3D3CJ

Structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
LGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDDLMRLDLAAGVDVQISLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N utilization substance protein B
publication title Structural and functional analysis of the E. coli NusB-S10 transcription antitermination complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 20
structure length 85
sequence length 85
chains with identical sequence K, L
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3d3cJ00
4V1Ak 1IBLJ 2MEWA 3W1YC 1J5EJ 4DUZJ 2UXDJ 1I94J 3R2DJ 4DR1J 4AQYJ 2UUAJ 4DR5J 4KHPJ 4DV6J 4JI5J 4JI4J 4LF9J 3R2CJ 4DR6J 3JAMU 4B3TJ 4JI0J 2UUBJ 4LF5J 4X62J 4X66J 4KY3A 4JI2J 4NXMJ 1HNWJ 2E5LJ 2MTLA 5AJ3J 4YHHJ 3J80U 4DR4J 4JI6J 1N36J 5FLXU 3D3CJ 2UUCJ 4JV5J 5LMNJ 3D3BJ 4LF7J 4JI1J 4DV3J 4LF8J 4X64J 1HNXJ 1XMQJ 1N32J 4JYAJ 4GKKJ 5A2QU 4B3RJ 3J81U 4YY3J 1XNRJ 5IT9U 4JI7J 3OTOJ 2KVQE 4DV0J 1HNZJ 2HHHJ 4DV7J 4RJVA 4NEZA 1IBKJ 2UXBJ 4OX9J 2KL8A 4PWWA 4LFAJ 4DV2J 4K0KJ 4DV4J 4HHUA 5BR8J 4LF4J 4GKJJ 3T1YJ 1N33J 4LFBJ 1HR0J 3T1HJ 4B3MJ 2UU9J 1XMOJ 3J7AN 4DR3J 3IMQJ 5LM7E 4B3SJ 4KYZA 4DUYJ 4LF6J 2ZM6J 4NXNJ 1N34J 5IWAJ 1XNQJ 2VQFJ 4NEYA 1FJGJ 2MQ8A 4JI8J 2VQEJ 4JI3J 4DV5J 4DV1J 4X65J 2UXCJ 4DR7J 2F4VJ 4DR2J 4LFCJ 1IBMJ 5LMUJ
chains in the Genus database with same CATH superfamily
2FLLA 2QEXS 4B08A 1TL1A 4K4SA 1HWKA 1N56A 1FKAF 2UU9F 3PXGa 1SQFA 2DO0A 2LU1A 4B02A 5KFUA 4OHZA 4AL6A 1RACB 1FDAA 3NS6A 3M2UB 3DM2B 1AZSA 1SKRA 4X64J 2BM0A 3V81B 3FDSA 1L3VA 4NYZA 4CT8A 3LQVA 3RYLA 4J9UE 3OL9A 4KT0C 1TV6A 5KFTA 1L3SA 1NKEA 3MR3A 4RJVA 4KPCA 3DRSB 2ROPA 2V50A 2ZH3A 2EC0A 3W2VA 2XMTA 1VRUB 5KG4A 2ZE2A 3FBBA 1ZETA 1X4CA 5L1KA 2DJWA 4S0MA 3SYZA 2HNZA 4DX6A 4DR6F 4CYUB 2QSFA 1K9MT 4J9KA 3VAHA 2ZBRA 3DKDA 1IVZA 1N36F 4RNMA 4FYDA 2AJQA 4DZ6A 2MKJA 1BD6A 1DQ9A 4LREA 1Y11A 3CJKA 4F50A 1LXJA 3G8TA 1RT4A 3RB3A 4IDKB 4F0MA 2XYHB 2QZ8A 1E6VA 2OLWA 3S8SA 1NHKL 3N6NA 3BB5A 4YHHJ 2XLIA 4KV8B 3SXLA 4C48A 3MEEA 2Q3PA 3IS9A 4ZKAA 3MM8A 4RUAA 4P2XA 3MFIA 3BSCA 2O01C 2R7QA 1CQMA 5HN0A 2MLYA 5DGAA 2YNFB 1OS5A 1R0CB 1T03A 2UXBJ 4HKQA 4PG4A 3OFEA 2KL8A 2ZJPQ 2XMAA 7FD1A 2LMIA 2HKEA 2HMIB 2NYHA 4LRDA 2HURA 3BPSP 1N5VA 4HHHA 3M7VA 5AJ3F 1JJ2R 1JJHA 3KWMA 1SL2A 4KGVB 3K17A 2DHHA 3OR2B 1KFDA 1K44A 4QCLA 4R8UA 2B9XA 3IRXB 1JLQB 3LANA 1S6QA 3CO0P 2E44A 1HMVA 1DJ0A 1NM2A 4C97A 4KPYA 1EQ0A 1CG2A 1YBUA 3W9JA 2HBQB 5KFHA 2EKYA 2MHEA 1R0AB 1HR0F 4A8FA 3MR2A 4ECWA 3U1LA 2JLFA 3I55S 4DUYF 4C8ZA 2MMYA 4RNNA 2EKNA 1Y9OA 2X1BA 5KG2A 2C3YA 2J0XA 2H3EB 3GV8B 2OP5A 1VBKA 3WZ0A 2Y1LB 1WDDA 2HQDA 3WBZA 2H4YB 2CPZA 3PJXA 4OYZA 5DDRC 1PKUA 2N3OA 1DBDA 3MMAA 4X66F 1DFDA 4M5KA 3SDEB 2J8AA 4F4ZA 1KSPA 1NO8A 3BN4A 3LP1A 3I5AA 4F25A 3BDPA 3LP2B 3QFWA 4K59A 3I4HX 1AUSL 2DPJA 1UVNA 2K2PA 4FVMA 2QA1A 2O67A 2YWFA 2FD2A 1M5HA 3IA0A 2F65A 2D1CA 3H5SA 1F9HA 3DMJB 4O3QA 2X1FA 2FIUA 1KLMB 4DFPA 2DGQA 1S9GB 5HVFA 4MFBB 3D3CJ 4ENOA 4MIBA 3OHBA 1NJZA 5ETOA 4Z7YA 2JZ5A 5KG1A 1IR0A 3G6XA 2RRNA 3PYEA 3IR7B 4CO5A 3CJ5A 3Q23A 1HHQA 4KGXB 1J5EF 4ID5B 4RUHA 5C42B 3G82A 4DV2J 4OHYA 2DPIA 1S97A 4OL8A 1JLFB 2BANA 4A46A 1X8DA 2KFNA 2CFXA 2BXJA 2FQQB 1MLAA 3DOLB 2ZH4A 3KLFB 4FPRA 2DCLA 3V6HA 1RWWB 2BV3A 1FT8A 4KAIA 3TOQA 1NB7A 2KRRA 1XMBA 3DLBA 2Z2MA 2VPXB 3VAIA 1RWVB 1AFIA 4I1TA 4ZDNA 3X3UA 4V1Ak 2FTRA 3V6DA 3MAHA 3CCSS 4CO2A 2E1RA 4U7UD 1F6TA 4ECYA 2Z2YB 1EP4B 4LF9J 2XMUA 5F9LA 4CNYA 2ASLA 1U1MA 1HWIA 1TU0B 4NCGB 1ZZFA 4EBEA 1NCLA 2UUCJ 4JI1J 3HHLB 2LA4A 3BDEA 2B4VA 2G0CA 1HNXJ 5EX0A 2ZHBA 1C0UB 4FF4A 3NLCA 3I96A 3OW2R 3DN9A 4LUBA 1VR6A 2FJXA 3DOMB 2EC2A 2G2OA 2RVJA 1CC7A 4F3OA 2LDIA 2V4JB 4AQYF 4ZPAA 2VBZA 2HQCA 1BGXT 3CVKA 5GADU 2WTFA 1K0TA 3GFYA 1AW0A 4FPIA 4CM2A 1VYAA 4Y2IA 3QO9B 3MMCA 3QNWB 3IBFB 2RU3A 4UUXA 2CPDA 4IKAA 3OTDA 2DNPA 3CIZA 4YQWA 3RBXA 1YDLA 2WVDA 2DNMA 2CQ3A 4OX9F 1S1WB 2FVSA 2E1AA 3QGGA 2KXNB 3SI8A 3JSRA 2PA3A 4DR1J 2ZZTA 1VQKS 2Y3YA 1LEOA 4IUFA 2AYBA 2OEKA 4X62J 3MM6B 3H8YA 4ANEA 2QN6B 1OMSA 5KFEA 4PG5A 3SIPB 5DG8A 2G1HA 3DLEB 4KTQA 4RBTA 3MPUB 3X1LB 5J1EB 2HAIA 1FKOA 4NLXA 2NPIA 2E1PA 3DRYA 1N6QA 4ATNA 4UOCA 4F0KA 3BQ0A 3N79A 3FZBA 4WFZA 2A18A 2F8EX 3HK2A 4QR1A 4IFYB 3CT9A 2M70A 1TQLA 2R2RA 2NUUG 3BEGB 1CJKA 2FY1A 4HYKA 3TNVA 2GV1A 1NEEA 4LBHA 1NK0A 4F8RA 1WHXA 2V2ZA 2FGOA 4K4WA 2H1YA 4PG8A 2AF6A 3VWSA 1KFSA 2CIMA 2V8VA 2OPPA 2DR6A 4C11A 4YFUA 4KH1B 1YQHA 2VICA 3NXZA 1RAIB 1NJXA 7FDRA 1B3TA 3MAAA 3NGSA 1QUVA 2W7OA 1GMWA 4ZIWA 3M2RB 5D4NA 3AD7C 4F0HA 3L09A 5C24A 1URNA 1RTHB 2O5DA 4CLTA 1LFWA 5FLXU 2DH8A 4Q7AA 5AE3A 2IY5B 2IAJA 1IKYB 2UUWA 3R1LA 1UEUA 2WVBA 3OTOJ 2B6AB 2HZAA 4P7VA 2NREA 2Q6BA 2J0WA 2ATLA 4LRCA 2W9AA 2CQPA 2YPYA 5HVHA 1LWCB 3DGVA 4ZS6A 2CJYB 2ZNYA 3JYTA 3QMQA 1PJ7A 1HBOA 2XMWA 1FE0A 1KOHA 1L5UA 1M0SA 4O23A 4OLPA 5HQ8A 4PWDA 3QJPA 5F0WA 4JI0J 4V19X 3DDNA 3F0NA 2YX7A 1UJ4A 1YGYA 4TKTA 5HAOA 2UV8G 3G71S 1I51B 4DV5F 2VKRA 3C46A 3FFIB 3S7RA 5L9NA 1OSDA 1U1PA 3QATA 3THPA 1OY6A 1WOOA 4BLGA 1EQMA 1MWQA 2IHR1 4B3MJ 3OQ2A 3PFEA 3DLGB 2HHQA 2W24A 2D7SA 4PCQA 3QZ8A 5M2PA 2CKWA 2DT9A 3NMRA 3FJ2A 1UETA 4X4OA 1MU2A 2OPQA 4NZ0A 4H4OB 2FUG9 2VQEJ 1C4CA 1TL5A 1XIQA 3MTKA 5K8PA 1VI7A 3PNIA 4P2MA 4BC7A 2CJ9A 2MEWA 2WW4A 3GB0A 2ZOFA 4IQMA 2FVCA 3L9ZA 2UUAJ 2W4CA 4DR5J 1U6ZA 4UQTA 3W3SA 2I5JB 1FNXH 2DKOB 2ZBQA 4PPDA 2F40A 2MHNA 5DO2A 4ZCLA 1K0VA 3BBFA 1VIXA 5ETVA 2IMWP 1RWOB 1X5SA 3HULA 3RW6A 2YQ1A 4DR7F 2JJ4D 4JV0A 2WVCA 5LMUF 1Q5VA 1ZPWX 4USWA 3Q2TC 4MKVA 2HYIB 1IKWB 2J76E 1UAWA 1N33J 3BZQA 2GHPA 1S10A 4OZLA 3VGSA 2Q6CA 1B7YB 4C7QA 2RRAA 1JKHA 4LF7F 4WP3A 1GXUA 4LBIA 2YY3A 2CDRB 1TKTB 1P9YA 2HHHF 1M1KT 1S0OA 4C8NA 1CJVB 3NP5A 4LIWA 4RW9A 4E8UA 1WC0A 1V5VA 1HWLA 4DUZJ 2DNLA 5A0YB 2ZD1A 2KTQA 4C8LA 4USVA 2HNDB 2FLPA 2IM0A 2VJVA 3Q22A 5HL7Q 1YTYA 3V5RA 3W5XA 4JUZA 3CD0A 1FDDA 1RZMA 2FLOA 1UZHA 2XZDB 3NL0A 1MROA 2LEAA 3H5UA 3CC2S 3Q8SB 4WTYA 3MI7X 3G8QA 4DL7A 4B9TA 4Y0FA 1H98A 3I31A 1Q8IA 3TUIC 4QWBA 3UFCX 2GC8A 2BDPA 4ICLA 2GQ2A 4U7UK 3MEDA 5BYRA 2W2OP 5IOLA 1NHVA 4OX6A 2OTLS 3MECA 1UVLA 1NDLA 5IC6B 1LK5A 2M0GB 2G1DA 4XDDA 3T19A 2HZCA 2W9CA 1KNZA 2FHJD 3PHEA 3EPIA 2KYZA 5CYQB 4FKXA 2ALYB 3SCIE 1WOSA 4B3TJ 1WG4A 1YITS 2E7XA 3FSIA 3KHHA 3NAIA 2VDHA 1DQAA 4NLDA 3ISND 4LR8A 2ZBCA 2BE2A 2CPEA 2PMZD 3GYGA 2JEGA 1H3DA 1TL7B 3AFGA 1PAEX 5HJYA 2N82B 2NXUA 3VQSA 1NAQA 4HI2A 4Q44A 2V67A 5K20B 3ISNC 4FKYA 1T9UA 1GMVA 2V4QA 1KRPA 5AE1A 2P6SA 1U1KA 2YQ3A 1Z4UA 3I0SA 1S1UA 3CF5Q 2B4PA 2W9BB 1UCNA 3UCUP 4MKAA 2MKCA 1WEYA 3MMBB 3P45B 1HNIB 2CUYA 4NZ7A 1N34J 2KXHA 5CXTA 4G1IA 4KB7A 4LVOP 4JI8J 4P52A 3FMWA 3TA1A 1FRMA 1JK9B 1WI8A 1YRUA 2CQ2A 4CLSA 3M32B 5GAGI 2OD4A 2OO4A 1F3FA 1ZM4A 1J5OB 1PBAA 2DIUA 3T1AA 1S57A 1IWAA 2VG5A 1VHFA 2UXCF 3T9NA 1RHMB 5JUMA 3KLIB 1RJJA 3HFVA 1SUQB 4UY85 2R8IA 3K89A 1N52B 2DXDA 2Y8WA 1H2VZ 3NNAA 2N4CA 1NDPA 3AJ1A 2B5JB 2H5EA 1Q79A 4OYPA 2NXNA 2KFYA 4C0BA 3H0PA 2PFFB 3SV3A 2AMCB 5IM0B 4CLPA 4K0KJ 1CS4A 4XK8C 4F4KA 1VQSA 3D2WA 4WPAA 3T5HA 1HL6A 4M5DA 3BSNA 2FHKA 3J7ZT 2DNNA 4PABA 1QUPA 4OYMA 2YQ0A 1WWHA 4ES2A 3K8VA 4Y2AA 3SEOA 1LW0A 1Q5YA 2VC0A 2A6OA 2R2TA 3PZPA 1MWZA 1TL3A 2XO7A 1HBUA 4L3KA 2I38A 1LWFA 4A8WA 2PIIA 3ILOA 1T9VA 1QLNA 3SZ2A 4LT6A 4EYIB 1ZA2B 1I1GA 3KNGA 5J2NA 2C2ZB 3NCQA 4I6WA 4JV1A 3PR4A 4M5JA 2JNJA 4YN3B 3GFZA 4JI4J 3RRGA 8RUCA 4MKYA 1RT5B 4Y2KA 3KMSA 3DXBA 1BC6A 1WORA 1AXQA 1TTHB 3KJNB 5DLGA 1FFSB 3OTCA 4DG1B 4FS1A 1JLEB 2POKA 2WAQD 2XM3A 5IT9U 2QV6A 1X5OA 5ETLA 2A6MA 4HVZA 5HROA 1TL1B 1IJFB 2XZTB 2GVZA 4MKBA 4LF5F 4HDGA 4HR2A 4IO1A 1YLXA 3UI3A 3CJRA 3AD8C 3B82A 4M5HA 4WZQA 5GAEI 1K73T 5HMZA 3W62A 1AZSB 4CT9A 2O3DA 3ZNUA 2KG0A 3JSBA 4QW8A 2LEBA 2KO1A 4WZMA 2CZ4A 2D74B 2GO8A 4TNOA 1T3OA 4QJVA 4RNOA 2J6TA 2ZE2B 4C98A 3KUEA 2HNZB 3N6MA 1NK7A 5D6GA 2B7CB 5E2QA 2AJ4A 2DGOA 2LQ8A 4J9OA 2NR0A 2HS3A 2GIFA 8AT1B 2YNHB 4G1QB 4O4GA 1TUGB 5A2QU 1VQ4S 1Q82T 3J81U 2EG2A 4ZMMA 4OI2A 2KN4A 5G4DA 4F2RA 1YG0A 1E6YA 1UP1A 4B9VA 3G6VA 3TR5A 1HW8A 2OHDA 1HBNA 2ASJA 4A8QA 1VQ6S 3FK4A 5U47A 1DQ8A 1QAIA 1XK8A 1EETB 2VONA 5CQGA 1SIWB 3H5XA 2GA7A 5M2RA 1YJVA 3MM8B 3R8YA 1MMNA 3AJ2A 5A8KA 2IDLA 2BYCA 3IM8A 3L7UA 4WIIA 1T03B 5F8MA 3UWTA 4F3MA 2AEMA 3BJYA 1VISA 3TYTA 1NK5A 4E2FB 1S6PA 2CPIA 4DPWA 2VG6B 5EWFA 3LAMA 4YR3A 4IOBA 1JIHA 1LV5A 1S1VA 1S99A 2WRMA 4I68A 4R8UB 4Y00A 4RR5A 1FESA 2U2FA 2FB0A 3QGIA 1HMVB 3HHDA 2DR5A 1DY3A 2I6WA 1XERA 2W8KA 3A8IA 2XEXA 2DNGA 2XMKA 1I94F 3BS9A 2W4DA 8ATCB 3MF5A 1JLAB 4R0JA 1QVGR 2HVZA 2LQBA 3OVBA 3ENVA 2ERRA 3FVYA 4RU2A 2C22A 4NLUA 3W9HA 2Z57B 2BJEA 3MD1A 3WIVA 5LMNF 2IC3A 2EPIA 1HQ2A 3PJ9A 1TZ0A 2FJAB 3OUYB 5IQ6A 4JI7F 1S48A 3U1MA 2PA8D 3THTA 2GAGC 4X4NA 4CI0B 4B9MA 1FE4A 3K57A 2HHVA 3N5FA 1KVIA 1R6VA 4DV6J 4JI5J 2FJWA 2COLA 3KLEA 3LP1B 2XZWA 3UN2A 4JI6J 4XIUA 1HD1A 1WTFA 1KHWA 2YTCA 1L3TA 5KT5A 3U27A 1UVMA 2IRUA 3D7SB 5L9XA 3R6GB 1U1QA 5HLFA 4JV5F 1KVKA 1S0VA 5ETMA 3GWCA 4Y65A 5AXNA 1FKPA 2IM3A 1SVDA 3BH6B 5LM7E 4DFMA 1TVRA 5LSLA 4NMXA 3DOKA 2VQFJ 2ZWOA 1F5AA 2XHWA 5ADZA 4QWDA 3QPIA 4QIWD 4JI3J 4Q8EA 2P5VA 3CEDA 5KFXA 4UOFA 3CCJS 3KLGA 2DH9A 3ET6B 5ITHA 4M94A 2L48A 2FJDB 1HQEA 2ZKTA 3FEYB 3NY0A 4ZP6A 1FFGB 4ED0A 1W26A 2J8SA 4B9SA 2BANB 2ZWPA 5GMEA 2HEKA 3ISZA 2G2ZA 5FJ4A 4XO0A 1T94A 5CYMB 1XN9A 4HACB 3GIKA 2QLJB 2V6AA 5CZXA 2OPSB 5C25A 2DR9A 4LF8J 1IXKA 5IT4A 3N6LA 2Y1RI 1U6FA 3BO2A 3CCLS 2F1FA 4OZ1A 2GMLA 3SCLE 5ETRA 2JDJA 1UJ6A 3V6DB 2ZC3A 2XTJP 2XS7A 3BSAA 1PGZA 2YWKA 4WK1A 1H2UX 1JNZB 1SV5A 1JLGB 5B09A 4Q2MA 3FQKA 1KS2A 5FD1A 3I82A 4JYAF 3KK1A 1HNZF 3NG8A 2AZ3A 5A76A 1EZZB 1VFJA 3G96A 1IBLJ 2KHCA 1KTVA 2QL5B 1UFWA 2L08A 2DR7A 3QRRA 5C7PA 1BMQB 2BE9B 3MM7A 1AROP 1ZS6A 3VAMA 2IJNA 3K5OA 3QYYA 3VTIA 5JVGQ 3LPEA 4LSNB 1ZOTA 1NJYA 4R25A 5E0OA 2HK3A 3R5GA 3PW0A 2YH0A 4LR9A 3VAGA 5I3PA 4PXBA 1SQGA 5B0AA 2FC9A 4L76A 3T1YJ 1BE4A 5DG7A 1EJ7L 4P6QA 4ZLJA 4ZN1A 5EHHA 3QRPA 4L75A 2MZTA 2V2KA 4DHVA 3HO1A 2RS8A 5D4PA 1W25A 1U4BA 3PW4A 3Q0AA 3FEXB 5EUHA 3PRBA 4AXJA 3CMQA 2MGZB 1CJKB 2HS0A 2Y0BB 2XYPB 3RZAA 3OSNA 3T1HF 2W7PA 1Y10A 4ZK7M 2ZUAA 2L9WA 1J27A 4KY3A 4JI2J 1K1QA 2PGCA 2OMOA 2J7UA 1X4EA 3VAKA 3AODA 4ZLLA 2OPPB 4C11B 3ZTOA 5D0HA 1WHWA 1FERA 2E5GA 2F4VF 1FVQA 1O6XA 2KHDA 3Q2SC 4KHRA 4KFBA 2E1MC 2WOMA 2UZAA 2XSJB 4LFAJ 1UL3A 4C6AA 4DFJA 4NLOA 3PX4A 1PJ6A 2X3DA 4J9MA 3M2VA 1RWUA 5C24B 4J9NA 3BGRB 3TO8A 3RRHA 1Y5NB 4P75A 5HP1B 2PMWA 3L4BC 2V63A 1HBMA 2D3UA 2DNQA 1IBMJ 4QPXA 4O44A 