1CULA

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
molecule keywords TYPE V ADENYLYL CYCLASE
total genus 62
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1culA00
2WZ1A 4CLTA 4CLKA 2BW7A 3G82B 1CJTA 3R5GA 1YBTA 4OZ2A 4P2XA 4OYWA 4CLZA 1Y10A 4USVA 4CLUA 3C16B 1CJTB 1YBUA 1Y11A 3G82A 4OYAA 4WPAA 3MR7A 1CJVA 5D0RA 1CULA 1CJUB 4OYBA 1U0HA 4P2MA 4CLLA 3MAAB 5D0HA 3UVJB 1TL7B 3C16A 3C14B 2GVZA 3C15B 4OYIA 5D15A 5IV3A 2W01A 3ET6A 1YK9A 4P2FA 2GVDA 2QV6A 4NI2B 1FX4A 1WC0A 4USWA 3UVJA 4CLWA 4WP3A 1CS4B 4OYXA 2GVDB 4WP8A 5IV4A 1CJUA 1U0HB 4USTA 4OYPA 1CJKA 1CJVB 4OZ3A 4USUA 4NI2A 1AZSA 4CM2A 4CLSA 2GVZB 3C15A 1WC6A 1AZSB 3C14A 3ET6B 1TL7A 1WC4A 1AB8A 4OYZA 4CM0A 1WC1A 5D0GA 1CJKB 1CULB 4CLYA 4CLPA 1WC5A 4OYOA 1CS4A 1WC3A 5D0EA 1FX2A 4OYMA 3MAAA 4WP9A 4CLFA
chains in the Genus database with same CATH superfamily
3GFYA 1OYDA 1TKZA 3QSIA 1NU4A 1PJ6A 4X4PA 2HFNA 5ETMA 2ZVIA 5D4LA 1RWVB 2IC3B 3H0PA 3E51A 3NGKA 2MLYA 3IS9B 3MFHA 1NJZA 4LRFA 2J5AA 2KZZA 1WF2A 2YPZA 4QQBA 3GQCA 3BR8A 2L9DA 4GC7A 3GCWP 4F0MA 3WC2A 3MM8B 2KJWA 1V3RA 3DYAB 1T02A 3MMBB 4F26A 3TZXA 4DLEA 5LL6d 3W9JA 4YR0A 2XMJA 5K20B 1U24A 1TK0A 3GR1A 3HSDA 2MHNA 4CLUA 4Q2MA 2A1BA 1MROA 2CZVC 2DXFA 4KV8A 1Q7YT 3PKMA 7FD1A 2B5JB 3M6UA 4KSEB 1S9EA 4PUOB 4FF1A 4LBIA 2GHVC 5F8IA 3FMWA 5EWFA 4OYBA 1NJXA 1UAWA 1N0UA 2DNOA 1NSQA 3HJVA 1JJ4A 1D0EA 1S9EB 2OSQA 3L95X 2ZH6A 4XPCA 3VVTA 2W7PA 2ILZA 1YJNS 3BO4A 1KN6A 1YRUA 4AQYF 4NCBA 2DNLA 2GMLA 5EUHA 4DZ6A 1VQNS 1D8ZA 1UVKA 2IYIA 3KWMA 4QWCA 1RABB 4K4WA 2FD2A 3UCGA 3DRYA 4RNMA 1RT3A 3PO5A 1YIJS 1UVIA 3H5SA 1R3NA 1RT5B 3IS9A 1U26A 1KBRA 4XK8C 3GR0A 2WBMA 4WF9Q 5AXMA 2IHR1 1HMVA 2AZ3A 2JWNA 2KKHA 3D5MA 5B0AA 9RUBA 1KQSR 3GYNA 2Z57B 3BPDA 2XQCA 3OUYB 2B0GA 3GWCA 3PW5A 3SCJE 1H38A 4NXNF 1QE1A 1N36J 2GA7A 5KFNA 2J8SA 3NGSA 2EG1A 3ZZYA 2I5JA 3H5XA 3MEDA 1SC6A 4IQXA 4DR6J 5KFQA 4R0JA 4M5MA 4PWDB 5E3RA 5HROA 1FX4A 1WC0A 2KT5A 3H42A 3BS9A 3CTRA 3DU5A 4TU7A 4ECTA 1XMOF 4OYXA 3M30B 5A2QY 1N34F 1JIHA 2LQJA 2EPIA 1HPZA 4IFYB 2F9JA 4KH0B 4MKAA 1N0VC 2GV1A 2ZKUA 1S7IA 3EZUA 3TVZA 4KFBB 2C2OB 3HCXA 1ZETA 2IDLA 2G0JA 2NXEA 3MDFA 3CIMA 3SYZA 4X4OA 3ILJA 3NAHA 3K8VA 1TKXB 4EO8A 4FVCA 1QD1A 1IKXB 3GE9A 4C11A 1O5JA 1PC4A 4LF1A 1ROFA 4EZ9A 4DG1B 4ZJLA 5B08A 5M2UA 1HBMA 5KG3A 2D9OA 2OGUA 1W26A 2N4DA 2U1AA 2VG6B 1YZ6A 3DRPB 3KLIA 2B3TB 4MIWA 5IC4B 2Z2ZA 1LXNA 1ZOTA 2KVQE 2LEBA 1U1LA 1UWBA 4OX9J 2LQBA 1Q8IA 4DQIA 5D77A 2NQPA 1FDDA 4J91A 2IM0A 5HSPA 2JEIA 1G3OA 4CM0A 5HO4A 3NBPB 2MQOA 1HD0A 1RTHA 4ZP7A 3HKWA 5T7LB 2CQDA 4O4GB 1V3SA 2MDAA 3FUYA 3I96A 2OO4A 4ZKAA 3DOKB 1X9MA 1URNA 2AV5A 2MKJA 2MJUA 3FSXA 2Y8WA 2NPFA 3GJSB 5H1SV 1NKBA 1EIYB 1DARA 1GMUA 2UVRA 4U8YA 3R5JB 5GADI 5J1NA 3O5TB 4DR2F 1TFYA 3M8PB 3HO1A 2YVSA 4X62F 1D3WA 1NO8A 3HULA 1DZ5A 1WTBA 2JNJA 1LNQA 2XHWA 1D09B 1XN9A 2BKPA 2R7QA 1PSDA 2ZBRA 3D6TB 2W2QP 5KOXA 1DTTB 4DV4J 1WHXA 3F56A 2VV5A 1JQGA 4CLKA 1RT2A 2KFZA 5BR8F 4O23A 3CCJS 5I3QA 1BHNA 3DN9A 3ISND 3J7YU 2OPPB 1UW9A 2JC1A 1V5VA 2HG4A 3IG1A 4C2MA 3U1NA 3EX7B 2CQGA 5LT5A 3FBBA 4X66F 4IO9Q 3SQGA 1QAIA 2MKHA 2RB7A 2XS2A 1KHWA 4DU8A 1RT1A 2G1HA 4WZMA 2QLBB 3JQJA 3M1VB 1H98A 3HHLA 2D69A 3G82A 4OYAA 4QW9A 4DL3A 2XCAA 1S1WB 3DXBA 3H90A 4LSLB 1S99A 1T95A 4CIOA 3TI0A 1GXTA 2DO0A 1FKPB 1VQSA 2RUSA 2Z4PA 4KGZB 1W2IA 4X65F 1W2BR 2J6UA 1HWKA 4ZVGA 3DI6A 2BJDA 1F60B 3IR5B 3UN5A 1SBRA 2E1RA 4J7CA 3QWPA 3NY0A 2ZITA 3S01A 3THTA 1IM6A 2GHWA 5ETOA 3QGPA 2XMMA 3BSNA 1Q8KA 4RWWA 5CXTA 5C24A 4YFUA 1VS3A 1FJEB 2ZH9A 1NBEB 1IBKJ 1S9GB 1LW2A 1S49A 4YUDA 1JNRB 5A8WB 1Y5NB 2VQFJ 3HK2A 2XTJP 2IFXA 3QGHA 1IKVB 4P9SA 3GPAA 3MMAA 1IKXA 5F3TA 4C11B 2HVIA 1Y9OA 2YNFA 4PXCA 2FLLA 4DSFA 3FDSA 1N5TA 2D1CA 2XMWA 3BN4A 3OFHA 2QJ3A 2KHCA 2ZZTA 2UP1A 2YKNA 5L46A 3KUHA 1RXOB 4G1PA 2W2NP 2Q79A 2QV6A 3KUGA 3M30A 3MD1A 3PHEA 2BJ1A 1F9FA 4RW4A 3IXQA 5LMNF 1RAJA 1XC9A 1Q0NA 4MJKA 2DR7A 1WHYA 6AT1B 4CTAA 3CF5Q 1RISA 2N4CA 4OL8A 4YEAA 2DBBA 4ZP8A 4UQTA 3IWLA 5HN0A 4GKJF 1N33F 3Q89A 4NYOA 3TJ8A 2FGOA 1KLMB 2A3JA 3OVAA 1SJFA 5K8MA 2V2KA 4K8RA 1RZMA 2M3DA 2XBPA 1KTVA 3I32A 3N6MA 4TY9A 3EPIA 2BJ7A 1MWQA 3M7VA 3W2WA 3V81B 1HD1A 4IR1A 1S1TB 1VIXA 2XMKA 2KYXA 3GYXB 4ECWA 1TQLA 2J9CA 2NS1B 3QLHA 2CQBA 1S10A 2ATLA 4NI2A 1JLAB 4DV7F 1PAUB 1RWMB 3U27A 4RW9B 2HSEB 4OJ1A 1W25A 1TKTA 3KYLA 1DHMA 4ES1A 3C14A 5IT0A 4LF9F 1JNZB 1YSJA 4IQMA 2LP4A 2Z2MA 3ET6B 1X7VA 1Q86T 4CZCA 2NCKL 3HSJA 4OYZA 5B0DA 2XSJA 2HEKA 1OY9A 3AD7C 1RWXB 3BPSP 4LVNP 4EGLA 1NZ8A 3CDAA 4N56A 2H3EB 4LRBA 3VGSA 2MXYA 4MTPA 2JL9A 3A13A 3ZTQA 4FNIA 4ECQA 1S9GA 4HT7A 5A8WA 1FCAA 3M6XA 3SFUA 4K0KJ 1H7XA 3NLCA 3D2WA 4X4TA 3PHTA 3W2VB 1R0CB 3DOMB 4DN9A 3L7UA 5LSLA 4EBCA 2HZCA 2UUBF 1YKWA 2PA3A 3BH7B 3RU0A 4CYUB 4Z7YA 4IRCA 3A12A 3P6YC 4HACA 3MPYA 3PDNA 2E5LJ 1Y5LB 3LOUA 5LSRA 4K59A 1RCXB 3AT1B 4KPYA 4TNOA 4LF7F 4MMOA 5DZ6A 8RUCA 2KFNA 3D0IE 5KG5A 3SQGB 1NDPA 2PMWA 2EBGA 1C1CB 4C4WA 1OS5A 2B4UA 2DCUB 3CO0P 3DM2B 3ENAA 3H20A 3PYGA 1HHSA 4XAKA 1Q79A 2W24A 2FVCA 2E66A 2LQ5A 5G0RB 3PXGa 1YQHA 1U1OA 1JLEA 4DV2F 2KM8C 5D4OA 5E3QA 2F63A 4DUZF 3PZPA 4V19X 3MEEB 3RAMA 4ZA1A 4R5PB 4CLZA 1UMJA 2WVFA 3MD3A 4NL5A 3W9IA 5D4PA 1T3OA 2RQ4A 3LP2A 3TYTA 4A8WA 3R1HA 5I42A 2R7OA 2IY5B 4M94A 4WFZA 2IPOB 4F4WA 1DTTA 1S0MA 2GW8A 2OPSB 2ZD1B 4M5IA 4R8UB 5A8RA 3I4HX 2DKOB 2QA1A 1OQ3A 3HHEA 4O4RA 4DPUA 5DDOC 4ETXA 1U49A 1L3VA 3FMBA 2VC0A 3M2RB 3QGIA 2VQFF 5FIIA 4DPWA 1FD8A 2RF2A 5KTQA 2KM8B 4YDXA 3CMAS 2EVZA 3HVTB 2DIUA 3CCWA 3MCOA 4O44A 4ZVOB 2YNIB 3HT3A 1S0OA 1V9OA 1SKRA 3KMSA 4ED4A 3HKZD 2AT1B 2B9XA 4B17A 4ZVRB 2YWGA 5THWA 1X0PA 2VFTA 4FZVA 4OX7A 4NXMJ 1OY8A 4F4XA 4KYZA 1DAXA 5J2NB 3VAMA 1VI7A 3BEGB 1FDAA 2OPQA 1FE0A 4O3NA 1U4BA 1R7IA 1HWIA 2CYYA 3RRHA 1SV5B 1R43A 3BYPA 4FXVA 5LMUF 1KQFB 2A10A 1G2EA 1S4EA 1J5EF 3UN2A 3KK3A 4WKRA 3MHYA 4V1Ak 3ZZUA 2CPIA 5DG8A 3H5YA 1PG5B 3H4DA 3BGLA 3FBEA 2ZZNA 3NWRA 5KFFA 2VQEJ 4R8UA 1UA0A 3SDEA 2GVDB 1ACMB 3R3TA 1N5SA 1UPMB 1WEXA 1XR7A 1P9QC 2Z8QA 3EGWB 3MMCB 3PJ9A 3PW7A 4Q0BA 4WE1B 1LQ9A 1SL2A 4QW8A 2WBRA 4RW7A 1O6XA 2HAFA 3JQMA 2EW9A 3D1OA 4WU2A 3GIMA 3Q22A 5HANA 2RQCA 4DL7A 1X5PA 4UOCA 1RWKB 5E0OA 2M88A 1HLWA 1JLEB 1TVRA 1JLQA 2W4PA 1T05A 3RBXA 1IBCB 3ENVA 4CM2A 3J80Y 2J8AA 4PABA 4JOUA 4MH8A 4CLSA 2UVWA 3V6JA 1WC6A 3B82A 2LFVA 2ZBIA 4CNZA 4R25A 4DV6J 2EK1A 3VZHA 1KDNA 2CUYA 3AH6A 1RADB 2CJAA 2X1GA 5HJYA 3ILOA 1PYSB 4USJC 2BOPA 2FC8A 4LUBA 2ZD1A 3QJLA 4K4VA 1B64A 1OJ4A 4N8OA 3J81U 5K8NA 2HNDA 3T6JA 5DDQC 5RUBA 4Z2XA 2M0GB 3CMQA 4ID8A 1ZPVA 4CO3A 4PG8A 1H2UX 4F25A 2CJXB 4YQWA 3W2VA 2FJEB 2EKNA 4KGMA 4Y3CA 1J27A 1QSSA 4RNOA 2LEPA 5D8HB 3D28A 2V2ZA 3IR7B 3R6LB 1BQMA 1FESA 1UJ4A 3N01A 5JXSA 1PO6A 2XI3A 2DH9A 1N56A 1NHVA 5G4DA 1C1BB 3EDQB 4RWXA 3HFKA 4ZK7M 3MECA 2XY6A 2FHMA 3U7JA 3K57A 1U25A 1VQLS 4YMEA 4HLBA 1KWMA 4F2SA 3KLGB 2WK4A 1IR2A 1S6PA 4L76A 2SXLA 1N33J 3OSPA 1RTIB 2CPZA 2AF6A 2E29A 2XS5A 5HLFB 3TUPA 2ZVSA 3R5GA 2EWHA 2FZKB 3OVSA 3KK1A 1JLCA 1T94A 1SL1A 4N76A 4Q8FA 3JTOA 4B9LA 1MU2A 4KRWA 1K73T 2GFFA 3N6LA 1ZM2A 3KK1B 4JI6J 4ATNA 5I3PA 4HDHA 1T9UA 1VCTA 4TN2A 5DLFA 3C16B 1S57A 3EZOA 3G86A 1VLYA 1EQ0A 4DMZA 2JC0A 5GVQA 1VBZA 5J2QA 1QM9A 1CULA 3PKYA 2MEWA 2MLXA 4WFXA 3MAHA 4CDIA 3SSSA 3QMQA 4I0WA 4ECVA 3CJ8A 3OHBA 5GAGI 2PMHA 1KONA 3P5BP 1DTQB 3EGVA 3UVJB 5T14A 2YWKA 1SKSA 3CUNA 3DGVA 4LF5J 1N32F 4LIWA 3C14B 4NZ0A 4J9LA 2HAIA 3WHIA 2Y1LB 3ELHA 1BWVA 1FO1A 1NNDA 2B7CB 2F8EX 5KG6A 4U67Q 2KZMA 4OYIA 3KG4A 1WDDA 2QL5B 4DX7A 2QIFA 2WHOA 3DLEB 4FNHA 4ILMA 2UUBJ 1Z2LA 5IV3A 1B3TA 1M5KC 2R8JA 4JI8F 2ZHAA 3BO2A 3TA1A 4YHHJ 4B3RF 1X4EA 3V81A 4JI0F 4X65J 3QSYB 4P2FA 2YH0A 2GC8A 3IWNC 2ROPA 2VIHA 3S1TA 3DDNA 2WOMB 5GMEA 4NYPA 1UVJA 1R8AA 4FYVB 2IVYA 4WWSA 2J0QD 5C24B 1G7CB 2RQKA 3MOJB 2BRLA 3I5CA 1KOHA 2GGPB 2MQMA 5HATA 2IAJB 1RTJA 3Q8VA 2LVWA 3GJTB 2YNHB 2E9ZA 4WP3A 3W64A 2DHGA 4RW4B 2VASA 3QPIA 1RAEB 4HTJA 2G13A 2D9PA 1U0HB 2CJBA 2CQ4A 2CQPA 3NWGA 4QPTA 4RW8B 4UUXA 4ZVFA 3D4JA 5C25B 3BBBA 4QR0A 4GVLA 1RWOB 2MKSA 4KKOB 2DEJA 3UD3P 3NNAA 2VZ9A 2DNPA 2NXCA 3M1VA 4U7UK 3HHLD 1YITS 3TJAA 3G4SS 2UU9J 3KJVA 1LK5A 1Y00A 2W4DA 2WONA 4Y34A 3OR1A 3SFGA 2E5IA 4QIEA 1SV5A 2ZM6J 4A48A 1ZH5A 1UPPA 3R9LA 3J7ZT 4YOEA 1AZSB 1I94F 3LGMA 3E8OA 4WXWA 3V6KA 3JTNA 2X1BA 2QG9B 2N3OA 3CD6S 1FEHA 1HYSA 1FTRA 5D78A 4B3SJ 3KG1A 4I68A 4OMFG 4WIIA 3W66A 3OT9A 3TZWA 3DC2A 1WKLA 3I6PA 3OJUA 1BMQB 4NXMF 3GIKA 2C2EA 1CJKB 1SJ1A 2ZE2B 1A6LA 4MFBB 2OI2A 2Y0BB 4O44B 4DV5F 3HVTA 3PW0A 4X64J 4R0EA 1R89A 1VK8A 1WC3A 3NS5A 1HNWJ 3OTOJ 1J5OA 4CO1A 1RTJB 1J5OB 3I0RA 2F4VJ 3KHHA 4DQQA 2IM3A 1K0TA 1Z2ZA 1N6QB 3SSRA 5L38A 4ZPWR 1VFJA 4YY3F 1NSAA 2VUGA 1XMOJ 4BWMA 3ZZZA 4K4SA 1T03B 4QJVA 5IQQA 5A0YA 1GFWB 1OY6A 4NA2A 4Q5VA 3RB6A 4I7FB 3KK2A 3KG0A 5L9XA 2FJWA 1FK9B 4NLXA 4R5PA 3MEEA 4TLQA 4TU8A 3MUMP 1VC6A 5GAHI 4N8NA 1B0VA 1RT2B 4L6V3 5IWAJ 3CSKA 2VPYB 4HHUA 2FHKA 5ETVA 1FERA 5HL7Q 2XB2D 4LFBJ 2NLWA 4ZN3A 2F8MA 4DG1A 5HQLA 2PSZA 4UY85 3AJ1A 5KFXA 4DZDA 1NH7A 2JSXA 2K2PA 4PXEA 3TUZC 3QGGA 3M2UA 2X1AA 3A3OB 5DRKA 4DV3F 2ACYA 1C4CA 1UEUA 3QJJA 2CRLA 4UY8T 2DNQA 2B9EA 4C8KA 1MG7A 5D0RA 4U7UD 2PFFB 4JUZA 2X51A 4CYUA 1NJIT 2RMLA 1RLCL 1KSPA 1LV5A 2CJQA 1RTHB 4NLVA 1S7HA 4OI4A 4K2XA 4H4MB 1S1VA 3RBEA 1TL7B 2A2CA 1FD2A 3IRXB 1U2FA 2CADA 2H5JB 3QATA 5DM6Q 4ID5B 3D68A 4LBHA 3ADAC 2HPUA 3DRRB 4USHA 5F0UA 3S7RA 4URGA 4B9MA 3MM5B 2ZH5A 4DV1F 2G9OA 5EN1A 3I82A 1IR1A 1EB0A 1VGYA 4Q43A 1HR0J 2R42A 2FVSA 4O0IA 1AA1B 1RT7A 2J9DE 4RJVA 2F40A 2VPXB 1RLDA 2QZ8A 2RS8A 4WTYA 1YHQS 4HVZA 3KNAA 1TKXA 1F5BA 1RT5A 1EHWA 1LWEA 3AD9C 2RHSB 1VQPS 1TAQA 2OJ3A 5M2PA 4WK1A 1X4DA 1S1UA 2AQ4A 3JYTB 4NLUA 4N47A 1R0AA 1TKTB 2WCXA 1TMMA 2O66A 2E5HA 1H3DA 3DGPA 1Y0HA 4BDPA 1TK5A 4A8MP 3JSMA 4F8RA 2EEYA 1RSCA 3TA2A 2YX1A 1GX5A 2V50A 5HMWA 3ZTPA 3ILIA 5HROB 3UVJA 3AXKA 1Q5YA 2I5JB 2BABA 2E9TA 1NMEB 2AHOB 2PO4A 3H2UB 1GTHA 1K47A 4QZVB 3HHKA 2OD6A 1ICEB 1NDLA 1SC4B 4Y6IA 4YN3B 3UDCA 5ETLA 1TV6B 3EJMA 2ZZMA 1TUVA 1FKOA 3DOLA 2MQQA 5CABA 1YVFA 3BV8A 3LAMA 4RBUA 2UXBF 2IMOA 4TKTA 4I56A 4DOZA 3MFIA 1CPZA 1CC8A 1FHTA 4Q7AA 4ELUA 1RT3B 4J90A 2HGLA 2K3IA 3THPA 3QT8A 3D6HB 2BXJA 1S0NA 3Q83A 2HNYB 4USMA 4X84A 5KFJA 3T1HF 2KRRA 4E0DA 2PC6A 4O3OA 4OLPA 3TX0A 1NJWA 2XI2A 1N34J 1JLQB 3GSIA 2CQHA 4O3RA 2RD5C 4U8VA 4ZDNA 2FB0A 4IRDA 4OFZA 