2QA4S

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qa4S00
5HO4A 2DNNA 1VQMS 1X4BA 2F9JA 1VQPS 1VQ8S 3PIPQ 4CH1A 4YOEA 3DXBA 4TU8A 3CCES 5LJ3Y 1FJCA 2KFYA 3G6ES 3CC7S 3NS5A 2N3OA 2KM8B 3S01A 1U1LA 5GAGU 2LXUA 3U1MA 2YH1A 2OTLS 1YWXA 1QVGR 4TU7A 1H6KX 4W92B 1B7FA 2MKCA 1U1KA 2J0SD 3SMZA 1X4HA 2CQ3A 2E44A 2RT3A 3HI9A 2HYIB 1NU4A 2MSSA 1WHVA 3BS9A 2MSTA 3CPWR 3H2UB 2X1GA 1M1KT 3MUMP 2MQMA 1FXLA 1P1TA 2MKSA 2L41A 1YJNS 4C4WA 3S8SA 3FEYB 2KXNB 4YUDA 3N9UC 5CYJA 2G0CA 3VF0B 2KI2A 2K8GA 3J7ZT 2OSQA 2MKHA 2CQDA 2J8AA 1M5PC 2J76E 3CULA 1W2BR 2DNPA 2CPZA 4PR6A 4IO9Q 1FT8A 1WEXA 3UCZP 2X1AA 1URNA 2DNQA 1WWHA 2KXFA 4C7QA 1JJ4A 2AYMA 2LECA 3ZZZA 2KH9A 2BZ2A 4A8XA 3CTRA 4ZKAA 2XS5A 1DZ5A 1U1OA 1QVFR 3CCUS 5JVGQ 1SJ3P 2MZQA 1VQ4S 2DNYA 2A3JA 2DNHA 3PIOQ 4UY8T 3R1LA 2CPIA 3MD3A 2K3KA 1WI6A 2CQ2A 1M5VC 5D78A 1WHYA 2CPXA 1X4EA 1AUDA 1VQ9S 5GMKa 2DNRA 2XB2D 2N82B 1K73T 2QA4S 4Y00A 1L3KA 2RRAA 1D9AA 1WTBA 3UE2A 2MZ1A 3VAHA 2HGLA 1U1RA 3P3DA 3CF5Q 1VQLS 3Q2TC 3CMAS 3ULHA 1XN9A 1Q7YT 3DLLQ 1X0FA 1OPIA 3SDEA 2CPYA 2MZRA 1SJQA 1U6FA 3H2VE 3G9CA 3G96A 2FHOB 1VQ6S 4P6QA 2KXHA 3FEXB 2SXLA 2ADBA 1WG5A 2MQNA 2D3OR 1WF2A 2OSRA 5EN1A 5DM6Q 3VAKA 1JJHA 1OWXA 2CPJA 3CCQS 2MKJA 2M4MA 5HL7Q 1U6BA 2CQIA 2O3DA 5LSLA 2CQCA 3TYTA 2MQPA 3MUVP 3LQVA 3R1HA 4C0OC 3CCSS 2NZ4A 4FXWA 1VBYA 2LXIA 2LQ5A 1KC8T 2DITA 2KHCA 2KVIA 2KRBA 2RNEA 2YKAA 1SJ4P 5CA5A 1CVJA 2KT5A 1YIJS 2KYXA 2DK2A 3MOJB 3NMRA 3S7RA 2U1AA 3BEGB 3TP2A 2DNZA 2MQLA 3G71S 1U1NA 1F9FA 2DGSA 1NJIT 2DGWA 2DO0A 3CXCR 2CQGA 1OO0B 2MMYA 4WFAQ 2HVZA 3G8TA 1VQ5S 2MB0B 1WHXA 2XSFA 3ZZYA 1P27B 2L9WA 1VQ7S 3B4MA 2I38A 2OIHA 2D9OA 2V94A 4QPTA 3B4DA 5IM0A 1IQTA 1H2TZ 3CC2S 1UFWA 1HL6A 4ERDA 2JVOA 3MXHP 1A7GE 2AYGA 1M5OC 3G4SS 1X4CA 3VAJA 1X4AA 4U67Q 2HGMA 3MDFA 4RU2A 3LPYA 2MY7A 4CIOA 4WFNQ 2XS2A 2U2FA 4WFBQ 2CPHA 3IWNC 2OTJS 4CQ1A 3SXLA 2DO4A 4IOAQ 2RUGA 2MPUA 5LXRA 2G1DA 1U2FA 3VAMA 4LMZA 2CQPA 4J5OA 5JVHQ 3CC4S 1X4GA 2JWNA 2MKIA 3NS6A 5DDQC 4YB1P 2DNGA 4F02A 2CJKA 2EK6A 2PE8A 3EGNA 1X5SA 4WF9Q 4W90B 1NO8A 5CXTA 2ADCA 1R8PA 4Y0FA 3UCUP 4TU9A 2BOPA 1G2EA 2AYBA 5DDRC 1VQOS 2KN4A 2LEBA 2N7CA 1X5TA 1X5PA 2DIUA 2MHNA 1R8HA 1YITS 4TLQA 4PKDB 1QM9A 3MUTP 5BJRA 2DH8A 1KQSR 1DHMA 2LCWA 2GHPA 2M7SA 2QFJA 3MI7X 4OZ1A 3MURP 1D8ZA 2DH7A 3NNAA 4M5DB 2AYEA 2B0GA 2DISA 5DETA 2CQ4A 3CD6S 2X1BA 3THTA 2PEHA 4WIIA 3V4MA 2WBRA 3I55S 1WG4A 1ZZNA 2VOOA 2DH9A 1YJWS 4PRFA 2DB1A 2RQCA 2RS2A 5GAEU 1VQNS 1DRZA 2LA4A 2YTCA 3UD3P 2VONA 5H1SV 1S72S 1OIAA 1SJFA 3D2WA 2ZJRQ 2KRRA 1YJ9S 2MJNA 2UP1A 2YWKA 2XS7A 4EGLA 4OZ0A 4WCEQ 2KU7A 4QQBA 4LIRA 2M8DB 1M5KC 1ZZFA 2VODA 3NNCA 2EK1A 2DGTA 3US5A 3BO2A 2MZTA 1VC5A 4QU6A 2JVRA 3OW2R 3Q2SC 2JX2A 2MJUA 3NNHA 1HA1A 1FNXH 1KD1T 1YI2S 2M2BA 2MYFA 1SXLA 2CQBA 2DGUA 2MGZA 3UWTA 3J7YU 3L3CA 1YHQS 4ED5A 3R27A 5LJ5Y 2CPEA 1VC0A 2XNRA 4F26A 2E5HA 2MGZB 2Q79A 3CMES 1H2UX 3CCVS 2EVZA 2OJ3A 1FHTA 1Q82T 1N8RT 2LYVA 3CCJS 4V19X 2DNKA 2HZCA 1WI8A 2GO9A 1H2VZ 1VBXA 3MD1A 2CQHA 3BO3A 1K8AT 2M70A 1FJEB 1N54B 4F25A 2D9PA 2DGXA 2FC8A 1Q81T 3P49B 1U1MA 2M52A 5GADU 5DM7Q 1PGZA 3IRWP 3SDEB 1UAWA 2E5GA 1KOOA 2CQ0A 4QU7A 3CCRS 2QEXS 5FJ4A 2KM8C 1PO6A 2M8HA 1DBDA 2DHSA 2E5JA 1HD0A 2I2YA 1K9MT 3EX7B 5GVQA 2MQQA 1YTYA 2CPDA 3S6EA 5LXYA 3CCLS 2ERRA 2RU3A 1RKJA 1X4DA 2KG0A 3CCMS 1U1PA 3VALA 2DIVA 1WG1A 2DHXA 2M0GB 2AD9A 1SJRA 1N88A 2MKKA 2FC9A 1FJ7A 1JMTA 2FY1A 1WHWA 5D77A 5GAHU 2MZSA 2DGOA 2DNMA 2LKZA 1ZH5A 1KOHA 2DNOA 3RW7A 3EGZA 3JB9k 3P6YC 2LA6A 3VAGA 2L08A 1M90T 1U1QA 1VC6A 2MQOA 1WF0A 2E5IA 4FXVA 1X5OA 3UCGA 3K0JA 3G8SA 2F9DA 2FPHX 5IM0B 3I56S 4IOCQ 1S79A 2MXYA 2XNQA 5DDOC 1WELA 2X1FA 1N52B 2LEAA 2RQ4A 4CH0S 5DDPC 2ZJQQ 3UD4P 3HHNB 3THPA 2DHAA 4IUFA 2ZJPQ 2DGQA 4WKRA 2HGNA 2YH0A 3P5TL 3BO4A 5ITHA 2N3LA 3U1LA 1Q86T 5IQQA 2LMIA 1BY9A 2M9KA 3TO8A 1WEYA 2DGVA 2KG1A 1JJ2R 1WF1A 2MY8A 4Z2XA 1FO1A 4UQTA 3RW6A 2VOPA 2RVJA 5MLCV 2CPFA 5IFMA 1RK8A 2MZJA 2DNLA 2JRSA 1VBZA 1UW4A 2DHGA 4BS2A 2NLWA 1HD1A 2F3JA 1A9NB 1VQKS 3CUNA 2G4BA 3VAIA 1UP1A 1X4FA 2M88A 2J0QD 2CQ1A 5LSOA 1WEZA 2RS8A 4LJMA 1O0PA 2RRBA 3VAFA
chains in the Genus database with same CATH superfamily
5EGYA 3RG6A 1VQMS 2K1RB 4IR9A 3I31A 1RADB 1Y11A 3N6MA 5A0YA 4PG6A 3D6FB 4HI1A 4YS2A 2XSJA 5LJ3Y 5JJBA 3OLAA 3CCES 3G6ES 2CYYA 3I5CA 2XI2A 1TKTA 2NS1B 2RKIA 4LF9F 3G87A 3DOLA 1WOSA 2R7XA 1JLFB 1IBCB 3U1MA 3FK4A 4R8UA 1YWXA 2Q43A 5KFPA 2R2SA 1HKAA 4MK9A 2KFZA 1FF2A 1UL3A 2CZVC 2MKCA 3Q89A 4LF1A 3DYAA 4J9VA 2I5JA 3SMZA 2B8QA 2E44A 2B9EA 3RJMB 1Z1ZA 2NZCA 3VQSA 5CD4H 1VFJA 3HI9A 3T5KA 2HHUA 2FTRA 2HIQA 2KT2A 4EEYA 1TK5A 1QDUB 5HVGA 2XMTA 2CZ4A 3BS9A 4B3OA 1OS5A 2MSTA 3CPWR 1F9EB 4IQXA 2K3IA 3H2UB 2D1CA 3DFEA 1M1KT 1RWPB 2HK2A 1FXLA 4A46A 2A6OA 1NPPA 1GAOA 1ZETA 1J5OA 1JNRB 1B4SA 2IYIA 3MPWA 3MM9B 1PYOB 4QYRA 3S8SA 3FEYB 2KXNB 4WIQA 4FYYB 1N36F 4KTQA 5LMNF 3VF0B 2IRUA 2KI2A 1XQIA 2K8GA 3DRRA 3QQCD 4UZCA 5KFBA 4DF8A 4LF7J 4LBHA 2J8AA 4QR2A 3R5JB 4HYKA 2XGQA 1XMOF 1TFWA 1AROP 3CULA 4O44A 3FBEA 2DNPA 1TKZA 4K5SA 4P2XA 1KLMA 2X1AA 3T1HJ 