2G4BA

Structure of u2af65 variant with polyuridine tract
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
172
structure length
172
Chain Sequence
b'LGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3'
publication title Structural basis of polypyrimidine tract recognition by the essential splicing factor U2AF65.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 44
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g4bA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2g4bA02
2MJNA 4ZKAA 1OPIA 2OJ3A 2KVIA 2FC8A 3SDEA 1M5KC 1KOOA 2DGUA 3SMZA 5GADU 2DIVA 2WBRA 1BY9A 3B4DA 2M52A 3VAHA 2AYBA 2MKKA 1M5PC 2LKZA 2MQMA 5MLCV 2ADBA 1VC6A 1H2UX 3MXHP 2RQCA 1VQKS 2KHCA 3CCLS 2LECA 3P5TL 2VOOA 4Y0FA 1JJ2R 1U1NA 1WELA 2CQGA 1FJ7A 2X1AA 3CMAS 2M0GB 5DM6Q 3CC2S 1U6BA 2L41A 5DM7Q 2CPZA 4CIOA 2CJKA 2MB0B 4YB1P 3MOJB 2DHXA 2KXHA 2M8HA 2CPDA 2U1AA 2PEHA 2FHOB 2MZQA 2BOPA 2DGXA 5LSLA 1L3KA 3V4MA 1SXLA 2MYFA 4OZ0A 3P6YC 1X5SA 1KC8T 5DDRC 2RUGA 1VQ8S 2LMIA 1QM9A 5IM0A 2RRBA 4WFNQ 1SJ3P 2XS7A 3NNHA 1SJRA 2KT5A 3VAIA 3TYTA 2FPHX 5DETA 4YUDA 2OTLS 2MZTA 3S6EA 5GMKa 1VC5A 1CVJA 3UCGA 1F9FA 2D9OA 2DNGA 1HA1A 2DNLA 2DHSA 1R8HA 5CA5A 3P3DA 2DGOA 2RRAA 2DHAA 3CULA 1KQSR 1VQLS 1WI6A 2MPUA 4W90B 3CCQS 1VBXA 2DHGA 3CCJS 1SJFA 2KM8C 4C4WA 3UWTA 3K0JA 2QFJA 5GVQA 2ZJQQ 2MSSA 2N7CA 2MKIA 2DK2A 3NS6A 2XNRA 2E44A 2DGTA 4FXVA 3DXBA 1N8RT 2DNQA 5DDOC 3S01A 3G71S 1RK8A 2EK6A 2HZCA 4CH0S 2MKCA 3J7YU 1P27B 2MQOA 1K73T 3L3CA 2CQBA 5D78A 4WIIA 1URNA 5IM0B 3UCZP 2G0CA 2MQNA 2KG1A 2CPEA 2FY1A 1WEXA 2OSRA 2E5IA 1H6KX 2QA4S 5FJ4A 2MKSA 3SXLA 2LEAA 1WWHA 2AYMA 5LSOA 3CUNA 2JX2A 2KFYA 2LYVA 2V94A 1FJEB 3HI9A 1WI8A 3LQVA 2F9DA 2LXIA 2M8DB 1UAWA 4QQBA 3R27A 1U2FA 4EGLA 1X5PA 2NLWA 2J0QD 1IQTA 3R1HA 2RT3A 1HD0A 5JVGQ 1HD1A 4IOAQ 2DH7A 3D2WA 4OZ1A 5BJRA 4IOCQ 3CTRA 1Q82T 3UCUP 1U1QA 2MKJA 3CPWR 1YHQS 2DO0A 1PO6A 2VONA 2ERRA 2KRBA 2LXUA 5GAEU 2MQLA 2CPYA 3P49B 2JVRA 5JVHQ 2RS2A 2CQ2A 2KM8B 2RNEA 2LA6A 3ZZZA 1JJHA 3G6ES 3LPYA 2M4MA 2CQCA 3U1MA 1WG5A 3R1LA 2RVJA 2KRRA 1H2VZ 4PKDB 1WHVA 2D3OR 2DGSA 2DNMA 3TP2A 1VC0A 4PRFA 2OTJS 2HGMA 3MUTP 1U1KA 4WFAQ 1DHMA 2I2YA 2U2FA 3NS5A 2QEXS 1N54B 1Q86T 3G8TA 4WKRA 2XS5A 3VAJA 2DGQA 1ZZFA 1OWXA 3G96A 3CXCR 1WHYA 1WEYA 2L9WA 3OW2R 2DNNA 2MHNA 1U1OA 2XS2A 2X1FA 1VQNS 4TU9A 3BS9A 3ULHA 3UD4P 2MGZB 2K8GA 4RU2A 4LIRA 2G4BA 1KD1T 4V19X 1YJ9S 2N82B 2B0GA 2CQDA 2J76E 1VQPS 3G8SA 2FC9A 2CPJA 2LCWA 3VALA 4UY8T 1B7FA 1M90T 1R8PA 3Q2TC 1X4EA 2N3LA 1YI2S 2BZ2A 3ZZYA 3MUVP 2XNQA 2KI2A 1NJIT 4F02A 2HYIB 2CPIA 2AD9A 2VOPA 2JWNA 1PGZA 3CMES 2XSFA 4UQTA 4ED5A 3CCVS 4A8XA 1X5OA 1ZH5A 4LMZA 1NO8A 2DO4A 3MD3A 1VBZA 1YJWS 2MY7A 2DNPA 2N3OA 5GAHU 2RQ4A 2O3DA 2MZSA 2CQPA 2D9PA 1X0FA 2LQ5A 3MUMP 2HGLA 2KN4A 3BO2A 2Q79A 2DGWA 2RS8A 4QU6A 4TU7A 3CC7S 2AYGA 5ITHA 1X4CA 2YH1A 2KU7A 2MJUA 2M70A 4WFBQ 3MURP 1Q7YT 1OO0B 2YWKA 4U67Q 2DB1A 1ZZNA 1U1RA 4CQ1A 1VQ5S 1U1LA 2MSTA 2L08A 1QVFR 5DDQC 1OIAA 2CQ3A 1M5OC 1WEZA 2I38A 1M1KT 3VAGA 3G9CA 1WF0A 1X4AA 5CXTA 1WF1A 3B4MA 3NNAA 2CPFA 1JJ4A 3N9UC 1P1TA 2M9KA 4TU8A 2HGNA 3CCES 3US5A 2DNKA 4CH1A 2MGZA 2DNYA 2SXLA 4W92B 3CF5Q 2CQ4A 1HL6A 2E5JA 2KG0A 4QU7A 2J8AA 2RU3A 3THTA 1WF2A 3H2UB 4Z2XA 1N52B 4IUFA 1WHXA 5H1SV 2MY8A 2E5GA 3CCRS 2MXYA 3BEGB 1VQ9S 1X4BA 2MZJA 1S72S 1YWXA 3I56S 2ZJPQ 3CC4S 1WHWA 1UW4A 2M2BA 1WG1A 2KXFA 2CPXA 1FJCA 5EN1A 3BO4A 3U1LA 1X4FA 2DH9A 2CQIA 2J0SD 2PE8A 1YJNS 5LJ5Y 2UP1A 3EGNA 2GO9A 4P6QA 1D8ZA 5HL7Q 2MQPA 3IWNC 1SJ4P 2YH0A 4LJMA 2M7SA 3VAMA 1W2BR 3VF0B 2ADCA 1VQ6S 5LJ3Y 3PIPQ 2HVZA 3G4SS 4BS2A 3EX7B 3IRWP 5GAGU 1NU4A 1JMTA 3MDFA 1DBDA 2DITA 1UFWA 1XN9A 2EVZA 3NNCA 2JRSA 1WTBA 2KH9A 2LEBA 3I55S 2M88A 2MZ1A 1H2TZ 1SJQA 3RW6A 1X4GA 1X5TA 4FXWA 1U1MA 2YKAA 1D9AA 3Q2SC 2KXNB 3NMRA 1VQ7S 1U1PA 2JVOA 4C7QA 1Q81T 2VODA 2F9JA 3FEXB 2CQ1A 1A7GE 2G1DA 4QPTA 1N88A 3SDEB 2DGVA 3HHNB 5DDPC 1FXLA 3UD3P 3H2VE 2YTCA 3VAFA 1K8AT 4Y00A 3CCMS 2F3JA 4IO9Q 2OIHA 2DNOA 1FT8A 2A3JA 4J5OA 4F26A 1YITS 3MI7X 1U6FA 1YIJS 3BO3A 3CD6S 2XB2D 3S8SA 1X4HA 3MD1A 1A9NB 2MZRA 5IQQA 1RKJA 1DRZA 5D77A 2X1GA 2DIUA 1FHTA 3DLLQ 2MKHA 2NZ4A 1QVGR 2ZJRQ 2DH8A 2X1BA 2GHPA 1VQOS 1S79A 1UP1A 1DZ5A 5LXYA 2DNZA 5HO4A 1FNXH 2EK1A 1KOHA 1O0PA 4F25A 4PR6A 2AYEA 2DNRA 2KYXA 2MMYA 2MQQA 1YTYA 2LA4A 2CQ0A 3FEYB 4YOEA 3CCSS 1X4DA 3RW7A 4C0OC 1WG4A 3J7ZT 2K3KA 5IFMA 3EGZA 2OSQA 4ERDA 3UE2A 1VBYA 2CQHA 2DISA 1FO1A 3CCUS 4TLQA 2DNHA 3S7RA 1G2EA 4WF9Q 3THPA 2E5HA 3VAKA 3TO8A 5LXRA 1M5VC 3JB9k 3PIOQ 1AUDA 5CYJA 4M5DB 1VQMS 1K9MT 2CPHA 1VQ4S 4WCEQ
chains in the Genus database with same CATH superfamily