2MY7A 3ZXWA 2EK6A 3UW1A 1NSPA 2YNFB 4EBEA 4JV2A 4B3OB 2MKYA 3HVAA 4LF8F 3N9UC 1LOUA 5B0CA 1EKSA 4C6AA 4X64F 2XEXA 4LJMA 4B3SF 3AB2B 3MPWA 2VL1A 2HVHA 2HLTA 4EI2A 2XS7A 1WC5A 2ZBPA 3LPEA 4URSA 1X4CA 3M2VB 3K2YA 1N5QA 2YNGA 2W2OP 1WEZA 1NPRA 1UEKA 2HFVA 2XWYA 3H7HB 5GAEI 2D3OR 4GKKJ 2P6TA 3R8YA 3MGJA 3BDPA 3AQPA 2WZ1A 3P45B 3FRYA 3SMZA 2H48B 2OFGX 3NG8A 1VQ4S 4M8LA 1M0SA 2BV3A 5EX3A 3OJSA 3SV4A 3C19A 1SUQA 2L9NA 3HZGA 1FRXA 1H0HB 4TXSA 3OR2A 4DPOA 2NUUG 1CC7A 1NK4A 3LP0B 1HARA 1JXVA 3MMJA 4ZCIA 4F3QA 1RCOB 2QSFA 4ETZA 4ELTA 2DR8A 3BKTA 4KTQA 3EYZA 4LSZB 1TUWA 2ZH2A 1H72C 3IG1B 2AJFE 1XJWB 2BKNA 4KJIA 4Y2AA 2F8HA 3KUEA 1NKCA 3NMAA 4CP5A 2MTLA 4F4KA 4V19J 3BM7A 2R2SA 5L1IA 1UFKA 4M5LA 1KFSA 2HGNA 4I7FA 2VBZA 1Q8LA 3KK2B 5BR8J 3FFIA 3VGVA 3ENQA 3VHQA 2AEFA 1UA1A 1T03A 1CJUB 1URRA 2DGWA 4GKKF 4GO7X 2BR0A 5LXYA 2G4BA 4KGXB 2ZUGA 2B9YA 2MZSA 2BMBA 3FFIB 3EPGA 1NK5A 5CCLA 3LP1A 3FGVA 4IR9A 1DLOA 1SVDA 2E7VA 4MIBA 4DR5F 3KJQB 5E3PA 4FXDA 2Z56B 4PKDB 3W1YC 4C7QA 5C42A 5J1EA 3DLGB 1VOMA 1RHKB 3MPVA 1IKYB 4X4SA 3FNNA 4U95A 5M2RA 4DL0C 2YX4A 2O5DA 5K8OA 4E8UA 5MLCV 1NAQA 4FPIA 3PVXA 2W1BA 5F8NA 4DI6A 1LWCA 1NJYA 2J76E 3I56S 3CCRS 3AA9A 3OXLA 4OJHA 3PO4A 1WKKA 4FDFA 3EMTA 2HYIB 3C6UB 5GAGU 2XO6A 1RHRB 3Q8RB 2HK2A 1HBOA 1FRJA 2MPUA 4OX6A 4DX6A 3VF0B 3IM8A 3KLIB 4QIFA 5KFZA 2APOA 1SC3B 1WACA 2E1PA 3D7SB 2HVDA 3IO1A 3QIPA 1RT6A 4MYUA 4DX8H 4YS2A 5IWAF 3QYYA 3J81j 4X62J 1C4AA 3FCVA 3W7BA 2DNRA 3KLHB 3KJVB 2V8PA 3KXDA 2QL9B 3ITHA 1LWXA 2HK3A 2LA4A 2H9ZA 2ZHOA 3NOCA 1WUUA 4OLOA 2KT2A 1IBLJ 4JV1A 3G6ES 1Y5IB 2WRMA 2RE1A 4WP8A 2X7IA 2QRRA 3J7A1 2BZ2A 3UDLA 1CJUA 3TUJC 5E33A 4BC9A 2XLJA 1RTDB 3T1YF 2CQ2A 3B54A 1ZS6A 2QYCA 1F2HA 4NEYA 3W65A 5CD4H 1N88A 4M1KA 3LWLA 1SXLA 4C0OC 4HH1A 2XGPA 3K89A 3IAM9 4IDKB 2YH1A 4AYBD 3HZEA 2HWTA 3HM9A 3P8BB 1VHFA 4H4KC 4KR0B 1C1CA 2CNNB 4RU9A 1RACB 3B8HA 2V69A 1NSKL 2QMUB 3M6VA 3C15A 4DHVA 1P1LA 4XDDA 4ZLNA 3M9MB 3RB0A 2CPYA 2Q1LA 4U6PA 3PY8A 4NASA 4FF2A 3DU6A 3THVA 1DBDA 1OPIA 2F9DA 2LU1A 1LFWA 1KVKA 3KNGA 2JLFA 2VG7A 3CJ2A 3VV2B 1RE1B 4N5SA 1ZYQA 2V5HG 2VG5B 1SH0A 3LAKA 2BJ3A 2F1FA 3POTB 4IFVB 4PPZA 1V6HA 2RSQA 2HWHA 4Y2KA 4TLRA 1KP6A 1F9EB 1IJFB 2CQ1A 3SV3A 5CCMA 4FXWA 4WTOB 1BGXT 1YWXA 2KI2A 3DOMA 2UVVA 1CQNA 3U02A 1GX6A 3NS7B 3JAMY 4QPXA 3IR6B 4RUBA 5HMZA 2BACA 2VA2A 2R7TA 2XGQA 1U8WA 3IGNA 5ETNA 3ZTOA 3MOZA 2AJQA 1Q95G 4F02A 2N3LA 3D3BJ 4WBFA 5BXIA 2VH7A 2F5GA 1RAAB 2FDNA 1VC0A 2YKNB 4A8YA 1NRKA 3UD4P 3HI9A 4DL6A 1UFLA 2BW7A 1HI1A 2QTWA 4BCAA 2GO8A 2OP5A 4BLGA 4U7CA 1MN9A 4S0MA 4YB5A 1K8AT 2CPJA 2EBEA 3HFZB 4NPOA 2Z0GA 5KFTA 2EG2A 2ROGA 4OI3A 1OSCA 2HVEA 1Q78A 3CDEA 4L73A 4NLDA 2B51A 3OXFA 4YB6A 5HVFA 5K5MA 4DBQA 2YPYA 4LT6A 5BYQA 3T5HA 1XMQJ 5HLFA 2FHOB 3GG0A 2DGTA 2ACMA 1HWUA 5GAEU 3PNIA 2RU3A 4ZITA 1FKOB 3DOLB 4WPAA 5AXLA 3BQ1A 4C9DA 1J2VA 4ECUA 4UW2A 4QBUA 3OL8A 2WSFC 4FF4A 2VFUA 2R4FA 1U1MA 2V6AA 4I69A 3MM6A 5K9FA 1U48A 5D0HA 2F65A 5HQ8A 1C0UB 1BQMB 4ENOA 4ZLJA 4DS4A 2AD9A 1RT4A 2DR5A 3I0SA 3JSMB 2XCPA 2F3JA 3C15B 3FQKA 4RO0A 2QA2A 4G65A 2UXCF 3B4MA 4RZRA 4KQZA 4E98A 3GMGA 1RU2A 1U2RA 5A76A 5KFDA 1UVMA 5D15A 4F67A 3QO9A 4DX5A 5KFHA 5KG7A 2RAQA 1GH8A 2KN4A 2FJXA 2WTFA 5FDLA 1VQOS 3VCDA 4W92B 1W7WA 3C6TB 5B0FA 1FK9A 3BQ0A 1FRMA 2H5IB 3RW6A 5AXKA 5A0YB 1FJ7A 5B7WA 2LXFA 2L9WA 3W5YA 3BGOP 1ZPWX 1NUEA 3G2XA 3DRRA 3HVRA 5JJBA 2CNOB 5KFVA 3PR4A 4IUFA 3K5LA 2NZCA 2R9LA 4IG0A 3JTPA 3BDEA 4Y28C 2R7SA 1FF2A 2M5YA 5HK4A 2AEJA 3OD2A 4HTIA 4YB1P 1UKUA 3W8PA 1CJKA 4PG5A 1FKAF 3MCSA 2L3MA 3SDEB 3MR5A 3H40A 3T19A 3NBPA 2FLNA 1DRZA 1NK8A 2Z2LA 3LW5C 3OL7A 2O67A 3HHLB 3VALA 2HLUA 3IP0A 4XIUA 2HNZA 3CIZA 3FZ2A 4DV0J 4O0NA 3G71S 4M5DB 4KO0B 3KDOA 5E3CA 1VLOA 3RG6A 3TVYA 1WG1A 2UUCF 4LFCF 2V4JA 4DR4F 4ANDA 2COLA 3Q8UA 4ZJOA 2W9CA 3KJFB 1ZM4A 4C0BA 2W9CB 2C3UA 2DB1A 4WKYA 3ZO7A 2BJEA 2C1EB 2ZWPA 3FBCA 1DLOB 1DQ9A 1WSVA 2YKMB 3CCES 4GC6A 2HWIA 1AB8A 4CT9A 1U1KA 2FY8A 3KHGA 4YHHF 2RHQB 1WJ9A 2VD3A 2XZWA 3ICLA 3WC0A 1EX8A 3QT7A 2JZ5A 3R7SB 5JMNA 2EFVA 1JXLA 2QLXA 4DCOB 2M8HA 5F3ZA 2VPZB 5EHHA 2QE5A 2WSEC 3DRSB 4K4TA 3S8SA 1MNEA 3K59A 3KOAA 3M8YA 1SJRA 4WK3A 1HW8A 4OYMA 2OUGA 4ECRA 4ZVPB 4Y0FA 4F0KA 4KY3A 2W7OA 3RYLA 4X66J 2OEMA 4ED1A 2E1AA 1RHQB 2PDAA 3CE8A 3DOKA 5A8RB 5E41A 2QN6B 5KFBA 1Z1ZA 2A0FB 4FKYA 3K5OA 4USKA 3US5A 2BQ3A 2JRSA 3MM7B 3LP0A 4QIWD 3GFXA 1VRUB 4ZPAA 1HQ2A 3KLEB 1JKHA 5DETA 3GIIA 4DR1J 2HHXA 3R1LA 2P9EA 2HBQB 5LMUJ 3B78A 5KFLA 5JVHQ 1VQ5S 3BKUA 2KT3A 1XMQF 5AE1A 2DHXA 4K4UA 3QNWB 1Q16B 5KFAA 2WONB 3TA0A 5K14B 4WYLA 1KEKA 2AJ1A 3RUBL 4DL2A 4A47A 2GJIA 1X4FA 3D0HE 3IA0A 2VJUA 3VAIA 1U1QA 4IKAA 4CH7A 3PX0A 3E01B 3DLLQ 2ZH8A 1ZM3A 2ZFHA 4LSNA 1RWWB 5CZXA 4DV2J 1NM2A 4CO0A 3L9ZA 3MM6B 5F0WA 3IRWP 1TMJA 4J37A 1U0HA 4RW8A 4J9OA 4ED7A 4NLGA 1FE4A 4PWWA 5IC6B 1SB6A 4QOTA 2IJRA 1SIWB 4ICLB 4W98A 1ZAXA 1RP5A 2IAJA 2Z58B 3BQ2A 1RKIA 4F04B 2HHHF 2DRAA 2IA6A 4CNYA 5L9NA 2PT0A 2V8VA 4WJBA 3M6WA 2LXIA 5KFSA 3T1HJ 3RBDA 4KAIA 2CQ3A 1D9DA 1F3FA 3M05A 4I6WA 1NK6A 5LXRA 4FBUA 1KS2A 1I5OB 1U6FA 4WXOA 1MLAA 3DLHA 1GMWD 4AXIA 2EXUA 3TVKA 2J0XA 1TL5A 3SCKE 1EKRA 2M4MA 1RHJB 2QFIA 3LWMA 2ASJA 2OFHX 3D66A 4QWDA 1PYTA 2UUAF 1UEVA 3PRDA 1BY9A 1RAFB 2NSCA 1HWJA 4F0HA 4D3GA 3R2CJ 1FRHA 5BJRA 2A6OA 2JEFA 2HHSA 4NI2B 3AB4B 4PXBA 2BDPA 4CO2A 1RT4B 3GCXP 1BLUA 4DS5A 4DV7J 1BE4A 3CCMS 2C3MA 3ETMA 2WVDA 3OFFA 4USWA 3IBCB 2IVFB 2FVQA 3SCLE 2X1FA 4G1IA 1X60A 2MQPA 3OTBA 2DRBA 2VOPA 3DGPB 3RGIA 3CCQS 4DJBA 5L1KA 2HRYA 1U45A 1BQNB 2XNRA 2HZVA 5CYQB 3RB4A 3QT6A 2XYGB 1I3OB 1PYOB 5ADZA 1G4CA 2YTCA 3TAMA 2KTQA 3BBFA 1FRIA 4J9PA 2DT9A 2B8PA 3Q2TC 2GCFA 2F4FA 4Q8EA 2R7VA 2VG7B 3LTOA 4NZ7A 2HIQA 3NNHA 4GVBB 1KRPA 2GZOA 4ECYA 3W3SA 4J9SA 3CDWA 3D1QA 2DJWA 2ZH3A 2FY1A 1XIQA 3H8YA 3DYAA 1QDUB 1RBLA 4QWBA 2UUCJ 5LOQA 1I51B 3HHDA 5AT1B 2HQCA 2AJ4A 4LRDA 3GSDA 5KG0A 2GIQA 2KXFA 1L3KA 3P96A 1N52B 2G0CA 4ICLA 2QMWA 1SQFA 2GNKA 2ZOGA 3QBCA 4H4OA 5U47A 2POKA 3EUNA 4KE5A 4M5KA 4HYKA 4WE1A 1ITPA 3G8QA 7FDRA 1CSJA 2VODA 1C1BA 5B0BA 4TQRA 1KD1T 4NMXA 1CS4A 3N6NA 2O3DA 4ANCA 5D0EA 1FX2A 1FWPA 3EXCX 3FC9A 3PTWA 1PBAA 2MQ8A 3DLKB 3ITHB 1RDRA 3LGNA 3Q86A 3R27A 1HHQA 1OSDA 3MAAA 4A8QA 1YI2S 4N77A 4WP9A 3ZNUA 3VAJA 3DI6B 4LF6J 4K4YA 4M5JA 3EVOA 3D3CJ 1K1QA 4EYHB 2B43A 1FJCA 5GMKa 1C2PA 1WOOA 2K7JA 3POTA 4CLTA 2FUG9 2ZJRQ 2HQDA 2VPWB 5J2NA 2BE7D 4BBYA 1CJTA 1PJ7A 2AYEA 1EP4B 1WF0A 4WFYA 2IDEA 3HHLC 1SKWA 5HI7A 5KT6A 2V34A 3CCTA 2B9WA 3N5BA 4QWEA 2CNLB 1X4BA 1LWCB 2HBZB 3R5BA 2KG0A 3N0VA 1HI0P 1YJ7A 3HSGA 4ZVTB 1U0SA 2G0IA 4JBCA 4LFCJ 1NZAA 2YX7A 4IDKA 3C3LA 2MKKA 2MY8A 4B3MJ 4WU3A 1R6YA 2W25A 2QSWA 4DSJA 2XNQA 4C8ZA 1S76D 1WG4A 4FS2A 3VGTA 3K58A 1FVSA 1U1RA 1Q4RA 4IH7A 2Q6CA 3TR5A 4EYIB 1HI8A 3I31A 1PILA 2XYPB 2GQ2A 2R3VA 5CYJA 3DLBA 4QIVA 5C2GA 5KT2A 1VYAA 3WZ0A 3C2PA 4ER8A 1N5YA 3NMRA 3TAQA 4F50A 3W5XA 1J5EJ 4PAAA 4CT8A 5I3UB 2UU9F 4P73A 2HBYB 3M8QB 2YY3A 4NLRA 3WQPA 4KC5A 4RBVA 5DDRC 1E6YA 3P49B 2OSRA 2ZH4A 4H4OB 3TNVA 1ZAWA 3FVYA 1FA0A 4NRTA 1FVQA 4ZHRA 1HNXF 4Q0BB 3U1LA 3TAPA 3VQTA 3K5NA 1SJQA 1M5PC 3F0NA 1B7FA 3IC1A 4NYZA 3QRQA 3G9CA 5SUHA 4HACB 1EARA 2CFXA 5KFYA 2AEMA 3OTEA 5C25A 3L7OA 3Q8PB 5F8JA 2YNIA 1U2CA 4C8LA 3MURP 5HQMA 2RF2B 2ABYA 5CD4A 2YNHA 4JI3J 1C0TB 4TU9A 4GVBA 2R2TA 2BQUA 2BOAA 4JV5F 2VOOA 2XMVA 4DR7F 4X4UA 3M2VA 1UZHA 3PFOA 2XSFA 2LQ9A 4OHVA 2X3DA 2IRUA 2IYGA 4W4MA 4KIAA 1KNZA 1M5OC 5KFEA 4DSKA 3ISZA 4UZCA 4DR2J 1VQ6S 3EM1A 4DF4A 4DFMA 1JLFB 3JSRA 2DXDA 3ULHA 1NB7A 1S1XB 2DH8A 4ZS6A 2RKIB 2JEJA 4X4VA 1IVZA 1LKZA 5DQGA 4IG3A 1HIYA 1RYSA 1FT8A 1NEEA 2YXLA 2HQGA 3I5BA 3M32B 1R8HA 4AUKA 5H9EJ 5AXNA 4OJ3A 3DHXA 3HD1A 1JLAA 2ZDPA 2H5EA 3CGIA 2V8GA 3I0SB 2JVOA 4JB8B 1QJHA 4OJGA 3TX8A 4NXNJ 2RVJA 4FYXB 1XNRJ 1SUQB 1C0UA 2DNYA 2HS0A 3BKFA 4C97A 2NXNA 1I94J 2VFRA 2CG8A 1PCAA 2H4WB 2ROEA 2E7XA 3CJSA 2UV8A 3TP2A 2W8LA 2FZCB 2J7KA 3NAIA 4M63A 2UXDJ 1TKDA 4RNNA 4O3QA 2JLGA 3GB0A 4ZVUB 3CULA 2YNGB 4DV1J 2C2ZB 3TO8A 5KOWA 4F2RA 4JI5J 3Q2SC 3ONQA 3QWUA 1HQEA 1UJ5A 1VDHA 4GO5X 4ITSA 1UP1A 4M5GA 3X3UA 2AZ1A 2D3O1 3GTYX 1PC5A 1YLXA 2C3PA 2I8EA 2LMIA 3CC7S 1F5AA 5C5JA 5J2MB 1X5OA 2P9CA 4OZNA 4LF6F 4G1QA 3Q24A 1VIOA 3MEGB 3BSOA 3PX6A 1GXUA 2DYAA 2DRDA 2G2ZA 4ECXA 2CQCA 3LO3A 2OMOA 3AHPA 1LWEB 3NGTA 3MUVP 3MEGA 3OPKA 1U1PA 2JJ4D 1QY7A 2QL7B 1SIZA 4EO6A 4RW9A 2MQLA 3MECB 5IM0B 3J7YI 2NR0A 3PG9A 3BB5A 1F1BB 2QLWA 4DL4A 3GV8B 2HS4A 2HRTA 2NYHA 3AAWB 1FWKA 2AX1A 3GJRB 3A8IA 2UV8G 3FKBA 4FKXA 1YRXA 2BE9B 1F9HA 1XR5A 1YJTA 4O3PA 1S1VB 3QZ7A 9ATCB 3PJWA 3MR7A 4JYAJ 5HVHA 5DS7A 2HIYA 1S6UA 4ZVHA 2MZ1A 4CLLA 1TK8A 1WDTA 2RJZA 5GADU 2HQ3A 4MKVA 2FVPA 4DV4F 2AP6A 4LSNB 2OPRA 2ZOFA 3GLJA 4RNHA 4K4XA 2DK2A 4PYAA 1HNVA 2VF3A 4CO5A 2BRKA 2Y0SD 3IM9A 1RHUB 2KRBA 4L3NA 2JDJA 3M2UB 3AJDA 1P9YA 1H7WA 2JOQA 2LU2A 1KVIA 3FSYA 2J9EA 2W2PP 2DY1A 4C8MA 3JYTA 1R0AB 1NK7A 1NDCA 3PACA 2HHVA 4I2QB 4LF4F 4RR5A 5AE3A 4LF8J 2VONA 3P4UB 3SSQA 4DR3J 2IBOA 4OV1A 2QA4S 1MMDA 1ULRA 2BW2A 3CW2C 3O6QA 5DJBA 4C3LA 4CRJA 3NCPA 2CNKB 3HHNB 4ZJQA 4B3TF 4MIAA 1S0VA 3BGRB 2FTRA 1Q5VA 2CG4A 4NRUA 1UCNA 2XMTA 3L7PA 1NKEA 1U47A 1T7PA 4M5DA 5GAHU 4UQGA 1UZDA 2B4OA 4MYTA 1M90T 2HGMA 1Y3KA 2DHSA 3TOQA 1NH8A 4H4MA 3KLFB 3HP6A 3KK3B 2C42A 4KGKA 3WIUA 2ZJQQ 2GS8A 4J9UE 2QLFB 4E2FB 4DR7J 1LWFB 4RBTA 1EJ7L 3VGUA 1ZZNA 1RAHB 2ZE2A 4OYPA 3CCUS 3O44A 3UN3A 1FNOA 5HMXA 1RU1A 3MM9A 4B9UA 4NLYA 4B9NA 2OTJS 3PYFA 4PCQA 1WI6A 3CDBA 1RK8A 4ZHRB 3CWJA 4DUYJ 1ZTWA 5F8LA 1HA1A 3C6UA 1RT1B 1UWBB 1YRTA 1T8EA 2CIMA 3ILLA 2VG6A 3CJTA 3IFEA 3AY0A 3FCHA 3P3DA 2FYXA 4C3KA 1HNWF 1F6TA 5J2PB 3AOCA 3BGRA 4YR3A 2ALYB 2BYCA 2OPPA 2HHPA 1WI8A 3LH2S 5T41A 3MZIA 1SL0A 3KHRA 2GJ2A 3DCAA 1Z4UA 2D74B 3C6TA 4NEZA 4CQ1A 6FD1A 4NLQA 2M7SA 4DV6F 3UR3C 5SZTA 3LP1B 3M8RA 5E2QA 5EX0A 4ZCMA 2CWKA 5ETRA 3DFEA 2FC9A 1APSA 2LCWA 2HFZA 2EFPA 4KB7A 3UFCX 4EMDA 3NRBA 2ZH7A 5IXUA 4QCLA 2HHUA 4CLPA 2NREA 1P1TA 1XBWA 3LP2B 4DUZJ 3T5LA 2FHJA 3IBFB 4FPRA 1DURA 4OZJA 1X9WA 2MJNA 4LMZA 5I4MA 1AFIA 3B4DA 1KHVA 5A8KA 2J6TA 3MEKA 2K8GA 3P5TL 2IRXA 5CH7B 2R7UA 2GMJA 5KG2A 2C2DA 3IGVA 1FJGF 4DQPA 3O8WA 2ILYA 4LF9J 2EC0A 2C2KB 1PJ5A 2DIVA 4FN5A 4PG7A 3D6MB 4C8NA 2PIIA 2RH3A 4PUOA 3RR8A 2ZWOA 1FDBA 2H54B 3GG1A 1S12A 2OMLA 1YJUA 2QX0A 2V9KA 3OR2B 5KFCA 1HYSB 4C8OA 3QT5A 4F4ZA 2HFUA 4K5SA 1RAGB 