3WIUA

Crystal structure of pro-s324a/l349a
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
395
structure length
395
Chain Sequence
b'NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKIAPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tk-subtilisin
molecule tags Hydrolase
source organism Thermococcus kodakarensis
publication title Requirement of the insertion sequence for activation of Tk-subtilisin
rcsb
total genus 130
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3wiuA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3wiuA02
3L1KA 1SCBA 1P7VA 2XRMA 1TK2A 3DE6X 3AJ9A 4H6WA 1Y3BE 1GTJ1 3LPAA 4B5LA 1ITPA 1Y33E 1SIBE 1SELA 4NE7A 4KPGA 3SQOA 5I9SA 4Z2AA 1SUAA 1KE2A 2W2OA 1V5IB 1SPBP 1AV7A 2SBTA 3WIVA 1DBIA 4WOCA 2PYZA 2GKOA 3CNQS 3GCWA 5JMOA 2W2PP 3QTLA 1WVMA 1JEAA 4DWWA 1PFGA 2QTWA 4C3UA 3Q40A 3H42A 1PTKA 1SBCA 4NMXB 2Z2YA 2Z56B 5JXHA 2HD4A 3HJRA 2PKCA 2Z57B 1BE6A 1V5IA 4C3VA 1OYOA 1SUEA 3A3OA 1TM7E 1THMA 3TI9A 1Y4DE 4NMXA 4HX2A 3A3NB 1OYVA 5ARBA 1TM4E 1NDUA 4LVNA 3P5BP 1GTL1 2Z58A 1BH6A 1YJBA 5FBZA 2WUWE 1LW6E 1XF1A 1GA1A 1Y48E 2PMWB 1WMEA 2HPZA 1ZVJA 1VSBA 1S01A 1KDYA 1AU9A 1KE1A 2Z58B 1SCAA 5CW1A 5K7SA 1C9MA 3A3PB 1SCDA 4H6XA 1TM3E 1GCIA 1YU6A 2B6NA 4WOBA 1SPBS 3AJ8A 1Y1KE 3DVRX 5AQEA 5ARCA 4J94A 1DUIA 3CNQP 2WUVA 2ST1A 4M1ZA 1SVNA 1TECE 1ST2A 5FAXA 3DVSX 1P7WA 5AVKA 1BJRE 4RYDA 3WIUA 3P5BA 1AQNA 3DE3X 1SIOA 3VV3A 1SBNE 1AK9A 2X8JB 1Y3DE 3PTLA 1TMGE 4K8RB 1OT5A 4KB5A 1S2NA 1GA4A 4YN3A 3VV2A 1BE8A 1HT3A 3H42B 1KDVA 5AMXA 2Z57A 1AF4A 3LXUX 1Y3CE 4H6VA 4BWGA 2PQ2A 1UBNA 2XTJA 3D43A 2DP4E 4AKSA 3AFGA 2W2QA 3DVQX 4LVOA 4OMDA 1TM5E 4AKTA 1SCJB 1C9JA 4ZOQI 2IY9A 1IAVA 4NE9C 3WQBA 1PJ8A 3VV2B 3CO0P 2Z2XA 4CFZA 3BPSP 3DE5X 3VSBA 3VHQA 3LPCA 1YJAA 3DDZX 3LPDA 1SBHA 3EIFA 1SUDA 5JXIA 1T1GA 1MPTA 1AVTA 2G4VA 2Z30A 2ZRQA 4GI3A 3DE7X 2W2OP 4MZDA 3I2YX 1TM1E 1GT91 2PWAA 1TO2E 1TO1E 2P4EA 1NDQA 5ARDA 3ZXYA 3BGOP 2SECE 3UNXA 4CG0A 2IXTA 2Z56A 1EA7A 3A3PA 4JP8A 4ZARA 4DZTA 3ZXXA 1Y34E 2W2QP 1Q5PA 1BFKA 2Z30B 5FFNA 1MEEA 3TI7A 3GT4A 2Z2ZA 2PRKA 2W2PA 5AVJA 1CNMA 2TECE 2QTWB 3SICE 2W2MA 3DE2X 1NLUA 1EGQA 3F7MA 3QMPA 3DYBA 1ZVKA 3BX1A 2V8BA 3BGOS 3A3OB 1Y9ZA 2W2NP 1Y3FE 1KDZA 1GA6A 1WSDA 3GCXA 1SH7A 2ZWPA 2Z2YB 4YN3B 1GNVA 2ID4A 1SIUA 1CSEE 1R0RE 4K8RA 2PMWA 1ST3A 4FONA 2ID8A 3OSZA 1SCJA 1SUCA 3TECE 1WMFA 3VTAA 2W2NA 3WHIA 3EDYA 1P8JA 4I0WB 3GT3A 1SBTA 3I30X 3T41A 2WV7A 2SNIE 1R6VA 1PEKE 4CFYA 3DE1X 3QFHA 3DWEX 4OV6A 1Y4AE 5B1DA 1WMDA 3VYVA 4NE9A 1SUBA 1YJCA 3CO0S 1BFUA 3GCXP 2ZWOA 1S02A 5JXJA 3Q5GA 1T1IA 4OV6B 4HVLA 2DQKA 2E1PA 2PWBA 4DJ5X 5JXGA 3DE0X 3D9QX 1GTG1 3I37X 5B1EA 2XTJP 2DUJA 4OMCA 1SCNE 3DE4X 2X8JA 1AH2A 3DW1X 3PRKE 3I34X 1A2QA 2WWTA 4KG7A 1V6CA 1SN7A 1T1EA 1SBIA 1GNSA 3GCWP 5SICE 3A3NA 2SICE 3BPSA 2W2MP 3F49S 1R64A 3SQOP 1SUPA 3F7OA 1C3LA 1IC6A 3DW3X 3EE6A 1C9NA
chains in the Genus database with same CATH superfamily
3BWEA 1VBYA 1U7PA 5ETQA 2XT9A 2JFXA 1U6BA 4DMFA 1N36B 4EF4A 3K2QA 4BJ5A 2NU7B 2DHRA 2VAWA 2HSDA 3NYRA 3ZN2A 1WLYA 2DFDA 4AY2A 2AIRA 2LKCA 1V8OA 2A9VA 4DCOB 4ZU6X 5BN5B 4MWZA 4L8WB 1O97C 3PGJA 4B45A 1X9IA 5HTOA 3Q8XB 5AOAA 3SC2B 5A3QA 5TRTA 4US0R 1H6CA 3T0IA 3LVBA 4RV4A 3R7BB 1VE5A 2FAXA 2QMXA 2KVIA 3WRVA 4HRVA 1T25A 4CF3A 3Q40A 4ECXA 3EARA 2OMLA 2ZREA 3M1VA 2LD4A 1Z7YA 2H59A 1IQ0A 1Z6GA 1H66A 3L7CA 2AZ3A 2ZCUA 4W90B 2OMEA 1QM9A 3DGVA 5G0UA 1LK7A 1S1WB 2HS3A 7ADHA 5HILA 1V3SA 1JLBA 3RU7A 1THMA 4ADSG 4BLSA 1EKRA 2QQ5A 3GZNB 3IVXA 1JQEA 2Q49A 4DEYA 4DPXA 2QDKA 1HTTA 2XX3A 2GF2A 2C04A 1HDOA 2V8HA 5TJ9A 2PMWB 3QWIA 3MWGA 3OOJA 1V71A 4F9TA 5CD4H 4HDKB 4OY3A 4I4TA 3IAFA 4P4LA 2OE2A 4ZDIA 3FEZA 3LKBA 4PY2A 1YJ9S 2IIQA 3L40A 4HAIA 4DCVA 3AUAA 1PG5A 1N5TA 2HLDA 2MKSA 2O3RA 3H40A 1QXSA 4WD3A 1EKSA 3KEQA 5AOCA 3N59A 4HYYA 5LMZA 1R89A 1PCXA 1N6QB 2XLJA 5T64A 2J3HA 1NUSA 4PYNA 4YCSA 1KMNA 3O1IC 2ZDHA 1N7GA 2CQ2A 4C2MA 3E5MA 3ETLA 1T7PA 2SKDA 1P9QC 2FC9A 2WR8A 4JUDX 3Q23A 1UQRA 1YZVA 2WVDA 2BR3A 2VJCA 4O3QA 2DPYA 2WVJA 3ZJ4A 3PPXA 4E7PA 4ZPVR 3BO2A 1UFVA 1ULHA 4KRFA 2HNDA 4DC9A 1OPXA 5ULLA 1CUXA 4YECA 4ED6A 4B4OA 2A0UA 4OVKA 3EODA 5LXRA 4ZVUA 5IC5A 4Y6PA 3I9LA 3H4BA 5BSGA 5KIAA 4RFVA 3RS5A 2DT5A 1IXYA 2CPHA 5ALDA 5BPFA 4K3VA 4WCDA 2FWRA 4HAXA 5IASA 4HPXB 1ODTC 3FIUA 4X4UA 4QSHA 2IPNA 2Z30A 3OC6A 2IY5B 2Y1KA 4KTTE 1KOFA 3M2UB 1QX3A 3PD7A 4XX0A 4KMSA 2KI2A 4JEHA 6Q21A 1JDPA 1NDQA 2XGSA 3W8NA 4KW7A 3A6JA 4DUYJ 1YONA 2G0IA 4RF3A 1X9MA 2GBPA 3HY4A 3DMJB 3HT3A 1V9OA 1NOJA 1L4HA 3BE6A 3AOBA 2XLCA 3DWGA 4L3OA 3ZVLA 4QAQA 1G7CA 1PBNA 4HLUC 3PICA 1GMUA 4BB0A 1NYRA 1G4UR 2A5FA 4V1CB 3G8SA 3EFOB 4AQ7A 3MM9A 3PCTA 1HE3A 2IHBA 5ERGB 4OHUA 2C2MA 1F0YA 2F65A 2P2YA 5FOVA 3SEZA 3C3WA 3SQMA 2UYYA 3MXTA 3D0HE 4DWOA 3R9XA 3AF4A 1Y3FE 1JLQB 4EO9A 3KKKA 5CG2A 1Q84A 2EGGA 4Q9AA 3J7A1 1MO6A 5HQLA 4RHEA 2UUWA 4MINA 1U9YA 1CVIA 3HI4A 5HJ2A 3WLHA 2R8IA 4EVIA 4JLKA 4YFYA 4JBLA 2XXAB 1EJBA 1F8XA 3NETA 5J43A 3KLVA 2IS6A 1ZZEA 3ENZA 5D1HA 3VR5D 5IUJC 1ISSA 3F41A 5KTPA 1PS9A 2PM8A 4TMWA 1RPJA 1UKAA 4RW7A 2QDXA 2ZTSA 3DI6B 3SVTA 3QE2A 2YL2A 1R6XA 4F8YA 