1IJFB

Nucleotide exchange mechanisms in the eef1a-eef1ba complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords elongation factor 1-alpha
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ijfB00
4X65F 1FKAF 3R3TA 4DV4F 4X66F 1XNQF 3T1HF 4GKJF 4DR6F 4DV7F 3OTOF 4LFAF 4X64F 5BR8F 4LF9F 2UUCF 2HHHF 2BVZA 2RJZA 5AJ3F 2B7BB 1B64A 2KJWA 4KHPF 3T1YF 1I94F 4DR7F 4DUZF 4DV3F 2UU9F 2YY3A 4B3MF 1HR0F 4DV0F 4JI4F 4DR2F 4JI3F 4JI8F 2UUBF 4LF8F 4LF6F 4NXNF 4JYAF 4DV5F 4K0KF 4X62F 4JI7F 4DR4F 4JI0F 4LF7F 4DUYF 1VMBA 1IBLF 1N34F 5LMUF 2UUAF 1XMQF 2B7CB 2ZM6F 2F4VF 4JI5F 1CQNA 4OX9F 4JI1F 5IWAF 1LOUA 2E5LF 4B3SF 1N36F 4NXMF 1XNRF 1G7CB 2UXCF 1RISA 4LF4F 1CQMA 5LMNF 1XMOF 4DR5F 4DV2F 1QJHA 4B3TF 4YHHF 1IJEB 2KJVA 2UXDF 4DR1F 1J5EF 1GH8A 2J5AA 2VQFF 1G1XA 1N33F 1HNZF 1IBKF 3ZZPA 4DV1F 1F60B 4YY3F 4DV6F 1HNXF 4JI2F 4LFCF 1HNWF 4JV5F 2UXBF 2VQEF 4AQYF 1FJGF 1IJFB 4DR3F 2BXJA 1IBMF 4B3RF 4LFBF 4LF5F 1N32F 4GKKF 4JI6F
chains in the Genus database with same CATH superfamily
1VK3A 3OJUA 3CXCR 1JLCB 1S12A 2ADBA 3EVMA 3CDWA 4K4VA 2BANB 1YJ7A 1GMWD 3NGUA 3QBCA 5D3GA 4LUBA 2OKQA 1D3WA 1R43A 2C3PA 4CLFA 2ZH6A 1WC5A 4ILRA 1ZYQA 5K14A 1RT4B 2IIHA 1HLWA 3CJTA 1QDUB 1H7WA 3UN5A 1FJCA 1TKTB 4PG5A 1BGXT 2AYMA 4LIWA 1C0UA 2CJBA 3CCES 4Q5VA 2AJ1A 3JYTB 2WOMA 2DGWA 2NXUA 1VRTB 2JVRA 2NUHA 4J90A 1G4CA 5HVGA 4KHRA 3GYGA 4MYTA 4ZPAA 5DS7A 1AFJA 3WHIA 3DI6A 3H5SA 2MHNA 5L8RC 5C25B 2XMJA 2DHXA 4ZLNA 3Q2TC 3JSYA 1RWWB 3GJRB 2CWKA 4B3SJ 5KFIA 3CCLS 1R0CB 2JC0A 2MQOA 4ZVHA 1SKRA 3LANA 4GKKF 1REVA 1URRA 1IKWB 4LBHA 1U4BA 2R2RA 3UDEA 2EI5A 4D3GA 4LF9F 1E6VB 4XDCA 1T3OA 3CWJA 3OPKA 2BM0A 3CDEA 3R7NB 1TL3B 4X4UA 5FDLB 2UVRA 2AJQA 1RT7A 3O8WA 5HROB 5F0UA 1FNOA 3CJKB 3LALA 1CJUA 2VG7B 2D74B 2NZ4A 2LQBA 4PKDB 4PWDA 3T1AA 1T05A 3OHAA 2VF3A 2ZVSA 2GGPA 4KRWA 3NAIA 4X62J 4I2PA 1VI7A 4WU3A 4GVLA 4ZA1A 1FA0A 4XTTA 4NZ0A 1X4GA 4TLQA 2DNGA 2XO7A 2DYAA 1WC4A 2BMBA 4OYMA 1VQ5S 4P2FA 2UVVA 4JBCA 5KFDA 1NMEB 1S1WB 2ASDA 1HQ2A 3H4DA 1PYSB 5JXSA 1Q95G 1LXJA 1R6YA 4AYBD 3PW2A 1FERA 3I0SB 1CSJA 4JV5J 3MEGA 4YDXA 4IFYA 1SI9A 1CULB 4P6QA 1ZOTA 1JJCB 1NRKA 6AT1B 3I87A 3G6YA 1VC6A 3Q23A 3GILA 4KH1B 2VPYB 1B99A 2V63A 3IP0A 3NNAA 4ZCLA 3BKFA 4MK9A 1K47A 3NCPA 4JI7F 1S1UB 5KFJA 4LF7F 2KXHA 1RADB 3KUGA 3GZ7A 4J9OA 5L46A 4DG1A 1RISA 2SXLA 4MIWA 4H4KA 4IR9A 1RAOA 3T5KA 3D0HE 3S6EA 4B3TF 3G4SS 2FJVA 5KFNA 2WBMA 2EK6A 1N33F 2YNGA 2CNLB 3AB2B 2ZH4A 3P6YC 1C0TB 2XMUA 2HBRB 5B0AA 2HQDA 2RRBA 3DLGB 2H4WB 2OPPA 1N5YA 1JJ2R 4X4OA 1FK9A 2ZHOA 4EU0A 4LSLA 2OSRA 1QUPA 1RABB 1S48A 3GWCA 1HNVA 1XTZA 4EI2A 2XC9A 3DMJB 1RT3B 3HJFA 1ZZNA 4CWBA 3PO5A 1IR2A 4RW8A 4CLTA 4B3OB 3M8ZA 2FGOA 3V6HA 2OFHX 2RQ4A 5CYQA 2JWNA 3Q8VA 4K4TA 4RW4B 1YI2S 2HQIA 1JLFA 3MAAB 3PY8A 2MYFA 1BQXA 1N36F 5KT5A 1HW8A 3SMZA 2W8KA 1KHVA 3K17A 2ZE2B 4CTAA 1VCTA 1HBNA 3RU0A 4NLSA 5LMUJ 1FVQA 2CQPA 4LRAA 3POTB 3OVSA 2AMCB 2BJDA 2KL8A 4LSNB 1YJNS 4QIFA 2CPEA 3QRPA 1OPIA 2VQEF 1RQ0A 2XEXA 2KT5A 3VGSA 1G3OA 3S8SA 2ZH1A 1DLOA 1RU1A 3GYNA 2A2DA 2YKAA 4I67A 4EYHB 3SI8A 3M2VA 1HPZB 2CQ1A 2EFVA 3PX6A 1O6XA 2I0XA 3DDNA 1GTEA 1H2TZ 4NPOA 3H2UB 5KFLA 4ECUA 4NLOA 2X7IA 2HHQA 4FVCA 1FRIA 3NGTA 1FJGJ 2C2OB 4HI1A 3TUZC 2BX6A 3AAWB 3M6UA 3OW2R 1RWUA 1Q82T 4RO0A 3S7RA 3HHNB 2NS1B 3QATA 2WSFC 1S97A 4X4VA 1KONA 2XWXA 5GMKa 1R8BA 3BQ1A 1AZSA 2X1GA 5KFQA 3RZAA 3P4UB 1WKKA 2EVZA 1HKAA 2QA1A 2VIHA 3RR7A 1R8AA 1BUXA 2LLZA 3FSYA 4F2RA 1KLMB 4IOCQ 2ZBQA 1RUSA 2NR0A 4YB6A 1KP6A 2Z30B 1RWOB 1T02A 4U7CA 4AQYJ 4IFVA 2FVRA 2W7PA 4ECYA 1NZ8A 3U02A 3VQSA 1KQFB 1YGYA 5C42B 3SFGA 3P45B 3VTIA 4ZVTB 3NGDA 4EBDA 2C3UA 2DR6A 2OTJS 1Q53A 4W98A 2FLLA 3MM9B 2PEBA 2CQDA 4Q7AA 1S4FA 1EAYC 2NCKL 4Z7YA 5F8MA 1RTDB 2YKNB 4PABA 1F2HA 4F4YA 4NLUA 3A1YG 3LPEA 3IM8A 4DV0J 3SDEA 3W61A 3TZXA 2BM1A 4IG3B 1U0HB 2BE2A 5DDRC 1Y5IB 1X4HA 1DTTB 2QLFB 7FDRA 1FRXA 3NNHA 4C8ZA 1VQKS 2EW9A 4C11A 2IJFA 4LR9A 3QIDA 3FFIB 4USMA 3QSIA 4OZNA 4ZN3A 3GLJA 4RNFA 3TZZA 3OUYA 1U1RA 2XHCA 4FN5A 4DFPA 6FDRA 4IQXA 2GW8A 3D3CJ 1VQPS 2R8JA 4DUZF 3LAMA 2DHSA 3PXGa 2F63A 1Q5YA 3CTRA 1NKCA 2KVQE 1HMVA 1TP7A 1RHRB 4KV8B 3BEGB 3VAKA 3MCMA 3CCUS 2GVZA 2MSSA 3DRYA 4CT9A 3QJLA 3DLEA 1SJ4P 3IWNC 3CJRA 4L3NA 4CQ1A 3AA8A 1IXKA 3DU6A 3UPFA 3C6TA 3LF0A 3BH7B 5IQQA 2NLWA 1LNQA 5K8PA 3U27A 3A8IA 4WFZA 1F9FA 2DEJA 4HT5A 2LXUA 2XWYA 2F8MA 1HNXF 1FNMA 3BJYA 4WKYA 3TUJC 4ECQA 1H2UX 3KMQA 4YMEA 3I5AA 4LVOP 4ECVA 3DRPA 4X66F 2X51A 4WJBA 2LEAA 1CVJA 4CLZA 4LRBA 2HHHF 2MMYA 2M8DB 2LXFA 3LGMA 1S6UA 2MKIA 3ULHA 1S79A 4I7FB 1JLBA 4L73A 4ZPDA 3TZWA 1AFIA 5CHCB 1GNKA 5A8RB 4FDFA 3K5NA 5HI7A 3PJ9A 2XNRA 1K0TA 3M8PB 1S0OA 3CJ5A 1SJFA 2G2ZA 4HHHA 4XDDA 4RW6B 1HBUA 4OHVA 5LOQA 4ID5B 1JXEA 4I69A 1QD1A 3DHXA 4RW7B 4DV7J 1A9NB 3A8KA 3MM5B 3SYZA 2J6UA 2E44A 5E3AA 4JI5J 4C4WA 2VC0A 4G1QA 1KOOA 2YQ3A 5A8WB 3A12A 4QYZK 4EZ6A 4ZOSA 2LU1A 1RJJA 3ZZTA 3ZZZA 3NLCA 3CCZA 4IH5A 2Q1LA 1SQFA 2Q6CA 4O44B 4ALZA 1CC8A 1PJ5A 2MLZA 1VQOS 2W4PA 2QA2A 1WKLA 2ILYA 2RSQA 1B4SA 1NAQA 2KM8B 5IFMA 5ETPA 2RJZA 4HLBA 1IBMJ 1RLDA 3QFWA 3PRDA 3UDCA 2B3TB 