1CULA

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
189
structure length
189
Chain Sequence
b'MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYPE V ADENYLYL CYCLASE
molecule tags Lyase/lyase/signaling protein
source organism Canis lupus familiaris
publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
total genus 62
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1culA00
1Y10A 1WC1A 2QV6A 4OYWA 4OYZA 1Y11A 1CJVB 3G82B 3G82A 4WP3A 1CJUA 4WP8A 4OYOA 1CULB 4CLYA 1U0HB 2GVZA 3C14B 1CJTB 1CS4A 4USTA 4WPAA 1YK9A 4NI2B 4P2MA 3MAAA 1U0HA 1WC3A 4OYAA 1FX2A 4OYIA 5D0GA 3R5GA 1TL7A 1WC6A 4USWA 2GVDA 4OYMA 4OYBA 1AB8A 1YBUA 4NI2A 4OZ2A 3UVJA 5D0HA 3MR7A 1CS4B 1WC0A 4CM0A 1FX4A 4P2XA 4CLLA 1CJVA 1AZSB 4CM2A 4CLKA 2GVZB 3C14A 5IV4A 1CULA 2W01A 4CLZA 5IV3A 3ET6B 2WZ1A 4USUA 4OZ3A 1WC4A 4CLUA 5D0EA 2BW7A 1CJKB 3UVJB 4OYPA 4P2FA 3ET6A 4CLSA 2GVDB 1CJUB 1WC5A 1AZSA 1CJKA 3C16B 1YBTA 3MAAB 4CLFA 3C15A 4CLTA 4CLWA 5D0RA 1CJTA 1TL7B 4OYXA 3C15B 4CLPA 4WP9A 5D15A 4USVA 3C16A
chains in the Genus database with same CATH superfamily
2BW2A 3DKDA 2CJAA 4M5GA 1LFWA 2D3ZA 3ZXWA 3GSIA 1I51B 4NLRA 1TKTB 4C0BA 3N6MA 3BSCA 4F36A 3M2VA 1VQ6S 1PYSB 2HRUA 2OSQA 5IM0A 3BGOP 2FJEB 3HK2A 3G82A 4K4TA 1LKZA 2LMIA 3FEZA 3QMQA 2JWNA 2BV3A 3D3CJ 3MAHA 1C4AA 4WU2A 4RNFA 3MEGB 3FFIB 2NQPA 4F4WA 2GV1A 1WF1A 1NBEB 4B9TA 4IFYB 2G0CA 3LALA 1SJFA 2YWEA 1JNRB 3NGKA 2B56A 1LV5A 4NI2B 3H25A 3LWLA 1REVB 3W2WB 3GB0A 4HKQA 1N32F 5JVGQ 2BKPA 2OLWA 2MLYA 3MMCB 4CO2A 4DR3F 4ELUA 4DLGA 1NDLA 1XEZA 4CO0A 3TUPA 4MH8A 2NCKL 4N77A 1QAIA 1L3SA 2OD4A 5D0GA 1VQ5S 2PFFB 2DH9A 2IAJA 3H2LA 5HVGA 1HWKA 3MI7X 3NGRA 4DPTA 2EFQA 2EFPA 1TAQA 5D0HA 3QWPA 2XI2A 3KLGA 2XHWA 2E1PA 2WOMB 3TZWA 2AQ4A 1FWPA 1UEKA 1KFDA 2QE5A 3DXSX 1FDNA 1QTNB 1YZ6A 3ENQA 5C2CA 4DLEA 3O3LA 4MIWA 3GIRA 3MM5A 2MGZA 2FLNA 1NH8A 2J76E 3GFZA 2R7VA 1D8YA 5KFUA 2CQ4A 4AYBD 1RHMB 1UWBA 4MKAA 2EFVA 2B8PA 2AJ1A 1UAWA 3VAHA 2VA2A 2OPPA 2R8KA 3HO1A 2LYVA 3J7YU 3N6LA 1ITPA 4K50A 2W7OA 2ZM6F 5EUHA 2CPFA 3ELHA 3AXKA 3POTB 2XC9A 1HQEA 1NB2A 4DDFA 4RW8B 2ASDA 3ENWA 1KVIA 2EKYA 2R4FA 1JKHA 3VGVA 3MWBA 1TKZA 1VIOA 1SXLA 3M8PA 3R6GB 3MMJA 2YNFB 1U2RA 1XMQJ 4UOHA 2BJ3A 4LQ3A 2B4PA 3EPGA 3E01A 2ZDPA 1EQMA 4JI4F 5B0AA 4F3MA 1R0AA 3IMQJ 1VQMS 2YWGA 1EZZB 1BMQB 1YDLA 1UVMA 2AEFA 2BUNA 4MYTA 3QIPB 1IWGA 3RB0A 3DYAA 2XMMA 1EAYC 2EW9A 3KHLA 3RTVA 2B5JB 3M8QB 4YQWA 2AGPA 3DGPA 1U1QA 2V9KA 1OJ4A 3BGFA 1DTTB 4F4AA 1KOOA 2Z2MA 2JLGA 3NL0A 4CLFA 1AFIA 4IOBA 4USJC 1RTHA 2QSWA 1LOUA 1S57A 1EP4A 2N4DA 2B4VA 2YQ1A 3O8WA 4NA3A 3CCMS 4DR5J 4CWBA 1YRUA 2YX4A 1JJHA 4CLWA 5KFDA 1JMTA 2WHOA 2R3VA 1XMBA 3DLBA 5A8KA 4CO3A 3DYAB 3MEDA 3DNCA 2H5IB 3IR6B 3N01A 3UDVA 2VDHA 1U2CA 3FK4A 1T02A 3PM9A 2QRRA 5F8LA 4KH0B 3BO4A 5GAHU 2ADCA 3D68A 3PCOB 2IBOA 5CQGA 1DTTA 2Q79A 4PEOA 2V94A 3H4BA 3UW1A 3TWZA 3I31A 3OXLA 3TX8A 1VBYA 1RK8A 3IR5B 3AT1B 4DSEA 1VC5A 3HF5A 2FZCB 4JI7J 2OGUA 4GKKJ 1H6KX 2VONA 5CXTA 1NSKL 1CLFA 4ZMMA 2W9CA 4DG1B 3GJTB 2LQ8A 1HQEB 2AF6A 4DV3J 4BWMA 5BYSA 1N54B 1I5OB 4DPUA 2BQ3A 1VRQC 4O3QA 2OPQA 4CLYA 2UU9J 2XS7A 3EVMA 2QLWA 1FK9A 5AE1A 1CQMA 2YQ3A 3N0VA 4EUVA 3I55S 4USTA 4QWBA 3PW5A 4X64J 2DEIA 4PG8A 1AW0A 3M2RA 2DTJA 2V2ZA 4ZN3A 4ZJQA 1FJEB 2EG2A 2HBYB 2ZWPA 4E0DA 4RW6B 2XSFA 2JVRA 3H5SA 2GGPB 3A12A 5H9FJ 4HHJA 1F2HA 2HFZA 3W64A 5EDWA 1RHJB 4JUZA 3BR9A 4DV4J 4MFBA 2QN6B 4B02A 4K59A 1VLOA 2HIQA 4RW9B 4WWSA 2EBGA 1A0OB 2JFDA 2ZHOA 3CSKA 3CCWA 4OI6A 2AYEA 1JLAB 4ZS6A 4YR2A 3J7YI 2HVIA 4DV5F 4UUWA 2VBZA 3LP2A 1KKHA 4DXLA 3HHDA 3GFYA 1FEHA 4YB7A 2VJUA 2DR6A 2YNGB 1Y5NB 1VQOS 4B3TJ 4AT1B 1TAUA 1T95A 1D3WA 3K7RA 2VG6A 3GR1A 2B9WA 1GT8A 3CJRA 1GQEA 4IG3A 4M63A 1UJ5A 4DQSA 1TELA 2MZJA 1T94A 1RT1A 1NHVA 3A3NB 2UUTA 3FCWA 4B9SA 1HYSB 4I2PA 1IKWB 1VMBA 5EGYA 3UDCA 1RSCA 4LIRA 5CABA 4MIAA 3PW7A 2FJWA 1QD1A 2QLXA 3NRBA 4Y2IA 1R3NA 2WTFA 4QIEA 3TEHB 3J81Y 3P3DA 2DEJA 3FQKA 2JOQA 2MXYA 1U48A 4K4YA 2CJBA 2XWXA 4I1TA 2V8VA 2ASYA 5CAAA 3LP0A 1JLBB 2K8GA 1F5AA 2Z30B 1DY3A 3MEKA 2E5IA 3UFCX 2QFJA 3AA9A 2V50A 1Q8LA 1N5TA 2YH0A 1G2EA 1R6VA 2W24A 3DRXA 5D0EA 2OHDA 2I2YA 3MMCA 1DBDA 1U02A 2F3JA 1PC5A 2DIUA 1HNVA 1RB0A 2MY7A 3TEGA 5J2QB 3RB3A 4A8FA 3NNHA 2W9BB 5HMWA 3AODA 2B8QA 4P74A 3IR7B 5JMNA 1RT6B 3MR2A 4J9NA 1L3VA 4Y0FA 2R8GA 1SV5B 4P2FA 4Q43A 4DV4F 3OUYB 3JTOA 1U47A 1N36J 4EBCA 5E41A 1DQ8A 2BM1A 2M8DB 1H7XA 5IWAF 4G1QA 4AE5A 5GAEI 1UW4A 2HAFA 1H72C 3MM6B 1N5VA 3QAUA 4R8UA 1IKVA 1WKLA 4K4WA 2ZH8A 3BKUA 4IG0A 5KFZA 1N32J 1RHQB 2XB2D 2WBMA 2ZE2A 4RUCA 2HNYA 4DZDA 1VQNS 4FS1A 2XQCA 1U45A 3P96A 3KOAA 4PABA 5LMUJ 3LTOA 3R5DA 3LWMA 2CNOB 1BWEA 2FY8A 4YHHJ 2MJUA 4DV7F 3UQSA 4X62F 4FVMA 5DJBA 1HBNB 2M88A 4ETXA 2DNHA 4ZK7M 3N79A 2N7CA 3M9MB 2IA6A 4CH0S 3V4IB 1C0TB 2RS2A 3MOJB 1OWXA 2V4JB 1Q5VA 2F4VF 2KJWA 1FRMA 2MHNA 3S01A 1UA0A 5KFBA 3D67A 4G1QB 2HS0A 1HA1A 1BQXA 2MKIA 3TX0A 4CO1A 3R8YA 1HI8A 2WVCA 3GR0A 3IGNA 5FLXU 1SV5A 2R2TA 5KG2A 4A8SA 1RWWB 3JQMA 1NJZA 2MEWA 1HKAA 2YNHA 2XMJA 4YN3B 2XMWA 1DTQA 5DGBA 1PKUA 2YXLA 1AXQA 2KT5A 3ZFVA 4CH1A 2DHGA 1JB0C 2KDOA 2YPZA 4NPOA 5D3GB 3VTIA 1GAOA 4NOHA 4OYZA 3FJ2A 4DL6A 2CYYA 1BGXT 2C1EB 2MKSA 3I4HX 4I6AA 3I4PA 4JP8A 4KHRA 3WIVA 2FHOB 4NMLA 1S4EA 4ZPBA 1SQGA 1E6VA 1KWMA 3L7PA 1DQ9A 2HQIA 1UMJA 1AA1B 1RHKB 1UA1A 1DFDA 2Y1RI 3CJQA 4L3KA 2A6MA 3ILIA 3EX7B 1RKJA 4B3MF 4RZRA 3AH6A 1N52B 2WONA 1TK8A 1I94F 2C2KB 2IRXA 4X4SA 2DNQA 2HHXA 3C8YA 3Q8UA 4OI1A 2PMZD 4D3GA 1VQ8S 2J6TA 3EZUA 4I7FB 1BC6A 4ID5B 3PJXA 2I1RA 2VG6B 1MROA 3PYDA 3NBPB 3BPSP 3QT5A 4LSZB 4DR6J 4IDKB 4OI0A 3G87A 2KB2A 2FGCA 5BR8J 4QIGA 2XTJP 4DV7J 3D2WA 4F4XA 2LDIA 2EI5A 1VHFA 4YY3F 3KHHA 2VJVA 3NGUA 3FKBA 1K0VA 2RSQA 2IVYA 4OJGA 4LFAF 2V63A 4OZ2A 2HLTA 4C0HA 1RT7A 4IR9A 3BREA 3NP5A 1RT4B 1WDTA 1KFSA 2AYGA 4Z7YA 1UVIA 3JYTA 2KJVA 2D7SA 4DU8A 3M2UB 2NREA 3LP1B 1L3UA 3KNAA 2CQ1A 3BSOA 2WSFC 5DZ6A 3UO0A 4F26A 4Y6IA 5KAKA 1DJ0A 3UCUP 3LQVA 3IRWP 2I5JA 1TL1B 4CYUB 4M5DA 2GMJA 5J1EB 3ADAC 2XLJA 1E6YA 2A3JA 1N36F 1HR0F 4TNOA 3VV2B 5JJBA 5K8MA 1OY9A 1RTDA 1VHIA 2QGFB 2GNKA 2J6UA 3KTQA 3K5MA 4OL8A 3AQPA 4NWBA 1X9WA 2YPYA 2E1RA 3AB2B 4FPIA 2ACMA 2VBWA 3OTDA 3T5HA 3PHEA 1JLQB 1XC9A 4DQIA 3PX4A 4ELTA 4KY3A 4PPZA 3OHAA 4CCHA 1DLOA 1YRXA 2H3EB 2PE8A 3MR6A 2VFTA 4F3OA 3DDIA 5GAHI 4O44B 1R8AA 2OMLA 2P5VA 5HVHA 3VAJA 3ZO7A 3UVJB 2UV8A 1UVNA 2WBRA 3DN9A 1F60B 3A8IA 3OT9A 3IBCB 4WYLA 5EHHA 2CDQA 1N0VC 5K14B 3VHQA 3NOGA 2MY8A 1NB7A 4N8OA 1FTRA 6FDRA 1FRHA 5RUBA 1P1LA 3CPWR 4ED7A 2ZBQA 2LA6A 4X4TA 3PTWA 4F0HA 3MUMP 3RR7A 1RBAA 5DDOC 3NAHA 4JI8J 4LF1A 2G2YA 5HMZA 2PD1A 1MN9A 4M5LA 3LGMA 4X84A 3RGIA 2C2NA 2YKQA 3DGPB 1SC3B 2G0IA 1RAFB 2LU2A 1SL0A 2FVQA 2RS8A 4K4UA 3H2VE 4F7VA 5J2MA 4JI0J 3DLKB 1RTHB 1HBUB 2RUGA 3VGUA 2KFNA 1HW8A 2AEJA 4ZVFA 5A0YA 2L9DA 2UUBF 4FNIA 2FVSA 2R7UA 2H65B 1DURA 5LM7E 1R0CB 1MWYA 3SCKE 1X9SA 1MG7A 2F9DA 5KFXA 2DHAA 4UOGA 2DPJA 2IFXA 4ERDA 1YGYA 1ZA1B 4LSLB 3I87A 3GZ7A 4DS4A 2AW0A 4BC7A 3Q8VA 3QIDA 3GIJA 3NWRA 2RE1A 3PRDA 2WAQD 1KS2A 2RILA 3SBMA 4USVA 1T9UA 2GMLA 4MJKA 2B9XA 3PR4A 3UI3A 4C8KA 1DAXA 5GMDA 4DFJA 3EDQB 1ZPVA 4P71A 3HLUA 2ZBPA 2BABA 2AJ0A 5K8OA 2JX2A 3HVTA 3OFEA 2E1MC 1D09B 3THTA 1IUJA 3TJ8A 3ZTQA 2XCAA 2KT2A 3RBXA 3THPA 4OYWA 3PW2A 1OSCA 2XMTA 4O3SA 2WVEA 3CDWA 3BGRB 1FESA 1YQHA 3F41A 1LWFB 2FTRA 3MM5B 5IOLA 4YB1P 1RLDA 2HBRB 2BJEA 3BKTA 3KUHA 5LJ5Y 3OL8A 1C4CA 4B9LA 1OPZA 1MROB 2G2OA 1PJ6A 3OQ2A 4LRDA 4TKTA 1GTHA 4DFKA 1UKUA 5KFIA 1JXVA 2DYAA 1HPZB 2DT9A 5F8HA 3WHIA 3JYTB 1BQMB 3A3OB 1PSDA 4KIAA 2BMBA 5KG6A 3PW0A 3POTA 4FYWB 1H38A 4EK2A 2MQLA 3W2VA 1X4AA 4NLWA 4P2MA 5SZTA 2W8KA 4U9RA 4N76A 3MAAA 1NPPA 4DL2A 4FXDA 4TLQA 5KFRA 5B7WA 1PIEA 1VCTA 3QGHA 1RJJA 5L9XA 2YQ0A 4N5SA 3TVYA 4LF8J 1G3OA 1CSJA 4H54A 4OZ5A 1U0HA 2GJFA 4JI6J 2G0JA 2X1BA 4OHVA 2BE7D 1FWLA 4ZVRB 4C8MA 2IMOA 2N4CA 4PXEA 3KJVA 5FJ4A 1NXIA 1JLFA 1OY6A 2YWWA 3BR8A 1WC6A 3R5GA 4M95A 2MKYA 4HHHA 3I32A 1REVA 2DR7A 1YBUA 1RLCL 2YNHB 3ZZYA 2ZOMA 1FXLA 3CCTA 3UVJA 4X4UA 4ZPTR 3T5JA 2V34A 2J6SA 5KG4A 4OLOA 2IPOB 4O0IA 2D1CA 5BYQA 1BQNB 3ISND 4LFBF 5KFKA 2WB1D 3OJSA 1L3TA 1URRA 3OFHA 3TZXA 1S4FA 3MAQA 3HSJA 4I6WA 1KTVA 4GO5X 2R7SA 5AXLA 4OMFG 5HROA 2ZH6A 3T1YF 1WNEA 1JLCB 1X5SA 2NR0A 2DXDA 2YNIB 5FDLB 3CJSA 1Q5YA 1CULA 1FVSA 5IV3A 4ECTA 4LF9F 5K14A 3KUGA 4AQYJ 3BN7A 1D0EA 2LA4A 2EPIA 1Q79A 4KR0B 3W5YA 1RT2B 2QYGA 5HJYA 4DS5A 3CMES 1RDRA 2AJ4A 3EVWA 4R0EA 3SI8A 2HIYA 1BWVA 4URGA 3P49B 2ZM6J 4KV8A 4NZ6A 2CG4A 3IAS9 2VKRA 4IOCQ 3VAGA 3UWTA 3QSIA 4ZJLA 5LL6d 3K58A 2YKAA 3ETMA 4NLUA 2AU0A 2A18A 3BF4A 2DNRA 1ZYQA 1T05A 2FQQB 2BANB 3D54A 1XMQF 4YS2A 3QRRA 3CCQS 1RT5A 1GXUA 1NZAA 3D6TB 4TLRA 4AFFA 3BM7A 4P7TA 3H42A 5HK4A 5C25A 1S7HA 1SL2A 3EZOA 4QR1A 1M90T 4C9DA 2ZE2B 3JQJA 3EGWB 4KTQA 2JSXA 5KOXA 2GHVC 1S1TA 4FF4A 1WELA 5C42A 2M7SA 4J9LA 4DL5A 2PT0A 1RE1B 2RDIA 1VBXA 2GAGC 5J1PA 4AD6A 5F3TA 1APSA 1B0VA 1TQLA 1H3DA 1S6QA 1IXKA 1D8ZA 5KT2A 1RHRB 4CNYA 2LEPA 3T6JA 4A8OA 1S48A 5HSPA 5A2QY 5J2NB 2G13A 1OSDA 1TUVA 2Y3YA 3C6UA 3FBCA 1AUSL 3JTPA 3CTRA 5IXUA 3T1YJ 2K7JA 4HACB 3PG9A 5FLXY 1VQ7S 3NKYA 2RQMA 2XS2A 2L9WA 1XTZA 4LRCA 4LF4F 1UFKA 2I38A 4KGVB 2OFGX 1IBKF 2B9EA 2DCLA 3FVYA 3MEEB 1CEZA 3FEXB 3GPAA 2LQ9A 2W2NP 3JTNA 2H54B 1OQ6A 4C0OC 4ZLLA 4X66F 4WFAQ 4P7VA 2POKA 4YHHF 3SQGA 1RBOB 3U1NA 1YJTA 5DGAA 1SL1A 2UZAA 1RQ0A 2MZSA 3D0IE 4DR2F 3ZZTA 3THVA 2NS1B 1M1KT 4JI7F 4GKKF 3SCJE 2VG7A 2GJ2A 4ES3A 1SUQA 3E3XA 3KK2B 4DUZJ 1BY9A 2K2PA 1U0HB 2Y1IA 4QJVA 1JNZB 2MKHA 4KJIA 3LOUA 2H48B 1TFYA 2E7VA 5KG0A 2UVWA 1U2FA 1YIJS 1RWVB 2HSEB 2D69A 3P5BP 4KC5A 2Z4PA 4CQ1A 1KLMA 3TOQA 1SB6A 1WDDA 4ZPDA 2JHEA 2BVZA 5L8RC 3RW7A 2BEFA 4J7CA 1T11A 3H7HB 1FRLA 2IIHA 4J9QA 3NNAA 2UUCF 2UXBF 3L9ZA 2OIHA 4LF8F 3HULA 4KAIA 1G4CA 2OD6A 3DRYA 1YJ7A 1S76D 1AB8A 1KQGB 3ENAA 2YH1A 1RWUA 3W62A 2E7WA 5H9EK 1N5YA 4HR2A 4ECZA 3OR2A 2J0SD 2NYHA 3FBBA 1EX8A 3HVTB 4KE5A 1Q82T 2RNEA 3DRPB 3MOZA 3LANA 3BYPA 1OYDA 4UW2A 3CJ4A 2KXHA 2R2SA 5IT0A 2EWHA 2JFKA 4QYRA 5A6WA 3M05A 1NUEA 4Y2CA 3M4XA 3HP6A 4B9NA 2QFIA 2VASA 5C7PA 1Y9OA 3ZC4A 4NXMF 1GXTA 5CYQA 4F0KA 2HFSA 1RYSA 4NXNJ 1FDDA 1U8WA 5ETTA 2AYMA 3BBCA 2JC1A 2DK2A 3DDNA 2Y0SD 2QL7B 3ISZA 3LH2S 3QNWB 3DLLQ 2HEKA 1H98A 5C24B 2FJXA 4Q2MA 1UTAA 2XCPA 3H8YA 1X4BA 4I2PB 4WK1A 3HXMA 5HQMA 1FDBA 2DRDA 2HWHA 4TYBA 2F63A 3CF5Q 4NLSA 4HDGA 