4ZP8A 3TJ8A 2FVPA 2QIFA 4I0WA 2XLJA 1Y4ZB 2UV8A 2KFZA 2DRAA 3M8WA 2J9EA 4TU7A 1U0HA 4DF8A 4BCAA 3JYTB 1AYEA 2NSBA 2QFIA 3T6BA 4DV3J 3US5A 4RNFA 4OJGA 2JH3A 3V6KA 2HPUA 5KT2A 1BQNB 4H54A 4KC5A 5KT7A 4F67A 2R8HA 1RUSA 3I5CA 2N7YA 3CDEA 2C2OB 1NB2A 2GJFA 2ZOGA 4CM0A 1JLCB 4J7CA 3OL8A 3S6EA 1SJQA 3F73A 3W8PA 3FKBA 3CPWR 5HK4A 1SCJB 2ACMA 4X64F 1XNQJ 4TY9A 2MLXA 1HHTP 4I7FA 1LW2A 2AJFE 3Q24A 3MM9A 3OFFA 1S77D 3T6JA 1WC6A 5FLXY 1H7WA 3TANA 3KMQA 4I6YA 1UWAA 2KT2A 2YKPA 2FHJA 2M8DB 5LOQA 1Y00A 4KH0B 2BR0A 5KOWA 3AB2B 3MOZA 1F1BB 3M9MB 1MU2B 2OPQB 5LSOA 1CSJA 2WSEC 1B7FA 3TAMA 4BHQA 4FS2A 5EWEA 2KB2A 3D67A 2AKWB 4ECUA 4EU0A 1I3OB 2KT3A 3HX9A 1YI2S 2YNGA 1QSYA 2OGUA 1MNEA 2NZCA 1NDKA 4YHHF 3KNAA 4AXIA 2ILZA 2B3TB 2CYYA 5HMXA 2I0XA 2MQLA 1D9DA 4TYBA 1OJ4A 4HTJA 2OFGX 2CJAA 2LQ9A 5L1LA 3V4IA 3DU6A 3VGUA 1S1XB 2Z58B 1FRHA 3ZZOA 1U25A 2IPOB 4UY8T 4RPFA 2UXBF 3M6VA 1VC6A 3W1YC 1T9WA 5HBMA 3IFEA 2DYAA 3OFGA 1KD1T 3OLBA 3KG0A 3CXCR 4URQU 1P6TA 4K4ZA 1FCAA 3IBCB 3G8SA 2KZMA 2Z56B 1VDHA 4ILMA 1HIYA 4I69A 3T5KA 3KUHA 1R8AA 4WFYA 1QSLA 4B17A 1G3OA 5IC4B 5D4LA 5IV3A 4RW9B 3H5YA 2D9OA 1XWLA 4GVBB 2FDNA 4ES3A 3P8BB 4P10A 2JC0A 3C8YA 3HFZB 2E9RX 1VQNS 4TLRA 4RO0A 2ZH5A 2BUNA 3TX0A 1JJCB 5D77A 3T9ZA 4ECRA 2DXFA 1N88A 5M2UA 1G2EA 3M8QA 3DRRB 3MR7A 4I56A 1X9MA 2F7VA 2Z8QA 1WC3A 4ZP9A 1JMTA 4I67A 2GAHC 2HHPA 2VODA 4B9LA 4N76A 4F4XA 3BR8A 1RB0A 3PG9A 2C2EA 3JB9k 1U0SA 4CH7A 3RGIA 4DU7A 1T8EA 4B3OA 3VAFA 5K8OA 2PO4A 3AA8A 5J2QA 1XMQJ 2QO3A 5A8RA 2LU2A 1FK9A 2B43A 1QY7A 1EIYB 4NLGA 3R6LB 3SSQA 1RT2B 2LXFA 2XO6A 2FJBB 3AH6A 4LF4J 1V9OA 2A3JA 3DLHA 3M4XA 3PX0A 3OFHA 2DY9A 4DU8A 4WE1B 4C8MA 3IGNA 4LF6J 3O8WA 1M1GA 2O1PA 2BE2B 2VBYA 3BR9A 3CWJA 5RUBA 2HFOA 1MSWD 1S5ZA 1NK6A 1NJIT 2DNRA 1RT6B 4WFXA 2PFDA 4FNHA 1GAOA 3DCAA 4DV2F 2AU0A 5KG7A 3OL6A 1Q4RA 3ILIA 1VRTB 1P9QC 2K06A 3I0SB 3HD2A 2DHXA 2P9EA 3A3NB 2UUBJ 3CCZA 1VIOA 1FWKA 4CWBA 2W2NP 2RHSB 1TL4A 3FNNA 4QU6A 2LDYA 4WFNQ 4IG3A 4ED7A 1SKSA 4J9VA 2IRYA 1PC4A 5B0CA 1W2IA 4Q0BA 3WX4A 2D41A 2GIRA 2ZOMA 3H25A 4CH1A 3GLJA 4AD6A 4LIRA 2PC6A 4OLOA 3HPOA 3R5BA 2VG5B 4LF9F 4ZVGA 1VCTA 3TRGA 3KK3A 3P4UB 4NCBA 4NA1A 3FBFA 1FRJA 2LFVA 2XG8A 1ZM2A 3Q86A 4PQAA 3KDNA 4AFFA 5T7LA 4JI1F 4USTA 4G1PA 1HNXF 3C6UA 4NCAA 4WFAQ 3BV8A 2ROGA 3PFOA 4TY8A 3CJQA 2ROEA 3QRQA 4ED6A 3ZTRA 2XCAA 3L7PA 3SCKE 3CC4S 2W7AA 2PI5A 4ITSA 3GU0A 2E5IA 3VGVA 2XLKA 3M9NB 2B8QA 2R2UA 1HWUA 5GAHU 4USJC 4Q5VA 2PDAA 1S6UA 1TAQA 3Q8YA 4R5PA 4N56A 3PRVA 4K50A 4DPTA 3BH7B 4ERDA 2KT5A 3HVAA 3MCSA 3GPAA 5DM6Q 4LMZA 4ZJLA 1TL3B 2HFUA 1CULA 3NS7B 5HQLA 4WYLA 3VV2B 1RXOB 2VUGA 4OJ3A 1LOUA 1KVJA 4TQRA 3OR1B 3PM9A 4DFKA 2DHSA 4DR1F 1VQYA 1ZH5A 4ED2A 4HHUA 5BR8J 4GC7A 4FXDA 4X62F 2JLEA 1R8BA 2HFNA 2VFUA 4JV2A 3DRPA 2EWHA 5K14B 1M5VC 2HBZB 3IMQJ 3K5PA 3LP0A 4G6VB 1R8HA 5F3TA 1RHUB 3GR1A 3ETMA 4OI4A 3E01B 3UDVA 3C14B 1ZTTA 1AUDA 3GJSB 4DI6A 3LGMA 3OHAA 5HROB 1S4EA 2OJ3A 4I64A 1K8AT 3N0VA 2C1EB 1QTNB 2GVZB 1WNEA 2HHTA 2HWIA 3C6TA 1NUEA 1FRIA 3B6BA 4YP3A 1KEKA 2ZEJA 3DRSA 2BW2A 5C2CA 4NA2A 1VRUA 3IG1B 5D0RA 4A8KA 3FSXA 4DSLA 2RIJA 2BVZA 3GIRA 3T5JA 1ZYQA 3DHWC 4GRSA 5B0EA 3CULA 2ZBIA 2ABYA 2KKHA 2YKNA 2HRTA 3ICLA 3OJUA 1UMJA 4EMDA 4DV7F 1RWPB 4IDKA 4DR3J 4ED1A 1VLOA 1ULRA 2EK1A 5I4MA 1OIAA 2QMUB 5I3UB 1FDBA 5GADI 3OTOF 3IWNC 3TAQA 4PG6A 4N5SA 1E6YB 2M9KA 1W7WA 5KFKA 2HQ3A 1FO1A 4QIEA 2JWNA 4IR9A 1RDRA 4G65A 2ZHAA 1ZAXA 2AEFA 4C0OC 3A1YG 4NXMJ 1X4BA 2MZ1A 2ATCB 4NX9A 1PO6A 5IT9Y 2Q43A 3VVTA 4J37A 1D8YA 1Y5IB 3UQSA 3IN5A 2BX6A 4F4WA 1XNRJ 4P2SA 1FEEA 1NK4A 1RTJB 5J2PB 2DHGA 1TELA 1B0PA 1VQPS 1QDUB 1S6PB 4JI0F 3KLHA 3IRXA 3M8SA 5ETTA 1S1VB 1H0HB 4IH7A 1MN7A 5A8WB 2FLNA 3V6JA 3KOAA 4K2JA 1T7PA 1U7LA 3W2WA 1D9FA 4K8RA 2FVQA 2I2YA 1WEZA 4UOHA 1URRA 2FYXA 4NLVA 2AJ2A 2IMOA 2RJZA 4DL2A 1UVIA 2PEHA 3KXDA 2JOQA 4B3MF 1DURA 5EX3A 1Q1KA 1Q8BA 1I5OB 2CQHA 4C3LA 5A2QY 3J81Y 2IC3B 3UR3C 1Q78A 3DI6A 4TXSA 2G13A 2CJKA 2KRBA 3AHPA 4OX7A 2VQEF 1N32J 4DL5A 3D1QA 3BSOA 3DGPB 1HA1A 5E3QA 2BQRA 2RKIB 3SDEA 4BS2A 4FNIA 4IO9Q 4O0NA 4LRBA 4CLKA 1TUWA 3DLKB 4N8OA 4QQBA 4WWSA 2UUAF 5BYSA 1VC0A 5IZHA 3LP2A 4HDHA 1F9FA 4WFBQ 3KTQA 2WVFA 4KJIA 4DL6A 5J2MA 1WF1A 2PD1A 3KLEB 3HZEA 2DK2A 5IT0A 2XY7A 1FRXA 3RG6A 1VS3A 2P9CA 2YWGA 4RW8B 3RB6A 2XI2A 2EEYA 2D3O1 2JEFA 5DDPC 3CJSA 1N5YA 3UCGA 2QLFB 3K7RA 3KJVA 5HLFB 3CD5A 2XY6A 4ID8A 1SKUB 2GGPB 3G4SS 3CD7A 2MZSA 3O44A 3GIIA 1FKPB 5IXUA 1SXLA 4CLZA 2W2PP 4BWMA 4IG0A 2Z2LA 3R7NB 4LF1A 1GQEA 4ID5A 1TP7A 1VQOS 4DQRA 3Q8UA 1XBWA 1GX5A 3ILJA 1IJEB 1NNDA 1NPKA 2ZBPA 3D0GE 1HPZB 1TFYA 3KLGB 4RZRA 1SC6A 2NLWA 3J7YU 4DUZF 1KC8T 5IS2A 3A4TA 5F8JA 4NLQA 3CCUS 1HQEB 5B0GA 3PACA 1RAEB 1ZZNA 5J1PA 2GVDA 4MK7A 4WJBA 3D66A 3KDOA 2WB4A 1U24A 3FCVA 3O5TB 4ZVSB 1L3KA 3C16B 4USUA 1C1BA 4LQ9A 2QRRA 5DM7Q 3UD4P 2QTWA 4X4TA 1Q86T 4IRCA 1Y7PA 3W61A 4J90A 3GP9A 1EP4A 4TN2A 2UXCJ 3HFKA 2RMLA 1WG5A 5F41A 4BBYA 2WK4A 3CJTA 4OI3A 2O66A 1REVA 4DOZA 3PEHA 2YPZA 3KJFB 4DPUA 2VG7B 1VBXA 1SV5B 4J9PA 4GO7X 2HZVA 3OTBA 4Y3CA 3J80U 3NNCA 1IN0A 4A8SA 4M5GA 3DOMA 3AOCA 4KKOB 5D3GA 2MQQA 2XB2D 1ZM9A 2V4JA 1IR2A 3M05A 1IQTA 1KOOA 5L1JA 4DCPB 3QLHA 9RUBA 1TKZA 3N01A 4IFVB 3OXLA 5EWGA 4GC6A 5JJBA 1H7XA 4UUWA 3QO9A 4J9RA 5L38A 4B3TF 4WP8A 4Q2LA 3CCVS 4PUOB 1M1HA 1D9AA 5E33A 3VCDA 4PEOA 4HT7A 4P2FA 4KBIA 4A4JA 3DC2A 3ZFVA 4IRDA 2VH7A 2IA6A 3T3FA 5IQQA 1M5KC 2RNEA 1H38A 4LSLB 3MM6A 3IWXA 1V6HA 1F5BA 4K4YA 4AE5A 3QWUA 5L1IA 1Q53A 1EB0A 3DLEA 3NAHA 4DQIA 5FDLA 4KHPJ 1APSA 1ZPVA 3CB4A 4L74A 2R7UA 2C3UA 3MAQA 1FTRA 1U2CA 4DBQA 4FDFA 5H9EK 3RR8A 3QIPA 3R5AA 4F3QA 3OVSA 1ELOA 1N34F 1NMEB 2QMWA 4JI8F 1M90T 3D1OA 5B0FA 3CJ4A 3I9ZA 5KFQA 4AL7A 4X4QA 2IBKA 2G2YA 3TA0A 3K2YA 9ATCB 1D1UA 3U7JA 1X9WA 1Q95G 1VMBA 2N7CA 1FJEB 1T95A 4GVLA 1LK7A 4X4PA 3UDLA 4P7TA 1WUUA 3RAXA 4OJHA 3THVA 2L3MA 4UZBA 4R0EA 1KQGB 1F3VA 2C3OA 3H2VE 3QJLA 2HNYB 2UVRA 1TK0A 4KFBB 1RTIA 1RTHA 3EGVA 2CWKA 4K0KF 1P8GA 4K4TA 2MB0B 1VBYA 2DGXA 3KLVA 1IKYA 1IWGA 1FX4A 1HWJA 3M2VB 5LXRA 2E5LJ 2B6AA 2VV5A 1OY8A 3H40A 4EZ6A 1LWEA 4MMOA 3D4JA 2VBWA 3E2EA 3BO4A 1SQEA 2WSFC 2ZNZA 4OZ3A 2LYVA 3NCRA 4O44B 1IBKJ 4LQ3A 3TARA 4OZNA 1RGVA 1RYRA 1GTEA 3C2PA 4JI4F 3O3LA 4QIGA 2ZH2A 3M6UA 2M3DA 1S7IA 2R7WA 3JAMY 2UP1A 3JQMA 3A8KA 4LFBF 2EBGA 3EE3A 3IC1A 2OH2A 2HQGA 4DV1J 2B8PA 3T41A 3F44A 1RT1A 3M9OB 2HVIA 3MD3A 3KYLA 1QAJA 1NK9A 2L9NA 1DARA 2MPUA 3AJDA 4CIOA 4EZ9A 3QAUA 1Q81T 3QT5A 3VF0B 3HF5A 4C0HA 2HK2A 2RT3A 1HNWJ 4F36A 4ZPCA 2YXLA 2WB1D 4UOGA 3L3CA 4F26A 5D8HB 3IRWP 5EN1A 1O8BA 2BW7A 2HAFA 5IV4A 1U48A 4I7FB 5KFPA 3MM5B 1S12A 3TJAA 1RBOB 4FYWB 2Y8YA 1G1XA 3JSYA 4M1KA 1JWWA 2DGTA 2PN6A 1C0TB 4O3NA 2CPYA 3H59A 3RBEA 1VQLS 3V4MA 4C8OA 1X5PA 3BPDA 2YKMA 3RBZA 4LJMA 3MEGB 4B3SJ 4CRJA 2V94A 4NXNJ 5HMWA 4K5SA 2ZJQQ 1U6BA 2CNNB 4M63A 2E1CA 1Q16B 3TAMB 1Z2LA 4MIAA 4DR2J 1HFEL 3D5MA 1WD6A 3GIJA 1JX4A 1P1TA 2RUSA 3EX7B 3GCXP 5MAOA 4OJ1A 5CYJA 3GYNA 1S0NA 2VC1A 1NSPA 2CZ9A 4N7TA 3EXCX 5CA5A 4JV5J 1IKWA 3SMZA 3H4DA 3LO3A 2BRKA 2X7IA 2YBVA 5HVGA 1NXIA 3HT0A 1IKXB 2RF2A 1BLUA 3TVZA 5HBMB 1PSDA 1F60B 2XS2A 3PEJA 1CJVA 4CTAA 3MUVP 5HATA 2BOAA 3VALA 1T11A 1N0VC 2JSXA 1NSAA 4DN0A 3DYAB 4NEYA 2KI2A 5I42A 4OX8A 2HRYA 1U09A 1TAUA 3G6ES 1SBRA 3JSMA 1LKZA 4OV6A 1B70B 2Q66A 1P1LA 3U02A 2AT1B 2YX1A 3HP6A 1QSSA 2WONA 2KJVA 3MHYA 3CJ8A 2UVWA 3KK2A 2K3IA 5E41A 3LAKA 5JVHQ 4B3RJ 4KGMA 4NA3A 5DQHA 2CPXA 3BN7A 2OI2A 1YX2A 2GFFA 3P3DA 3DDKA 4KO0B 5F8HA 5IFMA 4PWWA 1CJTB 3LGNA 3GJQB 4JI5F 3WDOA 1GXLA 3NWGA 2IM1A 1C1CB 3KG4A 4ZN3A 4OYXA 4LBPA 4ZPTR 2CA9A 1SL1A 4E0DA 2XBPA 4PG7A 4ZVOB 5CYQA 3BYRA 5KOXA 4MAKA 3UPFA 2XNRA 2JLGA 1WTBA 5A8RB 2HFVA 3H98A 4RBVA 2DNYA 2Y0SD 5KFOA 4FBUA 2OMLA 3IR6B 2V8HA 2ZZMA 2CXEA 1TL7A 1ROFA 1U26A 4J9SA 1S7HA 3PO5A 1R0BG 1XTZA 3OL7A 1IUJA 2DB1A 3ZTQA 4Y6IA 4F4AA 2VQFF 2H48B 4JI3F 4F04B 2KJWA 2YH1A 2EFQA 2FY8A 4ZPVR 3JTOA 2XCPA 3BGFA 3S01A 4CO0A 4AL5A 2JEIA 3OVAA 4ZPWR 1NH8A 2FVRA 2HSEB 2RDJA 3GG1A 1LQ9A 1HNIA 4DV4J 5KFMA 3D28A 1HI8A 4YUDA 3UD3P 4DSKA 1IBCB 3TEGA 1WF0A 4F02A 2LECA 2CPJA 4OYOA 4IG3B 2B51A 4LF8F 2F5GA 1VQ8S 3RJMB 2VA3A 2R42A 3PW2A 2KVIA 2IFXA 2FZCB 4Q0BB 1SUQA 2MKKA 2BEFA 2GJ2A 5ETPA 4UTGA 1NPPA 2AWZA 2FZGB 4HHJA 2DVIA 3BYPA 3TP2A 3DFEA 3R2DJ 3U1NA 2QL9B 1S9EA 2B5JA 3KK3B 3D6TB 5J1NA 3I5BA 4Q45A 1S4FA 2GQCA 1KLNA 3D0IE 2EVZA 3I87A 4CO4A 2NXJA 5T7LB 3BREA 2LVWA 3ZXWA 2QA4S 2MLZA 1WACA 4JP8A 4W90B 3UD5A 2V9WA 2DGWA 2KM8C 4NL5A 1IBLF 3NGDA 1A9NB 4ZVUB 1N8RT 5G0RA 1X4DA 4K5RA 1FF2A 1V5IB 3CD6S 1SJRA 1SJ3P 5KFFA 1YJRA 2CWXA 4B9UA 2B9EA 5HSPA 3SQGB 1AA1B 5C5JA 5EGYA 3DU5A 4C4WA 4RX6A 1U8SA 3MPWA 2F63A 4BC9A 3M30A 2CNLB 1WKJA 2I9SA 3FC9A 4LR7A 2ADCA 3C15A 4A8YA 3FQLA 3CNQP 3R7SB 2R7SA 1JXLA 1M5OC 2QA2A 3T1YF 2KZZA 4BWJA 1HNVA 4DG1A 2NZ4A 3DRPB 2BA9A 4WP9A 2OEMA 1U1RA 3A3PB 2WZ1A 3LP0B 4DQSA 4DL4A 5CCMA 1YJ9S 4DLEA 1T0TV 4K2XA 2P8IA 2DISA 3MWBA 2HW3A 5KFCA 1GEHA 1RYSA 3LOUA 2EW9A 1G6BA 2CQ4A 1EKRA 3EXYA 3RB0A 2BQUA 3CDBA 4IOAQ 4GMKA 4NZ6A 3HVWA 1X4GA 2XHCA 4ANDA 4JI2F 3C6TB 4NLWA 5E5NA 5DRKA 2XYGB 2ZH8A 1PYSB 3MR5A 3A8JA 2XMVA 5BJRA 1DLOB 4IQXA 1FJGJ 2J6SA 4FF1A 1GXTA 4IRKA 1QE1A 3HSZA 4LFAF 3HVTA 2YNHA 4G1QA 2YKNB 4RW4B 3NMAA 2WBRA 3BKUA 4P72A 4M5MA 1A7GE 3CC7S 4QWEA 4CO3A 1WSRA 2M7SA 2QLBB 3UW1A 2OEJA 3CE8A 3QT8A 2K7JA 3LW5C 5DGBA 1SJFA 1IBMF 4QPTA 1U1LA 2CG8A 1EETA 3ZZZA 4PQUA 3FGVA 2JHEA 4OQJA 1T05B 3MPYA 4I2QA 2NSCA 4OHWA 3OJSA 5F8GA 2APOA 2J7WA 1PYOB 4ETXA 2H54B 1UW4A 5A6PA 1DTQA 2ZKUA 4MIWA 3GFHA 4A8XA 2L41A 5K8MA 3M8YA 4DV3F 5KFIA 3OLAA 4KR0B 1WC5A 1R6YA 1CVJA 3UCZP 4DX8H 2VG6A 3AQPA 4OZ2A 1HI0P 5D4OA 4KSEB 3VZHA 3KLHB 3EGWB 4JB8B 2V4RA 3EPGA 1MWYA 3ENWA 1F2GA 3J7Z5 3FCWA 3HLUA 3LWMA 4RNHA 4PWUA 1VK3A 3R5CA 1KQFB 4WCEQ 1XNQF 2MQMA 3D0HE 4ECVA 2DNHA 3E8OA 1H72C 3W2WB 4ZVTB 1JLAA 3K5LA 1KQSR 2OAUA 2GQQA 1OYEA 4WYWA 2DGSA 4TVAB 3IAM9 4YR2A 5CH7B 2CQIA 5D15A 2OPRA 4U95A 3MOJB 2HHUA 3OUYA 4MK9A 1TV6B 4ZCIA 1SIZA 4M5IA 3W2VB 3GV5B 4DSEA 3DI6B 1YJUA 5KFNA 4FZVA 4J5OA 3KG1A 2CQCA 4LSZB 4Z7CA 3I32A 2QE5A 4EBDA 4H4KA 4DWIA 4KGZB 4OZ0A 4M5NA 2BJ8A 1XC9A 2DXEA 4K4XA 2PSZA 5ETQA 2MSSA 3SSRA 1ACMB 1SH0A 2RDDA 3HVRA 1NZ8A 2HQFA 4P73A 1WHVA 3CJKB 3RBDA 2MYFA 2J9DA 1SI9A 5J2MB 4CNZA 2R7RA 1RT4B 2DTJA 4YB5A 3BQ2A 1VGYA 4BDPA 3IP0A 3MMJA 1E6VB 3PDNA 3EDRB 2RU9A 4WXOA 4QWAA 2YWEA 4PZVA 4N8NA 1LWXA 1UW9A 4GKKJ 1N5YB 2RQMA 3HDSA 3KJVB 4DV0J 3RR7A 1QVFR 5KFGA 1OPZA 2LQ5A 2CADA 2FC8A 4O3PA 3MEEB 3IS9B 3NEKA 