3WIUA

Crystal structure of pro-s324a/l349a
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKIAPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Requirement of the insertion sequence for activation of Tk-subtilisin
rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 130
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3wiuA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3wiuA02
1V6CA 3VHQA 1NDQA 1TECE 4OV6A 4LVOA 1AQNA 2Z57A 1GTG1 3I30X 1SBNE 5JXJA 1AH2A 3VV2A 3GCWA 1TO1E 3H42A 3DE6X 2XRMA 2XTJP 3VV2B 2V8BA 1OYOA 4KPGA 3DW1X 1R0RE 3GCXP 4NMXB 3ZXYA 1BE8A 2Z2XA 4NE7A 4WOCA 1LW6E 1TM3E 1Y4AE 3F7MA 3EIFA 2ST1A 3DE0X 1KDVA 4K8RB 3DE7X 2P4EA 1PJ8A 2PWBA 3A3PA 1SCBA 5AMXA 1BE6A 2PRKA 1BJRE 3QFHA 1SBHA 1UBNA 3TI9A 4MZDA 4DZTA 3OSZA 1TM4E 4WOBA 1SUPA 4JP8A 4YN3B 3SICE 4BWGA 2G4VA 3HJRA 1GA6A 4AKSA 1IAVA 1T1EA 1SH7A 1GTL1 2WUVA 5B1DA 1PTKA 3PRKE 3SQOA 3BGOP 1T1IA 3LPCA 4DWWA 2DUJA 1TM5E 4I0WB 3DE4X 5ARDA 1SN7A 3AFGA 3CO0S 1ZVKA 2Z2ZA 2SECE 2GKOA 1GNSA 4GI3A 1Y9ZA 2X8JA 4H6WA 1S01A 3DDZX 1GT91 2SNIE 2W2PA 1SUBA 1THMA 3DE3X 1SVNA 3F7OA 1TM1E 1ITPA 3F49S 3WIVA 1NDUA 1S2NA 3VYVA 1MEEA 3BPSA 5K7SA 1YJAA 1KDZA 1Y3FE 4NE9A 3P5BP 3DYBA 1S02A 1NLUA 1Y1KE 1EA7A 2PMWB 3I34X 2WV7A 1Y34E 4YN3A 3BPSP 3DVSX 4OV6B 1SBIA 2W2NP 1AF4A 3CNQP 5AVKA 2PKCA 1C9NA 1BFKA 2QTWA 4KB5A 5SICE 4H6VA 1WMDA 2TECE 2PMWA 2SBTA 2WWTA 3A3OB 5FFNA 3WHIA 2Z30B 1AK9A 1SCNE 4H6XA 1GA1A 5JXIA 1SIOA 1SUAA 5AQEA 1SUDA 4Z2AA 1SELA 4NE9C 1GA4A 1HT3A 1Y4DE 4C3VA 1MPTA 1SCJB 4OMCA 5CW1A 1Q5PA 3QTLA 3EDYA 3DE2X 1A2QA 3TI7A 5FBZA 1DBIA 1TM7E 4ZOQI 2Z56B 1YJCA 5JMOA 2X8JB 4K8RA 3DW3X 2DQKA 1C9JA 3PTLA 2Z58A 1YJBA 3WQBA 1AV7A 1GCIA 2W2QA 2Z58B 1WSDA 2ZWPA 1KE1A 3GCXA 4LVNA 3H42B 5I9SA 1Y3CE 2W2QP 1TMGE 2PWAA 3Q5GA 2XTJA 5B1EA 3A3NB 1KDYA 3EE6A 3UNXA 3DVRX 3DWEX 2W2NA 5ARCA 2B6NA 1SPBP 2PYZA 4C3UA 4HVLA 4KG7A 3VSBA 3DE1X 1OYVA 5FAXA 3I2YX 1R6VA 3GCWP 3TECE 1EGQA 2W2MA 3L1KA 1YU6A 1WMFA 1C3LA 1AVTA 4NMXA 2W2MP 2HD4A 3I37X 4M1ZA 2W2PP 3DE5X 3DVQX 1T1GA 2IY9A 2SICE 1SCAA 3WIUA 1P7VA 3QMPA 1IC6A 1Y48E 1SBCA 1CSEE 1C9MA 3D43A 3CO0P 2Z2YA 1Y3BE 3D9QX 4AKTA 3LPDA 4J94A 3BX1A 1CNMA 3AJ9A 3P5BA 1ZVJA 2IXTA 1P7WA 1TK2A 3Q40A 4ZARA 5JXHA 1ST2A 1SUEA 1ST3A 3SQOP 2PQ2A 2W2OP 1Y33E 3BGOS 3VV3A 4CFZA 4CG0A 2ID4A 1VSBA 1SIUA 4OMDA 3LPAA 2ID8A 3LXUX 3VTAA 4CFYA 1V5IA 2Z57B 1WVMA 3GT3A 2HPZA 2ZRQA 1R64A 2Z2YB 1SPBS 2ZWOA 1DUIA 3AJ8A 3CNQS 4DJ5X 4HX2A 4B5LA 1SCDA 3A3NA 5ARBA 2Z30A 1P8JA 1SUCA 3GT4A 1TO2E 5AVJA 1V5IB 2W2OA 1AU9A 1SIBE 1XF1A 1PFGA 4RYDA 2E1PA 1SCJA 3T41A 4FONA 1PEKE 1OT5A 1KE2A 1BH6A 2QTWB 3A3PB 5JXGA 1GTJ1 1JEAA 2WUWE 1Y3DE 3A3OA 1GNVA 2DP4E 1WMEA 2Z56A 3ZXXA 1SBTA 1BFUA
chains in the Genus database with same CATH superfamily
