3D3CJ

Structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
LGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDDLMRLDLAAGVDVQISLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords N utilization substance protein B
publication title Structural and functional analysis of the E. coli NusB-S10 transcription antitermination complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 85
sequence length 85
chains with identical sequence K, L
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3d3cJ00
3W1YC 4DR1J 1J5EJ 4DUYJ 2MQ8A 2E5LJ 2UXBJ 5LMNJ 4DR7J 2UXDJ 4DV7J 5AJ3J 4JI6J 4LF5J 4JI0J 2ZM6J 4DUZJ 4KHPJ 4NXMJ 5LMUJ 4B3SJ 4JI2J 4OX9J 1N33J 4DR6J 4KYZA 4JI8J 4LF7J 3J81U 1N32J 3J7AN 3R2DJ 4DR4J 1XNRJ 4K0KJ 4DV6J 4X66J 2KVQE 4B3MJ 4JI1J 3R2CJ 4X64J 2MEWA 4X62J 4JI4J 4NXNJ 4JI7J 5IWAJ 2UUBJ 3D3CJ 2HHHJ 2UUCJ 4DV0J 4JV5J 1IBLJ 4AQYJ 1HNZJ 5IT9U 1N34J 4JI3J 4DV5J 4YHHJ 1N36J 4KY3A 2F4VJ 4LFCJ 2VQEJ 5LM7E 4LF6J 2VQFJ 4V1Ak 4DV1J 4YY3J 5BR8J 4DR5J 4PWWA 3T1HJ 2UU9J 4LFAJ 4LF4J 2KL8A 4DR3J 3OTOJ 1FJGJ 4NEZA 4JYAJ 1IBMJ 1IBKJ 1XNQJ 4GKJJ 1HNXJ 3JAMU 4LF8J 3IMQJ 4JI5J 4DV3J 1HNWJ 5A2QU 2UXCJ 2UUAJ 4DR2J 5FLXU 4RJVA 4GKKJ 3D3BJ 4B3RJ 1XMQJ 4DV2J 4B3TJ 4HHUA 1I94J 4NEYA 1XMOJ 3T1YJ 4X65J 4DV4J 1HR0J 4LF9J 3J80U 2MTLA 4LFBJ
chains in the Genus database with same CATH superfamily
1TV6A 1Q78A 1S9GB 2RRNA 2MJUA 5HVFA 3O1LA 2HRYA 2QLXA 4OZJA 4R5PB 2HNYB 2ZITA 1HYSA 4RUCA 3P3DA 3H4BA 2A3JA 3BSNA 1RXOB 1BQNA 4HHJA 2RS2A 1RT4A 2DIUA 4KH0B 5EUHA 1N6QA 3HHKA 2FJWA 2NPFA 3OUYA 1UMJA 4DV0J 1E6VB 4B3MF 2Z0GA 4ED1A 1L3SA 3QJJA 2ZBRA 3HK2A 2V2KA 2ERRA 1RWXB 4PPDA 2MKYA 1IBKF 1UW9A 4F2RA 4JP8A 2HAIA 4USMA 1UWBB 4ES1A 3TYTA 1LXJA 1SC6A 3IC1A 4PXBA 5EHHA 3AAWB 4C11B 4Q2MA 4ZVSB 4M8LA 1SVDA 2VD3A 2EC2A 3MHYA 4XPCA 2E1RA 3VQTA 4NLRA 3R7SB 1IKWA 2XHWA 4GVBA 3P49B 3NBPA 4YB7A 1IKYB 1EAYC 4Q7AA 2ZM6J 2ATCB 4JI8F 1LNQA 4UF4A 3Q8RB 4NMLA 4C48A 1V3RA 4I69A 5KT3A 1JMTA 1KDNA 1NK4A 3SSRA 3FMWA 1MNEA 3LF0A 3HCXA 1NK0A 4DUZF 4TU8A 3FSIA 5CZVA 1HMVB 2XM3A 1O5JA 4OZLA 1RBLA 3E51A 1RACB 2WZ1A 1MW7A 3G8SA 3LWLA 1YKWA 4LSZB 3CJRA 4ZCMA 6AT1B 3DOKB 5J2PB 4F0HA 5KFNA 4HEA9 3HFKA 1WOPA 2C2MB 4G65A 4UTGA 1B7FA 4JV0A 2F4VJ 4NMXA 4F26A 1FDAA 3W5YA 4TY9A 2B43A 2DB1A 2R7OA 2M5YA 2DGQA 2HFSA 3IP0A 3CE8A 3OW2R 3MD1A 2W2OP 3GB0A 4KHRA 1U6BA 2DH8A 3BH6B 3TX8A 1PG5B 1CJVB 1XERA 3UD4P 3PEHA 3W1YC 3P5BP 2HWHA 4URGA 3OTCA 3DOLB 3JTNA 3K7RA 1UFKA 2EFPA 3NS6A 1OJ4A 2FGCA 3KJFB 5DLGA 1MWYA 3KYLA 3AHPA 2W2NP 1LK5A 1Q4RA 4CWBA 3MPDA 3CMAS 2L9NA 4ILRA 3LUYA 1JLFB 2B8PA 2R2RA 3VR1A 2VFRA 2DPJA 4EZ9A 3DRYA 3D67A 2OGUA 4WJBA 4JI4J 2UVRA 4B9SA 4FKYA 3MZIA 3QMQA 2H1YA 5D6GA 1Y11A 3GE9A 1VHFA 3ILOA 4ZPDA 2VBYA 4LFCJ 4MT1A 3CF5Q 4OLPA 4DHVA 3W2WB 4L72B 1U2RA 2W8LA 2JZ5A 3DDNA 5HAOA 2G2ZA 3KXDA 1WHWA 4NRTA 1H7XA 1WF2A 2UXCJ 3M2VA 3MMCA 4W92B 1TAQA 3H20A 4QYZJ 4NA2A 2IMOA 3DC2A 1VRUB 3N6NA 5L9NA 5T41A 1QAXA 3ADAC 3IR7B 2ZJPQ 4IOCQ 1Q1KA 1RYSA 1KFDA 4Q8FA 2KVIA 2W9BB 3U1NA 1W2IA 4ZVGA 3KMSA 1RT7B 4JI7F 1C1CB 4DUTA 3QGPA 2HQIA 3PRDA 2HQ3A 2ZHAA 2UUTA 1P8GA 2C1EB 1NK6A 2PEBA 3G82A 3SBMA 1K1QA 2RUGA 1ULRA 1RHQB 5BXIA 1NHVA 1HQ2A 2ALZA 3M32A 2RJZA 3BQ0A 3ETOA 3Q83A 1JLCB 3CCZA 1ZZNA 3AXMA 3MCMA 1JNRB 3DRSB 3O2IA 3OFHA 1FEEA 2XQCA 3A8EA 3PFOA 5KG6A 3TP2A 2K2PA 2KB2A 3FBBA 4HHHA 6FDRA 1HBNB 3H98A 3U7JA 4WE1B 4ICLB 2XZDB 4FPRA 1TU0B 1M1KT 2GV1A 4NLYA 2WW4A 5LMUF 2HURA 1FJ7A 4G1QB 1F60B 1VLYA 3H7HB 1RBAA 4NXMJ 4AL7A 3CJSA 1GH8A 2MKJA 2BA9A 2KRRA 2DY1A 2YKMB 4DEZA 2HHPA 3GV5B 1NZ8A 4CLFA 4M5MA 3MEDB 5D0HA 2CQ1A 2I5JA 2J6UA 4E98A 4N7TA 3VF0B 5KFBA 5CAAA 4RNHA 3PYFA 2VBZA 2MY7A 3HHLC 1N34J 2D69A 3QFHA 3ETMA 1SH2A 4ZVQB 3Q24A 3QT5A 3ENVA 1KD1T 2RDIA 3HVTB 1V5VA 2ZKTA 4KKOA 2GGPB 5KG5A 2DR5A 1SH0A 1S9FA 2EXUA 4K4YA 5EN1A 2IHR1 1ZM3A 3AFGA 1LV5A 5CCMA 3AODA 3I4PA 5JJBA 1R7IA 2CPZA 2CJXB 3VGSA 3KTQA 3IM9A 5HROA 1TMJA 3V6JA 2K06A 4RLEA 3DYAB 5AXNA 1GEHA 4PG4A 3G71S 5CYMB 1M5HA 3T9ZA 3CDBA 3J7ZT 1T9WA 3H5UA 3PW2A 2KH9A 1NJWA 4ZVPB 5D78A 3MM8B 3Q86A 5KG7A 4JI1J 1QAYA 2LEPA 2H51B 5I42A 2XZTB 2Q6BA 2RVJA 1LFWA 2F65A 1IR2A 2J0QD 4CO5A 4NOHA 3HF5A 3CD5A 2R2TA 2V0NA 2V69A 3DHWC 1FE4A 2KXHA 2VKRA 4LFAJ 1MSWD 2V2ZA 2UZAA 3W5XA 1B99A 3TVYA 5HP1B 1FFSB 1IKVA 3LA0A 3IBWA 4QOTA 3POTB 1S59A 4URSA 1TKXB 3RYLA 1JJ4A 5C7PA 1KP6A 4USHA 4QJVA 5IT0A 5AJ3J 2P8IA 2MZQA 2MGZA 1R8AA 2VG5A 2HMIA 3MWBA 4NWBA 3PV8A 1KQSR 1FESA 1ICEB 4DCPB 3FQLA 2WCXA 1GAOA 4KE5A 4LRCA 2CRLA 4DPYA 3DCAA 1SQEA 4Y2CA 1XBWA 3PO4A 3QAEA 3G6VA 2NUHA 4IFVA 2DHHA 2JC1A 3CJ2A 4IR1A 4RNMA 4DSKA 4KBIA 4OZ0A 3RJMB 4M5LA 1BHNA 4OZ1A 2OEJA 3WIUA 3PYDA 4GKJF 5BR8J 4FF2A 4DR2F 2GCFA 1X8DA 4NLDA 2M4MA 4C3KA 1VQPS 4ALZA 2CPIA 1G1XA 3QIDA 2CFXA 1LWFB 4LR8A 5FLXU 3D3BJ 3LP0B 3N79A 2PEHA 1FO1A 3D0GE 5IM0A 4X65J 1HD1A 2L9DA 2CG8A 4MKBA 1OWXA 3ZZYA 2MKIA 1FEHA 3VAIA 2GVDB 3I87A 3PHTA 1NEEA 3IR5B 3NKYA 1S9GA 3KHLA 4CCHA 4DV7J 2LECA 1AZSB 5E7OB 3RB0A 1WEZA 3QGHA 1AA1B 4KHPJ 4FBUA 4CH1A 5ETKA 2QIFA 2HHSA 2V50A 1XR7A 5F8LA 3NRBA 1U6ZA 5H1SV 4DSLA 2MEWA 3TZXA 2MLXA 3SSSA 3UDVA 4MKYA 4H54A 1BGXT 1GMVA 3NAIA 3D3CJ 1BUXA 2PFFB 1BWVA 1SIZA 2XI2A 3VAGA 1FFWB 1E6VA 2DHAA 3C46A 2B4OA 2DNLA 1SUQA 1RU2A 4DLGA 4ZA1A 2KM8C 1F1BB 1L3UA 4G1IA 3DXSX 3BQ1A 1S6OA 1Y4ZB 7FDRA 3FVYA 1NHKL 1T9TA 1SBRA 4LF8J 4YN3B 5T7LB 2MLYA 1C0UB 2IM3A 4LF4F 1W25A 2HFVA 4U95A 2XMUA 1KWMA 3NG8A 5A8WA 4ECYA 4C11A 3W8PA 2Q3PA 2W25A 3NAHA 3SFGA 1TL4A 2LDYA 4DFPA 2C2DA 3QRQA 1WHVA 5KFEA 3LAMA 4XO0A 1RJJA 3N9UC 3MPYA 3BKTA 1EZZB 4LSLB 3FEZA 2GMJA 1IKYA 4F4YA 1HI8A 2QYCA 4DI6A 3SCIE 5LT5A 1KHVA 3OQ2A 3AA8A 3V4MA 3I82A 5H9FJ 3RR7A 2DO0A 2OUGA 4WIQA 2JX2A 1HMVA 1Q8KA 3CO9A 3FFIA 3W8GA 2KO1A 4AQYJ 4M5GA 1EKSA 1GXUA 5J2NA 3PW0A 1LK7A 5J2PA 3OXFA 3QSIA 1JKHB 3OL9A 4A8WA 2QL9B 3OTOF 3OR1A 3KHGA 3DLKB 3M8ZA 1Y7PA 3AQPA 2R7TA 4WP9A 2BYCA 4OLOA 4P75A 5EWEA 4I68A 2FGOA 2HQGA 2OPPB 3PTWA 2ZHOA 4RJVA 3M8YA 3QIPB 1X9WA 2Z2YB 3VHQA 1HHTP 4IDKA 2V8HA 2X51A 4OYIA 1S12A 2V2VA 2VFSA 1FKOA 5KT5A 2AKWB 3RG6A 1EP4B 2IA6A 2ASLA 4AE5A 2L41A 3R7BB 3DOLA 3PNIA 2F5GA 4C2MA 5F9LA 5I3UA 2GC8A 2WK4A 1N32F 1Q5YA 4ZVFA 1DQ9A 4X62F 4DZDA 4NZ7A 2R2SA 3HHLB 1RHRB 3JYTB 5FLXY 1FNXH 4ECXA 4GRSA 2FLOA 4OQJA 4FN5A 3ZNJ1 4Q5VA 2BEFA 1NDKA 3FCVA 4ETZA 4LIWA 3KHRA 1X4FA 3T1AA 1TFYA 4DR5F 3A3OB 2ADCA 2Q79A 4PABA 3OL8A 2RQKA 4R0EA 2VQFJ 1FJGF 1FT8A 3BO3A 1XNQF 3HVAA 2BW7A 4QIGA 5B0BA 4PAAA 4NEZA 3RTVA 4NA1A 1SJ4P 5HQ8A 3S7RA 2WHOA 5C24B 4U9RA 1N8RT 4M94A 2MSTA 2LQ8A 3KFWX 1MU2B 1IM6A 3PRBA 2UVWA 2WAQD 2K7JA 4ZLJA 2BRLA 3N4WA 1B70B 4O44B 3GYNA 1GFWB 4PYDA 4K50A 2V9KA 1RT7A 1V6HA 3K5PA 1C1CA 2YNIB 2J7WA 3A1YG 4RU9A 2XTJP 3BBBA 3PKMA 3D1QA 5GMKa 3TVKA 4DPTA 2RD5C 5IC4B 2AJ4A 5KFOA 1UTAA 1P1LA 1XEZA 3H25A 3OR2B 3OVSA 3BGOP 1TELA 4I6WA 3TI0A 1BE4A 1ZS6A 4ZHRA 1JLCA 3DRSA 2BQ3A 4C8ZA 2OSRA 1WD6A 1OY9A 5LOQA 2IJFA 3RZAA 1ZAWA 1WOOA 2JFKA 4ENOA 2CKWA 4WU3A 4DR7F 2MY8A 3MPWA 4IOBA 4RW4B 3NGUA 3T3FA 2NREA 1GK8A 2WBMA 3VWSA 4WE1A 1NM2A 4YDXA 2LEBA 2VASA 1Z1ZA 1RA7A 3R1HA 1RP5A 4GMKA 2KU7A 4FYWB 4G1QA 4HH1A 2BXJA 2NXEA 1NH8A 3GZ7A 4KO0B 2MLZA 2FVRA 7AT1B 3FBFA 3DKDA 3QPIA 3P45B 5FIIA 2HHHF 4B3MJ 3MAQA 3DHXA 2YKMA 2NQPA 2LKZA 1XWLA 2QYGA 3IBCB 2QN6B 3HFZB 3MEDA 4UT4A 2NPIA 2F8MA 1NJZA 2LEAA 3WIVA 1V3ZA 2XG8A 1F2GA 3NGTA 4F04B 2ABYA 3QNWB 2ZC4A 3M8WA 4KJIA 3GILA 4F4AA 3HVTA 3H2VE 2Y1IA 1WELA 1W7WA 4H4KA 4IFYB 1Z4UA 2VZ9A 1FVSA 1UA1A 1H3DA 4IUFA 1RAHB 2DR9A 3PIOQ 2I1RA 1DTTB 3A8IA 4RR5A 5FD1A 3AOCA 2DVIA 1VC0A 1CJKB 4PXEA 4GO5X 3DYAA 3H5XA 2VDHA 1P27B 2OMLA 3CJ4A 4NZ6A 4J9PA 1RHKB 3EGVA 4DUZJ 2IVFB 5CYMA 3B8HA 3ZNUA 3ZTOA 2DH7A 2EFQA 2HFNA 2CQ3A 4LR9A 1QAJA 1QTNB 4ECWA 1O6XA 3B54A 3ZZUA 2MMYA 1EJ7L 3AD8C 2BM1A 2A10A 4CQ1A 2I9SA 4JUZA 2FLLA 1A7GE 3EE3A 3PW5A 2C3OA 1S9EB 5D4OA 5LM7E 3NLCA 1WSVA 1G6BA 4B3OB 1UPPA 2YNFB 1RKJA 2XYHB 1OIAA 1RAGB 2UUAF 5AE1A 2QA4S 5A8RB 2YX7A 5KFHA 2G4BA 5A8KB 2IBKA 4P73A 3BSAA 2IDEA 2I2YA 5F3TA 2N7YA 2EI5A 1VBYA 3DRRB 5HP1A 3X1LB 1I51B 4ZDNA 1X9SA 2W2QP 3POTA 5L8RC 4ZVEA 4C4WA 4DFKA 2DNKA 1TKXA 2BUNA 5KOXA 4NLVA 2IYGA 3GG1A 1TL3B 3DU6A 1N33F 3UNGC 4IG3B 1NJIT 2Z58B 4C8OA 2QE5A 1SL2A 3TX0A 2CQGA 3VALA 4A47A 5CA5A 5CHCB 4B3SF 2C2OB 3B4MA 1RAAB 2RNEA 4AT1B 3J7A1 2C2RA 2DGUA 4M5HA 4DQPA 2O1PA 3IGVA 2YWGA 3MD3A 2XS7A 1NB2A 2X1BA 3GFZA 3FDSA 2POKA 3SXLA 1MMLA 3CCQS 4MIAA 2ZBQA 2QFJA 2MZSA 2J9EA 2W7PA 2N3OA 1AFJA 2KI2A 5GAEU 4CH0S 3BPDA 4AFFA 1S1UB 5GAEI 3T5HA 4GKKJ 3SDEA 1LWFA 2MQQA 3NWRA 4X4PA 3LP0A 3SFUA 2QSFA 1QM9A 2E5GA 4I1TA 2V34A 2RDDA 3EVMA 3JB9k 2NUUG 3ILLA 3T9NA 4RW9B 2GVDA 3QWPA 3RBEA 1HQUB 3JQJA 1QSYA 4C97A 1XMBA 2VPYB 2Y1LB 3AXKA 4ANEA 1Y9OA 1FWKA 1RAFB 3DLGA 1RU1A 2IRXA 2H5IB 1UJ6A 3H59A 2XY5A 1YSJA 1Q8IA 1NKEA 4O0IA 3RB3A 2QL5B 2YWKA 1N36F 2WRMA 4QW9A 2DGTA 1VYAA 2Z4PA 4K4SA 5DM6Q 2HFZA 3W2VB 4KPCA 3MR6A 1B3TA 4W4MA 2KKHA 3CDUA 1UCNA 4PXCA 1BQXA 4LT6A 2HK3A 4FDFA 1WORA 1Q53A 5T7LA 3V2UC 1DBDA 5D8HB 4N76A 2KXFA 3TANA 4MTPA 1ZETA 3BGLA 3CDAA 4DX7A 4WP3A 4CP5A 1FI4A 4R25A 5KTQA 4CLPA 2CVEA 2HPUA 4LSLA 2HZCA 2EPIA 3RW7A 3I0SB 4WBFA 1S1VB 3KLEB 3VV2B 1MWQA 2ZH3A 2E29A 3TA0A 3N0VA 1KFSA 1X4AA 3IBFB 4RBUA 5HBMA 2XI3A 3H90A 1PCAA 4CI0B 4M63A 3JSYA 2ZJRQ 2LA4A 1QSLA 2YKAA 1JKHA 4ZCIA 4Q0BB 1HHQA 1GMUA 1HNXF 2ZH5A 4IO9Q 3EVOA 5B7WA 3TAPA 3DLKA 4UZCA 1SL1A 2YWFA 2V63A 3E3XA 2O66A 5D0RA 1JQGA 3L4BC 2OPPA 4DV2J 5JMNA 3QIPA 4EGLA 1TAUA 5KFGA 3BN4A 4LF9J 3S1TA 2VG7B 4YEAA 1XN9A 1FRMA 2XMWA 1KRPA 1SJ1A 2ROPA 3AD9C 1REGX 1QLNA 3QJPA 2NXNA 4ZOSA 1EP4A 2H5EA 4RKUC 2JHEA 4OZNA 3HZGA 3OVAA 3HHEA 1T9YA 2EBGA 2XMJA 4F3MA 5DG8A 4TVAB 4DV0F 3HHLA 2IVMA 1T02A 2RHQB 2XY7A 3JYTA 2PO4A 3NNCA 4USTA 1WG5A 1HNZJ 2YY3A 2OHDA 3C14B 2XGPA 3OXGA 2F7VA 4RZRA 2U2FA 2GHWA 1HBMB 1VQNS 1BD6A 4USKA 3CC7S 3T6BA 3ZTRA 2HIYA 1RADB 2DGSA 3M8PB 1V9OA 2W2PP 4WFBQ 1T9XA 4FYXB 3IGNA 4MAKA 1X4CA 2VF3A 3LTOA 5F8JA 4U6PA 1HHSA 5C24A 1MU2A 1HR0J 3O8WA 4CNYA 2DGOA 2ZM6F 1UEUA 4DUYJ 1R8HA 2R8IA 4DL5A 2WBRA 2ADBA 1OQ3A 1L5UA 3TWZA 1FKAF 2M70A 3CGIA 2OIHA 4J5OA 2PN6A 3HT0A 4B9VA 1A9NB 5ETPA 2UUBJ 2YNIA 4V19X 4ECSA 2FDNA 3R5CA 3N5BA 3MUMP 1CS4B 4KTQA 3FCWA 3L95X 2F4VF 2AP6A 3UNYA 3NS7B 4R8UB 3Q8SB 1Q79A 2LYVA 3BDEA 3P8BB 2MZRA 3MMBB 2CQ2A 2XLIA 1RKIA 4FXWA 3VAMA 2VHGA 3KLHB 1RDRA 1WDDA 4PPZA 4IRDA 2IIHA 4LF6F 1S0VA 1HNIB 3SCKE 1NK5A 4R0JA 2YKNB 2ZBPA 1CLFA 1RCOB 3CJ5A 1I94J 4WYWA 3ZZPA 3Q89A 5H9EK 5F8IA 3W9JA 1WTFA 4O3NA 