3WIUA

Crystal structure of pro-s324a/l349a
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKIAPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tk-subtilisin
publication title Requirement of the insertion sequence for activation of Tk-subtilisin
rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 130
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3wiuA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3wiuA02
3A3PB 1OYVA 2W2QA 1BE6A 1DBIA 3QFHA 3BPSP 3AFGA 1BE8A 2GKOA 4Z2AA 1SVNA 2P4EA 4BWGA 1T1IA 1BJRE 3L1KA 5AMXA 1SCDA 3I30X 1WVMA 1SIOA 3H42B 5JXIA 3DW1X 1AU9A 1P7VA 5FFNA 1EGQA 3GCWP 2Z30A 4K8RB 4C3UA 4JP8A 1TM5E 2Z56A 2W2NA 5ARBA 3A3OA 1SBCA 3QMPA 4J94A 3SQOA 4H6VA 1Y9ZA 2QTWB 4OMCA 2PMWB 1KE1A 4KB5A 1AF4A 1SCBA 4AKTA 2Z58A 2TECE 3DE1X 5JMOA 4H6WA 1XF1A 2WWTA 3A3PA 1WSDA 3Q40A 3ZXYA 1P7WA 1DUIA 2WV7A 4CG0A 3QTLA 1SUCA 1GT91 4I0WB 4H6XA 3GCXP 2PWAA 1SN7A 2DP4E 4FONA 3D9QX 3H42A 3VHQA 3A3OB 1SPBP 1ZVJA 1Y3CE 3DW3X 4NE7A 1TM4E 5JXGA 1SUBA 1TMGE 3VV2B 1GA6A 1TM3E 1R64A 1MEEA 3WQBA 3BGOS 2QTWA 1NLUA 2PMWA 1Y4AE 1SCNE 4KPGA 1VSBA 1NDUA 1Y3DE 2ST1A 1TECE 4HVLA 4ZARA 1Y3BE 4CFYA 1TO2E 2W2PA 1IAVA 2E1PA 1GA4A 3A3NB 2PQ2A 1AQNA 1KDVA 1CSEE 3CO0S 2PYZA 2IXTA 1Y4DE 4ZOQI 1BH6A 1YJAA 3VYVA 1GTG1 1Y1KE 5ARCA 1GNVA 1SBHA 3DE5X 1SBNE 1C9JA 3D43A 1Q5PA 4LVNA 4NE9A 1R6VA 2XTJP 5FAXA 1KE2A 1AK9A 3EIFA 3DE7X 3GT4A 2W2OA 4B5LA 1OT5A 1S01A 1TK2A 4NMXB 3VV2A 1R0RE 3CNQP 3F49S 2V8BA 5JXHA 3BPSA 2W2MP 2SBTA 1HT3A 3P5BP 2PKCA 1SCAA 1PTKA 3A3NA 3TI7A 1PJ8A 3TECE 2HPZA 1SBTA 1SIBE 3GCWA 3DVSX 2B6NA 3DE2X 3LPAA 2Z2XA 2SNIE 1THMA 1BFUA 1PFGA 5AQEA 4MZDA 2ID4A 2IY9A 2W2QP 3LXUX 1YJBA 4NE9C 5B1EA 1EA7A 4RYDA 1OYOA 2Z57B 5B1DA 1GTJ1 3VSBA 3I37X 4DZTA 3F7OA 3DYBA 5CW1A 3DE0X 1Y48E 4NMXA 2WUVA 5AVKA 1TO1E 1SELA 2ZWPA 1S02A 3AJ9A 1SBIA 5K7SA 1GCIA 1WMFA 4M1ZA 2W2NP 3WHIA 2G4VA 3ZXXA 1CNMA 1S2NA 3DE4X 3EDYA 1YU6A 1T1EA 1GNSA 1ST3A 1T1GA 1C3LA 1SPBS 3T41A 3DVQX 3GCXA 4HX2A 4YN3B 1UBNA 1ST2A 5JXJA 2DQKA 3LPCA 1AV7A 4OV6B 4CFZA 1WMEA 3TI9A 1Y3FE 3HJRA 3F7MA 4DJ5X 3I34X 5SICE 4C3VA 1AVTA 2ZRQA 1GA1A 2Z57A 1Y33E 1V5IB 2Z2YB 1SUAA 1LW6E 3WIUA 2HD4A 1JEAA 5FBZA 4OMDA 4WOBA 1SCJB 2WUWE 3I2YX 2SECE 2X8JB 3LPDA 5I9SA 1BFKA 3EE6A 3DVRX 3Q5GA 1PEKE 3GT3A 2XTJA 4YN3A 1V6CA 2SICE 1C9NA 3BGOP 4OV6A 1TM7E 1AH2A 2W2PP 3PTLA 4GI3A 3CNQS 1WMDA 1TM1E 5AVJA 4LVOA 1NDQA 3PRKE 1IC6A 1SUPA 1SUEA 2Z30B 2ZWOA 5ARDA 2Z56B 1GTL1 1YJCA 1V5IA 2Z2YA 3CO0P 4K8RA 1SIUA 3SICE 4AKSA 3UNXA 4KG7A 1SUDA 2W2MA 1A2QA 3BX1A 3P5BA 3DE6X 2PWBA 4DWWA 1Y34E 3OSZA 2W2OP 3SQOP 1MPTA 1SCJA 2Z2ZA 2ID8A 2XRMA 2PRKA 3VTAA 1ITPA 2Z58B 3DWEX 3VV3A 3DE3X 2X8JA 4WOCA 3AJ8A 2DUJA 1P8JA 1SH7A 3DDZX 1C9MA 1KDYA 1ZVKA 3WIVA 1KDZA
chains in the Genus database with same CATH superfamily
3AR5A 1CZLA 3N28A 3CWCA 1T9AA 5M5BA 1CU1A 1CUZA 4UAGA 1QGDA 121PA 3G17A 3VKWA 4RV4A 1AN0A 1J2RA 4K6MA 2BW2A 3SYLA 1XKLA 1HLFA 3TSZA 2Z9CA 3A37A 3BGSA 4QQNA 3HKBB 3ZTPA 621PA 1QQ5A 3O3CA 4PRFA 2K7ZA 1Y9ZA 3PQ8A 5FTNA 3WQQA 4NBRA 3DWFA 1OT3A 3VR3D 3E9EA 1C1BB 1DARA 1QMGA 2FMHA 5FOVA 3OM1A 1RXVA 4IYQA 3BS9A 2WAAA 1JQKA 3L0OA 4UTRA 2FE1A 4JEHA 3T3OA 4IIBA 4RV5A 4IKOA 2EARA 4DLPA 2HA2A 2NVUB 2XBMA 2VPXA 2LDIA 4LJ9A 1WXWA 2X3DA 3R09A 2OILA 2MGZB 4N5MA 5K20B 1R0LA 5EZQA 4YP7A 2IX9A 3FUCA 4JXJA 4ZD6A 4LQDA 3TZYA 2C83A 1ENYA 3KQQA 4FF4A 2ZRAA 3CT9A 1TM4E 4Z4QA 3I05A 1NUAA 4LDPA 4CQMA 1GH8A 1HX7A 2EKZA 1NUPA 3CLSD 2D54A 3BH7A 3LBYA 2ILVA 1QRUA 1UDWA 1Y5IA 5LYJA 4BPBA 3PY8A 2C00A 4CV1A 4IQGA 3TM4A 1GZDA 3HKEA 4GEKA 1V5WA 5IMBA 2LMIA 3ZX4A 3I5MA 5CLGA 3LNTA 4BUJA 2VQFF 1AQNA 1ZP6A 4ZOAA 5H16A 2FGJA 1NZ8A 3PSAA 5T6BA 4X7PA 1XMXA 2F1IA 2PE8A 1YQXA 3BXHA 2W9BB 3H19A 4G8DA 2PN1A 2QYCA 2G17A 5KFQA 3H3JA 2WAOA 4OX8A 3EIFA 4L0MA 2Q1WA 1DFDA 1JLHA 2H2FA 1F0PA 3M7VA 4NDNE 1EXWA 1D2NA 4LVCA 3K0JA 5JNWA 2AGPA 2GVDC 4PC3A 1R0RE 4X85A 3AJ1A 4EENA 1U7ZA 4F5EA 3D3QA 1XROA 5JS7A 5HLFA 2WM2A 2IX3A 1JR4A 1CV2A 2NTVA 1JA1A 4J1NA 3P0RA 1KLMB 4KR0B 4FYWB 4UQOA 4OO3A 4ZYTA 1E2JA 1S9FA 4RFSA 5HCUA 2EZUA 2WIJA 2LNDA 3QLUA 1F6TA 2A2DA 3GG2A 3L0CA 1HZZC 3GXOA 2YINC 3T9EA 2VI5A 3DWGA 3EGCA 3GH1A 3J80Y 3QFCA 1YDLA 1W36D 2P3QA 2HNZA 4B76A 1D07A 3PUWA 1IXRC 3VSBA 4IL5A 3P0HA 2LE0A 5ISMA 4U0JA 2XDWA 1B1CA 1RPJA 2OEMA 4C06A 2OEKA 2CV1A 4TLEA 1SBIA 4G0VA 1N2CA 3T5HA 4QTXA 1WPXA 1GZVA 4PPDA 4LTMA 4YUYA 3KUGA 3UI3A 3C15B 5CD4H 2OY0A 3GLGB 3AUKA 1FFGB 2GD6A 3GZ4A 4DR3B 2XNSA 3MJRA 2OWDA 2SKEA 3EXIB 3FEYB 4DV5J 3KPYA 3I9FA 4CR8A 3C8DA 2GPJA 4UM9D 3UJCA 1U0FA 1TFYA 5HP4A 3M2RB 3K72B 4DL9A 5LJLA 7ABPA 3D66A 1ENZA 3CO9A 3ZLJA 3QATA 4H7KA 1U6BA 1K66A 2VJKA 1MHPA 5AW3A 2WSYB 1JXQA 2AL7A 4YP3A 5IT9U 2CHEA 5KPDA 3P20A 4C4TA 2YBVA 2BOVA 4DFMA 5MDHA 3OAAA 1H5NA 3M32A 4FEGA 4YV1A 1OFTA 4BHTA 4IIJA 1YUBA 5BSUA 3I2IA 2CBXA 2IEAA 1U49A 1VC0A 4EO7A 1UEXC 1G5HA 3NQ41 3Q7RA 3BGWA 4G1BA 2HHHF 1NR1A 1M5HA 1BS2A 4E33A 1IY1A 3W5ZA 3TQEA 1DIBA 1PTJC 3NOVA 4RJKA 4IY1A 4MWOA 1TKTA 1YUNA 5IBCA 1KFEB 1EHWA 5AP9A 4WK1A 4TLDA 2JVIA 2RHWA 1JLLB 1ZHHA 5ALJA 5C1BA 5TMEA 2Y1WA 2J6IA 2D4HA 