2G4BA

Structure of u2af65 variant with polyuridine tract
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
172
structure length
172
Chain Sequence
LGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3'
publication title Structural basis of polypyrimidine tract recognition by the essential splicing factor U2AF65.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 44
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g4bA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g4bA02
4UQTA 2CPIA 3OW2R 2FY1A 2JX2A 2BOPA 3J7ZT 2HZCA 1FT8A 1KQSR 4A8XA 1WTBA 1ZZFA 1H2TZ 2RUGA 2RRBA 3CD6S 1WHYA 4Y0FA 1Q7YT 5D77A 3R1HA 1FO1A 2M52A 1N54B 1HD0A 2JRSA 3R1LA 1UAWA 1WF0A 1A7GE 2D9OA 5DDRC 1YIJS 1W2BR 2KYXA 3S7RA 1OWXA 2FC9A 3SDEA 1FJCA 1JJ4A 1WEXA 2DNLA 2G1DA 2NLWA 5D78A 1DBDA 4OZ0A 4EGLA 4IOCQ 1X4CA 5IM0A 3CCLS 1U1QA 2OSRA 1VQ4S 1VC5A 1DZ5A 2OTJS 1WEZA 2DO0A 1YJWS 4WCEQ 3BS9A 5MLCV 3L3CA 3BO2A 3CUNA 1FXLA 1VBZA 4Z2XA 2MQOA 3RW6A 4YUDA 1X5TA 1KOHA 3B4MA 2E5HA 2DK2A 3I55S 2DNKA 3THTA 3G8TA 3D2WA 2RQCA 4QQBA 3VAGA 2M7SA 4LIRA 2CQ0A 4UY8T 4C4WA 4YOEA 3CCES 2EVZA 2RNEA 2XSFA 1YJ9S 3S6EA 1N88A 3CC7S 5IFMA 4QPTA 2CQ3A 3P5TL 2M8DB 4TU7A 4CH0S 4IO9Q 2Q79A 3G4SS 5LJ3Y 3TYTA 1FHTA 2KM8C 3UWTA 1JMTA 1UFWA 1NO8A 1ZZNA 1FJEB 2YH1A 3EX7B 1D8ZA 1X4GA 3G9CA 2I38A 1PO6A 2B0GA 1VQPS 3VAJA 3VAFA 3G8SA 1B7FA 3CMAS 5DDOC 2MKHA 4CQ1A 2ADBA 3MURP 3LPYA 1NJIT 1H6KX 2MZRA 2CQBA 2CPFA 4M5DB 2XS5A 3DLLQ 2DGWA 2N3OA 2KRBA 2LQ5A 2E5GA 3CCQS 4PRFA 2VOOA 1M5OC 1U6BA 4TU8A 5BJRA 1KC8T 5GAEU 2I2YA 2KG1A 3Q2SC 2DNYA 3BEGB 3SMZA 1X4HA 2DIVA 2QFJA 2KVIA 2KU7A 3R27A 3MI7X 1X4FA 2CQ4A 3Q2TC 2DHXA 1U1KA 3EGZA 3BO4A 1WF2A 2DB1A 3UCZP 1VQLS 2DGOA 2HGMA 5LXRA 1N52B 3VALA 2RRAA 3P6YC 2J0QD 2DNPA 5GAHU 4FXWA 2CPJA 5CA5A 1VQKS 3UCGA 2RT3A 3U1LA 4WFNQ 4ERDA 3CCMS 1U1NA 5CXTA 2AD9A 2MZQA 2MQLA 2MZTA 4F25A 2DH8A 2CPZA 1X4DA 2LYVA 3TO8A 2DHSA 3CC4S 2JVRA 2CPYA 4LJMA 3TP2A 3VAKA 4QU6A 2X1BA 1Q86T 5CYJA 2MGZB 2N82B 3CCUS 1IQTA 2MQPA 5GADU 3MOJB 2HGLA 2DGSA 2X1FA 2LXUA 2XNRA 2CQIA 3RW7A 3PIPQ 1U1MA 2FPHX 1VQMS 2WBRA 2MQNA 4WF9Q 1SJRA 1WWHA 4WFBQ 1WHXA 2OJ3A 1PGZA 1VBXA 4CIOA 3N9UC 1U1OA 1AUDA 1YWXA 3MUVP 2LEAA 2MY7A 3CF5Q 2DH7A 1M90T 1R8PA 2MSTA 2DNGA 2DO4A 3CTRA 2MSSA 2N7CA 3CCVS 1SJQA 1UW4A 1M1KT 2DISA 5DDPC 3H2VE 3SDEB 2CQ1A 1K8AT 2CPXA 3U1MA 3J7YU 3ULHA 2UP1A 3CCRS 1X5PA 3MXHP 4C7QA 2DGUA 4J5OA 5IM0B 2HGNA 1DHMA 4TLQA 1DRZA 2MXYA 2YTCA 2FHOB 3US5A 3NNHA 5FJ4A 2U1AA 3NS6A 2QEXS 2MKKA 2KN4A 2X1AA 2CQ2A 2MKSA 2RVJA 4OZ1A 1YTYA 2HVZA 3BO3A 1SXLA 1X4BA 1CVJA 2XB2D 2KXFA 2DNMA 3ZZYA 2CJKA 2KHCA 2F9JA 3NMRA 2MKIA 3FEYB 2F9DA 5GMKa 1Q81T 2MZJA 2LKZA 2MYFA 4W90B 2LMIA 2DHGA 2LCWA 2YKAA 1R8HA 2DNRA 1S72S 2KXHA 3HHNB 2OTLS 1XN9A 2DNHA 4FXVA 1X5OA 3UE2A 1ZH5A 1VC0A 2VOPA 4P6QA 3G6ES 4C0OC 2AYGA 1OIAA 2DGXA 2KM8B 2KH9A 1HA1A 1S79A 3EGNA 1WI8A 2VONA 3MD1A 2G0CA 1VQOS 2ZJPQ 1YJNS 1U2FA 2DNNA 2LXIA 2KRRA 4LMZA 2V94A 1HD1A 5EN1A 2JWNA 2U2FA 1D9AA 1WHWA 2GHPA 1WEYA 2DNQA 3I56S 4CH1A 2ZJRQ 5LXYA 1U6FA 1JJHA 1VQ5S 4WKRA 2RQ4A 4V19X 2CPDA 1H2UX 3CCJS 2M88A 2N3LA 1VQ7S 2HYIB 3P49B 1RKJA 3UD3P 2KG0A 1WF1A 2EK1A 2MQQA 1KD1T 5DM7Q 2MPUA 2CQGA 1FJ7A 3MUMP 3CXCR 3VAMA 4QU7A 2RS2A 2YH0A 1WG4A 2CPHA 2M2BA 2L41A 2MJUA 4U67Q 2M70A 1RK8A 3MDFA 3G71S 2J0SD 2M9KA 1QVFR 3NS5A 3UCUP 2L08A 1WI6A 3SXLA 2MKCA 1K9MT 1WHVA 1UP1A 2D9PA 5H1SV 3K0JA 5DETA 2MY8A 5DDQC 2CPEA 2F3JA 1N8RT 1X4AA 5GVQA 4PKDB 3S01A 1SJ3P 1WG5A 2DGTA 5GAGU 2JVOA 5LSLA 1BY9A 3H2UB 2CQHA 2MB0B 4ED5A 2M0GB 3LQVA 2DGQA 1FNXH 2YWKA 3IRWP 3CULA 2X1GA 4IUFA 1M5PC 4ZKAA 1P1TA 1OPIA 3CCSS 1P27B 2MQMA 2L9WA 2MZ1A 1VBYA 2XS2A 5LSOA 4WIIA 1WG1A 3VF0B 2CQDA 2VODA 2KFYA 1YHQS 1NU4A 1JJ2R 2ZJQQ 2M8HA 3THPA 2ADCA 2DHAA 2PEHA 5IQQA 5HO4A 4RU2A 2OSQA 2MZSA 2QA4S 2DNOA 3VAIA 1VQ6S 1A9NB 1M5KC 1U1RA 2E44A 1VQ9S 2CQCA 2MJNA 2KT5A 3S8SA 5LJ5Y 2BZ2A 2AYBA 1X5SA 2KI2A 1K73T 1O0PA 2E5IA 2LEBA 5JVHQ 1QM9A 1URNA 3CPWR 4PR6A 4F26A 5JVGQ 3VAHA 2XS7A 2ERRA 2J76E 4IOAQ 1F9FA 1VC6A 2J8AA 2LA6A 2LECA 1QVGR 3MD3A 2XNQA 3P3DA 1KOOA 1H2VZ 3CMES 3UD4P 1VQ8S 1HL6A 3FEXB 4Y00A 2AYEA 4YB1P 2CQPA 3IWNC 2D3OR 3JB9k 4W92B 2MMYA 2MHNA 2M4MA 2FC8A 1L3KA 2PE8A 3MUTP 2RS8A 2K8GA 1G2EA 1WELA 3HI9A 1SJ4P 2DGVA 1U1LA 1X0FA 2DNZA 1Q82T 2DIUA 2GO9A 3B4DA 2A3JA 3V4MA 1SJFA 3NNAA 2KXNB 3NNCA 2RU3A 3G96A 1M5VC 4BS2A 2E5JA 3DXBA 1YI2S 4TU9A 1OO0B 1YITS 1VQNS 1U1PA 2NZ4A 5DM6Q 5ITHA 1X4EA 3CC2S 2OIHA 2MGZA 2O3DA 4WFAQ 2G4BA 2DITA 3PIOQ 4F02A 2MKJA 2AYMA 2SXLA 3ZZZA 2K3KA 5HL7Q 2LA4A 2DH9A 2EK6A
chains in the Genus database with same CATH superfamily
