2QA4S

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qa4S00
5JVGQ 2MZTA 2DK2A 1WEZA 3R27A 3UD4P 1ZZNA 1X5TA 2DNYA 2MPUA 5DM7Q 2LQ5A 2MQLA 4F26A 3VAHA 3IWNC 5IM0B 1FO1A 4W90B 3R1LA 1VC0A 4U67Q 4C4WA 4PKDB 3IRWP 2OTJS 2MSTA 2KHCA 3CMAS 4QQBA 3NMRA 3L3CA 1WF0A 2VOOA 2MZQA 5CA5A 3CUNA 2ZJRQ 1YJWS 2M52A 5CYJA 1DHMA 3VF0B 1A9NB 3Q2SC 3NS6A 4UY8T 1OPIA 1U1RA 2N7CA 2MZJA 1RKJA 3PIOQ 2KU7A 2YTCA 2EVZA 4P6QA 5GAGU 5FJ4A 3S01A 3MD3A 2L08A 5ITHA 3CXCR 1YHQS 2MQMA 4TU9A 1HA1A 1U1KA 3P3DA 5GMKa 4WFNQ 3CCJS 5DDPC 1WHXA 4CIOA 2Q79A 2DGXA 1VQMS 2DISA 3S6EA 1L3KA 1XN9A 1H2TZ 5LJ3Y 2MJUA 1U1MA 3VAIA 1K9MT 2LEAA 4M5DB 2M0GB 2AYGA 2CPYA 3G6ES 3OW2R 4F02A 2X1GA 5LXYA 2KM8B 1H2VZ 3UWTA 2YH1A 1FHTA 1YIJS 1PGZA 2DNRA 4PRFA 1YITS 3CTRA 2MKJA 2D3OR 3SDEA 1P1TA 1YJ9S 2HGNA 1X4CA 2CQPA 2CPDA 2CPXA 1U6BA 2RNEA 2DNPA 1VQ7S 4IUFA 3CCQS 2VODA 1KOOA 2G0CA 3CPWR 1URNA 1D9AA 2DNOA 2CQ4A 2MQPA 2DHGA 1OWXA 2LMIA 2RU3A 2M7SA 2N82B 1Q86T 1FNXH 2X1BA 1M5KC 3PIPQ 1B7FA 3FEYB 3CCES 1VQ8S 1HD0A 4CH0S 3HHNB 1FXLA 3CCLS 2FPHX 4WKRA 2DITA 1X4GA 1WG4A 1VQKS 2XS7A 4YB1P 4J5OA 2KXNB 3VALA 3UD3P 3LPYA 3NS5A 3UCGA 2FHOB 1M5VC 2CQ3A 2L41A 3BO3A 1VC5A 4YUDA 1WG5A 3LQVA 3VAGA 3MUVP 2LXUA 1U1PA 2MJNA 1X5SA 5H1SV 3CMES 2HYIB 2KH9A 2KN4A 3P5TL 5HL7Q 2J0SD 1VQLS 2CPFA 3MUTP 1SJ3P 1NJIT 4RU2A 1M5OC 2RVJA 3J7YU 2KG0A 2MY7A 1U6FA 2CQGA 2KXFA 5IFMA 2L9WA 1FJ7A 2DGQA 5EN1A 3UCZP 1A7GE 2VONA 3MI7X 3VAMA 2KG1A 2DNGA 4V19X 2ZJQQ 1WEYA 3ULHA 1WI8A 3CCVS 2KVIA 1QVFR 3G4SS 3TO8A 5D77A 2DNLA 1F9FA 2MQNA 2WBRA 1S79A 2M8DB 3SDEB 5LSOA 2QEXS 3P49B 2N3OA 2HGMA 3CC2S 2MKHA 2F9JA 2CQ2A 2MB0B 3US5A 2CQDA 4WFAQ 1K73T 2KRBA 2E5JA 1DRZA 1Q81T 1VBXA 4WCEQ 1S72S 3EGNA 2O3DA 2PEHA 3UE2A 2XB2D 3CCMS 1YTYA 1KQSR 2DO0A 1VBZA 2M4MA 2CPJA 3MXHP 1M1KT 3G9CA 2MKIA 1VC6A 1WELA 1CVJA 2QA4S 3Q2TC 2D9OA 5LJ5Y 2DNMA 1VQOS 1NO8A 4OZ0A 3D2WA 1X4EA 3G8TA 1Q82T 1M5PC 4QU7A 2NLWA 3BO2A 3THPA 1VQ5S 3DXBA 1IQTA 1WHYA 4EGLA 2XNQA 4LMZA 1U1QA 4LJMA 4QPTA 2JVRA 1VQ6S 3SMZA 1K8AT 4PR6A 1U2FA 1AUDA 4C0OC 2RRBA 2EK1A 2DNQA 4TU7A 2G1DA 3ZZZA 3BO4A 2CQBA 3H2VE 2MXYA 2XS2A 3G71S 3HI9A 2MZ1A 3P6YC 1X4DA 2DNNA 2SXLA 2MGZA 2KI2A 3RW7A 5DDQC 3MD1A 4WF9Q 2RS8A 2G4BA 3V4MA 2M88A 4CQ1A 2F3JA 2YH0A 2MKCA 2JRSA 1FT8A 1WHWA 2MZSA 1X4FA 2KXHA 2DIUA 2MQQA 1JJ2R 3MURP 2ADCA 1U1NA 1YJNS 1WEXA 2U2FA 1N88A 3B4DA 2CQCA 2DIVA 2KM8C 3NNHA 2LEBA 4Y00A 2RT3A 1UFWA 2LYVA 3TYTA 2MY8A 2A3JA 1Q7YT 2OIHA 1YWXA 1UW4A 3CC7S 2JVOA 1X5OA 1VBYA 3U1LA 2MZRA 2DNKA 2DHSA 2K3KA 2AD9A 2CPIA 3B4MA 4ERDA 5DETA 2AYEA 2F9DA 2KRRA 5DDOC 4WFBQ 2RRAA 2RQ4A 2GO9A 1N52B 1UP1A 1SJQA 2CPHA 2X1AA 2HZCA 2ERRA 1R8HA 1ZZFA 4IOCQ 1JMTA 3CULA 1KOHA 5HO4A 2U1AA 2XS5A 2PE8A 1DBDA 2E5HA 1FJEB 2MYFA 2DH9A 1ZH5A 2OJ3A 1NU4A 4UQTA 4TLQA 5D78A 4TU8A 3MDFA 2J76E 2DNHA 2MKKA 1WF2A 2CJKA 2FC8A 2BOPA 2I2YA 3TP2A 3H2UB 2DGUA 2LECA 4IOAQ 2XSFA 2DO4A 2V94A 4CH1A 3R1HA 4BS2A 4FXVA 2B0GA 5GADU 2CQIA 2HGLA 5MLCV 5GAEU 2VOPA 2DGVA 2CPEA 2DH7A 1KD1T 3EGZA 4WIIA 3CF5Q 5GVQA 1KC8T 1QVGR 3G96A 2DH8A 2E5IA 3FEXB 4YOEA 1WG1A 4A8XA 2GHPA 3CD6S 2MGZB 3CCRS 2JX2A 1WI6A 1X4BA 1SXLA 2LA4A 2YKAA 1VQNS 2RS2A 2KT5A 1VQ4S 2DGTA 3EX7B 2J8AA 1N8RT 2QFJA 3G8SA 1U1LA 2KYXA 1DZ5A 4ED5A 2NZ4A 2AYMA 5IM0A 2M9KA 3NNCA 2RUGA 3K0JA 1N54B 3CC4S 4Z2XA 1HL6A 1X5PA 4F25A 1R8PA 2BZ2A 1VQ9S 2E44A 1RK8A 1WWHA 3VAFA 1H2UX 2I38A 3DLLQ 2JWNA 3MOJB 2DGWA 1PO6A 3RW6A 1SJRA 2M8HA 2OTLS 5BJRA 2X1FA 2ZJPQ 3UCUP 2DHXA 4Y0FA 1OIAA 3ZZYA 1VQPS 1FJCA 2CPZA 1HD1A 1W2BR 2RQCA 1YI2S 4OZ1A 2D9PA 3VAKA 3BEGB 2LCWA 1SJ4P 1O0PA 4C7QA 2OSRA 2MHNA 3J7ZT 2MMYA 2J0QD 1X4HA 1G2EA 2M70A 1OO0B 2MKSA 2E5GA 1WF1A 4ZKAA 3MUMP 2CQ0A 5LXRA 5IQQA 2FY1A 2CQHA 3NNAA 1X0FA 2FC9A 3S8SA 2DB1A 3I55S 5JVHQ 2MSSA 2OSQA 3CCUS 3N9UC 2KFYA 2LXIA 2N3LA 5LSLA 5CXTA 3U1MA 1WTBA 1BY9A 1JJ4A 2AYBA 3THTA 2LA6A 2XNRA 2K8GA 2CQ1A 1D8ZA 1U1OA 4LIRA 2YWKA 5DM6Q 4IO9Q 2M2BA 3SXLA 1SJFA 5DDRC 2DNZA 2LKZA 3BS9A 3S7RA 2UP1A 2DGOA 1JJHA 2DGSA 2HVZA 3I56S 1M90T 4QU6A 1P27B 1H6KX 2ADBA 4W92B 3VAJA 1UAWA 1QM9A 2EK6A 4FXWA 3JB9k 1WHVA 2DHAA 1X4AA 5GAHU 2MQOA 3CCSS
chains in the Genus database with same CATH superfamily
2DK2A 1CG2A 2XY5A 3T9ZA 5DM7Q 1MMDA 4GC7A 4DR4J 2LDIA 1LWEB 2FYXA 3CMAS 4I7FA 1WF0A 1JX4A 2MZQA 3T1YF 1U1RA 4CP5A 3NRBA 2KU7A 4BLGA 1U1KA 3DLEB 3P3DA 1VQMS 1IR1A 2UXCJ 2HS3A 1FFGB 2NYIA 1U26A 3CJ2A 1BD6A 1H2TZ 4PWUA 2RDJA 1MWQA 2X1GA 2WSEC 5THWA 2ZZNA 3SDEA 1FA0A 5GAHI 2HHXA 4O3SA 4I69A 1QY7A 4YB5A 3DDIA 2ZUGA 4YB7A 2VODA 4ETZA 2QMXA 4LSZB 4ZVGA 7AT1B 1TKTA 2PD1A 2PMZD 4ANDA 3F56A 3MF5A 1RDRA 4QR1A 2HHTA 2V50A 2IAJB 5F3ZA 3PV8A 3H98A 2MDAA 1SKRA 2HHHJ 2QZ8A 1FVQA 5D15A 4J5OA 3LPYA 3M30B 1RAJA 1VC5A 4YUDA 4P7TA 3VAGA 3O1LA 2W9BA 2OI2A 3A1YG 2IYIA 2GJIA 3KDOA 1XMOF 3P5TL 2CNLB 2CNKB 1VQLS 3WDOA 3MUTP 1SJ3P 4YR3A 1XMQF 2AIRB 2XZTB 3R7SB 4DV3F 3HVTA 2ZJQQ 3BGLA 3PRDA 1SC3B 3W2WB 2DNLA 4PEOA 1PC5A 2FUG9 5HSPA 3IMQJ 4GKJJ 5E3AA 1T7PA 4CO4A 2UXBF 4RNNA 5HK4A 3BSNA 2ZDOA 4P73A 1G7CB 1S1XB 1K47A 2LQ9A 2XQCA 4J9QA 1P6TA 3M32B 1NO8A 3JQJA 