3WIUA

Crystal structure of pro-s324a/l349a
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKIAPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tk-subtilisin
publication title Requirement of the insertion sequence for activation of Tk-subtilisin
rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 130
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3wiuA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3wiuA02
3SQOP 4ZOQI 5SICE 3VSBA 4CG0A 4LVNA 4C3UA 4H6VA 4RYDA 1GA1A 1KE1A 1V5IA 2ID4A 2Z57B 2WUWE 2ZWPA 3A3NB 3H42A 1PFGA 1ZVJA 1AF4A 1Y33E 2V8BA 4WOCA 1Y48E 1TM3E 4BWGA 3GCWA 3AFGA 2IXTA 1TK2A 2SICE 1Y9ZA 3GCXA 4OV6B 1MEEA 2ST1A 1KDYA 4J94A 3HJRA 2Z2ZA 2PRKA 5I9SA 3CNQS 1KDZA 4KB5A 3F7OA 5AMXA 3I30X 3GT3A 1ITPA 3LPDA 1GNVA 3AJ8A 1MPTA 2W2PA 1XF1A 2Z56B 5JXIA 1V5IB 1TM7E 1SUAA 4I0WB 1BH6A 1Y3DE 5AVKA 2P4EA 4H6WA 3D43A 3PRKE 1BJRE 5JMOA 4DJ5X 3I37X 2IY9A 3A3PB 2PWBA 1GTJ1 4OMDA 4Z2AA 1SCJB 1SBCA 1SUDA 1LW6E 3DE0X 1P7WA 1SBTA 1T1IA 2Z30B 1WMFA 1SCDA 5JXJA 4FONA 3F7MA 3DDZX 2X8JB 1Y34E 3OSZA 3CNQP 4M1ZA 1GCIA 1YJAA 1NDQA 1C9JA 1SBHA 3SQOA 1Y1KE 3CO0P 1A2QA 2Z57A 1R64A 3QMPA 3EDYA 3A3NA 3D9QX 2Z2YB 3BPSP 3QTLA 2GKOA 1YJCA 5JXHA 2PWAA 1EGQA 4AKSA 3EE6A 2QTWB 1SCAA 1SCBA 4OV6A 2HD4A 5CW1A 1PEKE 5ARBA 1AU9A 2Z2XA 1HT3A 4MZDA 2W2NP 1GTL1 3P5BP 1TO1E 3DWEX 2Z56A 1SN7A 1IAVA 3BGOS 3DE5X 1SBNE 2Z58B 1AH2A 1THMA 3PTLA 1YJBA 1SELA 2G4VA 3A3PA 3GT4A 4LVOA 1SCNE 1SCJA 3SICE 1GT91 1SVNA 3VV2B 2WV7A 2Z30A 4K8RB 1SIBE 3LPCA 1BE8A 2X8JA 1SPBS 2E1PA 2DUJA 2WUVA 2TECE 1GA6A 2W2OP 5JXGA 1AK9A 1DBIA 4WOBA 1P7VA 3AJ9A 3WQBA 1ZVKA 2Z2YA 4YN3B 3DYBA 2DP4E 4OMCA 1P8JA 3DVQX 1T1GA 2QTWA 1S01A 1GA4A 4NMXB 3BPSA 1TM5E 3LPAA 1BE6A 5ARCA 2XTJP 4H6XA 3DE1X 4C3VA 4DZTA 1WSDA 3DE3X 2XRMA 1Q5PA 2W2QA 3F49S 2PYZA 1DUIA 2W2NA 3TI7A 2Z58A 1R0RE 4ZARA 1Y3CE 3P5BA 1TM4E 3DE6X 1R6VA 4CFYA 1GTG1 3L1KA 4NE7A 4HVLA 1AQNA 3DW1X 1SIOA 3A3OA 4KPGA 2W2QP 3VYVA 3VV2A 1WVMA 4K8RA 3TECE 3I2YX 1JEAA 1WMDA 2W2MP 3DE7X 5AVJA 4DWWA 5B1DA 1VSBA 4KG7A 1SUBA 1S02A 4CFZA 1YU6A 1Y4DE 3BX1A 1OYVA 1SUPA 2W2OA 2PKCA 4YN3A 3DVRX 1CNMA 1S2NA 1ST2A 1GNSA 2PMWB 1AV7A 1KDVA 3A3OB 2SECE 5FBZA 5AQEA 4NMXA 1V6CA 2DQKA 1Y3FE 3EIFA 1TM1E 1UBNA 4NE9C 3I34X 3LXUX 1KE2A 3DE4X 2XTJA 2HPZA 5ARDA 2SBTA 1PJ8A 5FAXA 5B1EA 3ZXXA 1TECE 3WHIA 4B5LA 3TI9A 3BGOP 2WWTA 5K7SA 1SH7A 3CO0S 2PQ2A 1IC6A 1Y4AE 3GCWP 1T1EA 3Q5GA 3VTAA 1OT5A 1PTKA 3QFHA 3T41A 3GCXP 4JP8A 1BFKA 3H42B 2ZRQA 1Y3BE 4AKTA 5FFNA 2SNIE 1NDUA 1TO2E 4GI3A 1SIUA 3WIVA 2W2PP 1NLUA 3VV3A 3DVSX 1C9MA 1OYOA 1SPBP 1C3LA 3Q40A 4HX2A 2ZWOA 3VHQA 1SBIA 3DW3X 1ST3A 2W2MA 1WMEA 1CSEE 1C9NA 3UNXA 1BFUA 2PMWA 3WIUA 3DE2X 1TMGE 2B6NA 1EA7A 1AVTA 2ID8A 1SUCA 3ZXYA 4NE9A 1SUEA
chains in the Genus database with same CATH superfamily
5CG1A 1GUZA 3QU5A 3GMDA 1E3DA 3D5QA 2HW3A 3EWAA 1E96A 1S0OA 1UP4A 4TUYA 5JAHA 4AZ0A 1Z5OA 3H42A 3G2NA 3KJNB 1ZVJA 521PA 1RTIB 3L4BA 4OAOA 3V2IA 3O1IC 1UZNA 1W9MA 4J9UE 3W62A 1Y6QA 6PFKA 5D3MA 1VRVA 3EWSA 2E9RX 1GR0A 3I9JA 3EW9A 4YCNA 3EDMA 1RT3A 1SM4A 3CH4B 4DMUB 5KCMA 4PHTA 1X92A 5K45A 4KR3A 3G8SA 2H2DA 2ZJZA 3IUMA 3TQ1A 4I0WB 1CDEA 1M8KA 1XK8A 1FW8A 1NF9A 4S1VA 1GL6A 3CW2C 3PRKE 3UD4P 2TYSB 2ZULA 1LSOA 1XKLA 3T34A 4A1FA 2WJWA 1R4ZA 3IIIA 5HKAA 3NUGA 5KAPA 5KNLA 3I6YA 1UDXA 3MSXA 3FKJA 4U3JA 4RNHA 1NBWB 1Y1QA 1Z4LA 1YKFA 4M55A 1TKXB 3INRA 2VFTA 1UMJA 1QTNB 3T7KA 4HS9A 5J1TB 3OLCX 3B9BA 3GBPA 3L7UA 3BO4A 3C3MA 1OS5A 1A3CA 4YMSA 3EZOA 3U3ZA 1P6TA 2ZRDA 3KKKA 3LF2A 1X9SA 4LOAA 5DGIA 4ZMRA 4CQ1A 1MB9A 5K8UA 5H9WA 3TMKA 1B3BA 4ND4A 5HBMA 1PYGA 4CKEA 3QOWA 2JHGA 2JLXA 3C4JA 3ZXWA 1RWXB 3QKTA 1FRZA 4QR2A 2Z8XA 2FW1A 1WX1A 3KK0A 2BT4A 2FOIA 4HDRB 1RAFA 2BMFA 2CWWA 4BMSA 1DG1G 2JL9A 1MWZA 1DRVA 3GJTB 3A3PA 1J25A 4LJLA 1AZWA 2R86A 3PI6A 3BGRA 4TMXA 2H2FA 5TR9A 4Q6WA 1J07A 3T1YB 1PVVA 3VZBA 3E48A 3O9ZA 1IJEB 5LQUA 3VR4A 1CZOA 1PL7A 1L5HA 4YP1A 5I6DA 2Q1WA 4DMFA 1S2OA 2TECE 4MYRA 2I4NA 1HSOA 5ICMA 3RQSA 1GSOA 3JAWA 2DG2A 1NWHA 3GDOA 1WRBA 1IH8A 2H5IA 2QW8A 1XGKA 4YN3B 4ZPXA 2WD9A 3VAJA 3GV5B 1JJHA 2QJTA 4OHFA 3GR1A 2X22A 2NUTB 5ADWA 3EYWA 1X1CA 4PG6A 3ACCA 1BE4A 4DXHA 4E5PA 3R6GA 3MTQA 1F9HA 3OHBA 1CUSA 3EUAA 1C8KA 4JNCA 1W73A 3T06B 5CAAA 4P22A 5IC4B 4JODA 3MWYW 4C48A 5KWVA 3JVUA 4GX5A 2VSNA 4XKJA 1H1TA 4GRDA 3RAMA 4XGKA 3A7DA 4D81A 3WWDA 2WT8A 4UDXX 3N5CA 3LT4A 3IDSA 2ZUTA 5JARA 1FDSA 2YWRA 2V1UA 2GAJA 2ZETA 1JQLB 3PWZA 1O96B 5LLTA 2IS6A 3ZLVA 3A1UA 1U0GA 2C94A 2D2FA 4B83A 3K1YA 3SDEA 4RENA 1WXQA 2VPXB 3COPA 5CM8B 3LX8A 4PZUA 1G7TA 2C04A 3GYXB 1YJ9S 3L18A 5C51B 4GE0A 1PZFA 5B3KA 1H6AA 3P2OA 5AVTA 4AYWA 1Q4RA 4EUSA 5EJ5A 3ODPA 4MQUA 1L8QA 2JKYA 2ZC3A 3JVEA 2DBVO 1FTRA 3MTJA 2EBFX 1FMTA 1ZN8A 2ROQA 5G0RA 5CHYA 4C3ZA 3CT9A 5HOEA 1I7SB 2IOFK 4A6XA 5JSUA 4JYBA 1WTBA 4YO7A 3T7JA 2PV7A 1MMDA 1JFRA 1Q91A 5EMHA 1N36B 1EESA 1G8SA 5A0FA 1IUKA 1RACA 3K0HA 2QV7A 2DH6A 1LV8A 1ZETA 1E64A 3U7QB 1YHNA 4C2AA 4KGZB 3CC2S 4R2IA 5IQ6A 4EFNA 3H9JA 4DV6F 2KXFA 3GGSA 4FFVA 4F2PA 3UT0A 3R76A 1M7BA 3KQVA 2LIPA 4PZZA 2YASA 2VF3A 4G24A 4OI3A 1JXMA 