2QA4S

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qa4S00
3NMRA 2CQ0A 1FNXH 1JJ2R 2EK1A 2KVIA 3BEGB 3TP2A 2RRAA 2JRSA 4YB1P 4LJMA 5DDRC 2MMYA 4EGLA 2MHNA 3FEYB 5GMKa 3CCJS 2HGNA 4WFBQ 2D9PA 3MUTP 1FJCA 1H2VZ 4QU7A 2RVJA 2QFJA 2X1AA 1W2BR 2DNQA 1R8PA 2RRBA 1DZ5A 2RUGA 3MURP 2DGVA 5IM0B 1FHTA 2DH8A 2KRRA 1B7FA 3CCRS 2QEXS 2LECA 3Q2TC 1JMTA 2G4BA 1VQKS 3THPA 2DGXA 1VC0A 2FC8A 3BO4A 1WG5A 4PR6A 1N88A 2M0GB 2CJKA 1P27B 3VAMA 1YHQS 2MZQA 5DDOC 2YWKA 1QM9A 1CVJA 2BZ2A 3CCLS 3UWTA 4TLQA 1AUDA 2LKZA 1M1KT 2L08A 4C7QA 2MB0B 1OPIA 2CPYA 2DNOA 3S7RA 2UP1A 2KU7A 1VC5A 3FEXB 2F9DA 2K8GA 1Q86T 2LXIA 3S6EA 4Y00A 1G2EA 4TU7A 1WEXA 2MYFA 3VAKA 1WF0A 2KG1A 1VQ5S 1M5KC 2CQGA 3NS6A 4LIRA 1F9FA 2J76E 2X1FA 3US5A 3VF0B 2YH1A 2KXHA 1U1NA 2QA4S 1UAWA 1Q81T 3HHNB 2XSFA 2KG0A 4WCEQ 3U1MA 3CTRA 2DK2A 4WF9Q 3EGZA 2FHOB 4A8XA 2XB2D 2KI2A 2DISA 3D2WA 1X5TA 2KXNB 1X4HA 2RT3A 2JX2A 3MD3A 2MGZB 2MKIA 2BOPA 1VQNS 1FXLA 2DNYA 2CPXA 3CCES 1RK8A 1VBZA 1WG4A 1BY9A 3OW2R 4PRFA 3CCMS 4W92B 1A9NB 3BO3A 1SJ3P 5LXRA 1M5VC 4IO9Q 5GVQA 1KQSR 1K73T 4IOAQ 2XS7A 2DNKA 1NU4A 4OZ1A 1VQLS 4IUFA 1OWXA 2PE8A 5DDQC 2ADCA 2G0CA 2MQNA 1H2TZ 2DHXA 2CQHA 5HO4A 3IRWP 2DGTA 2KFYA 2M8HA 4U67Q 2VOOA 1SJQA 3P49B 3B4DA 1PO6A 2MZTA 2MKHA 1N54B 2GHPA 4F26A 4WFNQ 2FY1A 2OSQA 2LYVA 2MZ1A 1N52B 2CQ2A 2KT5A 3VAJA 3MUMP 3NS5A 4W90B 2DHGA 2CQ3A 2KXFA 2JVRA 2AYBA 3RW6A 2CQDA 5FJ4A 2MXYA 2CPEA 2RQCA 2A3JA 5IFMA 5LJ3Y 2DITA 1NO8A 4F25A 1XN9A 1K9MT 4J5OA 3ZZZA 2G1DA 3MUVP 2J0SD 2DO4A 2MKJA 2DHAA 2SXLA 3UCGA 4FXWA 5H1SV 1WF1A 2L41A 2MY8A 1N8RT 2DO0A 4P6QA 3SXLA 1X4EA 1Q82T 2CPJA 1X4GA 1DHMA 3CCSS 2MQMA 2JWNA 4CQ1A 2MGZA 2N7CA 2DNNA 5DETA 5HL7Q 1WI6A 2J0QD 4WIIA 2CPDA 2M88A 4WKRA 1YWXA 2MJNA 2MSSA 2MQPA 3VAIA 1U1RA 1UFWA 1U1OA 2VONA 2RU3A 3CXCR 2ZJPQ 1S72S 3P6YC 1R8HA 1WTBA 1VQMS 3J7YU 5GAEU 2NZ4A 3CCUS 1U1KA 5GAGU 1VQ9S 2I2YA 3TYTA 2ZJRQ 2CQCA 3LQVA 1M5OC 2F3JA 4Y0FA 4WFAQ 1UP1A 2FC9A 1QVGR 5CA5A 3G71S 1WEZA 4C0OC 1Q7YT 1NJIT 1WWHA 3I55S 3Q2SC 3DXBA 2AYMA 4FXVA 1YJNS 5JVHQ 1WELA 2X1BA 1U1LA 2WBRA 4C4WA 3MD1A 1X4DA 1KC8T 3PIOQ 1WHYA 2AYGA 2LCWA 5MLCV 1UW4A 3SDEB 2PEHA 4CH0S 3S8SA 1O0PA 2LA4A 3K0JA 1WHXA 1VQ7S 3MXHP 2MY7A 1KD1T 1VQ8S 4CH1A 2NLWA 5LJ5Y 2KN4A 3CUNA 1FT8A 2DIVA 3MOJB 2DB1A 3G96A 1P1TA 2LEBA 1HL6A 2MZSA 1WHWA 3NNHA 5IM0A 1X4BA 2DH9A 4UY8T 3CMAS 2KM8B 2N82B 1ZZNA 2DNRA 3EX7B 3P5TL 2DNGA 3SMZA 1VC6A 5IQQA 2E5IA 3NNAA 2MZJA 3CD6S 5CXTA 2K3KA 3UCUP 3B4MA 3CC4S 2YKAA 1K8AT 4YOEA 2XS2A 2DNZA 2KHCA 3VAFA 1VQPS 1VBXA 2RNEA 1X5PA 2N3LA 1YJWS 3G9CA 1YITS 2CPHA 2DH7A 4Z2XA 2M52A 2HYIB 4TU8A 1OIAA 3CCVS 2XNQA 3EGNA 5JVGQ 5BJRA 3UD3P 3UD4P 2OJ3A 5CYJA 2D3OR 2DNHA 1WI8A 1DRZA 3UE2A 1QVFR 3SDEA 2KH9A 2XNRA 4ED5A 3VAGA 4YUDA 1U1MA 4PKDB 1RKJA 4OZ0A 3CULA 4ERDA 2Q79A 4LMZA 2MPUA 3H2UB 2KYXA 5DM7Q 2U2FA 5LSOA 1D9AA 1VBYA 2DGUA 2CQ4A 4IOCQ 2E5JA 1U1PA 2MQOA 1WF2A 1FJ7A 2GO9A 2DNLA 2OSRA 1SJ4P 1VQOS 1WHVA 2M2BA 2CQPA 5ITHA 2KM8C 2M9KA 2DNMA 3P3DA 1SJFA 3VALA 1U6BA 1X4AA 3G8SA 4F02A 2ADBA 2DHSA 3HI9A 2HGLA 2LMIA 2HVZA 4UQTA 2MKSA 1VQ6S 2O3DA 2M4MA 2OTJS 3R1LA 1YTYA 1HD0A 2V94A 3NNCA 3CC2S 2CQIA 3UCZP 2RQ4A 2RS2A 2MQLA 1L3KA 2VOPA 2DGOA 1WEYA 2CPFA 5DDPC 5LXYA 5GADU 2E5GA 3VAHA 3CC7S 1X5SA 4QU6A 2F9JA 3MDFA 3G6ES 3U1LA 3IWNC 4BS2A 2X1GA 2XS5A 2DNPA 3ZZYA 2DGWA 2AYEA 1SJRA 1S79A 2HZCA 1JJ4A 1ZZFA 2LA6A 1YIJS 1VQ4S 2LEAA 1PGZA 1H6KX 2E44A 2CPIA 4QPTA 2EK6A 2M8DB 2LXUA 2L9WA 2LQ5A 5EN1A 1U6FA 2M7SA 1FJEB 5D77A 1JJHA 4ZKAA 1D8ZA 2N3OA 5LSLA 1X4FA 3H2VE 1A7GE 4TU9A 1SXLA 3BS9A 1FO1A 2YTCA 2OTLS 2JVOA 2ERRA 1DBDA 2CQ1A 2M70A 2CPZA 3S01A 3JB9k 4V19X 3G4SS 2HGMA 3L3CA 3I56S 2DGSA 1X4CA 3G8TA 3J7ZT 2MKKA 2EVZA 2E5HA 3N9UC 2MQQA 1H2UX 1KOHA 2AD9A 3MI7X 3RW7A 2I38A 3ULHA 1M5PC 2OIHA 1M90T 5DM6Q 2YH0A 2RS8A 2CQBA 1KOOA 3R27A 2J8AA 1WG1A 3TO8A 2DIUA 4RU2A 1X0FA 5GAHU 1IQTA 3CF5Q 2U1AA 2B0GA 1YJ9S 2MSTA 3DLLQ 1HD1A 3PIPQ 1YI2S 2FPHX 1ZH5A 1X5OA 2MJUA 4QQBA 2MKCA 4CIOA 2VODA 2MZRA 3CPWR 1U1QA 3THTA 2DGQA 3CMES 3CCQS 2D9OA 3BO2A 1URNA 1U2FA 1OO0B 2KRBA 2ZJQQ 1HA1A 4M5DB 5D78A 3R1HA 3V4MA 3LPYA
chains in the Genus database with same CATH superfamily
4DQPA 3PG9A 1U0HB 1EZZB 2XYPB 3BN7A 1F3FA 1C0TA 4O44A 4DWIA 2ROGA 4RW4A 2JRSA 4LJMA 4M5HA 1HNWF 2IAJB 1NEEA 1KTVA 3W66A 5IC6B 4WFBQ 3PJXA 3QRPA 3MR2A 1DZ5A 2RUGA 2C3YA 1I94F 1RWUA 5HMWA 3QAEA 1XNQF 1L3SA 4J7CA 1JNRB 2FC8A 1N88A 5ETSA 4AL7A 2GX8A 3W64A 3K57A 2HHHF 3M2VA 3M9NB 3NGRA 1RA6A 3D54A 4F67A 2MB0B 5KFTA 1S57A 2N7YA 2BE9B 1WF0A 1B0PA 3GFZA 1U0HA 3MM9B 4NLXA 3IFEA 2QL7B 1U1NA 4IQXA 4LR9A 2DTJA 4DCJB 2IAJA 4Q43A 4KPCA 4YQWA 2W9CB 4OHZA 1M5SA 3LANA 2KXNB 1ZM2A 1GNKA 2AGOA 5DZ7A 3HDSA 1PIEA 2CG8A 3H7HB 3CCZA 2G2YA 4N56A 5B0CA 4NRTA 2R42A 2IM2A 2K7JA 4KBIA 2KFYA 1N54B 1RLCL 3DMJB 1CBKA 4ZCMA 4W90B 1KHVA 3EZ5A 2DY9A 3LGNA 1L3VA 3NGKA 2A3JA 5IFMA 2J0SD 3TWZA 3ILIA 1REVB 1X4EA 4Q2MA 2W9CA 3EXCX 1DHMA 4P7TA 1HWLA 4NRUA 5A2QU 3G82B 2OPSB 4JOUA 1U1OA 2D74B 3VAIA 2VONA 1FRHA 5AT1B 2EFPA 3PXGa 2N4DA 4DX6A 1RYRA 4PG6A 1R8HA 3UDLA 2P8IA 