4J9OA 4RWWA 1SBRA 4G1QA 2FJVA 4LFBF 2N7YA 7FDRA 4I67A 2UV8G 1YBAA 1KKHA 4TQRA 3MEDA 1WJ9A 2ASDA 3IWXA 3W5YA 3K5PA 4BWMA 1UA0A 4CLLA 1TKXA 4GVLA 2M8HA 4M95A 5HBMA 5LSLA 2PGCA 3FGVA 1SJ1A 1UMJA 5KAKA 3SEOA 1GTEA 3LF0A 1SJ3P 3HJVA 1RWMB 2FHKA 2YKOA 4DG1B 4LF9J 3HZGA 2PT0A 2D9OA 2O67A 1RAGB 4EU0A 3P3DA 4FF3A 3JSMB 3CULA 1B99A 1URRA 2ZBIA 3GWCA 4FBTA 2OMLA 1FWLA 3TAMB 1T9YA 3QWPA 1G1XA 2OUGA 2VFVA 3KG0A 4EYIB 5KFNA 2Q66A 3H5XA 5CH7B 4JI0J 2HG4A 4B3OA 1MN9A 2F63A 3MM6B 4FS2A 2KJVA 1UVLA 1HMVA 1WKKA 3QJJA 4USHA 3G2XA 2KFYA 1ROFA 3HLUA 1JLGA 2LYVA 5CZXA 5AJ3F 2LXIA 3T5HA 3W1YC 3ENQA 5AXNA 2KO1A 1HD0A 5IOLA 1RHRB 2IFXA 4M5IA 3CPWR 2AKWB 3ZTPA 1YJUA 3P49B 4DOZA 1LWCB 3PDNA 2CQ2A 2FQQB 4V1Ak 2MQ8A 2LA6A 2R2UA 3RAQA 3EICA 2I1RA 2AZ3A 3KNGA 1H2VZ 3HSDA 4CNYA 4HHHA 4PUOB 1SL2A 3OTOF 5I42A 2VKZG 2GJFA 4X65J 4MH8A 1U49A 4JI5F 4WTOB 2W4CA 2X1FA 4L74A 4N56A 4MYTA 3NBPB 4LIRA 2FJDB 2GV1A 2MHEA 2O01C 4BLGA 3VALA 2FC9A 5DQHA 3Q2TC 2H48B 2IBOA 2XNQA 5KT5A 1U0HA 4B9SA 4DU8A 2VQEJ 3P5BP 1DTTB 4I2QB 2W25A 1TL4A 4K4SA 3M8SA 1AZSA 4X4SA 2BOAA 2E1RA 3OQ2A 1SCJB 2YH1A 2KU7A 3OFGA 2PC6A 3ENVA 1RWKB 4DBQA 1DURA 1GMWD 3ZZUA 2V5HG 3N01A 5BR8J 4DWIA 1LXNA 2FVSA 3PHTA 4TU8A 2XG8A 2VFUA 2DNKA 4J9KA 4DFPA 2J8AA 4JI3J 2RU3A 1RWNB 3E2EA 2EFNA 1VJQA 3TVYA 4X66F 2XSJA 1TK5A 1X4BA 5CYQA 1WG1A 5B0FA 4NEYA 4PG6A 5GAEI 4QWCA 4MJKA 4OYAA 2J0SD 2BDPA 4C11A 5HJYA 4IDKB 3IWNC 2YH0A 1BC6A 2QLFB 2BR0A 4DV5J 2ZZNA 3NGDA 4B3TF 1HQEB 3IM8A 3BPSP 1XN9A 2WOMB 2GHVC 2HAIA 3NMRA 4FVCA 1S77D 4K4YA 3GYNA 3QGHA 4Q45A 2QIFA 4FPRA 1DAXA 3UDLA 3AFGA 1LWEA 3KK1B 1FT8A 2ZH4A 2K1RA 1YIJS 4MIBA 5IT0A 4K5RA 1RSCA 2NPIA 2PMHA 2GIFA 2PMZD 1DRZA 2VIHA 4Q8FA 4EBDA 3M6XA 4CLFA 2VFRA 3NGRA 3GCXP 3H5UA 2RUSA 2IBKA 1TUWA 2H3EB 2CVEA 3KUHA 2MQQA 3AJDA 3NGSA 3HZEA 5HJXA 5J1EA 2CQ0A 5A8KB 5KFHA 4C2MA 1WG4A 2EFOA 2OSQA 1BQMB 3UE2A 4RW4B 2KZMA 3SQOP 4HDHA 3DRRB 4TLQA 3S7RA 4I0WA 2GJ2A 4NI2B 1VIXA 4CZCA 3D9BA 4UQGA 3JYTA 1CULA 3TZYA 3JQJA 4TKTA 2K3IA 3MMBA 1KDNA 1R7IA 5FLXU 2YNIB 2PI5A 4ZHRA 2FY8A 3KKFA 2M52A 2HHTA 1RDRA 3SQGB 2MQMA 2ZM6F 1RKIA 5C2CA 1VC6A 3LGHA 1X9MA 4NMLA 1TUGB 1HYSB 1U1NA 1WELA 2Q6BA 4LSLB 5IT9U 1TTHB 5ETKA 4A8FA 1JQGA 3JAMY 3HP6A 2GMHA 3PHEA 3VQSA 1N6QA 3TYTA 3QGGA 4Q7AA 1VHIA 5C25A 3OLAA 3V6DB 1HHTP 2HFNA 1NBEB 1R8HA 3GPAA 5JUMA 1ULRA 4WYWA 3MEEA 3HVAA 4FF4A 1S0OA 2QA1A 2XMMA 4CI0B 3EXYA 5GVQA 3QLHB 1FE0A 1HHQA 2GVDA 2WK4A 1HBNA 1RHMB 4UT4A 1Q78A 1HNWJ 4PG7A 4IQXA 1MNEA 4DCPB 1Q8IA 1JJCB 4DS5A 3KXDA 4ZVTB 2KT3A 2AIRB 3DOLA 3K5MA 1WEXA 1H6KX 2ZH1A 2YNFA 1TELA 2BYCA 1LW0B 2JX2A 1SV5A 3MCMA 4ZOSA 4X4PA 4RUHA 3PFEA 4WJBA 2YWEA 1NDCA 1S5ZA 4BHQA 4JB8B 1IQTA 2BRLA 2DH7A 4QWBA 1CPZA 2KRBA 5F8HA 4N8NA 4DV0F 4OMFG 5DG9A 1G4CA 3GSIA 2DPJA 4MK9A 5L9XA 3PO5A 2HLUA 1M1GA 1MROA 2RVJA 2HGMA 5T14A 3ZFVA 1RTHA 2I2YA 2QO3A 2XS5A 4V19J 2UVWA 4N76A 2YNGB 3DU5A 4U8YA 1F2HA 3J81U 4LFCJ 4ZP7A 1T9WA 3T41A 2V4QA 4V19X 2XZDB 4UY8T 2YX7A 4ELUA 4K4ZA 3MUVP 3RGIA 4I1TA 1UEUA 3UVJA 2R7XA 3CMES 4G1PA 1DARA 2CNOB 3NGUA 1IKVB 3CJ8A 3Q22A 1N36J 7AT1B 4L3NA 4JI4J 3I9ZA 4O4GA 4DCJB 5DLGA 2C3YA 3ELHA 2MJUA 2C42A 4Z7YA 3RBXA 3C15B 3LPEA 3PYGA 3Q8PB 1XMQJ 4NLPA 2YKMA 2ALYB 3C14B 1F1BB 4ICLB 5J2PA 1M1KT 4B3RJ 4CLKA 1EJ7L 1YX2A 3VGTA 2W9BB 3AA8A 2RQKA 1GXTA 2XLKA 2RHQB 3P45B 4CYUB 1N52B 3RBEA 3CCRS 5L38A 4DDFA 2IRYA 3LW5C 4C8YA 1WHWA 3ENWA 4ZVGA 2ZWOA 3TOQA 2UXBF 4KIAA 4F4YA 3W5XA 2A6OA 1D8ZA 1VLYA 5HL7Q 2OPSA 1OYEA 1GX6A 3I5CA 1SIWB 1SJ4P 1FKPA 1VQ6S 1T03A 4BBYA 1PYTA 1XWLA 3HFKA 1TMJA 4AQYJ 2VDHA 4M1KA 1TMMA 3A3NB 3RW6A 1IKWB 4B3MF 4LFAJ 4MMOA 4TY9A 5F8JA 2GGPB 1QAXA 3FUYA 3QJPA 1NK4A 4FNIA 2MKYA 5KG1A 4QOTA 1DQ8A 3VV2B 1I51B 2F65A 3ZZRA 2MZRA 4PXDA 4IO1A 1WOOA 4ECWA 3GR1A 3GFZA 4CCHA 4GKKF 5GAHI 1KTQA 1UVIA 1FVQA 3MMCB 3PX4A 4PYDA 3M2UA 3D1OA 1VQYA 3AB4B 1R89A 1CJVA 1GXUA 3KLIA 1VBYA 2CNNB 4H4MB 2DXEA 4Q8EA 1ZOTA 3GIJA 1X9SA 3SDEA 3ZO7A 3MTKA 5EWFA 1JWWA 4ZVHA 2DIVA 2VG6A 3OR1B 5DQIA 1CJUA 2Z2ZA 2ADBA 3LA0A 2NXJA 3O2IA 1FRHA 1F3VA 3I0RB 2X1AA 1DTQB 5L1KA 1C1BB 3RU0A 4UF4A 2FJWA 1S59A 1XMOF 5HMZA 4NXMF 4OZ0A 2D41A 3DOMA 1C0TB 4WE1B 1VQ8S 3NNHA 2VC0A 4C3MA 1S9FA 2FPHX 2H51B 3KK2A 2J7UA 3OJSA 1HWIA 1FXDA 1L5UA 2ZC3A 1VRTB 2DHSA 4C98A 1NCLA 4RJVA 2R7RA 4O0IA 2DHGA 3KLEA 2HKEA 1T11A 4S0MA 4C4WA 3UWTA 1UKUA 3KDNA 3F41A 2MSSA 3LP2A 1H72C 3CDWA 1IJEB 1ZTWA 2XLJA 2R7OA 3HK2A 1S0VA 3MWBA 2YBVA 5LSRA 4WZQA 2AGQA 2RAQA 3Q8QB 3PNIA 3OL8A 4N41A 1HI1A 4RBTA 3QGPA 1IM4A 1MMLA 4KV8A 3D6FB 3D0IE 2F4VF 3A13A 3BYRA 1UAWA 2ZHBA 2J0QD 4IG0B 4KQZA 2QMXA 1HD1A 3M8RA 5JVGQ 2CWXA 3E3XA 2DO0A 1PO6A 2R8JA 2PD1A 5F9NA 3GV8B 2OD6A 4I69A 2CQCA 1FI4A 3T6BA 3TAMA 4P2FA 2DGSA 3W9HA 2KVQE 1XTZA 4NLTA 1YQHA 3NS5A 4J90A 1VK3A 3D0HE 4NZ6A 4L6V3 4OYBA 3G96A 2ZEJA 4DPUA 1F2GA 2OPRB 2BE2A 3H4BA 3MM6A 1U1OA 3N6MA 4NASA 5EWGA 4G6VB 3RR8A 2G0IA 4DHVA 3TJ8A 5F0UA 5AT1B 1B7FA 4D3HA 5E41A 2R42A 4U6PA 4USUA 4DXLA 2VU5A 1JX4A 4Q44A 3AJ2A 4UOFA 1VS3A 5M2PA 4ZK7M 1LWCA 4NLRA 2HGLA 4Y34A 4QU6A 4P52A 2AT1B 3THVA 2XI2A 2WONA 3UQSA 2L08A 2XMAA 5F3ZA 4DR3J 1V3SA 1HR0F 4BCAA 1O5JA 2B43A 3NBPA 4HHJA 5ETSA 2PA8D 2CQ4A 2FVCA 4FYDA 2W2PP 4DL6A 4U96A 1RACB 2V69A 3BEGB 2C2EA 2R2TA 2OH2A 4M5JA 4RUAA 4RR5A 4I2QA 3FCWA 2UP1A 1RTJB 1SVDA 3IGNA 2MQPA 3M30A 2PFDA 4KGXB 4LF7F 4ER8A 3GR0A 2Y1JA 2B6AA 2RSQA 4ZVSB 5ETOA 1JXVA 1N5VA 4ZVRB 1S6OA 1D09B 3BN7A 2KXNB 1GT8A 2BEFA 2FLPA 1UPMB 2F40A 3O8WA 4F2SA 3HHNB 2F3JA 3A1YG 1W25A 2VJUA 4EMDA 2FUG9 3GE9A 3OFHA 1X4HA 1I94J 2B56A 2BM1A 4WBFA 5IQQA 4A8MP 2R3VA 2ASLA 3FC9A 3B82A 4DJBA 1T8EA 5KFKA 5EUHA 