4BMOB 2IY5B 1VJWA 1Y8CA 5JISA 1MSWD 1G3UA 4FR2A 1UP7A 4OL0A 3T4UA 3TZEA 4C0WA 2J6BA 4DCJA 2BELA 5JZSA 1S5PA 4B32A 4TMVA 3AJ8A 4H1UA 2D5IA 1PR0A 1ULAA 3BMOB 4B73A 5K3BA 4NI2A 4D0NA 1C3EA 2YQ4A 2W2QA 5HW0A 2FK8A 4U7CA 4TT3A 1IY2A 5EUHA 1B6TA 1VRQC 2PT5A 1J2EA 1YL6A 1U1EA 1X74A 3NHFA 3RKUA 5DWDA 4B45A 4WPGA 1KPGA 3AERA 4ZP1A 1RMYA 5J2TF 4X4QA 1ULBA 1ZD5A 4RIGA 1WVMA 5EWLB 4BO6A 3ANMA 3MWJA 4LNHA 4MW0A 4Q3NA 2GMWA 1N1GA 3UHFA 1SQ5A 3T5LA 2HZAA 1BQ4A 1QCCA 1ELOA 5GJBA 5KFHA 4E2WA 1UWKA 3C1UA 4OYYA 1QE3A 1VSVA 3CPSA 5LB4A 1DEKA 4PGHA 2O5CA 1E3TA 5HUQA 1WDLA 3WOHA 1KP3A 2IY8A 2JD0A 2VA2A 1Y6GA 2LEPA 2CBGA 2G9NA 3VZCA 9ATCB 4HKQA 4NBSA 1I4EB 2NADA 1K9SA 2JASA 2J48A 3L8FA 4NS4A 1FDUA 2X0IA 1E79D 3R3TA 1Z2ZA 3W5YA 3DTVA 1Q8LA 2F55A 3CD6S 1UR5A 1UXIA 4WEQA 3RJTA 1IZ0A 3R0JA 1YACA 1R8XA 3BSWA 4XGRA 4JI5B 3WYNA 1D8TA 4I4TA 3DUWA 2KM8B 3F5MA 4Z4HA 2G25A 2IV3A 4S12A 1SKAA 3RFVA 2PGIA 1E0DA 1HQDA 2IBTA 1GA6A 2XXJA 4I1IA 4PQUB 4HI2A 3RZAA 2KPOA 4DQUA 1WW8A 2PGLA 5LZ5A 3RVLA 3PFHA 4QPXA 2QTGA 4OAPA 3LK7A 4HNSA 3HJUA 2PNFA 4OYXA 2IHKA 4E30A 4ED3A 1ZVVA 5EESA 2GK4A 2OEPA 4IRDA 4H1VA 1FSSA 4LYYA 3PTAA 2DH6A 4ZAZA 3ZE8A 3DDIA 3CLRD 1CKEA 4RANA 3BJYA 1TRKA 2I1LA 3T7CA 5KQRA 2QRPA 5BMVF 1IBLB 3R5AA 3KU4A 3KJXA 4KPFC 1IVYA 1QG6A 3VR1A 3FHJA 3FWYA 3CXUA 3WXBA 3V34A 5ALXA 3VTKA 5I7SA 2NYHA 1H85A 2G04A 3AESA 1HG0A 4NC9A 3L7CA 2DPHA 3MZIA 4PQEA 4OLPA 3V4IB 5L38A 2ADOA 4IDOA 3GH3A 2KLHA 2ZBEA 4P72A 5J5CA 1RR6A 2PEBA 1A6LA 1IXZA 3WO0A 2LU2A 5DKFA 4NNJA 5DI3B 1T4CA 3UT5A 4RCYA 3SYZA 1AURA 2OAUA 4HWOA 1DG3A 3FVWA 2AFIA 3DDHA 3RRYA 2DNKA 5EE0A 4DW8A 4ZMMA 1ZNYA 2HOQA 4R01A 4CLOA 1CBKA 3CCJS 4IEEA 4USMA 2WABA 4OJYA 5AKYA 1UBTS 4I36A 4BEJA 3IE2A 4NLGA 1CUDA 1HR0J 2J5RA 3SC6A 3RAEC 2NMVA 2D4AA 3CJSA 2YY3A 3AF1A 2OZVA 5DHAA 2PT0A 4GLOA 1J90A 1S02A 3AJ9A 4QWAA 2C3PA 1YR7A 4YHBA 4DHVA 5G2OA 1AQJA 1Q1ZA 4FXVA 2ZJFA 3KDSE 4XSVA 3C3XA 3RIHA 1CY8A 3DNMA 3QKUA 4TQGA 3B1YA 5FL3A 4FPRA 3ZHTA 3GWZA 2FCRA 1L3KA 3IV9A 1YRBA 3FDZB 5GMEA 5CIWA 4LPKA 2DQKA 5TQ2A 1HWYA 3TN7A 4LF6B 4JXZA 4JBWA 1YZGA 4NECA 4OJTA 2ERYA 1JLBB 2JJ8A 3NIDB 4PZUA 3KJNB 5JE8A 2ZJRQ 1AHIA 3LHKA 2HNYB 4NFLA 2X9LA 1Y10A 1CQXA 5K3EA 3C70A 4R16A 4DSKA 4HPXB 4FPXA 1S1TB 4AY5A 1UAYA 5LU9A 4R2KA 2O0LA 2ZIXA 4UCWA 2GLUA 3FQKA 3HVTA 3FWPA 5IAJA 1N5LA 5TPWA 3NCTA 2DWQA 4QXQA 1Z75A 3NDPA 4N18A 4RPHA 5KG6A 4QE3A 2YNGA 3T5KA 4AK9A 4CM5A 1IKVB 1NB2A 3C3YA 5A3SA 3QVTA 4BVLA 4LRWA 2PLRA 2G0NA 2C28A 4C7OB 2AXQA 4A8SA 2GD2A 4UEJA 1Z25A 2P9GA 3RYFA 1K1QA 2FMIA 4U2DA 1MFZA 4RZIA 1XK6A 4YJ2F 1ZPWX 1SCUA 4ZJOA 1QF6A 3OPVA 4S3MA 4FBTA 4RJ2A 1M1NB 4EYSA 1M66A 2IA5A 1YDFA 3RIGA 4DDHA 4PXYA 1NRWA 4EWLA 3VAMA 1F2DA 3F7TA 1TC1A 3ZQUA 1Y34E 3KU1A 1Q0HA 2XB2A 5C7LO 1GDDA 1N33B 3ETMA 2VEOA 4DV6B 3DGVA 2VCEA 4MUNA 3ZYCA 1JHZA 4PXBA 3ZVRA 1EFHA 1ULRA 2Z83A 3JYHA 3UTDA 3WYEA 2C5EA 4HWTA 2AEJA 1M0TA 4YUAA 1TL7A 2L82A 1M6VB 3T3DA 5GAHI 3KLHA 1CRLA 3M2PA 2B5JA 4EAAA 4W9NA 4GX5A 1S0OA 1D9DA 4JOUA 2YX1A 4RW8A 5K6AA 3UDEA 3WGNA 3P26A 3QVMA 1NGSA 1Z18A 4KMOA 1BWPA 1EP3B 3EC7A 3LOQA 2H2DA 3SM3A 3GONA 5IM4F 5KTPA 2Q1LA 1J97A 4LSZA 4MZXA 4E09A 4LF4B 3ENNA 3BCRA 4FD3A 2N1MA 3WBJA 3PIDA 2EGUA 2W93A 4MWCA 1OX5A 3IT3A 3UK6A 4LSMA 4C0JA 3NDBB 3LGHA 5EIXA 3RG8A 2CQ4A 4RETA 1M2FA 1K1EA 1JDVA 3N7AA 4LC0A 2XVMA 4G6ZA 3G3EA 1HM5A 1Y3CE 5I3CA 3JSBA 5JASA 2WU1A 3MGAA 1N5MA 1XA4A 4DEVA 4YTEA 5EKSA 1RHQA 1SCNE 3MWDA 5H4HA 5DZSA 3SC4A 4LEIA 2G8LA 2ST1A 3L06A 3W8PA 2HFSA 2YVKA 2IYQA 4LRFA 3O7WA 1CJTA 4GPIB 3OJ0A 5GOTA 5DPMA 2PKEA 1T9CA 1PR9A 2DGWA 4J43A 3MWKA 1MOQA 2FPWA 3V9AA 5E0KB 4TYBA 3F9IA 2W11A 1WEKA 3KQUA 1XC7A 2GZRA 1RP1A 5CT4A 3QKSA 4OY3A 1QZ3A 1BCSA 1O7JA 3MCSA 2UVDA 1OAOC 2Q4EA 4P5PA 1W19A 2BUAA 4ASUA 1QHSA 4LDQA 4DUGD 4N47A 4JYMA 1NZFA 3UICA 3GUVA 1XXHE 4JLMA 1JT9A 3LHFA 1QO7A 4ZI2A 1E6YA 2IRYA 1ZCJA 4AYXA 1E3WA 3WHKA 4CU2A 3LPAA 3RFXA 5FORA 1NUSA 4GKAA 1FXRA 2A0FA 2R8KA 2MWMA 2YQ5A 4KU4A 1SB6A 4UEQA 1T9GS 2YHAA 5C1OA 4JHXA 1FWKA 1RT7A 4NENA 4K6OA 1MAAA 2RHHA 3BGIA 4ECUA 3TZCA 3L7MA 3LUGA 1KSJA 4M0FA 4L5YA 2DGVA 1FJGF 4MB2A 4MROA 4H27A 4KJZA 4BVAA 2H85A 1ZXBA 3ZDEA 3MJTA 2O7QA 3F78A 4QJ5A 5JEDA 2NPIA 4KXXA 2UZIR 3IO1A 2P0EA 5FH9A 4Y2JA 4QNNA 4IKEA 1SXQA 1UPFA 2XLJA 1N2HA 3GCXA 1TL1A 2QZSA 1BE1A 4RPLA 1ECGA 3JS5A 1AHPA 4RNHA 4N3AA 1VJ0A 3LQ1A 4ZVHA 3VAZA 3NUGA 2EATA 3R7BB 2RK4A 6ABPA 1TAUA 3SVTA 3SYTA 2VXBA 3VVBA 4O44B 1CDEA 1FU8A 5DCLA 4JYZA 3HSJA 4BVEA 4KN5A 4BQFA 2YZ7A 4NBTA 1RZRA 4EPXA 1GFSA 4Q1FA 5C7PA 3BL5A 5D3KA 3CZ5A 1V3SA 1KVRA 1EG7A 2Z8QA 1GKKA 1MO5A 3WWPA 2F3QA 1IAQA 4A91A 2E48A 1SO8A 5C5IA 1CUJA 2AR9A 4DUZF 1JXLA 1WI6A 1IOLA 2FA9A 3HYNA 4D82A 1U63A 2EHDA 1HNXJ 8ATCA 3ZLVA 3V4RA 5BN5B 4A1FA 2W90A 4C04A 3ZI4A 4W99A 1H2UX 3PS9A 1YKGA 1GGVA 2VBWA 4WY8A 4B3CA 3ROEA 2Z56B 4INZA 3OOWA 2X7JA 2NUPA 1GR1A 5LM3A 4BQEA 3CV3A 1IBCB 3B6KA 4ZFNA 5K3AA 1IR2A 4RVGA 1AA1B 2QN1A 2RIJA 2YWGA 1PT6A 3Q7TA 1C30A 1LSSA 3Q88A 5FO0A 2NSLA 3PB3A 1DPFA 1RAEA 1Z34A 4M9SA 4BRSA 3OF3A 1OH7A 4MKVA 1AQYA 4ZO6A 5T4FA 1MB9A 2HFOA 3F3SA 3UK7A 1DKOA 1NI3A 3WSWA 1SMKA 1V9CA 