4ES2A 5D4NA 2ALYB 2UXDJ 3TAMB 2XBPA 1H73A 5LJ3Y 1LWCB 3G2XA 1V3SA 2Y8YA 4JI4F 4H4OB 4MK9A 2GA7A 4ZLLA 4KO0A 4NLQA 5L46A 2J0WA 2CQIA 2QA4G 4XDCA 4DU8A 2KRBA 2Y3YA 4LFCF 2C2NA 5KFPA 2PE8A 3MTJA 2HWIA 2JVOA 2LXFA 4WXOA 3MM6B 4MKAA 4O3SA 3IS9B 2H4YB 3PR4A 4LF4J 4I2QB 2UXCF 3RW6A 3RB6A 1LW2B 2HNZA 3FEYB 3PFEA 1F3FA 4OHWA 4J7CA 2RKIA 4IFYA 4YQWA 1TK8A 1WEYA 1FF2A 2NZCA 4EO6A 5F8NA 1DTTA 5KT2A 1AT1B 3CJ0A 3GSIA 4A8YA 3VAKA 3UD3P 2LMIA 1CJKA 2B51A 4A8OA 5BYQA 4QWBA 3EZUA 3S6EA 3VVTA 2H3EB 2HNDA 2B5JB 2VFVA 2DBBA 3MPUB 3G8TA 3BREA 4DV6J 4DG1B 2DPIA 3W61A 2RMLA 4WTYA 4OYZA 3IRXA 3UDLA 1UFWA 2EVZA 2BACA 2R8KA 2H65B 3HKZD 4NE9C 4P2FA 1S9EA 5C2GA 4M95A 4B3OA 4JI3F 3FBCA 2YNFA 3LWMA 1UJ5A 4QPTA 3QT6A 4QIWD 4JB8B 1HD0A 2B4PA 1KVIA 3MOJB 3Q2TC 1RWPB 4DDFA 2BVZA 5A8KA 4OI6A 3QRRA 2KFNA 1B0VA 3HO1A 2MQNA 3DRRA 1Q5VA 1S0OA 4J9UE 4Y6IA 1SKRA 1R8CA 1N88A 1UFLA 1WC0A 1MN9A 4NXMF 3THVA 1U8WA 1DY3A 2QRRA 2GJFA 1TL3A 1FJEB 2DRBA 2XYGB 4HDGA 1RAOA 2QGFB 4IG3A 5D3GB 4KHMA 1CVJA 4X4SA 1Y3JA 1RAJA 3M6XA 5AXMA 4X64J 1K1SA 5KG0A 5CYQA 1FFGB 2Z30B 1N34F 3BB5A 3EZOA 1ZOTA 1CJTB 1TKZB 5HMWA 4B17A 2ZBIA 4DV5J 5HI7A 1NBEB 3D6MB 1FRHA 2YX4A 3BO4A 3KDOA 2XMAA 4YY3J 2W7OA 2EFOA 3MAHA 3HVRA 4N8OA 4YDDB 1RWOB 2VQEF 3D28A 1UZDA 4FKXA 4LRFA 3F0NA 3LP1B 2BKPA 1VQ6S 1YJUA 3A8KA 2XNQA 1XMOJ 1TVRB 2GQQA 3EDQB 2EW9A 3NCRA 3MOZA 3TJAA 1RTHB 4CDIA 3FRYA 1HBOB 4RW9A 4ED4A 4FYVB 3JSMB 2W8KA 2ZOGA 1HQUA 1JNZB 4TXSA 2DGXA 4JI1F 2DR6A 4RW6A 4CLTA 3CO0P 2VA2A 2HBRB 4NYPA 5JUMA 1T3OA 3G6XA 3PJXA 3MMAA 3R2CJ 2A6MA 4A8FA 2O5DA 1CC7A 4Y0FA 1Q0NA 3VAFA 3JTOA 2LLZA 2HS0A 1HQEB 3HD1A 4BWJA 4FXVA 1CJUB 2NXJA 4A8SA 1NU4A 4C3MA 2WVFA 1M5OC 4F02A 2Z2ZA 5CH7B 4LFAF 1BMQB 1S7HA 1NCLA 1FTRA 2ZDOA 1R0CB 4PWWA 4X84A 1T9VA 2AYMA 1VRTB 1FHTA 4WFZA 4QR1A 5L39A 3W2VA 4ZPTR 2RF2B 2CPXA 2O67A 1X5TA 2GVZB 3MI7X 2LU1A 3V6DB 4DR1J 3CC2S 5AJ3F 3DLLQ 4YMEA 1ZH5A 3H2LA 2CYYA 2J8AA 3OXLA 2CJ9A 1MLAA 4HR2A 4ZIVA 1F9HA 1YWXA 2XMTA 2GO9A 4H4MB 4ZCLA 1F6TA 5HATA 2ZWPA 3CEDA 3I0SA 3P96A 1F9EB 2IPOB 2D9OA 2QJ3A 1S1VA 3R97A 3KLEA 2RE1A 1M1HA 1QUVA 1KVKA 3UR3C 5IOLA 5J1EA 1SKSA 1FWLA 1RABB 1LKZA 1EETB 2KJWA 2WVEA 3NGRA 1NO8A 2R2UA 4O0NA 5BR8F 3RGIA 4J37A 2BM0A 2E7XA 1NNDA 4RBVA 3TO8A 3NGKA 4DV1J 3QGGA 4DQQA 2QV6A 2J0SD 4C8YA 2OAUA 2GQ2A 2ACYA 2KL8A 3D54A 4Q0BA 4ZITA 5CD4A 1D09B 1H2UX 2VONA 1SJ3P 3FZBA 5M2PA 1GNKA 2XSJB 4JI5J 1M5PC 2HHUA 2X7IA 1JLGA 4EUVA 4X65F 3CCWA 1U0HB 3U27A 2MQOA 4DFJA 2DISA 5F8HA 4EYIB 3HSGA 4DV7F 5K14B 5D15A 4KHPF 3ZZRA 4J9QA 2CA9A 2MZTA 4CO2A 2HRUA 4ECVA 3CJKA 1T0TV 1VQ8S 5KFWA 4ZPVR 3SI8A 2DIVA 4JI2J 2BJEA 2C3UA 4GVLA 2OSQA 3KOAA 3J81U 2HVHA 1PO6A 5HK4A 4NLTA 1VHIA 3GG0A 5IV3A 4C3LA 2CZVC 4L76A 1D8YA 3LANA 1APSA 1UVIA 2BRKA 4LBIA 1E6YB 2EBEA 2FJXA 5K8MA 3IR6B 2FQQB 2BE2B 2YWWA 5LSRA 3C14A 2J5AA 3UN5A 1S79A 1HBMA 2DHSA 2M88A 4ATNA 1OYEA 2OPQB 4LF8F 4B9TA 3NY0A 4J9SA 4F25A 1IN0A 1I5OB 3J7YU 1F3VA 4YP3A 4QBUA 2CWKA 1R6VA 3BKUA 3B78A 3J7YI 3MM5B 2Z2MA 3AJ1A 2I38A 5CZXA 1X4BA 1RYRA 2BW2A 3ZZTA 4FF1A 5ETRA 2F40A 4EU0A 4RUHA 1IVZA 3DLJA 1RTIB 2WB1D 2V4JB 4B3SJ 4PYAA 2RH3A 3PW7A 1PYTA 2RSQA 3THTA 3IWNC 2EKYA 1JXEA 1KC8T 1JLQB 3C8YA 3MR2A 2XGQA 4FNHA 2R8HA 4AQYF 3SYZA 1S6PA 4EEYA 2V68A 3NMAA 4KFBB 1SB6A 2FYXA 4P9SA 2FZGB 1GMWD 3N28A 1EARA 1F5BA 3KJVB 4FVMA 4R8UA 4DJBA 3OLAA 2XEXA 1LWEB 3T5KA 5DDRC 3KLHA 3M9NB 1RE1B 1YITS 3R5DA 2HWTA 2CG4A 3OSNA 2ATLA 2BDPA 1HNIA 5B0EA 3MCNA 5IFMA 2X1FA 4P10A 2H5JB 2YKNA 4Y00A 3MUVP 5E5NA 3A8JA 1Y0HA 4DU7A 4NI2B 1TL1B 2QFIA 4HDHA 4Q43A 4QWEA 1U1NA 5F0UA 3BV8A 3O6QA 4NLXA 5B0FA 2KHDA 3TAMA 4BHQA 3ILJA 4G3IA 2Q6CA 4Y65A 4UUWA 3FMBA 3G96A 2BQUA 4H4OA 3GSDA 2U1AA 4ZVUB 3MCSA 4MH8A 3CCMS 3BSCA 4NRUA 5ETVA 2CQ0A 2VQFF 3V4IB 1SV5B 1U1KA 3AT1B 2IMWP 1R89A 3TNVA 4Z37A 3UPFA 4CYUB 2MQPA 4EI2A 4ZVHA 3MM6A 3UW1A 3ITHB 3I56S 4UOFA 2OO4A 2R9LA 1ZAXA 3VCDA 3J81Y 2QMWA 1LW2A 3GR0A 2A0FB 2MQLA 4PWDB 2HVZA 4OYPA 5DRKA 5KFJA 1ITPA 1XMQJ 1VQOS 4TU9A 4A8QA 1L3VA 2CADA 4HHUA 4UUXA 2PSZA 3M05A 4FBTA 4QPXA 4LBHA 3UQSA 5DDOC 1D8ZA 1A6LA 3CCJS 3MM7B 1MMNA 5GAGU 1RWNB 2YH0A 5GAGI 4K59A 3LP2A 4WP8A 5U47A 5DQHA 4CM0A 4WIIA 1FRKA 3QZ8A 1PJ7A 3J7AN 2JWNA 3Q8VA 2KZZA 3GV7B 1QUPA 2B5JA 2MKSA 2CDQA 2SXLA 4OV6A 1BC6A 2JNJA 3ILIA 4Y28C 4F0MA 4DG1A 2AGPA 3HHNB 4NASA 3CC4S 2BJ8A 2PD1A 4IRKA 4YR2A 1PJ6A 3WBZA 2FHKA 2B7BB 1X4EA 4HKQA 1UWAA 4PG8A 3KUHA 1TK5A 1RT3B 2XS5A 4H4KC 1R6YA 1HI1A 3G9CA 3HSDA 1N5VA 4C0BA 3BR8A 3MECB 4Q2LA 1DRZA 2NXCA 5E3PA 2NS1B 2GMLA 3CULA 2AMCB 2AYBA 1X60A 2CQBA 1I6JA 1RWUA 2HS3A 4LFBJ 1UJ4A 2KXNB 1U1RA 1KTQA 4J90A 2XLKA 4KQZA 5IQ6A 4ZMMA 1ZZFA 3BH7B 2GIRA 2IBOA 3NCPA 5E2QA 1VIOA 4UOGA 4X2BA 5ETSA 1AUSL 4DCJB 1AFIA 1PAEX 3CUNA 4NCGB 3AQOA 1KQKA 5D3GA 2KT5A 4NLSA 2OLWA 5HL7Q 1UZHA 3IAS9 5EX3A 1DHMA 2HEKA 4D3GA 4A48A 3GLJA 2ZVIA 1CJTA 1TKZA 2DHXA 2CJAA 3NGSA 3W60A 2C2ZB 3AD7C 3AJDA 3TZZA 5J1PA 2DR8A 5J2MB 3G6ES 3KNGA 3V5RA 1UKUA 2PT0A 2DKOB 1HPZB 5BYRA 3M9OB 2DITA 3WZ0A 1BXNA 5KFDA 2AJQA 3LP1A 5E3AA 2BOPA 2MYFA 1M5KC 3J80U 2ZZTA 3SEOA 1UVLA 1HNVB 2PDAA 1WTBA 2BANB 4QQBA 3Q8YA 1RTHA 2HLUA 1QAIA 1VK8A 2E44A 2GAHC 3JSMA 1BWEA 4BWMA 1NK7A 2ZC3A 3OHBA 2DH9A 4RL1A 4XTTA 4ECUA 3KG1A 4K0KJ 4M5DB 2HQCA 5E33A 4HL9A 4DSIA 3VZHA 2IJNA 3TA1A 4WKYA 1AB8A 1KS2A 4DQRA 3MR5A 3A4TA 4NPOA 1IBLJ 3GTYX 3L7OA 4FVCA 1BY9A 1CJUA 3B6BA 3C19A 1KOHA 1VQYA 4LF6J 3TUJC 3D4JA 2LQ5A 1U45A 2RHSB 1M90T 5KFVA 3ZZ0A 2H4WB 2Y1JA 1H2VZ 3I0RB 2RF2A 4B3RJ 2M7SA 4DZ6A 3GONA 2YWEA 1WEXA 2GVZA 5FDLB 1KNZA 4CLKA 3DDIA 2AIRB 2JOQA 4B02A 4KPYA 2R7XA 2HVDA 4OYXA 1ZBTA 1PILA 3ET6B 1NZAA 1U1QA 4KR0B 4H4MA 2VG6B 2DXFA 3BYPA 4ZPCA 4OX6A 2HGLA 2ACMA 2UVVA 1RT6A 1UVMA 2LQ9A 3BGRB 1N48A 3WX8A 1Q8LA 2JLFA 3CWJA 2FD2A 3JXOA 1EETA 2AT1B 3ISZA 5HVHA 1EB0A 4KY3A 2W2MP 3CCUS 2M2BA 4EFAC 3DRXA 3K59A 3LAKA 4GKKF 3H4DA 3RR8A 3HM9A 2JEFA 3E01B 1U09A 4FYDA 3KLGB 2XSJA 4KSEB 2LA6A 1U0HA 1U0SA 3D1HA 2FHMA 1SC4B 3KLFB 2V4RA 2GO8A 3F73A 3FZ2A 5K14A 3V6KA 3CD6S 4ED7A 4USUA 5DZ6A 3T1YF 2NCKL 1ZM2A 4DS4A 3FUYA 2HBQB 3FEXB 4MFBB 4WKRA 1WACA 4RNFA 3Q0AA 3KDNA 4A4JA 4DX8H 5ETOA 3GJQB 1U49A 4WFNQ 4J9NA 2WSFC 2HHXA 3GIKA 1E6YA 2FVQA 4P71A 2FJBB 3J80Y 3DNCA 2K3IA 1S49A 1RLCL 4IH7A 3K5LA 1RT4B 3PEJA 2J8SA 3C16B 4JI3J 4PQUB 2BE2A 1C0TB 2DRAA 2RUSA 3TQ1A 1L3KA 2W4CA 4Y2MA 4P52A 3L3CA 2IM1A 4TNOA 2HFOA 3TEHB 3L09A 2OPQA 5BYSA 1VR6A 4KGMA 1U24A 1OQ6A 1RLDA 1HIYA 3M2UB 1SKWA 3GJRB 3MM5A 1R0AB 5THWA 3QFWA 4BLGA 2I8EA 2ZH1A 3M4XA 3GU0A 1CPZA 4IO1A 4Y34A 3HSZA 4J9RA 2ZZMA 1DQ8A 3ICLA 4FS1A 3WQPA 2VC1A 9ATCB 4NCAA 4CZCA 4RW8B 1SQFA 5DLFA 1RTIA 1IKWB 3HP6A 3FQKA 2V4JA 4LF7J 2C2EA 4LR7A 1JXLA 4AXJA 4E8UA 2KG1A 1JLQA 4ECZA 4NXNJ 3I6PA 4NLGA 4KH1B 2GJIA 2VJVA 3D0IE 3U1MA 2Q1LA 5KFZA 4E0DA 3OL6A 4F2SA 4PUOA 3VAHA 2VQEJ 2HSEB 3KJVA 2KT3A 5DDPC 2WOMB 3KHHA 1YTYA 2UP1A 1FX2A 3T1HJ 3GJSB 3OTEA 2R7WA 5A76A 2J76E 5KFFA 1LWEA 2XMVA 3SSQA 4KRWA 3JAMU 2BJ1A 4DV2F 2QLWA 1PIEA 5G4DA 4WFXA 4F3QA 4LF9F 1VISA 4PR6A 4CT9A 1XQIA 2KYXA 2KFYA 2IJRA 1RAEB 2VL1A 1T95A 1X4HA 4A46A 4NI2A 3M8QB 1TL1A 4O4RA 4DF8A 1FVQA 2WVDA 1S6QB 2F8HA 1NPKA 4P74A 3FJ2A 4X4UA 1DTQB 3HLUA 1TR0A 1OO0B 1UVNA 4YUDA 4IG0A 2NLWA 1JLEB 4ES3A 1HNZF 2CJYB 4LMZA 1RWWB 1UEKA 1YBUA 5DS7A 2NR0A 3HULA 2EFNA 5AXLA 1SV5A 3UDEA 4YR0A 2PIIA 4Q44A 5KFXA 4XDDA 4CYUA 3CPWR 2AHOB 2DNGA 5CYJA 3PKYA 3ITHA 3R27A 3PYGA 3HJVA 1FKPA 1YZ7A 5F0WA 1HR0F 1VQLS 1TZ0A 4DSFA 3PG9A 4PWDA 4DUYF 1YRTA 3MAAA 1LXNA 1B64A 1NLKL 2PMWA 3GP9A 1X5SA 4WZQA 2AYGA 4EWTA 4ZJQA 3GIJA 4L3NA 1JWWA 3MM7A 1QSSA 1KSPA 4OZ3A 1W2BR 2QO3A 1TFWA 3K8VA 3M6UA 1BLUA 2UUBF 3MEGB 4ED8A 2HVEA 4DPOA 4DQSA 3TR5A 1LFPA 3I32A 1U47A 2QG9B 3EX7B 5MLCV 3N01A 2RB7A 4EBCA 1D9AA 1N5YB 3GIMA 1RT1A 5L1KA 4X4OA 2GX8A 4I4BA 2W24A 1KR4A 4ZN3A 3TAQA 1CULB 2DCUB 5J1NA 4QIEA 1CQNA 1JJCB 1WC1A 1RT3A 1IBMJ 4F0KA 3CJQA 3NOCA 3M32B 1I94F 5CQGA 3G87A 3MECA 5C5JA 1GT8A 5KFCA 4F36A 5IQQA 1CBKA 4R5PA 3BM7A 2HNYA 2UXDF 4OJ3A 2D3UA 4FS2A 2W1BA 1KONA 1S10A 3SQOP 3K17A 1N5QA 3QO9B 3W9IA 1P9YA 1FXDA 2ZKUA 3MURP 2VH7A 1NPRA 4I67A 4OI4A 3A3NB 1HW8A 4N77A 1D3WA 3GIRA 2W9CB 3TQEA 1CQMA 2MQMA 4JOUA 3JAMY 3PIPQ 2CNLB 1Q7LB 4NCGA 2YXLA 2HZVA 4OJGA 2Y0SD 3JTPA 2E9RX 2PI4A 4USJC 4I64A 4O3QA 2EWHA 2PA8D 2FVCA 2YKPA 2HHWA 1U1MA 2I0XA 1U25A 3RRGA 1TTHB 1UWBA 2JDJA 3DXBA 3RRHA 1IKXB 4A8XA 4L6V3 3D6FB 1X4DA 4OFZA 5JVGQ 1IJFB 5J2MA 4DXLA 2N4DA 2VB6A 4NLOA 2L08A 3HZEA 3K58A 4KC5A 2CJBA 1FA0A 2FHOB 3UCUP 1F0XA 3OBIA 4J9OA 5DETA 4DSJA 1X5OA 2UXBJ 1Z2LA 1HNVA 5K8OA 2AW0A 3ZC4A 4HT5A 4OI0A 4IKAA 1NSKL 5HROB 4IOAQ 4DS5A 4OX9J 1FXLA 3NCQA 4DV6F 3DFEA 3S8SA 2BX6A 1U8SA 1LW0B 5F9NA 3BZQA 3DOKA 4ZJOA 1Q7YT 4IYQA 4CLYA 2GZOA 4M5DA 2G2YA 2VICA 1S1TB 3CCLS 2UUCJ 3CJ3A 2B3TB 3F41A 4DMZA 2DR7A 3TUZC 5KG1A 4OL8A 1G7CB 4L73A 2DHGA 1S1XB 1S76D 1GTEA 4WPAA 4DPWA 2LXIA 4DX6A 3D1OA 1CJVA 1NRKA 2DEJA 3KK2B 3G8QA 4QCLA 4LSNB 4TY8B 5KFYA 1HWLA 3DI6B 6FD1A 1HFEL 1YQHA 1C1BB 1JLFA 4ZPWR 3F44A 3C66A 3LW5C 3THPA 1KLMB 4ZIWA 1YJ9S 4X4QA 3H0PA 1O51A 3R1LA 4I0WA 1HI0P 1YLXA 1FDBA 3ET6A 4ZP9A 5F8GA 4X64F 3SV4A 1HWJA 2VJUA 1X4GA 2CQPA 2VG6A 2KVQE 2IRUA 2MGZB 2CNNB 3I5CA 3BKFA 2VG5B 1NUEA 4DR6F 3CSKA 2AD9A 1HBUB 3HVWA 2F9JA 4WYLA 3W2WA 4DV5F 1FRLA 3EJMA 1NH7A 5HMYA 1URNA 2MKCA 4ZLPA 4DSEA 2Y9HA 3GPAA 4YY3F 1RGVA 3K5OA 1RWKB 1W26A 4RU2A 1SJRA 1N5TA 2D3ZA 4P7VA 4ZKAA 4PEOA 2ZZNA 3LOUA 1NDPA 3NWGA 3BR9A 4XIUA 2ZUAA 5ADZA 4IFVB 1VRUA 1K47A 4BBYA 2JEGA 4FZVA 1SJQA 2IFXA 4QWAA 2AJFE 3I96A 2Z2LA 2DNYA 1XMOF 3BQ2A 1UAWA 3E01A 2IY5B 3K5MA 3D6HB 4OV1A 1M5VC 4B3TJ 2W9BA 2QC3A 4CLSA 4EBDA 1OMSA 3D68A 2DNOA 1L3TA 4DF4A 3KLFA 2AU0A 1YJRA 8ATCB 1TQLA 3BEGB 4O4GB 2P9EA 5LSOA 4D3HA 2OD4A 1AW0A 1AYEA 4CO3A 4WTOB 4DL7A 1URRA 1XIQA 4L74A 4MFBA 2V94A 3M2RB 3PRVA 1H7WA 3PZPA 3MGJA 3L7UA 4F4XA 2IAJB 3VGTA 3EZ5A 5ETLA 4U7UK 1S99A 2ZH6A 3C16A 4E2FB 3IWXA 4PQUA 1C0TA 4YR3A 4M5NA 1HBNA 4I56A 3HFVA 2V6AA 1SUQB 4ICLA 2VKZG 4CLZA 2V8VA 1YBAA 2P6TA 2GMHA 2BE9B 4DR1F 2FJEB 2VU5A 3M2UA 2HIQA 1R0AA 3GWCA 2CQCA 2E7VA 2RQCA 1T05B 3AA9A 3IRWP 1B7YB 2FPHX 2OFGX 5LMNJ 5B0DA 1FD8A 4U7CA 2E5JA 3U02A 5A8WB 5IT4A 3N5FA 2CQHA 4K4XA 3Q2SC 2DYAA 2E9TA 4NA3A 2OJ3A 4RW8A 4ZP8A 5B0CA 4CIOA 4LQ3A 1YJTA 3L9ZA 1WKLA 1WG1A 5JVHQ 4YB6A 5KOWA 5AE2A 1GQEA 2GGPA 4KAIA 1AUDA 4DV1F 3DLBA 4ZCKA 4YHHJ 2HGMA 3FFIB 1EIYB 1T9UA 1CEZA 4ZVRB 4JI5F 3R5BA 5J2NB 2WOMA 3DM2B 3W7BA 1H0HB 3MMJA 3TUPA 4F4ZA 5LL6d 4BC9A 1RCXB 1KVJA 3OR1B 1NJYA 3BF4A 2HRTA 