3WIUA

Crystal structure of pro-s324a/l349a
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKIAPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Requirement of the insertion sequence for activation of Tk-subtilisin
rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 130
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3wiuA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3wiuA02
1BJRE 4H6XA 4CFYA 3SQOP 3EE6A 1KDYA 2PRKA 4NE9C 2PKCA 2Z56A 2W2NA 4AKTA 1GTJ1 1EA7A 2W2OA 3DVRX 3LPAA 4BWGA 3GCXA 1SIOA 4OV6A 1SN7A 3GT3A 4OMDA 2P4EA 2WUVA 3AFGA 2B6NA 3PTLA 5I9SA 5CW1A 1T1EA 3H42B 1IC6A 2Z57B 1YJAA 1AK9A 5AMXA 2HPZA 3P5BA 1WMFA 1C9NA 2SICE 4DWWA 3GCWP 1GTG1 4LVNA 2W2QP 4I0WB 2Z30A 1AH2A 3TECE 2W2PA 2QTWA 3WIUA 1AF4A 4YN3B 2DQKA 3T41A 3A3NA 3F7OA 3D43A 2HD4A 1IAVA 1SCBA 3TI9A 1CSEE 1NDUA 3A3NB 4C3UA 1GA6A 1JEAA 1TM5E 1SCAA 2G4VA 1KE1A 4HX2A 1Y3DE 1R64A 1BE8A 1C9MA 4K8RA 2QTWB 5AVJA 1MPTA 2WV7A 1SCDA 3F7MA 1THMA 1PFGA 1Y4AE 3I34X 3H42A 1V5IA 3DE2X 1GA4A 1ST2A 3VV2B 1Y33E 2Z2ZA 3CNQS 3DVSX 1BFUA 2W2NP 3GCWA 1SCJB 1SVNA 2TECE 1LW6E 3A3OA 2X8JA 1EGQA 4WOBA 3HJRA 4MZDA 3BX1A 2XTJA 3I2YX 4RYDA 4DJ5X 2PMWB 3BPSA 4H6VA 4GI3A 3AJ9A 3SICE 2XTJP 1P7WA 1NDQA 4NE7A 3A3PB 3BGOS 1PTKA 3BGOP 3PRKE 3QFHA 1SBHA 2Z2YB 3AJ8A 3P5BP 4NMXA 1AQNA 1R6VA 2W2OP 1YU6A 3DW3X 1SH7A 1GTL1 3UNXA 2ID8A 1TM7E 2PWBA 4H6WA 5JXGA 1T1GA 1ST3A 3DW1X 1GCIA 1YJBA 3DE6X 3VHQA 1TECE 1OYVA 2Z2XA 4FONA 2E1PA 1WSDA 4B5LA 5ARCA 2PMWA 3LXUX 2WWTA 1UBNA 1S02A 1T1IA 1SBTA 2PYZA 1YJCA 1SELA 1TM3E 5FBZA 2W2PP 3VSBA 3EIFA 2WUWE 1SUCA 5JXHA 5SICE 4K8RB 3WQBA 5FFNA 1KDZA 3OSZA 1Y4DE 3DE3X 2GKOA 1WMDA 4M1ZA 4CFZA 1C9JA 2DP4E 1R0RE 2SBTA 1SBNE 4OV6B 1TO1E 3A3PA 1SBCA 1SUBA 2ID4A 1VSBA 4YN3A 1V5IB 1ITPA 2PWAA 2Z58A 5AQEA 2X8JB 1DUIA 4LVOA 1A2QA 1AV7A 1BFKA 3DYBA 3D9QX 1OYOA 1MEEA 3DE5X 1SCJA 1TO2E 5K7SA 1CNMA 1OT5A 4KG7A 4ZARA 1SIUA 3BPSP 2Z2YA 3CO0P 4C3VA 1SUPA 1Q5PA 4KPGA 1P8JA 3SQOA 2Z56B 3F49S 3Q40A 2SNIE 2Z30B 2ZRQA 1SUAA 1S2NA 1Y3BE 3DE4X 4J94A 3VYVA 3EDYA 4NE9A 2ZWOA 1SPBP 3DE7X 1KDVA 2W2MP 1KE2A 3GCXP 1PJ8A 3DVQX 3DE0X 1DBIA 1WMEA 1AU9A 5B1DA 1Y34E 5AVKA 2IY9A 4AKSA 3QMPA 1Y1KE 1TM4E 5B1EA 2XRMA 2ST1A 2Z58B 3WHIA 1ZVJA 4JP8A 1HT3A 3I30X 1BE6A 1P7VA 1GA1A 2SECE 4NMXB 3DE1X 3VV2A 1SCNE 3DDZX 4KB5A 2Z57A 1GNSA 1ZVKA 4OMCA 3ZXYA 1SBIA 3QTLA 3A3OB 2W2MA 4CG0A 3ZXXA 1V6CA 1PEKE 1GNVA 2IXTA 5JXJA 1TK2A 5JMOA 3I37X 2V8BA 3CNQP 2PQ2A 2DUJA 1WVMA 1SPBS 1C3LA 1TMGE 1NLUA 1GT91 3LPDA 3TI7A 4ZOQI 4Z2AA 1Y48E 1Y3CE 4HVLA 1S01A 5ARDA 3WIVA 1AVTA 4WOCA 4DZTA 3LPCA 3VTAA 3CO0S 1SUDA 1Y9ZA 3GT4A 1SIBE 5JXIA 1BH6A 3VV3A 1TM1E 1SUEA 5ARBA 2W2QA 2ZWPA 3Q5GA 1XF1A 1Y3FE 5FAXA 3DWEX 3L1KA
chains in the Genus database with same CATH superfamily
2VZLA 2P2DA 2FZ5A 1U1EA 3HPRA 2YKGA 1ZWLA 4AXBA 4BJ6A 1N2CE 3A37A 3C16C 2QD4A 1KRWA 2DRAA 3NHYA 1K0UA 4F3QA 2GMLA 4NV0A 3UT5A 5FIIA 4OMDA 3V6HA 1UOPA 3AFGA 1B00A 1NMSA 4U7UK 4TV9B 1VIVA 5ES4B 1WPXA 4G5YA 1A5BB 4PF1A 4MWCA 3OPKA 4WBFA 4FF4A 5KDLA 2LCFA 1I3MA 1OAOC 2JDID 1TX4B 1AH2A 2DHXA 3LUPA 3NBFA 2GAOA 4L51A 4IL5A 2QBYA 3PF8A 4HI2A 2W6JD 3TLXA 4DLLA 2ROGA 4RW9A 3TMKA 4MIYA 1PYGA 1TD1A 3EMTA 1FDBA 2CUTA 3T7TA 3A3NB 4MDEA 5I42A 3ZJYA 3SSQA 4A8XA 4AI6A 3PNSA 1GITA 5HZHA 1U7UA 1ZAKA 5GINE 3CDBA 1JPNA 2V68A 4G1UC 1UKYA 9LDTA 1BX1A 2G13A 2XXJA 3AM4A 4BZZA 4ES1A 4UQTA 2IVYA 2EFNA 3QAUA 1RTIA 1RAGB 4ZI5A 5KFDA 4J9SA 4YRRA 2JS7A 1G5HA 4I1OA 2H00A 2NX2A 1RPTA 3O4FA 1DBVO 4U6SA 2MTLA 1GL3A 1YKWA 4ALNA 4QWMA 2ZKIA 4LYJA 3CT4A 2ZC4A 3L0CA 1GTHA 1I1HA 1KKMA 2DH9A 4YRPA 2DGOA 4XH9B 1XR5A 1O51A 2GH1A 3ZZNA 2GAJA 3TVDA 4DL0C 2FP4A 1FX1A 2H18A 1DEAA 1KHWA 3DXSX 5BYJA 4ZYLA 3IXMA 1N0WA 4R8VA 1HNNA 4R81A 2R2UA 1XP8A 4CEJA 4DT1B 1FRMA 1PJ7A 3DOJA 2XNHA 2Q6VA 1GQOA 1GLNA 2AEEA 5A3JA 1URPA 2OBYA 4A6EA 1XLVA 2HFNA 2IHJA 2XCTB 1EK6A 4R51A 2W83A 2E5IA 1CHNA 5FA5A 1B14A 4JU8A 4XEHA 3CCES 4EYGA 3JAMU 3CUEF 4ERDA 3CGIA 3QPDA 4JLOA 1GNQA 1G0NA 4DSLA 1GQQA 1ORIA 2I0XA 3S2EA 2K2PA 1IM8A 3L46A 1IZZA 2UUCJ 1RWVB 9RUBA 3EAGA 3HSYA 4JQSA 2C9ZA 1UZNA 5H02A 3D9BA 1IZ8A 2Y1KA 3TX0A 5EERA 3MA0A 4Y6SA 2DSTA 4NYMR 1XTKA 2E1AA 4MFBB 1ESMA 5KS2A 5B2FA 3CJRA 3NT4A 4PHGA 3BFPA 2ZBUA 4I1SA 3RYIB 1YE5A 1R8AA 1CP3A 3OW2R 1QRAA 5DW0A 1XRPA 1DUIA 2FPHX 1K5PA 1SWVA 3HGMA 2CCKA 2XLBA 4KLZA 1P18A 3HA7A 3KQHA 1OYOA 3SVLA 3IWNC 5IMBA 2A88A 3WGHA 4CKXA 4WP3A 1JMVA 3DHXA 4UCWA 3C3BA 3CCUS 2P3SA 2QA1A 1TQ8A 4P3YA 4ARZA 4RHXA 1E59A 4YJFB 5HCNA 3ZV3A 1ZIXA 5JASA 2PZJA 5I3UA 3PGMA 1F9EB 1WNFA 1IPHA 4CLOB 2VXOA 2XD9A 4XPCA 4L57A 1JRLA 1QE1B 3IALA 1ZINA 2XGMA 4P3NA 3T5CA 2WTAA 1H0KA 2JJ4D 1U4SA 1FEHA 2Q1UA 3RSOA 1IQZA 4A8QA 2X9GA 1XQXA 2IIPA 4F0MA 1U8CB 3BDIA 4HRVA 4EFDA 3IIKA 1VE7A 3UCFA 3ET6B 1KC1A 3RC9A 1NJ6A 2PT7A 1DGQA 1JECA 4GXTA 4EG6A 2QW0X 3LWLA 3KSDO 4ER5A 4UULA 1LJLA 3KQUA 4J6EA 2MYPA 1LDGA 4CLLA 2PDAA 2QZSA 1P3JA 4YREA 5ICFA 3QTLA 4M1WA 2XY6A 2XYHA 4HYYA 3D6AA 3OFVA 3TG8A 3N5BA 1E7MA 4R2KA 2GWHA 2PXAA 2CFSA 1EWTA 4XX0A 4ZVFA 2PSHA 3MWDB 3TAXA 2FW1A 4H0FA 5LMNF 1T8UA 4CN9A 3B36A 2Z0MA 4URVR 