3O44A 4ZCMA 4OX7A 3CJ5A 1FX4A 1Q8KA 4EK2A 3T41A 2V2KA 2NSCA 1WHYA 3HPOA 2G13A 3QRRA 3B82A 4FBUA 1XWLA 1K8AT 2HHWA 3QGIA 2RRBA 5LM7E 5T14A 4F3MA 1I51B 4DV4J 3G71S 2VD3A 2LLZA 2MKCA 3U7JA 5CYMB 1RKIA 4RW6A 1UVMA 5K20B 3MEEA 3PW4A 4I2PA 1RCOB 1NXIA 4ID8A 1F5CA 5ETNA 4V1Ak 2YNGA 1HFEL 3QGPA 3OBIA 3EZUA 1SL1A 1YWXA 2QE5A 2G0JA 3GIKA 4DQRA 2CPIA 3DLGB 1TVRB 1QAIA 2HQDA 1NJZA 2HZCA 2BJEA 2IM0A 1RISA 1IWGA 3VZHA 1OQ6A 1S9FA 3WIVA 4TLQA 2Q6CA 2VFRA 2R7OA 1UCNA 5KFCA 1S99A 1K1QA 2IM3A 2XSFA 3VCDA 4CH1A 2CPEA 3NP5A 3GCXP 2BE7D 3G96A 3EXYA 1NRKA 2RQMA 2RDIA 3NGSA 1NZ8A 4A8XA 4JP8A 3HVAA 2YKAA 3GILA 2RS2A 3K17A 5SZTA 4RUHA 3EX7B 3NGRA 3E51A 5DS7A 4K4SA 3BKUA 3G8SA 4LF6J 1OMSA 1RHUB 3IR7B 4DR4F 3CC4S 1RI7A 4FP9A 3K8WA 5G0RA 4ZVQB 2F63A 2JWNA 5IQ6A 3QT7A 2COLA 3ITHB 3BDPA 4ZLLA 2PEBA 4OZ1A 3VAKA 2B6AA 4LRCA 2CG8A 3N4WA 2MHNA 4ILLA 2MMYA 5HANA 4ZKAA 3MCMA 1M1GA 2UXCF 2EBEA 5GADI 2RRNA 4M95A 2YNFA 3M1VB 1BY9A 1WACA 2OD6A 2ZE2A 1HKAA 1D8ZA 2BMBA 3IN5A 3OSPA 3S7RA 1KVIA 5IT9Y 1N33J 1JJHA 1SUQB 5MAOA 2EFOA 4PXBA 1TAUA 2IM2A 2WW4A 5CHCB 3IR6B 2ALYB 2J7WA 1FO1A 4BC9A 3A8KA 2HHPA 4Y2MA 5DO2A 4QQBA 4B3RJ 2VOOA 4Q5VA 4DPOA 1YZ7A 2HHHF 3PW0A 2VBXA 4B3MJ 5FJ4A 2MQMA 3D0GE 3M2RB 1S1WA 2OFHX 3CCJS 1DAXA 1VOMA 1FWKA 1FXRA 4OYBA 1FRMA 4ZP8A 4M94A 3F73A 3MEGB 5K14B 4J9NA 2AGPA 1T8EA 2VU5A 1G4CA 1RTJA 2K1RB 3LWLA 1N32J 3PX4A 3D28A 3IS9B 4UQGA 1TKZA 3QMQA 1NK6A 4DHVA 3PYDA 2MKJA 3V81B 3FBCA 3HMJG 3TJ8A 2JH3A 4I2QB 3PDNA 1ZM2A 2OPQA 3F0NA 3SEOA 5CYQB 3T5JA 4GKJF 1VQ7S 4IUFA 2ASJA 1UVLA 3HKZD 1Y00A 3A4TA 4NLQA 2WVCA 1RHJB 1U02A 2KYZA 1FNXH 2IBOA 3NL0A 4ELUA 3FFIB 3BREA 2HMIA 4JI7J 2XSJB 3CCLS 4CLTA 1J5OA 3OTOJ 2AW0A 1R8AA 2BANA 1REVB 3OR1A 1SJ1A 2NUUG 1VK8A 4I6AA 2ZHBA 1EAYC 2HLUA 1RT4A 2VQEJ 1CC8A 2FVQA 4B9NA 1FK9A 4DV4F 1JLAA 3U1NA 4IQXA 1RWWB 2W2OP 1NJIT 3G86A 4ZP7A 3K2YA 5L1IA 2HBQB 3QYYA 3J7YU 2CQGA 1R7IA 3VAMA 3OUYA 3QFWA 2KG1A 4KGKA 1TUVA 1S0VA 4MYTA 4A8QA 4DPYA 3UNYA 2BDPA 5C7PA 4DFMA 3CMQA 1NK7A 1RTHA 2CUYA 4WP3A 3DRXA 4LVOP 3DLHA 2HEKA 3A3NB 1FFSB 3TUPA 3M4XA 4WBFA 1LFPA 3EMTA 1MG7A 4J9VA 3OFEA 2FZGB 1MW7A 4OZ0A 4B9VA 3H25A 3R5CA 2HIQA 1C0UA 1T94A 5D3GA 1IQTA 1IJEB 3T1AA 4C48A 2ROGA 4YHHJ 3CDEA 3K5OA 3KUHA 3J81Y 3KLEA 1XNQJ 2OUGA 2V68A 3RB0A 2ZITA 2DYAA 1AUSL 3ZZRA 1RWNB 2F8EX 1TL1B 2G2YA 2VICA 4TVAB 3EDRB 1FT8A 3M05A 3SV3A 1RT6B 4DL7A 3OFGA 4M8LA 4LF6F 3M7VA 4X62J 3M6UA 4OQJA 4K4YA 4YR2A 4J91A 3JSMA 4X4UA 4GRSA 1D9FA 2X1AA 1VRTA 1RBAA 2XS5A 3GFXA 4YQWA 1TAQA 4NI2A 3MDFA 4IG3A 1OPZA 4ECUA 1CJUB 1IBCB 1HWIA 3MAHA 3J80U 2ZD1A 4IFVB 1NSAA 3EXCX 2V94A 5AT1B 2HWHA 3BZQA 3MPDA 2AEFA 2R7SA 3EGZA 1F9HA 3BGFA 4ZP9A 4UUWA 1MROA 1QAJA 2DH8A 1TMJA 1N33F 3KOAA 1VQNS 4ZN3A 3BN4A 3HHLA 2ALZA 4ELTA 1DLOA 4URQU 4LBPA 2I0XA 1DZ5A 4X65J 1U2RA 5KT3A 4ELVA 2D7SA 3EWGA 4PABA 4M5IA 2I38A 1T03A 3ETOA 2BVZA 4RW4B 1PO6A 4B3RF 2OTLS 4ZLPA 2X1FA 1NHKL 4L73A 4XPEA 3FRZA 5JXSA 2B9EA 5KFDA 4B3MF 2EC0A 1TV6B 4EZ9A 1O5JA 3BQ1A 3J7ZT 1UA1A 3Q8PB 2Z4PA 1VI7A 2K7JA 1SIZA 2FC9A 2Y0SD 4HACB 2BABA 4K7QA 1N32F 3FSXA 4OYMA 3OD2A 2GIQA 3BQ0A 3OTCA 1FEHA 4WYWA 2YWKA 3VVTA 1NM2A 2DGOA 2DGSA 1JLCB 1X8DA 3AXMA 4FXWA 1MU2A 2P2CB 2YNHA 1JLBA 1VJQA 4ES1A 2IJFA 4GO5X 1RT1A 3MM9A 2RSQA 4WE1A 2DY1A 3AH6A 2OTJS 4JI7F 2VBYA 3OTOF 4ECSA 3C14B 1YJWS 3SQGB 4UZCA 4NEYA 2MZJA 2EFPA 4BDPA 4FKYA 4ECWA 1JK9B 1S0MA 5IXUA 5KFMA 2VQEF 3PXGa 1S6PA 2QYGA 1IXKA 2Q6BA 4WKYA 4Y2KA 2VB6A 3IR5B 3PEJA 4LBHA 1VHFA 4UOHA 2AYGA 3HFKA 4HEA9 2KM8B 1PGZA 2HK3A 3G87A 1XEZA 5KT4A 4DPUA 3MMJA 2HGNA 1HWJA 1XMBA 2RNEA 3D3BJ 1TTHB 3TQ1A 2HK2A 1URNA 1M0SA 2DY9A 4DUZJ 1KR4A 3FSYA 2N82B 2QLWA 2ZVIA 4X4SA 1H3DA 3CSKA 3FCVA 4JI4J 3I0SB 2WBMA 4X64J 1S49A 4YB1P 1Q0NA 3NOGA 3CCWA 1JLFB 4YHHF 3V4IA 2ZKUA 5DLGA 1XNQF 2MJNA 3CMES 2J0SD 1VQYA 4C3KA 3PKMA 2CPFA 4GVBB 2VJVA 3MAAB 2F4VJ 2L9WA 2AWZA 3T19A 1JXEA 2V8GA 3WC2A 3QO9B 1FERA 5KFQA 2LQ8A 4KB7A 2PN6A 4EEYA 4ZPCA 3CCVS 2NPIA 1YRUA 2HVEA 1TKXB 4FNHA 1CBKA 2CNNB 3HSJA 4X62F 3D6MB 3LP1B 1JXLA 3C15B 4YB6A 2YX7A 3G9CA 1IKXA 3N0VA 3FMWA 1I3OB 3MECA 4ANEA 2GQQA 2PI4A 1XR5A 2J6SA 3I31A 2GVDB 2DXEA 5I3QA 4DPTA 5IS2A 2VA3A 2PI5A 2LQBA 2RH3A 3SMZA 4DL0C 4XAKA 3C19A 5J2NA 3CJKB 2GHVC 3ZZZA 3BO4A 1Q8LA 3JS9A 4Q44A 3PVXA 2HNYA 1QTMA 3W9HA 2QSWA 2JRSA 3DLKB 1BMQB 1JLGB 2KXHA 3I5CA 3PYEA 1FWPA 4X65F 2NXUA 3H5UA 1UFWA 2WTFA 3HF5A 1RYSA 4NCAA 2UUAJ 3T6JA 4WFBQ 3A3PB 1HNIB 2RQ4A 1ZTWA 5KFPA 1XTZA 2QX0A 1URRA 4HL9A 5K5MA 2CYYA 5HO4A 3L7PA 1S6QB 2H4WB 2HZVA 2MYFA 2DH9A 4F7VA 1ZH5A 4KKOB 3G82B 2DNHA 3TX0A 2DRAA 5DG9A 3DOMB 1ELOA 3EZOA 1CSJA 3QLHB 5LMNJ 2ZNZA 3KJQB 3WBZA 2KHDA 4DXLA 2FGOA 2GHPA 4EBCA 2OAUA 3CCRS 3JTNA 1RB0A 4FYVB 1VQ4S 2QFJA 3LANA 2K06A 2MEWA 4CNZA 2ZH4A 4P10A 2KYXA 4NPOA 1FDDA 1SKSA 4G1QA 4C2MA 1JWWA 5AJ3J 1PKUA 1HBNB 3TA0A 4JI5J 1NK9A 1W2BR 4B17A 2V4JB 2BR0A 1YGYA 5A8WA 4CO0A 2O1PA 2HFVA 1DTQB 2MQ8A 1UEUA 3TRGA 4YS2A 3NNAA 1OJ4A 1T02A 5ETQA 4ZK7M 1HI8A 3BV8A 3ZTQA 3IAM9 5IOLA 2B4VA 4DL2A 5E33A 2MKYA 1X7VA 3MEDA 4CRJA 4MKVA 5DM6Q 3DRSA 5DDRC 2WB4A 1BXNA 