3D3CJ

Structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
85
structure length
85
Chain Sequence
LGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDDLMRLDLAAGVDVQISLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N utilization substance protein B
publication title Structural and functional analysis of the E. coli NusB-S10 transcription antitermination complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 20
structure length 85
sequence length 85
chains with identical sequence K, L
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 3d3cJ00
4B3RJ 5BR8J 4X62J 4LF7J 1XNRJ 4NXMJ 4JI2J 1J5EJ 4JV5J 4LFCJ 2UXCJ 2ZM6J 2UXBJ 4KYZA 3W1YC 1N36J 4YY3J 4LF4J 4DV6J 4JI1J 4LF8J 2MQ8A 4DR1J 1IBLJ 4GKJJ 2UUAJ 3R2DJ 4LFBJ 1N33J 4DUZJ 4AQYJ 2MEWA 4DR3J 2VQFJ 4JI7J 1XMOJ 4LF5J 2UUBJ 1I94J 4PWWA 4NXNJ 5IWAJ 5LMNJ 4JYAJ 4DV0J 4KY3A 3T1YJ 4B3MJ 4DR5J 3T1HJ 4DV2J 2F4VJ 1N32J 4V1Ak 4DV7J 4DV4J 3JAMU 5AJ3J 4DV5J 4B3SJ 4JI3J 3D3BJ 1IBMJ 5LM7E 3J81U 2KL8A 3IMQJ 1XMQJ 4LF6J 2UU9J 3J80U 5IT9U 4NEZA 2E5LJ 2UUCJ 5FLXU 4X66J 1N34J 1XNQJ 3R2CJ 2KVQE 1HNXJ 4DR6J 1HNZJ 2UXDJ 4B3TJ 3J7AN 4RJVA 4DR2J 1FJGJ 3D3CJ 4DV1J 4JI4J 4JI5J 5A2QU 4LFAJ 1IBKJ 4K0KJ 1HNWJ 4LF9J 4HHUA 1HR0J 2VQEJ 5LMUJ 3OTOJ 4OX9J 4NEYA 4DUYJ 4KHPJ 4DV3J 4JI6J 4X64J 4DR7J 2HHHJ 2MTLA 4DR4J 4JI0J 4X65J 4YHHJ 4JI8J 4GKKJ
chains in the Genus database with same CATH superfamily
2DK2A 4I6WA 2MKYA 5KG4A 4YS2A 2OIHA 1D09B 1OSCA 1RUSA 4NLOA 1BQMB 2ZM6F 3HSDA 2ROPA 1NH8A 1VRTB 5KFXA 1TKXA 1HW9A 1KHVA 3F0NA 1IR1A 2JFDA 1VQPS 1NSAA 1RB0A 1JLQA 2N4DA 2QIFA 4IG0A 5EN1A 2HNYB 2OLWA 2ZBRA 3SCLE 4NLGA 4Y00A 2NXCA 2XLKA 4J9MA 2IVMA 1TU0B 2NXJA 3I5AA 3KLIB 5CXTA 1SJRA 4A4JA 4KIAA 2D7SA 1B64A 2BA9A 3WBZA 3ENWA 4JI5F 2EC0A 1FNOA 3Q0AA 1KEKA 2OH2A 1GAOA 3RU0A 1JLBA 5AT1B 4EZ6A 1HBOB 1GFWB 4JI5J 5HBMB 1F60B 4KHMA 5FLXY 2DGOA 4B9NA 2DXFA 4F02A 3QBCA 3UFCX 5A2QY 1FRLA 1RWOB 2LKZA 3NGDA 4A8OA 2ZKUA 2YNHB 3T19A 2EFVA 3FUYA 3DMJB 2MB0B 2R7WA 2IMOA 2HFSA 5T7LB 4NXMF 3K57A 4EO6A 4HHJA 4DLEA 3VVTA 4C98A 3JB9k 4CIOA 4O4GA 3QFHA 2GO9A 5BXIA 3MEGA 2LVWA 4A8KA 2ZVIA 2DNYA 3O1LA 5GMKa 2FYXA 2A2DA 2GC8A 4ECVA 1S0VA 5DG9A 4E98A 2YKAA 4F8RA 1QY7A 3T1YJ 4UTGA 4H4KC 2W2MP 4IDKA 3TX0A 3MAAA 2MSTA 4ECZA 2YKMA 4OHWA 1U48A 3CW2C 3JQJA 1BY9A 3R5CA 2FY1A 1VQ5S 4P7VA 2X51A 2AYMA 3ZTOA 3EPIA 2FZCB 1T03B 3D54A 3M1VB 3BO2A 1U8SA 1N0UA 4Z7CA 3I9ZA 5ETOA 2MJNA 1UWAA 3IS9B 1YQHA 1IBKF 2BJ9A 2V69A 2OPQB 1HL6A 3KKFA 4P7TA 5BR8J 2VPXB 2KU7A 4F4KA 2VFUA 3M30B 3U1LA 1RWKB 4M5HA 1CS4B 4CO4A 2HQ3A 1FRHA 4OX8A 5GMDA 3KDNA 1DTQB 3C66A 1HBMB 5F8NA 3SEOA 3KHHA 3RRHA 3T1AA 1RA7A 4CLZA 4LF2A 2W2PP 4I2PB 2DT9A 1M0SA 3QJJA 1UZDA 2QMWA 3D0GE 5HAOA 3L4BC 2PGCA 5DRKA 4ILLA 1Q86T 3FCVA 1F5BA 2BOAA 3GJSB 3PRBA 2QFIA 1T3OA 4OHZA 4F25A 4DG1B 3HKWA 2GW8A 2JEIA 3BGLA 2V9KA 4HTJA 2JEGA 2E44A 1NJZA 2FLOA 4WZQA 3NAHA 1IJEB 4FZVA 2UVVA 3MPVA 5LMUF 1R8BA 1IM6A 3TA1A 2CQDA 3AD9C 2LLZA 1ZAVA 4JI2F 5A8KB 5C24A 1H3DA 1U6FA 4B9VA 2RS2A 2GIFA 1CC7A 3CULA 3NBPA 1OS5A 2ZEJA 5G0RB 1UA0A 2RMLA 5KFJA 3H59A 1CJUA 1S9FA 1FRXA 5GMEA 5IWAJ 1S49A 1AUDA 1CULA 2VA2A 2MHEA 1X4EA 1YJNS 5AXKA 2DY1A 5EDWA 4DPTA 1F9FA 3R8YA 1LWFA 3T1HF 2FZGB 2L9WA 4CH7A 3A3NB 4MTPA 3BH7B 5LOQA 4TYBA 1WTBA 5EGYA 3VALA 2QZ8A 3MR2A 2DNPA 1T8EA 4PABA 1XNQJ 2RDJA 5LXYA 3MMAA 2RUGA 4UOCA 1H74A 4EYIB 1FRMA 4L72B 4A8QA 3D0HE 4USIA 4CH0S 2BE2A 2Q6BA 1RT4B 3VHQA 3TAQA 1TKZA 1X4FA 1JB0C 4MMOA 4RPFA 1PAEX 4ED8A 2W9BB 2MY7A 1J5EJ 3I0RB 4OZ1A 2ATCB 4P52A 4ALZA 4C4WA 1RAOA 1KN6A 3RRGA 2G0JA 3ZZOA 1XEZA 4QCLA 3RBZA 3TW0A 4GVBA 3MM6A 3H20A 2VJVA 3NG8A 2E9TA 3DFEA 3ICLA 2FHMA 2XLJA 3QYYA 4F67A 4Q8FA 4M5DA 2VFTA 3T5HA 2IM3A 1IKWA 1V3SA 4TU7A 3EGVA 2L48A 1F3FA 3K8VA 2JVRA 2X7IA 1FTCA 3SYZA 3ET6A 2IIHA 3PDNA 4KH0B 5CA5A 4OX6A 2EW9A 2HS3A 5ETRA 3J7YU 1HWKA 4D3GA 5DZ6A 1BQNA 2P8IA 1I51B 1ZAXA 1UEKA 3QAEA 1VQ4S 1WG5A 1UVLA 3NY0A 2KRBA 3TR5A 3ENVA 3JSRA 2RE1A 4DR7J 4YR3A 4PG6A 2B51A 1UVMA 2VDIA 2QLXA 3E01B 3KG4A 1U6ZA 4L73A 1H2VZ 3T3FA 3KFWX 1FFWB 1D8ZA 5J1EA 1G3OA 4PAAA 3R7SB 3BKFA 2UZAA 4EUVA 1HQEB 3Q89A 1NDCA 5LSOA 3UN5A 5GADI 3L7UA 1OYDA 3Q83A 2GHWA 2RQKA 3FJ2A 1D9FA 2GAHC 3I5CA 1RT1B 1N5YB 3DRRB 4WWSA 2XI2A 2B7CB 4Q43A 5E3QA 2CQPA 2NUHA 1XJWB 2X1GA 4F2SA 1B0VA 2M7SA 3D9BA 5IQQA 3E3XA 1VQKS 2F3JA 5D3GA 2PA8D 2ZH4A 3CCJS 4WIQA 4JUZA 4KHRA 1QAYA 2MQMA 3QWPA 2AGPA 4MFBB 3DRPA 3WC0A 1CJVA 1YIJS 1TL7B 4Y2MA 2OSQA 4YHHJ 3D6MB 4CCHA 4ES3A 4NYZA 5J2PB 4IO1A 4ETZA 4Y28C 2XO7A 3FZBA 3NCRA 5FIIA 1LWCB 1XR7A 2YVSA 3ZTQA 3BB5A 4FXVA 5KFKA 2C2NA 4A8MP 4TLQA 2ROGA 3OL9A 3QRPA 2OEJA 3GFYA 4X4NA 1EETB 3J7ZT 2VQFJ 2LMIA 2ACMA 1OPIA 5KFUA 1OJ4A 4ZCIA 1WHWA 3MCSA 2XSJB 2C42A 2IAJB 1FFSB 2IHR1 1JKHB 1YJ9S 2BJ1A 4C3MA 2ZC3A 2W4PA 3MOZA 3PX6A 1IBMJ 3MUVP 3MWBA 4C3KA 4QOTA 4AXJA 4L76A 4Z7YA 2BE7D 2IVFB 2N3LA 1DARA 1PJ6A 1KWMA 1U49A 2HK3A 3HSGA 2M2BA 4QW9A 4WP8A 5KG1A 4DL0C 1VIXA 2FJAB 3D28A 3NGKA 3JTPA 3AXKA 5C5JA 3OL6A 4QYZK 3SSQA 1R0CB 3CGIA 2HRUA 5JVGQ 4WFAQ 1ZBTA 4IFYB 4YMEA 1RAAB 2QA4G 2VKRA 4C48A 5AXNA 1WKKA 5CZXA 3V6JA 1FVSA 3G6VA 1K0VA 4NI2B 5D4PA 3DOMB 5JMNA 4IYQA 2B8QA 3EGWB 3JXOA 1PC5A 3QPIA 4KO0B 4GC7A 1Y7PA 4DXLA 4H4MB 3A3OB 3PFEA 4M5GA 4DV4J 5KFQA 1WF0A 4CNZA 2YWGA 3THPA 1HW8A 3A1YG 2VPYB 2BX6A 4DV5F 1Y0HA 1KR4A 1X4BA 4CWBA 3QJPA 4ZLLA 4ZPBA 2DEJA 2UU9F 3TZWA 4CLPA 4CTAB 3THTA 4KT0C 2OJ3A 5IOLA 2PSZA 1S99A 2KRRA 2GMJA 2AZ3A 2XG8A 1NHKL 2NQPA 4BC7A 2LA6A 3DKDA 4ZPVR 2G1HA 3G87A 1NZAA 1FX2A 2J6UA 3NOCA 4LFCJ 2HQDA 1PILA 3JYTB 3T41A 4PRFA 4PZVA 1U1PA 1QUPA 3W1YC 3TQ1A 4DFMA 1WOSA 2JOQA 1R6YA 1W2BR 3HHEA 4ED6A 5C2CA 4ILMA 4LBHA 2AJ2A 1JLCB 3K5MA 2UUTA 2IC3A 1MWYA 1XMOF 1S9EA 2RF2B 4JYAJ 4IRCA 3KOAA 2D3ZA 2IM0A 2AGOA 3GFHA 3K58A 4DV7J 4O44B 2W9CB 1Q8IA 1IN0A 3AOCA 5F9NA 1HPZB 1UVNA 3ITHB 3Q2TC 1RCOB 1Q53A 3I32A 2HRYA 1QM9A 2YTCA 1GEHA 3MTJA 3OVAA 2FPHX 2W01A 2BQ3A 1KDNA 1ZM2A 3DCAA 1IBCB 2QRRA 5B0CA 3KG1A 2HNZB 1FK9B 1VQ8S 4DZDA 5HQ8A 3N28A 4WP3A 2DCUB 2BV3A 4ED0A 2O3DA 1TL1B 5C25A 2HHHF 5HROA 1KSPA 2CQ0A 2GJIA 2ZHOA 2LXFA 2DHSA 5KFBA 4Y2CA 5CABA 1FTRA 4ECWA 3V2UC 1L3VA 1UEUA 1VK8A 2BZ2A 1MN7A 1WI8A 1WKJA 3CMQA 4UOHA 1A9NB 1GXUA 1YBUA 3TAPA 2ABYA 2GO8A 4DQPA 4MK9A 3FZ2A 2W4DA 2A1BA 5U47A 2VC0A 3KLFB 1FFGB 4YB7A 2YBVA 2HK2A 2Y3YA 2HURA 1ZM4A 4P71A 5B0GA 9RUBA 3CCWA 4OJ1A 2P9EA 4KAIA 3OVBA 5E0OA 1LFPA 2ZBIA 2V8HA 2HQGA 2LQJA 3PRDA 2HQIA 1X0PA 5EX3A 5CYMB 3POTB 5ETTA 2XMTA 4X4RA 1RI7A 1RHUB 1N48A 2M5YA 4ILRA 1F9EB 2FIUA 2F9DA 2HEKA 3GWCA 1HBUA 4JV5F 5H9EJ 3PFOA 2CJAA 2EPIA 2YH0A 4MKBA 2WVBA 4X4UA 2O66A 2DPIA 1YZ6A 3MM7B 2HFUA 3C3LA 1H6KX 4USVA 2J0WA 4OZNA 2ZHAA 2VF3A 4W92B 1C1CA 4CT9A 1U1RA 3KJVA 1S1VA 2IRUA 1WC3A 2Z2YB 2HHTA 3NMAA 3O8WA 2AF6A 1KKHA 1RQ0A 1JLQB 3EX7B 1VLOA 2NCKL 4J9VA 4IG0B 1DTTB 3DRSA 3VGUA 4K4XA 1ELOA 3W8PA 1PIEA 4V19J 1UPPA 3DLEA 1WF1A 2IPOB 3OR2A 4BWJA 2MQOA 1HQ2A 1FKOA 2ZITA 3A12A 2R7QA 2E1AA 4F4AA 2XTJP 2E7WA 1RT2A 3HK2A 4WKYA 3IP0A 3PV8A 3V6KA 5MLCV 1CG2A 3T5LA 5KG2A 2GMHA 3E8OA 2UXCJ 2BXJA 4OYBA 2WONB 1JLBB 1VYAA 4DDFA 1SC6A 1XNRF 4RW9A 1VQMS 2WBRA 3H5UA 4KYZA 1GMUA 1LW0A 4KFBA 4ANEA 3TAMA 4X2BA 3SSSA 4K4ZA 1RP5A 1VBKA 3CJTA 3IBCB 1Q7LB 3KJNB 1VDHA 3MOJB 4USMA 1RT3B 5A8WA 1PBUA 5HO4A 4J90A 4U7CA 3PJWA 4NLRA 3MHYA 4RW4A 2L9NA 3GP9A 4K8RA 1FVQA 2JDJA 5D4LA 5KT7A 5AXLA 3RRKA 2RRAA 1VQLS 3DI6A 4B3SF 4ED4A 4I68A 2B9YA 3CTRA 1TK0A 4IH7A 3M2UA 5IT4A 2DGQA 1T11A 2JWNA 2KM8C 3MAAB 2YKMB 1J5OB 1HWIA 2QA1A 4OV6A 1C0UA 2K1RA 1HIYA 1DBDA 3VAHA 4C0OC 5DM7Q 2VPWB 3CSKA 2V8PA 1UVJA 4QR1A 2WOMA 2IA0A 3QJLA 3MM5B 1RHMB 3BBCA 1YZ7A 4QIWD 1RTHB 1SH0A 4OYXA 2DGSA 3D6HB 1FWLA 4DUZJ 1Q0NA 4GKJF 2LDIA 3VV2B 3EYZA 2Z4PA 5DGBA 3CJKB 5F0WA 2VASA 4TY8A 3HI9A 2UUWA 3CDWA 5F8HA 4UOFA 3J81j 1VC5A 1U45A 1YDLA 3TUIC 2Q6CA 4HI2A 3Q24A 1KP6A 3TA2A 1K1SA 1SUQB 2XGQA 4U7UK 5F8LA 3N6NA 5KTQA 2VG5B 3VF0B 1C0TB 4Q0BA 4ATNA 2RU9A 2ASJA 1Q4RA 3GFZA 2CPJA 3V6HA 3HZEA 2AIRB 2OPSA 3PR5B 2M4MA 1JJCB 3MPUB 1A6LA 3OR1B 3OJUA 3BSOA 1JLAA 1H2UX 3OXLA 4P74A 4R25A 4YEAA 2H51B 3JSYA 5LJ5Y 3QLHA 2MXYA 4O3OA 1SVDA 4DR4F 3FMWA 3BJYA 5IFMA 1X5PA 3LP0A 2LQ9A 4J91A 3MAHA 2AEFA 3M6WA 3GMGA 4LF8F 1Q81T 1KVIA 3KLGA 3KK3B 5LL6d 2AX0A 5LMNJ 5GAEU 3RBXA 4CO5A 2NZCA 4EI2A 3D1OA 1HNIA 5HLFB 3GIRA 3DNCA 3QGHA 3D3BJ 4H4KA 3KMQA 2G2YA 4QIEA 2I0XA 4ZCMA 3MUTP 4DCPB 1N8RT 2UVRA 2OD4A 1CJUB 4B02A 3T5KA 3WHIA 5I3UB 3EE3A 1TZ0A 3EGZA 2XMVA 4DR2J 1Z2LA 2O01C 1DURA 3D67A 4B3TF 5CZVA 3HVTA 1HR0J 2AYGA 3K59A 3G8TA 2BDPA 4ELUA 4FXDA 3QAUA 5J2MA 5KFSA 3MMJA 4URQU 2VL1A 8ATCB 1DJ0A 1BE4A 3MMAB 4ED7A 4JI7F 4NE9C 1FO1A 1BMQB 3R1LA 1WELA 1RT7B 1JQGA 3K5PA 2FGOA 4ZCLA 4KKOA 1TKZB 2E5HA 4DQIA 1S4FA 4KB7A 2BJDA 4JI7J 1C4AA 1M1GA 2W2NP 3IWLA 1XQIA 3OW2R 4F4YA 2HGNA 2MZJA 3MEKA 1QSSA 4TU8A 1NK7A 3IR7B 2OD6A 1JMTA 3AAWB 2DO0A 4PR6A 3MM6B 1VRUA 4JI3F 1WEXA 3MCNA 2VIHA 1BGXT 3W2WB 2ZZNA 4F2RA 4OMFG 1X4DA 4ZK7M 3PHEA 3P6YC 1IKWB 1VJWA 3UNGC 4M5NA 4IUFA 2XQCA 5H1SV 2YQ1A 4K4YA 2CZ4A 3G6YA 4NEYA 2BR0A 2RT3A 2PFFB 2FHKA 4PQAA 1E6VA 4WTYA 3ET6B 5L38A 3BH6B 1B0PA 2B5JA 3MFHA 2M52A 5L1JA 4QU7A 1BQNB 1TVRA 1HQUB 1HNVB 1YRUA 4ZVEA 1UW4A 1S6UA 1ZH5A 4DR1J 3DLBA 1KLMA 2F63A 4JI1F 3CCMS 2PN6A 4LF5J 1XR6A 5C7PA 2UP1A 2M8HA 2CQGA 1I94F 2CQ4A 3MCOA 4Y2AA 3VAFA 3AB2B 2C3OA 1SKUB 2RUSA 3NGUA 3W3SA 4DR5F 2J8SA 3IXQA 5AJ3J 1PG5B 2DVIA 1F2GA 4R8UA 1Q79A 5KFPA 4G1QA 5I42A 4DJBA 1N34J 4FDFA 2OPPA 3CCLS 1ZZNA 2FY8A 3DGPB 1YWXA 3ZZ0A 1LOUA 5IT9Y 5HP1A 2ZDOA 1DQ8A 1F9HA 1I5OB 5JJBA 3HD2A 3MZIA 4CO3A 4DV1F 2GHPA 1B0TA 1Q5VA 4LF9F 1JLGA 2FDNA 2ZBCA 4KV8A 2KYXA 3MCMA 5H9FK 2H3EB 2FLPA 5HQMA 3MMCB 4ITSA 1MMLA 5F41A 2MY8A 4G1IA 1YRTA 1O0PA 2ZOGA 3QRQA 2G0IA 5K8MA 4WKRA 4M5KA 1NJWA 3CD7A 3KTQA 3BGRA 3JQMA 4ICLA 3QMQA 2KDOA 2NYHA 2ZBPA 1Y11A 1T9WA 2IBKA 4O3NA 4ETXA 4ZN3A 1SPBP 3AJDA 1VQOS 3A8EA 1Q95G 3ETOA 4C6AA 3MTKA 2GJFA 5CYQA 1TELA 3HT0A 4FYXB 3MFIA 2HRTA 3ISNC 2R3VA 4ZIWA 3H7HB 2P6TA 3I5BA 4ZVFA 5KFOA 3M8PB 3ELHA 1G4CA 2FTRA 2C2KB 2W8LA 2VFRA 1TQLA 4QZVB 3M6UA 4FYVB 2HFNA 1JLFA 3RAMA 2HIYA 4DL7A 2W2QP 4AL6A 2QGFB 1U0SA 3NEKA 4YQWA 3VZHA 2XMMA 4GO5X 2NPIA 2E1MC 1IKXB 1N32J 3H42A 3VGTA 4KJIA 1JJHA 4UZCA 2BANA 2PMHA 1LKZA 2OTLS 1IKVB 3VVUA 4HI1A 1U2RA 4X66J 2R8IA 3O44A 2XGPA 2JRSA 3MEDA 3IR6B 1R0AA 2ALZA 2W1BA 1WEZA 4O0NA 3TEGA 1ZM9A 3KHRA 4LBPA 1U02A 3GIKA 3EDRB 1MROA 5DM6Q 1EP4B 2CPZA 2FQQB 3UD3P 2CNKB 1EHWA 1R6VA 3A8KA 1F2HA 2EFOA 4IFVB 1KQGB 2KYZA 2WB4A 