3NASA 3K9WA 3TR0A 4TRMA 3B4MA 4K1LA 3Q23A 2IZ0A 5JQGF 4FKZA 4DWJA 3TSAA 2G5PA 2CYYA 4FMCB 2CHVA 1XOIA 2CDNA 2HQGA 1OPZA 1T0JB 3DJYA 4BKUA 4DR3J 5L40A 4JL5A 3ZXIA 4Z2XA 4EYSA 1G16A 3KYCB 5H0IA 3KLGA 5DQGA 5FORA 3QYYA 3GNSA 4EF5A 2CT8A 4JLDA 1RDFA 5CB4B 2YOHA 3H2HA 3DA8A 2GN2A 5EHXA 3FOWA 2VPZB 2AXQA 3AF5A 1GGFA 3K05A 1Q84A 2FWJA 3BBFA 2YNMC 4OJGA 2IA5A 2IRYA 2EARA 1YVEI 4HH3C 3OJXA 5GONB 2P1DA 3GT3A 5DYYA 3L49A 4X1YA 2ADFA 3WL6A 5DGCA 3AR3A 3ORFA 2IXFA 5LXTA 4HYEA 4FXWA 1GKYA 4PC2A 2CNOB 2IDLA 1FLVA 1H8HD 2FG5A 4QELA 2QEQA 3KETA 4OI2A 1GTJ1 2YCBA 3AOGA 3RWOA 2JFFA 4ZANA 1J42A 1XVLA 2ODTX 1QAJA 2UYOA 4DCVA 4YCAA 2EZ4A 4F97A 4IAOA 1RT1A 1WD6A 5DM7Q 4R81A 5IZCA 5IM0B 2A4KA 1ILWA 2OO7A 1I13A 3SDBA 5TJHA 2W4CA 3GC6A 3ESCA 3TGLA 1FY2A 4IL5A 4L3VA 2WF5A 2WM8A 2FLOA 3BFKA 3Q3JB 3ZGOA 1ACMA 2CYCA 4B47A 1U1PA 3R75A 4DLGA 1CVRA 3PQ7A 1H2ZA 4G6ZA 3HQ4O 2EIHA 1W4CA 3L46A 1SRRA 4FZJA 3LCRA 1NH8A 4ZJPA 1P31A 2ATIA 3GFZA 1IN4A 4XDYA 3JYTB 2YRXA 2WBLC 5AIAA 1DDIA 2FFRA 1C4OA 4ECSA 2J9FB 1MC5A 2XPCA 3ZHBA 4O0IA 4TKVA 4X93A 1VISA 1QVFR 5G0UA 5EFOA 1QK3A 4F3TA 3I0RA 3VZQA 1DTQB 2PANA 3LPCA 1CY6A 4HO1X 4PHGA 3O3MB 4CBVA 2GCIA 2BE2A 5FA5A 4Y2IA 4C08A 2CXRA 3IX7A 2OYSA 1FJ2A 3AEKA 3OIFA 4F50A 4NNPA 4O4RA 3HYLA 2J5QA 3DLLQ 2QXUA 5TVGA 1YRXA 3ETLA 3CJKB 3OO0A 2XUAA 3IUNA 4JIGA 5JR3A 1NDLA 3LLCA 1ULBA 3GRAA 5J3JA 2ZI6A 4CIXA 3VX3A 2PZEA 1OXVA 3IJRA 4M1OA 4GZ6A 3ULHA 1XZJA 2O8NA 2VYVD 5H83A 4H0CA 4B33A 4IOLA 2O07A 2C4WA 1QE1B 3DE3X 4ZHSA 3KSZO 2ZITA 3RVQA 1XR3A 3GA7A 4JQOA 3WADA 3PW0A 4WE1A 3O83A 1U4OA 1EHIA 5IWAF 3DXXA 1S6UA 2VAVA 1BE0A 2AA3A 4I55F 1NOIA 2JFBA 4BVJA 4Y00A 1Z8NA 4WKCA 2ASDA 3FVWA 1GL9B 4CLRA 3IXQA 1D0IA 3TBFA 1YU9A 3BDVA 3O73A 1MOSA 3W4KA 2G2ZA 1A8QA 1RAIB 4UXJA 4CL3A 1VK8A 4R1OA 2OXEA 3Q7EA 4IIGA 2Q3PA 3RGWS 4MVJI 3OZAA 2F3UA 221PA 4Z4IA 4JC0A 3VHXB 4JI6B 2G07A 2QKYA 1DARA 4Z7CA 1RC8A 3A8KA 1ZIXA 1RADB 2FEXA 3LBHA 1FCAA 4PONA 5L4NA 2QXYA 3U2QA 4R8VA 4P93A 1VIMA 4ZEVA 2OUKA 3TEMA 4QYXA 2CNBA 1UMBA 5FB3A 3GCGA 2ZD1A 3SVLA 5MGNA 3PKIA 3F3MA 1ZK3A 2WWTA 1F38A 4U7CA 1V1RB 4ZEWA 1RAAA 1AKYA 1E7SA 1WXIA 2QM3A 1S7IA 2Q2QA 4RVDA 4WUTA 4OD0A 4YDDB 2ABYA 3PXGa 2VJUA 4DADA 1TDJA 4Q5IA 4PG8A 5IDQA 2R6AA 1QB8A 2OHVA 1ZW1A 1S2IA 4OLBA 4HT7A 2QSFA 1SBIA 1TD1A 3I42A 1FFSB 1UPAA 2AHOB 2VO1A 5ALQA 2XNRA 1T9GR 2BKAA 1H2UX 4J9RA 5I8PA 1JWBB 1F5SA 2I5JA 4KDFA 2EEZA 3ZHOA 4DSLA 4Y2QA 4Y2XA 5JWHA 3U3MA 3DLTA 1DFIA 4JJ8A 1XTUA 3FZNA 4UE2A 3LAWA 5CNKA 3REQB 1XZEA 1EFRA 1IATA 1VQ5S 1FFGA 2DQ4A 1A8IA 3NC4A 2A9VA 3RCBA 3FMGA 5KTTA 5EGNA 2PC6A 1FNNA 3VI3B 5HEKA 1QVWA 2CVEA 2PMHA 3J80Y 3NS6A 5TSDA 1RJJA 5K0TA 2CJWA 1IK6A 3K5MA 2DPYA 3S7ZA 4X6LA 1UPMB 3A2MA 1F8GA 3UO0A 4ND3A 3BM7A 2Z3VA 1DADA 2Y76A 3QATA 2VKZG 4R8SA 3T3PB 3HCCA 3JXEA 1JR3E 2E5LJ 5BSEA 3LOPA 2VF2A 3C3DA 1AB5A 2VBFA 3T1HB 2VSFA 3LGAA 4YLYA 4KR2A 1K75A 4YONB 1ZCFA 1A5ZA 4I8IA 4BNHA 2LVWA 3BH6A 4XQGA 3R7BB 4BRSA 3PSAA 1BU5A 3GEPA 4IVQA 2YUIA 5C2JB 3OAAA 2WHPB 1II8B 3KYDB 2XDQB 3VU9A 2C29D 3OX3A 3FOAA 1SBHA 4IKEA 1V7CA 2UP1A 1PS9A 5KDOA 4A8XA 2YVKA 4XRGA 4R5PB 2ZI7A 3BZWA 4ETXA 2BEVA 3OZWA 4HJXA 4HSGA 4PBSA 2XX3A 1YQXA 4LRSB 4ESHA 1YA6A 4RMIA 1X5OA 4RK6A 2LXFA 1V7QA 3CZAA 4I56A 4KMMA 2QK4A 3WVNA 2EFOA 3AQIA 3CMMA 1AQJA 2CNDA 4ELVA 4ZEXA 2FHMA 2BDPA 3OTIA 2W48A 1RC0A 4LNHA 5J4VA 4HTJA 4BASA 3Q6IA 3R4VA 2CE7A 4K6CA 1LWXA 3AODA 4LMBA 2ZCUA 2V7XA 4EA8A 1XRJA 4MS3B 3K7RA 2QG9B 1KO7A 4DR1J 3N87A 3TA2A 1I3OB 5EA2A 4CG2A 1BJKA 4JEMA 1A82A 3ZV6A 4DF3A 2C96A 3EZNA 2BZSA 3NHUA 4QBIA 1QQTA 3U4MA 3HP7A 4EFKA 2RGEA 4M9SA 4P4SA 3CEHA 3DKDA 4NV0A 3RJMA 4AZTA 2I55A 1GA4A 3C19A 2C2KA 3D2AA 1B15A 3EVMA 2Y6UA 3HHEA 2HMIA 1G3RA 1QSGA 1K6XA 4BAZA 3R3VA 3ZDCA 3NS5A 2BDUA 4AJOA 2O8EA 1FX0A 3FPEA 3FCAA 4X8LA 3T0FA 1I7LA 1F8UA 4QOJA 4MV1A 1T3OA 1P91A 3GFYA 4ZZIA 4CT0A 1ZCBA 4F06A 1RHQA 4JEUA 1R6VA 3KB2A 2L48A 3L4JA 3TNFA 5KDLA 3LIIA 5KINB 1WDTA 3WKAA 3K1ZA 1CETA 2IYSA 4B44A 3OCUA 2ONJA 5EE1A 2ZIAA 2AJCA 4ZK2A 5JXWA 1YACA 3W2WB 4I1VA 3HWSA 2R7XA 1OYVA 2RAFA 1M75A 3L7KA 4DCCA 3HPRA 3KZOA 4PQRA 4DLXA 3VH3A 4AMUA 1Q0SA 4GE3A 2BH2A 2ACMA 3C39A 4USVA 3WNVA 3DQZA 3ZGLA 3SSOA 3AA8A 3OXLA 3N0VA 1CR0A 1E7QA 1A8HA 4Q7AA 1SBQA 1CHDA 4F3RA 3H25A 3ZJVA 1H2TZ 4QU0A 2IA6A 3UOAB 2FWNA 2C2NA 4KGDA 3QFSA 2PFFB 4MKRA 2FVYA 1VCNA 2YH0A 4UM7A 5ELLA 1VYAA 1B6RA 5KAKA 1PWHA 1KVRA 4IDDA 1I7DA 2VHZA 2W9BA 4PVDA 4J3NA 5TMDA 2C31A 2QRHA 2HNYA 1DKQA 4CEIB 2K87A 2WABA 4V1Ak 3RVSA 1RHMB 2EAUA 5BV8A 2QJWA 5JANA 1S2LA 2AMVA 3TJMA 2I7VA 2CFOA 4O25A 3ROZA 2ZB7A 1YS1X 2RUSA 2ZATA 1VP3A 3BHIA 1SOWA 5L6MB 3LX4A 3PHGA 3I9MA 1Z36A 3D68A 1Q1NA 3O4HA 4NLWA 4ARAA 1XZAA 4ED3A 4U96A 4N0QA 1BWSA 1KBZA 2ZOMA 3C3PA 2PGOA 4OKSA 5JCPA 3WX0A 2R25B 3CS3A 3GMSA 1NJGA 3CRQA 3CUSA 4PRKA 3MR6A 5DNUA 2N7YA 1JHUA 3CNHA 1A9PA 1M8JA 1YR6A 1NK7A 2DT5A 2WAYA 1Z1ZA 2H5JA 1J56A 3VUFA 1W5EA 2SICE 4CCHA 2CDAA 1YS9A 1CVJA 1P5ZB 3NEAA 1JQ5A 1FDNA 1MX9A 2N46A 5D00A 3LQYA 1F4LA 4X6YA 4K4TA 3R3ZA 1O0PA 1TU3A 4W1PA 3G4SS 2UXBB 5FO0A 3TIIA 2ADOA 1BMQA 3D43A 1O0SA 4L08A 3ILYA 2CPZA 3CMAS 1Q0RA 1DQ9A 