1Z2ZA 3KMSA 2UU9J 3CJ4A 3GJSB 4DPWA 2MZTA 1WEZA 4DUZF 5ETTA 1TK5A 1HYSA 1RAAB 4BBYA 5T7LA 3AAWB 3GIMA 4JI4F 4PWDA 1KEKA 1RHKB 3R2CJ 2A18A 4X64F 4FN5A 2JLEA 5CYJA 3Q2SC 2BKPA 3OJUA 3QAUA 4DL6A 1Q53A 4HTIA 1HQEB 1S10A 3MD3A 3DOKB 3HD1A 3PO4A 4ZIWA 2B3TB 2RD5C 2Q66A 3NEKA 1O51A 2ABYA 1FDNA 3L9ZA 2F4VF 4F4AA 4O4GB 3A8JA 1E6VA 3SSRA 3OW2R 3DMJA 3IAS9 3ET6A 4B3OA 1YITS 2D3OR 4JI3J 2Z0GA 3U02A 1Q8IA 4I1TA 3NS7B 4C8MA 1TFYA 3BKTA 4YEAA 3W64A 5LSRA 3RRGA 3QBCA 2E5LJ 1F5AA 4L3NA 1S77D 3ILLA 4OJ3A 1N5VA 4U7UK 2ZOMA 4QYZJ 3PJ9A 3D67A 2WONB 2OO4A 1LK5A 1WG4A 2RHQB 3EZ5A 2GGPA 4ZPVR 3VALA 1R89A 4QIFA 2HWTA 3J81U 1U24A 4F0MA 4DSFA 4P9SA 3A8IA 4M5NA 1B99A 3H90A 2X51A 2HS4A 2D3UA 5HMZA 2ASLA 2Z2LA 3MMAB 4Q8EA 1S1VA 3R2DJ 3ISNC 2VV5A 4DX8H 5LSOA 2I8EA 4RWWA 1GXLA 4BWJA 3ZZPA 2UUAF 1NDLA 5DJBA 7FDRA 2DO0A 2W4PA 5C42B 2KJVA 2CPJA 2PFFB 1M1KT 2V2ZA 3MTJA 2YPZA 5GMDA 3H4DA 2UUCJ 4Y2IA 1ZAWA 4YMEA 2HQGA 3SBMA 2N4CA 3FCWA 5E3PA 1RTIA 2JNJA 2I6WA 5D4OA 1H0HB 3TJ9A 2NXJA 1GH8A 3GFYA 4MT1A 3H40A 1QSLA 1IJFB 4BCAA 4WZMA 2KL8A 5LMNF 2G1DA 4X4VA 3C66A 1CEZA 4NMXA 3HI9A 2MZ1A 4NX9A 5D0EA 1D0EA 2DNNA 1FDBA 3OQ2A 4FXDA 3I87A 2F65A 1FKOB 1S48A 1N48A 1KKHA 2E1RA 1N5YB 2FZKB 4R8UA 2VUGA 3BYPA 1MN9A 2XMVA 3H42A 1GMWD 1Q95G 2GHWA 4C11A 2X3DA 4C8NA 3RBEA 4DFKA 1UKUA 2AD9A 1HHTP 5AJ3F 1RWUA 3V5RA 5HVGA 2RRAA 3IBCB 2JEJA 4JI5F 4DSJA 3C16A 4IKAA 3KLGB 1T9UA 1ZZFA 3KLIB 3D0HE 3GV8B 1EP4A 1W2IA 2FHMA 5LT5A 4UQTA 2ROEA 5D78A 5C5JA 3ISND 1Z2LA 3OTDA 5AE2A 1WF2A 4KFBB 3L09A 4JV1A 4TQRA 1NLKL 1RWOB 2HKEA 3HFZB 4FXVA 3T5LA 3KJFB 5C24A 5F41A 4KHPJ 4IH5A 3LA0A 2R7RA 1WC0A 3K5LA 4C8LA 2CKWA 5KT2A 4OI0A 1JLEA 5HMYA 3DYAA 3IBWA 2UU9F 3TZZA 2IHR1 3KLHA 1F60B 1GTHA 1TL7A 3VZIA 1Y3KA 5HI7A 1R8PA 5RUBA 3QGHA 3DLLQ 3M6XA 1RAHB 2YXLA 4DR1J 4USWA 4AQYF 5HATA 2BE2A 4U6PA 4RW9B 1NNDA 3TAQA 2J0QD 2G9OA 4H4OB 5L1LA 4WZQA 2CVIA 1UETA 1IBLJ 1SKUB 2I1RA 2P9GA 2WVBA 3BM7A 3PR5B 4JI3F 3AOCA 1WTFA 3RR7A 2LKZA 5HMWA 3PRBA 2F1FA 4R5PA 1EETA 2H51B 1CJVA 2PGCA 1TUGB 1SC4B 2DHAA 4CO1A 2E5LF 3R27A 4PG5A 1QE1A 2RF2A 4J7CA 2AKWB 3NWGA 4AXJA 5ETSA 5KT5A 5I4MA 2WK4A 1RT5A 3W2VA 2FJXA 2B8QA 3L3CA 5KFGA 3CUNA 4F0KA 4FF3A 5HQMA 3MEKA 3AXKA 4IDKA 4A46A 3M8ZA 1FCAA 2JOQA 4G3IA 2IPOB 1C1CA 1O8BA 4WFNQ 2IVFB 2HG4A 2DEIA 1LWEA 3UN3A 1U1MA 1K9MT 3KNGA 2YWGA 1YJ7A 1PJ7A 1H2VZ 2YH1A 2KZZA 4O3OA 1RWVB 2XCAA 3UDVA 2P9CA 3D3CJ 1U6BA 3FVYA 4AXIA 4LSLA 3MM7A 3DLEA 3BKFA 3C2PA 4DOZA 2PIIA 3M8PB 4QPXA 3EM1A 2UUCF 4ICLB 3CCES 3IO1A 2QG9B 2XG8A 2EI5A 4HLBA 5M2PA 5HP1A 5KG3A 2P6TA 4DR7J 1VQKS 2XS7A 1S9EA 1L3UA 3TQEA 3UCGA 1ROFA 3LQVA 5JMNA 5ETVA 1SQFA 3AT1B 4Q0BB 4RBTA 4FPIA 2DPJA 3KLFB 2Y1RI 4HR2A 3TO8A 4ECYA 3PX0A 3TVZA 2QEXS 2CWXA 2W2PP 2E29A 1FTCA 1RWXB 2W01A 3GIRA 3NGUA 2XB2D 2B56A 3OTBA 1VRUA 3ELHA 3RJMB 5KFRA 1MNEA 2B7BB 3A13A 2GAHC 3A3OB 5LJ5Y 2I5JA 3ZTPA 3W7BA 5J1EB 4CYUB 5F3TA 1WC3A 1T3OA 4GVLA 2VJUA 1M5PC 2ZH5A 4X84A 4MYUA 3W5YA 3E2EA 5KG5A 2OEJA 4EWTA 3AA9A 1UVJA 3UDEA 1LXJA 4KGVB 4JI2J 1JXVA 4KHPF 1S1XA 4TN2A 3POTB 3OFFA 3M32A 4H4KA 2C3YA 4OL8A 1PC4A 1WHWA 3N5FA 3N28A 4JOUA 4M5HA 3D7SB 1Q1KA 1WJ9A 2VPYB 4Y00A 4ED7A 1GEHA 1NH7A 4IR9A 4OI6A 2VKZG 2AX0A 1R6VA 4Y2AA 1CS4B 4Y2CA 1BQNB 4DR1F 1UP1A 4EYIB 4ZVRB 2E1CA 1SBRA 2GIRA 4USMA 1FFWB 5CYMA 3CULA 4KH0B 2QT7A 2E5HA 2HRUA 4USIA 4TU8A 2ZH6A 3MR5A 3EPIA 3SCKE 2Y8YA 1IBLF 1IKWB 3DLGA 1ICEB 2P6SA 4LF2A 4YDDB 1CJKB 2CJYB 2HGLA 2VOPA 4KE5A 2MLZA 2PC6A 4PUOA 4MIBA 5B0FA 3PM9A 3AHPA 2KT5A 2L48A 4JV2A 3Q89A 3M8RA 3M2UB 2XY7A 1PCAA 3DRRB 1GT8A 4ALZA 5HVHA 2O01C 2VPXB 4W4MA 1TK0A 4ZPAA 1GAOA 3JTOA 1OYEA 2PMWA 4DL5A 1JNZB 1FJCA 5IT4A 4DV7J 5F8IA 2NPFA 2MTLA 1X4HA 4OMFG 2Y1LB 4MJKA 3OVSA 4K2XA 5HLFA 2LVWA 1LWCA 4RUBA 2X7IA 2W9AA 2N3LA 3FBBA 4OJHA 4OHXA 3GV7B 3AB4B 2RUSA 5A8KB 3CJQA 3ILOA 1S5ZA 2HVZA 1FRLA 1A0OB 3JYTB 2AZ1A 2MQOA 1VBKA 2HBRB 2DHHA 2ATLA 2ASYA 1S6UA 1X5TA 1RWKB 3FGVA 1VC0A 2QO3A 1YBUA 1UVKA 1NHVA 2ZH1A 1CC7A 4L75A 1HLWA 2J8SA 3VF0B 1UFKA 2HBZB 1SUQA 1NPKA 4RPFA 4ZVUB 3S01A 3OSNA 4JI0J 2W4CA 1NDPA 3PFOA 3IA0A 4OYAA 5LMUJ 1WHXA 3HHEA 2Z2MA 3ILJA 4I68A 5DLFA 4NOHA 2EKNA 4L6V3 2BJDA 4F3QA 3VAIA 4NA2A 3A8EA 2JLGA 2D3O1 1K0TA 4PRFA 2XM3A 3PJWA 1YBTA 2YKMB 4HH0A 4RNHA 3AOAA 3CCQS 2HLTA 3MM6B 5K14A 3VR1A 4DV0J 2R9LA 3BPSP 3KXDA 1N4LA 2UV8G 2GC8A 1TP7A 3SFGA 1FXLA 3V81A 4ZJOA 4WKRA 1JKHA 1PIEA 1H7XA 1B0VA 4I2QA 2WW8A 5CYQA 4RLEA 2B7CB 1NKEA 4HI2A 4Y65A 3ETMA 4JI2F 3J7Z5 1QLNA 4ZVFA 4EBEA 4IOBA 1UZDA 1NB2A 4S0MA 3GR1A 5HBMB 4OZ3A 3PW2A 5A2QY 2WCXA 2JDJA 2AZ3A 4NCBA 1F6TA 5I42B 4YP3A 3G4SS 5D77A 3SDEB 1NPRA 4M5KA 3IWXA 1IVZA 1RABB 3OL9A 3GTYX 5KT7A 2YQ0A 3PG9A 4N5SA 2BX6A 3FSIA 2IVMA 5CCLA 1TKTB 1CVJA 1KQGB 5DRKA 2OD4A 1RSCA 4C8KA 2AEJA 3GB0A 3N6NA 1VQ5S 3QSIA 4RO0A 3AODA 4OYZA 4IFYA 4U8VA 3D6FB 1V5VA 3TAMA 4B9MA 2HNDA 2DNQA 2W9BB 3GYGA 2JZ5A 3HXMA 4IO1A 2Z30B 1B4SA 3LWMA 2M88A 4DCPB 1SH0A 3CGIA 2ATCB 3OVBA 1KFDA 3HVTB 3CJRA 3B78A 1WC6A 2JFKA 3DOLA 2DIVA 4Q7AA 3V6JA 2XHCA 1I6JA 3EYZA 3EVOA 2EKYA 2LYVA 2JVOA 5E41A 4DS4A 5EUHA 2ZFHA 