2YX4A 1M5PC 2BMBA 3PY8A 3N9UC 1RTZA 1U2RA 4DPYA 1HQUA 1YIJS 4OHXA 4IG0B 4U7CA 3ET6A 2ZM6J 1D8ZA 2M52A 2K1RA 3I0RA 1S1TA 3FEZA 4QR0A 1EKSA 1NSKL 4X65J 1UKUA 3CDAA 4ILLA 2AEJA 4NLYA 2Z2ZA 4LFCJ 1VHIA 4C8KA 5CYMA 3TAPA 4HACA 4DS4A 4OZ5A 1LNQA 1TK5A 4O0IA 2CNKB 3AXMA 2OPSA 1CQNA 1S6QB 4ZHRA 4RL1A 5HMYA 5DDOC 4ES1A 1JXVA 2BJ9A 1KR4A 2GVDB 4UW2A 3CCWA 4RW6A 4U8YA 1FA0A 2V69A 5DQGA 4F2SA 1RQ0A 1C1BB 2UUTA 1NH7A 1RHKB 2WHOA 1CBKA 1HHSA 3HM9A 4NLPA 3CSKA 1F5CA 7AT1B 2ZDPA 3NCPA 1JLGA 2R7XA 2A2CA 1RAFB 4B9NA 4O3RA 3QQCD 3G2XA 1REVB 4QR2A 5KFBA 1XJWB 5KFJA 4USHA 2CNOB 4NWBA 1REGX 3FRYA 3EDQB 1IKVA 4ED5A 3WC2A 2DRDA 5H1SV 4RBUA 2VZ9A 5D3GB 3GILA 1PILA 4CH0S 2N4DA 4ZVRB 1XMQF 2CG4A 1KTQA 3MMAB 3QLHB 1RKIA 1TKZB 3ADAC 4X4UA 3ZZUA 3DHXA 2EFVA 3GFXA 2XY5A 2HS4A 1IM6A 1RU2A 5HO4A 4LF4F 1RT7A 2HWTA 1QD1A 3UVJA 4PXEA 4LSNA 4LF6F 2AZ1A 5T14A 2ZC4A 2XMJA 2HFSA 2W4PA 2B9YA 3AQOA 1UFKA 4L73A 4DQQA 1YK9A 1S76D 3CJ2A 2IBOA 4XTTA 2RS2A 2G9OA 4A8MP 3D54A 1WF2A 3ZZPA 2FGCA 1TK8A 3NOCA 5ETNA 2R7TA 5GMDA 5FDLB 1XEZA 1R7IA 4FYYB 4GKJJ 4RW7A 1HYSA 1N4LA 2H4WB 1ZM3A 2UUBF 3ITHA 4HTIA 4HH0A 1VLYA 1KN6A 1QM9A 5KT3A 1N5TA 2NUHA 1VK8A 4KGKA 4KYZA 3QIPB 2V68A 3G82B 2NXCA 2UVVA 2MGZA 2AP6A 1H2TZ 1MMDA 3PKYA 5KT4A 5DDQC 5LSRA 4FVCA 3DNCA 3TEHB 3ZTPA 2BQ3A 2FHMA 3ZZYA 4OI6A 1QTMA 2RAQA 1JXEA 5KFYA 2PT0A 3J80Y 3R97A 3N4WA 2VFRA 4OI0A 3V2UC 1OSCA 4Q43A 2R8JA 3K5MA 4NMLA 3FBEA 2XSJA 1SC3B 3A3OB 3SSSA 3KHGA 2J9CA 3J81j 2ZZNA 2IM2A 4DR4F 3MFHA 1XR5A 3POTA 3BGRA 4DV7J 1RTIB 1O51A 4D3HA 2BJ7A 2DGVA 2W25A 4EO6A 4ZITA 4Y2CA 3SQOP 2B4UA 2GHVC 4YB6A 1VJWA 3EYZA 4MYUA 4NRTA 5HP1A 3B4MA 3RW7A 1X4AA 3RRKA 3KJQB 1XMOJ 1J2VA 5CCLA 4PYDA 1KP6A 2FHOB 3H20A 1JLBA 3TUPA 2QJ3A 3QSYB 1LWEB 1TKDA 5IWAJ 2F9DA 1PAUB 1RBAA 1X4FA 1HARA 2NCKL 5B08A 4DPXA 3HCXA 1VJQA 1PCAA 4NYPA 2F8MA 6AT1B 2IYGA 5L8RC 3L7OA 3MMCB 3W8GA 3MURP 2UXDJ 3EZOA 5BR8F 3J7A1 1TR0A 1VQMS 1UWBA 4WKRA 2SXLA 2DNOA 1CEZA 3HHEA 3T5LA 3CGIA 4LF2A 2GMJA 4FXWA 1BQNA 4ANCA 2RB7A 3VHQA 3CCES 4U67Q 1YRXA 4PR6A 4ZIVA 4RU9A 3GIMA 3PYDA 3QSIA 2BE7D 4YY3J 3G9CA 1BWEA 4OFZA 1RT1B 1JLCA 2JX2A 4CDIA 2IA0A 3AXKA 3MCMA 4I4BA 1ITPA 1FKOB 3PW7A 5KFAA 5DQIA 1N6QB 2A1BA 3W9IA 2JC1A 4ECTA 4X4RA 4ZVQB 1FNMA 2UU9J 2BOPA 4EBCA 5CD4A 4ED4A 5AT1B 4YDDB 2M8HA 3UDEA 2CQBA 2AYGA 4CO1A 1PIEA 3LUYA 4W98A 1UEVA 3B54A 5CABA 2QYGA 1U02A 2MZQA 2CJQA 5T41A 4F4YA 2HVDA 3GV7B 1BWVA 4RKUC 4YR0A 4EYHB 1N5QA 2R8KA 2VPYB 2MJUA 2XGQA 3QGPA 5LJ5Y 2C2MB 3BF4A 4DR6J 2YKOA 2YKMB 4NI2A 3EUNA 1A6LA 4DR3F 1R89A 5E3CA 4P71A 1N36J 3TVYA 3MAAB 2VA2A 1VQ7S 2J0QD 1RAOA 1BQXA 2AD9A 3CTRA 4C3MA 5I3QA 5GAHI 4FF3A 2R4FA 4WU3A 1G4CA 3UR0A 3MPVA 1YVFA 4ZPDA 3B4DA 1KKHA 2IAJB 2CRLA 2Z0GA 3PIOQ 5A6WA 3HHNB 3DRXA 3NS5A 3PJWA 4NXMF 1YBAA 4X4VA 1S1XA 4QIVA 2GCFA 2XI3A 1FRLA 1OO0B 3HHLD 4MYTA 3UDCA 2VFVA 3NBPA 5KG5A 4ZA1A 4WXWA 3LH2S 5B0DA 4H4MA 2RD5C 4ZVFA 2EK6A 3A13A 3ENQA 1XNRF 3HHLC 4EFAC 3L95X 4ZVHA 4NE9C 1BQMA 3IBWA 2VL1A 4QW9A 3H42A 3OTEA 2K8GA 2ACYA 2RF2B 2W2QP 4X4SA 5K8NA 1RWXB 1HBOB 5B7WA 4IYQA 1KQKA 4QU7A 4RUCA 3JS9A 3A8EA 5LL6d 2MKIA 5AJ3J 4CTAB 5CAAA 1KWMA 4MJKA 5DJBA 4GVBA 4PWDB 2MJNA 1H6KX 5DG9A 4LVNP 5I42B 2AHOB 1V3ZA 2KH9A 2A10A 2AJ1A 2PEBA 2KVQE 4X2BA 1NKBA 1S9FA 3MXHP 4CLFA 2PMHA 3HXMA 4XPEA 4DLGA 1B99A 3JSMB 1G7CB 1S72S 1RT3A 4LRAA 1RHQB 4A48A 3KHRA 1HR0J 4URSA 2EXUA 2W01A 1HI1A 2LP4A 3M1VA 5BYQA 4EO8A 2WONB 1TFWA 1D09B 3G86A 4DUYJ 4Q8FA 2R7OA 3KK2B 4WK3A 1N32F 2BBEA 3DRRA 3O1LA 1CJUA 3R1HA 4Y34A 4C3KA 3QJJA 1UVJA 2NYIA 4K7QA 2HRUA 3TUZC 3NGRA 4C8YA 2LLZA 1O5JA 2D3OR 3FBCA 4X66J 1RADB 2D3ZA 2NXEA 2CAJA 4CLYA 2RH3A 1U1OA 1RI7A 1RT2A 4GO5X 1KDNA 2JEJA 3RB4A 2MZJA 1YJ7A 4L72B 4QIFA 4PRFA 4KIAA 1R3NA 2DR8A 3CJ0A 3GYXB 2RQKA 4WE1A 1QJHA 2VF3A 1Q7YT 3EZUA 6FDRA 4FP9A 3TZYA 4FF2A 1KBRA 4ECXA 1UPMB 3HJVA 3PIPQ 1WG1A 4DS5A 5BXIA 2OSQA 2HVHA 1RT6A 4IH6A 3W60A 3EGZA 3ELHA 2B56A 3PYFA 5KFSA 3AAWB 2DBBA 1N0UA 1VRTA 1FEHA 1HD0A 2YNIA 2D9PA 2BKOA 3ETOA 5F8LA 2VDIA 1JKHB 1NDCA 4C2MA 5KFDA 3BM7A 1J5EJ 3BGOP 2XWXA 1T3NA 2C2KB 1YJWS 2DY1A 4ELUA 1BUXA 4OI1A 2LEPA 4DMZA 3BGUA 5AXKA 4U6PA 1RBLA 3KHLA 1R8CA 3GCWP 4DL0C 4WF9Q 1HLWA 4JOUA 2HHSA 1XR7A 1OWXA 1RE1B 4ELTA 2RQ4A 2ZD1B 3W63A 4LRFA 2BKNA 4ECZA 4J9LA 2M88A 2XS5A 2ZH7A 2GW8A 3NGTA 1GFWB 2V8GA 1NZAA 3LTOA 2YKAA 1NK8A 2EI5A 2M4MA 4ZCKA 4QZVB 3AD9C 1S9EB 4ER8A 5ETSA 2MQPA 2VIHA 3QT7A 4N41A 3O2IA 4A47A 1MROB 4DPOA 5DS7A 3PYGA 3WC0A 5CZVA 2W2MP 4IH5A 3VVUA 3CMES 1RAAB 3GONA 1DRZA 2OSRA 2DNKA 3K0JA 5L39A 1RTDA 2LXIA 2QX0A 2DEJA 3HSGA 1GMUA 2V2VA 5ETKA 2H5IB 2HLTA 1NLKL 5G0RB 2DD8S 4QYRA 3PR5B 1YHQS 4ICLB 4AQYJ 3MEDB 2C28A 3MECB 1O0PA 1RWKB 4MT1A 4UQGA 2CVIA 3FCHA 2W9CB 3OR1A 2C2RA 1FJCA 2MXYA 3M30B 1PYTA 2VPWB 4DJBA 4A8OA 1X31C 2CQ1A 3C15B 5KG6A 2XWYA 4ZLPA 3K5NA 1R43A 2ADBA 5K14A 3HKWA 2V5HG 1V3SA 3VGTA 3KUGA 4OX9J 1DZ5A 4DUTA 2QC3A 4KHPF 2H65B 3WHIA 1NU4A 3BKFA 4P74A 1NKCA 1HNVB 3E01A 4DCJB 3TVKA 4LFBJ 1DAXA 3C14A 1WSVA 2GO9A 1PC5A 3I9V9 5HANA 2G4BA 1FD2A 2QA4G 3N5BA 2HGNA 4ZP7A 3J7YI 3NGKA 3VQTA 2QL7B 2W1BA 4XAKA 1S1UB 2JL9A 4OYIA 4HI1A 4DDFA 1BY9A 1Q7LB 1FJ7A 3I4PA 2IVFB 2EFOA 2G0IA 5F9NA 3IG1A 3HJFA 5KTQA 1XR6A 5HI7A 4OYWA 3GE9A 1F0XA 4CLLA 2ZJRQ 5HQMA 4I6AA 2YWWA 4W92B 4AT1B 3FZ2A 1JB0C 2L9DA 2CQGA 5FIIA 2CPHA 5F0UA 1QE1B 3C3LA 3TQEA 1X0PA 1H74A 2UUCF 3EJMA 3SBMA 2R2SA 3HVTB 4K4UA 2ZH9A 2HBYB 2BJDA 3IR5B 3BBCA 1RISA 1SB6A 2EBEA 2BZ2A 5I3UA 3CW2C 2E66A 2QT7A 3TQ1A 2E5LF 3CCTA 5KFLA 2C2DA 3PHTA 1CS4B 1Z1ZA 1DTTA 1FRKA 1FWPA 4PAAA 3G87A 4HLBA 1Q8KA 2AW0A 4M5DB 2HWHA 3H4BA 3P96A 4X84A 3RAMA 5SZTA 1IBKF 4PQUB 3SFUA 3GR0A 1WELA 1YBTA 1LW0B 5KG0A 1KONA 4W4MA 3PCOB 4I2QB 4F7VA 2XSFA 3QAEA 1HBUB 3M8PA 5HJXA 2R7VA 1LWFB 2MKHA 3LWLA 4UZCA 5AXMA 1RTJA 4NRUA 4Z37A 1S6OA 3FSYA 1DTQB 5J2PA 1TKXA 5J2NB 2DO4A 2HFZA 3ZZ0A 2C3PA 3WQPA 3QIDA 4DV1F 2Q1LA 3M6WA 1MG7A 4I2PA 1UFLA 2B4OA 1NJWA 2KDOA 4NEZA 4TQSA 3MR6A 1B4SA 1GH8A 5A8WA 2RE1A 1LXNA 2BJ1A 3NRBA 1HNWF 1WOPA 2DITA 1OQ3A 1YKWA 3C19A 4WBFA 1X4HA 3K58A 3R3TA 2VPZB 5H9FK 5F3ZA 4YS2A 1ZTWA 1H73A 3M2UA 1FXDA 3DM2A 3VAJA 2K3KA 3V81A 1NPRA 4DV5J 1C4AA 3GSDA 2E29A 1X9SA 3UO0A 2OPRB 3AOBA 3RAQA 4CYUA 3DGPA 3W5ZA 3PVXA 2CDQA 2BJ3A 4YEAA 2DRBA 3RUBL 1WDTA 1WJ9A 1XQIA 2F3JA 4B3SF 2RKIA 1CC8A 2V8DA 1L3UA 2GS8A 1P27B 4NXNF 3JQJA 3DLKA 2J9DE 4OYBA 1SC4B 2VFSA 2ZFHA 2E9ZA 2ZVIA 5KAKA 4QOTA 4DR2F 1T9XA 4MH8A 4D3GA 3SV4A 4O4GB 3IAS9 4XDCA 4RWXA 4RW8A 3TJ9A 3W5YA 2WSCC 1FHTA 3W66A 4EI2A 3VZIA 2HHXA 1WKKA 4KV8A 2H5JB 3O6QA 3SFGA 1JNRB 1F2HA 3F56A 4ZVPB 2QYCA 5DLFA 1HBNB 2GGPA 3IXQA 3TX8A 1AFJA 1Y0HA 4DR7J 2YNFA 3D6HB 1YWXA 3UN3A 2OKQA 5LMUJ 1WC4A 1SL0A 3JXOA 5THWA 5A8KB 1K1SA 2HMIA 2VHGA 1GK8A 3KKFA 1RLDA 1HQUB 4C9DA 3HSDA 1HPZA 4OV1A 4PYAA 1SC1B 3MEKA 5F8NA 1TMJA 2K1RB 3BO3A 1ICEB 3H7HB 1RHRB 4LF7J 3I0RB 3JTNA 3OR2A 1S1TB 5DZ6A 4CLWA 1JLQA 2H9ZA 2IYIA 2CQDA 4OZJA 3Q8QB 3EWGA 1RP5A 1ZAVA 2HHHJ 2RQCA 1U49A 2MY7A 3C16A 2HLUA 5KFWA 3E3XA 2EFGA 4U96A 2A2DA 3TZWA 1VQ5S 4ZHRB 3PV8A 1RA7A 3W64A 3P5TL 1R0AA 3N28A 4RW6B 1B64A 4CP5A 3ZO7A 3BGLA 4EGLA 3MPDA 4DQPA 3FMBA 5GAGU 3ZC4A 4M95A 1IM4A 5H9FJ 2BKPA 4Z2XA 2CVEA 3ENAA 4FBTA 3BKTA 4EK2A 2R3VA 4HL9A 4B3RF 1NRKA 3QWPA 3EVMA 1SH3A 3D6MB 2VG7A 3W7BA 2FZKB 2P6TA 4DF4A 3GJRB 2AV5A 5F8IA 3UNYA 1FFWB 4KKOA 4EEYA 3OXGA 3CCRS 3IO1A 1ZAWA 4MK8A 1IKVB 2GJIA 4PXCA 3Q8RB 4IFVA 4OIXA 1YJTA 2XULA 5MLCV 1U8WA 2Z30B 4DR5F 4OMFG 3CUNA 4KHMA 4DXLA 3Q89A 2LQJA 2F9JA 1OY9A 2KXFA 1N54B 1N5SA 4PUOA 2BRLA 1RLCL 2E7VA 2V8PA 2RILA 3OT9A 5LXYA 3P49B 3PO4A 3DMJA 3TI0A 4ZVEA 4NLSA 2OIHA 1CLFA 1KLMA 1RT7B 2JVRA 5E3RA 1S9GA 3UVJB 3CO9A 1N48A 4O3SA 1PBUA 3HKZD 4LSLA 3GG0A 4KQZA 4MFBA 3WIUA 2I8EA 1T9YA 1N33F 1FI4A 1YSJA 2XQCA 3BQ1A 3R5DA 4OHVA 3K8WA 4YMEA 3IWLA 1W2BR 3UNGC 1QAYA 2AGPA 3TUJC 1TVRB 2IVYA 1RHJB 4EUVA 3QT6A 3DOKB 5C42A 3TW0A 4DV4F 3IM9A 1U2FA 1T02A 4DZDA 4RW7B 1HYSB 4QWCA 2XMMA 1NBEB 1Q8LA 2IDEA 4Y28C 3R2CJ 1JLFA 3ITHB 3JAMU 4ZCMA 3I6PA 1MMLA 1RKJA 2MQNA 3DOLA 4N47A 3KLFA 4L6V3 2DCUB 3CDWA 2ASDA 2QG9B 2VKZG 2P2CB 3D9BA 1IR1A 3DLJA 2YWHA 2HVEA 3MGJA 4ED8A 2Y1IA 2X51A 3CCMS 5GAEU 1RABB 5C25B 4URGA 2LCWA 3ZZTA 3HI9A 2VB6A 2KU7A 4ILRA 3GTYX 1UZDA 2AIRB 4NCGA 3QBCA 4WU2A 2HNYA 4UF4A 5E7OB 4O3OA 3NKYA 1EARA 3B78A 4FYVB 4YB7A 1VC5A 3HHLA 3GZ7A 1C0UA 2E7WA 1I6JA 2IJRA 4ALZA 2R8GA 3POTB 2U1AA 4U9RA 2DIVA 3NNHA 2B7BB 2B0GA 3KK1B 2RUGA 2GMHA 1X5TA 5DETA 3AY0A 1WEXA 6FD1A 2DEIA 3RU0A 5GMKa 1JLBB 4P9SA 1FX2A 3I56S 3W65A 2ASYA 2CJBA 5B0BA 1VOMA 3F41A 3MM7B 4DSIA 1S1WA 4G3IA 2V0NA 2OUGA 3RTVA 1UWBB 1JQGA 4H4KC 3LA0A 2NPFA 2BACA 5J1EA 2IRXA 2E5JA 1RAJA 2MQ8A 1YZ6A 1RAGB 3CJ3A 3DLLQ 4AUKA 1ZBTA 4FYXB 2XGPA 2VFTA 4IFYA 2Z4PA 2VD3A 3EM1A 3D1HA 1X0FA 3MM5A 4LF5J 5E3AA 4K4VA 2OELA 2VOOA 1FXRA 4ZJOA 3H2UB 3D3BJ 4PPZA 1C0TA 1FJGF 3NWRA 4YB1P 2J6UA 1KHVA 3Q8VA 5K5MA 3M8ZA 3G6YA 3R5JB 1GNKA 2J5AA 3FRZA 2VBXA 1SPBP 3MEGA 4OYAA 1RK8A 2F8HA 4PKDB 2YKQA 2CZVC 1RWNB 5KFVA 2ZVSA 3EVOA 3M2RA 4NI2B 2IIHA 4ZPBA 2OFHX 2WCXA 2X3GA 1NHUA 2WOMB 2DGUA 1F9EB 5KFZA 1GX6A 4DL3A 3PW5A 4V19J 4NLRA 4J9QA 2ZH6A 3MUMP 1SJ4P 2ZH1A 3EZ5A 2CPFA 3LPYA 2KYXA 4KRWA 4Y2MA 4DN9A 3GSIA 2UVUA 2AJ0A 1CPZA 1UJ5A 2BM1A 1HBMB 1RU1A 1LWCA 4DSFA 3NBPB 5K9FA 1SJ1A 2GNKA 5AXLA 2Y9HA 4H4MB 1IKXA 4IR1A 1B0VA 2R9LA 1V3RA 1U0HB 1BQMB 2IJFA 2HGMA 4RLEA 4RWWA 4CQ1A 2VASA 4XPCA 2ZITA 4FXVA 2D69A 1X60A 3DYAA 3UE2A 2HHWA 2LKZA 4YDXA 3NGUA 3J7AN 1RCXB 1Z2ZA 1ZA1B 3AT1B 4J91A 1RSCA 2DH7A 1UEKA 1R31A 4YOEA 1R27B 5DZ7A 1YZ7A 5LJ3Y 2VOPA 2KM8B 3HHKA 4DX7A 4QYZK 4WIQA 3FFIA 4CCHA 2NS1B 1RAHB 2GHWA 2E9TA 5H9EJ 1FWLA 4HH1A 1I94J 3KFWX 1RT3B 3NOGA 1BXNA 4EWTA 1LW2B 1BHNA 3IGVA 3M6XA 4TYAA 4NLTA 1EAYC 3M1VB 3MM9B 3DDIA 3DLGA 2M2BA 3B8HA 4IOCQ 2E5HA 4KO0A 5LMNJ 1CJTA 3MCNA 1CJUB 4H4OA 3UN5A 1WC1A 3TA2A 4JI7J 1C1CA 4FN5A 2JRSA 3LALA 1Y3KA 1RA6A 3GJTB 2JFKA 2AGOA 5AE2A 3JTPA 4WTOB 4ETZA 2I5JA 2MY8A 3Q8PB 2IVMA 1HW9A 2ALZA 2WBMA 2AX1A 2V9KA 1Q0NA 2C3MA 4ECSA 3AOAA 4GKKF 1EHWA 2YNGB 5D78A 2QLXA 1RWMB 4DV0F 2MZRA 2AX0A 2LXUA 3PTWA 3OV7A 1GMWD 1HKAA 1D0EA 1TMMA 2J0SD 3QGHA 3MZIA 4ZOSA 3EMTA 3V4IB 1PJ5A 1PG5B 1YRTA 3H2LA 3CMAS 2MSTA 2JFDA 2AYEA 2J7KA 4CZCA 3ZTSA 5C2GA 2VJUA 5D0GA 1S59A 3LGHA 2ZM6F 2B9WA 2EFPA 5E3PA 2CJXB 3HD1A 2VU5A 1WKLA 2YVSA 2YNIB 2MDAA 5EDWA 4X65F 1TKTA 1FNOA 2QSWA 2PE8A 4LFCF 3M8RA 1OPIA 2HIQA 3E51A 3GQCA 4AYBD 2P9GA 2QLWA 2WVEA 1Y3JA 4ECQA 5A0YA 1B0TA 2GIQA 4O4RA 2C2NA 2GZOA 5KFRA 3ULHA 2HNDA 