1SH2A 4H4KC 3VCDA 1P27B 3RYLA 3H4DA 3DHWC 4K0KJ 1FD2A 4TY8A 5THWA 2RMLA 3ILOA 4FYXB 5DQGA 1NSPA 2UVRA 2XHCA 1REGX 3MZIA 3K5LA 2IC3B 3D5MA 3KKFA 1VOMA 4M8LA 4DU7A 4WK3A 4YMEA 2HBQB 2IMWP 1TL1A 1RWXB 5J1EA 5KFMA 2VFSA 4BCAA 4F02A 1B64A 4WTOB 4DJBA 1LWEA 1TKZB 1VS3A 3VQTA 3PO4A 1O0PA 3K5OA 2VBYA 3AAWB 5F8NA 1NZ8A 3P4UB 4NEZA 1KTQA 2CZ4A 3VALA 1VC6A 1MWZA 1QVFR 5HLFA 3PX6A 4NZ0A 2HHQA 1PJ5A 1S1XA 3IGVA 4LF7F 3KLIB 3MFIA 3OR2B 4N56A 4C8ZA 3HDSA 2OJ3A 2MZQA 4HLBA 5HBMA 4UQGA 1IM4A 2LXUA 3BB5A 4KFBA 3BO2A 5F41A 1Q53A 4L3NA 4H4KA 3PYGA 3CCZA 2YNFA 1LWCB 3C15B 3NBPA 1IJEB 1P1TA 3GCXP 2Y8YA 1JKHB 2JLFA 3HFKA 2LCWA 3QSYB 1U09A 4CNZA 7AT1B 4MK7A 2F8HA 2KG1A 3KLIA 3CJ5A 1QVGR 2RHQB 1SQFA 1TKDA 2CFXA 1JXLA 2ROEA 5ETMA 2XO6A 4U7UD 4QOTA 5E33A 2DBBA 4X62J 2C3PA 3W63A 2MQOA 3KHRA 2ADBA 4Q0BA 2VG5B 3GE9A 4NE9C 1UJ4A 2IBKA 5CHCB 3CD5A 3DMJB 5B0GA 3RUBL 4Z7CA 5A76A 1LWEB 2NUHA 5KTQA 3UCZP 4LF9J 4ZITA 3MPDA 4ZLPA 1QUPA 5LT5A 3KK3B 3D1HA 4NLGA 3A1YG 4EWTA 4PYAA 2ATLA 3CNQP 1FRXA 3CDBA 2VZ9A 2K3KA 3P5TL 4FNHA 4I7FA 5EWEA 1EIYB 4QIVA 4RUHA 3TJAA 1DTQB 3NS6A 4U8YA 1LWXA 4WU3A 5KT4A 4WPAA 4RX6A 2VQEF 4Q8EA 1HBUA 3MGJA 1U1LA 4M1KA 1HQUB 4ZP9A 3QRQA 5MAOA 3D6FB 2QLBB 3IWNC 4ANCA 2ZNYA 1I94J 3S7RA 1NH7A 2E9TA 1KSPA 1F6TA 3C6UB 5CYJA 3K5NA 2FB0A 2YKMA 2G2ZA 1YX2A 2HGLA 4YDXA 1XNRF 2RH3A 2NYIA 4KPCA 4WFZA 4USMA 3A3PB 3R5JB 1C1CB 3Q8PB 1VQLS 1S6QB 3HHNB 4HL9A 3UN5A 1WKJA 1YBAA 1CBKA 1R7IA 1TUWA 1TV6A 3DRPA 2HLUA 4BBYA 7FD1A 5A8WB 5HO4A 3BH7B 3Q86A 2FZKB 3LP1A 2ZWOA 3M6VA 4DL3A 2GQ2A 4B17A 2E44A 4E98A 2DO0A 4LVOP 4EBDA 1F0XA 1HARA 1VBKA 4ZHRB 3R27A 3F73A 3NEKA 3EJMA 5FIIA 2X1AA 3CC7S 2KT3A 2XY6A 2DJWA 1IBMF 1C2PA 3R5AA 2XMVA 5AXKA 2AZ1A 1UWBB 2B51A 2CWXA 2HNDA 2FUG9 3C14A 3N5FA 5KT7A 1S99A 3EM1A 1UPPA 4CLZA 2FZGB 4L74A 2DNMA 1Y00A 2PDAA 3ET6B 1GEHA 4IDKA 1KP6A 3GFXA 1GNKA 1BLUA 2HQDA 3TUJC 2O5DA 3GYGA 1F3FA 4LSNB 4C8NA 2NSBA 1HNVB 3SEOA 2C3YA 1N48A 1N88A 2M5YA 4XDDA 4TQRA 2A6OA 2DPIA 4LFCJ 3FDSA 3BQ2A 2CIMA 1IJFB 4IG0B 4NLXA 1WSRA 3QGPA 3HPOA 3KLFB 4DV1F 3DXBA 2AX0A 3H0PA 2K3IA 4KKOB 1IWAA 1S79A 4PQUA 2EEYA 4H4OB 3B6BA 3WBZA 1NK6A 1L5UA 2XSJA 2UU9F 4ZVGA 4AL7A 5IFMA 5B0DA 4V1Ak 4CO4A 2WVBA 3D1QA 2GIRA 2GVDB 1U24A 2OFHX 4MKYA 1HBOA 2B7CB 3K59A 4RR5A 1JXEA 3NLCA 4J9SA 1K44A 4N47A 3A8JA 2B6AA 4XPEA 5B0EA 3SV4A 2UVUA 3OTCA 4KGZB 5J2QA 1J5EF 4KHPJ 1FE4A 2WVDA 3HZEA 3IG1B 3QWUA 3RAXA 2QSFA 3D4JA 3SQGB 5KFLA 2BQUA 3HD2A 1X0FA 5KFJA 2Z2ZA 1YJRA 2V69A 5D0RA 2E7XA 4HT7A 2M4MA 2ZHBA 2CNNB 2J7KA 3G6VA 2DGOA 1J27A 1RWPB 3IBWA 3M6UA 3FRYA 4KKOA 2V2VA 2YKOA 4ZVHA 4CIOA 3KDNA 3SYZA 3CJ0A 5D6GA 5K8NA 3MF5A 2RQKA 1NJIT 1ZM9A 4M5NA 3AY0A 3IP0A 3S8SA 1MN7A 4I2QB 1XMOF 5T41A 3W2WA 1ZETA 5C25B 2WVFA 1YITS 2DHXA 2Z2LA 4C8YA 1ZPWX 2ZBIA 1CC8A 1JLAA 2X3GA 3OBIA 1WHXA 5HP1B 3W8PA 3VAFA 2V4JA 3GCWP 3A8EA 3Q2TC 2JDJA 2XM3A 1H2UX 1SBRA 3PZPA 4NL5A 3MM6A 4ZVQB 4UY8T 2YNIA 5FDLA 4F50A 2FPHX 3N9UC 4QQBA 2UV8G 4DHVA 1ROFA 1LXNA 4B3RJ 1OQ3A 4C2MA 3VVTA 4TU9A 1FT8A 2BJDA 3FC9A 1QAJA 4EZ9A 1KVJA 3JSYA 4ZKAA 3LGNA 2XLIA 4CI0B 3NMRA 2E66A 4QW8A 3HVWA 3H90A 4UOFA 3N28A 4KV8B 3M30A 2R2UA 3KG1A 4P9SA 2KL8A 3OL9A 3SSSA 4ED5A 2J7WA 3I0RB 4J9VA 4RLEA 2QMXA 3HI9A 3CJKB 3MMAA 4QBUA 2KVIA 2Y8WA 3OR1B 1JLBA 1P6TA 3N5BA 1V3SA 5AE3A 1NPRA 2RIJA 4FP9A 1KVKA 4F8RA 3IA0A 1G6BA 3D0HE 4ED3A 1RYRA 1WOPA 1NK9A 2CWKA 5I4MA 1HQUA 1WI8A 2Y9HA 4XPCA 2F4VJ 1UZDA 2A2DA 2LDYA 1FXDA 1BQNA 1NAQA 2P6SA 4RNHA 1CS4B 2DHHA 1UWAA 4WE1A 3NCQA 1NO8A 4QU7A 1M0SA 3CMQA 2LQBA 3FUYA 1CQNA 1O5JA 1R8CA 2AV5A 2WW8A 4ES1A 1QSLA 1KBRA 1FRKA 4JBCA 2V5HG 4JI5F 3G6YA 2J9EA 4OZ0A 1RXOB 3E8OA 4C97A 3CC4S 1YKWA 2PMHA 1KN6A 5DM7Q 2DH7A 4GMKA 1IBMJ 3TVKA 4NYZA 1RA6A 2NXJA 4ZN1A 2XGPA 3DOKB 3F0NA 3TP2A 3JSMB 3DU5A 4QIWD 2W8LA 4KH1B 5K20B 5I3UB 1IR2A 4L73A 2BX6A 3TNVA 4DPWA 4EO8A 3E51A 4DUZF 1U1PA 2ALYB 2J9DE 4GVLA 4LBHA 5D4OA 2PO4A 3NAIA 4C8OA 4WIQA 4ZP6A 4UT4A 2CJXB 5ETKA 4O3NA 1LQ9A 1C1BB 1JK9B 4LR8A 1Q7LB 3OW2R 1S6PB 2MDAA 2W25A 4BDPA 3AFGA 3GJSB 1WF2A 4C98A 4GVBB 4NMXA 2DRBA 2GCFA 2BACA 2CRLA 4J9MA 2BRLA 1S1VB 1UFLA 4JI1J 4FZVA 5DETA 2EK6A 2Q66A 3EICA 3TUIC 3V6KA 4DX7A 2KXFA 2MQQA 4EU0A 2W7PA 2R8JA 2ZH5A 3BBFA 4LRAA 1S6PA 4F67A 2YTCA 4JI4J 1MLAA 4MMOA 4KFBB 2OTJS 4ILMA 4G6VB 1MNEA 3NS7B 4F0MA 3B4DA 1RAHB 3G8QA 5ETSA 2FLPA 1X4EA 3DM2A 3O6QA 4NCGB 1LK5A 6FD1A 1A7GE 4DL4A 1T03A 1JWWA 4F4ZA 2A1BA 3R6LB 1NU4A 1X7VA 2W9CB 5DQIA 2EXUA 2GC8A 3BS9A 2IDEA 5DLFA 2ZC4A 4WTYA 1PC4A 2HMIA 4ED4A 4M94A 5B08A 2MZRA 3IS9B 4CO5A 1MWQA 3LPYA 2F4FA 2MKCA 3O2IA 1WC1A 2OTLS 4NXNF 3KLEB 3FFIA 2LQ5A 1VQSA 4PRFA 2KHCA 3K2YA 4O3RA 2Q43A 3DM2B 4NCGA 3BQ0A 4ELVA 4KQZA 2VOOA 4LRFA 2HHTA 2V4QA 1HMVA 4E8UA 2GS8A 3T41A 4NCAA 1W7WA 2DO4A 5A8KB 5AE2A 4RUBA 2RU9A 2VKZG 3J80U 1VK3A 3VGTA 3PO5A 2PEBA 4EFAC 4DEZA 4ILRA 2DY9A 2UUWA 2X1FA 2AWZA 1X4HA 1VRUB 4O44A 3HJVA 4ATNA 3PY8A 4AQYF 2FY1A 5CD4H 8AT1B 1XNQF 1F9HA 2QYCA 1DLOB 2P6TA 3QQCD 4KHMA 2BKOA 2KHDA 4HDHA 2MYFA 3RR8A 4C3MA 2D74B 4DV5J 1T03B 4QYZK 1UL3A 1FNXH 1UVLA 4CTAA 1SC4B 2J7UA 2W2QP 4DR3J 2ZZNA 4C8LA 3QT6A 4PKDB 2NLWA 1C0UA 4USWA 1TKTA 2PGCA 2ZVSA 4NLTA 4ECVA 2XMKA 1S0NA 1FF2A 2VU5A 5LSLA 5GMKa 1VQ4S 2D9OA 3P8BB 2HWTA 3SQOP 4Z37A 2CQIA 3UD3P 4ZCLA 4IO1A 2HWIA 1A9NB 2H1YA 4UZCA 3Q8SB 4G3IA 3R2DJ 1S5ZA 2L3MA 2F8EX 1YWXA 4BWJA 1U1KA 1D9AA 1JJ2R 2WRMA 3NG8A 4ECSA 4R8UB 4CLKA 2IM2A 3ZZRA 5IS2A 3C6TA 1KLNA 2NZ4A 2PFDA 2M0GB 2KYZA 5I42A 2W01A 4P72A 2BE9B 4LQ9A 3I96A 5HN0A 4FYVB 4RU2A 1RU1A 4RUAA 1RT3B 3H98A 3HKWA 3NXZA 5EWGA 3GV8B 4CT9A 2DNGA 2C3OA 4ZA1A 1EETA 1QM9A 1M5OC 3NCRA 1QLNA 3PRVA 4IOAQ 2D3O1 1EETB 4I56A 1EB0A 3MTJA 4PWUA 4OZ1A 3V6DA 3MCNA 1FKAF 1HNWF 3MXHP 3QO9A 1U0SA 1HHTP 4ZIVA 4DPYA 1Q86T 3FBEA 3PYFA 2MSTA 3I56S 5J2NA 2DR5A 4IRDA 1S72S 2HQGA 1SJ3P 3EPIA 2E9RX 2HQ3A 3GWCA 4B3TF 3Q8QB 3I0SA 4FDFA 1X9MA 4IO9Q 1KQSR 2DGQA 3FCVA 5DDPC 4FKYA 1QTMA 4ALZA 1XR6A 3V6DB 1K47A 2KU7A 5CD4A 1HNXF 3NMAA 1ZS6A 1PO6A 2LEAA 2XYHB 1VGYA 3AD8C 3T1HF 4YFUA 2FVRA 1F9EB 5LSRA 2ZH2A 1S77D 3G4SS 1BD6A 3O5TB 5HATA 5IT4A 5I42B 4EYHB 2I8EA 1T3NA 4X4NA 1QE1B 5LMUF 3W5XA 1UPMB 2WSCC 3DLEB 4PR6A 2AGOA 4FF2A 5E0OA 3AHPA 1XNQJ 4RW9A 2FD2A 5JVHQ 1VLYA 4ZPCA 5D4LA 3MCOA 5H9EJ 1VRTB 1KDNA 5D15A 1S1TB 2BANA 2WCXA 2KH9A 1S49A 2BOAA 4LFBJ 3OL6A 2CNKB 2CPJA 2CKWA 4EGLA 4J9KA 3BBBA 2ZD1B 5CZXA 4ZCMA 4N7TA 4IRCA 3IC1A 3VAIA 2F5GA 2KKHA 1GMWA 1FO1A 1PILA 2MKKA 2F65A 1FRJA 3TZYA 1C0UB 1S7IA 2DITA 2ZUAA 4LVNP 2M9KA 2MQ8A 3OV7A 3U7JA 3ZZPA 2PSZA 3KG0A 3DLGB 1W25A 2AJ2A 1NDCA 1YJNS 1CULB 5DM6Q 3UDEA 4B08A 2MLXA 3MD3A 3X3UA 4A8QA 1QE1A 1WUUA 2H5JB 4EZ6A 2W4PA 3OUYA 1FTCA 4XTTA 1J2VA 3QGIA 3NS5A 2RUSA 1LW2A 4F2SA 1RT2A 4P52A 1IKWA 4ZVEA 1LW0A 2EC2A 2C28A 3S1TA 4Q45A 2YVSA 1SKRA 2CPEA 3Q8YA 2RAQA 3OTOF 4I2QA 3W9IA 2M52A 3G8TA 1NK8A 2Z8QA 1PBUA 1JLCA 4USHA 1U49A 2F8MA 1UP1A 2LECA 2YY3A 3LW5C 2YNGA 4ZLJA 3KLHA 2MB0B 2IA0A 4P6QA 3SXLA 3OSPA 3MEDB 2V8PA 1IKXB 2K1RA 3EMTA 2QT7A 4O4RA 4PXBA 5ETOA 2GVDA 1S10A 4OYMA 2GAHC 3WC2A 2CPIA 4I0WA 4ZP7A 5A2QU 2DNYA 3CCLS 3GIKA 4MK8A 4W90B 1URNA 3TAMB 3D66A 1TVRA 3QO9B 4Y65A 2Z58B 5L38A 4TU8A 3I5AA 3OTEA 1FKOB 1BQMA 1T9WA 1WG5A 2MKJA 4DL0C 5F0WA 5ITHA 5D78A 4WXWA 2N7YA 4JI6F 3JSBA 3R7NB 4DF8A 1N6QB 3W2VB 1IQTA 4QCLA 4BHQA 5CA5A 4A8MP 4KGMA 3PW4A 3CXCR 1AYEA 5BR8F 3RBDA 4PWDB 1OS5A 5GVQA 3TQ1A 4DX5A 3JXOA 3KNGA 2R42A 5J1NA 2XS5A 2FLOA 2E5LF 3GMGA 3VZIA 4W4MA 5K5MA 1NK0A 1V5IB 2DR8A 1WG4A 4HHUA 3G2XA 4DWIA 1BE4A 4RNOA 3I5CA 2G9OA 4Y34A 5I3QA 3FSIA 2R7RA 2E5LJ 4PQUB 1FNMA 3M8WA 2OH2A 2UP1A 3M2RB 1KQFB 4HEA9 2DVIA 1RAOA 2DGXA 4ECUA 3V81B 2P9EA 3U1LA 1UETA 2KZMA 3QT8A 4RW6A 1ZTWA 3BSAA 1GMUA 2Z0GA 1K8AT 3NNCA 2OPQB 3QPIA 1VR6A 1TV6B 2RKIA 2QL9B 3A8KA 3GJQB 1M5SA 4OJ1A 4CT8A 4ED2A 4JOUA 3IM8A 4L6V3 1H74A 5DS7A 1HNWJ 4CLSA 2BE2A 5AJ3J 2ERRA 1CJUB 3M6WA 5HROB 2COLA 2FVCA 3CIZA 4DR2J 1JX4A 1VQ9S 3ULHA 2R9LA 3AD9C 3QAEA 3PYEA 4UUXA 3V4MA 5AXNA 3BJYA 3QFWA 2BYCA 3MR3A 4TVAB 1FKPB 2HHUA 5C24A 2J8AA 1NDKA 2F40A 3DU6A 1NNDA 1SJ1A 2F7VA 2D41A 3FSYA 4X64F 2EG1A 2UXDJ 2DY1A 2PC6A 4DCPB 4DL7A 3MM8A 3M1VB 1SKUB 4ZP8A 2MQMA 1HMVB 4NLOA 1TL7B 1VIXA 5MLCV 4RW7B 1S9EA 4DR4F 3C3LA 4QWCA 3CDAA 2E29A 4U8VA 1RGVA 4RW7A 5L1JA 4LUBA 2HHSA 2MPUA 4ECXA 1JJ4A 1R43A 3DMJA 1R0AB 4TQSA 1XWLA 1Z2ZA 4DCJB 1TL3A 2CJKA 2I9SA 2HZVA 5CYMA 3HSZA 2DR9A 4LJMA 2FDNA 3FEYB 3UN3A 2LXFA 5J2PA 1NK7A 3K0JA 4KRWA 3IS9A 4JB8B 4J91A 2VF3A 3J81j 2ZH9A 1OO0B 2LXIA 2H9ZA 1UZHA 4DV6J 4YOEA 2LKZA 4CH7A 3BQ1A 3QATA 2Y1JA 4AL5A 1RAJA 2YBVA 1NKCA 5DQHA 1CPZA 4M5DB 4LF5J 4WZQA 2MZTA 3GYXB 4NEYA 3M8YA 2HGNA 4RPFA 2BXJA 5CYQB 3BDEA 3M8PB 3RBZA 5IM0B 2VICA 2YWKA 1N34F 5E5NA 1CJTB 3M8RA 3CGIA 1I1GA 2PA8D 4O3OA 3BSNA 2NXUA 4O4GA 3E01B 4RNMA 1F1BB 3RJMB 4A8YA 3UD4P 4RW8A 3KJQB 1RP5A 3C66A 2CQBA 3Q83A 1XR7A 3EZ5A 1X5TA 4GKJJ 1TP7A 5KG5A 3R5CA 2CZ9A 2G1DA 1MU2A 5CCMA 1B7YB 2BZ2A 2HRTA 4B3MJ 3SCIE 3V81A 1U4BA 4DBQA 1UEUA 4DX6A 3KFWX 3S6EA 4GVBA 2B43A 1Y3JA 1FX2A 3CW2C 2FIUA 2P9CA 2VFRA 2X3DA 3CDEA 1ZA2B 2PIIA 1FXRA 3BGUA 3HCXA 1WOSA 3IWXA 4LSLA 3VVUA 3IXQA 1QUVA 5F9NA 1N6QA 4OYBA 5IT9Y 2ZH7A 2HHHF 1Y7PA 3M2UA 4Z2XA 2X51A 1NCLA 3RRKA 2CQDA 1N5QA 1J5OB 2HBZB 1KQKA 2MHEA 3TQEA 4YY3J 5HP1A 1NM2A 1DQAA 4DN0A 4OI3A 3UPFA 4OHWA 2DISA 5HLFB 4QPTA 3NGSA 2HRYA 2H4WB 2IAJB 4HACA 4ICLA 4B3OB 1EARA 1SJRA 3M32B 3MCSA 3L3CA 1YRTA 4K4SA 1UVJA 4QR0A 2MJNA 4IQXA 4L72B 1N8RT 4PCQA 4RBVA 2R2RA 1KRPA 5IQ6A 1PBAA 4ID5A 5E3RA 1SVDA 4H4OA 3TR5A 4ER8A 1RTZA 1O6XA 1FJGF 2WZ1A 4USUA 4LF5F 3MMAB 2CAJA 1WC4A 5LSOA 3GIIA 3MECA 3MMBB 3R5BA 5AT1B 3U02A 1U7LA 2C2ZB 2QA2A 5C42B 4QZVB 5IZHA 4UY85 2IY5B 1RAGB 2CQ3A 3EYZA 5L1KA 1CJKB 2QL5B 1S1UA 1WEYA 3JSRA 4EYIB 1SH0A 1PCAA 4LF2A 4ZLNA 3H5XA 3ET6A 4MK9A 1H2TZ 2XG8A 4IFYA 1RWNB 2XO7A 4ITSA 4A8WA 4JI5J 2GQQA 3T5KA 2M2BA 3T19A 3RG6A 3I9ZA 1Q8BA 3CEDA 1QAYA 3HHKA 3NCPA 3Q8RB 4UOCA 2DGWA 2Z57B 3KLFA 3V6JA 1HFEL 2ZH3A 4ZPVR 4LR7A 4M5KA 3PKMA 5G0RA 2VPXB 5KFPA 4P2SA 1LK7A 2ZFHA 4LFAJ 3UNGC 1V3RA 1RCXB 2FGOA 2P8IA 2W2MP 3PVXA 1U1RA 4JI1F 3TARA 2GIFA 2NXNA 5ETVA 1TL5A 2ZKTA 3KK1A 2ZZMA 1F2GA 3DLJA 4OFZA 3UN2A 4ID8A 3TYTA 4JI2F 5LXRA 5EWFA 3W61A 2IM3A 3I82A 9ATCB 3RZAA 3US5A 1SJ4P 2FJVA 4Y2KA 5DDQC 1VJWA 4A8KA 4DSIA 2GO9A 2NPFA 2ZVIA 1PAEX 4WCEQ 3UR3C 3M8ZA 2D3OR 1JLEA 2VC0A 4YR3A 1FFWB 4XAKA 4FVCA 1HWUA 1M1GA 3MM9B 1F5BA 2GX8A 