4NYMR 1QRSA 2Y1IA 2FSGA 4WK2B 2E1AA 3ZW7A 1HK7A 1TUEA 3K8QA 2B1RA 4J9PA 3FZNA 5IKXA 1GAXA 3AC0A 1EUZA 3D3NA 2MR6A 1DURA 3E9ZA 4AJ2A 3RIXA 2DPGA 3L5OA 2GBGA 4YALA 4ONEA 2R7SA 1G21E 3I34X 1V7ZA 4G0YA 3CM0A 1TV6A 1E6EA 4RVSA 2JLFA 1KVUA 4Y30A 1K2VN 4F86A 4JSTA 1O96A 4DR5J 2RS2A 3FTCA 1LDNA 1W1UA 4LF5J 4M0CA 2N46A 4HH3C 1PSZA 1SCBA 3CZCA 1XVAA 2WWIA 3NCHA 2JD2A 1VMBA 4FLMA 3SG0A 2EFQA 2JFNA 4D25A 4QJBA 1L5MA 4MWGA 3GIMA 4H6WA 1SQ6A 1ILWA 4B6PA 1FMLA 2K3IA 2R1VA 3SQOA 3KOZA 3WTCA 2PFFB 3P27A 5JPDA 1NK5A 5C34B 2XMGA 4JIMA 2Q4OA 3RKUA 3VDRA 3MJDA 3DSRA 3KUHA 3IESA 2P9YA 2LDIA 3ZNPA 5JSHA 2BRKA 1LEOA 1KR4A 1K5HA 3BMCB 3DR5A 1JS1X 2AJCA 3TZCA 2Y8EA 3ZQ6A 3LXMA 3NOXA 1RTIA 3F0TA 4BNMA 5C7OO 5EMHA 3EWGA 1U6IA 1FSFA 2E1RA 3AUXA 3BYZA 4O1HA 1EUCB 4PLZA 5B3KA 3X0DA 4JWTA 1PGNA 2Q3BA 5KYTA 3ENAA 2CLSA 4B75A 2OZLB 4UE6A 5HQMA 3WNQA 2HHVA 4B3SJ 3KU1A 2O7VA 4ZICA 4EDFA 4WECA 3KBOA 3W63A 1C3XA 4Z0HO 1IU9A 3PZPA 2Q3PA 5CYQA 5HF8A 5B1SA 2FSVC 1E2FA 3GDFA 1YI2S 5G0SA 3SIPB 2Q8QA 2OO5C 4TU8A 3IMEA 1I51B 2YVAA 3NB0A 1R8HA 1CQIA 1OFIA 1N2IA 3RG2A 1MTZA 1MJGM 1U3VA 3HCPA 7REQB 3TOZA 2C9OA 4NLOA 5DTIA 4D9BA 5FPYA 4L5YA 5CDGA 1SIOA 3TQRA 4MICA 4RNOA 5KJ1A 3QRRA 3GBVA 1ZOPA 3GA0A 4WIIA 4MUMA 4BKQA 3J81A 2G2ZA 1KDVA 1PAUB 2QX8A 5GGYA 3ICQB 1U2PA 3T52A 4W7HA 4C7JA 3C48A 5D6GA 4ME6A 5K5MA 4PQUB 2CYAA 4FUTA 2GHQA 2RH8A 4ZVOA 1JA0A 2HFNA 4ZQGA 3I0RB 2H65A 4K7QA 1N2CA 1W2WB 5FHQA 1HIYA 3DDZX 1D4AA 3T4EA 2AD5A 2QRGA 1LLUA 1H5UA 1UA1A 1KVSA 4J0EA 2VHQA 2BFBA 1MC1A 4ILKA 4FYWB 4ENPA 4KGDA 4OZ3A 5LMUF 4F1KA 3QGMA 1I32A 3HFSA 2EZUA 1UFRA 3VGSA 1OI3A 4ROTA 3NT2A 1GGVA 1CW2B 1EZZB 4YUWA 4B3MF 4B9LA 2VT2A 1GTRA 2KJWA 3FHLA 1S1TB 2COEA 1PR3A 2ZOGA 2JATA 2MMGA 4FR2A 4KN8A 4JI3J 4MVJG 3EXHB 1QO9A 3Q9NA 4NI2B 2BJDA 1KEEB 2CBZA 2PKRA 4DCCA 4D0SA 1RYZA 1THGA 4FXDA 2QOEA 1ZVKA 4YA6A 4NBNA 1QQBA 3D81A 4NXMB 5FLXU 4BPRA 2D5BA 1WMAA 1PT7A 2J5RA 1ZD4A 5LQDA 2ZYVX 3HJGA 4XCVA 3PVSA 3M4ZA 2HMSA 5J2UF 3M8RA 3EGWA 5HROB 3FG9A 4Q4CA 1SURA 4LZPA 1CB0A 2YWWA 1CNEA 3DFZA 4ZKEA 3IAS9 4HFJA 3AQ4A 4RTOA 2X6TA 3IV6A 3C16B 4Y2MA 3TQOA 1F5SA 1VL0A 1OQ6A 1GQYA 1FNCA 4EW3A 3CW9A 4YY3J 4UDXX 1JLQA 2OCBA 4IXNA 3ASVA 2Z6UA 1OX6A 4TZ0A 3H9EO 1EXDA 1QHNA 5D3MB 1RWQA 1T0JB 2XMUA 2XD4A 4NAHA 2HXGA 3ACDA 4NCGB 4Z9BA 1N7IA 2F4VB 2FHJD 3L1HA 2Y9MB 1CQMA 3BHIA 2DGQA 4JI3F 2MYFA 4B4WA 4U2KA 3H5XA 1CUCA 1YA4A 1ORVA 1TRHA 1BSVA 2JL1A 2I80A 3BB3A 5TB5A 2OB1A 2Z9DA 1RHKB 4WSOA 4O4HF 2WNSA 4PYKA 4Y9SA 4FC6A 4I3FA 4RTJA 4PANA 3VH3A 3TYXA 3MUVP 3VC1A 3L5KA 4Q8FA 2YBDA 2H1LA 1QUFA 3GWZA 4C05A 3IAS1 2PTHA 2W9BB 3KYCB 4O2BA 1P1LA 2O5VA 2JASA 4GPD1 2ZSBA 3NXZA 1F6BA 1TCUA 4I50F 4KKXB 4ZVTA 4C2UA 3W2GA 2Z6QA 3DF7A 4TV8F 2PZ8A 3TQTA 1U5BA 1MIOB 2BP7A 1QD1A 1GN8A 2XM3A 1JZSA 1O6BA 2NPFA 2ZH7A 1BWVA 4ZN6A 4Z51A 1KE2A 2W2OA 2MLYA 1OBCA 1QKJA 1UP6A 2QHXA 2E37A 2JHPA 1H9AA 3JU3A 2PMFA 2Q9CA 3GFBA 4RTQA 4RLEA 1A98A 3P45A 3VKVA 5L9NA 1GZ7A 2O7SA 3K2IA 1JTVA 3CULA 4RKEA 1H23A 3K7RA 2W7PA 4W98A 5ENVA 3HUTA 4FFBA 3O8LA 4MX8A 3O4GA 2GV1A 2CKDA 1S8FA 1AA6A 2G1KA 2KLBA 3PXUA 5LZ2A 1T0TV 2AWZA 1XALA 1REQB 1E79D 3M6VA 4BATA 3G8AA 2C4TA 5CFPA 1I7SB 4JOBA 4RZ3A 2B37A 2QRJA 3PGVA 2IZ7A 4EB3A 5EKDA 2CD7A 2RMKA 2VZLA 1FHTA 3MPUA 2ZBEA 4RW0A 3QWHA 2BMDA 2R86A 4YO8A 1Y80A 1PV4A 2R2RA 4YMUA 1XRJA 4A8PA 3C4JA 3JASA 3Q85A 1UOOA 4CXMA 4N7JA 2J0SD 3G0DA 2NQPA 3GPAA 5ITZB 2C2BA 2IHYA 4Q0MA 5A2GA 1GKKA 1OX4A 3PR4A 4MIOA 4GPIB 4ENUA 4A6EA 1J9GA 5ELLA 4BQIA 1UTAA 4B3IA 2PBRA 1JDBC 3ZE7A 2VYQA 1G4CA 1PLJA 1O5TA 4AZ0B 5FI0B 4XUCA 3F8TA 5L9XA 3BICA 4M2LA 1GAWA 1VKNA 3QU4A 5EMMA 2EG5A 1KI9A 4AW9A 1VC2A 4YAOA 2BFWA 3TTTA 5MGNA 4PNPA 2VKTA 4EG0A 1ND5A 3W3AA 4NKRA 4XSGA 2XTJA 5DBGA 3BB4A 2Q3DA 1A8PA 3LPYA 2VJMB 5ETNA 5CXSA 2Z5VA 2I8AA 3DAHA 1SPXA 4IWYA 3IS3A 4KC0A 3R5JB 4ER8A 2GBCA 1YL6A 1O7JA 5IC4B 1UKEA 1EP4A 2O3TA 4TOIA 2I4NA 1PFVA 2AH5A 2WT9A 5IABA 5AT1B 1NF9A 1WHTA 4CV3A 2XTNA 2IVZA 1SBZA 4RX6A 3DGPA 4FNAA 4CR6A 1J42A 4ICLB 2XKAA 2OFGX 1N33B 4AROA 3T3NA 4LF9B 2GAJA 2WAQD 3TTYA 4KKOA 2C99A 1ZYQA 1ZM4A 4H4EA 1R3NA 2PA8D 1N6IA 4JC5A 4XDHA 3OTOF 1SB9A 3BQNB 4TLBA 3QUAA 4RANA 1ZMXA 4Q4HB 4ZVLA 4WXEA 4LCBA 3LLMA 1FJGB 4TPKA 2GW8A 3MS7A 5BWLA 2P0AA 3EEOA 4HTFB 3MAGA 2O2ZA 3M6IA 2ZSJA 3DKVA 2QV6A 2JLCA 2HMVA 4JLPA 4L8YA 1QIDA 3BQ1A 5G4KB 4KQMA 3CCRS 2XB2D 4W5NA 1HNNA 5IPFA 1IQTA 5AXCA 1YAJA 1DQ9A 5LQAA 5A2QU 4MTLA 3GLGB 2BQRA 1HH4A 5TC4A 4DZDA 4XPIB 3KWJA 1R6TA 3A6FA 3HB5X 4KVFA 2XCTB 2ECFA 5JEDA 3W3ZB 4H4KC 1HETA 3MJRA 4OV6A 1P7YA 4ZTZB 2X1HA 2D3OR 2VXOA 1K97A 1QS0B 3L79A 3FLAA 4MW5A 3OHSX 2VF5X 3DDNA 5U1PA 1G64A 1K7EB 1VIOA 3A28A 4KRGA 4Y8VA 3ZU6A 4RPHA 2OP0A 1F1BB 3E82A 1TVKA 2Y1LA 3PGXA 1DRKA 1GFZA 4USUA 4QU5A 4U95A 1TU0B 5BN4B 3L7KA 2AUMA 2DFVA 2Y1FA 5INTA 4IJ6A 3M8PA 4BPBA 4C0LA 3RIHA 1MKYA 5E7IA 4FZ3A 2YRXA 4ZVUB 4NX9A 1IM6A 4TQRA 2NSBA 2W11A 1BA2A 4IH5A 5LIPA 4FBUA 5ELXA 2GEUA 4QATA 1X5TA 2FMIA 3DE6X 2FA9A 1LSOA 4MYUA 4RCZA 4OHPA 4YRSA 4C8YA 4IDOA 1Z36A 1DKRA 4NYPA 1EFRD 3PWTA 2FB0A 1ATIA 4HZIA 3AVPA 5JUMA 3IR5B 3UJHA 2QX7A 1U0JA 3R3VA 1TK9A 1NHGA 2I7TA 4LX0A 2B4PA 