7FD1A

7-fe ferredoxin from azotobacter vinelandii at ph 8.5, 100 k, 1.35 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PROTEIN (7-FE FERREDOXIN I)
publication title Oxidized and reduced Azotobacter vinelandii ferredoxin I at 1.4 A resolution: conformational change of surface residues without significant change in the [3Fe-4S]+/0 cluster.
pubmed doi rcsb
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 7fd1A00
1Y4ZB 1FCAA 4L6V3 1H7XA 1K0TA 1PC4A 3OR2B 2C3PA 4OMFG 5CHCB 1B0PA 5FD1A 1BQXA 1BWEA 3IR5B 6FD1A 2WAQD 1DFDA 1FDDA 1H7WA 1BD6A 1DURA 2ZVSA 3MMAA 1VJWA 5E7OB 1Y5NB 1FRXA 5BYQA 2UZAA 1Q16B 2VPXB 3HKZD 2FDNA 3EUNA 3GYXB 1H0HB 3MM9A 2WSCC 1FXDA 1Y5LB 1SIWB 2XSJA 1JNZB 3MMAB 1D3WA 2C3UA 2V2KA 3MM5A 3PNIA 1HFEL 4XDDA 1KQGB 4OV1A 1FRKA 1FDBA 1FRMA 1XERA 4ID8A 1G3OA 2WSFC 1FRHA 3MM9B 1GTEA 2C3MA 2GMHA 2XSJB 2O01C 2VPYB 3EGWB 2VKRA 1FEHA 3MM5B 3MMCB 2FJBB 1CLFA 1B0TA 1BLUA 1R27B 2Y0SD 3LW5C 1JB0C 2IVFB 2WB1D 1SJ1A 1ROFA 1IQZA 1GT8A 2C3YA 1C4CA 2C42A 1G6BA 1F5BA 5BYRA 2PA8D 1C4AA 3MMCA 1RGVA 4Y28C 7FD1A 1AXQA 5CH7B 3EXYA 3C8YA 4RKUC 3MM6A 1DAXA 3MMBA 1FDAA 2FJAB 1PC5A 1FTCA 1FF2A 3MM7B 1F2GA 1B0VA 1FXRA 3IR7B 4XK8C 4KT0C 2FJEB 1FRLA 1F5CA 1WTFA 2V4JA 2FGOA 3MM6B 3MMBB 1GTHA 2VPZB 3MM8A 5BYSA 3MM7A 3OR1A 3IR6B 1A6LA 4CI0B 1FDNA 1H98A 2FJDB 1FD2A 7FDRA 1KEKA 1GAOA 2PDAA 2FD2A 2WSEC 2Z8QA 1BC6A 4YDDB 2V4JB 2PMZD 1JNRB 1SIZA 2C3OA 5L8RC 3MM8B 1KQFB 3OR2A 1FERA 6FDRA 4AYBD 3OR1B 1FRIA 2GMJA 4XDCA 1FRJA 4DHVA 1IR0A 2VPWB 1Y5IB
chains in the Genus database with same CATH superfamily
5A6WA 3KLGB 3P4UB 2F8HA 3FZBA 5KFHA 4IRKA 3LAMA 2B9WA 4LF4J 2LKZA 1NSQA 3PO4A 1E6VB 4ID5A 2PEHA 4OYZA 1HBOA 2MHNA 1RT3B 1L3KA 2FHKA 1OQ3A 2E1MC 2ZUAA 4OZLA 1RTDA 2BE9B 2EC0A 2CDQA 2DGSA 4ZIWA 2ZH7A 4M94A 3HD1A 3PEHA 3C19A 5KFFA 4ZLLA 2L3MA 3D3CJ 3CCLS 3NGUA 3M6XA 1FWLA 1LNQA 3N28A 2GQQA 3V6DA 1UEUA 2FJEB 4N77A 3W63A 2Z56B 3BQ2A 1VQPS 4OX7A 3WX4A 5I42B 3SYZA 5DDOC 3M32B 1YVFA 1YHQS 3IFEA 2NSBA 5H9EK 3OT9A 4J9UE 3CCMS 1L3SA 1ZM4A 5C2CA 5I3QA 2FB0A 1HQEA 2C2OB 2H5EA 3H7HB 4O3SA 2VBXA 1SI9A 4FYYB 1TL1A 1U25A 2OEMA 3W5ZA 5K14A 4WK3A 3EJMA 4U8VA 3UCZP 2VOPA 3CJTA 2KYXA 5HP1A 2C2NA 4RU2A 1AUDA 3QFHA 1R8CA 1C2PA 4ID5B 3K5OA 4LF5F 1HBOB 3M2UA 1GTEA 5SUHA 1KHWA 3R5CA 4WJBA 3QWUA 3ZXWA 1IM4A 1GXTA 4KE5A 2W9CA 4ERDA 3JQMA 3PY8A 2VQFF 4Y2KA 4JI4J 1RTDB 1JK9B 4Y2MA 2RF2A 2V2ZA 3WIVA 4IFVA 2XY5A 3TAMA 1VRQC 1F2GA 1XJWB 1S0MA 4B3RF 3GIJA 5DZ6A 1HI0P 4JI2J 2NPIA 2AGOA 1HA1A 3V6DB 3VGVA 1F9FA 4G65A 3QGPA 4RW7A 1RAJA 3VTIA 2R7OA 3CPWR 4PUOA 2YTCA 1T0TV 3QO9A 3JQJA 1RCOB 5KFWA 2EVZA 2IJRA 3HPOA 5DDQC 4YN3B 1HQEB 2VHGA 2XWYA 2B4PA 4WYWA 2JEJA 4C97A 1NH7A 1Q7LB 4OQJA 1FXDA 1TL1B 3R6GB 3OL6A 2D41A 3OHAA 3DXBA 1ZZNA 1G3OA 1WF0A 5I3UB 2ZH8A 4LFCF 4FPRA 5HP1B 3WDOA 1D8YA 4YB6A 4GC6A 1JB0C 3EGVA 3PRDA 4F7VA 3CJ5A 4B9LA 3ZTOA 2IYIA 2BRLA 4ED5A 3F0NA 2M88A 4LRAA 2JLEA 2W9CB 2QE5A 5E3CA 4QCLA 4FF2A 3EXCX 5GADU 5F8HA 4OX9F 5AXLA 2RF2B 2MKCA 1WD6A 4IFVB 1MWZA 4QJVA 1GXLA 3PRVA 2VBYA 3BGRA 4C3MA 4ELTA 1PYTA 1KQFB 2CPEA 2C3OA 1KBRA 3LGHA 3Q8UA 5GAGU 3PW7A 1JLBA 1R8PA 2CPFA 3CO9A 3VVUA 2RIJA 2ALYB 3M8YA 4RW7B 2XGPA 2G0CA 1N32F 3UD3P 2EI5A 1FRXA 3RUBL 2XTJP 3ZNUA 2HQFA 1WF1A 3PW0A 2MKJA 1FVQA 4IQMA 2G2YA 2HHHJ 3VF0B 3M8QB 1RHUB 2GHPA 2MQNA 5CZVA 3BO2A 3GCXP 3MMCB 1FJCA 1GNKA 3I82A 4NRUA 3OV7A 4N7TA 1QM9A 3BGUA 4KJIA 2C1EB 1BXNA 4LF1A 3CD6S 1XR7A 1LFWA 4XK8C 2LCWA 2KXFA 3CC2S 1FKPA 4EMDA 1R43A 4KHRA 4OLOA 5C25A 5D78A 4DQQA 2J9DA 1X9WA 5HAOA 2VFVA 4DHVA 3DDNA 3OL8A 2L08A 4DL6A 3BGRB 3PR4A 3BEGB 1WC4A 2YNGA 1SUQA 2Q66A 1JLBB 3ETMA 3CCRS 2C2KB 3BYPA 4FF1A 1HW9A 1T9TA 5C2GA 4DR5F 4NXMJ 5L46A 2YH1A 1PO6A 2DHGA 3KUEA 1ZH5A 4XDDA 2CRLA 1EKRA 3BQ0A 4PWDA 5AE3A 5E3PA 2BRKA 3TA2A 1VQ7S 3BB5A 1CLFA 2GW8A 4ZP9A 4NZ0A 1S77D 4YB1P 2QA4G 1S1TA 3NWGA 3MF5A 3I32A 2ZBQA 2HSEB 1S1VB 4DR3J 4ZVRB 4CO3A 2YNHA 2VV5A 2ZH3A 3HFVA 5D3GA 2F9JA 1FF2A 1VLOA 4LJMA 1RSCA 1U2RA 3I9ZA 1HWIA 2FTRA 4EZ9A 2DGVA 3MEGA 5HJYA 1DLOA 1KR4A 2BXJA 1RKIA 4DV1J 2ZITA 4M5KA 3IBFB 1NZ8A 2R8KA 4OX6A 4HT7A 5LJ5Y 3PV8A 1U7LA 3BSAA 4X4OA 2Z2YB 3AA8A 3RBZA 2V63A 4LIWA 4FS1A 1SUQB 4FKYA 3UDLA 1N4LA 4PCQA 1T9WA 3R2CJ 1GH8A 1JIHA 3GE9A 1U45A 2VKRA 1I94J 2XLKA 3D0GE 3CJQA 2DJWA 4MH8A 1RP5A 1SL2A 2HZAA 1X4BA 4Y00A 3QIDA 2DR7A 3J7A1 5B0AA 4Q0BA 1X4CA 4CLZA 1S1TB 4ECVA 3CCJS 1FNOA 5DETA 1Q78A 3W8PA 2OO4A 3FNNA 2ZNZA 1U1LA 2YNHB 2BZ2A 4DQRA 3OR1A 5D3GB 1CJTB 1DARA 4Q7AA 3FDSA 1IR2A 2NUUG 4KPYA 2W8LA 2MKKA 3DHWC 4ZPAA 2DPJA 3MEGB 4WWSA 1S48A 3UDCA 1DLOB 3N6NA 4DV0F 4N8OA 1T02A 4QQBA 1NJWA 1FI4A 4CO4A 2BW2A 5IV3A 1KP6A 5ETNA 2BOPA 2BYCA 1N5QA 2N7YA 4DV5F 1ZPWX 1RBLA 2QFIA 3RAMA 3DLBA 2OMOA 2VU5A 4JV1A 4TXSA 3AT1B 4NA3A 4BCAA 4OLPA 4LQ3A 1GMUA 3MFHA 4IRCA 3CC4S 3BZQA 2V0NA 1KWMA 2KFYA 4X84A 2OTJS 3JB9k 1TTHB 2OPSA 2A3JA 2OFGX 4RZRA 3BO3A 1VC5A 1QAYA 4NEZA 1PYOB 2BJEA 4RJVA 3ZTQA 3JSBA 1RTIA 4QZVB 2UXCJ 2VQEJ 3OR1B 3ULHA 1M1HA 4KPCA 2UUAF 4KY3A 4C8YA 4ZVEA 2M70A 4JI5J 3BSCA 3S1TA 2AYBA 4FF3A 3N6LA 3BSNA 3EGZA 1S79A 6FD1A 1RTJB 2QT7A 3GR0A 1TR0A 