7FD1A

7-fe ferredoxin from azotobacter vinelandii at ph 8.5, 100 k, 1.35 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (7-FE FERREDOXIN I)
publication title Oxidized and reduced Azotobacter vinelandii ferredoxin I at 1.4 A resolution: conformational change of surface residues without significant change in the [3Fe-4S]+/0 cluster.
pubmed doi rcsb
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 7fd1A00
1FRIA 3MM8B 4AYBD 5BYRA 4YDDB 2VPWB 1FRHA 4XK8C 3IR5B 2Y0SD 3MM6B 3MM8A 1B0VA 1Q16B 4Y28C 1SIZA 2GMJA 1F2GA 1G6BA 1FDAA 2FJAB 5L8RC 1FF2A 6FD1A 1BD6A 5BYQA 1XERA 1GT8A 3MM6A 4XDDA 1FERA 4KT0C 2C3OA 1Y4ZB 1G3OA 3LW5C 2VKRA 1BQXA 2XSJB 1H98A 3OR2B 1A6LA 2FJDB 1C4CA 2C3YA 1SIWB 1FCAA 3MMAB 1JB0C 3OR2A 2WAQD 2C42A 2V2KA 1H7WA 1GTHA 1D3WA 1JNRB 2O01C 2IVFB 1FTCA 1CLFA 1DURA 3MMAA 3OR1B 1HFEL 4OMFG 1F5BA 1H7XA 1Y5IB 2ZVSA 5E7OB 3OR1A 1Y5LB 3IR7B 5CHCB 1DAXA 4OV1A 2FDNA 2C3UA 3MM9B 2Z8QA 1PC4A 1FXDA 3EGWB 2WB1D 3C8YA 1BLUA 1C4AA 1R27B 6FDRA 3MM7B 2XSJA 3MM9A 1FDNA 3EUNA 2UZAA 2WSCC 1JNZB 4DHVA 1GAOA 1B0TA 5CH7B 1RGVA 1GTEA 1SJ1A 2VPXB 3IR6B 3MMBB 1BWEA 7FDRA 1IR0A 3GYXB 2FD2A 3MMCB 2PMZD 1BC6A 2WSEC 3EXYA 1H0HB 1Y5NB 5FD1A 3MMCA 4XDCA 1FDDA 1FDBA 3HKZD 1FEHA 5BYSA 2VPYB 2PDAA 1IQZA 1FXRA 1K0TA 2VPZB 1B0PA 7FD1A 1DFDA 1F5CA 1FRJA 2V4JB 1FRMA 3MM5B 3MM7A 3PNIA 1VJWA 2C3PA 1FRLA 1KEKA 2PA8D 1PC5A 4L6V3 4ID8A 1FD2A 1KQGB 2FGOA 2V4JA 3MM5A 4RKUC 1AXQA 2FJEB 4CI0B 1ROFA 1FRXA 2FJBB 2C3MA 2WSFC 1FRKA 3MMBA 1KQFB 1WTFA 2GMHA
chains in the Genus database with same CATH superfamily
2MMYA 4RNFA 2E29A 2RQCA 2GJIA 1UKUA 3HHLC 1Q82T 4U9RA 1Y11A 3PX4A 4B08A 3EVWA 4Y00A 4UF4A 2DXEA 3NCRA 4KGMA 1XMQJ 2I0XA 3BGOP 4U6PA 1LXNA 2OI2A 5E3AA 1MROB 1U47A 1UEKA 1ZTWA 4P2XA 4P75A 4DSJA 1U6ZA 4DL6A 1N32F 1NXIA 3DLEB 3NOCA 1O51A 3FBCA 2QMWA 3ZZUA 2V2ZA 4LF6J 1FJGJ 4QYZK 1XMOJ 5KG3A 5GAGU 4BC9A 1TL3B 3A8IA 1VRQC 5KFGA 3KNGA 4IKAA 4RW8A 2CYYA 1UW9A 2GGPB 3KUEA 4OYOA 4C8OA 1Y9OA 2KYXA 1RJJA 3JYTA 5A2QY 3SIPB 2HBYB 5DG8A 8ATCB 1R89A 4E2FB 2DNKA 3JTOA 2MKIA 3DXSX 4TKTA 3PKMA 3SYZA 4CTAB 1UVMA 3CPWR 3TARA 3CGIA 2PC6A 3LP0B 4HL9A 2HQ3A 2YKQA 2D1CA 2ZUAA 3CJSA 3A1YG 3W61A 4CLKA 2W4CA 2LEBA 3KLFB 3GIJA 2R7SA 2FHKA 2DCLA 5IT9U 2B4VA 2H5IB 1DRZA 3NXZA 1S77D 2XMUA 1TL5A 5E3PA 1NDKA 3D6HB 4WF9Q 2ZWOA 3TJ8A 3BBCA 1VFJA 5DDRC 2NLWA 1XTZA 1QD1A 2B4PA 3RJMB 3D6FB 1RAAB 2G0CA 2ACMA 3KLGA 4GVBB 5AJ3F 5I3QA 2CNOB 3NWRA 4UY85 2HVDA 2DGSA 2FY8A 2QLWA 1JWWA 4OQJA 5C24A 4M5NA 1U6FA 1NM2A 2OPRB 3BGRB 3FEXB 5B0DA 1KHVA 1BQMB 3H7HB 1N36F 2V69A 2BBEA 4NLWA 4O4GA 2J76E 1TL1A 3MGJA 4FF2A 4CH7A 4I6YA 3J7A1 5ETSA 1B7FA 2CIMA 2VFSA 3Q8YA 1HWLA 2J0QD 1VQ6S 3O5TB 2FZKB 4NLDA 1GTHA 1Q8KA 5CYMA 4PYDA 1OPIA 4ECXA 3LOUA 1VQPS 4WFAQ 1VQ7S 1NRKA 4M5KA 5F8LA 4CLZA 3WC2A 9ATCB 4LRFA 3QSIA 1SJRA 1PC4A 5J1PA 1RABB 5I3UA 4C2MA 4X4PA 3V6DB 3AJDA 2HHXA 4Q43A 4OJ3A 4A8XA 2OJ3A 2OMOA 2M7SA 1FDDA 1NKCA 4RJVA 3TAPA 1TMJA 2VC0A 2G0IA 5A8KB 2V4JB 3MM5B 1U1MA 4IRDA 4WFYA 2MZRA 1IBKJ 2XEXA 4RW4A 1S1VB 1CPZA 1KNZA 1GXLA 4F4XA 3FRZA 4EBEA 2ZD1A 1SKSA 2EG2A 2OIHA 4IYQA 4KBIA 5SZTA 1MLAA 2MEWA 2CJ9A 1XIQA 1WEZA 1G3OA 2K1RA 5B09A 4DQRA 1U1NA 3OT9A 4OYXA 1SC1B 1CULA 3K5LA 3CULA 1M5KC 3V5RA 3T9NA 3ZTPA 2KXFA 2J8SA 1JK9B 4LRCA 2BJ9A 1FKPB 2KT3A 4M1KA 1YRTA 3EPGA 1FKOB 3MCSA 2AGPA 4EZ9A 1QAYA 4K4TA 1X4EA 3CWJA 2RB7A 3DM2A 1N56A 1C1BA 1DTQB 2X51A 2COLA 2AEJA 4LR9A 5F3TA 5HK4A 1HNVA 4N8NA 4U96A 4CLFA 2BOPA 4DU7A 1NCLA 2J8AA 1PC5A 1FNOA 3R5BA 1HQ2A 1TU0B 2GV1A 1V9OA 4NOHA 4ELTA 2PD1A 2J6SA 1U45A 5D8HB 2J9DE 4YR3A 4NPOA 3UR0A 1I6JA 2QYGA 3IS9B 2E5HA 3GP9A 2DD8S 5L39A 1NPKA 3IP0A 1HBOB 3R6LB 3KLEB 3FVYA 4LR8A 1GX5A 1Z2LA 2CQ0A 3G87A 3H4DA 5C25B 4MTPA 4ED4A 1RWNB 4Q0BB 4KV8A 2G1HA 5C5JA 4X65J 5BR8J 1H2VZ 2NSBA 2DTJA 2OD4A 2ZNZA 2Y0BB 3VGSA 3BSCA 2HFNA 4RW7A 2K06A 1OSDA 1N6QB 2EPIA 5A0YA 4AE5A 1RT5A 4DPYA 3ELHA 1TKTA 3DRRB 4PRFA 4KH0B 4QU6A 3EGVA 2VD3A 3DLBA 3JXOA 4I6AA 4ICLB 4CM0A 5C42A 1NLKL 3HJVA 4K4UA 3K7RA 2GAHC 2AU0A 1KLNA 2VPWB 3Q86A 3IMQJ 2IMOA 4ZVOB 3T9ZA 1KFSA 1WG1A 2F4FA 3BKTA 3IXQA 2X7IA 3M4XA 4ZCLA 2H54B 5T7LA 4DSLA 1ZS6A 2DHSA 4OYMA 1IN0A 3U27A 3LALA 4GKKJ 1NK4A 3SEOA 4EMDA 1C0TB 2OPQA 4NLPA 5A76A 5IWAF 2Q43A 2H5JB 3PDNA 3ET6B 1JNZB 2M0GB 2YQ0A 3M05A 4CLPA 2ZBIA 4RZRA 4DR5J 1UA1A 1T94A 3N79A 5GAEI 2E1RA 2ZITA 1Q86T 1JKHB 4ZMMA 4WU3A 1WSRA 3U1NA 3FEZA 2HQCA 2IVYA 5HROA 3CCMS 3PNIA 3FQLA 1BUXA 1RWOB 3TI0A 4I7FB 4NYZA 3FK4A 4WWSA 5HVGA 2W1BA 2HHHF 3DDKA 3R5CA 5IC6B 3ZZPA 4A8WA 3DN9A 3Q2TC 1CVJA 1FFWB 4F4YA 4OJGA 3AA9A 4EBDA 2R7RA 1B0VA 1YJNS 1UTAA 2HNDB 3PG9A 1D09B 1HWIA 2PMWA 1RHRB 2ROGA 2XYHB 4DN9A 4EFAC 1FHTA 3RR8A 2YQ1A 2KFNA 1XN9A 5KFSA 2M2BA 5GAHU 3PEHA 2CQBA 4OV1A 2W9CA 2P2CB 2Z8QA 1PILA 2J9EA 4DPUA 2RH3A 4TQRA 1RXOB 1TK8A 1YDLA 2YKNA 3DYAA 1J5EJ 1SL1A 4ES3A 2MYFA 1IBLF 1JXEA 1Q7YT 5F41A 2B8PA 3VVTA 1IKXA 1Y5NB 2ZH6A 4XPEA 1UVIA 3UD4P 5B0BA 5F9NA 7AT1B 1Y3JA 1TVRB 4K4SA 2VH7A 1YZ7A 1NPPA 5U47A 1ZA1B 1HQUA 1T03A 3RB4A 4H4KA 3P4UB 4ZLLA 1H74A 1KRPA 2LFVA 2XSFA 1UCNA 3BR8A 2HHTA 2VBZA 4KHPF 3F0NA 3KDNA 