1FK9B

Crystal structure of hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
423
structure length
403
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 103
structure length 403
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fk9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fk9B03
4O3PA 4ZVFA 5KFXA 4YP3A 3HVTA 1C0TA 3H98A 3NGDA 3OL9A 1VRTA 4RNOA 2BRKA 3CJ3A 4GC6A 2AU0A 2E9ZA 2WONA 4MKBA 3MECB 1UWBB 5F9NA 4F4ZA 2BQ3A 5F8LA 3MFHA 3PR4A 3MR2A 1IKXA 1LW2A 4LQ3A 2FVPA 3UPFA 3CJ4A 1GX6A 4DL3A 4URQU 1XR7A 1S49A 3MF5A 1HNIB 4IG0A 2UVVA 2RKIA 1S97A 3E01A 3HHKA 3V6DB 5J2MA 3DOKB 2EC0A 3PJWA 3CVKA 1JLBA 1LWEA 4Q0BB 3T5LA 2V9WA 4IRKA 4MIAA 4ZHRA 3IRXB 3H5YA 1DLOB 2I1RA 4URGA 4TN2A 1RT2A 1S48A 3N6MA 3OL8A 2W9BB 3T5JA 1TKXB 2XI3A 4ECYA 1K1SA 3BSCA 3N6LA 4IKAA 3G6VA 3PW5A 1BQMA 5KG1A 1QUVA 2R8GA 5KFFA 1SUQA 4KHRA 5KT6A 4U6PA 3MR5A 4KSEB 4EBDA 4RNHA 3GIJA 4K4SA 3FQLA 2RF2A 1YVFA 4JUZA 3NBPB 1HYSA 2YNHA 1JX4A 3M8PA 2ASJA 5F8GA 3MEGB 1D0EA 4KBIA 5F8MA 5T14A 2J6SA 4TYAA 4IFYA 1SV5A 1BQNB 1S1UA 5KG4A 2JLEA 3M9MB 5C25B 5KFMA 1WNEA 5KG0A 3H40A 2C2DA 4ZP8A 3DRPA 3JSMA 5KFYA 2ASLA 2R2TA 1T05B 2UUWA 2OPRA 3DRRB 4M95A 3EPGA 2O5DA 2VG5A 1ZTTA 4K4WA 1TKTA 2FJXA 1RT6B 3LAKA 3SFGA 2UVWA 3TAMA 2IAJB 1HNVA 5HBMA 2C22A 3I0RA 3FFIB 1RT3A 1QAIA 3KLGA 2E9TA 2ILYA 1IKVB 3KLVA 4G3IA 4ED3A 1GX5A 3NMAA 1KLMB 2B6AA 1IKWB 2RDJA 4ECSA 3MEDB 4WE1A 4IH5A 4TY8A 2C2EA 5DQHA 5KFUA 4R8UB 2OPPA 3KK3A 4ED2A 3GYNA 4K4ZA 2ZE2A 1HQUA 3SI8A 4NCGA 2YNIB 4RW9A 2ZKUA 2R2SA 3GIMA 1MMLA 3IGVA 2W9CA 3RB0A 3QO9A 1C1BB 4MH8A 4RW7A 1T3NA 1S4FA 4NLVA 1QE1B 3KOAA 4IR9A 4TQSA 2XC9A 4EBCA 4G1QB 4ECVA 2IA6A 3MR6A 4J9SA 3V6KA 1N56A 3Q8SB 4RW8B 1KHVA 4F4WA 4WFZA 1RYRA 3OL7A 3M8QA 3QIPB 1RT7A 3KK2A 3KLHB 5KFEA 1S1WA 1RT4A 4Q45A 4O3SA 1TVRB 4O4GA 3I5AA 3HVTB 2FVRA 3PJXA 4O4RA 4QWEA 2DPJA 1C0TB 1DTQA 5F8NA 1VRTB 2VA2A 3ITHA 4NLXA 4IH7A 4J9LA 3MTKA 2WONB 1HMVB 1QAJA 5D3GA 4NZ0A 5KT2A 4H4MA 4KV8B 2D7SA 2AX1A 1LWFA 2FLLA 4FBUA 3C6UA 4RZRA 3GV5B 1EP4A 1IKXB 1JLGA 5KFOA 1EETA 1JLQA 1LW2B 1TL1A 4ECQA 3RB4A 5K14A 1DTTA 5EUHA 3OL6A 3LP2A 2JC0A 1NNDA 3DLGA 4YQWA 4NLPA 4YR0A 3BGRA 4EBEA 3BR9A 3PVXA 2W7PA 4QWCA 1S6QB 4ZPBA 4I2PA 4NLWA 4I2QA 2RKIB 1IKYA 3E01B 3QLHA 5J2MB 4O3QA 4KKOA 4LSNA 4TLRA 5KFNA 3KJVB 4ECZA 3FDSA 3IS9B 3KLIB 1JLBB 1LWEB 3H2LA 3QGIA 2HMIB 3MEEA 4J9QA 4ZHRB 4WZMA 4PWDA 3CO9A 5L1KA 4EO8A 4DL2A 2YNGA 1RT2B 3KK1A 2YKNA 2HAIA 1RA7A 1S1VA 3KLFA 2WTFA 5KFHA 3DLEB 2XGPA 2I5JB 3PZPA 2W9AA 2RF2B 1N6QA 5CYMA 1S0OA 3H5UA 1HYSB 2VG7B 2WB4A 2B5JA 1JXLA 2YNHB 3M8PB 4F50A 1SH0A 4J9NA 4IRCA 1RT5A 4RNFA 5F8HA 3I0SA 3ISNC 5KFSA 2VA3A 3CIZA 1SV5B 3T1AA 1S1UB 5FDLA 3BREA 3QGGA 4O3NA 5KG3A 1N4LA 1T94A 3V81A 2ZD1A 4XPCA 5DLGA 1RT1A 2HNDB 2XI2A 3H5SA 4TY9A 2XCPA 4ECWA 1JLFA 3V4IA 3KLEA 2VG5B 1TKTB 3DDKA 3HVWA 2IJNA 4TXSA 4GC7A 4X2BA 3DLKA 3TAMB 2GC8A 1C0UA 4LQ9A 3DM2A 1R0AB 2YNFA 5J2PB 1Z4UA 5DG8A 5L1JA 5HBMB 4ED6A 3GILA 4O44A 3KLGB 3GV7B 1FKPA 1REVA 4ID5A 5KFKA 1JIHA 2WOMA 1TV6A 4IG3A 3JYTB 5KFZA 2AQ4A 3NL0A 2IM3A 1S1XA 1JKHA 1TL3B 2HNYA 2B6AB 4WE1B 3NKYA 1S1TA 3C6TB 4NRTA 2UVUA 3SFUA 4K4XA 2OPPB 3KK3B 4FS2A 1HQUB 2HNYB 4QPXA 4QW9A 4KO0A 5I42A 2D3UA 4PQUA 5KFAA 2JEGA 2IBKA 3QIDA 1K1QA 4RW6A 2W9CB 5C24A 2W7OA 3QO9B 3MECA 2HWIA 2J6TA 2V4QA 2YKMB 4H4OA 1ZETA 3KMSA 2ATLA 4J9PA 2OPSA 4NLTA 3PW7A 4ED1A 3TQ1A 5CYQA 4HKQA 3LP0B 1N5YA 3IGNA 3KHHA 3DI6A 4Q8FA 4Q44A 3M8QB 1RT7B 3KK2B 3PW2A 1S1WB 5KFRA 3BSNA 1OS5A 5KFTA 3LALA 4IFVA 4R5PB 1RTIA 1HNIA 1HQEA 4WXOA 2HNZB 1C1CB 4IDKA 3M9NB 2JC1A 4NLOA 3ITHB 3V6DA 3DOKA 4KFBA 1SH3A 4MK9A 5KFQA 3MR3A 3RAXA 3KHGA 5D3GB 4ZMMA 4PUOB 3MFIA 1RDRA 1S6PA 1S9GB 3BQ1A 1LWFB 4LSLB 3C6UB 4K4UA 1EP4B 4Q43A 1DLOA 1JLGB 1TL1B 1JLQB 2R8IA 1JLAA 4RW4A 2OPQA 4YMEA 4ECUA 3PR5B 2ASDA 3KNAA 3H59A 3DLGB 4QWDA 3GV8B 3BGRB 5KFGA 5C42A 4WFXA 2IC3A 4ICLA 3UR0A 4J9OA 3PHEA 3V6HA 1RAJA 4I7FA 4MFBA 4I2QB 4NLUA 5L1LA 1JLEB 1IKYB 3QLHB 3CWJA 4Y2AA 5KT5A 4OL8A 4IR1A 4KKOB 1JLCA 4LSNB 4EO6A 1FK9A 4WYLA 4R0EA 5EWGA 3T5KA 4DEZA 4DL5A 4NLSA 3MEEB 3RAQA 3LAMA 1NHUA 4PWDB 4NLDA 4ZP7A 3I5BA 4ZPDA 2YNGB 3KK1B 2CJQA 3M9OB 5HROA 3OHAA 1VRUA 4RUAA 1ZTWA 4QW8A 1S1VB 3KLFB 2IM2A 4O3OA 3Q8RB 1U09A 3CDWA 4U7CA 2V0NA 3RBDA 2FLPA 4NYZA 1RT6A 3BSOA 2WHOA 3BJYA 3IG1A 5CYMB 4ZVHA 5KFLA 3I5CA 5DQIA 3OSNA 3V6JA 3FFIA 2B5JB 4IQXA 4EEYA 1IKVA 1RT5B 4IG0B 1HPZA 1RTHA 1KLMA 4WFYA 4NLYA 4ZVGA 3MEDA 4F4XA 3DRSA 3ISND 3V81B 5J1EA 2BQUA 2D3ZA 2ZD1B 3CDEA 2BQRA 1RT1B 3LP1A 1C2PA 4H54A 2W8LA 3FSIA 1TKZA 1S9EA 2HWHA 4RU9A 3OLBA 4DG1A 2VG6A 3KLEB 3CJ5A 4HYKA 1MU2A 5HLFA 4Y3CA 4KHMA 4JV1A 2XGQA 3QZ7A 5F9LA 1S0NA 3DM2B 1W25A 5JXSA 2D41A 1RTJA 1QE1A 1BQMB 4MK7A 4K4VA 5F8JA 4O44B 1RTDA 1FKPB 1SUQB 4ZPAA 1REVB 4ID5B 4EYHB 4G1QA 2J6UA 3EZUA 2WOMB 1TV6B 4IG3B 4XO0A 1S9FA 1S1XB 4JV0A 3GQCA 1S1TB 3KLHA 1T03A 5KFDA 1TVRA 5EDWA 3T19A 3PW4A 4KO0B 2UUTA 5I42B 3Q8QB 4IFYB 4PQUB 3DOLA 1LWCA 5EWFA 2V4RA 4IRDA 5KT7A 3KMQA 4RW6B 5C24B 3DMJA 3RB6A 1HMVA 2R2UA 2B43A 3UDLA 5JUMA 3FRZA 5I3UA 1J5OA 4H4OB 4KV8A 