1Q11A 5KINB 3K0HA 3I64A 2A6PA 5AHKA 4CKWB 4PS1A 3ZWWA 2UVUA 3VKUA 3AP2A 4ILKA 2VIHA 1CQPA 3VR4H 5B0GA 2M98A 2XMUA 4ASUA 4ME6A 4MW1A 2FZCB 5IKMA 1NRJB 1VG9B 1E94E 3EQ6A 2FK7A 3OTDA 2P40A 2ZS7A 1CF9A 1H22A 2H9AA 2R7TA 4HNHA 2XNQA 5L45A 1TMOA 2JBHA 3R74A 3A1WA 2QRHA 1ZZNA 5J2NA 2WP0A 3JQ8B 2WM3A 4C11B 2ADMA 4S1VA 2V6FA 1GU1A 3IS3A 3M4XA 2IYAA 1LWFA 3DZGA 1XD2B 4D9BA 2VFVA 2JLGA 2O05A 1P1BA 4GYJA 4OTZA 1P31A 2MSCB 4CO2A 3QU7A 2G1JA 2D59A 4UHHA 4C4AA 2X1GA 1S1WB 2ETXA 1MROB 1NPKA 1DT3A 4MS1A 3QF4B 3ONEA 3ZK7A 3AVYA 2NVUB 3WIUA 1BXGB 5KYYB 3EGOA 3HU5A 1VKRA 5TC4A 2YXPX 1XF9A 1PFQA 3LBYA 1KO5A 3TI9A 4JN6B 1GPYA 4DJBA 3KWLA 5FOTA 1WHVA 4XYLA 2GN1A 1PFUA 3OLWA 3UI3A 2N75A 5L51A 4ENOA 4F0KA 3MMPA 4IVPA 3OZGA 2XOKD 3JSMB 1S6QA 1VYAA 3RF6A 2ZHAA 2WKWA 4NVRA 3FHLA 2I4RA 5CUQA 1EFTA 5A8RB 3I2JA 1PS9A 4LYYA 1J42A 3AR2A 5BW4A 1ESDA 4Q02A 1Y4ZB 3H6KA 1G1AA 2BANA 3ILJA 4P2FA 2BGNA 5AE1A 3GRAA 1FD8A 1HT2E 4EKIA 3VO8A 1VHQA 2WAOA 3ITDA 3OTOF 2YS7A 5B3KA 1W2GA 5AHRA 2FQWA 3G85A 1TJ4A 2ZRDA 2X0KA 4DA8A 4C2MA 2A92A 3UHAA 3QPUA 4MJXA 3AU8A 3SF8A 4Y1FA 2C58A 3M3DA 4FMDB 4BKRA 4UY85 3I32A 4R8UB 4EUNA 4XWYA 1B70B 3DWIA 4B7ZA 2IX3A 2C5BA 1YNOA 1R8SA 1HBOB 4ES3A 2BKAA 4LFBJ 3NH6A 4FONA 4V3BA 1T15A 2JIPA 1R7IA 4ENUA 3OHSX 3BXXA 4AROA 4NAUA 3V3KA 3J80Y 5E7IA 1SULA 1V11A 4WFXA 2L82A 3DDIA 4BBYA 1Q17A 1GV1A 1Q2UA 4Q39A 4XB2A 3FC9A 4ZCSA 1PNVA 2QD1A 5E3CA 4YMTA 1UWBB 4X84A 4W5QA 4RXMA 3CZ9A 4WZBE 4JIMA 3WYEA 2CXRA 4GR5A 1N2SA 3PPVA 1W9MA 1AO0A 2NUUG 2YX1A 2GD0A 2C0CA 3W2GA 2HSEB 4YFYA 4X6LA 2BRLA 4DX5A 3GCZA 2KH9A 2BR5A 4C30A 1A04A 1ZSNA 2WLSA 3OOSA 3BMQA 5HPYB 3D0KA 1G1XA 1H0SA 5TDHA 1KYXA 5TPZD 2EK6A 2EJCA 5BV1A 4BU1A 2JGDB 2UYYA 3THXB 3FNQA 1EWVA 2L9NA 1GNPA 1IKYA 1Q19A 1XQ6A 3UB2A 1M1UA 2O3TA 3V9PA 4AKGA 3LW7A 3AU9A 4NYJR 4GP9A 5COAA 4YCMA 4IJ5A 4ZVEA 4ZARA 2Q49A 2YBDA 1DWPA 3BSOA 4HPXB 4AS2A 2VBIA 2ALJA 1MJ5A 1S2LA 5THWA 4PV7A 4NASA 4RE6A 1MB0A 2X1MA 2H6EA 3W2WB 4IUYA 2G9NA 3EGDB 4MB6A 4MS4A 1VJQA 4USJC 1S7GA 4EY5A 2WWWA 5IM0A 3O90A 2VJQA 1R0AB 2W2MP 4G8BA 1RWWB 3MGGA 5EY5B 3PGJA 3T8YA 1U6ZA 3SX2A 3F9IA 4E0BA 3GH3A 3MPOA 1GZSA 1XQWA 4ZV9A 3B9QA 3ABZA 3O2NA 2FDCA 1BWVA 1IYZA 3DMTC 4P75A 3FNIA 1JIHA 4OMFG 3BH6A 2CSXA 4C3LA 3D3JA 5L40A 4DDFA 5IQ6A 3L18A 2NAPA 5KVSA 3ZY4A 2F48A 1W0KA 2AJ8A 4EMSA 1YJNS 2ZAOA 2AG8A 5CD9A 2DJWA 1OTHA 1P4AA 2G4BA 3ZIDA 4WFQA 1OZ0A 4GE0A 1VGYA 2CB0A 1GT91 3DR3A 4AO8A 3C14A 1DS6A 2ZXUA 6LDHA 2OCPA 3P6YC 2WONB 2CDAA 1S9FA 2INGX 1DDGA 3KQWA 4DPOA 2IDZA 2F7VA 2GJ2A 2BTQA 3CO0S 2QNBA 4WN3A 4OO3A 5CCEA 4Q8EA 3WJ1A 5K3AA 3QFFA 1VRUA 4JOQA 1Z8FA 3ZWPA 3IBFB 4UUNA 3C66A 4PYIA 1F8YA 2JW5A 1D5WA 5EI5A 4BQRA 3OC6A 2OHIA 5IJXA 5J2UB 4Y2XA 1M67A 1DV1A 5ED4A 3E8OA 4YUAA 5CXQA 1FFWB 4EAQA 3T9ZA 3IQGX 3STXA 1GTJ1 1U7HA 1ENZA 2DNYA 2A18A 3AR5A 1V7PC 1O03A 5DTEA 3E1SA 3IQEA 1B76A 4IGFA 3UYKA 3HKDB 3U4CA 4MO2A 3WICA 1BROA 3V7UA 1FBNA 2BELA 3ETLA 2MLZA 5JIBA 3ZDBA 3QUAA 2QTRA 4G6ZA 1XFDA 5AVZA 2CYBA 2ANCA 4F4UA 3WKDA 1GDTA 3OZBA 2C78A 2CFTA 1SCIA 2ZTMA 3H5RA 2AK2A 1ULZA 4YR0A 3BJRA 4HWSA 2NSBA 1Z6QA 2IEDA 2JKYA 5C4IA 3A7EA 2H2WA 4C1NA 5ADHA 1BXRB 2GEDA 2JAPA 1W9HA 3IBWA 1JE1A 4JUAA 5IH3A 2FOLA 1U02A 5DOZA 1X4CA 2LCWA 3OHPA 2XS7A 3IVCA 5EHGA 1RAIA 4HGNA 4DR6J 3RUCA 1GUZA 2ZS8A 1I5RA 2VP4A 3WFZA 1XZDA 1WG1A 4LCJA 5G3YA 4N5MA 5P21A 3M9LA 4YY3F 4B4KA 1W6UA 1MAWA 2OYRA 4B6JA 4IF4A 5FOWA 4ZP9A 5JPDA 3BKFA 4KSEB 3FDFA 3NW9A 4ZP8A 1YMUA 1HDOA 2MKIA 5D0RA 5TQJA 5LNK6 3M6MD 1G21A 1FCAA 1SFRA 4WZMA 3RPEA 3ENZA 1DAKA 1XERA 5HK8A 3R7BA 1GIAA 2AFHE 1N5IA 2ZIXB 4B3RF 3ETJA 3HCEA 4IQ8A 2XA2A 2XCLA 3DYAB 4O3OA 3VPSA 3ZY2A 4CODB 2BKPA 4K4WA 4CIBA 1NQXA 3D0GE 3SG0A 3CNHA 2UV8G 1YKGA 1XZHA 3SYNA 2J48A 2ZVIA 3AB3A 3ZTQA 4TQGA 2XWJI 1AUVA 4LHEA 4K7QA 1AM4D 1F4LA 4PZLA 1P4GA 1OXVA 4I2PA 4BMCA 1UC8A 3CZMA 4RF4A 3M9MB 5I8PA 4GI1A 4HX5A 3IQHX 4RLQA 3LTOA 4DSZA 4POAA 4WACA 4CH1A 1GN9A 1M2GA 4NI5A 4QGAA 1WEYA 3QJYA 4B3TJ 1KDZA 1UZDA 3RIGA 3HWX1 4FS8A 5CM8B 1S9EA 5LQJA 4IH6A 2Q0QA 1DDIA 4PXYA 4R41A 3CTPA 3WI7A 2YR0A 1H2FA 1GTMA 4QEKA 2PZEA 4CRJA 3EIOA 1MJGA 4LBIA 5GZ1A 4EEYA 3H05A 2UVQA 3D6NB 3CJ2A 5FO1A 4GX0A 1U8WA 5A5EA 4NLGA 5EQFA 4M38A 4PR3A 2VR1A 3T1TA 3O0DA 3HHLB 1U63A 4FBMA 1ZISA 1NVFA 1RI7A 2AR0A 2F1KA 3LA8A 4QTYA 1MEEA 1Z88A 2I87A 2PH3A 4JYZA 1RP7A 4CKZA 4JI8J 4HLBA 4KODA 2IYOA 3GZ4A 3MTQA 2HS0A 1DCFA 3P2JA 1V1RA 2QX9A 4DU7A 5EG5A 2KMLA 1RT2A 3NTQA 1YTLA 1R6AA 2HHPA 2KFNA 2C7VA 2HAEA 5IXSA 3RBDA 4FDLA 4G6VB 3M2UB 2FZEA 4MXDA 1P2BA 3T54A 13PKA 1U3VA 2LXUA 4IQ4A 1SCUB 4RVOA 5DT2A 2XKKA 5GONA 1RJGA 3KLGB 1HL6A 2WMDA 3OM0A 3CH7A 3OVBA 2JHPA 3D3WB 2GPTA 4F9GA 3FCOA 2JK1A 3O9MA 1RYSA 4NLXA 5F2NA 3TZEA 4USWA 4JNCA 3NM6B 3WL4A 2NUPA 2QLFB 1ECCA 3KVNA 2AR7A 4MAMA 4FGLA 1PJRA 4D26A 3K9FC 3ENNA 4CLPA 5KC9A 2HJ9A 4FHFA 3THRA 2J9ZB 1FDOA 3D2BA 4TTTS 4OG2A 4KNVA 2ZGVA 4NCXA 5CTAA 2WWGA 1Y3CE 3TQFA 1R8QA 2DLCX 1QIIA 1LV8A 2I4IA 4RANA 1Z7GA 2Y2UA 4AWXA 1NC3A 3CUUA 1P1KA 5JJCA 2COEA 2HAIA 2B9WA 1NY6A 2OGZA 3HJUA 2QVXX 1YL5A 2C2EA 2YOFA 5L8RC 2FHSA 3TLGB 3OEEA 1XNRJ 1E2DA 4DN6A 