1IKYB 4ZJOA 3ONQA 1MWZA 3I0SB 4R5PA 3VWSA 2HWHA 2QO3A 1U25A 3CJQA 5AXKA 2M52A 2FHJD 3N01A 4DV4F 3DYAA 3K2YA 1PJ7A 3R6GB 2PFFB 1JNZB 1CPZA 3IM8A 3MOZA 5J2QA 3MMAB 3LTOA 2H4WB 3L3CA 2YWWA 4RNFA 4I67A 4OX6A 3ET6A 4Z2XA 5AXLA 2YWHA 5FDLB 2GHWA 5LMUJ 4DFJA 1JLCA 1Q78A 3AXMA 4PWUA 8ATCB 3T5JA 2DBBA 4M5LA 2O66A 2Y3YA 4QWDA 4UY8T 2A6MA 2BUNA 4ZITA 2CA9A 2HRTA 4LR9A 1HWUA 4J7CA 2HHVA 1XIQA 3HMJG 2HG4A 1R0AA 2ASJA 1PYTA 4L3KA 3BN7A 3GILA 1NJIT 2DT9A 3OD2A 1TKXA 2AJ1A 4AL7A 2ALYB 2BOAA 3BEGB 3NGKA 4KR0B 2LU1A 3Q2TC 1Y7PA 1B70B 4DSFA 2PFDA 3MM7A 2CUYA 5CXTA 4CLTA 2H5JB 3HFKA 3Q23A 1Z2ZA 2DHSA 3FZBA 4LF2A 4JI0J 3LP2A 2X1BA 1RI7A 1DARA 2ZNZA 1WC4A 2XWYA 1FI4A 2MQPA 2DGSA 1I6JA 1FFSB 3N5FA 3NXZA 2ZH7A 3B8HA 4ZP7A 2VDIA 3KNAA 3H59A 2BE7D 5I42A 2FD2A 3QO9A 3CF5Q 3PG9A 1S10A 1NKEA 4BC9A 2R7WA 2MSTA 3JTPA 3MM5B 2CPXA 1XNRF 3CGIA 3O1LA 2WRMA 4KH0B 4LF4J 3SQGB 2GO8A 1V3RA 2BQUA 4P75A 4RUHA 1FNOA 2HVZA 1SXLA 3C16A 1H7WA 2DRBA 1RADB 4AQYJ 2B7CB 3HX9A 1H38A 4PPDA 5KG2A 2PD1A 2X3GA 5I3UA 4X4UA 5M2UA 3R5BA 2CZVC 1X5OA 3UE2A 1W2IA 4GKKF 2KT3A 5B0BA 2KH9A 3MM6B 1QSLA 5K14A 2R7VA 3DOMB 5EN1A 3T19A 2EC2A 3B78A 4ZVTB 1BC6A 1IKYA 4NLVA 3WDOA 2P9EA 1N36F 2X7IA 3I0SA 1RAOA 2MPUA 2QYGA 4H4MB 4XAKA 3DNCA 3Q83A 2XMVA 1Z4UA 4KH1B 4DV5F 1X4AA 1HNXF 3MMAA 2WOMB 5L1KA 4LF9F 4M5JA 5A2QY 1X8DA 1NSPA 1EZZB 4N7TA 3BPDA 2DGQA 5D4PA 5FDLA 4NLUA 1P1TA 1NSKL 2W8KA 1WG1A 4FF1A 3CJRA 4O4GA 2DR7A 3R5DA 3W62A 1Y4ZB 3ZC4A 2KYZA 1YHQS 4P7VA 1PKUA 1J5EJ 2N4CA 2IRXA 4CO5A 2BM1A 2C2RA 2CJYB 3GV7B 2OSQA 5BYRA 4ECXA 3G2XA 3NP5A 3M9NB 2HZAA 3KDNA 1BD6A 1ZOTA 1JIHA 3A8KA 2JL9A 3W1YC 3OV7A 4X4PA 1NSQA 3PX6A 1BQNB 3LANA 1NK6A 4B3MJ 1R31A 2LXFA 3I0RB 2Q1LA 4EBCA 1UVIA 1XBWA 4I6WA 2IMOA 3Q22A 4DQSA 3KLHB 3HHDA 2DGVA 1RZMA 3B4DA 3BGFA 5HQLA 3HVWA 4KGVB 3NNAA 3G96A 1M5VC 4FDFA 4M94A 1YRTA 1SPBP 4HLBA 3FRYA 4MAKA 2ZM6F 2EBEA 4U95A 4M5IA 4N56A 2UXCJ 4CO0A 4A8XA 1QLNA 3CD6S 5C42B 4J9LA 3SSQA 5CYMB 3MM5A 2ZOFA 4NX9A 4JI5J 2YWEA 4HR2A 1JJ4A 4QWBA 4OX8A 2W8LA 4LF7J 4P9SA 3SQGA 2R8GA 1DZ5A 1FX2A 1EHWA 4H4KC 1RBOB 3UD5A 4FF3A 2EFPA 2ASDA 1EX8A 1TUWA 2HFZA 1RA6A 3DLGB 4K4UA 9ATCB 3T6BA 5K5MA 1AYEA 1OYDA 4LRBA 2F1FA 2AJ4A 1RHKB 1R8BA 3S6EA 4PYDA 5HATA 2Q79A 3P45B 5LJ3Y 1HNZJ 3MZIA 4PG5A 2HAFA 3MM6A 4LR8A 3RZAA 5D0HA 3KK3B 4MKVA 2LQBA 3DOMA 4ECSA 5AT1B 4ED2A 3RGIA 5F41A 2VPXB 1EIYB 2N3OA 3LOUA 4UF4A 1RWVB 4ZVEA 1IBMF 3Q2SC 4DV1F 3FBBA 2IAJB 1OSCA 3C8YA 1NK7A 2Z2MA 4H4MA 5CD4H 3VZIA 2HLTA 2PIIA 3UCZP 1F60B 1BQMB 4NLPA 4WP3A 1N52B 1GX6A 3GIKA 2WOMA 4KFBB 4K4SA 4DPUA 2MDAA 3A8IA 3KJVB 2LDYA 2V2KA 1FWLA 1YVFA 2KB2A 1NJWA 2UUAJ 4LRFA 1FX4A 4EBDA 3AQOA 3CCUS 3TEHB 2C22A 2FLPA 4M5NA 2H4YB 3HSJA 1HFEL 4WFBQ 3DRPB 1PGZA 2V5HG 2PMWA 2HBQB 1TK0A 3CCVS 5RUBA 3SV4A 3TJ8A 2GX8A 5M2RA 3U1MA 3ULHA 2QG9B 1VS3A 4DOZA 2ZHOA 1DHMA 3MMCB 3US5A 5FJ4A 3M6XA 2R8IA 3FZ2A 4MK9A 1BQNA 1Y11A 1DQAA 2UXDF 1TL7B 2XB2D 4WU2A 4L72B 4LQ3A 2AJ2A 3I0RA 2IJNA 4DQQA 2F9DA 2B9WA 3NGUA 4NMXA 3KLHA 2IHR1 4LF5J 4F8RA 1MROB 2OTLS 3GR1A 3OBIA 3HVAA 5KFBA 3DDIA 4ZVQB 3GIMA 3HT3A 5B7WA 3MD1A 1IWAA 4HACB 4DX7A 3KFWX 2RU9A 2BJ1A 5B0CA 2HSEB 1MN9A 3Q8YA 3GQCA 5AJ3J 1NK0A 4TYAA 5B08A 5C42A 2WBMA 4FBTA 1FJ7A 5CYMA 4MYUA 2L41A 5KT3A 2AGOA 5L9NA 3MR2A 4G1PA 1SJ3P 5KFGA 2DGTA 4DL2A 4JB8B 3EMTA 1TK5A 4OJHA 2XSJB 4N5SA 2P9GA 3MPUB 1XQIA 1HW9A 3RYLA 4F3OA 2J9DA 4MK7A 3DLGA 3LWMA 2FGCA 5HANA 3QAUA 1AUSL 1F6TA 1D8YA 1DLOB 4A8SA 2AZ3A 2QA4S 2Y0SD 4ZLLA 4DSJA 2B5JB 1HWKA 2GQQA 3KK3A 1XR5A 3Q8SB 2BZ2A 2RAQA 2F63A 4KRWA 2LEBA 4Y3CA 5JVHQ 3I31A 1VC6A 3FEZA 3RAQA 2LA6A 1NRKA 4MFBB 2V67A 3CMES 1TAUA 2IAJA 2O1PA 4U8VA 4YB1P 2V69A 2Y9HA 4ECQA 1BQMA 2P9CA 1KFSA 1B4SA 2K8GA 3NOCA 4GO7X 1WELA 3TW0A 1SJ4P 4USWA 2FQQB 1KQKA 3CDBA 4KFBA 1QUPA 1QAJA 1KWMA 3KJVA 2Q6CA 1HIYA 1V5IB 3W9JA 1GMUA 3TUZC 5KFUA 4WP8A 2F5GA 2DEIA 5J2NB 2I0XA 4JV1A 3EVMA 3DRPA 2FY1A 2XO6A 1W7WA 1S59A 4ECYA 3PXGa 2NCKL 1KHWA 1UEVA 3UNYA 2F65A 4YB6A 1W2BR 3DHXA 3M8PB 3O2IA 3SFUA 4PXBA 1OY9A 5KG7A 1Q5YA 3MMCA 4XK8C 4X64F 2FHKA 3BO2A 4BLGA 1M0SA 4USHA 3SSRA 1UFLA 1TL7A 1LFPA 1T9VA 4GO5X 2QN6B 3M4XA 4LVNP 2GIRA 3VAGA 1U49A 5F8GA 1N5TA 3LP1B 4DQPA 1S76D 3UWTA 1JXVA 1BHNA 3RUBL 4DPYA 4HACA 5H9EK 5KG0A 3CCWA 3DDKA 3NGSA 4B3SJ 1JNRB 1BUXA 4I4BA 1Q7LB 2F7VA 4HDHA 1T7PA 3PNIA 1XMQF 1VRQC 1VR6A 2EG1A 2QFJA 3MI7X 1NCLA 1FD8A 3H5UA 5IS2A 3QFWA 3D28A 1FE0A 2RRAA 3P6YC 4B9NA 3ZZOA 3K5PA 2LYVA 1S9GB 4W4MA 2XSJA 2CRLA 3ILLA 2CZ9A 2XLKA 1H0HB 2R8HA 3ZFVA 3GYNA 4DPXA 1ZA1B 2HNYB 4YHHJ 3Q8QB 4ECUA 1DLOA 4WTOB 4X84A 2I1RA 3TOQA 2A18A 4K8RA 2E9ZA 2B5JA 3PYDA 4HT5A 5KFZA 3AD9C 1MMDA 4CO1A 1V5VA 1K8AT 5ETSA 1PC4A 4C3KA 4N47A 4ZVOB 3VQTA 3MEGB 3JSMB 2R2UA 2B56A 3W3SA 3GP9A 4O4RA 3AOAA 4MFBA 3BO3A 2IDLA 2VQFF 4I7FB 3MPVA 5KG1A 4DR2J 2FJAB 3UN2A 2DHGA 5FLXU 2VG6B 2G0JA 2UV8G 1C0TB 1MLAA 4J90A 1Y5LB 1XN9A 1IKWB 4GVBB 3UDLA 3TZYA 1S0VA 4WXWA 4QPXA 4F7VA 2LFVA 4P6QA 4OZJA 2AYGA 1BQXA 4FF2A 1HA1A 4TLRA 1VQOS 1YJNS 4E8UA 1TK8A 4Y28C 3LW5C 5J2NA 4Y65A 4Q45A 2DNQA 3I56S 2ZJRQ 4ED7A 2OAUA 2V34A 4CH7A 4DL4A 1TZ0A 3BPSP 1AW0A 5KFPA 3VAMA 4FYYB 2Q43A 2QTWA 1YG0A 4QWEA 5L1LA 2M9KA 3M8PA 2LP4A 2L08A 3PFOA 3KLFB 5F3ZA 3FMBA 1HNVB 2MY8A 2JLFA 2GJIA 3TZWA 3IM9A 4LSNB 2VV5A 4DCJB 4P2FA 4EK2A 2X1GA 4IUFA 1M5PC 4ZKAA 4Z7CA 4RNNA 1J2VA 2VODA 3DFEA 3LP1A 4ZLPA 2IA0A 4UZCA 5EWEA 2W2PP 2KKHA 1VQ9S 2CQCA 2KT5A 2E5IA 1HBOB 4ZVHA 3PACA 3PKYA 3P8BB 3D68A 4OX9F 3G6YA 2YNIB 1EQMA 2YKMB 5KFLA 2CQPA 1Q5VA 3ADAC 1FRLA 5L38A 3V81B 3D6MB 1U26A 1CJKB 1SJFA 1S9GA 4RWWA 4FS1A 3D0IE 4TU9A 4IH7A 4ZS6A 2C2MB 5IWAJ 4RW9A 1GMWA 