1FK9B

Crystal structure of hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
423
structure length
403
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 103
structure length 403
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fk9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9B03
3FFIB 2J6UA 1CSJA 3BGRB 5HROB 4TQSA 5J1EA 3KMQA 3LAMA 5C25B 1T05A 3LANA 3DLKB 4NLUA 2FLPA 4I7FA 2YKMA 2VA3A 3H5XA 2YNGB 2WONB 3GV5B 4MFBB 3DOKB 1RT3B 1SV5A 2JC0A 3RB4A 3OL6A 1LWFB 3MEGA 4TQRA 4RNFA 4O3RA 2FLLA 1RT4A 1EP4A 4J9SA 5KFYA 3H2LA 1JLFB 3RB0A 2UVUA 1MU2B 3MEEA 1UWBB 5L1LA 2XCAA 1IKYB 4RW6A 4LQ9A 4YP3A 2ASJA 1JIHA 4IRCA 2BQ3A 1RT1B 2I5JA 5KFSA 4I2QA 3T5JA 1RTIA 1VRUA 1XR7A 3E01B 5J1EB 1TKXA 5L1JA 4DEZA 1T05B 3C6UA 3MF5A 3CIZA 4I7FB 2YKMB 3GYNA 4FBTA 1MMLA 4K4SA 4TYBA 3BSAA 3HVWA 3DMJB 1SV5B 1KHVA 3OL7A 4WYWA 1RT4B 3MECA 1FK9A 2HNYA 4HKQA 1T94A 4NYZA 3TAMA 3H5YA 3MEEB 4R0EA 3KK3A 3CDUA 3BJYA 4YQWA 4NLGA 3E51A 3RBDA 2D3UA 4QW9A 3GV7B 2W9AA 4U7CA 4ZVFA 4O3QA 3DM2B 4ZP6A 4ZPBA 4DL7A 1RTIB 2UVWA 4TLRA 3RBEA 1TKXB 5KFPA 3C6UB 4K50A 4IG3A 2ILZA 1JXLA 4MH8A 4FS2A 4M94A 3KLIB 3OL8A 4K4WA 4J9OA 1T3NA 1RTJA 2V0NA 3BSCA 3PHEA 1D1UA 1GX5A 2HNYB 4ECSA 3DYAB 1HQUA 2I1RA 3KK3B 2IBKA 2BR0A 4Q0BA 2AGOA 3MR2A 3LP0B 1IKVA 1LWEA 2ZE2A 3NKYA 1RT7A 3H98A 1C1CA 4ED0A 2W7PA 1HQEA 3LP1A 4IG3B 3FQLA 2HNZA 2HAIA 4KSEB 4HYKA 1TVRA 4ZP8A 3MFIA 2AX1A 4Y2AA 3NL0A 1RTJB 4KKOA 3JSMA 1QUVA 4LSLA 4KFBB 1DTTA 3QGIA 4I2PA 4KAIA 2AGPA 1S6QA 3G6XA 3V6DA 4XO0A 5J2NB 1S1UB 2CKWA 4Q0BB 2IJNA 3DRSB 1IKVB 1NNDA 3M8QA 3KJVA 4TY8A 2ZE2B 2UUTA 1BQMA 4URQU 1RYRA 1C1CB 2JLEA 4ZPCA 1HQEB 1TL1A 3LP1B 3GQCA 3I5AA 2HNZB 4RW4A 2J6SA 2JEIA 4EBCA 4GC7A 5D3GA 1TVRB 5HLFA 5KFRA 3H4DA 2BQUA 3KLVA 4KKOB 4J9PA 1S0MA 1K1QA 4IRDA 4Y34A 1RT5A 4KV8B 4O44B 4I2PB 2VG7A 3IS9A 2RKIB 2WRMA 4O4RA 1S6QB 5KG6A 2UUWA 1NHUA 1QAJA 1IM4A 4RW8A 4WE1A 3M8QB 1KLMB 3KJVB 2WCXA 4NLWA 4TY8B 2AX0A 4ID5A 1TL1B 3KLFA 3ITHB 4RW4B 1TKZA 4O4GA 1S9EB 4WXOA 5JUMA 5D3GB 1ZETA 1HNIA 5HLFB 2BE2A 3OSNA 3HKWA 5EDWA 4XPCA 5KG7A 1RTDA 3DRRB 1SH2A 4DL2A 2VG7B 2YNGA 3IS9B 2D7SA 4JUZA 2YNHA 3DOKA 2ZKUA 3N6MA 3KHGA 3PW0A 5F8LA 2JC1A 5DG9A 3DLEA 3BQ2A 3QLHA 5DLFA 2BANA 2ALZA 4RW8B 4WE1B 5KFBA 2C2DA 2C2EA 4IQXA 3RB3A 5KT2A 1IKWA 4B3OA 5KT4A 3OHAA 1UWBA 3NBPA 2C22A 5KFEA 5T14A 3OHBA 4ECYA 5KFVA 3KLFB 1TKZB 1DLOA 4O4GB 3CWJA 4O3SA 4K4XA 3T5HA 5HP1A 1HNIB 2ASLA 2BE2B 5CYQA 3NMAA 3JYTB 4IH5A 3E01A 5HBMA 2FJXA 3SFUA 1C1BA 4F4XA 1RTDB 3PR5B 4F50A 3V6KA 3V6HA 1I6JA 1XR6A 2W9BA 3G6VA 2YNHB 3DMJA 3G86A 2IA6A 3DLEB 4NLPA 3QLHB 4IH6A 2BANB 4EO8A 5KFNA 1N5YB 3QYYA 3V6JA 2OH2A 3LAKA 2AQ4A 1IKWB 4B3OB 4Q43A 4KBIA 3NBPB 4WYLA 3CVKA 3OLAA 1N48A 5F8NA 3Q8QB 2FVRA 4ED6A 1DLOB 4MK9A 2IM3A 1HARA 3DM2A 5HP1B 3H5UA 5CYQB 4H54A 4NLXA 1JLAA 5HBMB 1C0UB 3EZUA 1C1BB 1FKPA 2R8JA 4Y3CA 2W9BB 3KLIA 2XGQA 4RNOA 1S48A 1EETA 3NAIA 3FSIA 5J2MA 4PQUA 1RDRA 3DYAA 4RW7A 5KFTA 5KFCA 2O5DA 1LW2A 3LP0A 3UR0A 2FJWA 3RB6A 2YNFB 4YMEA 4M95A 1FKOA 4NLRA 3DOLA 3IGNA 3IG1A 1JLAB 4PUOA 4EYHB 5DG8A 5KFIA 5F8HA 5L1KA 4ED1A 1FKPB 5KFOA 3EPIA 4KB7A 2C2RA 1RTHA 2J6TA 4R5PA 4F4ZA 3Q8PB 3PVXA 2HWHA 1EETB 4KFBA 1S1WB 2YNIB 3V4IA 4FS1A 5F9LA 5J2MB 4PQUB 4JV2A 4NZ0A 2IAJA 5KT7A 3H59A 4WFYA 2UVRA 2V4QA 3GV8B 4RW7B 1JLQB 5F9NA 5J2NA 1S1UA 3DLGA 1LW2B 4NLQA 3DRSA 4LSNA 2YKNA 3CJ2A 5DQIA 3H40A 2B5JA 1FKOB 3DOLB 4IG0A 1S1VB 1TQLA 3IG1B 5EUHA 2R2SA 4PUOB 3PW5A 3UPFA 3BR9A 4RU9A 1JLEA 5DQGA 4G3IA 2E9ZA 1N6QA 1RTHB 1JLGA 4R5PB 1YVFA 1JX4A 3I0SA 1XR5A 3H4BA 3PW4A 4KHRA 2HWIA 1ZTWA 3V4IB 4FBUA 4QWBA 2R8HA 1TP7A 5F8GA 4J9KA 4ED2A 1S1TA 3DI6A 2IAJB 4KV8A 4O44A 3TQ1A 2RKIA 2AU0A 1LW0A 1TL3B 3UQSA 3DLGB 5KFQA 1JLBB 3T5KA 1KLMA 4LSNB 2GC8A 2IC3A 2YKNB 5K14B 5KFDA 2IM2A 3GIJA 4OL8A 1Z4UA 4K4YA 2B5JB 2VG6A 4ECVA 4IG0B 3KHRA 4IR1A 3NAHA 1KHWA 1DTQA 2JEGA 4TY9A 1HPZB 4DG1A 1JLEB 3KNAA 1C2PA 3ITHA 3MR5A 2WTFA 5FDLB 1S9EA 1N6QB 4QPXA 1JLGB 5KT6A 3I0SB 2F8EX 4J9QA 4Q8EA 2BRLA 4DL4A 5DG7A 3DDKA 4QWAA 3FDSA 1RA7A 4JV0A 3DRRA 1S1TB 3DI6B 3QIPB 2XGPA 2OPRB 1LW0B 2GIQA 4ZMMA 4ZP9A 5F8IA 5KFZA 4TYAA 3VQSA 3NGDA 1IKXA 3PW7A 2IC3B 3KK1A 4K4UA 2ZD1A 1C0TA 2VG6B 1DTQB 4ED8A 2WHOA 1VRTB 4DG1B 4Q45A 4ECZA 1S0NA 4EYIB 2WOMB 4IRKA 3IGVA 3JYTA 4MKAA 3GILA 2RDJA 5DGBA 2C28A 3OLBA 1ZTTA 1S4FA 4LQ3A 4WZMA 4RNNA 4EO6A 3MEDA 1N5YA 1IKXB 2XC9A 3KK1B 2ZD1B 5KFXA 1C0TB 2B6AA 5KFMA 3KMSA 3BQ0A 4K4VA 1SH0A 3LP2A 5DQHA 3RAQA 2HMIA 3BSNA 5F8MA 1SUQA 4F4YA 3QGHA 2OPPB 3KHLA 1S9GA 3T19A 4EEYA 4XPEA 3FQKA 4F4WA 1C0UA 4MK7A 1SH3A 4QWEA 3GIMA 2FLNA 3OSPA 4G1QA 4PWDB 2BQRA 1WNEA 2W8KA 2WB4A 1JLCB 4K4TA 4H4OA 3BSOA 3MEDB 2R2UA 3T5LA 1TKTB 2WK4A 2VA2A 4IKAA 1TV6B 1S1XA 2ILYA 2B6AB 1RYSA 2V4RA 3Q8SB 4YR3A 3LP2B 1RT6A 4GC6A 2HMIB 2RDIA 1SUQB 1R0AA 1S49A 4QW8A 1K1SA 1S9GB 2YNFA 1REVA 4NCGA 4J9MA 1W25A 2IMWP 3I0RA 4IR9A 3SI8A 3MR3A 4KHMA 4URSA 1J5OA 4G1QB 4R8UA 4J9LA 2VG5A 4IFYA 3QO9B 3IRXA 3CDWA 3PZPA 4H4OB 4ZPAA 1BQNA 3I5BA 5KFWA 3CO9A 2CJQA 4NLOA 5F8JA 1S1WA 2YNIA 3KK2B 3D28A 4NLYA 5KG1A 4J9NA 1S1XB 5EWGA 