1AGYA 2EBWA 1H1LB 3L0DA 1Z7BA 2AX4A 1I0IA 3G02A 3FBCA 4XR4A 4X62J 1V95A 2GVDA 4MVJA 3FTEA 1NW5A 1EK2A 4BBAA 4RNMA 5DLEA 3OFSA 4R68A 2XZLA 4U6NA 1I3OB 3N2YA 3LKVA 3HLUA 2B35A 3CJ4A 4UCQA 1GZ5A 5FNVB 4X8LA 1UBSB 3DD5A 4HJXA 1MW9X 3H87A 2QUZA 3VYUB 4LAFA 4F4KA 4IMRA 1IM5A 3L1HA 1K7CA 3EZYA 3M1AA 4B33A 4CEIA 4I4CA 1OPIA 2IYUA 4FQ7A 1DBDA 1U7ZA 1DBSA 1IKYB 4FGUA 3VJMA 1GZ6A 4HVZA 3KK3A 3R3HA 5LJLA 1TYEB 1E3MA 1T2VA 4BFZA 5BR7A 3C8UA 3H4TA 4HJRA 5IXUA 1HMYA 1PZEA 2VH7A 3W5AA 1R27B 3NNHA 4PWDA 4X93A 4X6XA 2PMCA 5KFCA 1KE1A 2AE2A 1N75A 4DV4F 3E70C 1O6GA 3UO0A 1NR1A 5H16A 3KKEA 4Y2MA 2E7WA 5DW3A 4C0QC 4LCEA 6YASA 3F7MA 2DFVA 1HRDA 5I5GA 2AWOA 3ORSA 3M8KA 3DXFA 4NONA 1HM5A 1RLTA 1ST2A 4ENTA 3MEGA 1XU4A 1OSCA 1N5MA 3S6JA 4EJSA 1DC3A 4LJRA 5KYTA 4IJWA 1SB9A 4UEQA 1AG9A 4GBMA 4DILA 2WJGA 4OJYA 3DRSB 2B78A 4JLKA 2VL7A 1N9KA 4WY5A 1DJLA 3MGAA 1Y4SA 1EQAA 1R6VA 3ORFA 1L1RA 4E98A 3WLKX 3LA6A 3MAHA 1RRGA 3E22A 2BFFB 2WSSD 3ZHXA 1ZD3A 4ZRMA 3A4VA 2J45A 3BGLA 4BLGA 3P2KA 5HYVA 3LW5C 1TL7B 2O20A 4W9NA 1ECPA 5HM8A 4KXXA 4ETMA 3S1AA 4CM4B 3WX8A 1R0LA 3PQFA 5KNBH 4CMIA 1FXLA 1NJ2A 1UOQA 4K6FA 1VLVA 3QZ8A 3ZKWB 1EU1A 2V50A 5CH3A 5B1IA 2HQDA 2VK1A 3LX4A 3O3CA 2DFTA 2AJLI 2DGWA 5J5AA 1S7HA 2RGYA 2DHEA 2QSUA 3FETA 2CJWA 1YK9A 1IMJA 2QVBA 4BRUA 3DMNA 1PC5A 4UD6A 1JHPA 5AM0A 3LHFA 2PK3A 2V9WA 1NUQA 2HHLA 4O29A 1PZGA 2X3FA 2ATVA 3Q41A 1MA0A 1YACA 1Z18A 5HZMA 4B3HA 2I5JB 3VSDA 2KO1A 4N1AA 4LRCA 3DBRB 1CY2A 3F41A 3C4JA 3S8EA 3O2IA 3RAXA 1LK0A 5K0JA 2D62A 3GPLA 4OGFA 1XWLA 4WDRA 3V4PB 5FWAA 1KFJB 1SXJE 1UXOA 3IDFA 3G23A 1D4ZA 1RHKB 2C04A 2C22A 1SCJA 2KSQA 4JL8A 1NNEA 2YIVX 1IBLJ 4FFRA 4NOLA 1XDGA 1R89A 4IHJA 1QSLA 3RUHA 1YZUA 2Z56B 2FX5A 1DXYA 2R96A 2PX8A 1Y8CA 2GXQA 1GPDG 3WBJA 2R7KA 2A0UA 4C0HA 3T95A 2BEWB 3W5IA 5J63A 1BJKA 2ZH4A 4LY9A 1ONPA 3CUTA 1VA5A 3RWMB 3IRUA 1MMDA 4USKA 1Q0TA 2F7SA 3BRWA 3EGDA 3GIRA 3K05A 2EWWA 2DVIA 3Q1KA 2ZCVA 5GVSA 5CITA 3QJPA 4JI6B 3MUVP 1XK6A 3AINA 2ZUUA 3W9YA 3A6GA 2ZDOA 2H9YA 5J1EB 2WUFA 4X0EA 3I6MA 3SJ7A 1SKBA 2IRUA 1JDBB 1L3KA 1FUEA 4E0DA 2J9DE 3LC7O 2MGZB 3HHEA 2GBPA 2ZT8A 5IK2D 3L7BA 2AQKA 4MP8A 5HP4A 5EIHA 3HCOA 2R8OA 4WTYA 1BC6A 2BJEA 5DYWA 3VU8A 2VB6A 2UUBJ 1OPRA 1SG6A 2NZVG 2VRBA 3ABOB 1IOLA 3CB2A 2ACVA 1TTTA 4N41A 2RQCA 2IU0A 1H66A 3W9BA 5ETOA 3QEKA 3R2CJ 1SIBE 3LGNA 3CZRA 1VRWA 4KQEA 1NBAA 3G2XA 5KYUA 4O0IA 3SIPB 3VKWA 3IR6A 4A6PA 1HIYA 2W4QA 1JKHA 4LRQA 3ZHBA 3ADKA 1QE1A 2EG5A 3RYHB 4OYHA 4P2BA 1X0XA 2E6KA 4N0MA 1PEDA 2QJ3A 5IAOA 5EJ8A 1E9RA 1FDIA 4AMYA 1WTFA 1U0EA 5BWMA 1PT9A 1I1NA 4IWYA 5LN1A 1Z0KA 4FW8A 4EARA 2GZAA 1FFWA 4Z7NB 2F3SA 3WDOA 1YDWA 1QKIA 4F71A 1P4RA 4JI4J 3SHTA 5AXNA 5KT3A 3DOMA 2VZEA 4XDHA 3ZV6A 5KZMB 2BJWA 1FKPA 1YZFA 1Y81A 4EHAA 3BWYA 3WWOA 3T94A 2OBLA 3JZFA 5HE9A 5A9SB 4WH0A 3A1TA 3SDEA 1AGPA 3R77A 3BBCA 2C54A 1CV2A 3H3FA 2XCUA 1XXHB 5F3RA 1RW4A 2XUOA 4UUMA 1H2RS 4HI1A 1CSEE 1TAUA 1JLEA 2G36A 4Q5IA 2AJ4A 2OQIA 3W6PA 1TM5E 4GO7X 5E1MA 4TKLA 1XWFA 3LPNA 4GLOA 1YDLA 3EPHA 3OQJA 2W8BB 2WV7A 4UNRA 3C5EA 4HMQA 4IKOA 1KOHA 1CR1A 3N70A 1TB4A 2R00A 2EEYA 2POCA 4UT4A 5F1OA 3EVNA 1J0BA 4QYMA 4DL2A 2B25A 2P2SA 2WJVA 4LXUA 1G6BA 2B2NA 2QZ9A 4CMCA 3TEGA 2WDPA 1JLSA 3D8TA 4R3WA 2ZR7A 1EIWA 5HF6A 1NJZA 4ND3A 1Q6ZA 6REQA 1I1OA 3CYFA 3WX4A 4M9RA 5C51B 4RCZA 5M29A 3LQQA 5I7EA 1YQUA 4BL5A 4GXRA 1PILA 1F6DA 1ARZA 3FVWA 4O0NA 1PT7A 3CJ8A 4X91A 3JQPA 2MKCA 5GIPE 4A9AA 3USZA 1J2EA 1TJYA 1FP6A 1SC1B 3BOSA 4R4JA 4IDFA 4QJVA 1SOWA 1ATIA 2VDWB 3UAZA 2NP6A 3NHUA 2FEXA 4OYPA 1DBRA 3MBKA 3G13A 1J2UA 4QSMA 4EQ6B 4LIPD 3T0FA 3V2HA 2V5UA 1YIDA 2PI4A 4PLTA 1Z2DA 1CJUB 4XD7A 1G3UA 1H93A 1VLQA 4QXQA 1OQ6A 4HUTA 4BCBA 3B1YA 3W8RA 2X9VA 5JFOA 2DR9A 2ZYRA 3UTCA 2H65B 3VU0A 3DTVA 2E9SA 1ID8A 1RCOB 5TJHA 2ZOFA 2W58A 1EINA 2H5JA 4F1WA 2IMOA 4HNRA 4YXWA 1ITPA 3CCMS 4F5EA 3B78A 3UWSA 2P6RA 4YYEA 2CLEB 4WGFA 5BYQA 1E9AA 2IDMA 1A2QA 1E9FA 3HO8A 4ZYTA 4XPEA 2ENUA 4O1HA 3MMNA 2G9ZA 3BRSA 3FYHA 3M6IA 4EZ6A 1F2HA 4KV8A 2HJSA 3AFOA 5EQDA 2JFWA 1A9ZA 4DSUA 3Q8XB 4L07A 5JCPA 2VPTA 3GGSA 4D8XA 3UNYA 4R8UA 2BXJA 1JEQA 4JJFA 5HM6A 4XUCA 1H9BA 2OYSA 1VQ4S 4PO9A 3WYCA 1QS0A 4IV5A 4JLMA 2H4HA 1KKLA 4XQEA 2J5BA 1FFXB 1FU4A 2VODA 4PSKA 3M7VA 4FDMA 4UU1A 4MFBA 1I2MA 4E3ZA 3F9CA 4M87A 3G5TA 3QV1A 3HEBA 3JPWA 5DYYA 2IOHA 3LCUA 3D1HA 3R5AA 2AC4A 5D77A 2P5UA 3T3PB 5E9AA 5EE0A 1YS1X 4YJHB 3C3MA 1KXJA 1EXDA 2QMQA 3NUGA 1CUFA 2IYEA 4OZNA 5ERYA 4P7VA 3R4CA 1D9AA 1SD1A 2ADCA 4GUDA 4PRFA 5EWEA 4ALKA 3P9XA 4R7TA 2O7QA 1Y3JA 2HHQA 1QFXA 1NH7A 2X76A 3OKFA 1KI7A 2VSYA 1NKEA 1E3DA 4P5PA 5JUWA 3AQOA 1SOAA 2M2BA 1S01A 1KO8A 3H4VA 4MKRA 4CEJB 4DR6F 1O96A 2KVIA 3BE4A 1DXHA 3MGJA 2W7PA 3FYUB 4OYLA 5DHPA 3C48A 2H7YA 5IAJA 2ACWA 3JRXA 1XTTA 2OGWA 3FRYA 1U9IA 2AFHA 1YZVA 1J1UA 3BQ1A 1JEJA 2QM3A 3QBTA 5T8KA 5CX4A 3GROA 1NK0A 1IJEA 3HY6A 4TTJA 4IOMA 5BNZA 2XHWA 4QUDA 1HMVA 2IY5B 2FW9A 4RPGA 4W92B 3AOGA 2BF4A 2YVAA 4L9SA 3VU3A 1USIA 2Z95A 1IKVB 1P2VA 1S1UA 4R05A 4JU9A 5JDCC 2Y1LA 3BGVA 2CCGA 4JXKA 5CFRA 3DOEA 2GARA 4Y7DA 3E18A 1VHDA 3GQBA 2DIUA 3UMVA 3JR3A 3DLJA 1L9KA 3ADAC 