3JQRA 1M1XB 4C4SA 4OV6A 5BQOA 1CF4A 4MK7A 1TB4A 1ZK3A 4CLDA 2J6CA 4IYJA 3KT8A 4FNAA 3HJBA 4PVCA 2MLYA 3TEMA 1YZKA 1X1SA 4IHJB 1M2VA 3TCXB 4FVCA 1UIRA 4AG6A 1ORRA 2IXDA 1UXJA 2PT9A 1P5FA 3ADKA 4Q7AA 4ZQBA 4I55F 1M1NA 4ZZ3A 1PI3A 2J0WA 5CT4A 2FLVA 4DAOA 3CLSD 3MS7A 3HYCA 2IE0A 3SKVA 2OPRB 3RWBA 2RH3A 2WBMA 1M0TA 5IUNC 3MPYA 3I9NA 3PYGA 4YJ2B 1NAQA 4GIBA 5A0TA 3U16A 5ALPA 2IS6A 1XTJA 3LG2A 1PKUA 1T7PA 5LZ9A 3THYB 4JDPA 3MGJA 1JX4A 1QSLA 1SJ9A 3UK6A 1HLGA 1EDBA 3V7UA 1PRYA 5DHQA 4Y7CA 4H4EA 1JT9A 4EJMA 2AGQA 1UXKA 2XX3A 1RWOA 4I2VA 5CUQA 1RAAA 2BGGA 5KSZA 1LSSA 2NXNA 2CDRA 3JQBA 4TTPA 1T2DA 4YRSA 3SPXA 2C7RA 4ENRA 4AL7A 4RMNA 4UU7A 1IN1A 2DNNA 2JJMA 2GQCA 3WDMA 2ACEA 4JCCA 4D9BA 2Z95A 4W9MC 1RI3A 3THYA 3E3OA 3I53A 3EDRB 2QT0A 5ALUA 2D1CA 4PAGA 3UOGA 4FCTA 2VA3A 1XDGA 3P9KA 3H4MA 1R4ZA 2VF7A 3G5MA 4EB8A 4LF4J 4YN3A 1ZK1A 5ESWA 3GMGA 2BW0A 2OHXA 2OP0A 1NMYA 3AOBA 4PHCA 3NT5A 3PGMA 3RK0A 4RTQA 1ZD3A 4AD8A 1PT9A 3MM4A 2ZT5A 3QVXA 4HHEA 2PMHA 3G79A 1LDNA 3N6XA 4RD2A 4PG6A 3L7IA 2APOA 3NUGA 5C46F 1M1UA 3OFEA 1Z1ZA 2X1FA 3B9BA 4UVGA 1UT5A 1RBMA 5HF5A 1GX5A 2HB6A 5AQEA 1VLJA 4DJEC 1VRVA 4NE9C 1C7QA 4ARSA 3OJLA 4E31A 1MPTA 1SQFA 2HNAA 3ZGNA 2HLTA 4PICA 3FNRA 4BPBA 3H17A 4BP9A 4QBIA 5ETJA 1JF8A 1ZOSA 4CQNA 3GJYA 1F9FA 4CLKA 4BB9A 3QUCA 4ZVEA 1JFLA 2ZS8A 1TYEB 1YR9A 2RSLA 1N8NA 2ZBQA 1MRSA 3R6LA 1EDDA 1R0SA 1XP8A 3VVLA 2J59A 5CYMA 2MZSA 5CDTA 3OLYA 4K9RA 2QB5A 2P62A 2VP5A 9ATCA 4MYHA 4N01A 2GLXA 4D4GA 4AMZA 3IXMA 3HSSA 2BGIA 1CUJA 4OM8A 1T2VA 3P96A 2B1IA 4ZHSA 3UJCA 1Z4NA 3ZDQA 4QFCA 3HVKA 3LUGA 3DZIA 1RBAA 3BE4A 7REQA 5LLTA 2NO1A 1NJ2A 3GQBA 2HPUA 1L7MA 5JZOA 3OOHA 3L09A 1THGA 4QDXA 1P61B 2J7PD 1E2JA 1T10A 1MJFA 1QYWA 2CMFA 2HZBA 2BN4A 1FDWA 5CYFA 2PD6A 4WCVA 1NBMA 1U28C 3AL3A 3LUHA 3KHRA 3LM8A 2GKGA 3IRXB 1G2OA 1NHUA 1UXOA 2Q28A 1GNTA 1O9GA 2WAOA 3TPCA 4YOEA 5JPCA 3W7BA 4MK9A 4Z9BA 1HORA 4FZRA 2OMKA 2EFVA 4YX9A 3RC8A 2Z57B 3QYPA 3FPGA 1U0HA 4ZHRB 1O95D 2FQQA 4UNSA 3R7BB 3U9LA 1HC7A 4JP3A 4DRXB 1U2DA 5A6SA 4PNPA 1I2DA 3IE1A 4PWZA 1Z29A 1JLMA 5BQ3A 2FEMA 3E7FA 1PJ7A 4ZCMA 3LWBA 1JXQA 2NACA 1SL1A 1S1TA 4N8DA 1YONA 3L8FA 2GA8A 4HNVA 5DQIA 3GWCA 5E7OB 4DJTA 1KPIA 3B9QA 1E66A 3OLWA 2FB0A 2PLFA 4G0UA 1N2CA 3H2ZA 1OUMA 3ROTA 4BO3A 2W9BB 2SXLA 2YZNA 4RELA 3PTZA 3NGSA 1XZJA 2XQVA 5EE3A 4LF6F 3AVOA 2E48A 1XVTA 5TF4A 2JCYA 3GJSA 2P8SA 2HU2A 4MQBA 5IDYA 2O8DA 5G41A 2HWWA 3HYRA 1CYEA 4Q66C 2CHUA 4WLVA 4CLXA 3S40A 2F2TA 3SHWA 3DOHA 2MGZB 5AVSA 2GEDA 3DO8A 2IS1A 2VPZB 4K4TA 3H90A 3PA6A 4MKVA 4BLRA 1BW9A 1JR2A 4DJDC 2IBTA 4P3PA 5L3ZA 2A30A 3VTIA 2X77A 4H31A 4A8SA 4MP8A 4P4SA 1G5QA 4HH4A 3LT5A 2Z9DA 1U8XX 4ZRDA 3K30A 2DXFA 1ZGHA 2CAJA 1Q8IA 2CK3A 5A8KB 5CH8A 4EQ6B 4Q1CA 1QRAA 1XA0A 2BE7A 2ATLA 2DFLA 3IM9A 4CJXA 1ZJZA 3D4LA 2FZ5A 1ZZNA 2CUKA 2LIVA 4IINA 5DGDA 5JT1A 2P4QA 2NYRA 2E5LJ 3JQPA 1DLOA 1RCUA 3B6KA 3WHPA 1FA0A 2JFUA 1QIDA 5F1KA 2YIVX 3GZ4A 1X8JA 5DH9A 5P21A 3CJ8A 4QGFA 2ZD1B 1H2ZA 3CWZA 