1ZPWX 4OI4A 3QE4A 2NACA 1HQUB 4QOFA 1A98A 1XZMA 3Q9LA 5DSZA 3V7YA 3GVIA 3HXTA 3L1HA 3TZEA 4AZSA 3FXAA 2QD2A 2AVDA 5L9AA 2GFQA 1AQ6A 3JAMY 4XDZA 4I9HA 3E6AA 1NP6A 3VPXA 4HDCA 2MCFA 2I71A 1A9XB 3HLUA 1O0CA 4NAUA 4W7HA 2PWAA 3RVBA 3FQLA 1VMAA 3TB4A 1EFPA 1ONNA 2A4MA 1Q17A 4XE5A 2GM5A 3UMBA 2XB8A 8AT1A 2QL5A 2DXDA 2HWIA 4ED9A 4ZVSA 5E9AA 1DJPA 3FPBA 2CFTA 1TCUA 1XZDA 4B3MF 2PGNA 2AKEA 3I62A 4DG9A 1FFYA 2GEKA 3TZBA 1GNQA 3C1UA 2Q0QA 5FUWA 5E3PA 1XTKA 2J7PA 2IM3A 4ZCIA 2C2BA 4H1WA 2ENUA 3NCQA 4YHHB 1PR9A 2CXNA 2BJWA 2QMZA 1Q7YT 3T1YJ 5TQ0A 1HYHA 4YI5A 1JBEA 1SC4B 1Y6FA 1ZH5A 2OCLA 2VQFJ 3CLVA 1LTQA 3EIUA 3NBMA 3ME5A 1UBJS 2KYZA 1XKXA 4C88A 4F4ZA 4XAKA 1X87A 3HKBA 2G25A 3HNPA 3WQSB 4EH1A 4NNJA 4R05A 4U1RA 1FXUA 1SG6A 2ILVA 3ZE6A 3PA6A 4MDYA 2Z6UA 2Q0HA 1RHRA 1OILA 1S1UB 2YC2C 3AG6A 2LQ8A 2Q5QA 1CVLA 3UATA 1G20A 2E5JA 3QOFA 1W2WB 4UNNA 3ICOA 1VFPA 1AS2A 3UH1A 4EQ6A 4JGBA 1EIYB 5EFZA 1OMSA 2GPSA 3KVNA 4BWJA 3G82C 1LTHR 5FX2A 2R00C 2FKAA 4YPFA 3E05A 3VBEA 3MCMA 1KTQA 3N6MA 5E6SB 3O1JC 2QVBA 2VJLA 1TTQB 1R10A 2R5NA 1AQNA 2P2CB 2FMIA 3JWEA 1IBMF 4U67Q 2JCGA 1UBOS 3LVBA 1UBRS 1RWWA 2XMRA 5DDPC 2BKXA 5ENVA 4URWR 1ZM3A 3MM7B 3ANMA 3O2NA 4KPUA 1A7KA 3D4JA 1RXCA 1DQYA 3L92A 4J76A 1C7ZA 3V4LA 2PUTA 3ZTQA 2I4RA 4IHJA 3AY3A 2F1RA 4E5NA 3BJEA 4PN3A 3ZWNA 1H4SA 1WUYA 3OM9A 2ERXA 1LNQA 1EINA 3BMNB 1LPMA 3U4AA 3U27A 2WOJA 4OQLA 3DL7A 1ORRA 2ZDQA 3RHSA 1P1BA 3W7AA 2HKEA 3AD8C 4GKVA 1GT8A 1P4JA 1OA1A 1M0WA 4R3NA 5C42B 3ZXXA 2JGDB 5BMOA 2D3OR 4TVKA 2VPIA 2FUKA 2MINA 4TU8A 4RO0A 2HHVA 3NTOA 1N36J 3BQNB 3EGIA 5K0JA 2FGCA 1HI8A 2ETXA 1JFLA 1DX9A 2B5WA 3OEED 5H9FK 4MZXA 4XYMA 1NLUA 3ER8A 4POAA 1NPRA 1GXUA 4K4UA 4DYHA 4YB6A 4H4OA 4Z4EA 3ILHA 1RT2A 1VE5A 1J0XO 1ATZA 1YI0A 5LXTF 4ARBA 1W5BA 4WJZA 5JJLA 2R6DA 2PCJA 3KE8A 1Z8FA 2HO5A 3JD3A 1RM4A 3BKTA 3WTCA 5B1YA 1RLMA 1NFQA 4GZLA 4CF7A 1LU9A 1OYDA 2DZDA 3LDUA 3AI7A 5AOAA 1JH9A 3O5TB 3QHQA 5EMNA 3WK8A 5KQRA 5T41A 1PEYA 5G4KA 3EXG2 2CXXA 2WJGA 4YPOA 1M5KC 4HUQB 1U8EA 2QE7A 4ARCA 4DHVA 1EG7A 3X0DA 3GAAA 2LRHA 4J0KA 2KFZA 1PFGA 3RIMA 3KQMA 5FBLB 2YBDA 1KJWA 3D1OA 3H1BA 2OHOA 3QNMA 1ZX1A 3RVDA 3NTVA 4X62F 3UNYA 2B43A 4NENB 4BGDA 3LALA 3PXDA 3OQOA 2GNAA 4PYQA 4RHFA 1MPTA 1PV1A 3WP1B 3GLFE 1XMVA 4LF5F 3ONDA 3SFTA 1TMYA 5BWNA 4KWIA 4B4DA 4DX6A 8MHTA 5JVGQ 2VA9A 4JZYA 4L4UA 4BNWA 5AVVA 3BXFA 4QXQA 3FDZB 4HTFA 4BV2A 2IBOA 2AJFE 3HHLD 4NU6A 4RL1A 2VBXA 3BAFA 3PEYA 2Y66A 3EMVA 1T0BA 4JI0F 3EGEA 3A9VA 2OPPB 3UBMA 2WWYA 1EM8A 4GQIA 1E6CA 3OR1A 1GUDA 3F71A 4AROA 2EBEA 1UCFA 4EQZA 1YF3A 4AL5A 5CW2A 2GUWA 2AXPA 4O4GA 1TYEB 4KAXA 1N2EA 1DIGA 1U7UA 4GLLA 5MDHA 5J2UB 5FNVA 3EH2A 2JCYA 4AS2A 3BSYA 1H93A 2HHJA 1ORTA 4JL6A 3OZ7A 2QGFB 3GP8A 5CB8A 1JKJA 3UMFA 2QVGA 4C8ZA 2AFHE 5GQSA 4J7XA 3ENVA 1B16A 2EEPA 4FOSA 4RDIA 4K6HA 5TQ2A 4N9WA 4PWDA 1W52X 4MMOA 4A15A 3PX6A 1ZC4A 5I7AA 2NNLD 3MS2A 5C2GA 2QYHA 2OE2A 2HBQB 3GONA 2I0FA 1U6JA 1HLDA 2M9MA 3DMGA 1ZXLA 3P0RA 1RTJB 3SS9X 5C5EA 2X0JA 5JAZA 3H4DA 1YBUA 3JZMA 3ORQA 3BGVA 4XWOA 2QT7A 3F74A 3MCAA 2Q9AA 1QQAA 1P0MA 4GQBA 1SXGA 5LBUA 1AK9A 2CNNB 5DM4A 4DY4A 5DYNA 5J4LA 4CEJB 2YVLA 2Q50A 4L5CA 1WDKA 1D4AA 4URYR 2ECFA 1XCOA 1BXRA 4BEBA 2WU1A 3DH0A 4RF5A 4FHGA 3KQHA 1G21B 2XHEA 3K16A 2ZWIA 4OP3A 2I6SA 2IU4A 1JAYA 1JX4A 1I2AA 1NVKA 3GEEA 5LQAA 4FVTA 4LCJA 1JLRA 1FVSA 2CVQA 4PC1A 3HP4A 3IPAA 5ETOA 3PF8A 2DEIA 4G1MB 4YUAA 2NO9A 4FR2A 2BMDA 3IHTA 3L40A 3DLKA 2MZJA 5JSQA 4AL7A 3KT3A 2HFJA 1WPGA 1OREA 1ZH4A 4ED2A 3VTIA 3ECSA 4LJYA 3ZZPA 1G0OA 3ROMA 3VVUA 2ZNZA 1KFCB 2PRIA 3I96A 4F5DA 3ILSA 1ZJ5A 4DLSA 4UOCA 1G6OA 1ZP6A 3RYLA 2Y0BB 3QKSB 5CA1F 3M1YA 2VK4A 5DM60 4IQ8A 3FLMA 4M5NA 1UQRA 5C8YB 1YBAA 4JEHA 2A58A 1CUBA 3W6ZA 2BHRA 2LGJA 4EJSB 4RPFA 2LCIA 1X1AA 4DUZB 1M2HA 2QM0A 2XNSA 5CEFA 2B5OA 1CNMA 1JJ2R 4M8KA 2B61A 1B00A 2JIOA 4QICA 4QJ5A 3TP2A 4OJHA 3GFSA 1GYPA 1DT3A 1MQSA 2L9WA 4JI6J 4CT4B 2XSJB 3NIBA 3EGZA 4JBLA 3HKDB 1KOFA 2CL0X 2QQ5A 3VHRA 1HBJA 4G0PA 2CHFA 1FQJA 2O3JA 3E7DA 1H2XA 1MHPA 4ZVTA 2OPHA 4Y0VA 3FW1A 5E9JA 3G02A 1K1QA 5EIBD 5FAXA 4LV8B 4LAFA 1T8WA 2RHLA 1RQ2A 2IZ7A 5FA8A 3C3AA 3FPKA 4TL9A 4MJLA 2BFFB 2AFIA 3RC2A 3WGOA 2D5AA 3VPHA 4C3OB 3Q83A 2JA2A 3IWNC 4E31A 2VXYA 3PNVA 4FLEA 1ODLA 3PNLA 1T9GS 3VZCA 2DYKA 1TJPB 3D54A 1ZD2P 4C8KA 4XCVA 2LFVA 4IOCQ 4DQLA 3LPEA 3UMRA 2PZ8A 4X60A 1R8YA 1NLMA 4MQFB 2A35A 4PX5A 5IS2A 2WTEA 3EMKA 1U6BA 4DB2A 1T36A 4R83A 3E8SA 2Z3ZA 3DM2A 3CVXA 3SX4A 1I7NA 3OL7A 2WWWA 2H8KA 2B4QA 3ANSA 4GR4A 4QGAA 5P8WA 2FIUA 4LYEA 3GOQA 2QRGA 1GAJA 3HSGA 1P7ZA 1HF3A 3O74A 1KEWA 1J8MF 3ENQA 2ZVIA 2M98A 4I2QB 2VNIA 3KJXA 4BO3A 2EC5A 2RHBA 4M98A 4F93B 1XR7A 3CJQA 2FDCA 2EF1A 2G70A 5CXSA 4KO4S 5CA0A 5I7EA 1D1UA 4MS1B 3PUIA 1LLUA 1WCIB 1PSWA 3U37A 1YR3A 4YT8A 4CLTA 4HOYA 3WQRA 1IDOA 5E7MA 1P81A 4LDAA 1F2TA 4YS6A 4EG3A 4C0HA 4YRAA 3FFBA 4RHEA 4GZ5A 3CZCA 3GRUA 1DJOA 4KR0B 1JN0A 1YOVB 2KWIA 4KH1A 4F3YA 4NI2A 3BGFA 1U9CA 3SYRA 1SUQB 3RTAA 3BTSA 5C4GB 4G1VA 2X8WA 4G1QA 1QJCA 4UE6A 1P0PA 3S6EA 4ZKEA 2PSJA 3UBTA 5FLKA 4JI5B 1BXZA 3J81j 3O8QA 4RK7A 4TTTS 3ZQKA 4X6XA 5CCLA 1ORVA 4D3XA 