1MROB 2WTFA 2AQ4A 1NB7A 1Q86T 4NX9A 3M30B 2FIUA 1FDNA 2RRBA 1FE0A 2P5VA 3HDSA 2BJDA 3QT8A 5E41A 2KT2A 2BOAA 4JI2F 3M8QA 1AROP 4LF5J 2EEYA 3MM8A 1KKHA 4IDKB 3TVZA 4UW2A 1U1LA 1S6QA 1FKOB 2YX1A 5GVQA 1VQ4S 1OY6A 1IBCB 3PO5A 5DO2A 1DTQA 2V5HG 1R8BA 3W65A 3AB2B 2CDRB 5I3UB 5IWAJ 1JLEA 4C8NA 3HPOA 4F4KA 4DL0C 2YTCA 4LREA 1PYOB 5F3ZA 4O3RA 3UI3A 2G1DA 2QEXS 4NLUA 2G0JA 4UY85 1RHUB 2E7WA 2QLFB 4AL5A 3I55S 1IUJA 1HNWJ 5A2QU 3NP5A 2CNOB 4RPFA 3D2WA 4PRFA 4ID8A 3IA0A 2RILA 2WVCA 4TN2A 4PCQA 3NGDA 1DZ5A 1TL7B 4WK3A 3GR1A 4JI6J 4TQSA 2BBEA 5D4PA 1C4AA 3OV7A 2GNKA 1U4BA 2RAQA 4K4UA 3UDCA 2V8GA 5F8MA 3ZXWA 3PY8A 2DNMA 3KKFA 3LH2S 1T03B 4Z7CA 3MEGA 4K4ZA 3R6GB 1S4EA 4JV5J 1JXVA 2VBWA 3H40A 5ETMA 4KGKA 3RAMA 4KT0C 1N5YA 1SC1B 4PQAA 2MPUA 2L48A 2OEKA 2M9KA 1CULA 4NLWA 3NXZA 3FSYA 3LALA 3NOGA 4WFAQ 1N0VC 1RT5B 5D0EA 1U1OA 2C42A 4ITSA 1AZSA 1IWAA 4ZHRB 4WK1A 3T1YJ 1SXLA 4ZLNA 1J5EJ 1LQ9A 3VGVA 4ED5A 2J6TA 1H6KX 4MIBA 4ANCA 2VOOA 2HBYB 1CSJA 2G0CA 3A3PB 3CNQP 3QO9A 2VODA 3OJUA 3I5BA 4GO7X 4B9UA 2B4VA 1RWVB 4NYZA 1IQZA 2DJWA 4P2MA 5KT4A 4I2PB 2C3PA 2W9CA 2CQDA 3BYRA 3K8WA 4XK8C 1S1WB 4K2XA 3JSRA 2OELA 2XB2D 3TOQA 4BS2A 1CC8A 1ZPVA 2OTJS 1MWZA 4FYYB 3B82A 4RW7B 2AZ3A 1Y5NB 3PDNA 1JX4A 3IXQA 4QZVB 1C0UA 2N7CA 3Q8UA 3NNAA 1IKXA 2XMKA 4HI1A 3CCES 2E5IA 2RU9A 4DR3J 3LPEA 1XMQF 2DNQA 3KK3B 2ZVSA 5HMXA 2GS8A 3PR5B 1NDLA 3MUTP 1N5SA 1H72C 1FRXA 2FC9A 2JEIA 1U26A 2ZH9A 2LQJA 1Z2ZA 2O3DA 3QLHB 2WVBA 2ZUGA 5GAHU 4DPXA 3HKWA 2LFVA 5GAHI 4OHZA 2DT9A 5T14A 1OYDA 4GC6A 4XPEA 3SQGB 3B4DA 1GX5A 3Q22A 3CCVS 2YQ1A 5A2QY 3E2EA 1LW0A 4PZVA 2DNPA 2YKOA 1FERA 1WF0A 2C3YA 1RTJB 5B0AA 5LXRA 5JXSA 4KB7A 2XULA 1S1TA 1VOMA 2LVWA 3ZTPA 5M2RA 5G0RB 3KUGA 1VMBA 1YJNS 1ZA1B 2XHCA 1SIWB 4ECQA 4OHYA 2I6WA 5IV4A 2LCWA 4LQ9A 2MZ1A 1JLAB 2LDIA 3PJ9A 1S1XA 2RDJA 5C25B 2QT7A 1WDTA 1NAQA 1FNOA 2DGWA 4QIVA 3KK2A 4LFBF 2HW3A 4LSNA 1X31C 2CQ4A 2LXUA 4TY8A 1Q16B 1WUUA 3DI6A 1JIHA 1H98A 3IWLA 2P9CA 2R42A 3GYGA 1RTZA 1C1BA 5HQLA 4JI0J 3JS9A 5EWFA 2WONB 1KLMA 1X5PA 3BBCA 2F1FA 4CM2A 1RHMB 3C15B 1RQ0A 5AE3A 2IRYA 4UQTA 3RU0A 3C2PA 4DR4J 1RI7A 4USIA 4ED6A 3H42A 5L38A 2XWXA 4NYOA 3G4SS 1DQAA 4RUBA 4USVA 4UOHA 3TEGA 2EG1A 3RBZA 3R5JB 1HBUA 3W3SA 2L3MA 4ZVOB 2ZNZA 3EDRB 5E3RA 4MYTA 2FJDB 1I1GA 4OYOA 3NL0A 2APOA 1VC6A 5K9FA 3EICA 4ILMA 4DN0A 1EQMA 4IRCA 4JYAF 2UV8A 2GJ2A 1K0VA 4B08A 3SIPB 4J9LA 3GFXA 1NHUA 2IYIA 4DV4J 4O44A 1RSCA 2PC6A 3QZ7A 1SC3B 3DLHA 1D9DA 3SDEB 2PGCA 1VQSA 1N52B 1S72S 4RNOA 3MXHP 3G6YA 2BJ7A 2K7KA 4O4GA 4ED2A 3ZZOA 1PKUA 4K0KF 3PX4A 1SPBP 2IDLA 1XNRJ 4CO1A 1PBUA 2ZD1B 3OR2A 4EZ6A 1VGYA 1IBLF 3M2RA 4LUBA 1MN7A 1F9FA 2M3DA 3CD7A 1YJ7A 2NSBA 4IH6A 2FLNA 4W90B 3OHAA 1PYSB 2FC8A 5FJ4A 3DLGB 3R3TA 2IAJA 3R9LA 1U2CA 5DJBA 2YQ3A 3EGNA 5HLFB 3CT9A 1IXKA 2BABA 4B3RF 2HQDA 3C3LA 4RW4A 1DLOB 4MK8A 5HO4A 1SJFA 3ENQA 4N5SA 2AX1A 1ZA2B 2GIQA 4ZPAA 3CCSS 2HS4A 2CNKB 2G0IA 2XY6A 1WF1A 4UOCA 2CVIA 2CPYA 1REVB 2YWHA 3QRPA 3BJYA 3KJQB 4ZK7M 2DCLA 2WB4A 2MQ8A 2BZ2A 1S77D 4N56A 1T05A 3C6UB 3LQVA 4UZBA 1XK8A 2OEMA 2MKHA 5KG4A 4PWUA 2R8GA 1ROFA 3MDFA 1WHXA 1SQGA 2DNNA 3FC9A 3F56A 4ED3A 4DL3A 3V6HA 4O3OA 5DG7A 2VDIA 4FF4A 1B0TA 3FRZA 4CO0A 2A1BA 3MR3A 4ECTA 2Z57B 1R0BG 2EKNA 1M1GA 4DLEA 3UR0A 2VPWB 2M52A 3T41A 2B0GA 3HMJG 1N54B 1VJWA 4M5IA 5HJYA 3TJ9A 1ZTTA 1HL6A 4OI3A 1UVJA 1K9MT 3W63A 2D74B 2Z8QA 3WC0A 2XWYA 2JH3A 1WHYA 4BC7A 5HBMB 2UU9J 3JSBA 3MFHA 2MKKA 4LRBA 2O01C 3DOMB 1HLWA 1PSDA 1TKTB 2KJVA 2KHCA 3DMJB 5HSPA 3DM2A 3QT7A 2DNRA 2JRSA 3I9ZA 4K4TA 2YNGB 1MROA 2KN4A 3DDKA 1PC4A 4CO4A 5A6WA 3M30A 1FJCA 3MPVA 2P2CB 3ISND 2VPXB 3DGVA 2F63A 2D7SA 2W4DA 3ULHA 4I6YA 2BKOA 1KQGB 4Y3CA 2ZOMA 2CWXA 1KBRA 1XR5A 4PXDA 1TUWA 1G3OA 1VI7A 2RIJA 1JK9B 3OPKA 1K8AT 4C0HA 3DGPB 2F3JA 1JJHA 4X4NA 3N6MA 2ASDA 2ROGA 4LF1A 1ACMB 1IM4A 2RT3A 3IAM9 4J9MA 4PG7A 5KFRA 5A8RA 1S48A 5IC6B 1RTDB 1T94A 1YGYA 4OMFG 2GHVC 4ELUA 3FK4A 3I9V9 1T11A 5CCLA 4NEYA 2HYIB 3T5LA 2MTLA 3ZO7A 2FHJA 1YG0A 3QATA 1JJ2R 2E5LJ 2B6AB 2DK2A 4ZP6A 1XJWB 1TL7A 2XZWA 3VZIA 4LF7F 4TKTA 1T3NA 3W66A 2QZ8A 4PG6A 1NSPA 3PXGa 2X1AA 2MSSA 4DR6J 5HMZA 2E66A 4NXNF 5ITHA 2FVSA 3UN3A 2R7SA 3WC2A 4LVOP 3LPYA 4MYUA 2QMXA 1GMWA 2CJKA 1T03A 2DXDA 4QR2A 4UY8T 5L1JA 1Y00A 2XLJA 2KYZA 3OL7A 2V67A 3T1HF 2ILYA 3KWMA 1S1UA 5IS2A 3TZYA 4JV2A 2E9ZA 3CB4A 1FNMA 3OFEA 4DV3J 3T6JA 2FZCB 4WU2A 5AXKA 1QVGR 1GX6A 1RT5A 2CAJA 3R5AA 4K4WA 4U8YA 3MEEB 4XAKA 3GCXP 5CXTA 3CW2C 5DM7Q 1FDDA 4F50A 1C4CA 3SMZA 2Y0BB 2VFUA 1O8BA 3BBFA 2DXEA 2J6SA 1ZTWA 3TZWA 2FB0A 1S4FA 3EMTA 1X7VA 1YDLA 1TP7A 3EPGA 2EG2A 4I2PA 2NSCA 4ILLA 3RBDA 2OTLS 1S1WA 1VBKA 1M0SA 3GIIA 1YK9A 2CJQA 3QWUA 5EDWA 4Q45A 1XTZA 4RW7A 4HH0A 3MCOA 1EKRA 2KFZA 1H74A 3EYZA 4V1Ak 4KGXB 3ELHA 2B7CB 1WC3A 3LGNA 2ZH8A 2AX0A 3NNHA 2MHEA 1GTHA 1IBKJ 1S97A 5ETQA 4ZJLA 3KK3A 4IQMA 4CTAB 4X4VA 3PYEA 1J5OB 3LO3A 2HNZB 1HARA 4LVNP 3FGVA 4DCOB 3M1VB 5KT6A 2IC3B 2G2OA 2RKIB 4O3PA 1XC9A 3QLHA 2W7AA 1A0OB 2B8QA 4RBTA 5C2CA 4JI8J 5DGBA 2FJAB 1PC5A 3AB4B 3MF5A 3SQGA 3PACA 3ENWA 2HNDB 2YBVA 4Z2XA 2PA3A 2NYIA 4J91A 1RTJA 2DRDA 2UUWA 3US5A 4HLBA 5G0RA 1IBMF 4ZP7A 4YFUA 3IRXB 2KM8B 3EPIA 3CCRS 3OSPA 2WSEC 3EXYA 1JLAA 5HJXA 1YRUA 4OI1A 2VG7A 4GC7A 3I5AA 1JLBB 9RUBA 1YRXA 5C25A 2J9DA 2NZ4A 2HFUA 2A6OA 1YX2A 2A18A 1DJ0A 3IG1B 4QR0A 1FX4A 2J9CA 2EK6A 4OYMA 4J9VA 2JFDA 2AJ2A 2R7QA 2OFHX 1DARA 3GCWP 5IXUA 3QQCD 4ZVTB 1X0FA 2DEIA 2K1RB 4NLPA 1YBTA 4U8VA 3GQCA 3T19A 1VJQA 1PJ5A 3BPSP 2J0XA 1R3NA 2WONA 2ASYA 4KYZA 1S6UA 3C15A 4EYHB 3E8OA 3LGHA 5E3QA 1RHJB 3TW0A 3L7PA 4MMOA 4BDPA 4P7TA 4L75A 2UV8G 3M8PA 4KGZB 5A6PA 2GW8A 1QD1A 3BN7A 5E0OA 8AT1B 5KFMA 3VVUA 3I4HX 2QMUB 2JEJA 5CYQB 3GFHA 1RWMB 5KG3A 4DQIA 3M9MB 4P2SA 4LF2A 2COLA 5KFAA 3IMQJ 1B4SA 1Y10A 1HKAA 4OJHA 5GMDA 3OFGA 2FHJD 2E1PA 3AJ2A 1RB0A 4I7FB 2HGNA 2UXBF 3KLIB 3O3LA 5LSLA 4JBCA 1DFDA 1FRIA 3CD0A 2NXUA 5D0GA 4OX9F 4KIAA 5KFSA 4C8LA 2MJNA 5BJRA 5LXYA 4CH7A 1HWUA 5I3QA 2HVIA 2AJ1A 2AV5A 3LGMA 1CS4A 1MG7A 3QSYB 4HACB 4QW8A 2Z56B 2UUCF 1TL5A 4CLWA 2JL9A 2E1AA 3MMBA 2DNZA 2JVRA 2ZD1A 1TUGB 4JI7J 1VQ5S 2B9EA 3BDPA 4RW6B 4N8NA 2DO4A 4CLUA 4X66F 4Y2KA 1VBXA 3CMQA 3UVJB 4C6AA 3MMAB 3UE2A 2Q66A 2ZH2A 1UVKA 1UEVA 2OPRB 3D9BA 4QU7A 1WOSA 2RS8A 2E5HA 1NDCA 1TUVA 1P9QC 1LEOA 5HLFA 4AYBD 3OTDA 1VQKS 1P6TA 3R5GA 1DLOA 3WDOA 2CIMA 1LWCA 1VS3A 1EQ0A 3H8YA 2XMMA 3CTRA 1VIXA 2LQBA 2MDAA 2VFTA 4YS2A 1REVA 3EWGA 1K73T 3V81B 4P2XA 1D0EA 5C42B 5B08A 3AY0A 3C6UA 4ECRA 3KMQA 5LMUJ 2ZE2B 2P9GA 1X9MA 2ROEA 3Q8PB 4MJKA 3KG0A 2CPJA 2IVYA 3DLEB 1RK8A 5A0YB 1QY7A 1R31A 1UL3A 5KFLA 2XC9A 3IS9A 1KLNA 2VBXA 4I2QA 5EX0A 4P72A 3VGUA 3PW4A 2A2DA 3PM9A 1NK9A 5J1EB 5KT7A 3KG4A 4ELTA 4TQRA 2B9XA 3RBXA 1Q82T 3DOMA 4DN9A 1TKTA 4B3TF 3DMJA 5HANA 2ZFHA 2PI5A 2G13A 2D3O1 4I6AA 3ONQA 3OFFA 2LP4A 2YKQA 4USWA 1RA6A 2ZH7A 2YNGA 2X3DA 1R8PA 5J2QB 2BV3A 4IQXA 3QAUA 1JLGB 3VQSA 4A8MP 3W62A 5B09A 4QU6A 4FF3A 3P6YC 3FSXA 2JLGA 2XCPA 3W9HA 4HYKA 3FNNA 1CG2A 2VC0A 2OKQA 1KQFB 2YVSA 2XCAA 2AGOA 2CXEA 2ZNYA 4DFMA 2RQ4A 1PBAA 1IR0A 3HD2A 3CJKB 4NL5A 4Y2IA 1X0PA 1T7PA 4K5SA 1YZ6A 3DGPA 2M0GB 2P6SA 5MAOA 3CIMA 3JQMA 1VC5A 2E1CA 4DL4A 3UWTA 3M6VA 4ERDA 1V5IB 2C28A 5DG9A 4C9DA 3EM1A 1RTDA 3K57A 3CIZA 3PHEA 2CZ9A 1PGZA 1TKDA 2QTWA 1XR6A 1PAUB 2PFDA 4X4TA 4BCAA 2QSWA 3TA2A 2BJ3A 3D7SB 2QA2A 4DOZA 1KEKA 2AJ0A 1NMEB 3DRPB 2KDOA 1NXIA 5LMNF 2R7UA 2D3OR 1UP1A 1EHWA 2KG0A 3VAJA 2LU2A 1VDHA 3ZZZA 4FNIA 2C2KB 1ZM9A 4K5RA 8RUCA 2N3LA 2W01A 2M8DB 2B6AA 3M8RA 2VV5A 3DN9A 1U02A 1IJEB 3UO0A 2H9ZA 2ZOFA 1NKCA 3PJWA 1HA1A 1VK3A 1YI2S 4QWDA 3EXCX 3HX9A 2W9AA 5K5MA 1LWXA 1S7IA 4TLQA 2VPZB 4C8KA 1YHQS 5B0GA 4K4VA 4LRDA 2N82B 1QE1B 4ID5B 4YHHF 3WX4A 3TUIC 4P6QA 5KFIA 3K0JA 1S6PB 3FCHA 3EGZA 3R8YA 4X4RA 4DBQA 5H9EJ 3GYXB 1Y3KA 1TVRA 4JYAJ 3OD2A 1TMMA 4GKJJ 3MM9B 1UW4A 2VIHA 1EX8A 4DR2J 4M1KA 4ETXA 5KFKA 2B9YA 1FK9B 1HBOA 3MTKA 3QBCA 4EK2A 4DL2A 2AYEA 1Q8BA 4LF5F 2GHPA 3MEEA 1MMDA 2J9DE 3TARA 4C8MA 3AOBA 1D1UA 2XSFA 1JB0C 2ASJA 2AEMA 2Y1RI 2NYHA 3TJ8A 3C6TB 2KTQA 3MEKA 3BGUA 4WXWA 1HQEA 5IWAF 3M7VA 1Y5LB 4O23A 2V2QA 4TYAA 3UD5A 2K3KA 5M2UA 4A8KA 1K0TA 5L9XA 2IA0A 1QJHA 1VRTA 1WG4A 2H54B 1WC4A 1OPZA 2A2CA 3PX0A 2YNHB 1YJWS 3K2YA 4JV1A 3OLBA 7FD1A 2RQMA 3KUEA 3EVWA 2J7KA 1HNWF 3D5MA 5KFUA 4ER8A 4URQU 1N0UA 3V6DA 2D41A 4FPIA 4ZS6A 5DQGA 1F2HA 4WFYA 1OS5A 4C7QA 2Q43A 3KK1B 4CTAA 2EFVA 3NMRA 3RAQA 1J5OA 3R7NB 2FVPA 4JI6F 3M1VA 2IC3A 2OPSB 2CZ4A 1BQMB 4G1PA 1QVFR 1UA0A 3PVXA 2HLTA 1ZPWX 3PCOB 1R43A 2R7RA 4RO0A 3ZTQA 1J27A 4PKDB 4OYAA 2YH1A 4YB1P 5GMEA 4JV5F 2MZJA 3LP2B 3J81j 5KFQA 3EUNA 4KV8B 2RU3A 2FZKB 1I3OB 3BGFA 2K8GA 3QGIA 5IT9U 5CABA 3CDWA 3HHDA 4TYBA 2DNHA 3ENAA 1RT2B 3D6TB 4C0OC 3QYYA 4K8RA 4OYBA 3OTOJ 4ZPBA 2YPZA 4S0MA 2ZHBA 4HI2A 4K7QA 1JLBA 2GIFA 3CXCR 4N47A 1KHWA 4QYZK 1J5EF 2FTRA 3IG1A 2HZAA 3K5NA 2WW8A 5CD4H 1TV6B 1Q81T 3R6LB 3Q23A 4F8RA 2F9DA 4YOEA 2HAFA 4KGVB 2L9WA 1IQTA 1D9FA 3ISNC 2UVUA 3HXMA 1B0PA 2K1RA 2DGVA 1HYSB 4HTIA 2ZEJA 1BQNB 5L1IA 3SCJE 3AOAA 2R8JA 2XNRA 4OYWA 1N32J 1N6QB 3R2DJ 1FXRA 3RAXA 2OMOA 4X62J 1WI8A 5DQIA 2V8DA 3OUYB 1RUSA 1J2VA 2FLPA 3HSJA 1N56A 4LRAA 4LBPA 1VFJA 1WSRA 4QIFA 3HHLD 2EFGA 3ZTSA 1U1PA 4WCEQ 2XS2A 3OTBA 1U7LA 4DR3F 2CPFA 2MHNA 4DR5J 2AGQA 3GMGA 2AZ1A 1FJGJ 4RNNA 4WWSA 1XNQJ 2G1HA 4LIRA 3PX6A 2R4FA 3DU5A 3Q8QB 2FJVA 3MR7A 4F3OA 3TRGA 1DURA 2WSCC 1ELOA 2B9WA 1UETA 2OI2A 2R3VA 2XYPB 4GVBB 4I7FA 4CLLA 4AXIA 4K2JA 1WNEA 2F8EX 3KLIA 3NBPB 2HHTA 1WC6A 3BO2A 1HWKA 2OP5A 3CJ8A 3W64A 4C98A 2BMBA 3H2UB 1FWPA 3M6WA 3HJFA 2YQ0A 4KFBA 1WC5A 3CMES 4HACA 5ETTA 3O44A 4QWCA 3G86A 5K8PA 2OD6A 2HG4A 3UCZP 1H2TZ 5SZTA 4M5JA 5AT1B 3UVJA 3SZ2A 4L3KA 5GADU 1G4CA 3UFCX 4LJMA 1OSDA 3GV8B 5GADI 2OPRA 1O0PA 1TK0A 2PMHA 2AF6A 2R7VA 1SL0A 3OJSA 2BKNA 1RISA 5D77A 2VUGA 1N4LA 1SH3A 4DX5A 3QJLA 2AWZA 4RWWA 2IM0A 4TU7A 3IFEA 3BS9A 1KTVA 2DY9A 4ZN1A 1S0NA 1R27B 1S0MA 4JI0F 5IT9Y 4DR7J 1NSQA 2EK1A 1NSAA 5E3CA 3V81A 4IR9A 1C2PA 3GJTB 1VRQC 4DL6A 5C42A 2M8HA 4DR4F 3EGWB 4OHXA 1K44A 2ZE2A 3P4UB 4ANDA 2XO7A 2HQFA 4U96A 4ELVA 2E1MC 4W98A 3V4IA 1QDUB 1VLOA 2CPHA 3DLEA 5A0YA 5RUBA 2HHHJ 3UCGA 2QLJB 1QTMA 4OZ5A 5SUHA 2ZDPA 2FUG9 4OX8A 4AD6A 2J7UA 5LJ5Y 1RT6B 2RRAA 4IH5A 1WKKA 5HQMA 4FP9A 2ZBCA 4CNZA 2CUYA 1S5ZA 4N41A 4Z7YA 4G6VB 2EC0A 4WZMA 1HW9A 3CVKA 2AEFA 4EO8A 3M2VB 3MMCB 4DV4F 5L1LA 3KLVA 1WJ9A 4OHVA 4WF9Q 1VQ7S 4OI2A 2CPDA 2JSXA 3M8SA 2F4FA 2HHVA 5J2QA 4TLRA 2X1GA 2ZWOA 2GFFA 2DD8S 4M5KA 1YIJS 3X3UA 1XNRF 