2ZC4A 3LQVA 1X31C 2GVDB 2R2UA 3CUNA 3MR6A 3QO9B 1Q8KA 1QVFR 2MQ8A 4IQXA 1REVA 3ZTPA 2QEXS 4DSLA 2GGPB 2E5IA 2HVZA 1N33F 1CJKA 1QE1A 4DR3F 5K9FA 1SKSA 4O3QA 4FF1A 1HBNB 3O3LA 4W90B 2VHGA 2ZBQA 2VD3A 1S7IA 2L9DA 2E7XA 1FEEA 4Q44A 3TZYA 3H4BA 3DLHA 3PX0A 4ZP9A 4HH1A 4PXCA 4FYYB 3K5OA 1CJTB 1HI1A 2IC3B 2Y0SD 3C6TA 2HAFA 3G4SS 4Q2LA 4WE1B 4ZCKA 2HHPA 1YJ7A 4A8XA 5ETSA 2HBRB 1E6YB 1ICEB 1XR5A 3DM2B 3OTEA 2VBYA 3QIPA 3UVJA 3VGSA 4P10A 5I4MA 4LUBA 3SBMA 4DEZA 3N6LA 5A8RA 3DU6A 3WZ0A 1LWEA 2FJVA 1GTHA 3CCUS 4DWIA 3OPKA 4TQSA 2WHOA 4LRAA 2IJRA 5CAAA 1RAJA 5B09A 3KWMA 4WFYA 1RLCL 5ETMA 4LFBF 3L95X 1SQEA 1DQ9A 1IQTA 2QFJA 1ZPWX 1OY9A 3PIPQ 2A3JA 2R7TA 4DFKA 4ZVQB 3FBFA 4A48A 1GQEA 2BJ7A 2CJBA 4DV2F 3K89A 3RGIA 3OT9A 2CDRB 3IMQJ 3JSBA 3MPYA 3CD0A 2ZOFA 5FLXU 2CWKA 2O1PA 1HNXJ 3NMRA 5A2QU 3LP1B 3T5JA 4QIVA 3M8ZA 4C8LA 2QYGA 3KK1B 1B7FA 4NL5A 5T41A 3T9ZA 2KT5A 1SBRA 3C14B 3LTOA 5C42A 4KQZA 4JI0J 5E33A 4JI6F 2DGWA 2QLFB 4X65F 4QQBA 2VPZB 4X62F 2UXBJ 1T7PA 3VAJA 5A6PA 3BQ2A 1I1GA 2J76E 4PUOB 4PPDA 5GADU 1S1XA 2XMAA 3CO0P 2P2CB 2GMLA 1YBTA 3I31A 4ZIVA 1W25A 2G0CA 2DHXA 3QFWA 2BRKA 2EFQA 2V4QA 1XWLA 4O0IA 3GV5B 2N4CA 3UO0A 3H0PA 3CMES 3M8QA 3HSZA 3R1HA 1BC6A 3B8HA 5HJYA 5HMZA 4JB8B 1TK8A 1WC4A 4HACA 3MM9B 3GU0A 1P8GA 2OMLA 4IRDA 2L3MA 1S9GB 3C46A 2MGZA 5KFNA 2AKWB 2ZH3A 1R8HA 3KJVB 2EI5A 3AA8A 4FPIA 3U1NA 4RU9A 1X9MA 2BEFA 1YHQS 1RZMA 4LSZB 2CNLB 1YX2A 1RCXB 1KOHA 1KQSR 1UVKA 3OSPA 1WEYA 4N7TA 2JL9A 2GIQA 5HVGA 5FDLA 5D4NA 4DFPA 3M2RB 3UR3C 1QDUB 3UCGA 5KOWA 4UY8T 2BUNA 3QT5A 1UWBB 5DGAA 2RH3A 5CYJA 1U09A 3IRXA 1QTMA 3R6LB 4NXNJ 3CCZA 2YH1A 1PJ5A 4LF6F 1CQMA 1H7WA 1MMNA 2C2OB 4DV0F 4P2MA 1P1LA 2DIVA 2R7OA 2DGXA 4ZKAA 4URSA 3U7JA 4LF6J 3WC2A 5HJXA 4HTIA 2VOPA 2CPFA 4NEZA 1OYEA 3V4IA 2B8PA 1U4BA 3FBBA 5RUBA 2ACYA 2IYIA 2RHSB 1YLXA 5A8WB 5DO2A 4BS2A 3HKZD 1Y5IB 4ECYA 3CCTA 1VLYA 4E0DA 2GV1A 3THVA 3BSAA 1MN9A 1S7HA 4K0KF 2N7CA 1JX4A 2D9OA 3DI6B 3DLLQ 3WIUA 2CG4A 5LJ3Y 3Q8YA 1D3WA 4ECSA 4Y34A 4IR1A 1H98A 1TV6A 1RAIB 4B9TA 3GB0A 3RAXA 2J9CA 4LBIA 1IBLJ 2OPRB 2KVIA 4FXWA 3SFUA 2CNOB 3NWGA 4OV1A 2Y8YA 1KTQA 4J5OA 2C2DA 2JX2A 2MSSA 3D7SB 1DLOB 3O5TB 4USTA 1YVFA 2B9EA 4ZLPA 2R7XA 3CVKA 4EEYA 3QSYB 2MKHA 1VQ9S 1DFDA 4NCAA 1YJUA 2KKHA 2OO4A 2F4FA 3M32B 1J2VA 3HMJG 1PKUA 1FF2A 3CC2S 1LXNA 3RB3A 1RT6B 4WFBQ 4TY8B 5KT5A 2LYVA 3CJSA 4ID5A 1OWXA 4N47A 1HNWJ 2X1AA 4PPZA 1ACMB 3L09A 4HDGA 2R7UA 4DPXA 4PQUB 2DGTA 3CXCR 4E8UA 4XPEA 2CNNB 1YRXA 4QIFA 4GKKJ 2VDHA 4KHPF 2CZ9A 1V9OA 1SIWB 4PG8A 2QMXA 1WSVA 2JLFA 3P49B 2YNFB 2CJXB 2XCAA 1Y5LB 5ADZA 1AYEA 2WB1D 2B6AB 1NJXA 1X8DA 1RBAA 3VZIA 3KMSA 2VKZG 3RAQA 3G8QA 2IY5B 3QT6A 4DZ6A 1NB7A 3FCWA 4IG3B 4L3KA 3C6UA 1WF2A 1VS3A 2RDDA 3N9UC 3QT8A 2DEIA 2YWEA 2ZH9A 2W7OA 2XZDB 3FC9A 4NZ0A 3J81U 2B9XA 3PO4A 1MNEA 2OI2A 3FSXA 2NR0A 1IXKA 3M4XA 3ZTRA 3JAMY 2H4WB 2ZH7A 4K5RA 5A76A 2V9WA 4DU8A 4RL1A 5KFMA 1KNZA 5KG0A 4Y2KA 4LIWA 3PW7A 3N5BA 2CQHA 1HNIB 2GIRA 1RWUA 3BYPA 4X64J 2XM3A 1UCNA 1BQXA 1HI8A 2P9GA 2AU0A 4NYOA 4P72A 2CG8A 3QGPA 4ZHRB 5KFFA 2HWHA 3HVTB 4ECUA 1FJCA 2M70A 3OXGA 3SCJE 1K44A 3M2VA 3TNVA 4DV6F 2I6WA 1QLNA 1YITS 3PXGa 3JSMA 4LT6A 1GK8A 2FHOB 1M5OC 3EVWA 2QO3A 3DOKA 3RYLA 1K47A 3D6TB 3C2PA 4NCGA 2KJVA 1H72C 1OIAA 3W2VA 4HT5A 2Z58B 3IAS9 2BJ8A 2E1CA 1HHQA 4PWDB 2GX8A 3DLGB 3SCKE 5CCMA 4B9UA 3AA9A 4NLUA 1TUVA 2OMOA 2HMIA 2QC3A 1HNZF 1TL3B 2YWFA 3UN3A 2YPZA 1M5KC 4DV3J 5KFCA 2RDIA 3CJQA 1NKCA 3OTOF 1TTHB 5CQGA 3GPAA 3BGFA 4FNHA 2QG9B 3G96A 2U2FA 1S79A 2IRXA 1MWZA 3PW4A 4WXOA 2R8GA 2Q3PA 5AXMA 2FVRA 1QAXA 2PMZD 2IM1A 2PIIA 4IH5A 2W25A 3DYAA 4WU3A 1FD8A 4PWWA 3G82A 4ZN1A 1WWHA 2B5JB 2XZWA 2FJXA 3DN9A 3ILIA 3KLHB 1VC0A 5F3ZA 1JJ2R 1BWEA 4CO0A 3K8WA 2HQCA 4DPWA 3CD5A 2XY6A 2HHVA 5LXRA 3MPWA 1S1UB 4I2QA 4U8YA 5HVFA 3SDEA 3VWSA 1XMQF 2CPXA 2ZJPQ 2HS4A 2LECA 4ENOA 1X0FA 1V3RA 4XIUA 1X9SA 1YGYA 3ILOA 2VQEF 2YKNB 1T0TV 2J8AA 2VFVA 3HT3A 1F1BB 5KT3A 2KTQA 2XYPB 1NPRA 1NSQA 2WW4A 1JLEB 5CH7B 4J9SA 3KUEA 5D15A 5EUHA 2C2MB 4LSLB 2Q66A 1OO0B 2CJQA 2OGUA 4KV8B 2CZVC 4BDPA 3SQGB 2UVWA 3H5XA 4USJC 2MPUA 2MKSA 2F65A 3IGVA 4B17A 2R8HA 3UQSA 1S1TA 4MIAA 4DBQA 1VGYA 5LSLA 3HPOA 3DDIA 3SZ2A 2FGCA 4P73A 1CSJA 3KLEB 3EUNA 1K1QA 1RHJB 1K8AT 2Z57B 2XS7A 3VGVA 3MECA 3CJ8A 4Y65A 2Z0GA 5D4OA 3W9JA 4LQ9A 4FF3A 2UUCF 2MZSA 4RJVA 1FJGJ 3KHGA 2B9WA 3BEGB 3AHPA 1AZSB 4LFAJ 3T6BA 4CZCA 3NS7B 4DOZA 4DR6F 4RWXA 2R8KA 1VOMA 2BABA 1KRPA 3FGVA 4I67A 4ZLNA 3A8JA 5CYQB 2AYBA 4DQSA 2W4CA 2E5GA 4WP9A 3UNYA 2ZM6J 1BQMA 2RJZA 4LR9A 1VRTA 1YJVA 3DLKB 2KXNB 3TEHB 2E29A 3J7YI 2WCXA 2HSEB 2ZH1A 2V68A 2JH3A 3CDAA 2QTWA 3M6VA 1HLWA 4U8VA 2HZAA 1NK8A 4I69A 3ISND 3SFGA 4QW8A 1JLFB 4NLPA 3R5BA 4PG5A 5B0EA 1LW2B 2CA9A 2YNGA 3D0IE 4TU9A 4PG7A 3BZQA 5IT0A 4DSIA 4X4QA 4C2MA 2Y1IA 4CLYA 3NGSA 1HBOA 3DOLB 4WK1A 5M2PA 5FJ4A 1LNQA 2H65B 3N79A 4UQTA 2YKQA 1RTIB 1XTZA 3LAMA 3EICA 4EWTA 4JI8F 3I4PA 3PVXA 4DSKA 1S6PB 4DN9A 3CO9A 2BQRA 2YNHA 1FERA 4JI8J 1TR0A 3UDLA 2PA3A 2H5JB 3DMJA 4A8YA 4ZITA 3HHDA 4NXMJ 2IBOA 2K06A 3HDSA 1TP7A 3PO5A 1EZZB 2Z30B 2K2PA 3I6PA 2K3KA 1UKUA 3QNWB 2AGQA 3TJAA 1IM4A 2ZVSA 5E5NA 3FEZA 4MAKA 2BW2A 1RWXB 3Q86A 4QYRA 4WZMA 1RWNB 1VJQA 3V4MA 4MK7A 2A6MA 3EVOA 3IN5A 2DR9A 4ZVOB 4AQYF 2DGUA 1SKRA 2PEHA 1B70B 3ENAA 2E1RA 3JQKA 1Z1ZA 3IM8A 2VODA 3W65A 3GILA 3R5DA 5KFRA 4OJGA 1GMWD 4YB1P 1UVIA 3NP5A 2N82B 1KVJA 2IM2A 1O51A 2QA2A 2CYYA 4ZDNA 1VR6A 2HGMA 3M1VA 3IRWP 4CYUB 3CJ4A 3IS9A 5M2RA 1IBKJ 4F50A 2DH8A 2OPQA 1RACB 1CBKA 2DGVA 4ZPTR 4PYAA 4AL7A 2H9ZA 5KT6A 3M30A 3M8RA 2U1AA 4DUYF 3S6EA 1WC0A 1V6HA 3LPEA 1NPKA 1RTZA 3HLUA 3I96A 4OFZA 3C6TB 1DTQA 3FBCA 5KFZA 4DN0A 5C2GA 2MLYA 4KRWA 1FDDA 2DNGA 4ZA1A 3DDNA 4I2PA 4ID8A 2A10A 2CRLA 2BW7A 2J5AA 2IJNA 3D68A 3UVJB 3IR5B 3R7NB 2DRAA 2UV8G 3WDOA 3FSYA 1G6BA 3B4MA 5J1PA 5A8RB 1NZ8A 5JUMA 1T9VA 2XNQA 2Z2MA 3EZ5A 2ZHBA 4DG1A 3OD2A 4ECTA 3OFFA 3LA0A 2LP4A 3F41A 3R2CJ 1AFIA 3HHLB 1EKRA 4CLFA 2F5GA 1RTDB 5CD4A 4QU6A 2EFGA 2BJ3A 4JI4F 3FNNA 1XIQA 3W66A 5LMUJ 5A6WA 1MSWD 1GMWA 2MQPA 4CM2A 2RIJA 5KFIA 1UZHA 1ZA2B 4JI2J 1R0BG 2CPDA 3GYNA 1IJFB 1HD1A 1WDTA 4OYAA 1GH8A 3LWMA 3RTVA 4NLQA 5FD1A 4NA1A 4LQ3A 2LU1A 2HLUA 1EKSA 3EGNA 2KG1A 5G0RA 2V4JA 4DU7A 3H2LA 2V2ZA 1KTVA 2APOA 1MLAA 2KT2A 2EBGA 2EBEA 2ZDPA 4C97A 2DNNA 2MKCA 3BBBA 2YX1A 3T1HJ 1U8WA 4J9KA 3KUGA 2QJ3A 2A2CA 4HYKA 3ZZUA 1NDKA 2QT7A 2CADA 4J9RA 4KE5A 3QZ8A 3IG1A 1X4HA 2AHOB 4IOAQ 1N6QA 1HYSB 1WHYA 1QVGR 4UZBA 3M8QB 2V67A 4WFNQ 2J9EA 1C1BA 3MPDA 4USKA 1RT4A 4RW6A 2B0GA 4WXWA 3AT1B 3OVSA 3TP2A 3WX4A 1KBRA 2ZFHA 3I0RA 5GAGI 3UD5A 1IUJA 3NAIA 1U1QA 1C2PA 2RAQA 2DD8S 2LQ5A 4ER8A 3RJMB 1BD6A 5DLGA 1H2TZ 1WD6A 1YSJA 1JNZB 2C3PA 1TAQA 4B3MF 3HX9A 2NPFA 2B56A 4K4SA 3BR9A 5EWGA 2BVZA 1VBZA 3B82A 1SV5A 4B08A 3OTDA 2DTJA 2N7YA 4A8SA 2XBPA 4B3MJ 2F8HA 2RKIB 5SZTA 1SJ4P 3FBEA 1RAGB 5JVHQ 2DJWA 3S1TA 5BJRA 5K8PA 1NK6A 1AROP 1FE0A 5IC6B 1UJ4A 1JWWA 5KG5A 4Y0FA 3QGGA 3M8SA 3Q8RB 1KFSA 1T94A 4U95A 4OX9F 3TRGA 3GIMA 2DHHA 4GVLA 3AY0A 3MD1A 5D6GA 3H25A 4OX9J 1KLNA 2GZOA 4WYWA 2CQIA 1YKWA 4EBDA 4CT8A 2R2TA 3Q8QB 3V4IB 3HFKA 3ZNJ1 2VG6B 3GTYX 3JS9A 5IQ6A 3NXZA 5F8GA 3SI8A 2MJUA 3OTCA 4CH1A 1RGVA 1HQEA 2D3UA 3G86A 2HAIA 2FJWA 3NLCA 2ZE2B 3UD4P 3V81A 4DI6A 2JC0A 1RT1A 1S6QB 1N5YA 1F5CA 3DRRA 3H2VE 4F36A 4N5SA 2NUUG 2Z8QA 3C15B 3I0SB 2DNKA 1HA1A 1TV6B 4C8KA 1N54B 2QLJB 2F4VF 1VHFA 2EK1A 2KL8A 3ONQA 4QPTA 1Q82T 2GAGC 4F4XA 2XULA 3M9OB 2W24A 3QQCD 3TOQA 3OFEA 1ZAWA 4J37A 1UEVA 4MFBA 2E7VA 3FK4A 1TL7A 2BMBA 1SQGA 5J2PA 3MI7X 4RW8A 1NHUA 5LT5A 1LWCA 3KUHA 3I9V9 4ZS6A 3B4DA 3H90A 5K5MA 3TZZA 1RHRB 1YJTA 1NRKA 3U02A 4NMXA 4MT1A 2UUBF 1RT5A 3BF4A 4UY85 4ZVHA 5K14A 4DF4A 1EETA 3AXMA 5H9FJ 5CD4H 3NNHA 4BHQA 2WSFC 1FNMA 3AFGA 2UUBJ 1HMVB 2N3OA 2XSJA 4F3MA 2IAJA 2CAJA 4S0MA 2FC8A 4Y6IA 1HWJA 2V5HG 3UCUP 4OYMA 1VMBA 1FXRA 4G3IA 1KFDA 3GV7B 4C7QA 4C8OA 3O2IA 1IVZA 3C6UB 2HWIA 4CI0B 2ASYA 4ZJQA 2KJWA 2XS5A 4I64A 2D9PA 2X3DA 1RTJB 4HHUA 1U1OA 4OLPA 2EFNA 1ZS6A 4ZMMA 2QE5A 3NS6A 5KFGA 5DQIA 1O8BA 3EMTA 1KOOA 2V4RA 1M5VC 2H5EA 5J2QA 4R5PA 1H0HB 1KS2A 4LF7F 4NYPA 2HZVA 1TFYA 1Q8LA 1RWVB 2B4UA 3PZPA 3LAKA 3RW6A 1P9QC 2V2VA 4C8MA 4NI2A 4H4OA 2YNIA 3DOMA 2J7WA 4YY3F 3D5MA 1A7GE 1FA0A 1VK3A 4KO0A 2OEMA 4DS4A 2IRYA 4IKAA 4U96A 4ZP6A 1HD0A 2XB2D 5A0YB 1PC4A 4H4MA 5KFYA 2YXLA 4J9QA 1G7CB 1PO6A 2HFZA 3GSDA 4DV5J 3WX8A 4QPXA 3KNGA 2UU9J 2VOOA 5IT9U 3NRBA 4CTAA 1NH7A 1S59A 2DNRA 2LXUA 1YJRA 2WSEC 4NX9A 4B3RF 3I4HX 1ROFA 3DOKB 3S01A 3HP6A 4NCGB 3W63A 4F0HA 4NLYA 2PD1A 1S10A 1SJ1A 2VFSA 4BCAA 1VISA 4B3RJ 3JYTA 1N0VC 2QL5B 4ZP7A 5ETKA 4JBCA 3GIIA 4OI4A 1NKEA 2QL9B 3HVAA 5HN0A 3HF5A 2GS8A 3VAMA 1U0HA 1U6BA 1PBAA 3L3CA 4NLWA 1JLCA 4I7FB 4IR9A 1NDLA 1YI2S 1YTYA 4ED3A 2YPYA 1XMOJ 2I2YA 2IJFA 2CJ9A 3R7BB 3FMBA 4B3OA 2RF2A 3ADAC 3CCES 1M90T 3BQ0A 4CLWA 3MR5A 3W9HA 4O44A 2W9CA 3B78A 1ZTWA 1HPZA 1YK9A 1TKDA 3ITHA 4TKTA 5D8HB 2X1BA 3VAGA 1V5IB 3J80U 3QATA 1N5SA 3MEEB 1A0OB 3LPYA 1AA1B 2CQ1A 4OJHA 3BKTA 3J7AN 1NJIT 1Q8BA 1LV5A 2HNZA 1FK9A 1ULRA 1XMBA 5GAEI 2OUGA 4YUDA 2F8MA 3OL7A 1FDAA 4HLBA 1TL1A 2HHHJ 2EG2A 1GXLA 3B54A 4FNIA 5KG6A 2AD9A 4ANCA 3JTNA 2EEYA 1PCAA 5KT4A 1NSPA 4NLVA 4M63A 1WNEA 2AEMA 4FYWB 4A8FA 4ECQA 3OHBA 4USHA 1N36F 2CQ2A 4XDCA 3MR3A 1WG4A 1UW9A 1OPZA 2MMYA 1RBLA 3CDBA 5EX0A 4ZOSA 1DQAA 2D69A 4F0MA 2C3MA 2C3UA 3AJ2A 2ZD1B 1IKYB 3BYRA 1MW7A 1DHMA 2BYCA 3KLFA 3ETMA 2A0FB 3CCSS 4V1Ak 4N76A 1XBWA 4HDHA 4ZPCA 3HVWA 2JEJA 2EG1A 3A13A 4ZPDA 2VZ9A 5HMYA 4KPYA 2DHAA 3PYFA 5KFWA 4I4BA 3VTIA 2OAUA 3D3CJ 2LEPA 1NMEB 3TUZC 2UXDF 5CYMA 2X1FA 4FVMA 1S1TB 4LVNP 2C1EB 4LR8A 4DCJB 5M2UA 3PJ9A 2XC9A 2AP6A 3C16B 3SQOP 1D9AA 4JV5J 4RUCA 3K2YA 2HFVA 4KSEB 3MGJA 2RSQA 1U1LA 2Y1LB 3EDQB 3MM7A 1BUXA 5L1IA 1NJYA 1TKXB 2DXDA 4LRCA 4L75A 2NSBA 4I1TA 1F0XA 4X4OA 2LCWA 5BYQA 1KQFB 2NSCA 1REGX 2MZ1A 1ZA1B 3PKMA 1CLFA 2B4OA 1FJEB 1Q5YA 3WQPA 2KI2A 1DTTA 2KZMA 4IQMA 4MIWA 3U1MA 3HHNB 2FJBB 2H54B 4N56A 5D0RA 5F3TA 2XI3A 1RDRA 3ZO7A 1CVJA 4ZVGA 2AMCB 4XK8C 2RQ4A 4CO1A 4CQ1A 3J7A1 2CQ3A 4X4VA 4KPCA 2EK6A 3KDOA 2ZWPA 3P3DA 2YNGB 2MQNA 4KGMA 1Q78A 3RG6A 1IR0A 3AD8C 2WONA 1XNRJ 4HH0A 3K0JA 3KLVA 1RXOB 2HG4A 2KXFA 1NCLA 1IWGA 3P5BP 2BKPA 2I1RA 2BACA 3HJFA 4P9SA 3BREA 4O3SA 3CE8A 4PG4A 3R27A 2Y8WA 2KH9A 4DL3A 4O4GB 3OFHA 3MEGB 1RT3A 5KFAA 1EJ7L 1UETA 1SC1B 4LRFA 5AE2A 1DY3A 4OZ5A 2X3GA 1C4CA 3HVRA 3K5LA 3W8GA 3T1YF 4B3SJ 3M8WA 4YDDB 3OTBA 4J9PA 5KT2A 4IDKB 5HL7Q 1GX5A 2K7JA 2I8EA 3DLJA 3H98A 2FZKB 