4DWIA 3H42A 1MG7A 4J90A 2C28A 4DMZA 3ZZZA 2KH9A 4PWDB 3CNQP 2BZ2A 3W62A 3BYRA 2APOA 4RO0A 4Q8FA 3JQJA 1SJ3P 2MZQA 1VQ4S 4ECQA 1RWMB 5A8WB 4BHQA 4N41A 1SV5B 3M8WA 2BRKA 3MHYA 3RBEA 4UY8T 5HN0A 3TZYA 3R1LA 2R8KA 1UCNA 1RAFB 1S6QB 1WI6A 1LQ9A 1U47A 3PFEA 2YY3A 1F1BB 3HZEA 3BF4A 1P1LA 1WHYA 4Y3CA 5B0FA 4MYUA 1AUDA 4ED4A 2UUCJ 5J2MA 3AQPA 4YMEA 4ZN3A 1TMJA 1RHKB 3M6XA 3AQOA 2I1RA 2OPSB 1L3KA 4RLEA 3BPDA 3K5OA 3UE2A 1VDHA 2WSEC 4ATNA 3W61A 5HMYA 4I64A 2XLIA 4K4UA 2YKPA 2CXEA 1RXOB 3SBMA 4KGXB 5HATA 3PR5B 4FNIA 2R9LA 2BRLA 4ED3A 2ILYA 5I42B 1FRKA 3QLHA 5LMUF 5EHHA 4NZ0A 3LP1B 2J8SA 2ZD1B 3AOCA 3P3DA 3CF5Q 3OFEA 3DM2A 1SPBP 5ETLA 3M6VA 4MTPA 2QLFB 2QMXA 2XMVA 4C11B 4F67A 2V69A 2YKMA 1XN9A 3J80Y 3CMAS 3W9JA 5GAGI 2R4FA 1FDAA 2ZD1A 3N6LA 3WDOA 4ERDA 2MZRA 2V50A 3SDEA 1SJQA 3HHDA 1B7YB 1C1BA 1FWLA 2Z0GA 3GSDA 3HCXA 3HFKA 3LTOA 1FNMA 3QIDA 3DOMB 4QWBA 3UDVA 1RYSA 1VQ6S 1IR0A 4QW8A 4GC6A 3W63A 2F1FA 2W2MP 4FVCA 2KXHA 3JS9A 4NA2A 4UUWA 3T5LA 5L1KA 2SXLA 4R8UB 4DFKA 1M5HA 2E7XA 2ZWOA 2XY7A 3GQCA 3D3CJ 5KFTA 1FA0A 1O51A 2HZVA 2OSRA 4TY8B 4CO5A 1P8GA 5CYMA 1UFLA 3R5CA 2A6MA 3RB3A 1JJHA 4PXEA 4KHMA 5IV3A 3RBXA 2XWXA 2M4MA 5CYMB 3TAMA 4IFYB 2CQIA 1BWVA 1XEZA 4F3QA 2IBKA 3ET6A 2VG5A 2V4JA 2ALYB 4URGA 2WOMB 3FRZA 2B4UA 4HR2A 2MQPA 3DRSB 2B4OA 4OYXA 3JSMA 2ZH1A 3FBBA 1PG5B 4RBTA 5CH7B 2V4JB 2XEXA 3I9V9 3CCWA 1HNIB 3IR6B 3PACA 6FDRA 3PX4A 4ELTA 1R31A 2H5JB 3AFGA 3IS9A 5IXUA 2HIYA 2HWHA 4ZJLA 3RYLA 2XO7A 3HT0A 1VBYA 1T95A 1D3WA 1UWBB 2LXIA 3IWXA 1KC8T 3W3SA 1WORA 4F4AA 1BC6A 3TA1A 2VPZB 1XTZA 2CKWA 4CI0B 5CA5A 1M5SA 1K1QA 4HEA9 4DFJA 1VRTA 4O3QA 2HQ3A 3EM1A 1IQZA 1RLDA 3MCSA 4A4JA 4DZDA 1EKSA 2ZWPA 2F4VJ 1S49A 3CGIA 4I2PA 4ZP6A 2GJFA 1CBKA 2CUYA 2HFOA 4NCAA 2MEWA 1RT4B 1S57A 2Q6CA 3NMRA 3BEGB 3G71S 1A0OB 3M6WA 3VGVA 3MM7B 4K4TA 3M4XA 4TNOA 3I32A 3BREA 1CULB 2IAJB 3H98A 3FQLA 1F9FA 2P9GA 1REGX 3W5YA 1BQXA 1GMWA 1VLOA 2R42A 1S6UA 2CA9A 1JNZB 3KDNA 3NXZA 5E3RA 2YWFA 3KLGB 1FX2A 4UF4A 1MMDA 4X64F 1WHXA 2G1HA 1IBKJ 1KWMA 5B7WA 3SSRA 2V67A 4IFVB 4G1QA 2KJVA 1N32J 3ZZYA 5KFWA 2DD8S 2HVEA 3KJQB 2FGCA 2HAIA 4DG1A 4A8SA 3V6DB 5G4DA 3F0NA 2DR7A 4NL5A 3CEDA 2MLXA 2DY9A 3TNVA 1LWFA 2XMAA 2E5LJ 1RT3B 2I38A 2CG8A 4YY3F 4CLKA 3W60A 2OIHA 3KLVA 4LQ3A 1VQYA 4LRBA 1Q95G 1ZA1B 2PA8D 2ZZMA 3WC2A 1IQTA 1LWFB 2JHEA 2B43A 1KONA 4L72B 4MIWA 4ZLNA 3H5YA 4ELUA 4XDDA 1F9HA 5D6GA 1QE1A 2YX4A 1TU0B 2AJ0A 1JLQA 3GIMA 3NMAA 2AYGA 3BR8A 2V4QA 1TK0A 5E3PA 1S0MA 5KG6A 1X4AA 3MCOA 3VGSA 8AT1B 2N4DA 3MFHA 2XS2A 3IC1A 4WK3A 5F8GA 3GFXA 1TAQA 2OO4A 4C0HA 4CO3A 3FGVA 3ZFVA 1PIEA 1SQGA 4WFBQ 4ZPWR 3SV4A 2VG6A 3VZIA 4OYAA 1S4EA 1RDRA 3SXLA 3VGUA 2OTJS 5KOWA 4IOAQ 1E6VA 4I4BA 4IR1A 1JLGA 3C46A 2XCAA 3IBFB 1YRUA 3HF5A 1JXLA 2VBXA 1EHWA 1BQNA 3D3BJ 4P2MA 5HVFA 1SL0A 1TUVA 3HHLB 3ONQA 3MM6B 5L38A 2MKIA 1OSDA 1TVRB 2DNGA 3GFHA 4WU3A 1HR0F 3LH2S 1LV5A 1RAOA 2LDIA 3MGJA 5D4OA 1U8WA 4DBQA 1I6JA 1TL1B 3GWCA 1U09A 3AY0A 2OEJA 2R7UA 4NLDA 1RWVB 4JI2F 5EWGA 4OX6A 4WF9Q 2JLEA 3DLJA 2YNHB 2V6AA 3KHLA 1SB6A 3JSYA 4DL2A 1U0HA 1WC5A 1SIZA 3TAMB 2E7VA 2DRDA 2WHOA 1VRUA 2BOPA 1HBNB 3OTOF 2AYBA 1VCTA 4DV1F 3GE9A 4WFZA 1L3TA 1VQOS 3PYEA 2WW4A 3C19A 2XSJB 4F4XA 4HH0A 2LEBA 1EETA 1NB7A 1FRLA 2GO8A 4CYUB 4OYBA 4JI5J 1HNIA 1X5TA 1KLNA 1TKTB 5DQGA 4ECWA 3OR2A 1HWLA 3HSGA 5FLXU 4N56A 1YITS 2NXUA 3FCHA 3G8QA 2BYCA 4M63A 4FF4A 2YBVA 2AX0A 2W4DA 3J7Z5 4DR3J 4BDPA 1N32F 1I94J 4DQQA 3QO9A 3BPSP 3CXCR 2DH8A 1KQSR 2M7SA 3SCKE 4B17A 3PZPA 3MI7X 4ZS6A 1PYSB 3UFCX 4JI1F 2E1AA 3QO9B 4LRAA 3ET6B 3ZXWA 5HLFB 3ISND 3NNAA 2LLZA 3AA8A 3RAMA 2AYEA 2XMMA 4X4QA 5JMNA 1IKYA 1YK9A 3QSIA 4C3KA 1HWIA 5L8RC 3V4MA 4ZA1A 3QJPA 1RWNB 2YQ3A 3IFEA 2W4CA 5IS2A 1SC3B 4HT5A 2EKYA 3T19A 5HQ8A 5AJ3F 2MTLA 2BR0A 2VOOA 1PAEX 2DH9A 4B3RJ 2DB1A 4FN5A 3U1NA 2FHMA 4QIGA 3PG9A 2ZKUA 4DR3F 3H25A 2V8VA 2LA4A 2Z4PA 4MKAA 3OLBA 2EPIA 3OVAA 4DR2F 2QIFA 1S72S 1OIAA 2WONA 3BDEA 3ILOA 3D2WA 3Q8VA 1SKRA 4JB8B 3QGGA 1YBUA 4BWJA 3AD8C 3SSQA 3R7NB 4EGLA 1QAIA 4OZ0A 3T1YJ 2VDIA 2VKZG 2M8DB 1M5KC 5DLFA 2GVZB 3CJ3A 2H5EA 3M30B 2VODA 4YDDB 2XQCA 4WXOA 2DGTA 4OI2A 3LAMA 3CDAA 3W7BA 2B8PA 1S1VB 4NLRA 4RPFA 4TLRA 3BO2A 2MZTA 2PO4A 2JVRA 4USHA 2HVIA 1TKZB 2MJUA 3BB5A 4J9MA 5ETVA 2HLTA 2VV5A 2PIIA 2C2MB 4ELVA 5DG7A 2PEBA 3G82A 5HJYA 4MKYA 4DSEA 4PEOA 1BGXT 1ZOTA 4RUAA 3QWPA 4XK8C 4O0NA 5AXLA 1RHJB 2GA7A 1S6PA 2RRNA 2CPEA 4QR0A 5LJ5Y 3X1LB 3W9IA 1S9GA 2Q79A 3GPAA 4X62F 4DS4A 2OPSA 5IZHA 3RB0A 4ZJOA 1KRPA 2IJRA 3CMES 4A8FA 4PUOA 3KNAA 1DTQA 1CJUB 3B8HA 1Q82T 5J2NA 1EQMA 3ADAC 4PUOB 4X62J 3PW5A 3QYYA 1OSCA 3H5UA 4DFMA 4ZPTR 2HZCA 2I0XA 4GRSA 3VHQA 2E66A 1BLUA 1WI8A 2AGPA 2IM0A 1UVNA 2QSWA 2BJ7A 2W1BA 1LNQA 4U96A 2JEGA 1KTVA 2D9PA 3DU5A 1IN0A 2CAJA 3HK2A 5KFSA 1Q8KA 1RLCL 3F44A 4KSEB 3MPDA 4ZITA 2Q1LA 2WSCC 4KH0B 5ETQA 2R2RA 4IRDA 3MMBB 5KFHA 4OZ3A 3ZTRA 1NZ8A 2M52A 2E1RA 5KFJA 4NCBA 1RJJA 3HZGA 4OYIA 2V9KA 3QT5A 3IRWP 2HEKA 1BXNA 1EB0A 1JLCB 2JEIA 5A8RB 4DQPA 3DRXA 3PNIA 4USVA 3PO5A 1V5IB 1Y00A 2R8GA 5FJ4A 3BN4A 3W2WB 1F2GA 1RT7A 2QLWA 