3MPYA 1HWLA 2E5GA 1EJ7L 2JHEA 1KQGB 1Y3KA 4DSIA 3CCVS 5HMWA 1X9SA 1P27B 3T19A 1SH0A 3OW2R 1X4AA 5J1NA 1HI8A 3S7RA 1C1CB 2IMWP 3LPYA 4DPUA 3LPEA 2CPDA 3G8QA 3HLUA 4YY3J 4C11A 5HL7Q 4ZVUB 4NLDA 3QNWB 1CC7A 3NS5A 3AQOA 2ZH2A 1CG2A 2XBPA 2CZ4A 3DOLA 4I2QB 3T9ZA 1FERA 2QA4S 2R7SA 2ZBPA 3BM7A 5AJ3J 3PRBA 4UQTA 5CHCB 1LQ9A 3KLIA 1D9AA 2QLBB 3QGIA 3PHEA 1Q8BA 4GKJF 2DO4A 1VS3A 2GS8A 1Q95G 1M5SA 2IM3A 4JB8B 4LBHA 4W90B 1TKXA 3K59A 4CO5A 1RWUA 4CLWA 5KFQA 4PWWA 4B02A 1FRMA 2YKMB 1R6YA 2CZVC 4F2RA 3QSYB 3AD7C 1TUWA 4OJGA 4AUKA 2XMVA 3K0JA 5BYRA 4KGMA 1UJ6A 4JI0J 1TUGB 4NYZA 4N76A 2ZNYA 5KFIA 1OMSA 2R9LA 2IIHA 3H0PA 2F4FA 2KKHA 2R2SA 2ACYA 3R7BB 2R2RA 1CQNA 4C11B 2RKIA 1H3DA 3D28A 4U67Q 1GK8A 4TY9A 3NAIA 3TJ9A 3UNGC 2ATLA 1WEZA 3DOLB 5BR8J 2ZVIA 2GVZA 3TQEA 4DG1A 2AU0A 4K4TA 1RISA 2E44A 2HAIA 4LSZB 5LMUJ 3FK4A 3H4BA 4JYAF 2V4QA 4JI6J 3EUNA 2HFSA 2VONA 1M1GA 2AW0A 3IAS9 1RTZA 2IM1A 5HSPA 4CH1A 3PXGa 2OH2A 1YRTA 1LK7A 1PAEX 3LANA 2JEIA 2EFQA 1TKXB 2AZ3A 4QWDA 4QBUA 4F4WA 3K57A 3GU0A 3ZZTA 4O4GA 4TN2A 3KJQB 4O44A 3K58A 3E01A 3MUTP 4I6AA 5K8PA 2HHSA 1S76D 3MEEA 5JMNA 4F0HA 2OP5A 3CJ2A 3GQCA 3P3DA 3MUMP 3JTOA 2B8PA 3RZAA 4IOCQ 1KQKA 2GQCA 3AOAA 3ONQA 3M2VB 2ZDOA 1LKZA 2U1AA 3TP2A 3GONA 3V81B 2N7CA 3RG6A 4NLGA 4ZVTB 2RKIB 2IY5B 5HVGA 4LSNB 3DDKA 4H54A 3SV3A 2BEFA 2O67A 2H3EB 3IR5B 1U8SA 4IH6A 3NY0A 3N6MA 3PYGA 1VHFA 1Y5LB 4PAAA 2W4DA 4DUZJ 3FCVA 2XGQA 5E5NA 5BXIA 4ENOA 4LF6F 2QRRA 2J6TA 1OWXA 5D0HA 5K9FA 5ETSA 5GAHI 3RB4A 4LF5J 5HN0A 4EZ6A 1JQGA 5LSLA 2M8HA 1MU2B 2FHJD 4FS2A 5JJBA 4O4GB 4MIAA 4O44B 3IA0A 4KGKA 3E01B 4QR2A 4AD6A 2XS7A 4GKKJ 2YKNA 3QAUA 4ZLNA 2P9CA 5J2NA 4B3RJ 4X66J 1IKXA 4LR7A 4K5RA 3CJ8A 2UUBF 2XI3A 3CD7A 3GZ7A 5JUMA 3B8HA 1KD1T 1YSJA 2FHOB 3P49B 3CDAA 2OPPA 4ATNA 4IO9Q 5KT5A 3GB0A 3C6UA 4RBUA 1NK6A 3GIKA 3MM9A 1WTBA 5KFZA 4OV6A 2FLPA 1WACA 3PDNA 4RW4B 1WC5A 3WHIA 4X4RA 2JJ4D 2B8QA 3A3OB 1AFJA 4H4KA 4I7FB 4ZLPA 4EBDA 1BHNA 5KFLA 4O0NA 1TAUA 1AZSA 3DOMB 3O1LA 2MXYA 1WG1A 1YITS 1S4FA 2IBKA 3KK2A 4LT6A 1NH8A 4ZJOA 2H9ZA 4HYKA 4UZBA 5DG8A 4JI8J 3HVTA 1H98A 4OX9J 2CQHA 4OFZA 3CEDA 4A8WA 3DM2A 1XMQF 4LF9J 5J2NB 1N5SA 3CO0P 2QYCA 4DSFA 3UPFA 3EWGA 5IM0A 2K7JA 5F8IA 4NLXA 1WOPA 1RTHA 3AOBA 3O5TB 2MZ1A 4OX8A 3TI0A 2PC6A 1K8AT 2OPPB 2BQUA 3KHRA 4K4UA 1S6QB 3MM5A 4YUDA 3OTOF 4DSLA 2CKWA 2HHPA 2RNEA 2AMCB 3CJ4A 4LUBA 3MM9B 4R5PB 3RB6A 1SB6A 2EFNA 1WORA 2BKPA 3WBZA 4RPFA 1EARA 3R5AA 4RUCA 4QR0A 1LWEA 1RT4B 2XYHB 1LXJA 1FTCA 3JS9A 1AZSB 1KKHA 3GFYA 3IC1A 2CPIA 3CGIA 1WWHA 3KK2B 3HULA 5SZTA 4PG6A 3CDEA 3CNQP 5LMNF 5IWAJ 1N6QA 2W7PA 3KFWX 2UUCF 4HH0A 3HVTB 4NRTA 1U1RA 2CQCA 2JWNA 3B4MA 2WVDA 3DM2B 2G1HA 2LXFA 2W2OP 3IP0A 2FLOA 2VZ9A 2LECA 2GIQA 3HDSA 4H4MA 4ILLA 5M2UA 3GYNA 3NGSA 1OIAA 2B6AB 4U8YA 1O5JA 5HMZA 3EICA 4F0KA 4CLYA 1U49A 1RTHB 4B3MF 1AA1B 2F9DA 3L4BC 2BMBA 3QJPA 2GMHA 1F9EB 3MM5B 4HL9A 3ZC4A 2RUGA 4N5SA 4K4ZA 2AYGA 3G2XA 3RRKA 1CSJA 4ZPDA 3TZWA 3KG0A 2IPOB 3CCZA 3G6YA 2FVQA 3I4PA 1KVIA 2P6SA 3MUVP 2ZHOA 4WP8A 1FRIA 1RA7A 4V19J 1OY8A 1N6QB 1YX2A 2HGNA 4E2FB 3JSYA 2KZZA 4OHVA 1B0PA 4DPWA 4P9SA 2HG4A 1U09A 2C2DA 2WVFA 4NOHA 3ZZRA 3M9NB 4F67A 3LP0A 4P2FA 1ZYQA 2YQ0A 2YPYA 3BGFA 1WKJA 1ZM3A 4OZNA 2DNPA 4H4MB 2FHMA 4P71A 1NDKA 2XNRA 2WK4A 3UCGA 5DGBA 4PYAA 2CPHA 2HRUA 2MY7A 4ETZA 1R8BA 1RBAA 1GMWA 4DR1J 3PJ9A 3D2WA 4C3KA 2OFHX 2CJKA 2KG1A 3BQ1A 3DRRA 4YOEA 2CWXA 3PFOA 1FXRA 2VBZA 5CCMA 2QL7B 2Y1JA 2D3OR 2MQLA 4RBTA 4K0KF 4PXEA 3KMSA 1SV5A 2DNYA 2BANA 4IUFA 5HQMA 2KH9A 3R97A 2GZOA 4DMZA 5E33A 5IT0A 1XR6A 4HHJA 4ECZA 2XM3A 3ZZOA 1NJXA 2RU9A 2CJQA 1H6KX 4JI3J 2CXEA 2XY7A 3FCWA 2BE7D 1WNEA 4E98A 3W2WA 3Q23A 2HK2A 4TY8A 2WONA 3N79A 4IR9A 2OAUA 3H2UB 3IRXB 4OL8A 3THTA 3EMTA 2YPZA 3LW5C 1K1SA 2DRDA 5EWGA 2G1DA 4ECSA 1Q79A 4DZDA 3KDOA 4JOUA 3CCWA 1LFPA 1C0TA 4M1KA 4FPIA 4AQYJ 4NYPA 2LXIA 3FRZA 4L72B 4JV5J 4RBVA 5D0EA 2F63A 2YNIA 2ZC3A 4X4TA 2MZTA 3K2YA 2VODA 3O44A 5CCLA 2VFSA 2AT1B 1QUVA 3IGNA 3TO8A 1UETA 2J7UA 2Y8YA 2MDAA 3QRPA 4WP3A 1WI6A 2R7XA 1FCAA 1M5PC 2J9CA 1SV5B 1UVKA 2PI4A 2BANB 3CE8A 3JQKA 4DX7A 4FNHA 5D4NA 1O8BA 2ASDA 2CJ9A 2UUAJ 2GC8A 3IWNC 4YB7A 1IKVB 1Y11A 3W2VA 1LWCA 1I5OB 4NCGB 3BR8A 3FSIA 4OYAA 4OYMA 2KFZA 2FVPA 1RAEB 3W2WB 3Q89A 2KRRA 1YJ7A 4QIFA 4TY8B 4KTQA 2WONB 1KTVA 1N52B 3FFIA 3EDQB 1HYSA 1WKKA 7FD1A 2YY3A 2DGUA 3HMJG 1FJEB 1Q86T 4EBCA 1RT6B 4MAKA 2XCAA 1IBMJ 2BX6A 3GG0A 4X65F 1C0TB 1YJWS 1U47A 2VC1A 3Q22A 1YGYA 3FBCA 2QV6A 2YNIB 2BM0A 2XS5A 3H2LA 2XULA 3M9OB 2VA3A 4ED2A 4FYVB 4ZCLA 1PJ6A 3D7SB 2B4OA 5D15A 2RMLA 2R7QA 3NNCA 4KHMA 1O0PA 3RU0A 1M1KT 4RNOA 2WVCA 4CWBA 2LQ8A 3MCOA 4NA2A 1NKBA 1S0NA 1IN0A 4EI2A 3N9UC 3R1HA 1WC1A 1LWCB 2DHSA 2VPYB 4KH0B 1RWXB 4RX6A 2B9XA 2ROGA 1X9MA 1VOMA 2YBVA 2KTQA 2X1BA 5AXNA 2CG4A 2OI2A 4WIQA 3M1VA 3FFIB 4LF4F 1HYSB 1YK9A 3PG9A 3VV2B 3JXOA 4IDKA 4MFBA 1HHQA 4DL2A 2Z8QA 3SEOA 5KT3A 1KS2A 5DDPC 3JTNA 3O3LA 1Y5IB 2UXBJ 1QVGR 1S6OA 3V4IB 3Q83A 3FVYA 4JUZA 4E8UA 5B0CA 1BD6A 3NNHA 4WBFA 3VGTA 1R0AB 4USWA 2WW4A 2EKNA 2HS4A 1JMTA 4ECQA 5C42A 3HD2A 4NXNF 1BQMA 3UR3C 2QC3A 2HIYA 2KT3A 3R27A 