2G4BA

Structure of u2af65 variant with polyuridine tract
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
172
structure length
172
Chain Sequence
LGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of polypyrimidine tract recognition by the essential splicing factor U2AF65.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3'
total genus 44
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g4bA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g4bA02
2DH7A 1DZ5A 2XS2A 3MOJB 1U1KA 3MXHP 2HYIB 2MQMA 5LSOA 1WWHA 2DHSA 1JJ4A 2MKHA 2MKKA 3ULHA 1CVJA 3BO3A 1U1MA 4V19X 3R27A 5DDRC 1DHMA 2EK6A 1K8AT 1HL6A 1WF0A 2LQ5A 2RRBA 1X5SA 2KG1A 4LIRA 1M5OC 5GVQA 1VQKS 2MSTA 1H2VZ 1ZZFA 5GAGU 3N9UC 4IO9Q 2LKZA 2KXHA 2MY8A 2OSQA 1VBXA 2DK2A 3CULA 2L41A 3NS6A 2PEHA 4PR6A 2MKIA 3G8SA 2E5JA 4W92B 2CQCA 3S7RA 1KOOA 1N52B 3EX7B 1OWXA 2LXUA 1X0FA 1WG1A 2ADCA 2J76E 4WIIA 3S01A 2KXFA 2X1GA 5EN1A 2LEBA 3NNCA 2FC8A 3Q2SC 2U1AA 2MJUA 2EK1A 2RQ4A 3MUVP 1R8HA 1WG4A 1WHYA 4TLQA 3TYTA 3G71S 3K0JA 2JWNA 2DB1A 3THPA 2MZQA 2M2BA 2HZCA 2JVRA 3CUNA 3HHNB 1P27B 3LQVA 2CPDA 2G1DA 1A7GE 3BEGB 2F3JA 4OZ1A 1S79A 2LA4A 2CQ4A 2RS8A 1VBYA 4BS2A 4WCEQ 1JJHA 4ED5A 3I55S 2RQCA 3P6YC 1OIAA 1WG5A 2DNOA 1WHWA 1FJ7A 3R1LA 2M0GB 2M8HA 2CQGA 1UFWA 3ZZYA 1VQ9S 4QU6A 1YHQS 1L3KA 1WEZA 5DDOC 5D78A 1D9AA 2KN4A 2CQ3A 2G4BA 1K73T 1VQ8S 3B4DA 3H2VE 2LMIA 4QQBA 1H2TZ 1SJQA 1YJWS 2U2FA 4CH0S 1FXLA 3CCJS 2I38A 3VAHA 5ITHA 2I2YA 4WFNQ 3B4MA 3UWTA 2K3KA 4C7QA 1DRZA 1VBZA 2DGWA 5LXYA 2OSRA 2ERRA 1QVGR 3G9CA 2QFJA 2J8AA 3CXCR 1M90T 2BZ2A 2OTJS 3PIOQ 1VQ5S 2MZRA 2ZJQQ 4UY8T 2DGOA 2KI2A 2LCWA 3CCVS 4WF9Q 2CJKA 2N3LA 4Y0FA 3DXBA 1WI6A 1YWXA 2DHXA 1U1QA 2CQ0A 4J5OA 2MKJA 2CPJA 2J0QD 4WFBQ 1U1OA 2ADBA 1U2FA 2KVIA 4QPTA 3S6EA 2DIVA 1WEXA 3MDFA 4WKRA 1VQ7S 2F9DA 3PIPQ 2AYBA 1WEYA 1Q86T 2OIHA 2DGVA 1FNXH 1URNA 3RW6A 3VAFA 3VAIA 3MURP 5GAEU 1BY9A 4UQTA 2MHNA 2CPEA 1VQMS 3CCLS 5CYJA 5CA5A 1U1NA 2KT5A 1FO1A 4U67Q 1B7FA 2MGZA 2MZSA 2DGQA 3VAGA 2CPYA 2MKSA 2M4MA 2LEAA 3J7ZT 1ZZNA 2MKCA 4PKDB 2QEXS 5DM6Q 1HD0A 3H2UB 2CQ1A 5GMKa 1FT8A 2DHAA 2CPXA 2D9PA 1WELA 2RNEA 2AYMA 3SDEA 3EGZA 3NS5A 4F25A 3SDEB 2DISA 3UE2A 3U1LA 2CQBA 2M7SA 3G96A 1N54B 2DH8A 5DETA 2NZ4A 3UCGA 1VQNS 2FC9A 1YJNS 1WTBA 2N3OA 3OW2R 2M9KA 4C0OC 2LYVA 1H2UX 3VAJA 3SMZA 4Y00A 2FHOB 2DNMA 2YTCA 2HVZA 3CC2S 5IM0B 5D77A 3CMAS 1SJFA 1RK8A 3VALA 2XB2D 2X1AA 4IUFA 3CCQS 2X1FA 2X1BA 1P1TA 2ZJPQ 2CPHA 3MUTP 3UCZP 1PO6A 2MJNA 2JRSA 2MMYA 2SXLA 2KXNB 2V94A 3SXLA 4ERDA 3IWNC 1U6BA 5LSLA 1WHXA 4C4WA 2XS7A 2MB0B 1ZH5A 2AYEA 3NNAA 4LJMA 3CPWR 5CXTA 2DNYA 3FEXB 2J0SD 2MZTA 3US5A 1WF2A 5HO4A 4CIOA 3TP2A 4EGLA 2YH0A 4ZKAA 5DDQC 2D3OR 2OTLS 1WF1A 3U1MA 2L9WA 3G6ES 1VQ6S 2M52A 3R1HA 2OJ3A 2KG0A 3CTRA 1W2BR 4YUDA 2DITA 1VQPS 4A8XA 2CQDA 2MXYA 2VODA 5JVGQ 2XSFA 1X4CA 1VQLS 2KU7A 2N82B 4WFAQ 2F9JA 4CH1A 1YJ9S 3RW7A 3UD4P 2DNGA 2KM8B 2JX2A 2DNNA 2E5GA 2XS5A 4F02A 1U6FA 1X4FA 3MUMP 2L08A 2N7CA 2MZJA 2G0CA 1NU4A 1X4GA 2K8GA 1X5TA 5LJ3Y 1KOHA 2CQ2A 1VC6A 1Q81T 1M1KT 1YI2S 2GO9A 2RUGA 2EVZA 2KRBA 5HL7Q 1SJ3P 2MY7A 1D8ZA 3CCMS 2A3JA 3S8SA 3P3DA 2LXIA 3G8TA 5H1SV 1M5PC 1X5OA 5GAHU 1FJCA 3CCES 1OO0B 2MPUA 2RS2A 2KM8C 5IQQA 2DNHA 3NNHA 3CC4S 3DLLQ 1SXLA 2M70A 1FJEB 3CCSS 3V4MA 2VOPA 2HGLA 2LA6A 1M5VC 2YKAA 3LPYA 1WHVA 3Q2TC 1U1PA 4FXWA 1SJRA 3D2WA 2FY1A 2XNRA 1U1RA 1F9FA 3CF5Q 4P6QA 2QA4S 1JMTA 1YITS 1NJIT 2VONA 4IOAQ 5MLCV 2DNKA 1VQ4S 2DNPA 3VF0B 3NMRA 1U1LA 2B0GA 1K9MT 1KQSR 1PGZA 1X5PA 1X4BA 2Q79A 2DIUA 5BJRA 4YOEA 2O3DA 1OPIA 2MGZB 3CD6S 1R8PA 3J7YU 1G2EA 1X4AA 2RU3A 2E44A 2NLWA 1O0PA 1X4EA 3UCUP 3P49B 3BS9A 2DNZA 2XNQA 1KD1T 2HGNA 3VAKA 2DGSA 4F26A 3TO8A 3CMES 2DO0A 2KHCA 5IFMA 3CC7S 3IRWP 2CPFA 3BO2A 1UP1A 2MQPA 4OZ0A 2MQOA 2YWKA 4W90B 4RU2A 2DNLA 4FXVA 2PE8A 2ZJRQ 5LJ5Y 2CQPA 2KRRA 3EGNA 3P5TL 2RVJA 4LMZA 4TU7A 4PRFA 2KH9A 3VAMA 1HA1A 2VOOA 2DGXA 1NO8A 1AUDA 3MI7X 5DDPC 2KFYA 2AD9A 4CQ1A 4TU9A 1S72S 1N8RT 1X4HA 2MSSA 2WBRA 2MQQA 2JVOA 3ZZZA 2RRAA 2AYGA 2YH1A 1SJ4P 2DGTA 1VQOS 2BOPA 2RT3A 3CCRS 1QVFR 3I56S 2MQNA 5FJ4A 3MD3A 2DO4A 2MYFA 2MQLA 3UD3P 1VC5A 1N88A 5LXRA 1YIJS 2DNRA 4Z2XA 3HI9A 1IQTA 2KYXA 2LECA 2FPHX 2CPZA 2GHPA 1UW4A 3JB9k 4YB1P 1HD1A 1KC8T 2M88A 1Q82T 3BO4A 3FEYB 3MD1A 3L3CA 3CCUS 1DBDA 5GADU 1XN9A 1X4DA 1A9NB 4QU7A 4TU8A 2D9OA 2E5HA 5IM0A 3THTA 1Q7YT 2DNQA 3G4SS 4IOCQ 1H6KX 2E5IA 2UP1A 1FHTA 1VC0A 1UAWA 2CQHA 1QM9A 1WI8A 1M5KC 2HGMA 4M5DB 1RKJA 5DM7Q 1YTYA 2CPIA 2M8DB 2DHGA 1JJ2R 2CQIA 5JVHQ 2MZ1A 2DGUA 2DH9A
chains in the Genus database with same CATH superfamily