5F73A 1MRZA 2JGFA 4WFAQ 4ESEA 4CYUB 4Q0BA 4QEKA 5TV2A 3V32A 2HO4A 2IVYA 2X8JB 2DHRA 2R8EA 1NP7A 1PF7E 3MT0A 3D02A 3I8OA 5CH8A 1WORA 3TPCA 5DZ6A 5E3IA 2UZ3A 3A6EA 3PDIB 4G0WA 4I64A 1E2LA 3K0AB 3QBJA 2VAMA 2C5SA 5I7SA 2CUTA 3EBLA 1XN9A 1JHVA 5HJYA 3AESA 2ZP1A 4BTVA 5JJCA 2OAUA 1HZJA 1JLCA 3SVTA 1VYTA 1YJXA 3VQSA 5G3YA 2FX5A 2PL5A 1V8ZA 5GOZA 4AF6A 4D82A 5ALTA 3FYDA 1AN0A 4GVXA 4C0BA 1KA9H 1KOLA 1GPNA 1HW8A 3OSNA 1J21A 5J2QA 2D1YA 2NSHA 2QFIA 2N3OA 2Q6OA 3MJDA 4O1MA 3Q8YA 1B43A 1WC1A 3HD2A 3MD1A 2Y1DA 2GV1A 2OYRA 4FDTA 2W9XA 4X2BA 2N4DA 5KFJA 3ZE7A 3QNWB 2COKA 3QU7A 5J23A 3ZHRA 1GGNA 2CCGA 4W82A 4K0KB 1NSPA 3S1AA 1T4BA 3PZBA 4UVGA 2IZ5A 3BKWA 4EYEA 3TQIA 1OY9A 4LF8F 4BRZA 3E01A 1R18A 1FDBA 1TMMA 1RRGA 3Q8KA 1EWYA 4O2AA 2ZCJA 2EZ9A 1M5VC 1VIXA 5KYTA 2X4DA 1X86B 2J5RA 1PWEA 3D6TB 1T9DA 3N6XA 5DDOC 1C8BA 1VG9B 3ZKAA 4DCOB 3PK0A 1LW2A 2PT5A 4ENPA 2RSQA 3TUIC 4UM8B 4KYTA 1ZK0A 4BP8A 3REGA 4KSBA 3A58B 2HNZB 3RIEA 1NW6A 4HRAA 5KG0A 3JQ9C 2AYYA 5L39A 1U2ZA 1OY6A 2WB1D 2AW5A 2HWWA 5E3RA 3LWDA 1ND6A 2O2JA 2IIBA 3L3CA 3QAEA 2PZMA 1QYVA 3FDSA 1Y0BA 3LKBA 1U5AA 3CNLA 1L1FA 2OXFA 1XHEA 2TRSB 1QP7A 1P2BA 3IE1A 4HMQA 5EKUA 3KOZA 2KM8B 1HHTP 1VMBA 4D3ZA 1D9XA 3V2GA 1BEUB 5AQEA 3OZUA 3L0OA 4ZV4A 1KBRA 2AD1A 3PEVA 4V0LA 1QWSA 3LANA 5LM3A 5DT9A 1UF9A 3VGUA 4IINA 3MJ4A 5RUBA 2E6UX 1N48A 3TI9A 3VQTA 4BNKA 3CO0S 2CK3D 3MMBB 5K0LA 2XNDA 2LBPA 4IGIA 1U94A 3RYFA 5FYDA 3BWVA 1QWOA 4CLOB 1GG8A 4WBXC 4FUTA 3JYPA 3P9NA 4BLUA 1MO5A 1UOOA 3UQYS 4UTGA 3G6YA 2R7WA 3C15B 4CIOA 3MT9A 4AMBA 1UBLS 1ZS6A 1YTYA 5E6UB 3OPXA 3H8WA 4FC6A 1E5QA 4LJ5A 1DLOB 3OJWA 3I2HA 4P3OA 1TLTA 2ZR9A 1NX9A 4EY5A 5DO9A 4OZ0A 4MH8A 4CT8A 3DMHA 5LNK1 3GQBB 2I2YA 5LWHA 3UVJA 1KLNA 2HQBA 1IJBA 4TWBA 5HTOA 5B1HA 1OZHA 4LTMA 4I4TA 4J1TA 4M6WA 5CEJA 3CKLA 1ONPA 2I1WA 2V7GA 3FNHA 4ZQCB 1NH7A 2PZLA 3U1NA 1PO7A 2A67A 3H5WA 2W93A 4DUGA 3IOBA 1NSTA 3WL3A 5JFGA 1YG0A 3OOYA 2A9OA 3E3NA 4C9DA 2BSXA 4QECA 4UD2A 1ZRNA 1UAWA 1WULS 1NFFA 3H11B 1BH2A 4HNAB 1U8FO 1H74A 2KQUA 4XDHA 3AR2A 3M81A 1C7JA 1FX1A 4JN6B 4K4VA 3MBOA 2ZW9A 4N6OA 4LK3A 1VBYA 4ES3A 5KFPA 3CHYA 3CZ9A 2W2PA 2AYXA 3J7A1 2RKIB 3LBYA 2UXBJ 3WLNA 4A36A 4XPZA 3BO3A 4IZHA 1EP4A 2RIJA 4MUJA 3TQTA 4WLNA 1PQPA 3DSRA 3TW6A 1KI7A 1WV1A 1PDVA 2I76A 2G88A 2C00A 2AF6A 1MP0A 4IUDS 2FGOA 2ZM5A 3FFIB 2Q2OA 3UT5A 3IUBA 5ETNA 4RUHA 2FZLA 4C4WA 2J9CA 4U9RA 1FXDA 3FYHA 3AV0B 1QLJA 4QOEA 1VBNA 1YITS 1US8B 1YJAA 1JE1A 1EAYC 3SQOA 4QDXA 2CV2A 3DDNA 2IHBA 5A62A 3LTNC 4RW7B 4CNZA 1IKWB 4U7TB 4ITRC 5BQPA 2EJBA 1R16A 5ALKA 1Z28A 1FP4A 2HRZA 1DVRA 2J45A 3PQ8A 2HM7A 1Z47A 1S1VB 1ISGA 4JENA 3E7FA 3C7DB 5EJIA 3CCFA 4F86A 2FVPA 3DZBA 4W9NC 2Q5JA 2FJBB 1L5VA 2H9AA 2VCYA 3BGIA 1VC5A 3A2NA 1RWKA 4KC0A 1JKHA 3MQFA 4YHHJ 4JUCA 5K8TA 3LY5A 1T9KA 3CCRS 3HE3A 4KGKA 1XQVA 3C5VA 3K32A 1D7OA 1E1CA 3BA6A 1CG2A 3JWHA 2XKAA 1ODTC 4OXKA 4NMLA 4PAOA 1NU8A 1NVMB 3UJHA 1ZVKA 2DCMA 2M2IA 4C1BA 3K1AB 1N54B 3ETHA 1XKTA 1X60A 5AI6A 2AQIA 1SXLA 3PU6A 2CAJA 1KYXA 4RABA 1PBTA 2FNAA 5DEIA 4IM7A 2Z5FA 3ERCA 1IY2A 4B84A 5I9TA 2IGTA 3VKVA 3R9XB 3QELA 1E58A 1DLJA 1OI3A 2Q41A 1TV6A 1NZFA 3N05A 5JD3A 1A4RA 5JSHA 1SJ9A 1CFZA 4F38A 2B3DA 3KOOA 3R3YA 5TX7A 3E7XA 3C1TA 3D6FB 5IOLA 2KXNB 1BQEA 4IF6A 4Y2AA 4RK4A 1FRIA 3H2SA 3NX4A 2OBLA 1AKWA 4I6AA 2JJYA 4FXDA 3HU1A 4YXWA 4ALJA 3RB6A 2LD4A 1HKHA 5IT9Y 5JU6A 5B1DA 3C6XA 1VCHA 3UJ3X 4M9QA 2NREA 5DMHA 2EW8A 3E58A 2J0QA 1RTZA 3FCCA 2V7QA 1BMFA 3K94A 4QIVA 1Y1TA 2LA4A 4YTEA 3M32A 2RS2A 5DASA 5H9EJ 3RNLA 2MY7A 3ZKWB 4IYRA 4J2OA 1KI2A 3HGQA 5FBZA 1USGA 4MROA 4NS1A 4BKRA 1I01A 1ZXBA 4AIRA 1RM5A 1F20A 1PN3A 5ERGB 2YYYA 3JQBA 4MI6A 5CGZA 4PPDA 2B6AA 4YROA 3ULKA 5ETPA 2OMOA 5B1EA 4M5MA 4FPXA 3CDBA 1M5TA 1L5NA 3PNPA 1QOQB 3SHFA 4GO5X 1TTHA 1EI9A 1QPBA 2O8VA 4G5RA 1K6MA 4KSYA 5FUBA 3D4LA 1I3MA 4P5DA 1EEXB 1WZEA 2OP5A 3T5LA 2Y1LA 3NWOA 2ZJQQ 1TEHA 5EKSA 2ACVA 1SUWA 3QIAA 4OP2A 3NAMA 2BTOA 1EGVB 4EHJA 3G8CA 5DNDA 4MQMA 4R0JA 3AHIA 4MUKA 3HVWA 4KDRA 1CKEA 4ZAYA 3LBIA 2W6ID 1X4EA 3SHWA 4PABA 1QK5A 2FPXA 2H4WB 1R8CA 2FB9A 3T15A 5KX5B 1RHUA 1H73A 4J0CA 2QRVB 3SV3A 1M1UA 1W87A 4B0PA 2QP9X 2B4VA 1U80A 3VR5D 4QNRA 2CLEB 3OWHA 4HX5A 2FF7A 1OJ7A 3Q41A 3EUNA 3GP9A 1B74A 4LJ7A 4PAWA 1GHTA 5E1MA 4HEQA 2GBFA 3LGHA 5KWSA 2WJVA 7AT1B 1SH0A 3FUYA 4HWRA 2NS1B 2HZBA 5BQOA 1CY0A 4J94A 2KB2A 3B4DA 3HJRA 4FDLA 1L1EA 3ZDFA 4RW9A 2M3DA 4FYVB 2O66A 3WRXA 1QX3A 3BRSA 3OC0A 4MV4A 3L04A 2XRZA 2PMBA 1EKXA 4FJ1A 2V4MA 2ZKLA 2QY6A 2FCRA 3F5FA 3P4UB 1OASA 2GN8A 4B3IA 3MK31 4QC2A 5IT0A 2P75A 4DPUA 1KKUA 4E5KA 1KXJA 2ZOFA 3W5BA 4AECA 3E3AA 3P0FA 3X1XA 2ONZA 4N77A 4MW0A 4J9PA 3DEKA 5BSRA 2KU7A 3VNSA 4FB4A 4PGGA 3BBBA 4WFQA 3KJNA 4DV7B 2PNJA 2KZZA 1RTIA 1CLUA 1RR6A 2HYDA 2O2CA 1Q6YA 3GIDA 1CUDA 4A1OA 1J99A 4OHZA 4KUHA 3EQ7A 4I6JA 3L8EA 4LDNA 1I8TA 3QJ5A 4QVIA 1XA0A 4P71A 2IHUA 1XVUA 4P5PA 1RSZA 3W3SA 4UARA 4IXMA 1QQBA 2Y92A 4QATA 3H99A 4I0WA 2W7OA 3GN1A 1KIMA 5AM2A 1PGPA 1IU9A 2JFYA 3THSA 1JQBA 3NBUA 2AQ4A 2Q21A 2GK7A 2AF4C 5JLAA 3SICE 2BE7A 4FGLA 2PX8A 4RFSB 3Q98A 4YRZA 3KFVA 4UCWA 1SVMA 1ZD9A 1F0XA 3QKWA 