4OX9J 2VG7A 3MAAB 4IDKA 5KFOA 1HW8A 3J81j 4ZPTR 1HQEA 3IS9B 3DLHA 3DDNA 3DLEB 2ZOFA 1FO1A 1FK9B 3TAPA 5LXRA 2RIJA 1IKYA 2VA2A 1MLAA 5A6PA 2CRLA 3AQOA 3IBFB 4ED1A 2CG8A 1VISA 3H2LA 3RG6A 2CDRB 3ETOA 2UUCF 3M2VB 4LQ9A 2LKZA 2UU9F 4OL8A 4KH1B 5KG6A 1IKXB 4Q0BA 1B0TA 1NK8A 1W2IA 3PXGa 2QL7B 1EIYB 2MB0B 2CJKA 3QZ8A 3N5FA 4AFFA 4YHHJ 3HSGA 2BOPA 3Q23A 1YBUA 5A6WA 5A8KA 2A2CA 2BVZA 4KO0B 1BQMA 2PMWA 4RW4A 4I4BA 1RWPB 4D3GA 2HVHA 3S6EA 3R5BA 4A4JA 1MG7A 2OHDA 2DNGA 3EVMA 4DR2F 1XMBA 4K59A 3FSYA 2VQFJ 5F3TA 4QWAA 5KFSA 1T3OA 3C16A 1TQLA 4Y28C 2IDLA 2A1BA 2YNIA 2AX0A 4GMKA 2GVZB 3R5AA 2CWKA 3GG0A 3VVUA 1GMWA 1KONA 4ZP8A 3SQGA 4GKJJ 3NCQA 4F04B 1Y00A 1RK8A 1UETA 3GZ7A 1WC4A 2MKCA 1HYSA 3VVTA 2IAJB 5IM0B 4OZ5A 5A2QU 2BUNA 4NLQA 1MW7A 3V6JA 2YWHA 3R5DA 3J80U 5KT4A 2QZ8A 5LSOA 5HAOA 1PYSB 1N34J 5ETPA 1TP7A 3OVSA 4QJVA 3CJ5A 3ADAC 4QQBA 4YFUA 4DR6F 3W8GA 4ZVQB 3GP9A 5IQ6A 2PN6A 1RWUA 3V6DA 4J9RA 2W2OP 2LXUA 5G0RB 1RT1B 2P2CB 3BH7B 1T05B 1QE1B 3LPYA 3M8PB 4X4RA 2BJDA 1FX2A 1H38A 3U1MA 1BHNA 1WG5A 3NOCA 5LM7E 3TQEA 4C48A 4PWUA 4DPYA 4CLSA 4W4MA 2VPYB 2DGQA 2ZUGA 3AD7C 4YB7A 3V81B 1CEZA 1ACMB 1O51A 5KFCA 3BPDA 1RAHB 4YY3J 1KQKA 4NA1A 2D1CA 4KBIA 4R5PB 1YJ9S 2GQ2A 2EC0A 1VQPS 1MU2B 1LW2A 2RU9A 3NWRA 4C3LA 2HYIB 3MAHA 3W63A 2PFFB 1X5OA 2QV6A 3OTBA 4KAIA 3C6UA 3M32B 2N3OA 3TARA 2XTJP 2O3DA 2FGCA 3IXQA 1C0UB 4C3KA 4F8RA 4QYZK 4HYKA 2XY5A 3M8WA 1P6TA 2M70A 4OI3A 5B0AA 2ZFHA 5H9EK 3M8QB 3EGVA 2ZZTA 4DV1J 4CM0A 4F3MA 3BM7A 4E2FB 2I5JB 1TL7B 2YKNB 1HWLA 1FDBA 2SXLA 3IO1A 4F50A 2L3MA 4ZLPA 3H2UB 2IHR1 2J0WA 4K4TA 1S72S 1TAUA 1RT4B 1YWXA 4ZITA 1WC3A 1CG2A 2BANB 1WDDA 4LF9F 4OHZA 2BKPA 4J91A 1IKVA 2ATLA 1S9GB 4USWA 1Q7LB 4PYAA 2FVPA 4RNMA 1IWAA 4NZ0A 2P9CA 1HFEL 1AW0A 2R7SA 1MMDA 4OYWA 1CQNA 3EPGA 4NLSA 3C14A 4ICLA 1OS5A 5LMNJ 3G87A 1U47A 5B0DA 1N5YA 2JVOA 2W9BA 4KC5A 2V2ZA 2VBZA 4JI0F 4DF4A 3H2VE 2YTCA 3QNWB 4WPAA 4CYUA 2WSCC 3SSRA 2EFQA 2HSEB 1RKJA 2OLWA 1RT6B 1FHTA 3HULA 3FRZA 2FD2A 4KE5A 4DSIA 4PXBA 3GIKA 2Z57B 3BN4A 2X3GA 4QR1A 1D9FA 1UP1A 1WSVA 1NXIA 4XDCA 2UV8A 2ZH5A 1FNXH 4OI6A 3IBWA 3H20A 3CEDA 1YTYA 3ICLA 3IP0A 5C5JA 4NWBA 2YX4A 2ZH2A 2FLOA 4QYZJ 4ERDA 1NAQA 2NXCA 3GYGA 1G2EA 4A48A 1T3NA 5H9EJ 3TO8A 4O3NA 3WDOA 1WC6A 3CDAA 3GJSB 3B54A 2JLFA 2GGPA 1F5CA 4NX9A 3ZTQA 4DMZA 1VI7A 3KHLA 1FNMA 3SMZA 4DQPA 1DLOB 4X65F 1MSWD 3IFEA 2B4VA 4ED2A 5DGAA 4LR9A 3R9LA 3BBBA 4B17A 5DJBA 3IG1A 2AJ0A 1EQ0A 2NCKL 2AGPA 3MCOA 2VQEF 5GAGI 4UTGA 4CO0A 2V4JB 4HEA9 5J2NB 4HH0A 2ZH3A 3RTVA 4BWJA 2V9WA 2VUGA 5G4DA 4K4UA 4KYZA 4ID5B 4LSNB 1TL5A 4QWEA 1FESA 1T9UA 2OTLS 3TA1A 2ZHOA 3H98A 3SCIE 3KJVA 1W26A 4ZMMA 1HBOB 1S1TA 2HW3A 5A0YB 1KQSR 1VBXA 1PYOB 3H7HB 2Z0GA 2GMLA 2DPIA 1X9WA 5BR8F 3EGWB 1NJZA 2N7CA 3OR1A 2DK2A 3MM8B 4KTQA 2COLA 5DDOC 4JI3F 1EARA 3DHXA 4KHRA 2L9NA 3L3CA 4AL6A 1URNA 1DTQA 4O23A 2G0JA 2DRBA 1ZPVA 4ZPCA 2FZKB 2OSRA 1V6HA 3AOCA 1S12A 3DLBA 2LEAA 2DXFA 2LVWA 4LF4J 4ED3A 1C0TA 3M4XA 2R7UA 2V94A 4R0EA 5ETMA 3QRQA 1VK8A 1PKUA 4DV5F 4HVZA 3MECA 2A6MA 5DO2A 1WC0A 4R25A 5GAEU 2UUWA 4KR0B 5L46A 1TVRB 1OSDA 4USTA 2CUYA 2W9AA 2W4PA 3A8JA 1S1VA 1S1XB 2OTJS 1WHVA 2DNMA 1S6UA 4ED7A 1DHMA 3EPIA 3LP0B 4M5GA 4L76A 2OEMA 2AJQA 4QW9A 3FNNA 1LFWA 1KR4A 7FD1A 4O3OA 3LGNA 3AY0A 5HVGA 1YJTA 1UZHA 1REVA 2B0GA 4LBHA 3QYYA 2D3UA 4YR3A 1T9TA 5ETTA 3C6TB 2H5EA 4O4RA 1YI2S 3OHAA 3A3OB 3OLBA 4IG0A 3SFGA 1NLKL 5AE2A 4KGMA 4F2RA 1FXRA 2HWHA 2AJ2A 2LEPA 2RQ4A 3K89A 1PSDA 3HF5A 2LXFA 3LAMA 1Y5IB 3VCDA 1U8SA 2XWXA 1RCXB 5KG7A 1FFSB 3TWZA 1IVZA 4IOBA 1PJ5A 2XMUA 1U1LA 3CJKB 3HVRA 4CTAA 1F9HA 1UW9A 3SYZA 3VAGA 3PR5B 2OPRA 5E3PA 3CCES 3US5A 3LOUA 3FKBA 5HROB 1WD6A 1FD8A 3ISND 2C22A 2V8PA 1FTRA 4ILRA 4OZJA 2VBYA 4RW7B 2YXLA 5A8RA 3BO4A 2CQIA 3BR9A 4KRWA 5IC4B 1E6YA 3VAMA 5KFAA 2YQ0A 1RHUB 2HRYA 4MKYA 2WHOA 3EX7B 4C8LA 1ITPA 5HMYA 3Q8VA 1EHWA 1XR7A 5KT3A 3U7JA 1APSA 1MWQA 2EEYA 3QT7A 1VQ7S 1Z1ZA 1UJ4A 4LR7A 4ZVFA 1ICEB 1SI9A 3JSYA 1HNWF 2ZKTA 2QYCA 4Z37A 4DUZJ 2QMWA 4IO9Q 3ONQA 3HM9A 3M8ZA 4M5DA 1R8CA 3QZ7A 3MD1A 4LBPA 3PKMA 2RRNA 2H5IB 3NS7B 3DLLQ 1UFKA 1JLAB 3TNVA 3RB0A 3J7YI 1RTJA 3HHLD 3W3SA 3D54A 4ZIWA 3WX8A 4FYYB 3ZZTA 3QAUA 3DOKB 5T7LA 4ZP9A 2K3KA 4TY8B 1S7IA 4ZLJA 3CJQA 5K5MA 2GNKA 2J0XA 3VHQA 4B08A 3GYXB 2KB2A 2OMOA 4WF9Q 2LDIA 2FTRA 4ETZA 1S0NA 3BGLA 5DG7A 2CPHA 3OXLA 3R7SB 4J9SA 1SKRA 2WBRA 1BY9A 4LFCF 2IYIA 1RZMA 4EO8A 3MEKA 3E01A 1GH8A 1H2UX 3MXHP 4IR9A 3NLCA 2HK3A 4UW2A 1X60A 3DYAA 3TUJC 3CMAS 3V2UC 4UUXA 5M2UA 3MAAA 2MYFA 4AUKA 3AT1B 3AODA 5D4LA 1OQ6A 4I68A 5A2QY 1N36F 4J9QA 4JI4F 4OZ3A 4L73A 4Q5VA 3NXZA 4ZN3A 3DLEA 2FHJD 1AXQA 3PX0A 1XC9A 1FK9A 2BXJA 2BQ3A 1CJKB 2ZH9A 2ZH8A 2CIMA 2DR7A 2AJ1A 1XMQF 3GFHA 4P7VA 2DEIA 5AE3A 1PAUB 4HACB 4B3RF 4O3QA 3LALA 2DKOB 2MKIA 4DPWA 3NY0A 4Y6IA 4JBCA 4FXVA 3ZZOA 1N8RT 1XBWA 4M5HA 3PW2A 4LQ3A 2QFIA 4CLYA 2EK6A 1GMUA 2NXNA 5D78A 3GQCA 4OZ2A 4LRCA 3ISNC 4NLXA 1KRPA 1PG5B 1RT3B 1HNXJ 5D15A 4CRJA 1J5EJ 2HZAA 3CUNA 3TR5A 4QIGA 2A10A 4BC7A 2FZCB 4KO0A 1WI8A 4KHPJ 3BH6B 4NPOA 3MHYA 5JJBA 4LF6J 1SC3B 4ZCKA 4B02A 2NZCA 4AQYF 2MLYA 1IR2A 3HHLB 1S6PB 1RT2B 