2C91A 2W92A 3H2FA 3M7WA 3EXSA 3MYOA 1NDYA 1QAYA 2XVKA 1QASA 2G95A 3VQTA 4JL1A 2UXBF 1I2RA 2BNJA 3TNVA 9XIAA 4Z37A 1HP4A 4CLYA 2Y8VA 3T42A 2V6AA 1Y3KA 5I3HA 3MHYA 3HGRA 3TC6A 2ZBRA 4KWSA 1GWJA 3OGSA 4QX4A 3DYOA 3PX4A 3P80A 1YRTA 3CL8A 2JIWA 3DHDA 2J8FA 3G24A 4Y90A 1WB0A 4TO8A 4JYFA 2VPXB 3KFWX 3W3SA 1YITS 2OZ3A 4QG8A 6ENLA 3MGJA 3MM9B 3LF0A 2VICA 4LF4F 3MM5B 4J3ZA 2DRDA 1HJXA 4OX6A 2FJXA 5FIIA 4AUKA 1KKRA 3GR8A 1VCTA 3CQKA 1NF7A 3J7AN 3O2IA 2RU9A 3PB0A 3QV8A 3K8MA 2RDJA 2WHKA 1UL3A 3EWZA 3NPUA 2G3FA 2HGLA 2DVUA 2W27A 4RR5A 1H38A 4NZJA 1XIHA 3MW7A 1RWKB 2NREA 3TUIC 4LOCA 1GMWD 1SW0A 3DOMB 2CA9A 1IXPA 1JVNA 1L8PA 2QJIA 2J7FA 4PMJA 4AUBA 2WONA 4CYUB 1DIOA 1VBYA 1M7XA 1GKPA 4GH1A 4HNNA 4RW6A 1MWZA 2H6RA 4S3FA 1F6TA 5CHCB 3OQEA 3PAJA 4LF7J 3MVTA 3VTRA 3UR7A 2WB5A 1S5VA 2HHXA 1IR1A 2NYHA 2NWSA 3H4BA 3N12A 1ZZMA 3U2ZA 1QOPA 2G1HA 4M5JA 3VE7A 1YW1A 2VFDA 4P72A 3FVYA 1JXLA 2C2KB 3OYXA 3GUWA 4IJBA 3CJTA 4ORIA 2K06A 2XO6A 2Q66A 3RAOA 2HJPA 2IPWA 3S2LA 5CD4A 1J10A 1S4EA 1GOMA 4AFFA 3B9EA 3CJSA 1TTHB 3ZNUA 2J5AA 1EA9C 1RQHA 1KXVA 1ELSA 5J2PA 2YGYA 3CYJA 1PXGA 3ADAC 1CJUA 4XTDA 4EU0A 3GVGA 3BLFA 1QUPA 4D6HA 4RL3A 4B5SA 4RXFA 4DPQA 2DSZA 1ZJBA 2C13A 2C71A 3AIQA 5EHHA 5TNVA 4AIUA 3B05A 1EARA 3M7SA 3W23A 1H72C 3AUJA 1BMQB 3B0PA 3LCFA 1MW3A 3BICA 5DQHA 1W2BR 1OGSA 1YK9A 4ONVA 3T9NA 1RWVB 3M30B 1F61A 3MA8A 2Y5JA 4WR3A 1J01A 1GNXA 1TWSA 3QO9B 5BMWA 4UFIA 1JUBA 1B3TA 1MEIA 4YVPA 1S2AA 3K8WA 1V6YA 4K8EA 3IFEA 4NX5A 3UQSA 2OLAA 3VD5A 3AB4B 3PPCA 2CCRA 5HQLA 3H7UA 1XFBA 2C1IA 3W88A 2J4GA 4E2DA 4KIRA 1RP8A 4GUGA 3SSSA 2VGIA 1FKPB 3RCMA 4GXPA 4PG5A 1LG2A 2OX4A 4IOAQ 1HBNB 3ZTPA 4BZYA 4ZE5A 2M7SA 1C92A 4GQRA 4CN1A 1YTYA 3Q89A 5HR6A 3IG1A 3TN3A 3G22A 1E6ZA 2YNGB 4DMZA 2C1GA 4B3SF 1PV8A 2XS7A 1HHTP 2QVHA 1GUVA 3MS8A 4A8NA 4OYOA 1LQAA 2OT0A 3DRRB 2CETA 3DCPA 4HSNA 2YNFA 2JEFA 3NEHA 5K4ZA 4E6MA 2BVDA 3JVAA 3S0CA 4C3MA 3B8DA 4E5TA 1OC6A 2VA3A 3GTFA 4G7EA 2QNEA 1KFCA 2DNZA 3E51A 1VB9A 3MJMA 4PMXA 1Q66A 4OYAA 2ZX5A 2EFNA 3H20A 4J7CA 1U02A 4EXBA 3BPWA 2HNHA 3F5LA 1KVIA 2YXLA 4C8NA 6TIMA 4GC3A 4WKFA 4M63A 3HG4A 3E9AA 3WDQA 2YNHB 3ILJA 3VKKA 1DV7A 5HJYA 1OFAA 1Q8JA 4IPIA 3IA0A 3DOKB 2HPUA 2PN6A 1YJ7A 3O6QA 3ID7A 4PMZA 1SIWB 3OBIA 4B16A 1KQFB 1BQMA 1XIFA 3IEBA 2NYIA 4R27A 2CJ9A 1DJHA 4ZK7M 4DYJA 5HR7A 4K50A 3VAGA 1IM6A 4JI3F 4O3NA 1BYBA 4DX6A 2HK3A 4OHYA 5KG7A 3S2CA 2VPZB 4QYRA 3RRXA 4ZOEA 4NZCA 3WQVA 3URNA 4P7OA 3W5ZA 3FGCB 2WYSA 3VOGA 1NK0A 1IF2A 1U6FA 2UUBJ 3VGFA 2E4TA 1FERA 1TA3A 1NQKA 1E3XA 3VALA 2K8GA 4YDXA 4AF0B 1TZ9A 2H9ZA 3UR0A 1JIBA 3B9OA 3NLCA 4DZDA 4CCDA 3W65A 2OOGA 1DXEA 2XMUA 2BOFX 5GMDA 1PVNA 2WBKA 4NNCA 4DF2A 3LMZA 2AIRB 1QE1B 5AVNA 3N13A 4FR1A 2XULA 2E40A 1VJIA 4ZVSB 2QUUA 1YDYA 1MW1A 2DB1A 4KPYA 1SQFA 4AVOA 1C9WA 2RSQA 4GIEA 1EC8A 1NXIA 3G1FA 2MPUA 1BG9A 1Q7MA 