2NZ4A 3M8QB 1VR6A 1EETA 4DUYJ 1U1KA 5I3PA 2Z0GA 4GKJF 5I4MA 3G71S 3FMBA 3QJPA 4ZN1A 1VQYA 1RZMA 2E5LJ 3FQKA 4DI6A 3KK3A 3GQCA 5B7WA 4ZVHA 1OY8A 1RAIB 3TANA 1UVMA 2KN4A 4RWXA 1REVA 2DIVA 4AQYJ 4DF8A 3G86A 1YBUA 1TUVA 3N79A 2GGPB 3G82A 1QDUB 3O2IA 3QFHA 4UOFA 3SCKE 5A8KA 2D3O1 3MTKA 3N6MA 3O3LA 1KLNA 3BB5A 2HNDB 4W4MA 2DNZA 4UW2A 4V1Ak 3VAFA 1KFSA 3IM8A 2FLLA 5AXKA 4KHPF 1TL4A 3ILLA 5D4PA 4RR5A 3G9CA 5KT4A 3AT1B 4UOGA 3KK2A 5DGAA 5IS2A 2R8IA 1PILA 5KFZA 2AJFE 1VJQA 4M5LA 1FFWB 1IKVB 3AQOA 1Z2ZA 2E7XA 1HYSB 2IA6A 2A18A 1RHUB 2GGPA 2FHKA 2DHSA 1H0HB 2XY5A 5T14A 3J80Y 1RCXB 2C3PA 2C2MB 4RW6B 5M2UA 3MEEB 4IFVB 3QPIA 2ZH6A 4NLSA 4DX7A 2WK4A 4R25A 1HARA 4P9SA 2XS5A 1Q1KA 1I51B 4EZ9A 1T03B 1LOUA 2EFNA 5H9EJ 5B0BA 5KFXA 4A8FA 4I67A 1TV6B 1OS5A 5A8WB 4X4PA 5D77A 1JJHA 4NLOA 1V5IB 1X4FA 3FEZA 4DSJA 2V8HA 3IP0A 3RRKA 1IQZA 3S01A 3OLBA 3OVAA 3SQGA 1KOHA 1Q0NA 4L3KA 3X1LB 2AV5A 2BQRA 4RW6A 3AD7C 5EWEA 3MEEA 4KGVB 4IFVA 3RW7A 3EZOA 4F4YA 3GZ7A 3BF4A 1CPZA 1IQTA 1X0FA 1WC3A 2Y1LB 4Y6IA 4DR1F 5CCMA 5HAOA 1M1GA 5KFGA 2Y8YA 4PAAA 1T03A 4IYQA 2BJDA 3M9OB 2HURA 2Z2MA 1NPPA 4FBTA 1S10A 1XMQJ 4DL7A 2Y1IA 4PXBA 3OQ2A 4PWDB 1H38A 3CW2C 1HW8A 3Q8RB 1U4BA 5I42B 3DRRB 4USVA 3ELHA 1S9FA 3AA8A 2HFSA 1T7PA 3KDNA 1VS3A 3PYGA 2OI2A 3FQLA 3VQTA 4IH5A 3HD1A 2CJKA 1P27B 1VMBA 1QJHA 3L7PA 4W98A 4JI2F 3EGWB 1M1KT 3AB4B 4ENOA 2WVEA 3MCOA 5BYRA 4X4TA 2HVIA 4QIEA 1IBMJ 1AT1B 3OTOF 3DRSB 1D09B 4KQZA 2KG1A 3HD2A 4RW8A 2G13A 2Z56B 2NPFA 2ZFHA 1TUWA 1WDTA 4X62J 5G0RB 2KG0A 1I6JA 4Y2CA 4WF9Q 2HRUA 2IVMA 4RO0A 2P9EA 4IFYB 3OFHA 2HW3A 2G0IA 4OI3A 1U49A 4DL4A 3P96A 4W92B 2VBZA 1K73T 1HMVA 2XS7A 2RF2A 5E3QA 4PXCA 4O3RA 2D3ZA 1EX8A 3I0RA 5GMEA 1WORA 2G0CA 2MQNA 2DHXA 5HMYA 3MR7A 4CNZA 3B4DA 1V3SA 3VGUA 3QGIA 3DRSA 5HBMA 4LT6A 4LF6F 4TYAA 1SKWA 3CJ0A 5JUMA 3NKYA 2A2CA 3E3XA 3SCJE 3RW6A 5IT9Y 3J81j 5G0RA 4EI2A 2V6AA 1WOOA 3U7JA 5CZXA 1RHRB 2XGPA 2HHWA 3A3PB 4IFYA 2KDOA 1MLAA 4QBUA 3CCSS 2V68A 1YWXA 3CXCR 3FBFA 3POTB 2JLEA 1KVKA 3LP1A 3HZEA 1HR0F 5KFEA 4Q0BB 2ZDPA 1BLUA 4WTYA 4ES3A 2FJVA 3EGVA 3E51A 5HATA 4XDCA 2PEHA 3HT3A 3QSYB 4Z7YA 3F44A 3MXHP 1VQ8S 3A1YG 2YWWA 5AXLA 2NYIA 4USMA 2BW2A 1L3UA 1NH8A 2V34A 2GVDB 1UWAA 1OPZA 2I0XA 3JTPA 5EUHA 5A8RB 3HM9A 4B9LA 4BCAA 1N34J 1F0XA 2BW7A 1KQFB 2XSJA 3POTA 1JLBB 3CD6S 4DV5F 3QGGA 1K1SA 3G87A 4ECYA 3NAHA 4JBCA 4Q0BA 4LBHA 1R89A 2H5EA 4AFFA 9ATCB 3QSIA 3MPUB 1TFWA 3KMQA 5CYJA 1WI8A 4Y28C 1C1CB 4DR6J 1E6VB 2EFQA 2CVEA 2COLA 1U1MA 1FRLA 5DM7Q 2U2FA 3H0PA 4XAKA 1D9AA 4QIFA 4RNMA 1VBYA 1YK9A 1VJWA 2XCAA 3RB6A 2XMUA 2P6TA 3CO9A 2YX4A 1N48A 5A8RA 4C8LA 4OJ1A 3J7YI 2LMIA 2VASA 3BQ0A 1HNWJ 4NLPA 3OT9A 1IN0A 5ETTA 1OYDA 2OPRA 3UCZP 2J6TA 4C98A 2FD2A 2VD3A 1I94J 4DV2F 1XNQJ 3IWNC 2OEJA 1RU1A 2OUGA 3PDNA 4ECUA 5CCLA 1RWOB 3ZZOA 1E6VA 2HHHJ 4PCQA 2CNNB 1IM4A 2V9WA 2LXUA 3SYZA 1B3TA 1TZ0A 3FCVA 4J9MA 3WBZA 2HHSA 2JVOA 1W26A 1N32J 1Q16B 2V2ZA 3N9UC 2E5HA 1LWCA 2C42A 4H4MB 2AD9A 4I56A 1UKUA 3R7BB 4E98A 1WDDA 3A8KA 2BE2B 5KOXA 2VDHA 2IJFA 1YI2S 1NJZA 1ZH5A 1T8EA 2ZOMA 2MKCA 1S6QB 1Q7LB 2VG6B 4ZOSA 1Y10A 2ZDOA 1LEOA 3QLHB 3DHXA 3IWXA 1HA1A 3GR1A 3RR8A 2FJBB 2RVJA 2QFJA 5D0EA 2ILZA 2B5JA 4I4BA 2EK1A 1TK5A 4B9NA 3J7Z5 2MEWA 3PKMA 2B56A 1H2VZ 4QU7A 4FS2A 4H4MA 4PWWA 3MGJA 1N5SA 4ZS6A 4L75A 4P10A 2XMMA 5ETQA 2ZE2B 1Y4ZB 3T1YF 4X65J 2ZVSA 1AUDA 1SJ1A 4ZITA 5I3QA 4P7VA 1HW9A 3I4HX 2KU7A 4WJBA 3GWCA 1VC5A 2VG6A 4OZ2A 4KH1B 2K8GA 4CM2A 1OY9A 3QLHA 2YQ0A 1KVIA 3V6DA 3M8PA 2ATLA 5F8LA 2XY7A 2V67A 3OUYA 1RDRA 3KOAA 1FKPB 2KI2A 5BR8J 1SC3B 3TAQA 3ICLA 4DL6A 3GFHA 1BY9A 2F8EX 2LQ9A 3E01B 4LFBF 3OD2A 3M8RA 4C8OA 4IOAQ 3QT7A 3MMBB 4FF4A 3NY0A 1U25A 5K20B 4B9SA 4TQRA 1T9YA 2ADCA 1H72C 3N0VA 3IRWP 4LSNB 5B0FA 1KDNA 4U67Q 3FVYA 1S77D 2R7TA 3JSMA 4DR2F 3PW5A 5THWA 3CJQA 4DS4A 2W8LA 3M8YA 2QT7A 3R3TA 5F0UA 4ZVQB 3HKWA 1X4GA 1VRQC 2GIQA 4OYWA 2B9EA 3QNWB 4UZCA 4F3OA 4DFPA 2CKWA 3MF5A 4YMEA 2OPQB 4G65A 3E01A 3PM9A 2LQ8A 1VLYA 2YKOA 1TMMA 4LF4J 2ZJRQ 2HMIA 3MMBA 3HHDA 4WP8A 2Z2LA 4ECVA 1OSCA 4RBUA 4LSNA 1UTAA 5CD4H 1WWHA 1HFEL 2MLYA 3OVSA 2DBBA 1BWEA 3SDEB 1TK8A 2Z8QA 1MG7A 4CH1A 2NLWA 2FLNA 1HQ2A 2V4JA 1RHMB 1P1TA 1VCTA 2BUNA 2MZSA 4WFXA 2W2MP 2DR9A 1X4BA 3HFVA 2UVWA 1S97A 3OJUA 3ZZRA 1FX4A 2OPQA 4I69A 4X66J 1FRJA 7AT1B 2R4FA 4KGZB 3HVAA 4QPXA 3PEHA 3CC4S 1N33F 1UEUA 2VPYB 4ES2A 2AP6A 4R5PB 1HWUA 5BXIA 2RNEA 2CPHA 1WC1A 2HVHA 4KYZA 4IO1A 1J5OB 4TYBA 1FERA 4DR1J 3PACA 3SDEA 2NS1B 4DV7F 4N7TA 2Q79A 1HHQA 2MPUA 2GJFA 4IOCQ 4BWMA 2HK3A 4IG0B 3G6XA 3O5TB 1S0OA 5EWGA 4AL6A 2KM8C 2DNMA 5H9FK 3W65A 2VIHA 4F04B 2BE7D 5GADI 3T41A 4R5PA 5GADU 2V0NA 5L1KA 5G4DA 2HHTA 4E2FB 3MECB 2H3EB 3ZXWA 2AYEA 1NRKA 5CH7B 1RA7A 1WKJA 1I3OB 1HI0P 2LA6A 1VQ4S 4CO5A 5HQLA 3EUNA 3KNGA 1ITPA 2IRYA 1R0AB 4ZIVA 3P45B 2JEIA 1B0VA 4IG0A 1A7GE 3MAAB 2RUSA 3GCWP 4TN2A 4Q5VA 4GC7A 1FI4A 2B7CB 1S99A 2MKKA 5HVGA 2Y1JA 1S49A 3MI7X 2B3TB 4WZQA 4JI6J 3SV3A 2J8AA 1VIXA 2HSEB 4PUOA 4P72A 2B4VA 2ZH2A 2Z58B 2YNHB 4J9KA 1X5OA 2HNYB 3FK4A 2NXEA 1W2IA 3DDIA 4ED3A 2LQBA 2YQ3A 1SQFA 