3VPGA 4DV0J 4J9UE 4XPCA 3WLFA 1S7CA 1ZAYA 5FULA 1E63A 5D0HA 5KVVA 2BCEA 4MCHA 4KGZB 3LDHA 2UXDJ 1YRXA 5D8DA 4WJBA 1KQSR 3QYFA 1JJ2R 1TCAA 4B3TJ 2IHVA 2DG2A 4R7GA 2JEFA 3UWSA 3T7SA 2PH7A 1V11A 2VFSA 1BOOA 3EVBA 2GB4A 3SN6A 3OSUA 1GILA 3A06A 5DBFA 1R31A 4YHHJ 5E3QA 3PEHA 4I4TF 1HNIA 5AKGA 3LO5A 4EG7A 1E2QA 2W4MA 5FH9A 1A8HA 1WXWA 1DIHA 4ZAWA 2YHBA 4PYRA 1Q0HA 4L08A 1DAOA 3GEEA 1X86B 2IU6A 3W5AA 5DBIA 2LIVA 4N77A 5IANA 1NK9A 3EUEA 4BVFA 4UHEA 4YMEA 4RCVA 2E5LB 3TAMA 2IHJA 4PCUA 1CJTC 2QRVB 4DNPA 1I5OA 1XLVA 1Y1KE 1XEAA 4FIDA 1SB8A 3K16A 1SVNA 2F3PA 4OZ1A 3KNAA 3NWBA 4Q15A 3O8NA 1IJFA 1DIRA 3ANMA 4QWWA 4PR3A 4D0LB 2J41A 2ASVA 3VV3A 1SBNE 1OYYA 1YRWA 4HNQA 2GO9A 3V6DB 3SHTA 1KKLA 2UVPB 2VP3A 5EDWA 2BTEA 1EYZA 1N2SA 3TVZA 3AI3A 3AFGA 2BVZA 3B3AA 1BXKA 1GT6A 3CUNA 1H2BA 1SCJB 1S1VB 3PE6A 3WK6A 1PF7E 1UXIA 3DR3A 2AXEA 5LP6A 3UJ6A 1SHUX 2BHRA 1RT6B 1C3OB 2C2KA 1F7UA 1SBHA 1ZK3A 2WWRA 2XWQA 2IA5A 2HIYA 3L4KA 4ZVPA 5ALSA 3UYKA 2EJWA 4TN5A 5K99A 2B30A 5KKCA 1PQYA 2RAFA 4H0CA 5JCPA 4M0MA 3CB4A 2Q6KA 1U6JA 5CTAA 1TT7A 2E21A 5J1EA 2OH2A 5K0FA 3L7AA 3LKZA 1GVHA 3T5MA 3LWBA 2ZJ5A 3PKIA 4S1TA 3H8YA 4NLUA 1A7KA 4EJSC 1ENOA 3D1VA 3N2ZB 1JDZA 1KJ8A 2WM3A 3UMRA 4N3BA 4P22A 4ZYLA 4IZIA 2BP7B 4Y2YA 1AXQA 1OY1A 4G5QA 1PK9A 3H16A 2AJ2A 4JT2A 4OIFA 4TSRA 4C6HA 1QE5A 3CUUA 1UFLA 4Y1EA 3MMZA 4IJMA 5LYJF 3B5EA 5HQ8A 3V7YA 3RNLA 1IN7A 5FO0A 1J27A 4PQEA 5CLIA 1E9AA 2NIPA 4DV4B 1OXBB 4CN8A 1WUTA 2JGDA 3OM8A 3HHLC 4UNSA 3I5BA 3UD3P 1FU8A 1JG6A 5E7OB 5GOZA 2E82A 4QDKA 4OQXA 4DSAA 3M3HA 2HQRA 3M83A 3B3GA 2YH2A 4EG5A 3ICCA 2PKXA 2R8EA 3I96A 1NVDA 1U9JA 4N03A 1FF2A 1SK8A 5B4VA 3K0AB 4I9GA 3QBJA 3W2WB 4LQDA 4OBXA 3MCNA 3QPCA 3LRPA 1ENPA 8GPBA 1B23P 2O2YA 1H1LA 3K89A 2PUCA 3NNDA 4KHMA 1CB7A 2Y68A 2WJIA 2G76A 3RUBL 1X7GA 5KVAA 4NBSA 3V2IA 3BPSA 2CLOB 1IEXA 1VIAA 2UUCJ 2AR9A 13PKA 2OV6A 2RBKA 4M9CA 3JAMY 2ZP1A 4A16A 4FYHA 2EKZA 4PCLA 4RZXA 4UC0A 3AKYA 2HFUA 3RLIA 3ZZOA 4JP2A 1US8B 4J0QA 2CVEA 2Q21A 2AMFA 3HLYA 5IJ9B 4KJZA 4JXZA 3ISND 4QU0A 3TTUA 3L01A 3BFPA 4Q1AA 1RKBA 2ZYRA 2RVJA 2HREA 1O97D 4MUJA 1ZONA 3R3JA 4XASA 5TVKA 1AN9A 2ODTX 1FE8A 1A9TA 2OC9A 4KSEB 1N5LA 3H2GA 3HFKA 1KQGB 4CV2A 2HRDA 2IUTA 2MKKA 5IWAF 1DMRA 2PZAA 3N2KB 4N3CA 1ZAVA 4GI1A 1Z6TA 3KAKA 3SMVA 2QP4A 3CKMA 2IYOA 4X64F 4BP1A 3LVRE 1G6OA 5BWMA 4KRWA 2QE7D 3HSZA 2VOPA 3C6TB 1PL8A 5G40A 1WCV1 3C5WP 4LBHA 2QAIA 2LV8A 4ZO6A 2XYRA 4QHTA 3E9YA 1NFQA 3K9QO 4F26A 3TK1A 1T3ZA 2OXEA 1QBKC 2KG1A 4P5EA 1OAOC 3GGDA 3PUZA 3E9RA 2XPCA 2CQ4A 1XJCA 2QVCA 3OFSA 4R71A 3GMDA 2YWHA 4MUGA 1FX0A 1ZHOA 1S01A 4DQRA 4DKXA 2XIJA 3CLSC 1CVRA 1QQAA 4EUVA 4JI6J 4DV5F 1G8GA 3F97A 2ZROA 3IPLA 1CFZA 3DM2A 4N8SA 4RY8A 1GPAA 2X51A 1ECFA 5BYAA 4JYZA 3DVRX 3VOTA 5LFAA 3MUMP 3VVTA 3H7AA 3QIAA 1U2DC 5EPEA 4RVUA 2WUVA 5KNBH 1NXXA 3V4ZA 1QSSA 4EYKA 1UBMS 2WYOA 3NQ41 2CLFB 3DF9A 3V8MA 4TLAA 3I45A 1DBRA 3BD9A 1UOQA 4W9MC 4GE3A 4FLEA 2IBOA 3OFNA 2AKEA 3CO9A 2C4MA 4OL8A 2W6JD 2PGXA 2G28A 1C7JA 1E1MA 2IEDA 1WZEA 1A7JA 1X2BA 2Z57A 2EVZA 4KPYA 3GG2A 4L95C 4MIAA 2PQ2A 1C1CA 1AA9A 2XYHA 1NN1A 2WOMA 1L7NA 2DNQA 3IEUA 3ZE2B 4NHEA 1TM5E 1N8RT 3K57A 1X5PA 1L4EA 2V6FA 3EXCX 1HYGA 5SY9A 4RPFA 4QR0A 4DG5A 2VHEA 1RT2B 3TGPA 2W7AA 1T9GS 5F3WB 3D2BA 4IJWA 4K9MA 1WAMA 2C3UA 1JEQB 3T1NA 3COYA 1HDGO 2LVBA 4QIWD 5DM6Q 4QOJA 1INLA 4Q39A 2UZAA 5D77A 5E1OA 3JZAA 4PQFA 3R9IA 4B3TF 3QWBA 5FP0A 1RM0A 3M82A 2XNDA 3TD9A 3KZXA 4D5GA 3RSOA 1G1AA 4LYEA 1SD1A 1PYOA 2PA0A 3L8EA 2NUBA 5E4TA 4KPUB 1ABEA 4KYUA 3JATA 1P9LA 1W0JD 4I6WA 2I55A 1C7IA 5EGSA 3RJMA 2VVTA 1ZYUA 5BN4A 4JODA 3V4LA 3MHYA 1WG5A 4FJ1A 3PEJA 4KGZA 2R5WA 2FJBB 2IYXA 4JJFA 2Y6VA 3JD0A 3VPCA 4OU4A 4NU0A 2F4NA 2VHGA 4RNCA 1PWYE 4NPAA 4Q16A 3MINB 5EZYA 3V81B 5LBTA 1B26A 1GXTA 4CF5A 1EE1A 3FI0A 1HYHA 2FPSA 1MHPA 3KQVA 2X22A 2FRDC 1FU7A 1CRPA 3HU2A 2ATCB 4IY1A 2BV3A 1OJ4A 1ZUNB 3J7YU 4LAFA 5CB6A 1RWNA 3C39A 3IUPA 4AJNA 5JJ5A 4E5UA 3H6GA 3BH7B 1Q0LA 4LZNA 2EFEB 2CA9A 1GNKA 2XUGA 5IF9A 1T9TA 4GYWA 3AB2B 3QHPA 4QM6A 2PXAA 3CO0S 2QX9A 3I76A 4OKNA 3THOA 4BZPA 3NHFA 1RAIB 2WU1A 1ZGHA 4GP7A 1YG0A 2PD1A 1Q1NA 3U16A 1XLUA 3RTEA 1VK3A 3D4LA 3CRQA 5EKUA 1CY2A 5ITHA 3UNGC 2V1XA 4JITA 1XMOB 4OHBA 3ROEA 5BYSA 3BSAA 1TP7A 3PG9A 5CBKA 1E5XA 2IYFA 1YSCA 4U7PB 3DLGB 2VN8A 3QXJA 2BUCA 2CUNA 2YS6A 3UHAA 4BVLA 2GX6A 3SYRA 1EHCA 1XTKA 1XMPA 2IC3B 4I8XA 3D1HA 3RVLA 2CJ9A 2VF7A 3PDWA 1QPZA 1JLAB 2RS8A 1NR1A 5IAOA 2ZB2A 1YS9A 3MCTA 3KB6A 3N01A 4Z5XA 3E5RA 3NP9A 1KRXA 1U2EA 1BYIA 5J2QA 5KFPA 1WV1A 4CM0A 3ANYB 1X0FA 4KVAA 3VPSA 4F3CA 1K7FB 1L7OA 3BJIC 4TV9B 1A6LA 2JLGA 3AFIA 1NPDA 1X7VA 3HSKA 3UKOA 1QGED 1SQSA 2OCPA 1U5CA 4D9CA 1FWKA 4PCVA 4C11A 1JEJA 3F5MA 4DS3A 4P4SA 2KRBA 3PWZA 1CEYA 1S1UA 3GV5B 5JXSA 4X41A 3IP6A 3NTLA 1JYFA 4GVBA 2AI2A 3E58A 1JK9B 3IB3A 4FKYA 1OYDA 2WRMA 3B12A 2Q4RA 4CMHA 2R8JA 6PFKA 4A92A 3S8MA 3VGPA 3M9WA 4KI0A 4UUBA 1NV8A 2VHYA 4X7RA 1QG6A 1X9HA 3INGA 4MV1A 2BEUB 1GTVA 5F8HA 3EDRA 3UR3C 4V38A 2ZR8A 2ZU0C 3R3WA 4HLUA 3VU1A 1AJEA 3MLBA 4P7BA 5CFMA 4OXKA 1IQRA 4C4ZA 5T14A 5HVNA 5CJPA 2PEYA 1YU6A 3MLEA 1M1KT 3R77A 4XSVA 3EVGA 4RTKA 