5EWFA 1JLQA 1RT6B 3HVTB 2AGQA 2R8KA 3D5MA 3SFGA 1R0AB 3MTKA 2HNDB 2OPQA 3N6LA 4H4MB 2B43A 4MIBA 1REVB 4NCGB 3MFHA 2AWZA 3N6NA 3I0RB 3BQ1A 1S1VA 5KFGA 5L1IA 4X2BA 2GIRA 1J5OB 2FJVA 2RF2A 1JKHA 3ISND 4R8UB 1T03A 3CJ4A 2VG5B 4IFYB 3KLHA 3IRXB 1QE1A 4IOBA 5KT3A 4J9RA 1BQNB 3HHKA 1D0EA 4DL3A 2V9WA 3MEGB 4NLTA 5L9XA 5KG0A 2FVCA 1EP4B 4QWDA 4O3NA 4ZVEA 4KO0A 4KE5A 1TL3A 3MR6A 4MIAA 5I3UA 1JLBA 4RW6B 4ICLA 3BREA 4ECQA 4RUAA 3I5CA 5K14A 2OPQB 1N4LA 3KHHA 2I5JB 4WFXA 4O3OA 4I2QB 4IH7A 4RZRA 5C42A 1VRUB 2D3ZA 4TXSA 3M9OB 1HPZA 2R8GA 3C6TA 4IFVA 1QAIA 1JKHB 2RF2B 5FDLA 3CJ0A 1T03B 3UDLA 3KLHB 1N56A 2UVVA 1QE1B 3KLGA 3M8PA 3V81A 5KFHA 5KFLA 1RT2A 4YR2A 1S10A 3GIIA 3MECB 3G6YA 2ASDA 2ATLA 1FK9B 3QIPA 4DL6A 4KO0B 5KG3A 2OPRA 3TAMB 3KLEA 2JEFA 4ECWA 5JXSA 5I3UB 5DGAA 4ICLB 4NLSA 3PJXA 5KG5A 2E9RX 5KT5A 1LWCA 4IDKA 4QWCA 3M9MB 3GIKA 3IN5A 2QE5A 5C42B 2OPSA 5I42A 1VRTA 4JV1A 3C6TB 4IFVB 5C24A 2W9CA 2FVSA 2WOMA 4NLVA 2EC0A 4MK8A 5KG2A 3RAXA 1HNVA 3KLGB 3HVAA 3M8PB 3OL9A 2DPJA 3V81B 4DL5A 1RT2B 4ZVGA 1HMVA 3ICLA 4TN2A 5J2QA 2XI3A 3KLEB 4RNMA 1HQUB 1S0OA 4ZHRA 3LALA 4ECRA 2FVPA 5C5JA 4RW9A 1S6PA 3CDEA 2BRKA 1LWEB 1LWCB 4IDKB 2IJFA 3TVKA 1RT7B 3PR4A 2FVQA 1HYSA 4ED7A 1S9FA 2R2RA 4Q44A 2OPSB 5I42B 4ZPDA 5CYMA 5C24B 2W9CB 2OPPA 3KOAA 3QIDA 4NLDA 4Y2CA 2XWYA 4O3PA 1HNVB 1S97A 2QV6A 3CJ5A 4WXWA 5KG4A 3JSMB 4LSLB 5KFJA 1DTTB 1HMVB 3QZ8A 4PWDA 5J2QB 3T1AA 4ED3A 1JLCA 3DRPA 3V6DB 4WZQA 4ZHRB 4WFZA 4RUCA 3Q8RB 1NHVA 1TKTA 3H5SA 3PJWA 4RNHA 4RW9B 1S6PB 2E9TA 5J2PA 1TV6A 1BQMB 2DPIA 1HYSB 1RA6A 5CYMB 1U09A 3QGGA 5KFUA 3CJ3A 4NRUA 3FFIA 3QZ7A 4YR0A 3BGRA 5HROA 2D41A 4U6PA 5C25A 2IM1A 2W7OA 4K4ZA 3DLKA 4NRTA 1RT5B 1GX6A 4ZVHA 3QO9A 2WONA 1OS5A 3EPGA 3DRPB 4MFBA 1RT3A 2IM0A 4MKBA 5KFAA 5KFKA 2W8LA 1LWFA 2XCPA 3FRZA 3PW2A 5DLGA 4ZP7A 3KK2A 4ECTA 5KFFA 3ISNC 4ECUA 2XI2A 5J2PB 1RAJA 1JLFA 2R2TA 5EWEA 4ECXA 1MU2A 4ID5B 4EBDA 3HVTA 4EBEA 1IKYA 4Q8FA 2HNDA 3M9NB 2R8IA 4URGA 2JEJA 4H4MA 1RT1A
chains in the Genus database with same CATH superfamily
4TNOA 3I9V9 3M2VB 5C25B 2W4CA 2R7RA 3CCWA 3RB4A 7AT1B 4LVOP 4UQTA 1YBUA 4B9VA 4RW6A 2ADCA 4F02A 4LSZB 3U7JA 3BSAA 3H0PA 5BJRA 1RHRB 1RI7A 3CJSA 3K89A 3H5YA 3MEEB 3KK3A 1X5PA 4KGZB 4OJ3A 2PN6A 2W9AA 2R7VA 4U7CA 4QCLA 1U0SA 4J9OA 1YGYA 2V0NA 3R5CA 2I1RA 3KJNB 3MMBA 3TUIC 4X66F 1HD1A 1HWIA 3D6HB 2G2ZA 2MYFA 2Z2YB 4UY85 3TX0A 3TWZA 1P1LA 2AGPA 1R27B 2ZE2B 1BQMA 1NDLA 5E3QA 3H4DA 2XM3A 3MWBA 2YKQA 1KLMB 4DF8A 1RAEB 3RRKA 3SZ2A 2XMKA 2CPIA 1LWXA 3CO0P 5D3GB 1FWLA 4I56A 3RYLA 3OSNA 2DGSA 4IYQA 3QLHA 2C2DA 4WE1B 3TUZC 1FERA 2GQ2A 2HBZB 1KQFB 5KFEA 1NXIA 3KLFB 2F8HA 1VQ6S 3LGMA 3WX8A 2JVOA 3IP0A 2KB2A 4IH6A 3QYYA 2W24A 1OSCA 4LF4F 3FSYA 3EX7B 2A10A 2HHXA 4DFJA 4PQUA 5KFTA 3EVWA 5HANA 1SIWB 2JWNA 4M95A 1RZMA 2A2DA 1NK8A 3CD7A 4Y28C 2GFFA 1RTHA 3DGVA 4OI6A 2UUBJ 5J2NA 5DM6Q 3A4TA 1FRKA 3P45B 2E9ZA 3V4MA 1Q8LA 1UZDA 3NOGA 4J9KA 1YJ9S 2RKIA 2CZ4A 2CRLA 5CH7B 4QIFA 5FDLB 3J7Z5 3I0SB 1C4CA 1NU4A 1VBXA 3QIPB 3M8SA 3EYZA 4U8VA 3JAMU 1IKXA 1HNXF 3T9ZA 1KONA 1FX4A 1R89A 1DBDA 2AMCB 2YWEA 4JI8F 4X65J 4ZVQB 4I6WA 4AXJA 2BKPA 4HLBA 3P96A 5ETPA 1SKUB 1RAHB 2D3O1 2VDIA 5H9FJ 3K8WA 2W8KA 1P9QC 1SL1A 3QFHA 2R2UA 4ZCKA 4MIWA 4LIRA 1RYSA 2HMIB 1S59A 2HHQA 1K1SA 4NCGA 2K2PA 2NXEA 3MR3A 2B3TB 1SJ3P 1X8DA 3QO9B 2OSQA 1PYSB 3ILJA 2VONA 3KK2B 1RT6B 1M5KC 2UXDF 2F8MA 3JQJA 2CQGA 1CJUA 5B08A 1SKSA 1KN6A 3HHNB 4EGLA 4MIAA 3M7VA 3M30A 3LPYA 3I5CA 5IWAJ 5D6GA 2BEFA 2LMIA 3UDLA 1SQFA 2GX8A 4WPAA 3OFHA 2ASDA 5D8HB 2RH3A 3J7YI 4NLSA 5ETLA 4N5SA 2GVZA 4C3LA 1IR1A 4JP8A 8ATCB 2V2KA 1HNVA 2UU9F 4RX6A 1W2BR 3SEOA 2D69A 1OPZA 3SCLE 3W2VA 2AEFA 3CDEA 4IDKB 3DDNA 2HKEA 4Q44A 2OPSB 1FXDA 4OX6A 2V34A 2OPPA 4XAKA 1F3FA 1VHIA 3PRBA 2BM0A 4LSLB 2Y8YA 2GJ2A 4ED3A 1RUSA 2IDLA 3W5ZA 2C2ZB 3PTWA 3CJ3A 2ZHAA 3LH2S 4AT1B 2D41A 4JI0F 2QA2A 3TZZA 4ECUA 3FZ2A 4Q8FA 1RHKB 1RCXB 1NLKL 2OMOA 2WSCC 2H9ZA 3LAMA 4NLUA 2YKMA 2NPIA 2C3PA 4DWIA 4J90A 1EP4A 1OWXA 3UNYA 1TK8A 2XO7A 1FEHA 4NWBA 1UWBB 2BE7D 2IYGA 4LQ9A 4IRCA 1RT1B 1H3DA 4K5SA 2CXEA 3E01B 1TKXA 1T05B 3MF5A 3CIZA 3GYNA 4X4SA 4P2SA 4ZJQA 3Q8YA 2ZZNA 4C8OA 1HWKA 4F3MA 2ERRA 1TFWA 3CJRA 4ZN3A 4BDPA 2CJBA 1BE4A 1H2VZ 3LP0B 2JHEA 1EJ7L 3HSGA 4Y2IA 5HJXA 1XC9A 3QWPA 3QFWA 3JSMA 1QUVA 1EHWA 2B4PA 2L9WA 5E0OA 4WP3A 2Q3PA 3HT0A 3DRSB 4TY8A 2I9SA 2JLEA 1HQEB 1ZPVA 3HFVA 5HJYA 2ZC4A 3ZZPA 3SCKE 2W7AA 1T11A 4O44B 2HBQB 2E29A 2KT5A 3X3UA 2AX0A 1U1MA 4YDDB 4C97A 1TKZA 1Q1KA 3WIUA 2XYPB 1ZETA 4XIUA 3SSRA 2VU5A 4LR8A 1SJRA 2ZKUA 4CWBA 3BQ2A 5DLFA 2G1HA 2Z58B 1YI2S 1VBYA 2PA8D 3NNCA 4FN5A 4FYXB 3G6VA 3G82B 3G86A 4QQBA 3I82A 3H20A 3LAKA 2GW8A 4Q43A 3MUVP 1NH8A 2LQ9A 1HARA 1JLAA 5K8NA 3K7RA 4X62F 4L72B 2NPFA 4RNOA 3H25A 4QPTA 1U47A 3TA2A 3C14A 3DOLA 5C7PA 3IG1A 4PUOA 3AB2B 1HWUA 2F63A 3MPYA 4R5PA 2VKRA 1FESA 5IM0B 3MI7X 3V4IA 5KT7A 3H59A 4WFYA 3PV8A 2U1AA 2HZVA 1G3OA 2LXIA 5ETMA 5DQGA 1U2CA 2RVJA 2BBEA 1DURA 2ACMA 5LMUF 4QWBA 3N5FA 2AU0A 1U1KA 3MMCB 1HFEL 1KLMA 1S79A 1PO6A 1Z4UA 3OJUA 1XN9A 2YWGA 1NB2A 4DG1A 1JLGB 