3P5TL 2YX7A 3US5A 2OGUA 1M5SA 1W2BR 2FTRA 4MFBA 1MSWD 3BGRB 1T9VA 3J7YI 4DSEA 3HCXA 2WBRA 2BJEA 4DL2A 3KLHA 3K58A 1LWFB 3VCDA 3IR6B 2HLUA 1WF1A 2MGZB 3H5XA 3CCRS 1CJKB 3TOQA 4PUOA 2GO8A 3HDSA 1C1BA 1EZZB 3NGKA 3PG9A 3CUNA 1T8EA 4NA3A 5IS2A 3E51A 2ZWPA 3FCHA 5IZHA 4KGZB 4HKQA 2YWKA 5ETSA 4MMOA 4ZCMA 3HFVA 4O4GB 3TAMB 5DLGA 4F02A 4OZ1A 3ENQA 1FKPA 1FRHA 4LFAJ 1RAIB 2HWIA 3DRXA 3JB9k 4LJMA 1H2VZ 2BDPA 1KC8T 1Y4ZB 3N28A 4B3MJ 4OHZA 2G4BA 4USTA 2B6AA 1WC0A 4NYOA 5IOLA 4A46A 4AL7A 3OBIA 4LF4F 4CH0S 2HGLA 1XMBA 2R42A 1FFSB 2J76E 4RNHA 1KFSA 1T9TA 1FDBA 1NPRA 2JSXA 2R7OA 2DBBA 1FVSA 4O0NA 3L7UA 1H3DA 3D67A 1WNEA 3AHPA 2UXDJ 3H40A 3AXKA 4A8MP 1VOMA 1TL4A 1N32F 2R2TA 3C3LA 4X65F 3EGZA 2QSWA 4ZPVR 4KH0B 5D15A 3ITHA 1RT1A 2RMLA 1KBRA 1CJVB 2BABA 5AJ3F 4RLEA 2QJ3A 3VF0B 1X5TA 3IWXA 4GO7X 1XR5A 4TU7A 1FTRA 2VJVA 1NEEA 4AL5A 2GJ2A 4X4SA 3VR1A 1T7PA 3TVKA 3C14B 2AX1A 5CD4A 2GZOA 3MUMP 2VDHA 3GPAA 3LWMA 1URNA 3OTEA 2IBOA 2ZNZA 2IHR1 1U02A 4ZVFA 4ZMMA 1HBMA 2AYGA 1MLAA 4OX9J 3RUBL 1S9EA 2P9CA 2HAFA 2CNNB 2KZZA 2QC3A 4OI2A 3MPUB 2OHDA 1UVKA 4F0MA 4HHJA 2I9SA 3BR8A 3D1OA 3TJ8A 4ZVGA 3BSOA 2ZUAA 2ZJPQ 3HX9A 1UZDA 4ECTA 3NGSA 4NMLA 2QX0A 1VRQC 2DH9A 3TR5A 4B3TJ 2CVEA 3Q89A 3VQTA 2WB4A 4HYKA 1D8ZA 5IV4A 3M2UB 2OO4A 1PC4A 1G6BA 1WJ9A 1Q79A 4C3KA 4ED3A 4RNNA 1IBLF 1X9SA 4F7VA 2HVDA 2OMLA 5BYSA 2BQRA 2V5HG 3GFXA 4JI1F 1UEVA 3IBFB 2CPXA 3PJWA 2XY6A 4JP8A 4HH1A 4N76A 3MAQA 3PFEA 4H4OB 2VPZB 2GC8A 5DDQC 3HXMA 3BZQA 4CIOA 2QLBB 3HVTA 1HHSA 1PBAA 1K44A 3MEEB 1IQTA 1UFLA 4KJIA 2HS0A 2K7KA 2HNYB 1V9OA 2HQFA 3PYEA 3TP2A 2ZOGA 4DR3F 2WSCC 1WELA 1EP4B 3RGIA 3V81B 1FJEB 1N36J 3DDIA 3M32A 2Z57B 1TKZB 1XK8A 3V4IB 1NJWA 4I1TA 2XQCA 1RT2A 3PM9A 4Y65A 2M3DA 4ED6A 3OFHA 2IRUA 3VAFA 3M9MB 3D2WA 1E6YB 1SL0A 3B4MA 1CPZA 2PFDA 5T7LA 3HT3A 5J1EA 3BGUA 2R8IA 4DLEA 5C24B 2E5HA 4YR2A 1SH3A 2VKRA 2M5YA 2I1RA 4PXDA 1U25A 1FEEA 4R0EA 4ZPWR 1XBWA 1G7CB 2B4OA 1OQ3A 2A6MA 3W1YC 3PJXA 3LP2A 2BRKA 1BD6A 2FHMA 4BC7A 2ATCB 2JFKA 2OPQB 3W62A 2F40A 4ICLA 4DCJB 2EBEA 2VFUA 4DV6F 2FHOB 4FXDA 5SZTA 5CYMB 4YP3A 1MWQA 4YEAA 3TJ9A 2Y0SD 3U1MA 3M1VB 4ENOA 4IKAA 2X1AA 1RTHB 3UDLA 2AGOA 3DRSA 4UF4A 3EPGA 3THVA 2KJWA 3FEYB 1Y3JA 3ZZ0A 2XSFA 3QZ7A 3DLKA 4NCGB 3ZXWA 1RAJA 2IAJB 2YY3A 4QJVA 2D3OR 1HR0F 4DR2F 1NB2A 3DRRB 3CC4S 3D54A 4DX6A 2B8PA 4ED5A 3FZ2A 2JVOA 3R9LA 4KO0B 4O3RA 3KJNB 3HVAA 4E98A 4WTOB 3ETMA 3TAPA 5EWGA 3HSGA 1EQMA 1MWZA 4QPXA 2XSJB 2U1AA 3PR5B 2VPXB 1JMTA 2J0SD 3GIRA 1EKRA 1OSCA 1VYAA 2JEGA 3I55S 4QIVA 1M5VC 4O3PA 1JJ4A 3HHLD 2E9ZA 3D68A 2QMWA 5HVFA 4DX7A 2G0IA 3JSMA 1N0VC 1M5HA 4N7TA 3B6BA 3SV3A 2V8HA 4F3QA 1X0PA 1VDHA 1GXLA 5KFPA 4DMZA 2WCXA 1S1TA 2IRYA 2FC8A 3HKWA 2AJFE 3N01A 5THWA 3FZBA 4ZLJA 1OPZA 1TL7A 3BBCA 4KYZA 4O3OA 4JI3J 2KFNA 3R5CA 1CEZA 1EARA 2HQGA 1BQMB 2E66A 4WFBQ 4NZ6A 2WOMB 2ASYA 2GAHC 5B0BA 3UO0A 4YB1P 2IMWP 2C3MA 1WACA 3HHKA 1T03A 2RRNA 1L3VA 1LWCA 4M5MA 2WRMA 2LDIA 3QGIA 1JJHA 3KG1A 2MZ1A 2KKHA 3OR1A 4AE5A 4DL3A 4ECZA 1S0NA 1UWAA 1WHWA 2H54B 4UZBA 2AJ0A 2NSBA 2R8HA 4DQQA 1REVB 1AUDA 3WIUA 2Y1JA 2B7BB 3I31A 2EC2A 1L3SA 1UETA 5D0HA 1N6QB 3NS7B 4URQU 4NLVA 1RWXB 4YOEA 4H4MB 4Y6IA 3IAM9 1U1LA 3PHTA 1AUSL 8RUCA 1YBAA 2CWXA 1NK6A 1J5OB 3ETOA 2ZM6F 3MR5A 2FD2A 4FKXA 5H9FJ 4UUWA 2DKOB 3WZ0A 3TVYA 3K59A 4ZP9A 1TFWA 3IRXB 3FEXB 5E3PA 4RBVA 1KTQA 2LQJA 2QO3A 2ZZMA 2ZD1B 4TU8A 2DNYA 2UXBF 1Y5LB 5A76A 2NSCA 2GQ2A 4M95A 2YNFA 3S01A 3EICA 3DGPB 5E3QA 1WOPA 3MMJA 2J8AA 2CQ0A 4M5JA 1WI8A 2Z2LA 1VK8A 3IR7B 5HP1B 2ERRA 3M8QA 3NWRA 3NNCA 4U7UD 4LF5J 4IFYB 3LQVA 3VZHA 2PMZD 3GQCA 1VFJA 4ES1A 1GT8A 1U09A 5KOWA 3MM8A 2ZH7A 4QBUA 5SUHA 2NXJA 3DHWC 1YJUA 4ZDNA 3TANA 2MSTA 3MCOA 4LF6J 3FSXA 2R7RA 1RZMA 3CNQP 1U7LA 1FNXH 1NO8A 1N5TA 2CQ4A 2E1AA 5HBMA 1K8AT 2V34A 3UVJB 4OZ5A 4V1Ak 3WDOA 3ILLA 4PG8A 3TYTA 5F8HA 4IDKB 3B8HA 4O23A 3FQKA 1WHYA 2B9XA 4JI6F 1RA7A 2A10A 1LW2B 1QUVA 1OIAA 1WOSA 1HYSA 2WVEA 4ZVSB 4R5PB 1UL3A 2BVZA 2ZJRQ 2FJDB 3R6GB 3MUTP 1H0HB 1NDKA 4RW9A 3UR3C 2D9PA 4JI4F 4OZ2A 3ZTQA 3NOCA 2BKPA 1D09B 2HS4A 2O67A 4RW8B 3I9V9 5D4NA 2FY8A 3QWUA 2AEJA 4F0HA 3MR7A 1LOUA 2BJ9A 2AGQA 3AD8C 1QSSA 4LSZB 4JV0A 2YTCA 1Q0NA 1NSPA 1NJIT 1RWNB 1MNEA 1YBUA 2CJXB 3FQLA 3D6MB 3ZZYA 2MZSA 1F3FA 2ZKUA 3SQGB 3SSSA 3KNAA 5AXMA 1HD1A 5DZ7A 4ZKAA 2X1BA 5AE2A 2EG1A 4YHHJ 1IR0A 4DSKA 4OJ1A 4F36A 3LGHA 3VAGA 4L75A 1FWLA 3OLAA 2KYXA 4C9DA 3A3PB 4GC7A 2VICA 1TU0B 3GSDA 3NWGA 4DWIA 1GFWB 4C8OA 3BKTA 2FC9A 4A47A 3NXZA 1HI0P 4MH8A 4OYPA 1S76D 1Q8KA 1UTAA 1Z2ZA 2OEKA 2HVIA 2G0JA 2YQ1A 2UUCJ 3RRHA 1TV6B 1MMDA 4I4BA 1KEKA 2CPFA 3RW7A 2F9DA 3OT9A 4I2QB 4N8NA 3PHEA 3DOKB 1CBKA 2HHXA 1IVZA 4B9VA 2ABYA 1HQEB 2Q3PA 3QFHA 1F6TA 2LA6A 4LF1A 2FZKB 1IKXB 2BJ8A 3CDUA 2RF2A 5F8GA 1XQIA 3PTWA 5ETQA 1LWEA 1T9YA 1Z4UA 4AXIA 3MR3A 1RTJA 4OX6A 1J27A 2G1DA 5D4PA 1KN6A 4EGLA 2RHSB 3A13A 3DM2A 4PG4A 3ICLA 4TY8B 1RAAB 4JI2J 3C16A 3OTOF 3ILJA 2GVDB 3KK2A 2OJ3A 5DQIA 1A7GE 2KXNB 2DNQA 1F9EB 4NX9A 5CA5A 3GMGA 2BRLA 4DUTA 3ZZOA 2K1RA 3J80Y 4NI2B 4PAAA 2YH0A 4TQRA 2HIYA 3GIJA 5DM6Q 2V2KA 3IS9A 2W1BA 2DPJA 1MN9A 3DOMA 