4MMOA 2KZMA 3BH7B 4MK8A 4Y34A 1T8EA 1Q8LA 1K9MT 3EX7B 5GVQA 5GAHI 2CPDA 3S6EA 4J9NA 3BSNA 4DU8A 2ERRA 3KK1A 3TRGA 5H9FK 1U25A 4I67A 2FB0A 2ZH2A 2KG0A 3I96A 4JBCA 4RWWA 3DI6A 2DIVA 2MKYA 1V9OA 1HWUA 2AJ4A 4GKJJ 2VC1A 3RB6A 2AJ2A 3RBZA 4E2FB 1SJRA 1N88A 2YKOA 3R7SB 2ZNZA 2FC9A 4AT1B 4DV0J 3J81U 3QIPA 1FJ7A 2LXFA 5D0GA 1B0VA 4CLWA 3LO3A 1IKWB 1WJ9A 5HAOA 2W9AA 2NR0A 3BYPA 2MZSA 1CC7A 1T9YA 1Q4RA 5DZ7A 2C2OB 2FVCA 2R3VA 4OI0A 5F8NA 3LAKA 1O6XA 1R0AA 3SQOP 2B7CB 1BE4A 2BJEA 1KOHA 2DNOA 3DKDA 1U2CA 2HBQB 2VJUA 2PA3A 4PXCA 1B0TA 4M5HA 5EUHA 1T9WA 3MPVA 3JB9k 2AEMA 3VAGA 1RAIB 5KOXA 3GILA 1NM2A 4AXIA 2LP4A 3EICA 3H4DA 2D3UA 2RHSB 4I2PB 3ENVA 2D41A 5IC6B 4ANCA 1BD6A 3OD2A 3OTEA 4ZPCA 2RQMA 3G8SA 2Z2LA 3BR9A 4I2QA 2FUG9 4BCAA 5KFVA 2G2ZA 1P6TA 3NEKA 3NLCA 4IRKA 1XIQA 1FE4A 3QPIA 4IOCQ 2MXYA 4LRCA 4PABA 5KG7A 5DDOC 3KHHA 2D74B 4PAAA 4CM2A 4QPXA 4J91A 1JLAA 5LMUJ 4C6AA 2H9ZA 3I9ZA 4I1TA 4ETXA 4DL7A 4RW4A 1RP5A 4NLYA 1CJVA 1FRJA 3UD4P 3THPA 3HHNB 3OVSA 3HHEA 4OJHA 4Y2AA 1NK5A 4C8MA 3UO0A 1G1XA 2IBOA 1RT5A 1SUQA 3M2RA 3U02A 4XPEA 3SCIE 2N3LA 1YJUA 4LR9A 4ZCKA 2JL9A 2BJ1A 2Y3YA 3I87A 4F4ZA 3BQ0A 3Q24A 3FJ2A 5F9NA 5JUMA 4Z37A 4QWEA 3VVTA 2OD6A 1WEYA 1YZ7A 1S6PB 2DGVA 2ZOFA 1OYEA 3TO8A 3ZZTA 1OYDA 4Z2XA 2KG1A 2HNZA 1CQMA 2RVJA 3H0PA 4Y28C 2UVWA 3TZXA 1DFDA 1S10A 5IFMA 2MZJA 2WVFA 3SCJE 4ALZA 3UNGC 4Q44A 2DHGA 2EFNA 3NBPB 1U48A 2HS3A 4OX9F 3TUPA 1WOOA 2C3UA 2YWEA 3EVMA 3M32B 3GTYX 4K4VA 2F3JA 3DN9A 4CP5A 1AUSL 3OT9A 2HQFA 3DCAA 1A9NB 3CJQA 3GMGA 2JH3A 3VAIA 3BDPA 3SSSA 2M88A 3E01A 2YKNB 1MMNA 2JLFA 3FFIA 4QCLA 4X4VA 5LSOA 1WEZA 2V2QA 3C6TB 2RS8A 3NOCA 1FKOB 1FTRA 3KDOA 3R8YA 3WZ0A 2VQFF 4WPAA 2LVWA 3LUYA 4K4XA 1O0PA 2RRBA 5HROB 3VAFA 4DV4F 4C8NA 3M9MB 2Y1IA 2QGFB 1YBAA 3CO0P 1X4BA 3EXCX 4KIAA 4CLFA 4DV1J 3R5GA 2QTWA 4F04B 1AA1B 4CH1A 1VQ8S 2PMHA 4F8RA 3FKBA 4XO0A 4TU8A 2VG7B 4DR5F 2HQGA 2V2VA 3QSYB 4XAKA 1H7XA 3QT6A 4WBFA 4NYZA 1HBUB 3GFYA 5K8OA 4J9KA 4NCGB 4ZVQB 2W2OP 3CD0A 4XDCA 1RHRB 1T03B 2JSXA 1TK8A 4OHZA 2ZUGA 2ZUAA 1U02A 3IGNA 4G6VB 1IKXB 4KFBB 3UR0A 4TU7A 1RBAA 3V81A 3WIUA 1QVGR 1U1KA 4BC7A 1N5TA 4DV5F 4IDKB 1F6TA 4XTTA 2D69A 1UVJA 2E1MC 1AXQA 2XMUA 2L48A 3HX9A 1NMEB 3BGRB 3MEDB 1VRTB 3MM5A 2AEFA 3HVRA 3MTJA 3TUZC 2J0XA 3M8PA 1ULRA 5K8MA 4DR7J 3MUMP 2MQMA 5HLFA 4DUYF 3HMJG 1SL2A 1VHIA 4LFBJ 5L1LA 4NOHA 2BM0A 4FKXA 2V2ZA 5DS7A 5CZXA 4C4WA 4CLZA 4JI3F 3PJWA 4CM0A 1T9VA 2E9ZA 2H65B 1CEZA 3ICLA 3A12A 1LWCA 3AHPA 1TL5A 4I7FB 4JOUA 3CW2C 1FKPA 1KTQA 2ASYA 2COLA 2IRYA 3ILIA 2AKWB 3K5PA 2HFSA 3Q0AA 1A6LA 1FK9A 1YG0A 5HMXA 1FEEA 1RTDA 3M8QB 2JNJA 5I3QA 1T7PA 4B3SF 1HQEB 2CPZA 4CCHA 5CYQB 3RR8A 4RUHA 3UCZP 4N77A 3N28A 1W25A 1WWHA 1TL4A 2HG4A 4D3GA 1NRKA 2Y1RI 2AYMA 4C7QA 2Z57B 4KH1B 4DCOB 4A8XA 3CTRA 4ZKAA 3PW7A 2LFVA 4ICLA 5K14A 1DZ5A 3CCUS 3E3XA 3IMQJ 3N5BA 4BC9A 2XWYA 1N0VC 1R8BA 4ICLB 1M0SA 5K14B 5KFAA 1QSSA 2ROGA 3I4HX 3C66A 5CCLA 5IQ6A 2HHQA 5A6WA 2CPIA 2VBYA 1B70B 3C15A 3KK2B 2GVZA 3K2YA 3AOAA 1KSPA 3KUEA 1OPZA 3D54A 2CPXA 1NHUA 4KAIA 3K58A 4Q8EA 5ADZA 1E6VB 2AJ1A 2DNRA 4DV6J 3WBZA 1RT5B 3M2RB 1NBEB 2XB2D 4ZHRA 4H54A 1K73T 2QA4S 3AJ1A 1F5CA 4TYBA 5J2MB 1LWXA 4Y00A 3DLBA 5HJXA 5SUHA 3NGRA 3IN5A 1BWEA 2RIJA 3AT1B 1KQGB 1C1CB 4DPOA 2MLZA 4NLWA 3OPKA 3I0RB 2CDRB 3VAHA 4DQSA 4OYZA 2HGLA 1KDNA 2YXLA 1WKJA 3MMJA 3OXGA 4KYZA 4MAKA 3T1AA 3OHAA 4DR7F 1AFJA 1KEKA 4UOGA 3TJ8A 1DTQB 2D3ZA 4WU2A 4ZIVA 3Q2TC 2CZ9A 5J2NB 2JC0A 2LQBA 3OVBA 5K8NA 1XWLA 4G3IA 3UD5A 4L75A 1U6FA 1CJKB 3KFWX 3G86A 2W24A 3N4WA 4LF2A 4NCGA 3EZOA 3G9CA 1WKKA 3KUGA 4MH8A 2W9BB 2QA4G 2CRLA 2K1RA 4ZPAA 3MF5A 3FEXB 1C1BB 4CLPA 1IKXA 1WG5A 2HWIA 4KFBA 2MQNA 4L3KA 4U95A 2D3OR 1HW8A 2XTJP 3C14B 3IM9A 4B9NA 1WF2A 3KLEB 3LP0A 4WP3A 1G7CB 1UJ6A 1IBLJ 3EDQB 5D0RA 3CCQS 4DL4A 1FJGJ 4DR4J 2M3DA 3NKYA 2IPOB 3J7AN 3BM7A 1MNEA 1BMQB 4NASA 3UW1A 3ZNUA 1UZDA 2H1YA 2VF3A 2O3DA 3GJQB 4ZMMA 1GH8A 1LK7A 1GXUA 3PHTA 3EXYA 3MUVP 1JX4A 4KGVB 4YFUA 2NREA 2OFGX 3LQVA 2IVMA 1NSKL 3IGVA 4LREA 3MTKA 5CHCB 4C0OC 2B5JA 2VQFJ 1HBOB 1M1GA 4ECVA 1WD6A 2UVUA 1ZM4A 2C2KB 4WTOB 5E41A 1RWUA 3OUYB 3CCSS 3CMQA 3EGVA 2Q66A 2NZ4A 4RNNA 1FFWB 5A2QU 1GMVA 1AZSA 2RB7A 1L3VA 4CTAB 2WB1D 2YKAA 5DO2A 5KT4A 2W8KA 1HWJA 3TX0A 1SJ4P 3KLGA 2C2ZB 3PYFA 4DX6A 1KBRA 1OJ4A 1YIJS 4F4YA 2DK2A 2GVDB 4LT6A 3UDEA 2Y9HA 5CYQA 1L5UA 2CJQA 1U1NA 1YJ7A 4NEZA 3HKWA 1RT3A 2DGSA 2DO0A 2CNNB 2C3MA 2OD4A 3AJDA 2CJAA 4P71A 2NPFA 1H73A 1H72C 3WX8A 4CLSA 4O4GA 2ASLA 1Q53A 2HVZA 2MB0B 4ZVHA 2V9WA 2IYGA 1NK6A 3E2EA 5C2GA 2EKNA 4IRCA 5EWFA 2F4FA 5KFDA 1MN7A 3IAM9 2XSFA 3MPUB 4M5GA 4MFBB 1MW7A 1P27B 3HD1A 7FD1A 2UXDF 4TKTA 2HW3A 2C3PA 2HFNA 4DS5A 1TMMA 1VQ7S 3GV7B 2OPPA 1S97A 5EDWA 4TQRA 1WSRA 3JTPA 4LRDA 2EFVA 2UZAA 4M1KA 1S9EA 1SBRA 2EW9A 3D6MB 3TR5A 4QPTA 4GKKJ 4DR6F 3UN5A 1KR4A 1R6VA 1S1UA 1UFWA 3CDWA 1HARA 4PWUA 1HL6A 4QBUA 1FI4A 4DI6A 3M8SA 4O3OA 3MXHP 1N56A 2VQEF 2WVEA 3HP6A 2RUSA 3D0IE 3QMQA 4U67Q 4EYHB 1PC5A 4WJBA 3CSKA 2HKEA 2Z30B 3NWGA 4KE5A 4WFNQ 2U2FA 4OZJA 4KPYA 2VFRA 3IWNC 1RISA 1XNRF 2F5GA 4DZ6A 