1TKTA 3STWA 1DTQA 3DOCA 2GKOA 3VH1A 2GJ8A 1GLVA 1BA3A 3TF5A 4KHRA 5DTMA 3BR8A 1KEZA 2KI2A 1D9AA 1I3CA 5C7OO 3T0IA 1KR2A 3WP0A 3LIPA 1TTHB 1EVEA 3G85A 3M05A 1XA3A 3N9IA 2PMBA 1K7CA 3ZTOA 5IAKA 2DHAA 1RWNA 1NK6A 4O3NA 3MAAC 1MJHA 2R6HA 1XU9A 3QRWA 2E1CA 3M32B 2A5FA 3GZ7A 2WMOB 5B7PA 5LD2B 5DLFA 1E1DA 2FJ0A 1P7ZA 1Z4LA 1G3UA 3PJFA 4AECA 5T4FA 2FSVC 4BWVA 3RRYA 3RFTA 4CLUA 1EUDB 1X5SA 4YMHA 3HUDA 4WX2B 2DHCA 1NVVR 3I1YA 3P9PA 1Z12A 3PZPA 2E29A 3N86A 3BC1A 1J2RA 4UOZA 1E1NA 1N5DA 1E3EA 3E8MA 3MW8A 4HH3C 2VT2A 2CHFA 2ONYA 5ECDA 5HWSA 2DGUA 1Y1TA 2A0XA 3CISA 4Y1RA 2CSUA 5KSPA 1S0VA 5CDUA 4TVAB 3R0JA 5KG1A 3TW4A 1KYYA 4JB0A 4JEHA 3B7PA 3LGXA 1B16A 5F8LA 3VH2A 3PZBA 2IUUA 3SDEB 2R4QA 5FBHA 1DRUA 1GXSA 3UWOA 5AM2A 4G0QA 3H7AA 4TN2A 1G4AE 2AC7A 5M34A 1FB5A 5IWCA 2KZMA 1RAEB 3IIJA 4WA7A 1X0VA 1QAMA 2QAIA 2DFDA 3LFUA 1DCTA 4YUDA 1P4HA 3B1JA 1WQ1R 2Q29A 1RAIB 2OBNA 1Y0HA 5ARCA 2YNGA 5CVEA 2AIRB 4OHUA 1H9CA 4DPYA 4B3SJ 3I9KA 2HSGA 3GFQA 1FMCA 4E4RA 3CVJA 4NENB 3ZJ4A 5P8WA 3EUEA 4OHCA 4B76A 4EWLA 4IKOA 3FWPA 4A8JA 3Q1KA 1CTQA 1U4NA 4R9VA 1BEZA 3H8SA 2RGXA 1X9IA 4RA6B 3OJ0A 1AHNA 4ADSG 3JTOA 4TN1A 4RLEA 2XSFA 4Q3BA 1UK8A 3CSSA 4DWVA 5C35A 4QSHA 2NSBA 1IB0A 5PGMA 1AUQA 1UJCA 5L4NA 1AXEA 4C30A 2WWWA 1SIUA 3M2VB 2VTDA 4IVQA 4P7VA 1I10A 3CEDA 3IPRA 3GT3A 3H86A 5CHEA 1E7MA 3NHRA 3HB9A 1J5OB 4ILRA 6REQA 3HU2A 2Z9BA 4PNHA 2BGTA 4EQ6A 1YCFA 3OLBA 2HDNB 2PUJA 3GC6A 5JY6A 4A7PA 3VVUA 3HR8A 3HU1A 4F21A 3FQLA 1TUIA 3PT9A 1JL3A 3O7MA 4C03A 4CNBA 2G8NA 1WY7A 1N3YA 1KK0A 5FUYA 4F2GA 2XT0A 4X3PA 2VUIB 2B5OA 2HGSA 2HKIA 2JGKA 1I2BA 3R3TA 5AW0A 2CQ1A 2KM8C 1R0LA 1HQ2A 4P53A 3DOIA 3A1DA 4UDOA 5J40A 5D15A 5I8WA 2NXWA 3DCAA 5IJ9B 3UJAA 5F8JA 4S04A 3TQRA 4KQGA 3UB2A 4FR5A 2QLXA 1GPDG 4DYVA 2ROQA 2DEUA 2H11A 3QNUA 2XB2A 2DG2A 1TKBA 4YCSA 3QQPA 2JI8A 3TVZA 5FYDA 2IPMA 3AIMA 3KJFB 1LB1B 1VHWA 5ABPA 4E2XA 2B1QA 5GAEI 3NETA 3D8SA 3KMQA 2VWGA 1SVMA 4XIJA 3DDHA 3RSZA 1N2EA 3NAIA 3T9EA 3L77A 5F12A 3WDOA 4RHEA 1DLIA 1WBJB 2X3YA 1ZGGA 3A9WA 2BGKA 2A86A 5KOJA 1T4BA 1HWIA 2COEA 1DX6A 1HYGA 2ZFUA 4R8LA 3D28A 1MIHA 3EF3A 1FRIA 5FPYA 4YEDA 2HVDA 1GNQA 3I4PA 4I66A 5DJ5A 2F3QA 3ZZOA 2B37A 2E4WA 3U5ZB 1WSBA 4LIRA 1P44A 4B2LA 4UE3S 4G3IA 4FW9A 1NB7A 4RF5A 2PKWA 3SC6A 3QUQA 3WMXA 4DCJA 2D3WA 2CLSA 2PEYA 1BQ4A 3ZC4A 2EP5A 2G2YA 1KZ9A 3HF5A 2DPGA 3KXKA 4C9BA 4DMZA 3BDIA 1JGTA 2QTCA 1WXQA 2OG1A 3ZI4A 4U7CA 1UKAA 2BW7A 5D51S 2PIIA 3V8EA 3OE1A 3QI7A 2DU8A 4HY3A 2WSMA 4M8SA 5A6SB 4FFDA 4FE7A 4ETZA 4FXPA 4F85A 1MG0A 4TSRA 3GK3A 5HM8A 3I34X 3UB3A 2W00A 2WOOA 5DMXA 4H7EA 5IAGA 4IJKA 3F67A 1Q1BA 3PEUA 4UULA 1DKPA 4OV6B 2VP4A 2IHUA 2NO5A 4MQFB 3DM5A 4HAXA 1HBNA 1CRPA 3KQLA 3CNQP 4HADA 5AVKA 4WA8A 2RHLA 5B6JA 4N5SA 4URYR 4QTXA 2QMYA 3WGJA 1WHVA 4HWKA 4ZICA 4NAVA 4TOIA 1KAEA 2TECE 3RYCA 3G2PA 1E63A 2L48A 2D1SA 1C0UA 1K6JA 1KH1A 1JV2B 4EKIA 1OI2A 