2C2DA 1T7PA 4K0KF 3UR0A 1UVKA 5HL7Q 2GZOA 5DRKA 3K57A 1FJGJ 1S9FA 1HI0P 4OHZA 2MLZA 4RKUC 2OPSB 3G6XA 2CZVC 2ASJA 2BR0A 2O01C 4B9UA 2RDDA 2JJ4D 3H2UB 3SCLE 5A8RB 4JV2A 1X31C 2ABYA 4KGKA 4BC9A 3M9OB 2PI5A 4WXOA 2HAIA 2NXCA 4PG4A 5I3PA 2K06A 4GC7A 3AOBA 3DOLB 2SXLA 4I64A 4WP8A 2GHPA 2J8SA 3LP0B 1U6BA 4CDIA 2J0WA 1Y5IB 2WSEC 3KHGA 2NSCA 1WHWA 3C6TB 3RU0A 4NRTA 1NK5A 2HW3A 3OVSA 4LRBA 4OZLA 3I5BA 2OPSA 1Y0HA 4L76A 2C2RA 4DUYJ 5ETNA 1SQEA 2OAUA 4OI4A 3MR5A 3ILLA 2HG4A 4HTIA 3LP2B 3IWLA 5L9NA 1DZ5A 3GV5B 3HSDA 3ITHA 3ZTSA 5HJXA 5DO2A 3VWSA 3B82A 3MFHA 3MD1A 1WHYA 3W7BA 3RW6A 2QO3A 3M32A 5CCLA 3OVBA 1HYSA 1U26A 4JV0A 2CVEA 4DSFA 3TI0A 1OIAA 1OPIA 1VBZA 2H5EA 3G6ES 3DOMA 3HVAA 1TU0B 1Q78A 4LF6F 5IT9U 2M3DA 4E2FB 4MFBB 1RWOB 1Q81T 1HQ2A 3R1HA 2MZ1A 1D9DA 1YJVA 1WEZA 3A13A 1RAAB 3QGGA 1TMMA 2CADA 3DRSB 3IRXA 1HPZA 5F3ZA 2GHWA 4OX7A 4RBUA 1Q8IA 1WC0A 2YKNB 1YJUA 4JYAF 3DHXA 2CJQA 3K8WA 3GU0A 4K2JA 2RRAA 4CLLA 3JQKA 4EEYA 2ZZTA 3BGRA 4ANDA 3TUZC 4O4GB 1Q7YT 2VUGA 3QJPA 2E1AA 3HHLC 2UXCJ 3QLHA 2HNDB 4Q44A 4ZDNA 1N5SA 3CE8A 3ZTOA 4C11A 2VIHA 1FRIA 3HHLD 4XIUA 2HPUA 2YWHA 3BKFA 1XIQA 3H59A 1JLGB 2ZDOA 1YTYA 3IAM9 4CLUA 5DG7A 2LP4A 4A8XA 2ZBRA 3J7A1 1CC7A 2M70A 4ANEA 4NLPA 1S6OA 1G7CB 3PEJA 4Y2AA 1PG5B 1M5HA 4OZJA 4OX9F 1QJHA 4I67A 2Z2YB 3P6YC 4C3KA 5A8WA 3RB6A 1YG0A 4LF4J 1Q1KA 1SC1B 1A6LA 1GFWB 2KRBA 3KG4A 1N4LA 2E9ZA 1QAXA 5D4NA 3W1YC 5K9FA 4DR5F 1HNIB 3CCVS 1NKEA 1IVZA 3BYRA 1RTIB 4KO0A 4Y00A 4OI2A 1K1QA 2JNJA 4UQTA 2LU1A 5KFWA 3J80Y 4L75A 1EP4B 4OHXA 4TY8B 5A6PA 4IRKA 2C2EA 2JRSA 3GQCA 3DLHA 5J2PB 1H73A 2FHJA 1RADB 4K2XA 4HTJA 4G1IA 3CVKA 4I68A 4ICLB 4LT6A 4NX9A 3WQPA 2C2MB 2KVQE 1NJXA 1IBLJ 4YB5A 3DI6A 1MMDA 3MAAB 5L46A 2L9NA 2FLLA 2W4CA 1GTEA 1VJQA 2HK3A 2HFNA 2WB4A 1MMNA 4OX6A 4W92B 1J5OA 1NJWA 4NLQA 1Y4ZB 1CVJA 4KO0B 2ZEJA 2B5JA 2DGVA 3M8QA 2CQ0A 1GMVA 3M1VA 3MM8B 3MM7B 5D4PA 4U96A 1E6YB 4K5RA 3LPEA 3BEGB 4MTPA 3FGVA 3CJKA 4CRJA 2VQFF 1LNQA 5HMXA 1TKXB 4RW4A 2LFVA 2YKNA 3QBCA 1HBMB 1O51A 2G1HA 1YJWS 3CJ2A 1JQGA 1RU2A 2VG5A 5HBMB 2UUCJ 2UXBJ 2KO1A 1JLQA 4ZVOB 1S6UA 1IKYB 2RQ4A 3G8SA 4P75A 3DRRA 3RAMA 4WKRA 2HVDA 2V0NA 4ZCIA 4C4WA 4LBPA 1HI1A 5LMNF 2DXFA 2R7OA 1C1BA 3QJLA 4V19X 1X0PA 1EJ7L 1HW9A 2IRYA 3BZQA 3I6PA 3JSMA 2QJ3A 1SUQB 4IQMA 4RW4B 1FHTA 2EKNA 2GJIA 4OQJA 5T7LB 1TUGB 2XBPA 4USIA 8RUCA 2XGQA 2E5HA 3MPVA 5B0BA 3ISNC 5E7OB 1V6HA 4QR2A 3GG1A 2KXNB 4G1PA 3W65A 2VQEJ 1KLMB 3GIMA 2DHSA 4DG1A 5IC6B 2FYXA 3ZZZA 3KLGB 4UTGA 1Z2LA 2HZCA 2KN4A 1XBWA 2J5AA 1TMJA 1TZ0A 4UF4A 1QSYA 3TW0A 2VC1A 4BS2A 3D7SB 1MSWD 2NUUG 4WE1B 1IN0A 2CPDA 2HS4A 3DOMB 3FMBA 4YB6A 5J2MB 5CYMB 4JV1A 5I3UA 3CO0P 2XI3A 3FMWA 5M2RA 3EDRB 5GAEU 3UNYA 1WC3A 3SIPB 4J37A 1WWHA 2HHPA 1YJ9S 5G4DA 1VQYA 2QMWA 2XMAA 3KWMA 4OYIA 2FJBB 1B3TA 4A4JA 1R89A 4WBFA 1WORA 4DOZA 4ZIWA 1XERA 2DH8A 3CJ8A 4JI2J 1NPKA 1U1MA 1L3KA 1RTJB 2AZ3A 2VA3A 1Q4RA 1I3OB 2QLJB 3OFGA 3J7Z5 3D0GE 3IG1A 4F3QA 4QWEA 2KFZA 1K1SA 2Y1LB 3HHLB 1JLEB 1H0HB 1X4GA 2B3TB 4EI2A 5H9FK 4QU6A 2IM1A 3UDLA 1U1OA 1S9GA 2RF2A 1FX4A 4B3SF 3VR1A 3NOCA 1HBOB 1D9FA 2ZH4A 3KUEA 3MEGA 3Q22A 4DQQA 3QLHB 2JL9A 2ATCB 2ROGA 4DR1J 2BM0A 4QWDA 3FCHA 2RJZA 1P9YA 5E3CA 4ZVPB 3HX9A 4OZ3A 1W2IA 3DCAA 3MPUB 2E5GA 4DN9A 3WX8A 2VDIA 4PQAA 4X2BA 4X4PA 3M8SA 2XY5A 3MM9A 4ED8A 1UCNA 4PG7A 3Q89A 4FKXA 2V2KA 3TRGA 4IFVB 1B7FA 1WI6A 2FHJD 1LXJA 4LFCF 1EQ0A 2ILYA 3V4IA 5KFTA 4J5OA 3CC2S 5T14A 2QA4S 1X4CA 4DI6A 1S0OA 1FEEA 1Q95G 2ZOFA 1TL4A 2J9CA 4URSA 3SDEB 5KFGA 2YX7A 1NDPA 1KHWA 2ZJQQ 4C3LA 1WC5A 1NRKA 1S9GB 2MGZB 3R1LA 4PWDA 4DSLA 2ZD1A 5ETQA 3ZZ0A 4K4VA 3CJTA 5D77A 4EO6A 5KFCA 5G0RB 4YR0A 3V6HA 4A47A 4F2RA 2ZOGA 3AJ2A 3SMZA 1YBTA 4RU9A 3F44A 4K4XA 3PXGa 3MECB 3MMBA 4DSJA 4DSKA 4O23A 4XK8C 1HD1A 4FS2A 2GA7A 2JEGA 1S0VA 2W9AA 1Q0NA 4RNNA 3W60A 1HD0A 5LMNJ 1T9YA 3WX4A 2UUAF 2OELA 2OPRA 3JS9A 2HNZB 1TR0A 4OX8A 4ZCKA 1E6VB 1WHVA 1B0PA 1H2VZ 1JLFB 2BJ7A 4HH1A 3OL7A 3OSNA 2EFGA 1P8GA 5GMEA 3CCES 3PX0A 4FF3A 4DR7F 3EVOA 2XYPB 3M7VA 3ZNJ1 4PUOB 2CJYB 4AUKA 2B0GA 4KHPF 4B3OA 1HWIA 2RVJA 2X1GA 4OZNA 3IN5A 4EBEA 2ZHAA 1Q16B 1U25A 2AJFE 3B4MA 3K17A 3QFHA 4I6YA 2VV5A 3MCMA 3HHEA 1ZAXA 3C16A 2AYBA 5KFVA 2JZ5A 4PXDA 2FHKA 2V8DA 3GLJA 3IFEA 2V68A 3MHYA 2PMWA 2GMHA 3PHTA 5ETLA 1XMOJ 1D1UA 3OVAA 2QMUB 5KG1A 4GC6A 3FZ2A 3H40A 3GYNA 3T6BA 1ZOTA 4DQRA 4LIWA 4IYQA 4LSNA 5H1SV 8ATCB 2XZDB 2HFVA 4PUOA 2BJ9A 3FNNA 3PJWA 1VQPS 2AJQA 2RHSB 2BJ8A 3DOLA 4Y28C 3W66A 3HT3A 1BXNA 1RT5B 3KMSA 3C14B 4HH0A 4YP3A 3Q0AA 4X4RA 2LEBA 2OPRB 4GO7X 5D3GA 4Q0BB 1T05B 2AX1A 1FFGB 2U2FA 2HKEA 2OSRA 4M5HA 4U67Q 1YK9A 2W2PP 4OHYA 3FRZA 3RRGA 4ECQA 1FNOA 3K89A 4OJHA 5KG7A 4TU7A 4PPDA 2LQJA 4X65F 3WDOA 4MIBA 2V8HA 3ZZOA 4B9MA 4PYDA 3W9JA 3T1HJ 1NSAA 2A2CA 4RL1A 3AOCA 4OYAA 4B9VA 1RUSA 1U6ZA 4EMDA 3KDOA 5DDRC 1M1HA 2UUAJ 1FFSB 2IRUA 1WTBA 3CD7A 2ALZA 2J0XA 2GGPA 4ES2A 1HHQA 4KB7A 4M5IA 2C3MA 5FD1A 2VODA 2HGMA 4K8RA 2CVIA 4ILLA 3MPYA 3MR7A 5F0UA 2BJ1A 1RWMB 1HR0J 2XMUA 1C1CA 4DPOA 3PNIA 5KFQA 2M8HA 4G65A 1N33F 5KT5A 2O66A 4FYYB 3OHBA 1KHVA 1GH8A 2NPIA 3ILJA 1CJVA 1S1WB 2D3UA 4J90A 2EFNA 4I4BA 3W3SA 1HWLA 3MM7A 2GVZB 4URQU 3KLEA 1W26A 1RBLA 2DB1A 3H5UA 5DG8A 2KFYA 4Y2MA 3K8VA 1ZM2A 2J9DA 2KRRA 1ACMB 1PYOB 4WFBQ 2XY7A 3L7OA 1AROP 2KG0A 2QTWA 1RI7A 2VPWB 3SFGA 3VF0B 2ZUGA 4DPXA 3AQOA 4C7QA 3GILA 2CQPA 2F9JA 3PFEA 4DQPA 2JC0A 4IG3B 2L48A 3QIPA 3PRBA 4OIXA 3V2UC 2H4YB 1FWKA 3BH6B 1Z1ZA 3PACA 4WFXA 3KK3A 1RACB 4LREA 1S9EB 1PJ7A 2FHMA 2IVMA 2C22A 4K4ZA 2HQFA 1M5PC 5F8JA 5HAOA 2YWFA 5DZ7A 1S59A 3B78A 3HJFA 5T7LA 2EFOA 3EWGA 3TA1A 3JAMU 1IM6A 3CCRS 5AXMA 1AT1B 4MT1A 4YUDA 2HMIB 3DRSA 3IRXB 4H4MB 1RT1B 4NXMJ 2EVZA 2CQ2A 4JI8F 2IYIA 3Q24A 5L1IA 2CUYA 4ED6A 3IBFB 2P2CB 9RUBA 1IR0A 4WFNQ 4A46A 3ENVA 5L1LA 1U6FA 3EGVA 4NA2A 4DV6F 5HQLA 2GIQA 1IBKJ 4ETZA 2BE2B 2VD3A 1S1VA 1KEKA 2ACYA 2HVEA 2CPYA 1CJTA 2IHR1 4R5PB 1F5CA 1N33J 1GMWD 1GXLA 2QC3A 2RKIB 3KYLA 1QY7A 2N82B 4RO0A 5KFOA 1W2BR 4YDDB 3OLBA 2JH3A 2IC3A 3AJ1A 4WP9A 3PV8A 2LVWA 1LFPA 2B7BB 4PG5A 2XULA 3UE2A 3VZHA 2AT1B 3W8GA 2VPZB 3GJRB 3NGTA 5EX3A 3OJUA 1WJ9A 2MQNA 3MPWA 1KONA 1TVRB 2KI2A 3CJ3A 3DRRB 2YX1A 2XYGB 3HSGA 4Q2LA 5B0FA 3T9NA 1PGZA 3WC0A 3CULA 1WG1A 3H5YA 2R8HA 2O67A 2CNLB 4NYOA 1YZ7A 5BXIA 3J81U 1WEXA 1IKXA 3DOKA 2HZAA 2A0FB 1Y11A 3HVRA 2AGQA 4RBTA 3M6XA 2D9PA 4OYOA 3BDPA 2BBEA 5KFHA 4ED1A 4J9RA 1Y3KA 3ONQA 1I6JA 2DGUA 2IJNA 5AJ3F 3F56A 4KT0C 3DC2A 5HANA 4DFPA 3EGZA 1S0MA 3J7AN 1B0TA 1LW2B 2QA1A 2WONB 4WJBA 4R25A 2QEXS 4FYDA 3U27A 2C2OB 3FZBA 1T8EA 3A4TA 5GADI 2QLFB 1S12A 1FJCA 4USKA 1NKBA 3SZ2A 3Q2SC 4KBIA 5KFEA 3AXMA 3G86A 3OR1A 3JB9k 2C42A 3KLHB 2JLEA 2J0QD 3X1LB 1HL6A 4JV5F 1FE0A 1TL7A 3CO9A 3TVZA 4F04B 4TXSA 1RTIA 4IKAA 4K5SA 4WKYA 5A8RA 4AL6A 1FCAA 3LAMA 1X5OA 1HNIA 3M30B 1OYEA 1RZMA 3SSQA 4DR7J 2B9YA 2R7XA 2KTQA 4YEAA 4NI2A 2V2QA 4N8NA 5DG9A 4WF9Q 2Q3PA 2QZ8A 1NSQA 3D3BJ 2HNYB 3VQSA 5HI7A 2CG8A 1KD1T 2X7IA 2ZC3A 4X4QA 1LEOA 1R8PA 1Z4UA 4DX8H 3PEHA 1VRTA 3TZZA 2AHOB 3AA8A 3WIUA 1N5YB 2E1CA 1M5VC 2EC0A 2CJ9A 1YSJA 1ZM3A 2V9WA 5LJ3Y 2L08A 2R7WA 4MAKA 3PFOA 2DNZA 4C11B 3QT7A 3HD1A 4F4YA 1ZAWA 2I6WA 3DGVA 1R0BG 1NEEA 4PXCA 3SFUA 2N3OA 4F25A 4HVZA 2Z56B 2ROPA 1ELOA 3O1LA 4U6PA 3B54A 1RABB 4U95A 1UW9A 2WK4A 3R2CJ 4DR4J 2RQCA 2V67A 2XZTB 3CUNA 2HFOA 3RAQA 1RT4A 5DLGA 5JUMA 1RT7B 3AB4B 4FPRA 4XDCA 5KT6A 2MQPA 1HIYA 2CQHA 2FJAB 2UXCF 1ZAVA 2OPPB 1R6YA 2P9GA 3BGLA 4KSEB 2VBXA 4ZVSB 1SI9A 4NLDA 4X66J 4CZCA 1FDAA 2GW8A 2W2OP 3KK2A 1IR1A 1RKIA 1H7WA 1XN9A 1KNZA 1K0TA 2ZITA 1CJKA 2W1BA 3EE3A 1S97A 2W9BA 3ITHB 4QIFA 1ZTTA 4NCBA 4V19J 1N34J 3RBEA 1G1XA 2WOMA 1X4FA 1XJWB 4K7QA 3TA0A 2OUGA 1LW0B 3R9LA 1JIHA 1AFJA 5IQQA 1IBLF 3OD2A 3U1MA 1TK0A 3FQLA 5GAGI 3TAMA 2BOPA 4NLYA 1TTHB 5IWAJ 3LO3A 1IQZA 2XNQA 1WD6A 2HNZA 3V5RA 2A10A 3RRHA 4DF4A 3GP9A 3Q23A 1FVQA 3IM9A 3OFFA 3VGSA 3QYYA 3CWJA 4OYXA 1K73T 3J7ZT 3T3FA 3BN4A 2DD8S 3NWGA 4ZJOA 3SDEA 2CQGA 4I69A 2DRAA 1MU2B 2VB6A 4B3RF 1B4SA 3MURP 3E2EA 2B4UA 4DCOB 3WZ0A 3R7BB 2DNOA 1EHWA 2R7QA 1R31A 2MTLA 3CB4A 4IH6A 1P9QC 1UFWA 2RB7A 1OMSA 2CPXA 2BRKA 2IM0A 1PAUB 2QV6A 3GONA 3R7SB 4C6AA 4RWXA 2RU3A 2HYIB 4TY9A 2AD9A 1WTFA 2CPZA 3PDNA 4HYKA 2XSJB 2VFUA 3ETOA 4JI3J 1UJ6A 2ILZA 4WP3A 3BPDA 3C19A 3CCSS 1R27B 3GV7B 2HHWA 1K9MT 4U7UK 4IFVA 3TO8A 6AT1B 3DLEA 4WYWA 3B8HA 5ETRA 5ETPA 2ZNZA 4LMZA 2G4BA 2DNPA 3HKZD 3JAMY 1FD8A 5F9LA 3KK1B 4ZHRA 3TAPA 4NLVA 1B70B 3HZGA 4OJ3A 5CH7B 5KFAA 1GX6A 3UCGA 2AKWB 3HM9A 4LR9A 2OMOA 4OLPA 1XNRJ 2RD5C 4FBUA 2U1AA 3C46A 4P10A 3KXDA 4NA1A 2ZBCA 4JI0F 5KFNA 3GFHA 3TJ9A 1VC0A 1N56A 1N0UA 4CTAB 3OTOJ 1M5KC 3D6HB 2FC9A 1YI2S 1SIWB 2UVVA 2V6AA 3LGHA 3QJJA 4DZ6A 3EXYA 3I0SB 2VPYB 1Q8KA 4NZ7A 3G96A 3OXGA 3P45B 5IC4B 1SKSA 5CZVA 4HI2A 5A0YB 3TANA 3D28A 2YKMB 2RF2B 3FBFA 4DUTA 3R97A 3KMQA 1OY8A 1S1UB 4JYAJ 2AP6A 2IJFA 3ZTPA 2UXDF 3DFEA 1ZZNA 3HHLA 2KYXA 1ICEB 1O8BA 3SSRA 4ECRA 2DXEA 3MUVP 3W5ZA 4OX9J 4CM0A 3D9BA 4QYZJ 2HQCA 3KJFB 1QSSA 3MDFA 5L39A 4DR1F 3M9NB 2LLZA 4M5MA 1F9FA 1RTJA 2HS3A 4Y3CA 5U47A 4CM2A 4QPXA 1TFWA 1XK8A 2QA4G 1YLXA 2DGSA 2DGTA 1RHUB 3GG0A 3HMJG 4NASA 5IV4A 2O1PA 4PG6A 2FVPA 3AD7C 2MMYA 3KJVB 4O0NA 1RAIB 3OTBA 2XEXA 4HI1A 2JVOA 4NYPA 3SV3A 4FF1A 2BKNA 2DCUB 3CD0A 2VH7A 3R3TA 2BW7A 1X5PA 2GQCA 3DDKA 3W9HA 4Q5VA 4R0JA 3CDUA 1SIZA 2IYGA 2V4RA 5D8HB 1RWKB 2HVZA 2RDJA 3HT0A 3K5PA 3QRPA 2JEJA 1VI7A 2HURA 4OYPA 1QDUB 2CXEA 1SKWA 5F8IA 1VQKS 2B4OA 1XR5A 4R5PA 1SPBP 1AUDA 1KR4A 3LF0A 2F1FA 2BDPA 5KFFA 2MSSA 3OLAA 5F8MA 5LXYA 2BA9A 2CPHA 2H51B 1NHUA 1X4DA 2OKQA 3H20A 1WKKA 2CA9A 2I5JB 2OO4A 1AZSA 2OEKA 3GSDA 4CYUA 1GK8A 4AXIA 1LWFA 4Q8FA 4JV5J 1IKYA 3N6NA 1NLKL 3CMAS 2AEMA 4WIIA 5EN1A 2K7KA 2GFFA 4H4MA 3O44A 4KGXB 1FKOA 2Q6CA 1U8SA 1ZBTA 1HBMA 4RJVA 2HK2A 3OPKA 5C2GA 2PI4A 4TYAA 2XNRA 2DKOB 1HNXJ 1LWCA 1IBCB 2QG9B 3C15A 3DLKA 4PAAA 4W98A 3G9CA 2C3UA 3ZZUA 4F4KA 1HWJA 2OI2A 2ASLA 4OV1A 4U7CA 4DUYF 2XZWA 4DFMA 5E3PA 4LBIA 1FK9B 1RCOB 2PN6A 1CG2A 5KFSA 5LOQA 1FI4A 1TKXA 1V3ZA 5HVFA 5BJRA 1KOHA 4IUFA 1ZH5A 1S1XB 3C2PA 1YHQS 2AMCB 2VL1A 1T3OA 4CLPA 3DI6B 4UZBA 2VQFJ 4ECYA 3MTKA 3N4WA 1T0TV 3PIPQ 2AIRB 5EX0A 3KLVA 3BO3A 3TAQA 2CDRB 1Y10A 2WW4A 2IDLA 5M2PA 4DV0J 1RA7A 1SC6A 3UD5A 2Q1LA 1T9TA 4X4OA 2GO8A 2KM8B 1HHSA 1TL3B 1ULRA 3T9ZA 1WF0A 4XO0A 4Q7AA 1VDHA 2HFUA 2NZCA 3DLGA 1CJVB 1S1WA 1ZZFA 3G82B 4ZPWR 5GAGU 5HQ8A 3CT9A 5BYRA 