3CIFA 2EOAA 2VG5A 3RAXA 1JLSA 1NVBA 5FLYA 5KFEA 5TEVA 5B3JC 3FJYA 1G1AA 4UZEA 3ICQB 3QBJA 3DBRB 5LZ9A 2H2GA 2D1FA 2ATLA 1S6PA 4EYOA 3SXPA 3TQTA 4HDHA 3FTFA 2DUNA 5J2QB 1M2VB 3H40A 2R6DA 4L0CA 3PC7A 4KPUA 4F04A 3QKWA 4OA8A 4CQMD 5KNCH 5JDIA 1RVV1 3ETJA 2OBFA 1H4QA 2X0JA 3IYLW 5CH7B 4B3RB 5I5GA 2DTJA 1P75A 1R1DA 3R3XA 1D0SA 4FHGA 2VICA 5DJ5A 5T7LB 4DLXA 1E1YA 3FVYA 4RGYA 3T61A 1VI2A 5CABA 2C99A 4H35A 3BKXA 1N34F 1JA9A 1TT7A 3K1TA 2HFUA 1LBQA 1RTKA 1MC4A 1NWCA 4NZYA 1VIXA 4F26A 2JAHA 3HHLB 2FJPA 3ONFA 3QXHA 4MJKA 3RANA 3UAXA 3QVKA 1FVQA 2CK3A 3AEQB 2KX7A 2PMWA 1JB0C 1BU8A 3LW5C 1PSZA 2GX8A 5M29A 3QVWA 4GXRA 1IB0A 4M5DA 3MRTA 1A7AA 2CEKA 3NYRA 1YQDA 2WFZA 2ZBPA 3T7SA 4QRDA 2PUGA 3TX2A 2PRYA 4FSHA 2XI2A 3K6SB 2NR0A 5I6DA 5MFZA 4OHOA 2VJVA 2ODQA 3TQHA 1E77A 2I76A 1J99A 3O2QB 3DMGA 3A1TA 3UUEA 3JAKB 4H2DA 3HB9A 2V50A 4PNHA 2J8AA 1B43A 2J9DA 1KJ9A 1DUVG 1RWPB 3FW1A 1N6QA 1J23A 2JFFA 5LB2A 3M8YA 1Y0HA 2AXPA 3ESXA 1THTA 1Q16A 1NHVA 1M7GA 2DK2A 1EK1A 5F35A 4C6TA 4PFQA 4J2TA 3BQ0A 4YCDA 1SCAA 2CVFA 2QPOA 1M1ZA 3DOIA 3AK4A 1LV7A 1MJ5A 5LZ2A 4O4IF 3L40A 5K2OA 4D1YA 2AYYA 2ZUGA 1ZD9A 4BDPA 4Y0NA 2UVPB 1X7VA 5E9AA 4P3XA 2Q5HA 4MVJI 1WX1A 3OTGA 3ZZTA 1WUTA 4F6CA 5KFOA 3RODA 6REQA 4MIYA 1YLXA 4IGEA 5BN1A 5GAJA 3T9NA 5CFQA 3HHLC 5LA6F 1NRIA 1FERA 1JALA 5KVVA 1M1YB 5LWHA 4ZVTB 4DBQA 1ZSNA 3H4MA 1KFBB 3TTWA 1QONA 4B6FA 4QOJA 2UUCB 5ALOA 4WYLA 2Q4TA 1T1EA 2VSXA 4MW7A 1UZAA 4TZKA 3G9UA 2X58A 1H3DA 3TS1A 2OORC 1JVSA 1TPYA 1N88A 2IC3B 1GLNA 4DI6A 2Y67A 1XZJA 3U44A 1QAXA 3T1QA 2GTHA 1E3SA 1VIVA 3OTOJ 3GGCA 2BTOA 3QWAA 2GPAA 2CNLA 5IAAA 3H6KA 2XXAB 2NG1A 2CFCA 3TI9A 2UXDF 1JG3A 1MOSA 4UBMA 4W8HA 3R9KA 3ZD7A 1U7XA 1ZINA 2WMOB 2ZHBA 2H08A 1IBRA 1HYQA 1PQ4A 3A8JA 2VDMB 5LNK1 1NM5A 1X1CA 1KI8A 5TQVA 1BQMA 2A94A 3PIRA 4QIVA 1Q7BA 2H92A 1U1OA 3ILOA 1R8PA 1TJYA 5CBPA 5BPFA 4WBSA 1GV0A 1PT9A 4TRNA 1X92A 2BSAA 2YWWA 1EPUA 3K70C 4G1CA 3R0VA 4N0DA 4A6DA 2H1CA 1X4FA 5CA1B 5BMOA 5GVQA 2RDDA 2VPTA 4JLUA 1FYDA 2Y05A 3BBLA 2AXNA 5G40A 3OP1A 3IAAA 1E2HA 2OXEA 4L8YA 2V34A 3LECA 4WXPA 3OXLA 2PMBA 2UVRA 1XNHA 1OLUA 1ULTA 4A2PA 1RHUB 2ZCUA 5G53C 4X84A 2XMGA 4TT3D 1D6MA 3VR3A 2YH0A 3RE1A 2Q8NA 1NULA 3OU7A 3Q7IA 4H1WA 3VJRA 3JSYA 1PJBA 2X86A 3L6EA 2BP7A 1F9EA 1AUXA 4WWSA 1KK2A 4M49A 2C7VA 1S79A 4MVJF 3T3IA 4C11A 2XNKA 4J0IA 4BLSA 3AZQA 4I4NA 1U2RA 4JV5J 2VBCA 2IEBA 5KOYA 2YX7A 4TX1A 1HNIB 2II6A 2FSIA 4Q7QA 1DFIA 1CB0A 2H7VA 5EUCA 2YJZA 5C8YA 3U3OA 4X4UA 3I0RB 4CEJB 3T3GA 4M7PA 4EPVA 2ZIZA 2HJ9A 5FPKA 3BXEA 3MCNA 1P7VA 5FHQA 3L0ZA 4N9WA 4NYZA 4CMAA 4IXNA 1H69A 2H9AA 2WKPA 2W9AA 2ZOGA 5ARBA 1FPQA 4XQGA 1HI0P 3KZCA 2WICA 5EX0A 2CJYB 4YR9A 3QPCA 2X7HA 3OFEA 3NC0C 1GPMA 4D3DA 1KEEA 1NKBA 4LTDA 3QVGB 3IUJA 2DFPA 4NLDA 4HV4A 5JFTA 4LV5B 2H0AA 4B3MJ 4C0XA 3AGQA 2BTQB 3AF0A 1WSDA 2ZUDA 2JVJA 3PXUA 3VGJA 2AFHE 2AW0A 1JHPA 1EDOA 4CIAA 2CL0X 3MJSA 3K8QA 3BGLA 3UCEA 1QHHB 4YQYA 5AYVA 1WXQA 1ZZEA 4K9SA 4ND5A 3KK3A 1FJEB 3GGDA 1FA9A 1GRQA 2HMIB 3C5HA 5KTRA 4LR9A 1UM8A 1S8AA 4LAFA 1GX6A 2WKWA 3LALA 1YZFA 1K8QA 3SWWA 4ZDIA 4YP9A 1NNUA 4F9GA 2G1AA 3SEAA 3K17A 2RGXA 1ZIPA 3AR7A 3ZCQA 5LMNB 2MYFA 1SVUA 3RS4A 1CS0A 2PFGA 4LUCA 4C2AA 3I53A 2PGOA 3H5AA 5K09A 5M2RA 1YJAA 2HGSA 4X9XA 5JIBA 1S9GB 1C4XA 1NT2A 2EDAA 1E20A 1P73A 1BN7A 4DLZA 4F8EA 1R50A 2HB6A 1O96B 4EBCA 4Y2GA 1J1ZA 7MDHA 3DZBA 1E2BA 3DULA 2M9KA 5B12A 3AF5A 4MAFA 3QEMB 5CCXA 1QVAA 3D8BA 3FYTA 3ANYB 5KT3A 2WJJA 3WYFA 4KE9A 1M5OC 3FLAA 1VC2A 3ISNC 1TJ4A 4JLSA 1IN1A 3H5XA 3BPSA 1V2HE 2DUWA 4PPYA 2YXNA 2I4LA 4PLTA 5H9FJ 1N3BA 1UPBA 4F7WA 2JDJA 1PW7A 2QUIA 2FQQB 1VYAA 1RT3B 5AJ3J 1WELA 1YXMA 3UG7A 4FE7A 1HNWB 2H4ZA 4YRMA 4PZYA 2XWQA 4DCMA 1WTCA 1NSPA 4JASB 4B4OA 5F7JA 3F67A 3IAFA 4CLEA 4BP3A 5E3JA 1RT9A 3WGGA 5AJVB 5E6UB 2V59A 2YVUA 1GYRA 2AT1B 1M6WA 3RS0A 1PQWA 1W93A 3RVMA 3PPXA 4LREA 2DULA 1WV0A 2RNEA 1S7HA 5JSFA 4F4DA 1WQ3A 1RI3A 5EQJB 2Q6BA 1SPBS 1EZ1A 2VHWA 4HS9A 3DVLA 4GLLA 3BOSA 5TMDA 4G5OA 3STTA 3W8RA 2NXJA 3ECCA 1KK0A 4BVFA 3S01A 1ZESA 4L75A 2E5GA 2J4FA 2MZTA 1J4AA 3HL4A 4GX1A 3GJYA 1LD3A 2UZ0A 3DEHA 3UVJB 1E4VA 1HDGO 4BNDA 2ZU6A 2H5IB 4FEEA 1V71A 3ROTA 1ICIA 5KTSA 3NGMA 1G7RA 4O0MA 4HSEA 2V2VA 1AB8A 5CEEA 4MWEA 2IDEA 4F84A 3PTWA 3J81Y 2BFWA 5BV7A 2RHRA 3V8MA 3VR5H 4R40A 3OL9A 1Q20A 3OZAA 3UTCA 2W5UA 1ZOTA 1XMBA 2VU5A 4B2YA 4Z7NB 2NGRA 2DR8A 3OL7A 2DWUA 1VYHA 1WD5A 4F4YA 1NK6A 2QGFA 5ETTA 4RZHA 5FLKA 2XB2D 1KWMA 2QQ5A 2HQDA 4N8DA 3SYNA 1W87A 4AZ0B 2DXEA 5ABPA 2PQMA 3I1JA 3TLYA 4DWIA 2AI1A 2WFLB 5AOAA 3NT2A 3ME5A 2Q6OA 1DAGA 1FEHA 1TPZA 3DNCA 4F36A 2I03A 1U2ZA 4PCLA 2XUPA 1FW8A 3ZK9A 4I6WA 3PNQA 2FDNA 2Z1MA 4UU1A 1Y9AA 2A84A 2XRYA 3GJQB 5KJFA 1N5RA 3DRPA 3QT5A 5E7MA 5ALKA 1HQEA 3QHPA 4N3NA 4EAQA 1B8UA 3C3PA 4MGIR 4QXMA 2VBXA 3M9OB 1O0BA 2F43B 3N7TA 5DE3A 2M9MA 2V5AA 3OLVA 1T35A 5A0YA 4Q7KA 2VP9A 4BTLA 3ZE0B 1QYWA 3L1JA 1G6KA 1NXTA 3T6BA 4E4TA 2ZJOA 4US2R 3MCZA 1NJSA 2ZBQA 2HZCA 3HR4A 4X8MA 3J7YU 4LC1A 4O59O 2IOHA 1AF4A 2G06A 1KQSR 3TMKA 2JGLA 2D2FA 3FMWA 1SCBA 1XMVA 3VNQA 1DCMA 2C5BA 2VDLB 3W5IA 1E9RA 2NYIA 4ISBA 1QPBA 1P4JA 4OLFA 