4ZVEA 4U9RA 3G6XA 4OZ2A 4ILLA 2QMXA 5KG4A 4P2XA 4F36A 1UFWA 2L41A 3HFVA 4OYWA 2H65B 2NYIA 2ZDOA 3OVBA 3OR1B 2C3OA 1M5SA 2IJNA 4FYWB 2CPDA 3GIJA 4Z37A 5DGBA 1UW4A 1NB2A 2DGSA 4GRSA 4JI2F 1JJ2R 5E7OB 2IVMA 1Y11A 2LDYA 5L1LA 3ZC4A 3PW2A 3VAKA 3BSCA 1X4AA 2R2UA 4TQSA 1IBLF 4RW6B 2I6WA 4G1QB 3NCQA 2B7BB 2XZDB 1U1NA 1T9TA 4LFAJ 1S72S 2UVUA 2J6SA 4QR2A 2OLWA 3C46A 3CCLS 2ZBQA 4CCHA 1U02A 2B5JA 2BVZA 3WX8A 2MLZA 4PRFA 3GFHA 4JI1J 4HL9A 4GMKA 4ZIVA 1JWWA 4H54A 4TYBA 3M9OB 1WSRA 3VZIA 3PW4A 4LF5F 1N32J 3SXLA 1K44A 4OV6A 1VRTA 5EWGA 3MMBA 3CVKA 2F7VA 4P75A 4HEA9 4ANEA 1REGX 2FJAB 4B3MF 3K0JA 3OV7A 5E5NA 4ZCLA 4C3MA 3MR6A 1WNEA 2NUHA 4IFVA 4UZBA 1FXLA 2KFYA 3HVWA 4UUWA 3D0GE 5DQIA 4IOAQ 3VAFA 4ERDA 1S6PB 2DNMA 1TV6A 3J7Z5 3EGZA 2ZHBA 5C7PA 3AOAA 2FPHX 3QFWA 4LRAA 5B0EA 2DTJA 4B3TJ 4UT4A 1S6OA 2R7WA 1Y7PA 2EFQA 2Y1RI 3OBIA 2IM1A 1S1XA 4O3SA 3A3NB 4PG6A 2V2VA 1CEZA 1WWHA 2QEXS 1RWUA 4PR6A 3KKFA 2R7XA 4IO1A 3EXYA 4USTA 3R7BB 5CHCB 1HNZJ 3GIRA 1HNXJ 5DDPC 1WD6A 1AROP 4EBDA 1M1GA 3BH6B 4DFJA 2AYBA 4EK2A 2MYFA 2RT3A 2W2MP 3FCWA 1QTNB 1JLGA 2IM2A 3FBFA 1YX2A 2D7SA 3HMJG 2VBWA 2FIUA 1XQIA 4MK9A 3IMQJ 5ITHA 2CWXA 5GMDA 2Y1JA 2MZJA 2ASLA 1VQMS 3JSYA 1F5CA 5D3GB 1JX4A 3R7NB 2R7RA 2P9GA 2ASYA 2MKCA 3RZAA 3N28A 3MM5A 4ECZA 1X9SA 1NK0A 3CCZA 2P6SA 1VJQA 3HT0A 5IT9Y 4ID5A 2VQEF 3OXGA 2M70A 4ZMMA 4P72A 4HHJA 2ADCA 1TL7A 3ETOA 3IRXA 2PI4A 3EDRB 4MT1A 4LQ9A 5HP1B 1NPPA 2AWZA 3EE3A 4N41A 2AYGA 2G1DA 1E6YB 2H1YA 2HFOA 3D9BA 2ATCB 2JLEA 4ZP9A 3Q8SB 5DGAA 4LBPA 1VBYA 1T11A 2PEBA 3ZTSA 2JFKA 4EUVA 1IKYA 4NLWA 1QSLA 1JMTA 2LQ8A 2YWWA 3R97A 1X4GA 2WW4A 1E6VA 2DHAA 2UXCJ 1SJ3P 3BO3A 3F44A 4W90B 1XTZA 3OTOF 3HX9A 4I64A 3VAGA 3QFHA 1X31C 3MR3A 2YWEA 2BEFA 1I6JA 2YKOA 4A8FA 5DO2A 3SCIE 1RA6A 2C2RA 4ELVA 1RGVA 4A4JA 4JI7F 2O01C 3RRKA 2XMUA 2B6AB 1JKHB 4ALZA 3MCMA 4C98A 1D8YA 4NCGB 3I87A 1VRUA 2MGZA 1QVGR 1YBTA 2GJFA 2XULA 4DUYF 2CPEA 1LW0A 4AE5A 4F7VA 1VQYA 2W9BA 5FJ4A 2W9BB 3DNCA 2E9RX 4JI3F 4B3RJ 3BN7A 1TTHB 1YBAA 2QT7A 1S6QB 3DLGA 4USIA 4CWBA 5J1EB 2CQIA 1V3ZA 2CJ9A 2GIRA 3FEXB 4P7VA 4DCPB 2V94A 1B7YB 4A8SA 2VBXA 1SKUB 2W9AA 1CG2A 3DRXA 2IRYA 4Y2IA 5H9EK 2HHQA 4N7TA 5CAAA 4MFBA 4HH0A 3BF4A 3MMCA 2DHHA 2WAQD 3I5AA 4PQAA 4TVAB 5ETKA 2V0NA 3A4TA 5T7LA 3TUIC 3TANA 1IWGA 2VDIA 1L3TA 3MAAB 1MN7A 1VRQC 4BC7A 3JS9A 1NLKL 5KT3A 3E3XA 2R2RA 4DDFA 4FVMA 1KKHA 1Y3JA 2DNNA 3SQOP 4Q2LA 1RYRA 2DPIA 2YQ3A 5DLGA 4ZVQB 2OEJA 5J2QB 4KH1B 2K3KA 2V4JB 4CH0S 1HKAA 1HR0F 3O2IA 1UTAA 5A6WA 3SBMA 4L74A 4Y00A 5HP1A 2CXEA 1H73A 3Q8QB 4DSIA 2DCLA 3H98A 1H2VZ 4KHRA 3NEKA 2EFOA 2XWXA 3SI8A 4PQUA 4PWDA 2J7UA 3MM9B 4X4NA 1Q1KA 3KLVA 1HHTP 5ETSA 1IQTA 3K5PA 2R8GA 4B02A 4KHPJ 4LIRA 3ISNC 2RUGA 3O3LA 1QAXA 1GEHA 4IG0B 2Y1IA 1HW9A 4QR1A 2DNGA 3M2RA 2DH7A 1HNVB 2GHPA 4MAKA 2GGPA 2Q43A 1GK8A 3ZZOA 4UOGA 1TAUA 3MEDB 4CLWA 5B0GA 2L08A 1RI7A 1U09A 2I38A 1QE1B 4QYRA 4NE9C 3CD0A 2E44A 1OMSA 3LA0A 3V5RA 5C2CA 3PX4A 2GQCA 4B9TA 3QZ8A 4AL5A 2I0XA 4JI0J 1U8SA 3LQVA 4MK7A 1QVFR 3V4MA 3EVMA 4P52A 5JUMA 4WFNQ 4ES2A 2WB4A 3AD8C 2DVIA 3FEYB 4FYYB 4USUA 1RHMB 3D67A 1FTCA 1D1UA 5LM7E 1YZ7A 3DLEA 1BXNA 2W4CA 3CPWR 4ED0A 2V2QA 1SI9A 3DDIA 1VC5A 2OD4A 2B8QA 5ETTA 2PD1A 4DLGA 2GAGC 2CAJA 2RRNA 3OW2R 3AODA 2C22A 3MXHP 5H9FJ 2YKQA 4HHHA 3BBCA 1WF1A 3M4XA 1S1UB 2K7KA 3A8JA 3R5CA 5KFMA 2X3GA 1T9WA 3QLHB 4YY3J 2DGXA 4ED2A 2AGOA 1Q82T 2AX0A 3PRBA 1S1TA 3NL0A 1DTQA 2MHEA 2D3ZA 5F41A 2MKIA 3UCZP 2AGQA 4C8YA 4OHYA 3S6EA 2HHTA 1WC1A 3UDVA 1F2GA 3DMJA 1H2TZ 2Y3YA 1IWAA 4AD6A 2DNZA 2EC2A 3W63A 1CULB 2HHHJ 3CXCR 1L5UA 1YG0A 2U2FA 2DGUA 3CJ3A 4C48A 2AU0A 4LFBF 1H74A 4OQJA 5A6PA 2HVZA 2KU7A 3I55S 2KJVA 4Y2MA 4HKQA 4KBIA 1JLBB 2ZNYA 1JLBA 4NX9A 2RDJA 1NXIA 3CD5A 1G1XA 7AT1B 4NLTA 2HURA 1BQXA 2AIRB 2LXUA 1TR0A 2WW8A 4LR7A 4OHXA 1B4SA 4CLFA 4ES3A 4F4AA 2DGOA 2AJ2A 1JLCB 2FVRA 1RUSA 2H51B 2ZM6F 3J7AN 2XSJB 1G6BA 3CJ5A 1SQGA 4PQUB 1WOPA 2CKWA 1RBAA 3E01A 3GZ7A 2IC3A 2FJBB 1WELA 2I1RA 3DDKA 3TARA 2A6MA 2XY5A 1JXEA 4HR2A 4DR4J 2GAHC 4ZPCA 2BKOA 1GTEA 5KFIA 4DR1F 1TFWA 1RT7B 2P8IA 1U6ZA 2M9KA 2DISA 5LJ3Y 1RQ0A 3QIDA 1SJ4P 3IBWA 4AFFA 2OH2A 4ED8A 4QYZJ 4UTGA 3LPYA 4IOCQ 4J9MA 1KR4A 1Y10A 2RKIA 4USVA 3GJQB 4UOHA 1WHVA 4OI1A 3TEGA 5KFWA 1IKWB 5LJ5Y 1XNRF 2FHJD 5BYSA 5K8PA 2BQRA 2JEGA 1T0TV 4BS2A 2NPIA 1D9FA 4DPXA 1SPBP 4EFAC 2GX8A 1TL1A 1KQKA 3KHLA 1KOOA 4OI0A 3UWTA 3D1HA 4CO4A 3QAEA 4OI2A 2JFDA 2MQNA 3LALA 3TRGA 1CLFA 2G2YA 2BANA 2VG5A 2ZBCA 3EWGA 4YR2A 4A8KA 3EICA 3G8TA 3CMES 3ZZRA 1A0OB 1VK3A 4A8XA 3K7RA 1S6QA 5HBMB 1AT1B 3BSAA 1FWLA 2EI5A 4JI5F 3LGHA 1FDNA 4OI6A 5MAOA 3M32A 3ZNJ1 1UVLA 2V4RA 4K4ZA 4IG3B 1M1HA 4HDGA 1ELOA 2W01A 1SCJB 1T3NA 1UWAA 5F8HA 2CPHA 4AXJA 3SZ2A 4RW7B 1RBOB 2G2OA 1IKVA 4I2PA 1LW2B 4K5RA 4OIXA 2UUAJ 2AKWB 2V8DA 4I67A 4FP9A 4KO0A 4DU7A 3GU0A 4ED3A 3AFGA 1NHUA 1T9YA 1FFGB 4DFPA 2ZKTA 1RB0A 3IWXA 3KLHA 5IT9U 3EZ5A 2ZH1A 2DXEA 4MKBA 4DN0A 3UCUP 1LXJA 3QIPB 3T1AA 1GAOA 3VWSA 2V4QA 2OPQB 3NKYA 1QLNA 2YWHA 2V9WA 2HMIA 3GONA 1QAJA 3KMQA 4TYAA 4ZLPA 5IS2A 4RUCA 3T1YJ 1X0FA 5HJXA 1S4FA 4ZP6A 3RW7A 1YJRA 4PEOA 4NA1A 3AA8A 3ZZTA 3ZZ0A 3HPOA 3T5KA 4RPFA 3W60A 4DSEA 2L48A 1M5HA 1RKJA 2A2DA 4FYDA 3DRPA 4Y65A 1AZSA 4NLPA 1X5TA 3RB3A 1YDLA 3I9ZA 5KAKA 4IH5A 3CCVS 2KO1A 2LLZA 3JSBA 1F3VA 2CPFA 1MWZA 2HKEA 2BE2A 3K5MA 1R8PA 3OL9A 1R8BA 1YJVA 1AYEA 2FJDB 4ZPTR 2ASDA 1WC4A 4OZ1A 2GIFA 4QU6A 1L3SA 4Z7CA 1WG5A 1R31A 4I2QA 5CZVA 4KKOA 1RAIB 2HZAA 3QRPA 2HW3A 1T9VA 3MPUB 3NOGA 3QO9B 4LFAF 3OLBA 4L75A 3H59A 4DV5J 1FNXH 3OSNA 3L3CA 2YWFA 1X5SA 1XNQJ 1FXRA 2RS2A 2DY9A 4P6QA 4OYOA 1WTFA 3SIPB 3BGFA 1S5ZA 2KVIA 3DLKA 5KG1A 1BWEA 5AJ3F 3PRVA 5ETPA 2UXBJ 4JI4F 3V4IB 4QWAA 1HL6A 3T41A 4CI0B 2ZOMA 2K1RA 2LYVA 3CJKA 1REVA 3M9NB 4GKJJ 2BANB 4DF8A 2JHEA 1AXQA 2WOMA 5D3GA 3NP5A 2AYMA 2FLPA 2DR9A 4RKUC 4LF7J 2OHDA 4LR9A 3CJQA 1UETA 1HMVB 4I6AA 4A8OA 3MR2A 2PE8A 1K1SA 1NDKA 4ZOSA 2OEKA 5AE2A 5DM7Q 4NLOA 1EQMA 3GV5B 2BUNA 2DGVA 1L3UA 1U7LA 3PFEA 4TY8B 2PMZD 5IM0A 2N82B 2QFJA 3V6DB 5CYMA 1VRTB 1HBUA 3K8WA 2A18A 2PI5A 1DY3A 4URQU 4DCJB 3WX4A 3MAQA 2HFSA 2V63A 3V4IA 1AFJA 1JLGB 1RTIA 1FXDA 3T9NA 4YP3A 2D41A 3PR5B 3PCOB 3RAQA 4DWIA 5IOLA 1V5IB 4IOBA 4P2MA 5J2MA 3CJRA 2HBRB 4K0KF 4RW6A 2QA4G 1HQUA 2MZRA 3X1LB 1TUGB 5HVGA 4NA3A 4WZQA 3MTJA 4M95A 3UPFA 3C16A 5ETQA 1Q7LB 2HHWA 4A46A 4DL5A 2CZ9A 1Q8BA 2JH3A 3G87A 5LMNJ 3KTQA 4HT5A 1LFPA 3C8YA 1XERA 1MU2B 3JAMU 3D6FB 2HNYA 4LVOP 4MK8A 4TY8A 5KFOA 1X4HA 4OX9F 3MM8A 3OFEA 3OUYA 1UL3A 3FEZA 2J0WA 3RAXA 2VA3A 3HXMA 5DG9A 1VISA 2DR6A 3OL6A 4PZVA 5KFPA 3F73A 2PA8D 4ECSA 3PYEA 1O51A 1FFWB 2RDDA 2FGCA 3TAMB 2HRUA 4OHWA 2UZAA 3KLGA 3C66A 2VFSA 4NLSA 4IRKA 5CYQA 3RBZA 3CD7A 2C2NA 2BM0A 4RUHA 1ZA1B 2QGFB 3NGDA 2QLJB 3CT9A 1XMBA 5IQ6A 5L1JA 5A2QU 1D9AA 4NZ6A 2N7CA 4NCAA 2HQIA 1T05B 1SC1B 2K1RB 2WVEA 3A8EA 2DITA 3H5UA 3FSIA 1N8RT 4CTAB 4QU7A 5A8KB 2AGPA 1WORA 4EWTA 2IIHA 2HQFA 2ZC4A 3J81Y 3WBZA 2YKPA 2KXNB 3M8ZA 3OTDA 4JV5J 3CDUA 1NHKL 3T5JA 4JI7J 1YJ9S 2E1MC 3UQSA 4RUAA 1YGYA 2KB2A 2KH9A 3L4BC 3TW0A 3V6HA 3RRGA 2PFDA 3TQEA 2NXJA 4ED5A 1IR0A 1XR6A 2VKZG 1ZAVA 4OZ3A 4WFAQ 1WHWA 2RU9A 3UDEA 3L09A 4PYDA 3RR7A 4KT0C 3I9V9 3MMAB 4FS1A 1HBUB 5CYMB 2OKQA 2VDHA 2VU5A 5J2PA 4ZN1A 3T9ZA 4OZ0A 2R8IA 4ZPBA 1DFDA 2GVZB 5JVGQ 1A9NB 2LKZA 1RWNB 1OPZA 3CC2S 2QYGA 2C3YA 4F3MA 1HBNB 2WB1D 3T6BA 1TVRB 1YJWS 1HBOB 3FQLA 3ZTRA 8AT1B 4I4BA 5DQHA 3KLEA 4IYQA 3VAHA 1TKZB 2MZTA 2RRBA 4J9QA 2HMIB 1WKJA 1TP7A 3M8QA 5E3AA 1FKPA 1OO0B 1RAOA 4KPCA 3FZBA 3SEOA 1B0TA 4L3KA 4M5HA 4CLYA 2XM3A 2LEAA 4F4YA 1KQGB 2R8KA 3WDOA 1OWXA 4DXLA 4ZIWA 3CJ0A 3LF0A 1B0PA 4ZPVR 2C28A 1N5YB 3KLFA 1FEEA 1DQAA 5AJ3J 3R2DJ 1OQ6A 1S79A 5K14A 1VQ8S 3R5AA 1IM4A 3DKDA 1ZZFA 1M1KT 2OPSA 4FF3A 1TU0B 2IBKA 2OELA 2XYHB 4OX8A 3M8SA 4BHQA 4UOFA 1PKUA 4DPYA 4B9SA 2D3UA 2H4YB 3GP9A 4UF4A 3MF5A 3PIOQ 5L8RC 4ZCKA 2BE2B 4LF4J 5HMYA 1N5VA 4DR6F 3BR9A 1VBXA 3WIVA 2C2MB 1ZA2B 3CNQP 3H2VE 3FRZA 3MM7A 3HF5A 4JI6F 1RJJA 3Q8YA 1VMBA 1S9FA 2BBEA 2Y8YA 2DO4A 1T9XA 1IN0A 1LW0B 2NXUA 2WVBA 3A1YG 4XDCA 4AQYJ 3MPDA 2HNZB 3M8PA 1BUXA 1KTQA 2RRAA 3QQCD 3LANA 3KJNB 1CJTB 1FFSB 1YBUA 3DHWC 2B6AA 2MB0B 1CVJA 3DRSA 4B9VA 2UXDF 1O8BA 2CVIA 2UUWA 3CJ4A 3V2UC 1VQ9S 1LWFA 2RQMA 1GNKA 2O1PA 1RA7A 4P71A 1FI4A 5KFGA 3TEHB 4JYAF 5I42B 1DQ8A 1B70B 3GV7B 2GO9A 4K7QA 4K2JA 2W7AA 2FQQB 4K50A 1IKWA 1HBNA 2KG1A 4J9NA 1QTMA 2F4VF 1SH2A 2RNEA 2BM1A 2GVZA 2BJ9A 2KYZA 3OFGA 1HBMB 3GFZA 5B09A 4DQRA 1JJHA 2Y9HA 3DXSX 2PN6A 1PGZA 2ZUAA 4P10A 1BD6A 3O1LA 2P2CB 3CO9A 2XMAA 2NZ4A 2Z2YB 4LRCA 3HDSA 1TZ0A 2CDQA 1MSWD 1PBUA 2CA9A 4J9VA 1FRLA 2XZTB 5FDLB 4YDDB 2JX2A 2YQ0A 3AOBA 3ET6A 5KT5A 1H6KX 3UR0A 4I6YA 4KFBA 3UI3A 1YTYA 1EETA 2UUTA 5DG7A 1HNIB 2DPJA 3HJFA 4IFYA 2IA0A 1HPZB 1MW7A 3R6GB 3R5DA 2IJFA 3KFWX 1QUPA 2KDOA 2ZEJA 3ZZPA 5HBMA 3MTKA 3CC4S 4QIGA 1CBKA 1HQEB 1M5VC 1S97A 2J9DA 4J5OA 1A7GE 2OPRB 3TWZA 3UO0A 5L39A 2E5GA 3W2WB 2YKAA 6FDRA 4DV0F 1JJCB 4D3HA 1VQ7S 3AXMA 1R6VA 1SH3A 3EGNA 4JP8A 4RLEA 3OLAA 4DQSA 1XNQF 5IV4A 3TZZA 1S77D 4M5NA 3TZYA 2EKYA 3OTCA 1NK9A 1TL1B 2E5LF 1VR6A 1CJVB 3DMJB 4EZ6A 2OAUA 2I9SA 4NMLA 1KC8T 4LF2A 2E5JA 2WVCA 1N4LA 1S48A 3MI7X 3PV8A 5F8GA 4Q44A 5KFUA 1HFEL 3GYGA 5HAOA 1KVJA 1MWYA 3VTIA 2QC3A 3Q0AA 5F8MA 1IJEB 4WYWA 3F41A 3BYRA 3W5ZA 1AUDA 1VJWA 3TQ1A 3E2EA 3RJMB 4JI8J 1RWPB 2E1CA 1IBMF 4ZVSB 2IMWP 3AJ2A 3N4WA 1K9MT 3U1MA 2MSSA 1P6TA 2ADBA 2LDIA 3G6YA 3QRRA 1JLFA 2JVRA 2PEHA 4P7TA 1HQUB 1XK8A 4KGVB 4OZ5A 2XY7A 5D0GA 2VJVA 1KLMA 1LEOA 3VVUA 4ILRA 3PM9A 2GQQA 4Y2CA 3HLUA 3FJ2A 4LR8A 1NCLA 3UE2A 3W62A 1OIAA 5EGYA 3NXZA 3LUYA 1MROB 1TELA 4KV8B 3PYDA 5BYRA 4DUTA 1Y4ZB 3MUTP 3OQ2A 4J9RA 2B56A 4ED6A 1C0TA 2HS3A 1PAEX 4JI1F 1TL4A 5EDWA 3NGUA 3VR1A 3W8GA 1DJ0A 2XLIA 2RIJA 5J1PA 2NSBA 2YBVA 5H9FK 1AW0A 4RL1A 3V6DA 2Z30B 4XO0A 4WCEQ 1EZZB 2ZJPQ 4YB7A 1HNIA 1Q53A 1JB0C 2QO3A 3DLJA 3IN5A 4PPDA 2P5VA 4NOHA 2KHDA 3BJYA 3NGRA 5FLXY 3G82B 3N79A 4X4RA 2ERRA 2XG8A 2Q3PA 4P74A 5FLXU 4G6VB 3UD5A 1XWLA 4DPTA 2LA6A 4EU0A 5IT4A 1CQMA 1QSYA 2VFVA 3Q23A 4F3OA 1N48A 1OYEA 3MCNA 5FD1A 3JXOA 3N5FA 4JI4J 2Q6BA 1IUJA 1REVB 2CQ0A 4PG4A 3CJKB 2MZQA 2DEIA 3H2LA 5KFRA 1VBKA 2VHGA 3HD2A 2DD8S 3G6VA 2XC9A 3W9HA 1Q81T 3QAUA 4KHMA 2XLKA 3BZQA 3CEDA 3AQOA 3JQKA 5KT7A 1CJVA 3CCSS 3MWBA 2OIHA 3CB4A 2CPXA 2HNDB 3BREA 5KFKA 2W8KA 3H4BA 4DR3F 2DGQA 4P2SA 1K0VA 1KFDA 2BA9A 2KL8A 1N6QA 2N7YA 1P8GA 1S1WA 2V67A 4LSLA 2FJVA 1EAYC 3A8KA 3I0RB 4B08A 1FJGJ 4DEZA 4ZLLA 2J0SD 1IQZA 1IXKA 4CH1A 1NPKA 1QAYA 2FZGB 4PWUA 3UNGC 4MKYA 1XEZA 2B4PA 4C0HA 5IFMA 2XO7A 2XHCA 3VQSA 1EETB 2I2YA 4B3OA 2AJ0A 4PXDA 1FNMA 3A3PB 1P27B 4I1TA 2EFGA 2ZNZA 1TL3A 3FK4A 4XTTA 1GT8A 2FLOA 4NCGA 2YKMA 1YK9A 3JB9k 4OZLA 2MMYA 5DZ7A 3T3FA 4EEYA 3NNCA 3NCRA 2YQ1A 2EFNA 4RX6A 3W61A 5F9LA 3OHAA 1RTDA 2AW0A 1GQEA 3KDNA 1R8CA 2GVDA 5I3UA 1AUSL 4JV0A 2BJ8A 3ENWA 5CQGA 5C42B 2VICA 1ZTTA 2CZ4A 1KLNA 1ZM9A 2DNKA 2VKRA 3H25A 1VQKS 2Q66A 2OTLS 4AT1B 1N36F 1E6VB 2CJKA 1WEYA 2M8DB 4LREA 1PIEA 4G3IA 1VHIA 1FRKA 1CS4B 2BX6A 2V68A 3RTVA 4DV3J 1RT6B 4HI1A 4LQ3A 4BWJA 1SQEA 2WSCC 2LECA 1RTZA 2RDIA 3B6BA 2E7WA 4WFBQ 1GMVA 2J7WA 1ZBTA 1UJ6A 4I2PB 2VBYA 4O4GA 2CDRB 5KT4A 1IBKF 1N54B 3HSZA 1MMNA 4XPEA 2GMHA 3D54A 4J9KA 4Q45A 4KHPF 2V8HA 1BC6A 1B99A 1JK9B 1TL3B 1U6BA 3PJXA 1LK7A 3PEHA 1QUVA 2AMCB 3K17A 3PEJA 1X8DA 4WIQA 4DFKA 2DNHA 4DSLA 1HWLA 3IAS9 3G96A 3M8WA 4AL6A 5CA5A 3EVWA 5LSOA 2CVEA 3GILA 5IZHA 4X2BA 4H4KA 1R27B 2PGCA 5EWEA 2ZC3A 2MGZB 3PIPQ 4L72B 1EP4A 2VB6A 4U96A 1IBMJ 2ALZA 4FBTA 4NWBA 1R0BG 2VC1A 4IH6A 5D4NA 4RNFA 3ZFVA 4ZPDA 4AL7A 3TJ9A 3I4PA 2KXHA 3G8SA 1GMWA 3NS6A 5F9NA 1UVNA 1BQNA 8ATCB 2MSTA 1MMLA 3UNYA 4X4QA 1HNZF 3QJPA 2M2BA 4HI2A 2M52A 1WOSA 4QYZK 4RU2A 5D6GA 1O0PA 1I1GA 2K06A 5G0RA 2CJYB 4DR5J 2R8HA 2B4VA 3BGUA 2RILA 1S59A 4OHZA 3DM2A 1GXLA 4JI2J 1F0XA 3J80U