1CJUA 1BHNA 2W7AA 1NMEB 3CIMA 5E2QA 3ICLA 5JXSA 2RT3A 2GVZA 3EXCX 4TN2A 4JI3F 1CS4A 5HMYA 4J9OA 2PA3A 4QW9A 2UUBJ 2QX0A 1SH3A 1XQIA 5ADZA 4X65J 2OEMA 1JLGA 4M5JA 1T9XA 1V9OA 1FKPA 1UEVA 1WACA 2KM8C 1PYTA 4WZMA 1DARA 2ZH1A 1V5VA 2ZJRQ 2Q6BA 4P73A 1RTDB 4QWAA 4J9UE 1X60A 2DNLA 4MKVA 3CCJS 2HHHJ 5B09A 4B3SJ 1FA0A 1HLWA 3MUTP 1RAEB 4O3PA 3T1AA 1R8HA 3M2VB 2FC8A 3CCUS 2RRBA 3IO1A 4ZPAA 4PZVA 1VFJA 4C48A 2EBEA 1HNZJ 2VOPA 4FXVA 4KYZA 1NHKL 5KFYA 5B0CA 1MMLA 2PEHA 3L7UA 3G71S 2JEFA 1HNZF 2IJRA 4ZOSA 3ZTRA 3TA2A 4A48A 1J5EJ 2OEJA 3L95X 3LAKA 1U1NA 1RISA 4KPYA 4P2XA 1IKVB 4DV0F 1AZSB 3RB4A 5KT3A 3EGNA 4ZVUB 2RRNA 4X4VA 2I0XA 4LF7J 2DNKA 2E5JA 4IH7A 4ZVTB 1EKSA 1TK5A 4N41A 1EKRA 1VYAA 4NRUA 2L41A 4DV3F 2BQRA 4MYUA 4LF6J 3VAMA 2JEIA 2R7TA 3LUYA 3D1OA 4AXJA 2XLKA 3PIOQ 1NK4A 3GTYX 3HFVA 4PWWA 5C5JA 2OP5A 4DV1J 2O3DA 3D6MB 4J9PA 2N3LA 4GRSA 1GX5A 3NGDA 3QZ7A 2Y0BB 3I9V9 2EK1A 2NXEA 3KJNB 3MEEA 2DNNA 2QIFA 3PKYA 2HHVA 1DHMA 2VG7B 3T5LA 5M2UA 2YKPA 1Y5LB 4DV2J 2R8IA 2FJDB 4FBTA 1SCJB 2K1RB 4BLGA 2W4DA 4HT5A 5GADU 5KG3A 4DR6F 3PR5B 4FXWA 5KOWA 2VFVA 4DV2F 3NY0A 3C16B 1NJYA 4MKBA 3ZNUA 3I0RA 1X8DA 3CD6S 5SUHA 5K8PA 2ZJPQ 1JJCB 4ECWA 4FN5A 4IR1A 5F8GA 5E3AA 1RT3A 3PJ9A 4DMZA 3EUNA 2HVHA 2APOA 2B6AB 4CLTA 1MW7A 3FSXA 4IH5A 3OXFA 1DRZA 2DIVA 4GKJF 1SJQA 1HBNA 2XWYA 4CP5A 3BV8A 3LA0A 1F3VA 3L09A 2V8GA 2IVFB 3AOAA 1BUXA 2VHGA 4ED0A 4OV6A 1R8BA 1C0TA 3VAKA 1B99A 1T9VA 1VISA 1VK8A 1WOOA 1FERA 1WSVA 1YVFA 3L4BC 2ZKUA 7FDRA 4S0MA 1FJ7A 4ENOA 3AJDA 2KZZA 2CQCA 1ZM4A 1VRUA 4D3HA 4RWWA 1KC8T 4WFYA 3QZ8A 1RT6A 3HFZB 5E3QA
chains in the Genus database with same CATH topology
1Y10A 1WC1A 2QV6A 4OYWA 4OYZA 1Y11A 1CJVB 3G82B 3G82A 4WP3A 1CJUA 4WP8A 4OYOA 1CULB 4CLYA 1U0HB 2GVZA 3C14B 1CJTB 1CS4A 4USTA 4WPAA 1YK9A 4NI2B 4P2MA 3MAAA 1U0HA 1WC3A 4OYAA 1FX2A 4OYIA 5D0GA 3R5GA 1TL7A 1WC6A 4USWA 2GVDA 4OYMA 4OYBA 1AB8A 1YBUA 4NI2A 4OZ2A 3UVJA 5D0HA 3MR7A 1CS4B 1WC0A 4CM0A 1FX4A 4P2XA 4CLLA 1CJVA 1AZSB 4CM2A 4CLKA 2GVZB 3C14A 5IV4A 1CULA 2W01A 4CLZA 5IV3A 3ET6B 2WZ1A 4USUA 4OZ3A 1WC4A 4CLUA 5D0EA 2BW7A 1CJKB 3UVJB 4OYPA 4P2FA 3ET6A 4CLSA 2GVDB 1CJUB 1WC5A 1AZSA 1CJKA 3C16B 1YBTA 3MAAB 4CLFA 3C15A 4CLTA 4CLWA 5D0RA 1CJTA 1TL7B 4OYXA 3C15B 4CLPA 4WP9A 5D15A 4USVA 3C16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y10 A;  1WC1 A;  2QV6 A;  4OYW A;  4OYZ A;  1Y11 A;  1CJV B;  3G82 B;  3G82 A;  4WP3 A;  1CJU A;  4WP8 A;  4OYO A;  1CUL B;  4CLY A;  1U0H B;  2GVZ A;  3C14 B;  1CJT B;  1CS4 A;  4UST A;  4WPA A;  1YK9 A;  4NI2 B;  4P2M A;  3MAA A;  1U0H A;  1WC3 A;  4OYA A;  1FX2 A;  4OYI A;  5D0G A;  3R5G A;  1TL7 A;  1WC6 A;  4USW A;  2GVD A;  4OYM A;  4OYB A;  1AB8 A;  1YBU A;  4NI2 A;  4OZ2 A;  3UVJ A;  5D0H A;  3MR7 A;  1CS4 B;  1WC0 A;  4CM0 A;  1FX4 A;  4P2X A;  4CLL A;  1CJV A;  1AZS B;  4CM2 A;  4CLK A;  2GVZ B;  3C14 A;  5IV4 A;  1CUL A;  2W01 A;  4CLZ A;  5IV3 A;  3ET6 B;  2WZ1 A;  4USU A;  4OZ3 A;  1WC4 A;  4CLU A;  5D0E A;  2BW7 A;  1CJK B;  3UVJ B;  4OYP A;  4P2F A;  3ET6 A;  4CLS A;  2GVD B;  1CJU B;  1WC5 A;  1AZS A;  1CJK A;  3C16 B;  1YBT A;  3MAA B;  4CLF A;  3C15 A;  4CLT A;  4CLW A;  5D0R A;  1CJT A;  1TL7 B;  4OYX A;  3C15 B;  4CLP A;  4WP9 A;  5D15 A;  4USV A;  3C16 A; 
#chains in the Genus database with same CATH topology
 2BW2 A;  3DKD A;  2CJA A;  4M5G A;  1LFW A;  2D3Z A;  3ZXW A;  3GSI A;  1I51 B;  4NLR A;  1TKT B;  4C0B A;  3N6M A;  3BSC A;  4F36 A;  3M2V A;  1VQ6 S;  1PYS B;  2HRU A;  2OSQ A;  5IM0 A;  3BGO P;  2FJE B;  3HK2 A;  3G82 A;  4K4T A;  1LKZ A;  2LMI A;  3FEZ A;  3QMQ A;  2JWN A;  2BV3 A;  3D3C J;  3MAH A;  1C4A A;  4WU2 A;  4RNF A;  3MEG B;  3FFI B;  2NQP A;  4F4W A;  2GV1 A;  1WF1 A;  1NBE B;  4B9T A;  4IFY B;  2G0C A;  3LAL A;  1SJF A;  2YWE A;  1JNR B;  3NGK A;  2B56 A;  1LV5 A;  4NI2 B;  3H25 A;  3LWL A;  1REV B;  3W2W B;  3GB0 A;  4HKQ A;  1N32 F;  5JVG Q;  2BKP A;  2OLW A;  2MLY A;  3MMC B;  4CO2 A;  4DR3 F;  4ELU A;  4DLG A;  1NDL A;  1XEZ A;  4CO0 A;  3TUP A;  4MH8 A;  2NCK L;  4N77 A;  1QAI A;  1L3S A;  2OD4 A;  5D0G A;  1VQ5 S;  2PFF B;  2DH9 A;  2IAJ A;  3H2L A;  5HVG A;  1HWK A;  3MI7 X;  3NGR A;  4DPT A;  2EFQ A;  2EFP A;  1TAQ A;  5D0H A;  3QWP A;  2XI2 A;  3KLG A;  2XHW A;  2E1P A;  2WOM B;  3TZW A;  2AQ4 A;  1FWP A;  1UEK A;  1KFD A;  2QE5 A;  3DXS X;  1FDN A;  1QTN B;  1YZ6 A;  3ENQ A;  5C2C A;  4DLE A;  3O3L A;  4MIW A;  3GIR A;  3MM5 A;  2MGZ A;  2FLN A;  1NH8 A;  2J76 E;  3GFZ A;  2R7V A;  1D8Y A;  5KFU A;  2CQ4 A;  4AYB D;  1RHM B;  1UWB A;  4MKA A;  2EFV A;  2B8P A;  2AJ1 A;  1UAW A;  3VAH A;  2VA2 A;  2OPP A;  2R8K A;  3HO1 A;  2LYV A;  3J7Y U;  3N6L A;  1ITP A;  4K50 A;  2W7O A;  2ZM6 F;  5EUH A;  2CPF A;  3ELH A;  3AXK A;  3POT B;  2XC9 A;  1HQE A;  1NB2 A;  4DDF A;  4RW8 B;  2ASD A;  3ENW A;  1KVI A;  2EKY A;  2R4F A;  1JKH A;  3VGV A;  3MWB A;  1TKZ A;  1VIO A;  1SXL A;  3M8P A;  3R6G B;  3MMJ A;  2YNF B;  1U2R A;  1XMQ J;  4UOH A;  2BJ3 A;  4LQ3 A;  2B4P A;  3EPG A;  3E01 A;  2ZDP A;  1EQM A;  4JI4 F;  5B0A A;  4F3M A;  1R0A A;  3IMQ J;  1VQM S;  2YWG A;  1EZZ B;  1BMQ B;  1YDL A;  1UVM A;  2AEF A;  2BUN A;  4MYT A;  3QIP B;  1IWG A;  3RB0 A;  3DYA A;  2XMM A;  1EAY C;  2EW9 A;  3KHL A;  3RTV A;  2B5J B;  3M8Q B;  4YQW A;  2AGP A;  3DGP A;  1U1Q A;  2V9K A;  1OJ4 A;  3BGF A;  1DTT B;  4F4A A;  1KOO A;  2Z2M A;  2JLG A;  3NL0 A;  4CLF A;  1AFI A;  4IOB A;  4USJ C;  1RTH A;  2QSW A;  1LOU A;  1S57 A;  1EP4 A;  2N4D A;  2B4V A;  2YQ1 A;  3O8W A;  4NA3 A;  3CCM S;  4DR5 J;  4CWB A;  1YRU A;  2YX4 A;  1JJH A;  4CLW A;  5KFD A;  1JMT A;  2WHO A;  2R3V A;  1XMB A;  3DLB A;  5A8K A;  4CO3 A;  3DYA B;  3MED A;  3DNC A;  2H5I B;  3IR6 B;  3N01 A;  3UDV A;  2VDH A;  1U2C A;  3FK4 A;  1T02 A;  3PM9 A;  2QRR A;  5F8L A;  4KH0 B;  3BO4 A;  5GAH U;  2ADC A;  3D68 A;  3PCO B;  2IBO A;  5CQG A;  1DTT A;  2Q79 A;  4PEO A;  2V94 A;  3H4B A;  3UW1 A;  3TWZ A;  3I31 A;  3OXL A;  3TX8 A;  1VBY A;  1RK8 A;  3IR5 B;  3AT1 B;  4DSE A;  1VC5 A;  3HF5 A;  2FZC B;  4JI7 J;  2OGU A;  4GKK J;  1H6K X;  2VON A;  5CXT A;  1NSK L;  1CLF A;  4ZMM A;  2W9C A;  4DG1 B;  3GJT B;  2LQ8 A;  1HQE B;  2AF6 A;  4DV3 J;  4BWM A;  5BYS A;  1N54 B;  1I5O B;  4DPU A;  2BQ3 A;  1VRQ C;  4O3Q A;  2OPQ A;  4CLY A;  2UU9 J;  2XS7 A;  3EVM A;  2QLW A;  1FK9 A;  5AE1 A;  1CQM A;  2YQ3 A;  3N0V A;  4EUV A;  3I55 S;  4UST A;  4QWB A;  3PW5 A;  4X64 J;  2DEI A;  4PG8 A;  1AW0 A;  3M2R A;  2DTJ A;  2V2Z A;  4ZN3 A;  4ZJQ A;  1FJE B;  2EG2 A;  2HBY B;  2ZWP A;  4E0D A;  4RW6 B;  2XSF A;  2JVR A;  3H5S A;  2GGP B;  3A12 A;  5H9F J;  4HHJ A;  1F2H A;  2HFZ A;  3W64 A;  5EDW A;  1RHJ B;  4JUZ A;  3BR9 A;  4DV4 J;  4MFB A;  2QN6 B;  4B02 A;  4K59 A;  1VLO A;  2HIQ A;  4RW9 B;  4WWS A;  2EBG A;  1A0O B;  2JFD A;  2ZHO A;  3CSK A;  3CCW A;  4OI6 A;  2AYE A;  1JLA B;  4ZS6 A;  4YR2 A;  3J7Y I;  2HVI A;  4DV5 F;  4UUW A;  2VBZ A;  3LP2 A;  1KKH A;  4DXL A;  3HHD A;  3GFY A;  1FEH A;  4YB7 A;  2VJU A;  2DR6 A;  2YNG B;  1Y5N B;  1VQO S;  4B3T J;  4AT1 B;  1TAU A;  1T95 A;  1D3W A;  3K7R A;  2VG6 A;  3GR1 A;  2B9W A;  1GT8 A;  3CJR A;  1GQE A;  4IG3 A;  4M63 A;  1UJ5 A;  4DQS A;  1TEL A;  2MZJ A;  1T94 A;  1RT1 A;  1NHV A;  3A3N B;  2UUT A;  3FCW A;  4B9S A;  1HYS B;  4I2P A;  1IKW B;  1VMB A;  5EGY A;  3UDC A;  1RSC A;  4LIR A;  5CAB A;  4MIA A;  3PW7 A;  2FJW A;  1QD1 A;  2QLX A;  3NRB A;  4Y2I A;  1R3N A;  2WTF A;  4QIE A;  3TEH B;  3J81 Y;  3P3D A;  2DEJ A;  3FQK A;  2JOQ A;  2MXY A;  1U48 A;  4K4Y A;  2CJB A;  2XWX A;  4I1T A;  2V8V A;  2ASY A;  5CAA A;  3LP0 A;  1JLB B;  2K8G A;  1F5A A;  2Z30 B;  1DY3 A;  3MEK A;  2E5I A;  3UFC X;  2QFJ A;  3AA9 A;  2V50 A;  1Q8L A;  1N5T A;  2YH0 A;  1G2E A;  1R6V A;  2W24 A;  3DRX A;  5D0E A;  2OHD A;  2I2Y A;  3MMC A;  1DBD A;  1U02 A;  2F3J A;  1PC5 A;  2DIU A;  1HNV A;  1RB0 A;  2MY7 A;  3TEG A;  5J2Q B;  3RB3 A;  4A8F A;  3NNH A;  2W9B B;  5HMW A;  3AOD A;  2B8Q A;  4P74 A;  3IR7 B;  5JMN A;  1RT6 B;  3MR2 A;  4J9N A;  1L3V A;  4Y0F A;  2R8G A;  1SV5 B;  4P2F A;  4Q43 A;  4DV4 F;  3OUY B;  3JTO A;  1U47 A;  1N36 J;  4EBC A;  5E41 A;  1DQ8 A;  2BM1 A;  2M8D B;  1H7X A;  5IWA F;  4G1Q A;  4AE5 A;  5GAE I;  1UW4 A;  2HAF A;  1H72 C;  3MM6 B;  1N5V A;  3QAU A;  4R8U A;  1IKV A;  1WKL A;  4K4W A;  2ZH8 A;  3BKU A;  4IG0 A;  5KFZ A;  1N32 J;  1RHQ B;  2XB2 D;  2WBM A;  2ZE2 A;  4RUC A;  2HNY A;  4DZD A;  1VQN S;  4FS1 A;  2XQC A;  1U45 A;  3P96 A;  3KOA A;  4PAB A;  5LMU J;  3LTO A;  3R5D A;  3LWM A;  2CNO B;  1BWE A;  2FY8 A;  4YHH J;  2MJU A;  4DV7 F;  3UQS A;  4X62 F;  4FVM A;  5DJB A;  1HBN B;  2M88 A;  4ETX A;  2DNH A;  4ZK7 M;  3N79 A;  2N7C A;  3M9M B;  2IA6 A;  4CH0 S;  3V4I B;  1C0T B;  2RS2 A;  3MOJ B;  1OWX A;  2V4J B;  1Q5V A;  2F4V F;  2KJW A;  1FRM A;  2MHN A;  3S01 A;  1UA0 A;  5KFB A;  3D67 A;  4G1Q B;  2HS0 A;  1HA1 A;  1BQX A;  2MKI A;  3TX0 A;  4CO1 A;  3R8Y A;  1HI8 A;  2WVC A;  3GR0 A;  3IGN A;  5FLX U;  1SV5 A;  2R2T A;  5KG2 A;  4A8S A;  1RWW B;  3JQM A;  1NJZ A;  2MEW A;  1HKA A;  2YNH A;  2XMJ A;  4YN3 B;  2XMW A;  1DTQ A;  5DGB A;  1PKU A;  2YXL A;  1AXQ A;  2KT5 A;  3ZFV A;  4CH1 A;  2DHG A;  1JB0 C;  2KDO A;  2YPZ A;  4NPO A;  5D3G B;  3VTI A;  1GAO A;  4NOH A;  4OYZ A;  3FJ2 A;  4DL6 A;  2CYY A;  1BGX T;  2C1E B;  2MKS A;  3I4H X;  4I6A A;  3I4P A;  4JP8 A;  4KHR A;  3WIV A;  2FHO B;  4NML A;  1S4E A;  4ZPB A;  1SQG A;  1E6V A;  1KWM A;  3L7P A;  1DQ9 A;  2HQI A;  1UMJ A;  1AA1 B;  1RHK B;  1UA1 A;  1DFD A;  2Y1R I;  3CJQ A;  4L3K A;  2A6M A;  3ILI A;  3EX7 B;  1RKJ A;  4B3M F;  4RZR A;  3AH6 A;  1N52 B;  2WON A;  1TK8 A;  1I94 F;  2C2K B;  2IRX A;  4X4S A;  2DNQ A;  2HHX A;  3C8Y A;  3Q8U A;  4OI1 A;  2PMZ D;  4D3G A;  1VQ8 S;  2J6T A;  3EZU A;  4I7F B;  1BC6 A;  4ID5 B;  3PJX A;  2I1R A;  2VG6 B;  1MRO A;  3PYD A;  3NBP B;  3BPS P;  3QT5 A;  4LSZ B;  4DR6 J;  4IDK B;  4OI0 A;  3G87 A;  2KB2 A;  2FGC A;  5BR8 J;  4QIG A;  2XTJ P;  4DV7 J;  3D2W A;  4F4X A;  2LDI A;  2EI5 A;  1VHF A;  4YY3 F;  3KHH A;  2VJV A;  3NGU A;  3FKB A;  1K0V A;  2RSQ A;  2IVY A;  4OJG A;  4LFA F;  2V63 A;  4OZ2 A;  2HLT A;  4C0H A;  1RT7 A;  4IR9 A;  