1BXNA 5G4DA 3D6TB 1L3SA 5FDLB 1RBLA 2H3EB 3MPUB 1YBTA 2GC8A 3AQOA 5KFVA 2E1AA 2ZDOA 4IRKA 1N54B 4K4XA 3MF5A 4TY9A 2AJ4A 4IFVA 3MEDB 3MTJA 2BV3A 2HWIA 4NXMJ 4O0IA 3J7YI 4JV0A 4ECQA 1YJRA 4DV7F 4J9OA 1S1WA 3AT1B 2OP5A 3C15B 4IO9Q 5CH7B 3MECA 4JI7J 3TYTA 4IG0B 4PXEA 2MGZA 3I55S 4NX9A 2Q6CA 3W9IA 5JXSA 3R2DJ 3HHLD 1LFWA 1RADB 3FZ2A 4H4MB 4X4QA 1KN6A 2JH3A 4NZ6A 4UW2A 3C16B 2ZOFA 1A0OB 2B6AB 3EVMA 1FRMA 4Z7CA 2DNYA 2JVRA 2ZUGA 3PJ9A 4RKUC 1VJQA 2OPSB 3OTDA 4OZJA 2VG6A 1U0SA 3MMBA 5HVHA 2UU9J 4G1QA 4A47A 4X62F 2E5LF 1XERA 4XDDA 3GJQB 2HIQA 1NB2A 4DR1J 2BM1A 3CCRS 1M90T 1S76D 3SSSA 2W2OP 4O23A 2DRBA 1RWWB 3KFWX 2M8HA 3IN5A 2W25A 3J7ZT 5AE2A 5CHCB 5A8WB 1H72C 4MKYA 3PJXA 4PWWA 2BOAA 3HHNB 2D9PA 2YX1A 1H3DA 4BCAA 2OPPA 1ZYQA 3K17A 3CE8A 4DR6J 1BWVA 2ZHAA 2B5JA 3KHLA 1T9YA 3CDWA 2ZE2A 2YTCA 3HI9A 1RWUA 5I3PA 2LXFA 3RAQA 2RUGA 4BC7A 3D3CJ 1FD2A 3VQSA 2BKOA 3OBIA 2YBVA 4M95A 2PEHA 1HMVA 4MAKA 4LREA 4QR2A 4J9QA 1XNQJ 4MIWA 1EZZB 3AQPA 2HG4A 2OFHX 2WZ1A 2J0SD 2V2QA 3KYLA 1H7WA 5D0EA 3OVSA 2OEMA 1GNKA 1EX8A 4HH1A 5B0FA 4MK9A 3K57A 3K5OA 4ZPDA 1OWXA 3PO4A 3IM8A 3OFGA 1KVKA 1HR0J 1LW2A 1IKWA 1RYRA 4WK1A 4V1Ak 3AD9C 2FZCB 4JB8B 2HNYA 2IM3A 3QWUA 4RW8B 1S0MA 3VZHA 1S49A 1MU2A 3SCIE 1HNWJ 2ZH8A 3JYTB 2A10A 3NLCA 4RO0A 4LMZA 2NCKL 3A13A 4QWAA 2C22A 8AT1B 2Z58B 2W2PP 1ROFA 4DFJA 1MG7A 3QATA 2XNQA 2HBRB 1GMVA 3CMES 2EVZA 1FT8A 1YSJA 2AYEA 3TUZC 4L73A 4EWTA 2NQPA 3VAGA 3EDRB 3RBZA 3GJTB 4QZVB 1VQYA 4DV6J 2EFQA 1K73T 4BLGA 1VHFA 4RBUA 5M2PA 1DARA 2QMXA 5D4NA 4O3OA 3SI8A 2HFOA 3PR4A 4X4TA 1JNRB 2HRUA 3V81B 2FVPA 2GO8A 2BACA 3B82A 1P9YA 3QT8A 1W25A 4WXWA 3IR7B 1HLWA 4N41A 1RTDB 1NJXA 3C19A 4G65A 1AYEA 2K7KA 1F9EB 5HI7A 4TU7A 4TYBA 1HI0P 2HS3A 2P6TA 3KLGB 1XNRF 2LECA 1RA6A 5C24B 4ELVA 3MR6A 2W4DA 2JWNA 1G2EA 5IT0A 3HP6A 1L3TA 2VPZB 3DRSA 5EWEA 2HMIA 2LLZA 4DR3F 4ID8A 2ZH7A 4MFBA 1YWXA 5I42B 1TL1B 3RUBL 3RBDA 1ZM3A 2W8LA 3CCVS 1R8BA 2DNLA 1TAUA 1Q8BA 4LSZB 2HWTA 5LJ5Y 1VS3A 5CYMB 3MAHA 2WHOA 4ZN3A 2B3TB 1WG5A 4MIBA 1EKSA 3GPAA 2DNMA 1UPPA 1JX4A 1HYSB 3HFVA 3BEGB 3QSYB 4OI6A 2VG7B 4J91A 4F3QA 5I3UB 4X64J 2UVRA 4WTYA 4DL4A 4CCHA 2JLFA 5D0RA 3EX7B 1HL6A 1B70B 4K7QA 5F3ZA 1RWXB 3W3SA 1P6TA 1JLGA 2ASLA 4K2XA 2R7VA 4NA3A 3GCWP 3I5BA 2XNRA 2D9OA 3PX0A 2CNLB 2RSQA 1WKKA 2WW4A 2VPYB 4J9NA 2AW0A 4RU2A 4RW4B 1KEKA 3OTBA 1VIXA 1CEZA 1A9NB 5EWFA 2CPFA 2ZD1B 3RBEA 3PY8A 1NJWA 3BR9A 2DNHA 2K1RB 3QGGA 1S1TA 4B9SA 2EW9A 4IG3B 1UAWA 1CULB 3TO8A 5LSLA 2CADA 3RRKA 4UTGA 3MPYA 2FJWA 4ZCMA 4NA2A 3OVAA 3D28A 1URRA 3AJ1A 2DGTA 1D1UA 5KG1A 2W24A 2VJVA 4P7TA 3I31A 1CS4A 3IWXA 4F4AA 1O6XA 1U1RA 3DM2B 1C1BB 3M8WA 1GTEA 2XO7A 1P9QC 3RW6A 2IFXA 4WP9A 4DUZF 1RAFB 1W26A 2Y9HA 1HNVB 5B0GA 5HLFB 3KLHA 5KT6A 3HJFA 2JFDA 1NO8A 2POKA 1QAIA 4NLGA 5GMKa 2GVZA 2O1PA 2PN6A 2P9GA 3KG1A 1NEEA 2G13A 2E5IA 3W66A 4LRDA 3F73A 3HZGA 4NLOA 1SJ3P 1C4CA 3OL8A 1N48A 3H59A 4B3TF 3RR7A 1LWCA 1QUVA 4PABA 4OI3A 4FVMA 2OEKA 4O0NA 1DURA 4DQQA 4NEZA 2BQ3A 4AD6A 1F5BA 4X4OA 1DZ5A 1SVDA 2HRTA 4J7CA 4C8KA 1F3VA 4KV8B 2V8PA 2YWKA 3G96A 4OHZA 3T1YF 4LF9J 4FF3A 3SV3A 2BQRA 3GJRB 4RW7B 2BE2A 1VBZA 2VFTA 2A3JA 3NGSA 3DRYA 5A0YB 1KWMA 1GEHA 2CPHA 4WPAA 3HKZD 1RT5B 5CA5A 2BQUA 4B9MA 1TKTB 3MM7A 1IR1A 4IUFA 4KKOA 1VRUA 5C42B 3ZC4A 3UN5A 3F44A 5GAEU 4KFBA 3R8YA 3NKYA 4PPDA 3KJQB 5HO4A 4JI0F 3T3FA 5KT3A 1FKAF 3MM6A 2ALZA 3FBFA 5AXMA 2RMLA 1PAUB 1WC3A 4ERDA 4JV5J 5KFQA 1ZOTA 1ZM9A 2IC3A 1TL4A 3NOGA 1WEXA 2R8IA 4OZ0A 4G1PA 4LF5J 3TA1A 1RLCL 3WC0A 4EBCA 3VAJA 4LFCF 4J37A 4Y2CA 3ENVA 2R2RA 3EUNA 2IBOA 3RW7A 3KXDA 1NU4A 3IO1A 5K20B 1KOOA 1HARA 3C6TB 2UUWA 2GHPA 4WFZA 2HGMA 3B78A 1SKUB 2QL9B 3TVZA 1R31A 3MURP 4ALZA 4ANEA 3R6GB 1KTVA 2NPIA 1CJTA 2CPYA 4CLUA 3VTIA 3HVAA 1FRXA 1F9HA 2KH9A 1AZSA 3M6WA 3DLHA 4KGXB 4UY8T 4OX8A 1X9MA 1X4DA 5L8RC 3CJKB 4BBYA 5LT5A 4J5OA 3PO5A 5K8NA 4CH1A 2GX8A 1JB0C 1S1UA 3P6YC 2UVVA 3C66A 1SUQA 2LQ9A 4P10A 2W9CB 2W7OA 3P96A 1IM4A 1XJWB 3AB2B 2YKNB 2EKYA 3RB0A 2BJDA 4P2FA 4I2PA 1VLYA 1T8EA 2JSXA 2SXLA 5KFZA 1UFKA 4RW9A 4DV4F 4LR7A 1IKXB 4A8OA 1C1CA 4KHPJ 1TAQA 1D9AA 4PCQA 3QAUA 1CSJA 2PFDA 5F8MA 1HNZF 5J1EA 3NS6A 4QBUA 1X5TA 3FMBA 1XR7A 1FE0A 4K5SA 1LK7A 1RE1B 3H40A 1S57A 3ISZA 1HQUB 1T03B 4KH1B 2AYMA 4LF7J 1IKYA 1PKUA 4OFZA 2ZHOA 5D4OA 2V4RA 1KDNA 1NDLA 4AYBD 9RUBA 2FTRA 2VDIA 3NMRA 1RHQB 4LT6A 1TL7A 3CJQA 3VF0B 2KKHA 1GMUA 4WFXA 3V4MA 2XC9A 3BH6B 3N28A 3M8SA 4DL0C 2X1GA 4FYXB 4FVCA 4IFVB 4YP3A 4ED7A 3PW2A 1DY3A 3NL0A 4ED0A 1VQMS 2ZOGA 1S1WB 2VFUA 5G0RA 3K2YA 1T7PA 4F4KA 4WZMA 2K2PA 3MECB 2MGZB 3G8QA 4M5LA 5LL6d 2ZZTA 2VICA 3HD2A 1IR0A 1N5SA 2IYGA 1YZ6A 4IH6A 2E5LJ 1MWYA 2L9NA 3X1LB 4XDCA 3I82A 2YQ3A 1IQZA 1K0TA 4E0DA 1VDHA 2XULA 2QTWA 3CW2C 3DOKA 2VG6B 4DSEA 4L6V3 5CXTA 4O3RA 3HZEA 1WUUA 4G1QB 2JOQA 4W98A 3J80Y 4CM2A 2H48B 2MZSA 4J9PA 4PAAA 4QIGA 4DMZA 1FF2A 3NCPA 1VQSA 3TEHB 3DLLQ 2UUAF 3OVBA 2RILA 3H20A 4J90A 4DPOA 3ONQA 4IOAQ 1B99A 3CB4A 4ZVEA 5DLGA 3M8ZA 2B9WA 4QIEA 4P2MA 4J9SA 3BPDA 3AY0A 3LWMA 3CJRA 3PW5A 2OPPB 2ZH9A 2WSCC 5KFYA 4JYAF 4FPIA 5J2NA 1RGVA 2EFPA 1SJ1A 2B5JB 1K47A 4KPCA 1HW8A 