4P7VA 2UUBJ 4EBCA 3G71S 1MMNA 1CQMA 2MY7A 3HULA 3DXSX 4YR3A 1MMLA 4OYIA 2F3JA 4YUDA 2JLFA 2MLYA 4P52A 1GH8A 2E9RX 4W92B 4LF2A 4PQUA 1IKYB 1EX8A 1OYEA 1N54B 4MK8A 3MZIA 2FZCB 3NBPB 2H4YB 2QLXA 3BSNA 1A0OB 1RLCL 2N82B 1O51A 2XBPA 1IBLJ 1VGYA 2IJRA 2Y1LB 5IQ6A 4WFXA 3R5GA 3D1QA 4C98A 3MPYA 2MZQA 3IGVA 2K7JA 1R0AB 4EEYA 2MKJA 2Z58B 3KLGA 2HMIA 4GKJJ 1JKHB 5KTQA 1N0UA 2XI2A 3QAEA 2CPZA 2XGQA 3QAUA 5IT4A 1SKSA 2ZH8A 4AL6A 4ZIVA 4NA2A 2VG5A 3MDFA 2E5LF 3TVZA 4CM0A 2UXCF 3LH2S 3GCXP 3M30A 1LWXA 2W2PP 3M8YA 4K0KJ 4LBPA 3KJVA 3CCJS 2YNHB 3K57A 1IR1A 1RT5B 1SUQB 4N8OA 4UOGA 1IBKF 1JLAA 4K5SA 2OAUA 1DTQA 5A8KB 4ZCIA 2L41A 5DGAA 3B54A 3BR9A 2LXIA 3J7AN 2MKCA 2VG6A 3LP0A 1FFWB 4F8RA 4ATNA 1FCAA 2ZOMA 4ZVPB 1TVRB 3BO4A 3MD3A 4DJBA 4ZIWA 1KHWA 1WD6A 2H5EA 2ZDPA 2ALZA 3LP1B 4WP8A 4K7QA 2PGCA 5DO2A 4OHYA 1JLQB 3TW0A 2NREA 3T1HJ 1UMJA 1NHKL 1S9GA 1I1GA 4RNMA 1M0SA 1RYSA 5RUBA 2QL7B 4J9NA 5KFKA 3IBCB 3R8YA 2ROEA 2GIFA 4MK7A 2M88A 4ER8A 4J5OA 3QT5A 1GXUA 1BC6A 4CO2A 1VQ9S 3SCIE 1XMQJ 5BYQA 2YX4A 3R6LB 4DR2J 2QLWA 3PRVA 2I5JA 2Q43A 4G1QB 1PYTA 1MROB 1HNWF 3GP9A 2W7AA 3GJQB 3M6VA 1J5EJ 4ED7A 1UWBA 1SPBP 5I42A 2F5GA 3EE3A 3AA9A 3UNYA 1NCLA 4IQMA 3JQMA 2YKMB 2MY8A 5H1SV 2XM3A 3CT9A 2OELA 4P2SA 4ITSA 4C6AA 5JJBA 4DV3F 1P1LA 1TL1A 4WBFA 2YNIA 5HN0A 3I56S 2LKZA 4LMZA 1V6HA 4TU9A 2WAQD 1ELOA 5ETMA 1WC1A 5B0DA 2B7CB 5AT1B 2QMUB 1YTYA 2J7UA 5KFSA 3C15A 4DPYA 2DR9A 3E01B 3F73A 1FFGB 2C3OA 3HSDA 3G8QA 3G6ES 3M8WA 4OZ0A 2KN4A 4RX6A 4ES3A 4I6YA 1BMQB 2W2OP 2DVIA 4V19X 2O1PA 4CLSA 1NDLA 2J8SA 3TX0A 2HIQA 4N77A 1YWXA 4DU8A 4QW8A 2QFJA 3N4WA 1SJ3P 2WB1D 5LSRA 4DR5J 1LW0B 5EGYA 3KWMA 1QVGR 2BJ1A 4I64A 1YSJA 3QO9A 4NEZA 2DGVA 5E3CA 4W90B 3GV5B 3FMBA 2X3DA 1KQGB 4Y2CA 5DQGA 1KRPA 2OI2A 4DHVA 3H2LA 4C0HA 2B4UA 1Q16B 3KMSA 2AF6A 2BW7A 1RAHB 1HIYA 2BANA 1TUGB 5FIIA 3EM1A 3NL0A 2DRAA 4IOAQ 4KHPJ 1I94J 3KLIB 3IG1B 1RT4A 4DUYF 2GHPA 2FVPA 2Y3YA 5FLXU 1SCJB 2V68A 1PAEX 1X4EA 1O8BA 3EZUA 3OQ2A 4USUA 5G4DA 3AY0A 3R7BB 1TKTA 3PACA 3QIPB 4M94A 4DR1F 2BA9A 2NXNA 1ZH5A 3JYTA 1ZPVA 5LM7E 1VRTA 2XB2D 1HNZF 1CJTB 2CRLA 2V9KA 1Q1KA 2B43A 1GMVA 5KG6A 1JXLA 4QWAA 3KHHA 4LBIA 2IVFB 3TQEA 3AFGA 3FMWA 1ITPA 5C25A 2FJBB 1RAGB 3FEZA 3HJVA 3FBBA 2JEJA 4J9MA 1I51B 5AE3A 3P96A 1MU2B 2D41A 4B9MA 3O1LA 1Y9OA 3KLEB 2AKWB 1RT1B 2XY5A 1TFYA 4B3RJ 2FPHX 1IKWA 4MKBA 5EUHA 5DG8A 1ZM3A 1KNZA 3CJ0A 1E6VA 4GVBB 1XNQJ 1FDDA 4DDFA 4NEYA 2UXBJ 1TL3A 5FDLA 4RKUC 3MEDB 4DL4A 2CPJA 3CJKA 2VG7A 1RXOB 4LVNP 4NL5A 2KYZA 4CNYA 3HSZA 5FLXY 1HBOB 4DF8A 5ETOA 2KFYA 2MKYA 3W2WB 1BQNB 2CG8A 3CO0P 5T41A 3F56A 4CLKA 2HBQB 3H7HB 3RW6A 4KGVB 1W25A 3J7YU 4TY9A 3VZIA 3TI0A 1T0TV 1S1WA 2VOOA 2XLJA 1IKVB 1XWLA 1B64A 3E3XA 3PX4A 2ZBPA 3H20A 2F7VA 2L08A 2FVQA 2BKNA 2EWHA 2WK4A 3ENVA 1U45A 2CDRB 4JI8F 3OFGA 1CULA 4A8XA 2MQMA 2PA8D 3D4JA 4QR0A 4KAIA 2OEMA 1WOOA 2QIFA 3KXDA 4FYYB 1LK7A 3DOLB 3NMAA 4F3OA 3GFHA 1Z2LA 1S1UA 1NJYA 1RHJB 1N5QA 4DFMA 3NP5A 2F4VJ 2LEBA 4WIIA 2NQPA 4ZHRB 2C2KB 1YVFA 3ISZA 2GIRA 3VAHA 2PFFB 3BGLA 1J2VA 5CXTA 3N5FA 4FNHA 3CW2C 3SEOA 4K50A 2K3KA 3KLFB 4Q8EA 3JSRA 2JDJA 4MYUA 4E8UA 2HBZB 3MXHP 3O6QA 4FKYA 4YY3J 1C0TA 2HEKA 2QT7A 3M9OB 3DLGA 3EVOA 5ADZA 1SC1B 2OD4A 1LXNA 3JQKA 3HHLB 4ECXA 1B0TA 5GADU 3N0VA 4CT8A 4PWUA 5T14A 4PXEA 2YH1A 1UPPA 5ETNA 1RT6B 3H5YA 2X3GA 2YWGA 2VA3A 3DMJA 1RT3A 1BE4A 4USVA 5C2GA 3BBBA 3G8TA 1HNIB 2HVZA 3CDBA 4B3OA 1VHIA 5J1PA 3GCWP 1KSPA 1WEYA 4RW4A 4JI0J 3DKDA 3MAAA 3C8YA 3OD2A 3BM7A 4ZVOB 2XY7A 1ZA1B 2DHAA 4A8OA 2XZTB 2ZE2A 3JS9A 2JHEA 2XGPA 5KFYA 4BLGA 3RYLA 2GQCA 3POTA 2LDYA 4GO5X 3Q8PB 4BHQA 2HZVA 4LSNA 4FS1A 2DGUA 3AJDA 2E1RA 3PYDA 1C4CA 5ETTA 3CEDA 1G2EA 1DY3A 1Q5VA 4FF3A 1KOHA 2G2OA 4DL0C 4Y3CA 4DLGA 3FUYA 3MMAB 4WFAQ 4NYZA 1RAFB 1D9DA 3MPWA 1X8DA 3NGRA 3M9NB 3MF5A 2GJFA 1HPZA 2K06A 4H54A 2VKZG 4K4WA 3GIIA 4DR7J 3CCTA 4NLDA 2W9BA 2R8GA 2AP6A 3DU5A 3SSRA 2CJQA 2XYGB 2PO4A 1ZTTA 4WKRA 2MQNA 2A3JA 4GRSA 1WDTA 1SB6A 3RAMA 2HFZA 1ZAWA 3WX8A 3WC2A 3MM6B 2JLGA 3EDQB 4S0MA 2AWZA 5H9EK 4UOCA 2VPWB 2GJIA 2R7TA 3MD1A 5IT0A 4ZPTR 4C8YA 4Y2IA 1RHQB 5KFEA 2DNPA 4WIQA 2CNOB 2HS3A 1NNDA 1NLKL 3BV8A 1TAQA 2IFXA 1WSVA 1ZM2A 3QGHA 4FBTA 2KU7A 3KTQA 4DR6F 5F8IA 2AZ1A 1KLMA 3DN9A 2R2SA 2FJWA 5A0YB 1JLEB 4U8VA 1JX4A 2HRTA 2A0FB 3TEHB 2BJ3A 3CD5A 1S5ZA 2RS2A 1KQSR 4NXNF 3ISNC 5C42A 3BPSP 4KC5A 2EKNA 3W64A 2VDIA 5IT9Y 3I4HX 1SVDA 1SC3B 3S1TA 4QR1A 2UUAF 2XMWA 3N9UC 4ZP8A 4IH6A 3VVUA 2KH9A 1TKXB 5KFCA 1U6FA 1XNRF 3CJSA 1Q8LA 4FVMA 3BPDA 2MTLA 2CYYA 1KD1T 1RTDA 4OL8A 3B82A 3NCQA 4NE9C 2YKNA 1YKWA 5FJ4A 2B9YA 2DITA 2HRUA 1VIOA 1UEUA 3TWZA 4IG3A 3C46A 1R27B 2UVUA 3RB0A 4MJKA 1RBLA 4EYIB 3WIVA 1FD2A 1T03B 3C6UB 3A3OB 4QPTA 4OV1A 2EXUA 4L72B 2DD8S 4K4ZA 4B17A 1R0BG 2CPYA 2HURA 2W01A 3EGWB 3OR1B 2OPSB 2UXCJ 4KGXB 5CD4H 3FFIA 3KHRA 3MR2A 1VQ6S 4TVAB 1WSRA 2W8LA 3X1LB 2QN6B 2QE5A 4PZVA 3Q0AA 4EMDA 1PYOB 3GU0A 3OFEA 5I3UB 2O66A 3V2UC 4KT0C 2C22A 5A2QY 4LQ3A 3K5PA 4X2BA 2Y9HA 4LIRA 1NB7A 4KIAA 3QT8A 2UU9J 3DLHA 3KYLA 3KG4A 5B0EA 3IMQJ 1FRMA 2BOPA 4DZ6A 2DXEA 2ZBRA 4B3SF 4XPEA 2D3O1 3VAMA 