3BRE A;  3NP5 A;  1RT4 B;  1WDT A;  1KFS A;  2AYG A;  4Z7Y A;  1UVI A;  3JYT A;  2KJV A;  2D7S A;  4DU8 A;  3M2U B;  2NRE A;  3LP1 B;  1L3U A;  3KNA A;  2CQ1 A;  3BSO A;  2WSF C;  5DZ6 A;  3UO0 A;  4F26 A;  4Y6I A;  5KAK A;  1DJ0 A;  3UCU P;  3LQV A;  3IRW P;  2I5J A;  1TL1 B;  4CYU B;  4M5D A;  2GMJ A;  5J1E B;  3ADA C;  2XLJ A;  1E6Y A;  2A3J A;  1N36 F;  1HR0 F;  4TNO A;  3VV2 B;  5JJB A;  5K8M A;  1OY9 A;  1RTD A;  1VHI A;  2QGF B;  2GNK A;  2J6U A;  3KTQ A;  3K5M A;  4OL8 A;  3AQP A;  4NWB A;  1X9W A;  2YPY A;  2E1R A;  3AB2 B;  4FPI A;  2ACM A;  2VBW A;  3OTD A;  3T5H A;  3PHE A;  1JLQ B;  1XC9 A;  4DQI A;  3PX4 A;  4ELT A;  4KY3 A;  4PPZ A;  3OHA A;  4CCH A;  1DLO A;  1YRX A;  2H3E B;  2PE8 A;  3MR6 A;  2VFT A;  4F3O A;  3DDI A;  5GAH I;  4O44 B;  1R8A A;  2OML A;  2P5V A;  5HVH A;  3VAJ A;  3ZO7 A;  3UVJ B;  2UV8 A;  1UVN A;  2WBR A;  3DN9 A;  1F60 B;  3A8I A;  3OT9 A;  3IBC B;  4WYL A;  5EHH A;  2CDQ A;  1N0V C;  5K14 B;  3VHQ A;  3NOG A;  2MY8 A;  1NB7 A;  4N8O A;  1FTR A;  6FDR A;  1FRH A;  5RUB A;  1P1L A;  3CPW R;  4ED7 A;  2ZBQ A;  2LA6 A;  4X4T A;  3PTW A;  4F0H A;  3MUM P;  3RR7 A;  1RBA A;  5DDO C;  3NAH A;  4JI8 J;  4LF1 A;  2G2Y A;  5HMZ A;  2PD1 A;  1MN9 A;  4M5L A;  3LGM A;  4X84 A;  3RGI A;  2C2N A;  2YKQ A;  3DGP B;  1SC3 B;  2G0I A;  1RAF B;  2LU2 A;  1SL0 A;  2FVQ A;  2RS8 A;  4K4U A;  3H2V E;  4F7V A;  5J2M A;  4JI0 J;  3DLK B;  1RTH B;  1HBU B;  2RUG A;  3VGU A;  2KFN A;  1HW8 A;  2AEJ A;  4ZVF A;  5A0Y A;  2L9D A;  2UUB F;  4FNI A;  2FVS A;  2R7U A;  2H65 B;  1DUR A;  5LM7 E;  1R0C B;  1MWY A;  3SCK E;  1X9S A;  1MG7 A;  2F9D A;  5KFX A;  2DHA A;  4UOG A;  2DPJ A;  2IFX A;  4ERD A;  1YGY A;  1ZA1 B;  4LSL B;  3I87 A;  3GZ7 A;  4DS4 A;  2AW0 A;  4BC7 A;  3Q8V A;  3QID A;  3GIJ A;  3NWR A;  2RE1 A;  3PRD A;  2WAQ D;  1KS2 A;  2RIL A;  3SBM A;  4USV A;  1T9U A;  2GML A;  4MJK A;  2B9X A;  3PR4 A;  3UI3 A;  4C8K A;  1DAX A;  5GMD A;  4DFJ A;  3EDQ B;  1ZPV A;  4P71 A;  3HLU A;  2ZBP A;  2BAB A;  2AJ0 A;  5K8O A;  2JX2 A;  3HVT A;  3OFE A;  2E1M C;  1D09 B;  3THT A;  1IUJ A;  3TJ8 A;  3ZTQ A;  2XCA A;  2KT2 A;  3RBX A;  3THP A;  4OYW A;  3PW2 A;  1OSC A;  2XMT A;  4O3S A;  2WVE A;  3CDW A;  3BGR B;  1FES A;  1YQH A;  3F41 A;  1LWF B;  2FTR A;  3MM5 B;  5IOL A;  4YB1 P;  1RLD A;  2HBR B;  2BJE A;  3BKT A;  3KUH A;  5LJ5 Y;  3OL8 A;  1C4C A;  4B9L A;  1OPZ A;  1MRO B;  2G2O A;  1PJ6 A;  3OQ2 A;  4LRD A;  4TKT A;  1GTH A;  4DFK A;  1UKU A;  5KFI A;  1JXV A;  2DYA A;  1HPZ B;  2DT9 A;  5F8H A;  3WHI A;  3JYT B;  1BQM B;  3A3O B;  1PSD A;  4KIA A;  2BMB A;  5KG6 A;  3PW0 A;  3POT A;  4FYW B;  1H38 A;  4EK2 A;  2MQL A;  3W2V A;  1X4A A;  4NLW A;  4P2M A;  5SZT A;  2W8K A;  4U9R A;  4N76 A;  3MAA A;  1NPP A;  4DL2 A;  4FXD A;  4TLQ A;  5KFR A;  5B7W A;  1PIE A;  1VCT A;  3QGH A;  1RJJ A;  5L9X A;  2YQ0 A;  4N5S A;  3TVY A;  4LF8 J;  1G3O A;  1CSJ A;  4H54 A;  4OZ5 A;  1U0H A;  2GJF A;  4JI6 J;  2G0J A;  2X1B A;  4OHV A;  2BE7 D;  1FWL A;  4ZVR B;  4C8M A;  2IMO A;  2N4C A;  4PXE A;  3KJV A;  5FJ4 A;  1NXI A;  1JLF A;  1OY6 A;  2YWW A;  3BR8 A;  1WC6 A;  3R5G A;  4M95 A;  2MKY A;  4HHH A;  3I32 A;  1REV A;  2DR7 A;  1YBU A;  1RLC L;  2YNH B;  3ZZY A;  2ZOM A;  1FXL A;  3CCT A;  3UVJ A;  4X4U A;  4ZPT R;  3T5J A;  2V34 A;  2J6S A;  5KG4 A;  4OLO A;  2IPO B;  4O0I A;  2D1C A;  5BYQ A;  1BQN B;  3ISN D;  4LFB F;  5KFK A;  2WB1 D;  3OJS A;  1L3T A;  1URR A;  3OFH A;  3TZX A;  1S4F A;  3MAQ A;  3HSJ A;  4I6W A;  1KTV A;  4GO5 X;  2R7S A;  5AXL A;  4OMF G;  5HRO A;  2ZH6 A;  3T1Y F;  1WNE A;  1JLC B;  1X5S A;  2NR0 A;  2DXD A;  2YNI B;  5FDL B;  3CJS A;  1Q5Y A;  1CUL A;  1FVS A;  5IV3 A;  4ECT A;  4LF9 F;  5K14 A;  3KUG A;  4AQY J;  3BN7 A;  1D0E A;  2LA4 A;  2EPI A;  1Q79 A;  4KR0 B;  3W5Y A;  1RT2 B;  2QYG A;  5HJY A;  4DS5 A;  3CME S;  1RDR A;  2AJ4 A;  3EVW A;  4R0E A;  3SI8 A;  2HIY A;  1BWV A;  4URG A;  3P49 B;  2ZM6 J;  4KV8 A;  4NZ6 A;  2CG4 A;  3IAS 9;  2VKR A;  4IOC Q;  3VAG A;  3UWT A;  3QSI A;  4ZJL A;  5LL6 d;  3K58 A;  2YKA A;  3ETM A;  4NLU A;  2AU0 A;  2A18 A;  3BF4 A;  2DNR A;  1ZYQ A;  1T05 A;  2FQQ B;  2BAN B;  3D54 A;  1XMQ F;  4YS2 A;  3QRR A;  3CCQ S;  1RT5 A;  1GXU A;  1NZA A;  3D6T B;  4TLR A;  4AFF A;  3BM7 A;  4P7T A;  3H42 A;  5HK4 A;  5C25 A;  1S7H A;  1SL2 A;  3EZO A;  4QR1 A;  1M90 T;  4C9D A;  2ZE2 B;  3JQJ A;  3EGW B;  4KTQ A;  2JSX A;  5KOX A;  2GHV C;  1S1T A;  4FF4 A;  1WEL A;  5C42 A;  2M7S A;  4J9L A;  4DL5 A;  2PT0 A;  1RE1 B;  2RDI A;  1VBX A;  2GAG C;  5J1P A;  4AD6 A;  5F3T A;  1APS A;  1B0V A;  1TQL A;  1H3D A;  1S6Q A;  1IXK A;  1D8Z A;  5KT2 A;  1RHR B;  4CNY A;  2LEP A;  3T6J A;  4A8O A;  1S48 A;  5HSP A;  5A2Q Y;  5J2N B;  2G13 A;  1OSD A;  1TUV A;  2Y3Y A;  3C6U A;  3FBC A;  1AUS L;  3JTP A;  3CTR A;  5IXU A;  3T1Y J;  2K7J A;  4HAC B;  3PG9 A;  5FLX Y;  1VQ7 S;  3NKY A;  2RQM A;  2XS2 A;  2L9W A;  1XTZ A;  4LRC A;  4LF4 F;  1UFK A;  2I38 A;  4KGV B;  2OFG X;  1IBK F;  2B9E A;  2DCL A;  3FVY A;  3MEE B;  1CEZ A;  3FEX B;  3GPA A;  2LQ9 A;  2W2N P;  3JTN A;  2H54 B;  1OQ6 A;  4C0O C;  4ZLL A;  4X66 F;  4WFA Q;  4P7V A;  2POK A;  4YHH F;  3SQG A;  1RBO B;  3U1N A;  1YJT A;  5DGA A;  1SL1 A;  2UZA A;  1RQ0 A;  2MZS A;  3D0I E;  4DR2 F;  3ZZT A;  3THV A;  2NS1 B;  1M1K T;  4JI7 F;  4GKK F;  3SCJ E;  2VG7 A;  2GJ2 A;  4ES3 A;  1SUQ A;  3E3X A;  3KK2 B;  4DUZ J;  1BY9 A;  2K2P A;  1U0H B;  2Y1I A;  4QJV A;  1JNZ B;  2MKH A;  4KJI A;  3LOU A;  2H48 B;  1TFY A;  2E7V A;  5KG0 A;  2UVW A;  1U2F A;  1YIJ S;  1RWV B;  2HSE B;  2D69 A;  3P5B P;  4KC5 A;  2Z4P A;  4CQ1 A;  1KLM A;  3TOQ A;  1SB6 A;  1WDD A;  4ZPD A;  2JHE A;  2BVZ A;  5L8R C;  3RW7 A;  2BEF A;  4J7C A;  1T11 A;  3H7H B;  1FRL A;  2IIH A;  4J9Q A;  3NNA A;  2UUC F;  2UXB F;  3L9Z A;  2OIH A;  4LF8 F;  3HUL A;  4KAI A;  1G4C A;  2OD6 A;  3DRY A;  1YJ7 A;  1S76 D;  1AB8 A;  1KQG B;  3ENA A;  2YH1 A;  1RWU A;  3W62 A;  2E7W A;  5H9E K;  1N5Y A;  4HR2 A;  4ECZ A;  3OR2 A;  2J0S D;  2NYH A;  3FBB A;  1EX8 A;  3HVT B;  4KE5 A;  1Q82 T;  2RNE A;  3DRP B;  3MOZ A;  3LAN A;  3BYP A;  1OYD A;  4UW2 A;  3CJ4 A;  2KXH A;  2R2S A;  5IT0 A;  2EWH A;  2JFK A;  4QYR A;  5A6W A;  3M05 A;  1NUE A;  4Y2C A;  3M4X A;  3HP6 A;  4B9N A;  2QFI A;  2VAS A;  5C7P A;  1Y9O A;  3ZC4 A;  4NXM F;  1GXT A;  5CYQ A;  4F0K A;  2HFS A;  1RYS A;  4NXN J;  1FDD A;  1U8W A;  5ETT A;  2AYM A;  3BBC A;  2JC1 A;  2DK2 A;  3DDN A;  2Y0S D;  2QL7 B;  3ISZ A;  3LH2 S;  3QNW B;  3DLL Q;  2HEK A;  1H98 A;  5C24 B;  2FJX A;  4Q2M A;  1UTA A;  2XCP A;  3H8Y A;  1X4B A;  4I2P B;  4WK1 A;  3HXM A;  5HQM A;  1FDB A;  2DRD A;  2HWH A;  4TYB A;  2F63 A;  3CF5 Q;  4NLS A;  4HDG A;  1SH2 A;  4H4K C;  3VCD A;  1P27 B;  3RYL A;  3H4D A;  3DHW C;  4K0K J;  1FD2 A;  4TY8 A;  5THW A;  2RML A;  3ILO A;  4FYX B;  5DQG A;  1NSP A;  2UVR A;  2XHC A;  1REG X;  3MZI A;  3K5L A;  2IC3 B;  3D5M A;  3KKF A;  1VOM A;  4M8L A;  4DU7 A;  4WK3 A;  4YME A;  2HBQ B;  2IMW P;  1TL1 A;  1RWX B;  5J1E A;  5KFM A;  2VFS A;  4BCA A;  4F02 A;  1B64 A;  4WTO B;  4DJB A;  1LWE A;  1TKZ B;  1VS3 A;  3VQT A;  3PO4 A;  1O0P A;  3K5O A;  2VBY A;  3AAW B;  5F8N A;  1NZ8 A;  3P4U B;  4NEZ A;  1KTQ A;  2CZ4 A;  3VAL A;  1VC6 A;  1MWZ A;  1QVF R;  5HLF A;  3PX6 A;  4NZ0 A;  2HHQ A;  1PJ5 A;  1S1X A;  3IGV A;  4LF7 F;  3KLI B;  3MFI A;  3OR2 B;  4N56 A;  4C8Z A;  3HDS A;  2OJ3 A;  2MZQ A;  4HLB A;  5HBM A;  4UQG A;  1IM4 A;  2LXU A;  3BB5 A;  4KFB A;  3BO2 A;  5F41 A;  1Q53 A;  4L3N A;  4H4K A;  3PYG A;  3CCZ A;  2YNF A;  1LWC B;  3C15 B;  3NBP A;  1IJE B;  1P1T A;  3GCX P;  2Y8Y A;  1JKH B;  2JLF A;  3HFK A;  2LCW A;  3QSY B;  1U09 A;  4CNZ A;  7AT1 B;  4MK7 A;  2F8H A;  2KG1 A;  3KLI A;  3CJ5 A;  1QVG R;  2RHQ B;  1SQF A;  1TKD A;  2CFX A;  1JXL A;  2ROE A;  5ETM A;  2XO6 A;  4U7U D;  4QOT A;  5E33 A;  2DBB A;  4X62 J;  2C3P A;  3W63 A;  2MQO A;  3KHR A;  2ADB A;  4Q0B A;  2VG5 B;  3GE9 A;  4NE9 C;  1UJ4 A;  2IBK A;  5CHC B;  3CD5 A;  3DMJ B;  5B0G A;  3RUB L;  4Z7C A;  5A76 A;  1LWE B;  2NUH A;  5KTQ A;  3UCZ P;  4LF9 J;  4ZIT A;  3MPD A;  4ZLP A;  1QUP A;  5LT5 A;  3KK3 B;  3D1H A;  4NLG A;  3A1Y G;  4EWT A;  4PYA A;  2ATL A;  3CNQ P;  1FRX A;  3CDB A;  2VZ9 A;  2K3K A;  3P5T L;  4FNH A;  4I7F A;  5EWE A;  1EIY B;  4QIV A;  4RUH A;  3TJA A;  1DTQ B;  3NS6 A;  4U8Y A;  1LWX A;  4WU3 A;  5KT4 A;  4WPA A;  4RX6 A;  2VQE F;  4Q8E A;  1HBU A;  3MGJ A;  1U1L A;  4M1K A;  1HQU B;  4ZP9 A;  3QRQ A;  5MAO A;  3D6F B;  2QLB B;  3IWN C;  4ANC A;  2ZNY A;  1I94 J;  3S7R A;  1NH7 A;  2E9T A;  1KSP A;  1F6T A;  3C6U B;  5CYJ A;  3K5N A;  2FB0 A;  2YKM A;  2G2Z A;  1YX2 A;  2HGL A;  4YDX A;  1XNR F;  2RH3 A;  2NYI A;  4KPC A;  4WFZ A;  4USM A;  3A3P B;  3R5J B;  1C1C B;  3Q8P B;  1VQL S;  1S6Q B;  3HHN B;  4HL9 A;  3UN5 A;  1WKJ A;  1YBA A;  1CBK A;  1R7I A;  1TUW A;  1TV6 A;  3DRP A;  2HLU A;  4BBY A;  7FD1 A;  5A8W B;  5HO4 A;  3BH7 B;  3Q86 A;  2FZK B;  3LP1 A;  2ZWO A;  3M6V A;  4DL3 A;  2GQ2 A;  4B17 A;  2E44 A;  4E98 A;  2DO0 A;  4LVO P;  4EBD A;  1F0X A;  1HAR A;  1VBK A;  4ZHR B;  3R27 A;  3F73 A;  3NEK A;  3EJM A;  5FII A;  2X1A A;  3CC7 S;  2KT3 A;  2XY6 A;  2DJW A;  1IBM F;  1C2P A;  3R5A A;  2XMV A;  5AXK A;  2AZ1 A;  1UWB B;  2B51 A;  2CWX A;  2HND A;  2FUG 9;  3C14 A;  3N5F A;  5KT7 A;  1S99 A;  3EM1 A;  1UPP A;  4CLZ A;  2FZG B;  4L74 A;  2DNM A;  1Y00 A;  2PDA A;  3ET6 B;  1GEH A;  4IDK A;  1KP6 A;  3GFX A;  1GNK A;  1BLU A;  2HQD A;  3TUJ C;  2O5D A;  3GYG A;  1F3F A;  4LSN B;  4C8N A;  2NSB A;  1HNV B;  3SEO A;  2C3Y A;  1N48 A;  1N88 A;  2M5Y A;  4XDD A;  4TQR A;  2A6O A;  2DPI A;  4LFC J;  3FDS A;  3BQ2 A;  2CIM A;  1IJF B;  4IG0 B;  4NLX A;  1WSR A;  3QGP A;  3HPO A;  3KLF B;  4DV1 F;  3DXB A;  2AX0 A;  3H0P A;  2K3I A;  4KKO B;  1IWA A;  1S79 A;  4PQU A;  2EEY A;  4H4O B;  3B6B A;  3WBZ A;  1NK6 A;  1L5U A;  2XSJ A;  2UU9 F;  4ZVG A;  4AL7 A;  5IFM A;  5B0D A;  4V1A k;  4CO4 A;  2WVB A;  3D1Q A;  2GIR A;  2GVD B;  1U24 A;  2OFH X;  4MKY A;  1HBO A;  2B7C B;  3K59 A;  4RR5 A;  1JXE A;  3NLC A;  4J9S A;  1K44 A;  4N47 A;  3A8J