2G4BA

Structure of u2af65 variant with polyuridine tract
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
172
structure length
172
Chain Sequence
LGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of polypyrimidine tract recognition by the essential splicing factor U2AF65.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3'
total genus 44
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g4bA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g4bA02
3D2WA 1SJFA 2CQGA 5CA5A 4PRFA 2E5HA 2M2BA 2LEBA 2MGZA 2CPHA 4FXVA 1S79A 1P27B 1YIJS 2XS5A 2RS2A 5LXRA 1PGZA 2VOPA 3CCES 2DGWA 5GAGU 3S01A 1KQSR 1ZZFA 4QU6A 2KXHA 1F9FA 2QFJA 2MZTA 3U1LA 2DNLA 2MY7A 1YHQS 1WHWA 1VQKS 1X5SA 2M52A 3VAIA 1OO0B 1KOOA 5DDQC 2M4MA 2PEHA 3CCSS 2DIUA 5DDPC 4RU2A 2MSTA 2KXNB 3CPWR 1UP1A 4W92B 2MZSA 1FXLA 3G96A 5JVHQ 2CQCA 4J5OA 2XNRA 1X4CA 2F9DA 2N3OA 2RVJA 3NNCA 2FPHX 2XS2A 1UW4A 2RUGA 2DGTA 1WI6A 1M5KC 1X4EA 2K8GA 3H2VE 1HL6A 4TLQA 1OPIA 3MUVP 1VQPS 3S6EA 3CC2S 2ERRA 2CPXA 1SJ4P 2OSRA 4A8XA 1A7GE 1X5PA 2OIHA 2DO4A 2MQNA 2KXFA 1U6BA 3CCVS 5D77A 2G0CA 4WFBQ 2MKCA 4YUDA 5DDRC 3BS9A 2PE8A 2CPJA 3VAMA 1X4AA 2WBRA 1U1LA 2FC8A 3UCUP 1U1MA 1YJ9S 3B4MA 3R1HA 3VAFA 1FO1A 2E5IA 1WHYA 4CH1A 3I56S 2LMIA 3IRWP 2DH7A 1R8PA 4CH0S 2CQ2A 1WHXA 3DXBA 2DNPA 3LPYA 4F26A 3MUMP 2MQOA 2DK2A 1D8ZA 4C4WA 1U1PA 3OW2R 3CXCR 3VAGA 3FEXB 3UE2A 2KG0A 3CMAS 3BEGB 1K8AT 2D9OA 1WEZA 3MD3A 2DNRA 3THTA 2M70A 5GAEU 2M7SA 3G9CA 4LMZA 3SXLA 2M8HA 5JVGQ 1N8RT 4C0OC 3SDEA 4LJMA 1M90T 2KU7A 3MD1A 2MGZB 2MQLA 2MPUA 3NNHA 4LIRA 3S7RA 2CQ0A 4YOEA 1HA1A 3VAJA 2MKJA 4BS2A 2E5JA 2LCWA 2MKHA 1RKJA 1SJ3P 2I38A 2VODA 4ERDA 1WHVA 3R1LA 2VONA 2J0SD 3HHNB 2B0GA 2DHXA 1W2BR 1BY9A 5H1SV 2CQ4A 1HD0A 2M8DB 2XNQA 2DNMA 4Z2XA 1M5OC 3THPA 3BO3A 5ITHA 2YTCA 5D78A 3UCZP 4QPTA 2ADBA 1PO6A 2DISA 2DGSA 2DNGA 2MYFA 2YKAA 3EGNA 3L3CA 2D9PA 1WG4A 3P3DA 3VAHA 3TP2A 1AUDA 3ZZYA 1U1NA 1KD1T 1G2EA 1VQMS 4WCEQ 2NLWA 5GAHU 1WG1A 1S72S 2DIVA 2FHOB 4W90B 3G8SA 3CCRS 1U1QA 2MMYA 2MJUA 2DNQA 2DNZA 5GVQA 2BOPA 1FHTA 2OJ3A 2RRAA 1Q7YT 1FNXH 1VQNS 5DDOC 4WFNQ 3P5TL 5HL7Q 1JJ4A 2MZ1A 1OIAA 4F25A 2LXUA 3JB9k 1U6FA 2DHAA 5MLCV 3P49B 2MQQA 2MZJA 4C7QA 2K3KA 4F02A 2CPYA 2MQMA 2N3LA 3SDEB 2Q79A 1YTYA 4UY8T 2XB2D 4IOAQ 3I55S 1VQ8S 1YJNS 2QEXS 4OZ0A 2N82B 3G71S 1QM9A 1M5VC 2ZJRQ 2UP1A 2DNYA 4IUFA 2LA6A 3MDFA 2ZJPQ 1R8HA 2AD9A 3RW7A 1SJQA 5EN1A 3UCGA 4YB1P 1DHMA 2KI2A 4TU9A 2EK1A 4PKDB 1L3KA 3NS5A 2CQBA 2HZCA 2CPEA 1U2FA 2F3JA 3TYTA 1FJEB 1Q82T 1DRZA 1QVFR 4QQBA 1VQ9S 3CCJS 1H2VZ 2AYMA 1N54B 3CULA 4Y0FA 1VBYA 4PR6A 1VC0A 3EGZA 1VQ6S 2CQ3A 1VBZA 2DGVA 4Y00A 2KM8C 2DNKA 3SMZA 2RRBA 1A9NB 1X4FA 3CUNA 2KFYA 1K9MT 2M88A 1WWHA 3CCQS 2N7CA 1DBDA 1K73T 1CVJA 2JWNA 2G4BA 2SXLA 1X4HA 2O3DA 2DNOA 4U67Q 5IQQA 2XSFA 1ZZNA 4WIIA 3PIOQ 2LA4A 2HGMA 2MKKA 2KN4A 2MXYA 2DITA 2U1AA 3S8SA 2QA4S 3UD3P 3H2UB 1YITS 5LXYA 1N52B 5LJ3Y 2V94A 2CPFA 2X1BA 2DO0A 1JJHA 2DH8A 1H6KX 2DGQA 2CQDA 1M1KT 1X4DA 1RK8A 2KRRA 2MZRA 2MKIA 3EX7B 4WKRA 3CCUS 3G4SS 5GADU 2MY8A 2FC9A 2KT5A 2GO9A 1X0FA 3PIPQ 3RW6A 1SJRA 2CQPA 2J76E 2AYBA 1UAWA 5GMKa 1FJ7A 2KG1A 2YH0A 2CQHA 2J0QD 4TU8A 5HO4A 2MKSA 1WF2A 2VOOA 3VAKA 2DGOA 2DB1A 2JRSA 1URNA 2CQIA 3NNAA 2YWKA 5DM7Q 2EVZA 5LSLA 1VQ7S 3BO2A 1KC8T 2OTJS 3CC7S 1KOHA 1B7FA 3US5A 2M0GB 1SXLA 1DZ5A 2F9JA 1VQ4S 1M5PC 2L08A 5IFMA 2LYVA 3N9UC 5IM0B 4V19X 4EGLA 2MHNA 2JVOA 3LQVA 1VC5A 2DHSA 2HGLA 1YWXA 2DH9A 1VBXA 2LXIA 3J7YU 2KH9A 2EK6A 1NU4A 5CYJA 1OWXA 4TU7A 3J7ZT 2CJKA 4M5DB 2MB0B 2GHPA 3MXHP 2KRBA 1NJIT 2L41A 1X4BA 1VC6A 3CF5Q 5CXTA 2LQ5A 2CPIA 2RQ4A 3ULHA 1QVGR 2HGNA 3DLLQ 5LSOA 1VQOS 2JVRA 2KVIA 2LECA 1XN9A 1U1OA 2RT3A 2A3JA 3V4MA 3UD4P 1NO8A 2L9WA 3Q2TC 4WFAQ 4ED5A 1WTBA 2AYGA 2KM8B 2X1FA 2DNNA 5FJ4A 1ZH5A 2YH1A 1X5TA 4CIOA 1D9AA 1H2TZ 1WF1A 4UQTA 3CC4S 3NMRA 3G8TA 1UFWA 3MURP 2FY1A 5DM6Q 1X4GA 2RNEA 1WF0A 2X1AA 2OTLS 3TO8A 3G6ES 3CCLS 2RU3A 4P6QA 3NS6A 2M9KA 4OZ1A 2ADCA 1HD1A 3FEYB 1YJWS 3U1MA 1O0PA 2AYEA 1Q81T 1P1TA 2OSQA 2J8AA 3UWTA 1U1KA 2U2FA 2XS7A 2DGXA 2BZ2A 3Q2SC 5BJRA 2I2YA 2KYXA 1VQLS 1X5OA 4IOCQ 2CPZA 2ZJQQ 3MUTP 2MZQA 2D3OR 2DGUA 1WG5A 4CQ1A 1WELA 3MOJB 3BO4A 2X1GA 3P6YC 5LJ5Y 3B4DA 2NZ4A 1N88A 5IM0A 4IO9Q 3IWNC 2E5GA 2MJNA 1YI2S 2G1DA 2E44A 5DETA 3MI7X 4WF9Q 2JX2A 4QU7A 1Q86T 1FJCA 3CMES 1H2UX 1WI8A 2RS8A 1IQTA 1WEYA 1U1RA 1FT8A 3ZZZA 2LKZA 3VALA 4FXWA 3CD6S 2DNHA 3VF0B 3K0JA 2KHCA 3CTRA 1VQ5S 1JJ2R 2CQ1A 2HYIB 3R27A 2DHGA 1JMTA 2HVZA 2MSSA 4ZKAA 3CCMS 1WEXA 2CPDA 2MQPA 3HI9A 2LEAA 2RQCA
chains in the Genus database with same CATH superfamily