1N5SA 3IWLA 3LTOA 3POTA 4XIUA 2CLPA 2E6FA 3AHZA 4ZSTA 4FPRA 5ETRA 2INEA 4EACA 3EWBX 1Z8AA 1LWXA 3CCLS 2LEPA 3NDOA 2V68A 2YLAA 2BDPA 2XBPA 1J4EA 3M1VA 2IJFA 1MW7A 2X1IA 3N4AA 3WNMA 1RJRA 2O9PA 3IR6B 4NLYA 3WDPP 1MUWA 4EWND 4QM1A 4H9YA 1Q7ZA 3PW7A 3OFEA 3T9ZA 3CUXA 5E3CA 5IT4A 2IKJA 5A8NA 1EB3A 2Y88A 3PO4A 3G82B 1HTIA 1DWHM 1ZA2B 4HBKA 3TFCA 1HJWA 4M5NA 1O66A 4QS6A 2HG4A 5KFCA 2R8JA 4D9PA 1HL8A 4US5A 5CXPA 3LD5A 2VGGA 2B4OA 5HUOA 2MXYA 3O2LA 3LUYA 1T7LA 5C9ZA 1N8IA 2YH1A 2QT7A 4RUHA 3L2LA 3W7PA 4A2RA 1WOOA 5FSEC 3US5A 2WMJA 4C6NA 2CVEA 2G2OA 3WC2A 4H9VA 4LY4A 2ZZ2A 3M0LA 3OHIA 3RLVA 1G1YA 3UP8A 2CJYB 1IKXA 3RK8A 2ZWPA 2Q09A 6A3HA 3BQ0A 3ITGA 2IRUA 4ZVTB 3W73A 1LYXA 1JPMA 4I9JA 4EEYA 4P8WA 3GVRA 5F7UA 4XO0A 4PQUB 2ZH3A 3GTIA 3GTYX 2YTCA 3SCTA 4J35A 3VGBA 1J0JA 3G8TA 1ZH5A 1NH6A 2HHHJ 3W1QA 5A6PA 4M1RA 2IUZA 4KYZA 1PBUA 2I5JB 4ZITA 4YHHF 4S3KA 2EG1A 2HRUA 3V6HA 2KM8C 1M6JA 2ZX7A 4JTAA 1HYSB 4ZLPA 2YXXA 1EO5A 2E9MA 3QGVA 1RQBA 2DVXA 3QHNA 4LUTA 1RTJB 2MQPA 4UUWA 3A8JA 2OT1A 3CAQA 2VRJA 4JOMA 1GK8A 3RPDA 4QDMA 4X62J 1PYTA 1RVKA 3GXFA 2C2RA 2Z00A 3RLUA 3HFVA 5E0OA 4LFBJ 2O01C 1MN9A 2X0YA 3WKZA 5HROA 4E8UA 2BQUA 4OJ1A 1VPQA 3K1GA 3B9DA 2VFRA 1GNKA 1SJ3P 4I5UA 5DN1A 2F63A 2C15A 4OV1A 2ZZTA 2Y5EA 2DGOA 1YMYA 1XJWB 2C2EA 1UD6A 3LBOA 5FCZA 1XL9A 3TQKA 4TY8A 3BV7A 1NM9A 1S5NA 1WDPA 4XAFA 4ID8A 2R14A 3SFWA 3MMBB 4FXRA 5DY2A 2PSNA 3Q2TC 5J5RA 4F2TA 4JI7F 2ZWOA 3NBPA 4U9RA 3ZVHB 2MZRA 2GQCA 1S0MA 4A3HA 3T8QA 2ROEA 2UXCJ 5A2QY 1Z69A 5KG0A 1HBUB 4MK7A 4DQWA 4IKAA 1A9NB 2ZC8A 1J0YA 2CLLA 5LA0A 1S1TB 4R3UA 2M9KA 1UUQA 1IEWA 1SL0A 5BR8F 4N8NA 3WJSA 4Q45A 4LBPA 1RV8A 1JQXA 1NU5A 2EPNA 4B3LA 1PJ6A 4HT5A 3G4SS 1DXFA 3PBUA 5I24A 2IAJB 3TYUA 2RVJA 2ZFHA 4LBRA 1K8YA 2G4JA 2R24A 1YE4A 4Q7AA 4MJ2A 3FEXB 3PPFA 3MYPA 1NKCA 4JQ4A 3S83A 1XCXA 3P81A 1XSJA 2FTRA 5FJTA 1TKTA 3SI8A 3N5BA 5BZAA 2NXHA 2OSRA 3GR1A 4JYEA 1ULRA 4X4NA 3A12A 4Z2GA 2B51A 1E1CA 4HA4A 1K9TA 2KVIA 4F4KA 2LFVA 4B3RF 2A3EA 5K14A 4Z1CA 2ATLA 2HQGA 2DSVA 2BG5A 2RS8A 4YB1P 1FX4A 2YKNB 3A9IA 1HQUA 3FMBA 4LRTA 3VNZA 3NY0A 1J5OA 4QBUA 3BMXA 3AALA 2LU1A 2Y9HA 3W38A 4JUZA 4HIBA 3S8HA 1H49A 3C19A 2ZDOA 3ZS4A 2AX1A 1EYWA 1KFLA 4WFZA 3M9NB 4PULA 4B9ZA 3EUNA 4DR1J 4UZUA 5A8QA 2FH8A 1WF1A 1M5VC 3PAOA 2FHJD 3FMWA 3MPVA 1P43A 1TE1A 5CG7A 2I1OA 2RHGA 5C42A 1V3IA 4UMBA 1CLFA 2PU1A 3RB6A 4WLCA 1U2RA 4RW5A 2Q6CA 4YS1A 1R85A 2WJZA 2RDIA 4YMEA 4LNCA 4WUIA 3SDOA 5D2WA 3DRXA 3UY8A 1EX1A 4W7VA 3UNGC 2BXYA 2M2BA 1EETA 4O3OA 4W9TA 2D41A 3DC8A 2EQDA 1KOOA 3TONA 3UWYA 2JQXA 3BPSP 2VD9A 4WDUA 4GX9A 2ILYA 3CV6A 3QAEA 2CIMA 3WH9A 4UNKA 1I6JA 3ATYA 3TA2A 1PGZA 2OZ8A 3F56A 1RE1B 3QZ8A 1TL4A 3AO0A 3VIGA 4H8UA 3PK7A 3VKCA 3AXHA 1LWHA 2DIKA 4FA3A 1DQAA 2DJLA 1VEOA 2PO4A 4ZJQA 1TPVA 3WK3A 1PCAA 4WVXA 2XM1A 1I2OA 2PIIA 4K5SA 3W7HA 3A1YG 1AW0A 