2FJWA 3DRPB 3LANA 3JSMB 2FVSA 2F8EX 2RDIA 4WXWA 2OPSB 4NLGA 4ZVEA 2OPRB 2UVRA 5J2NA 4ZPCA 3NAIA 4RNNA 1NHVA 3H5XA 5CYQB 2FJVA 3IN5A 5J2QA 4MIBA 1N5YB 2GIQA 1HNVB 3DI6B 5KFBA 4J9MA 4WYWA 2R2RA 3TVKA 2CKWA 3DYAA 3I0RB 3E51A 1RT3B 4B3OA 2IM1A 4KB7A 1S6QA 2BANA 1KHWA 4IFVB 3GIIA 1RTIB 2IMWP 1HQEB 4K4YA 4K50A 4IDKB 2JEFA 1LW0A 4Y34A 4QWAA 1FKOA 2BE2A 3G6XA 3BQ2A 4K4TA 4KFBB 4FS1A 5HP1A 3PW0A 2AGPA 4TY8B 3KJVA 3IS9A 3KLIA 3CJ0A 2ZE2B 1S6PB 4NCGB 2HMIA 4RW9B 1RA6A 2GIRA 4NRUA 5KG2A 5KT4A 4ECTA 1I6JA 1JLAB 4RW4B 2OPQB 3N6NA 2DPIA 4ED8A 4J9KA 1UWBA 4RW7B 3OHBA 5DGAA 5KFWA 4TYBA 3Q8PB 5C42B 2IC3B 4ICLB 3DLEA 2I5JA 4I7FB 4MFBB 1S0MA 1CSJA 2AGOA 4ED0A 4Q8EA 1JLCB 2VG7A 1FK9B 1RT4B 5L1IA 4MKAA 1S10A 4O4GB 4F4YA 1N48A 1RYSA 1DTQB 3BQ0A 3KHRA 4NLRA 4FBTA 3KHLA 5KG6A 5DLFA 4M94A 1D1UA 1IM4A 2BRLA 2ILZA 3OSPA 5HROB 2WK4A 4H4MB 1VRUB 2HNDA 4Q0BA 5KFVA 3H4DA 2R8HA 2R8JA 2C2RA 3IRXA 5DQGA 4RUCA 1EETB 4WZQA 5K14B 2W9BA 1TKXA 1DTTB 2XCAA 3IG1B 4J9RA 3LP2B 5J2PA 1R0AA 2FLNA 2AGQA 4KAIA 3ICLA 3OLAA 4I2PB 1HPZB 5KT3A 3JYTA 1RTHB 4ZP6A 5F8IA 4ZP9A 3CDUA 1TL3A 2WCXA 2C28A 3NBPA 3RBEA 3G86A 3FQKA 3DRSB 3EPIA 3C6TA 5J1EB 2W8KA 3MEGA 4IH6A 2IJFA 3LP1B 1HARA 1TKZB 1S9EB 2QE5A 1BQNA 4ED7A 4DG1B 2VG6B 5C5JA 1MU2B 5HLFB 5EWEA 2YKNB 5C25A 3D5MA 4TQRA 3T5HA 2YKMA 4JV2A 3NAHA 4NLQA 3GIKA 4DL7A 1RTJB 1T05A 4O3RA 3DRRA 2IM0A 1TP7A 1RTDB 4DL4A 2JEJA 4Y2CA 3QZ8A 3LP0A 1N6QB 2IAJA 5L9XA 2BR0A 4ECXA 4XPEA 3QGHA 4ECRA 2R8KA 5KG7A 1T03B 5DG7A 1SH2A 4R5PA 1XR5A 3D28A 3I0SB 1TQLA 2HNZA 1C1CA 3DOLB 1LWCB 5FDLB 5DG9A 1IKWA 3UQSA 3DMJB 2FVQA 4QWBA 2WRMA 4R8UA 5KFCA 4PUOA 2FVCA 5I3UB 1J5OB 4RNMA 3G6YA 1S9GA 2YNIA 4DL6A 4LSLA 1XR6A 4IOBA 2E9RX 1JLFB 3V4IB 5J2NB 3QYYA 3RB3A 2XWYA 5KFIA 5DGBA 4EYIB 5J2QB 1C1BA 3CJ2A 3DLKB 2OH2A 1C0UB 2YNFB 3HKWA 2AWZA 4URSA 2JEIA 4MK8A 3DYAB 4KE5A 4B3OB 3HVAA 2ALZA 2BANB 2QV6A 3VQSA 5KFPA 4YR3A 5KG5A 4RW8A 5KFJA 1LW0B 1JLEA 2AX0A 1JKHB 2BE2B 1FKOB 4YR2A 3BSAA 3H4BA 5HP1B 3QIPA
chains in the Genus database with same CATH superfamily
4B3MJ 3HVTA 3BH7B 1KVIA 3OL9A 2MKCA 2YQ1A 2VBYA 1G2EA 1YJRA 3MFHA 3HHNB 4DUYF 2QLXA 2CPDA 4USTA 1XMQJ 2MQ8A 1U1KA 3JSYA 1TKXB 2GJFA 1PYSB 2DITA 1KVJA 4U6PA 4OZ2A 4YB7A 5F8GA 4KBIA 3NOGA 2JLEA 2DNGA 3M9MB 3H40A 4FPRA 3EVWA 3MOZA 3WIUA 3VZHA 2XZDB 1FCAA 2UVWA 5E33A 3GYXB 1WF1A 1HA1A 3W62A 1P1LA 2FJBB 3ZFVA 4FKYA 1WKKA 3DFEA 2ZE2A 4CH1A 1S57A 3QRPA 3DGPA 3DLJA 2OKQA 3RB0A 2B4UA 2RILA 4DZDA 1IXKA 4OX6A 5FD1A 4A8WA 4K0KJ 2ZH6A 1KNZA 3O8WA 5F8NA 1SKWA 3U02A 3Q22A 5L39A 1VJQA 1JLGA 5IC4B 4DV4F 7AT1B 3LP2A 3PX4A 3BM7A 2W7PA 4AL5A 4C8OA 4QIFA 5CXTA 3QLHA 1HI1A 4D3HA 4KKOA 5KFNA 3I87A 1LWEB 2FYXA 3MEEA 5M2PA 3UD3P 2DH7A 4OYMA 1RWNB 3GCXP 3TJ8A 3CC2S 4PG8A 2B7BB 2I0XA 1VQ8S 3JQMA 4OZ5A 2B7CB 3J81Y 5IQ6A 3H5SA 1CBKA 1KLNA 3DDKA 4HDGA 4GC7A 1C0UA 1ELOA 2K7JA 1JIHA 1SI9A 4IG3A 3P3DA 3F0NA 4N8NA 1K1QA 2OLWA 1IM6A 3CC4S 4DU7A 7FDRA 5A6PA 3AAWB 2RUGA 1QTMA 4L76A 1RT7B 1PILA 3EVOA 2P9GA 1RBAA 1YWXA 4WTOB 1RDRA 2VPXB 2NXJA 3M2UB 2Y0BB 3H59A 3BN7A 3I6PA 3LWLA 3DN9A 3MPUB 2DRDA 2ZH4A 1XJWB 4EO6A 1LK5A 1ZOTA 1V3RA 4PWDB 4NLDA 4ZPDA 2BOAA 4ANCA 5HROA 2AHOB 3PV8A 1UVLA 1F1BB 4DCPB 3BJYA 2GVZA 4FP9A 5H9EK 1RT5B 3K2YA 3G87A 4XK8C 5AXLA 3S01A 1U8WA 4X4UA 2G2YA 2QG9B 5L9NA 1S9EA 3UO0A 3CJ5A 2IVYA 2XSFA 3R6LB 4BCAA 4X66J 1KFSA 2VQEF 3ILOA 2HK3A 4CO0A 1JNZB 1U26A 5EDWA 1TVRA 3IAS9 3I55S 3KMQA 5C24B 3WBZA 3N4WA 2CNLB 3PNIA 1RP5A 3NAIA 4RNNA 2AYGA 2IMOA 2XS5A 2A6OA 3D68A 3I0RB 2IM1A 4PXCA 4CNZA 9ATCB 2W1BA 2Y8YA 1VK8A 2B9WA 2AGPA 1UVJA 2CNOB 1R8PA 4NCGB 4CLLA 4ECTA 1WHWA 1UTAA 3D6FB 2HFNA 4LMZA 5C42B 2MQPA 3LGNA 4QBUA 1VQYA 4O4GB 2DGUA 1UWAA 3L7OA 1K0VA 8ATCB 2I8EA 1NZAA 2M3DA 3E3XA 3U1MA 1AUDA 2HNDA 2C2RA 5CQGA 1TKXA 2XCAA 3JTOA 3CXCR 4OYBA 4DV6J 1FRJA 2BW7A 1R89A 1NPRA 5F8IA 4N47A 2MQLA 2D9OA 4CIOA 4M1KA 1X9SA 2DHSA 1C4AA 2N3LA 4NLQA 3NGTA 3SV4A 3GFXA 1FJCA 3RW7A 4LIWA 5B0CA 1C1CA 3LTOA 1CJVA 1X5TA 1HHSA 1M1HA 1S72S 4LSLA 1XR6A 3G2XA 5DGBA 3HHLB 4UOGA 2L41A 4LF4J 1FERA 3HVAA 2JVOA 3R3TA 4UUWA 2EG2A 3EGZA 3EZ5A 3BSAA 1FJGJ 2OEJA 4RNOA 1I94J 3A8JA 1LFPA 1L3UA 1NKCA 2HK2A 3PR4A 1HR0F 3OJUA 2PFFB 4OMFG 4JOUA 1AXQA 4DFJA 4CZCA 3LPYA 1YJVA 1TUWA 3CCWA 3V6DB 5B08A 1LWEA 4ITSA 3VGTA 2MXYA 4YDDB 3OL8A 2GO9A 3GIRA 3CT9A 1TK5A 2QMUB 4ED5A 2HHHJ 3V4MA 3GIJA 3BO2A 2LU2A 3PIPQ 1YVFA 4JUZA 1RKJA 4DN0A 5T14A 3G9CA 4WFBQ 3T1HJ 4U7UD 3JSMA 3AQOA 2OPRA 2ROEA 3VGUA 3ILIA 3SFGA 5FLXU 4GO7X 2C3OA 1FE0A 3A1YG 2Q3PA 2VZ9A 4YB5A 4ED3A 2DNYA 1W2IA 2VFUA 4R8UB 2J76E 4KPYA 2WBRA 1S6OA 3PACA 4BLGA 3FEZA 4HLBA 4AFFA 4F0KA 4BS2A 4KC5A 3R6GB 4DI6A 3MWBA 3V6KA 4WCEQ 4N76A 3CJQA 1RT7A 1RT4A 4NXMF 3HM9A 2NSCA 5JVHQ 2DR8A 2MQMA 3GV5B 2W4PA 3M2UA 1LW2B 1N88A 5EUHA 1ZS6A 4LR9A 2XEXA 4I2PA 3P45B 2Z57B 1N5QA 4X84A 2M8HA 2PA3A 5HQLA 4PWDA 3GFZA 4LF5F 4UQGA 4DV0J 4HACA 4NOHA 1MMDA 3OW2R 4N5SA 1N6QA 2KM8B 1K9MT 3Q86A 2VG7B 2WB4A 2MHNA 3KJFB 1RT5A 3BDEA 2OJ3A 4LFAJ 2JVRA 2XLIA 2VG5B 4Z37A 2ZJRQ 2GC8A 5L1JA 3UDEA 4ED6A 2PMHA 2OMLA 3NL0A 4PEOA 1UEUA 2CYYA 3HZEA 