3G8CA 1ZFNA 1Y8RA 4OUDB 4Q82A 1ST2A 1YMVA 1M0SA 4DMKA 1YMQA 5EP3A 3RTAA 2Q4EA 1KHHA 5FTLA 1WSRA 3HDJA 4R9RA 1TIPA 4KUGA 4DS4A 3PI7A 1QMGA 2DPJA 1M90T 3CCJS 3ORRA 3L7NA 4FQ5A 3IOCA 3TDMA 3K9GA 3PC8C 5A8KB 2VG8A 2BHLA 1VK8A 3E03A 3F96A 1ZM7A 1TQ8A 2MY7A 2OD2A 2P9BA 2YVLA 3NGXA 3O8OA 2QLTA 2AZ1A 4RUBA 4WHMA 3ZWOA 1W5BA 3A6PC 3FPSA 4ECWA 5CYPA 4OHOA 5CLGA 5KAKA 2ECOA 3PGKA 4GU5A 1ZY2A 1IKXB 4WFAQ 2D2VA 3FHTA 3FYUA 3U40A 3JV7A 4YCCA 5LDDC 1PJ5A 1FYDA 3RK1A 1WBBA 5AHWA 4DVJA 1NKCA 1J0CA 3D5TA 3E2PA 3EVZA 1XVIA 1G3RA 3VGTA 4FQ7A 5A6PA 1CJUC 1JLCB 2V4RA 2H7YA 1TVEA 2AVDA 3EGXB 3I01A 5NLLA 2M0GB 3HO6A 2FLWA 1E6YA 2O5CA 1CJKC 3H9JA 2ZTHA 2H00A 4IFVA 1URNA 4MK7A 3C6UA 2CQ0A 3GLFE 1NATA 2WYUA 5K20A 3MEEA 1TTHA 2P0EA 1PVVA 4YJHB 3BWDD 3EIHA 5TDHA 4E6PA 2R96A 3V8EA 4DLBA 2ILTA 3KZNA 1J0AA 4OYBA 2Z2YB 3TAXA 1IJEA 3K5NA 1DQ8A 1NDKA 3SSAA 5BUCA 1MAWA 4BGEA 4PGAA 1P1RA 1YR6A 1FI4A 4YDRA 3K1AA 2NTEA 1CUJA 4LF6F 3KD3A 4BS9A 1LFDB 1E0AA 2QD4A 4FM9A 1N5SA 3TECE 3AHGA 4O4HB 1XXHA 5AXNA 2C5HA 4TZ6A 2Z5GA 4AJPA 1PWHA 4GBED 1L4BA 3ESCA 1Z4LA 4MP8A 3K9HA 3WMFA 1THTA 4B9SA 1RTDB 1RLIA 1B00A 3K1ZA 3B82A 3NHLA 4PR0A 1DHTA 1PJTA 1X8DA 5KFNA 2B9YA 3GJ8A 1RD4A 2RGBA 4YDSA 1USVA 5TT1A 4MWSA 1RPAA 2X40A 4C08A 4FEGA 1CLUA 1W35A 3PX2A 3CEAA 2H2HA 2EJTA 4DXLA 3AHFA 4UNRA 4F6RA 1K5DA 4ZZ3A 4M86A 3OL8A 1FNSA 2JBHA 2ATIA 5GAEI 4ZOBA 2JJ1A 5DQGA 4J0DA 3LDFA 4LSLB 5H16A 2UXCF 2CWXA 4B4UA 1T2FA 1MC5A 1ZA1A 4MKVA 2BJVA 5F3DA 1FFGA 2YQ5A 4FZ5A 2FY1A 1E92A 4KXNA 3IIKA 4U7CA 4GOND 4CM9A 2VPYA 2XNSA 5T3YA 1GV0A 2VQFJ 5C1OA 2BKNA 3JSXA 3HGQA 1TAGA 4YRKA 2R3VA 2X8WA 4I6EA 2QPTA 9ABPA 3GLIA 3WRYA 4Y6QA 5LXYA 4K0KF 5UKDA 4XWYA 2KE5A 2DUMA 2QUIA 2G72A 4EFNA 4P0PB 2GN9A 1TZJA 2W98A 5DYGA 2GBLA 1BIFA 2MSDB 5CG1A 1PU2A 3U13A 1HQEB 1E7WA 1KP9A 3S5JA 3WYCA 4MVJF 1WVGA 1VCOA 1G4HA 3QJLA 4G0OA 5GWXA 5AK6A 1SPBP 5EXDA 5MLCV 5B1YA 3QFFA 4JI7B 4KDRA 1LDMA 3MYRA 3OE7A 1M5KC 3CF6R 2BE7D 4Y65A 3L8DA 4LZZA 5A4AA 2PTGA 5C52B 3M7IA 2FDRA 1I4LD 1IWBB 1E4EA 2PAFA 2KDOA 2NO1A 4AZTA 1VBZA 3J81k 3KKLA 2IYAA 5LB2A 2H48A 3SYZA 4ND6A 3IUMA 1X60A 3C5HA 3R20A 1J7JA 2RHJA 3GO4A 5CYFA 4NZOA 5LJIA 1FPQA 1KFJB 3P5BP 3D6MA 1Z25A 2NTVA 3DT6A 4PIPA 3RU9A 4MROA 3TNDA 4TYMA 3ONWA 1XZLA 3R0JA 4QUEA 4J0IA 3WRXC 2ZAOA 2P2CB 2JC3A 1JA1A 5ALPA 4LOHA 5BYJA 4XJXA 3C8UA 1UFQA 2F7SA 1IBMB 5AXBA 1NQXA 4E15A 1N8KA 3VC3A 2HNBA 2DNMA 3W1EA 1WQ1R 2HCFA 3BMOB 2HQSA 3JSBA 4WE1B 4WWSA 4LF4B 2HC9A 4UZCA 2XHCA 4P80A 4LRCA 4RM2A 1S1VA 4MVCA 4K5SA 1ETHA 1EPUA 4P82A 1H5QA 2ZSEA 4QPTA 4BLQA 4FT2A 4F11A 1F3FA 1XNRJ 2IHZA 2XY4A 4M0PA 3HKCB 2V8DA 1CY0A 4ARVA 2HQ1A 5CBPA 2WWYA 3M8PB 5JJBA 1XCOA 1QB7A 4BKUA 3ZHZA 4UQTA 3EVDA 1PJ8A 1NWCA 4W1SA 4KTQA 3M3DA 5DLGA 2R9LA 1W9MA 3KVOA 2LQ5A 3Q8VA 2CVPA 3K0FB 4WK6A 3UUGA 3R97A 2WICA 2WAMA 1N5RA 5CPFA 5LP6C 1IKVB 2OFWA 2PKQP 3FH0A 3IKVA 1QZXA 4OI3A 4B80A 3JYOA 1ABBA 1MNQA 5A8KA 4J9VA 4C6RA 5K3FB 3B51X 3KLPX 3JAWA 1RKJA 1PYGA 2FLPA 3EQ9A 2Q8PA 4FVMA 1SC9A 4RW7B 3K5WA 3TBKA 3BQ2A 5E95A 3GRCA 5AE2A 4LF1A 3QKRA 5L8VA 3ZLTA 4TXSA 5LXTF 1IR0A 5J2PB 3ZPXA 1P9OA 5K3DA 1P2VA 2W2MA 3B1YA 3WZ2A 2DUWA 3D3JA 1F2VA 1D1SA 2HOQA 4CT8A 3VAZA 1XD2A 3O8QB 5HGJA 1V25A 5DM70 5KYWA 3FHJA 1EM6A 3LZCA 3AL3A 3CE6A 5JC1A 2WWHA 2WFAA 3VX3A 3IUQA 1BX0A 2YJ3A 4M36A 3SYLA 4FS8A 2FI1A 2DHQA 2R1TA 2CJYB 2QA4G 4JLMA 3ZGXA 4G5YA 1VKRA 3MWYW 4QYTA 4LSZA 4MS3B 3QFHA 4FBGA 3IEIA 3LPEA 1CQJB 4G2NA 1W4ZA 3THYB 3ZDYB 1LFPA 4MQUA 5CB4F 4TQ9A 3HWX1 2AYEA 1QV6A 4WA8A 1N2EA 2NM0A 1FQKA 3TZZA 4ETNA 2MKJA 3PNMA 2OPRA 1A4IA 2PT5A 3HK2A 4HVCA 3A2LA 3NPMA 3D4JA 1PUJA 2YX7A 1S1WA 4DBQA 1OXMA 1CD5A 5EI5A 3HXOA 2IS1A 4M7RA 4L28A 3ELWA 3KT0A 2MLXA 2J4CA 1GCOA 1E2BA 4LIWA 4A8WA 2XQKA 3MJTA 2HUNA 1LRJA 2Q6TA 1KO1A 3FF4A 5CVDA 3BWMA 3H05A 2F9LA 1X13A 2O7RA 5SZHB 2BFEB 2ERRA 2G0TA 1U7OA 4QRHA 1PL7A 5J2MB 4ER6A 5F2EA 2WAOA 3JPWA 3PVCA 4GKKF 5HBRA 2CPIA 4K1LA 2ODBA 1FDRA 1T9AA 2I4TA 1ZVMA 3P9IA 3JWEA 2ONCA 2H4WA 3PTWA 5T4HA 2VP9A 5BJRA 1JWWA 1P0PA 3EPRA 1R8YA 2PZKA 4R0MA 2QR5A 5BW4A 1CJCA 3KWLA 4H7EA 3JVVA 2V9KA 1IKWB 1QONA 3LHFA 3H20A 4D9EA 4IP0A 3PX3A 4ER3A 2I65A 2B82A 5AH0A 4QLBA 3CX8A 3ZBUA 5C2GA 1NXTA 3CH6A 1KRWA 2QQEA 3OBIA 3GLIB 3LUDA 3PW5A 3U3RA 5F4BA 1JNYA 5K51A 2DEJA 2M9KA 3EVMA 2NU7A 3KJQA 2H5JA 2GF0A 5HGXA 5KYUB 4TSKA 2H07A 1RLJA 3NBPB 5BN5A 2P4QA 1E5LA 3E2MA 3G8QA 4IDPA 3T1YF 1MVOA 3F2IA 1A04A 1L7QA 1VMAA 3RABA 3O8CA 4P4TA 4AD8A 2DKNA 4USHA 2WTUA 5A5VA 5B7PA 4R1SA 1VCHA 2FXVA 3LVFO 4YXFA 1LLQA 4GS5A 3GNLA 3ISZA 3C8DA 1EB9A 3PJ9A 4BZWA 4P3XA 2Y67A 4C8LA 3CN9A 4MI3A 3PV0A 4MKBA 2HHUA 4X7PA 2C4WA 2O8EB 1U3UA 3HJUA 3H2HA 3FEYB 2FH5B 1QWSA 2V7BA 3OZXA 1X5OA 3RC7A 2UU9F 2EX4A 4UW9A 4DLKA 3PQ4A 4FVCA 1BDMA 4EG1A 4OQZA 1GFSA 4DILA 1VQ4S 2ONYA 4I2PB 1KIAA 3NGTA 5IUNC 4PXEA 1QQTA 2Q4BA 5LMNJ 1KI6B 1S6QB 8AT1B 4DDFA 2IOYA 4CCSA 1SAYA 1T5HX 2XE6A 5F52A 2V8PA 3P9YA 3LIPA 1VMEA 5EC8A 2V58A 3FLMA 4G85A 4PZEA 2FN3A 3R23A 1YKGA 1KLMA 3IC5A 3FTQA 3OW2R 1RYSA 4ZHRA 1Z4JA 1XSEA 1CRWG 3TBFA 4D74A 4HRAA 1YA8A 4K9NA 1QRRA 3PC3A 5AHOA 3LPCA 1SV5B 4RD3A 1LPSA 2ZBCA 1XMOF 1AVTA 2Z4RA 