4F4WA 3AH6A 1IR1A 4B9NA 2ZH4A 3HI9A 3G82B 5K8NA 1KN6A 1YVFA 2PMZD 2JC0A 2CPEA 3A12A 1VBZA 3A13A 5I3PA 2ILZA 3VTIA 4EMDA 1DAXA 2B56A 1U6FA 1M5SA 4EBEA 1VQMS 4CRJA 4MIWA 1WWHA 5IZHA 4AUKA 5K20B 3RRKA 2C3MA 1HWIA 3U1LA 1FD2A 2UUAJ 3FKBA 3FBEA 1S57A 3WHIA 3DRPA 2G9OA 1LOUA 3IM8A 3P5TL 2VA3A 2KZMA 1OPIA 2XO6A 1H38A 1SKUB 3UN2A 2H48B 3H5SA 1U48A 2B4UA 1N33J 2MXYA 2OH2A 5DGAA 1T8EA 2I5JB 4HTJA 4MKVA 3J7Z5 5DZ7A 4B9LA 1F5AA 1SI9A 4DWIA 2Y8WA 3W5ZA 2D1CA 2BQRA 1G2EA 1QE1A 4ID5A 1WI6A 2FY8A 2UU9F 1KOOA 1HPZA 4KKOB 1FRJA 2ZJQQ 3BSOA 1Q95G 4PUOB 1OSCA 2QL7B 4HVZA 3CDEA 4YB5A 4F7VA 5KFTA 3MM9A 3RUBL 2BANA 1VCTA 3S01A 1FK9A 1SCJB 3H5YA 5D4LA 2YPYA 5HVGA 1RAIB 1OY8A 2JJ4D 2GAGC 1UPMB 3N6LA 2QX0A 3SV3A 4B9MA 2QA1A 4OZ2A 3D66A 3ZFVA 1FCAA 2BR0A 4RUAA 3RB4A 4NZ0A 5H9FK 1IWGA 3C6TA 5EGYA 2FY1A 4X66J 5I42B 2HHQA 2AEJA 4QYRA 5HN0A 2BJ9A 5KAKA 3T5JA 2QLBB 4PG5A 4FXDA 2DTJA 3O5TB 4DPUA 4IG0B 4OX7A 1P1TA 4ED0A 1N36J 5DDQC 3I0RA 1NJXA 3OVBA 3D0HE 2YNHA 4U7UD 2BE7D 1U2FA 3KNAA 5FDLA 1IKVB 3CCTA 3HT3A 1ZAVA 1GXTA 2E5LF 2V9WA 3KK1A 1RZMA 4OIXA 3IO1A 1NK8A 2HBZB 2V8PA 1AXQA 1FKPB 4AL6A 3SCLE 2C22A 1ZM4A 2N4CA 2OPSA 3MAAB 2HMIB 1BQMA 1WKJA 3NS5A 1FTCA 1F5CA 3BGRA 2GQCA 3I31A 2W4PA 2MB0B 1VQ9S 2V4QA 2X3GA 1YJVA 1RBOB 4Q8EA 5I4MA 2IM2A 5EWGA 4CT8A 4F67A 2D9PA 4J9KA 3GFYA 1Y5IB 4Y2AA 3CJTA 3KJNB 1NPPA 3K89A 1ZYQA 1GXLA 4KV8A 4V19J 3NEKA 3MFIA 3IN5A 5F41A 4HT7A 2HKEA 3KLGA 1NKBA 1RT2A 2HK2A 5ETNA 4DV3F 1RT1B 3OT9A 1HNXJ 4RX6A 4OJ1A 5KG2A 4NCBA 2VOPA 5IM0B 2JLEA 3JQKA 4U67Q 4RWXA 4MK7A 4UQGA
chains in the Genus database with same CATH topology
3W1YC 4DR1J 1J5EJ 4DUYJ 2MQ8A 2E5LJ 2UXBJ 5LMNJ 4DR7J 2UXDJ 4DV7J 5AJ3J 4JI6J 4LF5J 4JI0J 2ZM6J 4DUZJ 4KHPJ 4NXMJ 5LMUJ 4B3SJ 4JI2J 4OX9J 1N33J 4DR6J 4KYZA 4JI8J 4LF7J 3J81U 1N32J 3J7AN 3R2DJ 4DR4J 1XNRJ 4K0KJ 4DV6J 4X66J 2KVQE 4B3MJ 4JI1J 3R2CJ 4X64J 2MEWA 4X62J 4JI4J 4NXNJ 4JI7J 5IWAJ 2UUBJ 3D3CJ 2HHHJ 2UUCJ 4DV0J 4JV5J 1IBLJ 4AQYJ 1HNZJ 5IT9U 1N34J 4JI3J 4DV5J 4YHHJ 1N36J 4KY3A 2F4VJ 4LFCJ 2VQEJ 5LM7E 4LF6J 2VQFJ 4V1Ak 4DV1J 4YY3J 5BR8J 4DR5J 4PWWA 3T1HJ 2UU9J 4LFAJ 4LF4J 2KL8A 4DR3J 3OTOJ 1FJGJ 4NEZA 4JYAJ 1IBMJ 1IBKJ 1XNQJ 4GKJJ 1HNXJ 3JAMU 4LF8J 3IMQJ 4JI5J 4DV3J 1HNWJ 5A2QU 2UXCJ 2UUAJ 4DR2J 5FLXU 4RJVA 4GKKJ 3D3BJ 4B3RJ 1XMQJ 4DV2J 4B3TJ 4HHUA 1I94J 4NEYA 1XMOJ 3T1YJ 4X65J 4DV4J 1HR0J 4LF9J 3J80U 2MTLA 4LFBJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1Y C;  4DR1 J;  1J5E J;  4DUY J;  2MQ8 A;  2E5L J;  2UXB J;  5LMN J;  4DR7 J;  2UXD J;  4DV7 J;  5AJ3 J;  4JI6 J;  4LF5 J;  4JI0 J;  2ZM6 J;  4DUZ J;  4KHP J;  4NXM J;  5LMU J;  4B3S J;  4JI2 J;  4OX9 J;  1N33 J;  4DR6 J;  4KYZ A;  4JI8 J;  4LF7 J;  3J81 U;  1N32 J;  3J7A N;  3R2D J;  4DR4 J;  1XNR J;  4K0K J;  4DV6 J;  4X66 J;  2KVQ E;  4B3M J;  4JI1 J;  3R2C J;  4X64 J;  2MEW A;  4X62 J;  4JI4 J;  4NXN J;  4JI7 J;  5IWA J;  2UUB J;  3D3C J;  2HHH J;  2UUC J;  4DV0 J;  4JV5 J;  1IBL J;  4AQY J;  1HNZ J;  5IT9 U;  1N34 J;  4JI3 J;  4DV5 J;  4YHH J;  1N36 J;  4KY3 A;  2F4V J;  4LFC J;  2VQE J;  5LM7 E;  4LF6 J;  2VQF J;  4V1A k;  4DV1 J;  4YY3 J;  5BR8 J;  4DR5 J;  4PWW A;  3T1H J;  2UU9 J;  4LFA J;  4LF4 J;  2KL8 A;  4DR3 J;  3OTO J;  1FJG J;  4NEZ A;  4JYA J;  1IBM J;  1IBK J;  1XNQ J;  4GKJ J;  1HNX J;  3JAM U;  4LF8 J;  3IMQ J;  4JI5 J;  4DV3 J;  1HNW J;  5A2Q U;  2UXC J;  2UUA J;  4DR2 J;  5FLX U;  4RJV A;  4GKK J;  3D3B J;  4B3R J;  1XMQ J;  4DV2 J;  4B3T J;  4HHU A;  1I94 J;  4NEY A;  1XMO J;  3T1Y J;  4X65 J;  4DV4 J;  1HR0 J;  4LF9 J;  3J80 U;  2MTL A;  4LFB J; 
#chains in the Genus database with same CATH topology
 1TV6 A;  1Q78 A;  1S9G B;  2RRN A;  2MJU A;  5HVF A;  3O1L A;  2HRY A;  2QLX A;  4OZJ A;  4R5P B;  2HNY B;  2ZIT A;  1HYS A;  4RUC A;  3P3D A;  3H4B A;  2A3J A;  3BSN A;  1RXO B;  1BQN A;  4HHJ A;  2RS2 A;  1RT4 A;  2DIU A;  4KH0 B;  5EUH A;  1N6Q A;  3HHK A;  2FJW A;  2NPF A;  3OUY A;  1UMJ A;  4DV0 J;  1E6V B;  4B3M F;  2Z0G A;  4ED1 A;  1L3S A;  3QJJ A;  2ZBR A;  3HK2 A;  2V2K A;  2ERR A;  1RWX B;  4PPD A;  2MKY A;  1IBK F;  1UW9 A;  4F2R A;  4JP8 A;  2HAI A;  4USM A;  1UWB B;  4ES1 A;  3TYT A;  1LXJ A;  1SC6 A;  3IC1 A;  4PXB A;  5EHH A;  3AAW B;  4C11 B;  4Q2M A;  4ZVS B;  4M8L A;  1SVD A;  2VD3 A;  2EC2 A;  3MHY A;  4XPC A;  2E1R A;  3VQT A;  4NLR A;  3R7S B;  1IKW A;  2XHW A;  4GVB A;  3P49 B;  3NBP A;  4YB7 A;  1IKY B;  1EAY C;  4Q7A A;  2ZM6 J;  2ATC B;  4JI8 F;  1LNQ A;  4UF4 A;  3Q8R B;  4NML A;  4C48 A;  1V3R A;  4I69 A;  5KT3 A;  1JMT A;  1KDN A;  1NK4 A;  3SSR A;  3FMW A;  1MNE A;  3LF0 A;  3HCX A;  1NK0 A;  4DUZ F;  4TU8 A;  3FSI A;  5CZV A;  1HMV B;  2XM3 A;  1O5J A;  4OZL A;  1RBL A;  3E51 A;  1RAC B;  2WZ1 A;  1MW7 A;  3G8S A;  3LWL A;  1YKW A;  4LSZ B;  3CJR A;  4ZCM A;  6AT1 B;  3DOK B;  5J2P B;  4F0H A;  5KFN A;  4HEA 9;  3HFK A;  1WOP A;  2C2M B;  4G65 A;  4UTG A;  1B7F A;  4JV0 A;  2F4V J;  4NMX A;  4F26 A;  1FDA A;  3W5Y A;  4TY9 A;  2B43 A;  2DB1 A;  2R7O A;  2M5Y A;  2DGQ A;  2HFS A;  3IP0 A;  3CE8 A;  3OW2 R;  3MD1 A;  2W2O P;  3GB0 A;  4KHR A;  1U6B A;  2DH8 A;  3BH6 B;  3TX8 A;  1PG5 B;  1CJV B;  1XER A;  3UD4 P;  3PEH A;  3W1Y C;  3P5B P;  2HWH A;  4URG A;  3OTC A;  3DOL B;  3JTN A;  3K7R A;  1UFK A;  2EFP A;  3NS6 A;  1OJ4 A;  2FGC A;  3KJF B;  5DLG A;  1MWY A;  3KYL A;  3AHP A;  2W2N P;  1LK5 A;  1Q4R A;  4CWB A;  3MPD A;  3CMA S;  2L9N A;  4ILR A;  3LUY A;  1JLF B;  2B8P A;  2R2R A;  3VR1 A;  2VFR A;  2DPJ A;  4EZ9 A;  3DRY A;  3D67 A;  2OGU A;  4WJB A;  4JI4 J;  2UVR A;  4B9S A;  4FKY A;  3MZI A;  3QMQ A;  2H1Y A;  5D6G A;  1Y11 A;  3GE9 A;  1VHF A;  3ILO A;  4ZPD A;  2VBY A;  4LFC J;  4MT1 A;  3CF5 Q;  4OLP A;  4DHV A;  3W2W B;  4L72 B;  1U2R A;  2W8L A;  2JZ5 A;  3DDN A;  5HAO A;  2G2Z A;  3KXD A;  1WHW A;  4NRT A;  1H7X A;  1WF2 A;  2UXC J;  3M2V A;  3MMC A;  4W92 B;  1TAQ A;  3H20 A;  4QYZ J;  4NA2 A;  2IMO A;  3DC2 A;  1VRU B;  3N6N A;  5L9N A;  5T41 A;  1QAX A;  3ADA C;  3IR7 B;  2ZJP Q;  4IOC Q;  1Q1K A;  1RYS A;  1KFD A;  4Q8F A;  2KVI A;  2W9B B;  3U1N A;  1W2I A;  4ZVG A;  3KMS A;  1RT7 B;  4JI7 F;  1C1C B;  4DUT A;  3QGP A;  2HQI A;  3PRD A;  2HQ3 A;  2ZHA A;  2UUT A;  1P8G A;  2C1E B;  1NK6 A;  2PEB A;  3G82 A;  3SBM A;  1K1Q A;  2RUG A;  1ULR A;  1RHQ B;  5BXI A;  1NHV A;  1HQ2 A;  2ALZ A;  3M32 A;  2RJZ A;  3BQ0 A;  3ETO A;  3Q83 A;  1JLC B;  3CCZ A;  1ZZN A;  3AXM A;  3MCM A;  1JNR B;  3DRS B;  3O2I A;  3OFH A;  1FEE A;  2XQC A;  3A8E A;  3PFO A;  5KG6 A;  3TP2 A;  2K2P A;  2KB2 A;  3FBB A;  4HHH A;  6FDR A;  1HBN B;  3H98 A;  3U7J A;  4WE1 B;  4ICL B;  2XZD B;  4FPR A;  1TU0 B;  1M1K T;  2GV1 A;  4NLY A;  2WW4 A;  5LMU F;  2HUR A;  1FJ7 A;  4G1Q B;  1F60 B;  1VLY A;  3H7H B;  1RBA A;  4NXM J;  4AL7 A;  3CJS A;  1GH8 A;  2MKJ A;  2BA9 A;  2KRR A;  2DY1 A;  2YKM B;  4DEZ A;  2HHP A;  3GV5 B;  1NZ8 A;  4CLF A;  4M5M A;  3MED B;  5D0H A;  2CQ1 A;  2I5J A;  2J6U A;  4E98 A;  4N7T A;  3VF0 B;  5KFB A;  5CAA A;  4RNH A;  3PYF A;  2VBZ A;  2MY7 A;  3HHL C;  1N34 J;  2D69 A;  3QFH A;  3ETM A;  1SH2 A;  4ZVQ B;  3Q24 A;  3QT5 A;  3ENV A;  1KD1 T;  2RDI A;  3HVT B;  1V5V A;  2ZKT A;  4KKO A;  2GGP B;  5KG5 A;  2DR5 A;  1SH0 A;  1S9F A;  2EXU A;  4K4Y A;  5EN1 A;  2IHR 1;  1ZM3 A;  3AFG A;  1LV5 A;  5CCM A;  3AOD A;  3I4P A;  5JJB A;  1R7I A;  2CPZ A;  2CJX B;  3VGS A;  3KTQ A;  3IM9 A;  5HRO A;  1TMJ A;  3V6J A;  2K06 A;  4RLE A;  3DYA B;  5AXN A;  1GEH A;  4PG4 A;  3G71 S;  5CYM B;  1M5H A;  3T9Z A;  3CDB A;  3J7Z T;  1T9W A;  3H5U A;  3PW2 A;  2KH9 A;  1NJW A;  4ZVP B;  5D78 A;  3MM8 B;  3Q86 A;  5KG7 A;  4JI1 J;  1QAY A;  2LEP A;  2H51 B;  5I42 A;  2XZT B;  2Q6B A;  2RVJ A;  1LFW A;  2F65 A;  1IR2 A;  2J0Q D;  4CO5 A;  4NOH A;  3HF5 A;  3CD5 A;  2R2T A;  2V0N A;  2V69 A;  3DHW C;  1FE4 A;  2KXH A;  2VKR A;  4LFA J;  1MSW D;  2V2Z A;  2UZA A;  3W5X A;  1B99 A;  3TVY A;  5HP1 B;  1FFS B;  1IKV A;  3LA0 A;  3IBW A;  4QOT A;  3POT B;  1S59 A;  4URS A;  1TKX B;  3RYL A;  1JJ4 A;  5C7P A;  1KP6 A;  4USH A;  4QJV A;  5IT0 A;  5AJ3 J;  2P8I A;  2MZQ A;  2MGZ A;  1R8A A;  2VG5 A;  2HMI A;  3MWB A;  4NWB A;  3PV8 A;  1KQS R;  1FES A;  1ICE B;  4DCP B;  3FQL A;  2WCX A;  1GAO A;  4KE5 A;  4LRC A;  2CRL A;  4DPY A;  3DCA A;  1SQE A;  4Y2C A;  1XBW A;  3PO4 A;  3QAE A;  3G6V A;  2NUH A;  4IFV A;  2DHH A;  2JC1 A;  3CJ2 A;  4IR1 A;  4RNM A;  4DSK A;  4KBI A;  4OZ0 A;  3RJM B;  4M5L A;  1BHN A;  4OZ1 A;  2OEJ A;  3WIU A;  3PYD A;  4GKJ F;  5BR8 J;  4FF2 A;  4DR2 F;  2GCF A;  1X8D A;  4NLD A;  2M4M A;  4C3K A;  1VQP S;  4ALZ A;  2CPI A;  1G1X A;  3QID A;  2CFX A;  1LWF B;  4LR8 A;  5FLX U;  3D3B J;  3LP0 B;  3N79 A;  2PEH A;  1FO1 A;  3D0G E;  5IM0 A;  4X65 J;  1HD1 A;  2L9D A;  2CG8 A;  4MKB A;  1OWX A;  3ZZY A;  2MKI A;  1FEH A;  3VAI A;  2GVD B;  3I87 A;  3PHT A;  1NEE A;  3IR5 B;  3NKY A;  1S9G A;  3KHL A;  4CCH A;  4DV7 J;  2LEC A;  1AZS B;  5E7O B;  3RB0 A;  1WEZ A;  3QGH A;  1AA1 B;  4KHP J;  4FBU A;  4CH1 A;  5ETK A;  2QIF A;  2HHS A;  2V50 A;  1XR7 A;  5F8L A;  3NRB A;  1U6Z A;  5H1S V;  4DSL A;  2MEW A;  3TZX A;  2MLX A;  3SSS A;  3UDV A;  4MKY A;  4H54 A;  1BGX T;  1GMV A;  3NAI A;  3D3C J;  1BUX A;  2PFF B;  1BWV A;  1SIZ A;  2XI2 A;  3VAG A;  1FFW B;  1E6V A;  2DHA A;  3C46 A;  2B4O A;  2DNL A;  1SUQ A;  1RU2 A;  4DLG A;  4ZA1 A;  2KM8 C;  1F1B B;  1L3U A;  4G1I A;  3DXS X;  3BQ1 A;  1S6O A;  1Y4Z B;  7FDR A;  3FVY A;  1NHK L;  1T9T A;  1SBR A;  4LF8 J;  4YN3 B;  5T7L B;  2MLY A;  1C0U B;  2IM3 A;  4LF4 F;  1W25 A;  2HFV A;  4U95 A;  2XMU A;  1KWM A;  3NG8 A;  5A8W A;  4ECY A;  4C11 A;  3W8P A;  2Q3P A;  2W25 A;  3NAH A;  3SFG A;  1TL4 A;  2LDY A;  4DFP A;  2C2D A;  3QRQ A;  1WHV A;  5KFE A;  3LAM A;  4XO0 A;  1RJJ A;  3N9U C;  3MPY A;  3BKT A;  1EZZ B;  4LSL B;  3FEZ A;  2GMJ A;  1IKY A;  4F4Y A;  1HI8 A;  2QYC A;  4DI6 A;  3SCI E;  5LT5 A;  1KHV A;  3OQ2 A;  3AA8 A;  3V4M A;  3I82 A;  5H9F J;  3RR7 A;  2DO0 A;  2OUG A;  4WIQ A;  2JX2 A;  1HMV A;  1Q8K A;  3CO9 A;  3FFI A;  3W8G A;  2KO1 A;  4AQY J;  4M5G A;  1EKS A;  1GXU A;  5J2N A;  3PW0 A;  1LK7 A;  5J2P A;  3OXF A;  3QSI A;  1JKH B;  3OL9 A;  4A8W A;  2QL9 B;  3OTO F;  3OR1 A;  3KHG A;  3DLK B;  3M8Z A;  1Y7P A;  3AQP A;  2R7T A;  4WP9 A;  2BYC A;  4OLO A;  4P75 A;  5EWE