1OYBA 1SFJA 2D3LA 4QBXA 3Q4DA 2RH9A 5ETLA 2YQ3A 2PE4A 2PTZA 5GAGI 1H6KX 3LI0A 2U2FA 1S5TA 1TMLA 4OV4A 3T4CA 4DWSD 4IIFA 2GJIA 4XQ6A 1DQWA 1E1FA 2OKQA 4LSNA 2MJNA 3GKAA 3S2NA 3S5NA 2HQCA 3EEZA 2DQXA 2UUTA 1YBTA 1PE1A 1BHGA 1XIBA 2BQRA 3OTRA 2EPIA 4U33A 1JGIA 2JFEX 3CUFA 4I1TA 3GJQB 1QCWA 2AKWB 4CTAB 3NGRA 4ZKAA 1R0AB 4Y2WA 1TUVA 1Q4RA 2Y1HA 3WQGA 4LREA 4PRWA 5F8LA 1UZ1A 1EXBA 4B9LA 3HZEA 4O4RA 3GDMA 4NZ4A 1NJYA 1SL1A 4IG2A 4OZ1A 1TP7A 4ZQCA 4NX0A 2J76E 3D5MA 3BSOA 2IDLA 4GD0A 1QM9A 1Y9OA 2F84A 4PCFA 2G3NA 5KSWA 1Z89A 3E0FA 2VZSA 1F2HA 2OH2A 1CXKA 3BG9A 1U2FA 1BQNB 1ZAXA 3DESA 5KAKA 3HHLC 2PWVA 1X5TA 1MUMA 3MT1A 4HHUA 5H8UA 1JULA 4P7LA 5CC6A 3UPMA 2GV1A 4GZJA 3FCWA 5HATA 5IV3A 4DV7F 3CL6A 1XF0A 2IXUA 1VS3A 3D2WA 5E33A 5CYQB 1B30A 3H2CA 2ZOMA 5KFKA 3V35A 3NTYA 1AB8A 4LUBA 1RHMB 1FDYA 3QH2A 4LS2A 1ZZFA 4AVNA 2VBWA 5FL1A 3P84A 5CPSA 5I3DA 4ZSUA 5A2AA 3DXIA 3BWWA 4N6EA 3E12A 4CD8A 4L1GA 2DV0A 3AHYA 2CW6A 4QNEA 1UWIA 1JKHA 4ZBCA 4TNOA 1IGWA 1ZCOA 3IN5A 1EHNA 4MZ8A 1SW7A 3GFHA 3KHGA 3EVWA 2W79A 4KCTA 3Q86A 5EU9A 3POHA 1UEKA 1JGMA 4U6PA 4YN5A 3NL3A 1JZ5A 2Z2YB 3CNQP 1XKJA 2DSUA 4DJEA 1TJPA 2J8GA 1DWFM 3M7VA 5BOEA 2XGBA 3L2MA 3IXQA 5A8WA 3FSXA 2PGEA 4F0HA 2UBPC 3E3XA 4WBFA 4C0BA 4K7VA 1ZBCA 1NMEB 5ENLA 2DCUB 3AHPA 4QU6A 1KQSR 2ISWA 3QOKA 1YTEA 2QDGA 2ZOXA 3T5KA 4EMDA 3OBKA 3NCOA 2OELA 1P9QC 3GXNA 4IFVB 1R38A 4CNNA 3CC2S 4PTMA 1EJVC 3MJYA 4RDYA 2Y3YA 1UZ4A 2BGSA 4Y9AA 1V6UA 4D6DA 4ZPBA 4LF5J 1HG3A 2XH2A 3EB4A 4DI9A 5GMEA 2HV5A 2ZZ7A 1Q53A 2YWFA 2VC0A 5CSUA 5IZHA 2DIEA 2C42A 1YJ9S 3HZGA 3OLEA 3KVLA 2VU5A 4Q8FA 2V63A 2XI3A 2F61A 1KGXA 4TV6A 2BM0A 4ZQNA 3Q0AA 3M43A 4PTWA 4PRFA 5I3JA 5IC4B 2IVFB 3JU2A 3OODA 3G6XA 3ANYA 1BSLA 2JIEA 1NJJA 5CPLA 1D8CA 3TEVA 4MKAA 4OYWA 3UG3A 3N34A 2NUXA 1IT7A 2PD1A 1XNRF 2DR5A 3G8EA 4B9YA 3KE0A 4HU4A 3PBGA 4IMGA 4OECA 5CYJA 4LR8A 3OGRA 4QWCA 3S5OA 1SBRA 4YCOA 5A0YA 3FHAA 4USJC 2QTWA 4U7UK 4UQBA 4E3TA 1I75A 1KCKA 3AD9C 2MHEA 3GBDA 3GC4A 3TVKA 3MPDA 1GZ1A 4TVDA 1ISWA 4PTDA 1S2UA 5GAHU 3QOMA 1RWMB 2ZXQA 1PKLA 1VIZA 1VQ9S 3UVIA 3DDIA 1BLUA 4NLSA 3BSGA 1NDVA 1B90A 4ZTXA 2OO0A 2ZJPQ 3FC9A 4PXBA 1Q0NA 2J7HA 3QHOA 3OIHA 1RKIA 1KN6A 4X4PA 3KWSA 3R5AA 1W91A 3TNOA 5EKYA 1K1DA 4RZBA 2ZD1A 4HKPA 4A8XA 3SCOA 5AYYA 3IGNA 2O92A 2ZNYA 3PYFA 3ES8A 4DZHA 4AVFA 1RCXB 5J1EB 2B6AA 2VDGA 3W25A 3WQ4A 2HVIA 1GMWA 2QKFA 2WCSA 3ZYZA 3EBVA 3QRQA 3M8RA 4DHVA 1A7GE 2RD5C 1FP9A 1S6QB 3LRMA 1L3UA 2WVDA 3LERA 1W3IA 1V3MA 2AHOB 5ABHA 5FJPA 4FDFA 2ISSA 3HULA 3M44A 4USKA 2DHGA 1BEUA 3U5YA 3K5NA 1M5HA 2X41A 1BXCA 4O53A 3PCOB 5HQMA 3DDNA 3LWLA 4OIXA 1GVRA 4KKOB 4OYPA 3RDKA 1B70B 1GOWA 1TTIA 4JZ5A 1KLMA 1EOKA 5H9FJ 1NY1A 4CNOA 3S8SA 4OBRA 3DM2A 3OBEA 1LW0B 4OX8A 2VC1A 1C29A 2LXUA 8CGTA 2IKGA 2NZ4A 1QHOA 4GVGA 5J2QA 1T40A 1JQVA 3PWGA 1F5ZA 1HKMA 4OQVA 1S59A 3SQOP 1XV8A 