2HNYA 2JDJA 1Q8LA 5FJ4A 1C4AA 4ED1A 4HR2A 3H25A 2FZGB 1N33J 3ZTPA 3UD4P 3ENQA 4ZVQB 5CYMA 1IWGA 1NU4A 3VAKA 3NXZA 3HT3A 1F6TA 3NEKA 4OHZA 3M1VB 3WC2A 1LW2B 3TVYA 3GSDA 2HQIA 1KDNA 2LDYA 1AYEA 1REGX 4DSEA 5GADI 4IDKB 1FD8A 1UW9A 4C8OA 5LL6d 2UU9F 2FLLA 1WHVA 1VI7A 3UE2A 3EDRB 5KG0A 3H2VE 4CLSA 2DVIA 3QMQA 1D9DA 1CULA 4F25A 4JI4F 2DXFA 3UCUP 1SKWA 2CQGA 5GAGI 2MGZA 4PRFA 5DLGA 1F9HA 1PGZA 2DH9A 2W25A 3ET6A 2MQPA 2ZH6A 3BR9A 3MCSA 2HGLA 1D0EA 1S49A 1CJUB 3KUGA 4DFPA 5IS2A 2RU3A 4NLQA 2ADBA 4JI2F 1HNVA 3MHYA 4M8LA 5C42B 1BQMB 2NXEA 5ETTA 3GV8B 2V50A 4MT1A 1RQ0A 4WTYA 2HNYB 4P10A 4AT1B 2E29A 3QGHA 5IXUA 2CQDA 1NKEA 2HMIB 1VJQA 2A2DA 1HHTP 3HF5A 4DPXA 3HFKA 2QSFA 4CI0B 5DLFA 1RCXB 1QTNB 2W01A 5CYMB 3DLJA 2P9GA 2B7BB 4RUAA 1SH3A 5RUBA 3HVAA 1DTTA 2I8EA 2MZRA 4NLOA 4K50A 5LJ3Y 2ZHBA 3A8IA 3AOCA 2XB2D 3NS6A 1N5TA 4RLEA 1Q5VA 2WAQD 3IBWA 3DGPB 3T6JA 3V6KA 2AHOB 1XMBA 2K3IA 3BN4A 4TU8A 2AQ4A 3T5HA 1KQSR 5AE2A 4WIIA 2MGZB 3BGOP 3MPVA 2QSWA 1TAQA 1ZPVA 1TV6A 3SQGB 1C1BB 5J2MB 4WTOB 1M90T 5M2RA 4FYXB 2HZCA 2DH8A 4Q8FA 4G1QB 2WOMA 2IJNA 1S72S 2CJBA 1HNVB 2DO0A 2V34A 2EFVA 1VQKS 4W92B 2R8JA 2N82B 3P45B 4JV2A 2GAHC 2RD5C 1SJ4P 1PC5A 4V1Ak 3BBCA 1UEKA 1HQUA 1EZZB 1KLNA 2QMUB 3OXFA 3MM7A 4I2PA 2HHVA 1QD1A 3FCHA 2WSEC 4DV3J 2E1CA 2ZD1A 2R7VA 5H9EJ 1X8DA 3IBCB 2ZKTA 2HHHF 2HYIB 3QAEA 5GAHU 4F8RA 3G96A 4DN0A 1A7GE 4CYUB 2HURA 2RJZA 2IA6A 2EFGA 4KRWA 1X4DA 3GSIA 1IKYA 4I6YA 2VFRA 2VASA 4RL1A 1NHUA 2XCPA 2Z57B 3JSMA 4M95A 5LT5A 1ZETA 1VHIA 2OPRA 3Q0AA 4F36A 1DQAA 2BR0A 1U1MA 2XMAA 1VYAA 3BH7B 2FVSA 4F02A 5AXMA 3W7BA 3PTWA 4DFKA 4ED4A 3EGWB 4PPZA 5KG4A 1SJFA 2H48B 2NSCA 3DI6B 3W64A 1RKJA 1DHMA 2HAFA 1CJKA 2R2TA 5EUHA 1TV6B 1WSRA 4J9NA 5GAEI 2DY9A 2LQ9A 4LF8J 4JI1F 2G2OA 2DGWA 2XQCA 4M5GA 1TKTA 4DCOB 1HR0J 4NXMF 7AT1B 1N48A 4YP3A 2RS2A 4R25A 4ANDA 3UN5A 3PR5B 2CQBA 3FSXA 3D9BA 3B78A 4M5HA 3VHQA 5AXKA 5LMNJ 2ZD1B 1XNQJ 3FQLA 2B9EA 2XYGB 1BWEA 2F65A 2HW3A 2XG8A 2Y0BB 1H74A 3T1HJ 2E1AA 2WHOA 4DR3F 1NKCA 1VBKA 1VQ4S 5EWFA 3THPA 4DSJA 1FRKA 3CB4A 1QJHA 3JSMB 3ZZUA 2EFOA 3EM1A 4ZVFA 2LEBA 2CQ3A 2E5HA 2OPRB 1R89A 3LWMA 1Z2ZA 4LSLA 4NLUA 2DNNA 4DV1F 2IDLA 3KMQA 1WKLA 2VG5A 3SMZA 2QLJB 8AT1B 1WELA 1CJKB 2FJAB 1MMDA 3BO4A 2GJ2A 1LV5A 1YJVA 4P2SA 4MJKA 3UDVA 3J80Y 4O3RA 2QA2A 1WOSA 2HQCA 5KFGA 4CLFA 5ETMA 4M63A 3ILIA 4NLPA 5A8KB 2DNHA 1GAOA 1YJNS 4AFFA 2XZTB 2XMKA 2UVWA 3CJ0A 2MQMA 2E7XA 3PX6A 4YR2A 2HBYB 1I94F 4ECUA 2R3VA 3RBXA 3AAWB 2GO9A 3C15A 3MEKA 3LP2A 2HIQA 3S8SA 4Q45A 1T03A 2NXCA 5A8WA 5JXSA 4CNZA 1S10A 4I6WA 3BYRA 1RDRA 1B64A 3JAMU 2XSJA 3C6TA 2R7WA 4DOZA 2GAGC 1FRHA 1JLQB 1FT8A 2CQ2A 4K4VA 3G6XA 2F7VA 2KU7A 4OI0A 1KFDA 4P7VA 4CTAA 1WF2A 3LGNA 3NCRA 4YHHJ 1B4SA 3B6BA 4LSLB 4KGZB 2Q6CA 2VG5B 3G71S 2M5YA 1PCAA 3Q8PB 2FGOA 4XPCA 2L41A 2H4WB 2BV3A 1R8AA 1X60A 4TQSA 2J0WA 3N4WA 1SIZA 4DV2J 3GTYX 3TARA 2MZSA 4OJHA 4ZCKA 2UV8A 3FBEA 3FEYB 1S1UA 3J80U 1UVJA 1PAUB 4UUWA 3ITHA 2BJ1A 5F8LA 4Q43A 4U7UK 2B4VA 1DFDA 1S1WA 1RA6A 4BHQA 2HPUA 4F3MA 4PG4A 3GMGA 5G0RB 2WW8A 1J5EJ 4FXDA 3C15B 2V9WA 1S1XA 2ZWPA 4R8UA 4L3KA 3AB2B 2PE8A 1T03B 4XTTA 5A8WB 3SV4A 4BLGA 1OQ6A 2XSJB 1ZA2B 3C6TB 2ILZA 2XY6A 3NS7B 1GX5A 2J0QD 3CXCR 1YBAA 1OPIA 3K8VA 3DOKA 2IVFB 1S4EA 2VQEF 2CJYB 3PIPQ 2ZBCA 2AKWB 1RGVA 1KVKA 1M5OC 4M5DA 5KFEA 3I0RA 2N3LA 3ZNJ1 4JI5F 4Z2XA 3MMBA 1U1OA 4CTAB 4OJ3A 5HVFA 3TUZC 4ECWA 1F2HA 3H98A 3O2IA 2PMWA 3TZYA 3T3FA 1T11A 2HS3A 4PQUA 2FHJA 1I1GA 1T8EA 1WG5A 1U8WA 1Q1KA 2ZZMA 2DEJA 2IA0A 3D67A 4URQU 1CJVA 3ETOA 1AT1B 3PM9A 4O3QA 4UOCA 5ETLA 2MPUA 2KHDA 4I68A 2CG8A 4TYAA 2AX0A 2R4FA 2CJXB 2VDIA 1SCJB 2MKHA 2QG9B 1S1UB 3HKZD 3D5MA 2JRSA 3ITHB 3DLHA 1RU1A 4FXVA 1S1WB 3P6YC 4YY3F 2DHXA 2YX1A 1HFEL 1S1XB 3H42A 1BE4A 2I38A 2OELA 4MIWA 3TVZA 4TU9A 1UJ5A 1WC6A 4G6VB 1S6PA 4DR7J 1FJGJ 1N36J 2HHUA 1BY9A 4OYPA 2KM8C 1UTAA 4WXWA 3K17A 3BJYA 1N0VC 4Y65A 5AJ3F 4DFMA 6AT1B 3KWMA 4EFAC 1EQ0A 2K7KA 1FDAA 5A0YA 1HBNA 3SCIE 4OYWA 3EZOA 4JP8A 3I0RB 5DG9A 3EPGA 1MN7A 3MMBB 3DYAA 1VLYA 3H40A 3BPSP 4A8QA 2MY8A 1K0VA 4ZVSB 3CJ3A 5IC6B 3W9HA 2XO7A 4DSKA 4PQUB 1HNIB 4ZPCA 4DL0C 3H5XA 3ENVA 2ACMA 4RNNA 1OSDA 3QT6A 4I67A 2YKQA 4P72A 3A12A 1E6YA 3CJKA 2WZ1A 1LOUA 4D3HA 2HNZA 4OYXA 1TMMA 1U0HA 1CJVB 4JI0F 2ZM6J 1XMOJ 4WE1A 3M4XA 4TU7A 4URSA 2OSRA 4I1TA 2AGPA 1UFWA 3NMRA 2XMMA 2C3MA 2BBEA 3ZZ0A 1S0OA 3QYYA 2KN4A 4KYZA 1HMVA 2X1AA 2AJ1A 3OJSA 4IR1A 3OUYB 2BJDA 3HHNB 1TL7A 1S6PB 3LH2S 5BR8F 3SCLE 2NYHA 3TEGA 4ZPBA 5LMUF 2DNGA 5F9LA 4JI6F 4RO0A 2LXUA 1FO1A 5A0YB 5KG3A 1HBNB 1T7PA 2IMOA 2J8SA 4C9DA 1APSA 1NAQA 1T9XA 5KTQA 3DYAB 1GMWD 4TVAB 2AJFE 5D77A 2RQKA 1P8GA 1N56A 2DRBA 3AFGA 2M52A 4Q8EA 4OYOA 3KHHA 2I6WA 1DBDA 4H4KC 2ZH4A 2P8IA 4B3SJ 3CJKB 3BKFA 3L95X 2HNZB 1U0HB 9ATCB 3TOQA 2EEYA 3L7PA 2B51A 4QIVA 3NGKA 4LF2A 2J6UA 2X1GA 1QDUB 3M30A 4NXNJ 4Y34A 3LALA 4PR6A 5LOQA 3RW7A 1F5BA 1JWWA 2CPJA 5B09A 5D0RA 2ZDPA 1PJ5A 1YDLA 4ES2A 1HD1A 2GO8A 2HHQA 5IT9Y 4URGA 1RAIB 1DTQB 2FZKB 2RVJA 1ZA1B 3DHXA 4U7UD 4DUZF 3HSJA 2V2VA 3NG8A 4C0OC 1HBUA 2MSTA 2WCXA 2YH0A 2CWKA 4BC9A 2MJUA 3L7UA 2RS8A 5EX0A 3EVOA 4X4VA 