4PXEA 1S48A 2RF2A 3G6ES 4LFAF 2C2RA 3V4IB 4KJIA 1U09A 3R1LA 5K8OA 4WK1A 2G2YA 5BXIA 1LWFB 4LT6A 3FSIA 2BQUA 2QEXS 1N54B 1ZZFA 3VZHA 4DV7J 3KUEA 3DLJA 4OV6A 1YSJA 2MHNA 3HKWA 1PIEA 4DV4J 1QAYA 2ZVSA 2BJ9A 3V6KA 3IGVA 1Q8LA 1CC8A 1GAOA 3G8SA 2LCWA 2HQ3A 2RDDA 1M90T 2N3LA 2HNDB 3J7A1 2YWWA 4F3QA 2JWNA 3K17A 1SL1A 3V5RA 5D0HA 1GEHA 3N5BA 1VBZA 2MY7A 5G0RA 5GAHU 4FP9A 1RLCL 5FDLA 4Y2CA 2CQPA 3T1AA 1AFIA 4MT1A 2WB4A 1VFJA 3C66A 3M8PA 3UDEA 2IJFA 2YQ3A 1F3FA 4G3IA 4QIEA 3BDPA 4CO3A 3V81A 1L3SA 3G9CA 5CXTA 4F4KA 2C2KB 3HHEA 2DJWA 1P1TA 4H4KA 4CH1A 1K1SA 1PAEX 2QMUB 2DNYA 2CJ9A 2LU2A 2KG0A 2J6UA 2CADA 4E0DA 1WHXA 3L7OA 3T5LA 3PW5A 3P96A 1M0SA 4KPCA 3T9NA 3WIUA 2W8KA 4K8RA 2ZE2A 3IR6B 2CVIA 1RTDB 3FRYA 3GB0A 1W2BR 4IYQA 4NRTA 4BS2A 2KKHA 3L95X 4EBEA 3EDRB 2UUBJ 1QTMA 2DTJA 2OO4A 3I55S 3M8QA 1H2TZ 4DL0C 4K2JA 3MPUB 3Q2SC 1D9AA 3G82B 3MOZA 1TL7A 2I6WA 2YKNA 5F9LA 1FXLA 2B9YA 2OIHA 2C2ZB 1Q8KA 4F26A 5HI7A 3NRBA 2HVIA 2ZOGA 5D3GB 1L3VA 4NA2A 1RT4A 4NLVA 1VQSA 2XY7A 2BANA 3NL0A 3UNYA 4J9VA 1S9GA 5LXYA 3ETMA 1NZAA 4NLOA 4WIQA 1TFYA 2J9DE 3FEYB 1X4DA 3EDQB 1FRKA 1WTFA 3KMQA 1S9EB 4P7TA 3H4DA 2XWYA 4K5SA 1SC6A 4ZVUB 5CYMB 4KFBA 2EPIA 5KFYA 1SB6A 4DPTA 4C9DA 4DSJA 3WBZA 1M5KC 4OHWA 3NGTA 5HSPA 3W9JA 2P8IA 3GIMA 3MMJA 4RW8A 3IRXB 4DL2A 4YDXA 4M5KA 1R27B 4JV5J 4YB6A 2XGQA 4RW6A 5IT4A 1FJ7A 2VG5A 2CZ9A 4B9VA 1X7VA 4MYUA 3MPVA 3KMSA 3QO9B 3BF4A 5THWA 2Q43A 2BQRA 4DR7J 1HWKA 4Y2KA 8AT1B 4ECVA 2XQCA 4PPZA 4AL7A 1KQGB 1YLXA 2UU9J 2CXEA 5GMKa 4LR8A 1FWKA 3AA9A 3EVWA 3EXCX 2H1YA 3AOBA 3I4HX 3D28A 3CCQS 2Y1IA 2NSBA 1FF2A 3KJFB 3WIVA 2WW8A 5CZVA 4DR3F 1DLOA 2XM3A 5DQGA 5T41A 4RX6A 2V2QA 4U95A 2Z58B 2BW2A 1ELOA 4N7TA 1JIHA 1P27B 1RQ0A 3ZZ0A 4WU2A 1K44A 2HRTA 3CWJA 4HH1A 3FCVA 3EMTA 2E5IA 1S0MA 5HLFB 3GV5B 4R8UB 3HHKA 4NRUA 4ES2A 2KYZA 1QSSA 4NLWA 3JTPA 1RTIB 5D6GA 3RAMA 4U7CA 4ID5A 3R7BB 3FEZA 4OZ1A 2HHWA 1HBOA 5A76A 1S1UB 5KFQA 1V5IB 2RS2A 3BGFA 1SL0A 1EZZB 2DY9A 4RNHA 3IBCB 3SV3A 4PRFA 2AWZA 1PJ6A 4CO4A 3I96A 3D4JA 1RCOB 5A8WB 3G8TA 2HFOA 2DD8S 1OWXA 2LU1A 3CXCR 1PC4A 4DEZA 2L9WA 2VFTA 4WFZA 1TL1A 3IA0A 4PG5A 1XNRJ 4I64A 2K8GA 2BKNA 3MPWA 2XO7A 1KFSA 3R2CJ 1YJVA 2G2OA 4B9MA 2H4YB 3GJQB 1RHJB 3HVTA 4OX9F 3UNGC 1NJIT 2NREA 4RBUA 3N6LA 4WP8A 2JNJA 2MZSA 1S4EA 5KT6A 1TVRA 3MUMP 4A8QA 2AYGA 1Q7YT 4U8VA 5LOQA 1OO0B 3D68A 1U1RA 2ZC4A 3LP0A 4DU7A 3B8HA 3AJ1A 4FF1A 1S6QB 3T1HJ 1C1CB 1FNOA 1O8BA 3BGUA 1KTVA 1EETB 4O44B 3HPOA 3PVXA 3QQCD 5L1IA 2APOA 1T02A 2HMIB 4YHHF 3C6TA 3BJYA 1VQ9S 1KSPA 2XMKA 4AT1B 4ZPDA 5EN1A 1FRJA 4QIFA 3OVAA 4JI1J 4ID8A 5KFWA 3CCWA 5DZ7A 2D3ZA 1IR0A 2M7SA 4DX5A 3BKTA 2QN6B 1GX5A 3KNAA 1NMEB 1NU4A 1UFWA 2VQFF 5JXSA 3BSCA 2M88A 1UPPA 3CD0A 3B6BA 3EE3A 4GKJF 1N5TA 1Q81T 5E3QA 1TR0A 2F7VA 2F9JA 3SCKE 1UVMA 3W60A 3GCWP 2C28A 2WRMA 2Z56B 5HROA 4ZPAA 2Y8WA 5KTQA 2RKIB 2A3JA 1Y4ZB 1KLNA 3MI7X 2DRDA 5KT2A 2GC8A 2CDQA 1H0HB 3CD6S 3TJAA 4CO1A 4OI4A 5KG0A 1N34F 4RW7A 4JV1A 1OYDA 1Q8BA 1SQGA 1KVJA 3GJRB 2R9LA 3ET6A 2DNZA 3MGJA 4FYVB 3S1TA 4DL7A 4YOEA 2E1MC 4ALZA 3GG1A 4M5NA 4C0OC 3IR7B 3T3FA 3M8YA 1JLFB 1RBAA 4MIAA 5F8GA 2YPZA 5C24B 1SUQB 5KOWA 3JB9k 2ROEA 2ZH6A 1VQMS 4JV0A 1CS4B 4FVMA 2KVIA 4OLPA 3AH6A 5EX0A 3HSJA 2C1EB 1BLUA 3N79A 2ALZA 1NUEA 1Q0NA 4YY3F 1UWBA 4KGZB 1UJ5A 2C2DA 1VQKS 2VOOA 2BW7A 3A8KA 4OV1A 4Y2IA 2FHOB 2Y3YA 3JXOA 4C8NA 2DGXA 3V4MA 2KHDA 2W7PA 1OSCA 1X5SA 2IMWP 5KFVA 4M63A 4RNFA 4G1QB 5E0OA 1SH2A 4MFBA 4I2PA 2JLGA 3MM7A 1HIYA 3WQPA 1RAAB 3PR4A 2V2KA 4I6WA 4K7QA 3GONA 2RB7A 2DNLA 1B70B 5F8NA 4E98A 1VQLS 1WI6A 3PJ9A 1N5QA 4DV1F 1SC4B 3KJQB 5D4PA 1P9YA 4G1IA 3AB2B 2KTQA 3K0JA 1UWAA 4FKYA 2UXDJ 2F8HA 5HBMB 1LXJA 3S01A 2J9CA 4CH0S 1UL3A 4CO2A 1K73T 3PV8A 2CQBA 3KHRA 2V67A 3MF5A 4O0NA 5ETRA 2XMTA 2FY1A 1BXNA 2QA4S 2HFZA 3PRDA 4HDGA 4J9UE 3BB5A 3OD2A 3UN3A 2NLWA 2RHSB 4EUVA 3G6VA 3D2WA 1SKUB 1QY7A 1CJKA 2MKJA 2R8KA 2OPQA 3GJTB 4HTJA 2KM8B 3GSDA 2RNEA 5LMNF 3DNCA 4HACA 3T5KA 4JI8F 3FBEA 4C6AA 3VAJA 1RABB 5F8LA 1I3OB 4PCQA 1U26A 2DNNA 1RT3A 3SZ2A 1JKHA 1Q53A 1NHKL 3VGSA 3M6VA 5B0BA 1RYSA 4ED4A 3NP5A 2KI2A 1J5OB 3CT9A 1RAIB 2HIQA 3DRPA 2VDIA 4DPXA 3B78A 3HHLA 1LQ9A 1S6PA 4M5MA 4RL1A 5I42B 3VGUA 4FBUA 3V4IA 3QSYB 3MURP 4LRAA 5I4MA 2FZGB 1PC5A 5IWAJ 2PDAA 1VHFA 3G86A 3M2RB 2OPPA 3QSIA 4J9LA 2CQ3A 1EQMA 1X4AA 4P2SA 1ZAVA 2HGNA 4ANEA 2ATCB 4ED6A 4Z2XA 2Y9HA 2VZ9A 2HNDA 3MEGB 1VRUB 5AXKA 2QSWA 4USKA 3OJUA 4KB7A 1IR1A 3ILLA 4ZJOA 2EFGA 1TL3B 1TAQA 3VF0B 1F5AA 1TK0A 3W9IA 3PIPQ 4B9LA 5GAGU 2HS3A 3JQKA 2AGOA 2FHJA 1OQ3A 1V3RA 2V8GA 2LEBA 3CO0P 3PYFA 3LGMA 2UZAA 2YPYA 1ZS6A 5E2QA 2A2DA 4ELVA 1K47A 1N4LA 2FDNA 4ES1A 2CQ1A 4QPTA 3CGIA 1N5SA 3M9OB 1NHUA 2CJQA 3DHWC 4OJ1A 3VAFA 3QRPA 1QDUB 1HW9A 4J5OA 2GAHC 4C11B 1XQIA 4URQU 4X62J 1KNZA 4LF4F 2B8PA 1FEEA 2BBEA 2ZJRQ 4QIVA 1RTDA 3E8OA 2XYPB 3TX0A 3U27A 3LP1B 4EYHB 5IFMA 2GFFA 1U02A 3CD7A 4OYIA 1RAJA 4ZPVR 2D7SA 2JLEA 2DBBA 1LWEB 3PIOQ 5CYJA 1CLFA 3G82A 1TK8A 1K9MT 4WCEQ 2HBZB 4DQSA 1N32J 1M1HA 4OI2A 3DLKB 3D5MA 1KOOA 3D7SB 3PJXA 5D3GA 5K9FA 2B51A 1NDLA 4HL9A 5KG2A 2CJYB 4QPXA 1U6BA 1JXLA 1HKAA 3W2WB 1UFLA 4LRFA 