3D3CJ

Structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
LGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDDLMRLDLAAGVDVQISLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the E. coli NusB-S10 transcription antitermination complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords N utilization substance protein B
total genus 20
structure length 85
sequence length 85
chains with identical sequence K, L
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3d3cJ00
1IBLJ 3IMQJ 1XMOJ 4X62J 5LM7E 3T1YJ 2MTLA 2UUBJ 4DUYJ 4V1Ak 4LFAJ 3R2CJ 1FJGJ 5AJ3J 4DR7J 4DV3J 2F4VJ 4LF8J 1HR0J 2UXCJ 3R2DJ 2E5LJ 4PWWA 4LF6J 5IWAJ 4LF7J 4JI5J 5LMUJ 4JI8J 4LF4J 4GKKJ 4KY3A 1N36J 5A2QU 4YHHJ 4KYZA 2UUCJ 1HNZJ 4DUZJ 4LFCJ 1HNWJ 4DR3J 3W1YC 4DV5J 4X65J 2HHHJ 4B3SJ 1J5EJ 1XMQJ 3JAMU 4DR4J 4JI7J 2KVQE 4JI6J 4X64J 1N32J 2VQFJ 2VQEJ 4YY3J 1IBKJ 4RJVA 4JI1J 4B3MJ 4DR2J 4AQYJ 4LF5J 4DV0J 4NEZA 2MEWA 4DV7J 4JI0J 4LF9J 4DV4J 4HHUA 1I94J 1XNQJ 5BR8J 4NXNJ 4NXMJ 1IBMJ 4OX9J 4X66J 4JV5J 3D3BJ 4JI3J 2KL8A 2ZM6J 3J7AN 1XNRJ 4B3TJ 4NEYA 4DV2J 5IT9U 4JI4J 3J81U 4DR5J 4GKJJ 4DV1J 2UXDJ 2MQ8A 3J80U 4JI2J 4K0KJ 5LMNJ 4B3RJ 1N33J 4LFBJ 4KHPJ 2UXBJ 3T1HJ 4DR1J 1N34J 1HNXJ 3D3CJ 4DR6J 4JYAJ 2UU9J 2UUAJ 4DV6J 5FLXU 3OTOJ
chains in the Genus database with same CATH superfamily
3TW0A 5CHCB 3Q0AA 2VFSA 4XK8C 4C8OA 2DNLA 5A8WB 1VC5A 2DNYA 1B64A 1X4FA 3G6ES 1RACB 3W61A 1ICEB 1C1CB 1T95A 4J9PA 4HTJA 3HLUA 3MPUB 2IHR1 2Z58B 1R0BG 3DOKA 4AL5A 1D09B 5AXKA 1S97A 5F8LA 4DR4F 2LEAA 4QW9A 4K4WA 2E1CA 2Q79A 2XS5A 4NRTA 4AD6A 3C16B 3KUHA 3HP6A 3TI0A 2HHTA 1R89A 4LSLA 1LWFA 2DH8A 2EBGA 5DJBA 3JYTA 5CZXA 4QQBA 2Z8QA 3C8YA 5IV3A 2IRUA 3CJKA 5J2NB 4Q2LA 1ZETA 4LF8J 1EKRA 4QYZK 2PEHA 4DR2F 4DZDA 3AJ2A 3OFHA 2FVQA 1FWPA 4JI5J 2OJ3A 4ILMA 3J7YI 5BYRA 4GRSA 1YG0A 3NLCA 4QR1A 5J1NA 4YHHJ 3BN4A 2O67A 2DNMA 3HHLB 1Q0NA 4KYZA 4CTAA 4KHPF 4IG3A 2KTQA 2ZKUA 4TQSA 2EC2A 2ZZTA 1LK5A 1IKYA 1G3OA 2JL9A 2XLKA 3D9BA 1TV6B 3OTEA 1HNIB 2APOA 2VFVA 3AQPA 4A8OA 5IXUA 3MUVP 3DRPB 1T3NA 1VBXA 2HEKA 2HQ3A 2YX7A 3NP5A 3OL7A 1M5HA 5KFVA 4JI4F 2VBXA 5KFNA 2A10A 1S6QB 4PAAA 5G0RA 4ECVA 2OEMA 3IGNA 4L3KA 2CQ4A 3C6TB 4C0BA 1M5SA 3QLHB 2HHVA 3RBDA 2X1GA 3SFUA 1DQ8A 1FESA 4YQWA 1YIJS 1RHUB 1NK0A 5HVHA 3QT8A 2OO4A 5C24B 1U1NA 1SH2A 1RT2B 2DNOA 3QSYB 2GHVC 2ILYA 1JLQA 4RJVA 5L9XA 1JLFA 3U02A 1K73T 2V2QA 4JI1J 4C98A 1WI8A 4USUA 5CCLA 2Z2LA 2Q3PA 4LF6F 1RISA 1B0VA 2BM1A 3MDFA 2V67A 1HNVA 3W2VB 1HYSB 3J81Y 5J2QB 4DQPA 2KXNB 4PEOA 1GMWA 1FX4A 1RWKB 3V6HA 3F73A 3BDEA 1I94J 2B8QA 4Z37A 1Q16B 1Q81T 2G4BA 5H9FJ 2LP4A 3DOMA 3NGTA 3UN3A 2VQEF 3CCSS 2IRYA 3ZTOA 2MB0B 3IWLA 3QGPA 1U26A 1SUQB 3M1VB 1N5YA 4JV5J 1N5TA 4DUYF 2DRDA 4DCPB 3PW2A 3RBEA 2DXEA 2VPYB 2IBOA 4PYDA 1B7FA 3UD5A 1JLBB 2LLZA 2AWZA 2EKYA 4ZPTR 4YR2A 3PFOA 1S0MA 3EDQB 3PVXA 4K4VA 1R43A 2FDNA 2JWNA 4DV2J 2PSZA 2V94A 1C1BB 4URQU 2KT2A 3KK2A 1VBZA 3T3FA 4CO2A 3LUYA 4M5LA 4OJGA 3TRGA 2V8DA 4CLSA 1Z1ZA 4JI6F 1RT3A 2IFXA 1NHUA 3CCWA 4CM2A 1F5BA 2J5AA 1LFWA 1RQ0A 2E44A 1EB0A 2HSEB 2QL9B 3AD8C 5CYJA 4ECRA 2VB6A 4PXDA 4KKOA 1HWLA 1CLFA 1N36F 2ZBQA 1RTDA 2CQ2A 3OBIA 2CQ0A 2V9WA 2UZAA 3LF0A 4OHZA 3DRRA 2AHOB 1KBRA 3PJWA 5JMNA 2CQCA 2VPWB 3O5TB 4DR6J 3PNIA 1MU2A 2WONB 1HNXF 4ID5A 1VJQA 2JSXA 3BBBA 3GFHA 1EHWA 5EX3A 4OL8A 3PHTA 2NUUG 2OHDA 3IG1A 2RU3A 1N48A 5GAEU 2D69A 4MYTA 3GIKA 1LQ9A 2GQCA 3G9CA 1H7XA 3DLBA 3AFGA 3KWMA 2LXIA 1TL1A 4LFAF 3BB5A 3CT9A 3B54A 1YRXA 2CNKB 4LRAA 4QZVB 5K8OA 5F3ZA 1KN6A 1HBUA 2PD1A 3GYGA 3ZZYA 1RAJA 4KGKA 1KP6A 3NMRA 1V3SA 4NLVA 5HANA 1UFKA 4B17A 1D1UA 2AX0A 1NEEA 3PDNA 5KFBA 1DURA 1WSRA 4H4OA 3EYZA 1B3TA 4DQIA 2Y8YA 2LVWA 3S6EA 1MWZA 4PQUB 3Q24A 5CYQB 2KN4A 2MY8A 2JEFA 3RW7A 1S1XB 4OZ0A 2N3LA 4PKDB 1RYSA 2GGPB 3CJ8A 3JXOA 4W98A 2BOPA 2IMWP 4LF7J 2NZCA 5LMUJ 1KOOA 1JKHA 3NXZA 4OJ3A 4FXVA 1VBKA 1JLBA 1SC1B 4RUBA 4A8SA 1CJTB 1FEHA 3PYDA 1LWFB 3JYTB 4P2MA 5H9EJ 1CS4A 5DDPC 3M05A 2RHQB 3GR0A 2QL7B 3VAFA 1SUQA 3M1VA 1UFWA 4NPOA 5J2PB 1N5YB 1QSYA 4JV2A 3TZWA 1HW8A 1RI7A 1XR6A 1XEZA 3MI7X 1NH7A 2ZOGA 3GIRA 3H90A 4OZLA 3PKYA 3H5XA 3BEGB 5GADU 2DNPA 1J5EJ 3TYTA 3A3OB 2QA4G 5ITHA 2DO0A 3JSMB 1Q82T 1PYOB 3D0IE 3RGIA 3IWXA 4C3KA 5A8WA 3PYFA 5HQLA 2HZVA 3PW0A 3CXCR 2DGTA 1UWBA 4X4UA 4TKTA 1UW9A 3DOMB 3BKUA 3X3UA 4C8ZA 1PJ5A 2FGOA 2KFZA 4I1TA 1NJWA 3CWJA 1H2VZ 1ZPWX 2C2RA 1SBRA 4PPDA 1HMVA 3M2UA 5EWFA 2UVVA 5KFGA 5J2QA 3M8QB 3QYYA 1SC3B 3EXYA 2V2KA 3P3DA 4I68A 4KPYA 3GB0A 1K0VA 4B3RF 4I0WA 2YNFB 4ID8A 5D77A 1OY6A 5ADZA 5H1SV 2DNRA 4ED5A 1PJ7A 3I0RB 3OW2R 4X4NA 4PXCA 4Y65A 2JLGA 1RAGB 1F9HA 2B9WA 4MIBA 3HPOA 2UVUA 5HATA 3M8SA 2DNGA 2O1PA 3SBMA 1FRXA 5C42A 4IR1A 2QE5A 4HDHA 2GHPA 3MD1A 4CNZA 4IDKA 3K89A 1FDDA 2R8IA 2R7WA 3CDEA 1AA1B 4RX6A 1UVJA 4O44A 1SIZA 2BRLA 2KRRA 1XTZA 1BQMA 2HBZB 2HIYA 2K3IA 2QL5B 4OQJA 4CO3A 9ATCB 3L3CA 2JJ4D 2KG0A 1QM9A 2F8MA 3DRPA 4O4GB 1EQ0A 3P45B 2CXEA 4KGXB 5D8HB 3D5MA 2W8KA 4ZP7A 1OJ4A 2CPXA 2HZCA 3MR3A 1Y5LB 2XYPB 3K57A 1T9TA 2Z2YB 1KR4A 3DMJA 3R5AA 2XCAA 2Q1LA 3NS7B 4MK7A 3KG4A 3EE3A 1Y3KA 3IP0A 2QMWA 2VUGA 1HMVB 2AJ4A 2KB2A 3M2UB 3DNCA 4M5GA 3F44A 1LXNA 1Q4RA 4F0HA 1IN0A 4M5DB 4XPCA 3V81A 3VAIA 5A8RA 5L8RC 4C11B 5CAAA 4ZVFA 4FZVA 2DGWA 2DH9A 1FRHA 3ZZ0A 1IKXB 5KFHA 2WTFA 3OVSA 1AB8A 1FRKA 3P5BP 3KLHA 2CPHA 2IJRA 4OI6A 2ILZA 2WVFA 4OZNA 2P9GA 3BF4A 4RKUC 3RBZA 3HHDA 4J9NA 2IC3A 5CYMA 3HSGA 3SCIE 3DLHA 2R7UA 3MAQA 3IR5B 4MK9A 2XSJA 1NO8A 2NXUA 2J8SA 2G2OA 5HROA 2Z4PA 2DB1A 1KRPA 2BJ3A 5JJBA 4J9RA 4LF7F 2FTRA 2UUBJ 1U8SA 4TXSA 2A3JA 1PBUA 2GGPA 1HWIA 2YQ3A 1X4AA 3P5TL 5JVHQ 3MEDA 1KQKA 5KFMA 1Y5IB 1NPPA 3POTB 1F60B 1FXRA 2ZOMA 4PXBA 5KFUA 2FJWA 1WTFA 4OYBA 4DL4A 2Y1RI 2AD9A 2I5JB 3ENVA 4KGMA 3KNAA 2J9EA 4YB7A 4IR9A 3KG1A 2DY1A 3GV8B 2IPOB 4FKXA 2N7CA 1PC5A 1WC5A 2E5JA 4MKBA 1UCNA 1JK9B 4GVBA 5IT0A 2DITA 2FLPA 3ZTRA 1VLYA 3OVBA 2HZAA 1RHMB 1ZAWA 1UEUA 1WSVA 2J7UA 2KYZA 3W64A 2XC9A 1N52B 1KKHA 2RT3A 3BBFA 5IC6B 4XO0A 4UQTA 3LQVA 3CCVS 2CQGA 2LECA 4OHWA 1X0PA 2MLXA 4F04B 1IKVA 2B6AB 4ETZA 4GKJF 2ZBCA 4X65J 2J76E 3HKWA 4NLRA 4ID5B 2H4YB 2ACYA 1O0PA 3L09A 4GVLA 3MEGB 2Q6BA 3U1LA 3BYPA 3SDEA 5KG3A 1WOOA 1Y7PA 3D6MB 3RR7A 1WF1A 1YWXA 1NK5A 4RW8A 3FMWA 4DFMA 2MKKA 2AJ2A 4DR4J 3MM5B 4ZPWR 1XJWB 2OGUA 4ZVHA 4WYLA 2RU9A 4PG8A 1A6LA 2QA2A 5CH7B 1HFEL 1RK8A 2IDLA 3ETOA 1UVMA 2CDQA 3MCOA 2MHNA 2C3PA 4QR2A 4DN9A 5GAGI 4JV0A 1WHVA 5KFEA 4USWA 2OH2A 3DLEB 3CO0P 4P52A 4I7FA 2R8HA 2VC0A 2YKAA 3MMBA 2RQMA 4PRFA 5BJRA 4ILRA 4B3MF 3CSKA 2GA7A 5E7OB 2ZJRQ 4WK3A 1VS3A 2YKOA 1EAYC 3FBFA 4YN3B 1T7PA 2RHSB 1IKXA 4I4BA 1CJTA 3F41A 1NM2A 4X64F 4TY9A 3W5XA 4LBIA 3GMGA 3OL9A 1N54B 3DRXA 1U0HB 1TP7A 3QSIA 3CF5Q 4OX9J 1FK9A 1S1VA 2M3DA 2LQJA 2A1BA 2O3DA 2QC3A 3TA0A 2UUBF 2OUGA 1UP1A 4KJIA 2UXCF 4ZA1A 5C24A 3MURP 5D3GA 2ZM6J 5I3UA 1W26A 4P7TA 3SI8A 3MECA 4LF9F 2WBRA 1XMBA 1Q8IA 2J0WA 5AJ3F 3MOZA 2LEPA 3ADAC 2MKCA 4FP9A 2AV5A 2PE8A 5L1JA 2VDHA 2BE2B 2V4JB 2B4PA 2B6AA 1FDBA 4IYQA 2HHHF 1NDLA 4B9NA 3NG8A 4JP8A 2CPEA 3QIPA 3ONQA 2HRYA 1TFWA 1LWCB 2GO9A 2FY8A 5F8MA 2Z2ZA 3ISZA 2R7RA 3CCUS 1U02A 2A2DA 2A6OA 1F2GA 2NXJA 2XMAA 4DMZA 1N6QB 1VQSA 4CYUA 3T1HF 3CTRA 1HKAA 4J9UE 1IBCB 2F9JA 2E5IA 3W60A 2BE2A 2V4JA 3BJYA 4IG3B 3DGPB 4I2QA 3TANA 1TL3A 3QIDA 4FDFA 2DXFA 5LSLA 2DGUA 3TQ1A 2UU9J 3AB2B 4AYBD 1HNWF 2PA8D 1S1TB 3GR1A 4TYBA 1DZ5A 1R8HA 1T03B 3DN9A 4NRUA 2XO7A 4JV1A 4EI2A 2OKQA 4Y3CA 4ILLA 1KLMA 3HDSA 1XWLA 3M6XA 1UFLA 3VV2B 1RU2A 4M5JA 4DUYJ 2YWKA 4HH0A 1T3OA 1RT3B 1ZTWA 2RRAA 1JLEA 3MD3A 3CD0A 1L5UA 4K2XA 4DWIA 2MZ1A 3H5YA 1DRZA 5JUMA 2GIRA 3IBWA 4DSKA 2A18A 1FJGJ 1T94A 4WZQA 2HFNA 2M8DB 3H0PA 3BQ2A 1HBNA 1TKDA 3CJRA 2AYEA 3LP2B 5KG0A 1DY3A 2CQPA 1HHSA 2VG7B 3PO4A 2IVMA 3S01A 4USIA 1OMSA 1R6YA 2G1HA 2XYHB 1CEZA 3TZYA 4WFAQ 2D7SA 4MMOA 1CULB 1FDAA 2HK2A 3SFGA 3NMAA 3PHEA 5FJ4A 1SH3A 5KFWA 2LCWA 2HQGA 1P9YA 3MPDA 2RH3A 3BS9A 3I32A 4O3QA 3ZNUA 1IVZA 2CFXA 3FRZA 3A3NB 2I0XA 2E5LF 1EQMA 4L74A 2W7AA 3WC0A 1TKXB 4F4KA 1RT7B 1G6BA 3ET6A 1TMMA 4CM0A 5F8GA 4ZVEA 5F0UA 2HNDB 2KM8C 2X1AA 4DN0A 1FTCA 4DL5A 1CSJA 2BUNA 3VCDA 1KTVA 1ZM4A 1NDCA 1WHXA 3ZNJ1 1Q78A 2CJ9A 4TY8B 4MKVA 3ZZRA 1TL3B 5E41A 3HO1A 3SSSA 1Y11A 4JI7F 1I3OB 2YQ1A 4HEA9 8RUCA 1NLKL 4DF4A 5KG6A 4JI7J 2NS1B 1RADB 4ANCA 1N0UA 2HKEA 3DRSA 4OMFG 3SSRA 1K47A 4NCGB 4UW2A 1DLOB 2HAFA 4UY8T 2FZCB 3R5DA 2B43A 2M5YA 2EFOA 1Y0HA 2I5JA 2U2FA 5A6PA 4DQRA 4KB7A 2E66A 4IH6A 4NMLA 2ACMA 3I0RA 5DM6Q 6FD1A 1RT7A 4ZPBA 2NCKL 2VKZG 3C14B 1RT5A 3KNGA 4QPXA 4NEZA 1U1PA 1UMJA 1LEOA 2JLFA 2FJXA 1RT4B 4DR7F 2AZ3A 2OD4A 1NHKL 2YWFA 4HHUA 4Z7CA 3DYAB 1FKPB 3PIOQ 2IVFB 4FVMA 4RL1A 1CQNA 5KT3A 4RW9A 1IBMJ 5M2UA 1NCLA 4FF2A 4BBYA 3DLJA 4YDDB 4RZRA 2QSWA 4M8LA 1HR0F 3FEXB 1OQ3A 3VAKA 3ZFVA 3H2VE 3TUJC 2ZH5A 1K0TA 2PDAA 2F1FA 3NCRA 2C22A 4EYHB 2F40A 4ZVGA 1X4DA 4Y2AA 3G4SS 4JI4J 2OIHA 3T6BA 2OPRA 1RU1A 4LSNA 4X65F 2NSBA 3J80U 2RIJA 2CPZA 1FFWB 4YB1P 3CJQA 2L9NA 2GV1A 1R27B 2WSFC 1DARA 2AZ1A 1HA1A 3HHEA 1RWWB 4B9VA 4D3HA 2VKRA 5EGYA 1KC8T 1FKPA 5D4LA 2H3EB 2XO6A 3MFHA 1N34F 1YJWS 1YK9A 4U7CA 5A8RB 3S8SA 3ILIA 4IQXA 4LF5F 4RW9B 2ZH8A 1KOHA 2HGMA 2CPFA 2XMUA 1RT6A 2X3GA 4LF4F 1E6YA 4O3SA 1D8ZA 2HFOA 1LWEB 1VLOA 2O01C 2BABA 2V6AA 4ZJQA 4Y0FA 1VQ6S 3GLJA 4I2PA 4IQMA 2UUAJ 3WQPA 1HYSA 2RVJA 3M6WA 2I1RA 2HS4A 2GAHC 2BZ2A 2JZ5A 4LFCF 1UZDA 4FNIA 2XS7A 1FJGF 5L38A 3LPYA 2C2ZB 3FJ2A 1K1SA 5A76A 4HDGA 4QU6A 2UP1A 3DU5A 1WACA 4X62J 2FB0A 4F0MA 3H2LA 1WI6A 3PRVA 5F8NA 1UEVA 2W2QP 1RLDA 4IFVA 1YBUA 3AA8A 3BKFA 1XBWA 4W4MA 3L7PA 4YB5A 2F8EX 2W9CB 2YKMA 2CA9A 2BJ7A 1GH8A 2W7OA 3A8KA 3EDRB 1DTQA 1HARA 4B9MA 4M95A 5J1EB 2VIHA 1DTTB 1S6QA 2E1AA 2VG6A 3EGNA 3EXCX 3GPAA 5G0RB 1SKSA 4F2RA 2XZTB 4WTYA 1K44A 1FRLA 1QJHA 2GZOA 2B3TB 3IGVA 3CUNA 2F4VJ 3BYRA 3JSYA 2QIFA 2OEJA 3HVAA 2GNKA 3PRBA 2OAUA 4I64A 3SV4A 1H38A 4M5NA 4OZJA 5GAEI 5C25A 1CJUA 4K4UA 3GG0A 1V5IB 4K4ZA 1T9YA 2DNZA 1RBOB 3BR9A 1U45A 1SJFA 4PR6A 4KY3A 4ICLB 3OUYB 2YNHA 3CJ4A 1HIYA 1T9XA 1UJ4A 1RWNB 1NJZA 2UUCJ 4ELVA 4RUCA 1RA7A 4DPOA 4ES2A 2CAJA 2WVDA 2IBKA 4NL5A 1FX2A 4NYPA 2CPDA 2HS0A 5J2MA 4DS5A 3UCUP 3H7HB 1JXLA 3FRYA 1SPBP 1TUGB 2WRMA 3JQMA 3GSIA 5B0CA 3NGDA 3EPGA 1AFIA 5K14A 2LEBA 3DLEA 4WXOA 4ZCIA 4OYAA 3W66A 5J2PA 1S5ZA 1TUWA 3I0SA 3FCVA 3JB9k 5HLFB 2XQCA 2CDRB 4MT1A 2OLWA 2VONA 5K20B 4X64J 2BW2A 2IJNA 2J7WA 1RTJB 3FBBA 3W9HA 4WTOB 1OYDA 5BR8F 4XPEA 3V81B 1IUJA 4ZITA 1WKJA 2HNYB 5KFZA 2R2RA 1AZSB 2LYVA 3UD3P 