4WN9A 1ODTC 2CQ0A 1KSHA 2C8KA 1UCNA 1PL0A 2DUWA 5KYXB 4IJMA 5FT9A 2OTJS 4X95A 1T3GA 3Q7EA 1R4NA 1MA0A 4NWIA 1S0UA 2NO0A 4WFAQ 3HRKA 5HF8A 3DEHA 4XFDA 2OK8A 3R9XA 3A6HA 4M5DB 5EHNA 3RODA 3NS7A 3CVYA 1KRPA 3P0HA 2IU3A 4D0NA 3GD7A 2A78A 1ICEA 1LFWA 2MINA 1A69A 1U25A 3R3UA 4RABA 4EABA 3POTB 4ZOLF 3GCXA 3QVWA 5E6RA 5HL7Q 4ZXFA 3I2GA 3STXA 4MIKA 2YRFA 1DBPA 5AW7A 1ZXBA 1WI8A 2JGIA 2BBEA 4M5DA 3O93A 5TIIA 2IDKA 3ORRA 4PZLA 3OFKA 4D0SA 2WKQA 2HIAA 1QKJA 3KVYA 4RAOA 1W2BR 1C1BA 4R2MA 4LFAF 1VIOA 1FXWA 4QOHA 1D9ZA 3U3XA 1JPUA 1QSGA 1XL1A 5F8MA 1K92A 4N7MA 2RKWA 3DVQX 1CUDA 2DMRA 2GK4A 2O2EA 1QU3A 2U1AA 1FP6A 1QGOA 3ICCA 3FPBA 5DG9A 1W76A 1TUGB 2GA9A 3N07A 4ZV9A 3D6MA 4ZEXA 3PEYA 1MPXA 1UBMS 4YRIA 1C4AA 4BNLA 4EG4A 4CF7A 1JXAA 2F17A 4YHHB 1SHJA 1X80A 3VNRA 3KQQA 3PFEA 3MGBA 2J32A 2AX4A 2MKHA 2WVFA 4R4JA 3EDQB 4B3RJ 1D1QA 4BU0A 3B1XA 2CLCX 5DGTA 1UP7A 3PW4A 5FD1A 3WO0A 3F0NA 1H6KX 4EY4A 1A97A 1I94J 3EIOA 1FS5A 1NOKA 3O1IC 4LF8J 2P9HA 3A6KA 3HNRA 3T7SA 4UUBA 3KYDB 4F4AA 3O3NB 1PG2A 5G0VA 1Q0SA 2FZLA 3C45A 1W581 1BGVA 1JTVA 1GHTA 2FPIA 2IIHA 4FWIB 5FWYA 3HJNA 3V4FA 3OICA 1B1CA 3RDPA 5DCUA 4CEHB 4XI9A 4LOLA 2UZ4A 1RRCA 4EY3A 1FCAA 2QJOA 3PKZA 3PRJA 2B3TA 2C83A 2AJ2A 3UUFA 2PUAA 2H0AA 3PJGA 3OQJA 5IFKA 5AYVA 2DK2A 2I91A 4WXMA 3EB9A 2BM9A 2BE9A 1Q50A 1LEHA 1CIPA 4YFYA 3GWZA 3CT6A 2DT5A 3CJQA 4ZMMA 2NZ8A 4GKKJ 3PG9A 5JATA 5KVVA 5FLEX 2K7JA 3IHLA 4LF9J 1T9WA 3LUCA 1JSZA 2L0XA 3P2OA 1A9OA 3BSWA 4BAGA 1Z38A 1CULA 4RPHA 3FUYA 4RD6A 1PK7A 1IM6A 1QJ4A 5LXRA 3KMSA 2ERXA 3VKGA 1H2XA 1Q7RA 5LYJA 2I0XA 2QXTA 4F5YA 3H6HA 1LLDA 5JMWA 1JKFA 1VL6A 2C97A 3ZQ4A 4UM9B 5KU1A 4N40A 1DWPA 3KJHA 2XD9A 3Q8KA 3JTEA 2XAUA 3Q8PB 3H8WA 2LZ0A 3QEJA 4BECA 1VBKA 1WXWA 4KGDA 3BM7A 2FX2A 3FPEA 4MW6A 1GIAA 1U26A 3KTAA 2E9RX 3Q6NA 4MICA 3RFCA 1FNBA 3TQCA 4KQHA 1NXSA 3KXPA 4U8GA 3E5MA 4CT8A 3HB4X 2Q1SA 2SNIE 3FBCA 4EF5A 2UUWA 5B0FA 2XZWA 3BZWA 3WB2A 3NIBA 4BKRA 5JZMA 3J7TA 4L50A 3UN3A 1CQZA 1N8TA 1WEZA 1PNOA 3WYDA 1T34A 1V11B 4DIOA 3SHQA 3HBFA 2H1CA 1DQYA 1R8JA 4IWNA 4RIIA 3ZTSA 4HOYA 1FDDA 4B6JA 1ULRA 3T5KA 1U0NA 3N76A 2RDIA 1HTTA 3PSAA 1FKPB 1H8EA 3R9KA 4YMTA 1Y8RA 3PPVA 3ZEIA 5CT8A 3AM4A 5GINE 5AHOA 1X1QA 2G08A 4Z51A 1KS2A 1U4OA 2JFVA 2OCBA 4MIEA 3V1YA 2OYRA 2H1SA 3V3TA 5ALIA 5IN4A 4JROA 2I9KA 1ZR2A 5JXIA 5AI4A 5HFJA 2YNFB 3QPUA 3ZCVA 2FLOA 4DQRA 1NUTA 4KWIA 1S1UA 4AT1B 3KR0A 2VHCA 2EL7A 1Y4DE 1HNXB 1RM0A 4TU9A 3TSYA 3AI3A 3NRCA 4R9UC 2ZG6A 3HVIA 1UT8A 3CX8A 1V6HA 2JC3A 2JI6A 1U7TA 2Z3WA 2H5LA 3ZLVA 3BFVA 3VR5A 1KP2A 2C1EB 1AM4D 4GM4A 3ZTQA 4KL8S 3G82A 3IUSA 2AWOA 2AQ4A 1MO3A 1GPJA 4N6NA 1JZQA 4Y6LA 5BQXA 3CVOA 3SR3A 3NL0A 4LBHA 2JX2A 4BLVA 3HJAA 5FAKA 1JHYA 3TDKA 1B3RA 2PE5A 1JDBC 2ZDQA 5AJWA 2OMEA 4BP8A 3AZQA 3D5EA 3W3AA 3V6KA 1QWSA 4FZ5A 2M9MA 1QYVA 2FPWA 1YO6A 5H9FJ 3RYFA 1I0ZA 1XNRJ 3CW2C 2V0NA 2XDQA 3EISA 5SY4A 