1VFJA 5AXMA 4O3NA 2DCUB 5KFSA 4YN3B 3ZZZA 4UQTA 2HNYA 3OW2R 1NMEB 1XERA 5JMNA 1KLMB 4DV3F 1FO1A 5KFIA 1A7GE 4EUVA 5KFOA 4LF8J 1ZYQA 2G1DA 2XHWA 4IH5A 5I4MA 2XMKA 3MEGA 3JSMA 1PBUA 1RE1B 4I64A 3KTQA 2JEGA 5IT9U 5CABA 4I7FA 3V6DB 1X5TA 1GFWB 1YRUA 1U0SA 4CYUB 1RTJB 3K59A 4RWXA 1ZAXA 2R7QA 2WSEC 1TU0B 2VG6A 4DR3F 4LIRA 4QIWD 1C0TA 4YOEA 2BE2B 1LWFB 3GFYA 1IKWA 4GVBA 4CH0S 5F3TA 1H98A 1AB8A 2ZWOA 4MKBA 1JKHB 4O0IA 2IM3A 2J6SA 1AA1B 2EFQA 3VAFA 5J1PA 2W4CA 3KUEA 3OL6A 4F2RA 3FBCA 4NXNF 4AUKA 4IO1A 1R43A 5GAEU 2KG1A 2VBZA 3GZ7A 4BHQA 3PEHA 2XLIA 3KLFA 4NA1A 3W7BA 1HNVA 2Y1JA 3W66A 2DNPA 3AODA 4KHMA 1NK9A 1OY6A 2V4RA 2IRYA 2MZQA 4E98A 1FERA 2YNHB 4LSNA 3RR7A 1KFDA 1SL1A 2WCXA 5EHHA 2R2SA 2KO1A 1APSA 3CIZA 2NSCA 2HVIA 1FDBA 3H2LA 3BSCA 2QSFA 1YWXA 3MUVP 5HMYA 2XHCA 4ANDA 3OQ2A 2YPZA 1CS4B 1WKJA 3LPEA 2V0NA 1CQNA 4CLWA 2CQ1A 2LLZA 2FLLA 1UJ5A 5A8WB 1HBOA 5FD1A 2CJQA 3MCNA 4RUCA 4U96A 1YBUA 3J81U 3O44A 5IZHA 2FTRA 3OL8A 4X65J 2IY5B 2YNIA 2YKMA 4DJBA 4FYDA 1OPZA 2B3TB 4P7TA 3V2UC 4UOHA 2LMIA 1RXOB 3QT5A 3V81A 3MCOA 4NA3A 1U45A 1S0NA 4CO2A 4FXVA 1CJKA 4OLPA 4J9VA 3G6ES 4J37A 4ANCA 2KJWA 4TY9A 1N6QB 2CVIA 2VH7A 3R7NB 5KG6A 4RW6B 4ZIVA 2O67A 4NL5A 2GIFA 2RQ4A 4NA2A 2UXBJ 1Q79A 3PM9A 1U47A 1KLMA 4DG1B 2EK1A 1CEZA 2CFXA 1ZM2A 2CXEA 4N41A 4J9NA 5H1SV 4H54A 2EKYA 3Q89A 1N8RT 3QSYB 2RD5C 3OJUA 5LSLA 2FZKB 3M6WA 2WW4A 2OPSB 2MB0B 3LQVA 3V6DA 3D67A 3FKBA 5KFXA 2ZBCA 4CYUA 1RTJA 2VPWB 3SEOA 2VA3A 4QBUA 3CCSS 1G7CB 3UDCA 4NLDA 4E2FB 1V3ZA 4DR4F 2EW9A 3VF0B 1TL5A 2PI4A 3N6NA 5BR8J 3T5HA 2CJBA 2BE2A 2YQ0A 2ROGA 1LWFA 1LFWA 2IM2A 3NAHA 1SC6A 3CCZA 4FPRA 3BYPA 2B9XA 5E41A 4J9KA 3CDAA 1JLFA 1FD2A 2ZOMA 5SZTA 1JKHA 5KFYA 3R8YA 4C8ZA 1RAIB 4F26A 4NRUA 2VKRA 1Q8IA 4C48A 3R3TA 4LRDA 2V9WA 4JI4J 3I6PA 1F3FA 2XMTA 1NM2A 2AEJA 3CVKA 1VQ8S 2LEPA 1LK7A 2IVMA 2ATLA 2YQ3A 2QA4G 3BGUA 5D0RA 1O5JA 4BWJA 2HBYB 4DL5A 2DNZA 1Q4RA 3K8VA 2YQ1A 1N5VA 2YNHA 3NNCA 1SB6A 1FRHA 1ROFA 1F5AA 2GAGC 3GONA 1VQNS 2Z58B 5ITHA 1X4EA 3CC2S 1IBKJ 3MCMA 2DPIA 1H74A 1FESA 3GG1A 2HK2A 2R42A 5DJBA 1TELA 1NEEA 1HLWA 2R2RA 2LU2A 3Q24A 5HLFB 1DURA 2H51B 2LQ8A 2F4VJ 2XI3A 1WTBA 4A47A 1CS4A 2WONB 1QY7A 5A8WA 4ZPDA 2L48A 4IOCQ 2VBXA 2Z0GA 1CJVB 3PCOB 3M30B 2OEKA 1RDRA 4HKQA 2HRUA 2AWZA 2ZZMA 2MQOA 3FBEA 4ES2A 4ELUA 4F4XA 2B4UA 2R7OA 3QMQA 4DQRA 1RQ0A 3THTA 1IKXB 1N88A 2M8DB 5MAOA 3EZOA 4TU7A 2FZCB 5EGYA 1UFWA 2IPOB 1S57A 1D8ZA 3ELHA 3VV2B 1N6QA 4C0BA 4DR1J 2K7KA 5GMEA 5A2QU 4RW6A 3OL9A 3MCSA 2HFUA 2CQBA 2CPFA 3HPOA 1S4EA 1B0TA 4B9VA 1RLCL 3SFGA 4TU8A 4DG1A 1QJHA 1RWMB 2ASYA 2D74B 2B43A 3MTJA 1IXKA 2BYCA 4DQIA 2KU7A 4KYZA 5E3AA 1PG5B 1WF2A 3OR1B 3MM8B 3BSNA 2FYXA 1HQEB 1CBKA 2GAHC 4I68A 1R8AA 3IO1A 3T9ZA 3UR0A 2DH8A 1T9TA 2OPSA 3PO4A 1FKAF 5DLFA 1NB2A 3AD8C 3IG1B 4R0JA 1FVQA 4QU6A 2JZ5A 4IKAA 1Q86T 4DR6J 3K5OA 3TI0A 3I87A 5KTQA 3K7RA 5M2PA 4DV6F 4AXJA 1SKUB 2XY5A 3HHEA 1ULRA 5CZVA 1TUVA 3L7OA 5KOWA 4B02A 2UP1A 4QYZJ 1RAHB 5D4NA 1MWYA 1DRZA 4NCGB 1I1GA 1X31C 4I69A 1WOPA 2YX1A 2HQFA 3KJNB 1NHKL 3NMRA 3OLAA 1QAIA 2LKZA 3D1OA 2OPPB 2HHXA 1VISA 8RUCA 1P9YA 2DR9A 4K7QA 1U7LA 4CI0B 3PYFA 4N77A 4NLSA 3M8YA 4CLYA 2ROPA 4YEAA 3OTBA 3H0PA 4PYAA 1LQ9A 3H42A 4FN5A 3TVKA 2XMUA 4DLEA 3K17A 5F8JA 4J9QA 1WEYA 2VHGA 3RG6A 4PXDA 5HLFA 4P72A 4FYWB 3QRPA 4XDCA 2DY1A 1FA0A 2WONA 4DFKA 3G71S 3N6MA 2PGCA 3UCUP 1T05A 2K3IA 5CYQB 3K0JA 1LWEB 1CJVA 3M30A 4ZIWA 3S01A 1TTHB 1VYAA 4RNOA 2E1CA 1SUQB 3ISZA 3NCPA 4J9UE 2HZVA 3MEDB 3HXMA 1YZ7A 3E2EA 4JV2A 3QQCD 4LFBF 2CQDA 2Q6BA 1IKXA 4AYBD 2Y8YA 3P5BP 2PA8D 2R3VA 2KZZA 1LK5A 1AZSB 3C15B 3PV8A 5HO4A 3CDWA 4RU2A 2DNOA 3G87A 2IJFA 3VAIA 1SIZA 2QV6A 1VQ6S 3B6BA 2JOQA 4C8MA 4FPIA 1S97A 3I9ZA 3PO5A 4O3PA 1HR0J 1NKCA 1SQGA 4ECTA 4LBHA 1QM9A 2CJ9A 3CPWR 2VC0A 2ZKTA 4ZMMA 2ERRA 1Q0NA 1HWIA 3VVTA 1B64A 1N34J 4LT6A 5C7PA 4USVA 4DV2F 1U0HB 3UD4P 5SUHA 1N36J 1FEEA 2G1HA 3F73A 2AYEA 1VQYA 3KNGA 2MMYA 2ZBQA 3CJ4A 4NLYA 1IJFB 3OR1A 3MM8A 2C2ZB 1HQEA 2AV5A 2VKZG 3ZO7A 3QLHB 3SCJE 2A0FB 4O44B 1HWJA 2A3JA 2KXNB 4JYAJ 3IG1A 3O5TB 4M5GA 5HMWA 4DL6A 1F3VA 3PYGA 5F0UA 2O3DA 3CWJA 5CQGA 2CPIA 3CE8A 2BW2A 2ZH1A 2BOPA 2HEKA 3J7ZT 3TVZA 2RUGA 1PILA 1YRXA 2RHQB 1JWWA 3OFEA 3I9V9 1WJ9A 5CCMA 1T02A 2BABA 2AEMA 2EFNA 2W9AA 2FGOA 1QUVA 3CB4A 2QLWA 3CJSA 1T3NA 5T14A 1G1XA 1S0MA 4FP9A 3PW5A 1RT7B 3B4MA 2ZEJA 4DDFA 2FJBB 1SC3B 5F8MA 2RQCA 4QQBA 4PUOB 2WK4A 2OPPA 4ZP8A 2E1RA 5EX0A 4JI3J 1FWPA 4ZJQA 2XGPA 4B08A 2QLXA 4YMEA 2ZUGA 4DN0A 2ZNYA 3RRGA 3RB6A 1GT8A 2W2QP 3T1AA 2A2DA 1MNEA 4AL6A 3GSIA 5A6WA 4CQ1A 4I2PB 1H6KX 1X0PA 2V68A 1GMVA 3WHIA 1PYOB 1VIOA 3CMQA 2ZM6J 3IR7B 2IA6A 2LQ5A 3RBZA 2WVBA 2VQEJ 4WIQA 2JDJA 1D9DA 2OHDA 4DWIA 2KVIA 5IT4A 4R8UB 3B82A 4K2JA 1ZTTA 3PY8A 3FJ2A 3M8RA 5CYQA 5LXRA 1LWEA 4ZVSB 1FF2A 4HI1A 1VQKS 3U1LA 1S9FA 4CT8A 1SUQA 1V9OA 5AXNA 2R7RA 4DU8A 2MTLA 2P8IA 1ICEB 4WYLA 1NK4A 3MEDA 4KO0B 5H9FJ 4N8OA 4DV7J 2PC6A 3KG4A 2BRKA 2IVYA 4L73A 2X1FA 4P52A 4QCLA 2UUBJ 4X4OA 1C4CA 1AZSA 3C15A 1AUDA 1L3VA 2BBEA 4NEZA 3M2UB 2D69A 4F67A 4JI0F 1NJYA 2J7UA 1KP6A 4J9PA 2CNOB 3A8EA 5KFEA 2FJXA 2ZVIA 3AJ1A 3TRGA 