3P45B 5KG7A 2ZZTA 3MMBA 1U1KA 1J5OA 4YR2A 4ED2A 1GXTA 1LWXA 1FX4A 5THWA 2C2ZB 2CIMA 4Q2MA 1OQ3A 4F7VA 2R7RA 1VBYA 4RNOA 4GO7X 2K8GA 3MM5A 5BR8F 5B0BA 2RILA 4ED1A 1NXIA 2WVDA 2J7UA 2DNQA 3NWRA 1RU1A 2ILZA 2XWYA 1JXEA 2RU3A 2XY5A 1UFLA 1RTHA 3AOAA 4ZJOA 3Q8SB 5DG7A 1DAXA 2HBQB 2J9DA 1U26A 4GKJJ 3CB4A 2I5JA 3CJKA 5F9LA 4UQGA 4I6AA 4Q45A 4K4VA 3UI3A 4P75A 1SUQA 4YR0A 4U7UD 1SJFA 1FXDA 2VG5A 2L41A 1S97A 1C0TA 2XSFA 4J9NA 4BWMA 3RUBL 1L3SA 2YX4A 3PYEA 2CFXA 3OSNA 1S0OA 5D0EA 1BXNA 1RJJA 1S0NA 3R5GA 4Y2IA 3QSIA 5SUHA 3FVYA 1P1TA 4W98A 1WTFA 4DPYA 4EK2A 3QZ7A 3IGNA 4NPOA 4RKUC 1TK5A 4KGXB 2AV5A 1CPZA 3OR1A 2HYIB 3TA0A 3H5YA 2JLEA 3LANA 1M1HA 4DR4J 2G2ZA 5K20B 1UPMB 3GZ7A 4RUBA 5KFLA 3BM7A 4UOGA 1ITPA 3PCOB 3EXCX 5I3PA 1ZYQA 1Q7YT 1UFKA 3EZUA 5C24B 4QR0A 4F4WA 4LF8J 2V8VA 2OSRA 5HMXA 3NBPB 4BC9A 3KK3A 1PSDA 4K2XA 1FRIA 1TMMA 4EZ9A 2H1YA 2HGLA 4ES1A 2ZJQQ 4UW2A 3MXHP 4Q8EA 2AWZA 5HLFA 4CLLA 3DC2A 1FJ7A 5IWAF 1HKAA 1VCTA 1CULB 3CJ3A 2V4JB 4ZVSB 1LFWA 2G9OA 1LWFB 4NMLA 2PC6A 5I3UA 3CCVS 1BWVA 4WJBA 2VC1A 3R6GB 4B3TJ 2LQBA 5DS7A 1XNQF 1R27B 4YB5A 2OTJS 1UJ6A 1WUUA 2V0NA 1LK5A 2KFYA 2MTLA 2ERRA 2BE2B 4M94A 3IG1B 4RWWA 4DX6A 1T02A 3AQPA 3CDUA 2LDYA 1N6QB 3HCXA 4R0EA 3G71S 2VBWA 1XERA 1J5EF 1C1BB 3M7VA 1RT7A 4K4WA 2OEKA 4RW6B 2FJEB 1S6OA 3R2DJ 3CIZA 2FHJD 4GVBB 4DCOB 4CP5A 3OLBA 1WC5A 3BGOP 4AL5A 4M5DB 4N8OA 2UVUA 4DMZA 4JI3J 4OLOA 4L3NA 2ALYB 2HBYB 4USWA 3W2WA 2CPEA 4CLSA 2VB6A 2ZNYA 4DLGA 5LSRA 1UMJA 1NB2A 4GRSA 2NREA 1JIHA 1UP1A 1SV5B 3UN2A 4ZVTB 5IV3A 2C28A 3LGHA 4PXDA 3TI0A 2QLBB 2V50A 4FP9A 3TUJC 2WW8A 4F26A 4OJ3A 2YWWA 3LP2A 5DLFA 5K8OA 5CHCB 2R7VA 2M8DB 2LQ8A 3W62A 3J81Y 2ZH5A 4AFFA 4DR7F 5B0FA 3GYXB 1UA1A 1FKPA 1HQUA 1HNVA 3I82A 2H5IB 3RB6A 1ZETA 4C0BA 4C0HA 4WPAA 1VI7A 4MH8A 5IC4B 4HR2A 2E9ZA 4I56A 2PI5A 5J1EB 3CEDA 4DSJA 4JI1J 2GVZA 3IAM9 1T9UA 2MZQA 3N4WA 5T14A 5GAHI 1UTAA 1RAHB 2A18A 2XYHB 4OI3A 3W5XA 3RZAA 4QWAA 1B99A 3PW5A 2E9RX 1I94J 4PCQA 1RHQB 1NLKL 4JP8A 3TARA 4DR5J 1NK9A 1Y3JA 2E5LF 4J9UE 1M1KT 3JAMU 4A46A 4CNYA 2AZ1A 3EZOA 3O6QA 3V81B 4FN5A 3OV7A 1H7XA 2E5LJ 2GNKA 3DGPA 3SV3A 2FHJA 2JHEA 4TVAB 2J6TA 4DV1J 4TY9A 4N41A 3G6ES 3R9LA 1ZOTA 5D3GB 1SIZA 2DNMA 4LF9J 2RVJA 1FESA 3PW2A 1U7LA 1RKIA 3DRPB 1CJVB 4MKAA 4LF4F 3MMCA 2GFFA 4YHHF 2JJ4D 3PJXA 4B9MA 3W60A 2V63A 2LEBA 3I87A 4FS2A 2HVEA 5DJBA 4FYDA 4LF4J 1SC4B 1UJ5A 3D2WA 2Y9HA 3OXFA 1K9MT 4RW8B 2BJEA 4DUTA 3MUMP 4OX7A 2VQFF 3L7OA 3ZFVA 1FD2A 4EO8A 2DR6A 3FSIA 3LO3A 1RT5B 2Q79A 5K14B 3PHTA 4NRTA 5EHHA 3A4TA 4PXBA 1RU2A 3OUYA 6FD1A 2HKEA 2EWHA 1IBMF 4EU0A 1N52B 1VIOA 3D1QA 3NOGA 2F9JA 4EBEA 3BGUA 2D3O1 3NNAA 1WORA 4A8WA 3M8PA 2VBXA 5L9NA 2QMUB 1HARA 5IZHA 4PKDB 2A6OA 1RE1B 3KXDA 3HZGA 3GSIA 3TJ8A 2CJKA 2RNEA 1LK7A 3LALA 4RBUA 1APSA 2FVQA 3UWTA 1EAYC 1F6TA 3H2UB 1IKXA 5J2QB 4O4RA 2LU2A 4R5PB 4RZRA 2ASDA 3C19A 2HPUA 3A8IA 1MMDA 5KG3A 2RRNA 3OL8A 4H4OB 2YNIB 3AH6A 2D1CA 1IKVA 1T05A 2J6SA 3HHLC 3OHAA 4DV4F 1D0EA 4X4PA 4RW7A 1D8YA 1RBOB 4K4TA 3M6XA 3ILLA 4JV1A 5E3AA 1AUSL 1RWPB 2P6SA 2BKNA 2PMWA 4AUKA 3D66A 1MU2A 4M5MA 5L46A 1EP4A 2FB0A 2FUG9 4TN2A 3J7Z5 1RA6A 3CDEA 2G4BA 4IFVA 2YKOA 4GMKA 2R4FA 4K59A 1CC8A 4OI1A 1OY8A 2GVDA 3CMAS 4ZLJA 4LFCF 3QO9A 4LRDA 4DX7A 4WFZA 4MKYA 2HHWA 3V5RA 2BKOA 2E66A 2GGPA 2GQ2A 1KVKA 1N33J 4QR2A 2B3TB 4WYLA 4DR3J 4DSEA 3VAKA 1IWAA 1HBNA 4FPRA 2MKIA 3NGTA 3OJSA 1W7WA 3P4UB 4MIBA 1S9EB 1U0HB 3I55S 5DQHA 5ETNA 4JYAF 3MM8A 4QWCA 2V34A 4DV7F 1CJTA 2LFVA 5HQLA 4B3OB 1S76D 2B4PA 2R42A 4WE1A 1SKWA 4FS1A 3V6DA 1BHNA 5IXUA 5GAGU 3PTWA 1VQ7S 1E6YA 3W64A 1XK8A 1EQ0A 1FCAA 1X4GA 3GR1A 2POKA 3DM2A 5ETPA 4ERDA 2JEFA 1NPPA 2XYGB 5CCLA 4OYPA 1K0TA 5G4DA 2DBBA 2DHGA 2V2QA 1X4CA 4DX8H 4LJMA 5DDQC 1X5TA 5C25B 4O3PA 4MJKA 3MURP 5HROB 2F7VA 2YY3A 3NKYA 1X9WA 4F0KA 2G13A 1Z4UA 5L1LA 5L8RC 3D6FB 3BPSP 3QRRA 4LFBJ 1X5OA 1L3UA 4LREA 1TFWA 5J2NA 1IR2A 4TYAA 3ENQA 2EFPA 2DRBA 1R8PA 4DV2J 3QIDA 1B3TA 2RHQB 4LVOP 2G1DA 2BE9B 1JNRB 2O67A 4GC6A 4M1KA 1S57A 3ZXWA 1FE4A 3UE2A 2DYAA 3LP1A 2C22A 2CPIA 1FDNA 3KK1A 3BN4A 5DZ7A 2NYIA 3C14A 2HIQA 3MAQA 2FLLA 3W5ZA 4JI6J 2JNJA 4X65J 2HZCA 5F8MA 4DSFA 2BOPA 4X62J 4ES2A 4RNFA 1CQNA 2DR7A 5B0DA 4PUOA 3Q2SC 3RW7A 3SIPB 5F8JA 3IA0A 2DR8A 1HBUB 4ZVRB 3IBFB 2IDLA 5J1NA 3NS5A 4OZLA 3K5NA 3LH2S 2GQCA 1U1MA 2J0SD 3Q8VA 4Z2XA 2YX7A 5DDPC 1Y5NB 2B7BB 4OL8A 1GMVA 1PAUB 5F8IA 1C1CB 2XMWA 2W8KA 4WK3A 1S1VB 3MM9A 1JXVA 3M9NB 1S9GA 2JFKA 3BN7A 3ZZZA 2RQCA 2XNRA 3FKBA 3Q22A 1EQMA 2KFZA 3DRSB 2VICA 1QSLA 4KBIA 1CEZA 4I6YA 2DNHA 2V6AA 3DLEB 5MAOA 3OR2B 4KGKA 1FKOB 1WJ9A 5L39A 2K3IA 5BYSA 4YN3B 3DGVA 3G2XA 1UFWA 2MLXA 5D0HA 5IM0A 1FHTA 1RT2B 3M2RA 1NU4A 2UXCF 4URGA 2DKOB 1I3OB 4RW9B 1UWBA 2M9KA 1PYTA 1L3KA 1LW0B 3LGMA 4KFBB 3IWNC 4YB6A 4OYOA 3TAMB 2XCPA 4YOEA 3GIJA 3HHKA 7FD1A 2NLWA 1NDPA 3E2EA 4L6V3 3ZZRA 4FF2A 3CF5Q 4LF1A 3CD6S 4OI2A 2CVEA 4DV0J 1UAWA 2PDAA 3TWZA 2VA3A 1WOOA 4RW4B 4UF4A 3K17A 3W61A 1S48A 2IFXA 4TLRA 1FXLA 3P96A 3UDCA 2Z2LA 4OHYA 1KC8T 4QJVA 2DCLA 1WC1A 3M2UB 2KXHA 3W7BA 4K0KJ 3GJTB 2DR5A 4M5IA 2Y1RI 2AJQA 1QJHA 4OZ3A 3BO3A 1VRQC 2GA7A 4OYWA 1C0UB 2K1RB 2BRLA 3N6MA 4EYHB 4D3HA 1G2EA 3MMBB 2RRBA 1VQYA 1QSYA 2XO6A 1RWWB 2WBMA 2HNDA 2WOMB 3G6XA 5HMWA 2OPRA 3LGNA 5D78A 3CT9A 2KO1A 4NA3A 4TQRA 3RB0A 1DLOA 2YWKA 3FRZA 2MLZA 2EVZA 3W5YA 3CC4S 3HD1A 4DUZF 4Y3CA 2D74B 4WFXA 1RWMB 3TJ9A 2GCFA 3X1LB 1RISA 4RUHA 4MYTA 3M32A 4ZPWR 2D41A 1NNDA 1GNKA 1ZZFA 2J0XA 1YG0A 1T9YA 4AT1B 2DO4A 2I5JB 1RT6A 1T9TA 4J9OA 2MDAA 4Q0BB 4PXEA 3CJ0A 3ZC4A 1UL3A 1F5AA 1RSCA 1GX6A 2WSCC 3LWLA 2OPSB 4PQUA 1NO8A 4KHPJ 3KNAA 1JLAB 5ETVA 2YNFA 1URNA 3DRYA 2EXUA 1B4SA 3EVMA 3QLHB 4DPOA 1FDBA 1AW0A 2B6AA 3GCXP 3C8YA 3SCIE 4YFUA 1P27B 1KQKA 1OY6A 3M9MB 3ZZPA 3LP0B 2JZ5A 2V94A 1AB8A 4XDDA 7AT1B 5E7OB 1U2FA 4QIGA 3H40A 4IG3A 3TANA 2DB1A 3KLGB 1AFJA 5E41A 4MKVA 2LA4A 5LMNF 4FBUA 4H54A 2HVIA 2R8JA 1R31A 1TL4A 3A3PB 2ZUAA 4HT7A 1EARA 2EKNA 2CXEA 4CM0A 4AYBD 1V3ZA 5KAKA 2OFHX 4DR2F 2CUYA 2RD5C 1WACA 1SH2A 4JV0A 3VQSA 2CWXA 1HR0F 2DY9A 5J2MB 2F40A 1HWLA 3PNIA 2F8EX 4EFAC 4DL6A 4ZHRA 3EJMA 2H4YB 3IO1A 1RABB 3M05A 1M5PC 2M0GB 4O23A 5E2QA 4C11A 1NUEA 4DV6J 2I38A 1K73T 2FVPA 2PO4A 3TZXA 3UPFA 4KKOB 3HULA 4IRKA 1FI4A 2CQBA 3PIOQ 2BBEA 2PFDA 5KFVA 2PEBA 1G1XA 3UDEA 2FJDB 2Q43A 4KH1B 1WDDA 1PGZA 4P2XA 3CJ2A 4PWDA 4M95A 4M5LA 2XHWA 4MYUA 5E3CA 4WU2A 4OI0A 4NRUA 3DLGA 1VRUB 1L3TA 1S1WA 2ADCA 4RU2A 1HNZJ 3P5TL 1TL3A 4E2FB 4JV2A 4K5SA 4BLGA 2JC1A 2QSWA 1JJ4A 3PW0A 2RB7A 4ECXA 1GT8A 2DITA 1TUWA 3OTOJ 3DXSX 4DHVA 4LSNA 3D1HA 4N77A 4RLEA 1FEHA 5KFEA 1RAFB 3NCQA 2L08A 1E6VB 4WBFA 3CC7S 1SL0A 1NBEB 4G6VB 4NASA 3GJRB 4DL4A 4DL2A 4RNMA 1TVRB 2DNLA 3LP2B 1QUVA 4XPCA 3NGRA 3L7PA 4NLTA 4DR1F 3BO4A 1KLMB 5HANA 3KK2A 3GR0A 1FKPB 1YJWS 3KLHA 4LF5F 1WKLA 5ETLA 4A47A 2KT3A 1WC6A 3PYDA 2AW0A 2UV8A 2GVZB 5L1KA 4OZ0A 1NK5A 1S1UA 5AJ3F 2QV6A 1XMQJ 4C3LA 1X5SA 4R8UB 2FD2A 4K7QA 1Y9OA 1V5VA 3KJQB 4G1QB 3E51A 5I42B 3AQOA 2YWHA 1N34F 2OPPB 2KZZA 4HEA9 4IOCQ 2ILYA 2VQEJ 5HP1B 2HHQA 2ATLA 2YKNA 1HI0P 2W7PA 4USUA 2NXEA 1S5ZA 4I0WA 5EWFA 1TL5A 3EM1A 3BSNA 1JLGB 1M5SA 4B9SA 3UR0A 1JLEA 1EIYB 5IS2A 1SI9A 5ETQA 1F3VA 3R97A 3RBDA 2CJYB 3M8YA 4LSLA 2B43A 5ITHA 2D3OR 1TKTA 1N4LA 3SQGA 2XEXA 2CQCA 2KFNA 3BGRB 4ICLB 3FFIA 3K7RA 5BYRA 3SMZA 1TAUA 5GVQA 4OZ2A 2FVSA 1Y4ZB 2QA4S 3MF5A 2C3YA 1FRJA 3KLEA 1M5HA 1N88A 4AD6A 2VG7A 1W2IA 2UUCJ 1T95A 4F3QA 2QYCA 1AZSA 2ZZMA 2W7AA 4DR6J 3W9IA 9ATCB 3PG9A 1KONA 3RR8A 4QWEA 1KHWA 4OHXA 4DS5A 3BSCA 1SB6A 3OUYB 4OQJA 2DH9A 2C2RA 1XC9A 1XN9A 2CVIA 3TVYA 3HFZB 2HHSA 2BM0A 2HNYA 4RNHA 4G1PA 3DLKA 3J80Y 3PEJA 4LIRA 4Z37A 4RBTA 3ZZTA 3KLIA 3TO8A 2CPHA 3TX8A 2JVOA 3F73A 3N0VA 1RYSA 1P6TA 1SC3B 1SXLA 2V8GA 5IV4A 1D1UA 3U27A 4X84A 1R7IA 5DETA 4MK8A 1LW2A 1FNXH 5HBMA 1JXLA 4L74A 4OYZA 1N32F 2Q1LA 2HVHA 2IDEA 2BANB 3BBFA 3DOLA 5JXSA 2ASLA 2P5VA 1RTIA 3PYGA 3FQLA 1RK8A 1R8AA 3ZZYA 5T7LA 4X66F 1S6PA 2MHNA 3MEDB 5DG8A 1R0AB 3R5AA 5DDRC 1T05B 1IQZA 5B7WA 4RW7B 1Z2ZA 4U67Q 1MROB 3FQKA 3IFEA 3P8BB 1RHKB 1U25A 4DQRA 1NSKL 4KTQA 1N56A 1NEEA 1O6XA 1VC6A 1NKBA 1MU2B 2QLWA 3OLAA 3HHLD 4ZVPB 3GE9A 4F3OA 2K7KA 4AQYJ 2QN6B 1Y00A 2NZ4A 4Q5VA 1T9XA 1PYOB 4OYIA 1REVB 2VV5A 2QX0A 1T03A 1Q1KA 1SCJB 4KY3A 1VQSA 2ZH6A 1CJKB 1QE1B 2QL7B 4O3RA 2M3DA 4ANDA 4XO0A 4M5JA 2ZWOA 6FDRA 1WHVA 4HKQA 4EMDA 4W4MA 3BPDA 4CYUA 3TVKA 1CS4A 3TYTA 2HBZB 3MD3A 3MM8B 1HBMA 3VCDA 1SL1A 2DNZA 4DUYJ 1N5VA 1JK9B 1R43A 1SH3A 5L9XA 7FDRA 2HHXA 3BS9A 2R9LA 4OZJA 3QIPB 3V6DB 2AYEA 3WIVA 1RLDA 4WTOB 1FWPA 1LWEB 2DNOA 4NZ6A 1QD1A 1S0MA 4X4TA 3BKUA 3BR8A 4HHHA 3DRXA 4RBVA 3PRVA 5D77A 2FLNA 1GTEA 3AODA 4XAKA 2SXLA 4UT4A 1TMJA 3QGIA 5KFDA 2XMJA 3HHLA 1R8CA 5J2NB 1SL2A 1RTDA 3FEXB 1N5QA 5A8KA 4JI4J 1EX8A 2OFGX 5HSPA 1HNXF 4V19X 3GQCA 3KG0A 2COLA 2HWTA 5E3PA 5H9EK 4AE5A 3G9CA 3HJVA 2DPJA 5HK4A 2LEAA 3R3TA 5C42B 4CLUA 3HM9A 3Q23A 1X60A 2RQMA 4JI0F 4RUAA 1HWUA 4AXIA 3Q8PB 2UUAF 4ED5A 2HHUA 5GAHU 2AEJA 4C9DA 3FRYA 2UXBF 3HXMA 2KB2A 1WG1A 4KGZB 1S1XB 2UUAJ 4FF4A 2AJ4A 2HS0A 4XTTA 2CDQA 4KGVB 4ZJLA 3PX4A 1X7VA 3H4DA 3GCWP 2F1FA 3RBEA 2AJ1A 4RNNA 3LW5C 5K8NA 1NAQA 2DXEA 1D9DA 3SV4A 1QAIA 2W9AA 1HYSA 4J9LA 3VQTA 2W9BA 4HACB 3BQ1A 1SQFA 3D4JA 3ISZA 2MGZB 3PY8A 1OSDA 2KHCA 2XLIA 3CIMA 2AT1B 4UUWA 2AJ0A 4KR0B 3S7RA 1NK4A 3FEYB 3G8SA 2HQFA 1TUGB 1H73A 2WVEA 3GLJA 2YKPA 1HHTP 4F04B 4C8YA 1VQNS 4FVCA 3AJ1A 4LR7A 3KYLA 4ZVUB 2MZTA 5FDLB 4LMZA 4PWUA 2E5JA 4DPUA 5AE1A 1VFJA 1NHVA 3IRXB 5IM0B 2RKIA 2MKJA 4FKYA 4NXNF 1KD1T 3L9ZA 3FDSA 3T6JA 5AE3A 3RB4A 4EBCA 4WF9Q 2O5DA 1WI6A 3LF0A 3GG1A 2I9SA 1LXJA 1ZTTA 5B08A 3E01A 5KFTA 2KVQE 4QWBA 3CPWR 2YQ3A 4TXSA 1I6JA 4OIXA 2NXNA 3T9NA 4F4ZA 1HFEL 3HO1A 2PT0A 2XMKA 2VG6A 4NWBA 2GJ2A 3NCPA 1FKAF 3OFGA 2OELA 1R3NA 2M88A 3TVZA 4DL5A 2MQQA 3GYGA 4OHVA 4WIIA 3DHXA 1EB0A 3I56S 2ZE2A 3AD7C 1S6QA 1U24A 1S12A 1IBLF 3H8YA 1S4EA 3OQ2A 3C15A 3I0SA 2NS1B 4IO9Q 3JTOA 2ZH8A 3GV8B 3Q8UA 2C2EA 3MDFA 4ELTA 3GG0A 2VONA 5D0GA 2GHVC 1NK0A 3ULHA 2OKQA 2HNDB 1BLUA 2F4VJ 2WVCA 2IYGA 1S77D 1SJQA 2WZ1A 2BM1A 2HFOA 1Q16B 3QT7A 3FCHA 1W26A 1FWKA 1Y3KA 1H38A 1ZPVA 4ID5B 8RUCA 3IM9A 2XHCA 2R2SA 1U47A 2IMWP 1WSRA 3CJ5A 3ZTSA 4DFJA 2R7SA 1HNWF 3GJQB 1T3NA 4P2SA 4GKKF 4ZPAA 1DZ5A 3KHLA 1LQ9A 1JKHA 3PM9A 3DHWC 4B9LA 4FKXA 4NLSA 1RADB 3EPGA 1HMVA 2MEWA 3R5JB 3BV8A 4OI6A 4ELVA 3OBIA 4K2JA 1U2CA 2P9CA 4RO0A 2CPYA 3H5SA 2ZKTA 4LRBA 1RYRA 4KC5A 2QSFA 4R0JA 5EWEA 2PI4A 2NXUA 1AT1B 4RR5A 2Z2ZA 4RX6A 3LOUA 2ZH2A 2ZJRQ 