2W8LA 4RUBA 3ZZRA 1EX8A 2XC9A 2CQ0A 3JQKA 5LT5A 4CLUA 1DHMA 2G0JA 2C42A 4QYZJ 1UA0A 3OD2A 3C66A 4DSJA 5JMNA 1UTAA 1FVSA 2HGLA 3R9LA 1K47A 2ZHOA 3MUTP 3K59A 2FJVA 2MKYA 1UVKA 2OTJS 2V2QA 1C2PA 4DCOB 1OQ6A 2MTLA 4DR4J 4ED3A 3M8QB 4N77A 1S0MA 2ILYA 4DV6F 2ZUGA 4PXDA 2HQIA 4JYAJ 1VQ9S 1RTDB 4E98A 3MDFA 3OBIA 1UA1A 2V34A 1MW7A 4JI6F 1HNZJ 3SQGA 4B3OB 3QZ7A 3OSPA 3MTJA 1WHYA 1VRQC 2X1GA 2DHAA 1QAXA 4DEZA 5J2QB 3ILLA 3ONQA 2QMXA 2N3LA 1SH2A 2FJEB 1FK9B 3PKMA 1FXLA 5KG3A 5KT6A 1JJ4A 2F4FA 3QFHA 2QGFB 3H90A 2EG1A 1IQZA 4NOHA 2OD6A 2MQOA 4USMA 2HG4A 2RSQA 3CCQS 1MN9A 2ZDOA 3EGNA 4ELVA 1SKWA 2RHQB 5JXSA 4GKJF 2K7KA 4NASA 3HSJA 1R8PA 4U8VA 3PRDA 3HT3A 3SCJE 1GT8A 1FDNA 2W9BA 1YJNS 2AGQA 2I1RA 4UT4A 3MMBA 1GTHA 3AB4B 1AT1B 4DX5A 3R7BB 1U45A 1S79A 1FD8A 3M32A 1J5OA 3HMJG 2NQPA 1VBZA 4TLQA 1A0OB 4TU9A 5GVQA 3R27A 1DLOA 3T1HJ 3KLIA 3S1TA 4M8LA 2QFJA 2Y1JA 1U47A 3CDUA 4ZLNA 3EVWA 2HBRB 1LFPA 3DXSX 3Q83A 3HZGA 1M5SA 2KG1A 2XNQA 4RW4A 3ZNJ1 1Y5LB 2WW8A 2DNZA 3TWZA 3GMGA 3AA9A 3D6FB 2F4VJ 2H51B 2X1AA 4ZJQA 4MTPA 1AB8A 5IM0A 3WX8A 3C6UB 3CIMA 2AQ4A 4KE5A 1NSQA 3A12A 4TY8B 5SUHA 4TU8A 1XMOF 1TUVA 3PX6A 1D3WA 3BBBA 3OPKA 1OYDA 2RDIA 2AYMA 3P5BP 4WKYA 2LA6A 4L3NA 5IWAF 3OXFA 1DTTB 1S49A 1T05A 1FTCA 1U1NA 3LF0A 5L46A 3MCOA 2EFNA 2Q79A 2FPHX 4JBCA 4R5PB 4NYOA 2UXDF 1UPPA 2RRBA 3M8PB 1CULB 5D0EA 4NPOA 2HIYA 4USIA 2MKSA 2M5YA 4M5LA 1RCOB 3P6YC 1TKXB 1RT5A 4QBUA 1X7VA 3FUYA 1T9TA 1WI6A 4USKA 3TZZA 2BABA 5CHCB 2PI4A 2JVOA 4YY3F 5CD4H 4HT5A 4HEA9 1JLEA 3VR1A 4I2PB 3EICA 2GX8A 2A0FB 3TZXA 3D68A
chains in the Genus database with same CATH topology
4V1Ak 1IBLJ 2MEWA 3W1YC 1J5EJ 4DUZJ 2UXDJ 1I94J 3R2DJ 4DR1J 4AQYJ 2UUAJ 4DR5J 4KHPJ 4DV6J 4JI5J 4JI4J 4LF9J 3R2CJ 4DR6J 3JAMU 4B3TJ 4JI0J 2UUBJ 4LF5J 4X62J 4X66J 4KY3A 4JI2J 4NXMJ 1HNWJ 2E5LJ 2MTLA 5AJ3J 4YHHJ 3J80U 4DR4J 4JI6J 1N36J 5FLXU 3D3CJ 2UUCJ 4JV5J 5LMNJ 3D3BJ 4LF7J 4JI1J 4DV3J 4LF8J 4X64J 1HNXJ 1XMQJ 1N32J 4JYAJ 4GKKJ 5A2QU 4B3RJ 3J81U 4YY3J 1XNRJ 5IT9U 4JI7J 3OTOJ 2KVQE 4DV0J 1HNZJ 2HHHJ 4DV7J 4RJVA 4NEZA 1IBKJ 2UXBJ 4OX9J 2KL8A 4PWWA 4LFAJ 4DV2J 4K0KJ 4DV4J 4HHUA 5BR8J 4LF4J 4GKJJ 3T1YJ 1N33J 4LFBJ 1HR0J 3T1HJ 4B3MJ 2UU9J 1XMOJ 3J7AN 4DR3J 3IMQJ 5LM7E 4B3SJ 4KYZA 4DUYJ 4LF6J 2ZM6J 4NXNJ 1N34J 5IWAJ 1XNQJ 2VQFJ 4NEYA 1FJGJ 2MQ8A 4JI8J 2VQEJ 4JI3J 4DV5J 4DV1J 4X65J 2UXCJ 4DR7J 2F4VJ 4DR2J 4LFCJ 1IBMJ 5LMUJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1A k;  1IBL J;  2MEW A;  3W1Y C;  1J5E J;  4DUZ J;  2UXD J;  1I94 J;  3R2D J;  4DR1 J;  4AQY J;  2UUA J;  4DR5 J;  4KHP J;  4DV6 J;  4JI5 J;  4JI4 J;  4LF9 J;  3R2C J;  4DR6 J;  3JAM U;  4B3T J;  4JI0 J;  2UUB J;  4LF5 J;  4X62 J;  4X66 J;  4KY3 A;  4JI2 J;  4NXM J;  1HNW J;  2E5L J;  2MTL A;  5AJ3 J;  4YHH J;  3J80 U;  4DR4 J;  4JI6 J;  1N36 J;  5FLX U;  3D3C J;  2UUC J;  4JV5 J;  5LMN J;  3D3B J;  4LF7 J;  4JI1 J;  4DV3 J;  4LF8 J;  4X64 J;  1HNX J;  1XMQ J;  1N32 J;  4JYA J;  4GKK J;  5A2Q U;  4B3R J;  3J81 U;  4YY3 J;  1XNR J;  5IT9 U;  4JI7 J;  3OTO J;  2KVQ E;  4DV0 J;  1HNZ J;  2HHH J;  4DV7 J;  4RJV A;  4NEZ A;  1IBK J;  2UXB J;  4OX9 J;  2KL8 A;  4PWW A;  4LFA J;  4DV2 J;  4K0K J;  4DV4 J;  4HHU A;  5BR8 J;  4LF4 J;  4GKJ J;  3T1Y J;  1N33 J;  4LFB J;  1HR0 J;  3T1H J;  4B3M J;  2UU9 J;  1XMO J;  3J7A N;  4DR3 J;  3IMQ J;  5LM7 E;  4B3S J;  4KYZ A;  4DUY J;  4LF6 J;  2ZM6 J;  4NXN J;  1N34 J;  5IWA J;  1XNQ J;  2VQF J;  4NEY A;  1FJG J;  2MQ8 A;  4JI8 J;  2VQE J;  4JI3 J;  4DV5 J;  4DV1 J;  4X65 J;  2UXC J;  4DR7 J;  2F4V J;  4DR2 J;  4LFC J;  1IBM J;  5LMU J; 
#chains in the Genus database with same CATH topology
 2FLL A;  2QEX S;  4B08 A;  1TL1 A;  4K4S A;  1HWK A;  1N56 A;  1FKA F;  2UU9 F;  3PXG a;  1SQF A;  2DO0 A;  2LU1 A;  4B02 A;  5KFU A;  4OHZ A;  4AL6 A;  1RAC B;  1FDA A;  3NS6 A;  3M2U B;  3DM2 B;  1AZS A;  1SKR A;  4X64 J;  2BM0 A;  3V81 B;  3FDS A;  1L3V A;  4NYZ A;  4CT8 A;  3LQV A;  3RYL A;  4J9U E;  3OL9 A;  4KT0 C;  1TV6 A;  5KFT A;  1L3S A;  1NKE A;  3MR3 A;  4RJV A;  4KPC A;  3DRS B;  2ROP A;  2V50 A;  2ZH3 A;  2EC0 A;  3W2V A;  2XMT A;  1VRU B;  5KG4 A;  2ZE2 A;  3FBB A;  1ZET A;  1X4C A;  5L1K A;  2DJW A;  4S0M A;  3SYZ A;  2HNZ A;  4DX6 A;  4DR6 F;  4CYU B;  2QSF A;  1K9M T;  4J9K A;  3VAH A;  2ZBR A;  3DKD A;  1IVZ A;  1N36 F;  4RNM A;  4FYD A;  2AJQ A;  4DZ6 A;  2MKJ A;  1BD6 A;  1DQ9 A;  4LRE A;  1Y11 A;  3CJK A;  4F50 A;  1LXJ A;  3G8T A;  1RT4 A;  3RB3 A;  4IDK B;  4F0M A;  2XYH B;  2QZ8 A;  1E6V A;  2OLW A;  3S8S A;  1NHK L;  3N6N A;  3BB5 A;  4YHH J;  2XLI A;  4KV8 B;  3SXL A;  4C48 A;  3MEE A;  2Q3P A;  3IS9 A;  4ZKA A;  3MM8 A;  4RUA A;  4P2X A;  3MFI A;  3BSC A;  2O01 C;  2R7Q A;  1CQM A;  5HN0 A;  2MLY A;  5DGA A;  2YNF B;  1OS5 A;  1R0C B;  1T03 A;  2UXB J;  4HKQ A;  4PG4 A;  3OFE A;  2KL8 A;  2ZJP Q;  2XMA A;  7FD1 A;  2LMI A;  2HKE A;  2HMI B;  2NYH A;  4LRD A;  2HUR A;  3BPS P;  1N5V A;  4HHH A;  3M7V A;  5AJ3 F;  1JJ2 R;  1JJH A;  3KWM A;  1SL2 A;  4KGV B;  3K17 A;  2DHH A;  3OR2 B;  1KFD A;  1K44 A;  4QCL A;  4R8U A;  2B9X A;  3IRX B;  1JLQ B;  3LAN A;  1S6Q A;  3CO0 P;  2E44 A;  1HMV A;  1DJ0 A;  1NM2 A;  4C97 A;  4KPY A;  1EQ0 A;  1CG2 A;  1YBU A;  3W9J A;  2HBQ B;  5KFH A;  2EKY A;  2MHE A;  1R0A B;  1HR0 F;  4A8F A;  3MR2 A;  4ECW A;  3U1L A;  2JLF A;  3I55 S;  4DUY F;  4C8Z A;  2MMY A;  4RNN A;  2EKN A;  1Y9O A;  2X1B A;  5KG2 A;  2C3Y A;  2J0X A;  2H3E B;  3GV8 B;  2OP5 A;  1VBK A;  3WZ0 A;  2Y1L B;  1WDD A;  2HQD A;  3WBZ A;  2H4Y B;  2CPZ A;  3PJX A;  4OYZ A;  5DDR C;  1PKU A;  2N3O A;  1DBD A;  3MMA A;  4X66 F;  1DFD A;  4M5K A;  3SDE B;  2J8A A;  4F4Z A;  1KSP A;  1NO8 A;  3BN4 A;  3LP1 A;  3I5A A;  4F25 A;  3BDP A;  3LP2 B;  3QFW A;  4K59 A;  3I4H X;  1AUS L;  2DPJ A;  1UVN A;  2K2P A;  4FVM A;  2QA1 A;  2O67 A;  2YWF A;  2FD2 A;  1M5H A;  3IA0 A;  2F65 A;  2D1C A;  3H5S A;  1F9H A;  3DMJ B;  4O3Q A;  2X1F A;  2FIU A;  1KLM B;  4DFP A;  2DGQ A;  1S9G B;  5HVF A;  4MFB B;  3D3C J;  4ENO A;  4MIB A;  3OHB A;  1NJZ A;  5ETO A;  4Z7Y A;  2JZ5 A;  5KG1 A;  1IR0 A;  3G6X A;  2RRN A;  3PYE A;  3IR7 B;  4CO5 A;  3CJ5 A;  3Q23 A;  1HHQ A;  4KGX B;  1J5E F;  4ID5 B;  4RUH A;  5C42 B;  3G82 A;  4DV2 J;  4OHY A;  2DPI A;  1S97 A;  4OL8 A;  1JLF B;  2BAN A;  4A46 A;  1X8D A;  2KFN A;  2CFX A;  2BXJ A;  2FQQ B;  1MLA A;  3DOL B;  2ZH4 A;  3KLF B;  4FPR A;  2DCL A;  3V6H A;  1RWW B;  2BV3 A;  1FT8 A;  4KAI A;  3TOQ A;  1NB7 A;  2KRR A;  1XMB A;  3DLB A;  2Z2M A;  2VPX B;  3VAI A;  1RWV B;  1AFI A;  4I1T A;  4ZDN A;  3X3U A;  4V1A k;  2FTR A;  3V6D A;  3MAH A;  3CCS S;  4CO2 A;  2E1R A;  4U7U D;  1F6T A;  4ECY A;  2Z2Y B;  1EP4 B;  4LF9 J;  2XMU A;  5F9L A;  4CNY A;  2ASL A;  1U1M A;  1HWI A;  1TU0 B;  4NCG B;  1ZZF A;  4EBE A;  1NCL A;  2UUC J;  4JI1 J;  3HHL B;  2LA4 A;  3BDE A;  2B4V A;  2G0C A;  1HNX J;  5EX0 A;  2ZHB A;  1C0U B;  4FF4 A;  3NLC A;  3I96 A;  3OW2 R;  3DN9 A;  4LUB A;  1VR6 A;  2FJX A;  3DOM B;  2EC2 A;  2G2O A;  2RVJ A;  1CC7 A;  4F3O A;  2LDI A;  2V4J B;  4AQY F;  4ZPA A;  2VBZ A;  2HQC A;  1BGX T;  3CVK A;  5GAD U;  2WTF A;  1K0T A;  3GFY A;  1AW0 A;  4FPI A;  4CM2 A;  1VYA A;  4Y2I A;  3QO9 B;  3MMC A;  3QNW B;  3IBF B;  2RU3 A;  4UUX A;  2CPD A;  4IKA A;  3OTD A;  2DNP A;  3CIZ A;  4YQW A;  3RBX A;  1YDL A;  2WVD A;  2DNM A;  2CQ3 A;  4OX9 F;  1S1W B;  2FVS A;  2E1A A;  3QGG A;  2KXN B;  3SI8 A;  3JSR A;  2PA3 A;  4DR1 J;  2ZZT A;  1VQK S;  2Y3Y A;  1LEO A;  4IUF A;  2AYB A;  2OEK A;  4X62 J;  3MM6 B;  3H8Y A;  4ANE A;  2QN6 B;  1OMS A;  5KFE A;  4PG5 A;  3SIP B;  5DG8 A;  2G1H A;  3DLE B;  4KTQ A;  4RBT A;  3MPU B;  3X1L B;  5J1E B;  2HAI A;  1FKO A;  4NLX A;  2NPI A;  2E1P A;  3DRY A;  1N6Q A;  4ATN A;  4UOC A;  4F0K A;  3BQ0 A;  3N79 A;  3FZB A;  4WFZ A;  2A18 A;  2F8E X;  3HK2 A;  4QR1 A;  4IFY B;  3CT9 A;  2M70 A;  1TQL A;  2R2R A;  2NUU G;  3BEG B;  1CJK A;  2FY1 A;  4HYK A;  3TNV A;  2GV1 A;  1NEE A;  4LBH A;  1NK0 A;  4F8R A;  1WHX A;  2V2Z A;  2FGO A;  4K4W A;  2H1Y A;  4PG8 A;  2AF6 A;  3VWS A;  1KFS A;  2CIM A;  2V8V A;  2OPP A;  2DR6 A;  4C11 A;  4YFU A;  4KH1 B;  1YQH A;  2VIC A;  3NXZ A;  1RAI B;  1NJX A;  7FDR A;  1B3T A;  3MAA A;  3NGS A;  1QUV A;  2W7O A;  1GMW A;  4ZIW A;  3M2R B;  5D4N A;  3AD7 C;  4F0H A;  3L09 A;  5C24 A;  1URN A;  1RTH B;  2O5D A;  4CLT A;  1LFW A;  5FLX U;  2DH8 A;  4Q7A A;  5AE3 A;  2IY5 B;  2IAJ A;  1IKY B;  2UUW A;  3R1L A;  1UEU A;  2WVB A;  3OTO J;  2B6A B;  2HZA A;  4P7V A;  2NRE A;  2Q6B A;  2J0W A;  2ATL A;  4LRC A;  2W9A A;  2CQP A;  2YPY A;  5HVH A;  1LWC B;  3DGV A;  4ZS6 A;  2CJY B;  2ZNY A;  3JYT A;  3QMQ A;  1PJ7 A;  1HBO A;  2XMW A;  1FE0 A;  1KOH A;  1L5U A;  1M0S A;  4O23 A;  4OLP A;  5HQ8 A;  4PWD A;  3QJP A;  5F0W A;  4JI0 J;  4V19 X;  3DDN A;  3F0N A;  2YX7 A;  1UJ4 A;  1YGY A;  4TKT A;  5HAO A;  2UV8 G;  3G71 S;  1I51 B;  4DV5 F;  2VKR A;  3C46 A;  3FFI B;  3S7R A;  5L9N A;  1OSD A;  1U1P A;  3QAT A;  3THP A;  1OY6 A;  1WOO A;  4BLG A;  1EQM A;  1MWQ A;  2IHR 1;  4B3M J;  3OQ2 A;  3PFE A;  3DLG B;  2HHQ A;  2W24 A;  2D7S A;  4PCQ A;  3QZ8 A;  5M2P A;  2CKW A;  2DT9 A;  3NMR A;  3FJ2 A;  1UET A;  4X4O A;  1MU2 A;  2OPQ A;  4NZ0 A;  4H4O B;  2FUG 9;  2VQE J;  1C4C A;  1TL5 A;  1XIQ A;  3MTK A;  5K8P A;  1VI7 A;  3PNI A;  4P2M A;  4BC7 A;  2CJ9 A;  2MEW A;  2WW4 A;  3GB0 A;  2ZOF A;  4IQM A;  2FVC A;  3L9Z A;  2UUA J;  2W4C A;  4DR5 J;  1U6Z A;  4UQT A;  3W3S A;  2I5J B;  1FNX H;  2DKO B;  2ZBQ A;  4PPD A;  2F40 A;  2MHN A;  5DO2 A;  4ZCL A;  1K0V A;  3BBF A;  1VIX A;  5ETV A;  2IMW P;  1RWO B;  1X5S A;  3HUL A;  3RW6 A;  2YQ1 A;  4DR7 F;  2JJ4 D;  4JV0 A;  2WVC A;  5LMU F;  1Q5V A;  1ZPW X;  4USW A;  3Q2T C;  4MKV A;  2HYI B;  1IKW B;  2J76 E;  1UAW A;  1N33 J;  3BZQ A;  2GHP A;  1S10 A;  4OZL A;  3VGS A;  2Q6C A;  1B7Y B;  4C7Q A;  2RRA A;  1JKH A;  4LF7 F;  4WP3 A;  1GXU A;  4LBI A;  2YY3 A;  2CDR B;  1TKT B;  1P9Y A;  2HHH F;  1M1K T;  1S0O A;  4C8N A;  1CJV B;  3NP5 A;  4LIW A;  4RW9 A;  4E8U A;  1WC0 A;  1V5V A;  1HWL A;  4DUZ J;  2DNL A;  5A0Y B;  2ZD1 A;  2KTQ A;  4C8L A;  4USV A;  2HND B;  2FLP A;  2IM0 A;  2VJV A;  3Q22 A;  5HL7 Q;  1YTY A;  3V5R A;  3W5X A;  4JUZ A;  3CD0 A;  1FDD A;  1RZM A;  2FLO A;  1UZH A;  2XZD B;  3NL0 A;  1MRO A;  2LEA A;  