3J81j 5ETTA 4ZVGA 4OHYA 3BQ1A 2K7KA 1C4AA 1SCJB 4C11A 2PN6A 4GVBB 4LBIA 4USJC 3W8GA 4DDFA 2GQ2A 3PDNA 1U2FA 3VV2B 3VAMA 3T3FA 3PRBA 1XR7A 1EP4B 2QN6B 4NRTA 1HNWF 4H4MA 5DDQC 3FUYA 4OLOA 1Y9OA 3DOKA 4IG3B 2O66A 4F0MA 4ECXA 2ZH9A 3GB0A 4O3NA 2CJKA 2EK6A 5C25A 2PE8A 1SC6A 4B08A 1QSYA 4CYUA 2ZE2A 2WZ1A 2CJBA 3FBFA 1RTHA 3AB2B 5B0DA 3HJFA 2GV1A 5CXTA 5D4PA 4DEZA 4XPCA 4FVMA 1R8PA 3VCDA 3ZTPA 4AL5A 1Q8BA 2VFVA 1TTHB 2YNHA 4A8YA 1RUSA 1U24A 2WVBA 1U0HB 4OQJA 3ZNJ1 5DDRC 3M32A 1HPZB 4J9QA 1LKZA 4JI8J 4U8YA 3CCZA 4FP9A 2QSFA 3HPOA 4X4PA 3LP1A 5AE1A 1HNZJ 2E1CA 2PMZD 3KKFA 3D1QA 2W7PA 1NJZA 4O23A 2FJXA 2HS4A 1S1WB 1HBUA 2B9YA 3H2LA 1R8HA 3IR7B 2RD5C 4PKDB 4NXMF 2FZCB 2PFFB 2BANA 3HSZA 2FLNA 1AZSB 2A10A 1TAUA 3QRQA 1DY3A 2J5AA 3A8EA 1X9MA 2OH2A 4HDGA 2QFJA 2GHPA 1F5AA 3PYDA 4B3TJ 4HHJA 4DSIA 1N4LA 4OZ1A 5KFGA 1R3NA 1D8ZA 1FRHA 1SH3A 4R0EA 2EI5A 4C98A 2ZDPA 2HVDA 3QGPA 1IBMF 4ID5B 1N34F 2DISA 3QT7A 2HAFA 2QRRA 1CULA 2IAJA 1PSDA 3IO1A 4LVNP 3LGMA 4ZOSA 4M5JA 2VASA 1RTJB 3THVA 4G1PA 1DAXA 1SH0A 4F4KA 4U7UD 1YSJA 2WBRA 2NPIA 3JSMB 3I55S 1W7WA 2AF6A 2ZNYA 3OXFA 1RTJA 1WG4A 1XR6A 5B0CA 4AL6A 1ZZNA 4I69A 3OBIA 1JIHA 2ATCB 2R8IA 4ECRA 4R25A 4DL5A 3Q8SB 4F2RA 3QRPA 4PRFA 4OZ5A 3V6DA 2H3EB 3MOZA 1QUVA 2Z2YB 2P9CA 3MEEA 1S0VA 1SL1A 1Q5VA 1UEKA 2B9WA 2I8EA 2J9DE 2YTCA 3KXDA 3PRDA 4N8OA 4C3MA 2ZHOA 3UD3P 3NS7B 3PFOA 2R7OA 3NWRA 4FKYA 4B3OB 4FDFA 2KRRA 1YJ9S 5HP1B 2MJNA 1NH7A 3OR1B 1X9WA 3UI3A 1K0TA 1X31C 1G4CA 2N7YA 1NB2A 3PCOB 1PJ7A 2GIFA 1CS4B 2KU7A 2X51A 3IP0A 4YR2A 4LIRA 2FYXA 3G82B 1NK0A 2AEJA 2KDOA 4JYAJ 4DPTA 2RSQA 1E6YB 5KAKA 2UXDJ 4X4NA 4CT8A 5GAEI 4NE9C 3US5A 4RNOA 3QZ7A 2DPJA 2JJ4D 4DR5J 5HK4A 2XCPA 3OW2R 4V1Ak 4O3SA 5KFKA 1UEUA 4LF7F 1SQEA 2GGPB 2JX2A 4R5PB 2R8JA 4FXDA 3NGSA 1JLGB 1FD8A 5F8HA 1WKLA 2M2BA 4ZVOB 1N6QB 1AW0A 1RBLA 1XMQF 1N36J 5F0UA 2LEPA 2B6AA 3T1YF 5F8LA 2MGZA 1SC4B 3J7YU 3H7HB 3OL8A 3L3CA 1S9FA 4ED5A 4QIWD 3GCWP 3HO1A 3ITHA 3HSJA 4YEAA 3F56A 2XNRA 4F26A 3TARA 1TR0A 4U8VA 3DRPA 4C8ZA 4K4YA 2CJYB 1V3ZA 5GADI 3CCVS 1HLWA 2YNFB 1FEHA 3OTBA 4U9RA 4PYAA 4X65F 2FJBB 4RX6A 1BQMB 1ZAWA 3A8JA 4UOCA 3O1LA 3LALA 2PI4A 5A2QY 3N01A 3CJKB 4QJVA 4F50A 4LFCJ 1DLOB 4PG4A 5I3PA 1UVLA 1HHQA 2RF2A 3D6HB 2GO9A 2ZBPA 4QWCA 5E33A 1VBXA 2DEJA 3CJKA 3H4BA 1YZ6A 4NWBA 1N54B 1RA7A 2GQQA 4F25A 3UDCA 3J7YI 1EETB 2GIQA 1DQ9A 1N5SA 1Q81T 3DOMA 4JV1A 2ZZTA 3HVTB 4LF9J 4OX8A 1R27B 2CG4A 5GADU 3LP2A 1QSLA 1LXJA 1XJWB 1TUWA 2OPQB 1UJ4A 4I6YA 3DNCA 3OR2B 1KOOA 3W5XA 3AXKA 4K5RA 4LSNA 1D9DA 4QU7A 4JI0F 2KJWA 4MYTA 3UNYA 2F8EX 4ANEA 4KRWA 2QEXS 4WTYA 4X84A 2E1PA 2M8HA 3SYZA 1PO6A 4C8LA 2E5JA 3ZZUA 4WP9A 3T5JA 4LF5J 1JLEB 1RAJA 3TEGA 4LVOP 1NK8A 4X66J 3FSXA 1YTYA 1N0UA 4YR3A 3H5XA 5AT1B 2UVVA 1UVKA 1K1SA 2DTJA 4DQRA 1U1PA 5AE3A 1DJ0A 1KN6A 4URQU 2QLBB 5AXNA 3C3LA 2CNKB 1WG1A 1EKRA 1EJ7L 2K7JA 3RB4A 3M2UA 2XY6A 4GC7A 5CD4A 5EWEA 4IFYA 4P10A 3LGNA 4ZN1A 4GMKA 4ID5A 2P6TA 4X66F 2FY8A 3PW2A 2PI5A 2WOMA 3DRRB 3M8YA 1DQAA 3H59A 2CADA 3OL6A 4FBTA 3V4IB 5DRKA 3BGFA 2DR8A 2FVQA 1NH8A 2IIHA 4HACB 3LF0A 4DR1J 2FVSA 2LU2A 2DNMA 4ED8A 2C2EA 1VR6A 3GONA 4DN9A 4HACA 4OYWA 1ZH5A 2P5VA 4S0MA 2AQ4A 2UXCF 4Y2KA 4QYZJ 4NEYA 5K20B 4LF8J 4K7QA 2H5IB 2XO6A 4ECTA 3I0SB 2LA6A 3W2VB 3Q8PB 1E6YA 2L08A 1HNVB 3TI0A 5KFCA 2ASJA 2V4RA 1VC6A 1FXRA 4NLOA 5ETNA 1TL7B 3EWGA 5D3GA 3FRYA 2E5IA 3KK3A 4FF1A 4B9VA 4FXVA 2EFQA 3JXOA 4RW4B 1MN9A 4NX9A 1RE1B 3AB4B 3K0JA 1FFGB 2F9DA 2HZAA 3AJ2A 1H0HB 3JSBA 2C1EB 4ZLLA 3BN7A 3J7A1 4PQUA 2L3MA 4P52A 4RUCA 2B6AB 3OFHA 1JQGA 4UQGA 1T11A 3N0VA 1SKSA 1G6BA 1RAGB 4O4GB 2DCLA 2JLGA 4TXSA 2IDEA 2C3YA 4J9UE 2R7WA 2AJFE 3SZ2A 4C97A 1WELA 4RW9A 3UDLA 2NXCA 5CCMA 2HRYA 2G2YA 2NXNA 3LPEA 1NSPA 4AXJA 2RQ4A 4CH0S 3KK2A 3CJTA 2ZJQQ 4DG1B 2HPUA 4DPUA 4DU7A 1U4BA 1R7IA 4JI6F 1N5VA 3OL7A 2ZJPQ 4OL8A 1BQMA 2R7QA 2ABYA 3PJXA 5T7LB 5K5MA 2FLOA 4DQIA 1YGYA 1FD2A 2YH0A 4RNMA 4YHHF 1Q7LB 2PFDA 3P5TL 3PJ9A 5D15A 2NSBA 3KJVB 2A2CA 5D4LA 3VR1A 1XMQJ 2OEKA 1S6QA 3U1LA 1W26A 3FDSA 2ZH8A 3BZQA 1Q86T 2IJFA 1QAYA 4X64J 2ZBQA 4AYBD 1IBKF 4LF6F 4L3NA 5G0RB 3P8BB 2M9KA 3CDBA 4P75A 2L9DA 4YDXA 1JJ2R 3V6JA 2QLJB 4FPRA 3HXMA 2W7AA 3FC9A 3G2XA 4OV6A 3KUHA 4NXNJ 3DDNA 3G6VA 1RK8A 3AAWB 1HFEL 2JRSA 2DNLA 1RCOB 4UOFA 2I9SA 3HT3A 4PG5A 1NK7A 4BS2A 1RB0A 2L9NA 1N33F 3TZZA 5C42B 2HHHF 2P9EA 4ED0A 2QA1A 4LSNB 3CUNA 2G4BA 1Q5YA 2ALZA 2HRUA 4K0KJ 4LFBF 4CH7A 4H4OB 4FPIA 1X4FA 2AP6A 2J0QD 1VGYA 1LW2A 5I4MA 2VPXB 4ES3A 9RUBA 3I5AA 1MWQA 5L9XA 4LJMA 3RRGA 3HVTA 2VG5B 4DV7F 1RT1B 1CC8A 3BKUA 3PW0A 1IKVA 3OTCA 5KFRA 5DGAA 1VK3A 1FKOA 1GXTA 3D1HA 2DNNA 5IT9U 2W2QP 2W9CB 3ZO7A 3SFUA 4CNZA 3DXBA 3DU6A 3L95X 3VWSA 4KGMA 4RW6A 5IWAJ 3KLHA 7AT1B 2KFYA 1FJCA 3NS5A 3PKYA 2KM8B 2DR6A 2ATLA 1U1LA 1FDNA 3TJ9A 2LXUA 3G6XA 2HNDA 1S7HA 2BACA 4Q0BB 1H6KX 1VYAA 5KG4A 1HNXJ 4W92B 4KKOA 1B7FA 1DARA 1VJWA 1YRXA 2BW7A 4B3TF 1YVFA 3RW6A 4XIUA 1H38A 1ZBTA 3NAIA 3MM7A 1NSQA 2HFVA 4FS2A 4JI6J 3C2PA 2RHQB 3HHLD 3PVXA 5FIIA 2MSSA 4IDKA 1RABB 1Z2ZA 3I0SA 3W2VA 2IM3A 5ETOA 1EAYC 4LF5F 2BKNA 