4TLQA 1VIOA 4J9MA 1TK5A 1X5PA 5HQLA 1S7HA 3EXYA 5KFDA 2BJ7A 3UCZP 1YBUA 2Z2YB 3HVRA 1YTYA 4LFAF 2FHJA 3PFEA 3Q8RB 1IQTA 2M9KA 4ZHRB 4UT4A 1HI1A 4IDKA 3UNYA 2FJBB 4WIQA 1HMVB 4URGA 1PYTA 5B08A 5BYRA 2F65A 4Y28C 4I2QA 1JLCB 3KK2B 2VDHA 3W60A 2Y1IA 3PKYA 4OYAA 1Q5YA 4IFYA 3VAHA 4L3NA 2NR0A 2QLFB 3DRXA 1SV5A 3SCJE 2HFSA 3ICLA 1W2BR 3L7OA 4IOCQ 3THPA 3BDPA 2NXNA 2GQ2A 1S0VA 1X9WA 4P2SA 1XMQF 2AP6A 1DAXA 3OJSA 4PUOA 1F60B 3ILOA 5DO2A 1K0VA 2AKWB 5MAOA 1FJCA 1LW2B 1IKWB 1L3KA 3WDOA 4ECSA 1DTTA 4KJIA 2Y8WA 2HNYB 3HM9A 2O3DA 1LWXA 3G82A 5I4MA 1MU2B 1UWAA 4F8RA 4LF6F 3MMCA 1FJGF 3I87A 2K8GA 1XMOF 2YNHA 1RZMA 4H4OA 2IA0A 4YUDA 3L09A 1RKIA 3IBWA 3QGIA 1U26A 2ALYB 4B3MJ 1SH0A 5AXKA 4ECYA 1NJYA 2YKPA 3WIVA 2RAQA 4B9TA 3TOQA 4WCEQ 4RU9A 2IYIA 3H5SA 4EUVA 4ZK7M 3TVYA 3FRYA 2E66A 1UJ5A 3ZZRA 3O44A 2P6SA 4ANCA 3ZTSA 5KG6A 1LFPA 5HMXA 3EM1A 1MW7A 3I0SA 3K58A 3MEKA 1A7GE 4ZCKA 4C7QA 1S0NA 4OLOA 5T41A 1GAOA 4CO2A 4LBHA 4QWBA 1B64A 2PSZA 1JJHA 1U1LA 7FDRA 3L7PA 1BC6A 1RISA 3GTYX 2N7CA 3BQ0A 3HLUA 3DRSB 1KC8T 1FJ7A 1M1HA 2CVIA 2HMIB 1DFDA 1WI6A 1Q8IA 3V2UC 2IMWP 4MFBB 1KQKA 3TW0A 1OPZA 4TQSA 2FJEB 1Q5VA 3ADAC 2WSFC 3Q24A 4WKRA 2D7SA 5ETQA 2BEFA 4UQGA 3BGUA 1Q16B 4UQTA 5KFPA 2FLLA 5JVGQ 3W1YC 3FCHA 2W9BA 2QO3A 4AL7A 5CCLA 3SQOP 1S9FA 3HDSA 3TR5A 1RUSA 3FCVA 2R7QA 3MMAA 1QDUB 4CO1A 5DG7A 2XMKA 1S12A 4QR1A 4ZDNA 3Q8SB 2CQDA 3P5TL 3ISNC 1ZAVA 2JHEA 3PYGA 1HBUA 3U1MA 2FVSA 2KXNB 4O3PA 4ECTA 1JLGB 2KM8B 1V3SA 4CLTA 4ZVPB 1HWUA 2MQNA 4ECUA 5IOLA 1R8PA 5HP1A 3H4BA 3QO9B 4QCLA 5KFBA 2QL7B 3BGFA 2UP1A 3JSBA 1FVSA 2G4BA 4FYWB 1S6UA 2C3PA 3HSZA 1VK8A 1LNQA 2KVIA 2LYVA 3M8RA 3PXGa 2MQQA 1PCAA 2RS8A 3BO4A 4R25A 1IBKF 1S1TB 2KL8A 3IR5B 2DKOB 3HHEA 2DO4A 3DGPA 4CLLA 3M2UB 3MCOA 2VC1A 3GMGA 2YXLA 2YWEA 4FXVA 2H4WB 4PG5A 2R8JA 1VRTA 4QWEA 5CYJA 1NK0A 3T5HA 3TZZA 2FC9A 2B51A 1OYDA 2FZGB 2UUCJ 1CS4B 3QIDA 2IBKA 3MAAA 3BN4A 3NRBA 2J6UA 3OSNA 2VV5A 1EB0A 2DH8A 3RAXA 1K44A 2ASYA 4AFFA 2KG0A 1YJWS 3A3PB 2F5GA 2VOPA 3KLHB 2HURA 2H4YB 3CXCR 1FEHA 4N76A 4IH5A 3HT3A 3J7Z5 3LPYA 1TV6A 2DNRA 3TX8A 3OTOJ 5LJ3Y 2WVEA 4Q45A 2RF2B 4AQYJ 5H1SV 4X2BA 1N5VA 3Q89A 2WK4A 3ZZZA 4NLRA 4QOTA 4EGLA 2GVDA 3VWSA 4C0OC 4Y65A 2DR7A 2W01A 4EZ6A 1FERA 1LWCB 4C8LA 2FJDB 2HAFA 1VQ8S 1CC7A 2RRBA 2XMAA 4B17A 1RCXB 4I56A 1N5YA 3VCDA 1EETA 4NLQA 1J2VA 1M5OC 2XGPA 5DLFA 1OYEA 3CD5A 4DX8H 4TYAA 1T95A 1RCOB 1OY9A 2BE2B 4DV5J 3GIMA 4KPYA 5CABA 4ELUA 4PG4A 2DXFA 2HS0A 1TK0A 3FC9A 5IT9Y 2MY8A 4DX7A 1OO0B 2HQDA 4X65F 5BR8F 5KFFA 3MEEA 3SDEA 1QAJA 2ERRA 1REVA 5GVQA 4KKOB 1VRUB 3CMQA 3JSYA 2C2EA 4DG1A 1VMBA 4C11A 3D4JA 4ER8A 3V6KA 3DFEA 3LAKA 5D4LA 3HO1A 4A48A 2I2YA 2QA4G 4JI5J 3K89A 4F02A 2DGWA 2F4VJ 1T9TA 3MM6B 2V2VA 1IXKA 3Q23A 4K0KF 3RYLA 1BQXA 1VC0A 1RHKB 2HLUA 3M8QA 3QZ8A 3HVWA 2IC3B 2JEFA 3MWBA 3T1HJ 1IVZA 4QR0A 4JUZA 2YPZA 4MMOA 3MR2A 3PRBA 1SBRA 1YVFA 2YNGA 2FDNA 3TVKA 2P9CA 4GKKF 3V4IA 1WD6A 1PO6A 2EC0A 3VALA 1FDNA 1T3NA 4OX7A 2MSSA 3KOAA 3S6EA 4UOFA 1HD0A 2CXEA 2DJWA 2Q6BA 3H2VE 2Z2ZA 2ASDA 1NJZA 4CRJA 1NKEA 1TTHB 1CJTB 1VYAA 1X8DA 4EYIB 3POTA 5FIIA 2L9WA 4B9LA 1RAEB 3K8VA 4DR5F 3G9CA 2CRLA 2RDIA 1RWMB 1FX2A 3CD6S 3HVTA 4Q7AA 1LQ9A 5IV4A 3UVJB 1RQ0A 2BMBA 3FCWA 2HBQB 1U6BA 1JXLA 2ZH4A 1SXLA 3OQ2A 4LSLA 4KHMA 2GMJA 5AXNA 4JV2A 1R0BG 1U1OA 3RRGA 4XAKA 4ZP9A 4DV4J 2NXCA 2NS1B 3FUYA 1BY9A 3LH2S 1SUQB 3D1HA 2GNKA 4YY3J 2HW3A 1HPZA 4XO0A 1NB7A 4ZP8A 2F8EX 2RRAA 1IJFB 1NSKL 4HI2A 2PO4A 1RHMB 5B0CA 4PZVA 4DR2F 4FBUA 1T9WA 4I2PB 3R1LA 4M5HA 4F50A 5DS7A 1EJ7L 4RW9B 3UWTA 4M5DA 1C1CB 1N88A 4ECRA 2FHOB 4LF4F 4ZP6A 5DQHA 2GIQA 3UN2A 5J1EB 4EO8A 4NZ7A 4QYRA 4B3SJ 4PQUA 3AAWB 4LIRA 2CWKA 3Q2SC 3E2EA 2L48A 1IKYB 5IV3A 2IHR1 2X1BA 2ZEJA 5CD4H 2XYPB 5FLXY 3IC1A 4DZ6A 3WX4A 3D2WA 2YX4A 1FRIA 4ETZA 4XIUA 1TL7B 2WVBA 2ZJRQ 1WORA 4AXJA 2D3OR 6FD1A 1DQAA 2QSWA 4DV3J 4KT0C 5IFMA 1WHYA 1S1XA 1ZZFA 5LXRA 4HHUA 1KVJA 4FP9A 3GFZA 2VL1A 2K3IA 3ILJA 5H9EJ 3OPKA 2HQGA 2VIHA 5G0RB 1RTHA 2Y1LB 3GIRA 3THVA 3UFCX 1JLBA 3W63A 4NYOA 3J81U 3W2VA 4C8MA 4NXMF 4L74A 1LXJA 2GQQA 1WJ9A 2I8EA 1IWAA 4FKXA 4U7CA 2FLPA 4YOEA 1ZAWA 4USIA 2N3LA 3DOKB 4MK7A 1WC4A 2MY7A 1E6VB 2AJ1A 4CLWA 2C3MA 1FRKA 4PXBA 1Z2ZA 1KTQA 2DY9A 4FYYB 4RL1A 1S6OA 3DKDA 4OZLA 5IXUA 1EAYC 4OYWA 4YDDB 1RB0A 2L08A 2QG9B 2CQ3A 2BANA 1XC9A 3LP2A 1SI9A 2FUG9 4R0EA 5K8MA 4JYAJ 3DLKB 2PEBA 4ZKAA 5EWGA 2UU9F 4OYIA 4R5PA 1HHTP 1LW0A 5H9FK 1NKBA 4KYZA 2WAQD 4KGVB 3FZBA 4FYDA 1VC6A 4DR1F 1AFJA 1QTMA 2XZTB 5K14A 2FJVA 4QIFA 5K8PA 3BSOA 3KNAA 3SSRA 3O6QA 5J2NB 3CJ4A 1NNDA 3M30A 4F0KA 1UA0A 1VQ9S 5J2PA 2KI2A 2J0XA 1QUPA 4G6VB 2QA2A 4NA1A 2MLXA 1V3ZA 4JBCA 1CG2A 3E01A 3G8TA 3W8PA 3KKFA 3VVUA 1IBCB 4DR6F 4TNOA 3I4PA 4F26A 1RWKB 4IDKB 4OZNA 3MPVA 2D74B 5D0HA 2ZKUA 3D0GE 4PXDA 3W62A 3BYRA 3A3OB 5K5MA 2NSCA 3R5DA 4I2QB 3BO2A 3WBZA 2BJEA 4IFYB 4Q5VA 2ZBRA 3GLJA 3OL6A 1RT6A 4J9LA 1SV5B 1YI2S 3OTCA 4DCJB 2CKWA 1XNQF 2KFYA 3BBFA 1F1BB 2RQKA 1U2FA 3QAEA 5IQQA 4YDXA 2CJAA 3JSRA 1M0SA 2LDYA 4QIVA 2JLGA 3QMQA 2HAIA 4PUOB 4Z2XA 2UXCJ 2UUBJ 2QA4S 4ZLNA 1W2IA 1NPRA 4QIWD 4ZCIA 2E5GA 4DFMA 1DTTB 3T1AA 