1SJFA 3U7JA 1S0NA 2RHSB 3W9JA 3N28A 4X4RA 4FXVA 3CJ0A 1TMMA 2H1YA 1S79A 4JBCA 4PYDA 4PEOA 2RQKA 4YDXA 3TA1A 3TNVA 1X9MA 2RS2A 5F8NA 2VOPA 4FBUA 1MROA 4I7FA 1R89A 2DGWA 3OPKA 1SKWA 4S0MA 1KQSR 4KKOA 3TWZA 4B3OA 2N7YA 1M1GA 5KG6A 1HBOA 2KXHA 4KE5A 5DQHA 3BYPA 1YHQS 4WFXA 2R8IA 1YRUA 2BYCA 4WTYA 3T9NA 1N5YA 1KOOA 3CCSS 1S6QA 2IAJA 2VQEF 3Q83A 4HI1A 5HBMA 2UU9F 2LU1A 4NE9C 3CPWR 1BQMB 3QJLA 3UW1A 1U25A 1O51A 1QE1A 2MZSA 3HD1A 3GU0A 3OTDA 1FXLA 1SQGA 2LDYA 3SIPB 2EI5A 2UUAF 2CJ9A 1QTNB 5KFHA 1HW8A 1HI1A 3KMSA 1X4CA 3ENWA 1SPBP 4UT4A 4FNHA 2GVDB 4P2SA 3RR7A 2QLFB 3TEGA 3SSSA 2FPHX 4K4YA 1YRTA 2DGTA 4ES2A 2EKNA 3C66A 3MCMA 4TXSA 3R3TA 4ZCIA 1X4EA 2HS4A 2K8GA 1Y4ZB 3DN9A 4FYXB 4NYZA 1MWZA 5B7WA 3I6PA 2H4YB 3A13A 1OPIA 3D54A 3FJ2A 4CO4A 1VRUB 4F04B 5C5JA 3EZ5A 1EETB 2KFZA 1MU2A 3MZIA 3SFUA 4DU7A 3W61A 4LREA 5LMUF 2Q3PA 3OVSA 2GQ2A 1HQEB 2MQNA 3FNNA 3TZYA 2L3MA 3VVUA 2VPXB 4PQAA 3CEDA 3KHLA 1HNZF 1QLNA 2HPUA 1RTIB 5KFMA 1Y3JA 5ETMA 2B4VA 2BBEA 5FLXU 2YWFA 2VD3A 5DDRC 4EYIB 2CPJA 4DMZA 5J2MB 5HSPA 4NZ0A 2WBRA 5K14A 1EKSA 3PTWA 2DYAA 4JV5F 2CDRB 4KO0B 3D6HB 2WBMA 4NEYA 5LT5A 5HP1B 2IY5B 2OUGA 2WW4A 3D1HA 3IFEA 1FO1A 4CH1A 4U96A 1IBKJ 2DR7A 5AXNA 1JLGA 2CADA 3K7RA 3IRWP 1IKWB 3GILA 1AUSL 2V9WA 3OL9A 1TKDA 1F5CA 2VFTA 1BE4A 4YFUA 3KMQA 1Q78A 3CJ8A 1C4AA 4Y65A 3IM8A 1JLAA 4Y2KA 3N5BA 3OL6A 2FZGB 3BB5A 3MUMP 4GO5X 3K5OA 1D8ZA 4C4WA 1B99A 1ZM4A 1U1PA 4RW4A 4LBPA 4DV1J 1D1UA 3CXCR 2IRUA 1UW9A 3UE2A 3GJTB 3VAGA 1LXNA 2GQCA 3PX0A 2OTLS 1GTHA 3AY0A 3CD0A 4J91A 3D1OA 5KFYA 1GAOA 3F41A 5FIIA 1K8AT 2K06A 1WEZA 1NDCA 2FGOA 3CJKB 3THTA 4I67A 3TUIC 4LF6J 1KEKA 1N8RT 4ZPWR 4GVBB 5B0EA 2UUCF 1TV6B 2FYXA 2R8HA 4JI8J 2UXDF 2ZUAA 4JI1F 2KL8A 3D0IE 2ATLA 1FRIA 1M90T 4MIBA 3PW0A 4LFAF 2R7QA 1X31C 4Q2LA 2NR0A 1GH8A 2C2ZB 3M30B 3GG0A 2AT1B 3OT9A 5E3AA 3OL8A 3CIZA 4AQYJ 2O5DA 2R8JA 3BGFA 2HFNA 1RT5A 5MAOA 4AL6A 1NSAA 3LH2S 1FXDA 1W25A 2LVWA 3DKDA 3ZNJ1 4I2PA 1AZSA 3D67A 2UVUA 3KJQB 2KHDA 2W9BA 4I2QA 4FYDA 4LIRA 5T7LA 4B3TJ 1CPZA 2MTLA 4Y2CA 2OPRB 2IVFB 5CAAA 1LOUA 3CJ2A 2BOAA 1JLCB 1T9TA 1NLKL 2PMWA 2QYGA 3DOLA 1C1CB 2H54B 4DL5A 2GNKA 2HHUA 4PG4A 1X0PA 1HA1A 1OY9A 3U02A 3WC2A 4BS2A 1U47A 2I38A 5GMDA 3DI6A 3R7SB 4WE1A 3R1LA 1XMOF 3UNYA 3FUYA 4LR7A 3LGMA 4PCQA 2J0SD 1D09B 3HSZA 1TP7A 1RTDB 4LUBA 1W2BR 4FS1A 2OFGX 5H1SV 3HHNB 2IHR1 1U0SA 2XSJA 3QT5A 4G65A 2E29A 1QAIA 3MF5A 1N48A 1IR0A 1UZHA 3OD2A 4PWDA 2XCAA 4ES1A 2J7WA 3D3CJ 2XNQA 2C3YA 5BYRA 4Z2XA 4DSKA 4FKXA 2HQ3A 1IKXB 2APOA 4QPTA 1XBWA 4Q45A 1D9DA 3L09A 4OV1A 4H4MA 1H73A 2YKAA 5D4OA 5FD1A 3UI3A 2HMIA 3BGRA 2DRBA 4DPWA 1XNQF 3GYGA 1WG4A 3P3DA 3QAUA 4RUHA 5HMWA 1R43A 2W8KA 1U1NA 2VUGA 4YR0A 3V4IB 1KD1T 1IBKF 3IG1B 2J0WA 4G1PA 3D68A 2EFPA 2V8HA 2DIVA 1UVIA 2QN6B 3KLHA 1S4EA 1S77D 5A8KA 3KHRA 5J2PB 2XWXA 4NRTA 3ZO7A 4BDPA 3J81U 3CCRS 2P2CB 5K9FA 1NK0A 4ECTA 1S0VA 2RQMA 4WKYA 4CT8A 1R27B 4R5PB 2PI5A 1FHTA 1JLFB 2HQDA 4OZ2A 4J9KA 5EWEA 4F4WA 5DDOC 3EXYA 3P5TL 2V8GA 2NQPA 1BUXA 1S9GB 1OIAA 3K58A 1H38A 4B3SJ 1LWCA 3EJMA 2OKQA 3OR2B 1U6FA 1FRHA 3DMJB 3L7OA 4HH0A 4JI1J 5F8GA 1CS4A 5HAOA 1QUVA 4USKA 4DR1J 3M8QB 4DF8A 4C7QA 2K3KA 4OI1A 3OJUA 1SC3B 1FWLA 1M5SA 5L38A 2CRLA 4XO0A 5I3QA 4JI0J 3I0RA 3SDEB 3IAM9 2Y8WA 4DR6F 1YTYA 1TU0B 2XMTA 2E9ZA 1B0TA 2QL7B 3OTEA 3P5BP 3G86A 3NGUA 1Y10A 3G82A 3MEKA 2V9KA 3EGWB 3RU0A 1XWLA 3JAMU 3KYLA 1VFJA 4FN5A 3NCPA 5RUBA 3H40A 2COLA 4HACA 1QM9A 4AYBD 2ZH1A 2ZJRQ 1Y9OA 4J9QA 3MAHA 4RNFA 2BQRA 2LA6A 3MDFA 5HJYA 2ZJPQ 2XWYA 4DUZJ 1DQ9A 1QUPA 4RNOA 1RCXB 2QSWA 3G2XA 3UCGA 5EN1A 4YS2A 2YKQA 1TTHB 2VPWB 1TKZB 2JJ4D 2QL5B 3I87A 3T19A 3CDAA 3P8BB 3OXLA 2RDIA 1SL0A 1RWVB 2FJEB 3ZZ0A 1U26A 2Z2ZA 2BJ1A 4NLWA 2GW8A 4WU2A 3WIVA 1SI9A 1SH0A 4KQZA 4WJBA 2XMMA 4KRWA 4M5JA 4MMOA 1M1HA 1RGVA 2FVPA 1E6YB 5KT6A 3CCJS 3I82A 4CWBA 2AYMA 2H51B 2IJNA 4PXBA 1PC5A 5D15A 3G87A 3F44A 5E3QA 8RUCA 4Y0FA 4PUOB 1WACA 3CULA 3EPIA 4K0KJ 3ET6A 3MMCA 3U27A 4YR3A 1VQ6S 3RR8A 1HNXF 3M8YA 2HNYA 1EB0A 2PGCA 1CG2A 2IM0A 1J5EF 1EP4A 1TL4A 3ZZRA 4FYVB 3CJTA 4MKBA 4LF5F 3CUNA 4KTQA 4A8OA 3R5GA 1T11A 3HHLB 2M88A 4OYBA 2H5IB 3HF5A 1RACB 4LRFA 2YNFA 1TUWA 1ZAWA 2N7CA 4WK1A 4F4YA 4DXLA 1JLEB 1CVJA 1JWWA 4ECSA 2CFXA 2GGPA 5LSRA 1X4HA 2J9DE 2V2VA 2W9CA 2O3DA 3KLIB 1G7CB 1S0MA 4F4ZA 3J80Y 2YXLA 2ZUGA 4C97A 2LA4A 2W4DA 2R8GA 4XAKA 1NZ8A 5DS7A 1GX5A 2FHJD 5K14B 1UWAA 4P74A 4B02A 4RW7B 5HMZA 2QA4G 2C3UA 4A8QA 3FBEA 1SVDA 1VRTA 2KN4A 1Y5LB 2U1AA 5F41A 1ZA2B 3S8SA 3H2UB 4PG5A 3VR1A 1MMNA 1U48A 3DRYA 2CA9A 1TK0A 2HW3A 1S1VA 3I0SA 3DLJA 4DV0F 1NAQA 2QJ3A 1VBKA 5K5MA 4O44A 2G9OA 4GKKF 1U49A 4NZ7A 3BSCA 1UETA 1NPPA 1H6KX 1UKUA 2ACYA 4DUYJ 4O3NA 2C2EA 5A8RB 5KFPA 3PW5A 2QV6A 4DPOA 2VFSA 4O4RA 1D8YA 2ALZA 2DCUB 4JYAJ 2VJUA 1Z2ZA 1JKHB 4DZ6A 2WK4A 3H98A 2VIHA 1CBKA 2FLNA 1MMLA 4ZPVR 5B09A 3W9IA 2QZ8A 4M95A 2WONA 4X62F 4CLYA 4DV3J 1S1XA 2CZ9A 4NLTA 3X3UA 2I8EA 1YJ7A 2XHWA 4DV2J 4ZDNA 4C0HA 3K5NA 2CQPA 4YY3F 3MM5A 2IIHA 4M5NA 1NK6A 1TVRB 1F60B 2HS0A 1JB0C 1SIZA 4MH8A 5GMKa 4KH1B 3QRQA 1IR2A 5ETVA 2GCFA 3CJKA 3J7Z5 1GFWB 2H5JB 5IWAF 3DU5A 2YH0A 1KVJA 1REVA 1RTHA 3M32B 3JSMA 3PVXA 2ZFHA 1VLOA 2J9EA 4WK3A 2VFUA 2DT9A 3HFKA 3KG4A 2R2TA 3BSOA 2DGOA 2DB1A 1RT2A 2B7CB 3NGKA 2BXJA 2I9SA 3BH6B 3QWPA 4IFVA 4RWXA 3G6VA 1HNWJ 1URNA 3LUYA 3M30A 1UEVA 2CQIA 2YWKA 2C3PA 4K7QA 4MT1A 1L3VA 4UUWA 2BV3A 3LWLA 4CCHA 3GCWP 4HYKA 2E5LF 2YNHA 3M8WA 1RT3B 2OPQA 2RUSA 5JUMA 3MM6B 4ECWA 3IAS9 1PAUB 4KV8B 1JXLA 1T9WA 1F1BB 1HHSA 4OLOA 2BQUA 1X9WA 4ZP6A 4NLVA 4ILLA 3BM7A 2AW0A 3R7NB 4F2SA 1KS2A 3TW0A 5B0CA 4KGVB 3LQVA 1UJ5A 4DX5A 3DLGA 5BR8J 3HULA 3GB0A 