3H0PA 1T94A 2QGFB 4IFVA 3T6JA 1QJHA 4A8YA 2JEIA 3DMJA 3JYTB 1CULB 1G3OA 1B3TA 2HNZA 3GTYX 4LRDA 1CVJA 1QUPA 1VYAA 1J27A 5KT7A 2XCPA 3DI6A 2DGOA 1W7WA 3W66A 2B3TB 2V68A 5C2GA 1BWEA 2JDJA 3K7RA 1HNIB 3MMAB 4GRSA 3W64A 4KHMA 2VF3A 3D67A 3JSBA 1GMVA 2E44A 2DNQA 2P6TA 1RE1B 3PYEA 4OFZA 2QLXA 2EFVA 3JSRA 3D1QA 4U9RA 3SFUA 3K58A 2YKQA 5C25B 3Q8SB 2HVEA 3UDCA 3OL9A 2HNYB 4ZVOB 4HI2A 1NEEA 4DN0A 1IJFB 1FX4A 1Q95G 4UUWA 1U1QA 2C2MB 3QGIA 5I3UB 2GVDB 4YN3B 4YS2A 2VPWB 4LUBA 4FKXA 1VIOA 2XMVA 2BV3A 4DI6A 4ECXA 3RB3A 4NCBA 2R2SA 1IBKJ 1U1KA 1XR5A 1Q86T 2VFSA 4DUZF 2RQMA 1KFDA 3PX6A 1WHYA 3UN5A 3QT5A 1RHQB 3OV7A 2ROGA 1RYRA 2MGZB 5SZTA 3CCZA 2V2VA 4NLYA 3K57A 2HIYA 2FB0A 3DRSB 4R8UA 2N82B 5HP1B 2WBMA 1L3UA 4RO0A 5HANA 1RTIA 1X31C 3IM9A 1V5VA 2R8IA 4TQSA 2Y0BB 1MROB 2ZDOA 5D0RA 1S1UA 3CB4A 4Y3CA 1HI0P 2IM0A 2KN4A 3BO2A 2VHGA 1U4BA 5B08A 5C42B 2DGWA 3JAMU 5ITHA 2LQ8A 2HLTA 4K4XA 4PQAA 3LUYA 3SIPB 5A8WA 3DM2A 4DUTA 1H7WA 1WEZA 5CCMA 4ED0A 4UZCA 1JJ4A 3I6PA 3UVJB 4QU7A 4RLEA 3THTA 2MLXA 2RJZA 4DX7A 2IRUA 1B7YB 1DQAA 2OFGX 3TX8A 3I56S 2XEXA 1YRXA 2M2BA 3GU0A 3KTQA 1K0VA 1FVSA 5BYQA 4O4GB 2X7IA 1R0BG 5IV4A 5I3QA 1RWWB 5LJ5Y 5B7WA 4URGA 2H5JB 3Q8RB 1NHVA 1OY8A 1CJTA 3GLJA 2E7XA 5J2PB 4MAKA 5HMXA 3NCPA 4XTTA 4C97A 4DUYJ 1XR6A 5E5NA 2B5JB 1X4GA 2YKAA 2V8DA 5KFMA 1S6QA 2XZTB 3NAHA 3RUBL 4Y00A 3N0VA 4Y2AA 1M5SA 2HMIA 1HNXF 1J5EF 2OPSB 3BO3A 2XB2D 1A9NB 1FRXA 3W5ZA 4PAAA 4KHPF 5F41A 4GO5X 3PTWA 2GAGC 2KL8A 1Y3JA 2EK1A 2VBWA 4LF6F 2DNRA 2MMYA 3R2DJ 2LA4A 1TFWA 4URSA 3R5JB 1DJ0A 4WXOA 3BQ0A 4N8OA 4FNHA 4TLRA 3HJFA 3FDSA 4I6YA 1NH8A 1NKCA 4B9TA 4MKBA 3VAKA 4FYWB 2YWFA 4O3SA 1I6JA 3QIDA 1RT5B 5B09A 1RHKB 2PIIA 4M8LA 3R97A 2LP4A 3M6UA 2E29A 1OPIA 4DG1A 4DL5A 4DL3A 2CJAA 1YBTA 4DSFA 1QTNB 2DGUA 3L9ZA 4DV7F 1RISA 5K14B 3KLGB 1NSAA 2RKIA 3JSMA 2K7KA 1CQMA 2D74B 4DV4F 3MCSA 2OEJA 1IBMJ 1NRKA 2LECA 2CQGA 3G8QA 3KWMA 1Y0HA 2M0GB 3HFZB 2QX0A 3R8YA 3LTOA 5DM7Q 3KLIB 1FERA 1HBMB 2IY5B 1SXLA 1T7PA 4DX6A 1NDPA 2EWHA 2LQ9A 2RUGA 4LVNP 4ATNA 1QM9A 3FBFA 4M94A 3U1NA 1T95A 1BWVA 1ZAXA 2KT5A 1JLFA 2UUTA 1LNQA 1VC5A 1FKOB 5AXMA 2Y1RI 3ZTRA 2ABYA 1MN7A 1CJUB 3M1VB 2MPUA 4OZNA 1HARA 3K5LA 3T1YJ 3CCJS 5E3CA 5CQGA 2QFJA 3CDUA 1ZM2A 4LVOP 2ZJQQ 3TA2A 3OSNA 2I0XA 2GQCA 2OGUA 2Y0SD 1KHVA 4WIIA 2YY3A 1QSYA 3UCZP 1VMBA 2AJ4A 3CMQA 2QG9B 4DR1J 1RI7A 3KK2B 1GFWB 1JB0C 3VZIA 2MKSA 1REGX 4PUOA 1ZA1B 4I6AA 4F0HA 1VOMA 4P2XA 2XHCA 4PZVA 3KLEB 2JEJA 2X3DA 2ACMA 3R1HA 1ZPWX 3LP2B 3UCUP 1UA1A 2UUBF 2RD5C 3RBDA 4DSLA 2JVRA 5JVHQ 5GADI 5KFGA 3JS9A 3W61A 3I5AA 1DTTA 3DRXA 2GJIA 1VC0A 3MUTP 1WC5A 4WKRA 4CT8A 5B0EA 4KV8B 4B9NA 5HQ8A 1D1UA 3M9MB 2QL9B 3NWGA 2E1CA 2CZVC 3LAKA 2G4BA 1R0AB 4ZDNA 2CQDA 1TU0B 1R8PA 4WP3A 2Z8QA 3Q8YA 1JNZB 1SQFA 2DR9A 4QR2A 1XIQA 4L72B 3TRGA 5J2MB 2MLZA 4X64J 2B9XA 2NPFA 3MAQA 2RDJA 1KLMB 2WVEA 2Q79A 1RBLA 4TU7A 3CC7S 3PM9A 5FLXY 4OJGA 4PWDB 2BE2B 4ZIVA 2DB1A 4J37A 3EUNA 1VQ5S 1NK5A 2V50A 1MWZA 1M5OC 2ZDPA 1RT7B 4F4WA 3B4MA 1JXEA 5IT9Y 1RU2A 2WOMA 4JV5F 4W92B 4YMEA 4TYBA 1JLQB 2AQ4A 5H1SV 2E5GA 5HK4A 3ILOA 3DDIA 3DU6A 1J5OA 1HLWA 1QAJA 1UVJA 4QZVB 4DR7F 2KXFA 4FXDA 3X1LB 1MMNA 4OHVA 1X4FA 3KK1A 3KYLA 3HFVA 2WONB 4LJMA 5E33A 4F7VA 2HVZA 1IUJA 3R3TA 4WFXA 1ZA2B 3HMJG 1CSJA 4RW9B 4ANCA 3IAM9 2IVFB 1RU1A 2EVZA 1KVKA 3DRYA 4X4OA 3M2RA 1Y5LB 4IRCA 3KJNB 1BE4A 5JMNA 2G2ZA 2KDOA 5B0CA 5K8PA 4W98A 4OJHA 3UO0A 2G1DA 3DRRA 2KZZA 1A0OB 4HHUA 2V8VA 4NI2A 5D4NA 2XMWA 3KG1A 1U6FA 4OHXA 4CDIA 3M30B 3MEGA 1VRUA 5KFRA 2QRRA 2B6AB 4OHYA 2JEGA 2GHPA 4FS1A 2HFSA 1TL3A 3IMQJ 3M05A 2KYXA 3OFEA 2ASYA 2AP6A 5LMUJ 2JHEA 4DQRA 2IIHA 4OI1A 3QATA 2QLWA 4LSLA 1OPZA 3CJ0A 2W2NP 3C2PA 4NEZA 3PEJA 3C19A 4B3SJ 2AEJA 2MJNA 1AT1B 5KFJA 3J81Y 3QRRA 3QPIA 1K1QA 2WSFC 3EWGA 3LWMA 2CNLB 4USIA 4A8KA 3C46A 1XNRF 1M5PC 4OYPA 5MLCV 1QSLA 2VG7B 3DN9A 2GO8A 2DCLA 4OZLA 2RQCA 3P4UB 2KHCA 4Y0FA 3DFEA 4RZRA 3OUYB 4JUZA 3CC2S 3QLHA 4MIWA 5CD4A 2KXHA 5B0GA 2IVMA 2VBXA 4JI2J 2ILYA 4P73A 3LP1A 1IKYB 3P6YC 2W1BA 5DDRC 1V9OA 1VGYA 2XS7A 2HHHF 3BKFA 4J9PA 1OJ4A 3BKUA 4X4QA 1LW0A 5ETVA 3DKDA 2HS4A 1SJFA 1IQZA 3DLKA 4Q0BB 2Q3PA 5EGYA 3TQ1A 1TZ0A 2B4UA 5DGBA 4I56A 5LT5A 3T1HF 4UY85 2DCUB 2ZITA 2HZCA 1DFDA 4A46A 1VBKA 2E1PA 3KLHB 2CG4A 2RILA 3TANA 4M5LA 2G0CA 3MR7A 2EW9A 4H4KC 1KN6A 2CPEA 4WXWA 1UEVA 1ZTTA 3W2WA 3ZNJ1 2YNGA 4JI1F 5ETQA 3HI9A 2F9DA 4DCOB 4XK8C 3KLVA 5K8MA 3TAQA 4N47A 3CJSA 3C16B 4FDFA 3HHDA 4XO0A 1HI8A 3BGOP 4NLDA 1Y7PA 4ZCLA 4CLZA 1NKEA 2C2OB 4ZPBA 2CPYA 4F4ZA 3I82A 3O1LA 2DXDA 3VQTA 2Z30B 1HNIA 2JH3A 3MMAA 2IDEA 4J9MA 3OHBA 2V0NA 1NDKA 4NCGB 4LF5J 2U2FA 4F67A 4AE5A 2J6SA 1FRMA 1VJWA 2C3UA 4RNOA 3C8YA 3C15A 2XS2A 5HVFA 1HHSA 4EBCA 1S57A 4DN9A 4RU2A 1FCAA 1UEKA 2HVDA 2OI2A 2HNYA 1FKAF 4JI8J 2FHMA 3RB6A 3FFIB 2BE9B 2AEFA 2CPIA 4KGVB 1FRIA 1RWVB 3UFCX 2JC1A 5BYRA 1WOPA 4FZVA 3CCVS 1PBAA 1NO8A 4HR2A 3EJMA 1RLDA 5I3UA 2F8MA 3N6NA 4USMA 2NSCA 1TKTB 3VWSA 4FN5A 4X2BA 3POTB 3RZAA 2B7BB 3HKZD 4WFBQ 3I5BA 2O66A 4PQUB 2P5VA 4KSEB 1HQUB 3MR6A 1LW2B 4F4XA 3PJWA 3N9UC 1RUSA 4KH0B 1N0UA 3AD8C 4Z7CA 2MGZA 2E5LJ 2F8EX 4QW8A 2ZBQA 