3MOJB 3GSIA 3LH2S 1LW2B 3MXHP 4WJBA 2HYIB 3MOZA 2KT3A 3CVKA 5LSOA 4AQYF 1WWHA 2JHEA 2YNFB 3GFYA 4B9LA 3M6XA 1NLKL 5D0HA 2IJRA 1R27B 2MKHA 3QAEA 1JJ4A 3KK1B 1HWUA 4GVBB 2MKKA 3K59A 4MIBA 2R3VA 5SUHA 3W2WB 1LWFB 4P2MA 4USKA 3FBCA 1K8AT 1HL6A 2HMIB 1WF0A 4MIAA 2OFHX 4JI1F 2AHOB 3SCIE 2QSFA 3D6TB 5F8NA 2OPPA 2AW0A 3KHLA 1TKXA 5I3PA 2RRNA 4RWXA 4RUHA 1H2VZ 1ZZFA 5GAGU 3UR3C 5I3QA 2LKZA 5CABA 3KNGA 2OUGA 4ZIWA 2M3DA 3I96A 3M2VA 4DSIA 3ENWA 2E9RX 4JV5J 2HURA 1R31A 4FNIA 4ECUA 1IJFB 3B6BA 3MCOA 5D4PA 3ADAC 2HQIA 1JLAB 3HJVA 1WDDA 1KQKA 1GTEA 4USJC 4PYAA 5IV3A 1H98A 2FJAB 3MCSA 1FF2A 4USUA 4G6VB 4PR6A 2XLIA 3MAQA 2ZHBA 4WFYA 3VGSA 2W01A 2BA9A 2C2EA 3KTQA 4FF4A 3RUBL 4X4SA 5U47A 3NGDA 2CNOB 4W92B 3FMBA 4I6AA 5KG1A 2DKOB 1LV5A 5JXSA 1WG1A 3KUEA 3PEJA 4WIIA 5K5MA 2KXFA 1JXLA 2B9YA 3AODA 3L7PA 2LQJA 2LEBA 4NLQA 4OZ3A 2GMLA 4AQYJ 3Q2SC 2F40A 2QMWA 1LXNA 2U1AA 4MYUA 4Q2LA 4AL6A 4ZLLA 4OX7A 1TFWA 2R7UA 2EK1A 4ZVSB 1MWYA 1RJJA 4DPWA 4NWBA 4OI6A 4WTOB 1RYRA 2HVHA 1RT2A 3SV3A 3NP5A 2BANB 3TYTA 4LF4F 3G71S 3LWLA 5J2PA 2HIQA 2JWNA 5L39A 3P8BB 3FSIA 2MZQA 2BW7A 2JEGA 3IS9A 4O44B 3C66A 5E33A 4DQQA 5JUMA 4G1QB 1P27B 3I82A 4B3RF 1S97A 1GMWD 2W1BA 2ZNZA 2FTRA 2R9LA 3OR1A 2IC3B 2LA4A 4Y65A 3MFHA 1VBYA 2FLPA 2C3OA 4NXNF 2RE1A 2RKIB 2EW9A 2AP6A 3EJMA 2V4JB 4UTGA 3W8PA 2Z2ZA 4K4XA 2BOAA 2RQCA 1S6QB 3OTCA 2G13A 4ILMA 1JNRB 3MM6A 4FF2A 4G1IA 3IBFB 4IR1A 1RCXB 1EAYC 1VRTB 3CD0A 3K2YA 1D9FA 3O1LA 1WHWA 1XK8A 1NPKA 3M6VA 3PEHA 4EBCA 3BB5A 2M0GB 2V63A 3GILA 3R1LA 3W3SA 3SCJE 5J2NB 3MPYA 2GHWA 1HQEB 2F65A 1IKYB 1UFWA 3MMBB 3ZZYA 4YHHJ 1CULA 1NZ8A 5IT0A 3MPDA 3H40A 1HBMA 1FWLA 1QSYA 1KSPA 3VQTA 2J7UA 2E66A 1SH0A 1VYAA 4DPUA 3T6BA 1JJCB 3OTOJ 3I4HX 1U2CA 4QQBA 1QTNB 2VG5A 4DFKA 2D3UA 3CWJA 3D6FB 1SVDA 3IAS9 3SQOP 3ZXWA 5KG4A 2HLUA 3BPSP 3ZNUA 2V8VA 3DC2A 3GFXA 1SJQA 3JSRA 1XTZA 3MEEA 3HD2A 3IRXB 4OJGA 4CO1A 1YJWS 4RL1A 3KG0A 1FXLA 5DQHA 1HPZB 3HSGA 3DYAB 1FXRA 3QIDA 2D69A 2XG8A 4WFNQ 3E01B 3ILLA 3UWTA 2IYIA 1VS3A 3TVKA 5AXLA 1FDDA 3SQGA 2R2UA 5C42B 4NA2A 4QWBA 3DMJA 2YXLA 2UV8G 3EVWA 3LPEA 1QY7A 1S9GA 4P2XA 3WHIA 4B3TJ 1FJGJ 2E1RA 2QFJA 1W7WA 1FRMA 1TL5A 2BZ2A 1P1LA 2BEFA 3DLGB 3CXCR 3FBEA 4FKYA 4AUKA 3QRPA 1VQ5S 3G6YA 1HBUA 3M32B 1T11A 2VBYA 2XBPA 2XLJA 1VDHA 1WKLA 2B4UA 3BKTA 3G87A 2LCWA 2IRXA 3Q83A 3VGTA 1CLFA 3NWRA 4JI3J 1BQNA 3CCVS 4WF9Q 4U7CA 3DMJB 2N3LA 3BGUA 2VFUA 1SV5B 3AAWB 3FQLA 3OBIA 3KNAA 4A8KA 4NRUA 2UXCJ 4WP8A 4Z7CA 1BWEA 4ZPCA 1F5CA 3KK2B 3TA1A 5CZVA 3RZAA 3PZPA 2Y3YA 2OPSB 7FDRA 4B9UA 4OZLA 1U2FA 3QSIA 1RWUA 3M2UB 1SI9A 4U8YA 1V3SA 2JC1A 4F3QA 2JH3A 3KLGB 3AB2B 3VQSA 4MKBA 3S6EA 2CZ4A 2EFVA 4NXMJ 1OS5A 1N32J 1WEXA 4DFMA 3PO4A 1VQ7S 4A8OA 1UFLA 4IO1A 3PIPQ 1WEYA 2HBYB 1F3FA 2ZH9A 2AYBA 1URNA 2NZCA 3M2RB 3AXKA 1N5YA 4C8OA 3FZ2A 4LVNP 1BMQB 5GAEU 1GX5A 1R89A 4PPDA 1BY9A 1T9XA 2ZFHA 3HHLD 4ED2A 1VIOA 5DG9A 2WONA 5B0GA 3K89A 4GC7A 2AWZA 5KT4A 5HANA 1VQMS 1URRA 4OZJA 3GYNA 3N79A 5CYJA 2BE7D 4LBPA 5KFLA 2B8QA 4U67Q 3FK4A 2H51B 4B3RJ 4XTTA 1C2PA 2FJXA 3FUYA 1FRIA 2PMHA 1QSSA 2VBXA 4LFBF 3J7Z5 4B08A 2E7XA 1SQGA 2CG8A 2CJ9A 1TV6B 2FUG9 5ETRA 2DR5A 1RU1A 2YNHB 4RW7A 3P96A 3ZTQA 2V34A 4A46A 4K4WA 2A18A 2VH7A 4PYDA 4NCGB 1VLYA 1NMEB 3JSMA 3H2UB 3DOLA 1RTIA 1FT8A 1J27A 2CPXA 1WELA 4LRCA 1FJ7A 1MN9A 4DX7A 3MECA 2MDAA 1GAOA 5AXNA 5KT2A 4C11A 1TMJA 3NS5A 4F25A 3SDEB 5M2UA 2DISA 5CQGA 4DSJA 1VBKA 2QMUB 1GH8A 2OPRB 2CJXB 3T1AA 1G3OA 2HVDA 2HZVA 1HWIA 3U1LA 3GB0A 4UOGA 2E1AA 5KT5A 1S1UB 1F3VA 1NSAA 1FX2A 1NPPA 2M7SA 2W4CA 3C14A 3FRYA 3HDSA 3DI6A 3UDVA 4F3OA 3AA9A 1N54B 4HI1A 1AZSA 2ZOMA 3DLHA 1YJRA 4GKKF 5D4OA 4DV7F 1X9SA 2YX4A 2GS8A 3BM7A 5IT4A 1YJNS 2MQ8A 3QZ7A 3HP6A 3HLUA 2E5LJ 3K5PA 3I0RB 1N4LA 3KDOA 1EIYB 3M8YA 3A3PB 4N47A 2DT9A 2XO6A 4RW6A 2NYIA 1NB2A 1Q0NA 1XMOF 2OEJA 2YBVA 3H8YA 4H4KC 4C0OC 1NJYA 2YWGA 1NKCA 3I0SB 1WNEA 2BKPA 5BYRA 4DV6J 4LFBJ 1JXVA 2ZC3A 2CZVC 3CJ3A 4FBTA 1Y3KA 5KAKA 4NLWA 4B3OA 1RAFB 2DNMA 4DFPA 1NDPA 2ZBQA 1M1GA 3C2PA 1U48A 3CMAS 2Z2LA 3OXLA 4IH5A 4OI2A 2L9DA 1PG5B 3U27A 1CC8A 1F9EB 5A8KB 2CJQA 2X1FA 2X1BA 1CEZA 2YPYA 5DLFA 3UCZP 4JBCA 5ADZA 2W7OA 3HSDA 3FEZA 2KXNB 3PJWA 4B3SJ 3C6TA 2VDHA 3CJRA 2E7WA 3RAQA 4NI2A 3RR7A 2XYHB 5I3UB 3D28A 1JKHB 1OY9A 4X4UA 2OPSA 2XI2A 2RKIA 2N7YA 4N8NA 3MHYA 4ICLB 4NA3A 4FDFA 3V6JA 1IBKJ 4LJMA 4X62F 2Y1RI 1CSJA 5CXTA 2VF3A 1RT2B 3FEXB 3TA0A 1RWPB 2IHR1 2MZTA 5D0RA 1WF2A 3PRVA 3W2VA 1FD8A 2HQ3A 3G86A 1S1XB 2HHPA 4NMLA 3LALA 3TJ8A 4ZLJA 2AIRB 2WBMA 1LWCB 4ECRA 4HVZA 2AKWB 3CO9A 1ZM9A 4DX5A 3KDNA 4LF7F 2L9WA 2WOMA 3JYTB 2QYGA 2PI5A 4NLSA 2OLWA 3T3FA 1ICEB 3D6MB 3H90A 3N4WA 1RT7B 4ID8A 4RKUC 5C7PA 1J5EJ 1XNQF 2PMWA 4DV4J 1GQEA 3CTRA 3GIRA 1FFSB 2LEPA 4CO5A 1DTTB 1U0SA 5ETOA 1QSLA 5DRKA 4A8XA 4BC7A 1YJVA 2MXYA 3N0VA 2Z30B 2VODA 2DCUB 2EKNA 3GJQB 3HSJA 1T03B 3DYAA 2WVFA 1C1CA 1RHMB 5KFNA 2F9JA 4OI1A 4ELUA 1HMVA 4CH1A 3BDPA 3H4DA 4CH7A 1VQYA 1HNIA 3LAKA 5DO2A 4GKJF 2VV5A 5DLGA 1FWKA 3M9OB 1Q53A 4A8YA 2XS5A 3ZZRA 1HHQA 4F02A 4HR2A 1JLAA 1U6FA 2J9CA 4TY8A 4MTPA 2L08A 4K4SA 1E6YA 3CW2C 2G0CA 2YVSA 1C1BA 4L76A 4WPAA 3UDLA 1NH7A 4DR7F 4RW4A 4EUVA 3JAMY 2FGOA 3W60A 1RTJB 2B4VA 2CQ2A 2LLZA 2YKMA 1TP7A 5A8RA 3W9JA 1K0VA 3ENVA 2UUBF 1D3WA 1KFSA 4NYPA 1T7PA 4RW9A 3MMJA 1HNWJ 5FIIA 4CDIA 2OO4A 3BH6B 2UXBF 4J9QA 3D0IE 4AXJA 3HM9A 5K14B 4IRKA 1FRXA 4KC5A 2MKYA 4DSLA 2D74B 3AA8A 1T0TV 3RJMB 2YQ1A 1RTIB 4KH1B 4NLYA 2OP5A 3DM2A 2RS2A 4Q0BB 2NXCA 2KM8C 3LA0A 5KFHA 4NXNJ 3CC4S 5ETVA 4PUOB 1WOPA 5J2PB 3BQ2A 1FJEB 1C1CB 3V4MA 2AEFA 1UVJA 2VOPA 5HATA 5ETNA 4JI6F 4X4RA 4KGKA 1U6ZA 1N34F 1M5VC 4PABA 1IKXA 4JV0A 