3H5U A;  3CC2 S;  3Q8S B;  4WTY A;  3MI7 X;  3G8Q A;  4DL7 A;  4B9T A;  4Y0F A;  1H98 A;  3I31 A;  1Q8I A;  3TUI C;  4QWB A;  3UFC X;  2GC8 A;  2BDP A;  4ICL A;  2GQ2 A;  4U7U K;  3MED A;  5BYR A;  2W2O P;  5IOL A;  1NHV A;  4OX6 A;  2OTL S;  3MEC A;  1UVL A;  1NDL A;  5IC6 B;  1LK5 A;  2M0G B;  2G1D A;  4XDD A;  3T19 A;  2HZC A;  2W9C A;  1KNZ A;  2FHJ D;  3PHE A;  3EPI A;  2KYZ A;  5CYQ B;  4FKX A;  2ALY B;  3SCI E;  1WOS A;  4B3T J;  1WG4 A;  1YIT S;  2E7X A;  3FSI A;  3KHH A;  3NAI A;  2VDH A;  1DQA A;  4NLD A;  3ISN D;  4LR8 A;  2ZBC A;  2BE2 A;  2CPE A;  2PMZ D;  3GYG A;  2JEG A;  1H3D A;  1TL7 B;  3AFG A;  1PAE X;  5HJY A;  2N82 B;  2NXU A;  3VQS A;  1NAQ A;  4HI2 A;  4Q44 A;  2V67 A;  5K20 B;  3ISN C;  4FKY A;  1T9U A;  1GMV A;  2V4Q A;  1KRP A;  5AE1 A;  2P6S A;  1U1K A;  2YQ3 A;  1Z4U A;  3I0S A;  1S1U A;  3CF5 Q;  2B4P A;  2W9B B;  1UCN A;  3UCU P;  4MKA A;  2MKC A;  1WEY A;  3MMB B;  3P45 B;  1HNI B;  2CUY A;  4NZ7 A;  1N34 J;  2KXH A;  5CXT A;  4G1I A;  4KB7 A;  4LVO P;  4JI8 J;  4P52 A;  3FMW A;  3TA1 A;  1FRM A;  1JK9 B;  1WI8 A;  1YRU A;  2CQ2 A;  4CLS A;  3M32 B;  5GAG I;  2OD4 A;  2OO4 A;  1F3F A;  1ZM4 A;  1J5O B;  1PBA A;  2DIU A;  3T1A A;  1S57 A;  1IWA A;  2VG5 A;  1VHF A;  2UXC F;  3T9N A;  1RHM B;  5JUM A;  3KLI B;  1RJJ A;  3HFV A;  1SUQ B;  4UY8 5;  2R8I A;  3K89 A;  1N52 B;  2DXD A;  2Y8W A;  1H2V Z;  3NNA A;  2N4C A;  1NDP A;  3AJ1 A;  2B5J B;  2H5E A;  1Q79 A;  4OYP A;  2NXN A;  2KFY A;  4C0B A;  3H0P A;  2PFF B;  3SV3 A;  2AMC B;  5IM0 B;  4CLP A;  4K0K J;  1CS4 A;  4XK8 C;  4F4K A;  1VQS A;  3D2W A;  4WPA A;  3T5H A;  1HL6 A;  4M5D A;  3BSN A;  2FHK A;  3J7Z T;  2DNN A;  4PAB A;  1QUP A;  4OYM A;  2YQ0 A;  1WWH A;  4ES2 A;  3K8V A;  4Y2A A;  3SEO A;  1LW0 A;  1Q5Y A;  2VC0 A;  2A6O A;  2R2T A;  3PZP A;  1MWZ A;  1TL3 A;  2XO7 A;  1HBU A;  4L3K A;  2I38 A;  1LWF A;  4A8W A;  2PII A;  3ILO A;  1T9V A;  1QLN A;  3SZ2 A;  4LT6 A;  4EYI B;  1ZA2 B;  1I1G A;  3KNG A;  5J2N A;  2C2Z B;  3NCQ A;  4I6W A;  4JV1 A;  3PR4 A;  4M5J A;  2JNJ A;  4YN3 B;  3GFZ A;  4JI4 J;  3RRG A;  8RUC A;  4MKY A;  1RT5 B;  4Y2K A;  3KMS A;  3DXB A;  1BC6 A;  1WOR A;  1AXQ A;  1TTH B;  3KJN B;  5DLG A;  1FFS B;  3OTC A;  4DG1 B;  4FS1 A;  1JLE B;  2POK A;  2WAQ D;  2XM3 A;  5IT9 U;  2QV6 A;  1X5O A;  5ETL A;  2A6M A;  4HVZ A;  5HRO A;  1TL1 B;  1IJF B;  2XZT B;  2GVZ A;  4MKB A;  4LF5 F;  4HDG A;  4HR2 A;  4IO1 A;  1YLX A;  3UI3 A;  3CJR A;  3AD8 C;  3B82 A;  4M5H A;  4WZQ A;  5GAE I;  1K73 T;  5HMZ A;  3W62 A;  1AZS B;  4CT9 A;  2O3D A;  3ZNU A;  2KG0 A;  3JSB A;  4QW8 A;  2LEB A;  2KO1 A;  4WZM A;  2CZ4 A;  2D74 B;  2GO8 A;  4TNO A;  1T3O A;  4QJV A;  4RNO A;  2J6T A;  2ZE2 B;  4C98 A;  3KUE A;  2HNZ B;  3N6M A;  1NK7 A;  5D6G A;  2B7C B;  5E2Q A;  2AJ4 A;  2DGO A;  2LQ8 A;  4J9O A;  2NR0 A;  2HS3 A;  2GIF A;  8AT1 B;  2YNH B;  4G1Q B;  4O4G A;  1TUG B;  5A2Q U;  1VQ4 S;  1Q82 T;  3J81 U;  2EG2 A;  4ZMM A;  4OI2 A;  2KN4 A;  5G4D A;  4F2R A;  1YG0 A;  1E6Y A;  1UP1 A;  4B9V A;  3G6V A;  3TR5 A;  1HW8 A;  2OHD A;  1HBN A;  2ASJ A;  4A8Q A;  1VQ6 S;  3FK4 A;  5U47 A;  1DQ8 A;  1QAI A;  1XK8 A;  1EET B;  2VON A;  5CQG A;  1SIW B;  3H5X A;  2GA7 A;  5M2R A;  1YJV A;  3MM8 B;  3R8Y A;  1MMN A;  3AJ2 A;  5A8K A;  2IDL A;  2BYC A;  3IM8 A;  3L7U A;  4WII A;  1T03 B;  5F8M A;  3UWT A;  4F3M A;  2AEM A;  3BJY A;  1VIS A;  3TYT A;  1NK5 A;  4E2F B;  1S6P A;  2CPI A;  4DPW A;  2VG6 B;  5EWF A;  3LAM A;  4YR3 A;  4IOB A;  1JIH A;  1LV5 A;  1S1V A;  1S99 A;  2WRM A;  4I68 A;  4R8U B;  4Y00 A;  4RR5 A;  1FES A;  2U2F A;  2FB0 A;  3QGI A;  1HMV B;  3HHD A;  2DR5 A;  1DY3 A;  2I6W A;  1XER A;  2W8K A;  3A8I A;  2XEX A;  2DNG A;  2XMK A;  1I94 F;  3BS9 A;  2W4D A;  8ATC B;  3MF5 A;  1JLA B;  4R0J A;  1QVG R;  2HVZ A;  2LQB A;  3OVB A;  3ENV A;  2ERR A;  3FVY A;  4RU2 A;  2C22 A;  4NLU A;  3W9H A;  2Z57 B;  2BJE A;  3MD1 A;  3WIV A;  5LMN F;  2IC3 A;  2EPI A;  1HQ2 A;  3PJ9 A;  1TZ0 A;  2FJA B;  3OUY B;  5IQ6 A;  4JI7 F;  1S48 A;  3U1M A;  2PA8 D;  3THT A;  2GAG C;  4X4N A;  4CI0 B;  4B9M A;  1FE4 A;  3K57 A;  2HHV A;  3N5F A;  1KVI A;  1R6V A;  4DV6 J;  4JI5 J;  2FJW A;  2COL A;  3KLE A;  3LP1 B;  2XZW A;  3UN2 A;  4JI6 J;  4XIU A;  1HD1 A;  1WTF A;  1KHW A;  2YTC A;  1L3T A;  5KT5 A;  3U27 A;  1UVM A;  2IRU A;  3D7S B;  5L9X A;  3R6G B;  1U1Q A;  5HLF A;  4JV5 F;  1KVK A;  1S0V A;  5ETM A;  3GWC A;  4Y65 A;  5AXN A;  1FKP A;  2IM3 A;  1SVD A;  3BH6 B;  5LM7 E;  4DFM A;  1TVR A;  5LSL A;  4NMX A;  3DOK A;  2VQF J;  2ZWO A;  1F5A A;  2XHW A;  5ADZ A;  4QWD A;  3QPI A;  4QIW D;  4JI3 J;  4Q8E A;  2P5V A;  3CED A;  5KFX A;  4UOF A;  3CCJ S;  3KLG A;  2DH9 A;  3ET6 B;  5ITH A;  4M94 A;  2L48 A;  2FJD B;  1HQE A;  2ZKT A;  3FEY B;  3NY0 A;  4ZP6 A;  1FFG B;  4ED0 A;  1W26 A;  2J8S A;  4B9S A;  2BAN B;  2ZWP A;  5GME A;  2HEK A;  3ISZ A;  2G2Z A;  5FJ4 A;  4XO0 A;  1T94 A;  5CYM B;  1XN9 A;  4HAC B;  3GIK A;  2QLJ B;  2V6A A;  5CZX A;  2OPS B;  5C25 A;  2DR9 A;  4LF8 J;  1IXK A;  5IT4 A;  3N6L A;  2Y1R I;  1U6F A;  3BO2 A;  3CCL S;  2F1F A;  4OZ1 A;  2GML A;  3SCL E;  5ETR A;  2JDJ A;  1UJ6 A;  3V6D B;  2ZC3 A;  2XTJ P;  2XS7 A;  3BSA A;  1PGZ A;  2YWK A;  4WK1 A;  1H2U X;  1JNZ B;  1SV5 A;  1JLG B;  5B09 A;  4Q2M A;  3FQK A;  1KS2 A;  5FD1 A;  3I82 A;  4JYA F;  3KK1 A;  1HNZ F;  3NG8 A;  2AZ3 A;  5A76 A;  1EZZ B;  1VFJ A;  3G96 A;  1IBL J;  2KHC A;  1KTV A;  2QL5 B;  1UFW A;  2L08 A;  2DR7 A;  3QRR A;  5C7P A;  1BMQ B;  2BE9 B;  3MM7 A;  1ARO P;  1ZS6 A;  3VAM A;  2IJN A;  3K5O A;  3QYY A;  3VTI A;  5JVG Q;  3LPE A;  4LSN B;  1ZOT A;  1NJY A;  4R25 A;  5E0O A;  2HK3 A;  3R5G A;  3PW0 A;  2YH0 A;  4LR9 A;  3VAG A;  5I3P A;  4PXB A;  1SQG A;  5B0A A;  2FC9 A;  4L76 A;  3T1Y J;  1BE4 A;  5DG7 A;  1EJ7 L;  4P6Q A;  4ZLJ A;  4ZN1 A;  5EHH A;  3QRP A;  4L75 A;  2MZT A;  2V2K A;  4DHV A;  3HO1 A;  2RS8 A;  5D4P A;  1W25 A;  1U4B A;  3PW4 A;  3Q0A A;  3FEX B;  5EUH A;  3PRB A;  4AXJ A;  3CMQ A;  2MGZ B;  1CJK B;  2HS0 A;  2Y0B B;  2XYP B;  3RZA A;  3OSN A;  3T1H F;  2W7P A;  1Y10 A;  4ZK7 M;  2ZUA A;  2L9W A;  1J27 A;  4KY3 A;  4JI2 J;  1K1Q A;  2PGC A;  2OMO A;  2J7U A;  1X4E A;  3VAK A;  3AOD A;  4ZLL A;  2OPP B;  4C11 B;  3ZTO A;  5D0H A;  1WHW A;  1FER A;  2E5G A;  2F4V F;  1FVQ A;  1O6X A;  2KHD A;  3Q2S C;  4KHR A;  4KFB A;  2E1M C;  2WOM A;  2UZA A;  2XSJ B;  4LFA J;  1UL3 A;  4C6A A;  4DFJ A;  4NLO A;  3PX4 A;  1PJ6 A;  2X3D A;  4J9M A;  3M2V A;  1RWU A;  5C24 B;  4J9N A;  3BGR B;  3TO8 A;  3RRH A;  1Y5N B;  4P75 A;  5HP1 B;  2PMW A;  3L4B C;  2V63 A;  1HBM A;  2D3U A;  2DNQ A;  1IBM J;  4QPX A;  4O44 A;  4ZP8 A;  3TJ8 A;  2FVP A;  2QIF A;  4I0W A;  2XLJ A;  1Y4Z B;  2UV8 A;  2KFZ A;  2DRA A;  3M8W A;  2J9E A;  4TU7 A;  1U0H A;  4DF8 A;  4BCA A;  3JYT B;  1AYE A;  2NSB A;  2QFI A;  3T6B A;  4DV3 J;  3US5 A;  4RNF A;  4OJG A;  2JH3 A;  3V6K A;  2HPU A;  5KT2 A;  1BQN B;  4H54 A;  4KC5 A;  5KT7 A;  4F67 A;  2R8H A;  1RUS A;  3I5C A;  2N7Y A;  3CDE A;  2C2O B;  1NB2 A;  2GJF A;  2ZOG A;  4CM0 A;  1JLC B;  4J7C A;  3OL8 A;  3S6E A;  1SJQ A;  3F73 A;  3W8P A;  3FKB A;  3CPW R;  5HK4 A;  1SCJ B;  2ACM A;  4X64 F;  1XNQ J;  4TY9 A;  2MLX A;  1HHT P;  4I7F A;  1LW2 A;  2AJF E;  3Q24 A;  3MM9 A;  3OFF A;  1S77 D;  3T6J A;  1WC6 A;  5FLX Y;  1H7W A;  3TAN A;  3KMQ A;  4I6Y A;  1UWA A;  2KT2 A;  2YKP A;  2FHJ A;  2M8D B;  5LOQ A;  1Y00 A;  4KH0 B;  2BR0 A;  5KOW A;  3AB2 B;  3MOZ A;  1F1B B;  3M9M B;  1MU2 B;  2OPQ B;  5LSO A;  1CSJ A;  2WSE C;  1B7F A;  3TAM A;  4BHQ A;  4FS2 A;  5EWE A;  2KB2 A;  3D67 A;  2AKW B;  4ECU A;  4EU0 A;  1I3O B;  2KT3 A;  3HX9 A;  1YI2 S;  2YNG A;  1QSY A;  2OGU A;  1MNE A;  2NZC A;  1NDK A;  4YHH F;  3KNA A;  4AXI A;  2ILZ A;  2B3T B;  2CYY A;  5HMX A;  2I0X A;  2MQL A;  1D9D A;  4TYB A;  1OJ4 A;  4HTJ A;  2OFG X;  2CJA A;  2LQ9 A;  5L1L A;  3V4I A;  3DU6 A;  3VGU A;  1S1X B;  2Z58 B;  1FRH A;  3ZZO A;  1U25 A;  2IPO B;  4UY8 T;  4RPF A;  2UXB F;  3M6V A;  1VC6 A;  3W1Y C;  1T9W A;  5HBM A;  3IFE A;  2DYA A;  3OFG A;  1KD1 T;  3OLB A;  3KG0 A;  3CXC R;  4URQ U;  1P6T A;  4K4Z A;  1FCA A;  3IBC B;  3G8S A;  2KZM A;  2Z56 B;  1VDH A;  4ILM A;  1HIY A;  4I69 A;  3T5K A;  3KUH A;  1R8A A;  4WFY A;  1QSL A;  4B17 A;  1G3O A;  5IC4 B;  5D4L A;  5IV3 A;  4RW9 B;  3H5Y A;  2D9O A;  1XWL A;  4GVB B;  2FDN A;  4ES3 A;  3P8B B;  4P10 A;  2JC0 A;  3C8Y A;  3HFZ B;  2E9R X;  1VQN S;  4TLR A;  4RO0 A;  2ZH5 A;  2BUN A;  3TX0 A;  1JJC B;  5D77 A;  3T9Z A;  4ECR A;  2DXF A;  1N88 A;  5M2U A;  1G2E A;  3M8Q A;  3DRR B;  3MR7 A;  4I56 A;  1X9M A;  2F7V A;  2Z8Q A;  1WC3 A;  4ZP9 A;  1JMT A;  4I67 A;  2GAH C;  2HHP A;  2VOD A;  4B9L A;  4N76 A;  4F4X A;  3BR8 A;  1RB0 A;  3PG9 A;  2C2E A;  3JB9 k;  1U0S A;  4CH7 A;  3RGI A;  4DU7 A;  1T8E A;  4B3O A;  3VAF A;  5K8O A;  2PO4 A;  3AA8 A;  5J2Q A;  1XMQ J;  2QO3 A;  5A8R A;  2LU2 A;  1FK9 A;  2B43 A;  1QY7 A;  1EIY B;  4NLG A;  3R6L B;  3SSQ A;  1RT2 B;  2LXF A;  2XO6 A;  2FJB B;  3AH6 A;  4LF4 J;  1V9O A;  2A3J A;  3DLH A;  3M4X A;  3PX0 A;  3OFH A;  2DY9 A;  4DU8 A;  4WE1 B;  4C8M A;  3IGN A;  4LF6 J;  3O8W A;  1M1G A;  2O1P A;  2BE2 B;  2VBY A;  3BR9 A;  3CWJ A;  5RUB A;  2HFO A;  1MSW D;  1S5Z A;  1NK6 A;  1NJI T;  2DNR A;  1RT6 B;  4WFX A;  2PFD A;  4FNH A;  1GAO A;  3DCA A;  4DV2 F;  2AU0 A;  5KG7 A;  3OL6 A;  1Q4R A;  3ILI A;  1VRT B;  1P9Q C;  2K06 A;  3I0S B;  3HD2 A;  2DHX A;  2P9E A;  3A3N B;  2UUB J;  3CCZ A;  1VIO A;  1FWK A;  4CWB A;  2W2N P;  2RHS B;  1TL4 A;  3FNN A;  4QU6 A;  2LDY A;  4WFN Q;  4IG3 A;  4ED7 A;  1SKS A;  4J9V A;  2IRY A;  1PC4 A;  5B0C A;  1W2I A;  4Q0B A;  3WX4 A;  2D41 A;  2GIR A;  2ZOM A;  3H25 A;  4CH1 A;  3GLJ A;  4AD6 A;  4LIR A;  2PC6 A;  4OLO A;  3HPO A;  3R5B A;  2VG5 B;  4LF9 F;  4ZVG A;  1VCT A;  3TRG A;  3KK3 A;  3P4U B;  4NCB A;  4NA1 A;  3FBF A;  1FRJ A;  2LFV A;  2XG8 A;  1ZM2 A;  3Q86 A;  4PQA A;  3KDN A;  4AFF A;  5T7L A;  4JI1 F;  4UST A;  4G1P A;  1HNX F;  3C6U A;  4NCA A;  4WFA Q;  3BV8 A;  2ROG A;  3PFO A;  4TY8 A;  3CJQ A;  2ROE A;  3QRQ A;  4ED6 A;  3ZTR A;  2XCA A;  3L7P A;  3SCK E;  3CC4 S;  2W7A A;  2PI5 A;  4ITS A;  3GU0 A;  2E5I A;  3VGV A;  2XLK A;  3M9N B;  2B8Q