4OJ3A 1J11A 4WZMA 1XINA 1L2UA 4GH3A 3RN6A 2IIHA 3R0DA 3PUGA 2WJDA 1D8ZA 1FXDA 1S0VA 3S1GA 1ALDA 2ZH9A 1BHNA 4DL2A 2C3YA 4MTVA 4KCVA 8ATCB 2FJUB 4E0CA 2IC3B 2V5JA 3GG0A 4F3MA 4IFKB 3DG6A 5DT5A 4DO4A 3GCWP 5D6GA 1QPNA 1S3TC 4HOWA 1EP4B 4GQBA 4C8KA 3I31A 3I6PA 1QATA 7TAAA 3LPOA 3R94A 2W8KA 4BCEA 1NK9A 5H91A 3NM1A 1HNWJ 2N7YA 3UCDA 4MHBA 2MJUA 4C7QA 4J9SA 4JY9A 1JXJA 1FJ7A 3TYBA 2O55A 4FXDA 2GMHA 4Z0SA 2Z1VA 4ECQA 1W1IE 3D46A 3CO9A 2DO0A 3PHAA 2V9WA 4DR6J 4ZQPA 3ZZ0A 4HMCA 2WVVA 2HMIA 5DRIA 2CLOA 3MP5A 1NK7A 4IQXA 5D03A 5ETOA 4F4WA 2XZ7A 1D9AA 3ET6A 4JV5J 1BYDA 2QMUB 3CV2A 2F8EX 1XCFA 1E15A 3EKZA 4IQLA 5E70A 1E9LA 3HV9A 2V8VA 1DE6A 1T02A 2VOTA 3JTNA 3CO4A 2XGPA 1YXCA 1WKDA 4PUUA 3R43A 1XICA 3UQNA 1LW2A 2IM0A 5LNRA 4IIGA 4M19A 3ENVA 3NQDA 3A6OA 3H2MA 4LRAA 1RISA 3TP2A 2ZIDA 4I7FB 3S3GA 2NUUG 3I6RA 3KJVA 1TL7A 1ZA1B 3A13A 2UV8G 2W4CA 3V4BA 1WC6A 4ZGYA 5I2UA 4R0JA 1HJQA 1RHUB 4ZO8A 1VIWA 4I2QA 4IQDA 5FJ4A 3T2OA 1V08A 4U3CA 4GNKB 2G2YA 1V8EA 1J6OA 5CLTA 3EDDA 1NJXA 1KKOA 3NFUA 4UTGA 4ZVGA 3AS3A 3W60A 3DGBA 2F2HA 2GOUA 2X2YA 5AE1A 2ZXBA 3ITXA 1UOKA 4AXNA 3MBDA 1FE0A 4GQGA 1KW1A 4UQGA 2A2CA 3IUDA 1XLBA 1EOMA 1HGWA 2X51A 1HPZB 3S2MA 2V2ZA 1XIIA 4CQBA 5CPTA 4GUJA 2E5IA 5F9LA 1R3VA 1HQTA 3GR7A 4PKDB 3NNTA 4AHPA 4IIBA 1H0IA 1SQEA 1NP0A 3TANA 3VGSA 3ONBA 4X2RA 3QFHA 4CO3A 2CZVA 2DGAA 2Y89A 5IFTA 4S2CA 1BC6A 4I7VA 5LYRA 4BDPA 2GK1B 3TYAA 4B91A 3DAQA 2BACA 3W4RA 3AS2A 1U1UA 1GT8A 3IWNC 4A4JA 1J2WA 5H9EK 1AQMA 2UY4A 3M2RA 2V9DA 4RE4A 3A3NB 4F0RA 2VCAA 3HI9A 1N7KA 3GNRA 1VFUA 3QYYA 2X8RA 1ROFA 4UOCA 1G7CB 3NOGA 2Y7FA 4IFRA 1B99A 1ZJIA 4D72A 4MFBB 2XJ7A 2AP6A 1UCNA 1WC1A 5GMKa 2FJWA 5HBMB 4NIRA 1WV2A 3VNLA 4D6CA 2PB1A 2XLJA 3GFXA 1FFQA 3SM0A 5C0QA 3ABQA 1H73A 3HSJA 4CH0S 2IDEA 3GP9A 4LUIA 4Q4QA 4DF4A 3CUZA 2A3HA 3QLHB 3L95X 5KMYA 4A22A 1TKXA 2XIJA 1PKYA 4WIWA 3H4XA 4L4PA 1VS1A 3V6JA 2ZZ6A 1UVMA 1DFDA 2MZTA 1XLMA 1S2VA 3TQPA 3ITHB 1W6TA 3OTCA 2M52A 3BSAA 3G2XA 1S1UA 4J1OA 4J9LA 4ZN3A 2BHZA 1RWPB 2EEXA 3WLOA 1BKHA 4K4WA 4DY1A 2ZRXA 1F60B 3RRHA 2FVLA 3TTQA 1U49A 2KAUC 3NAIA 3D0HE 1JCYA 4CD6A 4JI4J 3C2VA 1W56A 3H2VE 1RAOA 4N76A 4WXOA 2JX2A 3DYMA 2Y0SD 3WLPA 3UA3A 1ACMB 1J79A 1JMTA 4O44A 2QVNA 1EC7A 4JP8A 3M5ZA 1X6NA 1Z41A 4DWIA 1IKYA 2XN2A 2FC9A 1HXJA 2HHWA 5BXIA 3MV01 4E2OA 1T05A 3H8AA 1AMKA 5J1NA 1OEPA 3CM4A 3GFYA 2BZNA 2Z1KA 3D5HA 1Z44A 1VRUB 4X65J 3NQBA 5BWAA 3LP0A 4NAEA 3KTQA 1GKQA 3PBVA 2A0FB 3KOYA 1E6RA 3H8YA 3VVUA 4H1ZA 2QUVA 3IVTA 3M8YA 3LM7A 5KT2A 4GO8A 3PY2A 2VG7A 5KFRA 1S39A 4AEFA 3C2YA 4DO7A 3M46A 1UG6A 2Y1IA 2W61A 4D8AA 3L67A 4YR2A 2PEBA 3M8PB 1EBGA 4P7TA 3ITCA 2DPEA 1VRTB 3E3HA 2PTDA 3GW3A 3DERA 3VYLA 1UAWA 4X4SA 1X6LA 1W8GA 3NRBA 4GISA 2V82A 3VGEA 1ONXA 5AT1B 3LI1A 1W3JA 4QE1A 2A0NA 1AFSA 4YVVA 2NT1A 2GFTA 1UUOA 2AZ3A 5D37A 4DL4A 2RRBA 5FJJA 1ZRQA 