chains in the Genus database with same CATH topology
2WZ1A 4CLTA 4CLKA 2BW7A 3G82B 1CJTA 3R5GA 1YBTA 4OZ2A 4P2XA 4OYWA 4CLZA 1Y10A 4USVA 4CLUA 3C16B 1CJTB 1YBUA 1Y11A 3G82A 4OYAA 4WPAA 3MR7A 1CJVA 5D0RA 1CULA 1CJUB 4OYBA 1U0HA 4P2MA 4CLLA 3MAAB 5D0HA 3UVJB 1TL7B 3C16A 3C14B 2GVZA 3C15B 4OYIA 5D15A 5IV3A 2W01A 3ET6A 1YK9A 4P2FA 2GVDA 2QV6A 4NI2B 1FX4A 1WC0A 4USWA 3UVJA 4CLWA 4WP3A 1CS4B 4OYXA 2GVDB 4WP8A 5IV4A 1CJUA 1U0HB 4USTA 4OYPA 1CJKA 1CJVB 4OZ3A 4USUA 4NI2A 1AZSA 4CM2A 4CLSA 2GVZB 3C15A 1WC6A 1AZSB 3C14A 3ET6B 1TL7A 1WC4A 1AB8A 4OYZA 4CM0A 1WC1A 5D0GA 1CJKB 1CULB 4CLYA 4CLPA 1WC5A 4OYOA 1CS4A 1WC3A 5D0EA 1FX2A 4OYMA 3MAAA 4WP9A 4CLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZ1 A;  4CLT A;  4CLK A;  2BW7 A;  3G82 B;  1CJT A;  3R5G A;  1YBT A;  4OZ2 A;  4P2X A;  4OYW A;  4CLZ A;  1Y10 A;  4USV A;  4CLU A;  3C16 B;  1CJT B;  1YBU A;  1Y11 A;  3G82 A;  4OYA A;  4WPA A;  3MR7 A;  1CJV A;  5D0R A;  1CUL A;  1CJU B;  4OYB A;  1U0H A;  4P2M A;  4CLL A;  3MAA B;  5D0H A;  3UVJ B;  1TL7 B;  3C16 A;  3C14 B;  2GVZ A;  3C15 B;  4OYI A;  5D15 A;  5IV3 A;  2W01 A;  3ET6 A;  1YK9 A;  4P2F A;  2GVD A;  2QV6 A;  4NI2 B;  1FX4 A;  1WC0 A;  4USW A;  3UVJ A;  4CLW A;  4WP3 A;  1CS4 B;  4OYX A;  2GVD B;  4WP8 A;  5IV4 A;  1CJU A;  1U0H B;  4UST A;  4OYP A;  1CJK A;  1CJV B;  4OZ3 A;  4USU A;  4NI2 A;  1AZS A;  4CM2 A;  4CLS A;  2GVZ B;  3C15 A;  1WC6 A;  1AZS B;  3C14 A;  3ET6 B;  1TL7 A;  1WC4 A;  1AB8 A;  4OYZ A;  4CM0 A;  1WC1 A;  5D0G A;  1CJK B;  1CUL B;  4CLY A;  4CLP A;  1WC5 A;  4OYO A;  1CS4 A;  1WC3 A;  5D0E A;  1FX2 A;  4OYM A;  3MAA A;  4WP9 A;  4CLF A; 
#chains in the Genus database with same CATH topology
 3GFY A;  1OYD A;  1TKZ A;  3QSI A;  1NU4 A;  1PJ6 A;  4X4P A;  2HFN A;  5ETM A;  2ZVI A;  5D4L A;  1RWV B;  2IC3 B;  3H0P A;  3E51 A;  3NGK A;  2MLY A;  3IS9 B;  3MFH A;  1NJZ A;  4LRF A;  2J5A A;  2KZZ A;  1WF2 A;  2YPZ A;  4QQB A;  3GQC A;  3BR8 A;  2L9D A;  4GC7 A;  3GCW P;  4F0M A;  3WC2 A;  3MM8 B;  2KJW A;  1V3R A;  3DYA B;  1T02 A;  3MMB B;  4F26 A;  3TZX A;  4DLE A;  5LL6 d;  3W9J A;  4YR0 A;  2XMJ A;  5K20 B;  1U24 A;  1TK0 A;  3GR1 A;  3HSD A;  2MHN A;  4CLU A;  4Q2M A;  2A1B A;  1MRO A;  2CZV C;  2DXF A;  4KV8 A;  1Q7Y T;  3PKM A;  7FD1 A;  2B5J B;  3M6U A;  4KSE B;  1S9E A;  4PUO B;  4FF1 A;  4LBI A;  2GHV C;  5F8I A;  3FMW A;  5EWF A;  4OYB A;  1NJX A;  1UAW A;  1N0U A;  2DNO A;  1NSQ A;  3HJV A;  1JJ4 A;  1D0E A;  1S9E B;  2OSQ A;  3L95 X;  2ZH6 A;  4XPC A;  3VVT A;  2W7P A;  2ILZ A;  1YJN S;  3BO4 A;  1KN6 A;  1YRU A;  4AQY F;  4NCB A;  2DNL A;  2GML A;  5EUH A;  4DZ6 A;  1VQN S;  1D8Z A;  1UVK A;  2IYI A;  3KWM A;  4QWC A;  1RAB B;  4K4W A;  2FD2 A;  3UCG A;  3DRY A;  4RNM A;  1RT3 A;  3PO5 A;  1YIJ S;  1UVI A;  3H5S A;  1R3N A;  1RT5 B;  3IS9 A;  1U26 A;  1KBR A;  4XK8 C;  3GR0 A;  2WBM A;  4WF9 Q;  5AXM A;  2IHR 1;  1HMV A;  2AZ3 A;  2JWN A;  2KKH A;  3D5M A;  5B0A A;  9RUB A;  1KQS R;  3GYN A;  2Z57 B;  3BPD A;  2XQC A;  3OUY B;  2B0G A;  3GWC A;  3PW5 A;  3SCJ E;  1H38 A;  4NXN F;  1QE1 A;  1N36 J;  2GA7 A;  5KFN A;  2J8S A;  3NGS A;  2EG1 A;  3ZZY A;  2I5J A;  3H5X A;  3MED A;  1SC6 A;  4IQX A;  4DR6 J;  5KFQ A;  4R0J A;  4M5M A;  4PWD B;  5E3R A;  5HRO A;  1FX4 A;  1WC0 A;  2KT5 A;  3H42 A;  3BS9 A;  3CTR A;  3DU5 A;  4TU7 A;  4ECT A;  1XMO F;  4OYX A;  3M30 B;  5A2Q Y;  1N34 F;  1JIH A;  2LQJ A;  2EPI A;  1HPZ A;  4IFY B;  2F9J A;  4KH0 B;  4MKA A;  1N0V C;  2GV1 A;  2ZKU A;  1S7I A;  3EZU A;  3TVZ A;  4KFB B;  2C2O B;  3HCX A;  1ZET A;  2IDL A;  2G0J A;  2NXE A;  3MDF A;  3CIM A;  3SYZ A;  4X4O A;  3ILJ A;  3NAH A;  3K8V A;  1TKX B;  4EO8 A;  4FVC A;  1QD1 A;  1IKX B;  3GE9 A;  4C11 A;  1O5J A;  1PC4 A;  4LF1 A;  1ROF A;  4EZ9 A;  4DG1 B;  4ZJL A;  5B08 A;  5M2U A;  1HBM A;  5KG3 A;  2D9O A;  2OGU A;  1W26 A;  2N4D A;  2U1A A;  2VG6 B;  1YZ6 A;  3DRP B;  3KLI A;  2B3T B;  4MIW A;  5IC4 B;  2Z2Z A;  1LXN A;  1ZOT A;  2KVQ E;  2LEB A;  1U1L A;  1UWB A;  4OX9 J;  2LQB A;  1Q8I A;  4DQI A;  5D77 A;  2NQP A;  1FDD A;  4J91 A;  2IM0 A;  5HSP A;  2JEI A;  1G3O A;  4CM0 A;  5HO4 A;  3NBP B;  2MQO A;  1HD0 A;  1RTH A;  4ZP7 A;  3HKW A;  5T7L B;  2CQD A;  4O4G B;  1V3S A;  2MDA A;  3FUY A;  3I96 A;  2OO4 A;  4ZKA A;  3DOK B;  1X9M A;  1URN A;  2AV5 A;  2MKJ A;  2MJU A;  3FSX A;  2Y8W A;  2NPF A;  3GJS B;  5H1S V;  1NKB A;  1EIY B;  1DAR A;  1GMU A;  2UVR A;  4U8Y A;  3R5J B;  5GAD I;  5J1N A;  3O5T B;  4DR2 F;  1TFY A;  3M8P B;  3HO1 A;  2YVS A;  4X62 F;  1D3W A;  1NO8 A;  3HUL A;  1DZ5 A;  1WTB A;  2JNJ A;  1LNQ A;  2XHW A;  1D09 B;  1XN9 A;  2BKP A;  2R7Q A;  1PSD A;  2ZBR A;  3D6T B;  2W2Q P;  5KOX A;  1DTT B;  4DV4 J;  1WHX A;  3F56 A;  2VV5 A;  1JQG A;  4CLK A;  1RT2 A;  2KFZ A;  5BR8 F;  4O23 A;  3CCJ S;  5I3Q A;  1BHN A;  3DN9 A;  3ISN D;  3J7Y U;  2OPP B;  1UW9 A;  2JC1 A;  1V5V A;  2HG4 A;  3IG1 A;  4C2M A;  3U1N A;  3EX7 B;  2CQG A;  5LT5 A;  3FBB A;  4X66 F;  4IO9 Q;  3SQG A;  1QAI A;  2MKH A;  2RB7 A;  2XS2 A;  1KHW A;  4DU8 A;  1RT1 A;  2G1H A;  4WZM A;  2QLB B;  3JQJ A;  3M1V B;  1H98 A;  3HHL A;  2D69 A;  3G82 A;  4OYA A;  4QW9 A;  4DL3 A;  2XCA A;  1S1W B;  3DXB A;  3H90 A;  4LSL B;  1S99 A;  1T95 A;  4CIO A;  3TI0 A;  1GXT A;  2DO0 A;  1FKP B;  1VQS A;  2RUS A;  2Z4P A;  4KGZ B;  1W2I A;  4X65 F;  1W2B R;  2J6U A;  1HWK A;  4ZVG A;  3DI6 A;  2BJD A;  1F60 B;  3IR5 B;  3UN5 A;  1SBR A;  2E1R A;  4J7C A;  3QWP A;  3NY0 A;  2ZIT A;  3S01 A;  3THT A;  1IM6 A;  2GHW A;  5ETO A;  3QGP A;  2XMM A;  3BSN A;  1Q8K A;  4RWW A;  5CXT A;  5C24 A;  4YFU A;  1VS3 A;  1FJE B;  2ZH9 A;  1NBE B;  1IBK J;  1S9G B;  1LW2 A;  1S49 A;  4YUD A;  1JNR B;  5A8W B;  1Y5N B;  2VQF J;  3HK2 A;  2XTJ P;  2IFX A;  3QGH A;  1IKV B;  4P9S A;  3GPA A;  3MMA A;  1IKX A;  5F3T A;  4C11 B;  2HVI A;  1Y9O A;  2YNF A;  4PXC A;  2FLL A;  4DSF A;  3FDS A;  1N5T A;  2D1C A;  2XMW A;  3BN4 A;  3OFH A;  2QJ3 A;  2KHC A;  2ZZT A;  2UP1 A;  2YKN A;  5L46 A;  3KUH A;  1RXO B;  4G1P A;  2W2N P;  2Q79 A;  2QV6 A;  3KUG A;  3M30 A;  3MD1 A;  3PHE A;  2BJ1 A;  1F9F A;  4RW4 A;  3IXQ A;  5LMN F;  1RAJ A;  1XC9 A;  1Q0N A;  4MJK A;  2DR7 A;  1WHY A;  6AT1 B;  4CTA A;  3CF5 Q;  1RIS A;  2N4C A;  4OL8 A;  4YEA A;  2DBB A;  4ZP8 A;  4UQT A;  3IWL A;  5HN0 A;  4GKJ F;  1N33 F;  3Q89 A;  4NYO A;  3TJ8 A;  2FGO A;  1KLM B;  2A3J A;  3OVA A;  1SJF A;  5K8M A;  2V2K A;  4K8R A;  1RZM A;  2M3D A;  2XBP A;  1KTV A;  3I32 A;  3N6M A;  4TY9 A;  3EPI A;  2BJ7 A;  1MWQ A;  3M7V A;  3W2W A;  3V81 B;  1HD1 A;  4IR1 A;  1S1T B;  1VIX A;  2XMK A;  2KYX A;  3GYX B;  4ECW A;  1TQL A;  2J9C A;  2NS1 B;  3QLH A;  2CQB A;  1S10 A;  2ATL A;  4NI2 A;  1JLA B;  4DV7 F;  1PAU B;  1RWM B;  3U27 A;  4RW9 B;  2HSE B;  4OJ1 A;  1W25 A;  1TKT A;  3KYL A;  1DHM A;  4ES1 A;  3C14 A;  5IT0 A;  4LF9 F;  1JNZ B;  1YSJ A;  4IQM A;  2LP4 A;  2Z2M A;  3ET6 B;  1X7V A;  1Q86 T;  4CZC A;  2NCK L;  3HSJ A;  4OYZ A;  5B0D A;  2XSJ A;  2HEK A;  1OY9 A;  3AD7 C;  1RWX B;  3BPS P;  4LVN P;  4EGL A;  1NZ8 A;  3CDA A;  4N56 A;  2H3E B;  4LRB A;  3VGS A;  2MXY A;  4MTP A;  2JL9 A;  3A13 A;  3ZTQ A;  4FNI A;  4ECQ A;  1S9G A;  4HT7 A;  5A8W A;  1FCA A;  3M6X A;  3SFU A;  4K0K J;  1H7X A;  3NLC A;  3D2W A;  4X4T A;  3PHT A;  3W2V B;  1R0C B;  3DOM B;  4DN9 A;  3L7U A;  5LSL A;  4EBC A;  2HZC A;  2UUB F;  1YKW A;  2PA3 A;  3BH7 B;  3RU0 A;  4CYU B;  4Z7Y A;  4IRC A;  3A12 A;  3P6Y C;  4HAC A;  3MPY A;  3PDN A;  2E5L J;  1Y5L B;  3LOU A;  5LSR A;  4K59 A;  1RCX B;  3AT1 B;  4KPY A;  4TNO A;  4LF7 F;  4MMO A;  5DZ6 A;  8RUC A;  2KFN A;  3D0I E;  5KG5 A;  3SQG B;  1NDP A;  2PMW A;  2EBG A;  1C1C B;  4C4W A;  1OS5 A;  2B4U A;  2DCU B;  3CO0 P;  3DM2 B;  3ENA A;  3H20 A;  3PYG A;  1HHS A;  4XAK A;  1Q79 A;  2W24 A;  2FVC A;  2E66 A;  2LQ5 A;  5G0R B;  3PXG a;  1YQH A;  1U1O A;  1JLE A;  4DV2 F;  2KM8 C;  5D4O A;  5E3Q A;  2F63 A;  4DUZ F;  3PZP A;  4V19 X;  3MEE B;  3RAM A;  4ZA1 A;  4R5P B;  4CLZ A;  1UMJ A;  2WVF A;  3MD3 A;  4NL5 A;  3W9I A;  5D4P A;  1T3O A;  2RQ4 A;  3LP2 A;  3TYT A;  4A8W A;  3R1H A;  5I42 A;  2R7O A;  2IY5 B;  4M94 A;  4WFZ A;  2IPO B;  4F4W A;  1DTT A;  1S0M A;  2GW8 A;  2OPS B;  2ZD1 B;  4M5I A;  4R8U B;  5A8R A;  3I4H X;  2DKO B;  2QA1 A;  1OQ3 A;  3HHE A;  4O4R A;  4DPU A;  5DDO C;  4ETX A;  1U49 A;  1L3V A;  3FMB A;  2VC0 A;  3M2R B;  3QGI A;  2VQF F;  5FII A;  4DPW A;  1FD8 A;  2RF2 A;  5KTQ A;  2KM8 B;  4YDX A;  3CMA S;  2EVZ A;  3HVT B;  2DIU A;  3CCW A;  3MCO A;  4O44 A;  4ZVO B;  2YNI B;  3HT3 A;  1S0O A;  1V9O A;  1SKR A;  3KMS A;  4ED4 A;  3HKZ D;  2AT1 B;  2B9X A;  4B17 A;  4ZVR B;  2YWG A;  5THW A;  