4ECWA 1TKXA 1S6PB 4DCOB 3H98A 3NWGA 5DQGA 3LPYA 2QMXA 2CQ0A 2GJ2A 5HK4A 1NHVA 1K0VA 5D4NA 3MWBA 2GCFA 4HDGA 4F4AA 4LF6J 3HT0A 2RRAA 3MAAA 4WKYA 3CCJS 4HT5A 5DG8A 2HGNA 4Y2AA 3MUTP 4ZIWA 2XZDB 3OFFA 4JP8A 3KYLA 3OTDA 2R7UA 2DGVA 3MEDA 4DN0A 3BBFA 1B7FA 3R7NB 2LECA 3MR3A 1N4LA 1VQKS 3KKFA 3SFGA 4DPWA 3NCQA 4MKYA 2DEIA 4CDIA 4I2PB 1LW0B 4YY3F 2JL9A 2YNHA 1JLFB 1SUQB 2UZAA 4EWTA 1U24A 4NOHA 1HR0J 1S6PA 4K4ZA 3HXMA 4C8ZA 5J2NA 4EO6A 4LF8F 2DYAA 2A10A 3GP9A 4K4TA 2DEJA 1N5YB 1CG2A 3EGZA 1R8AA 1Y0HA 3UI3A 3WC0A 2V8PA 1Y5LB 2XGQA 4EYHB 1NHUA 3SSRA 1I1GA 1BQXA 3HK2A 4ZPCA 1JLFA 5A6PA 4NLGA 3KLVA 4DV5J 1SUQA 3CDUA 2MKHA 1SC6A 2Q6BA 4A8KA 4ZDNA 2UU9J 2XCPA 2DHGA 1EKRA 4N47A 5M2PA 1SBRA 4CP5A 2HS3A 4CTAA 4USKA 3GLJA 3QT8A 1K9MT 1BGXT 1N5YA 5H1SV 2MY8A 1RTIB 3SXLA 2QC3A 3I87A 3DLKB 3IR7B 3MCNA 1WI6A 4F36A 3NAIA 4WKRA 2IJNA 4RNOA 3V2UC 5GAEI 4U96A 3Q22A 4LRAA 5GAEU 2XM3A 2FJDB 1VQ9S 3TYTA 1PYTA 2BABA 2E7WA 1OSDA 4C3KA 2FJEB 4K4YA 4Q2LA 4Y34A 1UWBB 1F2GA 4EUVA 1EAYC 2KFZA 4QJVA 3BR9A 4DV2J 5MLCV 4ES1A 1HHTP 2F4VF 2NYHA 5JMNA 4TKTA 2VQEF 2BM0A 4RUAA 5LJ5Y 1RTIA 1UEKA 1SQGA 3PRBA 4PYAA 3GSIA 1M5HA 2XLIA 2HS4A 4NCGA 3R5DA 1M0SA 2I5JB 2ZH4A 1KTQA 3ZO7A 2GMJA 4I2QB 3TNVA 1VHIA 3CJRA 5C2CA 4A46A 3B4MA 2IJRA 3FBBA 4YOEA 5F8MA 2XS2A 1Y9OA 3LF0A 3I9V9 4ZLJA 3EYZA 1VBXA 1NK8A 3FJ2A 4LF1A 2I8EA 3UVJB 1HWKA 3JQKA 1UWBA 3HVWA 5BJRA 1MNEA 1TL7B 1FTRA 4JI1F 4CRJA 2KL8A 4A8SA 2JJ4D 4ANCA 4F0HA 5M2RA 2KYXA 1FRMA 2RHSB 2VA3A 2VBYA 2H51B 2Q66A 2A6MA 1SJ4P 3AAWB 2A1BA 2J6UA 1F60B 3FSXA 3FSYA 4IG3A 2HK2A 6AT1B 4M5IA 2I5JA 4FZVA 2VG5A 3IBFB 2O3DA 1NSPA 4PEOA 4I2QA 4LRBA 1YTYA 4NEZA 4NLYA 2V94A 1S0VA 4O3SA 3P4UB 1XTZA 2RQ4A 2MQLA 2VOPA 3LW5C 2CPFA 1S1WB 3DU5A 1S7HA 3GG1A 3UVJA 3U1LA 2CWKA 2UUWA 5CAAA 1TL7A 4O3OA 4KO0A 5F8IA 2E1PA 1NJXA 1PJ6A 1NAQA 2UV8G 3T1YJ 3PR5B 1PGZA 1S12A 2ZEJA 4ZVTB 3CDEA 1NKBA 1DY3A 3PRDA 1JXLA 3H2VE 2XY6A 4TU9A 2PA3A 3GIMA 5KFWA 1T05A 3JQJA 2CNOB 1PYSB 3MAHA 1S1TB 3T5KA 1X4CA 3J7ZT 4HDHA 4O4RA 4N8OA 8ATCB 2MLZA 3RRHA 3R7SB 3M9MB 3L09A 5DM6Q 2YH0A 3R27A 2RQKA 2J6SA 5CABA 1S1WA 3H4BA 3A12A 4J9VA 2UUTA 4JV0A 1CC8A 2VJVA 4RWWA 4RJVA 1U1QA 2HS0A 1URNA 3C16A 4QIGA 3SZ2A 2ZJQQ 2DCUB 3DOMB 3R1HA 2V4RA 5KFLA 3QIPB 4DR2J 1T9UA 1RUSA 4Y65A 2WVFA 2VG7B 5D0GA 2XLKA 2BBEA 3OTBA 4HHHA 3EWGA 4WYWA 1ZM3A 1C1BB 1MROB 3KLGB 1F2HA 4NYPA 1WOPA 1R6VA 2AQ4A 5DDOC 4U7UK 5ETPA 1TL5A 1CVJA 1GXLA 2W2QP 1RJJA 2DPIA 2BKOA 2YPZA 3CD5A 1MSWD 2YNIB 4LIRA 3KUHA 1TKDA 2XWXA 2X1FA 3QIPA 2YH1A 2RJZA 1UAWA 2HFNA 3OR1B 2FVQA 3BYRA 1SV5A 2AX0A 2VG7A 1F5AA 3OBIA 1DLOB 2VC1A 4YB7A 2JX2A 2ZH3A 4NLRA 1FXLA 2ASLA 1C1BA 1MROA 1WG4A 2AMCB 2P9CA 2IM1A 2OFGX 2I1RA 4ETZA 4WFZA 3PZPA 1GEHA 4OZ1A 4HL9A 1DFDA 1OWXA 2PE8A 2C2KB 5DDQC 1KQKA 1FEEA 3AFGA 1ZAWA 2CQHA 2J5AA 2IC3B 3EVMA 1REGX 2CZ9A 2OSQA 4KE5A 2VJUA 3BGFA 2LU1A 3DLHA 3SBMA 2AU0A 4QW9A 4KHRA 2OP5A 4FBUA 5E5NA 4QIVA 3K5OA 2DRDA 3OR1A 2G1DA 3DLGA 2DO0A 1RT7B 1DLOA 2C22A 1Q82T 1YRXA 4ZPAA 1N6QB 5HL7Q 1B70B 4L3NA 3FZBA 4JI3F 4WU2A 3EM1A 2RU3A 1D9FA 2H48B 1RHJB 4TY8B 5EHHA 3HSJA 3QYYA 1U45A 1AB8A 3KLEB 3BYPA 1M5OC 2R2RA 2FC9A 1S0MA 4O3PA 3QGPA 2IC3A 3KG1A 1RISA 2FYXA 1X9MA 1UL3A 2VF3A 4HEA9 3W9HA 2WTFA 3VV2B 5K8OA 2IM3A 3KLFA 3O6QA 1ICEB 3HVRA 4DJBA 1YRTA 2CJ9A 1C0UB 3IM9A 4K7QA 5KFMA 2UVUA 4DS5A 5AXMA 4ZPDA 1RT7A 4NA3A 3MOJB 1C2PA 3D28A 4J9RA 3MPYA 3T19A 2R7QA 1F9EB 1N6QA 5IM0A 5KFAA 3EVWA 2W01A 2AEMA 4KGKA 1JB0C 3RB3A 2VC0A 1S1UA 4TY8A 3PX6A 1SVDA 5E3RA 3KLEA 1IWGA 4G6VB 4WIQA 2YXLA 2VB6A 3EGNA 5KG1A 3EE3A 2GFFA 4IR9A 3K8WA 2HNZB 2KH9A 2QA2A 2OD6A 3BSNA 2XULA 4ECTA 3VAGA 4LMZA 2PA8D 4YDXA 4OHXA 2DGUA 3FGVA 1KVJA 4URGA 4WTOB 2M2BA 3KJQB 4MYTA 3IR6B 3PFEA 3TAPA 1U6BA 2EC2A 1PBUA 2Q1LA 3DLEB 3MM7B 3MMAB 1SKSA 2F9JA 3MDFA 4U8VA 2XG8A 4P73A 4KGXB 2KO1A 2RHQB 2B4OA 2HNZA 2VFVA 4YY3J 2ZZNA 2GW8A 1LNQA 1J5EJ 4F4XA 3C8YA 1U6FA 2GAGC 3PX0A 3MM8A 1SL1A 3SI8A 4U9RA 4LF8J 1C4AA 4A8OA 1WC0A 5ETMA 3J80U 4I6YA 2ASJA 3F41A 4FNIA 4URQU 2FVCA 2AZ3A 3ULHA 4P2SA 2A6OA 1X7VA 4ZP7A 3DOLA 4JV5F 1FX2A 3MM7A 3DM2A 2BOAA 2PT0A 4A8YA 1S1VB 1MMLA 4CLPA 1XMOF 3CWJA 5C42B 1TK0A 4DL3A 1UVIA 3BO2A 4LR7A 1YX2A 4DU7A 1T02A 4DL2A 3NMRA 2B6AB 2D41A 3BEGB 2J0XA 4ELTA 4MK8A 2ZKTA 3GV7B 1FVQA 4F0MA 5KFPA 3JAMY 2E9RX 1JMTA 3PCOB 4LSZB 2CYYA 2YPYA 2IBKA 3AODA 3WIUA 3AB2B 1S1VA 2KFNA 1N36F 3L9ZA 3ZTOA 5C42A 2W9AA 5ETLA 3AXMA 4ED8A 3J7A1 1VRTB 3FEXB 3K5MA 4GVBB 2V2QA 5L46A 3N6LA 2R7RA 3US5A 3D1HA 4CLKA 3OJSA 3VVTA 1RSCA 5D4OA 3HHNB 2H9ZA 4ICLB 2F4VJ 1BMQB 1PC4A 1IKXA 1VQNS 1NSKL 5DQHA 1JQGA 1VK3A 2BVZA 3OW2R 2ILYA 3KFWX 2UXBJ 4RUCA 3EDRB 3BO3A 3RG6A 4UUXA 5GVQA 5AJ3J 3BH6B 4MT1A 2Y3YA 2QE5A 3GYGA 1EARA 2MTLA 4U7UD 3DLBA 1VRTA 3E2EA 1OQ3A 4HLBA 4WFNQ 1RTHB 1SKRA 4DSLA 1SC4B 1WC6A 4DPUA 4B3MF 1YVFA 1LFPA 2CPEA 4FF3A 1XR5A 2F65A 1DTTB 1NK0A 4WPAA 5JXSA 2SXLA 4ICLA 3HO1A 3PKYA 4B3OA 4CQ1A 2N7CA 2J0QD 2CPDA 4DUYF 3CVKA 2V4QA 1WTBA 5K8PA 5L1JA 1FDDA 1Q8KA 2I2YA 3DDKA 1FTCA 2ZBQA 3CE8A 4DHVA 1Q7YT 4LBPA 4OI2A 1DQ8A 1NJYA 2AYMA 5JVHQ 2F63A 