3H2LA 3CJ0A 1U7LA 3D9BA 1Q8LA 4LJMA 1RBAA 4OI0A 3IG1A 3G82B 3UDCA 3MMCB 3EGNA 4DF8A 2UXBJ 3HSJA 1I51B 1U25A 1LKZA 3GFHA 1HR0F 1N0UA 4H4OB 3UCGA 3LTOA 1FXRA 2HVHA 4NCGA 2WVCA 2XGQA 4HT7A 3OL9A 2QMUB 1AXQA 1LEOA 1HNWF 3CJTA 2GO9A 2XCPA 3ISND 3M9NB 3M32A 1NZ8A 3SCLE 4OI4A 1WOSA 3CCES 1QTNB 2CA9A 1U4BA 4LF8J 2AJ2A 4NLSA 3AH6A 2R7UA 4KTQA 3R7BB 4F2SA 1GX6A 1UWBA 3BREA 1PIEA 4DV6F 1DQ8A 2YX7A 5LMNJ 2JVOA 2E9ZA 3RBXA 3FQKA 5EGYA 2QL5B 3I0SB 2NXJA 1S9GB 2G2YA 3HFZB 3AOAA 4CYUA 3ZZ0A 4USVA 2NPFA 4C97A 1R8CA 2E5JA 4RPFA 2VF3A 1QJHA 5KG5A 3G8SA 3HD1A 3DHXA 1X0FA 5DDPC 4R0JA 1PJ5A 2ZH1A 1VBKA 2L9DA 2UV8A 4QPXA 3VAKA 3I0RA 2V8HA 4C8YA 1RDRA 3H0PA 2F1FA 4CO5A 1O5JA 2QN6B 3MR5A 2MXYA 3AA8A 3DCAA 4B9VA 2EBGA 2IRUA 1SJFA 2PGCA 2W2NP 2EFOA 4OHVA 4PWDA 4ED2A 3WIUA 5HSPA 5ITHA 2W9BB 4QW9A 2GIRA 1YITS 1RT4A 5DDOC 2PI5A 3EPIA 2DHHA 3CD0A 3MMAB 1H6KX 2JFKA 2MKJA 2CQIA 2QYCA 1KOHA 3QIPA 2KB2A 4P73A 1HBUB 2FLNA 2BUNA 4JOUA 3ITHA 2IM2A 4DUYJ 4NI2A 3LP0A 4LBIA 1WWHA 3MM9A 1SC3B 3DRPA 3PFOA 3GYGA 4DV1J 5HP1B 4X64F 1OS5A 3KLFA 3QJJA 2VJUA 2WSEC 3O8WA 3TZYA 5BYSA 2W2MP 1C2PA 2Z2MA 3MEGB 1NSQA 1FI4A 3MI7X 3WQPA 4UUWA 2RIJA 1QM9A 4CH0S 3NEKA 1E6YB 2BKPA 1NHKL 1FWPA 4H4KC 3TRGA 3UDVA 4PQAA 1RI7A 5DQIA 3DGPB 3KG4A 1NH7A 2IAJA 4AL5A 3TX0A 3PRDA 5AT1B 2MSTA 3BGRA 1VRTB 4WBFA 1KD1T 1SQFA 1LWFA 3BB5A 1WC5A 1NZAA 1NJIT 5DG9A 3OXLA 1HNXJ 2H9ZA 3HPOA 2CDRB 4ZLPA 3UNGC 3MAAB 1N34J 4I0WA 3D3BJ 4ZPBA 1WOOA 1KSPA 2LKZA 2DISA 1PYSB 4CNZA 2UVWA 3DU5A 4I4BA 5KFIA 1N4LA 3CJ3A 4QPTA 2HVIA 3FMWA 4NZ0A 2I6WA 2ZHBA 2B7BB 4ZOSA 3CO9A 4X4NA 2XI2A 1KQSR 2I5JA 1TV6B 4Q44A 3PYFA 3NMAA 1SQGA 1WDTA 4ZVRB 3V6DA 2EK6A 2HNZB 1RT7A 4DOZA 2XHWA 1KQFB 5L1KA 4TLRA 4K4VA 3R5JB 3CCJS 2GVDB 3AHPA 1MMNA 2N3OA 2CDQA 2LQJA 5KFCA 4ZP7A 2XSJB 4DU8A 3OUYA 5SUHA 3MFIA 4Y6IA 1N5YB 1I94J 3ETMA 4DL7A 2BE9B 5K9FA 1HIYA 3VGTA 3EZ5A 1M5HA 3GWCA 3TAQA 2UXDJ 1Y5LB 3KLIA 3LP1A 2ZFHA 3B54A 4ZIWA 3N6LA 1LWEB 4KO0A 2KRBA 3CUNA 4F04B 1K1QA 3Q22A 4LF9F 1NH8A 2ZVIA 3W9HA 4ILRA 3MEEB 3SDEB 1X4FA 3UR3C 1REVB 3RRHA 5C2GA 2YVSA 2QT7A 4K0KJ 3MHYA 2BX6A 1FTRA 2ZM6J 4DG1B 1RAOA 4C11B 2KT2A 2OUGA 4WP3A 2QLXA 1R3NA 5DZ6A 4ZIVA 3C3LA 2AF6A 4DLEA 3FGVA 1VQ5S 3BS9A 1HQEB 1PYOB 2OELA 1WACA 1RU2A 3TEGA 3DOMA 1ZAXA 4ILLA 2RVJA 2JEIA 2MJNA 5HJYA 2C28A 2J5AA 2R3VA 2A2CA 5CAAA 4F4WA 2BYCA 2YNGB 1JMTA 4JV5F 4FPRA 2LA4A 4YN3B 3V4IB 1XMBA 4GO5X 1LK5A 1TMMA 2DITA 4LF5F 3TQEA 2J9CA 1K8AT 1WELA 1BWEA 4YFUA 3H2UB 4HDGA 2EC2A 4AL6A 2HVZA 1JJ2R 4N56A 3POTB 4ED1A 4F36A 1UVNA 3B4DA 1NDCA 1Q0NA 2JX2A 4XPCA 5D3GA 1GFWB 2R7OA 5AE1A 2B9EA 1KS2A 3N5FA 3HVTB 3OFEA 4DSIA 2EI5A 1S6PA 1G7CB 4F4ZA 4JI8F 5KFMA 2C2OB 3G71S 3PZPA 4LSLB 4DR2J 2H1YA 1H2UX 3BV8A 2AJFE 3B4MA 2P5VA 1G1XA 2CJBA 4ETXA 4LF4J 3GR0A 3DRRA 2R9LA 1TELA 1HPZB 2A2DA 2HVEA 1X60A 2K7JA 2CZ4A 2DR9A 4FDFA 3NNAA 1NK6A 2OHDA 3I96A 2ZBQA 3MOZA 3NAHA 5B7WA 3QJLA 4M5DB 2MKSA 1S9EA 1S5ZA 4X4SA 4KAIA 4CQ1A 1MN7A 4WYWA 4RNOA 3U02A 1S48A 1T05A 1HBNA 2KZZA 4PQUB 1C0TA 3DHWC 3H90A 5KFOA 2RQ4A 1FD8A 4HH0A 3AD8C 2YWGA 1WHXA 4I67A 4DPTA 4Y2IA 1AROP 1JLFA 3NWGA 4CT9A 4YR0A 4JI1J 3CCZA 4R8UA 4QJVA 2C2ZB 3KLVA 1IKVA 2PA3A 2GMLA 1PBAA 1WDDA 2J7WA 2N7YA 4LF7F 3UD3P 3UD5A 2Y0SD 1RKJA 2ZOMA 4EI2A 2E1CA 3O2IA 4CT8A 1S1XB 1FDAA 4B3RJ 5KAKA 1H98A 4TY8A 3PIPQ 2F7VA 3AXMA 3PCOB 1U09A 3EMTA 4MT1A 2XWXA 3FKBA 4IQMA 2C2NA 1OY8A 1DLOA 1RTHB 1S4FA 2ATCB 1JLBB 2ZNYA 3QRQA 1HW9A 3GIIA 3W2VB 2BABA 3PTWA 4M5MA 4BWMA 4LQ3A 2A6MA 4N7TA 2KM8C 2FD2A 2DK2A 2GS8A 1U48A 4B9NA 3IWLA 2CQGA 3IAM9 1CJUA 1MMDA 4DR4J 3HULA 3KJVA 1QSLA 4Y2AA 5H9EK 2FJXA 1TKXA 3QFHA 2E7WA 4YHHJ 3I32A 2HZVA 1SJQA 2BANB 3LP2B 1VHIA 5GMDA 4DV2J 5ETPA 4ZPWR 1FXLA 1T3OA 1UETA 4BWJA 5HANA 5LMUJ 4R5PB 5CZVA 1LW0B 3LGHA 2AGQA 2DR6A 3A8EA 3ETOA 2YKMA 4KSEB 5L46A 4ES1A 3CIZA 3NNCA 3FSXA 1ZPWX 4USTA 5K14B 3US5A 4C9DA 3TJAA 1CJKA 1R6YA 2JZ5A 3OR1A 3M30B 2H51B 1VR6A 5J2PB 1Q53A 3QGPA 4XTTA 2AYGA 1B0TA 3E01B 5J1NA 4O3SA 3BZQA 2DY1A 2C2DA 5IS2A 3TWZA 4DLGA 1NHUA 4C3LA 1NK9A 4HACA 2R2UA 2YKOA 1B0PA 7FD1A 5KFAA 3H5XA 3GV7B 1KBRA 2C2MB 2GQCA 4ZJQA 2FGOA 2ROPA 2C1EB 4IG0A 3KUGA 1T9VA 5ETKA 4TXSA 2VASA 3K8WA 4OX9J 3J7AN 1OSCA 2ILZA 3BSNA 4OHYA 3T6BA 2O66A 1ACMB 5DETA 4EU0A 4KB7A 4ED5A 4H4MA 4FF1A 1RT6B 1KP6A 3TUJC 4OZ1A 2B6AA 5D78A 2HGLA 4PG8A 2XZDB 2VQEJ 1T02A 3PEJA 4WZQA 5IQ6A 2XB2D 3I5AA 3VQTA 1S72S 2JL9A 4NASA 1VQOS 3MPDA 2JJ4D 2FB0A 3M8YA 1BLUA 1VCTA 3DC2A 4DV0J 4E8UA 3IG1B 4OZ3A 1FWKA 2KHDA 4K5RA 2F8MA 1MN9A 1HNIA 2A18A 4HHHA 5EX3A 3D54A 2KG1A 2BW2A 1F0XA 2GCFA 2V5HG 5M2UA 1ULRA 1FK9A 4NCGB 4M94A 2B56A 3DDNA 2AX0A 4P9SA 1N0VC 3OHBA 4F0MA 1RT3A 3M32B 4N77A 1UVJA 5IM0A 3CDAA 4Z37A 5E0OA 2HSEB 4XK8C 5L9XA 4B3MF 2QV6A 2CJXB 3A4TA 4NXNJ 4OJ1A 1XQIA 2YH0A 2DNPA 2E9RX 1OMSA 4FS2A 4GO7X 1UWBB 3G86A 2CQPA 1F6TA 2ZBPA 3X3UA 1TFWA 2AT1B 3EXCX 1KONA 5J2MA 4Q8EA 2DR8A 4CYUB 5E3CA 3SFUA 3R5AA 3BYPA 1ZTTA 3R2CJ 3FEYB 3P8BB 2V8DA 1PBUA 2FYXA 3WZ0A 3SQGA 1VBXA 2XY6A 2NZ4A 4O4GB 2VHGA 1TKDA 2DB1A 3I0RB 1YQHA 2AHOB 3L4BC 3C2PA 2CQ2A 4NL5A 5KT2A 3D7SB 4FS1A 3W7BA 4OLPA 3SMZA 2WW8A 5MLCV 