2QRRA 3E8OA 1VFJA 3M6UA 4ANEA 4K4XA 4DR2J 3WX8A 2R2SA 3SZ2A 3PCOB 4IG0A 4EU0A 3PW5A 4QPTA 4K50A 2YNIA 2ZUGA 4DS4A 1T05A 2HHQA 1JLAB 1VQKS 3KLGB 1V3RA 1P27B 1WDTA 4RNHA 2MEWA 4KO0B 4NZ6A 1RT2A 4F67A 3O8WA 2ZOFA 2GJIA 3SMZA 3BZQA 4CLLA 4LF9J 3GE9A 3C46A 4QCLA 3DGPA 1FHTA 3TO8A 2ZH1A 4AT1B 2XNRA 1PO6A 1S76D 1VISA 1GTEA 3AB4B 1RTHA 2JEIA 2J9DE 5C2GA 1EJ7L 2HHWA 4DI6A 2VDIA 1YRTA 3A8JA 4X66F 2EG1A 1YTYA 1AUDA 1EARA 2FLLA 3BO3A 4B08A 1F2HA 2NUHA 3T1HJ 1A0OB 5HVFA 2XULA 4Y2CA 3CCQS 3WDOA 2Y1JA 2ZC4A 3UDEA 4UF4A 2R8GA 1FKOA 3EMTA 3QZ8A 1L3KA 1FE4A 1R8CA 2LQ8A 2NQPA 2ZKTA 3MM9B 4GKJJ 2FUG9 3GIJA 3RR8A 4KSEB 5DGBA 4USTA 4JI3F 1FDNA 5D0GA 3OLAA 2VC1A 3FMBA 3GJSB 2ZZNA 3X1LB 2DISA 2LA6A 1KQGB 1TKTB 2BM0A 3BREA 4KV8B 3CCMS 2KI2A 2VA3A 2LXUA 4F26A 5MLCV 2C2NA 2DTJA 3RUBL 1V5VA 4YHHF 2AGOA 1FVQA 3ULHA 5F9NA 1KQSR 2BJ9A 1VQNS 4KHPJ 1R7IA 2MY7A 1UWAA 1XC9A 2XMMA 4B3OA 2E9TA 1PAUB 4L75A 3UN2A 4LSNB 2DEIA 3MMBB 3I0SB 4USJC 2DO4A 4UTGA 5HQ8A 1M0SA 1X31C 4UQGA 5KG2A 1NDPA 2AMCB 2CVEA 4X4TA 3FBEA 3R7NB 4DSLA 2HVEA 3FNNA 4IUFA 3MEEB 4ZLJA 1RP5A 3LH2S 5GVQA 3HFZB 1N5VA 1X5SA 1JLEB 2GX8A 4F3MA 3NAHA 1ZH5A 2FYXA 5LXRA 2HVDA 2KHCA 2E7XA 4KAIA 4DF8A 4J9MA 1NPKA 2DKOB 2HGLA 3QT6A 2R7QA 5KT5A 4IH7A 2XGQA 1HQEB 1NSQA 1QVFR 1REGX 2V2ZA 3UVJB 5DZ6A 3BR8A 5DZ7A 3ZXWA 2FLNA 3M8YA 4NLWA 4DU8A 3U7JA 2HFVA 4CH0S 4ZPVR 3NNHA 1AW0A 1PSDA 1OYEA 1VR6A 1PBAA 2BKOA 2UXCJ 4G1QA 1IKVB 3FDSA 3BGFA 2X1FA 1ITPA 1BQMB 3Q2SC 4UOHA 1DLOA 4BC7A 3OL6A 3NAIA 2K3KA 3CO9A 2KDOA 2FZGB 2D1CA 4RBVA 5KAKA 3G6VA 2QGFB 3KDNA 2KFYA 2HMIB 1BD6A 2DHXA 3C6TA 1RT1B 3I9V9 2HS3A 4IOCQ 2RKIA 1PYTA 1GAOA 2EFGA 3CD5A 2R2TA 3TNVA 4CLTA 3QBCA 4YS2A 4ENOA 4DV5J 1S0NA 2AKWB 1VIXA 4OZ3A 1RAAB 4UOCA 5KFOA 1BQXA 2YX1A 2QMXA 2CNOB 2FJVA 4C48A 3IR6B 5HMZA 5B09A 3KLGA 2BR0A 3ZO7A 1TMJA 3TVKA 1GT8A 2M2BA 4A46A 1U49A 3DLKA 4PWUA 1HHQA 1T02A 3JSRA 2C42A 2W2OP 3VR1A 3L7OA 1AT1B 3GJRB 3RTVA 3DM2A 4JBCA 4F4XA 4ED0A 3I87A 1CBKA 3RG6A 2W25A 4GC6A 1CULA 4NE9C 3C19A 4N47A 1WKLA 2MSSA 4Y2KA 1FJ7A 2ZH4A 4QR0A 2PMWA 2ASYA 2D3ZA 2N82B 1WG1A 5ETKA 1PG5B 5LSOA 4FKYA 2KXFA 2DRBA 2R7XA 1TAQA 4ZK7M 5I3QA 1M1KT 1VRUA 3HK2A 1WDDA 4F4AA 4R5PA 1WWHA 2QN6B 4YP3A 2DIVA 4K5RA 2RILA 4HYKA 3BBCA 4RU9A 3EWGA 3NWGA 2ZUAA 2BDPA 4JI0J 4KC5A 4LSLB 5I4MA 4C11A 1ZYQA 3C2PA 3KLHB 4F02A 3J7ZT 2ZWOA 5DG8A 3ILJA 3D3BJ 4P9SA 3UCGA 1FRIA 1LW2B 3HVRA 1HBOA 2XY5A 1UA1A 3IRXB 4C0OC 2DR8A 1EETB 3FZBA 1GNKA 2CG8A 2GJ2A 3NGRA 3Q8UA 3SSQA 4PWDB 3EZOA 2CIMA 2MQLA 5JXSA 1L3VA 1P8GA 4U8VA 2GVDA 1XQIA 5KFXA 5IT9U 1U2CA 4BS2A 3V5RA 3BPDA 1GQEA 5B0AA 4YR0A 2YH0A 2YPZA 4CO1A 2MMYA 2DY9A 2JDJA 4I2QB 4KH1B 3RAXA 2KFNA 1I5OB 4NLDA 3T9ZA 3UWTA 1NB7A 5J1EA 4X4PA 4KQZA 2OSRA 4ZCKA 2DR6A 3HSJA 4ZCMA 1NK8A 4C9DA 2DPJA 5LMUF 1DAXA 1D3WA 1FXDA 2HFZA 3H5UA 1OWXA 2ZBIA 3IC1A 3M7VA 1T9UA 2V2VA 4OYOA 5EUHA 1X9MA 1J5OB 2DEJA 2FIUA 2LU2A 3LAMA 2ZD1A 3FFIA 2DYAA 3HSDA 3P96A 4K4SA 1GXLA 2OMLA 1UJ5A 5HAOA 4DL7A 1DTQB 2ZNYA 1MU2B 2WONA 4LVOP 5HK4A 4ZPCA 3R6GB 5HL7Q 2H1YA 2YKQA 5C2CA 5IZHA 3AT1B 5E2QA 2RRBA 4TNOA 1JLCB 1VDHA 1X7VA 2EG2A 3D1HA 3VWSA 4J90A 3JAMY 4OI3A 3L7UA 1Q7YT 1O51A 1NK9A 4IFYB 1GMWD 3B6BA 3TVZA 1VQ9S 2F8HA 2HBRB 4DXLA 3T1YF 1X9WA 3H8YA 3LGNA 2YNGB 3EZUA 4PUOA 1VRTA 5E0OA 3QZ7A 3W8PA 4AUKA 1XR5A 1SXLA 4F2SA 1HWJA 2YQ0A 4BLGA 3OVAA 3FC9A 3QMQA 4N41A 1G7CB 3FSXA 3HHLD 2JNJA 2ZVIA 4UZBA 1TQLA 3R2DJ 1FWLA 1RBAA 4P2XA 1HWKA 3UE2A 3JQKA 3ICLA 1TVRB 2ZH7A 2AJ0A 3SQGA 3HVTA 3I82A 1HNZF 4HKQA 2YWWA 3T1AA 3VQSA 3M9MB 4JB8B 4F4ZA 1HI0P 2VOOA 3O44A 1CJVB 2C2DA 3LP1B 3C3LA 2X51A 2DT9A 4RWXA 4TQRA 2PMHA 3CVKA 2P9CA 2DGVA 2UUTA 3R9LA 1N33F 1WNEA 3GG1A 1HNWJ 1SQEA 4WU2A 1RB0A 1U24A 3W1YC 3PZPA 2UU9F 1JJCB 3BKTA 4B3SJ 2I38A 4B9LA 1NK7A 1BLUA 3JTPA 3UCZP 2VU5A 2RRNA 2WOMA 2MLZA 3CE8A 2XG8A 2XYGB 4XDDA 4OZ1A 1SC4B 5CYQA 3LANA 2M88A 4WE1B 2BJDA 1ZM2A 1DQ9A 4E0DA 4OHYA 1GK8A 3VVUA 1HBUB 1X5TA 4LRFA 5IV4A 2HVIA 4KV8A 2KVQE 1U6ZA 3LO3A 1OQ6A 3OR1A 1RT5B 2V4RA 1T8EA 1ZS6A 3OXGA 3V2UC 4OV6A 4Q44A 3W9JA 4DV7F 3DKDA 1M5KC 4CZCA 1FF2A 2OD6A 3Q23A 5DQHA 3G86A 4O23A 2G0JA 2U1AA 4CQ1A 3HX9A 2BQ3A 1VQLS 3OTOF 4U7UD 1MG7A 5K5MA 2CPIA 1UVLA 4C7QA 1J27A 1UEKA 3TVYA 2YWEA 2V69A 4OX9F 2JEJA 1QD1A 4JOUA 2AX1A 1HQUA 3WIUA 1Q8KA 2HHSA 2Y0BB 3BQ0A 4A8KA 1WHYA 2XMJA 2FHMA 4P7VA 4XTTA 5DO2A 3KJVB 4WZMA 1JNRB 3DC2A 2H5IB 1FK9B 1S1VB 3E51A 2BKPA 1JLAA 3ILLA 4JI2F 2H54B 2NXCA 2OPPB 3ET6B 3HF5A 1WKKA 2WZ1A 5KFIA 3RBXA 2BA9A 2XSJB 5RUBA 3UI3A 1NSPA 3AY0A 4NLPA 3KK1B 4ELTA 4C8KA 1BUXA 1U6BA 5DS7A 2ZNZA 4B3TF 2DBBA 3KLFA 3EPIA 1RUSA 5MAOA 3T5JA 1U6FA 3BH7B 4DL6A 3HHNB 3PIPQ 2XM3A 5IS2A 1TAUA 2W2MP 1WC6A 4DR3F 5LMNJ 4ECXA 4DL0C 5KFRA 1AFJA 2JVRA 4PG4A 4FBUA 1OIAA 4LR8A 2XHCA 2FVCA 3KHLA 3V4MA 5CCMA 3V6KA 1TFYA 1P6TA 5CA5A 4AE5A 3NCPA 1UW4A 2DHHA 2W1BA 1S6PB 3TP2A 2I9SA 2EFQA 2AGQA 3HD2A 1YDLA 5FD1A 3PX0A 7AT1B 1KLMB 2FLOA 2FC8A 2M0GB 3K17A 3W2VA 3MR7A 3THTA 2Z30B 1QAJA 4U8YA 2MKYA 3KK1A 5M2RA 3BSOA 1AYEA 2CJYB 2HWIA 1NMEB 1R6VA 4OIXA 3PR5B 3W65A 4CCHA 1JLFB 3R97A 3V6JA 2BXJA 3QJJA 1BE4A 1K9MT 1C0TB 3HM9A 2AEFA 1WG4A 3M8PA 3D6FB 2B4UA 3NS5A 5AE2A 4O44B 3G82A 4U9RA 2H4WB 1VC0A 1YRUA 2HYIB 4MFBA 3NWRA 4CH1A 2PFFB 1NNDA 4NI2B 2DD8S 3N79A 4HACB 2J6TA 3CC4S 1HQUB 3FK4A 2W4CA 4ZDNA 2HAIA 3UDCA 5C42B 2DNHA 4DV2F 4FXDA 3D1OA 3L9ZA 2AEJA 3FCHA 3Q89A 1QLNA 2HURA 1MWYA 4X2BA 3D67A 1FEEA 4LT6A 4LF8F 5KFPA 1CPZA 1S49A 5F41A 3F0NA 3WX4A 1S77D 2COLA 3EUNA 3MMJA 2CPYA 3THPA 1JXEA 1MN9A 1G4CA 3M2VA 4ANDA 1RWMB 4ER8A 2HGNA 3K5PA 2EWHA 1NJIT 1D0EA 4J9OA 4WP9A 4NLUA 4EZ9A 3AQOA 4WP8A 1FD8A 1UL3A 2P6SA 1Q95G 3QRRA 4C97A 5K8MA 2DPIA 5CABA 3AXMA 3AODA 3CC2S 4F4WA 2VODA 3VGTA 2QYGA 1S59A 5I3UB 2QEXS 1WUUA 1FJCA 3SCLE 3Q83A 4QYZJ 4G3IA 3C15B 1GXUA 3NRBA 3OJSA 3V6DB 3Q2TC 1C1BA 2FHKA 3TX0A 3M2RA 1TR0A 2GIQA 1VYAA 2XWXA 3OTDA 4PQAA 2F3JA 3I4HX 3ZTSA 8AT1B 1JJ2R 1FXLA 1U25A 2KHDA 4ZIWA 4OZ2A 5KT7A 4FS2A 3C16A 4LSZB 3OXLA 2J0QD 2HPUA 4K7QA 2POKA 1PAEX 3NS6A 5K14B 4DL3A 2FY1A 2MZJA 4NLTA 1Y5NB 2R42A 3CW2C 3U27A 1VQMS 2BQUA 2HWTA 1VOMA 2XY7A 3BQ1A 4AL6A 2LU1A 4WJBA 5KG4A 2ZDOA 5J2MB 4QWCA 2XZDB 2ADBA 1QVGR 1IKWA 4IO9Q 1OY9A 3M4XA 4G6VB 4RWWA 1R8AA 1N5SA 1SJRA 4DG1B 4GO5X 3G6XA 4RW7B 1M5VC 2VL1A 4CLYA 4DV4J 1ZA2B 2YH1A 1JLQB 1X4GA 3A12A 2L9WA 4EO6A 3EZ5A 1X4CA 2MZTA 2BACA 1FA0A 2V8HA 2UV8A 3DYAA 4ZVQB 4ZJLA 4ALZA 2GS8A 4TU8A 1S10A 4FXWA 4IOBA 1N8RT 4CI0B 1YI2S 2IY5B 3HZEA 2CVIA 4Y2MA 1VRQC 4Q7AA 5KFLA 2QLXA 2M8HA 4F36A 5KFYA 1RAIB 1JLCA 1IQZA 2BANA 4GVBB 4IDKB 5E3PA 3OXFA 4YR3A 3M8ZA 4NLQA 2OPQA 3AOCA 4ED7A 2AT1B 2M7SA 5DETA 4QWAA 4QIFA 2BE7D 1I51B 1J5OA 1QSSA 1LW0A 4C4WA 4OLOA 1LNQA 4BWJA 4USMA 2UXDJ 1O6XA 5FIIA 3JTNA 1QUVA 1S9EA 4NI2A 3W5YA 2W9BB 5D3GB 2YXLA 2Y1IA 5CD4H 4L76A 3DU6A 2EVZA 3OR1B 5DG9A 2K7KA 3CCTA 4CT8A 3NL0A 4CDIA 5ETMA 2LXFA 3CJSA 3NCQA 2UXBJ 2E1RA 2G1DA 2W8LA 5L9NA 1S4EA 3OFEA 3N9UC 2BX6A 2HFSA 1NH8A 2YNIB 4K59A 4LIWA 4D3GA 3MMAB 1TKXA 3VGVA 5DDOC 3GILA 5SZTA 2HQIA 3HCXA 1ZPVA 3S7RA 3NGKA 2ZITA 3TJ9A 4RO0A 2QA4S 3TEGA 2BE9B 4K4TA 3IMQJ 1AZSA 2DXDA 2HVZA 3PTWA 1LXJA 3MMCB 1KFDA 2MTLA 2QLJB 1TU0B 1C4AA 3L4BC 2IC3B 5CYMB 4X4QA 2EEYA 2DHAA 3MR2A 4KIAA 3K5NA 2RQ4A 2FC9A 4DPWA 3GFYA 3H20A 3KLFB 1NSKL 1RJJA 2DK2A 2C3OA 4Q0BA 1DFDA 7FD1A 2ZH3A 5EWEA 2ADCA 2E29A 2Z56B 4USHA 5EHHA 4EEYA 2ATLA 1SI9A 4LF6J 3BH6B 3HULA 4M5DA 3T6JA 4RUAA 5J1PA 2AQ4A 5CD4A 2JHEA 2HLUA 4JI8J 2HBYB 4P73A 1RKJA 4ZIVA 4V19J 5CQGA 2W24A 3CDWA 4H4OB 4HHJA 1KQFB 2AU0A 4G1IA 6AT1B 2JC0A 3DLKB 5L1LA 1JB0C 2BOAA 4OI4A 3RJMB 2OMOA 3SEOA 2H5EA 3MM9A 1S1UB 3KMQA 2KZZA 2QFJA 3NOGA 2K7JA 2IA6A 4EZ6A 4MIAA 3PX6A 1KDNA 3OJUA 3EVWA 3DHWC 5D0RA 4P72A 2XS2A 1BQNB 3KJNB 4Q2MA 1SJQA 5B08A 3QRPA 2MJUA 5ETOA 2YKPA 1VQ7S 2CUYA 2G0CA 2QLWA 4HT7A 4ZVTB 3MR5A 3TEHB 3KYLA 3JAMU 3LGHA 1QDUB 2BJ8A 3IBFB 3MGJA 3T19A 2M9KA 1LWCA 1MW7A 2NPIA 3I5CA 3NEKA 4F25A 5IT4A 2A0FB 4JI6J 8ATCB 1RGVA 3MPYA 4YY3J 4KO0A 1IBKJ 4OLPA 4KH0B 4ZP9A 4C2MA 3FEYB 3N6LA 4R8UB 3D28A 2ZWPA 1HI8A 4L72B 5G4DA 2VJVA 4EK2A 4UUWA 1SKWA 3KLVA 3DDKA 2NLWA 2HK3A 1RZMA 4TU7A 2JLEA 3BGUA 3FCWA 2I2YA 4ZHRA 4ZVOB 4ZVPB 3H2UB 4MIWA 2KM8B 1OY8A 2CADA 2DCLA 3PW7A 4QJVA 2RF2B 2VA2A 1UKUA 4O3OA 4X66J 3HT3A 2AJ1A 2K1RB 3B78A 1PILA 3GWCA 4J9KA 4DUZF 2KZMA 1Z4UA 2OELA 2F5GA 4C3LA 4LRBA 3ETMA 4TVAB 3VZIA 2HVHA 5HP1B 4DLEA 4EUVA 4DX6A 5AE3A 1X8DA 2B7CB 3ITHA 3O1LA 2ZE2A 4NASA 4ERDA 2B5JA 5GADI 2XB2D 1FVSA 3KHHA 3RB4A 3OHBA 1F3FA 2VG5B 5F3TA 1JKHB 5KFAA 4DCJB 4G65A 4HI1A 3GIMA 4LQ9A 4LFBJ 3ENQA 3BV8A 4C8YA 3QO9A 4WBFA 3J81j 3D7SB 1UVIA 3HHKA 4FPIA 4X62F 2ZBRA 1ZZNA 2OI2A 4J9SA 2HQFA 2WHOA 1NXIA 1Y00A 5D4OA 5E5NA 2EPIA 4ED1A 3WC2A 2VBYA 2QV6A 1X5OA 3R5GA 2ASJA 5ETVA 1SKUB 2MXYA 3NY0A 3R7BB 4P74A 3QPIA 4DCOB 1ZA1B 2R7OA 4QIEA 2YKNA 3IA0A 5JVGQ 2YBVA 2WVEA 4PZVA 2XHWA 5LM7E 1SCJB 3T5KA 1YITS 3H25A 1UVKA 2K2PA 1RT1A 3EM1A 4PG5A 3VHQA 1ZBTA 2WK4A 3DDIA 4ELUA 3MM7A 3QJLA 3G82B 5KFJA 3KMSA 3O2IA 5ETQA 2Q6CA 2RD5C 1SV5A 3FUYA 5AXMA 7FDRA 3RAQA 1VHIA 5GMEA 5FLXY 1NHVA 1S7IA 1CC7A 1HQ2A 3CDUA 2P2CB 3AD9C 4KFBA 1GFWB 4RW4A 4DJBA 4Y2IA 4F7VA 4DV3J 4YEAA 4ATNA 4NCBA 3EVMA 2NYHA 4NLXA 1IJEB 1M1GA 1JJ4A 4CT9A 2DNKA 4CP5A 4N5SA 3CB4A 5L1IA 1RTJA 5A8KB 4OYZA 4ED3A 1LW2A 2OFHX 1Q7LB 3PRDA 1MNEA 1FCAA 4CLPA 4ES1A 3QFWA 2MPUA 3R27A 5DRKA 2GMHA 4FS1A 5I42A 2EFNA 3LP0B 3O6QA 4HR2A 4A8XA 2UUWA 3RB3A 4DUZJ 1W2BR 3KUGA 4OX7A 5HMWA 3I5AA 2VG7A 3QT5A 5E3QA 2YWGA 5E3RA 5IQ6A 2C2EA 3THVA 1TK0A 1KVIA 3FSIA 3K58A 3LW5C 4YMEA 2Q43A 2KJVA 2YY3A 4IOAQ 1UPPA 1IBLF 1E6VB 1IWAA 4B9TA 2VH7A 1S9GA 1XERA 3OQ2A 4YDXA 3W7BA 4KE5A 1KNZA 2BV3A 3RU0A 2CJQA 1V6HA 4M5MA 3BSCA 5LL6d 4R25A 3KG0A 3GV7B 5KOXA 4F50A 3BDPA 4LMZA 3R1HA 2CZ9A 2I8EA 4ETXA 5IM0A 4F4YA 2AIRB 4WK1A 2EC0A 4UT4A 3M2VB 3QGIA 2VQFJ 1IBKF 1YZ7A 3AA9A 3UR0A 2PO4A 3AXKA 3CIMA 1VJWA 4I6AA 5AE1A 3TAQA 1T03A 4CO5A 3EGZA 1XK8A 4ZLNA 4KGVB 3G2XA 1XR7A 3QLHA 1S9EB 2F63A 1GX5A 1B0PA 1TL7A 4NZ7A 4WYWA 1VC6A 4ZPAA 3DDNA 4R0JA 5F8IA 2ERRA 3CMES 1W2IA 3QJPA 1D9DA 2EFPA 1S0OA 4NCGA 4PPZA 2DR5A 2KU7A 2H5JB 4ZLPA 1KHWA 4DV7J 1XNQJ 4EGLA 5K9FA 2FHJA 2DVIA 4ECSA 1N88A 1CQMA 4Q45A 3BN7A 1B4SA 2QYCA 2KT5A 2R3VA 3NGUA 5F8JA 1R3NA 4IFVB 4WFYA 3AOAA 5DQGA 4XDCA 2XGPA 3QIPB 4KHMA 4TYAA 1RAFB 4B02A 5DGAA 1U09A 3BM7A 2AW0A 4J37A 4NA1A 1XNRJ 4AL7A 4OX6A 5T7LB 4X4VA 2GCFA 2J8AA 1YGYA 2N4CA 1NRKA 2CRLA 4EYIB 5C5JA 1UWBB 4MH8A 3R7SB 3D54A 1NJXA 3OT9A 1U1OA 4JI2J 1RHKB 3G96A 