3J7YU 1T9VA 3IBCB 3TJ8A 5J1PA 3QSYB 1WC4A 4WE1B 2UXBJ 3PW4A 4N76A 2G0IA 3WDOA 2R7TA 4TU7A 1XMQF 3BDEA 1W2IA 2OEKA 3BBFA 1RTDA 1CULB 2UVRA 2QX0A 2XSJB 1U02A 4PG8A 3GJSB 1TFWA 2C2MB 4KY3A 2M3DA 4B3OB 4ED8A 4CT9A 5HI7A 4KAIA 4DSFA 3CF5Q 2NXUA 5CXTA 2J9DA 1KLNA 2LQ5A 1ZM3A 3UPFA 2P5VA 3EZOA 3ULHA 1UEKA 2A0FB 4E8UA 1T9YA 4B3SF 3W8PA 2FJXA 4NXMF 3TI0A 3KOAA 2B4UA 3D5MA 3ZFVA 2JVRA 2LECA 2CJYB 2A3JA 5B08A 4DR3J 2F4VJ 3HVWA 4QPXA 3FCHA 1NJYA 4DSIA 2E7WA 3KK3B 2XG8A 4PWUA 5CCMA 1N56A 3Q2TC 1G6BA 4OV6A 3K89A 4TKTA 4F7VA 3QZ8A 1P9QC 1S49A 4USVA 3AOBA 4TY9A 1OY6A 3PO5A 3A8EA 4DL0C 1X5TA 2YPZA 4Q7AA 2IM3A 4UQTA 1YBUA 2FHMA 4AT1B 4A8YA 2B9EA 3IBFB 1KNZA 3J81Y 2FY1A 4AL5A 4ZCMA 1X4GA 2F65A 3ENAA 1JLQB 1O6XA 2DEJA 1RCOB 2KO1A 3H90A 2BABA 4W98A 5ETPA 4E2FB 4P9SA 5A0YB 4ZJOA 3DCAA 2JC0A 3LGNA 5KT4A 5IWAJ 3ITHA 4ZLNA 1HD1A 5ETTA 3U1MA 1IKVA 1MMDA 3TUPA 5KFFA 1RHJB 3PYEA 4NWBA 2OD6A 5E5NA 2XM3A 2OPPB 1P1TA 1QE1B 2J8SA 4LBIA 4NA2A 1RB0A 3MR2A 2Q43A 4RUCA 2CVEA 4ZPAA 2DGXA 3SCKE 2A2DA 3GMGA 3W60A 2KJWA 2HHSA 5EHHA 2AIRB 2D7SA 3Q2SC 6FD1A 1RT1A 4FYWB 1K0TA 1P9YA 2EEYA 4NOHA 2PFDA 4LFAJ 3GFYA 1X5OA 2W24A 3W64A 4J9OA 1RKIA 3HP6A 3MUTP 1U2CA 2XEXA 4NA1A 1UFKA 4USTA 4RO0A 2DR9A 4USWA 3FFIB 2ZHOA 1F5BA 2R7XA 5HN0A 2HIQA 4PAAA 3W2VA 3CJ5A 1TAUA 2RU9A 4Q2MA 5K8NA 3ZTQA 3IN5A 3IWNC 1WD6A 1YI2S 2VBZA 1L5UA 1ZM2A 2G1DA 2B5JB 3QO9A 4GKJJ 2KZMA 1ULRA 4ZCKA 4RX6A 2HHTA 2BE2B 2PMZD 4USMA 3AOAA 3N6LA 2UUTA 4TYAA 3M2VA 2JX2A 4DPUA 2XGPA 1Q86T 4WF9Q 1RAGB 5T41A 1H2UX 3VZIA 4QIFA 1JLAB 1G4CA 5IT0A 4ZN3A 1U1RA 3R5BA 1E6YA 3HHEA 2LKZA 2VBWA 2XO7A 4GC7A 2DNHA 2C1EB 1SIWB 3DM2B 4PG6A 4DFKA 1FE4A 2OEMA 4HHUA 3A12A 2HRTA 4DFJA 4DX8H 2KHCA 4I6AA 4C3KA 1SC6A 2UUBF 1SKSA 2R7WA 3I4HX 3UVJA 4DEZA 2LQ9A 1C0UA 2QYCA 3KJNB 5AJ3F 3DRSB 2ZZNA 1F5AA 2BE7D 1T0TV 2EFOA 4MIAA 1UJ4A 4J9MA 3GJRB 2CPDA 4UTGA 4CO3A 4IH5A 1XR6A 2YNFB 1TZ0A 3HI9A 4NMXA 4P75A 3LA0A 5IC6B 3D2WA 4N8OA 4WTOB 3N6MA 2M2BA 1MU2B 3MMAB 3HSDA 3NAIA 4MYUA 2FLLA 4DV4F 1TKTA 2HLTA 1LFWA 4AQYF 3TVZA 4ETXA 3OUYA 3WC0A 2IJRA 3W65A 4NI2A 3CCES 2BVZA 5K8MA 4PQUA 1ZZFA 5CHCB 3W3SA 2Q6BA 4DR4J 1F9FA 3CJRA 3U1LA 2QFJA 4IRKA 2DNLA 2MY7A 2BKNA 1VQKS 4FS2A 4EZ9A 4NPOA 2HHXA 2ZBCA 1ZPVA 3VAIA 1LWEA 2QT7A 3RRHA 4MK7A 2IBKA 1RA6A 1B64A 4OQJA 3T5KA 3I32A 2AJ1A 4UOFA 3FBFA 5DDPC 2EFNA 3LP0A 1S9FA 1CQMA 3VVTA 2W7AA 4ENOA 4OX9J 2FZKB 4JI4J 4L6V3 1LW0A 1KDNA 3JAMY 4PPZA 5JVHQ 4Q0BA 2CQCA 1VDHA 2VF3A 5IT9Y 1FD8A 4JI2F 3VCDA 1S6PA 4DR7J 3GFHA 2I6WA 1RABB 5D3GB 3KG1A 2N3OA 2UVWA 2IRXA 4DU8A 4ECQA 1FRXA 1KRPA 3MAAB 1IBLF 3LP1B 1B70B 1NDKA 1S1WA 1WI6A 2K1RA 2YPYA 4OYOA 4CO0A 5KT2A 1EARA 1Y5NB 2ROPA 4DS4A 3H2VE 4RW8A 4CLWA 3OTOF 3T5JA 3HO1A 3GR0A 5A76A 4TLQA 4RW6B 4DUTA 2HHHJ 2M5YA 5EX3A 2HZAA 4D3HA 3CO0P 3MUVP 1NJWA 1KVKA 1VQPS 2VA2A 2XY7A 3S6EA 3JS9A 2ERRA 3SI8A 1SJ4P 4QYZK 3CT9A 3GR1A 2DO4A 1DARA 1MSWD 2XZDB 2XLJA 4RBVA 1IVZA 5HMYA 1U6BA 3SZ2A 2B9XA 4R0EA 3GP9A 3OL7A 5KFZA 4WBFA 2BW2A 4DQRA 1QJHA 1RAIB 1U0HB 3M2UB 4WFBQ 1MG7A 2HWHA 4LFBJ 1TAQA 3BS9A 3OTCA 3C16B 1RAEB 3PHEA 5D0RA 1TL7B 2UZAA 3HD2A 4JV1A 5CYMB 4MKVA 2QA1A 2FC8A 3AQPA 2G0JA 3EGVA 4TQSA 4NXMJ 2KKHA 1XNQJ 4IKAA 1KWMA 2HNDA 5AJ3J 3TR5A 2BJ7A 2C3MA 3QIPA 4ILMA 3OFFA 4WP8A 4OL8A 3CW2C 2L48A 2AJQA 1CJTB 2E5IA 1UWBA 1RAOA 1HYSA 1WHYA 2LMIA 4DSJA 3KLHB 2BMBA 1RHMB 4L73A 2DH7A 1GXTA 5F0UA 3H25A 4PZVA 3V2UC 2QMUB 4P2MA 3C19A 1WHXA 4I56A 5KFBA 2RRNA 2KT2A 4LQ9A 2DNPA 2AMCB 3SBMA 2EG1A 4ANEA 3GIIA 4ED7A 3QRRA 1FI4A 1UJ6A 1T8EA 2AQ4A 3CMAS 2VHGA 2BR0A 3FC9A 2VQEJ 3IP0A 1VHFA 2RJZA 1TKZA 3FKBA 4A4JA 5KG0A 1AB8A 5GAEU 1IKXA 2M7SA 4DLEA 4L76A 3MMJA 2M8HA 4ID8A 2GS8A 4QR2A 5HQLA 2OI2A 4MK8A 5E2QA 4ZLJA 1HPZA 5IXUA 2RMLA 2FHJA 1K1SA 2GJ2A 4UZCA 4C0OC 2MQPA 3AB4B 4OI3A 5EX0A 1WORA 2H65B 2V8PA 3KWMA 4DJBA 2FVRA 1NDPA 4ECYA 2KU7A 2UXCJ 1ACMB 3QGPA 3VQTA 3IR7B 3G82B 1TL1A 4FPRA 1Y00A 5KFIA 4NL5A 2FUG9 4DFMA 2V8DA 2GMHA 4IR1A 1U2RA 2DR5A 1XJWB 2YX4A 4KFBA 5IV3A 1NM2A 2ZD1A 3D0HE 5CYQB 1SUQB 5A0YA 1G3OA 3NNHA 3A1YG 1RWKB 2ZVSA 3H0PA 2YY3A 1J5EJ 3RBXA 4OX6A 1KKHA 3L7UA 1K1QA 1RHUB 1LWCB 3U1NA 3OLAA 2VQFF 1YGYA 1WTFA 2HBQB 4EFAC 5L46A 2MKHA 3AAWB 3VAJA 3PX6A 4XPEA 4URSA 1N5YB 3PRVA 4ERDA 5JJBA 2AF6A 3D7SB 4ZP8A 2HKEA 2B7BB 1VI7A 2VONA 3VAKA 2OD4A 4ZVUB 2QTWA 5D4NA 3ICLA 2DHXA 4ECRA 1UVLA 4YHHF 1BY9A 3TZZA 2LP4A 4NXNJ 1HWIA 5LL6d 4JV0A 3HHLC 4J9SA 4EZ6A 2E66A 1HNZJ 4QIGA 4ZIWA 4Q8FA 4EBDA 1KR4A 4I6WA 4X65F 2HVIA 4OJGA 3BV8A 2GVDA 2ZWOA 4GVLA 3THPA 1M5OC 2HBRB 5CZVA 2YTCA 5D78A 4F3OA 3ILIA 1PO6A 2DISA 2B4OA 4HDHA 5ETLA 1NK7A 3EGNA 3L3CA 1JXVA 2Y0BB 3ZZYA 1HHTP 1WJ9A 2JOQA 4QWCA 4E0DA 1AROP 1SV5B 3W62A 5GAHU 2V50A 2HWTA 6AT1B 1J2VA 1KFSA 3GYNA 3HX9A 2FHOB 4USUA 2V8VA 3ADAC 1QSLA 2IPOB 2YWHA 3H5UA 3M9OB 2FLPA 1HQ2A 2YWEA 4BHQA 4O0NA 1RXOB 4NCAA 1XMQJ 2MJUA 2RF2B 4DLGA 2DNZA 5GVQA 1E6VA 4ZLLA 2Z8QA 2BOPA 2OJ3A 4DV6F 3TA2A 3HFZB 3TEHB 1FJGF 2AKWB 4PXCA 1CJUA 4WFNQ 1RT6A 1TUGB 2W1BA 3IRXB 1WDDA 1REVB 1IJFB 1RTHB 2NZCA 5ETSA 4F36A 3JSMB 3SQOP 1T7PA 4LFCF 1KTQA 4F25A 1P8GA 4F8RA 4MKYA 1TR0A 2GHWA 5JXSA 5L1LA 