2W24A 4KV8A 4ELUA 1B7YB 3ZTSA 4DPXA 4DR4J 3H59A 4CO3A 1TELA 3F44A 1HA1A 4NXMJ 3JTNA 4TKTA 1EHWA 1TTHB 1VQ7S 2YNFB 3G9CA 1KWMA 3DC2A 3UCUP 3HMJG 2C28A 5J2PB 2RQKA 2B0GA 3JAMU 2CKWA 3NS5A 3KK1B 4ES2A 4A8FA 2KT3A 1MN7A 1UFWA 2CAJA 2DIUA 2HBYB 4JYAF 2JL9A 2UV8G 4I7FA 3EWGA 2ZUGA 4X62F 2ZC3A 5A8RA 3KNGA 1X4BA 2D3ZA 3K8VA 2VBXA 3JTOA 3QLHB 2WVCA 3ZZUA 1C1CB 2QL9B 2O3DA 2J9CA 2JOQA 5D0EA 4CRJA 1UKUA 1VBKA 4ID5A 5G0RB 2LU2A 1BXNA 1NK4A 1RK8A 4RW7A 1T95A 5IWAJ 1DARA 1U8WA 4U95A 1TK0A 3MM5A 2IPOB 3G2XA 3R5DA 4JV5F 1U0SA 2YX1A 3J7Z5 4HT7A 3VAJA 3RBXA 5J1NA 5A8WA 2HFUA 5KFBA 1F9HA 1YRTA 4LFCJ 1RTIB 4ETXA 3O5TB 4O44A 2ZHAA 3MOJB 1F1BB 2B56A 1HYSB 2HRYA 3H2VE 2VU5A 2J9DA 3RJMB 1VBYA 4C8NA 1ZBTA 5KG2A 1OJ4A 3SXLA 3JAMY 4DFKA 5K5MA 1B0PA 2R2UA 2AEFA 1B3TA 1VIXA 4EBEA 1DQ9A 3KK3B 3B78A 2M9KA 2XULA 3MI7X 1RACB 2XHWA 4TQSA 3X3UA 4LF8J 1N56A 1S6PB 4A8YA 5AXKA 2RE1A 1SXLA 3W5ZA 2E7WA 2M2BA 2M7SA 4LR8A 2QG9B 1FO1A 2DXDA 1LWFA 2MGZA 3G86A 3H25A 5MAOA 3P8BB 1KVKA 3OSPA 5LMNJ 3FK4A 4DV2J 4J9UE 1RB0A 5HANA 3UCGA 3IAS9 1PAUB 3D0GE 3IWLA 1OY9A 2IM1A 3R3TA 4G6VB 4ZPCA 4BCAA 1DFDA 4Y2MA 4JB8B 3K8WA 4BWJA 2JEIA 3IA0A 4K2XA 4URSA 2Y1RI 3PW5A 1TKDA 1IM4A 4DR1J 3MFIA 1B0VA 3VGTA 4DX5A 2VH7A 1WORA 2M52A 2DO4A 4CO0A 1QSLA 1U24A 4O4GA 2MQLA 3FCVA 5BR8J 4X64J 2FHKA 1X5SA 3T1YJ 1FKOB 3EGVA 5KOXA 2OP5A 5LMUF 2IM0A 3M7VA 3CULA 4KKOA 4ZN1A 3T6BA 1SH2A 2BE9B 2FDNA 5HJYA 3UCZP 2VHGA 1R7IA 2PT0A 5EX0A 2CZ4A 3ENAA 2DHGA 3ZNJ1 1X0FA 3L3CA 3MM7B 1VQMS 4CH7A 2OPRB 1VBXA 1TMJA 4Q45A 4KE5A 1LWEB 3K89A 3HF5A 4Q0BA 3EDRB 2VONA 4Q43A 1X4FA 2JX2A 2DT9A 3M6WA 1WUUA 5J2MB 3Q83A 1NM2A 4HL9A 4UZCA 2V4JB 3DM2B 4DL6A 4AD6A 2MZRA 4HDHA 1UZHA 4USIA 2YWHA 4HACA 1FESA 3TEGA 2Z56B 3T5LA 4DV4J 4YFUA 4Q2MA 1CJVA 2KZMA 4WTYA 4BWMA 1DURA 4OYXA 4A8QA 4RU2A 3I32A 2RVJA 2KM8C 1VJQA 3BO2A 4NCAA 3TZYA 1XEZA 1OYDA 3TO8A 3HO1A 1X9MA 3R5BA 2PC6A 3C14A 2UV8A 3D28A 3MWBA 1PSDA 4F2SA 2P9GA 3ZO7A 1N34J 1L3UA 5L39A 1RKIA 3QRRA 3J7ZT 2HNZB 3MUVP 1IWGA 4JI8J 3AB4B 2IJNA 2C2EA 4YN3B 4AQYF 4EK2A 1I3OB 3MGJA 5F8NA 3M8RA 2JJ4D 2XLIA 1BWEA 1H7XA 3KLVA 2G0CA 3HZEA 3NG8A 2HGMA 2BJ7A 4AXJA 3OTBA 3FRYA 2M8HA 5EWEA 1X9WA 2NPIA 3AODA 2FLNA 3M2RB 3CCVS 3D9BA 3QRQA 4TYBA 4K4SA 1HL6A 1LFWA 2MJNA 4DV0F 2ZWOA 3ENWA 5GMEA 3OXFA 5KFMA 2V0NA 1RHUB 4MAKA 4CCHA 3MCNA 3H4BA 2BZ2A 2CA9A 3M2UA 1YX2A 3UW1A 2JNJA 3KDNA 2KO1A 4FYVB 3TUPA 2GX8A 3T5JA 2FZGB 2YVSA 5HO4A 3EZ5A 5DETA 1PGZA 1XMOF 3A8EA 3UI3A 4WZMA 4U6PA 2KT2A 3L95X 3KJVB 3OJSA 3CC2S 2XS7A 4DV1F 1NK9A 4H4OA 2HHUA 3IN5A 1ZAXA 1R3NA 3CMQA 3KJQB 3D7SB 1LQ9A 1SIWB 4USKA 4LR7A 1QLNA 2ZOFA 4RBTA 1EP4A 3ZTPA 3MEKA 4DSJA 3V81A 2DNZA 3T19A 2W4DA 5I3QA 4UW2A 1TKZA 3V4IA 3RR8A 2QL5B 4ID8A 2FJXA 2HYIB 1LK5A 3U1LA 3SCJE 4DBQA 3K5LA 2W2MP 1U2FA 3KHLA 1E6YA 2DR8A 2EPIA 3I0RB 5DZ6A 2CJAA 4NMXA 4F4KA 5C24A 5GAEI 4PYAA 4WE1B 5BJRA 1SC6A 1Q86T 2ACMA 1IUJA 5D4LA 3N6NA 3PZPA 3CMAS 4U7UK 5ETKA 4OZ3A 2GV1A 4M8LA 3A3NB 4PYDA 3W65A 3I82A 1SH0A 2Q66A 1S4EA 4X84A 2OPQA 5DM7Q 2MHEA 3PDNA 4F4WA 4OX7A 1RHKB 1V5IB 2HKEA 2ZNYA 1KLNA 4IO9Q 2P6TA 2ROPA 5CCMA 3QZ8A 3M4XA 2PI4A 3M1VA 2YQ0A 1JLGB 3DNCA 4CZCA 2J6TA 4GKKJ 4HH0A 1RTHA 2ATLA 4ZP6A 5C5JA 2RDJA 4GMKA 3D1HA 1CS4B 4NLTA 1NU4A 3DDKA 4LF9J 2RUGA 3PR4A 1L3TA 5J2NB 4OHXA 4NCGA 2AZ3A 2CDQA 3RG6A 2XO6A 3DRRA 4JI5F 4F25A 3V6KA 5KG1A 1GX5A 1AXQA 4FYDA 4KO0A 1F5CA 2CJ9A 2IC3B 1XR6A 3CF5Q 3CJQA 4DFJA 2OH2A 2B5JB 5GAGI 2VJUA 3TA2A 1F60B 2XSJA 1VBZA 5F3ZA 2ZZTA 3DXBA 4L6V3 1M5KC 4Z2XA 2DHHA 3VGUA 1S1VB 3M6XA 4ECSA 4C3LA 1IBMF 3KG0A 4ZVRB 3A8JA 2HNDB 2XTJP 4MIBA 3W2VB 5IM0B 5AXLA 3UD5A 3GIKA 2BBEA 3G8SA 1ROFA 4NCBA 3SIPB 2V2ZA 3OL6A 4QIEA 3BDPA 1SV5B 2PIIA 4EZ9A 4IO1A 2C2RA 5L9XA 2GMJA 3OLBA 5K8OA 4PR6A 4NLRA 1Y7PA 1IN0A 1X4AA 3H0PA 3T9NA 1RBOB 2F4FA 3NMRA 1UJ4A 4ANDA 3DYAB 3SCKE 2ZZNA 1ZPWX 3V6DB 3FBCA 4QYZJ 2LMIA 4JOUA 4JI7J 5J2QB 4LF7J 2PSZA 3L09A 1WC6A 5K9FA 2B8QA 2BKOA 4V19J 1QE1B 2GNKA 2H48B 1BQMA 2ZH2A 1PO6A 3D6HB 2BQUA 4IRKA 4R8UB 4NWBA 4RUAA 3EX7B 4I0WA 1HD0A 4OMFG 1N33J 1NJZA 1L3KA 3O2IA 2H65B 3EPIA 2A6OA 4FYWB 3BQ0A 3MMCB 4LFAF 3N79A 3KUHA 1RGVA 2LECA 4C48A 2K2PA 2L9NA 3PFOA 5HK4A 4B3MF 1F2GA 4MKVA 2R8KA 1N6QA 4JUZA 3PX0A 4CYUB 4PQAA 4CLPA 1NKBA 2IDEA 4H4MA 2HHVA 3AOCA 3C19A 4NYPA 2AEMA 2CQHA 1RP5A 1J5OA 2IM3A 1HQUB 1NSAA 2W9CB 2MKHA 3VVTA 1NHUA 2UXDF 3N5BA 1K0VA 2MJUA 2WONB 3HP6A 1S77D 1QAYA 3IRXA 4JYAJ 1RSCA 4M5GA 1X4DA 2NUUG 2BXJA 1QAJA 1DZ5A 4U8YA 1UA0A 2EG2A 4C3MA 2ZD1A 1PILA 2GFFA 4XAKA 3QSYB 2HZCA 3QJPA 3VHQA 1S7HA 2P2CB 5EHHA 2VQEJ 5DJBA 3CD0A 3DGPA 3Q8UA 4DU7A 4OYBA 1S7IA 3QGPA 3LPYA 3G96A 2L9DA 4OYOA 1U2CA 1FHTA 1PG5B 1S1XB 5KFXA 2RKIB 4KHMA 5HP1A 2CPIA 1SBRA 2DO0A 4O3SA 2RT3A 4UY85 1X4CA 4OX9F 1PJ7A 4Y2AA 4E2FB 1EETB 4DN0A 2AV5A 3MMBB 1UJ5A 2KJVA 1RBAA 2HFVA 3AD9C 2RU9A 4NLWA 4NRUA 3TQ1A 2FVCA 4Y00A 2OFGX 4ED4A 4K2JA 4KFBB 5CZXA 4ILMA 2QMXA 3Q24A 3Q2SC 4C0BA 1MWYA 3UVJA 4FXWA 1WDDA 2LFVA 3R5JB 3UD3P 4IDKA 3G82B 2VB6A 3ONQA 5KG0A 4DL5A 1S6QB 4MKYA 4RWXA 1R6VA 4RUBA 3OR2B 1LW2A 1TK8A 4ZITA 4YQWA 2DNNA 3CIMA 4Q2LA 4R5PA 2VFRA 