A;  4I68 A;  2FGO A;  2HQG A;  2OPP B;  3PTW A;  2ZHO A;  4RJV A;  3M8Y A;  3QIP B;  1X9W A;  2Z2Y B;  3VHQ A;  1HHT P;  4IDK A;  2V8H A;  2X51 A;  4OYI A;  1S12 A;  2V2V A;  2VFS A;  1FKO A;  5KT5 A;  2AKW B;  3RG6 A;  1EP4 B;  2IA6 A;  2ASL A;  4AE5 A;  2L41 A;  3R7B B;  3DOL A;  3PNI A;  2F5G A;  4C2M A;  5F9L A;  5I3U A;  2GC8 A;  2WK4 A;  1N32 F;  1Q5Y A;  4ZVF A;  1DQ9 A;  4X62 F;  4DZD A;  4NZ7 A;  2R2S A;  3HHL B;  1RHR B;  3JYT B;  5FLX Y;  1FNX H;  4ECX A;  4GRS A;  2FLO A;  4OQJ A;  4FN5 A;  3ZNJ 1;  4Q5V A;  2BEF A;  1NDK A;  3FCV A;  4ETZ A;  4LIW A;  3KHR A;  1X4F A;  3T1A A;  1TFY A;  4DR5 F;  3A3O B;  2ADC A;  2Q79 A;  4PAB A;  3OL8 A;  2RQK A;  4R0E A;  2VQF J;  1FJG F;  1FT8 A;  3BO3 A;  1XNQ F;  3HVA A;  2BW7 A;  4QIG A;  5B0B A;  4PAA A;  4NEZ A;  3RTV A;  4NA1 A;  1SJ4 P;  5HQ8 A;  3S7R A;  2WHO A;  5C24 B;  4U9R A;  1N8R T;  4M94 A;  2MST A;  2LQ8 A;  3KFW X;  1MU2 B;  1IM6 A;  3PRB A;  2UVW A;  2WAQ D;  2K7J A;  4ZLJ A;  2BRL A;  3N4W A;  1B70 B;  4O44 B;  3GYN A;  1GFW B;  4PYD A;  4K50 A;  2V9K A;  1RT7 A;  1V6H A;  3K5P A;  1C1C A;  2YNI B;  2J7W A;  3A1Y G;  4RU9 A;  2XTJ P;  3BBB A;  3PKM A;  3D1Q A;  5GMK a;  3TVK A;  4DPT A;  2RD5 C;  5IC4 B;  2AJ4 A;  5KFO A;  1UTA A;  1P1L A;  1XEZ A;  3H25 A;  3OR2 B;  3OVS A;  3BGO P;  1TEL A;  4I6W A;  3TI0 A;  1BE4 A;  1ZS6 A;  4ZHR A;  1JLC A;  3DRS A;  2BQ3 A;  4C8Z A;  2OSR A;  1WD6 A;  1OY9 A;  5LOQ A;  2IJF A;  3RZA A;  1ZAW A;  1WOO A;  2JFK A;  4ENO A;  2CKW A;  4WU3 A;  4DR7 F;  2MY8 A;  3MPW A;  4IOB A;  4RW4 B;  3NGU A;  3T3F A;  2NRE A;  1GK8 A;  2WBM A;  3VWS A;  4WE1 A;  1NM2 A;  4YDX A;  2LEB A;  2VAS A;  1Z1Z A;  1RA7 A;  3R1H A;  1RP5 A;  4GMK A;  2KU7 A;  4FYW B;  4G1Q A;  4HH1 A;  2BXJ A;  2NXE A;  1NH8 A;  3GZ7 A;  4KO0 B;  2MLZ A;  2FVR A;  7AT1 B;  3FBF A;  3DKD A;  3QPI A;  3P45 B;  5FII A;  2HHH F;  4B3M J;  3MAQ A;  3DHX A;  2YKM A;  2NQP A;  2LKZ A;  1XWL A;  2QYG A;  3IBC B;  2QN6 B;  3HFZ B;  3MED A;  4UT4 A;  2NPI A;  2F8M A;  1NJZ A;  2LEA A;  3WIV A;  1V3Z A;  2XG8 A;  1F2G A;  3NGT A;  4F04 B;  2ABY A;  3QNW B;  2ZC4 A;  3M8W A;  4KJI A;  3GIL A;  4F4A A;  3HVT A;  3H2V E;  2Y1I A;  1WEL A;  1W7W A;  4H4K A;  4IFY B;  1Z4U A;  2VZ9 A;  1FVS A;  1UA1 A;  1H3D A;  4IUF A;  1RAH B;  2DR9 A;  3PIO Q;  2I1R A;  1DTT B;  3A8I A;  4RR5 A;  5FD1 A;  3AOC A;  2DVI A;  1VC0 A;  1CJK B;  4PXE A;  4GO5 X;  3DYA A;  3H5X A;  2VDH A;  1P27 B;  2OML A;  3CJ4 A;  4NZ6 A;  4J9P A;  1RHK B;  3EGV A;  4DUZ J;  2IVF B;  5CYM A;  3B8H A;  3ZNU A;  3ZTO A;  2DH7 A;  2EFQ A;  2HFN A;  2CQ3 A;  4LR9 A;  1QAJ A;  1QTN B;  4ECW A;  1O6X A;  3B54 A;  3ZZU A;  2MMY A;  1EJ7 L;  3AD8 C;  2BM1 A;  2A10 A;  4CQ1 A;  2I9S A;  4JUZ A;  2FLL A;  1A7G E;  3EE3 A;  3PW5 A;  2C3O A;  1S9E B;  5D4O A;  5LM7 E;  3NLC A;  1WSV A;  1G6B A;  4B3O B;  1UPP A;  2YNF B;  1RKJ A;  2XYH B;  1OIA A;  1RAG B;  2UUA F;  5AE1 A;  2QA4 S;  5A8R B;  2YX7 A;  5KFH A;  2G4B A;  5A8K B;  2IBK A;  4P73 A;  3BSA A;  2IDE A;  2I2Y A;  5F3T A;  2N7Y A;  2EI5 A;  1VBY A;  3DRR B;  5HP1 A;  3X1L B;  1I51 B;  4ZDN A;  1X9S A;  2W2Q P;  3POT A;  5L8R C;  4ZVE A;  4C4W A;  4DFK A;  2DNK A;  1TKX A;  2BUN A;  5KOX A;  4NLV A;  2IYG A;  3GG1 A;  1TL3 B;  3DU6 A;  1N33 F;  3UNG C;  4IG3 B;  1NJI T;  2Z58 B;  4C8O A;  2QE5 A;  1SL2 A;  3TX0 A;  2CQG A;  3VAL A;  4A47 A;  5CA5 A;  5CHC B;  4B3S F;  2C2O B;  3B4M A;  1RAA B;  2RNE A;  4AT1 B;  3J7A 1;  2C2R A;  2DGU A;  4M5H A;  4DQP A;  2O1P A;  3IGV A;  2YWG A;  3MD3 A;  2XS7 A;  1NB2 A;  2X1B A;  3GFZ A;  3FDS A;  2POK A;  3SXL A;  1MML A;  3CCQ S;  4MIA A;  2ZBQ A;  2QFJ A;  2MZS A;  2J9E A;  2W7P A;  2N3O A;  1AFJ A;  2KI2 A;  5GAE U;  4CH0 S;  3BPD A;  4AFF A;  1S1U B;  5GAE I;  3T5H A;  4GKK J;  3SDE A;  1LWF A;  2MQQ A;  3NWR A;  4X4P A;  3LP0 A;  3SFU A;  2QSF A;  1QM9 A;  2E5G A;  4I1T A;  2V34 A;  2RDD A;  3EVM A;  3JB9 k;  2NUU G;  3ILL A;  3T9N A;  4RW9 B;  2GVD A;  3QWP A;  3RBE A;  1HQU B;  3JQJ A;  1QSY A;  4C97 A;  1XMB A;  2VPY B;  2Y1L B;  3AXK A;  4ANE A;  1Y9O A;  1FWK A;  1RAF B;  3DLG A;  1RU1 A;  2IRX A;  2H5I B;  1UJ6 A;  3H59 A;  2XY5 A;  1YSJ A;  1Q8I A;  1NKE A;  4O0I A;  3RB3 A;  2QL5 B;  2YWK A;  1N36 F;  2WRM A;  4QW9 A;  2DGT A;  1VYA A;  2Z4P A;  4K4S A;  5DM6 Q;  2HFZ A;  3W2V B;  4KPC A;  3MR6 A;  1B3T A;  4W4M A;  2KKH A;  3CDU A;  1UCN A;  4PXC A;  1BQX A;  4LT6 A;  2HK3 A;  4FDF A;  1WOR A;  1Q53 A;  5T7L A;  3V2U C;  1DBD A;  5D8H B;  4N76 A;  2KXF A;  3TAN A;  4MTP A;  1ZET A;  3BGL A;  3CDA A;  4DX7 A;  4WP3 A;  4CP5 A;  1FI4 A;  4R25 A;  5KTQ A;  4CLP A;  2CVE A;  2HPU A;  4LSL A;  2HZC A;  2EPI A;  3RW7 A;  3I0S B;  4WBF A;  1S1V B;  3KLE B;  3VV2 B;  1MWQ A;  2ZH3 A;  2E29 A;  3TA0 A;  3N0V A;  1KFS A;  1X4A A;  3IBF B;  4RBU A;  5HBM A;  2XI3 A;  3H90 A;  1PCA A;  4CI0 B;  4M63 A;  3JSY A;  2ZJR Q;  2LA4 A;  1QSL A;  2YKA A;  1JKH A;  4ZCI A;  4Q0B B;  1HHQ A;  1GMU A;  1HNX F;  2ZH5 A;  4IO9 Q;  3EVO A;  5B7W A;  3TAP A;  3DLK A;  4UZC A;  1SL1 A;  2YWF A;  2V63 A;  3E3X A;  2O66 A;  5D0R A;  1JQG A;  3L4B C;  2OPP A;  4DV2 J;  5JMN A;  3QIP A;  4EGL A;  1TAU A;  5KFG A;  3BN4 A;  4LF9 J;  3S1T A;  2VG7 B;  4YEA A;  1XN9 A;  1FRM A;  2XMW A;  1KRP A;  1SJ1 A;  2ROP A;  3AD9 C;  1REG X;  1QLN A;  3QJP A;  2NXN A;  4ZOS A;  1EP4 A;  2H5E A;  4RKU C;  2JHE A;  4OZN A;  3HZG A;  3OVA A;  3HHE A;  1T9Y A;  2EBG A;  2XMJ A;  4F3M A;  5DG8 A;  4TVA B;  4DV0 F;  3HHL A;  2IVM A;  1T02 A;  2RHQ B;  2XY7 A;  3JYT A;  2PO4 A;  3NNC A;  4UST A;  1WG5 A;  1HNZ J;  2YY3 A;  2OHD A;  3C14 B;  2XGP A;  3OXG A;  2F7V A;  4RZR A;  2U2F A;  2GHW A;  1HBM B;  1VQN S;  1BD6 A;  4USK A;  3CC7 S;  3T6B A;  3ZTR A;  2HIY A;  1RAD B;  2DGS A;  3M8P B;  1V9O A;  2W2P P;  4WFB Q;  1T9X A;  4FYX B;  3IGN A;  4MAK A;  1X4C A;  2VF3 A;  3LTO A;  5F8J A;  4U6P A;  1HHS A;  5C24 A;  1MU2 A;  1HR0 J;  3O8W A;  4CNY A;  2DGO A;  2ZM6 F;  1UEU A;  4DUY J;  1R8H A;  2R8I A;  4DL5 A;  2WBR A;  2ADB A;  1OQ3 A;  1L5U A;  3TWZ A;  1FKA F;  2M70 A;  3CGI A;  2OIH A;  4J5O A;  2PN6 A;  3HT0 A;  4B9V A;  1A9N B;  5ETP A;  2UUB J;  2YNI A;  4V19 X;  4ECS A;  2FDN A;  3R5C A;  3N5B A;  3MUM P;  1CS4 B;  4KTQ A;  3FCW A;  3L95 X;  2F4V F;  2AP6 A;  3UNY A;  3NS7 B;  4R8U B;  3Q8S B;  1Q79 A;  2LYV A;  3BDE A;  3P8B B;  2MZR A;  3MMB B;  2CQ2 A;  2XLI A;  1RKI A;  4FXW A;  3VAM A;  2VHG A;  3KLH B;  1RDR A;  1WDD A;  4PPZ A;  4IRD A;  2IIH A;  4LF6 F;  1S0V A;  1HNI B;  3SCK E;  1NK5 A;  4R0J A;  2YKN B;  2ZBP A;  1CLF A;  1RCO B;  3CJ5 A;  1I94 J;  4WYW A;  3ZZP A;  3Q89 A;  5H9E K;  5F8I A;  3W9J A;  1WTF A;  4O3N A;  4ES2 A;  5D4N A;  2ALY B;  2UXD J;  3TAM B;  2XBP A;  1H73 A;  5LJ3 Y;  1LWC B;  3G2X A;  1V3S A;  2Y8Y A;  4JI4 F;  4H4O B;  4MK9 A;  2GA7 A;  4ZLL A;  4KO0 A;  4NLQ A;  5L46 A;  2J0W A;  2CQI A;  2QA4 G;  4XDC A;  4DU8 A;  2KRB A;  2Y3Y A;  4LFC F;  2C2N A;  5KFP A;  2PE8 A;  3MTJ A;  2HWI A;  2JVO A;  2LXF A;  4WXO A;  3MM6 B;  4MKA A;  4O3S A;  3IS9 B;  2H4Y B;  3PR4 A;  4LF4 J;  4I2Q B;  2UXC F;  3RW6 A;  3RB6 A;  1LW2 B;  2HNZ A;  3FEY B;  3PFE A;  1F3F A;  4OHW A;  4J7C A;  2RKI A;  4IFY A;  4YQW A;  1TK8 A;  1WEY A;  1FF2 A;  2NZC A;  4EO6 A;  5F8N A;  1DTT A;  5KT2 A;  1AT1 B;  3CJ0 A;  3GSI A;  4A8Y A;  3VAK A;  3UD3 P;  2LMI A;  1CJK A;  2B51 A;  4A8O A;  5BYQ A;  4QWB A;  3EZU A;  3S6E A;  3VVT A;  2H3E B;  2HND A;  2B5J B;  2VFV A;  2DBB A;  3MPU B;  3G8T A;  3BRE A;  4DV6 J;  4DG1 B;  2DPI A;  3W61 A;  2RML A;  4WTY A;  4OYZ A;  3IRX A;  3UDL A;  1UFW A;  2EVZ A;  2BAC A;  2R8K A;  2H65 B;  3HKZ D;  4NE9 C;  4P2F A;  1S9E A;  5C2G A;  4M95 A;  4B3O A;  4JI3 F;  3FBC A;  2YNF A;  3LWM A;  1UJ5 A;  4QPT A;  3QT6 A;  4QIW D;  4JB8 B;  1HD0 A;  2B4P A;  1KVI A;  3MOJ B;  3Q2T C;  1RWP B;  4DDF A;  2BVZ A;  5A8K A;  4OI6 A;  3QRR A;  2KFN A;  1B0V A;  3HO1 A;  2MQN A;  3DRR A;  1Q5V A;  1S0O A;  4J9U E;  4Y6I A;  1SKR A;  1R8C A;  1N88 A;  1UFL A;  1WC0 A;  1MN9 A;  4NXM F;  3THV A;  1U8W A;  1DY3 A;  2QRR A;  2GJF A;  1TL3 A;  1FJE B;  2DRB A;  2XYG B;  4HDG A;  1RAO A;  2QGF B;  4IG3 A;  5D3G B;  4KHM A;  1CVJ A;  4X4S A;  1Y3J A;  1RAJ A;  3M6X A;  5AXM A;  4X64 J;  1K1S A;  5KG0 A;  5CYQ A;  1FFG B;  2Z30 B;  1N34 F;  3BB5 A;  3EZO A;  1ZOT A;  1CJT B;  1TKZ B;  5HMW A;  4B17 A;  2ZBI A;  4DV5 J;  5HI7 A;  1NBE B;  3D6M B;  1FRH A;  2YX4 A;  3BO4 A;  3KDO A;  2XMA A;  4YY3 J;  2W7O A;  2EFO A;  3MAH A;  3HVR A;  4N8O A;  4YDD B;  1RWO B;  2VQE F;  3D28 A;  1UZD A;  4FKX A;  4LRF A;  3F0N A;  3LP1 B;  2BKP A;  1VQ6 S;  1YJU A;  3A8K A;  2XNQ A;  1XMO J;  1TVR B;  2GQQ A;  3EDQ B;  2EW9 A;  3NCR A;  3MOZ A;  3TJA A;  1RTH B;  4CDI A;  3FRY A;  1HBO B;  4RW9 A;  4ED4 A;  4FYV B;  3JSM B;  2W8K A;  2ZOG A;  1HQU A;  1JNZ B;  4TXS A;  2DGX A;  4JI1 F;  2DR6 A;  4RW6 A;  4CLT A;  3CO0 P;  2VA2 A;  2HBR B;  4NYP A;  5JUM A;  1T3O A;  3G6X A;  3PJX A;  3MMA A;  3R2C J;  2A6M A;  4A8F A;  2O5D A;  1CC7 A;  4Y0F A;  1Q0N A;  3VAF A;  3JTO A;  2LLZ A;  2HS0 A;  1HQE B;  3HD1 A;  4BWJ A;  4FXV A;  1CJU B;  2NXJ A;  4A8S A;  1NU4 A;  4C3M A;  2WVF A;  1M5O C;  4F02 A;  2Z2Z A;  5CH7 B;  4LFA F;  1BMQ B;  1S7H A;  1NCL A;  1FTR A;  2ZDO A;  1R0C B;  4PWW A;  4X84 A;  1T9V A;  2AYM A;  1VRT B;  1FHT A;  4WFZ A;  4QR1 A;  5L39 A;  3W2V A;  4ZPT R;  2RF2 B;  2CPX A;  2O67 A;  1X5T A;  2GVZ B;  3MI7 X;  2LU1 A;  3V6D B;  4DR1 J;  3CC2 S;  5AJ3 F;  3DLL Q;  4YME A;  1ZH5 A;  3H2L A;  2CYY A;  2J8A A;  3OXL A;  2CJ9 A;  1MLA A;  4HR2 A;  4ZIV A;  1F9H A;  1YWX A;  2XMT A;  2GO9 A;  4H4M B;  4ZCL A;  1F6T A;  5HAT A;  2ZWP A;  3CED A;  3I0S A;  3P96 A;  1F9E B;  2IPO B;  2D9O A;  2QJ3 A;  1S1V A;  3R97 A;  3KLE A;  2RE1 A;  1M1H A;  1QUV A;  1KVK A;  3UR3 C;  5IOL A;  5J1E A;  1SKS A;  1FWL A;  1RAB B;  1LKZ A;  1EET B;  2KJW A;  2WVE A;  3NGR A;  1NO8 A;  2R2U A;  4O0N A;  5BR8 F;  3RGI A;  4J37 A;  2BM0 A;  2E7X A;  1NND A;  4RBV A;  3TO8 A;  3NGK A;  4DV1 J;  3QGG A;  4DQQ A;  2QV6 A;  2J0S D;  4C8Y A;  2OAU A;  2GQ2 A;  2ACY A;  2KL8 A;  3D54 A;  4Q0B A;  4ZIT A;  5CD4 A;  1D09 B;  1H2U X;  2VON A;  1SJ3 P;  3FZB A;  5M2P A;  1GNK A;  2XSJ B;  4JI5 J;  1M5P C;  