2QMWA 1C0TB 2LQ9A 4NYPA 4USTA 3SFGA 1N5YA 1QAXA 4EI2A 3QJLA 2BKPA 1ICEB 1P1TA 2AZ1A 2MKSA 4W4MA 1RTDB 5KT7A 3V2UC 5BR8F 2L41A 5B0BA 3O8WA 1UMJA 1G3OA 2O5DA 4OI4A 4X2BA 1HMVB 3GYXB 2FJEB 3E8OA 2OHDA 3N9UC 5HBMA 1MLAA 3EJMA 4B3RF 3KLFA 1RHMB 3DLEB 1RHQB 2OSQA 3P4UB 4LRFA 4DOZA 1LOUA 2GNKA 1OMSA 2CQDA 5KT5A 1REVB 1VIXA 2J76E 3W5ZA 4P9SA 5DZ6A 1CS4A 3EMTA 1LW0B 4NI2A 4UZBA 1QE1B 1F5BA 1W2BR 4PR6A 1JLQB 4KGKA 1YJRA 3EUNA 1REVA 3MM9A 1C0UA 2WBMA 4PWWA 4RKUC 4AFFA 5A8KA 5D3GB 1VOMA 4USWA 2QC3A 5T7LA 5B08A 2YX1A 1OY6A 2UUTA 4A8KA 1JJ4A 2BDPA 2VUGA 4RW8A 2XS5A 2HFUA 2XZWA 5GMEA 1LWEA 1RWOB 5KFZA 3RGIA 4YQWA 5JVGQ 1VJQA 1B3TA 1QVFR 3NCQA 4QWDA 4DPXA 2DNYA 1GEHA 4O44B 5E5NA 4AQYJ 3CE8A 4Z7CA 3EGWB 1SKWA 1I94F 3ZTSA 3Q8YA 4ECZA 2Y0BB 4B3MJ 3TVKA 3MD3A 4MJKA 4L74A 3ZTOA 4D3HA 4F36A 3J81Y 4WK1A 3RUBL 3T1HF 3DLKA 3DHXA 3C8YA 1WC3A 2RQKA 3MR7A 4BWMA 5C2CA 5J1EB 4ZIWA 4ZP7A 3DRPB 2ZHAA 5M2RA 2BQUA 4DUTA 1GQEA 1AT1B 1MWZA 3GP9A 3Q86A 1XMOJ 1S1VA 4K8RA 2O01C 2OGUA 3L7OA 2R2UA 1CQNA 5J1PA 3QZ8A 3AODA 2N82B 4CLTA 4DCJB 3UPFA 5L1IA 2GAHC 3NOGA 4M95A 2RRAA 1D9AA 3FFIB 3CIZA 3H8YA 3QATA 1UA1A 4G1IA 4UY85 5E3QA 4M5LA 5B0EA 3O44A 3PYGA 4ZVTB 5KFUA 1VRUB 5CQGA 4J9PA 2UV8A 1RT1A 3GYGA 1WC0A 4DUZJ 2VD3A 4ZLJA 1C1CA 3E01B 2QL7B 1HR0J 2GJ2A 1U1RA 1SI9A 1PBAA 2DXEA 3IBCB 4C8KA 1VQLS 4DSJA 2EBEA 1NDKA 4QYZK 3DLLQ 1X0FA 2BUNA 4K0KF 2CPYA 1B99A 5L1JA 1TL3A 4K59A 4UUXA 5GMDA 4JI7F 5JXSA 2UUBJ 1O5JA 4DV0F 5DG9A 4OHVA 1WUUA 1V6HA 1CJKA 3DRSA 1CG2A 4WYWA 2ADBA 1RSCA 4GKJF 3IA0A 1VQSA 1S1TA 2MQ8A 2BBEA 3ISNC 3MR2A 4NXNF 2QX0A 5KT2A 2R7SA 5EN1A 5DM6Q 1NKBA 1OWXA 2CPJA 2QYGA 3D0GE 2ZOMA 4CO0A 4C2MA 2MKJA 3KK1B 2W9CA 2VA2A 1R6YA 1V3SA 4MIAA 1U6BA 2XI3A 2QG9B 1T9UA 5LSLA 2V8GA 5ETMA 2CJ9A 2V0NA 3QAUA 2YNGB 3GIJA 3DYAB 5KFFA 4ZVFA 3DLHA 2DHHA 1C2PA 3OXLA 3R1HA 2IDLA 4DSLA 4K4SA 4KPCA 3K17A 4TVAB 1Q0NA 3EPGA 3HD2A 4DF4A 2YNGA 2IRXA 3KJFB 1QLNA 3QIPB 4I0WA 5H9FJ 1OQ3A 3FSIA 2H54B 1PAUB 2PGCA 1U45A 2HNYB 4EUVA 2B4VA 2DITA 2E5LF 1RT2B 3OUYA 2RKIB 2J6UA 1UW9A 2KVIA 3BV8A 1RCXB 5F9LA 4KC5A 2FLLA 4HI2A 3OTDA 3GZ7A 3NGDA 2IMWP 1JLFA 2UU9J 3EDRB 4DSFA 1JKHB 1CVJA 2MHEA 3AXMA 1IKYB 1RU1A 5ETSA 5C24B 1S76D 4IYQA 2FLPA 1R0BG 4KGZB 4X4TA 4L6V3 4DL6A 2KYXA 3MEEB 2JEJA 3MOJB 1IR2A 1PYTA 3GIKA 3K5NA 1GMUA 1D09B 1PC4A 2V63A 1T02A 3CJ8A 2DNZA 2MQLA 3FCWA 1FKPB 2AW0A 2IC3A 2RMLA 4RNHA 3TOQA 3W66A 2DPIA 2QZ8A 1NJIT 2EFGA 4PXDA 2VFTA 2LU1A 3C16B 2AWZA 4J37A 4PCQA 5L9NA 5KT6A 5DLGA 1RA6A 1JLBA 3I5BA 1HI0P 2BVZA 3BSAA 2GMHA 1R43A 3ELHA 1NSAA 3NCPA 3O5TB 3DXSX 4U7UK 3M2VA 3OL9A 3SEOA 1GX6A 3B4MA 2XHCA 4LFAF 4ES2A 2RJZA 5KFLA 2HQDA 1HQUA 2D9OA 2QL5B 2VBWA 1QUPA 1GK8A 2GZOA 2NUHA 4R0JA 5A8WA 2Y1JA 4LSLA 5IM0A 1EX8A 3NGKA 2HMIB 4ILMA 3NGTA 1K44A 1NLKL 3M8RA 3DGPA 2VG6B 2ZITA 2DXDA 4IFVA 3W8PA 4L76A 8RUCA 2VHGA 2W25A 1GTEA 1PILA 1RAHB 1LK5A 1A7GE 1N34J 1M5OC 2HFZA 3VAJA 1X4CA 2X3DA 3GIIA 1X0PA 2YX7A 3CIMA 4A47A 5F8IA 2VIHA 1CPZA 2ZH3A 3ILJA 1GNKA 1GT8A 1AYEA 2MY7A 1KFDA 4B9SA 4BBYA 1TVRA 3U7JA 2VQEJ 2HQIA 2Q3PA 3VQTA 1RAEB 1Q78A 3B54A 1LEOA 4CWBA 5C25B 1RWWB 3IRXB 2DO4A 1UZHA 2RUGA 2MPUA 3HFZB 4CT9A 3W64A 3MM8A 1CSJA 1NEEA 2CWKA 4NXMJ 3C15B 4LMZA 3M7VA 3MMBA 5JVHQ 5E3CA 1YJTA 4NLGA 4V19J 1X4GA 2JWNA 1SC1B 2XG8A 3NS6A 4DR2J 3A8KA 3CJRA 4OZ2A 3RBDA 4K4WA 4YB1P 3K5MA 4F02A 2UV8G 1UA0A 4DSKA 4NLQA 2E9RX 4X4SA 1WSVA 3K8WA 4H4MB 4DL3A 3EGNA 2OAUA 2QMUB 2J9EA 1S77D 3M1VB 3KLEA 1HHSA 1CJTB 2F8MA 3MMAA 5LOQA 3QT8A 2JZ5A 4ZP8A 1NJWA 1NO8A 1NUEA 2OPQA 5LSRA 2ZE2B 4LF4F 5HROA 3TA2A 2XMWA 4DCPB 1U8SA 2J7WA 1WACA 2BX6A 8ATCB 1IUJA 3DOLB 4Y0FA 3JSRA 3Q22A 3BQ2A 3CD5A 4MKVA 1RI7A 2VZ9A 4TY8A 3BJYA 1X9SA 4JI7J 2IMOA 3LANA 1RZMA 4DX7A 1EQ0A 1JLCA 3ENAA 5MAOA 3T5HA 4CNYA 2N7CA 1X5PA 3E51A 4DUYJ 4JV5F 2DR5A 2R7TA 2OI2A 2H4WB 4OX7A 2V2KA 3D66A 2EWHA 2OP5A 4TLQA 1T03A 4JI1J 3TW0A 7FDRA 5SZTA 2PT0A 4F0HA 1SVDA 4NMXA 3TVZA 1T9TA 3PTWA 2QLXA 3CJSA 4YR0A 2LCWA 6FD1A 4I56A 1IKVB 1KVKA 2BJ8A 3D28A 1WTFA 1S99A 3R5DA 3MURP 3PXGa 1FRIA 2DH7A 2NYHA 3M05A 3GR1A 3M2UB 1UVIA 5EX0A 2BA9A 3BGRA 3C6UA 4M5DB 4I6WA 1R8AA 1ZA2B 2GCFA 1ITPA 5CABA 1JWWA 4RW6B 2B0GA 3CD6S 3OTOJ 1Z2LA 4WIIA 1HI8A 2BJDA 4WWSA 3D67A 4DR4F 3U27A 4IH5A 1RT2A 5HMWA 4C0BA 2J9CA 3R2DJ 2CNLB 2V5HG 4ZLPA 4EO6A 2RDDA 1YJWS 1X8DA 3AH6A 5LL6d 2RQCA 1NHKL 1TV6A 2ZC4A 3IM8A 3A3NB 2RS2A 3D1OA 5HVHA 1HHTP 1DRZA 2P8IA 3HDSA 1TL7A 3NCRA 4QIEA 3O3LA 2A18A 1UEVA 3TZWA 3KK3B 3D7SB 1IWAA 4OI3A 3DGVA 2XLKA 1S48A 3M8PB 3NGUA 1S0OA 3ENQA 5K8PA 3DGPB 2VFSA 4NZ7A 1S12A 3VGTA 2UP1A 2QO3A 1B64A 3Q8UA 2YWKA 5T41A 3MFIA 4EBCA 3Q23A 5LM7E 3EZ5A 1ZYQA 1RT6B 4OZLA 2N4CA 4RW8B 4ZCLA 4QQBA 4J9RA 1N6QA 1TQLA 4E0DA 1LWEB 4LF4J 4F3MA 1RT6A 1ZZFA 4I7FA 3NNCA 2JDJA 1WDTA 2OLWA 2DY1A 2W4PA 5HMZA 4ENOA 4OMFG 4PG8A 1NJYA 4F2SA 1VC5A 4BLGA 4RNFA 1F60B 1LW0A 4NI2B 2CIMA 3TQ1A 3LWLA 1XC9A 5J2QB 1S0NA 3AD7C 1VI7A 3DLKB 2AX1A 1HI1A 1ACMB 3V6HA 3GYNA 4GVBA 4OFZA 3WX4A 1EZZB 1RHUB 1FRXA 2BOAA 2WW8A 3DHWC 1SXLA 2CQBA 2DGUA 2ZM6J 3R97A 2WAQD 3M30A 5F41A 3B6BA 