3ABRB 4YCCA 2DUUA 1SIBE 1P1RA 1X3LA 1H6DA 1TKXA 3KEQA 2XE6A 1Q53A 2FPRA 3WBBA 1HE1C 1QTNA 2K7FA 3JZIA 1PV4A 4O4JA 1XZGA 3MXHP 4BIIA 2MLXA 1E60A 3F5SA 4IQ0A 3TNDA 4RTNA 3Q86A 1G9TA 1RWBA 4LYAA 4YREA 4F4WA 4JQYA 4MH0R 4DR7B 3AXTA 3VBCA 2FWIA 3LIPA 3MXOA 5HIAA 4YP6A 5H82A 4R1TA 2FMKA 5IMSA 3EMTA 1DRUA 5CIQA 4N5NA 1SUIA 1S1WB 3IP6A 3VJRA 2JGEA 3WGZA 2V0GA 4PLFA 4U6NA 2WB4A 3JSRA 5KHAA 1V1MB 1RWXA 2F4VB 2ZH2A 3SC6A 1KYTA 4POOA 4X4QA 3DO8A 4ZJQA 1T3ZA 4X1IB 3K96A 1N34F 1UA1A 1LLDA 4Q4AB 2DR7A 3N59A 2I2BA 5AK5A 1BFDA 3HA7A 3PT5A 3GJTA 2VP3A 3S8SA 4X84A 2EPIA 4Y65A 3NGMA 4TMZA 4GI5A 4DQRA 4B73A 1GVNB 4O2BB 2JX2A 3D8HA 1OWXA 1DAGA 3OETA 5AXNA 4FN4A 2RAPA 4CUKA 5SYNA 4ABTA 1IJEA 1USWA 3MT8A 3TA0A 2VRCA 2YRWA 1CR2A 3GFVA 2GETA 2Z8YM 4L76A 2O52A 1UJMA 3P9ZA 3OSUA 4O1IA 4EI9A 4LI3X 4JWTA 1Q12A 1P1TA 4L3KA 4DUZJ 1CJBA 1U8CB 4Q5VA 4YN3A 1JUDA 4LHVA 1VXOA 1B73A 5JS2A 2ZUVA 1JQJC 2ATVA 2NUTA 4ZGGA 3G96A 1NPYA 4R1MA 5KFTA 1HNWB 3F4KA 1QPZA 1N57A 5IC4A 2VA8A 3PITA 3NHAA 2QPOA 1WLSA 1E8NA 3F44A 2E3JA 3ILIA 3NP9A 3E5NA 3OE5A 1Q74A 4L0MA 1GMWD 3WKEA 3RT7A 4JB2A 3TQCA 2JATA 1IZ0A 2NO0A 4JC8A 4IIDA 3VKUA 1XROA 3DMTA 3UQSA 5JZSA 1UDRA 2PSZA 2FW9A 1LDYA 1O96A 4OFWA 2O3QA 1Z82A 3WGTA 1YDFA 2QDKA 1ICEB 1VI7A 1RZVA 2XI4A 4I1SA 1RHKB 2VPXA 4W4MA 2LU2A 2QYCA 4MVJA 4TZTA 4R0MA 4L6IA 2ZWVA 2VICA 5I01A 2QYOA 3VDXA 1J39A 4O6VA 2AI2A 2V7WA 2FXIA 3OA2A 2V2ZA 2AJLI 4HRXA 1BHQ1 2OMEA 5I4KA 4N56A 2ZVSA 3A1NA 1NJWA 2BGWA 1K7XB 1Q2UA 4CZ2A 3LP8A 3NXZA 2GPBA 1KS9A 1WY5A 4ES2A 3FSJX 2Q6BA 4ZDJA 1P4GA 4RTSA 3QG5A 3BFPA 2CPIA 4DR3F 3GZNB 3OFGA 1QV6A 2WIDA 4IMPA 5JZMA 4WK3A 3OR2B 1T2FA 1G20E 4XYEA 2VXBA 4AXJA 3V2HA 1T2EA 2I6XA 5EUQB 3QVMA 4MIKA 2CD9A 1YJWS 2Q49A 3U1TA 4E6EA 2WHEA 4ILLA 4DV5F 3KVRA 4P53A 4KXYA 2MKJA 1MV8A 4EUHA 3IV7A 3WLSA 3PEFA 2EBGA 2Z2ZA 1KBOA 1WEZA 1V1JA 2D1RA 4K1XA 2ERCA 2ASYA 3U7QA 4KGZA 1RISA 4GZMA 3J7TA 1TL7A 4MVWA 1Z4QA 3SCIE 1ZD8A 1JRLA 2KN4A 2RGBA 4F8EA 3FSXA 4V2IA 3CN9A 1RYHA 3REOA 2AJ1A 4JI5J 5B7WA 3DFMA 4EW6A 4BS2A 1FWPA 5D3GB 1HQCA 4ZMSA 5FOQA 4GHWA 5HL7Q 3T7DA 2QLWA 4PS1A 1GZHB 4UMVA 4IOJA 2HMAA 4BWVA 1J7KA 1OZGA 2HQIA 4C1NA 5EE5B 2HGMA 4HLNA 2KVQE 2JBWA 2N75A 2PUCA 1JG7A 4B3HA 4L9WA 1FYDA 3VO2A 2W9CB 3C0KA 4OYYA 3KYCA 1VQ8S 2DIUA 1UZLA 2E5GA 3R8CA 3BCSA 1RT5B 2JIBA 2VG5B 2PMKA 5CB4A 1CEZA 2WYWA 3VDNB 3ZTYA 3UIEA 4L1KA 3A1DA 4L6AA 1E99A 2VPZA 1PAEX 4ZTUB 2XMCA 4RA9A 1POWA 4GSLA 2NR0A 4R2XA 4MUYA 3I0MA 1AU9A 2QTHA 4W7SA 2BUBA 2OC4A 3MM9B 1A76A 2X6RA 1UIRA 3IEXA 1D4ZA 3VC7A 4OQNA 1QFMA 2Z58B 2IQIA 1MJNA 4BNZA 1YVRA 2CNOA 1I6WA 3L0BA 4DX7A 3CCZA 3I83A 4WPAA 1KJQA 4R3UC 1OIWA 3UPDA 1FFHA 1JDBB 1QCCA 3ZR4B 1PO6A 2PNFA 4KN5A 1MWQA 3AF0A 2C92A 1FJXA 1NDCA 5IM0A 2E2WA 1YKWA 1A27A 4DAEA 4K0KJ 2GPYA 3B36A 5JBIA 2NSLA 5KVVA 3B1XA 3PIIA 1MJGM 2KI2A 3K2EA 2CLSA 1P8JA 4DSTA 2ZAGA 1NWCA 4RD3A 1JLBB 2AGQA 4AMYA 3X1JA 3GJ4A 4EB3A 3GUUA 2UYHA 1EDZA 2GH1A 3SC2B 3FSGD 5JYEA 3TLMA 3QRQA 4QIGA 4EVIA 4U9IS 3CD6S 2NU7B 3WQPA 4HQKA 4DHEA 1TRHA 3D2CA 4XFKA 1WWKA 3JYTA 1TM4E 1K2VN 2I9SA 2JCXA 2VYND 4C4AA 1XCMA 1FUEA 3DBIA 4WFYA 2J9FA 1H6BA 4LRYA 1REQB 4B4UA 3KQPA 1DTQA 3PEUA 1EE1A 1Y4ZB 1FDVA 1G8JA 2EHDA 2DR8A 4PCUA 4KO0B 3IBWA 2DLDA 4Z3KA 1PHRA 3DL2A 4FFWA 5FI3A 4TYWA 2D5BA 3IVRA 4BZQA 3IT1A 2H1FA 2K4MA 3CJKA 1PWZA 2XVAA 3BSAA 3K4PA 1EHYA 2IDKA 1O97D 4I4TF 2SKDA 4LW8A 1U1FA 1Y3FE 4INZA 2YMMA 4QVKA 2I2CA 2G1KA 2V58A 2O7QA 1J2JA 1QE1A 2JRLA 4WX2B 3UAXA 3DJFA 2P5YA 1JGTA 4NE9C 4NX2A 4URXR 3FB1A 1L4BA 4NYIR 1E1KA 3DAYA 3VU0A 2O5CA 4RHTA 3IBSA 2IYZA 2DM6A 1XZFA 3ZVNA 4N7TA 4FE4A 1F0KA 1JLQB 2IFXA 2LEBA 4Q3KA 4A8MP 3H8SA 2AZDA 3FFWA 2C1EB 2MPUA 5MN6A 3GA5A 2OPRB 2V55B 2G5GX 1RAIA 1DO2A 3HGMA 1U1NA 1VE9A 4LTNA 4WSOA 1GPAA 1QLWA 3BMXA 3HA3A 3MNFA 3OXGA 4TN5A 2HC9A 3QVVA 2YJ5A 3VHXA 1O94D 4M88A 1RADA 3KTDA 4L6CA 4F4YA 4TVBA 2W98A 4F2SA 2EJUA 3TBKA 1CIVA 3MTGA 3NEKA 1C7RA 2VT3A 3UAOA 2IS4A 2FRDC 1X1QA 4XI9A 1V1RA 2ZHOA 2ZYRA 3LQKA 3P49B 3IUPA 3JQKA 5D84A 2XLJA 1NV9A 3GSIA 1FA9A 2HXGA 4DLLA 3H5LA 3NY0A 1HOTA 1OWOA 1XA4A 1R8PA 2CVIA 4WXWA 1OH7A 1SOVA 3LBAA 4E5UA 2E5LF 2XTMA 3UGTA 2IW3A 5LWQA 3RBZA 2A59A 4PAAA 4TSKA 3ZWPA 2XRFA 5KFKA 2HK9A 3THWA 3I9LA 1JA0A 4TU9A 1PT9A 2A0KA 4BJ6A 2NZYA 2JI7A 1OJLA 1KVKA 5K2MA 4OYRA 1FFSA 3WMXA 5AKZA 4B82A 4U2DA 1RRCA 3MOGA 4GNKA 3I37X 3VA7A 4EARA 4CV0A 3BT7A 3EVGA 3RNOA 1SULA 4W5OA 3AVTA 2OSRA 2QLJB 2W70A 2C8JA 4KCGA 3REQA 3WL4A 4IJUA 1C7EA 2IJGX 4ZZ0A 3P94A 4GP7A 3FMFA 4DPXA 4S1WA 1NI5A 4OHMA 4CCAA 2KBEA 5BSMA 3PEJA 3O31A 4N3AA 4RF4A 1MX1A 1FXSA 1SOAA 1AF7A 3ROTA 1PGNA 4F5YA 5ESXA 2YZMA 1GKUB 2OVBA 2HD4A 2QROA 4DV1F 3A11A 3O8CA 4UM5A 3I55S 2RB4A 3PUXA 2V9ZA 4B3BA 2AFIE 5LMNB 5LOQA 1BQXA 3D1QA 3SM3A 4DNPA 4FNMA 1U8YA 5DSTA 4BVKA 2PGXA 3IQZA 1NUHA 1LWEB 5AK3A 2G71A 2Z0GA 2AD9A 5A6SB 1QB7A 4AK9A 2BHTA 2E9TA 3VR2D 3R7BA 3IB3A 1JHXA 4L3OA 4W92B 5B1SA 2WSMA 1II8A 2YJGA 4YGXB 3DL4A 3KYDA 2XDQA 4QQKA 2BIFA 4QQFA 4BATA 4TUYF 2DPGA 3VC3A 1Y9OA 1YUNA 3TZCA 1RS0A 3DBVO 4Y30A 2H06A 3FCEA 3ANXA 5KVQA 3DPUA 4J6FA 4B7XA 2YZ2A 2O01C 4BVHA 1WUKS 2V8VA 4P54A 