1X0P A;  2VFT A;  4FZV A;  4OX7 A;  4NXM J;  1OY8 A;  4F4X A;  4KYZ A;  1DAX A;  5J2N B;  3VAM A;  1VI7 A;  3BEG B;  1FDA A;  2OPQ A;  1FE0 A;  4O3N A;  1U4B A;  1R7I A;  1HWI A;  2CYY A;  3RRH A;  1SV5 B;  1R43 A;  3BYP A;  4FXV A;  5LMU F;  1KQF B;  2A10 A;  1G2E A;  1S4E A;  1J5E F;  3UN2 A;  3KK3 A;  4WKR A;  3MHY A;  4V1A k;  3ZZU A;  2CPI A;  5DG8 A;  3H5Y A;  1PG5 B;  3H4D A;  3BGL A;  3FBE A;  2ZZN A;  3NWR A;  5KFF A;  2VQE J;  4R8U A;  1UA0 A;  3SDE A;  2GVD B;  1ACM B;  3R3T A;  1N5S A;  1UPM B;  1WEX A;  1XR7 A;  1P9Q C;  2Z8Q A;  3EGW B;  3MMC B;  3PJ9 A;  3PW7 A;  4Q0B A;  4WE1 B;  1LQ9 A;  1SL2 A;  4QW8 A;  2WBR A;  4RW7 A;  1O6X A;  2HAF A;  3JQM A;  2EW9 A;  3D1O A;  4WU2 A;  3GIM A;  3Q22 A;  5HAN A;  2RQC A;  4DL7 A;  1X5P A;  4UOC A;  1RWK B;  5E0O A;  2M88 A;  1HLW A;  1JLE B;  1TVR A;  1JLQ A;  2W4P A;  1T05 A;  3RBX A;  1IBC B;  3ENV A;  4CM2 A;  3J80 Y;  2J8A A;  4PAB A;  4JOU A;  4MH8 A;  4CLS A;  2UVW A;  3V6J A;  1WC6 A;  3B82 A;  2LFV A;  2ZBI A;  4CNZ A;  4R25 A;  4DV6 J;  2EK1 A;  3VZH A;  1KDN A;  2CUY A;  3AH6 A;  1RAD B;  2CJA A;  2X1G A;  5HJY A;  3ILO A;  1PYS B;  4USJ C;  2BOP A;  2FC8 A;  4LUB A;  2ZD1 A;  3QJL A;  4K4V A;  1B64 A;  1OJ4 A;  4N8O A;  3J81 U;  5K8N A;  2HND A;  3T6J A;  5DDQ C;  5RUB A;  4Z2X A;  2M0G B;  3CMQ A;  4ID8 A;  1ZPV A;  4CO3 A;  4PG8 A;  1H2U X;  4F25 A;  2CJX B;  4YQW A;  3W2V A;  2FJE B;  2EKN A;  4KGM A;  4Y3C A;  1J27 A;  1QSS A;  4RNO A;  2LEP A;  5D8H B;  3D28 A;  2V2Z A;  3IR7 B;  3R6L B;  1BQM A;  1FES A;  1UJ4 A;  3N01 A;  5JXS A;  1PO6 A;  2XI3 A;  2DH9 A;  1N56 A;  1NHV A;  5G4D A;  1C1B B;  3EDQ B;  4RWX A;  3HFK A;  4ZK7 M;  3MEC A;  2XY6 A;  2FHM A;  3U7J A;  3K57 A;  1U25 A;  1VQL S;  4YME A;  4HLB A;  1KWM A;  4F2S A;  3KLG B;  2WK4 A;  1IR2 A;  1S6P A;  4L76 A;  2SXL A;  1N33 J;  3OSP A;  1RTI B;  2CPZ A;  2AF6 A;  2E29 A;  2XS5 A;  5HLF B;  3TUP A;  2ZVS A;  3R5G A;  2EWH A;  2FZK B;  3OVS A;  3KK1 A;  1JLC A;  1T94 A;  1SL1 A;  4N76 A;  4Q8F A;  3JTO A;  4B9L A;  1MU2 A;  4KRW A;  1K73 T;  2GFF A;  3N6L A;  1ZM2 A;  3KK1 B;  4JI6 J;  4ATN A;  5I3P A;  4HDH A;  1T9U A;  1VCT A;  4TN2 A;  5DLF A;  3C16 B;  1S57 A;  3EZO A;  3G86 A;  1VLY A;  1EQ0 A;  4DMZ A;  2JC0 A;  5GVQ A;  1VBZ A;  5J2Q A;  1QM9 A;  1CUL A;  3PKY A;  2MEW A;  2MLX A;  4WFX A;  3MAH A;  4CDI A;  3SSS A;  3QMQ A;  4I0W A;  4ECV A;  3CJ8 A;  3OHB A;  5GAG I;  2PMH A;  1KON A;  3P5B P;  1DTQ B;  3EGV A;  3UVJ B;  5T14 A;  2YWK A;  1SKS A;  3CUN A;  3DGV A;  4LF5 J;  1N32 F;  4LIW A;  3C14 B;  4NZ0 A;  4J9L A;  2HAI A;  3WHI A;  2Y1L B;  3ELH A;  1BWV A;  1FO1 A;  1NND A;  2B7C B;  2F8E X;  5KG6 A;  4U67 Q;  2KZM A;  4OYI A;  3KG4 A;  1WDD A;  2QL5 B;  4DX7 A;  2QIF A;  2WHO A;  3DLE B;  4FNH A;  4ILM A;  2UUB J;  1Z2L A;  5IV3 A;  1B3T A;  1M5K C;  2R8J A;  4JI8 F;  2ZHA A;  3BO2 A;  3TA1 A;  4YHH J;  4B3R F;  1X4E A;  3V81 A;  4JI0 F;  4X65 J;  3QSY B;  4P2F A;  2YH0 A;  2GC8 A;  3IWN C;  2ROP A;  2VIH A;  3S1T A;  3DDN A;  2WOM B;  5GME A;  4NYP A;  1UVJ A;  1R8A A;  4FYV B;  2IVY A;  4WWS A;  2J0Q D;  5C24 B;  1G7C B;  2RQK A;  3MOJ B;  2BRL A;  3I5C A;  1KOH A;  2GGP B;  2MQM A;  5HAT A;  2IAJ B;  1RTJ A;  3Q8V A;  2LVW A;  3GJT B;  2YNH B;  2E9Z A;  4WP3 A;  3W64 A;  2DHG A;  4RW4 B;  2VAS A;  3QPI A;  1RAE B;  4HTJ A;  2G13 A;  2D9P A;  1U0H B;  2CJB A;  2CQ4 A;  2CQP A;  3NWG A;  4QPT A;  4RW8 B;  4UUX A;  4ZVF A;  3D4J A;  5C25 B;  3BBB A;  4QR0 A;  4GVL A;  1RWO B;  2MKS A;  4KKO B;  2DEJ A;  3UD3 P;  3NNA A;  2VZ9 A;  2DNP A;  2NXC A;  3M1V A;  4U7U K;  3HHL D;  1YIT S;  3TJA A;  3G4S S;  2UU9 J;  3KJV A;  1LK5 A;  1Y00 A;  2W4D A;  2WON A;  4Y34 A;  3OR1 A;  3SFG A;  2E5I A;  4QIE A;  1SV5 A;  2ZM6 J;  4A48 A;  1ZH5 A;  1UPP A;  3R9L A;  3J7Z T;  4YOE A;  1AZS B;  1I94 F;  3LGM A;  3E8O A;  4WXW A;  3V6K A;  3JTN A;  2X1B A;  2QG9 B;  2N3O A;  3CD6 S;  1FEH A;  1HYS A;  1FTR A;  5D78 A;  4B3S J;  3KG1 A;  4I68 A;  4OMF G;  4WII A;  3W66 A;  3OT9 A;  3TZW A;  3DC2 A;  1WKL A;  3I6P A;  3OJU A;  1BMQ B;  4NXM F;  3GIK A;  2C2E A;  1CJK B;  1SJ1 A;  2ZE2 B;  1A6L A;  4MFB B;  2OI2 A;  2Y0B B;  4O44 B;  4DV5 F;  3HVT A;  3PW0 A;  4X64 J;  4R0E A;  1R89 A;  1VK8 A;  1WC3 A;  3NS5 A;  1HNW J;  3OTO J;  1J5O A;  4CO1 A;  1RTJ B;  1J5O B;  3I0R A;  2F4V J;  3KHH A;  4DQQ A;  2IM3 A;  1K0T A;  1Z2Z A;  1N6Q B;  3SSR A;  5L38 A;  4ZPW R;  1VFJ A;  4YY3 F;  1NSA A;  2VUG A;  1XMO J;  4BWM A;  3ZZZ A;  4K4S A;  1T03 B;  4QJV A;  5IQQ A;  5A0Y A;  1GFW B;  1OY6 A;  4NA2 A;  4Q5V A;  3RB6 A;  4I7F B;  3KK2 A;  3KG0 A;  5L9X A;  2FJW A;  1FK9 B;  4NLX A;  4R5P A;  3MEE A;  4TLQ A;  4TU8 A;  3MUM P;  1VC6 A;  5GAH I;  4N8N A;  1B0V A;  1RT2 B;  4L6V 3;  5IWA J;  3CSK A;  2VPY B;  4HHU A;  2FHK A;  5ETV A;  1FER A;  5HL7 Q;  2XB2 D;  4LFB J;  2NLW A;  4ZN3 A;  2F8M A;  4DG1 A;  5HQL A;  2PSZ A;  4UY8 5;  3AJ1 A;  5KFX A;  4DZD A;  1NH7 A;  2JSX A;  2K2P A;  4PXE A;  3TUZ C;  3QGG A;  3M2U A;  2X1A A;  3A3O B;  5DRK A;  4DV3 F;  2ACY A;  1C4C A;  1UEU A;  3QJJ A;  2CRL A;  4UY8 T;  2DNQ A;  2B9E A;  4C8K A;  1MG7 A;  5D0R A;  4U7U D;  2PFF B;  4JUZ A;  2X51 A;  4CYU A;  1NJI T;  2RML A;  1RLC L;  1KSP A;  1LV5 A;  2CJQ A;  1RTH B;  4NLV A;  1S7H A;  4OI4 A;  4K2X A;  4H4M B;  1S1V A;  3RBE A;  1TL7 B;  2A2C A;  1FD2 A;  3IRX B;  1U2F A;  2CAD A;  2H5J B;  3QAT A;  5DM6 Q;  4ID5 B;  3D68 A;  4LBH A;  3ADA C;  2HPU A;  3DRR B;  4USH A;  5F0U A;  3S7R A;  4URG A;  4B9M A;  3MM5 B;  2ZH5 A;  4DV1 F;  2G9O A;  5EN1 A;  3I82 A;  1IR1 A;  1EB0 A;  1VGY A;  4Q43 A;  1HR0 J;  2R42 A;  2FVS A;  4O0I A;  1AA1 B;  1RT7 A;  2J9D E;  4RJV A;  2F40 A;  2VPX B;  1RLD A;  2QZ8 A;  2RS8 A;  4WTY A;  1YHQ S;  4HVZ A;  3KNA A;  1TKX A;  1F5B A;  1RT5 A;  1EHW A;  1LWE A;  3AD9 C;  2RHS B;  1VQP S;  1TAQ A;  2OJ3 A;  5M2P A;  4WK1 A;  1X4D A;  1S1U A;  2AQ4 A;  3JYT B;  4NLU A;  4N47 A;  1R0A A;  1TKT B;  2WCX A;  1TMM A;  2O66 A;  2E5H A;  1H3D A;  3DGP A;  1Y0H A;  4BDP A;  1TK5 A;  4A8M P;  3JSM A;  4F8R A;  2EEY A;  1RSC A;  3TA2 A;  2YX1 A;  1GX5 A;  2V50 A;  5HMW A;  3ZTP A;  3ILI A;  5HRO B;  3UVJ A;  3AXK A;  1Q5Y A;  2I5J B;  2BAB A;  2E9T A;  1NME B;  2AHO B;  2PO4 A;  3H2U B;  1GTH A;  1K47 A;  4QZV B;  3HHK A;  2OD6 A;  1ICE B;  1NDL A;  1SC4 B;  4Y6I A;  4YN3 B;  3UDC A;  5ETL A;  1TV6 B;  3EJM A;  2ZZM A;  1TUV A;  1FKO A;  3DOL A;  2MQQ A;  5CAB A;  1YVF A;  3BV8 A;  3LAM A;  4RBU A;  2UXB F;  2IMO A;  4TKT A;  4I56 A;  4DOZ A;  3MFI A;  1CPZ A;  1CC8 A;  1FHT A;  4Q7A A;  4ELU A;  1RT3 B;  4J90 A;  2HGL A;  2K3I A;  3THP A;  3QT8 A;  3D6H B;  2BXJ A;  1S0N A;  3Q83 A;  2HNY B;  4USM A;  4X84 A;  5KFJ A;  3T1H F;  2KRR A;  4E0D A;  2PC6 A;  4O3O A;  4OLP A;  3TX0 A;  1NJW A;  2XI2 A;  1N34 J;  1JLQ B;  3GSI A;  2CQH A;  4O3R A;  2RD5 C;  4U8V A;  4ZDN A;  2FB0 A;  4IRD A;  4OFZ A;  2MY7 A;  3ZXW A;  2EK6 A;  3UW1 A;  1NSP A;  2YNF B;  4EBE A;  4JV2 A;  4B3O B;  2MKY A;  3HVA A;  4LF8 F;  3N9U C;  1LOU A;  5B0C A;  1EKS A;  4C6A A;  4X64 F;  2XEX A;  4LJM A;  4B3S F;  3AB2 B;  3MPW A;  2VL1 A;  2HVH A;  2HLT A;  4EI2 A;  2XS7 A;  1WC5 A;  2ZBP A;  3LPE A;  4URS A;  1X4C A;  3M2V B;  3K2Y A;  1N5Q A;  2YNG A;  2W2O P;  1WEZ A;  1NPR A;  1UEK A;  2HFV A;  2XWY A;  3H7H B;  5GAE I;  2D3O R;  4GKK J;  2P6T A;  3R8Y A;  3MGJ A;  3BDP A;  3AQP A;  2WZ1 A;  3P45 B;  3FRY A;  3SMZ A;  2H48 B;  2OFG X;  3NG8 A;  1VQ4 S;  4M8L A;  1M0S A;  2BV3 A;  5EX3 A;  3OJS A;  3SV4 A;  3C19 A;  1SUQ A;  2L9N A;  3HZG A;  1FRX A;  1H0H B;  4TXS A;  3OR2 A;  4DPO A;  2NUU G;  1CC7 A;  1NK4 A;  3LP0 B;  1HAR A;  1JXV A;  3MMJ A;  4ZCI A;  4F3Q A;  1RCO B;  2QSF A;  4ETZ A;  4ELT A;  2DR8 A;  3BKT A;  4KTQ A;  3EYZ A;  4LSZ B;  1TUW A;  2ZH2 A;  1H72 C;  3IG1 B;  2AJF E;  1XJW B;  2BKN A;  4KJI A;  4Y2A A;  2F8H A;  3KUE A;  1NKC A;  3NMA A;  4CP5 A;  2MTL A;  4F4K A;  4V19 J;  3BM7 A;  2R2S A;  5L1I A;  1UFK A;  4M5L A;  1KFS A;  2HGN A;  4I7F A;  2VBZ A;  1Q8L A;  3KK2 B;  5BR8 J;  3FFI A;  3VGV A;  3ENQ A;  3VHQ A;  2AEF A;  1UA1 A;  1T03 A;  1CJU B;  1URR A;  2DGW A;  4GKK F;  4GO7 X;  2BR0 A;  5LXY A;  2G4B A;  4KGX B;  2ZUG A;  2B9Y A;  2MZS A;  2BMB A;  3FFI B;  3EPG A;  1NK5 A;  5CCL A;  3LP1 A;  3FGV A;  4IR9 A;  1DLO A;  1SVD A;  2E7V A;  4MIB A;  4DR5 F;  3KJQ B;  5E3P A;  4FXD A;  2Z56 B;  4PKD B;  3W1Y C;  4C7Q A;  5C42 A;  5J1E A;  3DLG B;  1VOM A;  1RHK B;  3MPV A;  1IKY B;  4X4S A;  3FNN A;  4U95 A;  5M2R A;  4DL0 C;  2YX4 A;  2O5D A;  5K8O A;  4E8U A;  5MLC V;  1NAQ A;  4FPI A;  3PVX A;  2W1B A;  5F8N A;  4DI6 A;  1LWC A;  1NJY A;  2J76 E;  3I56 S;  3CCR S;  3AA9 A;  3OXL A;  4OJH A;  3PO4 A;  1WKK A;  4FDF A;  3EMT A;  2HYI B;  3C6U B;  5GAG U;  2XO6 A;  1RHR B;  3Q8R B;  2HK2 A;  1HBO A;  1FRJ A;  2MPU A;  4OX6 A;  4DX6 A;  3VF0 B;  3IM8 A;  3KLI B;  4QIF A;  5KFZ A;  2APO A;  1SC3 B;  1WAC A;  2E1P A;  3D7S B;  2HVD A;  3IO1 A;  3QIP A;  1RT6 A;  4MYU A;  4DX8 H;  4YS2 A;  5IWA F;  3QYY A;  3J81 j;  4X62 J;  1C4A A;  3FCV A;  3W7B A;  2DNR A;  3KLH B;  3KJV B;  2V8P A;  3KXD A;  2QL9 B;  3ITH A;  1LWX A;  2HK3 A;  2LA4 A;  2H9Z A;  2ZHO A;  3NOC A;  1WUU A;  4OLO A;  2KT2 A;  1IBL J;  4JV1 A;  3G6E S;  1Y5I B;  2WRM A;  2RE1 A;  4WP8 A;  2X7I A;  2QRR A;  3J7A 1;  2BZ2 A;  3UDL A;  1CJU A;  3TUJ C;  5E33 A;  4BC9 A;  2XLJ A;  1RTD B;  3T1Y F;  2CQ2 A;  3B54 A;  1ZS6 A;  2QYC A;  1F2H A;  4NEY A;  3W65 A;  5CD4 H;  1N88 A;  4M1K A;  3LWL A;  1SXL A;  4C0O C;  4HH1 A;  2XGP A;  3K89 A;  3IAM 9;  4IDK B;  2YH1 A;  4AYB D;  3HZE A;  2HWT A;  3HM9 A;  3P8B B;  1VHF A;  4H4K C;  4KR0 B;  1C1C A;  2CNN B;  4RU9 A;  1RAC B;  3B8H A;  2V69 A;  1NSK L;  2QMU B;  3M6V A;  3C15 A;  4DHV A;  1P1L A;  4XDD A;  4ZLN A;  3M9M B;  3RB0 A;  2CPY A;  2Q1L A;  4U6P A;  3PY8 A;  4NAS A;  4FF2 A;  3DU6 A;  3THV A;  1DBD A;  1OPI A;  2F9D A;  2LU1 A;  1LFW A;  1KVK A;  3KNG A;  2JLF A;  2VG7 A;  3CJ2 A;  3VV2 B;  1RE1 B;  4N5S A;  1ZYQ A;  2V5H G;  2VG5 B;  1SH0 A;  3LAK A;  2BJ3 A;  2F1F A;  3POT B;  4IFV B;  4PPZ A;  1V6H