3B54A 2UU9J 3C2PA 5IZHA 4AXJA 1ITPA 2LP4A 4UY8T 1WC3A 4IO1A 2KXNB 4DLGA 4UTGA 1G1XA 4I0WA 4GKKF 4KIAA 1N5VA 1UEVA 3QRQA 1ZBTA 3L9ZA 4X66F 2MQQA 2H54B 1QAJA 1TVRA 4B3OA 3GIMA 4USKA 4USUA 1XNRJ 4Y6IA 4USJC 3Q8RB 3WC0A 3M30B 1NDCA 3I6PA 3OL9A 1ZTWA 2HVDA 3W3SA 1VRTA 4WU3A 1HARA 3PZPA 5DQIA 4BWJA 4J9LA 2AEFA 3ZTRA 3BV8A 2F4VJ 2GJFA 3M8ZA 1J27A 4DWIA 3PCOB 1FRJA 4A48A 5K14B 1Y10A 5JVHQ 3TZZA 1NO8A 5IT9U 4GRSA 4TYBA 1DURA 3MMAA 3M8PA 3DLKA 2I5JA 1K73T 4TKTA 4JV0A 3U1LA 4FBUA 3M2UB 1TQLA 1N0UA 4RUHA 2V2KA 4U6PA 2ZWOA 1H38A 1JLEA 2F40A 3I56S 3OQ2A 3F44A 4JI8F 2NR0A 1RABB 3MD1A 3A3PB 3DNCA 3KLHA 5DM6Q 2R2UA 2Z58B 2K2PA 4Y2CA 4UOGA 3TAMB 1R6VA 4LF9F 1UZDA 2E7VA 2ALZA 4HKQA 3C8YA 4RKUC 4FBTA 1TVRB 2ZKUA 3RB3A 3HHLD 2HWTA 2DIUA 5AE1A 1SC4B 2MYFA 5B0GA 4ECYA 5F8MA 2X3DA 4W98A 2G4BA 2JX2A 1VRTB 3ICLA 4PUOB 2Y3YA 3QO9B 1VFJA 2YWGA 2RDDA 4XDCA 4CZCA 4BWMA 2LA4A 1WDDA 1VQ6S 5HQ8A 1H7XA 1RLDA 1TELA 1M5HA 4XO0A 3T1AA 4FNIA 2QTWA 3KLEA 2ROEA 2KL8A 3R9LA 3WQPA 1R0CB 5HMXA 1OJ4A 1SQGA 3MGJA 4B9NA 3SIPB 2DNQA 2E66A 3F73A 3MMAB 4DV6J 3DLKB 4OV1A 4NLTA 1IBKJ 4ID8A 1CS4A 1JLFA 1FFSB 2CJAA 2IYGA 5IWAF 2WBMA 1IQZA 2AF6A 4EEYA 1RAAB 2NXNA 4FDFA 3KLHB 4ZCIA 1KFSA 1FX4A 4EK2A 2ZC4A 1TKZA 4ZKAA 5KFMA 1R31A 1RT2A 1CBKA 1CQMA 3KYLA 4JI1J 1FKOA 4DLEA 3K7RA 3VAIA 3CCSS 1JXLA 4NPOA 3GJQB 2EG1A 3OR2A 5KT4A 1AUSL 2E5LJ 4FN5A 3UDEA 2JH3A 2KT5A 4L6V3 2ZE2A 2I2YA 3UR0A 4OZ2A 5HLFA 3B82A 3OL7A 4U95A 1NXIA 5DDRC 1P9YA 3SFGA 4ZHRA 2LVWA 5GMEA 4NLYA 3MR5A 4IQXA 4X4NA 3QZ8A 3KLEB 4N8NA 3HXMA 2CAJA 2VG7A 5A8RA 5GMDA 4HACA 5J1EA 3MAHA 1CS4B 1JLFB 2DNLA 2K1RA 1G6BA 3CULA 1U1KA 2E7WA 2IBOA 5L9XA 3E3XA 1IBLJ 3RW6A 1FKPB 1X5SA 1XEZA 2BW7A 3TJ8A 3N01A 1RWOB 2PN6A 3J7ZT 2BJ3A 5C25B 1NDLA 2CADA 3VZIA 2ERRA 1NEEA 4KBIA 1FDNA 2A6MA 2KB2A 1RAHB 3D66A 4OI2A 2IAJA 4YMEA 1RT2B 4J91A 2FC9A 3V2UC 4IOBA 4Z7CA 1FKOB 2YNGB 1IR0A 5EGYA 5ETRA 2D7SA 5CQGA 3OR2B 2C3PA 2NXUA 3H59A 3NLCA 5GAEU 5T7LA 2V8PA 2DR6A 4DR1F 4J9OA 4YEAA 1FE0A 1Q16B 4CH7A 3TWZA 2UUTA 4A8MP 5HLFB 1U0SA 4PWDB 3KK3A 1EETA 3ZTSA 2B9YA 5ETPA 3LOUA 2DR5A 4NZ7A 5THWA 2E1PA 2CDRB 1S57A 2JLFA 5KFAA 2IRUA 1O51A 2UUWA 3VAGA 3T5LA 2C2ZB 1K9MT 3W60A 2KJWA 4DQSA 4ED0A 1B0TA 2VG7B 2M0GB 4LRFA 5A8RB 3ISZA 5E41A 1VQ9S 1YJRA 5J1EB 3ILOA 2K1RB 1YZ7A 4F2SA 1FNMA 2O1PA 3AXMA 1X0FA 5E3QA 4JI3F 1CPZA 3E51A 2YKAA 3VWSA 1F5AA 3IM8A 2RB7A 4NEYA 1GXUA 2KRBA 3HHLC 2VG6A 1HPZA 5CYQA 3OSNA 2PFDA 2D69A 4IFYA 4MKBA 2HFZA 4KFBA 4NE9C 1MMNA 1BUXA 4FXWA 3PKMA 4AQYF 4UQGA 4PZVA 3DLLQ 1TL3A 4JV5F 3SCKE 1FDBA 4YR0A 1ULRA 3KK3B 2QN6B 1EETB 2PFFB 3PACA 2ADCA 2GVDA 1TKDA 1LW0A 4OZ0A 1RYSA 3LF0A 3OXLA 2H51B 1TK0A 3FZ2A 3GG1A 3DU5A 1IWAA 4K4XA 1SKSA 3VQTA 4Q0BB 2EK1A 1Q7YT 2G2ZA 1RUSA 2VOOA 2V2QA 1IKWA 4U9RA 2AD9A 5KG7A 4LRBA 4R0JA 2HGMA 2D9OA 2ZH1A 4ZN1A 1JXVA 4L73A 8RUCA 2V4JA 4CNYA 2Q6BA 3IR6B 2BQ3A 3KDNA 4KHPJ 4RW8A 1NLKL 4F4KA 3AXKA 3J81j 4K2XA 1B7YB 2V69A 2B4UA 2MEWA 4GVLA 2BA9A 3O8WA 1VK3A 3TYTA 1BQXA 2VG6B 1NK0A 5GMKa 5CYQB 2K06A 2UZAA 2X51A 4IFYB 2RQMA 4KFBB 2DNOA 2WB4A 2ZJQQ 2D1CA 2DITA 1LEOA 3HM9A 1IBMF 1X7VA 3M8RA 3MURP 2MJNA 3A1YG 2AGQA 2CPXA 1TL3B 5LM7E 2D3O1 2DNMA 2DH7A 1RHJB 1OY6A 2VFUA 3ELHA 5F41A 1LW0B 1W7WA 2OPSB 3TRGA 3MM6A 1EB0A 2RSQA 1EQMA 2RRAA 3HSGA 1IXKA 2A6OA 1IKWB 1RTIB 5DGAA 4J37A 4J90A 2XS2A 1F3FA 1YWXA 1WDTA 4P74A 2V4JB 2LQJA 4LFAJ 1JX4A 5E0OA 3VR1A 2OGUA 2RT3A 2HVHA 1H73A 2L9NA 3MEDA 3ISND 2RAQA 4OHXA 4NYOA 1UWAA 1NMEB 4PEOA 1VBYA 1U1PA 2RRBA 3DDIA 5FD1A 2ZBIA 3EPIA 1NK5A 2GQ2A 3MTJA 1RT5A 2FQQB 5FIIA 3KG4A 1WJ9A 2DT9A 4MKVA 1SKRA 1JNZB 3EGNA 4ZN3A 2AYEA 2XO6A 4DF8A 3QFWA 2ATCB 2DD8S 2XMTA 1ZAWA 1VMBA 2HNDA 2EW9A 1TFWA 1FEHA 2AP6A 4ES3A 4CP5A 5K8OA 5DQGA 4JI7J 1DQ9A 1EHWA 1XK8A 2QL9B 2ILYA 1HWJA 5KFSA 1HHSA 4K5SA 4MK7A 2UXBF 3EXYA 2PEBA 3H5UA 3I87A 2DYAA 1KN6A 4QIWD 3A8KA 3MM6B 3LQVA 3C66A 3PYEA 1OPZA 1Q53A 4PABA 2MSSA 2HS0A 2E1RA 2GV1A 4TNOA 3LTOA 3PHTA 3KLIB 1SH2A 5IQ6A 2KFNA 1IUJA 2EK6A 4C3LA 1QSLA 2DXDA 3IGVA 3W61A 2YKPA 3MEDB 4WF9Q 3SFUA 5DJBA 2ZVSA 3KLGA 1N33F 4H4OA 3OJUA 1XR5A 2JVOA 4B08A 4USMA 5F3TA 1FK9A 1RT5B 3UO0A 4EBEA 4P75A 2WSFC 2Y1RI 3I96A 3CDBA 5A6PA 1RT3A 1HI1A 3GP9A 2HNDB 2YNFA 3KJVA 2LYVA 5K8MA 2W2QP 2DKOB 1SXLA 2HRYA 3RYLA 3G9CA 2XI2A 4HDHA 4Q2MA 3W65A 1Y00A 1V5VA 3A3NB 2VPZB 2IVMA 5BYSA 2W2NP 3TQ1A 8ATCB 2BJ8A 1IQTA 5I42A 3PIOQ 3IN5A 3M32A 2GVZB 4DG1B 3MDFA 1UA0A 1H72C 1S7IA 2MZQA 4LVOP 3I55S 3H90A 2IC3A 2MQ8A 3EE3A 4WZMA 1GMVA 4RNMA 3Q2SC 4FYDA 3A8EA 1OS5A 2NS1B 5A2QY 2V67A 4A46A 1VQ5S 4DBQA 1UPPA 2IM2A 2GJIA 1FVSA 3CC7S 4H4OB 3UQSA 3CDUA 2R7TA 1FK9B 1NHKL 4DR6J 1IJEB 3MEEB 4CM0A 5DZ7A 2QMWA 1Y9OA 2XZWA 4ANCA 2RILA 4CT8A 2L48A 2YNFB 3H4DA 4EO8A 3DLEA 1YBUA 3KJVB 2KM8B 3MTKA 3CSKA 3T5JA 2E9RX 4EGLA 3GIRA 3G4SS 3BN7A 3CW2C 5L8RC 1S7HA 2DEIA 2G13A 1RB0A 4CRJA 3OVSA 2HVIA 3KTQA 3HZGA 1V3SA 1L5UA 3M05A 3T6BA 2IC3B 5KFJA 3UFCX 1U6BA 3ISNC 1Z2LA 2VDHA 1FJ7A 5HQLA 3SSRA 1X4HA 3IXQA 3IS9A 1KLMA 1UFLA 3M9MB 4DX8H 3CJRA 4U96A 2V94A 2QEXS 2O01C 5KFBA 2EBGA 2N3OA 1N8RT 4DV3F 4MK9A 5I3UA 1JXEA 3IWLA 1DZ5A 5HK4A 5A2QU 4F04B 