3UWTA 3K5LA 2DRAA 3R27A 3GIRA 1IBMJ 4LR8A 4HHHA 1QTNB 1RTZA 1VC0A 3CJ0A 2MGZB 2UUAJ 1NK4A 2E7WA 3OFFA 5U47A 1H2UX 4DV3F 1Q1KA 2AGQA 5M2PA 5DGBA 2J6SA 1CLFA 4FNHA 2GAGC 1QD1A 2YKNA 4DV3J 1FJGF 3IRXA 3ZC4A 2PD1A 2ZFHA 3MEGB 4EZ6A 2ZEJA 4N7TA 1T05B 4OV1A 2DT9A 3MECB 1SKUB 1H2VZ 1J2VA 3MD1A 1BHNA 2OPRA 1VIOA 2CQHA 5D0EA 3RRKA 2M70A 5E0OA 3JAMY 4U7CA 1LW2B 3MR6A 1FJEB 5IWAF 1VK8A 1NK9A 4JV2A 2DGXA 4B3SJ 2FC8A 3GJRB 2OPRB 3HFVA 3P49B 5HI7A 2VBZA 3QLHB 3MZIA 3R6GB 1U1MA 3TA0A 2Z2MA 3K57A 3MM6A 4URSA 3T6BA 2AV5A 5KG0A 1DURA 1HW9A 1S1TB 1UAWA 3I0RA 5ETKA 2NXEA 2E5GA 2C42A 4LFAJ 2CQ0A 3CB4A 3H40A 2ZH5A 2KM8C 3R5AA 1DBDA 3P45B 2OELA 2VPYB 2WB4A 3IS9B 3IG1B 4RBVA 3OHBA 2I2YA 1UWBA 4NRUA 4EU0A 3RAXA 5FLXY 1VQ5S 4EWTA 1HNWJ 3PX6A 3QAEA 5KFQA 2DJWA 2VG7A 4YB6A 3IG1A 5LXYA 1YJNS 4O3PA 4IOBA 4KKOB 5AE2A 1F3VA 4P72A 4IG0A 1IKWA 1X4DA 3LW5C 5KFYA 3CCMS 1XNQF 3QGHA 2FVPA 2RE1A 4Y2IA 2ZKTA 1S1XB 3BBFA 3VTIA 2YNIA 3OFGA 1HYSB 1YJVA 4UOHA 3L7PA 3JTNA 3K59A 1NDLA 2BMBA 2AD9A 3R2CJ 2HMIA 2OMLA 2XULA 3CDEA 2DRBA 2MKKA 2YNIB 3HJVA 5C5JA 4DLGA 4DL0C 2OUGA 1UVMA 4DR6J 4ID8A 1JMTA 4WXWA 2FY1A 1IM6A 1FESA 5GAHU 4Q45A 4ED1A 1MU2A 1PJ6A 2BE2B 2HHTA 2DGOA 4ECYA 4J9LA 2OTLS 3TANA 1XERA 9ATCB 2YPZA 3IXQA 4PQAA 4UT4A 1J5EF 1YLXA 1BUXA 2FIUA 4I68A 4KV8B 3FZBA 2ZM6F 5J2PB 5I3UA 1FKAF 3OJUA 1RT4A 2AZ3A 3L9ZA 4K4ZA 4M5KA 1M90T 1DTTB 1RWXB 1UETA 3R9LA 3PW4A 1U1QA 3BKTA 2HHWA 2IA0A 4NMLA 2Q6BA 1VMBA 1TUGB 3I82A 2R2TA 1X5OA 2E29A 3UCGA 2C2NA 2HK3A 2QA2A 4R5PA 1J5OB 4KQZA 4KHRA 3AD9C 2D3O1 2FPHX 3OJSA 2DVIA 5KFIA 1SQFA 4M8LA 2UVRA 1F2HA 1S79A 3H5SA 2XNQA 3DMJB 2UUBF 3UN3A 3R3TA 1JLBB 3IWLA 1YX2A 2NUUG 4LUBA 1LXNA 4WFYA 2O67A 1U2RA 3QGIA 1S4FA 2H4YB 1PJ5A 2PDAA 1B0PA 4ZHRB 3EPIA 5H9EJ 3OQ2A 3CT9A 4FS1A 1MROB 5D0HA 4CDIA 4F3OA 4IUFA 4RW9B 2HNZB 1FFSB 3PX0A 3K89A 3FMWA 5DQIA 2QJ3A 2DGQA 2DYAA 1KFSA 2HGNA 3MAAA 4WKRA 3D0HE 1NKEA 3BO4A 4CRJA 5LT5A 5KFXA 1QJHA 2KHDA 4MK7A 4O4RA 2YPYA 1P9QC 5KG3A 1F3FA 2BQ3A 2KTQA 2LQJA 5IQQA 1XBWA 4FF3A 2LMIA 1BY9A 1LFPA 4U6PA 1KVJA 1EP4A 1FO1A 3V5RA 3LWMA 3CO9A 2ZOGA 2ACYA 1ZM3A 2V34A 2ZBCA 5G0RA 1SIWB 3ILLA 5E2QA 4ANDA 5MLCV 2VOPA 4KR0B 1T9XA 2CPFA 4FZVA 5KTQA 4X4RA 2WVCA 1RKIA 4KO0A 1UW4A 1Y7PA 1UPPA 4DV4J 2BJ9A 1IR1A 1GXLA 2V8DA 3CJ4A 1Q16B 2ROPA 1R89A 2NLWA 3GG1A 2JFDA 1JJCB 3HHLA 3MEGA 4KO0B 1YRTA 4DN0A 1VQKS 4J9SA 3Q8RB 5F3TA 4QW9A 2AHOB 2ZH7A 2GHVC 5I42A 4JI4J 2LQ8A 3RRHA 5H9EK 4M5NA 4A8QA 4PXBA 2CQ1A 5A8RA 2A0FB 3HULA 4KB7A 3PO4A 1M1HA 3DOKB 4IG3A 3GLJA 4IO1A 2J6TA 4FBUA 3D5MA 5E3AA 4KY3A 1X60A 5FD1A 5HO4A 3GJTB 3GR0A 3V81B 1FCAA 2F9JA 2WTFA 1VQPS 3PIPQ 4IH6A 2ZH4A 1CJTA 2EC2A 3MMAB 2AU0A 4YOEA 1URRA 1NCLA 3POTB 1NZAA 2DCUB 4NPOA 3C14A 4ZVRB 2DEIA 3WC0A 3W1YC 1UJ5A 3KLIB 4LSZB 3UN2A 3CC7S 2X3GA 1EARA 4CTAA 2N3OA 4DFPA 3POTA 2XBPA 2B51A 3S01A 2YWHA 2GW8A 3TAQA 5GAGU 2AGOA 1L3UA 4QIVA 5BR8J 3CWJA 4K2JA 4Q5VA 5T14A 2YH1A 4NLTA 2WSFC 3QFHA 1Y5LB 4KHPF 1I3OB 5EX3A 2GIRA 3ZZPA 2J0SD 2CNOB 1X4HA 2CQ3A 2RT3A 4QOTA 2VFUA 4RJVA 4F4WA 2HYIB 4KV8A 1S1XA 5I3UB 4A48A 1NU4A 4DPYA 1FTCA 5L39A 2K06A 1WHVA 3N79A 3KHRA 1JB0C 1DTTA 4PYDA 1RGVA 2WONB 2X1GA 2XYHB 3FVYA 3MEKA 4ETZA 2C2RA 1KNZA 1FWKA 2QE5A 4G1QB 2IC3B 4OYOA 3FEZA 1MMLA 1SH2A 4ZK7M 5KG2A 4JI5F 3M9OB 2GX8A 5HQMA 1V3RA 4P74A 4EK2A 1VBKA 4TQSA 1IXKA 3C16A 3FZ2A 3NP5A 4YUDA 4IO9Q 4RWXA 4NA3A 2B7BB 2BABA 2YQ1A 4N76A 4DX8H 3HVWA 5CYJA 2G0CA 2KYZA 4JI8F 5A76A 3J7ZT 1KP6A 2MKHA 4ZPBA 2AIRB 2HQCA 4HL9A 1M5PC 3MCNA 1Y10A 4I6AA 2Z2ZA 3DDIA 4FYWB 4E8UA 5M2UA 4PQUB 5DJBA 3M9NB 1FT8A 1WEXA 4OHWA 3F73A 2BEFA 4HTIA 1R0AB 1URNA 2DNQA 1UKUA 3TUJC 2GMLA 2KXFA 1FDDA 2NSCA 3P5BP 5B09A 2LECA 3DRYA 3CVKA 1LWCB 2P2CB 1C0UB 2YWGA 4USMA 5J1EA 3KJVA 4NLPA 2YKQA 2ZZNA 2OPPB 4JI3J 1VISA 3A3OB 5ETPA 2V68A 1U1OA 1U6ZA 1RAAB 2VJVA 1IM4A 4RUBA 3S1TA 2CJXB 3M6UA 2ZHBA 5HP1A 2HHHJ 2RU9A 2BE7D 2A3JA 3M8QA 4M94A 1KQKA 3FNNA 2DNHA 4HHUA 3PIOQ 1N33J 3R5BA 2C3OA 2ASDA 4HKQA 2K3KA 1PKUA 3DDKA 4ZDNA 4AL7A 3F41A 1BQNB 2CQ2A 2W8LA 4DUZF 1M5VC 4PWDA 1HBMB 4EBDA 5D78A 4OJ3A 2YVSA 1GFWB 1X4EA 2HVHA 4ED7A 1VQ9S 5GMKa 1R0CB 4O3RA 3SQGB 2HURA 1HBMA 1P9YA 3IAS9 3O6QA 5C7PA 1FDBA 2EFPA 4RW7A 1VS3A 2GHWA 3HHLC 4C8YA 4DX5A 1HIYA 1EIYB 5K9FA 2F7VA 3N6NA 1WTBA 4AD6A 4YY3J 3UVJA 2MZ1A 2HLUA 1X7VA 2KB2A 2HS0A 2Z56B 3RU0A 1ZAVA 2FJDB 4YB5A 3KNGA 4OYMA 4F7VA 2FJWA 3NAHA 3LGHA 2HRTA 4B3MF 3BSOA 1WC6A 3ULHA 4A8OA 4PPDA 1T0TV 2QL9B 1ZM2A 4FYVB 1Q7YT 4ZJQA 1OPIA 2VDHA 3I4PA 3H2VE 3KLHB 1RYRA 3G96A 2FJAB 1DLOA 2FHOB 2IVFB 3BGLA 2GS8A 3PM9A 4P6QA 1WOPA 4HVZA 2XLJA 4KHPJ 1TL3B 2J9DA 1NDPA 3LOUA 3SIPB 3EVWA 5AJ3J 5BYRA 2F4VF 1HPZA 4PG7A 2ROEA 3W9HA 3D6TB 2FHJA 4GVLA 4LIWA 3VAKA 2VPWB 3RZAA 1XR5A 1PCAA 2ZH6A 1S5ZA 2IFXA 3K8VA 5HL7Q 2RDJA 5AXMA 1IWGA 4WZQA 1RT7B 1IVZA 4W98A 2XM3A 2CQCA 2W9BA 3JYTB 3TYTA 1Q8IA 3GV8B 2W7OA 1JXVA 2G9OA 2R8HA 4DR1F 1N5YB 5F3ZA 1HYSA 2GFFA 3A13A 4WP8A 2FD2A 3CD7A 3HVAA 3WHIA 3JYTA 1VBZA 1YDLA 4N5SA 1WC4A 4FXWA 3TQEA 1H98A 3SV3A 4OJGA 5KFNA 4TYAA 2LQ5A 4DV2F 2BXJA 1Y5NB 3JQMA 2I5JB 2KHCA 