3HVAA 2ERCA 4WWHA 3HRHA 1UMKA 2EARA 1FKPB 2PZFA 1YHZA 3IJRA 3LXXA 2JJYA 5A3SA 4CCHA 1DIOB 4HEQA 1JIKA 1KI8A 2C2GA 2YC2C 1I5EA 2JEJA 1C7FA 2H2DA 1R0SA 4QXOA 1VQSA 4CR7A 1CRZA 3P2MA 2ZUAA 1QRAA 3TL2A 1ZN2A 3MINA 1VE7A 2HQCA 1XAHA 4X62F 2VXYA 1BZYA 2F63A 4GXQA 4EH1A 2G80A 2W70A 4EA8A 1G2EA 3TCNA 2A86A 1TTQB 5DM2A 2DHGA 1TJYA 3LF2A 5FO1A 3KTAB 1NJ2A 2H48B 3L95X 3T7TA 3VDXA 4A1FA 2FJXA 1BD6A 5HN0A 3OF2A 2QNIA 1ZNWA 2Z4SA 1C1XA 5ICFA 3WIOA 5EHQA 3HJAA 4LJKA 3NX4A 2HT1A 3KKEA 1SCUA 3H4TA 2NCKL 1YJ5A 1GUDA 3K0CA 2AN5A 2YXEA 1UA0A 3C19A 5A3JA 2VKQA 1GDTA 1QP7A 1GQQA 3K6SB 4ZITA 3KLHA 2P68A 3JD1A 1XBTA 3DUFA 2Q79A 4X8HA 3DE1X 3AOEC 4UXIA 3RKSA 4WK4B 2BFNA 2G71A 3VYVA 1VHQA 3CR3C 3A4TA 4M0UA 1XWWA 5IZCA 1MV5A 1MZVA 1J5XA 4LWPA 3L7MA 3FOBA 5JH7A 3WIBA 1N1MA 3IBTA 5JANA 5FV7A 4DEVA 4ZA1A 3ROZA 3HM9A 5F5LA 5ECGC 3N8HA 2E4YA 3PFIA 3R5KA 5CDTA 1NASA 1NE2A 3W7VA 3IM8A 4DQXA 3HBNA 4HB2A 4JI0B 3FYDA 1Z3IX 3ZV4A 4TV9A 3RIGA 4CF4A 4ZK2A 3JQBC 4BRWA 1P7ZA 1HORA 3R6TA 2MKCA 1H93A 4G1UC 1M1YA 1QAOA 2E4UA 4KQ6A 4OJQA 1C9NA 2I29A 2NGRA 1NJSA 1ZI6A 2X5OA 4QUDA 2R9VA 1XYVA 4D3GA 1JP7A 2OFPA 4G9EA 2XGOA 3F73A 1QORA 4WKNA 3KETA 4ID3A 3PSHA 1GGJA 3FSXA 4KSBA 1TL3B 3SHVA 4ZDWA 4LXHA 1N5DA 3TZWA 2WTMA 2MHEA 1P2DA 5C4GB 5LSRA 1BQNB 1O6CA 2IW3A 2ONKA 4HB3A 1Z6XA 2HHJA 4E08A 3R5TA 4H4OB 4FCWA 1U7HA 3N2NA 2VH2A 5AVXA 3MOZA 1XAJA 1CUUA 1X6VA 5K0GA 4TRNA 2DHXA 2E2WA 2PEHA 2DCLA 4Z7OB 4KXQA 3D54A 4TY8B 3HDYA 1VZ3A 1TKCA 4BNJA 1XNGA 4DV1J 3WAJA 1GKUB 3EH1A 1BMQB 1OF1A 4OHKA 2OK7A 4OHYA 3AO0B 4MPPA 2JCBA 1GSHA 1GRVA 1ZW1A 2JAHA 3UOWA 4ED7A 3HP4A 4REMA 4U7GA 3UVEA 3ED1A 5IDXA 4QARA 4RA6B 1I5RA 2XMZA 2XMKA 2XCSB 1O1YA 1Q91A 4BO4A 3FTPA 3DNCA 4IJKA 4U7DA 2IV2X 1SNYA 3KG0A 3H9UA 4W1RA 1WUYA 4KE8A 4JI8J 5WRFA 5A6SA 3OTBA 4U02A 3LQFA 2QU7A 2RIJA 4HDRA 2DNGA 1H2TZ 3DLIA 3SZMA 4UU1A 4X9XA 2ZC4A 2QYTA 2P78A 3W34A 1FF9A 2BXJA 4R5PA 5G3YA 3U3ZA 3FHOA 3A25A 1VQ5S 2RKOA 3I58A 2BRLA 1NR5A 4F21A 4TM8A 2KFYA 3URMA 1ZA1B 2SCUA 4DCJA 1PIEA 3G87A 2HNAA 3M70A 1WCYA 1YQTA 3RT1A 4UEQA 2C8KA 4RTSA 4EMBA 4ZDKA 3JSAA 4B4VA 1KAQA 2RD5C 2V4JB 4HEA9 3S1AB 3GFRA 4OMDA 1NSQA 3VAYA 2AV5A 4Z4CA 4DDWA 3CUWA 4YJ2B 3SIWA 2AXNA 4RA9B 4JI6B 4LFCJ 2CKWA 1JYEA 2PX6A 2ADMA 4IIHA 4YPOA 4U7UK 2I5JA 1V1RA 1SUDA 1ZM9A 4K46A 3BN7A 3ZHVA 1JDNA 2P3SA 5DP2A 5AKKA 4YWJA 1W85A 2WM2A 2GBFA 1FTYA 3ZEIA 5I42B 5DP1A 2H08A 3M6UA 4LOJA 2X6RA 3TOQA 1HR0F 4CO5A 2QP9X 2AGOA 5FLXA 4AZSA 3MJEA 2RH5A 4ATNA 5KHLB 5H81A 4J3NA 2ISCA 3ZTQA 1QGUA 3AKDA 4HH4A 4LXIA 3AF6A 2FEOA 3EGEA 3D4BA 4M0LA 4JA0A 5CA0A 4I3HA 3HZGA 1P2GA 1COZA 5HVHA 3G2KA 3GV7B 3GAFA 2A92A 1VCNA 1QCDA 2OP5A 3ZJTA 3ER8A 1VRCA 5KHOC 3PW0A 2V8BA 3RGGA 4F8JA 2W9BA 4EKEA 1WHTB 2QZPA 3F1LA 1FP4A 1DBVO 1ZZNA 5I4MA 4H18A 2P40A 2ZVPX 3UKJA 5HNKA 1XU4A 3VHXA 1QFSA 1XE3A 4FMPA 4YT4A 5BV0A 3FYTA 2FFJA 2HHHJ 4Y2QA 4UDYX 3VYSB 1D2GA 2BEVA 1SUCA 4H17A 3GT0A 2WG2A 1KQPA 3SU8A 4LZOA 4WY2A 4ZPWR 4UBIA 2CMFA 3GFYA 3BREA 2GCNA 3EEFA 5ALYA 1K7CA 3CGWA 5JD4A 3KPYA 4XUDA 1BWPA 3NOCA 1OPRA 5BSUA 1YHNA 3T1HB 4YJ3F 1X1QA 1DTWA 3P1JA 1BFUA 3L77A 4MYRA 5F5XA 4CUJA 1B3RA 2DBBA 3K92A 2IOHA 4ELVA 3SQDA 3FFAA 3SNHA 1NM5C 4JNCA 1KN6A 2B21A 5KREA 4TV8A 3QEMB 4BC7A 1SUQB 3QO9B 4G25A 1PHRA 1NHWA 5EE5B 4NWBA 1DTQA 3SMZA 2O2SA 4GEKA 4K40A 1I1OA 3RUIA 2O8CB 1FDVA 2FDXA 3I82A 1ZJ6A 3PDIB 3LUCA 2QGNA 3A6HA 1NUPA 5FPQA 1BHNA 3QM1A 2VNJA 3VVCA 1KZ6A 3K0FA 1VQNS 3IP1A 2GAOA 2OPRB 2RHGB 1E6UA 4IG0B 4YQEA 3CA8A 3ESAA 1AKYA 3QMMA 3M2UA 4QDJA 1A1SA 1P7VA 3WGIA 2PJDA 2C2OA 4OM7A 4LJ5A 4ZALA 4LC0A 1KJIA 3HMJG 4O2RA 4XFDA 5IXSA 3CKKA 1Y33E 3PT5A 1P2SA 3WI7A 3F5SA 3CY6A 4Q9DA 2V9CA 1OX4B 4DM4A 1K7YA 3QT5A 4CEJA 2OTLS 1QVRA 3MRVA 3OCVA 3TZXA 4G0VA 1G6BA 1DY3A 3SIXA 2DETA 3N6VA 1HEUA 3G2HA 1FTNA 4IIJF 2TS1A 4M53A 3HKEB 4BGVA 1MFZA 2BHNA 2I67A 5JVDB 2FZKA 2C2NA 4YHHF 5K03A 4L57A 4X71A 2YXPX 1F9EB 2ZUFA 3C6MA 1JR3E 3Q8RB 5I7RA 2M5YA 3MEEB 4N6OA 1SK9A 4XJVA 3G49A 3FJ1A 1NM2A 1L5HA 3NOQA 4GVPA 3IO1A 3MAQA 4CUZA 1TM7E 1D4OA 3M9LA 5C31A 4KH1A 2H1RA 1VBKA 3E5HA 3TR5A 3ZY3A 5KKNB 3CMES 4AWXA 1QCYA 1E0SA 3VSEA 1NH8A 2GJIA 2XUOA 2WUWE 1TUWA 2DEUA 3QVWA 4NBRA 1ZKDA 3H1PA 1KO7A 1W36D 1Z26A 1WJGA 5I9BA 3KJVB 1UK6A 1MENA 3KXIA 1HYQA 2H7VA 2P9EA 4A2CA 4FHDA 4QDTA 3R75A 3RS7A 3RAFC 3M30B 4HQLA 5CGQB 2VRBA 3FIJA 1X7YA 1R0LA 3H0CA 4TY8A 8OHMA 5LPNA 5K0BA 2V69A 1KEKA 3G9ZA 3AH8A 4P2GA 4JBYA 1H3FA 2BLNA 2IEZA 3K05A 2IBSA 2B4OA 3T94A 1E1KA 3RM3A 2RJOA 4WFNQ 4DQQA 3ZV3A 3Q4GA 1IN8A 1YK0A 3GRKA 3CJTA 4PZUA 4H7FA 2RDJA 3Q41A 2EERA 1M5TA 4WLVA 4KK4A 3ISJA 4Y67A 2GNKA 4B2YA 2Z8YM 4CE6A 4NEGA 2D0DA 3N8DA 1Z4UA 3LA6A 3U1TA 3FR8A 4B3SB 1B1CA 3TNVA 2AW5A 1WKVA 2ZOSA 3QFCA 4KH0A 1J4AA 1TCBA 4IWNA 4K26A 4XD7A 2H18A 4DPUA 3D1JA 3ERCA 3ZDBA 4DFPA 4NCIA 2G8NA 3B13B 4LF7B 4AZWA 1MMFB 3FWPA 3BBCA 1GV1A 1Z6YA 3ITNA 4BCDA 1XPRA 3EIWA 5HRUA 4QJIA 4ED2A 5BVGA 4ZZ0A 4J4HA 4KOAA 5T8KA 4UVGA 1LVHA 4PQUA 5BQXA 1UWBA 5JMTA 1Y3AA 3DMGA 3D66A 3BMCA 5IJWA 2IDLA 4FF4A 4RADA 4JOUA 5U9CA 3NRCA 5B3JC 1A3CA 4EWLA 1TIBA 2AFVA 4LYDA 5J1SB 4EDHA 3TSOA 1F9HA 2MCFA 4HWGA 3DUWA 3NG8A 