4JUZA 4HTIA 5IM0B 4Q5VA 2CWKA 4P10A 3T5LA 3MPVA 3V4IA 3A3PB 1M5PC 3P4UB 1CJKB 4Y6IA 1PGZA 2R7VA 2ROPA 1VMBA 1M90T 3OPKA 4LQ3A 4Q0BB 3SXLA 1K8AT 1S9GB 4PYAA 3PACA 3TOQA 4MYUA 1YJ9S 2DNNA 2MHEA 2KJWA 2AJFE 3D3CJ 3UNYA 4JYAJ 1VRUB 1ZM9A 4WFBQ 4F3OA 1NSAA 3OTOJ 4ZVSB 2ZH2A 2E1MC 1U2RA 4XAKA 4DFPA 5A6WA 1VQPS 1ZAXA 5F0WA 3UN5A 4RR5A 4CH7A 1YQHA 4E8UA 4DFKA 2VOPA 1LK7A 1SL2A 2IYIA 2L3MA 3DXBA 1KS2A 3U1NA 2EI5A 3CCLS 3T1YJ 3H5SA 2OTJS 1V9OA 4H4MB 5ETSA 2RQCA 1TKTA 2G2YA 3ILOA 2MQPA 4NXNF 4FYVB 4NXMF 3RB6A 5H9FK 4CLUA 1IR0A 1MWQA 1NAQA 2F9DA 2N3OA 5KG5A 4PQUA 2GVZB 5AJ3J 3K5OA 4B3TJ 2QT7A 4I67A 2CKWA 4YOEA 3M8WA 3DHXA 1IJFB 3EGWB 4USKA 4BWMA 2M4MA 5HO4A 3UDLA 3MXHP 1HLWA 3GONA 1HR0J 2UVRA 2RDIA 3DOLB 3R5BA 1QE1A 2AYBA 4P71A 3IG1B 5ETRA 3DRSB 1W7WA 3MM7B 2R2UA 1U1KA 2GMLA 1O8BA 3K5MA 3CCES 3N6MA 1FO1A 2HMIA 3MCMA 1GMVA 4ZP6A 5LJ3Y 1TL1B 4W90B 4RNOA 2RKIB 1NDKA 2XBPA 2F4FA 2XY6A 2IM2A 1F9EB 1HNZJ 1UVNA 1HWUA 4RW6A 1RWVB 2EXUA 3S1TA 5D78A 3MAHA 1DQAA 3QGHA 4KKOB 4LBHA 4F3QA 3MEKA 3A8IA 3N5BA 3E2EA 1PCAA 2JFKA 4MJKA 3PY8A 1VQYA 4ZLLA 3TA2A 4IRDA 2FGCA 2KXHA 4UZCA 2HNDA 3UVJA 3MR6A 4A8MP 3AH6A 3ITHB 1JQGA 1LWEA 3Q8SB 2W4DA 4QWBA 4OI1A 1N32F 3GCXP 4N8OA 2QG9B 1RT6B 2XEXA 3HI9A 3IAM9 3IRXA 4NCAA 3K2YA 2AJQA 2WSEC 1YLXA 1RTIB 2MKJA 3LGMA 3BO4A 3KHGA 4OZ5A 3GYXB 1E6VA 3D1QA 2HFUA 4RUHA 1XNQF 3SQOP 4EMDA 5M2PA 3VGSA 1WG5A 2Q66A 4OV1A 2V34A 4WF9Q 1JNZB 2B7BB 1QY7A 3NBPA 3Q8RB 4NA3A 4DEZA 2VBZA 4R5PB 2B4VA 2RMLA 1U1QA 2MDAA 3K8WA 1BWVA 4C3MA 3F56A 1MLAA 2QSFA 4AFFA 3PM9A 5B7WA 5KTQA 1FNOA 5B0GA 2OPSA 5I42B 2V8GA 2N7YA 2ZEJA 5LOQA 1CJKA 4U6PA 3CEDA 3IO1A 2ZM6F 1H98A 2BRKA 1YJ7A 2MZQA 3GYNA 4NWBA 5I3PA 3C6UB 2H65B 1WEZA 2BVZA 2UVWA 3EVOA 4NXNJ 5T41A 1RWPB 2MSTA 1S1TA 4P2SA 2XLJA 1V3ZA 2VHGA 4F0KA 1MSWD 4M5IA 1PC4A 3M9NB 3PEHA 3IS9B 5HMYA 3MUTP 1RHJB 4KFBB 4RW4B 2VJUA 1WTBA 2QZ8A 1IXKA 1HPZB 5T7LA 3QAUA 2ALYB 2C1EB 2LA4A 4AXJA 1KTQA 5KT2A 4Y00A 3FEZA 3W9IA 4DV1J 2NREA 1L3TA 4CWBA 2GHWA 2ATCB 1WEXA 3DI6A 3GU0A 2ZH6A 5A2QY 2PFDA 1SQFA 1SKRA 1VQ8S 2R4FA 2CQIA 3UO0A 3JS9A 4WKYA 5DG7A 5GAHU 2J9CA 1N6QA 4DSJA 2GFFA 4DR1J 2OTLS 4H54A 2BMBA 2ZVSA 3WZ0A 2CQDA 3DXSX 2IM0A 3R8YA 3CD6S 4N7TA 2ASLA 2KG1A 1REVB 3CJTA 5FLXU 4USVA 3TZXA 3K0JA 2DH7A 2X1BA 4JI1F 5B0EA 4E98A 4A8QA 4WP3A 3MECB 5ETTA 2Z0GA 2BJ1A 4NA2A 2WCXA 4C0HA 4H4KC 2E5HA 5A0YA 2ASDA 4W92B 4QOTA 3W2WA 4DR6F 3SIPB 4EFAC 4FF1A 2EBEA 4V1Ak 4TN2A 2FJEB 2W01A 2LQ9A 5D15A 2HW3A 3C66A 4K8RA 2OPSB 1RLCL 3LP1A 4V19X 3ZZUA 3KK2B 3MEEA 5C7PA 5HP1A 3R2CJ 3LWLA 4QIVA 3AAWB 4TLRA 3KJFB 1C1CA 5LMNF 5DLFA 3UDVA 5DDQC 1A9NB 2VICA 4RNNA 1YSJA 2FZKB 4I6WA 1KEKA 4I56A 2ZBPA 2BYCA 4DV5F 3D4JA 2EK1A 3IAS9 3G8SA 5ETLA 4OYIA 3D6TB 4S0MA 2MZRA 3MPWA 5FDLB 4ED4A 4FPRA 4DR1F 4LF4J 1XIQA 3MAAA 4EBDA 3V4IB 2D3O1 2FVRA 1JJHA 3E01A 1SC6A 2G9OA 3VZHA 4DPYA 4RW8B 2ROEA 1UA0A 4FBTA 2IIHA 4JI5F 5BYSA 1C4CA 3TUPA 5EN1A 1SB6A 2JX2A 2RDDA 4HVZA 5THWA 1EX8A 1KVKA 4L6V3 3RRHA 4IRCA 2XI2A 2V8PA 5L39A 3MM8A 1VI7A 3I4PA 1CJUB 3BGRB 2W9BA 3ENAA 1H6KX 1ZAVA 2IVYA 3I5BA 3MEGA 4N8NA 2LQBA 3VVTA 1F3VA 5GAGU 4DFJA 1N4LA 1RAEB 4U96A 3GJQB 4A48A 2YPYA 4Q43A 4DQSA 1JLGA 1RDRA 9RUBA 4PCQA 4IKAA 2IJFA 4IRKA 3AHPA 4HT5A 1NKBA 2VFRA 3CMQA 3MFIA 3KTQA 4NLGA 2RJZA 4DX5A 2QX0A 1NK4A 1X4EA 4OI2A 3HKZD 1M1HA 4Q8EA 1H2UX 1LW0B 3KK3A 2MKHA 2YKNB 4BDPA 1LV5A 4DPTA 1X4BA 1TL7B 2ROGA 4DUTA 3Q22A 2GMJA 4I2PB 4J91A 1LKZA 4KBIA 5LXYA 5T14A 2X3DA 3QWUA 1IKYB 3UW1A 2H48B 2WBMA 4IG0B 3Q8QB 1P9QC 3T5HA 3TJAA 5D4PA 4A47A 3PR4A 1NK6A 4L3NA 2GVDB 1HQEA 2B4OA 3MUMP 2W9AA 5D0HA 2R7TA 5BR8J 1E6YB 1RTDB 2IRXA 2R7SA 1F1BB 4QWDA 4YB6A 4P75A 3TZZA 4H4MA 2MYFA 3BO2A 2Y0SD 4NLSA 4ECUA 1TKZB 4DL2A 1P1TA 1OSDA 3MM6B 2V63A 2B51A 1YJTA 2RE1A 4RU2A 1WC0A 3I6PA 2H9ZA 1UETA 2P6TA 2DHSA 2V5HG 3HVTB 4NEYA 4P2FA 4ZKAA 5DLGA 3IM8A 2FD2A 2HQDA 5IC4B 2OPRB 2R9LA 3IWNC 1K1QA 3M2RB 3ZTQA 1QAYA 2HRUA 4UUXA 1TKZA 2JFDA 3BPSP 3TR5A 5BXIA 1Z2LA 2MQNA 2XCPA 2WW4A 2QLBB 5LJ5Y 3SQGB 1NKEA 1S12A 2VV5A 3FSYA 2MGZA 5E3CA 5KFKA 4AQYF 4K4YA 1ZOTA 3FBCA 2YX4A 3IR7B 3K7RA 1NUEA 1T9WA 1U8WA 1S1XA 1YBTA 4FYYB 4IFYA 3DM2B 1NZ8A 2JRSA 1C0UB 4LR9A 3W5ZA 4RNFA 5C25B 4XIUA 2DIUA 3M8RA 1HNVB 3ISNC 2QTWA 1VRTB 3GZ7A 4KTQA 1MMDA 2OFGX 1MROB 2KT3A 2ZFHA 3KK3B 5U47A 3KLEB 3CCJS 2DR9A 4C8LA 1FRJA 4ED8A 3H42A 1UPMB 4O3PA 2P9EA 3OV7A 4RW6B 1SJ3P 1HHTP 2D3UA 2IM1A 4ZCLA 1WD6A 2CNNB 1QAXA 2IAJA 2RNEA 1TL5A 2BEFA 3B8HA 1RHQB 2L48A 3HHLC 4P6QA 3AJDA 3OD2A 1SL1A 2E7VA 2K06A 4RNMA 2ZJQQ 5HI7A 3IN5A 4MFBB 1OPIA 2B8PA 3VTIA 2OPQB 4DZ6A 2W7PA 3PKMA 2G0IA 3DFEA 5F9LA 1JLGB 2C3YA 4GO7X 4MTPA 3B4DA 4KPCA 5IFMA 5KFDA 1QAIA 4ECTA 2BJEA 2L41A 1SL0A 4A8FA 2ZC3A 3PG9A 1HNIA 4C8MA 4MK8A 1S1UA 2D74B 1ROFA 2WVBA 3M32B 4PWWA 1GX6A 1X60A 1N5QA 1B7YB 1Y4ZB 3MM8B 4OHXA 3AD7C 5GAHI 3Q8PB 1YJUA 3QO9B 1M5OC 1EETA 1U0SA 2MZSA 3BSAA 2UUCF 4CTAB 1H73A 4PWDA 3IFEA 1CG2A 2BBEA 2J9DA 1DHMA 1BY9A 2J0XA 4NMXA 1JX4A 1PIEA 2Y8WA 3H59A 4LFBF 3DLGA 3D68A 3E01B 1VGYA 2HRTA 4LRCA 3RZAA 4WIIA 2ZE2B 4DR3J 2HHHJ 3QNWB 5HBMB 3SCJE 3CJ0A 5FDLA 4ES3A 1U47A 3RB0A 1QTNB 3WBZA 3I9ZA 3JSMA 4I6YA 1HBNB 2CJAA 4DSFA 4TLQA 4PG6A 3EGVA 2IDEA 4K2JA 4WPAA 4ZOSA 4E2FB 2AGPA 3HZGA 4L73A 4O3RA 2Y9HA 2AP6A 4WWSA 3MM6A 4CIOA 2FJAB 4X84A 1WEYA 5DM7Q 1FNMA 1IR2A 3MTJA 1NBEB 1WOSA 2C2OB 4H4KA 4LJMA 5GMKa 4GMKA 4OX8A 2I6WA 1GTHA 3FQLA 3MHYA 5K8NA 4OJHA 2VFTA 2WVCA 2CNLB 4FYWB 3V6DA 4DV4F 2W2PP 1XMOF 2QJ3A 3SDEB 1WF0A 3JSBA 2ZHBA 1CVJA 1ACMB 4O0NA 3M6VA 5E3AA 2J6SA 4AQYJ 4LF5J 1IQTA 4HHHA 5KT4A 3MMAA 2Y1LB 1URNA 4DU7A 1SV5B 2LDIA 4O3NA 5AXNA 2DCUB 3LA0A 3MWBA 4OYMA 2XMVA 3R1LA 1URRA 2NSCA 5ETNA 2JC1A 4CYUB 3EX7B 4C6AA 1S72S 4HLBA 3DLLQ 4NOHA 2RDJA 2IAJB 2VPXB 4ITSA 3A13A 1G2EA 1SJ1A 1RTHB 4JV5F 2IYGA 3G8TA 3J7AN 3GCWP 3P49B 3FVYA 2WAQD 3IS9A 3UD4P 3J81U 3DRRB 3OLBA 1S9FA 1HPZA 1Q8BA 2V9KA 1TL4A 2XLIA 3UR3C 2E9ZA 3M30A 3QATA 4K0KJ 1YJVA 1AROP 3VALA 3HFVA 1S99A 4B3RJ 2VG5A 1SJ4P 4LIRA 3DCAA 2FQQB 2MGZB 1WC3A 3WHIA 1DBDA 5ETPA 5KFTA 1LFPA 1RHRB 3VAJA 3R3TA 3ENWA 4JI8F 2HIQA 2KO1A 3AJ1A 1S79A 1HNXJ 1D9FA 1HD0A 3D66A 1RA6A 3B4MA 4KRWA 3RW6A 4DV6J 1IKWB 2BW7A 2MQMA 2PMZD 3UQSA 3CJ5A 5KOWA 2LMIA 3R6LB 3HMJG 1JIHA 4JYAF 4ZJOA 4ZMMA 1NU4A 3CDAA 3LALA 1X9SA 3W3SA 4X4OA 3RRGA 3OR2B 5EWGA 1RABB 2RS8A 4F8RA 3MCSA 3TUZC 3IXQA 1H7WA 4FYXB 1FKAF 3MM5A 2K1RA 3OTBA 3Q8VA 3ZZPA 2IM3A 2AF6A 3QWPA 1TVRA 4ECYA 1RTIA 4NLOA 3BGOP 4LFAJ 1ZTTA 2L9DA 4ICLA 3OUYA 1H74A 1S6OA 1LWXA 4HL9A 4FYDA 2YWHA 3RAMA 1IM4A 3US5A 3VAGA 2N4DA 1PYSB 4RPFA 1XNRF 2RUGA 2E7WA 1REVA 3EJMA 2GQ2A 4M5KA 5KFFA 3KJVA 4X4SA 5H9EK 4M63A 2E5LJ 3FZ2A 4NX9A 3D2WA 2FPHX 1FWKA 1S48A 4RBTA 1X0FA 1BC6A 5A2QU 1Z2ZA 2A6MA 2CZ4A 3MZIA 3N28A 1QUPA 4OFZA 4CRJA 2GQQA 2FHJD 2GAGC 4DBQA 3GFXA 3NNAA 1U1MA 1F0XA 4HI2A 5AT1B 1FTRA 1H72C 4ZN3A 1RAHB 1HI1A 1X5PA 3OFFA 2LKZA 3H98A 2VBWA 3ZC4A 3TWZA 4AXIA 3PW4A 2R8JA 2QFIA 4KGZB 2GVZA 2HHUA 1OPZA 2Z2MA 1GEHA 4ZP8A 3KLEA 3GTYX 2SXLA 3POTA 2M70A 3UPFA 3MTKA 4EBEA 2HHXA 3G71S 2VQFF 4CLFA 2CQHA 5BYQA 3RRKA 3T9NA 1HBMB 1YKWA 2FHOB 1ELOA 4LRDA 1UTAA 2NZ4A 2EW9A 1N32J 4PG7A 2GJFA 2J0SD 2JOQA 1R8BA 4RW7A 2VQEJ 1EZZB 1TELA 4DPXA 3TARA 2WOMB 1I94F 3ZZZA 4MKAA 1WORA 2PN6A 1L3SA 3J80Y 2QLFB 3LP2A 3I56S 4J9QA 3TX8A 3GQCA 4LF2A 4KT0C 4DV6F 4DV0J 2B0GA 4WFZA 1SQGA 2B9EA 1S1WB 4CLZA 5KG7A 4J9VA 4WFNQ 4UY85 3ZZTA 3IBCB 1KSPA 2QMUB 1U1RA 1KLNA 1ZZFA 1VIOA 3KHRA 3SYZA 2B9YA 2MJNA 4EWTA 3HT0A 4QIGA 4U7UK 4ZN1A 1Y10A 3DLGB 4IH5A 3W2WB 3KDOA 2M52A 3VQTA 5KFCA 4FF3A 4R0EA 1FJEB 4K0KF 1S1WA 4CLWA 1RBLA 1N0VC 1NPRA 3N5FA 4DX8H 5AXLA 1HW9A 3A8EA 3DMJB 2JVOA 1H0HB 3MF5A 6FDRA 3FKBA 3N6NA 3T41A 4R8UA 3GFZA 1YJRA 3W63A 4BC9A 3VGUA 2KRBA 3NKYA 3Q8YA 2ZHAA 4O4GA 3K5LA 1TTHB 5HQMA 2DJWA 1Q5VA 5LSRA 1A7GE 2EKNA 4DOZA 2RUSA 3PEJA 4WIQA 4I69A 3TAMA 2WSCC 4DQQA 2D41A 3TUIC 1H2TZ 1C2PA 2RB7A 4KR0B 3TJ8A 2VZ9A 3N01A 3VAHA 2DGXA 2KKHA 1Y9OA 1OSCA 2KH9A 4YUDA 2ZD1B 3FFIB 2PC6A 2E5GA 3DOLA 5DDRC 3J7YU 3D0GE 4DV1F 4WCEQ 4Q8FA 3NOCA 3H4DA 1F6TA 2HNZA 2V0NA 3CC7S 2GW8A 3OSPA 1XMOJ 1S7HA 1BHNA 5HJYA 3J7Z5 1FD2A 2YNFA 1RTZA 3HD1A 4DPUA 3M8PB 1BMQB 3QQCD 4C8NA 4N77A 3PXGa 2EK6A 3A4TA 4BCAA 4QWEA 4J9LA 1EP4B 1R8PA 2B56A 4DHVA 5KFQA 3FGVA 2QO3A 3MAAB 5E33A 3RYLA 4DG1A 5HMXA 5HROB 2C2MB 4FNHA 1R0AA 3OR2A 3CDBA 1PKUA 2AYMA 2CJXB 2XMKA 2XMTA 3CJKB 4I7FB 3CULA 2OP5A 1HD1A 1ZM3A 2V50A 2D3OR 4NYZA 1QTMA 1FT8A 1WJ9A 4OYPA 1EIYB 3LP0A 4O4RA 4RLEA 5HN0A 4GC7A 1CJVA 1VK3A 4QYRA 4B3OB 3OHAA 1NJYA 3W62A 1S57A 3I55S 2PT0A 3OL8A 1KHVA 4LREA 5B0FA 3GP9A 1FRMA 4N56A 1VK8A 2P5VA 4NZ0A 2Y3YA 3PX4A 1D8YA 2W4PA 2NR0A 2UXDF 3KKFA 1X4HA 3K59A 2XNQA 1LOUA 1RT4A 5L46A 2RSQA 5A8KA 3TAPA 3E3XA 3R5CA 1I1GA 5KG1A 1UJ6A 3HVWA 5IT9Y 4LR7A 3C15A 4NYOA 3A1YG 3G6YA 3CPWR 2HBQB 3L95X 2BKNA 4B3SF 2NYIA 4OJ1A 4DV0F 2XZWA 1QSLA 1SIWB 2DR7A 4PXEA 3PV8A 3NNCA 4LVNP 3UFCX 1U7LA 1XN9A 2FVPA 2GIFA 3GJTB 1JMTA 2ZHOA 4WU3A 1Q1KA 3TA1A 2RQKA 1Y3JA 3N4WA 1D9AA 4N76A 2G2ZA 2UV8G 4B3MJ 2A2CA 1SVDA 2E9RX 5HVGA 4ED2A 1F9FA 1JXVA 1TUVA 3LOUA 3DI6B 3PJ9A 3B82A 4LF1A 4QBUA 3Q86A 3UNGC 1BXNA 3HFKA 1RCXB 1TZ0A 4G1PA 1J2VA 5B0BA 4A8YA 2J6UA 2F4VF 1TV6A 2VD3A 2VFUA 3WIVA 1IWGA 3VF0B 1YBAA 1H3DA 3LPEA 2HQCA 3MEDB 4WXWA 2MLYA 2LFVA 2GC8A 2G13A 3QT7A 4ECZA 2BQRA 1RXOB 3PJXA 4DDFA 2IA0A 3KLIB 4TY8A 4TU9A 1KD1T 1S0VA 3PYEA 3KUEA 4X4RA 3GSDA 1MMNA 1YX2A 4Z7YA 2NXEA 1Q8LA 2KL8A 3BGRA 4NLYA 4DV3F 1T05B 2FVSA 1WELA 4LBPA 2W2NP 3U1MA 2VF3A 1T0TV 4HH1A 2RAQA 2CJKA 3HJFA 3GIIA 1WOPA 2DGOA 4CNYA 5DQIA 2VPZB 4DR5J 1XMQF 2WB1D 3PFEA 4U95A 3HXMA 1WC1A 2GO8A 2CZVC 2ZDPA 1APSA 1HBOB 1R31A 2C3UA 3CGIA 3BSNA 2HLTA 1IBMF 1NB2A 3G87A 1JWWA 2K8GA 2D9OA 2PGCA 1VQ4S 1N33J 1S6PA 1DJ0A 2C3MA 2XI3A 4LUBA 5IOLA 2DGQA 1CS4B 4YY3F 1I6JA 1T9VA 1N34J 3QFHA 2RF2A 2PEBA 3MMCA 2V4QA 4GKKF 4U67Q 1RWUA 2J7KA 2YTCA 5A0YB 2FJDB 1B70B 2JH3A 3LWMA 1AXQA 4KHRA 4EBCA 3HJVA 3I31A 4O0IA 2DHGA 1F5CA 3BGLA 1VQ5S 4MKYA 4ZVRB 1KONA 3CJ2A 3G8QA 5HBMA 4ZHRB 1NKCA 4OHVA 5HSPA 2OPPA 1IBLJ 1S4FA 1EP4A 3ZTPA 2CYYA 3ZZOA 3GV5B 4Y28C 1FNXH 1KFSA 2UXBF 3PYGA 3CJ3A 4CO0A 2F65A 5KT6A 2R8KA 3KLIA 2YNHB 1VHFA 2DGSA 4UOFA 4PABA 2XMWA 4B9SA 2FJBB 2NXNA 3KJQB 2PA3A 3M30B 3MCNA 4IO1A 1OO0B 3VAMA 4ED6A 1Q86T 1IM6A 3M32A 4Y34A 5D4NA 2YKMB 3IM9A 2H51B 1F5AA 2AEMA 2QA1A 4OYWA 3CNQP 4DLGA 2OEKA 2DRAA 1RWXB 2HHPA 4DR7J 3HSZA 5IWAF 3CCRS 1B99A 1YZ6A 1FFSB 3D0HE 3H4BA 1N56A 3PO5A 3TQEA 2HWHA 1QE1B 2O66A 4FVCA 3MOJB 2ABYA 1R0CB 1WF2A 3I96A 2WW8A 1MROA 4YFUA 4M5HA 1GMUA 3CIZA 4URSA 5IWAJ 3DGVA 2W9CA 3CMAS 2ALZA 4HACA 4OYXA 4GKKJ 3HHLA 3J7A1 3M8QA 5L1KA 5KFSA 1N36J 2C2KB 2CQBA 4BHQA 2IMOA 3O3LA 4CO4A 4DSEA 2E1PA 3P6YC 1T11A 1U2FA 3LAKA 1RYRA 1U0HA 1BGXT 4UOGA 1TK5A 4LFCJ 4J5OA 4WKRA 2MKSA 2L08A 3OFGA 5HJXA 2ZZMA 3D6HB 1RAOA 2UUAF 1GXTA 2B5JB 3SCKE 2D9PA 1Q5YA 1RKIA 5IQQA 4DR5F 1XMQJ 1OS5A 1KVJA 1Q79A 4RBUA 2HNYA 3OSNA 2KVIA 3KOAA 2NPFA 4QIWD 5J2NA 3C6UA 3N0VA 3NBPB 1TK8A 4J7CA 3DRYA 1EKSA 1G1XA 4OI0A 2VASA 1UAWA 3KXDA 3JTOA 5SUHA 2XWYA 5CZVA 1U4BA 5HLFA 2CWXA 4FF4A 3CCZA 4ZVUB 1YJNS 2AYGA 4M1KA 1IR1A 4QW8A 4A4JA 1FERA 4QU7A 5GMDA 4JI0F 1MMLA 2WB4A 3DOKB 4DX7A 1FFGB 1Q53A 4DSIA 4WFXA 1PJ6A 1WC4A 1VCTA 5EDWA 2LQ5A 1R0AB 2O5DA 5LT5A 2P8IA 3H40A 3SV3A 2ZJPQ 1S6UA 2PI4A 5CXTA 3QRQA 2XTJP 1WHWA 3AOBA 1P1LA 3LTOA 1O5JA 2KYXA 2OSQA 2YNGA 2Z57B 1L3UA 4PUOB 1UZHA 2LDYA 5EX0A 3NGSA 2PI5A 2RS2A 2V68A 4MAKA 4NXMJ 1AUSL 1RSCA 5F8HA 1W25A 1HBMA 2MQOA 2F7VA 1YHQS 5D6GA 3OTCA 2CG4A 5D0EA 3FQKA 3R5JB 3C14A 4EO8A 2HNZB 5B0DA 1SH0A 3IRWP 4ZPDA 1FE0A 3JQJA 1VQOS 1BWEA 3W8GA 1NZAA 4CLKA 2B9XA 1FKOB 1CC8A 2CQ3A 1BQNA 1DTTA 2CQ1A 1YVFA 2BANB 2VG6B 3QGGA 1J5EF 4B9UA 4ECWA 1VBYA 2JEGA 4JI3J 1MN7A 4ZS6A 4M94A 2MQQA 2MQ8A 3KFWX 4FN5A 4A8WA 1KWMA 2C28A 2CPJA 3TAMB 4K5SA 3M9OB 1RE1B 2MKIA 1RWOB 3QAEA 1B0TA 1HL6A 2DNQA 3ISND 2ZH9A 1C0TA 2YVSA 5K8PA 1RCOB 2XSFA 3EICA 4Z2XA 4URGA 1U1LA 2HG4A 1ULRA 4G1QB 4WE1A 2CJBA 4ECQA 3P8BB 2EFVA 1C0UA 3K8VA 2V8VA 3ELHA 2X7IA 2PIIA 1FI4A 1U48A 3CD7A