4DQSA 3UR0A 4ZA1A 4Z7CA 4OZNA 3LUYA 2C1EB 4X4PA 1TL1A 5KG2A 4DV7F 2ZVSA 1JMTA 5C2GA 1KOHA 1NAQA 2FJAB 2YKNB 4O4RA 2R7UA 4U95A 4K4VA 2BACA 2A1BA 3ENAA 3TUJC 2BM0A 3NCRA 1NSPA 1ZM9A 4F4YA 5L46A 4OFZA 5GAEU 3N01A 4BC7A 1RE1B 3KK3B 1A6LA 5HVFA 1WG1A 2VG7A 2CJBA 4ZHRA 1N0UA 3SQOP 2W7OA 1JB0C 3KKFA 4NYZA 2ZWOA 1OY6A 1U0SA 3MEEB 3VVUA 4IFVA 1X5PA 2H5EA 4KSEB 3G6YA 2WRMA 4Z7YA 1FRKA 2QA1A 1OIAA 3ZZYA 3MFHA 4J9UE 4NASA 4PQUA 1N34J 3RAMA 3BEGB 4JI0F 2XULA 4IQMA 3R8YA 5LMUF 3MUMP 3D54A 1QJHA 4LIWA 4XDCA 3LF0A 1Q79A 1Y9OA 3M9NB 4RW4A 4L76A 5A6PA 3N9UC 5CXTA 3EPGA 4K4XA 2NXEA 2XMJA 1KNZA 1B0PA 1RAIB 1EZZB 3MM8B 4RJVA 4NYOA 5KFZA 4K5RA 2BW2A 3KUGA 4O3RA 3CCSS 2AGQA 1R8BA 2J9EA 3QFHA 4HACA 2RHSB 1QUVA 3M2VA 2LQ5A 2UUTA 4F26A 4UT4A 2MSTA 4KY3A 5G0RB 2ZBIA 2R8IA 4M63A 3NOCA 1JLCA 5KFLA 1C4AA 2G1HA 3LAMA 3CXCR 4TU9A 2B6AB 6FDRA 2J9CA 2H5JB 5GMKa 2AGOA 4CI0B 4CLPA 4OI4A 4QWAA 3MWBA 3S6EA 2W9CB 2MJUA 4XO0A 1BC6A 3IGNA 2BJ1A 4C3MA 2OEMA 1Y7PA 5ETRA 1FRIA 1YJUA 1X4CA 2ZE2B 5DZ7A 1BUXA 2CPDA 3W61A 4P75A 2G2ZA 1Q5YA 3RUBL 3TANA 4K50A 2VPWB 3UNGC 4U9RA 3KJVB 2DNOA 2QRRA 4I64A 2R4FA 4IR1A 4HYKA 4EO8A 4X4QA 2VKRA 1M5KC 4FVMA 3IXQA 1NMEB 3CNQP 4URGA 5K8OA 4DLEA 3T1HJ 5KFUA 4RUAA 5B0AA 1M5VC 1XIQA 2G0IA 2CJQA 1ZA2B 2JC0A 2JHEA 1ZBTA 3M6WA 1FNOA 1FJ7A 2ZBCA 1RTJB 1TKZB 4MK8A 2HNZA 2MQNA 1VMBA 1D9DA 3US5A 1ZAXA 4DSEA 4KGMA 4MIWA 2E5JA 1F9EB 2APOA 4RR5A 4DN0A 2OMLA 2YKQA 2HHUA 1VBZA 4C98A 2OHDA 1EKRA 4DFPA 2DKOB 1O6XA 1VQOS 2L9DA 1AXQA 4CH7A 5CQGA 5FDLB 1TKXA 2RJZA 3THPA 1J5OB 3DXBA 4LBIA 5B0EA 1HHSA 4EMDA 2BANB 3OR1B 3DDKA 3W9IA 4JV5J 3T5KA 3I0RA 1AUDA 4DJBA 1ZA1B 3LP1A 3C15A 5BYSA 3ISZA 1RT4B 4X4RA 1FK9B 4QWCA 2KI2A 4G6VB 4CLSA 3QZ7A 2G4BA 3NBPB 4RU9A 4Y6IA 4F36A 3QNWB 3OUYB 3VTIA 2DXDA 3AJ2A 1N56A 1F3VA 1HW8A 3SCIE 5K8MA 2J9DA 3CJKA 4DV2J 3F44A 2HQIA 1WUUA 2AYEA 2E7XA 2IY5B 4FF1A 3OL7A 1N34F 3TZYA 3R97A 3QZ8A 1VIOA 4P52A 1R8HA 2KFZA 2YX1A 3DLKA 2B9XA 3BPDA 4UOFA 4X4TA 1RAOA 1YX2A 1SC6A 1NU4A 1DJ0A 2CG4A 2A6MA 2FC8A 1C0UB 2W1BA 5D3GB 3MMBB 3H2UB 2DGUA 1TMMA 3D4JA 1HNIA 3R1HA 2HFUA 4OI1A 1S6QA 3TVYA 2IDEA 3LOUA 2JX2A 1CULB 1SXLA 1PG5B 1MWZA 1UPMB 4KKOA 3UR3C 1H7WA 3I5BA 5KG6A 2FTRA 2Q3PA 1DURA 1H38A 3K0JA 4Z2XA 4YY3J 2E44A 3MM5A 3KG0A 4EU0A 4OI2A 2YQ3A 3IFEA 1FNMA 1NSQA 3UD5A 2M8HA 4KGXB 1AZSB 4JUZA 1AYEA 4PCQA 4OLPA 2RU9A 3JSMB 3DCAA 4F8RA 2H9ZA 1VRTB 2E9TA 1OY9A 4WFYA 3G6XA 1S97A 2FY1A 4NI2B 2H1YA 1X9SA 3U1MA 4LR8A 3D6TB 1TL3A 2LA6A 2YWEA 1K0VA 2K2PA 3J81j 4CT9A 2CQ1A 5D8HB 1MROB 4QU6A 2IA0A 4OZLA 2FLNA 3DDNA 1YDLA 1DTQA 5HQLA 3EGVA 5JVGQ 4HH1A 4EUVA 3HHLB 3HLUA 2NQPA 1ZZNA 4ED2A 5H9EK 4W98A 3FNNA 4KPCA 1IKVA 3HP6A 2KHCA 4DV1J 1T03B 3MCOA 3T1HF 1NK8A 3LP2A 4UY8T 4WTOB 4NXMJ 1KSPA 4LRBA 2L08A 3PRVA 2IVYA 3TOQA 3H2LA 4CIOA 4ZPWR 1BWVA 2DISA 3AD7C 5J2QA 1NDCA 5A2QU 1FHTA 4J37A 1S9GB 3MPUB 1ZM4A 2MLXA 3K57A 3NG8A 4DFJA 2B5JA 2Y9HA 1C0TA 4RW8B 4NRTA 1N36J 3AA8A 4OV6A 5HJXA 4ZVEA 1ZS6A 1MU2B 3DHXA 3FQKA 2Y0BB 2YNHB 1JLBB 1HQ2A 2MQPA 1HMVB 3BR9A 1OWXA 3GJTB 3GSIA 3MHYA 1RT1B 1Q86T 4P72A 1B7FA 4WE1B 3CJ3A 1X4GA 3RYLA 1X60A 3GCWP 2DD8S 4JV5F 2QGFB 4F4WA 4RW7A 2BJ3A 4PZVA 1GNKA 1S6PB 4MH8A 1M5OC 2WONA 4IRKA 3QATA 5IC6B 2VBZA 2DNGA 3R5DA 2XWXA 4LFBJ 2DXFA 2IC3A 2FY8A 5HMXA 2UUWA 2QA2A 2C2DA 4ANCA 2F9JA 4OV1A 3DU6A 3MPYA 1EX8A 4DN9A 2JLFA 3V6DA 4DV2F 1VBXA 3EGNA 3C8YA 2BBEA 2XLIA 3AY0A 5IC4B 3MMAA 3KHRA 2DNMA 4E0DA 4FYWB 2H48B 1KLMA 2RIJA 4CLLA 3D2WA 3HX9A 3JTPA 4AYBD 2DR5A 5DQGA 1FF2A 1U1QA 2D3ZA 1VQ6S 2W24A 1APSA 3JXOA 3Q24A 5J2PA 4RX6A 4QWDA 2EK1A 2BJ9A 2GVZA 3IBFB 1P9QC 3SV4A 1X4DA 3IC1A 2MGZA 1PBAA 3MD1A 3V4MA 1UTAA 4EO6A 4F2RA 2JFDA 1N5TA 3OXFA 1XK8A 2BOAA 2EW9A 2KM8C 1UJ5A 4ES3A 2RT3A 3M8QA 1Q8BA 1SIWB 3H5XA 4YY3F 1UW4A 2Y1JA 3NKYA 3CIMA 3B4MA 3MOZA 5I3PA 2XO7A 2E9ZA 3EICA 4OHZA 1N52B 1FKOA 2QIFA 3CDAA 5EWEA 3HT3A 1IKXB 5F8LA 4F4ZA 1KRPA 3ADAC 4EZ6A 1DBDA 3MECB 3J7AN 1FJEB 1EARA 4OYWA 2MKKA 3NY0A 3GYNA 5F9NA 4CLYA 4KBIA 2FHJD 4DX5A 2B0GA 4P71A 3HK2A 1Y0HA 1FKPA 3GPAA 3W66A 3KLIA 2ZEJA 4Q45A 2ZZMA 4R0JA 1WDTA 2J8AA 4GC6A 1V9OA 1NH8A 3GLJA 4LF1A 2NZCA 3K7RA 3NXZA 5IM0A 3RBXA 2VG6A 2ZNYA 4FVCA 1RTDA 2YKOA 3OL8A 1WWHA 1P9YA 3HHDA 3IGVA 2W2NP 3KTQA 3RW6A 1T9XA 4DV1F 5BJRA 2GO8A 2XMUA 1S0OA 1NB7A 5K8PA 2D9PA 4NXMF 2G2OA 2LFVA 1OO0B 1WF1A 2N7YA 5LXRA 4QIWD 3QJPA 4A4JA 5EHHA 5HROA 5LSLA 3FDSA 3TEHB 1FJGJ 2Z2YB 1YJVA 5GAGI 1FWLA 1VISA 1BGXT 1YQHA 2E9RX 1LWFB 2CZVC 3NWRA 1N36F 1YJTA 2Z2ZA 1VRQC 2XYGB 2VASA 1JIHA 1U4BA 4U7UD 3T5HA 2W25A 5KFXA 1A9NB 4ID5A 3OVAA 3WIUA 3I6PA 4P6QA 4KV8B 6FD1A 1FD2A 1T9YA 1V3SA 5A8WB 1HA1A 1WSRA 3PYGA 5BXIA 2XHWA 1Q4RA 4XTTA 3OV7A 1DARA 4LT6A 5LJ3Y 4ER8A 4TQSA 4QWBA 1F0XA 5LXYA 4LFBF 3P8BB 3R6GB 2ZH3A 2B4PA 2GIFA 3MEDB 2GMHA 3DRSB 1AW0A 2PA3A 4USKA 2CQ4A 1LW2A 3T9NA 4J90A 2DR8A 4ECRA 5AE3A 1VQ8S 1HD0A 4CH0S 5T7LB 4KH1B 4LRDA 2YY3A 4LRAA 4PWDB 5CABA 1U49A 4LF4J 1S57A 1U0HB 2XCPA 1Y5LB 3K5PA 2CQ3A 3UFCX 1D1UA 1U1PA 5IV3A 2XGPA 2HYIB 4J9KA 4PYAA 3SCLE 3K8VA 4ICLA 2KXFA 1T05A 4U8YA 3C6TB 1WEYA 4DG1A 