2CQCA 2AP6A 5C24A 3EZOA 1Y3JA 3DHXA 1HNXJ 5FIIA 4DV5F 4HKQA 3IGNA 2IRXA 5EHHA 4USUA 3B78A 3PR5B 2PE8A 4ZVQB 3ZTSA 3MM5B 3LO3A 4Q5VA 4EZ9A 2LEBA 4A8SA 1S7IA 2ASDA 2OAUA 1SC3B 4ENOA 5C42A 2CDQA 2HFZA 5L1LA 1QAYA 1FXRA 2DTJA 5E41A 3HSGA 3KLFB 5KOWA 4Y2KA 5DQIA 5KFLA 4C8YA 4OYOA 2QFJA 3MEDA 4CLWA 1K44A 2UXBF 4HYKA 4FZVA 3W61A 1ZM9A 1Y9OA 2P9CA 1S77D 2BJ8A 2UZAA 2KKHA 2MZSA 1FVSA 2RVJA 4AL6A 4DXLA 4IRDA 4IFYB 4C8KA 2YWEA 2VPZB 4WFNQ 3DRPB 4ZPCA 3HHLA 3TO8A 3U7JA 2R2RA 3CJ8A 3MI7X 3E51A 2I9SA 3MAQA 1XBWA 1VBZA 2K3IA 1V6HA 2M2BA 1E6VB 1YBAA 2PIIA 3FVYA 4U9RA 3AD7C 1H38A 1GH8A 2DIVA 2KYZA 5KFWA 2CXEA 1H72C 3W3SA 2ROPA 2DHAA 1FK9B 5L1IA 2JH3A 5GMKa 1WEYA 1H2TZ 3UD5A 3FBBA 4DWIA 5KTQA 4K2XA 1VHIA 4X4TA 3TUZC 2QEXS 4FYYB 4IH6A 2AYMA 3A8IA 1TKZB 4DG1B 1U0HB 1AB8A 2AMCB 3N5FA 5K5MA 1LQ9A 3RW6A 2JEJA 2OUGA 1Y0HA 5EX3A 4G1PA 4ZVTB 1RHRB 1GT8A 4ZCIA 3DOLB 3OTEA 4R8UA 3HMJG 3LW5C 1U02A 3DC2A 2ZUGA 3R2CJ 5DDPC 1LXJA 3M2RB 4E8UA 2O1PA 2RU3A 3OR1B 2BANB 1O5JA 5KG5A 1JKHB 1FKOB 3B4MA 5HK4A 3AJ1A 5B0FA 2C2NA 3NGDA 1LV5A 2DGXA 1SJRA 1RWUA 1LW2A 5CCLA 2LQBA 3UPFA 5A8WB 1GX6A 2MZ1A 1LXNA 4DR5J 1NO8A 3X1LB 3BH6B 1B0VA 4OHVA 4YB6A 4L73A 1VK3A 2XLJA 4M63A 1XNRJ 1FXDA 3OFHA 3NEKA 2H1YA 5KT6A 4C48A 2O66A 3IXQA 4DHVA 1W7WA 2GX8A 1ZYQA 1UAWA 4TU7A 2K7KA 4ED4A 1FRXA 1FEHA 2UUWA 1F3FA 2VG5A 4X62J 2XQCA 1RT6B 5AJ3J 2QGFB 1Y4ZB 2DNMA 2DNPA 3WIVA 2EC2A 5ETNA 4IH5A 3DDIA 5KFUA 2ZH9A 2YNIB 5LSOA 2HIQA 3PYEA 3W2WA 2MMYA 5CH7B 2XC9A 4JI7J 5LM7E 5IT4A 2X1GA 4YY3F 1FJ7A 2H4YB 1ZM3A 3PJ9A 1IWAA 1DTQA 2LVWA 3MM5A 4KQZA 1XMOJ 3UDCA 1VC0A 4QR1A 4ECQA 3TJAA 2KXHA 2KHDA 4NLPA 3PVXA 1CS4B 3DRXA 4OLPA 2CPEA 1V3ZA 1D8ZA 1TL5A 3PX0A 2UXDJ 3FEXB 3KLFA 2Z2LA 1SH0A 3NGSA 4JI8F 3I0SA 5LMNJ 1T94A 4XPCA 2JSXA 1PJ6A 2CA9A 2XCPA 1CJUB 2EBEA 4X2BA 2NYIA 2Y9HA 3GJTB 3DU6A 1B64A 1CQMA 7FD1A 2JHEA 3JYTB 2IM3A 2DXEA 2GAGC 1IR1A 2KVQE 2XMAA 2CQBA 5GAGU 2W7OA 2HWIA 1KDNA 3CEDA 3M8RA 5HO4A 3JSBA 5KFRA 1HNIA 2UUAF 3T1YJ 4NLOA 4MK9A 1E6VA 3RAXA 3KDNA 2XMJA 3GCWP 2LFVA 4MYTA 4CO4A 4FPIA 4QWDA 1B70B 1AFIA 1MG7A 2GMLA 4AYBD 1NSPA 4IR1A 3M1VA 1FK9A 1AW0A 2LA4A 2VD3A 1NKBA 3MCSA 1FRIA 4ELVA 2Z4PA 3JXOA 2QA4G 1S7HA 4QW8A 3M6WA 2EFNA 2JWNA 4DV1F 4EEYA 1IKVA 2VH7A 4NLYA 2D3OR 4PPDA 2RQ4A 2MZQA 1TKZA 3FSYA 3OLBA 4DG1A 1U0HA 4JV1A 1SKRA 5F9LA 2VDHA 2D41A 2J9CA 4JV0A 1YZ6A 5D0EA 1QVFR 4JI1F 4UY8T 5EWFA 3DOLA 1VCTA 2RD5C 2B43A 3UDLA 4B3TF 2F8EX 1UA1A 1PC5A 1APSA 2C3PA 3DI6B 3M2RA 3KFWX 4ZIVA 3OR1A 4QOTA 2BANA 3SCLE 1MWYA 2D3O1 1FKOA 4DV7J 3KLIA 2CJKA 5KG2A 3L09A 3R7NB 3TP2A 2JX2A 3BGOP 3W8GA 5A8WA 4ED0A 2VOOA 2WK4A 1T9VA 5JMNA 1VRUB 1EETB 1DARA 3B4DA 5DDOC 1WDDA 2DGQA 4JV5J 3W5XA 3C6TA 1FTCA 5IV4A 1WC6A 1U4BA 5AE3A 1HBNB 1WELA 2IBOA 4DR3F 3ADAC 5F41A 4XPEA 3QGHA 3OD2A 1T03B 3US5A 5FDLB 2QL5B 3G6YA 2YNIA 4N7TA 1HL6A 1WD6A 4RWWA 4X65J 3L9ZA 2KFZA 2KT2A 4DR6J 3Q0AA 1S5ZA 2BE2B 1XN9A 4ZVSB 4YP3A 5F8LA 1KBRA 4HTIA 4X64F 1Y5IB 2GGPA 5DS7A 2Q43A 4LF1A 1EHWA 1CS4A 3MF5A 4L3NA 2F4FA 3M6XA 4UTGA 4AL7A 1YDLA 2L08A 3KG4A 1N0UA 4XDCA 3NBPB 4M5JA 4NXNF 2QLJB 4J37A 4GKJJ 1BQNB 2AEMA 1G4CA 4ZJLA 5IWAJ 1HNZJ 2R2TA 1CJUA 2FJXA 3K17A 4OHXA 3OVAA 3K0JA 2NCKL 2ILYA 5CABA 4QYZK 4I68A 3IR7B 3ETMA 1RTZA 2OSRA 4USMA 4RW9A 4WP8A 5GVQA 2HVIA 4UZBA 1ZAXA 4EBCA 4ECVA 5D4OA 1XEZA 4MT1A 1GTEA 3K7RA 1DQ9A 5DZ7A 2C3MA 1AUSL 5KT2A 2D7SA 3CNQP 3CCQS 1IKXB 2V68A 2OEMA 2JC0A 3BR9A 2KT3A 2MSSA 1NK7A 4JI0F 4ZITA 2B4VA 2E7VA 4B3RF 3QAEA 3EMTA 1JLBB 3NMRA 2DH8A 1PGZA 2A10A 2M4MA 3CO9A 3LQVA 1WOOA 3DLEB 2YX1A 3MMBA 2RAQA 3AQPA 4PG5A 2G0CA 3W5YA 1Q8KA 5H9FJ 3ISNC 4O3NA 1WSVA 5A2QU 1NK8A 1X4CA 2GHWA 3ONQA 4ECWA 4DR4F 4PRFA 1TUVA 3CIMA 1R0AB 5GAGI 4AXIA 1J5EF 1FRKA 4YFUA 2CQDA 3SQGB 3HX9A 4CM2A 1BWEA 3FZBA 2YKMB 4MJKA 1X9MA 1PC4A 1CJKB 3DI6A 4JYAJ 3GU0A 2ZZNA 3EXYA 2QO3A 1OS5A 3LALA 3HHLC 2GQQA 2NXCA 2IHR1 2CQIA 2KG0A 3HKZD 2VIHA 2AV5A 1FI4A 4YMEA 4JI2J 1EJ7L 4P7TA 2V4JB 3EJMA 3UR0A 1ZM2A 4CTAB 2YY3A 2H4WB 5AXMA 1Q86T 1P27B 2MKJA 1OYDA 1VRUA 3Q8RB 3CDWA 2HZAA 4EGLA 2PMWA 5CYMB 2BBEA 3RJMB 1Y11A 3NNHA 1G3OA 4WFYA 3VAKA 4U8YA 1HBNA 1N0VC 4MK7A 2KRBA 5F8JA 4WIQA 1WACA 4HHJA 1T03A 2M0GB 4CLZA 3IRWP 3VAGA 3QQCD 3VWSA 3Q8QB 3RB6A 1HMVA 3WHIA 2FJWA 2BEFA 4C8NA 2G1DA 2Y1IA 1S6QA 4RUBA 2UV8A 2VV5A 4IDKB 3CMQA 2BE2A 2MSTA 4TY8B 3RRHA 2XY6A 3PEJA 2QSWA 3CD7A 4NRUA 1QSLA 4RW4B 1KEKA 4RW7B 1NDCA 4M5GA 1NK4A 3BBBA 5A8RB 4MFBB 2VC1A 2H5IB 1BHNA 2ZM6F 4RUHA 4F36A 1X31C 1FF2A 1HWUA 5K14B 1DTTB 3U1LA 1FXLA 1YRXA 1HPZB 5KT3A 3NBPA 2RSQA 1HBUA 3G86A 1N34J 3FSXA 3VAHA 2IJFA 4CNYA 3BN4A 4QIGA 2KZZA 5LXYA 1BQNA 3R5AA 2VG6B 3BKUA 3M6VA 4X4OA 4K59A 1HBMB 4Y0FA 1FESA 2BR0A 3H42A 5MLCV 3ET6B 3I4PA 3OJSA 1SH2A 2E1MC 1TQLA 3PTWA 4ES3A 2KXFA 4DL6A 2DNKA 4IOBA 3RZAA 4OV6A 1OJ4A 4URSA 3PEHA 2DO4A 2YX4A 4E0DA 2ZJPQ 3MXHP 5KFXA 2CPFA 1EKSA 2AU0A 4RPFA 1HNWJ 5RUBA 1IKXA 2HVDA 1SJ4P 4JBCA 5F0WA 3DXBA 4EUVA 2EC0A 3N01A 1JLBA 4Q0BB 3R5DA 3OVSA 4URGA 1VOMA 2Z2MA 3N6LA 3M8WA 1WC3A 4DPYA 2WW4A 2DISA 3ZZTA 3AXMA 5D78A 4A8KA 4ZVRB 2IVFB 1VQ4S 1HBOB 3O1LA 4LFCF 