2VG5B 3MHPA 4QUBA 1GFZA 3T9EA 1H2WA 2COLA 4UEKA 2G25A 4L3OA 2DJIA 2XTZA 1ZQ1A 1E3JA 3OL8A 3PX3A 1I1GA 1XCBA 3DTYA 2B5WA 2DY0A 4K6KA 2QLJA 1S3GA 1MIOB 2XVYA 1NW7A 4KE8A 2AJBA 2O23A 4R31A 3RKUA 2QP9X 4KGDA 1M6YA 3O74A 2BM1A 1MVOA 5K3DA 3GHHA 3OJ0A 2ZTVA 4ZVRA 1WVIA 3TZXA 4E5PA 3TR5A 3ABSB 4RSRA 4S1TA 4CLFA 3HI4A 2IIHA 2HWHA 3WMGA 4HQ0A 5F5LA 4DF3A 4IDCA 5JAMA 4Y2CA 2GZDA 4EU0A 2HN9A 2NO5A 4F5ZA 4TGLA 1N2CA 1VRTA 4RW9B 1KBQA 2QTTA 5D1NA 3CWQA 1BW9B 1M2EA 4EB0A 3KVYA 3AWIA 5T6MA 5BMVF 2KB0A 2CLFB 1IBKJ 1UMCA 4CH7A 1L4HA 4FNOA 2JVOA 1Z0SA 2PWBA 3AJ2A 2V3WA 1P3DA 1UA0A 4UFOA 4B31A 3OU2A 1L5RA 3GDOA 4L8YA 1UPUA 4P86A 4RHTA 4ARBA 5DM70 2RB7A 4BWFB 4W8OA 2VNAA 3NHPA 4CM9A 3FUTA 1YVPA 5KFUA 4WVFA 1WHYA 5ALDA 1N2IA 1XEXA 1Z5VA 1BMQA 4DMHA 1RXVA 3ZKAA 1MW7A 1C0UA 2HK7A 4Q4AA 2CJPA 4MQUA 2NZ4A 3GJ3A 4HKQA 4FCTA 4JZKA 3OSNA 1TK3A 2JLEA 3L07A 1TW2A 3DFZA 2E55A 5AJYA 4OQ4A 1G6KA 1XNQF 1XSEA 2CJAA 5LU9A 1GFWB 4JOBA 2GF2A 5FA6A 4EGSA 3ETEA 3HU1A 5HAOA 4MB2A 2UUAF 2BHTA 4WNIA 3AJDA 4X4PA 3DKRA 1C7FA 2IJNA 1RWMA 1DEHA 3UUGA 4JY7A 2YWEA 1K3UB 3O8OB 1ACJA 4I7EA 3PCXA 1PIEA 4DQPA 1F6WA 2WNIA 3ULKA 3DXBA 3GPBA 2B56A 3R0IA 5DHTA 1PG5A 2ZH7A 3KXPA 5CG2A 4HS4A 1TVKB 3EB9A 5ED0A 3RASA 2ILTA 3POTB 2KW5A 3C7KA 4LVOP 5EYPA 2IWHA 3W61A 3QJLA 3R6DA 3HVTA 2LYVA 4PNZA 1VIXA 1U1GA 3M6AA 4CM8B 3JYPA 2JD2A 1KYIA 3VR6H 3TD9A 1AGNA 3T9NA 4WP9A 4OLHA 5E7MA 3I0RB 4X62F 1JHQA 1NQAO 1QO7A 3CLSD 4M5NA 3FPAA 1DWOA 4LSLB 2VEOA 1TQDA 2DKOB 4QECA 4WMLA 5LCXA 4IQ0A 2PKQO 3QVOA 4QDZA 1S6PB 1TAQA 1T9YA 3QELB 4IUBS 3E6AA 3ZXUB 3G89A 1L7EA 1YC2A 2ZM6B 4KV8B 3ZNJ1 1HT3A 2HGNA 2QLMA 2BBSA 3RTEA 3KOWA 3D3KA 1CUAA 2FFRA 2WTUA 1N36B 2ID9A 1T9DA 2YY6A 5LQCA 4IMJB 1O5OA 5IVIA 2VH2A 3AEXA 4LRWA 2RGGA 1JTVA 2YNHB 1IBLF 5KYWA 3ZZMA 3SFZA 1IHPA 1GUAA 3RSCA 1Q8BA 3I4CA 3QE4A 1ZO8A 4ZHQB 4UEOA 2AWNA 4KV9A 1QRRA 1ZEMA 1WW3A 3IHWA 3UC9A 2DGTA 2PVSA 1NAQA 2YX4A 2FOIA 2EX0A 2PSJA 4IHJB 1M2WA 3KUEA 3KAQA 2R1VA 5AJ3F 4YI5A 5K2OA 1KQSR 1CJUA 1MMNA 1TT5A 4LYDA 4E2FA 1JWWA 3NV9A 1ULTA 1KNQA 4MWBA 4AUKA 3D7NA 4EEXA 1KMHB 1LC0A 1MWYA 4UZBA 2ZHOA 3I5MA 2P9ZA 3OLZA 1E4OA 1QJ4A 5FNZA 4L4ZA 2WWRA 3NMAA 4DMLA 4MUXA 1K0TA 2P9JA 1ZESA 3K5OA 1ZRNA 1E6CA 1DAHA 3EUAA 4QYTA 4HO1X 2VHJA 1JDSA 1S12A 1JLQB 1COWD 3L0YA 3OPXA 4KQ9A 1YVUA 3G2KA 4GM1A 4J76A 3AZOA 1P9NA 1W19A 3MWEB 3UJHA 5C2JB 4DEXA 3QWIA 5K3OA 2F00A 3S8YA 5ALJA 1YRYE 2VJMB 4M53A 2PBZA 4RKRA 1RLOA 4QYIB 4DF4A 1CS0B 2ZB3A 2RH4A 4LHYA 2AG0A 3FOEC 1KZ1A 4XIUA 2H63A 2XIQA 4PYKA 3K5HA 1JMKC 2OUKA 4YRMA 1WKCA 2GDJA 3HBLA 4L5BA 1OF1A 4MEJA 2WIDA 3LP2A 1MJGM 2J9EA 2IYRA 3KEQA 4IGAA 3A4TA 2HA7A 1E92A 1OYEA 1QQ5A 2M6KA 1RTHA 5HF9A 1H6KX 2IYLD 5HWSA 4RDXA 3R3TA 4BNJA 1V8ZA 1TMYA 3A2LA 4CCAA 4LMPA 2Z2ZA 4BHTA 2OH2A 4DSFA 4UCFA 4L76A 2QMUA 1FRVA 5BV2P 1K4KA 4YRNA 3FCEA 3RKSA 1Z4PX 1JAYA 3GONA 2DPMA 4HDCA 4CN8A 1B7YB 2P5TB 3DMYA 3BICA 1NDQA 3OLXA 4XWGA 1NNI1 4PPZA 1GQRA 3V34A 3NT2A 2FHMA 2QLNA 2Z1NA 3GT7A 1ZC3A 3SFTA 3TO5A 3HL4A 5KFIA 3FCXA 1ZCZA 1E8DA 1C0IA 2BKVA 3NB0A 4CT9A 4LXHA 4ZV4A 4BFLA 1X1AA 1ZGZA 2B1QA 4V0KA 4M7WA 5I51A 5AOVA 3VR2D 1NHUA 2Q0XA 3KALA 3WNZA 4B3SJ 2VNIA 5DNDA 3ZZZA 4C6TB 1J70A 3M9NB 4II3A 3W9HA 1HBUB 3JD0A 1XZNA 2OAQ1 4NS4A 2Q3BA 4BMDA 3DBIA 3K6SB 3MAJA 1C7ZA 5L6MB 3ENKA 3BGDA 3DRYA 3FCAA 1O97C 3QGGA 1UKCA 4K8RB 3KX2A 1EFPA 1NVXQ 4CM2A 5KFWA 4J16A 1EXVA 5IKXA 2CGEA 4GBGA 1GLVA 4EUHA 2DTDA 3B9BA 4BZXA 2XY7A 3IDZA 5CM9C 3EVCA 2KFYA 2ZSJA 4AWBA 4EJ2A 5C8YA 2NZYA 1A4UA 2GN2A 4K2AA 2YDXA 1DV2A 2R8KA 1SBZA 1VLYA 3ZLVA 4M83A 4N3NA 5L7WA 1XDSA 2LMIA 1TVRA 3R7SB 2V5VA 4P22A 4R5MA 3D6HB 4H9GA 2ZKLA 4A0QA 2IBOA 3K0KA 3PIPQ 1BMDA 3TE7A 1RI2A 3A13A 3CLUD 3FVRA 3KJNA 3AJAA 4ED9A 1TKCA 1EB9A 1THZA 3P4UB 2EL7A 1U0OC 1VLZA 1VC2A 3TB4A 4WIQA 1EP3B 4E2YA 3ZE1B 4WFZA 3IJ5A 3DI6B 4EAAA 1XDWA 4KR9A 5K7SA 1T5HX 1QM5A 3AOCA 3PXDA 3IL2A 3EULA 3EXG2 2QR3A 5JYDA 4LX8A 1ESNA 3DPUA 1G60A 5C52B 4U95A 2IYVA 1VYUA 4X65J 3U7FB 3Q40A 3C3XA 5L1JA 1I2BA 2KT2A 2AOVA 1GPAA 5COQA 1XTRA 4K9SA 3KT3A 2O5RA 3WB1A 3GO4A 1RE1B 1UBKS 3A4YA 2FSPA 1DBIA 4IP0A 5AKKA 2ZJYA 1UC4B 1MA3A 3EODA 4RBUA 2GEVA 2Y9MB 1YZHA 1ADFA 4YCSA 2XDQB 2FF7A 5E3RA 3M9OB 1I3CA 4A8TA 4D25A 1L4LA 1V16B 4ID3A 4ZYZA 1LZKA 1MN9A 3I73A 2WB4A 4DZZA 1QF6A 2UZIR 1NZ8A 1L7PA 3NM5A 2DXFA 3QFSA 1HI1A 4KQMA 1BDMA 2YV3A 4JT8A 4MRNA 3GFRA 4E03A 1BS9A 2OM2A 4MK9A 3UMSA 3A3OB 2V55B 3SXJA 3ZVLA 2ZEJA 3EZOA 3BWDD 4C21A 2HGLA 1XTIA 2WQ6A 1RWXB 4PG4A 4IOAQ 2XB8A 2GBIA 2JFUA 2WP8J 3NEAA 3AF0A 1D8ZA 3WA7A 4KIWA 4P53A 5HF5A 4KPEC 1RT2B 1FQWA 4EG0A 4AS1A 1ZD5A 2RIPA 2QJFA 3C6QA 2VYFA 2P9EA 2AYBA 4RUKA 1NMQA 1KIAA 1R1DA 3LBNA 1PS8A 2RQKA 4OYYA 4F3OA 4MGEA 3I56S 2VKQA 3V8VA 3ZW8A 5H3LA 5B1YA 2VSFA 4N77A 3K4HA 2G07A 4A23A 1QDUB 3KFLA 4UU7A 4EBCA 4X20A 1F5SA 3OMWA 2NUAB 3TFWA 4ARCA 5F1YA 4D3HA 1WD5A 2VWGA 2OXFA 4V0MA 2R2SA 3DXXA 1Q78A 4ZANA 2C9CA 1SIOA 4MWZA 5PNTA 1U1OA 1US8B 1K88A 5JTTA 4NCJA 3HCRA 2X8AA 1LKZA 2YN0A 3O44A 1X7XB 4B45A 1T3TA 5FYQA 4Q47A 5KTNA 2PRJA 4Y1GA 5JYBA 1RAAA 2X0EA 3IJPA 4ZITA 3LA0A 4V1CB 1WMAA 4QNNA 3ZGVA 2QMUB 2PTGA 