chains in the Genus database with same CATH topology
1IBLJ 3IMQJ 1XMOJ 4X62J 5LM7E 3T1YJ 2MTLA 2UUBJ 4DUYJ 4V1Ak 4LFAJ 3R2CJ 1FJGJ 5AJ3J 4DR7J 4DV3J 2F4VJ 4LF8J 1HR0J 2UXCJ 3R2DJ 2E5LJ 4PWWA 4LF6J 5IWAJ 4LF7J 4JI5J 5LMUJ 4JI8J 4LF4J 4GKKJ 4KY3A 1N36J 5A2QU 4YHHJ 4KYZA 2UUCJ 1HNZJ 4DUZJ 4LFCJ 1HNWJ 4DR3J 3W1YC 4DV5J 4X65J 2HHHJ 4B3SJ 1J5EJ 1XMQJ 3JAMU 4DR4J 4JI7J 2KVQE 4JI6J 4X64J 1N32J 2VQFJ 2VQEJ 4YY3J 1IBKJ 4RJVA 4JI1J 4B3MJ 4DR2J 4AQYJ 4LF5J 4DV0J 4NEZA 2MEWA 4DV7J 4JI0J 4LF9J 4DV4J 4HHUA 1I94J 1XNQJ 5BR8J 4NXNJ 4NXMJ 1IBMJ 4OX9J 4X66J 4JV5J 3D3BJ 4JI3J 2KL8A 2ZM6J 3J7AN 1XNRJ 4B3TJ 4NEYA 4DV2J 5IT9U 4JI4J 3J81U 4DR5J 4GKJJ 4DV1J 2UXDJ 2MQ8A 3J80U 4JI2J 4K0KJ 5LMNJ 4B3RJ 1N33J 4LFBJ 4KHPJ 2UXBJ 3T1HJ 4DR1J 1N34J 1HNXJ 3D3CJ 4DR6J 4JYAJ 2UU9J 2UUAJ 4DV6J 5FLXU 3OTOJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL J;  3IMQ J;  1XMO J;  4X62 J;  5LM7 E;  3T1Y J;  2MTL A;  2UUB J;  4DUY J;  4V1A k;  4LFA J;  3R2C J;  1FJG J;  5AJ3 J;  4DR7 J;  4DV3 J;  2F4V J;  4LF8 J;  1HR0 J;  2UXC J;  3R2D J;  2E5L J;  4PWW A;  4LF6 J;  5IWA J;  4LF7 J;  4JI5 J;  5LMU J;  4JI8 J;  4LF4 J;  4GKK J;  4KY3 A;  1N36 J;  5A2Q U;  4YHH J;  4KYZ A;  2UUC J;  1HNZ J;  4DUZ J;  4LFC J;  1HNW J;  4DR3 J;  3W1Y C;  4DV5 J;  4X65 J;  2HHH J;  4B3S J;  1J5E J;  1XMQ J;  3JAM U;  4DR4 J;  4JI7 J;  2KVQ E;  4JI6 J;  4X64 J;  1N32 J;  2VQF J;  2VQE J;  4YY3 J;  1IBK J;  4RJV A;  4JI1 J;  4B3M J;  4DR2 J;  4AQY J;  4LF5 J;  4DV0 J;  4NEZ A;  2MEW A;  4DV7 J;  4JI0 J;  4LF9 J;  4DV4 J;  4HHU A;  1I94 J;  1XNQ J;  5BR8 J;  4NXN J;  4NXM J;  1IBM J;  4OX9 J;  4X66 J;  4JV5 J;  3D3B J;  4JI3 J;  2KL8 A;  2ZM6 J;  3J7A N;  1XNR J;  4B3T J;  4NEY A;  4DV2 J;  5IT9 U;  4JI4 J;  3J81 U;  4DR5 J;  4GKJ J;  4DV1 J;  2UXD J;  2MQ8 A;  3J80 U;  4JI2 J;  4K0K J;  5LMN J;  4B3R J;  1N33 J;  4LFB J;  4KHP J;  2UXB J;  3T1H J;  4DR1 J;  1N34 J;  1HNX J;  3D3C J;  4DR6 J;  4JYA J;  2UU9 J;  2UUA J;  4DV6 J;  5FLX U;  3OTO J; 
#chains in the Genus database with same CATH topology
 3TW0 A;  5CHC B;  3Q0A A;  2VFS A;  4XK8 C;  4C8O A;  2DNL A;  5A8W B;  1VC5 A;  2DNY A;  1B64 A;  1X4F A;  3G6E S;  1RAC B;  3W61 A;  1ICE B;  1C1C B;  1T95 A;  4J9P A;  4HTJ A;  3HLU A;  3MPU B;  2IHR 1;  2Z58 B;  1R0B G;  3DOK A;  4AL5 A;  1D09 B;  5AXK A;  1S97 A;  5F8L A;  4DR4 F;  2LEA A;  4QW9 A;  4K4W A;  2E1C A;  2Q79 A;  2XS5 A;  4NRT A;  4AD6 A;  3C16 B;  3KUH A;  3HP6 A;  3TI0 A;  2HHT A;  1R89 A;  4LSL A;  1LWF A;  2DH8 A;  2EBG A;  5DJB A;  3JYT A;  5CZX A;  4QQB A;  2Z8Q A;  3C8Y A;  5IV3 A;  2IRU A;  3CJK A;  5J2N B;  4Q2L A;  1ZET A;  4LF8 J;  1EKR A;  4QYZ K;  2PEH A;  4DR2 F;  4DZD A;  3AJ2 A;  3OFH A;  2FVQ A;  1FWP A;  4JI5 J;  2OJ3 A;  4ILM A;  3J7Y I;  5BYR A;  4GRS A;  1YG0 A;  3NLC A;  4QR1 A;  5J1N A;  4YHH J;  3BN4 A;  2O67 A;  2DNM A;  3HHL B;  1Q0N A;  4KYZ A;  4CTA A;  4KHP F;  4IG3 A;  2KTQ A;  2ZKU A;  4TQS A;  2EC2 A;  2ZZT A;  1LK5 A;  1IKY A;  1G3O A;  2JL9 A;  2XLK A;  3D9B A;  1TV6 B;  3OTE A;  1HNI B;  2APO A;  2VFV A;  3AQP A;  4A8O A;  5IXU A;  3MUV P;  3DRP B;  1T3N A;  1VBX A;  2HEK A;  2HQ3 A;  2YX7 A;  3NP5 A;  3OL7 A;  1M5H A;  5KFV A;  4JI4 F;  2VBX A;  5KFN A;  2A10 A;  1S6Q B;  4PAA A;  5G0R A;  4ECV A;  2OEM A;  3IGN A;  4L3K A;  2CQ4 A;  3C6T B;  4C0B A;  1M5S A;  3QLH B;  2HHV A;  3RBD A;  2X1G A;  3SFU A;  1DQ8 A;  1FES A;  4YQW A;  1YIJ S;  1RHU B;  1NK0 A;  5HVH A;  3QT8 A;  2OO4 A;  5C24 B;  1U1N A;  1SH2 A;  1RT2 B;  2DNO A;  3QSY B;  2GHV C;  2ILY A;  1JLQ A;  4RJV A;  5L9X A;  1JLF A;  3U02 A;  1K73 T;  2V2Q A;  4JI1 J;  4C98 A;  1WI8 A;  4USU A;  5CCL A;  2Z2L A;  2Q3P A;  4LF6 F;  1RIS A;  1B0V A;  2BM1 A;  3MDF A;  2V67 A;  1HNV A;  3W2V B;  1HYS B;  3J81 Y;  5J2Q B;  4DQP A;  2KXN B;  4PEO A;  1GMW A;  1FX4 A;  1RWK B;  3V6H A;  3F73 A;  3BDE A;  1I94 J;  2B8Q A;  4Z37 A;  1Q16 B;  1Q81 T;  2G4B A;  5H9F J;  2LP4 A;  3DOM A;  3NGT A;  3UN3 A;  2VQE F;  3CCS S;  2IRY A;  3ZTO A;  2MB0 B;  3IWL A;  3QGP A;  1U26 A;  1SUQ B;  3M1V B;  1N5Y A;  4JV5 J;  1N5T A;  4DUY F;  2DRD A;  4DCP B;  3PW2 A;  3RBE A;  2DXE A;  2VPY B;  2IBO A;  4PYD A;  1B7F A;  3UD5 A;  1JLB B;  2LLZ A;  2AWZ A;  2EKY A;  4ZPT R;  4YR2 A;  3PFO A;  1S0M A;  3EDQ B;  3PVX A;  4K4V A;  1R43 A;  2FDN A;  2JWN A;  4DV2 J;  2PSZ A;  2V94 A;  1C1B B;  4URQ U;  2KT2 A;  3KK2 A;  1VBZ A;  3T3F A;  4CO2 A;  3LUY A;  4M5L A;  4OJG A;  3TRG A;  2V8D A;  4CLS A;  1Z1Z A;  4JI6 F;  1RT3 A;  2IFX A;  1NHU A;  3CCW A;  4CM2 A;  1F5B A;  2J5A A;  1LFW A;  1RQ0 A;  2E44 A;  1EB0 A;  2HSE B;  2QL9 B;  3AD8 C;  5CYJ A;  4ECR A;  2VB6 A;  4PXD A;  4KKO A;  1HWL A;  1CLF A;  1N36 F;  2ZBQ A;  1RTD A;  2CQ2 A;  3OBI A;  2CQ0 A;  2V9W A;  2UZA A;  3LF0 A;  4OHZ A;  3DRR A;  2AHO B;  1KBR A;  3PJW A;  5JMN A;  2CQC A;  2VPW B;  3O5T B;  4DR6 J;  3PNI A;  1MU2 A;  2WON B;  1HNX F;  4ID5 A;  1VJQ A;  2JSX A;  3BBB A;  3GFH A;  1EHW A;  5EX3 A;  4OL8 A;  3PHT A;  2NUU G;  2OHD A;  3IG1 A;  2RU3 A;  1N48 A;  5GAE U;  2D69 A;  4MYT A;  3GIK A;  1LQ9 A;  2GQC A;  3G9C A;  1H7X A;  3DLB A;  3AFG A;  3KWM A;  2LXI A;  1TL1 A;  4LFA F;  3BB5 A;  3CT9 A;  3B54 A;  1YRX A;  2CNK B;  4LRA A;  4QZV B;  5K8O A;  5F3Z A;  1KN6 A;  1HBU A;  2PD1 A;  3GYG A;  3ZZY A;  1RAJ A;  4KGK A;  1KP6 A;  3NMR A;  1V3S A;  4NLV A;  5HAN A;  1UFK A;  4B17 A;  1D1U A;  2AX0 A;  1NEE A;  3PDN A;  5KFB A;  1DUR A;  1WSR A;  4H4O A;  3EYZ A;  1B3T A;  4DQI A;  2Y8Y A;  2LVW A;  3S6E A;  1MWZ A;  4PQU B;  3Q24 A;  5CYQ B;  2KN4 A;  2MY8 A;  2JEF A;  3RW7 A;  1S1X B;  4OZ0 A;  2N3L A;  4PKD B;  1RYS A;  2GGP B;  3CJ8 A;  3JXO A;  4W98 A;  2BOP A;  2IMW P;  4LF7 J;  2NZC A;  5LMU J;  1KOO A;  1JKH A;  3NXZ A;  4OJ3 A;  4FXV A;  1VBK A;  1JLB A;  1SC1 B;  4RUB A;  4A8S A;  1CJT B;  1FEH A;  3PYD A;  1LWF B;  3JYT B;  4P2M A;  5H9E J;  1CS4 A;  5DDP C;  3M05 A;  2RHQ B;  3GR0 A;  2QL7 B;  3VAF A;  1SUQ A;  3M1V A;  1UFW A;  4NPO A;  5J2P B;  1N5Y B;  1QSY A;  4JV2 A;  3TZW A;  1HW8 A;  1RI7 A;  1XR6 A;  1XEZ A;  3MI7 X;  1NH7 A;  2ZOG A;  3GIR A;  3H90 A;  4OZL A;  3PKY A;  3H5X A;  3BEG B;  5GAD U;  2DNP A;  1J5E J;  3TYT A;  3A3O B;  2QA4 G;  5ITH A;  2DO0 A;  3JSM B;  1Q82 T;  1PYO B;  3D0I E;  3RGI A;  3IWX A;  4C3K A;  5A8W A;  3PYF A;  5HQL A;  2HZV A;  3PW0 A;  3CXC R;  2DGT A;  1UWB A;  4X4U A;  4TKT A;  1UW9 A;  3DOM B;  3BKU A;  3X3U A;  4C8Z A;  1PJ5 A;  2FGO A;  2KFZ A;  4I1T A;  1NJW A;  3CWJ A;  1H2V Z;  1ZPW X;  2C2R A;  1SBR A;  4PPD A;  1HMV A;  3M2U A;  5EWF A;  2UVV A;  5KFG A;  5J2Q A;  3M8Q B;  3QYY A;  1SC3 B;  3EXY A;  2V2K A;  3P3D A;  4I68 A;  4KPY A;  3GB0 A;  1K0V A;  4B3R F;  4I0W A;  2YNF B;  4ID8 A;  5D77 A;  1OY6 A;  5ADZ A;  5H1S V;  2DNR A;  4ED5 A;  1PJ7 A;  3I0R B;  3OW2 R;  4X4N A;  4PXC A;  4Y65 A;  2JLG A;  1RAG B;  1F9H A;  2B9W A;  4MIB A;  3HPO A;  2UVU A;  5HAT A;  3M8S A;  2DNG A;  2O1P A;  3SBM A;  1FRX A;  5C42 A;  4IR1 A;  2QE5 A;  4HDH A;  2GHP A;  3MD1 A;  4CNZ A;  4IDK A;  3K89 A;  1FDD A;  2R8I A;  2R7W A;  3CDE A;  1AA1 B;  4RX6 A;  1UVJ A;  4O44 A;  1SIZ A;  2BRL A;  2KRR A;  1XTZ A;  1BQM A;  2HBZ B;  2HIY A;  2K3I A;  2QL5 B;  4OQJ A;  4CO3 A;  9ATC B;  3L3C A;  2JJ4 D;  2KG0 A;  1QM9 A;  2F8M A;  3DRP A;  4O4G B;  1EQ0 A;  3P45 B;  2CXE A;  4KGX B;  5D8H B;  3D5M A;  2W8K A;  4ZP7 A;  1OJ4 A;  2CPX A;  2HZC A;  3MR3 A;  1Y5L B;  2XYP B;  3K57 A;  1T9T A;  2Z2Y B;  1KR4 A;  3DMJ A;  3R5A A;  2XCA A;  2Q1L A;  3NS7 B;  4MK7 A;  3KG4 A;  3EE3 A;  1Y3K A;  3IP0 A;  2QMW A;  2VUG A;  1HMV B;  2AJ4 A;  2KB2 A;  3M2U B;  3DNC A;  4M5G A;  3F44 A;  1LXN A;  1Q4R A;  4F0H A;  1IN0 A;  4M5D B;  4XPC A;  3V81 A;  3VAI A;  5A8R A;  5L8R C;  4C11 B;  5CAA A;  4ZVF A;  4FZV A;  2DGW A;  2DH9 A;  1FRH A;  3ZZ0 A;  1IKX B;  5KFH A;  2WTF A;  3OVS A;  1AB8 A;  1FRK A;  3P5B P;  3KLH A;  2CPH A;  2IJR A;  4OI6 A;  2ILZ A;  2WVF A;  4OZN A;  2P9G A;  3BF4 A;  4RKU C;  3RBZ A;  3HHD A;  4J9N A;  2IC3 A;  5CYM A;  3HSG A;  3SCI E;  3DLH A;  2R7U A;  3MAQ A;  3IR5 B;  4MK9 A;  2XSJ A;  1NO8 A;  2NXU A;  2J8S A;  2G2O A;  5HRO A;  2Z4P A;  2DB1 A;  1KRP A;  2BJ3 A;  5JJB A;  4J9R A;  4LF7 F;  2FTR A;  2UUB J;  1U8S A;  4TXS A;  2A3J A;  1PBU A;  2GGP A;  1HWI A;  2YQ3 A;  1X4A A;  3P5T L;  5JVH Q;  3MED A;  1KQK A;  5KFM A;  1Y5I B;  1NPP A;  3POT B;  1F60 B;  1FXR A;  2ZOM A;  4PXB A;  5KFU A;  2FJW A;  1WTF A;  4OYB A;  4DL4 A;  2Y1R I;  2AD9 A;  2I5J B;  3ENV A;  4KGM A;  3KNA A;  2J9E A;  4YB7 A;  4IR9 A;  3KG1 A;  2DY1 A;  3GV8 B;  2IPO B;  4FKX A;  2N7C A;  1PC5 A;  1WC5 A;  2E5J A;  4MKB A;  1UCN A;  1JK9 B;  4GVB A;  5IT0 A;  2DIT A;  2FLP A;  3ZTR A;  1VLY A;  3OVB A;  