3J7YU 1VQPS 5H9EJ 1T05B 3TZXA 1ZTTA 1WF2A 1DJ0A 2X1FA 5D0HA 2PD1A 4NYOA 1UMJA 4ZCMA 1IBMJ 3EGVA 4ERDA 2VC0A 2C2EA 4P72A 3SQGA 3BYPA 3SI8A 3ZZOA 4EWTA 4KT0C 2BVZA 4I1TA 1RWKB 3Q8SB 1SVDA 4WFZA 3CCRS 1Z2ZA 3FEYB 2R3VA 4ETXA 4J9LA 2WVEA 2DEIA 2DNHA 2L3MA 4QZVB 2DIUA 5KFOA 3HCXA 4O23A 3J7Z5 3DOMA 4F2RA 1NNDA 2V4JA 4DZ6A 4IQMA 4NLWA 3ENVA 4K8RA 4CTAA 3KJVB 1SKUB 3TUIC 1TFWA 2J9DA 4WZMA 2IJRA 1KFDA 4DL2A 5THWA 1HQ2A 3OUYA 5KFHA 4TU9A 1UFKA 2F5GA 5CYMA 1NDKA 4C0BA 3J81U 1UFLA 2EI5A 2CDRB 2VOPA 2MYFA 4DR2J 4K7QA 3N0VA 4UOCA 4AD6A 3KLGB 4CO2A 2XHWA 1SPBP 4PAAA 3D54A 4QQBA 4PXEA 4Z7YA 5E3RA 1EIYB 3MECA 3NG8A 3SCKE 4DR1F 5FJ4A 2ASYA 1ZETA 3PW7A 3ZTOA 4B3MF 1V5IB 1D09B 8RUCA 3MGJA 5ETMA 3KHHA 3M8QB 2CZ4A 3SSRA 4IDKA 3FRYA 4DUZJ 4NYPA 2PC6A 4K4UA 2R7XA 3KJQB 1JLQB 4RW4A 5B7WA 3MPVA 3GV8B 5A8RA 1XMQF 3PHEA 4MFBA 1IKYB 3CWJA 2MQQA 4USIA 4B9LA 3P8BB 1ITPA 2BV3A 3MEKA 3OHAA 1ZTWA 1T8EA 4NYZA 1Q53A 2QJ3A 2ZH2A 1MNEA 3TZYA 3FFIA 1NZ8A 1HPZA 4ILMA 3QJJA 3CDEA 2RIJA 2BQRA 4WP3A 3KLEB 2VG6A 4IOCQ 4XTTA 1S0NA 2B9EA 2RRBA 1UJ6A 2BKPA 4G1QA 2WOMB 4PR6A 1JXVA 3D6MB 2ZH5A 2XZTB 2H48B 4PQUB 2XSJA 3NOCA 1B3TA 2Y1RI 3D0GE 2W4DA 4K0KF 2HAFA 1WOSA 2OPSB 3IN5A 4F0MA 2GIQA 1HNVB 5F0UA 1CEZA 3D66A 3AJ2A 1N54B 1JJ2R 4QWAA 1ZPVA 1FTRA 1TL7A 2YKPA 4KYZA 3N6NA 2CPIA 3IO1A 5DGAA 3A12A 2CJ9A 1RQ0A 4ZS6A 3UCGA 4MKAA 1MWQA 2GJIA 1RHJB 4DX6A 2G13A 2ERRA 3KHLA 4M94A 1GFWB 5I4MA 4Q0BA 2VBWA 2W7AA 2XY5A 5DQGA 5B09A 1VI7A 4DQQA 4H4KC 1HBOA 4NA1A 5C2GA 3TX0A 1TAQA 2R7WA 1T05A 3CO0P 1H74A 2K2PA 1CJTB 1ZA1B 2YH0A 2HFUA 1HWKA 3G8SA 3NLCA 2DT9A 1RAEB 3ZNJ1 2NYHA 2Y0SD 1EQ0A 4KGVB 3RB3A 2RRAA 2HHPA 1RWVB 1LKZA 1FVQA 3ELHA 2B3TB 3UW1A 4Y65A 1OSDA 2KL8A 1W26A 5JVGQ 2BQ3A 4F8RA 2HYIB 3EWGA 1R0BG 2CADA 2E5HA 4ALZA 1S49A 1A7GE 1XNQJ 1S97A 3HHKA 3QFWA 2M7SA 4PCQA 3J7YI 1M5VC 4ZOSA 1R8BA 3MR5A 3QJLA 4K4SA 3A3OB 5K9FA 2WAQD 2AEFA 2A2DA 4X66F 1VBXA 2DHHA 2R9LA 4OZJA 1XK8A 2D69A 1Q8BA 5IM0B 3PX6A 1RT3A 3KLGA 4F04B 2MKKA 2MDAA 4OZLA 2V6AA 1X7VA 3R5BA 1T9TA 4JI6J 3M8ZA 1KN6A 3NRBA 3JAMU 2H9ZA 3MMJA 2FGOA 1J2VA 1T3NA 1BD6A 2G9OA 1XIQA 2ZFHA 4IR9A 4KGXB 1MN7A 5GAEU 4RW8B 4OIXA 3M8QA 1S79A 1PAUB 2XMVA 4QWEA 1VR6A 2UXCJ 2BJ3A 3R27A 1JLQA 1SBRA 1V3SA 2A1BA 1D9DA 1UFWA 2M8DB 5ETRA 1IKYA 2ZHOA 4N77A 4DV6F 5L1KA 3QT8A 4TNOA 2WTFA 2DHGA 3NCQA 1X0FA 1JXLA 4LRAA 3D2WA 1U1MA 2XG8A 4TY9A 1JLFA 2DR6A 2VFRA 3KLEA 4NLVA 3TAMB 2YNFA 1JB0C 5HBMB 1R3NA 2HS3A 2Y3YA 2WOMA 3MR7A 1R8CA 1VQKS 4QPXA 5F3TA 4LF4F 4PQUA 2CQHA 2HQDA 4ZDNA 2BJ9A 2J6TA 2VFTA 3JTNA 1FJGF 2OPSA 4I67A 2IY5B 2X51A 1RE1B 1I94F 2ZOGA 3NGRA 3HJFA 3QNWB 2AZ3A 1S9GB 1IBCB 4LIRA 1YSJA 2E1PA 4C8ZA 3CD0A 1RCXB 1JLEB 2UP1A 5H1SV 3K5LA 4NZ6A 4R0EA 4L3KA 3LAMA 2HHHF 3CMES 3THVA 2CJQA 4ZN3A 4WWSA 3HD1A 1YITS 3BSOA 4ZVHA 3T1HF 1R6VA 3ZC4A 1IN0A 4LBHA 3UCUP 1T3OA 2MQOA 1JJ4A 4ZLNA 4J9UE 3AFGA 4H54A 4XDDA 4ZKAA 2LECA 3RYLA 3ETOA 3C19A 1CJTA 2PN6A 3MM8A 2XB2D 2V9KA 5KT7A 3O3LA 4HI2A 2RDIA 4NLGA 3DGVA 4DV3J 4MIBA 4LF6J 5CHCB 2MTLA 1HQEB 1Q7LB 2PEBA 4KGMA 3MAAB 4AXJA 3OTOF 5KT4A 2XY7A 3QATA 1DAXA 2A6MA 3B8HA 2VDIA 2G2OA 1TR0A 1UCNA 1HD0A 2I5JA 1S0MA 3BGUA 2Q1LA 4KR0B 4DV0F 3H0PA 1X4EA 3M2VB 1IM4A 2ILZA 4PZVA 2VQFJ 1HW8A 1FDDA 2RDDA 5J2PA 2BM0A 4LFAF 3OLAA 3H7HB 4DLEA 3NNCA 4RBUA 3RBEA 3PXGa 1HR0J 3TUJC 1HARA 2JJ4D 4HR2A 4ED7A 4DCJB 3R1LA 3C2PA 1URRA 5EWEA 4TQRA 5D8HB 3V2UC 2FY8A 3P4UB 1Q5VA 1OQ6A 5IM0A 2VFVA 1GMVA 4ECXA 5E3QA 3GJSB 1VQMS 3PO4A 1HNXF 1RB0A 4PUOA 3FBCA 3V4IB 4PYAA 3F41A 3DLKB 2AYEA 3FGVA 2ZH8A 2FC8A 5KFJA 4RW8A 3NNAA 2CJXB 2H5JB 4LF9J 4Y28C 2DEJA 2E9ZA 4CT8A 2JLGA 3BBCA 3MR2A 1TTHB 2FVPA 2OELA 1REGX 2KFYA 3CUNA 3VAMA 1U1NA 1NPPA 1TMMA 2AYBA 2WVDA 5A2QY 5SZTA 3N6MA 3WC2A 1TAUA 2JFDA 2NLWA 5KFFA 2BE9B 1SUQA 4AQYJ 3FQLA 1QM9A 1ZM4A 5DETA 2ASJA 4I69A 4OYWA 1D0EA 2MKSA 2V34A 3AB4B 5KFMA 4W90B 4O0NA 1FE4A 1T95A 2YKQA 1SQFA 3LAKA 3TAMA 1NHKL 5HBMA 2HVHA 1QAIA 2JL9A 3RGIA 5ETLA 5GAEI 2ZWOA 3C46A 4JP8A 4DR7J 4OYPA 2W25A 2MZJA 2HG4A 2ZOFA 1S59A 3UR3C 2IA6A 1PAEX 2XULA 5G0RA 4LF2A 4F4WA 5EX0A 5KFEA 3KLHB 3I5AA 2FVRA 1L3TA 2VA2A 1P8GA 2DJWA 4NZ0A 4KV8B 4BHQA 2CG8A 1T9UA 1U48A 3RB4A 3POTB 4YQWA 4I6YA 3GE9A 1JMTA 1D3WA 3OFGA 1T9YA 2WBMA 3K5MA 3QJPA 3CW2C 1H73A 1RA7A 4DJBA 1HFEL 2H54B 2OTLS 1KSPA 2ABYA 2RF2B 2OTJS 3D0HE 1S0OA 2EWHA 3ILLA 5F8HA 4OHWA 3PFOA 4NCAA 1TELA 2XI2A 3ZTRA 4PG4A 4FKXA 2DPJA 1HHQA 5DG8A 3GILA 4P10A 4UY85 4CH0S 4NA2A 3TA1A 2ZNZA 5CD4H 2HNYA 5IZHA 2WSFC 4NRTA 2OPPB 1T7PA 4QW9A 5CCMA 2IPOB 4L74A 3EDQB 3PRDA 4P9SA 2XZWA 4N8OA 3BSNA 1HQEA 3I96A 5D4PA 5KFQA 1S99A 1N36J 3KHGA 4DR5F 4DLGA 3D3CJ 3K59A 4FVMA 3DLGB 2ZC4A 4J9OA 4CDIA 2B0GA 4WYLA 1XNRF 3RAQA 3R5CA 3I5BA 4E2FB 2GFFA 3M2VA 2RE1A 4J90A 3S6EA 1S1VB 4WTYA 2FJAB 5E3AA 2F7VA 1VJWA 4OFZA 2AJQA 1SC4B 4F4KA 2BKNA 3MPYA 4X62F 2LQJA 4ZVGA 5AJ3F 3J80Y 2W8LA 2HWHA 3P5BP 2OMOA 2VFSA 1N52B 4DFPA 4K4VA 1BQMB 3ZZRA 1YK9A 3GQCA 3R1HA 3P49B 3PW4A 4JI7F 2V67A 1W2BR 1VQ9S 2R2UA 5JUMA 3G8TA 4QYZJ 1SC1B 5CYQB 4OI6A 4KHPJ 4USKA 2KXNB 1GMUA 4ZVPB 4WFAQ 3DLLQ 5ETTA 1XMOF 2EFOA 