2D13A 3LQFA 3GJTB 3GUHA 4CO0A 4FW9A 2CUZA 4DIFA 1PK8A 5G4KA 3PHGA 1EETA 1ZUIA 3EE3A 1R0CA 3TVZA 3VVCA 1CFJA 3U9TA 1DAPA 4GI2A 2C3PA 2HSGA 3X1MA 2QY9A 2V58A 2J7PA 4KSYA 5CTJA 3M4JA 2MZ1A 3AR8A 1IK6A 5LP6F 3I92A 3HT0A 2YZMA 1SK8A 2QC3A 2P41A 5A8WA 5H9WA 1JIVA 2QENA 5B08A 2HA4A 4J9QA 3K0JA 3RO7A 1RQPA 3MEDB 4O3SA 1ZCFA 3INTA 2ZTSA 4F4JA 3FNHA 3A3OA 3SFUA 1CQIA 4W1PA 4ZN3A 1HNZJ 3I6QA 5DF1A 4KR0A 2CN1A 3A6HA 3KXDA 3N39C 2BVNA 5C34B 1BNCA 2D0DA 5E33A 4PAMA 1K7SN 2HL6A 5KQPA 3VO9A 5JH7F 3K6RA 1NKVA 5ILGA 2PLFA 2B5JA 3HDJA 3GBSA 1DRWA 2XDQA 3NNSA 1MMFB 1OY8A 1M34B 3BRQA 1FJCA 1HBNA 3E15A 3GXBA 1Y42X 1NMYA 1VCOA 2Q41A 2QYTA 2RF2A 2H3HA 3KQPA 3CLTC 1KAGA 4DX7A 3O0TA 4DMUB 1H0RA 5A4DA 2ZB4A 1PYOB 5KU7A 2WSFC 3NFYA 5DK6A 1W47A 3A6JA 3BT7A 1IPEA 4TXNA 3OLVA 3KTFA 3RVPA 3G79A 3QX8A 2GNKA 3JQAA 2QJRA 1HOXA 3GUZA 3L0OA 3IC5A 3ZVRA 3RK0A 4G0VA 5T4BA 2AP6A 4R8LA 5DEOA 5K6AA 2PGLA 1QZTA 3HVIA 2I3AA 5CFZA 3W2EA 4HDRB 4POOA 2DC1A 1GY8A 1G16A 2W01A 2QG4A 1R0YA 4NJMB 2X1HA 3R5HA 4HN2A 1W4LA 4MVJG 1QDUA 1QZUA 1LEHA 3N5CA 1EUYA 3HO1A 1ULUA 4MPJA 3QW2A 4DUGD 5KCZA 1HEYA 5AQEA 2UXDB 4HAOA 4XM1A 1KETA 4QUKA 3TK1A 4LVNP 4Q9LA 1FA0A 3BCRA 4HADA 2V9PA 4F6RA 3GCDA 1Q57A 3FGVA 4G3IA 4NPCA 3MUTP 3TD2A 5EMNA 4O4JF 5THXA 3DU5A 1U2ZA 1QYIA 2VVTA 2D1YA 3O7WA 3EIQA 4CMJA 3IMFA 2XHCA 2EQBA 2R7AA 4F2PA 2G0TA 4Q9AA 4GX5A 3U17A 2VQSA 2B98A 3PNKA 3RM3A 1HWLA 1L4UA 3LZDA 3I6IA 3FHOA 4ID5A 3IPYA 1P5HA 5H59A 1P60A 1E9DA 1JIKA 4Y00A 1WJGA 3OICA 3QYFA 3DFMA 1SKWA 3RSLA 5JJKA 2J46A 3PYGA 5JZSA 2UZ3A 4R1PA 1K8ZB 2J5QA 3PD0A 3PZBA 3RSQA 1S9GB 3ADOA 5G41A 4RM2A 3D59A 3VR5A 2OHJA 1KSGA 3QBCA 2FJEB 1R6YA 1RTDB 2ONYA 1KLMA 4O4HB 1YVEI 4FYWB 4YXWD 3DFUA 4JI1B 5KNDA 3UZUA 1CQIB 2MIIA 3H1PA 5J23A 3IAM6 1C0PA 4ND8B 3SKYA 1ZOSA 4CDGA 4MI1A 1GCUA 5DXFA 1JFVA 3G86A 4TV9F 1TMGE 2B82A 3EZNA 2EBUA 2H4WA 3IAUA 3PFIA 3UKJA 3WDKA 5G0WA 3U6BA 3R3SA 3HPOA 4TZTA 1ZA2B 4LY3A 3L4SO 3AK4A 2NV6A 4LGVA 3U3MA 1NJYA 2RKBA 3H2LA 4BO5A 1QHYA 2GD1O 5E3PA 4IOCQ 3ZTTA 3KEOA 3O4RA 1N36F 1X7VA 1TUBA 4XKJA 4DR3F 2Q3MA 4TU9A 2FGJA 3K35A 2VPYB 3UHFA 4QWCA 1E6MA 2YJ5A 3EY9A 5A8WB 1LLDA 1SMKA 3OX2A 3JQCA 1QMGA 2HJWA 4YIKA 2F2TA 2Q3JA 1C9NA 4UM9B 3R7BB 5KYXA 2DK2A 4I4NA 5G1OA 2E5GA 4DNXA 4H4MB 3SHQA 4IKAA 2YNHA 4QELA 2ID7A 3JV7A 5BSGA 4UMDA 3U81A 1OY1A 1U1LA 1RK8A 4TLMB 3OTEA 2R3SA 3K0FB 2XGPA 2HK8A 2IODA 4YP7A 4NRUA 3RK4A 1UM9B 3HCDA 4K5RA 1CPYA 3E4DA 4AQYF 4FFOA 3DMFA 5E6UB 3LBIA 3TAUA 1XVLA 1SCDA 2JZCA 1TZCA 4PQUB 5E0OA 1AK2A 4D6YA 1JLCB 3OL7A 1BYUA 4Y0VA 1B8PA 1TCBA 4U7TB 5HMLA 3SC2A 4PIVA 4E6PA 3ND9A 4B7XA 3VDNB 4U7UD 3ND5A 5D86A 1KVRA 3ZTPA 4FXVA 3ORYA 4NICA 3PNIA 3PG5A 1VJDA 3FCCA 4PX5A 3ANNA 1LV5A 1WZNA 1UKBA 2IX9A 3WTCA 3RARA 1ISHA 3MM8A 5ETKA 1M83A 1GUYA 1YK0A 2QL6A 1RWPA 3O9VA 2GK6A 3HACA 3ITKA 2VO1A 4XIIA 3AVUA 1X15A 1NVWQ 4UOFA 3S27A 1MJNA 1LQ2A 1OHHA 3NS5A 2V1XA 1AUOA 4TTQA 1TU4A 2EFVA 4PPGA 2A0YA 1QJHA 3HS3A 1M2KA 3TOCA 4DQDA 4P74A 2R65A 2CWDA 2JBAA 2VS1A 1YQDA 4MP3A 4KAFA 1XBWA 1VQ7S 2A35A 4RCYA 3THYA 1ONBA 3GAZA 1R50A 4A8WA 1Y8RA 1O0SA 3ROPA 4MYTA 1Y4DE 2XB9A 2XVZA 3A26A 3DHEA 3FBEA 1I32A 4B1FA 2LXFA 1E1KA 4UOCA 1WHSA 4BZPA 4Z3DA 3IAS9 4YJ3B 4I5FA 3D1OA 1RE1A 3U9SA 3UAOA 3D3CJ 4LRUA 4CVNA 3AYXB 3HSJA 4A8HA 4EGAA 1F2GA 1E20A 1TPZA 1NLYA 3W5CA 3SHFA 5CEJA 3T5DA 2ZTHA 4WAUA 4YJ2F 5JVDB 2JI6A 3VX4A 1H05A 3OQBA 2OB2A 2D74A 3I9ZA 5BPHA 3ELYA 1G7SA 4PSDA 1TGYA 1FE0A 5DDOC 4P1ZA 1GXSB 3FFIB 4IGIA 4H7EA 1YFLA 3O94A 2NMVA 2Z04A 2G0AA 4ZVHA 1TL3B 1C30B 2VL1A 3KJNB 1U7WA 2YXEA 4KPGA 4UU0A 2RNEA 2KYZA 3CJ0A 4XX0B 5A2QU 4YMIA 2PJUA 2VDPB 3KQTA 4M7RA 2DNQA 2J6HA 3OL6A 3NBQA 3BL6A 2HS3A 4ELTA 1JZQA 1U8ZA 3IR7A 4KNYA 3F3SA 2HU7A 4JR1A 4ZIWA 3VR1A 3ONFA 3BYPA 4V0SA 2OV6A 3ZVKA 2HDHA 3WXBA 2I1QA 3I5CA 2Z1MA 2GZRA 1OXSC 2AXNA 4LOLA 2I2XB 3M2PA 4BE4A 4CL0A 1XTPA 4E5DA 1BW9A 5E3AA 2IYIA 2O8BB 1RRPA 4B71A 2XHZA 4QUGA 1XPJA 2NUBA 5F8MA 4G5HA 3LHKA 3T7DA 2AUNA 1SU8A 4K6HA 5DG8A 4DEZA 3OLBA 4AJEA 4LQCA 1QH9A 1Y5NA 4I4IA 3GLVA 4PIPA 4QTZA 1QGOA 2OFXA 3AIOA 4Z0TA 3U5TA 3FR8A 2VSNA 4AUMA 2AJ2A 4I1VA 2ACMA 3PW5A 4A73A 4DR6B 2DCLA 2K5UA 4LWPA 4WFJA 5D3KA 3W3ZB 3I05A 5TQ2B 1S1UB 5KOHB 1Y8QB 4ISCA 3K0SA 4IR1A 2BUNA 3X1KA 3OQIA 4Q34A 1MH1A 5JS7A 3VU1A 3QELA 4X1IB 4Q3EA 1BH6A 3A1VA 1MTOA 3OCUA 3SIWA 3NWPA 2ZWPA 1T1SA 3OEED 4BNTA 2VH5R 3L40A 3CJ5A 5KFNA 2QG9A 5IT9U 4R1TA 3CINA 3BH7B 1U2DC 2PKCA 4B9EA 1W5EA 1FNSA 4JENA 3PITA 4MH8A 1GZ7A 3NNAA 4F8EA 2ZSUA 2R4UA 3ZNPA 2G1KA 3HFVA 5CURA 2VFSA 4DIUA 1JFTA 2GQQA 2P69A 1QHXA 2VOJA 3I23A 1K86A 1UFKA 1FY2A 3FCHA 1E9CA 1QHEA 4W98A 3VJRA 4FWTA 2W2QP 4XQ9A 3FOCA 5HMMA 3DMRA 3RDPA 4ZFNA 4ZVTB 2DEUA 1NG9A 3NHJA 5J1PA 1BCSB 3IQDB 5J5VA 3WGKA 5JSZA 4RMNA 1OO0B 3UA4A 1U31A 3ZCSA 2DPXA 4MA0A 2G9UA 2EHDA 2G4VA 4LRYA 1FW6A 3DLCA 4EMUA 2PNJA 4G5FA 5BN1A 2Q50A 5KKCA 2IF2A 2B2XA 3OXLA 1DB3A 2GCFA 3C7CB 1ZW1A 1GRCA 1FJ7A 1RCXB 3URKA 5KTKA 3PHLA 4YY3B 1MW8X 1RTZA 1GZUA 1N5TA 4B35A 3RIEA 4P2GA 4TVKA 4YHHB 2WT8A 1T05A 3BMOB 3PACA 4HEQA 4ZEWA 4XCQA 2BKXA 3AHIA 2PR2A 2XTJA 3R3UA 3HNRA 4LJ6A 2FVRA 4ZU3A 