1NAQA 1NHVA 1NPKA 1UTAA 2KRBA 2RNEA 1JK9B 4ZVPB 4ES1A 3V4IA 2FQQB 2BE2A 4OI6A 1WNEA 4OIXA 2DXFA 4O0IA 3QBCA 3PKMA 1ELOA 2J0WA 2KT5A 5IC4B 3RTVA 3ZZ0A 3TAPA 2VA3A 3K7RA 4EYIB 4WE1B 3S7RA 3NY0A 1HNXF 2U1AA 3AA9A 3FCVA 1AB8A 3TP2A 1ZPWX 3ZZOA 4CO2A 2V8HA 1QY7A 4OI1A 4RZRA 2PMWA 4DHVA 2OMOA 2DGWA 2CQGA 1OO0B 2MMYA 1GMWD 1ROFA 4Q2LA 4WFAQ 4LBPA 3G8TA 4ECUA 3OSPA 1ZM9A 2EFOA 2RDIA 2FHJD 3G6YA 3MMCB 4JI2J 3MAQA 2R7VA 5D4NA 1I51B 2L9WA 3TEHB 1CJVB 1APSA 2RILA 4DV2J 2IM2A 2BE9B 2MDAA 4NA1A 4WYLA 4Y6IA 3DMJA 3OR1A 4GO7X 2KFNA 4X4UA 2JFKA 1V5VA 2V94A 3T41A 5A8KB 4DLEA 2RAQA 3B4DA 2G0JA 3CJ5A 3ITHB 1DQ8A 3P96A 2D7SA 4NLXA 1H2TZ 3I6PA 3SQGA 3M8ZA 3CC2S 4C9DA 1RACB 4JP8A 2M5YA 1RWKB 1TZ0A 2JVOA 5KT3A 2JOQA 4NYOA 1WDDA 4K2XA 1T3NA 5CAAA 3IR5B 4K50A 3SI8A 5DQHA 3G4SS 4DPWA 4LFCF 1Y5IB 2VICA 1J27A 2POKA 2GGPA 4P2FA 4GO5X 4NLSA 3WIVA 3A4TA 2HGMA 3MDFA 4RU2A 1K47A 3LPYA 2X1FA 5F8JA 4CIOA 4EFAC 2F63A 2KT3A 3MWBA 4N47A 3NL0A 2CPHA 2NYIA 2HWTA 3FMBA 4MKBA 1AFIA 4CQ1A 3BBBA 4OJ1A 3ZZRA 2B56A 2UU9F 3CDUA 3TUIC 5LXRA 2KKHA 1MROA 2FZGB 3FBCA 2G1DA 3BGUA 4ED2A 4QWAA 1T05A 1VHFA 4J7CA 3B82A 1D1UA 4LF6J 4KJIA 2CQPA 1VLYA 3MECA 4J5OA 4RL1A 5KG1A 3CC4S 4HT7A 3LP2B 2UXBF 1XMBA 2PC6A 4CZCA 1I1GA 2XHWA 2FHKA 4YHHJ 2HBYB 1S9GB 2BV3A 3GJSB 2DKOB 2RF2B 3DC2A 3SCLE 3V6KA 1X5SA 3H90A 5A0YB 2MLYA 2IVYA 2HBZB 4N8NA 4W90B 4WZMA 3M1VA 1L3SA 4AUKA 2ADCA 1UFKA 5LMNJ 3UCUP 1KVIA 4TU9A 1Y4ZB 3Q8QB 1UPMB 2Z8QA 4A8MP 1G2EA 4FYDA 4Q2MA 2GMJA 3R7BB 2K2PA 4QZVB 3KG4A 5FDLA 3KTQA 2KN4A 5IOLA 3BBCA 2H48B 3D9BA 1NNDA 1TELA 2XGPA 2DIUA 1LFWA 4H4OA 2MHNA 1NXIA 1RTHB 2X7IA 4ZVSB 2YQ0A 3QFWA 1QM9A 3MEDA 3MUTP 1FERA 3W2WA 2NQPA 1FXDA 1D0EA 5BJRA 1JLEA 2CVIA 1DHMA 1HBOA 1YQHA 2J7KA 1OY9A 2IJNA 3KG1A 4ITSA 4OHXA 5C24A 2IA6A 2ZVSA 5HSPA 1RTIB 3DLGB 2XMJA 2G13A 3LP0B 4YP3A 4WE1A 2XZTB 4X4OA 4RU9A 4LQ9A 1QTMA 3FSYA 3MCMA 1KHVA 3DI6B 2BANB 2G0IA 1RBOB 3HKZD 4AE5A 4DV5J 2VB6A 2CQ4A 3N5FA 2X1BA 3THTA 4B9UA 4ED6A 2PEHA 3ENWA 3ETOA 2C22A 2ACMA 1MU2B 1HNVA 2HHPA 2HHVA 3GSIA 4ZPDA 3PRVA 3W65A 4ER8A 4OYPA 2UXCJ 2BKOA 3NG8A 3HSDA 5DG8A 1K0VA 2Z58B 4Q0BA 3HLUA 1HMVA 5DETA 2Y8WA 3B78A 1HQEA 2RH3A 2DR9A 2EBGA 3KMQA 3AOBA 4CO4A 5GAEU 2CWXA 1VQNS 5IT9Y 4UTGA 3CJ2A 2W01A 4UW2A 3EE3A 4Y2MA 3GU0A 1HQUB 3WQPA 1FE0A 2VONA 4QR1A 3KHGA 5H1SV 2AMCB 1JKHA 2CDQA 1FVQA 1C0TA 2NXJA 2XYGB 4AQYF 1SJFA 4Q7AA 5D8HB 3EZUA 3M2VB 1NDCA 3T9ZA 5J2QA 2GVDA 2XS7A 4ILRA 4WCEQ 3PEHA 4LR7A 4YB7A 5E7OB 3PY8A 4B9LA 1S9EB 4ZPVR 2OEMA 4NLVA 1HNZF 3CCTA 5HBMB 2C2DA 3TWZA 3DLEA 3T9NA 4I2QB 2EK1A 1HQ2A 4RR5A 1Z4UA 2XC9A 4QU6A 5RUBA 1YBTA 2ZDOA 3Q2SC 2KZZA 4JV0A 3NNHA 1HA1A 2VKRA 3EYZA 3MAAB 1FNXH 5ETRA 2A1BA 3MM8B 2H51B 1YI2S 1KD1T 4HLBA 1ZTWA 2UUCF 3L7UA 2MYFA 4EBEA 2FDNA 3KWMA 3L09A 1NJXA 4Y65A 2PSZA 2XMKA 2ZC3A 4OZNA 1YHQS 3D68A 4IKAA 1O8BA 2WCXA 3VZHA 3QWUA 4Q43A 4EZ9A 2E5HA 1U0SA 2EG1A 2G2OA 4CLLA 3HM9A 4JI4F 2B3TB 3OSNA 2FVRA 4CLYA 1U26A 5J1NA 2GQCA 2EVZA 2BM1A 3LA0A 5L46A 4CLUA 5KFOA 2YKMB 2OJ3A 2HSEB 2IY5B 1FHTA 1NKCA 2LYVA 5B0AA 3CCJS 1N8RT 3QNWB 4V19X 2DNKA 1XNRJ 2HHSA 1NPRA 2LDYA 4QIFA 5IV4A 2BQRA 2CVEA 4WKYA 4USIA 2UXBJ 5B0GA 3BO3A 1GX5A 4JUZA 3IBWA 1K8AT 3RR7A 4C48A 4FF2A 4G65A 3KOAA 1WC1A 2V8PA 1N5QA 3A3PB 4MT1A 2OKQA 2WVDA 2B4PA 3VVUA 1F0XA 3DM2B 2JC1A 5KG5A 3BKFA 1D8YA 5DM7Q 2IM1A 3UVJB 1PGZA 2UUWA 3NBPA 2VH7A 3O2IA 1R8CA 5AXKA 3SDEB 2E9TA 3GFZA 4JI0J 1MWYA 4IG0B 1IJFB 5F0WA 2HNDB 1Y0HA 1JXEA 3KMSA 3CCRS 1RTIA 3DLGA 1TKDA 2B5JB 4NZ6A 4DV7J 5BYSA 2EXUA 1FWPA 1N48A 4HDHA 2DHSA 4P7TA 1HD0A 2FGOA 2I6WA 2QT7A 2P6SA 4PZVA 3ETMA 2HBRB 3C6TA 3R6LB 2FJVA 4JV5J 3KG0A 2QV6A 2MQQA 2Y0SD 3EVOA 3CCLS 1FX4A 1TP7A 1OY8A 1UWAA 1FRMA 5IT0A 5KFMA 2RU3A 4OX9J 1ZPVA 1RKJA 4F0KA 2F65A 1KS2A 2BW2A 3C6UB 3Q83A 4M5DA 1U49A 2AJQA 1YKWA 3VALA 1Y3JA 2HNYA 2BJ3A 2KL8A 3L4BC 4EO8A 5CZVA 5A6PA 4P2SA 2GC8A 2VC0A 3TVYA 2DHXA 2M0GB 1W2IA 2VU5A 3PV8A 4M5IA 2WK4A 3PEJA 2QYCA 1TFYA 4OLPA 1H3DA 3ZTQA 2ZBRA 3KJNB 5KFEA 4X65J 4FYXB 3BGOP 2EG2A 4KBIA 3MM5B 5F8MA 1WHWA 3NRBA 5D77A 5FDLB 1J5EJ 1D9FA 4RBUA 4ZVUB 1PBUA 4MFBA 3J80U 1I5OB 1C4CA 3HHKA 2LKZA 4JYAF 3JAMU 4GKKF 3MAHA 3D4JA 3RW7A 3JTOA 3EGZA 3KYLA 3P6YC 4ECSA 3A8IA 3MR5A 3TX8A 3ISZA 2JEFA 5J2PA 2F8HA 3GCXP 2ZBIA 4YN3B 1S1UB 1KLMB 1WF0A 2MQOA 3KLFB 4A8WA 5BXIA 2ZVIA 3PHEA 3BH6B 1IBLF 3TJAA 1VRQC 3QRRA 2XYPB 4C3LA 3GV5B 1TV6B 4M5MA 2OFHX 4LSLB 5IM0B 5HANA 3I56S 2QFIA 2AT1B 2B9XA 4WFXA 3GG0A 4B9MA 1FNOA 3BSCA 4H4KC 2J7UA 4DJBA 4DXLA 1XNQJ 3MMCA 2YWWA 1FK9B 1FVSA 1KKHA 3FQKA 6AT1B 1N52B 3OV7A 1T94A 2O1PA 1S59A 2LEAA 4KT0C 1RQ0A 1KQFB 2Y1LB 5DDPC 3MR3A 2ILZA 1ZS6A 1SUQB 1T3OA 2DHAA 2W2PP 4NLUA 3UR3C 4IQMA 4LF8F 2KO1A 4H4KA 1IJEB 1ZTTA 5HQLA 1XK8A 2NCKL 4ZVEA 2EEYA 4PPZA 5ITHA 1KHWA 4E98A 1MSWD 1QAJA 2W2NP 4RW7B 4P7VA 5IT4A 2FZKB 1S6OA 2XZDB 1GTHA 1JLAB 2GJIA 5C42A 1Q79A 4B02A 1SV5A 4DV6F 5THWA 1S7IA 3T6JA 4J9OA 1H74A 1WF1A 2MY8A 4L73A 4P73A 2DBBA 4UQTA 4ZCMA 2EC0A 3UQSA 3H20A 4HH1A 4CO1A 4IH7A 2Y8YA 1CJUA 4EMDA 2F40A 2R7RA 3JQKA 2WRMA 2IHR1 1HBNA 4Z7YA 3A1YG 2VL1A 3PR4A 1Y3KA 2A2DA 4TN2A 3X3UA 1HD1A 1U7LA 3MPYA 4Y2CA 1H7WA 4MIBA 2XY5A 4HTJA 4ZP9A 3QJJA 2YNFA 1RU2A 1S1WA 1UP1A 2CFXA 4USUA 1ZAXA 2UUAF 2HHXA 4TY9A 1TL1A 2KVQE 3RAQA 4C8OA 1TKXA 1OQ6A 3KLIA 4ZCIA 4USKA 1SJ1A 5BYQA 4B9TA 1HWKA 1TKXB 2ZJRQ 4ILLA