2VA3A 8AT1B 4FNHA 3LTOA 5E3PA 3JS9A 1GNKA 2W2QP 3F0NA 4RBVA 1S6PA 3PG9A 1SJRA 3D2WA 4HYKA 4DL3A 4B9VA 3FSXA 2FY1A 4K50A 4C6AA 4PG8A 4H54A 1NK7A 1WC0A 2HS3A 1BC6A 2XY7A 1F9FA 4NPOA 3PYFA 1UMJA 4IQMA 3MTJA 3FZBA 4ZCKA 1I51B 3R6LB 4H4OB 1I5OB 3R7NB 1NJIT 4I2PB 1MROA 3GR1A 5EUHA 1NK9A 2VONA 5IOLA 2A6OA 2RQMA 4LRBA 3MM5B 4YP3A 4OJ1A 1D1UA 3TAMA 2WTFA 2W25A 2FHKA 3MPUB 2OGUA 2GJFA 2IDLA 4RBTA 3TEHB 5H9EK 3NMRA 4F50A 3DFEA 3KLHA 3GMGA 2XMMA 1KQSR 2I9SA 2X7IA 1ZAXA 4DR3J 3KUHA 4NYZA 1EKSA 2Q79A 2AJ2A 2DIUA 1V5VA 3ETOA 5CYMB 4ZPVR 3MR7A 1VFJA 2VG6A 2V2KA 3WDOA 4CYUA 4DV7J 1R8PA 3J7YU 2F8EX 3QRQA 4NMXA 1LKZA 1GMWA 2WVCA 2NXUA 3DRSB 2HKEA 1KQFB 3J81j 2YKQA 2ZH3A 3UNGC 1TUGB 2DNZA 3W62A 1JLEA 4MAKA 2AJFE 2DGSA 4DV1F 3W2WA 4OYXA 4DS5A 2DEJA 4JV2A 3I87A 3L95X 3CMES 3MCMA 5DJBA 2KHCA 3DHWC 3KLVA 3ISNC 1CJKB 3TX8A 3CC7S 6FD1A 4RW4B 1RA6A 2WVEA 3BF4A 4HI2A 3GE9A 1N0VC 4OZ0A 3HVWA 3KLIA 4X84A 2MQPA 2V4RA 4W90B 1I3OB 2QL5B 4BC9A 4CNZA 1RT1B 4N56A 3FVYA 4OX6A 2W2PP 5J2QB 2JFDA 1FXDA 4B9SA 4MYTA 2EXUA 4LREA 3W5YA 2ROPA 4ANCA 1KVKA 4HTIA 5LJ5Y 2YX1A 2EC2A 3EGNA 3FGVA 3HHLC 4EO8A 4DV2J 2E9TA 2H4YB 3VGUA 2ACMA 3Q22A 4DR1J 4TU7A 4PRFA 1B7YB 4DR2F 3OUYB 4NLTA 4WFXA 4G3IA 4WE1A 1HA1A 5L1KA 4K2JA 1NDCA 3V81B 4BCAA 4JI7J 3X1LB 3M8PB 1R0CB 1Q16B 4Y2MA 2XMJA 3R5GA 3MI7X 5DDPC 5F8JA 2C42A 3D68A 1GT8A 4TU9A 1DLOB 4UOCA 2GCFA 1S72S 2NSBA 2PFFB 3H7HB 4KO0B 2MQQA 3G82A 1S1TA 4LSNB 3V2UC 2JVOA 4DX6A 1U4BA 4DR6F 1H72C 2R2TA 2DGTA 3N5BA 2YH1A 1VQOS 3M30B 1VC5A 1S4FA 2AZ3A 2XHCA 3I56S 3M6WA 1IQZA 4TQRA 4MH8A 1UVMA 5AE1A 2LQ8A 2NSCA 3M8PA 1JXEA 2DO4A 3CJ2A 3MM6B 2GNKA 5KT6A 4KHMA 4DF4A 3UD3P 1S6QA 4LF5F 1JB0C 1N32F 1Q79A 4WIQA 2BV3A 1RBAA 1KTQA 1C0UB 2BVZA 1YDLA 2VFVA 3I5CA 4EI2A 3HI9A 4FZVA 1O51A 4J9RA 3RTVA 2EC0A 4ZJLA 1IQTA 3NAIA 1LWEB 1NK4A 4X4TA 1IBKF 4EZ9A 3NGRA 2F63A 2M88A 2XMTA 2YWWA 3IMQJ 3ZNJ1 5T14A 1IBMJ 3BO4A 2BJ1A 3MTKA 3H5SA 5DQIA 5KFDA 1VISA 2BANA 3D1QA 5IC6B 3I5AA 2QE5A 4B02A 1XN9A 1X4DA 2E1PA 4CLWA 1HNVB 4GVLA 3RB3A 2W9BA 4DBQA 1Q7YT 1T05B 1XC9A 3BGOP 3LW5C 2IM1A 5KT7A 4Q5VA 4ZVTB 2G0IA 3G4SS 4DPXA 4ZVPB 4F0MA 2W2MP 4NA1A 2GMJA 2AJ1A 1RT5B 3H42A 2BBEA 3PYGA 4DU8A 4UZBA 4ECSA 2GAGC 1ZETA 2BOPA 3OSNA 3OQ2A 3ENAA 5HMYA 2BXJA 1VC0A 1U25A 1UAWA 2V9WA 2KL8A 1QM9A 2MLYA 1TL7B 3UFCX 4JI2F 2RILA 4CLSA 3M05A 4LUBA 3W7BA 4O3SA 1YTYA 5FDLA 2DXDA 2DHGA 2Y1JA 2CQIA 3BKUA 3TUJC 2OPQB 2Z4PA 3D1OA 5JVHQ 2EFPA 5L1JA 2MZ1A 3Q8RB 4L6V3 2IMOA 5KFUA 3PKMA 4NASA 4LF8J 2DH7A 1F2HA 1I6JA 4JI0J 2ATCB 4CO2A 4UT4A 1U1KA 4OZ2A 1RT5A 2MQMA 1YJTA 2HRTA 5HI7A 3RAMA 1ZM2A 2HEKA 3SBMA 5D6GA 1D0EA 1O8BA 1KTVA 2DHSA 2LFVA 2BMBA 2Z2YB 5EGYA 4M95A 3UO0A 1AUSL 2BUNA 4NLVA 5K14A 2UUTA 4YS2A 3ULHA 3J81Y 3HPOA 3BO3A 4IG3A 3R27A 3QZ8A 3HXMA 4PXBA 2UV8A 2EK6A 1G1XA 3R2DJ 2ALYB 2KO1A 1M5HA 1PAUB 3ETMA 2RRBA 2VHGA 3W66A 1Q78A 3W9IA 4LIRA 5A8RB 4NLXA 1SJ1A 5GVQA 4F67A 4R0JA 2OEKA 1WKKA 3CD7A 5D3GA 1VBXA 2OSQA 4M1KA 4O4GB 4A8MP 2JEFA 1G6BA 5E3AA 4DR5J 4Q7AA 2FLOA 3E8OA 2B43A 2R42A 3B82A 3I6PA 2PFDA 1DQAA 2EFQA 2AJQA 2DR9A 2HFSA 2PEHA 4E8UA 5IS2A 1FNOA 4KY3A 4LR8A 1LWXA 2D7SA 4ED0A 1ZBTA 3MM9B 1MU2A 4ZP9A 3HO1A 3JXOA 4ZVGA 1N52B 3S7RA 1K1QA 3PXGa 4RNOA 2LU1A 4LBHA 4IRDA 2XY6A 5KFTA 2ZH1A 2UU9F 4LF4J 2R7VA 3BR9A 4NE9C 1X0FA 2ADCA 3BPDA 1UZHA 1IWAA 1V9OA 2R8KA 2J76E 4KGXB 1EZZB 1F5BA 2J0WA 2X1GA 4OYZA 1DTQB 2WB4A 1TK8A 2DJWA 4RWWA 2UUBJ 2ZNYA 4WBFA 1NKBA 4Y28C 3NNCA 3OJSA 2FC8A 4PG5A 1IWGA 2PO4A 4NRTA 3C6UB 2KKHA 3KYLA 5LOQA 1CC7A 5H9EJ 3TQEA 1SL2A 4JI8F 1R8HA 1Q8IA 2EG1A 3HSZA 3MPVA 4I64A 5HVGA 2CVEA 2A0FB 1RTJA 1WHYA 2YKMB 3W5XA 1YGYA 3PM9A 3M8RA 1XJWB 4R8UB 1GXLA 3LGMA 1X9MA 3K0JA 3OJUA 4LF6F 4GKJJ 2M2BA 3EGVA 2HZCA 4DPTA 1YKWA 4AYBD 1HNXF 2HHHF 4ZN1A 3DGPA 3I9ZA 2GMHA 3NLCA 3GIIA 4NCAA 4BS2A 3P4UB 4R25A 4AL7A 1S1WA 1T3OA 1VOMA 4WFZA 4DUZF 2J9EA 5HMWA 5CD4H 1KC8T 1MN7A 2EKYA 3I55S 4P75A 3FCWA 5FD1A 4ED6A 4OHZA 2KZZA 2F5GA 2HFUA 3GLJA 3Q8UA 3GSDA 3QATA 3W5ZA 3DRPB 4HKQA 3UN5A 5C25B 4JI1J 4FVMA 4GO5X 5ETKA 2R2RA 9ATCB 4A8SA 4M5GA 1PCAA 1F60B 3SQGB 1PSDA 1MMNA 4EK2A 1SUQB 2RHSB 2EBGA 4DL6A 4QU6A 1L3KA 3BGLA 4N41A 3IG1A 2VJVA 1A0OB 3H0PA 2YNFA 2G4BA 4DV5J 3RBXA 3H2VE 3PO5A 3N01A 4LRDA 1RWWB 2XZWA 4NX9A 3W65A 2QX0A 4FKXA 1AROP 1WDTA 2HIYA 1HMVB 1QAYA 4ALZA 5H9FJ 3K57A 4UQGA 4KKOA 2I38A 2D41A 1TKXB 2FY8A 2FJBB 5HK4A 2PI4A 4MJKA 1RTZA 3B4MA 4LSLA 1CJUA 1GEHA 3GWCA 1HQEA 3ONQA 5F41A 2DPIA 2F4VF 4ZN3A 1DRZA 1C4AA 2DGWA 2FJEB 4YR3A 5I3UA 1Q1KA 2OSRA 1AZSB 4DG1A 4ES2A 4LSZB 4ZPAA 4A4JA 4EYIB 5KG7A 1QVGR 3RRKA 1T3NA 1M90T 4HT7A 2OTJS 4EWTA 3D67A 5KFWA 3TEGA 1NAQA 1VK8A 2HWHA 1KLMB 3PX6A 1SKRA 2DR7A 4RUCA 1DQ9A 1UTAA 4QR0A 2NXNA 1L3UA 1E6VB 1NSPA 1OQ3A 3IR5B 4DQIA 3LGHA 2VPYB 4KFBB 3MECB 1RCOB 1XQIA 5GAHI 4RBUA 4JI0F 5AE2A 1Q95G 5C24A 4O0NA 3DXBA 1EKRA 1LOUA 3HZGA 4NL5A 1RWOB 5GMEA 5DG8A 1U1QA 2CQ0A 2W8LA 1U8WA 2CPJA 2XHWA 3OFGA 3VZIA 3PW0A 1SQEA 3ITHA 4J90A 2ROGA 4OX8A 2COLA 4IDKB 4OI4A 1SPBP 1U0HA 3ET6A 4QPTA 1RT6A 3T5LA 3W61A 1AA1B 2XO7A 3HVRA 1W26A 3OT9A 5HROA 3D0GE 5AJ3J 1IBLJ 2WRMA 3A8EA 3PTWA 2DIVA 