4W98A 2ZDOA 4Y34A 3BQ2A 3C8YA 1F2HA 1RI7A 1U1OA 2EKYA 3HO1A 1R31A 4X4VA 2CJYB 1FFGB 1PO6A 4Y00A 2UXDF 4MYUA 1WG4A 2Q79A 1VLYA 1YHQS 1R0CB 2OGUA 4QPTA 2R7TA 4PXBA 5C2CA 1LK7A 1NDPA 1F9EB 1ZZNA 2W2QP 5CZXA 5LMNF 3ICLA 1B7FA 1UW4A 4G1IA 3DRSB 5J1EB 1FD8A 1ZBTA 3B6BA 1HWIA 2ZWPA 2YTCA 3QZ8A 3DKDA 3T3FA 2FHMA 4OX9J 4NE9C 4DPUA 4R5PA 1XR5A 4N41A 2HNZA 1IBLJ 1UPPA 1H6KX 1OPZA 4X4PA 3UQSA 3DMJB 1NJZA 2FVQA 5GMDA 1L5UA 5J2NB 2GNKA 3G71S 4C6AA 1NB7A 3T1YF 2ZUAA 4GVBB 3M8SA 1EX8A 5HP1B 3BBFA 4B9VA 1Q16B 2GV1A 1UVIA 3CJ3A 1U24A 3BYRA 1XC9A 3W5ZA 3VVTA 3POTA 1OWXA 4P75A 1E6YB 3TEGA 4UOFA 2KO1A 2FZKB 2DO0A 3T5LA 4I6AA 1PYTA 1DLOB 3PG9A 1WSRA 4IKAA 3SBMA 2FQQB 4GKKJ 4K5SA 4KHRA 2NXEA 2RF2A 3SMZA 5E3PA 3KUGA 2ZNYA 3MEGB 5F8MA 1J27A 3DU5A 2GCFA 1FWKA 2HFSA 1VBYA 2RT3A 1FNOA 2E9TA 5HATA 3M4XA 3KLVA 1GX5A 1KLMB 2R4FA 2OPPA 2VU5A 2B9XA 1FRHA 4DV7F 1QE1B 3KOAA 4OZ1A 5F3ZA 4A47A 3J7ZT 4BC7A 4Q45A 3K89A 2R7QA 3JB9k 3OR2B 1U2RA 3MTKA 2W2OP 2EPIA 3VVUA 4H4MA 2FLLA 4NASA 2P5VA 2ADBA 3DLGA 4WKRA 3LF0A 4I56A 1VDHA 1SC6A 3C15B 2FLOA 3FDSA 2NXUA 1O8BA 4DF8A 1U6FA 4JV5F 4ZCLA 1FDBA 1S1VA 4ZJOA 3VCDA 3H90A 1DFDA 1F6TA 2SXLA 4CLUA 2YNHB 4IRCA 2F9DA 2I6WA 1SV5B 3BREA 2RQCA 3PYFA 3HULA 4OJHA 3JSRA 3MM7A 2IJNA 4HT5A 5HI7A 5KFZA 3CCJS 5ETQA 2N7YA 4FS2A 3N28A 4X65F 2XHCA 4DR6F 4DV1J 1VGYA 1U2FA 5CYQA 4MIWA 3K57A 1S1WB 1NUEA 1CULB 2YQ3A 2V2QA 1BXNA 3ITHB 1SH3A 5CZVA 1IR2A 2DHXA 3BZQA 1NXIA 1DBDA 3I56S 2J7WA 4ZLPA 1CQNA 3V6HA 2BMBA 2LYVA 2KHCA 2XNRA 5EWGA 4F3MA 2Z0GA 1R6YA 4F25A 3D67A 1IJEB 3I9ZA 3TJ9A 4GKJF 1LEOA 1YTYA 4TVAB 5IWAF 1HNZF 4IG0B 3CC7S 3AHPA 1IQTA 3DRSA 5J1EA 1MN9A 3HI9A 2A0FB 4CYUB 1U45A 3A3NB 3SQOP 3CB4A 2YKOA 3EZUA 1S1TB 1X4HA 4KO0B 3NCPA 4FYXB 4OHYA 3DMJA 1HW9A 2Q66A 3U1NA 2FVSA 5HVGA 4DBQA 5J2NA 1ROFA 3TOQA 2FJVA 1N5YB 3KUEA 4GVBA 2E5LJ 3GJQB 1YRUA 4K50A 3G6XA 5M2RA 2DGTA 3JQJA 5HP1A 3GYGA 1WTBA 1NDLA 2KFNA 3ZXWA 3J7AN 1DZ5A 3GJRB 1M5PC 2X7IA 1RU1A 1WKJA 4Q8EA 2MQNA 1K47A 2J0QD 1E6YA 3GFHA 1UA0A 1M5SA 2UUBJ 1VQLS 1IVZA 4UW2A 2GS8A 4RUCA 1F60B 5LT5A 1UVKA 2QZ8A 1U6BA 2C3UA 2QMWA 3FZ2A 4NCBA 3MEGA 3OVBA 3LP1B 3QWUA 3KJNB 2DCLA 2YKNB 4LR7A 1JNRB 3NAHA 3JAMY 3M6UA 3HXMA 4DS5A 3R7SB 1MLAA 5DG9A 1SQGA 5LJ3Y 4JYAF 5I3UB 1UEKA 2J0XA 3LUYA 3BGFA 2XMTA 2OH2A 3NS7B 1G7CB 2QLBB 4G65A 4O3SA 4O3PA 4JI2F 4CRJA 5D4NA 3OR2A 4HI1A 2W24A 2BRKA 4LR8A 4U67Q 1N33J 3AT1B 3ZO7A 1DRZA 1RHUB 3VALA 3DOKB 2UV8G 1X5OA 2P9EA 2XNQA 2MPUA 3C15A 2CQGA 3OTCA 3SEOA 2F40A 2HRUA 1F2GA 4OJGA 4LFBJ 2IA0A 1HD1A 2YNHA 1AA1B 3DHWC 4TYAA 1SV5A 3HP6A 3UWTA 2APOA 3Q8VA 4M95A 4PXDA 1M1KT 3OFFA 2J0WA 2HQIA 3I0RA 4L72B 2YX7A 3NXZA 1VS3A 2JNJA 1H98A 4NCGA 2DNQA 4FN5A 1VISA 1ZH5A 2Z58B 1FA0A 3KUHA 3VZIA 4ZJQA 5GADI 2D74B 3H8YA 2C2KB 4B17A 1S1WA 4DMZA 3PJXA 4O4GA 1FFSB 1G1XA 1WG5A 1CULA 2J7KA 2XM3A 5BYRA 1C0TB 4J9VA 1VRTB 3ITHA 3AH6A 4EMDA 1I51B 2MHEA 1NK6A 1NK0A 4JI4J 3FCVA 1QAXA 1NH7A 2XWXA 1TMJA 5D0RA 2JOQA 3E01B 4OZNA 4ZCKA 2NZCA 3IS9B 4FNIA 3CPWR 2HMIB 2ZVSA 1LFWA 1N34F 5IXUA 4HHUA 3LA0A 1PJ5A 3PZPA 1NSKL 4X4QA 1U1RA 1RHMB 1SXLA 5IT0A 1KONA 3AY0A 4KY3A 3TVZA 1RAGB 2H3EB 1N4LA 1Y7PA 2LP4A 1YJUA 4CYUA 2HQGA 5A76A 2BM1A 4P2FA 3GV7B 2DXDA 1TL3B 1S1TA 4KO0A 2YPYA 1RWOB 3QO9B 4DPWA 4DQIA 1N32J 3LP0B 1L3KA 1N5YA 4J91A 3KK2B 3BPSP 5KFTA 2FB0A 3M9NB 1HNWF 3D6HB 1H3DA 2JC1A 3V6DA 2FY1A 3K8VA 3L3CA 2X1AA 1JJCB 2R8IA 3OQ2A 1UJ4A 2WVFA 2G2ZA 2CQ3A 3C14B 3ZTPA 2COLA 1RAIB 3ZZUA 2HGNA 4OI1A 2P8IA 4M5LA 2PO4A 4ZP7A 4MKVA 1U47A 3NWRA 4RUAA 2CVEA 5GAHU 4U7CA 1M5OC 1Y5NB 1X4BA 5IFMA 1TL4A 1KOOA 3CCSS 3BPDA 5T41A 3LP1A 4N56A 5C7PA 1O6XA 3A8KA 2XGQA 3CCES 1IBMF 1D8YA 3IM8A 4EYHB 1REVB 5ETVA 1TV6B 1P1TA 4DPXA 5BYQA 2HHSA 2KN4A 1VQOS 2UUTA 3NS5A 4LBIA 3W1YC 4F7VA 5I3UA 4UT4A 2YBVA 4ZVEA 4UZCA 5KFBA 3OTDA 2CKWA 2IMWP 4NL5A 4K4TA 1ULRA 2CPZA 2ZE2B 1WHYA 2VBZA 3UNGC 3QT6A 3DGPB 2ZBRA 1KKHA 2ACYA 3GWCA 2VG7A 2E5IA 2YH1A 1VQSA 2BACA 2F9JA 1CC8A 3BQ0A 3J7A1 4NLRA 1KQSR 2ZKTA 1SKSA 2RQMA 1N5SA 3H4DA 3BR8A 4ATNA 3LP2B 2FLNA 2HQ3A 2Z30B 4DR2F 4NMXA 1Y5LB 1YJNS 4ZP6A 4ZP9A 1SJ1A 2ZH3A 2C28A 3PKMA 1Q78A 4KPCA 1MU2B 1T9XA 4JV2A 1WJ9A 4O3RA 4K2JA 3GR1A 2N4CA 2R8KA 1AYEA 1RAAB 1Z2LA 2IRYA 4WKYA 4WU3A 1KQFB 1YBUA 3KG1A 1X9WA 2E9RX 4V19J 2RMLA 2XWYA 4PYDA 5J2QB 1C0UB 1RCOB 3C16B 4GRSA 2AWZA 4DUZF 4MK8A 3SXLA 1NU4A 2HLUA 2AJFE 1M1GA 4ZVFA 4DSFA 2XS7A 5K8NA 4CLSA 2QA4S 5D4LA 1C0TA 1VRTA 4FF2A 3OXGA 4FF3A 5HMXA 5HSPA 4LQ3A 5HJYA 2CJBA 1OSCA 4ZPVR 2KG1A 2VPYB 1YKWA 2YWKA 2GZOA 3E01A 2QIFA 4J5OA 2W4CA 4F02A 2IVMA 1DY3A 2OP5A 5G4DA 2G0JA 4DS4A 4G6VB 3IRXB 1WOPA 2Y1LB 1XTZA 4C3LA 2R8GA 2FUG9 2OO4A 2WB1D 4A8QA 4YS2A 1Q79A 3WC0A 1UZHA 4IFYA 3CCMS 1CLFA 5KFYA 3DRPA 2HPUA 3KG0A 4PQAA 1Q81T 5H9FK 4Y2IA 5I3QA 1IUJA 2IAJB 3TA0A 1Y10A 3IBCB 3HHEA 2ROGA 4G3IA 2Q6BA 1KQKA 6AT1B 4B08A 4CM0A 3I31A 2DXFA 2R2SA 1MMLA 3QO9A 1WC0A 3DLHA 2GMJA 9RUBA 3VHQA 4NEZA 4TQSA 1TFYA 2G0IA 2CZVC 1VHFA 1KHVA 2RRNA 4F4AA 3ENAA 3KK2A 4WJBA 2YWWA 3J81j 1TVRB 1RUSA 2J8AA 3MM9B 2ZITA 1H2UX 3BO3A 2NREA 1KWMA 4YR0A 4JI5J 3C14A 1SQEA 3G8QA 