2HZA A;  1RHM B;  1ZAW A;  1UEU A;  1WSV A;  2J7U A;  2KYZ A;  3W64 A;  2XC9 A;  1N52 B;  1KKH A;  2RT3 A;  3BBF A;  5IC6 B;  4XO0 A;  4UQT A;  3LQV A;  3CCV S;  2CQG A;  2LEC A;  4OHW A;  1X0P A;  2MLX A;  4F04 B;  1IKV A;  2B6A B;  4ETZ A;  4GKJ F;  2ZBC A;  4X65 J;  2J76 E;  3HKW A;  4NLR A;  4ID5 B;  2H4Y B;  2ACY A;  1O0P A;  3L09 A;  4GVL A;  3MEG B;  2Q6B A;  3U1L A;  3BYP A;  3SDE A;  5KG3 A;  1WOO A;  1Y7P A;  3D6M B;  3RR7 A;  1WF1 A;  1YWX A;  1NK5 A;  4RW8 A;  3FMW A;  4DFM A;  2MKK A;  2AJ2 A;  4DR4 J;  3MM5 B;  4ZPW R;  1XJW B;  2OGU A;  4ZVH A;  4WYL A;  2RU9 A;  4PG8 A;  1A6L A;  2QA2 A;  5CH7 B;  1HFE L;  1RK8 A;  2IDL A;  3ETO A;  1UVM A;  2CDQ A;  3MCO A;  2MHN A;  2C3P A;  4QR2 A;  4DN9 A;  5GAG I;  4JV0 A;  1WHV A;  5KFE A;  4USW A;  2OH2 A;  3DLE B;  3CO0 P;  4P52 A;  4I7F A;  2R8H A;  2VC0 A;  2YKA A;  3MMB A;  2RQM A;  4PRF A;  5BJR A;  4ILR A;  4B3M F;  3CSK A;  2GA7 A;  5E7O B;  2ZJR Q;  4WK3 A;  1VS3 A;  2YKO A;  1EAY C;  3FBF A;  4YN3 B;  1T7P A;  2RHS B;  1IKX A;  4I4B A;  1CJT A;  3F41 A;  1NM2 A;  4X64 F;  4TY9 A;  3W5X A;  4LBI A;  3GMG A;  3OL9 A;  1N54 B;  3DRX A;  1U0H B;  1TP7 A;  3QSI A;  3CF5 Q;  4OX9 J;  1FK9 A;  1S1V A;  2M3D A;  2LQJ A;  2A1B A;  2O3D A;  2QC3 A;  3TA0 A;  2UUB F;  2OUG A;  1UP1 A;  4KJI A;  2UXC F;  4ZA1 A;  5C24 A;  3MUR P;  5D3G A;  2ZM6 J;  5I3U A;  1W26 A;  4P7T A;  3SI8 A;  3MEC A;  4LF9 F;  2WBR A;  1XMB A;  1Q8I A;  2J0W A;  5AJ3 F;  3MOZ A;  2LEP A;  3ADA C;  2MKC A;  4FP9 A;  2AV5 A;  2PE8 A;  5L1J A;  2VDH A;  2BE2 B;  2V4J B;  2B4P A;  2B6A A;  1FDB A;  4IYQ A;  2HHH F;  1NDL A;  4B9N A;  3NG8 A;  4JP8 A;  2CPE A;  3QIP A;  3ONQ A;  2HRY A;  1TFW A;  1LWC B;  2GO9 A;  2FY8 A;  5F8M A;  2Z2Z A;  3ISZ A;  2R7R A;  3CCU S;  1U02 A;  2A2D A;  2A6O A;  1F2G A;  2NXJ A;  2XMA A;  4DMZ A;  1N6Q B;  1VQS A;  4CYU A;  3T1H F;  3CTR A;  1HKA A;  4J9U E;  1IBC B;  2F9J A;  2E5I A;  3W60 A;  2BE2 A;  2V4J A;  3BJY A;  4IG3 B;  3DGP B;  4I2Q A;  3TAN A;  1TL3 A;  3QID A;  4FDF A;  2DXF A;  5LSL A;  2DGU A;  3TQ1 A;  2UU9 J;  3AB2 B;  4AYB D;  1HNW F;  2PA8 D;  1S1T B;  3GR1 A;  4TYB A;  1DZ5 A;  1R8H A;  1T03 B;  3DN9 A;  4NRU A;  2XO7 A;  4JV1 A;  4EI2 A;  2OKQ A;  4Y3C A;  4ILL A;  1KLM A;  3HDS A;  1XWL A;  3M6X A;  1UFL A;  3VV2 B;  1RU2 A;  4M5J A;  4DUY J;  2YWK A;  4HH0 A;  1T3O A;  1RT3 B;  1ZTW A;  2RRA A;  1JLE A;  3MD3 A;  3CD0 A;  1L5U A;  4K2X A;  4DWI A;  2MZ1 A;  3H5Y A;  1DRZ A;  5JUM A;  2GIR A;  3IBW A;  4DSK A;  2A18 A;  1FJG J;  1T94 A;  4WZQ A;  2HFN A;  2M8D B;  3H0P A;  3BQ2 A;  1HBN A;  1TKD A;  3CJR A;  2AYE A;  3LP2 B;  5KG0 A;  1DY3 A;  2CQP A;  1HHS A;  2VG7 B;  3PO4 A;  2IVM A;  3S01 A;  4USI A;  1OMS A;  1R6Y A;  2G1H A;  2XYH B;  1CEZ A;  3TZY A;  4WFA Q;  2D7S A;  4MMO A;  1CUL B;  1FDA A;  2HK2 A;  3SFG A;  3NMA A;  3PHE A;  5FJ4 A;  1SH3 A;  5KFW A;  2LCW A;  2HQG A;  1P9Y A;  3MPD A;  2RH3 A;  3BS9 A;  3I32 A;  4O3Q A;  3ZNU A;  1IVZ A;  2CFX A;  3FRZ A;  3A3N B;  2I0X A;  2E5L F;  1EQM A;  4L74 A;  2W7A A;  3WC0 A;  1TKX B;  4F4K A;  1RT7 B;  1G6B A;  3ET6 A;  1TMM A;  4CM0 A;  5F8G A;  4ZVE A;  5F0U A;  2HND B;  2KM8 C;  2X1A A;  4DN0 A;  1FTC A;  4DL5 A;  1CSJ A;  2BUN A;  3VCD A;  1KTV A;  1ZM4 A;  1NDC A;  1WHX A;  3ZNJ 1;  1Q78 A;  2CJ9 A;  4TY8 B;  4MKV A;  3ZZR A;  1TL3 B;  5E41 A;  3HO1 A;  3SSS A;  1Y11 A;  4JI7 F;  1I3O B;  2YQ1 A;  4HEA 9;  8RUC A;  1NLK L;  4DF4 A;  5KG6 A;  4JI7 J;  2NS1 B;  1RAD B;  4ANC A;  1N0U A;  2HKE A;  3DRS A;  4OMF G;  3SSR A;  1K47 A;  4NCG B;  4UW2 A;  1DLO B;  2HAF A;  4UY8 T;  2FZC B;  3R5D A;  2B43 A;  2M5Y A;  2EFO A;  1Y0H A;  2I5J A;  2U2F A;  5A6P A;  4DQR A;  4KB7 A;  2E66 A;  4IH6 A;  4NML A;  2ACM A;  3I0R A;  5DM6 Q;  6FD1 A;  1RT7 A;  4ZPB A;  2NCK L;  2VKZ G;  3C14 B;  1RT5 A;  3KNG A;  4QPX A;  4NEZ A;  1U1P A;  1UMJ A;  1LEO A;  2JLF A;  2FJX A;  1RT4 B;  4DR7 F;  2AZ3 A;  2OD4 A;  1NHK L;  2YWF A;  4HHU A;  4Z7C A;  3DYA B;  1FKP B;  3PIO Q;  2IVF B;  4FVM A;  4RL1 A;  1CQN A;  5KT3 A;  4RW9 A;  1IBM J;  5M2U A;  1NCL A;  4FF2 A;  4BBY A;  3DLJ A;  4YDD B;  4RZR A;  2QSW A;  4M8L A;  1HR0 F;  3FEX B;  1OQ3 A;  3VAK A;  3ZFV A;  3H2V E;  3TUJ C;  2ZH5 A;  1K0T A;  2PDA A;  2F1F A;  3NCR A;  2C22 A;  4EYH B;  2F40 A;  4ZVG A;  1X4D A;  4Y2A A;  3G4S S;  4JI4 J;  2OIH A;  3T6B A;  2OPR A;  1RU1 A;  4LSN A;  4X65 F;  2NSB A;  3J80 U;  2RIJ A;  2CPZ A;  1FFW B;  4YB1 P;  3CJQ A;  2L9N A;  2GV1 A;  1R27 B;  2WSF C;  1DAR A;  2AZ1 A;  1HA1 A;  3HHE A;  1RWW B;  4B9V A;  4D3H A;  2VKR A;  5EGY A;  1KC8 T;  1FKP A;  5D4L A;  2H3E B;  2XO6 A;  3MFH A;  1N34 F;  1YJW S;  1YK9 A;  4U7C A;  5A8R B;  3S8S A;  3ILI A;  4IQX A;  4LF5 F;  4RW9 B;  2ZH8 A;  1KOH A;  2HGM A;  2CPF A;  2XMU A;  1RT6 A;  2X3G A;  4LF4 F;  1E6Y A;  4O3S A;  1D8Z A;  2HFO A;  1LWE B;  1VLO A;  2O01 C;  2BAB A;  2V6A A;  4ZJQ A;  4Y0F A;  1VQ6 S;  3GLJ A;  4I2P A;  4IQM A;  2UUA J;  3WQP A;  1HYS A;  2RVJ A;  3M6W A;  2I1R A;  2HS4 A;  2GAH C;  2BZ2 A;  2JZ5 A;  4LFC F;  1UZD A;  4FNI A;  2XS7 A;  1FJG F;  5L38 A;  3LPY A;  2C2Z B;  3FJ2 A;  1K1S A;  5A76 A;  4HDG A;  4QU6 A;  2UP1 A;  3DU5 A;  1WAC A;  4X62 J;  2FB0 A;  4F0M A;  3H2L A;  1WI6 A;  3PRV A;  5F8N A;  1UEV A;  2W2Q P;  1RLD A;  4IFV A;  1YBU A;  3AA8 A;  3BKF A;  1XBW A;  4W4M A;  3L7P A;  4YB5 A;  2F8E X;  2W9C B;  2YKM A;  2CA9 A;  2BJ7 A;  1GH8 A;  2W7O A;  3A8K A;  3EDR B;  1DTQ A;  1HAR A;  4B9M A;  4M95 A;  5J1E B;  2VIH A;  1DTT B;  1S6Q A;  2E1A A;  2VG6 A;  3EGN A;  3EXC X;  3GPA A;  5G0R B;  1SKS A;  4F2R A;  2XZT B;  4WTY A;  1K44 A;  1FRL A;  1QJH A;  2GZO A;  2B3T B;  3IGV A;  3CUN A;  2F4V J;  3BYR A;  3JSY A;  2QIF A;  2OEJ A;  3HVA A;  2GNK A;  3PRB A;  2OAU A;  4I64 A;  3SV4 A;  1H38 A;  4M5N A;  4OZJ A;  5GAE I;  5C25 A;  1CJU A;  4K4U A;  3GG0 A;  1V5I B;  4K4Z A;  1T9Y A;  2DNZ A;  1RBO B;  3BR9 A;  1U45 A;  1SJF A;  4PR6 A;  4KY3 A;  4ICL B;  3OUY B;  2YNH A;  3CJ4 A;  1HIY A;  1T9X A;  1UJ4 A;  1RWN B;  1NJZ A;  2UUC J;  4ELV A;  4RUC A;  1RA7 A;  4DPO A;  4ES2 A;  2CAJ A;  2WVD A;  2IBK A;  4NL5 A;  1FX2 A;  4NYP A;  2CPD A;  2HS0 A;  5J2M A;  4DS5 A;  3UCU P;  3H7H B;  1JXL A;  3FRY A;  1SPB P;  1TUG B;  2WRM A;  3JQM A;  3GSI A;  5B0C A;  3NGD A;  3EPG A;  1AFI A;  5K14 A;  2LEB A;  3DLE A;  4WXO A;  4ZCI A;  4OYA A;  3W66 A;  5J2P A;  1S5Z A;  1TUW A;  3I0S A;  3FCV A;  3JB9 k;  5HLF B;  2XQC A;  2CDR B;  4MT1 A;  2OLW A;  2VON A;  5K20 B;  4X64 J;  2BW2 A;  2IJN A;  2J7W A;  1RTJ B;  3FBB A;  3W9H A;  4WTO B;  1OYD A;  5BR8 F;  4XPE A;  3V81 B;  1IUJ A;  4ZIT A;  1WKJ A;  2HNY B;  5KFZ A;  2R2R A;  1AZS B;  2LYV A;  3UD3 P;  2QRR A;  3E8O A;  1VFJ A;  3M6U A;  4ANE A;  4K4X A;  4DR2 J;  3WX8 A;  2R2S A;  3SZ2 A;  3PCO B;  4IG0 A;  4EU0 A;  3PW5 A;  4QPT A;  4K50 A;  2YNI A;  2ZUG A;  4DS4 A;  1T05 A;  2HHQ A;  1JLA B;  1VQK S;  3KLG B;  1V3R A;  1P27 B;  1WDT A;  4RNH A;  2MEW A;  4KO0 B;  4NZ6 A;  1RT2 A;  4F67 A;  3O8W A;  2ZOF A;  2GJI A;  3SMZ A;  3BZQ A;  4CLL A;  4LF9 J;  3GE9 A;  3C46 A;  4QCL A;  3DGP A;  1FHT A;  3TO8 A;  2ZH1 A;  4AT1 B;  2XNR A;  1PO6 A;  1S76 D;  1VIS A;  1GTE A;  3AB4 B;  1RTH A;  2JEI A;  2J9D E;  5C2G A;  1EJ7 L;  2HHW A;  4DI6 A;  2VDI A;  1YRT A;  3A8J A;  4X66 F;  2EG1 A;  1YTY A;  1AUD A;  1EAR A;  2FLL A;  3BO3 A;  4B08 A;  1F2H A;  2NUH A;  3T1H J;  1A0O B;  5HVF A;  2XUL A;  4Y2C A;  3CCQ S;  3WDO A;  2Y1J A;  2ZC4 A;  3UDE A;  4UF4 A;  2R8G A;  1FKO A;  3EMT A;  3QZ8 A;  1L3K A;  1FE4 A;  1R8C A;  2LQ8 A;  2NQP A;  2ZKT A;  3MM9 B;  4GKJ J;  2FUG 9;  3GIJ A;  3RR8 A;  4KSE B;  5DGB A;  4UST A;  4JI3 F;  1FDN A;  5D0G A;  3OLA A;  2VC1 A;  3FMB A;  3GJS B;  2ZZN A;  3X1L B;  2DIS A;  2LA6 A;  1KQG B;  1TKT B;  2BM0 A;  3BRE A;  4KV8 B;  3CCM S;  2KI2 A;  2VA3 A;  2LXU A;  4F26 A;  5MLC V;  2C2N A;  2DTJ A;  3RUB L;  1V5V A;  4YHH F;  2AGO A;  1FVQ A;  3ULH A;  5F9N A;  1KQS R;  2BJ9 A;  1VQN S;  4KHP J;  1R7I A;  2MY7 A;  1UWA A;  1XC9 A;  2XMM A;  4B3O A;  2E9T A;  1PAU B;  4L75 A;  3UN2 A;  4LSN B;  2DEI A;  3MMB B;  3I0S B;  4USJ C;  2DO4 A;  4UTG A;  5HQ8 A;  1M0S A;  1X31 C;  4UQG A;  5KG2 A;  1NDP A;  2AMC B;  2CVE A;  4X4T A;  3FBE A;  3R7N B;  4DSL A;  2HVE A;  3FNN A;  4IUF A;  3MEE B;  4ZLJ A;  1RP5 A;  3LH2 S;  5GVQ A;  3HFZ B;  1N5V A;  1X5S A;  1JLE B;  2GX8 A;  4F3M A;  3NAH A;  1ZH5 A;  2FYX A;  5LXR A;  2HVD A;  2KHC A;  2E7X A;  4KAI A;  4DF8 A;  4J9M A;  1NPK A;  2DKO B;  2HGL A;  3QT6 A;  2R7Q A;  5KT5 A;  4IH7 A;  2XGQ A;  1HQE B;  1NSQ A;  1QVF R;  1REG X;  2V2Z A;  3UVJ B;  5DZ6 A;  3BR8 A;  5DZ7 A;  3ZXW A;  2FLN A;  3M8Y A;  4NLW A;  4DU8 A;  3U7J A;  2HFV A;  4CH0 S;  4ZPV R;  3NNH A;  1AW0 A;  1PSD A;  1OYE A;  1VR6 A;  1PBA A;  2BKO A;  2UXC J;  4G1Q A;  1IKV B;  3FDS A;  3BGF A;  2X1F A;  1ITP A;  1BQM B;  3Q2S C;  4UOH A;  1DLO A;  4BC7 A;  3OL6 A;  3NAI A;  2K3K A;  3CO9 A;  2KDO A;  2FZG B;  2D1C A;  4RBV A;  5KAK A;  3G6V A;  2QGF B;  3KDN A;  2KFY A;  2HMI B;  1BD6 A;  2DHX A;  3C6T A;  1RT1 B;  3I9V 9;  2HS3 A;  4IOC Q;  2RKI A;  1PYT A;  1GAO A;  2EFG A;  3CD5 A;  2R2T A;  3TNV A;  4CLT A;  3QBC A;  4YS2 A;  4ENO A;  4DV5 J;  1S0N A;  2AKW B;  1VIX A;  4OZ3 A;  1RAA B;  4UOC A;  5KFO A;  1BQX A;  2YX1 A;  2QMX A;  2CNO B;  2FJV A;  4C48 A;  3IR6 B;  5HMZ A;  5B09 A;  3KLG A;  2BR0 A;  3ZO7 A;  1TMJ A;  3TVK A;  1GT8 A;  2M2B A;  4A46 A;  1U49 A;  3DLK A;  4PWU A;  1HHQ A;  1T02 A;  3JSR A;  2C42 A;  2W2O P;  3VR1 A;  3L7O A;  1AT1 B;  3GJR B;  3RTV A;  3DM2 A;  4JBC A;  4F4X A;  4ED0 A;  3I87 A;  1CBK A;  3RG6 A;  2W25 A;  4GC6 A;  1CUL A;  4NE9 C;  3C19 A;  4N47 A;  1WKL A;  2MSS A;  4Y2K A;  1FJ7 A;  2ZH4 A;  4QR0 A;  2PMW A;  2ASY A;  2D3Z A;  2N82 B;  1WG1 A;  5ETK A;  1PG5 B;  5LSO A;  4FKY A;  2KXF A;  2DRB A;  2R7X A;  1TAQ A;  4ZK7 M;  5I3Q A;  1M1K T;  1VRU A;  3HK2 A;  1WDD A;  4F4A A;  4R5P A;  1WWH A;  2QN6 B;  4YP3 A;  2DIV A;  4K5R A;  2RIL A;  4HYK A;  3BBC A;  4RU9 A;  3EWG A;  3NWG A;  2ZUA A;  2BDP A;  4JI0 J;  4KC5 A;  4LSL B;  5I4M A;  4C11 A;  1ZYQ A;  3C2P A;  3KLH B;  4F02 A;  3J7Z T;  2ZWO A;  5DG8 A;  3ILJ A;  3D3B J;  4P9S A;  3UCG A;  1FRI A;  1LW2 B;  