1LRTA 1UP3A 4M95A 1KFBA 4G7FA 3T40A 2JFKA 2M8DB 4DR3J 2HQDA 5EMYA 4QHRA 1SUQB 2ZJRQ 3IAPA 3K0JA 3ERPA 1S7IA 3W2NA 4LUJA 1JLBA 3WQEA 1APSA 3WL1A 2W9BA 2C22A 4H6QA 3ULHA 1OX4B 5DF0A 4EYHB 4K7YA 2QDDA 2XMJA 2OSYA 3VZYA 3CEDA 1IIHA 4C3KA 3GDTA 4OJGA 1E4NA 1RTIB 6FDRA 3E02A 2WMIA 1XYFA 4P7QA 2VCCA 3V6DB 1CXFA 2RHSB 4ED5A 3W7BA 2ZUVA 4ADUA 3VIOA 2QEZA 4GCXA 2HPMA 1NOFA 3ENLA 3QJJA 1Y7PA 1JPKA 3JSMA 2JEGA 1TB3A 2Q3PA 1U1NA 2QW5A 3AXMA 2AF6A 1ITQA 4ZFMA 2XGIA 4CDIA 3CCES 2RNEA 1AL7A 4DI8A 2MY8A 2VEMA 1UVIA 3W2WA 2OP5A 4BJHA 2MLXA 2DHSA 3R89A 1R27B 4IX0A 4WXZA 1HI1A 1RT3A 4TX6A 4FLRA 1IQ8A 4HSHA 1X96A 3M0HA 4A47A 1CSJA 4IRKA 2QA2A 2H8ZA 3A22A 1S10A 2JBMA 3ARQA 4CCHA 3SI9A 3PFOA 1FH8A 4QIUA 2QEXS 5C7HA 5CC3A 3TYDA 2BE2A 4W87A 2B8QA 2FD2A 1HWUA 4MMOA 2GHPA 4OI0A 4JKKA 3MHFA 4KGVB 1G4TA 2RB7A 2G3JA 1UD2A 1VLWA 4NCBA 2AX0A 3EKGA 3C3LA 1Q13A 3HTWA 4XD5A 4TY9A 2F9JA 2I7GA 1NO8A 4EIVA 5FSDC 4C7DA 4GMKA 4ZLJA 3CZ8A 4JN6A 2DKOB 3DKDA 4B5UA 3DGRA 4ERDA 3WDHA 4EO8A 3CVKA 4RKUC 4ZS6A 1T5AA 4DPPA 1KFEA 2Q3RA 4R8UB 1HR0F 5M2UA 2ERRA 1KM5A 1ZENA 4NA1A 3H55A 4WKYA 5C25A 5KITA 1M1HA 1YPFA 4XWUA 1EKRA 5D4PA 1FWKA 5KFZA 2E7XA 3C16A 3UGRA 5THWA 4XO6A 2FHJA 4YB6A 4MMWA 3KM8A 1TTPA 1CECA 2F4FA 3ZZ1A 2JH3A 4M1KA 4FR6A 3W2LA 1L6WA 2ZZ1A 1QAXA 2G0CA 2NZCA 4HTBA 5FI8A 3A3WA 5LA2A 3WF2A 3E1F1 4IUGA 1JLCB 1RLCL 4L7ZA 2DD8S 3A3XA 3LGNA 1MQPA 1S2WA 4OT7A 4IPLA 1TMHA 5B0AA 2B7OA 4MKSA 3I4HX 3GM8A 3I9ZA 3MM7A 2V38A 1ZAIA 3HM9A 5GAEU 3J7HA 2IQDA 4Y9NA 4J9RA 4C0HA 1GX5A 2IVMA 3OTOJ 2MLZA 4JI0F 4FF4A 2UXDJ 4RZ5A 5D8WA 1VFLA 1LROA 3ITTA 2ZA1A 2J7EA 2J78A 2H5EA 3UNTA 6XIMA 1T0TV 3RAMA 2XIMA 3CJ8A 4DV6F 5T26A 1XISA 1A0OB 1H98A 4GKJJ 3V3WA 1W37A 2BZ2A 2Z7GA 2KXHA 2H51B 1W1PA 2HDJA 5DY3A 4CT8A 1E40A 4H4IA 3SGGA 3L65A 4J40A 2IM2A 1VQTA 3HA1A 2AGQA 1FY6A 2E1PA 4S0MA 4ZPCA 3NGFA 3CMES 1KWMA 2XFYA 3OL8A 2AL1A 1YDLA 1TREA 3BN7A 3WUGA 4ZB0A 2XSFA 2VASA 1R0CB 4MIWA 2BHUA 3QQWA 2HNEA 4ACZB 4ZCMA 3RAQA 1YIJS 3STGA 2I6WA 4LBSA 2CNOB 1YQHA 3R12A 1FK9A 4DWSA 3NS5A 2QGYA 4IR9A 3WNOA 4AE5A 1NP2A 2GGPB 3W27A 1Q81T 2VIHA 5A2BA 6TAAA 2XNQA 1P0NA 1QPOA 3GYNA 3DGPB 2HFVA 4F0SA 1RR2A 3IVSA 4RZRA 4G1IA 4I2PA 4C1NA 3O3LA 3AOFA 3Q22A 4J4KA 1ZPWX 2UY2A 4C11B 1XNQF 1XLEA 2FTWA 4Z1AA 4J9UE 1JLQB 1X98A 4BQ2A 4F66A 1WUUA 1D9EA 1OJ4A 1UP2A 2AMXA 2J7BA 1LK5A 4B4HA 3AHXA 4DHGA 2YJQA 1A6LA 4YPJA 4QW9A 3R9LA 3E74A 3AXXA 1HI8A 4YFUA 2CWNA 2Y8KA 1LWEB 3VC6A 1U30A 1XMQF 3FSYA 4WTYA 5KG2A 1SV5B 1VLIA 1EP1A 3W7DA 1PKMA 2VGBA 1AZ2A 3ATZA 3NQ7A 5H2ZA 3TQ0A 1R89A 3QSIA 4LSLA 3OLBA 4HACB 2ACUA 3CQ0A 4D6JA 3H21A 4GGHA 2MGZA 1F5AA 2OSWA 1N88A 4HN8A 2VOMA 2ZKMX 1QTNB 3WMBA 4AZGA 3FIGA 3NO3A 3EDEA 4M82A 3NA8A 5LMUJ 2HVHA 1RI7A 3ZJKA 3GC2A 3NZGA 5DBUA 4AXJA 2CXGA 3HKWA 5XIAA 1E0VA 3PJTA 3SRHA 3OT9A 2CZDA 1DJXA 4KV8B 1RT4B 5KG4A 1SKRA 