4Y0FA 2E7VA 1M1GA 5L9NA 2BW2A 3NRBA 5JUMA 4BBYA 2OD6A 5K20B 3ZZRA 2YPZA 3CCWA 2NZCA 1P9YA 3BS9A 3OVBA 5HLFB 4Q44A 2AJ2A 3ILOA 4CM2A 3IGNA 3CJ3A 1IBCB 1AYEA 4RBUA 4ED2A 1EJ7L 1OSDA 2G9OA 1DQAA 1VRUB 4LREA 4OX8A 5C2CA 4OYZA 3JQJA 2WW4A 2W7OA 5KFZA 3MECB 1WG1A 2F1FA 5KG3A 1ZS6A 2CQ3A 4WK3A 4NA1A 1Q7LB 3SQGA 3CPWR 3LTOA 5D3GB 3I4PA 3QNWB 5CH7B 4N41A 3OHBA 3DGVA 4CLUA 3JTPA 1CLFA 2CJYB 5K14B 3I9ZA 1HHTP 3LOUA 1OQ6A 2V8GA 4HDGA 2ZITA 1P6TA 5LSOA 1S57A 2MZJA 1A6LA 4ECRA 3EXYA 2F8HA 1RA6A 2BOAA 3BYPA 2XLKA 1C0UB 1P8GA 4F67A 3FCWA 3OTDA 1L5UA 4DUZJ 2YWFA 1X60A 3CC7S 3CGIA 2HPUA 3T6JA 3L7PA 3DI6B 4CLYA 2W9BB 1YQHA 4KTQA 4CI0B 1TV6A 1FXDA 5JMNA 4ZVUB 4QCLA 4DI6A 1XIQA 1YJTA 1NK0A 4I2QA 4P2MA 3CIZA 4WYWA 2VFSA 3DOKA 4A4JA 4BS2A 2RU3A 3PIPQ 1HQEA 3BBFA 3I5CA 2DXFA 3ZZPA 3GJSB 2DR7A 2HFOA 2LQ8A 2MKSA 4OZJA 2OLWA 1HWIA 3NKYA 1OY8A 4K59A 1GMUA 4EO6A 1IKXA 5BYRA 5A6WA 3CJ4A 2H9ZA 4IG0A 2HG4A 2BEFA 4H4KC 5L1IA 5JVHQ 1ZTWA 3BO3A 1RT7B 1I6JA 1HNXJ 1M1HA 2JZ5A 3SQOP 3AOBA 3EYZA 1CJUB 4FP9A 5B7WA 5ITHA 2V6AA 1VQ4S 4TY8A 4UY8T 2KTQA 4PWDB 3PV8A 5CZVA 4X66J 1T05B 5LXYA 2GVDA 5B09A 1O0PA 4FF4A 2P5VA 3UNGC 4G65A 4UUXA 2HHHJ 4M5LA 2DPIA 2GGPB 2IYGA 4HI2A 2COLA 4OI0A 4I2PB 2ZFHA 4NI2A 4IRCA 4DPTA 4WP9A 1V3ZA 4M5HA 2RD5C 3HKZD 4R0JA 1YDLA 1Y00A 1SIZA 2V8VA 3ET6A 5GAHU 4L74A 3AD7C 2PMHA 2JLEA 4N47A 6FD1A 3DLLQ 4P9SA 4WCEQ 4LT6A 4DSIA 3QYYA 4QW9A 1NSQA 2JC1A 4FNIA 3MEGB 1IKYA 4OLOA 3L7OA 1BY9A 2J7KA 3NBPA 1LKZA 2CJKA 2DB1A 5DRKA 2F8EX 4E0DA 2CQ2A 3THTA 3E2EA 1XMOJ 1RTZA 2J9DE 3BSAA 2N4DA 3LWLA 5ETLA 5KT4A 5EDWA 3ZC4A 2P9EA 1X7VA 2XMKA 2UVWA 1NJXA 1PIEA 4DV1J 2Z8QA 4JI3F 2B9EA 2YXLA 1Y11A 4HEA9 3RAXA 1YHQS 2KVIA 2R7WA 1R0AA 4XO0A 3EUNA 4DG1B 1WTFA 3DLBA 4QR2A 2DY9A 1JKHA 2UP1A 4QOTA 3R1HA 4LQ9A 1QAXA 2YNGB 4K4UA 4USWA 4G1PA 3GTYX 4NLGA 3MTKA 2Z0GA 2OTLS 4RL1A 4B9TA 5CAAA 4ZCKA 4YDDB 1FE4A 2OPPB 1TUWA 1N5YB 1PC5A 3C66A 2RQCA 2HVEA 2YNHA 1FK9B 1RT5A 1C4AA 4LSLB 1SUQA 1V3RA 2EEYA 1JXVA 2CZVC 1R8HA 1NZAA 1AB8A 5IV3A 3OL9A 2KG1A 1HNVB 1FDAA 5A8KA 2XNQA 1T3NA 4CLWA 2UUWA 2XZWA 2RDDA 2W2NP 4WZQA 1NUEA 4GC6A 2Z2ZA 1TVRA 4OJGA 2MPUA 1UVIA 1Y3KA 5CYQB 3HD2A 3Q8SB 1FRLA 1JLFB 4XPCA 3H42A 3LP1A 1WG4A 2QGFB 1HHQA 5D6GA 2MQPA 1JLQA 4CTAB 5KT3A 3BGOP 1QTNB 4EO8A 3BKUA 1HBNB 4KPYA 1SJRA 3CO9A 1F5AA 3BYRA 3H5UA 2VC1A 3WC0A 5DG7A 3DLJA 2DR5A 5EWFA 3GSIA 2K8GA 2YKPA 1RAEB 5CABA 4CDIA 5I3PA 1UFKA 4F4XA 2C1EB 2R7XA 1D9FA 2E7XA 4LF4J 2AHOB 1DLOB 4I6AA 3J80U 3M2VB 4CNZA 4QWBA 2WVDA 2J9EA 4LF5F 1TK5A 1MROA 3PKMA 2HLTA 1T9WA 1RU2A 1JB0C 5IXUA 4L76A 4P73A 3K7RA 4PPDA 3C2PA 3T5HA 2ZHBA 1N32J 4X65J 4C7QA 1AW0A 2YKMA 3BGFA 1BLUA 3CCSS 1UW9A 3FBFA 2FVSA 3O3LA 4DCOB 4LF6F 5AJ3J 3I5BA 1OO0B 3AQPA 2LP4A 1TL5A 4B08A 2OUGA 1FRJA 3BSCA 1AZSB 1ZAVA 4ECWA 3FDSA 2QTWA 1NK7A 2L48A 1TUVA 2AQ4A 4OFZA 1T94A 3E01A 2EFOA 1ZM4A 2KXFA 4O0IA 5F9LA 4PCQA 2G2YA 2F9JA 4KGKA 3FKBA 1KTVA 2HVHA 3UQSA 3PW0A 2BR0A 3D6FB 1T9UA 1R8PA 1UCNA 3OL8A 4IFVB 1X31C 4DSLA 1W7WA 4YS2A 2CADA 4FPRA 1SJQA 1LW0A 1QVFR 2DRDA 5E5NA 1GEHA 2EFGA 3RB4A 2A18A 2CUYA 1U26A 2DTJA 2CVIA 1WKJA 3AJ1A 3EJMA 4PWWA 2ZH5A 5IC4B 3SDEB 3U1NA 5KAKA 1RE1B 5HMWA 2BE2B 5GVQA 5B0FA 3QPIA 2XCPA 4O3NA 2O5DA 4PPZA 3TRGA 2NYHA 2YKOA 4WPAA 1WHVA 4KKOB 2H3EB 3KLIA 3IG1A 2X1FA 1UP1A 2B51A 2AX0A 4F0KA 3PCOB 2MZTA 2RQMA 4C11B 2E5GA 2I8EA 3F0NA 4YR0A 4YHHF 2LEPA 2BACA 4U67Q 3V4MA 4UT4A 4X4QA 4JI1J 5KT7A 3QIPA 3UE2A 3BN4A 2ZVIA 4A8KA 5L1KA 3Q8RB 3ELHA 2A1BA 5GADI 2IA6A 1LEOA 3OUYB 3W5YA 4KQZA 1K1SA 1R31A 2L9WA 3L9ZA 5D0GA 1CJTA 3KOAA 1SL2A 3OTCA 3JXOA 2V67A 4OJ3A 3T41A 2WTFA 3EZOA 4Q0BB 1HFEL 1RCOB 2MEWA 4X4NA 1U1PA 2MXYA 3U7JA 2UUCF 1R8CA 4ED0A 2CQBA 4DR3J 2JFDA 1HMVB 5HQ8A 4ETZA 1MU2A 2GVZB 4HACB 3DLEB 3GV8B 4DOZA 5HMYA 3KLEA 1I5OB 7AT1B 2CG4A 2DGXA 1XJWB 3T9ZA 3ZTRA 3C6TB 2BE7D 4GVBA 2N7YA 4QU6A 4Q8FA 4NZ7A 1N52B 4WK1A 1F3VA 3D6TB 3MEDA 1B7FA 3BREA 3KUEA 3W60A 2K3IA 1IJEB 4M63A 2FB0A 3W9IA 4BC9A 2R7SA 1N48A 3QT6A 2MQ8A 3W66A 4ZS6A 1H73A 1HBOA 2ZBIA 4JI2F 3DRPB 4ZLLA 5F41A 2BQ3A 3W2WA 1BQNA 2DK2A 2B4VA 1HWJA 2Q6BA 1WWHA 2KI2A 4D3HA 2KG0A 2FGCA 2RH3A 1JLBB 4DV6J 1WI6A 1ZETA 3VV2B 2ALYB 1H38A 2DNOA 1RDRA 4F4AA 5KG5A 1U1MA 4RU9A 3PRBA 2MQQA 2B9WA 2DEIA 3EGNA 5E33A 4DQSA 3R7SB 1JNZB 3ADAC 4NLYA 1IKVA 2VZ9A 2HWTA 2HSEB 1HBUB 2J0QD 2UUBF 4RR5A 7FD1A 5GMDA 3MCSA 3W8PA 3H90A 1HR0J 3Q86A 4RNOA 2VOPA 3FVYA 5KFUA 4AT1B 4R25A 1S6OA 2KFZA 1HI1A 2IA0A 3DOLA 4IR1A 1AT1B 4U96A 2G1HA 2ZKTA 1KVJA 3GE9A 2FY1A 3QMQA 1NK5A 2XMMA 3IM9A 2M70A 3E8OA 4MKAA 1VQYA 4ZHRA 1SJ1A 2XYPB 4ANCA 2FQQB 4B9NA 4IRDA 4IYQA 1VQNS 3D66A 2D9OA 1DAXA 3MURP 1F5BA 3HPOA 2ZEJA 8AT1B 2YWEA 5KFAA 4GKJF 4I68A 2W25A 4M5DA 3KLFA 1XR7A 4ANEA 4MFBB 4WU2A 1FDNA 1EQ0A 5DQHA 3NS6A 3TAQA 2E1CA 5L1LA 4I56A 1KKHA 3HHLA 2HHTA 5M2UA 4K0KF 3KLHB 2V4QA 4FF2A 1S9FA 1NPKA 1RT6A 4M5NA 2O01C 2WVFA 3UD4P 2Y8YA 4PUOB 4OI4A 3CVKA 1RWPB 4DF4A 2GIQA 1C1BB 4HHUA 1U1KA 1WC3A 2XCAA 3VGVA 5DGBA 1HNIA 1RWVB 4M5KA 4YB5A 4L3KA 3D3BJ 5H9FK 3LGNA 5BXIA 1DQ8A 2RNEA 1KFDA 3R27A 2QSFA 1LFPA 2DNRA 4DQPA 1WG5A 4J7CA 2ASJA 