2XHCA 1TKXA 2KB2A 3R5CA 3TAMB 1RE1B 2EG2A 3PR5B 2IA6A 3CCTA 1UVNA 1TL5A 4F0MA 3M4XA 4XTTA 3T5LA 3NBPA 5A6WA 1IQZA 1TKTB 2AJ2A 3NGRA 5KOWA 5F8HA 1QD1A 1S1XB 4LF8J 2BACA 2Q79A 1YQHA 2KDOA 3MAQA 4OYPA 4DI6A 3OFGA 2I5JA 5F9NA 4K4SA 3ENVA 4WXOA 5E3RA 3FSIA 3LGHA 4J9VA 1K44A 1HWLA 1JNZB 4IG0A 1F3VA 1YJNS 2WVEA 2RILA 2ZKTA 4RNNA 3ETOA 3EUNA 1CLFA 2NXJA 3M1VB 2UP1A 3H4BA 1WKKA 4ED3A 1AUDA 3BKFA 4IUFA 2BANA 5T7LB 5J2QB 2HHHF 4UOCA 1R8HA 2V4RA 2HK2A 5IC4B 1M0SA 3KJFB 4YB1P 3I31A 2HZVA 3NS7B 2FJAB 2EK1A 3G6XA 3NS5A 4ZVFA 4KSEB 5J2PA 2YX1A 2MQ8A 1NDLA 2HQFA 1PIEA 3KK2B 2R2UA 4KR0B 1B4SA 4ZN1A 4NCGB 3H4DA 2HBYB 2AJ4A 2GMLA 4AXIA 2OHDA 4QQBA 3RRGA 5AXLA 1RTZA 4XK8C 3KK1A 3HJFA 1BQNA 3NEKA 2QO3A 1XMOJ 1TK5A 3J81j 3MTJA 5CH7B 2PEBA 1VBYA 2EBGA 3MPWA 2AEMA 3T9ZA 1XNRF 1LQ9A 4RW6A 2O67A 2DGVA 4QR0A 1HBMB 2DNKA 5AT1B 3TVYA 5D6GA 2FVQA 4B3RF 1NHKL 5KFLA 4A46A 3V6DB 1X4FA 1UVJA 3DLEB 3PJ9A 4UQGA 3R2DJ 2K2PA 1SQEA 4N7TA 4WP9A 2OH2A 1FRLA 1FX4A 1WWHA 4FDFA 3CCQS 1BD6A 1KHVA 3QMQA 4F4XA 3OJSA 1K73T 1WUUA 4RWWA 5EWGA 1RI7A 2J6SA 7AT1B 5L1JA 2X3GA 3K59A 5L1KA 1O5JA 5IOLA 4O0IA 4U67Q 1KLMB 2PSZA 3CMQA 1P6TA 5KFUA 1ZZNA 1TL3A 2CAJA 1Q5VA 1V6HA 2XMAA 6FDRA 1TL7A 5KT3A 1RBOB 1PJ7A 3NRBA 4DR4F 2AX1A 4EU0A 3UD3P 3SQGB 2YNHB 5A2QY 4YQWA 4X4PA 1HBOB 3PXGa 5C24B 1OYEA 2VG7A 2G2YA 1N52B 3BZQA 4IQXA 2NYIA 1YX2A 1GEHA 2CPFA 3MCOA 3NWGA 2WVFA 2K3IA 3R6LB 1JJHA 4HEA9 4K50A 1K0VA 2HS3A 4ZMMA 1M1KT 2IAJB 2CIMA 3C6TB 2DY1A 2UV8A 3QBCA 4OX9F 1S10A 1RISA 2JLGA 1T03B 1APSA 2C2OB 4OHVA 2XI3A 3GIJA 2XGQA 2HAFA 1HBNA 1OSCA 3AB2B 3DGVA 1FTCA 3MEDB 1EZZB 2DXFA 5ETNA 3D4JA 3R5AA 3RG6A 2WTFA 2MY8A 5I3UA 5J2NB 2FC9A 4B9VA 1FDBA 5J2NA 3RGIA 4JI7F 3TAQA 5A8KB 1X0FA 3PIPQ 4DV5F 4ALZA 5IT9U 1B0PA 3EMTA 2Y1LB 4X4SA 3BSNA 1JLQA 3OR1B 7FDRA 1LWFA 4U7CA 2IYIA 1FCAA 4USJC 1HNVA 1NKEA 1IR1A 4HHHA 1L3TA 3M2RB 2V6AA 2WCXA 1PSDA 1F2GA 2YNGA 3A3PB 3K17A 4FBTA 2BDPA 2KG1A 1H7WA 4NLSA 1S9GA 1B7YB 1WOSA 3TANA 2CQHA 3T3FA 1NNDA 1HPZB 3EICA 5HO4A 1WF2A 3BQ0A 3OR2A 4B3MF 4JI8F 4OJHA 2VOOA 4WYLA 2R4FA 3EYZA 4DV7J 2JRSA 3MWBA 4AFFA 2B4PA 3W2WA 1RAJA 1OYDA 4YHHJ 1VQ7S 3B6BA 1RBAA 3B8HA 1FWKA 4IRCA 2GZOA 1RTJA 1GXLA 1KOHA 2MLZA 1FEEA 1SUQA 5CYQA 4YMEA 3EVMA 4X65J 1B7FA 3A8IA 4JI6F 4FVMA 4PUOA 1RZMA 4DR2J 1C0UB 1N0UA 2HQCA 3EE3A 2KJVA 4HT5A 4KC5A 1SXLA 1U24A 3WX4A 3Q0AA 2E5LJ 3A3NB 3A3OB 1N4LA 1Q1KA 2LYVA 5IFMA 5IM0B 4C8LA 4KO0A 3V6JA 2MHNA 4X4TA 4CLLA 3I9ZA 3MM7A 5F9LA 2CJAA 5DG7A 1VC5A 3ELHA 1OQ3A 1YWXA 2DH9A 2LXIA 2O1PA 2QLBB 2WVBA 4RBUA 5H9FJ 3VGSA 1U4BA 2EK6A 3N79A 3OHBA 3GV5B 3C3LA 1KQKA 2DRAA 2WW8A 1AA1B 2OPPA 2DR8A 1C0TA 2B6AB 2FGCA 4NI2B 1TQLA 5CD4H 2W9CB 4K2XA 5KTQA 2KRBA 1V3ZA 4LSNB 2UUBJ 2W2NP 1NRKA 1VOMA 3SEOA 1T9XA 2LQ8A 1X4BA 3IMQJ 3NY0A 2E7VA 2RKIB 3PEJA 3EXCX 4QIVA 3GIKA 5G4DA 2ROGA 3MMBA 1WC1A 4OHYA 2ZH3A 1BXNA 3DRSA 4U95A 3PW7A 3DYAB 4J90A 1JX4A 2J5AA 3I0SB 2ZBRA 2HNYB 5KT7A 4QWDA 2Y8YA 2VB6A 1UL3A 4C8YA 3W2VB 4QIEA 5FDLB 2H48B 1SV5A 5I3PA 1N0VC 1NSQA 1FNMA 3H5SA 2B9WA 3RBZA 3IWLA 3HDSA 2YWWA 1V3SA 1FKOB 4JI3F 2DPIA 4WFAQ 3E3XA 3FVYA 2Z57B 4RKUC 1W7WA 1D3WA 1S6PB 3KFWX 3LAKA 3M8PB 3V5RA 5KFEA 1WTBA 5EDWA 3DC2A 2AYGA 5D3GA 3NMRA 5FJ4A 2OMOA 2YH1A 1L3UA 1J5OA 3Q24A 1IUJA 1D9AA 2GGPB 3QT7A 4TY8B 3VGVA 1WF1A 3IXQA 3E51A 1H3DA 3MURP 1RT5B 3ISNC 4U7UD 1IBLJ 3FSYA 2CYYA 4BLGA 3KLVA 1UA1A 1LWEB 1Y0HA 3UR3C 4GO7X 5HQ8A 2CWXA 2RHQB 3GCXP 3MFIA 1BLUA 1RBLA 2OPRA 5IZHA 1HNWF 2HEKA 2HNZB 3LP0B 4PXDA 4WXWA 4W4MA 1YJWS 2P9EA 5F3ZA 4B3MJ 1C1CA 3Q86A 3FQLA 2V4QA 1Y5IB 2OSQA 2ZC4A 3W1YC 3OV7A 2XS7A 3NBPB 1U1KA 2R7SA 2HQIA 4JI2J 4RUAA 1RT2B 3T1HF 4L75A 1QAXA 4YB5A 2B51A 3VTIA 3WHIA 5BJRA 2HVHA 2KYXA 4JI4F 1CC7A 1XEZA 4P7VA 4IG0B 3RB3A 4NRUA 3QZ7A 4IOCQ 3MAAA 2QGFB 2HFZA 3ILJA 3CNQP 5J1NA 2D3OR 2ASDA 1WG5A 2AGQA 1N32J 4PWDB 2EFQA 2XCPA 3SYZA 4A47A 2NCKL 2AHOB 3BBCA 1O8BA 3MM5B 3D6FB 1GMVA 3OBIA 4AL7A 3QIDA 5C25A 1PAEX 3P6YC 4ED4A 2BE9B 2GIFA 3D9BA 3UN2A 4IO9Q 4O3SA 2E5GA 3AD8C 4RZRA 2FJDB 2RDJA 1S99A 3SV4A 1OSDA 3I4PA 1NK4A 5D8HB 2E44A 4B9MA 1S7IA 3M32A 3UO0A 3MI7X 4NMLA 4QU7A 3PW2A 4NCGA 4Y6IA 1IQTA 2ASJA 2EWHA 2XYGB 1FT8A 3ZZZA 4OJ3A 3VALA 3KHHA 1U8WA 4FPIA 1S9EB 1RWWB 1TELA 5DG9A 4DL3A 4M5MA 1RWUA 3VF0B 3JSYA 4O4GA 2VG5A 3KLGA 3TQ1A 4ECUA 3RBDA 2E9TA 4B9SA 3K0JA 4EYHB 4NXNF 1RT4A 3IGNA 3PYGA 1JJ2R 1HBMA 1SQFA 2VG6B 2C2DA 2J7UA 2YQ0A 4ZHRA 1WC5A 2HVDA 3QIPB 2Y0SD 1U7LA 2QC3A 4KB7A 1FKPB 3H20A 3MPDA 4KGXB 2B3TB 4KV8A 2DHGA 3ISZA 2OEJA 4K5SA 4OZLA 3WZ0A 3H42A 2IBOA 1DTTA 1UWBB 3W8GA 4CO5A 4ZKAA 1TUVA 5F8IA 3CCMS 2BQ3A 3ENQA 1CJVA 4U8VA 1FJ7A 3P45B 1VIOA 3M9MB 1G1XA 1AFIA 1NHUA 3R6GB 3ILLA 3NGSA 4LF9J 3HZGA 1ITPA 5CA5A 3CVKA 4PRFA 4DV2F 4ICLA 5AE1A 2MGZA 2QMWA 4TQRA 4C6AA 2JHEA 1T3OA 4DSEA 4OI0A 4I68A 1F6TA 1P27B 4F3MA 1YIJS 2QLJB 5DZ7A 5LXRA 4DL4A 3FCWA 2V63A 2R3VA 2VV5A 4V1Ak 3T1AA 1SL2A 4WFYA 1U0HA 3M2UA 3S01A 3IA0A 1ELOA 3MPUB 4LRBA 4C8ZA 3T6BA 2G13A 2ASLA 5KFAA 4DS5A 2LXFA 2YQ1A 5LMNJ 1R31A 2BM1A 2R7UA 2M52A 4ZOSA 3MEEA 2IM2A 1OO0B 3AT1B 4M5GA 3Q8RB 3DDNA 1DURA 4CP5A 3DHWC 5DDQC 2M4MA 4CYUA 1IM6A 4DQSA 