2GGPA 3GONA 4FYVB 4C8MA 4J9SA 4WKRA 3BBFA 1F5AA 4Q2MA 1Q86T 3HHLB 5L8RC 1KHVA 1FNXH 2DVIA 4JI8J 3VAFA 3VAIA 4M5KA 4DXLA 4OYBA 3AJDA 4UQTA 4C2MA 2MHNA 3AQPA 4ILRA 3T1YF 1MSWD 4B3OB 5LMNF 1N5TA 5LL6d 1QAXA 4MKYA 1RYSA 3BSAA 1FK9A 4TY8B 3HT0A 3Q8SB 4PAAA 4PWDA 3FSYA 3W9HA 1PC4A 3EGWB 4CLPA 1C0TA 1GXTA 2I5JB 1FO1A 2KT5A 3DCAA 3GCWP 1RWXB 3SIPB 2MGZA 2E29A 2MZSA 2PDAA 4PCQA 4XAKA 5KFZA 4K4TA 3WC2A 4M8LA 2DGQA 3OHBA 2HQCA 5EX0A 4JI4F 5M2RA 1WUUA 2DXFA 4LFAF 4ECWA 3KJVB 1QAIA 2CNNB 2LEAA 3MM7B 2MLZA 2WCXA 3CE8A 2QMXA 2ZM6J 4ED8A 1YK9A 4DFJA 2VFRA 2QYCA 5KFIA 3PW7A 1N36J 4URGA 4JV5F 5GMKa 1O5JA 3DN9A 1TL7A 1UPMB 5L9XA 4CLKA 2ATLA 1X60A 3CJSA 3H5XA 1TUVA 2AJ4A 3DRPA 4OMFG 5DGAA 2ZEJA 1OSCA 2IIHA 3NY0A 2YNIB 4Y2KA 5BYQA 3KLIB 3SDEA 3Q0AA 3EGZA 3UE2A 4OIXA 2ZVIA 4ELVA 2HFVA 2KB2A 2OPRA 3QIPB 4RX6A 3ZZPA 4USIA 4DV4F 3MEGA 4FS1A 1RT4B 3KG1A 1N33J 1NK5A 4OX9J 4QW8A 1LFWA 2D3ZA 2DH8A 3T5HA 4PQAA 5B7WA 3R3TA 4DR2J 1FESA 3PVXA 2PA3A 3GFZA 3TZZA 2J6TA 4OV6A 4FXDA 2WZ1A 2KFZA 2HNYA 1WTBA 1HBNB 3MZIA 3RRHA 3GIMA 2GJ2A 4I69A 5FDLB 2K3IA 3SI8A 2UUWA 3CT9A 2WSCC 5DS7A 2CAJA 4QBUA 3SSRA 1T94A 5A6PA 5BXIA 4I68A 3PX0A 4XDDA 3IXQA 3NCPA 2QA2A 2AX0A 1SH3A 2HK2A 2YNHA 3C6TB 3LP0A 4RW7B 5D4NA 4F4XA 5HP1B 5D3GB 2DCLA 2UUAF 3KOAA 1XERA 1DY3A 7AT1B 3C6UA 1QE1A 4RUAA 4DV3J 2VFTA 1SV5A 2UVWA 4KGVB 1TQLA 2BE9B 2IAJB 2YTCA 2HNDA 5HQ8A 3H25A 3CC2S 2BQRA 1HNWF 3HD1A 1SJFA 4ZMMA 1PAEX 3DRRA 4HH1A 3VZHA 2QFIA 2X1AA 3EPGA 4DV3F 2R8JA 4ZP7A 4NLRA 2CPHA 4WK1A 2JRSA 1DLOA 1XMOJ 4RUBA 2J9DE 4Q8FA 2QIFA 4QR2A 3SXLA 2ZH2A 1S9GB 2P9GA 1U6BA 3IWNC 4K0KF 2HNZA 2K7JA 4CO3A 2AT1B 3R9LA 4YN3B 3U7JA 2ZOGA 4U95A 1KNZA 3QFWA 4RW8A 4ES3A 1IVZA 3UW1A 3LOUA 1F0XA 3NNAA 2MTLA 4JI4J 2KYZA 3EUNA 5CAAA 3T1HJ 4CTAB 3OTOF 3OW2R 5A2QU 1K47A 4DV1J 4L72B 1VMBA 2R7XA 3CCZA 4CIOA 2YH0A 4O23A 3OD2A 3POTB 1QLNA 1RB0A 2H9ZA 1TVRA 2X3GA 3HHDA 5DDQC 2OTLS 4LIWA 4USMA 2W7PA 3BN4A 3D7SB 3CB4A 4USTA 4U96A 4D3GA 3NGUA 4PXEA 4KHPJ 1CBKA 2BM1A 3D6HB 5HJYA 2KG0A 3QT8A 2DITA 2LU2A 1VQPS 4ITSA 3DOLB 2J5AA 4LF7J 1WTFA 1NM2A 4L74A 4QJVA 3JSMB 4DV0J 1QVFR 3X3UA 3DOKA 2ZM6F 1RHKB 2N82B 4X66F 4E0DA 3RBDA 1FRJA 3MEEB 2QSWA 1YJ9S 1NSQA 4TLRA 4MKAA 2Y0SD 3QWUA 2KM8B 2WSFC 3PW5A 2DNNA 2FLLA 1N0UA 1MMLA 2XMVA 3G2XA 1OMSA 5HVHA 4D3HA 3BYRA 4DV2F 2Y1IA 3ZZUA 2C2DA 3C16A 2X51A 1S0MA 4HDGA 4ZDNA 1X4FA 5CYMA 5KFEA 4C8ZA 3MUMP 3M30A 2MZJA 3TA2A 2AEJA 3CJ5A 2DEIA 4XPCA 1X5TA 2O1PA 1KOHA 4B9NA 3DRRB 1M1KT 2OPPB 2GO9A 3KHGA 4KFBA 2K7KA 2KRBA 1RISA 5HL7Q 1Y11A 5T7LB 2V67A 3DLBA 2Y8YA 2C2MB 2M5YA 5J2NA 1MROB 4O3RA 4BHQA 4NEZA 3E2EA 2YWFA 5E7OB 2EFOA 3R5BA 1RWMB 1PBUA 2JC0A 2K1RB 3LUYA 1RT6B 3LF0A 3VVUA 5MAOA 5H1SV 1X5OA 1YBUA 3OUYA 3JQJA 3OTDA 3SFUA 3CCES 4OHYA 1FJCA 2YKPA 4NLUA 1JK9B 1OO0B 2DRDA 2MPUA 3CD5A 4Y6IA 2XQCA 5DG7A 3IS9B 1N36F 4MK7A 5IQQA 3C46A 3DLLQ 1SXLA 3TUPA 4XIUA 3T5JA 1WJ9A 4K4ZA 1RAAB 5J2QA 5AE3A 3QSYB 1CJVB 4YB7A 3DHXA 4L75A 2LA6A 2AGOA 2GZOA 2G0JA 1WHVA 3T6JA 4QW9A 1S6UA 2R8HA 2QL7B 3CDBA 5HVFA 4KYZA 2PEBA 4AE5A 3DLGA 2HQGA 3VVTA 4X4PA 3QMQA 2YNIA 1U1RA 3OSPA 3MAAB 1RT3A 4P6QA 3R5AA 2HMIA 2IPOB 2NUUG 3C8YA 4QIVA 4IOAQ 2O5DA 4DUYF 1BQMB 4NLOA 4GMKA 3WQPA 2VIHA 2I1RA 2KTQA 3PDNA 4ELTA 1UA1A 2DNPA 3DDNA 1S77D 2QO3A 4OQJA 2B0GA 1CPZA 3FCHA 2B5JA 4X65J 1K9MT 4O4RA 3NGTA 3VTIA 4JOUA 1E6YB 1S59A 1TAUA 1X4BA 3MM9A 1FX4A 3CDAA 2K06A 4ZVOB 3WX4A 4DR1F 2B9XA 2O3DA 1OPIA 1YBAA 3CCWA 4PWUA 3CD6S 4DLEA 2H65B 1Z4UA 2AZ1A 2WK4A 2AEMA 2XZDB 4FVCA 1X4AA 3IWXA 3MMCB 1LEOA 4KH0B 3PR4A 3DU5A 3M2VB 2NLWA 1O0PA 2J0XA 1X4EA 2ZDPA 3GV8B 3UCUP 3BS9A 1IR1A 3CJ8A 4M63A 3R2CJ 2XWYA 4Y3CA 2HGNA 3VAKA 2VG7B 2DRAA 3IO1A 4P71A 1HIYA 1PJ5A 3M8WA 5HJXA 4CLTA 1J5EF 1XWLA 3KJFB 3TO8A 3FNNA 3TZYA 3BSOA 3C14B 3DXSX 4F4KA 3V6HA 4I67A 1I1GA 4F3MA 1ZOTA 4DUZJ 3AY0A 1T9YA 2MQOA 2UXDJ 4H4MA 4TNOA 4DV6F 3GPAA 4K4UA 5KFRA 2IM3A 1EHWA 5KFPA 4YFUA 3POTA 2DNLA 1LW2A 4FXVA 1HFEL 2ZJRQ 4IFVA 1LXJA 2CQPA 4JUZA 2F4FA 4I6WA 3TR5A 4F4AA 2FVSA 2RVJA 2IJNA 2VA2A 5B0DA 3TANA 2DY9A 2KH9A 4KRWA 4LF6J 4ICLA 3I5BA 2HW3A 5L46A 4PG7A 1GX6A 4I2PA 1H7WA 3PRBA 2XZTB 3DOMA 1S5ZA 4ED7A 1M0SA 1UJ5A 1CS4A 1TKZA 2W4PA 4HTJA 3L09A 4QIGA 2VPZB 4OYWA 4DG1B 2ASYA 1FVSA 1Y5IB 2VG7A 3TVZA 1B64A 3BN7A 1VCTA 3MMAA 1X4HA 2WBRA 4CO0A 1IKVB 5IXUA 1CJTB 3G6XA 1C1BB 2RRAA 1XMQJ 2AYGA 2HNDB 3LANA 4CCHA 1MWZA 3E51A 3D1HA 3GYGA 4WXOA 1YBTA 5RUBA 2RJZA 3J7AN 1VHIA 4LBIA 2ILYA 5KG6A 2MQLA 4IYQA 4J9OA 5KFQA 2NREA 5I42A 3N28A 2R7QA 4Z2XA 1RWKB 1X0PA 4ER8A 1LWEA 4NI2B 4C98A 4USVA 3EZUA 4DI6A 1J2VA 2PIIA 3NRBA 1JLGA 3SSQA 2GFFA 4RNMA 4LF1A 3EICA 2QGFB 4UUWA 4B17A 1Q4RA 4ZJQA 1S9EB 4DPYA 1HWLA 3QGIA 2RDIA 4JI5F 2PC6A 4AL5A 5F8MA 4KIAA 1T9UA 1DBDA 3CCUS 2C22A 3NEKA 2QG9B 5GADU 4OV1A 2P9CA 4LF9J 2Q66A 1RT3B 3AOCA 4TU8A 3I32A 2D9OA 1Y0HA 2E5HA 3THTA 5IM0A 1Y4ZB 5KFMA 3EXYA 3NXZA 4WYLA 1ZS6A 2WOMB 3JYTA 4QYRA 4KTQA 1RSCA 1TVRB 3JTPA 1D8YA 2R7TA 3EDRB 3GYXB 1U24A 2XI3A 3D5MA 4WKYA 4F4ZA 3KG4A 4M5MA 1H74A 1R8BA 1JIHA 4LQ9A 2CQHA 4L3KA 4LQ3A 3PRDA 3ZFVA 2KVQE 5DM7Q 2XCPA 3ZZTA 2ZHOA 3Q8VA 1QUVA 1NZAA 3LGNA 4P2SA 