3QO9B 1X4DA 1RTHA 4DV4F 1HIYA 3I0SA 3M8ZA 1NNDA 3S8SA 4OYXA 1DTTA 1VQ7S 4RNNA 1LQ9A 5KG7A 4J91A 3BGUA 1QLNA 2DB1A 3GB0A 2LEBA 1RT3A 2ZH7A 3I6PA 1Y7PA 4X64J 5KFRA 4I6WA 3SCLE 2LLZA 3CJSA 3T3FA 4GKKF 1WOSA 1TFYA 3BSCA 1B7YB 1VQPS 5KFBA 1YITS 1VISA 1L3TA 2DH7A 5J2PB 1TAUA 4BHQA 3GG0A 4LRCA 2Y9HA 2XNRA 4DR7J 3LH2S 1SH3A 1JK9B 1NB2A 1G4CA 4OZ0A 3CULA 1P9YA 2HIYA 1T3NA 2GO9A 3K7RA 2CQPA 1AA1B 2F1FA 3ZNUA 2ZITA 1RT1A 3G8SA 3HJVA 1QE1B 2A0FB 1K1QA 2M4MA 1Q5YA 4OYIA 4B08A 4PPZA 1DARA 4CT9A 2OHDA 3FCHA 5J2PA 1X9SA 2UXCF 4F7VA 3ZZYA 4BC7A 1S79A 3QRQA 1JJ4A 1XBWA 3TEHB 4RL1A 4NL5A 4RW7B 3IMQJ 2FJWA 1CQNA 3OR2B 4LR8A 2M7SA 3KG0A 2N3OA 1NDKA 2WVBA 3K59A 1FO1A 3NL0A 2V2VA 3M2UB 2ZBRA 4RU9A 2X3GA 5HMZA 4FXDA 1QE1A 1RAFB 2CZVC 2HGMA 4MKBA 3I56S 1H2UX 4GRSA 4B17A 3HHEA 4PQUB 3PVXA 3QQCD 3KNAA 1BQNA 3T5HA 1PYOB 3BDPA 4ZLLA 2HLTA 3TO8A 3BSAA 5HLFB 1SH0A 3KUEA 4C3MA 4Z37A 1SC1B 3ZTPA 3THTA 4TQSA 1TKTB 4QR2A 2IMWP 4I7FA 4L74A 5BYSA 3X3UA 4RW7A 3KJFB 4PWUA 4LQ3A 2J0WA 3TZWA 4J9OA 2MMYA 2BEFA 2AT1B 3GILA 3HFKA 1RE1B 3M2UA 3M30B 2DXFA 2GAHC 3DXSX 1RT6A 4S0MA 4X4VA 1RB0A 3MURP 1MWYA 1E6YB 5HSPA 2W24A 2DGXA 2FVPA 3RUBL 2J9DA 3VGVA 3VAMA 2MZQA 4AUKA 4JI3J 5HLFA 2RAQA 4DCPB 1CQMA 1JLCB 3EJMA 1FJGJ 3Q86A 2DNOA 5K14B 3OV7A 1TKTA 2JZ5A 1AZSB 1QAYA 3TUIC 5IC4B 4ZMMA 2JC0A 5JJBA 2DR5A 3DI6B 1F9FA 4DU8A 1CJUA 2XSFA 5KTQA 3M6UA 2RDIA 1H7WA 2NXCA 1SB6A 3TRGA 2JFKA 4LF2A 2E1MC 4EFAC 1X5TA 1HBOA 4FF1A 2CPXA 3LP2A 3C2PA 1E6YA 5K8MA 4B9MA 3R2CJ 4J9PA 5LXRA 1BHNA 2QSFA 3RAMA 2GQQA 4ANDA 1NK6A 1T3OA 2GZOA 1JLCA 2E1AA 1HHSA 2VOOA 1IWAA 5K14A 1OQ6A 3RBEA 1DURA 3BKTA 2KT5A 3DI6A 3MUMP 2UUBF 3HHLB 4KKOB 4KB7A 4DPOA 3GYXB 3MCMA 1XC9A 4FPIA 3N4WA 3ISZA 3RJMB 2GMHA 2QX0A 4C8YA 2WSCC 4MJKA 3LPEA 5CYQB 3M2RB 4MFBB 3G6YA 1RTZA 1ZAVA 1GTEA 1QY7A 1RWXB 5E3AA 3KHLA 5KFNA 4CYUB 3NGSA 1N5VA 2QGFB 1UP1A 3ISNC 4N41A 1HBMA 1ACMB 1YZ7A 1YJNS 1YLXA 2HHQA 4KR0B 4DFMA 2P2CB 2XI3A 3HHLA 3S1TA 2HLUA 1O0PA 3GV8B 1ZYQA 4ANEA 5HP1B 2XYHB 3G6VA 5KFYA 1NZ8A 2O66A 4O44B 4OJGA 2ASYA 3M8SA 3TUJC 2QV6A 3NG8A 3DHWC 4OZNA 4MFBA 2XO7A 1ZZNA 1DTQB 3LO3A 4O3NA 4C6AA 2HVEA 2E5IA 2MZJA 4BWJA 4MIWA 4CYUA 1X0PA 2VPZB 4NASA 4IRCA 3ZFVA 4Z2XA 4DR6F 3C15B 3DDNA 4JV5J 2BANB 1APSA 5D0HA 3TZZA 3EPGA 3DN9A 1XMOJ 2NUHA 1ZOTA 1PSDA 5HP1A 2PC6A 5K9FA 2R8GA 1WF2A 4D3GA 1IVZA 3PHEA 3KJNB 2JFDA 1RU2A 5DLGA 2DY1A 3TJAA 1DTQA 1H98A 4OV1A 2OTJS 2J8SA 2XWYA 1UVNA 2YKNB 4DLGA 2DGOA 4QYZJ 4DXLA 3VAHA 3IBWA 3IR5B 3C15A 2X1GA 2EG1A 2BANA 4NE9C 2B4UA 1N36J 3AY0A 2QA4G 4NYOA 4FN5A 4QPTA 2M8DB 1WNEA 4JUZA 1FJEB 1N32F 4LFAF 2YTCA 2XYGB 1OYEA 1LWEB 2CQ1A 1AYEA 3OFEA 3OL9A 1JLGA 2DHHA 2WSEC 4YR0A 1X60A 3QWUA 2YKNA 2CQBA 2IPOB 1PCAA 1XEZA 4P2MA 2DIUA 4DUZJ 2KKHA 4NXNF 3GIIA 1EETB 2DR7A 3PIPQ 2MDAA 2XC9A 2QJ3A 4U7CA 4CM0A 2BRLA 4CCHA 3RR7A 4OV6A 4IH7A 2DR8A 3KK3B 2Z30B 4PXEA 2IYIA 2AKWB 1S9EA 2D9PA 3H5XA 4B3MJ 1LWEA 4PXDA 2V8DA 3CJ2A 2XBPA 2VU5A 2KB2A 3TR5A 2QRRA 3AH6A 4OI1A 4X65F 1HKAA 4Y2IA 1YHQS 5A8KB 3MR6A 3H42A 4DR5J 2YWKA 5IZHA 1S48A 3CCLS 1XNRF 1RTDB 4NLTA 1D9DA 2GNKA 3B78A 5ETRA 1WEXA 1IBLF 2FIUA 1RTJB 1J2VA 3KK2B 5KFJA 1S5ZA 5B0GA 2FLPA 5BR8F 4DV4J 2YKMB 4ZA1A 2DK2A 4M8LA 4AYBD 5D8HB 4DEZA 1MN7A 3C3LA 3BPSP 5L9XA 4EEYA 2WVDA 2GA7A 3MMJA 4B9TA 1KQSR 3BKFA 2LQJA 2R7VA 1RTDA 4ZVUB 3CIMA 2AEFA 1H2TZ 4GKKJ 1UJ4A 5HO4A 3UN5A 2JLGA 4G1QB 2R8KA 1RTJA 2FTRA 4MIAA 5L39A 4GMKA 2BKPA 5E2QA 2M3DA 4I64A 2AJ0A 4P2FA 2FHJD 2PMHA 2YKMA 2L41A 3K5LA 2ACYA 2MQ8A 5DETA 4MAKA 2RDDA 3N01A 4LF4F 1F5BA 1S72S 4JI7F 4PYDA 3SQGB 4F4KA 1BE4A 5CYMA 1AROP 3ISND 4OL8A 2WBMA 4C0HA 4DG1B 3UDEA 5LMUF 3LTOA 5KFUA 4G1QA 3D1QA 2XMTA 3PTWA 2F5GA 5F0WA 1NK7A 1BD6A 2UXCJ 4CH0S 1UETA 3KXDA 2W4DA 1KD1T 3RU0A 3CJ4A 5KT7A 1U02A 4ZCLA 1YSJA 4X66F 2WZ1A 4ZPBA 4KPYA 4L6V3 5IQQA 4LBIA 1PKUA 4ZJQA 1MMDA 4J9UE 1YG0A 3TEGA 5CXTA 1TQLA 2W2NP 1RP5A 2WAQD 4DG1A 3W9JA 3DRPA 2K06A 1IXKA 3JSYA 2QMWA 1NZAA 1R27B 1XIQA 1N0VC 3VVUA 3OHBA 1LW2A 4AXJA 3VCDA 2VPXB 2Z57B 3ILOA 1RAOA 2AIRB 3KTQA 2GIFA 4OZ3A 2K7KA 2KZMA 3TA0A 3W62A 2QO3A 1U1PA 4RW8B 4L73A 5ITHA 2A2DA 3TAMB 3QRRA 3CNQP 3PYEA 2HGLA 4OMFG 3Q8PB 4ZPVR 2V8GA 5GAGI 1HNIB 3PJ9A 2AJ1A 5SZTA 3DGVA 2BJ9A 1SH2A 4ZVEA 1V6HA 2KYZA 1K47A 1HMVB 4O0NA 2RF2B 2DGWA 2ZM6F 4KSEB 3I0RB 3M6XA 1CLFA 1CEZA 3M6VA 1DAXA 2XO6A 3W8PA 5HJYA 1TVRB 3ZTRA 2CPIA 3MM6B 5HBMB 4IKAA 2E66A 1W7WA 1R31A 1JLAA 1NPRA 5LSLA 1Y00A 1JLEB 2EXUA 3OLAA 2DXDA 2CVIA 1GX6A 3K5NA 3DNCA 4DDFA 3TAMA 2HQGA 1SIWB 4MIBA 1NDPA 4ZCIA 2M70A 4V19X 3G4SS 4QYRA 4JI6F 1RWWB 5MAOA 7FD1A 2O67A 1NKCA 1HNIA 3D9BA 3FFIB 4WZMA 3QBCA 1G3OA 3UO0A 2OIHA 4OYBA 5GAHI 3BDEA 5GAHU 3CF5Q 5KG4A 4P2XA 1RI7A 1HD1A 5HROB 3LP1B 1KLMB 2VDIA 4O23A 4UQGA 2OAUA 4QIWD 3C6TA 2OO4A 1TVRA 1PC5A 3MM6A 3VZHA 1VHFA 1G6BA 3TARA 2PD1A 3QZ8A 3FNNA 1JLEA 4F4ZA 2IDEA 2ZUGA 1ULRA 2UUBJ 1U48A 2NXUA 1VDHA 1B4SA 2HAIA 5DZ6A 3CB4A 5IXUA 3CJ5A 4A4JA 3FFIA 4OLPA 1FHTA 4ED1A 5KT3A 2EKNA 1VFJA 3THPA 1HNXF 3TOQA 2M0GB 3OXGA 4OX7A 2XSJB 5A6WA 2V2KA 3BPDA 3L4BC 2QIFA 5HROA 4TLQA 3W1YC 5A76A 