3J80U 2BRLA 2E1MC 4USVA 3W8PA 3Q0AA 1HKAA 2E1PA 3GFXA 2DR8A 4ZN1A 3AA8A 4KIAA 2DJWA 1LQ9A 3NGDA 1JMTA 4ZVRB 1C0TA 2I2YA 5AE2A 3OTOF 2BM1A 1FT8A 4FKYA 1WF1A 4MKAA 3CCES 4WZMA 1NPRA 1RAIB 4OZJA 3KK1B 2K1RA 2XULA 5DQHA 1YJNS 2JNJA 3D6MB 3E2EA 3T19A 3R27A 2CQPA 4ZS6A 4PG7A 4K8RA 2O67A 1M90T 2PSZA 4OHWA 4JI4F 4XDDA 1B0TA 5FLXY 1YBTA 1WTFA 2VG5A 3MM8B 3TA0A 4H4OB 3ZFVA 4NLYA 4JI3F 3N6LA 3D54A 3E8OA 2HRTA 1VQ9S 2V8DA 4LIWA 1JKHA 1LKZA 1U8SA 2LU1A 4J9RA 1D0EA 5AXMA 5B09A 4RR5A 3JB9k 2LA6A 4DX7A 4WKRA 4H4KA 4O3OA 4B3RF 3CPWR 5FDLA 3CJ0A 3NG8A 2B9WA 3M8PA 4ERDA 2BKOA 1BXNA 1S10A 3FBEA 3NMRA 3MECB 2LFVA 3QIPA 1KD1T 3K5LA 1KC8T 3TRGA 3BDEA 3C6TB 4NLVA 3B54A 3RAXA 3FCWA 5F0UA 2PO4A 4ECRA 1GMUA 4PAAA 3PR4A 1CLFA 1NAQA 1R8BA 1S76D 1T9UA 2RSQA 5J2QB 2I8EA 4FYDA 4LRFA 4MKVA 2M52A 2VFUA 1UZHA 4NA2A 4AD6A 1GX6A 3QO9A 4MFBA 3LGHA 2W8LA 3KK2A 5LMNJ 2OHDA 2AYEA 4M5NA 2BMBA 2R7XA 2W2NP 1NB7A 3FFIB 2DIUA 4OYMA 5J1EA 4UW2A 2J7WA 2BE9B 2VOOA 1MWQA 1T95A 2EVZA 5ITHA 3J7A1 2XBPA 2UUAJ 3T5JA 4DEZA 2YWFA 3OW2R 1IBLJ 4TYBA 4EUVA 2KVIA 1ZAWA 3X1LB 2LQ5A 1MWYA 1RTIB 2ACYA 3RBEA 3C3LA 3CTRA 3GZ7A 2MZTA 2IRUA 3OR1B 3OL8A 1FX2A 2D74B 2XMJA 2AGOA 4ZDNA 1FFWB 3VZIA 1U24A 4Y2AA 4ZIVA 4LSLA 2KTQA 1PC4A 1WJ9A 2IFXA 2CNOB 2JEIA 2HQIA 4TKTA 2WRMA 4X2BA 5KG6A 1URRA 3KJVB 4CLPA 4CT9A 3MUTP 5HQLA 4OI2A 2GMHA 2RT3A 2J7UA 3T1YJ 1T02A 1WKKA 1S6OA 1U1QA 4DR1J 1X0FA 3KHGA 3DLEA 1RTZA 1IKWA 4B3OA 1UWBA 2MKIA 1TAQA 2PIIA 2ZZMA 3R2CJ 3D9BA 2CQ0A 3E01A 3V6KA 1I6JA 1XR6A 2EC2A 4DI6A 3THTA 4LUBA 1Z2ZA 1QJHA 1BC6A 5IS2A 3NBPB 2CPZA 2OELA 1DLOB 4MK9A 4PXEA 4PWWA 2XS5A 1B7FA 1RDRA 1S0VA 1R8HA 3LP0A 1Y10A 5EX3A 3PKMA 1A6LA 3S8SA 1NZ8A 3HPOA 2K7KA 4DCJB 4NASA 5J2MB 4MJKA 4NLQA 3DRSA 1AZSA 4CRJA 2MQOA 4DFMA 2GZOA 2PE8A 1F0XA 3UDEA 3F41A 4O44A 2QL5B 1VBZA 2WB1D 3DLGB 1QVFR 3AJDA 3KJFB 4LSNB 2IC3A 4K4YA 4A8WA 1TK0A 3GPAA 1JLEB 2E7WA 3WC0A 3D4JA 1GNKA 2YQ1A 1RA7A 4CLFA 4P2MA 4ZPWR 3VQSA 1RHJB 1RLCL 2J9EA 2BXJA 3K59A 1NSQA 2ZH4A 2FZGB 1GTEA 5EN1A 2BA9A 3EVMA 5A76A 1SC6A 2K7JA 1H98A 3PFEA 1HHTP 3W2WB 2DD8S 1YIJS 3S01A 1SH0A 3RAQA 3DDIA 1CJKB 3NCPA 3IM9A 3QGPA 2QN6B 1X5TA 4MK7A 1QSLA 3SQGA 5IZHA 4DX6A 3GIMA 3T1HJ 4LFAJ 1QAYA 5HQ8A 5E33A 1S49A 4ZCMA 1REVA 4BWJA 5K9FA 3IRXA 4ZPAA 5IM0A 5EWGA 1QSYA 4DR5F 2HNDB 3M6WA 3CJ4A 5HMWA 1SQEA 1N36J 3A12A 3RAMA 2GJIA 2EPIA 3KUHA 2V8GA 3MMCA 1IBMJ 3B8HA 4TXSA 5D0HA 1XMBA 4P73A 3Q8UA 2ZH9A 2CJXB 2BJDA 3AD9C 1RT2A 2DNKA 5KG3A 1GH8A 5DGAA 2CPFA 2DNMA 1FWKA 3EDRB 3I56S 2VPXB 3R5GA 3HHLC 4CP5A 3EXCX 2GIFA 3CF5Q 2HHPA 4OZ2A 1HMVA 2FGCA 4EFAC 3KLEB 4QIWD 5LJ5Y 2DBBA 4WIQA 4HT5A 3OTCA 4XTTA 4OI1A 2DRDA 4Y2CA 3K58A 4KTQA 3ENWA 2DNPA 5E2QA 4RNHA 4KPCA 2Z2ZA 2KXFA 5LSOA 5KFUA 4WJBA 2PI4A 3A8IA 4IOCQ 4FNHA 4OZNA 4NRTA 5CD4A 3UN3A 1NH7A 5EHHA 5B0GA 2J8AA 4EBDA 2HHHF 4UY8T 4A4JA 1VRQC 3A8KA 3ZTOA 3OXLA 4BC9A 4ZCLA 3BGRB 1EIYB 3DLKB 4QJVA 3D1HA 3NXZA 3H2LA 2OD6A 5L1LA 2KVQE 2ZOGA 3HFKA 3HSDA 4K4SA 1SV5B 2EWHA 5CD4H 1MWZA 1NJWA 3MECA 3BO4A 4TU8A 3KYLA 1IM6A 3R7SB 2F1FA 3BJYA 4ZP6A 1U6ZA 1RSCA 2HFNA 1FRLA 1NCLA 3ZNJ1 1NK4A 2YKPA 5IC6B 2IVFB 4X66J 4F2SA 2R7WA 3FQLA 2HAIA 2QA1A 4HYKA 4KFBB 3QGIA 2WBMA 1S6QA 3M8WA 3MAAB 4USJC 1C1CB 2N82B 4BCAA 2KHDA 5DZ7A 4ELVA 1X7VA 1TVRB 3KLVA 4C11A 1KSPA 1NKCA 5HAOA 1PGZA 4FVCA 1VQKS 1IM4A 4NLWA 4LFBF 4O4GA 5JUMA 1CG2A 5HLFB 4L76A 1VQ8S 1SH2A 1GQEA 2JLFA 1K8AT 3TO8A 2PMZD 2QG9B 1ZAXA 5BYQA 4OHVA 2LU2A 2K8GA 2DB1A 4M5DA 4DOZA 4WP8A 4LF8F 4Z7CA 4GMKA 3DXBA 3J7ZT 4FDFA 4LF4J 4ZLJA 3Q8QB 4U7UK 2CJKA 4OJGA 5CYQB 1FDAA 2FY8A 1VFJA 5HBMB 1FKPA 4CT8A 2W9BB 4RU2A 1EZZB 1EETA 2N4DA 2UXCF 2H51B 2MZSA 2XLIA 2MSSA 3RB6A 3MPDA 3JQMA 3IGNA 3NGTA 4RL1A 1Y00A 4PYAA 4DJBA 1RWOB 4NX9A 2QA4G 3QMQA 3PVXA 2YNIB 3KFWX 3SDEA 4FS1A 2V4QA 1M1HA 1SCJB 1R3NA 5AE1A 3SMZA 2R2SA 2EW9A 2AJ2A 1YVFA 2DRAA 4KHRA 1Q79A 4ITSA 3CB4A 2CDQA 2RDDA 1O6XA 2C3UA 3PEJA 2MQPA 4CLZA 3TEHB 1A0OB 5CHCB 4DZ6A 4TY9A 1CS4B 5IC4B 4KPYA 1U8WA 2V50A 1UETA 2KJVA 2HPUA 3DI6B 3W9HA 5KFZA 1HNXJ 3AXKA 4Q45A 4JI8J 3BGOP 2MZ1A 1K44A 4C0OC 3K8VA 1S4FA 5I3PA 2E66A 1SQGA 3OT9A 2AF6A 1WDDA 4OYBA 1VJWA 1PSDA 3QGHA 4NXMF 2G13A 4CNYA 4PR6A 1HA1A 3SSSA 2Z2MA 2ZWOA 2WB4A 2DGQA 2BUNA 3KUGA 2MQQA 1KQGB 2FC8A 2X7IA 2FB0A 2V4RA 2HGMA 2P5VA 1GMVA 1R8CA 3I0RA 5LT5A 3SI8A 4IR9A 1A9NB 4G1QB 2KKHA 1P9YA 4UF4A 1BQNA 3MM6B 1S4EA 4J9NA 5EWFA 2W2QP 3QATA 2UXDJ 2ZOFA 4Y6IA 1KBRA 2VBYA 2GIRA 1TELA 3EMTA 3HDSA 2H4YB 2G0JA 1QE1A 2FVCA 3TW0A 3HHLB 4KE5A 1XNRF 2RRAA 4ZCIA 2R4FA 3V81A 1E6VA 5KFLA 4KO0B 5JXSA 3SQOP 5KT5A 4O23A 2QE5A 4YDXA 2CPXA 4B9SA 1MROB 2UU9J 4MK8A 1ELOA 4I6AA 4TN2A 4EK2A 1EX8A 4I67A 2IJFA 5D4NA 1FD2A 3LO3A 1PJ5A 5I42B 5JVHQ 3O2IA 3UNGC 1SI9A 1WTBA 3FMWA 3NS6A 3I4PA 3Q8RB 3OTEA 1S6PB 1SJ1A 1NBEB 1QM9A 2BJ1A 4YR0A 3FKBA 4JI0J 5HN0A 4R0JA 3VR1A 4QBUA 1RT5B 2VQEF 3EPGA 4YY3F 3TJ9A 2A3JA 2J8SA 2D1CA 1GFWB 4DN9A 2XB2D 2HNDA 1SKWA 1T9XA 2OTJS 4KQZA 1KFSA 1XERA 4A8OA 2J9DE 2N7CA 3OFEA 3GV5B 2CWXA 2DT9A 4TQRA 4O3RA 3GCWP 1RT4A 5A2QU 1U4BA 3POTA 4MAKA 1UKUA 3JXOA 1DQAA 2VFVA 3OL7A 4QYZJ 