2XMMA 1VBYA 5EHHA 4PWDB 3NS7B 3H25A 3HHKA 3BDEA 2MZ1A 1HWKA 2V94A 1IJEB 3K5MA 2CZ9A 4YB1P 1RT4B 2KN4A 5L1LA 2CJQA 4DR7J 2AZ1A 3VV2B 3BF4A 2RDJA 5J2QA 3QIPB 4LVNP 2C42A 3D66A 1D3WA 2OO4A 4RUAA 2HZAA 4ZPVR 3VGUA 2AZ3A 3ITHB 4C8ZA 4NI2B 3GV8B 1Q4RA 4ZVTB 4E98A 3UI3A 3MM9B 3DRPB 5KFJA 1TZ0A 4H54A 1FXDA 4QU7A 1FO1A 1P8GA 3GE9A 3H8YA 1TQLA 2DCUB 4WK3A 2JRSA 2VPXB 3V81A 1SB6A 4Y34A 4G3IA 2BVZA 3PR5B 2AIRB 1UZHA 1AUDA 4I69A 1JIHA 1RTDA 3T5JA 4JI4J 5DJBA 4A8YA 1UPMB 3RU0A 4DPXA 4MKAA 1KR4A 3KK1A 1KQGB 1U1PA 2MQLA 2LEPA 1B7YB 3KTQA 2IJFA 3ILLA 3OFHA 2MJUA 3CT9A 3H5UA 2IAJB 4OYZA 4NLXA 1F2GA 4NRUA 4ZVGA 1RHJB 1RU1A 1U1KA 1LWFB 3NGKA 4I68A 3S01A 4UOGA 2HQIA 1RTJA 3M7VA 4C8NA 3OJUA 3HMJG 2FVCA 5I42A 2HK3A 3QLHA 3SCKE 4GC6A 1WNEA 2BJ3A 1NDPA 3PACA 1EHWA 3CJ2A 3DDIA 1S99A 1ICEB 4B02A 4TU8A 5KG4A 3TZXA 3OXFA 3BH7B 3VGVA 1BE4A 4MYUA 1UL3A 4RW6A 4DCOB 2UUCF 3CDEA 4PXCA 2RHQB 1HYSA 2QIFA 2I5JB 3NGUA 1Y3KA 2PFFB 3QJPA 2VG7A 2DIUA 1WTBA 1GXUA 1VLOA 2ACYA 3DI6A 2KDOA 1REGX 2Y1JA 4F3OA 1RT7B 1FRLA 4ZVFA 3W65A 1F2HA 4WYLA 2BRLA 4RBTA 2CFXA 4PG7A 1T11A 5HN0A 2P9EA 3DOLA 1L3UA 4HKQA 3PW0A 2HEKA 1ZH5A 5B0AA 4KHRA 3OTOF 3MM8A 3WHIA 2DIVA 2HFVA 3ULHA 3OUYB 1GT8A 4AQYF 3BM7A 2KYZA 2OEJA 5KFUA 3FSYA 1MSWD 2V34A 5CD4A 3OR2A 4JI6J 3RB3A 3G6VA 3NBPA 3UPFA 3JB9k 3KLIB 2QGFB 3LP1B 2VBYA 4KO0B 4IG3A 4OZ5A 4LFBJ 4U7UK 2DXDA 4CWBA 2RQMA 2I9SA 1D9FA 2RE1A 3ZFVA 3M8PA 4YQWA 2VFVA 3MPWA 1M1GA 3DNCA 5C2CA 1WHVA 4J9UE 3JAMU 4DV5F 4LIWA 2HBZB 3C14A 2R42A 1KHWA 2FC8A 2LDIA 2PI4A 2VQFJ 5FLXU 3EICA 2HHQA 4L76A 5T7LB 4EO6A 1QSYA 4ZA1A 3K0JA 4DFKA 2BXJA 1JJ4A 2KTQA 3QFWA 5KFEA 2Z30B 3DLGA 3SV4A 1DBDA 3DOMB 3P49B 2OPQB 4ILMA 2YPYA 3AB4B 5HLFA 4UZBA 3M6XA 3PW7A 3HHLA 1F3FA 2F9JA 1HBMA 1WKLA 3CDUA 4JI5F 3OFFA 2F4VF 2IY5B 2N82B 3KK3A 2QZ8A 3PJWA 1CLFA 5BXIA 4GKJJ 2F40A 5ETVA 2J6TA 2YH1A 3T1HF 2EFVA 2QX0A 1YJVA 4X4RA 2WRMA 2NREA 2ADBA 3W2WA 4RLEA 3OD2A 5HROB 2B4UA 2ZH2A 3PYEA 4JI8J 4PYAA 4YEAA 3UCUP 5ETMA 1AFIA 4ECWA 3TUPA 2XZWA 2XBPA 2DEIA 1RT2A 3PRVA 4S0MA 5D3GB 5IZHA 2CZVC 4Q8FA 2KT5A 1S6PB 2FIUA 2PA8D 2VONA 4AT1B 1WTFA 3IBFB 1CQMA 4K2JA 2HPUA 1GQEA 2Q3PA 1MWZA 2MHEA 4IR9A 2DO0A 3DYAB 1FCAA 5KFWA 2W7PA 2R8GA 2EKNA 1FVQA 2BR0A 1C0UA 3PHTA 1RA7A 1S9EB 4YY3F 2VFRA 2NUUG 2QLJB 1UJ6A 3ENQA 3PIOQ 3M2RA 2EFGA 3NNHA 1OQ3A 2XS7A 2ZZNA 1T05B 1HBNB 3BQ2A 1WHWA 1FJEB 3RZAA 3A12A 2E44A 2VA2A 5M2RA 4LUBA 3S7RA 2VBWA 5CCMA 1Q78A 1JQGA 2F63A 3IWNC 2I1RA 1JLFB 1HKAA 3LF0A 1TP7A 4R8UB 2ZWPA 3ZO7A 3LANA 1IKVB 4TN2A 4B3SF 3ZNJ1 2DPIA 1R8HA 2NXUA 4X66J 5D0GA 5E2QA 4U8YA 3C6TA 1S79A 4QW8A 3VAIA 2G1DA 1S4EA 4ZVHA 4JI3J 1JXVA 1ZM4A 2V4QA 4ZJLA 4X84A 4TY8B 3HHDA 3JQJA 5KG7A 2IJNA 3HT0A 2R2SA 2VUGA 2FHMA 3MUTP 2XHCA 4OYBA 4DV3F 1DLOB 5JMNA 2ASJA 1Q95G 2ZVSA 4DL5A 3R3TA 1HWJA 5LM7E 3CJKA 3A3NB 1WC6A 1X31C 3T19A 1O8BA 3HCXA 4QWCA 2V68A 1H38A 2X3DA 3G2XA 3DGVA 5A2QU 2B0GA 4ZN1A 1UFWA 2YNFA 3MMBB 2ZH3A 4USJC 3E51A 4N5SA 3D67A 4Q2LA 2K3KA 4USWA 1N5QA 2W4PA 2XWYA 1CJUB 1IWGA 3ZZOA 3KJVB 2W8KA 2QEXS 5L38A 1TKXB 2R7XA 3OL7A 3IGNA 4NMLA 1HI8A 1U2RA 5F8IA 1U8SA 1QE1A 4JI2J 2V0NA 4HT5A 5ETOA 1YJUA 2VU5A 1P1TA 4K4ZA 3E3XA 1NAQA 4DS4A 4YR2A 2YKMB 3ZZTA 4RNMA 4LRAA 3I4HX 2B7CB 1R8AA 2JEGA 3N01A 2DNOA 2M3DA 1CJKB 4U8VA 1UVLA 3OR1B 2CPDA 2J9DA 2JDJA 2ZE2B 1RACB 2DRAA 1EIYB 3HKWA 4CP5A 3C8YA 1R27B 3P5BP 2RDDA 3OSPA 4F7VA 1YJTA 1M5PC 2IDLA 3CCUS 3GYNA 1J5OA 3GV5B 3EDQB 2QE5A 4M5JA 2PMZD 1UJ4A 1Z4UA 4KRWA 4HACB 3Q8VA 4NMXA 1RTZA 2FLOA 3H5YA 1IM6A 2GFFA 2CUYA 1N33J 4DI6A 1LV5A 2A1BA 5E33A 4WU2A 1RLDA 4DX6A 4PKDB 4LSNA 4K50A 4B3OA 2V9KA 5HMWA 1PJ6A 5K8OA 5A8RA 4KGKA 4DXLA 3VAMA 3HX9A 3OV7A 2M5YA 2DNNA 5HMZA 2MTLA 4DX5A 2RT3A 3GG0A 3LGMA 3IA0A 5KG2A 2PIIA 1SQEA 1ZZNA 2D3O1 5E7OB 3KHHA 2E1MC 4KY3A 3SBMA 4RX6A 2N4CA 1QLNA 3GFYA 1V5IB 3CTRA 1HNIB 1YGYA 2GIFA 4IO1A 2UXCF 2UUBF 2WONA 2JLEA 4HI1A 3B6BA 2BE7D 2R8KA 3C46A 2JC1A 1FK9B 1RSCA 4KIAA 1S6QA 5JJBA 3CC7S 3AXKA 2BDPA 5LSRA 2B8QA 1RT3B 2UXBF 5AE3A 1RTIA 2XYGB 3Q8QB 5IM0B 2R2TA 4ZITA 2B9YA 3PV8A 5GMEA 3CC2S 4GC7A 2OTLS 2V67A 3EJMA 2CPXA 4Y3CA 1ELOA 2CWXA 1I1GA 4OI1A 5D77A 3PVXA 1CJVA 3HXMA 1XEZA 2WOMA 3GU0A 4ZHRA 5J2MB 2V50A 4AXIA 3OLBA 4LF8F 3DMJA 1RAGB 1N32J 3HSDA 4DCPB 1V3RA 4CO3A 4C4WA 1S0OA 2VKZG 1NSAA 2DBBA 5KOWA 1X9SA 2B9XA 5LMNF 1JLCA 3KK2A 2GW8A 1SC6A 2WBMA 1Y0HA 3GILA 3AJ2A 4HEA9 2CQHA 5DGBA 2ROEA 3SQGB 1JLQA 1FWLA 3UE2A 3VR1A 1B4SA 2XMWA 4LVOP 2NZCA 1PGZA 2WTFA 1XR5A 4URSA 1XWLA 1NK5A 4I6WA 3VAFA 2MQMA 2PDAA 2XMVA 1BQNA 4N8OA 2OD6A 3J81Y 3U7JA 2GHVC 4BHQA 1BGXT 3W5ZA 3IAS9 4WTOB 5RUBA 4Z7YA 3L95X 4HTIA 2WVFA 2YNIA 2H65B 3GR1A 2BRKA 1WG4A 1PG5B 5J2QB 4CLSA 3NGDA 1UEVA 3LW5C 2AMCB 4FXDA 2RKIA 4K4YA 3OXGA 1SIWB 1AA1B 1K1SA 4EK2A 4J9KA 3QT7A 2JNJA 1SH2A 3F41A 4WFNQ 3BO3A 4DQSA 1RT1A 5DDQC 2IVMA 6AT1B 1SPBP 3J81j 1TR0A 4C3MA 4USUA 4PPZA 4KQZA 5AJ3J 3JSMA 2XQCA 1TKZA 3BQ1A 1ZETA 2DGQA 4A8FA 4DUYF 3AODA 4A46A 2C2KB 4USHA 2HWHA 1AUSL 4WE1A 4CZCA 3QRPA 4O44A 4DV1F 4D3HA 4OL8A 5L9NA 3LQVA 1YKWA 2CPEA 1T0TV 1TUWA 1N36J 3W8GA 2ATLA 2C2RA 3KK1B 1HHQA 2MDAA 1WF1A 5CQGA 1RAHB 