5BYBA 2AFVA 1WOYA 3SZOA 4MI3A 4H7JA 3E3XA 2L19A 4RMJA 4PSDA 1TKZA 2QRZA 1HTWA 1FEEA 3RSGA 3UBMA 5J1SB 1IRIA 1EJBA 3A3OB 3G02A 3DZJA 1FTNA 2JL9A 2CV2A 1W0CA 3CVWA 4PO1A 4PSUA 4DR1B 5CDFA 3PEEA 2YHIB 2P11A 3TCKA 3CMCO 3ABOB 2GHPA 1RTZA 5D84A 3MN1A 3L3CA 5LXTB 1HR0F 3I9V1 2OO3A 3PX4A 5IOLA 3KZ1E 4B46A 1EUCA 4AJIA 3QI7A 4ASUD 3GP3A 4O2BB 2RHMA 4MJXA 4UHBA 3B6JA 3LRPA 2J87A 4MUBA 1THGA 2WJGA 3AHCA 4GPAA 1CE8B 3DYAB 3PPIA 1HLPA 3EG9A 2CY0A 1YL7A 1JLAA 2NZVG 1C1YA 5FWYB 3OR1A 4XM1A 4UOCA 4MKRA 1ZGCA 4RQBA 3WLPA 3USES 1V8PA 1G19A 3DT9A 3AIKA 1W85A 3B8HA 5KHOC 3BHNA 4LCEA 5F21A 2FUCA 1X5SA 3WISA 4OYOA 5AW9A 5TMPA 2BDUA 2LEBA 1W75A 3GR6A 4RIEA 1QE1B 5CVUA 3H04A 3OQMA 3A3NA 3ZEIA 4ZPXA 1JI0A 4C6AA 1G66A 3ZBUA 4P2BA 2JX2A 1Q0UA 3OF2A 2BHTA 2LLZA 5ANRB 1DWQA 1ULZA 2P7HA 3Q3GE 2W7OA 2W2VA 2HQCA 2WY2D 3U5ZB 4OKSA 2PL3A 3PBKA 3R1HA 4CKWA 1J70A 2C8LA 3KKFA 2BACA 4JUAA 1DKNA 2VS1A 4XSHA 1Y48E 1WEXA 4IQ8A 4D0GA 4ZCSA 3EGDA 5BR7A 2BF7A 4QOFA 3NWRA 1ZVMA 3CGWA 3VPFA 4X1IB 4BEBA 1RZRD 4AB1A 2R7TA 1X9IA 1FNMA 1NYQA 1JK9B 5JS6A 1L4UA 5JNUA 2D59A 1FJCA 3TBFA 4IMIB 3Q2OA 1LVHA 2OT3B 4GF5A 4V1CA 3MOGA 1T2VA 3FA2A 5EXTA 4AYBD 4OV6B 2ZE7A 4KO8A 2N7YA 1G42A 4WN9A 1T9VA 1DLOB 1ADFA 1IM4A 4DIOA 2BYCA 1WZIA 3TAUA 1Z0UA 1DTSA 3AUSA 3I4PA 3ZCSA 5TSDA 1ZCZA 1VMEA 1L5GB 2ZDQA 5DLFA 4GICA 4MA0A 2Q3CA 3WZMA 1DEOA 4ZPAA 2G9VA 3GA7A 5GONF 4JLOA 1DINA 5KNDH 1JRLA 1YUMA 2I4NA 4DUZJ 2DNLA 1X3LA 2VB6A 1RC8A 4KGVA 2ZYSA 5J1EA 4YXFA 1UBOS 2BM1A 2DR7A 1C4KA 2JEZA 5CNKA 5BOSA 5FHRA 4ZANA 4RA9A 3G2PA 2VCHA 5CLIA 2CHFA 3JVVA 2IV2X 4F7DA 2HJWA 1K7FB 2RMKA 3FQLA 3DZFA 3OFVA 4MVJH 5AXKA 3JTEA 4XTRA 5E7IA 4QQBA 1FCAA 4Y9UA 4G23A 4ME6A 4IIVA 3CC7S 3ANSA 3JWGA 1P0FA 5KFYA 4MINA 1EFAA 1RWWB 3BFVA 1Y4ZA 4WA8A 1ISFA 3WAGA 1DO8A 2ONYA 2GSDA 1H2ZA 1Q7RA 3N0RA 2AGQA 3RIXA 4JB0A 1AA6A 1OI4A 4F8JA 1R5OA 3WYBA 4N40A 3CRZA 3AHDA 2FWMX 4I81A 1FXWA 4OX7A 1KQGB 2GILA 5A71A 3FNFA 1VI5A 4BO9A 3N5KA 4W1PA 3HA5A 4YT2A 5C24B 2F9DA 4IEIA 1O9HA 1Y3JA 3UMMA 3CLVA 5JPDA 5AW6A 3H6HA 2PUHA 2IHUA 5EA2A 4HN4B 4OI3A 4BO3A 1IXKA 2B5WA 4J9PA 3H7IA 5G0TA 3A04A 3LO5A 3RVSA 2FPKA 2DHGA 4Y00A 3VVLA 2HKIA 3L7YA 1UMJA 5KTNA 2OO5C 3S2FA 1M76A 1GG5A 1S8OA 4E1BA 3H87A 2IU0A 3KLIA 1IJFB 2PX6A 3E9QA 1ORVA 3M8ZA 1H22A 4M5NA 5B1YA 1H6CA 4NHEA 5MGNA 1FNDA 3IR7A 1JHOA 7AT1B 1PR1A 2HMTA 3UMSA 2R44A 3RK0A 5C7IO 2VL1A 1S6UA 2IJNA 2JIZA 3H1TA 3COVA 1X7YA 4B3FX 1GL6A 5IAEA 3KYBA 4DUPA 2RKBA 2EKBA 4F2HA 3R7NA 1ZVJA 1UBMS 3DOHA 2JHEA 3GA5A 3WMWA 4GVLA 4O4LB 3MT9A 1T29A 3V3KA 2GHWA 1RQPA 2QTWA 2PQ6A 3Q2KA 4KDFA 2CDBA 5E4FA 3FFXA 3D0IE 5EJFA 3W4JA 4L50A 1P6QA 1QIIA 2B7BA 2JEFA 1V8ZA 3I92A 4PZCA 5DOVA 1FZTA 3I1FA 2O66A 2AS0A 2FNAA 4KMSA 2E5LB 1C0TA 1RT6A 2MXYA 3TTYA 5LP6B 5J59A 2HU5A 2G8NA 2CFOA 3PYGA 3MTIA 3SI7A 3ZD8A 2QR2A 1GRRA 1KC1A 4YACA 1WULS 3HB0A 4CLFA 1E3JA 1RI2A 3G0DA 5BORA 1QJHA 3V46A 1IBSA 3IURA 4YFYA 4B3JA 4I1OA 1YFLA 3W1VA 2AJ1A 2ODPA 1W88B 3W79A 4Q02A 1NH7A 6GPBA 1RQXA 3F4BA 1REGX 2YZ2A 2XG8A 4USUA 2IUSA 1O95C 3OIFA 3HFGA 2BANB 1XZ8A 4LRXA 1EFPA 3HE3A 1H2AS 2QJOA 4ABTA 4NYIR 2B56A 5KX5F 4CKCA 4I1YA 4LHWA 4DT1B 4B0PA 3MCVA 2JI7A 1A5BB 5DHSA 1N7GA 4CEIA 4NOHA 3A36A 4ND3A 1RFGE 2ZI6A 4M0UA 4ZT5A 2AU0A 3EVCA 1SUIA 2F3SA 3ILYA 3R7WA 1HNXF 3O3LA 4KRXA 1M0SA 2B5OA 4DPXA 4OP1A 3TX0A 2YV3A 3OY2A 1E6UA 3JZDA 2V8VA 4UM8B 3TINA 5KS2A 2EBUA 4A6EA 1R2QA 1N4DA 2FY1A 3GJ6A 3BH0A 5AI4A 4YREA 3PFFA 4ZU6X 2I0FA 4AAYA 2UXDJ 4GDMA 3JQ9C 2CWKA 1K7EB 4FS2A 5F9FA 5KG3A 4YJHB 4GKVA 4OATA 2WWVD 5I4IA 4R1SA 2UU9B 1WHSA 4CO0A 2BEVA 4RY0A 3AFMA 4Z2YA 3FSXA 1U9IA 5MFPA 1KA9H 3PJDA 4PAMA 1SG9A 1SULA 5G0RA 5H81A 5KFVA 1EFVA 4CLRA 5KSOA 3JW8A 4YRJA 1LW6E 3HJCA 5U1PA 2G82A 1N9KA 4FI3F 2CSUA 4G2NA 3C7DB 2BM8A 2CB0A 2ZFUA 1ZYQA 1AW0A 2J3MA 4YRCA 2V67A 2AIRA 4B6GA 1Z45A 2DEIA 1XZLA 2ZTMA 4MVYA 5SV2A 4MVJP 4F0JA 4E1VA 3CLKA 4MK9A 1X94A 4MB0A 3JQGA 1VQ7S 2GVZB 4HGNA 2H16A 1L7BA 4X60A 2QMZA 4F5YA 3OUZA 4XYGA 1YRAA 2Q0HA 4CDRA 2ZE2B 4CLUA 2YQ3A 1SBQA 4LDZA 5DULA 3GRAA 4UNPA 3Q0AA 1J49A 3UPUA 2XT6A 2BHLA 4KFRA 4X1KA 1SKWA 1Z35A 5K0NA 4BKMA 4JLVA 2DE0X 2FOLA 3GEMA 3U3ZA 1WI8A 1XLTA 3ZXUB 3ET6B 2XRMA 3LLSA 4FDUA 1R8QA 2VQEF 1FNBA 3WIVA 1XALA 3R9LA 4WNIA 3M6FA 1OJLA 1WZ2A 3CURA 4S0XA 4BFYA 1MX9A 4BWGA 3GT7A 3MFYA 3IE1A 1W1WA 4OXNA 1WE2A 4KYIB 5ADWA 5IFMA 3DTYA 2CFXA 2GLTA 1KP2A 4QBHA 4NZPA 3O8RA 4ELVA 4II3A 3PX0A 5B64A 3EE3A 1JG7A 5COAA 5JVGQ 4J0FA 1GADO 4X7MA 4XD7D 4YVFA 4ZTZB 3ADPA 3TKAA 3G8SA 3MXTA 4JCOA 1L5VA 3NWGA 3A6HA 5FOQA 1GVHA 4LX8A 3GIDA 1T0TV 2UVWA 3A58B 4PIVA 3O21A 4D4MA 5L1JA 4WKCA 2YKAA 1V5FA 1SCKA 4G85A 3TVKA 2GVZC 1EFDN 4Z3OA 1WC4A 1G17A 4H6XA 2MLZA 2IS4A 3MJCA 1I6MA 2CXEA 1SQEA 3JTPA 1LRLA 4CM4B 1KAGA 2MYPA 5CCDA 1YC5A 3BSFA 5H5JA 4V0NA 4KH1B 1U8WA 3L7UA 2QLMA 4R2MA 4DCPB 3F47A 5DLPA 1XWWA 1O5IA 3SV4A 1QU2A 4AFFA 1LBHA 3UV7A 2QN7A 2FEKA 5DEOA 5DDRC 2WSCC 2ACWA 2DLCX 2QQEA 3KUCA 4CUZA 3ZY4A 1I7QB 4ND4A 1GAWA 1U47A 3RYHA 4RE5A 3GU0A 3K58A 1GPH1 4BO4A 5FAKA 5F98A 2YIMA 4LQ3A 2RB7A 5BVGA 3RC8A 4B33A 1PWEA 1RLTA 4QTYA 4TS3A 3M5DA 3DEYX 2CVHA 1R0BG 