1VHFA 2XMAA 1XR5A 4MKVA 1AB8A 3OPKA 1R0AA 3HKWA 1SKWA 2CADA 1DZ5A 2LDIA 3PW2A 3GFHA 3CJTA 5I42B 3GTYX 4HH0A 3A3OB 2AGPA 1NUEA 9RUBA 1RT1A 1U26A 5CCLA 1U47A 3THVA 3ZTOA 5G4DA 2XYPB 1DTQA 3AH6A 1HBMB 1FK9B 1CVJA 2HFZA 1HNVA 3UN2A 1YRXA 3L3CA 4V19X 2ZZMA 2ZWOA 1Q8KA 3T19A 4F36A 5AT1B 1MW7A 5G0RB 1FJGF 1XIQA 2ZE2A 3CNQP 4J9NA 1RHUB 2LQ5A 4NZ0A 4W98A 1X5SA 3W2VB 5JJBA 2KG1A 4C4WA 2BX6A 4OYAA 4LVOP 3CIZA 3M2RA 1N5YB 4I7FB 1VQKS 2KFNA 1AFIA 3N9UC 1HWJA 4IO9Q 1CQNA 1ZM3A 2KXHA 1T9TA 4J9VA 4TKTA 1TUWA 1KHWA 2JZ5A 3TUIC 1XMBA 3U02A 1HW8A 3DGVA 2DK2A 2XULA 2XC9A 2BACA 3O2IA 3CULA 1H0HB 3MR6A 1RUSA 4J37A 1FDBA 1TAQA 1U0HB 1ULRA 1FA0A 4M5JA 3W1YC 5KFSA 3M2UA 3TNVA 4F2RA 4O3PA 1T9WA 2FIUA 3ISND 1ZAWA 1QD1A 3WIUA 3TUZC 2ACYA 1HYSB 1OY8A 2VZ9A 4OX9F 5B08A 2MKIA 3IBWA 2VFSA 4YY3F 5J2MB 3CJKB 2GIRA 4JI2J 1YG0A 3EX7B 2DHHA 4U7UK 1HHTP 4DN9A 3SCLE 3ENQA 2ZKUA 1RACB 1HQUA 1OWXA 4WYWA 1TL1B 2LXUA 4YDDB 2XGPA 1RAJA 4ZPDA 2DXEA 4DSEA 3S01A 1SCJB 2HAFA 2RF2B 5EN1A 1UEUA 4ECYA 1JLCB 1X31C 2ILZA 2C2KB 3M4XA 3B78A 2H5JB 3ZO7A 2MJUA 3Q86A 3AD8C 4DCPB 1EETB 2RQ4A 2HHVA 2P8IA 5C2GA 1K44A 1Q8BA 2VL1A 1RABB 4LF2A 4GO7X 3M8QB 3KMQA 2FHJD 2OFGX 1S7IA 3DDIA 2WAQD 4URSA 3TAQA 4IH6A 5FLXU 3UPFA 2HFNA 3MMCA 3DDKA 4CZCA 1NH8A 3NKYA 2VQFF 3TZWA 3N6MA 3HHNB 4KKOB 3HHEA 3LQVA 2B7CB 3BEGB 4M5HA 2F3JA 2VBWA 1S79A 3AD9C 2CQ4A 2RS8A 1EETA 3CSKA 3G8QA 3R5CA 3A12A 4WCEQ 2ZH5A 1JJHA 3MEGB 3KKFA 3QGPA 4G65A 4ZLNA 4ED5A 1HBUB 2CWKA 3M32A 4QIEA 4OJHA 1AYEA 3IC1A 1DJ0A 2C28A 3P6YC 3J80U 5DGBA 1QJHA 2FJDB 1WG5A 2DNOA 3R5JB 4C11B 2VD3A 4YEAA 4N77A 5F9LA 3HT3A 4DSFA 3V4IB 4DR6J 2F8MA 1TL1A 2DR6A 4Y2AA 1NPRA 3H59A 1JLEB 1SIZA 1ZTTA 1UVKA 2W4DA 2YWHA 1FFWB 1FE4A 1MWQA 1SKUB 2YPZA 3BSCA 4KQZA 4ETXA 1ZYQA 2GQQA 5HMZA 2GO8A 5DDOC 2V6AA 3M8SA 3SFGA 2V69A 2FZCB 2CQ3A 4IH7A 1K73T 1HNZF 1VQ8S 3QYYA 4DL4A 2LMIA 2VG6B 1X9WA 3O3LA 2VQEF 4JYAJ 2Q1LA 2R7RA 2DRBA 2XM3A 1H2TZ 3AT1B 4LRFA 2W9CA 4YR0A 3FFIB 4TVAB 1BWVA 2GAHC 3GR0A 2AV5A 5D0GA 3R7BB 5KFCA 3VAHA 4ANDA 2FZKB 2DPJA 4QYZJ 3CEDA 3NCRA 1QTMA 5IWAF 1UJ4A 4OZNA 2I2YA 4QZVB 2JOQA 1M1HA 4N8OA 1CJTA 1RT4A 4DDFA 3GIKA 2WONB 4ZVRB 5IC4B 2GQ2A 3LP1A 5LXYA 3PFOA 2NXJA 4DQPA 4ZPBA 2FD2A 2JJ4D 4F04B 3G9CA 1SC4B 1Y5LB 1PILA 3OR2B 1K0TA 5B0BA 3QJLA 3BSNA 2BQUA 2MZRA 3QFHA 2ZJQQ 4TYAA 2GGPB 2HBRB 5T7LA 2DGOA 2KI2A 2CKWA 2BW2A 2WSEC 4OL8A 2GVZA 3LP1B 4Y0FA 2KJVA 2V8GA 4JI5J 2BRKA 2XCAA 3H5UA 5KT3A 2IJFA 5AJ3F 4EEYA 4LSLB 1TL3B 2ZKTA 4KHRA 4PZVA 4WP9A 4WFBQ 1IBLF 4URQU 1WC3A 2XWXA 3C16B 2RU9A 2VG5B 2BJDA 2HQFA 3K5OA 2HVEA 3KWMA 3MEDA 3GG1A 2ADBA 1GTHA 2GIFA 1C0TB 2NPFA 1YZ7A 3GU0A 2YKNA 2MLXA 1SC3B 5E3CA 4ZHRB 4LF5J 3HVTB 3MDFA 3TJ9A 2F9DA 2ZBIA 1ZA2B 1NHUA 2R7OA 3RW6A 3DOKB 4OI0A 4C8KA 3UNYA 1B7FA 3MURP 3DI6B 3IA0A 2ROEA 1RTDA 4ZCIA 2JLEA 2W24A 2CPEA 3RU0A 2G2YA 4BWMA 1GMVA 4CWBA 1RI7A 1S9EA 3MAAA 3KHRA 4KBIA 4UOFA 2V68A 4QWEA 3DRSA 4F4WA 2VKZG 3ET6B 4FS2A 4R5PA 2OD4A 3D3CJ 4TY9A 2A2DA 2Q6BA 1RXOB 4XK8C 4C8LA 4X62J 1JX4A 2FVQA 4UUXA 1ZAVA 1ZM4A 1HNIB 3VAGA 2CPYA 5J1NA 2IDEA 2L9NA 2M4MA 2MKSA 1FEEA 3OVSA 3J7ZT 1UKUA 4Z37A 4PKDB 4DMZA 5DM6Q 2QEXS 2CA9A 3EZ5A 1HD0A 4TXSA 2HWTA 2LP4A 1AW0A 2D9PA 1DTTA 4DL5A 1TL4A 4WTYA 3VWSA 4ZK7M 1NHKL 2EFGA 5A6WA 4S0MA 1KVIA 4CRJA 1CS4B 1TKZB 3RYLA 3EVMA 4F4YA 4IRCA 5FLXY 1UWAA 3H2LA 2CQBA 2UUCF 2Z57B 3FBBA 3OFFA 3QQCD 2CVIA 1S1WB 4I2QB 3OR1B 1CJVA 5B0FA 2NZ4A 5CHCB 1VQNS 2FC9A 8ATCB 2BJ9A 1UWBA 1XR7A 1RU2A 3OL6A 5KG0A 5J2MA 4Q0BA 1RAGB 4QCLA 1RWNB 2M9KA 1NXIA 3HKZD 1LK5A 2QC3A 4O4GA 5HBMA 4K5SA 4R5PB 1JQGA 2CUYA 2LYVA 1H2UX 4L3NA 2O01C 2CWXA 4Y34A 3OHAA 3OTEA 2VU5A 3VAJA 1SL1A 4FP9A 1EQMA 3KK2A 3ILIA 4NLPA 5CH7B 4Y00A 2FHOB 2C3MA 1XEZA 5J1PA 5H9FK 4X65F 3SV4A 1TU0B 1VJQA 2HVZA 2IRUA 3FDSA 1NHVA 3K17A 4IG3B 3PHEA 2WB1D 4GVBA 2V5HG 1RK8A 1EQ0A 5CYQB 1HBOB 4W4MA 1DFDA 4RJVA 4IUFA 4EMDA 2QN6B 2ZJPQ 3O5TB 3MUTP 1HI1A 1I94J 1UCNA 3DLEB 1EB0A 2MMYA 1H73A 1YVFA 3ZTSA 3OTBA 2LQBA 5HMXA 2IM0A 3FBFA 4RR5A 2V94A 1WSVA 4ERDA 3KHHA 3BGRB 2V2VA 1W2IA 3BR8A 5LSLA 1CQMA 3V6DA 4ZJOA 1IR2A 2L48A 1WHXA 2V50A 2ASJA 3BBBA 4NLDA 2IVMA 4RNNA 1ACMB 1NB7A 2EWHA 2FJVA 1P9YA 2VICA 2MB0B 2AYEA 2B8PA 2J7WA 2E5LF 3D4JA 3CPWR 4GKKJ 4OZ5A 3M8QA 4CO4A 4ID5A 3PX4A 3US5A 2Q6CA 3TP2A 1V3RA 5HLFA 4EGLA 4M5IA 3QRRA 3V6DB 4QWDA 3IAM9 3U1MA 1SC1B 3QO9B 3QT7A 4IQXA 2FGCA 3JTOA 1VQ6S 3T1YJ 3QWPA 2FHJA 4P9SA 5GAEI 5A2QY 3VHQA 4A8FA 2E1MC 4YUDA 1JLCA 2ZH6A 5KOXA 1YSJA 1S1XA 3CJKA 2QLXA 2LQ9A 5JVGQ 1MU2B 4IOBA 4WZQA 3OLAA 1VQLS 1YJUA 1HQUB 2HRUA 4WFAQ 3IN5A 2GC8A 3NG8A 1U09A 3D3BJ 3JSBA 4ILLA 1WACA 4A48A 1PYOB 2DNGA 5AXKA 1RHQB 2B6AB 1PJ6A 1VGYA 1JLGB 2JX2A 2B4OA 2YQ3A 3TX0A 1HW9A 1SQFA 5BR8F 4C3MA 3DNCA 1REGX 2JLFA 4L73A 5E41A 1NKEA 3QJJA 2MHEA 2ZBPA 4TQSA 1LW0B 4K0KJ 3GJSB 3ITHB 4OLOA 4K4VA 4OYOA 2IA0A 1NU4A 1PIEA 2VB6A 1X4GA 4X66J 3MPWA 7FD1A 4A8QA 2RD5C 3BZQA 5LJ3Y 1C4CA 3CCTA 4KB7A 3NGKA 3NBPA 2RUGA 1X8DA 2C3PA 1ZPWX 2EVZA 1CG2A 2XMKA 1P9QC 3HFVA 1E6VA 1EX8A 2B56A 3I31A 4CM2A 1KEKA 3RAXA 1D8ZA 4IFYA 4JI7F 2Q3PA 4WU3A 3CCMS 1L3TA 1XNQJ 1X7VA 3TW0A 3RB6A 2F4VJ 