3HVR A;  1HBO A;  2XY5 A;  1UA1 A;  3IRX B;  4C0O C;  2DR8 A;  1EET B;  3FZB A;  1GNK A;  2CG8 A;  2GJ2 A;  3NGR A;  3Q8U A;  3SSQ A;  4PWD B;  3EZO A;  2CIM A;  2MQL A;  5JXS A;  1L3V A;  1P8G A;  4U8V A;  2GVD A;  1XQI A;  5KFX A;  5IT9 U;  1U2C A;  4BS2 A;  3V5R A;  3BPD A;  1GQE A;  5B0A A;  4YR0 A;  2YH0 A;  2YPZ A;  4CO1 A;  2MMY A;  2DY9 A;  2JDJ A;  4I2Q B;  4KH1 B;  3RAX A;  2KFN A;  1I5O B;  4NLD A;  3T9Z A;  3UWT A;  1NB7 A;  5J1E A;  4X4P A;  4KQZ A;  2OSR A;  4ZCK A;  2DR6 A;  3HSJ A;  4ZCM A;  1NK8 A;  4C9D A;  2DPJ A;  5LMU F;  1DAX A;  1D3W A;  1FXD A;  2HFZ A;  3H5U A;  1OWX A;  2ZBI A;  3IC1 A;  3M7V A;  1T9U A;  2V2V A;  4OYO A;  5EUH A;  1X9M A;  1J5O B;  2DEJ A;  2FIU A;  2LU2 A;  3LAM A;  2ZD1 A;  3FFI A;  2DYA A;  3HSD A;  3P96 A;  4K4S A;  1GXL A;  2OML A;  1UJ5 A;  5HAO A;  4DL7 A;  1DTQ B;  2ZNY A;  1MU2 B;  2WON A;  4LVO P;  5HK4 A;  4ZPC A;  3R6G B;  5HL7 Q;  2H1Y A;  2YKQ A;  5C2C A;  5IZH A;  3AT1 B;  5E2Q A;  2RRB A;  4TNO A;  1JLC B;  1VDH A;  1X7V A;  2EG2 A;  3D1H A;  3VWS A;  4J90 A;  3JAM Y;  4OI3 A;  3L7U A;  1Q7Y T;  1O51 A;  1NK9 A;  4IFY B;  1GMW D;  3B6B A;  3TVZ A;  1VQ9 S;  2F8H A;  2HBR B;  4DXL A;  3T1Y F;  1X9W A;  3H8Y A;  3LGN A;  2YNG B;  3EZU A;  4PUO A;  1VRT A;  5E0O A;  3QZ7 A;  3W8P A;  4AUK A;  1XR5 A;  1SXL A;  4F2S A;  1HWJ A;  2YQ0 A;  4BLG A;  3OVA A;  3FC9 A;  3QMQ A;  4N41 A;  1G7C B;  3FSX A;  3HHL D;  2JNJ A;  2ZVI A;  4UZB A;  1TQL A;  3R2D J;  1FWL A;  1RBA A;  4P2X A;  1HWK A;  3UE2 A;  3JQK A;  3ICL A;  1TVR B;  2ZH7 A;  2AJ0 A;  3SQG A;  3HVT A;  3I82 A;  1HNZ F;  4HKQ A;  2YWW A;  3T1A A;  3VQS A;  3M9M B;  4JB8 B;  4F4Z A;  1HI0 P;  2VOO A;  3O44 A;  1CJV B;  2C2D A;  3LP1 B;  3C3L A;  2X51 A;  2DT9 A;  4RWX A;  4TQR A;  2PMH A;  3CVK A;  2P9C A;  2DGV A;  2UUT A;  3R9L A;  1N33 F;  1WNE A;  3GG1 A;  1HNW J;  1SQE A;  4WU2 A;  1RB0 A;  1U24 A;  3W1Y C;  3PZP A;  2UU9 F;  1JJC B;  3BKT A;  4B3S J;  2I38 A;  4B9L A;  1NK7 A;  1BLU A;  3JTP A;  3UCZ P;  2VU5 A;  2RRN A;  2WOM A;  2MLZ A;  3CE8 A;  2XG8 A;  2XYG B;  4XDD A;  4OZ1 A;  1SC4 B;  5CYQ A;  3LAN A;  2M88 A;  4WE1 B;  2BJD A;  1ZM2 A;  1DQ9 A;  4E0D A;  4OHY A;  1GK8 A;  3VVU A;  1HBU B;  1X5T A;  4LRF A;  5IV4 A;  2HVI A;  4KV8 A;  2KVQ E;  1U6Z A;  3LO3 A;  1OQ6 A;  3OR1 A;  1RT5 B;  2V4R A;  1T8E A;  1ZS6 A;  3OXG A;  3V2U C;  4OV6 A;  4Q44 A;  3W9J A;  4DV7 F;  3DKD A;  1M5K C;  4CZC A;  1FF2 A;  2OD6 A;  3Q23 A;  5DQH A;  3G86 A;  4O23 A;  2G0J A;  2U1A A;  4CQ1 A;  3HX9 A;  2BQ3 A;  1VQL S;  3OTO F;  4U7U D;  1MG7 A;  5K5M A;  2CPI A;  1UVL A;  4C7Q A;  1J27 A;  1UEK A;  3TVY A;  2YWE A;  2V69 A;  4OX9 F;  2JEJ A;  1QD1 A;  4JOU A;  2AX1 A;  1HQU A;  3WIU A;  1Q8K A;  2HHS A;  2Y0B B;  3BQ0 A;  4A8K A;  1WHY A;  2XMJ A;  2FHM A;  4P7V A;  4XTT A;  5DO2 A;  3KJV B;  4WZM A;  1JNR B;  3DC2 A;  2H5I B;  1FK9 B;  1S1V B;  3E51 A;  2BKP A;  1JLA A;  3ILL A;  4JI2 F;  2H54 B;  2NXC A;  2OPP B;  3ET6 B;  3HF5 A;  1WKK A;  2WZ1 A;  5KFI A;  3RBX A;  2BA9 A;  2XSJ B;  5RUB A;  3UI3 A;  1NSP A;  3AY0 A;  4NLP A;  3KK1 B;  4ELT A;  4C8K A;  1BUX A;  1U6B A;  5DS7 A;  2ZNZ A;  4B3T F;  2DBB A;  3KLF A;  3EPI A;  1RUS A;  5MAO A;  3T5J A;  1U6F A;  3BH7 B;  4DL6 A;  3HHN B;  3PIP Q;  2XM3 A;  5IS2 A;  1TAU A;  2W2M P;  1WC6 A;  4DR3 F;  5LMN J;  4ECX A;  4DL0 C;  5KFR A;  1AFJ A;  2JVR A;  4PG4 A;  4FBU A;  1OIA A;  4LR8 A;  2XHC A;  2FVC A;  3KHL A;  3V4M A;  5CCM A;  3V6K A;  1TFY A;  1P6T A;  5CA5 A;  4AE5 A;  3NCP A;  1UW4 A;  2DHH A;  2W1B A;  1S6P B;  3TP2 A;  2I9S A;  2EFQ A;  2AGQ A;  3HD2 A;  1YDL A;  5FD1 A;  3PX0 A;  7AT1 B;  1KLM B;  2FLO A;  2FC8 A;  2M0G B;  3K17 A;  3W2V A;  3MR7 A;  3THT A;  2Z30 B;  1QAJ A;  4U8Y A;  2MKY A;  3KK1 A;  5M2R A;  3BSO A;  1AYE A;  2CJY B;  2HWI A;  1NME B;  1R6V A;  4OIX A;  3PR5 B;  3W65 A;  4CCH A;  1JLF B;  3R97 A;  3V6J A;  2BXJ A;  3QJJ A;  1BE4 A;  1K9M T;  1C0T B;  3HM9 A;  2AEF A;  1WG4 A;  3M8P A;  3D6F B;  2B4U A;  3NS5 A;  5AE2 A;  4O44 B;  3G82 A;  4U9R A;  2H4W B;  1VC0 A;  1YRU A;  2HYI B;  4MFB A;  3NWR A;  4CH1 A;  2PFF B;  1NND A;  4NI2 B;  2DD8 S;  3N79 A;  4HAC B;  2J6T A;  3CC4 S;  1HQU B;  3FK4 A;  2W4C A;  4ZDN A;  2HAI A;  3UDC A;  5C42 B;  2DNH A;  4DV2 F;  4FXD A;  3D1O A;  3L9Z A;  2AEJ A;  3FCH A;  3Q89 A;  1QLN A;  2HUR A;  1MWY A;  4X2B A;  3D67 A;  1FEE A;  4LT6 A;  4LF8 F;  5KFP A;  1CPZ A;  1S49 A;  5F41 A;  3F0N A;  3WX4 A;  1S77 D;  2COL A;  3EUN A;  3MMJ A;  2CPY A;  3THP A;  1JXE A;  1MN9 A;  1G4C A;  3M2V A;  4AND A;  1RWM B;  4ER8 A;  2HGN A;  3K5P A;  2EWH A;  1NJI T;  1D0E A;  4J9O A;  4WP9 A;  4NLU A;  4EZ9 A;  3AQO A;  4WP8 A;  1FD8 A;  1UL3 A;  2P6S A;  1Q95 G;  3QRR A;  4C97 A;  5K8M A;  2DPI A;  5CAB A;  3AXM A;  3AOD A;  3CC2 S;  4F4W A;  2VOD A;  3VGT A;  2QYG A;  1S59 A;  5I3U B;  2QEX S;  1WUU A;  1FJC A;  3SCL E;  3Q83 A;  4QYZ J;  4G3I A;  3C15 B;  1GXU A;  3NRB A;  3OJS A;  3V6D B;  3Q2T C;  1C1B A;  2FHK A;  3TX0 A;  3M2R A;  1TR0 A;  2GIQ A;  1VYA A;  2XWX A;  3OTD A;  4PQA A;  2F3J A;  3I4H X;  3ZTS A;  8AT1 B;  1JJ2 R;  1FXL A;  1U25 A;  2KHD A;  4ZIW A;  4OZ2 A;  5KT7 A;  4FS2 A;  3C16 A;  4LSZ B;  3OXL A;  2J0Q D;  2HPU A;  4K7Q A;  2POK A;  1PAE X;  3NS6 A;  5K14 B;  4DL3 A;  2FY1 A;  2MZJ A;  4NLT A;  1Y5N B;  2R42 A;  3CW2 C;  3U27 A;  1VQM S;  2BQU A;  2HWT A;  1VOM A;  2XY7 A;  3BQ1 A;  4AL6 A;  2LU1 A;  4WJB A;  5KG4 A;  2ZDO A;  5J2M B;  4QWC A;  2XZD B;  2ADB A;  1QVG R;  1IKW A;  4IO9 Q;  1OY9 A;  3M4X A;  4G6V B;  4RWW A;  1R8A A;  1N5S A;  1SJR A;  4DG1 B;  4GO5 X;  3G6X A;  4RW7 B;  1M5V C;  2VL1 A;  4CLY A;  4DV4 J;  1ZA2 B;  2YH1 A;  1JLQ B;  1X4G A;  3A12 A;  2L9W A;  4EO6 A;  3EZ5 A;  1X4C A;  2MZT A;  2BAC A;  1FA0 A;  2V8H A;  2UV8 A;  3DYA A;  4ZVQ B;  4ZJL A;  4ALZ A;  2GS8 A;  4TU8 A;  1S10 A;  4FXW A;  4IOB A;  1N8R T;  4CI0 B;  1YI2 S;  2IY5 B;  3HZE A;  2CVI A;  4Y2M A;  1VRQ C;  4Q7A A;  5KFL A;  2QLX A;  2M8H A;  4F36 A;  5KFY A;  1RAI B;  1JLC A;  1IQZ A;  2BAN A;  4GVB B;  4IDK B;  5E3P A;  3OXF A;  4YR3 A;  3M8Z A;  4NLQ A;  2OPQ A;  3AOC A;  4ED7 A;  2AT1 B;  2M7S A;  5DET A;  4QWA A;  4QIF A;  2BE7 D;  1I51 B;  1J5O A;  1QSS A;  1LW0 A;  4C4W A;  4OLO A;  1LNQ A;  4BWJ A;  4USM A;  2UXD J;  1O6X A;  5FII A;  3JTN A;  1QUV A;  1S9E A;  4NI2 A;  3W5Y A;  2W9B B;  5D3G B;  2YXL A;  2Y1I A;  5CD4 H;  4L76 A;  3DU6 A;  2EVZ A;  3OR1 B;  5DG9 A;  2K7K A;  3CCT A;  4CT8 A;  3NL0 A;  4CDI A;  5ETM A;  2LXF A;  3CJS A;  3NCQ A;  2UXB J;  2E1R A;  2G1D A;  2W8L A;  5L9N A;  1S4E A;  3OFE A;  3N9U C;  2BX6 A;  2HFS A;  1NH8 A;  2YNI B;  4K59 A;  4LIW A;  4D3G A;  3MMA B;  1TKX A;  3VGV A;  5DDO C;  3GIL A;  5SZT A;  2HQI A;  3HCX A;  1ZPV A;  3S7R A;  3NGK A;  2ZIT A;  3TJ9 A;  4RO0 A;  2QA4 S;  3TEG A;  2BE9 B;  4K4T A;  3IMQ J;  1AZS A;  2DXD A;  2HVZ A;  3PTW A;  1LXJ A;  3MMC B;  1KFD A;  2MTL A;  2QLJ B;  1TU0 B;  1C4A A;  3L4B C;  2IC3 B;  5CYM B;  4X4Q A;  2EEY A;  2DHA A;  3MR2 A;  4KIA A;  3K5N A;  2RQ4 A;  2FC9 A;  4DPW A;  3GFY A;  3H20 A;  3KLF B;  1NSK L;  1RJJ A;  2DK2 A;  2C3O A;  4Q0B A;  1DFD A;  7FD1 A;  2ZH3 A;  5EWE A;  2ADC A;  2E29 A;  2Z56 B;  4USH A;  5EHH A;  4EEY A;  2ATL A;  1SI9 A;  4LF6 J;  3BH6 B;  3HUL A;  4M5D A;  3T6J A;  4RUA A;  5J1P A;  2AQ4 A;  5CD4 A;  2JHE A;  2HLU A;  4JI8 J;  2HBY B;  4P73 A;  1RKJ A;  4ZIV A;  4V19 J;  5CQG A;  2W24 A;  3CDW A;  4H4O B;  4HHJ A;  1KQF B;  2AU0 A;  4G1I A;  6AT1 B;  2JC0 A;  3DLK B;  5L1L A;  1JB0 C;  2BOA A;  4OI4 A;  3RJM B;  2OMO A;  3SEO A;  2H5E A;  3MM9 A;  1S1U B;  3KMQ A;  2KZZ A;  2QFJ A;  3NOG A;  2K7J A;  2IA6 A;  4EZ6 A;  4MIA A;  3PX6 A;  1KDN A;  3OJU A;  3EVW A;  3DHW C;  5D0R A;  4P72 A;  2XS2 A;  1BQN B;  3KJN B;  4Q2M A;  1SJQ A;  5B08 A;  3QRP A;  2MJU A;  5ETO A;  2YKP A;  1VQ7 S;  2CUY A;  2G0C A;  2QLW A;  4HT7 A;  4ZVT B;  3MR5 A;  3TEH B;  3KYL A;  3JAM U;  3LGH A;  1QDU B;  2BJ8 A;  3IBF B;  3MGJ A;  3T19 A;  2M9K A;  1LWC A;  1MW7 A;  2NPI A;  3I5C A;  3NEK A;  4F25 A;  5IT4 A;  2A0F B;  4JI6 J;  8ATC B;  1RGV A;  3MPY A;  4YY3 J;  4KO0 A;  1IBK J;  4OLP A;  4KH0 B;  4ZP9 A;  4C2M A;  3FEY B;  3N6L A;  4R8U B;  3D28 A;  2ZWP A;  1HI8 A;  4L72 B;  5G4D A;  2VJV A;  4EK2 A;  4UUW A;  1SKW A;  3KLV A;  3DDK A;  2NLW A;  2HK3 A;  1RZM A;  4TU7 A;  2JLE A;  3BGU A;  3FCW A;  2I2Y A;  4ZHR A;  4ZVO B;  4ZVP B;  3H2U B;  4MIW A;  2KM8 B;  1OY8 A;  2CAD A;  2DCL A;  3PW7 A;  4QJV A;  2RF2 B;  2VA2 A;  1UKU A;  4O3O A;  4X66 J;  3HT3 A;  2AJ1 A;  2K1R B;  3B78 A;  1PIL A;  3GWC A;  4J9K A;  4DUZ F;  2KZM A;  1Z4U A;  2OEL A;  2F5G A;  4C3L A;  4LRB A;  3ETM A;  4TVA B;  3VZI A;  2HVH A;  5HP1 B;  4DLE A;  4EUV A;  4DX6 A;  5AE3 A;  1X8D A;  2B7C B;  3ITH A;  3O1L A;  2ZE2 A;  4NAS A;  4ERD A;  2B5J A;  5GAD I;  2XB2 D;  1FVS A;  3KHH A;  3RB4 A;  3OHB A;  1F3F A;  2VG5 B;  5F3T A;  1JKH B;  5KFA A;  4DCJ B;  4G65 A;  4HI1 A;  3GIM A;  4LQ9 A;  4LFB J;  3ENQ A;  3BV8 A;  4C8Y A;  3QO9 A;  4WBF A;  3J81 j;  3D7S B;  1UVI A;  3HHK A;  4FPI A;  4X62 F;  2ZBR A;  1ZZN A;  2OI2 A;  4J9S A;  2HQF A;  2WHO A;  1NXI A;  1Y00 A;  5D4O A;  5E5N A;  2EPI A;  4ED1 A;  3WC2 A;  2VBY A;  2QV6 A;  1X5O A;  3R5G A;  2ASJ A;  5ETV A;  1SKU B;  2MXY A;  3NY0 A;  3R7B B;  4P74 A;  3QPI A;  4DCO B;  1ZA1 B;  2R7O A;  4QIE A;  2YKN A;  3IA0 A;  5JVG Q;  2YBV A;  2WVE A;  4PZV A;  2XHW A;  5LM7 E;  1SCJ B;  3T5K A;  1YIT S;  3H25 A;  1UVK A;  2K2P A;  1RT1 A;  3EM1 A;  4PG5 A;  3VHQ A;  1ZBT A;  2WK4 A;  3DDI A;  4ELU A;  3MM7 A;  3QJL A;  3G82 B;  5KFJ A;  3KMS A;  3O2I A;  5ETQ A;  2Q6C A;  2RD5 C;  1SV5 A;  3FUY A;  5AXM A;  7FDR A;  3RAQ A;  1VHI A;  5GME A;  5FLX Y;  1NHV A;  1S7I A;  1CC7 A;  1HQ2 A;  3CDU A;  2P2C B;  3AD9 C;  4KFB A;  1GFW B;  4RW4 A;  4DJB A;  4Y2I A;  4F7V A;  4DV3 J;  4YEA A;  4ATN A;  4NCB A;  3EVM A;  2NYH A;  4NLX A;  1IJE B;  1M1G A;  1JJ4 A;  4CT9 A;  2DNK A;  4CP5 A;  4N5S A;  3CB4 A;  5L1I A;  1RTJ A;  5A8K B;  4OYZ A;  4ED3 A;  1LW2 A;  2OFH X;  1Q7L B;  3PRD A;  1MNE A;  1FCA A;  4CLP A;  4ES1 A;  3QFW A;  2MPU A;  3R27 A;  5DRK A;  2GMH A;  4FS1 A;  5I42 A;  2EFN A;  3LP0 B;  3O6Q A;  4HR2 A;  4A8X A;  