3DRSA 3UDVA 2QL5B 5HP1A 4NYOA 2J9DA 1IKWA 3C6UB 3PG9A 1TUVA 1S10A 2B7CB 3HT0A 4PG8A 2V8HA 3DXSX 5C7PA 3U1LA 3DDKA 3IC1A 1YJNS 2JOQA 1NSPA 3DGVA 4U7UK 3N4WA 4NE9C 4HI1A 4K2XA 2CFXA 3M9NB 5C42A 1HNZJ 2IM3A 5LJ3Y 3G4SS 3MMCA 2G1HA 2EI5A 2JRSA 1F6TA 3MM5B 3RBZA 4P72A 4Y2MA 4R0JA 5KFBA 2UXDF 4AXJA 3D3CJ 2VODA 2YQ1A 1P8GA 1DQ9A 4DV2F 2DR8A 3U02A 3OR2B 2AU0A 3W2VB 4H4MA 1RTZA 2EC2A 4DZDA 5J1PA 3H5YA 3PRVA 2CA9A 3BQ2A 2DIUA 3BSAA 1NSKL 2HQCA 8ATCB 2IJRA 3HVWA 2BE7D 2DH8A 3SCLE 2HBYB 2J8SA 1RGVA 5HO4A 1J2VA 3CNQP 1KOHA 2G9OA 2AYEA 3GILA 3R6GB 3RW7A 4F0KA 3BYPA 3I0RA 1N5YB 1C1BA 1G6BA 2B9WA 2P9EA 1KWMA 1NM2A 2B5JA 4I7FB 1T0TV 4WE1A 2OJ3A 1NPPA 2YKPA 1VCTA 2NR0A 3O6QA 5KG5A 2A18A 5KFZA 2YVSA 2VD3A 1VRTA 3B4DA 3EZ5A 3HD1A 2MKKA 1SIZA 3DC2A 4BC9A 3MR3A 2DVIA 1TKZB 2HURA 2OFHX 4HT7A 2AJFE 1IM6A 2KFZA 4MTPA 1KC8T 4EWTA 3PW4A 1LOUA 2LMIA 1SJRA 4NLGA 2MZTA 3RRGA 3QT8A 4YB5A 4WWSA 2IMOA 1Y9OA 1RT5A 3UN2A 2D69A 5CA5A 2M5YA 4DFKA 5IWAF 2DHAA 2A0FB 2C3OA 4WP9A 3I9V9 2PA3A 3QMQA 2W8LA 3SV4A 3SSQA 5K14A 3KLGA 4TVAB 2QA4G 2DGTA 3DXBA 3IG1B 2XZWA 1S7HA 1AFJA 2Z2LA 3H42A 4NA3A 4FF2A 3C3LA 5DS7A 3VR1A 1S49A 3EYZA 1Y3KA 3A4TA 3UI3A 1HPZB 1ZBTA 1XEZA 1HBMA 4C8MA 1WWHA 6AT1B 3KJVB 1S1TB 1OY6A 5F8IA 3HDSA 2M8DB 2XYHB 2EFPA 4EGLA 3RAXA 4X4VA 2JC0A 1FKOA 4IOAQ 5BJRA 4Y65A 3CTRA 1Q82T 1T9XA 3HSZA 2AF6A 2FLLA 2HFUA 3M1VA 3J7Z5 2VJVA 2ZNYA 3ZZZA 3H90A 2QC3A 2DR6A 1X0PA 3NMAA 1F60B 3F56A 4OYMA 3ZZPA 2FJBB 2AHOB 3K59A 3WZ0A 4WFAQ 1R31A 2GQQA 1H7XA 2XCAA 1YRUA 2QLBB 4U7UD 3TZWA 3BREA 1FRLA 3QFWA 3W7BA 4J7CA 3W65A 3ULHA 5U47A 3L09A 4X62F 3WX4A 2C3MA 2QSFA 3MECB 1RBOB 2VPZB 5K20B 1WUUA 3FMBA 2AD9A 2VOPA 2LFVA 5IV3A 4DR4J 3EVOA 2ZOMA 2VPXB 1S1VB 2DO4A 1S4FA 2V34A 2DNPA 2BJ3A 1AUSL 2XI3A 1X0FA 1KS2A 4PWWA 4P75A 3FBCA 3MZIA 1LKZA 4USVA 5I3PA 2HHQA 3LO3A 2B4PA 2OEKA 1N32F 1RWXB 3QT6A 2PEBA 1U0SA 1Y5NB 3D1HA 2IPOB 2XULA 3HT3A 1REVB 2I38A 1WF1A 2AW0A 2V9KA 4NXNJ 2AX1A 4ZCIA 4DSEA 4BDPA 1WACA 1HL6A 1R0AA 4IH5A 4IUFA 2MY8A 3K2YA 4JI6J 3MFHA 3O3LA 5HN0A 3QWUA 1FJCA 2W9CB 2BKOA 5J2MA 1U2RA 2R7QA 5KFDA 2AV5A 1KLMA 4CTAB 3TA0A 4PWDA 3IRWP 4TYAA 1RP5A 3OTDA 3TZXA 2UUAJ 3Q86A 2MZ1A 3TVZA 1U7LA 4OYOA 1RT7A 1YDLA 3L7UA 3PACA 3IS9A 4JI7J 2R4FA 1ZETA 2GIQA 2UXCJ 4ZLLA 3J80Y 5DDPC 2FJXA 5A8RB 2LQBA 2OP5A 1JLQA 1Y11A 1RA6A 3HX9A 1E6YB 2ZBCA 2X1GA 4K0KJ 2YNHB 2I8EA 2HZVA 3M2VA 2XHWA 4ZVPB 1EKSA 2HK2A 3TI0A 4PR6A 2BACA 2IRXA 1IKXA 1KBRA 2HHUA 4DZ6A 3J7ZT 4E8UA 1JLCB 4RW9A 4N5SA 1OMSA 2W24A 3FZBA 3KK3B 1GTHA 4DV3J 3G6XA 3FK4A 3CSKA 4DR5J 2DNHA 1GXLA 2E5HA 2QLJB 1IBKF 1JLBB 4M5DB 1L3TA 4IR1A 1U8WA 1FTCA 3D6HB 3M6WA 1C4AA 4GVBB 2IYGA 1G7CB 2AYBA 3CJTA 4JYAJ 4XPEA 4H54A 4NOHA 3NG8A 1IBLJ 4F36A 3ZTOA 4CM2A 1C4CA 5J2QB 4DLEA 3CCLS 2GMJA 1KHWA 5T7LB 2HQFA 1JJ2R 2GVZA 1WOSA 2ZVIA 4DV6J 4CIOA 3MOJB 1Y10A 3WC2A 2I9SA 5F0WA 2ZD1B 3IN5A 2EKYA 1N33J 4IH6A 4LSZB 2OD4A 2IAJA 1H3DA 3D3BJ 5KFPA 4PXCA 1HBUB 5IM0A 4WFNQ 1XNQJ 2JL9A 1WKLA 5DETA 2HQDA 2E66A 2F4FA 1F9FA 3H25A 1HA1A 5FD1A 3IR5B 4GC7A 2WVBA 2RRAA 3HHLC 3E01B 3AHPA 1YGYA 2CAJA 2EG2A 1PCAA 2IA6A 2H4WB 3DYAB 1QAIA 4K4VA 3MM9B 1RT1A 3RB4A 4ECYA 2W01A 2Z4PA 4KPYA 1YK9A 1T05A 1LV5A 1QE1A 2BJEA 3OUYA 3EM1A 4JV2A 4H4OB 4ECZA 1Q5YA 4OYZA 3ZXWA 5EHHA 3OTCA 3SXLA 1EAYC 4XDDA 1HWUA 1X5PA 5ADZA 3Q83A 4A47A 2C2NA 1IWGA 3MCNA 4R5PA 5ETNA 4IOCQ 4DUYF 2KJWA 2VONA 1MU2A 4JP8A 3ITHB 4DQIA 2HRUA 3AD9C 3BGRB 1FJGJ 1VDHA 2KRRA 3M32A 4DSKA 4PKDB 2D3OR 4B9UA 4DX8H 2DY1A 2HQIA 1C0UA 2LDYA 1H73A 4LFBJ 3IAS9 3KLHA 3HCXA 3OW2R 1ZM4A 4L75A 1VQNS 4TU9A 4EI2A 1S99A 3UD4P 2POKA 3QIPB 1WC1A 2HBQB 2EBEA 8RUCA 2NXUA 1E6VB 1U25A 1EX8A 1X4EA 1JNRB 2I5JA 4LIWA 5KFXA 2RF2B 2XSFA 1S1WB 3FCHA 3DGPB 4ED5A 1LWXA 2EG1A 4CLTA 1C2PA 5RUBA 2GW8A 3RJMB 4CT9A 2NQPA 2GCFA 2W7AA 1VR6A 3V6HA 3OL7A 3CD5A 1BQNB 1M5HA 2YWKA 3ISZA 2CYYA 1RAEB 2HBRB 4NCGA 4CQ1A 4OQJA 3G6YA 1Z4UA 2GS8A 4YEAA 5DDQC 3CJRA 1WF0A 3NNAA 5GMEA 1EB0A 2CPFA 2GIRA 1P1LA 3M7VA 5D4OA 1IBMF 4YDDB 1QUVA 3OT9A 1WF2A 3FFIA 5FDLB 3D66A 2R8GA 3CCTA 2FVRA 4EZ6A 3FZ2A 4MK7A 4AD6A 3KUGA 4OYXA 4C0HA 2QT7A 3I0SB 3NKYA 2QA2A 1UVKA 2O5DA 1ZM3A 5AJ3J 4IRDA 3PO4A 4TNOA 1SKWA 1TKTA 3AQPA 2ADCA 3POTA 1RT6A 4KKOB 1KEKA 3NAIA 4LF8F 1DBDA 4OX7A 3DLGB 2CJBA 3T1YF 3NNCA 2VB6A 3CVKA 4PQUA 3UR3C 1SJQA 3PZPA 5L39A 1HQUA 4FXWA 4WYLA 5HQMA 1I5OB 2HWTA 2WVCA 1A7GE 4A8OA 4ZA1A 1Z2LA 1K8AT 3OTOJ 2ZE2B 2DNOA 2H54B 2R7WA 4DR1F 2VC1A 4JI5J 5CD4H 2W4DA 1QVGR 2E7WA 4WZMA 1D9DA 2X1BA 4ECQA 3D0GE 2DRAA 1DZ5A 3GFXA 1FDNA 4ZJLA 2VKRA 1O0PA 4F25A 4DL4A 3EGZA 2BM0A 5HVHA 1R6VA 2CQHA 4EFAC 2DISA 3MM5A 3Q8UA 1D8YA 2Z2YB 1JK9B 3TJ9A 2V4JA 5J2NA 4Q43A 3NCRA 2E9RX 1OY9A 3FBBA 1PJ7A 4ZKAA 2XLIA 1FWPA 2PO4A 2AEMA 2DYAA 4WU3A 3K8VA 4LSNA 3OR2A 4TXSA 3W2VA 2IM2A 5GADU 3AXKA 2JEFA 3GIRA 3VAHA 2C3PA 2NS1B 5A0YA 5DM6Q 2CPZA 3MM8A 4X66J 4YB1P 4UOGA 2U1AA 2PEHA 2MZQA 3GV7B 1L3KA 2FIUA 2J9EA 4X64F 3QJLA 4KFBB 2GX8A 4AYBD 3HD2A 2DEJA 4LRBA 4YUDA 1ZYQA 2N4DA 4O3PA 4I7FA 2ZBPA 4RW8B 4B3TJ 4F3OA 4USJC 2RH3A 4O3RA 3J7AN 2FGOA 4RW6B 2J7WA 2VG5B 3A8EA 2XNRA 4K50A 2V63A 4F0MA 2WTFA 4DF8A 2VICA 