1WI8A 1E6VB 4DZDA 3TZWA 3DMJB 4IYQA 3TJAA 1NDKA 3M9OB 1G1XA 5KFJA 2POKA 3ET6B 1F9FA 1S79A 2Z56B 4USUA 2ZH9A 2OPPB 1DRZA 1GX5A 3VGTA 4DV6J 3LH2S 2DR7A 3AJ1A 3UE2A 1YTYA 4UZBA 4Q0BA 4C0BA 2A2DA 4WP9A 3BGRA 1WELA 4PG4A 3B8HA 3PR4A 4UW2A 4MFBB 4M1KA 2FJVA 2JEFA 3QRPA 3I4HX 1VS3A 1RT7A 4N8OA 4LMZA 3FCHA 3BYRA 2GGPB 4QPTA 2IRYA 3PFEA 2FJDB 1EIYB 3I82A 5F8MA 2PMHA 2VH7A 1SQEA 2M3DA 2FJWA 4OJGA 1QSYA 2AJQA 3ZC4A 5DDQC 5J1EA 3EDQB 1D09B 1VYAA 4N56A 2MZSA 1RYRA 1VK3A 2WVFA 5IV4A 3KWMA 3C46A 1RBOB 5KFNA 2JJ4D 2OIHA 1SPBP 1R6YA 1VBYA 1GXTA 2DHSA 2V0NA 2ZOFA 1GMWA 3POTA 2LXFA 5BYQA 3HULA 1MN7A 4A8MP 1LW0A 2GO9A 3AJDA 1R0AB 3MAQA 4CLUA 2ZZTA 3HSZA 2OEKA 4O0NA 7FD1A 1DY3A 3KFWX 2ACYA 1IBKJ 1H73A 1RWMB 2J5AA 2IRXA 4PXEA 1V5IB 4TY8A 5CD4H 2ASDA 1KVJA 1CS4A 1GQEA 1SH2A 5CCMA 1FJGF 3ZZOA 2NUHA 2CADA 1UEKA 5FLXY 1WORA 2E5IA 3FC9A 2WAQD 4K4WA 3NAHA 4C9DA 3CJ8A 3RZAA 1SC1B 1N8RT 5ETLA 1Y5NB 2HBYB 4R8UB 4LFCJ 1IKYA 2HIYA 3KG4A 2UZAA 3NNCA 2RUGA 2H3EB 4B9TA 2BKOA 1SQGA 3VAFA 4F04B 2FJEB 2DVIA 5E2QA 4CT8A 2B4OA 2GS8A 3C16B 2VG5B 2GNKA 2CAJA 1EP4B 2R7QA 2OH2A 3M2UA 4P2MA 1TR0A 3CO0P 2AJ0A 3OJSA 2XMTA 3I55S 1S1UA 4RWXA 3HJFA 1AROP 2AYBA 1PJ5A 3M9MB 1FKAF 2C2MB 2K8GA 1MLAA 5C24B 4LIRA 1VLYA 3N79A 3CDBA 1CJTB 4LRFA 4LF9J 1JLEB 4EI2A 1T9VA 3TVKA 3DYAB 4CM2A 3CO9A 3W62A 1P1LA 3UD4P 2DNYA 2V8PA 3KLHB 4O44B 3D6HB 1J5EJ 4DSKA 1TL7B 3VAHA 4W90B 2IFXA 4C4WA 4FZVA 3FJ2A 4LQ3A 1S7HA 2R2RA 1NPPA 2BYCA 3K5NA 1EJ7L 4Q2MA 4OI3A 2Y1IA 5B0DA 1HNVB 4LF4F 5AXMA 3GIJA 4WTYA 2DPIA 2HURA 3NGTA 3T3FA 2BE2B 4PG6A 3DHWC 4K4UA 1UZHA 3KNAA 5A0YB 1KFSA 3TARA 3H4BA 1Q7LB 3CDUA 2CPYA 1NJXA 2R7XA 4NEZA 2R7VA 3QIPA 1JLQB 4NLVA 2QL5B 1YJ9S 4MK7A 3UN2A 1Y3JA 4ED3A 2ZH7A 2XY6A 2DNPA 1RT3B 4R5PB 2LP4A 4ECQA 2ZWPA 4HHUA 1EETB 1CJVB 4DV6F 4HT5A 2GQ2A 4AD6A 3B6BA 2C22A 4RKUC 2RU3A 3FKBA 4QWEA 2WOMA 1UWBB 3GG0A 2X1BA 3QAEA 1CLFA 1NBEB 3M8WA 2C3MA 1RT5B 2DITA 4FS1A 1FEEA 1CPZA 3TAPA 3GMGA 3BGUA 4NCGA 2CJXB 1D3WA 4RZRA 1WDDA 3P4UB 3C6UA 1GX6A 1GTEA 4IDKB 2XGQA 4AL5A 4IG0B 3UI3A 5KFWA 4DCOB 2XMMA 1C1CB 2EFQA 3E01A 4MMOA 4RUCA 2OPSA 4X2BA 3I9ZA 4ENOA 3UCZP 1U2CA 1HI0P 3SIPB 2C2KB 2JEGA 3J7A1 2JL9A 5KFTA 5L1JA 2M8DB 2FZCB 3UVJB 3CC2S 2H4YB 2AU0A 4H54A 4R25A 4LSLB 3MM7B 4KRWA 2JEIA 1FD8A 2GMJA 2XWYA 2M4MA 5E0OA 4HHHA 1S1TA 5HBMA 1RACB 1VC6A 1JQGA 1ACMB 5EX0A 3RG6A 1U8SA 2J0WA 4WP8A 3PX6A 4JI8J 5I42A 1NK5A 1IBKF 5HP1B 3MR3A 5DQIA 2XNQA 3CDWA 1S9EB 5F9LA 2NSBA 1VFJA 3W9JA 4B9SA 2BE9B 5A6WA 4OX6A 3OHBA 3H2VE 1V3ZA 2WB1D 2XS2A 4QBUA 2KZMA 2V2QA 1NK0A 4ZJLA 1N6QA 2DIUA 2J7UA 3D1QA 2MQQA 2BQUA 4A8SA 3MURP 2AP6A 1FRXA 4LFCF 3T6BA 1HBUA 5KG4A 3TYTA 1WSVA 1X5OA 3U1LA 4CZCA 5J1PA 1SV5A 4ERDA 4RL1A 3DGVA 4AFFA 3Q8RB 1WKLA 1HQUB 2LDYA 4HDGA 1VRUB 2Z58B 1SJQA 4TXSA 3VWSA 2IMWP 3V6HA 4WWSA 1NK4A 4CTAA 2I5JB 1RP5A 4FF4A 2OJ3A 1MMLA 4FYYB 1U09A 4RBVA 4LF7J 2CJKA 2I2YA 4OIXA 3TP2A 1NJYA 2CJAA 2GQCA 1FESA 2DO4A 2J0XA 3IG1B 1U45A 4AQYJ 2GFFA 2LQJA 4YOEA 3D5MA 4ZCIA 3CD0A 4DL4A 1HBMB 2LA4A 2YKNA 3HVWA 2IIHA 4LF9F 1SI9A 3LAKA 2ZHAA 4OZJA 1KBRA 2R7WA 4ZVHA 3CT9A 3NCQA 3DGPB 4KT0C 1J5EF 2E66A 1VQ9S 4O3QA 2QLBB 1DTTB 3TX8A 3HSGA 2DGWA 1SJRA 3HT0A 1F2GA 1UVNA 3KK3A 4F2SA 1WOSA 4KC5A 4QOTA 1VQPS 1PILA 1R43A 1YI2S 1IR0A 4DR6J 1BQXA 2CJ9A 4B3TJ 2UVUA 1KDNA 2QL7B 1G6BA 1Q16B 1IUJA 2CQ0A 3P5BP 4A48A 3S8SA 5GAEI 1RGVA 4CLKA 3CCUS 3K89A 4GMKA 5DZ6A 2YNIB 3KK1B 1VR6A 2F40A 1NEEA 1RT2B 2QA4G 4QW8A 3NCPA 5CH7B 4EFAC 4ZVOB 3FQLA 1P8GA 4F4KA 4ITSA 4YN3B 4PUOB 1FE0A 4ED1A 3ENWA 4HTJA 1IBMJ 3DM2A 1Q78A 5BR8J 4G1PA 5L1KA 1GFWB 1U47A 3MR7A 4NWBA 2RKIA 5I3UA 1E6YB 4KIAA 4DU8A 2NREA 4CLWA 4OZ5A 4JB8B 2YWWA 5J2MB 3MM8A 3NS6A 3EUNA 4O23A 5KFFA 4DSLA 1RKJA 4EBDA 3JQMA 4OYOA 3SYZA 4G1IA 4F67A 1HPZB 2CA9A 4K8RA 4ZJQA 1HWUA 5CZXA 2KKHA 2BXJA 3KK2B 2IJRA 3OHAA 5HLFB 3FUYA 2HPUA 1LWCB 3UWTA 3H5SA 4I6WA 1YIJS 2EEYA 3H59A 2FVCA 5KG0A 1AT1B 1L3VA 5KFOA 1P1TA 4DQQA 4J9PA 3CW2C 5A8RA 3SI8A 1OSDA 1HR0J 2KDOA 1KOOA 2OPRA 3CPWR 1WOPA 2W9CA 3W5XA 3CJ0A 3DLJA 1RAGB 2M7SA 2A10A 4HI1A 1X31C 2RAQA 3MZIA 4JI8F 1XBWA 1OSCA 5C25A 1OY8A 3RRHA 3OXGA 3L95X 3O5TB 4PPZA 3JAMY 4JYAJ 1UWAA 2KXNB 2J7KA 2E7WA 3QPIA 3KJVA 2B9YA 2LXUA 2D74B 1SVDA 1X5SA 1X0PA 3HDSA 3MFIA 5HL7Q 2DCUB 1BQMA 3CE8A 1SH3A 1QD1A 4NLDA 2KG0A 3IRXA 1IM4A 3AQPA 2PO4A 3JQKA 3E8OA 3MI7X 4UOGA 3ULHA 2AMCB 4NZ6A 2WBRA 4OLOA 4ZPBA 4ILRA 1G3OA 1LWXA 2QLXA 3OT9A 4LSNB 3TA2A 3TEGA 4FDFA 2AX1A 2O3DA 2ZBPA 2PEHA 1OQ3A 2Q43A 1UEVA 3VV2B 3N6LA 4G65A 3UN5A 3HZGA 3R7BB 5ETKA 2H54B 4QU7A 2W2QP 1FXDA 4PXCA 3O3LA 3TZXA 4TY9A 5E3RA 4LF7F 1JKHB 2ILYA 4EGLA 2Y3YA 2C2RA 2ZBQA 4UY85 5FD1A 4NLPA 2JVRA 3AD9C 3LP0B 3MCSA 1U2FA 2A0FB 3TWZA 5FLXU 3VQTA 2RQKA 4NRUA 3DKDA 4I56A 4ZMMA 5FDLA 2YH0A 2AV5A 1C1BA 2F8MA 3MMCA 4CO5A 1YJNS 3SFUA 2WHOA 4C3LA 5M2RA 3OLAA 2MZRA 1WOOA 3PZPA 2KRRA 3GJRB 4KTQA 4HHJA 2UVRA 2XO6A 3PY8A 4NLGA 3O6QA 3NBPA 1S59A 2V69A 3IWLA 4DR6F 2U1AA 2V4RA 4ECTA 2EFNA 2HRTA 2D69A 5D0RA 4B3TF 1ZAVA 4MAKA 2BOPA 1PJ6A 4KO0A 2KT2A 5AE1A 4IFYB 2ROPA 4H4MB 3TAMB 1HBOB 