3FWYA 3VPGA 4YJ3B 3K09A 2AW5A 1EVLA 1R5NA 3BBLA 3PNMA 1N0VC 5JQGF 5JS2A 3WVNA 5FUBA 4RDHA 4O4LF 1XJ0A 3PDNA 2QLMA 3HXTA 4PS0A 4RVFA 3SIPA 4YA6A 2AQHA 4MYTA 1US8A 1T95A 1RKXA 1EM6A 5HP1A 1E5TA 4CLOB 1KEWA 2GFIA 2BBTA 4D1YA 2K3KA 1PVVA 3DXYA 5LJ3Y 3I9LA 2B9VA 3NWJA 3BFKA 5K01A 3VV3A 4Y2AA 4OIMA 4ZZIA 4K1XA 1QB8A 4WTYA 2GRJA 3UHFA 1JKHB 2X4GA 2H65B 5CXTA 3I8XA 3PNKA 1SOUA 2Q1YA 4FS8A 4MW9A 1K27A 3HO6A 1U5AA 5JYBA 4PC6A 1OFGA 3AO0B 2Q5IA 4EK9A 1YHZA 4ZI3A 4LF2A 2HXYA 3Q0EA 3ZZ1A 2OV6A 1QE1A 3OPYA 3PKJA 2J1LA 4K9KA 5GTDA 3NBFA 4G5XA 1O08A 3R0IA 1RLMA 1E6VB 2WNHA 3SI8A 2UVRA 4X0EA 4DOZA 1RKQA 1UDAA 2Y1LB 1M2VB 2F4FA 1NQAO 1U3WA 3R5JA 3GR1A 1XR3A 2UXDF 2XMWA 1L6RA 3SFGA 2IYQA 5EHZA 3PACA 2ZC4A 5EJ8A 4LVOA 4OQXA 4OXQA 1M6VB 4B0PA 4LV6A 5LBUA 1GNPA 2NTEA 4W7SA 3VKUA 1MJNA 3UDCA 2WVBA 1OPXA 4JI4J 4G37A 2R9LA 3OEHA 3PXAA 3HFJA 3UJDA 4AUMA 1PEDA 5EZYF 5KO2A 4LDQA 1N5IA 4G1QA 2PT5A 4A8JB 3T3MB 2HK6A 3W2VB 1Z15A 3BMXA 2BIFA 2XA2A 2B8EA 3PPIA 5JSZB 1MAUA 4CCYA 2A7XA 3EZXA 4BBZA 1GPYA 4ICIA 1V1MA 2NSHA 3KZXA 4E5UA 1RC8A 4HVZA 4URQU 1QONA 1ZX1A 1UP1A 5DCWA 3FB1A 3X3UA 2WC1A 1SY7A 4UTVA 1FVXA 4MDHA 5C52B 4E1BA 4L85A 1GRQA 3T94A 4MW1A 1TFYA 5IDWA 4Q1VA 3ZHCA 5AXBA 4DVGA 3A4NA 3DMJB 3GNQA 3PX4A 4IOMA 2F4VJ 2G0IA 4L5BA 4HYTA 4NAUA 1I1OA 3DXZA 3BREA 4V3CA 1GXSB 3C3XA 1APSA 4DRZA 1Z16A 3FYHA 1ABFA 2Z4SA 1RZMA 2YKGA 4PYDA 2NZ2A 3T6BA 3PFGA 3N8KA 3VM6A 1BX3A 2PAAA 1U1PA 4R1SA 2WWVD 4N7JA 2AFIB 1IHYA 2R48A 4X61A 3IP9A 1U6IA 4U2EA 3LQRA 1RAAB 1ODFA 4U7PB 3THWA 3F5SA 4J9SA 4ZJYA 2X7JA 3F56A 5FWNA 1M5RA 1DU4A 2XB8A 4F1JA 4UMDA 3CE6A 1YV9A 3FR8A 1M1KT 1NT4A 1J23A 1DMSA 3WHIA 3AXMA 1KAMA 1H5QA 3B7WA 3MMPA 1U2GC 2CNOA 4BVFA 5K3AA 2AOUB 5E4YA 1UOPA 3B6IA 3FSEA 5K3FA 1A04A 2EXUA 2QM8A 2TYSB 5T3YA 3VR4D 3AEKA 3Q3CA 5LPNA 2ZI6A 4OXXA 3PO5A 3A28A 3CCES 1BOOA 2WSSD 3O8BA 1SCKA 3SSRA 2XYGA 1F48A 2ZXFA 4RJVA 3FN4A 4FMDF 4W5HA 4YRGA 1TAGA 4MWEA 2UUAB 5JJLA 2IHBA 4JT2A 1EB8A 1B3TA 3NNSA 2B4VA 2QRKA 3SBOA 1NM5A 1JH9A 4JJ8A 4MKHA 3KDNA 1JHQA 5LYJB 3D7SB 3TNDA 2XQCA 5FR1A 1GYRA 3LAWA 3OFNA 5DTJA 2ZUWA 4OP2A 1XMOF 1FW6A 4F0HA 3H99A 1VE6A 3QVUA 2Y1XA 4IW3B 2IHZA 3REQA 2WHPB 1CZNA 1H0RA 2FOLA 2G4CA 3OZVA 1TVRB 1KKHA 4RMGA 3G1UA 4CR7A 1KKUA 2Q5QA 1W93A 2PKRA 4LY0A 3HDTA 1OV4A 2UV8A 2QYHA 1JEYA 1FF2A 2HMVA 4J0KA 4DV7B 1DEKA 3BHIA 3DNPA 1G5RA 1HLPA 2JFNA 5KIAA 3G2HA 2GVNA 3D6AA 3R5HA 1E9VA 1ZAVA 1NMQA 1WWHA 3TJRA 4XCQA 2BGLA 4ODIA 3L8CA 2FWAA 2D3UA 3CCMS 5KJ6A 1WNEA 4Q7MB 4D0GA 4BFXA 1VYHA 3MJCA 3E61A 3Q3JB 3IDFA 1KEKA 1GYQA 4OQEA 5KDLA 3BFXA 2RHDA 1V4NA 2K7FA 4K81B 3LHDA 3PFWO 2YWBA 2PCJA 3WGOA 3T12A 1XWIA 3QKUA 4IS2A 1SEPA 2B8TA 3CZRA 5GAHU 4HWSA 1B6GA 1NV9A 2Q45A 3QW4B 2IE8A 3ZXXA 4F2PA 2IIQA 4HQ0A 4M7PA 4TWIA 4LXYA 3NWPA 4Q2LA 1QHEA 4OHKA 3OL9A 2DBQA 1UVLA 4FS2A 4EYSA 5E8RA 5HW0A 3PRHA 1ZDMA 2JL9A 1CUGA 3FOBA 2OAUA 4HL9A 