3DGPB 4EFLA 4DR2J 1Q86T 4X3CA 2PGJA 2XUDA 1QZZA 3VNBA 3UJAA 3H2IA 4RACA 3J7Z5 2RH4A 1OLUA 2XDWA 2RJZA 1E6LA 4CO1A 4J2HA 3CQ9A 4P54A 4OP1A 2HHSA 3QYJA 2GEDA 2NZWA 2GI4A 5ADZA 1K86A 3NMUF 4DJDC 4L22A 4OU5A 4URUR 3GEBA 3G9UA 3T1YB 2R00A 4A8KA 1Z3CA 4O08A 3BHNA 1VQ6S 2P9JA 1TZMA 1WZCA 4LOAA 4J1QA 5CYQB 1P8AA 3ND7A 2HA4A 4CNBA 2Y27A 3EAFA 1S2OA 2VWPA 4D96A 3JQKA 3DZHA 2FW7A 1NJYA 1XZCA 1NL3A 3I2FA 2JI7A 1C3OA 1RQ2A 3DULA 4FS3A 3COJA 4PZYA 4TU9A 1L5GB 3BMNB 5HZKA 1NQWA 3FMVA 4UUXA 4BJ6A 1S1MA 5FD8A 5GY7A 5TQ2A 4OPMA 1KC1A 5TQ0B 4A48A 4F7DA 3OU7A 4F45A 1UPFA 5IH7A 3BRWD 2HJRA 5JDCC 4Z9AA 3HEMA 4FK8A 1JNRB 3PX6A 3OTWA 5CJ2A 5TE9A 3W5SA 3CJQA 4XFKA 3RASA 4ITRC 4DN6A 3OAAD 2K6GA 1EETB 2Q5LA 4Q4LA 1G2IA 3KKZA 1VIYA 3SV4A 1A5SB 2WWVD 2VAXA 1TZBA 1YL5A 3KQTA 2LZ0A 3L1KA 2OUIA 3EQ7A 3EXG1 1GAJA 3AX6A 3SDZA 1NBOA 3LQYA 2GEVA 2BJ9A 3TIFA 2G5CA 2VH5R 5BV7A 1XV5A 5FWNA 2IVFA 4PSAA 1SELA 2ZCJA 3OXLA 4YUDA 1QVWA 2BBEA 1N5OX 5JYBA 3UJBA 3LP0A 2Y1OA 4RY2A 1G1XA 3WLJA 2QVLA 2DNZA 3JTMA 1DDIA 2IL1A 4XX1A 5CJJA 3ZWNA 1D8TA 3NVMB 3LMKA 4W7SA 3ILHA 5K8VA 1WPXA 3C3MA 4GP6A 1GGEA 1J0XO 2VXCA 2WJZB 1UVJA 1NPRA 3KOXA 3OOEA 4QFBA 3JWHA 1WXDA 5K3CA 1HYEA 3FKSA 3QATA 4K6OA 5ARBA 2OPPA 3ZTOA 1NU4A 2I2DA 3OR2B 4IRCA 1FRJA 4HT5A 2RK4A 2IZ5A 3G2PA 4Q01A 3LP5A 4BFWA 1KJWA 2H4YA 1PFYA 1R5NA 3LUFA 1CDZA 3OD1A 5TARA 5EFZA 3V42A 3MEDB 1NRIA 4F3TA 1LUAA 3ZI7A 1RADB 3LBYA 4P1ZA 5EMNA 3TTSA 2ODWA 1IUPA 4ZTBA 2PBZA 4MLPA 2GC8A 4L6V3 5LXTB 1T24A 4CKWB 5G41A 3BFJA 4YJKA 1O58A 1NVEA 1RTHB 3PDNA 3DEJA 1V8DA 3TLGA 2ZH8A 3LLSA 1LI7A 2IA0A 4C0BA 2F8SA 4IAOA 1FS5A 3V48A 2ZI7A 1MZPA 4DQIA 2LDYA 1UT5A 1Q77A 4JFRA 1DHRA 3I9MA 4ECUA 4Q2MA 4IG3B 5DTQA 3CW8X 1Z22A 2ZR7A 1SV5A 2V7PA 1FPMA 4H7KA 2I6WA 4PO9A 4AJKA 1EM8A 1W5EA 1P31A 2XITA 4W5JA 3W6OA 5AFSA 2WLSA 3GFXA 3O4FA 3VKFA 1GPMA 2V54A 1UANA 1Z37A 1ZGAA 2IE8A 4LPKA 1U4SA 2NO0A 3V2UC 1GPWB 1EDOA 4JI0F 3A70A 3PXXA 4CLOB 4M5DB 4IG0A 4WDQA 1B14A 3E8SA 1Z13A 2WUFA 4IGEA 3GFSA 3EVAA 3TA2A 1O03A 4CV1A 3VYWA 5TEWA 5GM1A 2I6QA 3M8QA 2XWBF 4YP5A 2AQIA 2J6BA 2PS9A 4KXUA 1H6BA 1UWAA 3AVQA 3V1LA 1Q8IA 2JFKA 4B6SA 2IUFA 3BGOP 5D86A 3HZOA 2EX1A 4QA9A 4DLAA 1CEEA 4PRZA 1RXVA 4GO7X 1JI0A 3VVBA 3FN4A 1U0BB 2HMTA 3WLIA 3BF7A 4C3OB 4L3VA 2IHKA 2EBGA 3ET6A 3AEZA 1JKFA 4G1BA 5TX7A 4Q6BA 1CG2A 5DX0A 3OJWA 1Y1LA 2DTEA 2C8LA 2O8BB 3BGDA 3GYBA 4G6ZA 4PZVA 2BH9A 2AZXA 2GBIA 3OIFA 1R4MB 2QZSA 3U4DA 4MPJA 2D1FA 1JU3A 4LOIA 3AESA 1N9ZA 3EXIB 2YQ3A 2EKPA 1S7GA 2I2AA 2P77A 1QKKA 1MB9A 5I7VA 3CCWA 2FZCA 3BERA 1ZH5A 3QV2A 3TOCA 1TVRA 2MSKA 2PLFA 3JQAA 3TPCA 3MRXA 1A9PA 3A2NA 3STTA 4N4AA 1U3WA 2W7OA 4FB5A 4B8ZA 2K06A 3KJZA 4W5RA 4BTLA 1JEDA 4UHKA 4BDSA 2HCJB 4LXXA 1M1GA 1TMYA 4XDCA 2H5IB 1U1LA 2R8BA 4C8OA 1WHXA 5DNWA 2CXOA 2AUTA 4C11B 2ZUUA 1CQPA 1MW9X 2JDJA 3E61A 3H11B 4DR7J 3T0GA 1H4QA 4CZCA 2ZJ6A 2PBFA 4R1QA 4WIQA 2VBCA 3LY5A 1J25A 1BEUB 2VRCA 2HWIA 2JOQA 5A4JA 4ALZA 2FLVA 5H70A 4CLFA 1SCNE 3RGWS 3UAZA 1T43A 4PHHA 3REOA 2P69A 4AKIA 4EG8A 3L0OA 3ND8A 1FFEA 4GRIA 1DLJA 5BR8F 3A37A 4RHYA 1WLSA 3ZR4B 1R64A 2NSDA 2Y4OA 5AJYA 5HUHA 3FRJA 1S0VA 1EG2A 3O0DA 5BMVB 4ZPAA 3DEFA 4R7TA 3L4JA 1N1DA 3LANA 1AUVA 2ODQA 5KT6A 2AJ4A 3N2LA 3FM9A 3UAWA 2YIDA 3N6RA 3UK7A 1C29B 5K09A 2V0CA 1BD4A 2C4NA 4X4SA 2R8XA 3DL4A 4I2QA 2ODPA 1FUKA 5L39A 3PF9A 2IPXA 4L8LA 4KDEA 4HD8A 4LTNA 5CM9C 3ZKAA 2UYHA 3X3UA 4WEQA 2C2ZA 4LHSA 6REQB 4H4MA 3HRIA 1Q20A 1IN1A 3MTKA 3LA8A 4Y9UA 5K8MA 3AYZB 2BFMA 3MMSA 4L07A 5CEFA 5U4QA 3OCJA 1CULA 4JUBA 4KPFC 4M76B 1TUBB 4P9SA 4UNQA 4MUNA 1EFDN 2GD1O 4YIKA 3UT0A 3KUGA 5KNBA 3KELA 2RKBA 1RZVA 5JDIC 2AGQA 2A5YB 1EVJA 1F9EA 5HZHA 3TZHA 4KB7A 3MR5A 1C1DB 2IIPA 4OJ3A 1AQIA 3KZKA 1OX5A 4CDMA 1Z33A 3PYGA 2CLKB 1CJVC 3WNBA 4BX9A 4HGQA 1OWPA 5C42A 4TQSA 3KU4A 4I55A 4KQFA 4FYDA 3NUGA 1PUXA 2R6HA 1V96A 1QF6A 1D1PA 3R5FA 1HE8B 2KPOA 4EW1A 1IMJA 2G88A 4E21A 3KKQA 5KYVA 3F5FA 2Q3CA 1KAMA 4F2WA 2GHTA 4MV6A 4PVCA 5LM7E 3T3IA 3UB4A 2F1RA 2VQEF 5KOHA 3UDVA 1UZHA 1FRQA 1VA4A 1YRAA 4RUAA 3QIVA 4QEZA 2LFVA 2REQB 1NM5A 1RABB 1S1XA 1AGRA 4J9NA 2EG9A 3H5AA 3K8OE 2HBRA 1KNXA 2BJEA 1NLFA 1KFCB 4UBOA 3RU2A 4EJMA 4EGSA 1XMSA 4BMPB 1I1QB 4IRDA 4YMVA 3MR6A 3W4IA 2CY0A 1FTWA 4J4BA 5IX8A 5FWYB 3NDBB 1G3UA 4R1OA 1IY2A 1H5NA 1VL2A 3AJEA 2V7UA 4LZWA 2VBFA 1C8KA 5HM8A 5EKSA 3QTBA 3AERA 3BGUA 5A4IS 2FQYA 1HO3A 1RZRA 2Z8YA 5F8NA 1RMYA 2OHJA 2XXBA 3DE7X 3HHLD 2NNWB 2GFFA 4WZAB 5F51A 4ZAZA 1NOKA 2D1YA 2MU1A 1VGYA 1U8CB 4ZYYA 4C89A 4KPCA 4BMOB 3QVLA 1VBXA 1TK8A 4IV8A 1RPTA 2JFZA 4Q3NA 1WG4A 2HRQA 3I9JA 3PU6A 2B6AB 3MCZA 1HNXJ 1D6MA 5CZVA 4LIRA 3KZ1E 3DB2A 4GOLD 3X3HA 2VASA 2J9YB 1NBEB 4PO1A 1PTJC 2GVZA 4YLEA 4LQ4A 5E8RA 2B0GA 2YV5A 3ZWXA 3LSTA 4L5AA 5AJ3J 3FBBA 1TOAA 1V95A 3ORYA 3T5HA 3E9DA 1EB0A 1NLUA 2O50A 2J0QA 2JRSA 1XN1A 2R7KA 1BGXT 3GEHA 3LAKA 1CETA 3P0EA 2Q1WA 1EXWA 4X1IB 2J31A 5T4FA 4ERNA 1UL3A 2ZUDA 5LYYA 1N2JA 3Q2SC 4DHVA 1O6GA 1AO0A 5EMKA 2OCYC 3LQ4A 4QTUB 1KEVA 4K1XA 4LMBA 3A2MA 3OX3A 3SC3A 1GK8A 2VJAA 3VR4A 5TEVA 5H9EK 1USUA 3K70D 4IDEA 2RGDA 4R2XA 3UTCA 2A5DA 3NWEA 1TFUA 3GBSA 1YVFA 4UFOA 2UUPA 4I99A 1B64A 