1FD2A 3K5OA 3F73A 2HHHJ 4YR0A 2MTLA 4WFYA 3K8WA 1S1XA 5GMDA 1TKZA 2MQNA 3CJ4A 2JFKA 4CLPA 2VH7A 1TV6B 4ZS6A 1IXKA 3A3PB 4RUBA 2Y8YA 3LQVA 1F9EB 5AE1A 4IKAA 4NL5A 2ACYA 5E3RA 1YHQS 2ERRA 2CZ4A 2MQLA 2BMBA 2EKNA 1LFPA 1RAFB 4A8SA 1B4SA 2M4MA 3TZZA 3D6MB 4GO7X 5IS2A 4RPFA 5KG3A 4P9SA 4IFYB 2PI4A 1FA0A 1EP4B 1HNVB 2ZH7A 1GQEA 2IC3B 4G65A 3R5GA 4FPIA 3R6LB 4EEYA 1HPZA 2ZM6J 3CJKA 2AZ1A 1XJWB 4ECUA 2OELA 1KD1T 3OTEA 3Q24A 4ITSA 2WCXA 2CPJA 1NZ8A 4YR2A 3FSXA 4IG3B 2BZ2A 4F02A 3D6TB 1NJYA 5LMUF 5HMWA 4UQTA 3SCJE 4ZVEA 3MD3A 4IQMA 4TN2A 3T19A 4C8OA 3LH2S 2LQ5A 1YZ6A 4B3SF 3BQ1A 4EZ9A 1AYEA 4U67Q 1TL1B 3SBMA 1AA1B 3TUZC 3IWLA 3Q0AA 4ZP6A 3GIIA 3CE8A 3HVTB 3PCOB 2JSXA 4C8ZA 2XBPA 4ECTA 1V3ZA 1UTAA 5L8RC 1YJ7A 4X4NA 2E5JA 4QCLA 5MAOA 3KLFB 3I87A 1NK7A 4HKQA 5KFTA 1I1GA 2R7TA 3K5NA 1SH3A 4CLWA 2ZJPQ 2BA9A 3CC4S 4JI2F 3ILJA 1KQFB 1BD6A 3AAWB 3UW1A 2DH9A 3X3UA 1JLEB 3EGNA 3FVYA 2UVUA 2GO9A 1FDAA 4P6QA 3AOAA 1IBCB 2WAQD 1RA7A 1JLAA 5CCLA 5LL6d 2JJ4D 3MPDA 4DV0J 3PW7A 3FQLA 3RRKA 5KFIA 2BJ7A 1X5TA 4CLUA 1YKWA 3DOKA 2P6SA 1U1PA 4TY8A 3FMWA 3FEXB 1Q79A 1N88A 4CNZA 2P9GA 2KT2A 4X84A 2W2MP 2CKWA 3CCMS 2VA3A 1BGXT 3TW0A 4QYRA 3RYLA 3MEDB 4DFMA 2B4OA 2ZZMA 2W9CA 2W2QP 2NZ4A 1VLOA 1UJ6A 1DY3A 1R0CB 1TKXB 1U6ZA 1S79A 1U48A 2Z2MA 2E9ZA 4PEOA 4DV2J 1U45A 5L1LA 2V6AA 2N4CA 1NK0A 3CCSS 2E9TA 2ZUAA 2V4RA 2Q1LA 4P10A 1F5BA 4RUCA 2BRKA 4EK2A 2JZ5A 2HHSA 3THPA 1M5VC 1CC7A 2FVQA 3TVKA 1UZDA 4LF5F 4OJ3A 3UPFA 2FC8A 5K8NA 2EBGA 2HWIA 2IA0A 4F4AA 2XYGB 2NXEA 1NJXA 2UVVA 4JOUA 3AXMA 3OFFA 2ROPA 2XO6A 3ET6B 4PG4A 3H40A 4CWBA 1RXOB 4KT0C 4HT5A 1VRQC 3OXFA 4OX8A 4B3OB 2YNHA 2L41A 2HHVA 2CPDA 1Z2ZA 4ZLNA 1HMVB 1LEOA 4XPCA 2R8HA 5M2RA 2GHWA 1H98A 4PPDA 4MKVA 3BZQA 1JLGB 2UXBJ 1JLCA 3ENAA 3KK3A 3VAIA 3MFIA 4LREA 1N56A 1ZAWA 3UCGA 2K06A 3PY8A 4NMXA 1S97A 2ZNZA 2XMJA 1JLBA 2HQGA 2HEKA 1UWBB 3KG4A 1RAOA 3W62A 4ETXA 3GFYA 1XK8A 2KM8C 4GVBA 4NYZA 2X51A 3NEKA 2E1AA 4B3MJ 3L4BC 4ECSA 2E5LF 1BMQB 1RT2A 3G71S 5J2QA 3UR0A 1HQ2A 2MQOA 5HATA 3BBCA 3F0NA 2KG1A 4MFBB 4I2PB 1LWFA 3MM7B 2ZBRA 3P8BB 2LLZA 3SSSA 4QBUA 2ZD1A 2HHXA 4RBVA 2AYMA 5KFUA 2CJXB 2HHPA 3PFOA 4GKKJ 3LANA 1FJEB 1HBUA 1NH7A 3R27A 1U2FA 5D0EA 2UVRA 1U0HB 1HNZF 2RT3A 2R7VA 3DCAA 4ELTA 2HFVA 5DRKA 4LF2A 4RWXA 1AZSB 2VL1A 5SUHA 1YVFA 1JJHA 5DG8A 4XIUA 2F5GA 3A12A 3TUPA 4ZJQA 1R8AA 3MM9A 2ILZA 1YRTA 4PABA 3WC0A 4QR0A 1A6LA 3ILIA 4H4OA 5FIIA 3BS9A 2OKQA 2W7OA 2XC9A 4NLUA 2ASJA 5E7OB 3O44A 2XSJB 1NSQA 1LK5A 2OPQB 3ZZYA 3MR2A 5CYQB 4OX6A 1PGZA 3BV8A 1XMOJ 4A8XA 1B0PA 3BSNA 4NXMJ 3HO1A 2FYXA 1YJWS 3ITHA 1H74A 2D9PA 1YG0A 3BGRA 2NYIA 1RJJA 2CNKB 2BX6A 1X4CA 3JQMA 4MK8A 1WDTA 1ZZNA 4OLOA 4WK3A 1JKHB 1KP6A 2MSTA 1NB7A 1LK7A 1QVFR 2QYGA 1OIAA 3R7NB 3JTNA 4A8WA 3TEGA 4YQWA 4WTYA 3QIPA 2M3DA 3CF5Q 3EZUA 3QFHA 3DRPB 1E6VA 4UZBA 2MXYA 2K1RB 3CIZA 2MZJA 5L1JA 5KFEA 1FFGB 1FFWB 5D0GA 3OBIA 2AMCB 3PKYA 3QAEA 3CIMA 1R6YA 1O6XA 1S1WA 3DGPA 3MPYA 1SC1B 2F4VJ 1MWYA 3F44A 1NB2A 2OPPB 3KOAA 5J1EB 6FDRA 1UVNA 5E3AA 4ED8A 1BQNA 3MDFA 4ZPWR 2DHHA 1YJRA 1R8BA 2KH9A 1X8DA 5IXUA 3H59A 3PW0A 4ECRA 2G13A 4N77A 5KG4A 1S9EA 3I4PA 1NNDA 3MMBB 2FLNA 1XERA 3UD3P 4FYXB 4ES3A 2VV5A 4ZHRB 1D0EA 1YITS 1RB0A 5CYMA 2OAUA 3S8SA 5D77A 2YX1A 1FE4A 2IVYA 3I0SA 4QIWD 5IC6B 3N28A 3IRXA 4HLBA 1P9QC 4RKUC 4IH7A 2PSZA 4UOCA 1SH0A 4KKOA 1K0TA 5EX3A 3VGVA 3DLGA 1N6QB 5KFFA 4UOHA 3QO9A 4NCAA 2K2PA 1PILA 3LWLA 3T5JA 1N0VC 3KFWX 1SQEA 1VQ4S 2FJAB 3MEEB 2ZKUA 5ETLA 3T9ZA 5D8HB 2QTWA 2RMLA 4RNNA 1HR0J 3OL6A 3BR8A 1HBNB 2J5AA 1NPKA 4DS4A 1UCNA 3P5TL 4KY3A 4K4WA 1EKRA 2R2RA 1R43A 4ZCMA 3DOLB 1N48A 2H9ZA 3ZNUA 2DHXA 4DR4F 2YNFB 4ZN1A 4OIXA 1SV5B 4X4TA 4X4UA 2RRBA 2NYHA 2J6TA 1Q16B 2H65B 5HLFA 2J7KA 1Q5VA 4MKAA 4LF7J 2JFDA 2VASA 3H5SA 5CABA 2DR5A 3PEHA 5L9NA 1RADB 4W90B 4C8KA 5H9FK 2BJ8A 3BBFA 3KDOA 4Q2LA 5KOXA 3Q89A 3OXGA 4YP3A 2GA7A 4NXNF 3NS6A 1RTHB 4DPOA 3CO9A 3UD5A 1QD1A 4P71A 3J7YU 2B8QA 2DT9A 3PYDA 2HS0A 2RDIA 4IFVB 2XGPA 2E7VA 3DMJB 4JI6F 2HNZB 1Q1KA 5FJ4A 5EDWA 3DI6B 1BUXA 1WKJA 4DLGA 4DFJA 5BYSA 1GK8A 3JTOA 3WHIA 2WW4A 1PBUA 3I32A 2GZOA 2UUAF 1D3WA 1FDDA 5DZ6A 4ILMA 2WVFA 4J9NA 4ANDA 2QJ3A 9RUBA 4XAKA 3R5CA 3W8PA 3ZC4A 9ATCB 2WZ1A 5EWEA 4JI7F 1Q4RA 1GNKA 1HWJA 1WSRA 2F1FA 3TP2A 2UXCF 2RE1A 6FD1A 2YKMB 4RU9A 5DLFA 2YWGA 3CDBA 4ILLA 1T9VA 3EZOA 2MDAA 1U2CA 1WEYA 2NUUG 2WVDA 2UUCJ 3H8YA 4K0KF 1TV6A 2Q6CA 4NYPA 3RR7A 4GC6A 2J76E 3BSOA 3OVBA 5J1NA 4ENOA 1C1CA 1YZ7A 1ZM9A 1FEHA 5CAAA 1EETA 4O44A 2WSEC 1SPBP 2ZWPA 1ZH5A 3RRHA 4LMZA 3ZTSA 4LF1A 4DV3F 4DR5F 3NOGA 5IZHA 1FKPB 1NK9A 2IJNA 5H9FJ 2RS8A 1T03B 4DQQA 2NUHA 4DR2J 3CDEA 2FJEB 3PRBA 4QWDA 3L7PA 4IFYA 1NPRA 1QLNA 1EP4A 1HNVA 4AL5A 4JYAF 3NGKA 4IRKA 2L48A 1IBLF 2IC3A 2M9KA 2BJ1A 2HAFA 2MEWA 3FJ2A 4P74A 3CJ2A 3SI8A 1RWOB 4CP5A 1SKSA 1R3NA 4DV6F 4IG3A 4L3KA 2EXUA 1AB8A 2IM1A 1UW4A 1N33F 2CPXA 3I31A 3KHGA 1TKDA 3TUIC 1XNQF 1BQXA 2PE8A 3OSPA 1B64A 3O5TB 3M2UB 3DM2B 3GMGA 4DR6J 5HQLA 1NJWA 4OI0A 4HTIA 2LQJA 1NKBA 2WB1D 1CJVB 1JMTA 2XY6A 2DITA 1I94F 1WTBA 3TEHB 2ZHAA 1U24A 3CJ3A 2HPUA 1NK6A 5F8MA 3MR5A 1U1MA 4C0BA 4CO5A 4LBIA 3E51A 4C7QA 1F0XA 1AROP 3SDEB 4Q2MA 3HXMA 2DGVA 5C24A 1SUQA 3OPKA 2VG6B 1KVIA 3KLFA 1WNEA 2L9DA 1CS4A 4EO6A 4LF8J 3BDEA 1CJTB 3CW2C 2K7JA 4AXIA 2MKHA 3MTJA 1S76D 1CBKA 2B9EA 1JLEA 2O1PA 1VQOS 5AXLA 3A8IA 2QE5A 4WKYA 4NZ7A 1WORA 2D3O1 3VTIA 3KHHA 3QBCA 3DOMB 1FJGF 5KFLA 4KGKA 5CHCB 2Y1LB 2BABA 3CCUS 2KFNA 1IN0A 3FQKA 4P2MA 1B0VA 1AUDA 4CH7A