2DH7A 1RCXB 2HNDB 4B3SJ 2HVHA 5B08A 4N41A 4NXNJ 4A8KA 4JBCA 4ZVSB 1ZPWX 1S7IA 2VHGA 1IBMF 2CVEA 1U1LA 3X1LB 5BR8F 4ZOSA 4ED5A 3MMBA 1HW9A 3DOLB 5L39A 3GG1A 2R8JA 4QR0A 4ZCLA 1H2UX 1OYDA 3FZBA 4WIQA 3QWPA 2EG2A 5E3CA 2BW7A 5J1NA 1CULA 1TELA 5E3QA 1SJ4P 1QAYA 4KQZA 3GV5B 2M70A 2W7AA 5ETOA 4Q8FA 2FJBB 1X0FA 2LU2A 3OPKA 2MSSA 4NLTA 4DF4A 2LXIA 1JJ4A 1AZSA 3PEHA 2HHQA 3R3TA 1TU0B 3DNCA 2XTJP 1SJFA 2CDQA 4MKAA 3RB4A 1M1HA 4ZITA 3VAJA 1UAWA 4X4OA 2VG7B 3DI6B 1HR0F 5B09A 3F41A 2ZH2A 4P74A 2VFSA 4PYDA 2V9KA 4ZHRB 2EFVA 3IM8A 2WSFC 3LO3A 4DR3J 3KG1A 2IMOA 4ZPTR 3R1LA 2IAJA 4U67Q 4M5GA 2BJ7A 3D0IE 4MKYA 1AFIA 3GONA 3HJVA 4L3KA 2UV8A 3M30A 2DR9A 4JYAF 3GU0A 1OPIA 2N7CA 3PYFA 3K59A 4PQUB 3AB2B 2H5IB 3H7HB 4QYRA 2BRKA 4TYAA 5DDPC 4DV5J 2Q79A 1IQZA 2YQ1A 3THVA 2OMOA 2W7PA 2RDDA 5D0GA 2KO1A 4M5DB 1NZAA 1W25A 2NS1B 3BBCA 4WFXA 1M5SA 3W2WA 2BM1A 2UVWA 4D3GA 1PYOB 1U6ZA 2O5DA 2HVIA 4QCLA 3KHHA 5H9FJ 3ONQA 5L9NA 1KTVA 3QT8A 5CZVA 5F8JA 5F8NA 5KFAA 4E2FB 5KFYA 3H20A 3M2VB 2PDAA 4I0WA 1S9GA 2B51A 2C2EA 1W26A 4M5JA 4FYDA 4QIGA 4RW8A 4K2JA 1ZETA 1YKWA 4LVNP 3EVWA 1R27B 5EDWA 4RBUA 1HMVA 1LXNA 4R0EA 3TUIC 2KH9A 4WU2A 4QZVB 4M5LA 4WK3A 5E7OB 4RU2A 1QDUB 1SKWA 3Q0AA 3BH6B 8ATCB 1FE4A 2HHVA 4LFAJ 4M5MA 2WVDA 1LOUA 1VLOA 1QVFR 4ED6A 4KJIA 3PJXA 1UMJA 4NLWA 2ZH8A 5GMEA 3GFHA 4KHMA 3OR2B 2HGMA 2MKHA 4P2SA 4WFAQ 3N5BA 2XI2A 1V6HA 1PYTA 1S72S 1TVRA 4NZ7A 4QR2A 2V34A 1YRXA 2F5GA 3ICLA 4NLYA 3DRPB 2MKIA 1SL0A 3U27A 2XLJA 4MIAA 3I4PA 2YWFA 1GMUA 4AUKA 2HWIA 3WHIA 1NJWA 4LJMA 2C2OB 1WD6A 3TA1A 1NUEA 3PO5A 3I96A 3BGOP 4ZDNA 2MXYA 4DZ6A 2VBWA 2HW3A 2HFNA 4B3SF 2WZ1A 1FVSA 2VC0A 3SSQA 4NXNF 2B8PA 2FLLA 4HDHA 2IYGA 3DU5A 1QSSA 2QJ3A 1H74A 1RHQB 1XJWB 3HD2A 4JI6J 2ADCA 3QJJA 3JSBA 2W2MP 3BBFA 2HNZB 2A3JA 3KMQA 3ITHA 2K3KA 4OX9J 2CXEA 5HN0A 1R3NA 2V5HG 2F8HA 4Y28C 2ERRA 4V19J 5EWFA 2PE8A 3HFVA 4WPAA 5LL6d 3BBBA 4DX7A 3CJTA 4ZVTB 3M1VA 4IOAQ 3MPVA 1U48A 4HKQA 2FLPA 2NR0A 3EVMA 4F50A 2H65B 5D4PA 5T41A 5MLCV 1VIXA 3I0RB 2R2SA 2OKQA 4WIIA 2V6AA 1XR7A 3FK4A 5KT6A 2X3GA 1HNZJ 2R8GA 2BQRA 2GW8A 1RXOB 4RNOA 1ITPA 3W3SA 3GP9A 1ZM3A 4OYIA 2QFIA 4DR3F 1IM6A 1HL6A 3ZXWA 1BE4A 1D8YA 3PW5A 3OXLA 2XMWA 4GKKJ 4QJVA 2IDLA 3LTOA 2RQCA 3UO0A 2BQ3A 1GK8A 2ZC3A 4C7QA 3M2RA 3UPFA 2OSRA 3R6LB 1X9MA 3CCZA 1ZPVA 3Q8SB 5DGAA 2DRBA 3MEGA 4DV5F 1IN0A 3FZ2A 2K1RA 3IS9A 3WX8A 2OSQA 1YBAA 1RA7A 3NGDA 1UW9A 4I7FB 4DSIA 3ZZTA 4YFUA 3BS9A 1MSWD 4C97A 1M90T 3HM9A 4NA3A 3ZZUA 2BV3A 3L4BC 4AE5A 3JB9k 1WHVA 4DEZA 5GAHU 1VQSA 2AJ1A 3FFIA 3HCXA 1LK7A 2XSJA 4X4NA 5KFVA 4FKXA 1KQKA 2M5YA 1U7LA 3MM5B 1REVA 3ZTOA 3JAMU 2ZJRQ 1NHUA 5IT9U 1T9WA 1LWFA 3LW5C 1I94J 3RU0A 3Q22A 4RNMA 5ITHA 2JSXA 5AXKA 2E1MC 1RA6A 3DN9A 2DGXA 3O2IA 1F3FA 3ZTSA 2N4DA 3MPWA 4OYXA 2P9EA 2KVQE 2M0GB 3W63A 5ETMA 4LFAF 1LEOA 4P2FA 2C2ZB 1TL3B 1XERA 2HFOA 4KV8A 2CPXA 2DCLA 1RU2A 1RBLA 3TI0A 2C3UA 2G0CA 2PSZA 3J7YI 4USVA 5FIIA 2R8HA 2DHGA 5D4NA 2LMIA 3HHKA 3PW7A 3V2UC 3FEYB 1ZTTA 1RUSA 1IKVB 1HARA 2HQFA 2DT9A 2XEXA 3NS5A 2FHOB 3LP2B 2F7VA 3MUVP 1RTZA 4OYPA 4F4XA 2VFVA 5AXNA 3NLCA 4C0HA 5J2QB 5EN1A 4KPYA 4NLSA 1IWAA 1RT6A 4L72B 2L3MA 1R31A 4JI6F 1U0HA 4NE9C 2ZC4A 5E5NA 1XC9A 3RAQA 3HVRA 3AFGA 2ILZA 2B5JB 1C0TB 4OX9F 3CCTA 4FF2A 3MR2A 3C3LA 1B0TA 3Q2TC 2QA4S 3HHLC 3C6TA 2LEPA 3RRKA 5EX3A 2CRLA 2GJ2A 4N77A 3BO2A 4RW6B 3QSYB 1CJUA 2NXNA 3UW1A 4PQAA 3EGWB 4J9SA 4I2PB 4EYHB 4DX6A 4DUTA 2OPPA 5ADZA 2YNGB 2HSEB 2FD2A 1IR2A 4L74A 3RAXA 2CQBA 4RW7B 3AD8C 4N47A 3P6YC 1HNZF 3UQSA 3GZ7A 1F2HA 4WF9Q 3OTEA 4CQ1A 4MFBA 5CD4A 4JI1J 1KVKA 3BSAA 1CQNA 2OP5A 3MCNA 2VDHA 2XZDB 2IC3B 1CQMA 3NNHA 2LEBA 8RUCA 1FDAA 4N76A 4LREA 1KHVA 3WX4A 2V63A 3M8YA 1EB0A 4I4BA 2RB7A 4GKKF 5DDOC 4NLXA 3VGUA 3V6DB 1ZYQA 1WKJA 4LR9A 2VL1A 2HS0A 1TV6A 4IOCQ 5D0HA 5D6GA 2YX4A 5KAKA 4X66J 1HIYA 2ZM6J 3DC2A 1KLMB 2Q1LA 1HHQA 3FRYA 3ILIA 4WXOA 2XMAA 1VJWA 2D1CA 3D68A 4N8NA 4TYBA 4NLRA 5GADU 2FHJA 1KD1T 3W1YC 5J2PB 1R0AA 2GVZB 1H72C 2FGCA 2YKPA 4IRCA 3HHLD 2MGZB 5KFIA 1PBUA 2CIMA 1FRHA 1GXUA 4ZCKA 1XQIA 2AYMA 4NMLA 2WSCC 1B7YB 4LF5J 2C3PA 4F25A 3M8QB 1N0VC 4XK8C 5DGBA 4MK9A 3MOJB 3C14A 2YNFB 3SQGA 3SSSA 4Y0FA 3D66A 2E7VA 2VFTA 1HD1A 1I94F 5KFBA 2VPZB 1WC5A 2QTWA 2O66A 4K0KJ 3RB3A 1FTRA 4Q43A 2R2TA 2FIUA 1RU1A 2BA9A 4MTPA 4P7VA 2UVVA 1MWYA 3LALA 4DLGA 4ECXA 3QIDA 2EBGA 5KG7A 3RBDA 3P45B 2KFYA 3KYLA 1WTBA 4B02A 1Z1ZA 2HQ3A 4CO2A 4QYZK 2XNRA 2DNZA 1RADB 3IM9A 2VG5A 1FKPB 1LKZA 5IWAJ 2RE1A 2KB2A 3MR6A 4PPDA 1S1WB 2HAFA 2MPUA 2B43A 3ZNJ1 4KYZA 2P5VA 5IM0B 2VG6B 3IRWP 1VCTA 3I0SA 3KJNB 4OHWA 1RTDB 2V2VA 1I1GA 4A8YA 1JLFA 2M52A 4O3NA 4UUXA 5EWGA 2AHOB 2KJWA 2ZHOA 1CJTA 3PIOQ 2NYHA 2AJFE 2EVZA 3CB4A 5GAGU 3FBEA 3M6VA 2OPQB 1UFLA 4O44A 2XYPB 4GVBA 3Q8UA 3MAAA 1XN9A 5K8NA 4CO3A 3QO9A 2OLWA 2LEAA 3W8PA 1HNVA 4F02A 2BEFA 5HROB 1S4FA 1H98A 2DNRA 2HMIB 5HJYA 1UL3A 5B0CA 3OLBA 2VFUA 2OFGX 1NCLA 1MMNA 1D9AA 2R2UA 5A0YA 2PA8D 4AT1B 1RLDA 3IP0A 1JLAB 3QGGA 3BSCA 5F8HA 3FMBA 2GVDA 3DRYA 1JLQA 3NAIA 4CCHA 3RBZA 3Q8YA 4XDDA 3KDNA 1J27A 4KR0B 1RT3A 4DMZA 4ID5B 5EGYA 