4CH7A 4Z1OA 4IH5A 4LVNA 1U8CB 1JH8A 4OZ2A 4O4GB 2APJA 3W3ZB 3JAMU 3U40A 5A9RA 2GERA 2GAJA 4XGKA 3NW9A 3OTOF 2FW7A 4B5LA 5GADU 2ZJQQ 3BMXA 4MKIA 4XFDA 4OIMA 5L6MB 3HQ4O 3KLFA 3W9HA 2PMFA 3ZS8A 1N6NA 4FT2A 4P98A 1ZISA 2YV2A 3AKDA 3IB6A 3BSCA 4K4WA 1TAGA 1EJ7L 4J0EA 1G7SA 1L4GA 4M5GA 2PSDA 5FNVB 4QW8A 1X0PA 5GV8A 5CM9C 4NG5A 1UXKA 3PX3A 1Y00A 2FEXA 4LJLA 4NPCA 1T3OA 3HYLA 1NFQA 2VPYA 4LSLB 2Z6AA 1VDHA 1XCPA 3A6DA 1Q95G 1BX3A 4YB7A 1NB7A 2YV5A 1JNRB 4WLFA 3SJCA 5CB4B 4KDCA 2R7AA 3RADC 1AZWA 5KYUB 3VAKA 4YJGB 1N5IA 3EZNA 4J9MA 4IM7A 2R8ZA 4HWSA 4QLBA 3IAXA 3EBLA 4CW7A 3HCFA 4ZQEA 3EDYA 2P6SA 1R8YA 3K59A 3HWWA 3DRXA 2R8GA 2XJ9A 3T0IA 1T6YA 3QG5A 3C15C 3ND6A 1BDHA 1K8RA 1YZUA 3J81U 3D5EA 5EMLA 4TLMB 2D3OR 4EOGA 4JV5F 1XAIA 3U17A 2I2CA 4DZZA 2EQAA 2H4YA 2D3WA 1VTKA 4XDZA 3CRNA 3GVCA 3FMBA 3CCES 3QGHA 1C8VB 4JI6J 3OOSA 1H3EA 1JWLA 1Y9OA 1Z83A 3SCJE 3SE0A 3MAQA 1OXVA 3PZPA 3EOAI 5K8OA 3HKDA 1T03B 4OK3A 3OUYB 3N6NA 5IUJC 1RHKB 1UP4A 2GJIA 2O8EB 2BE9A 3JQCA 1BX0A 1YJTA 3EPGA 4CMEA 1K88A 3K0KA 4HZUB 2EP8A 1AH2A 4GKJF 1SAYA 2CVIA 3PXEA 3LP8A 2YHSA 4B3MF 4G26A 5A7GA 3WDOA 2KT5A 1HT2E 5TC4A 2IP4A 1FSPA 3CX8A 3K1ZA 4ZP9A 2WSLA 5TV2A 2MQMA 4A92A 2RBKA 1S8FA 3C74A 3PG9A 3P5BA 2PWBA 4HDSB 3DTNA 2JEGA 3H25A 1HPZB 4X00A 1NU4A 5H68A 1RWKB 1DQ8A 5DETA 4NXMB 1Z4LA 2BHNA 3CW8X 4OYBA 4YCNA 2BMEA 1NQAO 3GNLA 3AY0A 3PICA 4W8OA 2O2EA 2A58A 5ES3A 1Z2NX 3AWIA 1LWFB 3AFOA 3GJSA 4NBLA 4GL2A 1SC4A 1Z1ZA 3IDSA 1Z4QA 5JFGA 3LUDA 4UY85 3L7LA 2A78A 2YKMA 4LWZA 3VOTA 3T99A 3D3KA 2OXTA 3X2EA 3HO6A 4HLBA 7REQB 4AP5A 1ZBTA 1EQMA 3DV9A 5KKAA 2NVWA 2JKYA 1MGPA 5K0LA 2C8JA 4XJSA 5FPHA 1M8KA 5A06A 1WCIB 2IPLA 1NKTA 2UUOA 2BWJA 4E5MA 1NVEA 2GPTA 1Z5VA 2J6CA 1ZETA 4YH1A 4KREA 3EF3A 3GD5A 4H6WA 3AH8A 4MULA 4IVRA 5JVHQ 3S6EA 2P6MA 1TAHA 3H9JA 2XGJA 4C9DA 1TIKA 5CYOA 1WU8A 1MJGM 5EE3A 2O0KA 1GP2A 2V7TA 4K2AA 2G13A 5JLJA 2C2MA 2QQFA 2G71A 4IFVB 5HDBB 5DB4A 2CF5A 5AJ3F 4M5HA 3JXOA 3KZMA 4ZWNA 2OJ3A 1OGIA 2NUTB 4ZVOB 4S35A 2GESA 2KM8C 1SA0A 1MC1A 1KJYA 3QUQA 3LTNC 1T3ZA 3NCRA 2FRXA 4ZHQA 2JBHA 2N75A 2C5FA 1F8XA 1T6XA 3A6ZA 2ZYVX 1RI1A 3HK2A 3DUFB 5B3KA 3M3DA 1IAVA 5D2CA 1WTAA 4PEVA 4QQRA 3ET5A 1MNAA 1I51B 3Q15C 3EFOB 3L93A 4JDPA 5AJTA 1QOPB 3V4LA 3U48A 1T9TA 2HJGA 3LUYA 4HYYA 3LBHA 2ZI7A 2ONZA 1YB4A 5KYKA 1EWQA 4ALLA 5FXMA 2RAFA 5BQXA 2G5GX 3DOMB 3P2JA 2HBQB 2OD6A 1G7CB 3VR4H 2Q6LA 2QM7A 4LPSA 2QYSA 1JJBA 3H1BA 1O03A 5KNBA 2ATVA 1AKMA 2OM6A 2ANBA 4DQIA 4YP0A 5FBHA 2P41A 3JYTB 4K9NA 3PD1A 1VQPS 1NFFA 4D46A 2V4UA 4WD3A 5KOHB 3W2HA 2WZDA 2QRVA 4U00A 5HQTA 1GM5A 4JB2A 4MV0A 3W9SA 3H2UB 1D1QA 4ZJUA 3EZUA 1XKTA 3O31A 5BSWA 4UMDA 2OG1A 3DI6A 2FHJA 1UKCA 4IHAA 2O3SA 1K4KA 3RUIA 3C7KA 4LT6A 1CY2A 1VBFA 3EJMA 2QAIA 3PE3A 1G2IA 3OQIB 3DPUA 1R7IA 2AUNA 1OWMA 1JMVA 3AHIA 2FPPB 1MW9X 4RXUA 1T8EA 1Q0SA 4C43A 1QB8A 1V11A 3FFTA 1MMDA 2EZ8A 2RJOA 3MUFA 5CIYA 1U3TA 1X80B 2W2XA 3SNKA 4QFMA 3ZW8A 3AKEA 3KKKA 2QLXA 1R3NA 4G5FA 3H83A 5DQIA 1VQKS 2JBAB 5CX1B 3T1TA 3AP3A 4J5OA 3FGZA 1XTJA 1MFPA 4R1TA 4EUHA 4B3SB 4LF5J 2BPOA 4QU8A 5EJ5A 2XLCA 3Q6MA 2Z09A 3TIXB 1GEEA 1GR0A 1PUJA 3RT7A 1DBVO 1NWHA 4RLQA 3ILIA 1D5CA 2WNIA 4R5MA 3F3MA 3BSSA 1K3TA 2EYUA 1V39A 4I9UA 3N58A 4BNNA 3QX7A 2PT7A 3C24A 4RWWA 3FCHA 3U27A 3G71S 4QDUA 1HW9A 5JC8A 3DHYA 3LPDA 2AZ1A 1N2SA 5HK9A 1H4VB 4RU1A 2NAFA 1IM8A 1ECPA 5KSZA 5CDHA 3H2BA 5L9NA 4OHUA 4DLWA 1RKXA 1QIFA 5AKIA 1N5DA 2YWKA 4BFWA 4TKZA 4HX5A 1JIQA 4EGSA 2O5RA 3AUTA 1UJ6A 4PHFA 3ORSA 4EP1A 1Y5LA 4A9AA 3NUQA 2K8GA 1YL5A 3E3NA 2HR1A 5FDLB 5FEMA 4QFCA 3W1YC 3O2IA 3KEGA 3FWZA 1V5IA 4H31A 2Y76A 2FEWB 1U2EA 4QOTA 4K4VA 5KZMB 3R8YA 5THKA 4GOND 3VTFA 5LC1A 1P1JA 3UMCA 2ZSKA 4DSZA 3M2VB 2EGGA 2YWHA 2RRAA 2IIPA 2QD5A 1P2BA 2DBYA 4Q4AB 1P17A 3R2CJ 4HMPA 3NEJA 5AW8A 3D8HA 5AUQA 2R6HA 3ZJVA 4BIIA 1E7SA 5HVFA 3EZGA 3H9BA 2NACA 3V8PA 2KM1A 1ZGAA 3KYDB 1U1PA 2E5IA 1I10A 1O58A 4IHJB 3CKKA 2A1TR 2I91A 4LFAB 2JIZD 1URRA 1P1LA 2QROA 3B1XA 3DM2A 1YF3A 1MNQA 2YCLA 4HBZA 3V55A 4Q05A 4HQFA 3T1NA 4L85A 5HVHA 1UANA 1Q82T 1DKPA 5I3PA 2QSZA 2FTKE 5B0CA 5SY4A 1XR6A 1O94D 4NLYA 3SYRA 2Q9UA 4TSFD 1GU1A 3LH5A 3KFXA 1PAUB 4C0AC 1GL7A 3OFHA 5BWBA 3V6JA 4E12A 4NJMB 3KDAA 1M1YE 5IHXA 2XY7A 4J0HA 4LF7J 1F5CA 2DHCA 1XHEA 3KYIB 1S4QA 3U4QA 1HDYA 3MI7X 3GLRA 2PFKA 4LYHA 1VHQA 1MC8A 4LOAA 1WVIA 3IIEA 4MQMA 2MKYA 2ZI4A 1HQ2A 3MUOA 2ZCVA 4ZK2A 5JXGA 4K6CA 5CNMA 3RTDA 3T5AA 3DV0B 1RBOB 1G2EA 1Y3IA 3CVJA 4CWAA 3KZXA 4W92B 1K9VF 3CT6A 3V4VB 3H5OA 1NJ6A 4M55A 3DZIA 1VSBA 5L4SA 1KY2A 5ELLA 5I7VA 4DXDA 3NYIA 4WU2A 4FHFA 3FNQA 2GLXA 1RKQA 4B2PA 1KTVA 4D2IA 2LQ9A 3ZTTA 4A7PA 1IY0A 5A7FA 2H59A 4WDRA 2ZDHA 3WB9A 1G8YA 4X7BA 1JN0A 3V4FA 1QFSA 4BCCA 1EIYB 2DGTA 1X86B 3D6MA 5CPFA 4Z3DA 3W34A 5J1NA 4A23A 1YQHA 5K3CA 3MOIA 1ZK3A 4ARBA 1VXRA 1B15A 3BV8A 2MB0B 2CLKB 3ECSA 4ZYLA 1ML3A 3SY8A 3WL8A 3DFFA 4REMA 2IVYA 4XDHA 3OZWA 1JAIA 3HFSA 1JG6A 4KVGA 4BB5A 3FHCB 1SC1A 4KKOB 2IE0A 4NZ0A 3GQCA 3G85A 2VNAA 5TGTA 3LXXA 3EGVA 1YJNS 5JCPA 1U0JA 4YRZA 1HSZA 5K0CA 4UULA 4USWA 1WD6A 5BN4A 5ALLA 2XW6A 5IC4A 1I1OA 2Z2XA 3LIPA 3HVWA 2OZEA 3HP4A 