4TRRA 4FVCA 2I2XB 1W36B 4DWVA 1LZLA 4WASA 3WFJA 3DN9A 1R88A 3DVAB 3TAUA 2NV6A 3DFEA 4BCAA 3M3DA 5F35A 2ZTUA 2QRNA 2AOWA 2CFRA 3U9SA 4B7AA 1AN9A 4ZRMA 1VMKA 4NYJR 2J9YB 5KYKA 3PGA1 1Q57A 2KW5A 4D9KA 4WWHA 5EHIA 2B82A 4KI0A 3W1VA 4MS3A 3TJRA 1MC4A 2QG9A 4Q9LA 1I3OA 4PNHA 3R0VA 3WYFA 4WU3A 3R77A 3BJYA 4UFNA 3H04A 1KAMA 3L7IA 3AZQA 3TVZA 1ORWA 1OQ3A 4L9AA 3NYWA 4ZAGA 2IXBA 2H2WA 2YIJA 1X13A 4ZQGA 1P19A 3ZWBA 1AZSC 4DS3A 2RDMA 2VBYA 4MYTA 1XWFA 1YIJS 1CD5A 8ATCB 1NP3A 2MWMA 3FPAA 2QSWA 3SJAA 3LUDA 3ETNA 5FTLA 4A27A 5B0CA 2X14A 4LJKA 4RBTA 4ANFA 4BJ5A 1JSLA 2CEAA 5HSPA 1QIGA 2HNBA 2V6IA 4HXEB 5KKAA 4INJA 2DHSA 3ZZUA 3PR3A 3KYIB 5AJVB 4ZVPB 1T2CA 1M0TA 3GFBA 1PV2A 3JQDA 2XLIA 4YNBA 1M90T 3FDJA 1Q3TA 2E48A 3JQ8B 2FPOA 4RD2A 1KNQA 3W2WA 4C2UA 2AWOA 5DCLA 2R8IA 2PLNA 4DBLC 1DFGA 1DBDA 4AP5A 4RPLA 4CQJA 4KFRA 3CZRA 2EZUA 2WFZA 4DSKA 3R1IA 4OZ1A 2Q5FA 3PD7A 3FEZA 3PX2A 2WU0A 4B6OA 3AX6A 5AKJA 4BPBA 2FA9A 4Z1MD 1I5EA 2HCTA 4TS4A 4FDFA 2F4NA 4K9NA 4BB6A 2E9ZA 4P4UA 1RZMA 4YT4A 1D9FA 4EYQA 4F4KA 4XDDA 3GJYA 4CTAB 2EYUA 1VGRA 1IY0A 3P1JA 4A6PA 4Q93A 3ZC4A 5ETVA 1FVQA 2WD7B 1IE3A 3KB8A 4WZAB 1BOFA 1YNSA 2FSSA 5B0EA 1PTJC 1NBMA 1NSAA 4UBIA 4OKNA 1CDDA 2P6SA 4CEIA 2JFPA 5BUCA 4ZO9A 1T11A 5KNCH 1RHMA 2O2SA 4K4SA 1YBMA 3AIMA 3HHDA 4R2LA 1F9EB 3GV7B 2RHMA 4H3VA 5I7OA 2BHNA 2IHVA 4HGPA 3CW8X 1YB5A 4QLBA 1V3SA 4N8DA 2OCIA 1LPSA 5KFSA 1SBCA 1JYEA 5ALLA 4JBXA 3GUCA 4KXNA 3NGRA 2PH1A 1J23A 2X9GA 4KVFA 3SS7X 4O4JF 4N82A 2FC8A 3G0BA 3GJ7A 1JXEA 3KJFB 2ZIVB 4TZ0A 4PGHA 1K4YA 4M8NE 5EWJB 3N4WA 4B75A 1M74A 2BR4A 3C3WA 1QU3A 4DV7J 1R4NB 3F73A 4O8ZA 2HLPA 2HHAA 1TFUA 4Y2TA 5LJ5Y 3QGHA 3NDPA 5BN5B 1RCOB 1HT0A 2XB4A 1SCBA 4LJ8A 3KLBA 4PZPA 1TJYA 4Z4FA 2DFVA 2BUAA 3K5OA 4BB0A 3ICPA 4UCFA 4PQEA 1N75A 1V9LA 3JQRA 2QI9C 2GVZB 4WK0B 3S1LA 1QVAA 4BVGA 1LWCB 2KHZA 1Y8QB 1AH2A 4WZZA 4UUWA 4D6XA 1VE1A 2CDBA 3WKDA 1QH9A 1SB6A 3FRYA 1B8VA 3DHNA 1X77A 3T1YF 4IGEA 4PYLA 2CLDX 2VQFF 1CULB 3EXFB 4HB3A 2CADA 3P0IA 1XZCA 2IYIA 4I2PB 5EEGA 1Z0JA 5JCXA 3I2GA 2PBFA 4BB9A 2JB9A 4AZWA 5FTJA 1E9FA 1PL0A 1DBPA 4BNJA 2FLNA 3DG9A 1QG0A 1A9XA 3C5WP 1XKQA 5BSWA 2CJXB 5IEJA 3A4IA 1K06A 1T5TA 4IOMA 3A28A 1HORA 3KQTA 4DR7J 1UPBA 2PSHA 2MZ1A 5D51S 2GZ1A 3V4MA 3IULA 3GRPA 5KFOA 2PLFA 2AJDA 2HPHA 5CFNA 4PEVA 2F4VJ 2FMHA 1RRKA 4YMTA 4DC0A 1X1EA 3M4XA 3IEVA 1HWLA 4QM6A 1DUIA 2BGJA 4BNYA 5AH0A 2B0GA 1IOWA 4ER7A 1XXHB 1QYWA 5AW9A 3WR5A 4F02A 1QK4A 2LPMA 3LPMA 2EERA 1AIPA 3A04A 4HDGA 1P45A 2HJ9A 4ZIWA 4K9QA 2FG7C 3EPGA 4AMZA 4MAAA 3CXRA 1SC4A 4YBRA 2QP4A 2G9NA 3QRRA 1V8DA 1YZ6A 2QN9A 4MVJF 3WSWA 1SVOA 1I51B 2I6TA 4WL0A 3MRXA 4CV1A 5JFOA 4NWBA 3HACA 3Q9UA 2PX3A 3MEDB 1NUUA 5DM2A 4ND7A 1S1UA 1OFTA 4I1TA 2CB9A 4GRSA 2TS1A 2KHDA 3G1TA 1P77A 2GPNA 3IBGA 1XQYA 3OQ2A 2XXJA 3ZHCA 1HNWJ 1KZHA 4E94A 2WTFA 1PUJA 2W4IA 1X7XB 4OGFA 1I7PA 1UXOA 4OSPA 5E6SA 2YXDA 4R1QA 1ADBA 4NEQA 4F56A 3K8WA 1N36F 2XRYA 5F3DA 1B8UA 4CM6A 2HA7A 3KJZA 1O95C 3V4OA 2P2CA 4AKTA 3ZPXA 3SBOA 3ZGNA 4K88A 4USIA 2RIRA 3A6FA 2BA9A 2YPZA 1T9YA 2PEZA 3MM7A 1RRVA 1WAMA 1JDZA 4HZGA 5CDHA 1C9MA 3MYYA 3X43A 1UVKA 1YX2A 4HLUA 2KLHA 1KVQA 4FEAA 1CC1S 1F60B 5K3AA 1TF5A 2W2MA 4Q34A 3FVTA 2D7JA 1IY9A 4H1TA 3D7NA 3BMNA 4EPTA 4UU0A 3AVQA 3BFJA 3HWRA 4HC4A 3ZW7A 5AICA 3LUBA 3DCAA 2P2YA 1TMGE 4AF7A 3BPDA 4DG1B 4FMCF 3RROA 4E6PA 4HGZA 3V8MA 2A92A 3CT4A 4F3NA 5E4YA 3X1DA 3RAJA 1C3VA 4DA8A 2DO4A 4PSCA 1OGJA 2Y8WA 2JGDA 1PGQA 2FN3A 3ZWDA 1VBZA 1GX5A 4A2WA 1CSJA 1R37A 3EODA 1ZVMA 3GDGA 3I9OA 5KI6A 3WI7A 2VOEA 4NONA 5E3JA 2YXNA 1RQNA 1YE8A 1G2IA 3R44A 4OKIA 4AF8A 1W2GA 1O58A 1KK2A 4LZAA 1Y11A 3CCBA 3EA4A 3NB0A 3THPA 2O3RA 2YR0A 1T9BA 1DQRA 3IRVA 4LOIA 3S8MA 3WK5A 2V6GA 4EPXA 2NT3A 3FMIA 1JG2A 4GWGA 3G86A 3T19A 1W25A 4CH7A 3NH6A 5HZKA 1LI4A 3U4HA 4NEGA 4PW0A 1U0TA 1Q3HA 1XN4A 1SUDA 3O4VA 2YHBA 1F0NA 2GCFA 1WG1A 4JT2A 4KHRA 1QVZA 3N8KA 3MB5A 4HUQA 1Z17A 2YZNA 1XIQA 3ZN2A 1ADGA 3CO0P 3K8QA 3CTPA 3VO1A 4FFNA 3QTLA 3A26A 5FTWA 2A9RA 3IH5A 3CCTA 3O38A 5AFSA 4ZI5A 4XLLA 5EXXA 4ZRDA 5AYVA 4DUPA 2FR8A 4KE8A 1GNPA 4OJYA 3GUYA 1FF2A 5F7ZA 3ND9A 4EI7A 1SQ0A 4NENA 2XDWA 2JKZA 5F7XA 4RJVA 3F4BA 3EIEA 5KEIA 4E7PA 3R5DA 1GU7A 4RXUA 3FDZA 1C30B 4WLFA 4AJEA 4D8TA 3WGGA 1NRXA 2FN9A 1XEXB 3CX8A 2OPPA 3BWEA 1KERA 4P3YA 3BTVA 1YJ5A 2O48X 2XWPA 2LV8A 1QVRA 4Q8FA 2ZQYA 3W5SA 4QPXA 1ETUA 1N6QB 4B3RB 1U2TA 3PNMA 4A0QA 3PDNA 3FHOA 5J2UA 3CULA 4KKOB 3KZMA 1AHHA 2OOSA 1QTRA 4PIMA 4X9XA 2QGFA 3QITA 4PRYA 1DKRA 1QHSA 1G5PA 3F9IA 4QXPA 5CPBA 4MCAA 5FBKA 4GMKA 1WLYA 5IJ0B 3LECA 4UHCA 2V50A 3AQ4A 3I4PA 4B9LA 3X1YA 2HFSA 1HNIA 3UV7A 3RS4A 1XFAA 2HBQA 2P6RA 2KM1A 3LVRE 3VYRB 3E4CA 3BA1A 1RTJA 4II3A 1NOKA 1IQRA 4PYKA 1NM5A 4G01B 4KI7A 5PNTA 1F17A 2FSIA 5IC5A 5J4KA 4N76A 2FUNB 1ZNZA 1NCLA 5KTMA 3N5FA 2VJCA 1S8OA 2CWXA 2OV6A 1E2JA 2CNNA 2B21A 1BWEA 3RKUA 4CEJA 4H77A 4QQ8A 1IN8A 4DIBA 5FAKA 3JASB 2D3O1 1AOXA 4RE5A 3THYB 4UUXA 4J0GA 1A0OB 1BE1A 1K8RA 3R5AA 5A2QU 4JJZA 2H0AA 3Q8XB 1GGEA 1G21A 2WU8A 1TU4A 1ZH8A 4IQFA 1N6KA 4UUNA 1CERA 3KKEA 2JDIA 1KH1A 2RHCA 2IV7A 4Q7KA 3FTEA 2M88A 4PSAA 3WWYA 1KJ8A 