5H9EJ 3PHTA 1RTHB 1OS5A 2C2NA 3QQCD 4A47A 1UWBA 4HT7A 2GA7A 4ZS6A 3I9V9 4UOCA 4MKBA 4C8YA 1LV5A 1RJJA 1U6FA 4DUYJ 5IFMA 1JLGA 1DQAA 5DQHA 2D41A 4JI1F 4DL3A 2GAGC 2ZUAA 2QN6B 3G8QA 3K58A 3NMAA 2EXUA 3RB6A 2E1AA 4E8UA 3P49B 4IG0A 5F0WA 1QTNB 4FPRA 1K73T 2KRBA 1Q81T 1HNXJ 3KLEB 1KQSR 4ED4A 2KFNA 5DG8A 4WJBA 1LW2B 2MHEA 5IT0A 2D9OA 1C4CA 4OHVA 4X66F 2ZM6F 3G82A 1TK8A 2EC2A 4AL7A 3B54A 2DBBA 2NLWA 4Y3CA 2VIHA 4PXDA 3UVJA 5SUHA 3DOMA 4IRDA 3QLHA 1SCJB 5B7WA 4ECVA 1RQ0A 2BJ8A 4PR6A 3R5BA 4P2XA 2HRYA 4U96A 4J9OA 3FEZA 1C2PA 4CNYA 2SXLA 2ACMA 2RS8A 2QC3A 1YLXA 4DF8A 1YVFA 4FYXB 1X4FA 1T05B 2IBKA 3H0PA 4ES2A 2K7KA 1XR6A 4DG1B 3G2XA 3B4DA 5BYRA 3ZO7A 2XZWA 5A76A 4IG3B 4LF5F 2HFZA 2MY8A 1DFDA 6AT1B 4A8FA 1B64A 2BUNA 1EHWA 4CDIA 1HBNA 1Y5IB 2R3VA 2ZD1B 1FRJA 3L7OA 3BR8A 4LF8J 9RUBA 2V4JA 1UVIA 2FLOA 4C8ZA 4NA1A 3DXSX 3BGRB 4K0KF 1FI4A 3KHGA 1M5HA 1UA0A 1WC4A 3ENQA 1DLOB 3PACA 4A8OA 1RT7B 4OX8A 3I32A 2LECA 2AT1B 3LGNA 4PWWA 1EQ0A 2AQ4A 1HQUA 2CQIA 2DGVA 3CF5Q 5KFEA 3FEXB 3TUZC 1T0TV 2J6UA 3VQSA 3PNIA 5IWAF 1WI6A 1X4BA 4UF4A 4K4TA 2DGTA 1YRTA 4WK1A 1B70B 1R8CA 4C6AA 1S12A 2V9WA 1Q5VA 2HQCA 3IG1A 1DQ8A 1Y11A 1JNRB 3Q23A 4LUBA 2Z8QA 2V8HA 1HQEA 1HBMA 1LW0B 3DOKA 4DR5J 4F3OA 4DR2J 4K5SA 1AA1B 2ZDPA 3DGPA 5LOQA 5IQQA 1PAUB 4KHRA 3RTVA 1DTTA 3MM9B 4O4GA 2YWHA 5JVHQ 4OHYA 1YZ6A 2XBPA 2W8KA 2QMUB 4TY8B 1W7WA 3THTA 5U47A 1U8WA 2CZ9A 2RILA 4IO9Q 1SL2A 3MTKA 4DPXA 1VHIA 8AT1B 3BJYA 1H6KX 2QSFA 2KT3A 4O3PA 2EK6A 2V8VA 4DI6A 3TR5A 1X4AA 2QL9B 3GQCA 3HZEA 1YK9A 1LQ9A 3OL6A 4OZ2A 1S4EA 3IWNC 1IKYB 5C2CA 3WZ0A 2YNIA 3N6MA 4N7TA 4PKDB 3KK1A 3QWUA 3QJLA 3NMRA 1RT2A 2CWKA 3UDLA 3R5AA 2E1PA 4WFZA 1YHQS 2QLFB 1Y10A 1AB8A 3QRQA 1L3KA 1E6YA 4DUYF 3BQ2A 4FS2A 1S1UB 3CD5A 1B3TA 1YSJA 1KLNA 3GWCA 5J2MA 4USJC 4J9RA 1I5OB 2C28A 3CEDA 2CQPA 1N5SA 3S1TA 1HPZA 5DG7A 3SZ2A 1T11A 3V4IB 5C42A 1HNXF 4O0IA 1HI1A 2VQFJ 3GYXB 4ZPDA 3KK2A 1L3TA 2RMLA 5H9FK 3CIZA 2C3OA 4NLOA 4FBTA 2EPIA 2FPHX 4QIVA 1KWMA 1RAEB 1KTQA 5KTQA 1S6OA 3D1OA 2GX8A 3Q8QB 2IJNA 3GIIA 4CLFA 1WG5A 2QMWA 4DWIA 3BN7A 4NL5A 2KN4A 4JV0A 5K9FA 3QT5A 2V67A 4TNOA 3CWJA 1UPPA 3R5GA 1N5YA 2FDNA 4V19X 4DR7F 2KVIA 3QIPB 3A12A 4XPCA 1QAXA 2HZAA 2XYHB 2ZOGA 9ATCB 5G4DA 5HQ8A 2MB0B 3GE9A 4CWBA 4WCEQ 5J2NB 4LF8F 1XNRJ 3KLGA 3MXHP 3ZFVA 1FX2A 4J9LA 4E98A 2GV1A 2HNYB 2WOMB 3R5JB 1RAFB 4LQ9A 1X4EA 3G8TA 4KFBA 1V3RA 2OGUA 5AXLA 1LNQA 4LSNA 4ATNA 1SB6A 3QT6A 4NCGB 2JC1A 1PYSB 3SCJE 3C6UB 2FHKA 4C0OC 4TU7A 1RHRB 3LGMA 2AEMA 2VC1A 3RW7A 1RZMA 3E01B 3HKWA 4ILMA 2OPSB 3CVKA 3UDCA 3R7NB 3VGSA 1K1SA 1JJ2R 3BDEA 1WEXA 2U2FA 1N88A 3G6VA 3LP0A 3D9BA 3K5MA 5JUMA 1KHWA 3CC7S 3P96A 5KG1A 2DNKA 4UTGA 1BHNA 1UJ6A 5DETA 4C8OA 1HWKA 4I6YA 4PAAA 4B08A 2CPHA 1S1TB 3Q8VA 4DR5F 1EKSA 4RW9A 4DR2F 2UUBJ 3ZZ0A 4Y34A 2IA6A 4H4OA 2GZOA 1S76D 3KHLA 2J76E 4PG7A 1PAEX 3AOBA 4B9UA 2P8IA 4XIUA 2EWHA 4CM0A 5IZHA 4ED0A 5ETPA 3BSOA 4G1QB 3V6KA 5JJBA 2V4QA 4FNIA 3GFZA 2YPYA 4J9MA 2IRUA 5D4LA 3ZNUA 4BHQA 3ZTRA 4DBQA 1N5QA 4NLUA 3EE3A 2C42A 4K59A 2NZ4A 1N6QB 3NGKA 2ZBRA 2OELA 2XLKA 3PCOB 1N54B 1HNWJ 1HBUB 1RK8A 4D3HA 1RHMB 4H4MA 3TNVA 1HBOA 1ZOTA 3TW0A 2A6OA 1SV5B 2ZJPQ 3UCUP 5L8RC 2DHXA 5B0GA 4PG8A 2Z57B 2CPZA 1PSDA 2LCWA 1O0PA 4YDXA 4CTAB 1G2EA 2E5GA 4AL6A 2K3IA 2GCFA 5KFSA 2CQHA 1HYSB 3R9LA 2IM1A 3W5ZA 4WXWA 2QYCA 4USTA 2QLJB 2R42A 2J6TA 2Y8WA 1U1OA 1DQ9A 2XMKA 3AQOA 2CFXA 2PT0A 1S0NA 3M8PA 1AFJA 5KFKA 2VQFF 1KQFB 5M2UA 4Q2LA 1WC1A 2MQLA 3ENVA 3O8WA 2UXDJ 2LU1A 4B9LA 3Q86A 4U7CA 4USHA 5CA5A 2NXCA 1R0CB 4KAIA 4B3OB 3X3UA 1DHMA 1YJRA 2DR6A 3DI6A 1TL4A 2YTCA 3CJSA 3Q83A 1NSKL 2VF3A 5CAAA 2DTJA 3KLFA 2BKNA 3M8SA 3G6ES 1L3SA 3CTRA 2HVDA 1HWLA 1NKCA 1BWEA 3DLBA 1ULRA 1WKKA 2GMLA 4H4KC 1XNRF 2ZKTA 3DM2B 1T9TA 1KN6A 4M5DA 2R7TA 3BF4A 4TLRA 1VDHA 3RR8A 3PIPQ 2RKIB 2WVEA 3JSRA 4ZLJA 4CYUA 4NZ0A 4ZIVA 2FVPA 3HHNB 5I3UB 1WNEA 2XC9A 3T1YJ 1S1VB 2VA2A 3UD3P 2L41A 4IH7A 4WYLA 3BO3A 1F5BA 1TUWA 2HHSA 2KTQA 2YVSA 5H1SV 1Z4UA 4QIEA 3KLVA 4DV0F 2RVJA 2MY7A 3VGVA 1RLCL 3E3XA 2DGQA 1A7GE 2VONA 2CDRB 1RTIB 3W8GA 2FVRA 4DDFA 2QV6A 2N3OA 2PFDA 4QW9A 2CQ2A 5HAOA 3GSDA 2CQDA 5A8RB 1BLUA 5L38A 4WU3A 1BQNA 3CCMS 2OPRB 4DS5A 2A2CA 4ETXA 4DCJB 1UJ4A 1KONA 5F8GA 3WQPA 2UUBF 2R8KA 4TKTA 4DQPA 1Q82T 5C25B 3OR2A 1IKWA 1TZ0A 1U25A 5F0UA 1CJKA 1REGX 4C11B 3PTWA 1XMOJ 1TFWA 5KOXA 1L5UA 3DRPA 3GJQB 2GJFA 3VHQA 1XMQJ 2AF6A 1BQMB 4IH6A 4OJ1A 4DV3J 2F3JA 5B0BA 3IRXB 4I67A 1U1NA 3DRRA 2CQCA 4Z37A 2CNOB 1LFWA 1HNWF 2DEJA 1Q7YT 1JJCB 4CLZA 2UXBJ 1KS2A 1QUPA 2F9DA 3I5AA 3RGIA 2W4DA 1YG0A 4ZP6A 2VZ9A 3MGJA 5L9XA 1TKDA 2NCKL 1KP6A 4K4ZA 3CD7A 1K44A 4ECZA 2EG1A 2EFGA 1X9WA 3PKYA 1F1BB 2DJWA 2VDIA 1VGYA 4ED8A 2HAIA 4BS2A 5KFHA 4DU7A 4F0HA 1T95A 3EJMA 5A8KA 2XI3A 4A8WA 3LPEA 5GVQA 1KC8T 2CZ4A 1QVGR 2B9WA 3DFEA 4LR7A 3W65A 1T3NA 3JYTA 3CD6S 1Y4ZB 4BWMA 2I9SA 1J2VA 1GMVA 2FB0A 4YR0A 3GR0A 3D1HA 1C1BB 3JSYA 3MMCB 3PHEA 2FQQB 2M9KA 2UXDF 2BZ2A 1RWPB 5KOWA 2L9NA 2B4UA 4ZVPB 2FVSA 2DRDA 1TL5A 4ZLNA 4ZN1A 3KUEA 2BRLA 3H5YA 2MKSA 2YBVA 3WC0A 2O67A 3BH7B 3FBFA 4NYPA 3BB5A 4DQIA 2DB1A 1NKBA 3LGHA 2F4FA 4RNFA 3HO1A 4KO0B 3J80Y 1QE1B 2RF2B 2AJ2A 1EQMA 3W2VB 3OFHA 1R0BG 2AJ4A 4URSA 2MLYA 2YKMA 3H8YA 4HVZA 2M2BA 3SXLA 2J9DE 2UP1A 2W8LA 3I56S 2HFSA 1TQLA 1P27B 3MM6A 4W92B 3W60A 2V8DA 2ADBA 1QM9A 3HSDA 4GO7X 4KGZB 3L7UA