2UUW A;  3RB3 A;  4DUZ J;  1W2B R;  3KUG A;  4OX7 A;  5HMW A;  3I5A A;  2VG7 A;  3QT5 A;  5E3Q A;  2YWG A;  5E3R A;  5IQ6 A;  2C2E A;  3THV A;  1TK0 A;  1KVI A;  3FSI A;  3K58 A;  3LW5 C;  4YME A;  2Q43 A;  2KJV A;  2YY3 A;  4IOA Q;  1UPP A;  1IBL F;  1E6V B;  1IWA A;  4B9T A;  2VH7 A;  1S9G A;  1XER A;  3OQ2 A;  4YDX A;  3W7B A;  4KE5 A;  1KNZ A;  2BV3 A;  3RU0 A;  2CJQ A;  1V6H A;  4M5M A;  3BSC A;  5LL6 d;  4R25 A;  3KG0 A;  3GV7 B;  5KOX A;  4F50 A;  3BDP A;  4LMZ A;  3R1H A;  2CZ9 A;  2I8E A;  4ETX A;  5IM0 A;  4F4Y A;  2AIR B;  4WK1 A;  2EC0 A;  4UT4 A;  3M2V B;  3QGI A;  2VQF J;  1IBK F;  1YZ7 A;  3AA9 A;  3UR0 A;  2PO4 A;  3AXK A;  3CIM A;  1VJW A;  4I6A A;  5AE1 A;  3TAQ A;  1T03 A;  4CO5 A;  3EGZ A;  1XK8 A;  4ZLN A;  4KGV B;  3G2X A;  1XR7 A;  3QLH A;  1S9E B;  2F63 A;  1GX5 A;  1B0P A;  1TL7 A;  4NZ7 A;  4WYW A;  1VC6 A;  4ZPA A;  3DDN A;  4R0J A;  5F8I A;  2ERR A;  3CME S;  1W2I A;  3QJP A;  1D9D A;  2EFP A;  1S0O A;  4NCG A;  4PPZ A;  2DR5 A;  2KU7 A;  2H5J B;  4ZLP A;  1KHW A;  4DV7 J;  1XNQ J;  4EGL A;  5K9F A;  2FHJ A;  2DVI A;  4ECS A;  1N88 A;  1CQM A;  4Q45 A;  3BN7 A;  1B4S A;  2QYC A;  2KT5 A;  2R3V A;  3NGU A;  5F8J A;  1R3N A;  4IFV B;  4WFY A;  3AOA A;  5DQG A;  4XDC A;  2XGP A;  3QIP B;  4KHM A;  4TYA A;  1RAF B;  4B02 A;  5DGA A;  1U09 A;  3BM7 A;  2AW0 A;  4J37 A;  4NA1 A;  1XNR J;  4AL7 A;  4OX6 A;  5T7L B;  4X4V A;  2GCF A;  2J8A A;  1YGY A;  2N4C A;  1NRK A;  2CRL A;  4EYI B;  5C5J A;  1UWB B;  4MH8 A;  3R7S B;  3D54 A;  1NJX A;  3OT9 A;  1U1O A;  4JI2 J;  1RHK B;  3G96 A;  4JUZ A;  4HTI A;  5IM0 B;  4Q5V A;  2CWK A;  4P10 A;  3T5L A;  3MPV A;  3V4I A;  3A3P B;  1M5P C;  3P4U B;  1CJK B;  4Y6I A;  1PGZ A;  2R7V A;  2ROP A;  1VMB A;  1M90 T;  3OPK A;  4LQ3 A;  4Q0B B;  3SXL A;  1K8A T;  1S9G B;  4PYA A;  3PAC A;  3TOQ A;  4MYU A;  1YJ9 S;  2DNN A;  2MHE A;  2KJW A;  2AJF E;  3D3C J;  3UNY A;  4JYA J;  1VRU B;  1ZM9 A;  4WFB Q;  4F3O A;  1NSA A;  3OTO J;  4ZVS B;  2ZH2 A;  2E1M C;  1U2R A;  4XAK A;  4DFP A;  5A6W A;  1VQP S;  1ZAX A;  5F0W A;  3UN5 A;  4RR5 A;  4CH7 A;  1YQH A;  4E8U A;  4DFK A;  2VOP A;  1LK7 A;  1SL2 A;  2IYI A;  2L3M A;  3DXB A;  1KS2 A;  3U1N A;  2EI5 A;  3CCL S;  3T1Y J;  3H5S A;  2OTJ S;  1V9O A;  4H4M B;  5ETS A;  2RQC A;  1TKT A;  2G2Y A;  3ILO A;  2MQP A;  4NXN F;  4FYV B;  4NXM F;  3RB6 A;  5H9F K;  4CLU A;  1IR0 A;  1MWQ A;  1NAQ A;  2F9D A;  2N3O A;  5KG5 A;  4PQU A;  2GVZ B;  5AJ3 J;  3K5O A;  4B3T J;  2QT7 A;  4I67 A;  2CKW A;  4YOE A;  3M8W A;  3DHX A;  1IJF B;  3EGW B;  4USK A;  4BWM A;  2M4M A;  5HO4 A;  3UDL A;  3MXH P;  1HLW A;  3GON A;  1HR0 J;  2UVR A;  2RDI A;  3DOL B;  3R5B A;  1QE1 A;  2AYB A;  4P71 A;  3IG1 B;  5ETR A;  3DRS B;  1W7W A;  3MM7 B;  2R2U A;  1U1K A;  2GML A;  1O8B A;  3K5M A;  3CCE S;  3N6M A;  1FO1 A;  2HMI A;  3MCM A;  1GMV A;  4ZP6 A;  5LJ3 Y;  1TL1 B;  4W90 B;  4RNO A;  2RKI B;  1NDK A;  2XBP A;  2F4F A;  2XY6 A;  2IM2 A;  1F9E B;  1HNZ J;  1UVN A;  1HWU A;  4RW6 A;  1RWV B;  2EXU A;  3S1T A;  5D78 A;  3MAH A;  1DQA A;  3QGH A;  4KKO B;  4LBH A;  4F3Q A;  3MEK A;  3A8I A;  3N5B A;  3E2E A;  1PCA A;  2JFK A;  4MJK A;  3PY8 A;  1VQY A;  4ZLL A;  3TA2 A;  4IRD A;  2FGC A;  2KXH A;  4UZC A;  2HND A;  3UVJ A;  3MR6 A;  4A8M P;  3AH6 A;  3ITH B;  1JQG A;  1LWE A;  3Q8S B;  2W4D A;  4QWB A;  4OI1 A;  1N32 F;  3GCX P;  4N8O A;  2QG9 B;  1RT6 B;  2XEX A;  3HI9 A;  3IAM 9;  3IRX A;  4NCA A;  3K2Y A;  2AJQ A;  2WSE C;  1YLX A;  1RTI B;  2MKJ A;  3LGM A;  3BO4 A;  3KHG A;  4OZ5 A;  3GYX B;  1E6V A;  3D1Q A;  2HFU A;  4RUH A;  1XNQ F;  3SQO P;  4EMD A;  5M2P A;  3VGS A;  1WG5 A;  2Q66 A;  4OV1 A;  2V34 A;  4WF9 Q;  1JNZ B;  2B7B B;  1QY7 A;  3NBP A;  3Q8R B;  4NA3 A;  4DEZ A;  2VBZ A;  4R5P B;  2B4V A;  2RML A;  1U1Q A;  2MDA A;  3K8W A;  1BWV A;  4C3M A;  3F56 A;  1MLA A;  2QSF A;  4AFF A;  3PM9 A;  5B7W A;  5KTQ A;  1FNO A;  5B0G A;  2OPS A;  5I42 B;  2V8G A;  2N7Y A;  2ZEJ A;  5LOQ A;  1CJK A;  4U6P A;  3CED A;  3IO1 A;  2ZM6 F;  1H98 A;  2BRK A;  1YJ7 A;  2MZQ A;  3GYN A;  4NWB A;  5I3P A;  3C6U B;  2H65 B;  1WEZ A;  2BVZ A;  2UVW A;  3EVO A;  4NXN J;  5T41 A;  1RWP B;  2MST A;  1S1T A;  4P2S A;  2XLJ A;  1V3Z A;  2VHG A;  4F0K A;  1MSW D;  4M5I A;  1PC4 A;  3M9N B;  3PEH A;  3IS9 B;  5HMY A;  3MUT P;  1RHJ B;  4KFB B;  4RW4 B;  2VJU A;  1WTB A;  2QZ8 A;  1IXK A;  1HPZ B;  5T7L A;  3QAU A;  2ALY B;  2C1E B;  2LA4 A;  4AXJ A;  1KTQ A;  5KT2 A;  4Y00 A;  3FEZ A;  3W9I A;  4DV1 J;  2NRE A;  1L3T A;  4CWB A;  2GHW A;  2ATC B;  1WEX A;  3DI6 A;  3GU0 A;  2ZH6 A;  5A2Q Y;  2PFD A;  1SQF A;  1SKR A;  1VQ8 S;  2R4F A;  2CQI A;  3UO0 A;  3JS9 A;  4WKY A;  5DG7 A;  5GAH U;  2J9C A;  1N6Q A;  4DSJ A;  2GFF A;  4DR1 J;  2OTL S;  4H54 A;  2BMB A;  2ZVS A;  3WZ0 A;  2CQD A;  3DXS X;  2IM0 A;  3R8Y A;  3CD6 S;  4N7T A;  2ASL A;  2KG1 A;  1REV B;  3CJT A;  5FLX U;  4USV A;  3TZX A;  3K0J A;  2DH7 A;  2X1B A;  4JI1 F;  5B0E A;  4E98 A;  4A8Q A;  4WP3 A;  3MEC B;  5ETT A;  2Z0G A;  2BJ1 A;  4NA2 A;  2WCX A;  4C0H A;  4H4K C;  2E5H A;  5A0Y A;  2ASD A;  4W92 B;  4QOT A;  3W2W A;  4DR6 F;  3SIP B;  4EFA C;  4FF1 A;  2EBE A;  4V1A k;  4TN2 A;  2FJE B;  2W01 A;  2LQ9 A;  5D15 A;  2HW3 A;  3C66 A;  4K8R A;  2OPS B;  1RLC L;  3LP1 A;  4V19 X;  3ZZU A;  3KK2 B;  3MEE A;  5C7P A;  5HP1 A;  3R2C J;  3LWL A;  4QIV A;  3AAW B;  4TLR A;  3KJF B;  1C1C A;  5LMN F;  5DLF A;  3UDV A;  5DDQ C;  1A9N B;  2VIC A;  4RNN A;  1YSJ A;  2FZK B;  4I6W A;  1KEK A;  4I56 A;  2ZBP A;  2BYC A;  4DV5 F;  3D4J A;  2EK1 A;  3IAS 9;  3G8S A;  5ETL A;  4OYI A;  3D6T B;  4S0M A;  2MZR A;  3MPW A;  5FDL B;  4ED4 A;  4FPR A;  4DR1 F;  4LF4 J;  1XIQ A;  3MAA A;  4EBD A;  3V4I B;  2D3O 1;  2FVR A;  1JJH A;  3E01 A;  1SC6 A;  2G9O A;  3VZH A;  4DPY A;  4RW8 B;  2ROE A;  1UA0 A;  4FBT A;  2IIH A;  4JI5 F;  5BYS A;  1C4C A;  3TUP A;  5EN1 A;  1SB6 A;  2JX2 A;  2RDD A;  4HVZ A;  5THW A;  1EX8 A;  1KVK A;  4L6V 3;  3RRH A;  4IRC A;  2XI2 A;  2V8P A;  5L39 A;  3MM8 A;  1VI7 A;  3I4P A;  1CJU B;  3BGR B;  2W9B A;  3ENA A;  1H6K X;  1ZAV A;  2IVY A;  3I5B A;  3MEG A;  4N8N A;  2LQB A;  3VVT A;  1F3V A;  5GAG U;  4DFJ A;  1N4L A;  1RAE B;  4U96 A;  3GJQ B;  4A48 A;  2YPY A;  4Q43 A;  4DQS A;  1JLG A;  1RDR A;  9RUB A;  4PCQ A;  4IKA A;  2IJF A;  4IRK A;  3AHP A;  4HT5 A;  1NKB A;  2VFR A;  3CMQ A;  3MFI A;  3KTQ A;  4NLG A;  2RJZ A;  4DX5 A;  2QX0 A;  1NK4 A;  1X4E A;  4OI2 A;  3HKZ D;  1M1H A;  4Q8E A;  1H2U X;  1LW0 B;  3KK3 A;  2MKH A;  2YKN B;  4BDP A;  1LV5 A;  4DPT A;  1X4B A;  1TL7 B;  2ROG A;  4DUT A;  3Q22 A;  2GMJ A;  4I2P B;  4J91 A;  1LKZ A;  4KBI A;  5LXY A;  5T14 A;  2X3D A;  3QWU A;  1IKY B;  3UW1 A;  2H48 B;  2WBM A;  4IG0 B;  3Q8Q B;  1P9Q C;  3T5H A;  3TJA A;  5D4P A;  4A47 A;  3PR4 A;  1NK6 A;  4L3N A;  2GVD B;  1HQE A;  2B4O A;  3MUM P;  2W9A A;  5D0H A;  2R7T A;  5BR8 J;  1E6Y B;  1RTD B;  2IRX A;  2R7S A;  1F1B B;  4QWD A;  4YB6 A;  4P75 A;  3TZZ A;  4H4M A;  2MYF A;  3BO2 A;  2Y0S D;  4NLS A;  4ECU A;  1TKZ B;  4DL2 A;  1P1T A;  1OSD A;  3MM6 B;  2V63 A;  2B51 A;  1YJT A;  2RE1 A;  4RU2 A;  1WC0 A;  3I6P A;  2H9Z A;  1UET A;  2P6T A;  2DHS A;  2V5H G;  3HVT B;  4NEY A;  4P2F A;  4ZKA A;  5DLG A;  3IM8 A;  2FD2 A;  2HQD A;  5IC4 B;  2OPR B;  2R9L A;  3IWN C;  1K1Q A;  3M2R B;  3ZTQ A;  1QAY A;  2HRU A;  4UUX A;  1TKZ A;  2JFD A;  3BPS P;  3TR5 A;  5BXI A;  1Z2L A;  2MQN A;  2XCP A;  2WW4 A;  2QLB B;  5LJ5 Y;  3SQG B;  1NKE A;  1S12 A;  2VV5 A;  3FSY A;  2MGZ A;  5E3C A;  5KFK A;  4AQY F;  4K4Y A;  1ZOT A;  3FBC A;  2YX4 A;  3IR7 B;  3K7R A;  1NUE A;  1T9W A;  1U8W A;  1S1X A;  1YBT A;  4FYY B;  4IFY A;  3DM2 B;  1NZ8 A;  2JRS A;  1C0U B;  4LR9 A;  3W5Z A;  4RNF A;  5C25 B;  4XIU A;  2DIU A;  3M8R A;  1HNV B;  3ISN C;  2QTW A;  1VRT B;  3GZ7 A;  4KTQ A;  1MMD A;  2OFG X;  1MRO B;  2KT3 A;  2ZFH A;  3KK3 B;  5U47 A;  3KLE B;  3CCJ S;  2DR9 A;  4C8L A;  1FRJ A;  4ED8 A;  3H42 A;  1UPM B;  4O3P A;  2P9E A;  3OV7 A;  4RW6 B;  1SJ3 P;  1HHT P;  2D3U A;  2IM1 A;  4ZCL A;  1WD6 A;  2CNN B;  1QAX A;  2IAJ A;  2RNE A;  1TL5 A;  2BEF A;  3B8H A;  1RHQ B;  2L48 A;  3HHL C;  4P6Q A;  3AJD A;  3OD2 A;  1SL1 A;  2E7V A;  2K06 A;  4RNM A;  2ZJQ Q;  5HI7 A;  3IN5 A;  4MFB B;  1OPI A;  2B8P A;  3VTI A;  2OPQ B;  4DZ6 A;  2W7P A;  3PKM A;  2G0I A;  3DFE A;  5F9L A;  1JLG B;  2C3Y A;  4GO7 X;  4MTP A;  3B4D A;  4KPC A;  5IFM A;  5KFD A;  1QAI A;  4ECT A;  2BJE A;  2L41 A;  1SL0 A;  4A8F A;  2ZC3 A;  3PG9 A;  1HNI A;  4C8M A;  4MK8 A;  1S1U A;  2D74 B;  1ROF A;  2WVB A;  3M32 B;  4PWW A;  1GX6 A;  1X60 A;  1N5Q A;  1B7Y B;  1Y4Z B;  3MM8 B;  4OHX A;  3AD7 C;  5GAH I;  3Q8P B;  1YJU A;  3QO9 B;  1M5O C;  1EET A;  1U0S A;  2MZS A;  3BSA A;  2UUC F;  4CTA B;  1H73 A;  4PWD A;  3IFE A;  1CG2 A;  2BBE A;  2J9D A;  1DHM A;  1BY9 A;  2J0X A;  4NMX A;  1JX4 A;  1PIE A;  2Y8W A;  3H59 A;  4LFB F;  3DLG A;  3D68 A;  3E01 B;  1VGY A;  2HRT A;  4LRC A;  3RZA A;  4WII A;  2ZE2 B;  4DR3 J;  2HHH J;  3QNW B;  5HBM B;  3SCJ E;  3CJ0 A;  5FDL A;  4ES3 A;  1U47 A;  3RB0 A;  1QTN B;  3WBZ A;  3I9Z A;  3JSM A;  4I6Y A;  1HBN B;  2CJA A;  4DSF A;  4TLQ A;  4PG6 A;  3EGV A;  2IDE A;  4K2J A;  4WPA A;  4ZOS A;  4E2F B;  2AGP A;  3HZG A;  4L73 A;  4O3R A;  2Y9H A;  2AP6 A;  4WWS A;  3MM6 A;  4CIO A;  2FJA B;  4X84 A;  1WEY A;  5DM7 Q;  1FNM A;  1IR2 A;  3MTJ A;  1NBE B;  1WOS A;  2C2O B;  4H4K A;  4LJM A;  5GMK a;  4GMK A;  4OX8 A;  2I6W A;  1GTH A;  3FQL A;  3MHY A;  5K8N A;  4OJH A;  2VFT A;  2WVC A;  2CNL B;  4FYW B;  3V6D A;  4DV4 F;  2W2P P;  1XMO F;  2QJ3 A;  3SDE B;  1WF0 A;  3JSB A;  2ZHB A;  1CVJ A;  1ACM B;  4O0N A;  3M6V A;  5E3A A;  2J6S A;  4AQY J;  4LF5 J;  1IQT A;  4HHH A;  5KT4 A;  3MMA A;  2Y1L B;  1URN A;  4DU7 A;  1SV5 B;  2LDI A;  4O3N A;  5AXN A;  2DCU B;  3LA0 A;  3MWB A;  4OYM A;  2XMV A;  3R1L A;  1URR A;  2NSC A;  5ETN A;  2JC1 A;  4CYU B;  3EX7 B;  4C6A A;  1S72 S;  4HLB A;  3DLL Q;  4NOH A;  2RDJ A;  2IAJ B;  2VPX B;  4ITS A;  3A13 A;  1G2E A;  1SJ1 A;  1RTH B;  4JV5 F;  2IYG A;  3G8T A;  3J7A N;  3GCW P;  3P49 B;  3FVY A;  2WAQ D;  3IS9 A;  3UD4 P;  3J81 U;  3DRR B;  3OLB A;  1S9F A;  1HPZ A;  1Q8B A;  2V9K A;  1TL4 A;  2XLI A;  