4ANDA 4NYZA 3CDUA 4KRWA 2R7UA 3GV7B 1NUEA 4M5KA 4OI4A 4MH8A 5D0RA 4Q5VA 3KLIB 1JJHA 2G2YA 3PHEA 1D1UA 2Y0SD 4FF4A 4FP9A 2MPUA 5E3CA 4IG3B 2MJNA 2W2MP 2F4VJ 2A1BA 4KKOA 2FHJD 2HFOA 2XMVA 3M1VB 3GJTB 2DGTA 1FWPA 4DV3F 3BEGB 2CG8A 3CJQA 4RW4A 1Q82T 4IRDA 1K1QA 4Y34A 3IS9A 3LUYA 5GVQA 2MDAA 3FGVA 5L38A 5E3AA 1N5QA 1XQIA 2VFSA 2YNHA 2DNLA 3PW0A 1WHVA 5DG9A 4ZK7M 1ZM4A 2V94A 3OVSA 1IWGA 4WBFA 1PG5B 2LCWA 4WK3A 1NEEA 2OIHA 3CJKA 1C1BA 3F44A 3M2RB 1UFKA 4GO7X 2AZ3A 2IA6A 2CQBA 2XO6A 2KM8C 5H9EJ 4A46A 4WYLA 3OLAA 4RPFA 2H5JB 4X62J 2YH1A 3IO1A 4Y3CA 3F0NA 4J5OA 1AUDA 3QT6A 1NPKA 1WI8A 3W5XA 2HVZA 2UUCF 2MZQA 1FXRA 4YMEA 1U02A 1ROFA 4OYPA 2ZHOA 2CPHA 4P75A 5BR8F 4KFBA 4QR0A 1HW9A 5F9NA 1N88A 3MAAA 2EEYA 1HIYA 3PW5A 2OFGX 3BR9A 3THPA 4RU9A 5LMUJ 4V19J 1N6QA 3BH6B 2HWIA 4FBUA 1LW0A 3UQSA 2WVDA 1JXVA 5KFDA 4ED5A 3NAHA 1C2PA 2WTFA 1GEHA 1T9VA 2HBYB 3QAUA 4ZP9A 2V8PA 3OTOJ 1DTQB 3MUMP 2WHOA 1MLAA 2FPHX 2B9XA 4EYIB 1SJFA 1JJ2R 4MYUA 3P49B 1YLXA 5KFXA 5M2RA 2DK2A 4M8LA 4WIIA 2Z0GA 2B0GA 5ADZA 4JI4J 3MMAB 3LP2B 1OQ3A 2B4UA 1PC5A 5IFMA 3IBFB 3K5OA 2H54B 4R8UA 2I6WA 4RUBA 1QTNB 4JI3J 3PZPA 4B3SF 1S7HA 2FHOB 2YNIA 5KG1A 4GVBA 1S1XB 2ZOMA 3PRDA 1R0AB 4OJHA 3BQ1A 4CH7A 2RF2A 2YY3A 4CLSA 1LNQA 3B78A 5KT3A 2QA4S 3AA9A 2V8VA 3MEGB 1NO8A 3VVUA 1K73T 2DO4A 2E5GA 4OI3A 2EFQA 2GJFA 4RLEA 2DCLA 4KGKA 1N56A 2VC1A 2VD3A 2V9KA 4MKYA 3TP2A 3HMJG 3G6YA 1N5TA 2IVYA 5LJ3Y 4ICLB 5HVGA 5E3RA 4CH0S 1FDDA 2Z30B 1XMOF 3CCTA 4AXIA 5KOWA 1L3UA 2MQNA 1I51B 1IQZA 3D0HE 1WF0A 1FKAF 2XI3A 1R0BG 4Q2MA 2X3GA 4CH1A 2R2RA 4I1TA 1DQ9A 4K2XA 4C2MA 3DRXA 4M5IA 1X5SA 2MKYA 3J81j 2QMWA 2RHQB 1HD0A 2CPYA 5I4MA 4WZQA 1IJFB 4C8YA 4WFZA 4B9NA 1NHVA 5M2PA 2XZWA 3BKUA 3EXYA 3QGGA 1IR0A 4MKBA 5KFFA 3KXDA 9RUBA 3J80Y 4ECXA 4EBEA 2RJZA 4YB6A 4DLGA 3ZTRA 4TQSA 3G8TA 2YXLA 1PKUA 1RT3B 5HMZA 2UVUA 1MU2B 2FGOA 2CDRB 2GO8A 4C0HA 2HFZA 4UUXA 3HULA 4DU8A 4I7FB 1RWMB 2P6SA 3DMJB 4Q7AA 1HBNA 3QJLA 1I94F 4ZITA 3M6VA 4DSEA 3HT3A 4ZVFA 1ACMB 3DM2B 1Q7LB 4ZPBA 4K50A 1JXLA 1RTJA 2HNYB 2QIFA 4JBCA 2CQ3A 3C16B 3H98A 2HFSA 5AT1B 3HM9A 3W9JA 4HACB 5CZXA 2VH7A 4ZVPB 3DNCA 4X84A 3R7NB 2KHCA 1PJ7A 1ZA2B 3ENVA 4LRAA 4GC7A 1UPMB 1RT5A 2DNOA 5ETSA 1YZ6A 3C66A 2GQQA 2EI5A 1N8RT 3A8EA 3FNNA 1TL1B 3DN9A 5GADU 1S9EB 1FTRA 2BE2A 3THVA 5F8LA 2NREA 4DR2F 3RB3A 2HFVA 5KT4A 3SCJE 2ASLA 2IJRA 2P9GA 4U67Q 2HK3A 1Y7PA 2NZCA 2A2CA 4P2XA 5HP1B 2E1RA 5LXYA 1VOMA 4C8LA 3KLIA 4E0DA 4DR3F 1CBKA 3ONQA 2PI5A 3BKTA 4CQ1A 2GHVC 4O0NA 5K8OA 2XZDB 3UR0A 3C15B 1UWAA 5F41A 3L9ZA 3N79A 1B4SA 1IVZA 3VGUA 4TU9A 5IXUA 3M1VA 2AJQA 3OXGA 1RADB 3GFYA 1TQLA 2A18A 1RWNB 1TMMA 1NJYA 2RMLA 4F4KA 1XR5A 1N33F 4GRSA 5K20B 4ILRA 2IAJB 3FEYB 1YITS 2GHWA 1JLBB 2VV5A 4X4QA 2VOPA 3OUYB 1UL3A 2BJEA 5DS7A 2JJ4D 3EGNA 1S1TB 2MY8A 5JJBA 2OPRB 3N0VA 4C3KA 4TU7A 2CQ4A 3MM9B 4DV6F 4BC7A 4M5JA 3LOUA 1KQSR 3DOMB 1RAOA 3NCRA 4ER8A 3BYRA 1KEKA 2GV1A 4DR6J 2B6AA 3EZOA 3BGFA 3BSNA 2XQCA 2QTWA 2BQRA 2H3EB 3BSOA 3MEDB 3PO4A 3DLHA 5ETQA 2Y1LB 1FRXA 2MMYA 2HURA 3CMAS 1M5SA 3CDWA 2EFPA 2F3JA 1SVDA 3B4DA 4DR5J 3BPDA 1S77D 1SB6A 2QLFB 3I9ZA 4FPIA 3FEZA 3EDQB 2DEJA 3MAHA 1T03A 2CQDA 5E5NA 1Q53A 2VKZG 1JJCB 1RISA 3VGSA 4RUAA 2M8DB 3US5A 3MCMA 2FYXA 4UZCA 2VJVA 1N54B 1PBAA 2BJ8A 2OMLA 3GIIA 4ETZA 1X4BA 3M8RA 1F6TA 1UA0A 4YN3B 1LWCA 3ZZOA 3KUEA 3VAMA 3P4UB 4UOGA 4JV1A 2VBXA 3FBBA 4NXNF 1AT1B 3D68A 4CM0A 4RNMA 3OQ2A 3GJRB 4NEZA 4RW9A 2YX4A 2Z2LA 2BRKA 1HI8A 1CVJA 2W9CB 3O6QA 3K2YA 1S97A 2RILA 5CCMA 5KFJA 2WW4A 2V5HG 3BKFA 2LDYA 4FYYB 3ET6B 4U96A 5ETOA 3FCVA 5CYMB 4B3TF 1CJTA 2E7VA 4CO2A 3QZ7A 5C2CA 2XYGB 2PEHA 3VQTA 4U6PA 3TYTA 4ZVHA 2FHJA 4GKJF 2CJAA 1E6YA 2HHHJ 2AJFE 2R2TA 3G71S 4URGA 2JEJA 4DSJA 1PBUA 2J6UA 1APSA 5HROB 2HS3A 2FLPA 1HI0P 5DM7Q 2CFXA 3MEGA 1X4AA 2IRXA 3NGUA 2PD1A 5A8WB 3UCUP 2XCAA 2KN4A 2BQ3A 4X64J 5KFSA 1RLDA 2B7BB 3P6YC 2G0IA 2XMWA 2KJWA 2X1GA 4FBTA 3MCSA 1UJ6A 3CJTA 4DV4F 1RGVA 4R0EA 3M2UB 2JSXA 4DPTA 1NJXA 3C6UB 5DRKA 1S7IA 1TR0A 4M94A 1NKBA 1VK3A 1T3NA 4B9TA 4JI1F 3UN2A 1GX5A 1F5CA 3NWGA 2AHOB 1HL6A 3LQVA 3L4BC 2C1EB 3MR2A 5HO4A 3LP1A 2HNZA 3G2XA 4DV1F 3HJVA 4ZP8A 3MFIA 4ZLNA 1F2HA 4I2PA 4OIXA 3M8QA 4URQU 4U7UD 5CZVA 4PCQA 3A8JA 1OIAA 2VG7A 1CJVA 4RW8A 2DGVA 1F60B 4LFBJ 2V8HA 1KTQA 3HKWA 1T0TV 2BDPA 4XPCA 2DNHA 2XMUA 2D7SA 5IV3A 3W1YC 2QEXS 4JV5F 1HBUB 2P9EA 2MTLA 1G4CA 1UFWA 5KFVA 2ZJPQ 5HK4A 3QWUA 4LF8J 1Y3KA 3DMJA 3KG4A 3WZ0A 4KBIA 2HQFA 3G6ES 1BWVA 2XY7A 4F0HA 3DM2A 4J9VA 5D78A 5CQGA 3DRYA 2UXCJ 1WKLA 1P6TA 1X31C 5KFCA 2GGPB 2O5DA 1LW2A 3GR0A 3C16A 1YRTA 1OQ6A 5GMDA 2ROPA 1CEZA 4ANCA 2UVRA 4RW7B 2QGFB 4NEYA 2MZRA 1UP1A 2CJYB 4IG0A 2Z57B 3UPFA 1J5EF 5HMYA 2JH3A 4F36A 3CE8A 1UVKA 1VIOA 1TL3B 4M63A 2KO1A 2MSTA 2MQLA 2YKNB 2B5JB 2VG6A 1RKJA 2IYIA 1KHWA 2M7SA 1S9EA 2QX0A 3SV3A 4HR2A 6FDRA 3PCOB 2CZVC 4TYAA 2ZD1A 1HWLA 1FJEB 5J1PA 5DDOC 2Y8WA 1NM2A 3UN5A 2GAHC 4WKYA 4R25A 4C9DA 1UMJA 4NXMJ 1SUQA 2B56A 2XWXA 1HHQA 1S9GA 1TZ0A 1AROP 5LL6d 2KZZA 1WG1A 2W01A 1YJVA 2WK4A 3AD8C 2V4JB 4YR3A 2PFFB 2C2NA 2VASA 5HSPA 1WC5A 2Z56B 1FRIA 1U7LA 