1DQZA 3NXKA 2E4AA 2R9LA 5KYKA 2P2NA 2DNGA 5J4KA 1NJGA 3LAMA 4BV8A 1D3WA 1YAJA 3NHAA 3VDQA 2X2OA 5FEMA 4IDBA 3UHJA 4V19X 1ZOLA 3GK3A 1L8LA 3DRPB 4N3BA 3HJHA 4CG3A 2CLKB 2GS8A 2UYGA 4DXAA 1D2CA 4ELUA 4HNGA 3K0CA 4OHMA 3KLNA 5HS6A 3VHRA 1KWKA 3A4LA 1E79A 1Y6RA 4IRCA 2MZJA 2AD9A 2ZD1B 3MJHA 2TRSB 5D6GA 4EDFA 1AKEA 4OGLA 3UJNA 3KEGA 2RAFA 3GQCA 1R9MA 4BGIA 3AXSA 3BIJA 4OJMX 4FNGA 5JXHA 2QV7A 1ZU5A 4CZ2A 3W2FA 3M6LA 2YQZA 5J59A 2NZWA 3F2VA 3P8ZA 1RHJB 3DZFA 1LW0B 2I2DA 1SKSA 1DX9A 4PO1A 2HKEA 4PKDB 4CV0A 1WJ9A 1ZXLA 1TELA 4I2QB 4M5DA 1I7NA 4GVXA 3RTDA 3R5XA 1QWOA 2XLJA 1PJ6A 5KFYA 4PN3A 4QBFA 3PI7A 2AF4C 3PS9A 4LHZA 4YB7A 1E3IA 4KGVB 4ZHQF 1HR0J 5FPTA 2L69A 3ASZA 5KNCH 4NOKA 4I9GA 4B3MB 1MC5A 4K7JA 3TPFA 3E48A 3LQRA 3DZDA 3X44A 2B1GA 2BZ0A 4XRRA 3LT0A 4ROTA 1RPZA 3TAQA 1GGKA 4I1IA 4EQ6A 5JW6A 3AFNA 2ZC3A 4RVGA 3FTCA 1OT5A 3BPSP 1U3UA 3KDPA 3GMDA 3HZGA 4XEUA 3KTQA 3MLBA 1QP4A 4GX1A 1KYQA 4DNFA 2JAQA 3HDHA 4JZYA 4NYZA 4G56A 2O0HA 4Y2AA 5FV7A 4NE9A 2ZWOA 1E61A 3K09A 3KNZA 1J2VA 5ENDA 1QSYA 3CJSA 5AVKA 4FR5A 2P67A 3S5JA 2BEUA 5CB4F 2XMZA 2FZGB 3TYTA 3R23A 1XVAA 3ADCA 1P5JA 2HCBA 2YIJA 4V39A 2R6DA 4DR2B 3SLGA 3RFCA 2QTNA 4FSHA 3DONA 3CMQA 4UC0A 5EQJB 3K4PA 2JKZA 3AF1A 4FOOA 4MW9A 1N5YA 2Y0DA 3DLEB 1ANKA 2MZRA 1I4EB 4K0KF 5BR8B 3UBMA 1SCKA 2DUJA 3PFWO 4UBMA 1V4NA 5ALGA 1BKYA 2FF5A 5GAEI 3C45A 4E94A 1XA3A 1S77D 3I2FA 1S6UA 1NUAA 2B7LA 1PBTA 1XNQB 2I67A 3EYZA 3GLHE 4H4OA 2MKKA 3ZW7A 4NZOA 4RD0A 4LJ4A 2XI3A 3FMOB 1JU3A 2REBA 1NI5A 4QUEA 3IE1A 2CHFA 1T6ZA 4LC9A 1V2HE 3KYDA 3K57A 4DSKA 4Y0FA 2Q3PA 4A5SA 1KU6A 2OV1A 3NGSA 2QPLA 3FR7A 2JASA 5HIKA 2ZUCA 1QRDA 5EZYB 3A27A 3PA8A 2RHTA 2FH5B 2R6GA 4DG1B 3I01M 4BEJA 3NHFA 1A9QA 4EUVA 4EVIA 1T6NA 4PYNA 1QAMA 3DBLB 4M22A 2BZSA 4BUJA 3RSSA 2VA2A 1IBMF 1KGDA 4P93A 4XK8C 1L3TA 3AOAA 2W2PA 2A30A 3I9MA 3R5CA 3PRBA 3SYRA 2ASYA 1TK9A 4LSLA 2GILA 1X4DA 5J2TF 2GHTA 4NLSA 5LJ5Y 4L6V3 3GA0A 3R5SA 5FI3A 3OHBA 2BC9A 4HDSA 1E2UA 4N12A 4TPKA 3NCRA 1RC1A 3NUQA 1B42A 5H9EJ 1J6UA 2FFAA 1DFHA 5JNUA 3R8FA 2HIQA 1MIHA 2B4OA 2CD7A 3RRKA 4KXYA 4C0LA 5DNUA 221PA 1G6HA 3JVEA 4O2BA 2OD4A 1C0LA 1Y5LB 1SL0A 2CZGA 2RHBA 2IXDA 2HAFA 3GSDA 4KV7A 4ZOCA 1A9RA 3FOFC 3DLPX 4QOSA 1CRLA 2RVJA 4BAZA 3NWEA 1DT5A 1L4BA 3CH6A 1CQJB 3OECA 3MRSA 5K03A 1SVSA 1UEKA 2ZU6A 3OE7D 4PXAA 4Y6QA 3KOUA 2AOTB 1LI7A 2HNDA 1XMQJ 3P5BP 3CRNA 3OESA 2HQ3A 4Z86A 4R0JA 3O8NA 3UK7A 4HTFB 3NTLA 4QFMA 3R7FA 3SKXA 2V7GA 2R5FA 1NBEA 1T3GA 3OFGA 5LSLA 4F84A 3THTA 3OFKA 3TNJA 4J7UA 4LFBB 2QT9A 3UM9A 1Q0ZA 4TZKA 5SV2A 5JAIA 1ZK3A 2AUMA 4GKVA 1Y9DA 4B9LA 2DPIA 1TCAA 3Q0EA 1NFRA 1Q15A 2X4GA 3G9ZA 2VC1A 1RP1A 5FULA 2X0FA 1QIGA 4MUEA 2BE9B 4QDXA 1PF7E 5LLSA 2QW1A 1ISFA 4MYHA 2I80A 1BWQA 1R6XA 2JI4A 3FCSB 3FMVA 3O8WA 1TKAA 2VAMA 4H17A 3QIVA 3LUCA 4XXHA 3FOAA 1SOMA 4NXMJ 1CB7A 2RHWA 3OZSA 4GMDA 4FDTA 4AKHA 3CIMA 1KU0A 3WDLA 4BX8A 5BSTA 2CPEA 1BQEA 3P45A 5CLGA 2NU9B 3F74A 1X92A 3VPXA 4K9LA 4QT4A 5DTMA 5KVQA 4ARUA 4MMZB 5HTKA 3TUPA 3KZOA 1F6TA 1GMVA 3L77A 1T9GS 5AKIA 4P52A 3ROXA 4C0BA 3MS4A 1HXHA 2FU5C 3BKUA 5IK2A 3JARB 3NEYA 1OW3B 2VDWA 1Q5PA 4QTTB 2FX2A 4UDXX 3IO1A 3VF0B 1YJTA 1ISGA 1QE5A 5IXYA 4G65A 2WICA 1LW2A 3KHTA 5FOVA 4RZRA 2O48X 2Z2KA 1HSZA 1JJ4A 1VJ0A 1OE0A 2J3EA 2E0IA 2VBZA 5K8TA 1QU2A 4BRWA 3DMHA 5AUPB 1XMPA 3GQVA 2GLXA 4WU3A 2QX8A 3JQ9C 3U9LA 3RJMA 3QITA 3C14C 2K4MA 3MM9A 4YS6A 3Q7TA 4QTUB 3E81A 4DR7J 4YB6A 2FQ1A 5HQ3A 2ZI7A 2XE8A 3CD7A 1MUUA 2HNYB 2CJXB 1V3ZA 3HXLA 4L73A 1DHMA 4BCAA 4IH7A 1TZMA 1B16A 1ZTWA 4WCFA 2BSAA 2IIQA 3BXPA 1N5KA 2HT1A 2WJIA 3SC4A 4Q4DA 2HRBA 3HCAA 1G66A 3W4JA 5C24B 2GX8A 4KBGA 5CAEB 4JOUA 2WSBA 3UG6A 2BKEA 1EFRA 1MG7A 2IAJB 3N1UA 3M1YA 2QA4G 2IGTA 1KZ4A 2OYCA 4C7QA 4Y34A 2OPHA 1AUSL 3G9TA 2WRMA 1E6UA 3N07A 5EIBC 2ZSBA 1VJ5A 2RAVA 1RJ9B 1IFXA 2Q6KA 3QLEA 2FAXA 4LKOA 3HTXA 2FDRA 3PSHA 2NZCA 2P6UA 3PFNA 2JH8A 2K2QB 3X1JA 1FKPB 2R3VA 4PZ9A 3PD1A 1T9TA 2PZMA 5J4VA 3KWJA 4YRKA 2BACA 4FHDA 1MABA 3MZIA 5AUQA 3VGJA 1GVNB 4IY1A 2WHRA 5ILQA 2WQ7A 3HDTA 2XNJA 1TRHA 1DLJA 3C5HA 4CR8A 5ALQA 4TRNA 3A32A 1VCTA 2R2AA 4J3FA 1ZM4A 1T35A 1S8NA 4NNOA 4W6QA 5LL6P 1XNRF 1H1LA 2XYPB 2EP5A 1L3BA 2BR0A 1VL2A 2QLFA 3LLMA 3VC1A 1D6NA 1AIPA 2BLNA 3OEHD 1NPYA 1Q84A 4Z49A 3FNEA 2N7YA 4LMRA 3A2KA 4LF4B 4KN6A 3FKSD 2ASDA 4RC9A 1I0LA 3IE2A 4U7FA 3TZYA 3ZR4B 4X4TA 3D6MB 5AVJA 3PRHA 2F43A 1DWQA 2ZW9A 4NLTA 5JDCA 3SR0A 4P08A 2QAGC 5ALLA 2I6FA 4JLWA 1CJSA 4F3TA 2RD5C 4NOMA 3AV0B 3FFWA 4UUAA 2ZPTX 2AT1B 4EGLA 3MR2A 1FE8A 2OPSA 5GMOA 3DDHA 2PZLA 2ZK7A 5HJEA 4BFWA 3JVDA 4DR7F 4GC5A 1FLVA 2ZRBA 4GOLD 1O0CA 3DBOB 3VKVA 2CVFA 4WECA 4IRKA 3RTAA 4I99A 1SBHA 4GP7A 3UCEA 1AQNA 2AA3A 7REQA 2PT6A 4RLEA 3HZZA 2R97A 1Q7RA 4YT8A 4XVQA 4O44A 2QMYA 2F8MA 1WORA 2YZNA 3IWLA 2IEGA 1H5NA 1EUCB 3AHFA 4LJSA 2WOMA 2YV4A 4L8WB 2NP7A 2CDNA 3H1FA 3QKTA 1KEVA 2KBEA 3W0LB 2HFSA 4OK5A 2ABYA 2AZ4A 1NBWB 5AVXA 2G5CA 2P30A 3VBEA 4U9HS 8RUCA 4YWHA 1D8TA 1WF6A 3KXLA 1MKYA 1NXOA 1HDGO 5ES3A 1XAIA 3B1KA 2HK3A 3RC3A 2V1UA 4RUCA 3GYNA 3OSZA 1HWJA 4KJZA 2GVZB 4TKUB 4HDKB 3BGRA 3E82A 2Y8WA 4GUAA 1GV0A 4BVLA 