1CJUB 1XTUA 1KNQA 5FYQA 3ND5A 1DG3A 3AIOA 4OB8A 4G1VA 3HU3A 4CKCA 4J1SA 4CTKA 5KBYA 3EIQA 4WXYB 4BMZA 3UT0A 4KXXA 3A1SA 3E84A 1VK3A 3M9LA 2MTBA 3Q7RA 2LQ5A 3NAGA 1Q81T 3I0SA 2HXSA 4ERNA 1Y8ZA 1JJBA 3VAGA 4ARCA 4PYRA 1S6QA 3M8QA 1SPXA 4A8PA 4A2QA 1HE1C 1ZGJA 1JT2A 1WIWA 1PHRA 4E94A 1JDVA 3NP5A 4ZVRA 3EXYA 1A7KA 4R1PA 1XGKA 4XSGA 1OGJA 4YP9A 3I0SB 2J3HA 4ND2A 2XM3A 1EFKA 5IKXA 3P2KA 4DR5B 2WJGA 2Q4TA 1HOXA 1EXMA 2R6AA 1LWCA 3BXFA 5HQ3B 5ARDA 1SN7A 3AK4A 3OZWA 1OBHA 1U3GA 2ZYDA 1F14A 2J9FA 4M0CA 3NOCA 5C1OA 1MENA 4FN4A 1L7RA 3OFSA 1MOZA 4E5SA 2Q62A 2GVDB 3E35A 1H42A 2AV5A 3IJPA 3OQ1A 4ZI7B 1UK6A 4UQTA 2A9JA 2H2AA 2P40A 1L8LA 1UXIA 4A2WA 3EAGA 4YQZA 5AXLA 2LVWA 2WU0A 1B0AA 3CRNA 2PBFA 3TRJA 5GZ3A 2E5JA 3RK4A 2YRXA 2WCXA 3MF4A 3U7RA 2C2KB 4FYXA 5IDQA 4DPOA 1JH8A 2DUMA 1EEHA 3WGGA 2CG4A 1C3VA 4LVNP 3KEOA 3H4IA 2GJ9A 5C1IA 1QY7A 1B8OA 4LF7J 2CJFA 4RANA 5JNLA 3F8SA 1S2OA 1S0OA 5LJIA 3ZWKA 4DA9A 2UXDJ 1RLCL 2PPLA 3V48A 1GGKA 1T8UA 5DX1A 1GPMA 2QQFA 4YDXA 2J46A 2DNRA 3FWKA 1EP1B 1UFKA 3U44B 5D3ZA 1O03A 4PZVA 3MELA 4RDIA 4IX9A 3ONVA 3KG4A 1AN9A 1SCUA 1F7UA 2QZZA 3C41J 4AICA 3E8SA 3PQ4A 3JQBC 2AIRA 3CDBA 3WIBA 3T3HA 3K9BA 3I6MA 4BXOA 3I8SA 3W2WB 2HPHA 1MB9A 4BIIA 5DPMA 2RRAA 4E1AA 4DQ0A 1CJTA 4DCMA 4LCBA 1RC1A 3IQZA 4NPOA 1Y81A 1KJ8A 4I7EA 2GM3A 2BEVA 1GAQA 5DIFA 1A27A 3NNNA 3VI3B 1UBLS 1QTNB 1OIVA 2QE7A 2E4XA 3QVJA 2FHOB 4UJ3A 1KZHA 3IS3A 3UNXA 5FADA 3B6EA 1ZU5A 1XO1A 4HZUA 1PE0A 4HUJA 2R11A 3JQAB 1FQKA 4MUHA 3UUGA 1VQPS 2QTFA 1E3QA 1L3KA 3F6PA 3MF5A 2GK3A 2PA3A 3EF1A 2AJ1A 2W2MA 2CZQA 1AA9A 3OZAA 4KVZA 4DCOB 4BY9E 4YRCA 4BNTA 1U3DA 2VASA 4B3TF 5A7FA 1SZCA 1MX1A 1EFUA 2HUPA 3DMNA 3K8QA 2IH5A 3RJTA 3C16A 2QTVA 3I3SR 4Z0HO 1B43A 3PVZA 1G5FA 3L4BA 3C16C 3K20A 3TJZA 2X6RA 3OJUA 1JPJA 3ENZA 4X4NA 1OC2A 2QRZA 1YGYA 4TRNA 4HLQB 4EPTA 3ZHBA 1BKYA 4EUKA 4RVOA 5L45A 4UTXA 4S3MA 1NTRA 3SQNA 1XKLA 3KLOA 2GPJA 1FEZA 1FYFA 5FOTA 3R7WA 3GJ3A 1R64A 4MDYA 3ZLBA 4MGIR 4JWTA 3FKJA 4YV0A 3CDAA 4RBVA 1S77D 4P3KA 4A36A 3PDJA 2R8YA 2IKSA 1OMSA 3CC4S 3RYIB 1A9QA 1CJTC 2YWDA 1R7RA 4K8OA 4W90B 3UVEA 4PZDA 2CF6A 4R6WA 1RYZA 3K57A 3QE2A 3ADDA 2QQEA 3NVKI 3PQEA 2P6SA 3BA6A 1XNQJ 2H4HA 4KMMA 3DOMA 3UFCX 3RU2A 4UTOA 2FDCA 1IRIA 8AT1B 2ZUEA 1GFSA 2V58A 3H2SA 3VDXA 2O3DA 3K1TA 2ONJA 1SWVA 1XTVA 3HCPA 5IBCA 1QRUA 4CO4A 3UAOA 4QASA 3ZLTA 3GFZA 4NL4H 2CVEA 5K3CA 2FWNA 2YV4A 3TLGA 3GCZA 1NNUA 1ONSA 5HMZA 5EJGA 4LNAA 3LX5A 2O05A 4PAAA 1R0RE 3NDIA 3ZHOA 3MJFA 4L72A 1IVYA 1YIOA 4FOLA 3PFIA 3AIIA 4INOA 1JJHA 1A5TA 2UUAF 5BSWA 4U2DA 4PSCA 1WC4A 2FK8A 3WYAA 3M6VA 4P93A 4ZPAA 1WU8A 1VJRA 1NP6A 1ZA2A 3THPA 5TVGA 2KU7A 3AF1A 5ALWA 3OETA 2QYSA 1UBNA 1VLMA 2DLCX 2WUGA 3CJ4A 1IM5A 1WP4A 1UPFA 4Y2GA 3TQSA 5EEHA 1YE5A 1FLAA 3RKSA 3PNBA 3N8IA 3FTCA 3UAVA 1B0TA 2GHWA 4KLCA 3DLGA 2I5PO 1R6YA 1AJEA 4HV4A 2E66A 3KV1A 5ECGC 3GLIA 2D2FA 3U4IA 