5J2MB 1L3SA 2HKEA 1LNQA 3LWMA 2HAIA 1IQZA 2HQCA 3THPA 3SIPB 1RHQB 3H5UA 1HYSB 2YWHA 3QRQA 2OD6A 4J9NA 5LMUJ 2VA3A 5BJRA 3T1AA 3WDOA 2V8PA 2HNDB 4QU6A 1NCLA 4I64A 4UQTA 2RUSA 2G1HA 1REVA 4ER8A 1TV6A 3MD1A 1JKHA 2B8QA 4K4XA 4FYVB 2FPHX 5KFAA 2QSFA 3TQ1A 3GONA 2FJDB 4M5MA 2DVIA 3PW2A 1R27B 1V5VA 5DM7Q 1C1CB 2XYPB 1CJVB 2I2YA 5D3GB 4ZMMA 1VQ6S 4QJVA 4LSLB 3C6UB 3ENWA 1TL1B 1XNQF 1RZMA 1GK8A 1H2VZ 1U25A 2HHVA 5GAHI 1TKDA 3TANA 4B3SJ 2QC3A 4DL5A 3W65A 1C4CA 1MMNA 1TU0B 3RR8A 4DX7A 2CQPA 1NB2A 2V0NA 3RBDA 4M5HA 3QPIA 1WUUA 1RT6A 3HSJA 1VMBA 3V6JA 3S8SA 4HHHA 2DR7A 4ILLA 2BJ7A 3TX8A 1N5TA 1MU2A 5IS2A 4P2MA 2YWGA 4Q2MA 3DM2B 3KKFA 4JI6F 5LXRA 4ZPAA 1X4GA 5B0DA 3W9JA 1U2CA 3T19A 4YB1P 3SSQA 4DQRA 5AE2A 1I1GA 3JSMB 2OPRB 1PYOB 4QYRA 2WW8A 1F0XA 4DSJA 1RAFB 5J2QA 4KIAA 2UXCF 2CQ1A 4J9MA 3C16A 3TVKA 2K1RB 4F3OA 3FMBA 1IR0A 4OYIA 3PW0A 4P6QA 3ZZZA 4FS1A 4GMKA 4ED8A 1GMWA 2L48A 5BR8F 3PFEA 4EI2A 4I7FB 3VGSA 1RT4B 1OMSA 2GQCA 2PT0A 4LF8J 4FBTA 1ZPWX 3AOAA 5KG6A 1SJ3P 1MSWD 2R8HA 3IRXA 2DB1A 2QTWA 4O0IA 2NR0A 2BJDA 3QMQA 4A8YA 1U0SA 2KU7A 3W7BA 3IP0A 4I2PB 3QSIA 3JYTA 4LRDA 3M32B 5AXNA 3EPIA 3TR5A 2G4BA 2PFDA 4C8MA 2E7WA 2QFIA 4HACB 2XMUA 4DL4A 1TP7A 1B0PA 2N4DA 1N6QB 2IAJA 2KT5A 3DNCA 3UFCX 4HH1A 5LSRA 2W2MP 1LWCB 2V94A 3E8OA 4RBTA 4GVLA 2DYAA 4NA3A 3IMQJ 1F5CA 2JEIA 4OQJA 2EK1A 2ALZA 3FBEA 2DGVA 3OL6A 1QUPA 1Q1KA 3IM9A 3MM9A 2A2CA 4CLTA 2BJEA 2N7CA 3MM6B 4Z7CA 1UWBB 2KDOA 3B54A 2RS2A 1EKRA 1FRMA 2LXUA 1SCJB 1FKAF 2NPIA 1VBKA 1AFJA 4URQU 2LDIA 1SL0A 5J2MA 2HEKA 2BYCA 4P2SA 3AB2B 2AEJA 1SIWB 1GQEA 5K8PA 1R8HA 4TN2A 2EK6A 1F5AA 4P7VA 4B9TA 3OXLA 2VPWB 1HYSA 3MDFA 4LBPA 3HFZB 3OBIA 2OFHX 5DDQC 1YLXA 2PA8D 4PWWA 3DRRB 4K4WA 3BGLA 4USJC 5K20B 5AXKA 1VC5A 4ECSA 3KWMA 3MEDB 4DV3F 2ZZMA 2HRYA 4YEAA 4LF6F 1RU2A 3NWGA 2JRSA 1GNKA 4YN3B 2P2CB 2B4PA 1X5PA 3EVMA 4MH8A 3M05A 4HL9A 1S4FA 3GZ7A 2H65B 4A4JA 3MR6A 3Q24A 1U49A 3QIPB 2NUHA 4O4RA 2J9EA 2V8DA 5D3GA 2PDAA 3C6UA 1EETA 1TL1A 1F9HA 5IC6B 4LRBA 2GVDB 4LUBA 1YQHA 1AT1B 2VQFF 4TU8A 4ZIWA 1QSSA 1KVKA 1KOHA 3H2LA 2W2NP 3NGUA 3FK4A 2DY1A 3N79A 4QIWD 4WIIA 5E5NA 5ETSA 1DURA 3VAIA 4DSIA 2XO7A 4E98A 4DV2J 5FDLA 1YBTA 1TKTB 4TXSA 4ELTA 3DM2A 4C3KA 2AQ4A 2LCWA 2DKOB 4WE1B 3NKYA 3HPOA 3D1QA 3D7SB 1HQUB 3TAQA 2D3UA 3QIDA 3D3BJ 2LQ5A 4LF9F 2C2ZB 4Q2LA 2K1RA 4WXOA 3D6TB 3RBZA 2L9DA 3MFIA 1QJHA 1SJQA 2MZTA 1WC1A 1M90T 1WEXA 4RKUC 4ID8A 1X4FA 4OLOA 4CQ1A 1NJXA 2V2ZA 2ZH7A 2U2FA 4XIUA 4OX7A 1RAJA 4I7FA 3CDBA 4OL8A 2YKAA 3T5KA 1BUXA 3AD9C 2ZH1A 1NKEA 3JS9A 2F8MA 2KM8C 4DF4A 4AQYF 2YNGB 1DHMA 3Q8UA 4LF7J 4WBFA 1AZSB 3IA0A 3OTOJ 3ULHA 3BB5A 3J80U 3M32A 1SB6A 2DY9A 1I5OB 2CPJA 1C2PA 3HF5A 4KHMA 2E5JA 3QZ7A 1RWPB 4AT1B 1FKPB 2BZ2A 3W8PA 2W01A 1VQNS 1S1XB 4DR7F 2BABA 2E1AA 1PIEA 3AD8C 2V4RA 1LWCA 2HW3A 3ZTQA 1GXLA 4H4OB 2OHDA 3V5RA 3PCOB 1FNXH 4WYWA 1FJEB 2QLWA 4P2XA 1VIOA 4ZVOB 2C2MB 1Q7YT 3CJ0A 3S1TA 2CJAA 1Q5YA 1UL3A 3TVYA 3KTQA 3W2WB 4RL1A 3MM6A 2DPIA 1UWBA 3PRVA 4EFAC 4TYBA 3Q8PB 2PMZD 4ICLB 3DLEA 2E1CA 2HHQA 2JLFA 1DTQB 3LPEA 5IT9Y 1D1UA 1Q82T 2LMIA 5LOQA 2F4VJ 2LQ9A 2ZC3A 4WZQA 4LSZB 4RBVA 2AIRB 4J9RA 1R0AA 2CPYA 2DRBA 2DNOA 5HMYA 3HLUA 4OJ3A 1QY7A 5A8KB 1M5HA 3MUTP 2VASA 2GA7A 3T5HA 2YKMA 4CO3A 3DRRA 1CJKA 1SJFA 5HN0A 4ECRA 1PG5B 4C2MA 2YPZA 3I0SB 4YOEA 2B4OA 1FRLA 4IUFA 3DDNA 4BDPA 5KFCA 2UU9J 1RADB 4CLFA 1N36F 2LXFA 4YHHJ 1T11A 1OYEA 2QV6A 1RWWB 1LW0B 3H4BA 2CQ2A 4JI3J 1IBKJ 3QIPA 3SCIE 2P6TA 4C8LA 4DDFA 3N9UC 4GC6A 1Z1ZA 4CP5A 4F4ZA 2DCUB 3ILJA 1P9QC 3TARA 3QWPA 2GVDA 2CFXA 2HBYB 1HNIB 2CQ0A 2UVVA 2ZHBA 1YIJS 1S48A 1K1SA 2MKYA 3PW5A 5KG1A 1YI2S 2QYGA 4X4SA 2ZBQA 2PI5A 3M1VB 4FF1A 1K73T 2UUCJ 3FUYA 2ACMA 4WU2A 1B99A 5KG4A 5C25B 1WNEA 1NRKA 1H0HB 1S12A 4ZP8A 3EPGA 2O5DA 1TKTA 3CJRA 2ZEJA 2X3DA 2F3JA 1IKVB 2R7VA 5E0OA 2VHGA 4KHPF 4WE1A 4TY8A 2PI4A 5CD4A 2VB6A 1A6LA 1HQUA 3MZIA 4WK1A 1RXOB 2ZKUA 4RW7A 4OI3A 2K06A 2FGCA 4J9SA 4NZ7A 3A13A 3L95X 2QYCA 2ZBPA 3W66A 4IO9Q 4HTJA 4W92B 1WEZA 3CD5A 5K14A 4CT9A 1DTTA 3JQKA 1UP1A 4ZLJA 2BX6A 2R42A 4O3QA 4JB8B 3KLIB 1HKAA 1G6BA 1BY9A 2FD2A 2YNGA 4X4RA 2J7UA 3I9V9 1HBMA 4B02A 1NJWA 1OPIA 2IRUA 4RWXA 2VODA 3ET6A 1AZSA 4FYDA 3QGGA 5LJ5Y 1FNMA 4OX9F 1YJWS 5LSLA 4PWUA 3T6BA 3UI3A 2HBZB 4F67A 1IBLF 1FKPA 2M5YA 1NJIT 1N8RT 1S1XA 2B6AB 2ZZTA 3C6TB 3SFUA 3KK3B 2ADCA 2HVZA 3LH2S 4KRWA 3MHYA 3HK2A 4H4OA 3D0IE 4NLTA 4L75A 1OY9A 2V50A 3CCZA 3OXFA 1FWPA 2AJ1A 1GMWD 4TLQA 3VR1A 2O67A 2KJVA 3BQ1A 1LWFB 2OSQA 1FT8A 2VF3A 4ICLA 1CPZA 4NLUA 4LVOP 2XMWA 4DUYJ 2V2VA 4GKKF 4DEZA 2CRLA 2HLTA 4P73A 2HFVA 3PO5A 2MLYA 4O3OA 4W4MA 2GGPB 2WHOA 2D9PA 3HSDA 1EQMA 1YZ7A 1WWHA 5L38A 2F8HA 3MPWA 5A8KA 5E3CA 5J1NA 4F4XA 1CVJA 2C42A 2W2PP 4DOZA 4Z2XA 3EXCX 2NPFA 4RJVA 3QSYB 2J6UA 2MEWA 4FXVA 4HVZA 1GTHA 3GP9A 1P9YA 1VQ5S 4F26A 3TAPA 3CJTA 1H7WA 4F2SA 2DR9A 4ZK7M 4V19X 1KHWA 4DPOA 5HQMA 1RTIB 2FTRA 1VRQC 4A8OA 1LW0A 3FBFA 3MPDA 3KJVA 2HGLA 4RW9B 3AA8A 2OPQB 1ZA2B 1R43A 3T9NA 2IC3B 5D15A 2QN6B 4P71A 1NM2A 4DV4J 3KYLA 4J7CA 2BRLA 3OSPA 3PDNA 4DSKA 2HZCA 3W9IA 3BO4A 3TI0A 1QDUB 3IG1B 