A;  2R2U A;  1HWU A;  5GAH U;  4USJ C;  4Q5V A;  2PDA A;  1S6U A;  1TAQ A;  3Q8Y A;  4R5P A;  4N56 A;  3PRV A;  4K50 A;  4DPT A;  3BH7 B;  4ERD A;  2KT5 A;  3HVA A;  3MCS A;  3GPA A;  5DM6 Q;  4LMZ A;  4ZJL A;  1TL3 B;  2HFU A;  1CUL A;  3NS7 B;  5HQL A;  4WYL A;  3VV2 B;  1RXO B;  2VUG A;  4OJ3 A;  1LOU A;  1KVJ A;  4TQR A;  3OR1 B;  3PM9 A;  4DFK A;  2DHS A;  4DR1 F;  1VQY A;  1ZH5 A;  4ED2 A;  4HHU A;  5BR8 J;  4GC7 A;  4FXD A;  4X62 F;  2JLE A;  1R8B A;  2HFN A;  2VFU A;  4JV2 A;  3DRP A;  2EWH A;  5K14 B;  1M5V C;  2HBZ B;  3IMQ J;  3K5P A;  3LP0 A;  4G6V B;  1R8H A;  5F3T A;  1RHU B;  3GR1 A;  3ETM A;  4OI4 A;  3E01 B;  3UDV A;  3C14 B;  1ZTT A;  1AUD A;  3GJS B;  4DI6 A;  3LGM A;  3OHA A;  5HRO B;  1S4E A;  2OJ3 A;  4I64 A;  1K8A T;  3N0V A;  2C1E B;  1QTN B;  2GVZ B;  1WNE A;  2HHT A;  2HWI A;  3C6T A;  1NUE A;  1FRI A;  3B6B A;  4YP3 A;  1KEK A;  2ZEJ A;  3DRS A;  2BW2 A;  5C2C A;  4NA2 A;  1VRU A;  3IG1 B;  5D0R A;  4A8K A;  3FSX A;  4DSL A;  2RIJ A;  2BVZ A;  3GIR A;  3T5J A;  1ZYQ A;  3DHW C;  4GRS A;  5B0E A;  3CUL A;  2ZBI A;  2ABY A;  2KKH A;  2YKN A;  2HRT A;  3ICL A;  3OJU A;  1UMJ A;  4EMD A;  4DV7 F;  1RWP B;  4IDK A;  4DR3 J;  4ED1 A;  1VLO A;  1ULR A;  2EK1 A;  5I4M A;  1OIA A;  2QMU B;  5I3U B;  1FDB A;  5GAD I;  3OTO F;  3IWN C;  3TAQ A;  4PG6 A;  4N5S A;  1E6Y B;  2M9K A;  1W7W A;  5KFK A;  2HQ3 A;  1FO1 A;  4QIE A;  2JWN A;  4IR9 A;  1RDR A;  4G65 A;  2ZHA A;  1ZAX A;  2AEF A;  4C0O C;  3A1Y G;  4NXM J;  1X4B A;  2MZ1 A;  2ATC B;  4NX9 A;  1PO6 A;  5IT9 Y;  2Q43 A;  3VVT A;  4J37 A;  1D8Y A;  1Y5I B;  3UQS A;  3IN5 A;  2BX6 A;  4F4W A;  1XNR J;  4P2S A;  1FEE A;  1NK4 A;  1RTJ B;  5J2P B;  2DHG A;  1TEL A;  1B0P A;  1VQP S;  1QDU B;  1S6P B;  4JI0 F;  3KLH A;  3IRX A;  3M8S A;  5ETT A;  1S1V B;  1H0H B;  4IH7 A;  1MN7 A;  5A8W B;  2FLN A;  3V6J A;  3KOA A;  4K2J A;  1T7P A;  1U7L A;  3W2W A;  1D9F A;  4K8R A;  2FVQ A;  2I2Y A;  1WEZ A;  4UOH A;  1URR A;  2FYX A;  4NLV A;  2AJ2 A;  2IMO A;  2RJZ A;  4DL2 A;  1UVI A;  2PEH A;  3KXD A;  2JOQ A;  4B3M F;  1DUR A;  5EX3 A;  1Q1K A;  1Q8B A;  1I5O B;  2CQH A;  4C3L A;  5A2Q Y;  3J81 Y;  2IC3 B;  3UR3 C;  1Q78 A;  3DI6 A;  4TXS A;  2G13 A;  2CJK A;  2KRB A;  3AHP A;  4OX7 A;  2VQE F;  1N32 J;  4DL5 A;  3D1Q A;  3BSO A;  3DGP B;  1HA1 A;  5E3Q A;  2BQR A;  2RKI B;  3SDE A;  4BS2 A;  4FNI A;  4IO9 Q;  4O0N A;  4LRB A;  4CLK A;  1TUW A;  3DLK B;  4N8O A;  4QQB A;  4WWS A;  2UUA F;  5BYS A;  1VC0 A;  5IZH A;  3LP2 A;  4HDH A;  1F9F A;  4WFB Q;  3KTQ A;  2WVF A;  4KJI A;  4DL6 A;  5J2M A;  1WF1 A;  2PD1 A;  3KLE B;  3HZE A;  2DK2 A;  5IT0 A;  2XY7 A;  1FRX A;  3RG6 A;  1VS3 A;  2P9C A;  2YWG A;  4RW8 B;  3RB6 A;  2XI2 A;  2EEY A;  2D3O 1;  2JEF A;  5DDP C;  3CJS A;  1N5Y A;  3UCG A;  2QLF B;  3K7R A;  3KJV A;  5HLF B;  3CD5 A;  2XY6 A;  4ID8 A;  1SKU B;  2GGP B;  3G4S S;  3CD7 A;  2MZS A;  3O44 A;  3GII A;  1FKP B;  5IXU A;  1SXL A;  4CLZ A;  2W2P P;  4BWM A;  4IG0 A;  2Z2L A;  3R7N B;  4LF1 A;  1GQE A;  4ID5 A;  1TP7 A;  1VQO S;  4DQR A;  3Q8U A;  1XBW A;  1GX5 A;  3ILJ A;  1IJE B;  1NND A;  1NPK A;  2ZBP A;  3D0G E;  1HPZ B;  1TFY A;  3KLG B;  4RZR A;  1SC6 A;  2NLW A;  3J7Y U;  4DUZ F;  1KC8 T;  5IS2 A;  3A4T A;  5F8J A;  4NLQ A;  3CCU S;  1HQE B;  5B0G A;  3PAC A;  1RAE B;  1ZZN A;  5J1P A;  2GVD A;  4MK7 A;  4WJB A;  3D66 A;  3KDO A;  2WB4 A;  1U24 A;  3FCV A;  3O5T B;  4ZVS B;  1L3K A;  3C16 B;  4USU A;  1C1B A;  4LQ9 A;  2QRR A;  5DM7 Q;  3UD4 P;  2QTW A;  4X4T A;  1Q86 T;  4IRC A;  1Y7P A;  3W61 A;  4J90 A;  3GP9 A;  1EP4 A;  4TN2 A;  2UXC J;  3HFK A;  2RML A;  1WG5 A;  5F41 A;  4BBY A;  2WK4 A;  3CJT A;  4OI3 A;  2O66 A;  1REV A;  4DOZ A;  3PEH A;  2YPZ A;  3KJF B;  4DPU A;  2VG7 B;  1VBX A;  1SV5 B;  4J9P A;  4GO7 X;  2HZV A;  3OTB A;  4Y3C A;  3J80 U;  3NNC A;  1IN0 A;  4A8S A;  4M5G A;  3DOM A;  3AOC A;  4KKO B;  5D3G A;  2MQQ A;  2XB2 D;  1ZM9 A;  2V4J A;  1IR2 A;  3M05 A;  1IQT A;  1KOO A;  5L1J A;  4DCP B;  3QLH A;  9RUB A;  1TKZ A;  3N01 A;  4IFV B;  3OXL A;  5EWG A;  4GC6 A;  5JJB A;  1H7X A;  4UUW A;  3QO9 A;  4J9R A;  5L38 A;  4B3T F;  4WP8 A;  4Q2L A;  3CCV S;  4PUO B;  1M1H A;  1D9A A;  5E33 A;  3VCD A;  4PEO A;  4HT7 A;  4P2F A;  4KBI A;  4A4J A;  3DC2 A;  3ZFV A;  4IRD A;  2VH7 A;  2IA6 A;  3T3F A;  5IQQ A;  1M5K C;  2RNE A;  1H38 A;  4LSL B;  3MM6 A;  3IWX A;  1V6H A;  1F5B A;  4K4Y A;  4AE5 A;  3QWU A;  5L1I A;  1Q53 A;  1EB0 A;  3DLE A;  3NAH A;  4DQI A;  5FDL A;  4KHP J;  1APS A;  1ZPV A;  3CB4 A;  4L74 A;  2R7U A;  2C3U A;  3MAQ A;  1FTR A;  1U2C A;  4DBQ A;  4FDF A;  5H9E K;  3RR8 A;  3QIP A;  3R5A A;  4F3Q A;  3OVS A;  1ELO A;  1N34 F;  1NME B;  2QMW A;  4JI8 F;  1M90 T;  3D1O A;  5B0F A;  3CJ4 A;  3I9Z A;  5KFQ A;  4AL7 A;  4X4Q A;  2IBK A;  2G2Y A;  3TA0 A;  3K2Y A;  9ATC B;  1D1U A;  3U7J A;  1X9W A;  1Q95 G;  1VMB A;  2N7C A;  1FJE B;  1T95 A;  4GVL A;  1LK7 A;  4X4P A;  3UDL A;  4P7T A;  1WUU A;  3RAX A;  4OJH A;  3THV A;  2L3M A;  4UZB A;  4R0E A;  1KQG B;  1F3V A;  2C3O A;  3H2V E;  3QJL A;  2HNY B;  2UVR A;  1TK0 A;  4KFB B;  1RTI A;  1RTH A;  3EGV A;  2CWK A;  4K0K F;  1P8G A;  4K4T A;  2MB0 B;  1VBY A;  2DGX A;  3KLV A;  1IKY A;  1IWG A;  1FX4 A;  1HWJ A;  3M2V B;  5LXR A;  2E5L J;  2B6A A;  2VV5 A;  1OY8 A;  3H40 A;  4EZ6 A;  1LWE A;  4MMO A;  3D4J A;  2VBW A;  3E2E A;  3BO4 A;  1SQE A;  2WSF C;  2ZNZ A;  4OZ3 A;  2LYV A;  3NCR A;  4O44 B;  1IBK J;  4LQ3 A;  3TAR A;  4OZN A;  1RGV A;  1RYR A;  1GTE A;  3C2P A;  4JI4 F;  3O3L A;  4QIG A;  2ZH2 A;  3M6U A;  2M3D A;  1S7I A;  2R7W A;  3JAM Y;  2UP1 A;  3JQM A;  3A8K A;  4LFB F;  2EBG A;  3EE3 A;  3IC1 A;  2OH2 A;  2HQG A;  4DV1 J;  2B8P A;  3T41 A;  3F44 A;  1RT1 A;  3M9O B;  2HVI A;  3MD3 A;  3KYL A;  1QAJ A;  1NK9 A;  2L9N A;  1DAR A;  2MPU A;  3AJD A;  4CIO A;  4EZ9 A;  3QAU A;  1Q81 T;  3QT5 A;  3VF0 B;  3HF5 A;  4C0H A;  2HK2 A;  2RT3 A;  1HNW J;  4F36 A;  4ZPC A;  2YXL A;  2WB1 D;  4UOG A;  3L3C A;  4F26 A;  5D8H B;  3IRW P;  5EN1 A;  1O8B A;  2BW7 A;  2HAF A;  5IV4 A;  1U48 A;  4I7F B;  5KFP A;  3MM5 B;  1S12 A;  3TJA A;  1RBO B;  4FYW B;  2Y8Y A;  1G1X A;  3JSY A;  4M1K A;  1JWW A;  2DGT A;  2PN6 A;  1C0T B;  4O3N A;  2CPY A;  3H59 A;  3RBE A;  1VQL S;  3V4M A;  4C8O A;  1X5P A;  3BPD A;  2YKM A;  3RBZ A;  4LJM A;  3MEG B;  4B3S J;  4CRJ A;  2V94 A;  4NXN J;  5HMW A;  4K5S A;  2ZJQ Q;  1U6B A;  2CNN B;  4M63 A;  2E1C A;  1Q16 B;  3TAM B;  1Z2L A;  4MIA A;  4DR2 J;  1HFE L;  3D5M A;  1WD6 A;  3GIJ A;  1JX4 A;  1P1T A;  2RUS A;  3EX7 B;  3GCX P;  5MAO A;  4OJ1 A;  5CYJ A;  3GYN A;  1S0N A;  2VC1 A;  1NSP A;  2CZ9 A;  4N7T A;  3EXC X;  5CA5 A;  4JV5 J;  1IKW A;  3SMZ A;  3H4D A;  3LO3 A;  2BRK A;  2X7I A;  2YBV A;  5HVG A;  1NXI A;  3HT0 A;  1IKX B;  2RF2 A;  1BLU A;  3TVZ A;  5HBM B;  1PSD A;  1F60 B;  2XS2 A;  3PEJ A;  1CJV A;  4CTA A;  3MUV P;  5HAT A;  2BOA A;  3VAL A;  1T11 A;  1N0V C;  2JSX A;  1NSA A;  4DN0 A;  3DYA B;  4NEY A;  2KI2 A;  5I42 A;  4OX8 A;  2HRY A;  1U09 A;  1TAU A;  3G6E S;  1SBR A;  3JSM A;  1LKZ A;  4OV6 A;  1B70 B;  2Q66 A;  1P1L A;  3U02 A;  2AT1 B;  2YX1 A;  3HP6 A;  1QSS A;  2WON A;  2KJV A;  3MHY A;  3CJ8 A;  2UVW A;  3KK2 A;  2K3I A;  5E41 A;  3LAK A;  5JVH Q;  4B3R J;  4KGM A;  4NA3 A;  5DQH A;  2CPX A;  3BN7 A;  2OI2 A;  1YX2 A;  2GFF A;  3P3D A;  3DDK A;  4KO0 B;  5F8H A;  5IFM A;  4PWW A;  1CJT B;  3LGN A;  3GJQ B;  4JI5 F;  3WDO A;  1GXL A;  3NWG A;  2IM1 A;  1C1C B;  3KG4 A;  4ZN3 A;  4OYX A;  4LBP A;  4ZPT R;  2CA9 A;  1SL1 A;  4E0D A;  2XBP A;  4PG7 A;  4ZVO B;  5CYQ A;  3BYR A;  5KOX A;  4MAK A;  3UPF A;  2XNR A;  2JLG A;  1WTB A;  5A8R B;  2HFV A;  3H98 A;  4RBV A;  2DNY A;  2Y0S D;  5KFO A;  4FBU A;  2OML A;  3IR6 B;  2V8H A;  2ZZM A;  2CXE A;  1TL7 A;  1ROF A;  1U26 A;  4J9S A;  1S7H A;  3PO5 A;  1R0B G;  1XTZ A;  3OL7 A;  1IUJ A;  2DB1 A;  3ZTQ A;  4Y6I A;  4F4A A;  2VQF F;  2H48 B;  4JI3 F;  4F04 B;  2KJW A;  2YH1 A;  2EFQ A;  2FY8 A;  4ZPV R;  3JTO A;  2XCP A;  3BGF A;  3S01 A;  4CO0 A;  4AL5 A;  2JEI A;  3OVA A;  4ZPW R;  1NH8 A;  2FVR A;  2HSE B;  2RDJ A;  3GG1 A;  1LQ9 A;  1HNI A;  4DV4 J;  5KFM A;  3D28 A;  1HI8 A;  4YUD A;  3UD3 P;  4DSK A;  1IBC B;  3TEG A;  1WF0 A;  4F02 A;  2LEC A;  2CPJ A;  4OYO A;  4IG3 B;  2B51 A;  4LF8 F;  2F5G A;  1VQ8 S;  3RJM B;  2VA3 A;  2R42 A;  3PW2 A;  2KVI A;  2IFX A;  2FZC B;  4Q0B B;  1SUQ A;  2MKK A;  2BEF A;  2GJ2 A;  5ETP A;  4UTG A;  1NPP A;  2AWZ A;  2FZG B;  4HHJ A;  2DVI A;  3BYP A;  3TP2 A;  3DFE A;  3R2D J;  3U1N A;  2QL9 B;  1S9E A;  2B5J A;  3KK3 B;  3D6T B;  5J1N A;  3I5B A;  4Q45 A;  1S4F A;  2GQC A;  1KLN A;  3D0I E;  2EVZ A;  3I87 A;  4CO4 A;  2NXJ A;  5T7L B;  3BRE A;  2LVW A;  3ZXW A;  2QA4 S;  2MLZ A;  1WAC A;  4JP8 A;  4W90 B;  3UD5 A;  2V9W A;  2DGW A;  2KM8 C;  4NL5 A;  1IBL F;  3NGD A;  1A9N B;  4ZVU B;  1N8R T;  5G0R A;  1X4D A;  4K5R A;  1FF2 A;  1V5I B;  3CD6 S;  1SJR A;  1SJ3 P;  5KFF A;  1YJR A;  2CWX A;  4B9U A;  2B9E A;  5HSP A;  3SQG B;  1AA1 B;  5C5J A;  5EGY A;  3DU5 A;  4C4W A;  4RX6 A;  1U8S A;  3MPW A;  2F63 A;  4BC9 A;  3M30 A;  2CNL B;  1WKJ A;  2I9S A;  3FC9 A;  4LR7 A;  2ADC A;  3C15 A;  4A8Y A;  3FQL A;  3CNQ P;  3R7S B;  2R7S A;  1JXL A;  1M5O C;  2QA2 A;  3T1Y F;  2KZZ A;  4BWJ A;  1HNV A;  4DG1 A;  2NZ4 A;  3DRP B;  2BA9 A;  4WP9 A;  2OEM A;  1U1R A;  3A3P B;  2WZ1 A;  3LP0 B;  4DQS A;  4DL4 A;  5CCM A;  1YJ9 S;  4DLE A;  1T0T V;  4K2X A;  2P8I A;  2DIS A;  3MWB A;  2HW3 A;  5KFC A;  1GEH A;  1RYS A;  3LOU A;  2EW9 A;  1G6B A;  2CQ4 A;  1EKR A;  3EXY A;  3RB0 A;  2BQU A;  3CDB A;  4IOA Q;  4GMK A;  4NZ6 A;  3HVW A;  1X4G A;  2XHC A;  4AND A;  4JI2 F;  3C6T B;  4NLW A;  5E5N A;  5DRK A;  2XYG B;  2ZH8 A;  1PYS B;  3MR5 A;  3A8J A;  2XMV A;  5BJR A;  1DLO B;  4IQX A;  1FJG J;  2J6S A;  4FF1 A;  1GXT A;  4IRK A;  1QE1 A;  3HSZ A;  4LFA F;  3HVT A;  2YNH A;  4G1Q A;  2YKN B;  4RW4 B;  3NMA A;  2WBR A;  3BKU A;  4P72 A;  4M5M A;  1A7G E;  3CC7 S;  4QWE A;  4CO3 A;  1WSR A;  2M7S A;  2QLB B;  3UW1 A;  2OEJ A;  3CE8 A;  3QT8 A;  2K7J A;  3LW5 C;  5DGB A;  1SJF A;  1IBM F;  4QPT A;  1U1L A;  2CG8 A;  1EET A;  3ZZZ A;  4PQU A;  3FGV A;  2JHE A;  4OQJ A;  1T05 B;  3MPY A;  4I2Q A;  