1FSFA 4B9EA 1QX4A 1IXRC 1FFBA 4DMMA 2OBXA 4RK0A 1FU7A 1A2BA 1DNPA 3DBLB 1KOFA 2GD2A 1SB9A 2VXYA 4D97A 2PH1A 3OX4A 1ESNA 5CA0F 5KMGA 4Q3NA 2LDXA 3HTXA 5EQDA 4DIDA 3N2EA 4UKDA 4U7UD 2E4AA 2G09A 2XMAA 5A7HA 3GJSB 3PA8A 2HQ3A 1NX9A 4KYUA 4PZEA 1KC1A 4EUVA 4YUWA 3SXUB 1PBTA 5GGXA 4P58A 3UFBA 2H2WA 1X77A 3OX1A 4EOGA 3X43A 1XTKA 3G7UA 3KPYA 1KJZA 1ID8A 5HNKA 3R97A 3PFCA 3T9CA 5D00A 4DR4J 5E4JA 1JP7A 5F8IA 2VKQA 4ZCKA 2GCGA 2V8OA 3VZRA 2CJYA 1D8YA 3Q3IA 2HU5A 1B8PA 4IMJB 3M8WA 2IX9A 2X2EA 1AXQA 3TE6A 1OWMA 5FFNA 4A92A 3M1IA 1W9HA 4KQIA 3P20A 1RA7A 4K5SA 2ZYTX 3CO9A 4DIBA 4BE9A 3IE2A 3KSDO 3GZJA 1SOAA 4OHOA 4BC7A 2GNKA 4Y1EA 3UA3A 2F3UA 1SCJB 1W19A 1MIOB 1IN4A 1WMAA 1UZLA 1WDWB 2HVZA 3CD7A 4LJAA 1IY1A 3KLGA 2IXGA 3KCNA 3CB4A 1YJCA 1DTQB 2BHLA 2C4MA 1MTZA 2VBXA 4B74A 1IONA 2V4QA 2VZEA 1WKLA 2ZRJA 1T3ZA 2B9XA 2Q3EA 2JGDA 2OGWA 3MM5A 5CB8A 3RHTA 5BVHA 3GIMA 3DTYA 2QLFA 1CLUA 3ZD9A 4FGWA 3H5IA 3GRUA 4GMXA 1VGVA 1EQAA 3MPUB 4RKWA 4YP3A 3MCVA 4KXWA 4RKUC 2DJIA 1I32A 3QU7A 5AJXA 1K89A 5BR8J 4F8YA 1IM2A 1LW0B 1BN6A 2Q7DA 5HQ3A 2J48A 3DFUA 1LVUA 3PKIA 4DV5B 4XWWA 3D0IE 4USWA 1PGQA 5J2PA 2HD4A 2BJWA 4EPWA 3H87A 2JFZA 2ZTHA 1FRVA 2P9JA 3V8PA 1EUCA 4YR3A 1CS0A 4FDTA 2I34A 3WQSB 2WMDA 1SJFA 3N2NA 3ND8A 4F6LA 2A2CA 3GV7B 1JWWA 2OXFA 1R0CB 5E4FA 3WWPA 2FPGA 4BWJA 4NI5A 3Q10A 1S6PA 5DM60 1GD1O 3FI0A 2Q1TA 4V1CB 3AETB 1VC5A 3UE2A 4MGEA 1TYAE 3T9DA 2HC9A 2Q9AA 2NXCA 1YQHA 4U6NA 5HK9A 3O2QB 4G1CA 2JH3A 3WLRA 2WTAA 3AY7A 1H4VB 2E1MC 3ENVA 3R6WA 2ZE2B 4CL8A 3D6MB 4MGZR 5HEKA 1XRPA 2OHDA 3RJZA 1SJQA 2Z0MA 3EX7B 3RU9A 4IL5A 1DTWB 3ZWPA 1ZZFA 2P27A 5DMHA 1UEJA 4PINA 3EK2A 4F4ZA 1ECCA 2YASA 4LF5J 3B9PA 3K6KA 3VTKA 1G6Q1 3KUXA 4EA7A 4FONA 1CR4A 4CLOA 5I7SA 1ATZA 4A0SA 5EJ4A 1ZIXA 2RK6A 5A9RA 1NBME 2Z2MA 4K9PA 2AWNA 1RPAA 4YROA 5IZ4A 3ELDA 5TRTA 3ND7A 3MNFA 1XYVA 1HKHA 1E9AA 2GQ0A 5B1SA 4GKJJ 1YCGA 4ICLA 1YRLA 2Y0CA 1GTG1 4GMKA 3O5TB 1BNCA 3L6UA 4W5JA 5C4MA 4ES2A 4ZEWA 1G2EA 2HDOA 3R77A 5AW6A 2V6IA 4DNQA 3HFVA 2UYHA 3K7RA 1QHXA 2WF9A 3PI6A 1V3TA 1M1GA 4TKZA 4RC9A 4NNPA 5L53A 3NJ8A 5LZ5A 2ZTVA 1H65A 4XCVA 1MORA 3ITHB 2QLJB 2Y8WA 3IPYA 1OA0A 3D2CA 2V5VA 3GP5A 3LFHA 1S4QA 4MQ4A 4MP3A 3JU3A 3PIIA 1AK2A 4QYIA 1G4CA 4KMSA 1BD3A 3AD7C 5IBPA 2VDMB 2B21A 2WQ6A 3LUDA 1FNNA 2DPLA 4YV2A 4WUTA 1WM1A 5CNKA 4OHZA 2L69A 2WRMA 5C4GB 4EWTA 3BS9A 3EASA 3FMIA 3DMYA 4UCFA 2ZBUA 4EFKA 1NVKA 4KTQA 1M54A 5LZ8A 2V2KA 1G2QA 1ZUNB 5HIMA 2H1YA 1EHCA 2F1OA 3W9SA 4JS0A 4UTPA 2B0JA 3L5OA 4DPMA 2W11A 3VOSA 1CZHA 2BKUA 3BAZA 1HNIB 4OYXA 5EGSA 2VJAA 3CW9A 3BPSA 3SCIE 1O54A 1FLNA 1RTTA 3RR2A 1U8EA 3LBYA 2BGJA 1SXHA 4X7RA 1WG5A 2BR3A 3HBLA 4XDGA 4O59O 3LPYA 3PUKA 1HWJA 2PSZA 4PQAA 1UBCA 3GRFA 4Z9XA 4B34A 4BKOA 4KBGA 3O0TA 3DL7A 4H60A 4ZA1A 1OIAA 1NYTA 2ISCA 1T26A 2ZZMA 2Y93A 2CQ4A 3I5UA 1AIPA 3QMMA 1T91A 3DEKA 3NP7A 3PT5A 4M54A 5C81A 4CI9A 