A;  2RSQ A;  2HWH A;  4Y2K A;  4TLR A;  1KP6 A;  1F9E B;  1IJF B;  2CQ1 A;  3SV3 A;  5CCM A;  4FXW A;  4WTO B;  1BGX T;  1YWX A;  2KI2 A;  3DOM A;  2UVV A;  1CQN A;  3U02 A;  1GX6 A;  3NS7 B;  3JAM Y;  4QPX A;  3IR6 B;  4RUB A;  5HMZ A;  2BAC A;  2VA2 A;  2R7T A;  2XGQ A;  1U8W A;  3IGN A;  5ETN A;  3ZTO A;  3MOZ A;  2AJQ A;  1Q95 G;  4F02 A;  2N3L A;  3D3B J;  4WBF A;  5BXI A;  2VH7 A;  2F5G A;  1RAA B;  2FDN A;  1VC0 A;  2YKN B;  4A8Y A;  1NRK A;  3UD4 P;  3HI9 A;  4DL6 A;  1UFL A;  2BW7 A;  1HI1 A;  2QTW A;  4BCA A;  2GO8 A;  2OP5 A;  4BLG A;  4U7C A;  1MN9 A;  4S0M A;  4YB5 A;  1K8A T;  2CPJ A;  2EBE A;  3HFZ B;  4NPO A;  2Z0G A;  5KFT A;  2EG2 A;  2ROG A;  4OI3 A;  1OSC A;  2HVE A;  1Q78 A;  3CDE A;  4L73 A;  4NLD A;  2B51 A;  3OXF A;  4YB6 A;  5HVF A;  5K5M A;  4DBQ A;  2YPY A;  4LT6 A;  5BYQ A;  3T5H A;  1XMQ J;  5HLF A;  2FHO B;  3GG0 A;  2DGT A;  2ACM A;  1HWU A;  5GAE U;  3PNI A;  2RU3 A;  4ZIT A;  1FKO B;  3DOL B;  4WPA A;  5AXL A;  3BQ1 A;  4C9D A;  1J2V A;  4ECU A;  4UW2 A;  4QBU A;  3OL8 A;  2WSF C;  4FF4 A;  2VFU A;  2R4F A;  1U1M A;  2V6A A;  4I69 A;  3MM6 A;  5K9F A;  1U48 A;  5D0H A;  2F65 A;  5HQ8 A;  1C0U B;  1BQM B;  4ENO A;  4ZLJ A;  4DS4 A;  2AD9 A;  1RT4 A;  2DR5 A;  3I0S A;  3JSM B;  2XCP A;  2F3J A;  3C15 B;  3FQK A;  4RO0 A;  2QA2 A;  4G65 A;  2UXC F;  3B4M A;  4RZR A;  4KQZ A;  4E98 A;  3GMG A;  1RU2 A;  1U2R A;  5A76 A;  5KFD A;  1UVM A;  5D15 A;  4F67 A;  3QO9 A;  4DX5 A;  5KFH A;  5KG7 A;  2RAQ A;  1GH8 A;  2KN4 A;  2FJX A;  2WTF A;  5FDL A;  1VQO S;  3VCD A;  4W92 B;  1W7W A;  3C6T B;  5B0F A;  1FK9 A;  3BQ0 A;  1FRM A;  2H5I B;  3RW6 A;  5AXK A;  5A0Y B;  1FJ7 A;  5B7W A;  2LXF A;  2L9W A;  3W5Y A;  3BGO P;  1ZPW X;  1NUE A;  3G2X A;  3DRR A;  3HVR A;  5JJB A;  2CNO B;  5KFV A;  3PR4 A;  4IUF A;  3K5L A;  2NZC A;  2R9L A;  4IG0 A;  3JTP A;  3BDE A;  4Y28 C;  2R7S A;  1FF2 A;  2M5Y A;  5HK4 A;  2AEJ A;  3OD2 A;  4HTI A;  4YB1 P;  1UKU A;  3W8P A;  1CJK A;  4PG5 A;  1FKA F;  3MCS A;  2L3M A;  3SDE B;  3MR5 A;  3H40 A;  3T19 A;  3NBP A;  2FLN A;  1DRZ A;  1NK8 A;  2Z2L A;  3LW5 C;  3OL7 A;  2O67 A;  3HHL B;  3VAL A;  2HLU A;  3IP0 A;  4XIU A;  2HNZ A;  3CIZ A;  3FZ2 A;  4DV0 J;  4O0N A;  3G71 S;  4M5D B;  4KO0 B;  3KDO A;  5E3C A;  1VLO A;  3RG6 A;  3TVY A;  1WG1 A;  2UUC F;  4LFC F;  2V4J A;  4DR4 F;  4AND A;  2COL A;  3Q8U A;  4ZJO A;  2W9C A;  3KJF B;  1ZM4 A;  4C0B A;  2W9C B;  2C3U A;  2DB1 A;  4WKY A;  3ZO7 A;  2BJE A;  2C1E B;  2ZWP A;  3FBC A;  1DLO B;  1DQ9 A;  1WSV A;  2YKM B;  3CCE S;  4GC6 A;  2HWI A;  1AB8 A;  4CT9 A;  1U1K A;  2FY8 A;  3KHG A;  4YHH F;  2RHQ B;  1WJ9 A;  2VD3 A;  2XZW A;  3ICL A;  3WC0 A;  1EX8 A;  3QT7 A;  2JZ5 A;  3R7S B;  5JMN A;  2EFV A;  1JXL A;  2QLX A;  4DCO B;  2M8H A;  5F3Z A;  2VPZ B;  5EHH A;  2QE5 A;  2WSE C;  3DRS B;  4K4T A;  3S8S A;  1MNE A;  3K59 A;  3KOA A;  3M8Y A;  1SJR A;  4WK3 A;  1HW8 A;  4OYM A;  2OUG A;  4ECR A;  4ZVP B;  4Y0F A;  4F0K A;  4KY3 A;  2W7O A;  3RYL A;  4X66 J;  2OEM A;  4ED1 A;  2E1A A;  1RHQ B;  2PDA A;  3CE8 A;  3DOK A;  5A8R B;  5E41 A;  2QN6 B;  5KFB A;  1Z1Z A;  2A0F B;  4FKY A;  3K5O A;  4USK A;  3US5 A;  2BQ3 A;  2JRS A;  3MM7 B;  3LP0 A;  4QIW D;  3GFX A;  1VRU B;  4ZPA A;  1HQ2 A;  3KLE B;  1JKH A;  5DET A;  3GII A;  4DR1 J;  2HHX A;  3R1L A;  2P9E A;  2HBQ B;  5LMU J;  3B78 A;  5KFL A;  5JVH Q;  1VQ5 S;  3BKU A;  2KT3 A;  1XMQ F;  5AE1 A;  2DHX A;  4K4U A;  3QNW B;  1Q16 B;  5KFA A;  2WON B;  3TA0 A;  5K14 B;  4WYL A;  1KEK A;  2AJ1 A;  3RUB L;  4DL2 A;  4A47 A;  2GJI A;  1X4F A;  3D0H E;  3IA0 A;  2VJU A;  3VAI A;  1U1Q A;  4IKA A;  4CH7 A;  3PX0 A;  3E01 B;  3DLL Q;  2ZH8 A;  1ZM3 A;  2ZFH A;  4LSN A;  1RWW B;  5CZX A;  4DV2 J;  1NM2 A;  4CO0 A;  3L9Z A;  3MM6 B;  5F0W A;  3IRW P;  1TMJ A;  4J37 A;  1U0H A;  4RW8 A;  4J9O A;  4ED7 A;  4NLG A;  1FE4 A;  4PWW A;  5IC6 B;  1SB6 A;  4QOT A;  2IJR A;  1SIW B;  4ICL B;  4W98 A;  1ZAX A;  1RP5 A;  2IAJ A;  2Z58 B;  3BQ2 A;  1RKI A;  4F04 B;  2HHH F;  2DRA A;  2IA6 A;  4CNY A;  5L9N A;  2PT0 A;  2V8V A;  4WJB A;  3M6W A;  2LXI A;  5KFS A;  3T1H J;  3RBD A;  4KAI A;  2CQ3 A;  1D9D A;  1F3F A;  3M05 A;  4I6W A;  1NK6 A;  5LXR A;  4FBU A;  1KS2 A;  1I5O B;  1U6F A;  4WXO A;  1MLA A;  3DLH A;  1GMW D;  4AXI A;  2EXU A;  3TVK A;  2J0X A;  1TL5 A;  3SCK E;  1EKR A;  2M4M A;  1RHJ B;  2QFI A;  3LWM A;  2ASJ A;  2OFH X;  3D66 A;  4QWD A;  1PYT A;  2UUA F;  1UEV A;  3PRD A;  1BY9 A;  1RAF B;  2NSC A;  1HWJ A;  4F0H A;  4D3G A;  3R2C J;  1FRH A;  5BJR A;  2A6O A;  2JEF A;  2HHS A;  4NI2 B;  3AB4 B;  4PXB A;  2BDP A;  4CO2 A;  1RT4 B;  3GCX P;  1BLU A;  4DS5 A;  4DV7 J;  1BE4 A;  3CCM S;  2C3M A;  3ETM A;  2WVD A;  3OFF A;  4USW A;  3IBC B;  2IVF B;  2FVQ A;  3SCL E;  2X1F A;  4G1I A;  1X60 A;  2MQP A;  3OTB A;  2DRB A;  2VOP A;  3DGP B;  3RGI A;  3CCQ S;  4DJB A;  5L1K A;  2HRY A;  1U45 A;  1BQN B;  2XNR A;  2HZV A;  5CYQ B;  3RB4 A;  3QT6 A;  2XYG B;  1I3O B;  1PYO B;  5ADZ A;  1G4C A;  2YTC A;  3TAM A;  2KTQ A;  3BBF A;  1FRI A;  4J9P A;  2DT9 A;  2B8P A;  3Q2T C;  2GCF A;  2F4F A;  4Q8E A;  2R7V A;  2VG7 B;  3LTO A;  4NZ7 A;  2HIQ A;  3NNH A;  4GVB B;  1KRP A;  2GZO A;  4ECY A;  3W3S A;  4J9S A;  3CDW A;  3D1Q A;  2DJW A;  2ZH3 A;  2FY1 A;  1XIQ A;  3H8Y A;  3DYA A;  1QDU B;  1RBL A;  4QWB A;  2UUC J;  5LOQ A;  1I51 B;  3HHD A;  5AT1 B;  2HQC A;  2AJ4 A;  4LRD A;  3GSD A;  5KG0 A;  2GIQ A;  2KXF A;  1L3K A;  3P96 A;  1N52 B;  2G0C A;  4ICL A;  2QMW A;  1SQF A;  2GNK A;  2ZOG A;  3QBC A;  4H4O A;  5U47 A;  2POK A;  3EUN A;  4KE5 A;  4M5K A;  4HYK A;  4WE1 A;  1ITP A;  3G8Q A;  7FDR A;  1CSJ A;  2VOD A;  1C1B A;  5B0B A;  4TQR A;  1KD1 T;  4NMX A;  1CS4 A;  3N6N A;  2O3D A;  4ANC A;  5D0E A;  1FX2 A;  1FWP A;  3EXC X;  3FC9 A;  3PTW A;  1PBA A;  2MQ8 A;  3DLK B;  3ITH B;  1RDR A;  3LGN A;  3Q86 A;  3R27 A;  1HHQ A;  1OSD A;  3MAA A;  4A8Q A;  1YI2 S;  4N77 A;  4WP9 A;  3ZNU A;  3VAJ A;  3DI6 B;  4LF6 J;  4K4Y A;  4M5J A;  3EVO A;  3D3C J;  1K1Q A;  4EYH B;  2B43 A;  1FJC A;  5GMK a;  1C2P A;  1WOO A;  2K7J A;  3POT A;  4CLT A;  2FUG 9;  2ZJR Q;  2HQD A;  2VPW B;  5J2N A;  2BE7 D;  4BBY A;  1CJT A;  1PJ7 A;  2AYE A;  1EP4 B;  1WF0 A;  4WFY A;  2IDE A;  3HHL C;  1SKW A;  5HI7 A;  5KT6 A;  2V34 A;  3CCT A;  2B9W A;  3N5B A;  4QWE A;  2CNL B;  1X4B A;  1LWC B;  2HBZ B;  3R5B A;  2KG0 A;  3N0V A;  1HI0 P;  1YJ7 A;  3HSG A;  4ZVT B;  1U0S A;  2G0I A;  4JBC A;  4LFC J;  1NZA A;  2YX7 A;  4IDK A;  3C3L A;  2MKK A;  2MY8 A;  4B3M J;  4WU3 A;  1R6Y A;  2W25 A;  2QSW A;  4DSJ A;  2XNQ A;  4C8Z A;  1S76 D;  1WG4 A;  4FS2 A;  3VGT A;  3K58 A;  1FVS A;  1U1R A;  1Q4R A;  4IH7 A;  2Q6C A;  3TR5 A;  4EYI B;  1HI8 A;  3I31 A;  1PIL A;  2XYP B;  2GQ2 A;  2R3V A;  5CYJ A;  3DLB A;  4QIV A;  5C2G A;  5KT2 A;  1VYA A;  3WZ0 A;  3C2P A;  4ER8 A;  1N5Y A;  3NMR A;  3TAQ A;  4F50 A;  3W5X A;  1J5E J;  4PAA A;  4CT8 A;  5I3U B;  2UU9 F;  4P73 A;  2HBY B;  3M8Q B;  2YY3 A;  4NLR A;  3WQP A;  4KC5 A;  4RBV A;  5DDR C;  1E6Y A;  3P49 B;  2OSR A;  2ZH4 A;  4H4O B;  3TNV A;  1ZAW A;  3FVY A;  1FA0 A;  4NRT A;  1FVQ A;  4ZHR A;  1HNX F;  4Q0B B;  3U1L A;  3TAP A;  3VQT A;  3K5N A;  1SJQ A;  1M5P C;  3F0N A;  1B7F A;  3IC1 A;  4NYZ A;  3QRQ A;  3G9C A;  5SUH A;  4HAC B;  1EAR A;  2CFX A;  5KFY A;  2AEM A;  3OTE A;  5C25 A;  3L7O A;  3Q8P B;  5F8J A;  2YNI A;  1U2C A;  4C8L A;  3MUR P;  5HQM A;  2RF2 B;  2ABY A;  5CD4 A;  2YNH A;  4JI3 J;  1C0T B;  4TU9 A;  4GVB A;  2R2T A;  2BQU A;  2BOA A;  4JV5 F;  2VOO A;  2XMV A;  4DR7 F;  4X4U A;  3M2V A;  1UZH A;  3PFO A;  2XSF A;  2LQ9 A;  4OHV A;  2X3D A;  2IRU A;  2IYG A;  4W4M A;  4KIA A;  1KNZ A;  1M5O C;  5KFE A;  4DSK A;  3ISZ A;  4UZC A;  4DR2 J;  1VQ6 S;  3EM1 A;  4DF4 A;  4DFM A;  1JLF B;  3JSR A;  2DXD A;  3ULH A;  1NB7 A;  1S1X B;  2DH8 A;  4ZS6 A;  2RKI B;  2JEJ A;  4X4V A;  1IVZ A;  1LKZ A;  5DQG A;  4IG3 A;  1HIY A;  1RYS A;  1FT8 A;  1NEE A;  2YXL A;  2HQG A;  3I5B A;  3M32 B;  1R8H A;  4AUK A;  5H9E J;  5AXN A;  4OJ3 A;  3DHX A;  3HD1 A;  1JLA A;  2ZDP A;  2H5E A;  3CGI A;  2V8G A;  3I0S B;  2JVO A;  4JB8 B;  1QJH A;  4OJG A;  3TX8 A;  4NXN J;  2RVJ A;  4FYX B;  1XNR J;  1SUQ B;  1C0U A;  2DNY A;  2HS0 A;  3BKF A;  4C97 A;  2NXN A;  1I94 J;  2VFR A;  2CG8 A;  1PCA A;  2H4W B;  2ROE A;  2E7X A;  3CJS A;  2UV8 A;  3TP2 A;  2W8L A;  2FZC B;  2J7K A;  3NAI A;  4M63 A;  2UXD J;  1TKD A;  4RNN A;  4O3Q A;  2JLG A;  3GB0 A;  4ZVU B;  3CUL A;  2YNG B;  4DV1 J;  2C2Z B;  3TO8 A;  5KOW A;  4F2R A;  4JI5 J;  3Q2S C;  3ONQ A;  3QWU A;  1HQE A;  1UJ5 A;  1VDH A;  4GO5 X;  4ITS A;  1UP1 A;  4M5G A;  3X3U A;  2AZ1 A;  2D3O 1;  3GTY X;  1PC5 A;  1YLX A;  2C3P A;  2I8E A;  2LMI A;  3CC7 S;  1F5A A;  5C5J A;  5J2M B;  1X5O A;  2P9C A;  4OZN A;  4LF6 F;  4G1Q A;  3Q24 A;  1VIO A;  3MEG B;  3BSO A;  3PX6 A;  1GXU A;  2DYA A;  2DRD A;  2G2Z A;  4ECX A;  2CQC A;  3LO3 A;  2OMO A;  3AHP A;  1LWE B;  3NGT A;  3MUV P;  3MEG A;  3OPK A;  1U1P A;  2JJ4 D;  1QY7 A;  2QL7 B;  1SIZ A;  4EO6 A;  4RW9 A;  2MQL A;  3MEC B;  5IM0 B;  3J7Y I;  2NR0 A;  3PG9 A;  3BB5 A;  1F1B B;  2QLW A;  4DL4 A;  3GV8 B;  2HS4 A;  2HRT A;  2NYH A;  3AAW B;  1FWK A;  2AX1 A;  3GJR B;  3A8I A;  2UV8 G;  3FKB A;  4FKX A;  1YRX A;  2BE9 B;  1F9H A;  1XR5 A;  1YJT A;  4O3P A;  1S1V B;  3QZ7 A;  9ATC B;  3PJW A;  3MR7 A;  4JYA J;  5HVH A;  5DS7 A;  2HIY A;  1S6U A;  4ZVH A;  2MZ1 A;  4CLL A;  1TK8 A;  1WDT A;  2RJZ A;  5GAD U;  2HQ3 A;  4MKV A;  2FVP A;  4DV4 F;  2AP6 A;  4LSN B;  2OPR A;  2ZOF A;  3GLJ A;  4RNH A;  4K4X A;  2DK2 A;  4PYA A;  1HNV A;  2VF3 A;  4CO5 A;  2BRK A;  2Y0S D;  3IM9 A;  1RHU B;  2KRB A;  4L3N A;  2JDJ A;  3M2U B;  3AJD A;  1P9Y A;  1H7W A;  2JOQ A;  2LU2 A;  1KVI A;  3FSY A;  2J9E A;  2W2P P;  2DY1 A;  4C8M A;  3JYT A;  1R0A B;  1NK7 A;  1NDC A;  3PAC A;  2HHV A;  4I2Q B;  4LF4 F;  4RR5 A;  5AE3 A;  4LF8 J;  2VON A;  3P4U B;  3SSQ A;  4DR3 J;  2IBO A;  4OV1 A;  2QA4 S;  1MMD A;  1ULR A;  2BW2 A;  3CW2 C;  3O6Q A;  5DJB A;  4C3L A;  4CRJ A;  3NCP A;  2CNK B;  3HHN B;  4ZJQ A;  4B3T F;  4MIA A;  