3K89A 1ECFA 1Q12A 2XGMA 1O9BA 3O2JA 1ECJA 2EW8A 1QRRA 3GFGA 4JT2A 4WY2A 1M2EA 1V9LA 1Q79A 2QL5A 5BXQC 2HSDA 2RGAA 1TO1E 1YASA 1TR0A 4X65B 2HZ7A 1WWHA 2JIDA 2BAGA 4V38A 4FT4A 2ZQYA 1P2UA 4C4YA 1N2EA 3MMCB 5F2OA 4EPWA 1E9FA 2HZVA 5FPYA 3ZE7A 4RFSB 3NHAA 4EB8A 2C20A 5KFUA 2Q3HA 3DVQX 4ALMA 2Y1FA 1KZYC 1JX4A 1J5EB 4MW2A 1TCBA 4WKPA 1T0IA 4NBVA 1CS4A 1R0XA 2KVQE 1NV9A 4K50A 2DBZA 5J9FA 1IPFA 1A8QA 4OQQA 3AU8A 3IOMA 5KUTA 2PG3A 4IIDA 2ATCB 2DEUA 2OUIA 2W6QA 2AYEA 4NYOA 4QXOA 1K89A 3G9CA 1PBUA 4ETMA 5H8WA 4FC7A 3D3WA 3BF8A 4LZNA 1N2CB 2YV1A 1JBEA 1WOPA 2P79A 1KBQA 1JXMA 4G5QA 5BY2A 3ZCUA 4D0LB 4KX3A 2XO6A 4CF3A 1UIRA 3AVQA 3UMFA 1VGRA 3M33A 2RHOA 2XULA 5E5NA 4NR0A 1CZOA 3WFZA 3OD1A 4JVMA 2P1ZA 4AJ2A 4N8SA 3M8WA 5AK0A 1SWVA 5DO2A 4D42A 5D5PA 3BD9A 2J4CA 1K86A 4IHQA 3C14B 2OCDA 2OPSA 3MCAA 2JLQA 3I55S 1PF7E 2O4UX 2PVCA 3EWIA 4MVJM 3MTAA 3A4IA 5HVGA 1R7RA 4DSJA 2QMQA 1YONA 1WPRA 2Q4BA 1SIUA 3KK2B 1EI9A 4AFNA 5I3UB 4FYMA 4IIJB 1RBQA 1FEZA 2NZJA 4ZOBA 3C4JA 2VQEJ 2WHQA 3PI7A 1E2KA 4G9EA 4MW1A 16PKA 3NMUF 1PFWA 1WEYA 3EDQA 4J0QA 1Y98A 1DGQA 1WCXA 1NKCA 4EW3A 4Y2VA 4L78A 4F8RA 1W29A 2KVIA 1OBVA 3K35A 2DVMA 2O2HA 3K2YA 1QIGA 3VC3A 3BL6A 3DGPB 3W62A 2QYOA 3VQTA 4Z3KA 3EDRA 3DOKB 5JMPA 3LPEA 1PIWA 5KFLA 1G8SA 3AT1A 1AXRA 4WVFA 4EIWA 1GZHB 3Q8YA 3G0IA 4AMUA 5JHHB 3D8NA 1MBZA 1HE5A 2W6PA 1PRYA 1TX4B 3CWZA 4G6VB 4ZZ3A 4HWGA 4DDMA 4CDMA 4Y2IA 1FLVA 3BO2A 3R3HA 3J80U 3TIGA 1CX9B 3NS5A 2VF5X 2FOXA 4TN2A 3TLJA 3D4NA 2LD4A 5B4UA 5I7EA 4FLMA 3OLYA 2WD7B 4WLEA 4DABA 3MR3A 4HRXA 4X24A 2Y2VA 1L7NA 2VHVA 2F48A 2Y1JA 1VE7A 3I23A 3R6TA 3R9XA 1IE3A 3AERB 4ND8A 4PS0A 3D6HB 1AM4D 1CUXA 1E2UA 1A27A 5F8MA 3C14C 4CLSA 5D77A 4KBIA 5ILGA 2DXDA 4PG7A 3I4LA 4I0WB 1NK7A 1SKBA 4ANFA 4AY4A 3DMJB 4HXEB 1JUDA 1Y3AA 5C5CA 1UXOA 1A50B 3TUZC 1JPNA 2WF9A 3UJ7A 2FRDA 3MLBA 3VV2B 4CMCA 5KYYA 1Q92A 4OHVA 2WINI 1BXNA 5C5EA 2ERRA 1H0HB 2L42A 1GEGA 1KC3A 4PSKA 3K94A 1GPNA 2MCFA 1DSSG 5GOZA 3VVCA 5KVAA 1S1UB 6Q21A 2OHHA 3NAIA 4IINA 1OLXA 4LSNB 4LUBA 3D43A 4G0OA 1QF7A 2P2GA 1LFDB 2FX2A 4XCQA 1GAXA 3B70A 4I4TB 1TEXA 1K0TA 2HGMA 4N6NA 2P3LA 3FOCA 2ZSUA 1I2DA 3ZQKA 1RXYA 1XLVA 3HZHA 1WIWA 5I9IA 2FVXA 1M1GA 5LUAA 1XVAA 5HMWA 2E1RA 4P52A 3ZC3A 2DWPA 4KAFA 4I99A 4R9NA 4BFVA 2YW2A 3MMBB 1K0VA 3VVTA 2H7YA 2C07A 4DLBA 3FHTA 1TFRA 5HP1B 3KG2A 1AUVA 3B3QA 3O6QA 2WKQA 1Z2DA 3LLVA 2APOA 2BKOA 1Z7EA 2D7JA 4GL4A 3TECE 4ZVGA 2X14A 1U1LA 4QEZA 4YB5A 5DRKA 3MQFA 1MVLA 3PDIB 3FNEA 3CRQA 1U4NA 3D7KA 5EWJA 3EBOA 1MAWA 4HNAA 1JJHA 2NU7B 2XQIA 5ECWA 4DX7A 1JKJB 4Y30A 1JVBA 2LDBA 4QYRA 4HB4A 2Z57B 1HWUA 1YJRA 4ODIA 1R6XA 1YVRA 3F7OA 3PUIA 4GOMD 4PLGA 5JTUA 3NNCA 3IN5A 2HLPA 5HS6A 1KWGA 3Q9UA 3MSXA 5IT5A 2QG9B 1FZQA 1LW0B 1K7YA 1XMOB 1JEQB 2L2QA 4F12A 1DAIA 3OC0A 2JARA 3SHWA 3V4PB 1HG1A 1T4CB 4CYUA 1P0CA 3UT5B 1PL6A 3BF4A 3TUPA 1Z7BA 3T0FA 4K5RA 5AE3A 1AKUA 2BBSA 4F60A 2ZRCA 2A4KA 3B1WA 1YU9A 4R51A 1IATA 1F17A 3QJYA 4YDDB 1X1SA 3GPAA 3MPUA 1UVLA 2ZAYA 3L02A 3PITA 4X3OA 2IRXA 1U7PA 2I6SA 2YWRA 5SZTA 5KHLB 3PRBA 2DTXA 5DFAA 4AP6A 5GIOE 3RYIA 5L3SA 3BJIC 4LRUA 1I30A 3OMWA 2ZSJA 4KLAA 3ZZZA 1NBHA 3CKYA 3F6CA 2IIQA 3H8VA 5CB0A 4U63A 5FDFA 1TTTA 4A0SA 4MQBA 4KV7A 3BMNB 2C7RA 1W7AA 4GKJJ 3UZUA 4B3GA 2PI4A 5HJ5A 2MHEA 5CH5A 2VAMA 1KN6A 2FG6C 3U80A 1BHSA 2SICE 3BTSA 4PYIA 9GPBA 3KHUA 3H2IA 4ZVQA 1VQ6S 4XH9B 4X95A 5K6TA 1PBTA 4ZU3A 3EB9A 2JDID 3PK0A 2MKSA 1G1XA 1L6RA 4QBKA 4QPCA 1H2RS 1TLLA 2BFBA 2VFUA 4ZPBA 2BJ7A 4XD7A 3FKQA 3HBMA 3M70A 5TPWB 1NU6A 2W9XA 4ZA1A 3JQ7B 4M8IA 2CZ4A 2AUMA 5A6VA 2YWFA 5CFMA 3IL2A 1TOAA 3TZLA 1YBMA 1JPVA 2XCUA 3K53A 1NQVA 1WXFA 4BO2A 4FF1A 4EMUA 3FHOA 3OHAA 1WHTA 1CUWA 4CDNA 4UU7A 5DP2A 3TAMA 2BJ9A 1RKVA 3RF7A 4JBYA 2VP0A 4GMKA 3DDCA 1Q5VA 1E2FA 4XDDA 4IFYA 5AM3A 3GEPA 1URNA 5E2QA 1U8UA 2ZRDA 1U6KA 2XDAA 1ZAKA 4P5EA 1ZM4A 4N7BA 3UV6A 4K0KF 1NW6A 2BJ8A 2I9KA 5LQCA 2DT5A 3IT0A 4JI8B 5LQDA 1MJHA 3A05A 2ZU0C 5HRCA 1FP4B 1RD4A 3T12A 1SL2A 1B0AA 3D6NB 5LQJA 1SL1A 3THYA 4X4OA 2VPIA 1GARA 5EMJA 1KGSA 3PFOA 1SUCA 2EP7A 5B7PA 3RU2A 4F3CA 5HKBA 1BQEA 4OOEA 1Y89A 2B5JB 1T0HB 1LWCB 1QRDA 4NRTA 1WG4A 1GV1A 4RW8B 1KFKB 4TVOA 5L3RA 1CRQA 4Q0BA 3B12A 4B9LA 4TV8A 1JLFB 2QM3A 2WJPA 1FDWA 1VSUA 1E9CA 5IJAA 4AMVA 1Y4AE 3WWDA 3CEPB 1HBOB 5DN6D 4IICA 1QIHA 1FRZA 4EY7A 4MGKR 3RC7A 3FHLA 3W5BA 2ZBRA 2IXBA 4ERDA 2HFKA 5GJWC 3ZDDA 2D74B 4CO1A 1QOQB 4X94A 5KNBD 3ZTOA 4EFDA 2I62A 5DM4A 1KOHA 3OE5A 2NXEA 1JJCB 4O0LA 3UQYS 1YA4A 4RZRA 1ADGA 5J5AA 3MOZA 3GCZA 3AD9C 3NBXX 3GLHA 5AM5A 4NEZA 2ZJ1A 4FYYB 2BBWA 2PM8A 3WMRA 5CLQA 1DT5A 1U3GA 3ITEA 5DGIA 1HBUA 3SSMA 2FHJD 1KJWA 3WLOA 2MMYA 3IA7A 2MHNA 3GUYA 4IUCS 5AO9A 7MHTA 4EEKA 1F51E 1ZM2A 1X7WB 1LFAA 1IZYA 1F1JA 2MJUA 1J8DA 3R3VA 1U3CA 1CJTB 3COYA 2PU5A 4LCJA 4JI6F 3TWOA 4UOZA 2LDXA 1T1SA 1SHTX 1ZDMA 1HRKA 3NJRA 1Y5MA 1H1TA 1YC2A 2P69A 1IG0A 4KI7A 5IVIA 2XBLA 2JCXA 4GLFA 4JU8A 2RE8A 1RT4B 3BJMA 4AWBA 1BCRA 4CQNA 1AGNA 2G5PA 3COZA 3LX8A 2ZH4A 2XOEA 2X5KO 2CVEA 3TF5A 3QKSB 1S5ZA 2GXAA 3UMGA 1ADYA 1QHYA 2UUBB 1JL3A 1GYPA 2ZIUB 4YCCA 1BKDR 4HB3A 3AI2A 1RLIA 1MHTA 3KHKA 4F45A 