chains in the Genus database with same CATH topology
4J9OA 2JLFA 2GGPA 4RWWA 1SBRA 4DQSA 4G1QA 4OI2A 1F5CA 4NX9A 2FJVA 4LFBF 2N7YA 4DMZA 1FTCA 1VI7A 3M6WA 7FDRA 3DLKB 3KHLA 1C4AA 3D5MA 1KOOA 1FNMA 2UV8G 3SMZA 4I67A 4DQPA 1DLOB 4X65F 2IYGA 1G7CB 1YBAA 3PJXA 4TQRA 1MSWD 2AYBA 4XPEA 4H54A 4NOHA 3MEDA 5D3GA 3NG8A 3IFEA 2ASDA 1C4CA 5K9FA 3IWXA 2B51A 5J2QB 2B4VA 4DLEA 4ED2A 3CCLS 3K5PA 2GMJA 1KHWA 4HL9A 4BWMA 5DGAA 5T7LB 1UA0A 5KG2A 1JJ2R 4QPXA 1U6BA 1TKXA 4CIOA 4B17A 5DJBA 1JXLA 3MOJB 2M8HA 3IG1A 4M95A 2AJ0A 5HBMA 3W2WB 3WC2A 5LSLA 1UFLA 2I9SA 5F0WA 2AGPA 2ZD1B 2PGCA 3FGVA 2VQEF 3IN5A 1SJ1A 5GAGI 2EKYA 4CO0A 4IH6A 1UMJA 1T94A 5KAKA 2V4JB 4HEA9 3SEOA 1GTEA 3LF0A 5J2NB 2OD4A 4HH0A 2IAJA 2ZH3A 3RTVA 1H3DA 4BWJA 2V9WA 2VUGA 5KFPA 4IFVA 1HBUB 4PXCA 5G4DA 3T6JA 5IM0A 1QJHA 4WFNQ 4A8YA 2FHKA 1SJ3P 2YKOA 3DMJA 4DG1B 3JYTB 2JEIA 2JL9A 1G3OA 3HZGA 4ID5B 5DETA 4LSNB 1TL5A 2HNZA 2PT0A 1FESA 4QWEA 2OTLS 3TA1A 2E66A 2ZHOA 3H98A 3SCIE 1CVJA 1QUPA 1F9FA 3H25A 2D9OA 2O67A 3KJVA 1HA1A 4ZMMA 5FD1A 1HBOB 5KT7A 1S1TA 4EU0A 3IR5B 3P3DA 3DI6A 2DGOA 2XCPA 3JSMB 4GC7A 4FF3A 2RRAA 2HW3A 5A0YB 1KQSR 3CULA 3HHLC 2B3TB 3E01B 1VBXA 3AHPA 1BWEA 1YGYA 2JDJA 1URRA 3K7RA 2Z0GA 1HNIB 3MMAB 2GMLA 2EG2A 2ZBIA 2DPIA 1X9WA 3GWCA 2IA6A 5BR8F 4FBTA 3EGWB 1NJZA 3DYAB 4KHMA 2OMLA 2N7CA 1QAIA 3OR1A 2DK2A 3TAMB 3QWPA 4K4VA 3JSBA 3MM8B 4KTQA 2E44A 2COLA 1G1XA 2VFVA 3KG0A 3MM9B 2DNQA 2P6TA 1RT1A 3RB4A 5DDOC 4EYIB 4ECYA 5KFNA 2Z4PA 4KPYA 2Q66A 4OFZA 3H5XA 4JI3F 5CH7B 2QLXA 2EFVA 2HG4A 3JSRA 3DHXA 4KHRA 2L9NA 1T05A 3D1QA 1QE1A 3L3CA 1LV5A 2BJEA 4U9RA 3OUYA 4B3OA 3SFUA 4AL6A 1URNA 1DTQA 4O23A 3MM6B 4FS2A 2KJVA 4JV2A 4H4OB 3K58A 2YKQA 2DRBA 1ZPVA 4ECZA 1UVLA 4ZPCA 2OSRA 1V6HA 5C25B 5EHHA 3Q8SB 1HMVA 3OTCA 3SXLA 3DLBA 2LEAA 3UDCA 3OL9A 3QJJA 2HNYB 4USHA 2LVWA 4ED3A 2KFYA 1ROFA 3HLUA 1C0TA 1JLGA 2LYVA 3M4XA 2R7UA 2V94A 5CZXA 4R0EA 5AJ3F 4HI2A 2LXIA 3T5HA 4XDDA 1NEEA 4DN0A 1IJFB 1HWUA 1X5PA 3ENQA 5AXNA 5ADZA 1VK8A 4A47A 2KO1A 1HD0A 4DV5F 2IFXA 4R5PA 4HVZA 3MECA 4IOCQ 4UUWA 4DUYF 2KJWA 3QGIA 5DO2A 3CPWR 1U1QA 2VONA 1MU2A 4R25A 5GAEU 5I3UB 2UUWA 1YJUA 3ITHB 4DQIA 3P49B 2HRUA 4DOZA 1LWCB 4KR0B 3BGRB 3PDNA 1TVRB 2CQ2A 1OSDA 2VPWB 2LA6A 4LUBA 2R2UA 1VIOA 2W9AA 2W4PA 3RAQA 2XMVA 2BV3A 2I1RA 1S1VA 3KNGA 2KRRA 1H2VZ 3M32A 1S1XB 4PKDB 1WHVA 4ECXA 2DNMA 2D3OR 3RB3A 4B9UA 1S6UA 4NCBA 2OTJS 2R2SA 4ED7A 1U1KA 4DX8H 1DHMA 2HQIA 3EPIA 3LP0B 1XR5A 4CNYA 1C0UA 1Q86T 2LDYA 2VFSA 4DUZF 4PUOB 1SL2A 2RQMA 3OTOF 1KFDA 3IAS9 2AJQA 4QW9A 3FNNA 5I42A 2VKZG 1LFWA 3PX6A 3KLHA 1WHYA 1KR4A 7FD1A 4O3OA 3OW2R 4MH8A 1U49A 3LGNA 1ZM4A 4JI5F 2W4CA 2X1FA 3OV7A 1VQNS 2ROGA 4TU9A 1S99A 4N56A 1RYRA 3AY0A 3UD4P 4MYTA 3NBPB 2MGZB 2POKA 1YJTA 3QIPB 5SZTA 3CCZA 4NLYA 2EBEA 3K57A 4LIRA 2FB0A 3DRSB 4R8UA 2FJDB 2GV1A 2MHEA 2O01C 2N82B 1REVA 2B0GA 5HP1B 3QYYA 2NXUA 1E6VB 2WBMA 2FC9A 3VALA 1U25A 2D3UA 1L3UA 4YR3A 3C6TB 2H5EA 4O4RA 5DQHA 3Q2TC 1X4EA 1JNRB 2IBOA 3OHAA 1YI2S 1RTIA 2I5JA 2XNQA 3OLBA 4LIWA 4IG0A 5KT5A 3SFGA 4B9SA 2R8IA 5KFXA 2RF2B 4TQSA 2XSFA 1S1WB 1MROB 3FCHA 4ED5A 2ZDOA 2EG1A 1DTTB 5AE2A 1C2PA 4KGMA 4I2QB 2GW8A 2W25A 1TL4A 4F2RA 1S1UA 1FXRA 4CT9A 4K4SA 2HWHA 3M8SA 2LEPA 2RQ4A 3CB4A 4Y3CA 2GCFA 4X4SA 1HI0P 2NQPA 2E1RA 1PSDA 2IM0A 2W7AA 3OQ2A 2KN4A 3BO2A 1U4BA 3HF5A 2LXFA 5B08A 3LAMA 1Y5IB 5C42B 2DGWA 3V6HA 3VCDA 5ITHA 3OL7A 2YH1A 2KU7A 3OFGA 1U8SA 2XWXA 3CD5A 1BQNB 1M5HA 2PC6A 3ENVA 2YWKA 2HLTA 4K4XA 4PQAA 3LUYA 5KG7A 3ISZA 2CYYA 4DBQA 1DURA 4NCGA 4IOBA 4CQ1A 2XMUA 4OQJA 5A8WA 1U1LA 3CJKB 3G6YA 1Z4UA 3DM2A 4YEAA 3ZZUA 1H7WA 2V5HG 3N01A 5DDQC 4CTAA 3HVRA 1WEZA 3SYZA 5CCMA 3VAGA 3PR5B 1WF0A 2OPRA 5E3PA 4DWIA 4ED0A 3NNAA 1LXNA 2FVSA 2CPFA 2GIRA 1JJ4A 1P1LA 4TU8A 5D4OA 2XG8A 2VFUA 3I6PA 3CCES 3US5A 2DNKA 4J9KA 1IBMF 3LOUA 4YDDB 1QUVA 4DFPA 5HROB 2J8AA 4QU7A 4RLEA 2RU3A 3THTA 1WD6A 2RJZA 3E2EA 1WF2A 2EFNA 3TVYA 4X66F 2XSJA 1FD8A 2IRUA 1TK5A 3FFIA 1DQAA 1X4BA 5FDLB 3ISND 2C22A 2OFGX 2R8GA 3CCTA 3TX8A 3I56S 1FTRA 4ILRA 2XEXA 2FVRA 4EZ6A 5CYQA 1YRXA 2M2BA 3FZ2A 3KTQA 1K0VA 4OZJA 1WG1A 2VBYA 1FVSA 5BYQA 4O4GB 5B0FA 4RW7B 4MK7A 4PG6A 5A8RA 5GAEI 4QWCA 3BO4A 5I3QA 4MJKA 4C0HA 2QT7A 3I0SB 3NKYA 2CQIA 2QA2A 2J0SD 3BR9A 1UVKA 2O5DA 5LJ5Y 4KRWA 5B7WA 2BDPA 1ZM3A 4URGA 4C11A 4IRDA 3PO4A 4IDKB 4TNOA 3Q8RB 1E6YA 1NHVA 1SKWA 1TKTA 3IWNC 2YH0A 3VAMA 3AQPA 5KFAA 2ADCA 1BC6A 3POTA 2E7XA 1RT6A 5J2PB 4MAKA 5HMXA 3NCPA 2HRYA 2BR0A 4MKYA 2WHOA 3EX7B 4KKOB 3NGDA 1HQEB 4C97A 4B3TF 2ZZNA 1KEKA 3NAIA 4C8LA 4LF8F 1DBDA 5HMYA 4OX7A 1XN9A 3DLGB 2CJBA 3T1YF 3NNCA 2WOMB 2VB6A 3CVKA 1XR6A 5E5NA 1XR7A 3UR3C 4PQUA 5KT3A 3U7JA 2B5JB 1SJQA 2GHVC 3PZPA 1APSA 1X4GA 5L39A 1HQUA 4FXWA 4WYLA 2HAIA 2YKAA 2HWTA 4FVCA 1S77D 3NMRA 2V8DA <