3UPFA 1NNDA 3OJSA 1U0HA 2MQ8A 2KXFA 1FFWB 3K5LA 2IRUA 2B4OA 3F0NA 2MZJA 4OHXA 1RTDB 3D7SB 2EI5A 3VQSA 3DI6B 3QIDA 3GV8B 3VGSA 3QLHA 2K7JA 3QWUA 4O44A 4ED6A 1YBTA 2VFUA 1UVMA 2VOPA 3EWGA 4A48A 2XTJP 1OIAA 2KM8B 5L1JA 2JNJA 2G0CA 3SCIE 1KN6A 2HQDA 2XWXA 3HHKA 2AX1A 3ZTPA 1ACMB 2GHPA 3I82A 4P2SA 4O0NA 5KT5A 3TAMB 1U6FA 2W01A 4TQSA 3D5MA 2KG0A 2RSQA 1FRKA 3K8WA 3ZTRA 4LVOP 3PRVA 4KB7A 3KHRA 2DRDA 3C14B 4Y34A 4ELTA 4QR1A 2FLNA 3C6TB 2ZDOA 4ZHRB 1BY9A 1URRA 2VFVA 5FLXY 1JLAB 2UUCJ 4FNIA 1RT7A 2OMLA 3U7JA 2UXDJ 2EPIA 4DSKA 2W24A 5KFFA 5K8PA 2MZ1A 2C42A 3RBXA 4PUOA 4ZVFA 2VB6A 4MT1A 2QIFA 2UU9J 5ETVA 2R7TA 4U7UD 1BLUA 4DLGA 3CSKA 4QW8A 2GHVC 1LXJA 2AGQA 4TQRA 4CZCA 2HQIA 2D41A 2O5DA 4FYXB 3CD0A 2E1PA 4QYRA 2KJVA 4I2PA 3HM9A 1X9WA 1L5UA 1URNA 4PR6A 2BQ3A 4LF6F 3UVJB 2J8AA 1YX2A 4Y2IA 2VA2A 3P3DA 2G13A 5KG4A 2QA1A 3AD7C 4R8UA 3WC0A 4LRCA 3DC2A 5IV3A 3M9MB 3MUTP 2RS8A 3LGHA 3T1YJ 3PKMA 3JSRA 1KBRA 3PJ9A 4JUZA 3MPDA 4B3MF 3NS7B 3CW2C 2ZUAA 5HK4A 4KO0A 3QGPA 3LGNA 1QDUB 5DRKA 2QMWA 2ZOGA 5B0DA 2HFSA 1E6VB 2GQCA 1KQSR 3M2UA 1H2TZ 4HH0A 3V5RA 4ZPAA 3DOLB 1HD0A 1C1CB 3W60A 4Y2KA 1YIJS 4ID8A 4USIA 4AXIA 5D78A 1R0CB 5EDWA 4N76A 1RWUA 2NXCA 2OTJS 1WEZA 1Y3JA 4RZRA 2UXCF 5I3PA 3BS9A 2CDRB 4OL8A 2AW0A 3AA9A 1O8BA 3ITHB 4RLEA 4OX7A 5EWGA 4C11B 1RTDA 1Y10A 1FRMA 4PG6A 4LF7F 2C2EA 3DI6A 4F4WA 5IT0A 3E01B 4IRKA 1RWKB 2KT2A 1SIWB 3TYTA 1PJ6A 2NR0A 1FJEB 3VHQA 2Q66A 2HHHJ 1S1VB 3ISNC 1HMVB 5F8NA 3HFZB 2ADBA 3DM2B 2MZRA 3TAMA 4CCHA 1JLQB 3KJFB 3DLLQ 1LV5A 3IFEA 2W2MP 1HNZF 2VOOA 1TL3B 1U6BA 4PG4A 4IOBA 1X4HA 4RU9A 3CJKB 5IT9Y 2EC0A 3BO4A 3C46A 3BH6B 3C14A 5C24B 3EVOA 1KR4A 3C6TA 3UCGA 4OYAA 4ZHRA 4F25A 1JLAA 3TO8A 4JP8A 4DR5J 4OMFG 3FDSA 4ED4A 4USKA 4S0MA 1IQTA 1VCTA 3PEJA 3LO3A 1GMWD 4OV1A 1WHXA 3MF5A 4X4SA 4CIOA 4DL7A 1LW2B 5D8HB 1M90T 2E29A 2UUAF 2R9LA 4L75A 5HI7A 2RB7A 2N7CA 4NRTA 1MN7A 1SJQA 1XEZA 2DR5A 5B09A 4PWWA 3CCRS 1X5PA 3H40A 5IM0B 1Q1KA 4I0WA 3UVJA 3SIPB 4DS5A 4FZVA 2DJWA 4OZ1A 4U9RA 1C2PA 1XMQJ 2Z2LA 3CD5A 4W90B 1SV5B 2QGFB 1R8HA 4YB7A 3HHNB 3BH7B 2ZH9A 2HWIA 2G9OA 3W8GA 4WE1B 5HMXA 2C3UA 3EGNA 5GMDA 3TEGA 5A76A 2CG4A 1XMOJ 5KFMA 2VONA 2NXNA 2VFRA 4QZVB 2W9CB 4LF5F 1MMNA 1WSVA 3CCTA 4ALZA 1E6VA 2VC1A 5HMZA 2NXJA 4B3TJ 3DOLA 1C1CA 2XEXA 1RK8A 3VZHA 3VCDA 3D1HA 1K9MT 1BWEA 3T5KA 1H73A 1BXNA 2JEFA 5AJ3F 3PR5B 1PYSB 1RU2A 3I5CA 2R8JA 1VJWA 4DUZJ 3JQKA 2CADA 3RAXA 1TV6B 3CJTA 2ILYA 3ITHA 4C11A 1R0BG 4F2SA 1WC1A 2HIQA 4HT7A 3E01A 4DX6A 4PEOA 4CNZA 1W25A 5IQQA 2J8SA 1VK3A 1S1VA 5E5NA 4K4TA 1TMMA 1HMVA 1FJGJ 2HHWA 3ZXWA 2NSBA 3DM2A 3FCHA 1JLGB 3OR2B 4PABA 3TZZA 1JLQA 1X7VA 1VDHA 2FVPA 2GA7A 3PFEA 3A1YG 1TL3A 3KK1B 3MMBB 1NJZA 2BR0A 3HZGA 3CJKA 2DR8A 3V4IB 5IC6B 4URSA 4B9MA 5HQMA 2HQCA 2AZ1A 2M4MA 1PAUB 5C24A 2WVCA 5L39A 1FRXA 1VLOA 5GAHI 2KFNA 1Q82T 5BXIA 1HNWJ 2HHTA 1RISA 4MIBA 3N79A 3BYRA 4WWSA 2IYIA 4KE5A 4QWAA 1A0OB 4A46A 5KFWA 4YR2A 2CNNB 1SJ1A 4R0EA 4JI2J 3HVTB 3MFIA 3EM1A 1LW2A 3JSYA 3CJ5A 1UEUA 4I6YA 3R1LA 3W5XA 5D15A 1NDLA 1ZBTA 1DBDA 3K5MA 2C3MA 4EGLA 5IM0A 1R89A 2DO0A 3BBBA 5LOQA 2HPUA 3NY0A 3UO0A 2COLA 3UDVA 3CT9A 3GWCA 5KFDA 1ZA2B 1U6ZA 1KVIA 2W25A 3SCKE 4OZ3A 4JI8J 3G8TA 1HYSB 5F0WA 1SV5A 3FQKA 3EPIA 1C4AA 3AJDA 4EYHB 3H5XA 3FBFA 2XSFA 3GCXP 3P5TL 4Q2LA 4WJBA 4OHWA 4WE1A 4RBVA 1MSWD 1NO8A 3UN5A 1HW8A 3R2DJ 1GEHA 1PO6A 2B0GA 2RDIA 1RAJA 3ETMA 4F4AA 1T11A 3RB4A 3KOAA 1B7FA 2W9CA 3LPYA 4OI0A 3IAM9 1UFKA 4C8NA 2E5GA 2IJRA 3G6XA 3BDEA 4X4QA 2VIHA 1B0VA 1D9FA 2AT1B 1AFJA 4B17A 3NOGA 4OZ2A 3NMAA 5BYQA 3NG8A 3H4DA 2DYAA 2CWKA 4B3SF 2A1BA 2J0QD 4G3IA 5GAHU 3BKTA 1UPPA 3ISND 2IDEA 4PAAA 4KSEB 2AD9A 2WW8A 5D4OA 3D66A 4OLOA 3X3UA 3HFVA 2CPYA 3UNGC 4X66F 4NYZA 2YKQA 1TV6A 2PMHA 1TVRB 1F9HA 2MGZB 4OI4A 3MOJB 3R5CA 2EWHA 1RT3B 2CQIA 4DCPB 2HIYA 2NXEA 2EEYA 1VBXA 5KAKA 4P2XA 1U1OA 3RJMB 2ZH3A 1ELOA 2VJVA 4P73A 2X3DA 4IQXA 3PZPA 2MSSA 3OTOJ 4DS4A 3W2WB 4C7QA 4V19J 5KFAA 3RTVA 4PXEA 1JLGA 3OR2A 4YHHF 2VG5B 1P6TA 4EEYA 4A8YA 2CQ2A 2MKSA 3KK1A 3MMBA 3TJ9A 3WX8A 2XULA 1NUEA 2B8QA 3UW1A 1RAGB 4Y2MA 2XC9A 3V4IA 3HP6A 3AJ2A 4KJIA 3MECB 1S72S 2RKIB 4NLTA 3PW2A 1T9YA 3GIJA 3WIVA 4WFYA 4KGKA 1QAYA 1S77D 4IFVB 4YR0A 1CQMA 2R2TA 4YQWA 4X62J 5B0FA 4DR2F 4DSIA 1WI8A 1WD6A 4MIWA 3TARA 5C2CA 2V94A 1HD1A 4BDPA 2JWNA 2U2FA 4M95A 1R7IA 1YJTA 3H90A 2ZE2B 3HVTA 2E66A 3P49B 1RKJA 3UD3P 3EGWB 2GGPB 4JI6J 4U67Q 1BE4A 3MDFA 5ETTA 2D9PA 2CPEA 4NCBA 1LXNA 1NPRA 1E6YB 3GG0A 5CH7B 4ZP9A 4OJ3A 4CRJA 2XS2A 2GC8A 2YKOA 1HYSA 5JUMA 5KFVA 2AJQA 2NUHA 2NXUA 5K8OA 1KEKA 3OTCA 1GK8A 5KFRA 2MZSA 1HI1A 1QAXA 3KG1A 2CNLB 3ILJA 4UOGA 2EBGA 4DBQA 3KLGB 1ZPWX 2ZH4A 4ATNA 1FKPB 2UUTA 4QYZK 4PG8A 3C66A 2HS3A 5ETNA 3QRQA 4LF1A 4QOTA 2QE5A 3IR6B 3HDSA 3N28A 2ZDPA 1RHJB 1YQHA 1NDPA 2VZ9A 3J7Z5 1Y5NB 4OZNA 2B4VA 3K89A 4WP9A 3TUIC 2GO9A 1Q8KA 3V4MA 2RU3A 1S1TB 5CHCB 1YI2S 3M6UA 3OFFA 1H7XA 1TVRA 1GXLA 3ILOA 3SQOP 2MGZA 3FFIB 3M2VB 3TQ1A 3RRKA 2AYMA 2SXLA 4AD6A 2VU5A 1RT3A 4CO3A 2JC0A 2RF2B 3CJ8A 2J0WA 2XCAA 3BV8A 1IWGA 5DZ7A 4Y0FA 4Q8FA 4F36A 3FC9A 4EO6A 2CG8A 1M1GA 3W2WA 3J7YI 4YDDB 1IM4A 1JLBB 3CCLS 