3UR3 C;  2E9Z A;  3M30 A;  3QAT A;  4K0K J;  1YJV A;  1ARO P;  3VAL A;  3HFV A;  1S99 A;  4B3R J;  2VG5 A;  1SJ4 P;  4LIR A;  3DCA A;  2FQQ B;  2MGZ B;  1WC3 A;  3WHI A;  1DBD A;  5ETP A;  5KFT A;  1LFP A;  1RHR B;  3VAJ A;  3R3T A;  3ENW A;  4JI8 F;  2HIQ A;  2KO1 A;  3AJ1 A;  1S79 A;  1HNX J;  1D9F A;  1HD0 A;  3D66 A;  1RA6 A;  3B4M A;  4KRW A;  3RW6 A;  4DV6 J;  1IKW B;  2BW7 A;  2MQM A;  2PMZ D;  3UQS A;  3CJ5 A;  5KOW A;  2LMI A;  3R6L B;  3HMJ G;  1JIH A;  4JYA F;  4ZJO A;  4ZMM A;  1NU4 A;  3CDA A;  3LAL A;  1X9S A;  3W3S A;  4X4O A;  3RRG A;  3OR2 B;  5EWG A;  1RAB B;  2RS8 A;  4F8R A;  3MCS A;  3TUZ C;  3IXQ A;  1H7W A;  4FYX B;  1FKA F;  3MM5 A;  2K1R A;  3OTB A;  3Q8V A;  3ZZP A;  2IM3 A;  2AF6 A;  3QWP A;  1TVR A;  4ECY A;  1RTI A;  4NLO A;  3BGO P;  4LFA J;  1ZTT A;  2L9D A;  4ICL A;  3OUY A;  1H74 A;  1S6O A;  1LWX A;  4HL9 A;  4FYD A;  2YWH A;  3RAM A;  1IM4 A;  3US5 A;  3VAG A;  2N4D A;  1PYS B;  4RPF A;  1XNR F;  2RUG A;  2E7W A;  1REV A;  3EJM A;  2GQ2 A;  4M5K A;  5KFF A;  3KJV A;  4X4S A;  5H9E K;  4M63 A;  2E5L J;  3FZ2 A;  4NX9 A;  3D2W A;  2FPH X;  1FWK A;  1S48 A;  4RBT A;  1X0F A;  1BC6 A;  5A2Q U;  1Z2Z A;  2A6M A;  2CZ4 A;  3MZI A;  3N28 A;  1QUP A;  4OFZ A;  4CRJ A;  2GQQ A;  2FHJ D;  2GAG C;  4DBQ A;  3GFX A;  3NNA A;  1U1M A;  1F0X A;  4HI2 A;  5AT1 B;  1FTR A;  1H72 C;  4ZN3 A;  1RAH B;  1HI1 A;  1X5P A;  3OFF A;  2LKZ A;  3H98 A;  2VBW A;  3ZC4 A;  3TWZ A;  4AXI A;  3PW4 A;  2R8J A;  2QFI A;  4KGZ B;  2GVZ A;  2HHU A;  1OPZ A;  2Z2M A;  1GEH A;  4ZP8 A;  3KLE A;  3GTY X;  2SXL A;  3POT A;  2M70 A;  3UPF A;  3MTK A;  4EBE A;  2HHX A;  3G71 S;  2VQF F;  4CLF A;  2CQH A;  5BYQ A;  3RRK A;  3T9N A;  1HBM B;  1YKW A;  2FHO B;  1ELO A;  4LRD A;  1UTA A;  2NZ4 A;  2EW9 A;  1N32 J;  4PG7 A;  2GJF A;  2J0S D;  2JOQ A;  1R8B A;  4RW7 A;  2VQE J;  1EZZ B;  1TEL A;  4DPX A;  3TAR A;  2WOM B;  1I94 F;  3ZZZ A;  4MKA A;  1WOR A;  2PN6 A;  1L3S A;  3J80 Y;  2QLF B;  3LP2 A;  3I56 S;  4J9Q A;  3TX8 A;  3GQC A;  4LF2 A;  4KT0 C;  4DV6 F;  4DV0 J;  2B0G A;  4WFZ A;  1SQG A;  2B9E A;  1S1W B;  4CLZ A;  5KG7 A;  4J9V A;  4WFN Q;  4UY8 5;  3ZZT A;  3IBC B;  1KSP A;  2QMU B;  1U1R A;  1KLN A;  1ZZF A;  1VIO A;  3KHR A;  3SYZ A;  2B9Y A;  2MJN A;  4EWT A;  3HT0 A;  4QIG A;  4U7U K;  4ZN1 A;  1Y10 A;  3DLG B;  4IH5 A;  3W2W B;  3KDO A;  2M52 A;  3VQT A;  5KFC A;  4FF3 A;  4R0E A;  1FJE B;  4K0K F;  1S1W A;  4CLW A;  1RBL A;  1N0V C;  1NPR A;  3N5F A;  4DX8 H;  5AXL A;  1HW9 A;  3A8E A;  3DMJ B;  2JVO A;  1H0H B;  3MF5 A;  6FDR A;  3FKB A;  3N6N A;  3T41 A;  4R8U A;  3GFZ A;  1YJR A;  3W63 A;  4BC9 A;  3VGU A;  2KRB A;  3NKY A;  3Q8Y A;  2ZHA A;  4O4G A;  3K5L A;  1TTH B;  5HQM A;  2DJW A;  1Q5V A;  5LSR A;  1A7G E;  2EKN A;  4DOZ A;  2RUS A;  3PEJ A;  4WIQ A;  4I69 A;  3TAM A;  2WSC C;  4DQQ A;  2D41 A;  3TUI C;  1H2T Z;  1C2P A;  2RB7 A;  4KR0 B;  3TJ8 A;  2VZ9 A;  3N01 A;  3VAH A;  2DGX A;  2KKH A;  1Y9O A;  1OSC A;  2KH9 A;  4YUD A;  2ZD1 B;  3FFI B;  2PC6 A;  2E5G A;  3DOL A;  5DDR C;  3J7Y U;  3D0G E;  4DV1 F;  4WCE Q;  4Q8F A;  3NOC A;  3H4D A;  1F6T A;  2HNZ A;  2V0N A;  3CC7 S;  2GW8 A;  3OSP A;  1XMO J;  1S7H A;  1BHN A;  5HJY A;  3J7Z 5;  1FD2 A;  2YNF A;  1RTZ A;  3HD1 A;  4DPU A;  3M8P B;  1BMQ B;  3QQC D;  4C8N A;  4N77 A;  3PXG a;  2EK6 A;  3A4T A;  4BCA A;  4QWE A;  4J9L A;  1EP4 B;  1R8P A;  2B56 A;  4DHV A;  5KFQ A;  3FGV A;  2QO3 A;  3MAA B;  5E33 A;  3RYL A;  4DG1 A;  5HMX A;  5HRO B;  2C2M B;  4FNH A;  1R0A A;  3OR2 A;  3CDB A;  1PKU A;  2AYM A;  2CJX B;  2XMK A;  2XMT A;  3CJK B;  4I7F B;  3CUL A;  2OP5 A;  1HD1 A;  1ZM3 A;  2V50 A;  2D3O R;  4NYZ A;  1QTM A;  1FT8 A;  1WJ9 A;  4OYP A;  1EIY B;  3LP0 A;  4O4R A;  4RLE A;  5HN0 A;  4GC7 A;  1CJV A;  1VK3 A;  4QYR A;  4B3O B;  3OHA A;  1NJY A;  3W62 A;  1S57 A;  3I55 S;  2PT0 A;  3OL8 A;  1KHV A;  4LRE A;  5B0F A;  3GP9 A;  1FRM A;  4N56 A;  1VK8 A;  2P5V A;  4NZ0 A;  2Y3Y A;  3PX4 A;  1D8Y A;  2W4P A;  2NR0 A;  2UXD F;  3KKF A;  1X4H A;  3K59 A;  2XNQ A;  1LOU A;  1RT4 A;  5L46 A;  2RSQ A;  5A8K A;  3TAP A;  3E3X A;  3R5C A;  1I1G A;  5KG1 A;  1UJ6 A;  3HVW A;  5IT9 Y;  4LR7 A;  3C15 A;  4NYO A;  3A1Y G;  3G6Y A;  3CPW R;  2HBQ B;  3L95 X;  2BKN A;  4B3S F;  2NYI A;  4OJ1 A;  4DV0 F;  2XZW A;  1QSL A;  1SIW B;  2DR7 A;  4PXE A;  3PV8 A;  3NNC A;  4LVN P;  3UFC X;  1U7L A;  1XN9 A;  2FVP A;  2GIF A;  3GJT B;  1JMT A;  2ZHO A;  4WU3 A;  1Q1K A;  3TA1 A;  2RQK A;  1Y3J A;  3N4W A;  1D9A A;  4N76 A;  2G2Z A;  2UV8 G;  4B3M J;  2A2C A;  1SVD A;  2E9R X;  5HVG A;  4ED2 A;  1F9F A;  1JXV A;  1TUV A;  3LOU A;  3DI6 B;  3PJ9 A;  3B82 A;  4LF1 A;  4QBU A;  3Q86 A;  3UNG C;  1BXN A;  3HFK A;  1RCX B;  1TZ0 A;  4G1P A;  1J2V A;  5B0B A;  4A8Y A;  2J6U A;  2F4V F;  1TV6 A;  2VD3 A;  2VFU A;  3WIV A;  1IWG A;  3VF0 B;  1YBA A;  1H3D A;  3LPE A;  2HQC A;  3MED B;  4WXW A;  2MLY A;  2LFV A;  2GC8 A;  2G13 A;  3QT7 A;  4ECZ A;  2BQR A;  1RXO B;  3PJX A;  4DDF A;  2IA0 A;  3KLI B;  4TY8 A;  4TU9 A;  1KD1 T;  1S0V A;  3PYE A;  3KUE A;  4X4R A;  3GSD A;  1MMN A;  1YX2 A;  4Z7Y A;  2NXE A;  1Q8L A;  2KL8 A;  3BGR A;  4NLY A;  4DV3 F;  1T05 B;  2FVS A;  1WEL A;  4LBP A;  2W2N P;  3U1M A;  2VF3 A;  1T0T V;  4HH1 A;  2RAQ A;  2CJK A;  3HJF A;  3GII A;  1WOP A;  2DGO A;  4CNY A;  5DQI A;  2VPZ B;  4DR5 J;  1XMQ F;  2WB1 D;  3PFE A;  4U95 A;  3HXM A;  1WC1 A;  2GO8 A;  2CZV C;  2ZDP A;  1APS A;  1HBO B;  1R31 A;  2C3U A;  3CGI A;  3BSN A;  2HLT A;  1IBM F;  1NB2 A;  3G87 A;  1JWW A;  2K8G A;  2D9O A;  2PGC A;  1VQ4 S;  1N33 J;  1S6P A;  1DJ0 A;  2C3M A;  2XI3 A;  4LUB A;  5IOL A;  2DGQ A;  1CS4 B;  4YY3 F;  1I6J A;  1T9V A;  1N34 J;  3QFH A;  2RF2 A;  2PEB A;  3MMC A;  2V4Q A;  4GKK F;  4U67 Q;  1RWU A;  2J7K A;  2YTC A;  5A0Y B;  2FJD B;  1B70 B;  2JH3 A;  3LWM A;  1AXQ A;  4KHR A;  4EBC A;  3HJV A;  3I31 A;  4O0I A;  2DHG A;  1F5C A;  3BGL A;  1VQ5 S;  4MKY A;  4ZVR B;  1KON A;  3CJ2 A;  3G8Q A;  5HBM A;  4ZHR B;  1NKC A;  4OHV A;  5HSP A;  2OPP A;  1IBL J;  1S4F A;  1EP4 A;  3ZTP A;  2CYY A;  3ZZO A;  3GV5 B;  4Y28 C;  1FNX H;  1KFS A;  2UXB F;  3PYG A;  3CJ3 A;  4CO0 A;  2F65 A;  5KT6 A;  2R8K A;  3KLI A;  2YNH B;  1VHF A;  2DGS A;  4UOF A;  4PAB A;  2XMW A;  4B9S A;  2FJB B;  2NXN A;  3KJQ B;  2PA3 A;  3M30 B;  3MCN A;  4IO1 A;  1OO0 B;  3VAM A;  4ED6 A;  1Q86 T;  1IM6 A;  3M32 A;  4Y34 A;  5D4N A;  2YKM B;  3IM9 A;  2H51 B;  1F5A A;  2AEM A;  2QA1 A;  4OYW A;  3CNQ P;  4DLG A;  2OEK A;  2DRA A;  1RWX B;  2HHP A;  4DR7 J;  3HSZ A;  5IWA F;  3CCR S;  1B99 A;  1YZ6 A;  1FFS B;  3D0H E;  3H4B A;  1N56 A;  3PO5 A;  3TQE A;  2HWH A;  1QE1 B;  2O66 A;  4FVC A;  3MOJ B;  2ABY A;  1R0C B;  1WF2 A;  3I96 A;  2WW8 A;  1MRO A;  4YFU A;  4M5H A;  1GMU A;  3CIZ A;  4URS A;  5IWA J;  3DGV A;  2W9C A;  3CMA S;  2ALZ A;  4HAC A;  4OYX A;  4GKK J;  3HHL A;  3J7A 1;  3M8Q A;  5L1K A;  5KFS A;  1N36 J;  2C2K B;  2CQB A;  4BHQ A;  2IMO A;  3O3L A;  4CO4 A;  4DSE A;  2E1P A;  3P6Y C;  1T11 A;  1U2F A;  3LAK A;  1RYR A;  1U0H A;  1BGX T;  4UOG A;  1TK5 A;  4LFC J;  4J5O A;  4WKR A;  2MKS A;  2L08 A;  3OFG A;  5HJX A;  2ZZM A;  3D6H B;  1RAO A;  2UUA F;  1GXT A;  2B5J B;  3SCK E;  2D9P A;  1Q5Y A;  1RKI A;  5IQQ A;  4DR5 F;  1XMQ J;  1OS5 A;  1KVJ A;  1Q79 A;  4RBU A;  2HNY A;  3OSN A;  2KVI A;  3KOA A;  2NPF A;  4QIW D;  5J2N A;  3C6U A;  3N0V A;  3NBP B;  1TK8 A;  4J7C A;  3DRY A;  1EKS A;  1G1X A;  4OI0 A;  2VAS A;  1UAW A;  3KXD A;  3JTO A;  5SUH A;  2XWY A;  5CZV A;  1U4B A;  5HLF A;  2CWX A;  4FF4 A;  3CCZ A;  4ZVU B;  1YJN S;  2AYG A;  4M1K A;  1IR1 A;  4QW8 A;  4A4J A;  1FER A;  4QU7 A;  5GMD A;  4JI0 F;  1MML A;  2WB4 A;  3DOK B;  4DX7 A;  1FFG B;  1Q53 A;  4DSI A;  4WFX A;  1PJ6 A;  1WC4 A;  1VCT A;  5EDW A;  2LQ5 A;  1R0A B;  2O5D A;  5LT5 A;  2P8I A;  3H40 A;  3SV3 A;  2ZJP Q;  1S6U A;  2PI4 A;  5CXT A;  3QRQ A;  2XTJ P;  1WHW A;  3AOB A;  1P1L A;  3LTO A;  1O5J A;  2KYX A;  2OSQ A;  2YNG A;  2Z57 B;  1L3U A;  4PUO B;  1UZH A;  2LDY A;  5EX0 A;  3NGS A;  2PI5 A;  2RS2 A;  2V68 A;  4MAK A;  4NXM J;  1AUS L;  1RSC A;  5F8H A;  1W25 A;  1HBM A;  2MQO A;  2F7V A;  1YHQ S;  5D6G A;  3OTC A;  2CG4 A;  5D0E A;  3FQK A;  3R5J B;  3C14 A;  4EO8 A;  2HNZ B;  5B0D A;  1SH0 A;  3IRW P;  4ZPD A;  1FE0 A;  3JQJ A;  1VQO S;  1BWE A;  3W8G A;  1NZA A;  4CLK A;  2B9X A;  1FKO B;  1CC8 A;  2CQ3 A;  1BQN A;  1DTT A;  2CQ1 A;  1YVF A;  2BAN B;  2VG6 B;  3QGG A;  1J5E F;  4B9U A;  4ECW A;  1VBY A;  2JEG A;  4JI3 J;  1MN7 A;  4ZS6 A;  4M94 A;  2MQQ A;  2MQ8 A;  3KFW X;  4FN5 A;  4A8W A;  1KWM A;  2C28 A;  2CPJ A;  3TAM B;  4K5S A;  3M9O B;  1RE1 B;  2MKI A;  1RWO B;  3QAE A;  1B0T A;  1HL6 A;  2DNQ A;  3ISN D;  2ZH9 A;  1C0T A;  2YVS A;  5K8P A;  1RCO B;  2XSF A;  3EIC A;  4Z2X A;  4URG A;  1U1L A;  2HG4 A;  1ULR A;  4G1Q B;  4WE1 A;  2CJB A;  4ECQ A;  3P8B B;  2EFV A;  1C0U A;  3K8V A;  2V8V A;  3ELH A;  2X7I A;  2PII A;  1FI4 A;  1U48 A;  3CD7 A; 
#chains in the Genus database with same CATH homology
 1IBL J;  3IMQ J;  1XMO J;  4X62 J;  5LM7 E;  3T1Y J;  2MTL A;  2UUB J;  4DUY J;  4V1A k;  4LFA J;  3R2C J;  1FJG J;  5AJ3 J;  4DR7 J;  4DV3 J;  2F4V J;  4LF8 J;  1HR0 J;  2UXC J;  3R2D J;  2E5L J;  4PWW A;  4LF6 J;  5IWA J;  4LF7 J;  4JI5 J;  5LMU J;  4JI8 J;  4LF4 J;  4GKK J;  4KY3 A;  1N36 J;  5A2Q U;  4YHH J;  4KYZ A;  2UUC J;  1HNZ J;  4DUZ J;  4LFC J;  1HNW J;  4DR3 J;  3W1Y C;  4DV5 J;  4X65 J;  2HHH J;  4B3S J;  1J5E J;  1XMQ J;  3JAM U;  4DR4 J;  4JI7 J;  2KVQ E;  4JI6 J;  4X64 J;  1N32 J;  2VQF J;  2VQE J;  4YY3 J;  1IBK J;  4RJV A;  4JI1 J;  4B3M J;  4DR2 J;  4AQY J;  4LF5 J;  4DV0 J;  4NEZ A;  2MEW A;  4DV7 J;  4JI0 J;  4LF9 J;  4DV4 J;  4HHU A;  1I94 J;  1XNQ J;  5BR8 J;  4NXN J;  4NXM J;  1IBM J;  4OX9 J;  4X66 J;  4JV5 J;  3D3B J;  4JI3 J;  2KL8 A;  2ZM6 J;  3J7A N;  1XNR J;  4B3T J;  4NEY A;  4DV2 J;  5IT9 U;  4JI4 J;  3J81 U;  4DR5 J;  4GKJ J;  4DV1 J;  2UXD J;  2MQ8 A;  3J80 U;  4JI2 J;  4K0K J;  5LMN J;  4B3R J;  1N33 J;  4LFB J;  4KHP J;  2UXB J;  3T1H J;  4DR1 J;  1N34 J;  1HNX J;  3D3C J;  4DR6 J;  4JYA J;  2UU9 J;  2UUA J;  4DV6 J;  5FLX U;  3OTO J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...