3OFHA 2WHOA 2BYCA 5GAGI 1LW0A 2LXIA 3G8TA 4GC6A 4ZIVA 2W2OP 4J9MA 1M5PC 5GAHU 3DOMB 3OV7A 4PWWA 3QLHB 1V3ZA 2PSZA 2CNLB 1B0TA 3FKBA 3I0RA 3OL8A 2DNHA 1HWKA 4FBUA 3NNHA 1ZA1B 1FRLA 1R0AB 1XR6A 2KHDA 1SB6A 3QAUA 4CLYA 4DCJB 2FB0A 3CCSS 3T1HF 4KPCA 2ZHAA 4O44A 4CLZA 1B0VA 2QLBB 3LPYA 5D4LA 3N5FA 1B0PA 4Q43A 2B3TB 2QRRA 3IGNA 4KO0A 3Q2TC 4P73A 4FXWA 1U1PA 2Y9HA 1OYEA 4XDCA 3RBEA 3MM8A 2XNRA 4OI3A 4EFAC 4NYOA 3RG6A 2W9BB 4FYYB 2UXDF 5LT5A 4BBYA 5HO4A 1S0NA 2A1BA 2CZ9A 5LMUF 3AD7C 4ZITA 2DNKA 4Y2IA 1VQ4S 2G9OA 2N4CA 3I9V9 3L9ZA 3R5DA 1T9VA 2KJWA 3IWLA 3VF0B 4O3QA 3W8GA 2ZVSA 4QIWD 3CGIA 2JFKA 4QOTA 1A6LA 1WSRA 4QIFA 3K58A 2OELA 1PGZA 2BQ3A 2IBOA 2UUAJ 4NZ7A 5BJRA 4QYZK 4PXDA 3MFIA 4ZVUB 4YOEA 3BREA 4LT6A 4RLEA 2MGZB 4M5NA 3K5MA 1SKSA 3Q89A 2CDQA 1BXNA 2XSJB 2GIQA 3AXMA 3DRYA 3HULA 4J91A 1TKDA 4NCBA 1IN0A 3MM5A 4J7CA 3C15B 5J1EB 3KLHB 3PNIA 2BDPA 5LSRA 2G1HA 2XNQA 3KK3B 4HACA 2RDJA 5C24B 2LECA 1KD1T 1V6HA 5EHHA 4I2QA 3UD5A 1XNRJ 1PC5A 1JLBA 2ZUGA 3BGFA 2LXFA 2XS7A 3MMAB 2PA8D 5EWGA 4C48A 3IRWP 1S6PB 4DL0C 2UU9J 1UP1A 3GJRB 4WP3A 2EI5A 3T41A 3L7UA 3BQ0A 3CO0P 4WE1B 3RBZA 3EPIA 3AB4B 1KWMA 5HBMB 5EX3A 2G2OA 1WOOA 1LWCA 2B6AA 3Q23A 2Y1LB 4HHJA 1CJUB 3NOGA 3N6NA 3SYZA 1RADB 2KRRA 5ETSA 3L7OA 3P5TL 2NUHA 2ZUAA 3OXFA 4P2FA 1FERA 4LMZA 3U1NA 1H7XA 3CDWA 5E3RA 5L38A 3BQ1A 4K4YA 2W9CB 3PJ9A 4C0HA 3VAMA 2V4QA 3DM2B 4DR4J 4I6YA 1R8CA 2HQDA 3Q8QB 2GW8A 6FDRA 3BDEA 1UEVA 5B0AA 4X64F 2UVUA 3HCXA 2UXBJ 3DLJA 5IT9Y 3L4BC 1H3DA 4RW9B 4ECQA 1JLQA 4F7VA 3HFKA 3IFEA 2QT7A 2KFYA 3OFEA 2JLGA 1T8EA 1TMMA 4HT5A 5M2PA 3OL7A 2YWEA 4RO0A 2C2NA 3WZ0A 4PEOA 5LMNJ 4FPIA 4M5LA 5E2QA 3KJNB 4EU0A 2OEMA 4U6PA 5KFVA 3ZZZA 1RTDB 3NMAA 4P7TA 1SJ4P 3FQKA 1IJEB 3MEKA 1KONA 1OSDA 2C3YA 2LDYA 6AT1B 3BJYA 3HK2A 3R8YA 5IWAJ 1DARA 4KV8A 3MD3A 5FJ4A 3QNWB 4C3LA 1UA0A 2MYFA 1HLWA 2CXEA 1REVA 2XEXA 4PG6A 1N88A 2QL9B 1NNDA 1YIJS 2DNRA 2YKNB 2Z58B 1N34J 3AHPA 3OXGA 2AU0A 2KYXA 2R4FA 2H48B 2FPHX 1YLXA 2CPZA 2GHPA 2QZ8A 3DGPB 3KUGA 4RW6B 3TI0A 3JB9k 1S0VA 1SC6A 1VK3A 3MR5A 3H4BA 2XGQA 3LO3A 1KS2A 3FEYB 2GV1A 3KLEB 3BYPA 1IKVA 2CJYB 1BGXT 4KV8B 2HRYA 2PN6A 2HG4A 4QU7A 2H3EB 1QUPA 2B9EA 1T03A 1HR0J 3EYZA 4C8YA 1FTRA 2E9ZA 1YX2A 2GX8A 3PJXA 4ZPTR 2DD8S 1RP5A 4CT8A 4H4KA 3AQOA 4DJBA 4IOCQ 4USHA 1H6KX 2E5IA 2LVWA 2VJUA 2RF2A 1JLQB 2UP1A 4ETZA 3V6KA 1J5OA 3Q8YA 4F0KA 4NXMF 1XMQF 2IC3A 2ASDA 1S76D 3DLKA 3ISZA 3K7RA 1DAXA 2W2NP 1WI8A 2XMUA 2HGMA 1IKWB 3D54A 4M5DB 2VQFJ 1RKJA 3PR5B 1GMUA 1LQ9A 2CPIA 4P7VA 4Q8EA 1JJ2R 4X4QA 4JP8A 4BDPA 1UWBB 4DCOB 3MAHA 2O67A 3BBCA 2YKOA 4WU2A 5KFXA 3TVYA 1SH2A 5DQGA 1HYSA 4LRAA 2DH9A 1RDRA 1FE0A 1N6QB 2XS2A 4J9PA 1J5OB 4LFCJ 4JI3F 3W63A 5D15A 4O0IA 4I4BA 4RNHA 5LMUJ 2JEJA 3GCXP 2HK3A 3GP9A 1KP6A 4B3MF 1NDKA 4YDXA 2UVVA 4FF1A 4KSEB 5F8LA 2XLKA 1SBRA 2ZC4A 3KLFB 2EFNA 4NOHA 2WVBA 5ETPA 2R2SA 1U1MA 4YHHF 4CP5A 1IBMF 5DDRC 5EWEA 3SSSA 1DHMA 1RBLA 2GJIA 2ZE2B 3NAHA 3PCOB 4OYIA 2J6UA 3NL0A 1Q5VA 2DR8A 3H5YA 4OLPA 3VGVA 3MR3A 1Y10A 2VC1A 5HQMA 5KTQA 4WK3A 1M5OC 1HR0F 4YY3J 2JL9A 4FYWB 2MSTA 3V5RA 3BV8A 5A8WB 2MY8A 2IA6A 2QJ3A 2RQKA 4A8WA 2P5VA 4KR0B 1KLNA 2V2ZA 4AFFA 1GFWB 4C97A 5B0CA 2L41A 2VUGA 3NS6A 2N4DA 2V9KA 2DBBA 3H98A 2B5JB 4DSKA 2RH3A 2P6SA 2ZBCA 1NJZA 4ECXA 1ROFA 2OPQA 3M1VB 1NK6A 3E3XA 1HBNA 5F9NA 3G8SA 2E5JA 2FQQB 2VKRA 2CQCA 3AOAA 1KOOA 5T41A 3M9MB 3Q24A 3QLHA 1L5UA 3IM9A 5C25A 3A13A 2OAUA 2POKA 3OLBA 1UL3A 2I8EA 2YNGA 3CDUA 3DU6A 1U8SA 3KK1A 1FEHA 3TQ1A 2DTJA 1JNZB 1PBAA 1YQHA 5JMNA 2X3DA 3QIPA 3BKFA 3UDEA 5DZ6A 3ICLA 2IVYA 5AXMA 4USWA 3MUVP 1U2RA 4K59A 1S9FA 4M94A 4KGZB 4CTAA 4EO6A 1WG4A 1Y3JA 2C3UA 2Z8QA 2ZZTA 1SIWB 4TLQA 1TTHB 4WWSA 5KFFA 5BR8J 5KFOA 4X64J 3IBCB 2PT0A 5B0EA 5K9FA 1WC5A 2DB1A 3NS7B 5KFYA 3THPA 3J7YI 1R3NA 2HLTA 4MFBB 3O6QA 2JVRA 2H5IB 3CUNA 4PQUB 1JKHA 3JQKA 2CPDA 2G1DA 4N7TA 1A7GE 2HNZB 2KZMA 3TAPA 4V19J 2VC0A 3B8HA 4OZ1A 5L9NA 1U7LA 2HS0A 4DQSA 5E3QA 1WD6A 4YR2A 4DLGA 3VCDA 2R7WA 3RR8A 4ED3A 1RTHA 1P6TA 1VRUA 5A8KA 1FI4A 4YQWA 5IT9U 1RZMA 4CLUA 3OR2A 1OIAA 2W7AA 5ETLA 1RAEB 3P45B 5I4MA 4ZOSA 4DQRA 2M8HA 2CQGA 3C15A 1OQ6A 4OHVA 3T5KA 3PKYA 1QE1B 1VQ9S 1ELOA 4DF8A 1YHQS 2EG2A 1Q7LB 1WEZA 2BE2A 5D78A 3ZC4A 3I0SA 1Q5YA 2IAJA 1D9AA 2KN4A 4FF3A 4EBDA 2OHDA 3LWMA 3GV7B 3B4DA 4CT9A 1RKIA 2ZITA 5HROB 4LF8F 1U02A 2BRLA 3EZOA 4ATNA 1TKTA 2HHQA 1N6QA 4ID5B 1H38A 2U2FA 4CH0S 1UVIA 3CCJS 3JAMU 5ETMA 1F9HA 5KFAA 2HHWA 3B54A 5ITHA 4JB8B 3ZZ0A 4PUOA 2QLWA 2QA1A 4X4OA 3GQCA 2VQEJ 2B4PA 3TJAA 1S1UA 4F2SA 2K3KA 4ANEA 4C7QA 5K8MA 4EYHB 1RHJB 1HNZJ 1VBZA 2RUSA 1KKHA 1S6OA 2YY3A 1Z2LA 2ERRA 1NK0A 1VQSA 2E7VA 2GA7A 2J8AA 2NXEA 3HF5A 1UETA 5IZHA 2R8IA 3PIOQ 3Q8PB 4I0WA 1IBCB 2IBKA 3MM8B 2WW4A 2XYGB 4HDHA 5SZTA 4UY8T 4X4NA 2GVDA 3TZXA 1IXKA 1S99A 3I4PA 3CJ0A 3HZEA 4KHPF 2J6SA 2AF6A 2CJKA 3W64A 4LF9F 4XO0A 3F73A 1MMDA 2HPUA 1WI6A 1YWXA 4V1Ak 2DHXA 1FKAF 2K2PA 2P2CB 1PYTA 4UZCA 3KJVA 3KLEA 4J5OA 1FFGB 2MKJA 5EWFA 3MR2A 1TV6A 5K20B 2J0QD 3RB4A 3M8ZA 1S49A 2ZOFA 4DUTA 3G6VA 3HFZB 4DL2A 4NLGA 1RLDA 2B7BB 1U1OA 1N48A 2KVIA 3K8WA 2I0XA 1FKPB 4NEYA 4EZ6A 2JSXA 1K1SA 