2V8GA 4X4VA 2VG5A 3N0VA 1FEHA 2I8EA 1FXLA 5KT6A 1Q8LA 4WU3A 4U7UK 4YUDA 4H4KA 5J2MB 1UL3A 3OT9A 5K9FA 4RW8B 3UI3A 4LF8F 2MLXA 2M7SA 3MECA 4DEZA 5F9LA 7FD1A 3W64A 1P8GA 3MM9B 2RKIA 1VRUB 3DLKB 4O3QA 4CLFA 4HL9A 4IFVA 3IRXB 2XI2A 2G2YA 1HKAA 3X1LB 1XJWB 5DQIA 4OI1A 4IRDA 4HHJA 2YH1A 3UR3C 3NKYA 2QFIA 4KGZB 3DCAA 1TR0A 3MR5A 2X51A 1AT1B 5HVFA 3OLBA 4I6AA 4IG0B 2ZE2A 2HHPA 3QNWB 2VDHA 1FWKA 3WBZA 3IN5A 3T6JA 2FVSA 4NLRA 2XMMA 1NPPA 2GGPA 4ID5B 4DPOA 1U1KA 5C25B 3QJPA 4E0DA 1NPKA 2DGOA 2CZ4A 4ZPTR 2IBOA 1WDDA 3HK2A 2YKNB 4D3GA 5A8RB 2CPZA 5GAGI 2PSZA 1E6YA 1X4DA 1PJ5A 4TVAB 3CC4S 1K1QA 1AXQA 1WUUA 3KDOA 3NGTA 3LAKA 1RA7A 2C3PA 4ELVA 3R5AA 1F2HA 4WF9Q 1SJRA 3IA0A 4K5SA 2RJZA 4ZVPB 2DH7A 5HROB 3KLGA 2C3OA 3H2VE 2FY8A 2PMZD 3J7YU 1FKPA 3MXHP 1G3OA 4FXDA 1I94F 3AY0A 4GRSA 2HBRB 4KQZA 1YTYA 4GC6A 3KKFA 3QT6A 2V6AA 1KVKA 3LWLA 2F9JA 1XNQJ 2W7AA 3VGVA 1EB0A 1Q81T 2QC3A 2EKNA 3J7A1 2RQKA 2VPZB 2BEFA 1F1BB 4KC5A 1ZH5A 2VFSA 3PJWA 4MYTA 1S1TA 4X65F 1S79A 1L3SA 1VK8A 1S1UB 5JJBA 4UZBA 1C1BB 2YPYA 3FFIA 3M2VA 2DNNA 4YY3J 2VG7B 3HJVA 2OPRB 4KGMA 2XG8A 1HI0P 2RF2A 3CCJS 3THVA 3JTOA 2BJ7A 5ADZA 2XZWA 2ZHBA 1WF1A 2LQJA 2H5IB 2V2QA 4QU7A 3D54A 2MKCA 3QFHA 1PAEX 1JLBA 4JV5J 2UXBF 4YS2A 5LMNJ 1WG5A 5GAGU 3L7PA 2B51A 4NLOA 4WZMA 2Z2YB 1T9UA 2CNKB 3K58A 1MWQA 1Q8BA 1K1SA 2VL1A 5J2MA 2AMCB 4OHYA 3J80U 1PSDA 5E3PA 4RW8A 1OPIA 1WC6A 5H9FK 3R97A 3PJXA 2A10A 1TFWA 3MM9A 4DX8H 3QT7A 1VRUA 3D1QA 3DLKA 3M2RB 4KIAA 4JI1J 5L46A 3IRXA 2NPFA 3N4WA 4I2QB 2NYHA 4HHHA 5DG8A 3MR3A 3V6JA 2OP5A 2IYGA 1U1RA 6AT1B 1GXUA 1VGYA 1UJ4A 4NZ0A 5LJ5Y 3S8SA 1EARA 2Z56B 2AYBA 4DZDA 3KLVA 5BR8F 3T1HJ 2IC3B 1MROA 2F8EX 4IG0A 4LFAJ 1RJJA 1D1UA 4OHVA 1XK8A 4ZN3A 3JS9A 1I3OB 2CJXB 4NI2B 2RE1A 1R0AB 4OI6A 4ID5A 1RBLA 4XDDA 4NXMJ 3A4TA 1UA1A 5C25A 4QJVA 3T5LA 2HK3A 3HHLB 2HQGA 4EFAC 1U1LA 2D1CA 1WACA 4ZPVR 4O3SA 1T95A 2YKNA 2J7KA 5A8RA 4LFCJ 3PHEA 1KDNA 1OO0B 5HVGA 4DL3A 4LR7A 2D7SA 4KHPF 5HL7Q 4PPZA 1CG2A 3TX0A 3DGVA 3AHPA 5J2PB 1F5BA 1ZZFA 5HROA 2WVFA 2JRSA 2GMHA 2V2VA 1FXDA 2KYXA 3S7RA 3AA8A 2OSRA 3HKZD 3T9NA 5MLCV 3GSDA 2F4VF 3FRZA 3EZUA 5A0YB 3O6QA 4NPOA 1F5CA 3SZ2A 1HWLA 3ILIA 3SSSA 5IFMA 3FCVA 4QPTA 2ZBPA 2GW8A 3G4SS 2H3EB 2V8DA 1ZZNA 2KHDA 1S1UA 3OVAA 3W2VB 1C1BA 1FRJA 2PT0A 2L3MA 2VG7A 2E7WA 2OPRA 3PTWA 1U24A 2E7XA 3AFGA 4XIUA 3OL7A 3HLUA 4ECRA 4DU7A 3CDEA 2DNYA 2OKQA 4DR1F 3GJRB 5HP1B 3D0HE 3HCXA 4WBFA 3M8SA 2RMLA 3POTB 3MTKA 3D6HB 3VALA 3F44A 8AT1B 1NZAA 2MLYA 2V4JB 4U7CA 2D3UA 4DX5A 2MZTA 3CEDA 2ALZA 2IM1A 2O01C 2PA3A 2QJ3A 2FLOA 1WOOA 2EXUA 1RT6B 2H48B 1U8SA 4OV6A 5EWFA 4J9OA 3CO9A 2P6TA 2XNRA 2GZOA 3PYEA 4B3OB 1IM6A 3DGPB 3M2RA 4QW9A 4PXCA 2V50A 2LEAA 2LVWA 3RBDA 4I2QA 4K0KJ 1LW0B 4XO0A 4DUYJ 1WC5A 4ILMA 4GKJF 2BKNA 4DR6F 2M3DA 1FNMA 2XBPA 1F2GA 3I96A 1N48A 1NH7A 4ZCKA 3NEKA 2IC3A 3OPKA 2FHOB 4O4GB 2IMWP 3H25A 2QEXS 3AT1B 1YJUA 1JJCB 2BM0A 1FTCA 3C3LA 1IKVB 3GYGA 2BA9A 3IGNA 2CDQA 4ZP6A 3MR7A 4QIGA 1K0TA 4NI2A 4M1KA 5BYSA 3QWPA 1IVZA 4HI2A 3HHLA 3WZ0A 2DNRA 3BSOA 1LOUA 1OMSA 2B7BB 1HI8A 4RO0A 2AP6A 2XMWA 3H8YA 4C0OC 2MHEA 5E3RA 2EFOA 2P2CB 1U2FA 3HULA 3MMJA 3OSNA 4M5KA 4LMZA 1PCAA 2D3O1 4XPEA 3TR5A 5J2PA 2GMLA 1N32J 4CM0A 2M2BA 4YDXA 2MJUA 1X9SA 4TXSA 3AXKA 3CNQP 5DETA 1RHRB 4HTJA 4PKDB 1SH3A 2JVOA 4B9UA 2ZH8A 3GJSB 1TQLA 4UY85 4NZ7A 4M5MA 5A0YA 1DFDA 3OTEA 2XM3A 2HS4A 3WX4A 4MK8A 3H5SA 1MU2B 1KSPA 1IBLJ 4JI7J 2V63A 3JQJA 4A8QA 4DSEA 4ZK7M 2ZJQQ 2M8HA 4W98A 3PX4A 1A9NB 2XO7A 2E44A 4DZ6A 3W2VA 2YXLA 1GNKA 1X5SA 1HHQA 1O0PA 4P74A 3ZZPA 2K2PA 3FMWA 4IOAQ 1QVGR 1KOOA 3A3NB 1HL6A 3JQMA 2HVHA 5J1EB 3DU5A 5HP1A 2D3OR 1EJ7L 2W4PA 1HR0F 4ECVA 3POTA 2FC8A 1IUJA 2OMOA 2HFOA 4H4OB 4OYMA 2V4JA 1WORA 1TL1B 3ENWA 1SKWA 1N34F 4C97A 1RYRA 3HSDA 2YNGB 4G1QB 5HJYA 4FF4A 2YX7A 2JLGA 4OQJA 2QL9B 5DO2A 1RT6A 1U1PA 2NZ4A 3PIOQ 4QWCA 4F02A 4CWBA 4WTYA 2HKEA 2AJ0A 2VJUA 1N4LA 2EK6A 4B3OA 3DGPA 2R8KA 2JX2A 2AU0A 4XTTA 4LIWA 1FT8A 1RHQB 5DQHA 4JYAF 2RRBA 1UPMB 1LW0A 3OUYB 1YLXA 2XGQA 4L76A 5KG3A 5CCLA 2ZZNA 1N33F 3HO1A 2XY7A 3W65A 4LF6J 1IKVA 1UZHA 4G1IA 3RW6A 1KOHA 2GIQA 4O23A 3KWMA 2OD4A 3SBMA 4URGA 4C4WA 3A8JA 3CCES 2J9EA 2JFDA 2R7SA 1O6XA 3QSIA 2NPIA 4ZVGA 3IWLA 4L6V3 1JMTA 1RAFB 5CAAA 3EX7B 1X4GA 2FUG9 3EE3A 3G9CA 2XYHB 3CMAS 4JI3F 2GS8A 2ABYA 2E1MC 3L09A 2APOA 4WKYA 4WK3A 2ILZA 3TA0A 3EZ5A 1GAOA 2OGUA 2LQ9A 2CQ4A 1S6UA 2UVVA 1SQFA 2GMJA 2FZGB 2ZBIA 2VQEF 3DXSX 3QZ7A 3TP2A 3VAKA 2E7VA 3MR6A 5IV4A 4P2MA 1MU2A 4F4ZA 2KDOA 5ETOA 4F0HA 1WDTA 7AT1B 1N5YB 1VIXA 4ZLJA 1ZETA 2GVDB 5AE3A 2I9SA 3QT8A 2DISA 4DV7F 5DDPC 3SDEB 3DRSB 1YK9A 1DJ0A 4ECZA 3KYLA 2UUBF 3NL0A 2QSWA 3NNHA 4DHVA 1NB7A 1UCNA 2OEMA 2UVRA 4EO8A 2ACYA 1S7IA 3ZNUA 4IH6A 2YWGA 3HSZA 2V8VA 5J1EA 4MH8A 4B9TA 2MKIA 3FEYB 5GMKa 4C8LA 1T8EA 2V8HA 4H4OA 2BW7A 1LEOA 1S6PB 2E5LJ 1TL1A 1T9XA 3MPYA 4OI2A 4DMZA 1HNIB 4RUAA 4DV0J 2XMJA 2W2OP 4OHZA 2YNGA 4G1QA 3UDEA 5HBMB 4DUTA 2BJ8A 4V1Ak 4HEA9 1AROP 5KT2A 4HVZA 4DR7F 4IR9A 1OQ6A 4RNHA 3QBCA 1ZS6A 2VPYB 4FS2A 2NUUG 3DLBA 4OJGA 3EVWA 3OUYA 3MUMP 2CPHA 2M70A 3TANA 2OUGA 2F3JA 1Y0HA 5IC4B 4BCAA 4LSLB 4KTQA 