2HHU A;  2X7I A;  1JLG A;  4EUV A;  4X65 F;  3CCW A;  1U0H B;  3U27 A;  2MQO A;  4DFJ A;  2DIS A;  5F8H A;  4EYI B;  3HSG A;  4DV7 F;  5K14 B;  5D15 A;  4KHP F;  3ZZR A;  4J9Q A;  2CA9 A;  2MZT A;  4CO2 A;  2HRU A;  4ECV A;  3CJK A;  1T0T V;  1VQ8 S;  5KFW A;  4ZPV R;  3SI8 A;  2DIV A;  4JI2 J;  2BJE A;  2C3U A;  4GVL A;  2OSQ A;  3KOA A;  3J81 U;  2HVH A;  1PO6 A;  5HK4 A;  4NLT A;  1VHI A;  3GG0 A;  5IV3 A;  4C3L A;  2CZV C;  4L76 A;  1D8Y A;  3LAN A;  1APS A;  1UVI A;  2BRK A;  4LBI A;  1E6Y B;  2EBE A;  2FJX A;  5K8M A;  3IR6 B;  2FQQ B;  2BE2 B;  2YWW A;  5LSR A;  3C14 A;  2J5A A;  3UN5 A;  1S79 A;  1HBM A;  2DHS A;  2M88 A;  4ATN A;  1OYE A;  2OPQ B;  4LF8 F;  4B9T A;  3NY0 A;  4J9S A;  4F25 A;  1IN0 A;  1I5O B;  3J7Y U;  1F3V A;  4YP3 A;  4QBU A;  2CWK A;  1R6V A;  3BKU A;  3B78 A;  3J7Y I;  3MM5 B;  2Z2M A;  3AJ1 A;  2I38 A;  5CZX A;  1X4B A;  1RYR A;  2BW2 A;  3ZZT A;  4FF1 A;  5ETR A;  2F40 A;  4EU0 A;  4RUH A;  1IVZ A;  3DLJ A;  1RTI B;  2WB1 D;  2V4J B;  4B3S J;  4PYA A;  2RH3 A;  3PW7 A;  1PYT A;  2RSQ A;  3THT A;  3IWN C;  2EKY A;  1JXE A;  1KC8 T;  1JLQ B;  3C8Y A;  3MR2 A;  2XGQ A;  4FNH A;  2R8H A;  4AQY F;  3SYZ A;  1S6P A;  4EEY A;  2V68 A;  3NMA A;  4KFB B;  1SB6 A;  2FYX A;  4P9S A;  2FZG B;  1GMW D;  3N28 A;  1EAR A;  1F5B A;  3KJV B;  4FVM A;  4R8U A;  4DJB A;  3OLA A;  2XEX A;  1LWE B;  3T5K A;  5DDR C;  3KLH A;  3M9N B;  1RE1 B;  1YIT S;  3R5D A;  2HWT A;  2CG4 A;  3OSN A;  2ATL A;  2BDP A;  1HNI A;  5B0E A;  3MCN A;  5IFM A;  2X1F A;  4P10 A;  2H5J B;  2YKN A;  4Y00 A;  3MUV P;  5E5N A;  3A8J A;  1Y0H A;  4DU7 A;  4NI2 B;  1TL1 B;  2QFI A;  4HDH A;  4Q43 A;  4QWE A;  1U1N A;  5F0U A;  3BV8 A;  3O6Q A;  4NLX A;  5B0F A;  2KHD A;  3TAM A;  4BHQ A;  3ILJ A;  4G3I A;  2Q6C A;  4Y65 A;  4UUW A;  3FMB A;  3G96 A;  2BQU A;  4H4O A;  3GSD A;  2U1A A;  4ZVU B;  3MCS A;  4MH8 A;  3CCM S;  3BSC A;  4NRU A;  5ETV A;  2CQ0 A;  2VQF F;  3V4I B;  1SV5 B;  1U1K A;  3AT1 B;  2IMW P;  1R89 A;  3TNV A;  4Z37 A;  3UPF A;  4CYU B;  2MQP A;  4EI2 A;  4ZVH A;  3MM6 A;  3UW1 A;  3ITH B;  3I56 S;  4UOF A;  2OO4 A;  2R9L A;  1ZAX A;  3VCD A;  3J81 Y;  2QMW A;  1LW2 A;  3GR0 A;  2A0F B;  2MQL A;  4PWD B;  2HVZ A;  4OYP A;  5DRK A;  5KFJ A;  1ITP A;  1XMQ J;  1VQO S;  4TU9 A;  4A8Q A;  1L3V A;  2CAD A;  4HHU A;  4UUX A;  2PSZ A;  3M05 A;  4FBT A;  4QPX A;  4LBH A;  3UQS A;  5DDO C;  1D8Z A;  1A6L A;  3CCJ S;  3MM7 B;  1MMN A;  5GAG U;  1RWN B;  2YH0 A;  5GAG I;  4K59 A;  3LP2 A;  4WP8 A;  5U47 A;  5DQH A;  4CM0 A;  4WII A;  1FRK A;  3QZ8 A;  1PJ7 A;  3J7A N;  2JWN A;  3Q8V A;  2KZZ A;  3GV7 B;  1QUP A;  2B5J A;  2MKS A;  2CDQ A;  2SXL A;  4OV6 A;  1BC6 A;  2JNJ A;  3ILI A;  4Y28 C;  4F0M A;  4DG1 A;  2AGP A;  3HHN B;  4NAS A;  3CC4 S;  2BJ8 A;  2PD1 A;  4IRK A;  4YR2 A;  1PJ6 A;  3WBZ A;  2FHK A;  2B7B B;  1X4E A;  4HKQ A;  1UWA A;  4PG8 A;  3KUH A;  1TK5 A;  1RT3 B;  2XS5 A;  4H4K C;  1R6Y A;  1HI1 A;  3G9C A;  3HSD A;  1N5V A;  4C0B A;  3BR8 A;  3MEC B;  4Q2L A;  1DRZ A;  2NXC A;  5E3P A;  2NS1 B;  2GML A;  3CUL A;  2AMC B;  2AYB A;  1X60 A;  2CQB A;  1I6J A;  1RWU A;  2HS3 A;  4LFB J;  1UJ4 A;  2KXN B;  1U1R A;  1KTQ A;  4J90 A;  2XLK A;  4KQZ A;  5IQ6 A;  4ZMM A;  1ZZF A;  3BH7 B;  2GIR A;  2IBO A;  3NCP A;  5E2Q A;  1VIO A;  4UOG A;  4X2B A;  5ETS A;  1AUS L;  4DCJ B;  1AFI A;  1PAE X;  3CUN A;  4NCG B;  3AQO A;  1KQK A;  5D3G A;  2KT5 A;  4NLS A;  2OLW A;  5HL7 Q;  1UZH A;  3IAS 9;  5EX3 A;  1DHM A;  2HEK A;  4D3G A;  4A48 A;  3GLJ A;  2ZVI A;  1CJT A;  1TKZ A;  2DHX A;  2CJA A;  3NGS A;  3W60 A;  2C2Z B;  3AD7 C;  3AJD A;  3TZZ A;  5J1P A;  2DR8 A;  5J2M B;  3G6E S;  3KNG A;  3V5R A;  1UKU A;  2PT0 A;  2DKO B;  1HPZ B;  5BYR A;  3M9O B;  2DIT A;  3WZ0 A;  1BXN A;  5KFD A;  2AJQ A;  3LP1 A;  5E3A A;  2BOP A;  2MYF A;  1M5K C;  3J80 U;  2ZZT A;  3SEO A;  1UVL A;  1HNV B;  2PDA A;  1WTB A;  2BAN B;  4QQB A;  3Q8Y A;  1RTH A;  2HLU A;  1QAI A;  1VK8 A;  2E44 A;  2GAH C;  3JSM A;  1BWE A;  4BWM A;  1NK7 A;  2ZC3 A;  3OHB A;  2DH9 A;  4RL1 A;  4XTT A;  4ECU A;  3KG1 A;  4K0K J;  4M5D B;  2HQC A;  5E33 A;  4HL9 A;  4DSI A;  3VZH A;  2IJN A;  3TA1 A;  4WKY A;  1AB8 A;  1KS2 A;  4DQR A;  3MR5 A;  3A4T A;  4NPO A;  1IBL J;  3GTY X;  3L7O A;  4FVC A;  1BY9 A;  1CJU A;  3B6B A;  3C19 A;  1KOH A;  1VQY A;  4LF6 J;  3TUJ C;  3D4J A;  2LQ5 A;  1U45 A;  2RHS B;  1M90 T;  5KFV A;  3ZZ0 A;  2H4W B;  2Y1J A;  1H2V Z;  3I0R B;  2RF2 A;  4B3R J;  2M7S A;  4DZ6 A;  3GON A;  2YWE A;  1WEX A;  2GVZ A;  5FDL B;  1KNZ A;  4CLK A;  3DDI A;  2AIR B;  2JOQ A;  4B02 A;  4KPY A;  2R7X A;  2HVD A;  4OYX A;  1ZBT A;  1PIL A;  3ET6 B;  1NZA A;  1U1Q A;  4KR0 B;  4H4M A;  2VG6 B;  2DXF A;  3BYP A;  4ZPC A;  4OX6 A;  2HGL A;  2ACM A;  2UVV A;  1RT6 A;  1UVM A;  2LQ9 A;  3BGR B;  1N48 A;  3WX8 A;  1Q8L A;  2JLF A;  3CWJ A;  2FD2 A;  3JXO A;  1EET A;  2AT1 B;  3ISZ A;  5HVH A;  1EB0 A;  4KY3 A;  2W2M P;  3CCU S;  2M2B A;  4EFA C;  3DRX A;  3K59 A;  3LAK A;  4GKK F;  3H4D A;  3RR8 A;  3HM9 A;  2JEF A;  3E01 B;  1U09 A;  4FYD A;  3KLG B;  2XSJ A;  4KSE B;  2LA6 A;  1U0H A;  1U0S A;  3D1H A;  2FHM A;  1SC4 B;  3KLF B;  2V4R A;  2GO8 A;  3F73 A;  3FZ2 A;  5K14 A;  3V6K A;  3CD6 S;  4ED7 A;  4USU A;  5DZ6 A;  3T1Y F;  2NCK L;  1ZM2 A;  4DS4 A;  3FUY A;  2HBQ B;  3FEX B;  4MFB B;  4WKR A;  1WAC A;  4RNF A;  3Q0A A;  3KDN A;  4A4J A;  4DX8 H;  5ETO A;  3GJQ B;  1U49 A;  4WFN Q;  4J9N A;  2WSF C;  2HHX A;  3GIK A;  1E6Y A;  2FVQ A;  4P71 A;  2FJB B;  3J80 Y;  3DNC A;  2K3I A;  1S49 A;  1RLC L;  4IH7 A;  3K5L A;  1RT4 B;  3PEJ A;  2J8S A;  3C16 B;  4JI3 J;  4PQU B;  2BE2 A;  1C0T B;  2DRA A;  2RUS A;  3TQ1 A;  1L3K A;  2W4C A;  4Y2M A;  4P52 A;  3L3C A;  2IM1 A;  4TNO A;  2HFO A;  3TEH B;  3L09 A;  2OPQ A;  5BYS A;  1VR6 A;  4KGM A;  1U24 A;  1OQ6 A;  1RLD A;  1HIY A;  3M2U B;  1SKW A;  3GJR B;  3MM5 A;  1R0A B;  5THW A;  3QFW A;  4BLG A;  2I8E A;  2ZH1 A;  3M4X A;  3GU0 A;  1CPZ A;  4IO1 A;  4Y34 A;  3HSZ A;  4J9R A;  2ZZM A;  1DQ8 A;  3ICL A;  4FS1 A;  3WQP A;  2VC1 A;  9ATC B;  4NCA A;  4CZC A;  4RW8 B;  1SQF A;  5DLF A;  1RTI A;  1IKW B;  3HP6 A;  3FQK A;  2V4J A;  4LF7 J;  2C2E A;  4LR7 A;  1JXL A;  4AXJ A;  4E8U A;  2KG1 A;  1JLQ A;  4ECZ A;  4NXN J;  3I6P A;  4NLG A;  4KH1 B;  2GJI A;  2VJV A;  3D0I E;  3U1M A;  2Q1L A;  5KFZ A;  4E0D A;  3OL6 A;  4F2S A;  4PUO A;  3VAH A;  2VQE J;  2HSE B;  3KJV A;  2KT3 A;  5DDP C;  2WOM B;  3KHH A;  1YTY A;  2UP1 A;  1FX2 A;  3T1H J;  3GJS B;  3OTE A;  2R7W A;  5A76 A;  2J76 E;  5KFF A;  1LWE A;  2XMV A;  3SSQ A;  4KRW A;  3JAM U;  2BJ1 A;  4DV2 F;  2QLW A;  1PIE A;  5G4D A;  4WFX A;  4F3Q A;  4LF9 F;  1VIS A;  4PR6 A;  4CT9 A;  1XQI A;  2KYX A;  2KFY A;  2IJR A;  1RAE B;  2VL1 A;  1T95 A;  1X4H A;  4A46 A;  4NI2 A;  3M8Q B;  1TL1 A;  4O4R A;  4DF8 A;  1FVQ A;  2WVD A;  1S6Q B;  2F8H A;  1NPK A;  4P74 A;  3FJ2 A;  4X4U A;  1DTQ B;  3HLU A;  1TR0 A;  1OO0 B;  1UVN A;  4YUD A;  4IG0 A;  2NLW A;  1JLE B;  4ES3 A;  1HNZ F;  2CJY B;  4LMZ A;  1RWW B;  1UEK A;  1YBU A;  5DS7 A;  2NR0 A;  3HUL A;  2EFN A;  5AXL A;  1SV5 A;  3UDE A;  4YR0 A;  2PII A;  4Q44 A;  5KFX A;  4XDD A;  4CYU A;  3CPW R;  2AHO B;  2DNG A;  5CYJ A;  3PKY A;  3ITH A;  3R27 A;  3PYG A;  3HJV A;  1FKP A;  1YZ7 A;  5F0W A;  1HR0 F;  1VQL S;  1TZ0 A;  4DSF A;  3PG9 A;  4PWD A;  4DUY F;  1YRT A;  3MAA A;  1LXN A;  1B64 A;  1NLK L;  2PMW A;  3GP9 A;  1X5S A;  4WZQ A;  2AYG A;  4EWT A;  4ZJQ A;  3GIJ A;  4L3N A;  1JWW A;  3MM7 A;  1QSS A;  1KSP A;  4OZ3 A;  1W2B R;  2QO3 A;  1TFW A;  3K8V A;  3M6U A;  1BLU A;  2UUB F;  3MEG B;  4ED8 A;  2HVE A;  4DPO A;  4DQS A;  3TR5 A;  1LFP A;  3I32 A;  1U47 A;  2QG9 B;  3EX7 B;  5MLC V;  3N01 A;  2RB7 A;  4EBC A;  1D9A A;  1N5Y B;  3GIM A;  1RT1 A;  5L1K A;  4X4O A;  2GX8 A;  4I4B A;  2W24 A;  1KR4 A;  4ZN3 A;  3TAQ A;  1CUL B;  2DCU B;  5J1N A;  4QIE A;  1CQN A;  1JJC B;  1WC1 A;  1RT3 A;  1IBM J;  4F0K A;  3CJQ A;  3NOC A;  3M32 B;  1I94 F;  5CQG A;  3G87 A;  3MEC A;  5C5J A;  1GT8 A;  5KFC A;  4F36 A;  5IQQ A;  1CBK A;  4R5P A;  3BM7 A;  2HNY A;  2UXD F;  4OJ3 A;  2D3U A;  4FS2 A;  2W1B A;  1KON A;  1S10 A;  3SQO P;  3K17 A;  1N5Q A;  3QO9 B;  3W9I A;  1P9Y A;  1FXD A;  2ZKU A;  3MUR P;  2VH7 A;  1NPR A;  4I67 A;  4OI4 A;  3A3N B;  1HW8 A;  4N77 A;  1D3W A;  3GIR A;  2W9C B;  3TQE A;  1CQM A;  2MQM A;  4JOU A;  3JAM Y;  3PIP Q;  2CNL B;  1Q7L B;  4NCG A;  2YXL A;  2HZV A;  4OJG A;  2Y0S D;  3JTP A;  2E9R X;  2PI4 A;  4USJ C;  4I64 A;  4O3Q A;  2EWH A;  2PA8 D;  2FVC A;  2YKP A;  2HHW A;  1U1M A;  2I0X A;  1U25 A;  3RRG A;  1TTH B;  1UWB A;  2JDJ A;  3DXB A;  3RRH A;  1IKX B;  4A8X A;  4L6V 3;  3D6F B;  1X4D A;  4OFZ A;  5JVG Q;  1IJF B;  5J2M A;  4DXL A;  2N4D A;  2VB6 A;  4NLO A;  2L08 A;  3HZE A;  3K58 A;  4KC5 A;  2CJB A;  1FA0 A;  2FHO B;  3UCU P;  1F0X A;  3OBI A;  4J9O A;  5DET A;  4DSJ A;  1X5O A;  2UXB J;  1Z2L A;  1HNV A;  5K8O A;  2AW0 A;  3ZC4 A;  4HT5 A;  4OI0 A;  4IKA A;  1NSK L;  5HRO B;  4IOA Q;  4DS5 A;  4OX9 J;  1FXL A;  3NCQ A;  4DV6 F;  3DFE A;  3S8S A;  2BX6 A;  1U8S A;  1LW0 B;  5F9N A;  3BZQ A;  3DOK A;  4ZJO A;  1Q7Y T;  4IYQ A;  4CLY A;  2GZO A;  4M5D A;  2G2Y A;  2VIC A;  1S1T B;  3CCL S;  2UUC J;  3CJ3 A;  2B3T B;  3F41 A;  4DMZ A;  2DR7 A;  3TUZ C;  5KG1 A;  4OL8 A;  1G7C B;  4L73 A;  2DHG A;  1S1X B;  1S76 D;  1GTE A;  4WPA A;  4DPW A;  2LXI A;  4DX6 A;  3D1O A;  1CJV A;  1NRK A;  2DEJ A;  3KK2 B;  3G8Q A;  4QCL A;  4LSN B;  4TY8 B;  5KFY A;  1HWL A;  3DI6 B;  6FD1 A;  1HFE L;  1YQH A;  1C1B B;  1JLF A;  4ZPW R;  3F44 A;  3C66 A;  3LW5 C;  3THP A;  1KLM B;  4ZIW A;  1YJ9 S;  4X4Q A;  3H0P A;  1O51 A;  3R1L A;  4I0W A;  1HI0 P;  1YLX A;  1FDB A;  3ET6 A;  4ZP9 A;  5F8G A;  4X64 F;  3SV4 A;  1HWJ A;  2VJU A;  1X4G A;  2CQP A;  2VG6 A;  2KVQ E;  2IRU A;  2MGZ B;  2CNN B;  3I5C A;  3BKF A;  2VG5 B;  1NUE A;  4DR6 F;  3CSK A;  2AD9 A;  1HBU B;  3HVW A;  2F9J A;  4WYL A;  3W2W A;  4DV5 F;  1FRL A;  3EJM A;  1NH7 A;  5HMY A;  1URN A;  2MKC A;  4ZLP A;  4DSE A;  2Y9H A;  3GPA A;  4YY3 F;  1RGV A;  3K5O A;  1RWK B;  1W26 A;  4RU2 A;  1SJR A;  1N5T A;  2D3Z A;  4P7V A;  4ZKA A;  4PEO A;  2ZZN A;  3LOU A;  1NDP A;  3NWG A;  3BR9 A;  4XIU