1WF0A 3CC4S 4OHWA 1SH3A 3FBBA 4DQIA 2GA7A 2U1AA 1RTJB 4NCAA 4EEYA 1NHVA 3TUIC 1GMWD 3QLHB 5HQMA 2VBXA 1RYSA 2GHWA 2LA6A 4ZPCA 3L3CA 3MOJB 4KGZB 4PEOA 2FHJD 2ZZMA 2RJZA 1S59A 4X4UA 2MZQA 2XO6A 3NAIA 2ZJQQ 1R43A 1HNXF 4RW6B 3W5YA 3SZ2A 1N34F 1U24A 2GVZB 2ZKTA 1ZPVA 2IM0A 2AWZA 1VQ4S 2NXEA 3DI6B 4P72A 4Q2MA 3MTKA 2HFUA 1UW4A 5EX0A 2ZC4A 3DOLB 3EYZA 4YMEA 5A6PA 3IRXA 3TA0A 4TU9A 3MM8B 3QO9A 5A6WA 5IC4B 1F5AA 2KU7A 1U49A 5D15A 3A8KA 2V8GA 3BGLA 2E7VA 1VOMA 3QT6A 2VKRA 1FX4A 3OR2B 4MYTA 3NBPB 3M9OB 2CNKB 4YB7A 3H98A 4P71A 3MUVP 1I94F 2CQ1A 3M2UA 4YB5A 2CPZA 3MM7B 4DFPA 5JVHQ 3M8PB 3TAMA 3GB0A 3HSGA 2UXDF 5L1JA 4ID5A 3R7NB 5KFHA 4F67A 1JJCB 1KLMA 3NGRA 2LU2A 3T41A 4KFBB 1JLEA 3IRWP 3AD7C 2ZBCA 3MMJA 3T5KA 3C14B 3CJ5A 3T6JA 1SKWA 3N9UC 2J7UA 3D6MB 3CEDA 1FRJA 3SSQA 5F8GA 2E1PA 3R9LA 2V9WA 3DLGB 2QC3A 4LRBA 2ZM6F 2KJWA 3HHLB 4DSKA 1HBMB 2M4MA 3TANA 3EZOA 3MD3A 4FF4A 2XG8A 1QSSA 5BYQA 2MZJA 4BDPA 1U8WA 1KVIA 3QYYA 3KK3B 3D1OA 4DL3A 4HHJA 5D4PA 3EZUA 1F9FA 2RNEA 2RF2A 3CCTA 4A8QA 2P8IA 2CPIA 2YKAA 4WIIA 1VISA 3W2WB 2VB6A 5E3RA 3K59A 4C48A 3FDSA 5HBMA 2UZAA 1DJ0A 1Y10A 2QFJA 2VG5A 3N5BA 1GK8A 1RT2B 3UW1A 4CLYA 1AZSB 4K4WA 2XLJA 2HZCA 3RTVA 4GVLA 4OIXA 2J7KA 4CDIA 1JLAA 3MXHP 2V63A 4NLUA 1RHUB 3KMSA 2UV8G 2R4FA 3LO3A 1VJWA 2BJ8A 1GXTA 2HHWA 1NMEB 1S1UB 4ZS6A 3VZIA 4HLBA 2G2ZA 3ILIA 1U1QA 1U02A 2F9DA 1EQMA 2MZTA 1SCJB 4HR2A 5IT4A 3RGIA 2J0WA 3BN7A 1UEUA 2AQ4A 1SIZA 1BD6A 3N6MA 2EG1A 3W5XA 2C3YA 1R0AA 2CNNB 2QRRA 1XBWA 3CSKA 5IWAJ 2DNQA 1C0UB 3W9JA 1HD1A 5GADI 3HK2A 3I6PA 3LAMA 2VA3A 1X4CA 4M5IA 5F0WA 3ZXWA 5EN1A 1B3TA 4OV6A 3M2RB 3W64A 1K9MT 5KTQA 2KHCA 2W2QP 2YWFA 3VHQA 4FYVB 4OYPA 2DT9A 1AB8A 1OIAA 2BW7A 5F9LA 8RUCA 4MKBA 5KFLA 4HTJA 3KHRA 2LMIA 2HHHJ 2E9TA 5DRKA 4CIOA 2EBEA 2YWHA 3CO0P 4NYPA 1N52B 1D8YA 3KHGA 2ZDPA 4W4MA 2XM3A 4JI1F 3EWGA 2Y1RI 3D0IE 5THWA 2XY5A 4WXOA 3BKUA 1Y4ZB 4HDHA 2ABYA 3CCWA 3ZTRA 2OMLA 1UP1A 3Q8PB 4B3RF 1FTCA 4P74A 3UVJA 2U2FA 4LF2A 3P3DA 4OMFG 3MDFA 2LU1A 1TUVA 1RK8A 2FVQA 3O3LA 4CO0A 1VGYA 2A0FB 4LF1A 2DPJA 1IBLJ 4HYKA 2IJRA 4PG6A 2CVEA 6FDRA 1VQNS 2YNFB 2UVUA 1U0HA 1ITPA 3C6UA 1URNA 4C3KA 3QRRA 3E8OA 2DH7A 2AEMA 2PE8A 3G6XA 4DL2A 1LOUA 1FDBA 2IIHA 3SFGA 2ZC3A 4RBVA 3GZ7A 1WI8A 3BJYA 1QE1B 4P6QA 3I9V9 4A4JA 5KFKA 5KT7A 3J7YU 4IRCA 4DR4F 2G0JA 4I64A 3BSAA 3R97A 5ETTA 3R1HA 2JEJA 3EVOA 4DJBA 1FE4A 1ZM2A 1L5UA 2DGOA 4YHHF 4O3NA 1RWPB 4DQPA 3FFIA 3TZWA 4DV2F 3G4SS 2Z56B 1YX2A 5C7PA 4DUTA 5LMUF 2IVFB 1X5SA 1CBKA 2DHXA 3HFKA 3CVKA 4DDFA 4DV7J 2IPOB 2XLKA 3BPSP 1GH8A 1H2TZ 2DHGA 5KFNA 3GCXP 3CD7A 2APOA 5EDWA 1G4CA 2Q1LA 4DHVA 2WVDA 5F8HA 3A8JA 3I9ZA 1J5OB 3DU6A 2CQCA 2XLIA 3P45B 4ITSA 4USMA 4OX6A 1I3OB 3JS9A 2AEFA 3GJSB 4FKYA 2XTJP 4GMKA 1IUJA 5CYQA 4LSNB 2F8HA 4B3OB 4L75A 2HQFA 2RRNA 4X62J 2D3ZA 5A8RB 3QNWB 3JQMA 1WSVA 5H9FJ 4YS2A 1VK3A 4A8SA 2GJ2A 4RUBA 1YBAA 2QLBB 3CCSS 1EP4A 1X4GA 1X4BA 4DS5A 4OX9F 4OI2A 3M2VA 1E6VA 4Y0FA 1ZA2B 4TVAB 4P7VA 3PX6A 4UUXA 4UZCA 2VQEF 3D0HE 2L41A 4V19X 5KG0A 3JTNA 3QT5A 2KZMA 1IR2A 1SL0A 2YNHB 2WB1D 3DLKA 4P52A 2WONB 4ZVQB 2YWWA 3Q0AA 5JUMA 4DBQA 3JQKA 4NLVA 3MAQA 5LXYA 5E3QA 2HHVA 4DV0F 2QJ3A 1D9DA 1S6QB 1S97A 4NRTA 2MQOA 3M1VA 2MQ8A 1SC4B 5HQ8A 1RTIB 1F5CA 2W7AA 1DQ9A 1Z1ZA 3EE3A 4K59A 3ZZYA 2D69A 2NUHA 1GMWA 2UUTA 2GMHA 3IGVA 2FVRA 1CJVB 3GONA 1TFYA 4K8RA 1IBMF 4ED8A 2WOMB 4QYZJ 4URQU 3K5NA 4ANDA 2FQQB 4M63A 3D5MA 3S1TA 1Y7PA 2AD9A 3DMJB 4NXNF 4WFBQ 2O01C 1H73A 2ADCA 1J27A 1Q7LB 2ILYA 3HF5A 2BA9A 4C6AA 2E7XA 2RU3A 2BJ1A 1MROA 1BMQB 2MKKA 2Y3YA 1S10A 1OQ6A 3Q8UA 2VOOA 4UOHA 1O0PA 2LQBA 2CPJA 1C4AA 4Y2KA 1JLQB 3DLEA 2LQ8A 1FFSB 3LA0A 2WBRA 3KWMA 4DWIA 3GYXB 3NS5A 2OSRA 3KJFB 2LEAA 4LBPA 3OHAA 3KG0A 3KUHA 1BQNB 1TL3A 2RD5C 4FXWA 3MZIA 1R7IA 3QPIA 2WCXA 3RAMA 1MNEA 2NYHA 2GGPA 4NEYA 4RUHA 2CG4A 1VI7A 2OH2A 3D68A 4ZPAA 5LOQA 2YNIB 2X1FA 3V6JA 2Z0GA 4M5GA 4RNNA 5DM7Q 2MKHA 4CTAA 4NLYA 4KE5A 3CCQS 2FJAB 1AW0A 2RKIB 1UVKA 3MR3A 2I38A 2GAGC 3PW4A 1XR6A 1M1KT 2DVIA 3M6VA 3EGZA 2ZH5A 1RT1B 1W7WA 5HVFA 4DR7F 5D6GA 2RUSA 5GAGI 2F3JA 1XNRJ 3JSMB 3GIKA 2EWHA 1TKZB 4J9VA 3LPEA 2BZ2A 4NE9C 5FJ4A 4M8LA 1WF2A 4WE1B 5KOXA 5L1IA 1VQKS 1T9UA 3L9ZA 4O44B 5DQGA 5HATA 1FEEA 1H0HB 1S9GA 4DR3J 3NGTA 4GVBA 1HA1A 1T9XA 4IOBA 3IM9A 4UOCA 1CQNA 2HHSA 1RWVB 4PR6A 3B8HA 4JI4F 2OPRA 4MJKA 1NUEA 5F0UA 1BQMA 2KO1A 3UO0A 2W9AA 3TP2A 1YHQS 4RWXA 2EXUA 2LVWA 2JC0A 2G2OA 2MHNA 2MB0B 2OTJS 4N47A 1OY6A 3THTA 2DEJA 2HLTA 3MD1A 2DNGA 2KVQE 5EUHA 3EGWB 3TNVA 4Y2MA 1YLXA 1R0CB 1YJ7A 1ZBTA 4MKVA 2OSQA 2CJKA 1L3VA 3QQCD 2QFIA 3MR7A 3QBCA 3LWLA 2WB4A 3GSIA 2BM0A 2XY7A 1QVGR 5A8KA 2V4JA 3MM5A 4MH8A 3IRXB 2V6AA 4CI0B 4W92B 3I56S 5E5NA 3O1LA 2LCWA 3L7UA 3ZNUA 2DGUA 1WC0A 1EETB 1S1VA 2HYIB 4I1TA 2V8VA 2XCAA 1AT1B 3DLJA 1VC5A 4YB6A 2EFNA 1DHMA 3MEGA 3FSIA 1SL2A 2C3OA 4C0HA 2AV5A 3KJNB 2OKQA 3QGHA 3GSDA 1E6YA 2V2KA 1PAEX 2LXUA 1WEYA 1Y00A 3LUYA 3NY0A 4DPWA 1PSDA 1RAJA 3CF5Q 3OW2R 3CDBA 4JI6F 3TAMB 1P27B 2XS2A 3AFGA 2AYBA 4DUZJ 3FBEA 5HL7Q 4ID5B 1YIJS 1FKPA 3S8SA 1KLMB 3CMAS 2NYIA 4D3GA 2D41A 1JLEB 1FKOA 4LFBF 2OGUA 1EQ0A 1NK8A 