3ITHB 2DIUA 3KLFB 1WSVA 3M2VB 3PEHA 4RU2A 2LEPA 1PKUA 2MSTA 8ATCB 3JYTA 2VPZB 2KTQA 1CJTA 3TZWA 1KHWA 4PPDA 1ZYQA 1HIYA 4OYAA 3G96A 2LFVA 3PG9A 3RB4A 3OXFA 5D0HA 4QW8A 3GONA 3H7HB 4J5OA 2JDJA 4OIXA 1JXEA 3H8YA 5IV4A 3CJQA 4ZP7A 4KFBB 1HQUB 3QT6A 2F7VA 3P96A 4CO2A 3NNCA 1F9HA 3DLKA 2XS2A 3UVJB 1UW4A 4V19J 4X4QA 1T05A 1VK3A 3CJSA 2A18A 2QLXA 4QWAA 2EC2A 2V68A 3CDEA 4NX9A 5KFQA 3ET6B 2G1HA 1LWXA 3MMCB 4IFYA 4A8SA 1M5KC 4GKJF 4KYZA 1HHQA 3QGIA 4B3RJ 1HL6A 2E9RX 4DUZF 2ZITA 1MWQA 1R6VA 1YDLA 2W4PA 3GSIA 3GTYX 1ZPWX 2V4JB 3C6UA 2CJXB 3OTOJ 2AX0A 2OMLA 4DPYA 2B5JA 3QO9B 3EM1A 4A8XA 1A7GE 2OIHA 1BWEA 1LV5A 5ETQA 3ZZPA 4YN3B 2KXFA 2EFGA 4NLDA 3CCVS 4CDIA 4CZCA 1OS5A 3AA9A 1JLEA 4F50A 4DF4A 4HTIA 2G0CA 5U47A 2V34A 2MHEA 3RAMA 1NH7A 2MKCA 1RA7A 1SH2A 1FK9A 4M5HA 4CTAA 4YUDA 3TUZC 1S12A 2PE8A 2ZC3A 4DV6J 3VAMA 3IRXA 1X4AA 4K0KF 2BJ8A 1SB6A 4RW7A 1VK8A 1AXQA 3HVRA 1FFSB 3UCUP 1U1MA 1YJ9S 2IA0A 2K7KA 2NXNA 3GG1A 4IO1A 1VYAA 3BN7A 2D3O1 1AFJA 3MM7B 4M5LA 2FDNA 1S1VB 2XYPB 3VAFA 3MR7A 3FFIA 2H3EB 1SL1A 5C2CA 2R42A 4LQ3A 3UDCA 1BGXT 3VHQA 5GAEI 2GX8A 3KNGA 3NKYA 1YJVA 2MDAA 5B0GA 4MFBB 4BCAA 3Q8VA 4ZVOB 3K5PA 2W2MP 2WB4A 3Q8QB 4CH0S 2CQ2A 3MMAA 4RR5A 2G2OA 3FZ2A 3ZZTA 1NPKA 2ZOMA 1JLBA 4KPYA 1N36J 2WONB 1U8SA 3DXBA 3EZUA 5B0FA 2CVIA 5KFRA 1LKZA 4Z7CA 5F8LA 1UA0A 3M1VA 1S1WB 4PYAA 5D0GA 1MLAA 5D4PA 3RYLA 5KFNA 3K5LA 2B8PA 4Y2IA 1RT6B 3BH7B 5CQGA 3OW2R 3DM2A 2KG0A 3BJYA 4CO1A 1RAHB 1ZETA 2ZJQQ 1JNRB 3NWRA 3X1LB 3HZEA 3MOZA 4HH1A 4NASA 4URGA 1NKBA 1KSPA 3LF0A 1DJ0A 1EAYC 4DV0J 1U09A 1L3SA 1Y7PA 4CI0B 4QWEA 4LF4J 4LMZA 3QNWB 5BYQA 5E33A 3E8OA 1Q8BA 4OYXA 1SKUB 2WHOA 1UEUA 3F0NA 4WP3A 2FZCB 4MK9A 5ADZA 1NZAA 4KT0C 4TNOA 5C2GA 4JI0F 4K8RA 1HLWA 1DTQB 2HAIA 2UV8G 5SUHA 1VS3A 3B78A 1VHIA 4O23A 4DQQA 4LF8F 1EHWA 1PC4A 5HROA 2MQLA 5HLFA 3C15A 1N32F 1VISA 3OUYB 1RT3A 2MPUA 1MWYA 2OPQB 1EQ0A 1E6VB 5E41A 3BDPA 1NKCA 2BANB 4XDCA 4OI4A 3QFWA 3DLEA 3IR5B 1JIHA 1WC0A 2JLEA 4KGMA 4CM0A 1R6YA 3GWCA 1CSJA 3LOUA 4RW8B 4C98A 2AV5A 4ED0A 3KJVB 2ZH6A 1M5HA 3RTVA 2AJ0A 1IWGA 2MKJA 3C14B 4UW2A 5H9EK 3LWMA 2JL9A 4ZA1A 4RW9A 2PC6A 3UQSA 1T3NA 1RKJA 1SJ3P 1LW2B 1WHVA 1TKXB 5AE2A 2ZBPA 1S1UA 4IG3A 2CG4A 3OFHA 1NK9A 1TL3B 1RHRB 3M8SA 3ZC4A 2B0GA 4LRAA 1CULA 3I96A 1FRJA 3DHXA 4OHWA 4DZDA 3SQGA 1HD0A 1V9OA 2DBBA 3Q22A 3C16A 1NSPA 2AU0A 3M6XA 1R0AB 1MW7A 1A0OB 2WZ1A 3AODA 5L8RC 4MAKA 5ITHA 4G1IA 3BO3A 5IQ6A 2UVVA 2ADBA 3UCZP 4X4NA 3V6DA 3KLEA 1FVQA 2DRDA 2VC1A 3LP1A 2HNDB 2DGSA 2DNGA 5HVHA 1XR5A 2MYFA 4LRDA 2HIYA 4B9LA 4DR6J 4I4BA 2R8KA 3HT0A 3TP2A 4ECXA 2ZZMA 1B0VA 2OPSA 3HKWA 1PYTA 4LF9F 4X66F 3MR6A 3PV8A 4DPXA 1S72S 1DLOB 3JTNA 1TL1B 1WKJA 4W90B 2JH3A 3CDWA 4Q43A 3O3LA 3CE8A 1X8DA 3DDIA 3AD7C 3C46A 3D1QA 2W01A 5A6PA 1NB7A 2PD1A 1OMSA 1U1QA 2MMYA 1I94F 3NAHA 3IS9B 4DCJB 3KLGB 4EI2A 4Z7YA 2YQ3A 1GMWA 2YBVA 4ZP9A 3KK1B 4LVOP 4EEYA 1WOOA 1YSJA 1HBUA 2AZ1A 1RDRA 2MZ1A 3MM9B 1FKPA 2EKYA 3Q8YA 4ZHRB 4LR8A 1MN9A 2EW9A 2V5HG 2LXUA 1CJKB 3VGTA 3QT8A 5LM7E 4A8FA 1UTAA 5BXIA 3T6JA 1N34F 2DHAA 4NLYA 5MLCV 3BQ2A 2I1RA 3P49B 2AEFA 2BRKA 1IKVB 1IN0A 4DUYF 2MLYA 2OO4A 4DQPA 2PN6A 3UN3A 2HHQA 4F02A 4CLKA 4MIWA 5DO2A 2HG4A 2E1AA 2GMJA 2FTRA 3N6NA 4K4TA 1JQGA 4UY8T 1HWKA 2PA8D 2Z56B 1YRXA 5BYSA 1I6JA 4F4KA 3BREA 1CQNA 2Z2LA 2UXCF 1PJ5A 1VQ8S 1N6QB 2YKOA 4OZ0A 2N82B 2JNJA 5FLXY 4OHXA 3QAEA 4FZVA 4UOGA 2DNYA 3I9V9 1KN6A 3IBWA 3QSIA 1RWMB 2IFXA 1SJQA 2JC1A 2UUWA 2KI2A 2VFRA 4TU9A 5A8WB 4DQIA 1Y3KA 4PKDB 3EVOA 4IQMA 5ETRA 2CQBA 1RWPB 2QE5A 5EGYA 4P7TA 3PNIA 1U2FA 2NUUG 5CCLA 4NLQA 1FJEB 3BR9A 5K8PA 4FF4A 4EO8A 4I69A 5KT5A 5KFSA 5DZ6A 2JEFA 1HBNB 4DV7F 4JI5J 4WWSA 1VQ9S 3QWUA 3CJ4A 1RT7B 2WRMA 3F73A 1CJUB 1S4FA 4Y3CA 3ISND 2ZM6J 4WZMA 1PCAA 1HKAA 2GAGC 3AFGA 4NA3A 4QYRA 4J9PA 1VC0A 3EGZA 1KQGB 2CQ3A 3AA8A 2NUHA 1VBZA 3VGUA 4DN0A 3DXSX 1R8BA 3HKZD 2IRYA 1AYEA 3SMZA 4Y00A 5GAHI 2VFVA 3BPSP 3M2RA 4HTJA 2RRBA 1A9NB 2FHKA 2Q6CA 2ZH9A 1NH8A 2F1FA 1HWUA 1HR0J 4L74A 4OZJA 4Y2AA 5BR8F 3M8PA 3D6MB 4EWTA 2UXBF 3FQKA 3V81B 1DBDA 3HVTA 3QGHA 4OYIA 3T41A 3MEGA 2R7RA 2VJVA 3DLHA 3KUEA 1J5OB 2G4BA 2KZZA 4RL1A 4LSZB 2SXLA 1UVKA 3I5AA 3PFOA 1VRQC 1LK7A 1YKWA 2DNOA 1NJXA 5F8JA 4FNIA 3CWJA 4CTAB 4KHPF 1RYRA 1R3NA 2YWGA 2ZDOA 3WIUA 2Z0GA 4USHA 4QOTA 3KXDA 3D28A 4NLXA 2YKMA 1EQMA 3JQKA 2DITA 4D3GA 3MM8B 5KG2A 1LEOA 3D6TB 4ZK7M 5LJ3Y 3OHAA 4RNMA 2V94A 2FY8A 3O8WA 2Y9HA 2HURA 4J9UE 1S5ZA 2DO0A 2X1BA 3K8VA 1WOPA 2CJQA 4DWIA 2UXDJ 2CQDA 4ZVGA 1FKOA 2V67A 4MFBA 2AZ3A 2PO4A 1T9UA 1Q8IA 4CRJA 4EBCA 2MZRA 4H4OA 2C28A 2A6OA 3AXKA 3W63A 2MKIA 1N33F 2DHHA 1UCNA 4Q5VA 1BQNB 2PT0A 2CJBA 1LW0B 1Z2LA 2AJFE 4DV4J 1Z1ZA 2KT5A 4TY8A 1FD2A 1CEZA 4DR5J 1GTEA 2GFFA 1C0TB 2B6AA 2V2ZA 4O3QA 4P10A 3RW6A 3DRRA 4C11A 5C42B 1S97A 3ZTPA 5F0WA 3TQEA 1LXJA 4Y28C 4DV5J 1R7IA 3DOKA 2HHVA 5F8MA 3NCRA 2WVCA 2BEFA 1HI0P 2CG8A 3ILOA 3OQ2A 3VWSA 4GC6A 1XR7A 4K5RA 3V6HA 1RU2A 4U7UK 1RADB 2HNZA 3UFCX 3RZAA 3E01A 2JEGA 3HFVA 4GVBA 2JEJA 4ES3A 3POTA 1PJ6A 2QSFA 1KVIA 2CZVC 1FWPA 2F40A 4N77A 4URQU 2VL1A 5L1IA 5FDLA 4QR1A 4DL6A 5DM7Q 5HANA 2EVZA 5LSLA 4P73A 