1KLMA 3H2LA 3ZZ0A 1KNZA 2DRAA 4Y00A 1NK9A 1G2EA 4JI0J 1V9OA 1GT8A 1H3DA 3R97A 2EBGA 4M5NA 4ZVSB 1RAGB 2NSBA 3VTIA 2NSCA 2DISA 1CS4B 2UVRA 1UVLA 4NLQA 4C0BA 5BYQA 3DLJA 6FDRA 1A9NB 2BACA 2MLXA 1WTFA 4DSEA 2VQFJ 1YJRA 2LDIA 2FHMA 2OPRB 4QR1A 3HP6A 2R7SA 2DGTA 1EJ7L 3GV5B 2UU9F 1PO6A 4G1PA 4RBTA 4F26A 3D6TB 4MKVA 3H25A 3QFWA 3C6UA 1GK8A 5FJ4A 5LJ3Y 4GO7X 3LAKA 2WW8A 2RB7A 1N8RT 3CCWA 4DF4A 3AJDA 1CS4A 1Q4RA 4OHVA 2H4YB 3QWPA 1U1RA 5FLXU 4PG8A 2JEGA 3KHGA 5EWFA 4AD6A 3J7YU 3H59A 3CCUS 3I96A 1LWCB 3MCSA 3TVZA 3R9LA 4P52A 4HKQA 3WX8A 3HKZD 3L95X 2Z2YB 5CA5A 4FYVB 1U1LA 3IS9B 4M95A 3NWRA 2LCWA 5IT4A 2FZGB 4H4OB 3PW4A 4DPYA 3PEJA 1U2RA 2MY7A 4L72B 4ZP9A 2AEJA 2PEBA 2B5JB 1D3WA 4R0EA 2Q43A 3G96A 3KG4A 1F1BB 1YJTA 1JIHA 3BQ1A 1YBTA 3CMAS 3EX7B 4LFAJ 3MAQA 3V5RA 3NNAA 3LGHA 3CIZA 4OX9F 3HVTB 4IRKA 5IQ6A 1ZTTA 2KHCA 1FWLA 1X5PA 4UF4A 3NLCA 3H4DA 3T5JA 6FD1A 2NZCA 3M6WA 3A13A 1LV5A 5JVGQ 1FE4A 3IS9A 2RRNA 4NXNJ 2W4CA 4H4OA 3KHRA 2R8JA 2OEKA 1T9XA 1KSPA 1R6YA 4UZBA 3V6DB 3M8PB 1KS2A 1RABB 2FHJA 1FJ7A 3GJQB 1WHVA 2XHCA 2WCXA 4D3HA 1RADB 4NMLA 4C8KA 3P3DA 4CLYA 3RBZA 2RQMA 5A0YA 3OUYB 3CO0P 4DSFA 3OFGA 1VQ6S 2C3MA 4ID8A 2JOQA 3LAMA 4ITSA 3HVTA 1U6ZA 3K2YA 3DC2A 1ZS6A 3ILJA 4ZCKA 1EQMA 3BGRA 1TL3A 2LP4A 3LP0B 3GIKA 1RAEB 4QR0A 1CJVB 3V81B 1TP7A 1HBNA 1XNRJ 4Y2KA 1TAQA 3JSMB 2NREA 1SQEA 4KJIA 2KT2A 2LEPA 2BQ3A 3MZIA 1KONA 1IBLJ 4NCAA 3RTVA 4XPEA 4O4GA 3GONA 3O44A 3F73A 5I3UB 1FNMA 2GO8A 1F3VA 4IDKB 1M5PC 4DQIA 2RS8A 1RCOB 2B0GA 2VA2A 3D1OA 1NK4A 3H5YA 2HMIB 4DSIA 1SIZA 3BZQA 3DGPA 4NXMJ 2MJUA 3LP0A 4CIOA 2VODA 2H54B 4O3QA 1CJVA 3V81A 2YKQA 3LWLA 3CD7A 4AT1B 5LT5A 1VGYA 4CLWA 1RBLA 2YY3A 1X31C 1UZDA 4YDDB 4J9NA 4EGLA 4FKXA 4DFJA 2K2PA 1K44A 3L7OA 2GC8A 5H9EK 2V4JB 2HHPA 1PJ7A 5I3UA 2L9NA 2Y1RI 5F8HA 3NGTA 4QWBA 3CCRS 4IDKA 1TL1A 3BO4A 4JI7J 1X9WA 1ZAXA 2GJIA 2CPYA 3S7RA 3DYAA 4B3RF 1ELOA 1HQUA 3IAM9 1EIYB 5HJXA 2R8HA 4TU7A 2NUUG 2QLFB 2HQCA 5LMUJ 1O5JA 1S7IA 2WVCA 3I4PA 2CADA 1Y11A 3AD9C 2HEKA 1TUGB 2DNYA 1QSSA 4X4NA 1JKHB 1X8DA 3JAMU 4LFCF 1VI7A 1NPKA 4K2JA 3MR5A 3QT5A 5KAKA 4P75A 4J9LA 1JLQA 5ADZA 2QMUB 2HFZA 1HI8A 2LYVA 5E3CA 1HWJA 3H40A 5AE1A 3NS5A 1Z1ZA 2VPWB 1YJUA 4Q8EA 3Q24A 2NQPA 1VYAA 1IJFB 1WF1A 5LMNJ 4P6QA 3WQPA 2W1BA 1U8SA 2WW4A 4N5SA 2G2OA 2K1RB 4IR1A 4EU0A 3C14A 1JKHA 4DV0J 2XEXA 3ZZTA 2KHDA 2MSSA 2FGCA 3IG1B 4DPTA 1UFWA 1Q5VA 1ZPVA 3UN3A 4B3TJ 2UXDJ 1VQMS 4LSLB 1VOMA 1BXNA 2QSWA 2ZHBA 2IRXA 1FD8A 3T1AA 2QLXA 4PQAA 2EEYA 4OX8A 1FXDA 3M32B 1QVGR 2GS8A 7FDRA 5LOQA 2V8VA 3TUPA 4X4RA 4PUOB 3Q2SC 5CZVA 2CNKB 1WHYA 1D1UA 5U47A 4NLWA 2Z4PA 5J1EB 1NK5A 2ZM6J 3W63A 1IUJA 1TKXB 2D3UA 3DRYA 2E9ZA 4ZLPA 2IRUA 3CUNA 5HQ8A 2QYCA 3D3BJ 4EK2A 2K1RA 2WOMB 1UVKA 2AJQA 4NWBA 3G2XA 3IG1A 1GXUA 1P1LA 2OFHX 4DFKA 3PW2A 4WXWA 2UUCJ 4LSLA 3MEDB 2KVQE 5E3PA 4OJHA 3NGUA 3M32A 2XTJP 2N3LA 1YJWS 1TTHB 1F6TA 2BRKA 2M52A 5C7PA 2OLWA 3CCVS 5EX0A 3UD4P 3M05A 5LM7E 3MM9A 2L9DA 3D0IE 2VV5A 2C3UA 1VBKA 5J1EA 2IM0A 1RKJA 3KUGA 4DBQA 3BBCA 4YR3A 5J2NB 3CJTA 1VQOS 2WOMA 4DUTA 4X4OA 1EKSA 4CI0B 4JI8J 2EFVA 3TQ1A 1GXTA 3D67A 1HBUB 4JYAJ 3RZAA 3NNCA 4K8RA 4FF2A 2E5GA 5HVHA 3DMJA 2WRMA 1HNXJ 2DNPA 1J5EF 1XK8A 4QWEA 2C1EB 3AOAA 2ZNZA 2WB1D 3RRGA 3IGVA 3HJFA 3UDCA 5KFFA 3RB4A 1R0CB 4JV2A 2ZHOA 4CTAB 4HVZA 1LK7A 2OPSA 3T9NA 5D6GA 3JB9k 2ZBCA 1RWMB 2J7WA 1RAJA 4ZJLA 4OIXA 1P8GA 2EVZA 5E0OA 3M8QA 2QN6B 1HBUA 1GH8A 3PRVA 2CIMA 1N5QA 3UNYA 5KG6A 2W2PP 4EZ6A 2JDJA 2YWGA 2YX1A 4XPCA 4OI0A 2V63A 3J81Y 4QQBA 4BBYA 2MZRA 4LIWA 2DGQA 3PR4A 4ECQA 1PG5B 1U2FA 2HIQA 1NH7A 1AW0A 4P74A 1N5TA 4YFUA 3GFYA 3FRZA 3UPFA 2UV8A 4ED4A 5GMKa 2HWIA 2B4PA 2BKNA 1FJCA 4ZHRB 2HPUA 2BA9A 2DNQA 1W2BR 3NBPB 2HNDA 1RWKB 4I6AA 4NCGB 3HX9A 3LGMA 4ZVPB 3IXQA 3GR0A 3BM7A 4DQRA 3V4IB 5IWAF 1AFJA 2LKZA 2L08A 3Q8VA 1IKVA 4H4KC 4M63A 1XR6A 1HYSA 2CQGA 2N4CA 3QZ7A 3H5UA 3JSBA 2QA4S 1HPZB 5SUHA 2HZAA 4L76A 4P71A 2FHOB 4ZHRA 1FE0A 1X4HA 2MKIA 2UXBF 3NBPA 5CQGA 5AJ3F 1UA1A 2WONB 4JI5F 4IG3B 3IAS9 2F8MA 4IO9Q 1FWKA 2VG5B 2VZ9A 1NU4A 3TVKA 2OELA 3V4IA 4HTIA 2FQQB 3GTYX 4Q7AA 5DRKA 3ETOA 4ECXA 2V5HG 4OX9J 2FJXA 3NRBA 4ED0A 1B99A 1TV6A 3CJ8A 5A8WA 2AWZA 1ZM4A 2MZ1A 1Q78A 1N52B 2CQ2A 3AOCA 4KC5A 3VAJA 3Q23A 4RKUC 2KXFA 4KO0B 4WE1B 5KFVA 4ZVRB 1HPZA 4F25A 2M5YA 3ZZZA 4G1IA 1CULB 3SQOP 3PV8A 1G1XA 3MEGB 1FK9B 4C11B 1GX5A 4ELUA 4BLGA 1T05B 4WIIA 3W8GA 2WONA 1F9HA 2QL5B 1D8YA 4IH6A 3MPVA 3JYTB 1OY6A 3JS9A 3OXLA 2YWFA 4K2XA 3RBXA 4WFAQ 4OZ5A 2HQFA 3D0HE 3I32A 4FYWB 3RYLA 2CWXA 1Z2LA 5H9FJ 4C4WA 3FZ2A 1NJWA 2G9OA 4PWDA 4NI2B 3OL8A 2CG4A 4WE1A 3QJLA 2LA4A 2P6SA 3C16B 5I42A 1CULA 3DRRA 3RAQA 3BN4A 4X64F 3MEGA 4A48A 1FK9A 2KJVA 4C11A 3NNHA 4CLZA 2QLJB 2VFRA 2PMZD 2NR0A 1P6TA 5F3TA 2EBEA 5J2MB 3SMZA 4DR3F 1VC6A 4KHMA 2W25A 4NPOA 1UPPA 3WZ0A 3JYTA 4JI4F 1FXRA 3GJRB 2POKA 4K4UA 3ET6B 3TJ8A 4K0KF 4X4QA 4FS1A 4NMXA 4TU8A 5KFQA 3ZTSA 4DR7F 2FUG9 1S76D 2YNGB 2D3OR 2ZH9A 4F8RA 4NI2A 4QCLA 5ETKA 2KT3A 4PKDB 1H7XA 3G8QA 2B7BB 5LSOA 2CUYA 4DV1F 3HMJG 4HI2A 3RAXA 2AJ2A 1SV5B 5J2MA 1U26A 4ZVGA 