4UOHA 2A2CA 3CIMA 3VV2B 3SZ2A 2PGCA 3TOQA 3UR0A 1KN6A 4I1TA 2D3O1 4PWDB 3A3NB 1S48A 3M7VA 2UXCF 2OMLA 1F2GA 4JV1A 1FCAA 3DLEA 4HHUA 1FKOB 4DEZA 4ZPWR 1IKYA 3MMBA 2UUCJ 4P72A 2OIHA 4LR9A 2I5JA 2DGVA 3DRXA 1YZ6A 3A1YG 4OHXA 4B9TA 4ECTA 2YNGB 5F8IA 1CULB 2ASLA 3AOBA 3QT6A 3OVAA 1I94F 2OD6A 1RBOB 2ZBRA 1RTHB 1VRUB 1LWFA 3F56A 1LFPA 3CCLS 4K2XA 1N56A 5CA5A 1S7HA 1WOSA 3EWGA 5K8OA 4YMEA 1VRTA 1BQXA 3GG0A 1U1NA 3HHLA 4ECZA 5HQLA 2V8DA 3IRXA 2CDRB 2JDJA 1HQ2A 4CYUB 1IUJA 2BJ7A 1O6XA 1KVJA 1RWVB 2G2ZA 2Y0BB 1VIXA 2ZD1A 1IKXB 3ILJA 4MT1A 5ETQA 4EBEA 2FYXA 2HHSA 2VBZA 2MKCA 3MEDB 1ZZNA 4G1QA 4WXWA 1S1VA 4CLLA 2F8HA 3H20A 1PYSB 3JSYA 3HVAA 3M6UA 2CQ1A 2J9DA 3EVOA 2FDNA 2DHAA 1S12A 1HI0P 1Y7PA 2QV6A 2RNEA 4KPYA 4H4OA 3JQMA 1Z2ZA 2ZH8A 2AYMA 4H4MB 5L1IA 2CNKB 5K8PA 4UY85 4Q45A 2NPIA 1ZTWA 3KJQB 2VASA 3UVJA 2IFXA 2CJBA 2A6MA 4ZVHA 1P8GA 3IR7B 3IM8A 4YB5A 3SEOA 2V4JA 2ZDOA 2FHMA 2FZGB 4MMOA 3E01A 4ZCLA 3G96A 5DETA 5IQ6A 3F41A 3UCGA 3IP0A 2HZAA 1WC4A 5KG3A 4E98A 5GMDA 1AT1B 4R0EA 1YRUA 2R8GA 4HLBA 1ITPA 3N6LA 2N3OA 4O3OA 4RNFA 1WORA 1U45A 2XSJA 4DR5F 4C9DA 2EBEA 5HAOA 1B70B 2KT2A 3BGRA 2V2QA 2VPXB 3NCQA 3SMZA 2CG4A 2V0NA 2ZH7A 2CIMA 2NR0A 3ZTRA 4U7UD 1SUQA 2HS4A 1FWPA 2Z0GA 4DS4A 2OMOA 1KQGB 4N76A 2W9AA 5KG5A 4ZP6A 2EEYA 5BYSA 3UN3A 5IM0B 3KFWX 1LK7A 5D77A 2HAIA 5KFKA 1FVQA 3GJTB 4HHHA 1HARA 2RMLA 1KFDA 1NSKL 2GHVC 4KGMA 4AT1B 3VALA 2XB2D 1F1BB 2GVDB 4C0BA 3CCQS 1P1TA 2Y8WA 1PO6A 1G4CA 1MNEA 1AXQA 2MJNA 3HVTA 1RE1B 2SXLA 4DR4F 2V8HA 4K5RA 3C3LA 4ZA1A 4ED4A 2C1EB 4CI0B 3R7SB 1U49A 3DKDA 4C8NA 4E2FB 4B9MA 5F3ZA 1NDLA 2J8SA 3AJ2A 3ELHA 4GRSA 1ZH5A 3CDEA 3WX8A 4DHVA 1L3VA 1AFJA 1TL3A 1S1VB 2IRYA 4XPEA 1IKWA 1RLCL 1UW9A 2AX1A 2BABA 3LAMA 1PKUA 4M5DA 4JI6J 1UZDA 2E1CA 2DNYA 2J0SD 2R7SA 3T9ZA 2GVZB 3NWGA 1IM6A 2QA4G 4J9KA 2ZD1B 2F1FA 1HHSA 1M5SA 4MK8A 5A0YA 3K8VA 4R8UA 2PD1A 4ZKAA 1OY6A 2PMZD 2D3OR 1APSA 1WF1A 2D1CA 1S57A 3PACA 3R97A 3G6ES 1SL0A 3UVJB 3O44A 4FYXB 2FLNA 1JWWA 1RT7A 2HHTA 2K1RA 2BE2B 5KFJA 1XNRF 1FDAA 2M52A 3R1HA 2OJ3A 3J7A1 1RAIB 3BH7B 4KJIA 1W2BR 2FVCA 1RA7A 3CJQA 3J80Y 4DZDA 2GQCA 5D0EA 2EPIA 2CQDA 2C2ZB 3JTNA 3HMJG 3K5NA 3LP2A 2XSFA 1X4CA 3NBPB 1TZ0A 4IG0A 2KU7A 3NGSA 3PYEA 3UQSA 1YJ7A 2B51A 5CD4A 4DR7J 1TR0A 1Y00A 2JNJA 5E5NA 1FKOA 2NYHA 1GXUA 3RW7A 3UD4P 4AD6A 2IY5B 1DURA 1T95A 3ZTPA 2FVPA 1UEKA 2O66A 3WBZA 2E5GA 3IR6B 1QDUB 3HJFA 1NK8A 5IV4A 1FKPA 2IYGA 2RSQA 4PPZA 5LM7E 3IG1B 1WKJA 4OJ3A 2H4WB 2IVFB 4ZCMA 4B3SF 3GV5B 3HX9A 1VJWA 2N7CA 3J81U 1BHNA 1D09B 1JLFA 1BE4A 1NEEA 2OH2A 1UVLA 2K8GA 2YX7A 3SCKE 4I7FA 4ZVEA 4A47A 1VC6A 2MEWA 3A8JA 3TWZA 1Q81T 1YI2S 3RRGA 3V4IA 2HBZB 2B9WA 1BUXA 3FJ2A 4DPOA 4ECVA 1OYDA 2C2RA 4OHWA 3MF5A 4PXCA 4DUYJ 3G82B 4U9RA 2MY7A 1SJ3P 1KBRA 3KK3A 3OVBA 4WZMA 4DZ6A 2A3JA 1RAHB 3AFGA 3S8SA 3P3DA 4OFZA 3KXDA 1D9DA 4RZRA 2AMCB 2H5EA 2NQPA 1N5SA 3FRZA 4HL9A 3EXCX 4IKAA 2BKNA 5F8HA 3KMSA 3MGJA 3EM1A 3PV8A 5HLFB 4DN0A 4KE5A 5F0UA 3UDCA 5HSPA 3A8IA 2KDOA 4TYBA 1R6VA 3RGIA 1L3SA 2M70A 2RAQA 1HPZA 4MIWA 5C2CA 5CCMA 4AXIA 4PQUA 2NS1B 1HNXJ 2HHHJ 4MFBA 4FYDA 2HGLA 4CNYA 2YKAA 5GADI 2DY1A 1BQMA 2C2OB 1N33F 1EP4A 3QGHA 4ZVFA 2ZH4A 2AGQA 4QWCA 1UFKA 3CF5Q 3PYDA 1B4SA 3EMTA 4CM0A 4RPFA 5E0OA 2QA4S 1NRKA 1G7CB 1JMTA 1YITS 4X4VA 3O8WA 5A76A 1TK0A 1HBOA 2VDIA 1R0BG 2Z2MA 5J1EA 2FJWA 5MLCV 1F6TA 2FVRA 4DU7A 2ABYA 4J9UE 1NJXA 1U1LA 2BKOA 4J9LA 1EJ7L 1R7IA 1UPPA 2H54B 2HFOA 3ZZOA 4Q44A 3RB0A 1NJWA 4TN2A 1KRPA 1HI8A 1X5PA 2Q43A 3MWBA 3M1VA 4RW8B 4UF4A 5K8NA 5KG2A 1FDNA 5EDWA 2HHUA 5F3TA 3KLGA 1N5VA 3QGGA 3QJPA 1S4EA 2IM2A 2QLJB 4PG4A 1ZPVA 2WVDA 2AQ4A 1UJ6A 1BLUA 1Z1ZA 1R6YA 4FPRA 1G2EA 5KOWA 2E44A 2RU3A 3QT5A 3P49B 1LNQA 2QTWA 4IFYB 1Q8LA 5CZXA 2BR0A 3VR1A 1MG7A 2H1YA 3DLKB 3TAMB 5C5JA 1JLBB 4F26A 3A8KA 2DO0A 2UZAA 3GIJA 5KFGA 2QLFB 1TELA 2Z56B 3FC9A 5IFMA 1IR0A 2CPFA 5HN0A 1KLMA 3BO2A 4Z7YA 3V81A 4O3NA 1TK5A 2YWKA 3TARA 1GK8A 1R43A 2BJ3A 3LP0B 4ZVQB 5HP1A 1WC6A 2W8KA 2IMWP 2A10A 1RHRB 1RGVA 5C42A 1IM4A 2I6WA 4RU2A 3QPIA 4F8RA 2PE8A 2HHXA 1Y9OA 2HVIA 1NCLA 1VR6A 3EDQB 3MM7A 3WC0A 4RU9A 4X2BA 3P5BP 2P9EA 3D0HE 2HBQB 4LFAJ 1VRQC 4F0HA 3EE3A 3PHTA 2RB7A 2VOOA 3GZ7A 2XTJP 1REVB 1VLOA 2BJEA 2DGXA 5ETTA 2HSEB 3S1TA 3MCNA 1KR4A 5A8WA 2AJ0A 1NO8A 3D9BA 4Y2CA 4ES1A 2OI2A 1XBWA 5THWA 4C3KA 1AUDA 4DV0F 1T05A 2AD9A 4U8VA 4CQ1A 4KT0C 4DX8H 4IR9A 1N8RT 4QPXA 4OYPA 1EP4B 2J7KA 1CJKA 4HEA9 2MSSA 1R8AA 4K7QA 1EARA 2V8PA 1DQ8A 2BM0A 2P6TA 1BD6A 3NOCA 2RT3A 2CRLA 1B99A 4G1PA 4NCGA 4CLFA 3KLFA 3CCRS 1OJ4A 3FMWA 3UI3A 1TFYA 2MQNA 3F44A 1FRKA 2APOA 4P10A 3OL9A 1JLFB 3A4TA 2JEIA 1TKTB 1MLAA 3D66A 4I56A 4ZHRA 1C0UA 1HKAA 2CFXA 5LXRA 3PW4A 4P74A 2XMWA 1V5IB 2RDDA 1RQ0A 5DZ7A 3K5LA 1N5QA 4DL7A 2OKQA 1B3TA 4DV5F 1Y5NB 1UW4A 4KAIA 4BWJA 4YB1P 4JYAF 2WW8A 1HD1A 2XY5A 1Q82T 2NCKL 3C19A 4LR7A 4IFVB 4ED1A 4YB6A 3MD1A 4QR1A 2YQ0A 1NBEB 1S1TB 4LSNA 3T9NA 4QWAA 3ILOA 5G0RA 3M9NB 1YRTA 2BJ8A 5CYQA 5F8GA 1WC1A 2F7VA 1FTCA 3TRGA 1A9NB 2ALZA 4ENOA 1FD2A 2RHQB 3LP2B 1UVNA 5D8HB 4ZP8A 1PJ7A 4FN5A 3PFEA 1W25A 2DNQA 5L1LA 1OPZA 1VI7A 3QO9A 4MK9A 4DOZA 8RUCA 2ZWPA 3CMQA 2ZZNA 5F0WA 1QAJA 1KDNA 4K8RA 5A0YB 2CJAA 4B3TF 2RIJA 2VPWB 3CJ4A 4P52A 4LFCF 1FHTA 2CYYA 3AJ1A 4ZS6A 4N5SA 1S0OA 4HACB 4IDKA 4B3MJ 1RAOA 2DYAA 2L3MA 4DWIA 4ZLPA 1M5KC 5B09A 2HWIA 1FRHA 4UW2A 2M8DB 2HNYB 1S10A 4DR3F 1T02A 3FCVA 3QBCA 5KFBA 2UVRA 3PY8A 3HHKA 4NZ6A 3IGVA 1FNMA 3R6GB 4BLGA 3WIVA 2DGUA 4IG0B 4OYMA 3FFIA 1BQNB