4ZIVA 3OSNA 2RDDA 3LO3A 2LU2A 3R5DA 2ZZTA 4ER8A 2XTJP 5L9NA 2Y1RI 3AJ2A 5J1EA 1YZ6A 5C24A 2WSFC 4B9NA 1Q53A 2P9CA 4G1QB 4HI2A 1Q5YA 1DZ5A 2F9JA 5HK4A 1VQ4S 2HFSA 2L08A 5KFWA 2V2KA 3D3BJ 4NLGA 2BW7A 1R0CB 1J27A 4EGLA 1BMQB 1HNIA 3TARA 2F5GA 3PZPA 1T03A 2DHSA 3M7VA 3J7A1 4JUZA 2HGLA 5J2QA 1VBXA 4USIA 3GSDA 2LEAA 4ZPCA 3W5YA 2VQFJ 4DCPB 2HFUA 3CCWA 3JQJA 3ONQA 5THWA 5KG4A 1EIYB 3JXOA 3TZXA 3R97A 3TOQA 1IKYA 2EXUA 4M5DB 4DG1B 3KK2A 1SCJB 3K57A 1S9EA 4KHRA 5HVGA 2VC0A 4HHJA 2ZHBA 1FVSA 2W2QP 1S6OA 2WB1D 3BGUA 3H5XA 1NJIT 2ASYA 1VC6A 4X4VA 1DFDA 4DPTA 1D0EA 3PDNA 2CPIA 2RQ4A 2XULA 4ZVPB 3GV7B 2DXDA 4TLRA 2FJWA 4ZVEA 4CYUB 3J7AN 4ZPDA 3PR4A 1S6QB 1UPPA 1RU1A 2N4CA 1T94A 3DLLQ 2VG7B 1VQOS 1S57A 1NPRA 2W4CA 3BGRB 2VKRA 1BQMA 5KG5A 4XDDA 2RT3A 2ZHAA 3V4MA 4YR2A 4DX7A 1S0OA 2XLIA 1SBRA 3SCIE 1N33J 4GMKA 3ZXWA 3C6TA 3GQCA 4OX8A 4R0JA 5IS2A 2QFIA 3FRZA 4ED5A 3MTKA 3BKUA 4RNHA 2KM8B 4DFPA 1EJ7L 2DNNA 4C0BA 2O66A 2WOMB 3IS9A 4B17A 5H9EJ 2POKA 4KBIA 1H2TZ 4ID5A 5KFTA 2EC0A 1FFWB 3J80U 1IBMJ 3O44A 3G8TA 4IRDA 3L4BC 5C7PA 3AD9C 1S59A 3HHDA 2FVCA 2VBYA 3SCJE 2RNEA 1WF0A 3RB0A 2VZ9A 2CKWA 2X1AA 3OR1A 3G6ES 3CCLS 4EK2A 2VG5B 4QZVB 3NS6A 2M9KA 3FBBA 4U9RA 2XMWA 2OAUA 4BWJA 4ZS6A 3H2LA 5HQMA 2HSEB 2YNGB 4A8MP 4OZ1A 4TN2A 3DRXA 3FEYB 1ZTWA 1GK8A 1O0PA 4N8NA 1HMVA 3H59A 1Q81T 4IDKA 2ZH2A 1RYSA 3IWXA 2J8AA 1C2PA 2J0XA 1WSRA 1VIXA 3RAXA 4F2RA 3HK2A 2A6MA 3KUGA 1FNOA 3KHGA 3W9HA 4HL9A 2UUCJ 4LF7J 2BZ2A 2Z2MA 5K20B 3HXMA 4JOUA 3TAMA 3UN5A 4ELTA 1BHNA 3AH6A 4C3MA 4A8WA 2RKIA 3MEDA 5HVFA 4Z37A 2FB0A 4UF4A 5KG7A 1NB2A 3M6WA 2CPZA 3TUJC 4ETZA 5E3CA 5KFGA 4U8YA 2MZQA 5DQGA 4BWMA 3NP5A 1ICEB 3TAPA 3BR8A 3TX0A 1TFYA 3CDBA 3HT3A 4FF3A 5HP1A 1LWFB 2MB0B 5KG1A 1FX2A 1NXIA 5LJ5Y 3B4DA 2NZ4A 2PFFB 1N88A 4YEAA 5IM0A 3CDUA 2AEJA 2D1CA 2ZOGA 4JP8A 3JTOA 2C22A 5EWFA 4PXEA 2E1CA 2W2PP 3UDVA 1S1TB 3MHYA 3N5FA 5DETA 2KVQE 2GA7A 2IC3B 3DRPA 5HBMB 4K4UA 1T02A 1QSYA 3BGLA 3K5MA 2RS8A 3HLUA 3M8ZA 4C9DA 1WEYA 2D3UA 2Z2YB 3AJDA 4J37A 3R2CJ 1RT7A 3FZBA 2DKOB 2J6TA 2HVEA 3W2WB 1ZAVA 3GZ7A 4DV1F 3PCOB 4NLOA 2NS1B 1VQ5S 1HW9A 1RTJB 5DLGA 2AGOA 2FJVA 2HK3A 1N5QA 4LT6A 3QJPA 3DLKB 2OELA 1PG5B 3DGPA 3EDRB 2XQCA 2DVIA 4ZJLA 1H7XA 4RU9A 1RQ0A 5E7OB 3R27A 5AE3A 2YNIA 2B43A 3CIMA 2YKNA 2ABYA 3FGVA 1RHKB 2HVZA 2MSSA 1KTVA 1WEXA 1FRKA 3FMBA 3BN4A 1PBUA 4J7CA 4LIWA 2GVZA 2I0XA 1UVMA 4ZVRB 4ZITA 2CQGA 4EBEA 1N36F 1LK5A 2E5HA 3JYTB 3HM9A 1DTQA 2LEBA 4YP3A 2Z30B 2CPHA 2GJFA 2XZTB 4X62J 4ELVA 3JTPA 1SJ1A 2IM1A 3PFEA 4M5IA 5H9FK 2AP6A 5A2QU 2XS5A 1ROFA 1XIQA 3LP2B 4ITSA 4CLZA 9ATCB 1PGZA 3HHLD 3M9NB 4R8UA 2GJIA 3ZZUA 3B54A 5GAGU 2LQBA 4M5KA 4QU6A 4DOZA 2MZTA 1XK8A 2NXCA 1WHWA 2B8QA 2ATCB 3A8JA 1Q8KA 1X5SA 3BPDA 3DOLB 2GIRA 2DY9A 4DL7A 4LFCJ 2ZE2A 4FYYB 2ACMA 4UUXA 1GNKA 4K4XA 3MMBB 4QWBA 1FFGB 2HRYA 2PEHA 4RBTA 8AT1B 3T1HJ 1TV6A 2BJ9A 3RUBL 4EO6A 2E7XA 2UUAJ 4N41A 1S1UB 2HFOA 2V2QA 3CO9A 4IG3B 1UP1A 4BC9A 2KXNB 4M1KA 4W92B 4HVZA 4JI3J 4DBQA 2L9NA 3M05A 4CNZA 2FQQB 2H4WB 1XMBA 1FRMA 1RSCA 2CUYA 2PIIA 3K8WA 2HFVA 3LALA 1FF2A 2NSBA 2HQGA 2XNRA 2RD5C 4DR2F 5HROB 2C2NA 2D3ZA 1IWAA 2F9DA 4LSLA 2RVJA 3PJWA 2VG6A 1TVRA 4OI2A 3DOMA 3DU6A 2RUGA 3BQ1A 1KBRA 3BBBA 1SH3A 3Q8SB 3SV3A 4X2BA 3ZNUA 3UD5A 2EPIA 4RW4B 1DTTB 3GFXA 5I42B 3D0GE 4Y2MA 4OFZA 1FA0A 1FEHA 4ZVSB 2VPYB 4J9NA 3AOCA 4CH7A 3C14A 2F8MA 2V69A 2ZBIA 1DLOA 4C3LA 3CC2S 3GPAA 4P2XA 2VU5A 4RW9B 1KQFB 4K4VA 1RAAB 2OSRA 3D66A 2Z58B 3DI6B 1X5PA 4ICLB 2CNLB 4ZCLA 5F3TA 4F67A 1AW0A 1DQAA 1SKRA 3MECA 3OVAA 3BSAA 3FBCA 3JQMA 2QA2A 1NUEA 1F3FA 4HLBA 4K2JA 2BA9A 2RAQA 5D77A 3ZTSA 4N5SA 2HLUA 1H98A 3IR6B 1VR6A 3AXMA 4O3RA 2VDHA 1FTRA 1KLMA 2GAHC 4TVAB 4CLTA 2YKPA 1HI8A 3MM9A 1YVFA 1U1LA 1I51B 4XPCA 4JI6J 2BM0A 4KGKA 1KFDA 2YX7A 3JSBA 3QGGA 3B4MA 4Q8EA 1Q7LB 1XNRJ 5AXMA 3W66A 2RH3A 3KLFA 1NCLA 3FEZA 4OLPA 4I2QB 3R1HA 2JEIA 2DJWA 2KFNA 4JV5J 3THVA 1C1BA 3F56A 1TMJA 2A10A 3LPEA 3I56S 5KAKA 3W5XA 1CC8A 2ZNZA 2CZ4A 4O3OA 1Q8LA 1IKYB 1R8PA 1A6LA 2Y3YA 3O1LA 3GV8B 3RB6A 4ZJQA 1HQUA 4AXJA 5I3UB 4DL2A 1AT1B 2W2OP 3H5YA 5DGAA 3NCQA 2DPJA 3LPYA 4X4UA 4WPAA 2ZBQA 3SSRA 4IH6A 4H54A 4HACB 4EUVA 4F26A 2MQOA 2DK2A 4C8KA 4CLPA 4L3KA 3I5BA 4I7FB 1VGYA 3PHTA 2PA3A 5CZXA 1VJWA 1YBAA 2RIJA 3FEXB 4ZVHA 2FD2A 1HNVB 2RE1A 3BEGB 2ILZA 2XY5A 4NCBA 1VRUA 4RPFA 1FDNA 2ILYA 5M2PA 1RT4B 2D9OA 4P72A 3QLHB 3VZHA 2DNRA 3MD3A 5A8WA 4GRSA 2M70A 3BF4A 4NYPA 4X4OA 3G9CA 3SXLA 5LMNF 3QYYA 5JVGQ 1OPZA 3KNAA 1CS4B 1FDAA 4OZ3A 2J9CA 2P9GA 4GKKJ 3NOGA 2E1MC 2L9DA 3I0RB 2C42A 2QMXA 1QAYA 2GC8A 4LJMA 4RJVA 3SDEA 1FK9B 9RUBA 4CNYA 3UNGC 4YDDB 1VLYA 5HATA 4PG7A 4AD6A 3MR3A 3MD1A 3GYXB 2MGZB 3FRYA 4WIQA 3CD5A 4FF2A 2IMOA 4LR9A 4WYWA 4F3QA 4KH0B 1QSSA 1YBTA 2OP5A 3CB4A 4U6PA 4Q0BB 1X7VA 1MROB 1PYOB 1T05B 2FVSA 4O3PA 2XZWA 3TJAA 3W5ZA 3S7RA 4KKOB 4A48A 3CJ3A 4CLFA 1B3TA 3C2PA 1RLDA 1Q79A 1YZ7A 3N01A 1FERA 1JLGB 2CQ0A 4YOEA 4Y34A 1IKWA 2V4JA 3MPVA 4OJ1A 5GADI 2E5JA 2LCWA 2R2SA 4F0KA 3QATA 2VODA 2HHWA 3DMJA 1N5VA 1EX8A 2BKPA 1HFEL 2F8EX 1XC9A 3PRBA 1OQ6A 4I6YA 4F0HA 3M8QA 2B56A 2FLOA 4C8MA 1RTIA 1F9EB 3IGVA 2CQ4A 