2CZ4A 5KG2A 4OX6A 3VGTA 3CC2S 3ET6A 2I6WA 3QATA 1FFGB 1WEYA 4WK1A 2XLJA 2YNGA 4ID5B 1KEKA 2E9TA 4RUHA 2J7UA 1T0TV 1YIJS 2F4FA 4DX5A 1WC5A 2VKZG 3QMQA 3IN5A 4IQMA 4B3RJ 3GYNA 4FKYA 1EP4B 1SKUB 3LA0A 4TXSA 5F9NA 3DLGB 4J9SA 4YS2A 3G8TA 4ECRA 2XMJA 4YEAA 4KGMA 3SEOA 1C4CA 1VLOA 3ENQA 2E1CA 4DR4F 5FLXY 2RD5C 1FRIA 5J2QB 4U6PA 3NS7B 4LFCJ 2MSTA 3UFCX 4K4SA 1FDNA 1KHWA 2CDRB 3I9ZA 3NOCA 2UUAJ 1YJ7A 4ID5A 3CMES 3JSRA 2XZWA 3HHKA 3R5CA 4WBFA 2ALZA 4PZVA 1EP4A 3KLFB 5HN0A 2GVDA 1I5OB 4E8UA 1WC4A 2XMVA 3TA2A 1IJEB 2VFUA 2RRBA 1JLBA 5IM0B 2R3VA 1LFWA 3ENWA 1S1UB 4PR6A 4TY9A 5J2QA 1TKZB 3LALA 1FJGF 3R5GA 2BZ2A 5L1IA 3O1LA 3UWTA 1T9WA 1C1CA 3O8WA 4NCBA 1WD6A 3QJJA 4KY3A 4RPFA 2NXJA 5DG7A 3GPAA 1RXOB 2F9DA 3NOGA 3IC1A 4EMDA 4MKAA 3VAKA 1O6XA 3MEKA 2CJAA 1UCNA 2HAFA 2ZH5A 5IV4A 3CTRA 3U02A 2OD4A 4A8XA 2EFGA 2E29A 5ETVA 2MGZB 3H5SA 2BOPA 3CMQA 3D0GE 3CCES 1RK8A 3A3NB 3VZIA 3AXKA 2EPIA 1TKZA 1V3ZA 2ATCB 2PFDA 2DNKA 1V5VA 4DV3F 1VQLS 1RKIA 2CJBA 2IBOA 3N6NA 2AW0A 5KFOA 3KWMA 3P49B 2FZCB 2HQIA 2GHPA 4XTTA 4X4SA 1NLKL 3LUYA 4HHUA 3GSDA 5KFCA 3PNIA 1S6OA 2CQ3A 2HQDA 3NGDA 2AYBA 3M7VA 2JH3A 2AGQA 4M5KA 5LL6d 1NCLA 2DITA 2I9SA 3N5BA 4URSA 3MUVP 3CGIA 2DO4A 2HBQB 2DHAA 3UCGA 2VKRA 4MH8A 4XK8C 2W9BB 2PSZA 3MPWA 2PI4A 2J9EA 2OGUA 4U8YA 2CXEA 3MM8B 2X51A 2MQMA 2MGZA 2HBZB 4USWA 1EHWA 1KBRA 1IR0A 2M88A 2AX1A 4DMZA 2BM1A 3PO5A 1KR4A 2BE2A 4CO4A 3TZXA 4RZRA 4LF9F 3QIDA 1TU0B 5FIIA 1VQSA 2D7SA 3DOLB 1YKWA 1S6QA 3DM2B 1RYSA 2Z2ZA 4GKJJ 1SPBP 4DZDA 3W61A 3MD1A 2GQCA 3PO4A 5KOWA 3R6GB 2HRTA 3ADAC 1MW7A 3ZZUA 4WP3A 1Q8LA 2OH2A 2W9BA 5F8NA 2GMLA 3FDSA 3D4JA 1FKOB 3ZNJ1 3Q89A 3FUYA 3LWMA 4YB6A 4R8UB 2KM8B 3CJKB 3P5TL 4QW8A 4OHYA 5F8GA 4Z7CA 2ZE2A 3NMAA 5KG0A 5L1LA 2HHVA 4A8MP 1NB7A 1FCAA 1TELA 3HF5A 2YX7A 2JNJA 1RT4B 4KRWA 3UD3P 1U47A 4QWAA 1K0TA 4KHPJ 1N56A 1U8WA 4CWBA 2VBXA 4C97A 4ED5A 1PAEX 2BJ3A 3H2UB 3U1NA 1FKPA 3N28A 2E5JA 2XZTB 2MQOA 4M1KA 3RB0A 1FKOA 2OSRA 4V19J 2HVDA 3R8YA 2M9KA 1SJFA 2ZC3A 4R8UA 3W7BA 1X4AA 1F5CA 3CJKA 2IY5B 3K17A 1IKXB 3TJ9A 1S59A 4J37A 3Q8UA 5LXYA 2QLWA 1X5SA 4FVMA 1RT4A 4EO8A 4A47A 1KP6A 1FNOA 2HZCA 5IWAJ 2AJ4A 2APOA 1FESA 3EVOA 2VUGA 2EK6A 2RKIB 3FBEA 2L9WA 1ZPWX 1SCJB 4NLUA 1D8ZA 2R9LA 2ZVIA 3DOKB 2W8KA 3BS9A 2ACMA 4MMOA 4TVAB 2JHEA 2DD8S 5HI7A 3W5YA 3MOZA 2CJXB 1QD1A 4B3OB 5HANA 3BREA 4ECZA 2PFFB 3JXOA 3FRYA 4DUZF 4ED7A 1R3NA 4ILRA 4JI5J 1FDAA 5L38A 1L5UA 2F8HA 2VICA 4WYLA 1JNZB 2RKIA 5D78A 4RLEA 5T41A 1FNXH 2B9XA 4HT7A 1O51A 1R7IA 3I0SB 1RGVA 3DOKA 4X2BA 4YB1P 1RLDA 5DDRC 2MHNA 3FEYB 4TLRA 3B54A 4ELVA 4B02A 3RGIA 2X1AA 1RT3B 3GMGA 4OYPA 2DH8A 2KRRA 1MMNA 2UVVA 4DR5F 8AT1B 3GIRA 1QM9A 1Q79A 2VH7A 1J5OA 2HBYB 2IA0A 2GQ2A 4C7QA 3T1HF 1OPIA 4F4WA 4DL5A 4JI2J 1Q86T 4PG7A 2W4PA 3ZC4A 2PDAA 2Y0SD 1M5KC 3OTOJ 1MN9A 5J1NA 2CJYB 2YVSA 3BBBA 2QFIA 2C3OA 5F8JA 4C48A 4DV6F 3I5AA 4J9QA 3I5BA 4K59A 2ZZMA 5A2QY 2H5JB 4C3LA 1RT1B 1S0NA 3CCMS 1T9VA 1SJ3P 2H1YA 2HFVA 5ETNA 3EMTA 2FDNA 3TW0A 4DQSA 3MECA 3UR3C 4DR3J 3PW7A 3ETMA 4JI4J 2M8HA 2ALYB 1SJQA 4K4XA 2HFOA 2MZTA 3R5JB 1FWPA 3JTNA 2B8QA 2JSXA 1R0AA 2JVRA 4DOZA 4K0KJ 2DT9A 1QUPA 1YRUA 2BV3A 2MXYA 1GMWD 1NO8A 1RACB 1XN9A 4CT8A 1WSRA 2EI5A 5DS7A 2OPPB 2B51A 5HQMA 4CLFA 4OI4A 4LF5F 1LWFB 1FD2A 1B0TA 3GE9A 4DV1J 1LWXA 3PHTA 2ABYA 4Q44A 2L3MA 4KV8B 1NSAA 2CQCA 3T6JA 3AQPA 3LQVA 4Y0FA 1BQNB 4F3MA 4M5JA 3GJSB 2HNYA 4Q45A 2AGPA 4HTJA 2HWTA 1FKAF 2PN6A 3VHQA 4H4KA 2XI2A 2WBRA 1IBCB 5AE3A 1YZ6A 3PIOQ 4B3SF 1HNZF 1W25A 4HHJA 1R8BA 4I7FB 1GAOA 3SIPB 3KHHA 4WXOA 3TA1A 2RMLA 2OPPA 3NCRA 4Q8FA 4USHA 1A0OB 2VHGA 1LWFA 4OLOA 2DNRA 2VFSA 1PBAA 1RT6B 1KN6A 4KV8A 4I2PA 3V6JA 4UT4A 1LW0A 3VGSA 4TNOA 1SL0A 4CO0A 2W7AA 1CC7A 3BH7B 4XIUA 1Y3KA 1OIAA 4DR4J 3UNGC 2RIJA 4UOCA 3QGHA 2ASDA 4ZN3A 4YUDA 2OMLA 2BYCA 3K8VA 1CJTB 4UY85 4OJ3A 2CQ4A 3V6HA 4YB5A 1QAJA 1CJUB 2FVSA 2B8PA 4OYMA 3FCWA 2Q3PA 4C8NA 2NXNA 2V69A 1HBOB 1O8BA 4CO1A 2HFUA 1HD0A 1S1XB 3LP2B 1CJKB 3PFOA 2CQIA 5CD4A 1YGYA 3UW1A 3W3SA 1HI1A 2K3IA 5AXNA 4F3QA 4BS2A 1NBEB 4N76A 2L48A 3U27A 1WKLA 3BQ2A 1WACA 2ZWOA 1FRXA 2CJQA 1CJTA 4DN9A 4ZKAA 2PO4A 4OFZA 1YDLA 3DLKA 2Y0BB 5FD1A 1ZA2B 1JXEA 1ZBTA 4ILMA 4DL0C 1HWIA 2DGSA 2W2OP 4YP3A 1Z4UA 2MQQA 3Q8QB 1S1XA 1CJKA 3D6HB 2I38A 1H73A 5F9LA 4OI6A 3UDVA 4RU2A 2DXEA 2P9GA 5KT6A 1GFWB 3DLLQ 1ROFA 3FSIA 2HBRB 4Y3CA 2JEFA 1IR1A 3WX4A 4DV3J 2BX6A 3PX4A 4I68A 2DCLA 1OO0B 2KRBA 3TUZC 5KFKA 1HBMB 5C2GA 4XDDA 3CEDA 3MTJA 1JJ2R 1QTMA 3AJ2A 4QWDA 2KVIA 3TP2A 4ALZA 3MFIA 3IA0A 1PJ5A 3SCIE 5IV3A 1IBKF 4CNYA 3M4XA 2OEMA 2EW9A 2YWHA 3MM5B 2KJWA 3CD0A 2CDQA 4AL5A 2IIHA 1XR7A 3WC2A 5KG3A 2RE1A 2GIRA 2IFXA 3CDWA 5KFSA 3BGOP 4JI0F 4LF9J 2LXIA 4ECSA 1NXIA 4G3IA 2Y8WA 2JLFA 2X7IA 3GJTB 3K58A 1NDCA 4HH1A 3D2WA 1M1HA 3HPOA 2RT3A 3MD3A 2B9WA 1KFDA 1SL2A 2VQFF 1QAXA 1M5VC 1MWZA 3IGNA 3MM5A 4R0JA 2MKYA 4LUBA 4LFBJ 3OPKA 2AZ1A 4LRFA 1XERA 1JWWA 3PW0A 3MHYA 2XMAA 5E7OB 4EBDA 3GU0A 1Y3JA 5DQIA 4CO2A 3TX0A 4EBCA 2PIIA 1KRPA 1FDBA 4CLSA 2C2NA 4NZ6A 4J5OA 1S1TA 2VL1A 2MKJA 4FXWA 3HZGA 4H54A 1JX4A 1KQGB 3N5FA 