3N01A 3PR4A 2KN4A 2Z56B 3IWXA 2V8DA 4FBTA 2PE8A 4J7CA 2MZRA 4CRJA 3CCRS 4IFYA 4NOHA 3NL0A 3X3UA 3UCZP 1RTJA 2AQ4A 1PYSB 2DISA 2FC9A 5B0AA 4P6QA 4PYDA 4DX5A 3VAIA 2KG0A 1NM2A 2HVDA 2VJUA 2KM8B 4HL9A 4K4UA 4X64F 3ILJA 4LF7J 1AXQA 3GFXA 4X4SA 3CJRA 3LUYA 1N5TA 4YY3J 3BDPA 5E3RA 2ADBA 2ROEA 1X4AA 5I3QA 2OHDA 4QWDA 3EWGA 3AB4B 4NCBA 2H48B 3M2VB 4M8LA 5A0YA 3JSMB 4TNOA 3S8SA 2J0QD 2MYFA 1QAJA 2VUGA 3MR7A 4QYZJ 4CLKA 4CDIA 3TUPA 4C11B 5KOXA 2V2KA 3ZNUA 3F56A 4K50A 2FVCA 1YBAA 3VR1A 4CO2A 5F0UA 3UDVA 3W2VB 1LEOA 1MG7A 2J7KA 2WRMA 2E1PA 2JLGA 5KFHA 1ZM3A 2DH7A 3IC1A 2CKWA 1HHSA 1R89A 2YQ0A 1FRKA 1MWQA 1URRA 2ZUGA 2RS8A 3PEHA 2HMIB 3PACA 3B6BA 4HVZA 2HLTA 4DV3F 3EXYA 4NLDA 3DDKA 1S1WB 3KJFB 1J27A 1RKJA 1U1NA 3GONA 4CLTA 4I7FA 3SXLA 2G2OA 3PKYA 4LSNB 4DF8A 5HVHA 4YP3A 3NNCA 2EC2A 1B7YB 2LXIA 1O5JA 3RR7A 5DQGA 2B4VA 1S72S 4UUXA 1OQ6A 2WK4A 3N5FA 3DYAB 2KHDA 3G82B 4G65A 4IOBA 1WHXA 4DQQA 1PJ7A 4U6PA 2DRDA 5LM7E 3SSRA 3MEEA 1RAEB 4PEOA 2AX1A 2JSXA 2XY7A 2AJFE 4C8ZA 3BDEA 3TQEA 2WAQD 3KK2B 5HATA 4I2QB 2VBZA 2J9DE 3SDEB 3CWJA 2OP5A 2Y1JA 4BBYA 3IBWA 2XZTB 3QWUA 4NZ7A 1WOPA 2HW3A 2W2OP 4P2FA 4N8NA 1VHIA 2WVFA 6AT1B 2DIUA 3DU5A 1VQ6S 1QTNB 1VBXA 2IA6A 2MQLA 2Y0BB 1N36J 2VU5A 3HFVA 4NA2A 4QBUA 1OMSA 3AOBA 5HI7A 4YDXA 1SJ3P 4IH6A 2XS2A 3CCQS 5DDOC 2MKKA 2ZD1A 1P9YA 1IKYA 4ZP8A 4ECRA 1Y10A 1DRZA 3US5A 2IVYA 2WTFA 2ZNZA 1L5UA 2VH7A 3F44A 2R2RA 3POTA 4U9RA 1TKTB 3DXBA 2ZOMA 4NLXA 4JOUA 8AT1B 4C8NA 3HSJA 2UXDJ 3FFIB 3MECB 2XWXA 4EGLA 2BQUA 2XMUA 2GQQA 3UW1A 3CNQP 1FJGF 4WCEQ 4LFAF 4Q7AA 1FT8A 3C16A 2EKYA 2VG7B
chains in the Genus database with same CATH topology
4B3RJ 5BR8J 4X62J 4LF7J 1XNRJ 4NXMJ 4JI2J 1J5EJ 4JV5J 4LFCJ 2UXCJ 2ZM6J 2UXBJ 4KYZA 3W1YC 1N36J 4YY3J 4LF4J 4DV6J 4JI1J 4LF8J 2MQ8A 4DR1J 1IBLJ 4GKJJ 2UUAJ 3R2DJ 4LFBJ 1N33J 4DUZJ 4AQYJ 2MEWA 4DR3J 2VQFJ 4JI7J 1XMOJ 4LF5J 2UUBJ 1I94J 4PWWA 4NXNJ 5IWAJ 5LMNJ 4JYAJ 4DV0J 4KY3A 3T1YJ 4B3MJ 4DR5J 3T1HJ 4DV2J 2F4VJ 1N32J 4V1Ak 4DV7J 4DV4J 3JAMU 5AJ3J 4DV5J 4B3SJ 4JI3J 3D3BJ 1IBMJ 5LM7E 3J81U 2KL8A 3IMQJ 1XMQJ 4LF6J 2UU9J 3J80U 5IT9U 4NEZA 2E5LJ 2UUCJ 5FLXU 4X66J 1N34J 1XNQJ 3R2CJ 2KVQE 1HNXJ 4DR6J 1HNZJ 2UXDJ 4B3TJ 3J7AN 4RJVA 4DR2J 1FJGJ 3D3CJ 4DV1J 4JI4J 4JI5J 5A2QU 4LFAJ 1IBKJ 4K0KJ 1HNWJ 4LF9J 4HHUA 1HR0J 2VQEJ 5LMUJ 3OTOJ 4OX9J 4NEYA 4DUYJ 4KHPJ 4DV3J 4JI6J 4X64J 4DR7J 2HHHJ 2MTLA 4DR4J 4JI0J 4X65J 4YHHJ 4JI8J 4GKKJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R J;  5BR8 J;  4X62 J;  4LF7 J;  1XNR J;  4NXM J;  4JI2 J;  1J5E J;  4JV5 J;  4LFC J;  2UXC J;  2ZM6 J;  2UXB J;  4KYZ A;  3W1Y C;  1N36 J;  4YY3 J;  4LF4 J;  4DV6 J;  4JI1 J;  4LF8 J;  2MQ8 A;  4DR1 J;  1IBL J;  4GKJ J;  2UUA J;  3R2D J;  4LFB J;  1N33 J;  4DUZ J;  4AQY J;  2MEW A;  4DR3 J;  2VQF J;  4JI7 J;  1XMO J;  4LF5 J;  2UUB J;  1I94 J;  4PWW A;  4NXN J;  5IWA J;  5LMN J;  4JYA J;  4DV0 J;  4KY3 A;  3T1Y J;  4B3M J;  4DR5 J;  3T1H J;  4DV2 J;  2F4V J;  1N32 J;  4V1A k;  4DV7 J;  4DV4 J;  3JAM U;  5AJ3 J;  4DV5 J;  4B3S J;  4JI3 J;  3D3B J;  1IBM J;  5LM7 E;  3J81 U;  2KL8 A;  3IMQ J;  1XMQ J;  4LF6 J;  2UU9 J;  3J80 U;  5IT9 U;  4NEZ A;  2E5L J;  2UUC J;  5FLX U;  4X66 J;  1N34 J;  1XNQ J;  3R2C J;  2KVQ E;  1HNX J;  4DR6 J;  1HNZ J;  2UXD J;  4B3T J;  3J7A N;  4RJV A;  4DR2 J;  1FJG J;  3D3C J;  4DV1 J;  4JI4 J;  4JI5 J;  5A2Q U;  4LFA J;  1IBK J;  4K0K J;  1HNW J;  4LF9 J;  4HHU A;  1HR0 J;  2VQE J;  5LMU J;  3OTO J;  4OX9 J;  4NEY A;  4DUY J;  4KHP J;  4DV3 J;  4JI6 J;  4X64 J;  4DR7 J;  2HHH J;  2MTL A;  4DR4 J;  4JI0 J;  4X65 J;  4YHH J;  4JI8 J;  4GKK J; 
#chains in the Genus database with same CATH topology
 2DK2 A;  4I6W A;  2MKY A;  5KG4 A;  4YS2 A;  2OIH A;  1D09 B;  1OSC A;  1RUS A;  4NLO A;  1BQM B;  2ZM6 F;  3HSD A;  2ROP A;  1NH8 A;  1VRT B;  5KFX A;  1TKX A;  1HW9 A;  1KHV A;  3F0N A;  1IR1 A;  2JFD A;  1VQP S;  1NSA A;  1RB0 A;  1JLQ A;  2N4D A;  2QIF A;  4IG0 A;  5EN1 A;  2HNY B;  2OLW A;  2ZBR A;  3SCL E;  4NLG A;  4Y00 A;  2NXC A;  2XLK A;  4J9M A;  2IVM A;  1TU0 B;  2NXJ A;  3I5A A;  3KLI B;  5CXT A;  1SJR A;  4A4J A;  4KIA A;  2D7S A;  1B64 A;  2BA9 A;  3WBZ A;  3ENW A;  4JI5 F;  2EC0 A;  1FNO A;  3Q0A A;  1KEK A;  2OH2 A;  1GAO A;  3RU0 A;  1JLB A;  5AT1 B;  4EZ6 A;  1HBO B;  1GFW B;  4JI5 J;  5HBM B;  1F60 B;  4KHM A;  5FLX Y;  2DGO A;  4B9N A;  2DXF A;  4F02 A;  3QBC A;  3UFC X;  5A2Q Y;  1FRL A;  1RWO B;  2LKZ A;  3NGD A;  4A8O A;  2ZKU A;  2YNH B;  3T19 A;  2EFV A;  3FUY A;  3DMJ B;  2MB0 B;  2R7W A;  2IMO A;  2HFS A;  5T7L B;  4NXM F;  3K57 A;  4EO6 A;  4HHJ A;  4DLE A;  3VVT A;  4C98 A;  3JB9 k;  4CIO A;  4O4G A;  3QFH A;  2GO9 A;  5BXI A;  3MEG A;  2LVW A;  4A8K A;  2ZVI A;  2DNY A;  3O1L A;  5GMK a;  2FYX A;  2A2D A;  2GC8 A;  4ECV A;  1S0V A;  5DG9 A;  4E98 A;  2YKA A;  4F8R A;  1QY7 A;  3T1Y J;  4UTG A;  4H4K C;  2W2M P;  4IDK A;  3TX0 A;  3MAA A;  2MST A;  4ECZ A;  2YKM A;  4OHW A;  1U48 A;  3CW2 C;  3JQJ A;  1BY9 A;  3R5C A;  2FY1 A;  1VQ5 S;  4P7V A;  2X51 A;  2AYM A;  3ZTO A;  3EPI A;  2FZC B;  1T03 B;  3D54 A;  3M1V B;  3BO2 A;  1U8S A;  1N0U A;  4Z7C A;  3I9Z A;  5ETO A;  2MJN A;  1UWA A;  3IS9 B;  1YQH A;  1IBK F;  2BJ9 A;  2V69 A;  2OPQ B;  1HL6 A;  3KKF A;  4P7T A;  5BR8 J;  2VPX B;  2KU7 A;  4F4K A;  2VFU A;  3M30 B;  3U1L A;  1RWK B;  4M5H A;  1CS4 B;  4CO4 A;  2HQ3 A;  1FRH A;  4OX8 A;  5GMD A;  3KDN A;  1DTQ B;  3C66 A;  1HBM B;  5F8N A;  3SEO A;  3KHH A;  3RRH A;  3T1A A;  1RA7 A;  4CLZ A;  4LF2 A;  2W2P P;  4I2P B;  2DT9 A;  1M0S A;  3QJJ A;  1UZD A;  2QMW A;  3D0G E;  5HAO A;  3L4B C;  2PGC A;  5DRK A;  4ILL A;  1Q86 T;  3FCV A;  1F5B A;  2BOA A;  3GJS B;  3PRB A;  2QFI A;  1T3O A;  4OHZ A;  4F25 A;  4DG1 B;  3HKW A;  2GW8 A;  2JEI A;  3BGL A;  2V9K A;  4HTJ A;  2JEG A;  2E44 A;  1NJZ A;  2FLO A;  4WZQ A;  3NAH A;  1IJE B;  4FZV A;  2UVV A;  3MPV A;  5LMU F;  1R8B A;  1IM6 A;  3TA1 A;  2CQD A;  3AD9 C;  2LLZ A;  1ZAV A;  4JI2 F;  5A8K B;  5C24 A;  1H3D A;  1U6F A;  4B9V A;  2RS2 A;  2GIF A;  1CC7 A;  3CUL A;  3NBP A;  1OS5 A;  2ZEJ A;  5G0R B;  1UA0 A;  2RML A;  5KFJ A;  3H59 A;  1CJU A;  1S9F A;  1FRX A;  5GME A;  5IWA J;  1S49 A;  1AUD A;  1CUL A;  2VA2 A;  2MHE A;  1X4E A;  1YJN S;  5AXK A;  2DY1 A;  5EDW A;  4DPT A;  1F9F A;  3R8Y A;  1LWF A;  3T1H F;  2FZG B;  2L9W A;  4CH7 A;  3A3N B;  4MTP A;  3BH7 B;  5LOQ A;  4TYB A;  1WTB A;  5EGY A;  3VAL A;  2QZ8 A;  3MR2 A;  2DNP A;  1T8E A;  4PAB A;  1XNQ J;  2RDJ A;  5LXY A;  3MMA A;  2RUG A;  4UOC A;  1H74 A;  4EYI B;  1FRM A;  4L72 B;  4A8Q A;  3D0H E;  4USI A;  4CH0 S;  2BE2 A;  2Q6B A;  1RT4 B;  3VHQ A;  3TAQ A;  1TKZ A;  1X4F A;  1JB0 C;  4MMO A;  4RPF A;  1PAE X;  4ED8 A;  2W9B B;  2MY7 A;  1J5E J;  3I0R B;  4OZ1 A;  2ATC B;  4P52 A;  4ALZ A;  4C4W A;  1RAO A;  1KN6 A;  3RRG A;  2G0J A;  3ZZO A;  1XEZ A;  4QCL A;  3RBZ A;  3TW0 A;  4GVB A;  3MM6 A;  3H20 A;  2VJV A;  3NG8 A;  2E9T A;  3DFE A;  3ICL A;  2FHM A;  2XLJ A;  3QYY A;  4F67 A;  4Q8F A;  4M5D A;  2VFT A;  3T5H A;  2IM3 A;  1IKW A;  1V3S A;  4TU7 A;  3EGV A;  2L48 A;  1F3F A;  3K8V A;  2JVR A;  2X7I A;  1FTC A;  3SYZ A;  3ET6 A;  2IIH A;  3PDN A;  4KH0 B;  5CA5 A;  4OX6 A;  2EW9 A;  2HS3 A;  5ETR A;  3J7Y U;  1HWK A;  4D3G A;  5DZ6 A;  1BQN A;  2P8I A;  1I51 B;  1ZAX A;  1UEK A;  3QAE A;  1VQ4 S;  1WG5 A;  1UVL A;  3NY0 A;  2KRB A;  3TR5 A;  3ENV A;  3JSR A;  2RE1 A;  4DR7 J;  4YR3 A;  4PG6 A;  2B51 A;  1UVM A;  2VDI A;  2QLX A;  3E01 B;  3KG4 A;  1U6Z A;  4L73 A;  1H2V Z;  3T3F A;  3KFW X;  1FFW B;  1D8Z A;  5J1E A;  1G3O A;  4PAA A;  3R7S B;  3BKF A;  2UZA A;  4EUV A;  1HQE B;  3Q89 A;  1NDC A;  5LSO A;  3UN5 A;  5GAD I;  3L7U A;  1OYD A;  3Q83 A;  2GHW A;  2RQK A;  3FJ2 A;  1D9F A;  2GAH C;  3I5C A;  1RT1 B;  1N5Y B;  3DRR B;  4WWS A;  2XI2 A;  2B7C B;  4Q43 A;  5E3Q A;  2CQP A;  2NUH A;  1XJW B;  2X1G A;  4F2S A;  1B0V A;  2M7S A;  3D9B A;  5IQQ A;  3E3X A;  1VQK S;  2F3J A;  5D3G A;  2PA8 D;  2ZH4 A;  3CCJ S;  4WIQ A;  4JUZ A;  4KHR A;  1QAY A;  2MQM A;  3QWP A;  2AGP A;  4MFB B;  3DRP A;  3WC0 A;  1CJV A;  1YIJ S;  1TL7 B;  4Y2M A;  2OSQ A;  4YHH J;  3D6M B;  4CCH A;  4ES3 A;  4NYZ A;  5J2P B;  4IO1 A;  4ETZ A;  4Y28 C;  2XO7 A;  3FZB A;  3NCR A;  5FII A;  1LWC B;  1XR7 A;  2YVS A;  3ZTQ A;  3BB5 A;  4FXV A;  5KFK A;  2C2N A;  4A8M P;  4TLQ A;  2ROG A;  3OL9 A;  3QRP A;  2OEJ A;  3GFY A;  4X4N A;  1EET B;  3J7Z T;  2VQF J;  2LMI A;  2ACM A;  1OPI A;  5KFU A;  1OJ4 A;  4ZCI A;  1WHW A;  3MCS A;  2XSJ B;  2C42 A;  2IAJ B;  1FFS B;  2IHR 1;  1JKH B;  1YJ9 S;  2BJ1 A;  4C3M A;  2ZC3 A;  2W4P A;  3MOZ A;  3PX6 A;  1IBM J;  3MUV P;  3MWB A;  4C3K A;  4QOT A;  4AXJ A;  4L76 A;  4Z7Y A;  2BE7 D;  2IVF B;  2N3L A;  1DAR A;  1PJ6 A;  1KWM A;  1U49 A;  2HK3 A;  3HSG A;  2M2B A;  4QW9 A;  4WP8 A;  5KG1 A;  4DL0 C;  1VIX A;  2FJA B;  3D28 A;  3NGK A;  3JTP A;  3AXK A;  5C5J A;  3OL6 A;  4QYZ K;  3SSQ A;  1R0C B;  3CGI A;  2HRU A;  5JVG Q;  4WFA Q;  1ZBT A;  4IFY B;  4YME A;  1RAA B;  2QA4 G;  2VKR A;  4C48 A;  5AXN A;  1WKK A;  5CZX A;  3V6J A;  1FVS A;  3G6V A;  1K0V A;  4NI2 B;  5D4P A;  3DOM B;  5JMN A;  4IYQ A;  2B8Q A;  3EGW B;  3JXO A;  1PC5 A;  3QPI A;  4KO0 B;  4GC7 A;  1Y7P A;  4DXL A;  4H4M B;  3A3O B;  3PFE A;  4M5G A;  4DV4 J;  5KFQ A;  1WF0 A;  4CNZ A;  2YWG A;  3THP A;  1HW8 A;  3A1Y G;  2VPY B;  2BX6 A;  4DV5 F;  1Y0H A;  1KR4 A;  1X4B A;  4CWB A;  3QJP A;  4ZLL A;  4ZPB A;  2DEJ A;  2UU9 F;  3TZW A;  4CLP A;  4CTA B;  3THT A;  4KT0 C;  2OJ3 A;  5IOL A;  2PSZ A;  1S99 A;  2KRR A;  2GMJ A;  2AZ3 A;  2XG8 A;  1NHK L;  2NQP A;  4BC7 A;  2LA6 A;  3DKD A;  4ZPV R;  2G1H A;  3G87 A;  1NZA A;  1FX2 A;  2J6U A;  3NOC A;  4LFC J;  2HQD A;  1PIL A;  3JYT B;  3T41 A;  4PRF A;  4PZV A;  1U1P A;  1QUP A;  3W1Y C;  3TQ1 A;  4DFM A;  1WOS A;  2JOQ A;  1R6Y A;  1W2B R;  3HHE A;  4ED6 A;  5C2C A;  4ILM A;  4LBH A;  2AJ2 A;  1JLC B;  3K5M A;  2UUT A;  2IC3 A;  1MWY A;  1XMO F;  1S9E A;  2RF2 B;  4JYA J;  4IRC A;  3KOA A;  2D3Z A;  2IM0 A;  2AGO A;  3GFH A;  3K58 A;  4DV7 J;  4O44 B;  2W9C B;  1Q8I A;  1IN0 A;  3AOC A;  5F9N A;  1HPZ B;  1UVN A;  3ITH B;  3Q2T C;  1RCO B;  1Q53 A;  3I32 A;  2HRY A;  1QM9 A;  2YTC A;  1GEH A;  3MTJ A;  3OVA A;  2FPH X;  2W01 A;  2BQ3 A;  1KDN A;  1ZM2 A;  3DCA A;  1IBC