1S0V A;  3BGR B;  2FTR A;  1Q5V A;  2CG4 A;  4NRU A;  1UCN A;  2XMT A;  3L7P A;  1NKE A;  1U47 A;  1T7P A;  4M5D A;  5GAH U;  4UQG A;  1UZD A;  2B4O A;  4MYT A;  1M90 T;  2HGM A;  1Y3K A;  2DHS A;  3TOQ A;  1NH8 A;  4H4M A;  3KLF B;  3HP6 A;  3KK3 B;  2C42 A;  4KGK A;  3WIU A;  2ZJQ Q;  2GS8 A;  4J9U E;  2QLF B;  4E2F B;  4DR7 J;  1LWF B;  4RBT A;  1EJ7 L;  3VGU A;  1ZZN A;  1RAH B;  2ZE2 A;  4OYP A;  3CCU S;  3O44 A;  3UN3 A;  1FNO A;  5HMX A;  1RU1 A;  3MM9 A;  4B9U A;  4NLY A;  4B9N A;  2OTJ S;  3PYF A;  4PCQ A;  1WI6 A;  3CDB A;  1RK8 A;  4ZHR B;  3CWJ A;  4DUY J;  1ZTW A;  5F8L A;  1HA1 A;  3C6U A;  1RT1 B;  1UWB B;  1YRT A;  1T8E A;  2CIM A;  3ILL A;  2VG6 A;  3CJT A;  3IFE A;  3AY0 A;  3FCH A;  3P3D A;  2FYX A;  4C3K A;  1HNW F;  1F6T A;  5J2P B;  3AOC A;  3BGR A;  4YR3 A;  2ALY B;  2BYC A;  2OPP A;  2HHP A;  1WI8 A;  3LH2 S;  5T41 A;  3MZI A;  1SL0 A;  3KHR A;  2GJ2 A;  3DCA A;  1Z4U A;  2D74 B;  3C6T A;  4NEZ A;  4CQ1 A;  6FD1 A;  4NLQ A;  2M7S A;  4DV6 F;  3UR3 C;  5SZT A;  3LP1 B;  3M8R A;  5E2Q A;  5EX0 A;  4ZCM A;  2CWK A;  5ETR A;  3DFE A;  2FC9 A;  1APS A;  2LCW A;  2HFZ A;  2EFP A;  4KB7 A;  3UFC X;  4EMD A;  3NRB A;  2ZH7 A;  5IXU A;  4QCL A;  2HHU A;  4CLP A;  2NRE A;  1P1T A;  1XBW A;  3LP2 B;  4DUZ J;  3T5L A;  2FHJ A;  3IBF B;  4FPR A;  1DUR A;  4OZJ A;  1X9W A;  2MJN A;  4LMZ A;  5I4M A;  1AFI A;  3B4D A;  1KHV A;  5A8K A;  2J6T A;  3MEK A;  2K8G A;  3P5T L;  2IRX A;  5CH7 B;  2R7U A;  2GMJ A;  5KG2 A;  2C2D A;  3IGV A;  1FJG F;  4DQP A;  3O8W A;  2ILY A;  4LF9 J;  2EC0 A;  2C2K B;  1PJ5 A;  2DIV A;  4FN5 A;  4PG7 A;  3D6M B;  4C8N A;  2PII A;  2RH3 A;  4PUO A;  3RR8 A;  2ZWO A;  1FDB A;  2H54 B;  3GG1 A;  1S12 A;  2OML A;  1YJU A;  2QX0 A;  2V9K A;  3OR2 B;  5KFC A;  1HYS B;  4C8O A;  3QT5 A;  4F4Z A;  2HFU A;  4K5S A;  1RAG B;  4ZVE A;  4U9R A;  3G6X A;  4OZ2 A;  4ILL A;  2QMX A;  5KG4 A;  4P2X A;  4F36 A;  1UFW A;  2L41 A;  3HFV A;  4OYW A;  2H65 B;  2NYI A;  2ZDO A;  3OVB A;  3OR1 B;  2C3O A;  1M5S A;  2IJN A;  4FYW B;  2CPD A;  3GIJ A;  4Z37 A;  5DGB A;  1UW4 A;  1NB2 A;  2DGS A;  4GRS A;  4JI2 F;  1JJ2 R;  5E7O B;  2IVM A;  1Y11 A;  2LDY A;  5L1L A;  3ZC4 A;  3PW2 A;  3VAK A;  3BSC A;  1X4A A;  2R2U A;  4TQS A;  1IBL F;  4RW6 B;  2I6W A;  4G1Q B;  3NCQ A;  2B7B B;  2XZD B;  1U1N A;  1T9T A;  4LFA J;  1S72 S;  2UVU A;  2J6S A;  4QR2 A;  2OLW A;  3C46 A;  3CCL S;  2ZBQ A;  4CCH A;  1U02 A;  2B5J A;  2BVZ A;  3WX8 A;  2MLZ A;  4PRF A;  3GFH A;  4JI1 J;  4HL9 A;  4GMK A;  4ZIV A;  1JWW A;  4H54 A;  4TYB A;  3M9O B;  1WSR A;  3VZI A;  3PW4 A;  4LF5 F;  1N32 J;  3SXL A;  1K44 A;  4OV6 A;  1VRT A;  5EWG A;  3MMB A;  3CVK A;  2F7V A;  4P75 A;  4HEA 9;  4ANE A;  1REG X;  2FJA B;  4B3M F;  3K0J A;  3OV7 A;  5E5N A;  4ZCL A;  4C3M A;  3MR6 A;  1WNE A;  2NUH A;  4IFV A;  4UZB A;  1FXL A;  2KFY A;  3HVW A;  4UUW A;  3D0G E;  5DQI A;  4IOA Q;  3VAF A;  4ERD A;  1S6P B;  2DNM A;  1TV6 A;  3J7Z 5;  3EGZ A;  2ZHB A;  5C7P A;  3AOA A;  2FPH X;  3QFW A;  4LRA A;  5B0E A;  2DTJ A;  4B3T J;  4UT4 A;  1S6O A;  2R7W A;  1Y7P A;  2EFQ A;  2Y1R I;  3OBI A;  2IM1 A;  1S1X A;  4O3S A;  3A3N B;  4PG6 A;  2V2V A;  1CEZ A;  1WWH A;  2QEX S;  1RWU A;  4PR6 A;  3KKF A;  2R7X A;  4IO1 A;  3EXY A;  4UST A;  3R7B B;  5CHC B;  1HNZ J;  3GIR A;  1HNX J;  5DDP C;  1WD6 A;  1ARO P;  4EBD A;  1M1G A;  3BH6 B;  4DFJ A;  2AYB A;  4EK2 A;  2MYF A;  2RT3 A;  2W2M P;  3FCW A;  1QTN B;  1JLG A;  2IM2 A;  3FBF A;  1YX2 A;  2D7S A;  3HMJ G;  2VBW A;  2FIU A;  1XQI A;  4MK9 A;  3IMQ J;  5ITH A;  2CWX A;  5GMD A;  2Y1J A;  2MZJ A;  2ASL A;  1VQM S;  3JSY A;  1F5C A;  5D3G B;  1JX4 A;  3R7N B;  2R7R A;  2P9G A;  2ASY A;  2MKC A;  3RZA A;  3N28 A;  3MM5 A;  4ECZ A;  1X9S A;  1NK0 A;  3CCZ A;  2P6S A;  1VJQ A;  3HT0 A;  5IT9 Y;  4ID5 A;  2VQE F;  3OXG A;  2M70 A;  4ZMM A;  4P72 A;  4HHJ A;  2ADC A;  1TL7 A;  3ETO A;  3IRX A;  2PI4 A;  3EDR B;  4MT1 A;  4LQ9 A;  5HP1 B;  1NPP A;  2AWZ A;  3EE3 A;  4N41 A;  2AYG A;  2G1D A;  1E6Y B;  2H1Y A;  2HFO A;  3D9B A;  2ATC B;  2JLE A;  4ZP9 A;  3Q8S B;  5DGA A;  4LBP A;  1VBY A;  1T11 A;  2PEB A;  3ZTS A;  2JFK A;  4EUV A;  1IKY A;  4NLW A;  1QSL A;  1JMT A;  2LQ8 A;  2YWW A;  3R97 A;  1X4G A;  2WW4 A;  1E6V A;  2DHA A;  2UXC J;  1SJ3 P;  3BO3 A;  3F44 A;  4W90 B;  1XTZ A;  3OTO F;  3HX9 A;  4I64 A;  3VAG A;  3QFH A;  1X31 C;  3MR3 A;  2YWE A;  2BEF A;  1I6J A;  2YKO A;  4A8F A;  5DO2 A;  3SCI E;  1RA6 A;  2C2R A;  4ELV A;  1RGV A;  4A4J A;  4JI7 F;  2O01 C;  3RRK A;  2XMU A;  2B6A B;  1JKH B;  4ALZ A;  3MCM A;  4C98 A;  1D8Y A;  4NCG B;  3I87 A;  1VRU A;  2MGZ A;  1QVG R;  1YBT A;  2GJF A;  2XUL A;  4DUY F;  2CPE A;  1LW0 A;  4AE5 A;  4F7V A;  1VQY A;  2W9B A;  5FJ4 A;  2W9B B;  3DNC A;  2E9R X;  4JI3 F;  4B3R J;  3BN7 A;  1TTH B;  1YBA A;  2QT7 A;  1S6Q B;  3DLG A;  4USI A;  4CWB A;  5J1E B;  2CQI A;  1V3Z A;  2CJ9 A;  2GIR A;  3FEX B;  4P7V A;  4DCP B;  2V94 A;  1B7Y B;  4A8S A;  2VBX A;  1SKU B;  2W9A A;  1CG2 A;  3DRX A;  2IRY A;  4Y2I A;  5H9E K;  2HHQ A;  4N7T A;  5CAA A;  4MFB A;  4HH0 A;  3BF4 A;  3MMC A;  2DHH A;  2WAQ D;  3I5A A;  4PQA A;  4TVA B;  5ETK A;  2V0N A;  3A4T A;  5T7L A;  3TUI C;  3TAN A;  1IWG A;  2VDI A;  1L3T A;  3MAA B;  1MN7 A;  1VRQ C;  4BC7 A;  3JS9 A;  1NLK L;  5KT3 A;  3E3X A;  2R2R A;  4DDF A;  4FVM A;  1KKH A;  1Y3J A;  2DNN A;  3SQO P;  4Q2L A;  1RYR A;  2DPI A;  2YQ3 A;  5DLG A;  4ZVQ B;  2OEJ A;  5J2Q B;  4KH1 B;  2K3K A;  2V4J B;  4CH0 S;  1HKA A;  1HR0 F;  3O2I A;  1UTA A;  5A6W A;  3SBM A;  4L74 A;  4Y00 A;  5HP1 A;  2CXE A;  1H73 A;  3Q8Q B;  4DSI A;  2DCL A;  3H98 A;  1H2V Z;  4KHR A;  3NEK A;  2EFO A;  2XWX A;  3SI8 A;  4PQU A;  4PWD A;  2J7U A;  3MM9 B;  4X4N A;  1Q1K A;  3KLV A;  1HHT P;  5ETS A;  1IQT A;  3K5P A;  2R8G A;  4B02 A;  4KHP J;  4LIR A;  3ISN C;  2RUG A;  3O3L A;  1QAX A;  1GEH A;  4IG0 B;  2Y1I A;  1HW9 A;  4QR1 A;  2DNG A;  3M2R A;  2DH7 A;  1HNV B;  2GHP A;  4MAK A;  2GGP A;  2Q43 A;  1GK8 A;  3ZZO A;  4UOG A;  1TAU A;  3MED B;  4CLW A;  5B0G A;  2L08 A;  1RI7 A;  1U09 A;  2I38 A;  1QE1 B;  4QYR A;  4NE9 C;  3CD0 A;  2E44 A;  1OMS A;  3LA0 A;  3V5R A;  5C2C A;  3PX4 A;  2GQC A;  4B9T A;  3QZ8 A;  4AL5 A;  2I0X A;  4JI0 J;  1U8S A;  3LQV A;  4MK7 A;  1QVF R;  3V4M A;  3EVM A;  4P52 A;  5JUM A;  4WFN Q;  4ES2 A;  2WB4 A;  3AD8 C;  2DVI A;  3FEY B;  4FYY B;  4USU A;  1RHM B;  3D67 A;  1FTC A;  1D1U A;  5LM7 E;  1YZ7 A;  3DLE A;  1BXN A;  2W4C A;  3CPW R;  4ED0 A;  2V2Q A;  1SI9 A;  3DDI A;  1VC5 A;  2OD4 A;  2B8Q A;  5ETT A;  2PD1 A;  4DLG A;  2GAG C;  2CAJ A;  2RRN A;  3OW2 R;  3AOD A;  2C22 A;  3MXH P;  5H9F J;  2YKQ A;  4HHH A;  3BBC A;  1WF1 A;  3M4X A;  1S1U B;  2K7K A;  3A8J A;  3R5C A;  5KFM A;  2X3G A;  1T9W A;  3QLH B;  4YY3 J;  2DGX A;  4ED2 A;  2AGO A;  1Q82 T;  2AX0 A;  3PRB A;  1S1T A;  3NL0 A;  1DTQ A;  2MHE A;  2D3Z A;  5F41 A;  2MKI A;  3UCZ P;  2AGQ A;  4C8Y A;  4OHY A;  3S6E A;  2HHT A;  1WC1 A;  3UDV A;  1F2G A;  3DMJ A;  1H2T Z;  2Y3Y A;  1IWA A;  4AD6 A;  2DNZ A;  2EC2 A;  3W63 A;  1CUL B;  2HHH J;  3CXC R;  1L5U A;  1YG0 A;  2U2F A;  2DGU A;  3CJ3 A;  4C48 A;  2AU0 A;  4LFB F;  1H74 A;  4OQJ A;  5A6P A;  2HVZ A;  2KU7 A;  3I55 S;  2KJV A;  4Y2M A;  4HKQ A;  4KBI A;  1JLB B;  2ZNY A;  1JLB A;  4NX9 A;  2RDJ A;  1NXI A;  3CD5 A;  1G1X A;  7AT1 B;  4NLT A;  2HUR A;  1BQX A;  2AIR B;  2LXU A;  1TR0 A;  2WW8 A;  4LR7 A;  4OHX A;  1B4S A;  4CLF A;  4ES3 A;  4F4A A;  2DGO A;  2AJ2 A;  1JLC B;  2FVR A;  1RUS A;  2H51 B;  2ZM6 F;  3J7A N;  2XSJ B;  1G6B A;  3CJ5 A;  1SQG A;  4PQU B;  1WOP A;  2CKW A;  1RBA A;  3E01 A;  3GZ7 A;  2IC3 A;  2FJB B;  1WEL A;  2I1R A;  3DDK A;  3TAR A;  2A6M A;  2XY5 A;  1JXE A;  4HR2 A;  4DR4 J;  2GAH C;  4ZPC A;  2BKO A;  1GTE A;  5KFI A;  4DR1 F;  1TFW A;  1RT7 B;  2P8I A;  1U6Z A;  2M9K A;  2DIS A;  5LJ3 Y;  1RQ0 A;  3QID A;  1SJ4 P;  3IBW A;  4AFF A;  2OH2 A;  4ED8 A;  4QYZ J;  4UTG A;  3LPY A;  4IOC Q;  4J9M A;  1KR4 A;  1Y10 A;  2RKI A;  4USV A;  3GJQ B;  4UOH A;  1WHV A;  4OI1 A;  3TEG A;  5KFW A;  1IKW B;  5LJ5 Y;  1XNR F;  2FHJ D;  5BYS A;  5K8P A;  2BQR A;  2JEG A;  1T0T V;  4BS2 A;  2NPI A;  1D9F A;  4DPX A;  1SPB P;  4EFA C;  2GX8 A;  1TL1 A;  1KQK A;  3KHL A;  1KOO A;  4OI0 A;  3UWT A;  3D1H A;  4CO4 A;  3QAE A;  4OI2 A;  2JFD A;  2MQN A;  3LAL A;  3TRG A;  1CLF A;  2G2Y A;  2BAN A;  2VG5 A;  2ZBC A;  3EWG A;  4YR2 A;  4A8K A;  3EIC A;  3G8T A;  3CME S;  3ZZR A;  1A0O B;  1VK3 A;  4A8X A;  3K7R A;  1S6Q A;  5HBM B;  1AT1 B;  3BSA A;  1FWL A;  2EI5 A;  4JI5 F;  3LGH A;  1FDN A;  4OI6 A;  5MAO A;  3M32 A;  3ZNJ 1;  1UVL A;  2V4R A;  4K4Z A;  4IG3 B;  1M1H A;  4HDG A;  1ELO A;  2W01 A;  1SCJ B;  1T3N A;  1UWA A;  5F8H A;  2CPH A;  4AXJ A;  3SZ2 A;  4RW7 B;  1RBO B;  2G2O A;  1IKV A;  4I2P A;  1LW2 B;  4K5R A;  4OIX A;  2UUA J;  2AKW B;  2V8D A;  4I67 A;  4FP9 A;  4KO0 A;  4DU7 A;  3GU0 A;  4ED3 A;  3AFG A;  1NHU A;  1T9Y A;  1FFG B;  4DFP A;  2ZKT A;  1RB0 A;  3IWX A;  3KLH A;  5IT9 U;  3EZ5 A;  2ZH1 A;  2DXE A;  4MKB A;  4DN0 A;  3UCU P;  1LXJ A;  3QIP B;  3T1A A;  1GAO A;  3VWS A;  2V4Q A;  2OPQ B;  3NKY A;  1QLN A;  2YWH A;  2V9W A;  2HMI A;  3GON A;  1QAJ A;  3KMQ A;  4TYA A;  4ZLP A;  5IS2 A;  4RUC A;  3T1Y J;  1X0F A;  5HJX A;  1S4F A;  4ZP6 A;  3RW7 A;  1YJR A;  4PEO A;  4NA1 A;  3AA8 A;  3ZZT A;  3ZZ0 A;  3HPO A;  3T5K A;  4RPF A;  3W60 A;  4DSE A;  2L48 A;  1M5H A;  1RKJ A;  2A2D A;  4FYD A;  3DRP A;  4Y65 A;  1AZS A;  4NLP A;  1X5T A;  3RB3 A;  1YDL A;  3I9Z A;  5KAK A;  4IH5 A;  3CCV S;  2KO1 A;  2LLZ A;  3JSB A;  1F3V A;  2CPF A;  1MWZ A;  2HKE A;  2BE2 A;  3K5M A;  1R8P A;  3OL9 A;  1R8B A;  1YJV A;  1AYE A;  2FJD B;  4ZPT R;  2ASD A;  1WC4 A;  4OZ1 A;  2GIF A;  4QU6 A;  1L3S A;  4Z7C A;  1WG5 A;  1R31 A;  4I2Q A;  5CZV A;  4KKO A;  1RAI B;  2HZA A;  3QRP A;  2HW3 A;  1T9V A;  3MPU B;  3NOG A;  3QO9 B;  4LFA F;  3OLB A;  4L75 A;  3H59 A;  4DV5 J;  1FNX H;  3OSN A;  3L3C A;  2YWF A;  1X5S A;  1XNQ J;  1FXR A;  2RS2 A;  2DY9 A;  4P6Q A;  4OYO A;  1WTF A;  3SIP B;  3BGF A;  1S5Z A;  2KVI A;  