5I4MA 3FKBA 3D1QA 4HTIA 3V4MA 4NZ6A 1MLAA 2YVSA 3JSRA 2YKNB 3CD5A 1U48A 4FF4A 4ZA1A 1B0VA 1HBMA 3G6VA 1IKXB 3FMWA 1RWKB 3RAQA 3T9NA 3DLEB 3RRGA 2JEFA 1F3VA 4QYZK 5ETQA 2QLXA 4KC5A 2AWZA 2JOQA 2FVCA 4CLPA 5CA5A 3HHEA 5EDWA 5H9FJ 5E2QA 1FKAF 1PJ7A 5CZXA 2KXHA 1DRZA 4OI3A 1V6HA 4ZITA 5IOLA 3C6UB 1FDDA 1SC1B 3PW4A 3MAAA 2QYGA 4PWUA 1T05A 1HIYA 4LF8F 1ZAVA 3FC9A 1UWBA 3GCWP 4BS2A 2CIMA 1X31C 1HR0F 4O23A 3NMAA 1T9VA 4DV4J 5HI7A 1W26A 3U1MA 3IS9B 3QLHA 1KLMB 3W62A 3VAJA 1UVNA 3M8QA 1NBEB 1UP1A 4DQIA 3MMCA 2W24A 3EVWA 1F0XA 1PKUA 1XNQF 4DR2J 4DL4A 4C8MA 5B0DA 3L7OA 3K5NA 4LIRA 4O3OA 4Q2LA 3T1HF 1AROP 1UVMA 2Q1LA 1VC0A 1HBMB 1NK7A 2OSQA 1OY9A 3VGUA 1WUUA 4WU2A 1AFIA 4AXIA 3NRBA 4HHHA 1NPKA 2KDOA 4F50A 4ED7A 4K2JA 5IM0B 3BF4A 2CYYA 2OHDA 4ECRA 3G86A 3GJRB 3X1LB 5KFDA 2I1RA 3IWXA 2FJVA 1SBRA 1T95A 4C7QA 1VBXA 4EUVA 4MK8A 4B9UA 2FYXA 2R8IA 4K4WA 4PG8A 2RE1A 2NYIA 5IQQA 4Y3CA 5ITHA 3MAAB 1T05B 1KTQA 4XPEA 4RWXA 1HW8A 2EPIA 3G8TA 1UWBB 1F60B 2PD1A 4S0MA 3I9V9 3G8SA 1LWEB 2HHTA 3PKYA 1C4CA 1UCNA 2UXDJ 3QLHB 3BREA 1UVIA 1DAXA 1RWVB 5DRKA 1K47A 3IR7B 5L1IA 2CPYA 1JLAA 1R3NA 1S1VA 1F5CA 3L3CA 3SDEA 2P5VA 3TANA 1X4FA 3CMES 1RZMA 3IM9A 5KFRA 1WI8A 2QGFB 4ZPWR 2LDIA 4KKOA 3D68A 1YRUA 4ZP6A 4C8ZA 2ZEJA 3NWRA 4P52A 4YHHF 1CEZA 1OSCA 3R7NB 4A4JA 1VIOA 2HFNA 1D3WA 5KFYA 1Q5YA 3OXGA 3DC2A 3PO5A 4V19X 3BPDA 4WFYA 3SI8A 3P96A 3M6WA 2B43A 4K7QA 4I4BA 2J0SD 4DV2F 3CCES 2C3YA 2VUGA 2ZJRQ 2KG0A 1URRA 2AJ2A 2U2FA 4J9PA 2MQOA 1Q81T 5IFMA 2NCKL 3R3TA 2B56A 1VQLS 1V5IB 2F1FA 3J7AN 3PYDA 2DXEA 1J5EF 2A1BA 2NZ4A 1TP7A 2V6AA 3UNYA 1JLAB 2QLWA 4ZPTR 2MMYA 2CQ0A 1FX2A 3SDEB 1CJTA 3NGRA 5BJRA 4QPTA 3A13A 3MOZA 5J2QA 3LP0B 4KR0B 4DX5A 3C46A 1NZAA 4KKOB 3THVA 4C4WA 1XWLA 4ZLJA 3I5BA 4A8YA 1SPBP 2XSFA 3J7YU 4DR4F 5B0FA 2MKIA 2KZMA 4M5MA 1SQEA 1VQ8S 4AL7A 1VR6A 4RUBA 5CXTA 2Y0SD 3TR5A 2Y9HA 2SXLA 1ICEB 3PJWA 1GT8A 2CNKB 3DRRB 4USIA 4ZJLA 3ENWA 1Y3JA 4LF7J 3DRXA 2MKYA 4DUYJ 1UVLA 3T1YJ 1LWXA 2JNJA 3HSZA 3QPIA 2P9EA 5D4LA 1S97A 3MR6A 2JFDA 1TK8A 1L3UA 2CFXA 3TA1A 3BBFA 1RWWB 1WHYA 3DLGA 1B99A 1V3RA 1NCLA 2GMLA 4LVNP 1HNWJ 5D0GA 2M9KA 2EC2A 2GCFA 4DR7F 3C3LA 1FJGF 4YB5A 4OZ5A 1OYDA 1N36F 1U1NA 1XC9A 1VBZA 4DS4A 1Y5NB 2ABYA 1PBUA 5L1LA 4L3NA 5J2QB 3KLFA 1RHQB 1RTJA 1RT1A 1XERA 3HT0A 5KFNA 5DS7A 4IH5A 3LWLA 2CQ1A 2Q43A 2C42A 3KOAA 2QA1A 3FQKA 1NSPA 1C1CA 2KVQE 2C2RA 3HO1A 4KT0C 3QJJA 2ZM6F 1WTFA 2ZOGA 1WC0A 3RTVA 1XMOF 3JYTA 1N34J 3MCMA 2DR9A 2QIFA 5L9NA 2VICA 3W5YA 3BKTA 1Q0NA 3HHLA 3DLGB 3MWBA 2VH7A 3OTEA 1I3OB 4I2QA 4OZ1A 3HHDA 2BACA 2A18A 5D6GA 3GFXA 4LFBJ 3W2VB 4P2XA 1QVFR 5GVQA 2RHSB 4OI6A 4LRCA 4P73A 3IRWP 5AT1B 4F4YA 3PJXA 3Q2TC 3PNIA 3KNGA 4QOTA 2OPQA 3A4TA 1HNXJ 1DQ8A 3KLFB 4Y2AA 1R0BG 3GLJA 1K44A 1RT1B 5KOWA 4N47A 3V6JA 3PX0A 4NLVA 4PQAA 1KONA 1RWPB 3DN9A 5F8NA 2YKMA 1SJ1A 2BABA 4NX9A 3OVBA 4EYHB 2FLNA 5KFCA 1MNEA 1FXLA 3HK2A 4Q44A 1NPRA 4LRDA 4ED6A 3U27A 3Q8VA 3VZHA 3TNVA 1S9FA 2BOAA 2AJ4A 2XLIA 4X62J 1RWNB 1NRKA 1S9GA 3R1LA 3AJ2A 5FDLA 3RBDA 1SL1A 4B3SF 3DRPA 1M0SA 2XC9A 3R5GA 3QATA 3UN2A 3O6QA 1NJIT 1L3VA 1M5KC 1KHVA 1N54B 4GVBA 3JYTB 2PIIA 2LU2A 3DRYA 3PX4A 5IT4A 2AX1A 3BKUA 2XLJA 4FVMA 1C0UA 3IAM9 3ILJA 2CQ4A 4DV7J 5ETVA 3HHLB 2PSZA 4KV8A 3T41A 4Y0FA 3DXSX 2PA3A 2HVZA 1D8ZA 4GMKA 2ZJPQ 3OTCA 1MWQA 4WYLA 1H0HB 2WSCC 2F5GA 4FZVA 3OFGA 3FSYA 5C5JA 3MPWA 2ZOMA 3K5MA 1KVJA 3GIIA 4CO1A 1UJ4A 2OPQB 3MXHP 2Q3PA 3OPKA 1VQOS 2J7WA 5F9NA 1KNZA 4J9KA 2JC0A 1DJ0A 1P1LA 4MFBB 1VQYA 2OKQA 4UW2A 3ZFVA 3V5RA 2OUGA 1CVJA 5H9FK 4F4ZA 4ZK7M 1G4CA 1BGXT 4X64J 3C14A 3CT9A 5LSOA 4CM2A 1J5OA 3Q86A 1HWUA 4X4QA 2V9KA 4CDIA 3ZO7A 4U7CA 1HKAA 2PMZD 1YG0A 1S9GB 2DGXA 5FDLB 3DRPB 4GO5X 3M2VA 4B3TJ 3TZXA 3B4DA 2DIVA 3V81A 2NLWA 1ZOTA 1K0TA 4GVBB 3HFZB 1U2CA 2B7CB 3HJFA 2MZJA 1XNRF 1B3TA 1MW7A 1C0UB 2FZCB 4LSNA 1G7CB 3GYXB 1PG5B 3EZ5A 4KV8B 2XHWA 3US5A 4I69A 1HNZJ 4CLLA 3SSQA 1T3OA 5L38A 2B5JA 4C98A 1WOOA 4ZJQA 1RADB 3GPAA 2JEGA 2F4VF 3D0IE 1UA1A 4RNHA 3UN3A 1NK8A 1S5ZA 1TL4A 1WHWA 5D4OA 4DPYA 3GILA 5F3ZA 1MU2A 4C0HA 1Q8KA 3BS9A 2W9BA 1S0VA 1D9FA 3V6HA 5KFXA 5KAKA 1BQNA 5CD4A 4DEZA 4KO0A 5HJXA 3C14B 4ICLA 1J5OB 1VC6A 4O0IA 3ILLA 2YWHA 5DQHA 1CULB 4PPDA 2YX4A 2Z0GA 4IG3A 2NREA 5KFPA 1VQSA 4YS2A 3ET6B 4KAIA 2YWKA 1UMJA 2COLA 2KT2A 5L39A 3MZIA 2L9WA 1HL6A 1XBWA 2R42A 2RHQB 4AL5A 3RJMB 3OBIA 3UWTA 3CMAS 4PXDA 3KG1A 3NGTA 3U7JA 4RW4A 4ZIVA 3U02A 3W9IA 3KLVA 1LXNA 2W4PA 2DGTA 2B5JB 1RHRB 2H1YA 2FC8A 3M2RA 4I7FA 4WFAQ 1NDPA 2BUNA 3QZ7A 2ASLA 1L3TA 2XYPB 3DOMA 4LBPA 1RJJA 1KOHA 3I5CA 1X5OA 2OTLS 2HQGA 3WX8A 3FBFA 2QFJA 1DTTB 2FJDB 3PVXA 5T14A 2HKEA 2W9BB 1SL0A 2HFUA 1KEKA 4I56A 4DV6F 3ENAA 1IBKF 4YR3A 2VQFJ 1BQNB 3Q8YA 4J7CA 4X2BA 4ZVHA 3R5DA 4ECTA 3MI7X 3KNAA 4KO0B 3MR7A 2K8GA 1FNXH 3R7SB 4ICLB 3OTBA 4UZCA 3OVAA 4DUTA 4J5OA 3F56A 2GNKA 2NZCA 2FDNA 1LWFA 4C0BA 4QU6A 4IG3B 4Y2IA 3GFHA 2V8VA 1KOOA 1SIWB 2APOA 5A76A 3K89A 1YBTA 2VF3A 4D3GA 4CLUA 2DY1A 4NLWA 2BM1A 2YXLA 5F0UA 1MSWD 1RXOB 1Q82T 1S6QA 2WOMB 2MTLA 1UKUA 3M8SA 1ELOA 1RAFB 1ROFA 4IH7A 4R5PA 4N41A 4LREA 1YJ9S 2E5LF 1RU2A 2W9AA 5KOXA 4X4SA 