1PJ6A 1AROP 1JLCA 2AD9A 1NBEB 3RBDA 4F4ZA 4QU7A 1N5VA 1HW9A 2RUSA 1FKPB 3T1HF 3GR1A 1ICEB 3AXMA 2W9AA 4KR0B 4J9KA 2EK1A 1U1OA 3QQCD 1RWKB 4P74A 1VJWA 1X5PA 4OI1A 4DXLA 1VS3A 3MMAA 4FZVA 1P9QC 3TA1A 2B6AB 3J81j 5KFHA 1NXIA 4EFAC 3I96A 2QRRA 1XMQF 3QWPA 2C2ZB 4HVZA 1K9MT 3HSJA 2NXEA 3IXQA 2FIUA 3PKYA 1J5EF 2RHQB 4K8RA 2ZM6J 3UN3A 4DQRA 3GG1A 4MT1A 4N56A 1M5PC 3FC9A 3GG0A 1Q7YT 3CMES 3GFYA 3ITHB 4P10A 1WF2A 1U6ZA 1UVLA 1GXTA 2R7QA 4A48A 1M1KT 3MM6A 1DHMA 4BDPA 4WF9Q 2DIVA 2PE8A 4WWSA 1YJVA 2QFIA 4WXOA 5HROA 3N6MA 2DNLA 1H72C 4ZJOA 3CDAA 2IVYA 1SC4B 1HI8A 2ZH9A 4J9SA 4QWDA 2B4PA 3H8YA 2JH3A 3BH6B 3RRGA 2LA4A 1UVNA 5A0YA 1JLEA 1ACMB 3MPVA 3IC1A 1KS2A 3AH6A 3HHLC 5D8HB 2IM2A 1HBMB 1CQNA 4PRFA 4HTIA 3V5RA 1CC7A 1S9EB 4DR5F 2E1PA 1TKXA 2V2QA 2J5AA 1S59A 1XN9A 5D4OA 3GYXB 1FXLA 5HQLA 1JWWA 2XG8A 2XZDB 2PA3A 3VWSA 2BV3A 3DCAA 1FX4A 2CQCA 2Z2MA 4P7TA 3I0SA 2JEFA 2GMHA 2E1MC 2QZ8A 2IMOA 2HFNA 3W5XA 2R3VA 2W4CA 3C6UA 3IR5B 4NASA 4PEOA 5DDPC 1U1QA 2XMVA 1HWKA 1NH8A 4KHPF 5GAEU 1I94F 4JI6J 4ILLA 3AQOA 1Q4RA 2OPSA 4LRFA 1U1NA 5ETVA 2H5IB 1YRUA 4PG7A 3EMTA 5CYJA 3HVWA 4FXVA 2GMLA 3UDVA 4TLRA 2MB0B 5I3UA 3MFHA 2HZAA 4RUCA 1Q81T 3A4TA 2HW3A 3MTJA 3PNIA 3CJ8A 4DPUA 2JRSA 4JI4J 5F8JA 3HVTB 2CZ9A 3GJTB 1N4LA 5E41A 3W9JA 3THPA 2APOA 2KHDA 1NDPA 4RUHA 3TUIC 2N4CA 2NPFA 2AU0A 1FWPA 2ACYA 5HMZA 3RBZA 2I6WA 3UFCX 3VALA 1OMSA 3M32B 1UVMA 1QM9A 3Q8QB 3FSIA 4B3RF 3WBZA 4O3QA 1RT2B 1QAIA 3I6PA 2KHCA 1VC5A 1M90T 1XNQF 2H1YA 1KDNA 3HFKA 1SKUB 4AFFA 3MR6A 4FS2A 5LT5A 2RILA 5T7LB 4ZJQA 2GHVC 1ZM9A 5J1EB 2J0WA 1U8SA 4ERDA 4DQIA 4ED8A 4OIXA 3BQ2A 3FBEA 4C97A 5J2PA 3GONA 2R9LA 5GAGU 1KQKA 3P49B 4P2XA 4DV5F 3KK1A 5ETRA 4DSFA 2DGQA 2ZBCA 3LP2B 5LJ5Y 4UOFA 3T3FA 1FX2A 3GV7B 4IOBA 3TARA 3ZTOA 1OY6A 3NEKA 4UQTA 2CQIA 4ICLB 3F41A 3CD7A 5F3TA 3QLHA 1QSYA 1NDCA 1C1CA 1TAUA 1YG0A 1WEZA 5HATA 2C42A 4USJC 2CPHA 5KFOA 4OJHA 5G0RA 3PIOQ 1GQEA 4F04B 3DRSB 1V3SA 3W7BA 4QYRA 2ZH3A 5IT9U 3QT7A 4HTJA 1UAWA 3DLKB 1D0EA 4ZP7A 1NKEA 1FT8A 4ZPBA 2V69A 2V8DA 3HLUA 2RB7A 4OYWA 2AYEA 5E0OA 2C3YA 1RTIA 2PI5A 1Y10A 3J7A1 2H51B 3OTOJ 4RZRA 4DX8H 2GO9A 3KDOA 4QIGA 3HZGA 2EFNA 1T9XA 2KDOA 2V50A 3BB5A 1PBUA 2F4VF 1NPPA 4PXCA 4Y28C 4Z37A 1QY7A 2RS8A 2FJEB 3FNNA 2AW0A 4K5RA 1TZ0A 1GAOA 3HHDA 3KK3A 4OLPA 2CQGA 1APSA 3HK2A 4ED1A 5U47A 2VQFF 2D1CA 3TA0A 1S6PA 2DNHA 3ISND 2R7VA 2AGPA 4YY3F 3JSMB 2Y0BB 2M0GB 1WTBA 2HK2A 4KSEB 3NY0A 3IRWP 2HFSA 2FLPA 5A2QU 4FBUA 4LFBF 4KY3A 1VLOA 1PKUA 2OEJA 4LRCA 4WXWA 3P5BP 2DGSA 3ZNUA 3G6VA 1S1TB 2VV5A 3GB0A 4LRDA 1GX6A 3OXLA 3EXCX 3HI9A 1VHFA 2FYXA 3MM9A 1VQSA 1TL7B 3R5AA 3LO3A 4I6WA 5D77A 1H74A 3CSKA 3MPDA 2VL1A 4DZDA 3QJJA 1SL1A 3LAKA 2HHWA 1FD8A 4MTPA 3VAIA 9RUBA 4X4RA 2HHPA 4JI0F 3PEJA 3R97A 1U0HA 4P71A 2IDLA 2N3LA 1FKOA 1DTTA 1FJ7A 2R7UA 5F0WA 2V8PA 1LWCB 1OS5A 1VQ8S 3OVAA 5JVGQ 9ATCB 1TR0A 2WHOA 5B0CA 5E3RA 4W4MA 3NAHA 4ZVQB 3SFUA 4FPIA 5KG4A 1JQGA 2E5LJ 1YJWS 1VLYA 2CFXA 2ASLA 2RAQA 1FI4A 2I2YA 3R2CJ 2YKQA 4FYXB 3CB4A 1IBKJ 3H98A 3MM7A 4IG0B 4X4PA 2OPRA 1UEKA 2VFVA 1BHNA 2ZC4A 4FF1A 3CCQS 2OSQA 5HSPA 3IO1A 2V94A 3SBMA 4OQJA 1FRKA 4DR7F 4J9LA 2FLOA 4G3IA 3HM9A 2ZDOA 5KFFA 1KVIA 5J2MA 2V4JA 2Y1IA 1RI7A 3KJFB 3HHEA 2GA7A 4MIAA 5HL7Q 1T11A 4QWEA 3K0JA 2NYIA 2HQCA 4PXBA 2PEHA 2CIMA 3PVXA 1D8YA 1AA1B 1NK8A 1Z1ZA 1U6BA 2HAIA 2EC0A 3LA0A 4CLLA 2PDAA 1CG2A 3ET6B 1VISA 3W63A 2LYVA 4EWTA 4DS4A 2HNZA 2VFTA 2CPDA 2DNKA 2U2FA 2POKA 3M8QB 2Z4PA 5I4MA 5HJXA 3G6XA 2D7SA 2PD1A 3D5MA 1MG7A 1HNWJ 1RHMB 3JSBA 3CJ2A 5K8MA 1RWMB 5CQGA 3J81U 4DS5A 2MKKA 4J9RA 2QYGA 1U2RA 1HARA 1ULRA 2LQ5A 3LUYA 3MM8B 1YLXA 3M8PA 3CD6S 1NHVA 4RW6A 3RTVA 3M2RA 5IC6B 2BUNA 4DCPB 2I38A 4DPOA 4DV3J 2WSEC 1RCXB 2C2NA 3CE8A 2XS2A 1UW4A 2L3MA 5HBMB 2W2QP 3V6JA 5KFVA 3FGVA 4WFNQ 2P6SA 1Q8BA 5B0GA 5B08A 4F3MA 5H9EJ 4WP3A 4KBIA 1FE0A 3BDEA 1U48A 2YPYA 4K4YA 4IH7A 3K5MA 3RB6A 4M1KA 4B9UA 1S99A 1H6KX 5DG9A 2AIRB 3OXGA 3BN7A 2C2DA 3K5OA 2J6SA 1Q8IA 1LV5A 1SQGA 1C2PA 1FKAF 2XMTA 4P72A 1K73T 4RW9B 3OL7A 4QWCA 2XI3A 4CO1A 4TNOA 3WQPA 2UU9F 4C0OC 5E7OB 3BGRA 3J81Y 4C2MA 3RB3A 4P75A 3ZFVA 5HAOA 1Y5NB 3HFZB 4OYAA 4F50A 1S49A 2VASA 4DR4F 1YIJS 1N5SA 5A6PA 5KT6A 4OI3A 4CH1A 4CO4A 3SV4A 4F26A 4NXMF 1CJKA 1X5OA 1FWKA 1N8RT 1S10A 4NLPA 2MDAA 4RWWA 3R2DJ 3I0RA 4DUYJ 4ZLPA 1VC0A 3CCMS 4TN2A 3UN2A 2GAGC 3HD1A 3PO4A 4WE1A 3SSQA 2LCWA 3GIMA 2D69A 4U9RA 2QA4G 4A8SA 3ILIA 1HNZJ 1V5VA 4ELTA 3Q8YA 3EVWA 5CCLA 3TAMA 1XERA 3MOZA 2J0XA 1K1QA 3K2YA 4C8MA 1N88A 1PCAA 2FUG9 1W2IA 1JLGA 3GR0A 3HT0A 5M2RA 2WZ1A 3FJ2A 3W8GA 4EUVA 1CS4A 5FD1A 5L38A 1YRXA 4DL7A 3AJ2A 2ROGA 5IWAF 2XYHB 3AOAA 1F0XA 5J2NA 1S72S 2RF2B 2DH8A 2QA4S 1WF0A 4RPFA 2A2CA 1HWLA 2UZAA 3OV7A 4NLXA 3MHYA 2PMWA 2IYIA 1G1XA 1RTJB 2YWWA 5MLCV 4OI6A 5LJ3Y 3UWTA 2EBGA 2IC3A 4LFCF 2E29A 1FJGF 3C16B 2IBKA 1DBDA 1BWVA 1R89A 2B5JA 2PN6A 1FEHA 2QYCA 3KK2B 1HWUA 5KFGA 2DY1A 2VUGA 3HVRA 1NH7A 2HK3A 5LXRA 2EKYA 1IM6A 1Y0HA 1S1VA 4Z7CA 4CO5A 2E9TA 1SQEA 2K1RB 1YK9A 5AXNA 2HWHA 5HMXA 1YZ7A 4J9PA 2CNKB 5IM0A 1Q78A 2HNDA 3W2VA 5KFRA 3IS9B 1W26A 1EB0A 2RDIA 1YJRA 4NLQA 4LF8F 