chains in the Genus database with same CATH topology
3MOJB 3LH2S 1LW2B 3MXHP 4WJBA 2HYIB 3MOZA 2KT3A 3CVKA 5LSOA 4AQYF 1WWHA 2JHEA 2YNFB 3GFYA 4B9LA 3M6XA 1JJ4A 4A8FA 3QAEA 1R27B 2MKHA 3KK1B 1HWUA 2MKKA 3K59A 4MIBA 5SUHA 3W2WB 1LWFB 1K8AT 1HL6A 2HMIB 1WF0A 4MIAA 2OFHX 4JI1F 3SCIE 2QSFA 5F8NA 2OPPA 2AW0A 3KHLA 1TKXA 5I3PA 2RRNA 4RWXA 4RUHA 1H2VZ 1ZZFA 5GAGU 3UR3C 5I3QA 2LKZA 3KNGA 2M3DA 3I96A 3M2VA 3ENWA 2E9RX 4ECUA 1R31A 4FNIA 1IJFB 5D4PA 2HQIA 1JLAB 1KQKA 1GTEA 4USJC 1H98A 2FJAB 3MCSA 1FF2A 4PR6A 4G6VB 2XLIA 3MAQA 2ZHBA 3KTQA 4WFYA 4FF4A 2BA9A 2C2EA 4X4SA 3NGDA 5U47A 4W92B 3FMBA 4I6AA 5KG1A 1LV5A 5JXSA 1WG1A 3PEJA 4WIIA 5K5MA 2KXFA 2B9YA 3L7PA 2LEBA 2LQJA 4NLQA 2GMLA 3Q2SC 2F40A 2QMWA 1LXNA 2U1AA 4MYUA 4Q2LA 4AL6A 4OX7A 2R7UA 2EK1A 1MWYA 1RJJA 4NWBA 4OI6A 1RYRA 2HVHA 1RT2A 3SV3A 3NP5A 2BANB 3TYTA 4LF4F 3G71S 3LWLA 5J2PA 2HIQA 2JWNA 5L39A 3FSIA 2MZQA 2JEGA 3IS9A 4O44B 3C66A 5E33A 4DQQA 5JUMA 4G1QB 1P27B 3I82A 4B3RF 1S97A 2ZNZA 2FTRA 2R9LA 3OR1A 2IC3B 2LA4A 4Y65A 3MFHA 1VBYA 2FLPA 2C3OA 4NXNF 2RE1A 2RKIB 2EW9A 2AP6A 4K4XA 2V4JB 2RQCA 1S6QB 3OTCA 2G13A 4ILMA 1JNRB 3MM6A 4FF2A 4G1IA 4IR1A 1VRTB 3CD0A 3K2YA 1D9FA 3O1LA 1WHWA 1XK8A 3M6VA 3PEHA 4EBCA 3R1LA 3BB5A 2M0GB 3GILA 3W3SA 1FJ7A 3SCJE 5J2NB 3MPYA 2GHWA 1HQEB 1IKYB 1UFWA 3MMBB 3ZZYA 5IT0A 3H40A 1HBMA 1QSYA 1KSPA 3VQTA 2E66A 2J7UA 1SH0A 3T6BA 3I4HX 4QQBA 4DFKA 2VG5A 2D3UA 3CWJA 3IAS9 5KG4A 2HLUA 2V8VA 3DC2A 3GFXA 1SJQA 3JSRA 1XTZA 3MEEA 3IRXB 4CO1A 4OJGA 1YJWS 5IT9Y 3KG0A 1FXLA 5DQHA 1HPZB 3DYAB 1FXRA 3QIDA 2XG8A 4WFNQ 3E01B 3UWTA 2IYIA 1VS3A 3TVKA 5AXLA 1FDDA 3SQGA 2R2UA 5C42B 4NA2A 4QWBA 3DMJA 2UV8G 1QY7A 1S9GA 2E1RA 2QFJA 3CXCR 1FRMA 1TL5A 2BZ2A 1P1LA 3DLGB 4AUKA 1VQ5S 3G6YA 1HBUA 3M32B 2VBYA 2XBPA 2XLJA 2B4UA 2LCWA 2IRXA 1CLFA 1BQNA 3CCVS 4WF9Q 4U7CA 3DMJB 2N3LA 3BGUA 2VFUA 1SV5B 3AAWB 3FQLA 3OBIA 3KNAA 4A8KA 4NRUA 1BWEA 4ZPCA 1F5CA 3KK2B 3TA1A 5CZVA 3RZAA 3PZPA 2OPSB 7FDRA 4B9UA 4OZLA 1U2FA 1RWUA 3M2UB 1SI9A 1V3SA 2JC1A 4F3QA 2JH3A 3KLGB 3AB2B 3VQSA 4MKBA 3S6EA 2CZ4A 2EFVA 1OS5A 1WEXA 4DFMA 3PO4A 1VQ7S 4A8OA 1UFLA 4IO1A 3PIPQ 1WEYA 2ZH9A 2AYBA 1URNA 3M2RB 1N5YA 4C8OA 3FZ2A 4LVNP 5GAEU 1GX5A 1R89A 4PPDA 1BY9A 2ZFHA 3HHLD 4ED2A 1VIOA 5DG9A 2WONA 5B0GA 4GC7A 2AWZA 5KT4A 1VQMS 1URRA 4OZJA 3GYNA 3N79A 5CYJA 5KFLA 4U67Q 2FJXA 1C2PA 1QSSA 1FRIA 2PMHA 2VBXA 4LFBF 3J7Z5 4B08A 2E7XA 2CJ9A 1TV6B 2FUG9 2DR5A 2YNHB 4RW7A 3P96A 4A46A 4K4WA 2A18A 2VH7A 4NCGB 1VLYA 3JSMA 3H2UB 3DOLA 1RTIA 1FT8A 2CPXA 1WELA 3MECA 2MDAA 1GAOA 5AXNA 5KT2A 4C11A 3NS5A 4F25A 3SDEB 5M2UA 2DISA 5CQGA 4DSJA 1GH8A 2OPRB 3T1AA 1G3OA 1HWIA 3U1LA 3GB0A 2E1AA 5KT5A 1S1UB 3HDSA 5K8NA 2M7SA 3FRYA 2W4CA 4F3OA 3DI6A 3AA9A 1N54B 4HI1A 2ZOMA 3DLHA 1YJRA 4GKKF 5D4OA 1X9SA 2YX4A 3BM7A 5IT4A 1YJNS 3QZ7A 3HP6A 3HLUA 3K5PA 3I0RB 1N4LA 4N47A 2DT9A 4RW6A 2NYIA 1XMOF 4H4KC 1NJYA 3H8YA 4C0OC 2YWGA 1NKCA 3I0SB 1WNEA 5BYRA 3CJ3A 2CZVC 2ZC3A 4FBTA 1Y3KA 5KAKA 4NLWA 4B3OA 2DNMA 4DFPA 3C2PA 1U48A 3CMAS 2Z2LA 3OXLA 4IH5A 4OI2A 2L9DA 3U27A 1CC8A 5A8KB 2CJQA 2X1FA 2X1BA 1CEZA 5DLFA 3UCZP 4JBCA 5ADZA 2W7OA 3FEZA 2KXNB 3PJWA 3C6TA 2E7WA 3RAQA 3RR7A 5I3UB 3D28A 1JKHB 4X4UA 2OPSA 2XI2A 2RKIA 2N7YA 4N8NA 3MHYA 4ICLB 4NA3A 3V6JA 4LJMA 4X62F 2Y1RI 1CSJA 5CXTA 1RT2B 3FEXB 3TA0A 2MZTA 2IHR1 3W2VA 1WF2A 2UXDF 1FD8A 2HQ3A 3G86A 1S1XB 2HHPA 4NMLA 3LALA 5HO4A 4ECRA 1TFWA 2WBMA 1LWCB 4HVZA 3CO9A 1ZM9A 4LF7F 2L9WA 2WOMA 3JYTB 2PI5A 4NLSA 2OLWA 3T3FA 4ID8A 4RKUC 3N4WA 1RT7B 1XNQF 1GQEA 3CTRA 2LEPA 4CO5A 1DTTB 1QSLA 5DRKA 4A8XA 4BC7A 1YJVA 2MXYA 3N0VA 2VODA 2DCUB 1T03B 3DYAA 1C1CA 5KFNA 2F9JA 4OI1A 4ELUA 1HMVA 4CH1A 3BDPA 3H4DA 4CH7A 1VQYA 1HNIA 3LAKA 5DO2A 4GKJF 2VV5A 5DLGA 4A8YA 3M9OB 1Q53A 2XS5A 3ZZRA 4F02A 1JLAA 1U6FA 2J9CA 4TY8A 4MTPA 2L08A 4K4SA 1E6YA 2G0CA 2YVSA 1C1BA 3UDLA 1NH7A 4DR7F 4RW4A 4EUVA 3JAMY 2FGOA 2YKMA 1RTJB 2B4VA 2CQ2A 2LLZA 1TP7A 5A8RA 3ENVA 2UUBF 1D3WA 1KFSA 4NYPA 1T7PA 4RW9A 3MMJA 5FIIA 2UXBF 2OO4A 4J9QA 3D0IE 4AXJA 3HM9A 5K14B 4IRKA 1FRXA 4KC5A 2D74B 3AA8A 1RTIB 4NLYA 2OP5A 3DM2A 2RS2A 4Q0BB 2KM8C 5KFHA 3CC4S 4PUOB 5J2PB 3BQ2A 1FJEB 1C1CB 3V4MA 2VOPA 4JI6F 4X4RA 4KGKA 1U6ZA 1N34F 1M5VC 1IKXA 4JV0A 2VA3A 4FNHA 5E3PA 1GNKA 4RBVA 4DL3A 4HYKA 1S6PA 1SJRA 3D2WA 4B9VA 3FSXA 2FY1A 4K50A 4PG8A 4H54A 1NK7A 2HS3A 1BC6A 2XY7A 1F9FA 4NPOA 1UMJA 4IQMA 3MTJA 3FZBA 4ZCKA 4H4OB 1NJIT 4I2PB 1MROA 3GR1A 5EUHA 1NK9A 2VONA 2RQMA 3MM5B 4YP3A 4OJ1A 1D1UA 3TAMA 2WTFA 2W25A 2FHKA 4RBTA 3NMRA 4F50A 3DFEA 3KLHA 3GMGA 2XMMA 1KQSR 2I9SA 1ZAXA 4NYZA 2Q79A 2DIUA 3ETOA 5CYMB 4ZPVR 1VFJA 2VG6A 2V2KA 3WDOA 1R8PA 3J7YU 2F8EX 1LKZA 2NXUA 3DRSB 1KQFB 2YKQA 2ZH3A 3UNGC 2DNZA 1JLEA 4MAKA 2AJFE 2DGSA 3W2WA 4DS5A 4JV2A 3I87A 3L95X 3CMES 5DJBA 2KHCA