A;  2ZUA A;  5ADZ A;  4IFV B;  1VRU A;  1K47 A;  4BBY A;  2JEG A;  4FZV A;  1SJQ A;  2IFX A;  4QWA A;  2AJF E;  3I96 A;  2Z2L A;  2DNY A;  1XMO F;  3BQ2 A;  1UAW A;  3E01 A;  2IY5 B;  3K5M A;  3D6H B;  4OV1 A;  1M5V C;  4B3T J;  2W9B A;  2QC3 A;  4CLS A;  4EBD A;  1OMS A;  3D68 A;  2DNO A;  1L3T A;  4DF4 A;  3KLF A;  2AU0 A;  1YJR A;  8ATC B;  1TQL A;  3BEG B;  4O4G B;  2P9E A;  5LSO A;  4D3H A;  2OD4 A;  1AW0 A;  1AYE A;  4CO3 A;  4WTO B;  4DL7 A;  1URR A;  1XIQ A;  4L74 A;  4MFB A;  2V94 A;  3M2R B;  3PRV A;  1H7W A;  3PZP A;  3MGJ A;  3L7U A;  4F4X A;  2IAJ B;  3VGT A;  3EZ5 A;  5ETL A;  4U7U K;  1S99 A;  2ZH6 A;  3C16 A;  4E2F B;  3IWX A;  4PQU A;  1C0T A;  4YR3 A;  4M5N A;  1HBN A;  4I56 A;  3HFV A;  2V6A A;  1SUQ B;  4ICL A;  2VKZ G;  4CLZ A;  2V8V A;  1YBA A;  2P6T A;  2GMH A;  2BE9 B;  4DR1 F;  2FJE B;  2VU5 A;  3M2U A;  2HIQ A;  1R0A A;  3GWC A;  2CQC A;  2E7V A;  2RQC A;  1T05 B;  3AA9 A;  3IRW P;  1B7Y B;  2FPH X;  2OFG X;  5LMN J;  5B0D A;  1FD8 A;  4U7C A;  2E5J A;  3U02 A;  5A8W B;  5IT4 A;  3N5F A;  2CQH A;  4K4X A;  3Q2S C;  2DYA A;  2E9T A;  4NA3 A;  2OJ3 A;  4RW8 A;  4ZP8 A;  5B0C A;  4CIO A;  4LQ3 A;  1YJT A;  3L9Z A;  1WKL A;  1WG1 A;  5JVH Q;  4YB6 A;  5KOW A;  5AE2 A;  1GQE A;  2GGP A;  4KAI A;  1AUD A;  4DV1 F;  3DLB A;  4ZCK A;  4YHH J;  2HGM A;  3FFI B;  1EIY B;  1T9U A;  1CEZ A;  4ZVR B;  4JI5 F;  3R5B A;  5J2N B;  2WOM A;  3DM2 B;  3W7B A;  1H0H B;  3MMJ A;  3TUP A;  4F4Z A;  5LL6 d;  4BC9 A;  1RCX B;  1KVJ A;  3OR1 B;  1NJY A;  3BF4 A;  2HRT A;  1MRO B;  2WTF A;  2AQ4 A;  1NB7 A;  1Q86 T;  4NX9 A;  3M30 B;  2FIU A;  1FDN A;  2RRB A;  1FE0 A;  2P5V A;  3HDS A;  2BJD A;  3QT8 A;  5E41 A;  2KT2 A;  2BOA A;  4JI2 F;  3M8Q A;  1ARO P;  4LF5 J;  2EEY A;  3MM8 A;  1KKH A;  4IDK B;  3TVZ A;  4UW2 A;  1U1L A;  1S6Q A;  1FKO B;  2YX1 A;  5GVQ A;  1VQ4 S;  1OY6 A;  1IBC B;  3PO5 A;  5DO2 A;  1DTQ A;  2V5H G;  1R8B A;  3W65 A;  3AB2 B;  2CDR B;  5I3U B;  5IWA J;  1JLE A;  4C8N A;  3HPO A;  4F4K A;  4DL0 C;  2YTC A;  4LRE A;  1PYO B;  5F3Z A;  4O3R A;  3UI3 A;  2G1D A;  2QEX S;  4NLU A;  2G0J A;  4UY8 5;  1RHU B;  2E7W A;  2QLF B;  4AL5 A;  3I55 S;  1IUJ A;  1HNW J;  5A2Q U;  3NP5 A;  2CNO B;  4RPF A;  3D2W A;  4PRF A;  4ID8 A;  3IA0 A;  2RIL A;  2WVC A;  4TN2 A;  4PCQ A;  3NGD A;  1DZ5 A;  1TL7 B;  4WK3 A;  3GR1 A;  4JI6 J;  4TQS A;  2BBE A;  5D4P A;  1C4A A;  3OV7 A;  2GNK A;  1U4B A;  2RAQ A;  4K4U A;  3UDC A;  2V8G A;  5F8M A;  3ZXW A;  3PY8 A;  2DNM A;  3KKF A;  3LH2 S;  1T03 B;  4Z7C A;  3MEG A;  4K4Z A;  3R6G B;  1S4E A;  4JV5 J;  1JXV A;  2VBW A;  3H40 A;  5ETM A;  4KGK A;  3RAM A;  4KT0 C;  1N5Y A;  1SC1 B;  4PQA A;  2MPU A;  2L48 A;  2OEK A;  2M9K A;  1CUL A;  4NLW A;  3NXZ A;  3FSY A;  3LAL A;  3NOG A;  4WFA Q;  1N0V C;  1RT5 B;  5D0E A;  1U1O A;  2C42 A;  4ITS A;  1AZS A;  1IWA A;  4ZHR B;  4WK1 A;  3T1Y J;  1SXL A;  4ZLN A;  1J5E J;  1LQ9 A;  3VGV A;  4ED5 A;  2J6T A;  1H6K X;  4MIB A;  4ANC A;  2VOO A;  2HBY B;  1CSJ A;  2G0C A;  3A3P B;  3CNQ P;  3QO9 A;  2VOD A;  3OJU A;  3I5B A;  4GO7 X;  4B9U A;  2B4V A;  1RWV B;  4NYZ A;  1IQZ A;  2DJW A;  4P2M A;  5KT4 A;  4I2P B;  2C3P A;  2W9C A;  2CQD A;  3BYR A;  3K8W A;  4XK8 C;  1S1W B;  4K2X A;  3JSR A;  2OEL A;  2XB2 D;  3TOQ A;  4BS2 A;  1CC8 A;  1ZPV A;  2OTJ S;  1MWZ A;  4FYY B;  3B82 A;  4RW7 B;  2AZ3 A;  1Y5N B;  3PDN A;  1JX4 A;  3IXQ A;  4QZV B;  1C0U A;  2N7C A;  3Q8U A;  3NNA A;  1IKX A;  2XMK A;  4HI1 A;  3CCE S;  2E5I A;  2RU9 A;  4DR3 J;  3LPE A;  1XMQ F;  2DNQ A;  3KK3 B;  2ZVS A;  5HMX A;  2GS8 A;  3PR5 B;  1NDL A;  3MUT P;  1N5S A;  1H72 C;  1FRX A;  2FC9 A;  2JEI A;  1U26 A;  2ZH9 A;  2LQJ A;  1Z2Z A;  2O3D A;  3QLH B;  2WVB A;  2ZUG A;  5GAH U;  4DPX A;  3HKW A;  2LFV A;  5GAH I;  4OHZ A;  2DT9 A;  5T14 A;  1OYD A;  4GC6 A;  4XPE A;  3SQG B;  3B4D A;  1GX5 A;  3Q22 A;  3CCV S;  2YQ1 A;  5A2Q Y;  3E2E A;  1LW0 A;  4PZV A;  2DNP A;  2YKO A;  1FER A;  1WF0 A;  2C3Y A;  1RTJ B;  5B0A A;  5LXR A;  5JXS A;  4KB7 A;  2XUL A;  1S1T A;  1VOM A;  2LVW A;  3ZTP A;  5M2R A;  5G0R B;  3KUG A;  1VMB A;  1YJN S;  1ZA1 B;  2XHC A;  1SIW B;  4ECQ A;  4OHY A;  2I6W A;  5IV4 A;  2LCW A;  4LQ9 A;  2MZ1 A;  1JLA B;  2LDI A;  3PJ9 A;  1S1X A;  2RDJ A;  5C25 B;  2QT7 A;  1WDT A;  1NAQ A;  1FNO A;  2DGW A;  4QIV A;  3KK2 A;  4LFB F;  2HW3 A;  4LSN A;  1X31 C;  2CQ4 A;  2LXU A;  4TY8 A;  1Q16 B;  1WUU A;  3DI6 A;  1JIH A;  1H98 A;  3IWL A;  2P9C A;  2R42 A;  3GYG A;  1RTZ A;  1C1B A;  5HQL A;  4JI0 J;  3JS9 A;  5EWF A;  2WON B;  1KLM A;  1X5P A;  3BBC A;  2F1F A;  4CM2 A;  1RHM B;  3C15 B;  1RQ0 A;  5AE3 A;  2IRY A;  4UQT A;  3RU0 A;  3C2P A;  4DR4 J;  1RI7 A;  4USI A;  4ED6 A;  3H42 A;  5L38 A;  2XWX A;  4NYO A;  3G4S S;  1DQA A;  4RUB A;  4USV A;  4UOH A;  3TEG A;  2EG1 A;  3RBZ A;  3R5J B;  1HBU A;  3W3S A;  2L3M A;  4ZVO B;  2ZNZ A;  3EDR B;  5E3R A;  4MYT A;  2FJD B;  1I1G A;  4OYO A;  3NL0 A;  2APO A;  1VC6 A;  5K9F A;  3EIC A;  4ILM A;  4DN0 A;  1EQM A;  4IRC A;  4JYA F;  2UV8 A;  2GJ2 A;  1K0V A;  4B08 A;  3SIP B;  4J9L A;  3GFX A;  1NHU A;  2IYI A;  4DV4 J;  4O44 A;  1RSC A;  2PC6 A;  3QZ7 A;  1SC3 B;  3DLH A;  1D9D A;  3SDE B;  2PGC A;  1VQS A;  1N52 B;  1S72 S;  4RNO A;  3MXH P;  3G6Y A;  2BJ7 A;  2K7K A;  4O4G A;  4ED2 A;  3ZZO A;  1PKU A;  4K0K F;  3PX4 A;  1SPB P;  2IDL A;  1XNR J;  4CO1 A;  1PBU A;  2ZD1 B;  3OR2 A;  4EZ6 A;  1VGY A;  1IBL F;  3M2R A;  4LUB A;  1MN7 A;  1F9F A;  2M3D A;  3CD7 A;  1YJ7 A;  2NSB A;  4IH6 A;  2FLN A;  4W90 B;  3OHA A;  1PYS B;  2FC8 A;  5FJ4 A;  3DLG B;  3R3T A;  2IAJ A;  3R9L A;  1U2C A;  5DJB A;  2YQ3 A;  3EGN A;  5HLF B;  3CT9 A;  1IXK A;  2BAB A;  4B3R F;  2HQD A;  3C3L A;  4RW4 A;  1DLO B;  4MK8 A;  5HO4 A;  1SJF A;  3ENQ A;  4N5S A;  2AX1 A;  1ZA2 B;  2GIQ A;  4ZPA A;  3CCS S;  2HS4 A;  2CNK B;  2G0I A;  2XY6 A;  1WF1 A;  4UOC A;  2CVI A;  2CPY A;  1REV B;  2YWH A;  3QRP A;  3BJY A;  3KJQ B;  4ZK7 M;  2DCL A;  2WB4 A;  2MQ8 A;  2BZ2 A;  1S77 D;  4N56 A;  1T05 A;  3C6U B;  3LQV A;  4UZB A;  1XK8 A;  2OEM A;  2MKH A;  5KG4 A;  4PWU A;  2R8G A;  1ROF A;  3MDF A;  1WHX A;  1SQG A;  2DNN A;  3FC9 A;  3F56 A;  4ED3 A;  4DL3 A;  3V6H A;  4O3O A;  5DG7 A;  2VDI A;  4FF4 A;  1B0T A;  3FRZ A;  4CO0 A;  2A1B A;  3MR3 A;  4ECT A;  2Z57 B;  1R0B G;  2EKN A;  1M1G A;  4DLE A;  3UR0 A;  2VPW B;  2M52 A;  3T41 A;  2B0G A;  3HMJ G;  1N54 B;  1VJW A;  4M5I A;  5HJY A;  3TJ9 A;  1ZTT A;  1HL6 A;  4OI3 A;  1UVJ A;  1K9M T;  3W63 A;  2D74 B;  2Z8Q A;  3WC0 A;  2XWY A;  2JH3 A;  1WHY A;  4BC7 A;  5HBM B;  2UU9 J;  3JSB A;  3MFH A;  2MKK A;  4LRB A;  2O01 C;  3DOM B;  1HLW A;  1PSD A;  1TKT B;  2KJV A;  2KHC A;  3DMJ B;  5HSP A;  3DM2 A;  3QT7 A;  2DNR A;  2JRS A;  3I9Z A;  4K4T A;  2YNG B;  1MRO A;  2KN4 A;  3DDK A;  1PC4 A;  4CO4 A;  5A6W A;  3M30 A;  1FJC A;  3MPV A;  2P2C B;  3ISN D;  2VPX B;  3DGV A;  2F63 A;  2D7S A;  2W4D A;  3ULH A;  4I6Y A;  2BKO A;  1KQG B;  4Y3C A;  2ZOM A;  2CWX A;  1KBR A;  1XR5 A;  4PXD A;  1TUW A;  1G3O A;  1VI7 A;  2RIJ A;  1JK9 B;  3OPK A;  1K8A T;  4C0H A;  3DGP B;  2F3J A;  1JJH A;  4X4N A;  3N6M A;  2ASD A;  2ROG A;  4LF1 A;  1ACM B;  1IM4 A;  2RT3 A;  3IAM 9;  4J9M A;  4PG7 A;  5KFR A;  5A8R A;  1S48 A;  5IC6 B;  1RTD B;  1T94 A;  1YGY A;  4OMF G;  2GHV C;  4ELU A;  3FK4 A;  3I9V 9;  1T11 A;  5CCL A;  4NEY A;  2HYI B;  3T5L A;  2MTL A;  3ZO7 A;  2FHJ A;  1YG0 A;  3QAT A;  1JJ2 R;  2E5L J;  2B6A B;  2DK2 A;  4ZP6 A;  1XJW B;  1TL7 A;  2XZW A;  3VZI A;  4LF7 F;  4TKT A;  1T3N A;  3W66 A;  2QZ8 A;  4PG6 A;  1NSP A;  3PXG a;  2X1A A;  2MSS A;  4DR6 J;  5HMZ A;  2E66 A;  4NXN F;  5ITH A;  2FVS A;  3UN3 A;  2R7S A;  3WC2 A;  4LVO P;  3LPY A;  4MYU A;  2QMX A;  1GMW A;  2CJK A;  1T03 A;  2DXD A;  4QR2 A;  4UY8 T;  5L1J A;  1Y00 A;  2XLJ A;  2KYZ A;  3OL7 A;  2V67 A;  3T1H F;  2ILY A;  3KWM A;  1S1U A;  5IS2 A;  3TZY A;  4JV2 A;  2E9Z A;  3CB4 A;  1FNM A;  3OFE A;  4DV3 J;  3T6J A;  2FZC B;  4WU2 A;  5AXK A;  1QVG R;  1GX6 A;  1RT5 A;  2CAJ A;  3R5A A;  4K4W A;  4U8Y A;  3MEE B;  4XAK A;  3GCX P;  5CXT A;  3CW2 C;  5DM7 Q;  1FDD A;  4F50 A;  1C4C A;  3SMZ A;  2Y0B B;  2VFU A;  1O8B A;  3BBF A;  2DXE A;  2J6S A;  1ZTW A;  3TZW A;  2FB0 A;  1S4F A;  3EMT A;  1X7V A;  1YDL A;  1TP7 A;  3EPG A;  2EG2 A;  4I2P A;  2NSC A;  4ILL A;  3RBD A;  2OTL S;  1S1W A;  1VBK A;  1M0S A;  3GII A;  1YK9 A;  2CJQ A;  3QWU A;  5EDW A;  4Q45 A;  1XTZ A;  4RW7 A;  4HH0 A;  3MCO A;  1EKR A;  2KFZ A;  1H74 A;  3EYZ A;  4V1A k;  4KGX B;  3ELH A;  2B7C B;  1WC3 A;  3LGN A;  2ZH8 A;  2AX0 A;  3NNH A;  2MHE A;  1GTH A;  1IBK J;  1S97 A;  5ETQ A;  4ZJL A;  3KK3 A;  4IQM A;  4CTA B;  4X4V A;  3PYE A;  1J5O B;  3LO3 A;  2HNZ B;  1HAR A;  4LVN P;  3FGV A;  4DCO B;  3M1V B;  5KT6 A;  2IC3 B;  2G2O A;  2RKI B;  4O3P A;  1XC9 A;  3QLH A;  2W7A A;  1A0O B;  2B8Q A;  4RBT A;  5C2C A;  4JI8 J;  5DGB A;  2FJA B;  1PC5 A;  3AB4 B;  3MF5 A;  3SQG A;  3PAC A;  3ENW A;  2HND B;  2YBV A;  4Z2X A;  2PA3 A;  2NYI A;  4J91 A;  1RTJ A;  2DRD A;  2UUW A;  3US5 A;  4HLB A;  5G0R A;  1IBM F;  4ZP7 A;  4YFU A;  3IRX B;  2KM8 B;  3EPI A;  3CCR S;  3OSP A;  2WSE C;  3EXY A;  1JLA A;  5HJX A;  1YRU A;  4OI1 A;  2VG7 A;  4GC7 A;  3I5A A;  1JLB B;  9RUB A;  1YRX A;  5C25 A;  2J9D A;  2NZ4 A;  2HFU A;  2A6O A;  1YX2 A;  2A18 A;  1DJ0 A;  3IG1 B;  4QR0 A;  1FX4 A;  2J9C A;  2EK6 A;  4OYM A;  4J9V A;  2JFD A;  2AJ2 A;  2R7Q A;  2OFH X;  1DAR A;  3GCW P;  5IXU A;  3QQC D;  4ZVT B;  1X0F A;  2DEI A;  2K1R B;  4NLP A;  1YBT A;  4U8V A;  3GQC A;  3T19 A;  1VJQ A;  1PJ5 A;  3BPS P;  2J0X A;  1R3N A;  2WON A;  2ASY A;  4KYZ A;  1S6U A;  3C15 A;  4EYH B;  3E8O A;  3LGH A;  5E3Q A;  1RHJ B;  3TW0 A;  3L7P A;  4MMO A;  4BDP A;  4P7T A;  4L75 A;  2UV8 G;  3M8P A;  4KGZ B;  5A6P A;  2GW8 A;  1QD1 A;  3BN7 A;  5E0O A;  8AT1 B;  5KFM A;  3VVU A;  3I4H X;  2QMU B;  2JEJ A;  5CYQ B;  3GFH A;  1RWM B;  5KG3 A;  4DQI A;  3M9M B;  4P2S A;  4LF2 A;  2COL A;  5KFA A;  3IMQ J;  1B4S A;  1Y10 A;  1HKA A;  4OJH A;  5GMD A;  3OFG A;  2FHJ D;  2E1P A;  3AJ2 A;  1RB0 A;  4I7F B;  2HGN A;  2UXB F;  3KLI B;  3O3L A;  5LSL A;  4JBC A;  1DFD A;  1FRI A;  3CD0 A;  2NXU A;  5D0G A;  4OX9 F;  4KIA A;  5KFS A;  4C8L