4PMNA 3PYEA 1DY3A 4LVDA 4JPGA 2OQHA 1HFEL 5T14A 1NF0A 3DLKB 4H3DA 4ZMGA 3M0KA 2DNPA 4FKXA 6FD1A 5BYSA 1HT6A 5FJRA 5GPRA 2JLEA 2Z2UA 3GAYA 4RDVA 4MY8A 4QPTA 4Q4SA 4QP0A 4CZCA 4HH0A 3HPZA 1QPKA 1FWHC 3W5YA 3I55S 4LF9J 1W17A 2Z58B 1PX3A 1KDNA 2ISFA 1O6XA 2ZVRA 2XY5A 1RTHB 5EY5A 3FYOA 1WOPA 3MMCB 3UNYA 3ZNJ1 2WPBA 2FLNA 3RX2A 3WF1A 4KEUA 3UE2A 5D9NA 3DI6A 3MM5A 4XX6A 3WX7A 2PGWA 3KUHA 4TXSA 5D0RA 3EWUA 2XZDB 4UBPC 2CQPA 2M3DA 1FJGJ 1XDLA 4C6QA 2OPSA 1NSKL 1KBKA 5IRPA 2E28A 4NRUA 3HB9A 1UWAA 4Q8VA 1PAUB 1A53A 1YEYA 1IKWA 1MG7A 2LQJA 1AFIA 2W25A 1IQTA 3FA5A 3NYZA 2YCIX 1HMVB 2ZH4A 1HNXJ 3BG3A 3KK3A 1FTXA 2IYGA 4K4SA 4GYPA 1AUSL 2K1RB 2L41A 1F6KA 1OGGA 2BVYA 4CD4A 1ML1A 3LCWA 4TQRA 2C3OA 1AROP 1GOXA 1GVEA 1JNEA 5KT3A 3R6GB 5XIMA 2F8MA 3IK4A 2DH8A 4HEA9 1PPIA 3TX9A 4JR5A 1WZAA 3AIVA 4LIRA 3F7JA 4XTIA 4DG1A 3VKAA 3E0IA 4WJEA 3KOZA 1NDKA 1XG3A 3C2FA 4IOBA 4NG3A 3E2QA 3APGA 5E2QA 3VE9A 1F8MA 2WVUA 2W01A 1YNPA 5JH2A 2BUNA 1VJZA 5KETA 5AHFA 3W87A 3VD9A 4DPYA 1RD5A 3LXAA 4OLOA 4OHZA 3MI7X 3F2DA 2X0SA 3DFHA 3OVGA 3W63A 1FXPA 3SRKA 1D8WA 1VBHA 1K44A 3ANVA 3LQLA 4ZQRA 1VC0A 5C7PA 4XO7A 2RKIB 5I09A 3UW1A 3QZAA 1WKJA 1ICPA 1WI6A 4Q8QA 4YY3F 1DIDA 4X4VA 4IPPA 4DR5F 3UXDA 3DEQA 1RTDB 3K5XA 4NXSA 4DB7A 3UWQA 2WC7A 3H5UA 3TWZA 1WZLA 1AW5A 3Q8VA 3HFTA 4ZP7A 1A4LA 2X30A 4PMUA 1SJFA 4IX2A 1BVNP 1W8SA 3NPVA 1I60A 4WYWA 5FL0A 1QJHA 2QFJA 3GIKA 4M56A 3QGIA 2B9EA 3URAA 5BW6A 4PA8A 4ERAA 3TXZA 1W54A 2QCDB 4BK9A 3WG6A 1N8RT 3ARSA 3CUHA 1E4IA 1KLZA 3GHUA 4GI6A 4V27A 3G8RA 1QUVA 3A8IA 4KRWA 4HVZA 2IRXA 3W6MA 1F3TA 1HBNA 3IAS9 5JBEA 4NLTA 2XYHB 1UR0A 4PSPA 4AD2A 1J5EF 2PEHA 2YQ1A 4PC8A 3UWVA 5E7OB 3CJKA 4XPEA 4Y34A 2QCFA 2BVTA 5F1VA 1NH7A 1GORA 3UDEA 5BRBA 3SUTA 2Q79A 3VOIA 7AT1B 1HJSA 3CYVA 4IMAA 3LG3A 2F65A 4EZ9A 2ICSA 4AT1B 2VFIA 4K4XA 1POKA 5CC7A 2EW9A 4OUIA 2WSKA 5AZ1A 4Z2IA 4W92B 2ZJQQ 2AJ1A 3H53A 1FUYA 1HWJA 4JI6J 4IWWA 2QSFA 4RR4A 1SM9A 3UA4A 1K7FA 4N9EA 5DM6Q 2E5GA 4M8LA 5KFSA 3OBAA 2J6TA 3WH8A 1UR9A 3NZQA 4F9DA 1D0EA 1TUWA 4JCLA 1RLDA 4HZ7A 3BEGB 4PXDA 2OYKA 3GE9A 3C4UA 3HN3A 4LB3A 3CMAS 2OQYA 2GJFA 4NYOA 2O9RA 2JEJA 1PAMA 1PIGA 3CHVA 2HNYA 4EK2A 5AXMA 4DPXA 4DNMA 1OCNA 2OOFA 5HMEA 1O5JA 3C5QA 1SKUB 1ODUA 2WO5A 3LCIA 3LANA 2ZUUA 3LNMA 1JX4A 5CSYA 4CLPA 3HPOA 5LXYA 1HNZJ 4U8YA 2B3TB 3BR9A 2YW4A 5LHEA 3VGTA 2IS7A 1YVFA 3M8QA 4FAMA 3CL7A 1RTZA 4QYZJ 3NR0A 2B56A 4RW4A 3GUGA 3OW1A 4NLXA 2CPEA 3SCWA 1ZSXA 1HKKA 2C19A 1B54A 3EYZA 4IPNB 4O13A 4AX6A 5GADU 2G0JA 3UCUP 3GMGA 3B4UA 4JTRA 1L9WA 4BKNA 1Q95G 4V1Ak 5DLCA 1KP6A 1GQJA 3HF3A 2CQ3A 2HK2A 2P10A 1I2PA 3VO0A 1VCGA 1IWGA 2PMHA 2C8NA 3W66A 4ZO7A 3CBWA 1U1KA 4A8MP 2VWTA 1Y5IB 4UTJA 3W7EA 1P5BA 3K2GA 1VHIA 3WQ8A 3R5CA 5BOOA 4RNNA 3D7SB 1KWKA 5I42A 4LC6A 4XKMA 1TVNA 4QWEA 1RT7B 3E0LA 1GXLA 3AH6A 5G4HC 2HWIA 2OSQA 2MY7A 4NASA 