B;  2QRR A;  5B0C A;  3KG1 A;  2HNZ B;  1FK9 B;  1VQ8 S;  4DZD A;  5HQ8 A;  3N28 A;  4WP3 A;  2DCU B;  2BV3 A;  4ED0 A;  2O3D A;  1TL1 B;  5C25 A;  2HHH F;  5HRO A;  1KSP A;  2CQ0 A;  2GJI A;  2ZHO A;  2LXF A;  2DHS A;  5KFB A;  4Y2C A;  5CAB A;  1FTR A;  4ECW A;  3V2U C;  1L3V A;  1UEU A;  1VK8 A;  2BZ2 A;  1MN7 A;  1WI8 A;  1WKJ A;  3CMQ A;  4UOH A;  1A9N B;  1GXU A;  1YBU A;  3TAP A;  2ABY A;  2GO8 A;  4DQP A;  4MK9 A;  3FZ2 A;  2W4D A;  2A1B A;  5U47 A;  2VC0 A;  3KLF B;  1FFG B;  4YB7 A;  2YBV A;  2HK2 A;  2Y3Y A;  2HUR A;  1ZM4 A;  4P71 A;  5B0G A;  9RUB A;  3CCW A;  4OJ1 A;  2P9E A;  4KAI A;  3OVB A;  5E0O A;  1LFP A;  2ZBI A;  2V8H A;  2HQG A;  2LQJ A;  3PRD A;  2HQI A;  1X0P A;  5EX3 A;  5CYM B;  3POT B;  5ETT A;  2XMT A;  4X4R A;  1RI7 A;  1RHU B;  1N48 A;  2M5Y A;  4ILR A;  1F9E B;  2FIU A;  2F9D A;  2HEK A;  3GWC A;  1HBU A;  4JV5 F;  5H9E J;  3PFO A;  2CJA A;  2EPI A;  2YH0 A;  4MKB A;  2WVB A;  4X4U A;  2O66 A;  2DPI A;  1YZ6 A;  3MM7 B;  2HFU A;  3C3L A;  1H6K X;  4USV A;  2J0W A;  4OZN A;  2ZHA A;  2VF3 A;  4W92 B;  1C1C A;  4CT9 A;  1U1R A;  3KJV A;  1S1V A;  2IRU A;  1WC3 A;  2Z2Y B;  2HHT A;  3NMA A;  3O8W A;  2AF6 A;  1KKH A;  1RQ0 A;  1JLQ B;  3EX7 B;  1VLO A;  2NCK L;  4J9V A;  4IG0 B;  1DTT B;  3DRS A;  3VGU A;  4K4X A;  1ELO A;  3W8P A;  1PIE A;  4V19 J;  1UPP A;  3DLE A;  1WF1 A;  2IPO B;  3OR2 A;  4BWJ A;  2MQO A;  1HQ2 A;  1FKO A;  2ZIT A;  3A12 A;  2R7Q A;  2E1A A;  4F4A A;  2XTJ P;  2E7W A;  1RT2 A;  3HK2 A;  4WKY A;  3IP0 A;  3PV8 A;  3V6K A;  5MLC V;  1CG2 A;  3T5L A;  5KG2 A;  2GMH A;  3E8O A;  2UXC J;  2BXJ A;  4OYB A;  2WON B;  1JLB B;  1VYA A;  4DDF A;  1SC6 A;  1XNR F;  4RW9 A;  1VQM S;  2WBR A;  3H5U A;  4KYZ A;  1GMU A;  1LW0 A;  4KFB A;  4ANE A;  3TAM A;  4X2B A;  3SSS A;  4K4Z A;  1RP5 A;  1VBK A;  3CJT A;  3IBC B;  1Q7L B;  3KJN B;  1VDH A;  3MOJ B;  4USM A;  1RT3 B;  5A8W A;  1PBU A;  5HO4 A;  4J90 A;  4U7C A;  3PJW A;  4NLR A;  3MHY A;  4RW4 A;  2L9N A;  3GP9 A;  4K8R A;  1FVQ A;  2JDJ A;  5D4L A;  5KT7 A;  5AXL A;  3RRK A;  2RRA A;  1VQL S;  3DI6 A;  4B3S F;  4ED4 A;  4I68 A;  2B9Y A;  3CTR A;  1TK0 A;  4IH7 A;  3M2U A;  5IT4 A;  2DGQ A;  1T11 A;  2JWN A;  2KM8 C;  3MAA B;  2YKM B;  1J5O B;  1HWI A;  2QA1 A;  4OV6 A;  1C0U A;  2K1R A;  1HIY A;  1DBD A;  3VAH A;  4C0O C;  5DM7 Q;  2VPW B;  3CSK A;  2V8P A;  1UVJ A;  4QR1 A;  2WOM A;  2IA0 A;  3QJL A;  3MM5 B;  1RHM B;  3BBC A;  1YZ7 A;  4QIW D;  1RTH B;  1SH0 A;  4OYX A;  2DGS A;  3D6H B;  1FWL A;  4DUZ J;  1Q0N A;  4GKJ F;  2LDI A;  3VV2 B;  3EYZ A;  2Z4P A;  5DGB A;  3CJK B;  5F0W A;  2VAS A;  4TY8 A;  3HI9 A;  2UUW A;  3CDW A;  5F8H A;  4UOF A;  3J81 j;  1VC5 A;  1U45 A;  1YDL A;  3TUI C;  2Q6C A;  4HI2 A;  3Q24 A;  1KP6 A;  3TA2 A;  1K1S A;  1SUQ B;  2XGQ A;  4U7U K;  5F8L A;  3N6N A;  5KTQ A;  2VG5 B;  3VF0 B;  1C0T B;  4Q0B A;  4ATN A;  2RU9 A;  2ASJ A;  1Q4R A;  3GFZ A;  2CPJ A;  3V6H A;  3HZE A;  2AIR B;  2OPS A;  3PR5 B;  2M4M A;  1JJC B;  3MPU B;  1A6L A;  3OR1 B;  3OJU A;  3BSO A;  1JLA A;  1H2U X;  3OXL A;  4P74 A;  4R25 A;  4YEA A;  2H51 B;  3JSY A;  5LJ5 Y;  3QLH A;  2MXY A;  4O3O A;  1SVD A;  4DR4 F;  3FMW A;  3BJY A;  5IFM A;  1X5P A;  3LP0 A;  2LQ9 A;  4J91 A;  3MAH A;  2AEF A;  3M6W A;  3GMG A;  4LF8 F;  1Q81 T;  1KVI A;  3KLG A;  3KK3 B;  5LL6 d;  2AX0 A;  5LMN J;  5GAE U;  3RBX A;  4CO5 A;  2NZC A;  4EI2 A;  3D1O A;  1HNI A;  5HLF B;  3GIR A;  3DNC A;  3QGH A;  3D3B J;  4H4K A;  3KMQ A;  2G2Y A;  4QIE A;  2I0X A;  4ZCM A;  3MUT P;  4DCP B;  1N8R T;  2UVR A;  2OD4 A;  1CJU B;  4B02 A;  3T5K A;  3WHI A;  5I3U B;  3EE3 A;  1TZ0 A;  3EGZ A;  2XMV A;  4DR2 J;  1Z2L A;  2O01 C;  1DUR A;  3D67 A;  4B3T F;  5CZV A;  3HVT A;  1HR0 J;  2AYG A;  3K59 A;  3G8T A;  2BDP A;  4ELU A;  4FXD A;  3QAU A;  5J2M A;  5KFS A;  3MMJ A;  4URQ U;  2VL1 A;  8ATC B;  1DJ0 A;  1BE4 A;  3MMA B;  4ED7 A;  4JI7 F;  4NE9 C;  1FO1 A;  1BMQ B;  3R1L A;  1WEL A;  1RT7 B;  1JQG A;  3K5P A;  2FGO A;  4ZCL A;  4KKO A;  1TKZ B;  2E5H A;  4DQI A;  1S4F A;  4KB7 A;  2BJD A;  4JI7 J;  1C4A A;  1M1G A;  2W2N P;  3IWL A;  1XQI A;  3OW2 R;  4F4Y A;  2HGN A;  2MZJ A;  3MEK A;  1QSS A;  4TU8 A;  1NK7 A;  3IR7 B;  2OD6 A;  1JMT A;  3AAW B;  2DO0 A;  4PR6 A;  3MM6 B;  1VRU A;  4JI3 F;  1WEX A;  3MCN A;  2VIH A;  1BGX T;  3W2W B;  2ZZN A;  4F2R A;  4OMF G;  1X4D A;  4ZK7 M;  3PHE A;  3P6Y C;  1IKW B;  1VJW A;  3UNG C;  4M5N A;  4IUF A;  2XQC A;  5H1S V;  2YQ1 A;  4K4Y A;  2CZ4 A;  3G6Y A;  4NEY A;  2BR0 A;  2RT3 A;  2PFF B;  2FHK A;  4PQA A;  1E6V A;  4WTY A;  3ET6 B;  5L38 A;  3BH6 B;  1B0P A;  2B5J A;  3MFH A;  2M52 A;  5L1J A;  4QU7 A;  1BQN B;  1TVR A;  1HQU B;  1HNV B;  1YRU A;  4ZVE A;  1UW4 A;  1S6U A;  1ZH5 A;  4DR1 J;  3DLB A;  1KLM A;  2F63 A;  4JI1 F;  3CCM S;  2PN6 A;  4LF5 J;  1XR6 A;  5C7P A;  2UP1 A;  2M8H A;  2CQG A;  1I94 F;  2CQ4 A;  3MCO A;  4Y2A A;  3VAF A;  3AB2 B;  2C3O A;  1SKU B;  2RUS A;  3NGU A;  3W3S A;  4DR5 F;  2J8S A;  3IXQ A;  5AJ3 J;  1PG5 B;  2DVI A;  1F2G A;  4R8U A;  1Q79 A;  5KFP A;  4G1Q A;  5I42 A;  4DJB A;  1N34 J;  4FDF A;  2OPP A;  3CCL S;  1ZZN A;  2FY8 A;  3DGP B;  1YWX A;  3ZZ0 A;  1LOU A;  5IT9 Y;  5HP1 A;  2ZDO A;  1DQ8 A;  1F9H A;  1I5O B;  5JJB A;  3HD2 A;  3MZI A;  4CO3 A;  4DV1 F;  2GHP A;  1B0T A;  1Q5V A;  4LF9 F;  1JLG A;  2FDN A;  2ZBC A;  4KV8 A;  2KYX A;  3MCM A;  5H9F K;  2H3E B;  2FLP A;  5HQM A;  3MMC B;  4ITS A;  1MML A;  5F41 A;  2MY8 A;  4G1I A;  1YRT A;  1O0P A;  2ZOG A;  3QRQ A;  2G0I A;  5K8M A;  4WKR A;  4M5K A;  1NJW A;  3CD7 A;  3KTQ A;  3BGR A;  3JQM A;  4ICL A;  3QMQ A;  2KDO A;  2NYH A;  2ZBP A;  1Y11 A;  1T9W A;  2IBK A;  4O3N A;  4ETX A;  4ZN3 A;  1SPB P;  3AJD A;  1VQO S;  3A8E A;  1Q95 G;  3ETO A;  4C6A A;  3MTK A;  2GJF A;  5CYQ A;  1TEL A;  3HT0 A;  4FYX B;  3MFI A;  2HRT A;  3ISN C;  2R3V A;  4ZIW A;  3H7H B;  2P6T A;  3I5B A;  4ZVF A;  5KFO A;  3M8P B;  3ELH A;  1G4C A;  2FTR A;  2C2K B;  2W8L A;  2VFR A;  1TQL A;  4QZV B;  3M6U A;  4FYV B;  2HFN A;  1JLF A;  3RAM A;  2HIY A;  4DL7 A;  2W2Q P;  4AL6 A;  2QGF B;  1U0S A;  3NEK A;  4YQW A;  3VZH A;  2XMM A;  4GO5 X;  2NPI A;  2E1M C;  1IKX B;  1N32 J;  3H42 A;  3VGT A;  4KJI A;  1JJH A;  4UZC A;  2BAN A;  2PMH A;  1LKZ A;  2OTL S;  1IKV B;  3VVU A;  4HI1 A;  1U2R A;  4X66 J;  2R8I A;  3O44 A;  2XGP A;  2JRS A;  3MED A;  3IR6 B;  1R0A A;  2ALZ A;  2W1B A;  1WEZ A;  4O0N A;  3TEG A;  1ZM9 A;  3KHR A;  4LBP A;  1U02 A;  3GIK A;  3EDR B;  1MRO A;  5DM6 Q;  1EP4 B;  2CPZ A;  2FQQ B;  3UD3 P;  2CNK B;  1EHW A;  1R6V A;  3A8K A;  1F2H A;  2EFO A;  4IFV B;  1KQG B;  2KYZ A;  2WB4 A;  2ZC4 A;  3LQV A;  1X31 C;  2GVD B;  2R2U A;  3CUN A;  3MR6 A;  3QO9 B;  1Q8K A;  1QVF R;  2MQ8 A;  4IQX A;  1REV A;  3ZTP A;  2QEX S;  4DSL A;  2GGP B;  2E5I A;  2HVZ A;  1N33 F;  1CJK A;  1QE1 A;  4DR3 F;  5K9F A;  1SKS A;  4O3Q A;  4FF1 A;  1HBN B;  3O3L A;  4W90 B;  2VHG A;  2ZBQ A;  2VD3 A;  1S7I A;  2L9D A;  2E7X A;  1FEE A;  4Q44 A;  3TZY A;  3H4B A;  3DLH A;  3PX0 A;  4ZP9 A;  4HH1 A;  4PXC A;  4FYY B;  3K5O A;  1CJT B;  1HI1 A;  2IC3 B;  2Y0S D;  3C6T A;  2HAF A;  3G4S S;  4Q2L A;  4WE1 B;  4ZCK A;  2HHP A;  1YJ7 A;  4A8X A;  5ETS A;  2HBR B;  1E6Y B;  1ICE B;  1XR5 A;  3DM2 B;  3OTE A;  2VBY A;  3QIP A;  3UVJ A;  3VGS A;  4P10 A;  5I4M A;  4LUB A;  3SBM A;  4DEZ A;  3N6L A;  5A8R A;  3DU6 A;  3WZ0 A;  1LWE A;  2FJV A;  1GTH A;  3CCU S;  4DWI A;  3OPK A;  4TQS A;  2WHO A;  4LRA A;  2IJR A;  5CAA A;  1RAJ A;  5B09 A;  3KWM A;  4WFY A;  1RLC L;  5ETM A;  4LFB F;  3L95 X;  1SQE A;  1DQ9 A;  1IQT A;  2QFJ A;  1ZPW X;  1OY9 A;  3PIP Q;  2A3J A;  2R7T A;  4DFK A;  4ZVQ B;  3FBF A;  4A48 A;  1GQE A;  2BJ7 A;  2CJB A;  4DV2 F;  3K89 A;  3RGI A;  3OT9 A;  2CDR B;  3IMQ J;  3JSB A;  3MPY A;  3CD0 A;  2ZOF A;  5FLX U;  2CWK A;  2O1P A;  1HNX J;  3NMR A;  5A2Q U;  3LP1 B;  3T5J A;  4QIV A;  3M8Z A;  4C8L A;  2QYG A;  3KK1 B;  1B7F A;  4NL5 A;  5T41 A;  3T9Z A;  2KT5 A;  1SBR A;  3C14 B;  3LTO A;  5C42 A;  4KQZ A;  4JI0 J;  5E33 A;  4JI6 F;  2DGW A;  2QLF B;  4X65 F;  4QQB A;  2VPZ B;  4X62 F;  2UXB J;  1T7P A;  3VAJ A;  5A6P A;  3BQ2 A;  1I1G A;  2J76 E;  4PUO B;  4PPD A;  5GAD U;  1S1X A;  2XMA A;  3CO0 P;  2P2C B;  2GML A;  1YBT A;  3I31 A;  4ZIV A;  1W25 A;  2G0C A;  2DHX A;  3QFW A;  2BRK A;  2EFQ A;  2V4Q A;  1XWL A;  4O0I A;  3GV5 B;  2N4C A;  3UO0 A;  3H0P A;  3CME S;  3M8Q A;  3HSZ A;  3R1H A;  1BC6 A;  3B8H A;  5HJY A;  5HMZ A;  4JB8 B;  1TK8 A;  1WC4 A;  4HAC A;  3MM9 B;  3GU0 A;  1P8G A;  2OML A;  4IRD A;  2L3M A;  1S9G B;  3C46 A;  2MGZ A;  5KFN A;  2AKW B;  2ZH3 A;  1R8H A;  3KJV B;  2EI5 A;  3AA8 A;  4FPI A;  3U1N A;  4RU9 A;  1X9M A;  2BEF A;  1YHQ S;  1RZM A;  4LSZ B;  2CNL B;  1YX2 A;  1RCX B;  1KOH A;  1KQS R;  1UVK A;  3OSP A;  1WEY A;  4N7T A;  2JL9 A;  2GIQ A;  5HVG A;  5FDL A;  5D4N A;  4DFP A;  3M2R B;  3UR3 C;  1QDU B;  3UCG A;  5KOW A;  4UY8 T;  2BUN A;  3QT5 A;  1UWB B;  5DGA A;  2RH3 A;  5CYJ A;  1U09 A;  3IRX A;  1QTM A;  3R6L B;  4NXN J;  3CCZ A;  2YH1 A;  1PJ5 A;  4LF6 F;  1CQM A;  1H7W A;  1MMN A;  2C2O B;  4DV0 F;  4P2M A;  1P1L A;  2DIV A;  2R7O A;  2DGX A;  4ZKA A;  4URS A;  3U7J A;  4LF6 J;  3WC2 A;  5HJX A;  4HTI A;  2VOP A;  2CPF A;  4NEZ A;  1OYE A;  3V4I A;  2B8P A;  1U4B A;  3FBB A;  5RUB A;  2ACY A;  2IYI A;  2RHS B;  1YLX A;  5A8W B;  5DO2 A;  4BS2 A;  3HKZ D;  1Y5I B;  4ECY A;  3CCT A;  1VLY A;  4E0D A;  2GV1 A;  3THV A;  3BSA A;  1MN9 A;  1S7H A;  4K0K F;  2N7C A;  1JX4 A;  2D9O A;  3DI6 B;  3DLL Q;  3WIU A;  2CG4 A;  5LJ3 Y;  3Q8Y A;  1D3W A;  4ECS A;  4Y34 A;  4IR1 A;  1H98 A;  1TV6 A;  1RAI B;  4B9T A;  3GB0 A;  3RAX A;  2J9C A;  4LBI A;  1IBL J;  2OPR B;  2KVI A;  4FXW A;  3SFU A;  2CNO B;  3NWG A;  4OV1 A;  2Y8Y A;  1KTQ A;  4J5O A;  2C2D A;  2JX2 A;  2MSS A;  3D7S B;  1DLO B;  3O5T B;  4UST A;  1YVF A;  2B9E A;  4ZLP A;  2R7X A;  3CVK A;  4EEY A;  3QSY B;  2MKH A;  1VQ9 S;  1DFD A;  4NCA A;  1YJU A;  2KKH A;  2OO4 A;  2F4F A;  3M32 B;  1J2V A;  3HMJ G;  1PKU A;  1FF2 A;  3CC2 S;  1LXN A;  3RB3 A;  1RT6 B;  4WFB Q;  4TY8 B;  5KT5 A;  2LYV A;  3CJS A;  4ID5 A;  1OWX A;  4N47 A;  1HNW J;  2X1A A;  4PPZ A;  1ACM B;  3L09 A;  4HDG A;  2R7U A;  4DPX A;  4PQU B;  