3MOZA 2AYMA 3EZ5A 3EGVA 5AJ3J 2AGQA 1VQ7S 3RW6A 4L74A 1VQ4S 3SYZA 4PWUA 3N6NA 4RKUC 2RQ4A 1NK0A 1V9OA 3ISND 1YRUA 2LYVA 3KLHA 4IFYB 4KHPF 3CD5A 5L9NA 1G7CB 1N0VC 4PKDB 1I1GA 2FJAB 1XNRJ 1JLBA 3D1OA 3OUYA 2CZ9A 4IH7A 2MGZB 2R8GA 4IFVA 1QAIA 4ETXA 5K8PA 3CDAA 5KFHA 1XTZA 2OPRA 3MPWA 2J9DA 3PJXA 5KG5A 5F0WA 1V5VA 2XS2A 5C42B 4B9LA 1WG5A 1IBKF 5KG2A 3KLGB 1PAEX 4DLEA 3DOMA 3C2PA 4N8OA 3ICLA 5CABA 4ED7A 1ZM2A 5C24B 2ZH3A 2MQ8A 3NP5A 1H7XA 1SJ4P 3GYGA 3CJ5A 1Y3JA 1VK8A 1DTTB 1JK9B 3EE3A 3QZ8A 2GVDA 1CULB 3K5NA 3NEKA 1ZZFA 4MTPA 2ZH8A 2VQEJ 2EK1A 3IC1A 3GJSB 3PIPQ 2C42A 2AKWB 1T7PA 1MW7A 2DEIA 1P8GA 1JLFB 1RJJA 1IKYB 3JTNA 4DSKA 2EKNA 1R7IA 4DR7F 2L48A 3QT5A 2DY1A 3AY0A 2C3YA 1WORA 2ZH1A 4C0BA 1T9YA 4OYXA 2K3KA 1WACA 4A48A 2D3UA 5GAEU 3I96A 3HZEA 2P8IA 4QZVB 1HI1A 2CQ1A 3N4WA 5GADI 4FKXA 4LJMA 3MM7A 4Q0BA 4E8UA 1IKVA 3V2UC 2QT7A 1V3RA 3GU0A 2POKA 3I55S 2V2VA 4RO0A 2VF3A 4ZLLA 1TMJA 1L3SA 1KDNA 2O3DA 4KAIA 2RRNA 4DV3J 4RWWA 2KXHA 4WU3A 3FMBA 2XY5A 2ASYA 4PQAA 3K5PA 3CD0A 2YTCA 1TFYA 1VR6A 2R7OA 2R7QA 1N5SA 4KV8B 4O4RA 2D9OA 2CPEA 3GG0A 3IM8A 2KDOA 1JNRB 1UVLA 2QFIA 3AB4B 1GXTA 1YSJA 1KRPA 2HVIA 5B0DA 3GWCA 2ZBRA 5IT4A 1UW4A 4JB8B 2ZJQQ 5A8WA 4ECYA 3B6BA 3OR2B 4O3SA 5LSRA 1YX2A 1J27A 3OFFA 4P7TA 3UE2A 1HNIB 3DHWC 4BWMA 2X1FA 1RTDB 4F50A 1WD6A 2BANB 4LRDA 3D0IE 3M2UA 3IWXA 3VCDA 5F8NA 4ED6A 4EMDA 2E1CA 2YWKA 3IA0A 2UUCJ 2XMMA 3N9UC 2J5AA 2BW7A 1D8YA 2W4DA 1FKOA 2N3OA 3EWGA 1OYEA 4ED1A 3ZC4A 5BR8J 4CTAB 5GAHI 5F9LA 4NCBA 1HR0F 3VVTA 1JLQB 1RP5A 2QFJA 2BKNA 1YK9A 3FSXA 3J81U 2YWHA 4IOAQ 3UDCA 2LA4A 2DGXA 5A2QY 3M32A 4HDGA 2FJBB 4DCPB 3NOCA 2G2OA 1X4GA 4KH0B 3OFGA 1EQMA 3GIJA 3KNGA 1HLWA 2VODA 1VQMS 4EU0A 4NZ7A 1QY7A 2W4PA 3MR7A 2ATCB 4ZMMA 2R3VA 5J1NA 1EARA 1VRTB 1U48A 5A8RA 1VI7A 2F4FA 3CD6S 1FE0A 3RW7A 3UI3A 8RUCA 1VLYA 3KMSA 2DH7A 2CWKA 3H42A 1YQHA 4F4YA 1YWXA 2ZUGA 1H7WA 4CZCA 4PWDB 1XNQF 2VA2A 3FK4A 4JYAF 4GC6A 2NSCA 2UZAA 2GGPA 4ID8A 1U26A 3DFEA 3VAHA 1W25A 4CYUB 1J5OA 4LF2A 3GIRA 4LBHA 2CJQA 1CPZA 1RBOB 3GFHA 2DHXA 2IPOB 3MTKA 4EI2A 1RXOB 4IUFA 5KFGA 3QSIA 4LF5F 2X51A 2EFGA 3VZHA 4NLTA 2G9OA 2RQMA 2MEWA 1TL3A 3AXMA 1HBOA 5D0EA 2HHTA 2OPQB 3KHHA 1UA1A 2I5JB 4I2QB 2CNKB 4HI1A 1FDBA 3CULA 4DBQA 4LBPA 3TAQA 4P2FA 3TAMB 4X4PA 2JEFA 5I3UB 1FVQA 2XLKA 2ZITA 4I4BA 4HHUA 3HKZD 1XMOJ 3MOJB 3ZTQA 2EC0A 2QL9B 3ZZUA 4ZVGA 4QU7A 3DLJA 4N77A 4CM2A 4DQPA 1Q0NA 1U6BA 3KOAA 3HO1A 2KI2A 3QBCA 4OV1A 4USMA 2OLWA 4IO1A 4OFZA 3V6DB 4ZHRB 3CT9A 1TL7A 1HYSB 1U09A 1T9TA 2GMJA 4ZVTB 3M2VA 1MSWD 5C25A 4B9UA 3DRPB 4I0WA 2WZ1A 5J2PB 3W61A 4YB5A 3BF4A 2DNZA 3JSYA 2Q6CA 3LWLA 3W7BA 4L75A 4ILLA 4KH1B 2WONB 3DOKB 1LWFB 2DR6A 1YJUA 3RB0A 3MEEA 4ELTA 2ASJA 3DLLQ 2XS7A 3MDFA 1I94J 3MMJA 1VDHA 3H7HB 1U2FA 1U1NA 1RWPB 1KVKA 2WVCA 3D1QA 3BDPA 4NLGA 3E51A 3FC9A 1RWUA 3MM5B 1Q16B 3D2WA 4TLRA 5K8MA 4WFBQ 3BSCA 1RWVB 1UVMA 3UCGA 3KK3B 4X4RA 1EAYC 2FZKB 2ZE2A 3CMES 2HS0A 1Q95G 1U0HB 3ZZYA 2M9KA 4DU7A 4QIEA 5KOXA 1DTTA 3MEKA 2MJUA 2CJ9A 5H9FK 3MMBB 4G1IA 1FTCA 1WOOA 1OYDA 4DHVA 3N28A 5DDPC 3IWNC 5D3GA 1BQXA 4J9PA 1S0MA 1HNWF 1IUJA 3ZZRA 4WE1A 2LEAA 3KLFA 3ITHB 3RTVA 1RE1B 3NGKA 4DR2J 4DCOB 3ENQA 5KT2A 4WWSA 1NSPA 2WAQD 5T14A 2LLZA 1Q81T 4K5RA 2FIUA 3C8YA 1FE4A 1FVSA 1WSRA 5RUBA 1KWMA 3QLHB 2AQ4A 1WC1A 2VICA 3CVKA 1N48A 3IBWA 3TA1A 3K17A 4NE9C 2DHSA 1MG7A 1UW9A 1GK8A 4DR3J 2XGQA 3IWLA 3BV8A 2P2CB 1IWAA 2RQKA 2DR7A 3ILIA 5DG8A 2LQBA 2NXCA 4LT6A 2JFDA 3HZGA 3W60A 3HP6A 3AD7C 1S1WB 4PQUB 3R5JB 4CO1A 4JOUA 1AB8A 2ZZTA 5L46A 1X60A 1N33J 1RTHB 3H90A 3I0SA 3LF0A 4WTYA 2R8HA 3W3SA 1TP7A 4KV8A 4B9MA 4LF9F 3ADAC 4AL5A 2IM2A 3P3DA 2JEGA 2QMUB 4OX9F 3PEHA 1KOHA 4DV6J 2XGPA 1OY8A 3CGIA 1KFDA 3EJMA 3ZTSA 4OLPA 5IQQA 1S0NA 4IRKA 3OLBA 3T1YF 4W98A 1IKXB 4DX5A 4DUZF 4XK8C 3T9NA 3K57A 2HMIA 1ZBTA 2RU9A 1ICEB 3KHLA 2DNRA 2DTJA 1TK5A 4QWEA 3I87A 3BBBA 3U1MA 2MLXA 2FHMA 2CG4A 4P7VA 4U95A 3H2VE 4IKAA 2ZH7A 1RT6A 2RDIA 3SBMA 3I31A 2FZCB 3UWTA 1SXLA 2FY1A 2E1AA 2OD4A 1BMQB 2KFNA 2CNLB 2K06A 3BGLA 1JLQA 3M8YA 4H4MB 7FD1A 4NCGB 3MFHA 2HBRB 1XEZA 2KG0A 4N8NA 3OL6A 3W63A 1NHKL 4O3NA 1WC0A 1AUSL 1WC3A 1UJ4A 4C4WA 3PRVA 1MN9A 1CJUB 4USIA 1FK9B 3PKYA 4DPYA 3M30B 1WWHA 2E5HA 3K0JA 4IDKA 3IN5A 3M9MB 2BOAA 2OPSA 1VRTA 4NXNJ 2JX2A 3R8YA 1GTHA 3QAEA 2QO3A 1WUUA 1RABB 3D7SB 2VUGA 1G2EA 2OAUA 3T41A 1PILA 4NLDA 4HHJA 1Y0HA 1HNVB 4H4KC 3R5DA 2DXFA 4PWDA 4YFUA 3W2VB 2V2ZA 3VAIA 4B3TJ 3RUBL 3D66A 1N34F 4DPUA 2QLBB 4FXWA 4FXVA 2RUGA 2JRSA 5CAAA 2LXUA 4GKJJ 4K4ZA 1SJQA 4OZ0A 1OS5A 4LFAF 3ISNC 3TJAA 1RT1A 2F5GA 5DETA 4AL6A 1T05A 4NYPA 4UT4A 4WFAQ 1HNZF 2ZH2A 3I4HX 2NYIA 1JIHA 2HQDA 2MXYA 2I5JA 4I2QA 1VQLS 2KFYA 5D77A 2YKMB 2L3MA 1MMLA 4DV4J 2HGNA 3RRHA 2HRYA 2JZ5A 3KDNA 4HKQA 1OY6A 3AOCA 3TAMA 1X4HA 4YQWA 4K0KF 4QW9A 3RRGA 2UVWA 2A0FB 3ZZ0A 1TKXB 2MKJA 3WQPA 2ILZA 4JI1J 1KVIA 1KP6A 3Q2TC 2AYGA 4L3NA 2BR0A 2AW0A 4I64A 3W65A 1R6VA 2JLGA 4HEA9 4ED0A 1HQEA 3T3FA 2ZH5A 1RBAA 3BGUA 2DNYA 2XSFA 3FJ2A 3P5TL 3V6DA 2IJNA 3SCIE 3S6EA 3QT7A 4F04B 4MYTA 2J6SA 1WHWA 1S99A 3TJ8A 2C2KB 1VLOA 1Q5YA 1K0TA 