chains in the Genus database with same CATH topology
1VQSA 4CO1A 2DK2A 2E5LF 1CG2A 3R27A 2XY5A 2AJ1A 3T9ZA 4PG5A 5DM7Q 1MMDA 2VASA 3FFIA 4GC7A 1LK7A 2LDIA 1LWEB 1QE1A 1JIHA 2RF2A 3NWGA 2XSJA 4AXJA 4X4NA 5KFVA 5KT5A 5I4MA 2WK4A 1KQKA 2M5YA 1RT5A 3W2VA 2FJXA 1U4BA 1U7LA 3CMAS 3MM5B 4I7FA 3T5HA 3L3CA 1WF0A 1REVA 1JX4A 2W25A 5KFGA 2MZQA 3CUNA 2ZJRQ 3T1YF 1NHUA 4FF3A 5KFXA 1A9NB 4ID5A 1LWFA 3MEKA 1U1RA 3LW5C 4IDKA 3OVAA 3NRBA 3RU0A 2KU7A 3I6PA 4P6QA 4A46A 3Q22A 4KV8B 4RNMA 5ITHA 2JSXA 6FD1A 1FCAA 5AXKA 1FD2A 2E1MC 1RA6A 1V3SA 2JOQA 5A8WB 1HA1A 1U1KA 3DLEB 3P3DA 4G3IA 1C1CA 1O8BA 4WFNQ 2IVFB 3DN9A 2HG4A 2XHWA 2DGXA 1VQMS 1Q4RA 3OV7A 2HS3A 1LWEA 3O2IA 2NYIA 1DARA 1U26A 2N4DA 1BD6A 3CJ2A 1H2TZ 3MPWA 4LT6A 5LJ3Y 1U1MA 2P9EA 1K9MT 4TQSA 4PWUA 3KNGA 2M0GB 2YWGA 2RDJA 4LFAF 4QWBA 2X1GA 1F0XA 5LXYA 1H2VZ 2YH1A 4LFBF 2KZZA 2WSEC 5THWA 2ZZNA 4O3OA 3SDEA 2ZH3A 2B4PA 1TL3B 1FA0A 5GAHI 2XCAA 3MEDB 2HHXA 1XERA 4O3SA 2HFOA 2P9CA 4KV8A 2GMHA 2CPXA 3DRSB 3FVYA 1U6BA 2DCLA 4AXIA 3TI0A 4LSLA 4I69A 3MM7A 1QY7A 2C3UA 3DLEA 4YB5A 2ZUGA 3C2PA 4YB7A 4DOZA 2VODA 4ETZA 1AW0A 2G0CA 2PSZA 3J7YI 2QMXA 1N6QA 2PA3A 5FIIA 2CQ4A 2PIIA 3M8PB 1LW2A 2R8HA 2DHGA 4ZVGA 5D4NA 2LMIA 3T9NA 1TKTA 2PD1A 3HHKA 4QPXA 3PW7A 2PMZD 2UUCF 2DR8A 3V2UC 4ECRA 3F56A 5AE3A 3MF5A 3FEYB 1RDRA 4ICLB 4QR1A 3CCES 1HD0A 3IO1A 1ZTTA 4CH0S 1VQ8S 5T7LB 2XG8A 2EI5A 2IAJB 5F3ZA 3PV8A 1IKVB 4HLBA 1HARA 5M2PA 2YY3A 3H98A 2MDAA 5KG3A 2P6TA 5HP1A 4PWDB 2HHTA 1U49A 1VQKS 2XS7A 1SKRA 1S9EA 2DT9A 1L3UA 2QZ8A 1FVQA 4J5OA 2XEXA 2XCPA 3LPYA 3NS5A 3UCGA 1Y5LB 2FHOB 3K5PA 3M30B 3LP2B 2CQ3A 1RAJA 1ROFA 1VC5A 4YUDA 2F7VA 4P7TA 3LQVA 3UFCX 3O1LA 3VAGA 1D1UA 2W9BA 3MUVP 1U1PA 3A1YG 2IYIA 2GJIA 1XMOF 2XGPA 2HYIB 3P5TL 1VQLS 3WDOA 4J9KA 3MUTP 4F4XA 1SJ3P 4YR3A 4Q0BB 2VFVA 3SCLE 3K8VA 4RBTA 4ICLA 1XMQF 5AXNA 2KXFA 3NLCA 4C0HA 5J2QB 4DV3F 2DPJA 3KLFB 1T05A 3HVTA 5EN1A 4KPYA 4NLSA 1RT6A 3C6TB 4L72B 1WEYA 2ZJQQ 3BGLA 4DG1A 3PRDA 1WI8A 2L3MA 1E6VB 2Y1RI 1R31A 3DMJB 4IYQA 4JI6F 3M9OB 1G1XA 5KFJA 2POKA 3TO8A 4ECYA 3W2WB 2DNLA 1F9FA 3PX0A 1S79A 3TVZA 2ZC4A 2QEXS 5E5NA 1PC5A 1XC9A 2FUG9 2E29A 3RAQA 5E3AA 3HVRA 2ZH9A 1FTCA 2OPPB 1T7PA 2ILZA 1DRZA 2B5JB 4CO4A 1GX5A 2UXBF 1C0TB 4OX9F 4RNNA 3LH2S 2DR7A 3AJ1A 3BSNA 3UE2A 2XB2D 2B56A 1YTYA 3CCTA 3OTBA 4Q0BA 1VRUA 4FF2A 2ZDOA 3MR2A 4C0BA 1G7CB 2A2DA 1S1XB 2LQ9A 3C3LA 1B0TA 5KFRA 1MNEA 2B7BB 3BGRA 1WELA 3Q2TC 4PG4A 2QA4S 5LJ5Y 2I5JA 3HHLC 3C6TA 1P6TA 3W7BA 3M32B 2LEPA 3RRKA 4J9QA 1NO8A 3B8HA 3PR4A 5EX3A 5J1EB 2CRLA 2GJ2A 4UW2A 3O44A 4MFBB 4M1KA 4N77A 4ZCMA 4OX7A 5F3TA 3CJ5A 2FJVA 2JEFA 1T3OA 3I4HX 1M5PC 2ZH5A 4RW6B 3BO2A 1VS3A 3UW1A 4PQAA 1RT7A 4X84A 3EGWB 4MYUA 2V2KA 4I2PB 2NSCA 4J9SA 1WHYA 4N8OA 4EYHB 3FCHA 3HPOA 4LMZA 2G13A 2OPPA 2GGPB 3B82A 4QPTA 5KG5A 4FBUA 3E2EA 5ADZA 2YNGB 2IRYA 3PFEA 1XWLA 1UVJA 4EWTA 3AA9A 2FJDB 1K8AT 2HHWA 3I82A 2FD2A 1LXJA 5F8MA 3QGIA 2PMHA 2RRBA 2VH7A 1SQEA 2M3DA 5T14A 4F3MA 3RAXA 4KHPF 2CQBA 1S1XA 4TN2A 4RW7B 3G71S 3POTB 2FJWA 3OFFA 4N47A 3P6YC 2VD3A 4OJGA 3UQSA 1HNZF 3GZ7A 1QSYA 3M32A 4H4KA 2AJQA 3ZC4A 5DDQC 2C3YA 4WF9Q 5J1EA 3OTEA 4OL8A 2LLZA 4CQ1A 1PC4A 4MFBA 4N56A 2MKCA 3U7JA 5CYMB 1RKIA 1WHWA 2MZSA 4RW6A 3BSAA 1RYRA 1VK3A 1CQNA 1UVMA 2OP5A 3MEEA 3PW4A 4I2PA 3N5FA 3KWMA 3N28A 2IC3B 4JOUA 1Q1KA 1CQMA 3NNHA 4ID8A 2LEBA 1F5CA 2VPYB 3C46A 4Y00A 1FDAA 2YNGA 1HFEL 4ED7A 1NH7A 4N76A 5KFNA 2JJ4D 1KHVA 3QGPA 3WX4A 4IR9A 3OBIA 2OIHA 3EZUA 1SL1A 1YWXA 2QE5A 1R6YA 4OI6A 3GIKA 4DQRA 1VBYA 1GXTA 2VKZG 2DHSA 4I4BA 2AX0A 2CPIA 2RB7A 2V0NA 4Y2AA 2ZOFA 3DLGB 4GKKF 3POTA 4NLXA 2LXFA 5DDOC 3V6DB 1ZYQA 5BYQA 1TVRB 1QAIA 4Y2CA 1NJZA 1BQNB 4A8MP 4DR1F 1LW0A 2GO9A 1UP1A 4EYIB 2E1CA 1R0AB 1SBRA 3MAQA 2HZCA 2GIRA 2BJEA 2VL1A 2HS0A 1TV6A 5CYMA 4IOCQ 3CULA 2IM0A 5D6GA 2YX4A 5KAKA 1RISA 3VZHA 1OQ6A 1S9FA 2QT7A 7FD1A 2E5HA 2HRUA 3KFWX 4USIA 2ACYA 3DC2A 1KLMB 4TLQA 2Q6CA 4TU8A 2VFRA 2ZH6A 2Q1LA 2R7OA 3MR5A 3EPIA 3SCKE 3FRYA 1IBLF 5KFCA 1S99A 2J5AA 1K1QA 2IM3A 2IRXA 1IKWB 4WXOA 4PXEA 1VJWA 4TY8A 5CD4H 2ASDA 2D1CA 3DLGA 1KVJA 2XSFA 2P6SA 1GQEA 1SH2A 3VCDA 4CH1A 4N8NA 4YDDB 5CCMA 4TYBA 4NLRA 5GADU 2FHJA 2HGLA 3ZZOA 1FJGF 2NUHA 2CPEA 1KD1T 2VOPA 3NP5A 5J2PB 1R0AA 5FLXY 3G96A 3EXYA 4KE5A 1NRKA 2RQMA 2E5IA 2FGCA 2RDIA 2PC6A 2YKPA 2WAQD 4A8XA 4PUOA 4IRCA 3HHLD 3HVAA 2MGZB 5KFIA 4MIBA 5B0FA 2YKAA 3GILA 2CIMA 3NAHA 4K4WA 4C9DA 3PM9A 3AHPA 2KT5A 2RS2A 3RZAA 5SZTA 1FRHA 4RUHA 3EX7B 3E51A 5DS7A 1N8RT 4K4SA 2L48A 1GXUA 3G8SA 4JV2A 4ZCKA 1Y5NB 4NMLA 2AYMA 3M2UB 4R8UB 3M8RA 1IKYA 2XY7A 3KG4A 2WSCC 2UZAA 3DRRB 3NNCA 2RUGA 3IR7B 1GT8A 4ALZA 3CC4S 2C3PA 4DR4F 4B9TA 2O01C 4F25A 1RI7A 2VPXB 3M8QB 4FP9A 3K8WA 3VAFA 1TK0A 1N0VC 4XK8C 5G0RA 4ZPAA 5DGBA 4MK9A 2JWNA 1GAOA 5IQ6A 3MOJB 2YNFB 2FJEB 3JTOA 2COLA 3SQGA