2DGT A;  3CXC R;  4E8U A;  4XPE A;  2CNN B;  1YRX A;  4QIF A;  4GKK J;  2VDH A;  4KHP F;  2CZ9 A;  1V9O A;  1SIW B;  4PG8 A;  2QMX A;  1WSV A;  2JLF A;  3P49 B;  2YNF B;  2CJX B;  2XCA A;  1Y5L B;  5ADZ A;  1AYE A;  2WB1 D;  2B6A B;  1NJX A;  1X8D A;  1RBA A;  3VZI A;  3KMS A;  2VKZ G;  3RAQ A;  3G8Q A;  2IY5 B;  3QT6 A;  4DZ6 A;  1NB7 A;  3FCW A;  4IG3 B;  4L3K A;  3C6U A;  1WF2 A;  1VS3 A;  2RDD A;  3N9U C;  3QT8 A;  2DEI A;  2YWE A;  2ZH9 A;  2W7O A;  2XZD B;  3FC9 A;  4NZ0 A;  3J81 U;  2B9X A;  3PO4 A;  1MNE A;  2OI2 A;  3FSX A;  2NR0 A;  1IXK A;  3M4X A;  3ZTR A;  3JAM Y;  2H4W B;  2ZH7 A;  4K5R A;  5A76 A;  2V9W A;  4DU8 A;  4RL1 A;  5KFM A;  1KNZ A;  5KG0 A;  4Y2K A;  4LIW A;  3PW7 A;  3N5B A;  2CQH A;  1HNI B;  2GIR A;  1RWU A;  3BYP A;  4X64 J;  2XM3 A;  1UCN A;  1BQX A;  1HI8 A;  2P9G A;  2AU0 A;  4NYO A;  4P72 A;  2CG8 A;  3QGP A;  4ZHR B;  5KFF A;  2HWH A;  3HVT B;  4ECU A;  1FJC A;  2M70 A;  3OXG A;  3SCJ E;  1K44 A;  3M2V A;  3TNV A;  4DV6 F;  2I6W A;  1QLN A;  1YIT S;  3PXG a;  3JSM A;  4LT6 A;  1GK8 A;  2FHO B;  1M5O C;  3EVW A;  2QO3 A;  3DOK A;  3RYL A;  1K47 A;  3D6T B;  3C2P A;  4NCG A;  2KJV A;  1H72 C;  1OIA A;  3W2V A;  4HT5 A;  2Z58 B;  3IAS 9;  2BJ8 A;  2E1C A;  1HHQ A;  4PWD B;  2GX8 A;  3DLG B;  3SCK E;  5CCM A;  4B9U A;  3AA9 A;  4NLU A;  1TUV A;  2OMO A;  2HMI A;  2QC3 A;  1HNZ F;  1TL3 B;  2YWF A;  3UN3 A;  2YPZ A;  1M5K C;  4DV3 J;  5KFC A;  2RDI A;  3CJQ A;  1NKC A;  3OTO F;  1TTH B;  5CQG A;  3GPA A;  3BGF A;  4FNH A;  2QG9 B;  3G96 A;  2U2F A;  1S79 A;  2IRX A;  1MWZ A;  3PW4 A;  4WXO A;  2R8G A;  2Q3P A;  5AXM A;  2FVR A;  1QAX A;  2PMZ D;  2IM1 A;  2PII A;  4IH5 A;  2W25 A;  3DYA A;  4WU3 A;  1FD8 A;  4PWW A;  3G82 A;  4ZN1 A;  1WWH A;  2B5J B;  2XZW A;  2FJX A;  3DN9 A;  3ILI A;  3KLH B;  1VC0 A;  5F3Z A;  1JJ2 R;  1BWE A;  4CO0 A;  3K8W A;  2HQC A;  4DPW A;  3CD5 A;  2XY6 A;  2HHV A;  5LXR A;  3MPW A;  1S1U B;  4I2Q A;  4U8Y A;  5HVF A;  3SDE A;  3VWS A;  1XMQ F;  2CPX A;  2ZJP Q;  2HS4 A;  2LEC A;  4ENO A;  1X0F A;  1V3R A;  4XIU A;  1X9S A;  1YGY A;  3ILO A;  2VQE F;  2YKN B;  1T0T V;  2J8A A;  2VFV A;  3HT3 A;  1F1B B;  5KT3 A;  2KTQ A;  2XYP B;  1NPR A;  1NSQ A;  2WW4 A;  1JLE B;  5CH7 B;  4J9S A;  3KUE A;  5D15 A;  5EUH A;  2C2M B;  4LSL B;  2Q66 A;  1OO0 B;  2CJQ A;  2OGU A;  4KV8 B;  2CZV C;  4BDP A;  3SQG B;  2UVW A;  3H5X A;  4USJ C;  2MPU A;  2MKS A;  2F65 A;  3IGV A;  4B17 A;  2R8H A;  3UQS A;  1S1T A;  4MIA A;  4DBQ A;  1VGY A;  5LSL A;  3HPO A;  3DDI A;  3SZ2 A;  2FGC A;  4P73 A;  1CSJ A;  3KLE B;  3EUN A;  1K1Q A;  1RHJ B;  1K8A T;  2Z57 B;  2XS7 A;  3VGV A;  3MEC A;  3CJ8 A;  4Y65 A;  2Z0G A;  5D4O A;  3W9J A;  4LQ9 A;  4FF3 A;  2UUC F;  2MZS A;  4RJV A;  1FJG J;  3KHG A;  2B9W A;  3BEG B;  3AHP A;  1AZS B;  4LFA J;  3T6B A;  4CZC A;  3NS7 B;  4DOZ A;  4DR6 F;  4RWX A;  2R8K A;  1VOM A;  2BAB A;  1KRP A;  3FGV A;  4I67 A;  4ZLN A;  3A8J A;  5CYQ B;  2AYB A;  4DQS A;  2W4C A;  2E5G A;  4WP9 A;  3UNY A;  2ZM6 J;  1BQM A;  2RJZ A;  4LR9 A;  1VRT A;  1YJV A;  3DLK B;  2KXN B;  3TEH B;  2E29 A;  3J7Y I;  2WCX A;  2HSE B;  2ZH1 A;  2V68 A;  2JH3 A;  3CDA A;  2QTW A;  3M6V A;  1HLW A;  4U8V A;  2HZA A;  1NK8 A;  4I69 A;  3ISN D;  3SFG A;  4QW8 A;  1JLF B;  4NLP A;  3R5B A;  4PG5 A;  5B0E A;  1LW2 B;  2CA9 A;  2YNG A;  3D0I E;  4TU9 A;  4PG7 A;  3BZQ A;  5IT0 A;  4DSI A;  4X4Q A;  4C2M A;  2Y1I A;  4CLY A;  3NGS A;  1HBO A;  3DOL B;  4WK1 A;  5M2P A;  5FJ4 A;  1LNQ A;  2H65 B;  3N79 A;  4UQT A;  2YKQ A;  1RTI B;  1XTZ A;  3LAM A;  3EIC A;  4EWT A;  4JI8 F;  3I4P A;  3PVX A;  4DSK A;  1S6P B;  4DN9 A;  3CO9 A;  2BQR A;  2YNH A;  1FER A;  4JI8 J;  1TR0 A;  3UDL A;  2PA3 A;  2H5J B;  3DMJ A;  4A8Y A;  4ZIT A;  3HHD A;  4NXM J;  2IBO A;  2K06 A;  3HDS A;  1TP7 A;  3PO5 A;  1EZZ B;  2Z30 B;  2K2P A;  3I6P A;  2K3K A;  1UKU A;  3QNW B;  2AGQ A;  3TJA A;  1IM4 A;  2ZVS A;  5E5N A;  3FEZ A;  4MAK A;  2BW2 A;  1RWX B;  3Q86 A;  4QYR A;  4WZM A;  1RWN B;  1VJQ A;  3V4M A;  4MK7 A;  2A6M A;  3EVO A;  3IN5 A;  2DR9 A;  4ZVO B;  4AQY F;  2DGU A;  1SKR A;  2PEH A;  1B70 B;  3ENA A;  2E1R A;  3JQK A;  1Z1Z A;  3IM8 A;  2VOD A;  3W65 A;  3GIL A;  3R5D A;  5KFR A;  4OJG A;  1GMW D;  4YB1 P;  1UVI A;  3NP5 A;  2N82 B;  1KVJ A;  2IM2 A;  1O51 A;  2QA2 A;  2CYY A;  4ZDN A;  1VR6 A;  2HGM A;  3M1V A;  3IRW P;  4CYU B;  3CJ4 A;  3IS9 A;  5M2R A;  1IBK J;  4F50 A;  2DH8 A;  2OPQ A;  1RAC B;  1CBK A;  2DGV A;  4ZPT R;  4PYA A;  4AL7 A;  2H9Z A;  5KT6 A;  3M30 A;  3M8R A;  2U1A A;  4DUY F;  3S6E A;  1WC0 A;  1V6H A;  3LPE A;  1NPK A;  1RTZ A;  3HLU A;  3I96 A;  4OFZ A;  3C6T B;  1DTQ A;  3FBC A;  5KFZ A;  4DN0 A;  5C2G A;  2MLY A;  4KRW A;  1FDD A;  2DNG A;  4ZA1 A;  3DDN A;  4I2P A;  4ID8 A;  2A10 A;  2CRL A;  2BW7 A;  2J5A A;  2IJN A;  3D68 A;  3UVJ B;  3IR5 B;  3R7N B;  2DRA A;  2UV8 G;  3WDO A;  3FSY A;  1G6B A;  3B4M A;  5J1P A;  5A8R B;  1NZ8 A;  5JUM A;  1T9V A;  2XNQ A;  2Z2M A;  3EZ5 A;  2ZHB A;  4DG1 A;  3OD2 A;  4ECT A;  3OFF A;  3LA0 A;  2LP4 A;  3F41 A;  3R2C J;  1AFI A;  3HHL B;  1EKR A;  4CLF A;  2F5G A;  1RTD B;  5CD4 A;  4QU6 A;  2EFG A;  2BJ3 A;  4JI4 F;  3FNN A;  1XIQ A;  3W66 A;  5LMU J;  5A6W A;  1MSW D;  1GMW A;  2MQP A;  4CM2 A;  2RIJ A;  5KFI A;  1UZH A;  1ZA2 B;  4JI2 J;  1R0B G;  2CPD A;  3GYN A;  1IJF B;  1HD1 A;  1WDT A;  4OYA A;  1GH8 A;  3LWM A;  3RTV A;  4NLQ A;  5FD1 A;  4NA1 A;  4LQ3 A;  2LU1 A;  2HLU A;  1EKS A;  3EGN A;  2KG1 A;  5G0R A;  2V4J A;  4DU7 A;  3H2L A;  2V2Z A;  1KTV A;  2APO A;  1MLA A;  2KT2 A;  2EBG A;  2EBE A;  2ZDP A;  4C97 A;  2DNN A;  2MKC A;  3BBB A;  2YX1 A;  3T1H J;  1U8W A;  4J9K A;  3KUG A;  2QJ3 A;  2A2C A;  4HYK A;  3ZZU A;  1NDK A;  2QT7 A;  2CAD A;  4J9R A;  4KE5 A;  3QZ8 A;  3IG1 A;  1X4H A;  2AHO B;  4IOA Q;  1N6Q A;  1HYS B;  1WHY A;  1QVG R;  4UZB A;  3M8Q B;  2V67 A;  4WFN Q;  2J9E A;  1C1B A;  3MPD A;  4USK A;  1RT4 A;  4RW6 A;  2B0G A;  4WXW A;  3AT1 B;  3OVS A;  3TP2 A;  3WX4 A;  1KBR A;  2ZFH A;  3I0R A;  5GAG I;  3UD5 A;  1IUJ A;  3NAI A;  1U1Q A;  1C2P A;  2RAQ A;  2DD8 S;  2LQ5 A;  4ER8 A;  3RJM B;  1BD6 A;  5DLG A;  1H2T Z;  1WD6 A;  1YSJ A;  1JNZ B;  2C3P A;  1TAQ A;  4B3M F;  3HX9 A;  2NPF A;  2B56 A;  4K4S A;  3BR9 A;  5EWG A;  2BVZ A;  1VBZ A;  3B82 A;  1SV5 A;  4B08 A;  3OTD A;  2DTJ A;  2N7Y A;  4A8S A;  2XBP A;  4B3M J;  2F8H A;  2RKI B;  5SZT A;  1SJ4 P;  3FBE A;  1RAG B;  5JVH Q;  2DJW A;  3S1T A;  5BJR A;  5K8P A;  1NK6 A;  1ARO P;  1FE0 A;  5IC6 B;  1UJ4 A;  1JWW A;  5KG5 A;  4Y0F A;  3QGG A;  3M8S A;  3Q8R B;  1KFS A;  1T94 A;  4U95 A;  4OX9 F;  3TRG A;  3GIM A;  2DHH A;  4GVL A;  3AY0 A;  3MD1 A;  5D6G A;  3H25 A;  4OX9 J;  1KLN A;  2GZO A;  4WYW A;  2CQI A;  1YKW A;  4EBD A;  4CT8 A;  2R2T A;  3Q8Q B;  3V4I B;  3HFK A;  3ZNJ 1;  2VG6 B;  3GTY X;  3JS9 A;  5IQ6 A;  3NXZ A;  5F8G A;  3SI8 A;  2MJU A;  3OTC A;  4CH1 A;  1RGV A;  1HQE A;  2D3U A;  3G86 A;  2HAI A;  2FJW A;  3NLC A;  2ZE2 B;  3UD4 P;  3V81 A;  4DI6 A;  2JC0 A;  1RT1 A;  1S6Q B;  1N5Y A;  1F5C A;  3DRR A;  3H2V E;  4F36 A;  4N5S A;  2NUU G;  2Z8Q A;  3C15 B;  3I0S B;  2DNK A;  1HA1 A;  1TV6 B;  4C8K A;  1N54 B;  2QLJ B;  2F4V F;  1VHF A;  2EK1 A;  2KL8 A;  3ONQ A;  4QPT A;  1Q82 T;  2GAG C;  4F4X A;  2XUL A;  3M9O B;  2W24 A;  3QQC D;  3TOQ A;  3OFE A;  1ZAW A;  4J37 A;  1UEV A;  4MFB A;  2E7V A;  3FK4 A;  1TL7 A;  2BMB A;  1SQG A;  5J2P A;  3MI7 X;  4RW8 A;  1NHU A;  5LT5 A;  1LWC A;  3KUH A;  3I9V 9;  4ZS6 A;  3B4D A;  3H90 A;  5K5M A;  3TZZ A;  1RHR B;  1YJT A;  1NRK A;  3U02 A;  4NMX A;  4MT1 A;  2UUB F;  1RT5 A;  3BF4 A;  4UY8 5;  4ZVH A;  5K14 A;  4DF4 A;  1EET A;  3AXM A;  5H9F J;  5CD4 H;  3NNH A;  4BHQ A;  2WSF C;  1FNM A;  3AFG A;  2UUB J;  1HMV B;  2N3O A;  2XSJ A;  4F3M A;  2IAJ A;  2CAJ A;  4S0M A;  2FC8 A;  4Y6I A;  1HWJ A;  2V5H G;  3UCU P;  4OYM A;  1VMB A;  1FXR A;  4G3I A;  1KFD A;  3GV7 B;  4C7Q A;  4C8O A;  3O2I A;  1IVZ A;  3C6U B;  2HWI A;  4CI0 B;  2ASY A;  4ZJQ A;  2KJW A;  2XS5 A;  4I64 A;  2D9P A;  2X3D A;  1RTJ B;  4HHU A;  1U1O A;  4OLP A;  2EFN A;  1ZS6 A;  4ZMM A;  2QE5 A;  3NS6 A;  5KFG A;  5DQI A;  1O8B A;  3EMT A;  1KOO A;  2V4R A;  1M5V C;  2H5E A;  5J2Q A;  4R5P A;  1H0H B;  1KS2 A;  4LF7 F;  4NYP A;  2HZV A;  1TFY A;  1Q8L A;  1RWV B;  2B4U A;  3PZP A;  3LAK A;  3RW6 A;  1P9Q C;  2V2V A;  4C8M A;  4NI2 A;  4H4O A;  2YNI A;  3DOM A;  2J7W A;  4YY3 F;  3D5M A;  1A7G E;  1FA0 A;  1VK3 A;  4KO0 A;  2OEM A;  4DS4 A;  2IRY A;  4IKA A;  4U96 A;  4ZP6 A;  1HD0 A;  2XB2 D;  5A0Y B;  1PC4 A;  4H4M A;  5KFY A;  2YXL A;  4J9Q A;  1G7C B;  1PO6 A;  2HFZ A;  3GSD A;  4DV5 J;  3WX8 A;  4QPX A;  3KNG A;  2UU9 J;  2VOO A;  5IT9 U;  3NRB A;  4CTA A;  1NH7 A;  1S59 A;  2DNR A;  2LXU A;  1YJR A;  2WSE C;  4NX9 A;  4B3R F;  3I4H X;  1ROF A;  3DOK B;  3S01 A;  3HP6 A;  4NCG B;  3W63 A;  4F0H A;  4NLY A;  2PD1 A;  1S10 A;  1SJ1 A;  2VFS A;  4BCA A;  1VIS A;  4B3R J;  3JYT A;  1N0V C;  2QL5 B;  4ZP7 A;  5ETK A;  4JBC A;  3GII A;  4OI4 A;  1NKE A;  2QL9 B;  3HVA A;  5HN0 A;  3HF5 A;  2GS8 A;  3VAM A;  1U0H A;  1U6B A;  1PBA A;  3L3C A;  4NLW A;  1JLC A;  4I7F B;  4IR9 A;  1NDL A;  1YI2 S;  1YTY A;  4ED3 A;  2YPY A;  1XMO J;  2I2Y A;  2IJF A;  2CJ9 A;  3R7B B;  3FMB A;  4B3O A;  2RF2 A;  3ADA C;  3CCE S;  1M90 T;  3BQ0 A;  4CLW A;  3MR5 A;  3W9H A;  4O44 A;  2W9C A;  3B78 A;  1ZTW A;  1HPZ A;  1YK9 A;  1TKD A;  3ITH A;  4TKT A;  5D8H B;  2X1B A;  3VAG A;  1V5I B;  3J80 U;  3QAT A;  1N5S A;  3MEE B;  1A0O B;  3LPY A;  1AA1 B;  2CQ1 A;  4OJH A;  3BKT A;  3J7A N;  1NJI T;  1Q8B A;  1LV5 A;  2HNZ A;  1FK9 A;  1ULR A;  1XMB A;  5GAE I;  2OUG A;  4YUD A;  2F8M A;  3OL7 A;  1FDA A;  4HLB A;  1TL1 A;  2HHH J;  2EG2 A;  1GXL A;  3B54 A;  4FNI A;  5KG6 A;  2AD9 A;  4ANC A;  3JTN A;  2EEY A;  1PCA A;  5KT4 A;  1NSP A;  4NLV A;  4M63 A;  1WNE A;  2AEM A;  4FYW B;  4A8F A;  4ECQ A;  3OHB A;  4USH A;  1N36 F;  2CQ2 A;  4XDC A;  3MR3 A;  1WG4 A;  1UW9 A;  1OPZ A;  2MMY A;  1RBL A;  3CDB A;  5EX0 A;  4ZOS A;  1DQA A;  2D69 A;  4F0M A;  2C3M A;  2C3U A;  3AJ2 A;  2ZD1 B;  1IKY B;  3BYR A;  1MW7 A;  1DHM A;  2BYC A;  3KLF A;  3ETM A;  2A0F B;  3CCS S;  4V1A k;  4N76 A;  1XBW A;  4HDH A;  4ZPC A;  