5HMYA 5F8NA 1X5OA 1DTQA 4RWWA 2EEYA 2X1AA 2HS4A 2QSFA 1APSA 3PYDA 4NLTA 1X4AA 2N4DA 4ZPTR 3M8QB 3K5PA 3TQ1A 5KFTA 1D0EA 5T14A 3N4WA 5B0EA 2VQFF 2MLZA 2HFZA 5AXLA 2RU9A 3I5CA 2AX1A 4B3TJ 4DSFA 3NP5A 1G6BA 4OJHA 3IS9A 3R7SB 1A6LA 4IQXA 1YRUA 2HNZA 4ECZA 2XMTA 1HBOA 3KLEA 4F3MA 2KRRA 2CJYB 4FNIA 4ECVA 5F8JA 2M70A 2HK2A 3T1YJ 3U1LA 1HFEL 3CNQP 5C25A 4KR0B 3SXLA 1RAIB 2QA1A 1SJ4P 5HBMB 4FN5A 4GKJF 3ZTQA 2VG5B 4Q0BA 2XSJA 1XK8A 4IH7A 5ETLA 3M9MB 4U67Q 5GADU 1WKJA 1UFLA 1WC1A 2DH9A 2M88A 2Q79A 3TA2A 2EK1A 1JLAB 3J80U 3ENWA 3D1QA 4C0BA 1N6QA 2RS2A 4C98A 4A8KA 2AJ0A 3UDEA 1NK7A 1LWEA 4FNHA 1UZDA 4ZVSB 3H42A 1I5OB 4U95A 4JI0J 2OFGX 4ZLJA 4PWUA 2IDEA 4F2RA 5LSOA 4FZVA 2MQPA 1YG0A 4ICLA 2Y8YA 2O5DA 1FRHA 4U7UD 2BKNA 2B43A 3AOCA 3MFHA 1R0AB 3RB6A 2MKYA 1Q1KA 5DZ7A 4RR5A 2DHAA 1EARA 2DR5A 2HRYA 1HQEA 4LFCJ 2MPUA 1Y5IB 4ED3A 3ENAA 2Z4PA 2Q66A 3RG6A 5CZXA 2XI3A 1X4HA 1QAXA 4NCBA 3G6YA 3N6NA 2DYAA 3IFEA 3ET6A 3IR6B 4ZJOA 3FJ2A 2CAJA 1EKRA 2GZOA 2M52A 2KFZA 2D3UA 1NSPA 2XS5A 3MCNA 2YY3A 1P1LA 1KFDA 1V5VA 2PT0A 5HAOA 1JKHA 4BS2A 1X0PA 2HHPA 4EYHB 5E41A 1KKHA 1YJ9S 2CQ4A 4I7FA 4RUCA 5ADZA 5KFRA 3Q83A 1FA0A 2LXIA 2MKCA 2DRDA 4X66F 4MK8A 2L3MA 1X7VA 3UN3A 1YK9A 2H5EA 4JI3F 2Z2LA 5KT5A 2HNDA 1FNXH 2OLWA 1Q79A 2VODA 3GG1A 2A6OA 4OHXA 1WOPA 2AGOA 3NCQA 1S7IA 3MUMP 2CG8A 4ATNA 1QVFR 3KMQA 2C3UA 5DM6Q 4FBTA 3QWPA 3ZTOA 3N0VA 2B4OA 3FNNA 1U0HB 2G9OA 3C6UB 2DNZA 1HNZJ 3G6ES 1TUGB 3NG8A 2HGNA 1FFGB 2Z57B 1HHSA 2R8HA 4O3QA 2AJQA 3T5LA 2FY1A 4QWDA 1NBEB 1TVRA 2R7WA 4JV1A 4CO4A 4IR1A 2HIYA 1J5EF 3JAMY 2FGCA 4GRSA 4RNHA 2MLYA 5GAHI 3FFIB 3OTEA 4JI2F 2ZJPQ 4F25A 4X4VA 2O67A 2DGVA 4LQ9A 5FDLA 3R27A 3MCMA 2GJFA 4ED6A 4WJBA 3PM9A 4KC5A 2X3GA 1H7XA 2OAUA 3BBBA 5ETRA 1N8RT 2IA6A 3UQSA 3MEDA 3AOBA 3TJ9A 4DF4A 3CJ8A 1M5VC 4DN0A 1RBOB 4W90B 3C15A 2PMHA 4NWBA 1FNMA 2IM1A 2KJVA 1UMJA 5HJXA 3IBCB 4OZ2A 3CIMA 5FD1A 3UDLA 4ES2A 5CYQB 1U2CA 5BJRA 1M5SA 3V6HA 3C16A 3QZ7A 3GQCA 3R5GA 1V6HA 4HVZA 1N33F 2OPSA 2FPHX 4JI7F 1EP4B 2UUAJ 2DGXA 2IRYA 5KFXA 2VZ9A 3M2VB 4L72B 4QQBA 2IRXA 1OJ4A 4ENOA 1MWQA 1Q81T 1PJ7A 4WP8A 4DEZA 3PHEA 3CCLS 2LQ5A 2LP4A 4CNYA 2HKEA 1RP5A 2KXHA 1SKRA 4MIAA 4JP8A 1CC8A 4USKA 1N5TA 4AUKA 1R6VA 4F0HA 4ZVUB 3DXBA 5A8WA 3BKFA 3M6UA 3LGNA 3WX8A 1FESA 1VQLS 1YRXA 2XMJA 2RHSB 3OLAA 4LFAJ 4A8MP 4G1IA 4B9UA 1QY7A 3M1VB 3JTPA 4WKYA 5DGAA 1IBMJ 2R7TA 4DZDA 1BHNA 4V19J 4O4RA 3F56A 4J9RA 1D8ZA 2HHUA 3GFXA 3KDOA 2M8DB 4L3KA 5KT4A 1MMLA 5ETNA
chains in the Genus database with same CATH topology
3CC4S 1WACA 4AYBD 4OHWA 2MMYA 1SH3A 4RNFA 2FTRA 2E29A 2RQCA 3DOMA 3NMRA 2GJIA 1UKUA 1ZAXA 4LT6A 4DQIA 4ILLA 2RVJA 2JEIA 3HHLC 2GA7A 3VF0B 2MJNA 2U1AA 1Q82T 2KKHA 4U9RA 3PX4A 1RTJB 4NCAA 4B08A 4WFXA 4Y00A 3V4MA 1NHVA 2XC9A 4EEYA 2J5AA 2C28A 3N28A 3M8SA 3NCRA 4KGMA 2A2CA 3TUIC 2I0XA 4DL0C 4U6PA 2X1GA 3QLHB 4FVCA 4IFVB 2VBXA 4YP3A 1RYSA 2GHWA 2LA6A 4ZPCA 4ED7A 3L3CA 1LXNA 5E3AA 1MROB 4F4WA 1U47A 3MOJB 2BYCA 3PW2A 2YNGB 2FHJD 1ZTWA 1JMTA 2ZZMA 4JV5F 2RJZA 4DSJA 3NL0A 4FPRA 2LA4A 4ED0A 3V4IB 4X4UA 1XMBA 4GO5X 2MZQA 1VQMS 1U6ZA 3NAIA 4DL6A 2ZJQQ 2ZOGA 1N32F 1S1WB 1LK5A 1R43A 3DLEB 1O51A 2VFUA 3K2YA 5G0RA 1HNXF 1T7PA 2DITA 2QMWA 3ZZUA 4F4KA 4WZMA 4LF5F 2K2PA 3MECB 4RW6B 3SZ2A 2MGZB 3G8QA 5LL6d 1N34F 1U24A 2J9CA 1K8AT 1WELA 2ZKTA 1ZPVA 1BWEA 4YFUA 2IM0A 3H2UB 4HDGA 1IR0A 1N5SA 2AWZA 2IYGA 5KG3A 5GAGU 4IH6A 4AL6A 1MWYA 2HVZA 2L9NA 1TL3B 4BC9A 1JJ2R 1VQ4S 3X1LB 4N56A 3POTB 4ED1A 5KFGA 1UVNA 3B4DA 3KNGA 3DI6B 4IKAA 4XDCA 4XPCA 2JX2A 4RW8A 3I82A 2CYYA 5D3GA 4Q2MA 3MTKA 2YQ3A 1IQZA 2R7OA 2GGPB 1K0TA 4E0DA 5AE1A 4C8OA 1Y9OA 2KYXA 2XULA 1RJJA 3JYTA 1KS2A 1UW4A 5EX0A 3N5FA 3DOKA 3HVTB 2VG6B 3OFEA 5A2QY 4L6V3 4DSEA 5CXTA 4DSIA 5DG8A 2EI5A 1S6PA 1G7CB 4F4ZA 2ZC4A 1R89A 4O3RA 3DOLB 3HZEA 3EYZA 2DNKA 3JTOA 4JI8F 4YMEA 2MKIA 3DXSX 4TKTA 5KFMA 3PKMA 5A6PA 3IRXA 3SYZA 3G71S 4G1QB 3TA0A 2JOQA 4CTAB 5DLFA 3J80Y 4TU9A 3PZPA 3MM8B 1UVMA 3QO9A 4LSLB 5A6WA 2MZSA 4J9PA 1F5AA 3CPWR 2KU7A 3TARA 1U49A 2V8GA 4QIGA 4DMZA 3BGLA 3CGIA 1FF2A 3NCPA 1H2UX 2PC6A 1VQSA 3LP0B 4HL9A 2AJFE 2HQ3A 2D1CA 2YKQA 1VOMA 3B4MA 2P5VA 1G1XA 2CJBA 4ETXA 3A1YG 2VKRA 3OR2B 3DLLQ 3GR0A 3DRRA 2UUAF 2R9LA 4MYTA 2RILA 3OVBA 3H20A 2W4CA 3NBPB 4DPOA 3ONQA 3M9OB 4IOAQ 2LEBA 3CB4A 1HPZB 3KLFB 2A2DA 4ZVEA 3GIJA 5DLGA 2R7SA 2FHKA 2DCLA 2B4VA 2CZ4A 2K7JA 1DRZA 2DR9A 2B9WA 3NNAA 4YB7A 1S77D 3H98A 1NK6A 3I96A 4QIEA 3MUVP 4J9SA 2XMUA 1TL5A 5E3PA 1I94F 3MOZA 3NAHA 5B7WA 4WF9Q 3AY0A 2CQ1A 3LWMA 3M2UA 4YB5A 3QJLA 2CPZA 2MKSA 4M5DB 1S9EA 3PW5A 2OPPB 3MM7B 2ZH9A 4DFPA 4X4SA 5JVHQ 1VFJA 3M8PB 2WSCC 5DDRC 3TAMA 4KAIA 3GB0A 5KFYA 2UXDF 4JYAF 5J2NA 5L1JA 1RGVA 2NLWA 4CQ1A 1XTZA 2EFPA 1SJ1A 2B5JB 4ID5A 2B4PA 5KFHA 4F67A 4WYWA 1KLMA 2G0CA 1HW8A 4RNOA 3U02A 1S48A 4TLQA 1VIOA 2LU2A 4KFBB 4J9MA 1JLEA 3IRWP 3KLGA 1TK5A 5AJ3F 1X5PA 2ZBCA 1HBNA 1S7HA 1T05A 3EXYA 5I3QA 5KFDA 2KZZA 3MMJA 4PQUB 4UY85 3T5KA 1C0TA 3CJ5A 3DHWC 5KFOA 2RQ4A 3UCZP 2DGSA 1JWWA 1FD8A 2QLWA 4HH0A 4OQJA 3HVRA 5C24A 3T6JA 2YWGA 1YTYA 4LFAF 1U6FA 1WHXA 1SKWA 3N9UC 2J7UA 2FHJA 3PFEA 3CEDA 1FRJA 