3DLEB 3U27A 2B4PA 2XZTB 2EFGA 4ZVRB 3SCLE 4DFMA 3SI8A 2NYIA 3MHYA 1RCOB 7FDRA 4OI3A 2K1RB 1NU4A 4IRCA 3NWRA 3THPA 2UUCF 5E33A 3QPIA 2BQRA 2XCPA 1M5KC 4B3RJ 2BVZA 1ZTWA 5ETKA 3GCWP 2J5AA 2C2OB 2KI2A 5DGBA 4JBCA 3PW4A 2UU9F 2AEFA 1N5SA 2ZVSA 1GQEA 4WPAA 1H72C 4C8KA 1SCJB 3ENAA 3QYYA 1H2VZ 4Q43A 4ECWA 1XC9A 2VFTA 4A4JA 3MAQA 1NKBA 1FTRA 2YY3A 1YDLA 2IFXA 4OYWA 2PE8A 2FJEB 2QLBB 3RAMA 5KFJA 4TN2A 3A3PB 3CDUA 1LWXA 3DXBA 2R7UA 3BREA 2NREA 1NK8A 1ZM4A 1YITS 5DM6Q 3PRDA 2G4BA 4DV4J 1HQ2A 2CKWA 4AT1B 3T1YF 1JK9B 3D3BJ 2ZH5A 2OPQB 4M5HA 1S48A 1L3UA 3GR0A 1N5YA 3GIRA 2HZCA 4XPCA 3R6LB 5C5JA 3LA0A 3N5BA 3OXGA 1TAQA 2GVDA 3MWBA 4NYPA 3SDEA 4C3LA 1RU1A 3H7HB 3DRSA 4TKTA 4OZ0A 2GNKA 3GJQB 4FKXA 1U1QA 1VC5A 2OELA 4MIAA 1J5OB 6FD1A 1QTNB 4OYXA 1RTZA 1OQ3A 5D6GA 3GYXB 3EGVA 2NZCA 1FFGB 2G2OA 3BJYA 5HJXA 1NHUA 4U8YA 3KUHA 2QRRA 1S6PA 4CLUA 4CLPA 1HNIA 1FHTA 3MEEB 4DL0C 3A12A 5HBMA 1ZM3A 3ENQA 1QD1A 4DCOB 2E1AA 3BR8A 3TAPA 4UQGA 3RB3A 1XR6A 4I1TA 4IR1A 2QLFB 2WZ1A 2W1BA 1KTVA 3DU6A 2J6UA 2YX4A 4B9LA 1M5OC 4RR5A 2I2YA 4Y6IA 2DIVA 2HHHF 1NBEB 4QR0A 4DPTA 5KFCA 3BQ2A 2BJ3A 4FXWA 2CPJA 3OHBA 2DHHA 3CCMS 4LSLA 5D0GA 1SKRA 3TVYA 3GMGA 3DLEA 4UTGA 1TL4A 2KTQA 1RP5A 4UT4A 4U6PA 1RWPB 1S7HA 2PDAA 2HGLA 5AE1A 2GJ2A 2K1RA 1XNRJ 1VQMS 3GU0A 4ZLNA 4N8NA 3EXCX 2BKOA 2DKOB 4DR5F 3OHAA 3BQ0A 4KPCA 1EETB 2J0XA 5KFTA 5DGAA 2QMUB 3G8QA 3NCQA 2KFZA 4NCAA 2ATCB 2U1AA 3NS6A 3BKUA 3CO0P 4OYBA 4GKKJ 1OYEA 3EPGA 1FCAA 3NAIA 2CJKA 1LKZA 2LCWA 1AFIA 2YWFA 1SBRA 2LDIA 3AQPA 1NZ8A 1EQ0A 3T3FA 3MPWA 2M5YA 3R9LA 3NGRA 2RQMA 4X66J 4MJKA 2UVUA 3PW7A 4CH1A 3J7AN 2OPQA 5D0EA 4DV5J 1HNXJ 4PQUB 2BJ9A 2OH2A 4BC7A 4OZLA 4LF9J 3M8WA 3GE9A 1FVSA 1UVKA 5ETQA 2AGPA 1XMOF 3MEKA 1IQZA 3BGOP 2YH0A 1RACB 2W7PA 1SKSA 3TNVA 1R3NA 4RW9B 3NS5A 3SXLA 4Y2CA 4ED3A 1H3DA 2B9EA 4L74A 2VUGA 2QLJB 3H2UB 2WSCC 2RDJA 4B3TF 3BN4A 3IRWP 1J5OA 2HRYA 4B9SA 4C6AA 3PW0A 1P9QC 4NCGA 1RWOB 2XY6A 3RU0A 4DUZF 2YKPA 3MEEA 5F8IA 4O3RA 4OIXA 3E8OA 1WC3A 1KNZA 3T41A 3HHLC 2WTFA 2HHUA 3JYTB 4URQU 5JVGQ 2MEWA 5F8LA 2R7XA 5LMUF 1JXLA 5KT7A 3QRRA 3BBFA 1NK5A 2ZH2A 2PI5A 1FJGF 5IQ6A 3JB9k 1DAXA 1JB0C 4YB5A 2OI2A 1LNQA 1L3KA 3B54A 4K4VA 3BM7A 2AX0A 4EMDA 3J80Y 2DTJA 2ZBRA 5ETRA 1JLEB 4ENOA 2IVFB 2AHOB 1UVLA 2FIUA 4WFAQ 3Q0AA 4A8OA 3W8PA 2FJWA 1SVDA 3BDPA 1HNWF 1MW7A 4KPYA 3GV5B 1BGXT 1UTAA 3KG0A 1UVJA 1WC0A 1WHYA 4CLSA 4HYKA 2FVCA 5D77A 1EETA 3GB0A 3HVRA 2FC9A 5LT5A 1HBMB 1IR2A 5LM7E 2NLWA 2FJVA 3LP0B 1IJEB 4JI2F 3FSIA 2HHSA 5ETMA 1RAAB 4CLZA 4F0KA 1VHIA 3IMQJ 3CUNA 4DF8A 1UEKA 4RBTA 3RRHA 3W61A 2DNKA 3D2WA 1YJRA 3R2CJ 1BWVA 1M5HA 2RNEA 4ETXA 5E3QA 1KS2A 1YJ9S 3DRRB 2CQ3A 1N0UA 1OY8A 1YBAA 1YGYA 2WVDA 1IBMJ 3WQPA 4DV1J 3P4UB 5I3QA 5GAEI 4JI8F 4J9SA 4C9DA 2VF3A 2H65B 2DXEA 4LF4F 2RHSB 4CP5A 3O8WA 4RX6A 2H9ZA 1IR0A 4PQUA 3DMJB 4PRFA 3A13A 5FIIA 2ZFHA 3MGJA 4AQYF 5HAOA 4F3MA 4K2XA 3D4JA 5J1NA 1EP4B 1HBNB 5G4DA 1SH2A 4ZJLA 1RT4B 1RWWB 1FDDA 5CA5A 1YJVA 4ZCIA 3BGRB 4WFNQ 2WHOA 1U1NA 3ZZ0A 3EUNA 3KHGA 1RUSA 2Z2ZA 2BXJA 3D0GE 1FDNA 2OEJA 5CYJA 1GTHA 4WZQA 4ED8A 4PG7A 1YJ7A 2YNFB 3W5YA 2BKPA 2LXUA 3RW7A 1U1MA 4KAIA 1B3TA 2WBRA 2OJ3A 3N9UC 3LF0A 1F0XA 1Y3KA 2DEJA 1R8PA 1G6BA 4HDGA 2DO4A 3CTRA 2YBVA 3JAMU 2BJDA 2UV8A 3JYTA 1CLFA 2MKKA 2X1AA 1SQEA 4HTIA 1IR1A 1REVB 3ZZRA 1X4BA 3FK4A 5KT4A 3OTOF 2DNMA 4AE5A 1RLDA 1UWAA 3ZZYA 1JLFB 5F9NA 2MYFA 3Q8PB 1J5EF 2RIJA 2KXHA 2F8HA 4ES1A 3QIPB 1JLEA 4NASA 2DNHA 1TP7A 4ZPWR 3BZQA 2RH3A 1ZAWA 1VJQA 1EAYC 5T41A 3UQSA 4RL1A 1UVNA 2CAJA 3DDNA 3SV3A 3F56A 4Q44A 4AL5A 5K8NA 1IN0A 2WSFC 3VGUA 1VQ5S 4WKRA 4V19X 2FHJA 2CPDA 1VQ7S 2HYIB 2H54B 1YKWA 4DFPA 3TJAA 4X62F 5K20B 1CJTB 4DN9A 2E9TA 2HS0A 3W9HA 2JHEA 1UMJA 1HBMA 3LP0A 2JLEA 3P96A 3M32B 3KHLA 4I56A 4OYZA 2V4QA 4KKOB 4LQ9A 1I94J 2C2KB 3BGLA 4CDIA 2Y1IA 4JI6F 2Z8QA 3VVUA 3V6KA 1D09B 3HSGA 4ZVUB 1SC4B 5LSOA 1HHTP 4WIIA 2JSXA 1R6VA 2VBWA 2A2CA 4F4YA 3R7SB 3DRRA 3JTNA 1JJ2R 1S12A 1NHVA 4KGXB 2XMAA 4DF4A 1EKSA 3TX8A 1U48A 5D3GB 4JI5F 1WTFA 2J9DE 3KLIB 4RW4B 4C8OA 3VTIA 3TUPA 2XYGB 3VAHA 3NRBA 3DMJA 4USMA 2K06A 3CD7A 3IBFB 3Q8UA 3DN9A 4RKUC 4Y00A 4M63A 1T9WA 3TAQA 3G6VA 3DLHA 3I5BA 1EP4A 1HBNA 3IWNC 1RT4A 3TUJC 1DTTB 1V6HA 3DRXA 4MKYA 3BGRA 5KFKA 1GH8A 3HHLD 1FE4A 3EXYA 1PIEA 2WAQD 2ZHAA 2AJFE 3R5GA 4LBPA 2KL8A 2YNFA 2KZMA 1S1XB 3L9ZA 2HW3A 2W4DA 1UZDA 4NMLA 4X64J 1D0EA 3FSYA 2MLZA 2F4FA 2GFFA 4KY3A 1U2CA 2NS1B 3R1HA 2QZ8A 1KTQA 5DG7A 4LUBA 5DDRC 1I5OB 5E3CA 3ZZTA 1XTZA 3I32A 4ZCLA 3IBCB 3GPAA 3D6TB 3GTYX 5U47A 1REVA 1QTMA 3FSXA 3M05A 1P1LA 3IXQA 3AB2B 3I55S 2ZZTA 2CQ0A 4LREA 4A8WA 1WKLA 3WIUA 1NAQA 3QIPA 1KRPA 3EICA 3HD2A 1TKTB 2BMBA 3W9IA 4O3OA 2Y1RI 3Q8VA 2C28A 3LAMA 4CLLA 3QGIA 4IDKB 2HMIB 3G8SA 5DDOC 2MKHA 3M8QB 3V6HA 4KHPJ 4M5DB 1NJXA 4NOHA 2KRBA 1Q95G 3TWZA 3OTDA 4RBUA 3CJ3A 2AIRB 2AQ4A 1RCXB 3KLEB 4TY8B 1HARA 1FKOB 3KUGA 2FB0A 1GX5A 2ACMA 3MAAB 2HVDA 1CJTA 4RUBA 3ZTQA 4AFFA 2DHXA 3CJ0A 2P6SA 2C3YA 1S1WB 4F4KA 5LSRA 5CD4A 2VICA 3M32A 1S9EB 4P10A 1QSSA 1JQGA 4FNHA 4KKOA 2JVRA 4Q5VA 4OZ5A 1RYSA 1RBAA 2D3ZA 1BMQB 1Y00A 4CT9A 3ENVA 5HVHA 3W63A 1FDAA 1NH8A 