chains in the Genus database with same CATH topology
5EGYA 1VQMS 2K1RB 4IR9A 3I31A 3N6MA 5A0YA 4PG6A 4HI1A 3CCES 2XSJA 5LJ3Y 5JJBA 3OLAA 3G6ES 2CYYA 3I5CA 2XI2A 1TKTA 2NS1B 2RKIA 4LF9F 3DOLA 2R7XA 1JLFB 3U1MA 4R8UA 1YWXA 2Q43A 5KFPA 2R2SA 4MK9A 2KFZA 1FF2A 1UL3A 2CZVC 2MKCA 3DYAA 2I5JA 3SMZA 2E44A 3T5KA 1Z1ZA 3VQSA 5CD4H 2HHUA 1VFJA 3HI9A 2FTRA 2HIQA 2KT2A 4EEYA 1TK5A 2XMTA 2CZ4A 3BS9A 4B3OA 1OS5A 2MSTA 3CPWR 4IQXA 2K3IA 3H2UB 2D1CA 3DFEA 1M1KT 1FXLA 4A46A 1GAOA 1ZETA 1J5OA 1JNRB 2IYIA 3MPWA 3MM9B 4QYRA 3S8SA 3FEYB 2KXNB 1N36F 4KTQA 5LMNF 3VF0B 2IRUA 2KI2A 2K8GA 3DRRA 5KFBA 4DF8A 2J8AA 4QR2A 1TFWA 4HYKA 2XGQA 1XMOF 1AROP 3CULA 4O44A 2DNPA 1TKZA 4K5SA 1KLMA 2X1AA 2C28A 4DMZA 3ZZZA 2KH9A 4PWDB 2BZ2A 2APOA 4Q8FA 1SJ3P 2MZQA 1VQ4S 4ECQA 5A8WB 4N41A 4BHQA 1SV5B 2BRKA 3MHYA 3RBEA 4UY8T 5HN0A 3R1LA 2R8KA 1S6QB 1WI6A 1U47A 1LQ9A 3PFEA 2YY3A 3HZEA 3BF4A 1P1LA 1WHYA 4Y3CA 5B0FA 4MYUA 1AUDA 5J2MA 3AQPA 3M6XA 3AQOA 2I1RA 2OPSB 1L3KA 4RLEA 3K5OA 3UE2A 2WSEC 4ATNA 5HMYA 4I64A 2XLIA 4K4UA 2YKPA 3PR5B 4FNIA 2R9LA 2BRLA 4ED3A 2ILYA 5I42B 1FRKA 3QLHA 5LMUF 5EHHA 4NZ0A 3LP1B 2ZD1B 3P3DA 3CF5Q 3OFEA 3DM2A 4F67A 3M6VA 4MTPA 2QMXA 4C11B 2XMVA 3CMAS 2YKMA 1XN9A 3J80Y 5GAGI 2R4FA 1FDAA 2ZD1A 3N6LA 3WDOA 2MZRA 3SDEA 4AE5A 1SJQA 3HHDA 3GSDA 1C1BA 2Z0GA 3QIDA 4YMEA 3HFKA 1RYSA 1FNMA 1VQ6S 4QWBA 1IR0A 4QW8A 4GC6A 3T5LA 2F1FA 4FVCA 2KXHA 4NA2A 4UUWA 5L1KA 2SXLA 4R8UB 4DFKA 1M5HA 2E7XA 2XY7A 3GQCA 5KFTA 1FA0A 1O51A 2OSRA 4TY8B 4CO5A 1P8GA 5CYMA 1UFLA 3R5CA 3RB3A 1JJHA 4PXEA 4KHMA 2XWXA 2M4MA 5CYMB 3TAMA 4IFYB 2CQIA 1XEZA 2IBKA 4F3QA 2VG5A 2V4JA 4URGA 2WOMB 3FRZA 2B4UA 2MQPA 3JSMA 3DRSB 2B4OA 2ZH1A 4RBTA 5CH7B 2V4JB 2XEXA 3I9V9 3CCWA 1HNIB 3IR6B 3PACA 6FDRA 3PX4A 4ELTA 1R31A 3IS9A 5IXUA 2HWHA 3RYLA 2XO7A 1VBYA 3W3SA 1T95A 1D3WA 1UWBB 2LXIA 3IWXA 1KC8T 1BC6A 3TA1A 2VPZB 1XTZA 2CKWA 4CI0B 5CA5A 1M5SA 1K1QA 4HEA9 4DFJA 1VRTA 4O3QA 2HQ3A 1IQZA 3MCSA 4A4JA 1S49A 3CGIA 4I2PA 4ZP6A 4NCAA 2HFOA 3NMRA 1RT4B 2Q6CA 3BEGB 3G71S 3M6WA 3MM7B 4K4TA 3M4XA 4TNOA 3I32A 3BREA 2IAJB 3H98A 3FQLA 1F9FA 2P9GA 1BQXA 1S6UA 1VQ5S 1JNZB 5E3RA 3KLGB 2YWFA 4X64F 1MMDA 1WHXA 5B7WA 3SSRA 4IFVB 4G1QA 2KJVA 3ZZYA 5KFWA 2DD8S 4DG1A 2FGCA 2HAIA 4A8SA 3V6DB 5G4DA 2DR7A 4NL5A 3CEDA 3TNVA 1LWFA 1RT3B 2I38A 4YY3F 2OIHA 2ZZMA 4LQ3A 3KLVA 1VQYA 2PA8D 3WC2A 1IQTA 1LWFB 2JHEA 2B43A 1KONA 4L72B 4MIWA 3H5YA 4ELUA 4XDDA 5D6GA 1QE1A 2YX4A 2AJ0A 1JLQA 3GIMA 3NMAA 2AYGA 3BR8A 2V4QA 1TK0A 5E3PA 1S0MA 5KG6A 1X4AA 2N4DA 3MFHA 2XS2A 3IC1A 4WK3A 5F8GA 3GFXA 1TAQA 2OO4A 4C0HA 4CO3A 3FGVA 3ZFVA 4WFBQ 3SV4A 4O3SA 4ZPWR 1TAUA 2VG6A 3VZIA 2OTJS 1RDRA 3SXLA 5KOWA 4IOAQ 1E6VA 4I4BA 4IR1A 1JLGA 3C46A 2XCAA 1YRUA 3HF5A 1JXLA 2VBXA 1BQNA 1SL0A 1TUVA 3HHLB 3ONQA 3MM6B 5L38A 2MKIA 1OSDA 1TVRB 2DNGA 3GFHA 4WU3A 1HR0F 3LH2S 1LV5A 5D4OA 2LDIA 3MGJA 1I6JA 4DBQA 1TL1B 3GWCA 1U09A 3AY0A 2R7UA 4NLDA 4JI2F 5EWGA 4OX6A 4WF9Q 2JLEA 3DLJA 2YNHB 3KHLA 1SB6A 3JSYA 4DL2A 1SIZA 3TAMB 2WHOA 1VRUA 2BOPA 1HBNB 3OTOF 2AYBA 4DV1F 3GE9A 4WFZA 1L3TA 1VQOS 4F4XA 2LEBA 2XSJB 4HH0A 1EETA 1NB7A 1FRLA 2GO8A 1HNIA 1X5TA 1KLNA 1TKTB 5DQGA 4ECWA 3OR2A 1HWLA 1YITS 4N56A 2NXUA 3FCHA 3G8QA 2BYCA 4M63A 4FF4A 2AX0A 2W4DA 3J7Z5 4BDPA 4DQQA 3QO9A 2DH8A 1KQSR 2M7SA 3SCKE 4B17A 3PZPA 3MI7X 4ZS6A 3UFCX 4JI1F 2E1AA 3QO9B 5HLFB 3ISND 3NNAA 2LLZA 3AA8A 3RAMA 2AYEA 2XMMA 4X4QA 1IKYA 4C3KA 1HWIA 5L8RC 3V4MA 4ZA1A 3QJPA 2YQ3A 3IFEA 2W4CA 5IS2A 4HT5A 3T19A 2EKYA 5HQ8A 5AJ3F 2BR0A 2VOOA 2DH9A 2DB1A 4FN5A 3U1NA 2FHMA 4QIGA 2ZKUA 4DR3F 3H25A 2V8VA 2LA4A 2Z4PA 4MKAA 3OLBA 2EPIA 3OVAA 4DR2F 2QIFA 1S72S 1OIAA 2WONA 3BDEA 3D2WA 3QGGA 4BWJA 3SSQA 4EGLA 1QAIA 4OZ0A 2VKZG 2M8DB 1M5KC 5DLFA 3CJ3A 2H5EA 3M30B 2VODA 4YDDB 4WXOA 2DGTA 4OI2A 3LAMA 3CDAA 3W7BA 2UXCF 1S1VB 4NLRA 3BO2A 4TLRA 2MZTA 2PO4A 2JVRA 4USHA 2HVIA 1TKZB 2MJUA 3BB5A 4J9MA 2HLTA 2VV5A 2PIIA 4ELVA 5DG7A 4MKYA 4DSEA 1BGXT 1ZOTA 4RUAA 3QWPA 4XK8C 5AXLA 2GA7A 1S6PA 2RRNA 2CPEA 4QR0A 5LJ5Y 3X1LB 1S9GA 2Q79A 4X62F 4DS4A 2OPSA 5IZHA 3RB0A 3CMES 1KRPA 4A8FA 4PUOA 1DTQA 3B8HA 1Q82T 5J2NA 4PUOB 3PW5A 3QYYA 1OSCA 3H5UA 4DFMA 4ZPTR 2HZCA 2I0XA 2E66A 1BLUA 1WI8A 2IM0A 1UVNA 2QSWA 2JEGA 1KTVA 2D9PA 3DU5A 1IN0A 3HK2A 5KFSA 4KSEB 3F44A 2R2RA 2Q1LA 2WSCC 4IRDA 3MMBB 5KFHA 2M52A 2E1RA 4NCBA 1RJJA 3HZGA 2V9KA 3IRWP 1JLCB 2JEIA 5A8RB 4DQPA 3DRXA 3PNIA 3PO5A 1Y00A 2R8GA 5FJ4A 3BN4A 3W2WB 1F2GA 1RT7A 2QLWA 4MMOA 2KZMA 4MK8A 4Y34A 1T8EA 1Q8LA 1K9MT 3EX7B 5GVQA 5GAHI 2CPDA 3S6EA 4J9NA 3BSNA 2ERRA 3KK1A 3TRGA 1U25A 4I67A 2FB0A 2ZH2A 2KG0A 3I96A 4JBCA 4RWWA 3DI6A 2DIVA 1V9OA 1HWUA 2AJ4A 2VC1A 3RB6A 1SJRA 1N88A 2YKOA 2ZNZA 2FC9A 3QIPA 1FJ7A 2LXFA 1B0VA 3LO3A 1IKWB 2W9AA 2NR0A 2MZSA 1CC7A 1Q4RA 5F8NA 2FVCA 4OI0A 3LAKA 1R0AA 2B7CB 2BJEA 1KOHA 2DNOA 2PA3A