3PRDA 1XERA 1IBCB 5ETKA 4LSNA 3AHPA 2M8DB 3ZTRA 3ZTOA 2DNMA 3M6UA 4O44B 2D41A 1N6QA 1Z4UA 2J7KA 4C48A 1YK9A 2HHPA 4OZ5A 4OYWA 2OGUA 1WNEA 3IC1A 3EWGA 3DYAA 3GIRA 2LLZA 3IO1A 3L7PA 3LTOA 4MKAA 2D9PA 3HHLA 4H4OB 4NLUA 5B0AA 1G2EA 2DXEA 3VAHA 3O5TB 3C8YA 3HVTB 4WCEQ 1VQMS 2NLWA 3EDQB 2AWZA 4FKYA 5I4MA 1WG1A 4X64F 4J9LA 1EETA 3UDEA 3QPIA 3OFEA 3PJXA 2OLWA 3KTQA 4UOHA 4ZPBA 3T5HA 1HQEA 2F4FA 3G8SA 4DR5F 4K4ZA 2VH7A 2DNQA 1YLXA 2W9BB 2K7JA 2YKMB 4YY3J 4C8NA 1VRTB 2RRAA 2EFVA 4L72B 1ZTTA 1Q7YT 3EVWA 4MYTA 4ED2A 1FNXH 3DLBA 1FESA 1VQNS 5HL7Q 1JJ4A 3NG8A 4LF6F 2QG9B 2WVDA 3E01B 5E0OA 5J2MA 3PX4A 3B82A 1F0XA 4FXDA 1R8CA 1KP6A 2XO6A 1EKRA 2ROEA 4ECVA 1TK8A 3OTBA 4NYOA 3JB9k 1GQEA 4JYAF 1LW2A 3Q8UA 3NL0A 1R8AA 1BWVA 4G6VB 4C8OA 2X51A 2MQQA 1RUSA 2MZJA 2VA3A 2D69A 4I0WA 2P8IA 3A4TA 4BBYA 4XIUA 3UDLA 4IR9A 1R0BG 3SCLE 4HDGA 4P2FA 4TYBA 2CPYA 2F4VF 4DDFA 2MQMA 2GHVC 1UMJA 2V0NA 2N3LA 4FVCA 1WKLA 2BX6A 3MEGB 4JI7J 2XY6A 3N0VA 4QYZJ 3HCXA 1WC6A 1Y11A 2O01C 2XB2D 4G1QA 4IOAQ 2B9YA 3GFZA 3I55S 1UPMB 2QEXS 3DOKB 5HLFB 4I2PB 3BYRA 3GLJA 5KG3A 3G71S 3QJJA 1IBMF 5SZTA 1M5VC 2HMIB 2C2KB 5CABA 4NLPA 1BC6A 3K2YA 2AD9A 3ETMA 3RW7A 2CNOB 5C25B 3V4IA 1XTZA 2P6TA 4ECZA 5KFKA 5B0BA 1DHMA 3KDNA 5KOXA 4B3TF 3OVBA 2UU9J 1L3KA 2Y1IA 4P52A 1FKAF 2HZCA 1RWOB 2CPEA 2ZEJA 4KIAA 4B08A 4B9UA 2F3JA 3G8QA 3TYTA 5L39A 1D9FA 1PBAA 5G0RA 3HPOA 1Q82T 1DRZA 3PY8A 1QVFR 2CNKB 5HJXA 1QDUB 2WSEC 1FXRA 2F8HA 4K59A 2AGPA 1H2VZ 3MM6A 1N54B 2BJEA 4ATNA 2BRLA 4FP9A 3SFGA 2C2RA 4PR6A 2NREA 1REGX 1RWNB 2GO8A 1S7HA 2IVMA 2WAQD 4KGZB 4LRCA 4O4GB 4DX6A 3DFEA 3FMWA 1R0AA 1QAJA 3C15B 5EUHA 3RRKA 4LF5J 1I3OB 2KM8C 2XYHB 2H9ZA 2NPFA 2VICA 4H4KC 1GMWD 1KONA 2ZDPA 4MJKA 2C3OA 2IDEA 5AXKA 4H4MB 5DQIA 4IOBA 2KFYA 1X9SA 1K9MT 2DCLA 5L9XA 1JLCA 3CCZA 4RLEA 3KJVA 3TJ9A 1CJVB 1MN7A 2OPSB 2DR6A 3POTB 3PYDA 2VASA 4R25A 2PMHA 2JWNA 4QBUA 3MR5A 2ZH4A 1I94J 3O6QA 1QTMA 2E1PA 4M5DA 1ZA1B 2E1RA 2CXEA 3FSXA 1RHQB 4CLUA 3J7YI 4MTPA 5IQQA 2XSFA 1ZM9A 4WIIA 3PIOQ 4KHMA 2HGMA 3TA0A 5LOQA 2IDLA 5CYMA 1FJGJ 3AQOA 2MKKA 1MNEA 1X60A 1JLFA 2MXYA 1ZBTA 1S48A 2QA4S 2FIUA 1YJTA 1Q16B 1ZS6A 3RBEA 1YITS 4LF4F 1N34J 3HVAA 5M2UA 3PKMA 4H4KA 2MKYA 4PWWA 1HBUB 1V5VA 2VDIA 5LXYA 1HMVB 3I5CA 2ZNYA 1DY3A 3MEEB 4DR1F 1CJKA 2DH8A 2XMKA 1HYSB 3KLEB 2DGQA 2KYZA 1X4DA 5KFDA 3KK3A 2X7IA 1VQYA 1IM4A 4HT7A 1RK8A 2KRRA 1URRA 3PACA 4ZPTR 3EX7B 2XC9A 2BUNA 4YB7A 3OLBA 4WKRA 3CCUS 3G4SS 2R2RA 5GADU 2LDIA 1UFLA 2HWIA 3QFHA 2XMUA 2N4DA 4M63A 1NK8A 3PO4A 2GO9A 1WDTA 1DAXA 4AE5A 4AUKA 1SJRA 4DG1A 4J9RA 1IJEB 4B9TA 2J76E 4L3NA 2AYBA 1UAWA 5T14A 3HHKA 2Q66A 4LF1A 2XI2A 1EP4B 1QY7A 4LVNP 4PABA 4R5PA 4UZBA 1HWJA 3W7BA 1OJ4A 4OI6A 5KFJA 3TVKA 4IFYB 3Q23A 4OX7A 5HMXA 3KUHA 1S1TA 4QIWD 4IDKB 2J0QD 1PILA 4TU8A 1V5IB 1GT8A 2MKSA 3C6UB 1NMEB 1H0HB 4E98A 3RJMB 4ELUA 4QW9A 4FF1A 1LFPA 3R9LA 1Q0NA 4UY85 2BJ3A 3NNAA 1DQ8A 2PI4A 2JFDA 2GV1A 3TRGA 3KKFA 5DGBA 3KG0A 3BO2A 1BQXA 1KC8T 2OTJS 2MEWA 4QJVA 2OFHX 3KDOA 3CC7S 3WX8A 3NMAA 1HNXJ 4IYQA 2ZD1B 3NGDA 2A2CA 1VQSA 2CDQA 3US5A 2ALYB 4CM2A 3UD4P 4ZVTB 2X3DA 4ID5B 4ANCA 4N56A 3OSPA 2ZKUA 2IYGA 2M0GB 4M8LA 1C4CA 1FE0A 1YJRA 4RUBA 2HRUA 3R7BB 5D4LA 4BC7A 3V6KA 1M5PC 7FD1A 4V19X 3N9UC 4N47A 5CD4A 3HJVA 1ZAXA 2JVOA 5A8RA 4X66J 2P6SA 4I1TA 4K4WA 2W7PA 1U6ZA 3HSJA 2BE2A 3L9ZA 2KH9A 4ED6A 3LANA 4X64J 1NU4A 2BJDA 3P4UB 1RP5A 1N5TA 1OWXA 5CYJA 3J7ZT 3FK4A 5LMUJ 3V81A 1RWXB 3CD7A 3RAQA 3T1YJ 3Q89A 4ZLPA 2XMVA 4R8UB 2CNNB 3SSQA 2CJKA 2GHPA 2RB7A 3KLIA 5DJBA 2ZH5A 1JLBB 3OXGA 1U45A 3MXHP 4HKQA 1P1LA 2QIFA 3CGIA 1RT1B 4P71A 3MGJA 5D0EA 2L41A 4DSLA 1I1GA 3HSGA 4ANDA 2ZM6F 2ZOFA 4NLRA 4KHPJ 2VBXA 4LFBF 4JB8B 3FCVA 3L95X 4CLSA 2YNIB 3NLCA 2XMJA 2HGNA 2YVSA 1WC3A 3LAMA 1QVGR 2NPIA 5LSOA 2NSCA 3FDSA 2KVIA 1XN9A 3IM9A 4ZVQB 3PKYA 1U1OA 3EPGA 2IJFA 1NO8A 1PYSB 3R5JB 4LF2A 1GXUA 2L9WA 2G2ZA 3QRPA 1LNQA 1YJUA 1HARA 2PDAA 3S1TA 3NXZA 3NOCA 2W25A 5KFCA 2X1FA 1JKHA 4JV2A 5M2RA 2F63A 4LSLB 5ETOA 2IC3A 2RF2A 3DRPB 4EMDA 4ED1A 4CIOA 1ZH5A 1FDDA 3JSRA 3A8KA 2EBEA 2LQJA 3AJ1A 4IH7A 4WU3A 2GIQA 1YG0A 1UFWA 3BGOP 3BKTA 3R8YA 2K1RB 3CC4S 5DM6Q 2KT3A 3DRRB 3PM9A 4HR2A 4C11B 3DNCA 5C42A 1GX6A 3ZZOA 5IT4A 3HMJG 3TO8A 3WBZA 3M8RA 2RU3A 1AZSB 1HNIB 4G3IA 3PYFA 3DDKA 1S76D 4DHVA 2ZE2B 1VMBA 4P6QA 4QCLA 2XLKA 1SC1B 1VJQA 2RSQA 3MM8A 2NXEA 4M94A 3CSKA 3DGPB 2JSXA 2ADCA 1VCTA 2DD8S 5GMEA 1SC4B 3UR0A 2AYEA 3MPYA 2JLFA 1NBEB 2YKNB 4OMFG 3UWTA 2U2FA 3TX8A 4DR7F 3N4WA 1N5SA 2QL9B 4IFVB 4OZNA 2R7OA 2GVZB 3GIMA 4WZQA 1S6UA 2I5JB 2D74B 5K8OA 3VQSA 2I2YA 2Q1LA 2Z4PA 4KJIA 4DV3F 5JMNA 3GJQB 1NEEA 4KPCA 4C2MA 1NHVA 2WSCC 3NGTA 1VQLS 1IXKA 2IVYA 2IMWP 1OY8A 4LF7F 1T95A 5E3PA 3LP2A 2VKZG 2DGUA 4CQ1A 1H72C 1WELA 1Q4RA 3MCSA 2CWKA 4F4AA 3MOJB 5I42A 4PQUB 2HBZB 1F2HA 4I64A 3BO4A 2X1GA 2GQQA 4LBHA 4A8KA 5B0DA 4DCOB 1RAFB 2QLWA 1NSKL 2JZ5A 3WQPA 5KFOA 3MFHA 2A1BA 5GAGI 3E2EA 2H5EA 3GE9A 2MJNA 4OYMA 4OHZA 5KFXA 3LW5C 3MCNA 2ZWPA 3Q8PB 3DLGB 4X84A 3M6VA 3VV2B 1ZOTA 3MECB 4OYZA 2WOMA 3IG1A 5DRKA 2NYHA 1FJCA 4ILRA 5G0RB 3CMES 1WI8A 3T1YF 2QRRA 2J6UA 2ZH8A 2R9LA 2DTJA 1JK9B 2MLXA 5KFVA 4Q44A 3G6YA 4FXWA 4JI5F 3CD6S 4NZ6A 2W7OA 1RJJA 4WFZA 1W26A 1UZDA 1V3RA 2BKOA 3CTRA 1RLCL 4YB6A 2W8LA 5DLFA 1NK5A 3QLHA 1GMUA 5J1EB 5DG8A 2R7VA 1I5OB 3O2IA 4DR3F 3DOMB 4DN9A 2JFKA 2HYIB 2FJBB 1C1BB 1H74A 1JMTA 2XBPA 2ZVIA 1XQIA 1Q95G 1JJCB 4NEZA 2Y1JA 1NJZA 2DEIA 1K47A 2W9AA 3QQCD 2CQ1A 1HR0F 2ZH7A 2CPXA 2RQCA