1T05B 2CJAA 2JJ4D 3I4HX 2FPHX 1WWHA 1WKKA 4EZ9A 2Y0BB 2VQFJ 5D3GA 2QL5B 4RJVA 1M1KT 4NLQA 4KV8B 3DOKB 3J81j 1HQUB 3KLIA 3IAS9 4M8LA 4RW4A 2XZDB 1FK9B 3IWXA 4ZOSA 1X60A 2BV3A 4ZDNA 1G4CA 3L7UA 3ICLA 1UW9A 4CTAB 2KN4A 3FVYA 4A8KA 3DHWC 3HD1A 4ZPBA 4DSLA 1S5ZA 2BDPA 2V9KA 2KVQE 1RT1B 4NWBA 2J9CA 1NLKL 2GVZB 3ETOA 1DTTA 4MMOA 1VOMA 2HQ3A 4RPFA 3EYZA 4GC7A 2B9YA 1PC5A 1F9EB 5L8RC 4C0HA 2H5EA 2WB4A 4CLKA 1EKRA 1XNQF 3BBCA 4DPWA 2ZH6A 3HZEA 1T0TV 5HSPA 1KHVA 2DCLA 2LXIA 1B0PA 3RB0A 1S1XA 2C2DA 1RT2B 2G2ZA 3TA1A 3M8ZA 1JJHA 3M6VA 4K4WA 4ICLB 4ILLA 1RWNB 3GFZA 3GFXA 3PDNA 2MQQA 2P5VA 5ETPA 3BKFA 4UOFA 5B0AA 2ASLA 2FDNA 1B7YB 3G82B 3CIMA 2J0SD 4YY3F 4GKJJ 1QE1B 1U09A 1NDCA 2AF6A 2PO4A 1R6YA 4RNMA 4K5RA 2I6WA 1UKUA 2CQHA 4C98A 1YSJA 1T03B 4ED5A 5IOLA 4WFXA 1FNXH 2DXFA 2YWKA 3CULA 4F0MA 2QMXA 5IXUA 5KOXA 2L9WA 2MQMA 1VBYA 4KBIA 1N56A 4JV5F 3VGTA 3FUYA 5K8MA 5LMNF 3CJ2A 3N6LA 1UETA 1CC8A 2G0IA 2V2ZA 2F8MA 2ADCA 1K0VA 5E0OA 2DHAA 2PEHA 4OX9J 5KFNA 1TKTA 1CJUB 1DTQB 2OO4A 4IDKA 2HMIA 3UFCX 3QGGA 4WYWA 4USJC 3M8QA 1A6LA 2Y8WA 4M5DA 4ILRA 4JI1F 1CSJA 3KLEA 4TY8A 5LL6d 3MD3A 1FKOA 1J27A 3H5YA 4NLGA 3MAAA 1DY3A 4Z37A 2RILA 1MMLA 2J6TA 2NQPA 1V3SA 1ZPVA 5G0RB 2HNZB 1S1WA 2IIHA 3QJLA 3T1HF 2ZC3A 4LFAF 4ZN1A 1S9EA 3QGHA 1JXEA 4K4YA 1X0FA 4DI6A 4X4RA 5KG5A 1M5SA 2OFHX 4MKAA 3O3LA 4BWMA 4K4ZA 2ZKUA 3BR9A 5EX3A 2VBYA 3W5ZA 4DV3J 4NXMF 2OIHA 3KK2B 2PN6A 5GADI 3ZTOA 2DH9A 4LFCF 1Q7YT 3OFHA 1N54B 1UAWA 4KV8A 3DOKA 4IYQA 4R25A 4UUWA 1OWXA 1HQUA 1WEXA 3M7VA 1FK9A 2DNLA 1X4CA 4DR3J 1SH0A 2HWTA 2ZWPA 4FBUA 1VQ4S 4EZ6A 4CTAA 4WCEQ 4PWDB 1VBZA 4J9MA 2DK2A 1RT1A 5HQ8A 1UWBB 1SL2A 2GVZA 4ZA1A 1VHFA 4NXNJ 3EJMA 3OSPA 4IO9Q 1L3TA 4KHRA 1UA0A 4K50A 2C1EB 2HVEA 2I38A 3M1VB 3VAJA 2JEJA 4PQAA 4ITSA 1TMJA 3SYZA 1S6QB 3OVSA 2HNDB 3MURP 2HURA 4FVCA 1RT2A 1U02A 3C19A 3NWGA 2HAIA 3LGMA 1Q53A 2BX6A 2XS5A 4ICLA 2DGWA 3FCWA 3CCQS 1K47A 3BF4A 1N0VC 1VBKA 4GMKA 4RW7B 1RAEB 3JXOA 3SMZA 3R27A 3G82A 3LUYA 1X4FA 1RHUB 1QE1A 2YVSA 3EGZA 1VQLS 3OXLA 2HGMA 4IQMA 3OXFA 3FGVA 4JOUA 1Y5IB 4CO4A 2RT3A 1RTIB 1N33J 3L4BC 1T03A 4OYIA 4ED1A 3OFGA 4LJMA 5JXSA 4A8MP 2GV1A 2UZAA 3A3OB 4KT0C 5GADU 3IP0A 3I5AA 3PRBA 2N4DA 2IBKA 1OS5A 1RWXB 2B6AB 3KJQB 1CJUA 1DTQA 3NGDA 2V8PA 1N5QA 2VASA 1RABB 2DGUA 4J5OA 4TLQA 2MXYA 5F8HA 3GLJA 2I5JB 2YTCA 3GIIA 2F40A 3QATA 5AE2A 2JC1A 1GXTA 2FVRA 4K0KF 3PX0A 4DUYF 4ZPCA 4F04B 4BBYA 4LRAA 1RB0A 5B0EA 2QA2A 5G0RA 2HNZA 4Q0BB 1Y9OA 2YKAA 1ZM9A 1IBCB 1FRIA 2ZC4A 5CZXA 1VC0A 1KLNA 3H20A 3C6UB 1X9MA 2RDDA 4USUA 4EBEA 3I4PA 1PBAA 4F3QA 4QR2A 2KRRA 3KK2A 3FNNA 1W26A 1QSYA 1C0UB 3KMSA 4K4XA 2M88A 4FVMA 2JH3A 3C2PA 5E2QA 1WNEA 2N7YA 3LH2S 1KD1T 4YFUA 2CQGA 2CWXA 3GFHA 4OFZA 3CXCR 2RS2A 1WI6A 4DR4J 1UP1A 2XYPB 5DDQC 1OSDA 2EFVA 5GVQA 1CULB 4WXOA 3JSBA 5A8KB 2E9RX 2AKWB 4K59A 4PWDA 1U4BA 5ETLA 1N32F 3IC1A 3NCRA 4G65A 5IWAF 4FYVB 4EI2A 2H1YA 1T3OA 1R8CA 1UWBA 5DLGA 4EYIB 1P27B 3ZZUA 2DVIA 3HF5A 1VRTB 2ZD1B 5C2GA 2BE9B 2Z4PA 3EDRB 1VQSA 1RT5B 2BANB 4HHUA 2B8PA 1S6OA 3AH6A 3M1VA 5H9EJ 1IBLF 4JI7F 4WFZA 1S6QA 3K5NA 1K73T 2HNDA 1S49A 1TFYA 4QIVA 4DR7J 3D6FB 4OYOA 2HBZB 2J76E 1F9FA 1RTHB 2QYCA 2R4FA 2XNQA 2Z30B 4RW7A 2PEBA 3FEXB 3NBPB 3E3XA 1KQFB 3E51A 4EWTA 3TQEA 1XMBA 1KVJA 2MHNA 1G2EA 2DY9A 4NEYA 1KKHA 1RTIA 2DRAA 2DIUA 2RUSA 3NLCA 1HHSA 2CVEA 3G86A 2JFKA 1YZ6A 4BS2A 2E5JA 3AOCA 1CC7A 4LSZB 2L9DA 3BB5A 3DLJA 1TKZB 1LWCB 2DITA 4OYPA 4X4TA 3F41A 2LA4A 2W9BB 2B6AA 2JEIA 1K44A 2A6OA 4TYBA 2HLUA 4Z7YA 1DQ9A 5HN0A 1MG7A 4HH1A 2BJEA 1T94A 1WF0A 2D9OA 2Y1LB 3KHHA 1FJCA 1UJ6A 3EDQB 3D3CJ 3IBWA 2I5JA 1RSCA 1YJWS 4P71A 5KFHA 5A6PA 5DQGA 1HBUB 1RGVA 3TA2A 4J91A 4J9RA 3MAHA 4IFYB 4Q2MA 5L9XA 2FHMA 2E5HA 1U2RA 5L1IA 1VMBA 4Q0BA 3QAEA 5THWA 2EVZA 5T7LB 4GVLA 4UW2A 3CC7S 2KM8C 5D4LA 1JX4A 1NSAA 4PZVA 2J7WA 3C6UA 2FVQA 1WOSA 2GQ2A 1VLYA 4CNYA 1VQPS 2DXDA 3HT0A 4ETZA 3PR4A 3HKWA 2C2NA 1C0UA 1KONA 1HPZB 3M9OB 1Q16B 5BJRA 1KC8T 2ROEA 2W7OA 1SC1B 3IS9B 2QL7B 5DG9A 4G6VB 2XLJA 2DB1A 3D9BA 2BRLA 2UUWA 5KFQA 1GTEA 4IG3B 5EUHA 3HJFA 1CULA 5A8KA 4ERDA 2Q3PA 6FDRA 4UOCA 2MQLA 4DV6J 3KMQA 3AB4B 2HHQA 1R27B 3GJTB 1B99A 3R5JB 4L3NA 2N82B 2DPJA 2L9NA 4DXLA 4NE9C 4NZ6A 3PIPQ 2MQNA 1VRTA 3RR8A 2ZD1A 2IM0A 1Z2LA 2WVEA 3LALA 2OD6A 1RKIA 3L95X 2MY7A 4R5PB 2DD8S 2DNGA 2OLWA 1RT5A 3AAWB 2BANA 2POKA 4C8YA 2RRNA 1UW4A 3Q86A 2FJDB 3DYAB 1I51B 1Z1ZA 4CM2A 4MTPA 3TZXA 4YR3A 3DRYA 4QIFA 2HGNA 4EU0A 5J2QB 4OJ1A 3H4BA 1RTHA 2RVJA 3ET6B 4TNOA 4ES3A 1CVJA 3NBPA 1JLCB 2KHCA 3BSAA 2BACA 3DKDA 3R7BB 3ZNJ1 1NXIA 1WSRA 4A8FA 2VD3A 3K57A 1TUGB 1SI9A 2DGXA 4LBIA 2ZJPQ 1TKZA 1LWCA 3U1NA 4NLXA 2UVWA 4NYOA 1D9AA 1WHWA 4JV0A 2E5LF 2QT7A 5LXYA 2W9BA 3PHTA 3JAMY 1TKXB 3WC2A 2WB1D 1H2UX 4JI4F 2N3LA 4ANEA 3AOBA 4DV0F 1OJ4A 1U8WA 3FQLA 5DM7Q 3S1TA 1XWLA 1WG4A 2QX0A 1DQ8A 1QVFR 4LFBJ 1WHVA 3Q8RB 2ZITA 3MM7B 1ZAVA 4F50A 4C3MA 4PCQA 3MFHA 1O51A 1HBUA 4USTA 2CIMA 1VI7A 4WK1A 2M0GB 1S0OA 3KXDA 1NDKA 4IFYA 1RHMB 1IBKF 4ED0A 3ZTSA 3LP2B 3PVXA 1M1HA 2DR6A 4ZCMA 4X4NA 3IGVA 4Q8EA 1TKDA 2KFYA 5T7LA 2MKYA 4Y2AA 5I42B 3QO9B 2Z57B 1XR7A 4D3HA 3QJJA 4DV2J 1D3WA 3BQ1A 3IR5B 2MJNA 3RBEA 3U02A 2HFNA 3UN3A 1KQGB 9RUBA 5DS7A 1REGX 2XS7A 4NLWA 1HPZA 4YP3A 2LECA 1S99A 3C16B 5E7OB 3OVBA 2OFGX 1SL0A 4B3RF 3IS9A 4QIEA 4W92B 2CYYA 4UUXA 4Q7AA 5DZ6A 5I3UB 3HI9A 1FXRA 3QZ8A 2GJFA 4IG3A 5B0GA 4C2MA 4FKYA 2EG2A 1S4FA 3H98A 2GCFA 2W2NP 4X2BA 5K14B 3J81Y 2XQCA 1ITPA 2HFVA 3VR1A 4ER8A 2MKJA 2K3KA