5KT5A 1LXNA 5D3GB 3EPIA 2ZJPQ 2C2ZB 3P6YC 4LRDA 4QOTA 3W5XA 1JLGB 2W7OA 2HZVA 2F3JA 2BQUA 4C0OC 3A8IA 1UFLA 2XQCA 1NJIT 4OQJA 3W60A 2G0JA 3DOMA 3DXBA 3ZZPA 1RBAA 4KIAA 1S4FA 3HHLC 4I0WA 2AYGA 1OJ4A 3VQSA 2NPIA 3R5AA 3SSQA 3H90A 1RT2B 3OTEA 4ZP6A 3DRXA 3NP5A 3D3CJ 3MFHA 3KLHB 3B8HA 3CDBA 4FPRA 5B09A 3P8BB 1S9EB 4CO3A 4UTGA 2EC0A 3KLGA 1R43A 5K8NA 5D3GA 1AUSL 2H65B 3B82A 5EDWA 2HHXA 3NXZA 2K3KA 3UCUP 4X84A 3D7SB 4ILLA 1K8AT 1RHQB 4N8NA 3THVA 3SV4A 1BUXA 1UFKA 4IOBA 4WU3A 1N33J 4F2RA 4NLVA 1GMUA 2YNIA 2OJ3A 1DRZA 3Q8YA 5D15A 2HRYA 2E7VA 5KFDA 4KT0C 4FYDA 1GMWA 2F7VA 1RT2A 4DV7J 5T7LB 2DNLA 3UQSA 1WUUA 4NEYA 3KLHA 1QSLA 1HQEB 3WDOA 1B64A 3HCXA 4LVOP 5EX3A 4HI1A 2HVZA 2FLOA 2BMBA 4QZVB 3WHIA 2C2EA 5DDPC 4USTA 1XQIA 1NM2A 2NCKL 1U09A 4FP9A 1RBOB 5B0AA 4J90A 1SJRA 2IMOA 2LEAA 3T1HJ 2B9YA 2EG2A 3AOBA 3Q83A 5T7LA 3VR1A 4EBEA 3NEKA 1HQEA 2OTLS 1RHKB 1DBDA 2P5VA 3PJWA 1Y5IB 2IDLA 2F40A 3GIJA 1ZA1B 3L3CA 1P9QC 4USIA 4DV6J 4MK7A 1XWLA 5DGBA 1WSVA 1QUVA 5B08A 5C24B 1WG1A 2R2UA 4OZLA 4NXMF 1YJ9S 3K89A 1T94A 2CAJA 4YHHF 1Q95G 2FPHX 2WB4A 5CYMB 1NUEA 4FVCA 3IWLA 3CCQS 2D9OA 4NZ7A 3A8JA 3IRXB 4M5DB 4ED2A 4FYXB 9RUBA 2BJ8A 1C0UA 2R2TA 5KFHA 5HMXA 2FGOA 4U95A 3I82A 4CLLA 1LXJA 2R7OA 3C46A 1MU2B 3KLIB 5E33A 2RDJA 2LFVA 2ZH8A 2XMWA 5B0DA 1HNVB 4NLDA 4B9UA 1R8PA 4ZVFA 4M94A 1FVSA 2EFOA 2C28A 2DPJA 4RW9B 2ZD1B 4LF5J 2G4BA 5KFIA 1VC0A 1SI9A 4K4WA 1WG5A 3IO1A 5C24A 1RWVB 1D0EA 5IOLA 1VK8A 2EWHA 3J81U 1IM6A 4KTQA 4K4VA 5HVFA 3C66A 2ZBIA 2IYGA 3DRPB 3OSPA 3S6EA 3IRXA 2MYFA 4M5DA 1UZHA 4MK9A 2V9KA 4USJC 2ZOFA 1LW2B 4HR2A 2RU9A 3VF0B 2KXHA 4RNFA 1QTNB 1Q81T 1MU2A 3M8WA 1IKYB 3KLIA 4WCEQ 2J7KA 4B3SJ 3U1MA 1HNZJ 2GV1A 4DQQA 2XB2D 1VIOA 1HNVA 3NCPA 4ZJOA 2IVYA 3DLEA 1VBZA 3ENAA 3ZTQA 4RW9A 2ZD1A 4PRFA 4LF7F 4FNHA 3PY8A 4E0DA 1T95A 3MMAA 2HHUA 4KH0B 3BV8A 2ZHAA 1UMJA 2R2SA 3AD8C 2XHWA 3F0NA 2J9DE 3PYDA 2PGCA 4LQ9A 3C19A 4ZPTR 2IHR1 3KJVB 4B9VA 2FY1A 1RQ0A 4ZVOB 2LVWA 3W2WB 2BJEA 4N77A 3D6FB 5CHCB 2FY8A 1Q8IA 2CQDA 4USUA 1UJ6A 3I5CA 5LMNF 1T9TA 3BR8A 1IKYA 3E8OA 3V6KA 5D4LA 1JLAB 2LU2A 1BQMB 3W2VB 2CPJA 4EYIB 4CLTA 4DV0F 2QYGA 1QSYA 4B3TF 3F56A 5LSRA 2UXDF 3DCAA 2EKYA 2ZZTA 3TVYA 2VBWA 2IVFB 5GAGU 2ZKUA 5DG9A 2ZNYA 1WEZA 1PAUB 5C25B 3I55S 3KJVA 3TI0A 3HHLD 1WELA 2X1BA 2B6AA 3W2WA 5L9NA 4DLEA 3P5BP 4AE5A 3FC9A 3C6TB 3K0JA 1WHXA 2CNLB 1KKHA 2E1RA 2HQ3A 5FDLB 2G1HA 2DVIA 1LKZA 2XMKA 2DRBA 5DO2A 4DZ6A 1FT8A 3KMSA 1BQMA 3W2VA 2VQEJ 1IR2A 2AHOB 1WHWA 2DH9A 2MHEA 4UY8T 1IKWB 2UUCF 3D66A 1TR0A 1FFSB 3BGLA 2DNGA 3FKBA 1CSJA 2YKAA 3FMWA 1XMBA 4ATNA 1UPMB 5C25A 4GVBA 3JQMA 1U2CA 2LXFA 3T6BA 2DNHA 4ETXA 1VRUB 2GHWA 3DU6A 3UE2A 3AA9A 2C2RA 1UEVA 3GCXP 4JI1J 2HKEA 5FDLA 5L8RC 2QL9B 1JJCB 2GVZB 4K5RA 2O01C 4JI8F 4OYZA 1IKWA 3VALA 4JYAF 2JEJA 4UQTA 2HG4A 1GTHA 2RH3A 4NZ0A 3CT9A 1WKKA 1IBKJ 2H4WB 3H8YA 4LVNP 1DQAA 4ZK7M 1V3RA 3FBCA 2QZ8A 2RS2A 1L3KA 2E5LF 4QU6A 3G6ES 2ROPA 2ZC4A 2YKPA 1UW9A 4C9DA 3AJ1A 1VRUA 5IT9U 4ZP8A 4PPDA 2FVRA 2ZOGA 1A6LA 1H6KX 2E44A 4AQYF 2LQ5A 5EN1A 3C6UB 2GVZA 4K5SA 1FF2A 3Q0AA 2H5IB 4IRDA 1UA0A 1OMSA 1GQEA 2CPZA 4NA1A 3CSKA 4ED6A 1YQHA 4BDPA 4HYKA 4ZLNA 3HLUA 2RSQA 4C2MA 3QAUA 2ZH1A 2LDYA 3HSZA 1KOOA 1RAHB 2U1AA 3ONQA 1G7CB 3KDOA 3QO9A 4OHWA 3CPWR 4OZJA 3R5BA 4JV1A 3V4MA 2YNFB 1DQ9A 2D1CA 3SFUA 3D5MA 3CDAA 4QYZK 1HLWA 2FJAB 2WHOA 1J27A 1KWMA 5C5JA 2BDPA 3OL7A 1FA0A 4ZPWR 3UR0A 3EZUA 3KK1B 2QEXS 3Q2TC 4F2SA 1ZM9A 4Y2MA 3DFEA 1FRKA 4NA2A 3D68A 3JTOA 4LREA 1RWNB 1Y5NB 3UD5A 2O1PA 4A8QA 3T9ZA 2UP1A 1MWQA 4DPXA 4OYOA 4MYUA 2O5DA 2C2OB 2HWHA 3CJ3A 2X3DA 1NDLA 1RT5B 1Q53A 1VQ5S 2YNFA 3NS6A 4PABA 4AXIA 2J76E 4I1TA 2DKOB 1DJ0A 1NMEB 3A4TA 8RUCA 4C8MA 5J1PA 1RWPB 1FEHA 3KK1A 1ZTWA 1ZETA 4F50A 5A0YB 2B43A 1UJ5A 3OXFA 1N0UA 4NX9A 5DLFA 3HFZB 4IUFA 3TX8A 1XMQF 3LOUA 4DSKA 2R7WA 3WIVA 3BJYA 3BGRB 1TL3B 4UUWA 3B6BA 4GC6A 4RBVA 3BSOA 3OR2A 1QAIA 1TMJA 1RT5A 3HSGA 3OSNA 4OYAA 2PMWA 5ETOA 4BC9A 3OHAA 2RQCA 3HULA 1HBNB 1U7LA 1YBAA 3GFXA 2W7PA 3SSSA 5IT0A 2JWNA 1S9GB 4PG5A 1T11A 2DNNA 2QA1A 3EICA 4PQUA 2MJNA 2MQPA 1NHKL 2ZWPA 2JC1A 2OKQA 4O4GB 5GMDA 4M5GA 1JXVA 5RUBA 3A8EA 2V50A 4WP9A 3D6MB 1IBMF 4HACB 1LK5A 1URRA 4WWSA 3EXYA 1U0SA 3HSDA 4FXVA 4X62F 4JB8B 3H20A 1KC8T 3DGPB 2VFTA 4O0IA 1UW4A 3R6LB 2QG9B 3K5PA 3TZYA 2BXJA 3M30A 3OL6A 4KAIA 4PG4A 1HL6A 1S9GA 2N82B 2CA9A 4GO5X 2WSFC 2KZZA 4K50A 3UN2A 1AXQA 3OVBA 4HACA 2QTWA 3PYFA 4M5MA 2G2ZA 3VWSA 3TQEA 1YJVA 3L7UA 1TL1B 3A3OB 1S4EA 1AZSA 2HYIB 1GMVA 2XNQA 1Q8BA 3DKDA 3M1VB 1QVFR 1AFIA 4YN3B 3BKUA 3DYAB 3W5ZA 1H74A 2QLBB 4YHHJ 4FDFA 3IBCB 1HQUB 4ERDA 1NSQA 4CLUA 3W9IA 2C2DA 2YWEA 2ROEA 4WK3A 3CCTA 4HH0A 4F02A 2ADBA 5F3ZA 3HI9A 3ENVA 2MKSA 4ER8A 2FB0A 4X4UA 2CFXA 3R1LA 2YBVA 2FZKB 5DJBA 1XJWB 3AHPA 4MTPA 5K5MA 4YR2A 2DJWA 3CC7S 2Q6CA 2AF6A 2DR6A 1WJ9A 4KFBB 3I31A 3MMCB 1R8CA 3ITHB 4QWCA 1JLQB 3M1VA 4KKOA 2ZBPA 2KTQA 1ZZFA 4RX6A 5E41A 2OMOA 3R2DJ 3T5LA 2RILA 4GVLA 3RBDA 1EB0A 3OTCA 4NYZA 1R0BG 1C0TB 5F41A 2R7XA 5AE2A 5KG5A 2YQ1A 4RW4B 3J7AN 2ZUAA 3EDQB 1N34F 1SXLA 5CYQA 3Q8SB 3M2RA 2BJ7A 2ERRA 1BWVA 1S6UA 4F0KA 1UVJA 5EGYA 4RUBA 4A8WA 4XO0A 3QT6A 2BJ1A 3C14B 5B0EA 2D69A 2CRLA 4CH7A 1M90T 5KT2A 4RNHA 2J9CA 5D0RA 2BR0A 1RAAB 2PI5A 2UUAF 4KFBA 4LF7J 3M2VB 3MMCA 1NKEA 4UOHA 1EQ0A 3ITHA 4CZCA 2GHVC 4FYYB 4WFYA 4DX8H 1BC6A 3MPDA