1NHUA 2WCXA 4TY8B 2XHWA 1L3TA 3PHTA 2WVEA 4EZ6A 3UD4P 1U25A 4PG5A 1WHXA 4P52A 4JV5J 3HCXA 3DOKA 3G82A 3TUPA 3AAWB 1I3OB 5I3QA 4Q2LA 4JI7F 2J7KA 1DJ0A 1HBMB 2ROEA 1URNA 1TKZB 4K4XA 3JYTB 4OQJA 3L7PA 3V6HA 4C6AA 4NLPA 1AA1B 4EO8A 1N5YB 3JSBA 1DZ5A 2FVRA 3MM5A 2FJDB 3TEGA 4OLOA 3DKDA 4ES2A 1YRXA 5FD1A 2CPDA 2FHKA 1KQKA 3T6JA 4RUHA 1OY9A 2JDJA 3HHEA 2J0QD 4EWTA 1PJ6A 2OFHX 4NLRA 3TAPA 4YB1P 1JLAB 5B0FA 2M88A 2RAQA 1U0HA 4NMLA 3Q8PB 3OPKA 4HDHA 2N3LA 1KKHA 2V63A 2BZ2A 2C2OB 2VFRA 1J5EJ 3C14B 3DOLB 4ALZA 1S1VB 3IG1B 1KNZA 4PUOB 4G3IA 2SXLA 1JLGA 4R5PB 1JX4A 1H0HB 3PW4A 3V4IB 3PYGA 4AFFA 5DDRC 3IMQJ 3O8WA 1FHTA 4USUA 4ZJLA 3IXQA 4OL8A 4ECVA 3ETMA 1Q8IA 3PACA 4WU2A 1WHYA 4DV0F 3ITHA 2LDIA 1JXEA 2ZNZA 2B4OA 4QPXA 4PG6A 4DUYF 4DSIA 1HW8A 1WEXA 3KK1A 4YUDA 1LV5A 3RZAA 4ECZA 4DG1B 5G0RB 3VGVA 2EFOA 5DGBA 3FZBA 4CO3A 2XC9A 1C0TB 2UV8G 3QT8A 4K4VA 2YPYA 3FQKA 4NCAA 3H8YA 2EKYA 3JQKA 5L39A 3MM8A 4H4OA 3T5LA 1FD8A 1SPBP 2K1RB 5CCLA 2VFTA 3CXCR 2PEBA 4YOEA 1T8EA 2RB7A 1SL2A 5ETVA 1NK5A 3NNHA 1S1WA 5LXRA 1DFDA 1L5UA 3GG1A 4DSFA 4JI6F 3GONA 4Y65A 4KHPJ 2X1AA 2FJVA 4OZ5A 1H74A 2VG5B 3D3BJ 4IOBA 4ZVUB 3L7OA 2VZ9A 2NXJA 2J9CA 4W92B 3MR6A 2X1BA 4YEAA 2FTRA 3ILOA 4UTGA 1VRUB 3A3OB 3C6TA 2YBVA 3HSZA 3TARA 1LFWA 3UVJB 1JKHB 5AE3A 2CAJA 3GCXP 2DHGA 4N47A 1FJ7A 4LMZA 3OVBA 2GS8A 1IBKJ 1BLUA 3CCRS 4OYAA 4GKKF 3N5BA 5T41A 3HVAA 3M8PB 5LM7E 1F2GA 1NSAA 3BYPA 2M2BA 4KGMA 5J2QA 5D4OA 1HQUB 3LALA 2KL8A 2FVPA 3DU5A 5C5JA 4OX7A 1LWEB 1Q5VA 1S9FA 4ZPDA 5B0BA 1X4EA 1WKJA 1IJEB 1S72S 2HQGA 2QV6A 4W90B 4WXWA 1KOOA 4ZLPA 3H5SA 3HHLD 3W5YA 1RA6A 3DCAA 2VPWB 4RBUA 4DQSA 3FFIA 4P9SA 2C3MA 1PYOB 3NL0A 4RBVA 4ECTA 2HHUA 1D9FA 5CXTA 4ID5B 1B3TA 4WTOB 1U1PA 3M9NB 4H4MA 2PA3A 5GMKa 2V67A 3KMQA 2HIYA 1LOUA 4MFBB 5HATA 4X4OA 1DHMA 5KFYA 3HFZB 4DR7J 2CYYA 2WVBA 1TUWA 3SSQA 4YP3A 1FJGF 1RK8A 4F67A 1RTIA 1WSVA 5J1EB 1FRMA 4F3OA 1QLNA 3OR1A 3HVWA 2UP1A 1M5OC 4B3MF 1FK9A 5C2GA 4UQGA 4ZIWA 2VDHA 4OHYA 3RBDA 1H6KX 4FS2A 4K4WA 4FF1A 1SC1B 2H4WB 3B82A 2AX1A 1Q8BA 4NMXA 2XMAA 3VAJA 4M5HA 2I38A 3KJVA 2F65A 1X9SA 2VHGA 1NK6A 3GQCA 2B9EA 5H1SV 1L3VA 1XMQF 2EG1A 4OYIA 2ZHBA 1TU0B 1Y5LB 3KDOA 3TZYA 2LECA 3R6GB 3DRRB 3SXLA 2E5LF 5KAKA 3GR1A 4USTA 1GMWD 1CQMA 3NBPA 2B9YA 2HHSA 1DLOA 3NMAA 2AJ1A 3SFUA 1OO0B 3CMQA 3O3LA 4LRCA 1MMNA 1U45A 3DLEB 5KFNA 2OH2A 2EXUA 2PMHA 1IKWB 4B3OB 5FIIA 1Z1ZA 3ENAA 4DR4F 2ADBA 2W1BA 3AQPA 2NXNA 1V6HA 2ZVSA 4C8NA 1R8AA 1S48A 5J2MA 3GYXB 4M5GA 2RUSA 2P9CA 1ZOTA 2YNFB 2QSFA 2LP4A 2V6AA 4A8QA 3HHDA 1YHQS 1HR0J 3LWMA 2HW3A 1RHUB 2B8PA 3DLGA 4LSNA 2BJ3A 4LR7A 2KZMA 1WF2A 4B17A 4E2FB 1JLEA 3H4BA 2HQ3A 2HVEA 3CCVS 2AIRB 4ED2A 2F4VF 3PX4A 1AZSB 2EFVA 4ED4A 2QMXA 4JI5F 2CA9A 1AFJA 4F7VA 3EUNA 2WW8A 2GHPA 1WEZA 3UR3C 3W2WA 2IC3B 2H48B 2LEPA 1UTAA 1FDNA 1O0PA 1CJKA 1HBMA 3P5BP 2WOMB 2VL1A 3JYTA 1FRJA 1B70B 3U02A 4DQRA 4QR1A 2DH8A 4HTJA 3PX6A 1O8BA 1N5YA 1FNOA 4D3GA 4XPEA 1SH3A 2DNNA 1XNQJ 4DS4A 3OSPA 4E98A 2M4MA 1WNEA 4K4TA 4QOTA 4JYAJ 3QNWB 4DSLA 3Q8SB 2FDNA 1D8ZA 1YTYA 4BLGA 1S6UA 1UVJA 3SQGB 2BYCA 2J76E 4J9LA 2O66A 3A3PB 2XHCA 5F8JA 2VC0A 2WSEC 4NYOA 4YHHF 3PYEA 1REVB 5HQMA 1IXKA 1S1VA 4LF5J 2LQ8A 1KTVA 3IRXB 5B0CA 2ZC3A 2L9NA 3IR7B 1N4LA 3OD2A 3MXHP 1B64A 1DY3A 1WDTA 3KLEA 3PFOA 2G0CA 1XBWA 2BV3A 5EX0A 1YKWA 5LOQA 5G0RA 2DITA 2HLUA 5L8RC 2M3DA 5IV4A 1X4DA 1RT2B 2IMOA 2C2MB 4CI0B 4AQYF 2NUUG 2FVQA 2H1YA 2AV5A 2LVWA 3QIDA 2DVIA 2HK2A 3J81Y 1Q4RA 2OEJA 4GO5X 1HMVB 2DR5A 1VMBA 4G1PA 3CCQS 3CCMS 4B08A 2LKZA 2HHWA 4L3KA 3BGRA 2IM1A 1X4FA 3DLKA 2XYHB 2AP6A 1ITPA 4USHA 4TVAB 1SL0A 2Z4PA 4QR2A 3R5AA 1ULRA 2ZDPA 1BD6A 3MCOA 5MAOA 3CCZA 1SV5A 3L95X 4X4UA 3L3CA 1VRUA 2FD2A 3UVJA 4PXDA 1OJ4A 1RAAB 1IBCB 3VWSA 2YX1A 4BBYA 1NDPA 4OZLA 1S57A 4ECSA 3CC4S 5EGYA 1HQUA 4LREA 5KTQA 4CCHA 1LWEA 1C1CA 3OVAA 2FUG9 2FC9A 5BYSA 4DV7F 1GAOA 3RJMB 5CYJA 1TVRA 2COLA 3CNQP 3G6XA 2CPJA 1B99A 4ZPCA 2QLWA 2RQCA 3Q8VA 3W8GA 1EQ0A 5HLFA 1T9WA 2AEJA 2MQMA 3NRBA 1HNWJ 1S6QB 2QL7B 4C48A 4ID5A 2HIQA 1RAGB 4OHZA 3UW1A 1FRHA 5KG7A 4C11B 1VQ5S 4C3MA 4DQQA 4ANEA 3HD1A 3CCUS 2C2EA 1TUGB 1H72C 4O4GB 5CYQA 5HBMA 4NI2B 2W9BA 3PX0A 2V69A 5IQ6A 1F9EB 2HG4A 1ZM9A 2VQFF 3G9CA 4H54A 5U47A 3UDVA 2R8JA 4M5DB 3D67A 1FF2A 5THWA 3NNAA 1FFGB 4KR0B 4ZOSA 3W66A 4J37A 2A6MA 1FKPB 3EPIA 2C2RA 3NS7B 4N41A 3HX9A 3C46A 3J7AN 4DX8H 1EETB 1JQGA 4JV2A 4NZ0A 3GV8B 1H73A 2ROGA 2QZ8A 1KR4A 3H40A 4B3RJ 2Q43A 5EUHA 1CS4A 3VV2B 3JTOA 1PCAA 4LF9J 4G65A 3SDEB 3DI6A 2RIJA 3TQ1A 1SBRA 2H5EA 4OX9J 3ILLA 5D4PA 3PYDA 1LXNA 5KT6A 4J9QA 4WCEQ 4DL4A 2Y1JA 3DRRA 2KH9A 2GIQA 4K4UA 2Y0BB 4ED8A 2Y1RI 3PXGa 2C28A 2B7CB 4LQ3A 3BN7A 3G87A 3FVYA 4DUZJ 3PY8A 1RU1A 4QYZK 5F8MA 2PMWA 4I68A 2VPZB 1DARA 4G1QA 5T7LB 3MM6A 4PABA 2NCKL 4YS2A 2YNFA 4HH0A 2IMWP 4LF1A 2E5IA 3D28A 2BX6A 4X4TA 3HHLA 2ZEJA 1WG4A 1HWJA 2EK6A 1RQ0A 3K5MA 3I0RB 4ZVOB 2MY7A 4P72A 2Q79A 4C8ZA 1FFSB 2HSEB 1BQNB 4KO0A 4ZKAA 3G8SA 4ECQA 1VJQA 2F7VA 2IVMA 2DGWA 4N76A 2DGOA 1MROA 2UVVA 3ETOA 1QE1B 4L6V3 1G6BA 4YR2A 1RAFB 3G4SS 1VCTA 4UZBA 1OSDA 2YVSA 2E9RX 3GIKA 5I42A 