chains in the Genus database with same CATH topology
1IKYB 1NEEA 4CO3A 2R2RA 3BDPA 1HNWF 2JC0A 2LU2A 2RF2B 3ONQA 3Q24A 5HLFB 1MW7A 1DURA 2J0WA 4KPYA 3GV5B 1BGXT 2XCAA 3KG0A 1MWZA 3I0SB 1UVJA 2XI3A 1WTBA 4R5PA 3VWSA 1WHYA 4A47A 2HWHA 4Y0FA 4Q8FA 4HYKA 2FVCA 5D77A 2QO3A 1U25A 5AXKA 4EO6A 2M52A 1EETA 2WONB 2FHJD 3GB0A 3N01A 4DV4F 3DYAA 3HVRA 2FC9A 3K2YA 5LT5A 1HBMB 1QY7A 5A8WA 2NLWA 3W2WA 2PFFB 4ZPDA 3J7YI 2FJVA 1JNZB 1IM4A 2L48A 4YDDB 2VBXA 3LP0B 4IOCQ 1CPZA 1JLBB 2Z0GA 1IJEB 4JI2F 3FSIA 3CCLS 2HHSA 3MOZA 5J2QA 2V8GA 3M30B 3MMAB 4X4VA 1RDRA 4HKQA 2VG5A 3N0VA 3L3CA 2HRUA 1FEHA 2AWZA 4RNFA 3CUNA 2I8EA 4DF8A 4I67A 1FXLA 4OX6A 4RBTA 2ZZMA 5KT6A 1Q8LA 4WU3A 4Z2XA 2MQOA 4U7UK 4YUDA 3RRHA 4H4KA 5J2MB 5AXLA 2YWHA 5FDLB 2GHWA 4ES2A 4DFJA 4ELUA 1JLCA 1UL3A 1Q78A 4F4XA 2B4UA 4PWUA 5K9FA 2R7OA 3QMQA 4DQRA 4RW8B 1RQ0A 3UI3A 4LF8F 3T5JA 2DBBA 2DNKA 2O66A 3THTA 3D2WA 1YJRA 2M7SA 3MECA 4QWDA 4UY8T 1IKXB 4DEZA 5F9LA 7FD1A 1M5HA 2RNEA 4ETXA 5E3QA 1P8GA 1KS2A 3MM9B 2RKIA 1YJ9S 3DRRB 1N88A 2BUNA 1VRUB 2CQ3A 2M8DB 3DLKB 5MAOA 4O3QA 1N0UA 4TU7A 1HWUA 4HL9A 4IFVA 3IRXB 2XI2A 2HHVA 5EGYA 3X1LB 1UFWA 5DQIA 1YBAA 1YGYA 4OI1A 3HMJG 4IRDA 4HHJA 2YH1A 1D8ZA 2HG4A 3UR3C 1R0AA 2ASJA 3NKYA 5I3QA 5GAEI 4JI8F 4J9SA 1N6QA 4C0BA 3BN7A 4C9DA 2K7KA 3DCAA 3GILA 1TR0A 4RW6A 3MR5A 2X51A 4LF4F 3OL9A 1NJIT 3OLBA 3MCSA 4I6AA 2CQBA 2CPFA 4IG0B 2DT9A 2ZE2A 2HHPA 3O8WA 4RX6A 2H9ZA 3HPOA 1IR0A 1TKXA 4PQUA 3DMJB 1B0TA 2AJ1A 4PRFA 4AL7A 5FIIA 4B9VA 2ZFHA 3MGJA 3SFGA 3WBZA 4TU8A 4AQYF 4DG1A 1QJHA 3IN5A 3T6JA 2FVSA 2ASYA 2D74B 4F3MA 2B43A 3BEGB 3MTJA 3NGKA 1IXKA 4K2XA 4NLRA 2BYCA 2XMMA 4DQIA 2KU7A 2GGPA 5J1NA 4KR0B 5E3AA 1EP4B 1HBNB 4ID5B 2LU1A 5G4DA 1SH2A 1Y7PA 4DPOA 1U1KA 3Q2TC 1WF2A 5C25B 3QJPA 3OR1B 4DSFA 1RT4B 4E0DA 2DGOA 2CZ4A 3MM8B 3BSNA 4ZPTR 1HQEB 3MM7A 2IBOA 4I68A 1FDDA 5CA5A 1YJVA 4ZCIA 3BGRB 4WFNQ 1R8AA 2WHOA 3HK2A 1U1NA 3IO1A 2YKNB 3T9ZA 4D3GA 5CXTA 3UR0A 3ZZ0A 2DH8A 2CPZA 5A8RB 5GAGI 2OPSA 3PO4A 3HFKA 2PSZA 1E6YA 1X4DA 3Q23A 5DLFA 1FKAF 1Z2ZA 3EUNA 2DHSA 3CC4S 1K1QA 3FZBA 1AXQA 3KHGA 3IG1B 2BXJA 4R0JA 1FVQA 3D0GE 3LP2A 1FDNA 4QU6A 2JZ5A 2X1BA 4IKAA 1Q86T 1RI7A 1DARA 1GTHA 5CYJA 2ZNZA 4WZQA 2XWYA 3K5OA 3TI0A 4ED8A 4PG7A 2MQPA 2YNFB 3I87A 2DGSA 3LAKA 1RA7A 2C3PA 4ELVA 3R5AA 2LXUA 1I6JA 3RW7A 5KTQA 1U1MA 4KAIA 3N5FA 2ZH7A 2WBRA 3B8HA 4ZP7A 1SJRA 3K7RA 2OJ3A 3IA0A 4K5SA 3KNAA 2RJZA 4WF9Q 3H59A 5M2PA 4DV6F 5I42A 3N9UC 4AXJA 2FD2A 3LF0A 1F0XA 3QO9A 1Y3KA 3CF5Q 1S10A 2DH7A 1NKEA 1R8PA 4BC9A 1G6BA 4HDGA 2R7WA 2MSTA 5HROB 2XY5A 2DO4A 3HHEA 1ULRA 3CTRA 3JTPA 3MM5B 5CZVA 3KLGA 1TUVA 2C3OA 3L7OA 3H2VE 2BJDA 2PMZD 5KOWA 2CPXA 3J7YU 4B02A 1FKPA 2UP1A 4QYZJ 3MXHP 5D4NA 1XNRF 1G3OA 2UV8A 3CGIA 3O1LA 4FXDA 1MWYA 2WRMA 1DRZA 3JYTA 4NCGB 3SQGB 1CLFA 2GO8A 1V3RA 2BQUA 1I94F 2MKKA 3AY0A 2X1AA 1I1GA 4KQZA 1FNOA 4I69A 1SQEA 2HVZA 4HTIA 4RUHA 1YTYA 4GC6A 1SXLA 1REVB 3KKFA 3ZZRA 2YX1A 1X4BA 1H7WA 2DRBA 5KT4A 3OTOF 2DNMA 4AE5A 3LWLA 2B7CB 3ZZYA 3HX9A 1H38A 2F9JA 1JLFB 3NMRA 3OLAA 4PPDA 1QAIA 2W7AA 5F9NA 5KG2A 1Q81T 2LKZA 2MYFA 2PD1A 3D1OA 3Q8PB 2OPPB 2X3GA 1J5EF 2RIJA 5I3UA 2HHXA 4X4UA 5M2UA 3J7A1 2KXHA 2RQKA 2VPZB 2DR9A 2F8HA 4ES1A 3R5BA 3QIPB 1JLEA 4KC5A 2DNHA 1TP7A 2CZVC 4ZPWR 1X5OA 3UE2A 2VFSA 1ZH5A 1W2IA 1U7LA 4GKKF 2KT3A 3PJWA 3BZQA 4CI0B 4MYTA 1S1TA 2RH3A 5B0BA 4N77A 4X65F 4NLSA 1ZAWA 2KH9A 2ROPA 1S79A 3MM6B 1L3SA 1QSLA 1VK8A 4YEAA 5K14A 1S1UB 3OTBA 5JJBA 5T41A 1LQ9A 3UQSA 2R7VA 1C1BB 4FN5A 3FFIA 3M2VA 3TVKA 2XMUA 2DNNA 1UVNA 3DDNA 2VG7B 3SV3A 5EN1A 3T19A 3F56A 3B78A 4DLEA 1BC6A 5F8JA 4Q44A 2OPRB 4AL5A 4J9QA 4KGMA 5K8NA 2XG8A 1IKYA 1IN0A 1WEYA 2WSFC 1HI0P 4NLVA 1VQ5S 4WKRA 4V19X 2FHJA 2RF2A 4PXDA 5HLFA 2CPDA 3CCJS 3THVA 3JTOA 1VQ7S 3WDOA 2HYIB 2P9EA 5ADZA 1N36F 3I0SA 4DFPA 2XZWA 4XDCA 1WF1A 2ZHBA 2LQJA 4X62F 1FA0A 2MPUA 2WONA 4DN9A 2E9TA 4QU7A 4DFKA 2HS0A 4H4MB 2JHEA 3G71S 3N6MA 2PGCA 1UMJA 3UCUP 1HBMA 4XAKA 1T05A 3DNCA 3D54A 2MKCA 2K3IA 5CYQB 3K0JA 1LWEB 2XMVA 3LP0A 2JLEA 1JLBA 1Z4UA 3M32B 3P96A 3KHLA 4DV5F 1X4AA 1HNXF 3M30A 3MMAA 2UXBF 3S01A 4I56A 1WG5A 2WOMB 2V4QA 4KKOB 5GAGU 4LQ9A 4RNOA 5L1KA 3L7PA 2B51A 4NLOA 2E1CA 4LF9F 4WZMA 1SUQB 5A2QY 1X8DA 3ISZA 3BGLA 3NCPA 3K58A 2DGQA 1Q8BA 5D4PA 1K1SA 2VL1A 2Y1IA 5J2MA 5FDLA 4JI6F 2Z8QA 4OHYA 3V6KA 1PSDA 4NLUA 1P1TA 3MEDB 5E3PA 3HXMA 4RW8A 1OPIA 3E2EA 4JV2A 4LFBF 2W8KA 3PJXA 5LSOA 1HHTP 4WIIA 2JSXA 2A10A 1WG1A 4FF1A 1TFWA 2VBWA 2CQDA 2Q6BA 1IKXA 2A2CA 4O4GA 2DR7A 3R5DA 1Y4ZB 3ZC4A 2KYZA 4F4YA 1YHQS 3MM9A 4P7VA 4DX8H 3DRRA 3JTNA 4AYBD 2N4CA 1JJ2R 1VRUA 2IRXA 3D1QA 2PA8D 3DLKA 3M2RB 4KIAA 4CO5A 2KZZA 1LK5A 1NHVA 2BM1A 2C2RA 3IRXA 3PV8A 2NPFA 5HO4A 3CDWA 3GV7B 2OSQA 4DF4A 4RU2A 2DNOA 3N4WA 4I2QB 5BYRA 5DG8A 3MR3A 2IJF