1UWSA 3VFLA 3ALGA 2LVWA 4IRDA 1LORA 3G82A 3M8WA 1KNWA 1X38A 2VP8A 3KNAA 1O94A 3ABRA 2PLJA 3W70A 2WLYA 4LF8F 1BY9A 1VQMS 3STCA 2FVRA 1FXRA 3V5FA 2DGSA 3N4WA 1TV8A 4Y2CA 1TPFA 3ZZTA 4J9PA 2A3CA 4S3JA 2IPFA 1Q79A 1GVOA 1E5JA 3CCUS 2EXUA 3BTNA 1CXLA 2VC7A 2WBGA 3QFWA 3RYSA 2B7CB 4LVGA 4D8LA 3LGHA 4US6A 2X7IA 4UOGA 3SN0A 1P27B 1PO6A 4PQAA 1C0TA 1O4UA 3C15A 3UXAA 3V4MA 2XN0A 2ZUSA 1SU5A 2UU9J 3KEHA 4WHBA 3ZT6A 1MMNA 1HO1A 1V02E 2VJVA 3ZMRA 3OR2A 3L2IA 1CCWB 1MDRA 2QMKA 3GSDA 4EZ6A 2HS3A 3MP3A 3WX8A 1M7PA 2ZFAA 5I3FA 1OJXA 2MQLA 1W9UA 2VD8A 2PZ0A 4IF2A 2BDQA 3CIWA 1P6BA 1KA9F 2Z29A 4AD5A 1AVAA 1U83A 3DGVA 2E5LJ 4DJEC 5KFPA 2XM2A 1OSCA 1A5UA 3IBFB 2B9YA 1YZ7A 3Q8YA 1BPLB 2Z2BA 4DRSA 5HMSA 1GHRA 2YY3A 4OI1A 2BJ8A 5E3RA 3HJFA 4DR7J 4EI2A 6XIAA 1VAHA 4LPCA 4ANCA 1FXLA 2AYGA 2ACSA 1KD1T 4AZCB 2DISA 4GC4A 4DUTA 3GIJA 4HTJA 3QT8A 5AB3A 1UR4A 1E73M 5SZTA 1JLEB 1XWYA 3UDCA 4JI2F 4JV1A 3H23A 1X7VA 2W24A 3CC7S 4C6FA 4I7WA 3QMQA 1GVIA 3WFAA 4MJZA 1IWAA 4GJ1A 5ADZA 2ASJA 4CNYA 3EZ4A 2B9XA 1NH8A 4KFNA 1MMDA 1LWCB 4F4AA 3TW0A 4KFBB 4YLWA 4PE8A 2AV5A 4PTNA 3PVFA 1YBQA 2P5VA 1GPWA 1R86A 1LOUA 3NJ3A 2ROGA 5IQ6A 5KFBA 1S1WA 1S6OA 2EG6A 3CTLA 5KFWA 4H6RA 1EJXC 4CLSA 2GJPA 1LM1A 1R9YA 1M1KT 2JSXA 5D9OA 3CCRS 4I64A 3UD6A 4DS5A 3EKLA 1O12A 4A21A 3L7UA 4NA2A 2QPSA 3OXGA 1LBLA 4USIA 3DHPA 2QC3A 4AIBA 4X4QA 3AQOA 1S5ZA 4ED0A 1A5CA 4AWTA 2KB2A 2PMZD 1YSJA 1W1YA 5IHRA 1DXIA 5CCZA 3L4BC 3BQ1A 2DIUA 3OZMA 1YBAA 2CDQA 5HI7A 1J18A 4QIGA 1JNRB 3WNNA 1ZLPA 3D67A 1YLVA 4URIA 3FBEA 2PDBA 2QLXA 3RW7A 5K4XA 4U5IA 4HP5A 4LRDA 4NJKA 2AJFE 2DR7A 3USZA 3W02A 1U7LA 4PCSA 2OWCA 1K73T 1NARA 4XDCA 1ONRA 1SSDA 2GVLA 3VOCA 4J9OA 4AL7A 5IWAF 1MQQA 2QXWA 2VC5A 1I94F 1VPXA 1PDYA 3G0SA 4ATWA 5L9NA 4ZQMA 4IOTA 3RBEA 1R7AA 4EBDA 4B9VA 3F2BA 3PKMA 2R1PA 4JTLA 2F3JA 4LRCA 5F0UA 2PDWA 1QWKA 5EFFA 1JJCB 3B03A 1I1WA 2CZ9A 1CGUA 2CJQA 4L6V3 1CEZA 3S6DA 3QGPA 4NNAA 2XWEA 3BARA 3WF3A 2NR0A 1W0MA 3VGHA 2VYOA 1GEHA 3WENA 3N17A 2W9MA 5KZMA 3CT7A 1XMOF 2ZVSA 1WKFA 2WOMA 1RT5B 3BSMA 4ED3A 3VMPA 1N5TA 4Q4MA 5CH9A 4C1LA 5I3QA 1U33A 4KWWA 1AMYA 1CULA 2ZE2B 3C6UA 4QSFA 1NELA 1SC4B 2C1EB 3AAMA 3W0KA 4IRCA 4PUWA 3ZT7A 3THPA 3MDUA 3XISA 2P9EA 3H7HB 1HF6A 1PIIA 3BUVA 5A2QU 1DZ5A 1G94A 4ICLB 3TSDA 2G13A 3KLEA 4MWAE 3BSHA 2VENA 4MB1A 4KH1B 3T0AA 4LF6J 1ZM2A 2YVSA 1IR0A 5T91A 4PMQA 2ALRA 3WNLA 1MXDA 1XRVA 1MRAA 3TJLA 3M4XA 2POKA 4DELA 3TCEA 4E38A 2HURA 1F9CA 3DRYA 1WDDA 1I5OB 4XTTA 4X4OA 3L5AA 1Q4WA 1TRIA 1A3WA 5J04A 5HMYA 1AD1A 4E4FA 2YOCA 2ZZNA 1EDQA 4FP9A 3BE7A 3M0YA 1ZPVA 2GVZB 4Y28C 2W4PA 5ABFB 4JYAF 4JQ2A 2PD9A 3O7UA 3IJDA 5ABTA 4C98A 3M5YA 4S2BA 2BRKA 5EFDA 2BW2A 3R8YA 1GEQA 4KTQA 1TYGA 3KBJA 4Q7NA 3QRPA 1OK4A 2SFPA 1C2PA 1AQHA 3KYLA 3H26A 1XQIA 2VJUA 2XISA 2Z1BA 3I5BA 1REQA 1OY6A 3LRKA 1L3VA 1HNYA 2YDSA 3NGJA 4P52A 5L8RC 