3DOMB 2CXEA 1FTCA 2RIJA 2GHWA 4B9LA 2DRBA 5DDOC 3MAHA 2EFQA 5D78A 2D3UA 2E5IA 1SV5A 4A8WA 1B70B 1REGX 2Z2YB 3RAQA 3R1LA 4PQUB 4ZVEA 1S0VA 2Q79A 1SKWA 1O5JA 5LMNF 1P1TA 4DV2F 1QJHA 2IY5B 1UJ6A 1EKSA 3DYAA 1VQLS 5AE1A 3IBWA 3V6DA 1JK9B 3RRKA 2HGNA 5J2QA 4WYLA 5HVHA 1QE1A 2DNMA 5EX3A 3QGGA 2DH7A 3KHGA 2IRXA 4R8UA 2FJAB 3KLGB 3PW4A 1KR4A 2VA2A 4Y34A 4O4RA 3KKFA 4X64F 5BR8F 2HMIB 2G13A 2WW8A 2N3OA 4ZK7M 2QV6A 3DFEA 3T1YF 2V2VA 2H5JB 1ZA2B 3G87A 4Y2KA 2XS5A 3RBEA 4DEZA 2F65A 8ATCB 3MMCA 4B02A 3PEHA 3AT1B 2V9WA 4K4XA 3PYFA 4OV6A 2VG5B 4M5IA 4DPWA 2GCFA 3PW7A 3M8SA 2AJ4A 3M30B 4J9VA 1RKJA 2DISA 3TNVA 2GS8A 4IUFA 1JIHA 4DN9A 4UTGA 2XMAA 1VR6A 4CYUA 2R4FA 1JLAB 5C7PA 1WHXA 5DLFA 2OMOA 1TQLA 2J7WA 1DTQB 1UVJA 3MEEA 2VD3A 1OWXA 1H98A 5L1JA 4KPCA 2HNYA 1FF2A 1HQUA 2VG6B 3LP0B 5D0RA 2NXCA 4X4TA 4JV1A 2W9CA 4DV5J 2E5JA 2VBZA 5K8NA 2M4MA 1IJFB 4URGA 1TMMA 1YZ6A 2WONA 3L4BC 1GK8A 2FHJA 4DV4F 5LSLA 1WEXA 2RRAA 4USHA 1S0MA 4XK8C 4J37A 2VBYA 4TXSA 4J91A 3PYGA 2KRBA 1S9GB 5F8LA 3UR0A 2ZJQQ 1YJ9S 4KGMA 1GMWA 3FRZA 3M05A 1YBTA 3KFWX 1NSKL 4KB7A 2N7CA 4OZLA 3LW5C 5EN1A 1UA1A 1VMBA 2QEXS 2QLJB 2DCUB 1N34F 4JV2A 2Y8WA 1S1XA 3GFZA 2RKIA 2HHSA 3WX4A 2P8IA 4QZVB 1FXRA 4G1IA 4N5SA 5M2PA 4NOHA 2I5JB 5KFWA 1XC9A 4PG6A 1QTMA 1JNRB 4QIWD 3TX8A 1M5OC 2GQQA 5HQMA 2KB2A 2LVWA 3OFFA 5CYMA 4AUKA 2AT1B 1P27B 2UUTA 1UWBB 1EETA 5I42B 3MMBA 4UOHA 4UQGA 2IVMA 3TJAA 2ADCA 2MLXA 3O44A 1D9AA 1DJ0A 2DCLA 3SZ2A 3BF4A 3N6LA 3NOGA 5LL6d 4HR2A 4KFBA 4B9SA 2KRRA 3NCRA 1TL1B 4DV7F 2DJWA 2YNIB 5E2QA 2IAJA 4ZJLA 2EFPA 3SCLE 4M5DB 2VQFJ 3G82A 1IWAA 3OSNA 4QQBA 4CP5A 4C8KA 4ELVA 1S6QA 1IQZA 2OIHA 4DR6J 1U47A 3C15B 5GAHI 3OR2A 1D1UA 3IFEA 2WVBA 4LFBJ 2DGOA 4YB7A 5KT2A 3Q22A 3B4DA 2AYBA 4NXNJ 2C2MB 2DGTA 2LQ9A 4RJVA 1ZZFA 4XIUA 2BYCA 1UPMB 2VODA 2UUAJ 2HQ3A 1EIYB 5F9NA 5HLFA 5KG7A 1DRZA 3D0IE 5KFTA 3W9HA 3P3DA 4J9QA 3QO9B 2VBWA 1XNRJ 1RYRA 4NRTA 4C8LA 2V4RA 2ILZA 2FHJD 2YBVA 3W3SA 4OHWA 1GTHA 1YITS 1VRUA 1U49A 4WFYA 1MW7A 4TYAA 3MECA
chains in the Genus database with same CATH topology
5E3QA 1VK3A 2RH3A 3R3TA 3OJUA 3CXCR 4G6VB 4ZPCA 4BCAA 1JLBB 1JLCB 1DFDA 4Y2MA 3K8WA 4BWJA 2ADBA 2JEIA 1WI6A 3CDWA 3MMJA 2J8AA 1ZETA 2CQ0A 1H38A 3IA0A 1WI8A 2DNOA 4K4VA 2BANB 2Z2LA 4K2XA 4URSA 1RDRA 1VK8A 2Y1RI 5D3GA 3IR7B 4LUBA 3PW5A 5KG5A 1U1MA 5HP1B 1TKDA 4RU9A 3PRBA 2OKQA 3M8QA 1D3WA 2ERRA 1R43A 2C3PA 1IM4A 2MQQA 2ZH6A 3NNCA 2B9WA 3MFIA 1B0VA 3EGNA 5E33A 4DQSA 4IFYB 2VH7A 3LQVA 1JNZB 4ILRA 3VZHA 1ZYQA 5K14A 4NLYA 1RT4B 2M52A 1IKVA 2VZ9A 2DO4A 2PMZD 4CO0A 1QSLA 1U24A 4O4GA 2HWTA 1HBUB 2J0QD 2UUBF 2MQLA 1H7WA 2FHKA 3GQCA 1VFJA 4ES1A 1GT8A 1X5SA 7FD1A 1FJCA 1FKOB 5KOXA 1U09A 5KOWA 3MCSA 3MM8A 1TKTB 2OP5A 2ZH7A 5LMUF 4PG5A 2IM0A 3CULA 4QBUA 4KKOA 1BGXT 3T6BA 2AYMA 1SH2A 4LIWA 1C0UA 2CJBA 5SUHA 3DHWC 4RNOA 4Q5VA 2AJ1A 3CCES 1YJUA 3JYTB 2WOMA 4ZDNA 2DGWA 3TANA 2VOPA 2NXUA 3FVYA 2MSTA 1VRTB 2JVRA 2NUHA 3FSXA 2FDNA 2R7RA 5KFUA 4KHRA 4MYTA 4R25A 1S6OA 2KFZA 4ZPAA 5DS7A 1HI1A 1AFJA 2IA0A 3UCZP 1U7LA 3DOLA 4IR1A 1R7IA 2PT0A 1FNXH 3DI6A 3H5SA 2MHNA 5L8RC 5EX0A 5C25B 2CZ4A 2XMJA 2DHXA 2ZKTA 1KVJA 3GE9A 3Q2TC 1NO8A 1N5TA 2CQ4A 3JSYA 2FY1A 2E1AA 5HBMA 3QMQA 1K8AT 1NK5A 2DHGA 2XMMA 1X0FA 3L3CA 4OZ5A 3MM7B 1VQMS 5KFIA 3WDOA 4CH7A 4PG8A 3TYTA 5F8HA 3CCLS 2OPRB 1VBXA 4IDKB 4Q45A 2JC0A 2M70A 3E8OA 4KE5A 1VQYA 3B8HA 4MKAA 4ZVHA 1SJ1A 4ZHRA 2MQOA 1LWEB 1SKRA 3HF5A 4B9NA 4IRDA 4IYQA 3LANA 4Q0BA 4O23A 3FQKA 1VQNS 1WHYA 2VONA 4GKKF 2D9OA 4Q43A 1DAXA 1REVA 2B9XA 4JI6F 3MURP 1F5BA 1RA7A 2A10A 1X4FA 3HPOA 1URRA 1LW2B 1QUVA 2JX2A 2DT9A 2YWEA 1OIAA 1IKWB 5KFAA 3M6WA 5J2MB 1U4BA 1HYSA 4GKJF 2R2RA 4I68A 2EI5A 4HL9A 4R5PB 2V4JB 4D3GA 4LF9F 3DM2B 1UL3A 1E6VB 2W25A 2BVZA 2MZRA 4M5DA 4HDHA 4XDCA 3KLFA 2ZJRQ 4DL6A 1XR7A 1T3OA 3CWJA 2FJDB 2BM0A 3OPKA 4USIA 4MFBB 4WU2A 3CDEA 2YWHA 1FDNA 3MUTP 1TL3B 4X4UA 5FDLB 2UVRA 2AJQA 1FESA 5DQHA 1H0HB 1RT7A 3O8WA 5HROB 3T5LA 3NS6A 4RW9A 5F0UA 4YFUA 4Q2MA 3UR3C 2D9PA 3TAQA 2KZMA 4WTYA 4JI4F 1FNOA 3CJKB 4BWMA 3LALA 2VG7B 2E1CA 5L1LA 1DURA 3HHLA 4I56A 2HHTA 4A8QA 5M2UA 2D74B 4RU2A 2NZ4A 3I32A 2LQBA 3KLHB 2HS4A 2O67A 4PKDB 2V4QA 2RVJA 4RW8B 4K0KF 2KM8C 4FF2A 3I9V9 3BO2A 1S9FA 4NCAA 4PWDA 2KG0A 5D4NA 3T1AA 1RT6A 1XEZA 1T05A 3TO8A 3OHAA 3HO1A 3QWUA 2ZVSA 1X9MA 3R5BA 2PC6A 2O01C 1LOUA 3UD4P 2UV8A 4PUOB 4OI4A 3CVKA 4DF4A 3D28A 3MWBA 2GGPA 2GIQA 2AGQA 1PSDA 1C1BB 1QSSA 4F2SA 4KRWA 1U1KA 2P9GA 4JV0A 2XCAA 2YTCA 3NAIA 5DGBA 1NJIT 4I2PA 1HNIA 1MNEA 1VI7A 4WU3A 3FQLA 4ZA1A 1FA0A 1L3UA 4NZ0A 1X4GA 4YB5A 2MZSA 3ZZYA 5L39A 4TLQA 1RKIA 2DNGA 2ZKUA 3LGNA 1DQ8A 3J7ZT 2RNEA 2HNZB 1KFDA 3SQGB 3SSSA 2XO7A 3MUVP 3KNAA 5AXMA 3R27A 1VQ5S 2QSFA 1LFPA 3AB4B 2DNRA 4DQPA 2IJNA 1WG5A 2C2EA 2UVVA 4JBCA 1HD1A 4ZKAA 5KFDA 2X1BA 5AE2A 2EG1A 1S1WB 4AQYF 2ASDA 3MGJA 2ASJA 5F8NA 3M8RA 1IR0A 3H4DA 4OJ1A 4DSKA 2JJ4D 2XLIA 1AROP 1JLCA 3VAGA 5JXSA 2AD9A 1BWEA 3RBDA 1LXJA 1R6YA 1H7XA 3OLAA 4F4ZA 2KYXA 4AYBD 4QU7A 4C9DA 1N5VA 1HW9A 2G0CA 3KLVA 4GC7A 3HZEA 3NG8A 3PW2A 2HGMA 4AXJA 3OTBA 3FRYA 1FKPB 1FERA 3GSDA 3I0SB 3T1HF 