1EUDB 2RHDA 1U7LA 1R43A 3MUVP 1H6CA 4PM4A 2IZ1A 1Z7BA 3JPWA 4NJOA 1ID1A 1K9MT 4X4SA 3T1HJ 2I91A 2Y1CA 3KTFA 4OYPA 2VH2A 2XE7A 3KBBA 1CQIB 3G2PA 1I0IA 4J90A 5K8IA 3H2IA 3G88A 2PO5A 2ZJFA 4UOGA 3V4SA 3JD2A 5ALUA 5LYYA 2Y0BA 3QKSA 3A0UA 1WWHA 2C3UA 3SI7A 4UHBA 1LDGA 3ZTOA 4CO0A 4EMBA 5C8YA 4DEVA 2VJBA 1IWPB 3DLBA 2P6OA 2JHFA 1L7AA 2Q3CA 2HMVA 4WNYA 2IP4A 1YZVA 1U0RA 2VP2A 3WIUA 4J9VA 2XSJA 4WKOA 4N6NA 3HKDA 3DCIA 1IR1A 3TX0A 1SB9A 4OZ3A 1BROA 1C4AA 1SKWA 4XTCS 4ATNA 3H9GA 4P4LA 2YWHA 3B7GA 4ZVFA 1CFJA 4ZQHA 4X7PA 2G8LA 1N5TA 3JQFC 1LV7A 4U9HS 1LGYA 3IC5A 3B8EA 4E5DA 1H2FA 1A69A 3QSIA 2BFFA 2M6KA 1T8SA 1KIAA 3NHWA 1YFZA 1P6UA 5BQFA 2PMCA 1IVNA 3FCYA 3H13A 4BPRA 4N3NA 3Q2KA 4B6PA 3X1MA 5HP4A 2NUHA 1E1MA 3AFGA 2J5BA 2GFFA 1P6XA 3LUKA 3ND8A 3TTSA 4DOMA 3HB1A 2V97A 2G83A 2AS0A 4NZOA 1SC6A 1XAJA 4AJ2A 3ZK9A 3R40A 4BCDA 2FOLA 3M5WA 4MQFA 4DA9A 5JCOC 5F7OA 4CL8A 3TS1A 5AXLA 1TM7E 3WRYA 3D0GE 1JIVA 1QZ3A 3IFEA 1A95A 3AOEC 2GO9A 3O26A 3PKMA 2WQZA 5A4MS 5AQ1A 1IBKB 2BKOA 3OCVA 2E18A 2OK7A 2IX3A 3ZJ5A 4I4BA 1QGDA 1ZMTA 1PFKA 5B4UA 4RTOA 2QORA 2ZVDA 4I2QA 2ZT6A 2NAPA 2NTYC 4TL8A 1T7PA 3TARA 1B0UA 3KR2A 4MS1A 1WCIA 2ZBDA 1WEHA 2VHQA 3VTFA 2B9YA 3N5BA 3D9QX 3L0CA 3MS4A 1W5SA 1XZLA 1CEXA 1N5SA 3OFFA 5FL7D 1GTZA 1IIRA 3OOEA 2PPVA 2JVIA 1F5NA 3GB9A 1E98A 4LOKA 2GHTA 3RU2A 3O7MA 4KR0A 5I8ZA 3DWFA 1YOVA 3B1FA 1R0BA 1ZWKA 5A71A 3A6HA 1X8JA 1SUQA 5LMNJ 4C6SA 1VC2A 4OYOA 4YRDA 5AKEA 4HT3B 3I87A 1DB3A 1G4UR 4P7JA 4YO8A 5DHTA 3K3PA 3OJCA 5M7EA 2JD1A 1KVTA 1E8DA 5CCXA 4ENUA 1TZJA 5AHOA 1SKUB 1WL8A 4DDHA 5C4IA 1SD5A 2G4CA 3V2UA 2ZAYA 4O0LA 4MVJE 1RA7A 4CYUA 2WTUA 1WF6A 4IO0A 4O4IB 1PJ3A 2OHGA 1V16B 2X8JA 1LBHA 1KD1T 4ALLA 4MEAA 4FCTA 1G19A 3CZ4A 3D2WA 1WF0A 5LQMA 2UU9F 4ZYWA 1SC3B 1XZPA 5F3ZA 2ZBVA 4R2KA 5BSKA 5FXMA 2C7QA 3PDIA 1JX6A 4LJMA 3K0AA 3F56A 4X71A 3AL0C 1KPGA 3I9NA 1WHTB 2VHUA 3Q0IA 2QTBA 3PNBA 1Q11A 3BAZA 2Q9CA 3ROKA 1YIDA 3OFEA 1S1TB 2QMQA 3R5TA 3T9ZA 3OFHA 3FUUA 3BFXA 1G5FA 1IWGA 3WL5A 1NXSA 2EXUA 2L9DA 3CCSS 3HYRA 4NL5A 2B4TO 3IM9A 3I92A 1H0HB 1NBOA 4LRTB 5ELXA 1U1LA 2WSCC 3K09A 2BACA 3KHKA 4XD2A 5K8MA 4NTZA 2LKZA 2WWGA 1NF8A 3QNWA 2V7PA 2QXTA 2DULA 2WNHA 4E1AA 1ZGCA 2RH5A 4MMZB 3PX4A 4GD3Q 3KP1A 4OX9Y 2JD0A 2OFFA 2Q27A 4EA6A 3RS7A 5ALMA 1RFGE 4RGQA 1W6UA 7GPBA 1XZHA 3NAGA 2NXCA 4PWZA 1P2DA 4S12A 4DLZA 3IQDB 3DFIA 4KQEA 3TA1A 4K2HA 1SVUA 2ZZNA 1HDZA 3GJ8A 4DV2B 4XVRA 4QG3A 3KAJA 2GTIA 1HH4A 3WJ7A 4R2JA 4DCOA 1NJIT 4YCDA 5F1YA 4OQQA 1EQUA 2P68A 5H3LA 3KZNA 2JLAA 2W2TA 6ABPA 1JJAA 2C9ZA 3PNIA 3X44A 3ELWA 4AUEA 2HNZA 4GXNA 3HR7A 4MIEA 4CPDA 4AYTA 2QX9A 1KMMA 3SEFA 3D3EA 2CLOB 4BHTA 2BM8A 4M1EA 3C3CA 4GBGA 3V6KA 2BQ3A 4ME6A 4CMIB 4LKOA 4ZO6A 5HKKD 3E9NA 4R6XA 2ZTHA 1EP2B 3KUEA 1SCIA 3NJ8A 4MDHA 2FC9A 1XAHA 4EYOA 4G0OA 3EAQA 1MRNA 3HUFA 1DEKA 5M34A 2FMXA 2FJVA 4BNIA 1KJYA 1E3QA 2HHXA 3SLGA 5DOZA 1LC3A 3JYQA 1P9OA 1UOPA 5BQ3A 4Y3UA 3TOVA 5C53B 4DOZA 3BR8A 4TXJA 4NBNA 3VGTA 5NULA 2XWYA 4DRZA 3ITHB 1YJUA 2VHVA 5EHGA 4Y7DA 3VOTA 3BGSA 4WY8A 3D6VA 3LWBA 1GPJA 3MD0A 4TYAA 5BO5A 2E5HA 3C4VA 3NHPA 1J90A 3MMBA 2AF3C 4TRJA 4HN9A 2OBXA 2XCSB 2IH5A 4EO9A 4CLOA 4CO2A 2XOKD 3E2PA 1PEDA 1TM3E 3NWBA 1EH5A 3C15A 3QUQA 1USVA 1RXIA 4MJ7A 1GDHA 2WVAA 4DJBA 5E6UA 1DLOA 2UXBF 2IUTA 4TS1A 4TYPA 4F9FA 1IZ9A 4IHJF 2IC3B 4ZT4A 2VKTA 3ZO7A 2RONA 2APJA 3ZH2A 1M1HA 2J7UA 2XMDA 3GQBA 3QEOA 1BC6A 1XP8A 2W37A 3R09A 1W1WA 3D4IA 3MN1A 1HTWA 1WKCA 4KX5A 4EHDA 2QAIA 1M8PA 3RVNA 3DE0X 2CQHA 3QO9B 3HUEA 4NOJA 2OCKA 3KUDA 3W9JA 4BLVA 4Q7EA 3UAZA 2NV2B 3T7AA 2O05A 4HAXA 2IEYA 1BYIA 2G1DA 1HTTA 3H2VE 4YRBA 3W2IA 4MB0A 4BNMA 3COWA 4X97A 4E2YA 4ZVQB 3H11A 2OXTA 4IDNA 4HNAA 2F7VA 1R1DA 2JH3A 1TKRA 4JJKA 2XGMA 3ED1A 1JPVA 1EK0A 1VYUA 4F71A 1MVLA 3CKMA 1RAHB 1Z74A 4C4OA 2ZB3A 4URGA 4EEYA 4YRIA 3BF8A 4L4SA 2VTVA 2WD8A 2HWKA 4S1OA 4M46A 2V67A 2RKIA 4CR8A 1Y0HA 1QGUB 4MQLA 3PXUA 3BDIA 1QHGA 1M8FA 2IGBA 4QUEA 3DWIA 2GBCA 4JITA 2XYGB 5BVHB 4E46A 4E21A 3KQLA 3FFIA 3MVEA 4UY85 3H2ZA 3KS9A 4K8RB 2VC1A 3JR3A 1VQOS 2BVNA 1QM9A 3V1TC 1TT5B 4YQZA 4NS4A 1US8A 2AXNA 3M6UA 4A82A 1ENPA 1YGYA 5B1IA 3ADAC 2WPDD 5I7HA 1EBBA 1SG9A 4FDVA 1NVGA 4JBCA 4RW7A 4DL0C 1IKWA 2HVIA 3L05A 3CMES 4C89A 4S2EA 4MCHA 3OE4A 4PWWA 5MGBA 4Q39A 1EK6A 4DMCA 2XTJP 1RBLA 2O2GA 1S1VA 3MAJA 5TT1A 4EELA 3MFYA 1QRAA 1RI2A 3NTRA 1PR2A 3ICQB 2E0IA 4GPEA 3K70C 3GG9A 1S3IA 1YI1A 1Z88A 3WRWA 1VCIA 2CVHA 4F5ZA 3NAQA 2P9YA 1XNGA 1HDGO 3VNUA 3SHVA 2NUPB 4LS3A 4IUYA 3L6RA 3LF1A 3RYHB 2IXEA 1NBHA 1Z39A 3G9ZA 4EDHA 4YLEA 2KKHA 3B6ZA 3AKZA 3DOMB 3K71B 1VKOA 5KQLA 3PVCA 1MU2A 1OI7A 2VFSA 2PZAA 3HYSA 3B12A 3N8HA 4CM5A 2J6CA 2HCFA 1XTJA 4F0JA 1PLKA 2KSQA 1XP5A 2M0GB 5C2CA 2CZVC 2EW2A 3GYNA 4QNNA 4JHXA 3K1AA 4ZPAA 4ELUA 5J1SB 1FMLA 5FNVF 1FJ7A 4HQNA 3JQGB 3QBDA 1Y8AA 3JU3A 3DRSB 4LF7B 2R7AA 4X20A 4I9UA 4TYBA 3R9XA 3R6LB 3C16C 3AF6A 1U2EA 2A0WA 1SHTX 4MRMB 1X7ZB 1W7WA 1GCAA 2W6PA 2H54B 4F8JA 2JLWA 3W7BA 3A4MA 4PQGA 2K2QB 4MCIA 5LB2A 3D6FA 5AW0A 4EP1A 4O0NA 1IB0A 3I32A 4R01A 2R6R1 1T8TA 5IRCD 4A2QA 1GUBA 5GM2A 3CJ4A 4KL8S 1RD4A 3R0JA 1J2UA 1MO3A 5GAEU 