A;  2B6A A;  4XPE A;  5B0E A;  3SV4 A;  2UVU A;  3OTC A;  4KGZ B;  5J2Q A;  1J5E F;  4KHP J;  1FE4 A;  2WVD A;  3HZE A;  3IG1 B;  3QWU A;  3RAX A;  2QSF A;  3D4J A;  3SQG B;  5KFL A;  2BQU A;  3HD2 A;  1X0F A;  5KFJ A;  2Z2Z A;  1YJR A;  2V69 A;  5D0R A;  2E7X A;  4HT7 A;  2M4M A;  2ZHB A;  2CNN B;  2J7K A;  3G6V A;  2DGO A;  1J27 A;  1RWP B;  3IBW A;  3M6U A;  3FRY A;  4KKO A;  2V2V A;  2YKO A;  4ZVH A;  4CIO A;  3KDN A;  3SYZ A;  3CJ0 A;  5D6G A;  5K8N A;  3MF5 A;  2RQK A;  1NJI T;  1ZM9 A;  4M5N A;  3AY0 A;  3IP0 A;  3S8S A;  1MN7 A;  4I2Q B;  1XMO F;  5T41 A;  3W2W A;  1ZET A;  5C25 B;  2WVF A;  1YIT S;  2DHX A;  2Z2L A;  4C8Y A;  1ZPW X;  2ZBI A;  1CC8 A;  1JLA A;  2X3G A;  3OBI A;  1WHX A;  5HP1 B;  3W8P A;  3VAF A;  2V4J A;  3GCW P;  3A8E A;  3Q2T C;  2JDJ A;  2XM3 A;  1H2U X;  1SBR A;  3PZP A;  4NL5 A;  3MM6 A;  4ZVQ B;  4UY8 T;  2YNI A;  5FDL A;  4F50 A;  2FPH X;  3N9U C;  4QQB A;  2UV8 G;  4DHV A;  1ROF A;  1LXN A;  4B3R J;  1OQ3 A;  4C2M A;  3VVT A;  4TU9 A;  1FT8 A;  2BJD A;  3FC9 A;  1QAJ A;  4EZ9 A;  1KVJ A;  3JSY A;  4ZKA A;  3LGN A;  2XLI A;  4CI0 B;  3NMR A;  2E66 A;  4QW8 A;  3HVW A;  3H90 A;  4UOF A;  3N28 A;  4KV8 B;  3M30 A;  2R2U A;  3KG1 A;  4P9S A;  2KL8 A;  3OL9 A;  3SSS A;  4ED5 A;  2J7W A;  3I0R B;  4J9V A;  4RLE A;  2QMX A;  3HI9 A;  3CJK B;  3MMA A;  4QBU A;  2KVI A;  2Y8W A;  3OR1 B;  1JLB A;  1P6T A;  3N5B A;  1V3S A;  5AE3 A;  1NPR A;  2RIJ A;  4FP9 A;  1KVK A;  4F8R A;  3IA0 A;  1G6B A;  3D0H E;  4ED3 A;  1RYR A;  1WOP A;  1NK9 A;  2CWK A;  5I4M A;  1HQU A;  1WI8 A;  2Y9H A;  4XPC A;  2F4V J;  1UZD A;  2A2D A;  2LDY A;  1FXD A;  1BQN A;  1NAQ A;  2P6S A;  4RNH A;  1CS4 B;  2DHH A;  1UWA A;  4WE1 A;  3NCQ A;  1NO8 A;  4QU7 A;  1M0S A;  3CMQ A;  2LQB A;  3FUY A;  1CQN A;  1O5J A;  1R8C A;  2AV5 A;  2WW8 A;  4ES1 A;  1QSL A;  1KBR A;  1FRK A;  4JBC A;  2V5H G;  4JI5 F;  3G6Y A;  2J9E A;  4OZ0 A;  1RXO B;  3E8O A;  4C97 A;  3CC4 S;  1YKW A;  2PMH A;  1KN6 A;  5DM7 Q;  2DH7 A;  4GMK A;  1IBM J;  3TVK A;  4NYZ A;  1RA6 A;  2NXJ A;  4ZN1 A;  2XGP A;  3DOK B;  3F0N A;  3TP2 A;  3JSM B;  3DU5 A;  4QIW D;  2W8L A;  4KH1 B;  5K20 B;  5I3U B;  1IR2 A;  4L73 A;  2BX6 A;  3TNV A;  4DPW A;  4EO8 A;  3E51 A;  4DUZ F;  1U1P A;  2ALY B;  2J9D E;  4GVL A;  4LBH A;  5D4O A;  2PO4 A;  3NAI A;  4C8O A;  4WIQ A;  4ZP6 A;  4UT4 A;  2CJX B;  5ETK A;  4O3N A;  1LQ9 A;  1C1B B;  1JK9 B;  4LR8 A;  1Q7L B;  3OW2 R;  1S6P B;  2MDA A;  2W25 A;  4BDP A;  3AFG A;  3GJS B;  1WF2 A;  4C98 A;  4GVB B;  4NMX A;  2DRB A;  2GCF A;  2BAC A;  2CRL A;  4J9M A;  2BRL A;  1S1V B;  1UFL A;  4JI1 J;  4FZV A;  5DET A;  2EK6 A;  2Q66 A;  3EIC A;  3TUI C;  3V6K A;  4DX7 A;  2KXF A;  2MQQ A;  4EU0 A;  2W7P A;  2R8J A;  2ZH5 A;  3BBF A;  4LRA A;  1S6P A;  4F67 A;  2YTC A;  4JI4 J;  1MLA A;  4MMO A;  4KFB B;  2OTJ S;  4ILM A;  4G6V B;  1MNE A;  3NS7 B;  4F0M A;  3B4D A;  1RAH B;  3G8Q A;  5ETS A;  2FLP A;  1X4E A;  3DM2 A;  3O6Q A;  4NCG B;  1LK5 A;  6FD1 A;  1A7G E;  4DL4 A;  1T03 A;  1JWW A;  4F4Z A;  2A1B A;  3R6L B;  1NU4 A;  1X7V A;  2W9C B;  5DQI A;  2EXU A;  2GC8 A;  3BS9 A;  2IDE A;  5DLF A;  2ZC4 A;  4WTY A;  1PC4 A;  2HMI A;  4ED4 A;  4M94 A;  5B08 A;  2MZR A;  3IS9 B;  4CO5 A;  1MWQ A;  3LPY A;  2F4F A;  2MKC A;  3O2I A;  1WC1 A;  2OTL S;  4NXN F;  3KLE B;  3FFI A;  2LQ5 A;  1VQS A;  4PRF A;  2KHC A;  3K2Y A;  4O3R A;  2Q43 A;  3DM2 B;  4NCG A;  3BQ0 A;  4ELV A;  4KQZ A;  2VOO A;  4LRF A;  2HHT A;  2V4Q A;  1HMV A;  4E8U A;  2GS8 A;  3T41 A;  4NCA A;  1W7W A;  2DO4 A;  5A8K B;  5AE2 A;  4RUB A;  2RU9 A;  2VKZ G;  3J80 U;  1VK3 A;  3VGT A;  3PO5 A;  2PEB A;  4EFA C;  4DEZ A;  4ILR A;  2DY9 A;  2UUW A;  2X1F A;  2AWZ A;  1X4H A;  1VRU B;  4O44 A;  3HJV A;  4ATN A;  3PY8 A;  4AQY F;  2FY1 A;  5CD4 H;  8AT1 B;  1XNQ F;  1F9H A;  2QYC A;  1DLO B;  2P6T A;  3QQC D;  4KHM A;  2BKO A;  2KHD A;  4HDH A;  2MYF A;  3RR8 A;  4C3M A;  2D74 B;  4DV5 J;  1T03 B;  4QYZ K;  1UL3 A;  1FNX H;  1UVL A;  4CTA A;  1SC4 B;  2J7U A;  2W2Q P;  4DR3 J;  2ZZN A;  4C8L A;  3QT6 A;  4PKD B;  2NLW A;  1C0U A;  4USW A;  1TKT A;  2PGC A;  2ZVS A;  4NLT A;  4ECV A;  2XMK A;  1S0N A;  1FF2 A;  2VU5 A;  5LSL A;  5GMK a;  1VQ4 S;  2D9O A;  3P8B B;  2HWT A;  3SQO P;  4Z37 A;  2CQI A;  3UD3 P;  4ZCL A;  4IO1 A;  2HWI A;  1A9N B;  2H1Y A;  4UZC A;  3Q8S B;  4G3I A;  3R2D J;  1S5Z A;  2L3M A;  2F8E X;  1YWX A;  4BWJ A;  1U1K A;  1D9A A;  1JJ2 R;  2WRM A;  3NG8 A;  4ECS A;  4R8U B;  4CLK A;  2IM2 A;  3ZZR A;  5IS2 A;  3C6T A;  1KLN A;  2NZ4 A;  2PFD A;  2M0G B;  2KYZ A;  5I42 A;  2W01 A;  4P72 A;  2BE9 B;  4LQ9 A;  3I96 A;  5HN0 A;  4FYV B;  4RU2 A;  1RU1 A;  4RUA A;  1RT3 B;  3H98 A;  3HKW A;  3NXZ A;  5EWG A;  3GV8 B;  4CT9 A;  2DNG A;  2C3O A;  4ZA1 A;  1EET A;  1QM9 A;  1M5O C;  3NCR A;  1QLN A;  3PRV A;  4IOA Q;  2D3O 1;  1EET B;  4I56 A;  1EB0 A;  3MTJ A;  4PWU A;  4OZ1 A;  3V6D A;  3MCN A;  1FKA F;  1HNW F;  3MXH P;  3QO9 A;  1U0S A;  1HHT P;  4ZIV A;  4DPY A;  1Q86 T;  3FBE A;  3PYF A;  2MST A;  3I56 S;  5J2N A;  2DR5 A;  4IRD A;  1S72 S;  2HQG A;  1SJ3 P;  3EPI A;  2E9R X;  2HQ3 A;  3GWC A;  4B3T F;  3Q8Q B;  3I0S A;  4FDF A;  1X9M A;  4IO9 Q;  1KQS R;  2DGQ A;  3FCV A;  5DDP C;  4FKY A;  1QTM A;  4ALZ A;  1XR6 A;  3V6D B;  1K47 A;  2KU7 A;  5CD4 A;  1HNX F;  3NMA A;  1ZS6 A;  1PO6 A;  2LEA A;  2XYH B;  1VGY A;  3AD8 C;  3T1H F;  4YFU A;  2FVR A;  1F9E B;  5LSR A;  2ZH2 A;  1S77 D;  3G4S S;  1BD6 A;  3O5T B;  5HAT A;  5IT4 A;  5I42 B;  4EYH B;  2I8E A;  1T3N A;  4X4N A;  1QE1 B;  5LMU F;  3W5X A;  1UPM B;  2WSC C;  3DLE B;  4PR6 A;  2AGO A;  4FF2 A;  5E0O A;  3AHP A;  1XNQ J;  4RW9 A;  2FD2 A;  5JVH Q;  1VLY A;  4ZPC A;  5D4L A;  3MCO A;  5H9E J;  1VRT B;  1KDN A;  5D15 A;  1S1T B;  2BAN A;  2WCX A;  2KH9 A;  1S49 A;  2BOA A;  4LFB J;  3OL6 A;  2CNK B;  2CPJ A;  2CKW A;  4EGL A;  4J9K A;  3BBB A;  2ZD1 B;  5CZX A;  4ZCM A;  4N7T A;  4IRC A;  3IC1 A;  3VAI A;  2F5G A;  2KKH A;  1GMW A;  1FO1 A;  1PIL A;  2MKK A;  2F65 A;  1FRJ A;  3TZY A;  1C0U B;  1S7I A;  2DIT A;  2ZUA A;  4LVN P;  2M9K A;  2MQ8 A;  3OV7 A;  3U7J A;  3ZZP A;  2PSZ A;  3KG0 A;  3DLG B;  1W25 A;  2AJ2 A;  1NDC A;  1YJN S;  1CUL B;  5DM6 Q;  3UDE A;  4B08 A;  2MLX A;  3MD3 A;  3X3U A;  4A8Q A;  1QE1 A;  1WUU A;  2H5J B;  4EZ6 A;  2W4P A;  3OUY A;  1FTC A;  4XTT A;  1J2V A;  3QGI A;  3NS5 A;  2RUS A;  1LW2 A;  4F2S A;  1RT2 A;  4P52 A;  1IKW A;  4ZVE A;  1LW0 A;  2EC2 A;  2C28 A;  3S1T A;  4Q45 A;  2YVS A;  1SKR A;  2CPE A;  3Q8Y A;  2RAQ A;  3OTO F;  4I2Q A;  3W9I A;  2M52 A;  3G8T A;  1NK8 A;  2Z8Q A;  1PBU A;  1JLC A;  4USH A;  1U49 A;  2F8M A;  1UP1 A;  2LEC A;  2YY3 A;  3LW5 C;  2YNG A;  4ZLJ A;  3KLH A;  2MB0 B;  2IA0 A;  4P6Q A;  3SXL A;  3OSP A;  3MED B;  2V8P A;  1IKX B;  2K1R A;  3EMT A;  2QT7 A;  4O4R A;  4PXB A;  5ETO A;  2GVD A;  1S10 A;  4OYM A;  2GAH C;  3WC2 A;  2CPI A;  4I0W A;  4ZP7 A;  5A2Q U;  2DNY A;  3CCL S;  3GIK A;  4MK8 A;  4W90 B;  1URN A;  3TAM B;  3D66 A;  1TVR A;  3QO9 B;  4Y65 A;  2Z58 B;  5L38 A;  4TU8 A;  3I5A A;  3OTE A;  1FKO B;  1BQM A;  1T9W A;  1WG5 A;  2MKJ A;  4DL0 C;  5F0W A;  5ITH A;  5D78 A;  4WXW A;  2N7Y A;  4JI6 F;  3JSB A;  3R7N B;  4DF8 A;  1N6Q B;  3W2V B;  1IQT A;  4QCL A;  4BHQ A;  5CA5 A;  4A8M P;  4KGM A;  3PW4 A;  3CXC R;  1AYE A;  5BR8 F;  3RBD A;  4PWD B;  1OS5 A;  5GVQ A;  3TQ1 A;  4DX5 A;  3JXO A;  3KNG A;  2R42 A;  5J1N A;  2XS5 A;  2FLO A;  2E5L F;  3GMG A;  3VZI A;  4W4M A;  5K5M A;  1NK0 A;  1V5I B;  2DR8 A;  1WG4 A;  4HHU A;  3G2X A;  4DWI A;  1BE4 A;  4RNO A;  3I5C A;  2G9O A;  4Y34 A;  5I3Q A;  3FSI A;  2R7R A;  2E5L J;  4PQU B;  1FNM A;  3M8W A;  2OH2 A;  2UP1 A;  3M2R B;  1KQF B;  4HEA 9;  2DVI A;  1RAO A;  2DGX A;  4ECU A;  3V81 B;  2P9E A;  3U1L A;  1UET A;  2KZM A;  3QT8 A;  4RW6 A;  1ZTW A;  3BSA A;  1GMU A;  2Z0G A;  1K8A T;  3NNC A;  2OPQ B;  3QPI A;  1VR6 A;  1TV6 B;  2RKI A;  2QL9 B;  3A8K A;  3GJQ B;  1M5S A;  4OJ1 A;  4CT8 A;  4ED2 A;  4JOU A;  3IM8 A;  4L6V 3;  1H74 A;  5DS7 A;  1HNW J;  4CLS A;  2BE2 A;  5AJ3 J;  2ERR A;  1CJU B;  3M6W A;  5HRO B;  2COL A;  2FVC A;  3CIZ A;  4DR2 J;  1JX4 A;  1VQ9 S;  3ULH A;  2R9L A;  3AD9 C;  3QAE A;  3PYE A;  4UUX A;  3V4M A;  5AXN A;  3BJY A;  3QFW A;  2BYC A;  3MR3 A;  4TVA B;  1FKP B;  2HHU A;  5C24 A;  2J8A A;  1NDK A;  2F40 A;  3DU6 A;  1NND A;  1SJ1 A;  2F7V A;  2D41 A;  3FSY A;  4X64 F;  2EG1 A;  2UXD J;  2DY1 A;  2PC6 A;  4DCP B;  4DL7 A;  3MM8 A;  3M1V B;  1SKU B;  4ZP8 A;  2MQM A;  1HMV B;  4NLO A;  1TL7 B;  1VIX A;  5MLC V;  4RW7 B;  1S9E A;  4DR4 F;  3C3L A;  4QWC A;  3CDA A;  2E29 A;  4U8V A;  1RGV A;  4RW7 A;  5L1J A;  4LUB A;  2HHS A;  2MPU A;  4ECX A;  1JJ4 A;  1R43 A;  3DMJ A;  1R0A B;  4TQS A;  1XWL A;  1Z2Z A;  4DCJ B;  1TL3 A;  2CJK A;  2I9S A;  2HZV A;  5CYM A;  3HSZ A;  2DR9 A;  4LJM A;  2FDN A;  3FEY B;  3UN3 A;  2LXF A;  5J2P A;  1NK7 A;  3K0J A;  4KRW A;  3IS9 A;  4JB8 B;  4J91 A;  2VF3 A;  3J81 j;  2ZH9 A;  1OO0 B;  2LXI A;  2H9Z A;  1UZH A;  4DV6 J;  4YOE A;  2LKZ A;  4CH7 A;  3BQ1 A;  3QAT A;  2Y1J A;  4AL5 A;  1RAJ A;  2YBV A;  1NKC A;  5DQH A;  1CPZ A;  4M5D B;  4LF5 J;  4WZQ A;  2MZT A;  3GYX B;  4NEY A;  3M8Y A;  2HGN A;  4RPF A;  2BXJ A;  5CYQ B;  3BDE A;  3M8P B;  3RBZ A;  5IM0 B;  2VIC A;  2YWK A;  1N34 F;  5E5N A;  1CJT B;  3M8R A;  3CGI A;  1I1G A;  2PA8 D;  4O3O A;  3BSN A;  2NXU A;  4O4G A;  3E01 B;  4RNM A;  1F1B B;  3RJM B;  4A8Y A;  3UD4 P;  4RW8 A;  3KJQ B;  1RP5 A;  3C66 A;  2CQB A;  3Q83 A;  1XR7 A;  3EZ5 A;  1X5T A;  4GKJ J;  1TP7 A;  5KG5 A;  3R5C A;  2CZ9 A;  2G1D A;  1MU2 A;  5CCM A;  1B7Y B;  2BZ2 A;  2HRT A;  4B3M J;  3SCI E;  3V81 A;  1U4B A;  4DBQ A;  1UEU A;  4DX6 A;  3KFW X;  3S6E A;  4GVB A;  2B43 A;  1Y3J A;  1FX2 A;  3CW2 C;  2FIU A;  2P9C A;  2VFR A;  2X3D A;  3CDE A;  1ZA2 B;  2PII A;  1FXR A;  3BGU A;  3HCX A;  1WOS A;  3IWX A;  4LSL A;  3VVU A;  3IXQ A;  1QUV A;  5F9N A;  1N6Q A;  4OYB A;  5IT9 Y;  2ZH7 A;  2HHH F;  1Y7P A;  3M2U A;  4Z2X A;  2X51 A;  1NCL A;  3RRK A;  2CQD A;  1N5Q A;  1J5O B;  2HBZ B;  1KQK A;  2MHE A;  3TQE A;  4YY3 J;  5HP1 A;  1NM2 A;  