4ED3A 1RHMB 5T41A 1HQUB 1YI2S 1AW0A 4RWWA 4DFJA 3MM7B 4I2PB 2ZUGA 2FPHX 1RT4A 3M2RB 4C48A 3VQSA 4LFCJ 2LEAA 5KT7A 3SQOP 3CDWA 5ETKA 2J9DE 2POKA 3R5JB 1U24A 5F0WA 4LMZA 1VQMS 1IKYB 2CNNB 1WEXA 2B0GA 3AB4B 4DL5A 3SCJE 4IOAQ 3FJ2A 2GFFA 2Z2LA 3D4JA 4G1IA 3QT5A 1NM2A 5U47A 4DL7A 3A8JA 1IBLF 1JLGA 3MPUB 2LU1A 3W5XA 4F3QA 1QAIA 2JZ5A 4L75A 1LWFB 2B6AA 4OJ1A 4P2MA 4ALZA 3GFZA 3EX7B 4X4UA 4B9VA 5KFVA 3MFIA 2R8GA 4ZVOB 3D6FB 1N32J 2YX7A 1TKTB 1UL3A 3VALA 2MB0B 1BWVA 5K5MA 3NBPA 3TAPA 1GTHA 4QW8A 3MM8A 2BJ9A 1Y7PA 1A6LA 1SJ3P 1FD2A 1J2VA 4OI1A 2FD2A 2C2MB 2DBBA 1IVZA 2QL5B 3G82A 3AH6A 1RACB 4QWBA 3OLBA 3CCTA 5EN1A 5HANA 3UW1A 4USHA 1P9QC 5KT6A 2Y1LB 4RW9A 1REVA 2V5HG 4TLQA 4OHYA 5G4DA 1UPMB 1MROA 2EFPA 3MOJB 3CCQS 4LR9A 3C16A 2DHHA 1KRPA 2JL9A 4DPTA 2Z2ZA 2PO4A 4QIEA 1NHVA 1NJYA 1JLGB 1T9YA 3M6VA 4ZS6A 2ROPA 2EG2A 3MAQA 2MLZA 3F41A 3AJDA 3H5SA 2HLUA 4NA1A 4A8FA 3D6MB 5H1SV 4B9SA 5D8HB 2XNQA 4NI2A 3PFEA 1RLCL 2J8AA 3NP5A 4BBYA 3HX9A 4DR5J 3W8GA 4X4PA 4DN9A 1EKSA 5KFTA 4I64A 4F26A 4QU7A 3OD2A 4K8RA 1I6JA 1FESA 4ELVA 2H65B 1PSDA 4IG0A 2PDAA 3NBPB 2ASJA 3IMQJ 2QZ8A 1V9OA 1FFGB 3MM8B 2Z2MA 1ZZFA 1IBCB 3LP2B 3SSSA 3KXDA 2JLGA 3G82B 4UY85 2CNOB 1H7WA 1S99A 3HI9A 2VIHA 3N5BA 2OD4A 4K4SA 3LO3A 4C2MA 4B9TA 4RW9B 1REVB 3W66A 1DY3A 5KT2A 2V4RA 3BSOA 3AQPA 1MG7A 1MROB 3HVRA 3DKDA 3C16B 3AY0A 1JJ4A 4DR4J 1SJQA 3JTPA 1HLWA 3U1NA 4WK1A 4KHPF 2M7SA 5KG1A 1VISA 3OFEA 2YQ1A 2X7IA 3IRXA 4YDXA 3MMJA 4J9MA 4B17A 1UZHA 5HBMA 1AXQA 4DZ6A 3QT7A 4LR8A 3RBEA 4DCPB 3TX0A 2YWFA 4NI2B 2CA9A 3KKFA 1ACMB 2HEKA 4ZMMA 2XWXA 3TA0A 3GYGA 2W1BA 2QJ3A 1GX6A 3D54A 3GWCA 3CWJA 1SQFA 5HVHA 3OLAA 2NPFA 1NJZA 3QGGA 3DCAA 4DU8A 4IG0B 5D4PA 2QX0A 3ZZZA 1M5VC 4L74A 4MIBA 2HK3A 2F3JA 4R8UB 3RB0A 4O4RA 5L1KA 1P1TA 1TMJA 2VL1A 5K8NA 2KO1A 1WEYA 1K1QA 1S9EA 2IHR1 1IKVA 3DOKB 3Q8QB 1F1BB 1SC3B 4NCGA 4ZPVR 3PW5A 1YQHA 5LXRA 4HDGA 2V8HA 2V8DA 2HVEA 4M5DB 4DV0J 2J0XA 4LFAF 2IJFA 1JJHA 4QWEA 4WZQA 1O6XA 2PGCA 1IR1A 3KUHA 2QLFB 2MKSA 1WSVA 4ILRA 3UI3A 2H4YB 4ZDNA 1Z4UA 2Z4PA 4HHUA 1N5YA 4DV5J 3H5YA 3CIZA 5HBMB 3PW2A 3SBMA 5K20B 3FMBA 5MAOA 1RT6A 5C7PA 4MKYA 1D09B 1S59A 1U2FA 3QBCA 3NNAA 4MTPA 3CMQA 4MMOA 2ZZNA 4QPXA 1EIYB 2W7OA 3MR3A 5B7WA 1I51B 5FLXY 2XEXA 1QSYA 2DNKA 3N0VA 4JI7F 3RR7A 2EXUA 3QQCD 2ZZTA 5HROA 5IC4B 3J81Y 2BJ7A 2WVEA 1NB2A 2VPXB 1U6FA 1JJCB 2W2MP 5HO4A 4DL3A 2D74B 3AA9A 4ZP7A 1S6UA 1VRUA 2G0IA 3ADAC 3ZZYA 4C8LA 1NK4A 4ILMA 2GX8A 3SZ2A 2IM0A 1S9EB 4B9MA 2HHXA 2CUYA 2VA2A 1NB7A 1U26A 3GJSB 1NK9A 4YQWA 2DGOA 3MCNA 2HWHA 2J6SA 2LFVA 2NXJA 2R7UA 4NL5A 4DDFA 3BDPA 2LLZA 1SKUB 1YTYA 1N5YB 3M6UA 4EYIB 2P6TA 5KG2A 1BC6A 4P6QA 2Z30B 1E6YB 1RT7A 2I0XA 5KFOA 2FY8A 3K5PA 2DCLA 4WE1B 3OHBA 5LSRA 2GGPA 2M8DB 1MN9A 2LQBA 4PKDB 4QYRA 3LGMA 1T94A 1PYSB 5HMYA 1YRXA 3TUJC 1R7IA 2CZ9A 3V4IA 2QMXA 2Y1IA 2R8HA 2VC0A 3D6TB 2IVYA 5HROB 5FLXU 1JJ2R 4G1PA 4PXCA 1U6ZA 1R0AA 2PI5A 2C22A 2IRXA 1HMVB 3R5BA 2YWEA 4PG5A 2RDJA 3J81U 4GO7X 5C24A 1NSAA 1TL7B 2WB1D 1VRUB 3HCXA 3P8BB 2J5AA 2Y8WA 4Y28C 4HEA9 3J7Z5 2B3TB 4GKJJ 1W25A 1YKWA 1PBAA 1ZTTA 4P7TA 3NOGA 2AIRB 4NCAA 2A10A 3PEJA 3FUYA 3EVMA 4XIUA 3S01A 4WFXA 4ZOSA 4W4MA 3Q8SB 3CIMA 2BKNA 3KHGA 4YDDB 1SJRA 1P6TA 5KG6A 2V68A 4ELUA 2VKZG 2GMJA 1OYEA 1CC8A 1LW2A 3QT8A 4DR6F 2RRNA 5J2PA 3NOCA 2DPIA 1RT7B 5L1JA 5B08A 3LUYA 2HBRB 1RWMB 1B7FA 3H8YA 3POTA 2GGPB 4WP9A 4ECXA 2M4MA 2PT0A 3UVJA 1RYRA 2GHWA 2DR8A 2AJ0A 4USVA 2ZH9A 3I5AA 4Q5VA 4KGVB 2VJVA 1X5TA 4O3PA 2DHAA 1CJUA 1BLUA 4UUXA 2KVIA 4DX6A 5DG7A 2FGCA 2AYMA 3P5BP 5C24B 2UV8G 4JYAJ 4CLTA 1U1QA 1X4GA 2OJ3A 5EHHA 2W7AA 2HFOA 1RK8A 5CAAA 3LA0A 1FRLA 1SC6A 4FYWB 4J9SA 3FBBA 3AHPA 1HBUB 4ANEA 4C8NA 2HMIA 5I3PA 1U02A 5F8JA 1IM6A 4AYBD 4QW9A 5HATA 2E9ZA 3KJFB 3AJ1A 2J9EA 4UF4A 1RE1B 4IYQA 4UOHA 3EZUA 1URNA 4KGXB 2JC1A 1FWKA 2E9TA 5MLCV 5J2PB 2DNZA 2JFKA 3AD9C 3DGPA 3GV5B 4DS5A 2UVRA 2GHVC 1X5PA 3NL0A 2J7KA 3POTB 4CT9A 4B3OB 4C6AA 3UVJB 4WKYA 4WKRA 3WIUA 1EP4A 1JKHA 2HFVA 3SQGA 2X1FA 1C1BA 5J2MA 1NPPA 3DGVA 1W2BR 3HZEA 1QSSA 4DPOA 4G1QA 1PIEA 4HI2A 1WG4A 2D3ZA 2A0FB 3BBBA 4RR5A 2BDPA 2DISA 2V8GA 1YJUA 1YJTA 4EO6A 4LF6J 1G2EA 4PG7A 7FDRA 1RAOA 1FE4A 4K4YA 3T5KA 6FDRA 3AD8C 4NCBA 4KB7A 4DV4F 4HTJA 1QE1A 2KYZA 1VIXA 4OZJA 1Y4ZB 3M8PB 1PC4A 2I5JB 1R8HA 5E3AA 2PMHA 4NLSA 4CYUA 3OTDA 3MECA 5BYQA 4HH1A 1JLEB 4J9RA 4DR2F 4ZP8A 3TVKA 2HQDA 4HT5A 2HHWA 4AE5A 2DGQA 2W8KA 4QIGA 4CLKA 1TU0B 2UUBJ 2HQ3A 2DB1A 3I31A 3LAKA 3EYZA 1FHTA 3BGLA 2ZHAA 3E2EA 2O5DA 3HKWA 2C28A 1U4BA 5CD4H 3DI6A 4NASA 1EP4B 1PILA 4XAKA 2EBEA 1T9UA 1JKHB 2IDEA 1QLNA 2IFXA 3D6HB 2K3KA 1QTMA 3HVWA 2AZ1A 3CUNA 1ZS6A 1D1UA 3HSDA 4USTA 1VK8A 1JNRB 3UD5A 1GEHA 1MMLA 4HLBA 3FEXB 2FJXA 5EWEA 2LMIA 4M5NA 3VCDA 4ES1A 1ZM9A 4UT4A 4KQZA 3DRSA 4J9QA 2UXDF 1X4EA 1QE1B 2N4CA 1ZAXA 4ZCMA 3R2DJ 2FJWA 4KSEB 4CO0A 2CPZA 2D3UA 2DNRA 1QAXA 2HWIA 2E5IA 3MECB 2VBWA 3CJSA 4ITSA 1XMQJ 4A47A 2N4DA 4OI4A 4CIOA 1R27B 4F4XA 4EU0A 4OHWA 3J7YI 4OZ3A 5F8GA 2PA8D 3VAFA 4M5IA 1TKZB 4L76A 2HBZB 2D9PA 5KFUA 3TEHB 1TK5A 2L9DA 3Q24A 3OTOJ 1H2VZ 2LQ5A 5EX3A 4MYTA 1H2UX 2HZVA 4FKXA 3G87A 2NQPA 