3NWGA 1CSJA 4DWIA 2M8HA 3GR1A 3MEGA 4YDXA 4IFYA 1SI9A 5EWEA 1X9WA 4P6QA 2NPIA 4C8OA 2W9AA 4KR0B 4J9KA 2FC9A 4A47A 2FLNA 3M2RB 3CCVS 4MH8A 1HI0P 1ZOTA 2EK1A 4TYBA 1NRKA 4K4SA 1U1OA 1HL6A 1LFWA 3I87A 3G6YA 1VC6A 1S76D 2MJNA 3Q23A 3GILA 4DV0F 1VJWA 1X5PA 4OI1A 3ENWA 1VS3A 3OXFA 1Z2ZA 5KFMA 3MMAA 2V0NA 2HVIA 4MAKA 4FZVA 4CCHA 2VPYB 1P9QC 3TA1A 3H4BA 2BZ2A 3RRHA 3NNAA 2B6AB 4ZCLA 4MK9A 3M2UA 5KFHA 3UW1A 1TV6B 3NCPA 1MMDA 4EFAC 3I96A 4JI7F 1S1UB 5KFJA 4LF7F 4I4BA 1KEKA 2CPFA 2QRRA 1XMQF 3RW7A 2F9DA 2KXHA 4I2QB 3QWPA 4N8NA 3GZ7A 3PHEA 4J9OA 3DOKB 2HHXA 4HVZA 2KO1A 4B9VA 4DG1A 2ABYA 2GX8A 1HQEB 2Q3PA 3T5JA 1K9MT 1RISA 2YVSA 5HO4A 2SXLA 4MIWA 4H4KA 3EZ5A 5DETA 1PGZA 4IR9A 3T5KA 3D0HE 3S6EA 1XMOF 3A8EA 4B3TF 3UI3A 4WZMA 2LA6A 3IXQA 4U6PA 2KT2A 2FIUA 3PKYA 3L95X 1IKXB 3G4SS 1J5EF 3KJVB 3OJSA 2FJVA 4DQRA 5KFNA 3CC2S 2WBMA 2EK6A 2XS7A 1N33F 2YNGA 3GG1A 3CDUA 2RF2A 5F8GA 3AB2B 4N56A 4DV1F 1NK9A 1M5PC 4H4OA 1LWEA 2HHUA 2ZH4A 3GG0A 3P6YC 1Z4UA 1Q7YT 1C0TB 2XMUA 3CMES 4AXIA 3GFYA 5B0AA 3ITHB 3IN5A 1WF2A 3MR3A 1U6ZA 2RRBA 1RTJA 3DLGB 4OX6A 1UVLA 1ZAXA 1GXTA 2OPPA 1N5YA 2G1DA 1R3NA 1JJ2R 2R7QA 4A48A 5D4PA 1M1KT 3MM6A 1KN6A 4EGLA 1DHMA 4BDPA 4X4OA 1FK9A 4WF9Q 2ZHOA 3DM2A 2DIVA 4PG4A 4EU0A 1LQ9A 1SIWB 2PE8A 4LSLA 3ICLA 4TY8B 1QLNA 1YJVA 3OTOF 2OSRA 1QUPA 4WXOA 2ZOFA 4RBTA 5HROA 3KK2A 1EP4A 2OJ3A 1S48A 3MEKA 3N6MA 5DQIA 3GWCA 1A7GE 4DSJA 2DNLA 1HNVA 2DNQA 2KXNB 3V81A 1XTZA 2DNZA 3CDAA 4NX9A 3T19A 5CA5A 2XC9A 2IVYA 3GMGA 2W4DA 1HI8A 2BRLA 5I3QA 3DMJB 4UW2A 1RT3B 1TKZA 2ZH9A 3HJFA 1ZZNA 3ZZOA 3V4IA 3RR8A 2K1RA 3PO5A 3J80Y 4J9SA 4RW8A 4QWDA 2B4PA 4ID8A 3H8YA 2FJXA 2HYIB 2JH3A 2YH0A 1LK5A 4TQRA 4B3OB 3U1LA 3SCJE 4DBQA 3GIJA 3K5LA 3RRGA 2FGOA 3V6HA 2LA4A 1UVNA 2OFHX 1U2FA 5A0YA 1JLEA 5DM6Q 3KHLA 2V2KA 3IS9A 3MPVA 2RQ4A 5CYQA 2DPJA 1E6YA 2JWNA 1KS2A 3AH6A 3IC1A 2DR8A 2EPIA 4K4TA 3HHLC 5D8HB 2IM2A 4RW4B 1YI2S 2HQIA 1JLFA 1HBMB 1CQNA 3I0RB 4PRFA 3PY8A 2MYFA 1BQXA 2CJAA 3DOMA 4HTIA 4F4KA 4P7VA 1N36F 5KT5A 5C24A 1HW8A 3V5RA 1CC7A 5GAEI 3SMZA 3G71S 4EBCA 2W8KA 1KHVA 1MMNA 1S9EB 1CQMA 4WE1B 2MY7A 3DXSX 5BJRA 4YR3A 2ZE2B 1MMLA 4CTAA 4DR5F 1SC6A 2F3JA 4YUDA 1Q86T 2JLFA 1HBNA 3RU0A 4NLSA 1FVQA 1IUJA 1TKXA 5D4LA 3N6NA 3PZPA 1GH8A 3CMAS 2CQPA 4U7UK 2J5AA 2E9RX 4W92B 3POTB 4PQUA 1XN9A 3OVSA 1IKYB 2BJDA 5D4OA 3GYXB 1N54B 4MK8A 3MZIA 2GV1A 4LSNB 4M8LA 3NBPB 1YJNS 3I82A 1FXLA 1SH0A 2QLXA 4QIFA 3BSNA 2CPEA 2Q66A 1JWWA 1OPIA 2VQEF 2XG8A 4X84A 1RQ0A 2PA3A 2N82B 1O51A 2OPQA 3VWSA 2XBPA 2BV3A 2XEXA 1VGYA 5DM7Q 3DCAA 2MHEA 3PDNA 2Z2MA 4P7TA 3I0SA 2JEFA 2GMHA 2QZ8A 2E1MC 2KT5A 4F4WA 1G3OA 4OX7A 3S8SA 2ZH1A 1DLOA 2IMOA 2HFNA 2W4CA 3C6UA 2A2DA 2YKAA 3GYNA 3IR5B 5IQ6A 2ZNYA 4EYHB 4WFXA 4I67A 3SI8A 1KLNA 3M2VA 3D1QA 4IO9Q 2P6TA 1HPZB 5DDPC 1U1QA 2ROPA 5CCMA 2XMVA 2CQ1A 2EFVA 4C98A 3PX6A 3MPYA 2MZQA 2I0XA 1HWKA 3QZ8A 3DDNA 3IGVA 1NH8A 3M4XA 2PI4A 3M1VA 5GAEU 4KHPF 1GTEA 2K7JA 1I94F 1JLGB 3DNCA 1R0AB 1H2TZ 4NPOA 4CZCA 3H2UB 4EEYA 2J6TA 2MKJA 4ILLA 4HH0A 3AQOA 3KLGA 1Q4RA 5KFLA 2OPSA 1RTHA 4ECUA 1U1NA 4NLOA 2ATLA 4ZP6A 5C5JA 2RDJA 4GMKA 2HMIA 2HHQA 3D1HA 1YRUA 4PG7A 5CYJA 1JKHB 5KTQA 4FVCA 4NLTA 1FRIA 1NU4A 3DDKA 1N0UA 2RUGA 3HVWA 4FXVA 3PR4A 1L3TA 2XI2A 2GMLA 5J2NB 4OHXA 4NCGA 3QAEA 4TLRA 2MB0B 5I3UA 3MFHA 2CPZA 2CDQA 2XGQA 4RUCA 1Q81T 4HI1A 3QAUA 5IT4A 3TUZC 2HW3A 3MTJA 1SKSA 3PNIA 3DRRA 3AAWB 4JI5F 2ZH8A 4F25A 4AL6A 4NA2A 3V6KA 2JRSA 2VG5A 3M6UA 3OW2R 1RWUA 3MDFA 5F8JA 5KG1A 3HVTB 1Q82T 2E5LF 1GX5A 3TVZA 3S7RA 3HHNB 2NS1B 1N4LA 1AXQA 4FYDA 2WSFC 3LH2S 4KO0A 3M30A 5E41A 2UXCF 3THPA 2APOA 1S97A 2KHDA 3KJVA 1F5CA 3CCJS 4X4VA 4RUHA 1KONA 2XWXA 2CJ9A 2YNHB 1R8BA 2IC3B 5GMKa 3K57A 3BQ1A 1XR6A 3CF5Q 3TUIC 1RT5B 2N4CA 2NPFA 4DFJA 2AU0A 1SUQB 4N8OA 2OH2A 2ACYA 2B5JB 5HMZA 2X1GA 5GAGI 1IBKF 1JLAA 3TA2A 5KFQA 3RZAA 1F60B 2XSJA 4K5SA 1VBZA 3UFCX 2OAUA 5F3ZA 3VALA 2EVZA 3DXBA 1DTQA 2QA1A 4L6V3 1M5KC 5A8KB 3RR7A 3M32B 4Z2XA 1R8AA 4ZCIA 2L41A 1S1VB 1QM9A 3M6XA 5DGAA 4ECSA 1UVMA 3BR9A 3Q8QB 3FSIA 2LXIA 4C3LA 1IBMF 3FSYA 2LLZA 4F2RA 4B3RF 1KLMB 3WBZA 4IOCQ 2MKCA 2VG6A 3LP0A 4O3QA 1RT2B 1QAIA 4F8RA 3I6PA 3KG0A 2KHCA 4ATNA 1FCAA 1VC5A 2ZOMA 1TVRB 3BO4A 5IM0B 2HNDB 3MD3A 4MIBA 4YB6A 3W2VB 1M90T 2NR0A 4DJBA 1XNQF 1KHWA 3HFKA 1T02A 5AXLA 4U7CA 4IFVA 4AFFA 2W7PA 2FVRA 4ECYA 1WD6A 3MR6A 2H5EA 4FS2A 5LT5A 2ZDPA 2ALZA 3U02A 3VQSA 2RILA 5T7LB 1KQFB 1YGYA 2GHVC 3LP1B 1ZM9A 5C42B 5J1EB 3GIKA 2J0WA 1U8SA 4ERDA 3SFGA 4DQIA 2BBEA 3G8SA 4ED8A 1ROFA 3VTIA 3NGDA 2PGCA 5DO2A 4EBDA 2C3UA 4NCBA 4OHYA 1JLQB 4OIXA 3BQ2A 3OL6A 1Q53A 3TW0A 2OTJS 4C97A 4QIEA 5J2PA 2FLLA 3MM9B 3BDPA 2NREA 1SV5B 1UMJA 2PIIA 4EZ9A 2CQDA 4Q7AA 1S9GA 4IO1A 2C2RA 5L9XA 2R9LA 5GAGU 1KQKA 1S4FA 1I1GA 3P49B 4RNMA 2GMJA 4DV5F 1M0SA 3KK1A 1RYSA 3OLBA 5K8OA 4PR6A 5F8MA 4DSFA 2DGQA 4NLRA 4J9NA 1Y7PA 5KFKA 2ZBCA 1RTDB 1IN0A 1X4AA 2YKNB 3LP2B 3T9NA 5LJ5Y 4F4YA 4NLUA 2ROEA 3NMRA 1UJ4A 3A1YG 4MK7A 3SDEA 3T3FA 2M88A 3GV7B 4IOBA 3TARA 3DYAB 4J5OA 3SCKE 2BM1A 4IG3B 2BE2A 5DDRC 1Y5IB 2ZZNA 1ZPWX 1GXUA 1BC6A 4UQTA 3V6DB 4CO2A 2CQIA 4ICLB