1DQA A;  4DN0 A;  4OI3 A;  3UPF A;  4OHW A;  2DIS A;  5HLF B;  4QPT A;  3NGS A;  2HRY A;  2H4W B;  2IAJ B;  4HAC A;  4ICL A;  4B3O B;  1EAR A;  1SJR A;  3M32 B;  3MCS A;  3L3C A;  1YRT A;  4K4S A;  1UVJ A;  4QR0 A;  2MJN A;  4IQX A;  4L72 B;  1N8R T;  4PCQ A;  4RBV A;  2R2R A;  1KRP A;  5IQ6 A;  1PBA A;  4ID5 A;  5E3R A;  1SVD A;  4H4O A;  3TR5 A;  4ER8 A;  1RTZ A;  1O6X A;  1FJG F;  2WZ1 A;  4USU A;  4LF5 F;  3MMA B;  2CAJ A;  1WC4 A;  5LSO A;  3GII A;  3MEC A;  3MMB B;  3R5B A;  5AT1 B;  3U02 A;  1U7L A;  2C2Z B;  2QA2 A;  5C42 B;  4QZV B;  5IZH A;  4UY8 5;  2IY5 B;  1RAG B;  2CQ3 A;  3EYZ A;  5L1K A;  1CJK B;  2QL5 B;  1S1U A;  1WEY A;  3JSR A;  4EYI B;  1SH0 A;  1PCA A;  4LF2 A;  4ZLN A;  3H5X A;  3ET6 A;  4MK9 A;  1H2T Z;  2XG8 A;  4IFY A;  1RWN B;  2XO7 A;  4ITS A;  4A8W A;  4JI5 J;  2GQQ A;  3T5K A;  2M2B A;  3T19 A;  3RG6 A;  3I9Z A;  1Q8B A;  3CED A;  1QAY A;  3HHK A;  3NCP A;  3Q8R B;  4UOC A;  2DGW A;  2Z57 B;  3KLF A;  3V6J A;  1HFE L;  2ZH3 A;  4ZPV R;  4LR7 A;  4M5K A;  3PKM A;  5G0R A;  2VPX B;  5KFP A;  4P2S A;  1LK7 A;  2ZFH A;  4LFA J;  3UNG C;  1V3R A;  1RCX B;  2FGO A;  2P8I A;  2W2M P;  3PVX A;  1U1R A;  4JI1 F;  3TAR A;  2GIF A;  2NXN A;  5ETV A;  1TL5 A;  2ZKT A;  3KK1 A;  2ZZM A;  1F2G A;  3DLJ A;  4OFZ A;  3UN2 A;  4ID8 A;  3TYT A;  4JI2 F;  5LXR A;  5EWF A;  3W61 A;  2IM3 A;  3I82 A;  9ATC B;  3RZA A;  3US5 A;  1SJ4 P;  2FJV A;  4Y2K A;  5DDQ C;  1VJW A;  4A8K A;  4DSI A;  2GO9 A;  2NPF A;  2ZVI A;  1PAE X;  4WCE Q;  3UR3 C;  3M8Z A;  2D3O R;  1JLE A;  2VC0 A;  4YR3 A;  1FFW B;  4XAK A;  4FVC A;  1HWU A;  1M1G A;  3MM9 B;  1F5B A;  2GX8 A;  2C2D A;  1T7P A;  4K0K F;  3UR0 A;  1UVK A;  5HL7 Q;  2GZO A;  5DRK A;  3K57 A;  1FJG J;  1S9F A;  1HI0 P;  4OHZ A;  2MLZ A;  4RKU C;  2OPS B;  3G6X A;  2CZV C;  2ASJ A;  2BR0 A;  2O01 C;  4B9U A;  2RDD A;  2JJ4 D;  3H2U B;  3SCL E;  5A8R B;  4JV2 A;  1X31 C;  2ABY A;  4KGK A;  4BC9 A;  3M9O B;  2PI5 A;  4WXO A;  2HAI A;  2NXC A;  4PG4 A;  5I3P A;  2K06 A;  4GC7 A;  3AOB A;  3DOL B;  2SXL A;  4I64 A;  4WP8 A;  2GHP A;  2J8S A;  3LP0 B;  1U6B A;  4CDI A;  2J0W A;  1Y5I B;  2WSE C;  3KHG A;  2NSC A;  1WHW A;  3C6T B;  3RU0 A;  4NRT A;  1NK5 A;  2HW3 A;  3OVS A;  4LRB A;  4OZL A;  3I5B A;  2OPS A;  1Y0H A;  4L76 A;  2C2R A;  4DUY J;  5ETN A;  1SQE A;  2OAU A;  4OI4 A;  3MR5 A;  3ILL A;  2HG4 A;  4HTI A;  3LP2 B;  3IWL A;  5L9N A;  1DZ5 A;  3GV5 B;  3HSD A;  3ITH A;  3ZTS A;  5HJX A;  5DO2 A;  3VWS A;  3B82 A;  3MFH A;  3MD1 A;  1WHY A;  3W7B A;  3RW6 A;  2QO3 A;  3M32 A;  5CCL A;  3OVB A;  1HYS A;  1U26 A;  4JV0 A;  2CVE A;  4DSF A;  3TI0 A;  1OIA A;  1OPI A;  1VBZ A;  2H5E A;  3G6E S;  3DOM A;  3HVA A;  1TU0 B;  1Q78 A;  4LF6 F;  5IT9 U;  2M3D A;  4E2F B;  4MFB B;  1RWO B;  1Q81 T;  1HQ2 A;  3R1H A;  2MZ1 A;  1D9D A;  1YJV A;  1WEZ A;  3A13 A;  1RAA B;  3QGG A;  1TMM A;  2CAD A;  3DRS B;  3IRX A;  1HPZ A;  5F3Z A;  2GHW A;  4OX7 A;  4RBU A;  1Q8I A;  1WC0 A;  2YKN B;  1YJU A;  4JYA F;  3DHX A;  2CJQ A;  3K8W A;  3GU0 A;  4K2J A;  2RRA A;  4CLL A;  3JQK A;  4EEY A;  2ZZT A;  3BGR A;  4AND A;  3TUZ C;  4O4G B;  1Q7Y T;  2VUG A;  3QJP A;  2E1A A;  3HHL C;  2UXC J;  3QLH A;  2HND B;  4Q44 A;  4ZDN A;  1N5S A;  3CE8 A;  3ZTO A;  4C11 A;  2VIH A;  1FRI A;  3HHL D;  4XIU A;  2HPU A;  2YWH A;  3BKF A;  1XIQ A;  3H59 A;  1JLG B;  2ZDO A;  1YTY A;  3IAM 9;  4CLU A;  5DG7 A;  2LP4 A;  4A8X A;  2ZBR A;  3J7A 1;  1CC7 A;  2M70 A;  4ANE A;  4NLP A;  1S6O A;  1G7C B;  3PEJ A;  4Y2A A;  1PG5 B;  1M5H A;  4OZJ A;  4OX9 F;  1QJH A;  4I67 A;  2Z2Y B;  3P6Y C;  4C3K A;  5A8W A;  3RB6 A;  1YG0 A;  4LF4 J;  1Q1K A;  1SC1 B;  1A6L A;  1GFW B;  2KRB A;  3KG4 A;  1N4L A;  2E9Z A;  1QAX A;  5D4N A;  3W1Y C;  5K9F A;  4DR5 F;  1HNI B;  3CCV S;  1NKE A;  1IVZ A;  3BYR A;  1RTI B;  4KO0 A;  4Y00 A;  4OI2 A;  1K1Q A;  2JNJ A;  4UQT A;  2LU1 A;  5KFW A;  3J80 Y;  4L75 A;  1EP4 B;  4OHX A;  4TY8 B;  5A6P A;  4IRK A;  2C2E A;  2JRS A;  3GQC A;  3DLH A;  5J2P B;  1H73 A;  2FHJ A;  1RAD B;  4K2X A;  4HTJ A;  4G1I A;  3CVK A;  4I68 A;  4ICL B;  4LT6 A;  4NX9 A;  3WQP A;  2C2M B;  2KVQ E;  1NJX A;  1IBL J;  4YB5 A;  3DI6 A;  1MMD A;  3MAA B;  5L46 A;  2L9N A;  2FLL A;  2W4C A;  1GTE A;  1VJQ A;  2HK3 A;  2HFN A;  2WB4 A;  1MMN A;  4OX6 A;  4W92 B;  1J5O A;  1NJW A;  4NLQ A;  1Y4Z B;  1CVJ A;  4KO0 B;  2ZEJ A;  2B5J A;  2DGV A;  3M8Q A;  2CQ0 A;  1GMV A;  3M1V A;  3MM8 B;  3MM7 B;  5D4P A;  4U96 A;  1E6Y B;  4K5R A;  3LPE A;  3BEG B;  4MTP A;  3FGV A;  3CJK A;  4CRJ A;  2VQF F;  1LNQ A;  5HMX A;  1TKX B;  4RW4 A;  2LFV A;  2YKN A;  3QBC A;  1HBM B;  1O51 A;  2G1H A;  1YJW S;  3CJ2 A;  1JQG A;  1RU2 A;  2VG5 A;  5HBM B;  2UUC J;  2UXB J;  2KO1 A;  1JLQ A;  4ZVO B;  1S6U A;  1IKY B;  2RQ4 A;  3G8S A;  4P75 A;  3DRR A;  3RAM A;  4WKR A;  2HVD A;  2V0N A;  4ZCI A;  4C4W A;  4LBP A;  1HI1 A;  5LMN F;  2DXF A;  2R7O A;  1C1B A;  3QJL A;  4V19 X;  1X0P A;  1EJ7 L;  1HW9 A;  2IRY A;  3BZQ A;  3I6P A;  3JSM A;  2QJ3 A;  1SUQ B;  4IQM A;  4RW4 B;  1FHT A;  2EKN A;  2GJI A;  4OQJ A;  5T7L B;  1TUG B;  2XBP A;  4USI A;  8RUC A;  2XGQ A;  2E5H A;  3MPV A;  5B0B A;  3ISN C;  5E7O B;  1V6H A;  4QR2 A;  3GG1 A;  2KXN B;  4G1P A;  3W65 A;  2VQE J;  1KLM B;  3GIM A;  2DHS A;  4DG1 A;  5IC6 B;  2FYX A;  3ZZZ A;  3KLG B;  4UTG A;  1Z2L A;  2HZC A;  2KN4 A;  1XBW A;  2J5A A;  1TMJ A;  1TZ0 A;  4UF4 A;  1QSY A;  3TW0 A;  2VC1 A;  4BS2 A;  3D7S B;  1MSW D;  2NUU G;  4WE1 B;  1IN0 A;  2CPD A;  2HS4 A;  3DOM B;  3FMB A;  4YB6 A;  5J2M B;  5CYM B;  4JV1 A;  5I3U A;  3CO0 P;  2XI3 A;  3FMW A;  5M2R A;  3EDR B;  5GAE U;  3UNY A;  1WC3 A;  3SIP B;  4J37 A;  1WWH A;  2HHP A;  1YJ9 S;  5G4D A;  1VQY A;  2QMW A;  2XMA A;  3KWM A;  4OYI A;  2FJB B;  1B3T A;  4A4J A;  1R89 A;  4WBF A;  1WOR A;  4DOZ A;  4ZIW A;  1XER A;  2DH8 A;  3CJ8 A;  4JI2 J;  1NPK A;  1U1M A;  1L3K A;  1RTJ B;  2AZ3 A;  2VA3 A;  1Q4R A;  1I3O B;  2QLJ B;  3OFG A;  3J7Z 5;  3D0G E;  3IG1 A;  4F3Q A;  4QWE A;  2KFZ A;  1K1S A;  2Y1L B;  3HHL B;  1JLE B;  1H0H B;  1X4G A;  2B3T B;  4EI2 A;  5H9F K;  4QU6 A;  2IM1 A;  3UDL A;  1U1O A;  1S9G A;  2RF2 A;  1FX4 A;  4B3S F;  3VR1 A;  3NOC A;  1HBO B;  1D9F A;  2ZH4 A;  3KUE A;  3MEG A;  3Q22 A;  4DQQ A;  3QLH B;  2JL9 A;  2ATC B;  2ROG A;  4DR1 J;  2BM0 A;  4QWD A;  3FCH A;  2RJZ A;  1P9Y A;  5E3C A;  4ZVP B;  3HX9 A;  4OZ3 A;  1W2I A;  3DCA A;  3MPU B;  2E5G A;  4DN9 A;  3WX8 A;  2VDI A;  4PQA A;  4X2B A;  4X4P A;  3M8S A;  2XY5 A;  3MM9 A;  4ED8 A;  1UCN A;  4PG7 A;  3Q89 A;  4FKX A;  2V2K A;  3TRG A;  4IFV B;  1B7F A;  1WI6 A;  2FHJ D;  1LXJ A;  4LFC F;  1EQ0 A;  2ILY A;  3V4I A;  5KFT A;  4J5O A;  3CC2 S;  5T14 A;  2QA4 S;  1X4C A;  4DI6 A;  1S0O A;  1FEE A;  1Q95 G;  2ZOF A;  1TL4 A;  2J9C A;  4URS A;  3SDE B;  5KFG A;  2YX7 A;  1NDP A;  1KHW A;  2ZJQ Q;  4C3L A;  1WC5 A;  1NRK A;  1S9G B;  2MGZ B;  3R1L A;  4PWD A;  4DSL A;  2ZD1 A;  5ETQ A;  3ZZ0 A;  4K4V A;  3CJT A;  5D77 A;  4EO6 A;  5KFC A;  5G0R B;  4YR0 A;  3V6H A;  4A47 A;  4F2R A;  2ZOG A;  3AJ2 A;  3SMZ A;  1YBT A;  4RU9 A;  3F44 A;  4K4X A;  3PXG a;  3MEC B;  3MMB A;  4DSJ A;  4DSK A;  4O23 A;  4XK8 C;  1HD1 A;  4FS2 A;  2GA7 A;  2JEG A;  1S0V A;  2W9A A;  1Q0N A;  4RNN A;  3W60 A;  1HD0 A;  5LMN J;  1T9Y A;  3WX4 A;  2UUA F;  2OEL A;  2OPR A;  3JS9 A;  2HNZ B;  1TR0 A;  4OX8 A;  4ZCK A;  1E6V B;  1WHV A;  1B0P A;  1H2V Z;  1JLF B;  2BJ7 A;  4HH1 A;  3OL7 A;  3OSN A;  2EFG A;  1P8G A;  5GME A;  3CCE S;  3PX0 A;  4FF3 A;  4DR7 F;  3EVO A;  2XYP B;  3M7V A;  3ZNJ 1;  4PUO B;  2CJY B;  4AUK A;  2B0G A;  4KHP F;  4B3O A;  1HWI A;  2RVJ A;  2X1G A;  4OZN A;  3IN5 A;  4EBE A;  2ZHA A;  1Q16 B;  1U25 A;  2AJF E;  3B4M A;  3K17 A;  3QFH A;  4I6Y A;  2VV5 A;  3MCM A;  3HHE A;  1ZAX A;  3C16 A;  2AYB A;  5KFV A;  2JZ5 A;  4PXD A;  2FHK A;  2V8D A;  3GLJ A;  3IFE A;  2V68 A;  3MHY A;  2PMW A;  2GMH A;  3PHT A;  5ETL A;  1XMO J;  1D1U A;  3OVA A;  2QMU B;  5KG1 A;  4GC6 A;  3FZ2 A;  3H40 A;  3GYN A;  3T6B A;  1ZOT A;  4DQR A;  4LIW A;  4IYQ A;  4LSN A;  5H1S V;  8ATC B;  2XZD B;  2HFV A;  4PUO A;  2BJ9 A;  3FNN A;  3PJW A;  1VQP S;  2AJQ A;  2RHS B;  2BJ8 A;  3DOL A;  4Y28 C;  3W66 A;  3HT3 A;  1BXN A;  1RT5 B;  3KMS A;  3C14 B;  4HH0 A;  4YP3 A;  3Q0A A;  4X4R A;  2LEB A;  2OPR B;  4GO7 X;  5D3G A;  4Q0B B;  1T05 B;  2AX1 A;  1FFG B;  2U2F A;  2HKE A;  2OSR A;  4M5H A;  4U67 Q;  1YK9 A;  2W2P P;  4OHY A;  3FRZ A;  3RRG A;  4ECQ A;  1FNO A;  3K89 A;  4OJH A;  5KG7 A;  4TU7 A;  4PPD A;  2LQJ A;  4X65 F;  3WDO A;  4MIB A;  2V8H A;  3ZZO A;  4B9M A;  4PYD A;  3W9J A;  3T1H J;  1NSA A;  2A2C A;  4RL1 A;  3AOC A;  4OYA A;  4B9V A;  1RUS A;  1U6Z A;  4EMD A;  3KDO A;  5DDR C;  1M1H A;  2UUA J;  1FFS B;  2IRU A;  1WTB A;  3CD7 A;  2ALZ A;  2J0X A;  2GGP A;  4ES2 A;  1HHQ A;  4KB7 A;  4M5I A;  2C3M A;  5FD1 A;  2VOD A;  2HGM A;  4K8R A;  2CVI A;  4ILL A;  3MPY A;  3MR7 A;  5F0U A;  2BJ1 A;  1RWM B;  1HR0 J;  2XMU A;  1C1C A;  4DPO A;  3PNI A;  5KFQ A;  2M8H A;  4G65 A;  1N33 F;  5KT5 A;  2O66 A;  4FYY B;  3OHB A;  1KHV A;  1GH8 A;  2NPI A;  3ILJ A;  1CJV A;  1S1W B;  2D3U A;  4J90 A;  2EFN A;  4I4B A;  3W3S A;  1HWL A;  3MM7 A;  2GVZ B;  4URQ U;  3KLE A;  1W26 A;  1RBL A;  2DB1 A;  3H5U A;  5DG8 A;  2KFY A;  4Y2M A;  3K8V A;  1ZM2 A;  2J9D A;  2KRR A;  1ACM B;  1PYO B;  4WFB Q;  2XY7 A;  3L7O A;  1ARO P;  2KG0 A;  2QTW A;  1RI7 A;  2VPW B;  3SFG A;  3VF0 B;  2ZUG A;  4DPX A;  3AQO A;  4C7Q A;  3GIL A;  2CQP A;  2F9J A;  3PFE A;  4DQP A;  2JC0 A;  4IG3 B;  2L48 A;  3QIP A;  3PRB A;  4OIX A;  3V2U C;  2H4Y B;  1FWK A;  3BH6 B;  1Z1Z A;  3PAC A;  4WFX A;  3KK3 A;  1RAC B;  4LRE A;  1S9E B;  1PJ7 A;  2FHM A;  2IVM A;  2C22 A;  4K4Z A;  2HQF A;  1M5P C;  5F8J A;  5HAO A;  2YWF A;  5DZ7 A;  1S59 A;  3B78 A;  3HJF A;  5T7L A;  2EFO A;  3EWG A;  3TA1 A;  3JAM U;  1IM6 A;  3CCR S;  5AXM A;  1AT1 B;  4MT1 A;  4YUD A;  2HMI B;  3DRS A;  3IRX B;  4H4M B;  1RT1 B;  4NXM J;  2EVZ A;  2CQ2 A;  4JI8 F;  2IYI A;  3Q24 A;  5L1I A;  2CUY A;  4ED6 A;  3IBF B;  2P2C B;  9RUB A;  1IR0 A;  4WFN Q;  4A46 A;  3ENV A;  5L1L A;  1U6F