1R0WA 1SKSA 1P8JA 4U39A 2AE2A 1MO3A 3H2JA 3R74A 3G9CA 3P49B 4PCAA 3RYFB 1UM9B 1QFZA 4GOKA 5FB3A 1IQPA 1Y5IB 4Z7CA 1C0IA 2DXFA 4RLHA 3DLHA 1WHSA 1SUBA 1J8QA 5I47A 4DY4A 1T10A 2PSFA 3KHUA 3MTEA 4PX5A 3NJRA 2BEVB 3VGUA 3DU6A 5EIFA 3G4SS 3FPFA 3RT7A 4NC9A 1SIWA 5E41A 4DC1A 3DRPA 3GVHA 4MUIA 3D5EA 3TSCA 1X31C 4LDAA 3UH0A 1FTQA 4H60A 5EEHA 3U4QB 3L4BA 2AN1A 4DF3A 5DI3B 3VGJA 3BTSA 2R7QA 1NU8A 4TYBA 3LY8A 3LWZA 3DC2A 4JJ7A 1JKJB 3PJXA 4B9TA 4EO7A 2N82B 1IB0A 2XT6A 3S2ZA 1M2GA 4AXIA 3D0KA 4F72A 2VH7A 5KFSA 5DW0A 1DG9A 2IT1A 1HLGA 1KMMA 2FUG6 1RWPA 5LP6F 4G9BA 2Y6UA 3FJYA 1NKVA 1DBPA 2IYVA 2CLIB 4GYKA 4U8GA 1GTJ1 2H52A 3OICA 2XOKA 5EIBD 3IOEA 1B4SA 3ICLA 3CCCA 5JUWA 1BXRB 1PP4A 4L74A 3A27A 4L8GA 5FTMA 1N92A 2IC3A 1U2TA 3GEIA 1OVGA 4H9GA 3M8SA 2V7XA 1ND6A 4FE7A 1QJCA 4QOTA 3QBEA 3DTVD 5LT5A 2YWDA 1BDJA 2GJAA 2AUNA 1W2IA 3M4YA 3MCOA 5L8RC 4FZRA 2Q45A 4RLFA 3RVOA 2GQ2A 3IGVA 1E2IA 1Z0AA 1Q81T 3OZDA 1C30A 3SV3A 3HE3A 3HP1A 4EW2A 4ECTA 4ZT4A 2UUCB 2LLZA 4UHCA 4KGXB 3O21A 3CRVA 1QIMA 3EA4A 3W0LB 4AY4A 4DABA 1ORTA 3BZUA 1V5GA 1GZ6A 2KTQA 3QOXA 4GL2A 4E2WA 1XF9A 3DOUA 2F3TA 5CD9A 1JB9A 1XJWA 2BJ1A 2H65B 1F12A 4WKGA 2HG4A 1QLNA 3GNQA 3GRPA 1VA5A 1CZOA 3FUVA 1EVQA 2HPZA 4N18A 4JI3B 1P9WA 3T5CA 2EDCA 4KFTA 4R0JA 4OV1A 5THKA 3CLRD 1NYTA 3SJCA 2ZZMA 4JD5A 1IG0A 4JJZA 3PUYA 2NYHA 1DJMA 5H02A 2C2XA 1R0KA 4WOBA 3TFOA 2YQZA 4ZEMA 2M32A 1QCZA 5JCZA 1XZBA 3FSGA 3OEWA 3PFEA 1RYFA 3PFFA 1AQUA 2HGNA 5JZSA 3PQEA 3UCXA 4XRRA 3GYXB 5AI9A 4Q9NA 4TX1A 2DXDA 3IR6B 2JGFA 4MCAA 4V0ME 5GV8A 3EZ5A 4K6CA 4MGEA 4N76A 4DOMA 3M4XA 5J47A 1SCIA 4O02B 1LJ8A 4ETWA 1JWLA 5JQGA 2WNHA 3WFIA 3T35A 2KWIA 3NCPA 3D43A 3W5DA 2HNZB 2VG5A 2O7NA 1F0NA 2DR7A 5CDYA 2V65A 4JEMA 4BX0A 2V6MA 5LYJA 4MQMA 4D4LA 3CJKB 4DCPB 3KHKA 3EBPA 3PKZA 2YX1A 3ESZA 3ZHBA 4RFSB 3TR0A 2EQ5A 3QUSA 4BVAA 1LOUA 4QBGB 4R8MA 3J80U 2VUIB 3IUBA 3VHLB 4A8JC 3WGMA 1GTMA 3L8FA 4CU5A 1XYYA 1NP3A 1HE1C 2Y0PA 4F6CA 2H1FA 1XEXB 1XP5A 1CR4A 4B3GA 4KNVA 4MV5A 2FK8A 3BWVA 4BFZA 1XTUA 1WV0A 4KFUA 1ADGA 2R2SA 4LKOA 1G5PA 4H4DA 1E3LA 1RQGA 4F3YA 1T5DX 1JLFB 2FP4A 1O87A 5THWA 1R12A 1O6XA 2BW2A 4IJUA 4HRYA 4H4KA 2C3YA 4O4JF 2JHEA 3R1LA 1NTRA 3HA2A 3ZBTA 2Q0HA 4A8HA 1Y5NB 2AF3C 2ZRJA 3HYCA 1CV2A 1I4WA 1FJ7A 1JLCA 4LFCB 3W2TA 2A6MA 3ZZMA 3LDUA 4M0FA 3T5BA 3UD4P 4IOCQ 4P4GA 3ASZA 3RSQA 4TKUB 3EGXA 3RUAA 1X1RA 3M3PA 3DLJA 3DHEA 3ITHA 1OLSB 2GN0A 3CV3A 2EFNA 3SJZA 1IVNA 2P1ZA 2JARA 2ODAA 1PGPA 3M8KA 4JB2A 1E3IA 2H4WB 2GPYA 5CX1A 1I8TA 5J4YA 2H4YB 1Z7BA 4DI6A 3E0QA 2JJ2A 2ZKUA 2ABYA 1SMKA 3K6JA 4L76A 3H6KA 4CIDA 2EL7A 4RQAA 5KFHA 2OXFA 2WQZA 5GAHI 5DLQC 5HATA 5D01A 2JLXA 2MB0B 4JI1F 4HVTA 3OF5A 4YB7A 2GMHA 1V9LA 2ID7A 3SZUA 3GJ4A 2O01C 3FPKA 4B3DA 4QYWA 2DNOA 3RS3A 1OJLA 4BP8A 1IQUA 3GVPA 5DMHA 3UN3A 4TTRA 3IAM9 1IOWA 2QN8A 2MTBA 1HKUA 5EYPB 2VDOB 1ZEMA 3VR5A 2QWXA 4ZOEA 2GM9A 3MMBB 2CVHA 2XDAA 4K4XA 4ZGGA 4QIEA 3BK7A 2EQAA 4N1AA 1P9RA 4JZKA 4LE1A 4MW6A 1YIAA 4CMIA 2DD8S 1TPYA 1NSFA 2QRNA 2QORA 4W4TA 5HQ3B 2I6UA 2Y93A 4HATA 4FKMA 1E3EA 1T8TA 4AIIA 1M75A 4KWTA 2FX3A 3LP0B 3L7DA 4AKEA 5GP1A 1YJ8A 3JQPA 3EDRB 2G63A 5T6MA 3DLGA 5JZ9A 5B2EA 3CLRC 1S12A 1XWFA 2VA3A 3CLTD 5H3CA 3K32A 5AW9A 1X9SA 2RBGA 4PGMA 5BMOA 2EWVA 1HBUA 1HDYA 3MJVA 3BBFA 2C4VA 4GRSA 2HWUA 1C1HA 2IZOA 4YBZA 3KUKA 3AT1B 5HROA 7AT1B 2Q4DA 4JV5F 3J80A 4S04A 1MROB 2J5BA 5E3IA 2NUTA 4WZZA 3Q7EA 4MWDA 2CF6A 5T67A 3QEBZ 3NS6A 4B46A 1LC0A 4UUQA 4TKMA 1L7XA 5AWFC 1VYAA 3EGDB 5CCDA 4YB1P 5FOXA 4O4JA 4F91B 1A27A 5EJ6A 4DBLE 1WD5A 2L9WA 4KO0B 3I09A 2C5AA 4MKYA 1QYXA 2QA5A 3AUTA 1L7AA 4MDFA 3PS9A 1VXOA 2YOHA 4CLZA 4I1IA 1YC5A 5FBRB 1O9BA 2XQVA 5F8GA 4MYTA 3K4PA 1NVFA 1P5FA 4HFNA 3TLGB 4EF5A 4EUEA 2B5JB 3TCXB 1VCIA 1RCFA 4FVTA 4Y7CA 4X4TA 2WHEA 3SJAA 3T6BA 2AK2A 1OW3B 3A12A 4OYYA 1I6KA 4ZTUB 3I8XA 4Q2LA 4NEQA 4UOEA 2HS0A 3WYGA 3UMGA 4Q3EA 2J3EA 2RF2A 2H4HA 2ROEA 1QYIA 2WNIA 5B57C 1UC8A 1MSWD 1LZKA 4TMVA 2D6FA 4HDSA 4UZSA 3G2MA 4QJVA 4K9DA 2ZAIA 2C97A 3CFYA 4DBVO 5AVVA 4ALMA 5TQ2B 4ESVA 4R81A 2B98A 2W8BB 3TMAA 2F3SA 4ZT3A 2L41A 4ZMBA 3LALA 5CH8A 3RS2A 1ODLA 3UMVA 4MWCA 3BCSA 5EIOA 5G1NA 2Q2VA 2NYUA 4BNIA 3E3AA 2A1TS 1RCOB 1YQUA 2VKZG 3N0WA 2VJQA 4JV5J 5FAKA 3N6NA 3HJNA 1UC4B 2E55A 2JAQA 4C4OA 3ILIA 4R41A 1UBNA 4JR0A 2R2AA 1OFVA 2UXDF 2AP6A 3TB4A 4G8DA 1RTIB 1K8XB 2ZJ4A 4AS3A 2PKEA 4RVNA 2XYPB 5E2AA 4MARA 3NGDA 2H8KA 3PQ5A 1QDUB 3SVZA 4QOFA 4ZT6A 1Q78A 2ZRLA 3BDEA 1RFLA 2G4VA 2IVFB 1D9DA 1VCMA 1ZM3A 1T8EA 1G6Q1 4HADA 3AM5A 5C7LO 4G97A 4A7PA 3I5UA 4PG8A 1OH7A 1ODFA 5DLEA 4ZYXA 4OF4A 4GKAA 4JKYA 5FL3A 4QW9A 3SX0A 3S8EA 4WTOA 2ZPUA 3UQSA 4PTYA 4PRYA 4KBYA 1Q17A 1NBME 4EMTA 2QMUB 1CY8A 3R0ZA 2ZBGA 2B8WA 1XDWA 2RU9A 1NW6A 2ECPA 2XF2A 1T5BA 4ZU3A 5I9MA 3QBTA 4RLQA 1T3GA 2B5WA 3TW0A 3RBAA 2OAP1 4PLCA 4A0GA 1YTLA 2A1IA 3FHCB 4HQNA 2OHOA 2HHLA 1RMTA 1MR3F 2CZVC 4HDOB 2ID4A 3U7QA 4PIMA 1RK8A 2A84A 5AM0A 4TSFA 2H5IA 3QHQA 2HEGA 2GYWA 3LT4A 1LI4A 2LA4A 2WLTA 4M8NE 3EXG2 2FHJA 1AUXA 1W49A 4M9RA 2I62A 3M6FA 2ZM5A 1CG6A 4AQYB 5T7LA 1GFIA 2WCXA 1RXCA 5PGMA 4KHPF 1NNEA 5KQMA 1ID1A 2AI3A 1UJ6A 3PPIA 3B1JA 5FLEX 