1HWKA 2CNLB 2NUHA 3CCUS 3DMJA 1EX8A 4QYZJ 2JVRA 2ZE2B 2DTJA 5A8KA 1B70B 4ZHRB 4OMFG 2IRYA 1YLXA 2J76E 2XZDB 1EAYC 3NKYA 1VCTA 5ADZA 1YZ6A 1ZM2A 3DRSB 4R0EA 3JAMY 1XTZA 2X3GA 3NCQA 3CTRA 1W2IA 2RUSA 3W9JA 3TX8A 4HACB 1BMQB 5J1PA 2UUCJ 4CO2A 5CYJA 3X3UA 4NLRA 2Q79A 1AB8A 4ETXA 1JLQA 2P2CB 4TQRA 3BDEA 1QY7A 3NCPA 4CQ1A 3DU6A 1S12A 2G9OA 4B3MJ 4K59A 1Y0HA 2IAJB 2MHEA 3M7VA 4DQPA 3R8YA 4MYUA 4DI6A 5JVGQ 3SXLA 3QRRA 4BDPA 1X0PA 3DMJB 2OEJA 2F8MA 2HBQB 5T7LB 4NWBA 4ZVGA 3KK1A 3HHKA 4RU9A 1QUPA 3L09A 4YFUA 2W4CA 4A8XA 4LF7F 1LK5A 1RHKB 5E7OB 2FY1A 3I4HX 4DUYF 3FRYA 3D1HA 4EWTA 3PYFA 3T1YF 3TAQA 2EKYA 2CVEA 4PXBA 1XN9A 2BE2A 2ZBRA 5G0RA 1N88A 3OFFA 2UVUA 2ZOFA 3D3BJ 1RI7A 2UP1A 4LQ9A 3IO1A 2WTFA 2WBRA 4WFBQ 1IJFB 1HNWF 4BC7A 2WRMA 4PYDA 1T3NA 5CH7B 4DJBA 2E5JA 3K5LA 4AL6A 2O66A 3BH6B 4RNFA 2KJVA 1V3ZA 3QWPA 1UFKA 4TLRA 1RAGB 1HD0A 2CQPA 3RAXA 1VGYA 3FGVA 2BVZA 2VFTA 4ER8A 1HPZB 2LA6A 2YQ3A 3D1OA 4ED8A 3GR1A 3W1YC 4A8SA 3NAHA 1H2TZ 1XIQA 4DF4A 1TZ0A 3CD0A 2VJUA 1NUEA 4F4AA 4MKAA 1KC8T 3R6LB 5CABA 2OIHA 4DXLA 2UVVA 1JLCA 4WXOA 2XMJA 3KK1B 4N56A 4O3NA 2O3DA 5E3RA 1Q8IA 2OMLA 2OEKA 2ZH5A 4K0KJ 2GVDB 3CVKA 1MWYA 1VDHA 2GIRA 3VAMA 2OD6A 4DCJB 1Q4RA 1TFYA 2M2BA 2GA7A 1OO0B 1A0OB 4CCHA 3N5FA 4KH1B 2BE2B 4Z37A 1N34F 1NNDA 2YWWA 3RR8A 1Z1ZA 2ASYA 2XMWA 2I9SA 4M5LA 1FWPA 3IG1A 4F3OA 4RW6A 1A9NB 2HRTA 2XMUA 2KHCA 2AJQA 2FVRA 4LFBF 4OYIA 4WFZA 1FA0A 2GIFA 2DRAA 2QO3A 4QWAA 2UXCF 4RW8B 2W2PP 3H20A 4F0MA 2H5JB 3KJNB 2HLTA 3QJLA 3AODA 4OYBA 1HNXF 2DK2A 3TUIC 3WZ0A 3MD3A 1FEEA 2WVBA 5DO2A 2M3DA 4ZVPB 2LEPA 1HQ2A 1HNIA 5M2PA 3QSIA 4HVZA 3NGDA 3VVTA 2BKOA 2RQCA 2AEMA 1SVDA 4CH0S 4G3IA 2BQRA 1JLCB 5ETOA 4IRDA 2KI2A 2C3UA 2JSXA 1WHXA 5KG5A 4FP9A 1NSKL 4X62F 1YIJS 4QWCA 5KFKA 3LP1A 2AV5A 3HP6A 3RGIA 1KSPA 1UW4A 2XHCA 3P5TL 3QIPA 1XQIA 3HJVA 2RDIA 1UAWA 4IKAA 2MLXA 1RBOB 3VAHA 3S6EA 4DV7F 4A8OA 3OUYA 3I0SA 3OSPA 3IG1B 4WFNQ 3FEZA 2A2CA 4RW6B 4LBIA 1GFWB 2DCUB 2YKOA 2R7RA 1GQEA 4NMLA 4WCEQ 3GJTB 2VB6A 2MLYA 4JBCA 1TL5A 2VPWB 4E0DA 3M8WA 4C8KA 1E6VA 3D0HE 3CF5Q 3VGSA 2OLWA 1VJWA 4X65J 3OFHA 4HI1A 3K8WA 2RH3A 2AEJA 3TJAA 4GC7A 2F8EX 2ZFHA 9RUBA 5B0BA 2CQIA 4NMXA 3G6ES 4X64F 4DU7A 4Z7YA 4M5JA 3E8OA 4FVCA 2FJBB 5LXYA 1FFWB 1FTRA 3RRHA 5B0EA 3LP1B 5IV4A 4B3TF 3TW0A 3MPDA 5DM7Q 3QIPB 2RQ4A 2EWHA 4J9VA 1TUVA 4UOFA 3DFEA 2G0JA 2C2EA 3ZZPA 2CVIA 4WPAA 1VQNS 3KHLA 2H5IB 3I0SB 2FIUA 4QR1A 3TUPA 4OIXA 3GV7B 2FUG9 4A8KA 1DTQA 2VD3A 1HNZF 3MR2A
chains in the Genus database with same CATH topology
1WI6A 3MI7X 2R7XA 5A6WA 3KLGB 3KNAA 1FCAA 2D7SA 2F8HA 4KO0B 1M5PC 2J9CA 2K8GA 1SV5B 5CQGA 1FNXH 1UVKA 2PI4A 2BANB 3FZBA 3CE8A 5KFHA 4IRKA 3OR2B 2C3PA 4ICLB 2NXUA 3H59A 3NLCA 5GAEU 5T7LA 3LAMA 2B9WA 3OTBA 2LKZA 4FNHA 5D4NA 1O8BA 3OVAA 4DR1F 2ASDA 4J9OA 4J5OA 2CJ9A 4YEAA 1FE0A 1Q16B 3F56A 4CH7A 1E6VB 2GC8A 3PO4A 2GNKA 2UUTA 4ID5A 4A8MP 5HLFB 3IWNC 2FDNA 1LWFA 2PEHA 4YB7A 4C0BA 4PWDB 4IG3B 3KK3A 4QU6A 1EETA 1IKVB 1HBOA 2B9YA 3W2VA 1LWCA 4NCGB 3BR8A 3LOUA 2MHNA 3GFHA 4Y2IA 2V8VA 1KOOA 1SIWB 3FSIA 2DR5A 2APOA 4NZ7A 5THWA 1RT3B 1L3KA 2FHKA 2JLFA 2KFZA 5KFAA 2IRUA 1O51A 2UUWA 3VAGA 3T5LA 2FVPA 1OQ3A 4D3GA 1K9MT 4NLWA 2BM1A 5F0UA 1MSWD 2KJWA 3W2WB 2E1MC 4DQSA 1Q82T 1S6QA 2KRRA 2WOMB 4OZLA 1RTDA 4QIFA 4TY8B 4KTQA 1UKUA 2WONB 3M8SA 4ED0A 1B0TA 1ELOA 1KTVA 2VG7B 2EC0A 2M0GB 1ROFA 4IH7A 4R5PA 2CDQA 4N41A 1YJ9S 2E5LF 1N52B 2DGSA 2W9AA 5A8RB 3ISZA 5KOXA 3FFIA 1HYSA 7FD1A 2ZH7A 5E41A 4X4SA 4M94A 4ED3A 3PEHA 1VQ9S 1YJRA 2YY3A 5T41A 5KFFA 1HQUB 2DGUA 5J1EB 1YI2S 3HMJG 1AW0A 2L3MA 4RWWA 3CCLS 2K1RB 1FJEB 3M6XA 4DFJA 1Q86T 4EBCA 1RT6B 4F2SA 3MM7B 4MAKA 2XCAA 4I2PB 1FNMA 3N28A 3GG0A 2GQQA 4X65F 2O1PA 2ZUGA 1C0TB 1UEUA 1RT4A 2FJEB 2FPHX 3M2RB 4N77A 1YJWS 1U47A 3VQSA 3BQ2A 1X0FA 5E3QA 1VQPS 4JI3F 2VC1A 2LEAA 4OX7A 5KT7A 3WX4A 5I42B 3SYZA 3Q22A 5DDOC 1CPZA 3CDWA 3E51A 3M32B 2YKAA 1YVFA 1YGYA 3VWSA 2J9DE 2QV6A 2POKA 2YNIB 1YHQS 3IFEA 2BM0A 2NSBA 2XS5A 1F5AA 3H2LA 1U24A 3CCMS 2RB7A 2XULA 5F0WA 3M9OB 1GXUA 4LMZA 2KRBA 1L3SA 3HHLC 2VA3A 1ZM4A 4ED2A 1VQMS 2VG6A 4ZCLA 1HPZA 5I3QA 1IKYB 2FB0A 1WEXA 1HQEA 2B0GA 2B4OA 5CYQA 3AB4B 3OSNA 2RMLA 4DL5A 2H5EA 3SCJE 4O3SA 3FJ2A 4IFYA 2GFFA 2R7QA 4KHMA 1O0PA 3NNCA 2VBXA 3RU0A 4MKBA 2HFZA 1SI9A 2Z2LA 4G1IA 1TL1A 4KFBA 1M1KT 1MMNA 1U25A 5K14A 4WK3A 5U47A 4DL7A 3UCZP 4FXWA 2VOPA 4RNOA 1IBLF 2KYXA 3PKMA 1JLGA 5HP1A 4AQYF 4UQGA 2LU1A 4NA2A 1NKBA 1S0NA 3DLLQ 4RU2A 1TL3A 1AUDA 4JV5F 1IN0A 4F3QA 3SCKE 3N9UC 1QAIA 1R8CA 1FDBA 1C2PA 2JZ5A 4ID5B 4YR0A 1ULRA 1LWFB 3K5OA 3R1HA 4LF5F 3KK3B 2B6AA 1EETB 4OJ1A 1HBOB 3M2UA 2PFFB 3PACA 4ALZA 1LWCB 2ADCA 3GFZA 1GTEA 5SUHA 1TKDA 1KHWA 2DHSA 3R5CA 4WJBA 2VPYB 3EX7B 4X4UA 3QWUA 1LW0A 4B9VA 1IM4A 1GXTA 4OZ0A 4KE5A 5KFVA 2W9CA 1RYSA 3LF0A 3MFIA 3OXLA 4ERDA 4RX6A 2R8GA 3PY8A 2VQFF 1TK0A 4Y2KA 3FZ2A 3GG1A 3DU5A 2B9XA 2YX7A 4K4XA 1SKSA 3VQTA 2ROGA 4Q0BB 2EK1A 1X9MA 1Q7YT 1RTDB 1VOMA 1JK9B 4Y2MA 2RF2A 1TKTB 1UL3A 2KTQA 2VOOA 3VALA 2MB0B 1IKWA 2X1BA 4IFVA 2XY5A 4U9RA 2AD9A 5AXNA 5KG7A 3TAMA 4R0JA 2CG4A 2HGMA 2D9OA 3M1VA 3FFIB 4LF4F 1HYSB 1F2GA 