1QDUB 2FVSA 2WOMA 1WC4A 3V81B 1E6VB 2OTLS 2JL9A 1PYTA 4A47A 1M5PC 1N5VA 2LQJA 1S6PA 4FYVB 4BS2A 3CCJS 3D6TB 4ZVSB 5H9EK 3HK2A 3WBZA 4KYZA 2ZFHA 3PJWA 1N34J 1D3WA 4KGVB 3FBCA 4DR6F 2YQ3A 3NGRA 4HHHA 2KM8B 1YJRA 1G1XA 2ZBPA 2KG1A 3TOQA 2XEXA 2IM0A 3FRZA 2E44A 2QSWA 9ATCB 1D9DA 3LA0A 2R8IA 1HNZJ 4OYOA 4DV2F 3H5XA 3W9IA 4DPXA 4UUWA 5ETNA 1QAXA 1N0UA 1YJWS 2CVIA 2UXBF 2A6OA 2NXUA 4AE5A 3MCNA 1RT4B 3JS9A 4K0KJ 1GMWA 5IT9Y 3POTB 3R6LB 4DL7A 1XIQA 3NWRA 2NZ4A 5KFPA 4IG3A 2HYIB 2VIHA 2CQIA 3T6BA 3DYAB 3L09A 4ILMA 4QU6A 2C3OA 1RWKB 4OYWA 4Y00A 1VC5A 2DKOB 2EG2A 2J0WA 3WDOA 2E5JA 4XO0A 2NQPA 1A7GE 2UUTA 5IT0A 4ZPTR 4FVMA 3FRYA 2ZM6F 3GMGA 2BQUA 4KKOB 2D3OR 3FCHA 2F9DA 3KJQB 1IR2A 2UUWA 3MZIA 4BHQA 1ZS6A 2DRBA 2Q66A 2QYGA 4RW4B 5ETKA 2NLWA 3RBZA 1WOSA 3CIMA 4DV5F 3M2RA 4L73A 3TVZA 3IS9B 1ZAVA 4JUZA 3N6MA 4JI7J 2ZNYA 2ALZA 4DDFA 1U49A 5DDQC 1VQSA 4IO9Q 4OX8A 2KU7A 1H38A 1H2TZ 3ZO7A 3M8ZA 4C7QA 1R31A 4WF9Q 2YNHB 4CLTA 2UV8A 2ZH6A 4FXDA 4X4VA 3VAGA 3ZZTA 1LK7A 3LW5C 3CJKB 1RWXB 4X64F 1C1BB 1FJCA 4OMFG 4CLUA 3QPIA 4PPDA 4LF7F 1FA0A 3NLCA 3O1LA 4P71A 4QIVA 4D3HA 2B4VA 3HJFA 5B0EA 4LF6F 5F8HA 2J6TA 4F4ZA 1R6YA 1AFIA 2MLZA 5A8KB 5E7OB 2DIVA 3O5TB 2XLJA 3CW2C 4HVZA 2FJEB 3PJ9A 1NDKA 3UCZP 2DXDA 2XSJB 4F2RA 3JTPA 3O44A 2GA7A 4UOFA 5KFQA 1UEKA 4KC5A 3ZNUA 4DV0J 3MD3A 4IR1A 4DUYJ 1DTQA 1HPZB 3R1LA 3KNAA 5DZ6A 1N6QB 2ZUAA 5DG7A 4QWAA 1BY9A 2OEKA 4JV0A 2BOPA 5ETTA 1LW0B 3D6FB 6AT1B 4J9UE 2MKCA 2YH0A 2ZDOA 2GAGC 5A0YB 4NI2A 4LFCF 2KRRA 4DQIA 1LEOA 2OUGA 3MMAA 4PXBA 3LP2A 4DUTA 3M6XA 3WIVA 4F4WA 2RS8A 3BM7A 1VISA 1NK9A 1SIZA 3NCQA 4ENOA 3MGJA 3PIOQ 1TV6B 1S1XA 2G1DA 2KT2A 3Q22A 1R0AA 1HHSA 2CQCA 5AXNA 4G6VB 2V68A 3CJ8A 3ISZA 2HWTA 3RR7A 3TZWA 1D09B 3I5BA 4DMZA 1F5BA 4WP9A 4CO0A 4JI2F 1R8PA 4JI6J 2IHR1 3HVTB 3D5MA 4NL5A 4P6QA 1KVJA 2OSRA 4FYWB 1LFPA 3OV7A 1M0SA 4R8UB 1Y11A 1EKRA 4GVBB 3DHXA 2L9DA 1RBLA 4ICLA 3DU6A 1NJIT 3HD2A 2D3ZA 3M9OB 4LRBA 1FEEA 1N32F 1XWLA 2RF2B 1U2RA 2ZWPA 4OJ1A 2M8HA 4O0IA 1J2VA 1VS3A 3HI9A 1X9WA 3RGIA 1H2UX 3TUJC 4GKKJ 3PO5A 4F8RA 4HTIA 2EBGA 3HF5A 5M2UA 1ZZNA 1S0OA 2PGCA 3NY0A 4F0MA 3ZTPA 3AOBA 2L08A 2O01C 4EZ9A 1U1LA 5T7LA 3MD1A 2E9TA 3S7RA 3GE9A 4NRUA 1XJWB 2BVZA 5D4LA 3OXFA 2W7OA 1U1OA 2WSFC 5KFKA 1RT3A 3PW2A 5KFAA 4HH1A 2XCPA 5DLGA 4A8MP 1MU2A 5SUHA 3AODA 1JNZB 4A8FA 2PC6A 3LANA 4I7FA 2VA3A 5E41A 4CIOA 3RG6A 4ES3A 4M5MA 1FJGJ 1UVNA 2MKKA 5AJ3F 2XMTA 1TL5A 2R7TA 3B4MA 3C19A 4XDCA 4KT0C 4B3MJ 2BJ7A 1KHVA 1Y5IB 3IRWP 1YDLA 4WYWA 1OMSA 2HNYA 3EGWB 2IRYA 5ETRA 4HACA 3SV4A 1HBNB 1V3ZA 3BO2A 5CA5A 4F4AA 2IBKA 4MT1A 3NKYA 2RRBA 2OKQA 4KSEB 1LXJA 1RTJB 4K2JA 1M5VC 2Q6BA 2RD5C 2CKWA 1VC6A 3IR6B 2DH9A 1RYRA 1WELA 1TL1A 1XMQJ 3HVRA 2FQQB 1GXUA 3KKFA 5A6PA 1I5OB 1QAJA 2GO9A 2CADA 3M6UA 2NSBA 5HL7Q 2E5LJ 1B7YB 1IQTA 2KXNB 1VC0A 2AT1B 4IQXA 4KJIA 3OHAA 2Z8QA 5E3PA 3AJ2A 5HP1A 4NA3A 2BE2B 4IH5A 3EM1A 3JAMY 2FJXA 2ZBCA 2R7SA 4S0MA 1FCAA 1JWWA 5MLCV 3GJQB 4DR4J 3Q23A 3C15A 3HXMA 2RNEA 5AXKA 1Q86T 1F5AA 3GB0A 4AUKA 4J91A 2O1PA 4ZA1A 3DYAA 1DRZA 3Q83A 3P8BB 5BYRA 2U2FA 3PM9A 2CQ2A 3E3XA 1RHMB 2IAJA 2UUBF 2IY5B 4CLLA 3D3CJ 1EKSA 1F9FA 3TR5A 1S1TA 2EBEA 3MM9A 4JI5J 1CQNA 3R5BA 3T5KA 4A8SA 2GC8A 5K14B 5GAGU 3BN4A 2XY6A 3KHRA 4ES1A 2V2QA 1FNXH 2YKOA 3CEDA 2F8EX 4Q8EA 4OZ3A 1M1KT 4ELUA 1MNEA 2VPYB 3PW7A 3CCSS 1VQOS 3CDBA 5HVHA 5B7WA 4OV6A 2GCFA 3AFGA 4CO5A 2RDJA 2MKHA 4PPZA 1CC7A 1KLNA 1VQPS 4X65F 1VIXA 3CC7S 3MEDA 2DHAA 2JOQA 2EFNA 1NK7A 2OI2A 5KFMA 1FO1A 3OTDA 3AHPA 1M1GA 4V1Ak 4W4MA 4LVNP 4EEYA 2RU3A 4YY3J 3A13A 3A1YG 3SIPB 3QRRA 3TQEA 4UOCA 1JLCB 2OEMA 2R42A 2B6AB 2H5IB 4ATNA 5F3ZA 3VGTA 4K59A 1S5ZA 3BB5A 4QIGA 3EGZA 2ALYB 2HEKA 3GSDA 4CLKA 5KFWA 3CO9A 4YHHJ 5A8KA 2XZTB 1UEVA 3IAM9 2XSJA 3HHKA 5JVGQ 1LK5A 3TANA 4ZVEA 2FLOA 1NMEB 1O5JA 3CSKA 4RZRA 1TUVA 1HPZA 3BBFA 1B0VA 5IWAF 1PAUB 5BXIA 1T03B 2YQ0A 1NSKL 2HZAA 3FEXB 4DN0A 4M5LA 1RKIA 4U9RA 2H65B 2W9CA 3TI0A 1UFLA 1S12A 5A0YA 2DPJA 2YWWA 3BH7B 2AJ0A 2DNGA 4AQYJ 4NA1A 2NS1B 3QSYB 1LWCB 4NZ6A 3TVKA 1RT7B 3ET6A 5CYMA 3DC2A 4I69A 2OO4A 4PXCA 5KG4A 2VB6A 3T1AA 3U27A 3MPVA 2HGLA 3V5RA 3OBIA 4RW9B 3KG0A 1TV6A 2AJ4A 3MHYA 4HT7A 2HFUA 5HMXA 2HAFA 3I32A 2QJ3A 5HROA 3DLBA 4DS5A 5K5MA 2R9LA 4F25A 1RAJA 3HVTA 3R9LA 2HZCA 1JJ4A 1CJTB 4USKA 4DFPA 1WEYA 4C8MA 2YNGB 2HRUA 2ZBQA 2JC0A 1E6YB 4RNFA 2FLLA 1YBAA 3U1NA 4A8YA 2AEMA 5L1JA 2IDEA 3C6UA 2DISA 4OZ1A 4Z7YA 1T94A 2E7XA 2MHNA 1RACB 4FF3A 4O3QA 1SKRA 1W2IA 2PT0A 1RHQB 1BGXT 4PZVA 1XK8A 4PYDA 1NZAA 1UVIA 3WX4A 4DV7J 2MHEA 1X0PA 5LSLA 2L41A 1RWWB 4LR9A 1VBKA 3QJPA 1S1UB 4UOHA 4QYRA 1NNDA 2KYXA 2AYBA 1T3OA 4TLQA 3LP1B 2HNZB 1DAXA 3NS5A 3MPUB 4I2PB 5FLXU 3M8QB 2NR0A 3I6PA 3MURP 1HBUA 3F73A 4NPOA 4WXOA 2ZKTA 5EDWA 1V5IB 4X4NA 1R43A 2VG7B 2IA0A 1CJVB 2ZVIA 4RW8B 5KFBA 1BWEA 2B8QA 1CC8A 4AYBD 3OHBA 2BJ9A 3UFCX 3LGNA 3CWJA 4USWA 2XG8A 3MTJA 2W2PP 4F4XA 3PR5B 1FXLA 3V6JA 3TVYA 3S1TA 3UO0A 1NKEA 2VQFJ 1REGX 3IFEA 3GTYX 3HLUA 2IM3A 5JMNA 4NLXA 1C0UB 4B3SJ 1BUXA 2M5YA 1X5OA 4GVLA 4Y0FA 2DYAA 3FSIA 4RW7A 3ULHA 4A8XA 4DFKA 2FJWA 2OGUA 1AXQA 