chains in the Genus database with same CATH topology
1SJFA 3U7JA 1S0NA 3N28A 4X4RA 4FXVA 3CJ0A 4YDXA 1S79A 4JBCA 3TA1A 1X9MA 2RQKA 3TNVA 2RS2A 5F8NA 2VOPA 4FBUA 1MROA 4I7FA 1R89A 2DGWA 3OPKA 1SKWA 1KQSR 4KKOA 4B3OA 2N7YA 5KG6A 1HBOA 2KXHA 4KE5A 5DQHA 1YHQS 4WFXA 2R8IA 1YRUA 2BYCA 4WTYA 3T9NA 1N5YA 1KOOA 3CCSS 1S6QA 2IAJA 2VQEF 4HI1A 5HBMA 2UU9F 2LU1A 3CPWR 1BQMB 3QJLA 3UW1A 1U25A 1O51A 1QE1A 2MZSA 3OTDA 1FXLA 2LDYA 2EI5A 2UUAF 2CJ9A 5KFHA 1HW8A 1HI1A 3KMSA 1X4CA 3ENWA 3RR7A 4FNHA 4P2SA 3SSSA 2FPHX 4K4YA 1YRTA 2DGTA 4ES2A 3C66A 4TXSA 3R3TA 4ZCIA 1X4EA 2HS4A 2K8GA 1Y4ZB 3DN9A 4NYZA 5B7WA 1MWZA 3I6PA 3FJ2A 1OPIA 3D54A 4CO4A 1VRUB 5C5JA 3EZ5A 1EETB 2CPXA 2KFZA 1MU2A 3MZIA 3SFUA 5LMUF 2Q3PA 3OVSA 2GQ2A 1HQEB 2MQNA 3FNNA 2L3MA 3KHLA 2VPXB 4PQAA 3CEDA 1HNZF 1QLNA 2HPUA 1RTIB 5KFMA 1Y3JA 2B4VA 2BBEA 2YWFA 2VD3A 5DDRC 4EYIB 2CPJA 4DMZA 5J2MB 4NZ0A 2WBRA 5K14A 4JV5F 4KO0B 2WBMA 5LT5A 5HP1B 3D1HA 3IFEA 1FO1A 4CH1A 2DR7A 5AXNA 1JLGA 3K7RA 3IRWP 1IKWB 3GILA 2V9WA 3OL9A 1TKDA 1F5CA 2VFTA 4YFUA 3KMQA 1Q78A 1C4AA 4Y65A 1JLAA 4Y2KA 3N5BA 3OL6A 3BB5A 3MUMP 4GO5X 3K5OA 1D8ZA 4C4WA 1ZM4A 1U1PA 4RW4A 1D1UA 3CXCR 2IRUA 3UE2A 3VAGA 3PX0A 1LXNA 2GQCA 1GTHA 3CD0A 3AY0A 3D1OA 5KFYA 1GAOA 3F41A 5FIIA 1K8AT 1WEZA 2FGOA 3CJKB 3THTA 4I67A 3TUIC 1KEKA 1N8RT 4ZPWR 5B0EA 2UUCF 2UXDF 1TV6B 2R8HA 4JI1F 3D0IE 2ATLA 1FRIA 1M90T 4MIBA 3PW0A 4LFAF 2R7QA 4Q2LA 2NR0A 1GH8A 3M30B 3GG0A 5E3AA 3OL8A 3CIZA 2O5DA 2R8JA 3BGFA 2HFNA 1RT5A 5MAOA 4AL6A 3LH2S 1FXDA 1W25A 2LVWA 4I2PA 2UVUA 2KHDA 2W9BA 4I2QA 4FYDA 4LIRA 5T7LA 1CPZA 4Y2CA 2OPRB 2IVFB 1LOUA 3CJ2A 1JLCB 3DOLA 1C1CB 4DL5A 2GNKA 2HHUA 4PG4A 1X0PA 1HA1A 3U02A 3WC2A 4BS2A 1U47A 2I38A 3DI6A 4WE1A 3R1LA 1XMOF 3LGMA 4PCQA 2J0SD 1TP7A 1RTDB 4LUBA 1W2BR 4FS1A 2OFGX 5H1SV 3HHNB 2IHR1 2XSJA 2E29A 1QAIA 3MF5A 1N48A 1IR0A 4PWDA 2XCAA 4ES1A 2J7WA 2XNQA 2C3YA 5BYRA 4Z2XA 4DSKA 2HQ3A 1IKXB 2APOA 4QPTA 1XBWA 4Q45A 1D9DA 3L09A 4OV1A 4H4MA 2YKAA 5FD1A 5D4OA 2HMIA 3UI3A 3BGRA 2DRBA 1XNQF 4X4NA 1WG4A 3P3DA 3QAUA 4RUHA 5HMWA 1R43A 2W8KA 1U1NA 2VUGA 1KD1T 3V4IB 1IBKF 3IG1B 2J0WA 4G1PA 2EFPA 2V8HA 2DIVA 1UVIA 3KLHA 1S77D 5A8KA 3KHRA 5J2PB 2XWXA 4NRTA 3CCRS 5K9FA 1NK0A 4ECTA 1S0VA 2RQMA 4WKYA 4CT8A 1R27B 4R5PB 2PI5A 1FHTA 1JLFB 4J9KA 5EWEA 4F4WA 5DDOC 3EXYA 3P5TL 2V8GA 2NQPA 1S9GB 1OIAA 3K58A 1H38A 1LWCA 2OKQA 3OR2B 1U6FA 1FRHA 3DMJB 3L7OA 4HH0A 5F8GA 1QUVA 4DF8A 3M8QB 4C7QA 2K3KA 4OI1A 3OJUA 5L38A 1M5SA 2CRLA 4XO0A 5I3QA 3I0RA 3SDEB 3IAM9 1YTYA 2E9ZA 2XMTA 1B0TA 3OTEA 3G86A 3MEKA 2V9KA 3EGWB 3RU0A 1XWLA 3KYLA 1VFJA 4FN5A 3NCPA 3H40A 2COLA 1QM9A 4AYBD 2ZH1A 2ZJRQ 1Y9OA 4J9QA 3MAHA 4RNFA 2BQRA 2LA6A 3MDFA 2ZJPQ 2XWYA 1DQ9A 1QUPA 4RNOA 2QSWA 3UCGA 5EN1A 2YKQA 2VPWB 1TKZB 2JJ4D 3I87A 3T19A 3CDAA 3OXLA 2RDIA 1SL0A 2FJEB 3ZZ0A 1U26A 4NLWA 2GW8A 4WU2A 1SI9A 1SH0A 4KQZA 4WJBA 2XMMA 4KRWA 4MMOA 2FVPA 1RGVA 1E6YB 5KT6A 3CCJS 3I82A 2AYMA 2IJNA 5J2NA 4PXBA 1PC5A 4PUOB 5E3QA 3F44A 3CULA 4Y0FA 1WACA 3EPIA 3MMCA 3U27A 4YR3A 1VQ6S 3RR8A 1HNXF 2HNYA 2PGCA 1CG2A 2IM0A 1J5EF 1EP4A 1TL4A 3ZZRA 4MKBA 4LF5F 3CUNA 4KTQA 4A8OA 3HHLB 2M88A 3HF5A 2YNFA 1ZAWA 2N7CA 4WK1A 4F4YA 1CVJA 1JLEB 1JWWA 4ECSA 2CFXA 2GGPA 5LSRA 1X4HA 2J9DE 2W9CA 1S0MA 2O3DA 3KLIB 1G7CB 4F4ZA 3J80Y 4C97A 2ZUGA 2LA4A 2W4DA 2R8GA 4XAKA 5DS7A 1GX5A 2FHJD 5K14B 4B02A 3TQ1A 5HMZA 4RW7B 2QA4G 4A8QA 2C3UA 2KN4A 1VRTA 1Y5LB 2U1AA 5F41A 3S8SA 3H2UB 4PG5A 3VR1A 1MMNA 1U48A 3DRYA 1TK0A 2HW3A 1S1VA 3I0SA 3DLJA 4DV0F 1NAQA 5K5MA 4O44A 2G9OA 4GKKF 1U49A 4NZ7A 3BSCA 1UETA 1H6KX 1UKUA 2ACYA 2C2EA 4O3NA 5A8RB 5KFPA 3PW5A 2QV6A 4DPOA 2VFSA 4O4RA 1D8YA 2ALZA 2DCUB 1Z2ZA 1JKHB 2FLNA 2WK4A 3H98A 1MMLA 4ZPVR 5B09A 4M95A 2QZ8A 2WONA 4X62F 1S1XA 4NLTA 3X3UA 2I8EA 2XHWA 4ZDNA 4C0HA 3K5NA 2CQPA 4YY3F 3MM5A 1NK6A 1TVRB 1F60B 2HS0A 1JB0C 1SIZA 4MH8A 5GMKa 3CJKA 2GCFA 3J7Z5 5IWAF 3DU5A 2YH0A 1KVJA 1REVA 1RTHA 3M32B 3JSMA 3PVXA 2ZFHA 2J9EA 4WK3A 2VFUA 2DT9A 3HFKA 3KG4A 2R2TA 3BSOA 2DGOA 2DB1A 1RT2A 2B7CB 3NGKA 2BXJA 2I9SA 3QWPA 4IFVA 4RWXA 3G6VA 1URNA 3LUYA 3M30A 1UEVA 2CQIA 2YWKA 2C3PA 1L3VA 4UUWA 2BV3A 3LWLA 4CCHA 4HYKA 2E5LF 2YNHA 1RT3B 2OPQA 5JUMA 3MM6B 4ECWA 3IAS9 4KV8B 1JXLA 2BQUA 1X9WA 1HHSA 4OLOA 4ZP6A 4NLVA 4ILLA 3BM7A 2AW0A 4F2SA 1KS2A 3TW0A 5B0CA 3LQVA 1UJ5A 3DLGA 3GB0A 3J7YU 5J1PA 4WE1B 3PW4A 4N76A 2R7TA 3WDOA 4TU7A 1XMQF 3BDEA 1W2IA 1RTDA 2UVRA 2XSJB 4PG8A 1TFWA 2M3DA 4B3OB 4ED8A 4CT9A 5HI7A 4KAIA 4DSFA 3CF5Q 2NXUA 5CXTA 2J9DA 1KLNA 2LQ5A 1ZM3A 3UPFA 2P5VA 3ULHA 4B3SF 4NXMF 2FJXA 3TI0A 3KOAA 2B4UA 3D5MA 3ZFVA 2JVRA 2LECA 5B08A 2A3JA 3HVWA 4QPXA 3FCHA 1NJYA 4DSIA 2E7WA 3KK3B 2XG8A 4PWUA 5CCMA 1N56A 3Q2TC 1G6BA 4TKTA 3QZ8A 1P9QC 1S49A 4TY9A 3PO5A 3A8EA 4DL0C 1X5TA 4Q7AA 2IM3A 4UQTA 4A8YA