5JEEA 3IDOA 4K26A 2PQMA 5A1TA 2QRQA 1J21A 2IMWP 5ALFA 5KFQA 4HTAA 1ZVQA 1HHQA 2JFDA 3L7PA 3CCLS 4LV8B 4QQ8A 4B6EA 4RW4A 2AMJA 4WEQA 2PMZD 4U7JA 4WCFC 1FIUA 1SC4A 1U80A 2OD7A 2OILA 2HR1A 3RAPR 5JNRA 3MPWA 1H65A 2R2GA 3T5GA 2VD3A 3MI7X 3GRZA 3O8QB 2COKA 2QOEA 5G4KB 1QIFA 2QU8A 3W2WA 5AT1B 4RY9A 3RCBA 3ONVA 2LDIA 2VP3A 4DHVA 3A06A 4EO7A 1SBRA 3E2PA 1D2HA 1WNTA 3AR4A 3NORA 2ZR8A 3GDFA 1AA6A 4L4SA 2GD6A 4D5GA 5JAOA 1XXHA 2QMEA 5IDYA 4ILRA 2BKNA 3FMGA 1UP1A 2OLKA 4F60A 3IV6A 1EI9A 4KDFA 1S4MA 3UK6A 3FCUB 5MN5A 1KFKB 3II6X 4JI3F 4RFLA 1UFWA 4G63A 3UJCA 2XDWA 4DGSA 4NLRA 3WGVA 4OBWA 1BMFA 4HKTA 3EIXA 4JVNA 2Q45A 3H1TA 4EM6A 1A7KA 2R7OA 3MCOA 1NVGA 4QGBA 4RA6B 5HRCA 4EG3A 4E08A 3UAXA 4U8HA 3BILA 1PCAA 2NUPB 4C14A 1JDZA 4HC4A 4Z37A 2H11A 4Z1OA 4YDDB 2B2CA 3IESA 4RZHA 4EPRA 2PWYA 1WE2A 2F4VB 1PBNA 2R6AA 2REQB 4PNPA 4F0HA 3VSAA 2K1RB 3BO4A 3NIDB 4FMCB 1RAJA 3DHVA 1WHTB 2POKA 3KTDA 4IQMA 1IEWA 2IVFB 3FBWA 3H5OA 4KN9S 3A4IA 3U40A 2EW8A 5KOWA 4URFA 1AB6A 2VF2A 3G88A 1TFWA 1SBQA 4RK6A 4E1BA 2HF7A 1NKTA 1Q92A 1JPUA 4Z51A 2QSJA 4M1MA 1P7YA 3ZNNA 3T9DA 4Q43A 5EX3A 3KG0A 1QO0A 4OSOA 3HCPA 3RVQA 5CPBA 1YTUA 2XY5A 2QUHA 1CVRA 3OOEA 3H1AA 1N0VC 3LCVB 5I4CA 2I2CA 5AO9A 4Y6GB 4FI3C 4OAPA 3WRXC 4HWOA 3GCWP 3GZTB 4FFMA 1XO1A 5BSWA 4ZEXA 1NBHA 3Q3GE 2O8FA 2YWWA 3LDGA 1LWXA 4ZN1A 4M5IA 2H17A 2FPOA 3QSGA 4RHCA 1EQ2A 1AUDA 4FFWA 1F60B 1E96A 3JQAD 3FI9A 4NPOA 2FLPA 4D4KA 1N33F 4BJ5A 1TIPA 4O3PA 3RFVA 2EZUA 2VDVE 4RW4B 2VBXA 3MPDA 1E3LA 1YSCA 1YMQA 5CCDA 1C3XA 2ZITA 1OS5A 4B85A 4F45A 4YVFA 1UPMB 2BGJA 4G1QB 3UV7A 2NVOA 3N8DA 3OQ6A 3A9UA 4KC0A 7AT1A 2FWRA 2JIOA 3FNBA 3L02A 3LS2A 3LMKA 4C8ZA 1T9HA 1O6FA 2QV0A 4DL3A 1QFJA 3QFWA 2H4YA 4TLQA 3GD7A 4LVCA 2RG7A 2G4CA 2WF5A 4EYIB 5AJTA 2GM3A 2VLBA 5DM0A 3AW8A 5AI8A 1XN9A 3G8CA 2MTBA 3RRYA 3K94A 2YKQA 1HYSA 4D7AA 4KR0B 2JGDA 4DREA 2BZGA 2F3PA 1GRRA 5HQ3B 4MGHA 2FCRA 3QIDA 2P6NA 2NSJA 2EKZA 3SD7A 5KX5B 1SKUB 2WJPA 2QL7A 4KGXA 4HNVA 1ZJWA 1HR0F 4TKUA 1Q83A 3TYXA 3M4ZA 1UP6A 1G8FA 1UBHS 4Y1RB 1LEOA 3WK5A 1Z12A 3F67A 2W7OA 1FDVA 2DT8A 2RJ3A 1KEEB 4M1YA 3FG9A 4JYBA 3RBVA 4MW6A 1QVVA 4DIOA 5T64A 4K3UA 2G04A 3BE6A 4RQTA 2N1BA 2ZUVA 2R7UA 3BN7A 3QQ5A 1ZITA 2IC3A 2CQPA 4X44A 3UK0A 3BIOA 2OD6A 4G0QA 4FBTA 2ZJ5A 4UW2A 3SBXA 3VYSB 2F64A 2IVFA 2GEUA 5JZ9A 4QPJC 3UH1A 3LJKA 3RVOA 1ZJ4A 3P52A 5HMXA 1UWKA 5G0VA 3C3JA 5C5DA 5BR8F 5FJJA 2X40A 5K6RA 2ECQA 4PO3X 3L8FA 3W5HA 3HDYA 4EI9A 3ESCA 3CLTD 2Q3LA 4RSHA 1QORA 1GHTA 1GZ3A 1H0HA 4YV2A 2IC5A 4BO8A 3QKIA 3SDSA 5MLCV 4B34A 1EHYA 2G1PA 2W24A 2OJ3A 4FF2A 3WSWA 4YQWA 4LMZA 2XI2A 1NVUQ 1TCVA 1GN8A 3HXKA 1SJ1A 1MV8A 1XHEA 3DL2A 1QKJA 4ZT4A 2VI5A 3L0SA 5K9ZA 4LIWA 1QGZA 4S35A 3G8BA 4TMTA 2V4JB 4FPXA 3HRIA 1TKBA 1OWNA 4JC4A 3PC2A 1FFHA 5BSHA 3IBFA 4HGQA 3M9WA 4J1TC 4R9SA 3ZN2A 3N2KB 5K8LA 4IDKB 4LV5B 2ISCA 3L7NA 3SF8B 2BTQB 3WHIA 4C08A 2CVOA 4RAOA 5HKLA 5DWDA 1M5UA 2E4VA 3IAAA 3AIMA 3R1IA 5CPFA 1KDNA 2Q6BA 3JQQA 3K0AB 2HO5A 3CC4S 4JYAJ 3I28A 4BXOB 3FJ2A 2OAGA 1G5FA 2O2GA 4EO6A 1JHVA 1V6CA 2CYCA 2EFCB 4M98A 1C8VB 5BW5A 5FWXB 2P5SA 3B52X 2YYAA 1XVTA 1XBTA 5D84A 2V59A 2YWXA 1IXYA 3M8ZA 1USKA 1W581 1FX4A 2E3JA 2JJMA 4Q48A 2ZJOA 1RM0A 2A10A 4D74A 2B5OA 1QAQA 1DX6A 3I5BA 4P80A 3HYRA 2D3TA 4UY8T 1ISSA 5ARBA 1KYTA 4M3NA 1PS0A 2DPLA 5EQTA 3JTNA 4BQIA 2KZMA 2RHLA 4EW3A 4DCTA 1GK8A 4PZZA 4FKMA 5MN6A 1XALA 4M9UA 4QIVA 3AEUA 4B9SA 4FYKA 1DTTA 2ZQ5A 4N7BA 2K2WA 4BWGA 4DABA 4BU0A 2JIMA 2HPVA 3KJHA 1BO6A 2ZAMA 2E7ZA 5TT0A 2P4EA 3MMCA 2CFXA 1O54A 2WTNA 3U4DA 1MGPA 3Q8SB 3K58A 4HLQB 3CULA 4N18A 1QSGA 4Q7JB 1S0UA 2Q3FA 5KFRA 3QU9A 3HM2A 4X65F 3CE6A 1MAAA 1NHWA 3T3OA 3T4EA 3UJPA 3V2UC 1N6IA 2AGQA 1PDOA 2HPZA 3P5BA 3F90A 2ZKUA 3JVUA 4J91A 5IM4A 1FWLA 3FHCB 2DH6A 1KMMA 5GV7A 2AWZA 4WTOB 1A9TA 3V7NA 1UFLA 1XHLA 3PFFA 3V2UA 1ZHFA 4BMSA 3D6MA 4Q3AA 3WLFA 3FEZA 2F90A 3DLKA 4I66A 3WLMA 4DLAA 1F5AA 2IC3B 3QXXA 2IIBA 2GEKA 4K4SA 3AJRA 1OJ4A 2WHEA 3F46A 4L85A 4ZOAA 4HAYA 2FWNA 1PAUB 1V1RB 2B4UA 1QANA 3IURA 4IIJA 5AK0A 3VH1A 3IM9A 2Q5IA 2QRJA 4P3KA 1Z74A 4Q1VA 2X8BA 1J0CA 1S3IA 3BZQA 3MRVA 3FSXA 2GM9A 2VF4X 5KC8A 1OZGA 3R75A 5JISA 2YYZA 5HOQA 4BMVA 3IB3A 1RI5A 2BDPA 1BN6A 4HQRA 1C1XB 1Z6TA 3IPCA 3O3MB 3V46A 5ADZA 4PZEA 3KJFA 3HBMA 1Y3KA 2RUSA 2AKAB 1FT8A 1B8UA 3CW8X 3FYDA 3MAQA 4NG5A 3LWNA 3AG6A 3TZHA 5CVTA 3K1AA 1F38A 2IOYA 3TJZA 2DSNA 4QE3A 3A6PC 1NVAA 3OMLA 3WVNA 3OXGA 1HD1A 4UQPA 5F64A 3HV0A 2ZRKA 2F9JA 2NO1A 2AVNA 1ZRHA 1MMLA 1Z8DA 1J22A 4DCJA 3L0ZA 5KYYA 2HHTA 3CH4B 1TQ2A 4QR2A 4WKRA 3BH0A 2O1PA 1N1MA 5FTNA 4D6XA 1G9TA 2AW3A 4BFSA 4DV6B 4P98A 2R25B 3WOVA 1J00A 3C3CA 2JD0A 1W5SA 4AXIA 2CV0A 1YR8A 3VOAA 5FFNA 1R3NA 3CCCA 3I55S 2ICAA 1F2VA 2HHUA 2RKOA 4G4SP 1DOAA 2HKIA 1PZMA 1NXQA 2YKMB 3DDNA 1RTJA 4Q1CA 5CJJA 2P3QA 4MO9A 2QN8A 4P3OA 4P10A 4YAKA 3FM9A 2IITA 1ZWKA 1M76A 1VG8A 3B7WA 5JHHB 4K9KA 2ZBFA 4EKGA 1DY3A 2GYYA 2Q2NA 1G8PA 1J09A 3LQYA 4H0NA 4N4AA 4J7XA 5A71A 5AK3A 1GFIA 4IIDA 2C2HA 2XF2A 4DX6A 4TY8A 2Q6OA 2CVZA 1RM3A 3ZCTA 5CEFA 1BWSA 3K1TA 5KWSA 1T5LA 2RGUA 1E7WA 2J3LA 4KE5A 1VLLA 3H2YA 3DF9A 1P2SA 1ODJA 3HRHA 