A;  3EGV A;  4NA2 A;  4DV6 F;  5HQL A;  2GIQ A;  1IBK J;  4ETZ A;  2BE2 B;  2VD3 A;  1S1V A;  1KEK A;  2ACY A;  2HVE A;  2CPY A;  1CJT A;  2IHR 1;  4R5P B;  1F5C A;  1N33 J;  1GMW D;  1GXL A;  2QC3 A;  2RKI B;  3KYL A;  1QY7 A;  2N82 B;  4RO0 A;  5KFO A;  1W2B R;  4YDD B;  3OLB A;  2JH3 A;  2IC3 A;  3AJ1 A;  4WP9 A;  3PV8 A;  2LVW A;  1LFP A;  2B7B B;  4PG5 A;  2XUL A;  3UE2 A;  3VZH A;  2AT1 B;  3W8G A;  2VPZ B;  3GJR B;  3NGT A;  5EX3 A;  3OJU A;  1WJ9 A;  2MQN A;  3MPW A;  1KON A;  1TVR B;  2KI2 A;  3CJ3 A;  3DRR B;  2YX1 A;  2XYG B;  3HSG A;  4Q2L A;  5B0F A;  3T9N A;  1PGZ A;  3WC0 A;  3CUL A;  1WG1 A;  3H5Y A;  2R8H A;  2O67 A;  2CNL B;  4NYO A;  1YZ7 A;  5BXI A;  3J81 U;  1WEX A;  1IKX A;  3DOK A;  2HZA A;  2A0F B;  1Y11 A;  3HVR A;  2AGQ A;  4RBT A;  3M6X A;  2D9P A;  4OYO A;  3BDP A;  2BBE A;  5KFH A;  4ED1 A;  4J9R A;  1Y3K A;  3ONQ A;  1I6J A;  2DGU A;  2IJN A;  5AJ3 F;  3F56 A;  4KT0 C;  3DC2 A;  5HAN A;  4DFP A;  3EGZ A;  1S0M A;  3J7A N;  1B0T A;  1LW2 B;  2QA1 A;  2WON B;  4WJB A;  4R25 A;  2QEX S;  4FYD A;  3U27 A;  2C2O B;  3FZB A;  1T8E A;  3A4T A;  5GAD I;  2QLF B;  1S12 A;  1FJC A;  4USK A;  1NKB A;  3SZ2 A;  3Q2S C;  4KBI A;  5KFE A;  3AXM A;  3G86 A;  3OR1 A;  3JB9 k;  2C42 A;  3KLH B;  2JLE A;  2J0Q D;  3X1L B;  1HL6 A;  4JV5 F;  1FE0 A;  1TL7 A;  3CO9 A;  3TVZ A;  4F04 B;  4TXS A;  1RTI A;  4IKA A;  4K5S A;  4WKY A;  5A8R A;  4AL6 A;  1FCA A;  3LAM A;  1X5O A;  1HNI A;  3M30 B;  1OYE A;  1RZM A;  3SSQ A;  4DR7 J;  2B9Y A;  2R7X A;  2KTQ A;  4YEA A;  4NI2 A;  2V2Q A;  4N8N A;  5DG9 A;  4WF9 Q;  2Q3P A;  2QZ8 A;  1NSQ A;  3D3B J;  2HNY B;  3VQS A;  5HI7 A;  2CG8 A;  1KD1 T;  2X7I A;  2ZC3 A;  4X4Q A;  1LEO A;  1R8P A;  1Z4U A;  4DX8 H;  3PEH A;  1VRT A;  3TZZ A;  2AHO B;  3AA8 A;  3WIU A;  1N5Y B;  2E1C A;  1M5V C;  2EC0 A;  2CJ9 A;  1YSJ A;  1ZM3 A;  2V9W A;  5LJ3 Y;  2L08 A;  2R7W A;  4MAK A;  3PFO A;  2DNZ A;  4C11 B;  3QT7 A;  3HD1 A;  4F4Y A;  1ZAW A;  2I6W A;  3DGV A;  1R0B G;  1NEE A;  4PXC A;  3SFU A;  2N3O A;  4F25 A;  4HVZ A;  2Z56 B;  2ROP A;  1ELO A;  3O1L A;  4U6P A;  3B54 A;  1RAB B;  4U95 A;  1UW9 A;  2WK4 A;  3R2C J;  4DR4 J;  2RQC A;  2V67 A;  2XZT B;  3CUN A;  2HFO A;  3RAQ A;  1RT4 A;  5DLG A;  5JUM A;  1RT7 B;  3AB4 B;  4FPR A;  4XDC A;  5KT6 A;  2MQP A;  1HIY A;  2CQH A;  2FJA B;  2UXC F;  1ZAV A;  2OPP B;  1R6Y A;  2P9G A;  3BGL A;  4KSE B;  2VBX A;  4ZVS B;  1SI9 A;  4NLD A;  4X66 J;  4CZC A;  1FDA A;  2GW8 A;  2W2O P;  3KK2 A;  1IR1 A;  1RKI A;  1H7W A;  1XN9 A;  1KNZ A;  1K0T A;  2ZIT A;  1CJK A;  2W1B A;  3EE3 A;  1S97 A;  2W9B A;  3ITH B;  4QIF A;  1ZTT A;  4NCB A;  4V19 J;  1N34 J;  3RBE A;  1G1X A;  2WOM A;  1X4F A;  1XJW B;  4K7Q A;  3TA0 A;  2OUG A;  1LW0 B;  3R9L A;  1JIH A;  1AFJ A;  5IQQ A;  1IBL F;  3OD2 A;  3U1M A;  1TK0 A;  3FQL A;  5GAG I;  3TAM A;  2BOP A;  4NLY A;  1TTH B;  5IWA J;  3LO3 A;  1IQZ A;  2XNQ A;  1WD6 A;  2HNZ A;  3V5R A;  2A10 A;  3RRH A;  4DF4 A;  3GP9 A;  3Q23 A;  1FVQ A;  3IM9 A;  3OFF A;  3VGS A;  3QYY A;  3CWJ A;  4OYX A;  1K73 T;  3J7Z T;  3T3F A;  3BN4 A;  2DD8 S;  3NWG A;  4ZJO A;  3SDE A;  2CQG A;  4I69 A;  2DRA A;  1MU2 B;  2VB6 A;  4B3R F;  1B4S A;  3MUR P;  3E2E A;  2B4U A;  4DCO B;  3WZ0 A;  3R7B B;  2DNO A;  1EHW A;  2R7Q A;  1R31 A;  2MTL A;  3CB4 A;  4IH6 A;  1P9Q C;  1UFW A;  2RB7 A;  1OMS A;  2CPX A;  2BRK A;  2IM0 A;  1PAU B;  2QV6 A;  3GON A;  3R7S B;  4C6A A;  4RWX A;  2RU3 A;  2HYI B;  4TY9 A;  2AD9 A;  1WTF A;  2CPZ A;  3PDN A;  4HYK A;  2XSJ B;  2VFU A;  3ETO A;  4JI3 J;  1UJ6 A;  2ILZ A;  4WP3 A;  3BPD A;  3C19 A;  3CCS S;  1R27 B;  3GV7 B;  2HHW A;  1K9M T;  4U7U K;  4IFV A;  3TO8 A;  6AT1 B;  3DLE A;  4WYW A;  3B8H A;  5ETR A;  5ETP A;  2ZNZ A;  4LMZ A;  2G4B A;  2DNP A;  3HKZ D;  3JAM Y;  1FD8 A;  5F9L A;  3KK1 B;  4ZHR A;  3TAP A;  4NLV A;  1B70 B;  3HZG A;  4OJ3 A;  5CH7 B;  5KFA A;  1GX6 A;  3UCG A;  2AKW B;  3HM9 A;  4LR9 A;  2OMO A;  4OLP A;  1XNR J;  2RD5 C;  4FBU A;  2U1A A;  3C46 A;  4P10 A;  3KXD A;  4NA1 A;  2ZBC A;  4JI0 F;  5KFN A;  3GFH A;  3TJ9 A;  1VC0 A;  1N56 A;  1N0U A;  4CTA B;  3OTO J;  1M5K C;  3D6H B;  2FC9 A;  1YI2 S;  1SIW B;  2UVV A;  2V6A A;  3LGH A;  3QJJ A;  4DZ6 A;  3EXY A;  3I0S B;  2VPY B;  1Q8K A;  4NZ7 A;  3G96 A;  3OXG A;  3P45 B;  5IC4 B;  1SKS A;  5CZV A;  4HI2 A;  5A0Y B;  3TAN A;  3D28 A;  2YKM B;  2RF2 B;  3FBF A;  4DUT A;  3R97 A;  3KMQ A;  1OY8 A;  1S1U B;  4JYA J;  2AP6 A;  2IJF A;  3ZTP A;  2UXD F;  3DFE A;  1ZZN A;  3HHL A;  2KYX A;  1ICE B;  1O8B A;  3SSR A;  4ECR A;  2DXE A;  3MUV P;  3W5Z A;  4OX9 J;  4CM0 A;  3D9B A;  4QYZ J;  2HQC A;  3KJF B;  1QSS A;  3MDF A;  5L39 A;  4DR1 F;  3M9N B;  2LLZ A;  4M5M A;  1F9F A;  1RTJ A;  2HS3 A;  4Y3C A;  5U47 A;  4CM2 A;  4QPX A;  1TFW A;  1XK8 A;  2QA4 G;  1YLX A;  2DGS A;  2DGT A;  1RHU B;  3GG0 A;  3HMJ G;  4NAS A;  5IV4 A;  2O1P A;  4PG6 A;  2FVP A;  3AD7 C;  2MMY A;  3KJV B;  4O0N A;  1RAI B;  3OTB A;  2XEX A;  4HI1 A;  2JVO A;  4NYP A;  3SV3 A;  4FF1 A;  2BKN A;  2DCU B;  3CD0 A;  2VH7 A;  3R3T A;  2BW7 A;  1X5P A;  2GQC A;  3DDK A;  3W9H A;  4Q5V A;  4R0J A;  3CDU A;  1SIZ A;  2IYG A;  2V4R A;  5D8H B;  1RWK B;  2HVZ A;  2RDJ A;  3HT0 A;  3K5P A;  3QRP A;  2JEJ A;  1VI7 A;  2HUR A;  4OYP A;  1QDU B;  2CXE A;  1SKW A;  5F8I A;  1VQK S;  2B4O A;  1XR5 A;  4R5P A;  1SPB P;  1AUD A;  1KR4 A;  3LF0 A;  2F1F A;  2BDP A;  5KFF A;  2MSS A;  3OLA A;  5F8M A;  5LXY A;  2BA9 A;  2CPH A;  2H51 B;  1NHU A;  1X4D A;  2OKQ A;  3H20 A;  1WKK A;  2CA9 A;  2I5J B;  2OO4 A;  1AZS A;  2OEK A;  3GSD A;  4CYU A;  1GK8 A;  4AXI A;  1LWF A;  4Q8F A;  4JV5 J;  1IKY A;  3N6N A;  1NLK L;  3CMA S;  2AEM A;  4WII A;  5EN1 A;  2K7K A;  2GFF A;  4H4M A;  3O44 A;  4KGX B;  1FKO A;  2Q6C A;  1U8S A;  1ZBT A;  1HBM A;  4RJV A;  2HK2 A;  3OPK A;  5C2G A;  2PI4 A;  4TYA A;  2XNR A;  2DKO B;  1HNX J;  1LWC A;  1IBC B;  2QG9 B;  3C15 A;  3DLK A;  4PAA A;  4W98 A;  3G9C A;  2C3U A;  3ZZU A;  4F4K A;  1HWJ A;  2OI2 A;  2ASL A;  4OV1 A;  4U7C A;  4DUY F;  2XZW A;  4DFM A;  5E3P A;  4LBI A;  1FK9 B;  1RCO B;  2PN6 A;  1CG2 A;  5KFS A;  5LOQ A;  1FI4 A;  1TKX A;  1V3Z A;  5HVF A;  5BJR A;  1KOH A;  4IUF A;  1ZH5 A;  1S1X B;  3C2P A;  1YHQ S;  2AMC B;  2VL1 A;  1T3O A;  4CLP A;  3DI6 B;  4UZB A;  2VQF J;  4ECY A;  3MTK A;  3N4W A;  1T0T V;  3PIP Q;  2AIR B;  5EX0 A;  3KLV A;  3BO3 A;  3TAQ A;  2CDR B;  1Y10 A;  2WW4 A;  2IDL A;  5M2P A;  4DV0 J;  1RA7 A;  1SC6 A;  3UD5 A;  2Q1L A;  1T9T A;  4X4O A;  2GO8 A;  2KM8 B;  1HHS A;  1TL3 B;  1ULR A;  3T9Z A;  1WF0 A;  4XO0 A;  4Q7A A;  1VDH A;  2HFU A;  2NZC A;  3DLG A;  1CJV B;  1S1W A;  1ZZF A;  3G82 B;  4ZPW R;  5GAG U;  5HQ8 A;  3CT9 A;  5BYR A;  1CJU A;  1BHN A;  2W7A A;  1NME B;  3CIM A;  5E2Q A;  3ICL A;  5JXS A;  2RT3 A;  2GVZ A;  3EXC X;  4TN2 A;  4JI3 F;  1CS4 A;  5HMY A;  4J9O A;  2PA3 A;  4QW9 A;  2UUB J;  2QX0 A;  1SH3 A;  1XQI A;  5ADZ A;  4X65 J;  2OEM A;  1JLG A;  4M5J A;  1T9X A;  1V9O A;  1FKP A;  1UEV A;  1WAC A;  2KM8 C;  1PYT A;  4WZM A;  1DAR A;  2ZH1 A;  1V5V A;  2ZJR Q;  2Q6B A;  4P73 A;  1RTD B;  4QWA A;  4J9U E;  1X60 A;  2DNL A;  4MKV A;  3CCJ S;  2HHH J;  5B09 A;  4B3S J;  1FA0 A;  1HLW A;  3MUT P;  1RAE B;  4O3P A;  3T1A A;  1R8H A;  3M2V B;  2FC8 A;  3CCU S;  2RRB A;  3IO1 A;  4ZPA A;  4PZV A;  1VFJ A;  4C48 A;  2EBE A;  1HNZ J;  2VOP A;  4FXV A;  4KYZ A;  1NHK L;  5KFY A;  5B0C A;  1MML A;  2PEH A;  3L7U A;  3G71 S;  2JEF A;  1HNZ F;  2IJR A;  4ZOS A;  3ZTR A;  3TA2 A;  4A48 A;  1J5E J;  2OEJ A;  3L95 X;  3LAK A;  1U1N A;  1RIS A;  4KPY A;  4P2X A;  1IKV B;  4DV0 F;  1AZS B;  3RB4 A;  5KT3 A;  3EGN A;  4ZVU B;  2RRN A;  4X4V A;  2I0X A;  4LF7 J;  2DNK A;  2E5J A;  4IH7 A;  4ZVT B;  1EKS A;  1TK5 A;  4N41 A;  1EKR A;  1VYA A;  4NRU A;  2L41 A;  4DV3 F;  2BQR A;  4MYU A;  4LF6 J;  3VAM A;  2JEI A;  2R7T A;  3LUY A;  3D1O A;  4AXJ A;  2XLK A;  3PIO Q;  1NK4 A;  3GTY X;  3HFV A;  4PWW A;  5C5J A;  2OP5 A;  4DV1 J;  2O3D A;  3D6M B;  4J9P A;  2N3L A;  4GRS A;  1GX5 A;  3NGD A;  3QZ7 A;  2Y0B B;  3I9V 9;  2EK1 A;  2NXE A;  3KJN B;  3MEE A;  2DNN A;  2QIF A;  3PKY A;  2HHV A;  1DHM A;  2VG7 B;  3T5L A;  5M2U A;  2YKP A;  1Y5L B;  4DV2 J;  2R8I A;  2FJD B;  4FBT A;  1SCJ B;  2K1R B;  4BLG A;  2W4D A;  4HT5 A;  5GAD U;  5KG3 A;  4DR6 F;  3PR5 B;  4FXW A;  5KOW A;  2VFV A;  4DV2 F;  3NY0 A;  3C16 B;  1NJY A;  4MKB A;  3ZNU A;  3I0R A;  1X8D A;  3CD6 S;  5SUH A;  5K8P A;  2ZJP Q;  1JJC B;  4ECW A;  4FN5 A;  4IR1 A;  5F8G A;  5E3A A;  1RT3 A;  3PJ9 A;  4DMZ A;  3EUN A;  2HVH A;  2APO A;  2B6A B;  4CLT A;  1MW7 A;  3FSX A;  4IH5 A;  3OXF A;  1DRZ A;  2DIV A;  4GKJ F;  1SJQ A;  1HBN A;  2XWY A;  4CP5 A;  3BV8 A;  3LA0 A;  1F3V A;  3L09 A;  2V8G A;  2IVF B;  3AOA A;  1BUX A;  2VHG A;  4ED0 A;  4OV6 A;  1R8B A;  1C0T A;  3VAK A;  1B99 A;  1T9V A;  1VIS A;  1VK8 A;  1WOO A;  1FER A;  1WSV A;  1YVF A;  3L4B C;  2ZKU A;  7FDR A;  4S0M A;  1FJ7 A;  4ENO A;  3AJD A;  2KZZ A;  2CQC A;  1ZM4 A;  1VRU A;  4D3H A;  4RWW A;  1KC8 T;  4WFY A;  3QZ8 A;  1RT6 A;  3HFZ B;  5E3Q A; 
#chains in the Genus database with same CATH homology
 1Y10 A;  1WC1 A;  2QV6 A;  4OYW A;  4OYZ A;  1Y11 A;  1CJV B;  3G82 B;  3G82 A;  4WP3 A;  1CJU A;  4WP8 A;  4OYO A;  1CUL B;  4CLY A;  1U0H B;  2GVZ A;  3C14 B;  1CJT B;  1CS4 A;  4UST A;  4WPA A;  1YK9 A;  4NI2 B;  4P2M A;  3MAA A;  1U0H A;  1WC3 A;  4OYA A;  1FX2 A;  4OYI A;  5D0G A;  3R5G A;  1TL7 A;  1WC6 A;  4USW A;  2GVD A;  4OYM A;  4OYB A;  1AB8 A;  1YBU A;  4NI2 A;  4OZ2 A;  3UVJ A;  5D0H A;  3MR7 A;  1CS4 B;  1WC0 A;  4CM0 A;  1FX4 A;  4P2X A;  4CLL A;  1CJV A;  1AZS B;  4CM2 A;  4CLK A;  2GVZ B;  3C14 A;  5IV4 A;  1CUL A;  2W01 A;  4CLZ A;  5IV3 A;  3ET6 B;  2WZ1 A;  4USU A;  4OZ3 A;  1WC4 A;  4CLU A;  5D0E A;  2BW7 A;  1CJK B;  3UVJ B;  4OYP A;  4P2F A;  3ET6 A;  4CLS A;  2GVD B;  1CJU B;  1WC5 A;  1AZS A;  1CJK A;  3C16 B;  1YBT A;  3MAA B;  4CLF A;  3C15 A;  4CLT A;  4CLW A;  5D0R A;  1CJT A;  1TL7 B;  4OYX A;  3C15 B;  4CLP A;  4WP9 A;  5D15 A;  4USV A;  3C16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...