4EYHB 2CUYA 5KFOA 4KB7A 1NJZA 1LW2B 3QRQA 2IIHA 2YKNA 3DGPB 4DXLA 2B5JA 2D9PA 1AYEA 1WOPA 1VYAA 3ELHA 4HI2A 3CCLS 1ZTWA 5F8GA 3ZXWA 1FNMA 2DXEA 2QLXA 4WFNQ 4IG0B 1VHFA 5F3TA 2J0SD 2K3IA 1EB0A 3AQOA 1RB0A 4CLWA 1QVGR 3PG9A 2AZ1A 3M05A 5F8IA 1YJ7A 2VG6B 4PG4A 3GP9A 1JB0C 1SC4B 3IGVA 3EICA 3G8QA 3RU0A 4EO6A 1K0VA 5G4DA 2AD9A 2ZD1B 2QC3A 2V4JA 3BQ0A 1GXLA 1KS2A 3BPSP 2HVHA 4ZJOA 5D0GA 3QJJA 2KYZA 3G96A 5FJ4A 2DHHA 1TKTB 4RJVA 1RCOB 2ILYA 1L3KA 2HQCA 1O51A 1SUQB 4CNZA 1S9GB 1U6FA 3BR8A 2APOA 1P1TA 3OJSA 5GMEA 4IFYA 3WC2A 1ZPWX 2WBRA 4MIBA 2MGZA 8AT1B 4DF4A 3CUNA 4YB7A 2V9WA 4C8KA 5L9XA 5KG0A 4QWDA 3Q2SC 4RW6B 2IBOA 2DCUB 3FBFA 1QTMA 5K14A 1SC3B 4WFXA 1BHNA 5C42A 2XNRA 2Y1IA 1N52B 3KLHB 3KLGA 3R2DJ 2HLTA 4DL6A 4ECWA 1Y4ZB 3IAS9 1UAWA 3VAKA 4QWCA 1F3VA 3DXSX 4CDIA 2WVFA 4IFVB 5C24A 2Y9HA 2YKAA 1V3SA 3OL9A 2HHVA 3VHQA 1AW0A 1CULA 5GAHU 3NGSA 4O3PA 2GQCA 2MZJA 1JLCA 4RUCA 2N4CA 4J7CA 5AXLA 2F40A 1BQMB 2DPIA 2LEBA 2W25A 3J7YU 2Q1LA 5DO2A 4N56A 3UD3P 2GVDB 3Q24A 1VQYA 1X9MA 3M4XA 2KRBA 4ZP7A 2RHSB 1QD1A 3ZZZA 1JLFA 1ZYQA 3RBXA 3TZXA 1IKYA 4HL9A 5LMNF 5SZTA 5HI7A 2JVRA 4DV2J 4KY3A 1CSJA 1TKDA 3VAFA 2VBZA 3QQCD 4NOHA 2DR9A 3AOAA 4J9SA 1RU2A 2G4BA 2QRRA 4U8YA 2J0XA 1XR7A 1FI4A 2UXBJ 2UUAF 1UJ5A 3JSRA 1IBLF 4AL7A 3AJ1A 3TX8A 6FD1A 3KTQA 1DQ8A 1F9HA 3W64A 3IR5B 4DZDA 2MB0B 4FNIA 2XNQA 3F56A 1GT8A 4ZPVR 1W26A 2ZJRQ 3HSJA 2P6TA 4DPWA 2DNQA 4KGXB 3N01A 4A8KA 1RT7A 2NYHA 2CQHA 4V19X 2W7PA 2DY9A 1TAUA 4F3QA 2YPZA 4CO4A 1W7WA 5J2NB 3MM7B 4Q0BB 1HQ2A 1IKVB 2ZM6J 3OTBA 1WC6A 3I5AA 2VBWA 4EBCA 5KFRA 3R1HA 1VQNS 2RKIB 1MMDA 1NRKA 2ZBIA 1WI6A 2NUHA 3OR2A 4DV5J 1HNIA 2KFZA 3GLJA 1RTDA 1NDCA 4DL2A 2YNGA 3AT1B 4DR1F 2JC1A 2BANA 2C22A 1K9MT 2QLJB 4OI0A 3T5HA 5IT9U 2BW2A 3AH6A 4Z37A 3BZQA 1YZ7A 3A3NB 1ZA1B 3CC2S 2F9JA 3H5UA 3EZUA 1YG0A 2VJUA 5GAGI 4LF7J 4OHXA 4CTAA 3NAIA 1TL4A 2CNNB 1QSSA 4OYZA 2PDAA 4LF6J 5HVFA 1U1RA 4F0KA 3U1LA 1ZH5A 1X4CA 5KFIA 5L1KA 4IQMA 1UCNA 4Y2KA 2HWHA 2I0XA 1S1UA 3BS9A 4M1KA 2X3DA 3CJ2A 5DQIA 4RBTA 1FKOB 3KWMA 3KG1A 3EVOA 7FDRA 3W62A 2GNKA 3UD5A 1NPPA 2B51A 4RWXA 3H2UB 4FF2A 1VGYA 2BABA 3MR5A 3M32B 4F26A 1F1BB 1B0PA 1D9AA 4I6YA 3DDKA 1Y9OA 4MMOA 3FDSA 1ZM3A 4PEOA 4PRFA 2GVZB 3PYFA 2RS2A 2CIMA 3PDNA 4LFCJ 2QYCA 3GILA 3RR8A 1ZTTA 2Y3YA 4RNNA 4Y2MA 1Z2LA 3L7UA 3VTIA 2OPPB 4Z2XA 1YJTA 5A8RB 2M0GB 3BO3A 1C0UA 1OPIA 4CYUA 3Q86A 2FLNA 1Q78A 3T1HF 5GAEI 2MLYA 4FPRA 3IBCB 3Q89A 2KT3A 1UPPA 2YX7A 1Q8KA 3LTOA 3R97A 4QW8A 4J9MA 4KHMA 4URSA 1K47A 4JI2J 2OP5A 4NLOA 2OJ3A 2R8KA 3SFGA 3DGPA 2OPQA 2B43A 2AWZA 5L1IA 3FUYA 1J5OB 2JFKA 5DJBA 4DL3A 3VF0B 1PIEA 4P74A 1EP4B 4FZVA 1N36F 5I3UA 3BREA 2W2OP 4N7TA 1N32J 3PNIA 1IBMF 3GSIA 2HVDA 2XTJP 4B02A 2BACA 5D15A 3WHIA 2ATLA 3R7BB 1IN0A 1Y5NB 3BBCA 2MKSA 1HBOB 3D0GE 4DV1J 1TTHB 4P10A 5IOLA 1C4AA 3TNVA 4DL5A 3LPEA 1P27B 1Q7YT 2LXFA 4ZHRA 4CLYA 2DGUA 2M70A 4K7QA 1HYSA 2DO0A 2CVEA 1M5HA 2XWYA 3VALA 3JSMB 3DRPA 3MAQA 1R0CB 5A6WA 1TKTA 5J2PA 4LBIA 4DL0C 3R3TA 1UEUA 3GFZA 3QRPA 4C98A 1QUPA 2PFDA 5B0AA 2HS4A 2WONA 1LWFA 2N7YA 4WK1A 2RE1A 2XI2A 5EWEA 1MN7A 4PG8A 4DPOA 1TL7B 2GMLA 2ABYA
chains in the Genus database with same CATH topology
4KQZA 4TNOA 1KFSA 3I9V9 3M2VB 3LWLA 1XERA 3W7BA 5C25B 4A8OA 4ILLA 2J9DE 2N7CA 4DV2F 3H5XA 3OFEA 2W4CA 2R7RA 2WONB 3CCWA 3GV5B 3DOKB 3RB4A 4LVOP 1LWFB 2DT9A 4TQRA 4O3RA 4UQTA 1YJUA 1RT4A 3RB0A 3MEEA 4B9VA 1U4BA 4UUWA 4ELTA 4RW6A 2ASJA 3POTA 2ADCA 4F02A 4MAKA 3DLLQ 1UKUA 1QAXA 1N0UA 1DQAA 2VFVA 1YJWS 2XS7A 3U7JA 2CVIA 3BSAA 3OL7A 3MDFA 2UXBF 4QYZJ 5BJRA 2NXUA 4AE5A 3MMJA 1RI7A 1RT4B 4NYZA 1U2FA 1U1NA 3H5YA 3MEEB 3D1QA 3BDPA 3KK3A 3CDUA 4NLGA 5IT9Y 1X5PA 3E51A 4KRWA 3POTB 4OJ3A 1RWUA 2R7UA 2PN6A 3MM5B 3GV7B 2W9AA 4U7CA 2R7VA 1Q16B 4DL7A 3D2WA 4TLRA 4QCLA 4OI4A 5K8MA 2NZ4A 5KFPA 4IG3A 4MH8A 4WFBQ 4Q5VA 2HYIB 3KLIB 4J9OA 1JJHA 1YGYA 2V0NA 3BSCA 3PHEA 1D1UA 2CQIA 3R5CA 3T6BA 1UVMA 3UCGA 3DYAB 2I1RA 3KK3B 2Y0SD 3L09A 4ILMA 4X4RA 4QU6A 3MMBA 4FF4A 2ZE2A 2C3OA 4FP9A 3CMES 2MPUA 2HS0A 3TUIC 5E3CA 4X66F 1HD1A 1HWIA 4IG3B 3ZZYA 2MJNA 4Y00A 1VC5A 2MYFA 2M9KA 4QIEA 2A1BA 4KKOA 5KOXA 4UY85 2EG2A 2FHJD 2J0WA 1DTTA 2HFOA 3MEKA 3WDOA 1P1LA 2E5JA 2MJUA 2XMVA 3M1VB 2AGPA 2CJ9A 4XO0A 1R27B 2NQPA 3MMBB 2ZE2B 1A7GE 2UUTA 1FTCA 4G1IA 1BQMA 2DGTA 5IT0A 4DV3F 3BEGB 4ZPTR 4FVMA 4DHVA 3FRYA 3N28A 4RW4A 1Q82T 5DDPC 2ZM6F 5E3QA 3IWNC 5D3GA 1BQXA 3H4DA 3GMGA 2BQUA 4KKOB 2D3OR 4J9PA 1S0MA 1K1QA 4IRDA 3FCHA 3MWBA 4Y34A 2YKQA 2F9DA 3IS9A 1HNWF 3LUYA 1IUJA 2UUWA 3MZIA 3ZZRA 4BHQA 4WE1A 1KLMB 4DF8A 2DRBA 2Q66A 3RRKA 3SZ2A 2XMKA 2LEAA 5GVQA 2CPIA 3KLFA 2MDAA 3ITHB 4RW4B 3FGVA 2NLWA 3RTVA 5D3GB 4I56A 3RYLA 5L38A 5E3AA 3OSNA 2DGSA 3CIMA 4DV5F 1N5QA 3M2RA 2VFSA 3NGKA 3TVZA 3IS9B 1ZAVA 4JUZA 2YNHA 3N6MA 2DNLA 3PW0A 1WHVA 4IYQA 5DG9A 3QLHA 3ENQA 2ZNYA 4ZK7M 2ALZA 4WE1B 4DDFA 3TUZC 2C2DA 1FERA 1U49A 2GQ2A 5KT2A 5DDQC 1KQFB 1VQSA 4IO9Q 4OX8A 2WAQD 1ZM4A 5KFEA 2V94A 5T14A 3OVSA 2KU7A 1H38A 2LLZA 3KLFB 1Q81T 1H2TZ 2LCWA 2F8HA 1VQ6S 4WK3A 1NEEA 3LGMA 2OIHA 3CJKA 4K5RA 4C7QA 1C1BA 1R31A 2FIUA