4I67A 3SSQA 3Q8RB 4Y2IA 1AROP 1IQTA 2OPRB 2M9KA 3BGRB 3FEXB 5B0DA 1JLFA 3NWGA 1KHVA 4ZHRB 5F8GA 4CT9A 4YR0A 3CCZA 1HI1A 2V9WA 4IDKA 4R8UA 1BQMB 3DLGB 4QJVA 1N36F 2FJBB 2ZM6F 3KLVA 2BBEA 1IKVA 1HMVB 2PA3A 4NLWA 2GMLA 4O4GA 4URGA 2J7WA 2N7YA 5B08A 5BYRA 2KJWA 4LF7F 2J76E 3HHLB 4DSKA 3UD3P 1HBMB 2M4MA 2Y0SD 1TL1A 3TANA 3MGJA 4FF2A 3MD3A 4Y28C 4CH7A 2ZOMA 1RKJA 2E1CA 4I2QA 4FF4A 1JLCB 3O2IA 4CT8A 1S1XB 1FDAA 2XG8A 3KK2B 1QSSA 4I6YA 5BYQA 2MZJA 4BDPA 2Y1IA 3J7A1 3PKYA 1KVIA 5KAKA 3QYYA 4IFYA 3KK3B 3VAHA 4L3NA 1H98A 1B7FA 4TY8A 2CIMA 2VFSA 3D1OA 4DL3A 1HWLA 2J0QD 3PIPQ 2F7VA 1VQ6S 2NR0A 3DRXA 4HHJA 5D4PA 3O5TB 1SV5A 3EZUA 3SCJE 1U09A 4NLDA 1F9FA 2RNEA 1GTHA 3ICLA 5CYMA 1W2BR 1OPIA 3L7OA 2XWXA 4IQMA 4IOCQ 3THPA 3BDPA 2RF2A 3CCTA 3LOUA 4ECXA 1VQPS 4A8QA 4WFAQ 1VQ7S 1NRKA 1DLOA 2GQ2A 1RTHB 5F8LA 1S0VA 2CPIA 1S4FA 2YKAA 4P2SA 4WIIA 1X9WA 1XMQF 2AP6A 1DAXA 3W2WB 3WC2A 3OJSA 1JLBB 2ZNYA 2VB6A 1SJRA 5E3RA 4PUOA 3K59A 1PC4A 1F60B 1HW9A 5DO2A 3GIIA 3W2VB 1K0VA 5J1PA 5I3UA 2BABA 5MAOA 4C2MA 3FDSA 4X4PA 5HBMA 1FJCA 2UZAA 1LW2B 1DJ0A 4BWMA 4LQ3A 1IKWB 2QFJA 2VG5A 1L3KA 3WDOA 4ECSA 1DTTA 3N5BA 3V6DB 4KJIA 2HHXA 2HNYB 1RT2B 3HM9A 2KM8C 2O3DA 4Q43A 3UW1A 2FD2A 4K4WA 4OJ3A 4A8XA 2XLJA 2DK2A 2HZCA 3RTVA 5I4MA 2OJ3A 1MU2B 4F8RA 4LF6F 2OMOA 1U48A 2M7SA 3MMCA 4B9NA 3IWLA 4OIXA 2J7KA 1FDDA 1NKCA 1FJGF 1JLAA 3MXHP 3I87A 2K8GA 3TAPA 2VC0A 1XMOF 2YNHA 2CQGA 4H4OA 2IA0A 4NLUA 5A8KB 3IAM9 2V4JB 1MMDA 3MM5B 4YUDA 3L09A 3KMSA 2UV8G 2R4FA 3LO3A 1RKIA 3KJVA 1VJWA 3IBWA 1U1MA 1QSLA 3QGIA 4WFYA 4Y2AA 4IRDA 2MZRA 1GXTA 2HHWA 1U26A 2XEXA 4RW4A 1S1UB 4ZS6A 3VZIA 4HLBA 2FJXA 1S1VB 1TKXA 1SH0A 5AXKA 2E7WA 1CPZA 3I32A 2F9DA 1U1QA 1KNZA 1SJQA 1GXLA 4F4XA 3FRZA 4ECYA 2MZTA 2BANB 4EBEA 3LP2B 5IT4A 2ZD1A 1SKSA 2EG2A 2OIHA 2J0WA 4IYQA 4KBIA 3BN7A 5SZTA 4ZPWR 1UEUA 1T3OA 1UETA 4BWJA 1SIZA 2AQ4A 2CJ9A 1NJYA 1FXLA 2YKPA 4R5PB 1BD6A 5CZVA 4B9TA 1LW0B 1WEZA 2AGQA 3N6MA 1G3OA 2K1RA 2EG1A 3A8EA 3TOQA 5B09A 2IYIA 4WCEQ 4RU9A 4DQRA 2C3YA 3H5SA 1U1NA 1R0AA 3ETOA 2YKMA 4KSEB 4EUVA 4ZK7M 3TVYA 3FRYA 2E66A 1UJ5A 3ZZRA 4ES1A 2QRRA 3CIZA 1XBWA 3CSKA 3NNCA 3O44A 2P6SA 3K5LA 2DNQA 1C0UB 3FSXA 1HD1A 3CULA 1ZPWX 1M5KC 5K14B 3US5A 3V5RA 5GADI 5KG6A 3HK2A 4C9DA 3T9NA 1LFPA 1R6YA 5HMXA 2JZ5A 1MW7A 3I0SA 3I6PA 3OR1A 2KXFA 1JK9B 3K58A 3MEKA 3M30B 1A7GE 3LAMA 2VA3A 1FKPB 1X4CA 5F0WA 5EN1A 5KFJA 4ZCKA 5J2PB 2KT3A 4C7QA 1Q53A 4M1KA 1YRTA 3M2RB 1S0NA 4OLOA 3QGPA 2AYGA 5T41A 3EPGA 1K9MT 1GAOA 1FKOB 3MCSA 5KTQA 4CO2A 2KHCA 2AGPA 1B0TA 4EZ9A 2YWFA 1QAYA 4K4TA 4QWBA 1X4EA 3E01B 1B64A 3CWJA 2PSZA 1JJHA 2RB7A 1U1LA 5J1NA 7FDRA 3DM2A 2DT9A 4O3SA 3BZQA 1N56A 1C1BA 1DTQB 1OIAA 3L7PA 2X51A 1BC6A 5F9LA 2C2DA 2COLA 1RISA 5IS2A 3BQ0A 2N7CA 3HLUA 4MKBA 4DLGA 1NHUA 4C3LA 5KFLA 4HTJA 3KHRA 3DRSB 2LMIA 1NK9A 1KC8T 5F3TA 1FJ7A 1HNVA 2CVIA 2R2UA 2YKOA 2HMIB 2E9TA 1B0PA 4N8NA 7FD1A 1DFDA 5KFAA 1WI6A 3H5XA 1Q8IA 5DRKA 3GV7B 3V2UC 4CIOA 2EBEA 2BOPA 2IMWP 2GQCA 2YWHA 4MFBB 4NYPA 2J8AA 1PC5A 1KQKA 1N52B 2FGOA 1OPZA 3TW0A 1FNOA 3R5BA 4TQSA 2FJEB 2ROPA 1D8YA 2GV1A 4IG0A 1V9OA 2WSFC 3Q24A 4NOHA 4ELTA 4WKRA 4TXSA 2D7SA 2VASA 2PD1A 3K8WA 3KHGA 2J6SA 1OSCA 2ZDPA 2ILZA 3BSNA 4OHYA 1U45A 5D8HB 3T6BA 4UQGA 2O66A 4JI1F 2J9DE 5DETA 3BGUA 4YR3A 4EU0A 4KB7A 4NPOA 3UR0A 1I6JA 4ED5A 4H4MA 2Y1RI 4FF1A 1Q16B 4UQTA 1RT6B 3IS9B 3D0IE 5KFPA 5THWA 3TUJC 2E5HA 2FLLA 4OZ1A 2XY5A 4WXOA 5JVGQ 3FCHA 2W9BA 2QO3A 2DD8S 2B6AA 4AL7A 1Y4ZB 5L39A 4HDHA 2ABYA 5D78A 2HGLA 4PG8A 5CCLA 3CCWA 1HBOB 1T02A 3PEJA 2OMLA 3KLEB 1S9FA 4WZQA 3HDSA 5IQ6A 3TR5A 3FVYA 1UP1A 3Q8PB 2XB2D 3I5AA 1GX5A 1Z2LA 2CQ0A 4B3RF 3VQTA 2R7QA 1FTCA 3H4DA 1S72S 2U2FA 3MMAA 5C25B 4CO1A 2JL9A 3P3DA 2XMKA 4QR1A 5DG7A 4ZDNA 4MTPA 4OMFG 3Q8SB 2CQDA 3P5TL 3ISNC 3MDFA 1ZAVA 2JHEA 2LU1A 1VQOS 1HBUA 1TUVA 1RK8A 3U1MA 2FVQA 3O3LA 4CO0A 2JJ4D 4Q0BB 1VGYA 2DPJA 4KV8A 2FB0A 2FVSA 2KXNB 5C5JA 4HYKA 1BLUA 4PG6A 2CVEA 6FDRA 3DC2A 4O3PA 4E8UA 4ECTA 1JLGB 2KM8B 3IG1B 1VQNS 2YNFB 1V3SA 2UVUA 2KHDA 4K5RA 2F8MA 1HNIA 2A18A 5EX3A 1H2VZ 2NSBA 2DTJA 3C6UA 3D54A 1URNA 4C3KA 2OD4A 2KG1A 2BW2A 2ZNZA 3E8OA 1HWUA 2MQNA 4ECUA 2DH7A 3BSCA 2HFNA 4RW7A 1R8PA 1F0XA 2GCFA 5HP1A 2V5HG 3H4BA 1OSDA 2PE8A 3QO9B 1N6QB 4QCLA 5KFBA 3G6XA 4DL2A 3BGFA 1LOUA 1FDBA 5M2UA 3SFGA 2EPIA 1ULRA 5A0YA 2UP1A 3JSBA 1FK9A 2ZC3A 4NCGB 1FVSA 4RBVA 4AE5A 4M94A 2B56A 2G4BA 1RT5A 3GZ7A 1S6UA 1WI8A 2C3PA 3DDNA 1TKTA 1VK8A 2AX0A 3DRRB 4PRFA 1N0VC 3OHBA 4QU6A 3BJYA 1RT3A 3M32B 4N77A 1QE1B 2VD3A 4P6QA 3DLBA 2KVIA 2LYVA 3I9V9 4A4JA 5KFKA 3M8RA 1UVJA 4I6AA 4ICLB 5IM0A 3CDAA 5KT7A 3J7YU 3PXGa 5C42A 4Z37A 4IRCA 5E0OA 2MQQA 4DR4F 4I64A 4K4UA 2RS8A 3BSAA 3K7RA 3BO4A 2AU0A 4R25A 1KLNA 2VPWB 1IBKF 3R1HA 2JEJA 4DJBA 1FE4A 1S1TB 4XK8C 5L9XA 2IMOA 3IR5B 1ZM2A 1L5UA 3T9ZA 1KFSA 4B3MF 2QV6A 1WG1A 2DGOA 3HHEA 4OJ1A 3IXQA 2YH0A 4YHHF 4O3NA 2DO4A 3DGPA 2DNPA 3M4XA 4DQPA 2E9RX 3M2UB 4FS2A 3FFIA 4GO7X 2VC1A 4ZCLA 1UWBB 4DV2F 3GMGA 3G86A 3G4SS 2CQPA 2YWEA 4FXVA 5T7LA 4PG5A 2R8JA 4DSLA 2DHSA 5LMUF 3X3UA 1VRTA 4QWEA 1TFWA 1IN0A 2IVFB 1X5SA 3EXCX 5CYJA 2DHXA 1NK0A 3U27A