3HVW A;  2JEJ A;  2EG1 A;  3A13 A;  4ZPD A;  2VZ9 A;  5HMY A;  4KPY A;  2DHA A;  3PYF A;  5KFW A;  4I4B A;  3VTI A;  2OAU A;  3D3C J;  2LEP A;  1NME B;  3TUZ C;  2UXD F;  5CYM A;  2X1F A;  4FVM A;  1S1T B;  4LVN P;  2C1E B;  4LR8 A;  4DCJ B;  5M2U A;  3PJ9 A;  2XC9 A;  2AP6 A;  3C16 B;  3SQO P;  1D9A A;  4JV5 J;  4RUC A;  3K2Y A;  2HFV A;  4KSE B;  3MGJ A;  2RSQ A;  1U1L A;  2Y1L B;  3EDQ B;  3MM7 A;  1BUX A;  5L1I A;  1NJY A;  1TKX B;  2DXD A;  4LRC A;  4L75 A;  2NSB A;  4I1T A;  1F0X A;  4X4O A;  2LCW A;  5BYQ A;  1KQF B;  2NSC A;  1REG X;  2MZ1 A;  1ZA1 B;  3PKM A;  1CLF A;  2B4O A;  1FJE B;  1Q5Y A;  3WQP A;  2KI2 A;  1DTT A;  2KZM A;  4IQM A;  4MIW A;  3U1M A;  3HHN B;  2FJB B;  2H54 B;  4N56 A;  5D0R A;  5F3T A;  2XI3 A;  1RDR A;  3ZO7 A;  1CVJ A;  4ZVG A;  2AMC B;  4XK8 C;  2RQ4 A;  4CO1 A;  4CQ1 A;  3J7A 1;  2CQ3 A;  4X4V A;  4KPC A;  2EK6 A;  3KDO A;  2ZWP A;  3P3D A;  2YNG B;  2MQN A;  4KGM A;  1Q78 A;  3RG6 A;  1IR0 A;  3AD8 C;  2WON A;  1XNR J;  4HH0 A;  3K0J A;  3KLV A;  1RXO B;  2HG4 A;  2KXF A;  1NCL A;  1IWG A;  3P5B P;  2BKP A;  2I1R A;  2BAC A;  3HJF A;  4P9S A;  3BRE A;  4O3S A;  3CE8 A;  4PG4 A;  3R27 A;  2Y8W A;  2KH9 A;  4DL3 A;  4O4G B;  3OFH A;  3MEG B;  1RT3 A;  5KFA A;  1EJ7 L;  1UET A;  1SC1 B;  4LRF A;  5AE2 A;  1DY3 A;  4OZ5 A;  2X3G A;  1C4C A;  3HVR A;  3K5L A;  3W8G A;  3T1Y F;  4B3S J;  3M8W A;  4YDD B;  3OTB A;  4J9P A;  5KT2 A;  4IDK B;  5HL7 Q;  1GX5 A;  2K7J A;  2I8E A;  3DLJ A;  3H98 A;  2FZK B;  3P45 B;  5KG7 A;  2ZZT A;  3MMB A;  1U1K A;  1J5O A;  4YR2 A;  4ED2 A;  1GXT A;  1LWX A;  1FX4 A;  5THW A;  2C2Z B;  2CIM A;  4Q2M A;  1OQ3 A;  4F7V A;  2R7R A;  1VBY A;  4RNO A;  4GO7 X;  2K8G A;  3MM5 A;  5BR8 F;  5B0B A;  2RIL A;  4ED1 A;  1NXI A;  2WVD A;  2J7U A;  2DNQ A;  3NWR A;  1RU1 A;  2ILZ A;  2XWY A;  1JXE A;  2RU3 A;  2XY5 A;  1UFL A;  1RTH A;  3AOA A;  4ZJO A;  3Q8S B;  5DG7 A;  1DAX A;  2HBQ B;  2J9D A;  1U26 A;  4GKJ J;  3CB4 A;  2I5J A;  3CJK A;  5F9L A;  4UQG A;  4I6A A;  4Q45 A;  4K4V A;  3UI3 A;  4P75 A;  1SUQ A;  4YR0 A;  4U7U D;  1SJF A;  1FXD A;  2VG5 A;  2L41 A;  1S97 A;  1C0T A;  2XSF A;  4J9N A;  4BWM A;  3RUB L;  1L3S A;  2YX4 A;  3PYE A;  2CFX A;  3OSN A;  1S0O A;  5D0E A;  1BXN A;  1RJJ A;  1S0N A;  3R5G A;  4Y2I A;  3QSI A;  5SUH A;  3FVY A;  1P1T A;  4W98 A;  1WTF A;  4DPY A;  4EK2 A;  3QZ7 A;  3IGN A;  4NPO A;  4RKU C;  1TK5 A;  4KGX B;  2AV5 A;  1CPZ A;  3OR1 A;  2HYI B;  3TA0 A;  3H5Y A;  2JLE A;  3LAN A;  1M1H A;  4DR4 J;  2G2Z A;  5K20 B;  1UPM B;  3GZ7 A;  4RUB A;  5KFL A;  3BM7 A;  4UOG A;  1ITP A;  3PCO B;  3EXC X;  5I3P A;  1ZYQ A;  1Q7Y T;  1UFK A;  3EZU A;  5C24 B;  4QR0 A;  4F4W A;  4LF8 J;  2V8V A;  2OSR A;  5HMX A;  3NBP B;  4BC9 A;  3KK3 A;  1PSD A;  4K2X A;  1FRI A;  1TMM A;  4EZ9 A;  2H1Y A;  2HGL A;  4ES1 A;  2ZJQ Q;  4UW2 A;  3MXH P;  4Q8E A;  2AWZ A;  5HLF A;  4CLL A;  3DC2 A;  1FJ7 A;  5IWA F;  1HKA A;  1VCT A;  1CUL B;  3CJ3 A;  2V4J B;  4ZVS B;  1LFW A;  2G9O A;  1LWF B;  4NML A;  2PC6 A;  5I3U A;  3CCV S;  1BWV A;  4WJB A;  2VC1 A;  3R6G B;  4B3T J;  2LQB A;  5DS7 A;  1XNQ F;  1R27 B;  4YB5 A;  2OTJ S;  1UJ6 A;  1WUU A;  2V0N A;  1LK5 A;  2KFY A;  2MTL A;  2ERR A;  2BE2 B;  4M94 A;  3IG1 B;  4RWW A;  4DX6 A;  1T02 A;  3AQP A;  3CDU A;  2LDY A;  1N6Q B;  3HCX A;  4R0E A;  3G71 S;  2VBW A;  1XER A;  1J5E F;  1C1B B;  3M7V A;  1RT7 A;  4K4W A;  2OEK A;  4RW6 B;  2FJE B;  1S6O A;  3R2D J;  3CIZ A;  2FHJ D;  4GVB B;  4DCO B;  4CP5 A;  3OLB A;  1WC5 A;  3BGO P;  4AL5 A;  4M5D B;  4N8O A;  2UVU A;  4DMZ A;  4JI3 J;  4OLO A;  4L3N A;  2ALY B;  2HBY B;  4USW A;  3W2W A;  2CPE A;  4CLS A;  2VB6 A;  2ZNY A;  4DLG A;  5LSR A;  1UMJ A;  1NB2 A;  4GRS A;  2NRE A;  1JIH A;  1UP1 A;  1SV5 B;  3UN2 A;  4ZVT B;  5IV3 A;  2C28 A;  3LGH A;  4PXD A;  3TI0 A;  2QLB B;  2V50 A;  4FP9 A;  3TUJ C;  2WW8 A;  4F26 A;  4OJ3 A;  2YWW A;  3LP2 A;  5DLF A;  5K8O A;  5CHC B;  2R7V A;  2M8D B;  2LQ8 A;  3W62 A;  3J81 Y;  2ZH5 A;  4AFF A;  4DR7 F;  5B0F A;  3GYX B;  1UA1 A;  1FKP A;  1HQU A;  1HNV A;  3I82 A;  2H5I B;  3RB6 A;  1ZET A;  4C0B A;  4C0H A;  4WPA A;  1VI7 A;  4MH8 A;  5IC4 B;  4HR2 A;  2E9Z A;  4I56 A;  2PI5 A;  5J1E B;  3CED A;  4DSJ A;  4JI1 J;  2GVZ A;  3IAM 9;  1T9U A;  2MZQ A;  3N4W A;  5T14 A;  5GAH I;  1UTA A;  1RAH B;  2A18 A;  2XYH B;  4OI3 A;  3W5X A;  3RZA A;  4QWA A;  1B99 A;  3PW5 A;  2E9R X;  1I94 J;  4PCQ A;  1RHQ B;  1NLK L;  4JP8 A;  3TAR A;  4DR5 J;  1NK9 A;  1Y3J A;  2E5L F;  4J9U E;  1M1K T;  3JAM U;  4A46 A;  4CNY A;  2AZ1 A;  3EZO A;  3O6Q A;  3V81 B;  4FN5 A;  3OV7 A;  1H7X A;  2E5L J;  2GNK A;  3DGP A;  3SV3 A;  2FHJ A;  2JHE A;  4TVA B;  2J6T A;  4DV1 J;  4TY9 A;  4N41 A;  3G6E S;  3R9L A;  1ZOT A;  5D3G B;  1SIZ A;  2DNM A;  4LF9 J;  2RVJ A;  1FES A;  3PW2 A;  1U7L A;  1RKI A;  3DRP B;  1CJV B;  4MKA A;  4LF4 F;  3MMC A;  2GFF A;  4YHH F;  2JJ4 D;  3PJX A;  4B9M A;  3W60 A;  2V63 A;  2LEB A;  3I87 A;  4FS2 A;  2HVE A;  5DJB A;  4FYD A;  4LF4 J;  1SC4 B;  1UJ5 A;  3D2W A;  2Y9H A;  3OXF A;  1K9M T;  4RW8 B;  2BJE A;  4DUT A;  3MUM P;  4OX7 A;  2VQF F;  3L7O A;  3ZFV A;  1FD2 A;  4EO8 A;  2DR6 A;  3FSI A;  3LO3 A;  1RT5 B;  2Q79 A;  5K14 B;  3PHT A;  4NRT A;  5EHH A;  3A4T A;  4PXB A;  1RU2 A;  3OUY A;  6FD1 A;  2HKE A;  2EWH A;  1IBM F;  4EU0 A;  1N52 B;  1VIO A;  3D1Q A;  3NOG A;  2F9J A;  4EBE A;  3BGU A;  2D3O 1;  3NNA A;  1WOR A;  4A8W A;  3M8P A;  2VBX A;  5L9N A;  2QMU B;  1HAR A;  5IZH A;  4PKD B;  2A6O A;  1RE1 B;  3KXD A;  3HZG A;  3GSI A;  3TJ8 A;  2CJK A;  2RNE A;  1LK7 A;  3LAL A;  4RBU A;  1APS A;  2FVQ A;  3UWT A;  1EAY C;  1F6T A;  3H2U B;  1IKX A;  5J2Q B;  4O4R A;  2LU2 A;  4R5P B;  4RZR A;  2ASD A;  3C19 A;  2HPU A;  3A8I A;  1MMD A;  5KG3 A;  2RRN A;  3OL8 A;  4H4O B;  2YNI B;  3AH6 A;  2D1C A;  1IKV A;  1T05 A;  2J6S A;  3HHL C;  3OHA A;  4DV4 F;  1D0E A;  4X4P A;  4RW7 A;  1D8Y A;  1RBO B;  4K4T A;  3M6X A;  3ILL A;  4JV1 A;  5E3A A;  1AUS L;  1RWP B;  2P6S A;  2BKN A;  2PMW A;  4AUK A;  3D66 A;  1MU2 A;  4M5M A;  5L46 A;  1EP4 A;  2FB0 A;  2FUG 9;  4TN2 A;  3J7Z 5;  1RA6 A;  3CDE A;  2G4B A;  4IFV A;  2YKO A;  4GMK A;  2R4F A;  4K59 A;  1CC8 A;  4OI1 A;  1OY8 A;  2GVD A;  3CMA S;  4ZLJ A;  4LFC F;  3QO9 A;  4LRD A;  4DX7 A;  4WFZ A;  4MKY A;  2HHW A;  3V5R A;  2BKO A;  2E66 A;  2GGP A;  2GQ2 A;  1KVK A;  1N33 J;  4QR2 A;  2B3T B;  4WYL A;  4DR3 J;  4DSE A;  3VAK A;  1IWA A;  1HBN A;  4FPR A;  2MKI A;  3NGT A;  3OJS A;  1W7W A;  3P4U B;  4MIB A;  1S9E B;  1U0H B;  3I55 S;  5DQH A;  5ETN A;  4JYA F;  3MM8 A;  4QWC A;  2V34 A;  4DV7 F;  1CJT A;  2LFV A;  5HQL A;  4B3O B;  1S76 D;  2B4P A;  2R42 A;  4WE1 A;  1SKW A;  4FS1 A;  3V6D A;  1BHN A;  5IXU A;  5GAG U;  3PTW A;  1VQ7 S;  1E6Y A;  3W64 A;  1XK8 A;  1EQ0 A;  1FCA A;  1X4G A;  3GR1 A;  2POK A;  3DM2 A;  5ETP A;  4ERD A;  2JEF A;  1NPP A;  2XYG B;  5CCL A;  4OYP A;  1K0T A;  5G4D A;  2DBB A;  2DHG A;  2V2Q A;  1X4C A;  4DX8 H;  4LJM A;  5DDQ C;  1X5T A;  5C25 B;  4O3P A;  4MJK A;  3MUR P;  5HRO B;  2F7V A;  2YY3 A;  3NKY A;  1X9W A;  4F0K A;  2G13 A;  1Z4U A;  5L1L A;  5L8R C;  3D6F B;  3BPS P;  3QRR A;  4LFB J;  1X5O A;  1L3U A;  4LRE A;  1TFW A;  5J2N A;  1IR2 A;  4TYA A;  3ENQ A;  2EFP A;  2DRB A;  1R8P A;  4DV2 J;  3QID A;  1B3T A;  2RHQ B;  4LVO P;  2G1D A;  2BE9 B;  1JNR B;  2O67 A;  4GC6 A;  4M1K A;  1S57 A;  3ZXW A;  1FE4 A;  3UE2 A;  2DYA A;  3LP1 A;  2C22 A;  2CPI A;  1FDN A;  3KK1 A;  3BN4 A;  5DZ7 A;  2NYI A;  3C14 A;  2HIQ A;  3MAQ A;  2FLL A;  3W5Z A;  4JI6 J;  2JNJ A;  4X65 J;  2HZC A;  5F8M A;  4DSF A;  2BOP A;  4X62 J;  4ES2 A;  4RNF A;  1CQN A;  2DR7 A;  5B0D A;  4PUO A;  3Q2S C;  3RW7 A;  3SIP B;  5F8J A;  3IA0 A;  2DR8 A;  1HBU B;  4ZVR B;  3IBF B;  2IDL A;  5J1N A;  3NS5 A;  4OZL A;  3K5N A;  3LH2 S;  2GQC A;  1U1M A;  2J0S D;  3Q8V A;  4Z2X A;  2YX7 A;  5DDP C;  1Y5N B;  2B7B B;  4OL8 A;  1GMV A;  1PAU B;  5F8I A;  1C1C B;  2XMW A;  2W8K A;  4WK3 A;  1S1V B;  3MM9 A;  1JXV A;  3M9N B;  1S9G A;  2JFK A;  3BN7 A;  3ZZZ A;  2RQC A;  2XNR A;  3FKB A;  3Q22 A;  1EQM A;  2KFZ A;  3DRS B;  2VIC A;  1QSL A;  4KBI A;  1CEZ A;  4I6Y A;  2DNH A;  2V6A A;  3DLE B;  5MAO A;  3OR2 B;  4KGK A;  1FKO B;  1WJ9 A;  5L39 A;  2K3I A;  5BYS A;  4YN3 B;  3DGV A;  3G2X A;  1UFW A;  2MLX A;  5D0H A;  5IM0 A;  1FHT A;  1RT2 B;  3M2R A;  1NU4 A;  2UXC F;  4URG A;  2DKO B;  1I3O B;  4RW9 B;  1UWB A;  2M9K A;  1PYT A;  1L3K A;  1LW0 B;  3LGM A;  4KFB B;  3IWN C;  4YB6 A;  4OYO A;  3TAM B;  2XCP A;  4YOE A;  3GIJ A;  3HHK A;  7FD1 A;  2NLW A;  1NDP A;  3E2E A;  4L6V 3;  3ZZR A;  4FF2 A;  3CF5 Q;  4LF1 A;  3CD6 S;  4OI2 A;  2CVE A;  4DV0 J;  1UAW A;  2PDA A;  3TWZ A;  2VA3 A;  1WOO A;  4RW4 B;  4UF4 A;  3K17 A;  3W61 A;  1S48 A;  2IFX A;  4TLR A;  1FXL A;  3P96 A;  3UDC A;  2Z2L A;  4OHY A;  1KC8 T;  4QJV A;  2DCL A;  1WC1 A;  3M2U B;  2KXH A;  3W7B A;  4K0K J;  3GJT B;  2DR5 A;  4M5I A;  2Y1R I;  2AJQ A;  1QJH A;  4OZ3 A;  3BO3 A;  1VRQ C;  2GA7 A;  4OYW A;  1C0U B;  2K1R B;  2BRL A;  3N6M A;  4EYH B;  4D3H A;  1G2E A;  3MMB B;  2RRB A;  1VQY A;  1QSY A;  2XO6 A;  1RWW B;  2WBM A;  2HND A;  2WOM B;  3G6X A;  5HMW A;  2OPR A;  3LGN A;  5D78 A;  3CT9 A;  2KO1 A;  4NA3 A;  4TQR A;  3RB0 A;  1DLO A;  2YWK A;  3FRZ A;  2MLZ A;  2EVZ A;  3W5Y A;  3CC4 S;  3HD1 A;  4DUZ F;  4Y3C A;  2D74 B;  4WFX A;  1RWM B;  3TJ9 A;  2GCF A;  3X1L B;  1RIS A;  4RUH A;  4MYT A;  3M32 A;  4ZPW R;  2D41 A;  1NND A;  1GNK A;  1ZZF A;  2J0X A;  1YG0 A;  1T9Y A;  4AT1 B;  2DO4 A;  2I5J B;  1RT6 A;  1T9T A;  4J9O A;  2MDA A;  4Q0B B;  4PXE A;  3CJ0 A;  3ZC4 A;  1UL3 A;  1F5A A;  1RSC A;  1GX6 A;  2WSC C;  3LWL A;  2OPS B;  4PQU A;  1NO8 A;  4KHP J;  3KNA A;  1JLA B;  5ETV A;  2YNF A;  1URN A;  3DRY A;  2EXU A;  1B4S A;  3EVM A;  3QLH B;  4DPO A;  1FDB A;  1AW0 A;  2B6A A;  3GCX P;  3C8Y A;  3SCI E;  4YFU A;  1P27 B;  1KQK A;  1OY6 A;  3M9M B;  3ZZP A;  3LP0 B;  2JZ5 A;  2V94 A;  1AB8 A;  4XDD A;  7AT1 B;  5E7O B;  1U2F A;  4QIG A;  3H40 A;  4IG3 A;  3TAN A;  2DB1 A;  3KLG B;  1AFJ A;  5E41 A;  4MKV A;  2LA4 A;  5LMN F;  4FBU A;  4H54 A;  2HVI A;  2R8J A;  1R31 A;  1TL4 A;  3A3P B;  2ZUA A;  4HT7 A;  1EAR A;  2EKN A;  2CXE A;  4CM0 A;  