2NSC A;  4OHW A;  3OJS A;  5F8G A;  2APO A;  2J7W A;  1PYO B;  4ETX A;  2H54 B;  1UW4 A;  5A6P A;  1DTQ A;  2ZKU A;  4MIW A;  3GFH A;  4A8X A;  2L41 A;  5K8M A;  3M8Y A;  4DV3 F;  5KFI A;  3OLA A;  4KR0 B;  1WC5 A;  1R6Y A;  1CVJ A;  3UCZ P;  4DX8 H;  2VG6 A;  3AQP A;  4OZ2 A;  1HI0 P;  5D4O A;  4KSE B;  3VZH A;  3KLH B;  3EGW B;  4JB8 B;  2V4R A;  3EPG A;  1MWY A;  3ENW A;  1F2G A;  3J7Z 5;  3FCW A;  3HLU A;  3LWM A;  4RNH A;  4PWU A;  1VK3 A;  3R5C A;  1KQF B;  4WCE Q;  1XNQ F;  2MQM A;  3D0H E;  4ECV A;  2DNH A;  3E8O A;  1H72 C;  3W2W B;  4ZVT B;  1JLA A;  3K5L A;  1KQS R;  2OAU A;  2GQQ A;  1OYE A;  4WYW A;  2DGS A;  4TVA B;  3IAM 9;  4YR2 A;  5CH7 B;  2CQI A;  5D15 A;  2OPR A;  4U95 A;  3MOJ B;  2HHU A;  3OUY A;  4MK9 A;  1TV6 B;  4ZCI A;  1SIZ A;  4M5I A;  3W2V B;  3GV5 B;  4DSE A;  3DI6 B;  1YJU A;  5KFN A;  4FZV A;  4J5O A;  3KG1 A;  2CQC A;  4LSZ B;  4Z7C A;  3I32 A;  2QE5 A;  4EBD A;  4H4K A;  4DWI A;  4KGZ B;  4OZ0 A;  4M5N A;  2BJ8 A;  1XC9 A;  2DXE A;  4K4X A;  2PSZ A;  5ETQ A;  2MSS A;  3SSR A;  1ACM B;  1SH0 A;  2RDD A;  3HVR A;  1NZ8 A;  2HQF A;  4P73 A;  1WHV A;  3CJK B;  3RBD A;  2MYF A;  2J9D A;  1SI9 A;  5J2M B;  4CNZ A;  2R7R A;  1RT4 B;  2DTJ A;  4YB5 A;  3BQ2 A;  1VGY A;  4BDP A;  3IP0 A;  3MMJ A;  1E6V B;  3PDN A;  3EDR B;  2RU9 A;  4WXO A;  4QWA A;  2YWE A;  4PZV A;  4N8N A;  1LWX A;  1UW9 A;  4GKK J;  1N5Y B;  2RQM A;  3HDS A;  3KJV B;  4DV0 J;  3RR7 A;  1QVF R;  5KFG A;  1OPZ A;  2LQ5 A;  2CAD A;  2FC8 A;  4O3P A;  3MEE B;  3IS9 B;  3NEK A;  2YX4 A;  1M5P C;  2BMB A;  3PY8 A;  3N9U C;  1RTZ A;  1U2R A;  4DPY A;  1HQU A;  1YIJ S;  4OHX A;  4IG0 B;  4U7C A;  3ET6 A;  2ZM6 J;  1D8Z A;  2M52 A;  2K1R A;  3I0R A;  1S1T A;  3FEZ A;  4QR0 A;  1EKS A;  1NSK L;  4X65 J;  1UKU A;  3CDA A;  4ILL A;  2AEJ A;  4NLY A;  2Z2Z A;  4LFC J;  1VHI A;  4C8K A;  5CYM A;  3TAP A;  4HAC A;  4DS4 A;  4OZ5 A;  1LNQ A;  1TK5 A;  4O0I A;  2CNK B;  3AXM A;  2OPS A;  1CQN A;  1S6Q B;  4ZHR A;  4RL1 A;  5HMY A;  5DDO C;  4ES1 A;  1JXV A;  2BJ9 A;  1KR4 A;  2GVD B;  4UW2 A;  3CCW A;  4RW6 A;  4U8Y A;  1FA0 A;  2V69 A;  5DQG A;  4F2S A;  1RQ0 A;  1C1B B;  2UUT A;  1NH7 A;  1RHK B;  2WHO A;  1CBK A;  1HHS A;  3HM9 A;  4NLP A;  3CSK A;  1F5C A;  7AT1 B;  2ZDP A;  3NCP A;  1JLG A;  2R7X A;  2A2C A;  1RAF B;  4B9N A;  4O3R A;  3QQC D;  3G2X A;  1REV B;  4QR2 A;  5KFB A;  1XJW B;  5KFJ A;  4USH A;  2CNO B;  4NWB A;  1REG X;  3FRY A;  3EDQ B;  1IKV A;  4ED5 A;  3WC2 A;  2DRD A;  5H1S V;  4RBU A;  2VZ9 A;  5D3G B;  3GIL A;  1PIL A;  4CH0 S;  2N4D A;  4ZVR B;  1XMQ F;  2CG4 A;  1KTQ A;  3MMA B;  3QLH B;  1RKI A;  1TKZ B;  3ADA C;  4X4U A;  3ZZU A;  3DHX A;  2EFV A;  3GFX A;  2XY5 A;  2HS4 A;  1IM6 A;  1RU2 A;  5HO4 A;  4LF4 F;  1RT7 A;  2HWT A;  1QD1 A;  3UVJ A;  4PXE A;  4LSN A;  4LF6 F;  2AZ1 A;  5T14 A;  2ZC4 A;  2XMJ A;  2HFS A;  2W4P A;  2B9Y A;  3AQO A;  1UFK A;  4L73 A;  4DQQ A;  1YK9 A;  1S76 D;  3CJ2 A;  2IBO A;  4XTT A;  2RS2 A;  2G9O A;  4A8M P;  3D54 A;  1WF2 A;  3ZZP A;  2FGC A;  1TK8 A;  3NOC A;  5ETN A;  2R7T A;  5GMD A;  5FDL B;  1XEZ A;  1R7I A;  4FYY B;  4GKJ J;  4RW7 A;  1HYS A;  1N4L A;  2H4W B;  1ZM3 A;  2UUB F;  3ITH A;  4HTI A;  4HH0 A;  1VLY A;  1KN6 A;  1QM9 A;  5KT3 A;  1N5T A;  2NUH A;  1VK8 A;  4KGK A;  4KYZ A;  3QIP B;  2V68 A;  3G82 B;  2NXC A;  2UVV A;  2MGZ A;  2AP6 A;  1H2T Z;  1MMD A;  3PKY A;  5KT4 A;  5DDQ C;  5LSR A;  4FVC A;  3DNC A;  3TEH B;  3ZTP A;  2BQ3 A;  2FHM A;  3ZZY A;  4OI6 A;  1QTM A;  2RAQ A;  1JXE A;  5KFY A;  2PT0 A;  3J80 Y;  3R97 A;  3N4W A;  2VFR A;  4OI0 A;  3V2U C;  1OSC A;  4Q43 A;  2R8J A;  3K5M A;  4NML A;  3FBE A;  2XSJ A;  1SC3 B;  3A3O B;  3SSS A;  3KHG A;  2J9C A;  3J81 j;  2ZZN A;  2IM2 A;  4DR4 F;  3MFH A;  1XR5 A;  3POT A;  3BGR A;  4DV7 J;  1RTI B;  1O51 A;  4D3H A;  2BJ7 A;  2DGV A;  2W25 A;  4EO6 A;  4ZIT A;  4Y2C A;  3SQO P;  2B4U A;  2GHV C;  4YB6 A;  1VJW A;  3EYZ A;  4MYU A;  4NRT A;  5HP1 A;  3B4M A;  3RW7 A;  1X4A A;  3RRK A;  3KJQ B;  1XMO J;  1J2V A;  5CCL A;  4PYD A;  1KP6 A;  2FHO B;  3H20 A;  1JLB A;  3TUP A;  2QJ3 A;  3QSY B;  1LWE B;  1TKD A;  5IWA J;  2F9D A;  1PAU B;  1RBA A;  1X4F A;  1HAR A;  2NCK L;  5B08 A;  4DPX A;  3HCX A;  1VJQ A;  1PCA A;  4NYP A;  2F8M A;  6AT1 B;  2IYG A;  5L8R C;  3L7O A;  3MMC B;  3W8G A;  3MUR P;  2UXD J;  3EZO A;  5BR8 F;  3J7A 1;  1TR0 A;  1VQM S;  1UWB A;  4WKR A;  2SXL A;  2DNO A;  1CEZ A;  3HHE A;  3T5L A;  3CGI A;  4LF2 A;  2GMJ A;  4FXW A;  1BQN A;  4ANC A;  2RB7 A;  3VHQ A;  3CCE S;  4U67 Q;  1YRX A;  4PR6 A;  4ZIV A;  4RU9 A;  3GIM A;  3PYD A;  3QSI A;  2BE7 D;  4YY3 J;  3G9C A;  1BWE A;  4OFZ A;  1RT1 B;  1JLC A;  2JX2 A;  4CDI A;  2IA0 A;  3AXK A;  3MCM A;  4I4B A;  1ITP A;  1FKO B;  3PW7 A;  5KFA A;  5DQI A;  1N6Q B;  2A1B A;  3W9I A;  2JC1 A;  4ECT A;  4X4R A;  4ZVQ B;  1FNM A;  2UU9 J;  2BOP A;  4EBC A;  5CD4 A;  4ED4 A;  5AT1 B;  4YDD B;  2M8H A;  3UDE A;  2CQB A;  2AYG A;  4CO1 A;  1PIE A;  3LUY A;  4W98 A;  1UEV A;  3B54 A;  5CAB A;  2QYG A;  1U02 A;  2MZQ A;  2CJQ A;  5T41 A;  4F4Y A;  2HVD A;  3GV7 B;  1BWV A;  4RKU C;  4YR0 A;  4EYH B;  1N5Q A;  2R8K A;  2VPY B;  2MJU A;  2XGQ A;  3QGP A;  5LJ5 Y;  2C2M B;  3BF4 A;  4DR6 J;  2YKO A;  2YKM B;  4NI2 A;  3EUN A;  1A6L A;  4DR3 F;  1R89 A;  5E3C A;  4P71 A;  1N36 J;  3TVY A;  3MAA B;  2VA2 A;  1VQ7 S;  2J0Q D;  1RAO A;  1BQX A;  2AD9 A;  3CTR A;  4C3M A;  5I3Q A;  5GAH I;  4FF3 A;  2R4F A;  4WU3 A;  1G4C A;  3UR0 A;  3MPV A;  1YVF A;  4ZPD A;  3B4D A;  1KKH A;  2IAJ B;  2CRL A;  2Z0G A;  3PIO Q;  5A6W A;  3HHN B;  3DRX A;  3NS5 A;  3PJW A;  4NXM F;  1YBA A;  4X4V A;  1S1X A;  4QIV A;  2GCF A;  2XI3 A;  1FRL A;  1OO0 B;  3HHL D;  4MYT A;  3UDC A;  2VFV A;  3NBP A;  5KG5 A;  4ZA1 A;  4WXW A;  3LH2 S;  5B0D A;  4H4M A;  2RD5 C;  4ZVF A;  2EK6 A;  3A13 A;  3ENQ A;  1XNR F;  3HHL C;  4EFA C;  3L95 X;  4ZVH A;  4NE9 C;  1BQM A;  3IBW A;  2VL1 A;  4QW9 A;  3H42 A;  3OTE A;  2K8G A;  2ACY A;  2RF2 B;  2W2Q P;  4X4S A;  5K8N A;  1RWX B;  1HBO B;  5B7W A;  4IYQ A;  1KQK A;  4QU7 A;  4RUC A;  3JS9 A;  3A8E A;  5LL6 d;  2MKI A;  5AJ3 J;  4CTA B;  5CAA A;  1KWM A;  4MJK A;  5DJB A;  4GVB A;  4PWD B;  2MJN A;  1H6K X;  5DG9 A;  4LVN P;  5I42 B;  2AHO B;  1V3Z A;  2KH9 A;  2A10 A;  2AJ1 A;  2PEB A;  2KVQ E;  4X2B A;  1NKB A;  1S9F A;  3MXH P;  4CLF A;  2PMH A;  3HXM A;  4XPE A;  4DLG A;  1B99 A;  3JSM B;  1G7C B;  1S72 S;  1RT3 A;  4LRA A;  1RHQ B;  4A48 A;  3KHR A;  1HR0 J;  4URS A;  2EXU A;  2W01 A;  1HI1 A;  2LP4 A;  3M1V A;  5BYQ A;  4EO8 A;  2WON B;  1TFW A;  1D09 B;  3G86 A;  4DUY J;  4Q8F A;  2R7O A;  3KK2 B;  4WK3 A;  1N32 F;  2BBE A;  3DRR A;  3O1L A;  1CJU A;  3R1H A;  4Y34 A;  4C3K A;  3QJJ A;  1UVJ A;  2NYI A;  4K7Q A;  2HRU A;  3TUZ C;  3NGR A;  4C8Y A;  2LLZ A;  1O5J A;  2D3O R;  3FBC A;  4X66 J;  1RAD B;  2D3Z A;  2NXE A;  2CAJ A;  4CLY A;  2RH3 A;  1U1O A;  1RI7 A;  1RT2 A;  4GO5 X;  1KDN A;  2JEJ A;  3RB4 A;  2MZJ A;  1YJ7 A;  4L72 B;  4QIF A;  4PRF A;  4KIA A;  1R3N A;  2DR8 A;  3CJ0 A;  3GYX B;  2RQK A;  4WE1 A;  1QJH A;  2VF3 A;  1Q7Y T;  3EZU A;  6FDR A;  4FP9 A;  3TZY A;  4FF2 A;  1KBR A;  4ECX A;  1UPM B;  3HJV A;  3PIP Q;  1WG1 A;  4DS5 A;  5BXI A;  2OSQ A;  2HVH A;  1RT6 A;  4IH6 A;  3W60 A;  3EGZ A;  3ELH A;  2B56 A;  3PYF A;  5KFS A;  3AAW B;  2DBB A;  1N0U A;  1VRT A;  1FEH A;  1HD0 A;  2YNI A;  2D9P A;  2BKO A;  3ETO A;  5F8L A;  2VDI A;  1JKH B;  1NDC A;  4C2M A;  5KFD A;  3BM7 A;  1J5E J;  3BGO P;  2XWX A;  1T3N A;  2C2K B;  1YJW S;  2DY1 A;  4ELU A;  1BUX A;  4OI1 A;  2LEP A;  4DMZ A;  3BGU A;  5AXK A;  4U6P A;  1RBL A;  3KHL A;  1R8C A;  3GCW P;  4DL0 C;  4WF9 Q;  1HLW A;  4JOU A;  2HHS A;  1XR7 A;  1OWX A;  1RE1 B;  4ELT A;  2RQ4 A;  2ZD1 B;  3W63 A;  4LRF A;  2BKN A;  4ECZ A;  4J9L A;  2M88 A;  2XS5 A;  2ZH7 A;  2GW8 A;  3NGT A;  1GFW B;  2V8G A;  1NZA A;  3LTO A;  2YKA A;  1NK8 A;  2EI5 A;  2M4M A;  4ZCK A;  4QZV B;  3AD9 C;  1S9E B;  4ER8 A;  5ETS A;  2MQP A;  2VIH A;  3QT7 A;  4N41 A;  3O2I A;  4A47 A;  1MRO B;  4DPO A;  5DS7 A;  3PYG A;  3WC0 A;  5CZV A;  2W2M P;  4IH5 A;  3VVU A;  3CME S;  1RAA B;  3GON A;  1DRZ A;  2OSR A;  2DNK A;  3K0J A;  5L39 A;  1RTD A;  2LXI A;  2QX0 A;  2DEJ A;  3HSG A;  1GMU A;  2V2V A;  5ETK A;  2H5I B;  2HLT A;  1NLK L;  5G0R B;  2DD8 S;  4QYR A;  3PR5 B;  1YHQ S;  4ICL B;  4AQY J;  3MED B;  2C28 A;  3MEC B;  1O0P A;  1RWK B;  4MT1 A;  4UQG A;  2CVI A;  3FCH A;  2W9C B;  3OR1 A;  2C2R A;  1FJC A;  2MXY A;  3M30 B;  1PYT A;  2VPW B;  4DJB A;  4A8O A;  1X31 C;  2CQ1 A;  3C15 B;  5KG6 A;  2XWY A;  4ZLP A;  3K5N A;  1R43 A;  2ADB A;  5K14 A;  3HKW A;  2V5H G;  1V3S A;  3VGT A;  3KUG A;  4OX9 J;  1DZ5 A;  4DUT A;  2QC3 A;  4KHP F;  2H65 B;  3WHI A;  1NU4 A;  3BKF A;  4P74 A;  1NKC A;  1HNV B;  3E01 A;  4DCJ B;  3TVK A;  4LFB J;  1DAX A;  3C14 A;  1WSV A;  2GO9 A;  1PC5 A;  3I9V 9;  5HAN A;  2G4B A;  1FD2 A;  2QA4 G;  3N5B A;  2HGN A;  4ZP7 A;  3J7Y I;  3NGK A;  3VQT A;  2QL7 B;  2W1B A;  4XAK A;  1S1U B;  2JL9 A;  4OYI A;  4HI1 A;  4DDF A;  1BY9 A;  1Q7L B;  1FJ7 A;  3I4P A;  2IVF B;  2EFO A;  2G0I A;  5F9N A;  3IG1 A;  3HJF A;  5KTQ A;  1XR6 A;  5HI7 A;  4OYW A;  3GE9 A;  1F0X A;  4CLL A;  2ZJR Q;  5HQM A;  4I6A A;  2YWW A;  4W92 B;  4AT1 B;  3FZ2 A;  1JB0 C;  2L9D A;  2CQG A;  5FII A;  2CPH A;  5F0U A;  1QE1 B;  3C3L A;  3TQE A;  1X0P A;  1H74 A;  2UUC F;  3EJM A;  3SBM A;  2R2S A;  3HVT B;  4K4U A;  2ZH9 A;  2HBY B;  2BJD A;  3IR5 B;  3BBC A;  1RIS A;  1SB6 A;  2EBE A;  2BZ2 A;  5I3U A;  3CW2 C;  2E66 A;  2QT7 A;  3TQ1 A;  2E5L F;  3CCT A;  5KFL A;  2C2D A;  3PHT A;  1CS4 B;  1Z1Z A;  1DTT A;  1FRK A;  1FWP A;  4PAA A;  3G87 A;  4HLB A;  1Q8K A;  2AW0 A;  4M5D B;  2HWH A;  3H4B A;  3P96 A;  4X84 A;  3RAM A;  5SZT A;  1IBK F;  4PQU B;  3SFU A;  3GR0 A;  1WEL A;  1YBT A;  1LW0 B;  5KG0 A;  1KON A;  4W4M A;  3PCO B;  4I2Q B;  4F7V A;  2XSF A;  3QAE A;  1HBU B;  3M8P A;  5HJX A;  2R7V A;  1LWF B;  2MKH A;  3LWL A;  4UZC A;  5AXM A;  1RTJ A;  4NRU A;  4Z37 A;  1S6O A;  3FSY A;  1DTQ B;  5J2P A;  1TKX A;  5J2N B;  2DO4 A;  2HFZ A;  3ZZ0 A;  2C3P A;  3WQP A;  3QID A;  4DV1 F;  2Q1L A;  3M6W A;  1MG7 A;  4I2P A;  1UFL A;  2B4O A;  1NJW A;  2KDO