3S4YA 5ECYA 4XSVA 2LVBA 1SHLA 4RU9A 3FGOA 1UVKA 4CG1A 1T2DA 1L7VC 2I2WA 5H1YA 3KK2B 5KNBD 2OGUA 5EP4A 5IUKC 1V5EA 4BLTA 4FYDA 2REQA 3CLRD 2UXBF 1IUJA 3JCZA 4D42A 1X7WB 4ANFA 2OCLA 2CPZA 1D4AA 2GUWA 5F78A 2YNMA 1ZZEA 1YNSA 2NTNA 4CLRA 2CVEA 2Q3EA 1WW2A 1N77A 3V4OA 2M32A 4G0OA 1NK4A 1WETA 2HF8A 3T6JA 4O6VA 1ECFA 1XZAA 2O1SA 3UANA 3GOQA 1C9YA 1NB2A 2QVGA 1G3QA 1Y7LA 5B3JA 1BHNA 3EUWA 2GAGC 4MIEA 1JAHA 2VHTA 3H5XA 1IY0A 5AJWA 1YR3A 3PG9A 1NWCA 4ATNA 2W98A 4JI2F 3M8QA 3DC2A 4YJ3F 1S0NA 3KNAA 4R2JA 1L3CA 3M4NA 4LSMA 3W6ZA 3PEFA 3CTMA 3V7FA 4M0MA 4B4WA 2R4QA 8ATCA 4RL4A 3WIEA 3FZGA 4TTRA 4TVOA 2QYOA 4KLCA 3IIJA 4JDUA 1QNFA 2Q7XA 4L75A 3I1JA 4I1YA 2FPLA 3W63A 3TLEA 4NX9A 3SLRA 4QJ4A 3OA0A 4K9NA 4L2IA 4JI8F 1MOPA 3NDIA 2QVLA 2ORED 3RBAA 1XMOF 2OBMA 4HEA1 4O3NA 4OZ0A 2WHQA 4NWIA 3IQXA 5CVCA 1AK9A 1NJFA 4EHIA 3PFHA 5HDBB 4NENB 3HFJA 2IRWA 2AV5A 4YRIA 2FN3A 2PUWA 2R86A 2OV8A 3U3OA 2Y1JA 1DTQB 4RKFA 4O5OA 3LVQE 1HI8A 1R43A 3W8NA 4PYDA 3EFEA 1QAJA 4YRDA 2XLIA 1OX4A 1RWKB 4NS1A 1FK9A 5M04A 1AE1A 1RDRA 2WBLC 4ND6A 4FR0A 2E5WA 4OPMA 1P91A 4CM9D 1G8KA 2JZNA 4JX8A 4AMZA 3FRIA 4M86A 1Q3TA 4KQHA 1XNQJ 1CJTA 5JR3A 3RLIA 2GQ2A 1CLEA 1U8UA 1U0FA 2C82A 3W66A 4CMHA 5FPPA 2HDOA 4L4RA 4IICA 4DCOA 1KK0A 2YWRA 4LFAF 1D6SA 3HH8A 4US1R 1ZA1A 2PEZA 1SIWB 1SB8A 1B43A 1XDDA 2FSUA 1N78A 1F8GA 3RRJA 3DM2A 3SYTA 1AZLA 1O94D 3OZEA 3TQHA 2NSYA 2CPFA 4HDNA 1LJ8A 3HN2A 1QIHA 5CB4B 1B6TA 3BGOP 3KELA 4YAOA 4M1TA 1I13A 5DYIA 2KI5A 5AXBA 2A2CA 4URHA 4DLZA 4CQMB 1SJ4P 1K68A 2C95A 2CVPA 1TZBA 2LPMA 5REQA 4PG6A 5I42B 2WU1A 2NSDA 4U39A 3ZS8A 1XCLA 3GEBA 5KIAA 3NEKA 1NSFA 3NPMA 2HQIA 4MKZA 4BVFA 2XD4A 4OAOA 3MHTA 2OD9A 3ETDA 4K2JA 4MEBA 4H4OB 3ZCVA 3A1DA 1E2FA 2V74B 3DBLA 2VUGA 3KG2A 5IAGA 4DR3B 1YRHA 4RCVA 5GZ6A 2XYHB 4X9XA 1RKUA 5BURA 5LYJA 1I36A 3DO5A 3WV5A 1K0FA 1QUVA 5MGBA 2FGOA 5EMLA 2GO9A 4B6OA 4GKKJ 1UIRA 4F21A 5KT5A 3MB5A 4F5DA 2RGRA 3C24A 4LNAA 4CL8A 2W2KA 1E79D 2AQIA 3DLEA 2X7JA 1N5JA 1WMDA 1VIAA 4RLFA 1DIAA 2OQRA 4IRMA 4ZCIA 3M5WA 2QF7A 4Z7JA 1GMUA 2SBTA 2GCOA 5L6LB 1U0HA 2MYNA 1FP7A 3I09A 2W6JA 4U7GA 4KRGA 4PG8A 4KAIA 2Y0CA 5F3WB 1E2GA 2CFCA 3L79A 2Q0SA 4CRWB 4R1OA 4FUQA 2XODA 5K8OA 1ISPA 4ICLB 5IKEA 2WSCC 1GNLA 1DPGA 1S59A 4DS4A 1LS6A 1S1XA 1WSRA 1ZA1B 2MYFA 4D98A 1R0BG 5I7UA 1WZUA 3HSZA 3LRTA 4ZPVR 2ZYDA 3PQEA 1QIKA 3B20A 4NULA 4RO0A 1NT2A 4PLYA 1Z39A 5DIFA 1ML3A 3H0KA 4JMLA 3AAWB 4WBNB 4B6GA 1DAOA 3W5XA 4CNYA 2M8HA 1JKXA 3IHKA 2GYVA 1OX4B 4ZAWA 2GPNA 4UE6A 4ZVLA 2F65A 5B1DA 1KY5A 3HFRA 1YDFA 3PPXA 4Z8XA 4I2NA 1QGAA 2GO1A 1FJEB 3U7GA 1MB2A 1F3FA 1NBME 4IRUB 4NU6A 1E9VA 4XQCA 5KSOA 2QN1A 5EKDA 4M0EA 3FTFA 5C18A 2D54A 1CJVB 3TZLA 5IWAJ 3G3EA 1Y8ZA 1GWNA 2QUKA 3GW8A 4R71A 3CN9A 2YWBA 4D9CA 4K4XA 5LOVA 4S1PA 4YP5A 1E7YA 1VQOS 1RWQA 5EXTA 3QWFA 1VGVA 4ABTA 4RVHA 3VDMA 1QVRA 1SHJA 5FD1A 3BSYA 4PAQA 4XOUA 2JIRA 2HNYA 2I7VA 1ESZA 4YFVA 2R7RA 3FK4A 5ARDA 4E6EA 1ZTTA 2C7PA 1AVTA 2FQYA 1RYZA 3QVKA 4JI5F 4L1KA 4MHSA 3KUGA 5BR4A 1A88A 1QJCA 1VI2A 5D3GB 2E1RA 3QM1A 1DAIA 3G2PA 2CXQA 1CUCA 4CIVA 3KTAB 3L1KA 5IQQA 1Q1AA 3GI1A 1U5BA 3KSUA 4AZ3B 3O95A 1VMDA 1KDYA 2EEPA 4INAA 1UKZA 4OIFA 1RFGE 2GETA 4FINA 4CO5A 2H1VA 1FRXA 4P7FA 5CMLA 1U8EA 5KTPA 2XXAB 1NRWA 3V1KA 1TP7A 3UA3A 2FW0A 2WVAA 3DAFA 1WTBA 2LEPA 2BYCA 1ZGCA 4XJSA 2EBHX 1GKYA 5CYMB 4DA6A 2HLNA 1EZ1A 3GJXC 4AW9A 2GAHC 1Z6XA 4PGGA 4LF7J 4LQDA 1M7GA 2Q4OA 4JLSA 1HNIB 2G28A 2JCGA 1NAHA 3BWCA 5DGAA 3RT9A 3O4GA 1R0KA 3SXPA 4BVBA 4GL2A 3GTYX 3KSZO 2EYQA 1REGX 3CX3A 3KLPX 3CMCO 5AM4A 3OT4A 3MECA 3UXMA 2PTHA 1KAQA 1Z6ZA 3E9QA 4IJQA 2DHHA 2P5YA 2CUNA 3RYCA 4MMXB 4OP2A 4LF4F 4X85A 1VIMA 2QB5A 2YW9A 1FFSB 1E3EA 4DRXA 4TV9A 3DAGA 2I91A 1HNVB 1F0KA 3I34X 2HZAA 4DIBA 2O8EA 3VR2A 3NIGB 3UDEA 1UJNA 2Q07A 2VHZA 2PGCA 2OE2A 3WIBA 2YH1A 3G9UA 5JADA 5LMUJ 1JGTA 1QHFA 1LW6E 3BHIA 3SZRA 5LMCA 5LBIA 1Z45A 1ZP6A 4DJ5X 2GFQA 2MR6A 3DZIA 3FPJA 1T6YA 2PVPA 4BFTA 3FSGD 1LS1A 3OIDA 5CA5A 3TOVA 3R7DA 1WVGA 3QIPB 4NV1A 1TC1A 4RIFA 1RXUA 1D2NA 3KFVA 4FYWA 3LLCA 3SYLA 3LPLA 3NVKI 2H31A 1PJBA 3BBFA 2O7VA 4Z4IA 4KOEC 5TF4A 4FUTA 2ZYAA 1POWA 2YRXA 1DIRA 2I2AA 1PNRA 2CJBA 1RAEB 1FK8A 3A9TA 2ZBEA 2C9BA 3GLGB 2OTLS 1HL7A 4JVMA 3I0SB 2BM9A 4OJQA 2RARA 4YMUA 3ANSA 1YBHA 1EJ2A 3G7UA 1BZYA 4R2LA 4D8UA 1XAHA 3T5TA 3EOAI 3PDIB 5ALSA 1QK4A 4KL8S 3VDXA 1Z6GA 1TUVA 2Q62A 5IABA 2WOOA 3L3CA 1AKRA 1VA4A 1S10A 3V00A 3U4QA 1H8ED 1AB5A 1ZBDA 1O6ZA 1QS0B 2YPZA 5EJ9A 3MELA 3N2IA 4H7HA 4DEVA 3ZE0B 3B54A 1YB6A 1CR6A 5CFPA 1SJ9A 3BL8A 3LFUA 5IC6A 1RHJA 1PDVA 5NULA 4H4DA 4A26A 1PVDA 1FFAA 1DC6A 2BMWA 3QPCA 5D15A 1E2BA 4QDOA 4DNQA 4O25A 3ACBA 2HZVA 1T8EA 3OLCX 3GEGA 3N8HA 1UK9A 2HHHJ 4B83A 3RUBL 4IIJB 3CW2C 2FYXA 3DV0B 3HMJG 1X4GA 3SZ2A 4Q00A 3IM8A 1WOYA 3WFJA 4ER7A 3N3BC 2UDPA 3D6JA 1DMRA 3KQVA 1X9WA 3FFIA 3DRPA 3LRPA 1IXKA 1OJ7A 1FFYA 5BYBA 3DLKB 2NREA 3TW0A 2MYUA 1OILA 2VJVA 3CNLA 4MQ5A 4JR2A 3PEEA 3IGVA 2FSHA 5F98A 4YUDA 4MVCA 3SBEA 4YCAA 3GLJA 1EWQA 2ZJ7A 2JD1A 5ERGB 3LPEA 2Z3WA 5AR1A 3WSTA 4UBKA 1WLYA 3OZTA 1N5LA 4REQB 3A9RA 3DSRA 2HQCA 4JUZA 4INJA 4G4SO 2FG5A 3G6KA