chains in the Genus database with same CATH topology
4DQPA 1VHFA 4RLEA 5T41A 1FNXH 3BN7A 1G6BA 5KFLA 3TARA 1C0TA 2B9XA 4HT7A 3QIPB 1O51A 4O44A 2PD1A 3QZ8A 3FNNA 4DWIA 2ROGA 1R7IA 1JLEA 3I0SB 4RW4A 1RGVA 3DOKA 4X2BA 4F4ZA 2JRSA 4YB1P 2ZUGA 4LJMA 1ULRA 4Y65A 1HNWF 5DDRC 2MHNA 3FEYB 1U1OA 2IAJB 1NEEA 1KTVA 2NXUA 4TLRA 1U48A 4WFBQ 2VG7B 3PJXA 4ELVA 2HAIA 4B02A 2XLKA 2BBEA 3MR2A 3OTBA 2X1AA 1DZ5A 2RUGA 1RT3B 3CB4A 3GMGA 5IXUA 4WYWA 3CJ5A 4A4JA 2C3YA 1ZM3A 3FFIA 4OLPA 1FHTA 1I94F 2DH8A 1RWUA 1C1BB 1MROB 2KRRA 3QAEA 5HMWA 5KT3A 4ED1A 1XNQF 3KLGB 1MMNA 1L3SA 2UVVA 1VFJA 1JNRB 4DR5F 4NYPA 3THPA 1HNXF 3TOQA 2FC8A 1N88A 2M0GB 4AL7A 2AQ4A 3OXGA 4OX7A 2XSJB 5A6WA 2GX8A 2V2KA 5DDOC 4U7UK 3K57A 1QM9A 1TL5A 2QIFA 1CVJA 2HHHF 1GXLA 1Q79A 5HROA 3M2VA 2VH7A 1J5OA 4TLQA 3M9NB 2IA0A 2GQ2A 1RA6A 1KLMA 1RJJA 3D54A 3H2LA 4C7QA 3ZZ0A 4F67A 3T1HF 1OPIA 5KFTA 2DPIA 2MB0B 1KNZA 2DRAA 4F4WA 4DL5A 2N7YA 1Q86T 3CD5A 4PG7A 2W4PA 4Y00A 1NK9A 1G2EA 3ZC4A 1MSWD 2PDAA 1WF0A 2Y0SD 1M5KC 1B0PA 2YNIB 3GFZA 4LIRA 1V9OA 1GT8A 3MM9B 1TKDA 2XWXA 2X1FA 1H3DA 3QIPA 4NLXA 2YH1A 3IFEA 5J1NA 2EBGA 1U1NA 2YVSA 4IQXA 2RJZA 1UAWA 2HFNA 2C3OA 5F8JA 3OR1B 2FVQA 2DTJA 2IAJA 1SV5A 2NSBA 3VTIA 4DV6F 2AX0A 2VG7A 3I5AA 4Q43A 2NSCA 1F5AA 3I5BA 4J9QA 3OBIA 1DLOB 2VC1A 4YQWA 4YB7A 4K59A 2W9CB 2DISA 4OHZA 1M5SA 3LANA 2KXNB 2JX2A 2UVRA 1UVLA 2ZH3A 2ZZMA 1ZM2A 4NLRA 1FXLA 1GNKA 5A2QY 2ASLA 4NLQA 4C0BA 2AGOA 1C1BA 1MROA 4C3LA 1WG4A 1RT1B 2P9CA 1S0NA 5BYQA 3DLJA 6FDRA 3HDSA 3CCMS 1A9NB 2BACA 2IM1A 1SJ3P 2OFGX 1WTFA 2I1RA 4DSEA 4ETZA 3CCZA 4WFZA 3PZPA 2FDNA 4OZ1A 3TW0A 1YJRA 4HL9A 1DFDA 4DQSA 2LDIA 1OWXA 3MECA 2PE8A 2FHMA 3UR3C 5DDQC 4N56A 2OPRB 5B0CA 4NRTA 1KQKA 3PW7A 1FEEA 4QR1A 3HP6A 1ZAWA 2CQHA 2R7SA 2IM2A 2DGTA 2K7JA 4KBIA 2KFYA 2M8HA 3GV5B 1SJQA 2J5AA 2UU9F 4K4XA 1PO6A 2HFOA 2IC3B 2MZTA 4G1PA 4RBTA 1N54B 3JTNA 4F26A 3DMJB 2OSQA 4KE5A 4ZCMA 2JSXA 3BGFA 2LU1A 3H25A 1R0AA 3DLHA 4W90B 2JVRA 1KHVA 4QW9A 2AU0A 3C6UA 4KHRA 3EZ5A 4DOZA 2DT9A 1QUPA 1YRUA 2OP5A 3LGNA 2BV3A 4FBUA 5E5NA 4QIVA 1L3VA 3NGKA 2MXYA 5FJ4A 2A3JA 5IFMA 5LJ3Y 4GO7X 3LAKA 1NO8A 3K5OA 3OR1A 1XN9A 4CT8A 2G1DA 2EI5A 3DLGA 2J0SD 2WW8A 2RB7A 5DS7A 2OPPB 1N8RT 2DO0A 1RT7B 1REVB 2B51A 1DLOA 1X4EA 3CCWA 4DF4A 2C22A 1Q82T 4Q2MA 2W9CA 3EXCX 1DHMA 4P7TA 1HWLA 4OI4A 4LF5F 1YRXA 1Q4RA 4NRUA 4ZPAA 1LWFB 1N6QB 4OHVA 5HL7Q 1FD2A 3QWPA 4L3NA 3FZBA 1B0TA 2OPSB 3GE9A 2D74B 4JOUA 3VAIA 4WU2A 1FRHA 4PG8A 1U1RA 2EFPA 3PXGa 2RU3A 2JEGA 2N4DA 1D9FA 1RYRA 4PG6A 2ABYA 4Q44A 1R8HA 3KHGA 5EWFA 3UDLA 4TY8B 5EHHA 2L3MA 3QYYA 3J7YU 3H59A 4KV8B 2NZ4A 3CCUS 3I96A 1LWCB 3M8QB 3MCSA 1U45A 1EETA 3TVZA 1U1KA 2CQCA 5I3PA 3T6JA 3KLEB 3AQPA 3LQVA 1M5OC 4Y0FA 2R2RA 1BQNB 4HKQA 2Z0GA 4F3MA 2HNYA 2FC9A 1S0MA 4GKJF 4Q45A 3HKZD 4O3PA 5I4MA 3L95X 5CA5A 3G71S 3QGPA 3FMBA 2AGPA 3QJPA 4HTJA 2IC3A 2HWTA 3KG1A 1RISA 1FKAF 1X9MA 1VQYA 2PN6A 1UL3A 4H4KA 2XI2A 3IS9B 2WBRA 1U1LA 4M95A 5AE3A 4HEA9 3FQKA 3PIOQ 4B3SF 1HNZF 2LCWA 1W25A 5IT4A 4H4OB 2WTFA 4HHJA 3KK3A 1R8BA 3GQCA 3PW4A 5K8OA 3PEJA 2IM3A 3KLFA 3O6QA 1U2RA 4I7FB 1GAOA 5B7WA 4ZVHA 3KHHA 4WXOA 3TA1A 2MY7A 3HVRA 4L72B 4ZP9A 2RMLA 3TANA 4DJBA 1YRTA 2CJ9A 1C0UB 2OPPA 2B5JB 5KFMA 3NCRA 2UVUA 1UVMA 4DS5A 2KN4A 4RWXA 1D3WA 4ZPDA 1RT7A 1REVA 5AXMA 4NA3A 4R0EA 2DIVA 1C2PA 2Q43A 3D28A 4DF8A 3MOJB 3G86A 3G96A 3MPYA 4J9RA 3T19A 1TUVA 2R7QA 3KG4A 4USHA 1YJTA 3N79A 1LWFA 2GGPB 1N6QA 5IM0A 5KFAA 1JIHA 3BQ1A 3O2IA 4KGKA 1JB0C 3CMAS 3RB3A 4OLOA 2DNRA 2VC0A 3EX7B 1S1UA 2VFSA 3MAQA 1RT6B 3SCKE 3V5RA 1KN6A 3NNAA 4TY8A 5A8KA 4KV8A 4I2PA 3V6JA 3PX6A 3MTKA 3N6MA 3O3LA 1LW0A 3CIZA 5E3RA 4OX9F 1KLNA 3BB5A 3HVTB 2HNDB 4IRKA 5IQ6A 4TNOA 2DNZA 3KLEA 1SL0A 4UW2A 1ZTTA 4CO0A 2KHCA 3VAFA 1KFSA 2W7AA 2FLLA 5AXKA 4KHPF 1CC7A 1TL4A 5D4PA 1X5PA 3G9CA 4G6VB 3NLCA 3H4DA 3T5JA 6FD1A 4XIUA 3M6WA 1Y3KA 1OIAA 5KT4A 2VB6A 3EGNA 5KG1A 3UNGC 5JVGQ 1LV5A 3KK2A 1FE4A 2RIJA 3IS9A 2GFFA 5IS2A 2R8IA 5DGAA 4IR9A 1PILA 3K8WA 4UOCA 2RRNA 5KFZA 2AJFE 3QGHA 2HNZB 2W4CA 4H4OA 3KHRA 2KH9A 2QA2A 2OD6A 2R8JA 3BSNA 3AQOA 1IKVB 2XULA 1Z2ZA 4ECTA 3VAGA 2ASDA 4YUDA 2E7XA 1KSPA 4LMZA 2OMLA 1R6YA 2PA8D 3V6DB 4YDXA 3M8PB 1KS2A 2BYCA 2FHJA 2DGUA 3K8VA 4OHXA 4UY85 1HYSB 3FGVA 4OJ3A 2CQ4A 3V6HA 1KVJA 4URGA 2IA6A 1FJ7A 4YB5A 1QAJA 1WHVA 2A18A 2M2BA 2WCXA 4MYTA 3IR6B 3PFEA 2GGPA 4D3HA 4NMLA 2FVSA 2FHKA 4C8KA 3P3DA 3TAPA 1U6BA 2RQMA 5A0YA 3OUYB 4DSFA 2DHSA 1H0HB 2XY5A 5T14A 3J80Y 2Q3PA 4C8NA 3OFGA 1VQ6S 2C3MA 1HBOB 2Q1LA 4ID8A 2JOQA 1O8BA 3LAMA 4CO1A 2C3PA 4ITSA 4RW6B 1HD0A 1S1XB 3LP2B 5M2UA 3MEEB 4IFVB 3PFOA 3DLEB 3HVTA 1U6ZA 3K2YA 2CQIA 3DC2A 3QPIA 2ZH6A 1YGYA 4NLSA 3MM7B 4ZCKA 3UW1A 2WK4A 3W3SA 3BGRA 1HI1A 3MMAB 1TL3A 1SKSA 4R25A 2F9JA 3MDFA 1HARA 2XG8A 2K3IA 5AXNA 4F3QA 4BS2A 2XS5A 1Q1KA 2KO1A 4EZ9A