3DLK A;  5KG1 A;  1BWE A;  5AJ3 F;  3PRV A;  5ETP A;  2UXB J;  4JI4 F;  3V4I B;  4QWA A;  1HL6 A;  3T41 A;  4CI0 B;  2ZOM A;  2K1R A;  2LYV A;  3CJK A;  1REV A;  3M9N B;  4GKJ J;  2BAN B;  4DF8 A;  2JHE A;  1AXQ A;  2WOM A;  5D3G A;  3NP5 A;  2AYM A;  2FLP A;  2DR9 A;  4RKU C;  4LF7 J;  2OHD A;  4LR9 A;  3CJQ A;  1UET A;  1HMV B;  4I6A A;  4A8O A;  3MR2 A;  2PE8 A;  1K1S A;  1NDK A;  4ZOS A;  2OEK A;  5AE2 A;  5DM7 Q;  4NLO A;  1EQM A;  3GV5 B;  2BUN A;  2DGV A;  1L3U A;  1U7L A;  3PFE A;  4TY8 B;  2PMZ D;  5IM0 A;  2N82 B;  2QFJ A;  3V6D B;  5CYM A;  1VRT B;  1HBU A;  3K8W A;  2A18 A;  2PI5 A;  1DY3 A;  4URQ U;  4DCJ B;  3WX4 A;  3MAQ A;  2HFS A;  2V63 A;  3V4I A;  1AFJ A;  1JLG B;  1RTI A;  1FXD A;  3T9N A;  4YP3 A;  2D41 A;  3PR5 B;  3PCO B;  3RAQ A;  4DWI A;  5IOL A;  1V5I B;  4IOB A;  4P2M A;  5J2M A;  3CJR A;  2HBR B;  4K0K F;  4RW6 A;  2QA4 G;  1HQU A;  2MZR A;  3X1L B;  1TUG B;  5HVG A;  4NA3 A;  4WZQ A;  3MTJ A;  4M95 A;  3UPF A;  3C16 A;  5ETQ A;  1Q7L B;  2HHW A;  4A46 A;  4DL5 A;  2CZ9 A;  1Q8B A;  2JH3 A;  3G87 A;  5LMN J;  3KTQ A;  4HT5 A;  1LFP A;  3C8Y A;  1XER A;  1MU2 B;  3JAM U;  3D6F B;  2HNY A;  4LVO P;  4MK8 A;  4TY8 A;  5KFO A;  1X4H A;  4OX9 F;  3MM8 A;  3OFE A;  3OUY A;  1UL3 A;  3FEZ A;  2J0W A;  3RAX A;  2VA3 A;  3HXM A;  5DG9 A;  1VIS A;  2DR6 A;  3OL6 A;  4PZV A;  5KFP A;  3F73 A;  2PA8 D;  4ECS A;  3PYE A;  1O51 A;  1FFW B;  2RDD A;  2FGC A;  3TAM B;  2HRU A;  4OHW A;  2UZA A;  3KLG A;  3C66 A;  2VFS A;  4NLS A;  4IRK A;  5CYQ A;  3RBZ A;  3CD7 A;  2C2N A;  2BM0 A;  4RUH A;  1ZA1 B;  2QGF B;  3NGD A;  2QLJ B;  3CT9 A;  1XMB A;  5IQ6 A;  5L1J A;  5A2Q U;  1D9A A;  4NZ6 A;  2N7C A;  4NCA A;  2HQI A;  1T05 B;  1SC1 B;  2K1R B;  2WVE A;  3A8E A;  2DIT A;  3H5U A;  3FSI A;  1N8R T;  4CTA B;  4QU7 A;  5A8K B;  2AGP A;  1WOR A;  4EWT A;  2IIH A;  2HQF A;  2ZC4 A;  3J81 Y;  3WBZ A;  2YKP A;  2KXN B;  3M8Z A;  3OTD A;  4JV5 J;  3CDU A;  1NHK L;  3T5J A;  4JI7 J;  1YJ9 S;  2E1M C;  3UQS A;  4RUA A;  1YGY A;  2KB2 A;  2KH9 A;  3L4B C;  3TW0 A;  3V6H A;  3RRG A;  2PFD A;  3TQE A;  2NXJ A;  4ED5 A;  1IR0 A;  1XR6 A;  2VKZ G;  1ZAV A;  4OZ3 A;  4WFA Q;  1WHW A;  2RU9 A;  3UDE A;  3L09 A;  4PYD A;  3RR7 A;  4KT0 C;  3I9V 9;  3MMA B;  4FS1 A;  1HBU B;  5CYM B;  2OKQ A;  2VDH A;  2VU5 A;  5J2P A;  4ZN1 A;  3T9Z A;  4OZ0 A;  2R8I A;  4ZPB A;  1DFD A;  2GVZ B;  5JVG Q;  1A9N B;  2LKZ A;  1RWN B;  1OPZ A;  3CC2 S;  2QYG A;  2C3Y A;  4F3M A;  1HBN B;  2WB1 D;  3T6B A;  1TVR B;  1YJW S;  1HBO B;  3FQL A;  3ZTR A;  8AT1 B;  4I4B A;  5DQH A;  3KLE A;  4IYQ A;  3VAH A;  1TKZ B;  2MZT A;  2RRB A;  4J9Q A;  2HMI B;  1WKJ A;  1TP7 A;  3M8Q A;  5E3A A;  1FKP A;  1OO0 B;  1RAO A;  4KPC A;  3FZB A;  3SEO A;  1B0T A;  4L3K A;  4M5H A;  4CLY A;  2XM3 A;  2LEA A;  4F4Y A;  1KQG B;  2R8K A;  3WDO A;  1OWX A;  4DXL A;  4ZIW A;  3CJ0 A;  3LF0 A;  1B0P A;  4ZPV R;  2C28 A;  1N5Y B;  3KLF A;  1FEE A;  1DQA A;  5AJ3 J;  3R2D J;  1OQ6 A;  1S79 A;  5K14 A;  1VQ8 S;  3R5A A;  1IM4 A;  3DKD A;  1ZZF A;  1M1K T;  2OPS A;  4FF3 A;  1TU0 B;  2IBK A;  2OEL A;  2XYH B;  4OX8 A;  3M8S A;  4BHQ A;  4UOF A;  1PKU A;  4DPY A;  4B9S A;  2D3U A;  2H4Y B;  3GP9 A;  4UF4 A;  3MF5 A;  3PIO Q;  5L8R C;  4ZCK A;  2BE2 B;  4LF4 J;  5HMY A;  1N5V A;  4DR6 F;  3BR9 A;  1VBX A;  3WIV A;  2C2M B;  1ZA2 B;  3CNQ P;  3H2V E;  3FRZ A;  3MM7 A;  3HF5 A;  4JI6 F;  1RJJ A;  3Q8Y A;  1VMB A;  1S9F A;  2BBE A;  2Y8Y A;  2DO4 A;  1T9X A;  1IN0 A;  1LW0 B;  2NXU A;  2WVB A;  3A1Y G;  4XDC A;  4AQY J;  3MPD A;  2HNZ B;  3M8P A;  1BUX A;  1KTQ A;  2RRA A;  3QQC D;  3LAN A;  3KJN B;  1CJT B;  1FFS B;  1YBU A;  3DHW C;  2B6A A;  2MB0 B;  1CVJ A;  3DRS A;  4B9V A;  2UXD F;  1O8B A;  2CVI A;  2UUW A;  3CJ4 A;  3V2U C;  1VQ9 S;  1LWF A;  2RQM A;  1GNK A;  2O1P A;  1RA7 A;  4P71 A;  1FI4 A;  5KFG A;  3TEH B;  4JYA F;  5I42 B;  1DQ8 A;  1B70 B;  3GV7 B;  2GO9 A;  4K7Q A;  4K2J A;  2W7A A;  2FQQ B;  4K50 A;  1IKW A;  1HBN A;  2KG1 A;  4J9N A;  1QTM A;  2F4V F;  1SH2 A;  2RNE A;  2BM1 A;  2GVZ A;  2BJ9 A;  2KYZ A;  3OFG A;  1HBM B;  3GFZ A;  5B09 A;  4DQR A;  1JJH A;  2Y9H A;  3DXS X;  2PN6 A;  1PGZ A;  2ZUA A;  4P10 A;  1BD6 A;  3O1L A;  2P2C B;  3CO9 A;  2XMA A;  2NZ4 A;  2Z2Y B;  4LRC A;  3HDS A;  1TZ0 A;  2CDQ A;  1MSW D;  1PBU A;  2CA9 A;  4J9V A;  1FRL A;  2XZT B;  5FDL B;  4YDD B;  2JX2 A;  2YQ0 A;  3AOB A;  3ET6 A;  5KT5 A;  1H6K X;  3UR0 A;  4I6Y A;  4KFB A;  3UI3 A;  1YTY A;  1EET A;  2UUT A;  5DG7 A;  1HNI B;  2DPJ A;  3HJF A;  4IFY A;  2IA0 A;  1HPZ B;  1MW7 A;  3R6G B;  3R5D A;  2IJF A;  3KFW X;  1QUP A;  2KDO A;  2ZEJ A;  3ZZP A;  5HBM A;  3MTK A;  3CC4 S;  4QIG A;  1CBK A;  1HQE B;  1M5V C;  1S97 A;  2J9D A;  4J5O A;  1A7G E;  2OPR B;  3TWZ A;  3UO0 A;  5L39 A;  2E5G A;  3W2W B;  2YKA A;  6FDR A;  4DV0 F;  1JJC B;  4D3H A;  1VQ7 S;  3AXM A;  1R6V A;  1SH3 A;  3EGN A;  4JP8 A;  4RLE A;  3OLA A;  4DQS A;  1XNQ F;  5IV4 A;  3TZZ A;  1S77 D;  4M5N A;  3TZY A;  2EKY A;  3OTC A;  1NK9 A;  1TL1 B;  2E5L F;  1VR6 A;  1CJV B;  3DMJ B;  4EZ6 A;  2OAU A;  2I9S A;  4NML A;  1KC8 T;  4LF2 A;  2E5J A;  2WVC A;  1N4L A;  1S48 A;  3MI7 X;  3PV8 A;  5F8G A;  4Q44 A;  5KFU A;  1HFE L;  3GYG A;  5HAO A;  1KVJ A;  1MWY A;  3VTI A;  2QC3 A;  3Q0A A;  5F8M A;  1IJE B;  4WYW A;  3F41 A;  3BYR A;  3W5Z A;  1AUD A;  1VJW A;  3TQ1 A;  3E2E A;  3RJM B;  4JI8 J;  1RWP B;  2E1C A;  1IBM F;  4ZVS B;  2IMW P;  3AJ2 A;  3N4W A;  1K9M T;  3U1M A;  2MSS A;  1P6T A;  2ADB A;  2LDI A;  3G6Y A;  3QRR A;  1JLF A;  2JVR A;  2PEH A;  4P7T A;  1HQU B;  1XK8 A;  4KGV B;  4OZ5 A;  2XY7 A;  5D0G A;  2VJV A;  1KLM A;  1LEO A;  3VVU A;  4ILR A;  3PM9 A;  2GQQ A;  4Y2C A;  3HLU A;  3FJ2 A;  4LR8 A;  1NCL A;  3UE2 A;  3W62 A;  1OIA A;  5EGY A;  3NXZ A;  3LUY A;  1MRO B;  1TEL A;  4KV8 B;  3PYD A;  5BYR A;  4DUT A;  1Y4Z B;  3MUT P;  3OQ2 A;  4J9R A;  2B56 A;  4ED6 A;  1C0T A;  2HS3 A;  1PAE X;  4JI1 F;  1TL4 A;  5EDW A;  3NGU A;  3VR1 A;  3W8G A;  1DJ0 A;  2XLI A;  2RIJ A;  5J1P A;  2NSB A;  2YBV A;  5H9F K;  1AW0 A;  4RL1 A;  3V6D A;  2Z30 B;  4XO0 A;  4WCE Q;  1EZZ B;  2ZJP Q;  4YB7 A;  1HNI A;  1Q53 A;  1JB0 C;  2QO3 A;  3DLJ A;  3IN5 A;  4PPD A;  2P5V A;  4NOH A;  2KHD A;  3BJY A;  3NGR A;  5FLX Y;  3G82 B;  3N79 A;  4X4R A;  2ERR A;  2XG8 A;  2Q3P A;  4P74 A;  5FLX U;  4G6V B;  3UD5 A;  1XWL A;  4DPT A;  2LA6 A;  4EU0 A;  5IT4 A;  1CQM A;  1QSY A;  2VFV A;  3Q23 A;  4F3O A;  1N48 A;  1OYE A;  3MCN A;  5FD1 A;  3JXO A;  3N5F A;  4JI4 J;  2Q6B A;  1IUJ A;  1REV B;  2CQ0 A;  4PG4 A;  3CJK B;  2MZQ A;  2DEI A;  3H2L A;  5KFR A;  1VBK A;  2VHG A;  3HD2 A;  2DD8 S;  3G6V A;  2XC9 A;  3W9H A;  1Q81 T;  3QAU A;  4KHM A;  2XLK A;  3BZQ A;  3CED A;  3AQO A;  3JQK A;  5KT7 A;  1CJV A;  3CCS S;  3MWB A;  2OIH A;  3CB4 A;  2CPX A;  2HND B;  3BRE A;  5KFK A;  2W8K A;  3H4B A;  4DR3 F;  2DGQ A;  4P2S A;  1K0V A;  1KFD A;  2BA9 A;  2KL8 A;  1N6Q A;  2N7Y A;  1P8G A;  1S1W A;  2V67 A;  4LSL A;  2FJV A;  1EAY C;  3A8K A;  3I0R B;  4B08 A;  1FJG J;  4DEZ A;  4ZLL A;  2J0S D;  1IQZ A;  1IXK A;  4CH1 A;  1NPK A;  1QAY A;  2FZG B;  4PWU A;  3UNG C;  4MKY A;  1XEZ A;  2B4P A;  4C0H A;  5IFM A;  2XO7 A;  2XHC A;  3VQS A;  1EET B;  2I2Y A;  4B3O A;  2AJ0 A;  4PXD A;  1FNM A;  3A3P B;  1P27 B;  4I1T A;  2EFG A;  2ZNZ A;  1TL3 A;  3FK4 A;  4XTT A;  1GT8 A;  2FLO A;  4NCG A;  2YKM A;  1YK9 A;  3JB9 k;  4OZL A;  2MMY A;  5DZ7 A;  3T3F A;  4EEY A;  3NNC A;  3NCR A;  2YQ1 A;  2EFN A;  4RX6 A;  3W61 A;  5F9L A;  3OHA A;  1RTD A;  2AW0 A;  1GQE A;  3KDN A;  1R8C A;  2GVD A;  5I3U A;  1AUS L;  4JV0 A;  2BJ8 A;  3ENW A;  5CQG A;  5C42 B;  2VIC A;  1ZTT A;  2CZ4 A;  1KLN A;  1ZM9 A;  2DNK A;  2VKR A;  3H25 A;  1VQK S;  2Q66 A;  2OTL S;  4AT1 B;  1N36 F;  1E6V B;  2CJK A;  1WEY A;  2M8D B;  4LRE A;  1PIE A;  4G3I A;  1VHI A;  1FRK A;  1CS4 B;  2BX6 A;  2V68 A;  3RTV A;  4DV3 J;  1RT6 B;  4HI1 A;  4LQ3 A;  4BWJ A;  1SQE A;  2WSC C;  2LEC A;  1RTZ A;  2RDI A;  3B6B A;  2E7W A;  4WFB Q;  1GMV A;  2J7W A;  1ZBT A;  1UJ6 A;  4I2P B;  2VBY A;  4O4G A;  2CDR B;  5KT4 A;  1IBK F;  1N54 B;  3HSZ A;  1MMN A;  4XPE A;  2GMH A;  3D54 A;  4J9K A;  4Q45 A;  4KHP F;  2V8H A;  1BC6 A;  1B99 A;  1JK9 B;  1TL3 B;  1U6B A;  3PJX A;  1LK7 A;  3PEH A;  1QUV A;  2AMC B;  3K17 A;  3PEJ A;  1X8D A;  4WIQ A;  4DFK A;  2DNH A;  4DSL A;  1HWL A;  3IAS 9;  3G96 A;  3M8W A;  4AL6 A;  5CA5 A;  3EVW A;  5LSO A;  2CVE A;  3GIL A;  5IZH A;  4X2B A;  4H4K A;  1R27 B;  2PGC A;  5EWE A;  2ZC3 A;  2MGZ B;  3PIP Q;  4L72 B;  1EP4 A;  2VB6 A;  4U96 A;  1IBM J;  2ALZ A;  4FBT A;  4NWB A;  1R0B G;  2VC1 A;  4IH6 A;  5D4N A;  4RNF A;  3ZFV A;  4ZPD A;  4AL7 A;  3TJ9 A;  3I4P A;  2KXH A;  3G8S A;  1GMW A;  3NS6 A;  5F9N A;  1UVN A;  1BQN A;  8ATC B;  2MST A;  1MML A;  3UNY A;  4X4Q A;  1HNZ F;  3QJP A;  2M2B A;  4HI2 A;  2M52 A;  1WOS A;  4QYZ K;  4RU2 A;  5D6G A;  1O0P A;  1I1G A;  2K06 A;  5G0R A;  2CJY B;  4DR5 J;  2R8H A;  2B4V A;  3BGU A;  2RIL A;  1S59 A;  4OHZ A;  3DM2 A;  1GXL A;  4JI2 J;  1F0X A;  3J80 U; 
#chains in the Genus database with same CATH homology
 2WZ1 A;  4CLT A;  4CLK A;  2BW7 A;  3G82 B;  1CJT A;  3R5G A;  1YBT A;  4OZ2 A;  4P2X A;  4OYW A;  4CLZ A;  1Y10 A;  4USV A;  4CLU A;  3C16 B;  1CJT B;  1YBU A;  1Y11 A;  3G82 A;  4OYA A;  4WPA A;  3MR7 A;  1CJV A;  5D0R A;  1CUL A;  1CJU B;  4OYB A;  1U0H A;  4P2M A;  4CLL A;  3MAA B;  5D0H A;  3UVJ B;  1TL7 B;  3C16 A;  3C14 B;  2GVZ A;  3C15 B;  4OYI A;  5D15 A;  5IV3 A;  2W01 A;  3ET6 A;  1YK9 A;  4P2F A;  2GVD A;  2QV6 A;  4NI2 B;  1FX4 A;  1WC0 A;  4USW A;  3UVJ A;  4CLW A;  4WP3 A;  1CS4 B;  4OYX A;  2GVD B;  4WP8 A;  5IV4 A;  1CJU A;  1U0H B;  4UST A;  4OYP A;  1CJK A;  1CJV B;  4OZ3 A;  4USU A;  4NI2 A;  1AZS A;  4CM2 A;  4CLS A;  2GVZ B;  3C15 A;  1WC6 A;  1AZS B;  3C14 A;  3ET6 B;  1TL7 A;  1WC4 A;  1AB8 A;  4OYZ A;  4CM0 A;  1WC1 A;  5D0G A;  1CJK B;  1CUL B;  4CLY A;  4CLP A;  1WC5 A;  4OYO A;  1CS4 A;  1WC3 A;  5D0E A;  1FX2 A;  4OYM A;  3MAA A;  4WP9 A;  4CLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...