4C4WA 2XTJP 2PEHA 4KAIA 4RR5A 1DQ8A 3P6YC 2AD9A 8AT1B 5C25A 1WF0A 2DGWA 4FDFA 3M30B 5DZ6A 4RU2A 1YJTA 3MMBB 3CCVS 1KRPA 2GW8A 3OPKA 4CLYA 3W64A 2MGZB 4QWBA 1U7LA 3Q2TC 3HHDA 2IDEA 3CJ2A 1A9NB 3RAMA 3UE2A 3PIOQ 4KE5A 4C97A 3VQSA 4OX8A 1BE4A 1HLWA 3CCUS 3UN3A 4A48A 5EGYA 5F9NA 3GSIA 2A18A 5MAOA 3KXDA 4DSLA 1T9WA 1WHVA 1XR7A 4FVCA 1BC6A 3PJWA 3RTVA 5HANA 2IIHA 2XI3A 2H51B 3AOCA 3DRYA 3PYDA 1JWWA 3R8YA 4F3QA 1HI0P 2J6SA 2I38A 1VFJA 3Q89A 3QGPA 4ZVUB 4M8LA 1HNVA 4M5IA 2HS0A 2XS2A 4UOHA 3NMAA 2B6AA 1IKWB 4ED2A 3KK3A 3UN2A 2VQEJ 1RAHB 4NWBA 2E5LF 3QT7A 2CWXA 1C1BB 3CD6S 3HVRA 4P74A 2R7RA 2RU9A 1RYRA 3OL7A 1XQIA 2HHWA 2EBGA 2HWTA 2MY8A 3M8YA 2WONB 1HMVB 1LWFA 3H2UB 4RZRA 1QTNB 4IOAQ 2C2OB 2VKRA 3D4JA 3NGKA 2OFGX 2ZJQQ 4QWCA 2UUBF 4HEA9 1S6QB 3MMCB 5E2QA 2EFGA 5CA5A 2M88A 3NY0A 3LOUA 1EAYC 4ZHRB 2NQPA 4EO8A 2MB0B 2VUGA 1RLDA 2AW0A 3TEHB 4QCLA 4IYQA 2WSEC 3M8PB 1Y3KA 1Q95G 2HQFA 3SV3A 2J8SA 2UVUA 1N5VA 2Y8WA 3PYGA 3MUMP 4H4KA 3BKTA 3SDEB 2VBXA 2AKWB 3TRGA 1HBUB 3EICA 2VICA 2IBKA 4KGZB 2DNNA 3NS6A 1ICEB 3P96A 3EM1A 1WORA 4MMOA 3KMSA 1ZZFA 1GXUA 5I3PA 4Q8FA 2KH9A 4OI2A 4Q44A 1UKUA 3VV2B 4A8MP 1RTIA 1Y00A 3FMWA 1N33F 4DSEA 1BQXA 3MR3A 1WC4A 4EK2A 2CVIA 4Q43A 4WP9A 2OPQA 4ILRA 2IFXA 2VKZG 2IC3A 4I2QB 2QMXA 5KT5A 5SUHA 1YX2A 1S0VA 5ETPA 4LFBF 3SZ2A 3SYZA 2FHKA 4DFMA 3IR6B 3GB0A 3F73A 2CQ4A 3IG1A 3OSNA 1I3OB 3I5CA 4IQXA 2ZBIA 3CMAS 2C3YA 1O0PA 3K5PA 3ISND 2IYIA 2RS8A 1RT1B 2NSBA 2HFOA 4FXWA 5JXSA 4C0HA 1PBAA 1UZDA 3M30A 4HDHA 4ID5B 2J5AA 2L9WA 1NSAA 2XBPA 5KFDA 5L8RC 2HURA 4RW6B 2MGZA 5ADZA 2CUYA 4LREA 1QLNA 3LANA 4RX6A 2JDJA 2XYGB 2Y1JA 1NH8A 4D3GA 1U6ZA 2DNLA 1S76D 4Q7AA 3EGWB 4Y2MA 4B9SA 3IWNC 2JEFA 4JI4F 1FEEA 3HHLD 1S6PB 3HJVA 2K3KA 4NXMJ 4B9NA 2YQ0A 2VONA 1K0TA 3RG6A 2AZ1A 2AGOA 3TUPA 3ZZPA 2LXIA 5B0BA 5A0YB 2MKHA 2AJ2A 5KAKA 4A8FA 3DOMB 5AE1A 2AGQA 1RSCA 1LOUA 1UEVA 4LF5J 1RTHB 3CDUA 4EZ6A 2WCXA 3GG1A 3H25A 2W8KA 2YXLA 1PBUA 4NI2B 4FYWB 4BWMA 5HLFB 3OUYB 3GIKA 1RTJB 4NPOA 1RTDB 4Y2CA 4MKYA 3FNNA 3W63A 2EKNA 1VQ7S 3IWXA 1N32F 1IKWA 4RNMA 1J5OB 1S9GA 2DNZA 1U1QA 4ZPWR 1Q4RA 5KFIA 4EYIB 1C1BA 3PHTA 1RWMB 1FDAA 5KFPA 4YR3A 1JLEA 4CH7A 3UD4P 3UCZP 4DV5J 2V8GA 2Q6CA 3R9LA 3TA2A 2WONA 4MKBA 3MECB 3GG0A 3UVJB 4OHZA 4PG6A 4BC9A 2HRTA 3O5TB 4B9UA 3MMCA 5DO2A 2MLZA 1F5BA 4C7QA 2R7UA 2KZMA 2R7OA 4IRKA 4ZHRA 3OV7A 2I1RA 2W9BB 2RB7A 4KSEB 3EYZA 3M8PA 1M5KC 3TW0A 2OIHA 4CLKA 3AA9A 3L7PA 5KG0A 1FD2A 2C2DA 3BF4A 2MJNA 1JJHA 1RACB 3WX4A 2UXBJ 2GMHA 2C22A 3FFIB 1KTQA 5FLXY 2LKZA 2RNEA 3SDEA 1B4SA 1GEHA 1GXTA 2ZDPA 3MAAA 4L6V3 2DGSA 2LLZA 4WF9Q 3IR5B 3EGNA 3GIMA 1BWVA 2PGCA 2CPHA 1R7IA 4G1QB 4RLEA 2RHSB 3UDVA 1RBOB 3WX8A 2B8PA 3W2VB 2E29A 3L7UA 2XSJB 3N5BA 2GJ2A 3MTJA 4PKDB 4MAKA 3AOBA 3RRKA 4EBEA 3BS9A 3P5TL 4ZPBA 4I2QA 1RWXB 2RKIB 5HL7Q 3Q23A 2E44A 5A6WA 2QL9B 2AJ0A 1TL7B 1XMBA 3SCJE 3CSKA 3TZWA 4BBYA 4YUDA 2V8HA 2KTQA 2E5GA 2DK2A 2XGPA 3E2EA 4F50A 2JFKA 5KFSA 3IWLA 5KG3A 1S1UB 4OYZA 4EU0A 2V63A 4UUXA 2LEAA 1RT1A 3BEGB 1RABB 3V4IA 4C11B 3DLKA 4ZLLA 3QRRA 2DD8S 4ID5A 3EX7B 5KFKA 3AJDA 1JK9B 2WZ1A 3IC1A 1RJJA 3VAJA 4RW6A 2W9CB 2YVSA 2ATLA 2ATCB 2AJ4A 3HFVA 3MMAB 2FC9A 2RJZA 4LRFA 1S6PA 2QL7B 1B7YB 2HBQB 3UNYA 1KC8T 2GHVC 2VL1A 1HWLA 3BGRB 3IBWA 4LJMA 1H7XA 4LSNB 1RHKB 3A3PB 4RO0A 1VYAA 1NHUA 5A0YA 3CTRA 3TZZA 4R0JA 1MWZA 1U09A 3THTA 1YJ7A 2FLPA 3R97A 1OY8A 1WI6A 1TK8A 3UN5A 1OY6A 1RTHA 3G6ES 4K5RA 4USWA 2ZD1B 3FSIA 2E1RA 4NI2A 5HLFA 3CE8A 1RTJA 2EG1A 1RTDA 3A4TA 3I32A 3KLHA 5DJBA 3EDRB 5I42B 4U7UK 5HJXA 3T41A 1AROP 4DCOB 1J5OA 4KV8A 1ACMB 1NHVA 1UPMB 1RT3B 3NP5A 3GIIA 2GQ2A 4KFBB 2P6SA 2LEPA 1FX4A 1X4AA 4JI5F 2M52A 4DU8A 4YY3J 1I6JA 4MTPA 3BDPA 3UVJA 2FHJA 5HMWA 3G82B 1NLKL 3VF0B 4M5KA 3SSSA 2QLFB 2HHUA 2KYXA 2DH9A 1HHTP 5LMUF 1KQGB 2W9BA 2BKOA 1RISA 2C1EB 4OZ0A 4V1Ak 1FWLA 2MKIA 2BA9A 3CULA 3TYTA 1OIAA 5K8OA 3RRGA 1FO1A 5HMZA 2WVCA 3DXSX 3D5MA 2M70A 4JI8J 2IM0A 5BXIA 4HH0A 1TUGB 2CWKA 5DG7A 3QBCA 2RQKA 2OD4A 5LL6d 1JLFB 5GADU 2LA6A 4XAKA 2YNFB 3DYAB 4B3OB 1YRTA 2AT1B 2U1AA 1TZ0A 2AX0A 4FNHA 3W2VA 2BOPA 3K8WA 4OI4A 5GMEA 4I6WA 4B3SF 1WTFA 2UUAJ 3GMGA 1X5SA 3CGIA 3R5GA 2QRRA 4B9MA 3CJ4A 3D1HA 3X3UA 2RKIA 3AODA 2JZ5A 5HAOA 4A46A 4PABA 4CO5A 3CVKA 2V9WA 1T02A 3H5YA 4ANEA 2EFQA 2V2KA 3T5JA 4ECYA 3BSCA 3H2VE 2X3GA 3B82A 1BQMA 1QUVA 5DRKA 1PSDA 1NMEB 3HZGA 2IDLA 2Z8QA 1NAQA 2QT7A 1JX4A 3C3LA 4DQSA 3TWZA 1S1UA 4CLPA 2ASLA 4OZ3A 4OI0A 3Q83A 4C11A 4Y6IA 4ES1A 1LWXA 2Z56B 3O44A 3GYNA 2W9CA 3QFHA 3G96A 5BYSA 3ZNUA 4JI1J 4WK3A 3MURP 4YDXA 3MM8B 1EZZB 4B3TJ 3ZZ0A 3CJKB 1X4DA 3MMAA 1WI8A 1URNA 3RU0A 4ETZA 1F9FA 3MCNA 4NMLA 2EFVA 2N82B 1QAJA 1NK5A 2V69A 4KJIA 4LF8F 4F0HA 3BGRA 1R8AA 3VTIA 2BDPA 4ZA1A 1X8DA 4LSNA 3A8EA 4ECZA 1JXEA 1RT2B 1CG2A 2I5JB 6FD1A 2W9AA 5DM6Q 1O51A 2BW2A 4BWJA 4X4NA 4RNFA 2GO8A 3CIZA 4AE5A 4FF4A 4CO1A 2ZD1A 5DLGA 3WZ0A 5HQ8A 5IOLA 3HVWA 3QAUA 4FXDA 2V8VA 5J2PB 1RK8A 2HIYA 1HWJA 4OJ1A 4DR3J 5K8MA 2GHPA 5I42A 2ZOMA 2LQ8A 1RLCL 1PJ7A 5B0GA 1UW9A 1BMQB 4J9PA 2FDNA 2FIUA 4QR2A 1D9FA 2H5EA 2POKA 1XWLA 3BV8A 2J0SD 3MOJB 