3AERB 1ADCA 2XQFA 3E5RA 2FGJA 1ICIA 4M63A 3RANA 3ZKWA 3P2YA 1FDOA 4EKDA 5EP1A 1U1OA 3U02A 4TMFA 1KI1A 2OQ2A 4MR8B 4B02A 3DZIA 2FUG6 3QX9A 3RAFC 4I8XA 1T29A 3SK0A 3WG9A 3D7RA 1GGHA 4QD3A 3ZXYA 1B70B 2QEXS 1KFJB 3ROEA 5JASA 2ZH1A 4C7JA 3C6MA 3O3NB 1BQ3A 3LSYA 4G2TA 3OXFA 4OXYA 2CHQA 1Y80A 2CHEA 3NGXA 2OV1A 4IWYA 4RY0A 4X8MA 3GRCA 3DONA 1E4EB 2K7ZA 2KT5A 1T8UA 2OKCA 3HCWA 4PFQA 5E4FA 1TC1A 5JO0A 4LY6A 1WC4A 5ALVA 2CXTA 3DEYX 1VSTA 4UVEA 1J49A 5BWBA 1MJHA 2GHRA 4JUIA 5HMZA 3OFND 4W8GA 2DNGA 1KDZA 2ZRGA 1UWCA 3UWDA 3KXDA 2CVFA 4NOMA 2O5EA 2PN6A 5TPWB 1XF1A 5D8DA 1UEUA 1BCSB 2OKGA 4CMEA 5CK4A 2OP1A 3CIFA 4ICIA 3S2SA 2PUVA 3VU3A 5LCXA 2ZRNA 10MHA 3U17A 1YCGA 4HNQA 1PJ6A 3Q1KA 3V8RA 2H4WA 1LFWA 1ZSVA 4O3NA 4FCVA 3D7KA 2QRVA 2ZE8A 5GMEA 4ANEA 1KRPA 2A0YA 4WKYA 2PUJA 2YYAA 2FN7A 3ZV4A 4I2VA 2H6EA 5IT9U 3MXTA 3A14A 1H5UA 3QU2A 5DNVA 4HDRA 3FFAA 3BPSP 1MMNA 2I78A 2RG1A 2P3SA 3W65A 7AT1A 4BYGA 1D2MA 1J8FA 5BSUA 3I5AA 3PENA 4RWZA 3TSYA 3NGKA 1VIYA 4IP0A 4FYVA 5KNDD 3MD3A 3W05A 3CX4A 4PWYA 2XAAA 1MTZA 4YC7A 4JLWA 1YMQA 4P72A 2IEIA 1NC1A 9LDTA 2E4UA 4AFNA 1L8OA 4P7VA 3JRXA 1HPZB 5J63A 3UR0A 5JLJA 3AI1A 4ZJLA 1YB1A 2QUHA 1JAZA 4UUQA 2VNJA 2J3QA 2KRBA 4RCYA 3UF0A 3VV2B 3UMSA 4F7VA 3SZOA 2DFTA 2W2LD 1NV8A 3PIOQ 4PGMA 1DBWA 2AJTA 3OZBA 4BBAA 3QYPA 1F2VA 2IEAA 4AURA 4D9NA 3CUVA 3DOUA 2M6LA 5F98A 4EA7A 1U7PA 4B3RJ 4TZKA 3MJTA 5CA0F 2OM6A 3GV8B 1WNEA 1UXHA 1YRQA 1XCLA 3DLPX 3LL7A 4RJTA 2O50A 4C8LA 2QSZA 5HCUA 3DKKA 2VA2A 2R7TA 5CVUA 4OLHA 2WJZB 3KALA 1G8YA 5CH3A 2K8GA 2K5UA 2OVFA 2XD9A 2UV8A 3I28A 2ZS9A 1EQAA 5JCJA 1R0CB 3GLJA 4Y6LA 5DBEX 4DS4A 4X0EA 4EGFA 1ISRA 3GPBA 1F0PA 4U02A 4LGYA 4EHBA 1R00A 3W3AD 1NBME 4LXQA 2R9LA 4RFSA 4OIFA 4NBVA 2B2CA 2WDPA 2E21A 1MOZA 2RC5A 1AJEA 1Z38A 5C8YF 1P60A 5BP7A 3UXEA 4BMDA 3N1UA 2VQEB 4NPAA 2XT6A 1UCNA 3BRWA 4DUZF 3WLKX 1VSBA 1T9CA 1GN9A 2VJAA 1SXJD 1JV2B 4YALA 1RP1A 1Z6AA 3FYSA 3CF4G 4D9IA 4JV1A 4DDTA 4AAYA 2V03A 1B0ZA 4II7A 4HNTA 3AVXA 5D1HA 4ESOA 3IEIA 3AY7A 1PBAA 3RVMA 4LSLB 3SE0A 5TMPA 1GRNA 4Q45A 3K8OE 3KPVA 4B3CA 1TZKA 1VHFA 1S1WA 5KFAA 1Y6GA 4UZFA 1XD8A 3AJEA 3R3JA 5CBKA 1TQLA 1V1MA 1G5HA 1KE2A 4CLPA 2R1TB 5JDCC 4PZAA 4X1IA 4EBEA 4LE2A 3UNGC 2YN4A 4Q4AA 1N1DA 1A04A 3T7IA 4R1UA 3LK6A 4JT9A 3T8YA 2R7QA 4PCVA 2JAWA 2NADA 1EK1A 3AHFA 1VK3A 4O2BA 5EIAA 4JBWA 4YJ3B 1KBQA 2F3RA 3C2PA 1IRXA 3QJGA 3LCVB 4GL4A 1AT1B 4TYQA 2VC0A 2DR6A 5DDRC 2ZJ3A 4PO3X 1X70A 1GCOA 3Q9NA 3AV3A 4OTZA 1CJVB 4YEDA 3GFXA 3WX8A 3P0JA 2LCWA 4V0RA 4O2AF 3W2HA 2FF5A 4UU7A 1MRSA 2W5UA 4B79A 3N2YA 5FLEX 1AKEA 4F8RA 1MT3A 3EIWA 1R66A 2ZUSA 3OVMA 4IUFA 4MP6A 1E3IA 2W2KB 4CKXA 2ASEA 2Y05A 5GONA 2PJDA 4UOZA 1QHIA 3IIMA 1ZOTA 3VM6A 2OFXA 3FGPA 4EMUA 4KN9S 4PC6A 1UAYA 4D5GA 3U1VA 3ZTTA 1Y33E 1Z12A 3HU5A 2F8TA 3GEBA 1DJQA 1DRJA 3E9CA 2MYTA 2ST1A 4Z86A 4YR9A 4P38A 4XPCA 1ICEA 3FBBA 4RFVA 2CL6X 1RHKA 1SZJG 1NK9A 3TW0A 1C9EA 4P6VF 1U7XA 2XWXA 2OMLA 1HA1A 4ZIRB 2FCAA 2ZH6A 2XIQA 3MGBA 4JI5F 1FEEA 4O59O 3LUJA 3FZYA 3PXBA 5F9LA 1IBKJ 5BR7A 3LC1O 2PQ0A 3NKFA 1LW6E 5F0WA 3OW2R 1NK6A 2OG1A 2F90A 2FMFA 2C9YA 3GZNA 3ZVMA 1LD3A 4D9BA 3D6JA 3OR2A 3EHDA 1VGVA 3ESBA 5K5EA 1D0VA 4F3KA 3KZVA 4PAGA 1WDMA 4GXTA 4GAEA 3ON5A 4KU4A 4NZZA 5KFXA 2VH1A 4D4KA 2PQMA 2VRWA 3AR5A 2MGZB 4RJKA 2JEOA 2VHXA 3TSZA 1XF9A 3ZCPA 3NVAA 2K2PA 4HYQA 1E2IA 3DXZA 4KH0B 1E1QA 3H87A 1SJ4P 2G0TA 1RKJA 3FMBA 2HOQA 4F8YA 1S3GA 1HMPA 2V94A 1NZAA 3PJWA 3KLEB 3VNAA 1FW6A 1KI3A 4FYDA 3TVYA 1PLLA 4OZJA 5D3GA 1LK0A 4Y1GA 2R4TA 1QPGA 2V0CA 4RUAA 3GO4A 2Y93A 4IYJA 2QTNA 2PD1A 1KNZA 2FW7A 4D8YA 4AQ7A 1DINA 4K0KF 2G80A 1K6JA 3FK4A 3P8BB 4XVQA 2W9CA 3OLXA 1JJCB 1FTNA 4PX2A 2OGSA 3OEHD 3BXZA 1RT5A 2PO7A 2VG5A 4X5OA 1JU4A 2CPYA 3ZI0A 1EWKA 5M2UA 1NMXA 2JI6A 3S0JA 1H65A 4E5YA 1YI8A 3RUHA 2Z5VA 5FI1B 4KOAA 4YFVA 3M7VA 2QD4A 3MM9A 2W7PA 2FPLA 2D06A 1R9MA 2XCLA 4A0RA 1UWLA 4H54A 2XRMA 4BNDB 3PQ5A 3PR2B 1T9TA 2R65A 5B3JC 2Z58A 1P1KA 3KHRA 4CTNA 3WJ2A 4GRIA 4DTIA 5H59A 4UOFA 2WIKA 2PUDA 2HA2A 2HK6A 3M7IA 2YDYA 1X1SA 4Q3CA 4DLKA 2X9LA 4PNEA 4H08A 2D1SA 4KFCA 4LQ3A 1UJCA 4IVNA 1JKXA 2RS8A 1RZUA 3IELA 2P1ZA 1VHJA 3UDEA 4Z9XA 4OYXA 4X24A 4HDAA 1R0KA 4QDUA 4J9SA 2VDUE 4IGKA 2E1AA 4WXYB 3Q7SA 2MSKA 4PSVA 2XMSA 3G0HA 1JLBA 3OG9A 1PNRA 2OHHA 3F6CA 1FKOB 2R11A 3U3DA 4YAEA 3PJ9A 1T2UA 3T6BA 2AOXA 1J2TA 5IEBA 3L79A 3SC2A 2PIIA 1IN6A 1TRKA 1NX6A 3L7AA 2GERA 4NECA 2NU7A 1HBOB 3BE8A 2CPXA 4LXTA 5D7BA 4N0EA 4YIKA 5U4QA 5F21A 1U2GC 4LSZB 2AHOA 4KMOA 1PW5A 5CVTA 3TD6A 3BKUA 1Z5GA 3PNSA 1REQA 5FIUA 2R2GA 2HY7A 2WIJA 1Y4ZA 2PIDA 4DBQA 5LP6C 1DMSA 2P91A 3NOXA 4KO0A 4IWNA 2WJIA 4CTMA 3VHQA 1RT9A 4BRWA 4FCWA 3QIVA 3U9TA 4F4CA 3DP7A 2RHHA 3RBVA 3WGKA 4C7KA 4C2TA 1R0SA 2ZI3A 4D25A 4AO7A 4ILMA 1QU2A 1JJIA 1RVV1 2OELA 4Z99A 4HPJB 4AICA 3FA2A 4J0DA 1YK0A 4ZPTR 1D03A 3OP1A 1M6YA 1NK4A 1K7CA 3R7NB 5FADA 4WN3A 3ZU3A 1P6QA 2W11A 3QXXA 4HB2A 1E0KA 3VSBA 1GLNA 3JQJA 2FUCA 1Y9JA 3DMPA 1R8HA 3ZUPA 5DM1A 2IDJA 1Q0TA 1FQOA 3OT5A 3MSCA 3I01A 1BWVA 4BFYA 4UD6A 4YWJA 4KACA 4Y6RA 2JFNA 2EX4A 3FBFA 1JLQA 2B36A 2H1SA 3I12A 4DIDA 5A4FS 5JW6A 2EBUA 4MWTA