1BQNA 2PUVA 1N5KA 5DNDA 3VAGA 5AI4A 4YB6A 2GO1A 4ZVSA 4BL5A 3QLTA 3DFUA 3P0HA 3IDFA 3EUAA 3JAKA 2ZBRA 1PR1A 3CNBA 3IOMA 2MZRA 5TVGA 1A2BA 1X4HA 2RB7A 3STVA 2ZE2B 4PUOB 1SHZA 1YIDA 2XCLA 4AY6A 3K8ZA 3SF8A 2HJVA 3G82C 1ICEA 1GR0A 1X7WA 3SBEA 1F9AA 1SIZA 1HNZF 3JQEA 2ZANA 4B3XA 4PBRA 4ETZA 1C41A 5CXQA 2X1LA 1JHXA 1ZI9A 3AKEA 3DDCA 1J06A 3LBHA 1V6SA 3VZDA 3H1FA 2XMMA 1XZJA 2WM9B 4P81A 2VJUA 4OYIA 3Q86A 3W7AA 1W36B 3N5KA 3EMTA 5IZHA 2XMPA 1ACJA 1D2NA 1WMBA 3P2EA 1KEZA 2VPXA 4LYAA 2PZJA 4M9SA 2XB2A 3AP2A 5HSPA 2H2GA 1FOEB 1X19A 5K3FA 3CZMA 2X76A 4A73A 1NF8A 5B64A 3OU2A 4LJ6A 2JVOA 3JQQA 2C9DA 4I6JA 2NXUA 3CNQS 3GX1A 3DYIA 4K5QA 4CYMA 4Z0TA 3O5AA 4P0QB 2DNLA 3NANA 3Q8UA 4YJDA 1UKBA 2RGNA 1MIOA 5I3UB 4O2LA 2YKOA 1DWQA 4XIGS 3X1DA 1JQ5A 1DQNA 2V6BA 4GSLA 2ZJPQ 2WKWA 3GP5A 1IPFA 1NGSA 1OS5A 3QSIA 5DLDA 2HYIC 2XWXA 3DKIA 1BQEA 1FXWF 1OAKA 4HZUA 1Y89A 4IL5A 3ZGLA 4JLNA 1T29A 2XRFA 1G5IA 2JZNA 1V3ZA 3ZLBA 4YS6A 4PQRA 2HR1A 4C4WA 2GM5A 2Y1LB 1KNZA 4OP3A 4HEA6 1HTWA 4URXR 1PV2A 3BXFA 2GTIA 2CJFA 1MJHA 2CQHA 4RKRA 4B9NA 3GMTA 1PZGA 2AZTA 1TADA 1O08A 3BFKA 3COSA 1T36A 4B2LA 1FFBA 5J58A 1FS6A 1FT8A 2ZUGA 4GZLA 1AURA 1P62B 3AM1A 2PO7A 1QUPA 3W3AD 2PEBA 3PGLA 4K3UA 1IOVA 3OUUA 1ACMB 2FF5A 4Z0NA 2GUWA 1GQRA 4KBIA 1HA1A 2M6KA 3ILLA 3ZCTA 5G02A 3I01M 2P7IA 1PZEA 1G8AA 1XC7A 2BM9A 1E3WA 4IS3A 2WI8A 5HJ7A 4O0LA 2O1PA 5C8VA 1FW8A 2C7OA 5G4KA 3U1BA 5HBMB 4KUHA 3RTDA 4I9HA 5L1IA 2UVRA 4K6FA 3SEQA 1EP3B 1L5SA 4KT0C 4NRUA 5LR6A 1MMLA 3KQSA 2FR8A 2H2FA 3M9XA 1Q21A 2YKQA 1NG1A 2W2TA 3CUVA 4KO1S 3ZJVA 3IIJA 2FJAB 3PPYA 2JZ5A 3QE0A 4OHRA 4IIJA 1AZSC 2ILYA 4OOFA 2VG5B 1W0CA 4TUYB 4MAAA 5LC1A 5A5EA 1LVGA 1F2DA 4Y6LA 1ZTWA 4R1TA 3UWOA 1GGKA 4EEYA 1UEUA 5IP5A 4ZRNA 3T95A 1K3FA 3BGFA 1ULTA 1VPLA 3JYQA 4HH1A 5AKZA 1NH7A 1PK8A 2P5UA 3TAPA 2PZMA 1T3HA 3MEQA 4C0QC 3GLJA 1BX1A 4I1VA 3W8DA 4FGSA 2BKOA 2J7WA 2AJQA 2O2XA 5K14A 5C8XA 2A5GA 3ISVA 1CZUA 3OLQA 1F2TA 5COBA 3O2NA 3QMWA 2MLZA 2QBYA 1GPKA 1ENYA 2ATEA 1SOUA 2YNGA 5DYWA 1X80B 3KCNA 1Z4IA 1OQAA 4ALLA 2I2WA 3QFSA 2X1MA 5C81A 1DEHA 4X54A 2DH8A 1PNTA 5BSMA 3P97A 1XNQF 4Q9JA 1Z12A 3IRXA 3SD7A 3GLHA 3QF4B 3KXLA 3EC1A 10MHA 3ETOA 1P27B 4B3HA 3OJLA 4RR5A 2Y76A 1BH2A 2YTCA 1Y0HA 1W59A 2E18A 1S2GA 1KSJA 1WIWA 2W8KA 1QGYA 4OXIA 1R43A 2QRRA 1GXSB 1WC0A 2R7WA 3FNFA 2WY2D 1WMDA 3KMSA 3QW4B 5TS2A 1UF9A 4YEAA 4GKBA 2JH3A 3UN2A 4DPKA 3VNSA 5TLSA 3V7NA 4KDCA 4AULA 4YUYA 1PJ7A 3R8YA 2M4MA 1NUAA 4B9VA 3WMRA 2O8NA 5B3LA 1U94A 5F7XA 2JLEA 3MB5A 5KWJA 4D3HA 2BE2B 1M7HA 2V6JA 1BKDR 2PNFA 1VQMS 3W2VA 4F3NA 3EXAA 1WA5A 3PXDA 1LNQA 3F5DA 1GMWA 5LYJB 2WONB 4ZCMA 2VDWA 5CGZA 2Y9HA 1RM3A 3IKMB 1Q1GA 3PTAA 3LYLA 8ABPA 1RGVA 3RNOA 4R7ZA 2CLHB 2XUIA 3KWMA 1RW4A 5E1BA 4ZRMA 3SFZA 5IULC 5C1BA 3WG9A 3C15B 4ABYA 2W25A 5F1YA 4JBNA 4PG7A 3LPAA 3BS4A 3I0ZA 4LWOA 2HADA 3SYTA 4CU2A 2ZIXB 3GJYA 4A5SA 5BWOA 4LJSA 1BU5A 1E6VB 5FFMA 1AV7A 3V6DA 4B3RJ 3DRYA 2IFXA 5BOVA 1G63A 3LUHA 3UAOA 3LW7A 1KEEA 3ILYA 4GMKA 4AS1A 2LWIA 2V4ZA 1BVYF 2GX8A 5KG5A 4ER0A 4BS2A 4XTCS 4LV6A 1JDBB 2FUG9 3I5YA 3LOQA 4MRMB 4YLYA 4C3UA 4FQ8A 4L3NA 4X3PA 4CR8A 3I5AA 1W0KD 5KWVA 3BCUA 2FZ5A 4G1QB 2Z57B 3L9ZA 1EINA 1PBUA 1YI0A 3G5LA 5HMZA 4EECA 4KFBB 4BVHA 1UKZA 3EPJA 3V7WA 5A5FA 2IYPA 5ETPA 3HZZA 2BUNA 3EMDA 4ZCQA 5I3CA 4ZJLA 4KH0B 2QN7A 1H8HD 3ZLVA 3WRXA 2CFTA 3EULA 3THSA 1MB3A 4D43A 2Z4PA 4MUYA 4TMXA 5CW2A 2I76A 4WLFA 5FUVA 3WX8A 1SQFA 3NIGB 5L1JA 1REQA 5B7QA 3UFBA 5HS4A 2GXQA 4P7KA 3KJFB 3TRKA 4CMAA 4RF2A 1WMSA 2ZVJA 1CR1A 4YAJA 1F38A 2ZUBA 3B78A 4ZVQA 3EVOA 2FOIA 5HF5A 4FHCA 1SUIA 4NXNF 4CG1A 4HR2A 2FUG1 3L0DA 1SC1B 1UPBA 2P65A 2KJQA 4ND5A 3MA0A 4XRGA 1DKQA 2CDQA 1JMVA 4HP8A 1QLWA 1WDMA 2QMUA 2Q46A 2NTJA 3NC0C 3OMLA 1XK8A 4ZVRA 3HZEA 4BNWA 2EW1A 4URQU 3WIUA 4B3MJ 4FFWA 3CC8A 2IUUA 3VRHA 3C85A 1KAEA 3KQPA 2KM1A 5DHUA 1P1FA 2E66A 2Q62A 1CY7A 4H15A 1JR2A 3MM8A 4OQLA 5DPMA 3UGKA 2VZEA 3EGNA 5A8WA 4QJ5A 2P62A 4BVGA 3LWMA 5KC9A 2MHCA 4IIFA 3VYUB 3U02A 5K8NA 4MEAA 3CTPA 4DSIA 5EJEA 4ES3A 1A5TA 4B6OA 2ZSHA 2B3TA 1MU2B 1CUFA 3DGEC 4TN2A 1PKUA 3S7ZA 3VSBA 2FNAA 4RQUA 4KXMA 3SKVA 1H69A 5C5EA 1ZOTA 5JMPA 1GG9A 3EB9A 1Z1ZA 4E98A 4UPDA 1MMNA 2IRXA 3AW8A 4Z3OA 1KY3A 5EQDA 4HGPA 5D51S 4QLAA 2X8AA 4WGFA 4Q48A 4XGNA 1M5RA 2JEOA 5IH3A 2FPPA 3RVQA 2WJVA 3EDCA 2D3O1 3X1MA 3NJ4A 1EIZA 3KT6A 4JHXA 3WNZA 3F6BX 5KG7A 3T5JA 3TLCA 4EFAC 2OSVA 1JEOA 3CJSA 1QSLA 1RDRA 4DR3F 4I1UA 3V2UA 1CEXA 5EP4A 3MUTP 1M6NA 1D2CA 3B53X 4J91A 2IXGA 2I2FA 1ESEA 3K1YA 1PN3A 1TKRA 4H1WA 5JY6A 4DJJA 4BNDA 1QK5A 1QIEA 3HXTA 2R85A 3N05A 1E58A 3JTEA 1U9CA 4U3JB 4Y98A 4CIOA 4IYJA 3MUEA 5EJFA 4QTZA 4XWWA 1TA4A 1JEYA 4UJ5A 2HEKA 4XOUA 1NHVA 5SZKB 5ETMA 3QUTA 3PXEA 1VFPA 2G06A 2YUTA 4FCVA 4NRTA 1RYDA 1RP7A 2X5KO 1UXGA 2ANCA 4F4UA 1SHTX 4PHFA 1L5KA 5C24B 4MKFA 3BRCA 3GCZA 1PG2A 3QOWA 3B1VA 3GMIA 1HWLA 3KNZA 3U19A 2ZBIA 2DJWA 2V7WA 4KQEA 2H5EA 1RYRA 4DUGA 1RAFA 3TE6A 3D8RA 4C7OB 2OVBA 5LBIA 3OE1A 4EG3A 4ROSA 4GO1A 3GUHA 3UAGA 4HG2A 3BSCA 3CF4A 4Q1CA 3GYNA 3FB1A 5G2OA 2BDTA 4BOYA 3OT9A 2V6AA 3TMYA 3G71S 2DUJA 2V2QA 2B69A 4Q6WA 2DH7A 4OQMA 5LDGA 1RIFA 4TMYA