A;  4NEZ A;  4TQS A;  3MR6 A;  1B4S A;  1GH8 A;  5A8W A;  2RE1 A;  1LXN A;  2BJ1 A;  3NRB A;  1HNW F;  1WOP A;  2DIT A;  1OQ3 A;  1YKW A;  3C19 A;  4WBF A;  1X4H A;  3K58 A;  3R3T A;  2VPZ B;  5H9F K;  5F3Z A;  4YS2 A;  1ZTW A;  1H73 A;  3M2U A;  1FXD A;  3DM2 A;  3VAJ A;  2K3K A;  3V81 A;  1NPR A;  4DV5 J;  1C4A A;  3GSD A;  2E29 A;  1X9S A;  3UO0 A;  2OPR B;  3AOB A;  3RAQ A;  4CYU A;  3DGP A;  3W5Z A;  3PVX A;  2CDQ A;  2BJ3 A;  4YEA A;  2DRB A;  3RUB L;  1WDT A;  1WJ9 A;  1XQI A;  2F3J A;  4B3S F;  2RKI A;  1CC8 A;  2V8D A;  1L3U A;  2GS8 A;  1P27 B;  4NXN F;  3JQJ A;  3DLK A;  2J9D E;  4OYB A;  1SC4 B;  2VFS A;  2ZFH A;  2E9Z A;  2ZVI A;  5KAK A;  4QOT A;  4DR2 F;  1T9X A;  4MH8 A;  4D3G A;  3SV4 A;  4O4G B;  3IAS 9;  4XDC A;  4RWX A;  4RW8 A;  3TJ9 A;  3W5Y A;  2WSC C;  1FHT A;  3W66 A;  4EI2 A;  3VZI A;  2HHX A;  1WKK A;  4KV8 A;  2H5J B;  3O6Q A;  3SFG A;  1JNR B;  1F2H A;  3F56 A;  4ZVP B;  2QYC A;  5DLF A;  1HBN B;  2GGP A;  3IXQ A;  3TX8 A;  1AFJ A;  1Y0H A;  4DR7 J;  2YNF A;  3D6H B;  1YWX A;  3UN3 A;  2OKQ A;  5LMU J;  1WC4 A;  1SL0 A;  3JXO A;  5THW A;  5A8K B;  1K1S A;  2HMI A;  2VHG A;  1GK8 A;  3KKF A;  1RLD A;  1HQU B;  4C9D A;  3HSD A;  1HPZ A;  4OV1 A;  4PYA A;  1SC1 B;  3MEK A;  5F8N A;  1TMJ A;  2K1R B;  3BO3 A;  1ICE B;  3H7H B;  1RHR B;  4LF7 J;  3I0R B;  3JTN A;  3OR2 A;  1S1T B;  5DZ6 A;  4CLW A;  1JLQ A;  2H9Z A;  2IYI A;  2CQD A;  4OZJ A;  3Q8Q B;  3EWG A;  1RP5 A;  1ZAV A;  2HHH J;  2RQC A;  1U49 A;  2MY7 A;  3C16 A;  2HLU A;  5KFW A;  3E3X A;  2EFG A;  4U96 A;  2A2D A;  3TZW A;  1VQ5 S;  4ZHR B;  3PV8 A;  1RA7 A;  3W64 A;  3P5T L;  1R0A A;  3N28 A;  4RW6 B;  1B64 A;  4CP5 A;  3ZO7 A;  3BGL A;  4EGL A;  3MPD A;  4DQP A;  3FMB A;  5GAG U;  3ZC4 A;  4M95 A;  1IM4 A;  5H9F J;  2BKP A;  4Z2X A;  2CVE A;  3ENA A;  4FBT A;  3BKT A;  4EK2 A;  2R3V A;  4HL9 A;  4B3R F;  1NRK A;  3QWP A;  3EVM A;  1SH3 A;  3D6M B;  2VG7 A;  3W7B A;  2FZK B;  2P6T A;  4DF4 A;  3GJR B;  2AV5 A;  5F8I A;  3UNY A;  1FFW B;  4KKO A;  4EEY A;  3OXG A;  3CCR S;  3IO1 A;  1ZAW A;  4MK8 A;  1IKV B;  2GJI A;  4PXC A;  3Q8R B;  4IFV A;  4OIX A;  1YJT A;  2XUL A;  5MLC V;  1U8W A;  2Z30 B;  4DR5 F;  4OMF G;  3CUN A;  4KHM A;  4DXL A;  3Q89 A;  2LQJ A;  2F9J A;  1OY9 A;  2KXF A;  1N54 B;  1N5S A;  4PUO A;  2BRL A;  1RLC L;  2E7V A;  2V8P A;  2RIL A;  3OT9 A;  5LXY A;  3P49 B;  3PO4 A;  3DMJ A;  3TI0 A;  4ZVE A;  4NLS A;  2OIH A;  1CLF A;  1KLM A;  1RT7 B;  2JVR A;  5E3R A;  1S9G A;  3UVJ B;  3CO9 A;  1N48 A;  4O3S A;  1PBU A;  3HKZ D;  4LSL A;  3GG0 A;  4KQZ A;  4MFB A;  3WIU A;  2I8E A;  1T9Y A;  1N33 F;  1FI4 A;  1YSJ A;  2XQC A;  3BQ1 A;  3R5D A;  4OHV A;  3K8W A;  4YME A;  3IWL A;  1W2B R;  3UNG C;  1QAY A;  2AGP A;  3TUJ C;  1TVR B;  2IVY A;  1RHJ B;  4EUV A;  3QT6 A;  3DOK B;  5C42 A;  3TW0 A;  4DV4 F;  3IM9 A;  1U2F A;  1T02 A;  4DZD A;  4RW7 B;  1HYS B;  4QWC A;  2XMM A;  1NBE B;  1Q8L A;  2IDE A;  4Y28 C;  3R2C J;  1JLF A;  3ITH B;  3JAM U;  4ZCM A;  3I6P A;  1MML A;  1RKJ A;  2MQN A;  3DOL A;  4N47 A;  3KLF A;  4L6V 3;  2DCU B;  3CDW A;  2ASD A;  2QG9 B;  2VKZ G;  2P2C B;  3D9B A;  1IR1 A;  3DLJ A;  2YWH A;  2HVE A;  3MGJ A;  4ED8 A;  2Y1I A;  2X51 A;  3CCM S;  5GAE U;  1RAB B;  5C25 B;  4URG A;  2LCW A;  3ZZT A;  3HI9 A;  2VB6 A;  2KU7 A;  4ILR A;  3GTY X;  1UZD A;  2AIR B;  4NCG A;  3QBC A;  4WU2 A;  2HNY A;  4UF4 A;  5E7O B;  4O3O A;  3NKY A;  1EAR A;  3B78 A;  4FYV B;  4YB7 A;  1VC5 A;  3HHL A;  3GZ7 A;  1C0U A;  2E7W A;  1I6J A;  2IJR A;  4ALZ A;  2R8G A;  3POT B;  2U1A A;  4U9R A;  2DIV A;  3NNH A;  2B7B B;  2B0G A;  3KK1 B;  2RUG A;  2GMH A;  1X5T A;  5DET A;  3AY0 A;  1WEX A;  6FD1 A;  2DEI A;  3RU0 A;  5GMK a;  1JLB B;  4P9S A;  1FX2 A;  3I56 S;  3W65 A;  2ASY A;  2CJB A;  5B0B A;  1VOM A;  3F41 A;  3MM7 B;  4DSI A;  1S1W A;  4G3I A;  2V0N A;  2OUG A;  3RTV A;  1UWB B;  1JQG A;  4H4K C;  3LA0 A;  2NPF A;  2BAC A;  5J1E A;  2IRX A;  2E5J A;  1RAJ A;  2MQ8 A;  1YZ6 A;  1RAG B;  3CJ3 A;  3DLL Q;  4AUK A;  1ZBT A;  4FYX B;  2XGP A;  2VFT A;  4IFY A;  2Z4P A;  2VD3 A;  3EM1 A;  3D1H A;  1X0F A;  3MM5 A;  4LF5 J;  5E3A A;  4K4V A;  2OEL A;  2VOO A;  1FXR A;  4ZJO A;  3H2U B;  3D3B J;  4PPZ A;  1C0T A;  1FJG F;  3NWR A;  4YB1 P;  2J6U A;  1KHV A;  3Q8V A;  5K5M A;  3M8Z A;  3G6Y A;  3R5J B;  1GNK A;  2J5A A;  3FRZ A;  2VBX A;  1SPB P;  3MEG A;  4OYA A;  1RK8 A;  2F8H A;  4PKD B;  2YKQ A;  2CZV C;  1RWN B;  5KFV A;  2ZVS A;  3EVO A;  3M2R A;  4NI2 B;  2IIH A;  4ZPB A;  2OFH X;  2WCX A;  2X3G A;  1NHU A;  2WOM B;  2DGU A;  1F9E B;  5KFZ A;  1GX6 A;  4DL3 A;  3PW5 A;  4V19 J;  4NLR A;  4J9Q A;  2ZH6 A;  3MUM P;  1SJ4 P;  2ZH1 A;  3EZ5 A;  2CPF A;  3LPY A;  2KYX A;  4KRW A;  4Y2M A;  4DN9 A;  3GSI A;  2UVU A;  2AJ0 A;  1CPZ A;  1UJ5 A;  2BM1 A;  1HBM B;  1RU1 A;  1LWC A;  4DSF A;  3NBP B;  5K9F A;  1SJ1 A;  2GNK A;  5AXL A;  2Y9H A;  4H4M B;  1IKX A;  4IR1 A;  1B0V A;  2R9L A;  1V3R A;  1U0H B;  1BQM B;  2IJF A;  2HGM A;  4RLE A;  4RWW A;  4CQ1 A;  2VAS A;  4XPC A;  2ZIT A;  4FXV A;  2D69 A;  1X60 A;  3DYA A;  3UE2 A;  2HHW A;  2LKZ A;  4YDX A;  3NGU A;  3J7A N;  1RCX B;  1Z2Z A;  1ZA1 B;  3AT1 B;  4J91 A;  1RSC A;  2DH7 A;  1UEK A;  1R31 A;  4YOE A;  1R27 B;  5DZ7 A;  1YZ7 A;  5LJ3 Y;  2VOP A;  2KM8 B;  3HHK A;  4DX7 A;  4QYZ K;  4WIQ A;  3FFI A;  4CCH A;  2NS1 B;  1RAH B;  2GHW A;  2E9T A;  5H9E J;  1FWL A;  4HH1 A;  1I94 J;  3KFW X;  1RT3 B;  3NOG A;  1BXN A;  4EWT A;  1LW2 B;  1BHN A;  3IGV A;  3M6X A;  4TYA A;  4NLT A;  1EAY C;  3M1V B;  3MM9 B;  3DDI A;  3DLG A;  2M2B A;  3B8H A;  4IOC Q;  2E5H A;  4KO0 A;  5LMN J;  1CJT A;  3MCN A;  1CJU B;  4H4O A;  3UN5 A;  1WC1 A;  3TA2 A;  4JI7 J;  1C1C A;  4FN5 A;  2JRS A;  3LAL A;  1Y3K A;  1RA6 A;  3GJT B;  2JFK A;  2AGO A;  5AE2 A;  3JTP A;  4WTO B;  4ETZ A;  2I5J A;  2MY8 A;  3Q8P B;  2IVM A;  1HW9 A;  2ALZ A;  2WBM A;  2AX1 A;  2V9K A;  1Q0N A;  2C3M A;  4ECS A;  3AOA A;  4GKK F;  1EHW A;  2YNG B;  5D78 A;  2QLX A;  1RWM B;  4DV0 F;  2MZR A;  2AX0 A;  2LXU A;  3PTW A;  3OV7 A;  1GMW D;  1HKA A;  1D0E A;  1TMM A;  2J0S D;  3QGH A;  3MZI A;  4ZOS A;  3EMT A;  3V4I B;  1PJ5 A;  1PG5 B;  1YRT A;  3H2L A;  3CMA S;  2MST A;  2JFD A;  2AYE A;  2J7K A;  4CZC A;  3ZTS A;  5C2G A;  2VJU A;  5D0G A;  1S59 A;  3LGH A;  2ZM6 F;  2B9W A;  2EFP A;  5E3P A;  2CJX B;  3HD1 A;  2VU5 A;  1WKL A;  2YVS A;  2YNI B;  2MDA A;  5EDW A;  4X65 F;  1TKT A;  1FNO A;  2QSW A;  2PE8 A;  4LFC F;  3M8R A;  1OPI A;  2HIQ A;  3E51 A;  3GQC A;  4AYB D;  2P9G A;  2QLW A;  2WVE A;  1Y3J A;  4ECQ A;  5A0Y A;  1B0T A;  2GIQ A;  4O4R A;  2C2N A;  2GZO A;  5KFR A;  3ULH A;  2HND A;  2W8L A;  4RUB A;  3ZZR A;  1EX8 A;  2XC9 A;  2CQ0 A;  3JQK A;  5LT5 A;  4CLU A;  1DHM A;  2G0J A;  2C42 A;  4QYZ J;  1UA0 A;  3OD2 A;  3C66 A;  4DSJ A;  5JMN A;  1UTA A;  1FVS A;  2HGL A;  3R9L A;  1K47 A;  2ZHO A;  3MUT P;  3K59 A;  2FJV A;  2MKY A;  1UVK A;  2OTJ S;  2V2Q A;  1C2P A;  4DCO B;  1OQ6 A;  2MTL A;  4DR4 J;  4ED3 A;  3M8Q B;  4N77 A;  1S0M A;  2ILY A;  4DV6 F;  2ZUG A;  4PXD A;  2HQI A;  4JYA J;  1VQ9 S;  1RTD B;  4E98 A;  3MDF A;  3OBI A;  1UA1 A;  2V34 A;  1MW7 A;  4JI6 F;  1HNZ J;  3SQG A;  4B3O B;  3QZ7 A;  3OSP A;  3MTJ A;  1WHY A;  1VRQ C;  2X1G A;  2DHA A;  1QAX A;  4DEZ A;  5J2Q B;  3ILL A;  3ONQ A;  2QMX A;  2N3L A;  1SH2 A;  2FJE B;  1FK9 B;  3PKM A;  1FXL A;  5KG3 A;  5KT6 A;  1JJ4 A;  2F4F A;  3QFH A;  2QGF B;  3H90 A;  2EG1 A;  1IQZ A;  4NOH A;  2OD6 A;  2MQO A;  4USM A;  2HG4 A;  2RSQ A;  3CCQ S;  1MN9 A;  2ZDO A;  3EGN A;  4ELV A;  1SKW A;  2RHQ B;  5JXS A;  4GKJ F;  2K7K A;  4NAS A;  3HSJ A;  1R8P A;  4U8V A;  3PRD A;  3HT3 A;  3SCJ E;  1GT8 A;  1FDN A;  2W9B A;  1YJN S;  2AGQ A;  2I1R A;  4UT4 A;  3MMB A;  1GTH A;  3AB4 B;  1AT1 B;  4DX5 A;  3R7B B;  1U45 A;  1S79 A;  1FD8 A;  3M32 A;  1J5O A;  3HMJ G;  2NQP A;  1VBZ A;  4TLQ A;  1A0O B;  4TU9 A;  5GVQ A;  3R27 A;  1DLO A;  3T1H J;  3KLI A;  3S1T A;  4M8L A;  2QFJ A;  2Y1J A;  1U47 A;  3CDU A;  4ZLN A;  3EVW A;  2HBR B;  1LFP A;  3DXS X;  3Q83 A;  3HZG A;  1M5S A;  2KG1 A;  2XNQ A;  4RW4 A;  3ZNJ 1;  1Y5L B;  2WW8 A;  2DNZ A;  3TWZ A;  3GMG A;  3AA9 A;  3D6F B;  2F4V J;  2H51 B;  2X1A A;  4ZJQ A;  4MTP A;  1AB8 A;  5IM0 A;  3WX8 A;  3C6U B;  3CIM A;  2AQ4 A;  4KE5 A;  1NSQ A;  3A12 A;  4TY8 B;  5SUH A;  4TU8 A;  1XMO F;  1TUV A;  3PX6 A;  1D3W A;  3BBB A;  3OPK A;  1OYD A;  2RDI A;  2AYM A;  3P5B P;  4WKY A;  2LA6 A;  4L3N A;  5IWA F;  3OXF A;  1DTT B;  1S49 A;  1T05 A;  1FTC A;  1U1N A;  3LF0 A;  5L46 A;  3MCO A;  2EFN A;  2Q79 A;  2FPH X;  4JBC A;  4R5P B;  4NYO A;  2UXD F;  1UPP A;  2RRB A;  3M8P B;  1CUL B;  5D0E A;  4NPO A;  2HIY A;  4USI A;  2MKS A;  2M5Y A;  4M5L A;  1RCO B;  3P6Y C;  1TKX B;  1RT5 A;  4QBU A;  1X7V A;  3FUY A;  1T9T A;  1WI6 A;  4USK A;  3TZZ A;  2BAB A;  5CHC B;  2PI4 A;  2JVO A;  4YY3 F;  5CD4 H;  4HT5 A;  4HEA 9;  1JLE A;  3VR1 A;  4I2P B;  3EIC A;  2GX8 A;  2A0F B;  3TZX A;  3D68 A; 
#chains in the Genus database with same CATH homology
 4V1A k;  1IBL J;  2MEW A;  3W1Y C;  1J5E J;  4DUZ J;  2UXD J;  1I94 J;  3R2D J;  4DR1 J;  4AQY J;  2UUA J;  4DR5 J;  4KHP J;  4DV6 J;  4JI5 J;  4JI4 J;  4LF9 J;  3R2C J;  4DR6 J;  3JAM U;  4B3T J;  4JI0 J;  2UUB J;  4LF5 J;  4X62 J;  4X66 J;  4KY3 A;  4JI2 J;  4NXM J;  1HNW J;  2E5L J;  2MTL A;  5AJ3 J;  4YHH J;  3J80 U;  4DR4 J;  4JI6 J;  1N36 J;  5FLX U;  3D3C J;  2UUC J;  4JV5 J;  5LMN J;  3D3B J;  4LF7 J;  4JI1 J;  4DV3 J;  4LF8 J;  4X64 J;  1HNX J;  1XMQ J;  1N32 J;  4JYA J;  4GKK J;  5A2Q U;  4B3R J;  3J81 U;  4YY3 J;  1XNR J;  5IT9 U;  4JI7 J;  3OTO J;  2KVQ E;  4DV0 J;  1HNZ J;  2HHH J;  4DV7 J;  4RJV A;  4NEZ A;  1IBK J;  2UXB J;  4OX9 J;  2KL8 A;  4PWW A;  4LFA J;  4DV2 J;  4K0K J;  4DV4 J;  4HHU A;  5BR8 J;  4LF4 J;  4GKJ J;  3T1Y J;  1N33 J;  4LFB J;  1HR0 J;  3T1H J;  4B3M J;  2UU9 J;  1XMO J;  3J7A N;  4DR3 J;  3IMQ J;  5LM7 E;  4B3S J;  4KYZ A;  4DUY J;  4LF6 J;  2ZM6 J;  4NXN J;  1N34 J;  5IWA J;  1XNQ J;  2VQF J;  4NEY A;  1FJG J;  2MQ8 A;  4JI8 J;  2VQE J;  4JI3 J;  4DV5 J;  4DV1 J;  4X65 J;  2UXC J;  4DR7 J;  2F4V J;  4DR2 J;  4LFC J;  1IBM J;  5LMU J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...