4DX5A 2OKTA 4GQ0A 5KZ6A 4IM4A 1BD0A 1H09A 2RKXA 3NG3A 1YYAA 1X4GA 2CJXB 4GVIA 2OPQB 3AI0A 5TQLA 1XFCA 3R1LA 1EQMA 3PZMA 1O5XA 1HKVA 1UB3A 3GNXA 3DX5A 2GO9A 2A3AA 4TLRA 5HN0A 3EB3A 5G4EA 4DQRA 1C0UA 3Q2SC 3OUYA 2F6XA 3SRDA 4J90A 4NJHA 4YS2A 5AE3A 5BYRA 3CJ2A 2RRAA 1VQPS 4C6OA 1CB7B 4WPAA 3F03K 1XLLA 5LZLA 3G8QA 4KHPJ 1BF2A 5DMLA 3SR7A 5CD4H 5HJXA 4ER8A 3DC0A 4F3QA 3E0VA 1N55A 1PSCA 3BGOP 4H4MA 3L5LA 1MLAA 1F76A 4PMYA 1U24A 3LGMA 3LHVA 1N34J 1NZAA 1PTDA 2P9GA 2YWGA 3QZ6A 5I3UA 3V0TA 5J5DA 4EXAA 2YPZA 2VZUA 3MMJA 4USVA 1EGMA 3GG1A 2DNHA 1WI8A 5F0WA 5FDLB 4QU7A 3GR0A 4CP5A 1OPIA 4XZIA 3S1WA 4K3ZA 4OZ0A 1OYDA 1EP2A 5C2GA 4X84A 3GXPA 3UU0A 5I78A 1G0CA 4NEZA 2DZTA 3IV8A 2V2HA 3LGEA 3FJ4A 1RAJA 3MEDA 3VFCA 1TK5A 4XAYA 3V0SA 5LHFA 4IIHA 4XAZA 3M32A 3CO8A 4UTIA 2AL2A 4YJ5A 3KLIB 3LALA 4ECTA 2J8AA 1XUZA 3LP2B 1MSWD 1SSGA 2QJ3A 1CGTA 3MFIA 2FH6A 3AYSA 3D68A 4LVNP 1YJVA 3SAZA 2Y4SA 1WG1A 4BWMA 2QG9B 2APOA 2RF2B 2PDNA 2DVIA 5H1SV 1NBEB 5DT7A 1SQ7A 1G4PA 1EZZB 3BAJA 4DFPA 4M7SA 5I3KA 2AJ2A 1OY0A 2F38A 2DXEA 3GFZA 2PI6A 2NQPA 4O15A 1EO7A 4GY0A 1F1BB 4K4ZA 2CZ5A 1IZKA 4I3GA 1W25A 4K59A 3VGVA 1VYSX 3TX0A 2FGLA 3J81Y 2VELA 3NPWA 3QKEA 4DJDD 3IR7B 2R7VA 4S3CA 2R7OA 3P6YC 3WUFA 3BLPX 3EXYA 4OTKA 3FQLA 1BGXT 1U1MA 2O4MA 4WOQA 3QBUA 5AYXA 2GQQA 2PMQA 3RRGA 4J27A 4EX4A 3KUMA 3M16A 4PRRA 5C9XA 1Z2LA 1ZAJA 3TAMA 2QZ8A 5CQGA 4J9MA 4GYFA 5J2NA 1DP0A 3T0TA 1SC3B 3NVDA 2GVGA 4I8YA 2BBEA 1KGWA 4RNHA 3UR5A 4IMEA 1JZ6A 2EG8A 4NXMJ 3IP0A 1P4CA 1CS4B 1EWEA 3M47A 1HIZA 2EKCA 1JRCA 3SQLA 1SC6A 3UJ2A 1TV6A 3QGHA 3HQNA 1TFVA 4UXDA 5AC4A 3KJNB 5JVHQ 4NJIA 3HQOA 3H7VA 1T9VA 1F2JA 2MQQA 3HPAA 3RB0A 3JW7A 3AOAA 4LMZA 3CU2A 1QVFR 5LMNF 2GNKA 1WD6A 1YKWA 2CYGA 4HTYA 4YXGA 1V77A 3BGRB 2MQ8A 3FGVA 2WCGA 3FEMA 1DIEA 1K77A 3B0YA 1F8IA 5J2MA 2F40A 3U1LA 2HXTA 4ANDA 5CZJA 3IGVA 1KFJA 2E3ZA 1Q6QA 3RBZA 2P3ZA 3Q37A 3GV8B 2ZHBA 4MJ4A 2ADAA 3IJ7A 4UIOA 1ITUA 1DURA 1ICSA 3ABSA 3MMDA 5IV4A 1PC5A 3VAVA 4DR4F 3KLHB 3G1RA 3LPEA 1NOWA 2OX1A 3LPGA 3R79A 4JTQA 3JRKA 1XW8A 2POTA 1M68A 1NHKL 3MMAA 1T9YA 4LQ3A 1X6UA 4GIRA 4W4QA 4B3TJ 2KG1A 5HNTA 1WNOA 8A3HA 3UBPC 4JX5A 1TJ1A 5ETNA 3U6WA 1A0EA 1QI0A 3H2UB 4GKKJ 2KM8B 2DY9A 4WJXA 3NQVA 2D22A 2V81A 3BJTA 1FOBA 2G4FA 3G1HA 3G3DA 1AZSB 3WHIA 2BJ9A 4AZIA 3QPEA 1ESWA 3L4VA 4NQ1A 3C2EA 1XS2A 2AT1B 1WF0A 1FT8A 3WDJA 2PF8A 4NLPA 3T09A 1KR1A 4PWDB 1QI3A 4K4VA 4KPCA 2FB3A 2INZA 3BV4A 3V0UA 3VNMA 3GZ7A 1XCWA 2O1PA 3EOLA 5FESA 1XYBA 1WJ9A 3VX0A 4IDKB 2MKJA 3P62A 2YCLB 1XPGA 3C61A 2ZH6A 1KVJA 3KK2A 3PZNA 1DWIM 4QJ4B 4HYVA 4NLOA 2X1BA 2LDYA 1W9BM 1PL9A 4WDXA 3EX2A 4MY1A 4UQTA 4NZ0A 1KR0A 2G41A 3MAAB 1C3FA 2PDLA 4ZJLA 1LW0A 4JI8F 3WK1A 1LP6A 3I7SA 2LEBA 1UR1A 2XZWA 2IHR1 3PTQA 5D04C 1S1PA 3DRPA 4C9DA 1ZU8A 3LOTA 2I9SA 4X2BA 2EPLX 2BABA 4FXJA 1H74A 3W61A 1JDEA 1CBGA 2QN6B