A;  2MJN A;  5BJR A;  5LXY A;  4CH7 A;  1HWU A;  5I3Q A;  2HVI A;  2AJ1 A;  2AV5 A;  3LGM A;  1CS4 A;  1MG7 A;  3QSY B;  4HAC B;  4QW8 A;  2Z56 B;  2UUC F;  1TL5 A;  4CLW A;  2JL9 A;  2E1A A;  3MMB A;  2DNZ A;  2JVR A;  2ZD1 A;  1TUG B;  4JI7 J;  1VQ5 S;  2B9E A;  3BDP A;  4RW6 B;  4N8N A;  2DO4 A;  4CLU A;  4X66 F;  4Y2K A;  1VBX A;  3CMQ A;  3UVJ B;  4C6A A;  3MMA B;  3UE2 A;  2Q66 A;  2ZH2 A;  1UVK A;  1UEV A;  2OPR B;  3D9B A;  4QU7 A;  1WOS A;  2RS8 A;  2E5H A;  1NDC A;  1TUV A;  1P9Q C;  1LEO A;  5HLF A;  4AYB D;  3OTD A;  1VQK S;  1P6T A;  3R5G A;  1DLO A;  3WDO A;  2CIM A;  1LWC A;  1VS3 A;  1EQ0 A;  3H8Y A;  2XMM A;  3CTR A;  1VIX A;  2LQB A;  2MDA A;  2VFT A;  4YS2 A;  1REV A;  3EWG A;  1K73 T;  3V81 B;  4P2X A;  1D0E A;  5C42 B;  5B08 A;  3AY0 A;  3C6U A;  4ECR A;  3KMQ A;  5LMU J;  2ZE2 B;  2P9G A;  1X9M A;  2ROE A;  3Q8P B;  4MJK A;  3KG0 A;  2CPJ A;  2IVY A;  3DLE B;  1RK8 A;  5A0Y B;  1QY7 A;  1R31 A;  1UL3 A;  5KFL A;  2XC9 A;  3IS9 A;  1KLN A;  2VBX A;  4I2Q A;  5EX0 A;  4P72 A;  3VGU A;  3PW4 A;  2A2D A;  3PM9 A;  1NK9 A;  5J1E B;  5KT7 A;  3KG4 A;  4ELT A;  4TQR A;  2B9X A;  3RBX A;  1Q82 T;  3DOM A;  4DN9 A;  1TKT A;  4B3T F;  3DMJ A;  5HAN A;  2ZFH A;  2PI5 A;  2G13 A;  2D3O 1;  4I6A A;  3ONQ A;  3OFF A;  2LP4 A;  2YKQ A;  4USW A;  1RA6 A;  2ZH7 A;  2YNG A;  2X3D A;  1R8P A;  5J2Q B;  2BV3 A;  4IQX A;  3QAU A;  1JLG B;  3VQS A;  4A8M P;  3W62 A;  5B09 A;  4QU6 A;  4FF3 A;  3P6Y C;  3FSX A;  2JLG A;  2XCP A;  3W9H A;  4HYK A;  3FNN A;  1CG2 A;  2VC0 A;  2OKQ A;  1KQF B;  2YVS A;  2XCA A;  2AGO A;  2CXE A;  2ZNY A;  4DFM A;  2RQ4 A;  1PBA A;  1IR0 A;  3HD2 A;  3CJK B;  4NL5 A;  4Y2I A;  1X0P A;  1T7P A;  4K5S A;  1YZ6 A;  3DGP A;  2M0G B;  2P6S A;  5MAO A;  3CIM A;  3JQM A;  1VC5 A;  2E1C A;  4DL4 A;  3UWT A;  3M6V A;  4ERD A;  1V5I B;  2C28 A;  5DG9 A;  4C9D A;  3EM1 A;  1RTD A;  3K57 A;  3CIZ A;  3PHE A;  2CZ9 A;  1PGZ A;  1TKD A;  2QTW A;  1XR6 A;  1PAU B;  2PFD A;  4X4T A;  4BCA A;  2QSW A;  3TA2 A;  2BJ3 A;  3D7S B;  2QA2 A;  4DOZ A;  1KEK A;  2AJ0 A;  1NME B;  3DRP B;  2KDO A;  1NXI A;  5LMN F;  2R7U A;  2D3O R;  1UP1 A;  1EHW A;  2KG0 A;  3VAJ A;  2LU2 A;  1VDH A;  3ZZZ A;  4FNI A;  2C2K B;  1ZM9 A;  4K5R A;  8RUC A;  2N3L A;  2W01 A;  2M8D B;  2B6A A;  3M8R A;  2VV5 A;  3DN9 A;  1U02 A;  1IJE B;  3UO0 A;  2H9Z A;  2ZOF A;  1NKC A;  3PJW A;  1HA1 A;  1VK3 A;  1YI2 S;  4QWD A;  3EXC X;  3HX9 A;  2W9A A;  5K5M A;  1LWX A;  1S7I A;  4TLQ A;  2VPZ B;  4C8K A;  1YHQ S;  5B0G A;  4K4V A;  4LRD A;  2N82 B;  1QE1 B;  4ID5 B;  4YHH F;  3WX4 A;  3TUI C;  4P6Q A;  5KFI A;  3K0J A;  1S6P B;  3FCH A;  3EGZ A;  3R8Y A;  4X4R A;  4DBQ A;  5H9E J;  3GYX B;  1Y3K A;  1TVR A;  4JYA J;  3OD2 A;  1TMM A;  4GKJ J;  3MM9 B;  1UW4 A;  2VIH A;  1EX8 A;  4DR2 J;  4M1K A;  4ETX A;  5KFK A;  2B9Y A;  1FK9 B;  1HBO A;  3MTK A;  3QBC A;  4EK2 A;  4DL2 A;  2AYE A;  1Q8B A;  4LF5 F;  2GHP A;  3MEE A;  1MMD A;  2J9D E;  3TAR A;  4C8M A;  3AOB A;  1D1U A;  2XSF A;  1JB0 C;  2ASJ A;  2AEM A;  2Y1R I;  2NYH A;  3TJ8 A;  3C6T B;  2KTQ A;  3MEK A;  3BGU A;  4WXW A;  1HQE A;  5IWA F;  3M7V A;  1Y5L B;  4O23 A;  2V2Q A;  4TYA A;  3UD5 A;  2K3K A;  5M2U A;  4A8K A;  1K0T A;  5L9X A;  2IA0 A;  1QJH A;  1VRT A;  1WG4 A;  2H54 B;  1WC4 A;  1OPZ A;  2A2C A;  3PX0 A;  2YNH B;  1YJW S;  3K2Y A;  4JV1 A;  3OLB A;  7FD1 A;  2RQM A;  3KUE A;  3EVW A;  2J7K A;  1HNW F;  3D5M A;  5KFU A;  4ER8 A;  4URQ U;  1N0U A;  3V6D A;  2D41 A;  4FPI A;  4ZS6 A;  5DQG A;  1F2H A;  4WFY A;  1OS5 A;  4C7Q A;  2Q43 A;  3KK1 B;  4CTA A;  2EFV A;  3NMR A;  3RAQ A;  1J5O A;  3R7N B;  2FVP A;  4JI6 F;  3M1V A;  2IC3 A;  2OPS B;  2CZ4 A;  1BQM B;  4G1P A;  1QVF R;  1UA0 A;  3PVX A;  2HLT A;  1ZPW X;  3PCO B;  1R43 A;  2R7R A;  4RO0 A;  3ZTQ A;  1J27 A;  4PKD B;  4OYA A;  2YH1 A;  4YB1 P;  5GME A;  4JV5 F;  2MZJ A;  3LP2 B;  3J81 j;  5KFQ A;  3EUN A;  4KV8 B;  2RU3 A;  2FZK B;  1I3O B;  3BGF A;  2K8G A;  3QGI A;  5IT9 U;  5CAB A;  3CDW A;  3HHD A;  4TYB A;  2DNH A;  3ENA A;  1RT2 B;  3D6T B;  4C0O C;  3QYY A;  4K8R A;  4OYB A;  3OTO J;  4ZPB A;  2YPZ A;  4S0M A;  2ZHB A;  4HI2 A;  4K7Q A;  1JLB A;  2GIF A;  3CXC R;  4N47 A;  1KHW A;  4QYZ K;  1J5E F;  2FTR A;  3IG1 A;  2HZA A;  3K5N A;  2WW8 A;  5CD4 H;  1TV6 B;  1Q81 T;  3R6L B;  3Q23 A;  4F8R A;  2F9D A;  4YOE A;  2HAF A;  4KGV B;  2L9W A;  1IQT A;  1D9F A;  3ISN C;  2UVU A;  3HXM A;  1B0P A;  2K1R A;  2DGV A;  1HYS B;  4HTI A;  2ZEJ A;  1BQN B;  5L1I A;  3SCJ E;  3AOA A;  2R8J A;  2XNR A;  4OYW A;  1N32 J;  1N6Q B;  3R2D J;  1FXR A;  3RAX A;  2OMO A;  4X62 J;  1WI8 A;  5DQI A;  2V8D A;  3OUY B;  1RUS A;  1J2V A;  2FLP A;  3HSJ A;  1N56 A;  4LRA A;  4LBP A;  1VFJ A;  1WSR A;  4QIF A;  3HHL D;  2EFG A;  3ZTS A;  1U1P A;  4WCE Q;  2XS2 A;  3OTB A;  1U7L A;  4DR3 F;  2CPF A;  2MHN A;  4DR5 J;  2AGQ A;  3GMG A;  2AZ1 A;  1FJG J;  4RNN A;  4WWS A;  1XNQ J;  2G1H A;  4LIR A;  3PX6 A;  2R4F A;  3DU5 A;  3Q8Q B;  2FJV A;  3MR7 A;  4F3O A;  3TRG A;  1DUR A;  2WSC C;  1ELO A;  2B9W A;  1UET A;  2OI2 A;  2R3V A;  2XYP B;  4GVB B;  4I7F A;  4CLL A;  4AXI A;  4K2J A;  1WNE A;  2F8E X;  3KLI A;  3NBP B;  2HHT A;  1WC6 A;  3BO2 A;  1HWK A;  2OP5 A;  3CJ8 A;  3W64 A;  4C98 A;  2BMB A;  3H2U B;  1FWP A;  3M6W A;  3HJF A;  2YQ0 A;  4KFB A;  1WC5 A;  3CME S;  4HAC A;  5ETT A;  3O44 A;  4QWC A;  3G86 A;  5K8P A;  2OD6 A;  2HG4 A;  3UCZ P;  1H2T Z;  5SZT A;  4M5J A;  5AT1 B;  3UVJ A;  3SZ2 A;  4L3K A;  5GAD U;  1G4C A;  3UFC X;  4LJM A;  1OSD A;  3GV8 B;  5GAD I;  2OPR A;  1O0P A;  1TK0 A;  2PMH A;  2AF6 A;  2R7V A;  1SL0 A;  3OJS A;  2BKN A;  1RIS A;  5D77 A;  2VUG A;  1N4L A;  1SH3 A;  4DX5 A;  3QJL A;  2AWZ A;  4RWW A;  2IM0 A;  4TU7 A;  3IFE A;  3BS9 A;  1KTV A;  2DY9 A;  4ZN1 A;  1S0N A;  1R27 B;  1S0M A;  4JI0 F;  5IT9 Y;  4DR7 J;  1NSQ A;  2EK1 A;  1NSA A;  5E3C A;  3V81 A;  4IR9 A;  1C2P A;  3GJT B;  1VRQ C;  4DL6 A;  5C42 A;  2M8H A;  4DR4 F;  3EGW B;  4OHX A;  1K44 A;  2ZE2 A;  3P4U B;  4AND A;  2XO7 A;  2HQF A;  4U96 A;  4ELV A;  2E1M C;  4W98 A;  3V4I A;  1QDU B;  1VLO A;  2CPH A;  3DLE A;  5A0Y A;  5RUB A;  2HHH J;  3UCG A;  2QLJ B;  1QTM A;  4OZ5 A;  5SUH A;  2ZDP A;  2FUG 9;  4OX8 A;  4AD6 A;  2J7U A;  5LJ5 Y;  1RT6 B;  2RRA A;  4IH5 A;  1WKK A;  5HQM A;  4FP9 A;  2ZBC A;  4CNZ A;  2CUY A;  1S5Z A;  4N41 A;  4Z7Y A;  4G6V B;  2EC0 A;  4WZM A;  1HW9 A;  3CVK A;  2AEF A;  4EO8 A;  3M2V B;  3MMC B;  4DV4 F;  5L1L A;  3KLV A;  1WJ9 A;  4OHV A;  4WF9 Q;  1VQ7 S;  4OI2 A;  2CPD A;  2JSX A;  3M8S A;  2F4F A;  2HHV A;  5J2Q A;  4TLR A;  2X1G A;  2ZWO A;  2GFF A;  2DD8 S;  4M5K A;  1YIJ S;  3X3U A;  1XNR F;  4F4W A;  3AH6 A;  1IR1 A;  4B9N A;  2ZH4 A;  3HI9 A;  3G82 B;  5K8N A;  1KN6 A;  1YVF A;  2PMZ D;  2JC0 A;  2CPE A;  3A12 A;  1VBZ A;  3A13 A;  5I3P A;  2ILZ A;  3VTI A;  4EMD A;  1DAX A;  2B56 A;  1U6F A;  1M5S A;  4EBE A;  1VQM S;  4CRJ A;  4MIW A;  1WWH A;  5IZH A;  4AUK A;  5K20 B;  3RRK A;  2C3M A;  1HWI A;  3U1L A;  1FD2 A;  2UUA J;  3FKB A;  3FBE A;  1S57 A;  3WHI A;  3DRP A;  2G9O A;  1LOU A;  3IM8 A;  3P5T L;  2VA3 A;  2KZM A;  1OPI A;  2XO6 A;  1H38 A;  1SKU B;  3UN2 A;  2H48 B;  3H5S A;  1U48 A;  2B4U A;  1N33 J;  2MXY A;  2OH2 A;  5DGA A;  1T8E A;  2I5J B;  4HTJ A;  4MKV A;  3J7Z 5;  5DZ7 A;  4B9L A;  1F5A A;  1SI9 A;  4DWI A;  2Y8W A;  3W5Z A;  2D1C A;  2BQR A;  1G2E A;  1QE1 A;  4ID5 A;  1WI6 A;  2FY8 A;  2UU9 F;  1KOO A;  1HPZ A;  4KKO B;  1FRJ A;  2ZJQ Q;  3BSO A;  1Q95 G;  4PUO B;  1OSC A;  2QL7 B;  4HVZ A;  3CDE A;  4YB5 A;  4F7V A;  5KFT A;  3MM9 A;  3RUB L;  2BAN A;  1VCT A;  3S01 A;  1FK9 A;  1SCJ B;  3H5Y A;  5D4L A;  2YPY A;  5HVG A;  1RAI B;  1OY8 A;  2JJ4 D;  2GAG C;  1UPM B;  3N6L A;  2QX0 A;  3SV3 A;  4B9M A;  2QA1 A;  4OZ2 A;  3D66 A;  3ZFV A;  1FCA A;  2BR0 A;  4RUA A;  3RB4 A;  4NZ0 A;  5H9F K;  1IWG A;  3C6T A;  5EGY A;  2FY1 A;  4X66 J;  5I42 B;  2HHQ A;  2AEJ A;  4QYR A;  5HN0 A;  2BJ9 A;  5KAK A;  3T5J A;  2QLB B;  4PG5 A;  4FXD A;  2DTJ A;  3O5T B;  4DPU A;  4IG0 B;  4OX7 A;  1P1T A;  4ED0 A;  1N36 J;  5DDQ C;  3I0R A;  1NJX A;  3OVB A;  3D0H E;  2YNH A;  4U7U D;  2BE7 D;  1U2F A;  3KNA A;  5FDL A;  1IKV B;  3CCT A;  3HT3 A;  1ZAV A;  1GXT A;  2E5L F;  2V9W A;  3KK1 A;  1RZM A;  4OIX A;  3IO1 A;  1NK8 A;  2HBZ B;  2V8P A;  1AXQ A;  1FKP B;  4AL6 A;  3SCL E;  2C22 A;  1ZM4 A;  2N4C A;  2OPS A;  3MAA B;  2HMI B;  1BQM A;  1WKJ A;  3NS5 A;  1FTC A;  1F5C A;  3BGR A;  2GQC A;  3I31 A;  2W4P A;  2MB0 B;  1VQ9 S;  2V4Q A;  2X3G A;  1YJV A;  1RBO B;  4Q8E A;  5I4M A;  2IM2 A;  5EWG A;  4CT8 A;  4F67 A;  2D9P A;  4J9K A;  3GFY A;  1Y5I B;  4Y2A A;  3CJT A;  3KJN B;  1NPP A;  3K89 A;  1ZYQ A;  1GXL A;  4KV8 A;  4V19 J;  3NEK A;  3MFI A;  3IN5 A;  5F41 A;  4HT7 A;  2HKE A;  3KLG A;  1NKB A;  1RT2 A;  2HK2 A;  5ETN A;  4DV3 F;  1RT1 B;  3OT9 A;  1HNX J;  4RX6 A;  4OJ1 A;  5KG2 A;  4NCB A;  2VOP A;  5IM0 B;  2JLE A;  3JQK A;  4U67 Q;  4RWX A;  4MK7 A;  4UQG A; 
#chains in the Genus database with same CATH homology
 3W1Y C;  4DR1 J;  1J5E J;  4DUY J;  2MQ8 A;  2E5L J;  2UXB J;  5LMN J;  4DR7 J;  2UXD J;  4DV7 J;  5AJ3 J;  4JI6 J;  4LF5 J;  4JI0 J;  2ZM6 J;  4DUZ J;  4KHP J;  4NXM J;  5LMU J;  4B3S J;  4JI2 J;  4OX9 J;  1N33 J;  4DR6 J;  4KYZ A;  4JI8 J;  4LF7 J;  3J81 U;  1N32 J;  3J7A N;  3R2D J;  4DR4 J;  1XNR J;  4K0K J;  4DV6 J;  4X66 J;  2KVQ E;  4B3M J;  4JI1 J;  3R2C J;  4X64 J;  2MEW A;  4X62 J;  4JI4 J;  4NXN J;  4JI7 J;  5IWA J;  2UUB J;  3D3C J;  2HHH J;  2UUC J;  4DV0 J;  4JV5 J;  1IBL J;  4AQY J;  1HNZ J;  5IT9 U;  1N34 J;  4JI3 J;  4DV5 J;  4YHH J;  1N36 J;  4KY3 A;  2F4V J;  4LFC J;  2VQE J;  5LM7 E;  4LF6 J;  2VQF J;  4V1A k;  4DV1 J;  4YY3 J;  5BR8 J;  4DR5 J;  4PWW A;  3T1H J;  2UU9 J;  4LFA J;  4LF4 J;  2KL8 A;  4DR3 J;  3OTO J;  1FJG J;  4NEZ A;  4JYA J;  1IBM J;  1IBK J;  1XNQ J;  4GKJ J;  1HNX J;  3JAM U;  4LF8 J;  3IMQ J;  4JI5 J;  4DV3 J;  1HNW J;  5A2Q U;  2UXC J;  2UUA J;  4DR2 J;  5FLX U;  4RJV A;  4GKK J;  3D3B J;  4B3R J;  1XMQ J;  4DV2 J;  4B3T J;  4HHU A;  1I94 J;  4NEY A;  1XMO J;  3T1Y J;  4X65 J;  4DV4 J;  1HR0 J;  4LF9 J;  3J80 U;  2MTL A;  4LFB J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...