4RM2A 2HMWA 4XVRA 2K1RB 1YBFA 5CCBA 3JATB 5HF8A 5I7WA 1NA5A 4B08A 3B2NA 4QD3A 3GMSA 4ZOEA 4RGBA 3IBCA 2D0OB 3RTVA 2FW0A 3CC8A 4EJ6A 3EQ7A 2IVFA 2RHDA 2UUAJ 5ESDA 1U80A 3VSDA 3KXKA 5A8RB 3COPA 2OD2A 2CZCA 1FKOB 2QTHA 3WKAA 3GQBA 4R5PA 5SICE 2PZKA 1QNLA 3IHKA 1K7SN 2NV0A 4DRYA 2CAJA 3FTQA 2RQMA 4ED7A 5THXA 3LI2A 4PC6A 4GOKA 1ZA1A 4EFAC 5TS2A 5F3DA 4UJ5A 3F9CA 2XM3A 5CA0F 2G88A 5CVDA 2AGVA 4FD2A 1ULHA 2DGOA 3EN0A 2Z4SA 3LO8A 4J9KA 3C5CA 4OI2A 2NU8A 2KL8A 5GAEI 1X9MA 3ZJ5A 3U4DA 5ALGA 4BJHB 3KLPX 1E7QA 2DETA 1CD5A 1FUUA 1NMSA 2HLDD 1Q84A 3QSYB 3LCVB 4Y6SA 2C78A 1G291 3UHJA 3IQZA 3G13A 2HHCA 4YLEA 4F9FA 4R8LA 4QZVB 1W5TA 5IDWA 1V47A 5HOEA 1GNLA 1PIEA 3QJJA 3SYMA 4EF6A 3V1NA 1SC9A 1C80A 2QD4A 2WHPA 1L6IA 2H1IA 1LJUA 1T8UA 1CJKB 4WOCA 1XKQA 1RTJA 1RXSA 3Q9SA 2PN6A 4RMGA 4ZAVA 3S0JA 4J0KA 1ZIYA 2ZKUA 4N39A 3M8RA 3OVSA 3O0DA 3SX2A 4CF6A 1FKAF 3ENWA 2GJKA 3M4XA 2GBPA 4PLPA 4OVKA 2Q2VA 1UPPA 4Q19A 1V8DA 3IFEA 4DV4J 1BA3A 4WAUA 3K5WA 1ZOIA 4K5SA 4NXNJ 3ZE9A 2ARKA 1FO1A 3MOJB 4UW9A 1EQ0A 2JPDA 5GMKa 3HN7A 3BIXA 5LOVA 4YDSA 1Q91A 2PUAA 3IESA 1R8JA 2H5JB 3TNVA 1M2HA 5EHXA 2GW8A 1C7RA 3E7PA 3LVFO 3VNBA 3C97A 4A4DA 1PR5A 1F4LA 3MERA 4WZZA 4JUFA 4PQRA 3NX4A 4P4TA 3N8GA 2PRZA 5AXCA 2JVOA 3ZZRA 2ZE8A 3L09A 5ICCA 1BEUB 4ISCA 1WUYA 1VOMA 2AOUA 4W1RA 2GCOA 4D6YA 2C5HA 3ZH2A 3QFFA 4WCDA 4S1TA 2LQBA 4JKOA 3SNHA 3KQSA 1NU8A 5H9EJ 2BV3A 1VCIA 2GCGA 5TF0A 2CUZA 1FRIA 2N0SA 1IXYA 3O5AA 4BWYA 5IKOA 2MZSA 1FX4A 1JT2A 5EMNA 1FRHA 3CUKA 4H0FA 3V80A 8ABPA 4XB6B 3A6JA 3BXGA 1G0NA 1CJKC 2VWPA 1AO0A 4II7A 2NYVA 2GAOA 1QYVA 4C8ZA 3EQ2A 2B82A 2PQ2A 1HL3A 1SC3A 1GTG1 4C03A 3H75A 1T9KA 4JJ6A 5C3MA 3ZHCA 3GLQA 3B13B 2O8NA 4U5QA 5HANA 1XL1A 3PHLA 4TN5A 3GGSA 2ADCA 1EFKA 4LF5F 4EW1A 3E7FA 2WYIA 3C8MA 2VFTA 2V7QA 1HWLA 3LP1B 4UDXX 2O05A 1B6SA 3ZDZB 1L5LA 1JLEA 1VRTB 4FM9A 3RTGA 4HVCA 3WE7A 1L5ZA 4INAA 4P7VA 1XCGB 3NC1C 4WZAA 1RM5A 5T64A 2C2KA 1W9HA 3CLUD 5FADA 1W2WB 3AYZB 3VAAA 1VHLA 1CEZA 3MWBA 3J7TA 5CNIA 1A04A 1YR9A 4BLUA 3TYTA 5LDHA 1VQ9S 3O84A 4O4HA 1QTNB 2XKJE 3R0QA 4UJ3A 5AW7A 2GWHA 2HW8A 1UAWA 3PRJA 4WK3A 3HGTA 2ON6A 3R75A 2CN1A 1Q16B 2MYUA 3VI3B 1E7RA 1WHWA 3GSDA 2OCGA 2JCSA 4G1FA 2QFJA 2P2CB 3ZXXA 1AB6A 4W5JA 4LF1A 2HYIB 2O8DB 2VSNA 3F5FA 3AY3A 4NK4A 4PYAA 3GQVA 4WJLA 1B7FA 4POOA 4DRXB 5HEKA 5CIQA 4UDOA 2OPRB 3DPIA 5FT9A 4DCVA 5JXJA 1UVMA 1E69A 2D06A 4QUBA 2Z8YM 1T0BA 3RBEA 4FYXB 3RVRA 5AVOA 1TKRA 4CG3A 3NRCA 3K0HA 1U65A 4O4JF 3KEQA 3CDEA 1LH0A 3N74A 3ZNPA 4Q39A 4IOKA 4J3FA 3DWIA 1IHYA 3TPZA 4DLGA 2PFFB 3PC6A 5F2EA 2J07A 1TQ4A 3UJ9A 2B37A 3E7WA 4DR6B 3URKA 3CMMA 2RARA 2C3MA 3VWSA 4DMCA 3SM9A 4A8TA 2JVRA 1K6JA 5JBNA 1E18A 3DKDA 5HOQA 2ONKA 3OWXA 4ZZIA 3HG7A 1KZ4A 3U44B 3Q5GA 3F96A 4YWHA 4LY6A 3OIVA 4XPEA 4KQMA 3AVXA 1VKRA 2FG5A 1VHJA 5AHXA 1JMYA 4C05A 2CLEB 2GGPB 1NDQA 1S6QB 4IG4A 2G3YA 4PG8A 2YUTA 3HDGA 5B58T 2BM0A 2GX6A 4KY3A 2HQBA 4LF7F 1K7CA 2F65A 5DNVA 1O94A 4DG8A 3UNXA 1ZL0A 3TLMA 5HMXA 4HMQA 4TSFA 2QYTA 1LBEA 4MPTA 4ZZ1A 1SXJE 4CIXA 3CZRA 4UPVA 4DWWA 4EYIB 2VJYA 4ILMA 3AG5A 1JLGA 4DDUA 3PJRA 3P5TL 3UN5A 1YB5A 1YVEI 3IM8A 1U2GA 2F8MA 4IRCA 5E1MA 2YPYA 4PLFA 3QENA 1I4WA 3TEMA 4O29A 3K9CA 3KQPA 2XYGB 2A9JA 1MMNA 2Q29A 1R9MA 3T1YB 1X31C 5A02A 5CNJA 1QTMA 1DCFA 2IK8A 3HD2A 3LOPA 3PJ9A 2W70A 3GLIA 2P9ZA 1FYVA 3F90A 4B34A 5FLXY 3PRHA 3QXJA 1PC5A 1EGQA 3UB2A 3JSAA 2FVCA 1YJWS 1P61B 3MR6A 1SG6A 3OQJA 3BCUA 4NJEB 5ICSA 2DR2A 4GSLA 4FJ1A 1LW7A 4LBVA 1J42A 1JFSA 1S6OA 4Q4JA 2FVSA 4TKUA 3M6VA 1VPEA 4P38A 3CGIA 3MEEA 2EFPA 1IPHA 1GUZA 1KJ8A 3H8WA 4DXHA 1OXUA 3AETB 3KSBC 2IYIA 4L4RA 5B0EA 4ZO9A 3HFZB 2LW7A 3ZXYA 4CN9A 3K2QA 4YAIA 5C8YB 4M22A 3W5UA 2QK4A 1ZJZA 4X90A 4P4LA 4GR9A 4D96A 1IWGA 3BS4A 2IITA 4S0ZA 2XYHB 1OXBB 2REOA 4C6SA 2NZXA 2VK2A 1CUAA 4A47A 4X5OA 4YDRA 5EFOA 1OXKB 2JANA 3U3KA 2WTEA 2CWXA 3FKBA 4B71A 5IC5A 4NCHA 5FIUA 2VHEA 2V3WA 1TDJA 5EEGA 3D0HE 3K71B 1CUIA 2C03A 4ZAFA 2ZJYA 3PWKA 4DV1B 2Q7XA 4NCNA 5TPZA 3DNFA 1W35A 1KYXA 4YRLA 5IAOA 3WV5A 3K3PA 4NLXA 3PVZA 4GRIA 1U7DA 1IM5A 4NLPA 4V0LA 2HNDA 1QE5A 4ZGWA 4FZ5A 3HN2A 4QHSA 2VG6B 4AS1A 1JR2A 2V4RA 4R9SA 4WCFB 3GT4A 5LP6C 4DY4A 5A4KA 1F2GA 3NXSA 3UXHA 4RK0A 2I7VA 2Z3VA 1DJ0A 1NHGA 3QRPA 1I9CA 1TK2A 1UPTA 4H54A 1E2MA 3JAWA 4NMXB 4JOBA 1NQ5A 1V8BA 3H5LA 3PWZA 1UK8A 3F3KA 5A2QY 2XQFA 3D8RA 3VYTB 3ZCXA 1RE1A 2ICAA 1L1RA 3HWSA 2I9SA 3ESYA 1BXRB 3HB1A 1Y63A 3LQYA 3GLFA 1A0OA 4RW4B 3NPAA 1C5KA 4WHMA 4E1AA 1LPPA 1L5SA 2HXSA 4FMCF 4WJZA 2IY7A 1T95A 1NRXA 2FZWA 1CEXA 2O1SA 3DPSA 2A5DA 4ZJPA 4WNAA 2PZBA 2OAGA 2I4OA 1XZMA 2HM7A 5KNCA 4G3IA 3X0DA 3E15A 3DKKA 5DM7Q 1CQMA 1EDEA 1ZS9A 5IJWA 4IOJA 4X41A 1YD7A 4TZ6A 4WK0B 3AOGA 4R6WA 2A18A 1RACA 5EUQB 5AHWA 3MM4A 4F6LA 4TWAA 5IKXA 1RI5A 2O8BA 5LQKA 4REOA 5IBPA 4B8WA 3PUVA 2VYCA 1UQUA 3OZVA 3DD1A 3R1LA 4ZT2A 3K1AA 4MWZA 1SD2A 1CK4A 1WVGA 2PSJA 4DN9A 4MRRA 4FWIB 4URQU 3WDMA 4ETIA 2ZDPA 1ETUA 2WTXA 4DSAA 3IIJA 1IIRA 3V6KA 3EGWA 2KB0A 1TVKB 5J4VA 1M9NA 1BYIA 4D8VA 4YAGA 4GQBA 1QIJA 1S3FA 1SKUB 3O8NA 1SKRA 5I01A 3CW2A 5JZ9A 4UT4A 2GPWA 1FMTA 2IYVA 1OVMA 2MMGA 5CFNA 3G9QA 3DZDA 