5K5MA 2ZH1A 1S0MA 4B3RF 3NBPA 3GIJA 3TAPA 2V4JA 1GTHA 4QW8A 3MM8A 4IDKA 4MFBA 4CNYA 2Q6BA 1Y7PA 1HI0P 3IR6B 1A6LA 2BQ3A 1SJ3P 2NPIA 2AGOA 1FD2A 1J2VA 1HA1A 4OI1A 4DL2A 2FD2A 2Z8QA 3V6DB 3SEOA 2DBBA 4RW8A 5KT3A 1KS2A 3AH6A 1F9FA 5DDPC 4F4KA 3QGPA 4QWBA 4RW7A 1RAJA 3VTIA 3OLBA 2R7OA 3CPWR 3CCTA 3JTNA 5EN1A 4K2XA 3O3LA 1Y5IB 4PUOA 2YTCA 1QVGR 3QO9A 2B4UA 3UW1A 1S6OA 2BA9A 3V4IB 4USHA 3O8WA 1VK3A 3FVYA 1P9QC 3TYTA 2VG6B 1BQXA 2EVZA 1REVA 4RW9A 4JUZA 4E8UA 5KFWA 5KT6A 5DDQC 5B0CA 3HPOA 1BD6A 2V5HG 3NNHA 1HQEB 2XWYA 1NK0A 2B4PA 5GMKa 5CYQB 2UZAA 4TLQA 2X51A 4OHYA 5G4DA 4WYWA 1R0AB 2JEJA 4C97A 4IFYB 1MROA 1NH7A 2EFPA 3MOJB 2RQMA 3CCQS 1Q7LB 4OQJA 2HS4A 1FXDA 1JMTA 1TL1B 4KFBB 3OL6A 2DNOA 2WB4A 2ZJQQ 1KRPA 2D1CA 2DITA 2JL9A 2D41A 3OHAA 4ECQA 3DXBA 3HM9A 1ZZNA 1IBMF 1X7VA 2PO4A 3MURP 5C42A 3M8RA 4NXNF 4QIEA 1BQMA 3UR3C 1NHVA 2MJNA 1NJYA 1G3OA 1JLGB 1WF0A 5I3UB 2ZH8A 4FPRA 5HP1B 4LFCF 3M6VA 4ZS6A 2ROPA 3WDOA 1D8YA 3A1YG 2AGQA 2CPXA 1TL3B 2EG2A 2KT3A 3R27A 4YB6A 3MAQA 3F41A 3H5SA 2HNYA 2HLUA 4GC6A 1JB0C 2JDJA 3PRDA 4NA1A 3CJ5A 4A8FA 5H1SV 1Q8LA 4B9SA 4B9LA 2DNMA 2DH7A 2XNQA 5D8HB 5FJ4A 1C4AA 4ED1A 2IYIA 3PFEA 2BRLA 2VFUA 5F41A 1LW0B 4ED5A 2J8AA 3H25A 2M88A 3NP5A 2OPSB 2JLEA 2W9CB 2QE5A 3TRGA 3MM6A 2RSQA 4BBYA 3HX9A 5E3CA 4X4PA 4DN9A 4FF2A 4QCLA 3EXCX 5GADU 3UD4P 5F8HA 4OX9F 5AXLA 5KFTA 4I64A 2RRAA 3ENQA 4F26A 5CYMA 4QU7A 2RF2B 2MKCA 1WD6A 1NU4A 1IXKA 3VAKA 1IKWB 4IFVB 1RTIB 5DGAA 1MWZA 3HT3A 4QJVA 1GXLA 1I6JA 1FESA 4ELVA 4J37A 4OHZA 2XS2A 3M1VB 1LW2B 3TVYA 2VBYA 3GSDA 3WC2A 1PSDA 4IG0A 2PDAA 1YWXA 2HQIA 2LDYA 3NBPB 3BGRA 2ASJA 4DSEA 4C3MA 2QZ8A 2V4JB 2LQJA 1V9OA 4ELTA 1KQFB 2CPEA 2C3OA 5E0OA 3MM8B 4IDKB 3VR1A 2RT3A 5GADI 1JX4A 2Z2MA 2HVHA 1FD8A 1ZZFA 5GAGU 2L9NA 3MEDA 3ISND 4OHXA 3LP2B 4NYOA 4C8OA 3PW7A 1JLBA 5LL6d 3SSSA 2UU9F 1R8PA 2CPFA 1VBYA 2FLLA 2JLGA 3CO9A 1WHVA 1U1PA 1VI7A 2RRBA 3UE2A 4UY85 2RIJA 4RW7B 2XGPA 5FD1A 2ZBIA 5KG0A 3H2VE 2G0CA 1N32F 2DVIA 1H7WA 3QMQA 1S99A 1D9DA 3EPIA 2EI5A 3HI9A 3UD3P 4F25A 1NK5A 4JI4F 1FRXA 3N5BA 2GQ2A 3MTJA 3UCUP 1RT5A 2OD4A 1SKWA 2CQGA 4K4SA 5FIIA 5GAGI 2MGZA 3KG4A 3LO3A 2DT9A 1WF1A 4PRFA 4C2MA 5DLGA 3PW0A 2DH9A 4RW9B 1REVB 2W25A 1PGZA 4B9TA 1SKRA 2MQPA 2ZH6A 3BR9A 1JNZB 2MKJA 3EGNA 3MCSA 2HGLA 1FVQA 2AYEA 5KT2A 4IQMA 1S49A 1D0EA 2V4RA 3BSOA 4DF8A 3AQPA 3VF0B 2DD8S 4Q8FA 2XMTA 1ZAWA 1MROB 1VMBA 3M8QB 2HNDA 5IS2A 4DFPA 3HVRA 2GHPA 2RU3A 4NLQA 2ADBA 2MQNA 5CZVA 2EW9A 3AY0A 4JI2F 3BO2A 1JJ4A 1SJQA 1TFWA 1HNVA 1FEHA 3JTPA 3MHYA 3MMCB 3U1NA 2AP6A 4M8LA 4WK1A 4KHPF 1FJCA 5C42B 2M7SA 1GNKA 1BQMB 4ES3A 5KG1A 3OFEA 5K8OA 5DQGA 1DQ9A 3I82A 3GV8B 3IRXA 4YDXA 4NRUA 3MMJA 4J9MA 1XK8A 3OV7A 4B17A 2ILYA 1HWJA 1QM9A 5KFSA 3BGUA 4KJIA 5HBMA 1RQ0A 4WTYA 1AXQA 1HHSA 4K5SA 3RBEA 2HNYB 4MK7A 2UXBF 3EXYA 3H5UA 3I87A 2E29A 2YWFA 1KN6A 3QGHA 5IXUA 3CD6S 1XR7A 1LFWA 4QIWD 3KKFA 2CQDA 1NKEA 4XK8C 2XWXA 4ZMMA 2LCWA 2HMIB 2KXFA 3TA0A 3CC2S 1FKPA 2A2DA 3MM6B 3LQVA 1HHTP 3HF5A 3C66A 3HFKA 2QSFA 4CI0B 1GX6A 5DLFA 3D54A 3GWCA 1R43A 1OPZA 1Q53A 3CWJA 2MSSA 3DLJA 5CYMB 4KHRA 4OLOA 5C25A 2HS0A 2P9GA 3OLAA 2B7BB 2NPFA 4RUAA 5D78A 1NJZA 4DQQA 2E1RA 3QGGA 2J9DA 3DCAA 2GV1A 1SH3A 4TNOA 3HVAA 1X9WA 1DTTA 2I8EA 2MZRA 2VFVA 4NLOA 3KLIB 1SH2A 4K50A 4DHVA 5IQ6A 5LJ3Y 2KFNA 3DDNA 3OL8A 2ZHBA 1IUJA 4IG0B 2EK6A 2L08A 4C3LA 4DL6A 3BGRB 5D4PA 3PR4A 1QSLA 3ZZZA 2XB2D 1M5VC 3NS6A 3IGVA 1N5TA 3BEGB 4RLEA 2YKPA 4MIBA 3MEDB 2F3JA 4WF9Q 3SFUA 2YNGA 5DJBA 1SUQA 2WAQD 2Q66A 1JLBB 4R8UB 3IBWA 3RB0A 2ZVSA 3KLGA 4O4RA 3CCRS 3T6JA 3V6KA 5L1KA 1P1TA 4FF1A 1HW9A 1XMBA 2K3IA 3BN4A 1N33F 4DR5F 4TU8A 4H4OA 3OJUA 1XR5A 2JVOA 2AQ4A 4B08A 2VL1A 5K8NA 2YH1A 1PO6A 2DHGA 5F3TA 3T5HA 1FK9A 1KQSR 1RT5B 4WIIA 2KO1A 4XDDA 1WEYA 2CRLA 5AE2A 1ZH5A 1K1QA 3BQ0A 1S9EA 2MGZB 4PWDA 5AE3A 2IHR1 4EBEA 3MPVA 5E3PA 1IKVA 2QSWA 3DOKB 3Q8QB 2WSFC 4ZPVR 4NCGA 2Y1RI 3I96A 2BRKA 3CDBA 1TAQA 3PW5A 5A6PA 1ZPVA 3TA2A 1YQHA 1VQ7S 3BB5A 5LXRA 1RT3A 1TV6A 4HDGA 1HI1A 2V8HA 2V8DA 1CLFA 4M5DB 3SQGB 1C1BB 2GW8A 2J0XA 4ZP9A 5J2MB 4NZ0A 1M90T 2IJFA 4LFAF 2HNDB 2YNFA 5M2RA 1JJHA 4QWEA 2HZCA 4WZQA 1S77D 2DH8A 3KJVA 2PGCA 4YB1P 4G1QB 2LYVA 1S1TA 2IJNA 2CJBA 1HNVB 2DO0A 2WOMA 3NWGA 2EFVA 2QA4G 3MF5A 1VQKS 4W92B 2MKSA 4ILRA 2R8JA 2N82B 3UI3A 3I32A 5K8MA 4JV2A 4ZDNA 1S1VB 1Z4UA 2Z4PA 2RD5C 4CO3A 2YNHA 2VV5A 2ZH3A 1SXLA 2HRYA 3RYLA 1SJ4P 5D3GA 1PC5A 2F9JA 1FF2A 3G9CA 1N5YA 2XI2A 4HDHA 3H5YA 3CIZA 4Q2MA 5HBMB 3PW2A 4LJMA 1Y00A 1HQUA 3FMBA 1U2RA 5MAOA 3I9ZA 1KLNA 2VPZB 1HWIA 3OXFA 1RT6A 2IVMA 5BYSA 3MM7A 4MKYA 4I2PA 2HHVA 1U2FA 3FCHA 2FTRA 4EZ9A 2DGVA 3NNAA 2WSEC 3MEGA 4MTPA 2E1CA 2ZD1A 3TQ1A 4MMOA 1DLOA 2R7VA 1KR4A 5H9EJ 2ZZNA 1IQTA 1X8DA 2BXJA 2ZKTA 4QPXA 1RKIA 2HHHF 5I42A 3PIOQ 2ZITA 2W7OA 3IN5A 3M32A 3MR3A 2HYIB 3QAEA 4DG1B 5GAHU 4F8RA 5B7WA 3MDFA 5FLXY 3G96A 1UA0A 4DN0A 2R8KA 1A7GE 2MZQA 4OX6A 2XEXA 4HT7A 4LVOP 5LJ5Y 3I55S 3PV8A 1QSYA 2DNKA 2IC3A 2RJZA 2IA6A 1U7LA 3N0VA 4JI7F 3RR7A 2EFGA 3BSAA 4KRWA 1X4DA 1IKYA 4I6YA 2VFRA 4X4OA 5HROA 3AA8A 2VASA 3J81Y 1NHUA 4WZMA 4RNMA 2VPXB 1U6FA 2XCPA 3JSMA 3Q2SC <