4C0OC 4KFBA 4DL0C 2NUUG 2OI2A 4PUOB 3F44A 1ZAWA 3VAFA 1D9AA 5J1PA 3R5JB 1EP4B 1MW7A 1IWGA 1DLOA 3KNAA 1U1LA 1FHTA 2FZCB 2HGMA 3G82A 3FCHA 2M9KA 3EE3A 3MCMA 1IJFB 4X64J 4QIEA 3KK1B 3M9OB 3M7VA 3AXKA 1RGVA 5KOXA 5B0EA 2BJ1A 2B5JB 1KP6A 2HS4A 3Q8YA 3HSZA 1KLMA 3V81B 5BR8J 2BQUA 2HHXA 4RU9A 4C98A 5M2UA 4Y3CA 4NXNJ 3I82A 1W25A 1QE1A 3O6QA 4O44B 1SUQB 4XO0A 5ITHA 2O3DA 5L46A 3ZZYA 2QX0A 2KB2A 3FRZA 2UVRA 1U1PA 3LGMA 3DYAA 4KB7A 4B3OA 2VJVA 2B51A 4I0WA 4IFVB 1WKLA 4K4YA 1DQAA 2E7XA 2FHOB 1RA6A 2GIRA 2CNKB 1JLAB 1A0OB 3KNGA 4J9KA 1MROB 4LVNP 2EEYA 1S4EA 4C9DA 1SIZA 5G0RB 1CSJA 4M5NA 5IT9U 1JLCB 1U8SA 4F4YA 1WC5A 2L9NA 2KI2A 1S6UA 3KHRA 1WG1A 3RUBL 5KFVA 2R8JA 4JI0J 1EB0A 4B3RJ 4DV2F 2MLXA 4USVA 3HDSA 5ETOA 2BXJA 5DDRC 1VC6A 2B9YA 4OV1A 1OQ3A 3Q2SC 2NZ4A 5C5JA 4DPTA 4USHA 3OTBA 2WSCC 4PPZA 1OO0B 3VQTA 2EVZA 2Z2YB 1PKUA 1Q0NA 5ETKA 2IYGA 3D28A 3G4SS 4DR4J 3IFEA 3R7BB 1NSQA 2WRMA 1J5EJ 1K8AT 4QIVA 4KH0B 1NBEB 4PG7A 3LGHA 2HNYB 4YR2A 2YWFA 1BGXT 5T7LB 2ALYB 3CJKA 3RBXA 1F3VA 5HVFA 3K5NA 4M5DB 5IV3A 1TK0A 3H98A 1X0PA 1YGYA 3MD3A 2VJUA 3CF5Q 2HHTA 2RH3A 4CCHA 5D77A 2CZ9A 4ANDA 2ZHAA 4DL3A 3JTPA 1QD1A 4S0MA 4IG0A 2XYHB 4WPAA 2HBRB 2BE7D 2FZGB 4DQPA 4LF7F 4TKTA 4MIAA 1JQGA 1RT2A 3L4BC 2QA2A 4ELUA 3G6VA 5B0AA 4EBDA 4RNHA 3HT0A 2QA1A 3CCTA 3W9HA 3O2IA 5AT1B 2GIFA 2KVIA 3HD2A 3W60A 2B56A 3OFEA 4ZPTR 3GLJA 4ZN1A 3GSDA 1NPKA 2AF6A 1EARA 5EN1A 1QVGR 1Q8LA 1ZAVA 1P6TA 3U27A 2BUNA 3GR0A 2RDJA 3CJSA 2X1BA 5DQHA 4K4ZA 4KGKA 1SL1A 3BKFA 3IGVA 1Q8IA 4NEYA 1N56A 2D1CA 4HT7A 2CIMA 2CPXA 3HVTB 1NJYA 1B0TA 3ISZA 4I4BA 4NLXA 4IH7A 2KRRA 2J9DE 5U47A 3CDAA 2AX1A 4FBUA 1EP4A 1UVNA 1NK9A 2Z2ZA 2NXNA 3EUNA 1KS2A 3PM9A 3MCOA 2F4VF 4TLRA 3QGIA 4J9QA 2MY7A 5IQQA 3KK1A 2YKNA 2DR5A 4C3MA 2RHQB 2NS1B 2ZM6J 4QU7A 4KH1B 4DX8H 1T0TV 2CNNB 2B5JA 1BLUA 1WHXA 2ZVIA 3D9BA 3WQPA 3V81A 3KDOA 2HVEA 1HI8A 1SL2A 4LQ9A 1Z4UA 5HVHA 3IAM9 4CI0B 4LT6A 4O44A 3OT9A 2UU9F 1WDTA 2GAHC 4U95A 3PKYA 5CAAA 3DCAA 1RKIA 2JEGA 4YHHF 2OEKA 2CG4A 2V4QA 4JI3F 1IBKF 4CWBA 3MUVP 3ENQA 4ED1A 1HIYA 2MJUA 3FKBA 3PRBA 2O01C 5D0GA 4IFVA 4R5PB 4U8VA 2HNZB 2FHJD 2E66A 3T6JA 3DOKA 1V9OA 2FJEB 3HT3A 3HFKA 4P52A 1JLGB 1YG0A 1JLAA 1RAOA 4ECUA 1VIXA 4A8XA 1MROA 3RR7A 5KFGA 4WFXA 2XO6A 3QLHB 2EXUA 4Y2AA 4KKOB 1JLCA 1VLOA 3K58A 2DBBA 4NLSA 3MEEB 2XLKA 1UETA 1NEEA 2IM2A 2R7SA 2UUCF 2PSZA 1UVMA 3T9ZA 3TNVA 3MAHA 3TQEA 3FC9A 4AUKA 2DNRA 3C66A 1RBLA 2D3ZA 2KJWA 2N3OA 3FJ2A 1FFWB 2WVBA 1KTVA 5JJBA 4IG3B 4LFCJ 1S9FA 4LRCA 3VGVA 3DLBA 1L3VA 2DGOA 4QR0A 2LDYA 4IO1A 3I4HX 3F56A 2LU1A 3NCRA 4WXWA 2CAJA 3S7RA 5CYJA 6FDRA 3H5XA 2F63A 3IBFB 3PY8A 2DRAA 4NX9A 5T7LA 1M0SA 2MZRA 3IS9A 1YJ9S 4M5DA 2HMIA 3D1OA 3OHBA 3K5OA 2HSEB 2V5HG 3FCWA 4KTQA 1KR4A 1UJ5A 2EW9A 1S10A 1RYSA 1N48A 2EFPA 1FX2A 5DLFA 5HROB 4H4MB 3H20A 4ES2A 1KD1T 4UF4A 1CC7A 3GFYA 2GVZB 4U96A 4DN9A 1XERA 1TL3A 2ZBCA 5E7OB 3FQKA 2XMKA 4OYAA 1S9EB 2QE5A 4OYXA 4DUTA 2F1FA 4DL7A 3GTYX 1QSYA 2F65A 3CCLS 3LP0A 1X60A 5L9XA 2K8GA 3QT5A 5KG7A 5D6GA 4R25A 1FDNA 3R2DJ 4DFKA 2FVCA 2HZVA 4GO5X 1GAOA 3QYYA 3MM7B 3GPAA 2XMMA 2A3JA 3HKWA 1PCAA 4DX5A 4DR1J
chains in the Genus database with same CATH topology
4O3PA 4JI2F 5D4NA 5KFXA 2CPFA 3HVTA 3OR2A 4HI1A 1KVIA 2W24A 3OL9A 2MKCA 2BRKA 3CCUS 2VBYA 4A48A 2AU0A 5EGYA 5F9NA 1G2EA 1YJRA 2A18A 3MFHA 3HHNB 5MAOA 1IKXA 4U67Q 4DUYF 4DSLA 2QLXA 1DRZA 1SJ4P 1WHVA 4JBCA 5F0WA 1XR7A 4FVCA 2CPDA 3VALA 1BC6A 3DOKB 2UV8G 1X5OA 2P9EA 2XNQA 2MPUA 3DXBA 3N01A 4EUVA 2EC0A 3PJWA 1JLBA 4Q0BB 2CQGA 3R5DA 3OTCA 3RTVA 3SEOA 3OVSA 2F40A 2HRUA 1F2GA 1U1KA 4URGA 4OJGA 3JSYA 1VOMA 1TKXB 2XI3A 2Z2MA 3N6LA 2DITA 2DISA 3ZZTA 1KVJA 4U6PA 3DRYA 1JWWA 4YB7A 2IA0A 5D78A 1HD1A 4A8KA 2YNHA 4F3QA 2IVFB 5F8GA 1HI0P 3DHWC 4KBIA 1VQ4S 2J6SA 4TYAA 2I38A 1HBOB 1VFJA 1SV5A 2JLEA 2DNGA 3UWTA 3HP6A 2APOA 3O1LA 3M9MB 4LFCF 3J7YU 3H40A 1VQPS 5H9EJ 4FPRA 3MOZA 1T05B 4M95A 3VZHA 3QGPA 1ZTTA 1WF2A 4M8LA 4PXDA 1FCAA 1DJ0A 1M1KT 2UVWA 5E33A 1HNVA 3GYXB 2X1FA 1WF1A 1HA1A 3OFFA 2J0WA 2HQIA 2PD1A 3I0RA 2HS0A 4L72B 4NYOA 1UMJA 1P1LA 2XS2A 2FJBB 2YX7A 4ZCMA 3ZFVA 3DFEA 3NMAA 2B6AA 1IKWB 1VS3A 4ERDA 2VC0A 2C2EA 4ED2A 3KK3A 3SQGA 2ZE2A 1H98A 3SI8A 4NCGA 4CH1A 3ZZOA 2DNQA 4NWBA 4EWTA 2E5LF 3DGPA 3DLJA 2OKQA 3RB0A 4FN5A 1C1BB 4KT0C 2B4UA 2RILA 1IXKA 3CD6S 1ZH5A 3HVRA 2BVZA 4OX6A 5FD1A 4I1TA 1FA0A 3VZIA 5GADI 3Q8SB 4A8WA 2R7RA 2D74B 4WFZA 2RU9A 1RYRA 3OL7A 3H8YA 3CCRS 4B17A 1S1WA 4DMZA 2EBGA 2HHWA 3PJXA 4O4GA 1Z2ZA 2HWTA 2ZH6A 1G1XA 1WG5A 2MY8A 2J7KA 1KNZA 5BYRA 1C0TB 3FEYB 3O8WA 5F8NA 1VRTB 3ITHA 3AH6A 4ETXA 4J9LA 1SKWA 2WONB 1HMVB 3U02A 2MHEA 3Q22A 1NK6A 2DNHA 2L3MA 5L39A 1NK0A 1LWFA 3H2UB 4QZVB 4RZRA 4IOAQ 2DIUA 1JLGA 5KFOA 2VKRA 3NGKA 4O23A 3J7Z5 3DOMA 4DV4F 2OFGX 3LP2A 2ZJQQ 1QAXA 1NNDA 1NH7A 2V4JA 2XWXA 3BM7A 3PX4A 4F2RA 2W7PA 4IQMA 4QWCA 2UUBF 4AL5A 4C8OA 4HEA9 1S6QB 3MMCB 5E2QA 2JOQA 4NLWA 4QIFA 5CXTA 3ENVA 3E01B 3QLHA 4OZNA 4CTAA 1HI1A 4ZCKA 2EFGA 4KKOA 4D3HA 5CA5A 5KFNA 2M88A 3KJVB 1TFWA 3TUIC 3IS9B 4FNIA 3I87A 1LWEB 3LOUA 3CPWR 2J9DA 2HMIB 3MEEA 2ZVSA