4FJ2A 1U04A 5JUWA 2XECA 4MPPA 4AF8A 2H00A 4KGMA 4HQLA 1NNEA 1DIRA 4BQOA 2L18A 1D03A 2HCFA 3FFWA 3HB5X 4PWDA 2XNRA 2WF5A 2LTAA 1WUKS 4LOHA 1E58A 5GIPE 2X42A 4LJRA 1QX4A 3NTVA 4IXMA 1SXLA 1CPYA 1ZMXA 5JRDS 2I4IA 2UVVA 5C25A 4HYQA 1QX3A 3UKJA 4E4YA 3RAJA 3OA0A 2WB4A 4RCZA 4F72A 4P4SB 2BRUA 4WOJA 4XM0A 3D31A 3I28A 3MTKA 4OXIA 3E23A 4ENVA 2QUJA 4B3TF 3UMVA 5RUBA 1C9YA 2JAUA 1VXOA 5CGZA 3N9UC 2DXFA 3DAFA 4EKEA 4URVR 1CP2A 3RRMA 4DR5F 3AF2A 4HKTA 3UJNA 5K01A 3CX7A 2ZULA 1J5OA 4DQLA 5DGCA 1N5YA 1B4SA 3QRQA 2QLTA 2R6JA 3ROGA 1RABA 5AJZA 1L4YA 1JDZA 2AB0A 4US1R 1T2DA 1U0SY 2CUYA 3JYLA 4H7EA 5E1BA 5EFZA 3DL4A 2QGFB 3C7AA 4CRWB 2QPLA 1V0JA 3K0AB 1W25A 3LT0A 4QSMA 2BGMA 3L1KA 1U7LA 1EFTA 3EJWA 1SUQA 1FSZA 3OOJA 4CLKA 2ZETA 2Z30A 1SKYE 4QYIB 4K0KJ 4YMEA 1SXJB 5CXTA 1DJPA 3DMTC 3S5JA 4YALA 3F6YA 9ABPA 4QVKA 3GW8A 4I5FA 3VO9A 2NZWA 3A6LA 2IFTA 3E5NA 2JHCA 1F60B 3LLCA 2IEGA 4PAGA 3VMMA 2O8VA 2I6WA 3UMBA 3NVMB 4WFIA 4K4XA 2JC3A 1HQEB 4U2BA 1S4FA 3G88A 2Z1NA 3V9PA 5B1SA 3HHEA 1QS0B 2QGZA 2FD2A 3CSUA 4S0MA 2C2OA 1JSCA 4JI0J 4L4YA 3QA9A 2EBGA 4M0DA 4MQFA 5IABA 1PZMA 5K8CA 4EI7A 4OBBA 1YA6A 3Q86A 4KIGA 4YRBA 2Z5LA 2CFTA 2PS9A 3LT4A 4BP9A 1P80A 3W5CA 4F1KA 4HNHA 2FVQA 2B5VA 5D1NA 2QTRA 2R5NA 1Q14A 3JYOA 5FNZA 3INTA 2Q2OA 3MTEA 3Q8KA 4HVLA 1HEIA 4ML3A 5BOVA 3W06A 4QGSA 4ZIRA 3CCBA 5KHAA 4Y2RA 3VGUA 3SZGA 1E7WA 2FHMA 3DE5X 1H66A 3BXZA 4RZ3A 5DVZA 3PSHA 2C4VA 2J3JA 4GSYA 2GTPA 4G5HA 3D54A 4E5YA 3ZDFA 4DWVA 2W2LD 2WVJA 4CDIA 4EG1A 2G7MC 1SXJC 2V98A 2XIJA 4FX2A 4PANA 4TRRA 5JVDB 1NOJA 1TLTA 1T9DA 3P9SA 1US8B 8ADHA 1LRJA 4NA3A 3KFVA 3HHKA 3R41A 1EUCB 2J5QA 1FXUA 4MS4B 2YBDA 4HLCA 1TGVA 1G7TA 3U7QB 1XJWB 3AF4A 1Z29A 2JK1A 4IVNA 4UTNA 2DVIA 2Z5FA 1IKXA 2HF9A 4PQFA 1DKQA 5JCOA 1JLAB 4RVDA 2KLBA 2CDAA 5BWCA 1H98A 2JI8A 2F8TA 1VCNA 1SOMA 1RAHA 2B78A 3PHBE 4X4PA 1MJGA 4QELA 1A5ZA 2QL7A 1W5BA 5C4GB 3R6LA 1OQ6A 2R79A 2VUHB 3VNUA 1T9HA 3HCWA 2JDIA 3THTA 1N75A 3UWOA 5EIFA 1D3AA 4YEDA 2PXCA 3FNIA 2R66A 5EJ6A 2WB1D 1R9NA 4AJPA 3L1VA 5BPHA 1M5TA 2BKXA 3N4WA 1N5SA 2ORVA 2BBOA 2KSQA 4CKWB 1A9NB 2RI6A 1TL5A 4DMRA 3QYYA 2BFMA 3EFHA 2PTGA 3RO7A 4IWXA 1R3UA 2JA2A 2Z2YB 1N3LA 3S2YA 1KPHA 1VK3A 3INYA 4RK5A 4Q9AA 1R0AA 1D4FA 1KYYA 2EFYA 2HRDA 5KMGA 1YAHA 3QIPB 2PGNA 4A2CA 1DURA 2OPQA 3KUXA 3NH6A 1NUHA 4CCYA 1OH8A 2X8JB 4C07A 1F2TA 2A5LA 1R4ZA 2G5CA 3G68A 4CNZA 4ARSA 4FQ5A 4TM7A 3WHLA 4WQMA 1MO2A 2ZC3A 3B6BA 1C3JA 1NVXQ 3D1LA 3X2SA 2VHYA 3A1EA 2V7VA 5B55A 5ITZA 1SB9A 3L8CA 4Y6RA 1K8YB 5HCIA 1V1JA 3KVVA 4MW6A 1HE8B 2XVZA 2OLEA 5T7BA 2GK6A 5AKEA 3OJFA 2G0IA 3WX8A 1U09A 2PH7A 2WTMA 3U09A 5JANA 1SIWB 1U11A 2BOAA 2W6OA 2EFVA 1FQWA 3F6RA 3AKZA 2ZB2A 1B76A 4ILLA 2GT1A 3KKLA 3DMYA 1V25A 3CBQA 4DCGA 2LECA 3SSQA 3O47A 3HV2A 1J7JA 4EHJA 1RT2B 3GG9A 3GYGA 3GLVA 2C9CA 3B51X 1DDGA 4JJGA 1AGPA 1MABA 3V6DB 5A5FA 1I7LA 5DN6A 3UDVA 5D01A 4EW2A 4ZAXA 2C4TA 3UAVA 3L7BA 4IZHA 2VDWB 3D3JA 3D28A 3KQWA 5LXYA 3GOQA 3AY6A 4KBGA 3NDRA 2ROEA 2OFFA 3BMCB 3RAQA 2I9PA 1E1MA 4WL0A 3NWOA 1Z6PA 3DOEA 4HWKA 3HJAA 2ZKLA 3H5IA 2NZUG 3D4LA 3T94A 1N5VA 5U47A 1N0VC 1GPAA 4V3BA 2GD1O 3ETEA 3QKIA 3UA4A 4AKIA 3CLTD 2FJAB 1V7QA 2BJ1A 3HXMA 3EVFA 4D3YA 5HN0A 1SKYB 4ZVPB 3C6MA 3SKXA 2QTBA 3EPIA 4RZUA 2RSLA 5EE1A 4EMSA 4H4KC 1XDZA 3VR5A 4XVCA 5K8NA 2OXIA 2GMHA 1N8RT 2ILTA 2ZSBA 1TZBA 4ER7A 2QN9A 1R10A 3EPJA 2AQIA 4F71A 4HGQA 5JSZA 2FJUA 4WXMA 5IRCD 3V33A 2QLWA 4UW2A 2F7SA 2NZYA 3VFDA 3N6VA 1CJUA 2W01A 5DLEA 1N2CE 1ISMA 4G36A 1NY5A 3QGPA 1AGYA 1E2EA 4B1FA 2V7QD 5SY9A 3V1MA 4EG5A 1BTOA 2DKNA 2VHZA 4KO0A 1I94B 3AF6A 3ONVA 2W4QA 3I6YA 3ADDA 2UUAF 4KE6A 2QL6A 4MKGA 4GNKA 5JJBA 1U5BA 3OHPA 4WIAA 5DF1A 4M94A 2FZKB 4J9UE 3B6IA 4CTKA 3EMBA 5EJEA 5DX1A 3NTQA 4C7KA 1GMUA 4QDJA 3KNAA 5G0WA 4NDZA 2FF5A 2YNHA 2MZRA 1DEAA 4RPIA 1KQNA 4RXTA 5M2PA 2J7WA 4WXWA 1OFUA 5DBOA 1F20A 2D3TA 5DP1A 3E8XA 3BGUA 2R2UA 1T10A 1RXIA 5GVRA 1MEJA 1NIPA 2GZMA 2W58A 3ER8A 1J24A 2XZLA 2X1FA 3GCGA 3LQ4A 4KITB 3CU5A 1R6TA 5A9SB 1ZRSA 1JHMA 4WZBB 5IZCC 5K4HA 4H3KB 2QJFA 4QPJC 5CK4A 1CR1A 3FYSA 3EY4A 3Q1KA 4OXKA 2Q6VA 4RU9A 4B9UA 1S76D 2WWFA 2CYAA 3TQQA 1D9ZA 1GSHA 2ZI5A 4Y8VA 5GAGI 3NHUA 2YHUA 1Q6ZA 1B41A 2ID7A 1CR0A 3ONWA 1V16B 1OS5A 2HLDA 4YN3B 1CZUA 3VDMA 1NPPA 1MRSA 1HL6A 4ED0A 5CX4A 3N79A 3C1TA 3SKVA 3O9MA 2XLIA 1Z12A 2M6RA 3OZDA 5LQAA 3CN7A 5KVQA 2BJWA 3H1AA 2C2XA 4QOGA 1M6HA 4UTVA 4HLUC 1FC0A 2R7MA 2WHOA 4YLYA 5FFFA 2Z9BA 2ZUBA 4KC0A 2AMVA 4RAQA 1IK4A 1KY4A 5P8WA 4BATA 2F4FA 3CVYA 2VBFA 5EP3A 4DV4F 4FHDA 2PJDA 1PQYA 1IHXA 2XOXA 4Z0NA 4X64J 4AICA 3TTXA 4NXNF 3WLTA 1C9DB 2FV8A 4H17A 1K47A 3VPAA 2P9CA 4MS3A 4QG3A 4WYWA 3B1ZA 1JHQA 2DPGA 4EBEA 3C46A 1LNSA 2BUCA 3GT3A 4C87A 1P7CA 1LDMA 2WWIA 1CHNA 2NTYC 2EPIA 1DY3A 1KKUA 4WKBA 2FW9A 4MRMA 3MM5A 2P6NA 4LYFA 1WMDA 1JIHA 2KN4A 2ZJ3A 4IRMA 1E5QA 3IM9A 1X87A 3HXKA 1YRTA 2MSLA 5K5EA 1SUEA 4OJHA 3I4CA 1G6HA 3P71T 3WK8A 4YB6A 4W4MA 1KSHA 3A7EA 4EHLA 2IZOA 4LGVA 4OG2A 3EQ6A 3DLEA 1RRPA 4F4AA 1T4MA 3RH0A 3LX4A 2XCPA 5I9NA 2VN8A 1XQ9A 4IS2A 2VATA 2K6GA 3IXLA 3L6OO 3IP1A 2A0WA 4R98A 4F2DA 1NLKL 1FSGA 3QKRA 2D0IA 2Q3JA