4AYB D;  1V3Z A;  5KAK A;  2OFH X;  4DR2 F;  2CUY A;  2RD5 C;  1WAC A;  1SH2 A;  4JV0 A;  3VQS A;  2CWX A;  1HR0 F;  2DY9 A;  5J2M B;  2F40 A;  1HWL A;  3PNI A;  2F8E X;  4EFA C;  4DL6 A;  4ZHR A;  3EJM A;  2H4Y B;  3IO1 A;  1RAB B;  3M05 A;  1M5P C;  2M0G B;  4O23 A;  5E2Q A;  4C11 A;  1NUE A;  4DV6 J;  2I38 A;  1K73 T;  2FVP A;  2PO4 A;  3TZX A;  3UPF A;  4KKO B;  3HUL A;  4IRK A;  1FI4 A;  2CQB A;  3PIO Q;  2BBE A;  2PFD A;  5KFV A;  2PEB A;  1G1X A;  3UDE A;  2FJD B;  2Q43 A;  4KH1 B;  1WDD A;  1PGZ A;  4P2X A;  3CJ2 A;  4PWD A;  4M95 A;  4M5L A;  2XHW A;  4MYU A;  5E3C A;  4WU2 A;  4OI0 A;  4NRU A;  3DLG A;  1VRU B;  1L3T A;  1S1W A;  2ADC A;  4RU2 A;  1HNZ J;  3P5T L;  1TL3 A;  4E2F B;  4JV2 A;  4K5S A;  4BLG A;  2JC1 A;  2QSW A;  1JJ4 A;  3PW0 A;  2RB7 A;  4ECX A;  1GT8 A;  2DIT A;  1TUW A;  3OTO J;  3DXS X;  4DHV A;  4LSN A;  3D1H A;  4N77 A;  4RLE A;  1FEH A;  5KFE A;  1RAF B;  3NCQ A;  2L08 A;  1E6V B;  4WBF A;  3CC7 S;  1SL0 A;  1NBE B;  4G6V B;  4NAS A;  3GJR B;  4DL4 A;  4DL2 A;  4RNM A;  1TVR B;  2DNL A;  3LP2 B;  1QUV A;  4XPC A;  3NGR A;  3L7P A;  4NLT A;  4DR1 F;  3BO4 A;  1KLM B;  5HAN A;  3KK2 A;  3GR0 A;  1FKP B;  1YJW S;  3KLH A;  4LF5 F;  1WKL A;  5ETL A;  4A47 A;  2KT3 A;  1WC6 A;  3PYD A;  2AW0 A;  2UV8 A;  2GVZ B;  5L1K A;  4OZ0 A;  1NK5 A;  1S1U A;  5AJ3 F;  2QV6 A;  1XMQ J;  4C3L A;  1X5S A;  4R8U B;  2FD2 A;  4K7Q A;  1Y9O A;  1V5V A;  3KJQ B;  4G1Q B;  3E51 A;  5I42 B;  3AQO A;  2YWH A;  1N34 F;  2OPP B;  2KZZ A;  4HEA 9;  4IOC Q;  2ILY A;  2VQE J;  5HP1 B;  2HHQ A;  2ATL A;  2YKN A;  1HI0 P;  2W7P A;  4USU A;  2NXE A;  1S5Z A;  4I0W A;  5EWF A;  1TL5 A;  3EM1 A;  3BSN A;  1JLG B;  1M5S A;  4B9S A;  3UR0 A;  1JLE A;  1EIY B;  5IS2 A;  1SI9 A;  5ETQ A;  1F3V A;  3R97 A;  3RBD A;  2CJY B;  3M8Y A;  4LSL A;  2B43 A;  5ITH A;  2D3O R;  1TKT A;  1N4L A;  3SQG A;  2XEX A;  2CQC A;  2KFN A;  3BGR B;  4ICL B;  3FFI A;  3K7R A;  5BYR A;  3SMZ A;  1TAU A;  5GVQ A;  4OZ2 A;  2FVS A;  1Y4Z B;  2QA4 S;  3MF5 A;  2C3Y A;  1FRJ A;  3KLE A;  1M5H A;  1N88 A;  4AD6 A;  2VG7 A;  1W2I A;  2UUC J;  1T95 A;  4F3Q A;  2QYC A;  1AZS A;  2ZZM A;  2W7A A;  4DR6 J;  3W9I A;  9ATC B;  3PG9 A;  1KON A;  3RR8 A;  4QWE A;  1KHW A;  4OHX A;  4DS5 A;  3BSC A;  1SB6 A;  3OUY B;  4OQJ A;  2DH9 A;  2C2R A;  1XC9 A;  1XN9 A;  2CVI A;  3TVY A;  3HFZ B;  2HHS A;  2BM0 A;  2HNY A;  4RNH A;  4G1P A;  3DLK A;  3J80 Y;  3PEJ A;  4LIR A;  4Z37 A;  4RBT A;  3ZZT A;  3KLI A;  3TO8 A;  2CPH A;  3TX8 A;  2JVO A;  3F73 A;  3N0V A;  1RYS A;  1P6T A;  1SC3 B;  1SXL A;  2V8G A;  5IV4 A;  1D1U A;  3U27 A;  4X84 A;  1R7I A;  5DET A;  4MK8 A;  1LW2 A;  1FNX H;  5HBM A;  1JXL A;  4L74 A;  4OYZ A;  1N32 F;  2Q1L A;  2HVH A;  2IDE A;  2BAN B;  3BBF A;  3DOL A;  5JXS A;  2ASL A;  2P5V A;  1RTI A;  3PYG A;  3FQL A;  1RK8 A;  1R8A A;  3ZZY A;  5T7L A;  4X66 F;  1S6P A;  2MHN A;  3MED B;  5DG8 A;  1R0A B;  3R5A A;  5DDR C;  1T05 B;  1IQZ A;  5B7W A;  4RW7 B;  1Z2Z A;  4U67 Q;  1MRO B;  3FQK A;  3IFE A;  3P8B B;  1RHK B;  1U25 A;  4DQR A;  1NSK L;  4KTQ A;  1N56 A;  1NEE A;  1O6X A;  1VC6 A;  1NKB A;  1MU2 B;  2QLW A;  3OLA A;  3HHL D;  4ZVP B;  3GE9 A;  4F3O A;  2K7K A;  4AQY J;  2QN6 B;  1Y00 A;  2NZ4 A;  4Q5V A;  1T9X A;  1PYO B;  4OYI A;  1REV B;  2VV5 A;  2QX0 A;  1T03 A;  1Q1K A;  1SCJ B;  4KY3 A;  1VQS A;  2ZH6 A;  1CJK B;  1QE1 B;  2QL7 B;  4O3R A;  2M3D A;  4AND A;  4XO0 A;  4M5J A;  2ZWO A;  6FDR A;  1WHV A;  4HKQ A;  4EMD A;  4W4M A;  3BPD A;  4CYU A;  3TVK A;  1CS4 A;  3TYT A;  2HBZ B;  3MD3 A;  3MM8 B;  1HBM A;  3VCD A;  1SL1 A;  2DNZ A;  4DUY J;  1N5V A;  1JK9 B;  1R43 A;  1SH3 A;  5L9X A;  7FDR A;  2HHX A;  3BS9 A;  2R9L A;  4OZJ A;  3QIP B;  3V6D B;  2AYE A;  3WIV A;  1RLD A;  4WTO B;  1FWP A;  1LWE B;  2DNO A;  4NZ6 A;  1QD1 A;  1S0M A;  4X4T A;  3BKU A;  3BR8 A;  4HHH A;  3DRX A;  4RBV A;  3PRV A;  5D77 A;  2FLN A;  1GTE A;  3AOD A;  4XAK A;  2SXL A;  4UT4 A;  1TMJ A;  3QGI A;  5KFD A;  2XMJ A;  3HHL A;  1R8C A;  5J2N B;  1SL2 A;  1RTD A;  3FEX B;  1N5Q A;  5A8K A;  4JI4 J;  1EX8 A;  2OFG X;  5HSP A;  1HNX F;  4V19 X;  3GQC A;  3KG0 A;  2COL A;  2HWT A;  5E3P A;  5H9E K;  4AE5 A;  3G9C A;  3HJV A;  2DPJ A;  5HK4 A;  2LEA A;  3R3T A;  5C42 B;  4CLU A;  3HM9 A;  3Q23 A;  1X60 A;  2RQM A;  4JI0 F;  4RUA A;  1HWU A;  4AXI A;  3Q8P B;  2UUA F;  4ED5 A;  2HHU A;  5GAH U;  2AEJ A;  4C9D A;  3FRY A;  2UXB F;  3HXM A;  2KB2 A;  1WG1 A;  4KGZ B;  1S1X B;  2UUA J;  4FF4 A;  2AJ4 A;  2HS0 A;  4XTT A;  2CDQ A;  4KGV B;  4ZJL A;  3PX4 A;  1X7V A;  3H4D A;  3GCW P;  2F1F A;  3RBE A;  2AJ1 A;  4RNN A;  3LW5 C;  5K8N A;  1NAQ A;  2DXE A;  1D9D A;  3SV4 A;  1QAI A;  2W9A A;  1HYS A;  4J9L A;  3VQT A;  2W9B A;  4HAC B;  3BQ1 A;  1SQF A;  3D4J A;  3ISZ A;  2MGZ B;  3PY8 A;  1OSD A;  2KHC A;  2XLI A;  3CIM A;  2AT1 B;  4UUW A;  2AJ0 A;  4KR0 B;  3S7R A;  1NK4 A;  3FEY B;  3G8S A;  2HQF A;  1TUG B;  1H73 A;  2WVE A;  3GLJ A;  2YKP A;  1HHT P;  4F04 B;  4C8Y A;  1VQN S;  4FVC A;  3AJ1 A;  4LR7 A;  3KYL A;  4ZVU B;  2MZT A;  5FDL B;  4LMZ A;  4PWU A;  2E5J A;  4DPU A;  5AE1 A;  1VFJ A;  1NHV A;  3IRX B;  5IM0 B;  2RKI A;  2MKJ A;  4FKY A;  4NXN F;  1KD1 T;  3L9Z A;  3FDS A;  3T6J A;  5AE3 A;  3RB4 A;  4EBC A;  4WF9 Q;  2O5D A;  1WI6 A;  3LF0 A;  3GG1 A;  2I9S A;  1LXJ A;  1ZTT A;  5B08 A;  3E01 A;  5KFT A;  2KVQ E;  4QWB A;  3CPW R;  2YQ3 A;  4TXS A;  1I6J A;  4OIX A;  2NXN A;  3T9N A;  4F4Z A;  1HFE L;  3HO1 A;  2PT0 A;  2XMK A;  2VG6 A;  4NWB A;  2GJ2 A;  3NCP A;  1FKA F;  3OFG A;  2OEL A;  1R3N A;  2M88 A;  3TVZ A;  4DL5 A;  2MQQ A;  3GYG A;  4OHV A;  4WII A;  3DHX A;  1EB0 A;  3I56 S;  2ZE2 A;  3AD7 C;  1S6Q A;  1U24 A;  1S12 A;  1IBL F;  3H8Y A;  1S4E A;  3OQ2 A;  3C15 A;  3I0S A;  2NS1 B;  4IO9 Q;  3JTO A;  2ZH8 A;  3GV8 B;  3Q8U A;  2C2E A;  3MDF A;  4ELT A;  3GG0 A;  2VON A;  5D0G A;  2GHV C;  1NK0 A;  3ULH A;  2OKQ A;  2HND B;  1BLU A;  2F4V J;  2WVC A;  2IYG A;  1S77 D;  1SJQ A;  2WZ1 A;  2BM1 A;  2HFO A;  1Q16 B;  3QT7 A;  3FCH A;  1W26 A;  1FWK A;  1Y3K A;  1H38 A;  1ZPV A;  4ID5 B;  8RUC A;  3IM9 A;  2XHC A;  2R2S A;  1U47 A;  2IMW P;  1WSR A;  3CJ5 A;  3ZTS A;  4DFJ A;  2R7S A;  1HNW F;  3GJQ B;  1T3N A;  4P2S A;  4GKK F;  4ZPA A;  1DZ5 A;  3KHL A;  1LQ9 A;  1JKH A;  3PM9 A;  3DHW C;  4B9L A;  4FKX A;  4NLS A;  1RAD B;  3EPG A;  1HMV A;  2MEW A;  3R5J B;  3BV8 A;  4OI6 A;  4ELV A;  3OBI A;  4K2J A;  1U2C A;  2P9C A;  4RO0 A;  2CPY A;  3H5S A;  2ZKT A;  4LRB A;  1RYR A;  4KC5 A;  2QSF A;  4R0J A;  5EWE A;  2PI4 A;  2NXU A;  1AT1 B;  4RR5 A;  2Z2Z A;  4RX6 A;  3LOU A;  2ZH2 A;  2ZJR Q;  3N01 A;  3PR4 A;  2KN4 A;  2Z56 B;  3IWX A;  2V8D A;  4FBT A;  2PE8 A;  4J7C A;  2MZR A;  4CRJ A;  3CCR S;  4IFY A;  4NOH A;  3NL0 A;  3X3U A;  3UCZ P;  1RTJ A;  2AQ4 A;  1PYS B;  2DIS A;  2FC9 A;  5B0A A;  4P6Q A;  4PYD A;  4DX5 A;  3VAI A;  2KG0 A;  1NM2 A;  2HVD A;  2VJU A;  2KM8 B;  4HL9 A;  4K4U A;  4X64 F;  3ILJ A;  4LF7 J;  1AXQ A;  3GFX A;  4X4S A;  3CJR A;  3LUY A;  1N5T A;  4YY3 J;  3BDP A;  5E3R A;  2ADB A;  2ROE A;  1X4A A;  5I3Q A;  2OHD A;  4QWD A;  3EWG A;  3AB4 B;  4NCB A;  2H48 B;  3M2V B;  4M8L A;  5A0Y A;  3JSM B;  4TNO A;  3S8S A;  2J0Q D;  2MYF A;  1QAJ A;  2VUG A;  3MR7 A;  4QYZ J;  4CLK A;  4CDI A;  3TUP A;  4C11 B;  5KOX A;  2V2K A;  3ZNU A;  3F56 A;  4K50 A;  2FVC A;  1YBA A;  3VR1 A;  4CO2 A;  5F0U A;  3UDV A;  3W2V B;  1LEO A;  1MG7 A;  2J7K A;  2WRM A;  2E1P A;  2JLG A;  5KFH A;  1ZM3 A;  2DH7 A;  3IC1 A;  2CKW A;  1HHS A;  1R89 A;  2YQ0 A;  1FRK A;  1MWQ A;  1URR A;  2ZUG A;  2RS8 A;  3PEH A;  2HMI B;  3PAC A;  3B6B A;  4HVZ A;  2HLT A;  4DV3 F;  3EXY A;  4NLD A;  3DDK A;  1S1W B;  3KJF B;  1J27 A;  1RKJ A;  1U1N A;  3GON A;  4CLT A;  4I7F A;  3SXL A;  2G2O A;  3PKY A;  4LSN B;  4DF8 A;  5HVH A;  4YP3 A;  3NNC A;  2EC2 A;  1B7Y B;  2LXI A;  1O5J A;  3RR7 A;  5DQG A;  2B4V A;  1S72 S;  4UUX A;  1OQ6 A;  2WK4 A;  3N5F A;  3DYA B;  2KHD A;  3G82 B;  4G65 A;  4IOB A;  1WHX A;  4DQQ A;  1PJ7 A;  4U6P A;  2DRD A;  5LM7 E;  3SSR A;  3MEE A;  1RAE B;  4PEO A;  2AX1 A;  2JSX A;  2XY7 A;  2AJF E;  4C8Z A;  3BDE A;  3TQE A;  2WAQ D;  3KK2 B;  5HAT A;  4I2Q B;  2VBZ A;  2J9D E;  3SDE B;  3CWJ A;  2OP5 A;  2Y1J A;  4BBY A;  3IBW A;  2XZT B;  3QWU A;  4NZ7 A;  1WOP A;  2HW3 A;  2W2O P;  4P2F A;  4N8N A;  1VHI A;  2WVF A;  6AT1 B;  2DIU A;  3DU5 A;  1VQ6 S;  1QTN B;  1VBX A;  2IA6 A;  2MQL A;  2Y0B B;  1N36 J;  2VU5 A;  3HFV A;  4NA2 A;  4QBU A;  1OMS A;  3AOB A;  5HI7 A;  4YDX A;  1SJ3 P;  4IH6 A;  2XS2 A;  3CCQ S;  5DDO C;  2MKK A;  2ZD1 A;  1P9Y A;  1IKY A;  4ZP8 A;  4ECR A;  1Y10 A;  1DRZ A;  3US5 A;  2IVY A;  2WTF A;  2ZNZ A;  1L5U A;  2VH7 A;  3F44 A;  2R2R A;  3POT A;  4U9R A;  1TKT B;  3DXB A;  2ZOM A;  4NLX A;  4JOU A;  8AT1 B;  4C8N A;  3HSJ A;  2UXD J;  3FFI B;  3MEC B;  2XWX A;  4EGL A;  2BQU A;  2XMU A;  2GQQ A;  3UW1 A;  3CNQ P;  1FJG F;  4WCE Q;  4LFA F;  4Q7A A;  1FT8 A;  3C16 A;  2EKY A;  2VG7 B; 
#chains in the Genus database with same CATH homology
 4B3R J;  5BR8 J;  4X62 J;  4LF7 J;  1XNR J;  4NXM J;  4JI2 J;  1J5E J;  4JV5 J;  4LFC J;  2UXC J;  2ZM6 J;  2UXB J;  4KYZ A;  3W1Y C;  1N36 J;  4YY3 J;  4LF4 J;  4DV6 J;  4JI1 J;  4LF8 J;  2MQ8 A;  4DR1 J;  1IBL J;  4GKJ J;  2UUA J;  3R2D J;  4LFB J;  1N33 J;  4DUZ J;  4AQY J;  2MEW A;  4DR3 J;  2VQF J;  4JI7 J;  1XMO J;  4LF5 J;  2UUB J;  1I94 J;  4PWW A;  4NXN J;  5IWA J;  5LMN J;  4JYA J;  4DV0 J;  4KY3 A;  3T1Y J;  4B3M J;  4DR5 J;  3T1H J;  4DV2 J;  2F4V J;  1N32 J;  4V1A k;  4DV7 J;  4DV4 J;  3JAM U;  5AJ3 J;  4DV5 J;  4B3S J;  4JI3 J;  3D3B J;  1IBM J;  5LM7 E;  3J81 U;  2KL8 A;  3IMQ J;  1XMQ J;  4LF6 J;  2UU9 J;  3J80 U;  5IT9 U;  4NEZ A;  2E5L J;  2UUC J;  5FLX U;  4X66 J;  1N34 J;  1XNQ J;  3R2C J;  2KVQ E;  1HNX J;  4DR6 J;  1HNZ J;  2UXD J;  4B3T J;  3J7A N;  4RJV A;  4DR2 J;  1FJG J;  3D3C J;  4DV1 J;  4JI4 J;  4JI5 J;  5A2Q U;  4LFA J;  1IBK J;  4K0K J;  1HNW J;  4LF9 J;  4HHU A;  1HR0 J;  2VQE J;  5LMU J;  3OTO J;  4OX9 J;  4NEY A;  4DUY J;  4KHP J;  4DV3 J;  4JI6 J;  4X64 J;  4DR7 J;  2HHH J;  2MTL A;  4DR4 J;  4JI0 J;  4X65 J;  4YHH J;  4JI8 J;  4GKK J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...