3ZKAA 1IUJA 4C87A 3DD5A 2EBFX 1ZXXA 3QT7A 2PSHA 5HVGA 2ZIUB 4FP9A 3ZCTA 5ALRA 1CPYA 4LYFA 3VU9B 4YEAA 4JQZA 3PEVA 3G8SA 1NJ6A 3RO7A 3FJOA 3K94A 5K20A 3V3KA 2NREA 4M21A 4CM4B 3CEMA 1N6PA 3MM9B 3NFRA 4C2AA 4AJKA 1HE8B 1JHAA 2YH1A 2IH4A 5BSKA 2EBWA 4Y2CA 4PXAA 4J0DA 4YR9A 3NTRA 3RT7A 3IN5A 5E3CA 5CYMB 1NYRA 3F5FA 1H2RS 1S72S 1ZCAA 5H8WA 3VAAA 1ZIDA 3DHNA 1VQMS 2EARA 1A9XA 1KYZA 3CCBA 4O08A 3ANSA 2ZR8A 3FPAA 3U5TA 3FA2A 4BU1A 3ESBA 4S1OA 3KK0A 2O6LA 3X1ZA 4Q00A 2MKYA 3CEAA 3ICLA 3ILHA 3MTGA 2VPPA 3ASVA 4B3JA 4DFKA 4X92A 4A27A 2CBGA 5ALGA 3K6SA 1B0ZA 3AC0A 4BLGA 3B70A 3Q5EA 4PAMA 1NHKL 3SZUA 4LXQA 3NMAA 1NA5A 4J1QA 3VPFA 3USZA 1R74A 3C74A 3B2QA 1AVTA 1FXWF 5LQSA 1HNWJ 3UF0A 3DE5X 2X51A 4RWXA 5BSMA 3O90A 3TEGA 5EWLB 3MTDA 1CSEE 4XSHA 4WEOA 1EX8A 2A35A 4FYXB 4DXDA 3PD1A 5IXJA 2HMWA 1H8ED 4YXFA 3MCWA 5CFNA 1P18A 1TU0A 4I5DA 1QKIA 1REVA 1YZQA 1BDJA 5ES4B 5JISA 4J0EA 2QTLA 3SS7X 1XCJA 1P9LA 4MRVA 1CUSA 1JLEB 4DQVA 1KO4A 1E6VA 2XO6A 1OXKB 2ZUCA 2Q9UA 5EA2A 5ALYA 1XMQF 2XMPA 3NOQA 3GUVA 1U8FO 4RCVA 2ZPAA 4ZAZA 1NPYA 4K6MA 3T6KA 1GG9A 4PY2A 1NQOA 2YQZA 3F46A 5F76A 5B3AA 4QXRA 2PMFA 2G5PA 4PS1A 3W5XA 5HRAA 2QV6A 1VRQC 3NHUA 1TO2E 4I6YA 5IVHA 1PFGA 1J2UA 3MBKA 3A6LA 4QPNA 4DSUA 4XQGA 1MNQA 4B2PA 4DF8A 2QRUA 1F4PA 4B7AA 1GNVA 2W9BA 3GJ0A 1Q1ZA 2LQJA 4NOLA 1SHUX 3U61B 3CZAA 4KEAA 3WRYA 2A1UB 3RI3A 1HQKA 3KAQA 2HJ9A 3N7AA 5DYYA 2BCJQ 4ZOLB 1HETA 1RE1A 3NCRA 4QPXA 3TRDA 1RXOB 1FQOA 2ZH6A 2XRYA 3M6FA 4W99A 5B7WA 2OPPA 1U63A 5EY5B 4M4SA 2OUKA 4J0HA 2XUDA 3WHLA 1P1TA 3AH8A 3GH1A 1ZJ6A 3GQBB 2NUBA 4QZVB 4PGHA 3JWPA 5SZTA 3ICPA 1TKZB 1Z8HA 3OIVA 2IF2A 1Y3KA 4CF3A 1ISPA 4IDKA 5FPHA 1HPZA 2FDNA 5A03A 4IBOA 3M1VB 2QVCA 1H7XA 3O0DA 1TVKA 4ZDJA 3KU1A 1S49A 2QTHA 1P8GA 3IDOA 4WP9A 2B4RO 2GGPB 3BWVA 3UT5B 3LV8A 2O1PA 4F4XA 3UZUA 1NF8A 3M9WA 3EF0A 2AVNA 1EDEA 2ATVA 1XMOJ 3DDZX 3TNYA 2DNLA 4LFAJ 2AGVA 4US1R 4YRZA 5CB6A 2JZOA 3STVA 3OEWA 4WBFA 2VUUA 1IKYA 3AAWB 3J7AN 5MN6A 5AK3A 3V4OA 2NQ8A 1DURA 1SQSA 3MIIA 1QIHA 2I4MA 3M7VA 2IOFK 4REOA 4Z37A 4ELTA 2I9PA 2XYPA 4U7TB 1SZJG 4FSXA 4FSDA 3G13A 2BM8A 5T4BA 3RC1A 4IJ5A 4OCZA 1NW9B 1L4FA 1K0TA 1U6BA 3HLUA 2RHTA 1TLFA 2RJNA 1USGA 2ZJ4A 4DU7A 1M6WA 3H20A 2WWHA 1F5BA 4MHOA 1EE1A 4CTAB 3RAMA 4P9NA 5K8UA 1EXWA 3UFXA 5D3KA 3WL3A 5EWLA 3HA2A 1LBIA 4OX9F 2I71A 4R05A 4QNNA 2M8DB 3UWSA 1EK5A 4IFIA 5EJIA 1MD9A 1A4XA 3TFOA 5SYMA 1MC4A 2B1JA 4XD2A 3DE2X 1GG5A 1NVUQ 3IFSA 3LT0A 3IQGX 2AYGA 2Q2NA 4W9NA 4PX9A 3UJ7A 5GJBA 3OBBA 4XQ9A 2Q79A 4EMUA 4IOKA 5JWOA 5JAPA 4I08A 3UKOA 2BQRA 2NZCA 5HBGA 5JJCA 2OAEA 1YZFA 3AHJA 3N5KA 4UW9A 3RAPR 5D0EA 4ZITA 2CHEA 2D2XA 2CLHB 3A8KA 1TVCA 2QQ5A 3HSYA 3HHNB 3OP1A 4XUGB 4B79A 3HSKA 5DJBA 4UCWA 4M1TA 3GP3A 2FGKA 3NGMA 5AXCA 4MUMA 2EWWA 4JI2B 1BG6A 5HJEA 4ZVSB 4ECRA 4I0WA 2LW7A 4MQUA 3M5PA 2PZMA 1E98A 1BMDA 2REOA 4RVHA 4JFAA 3BDAA 4BXOB 1FE8A 3QYJA 5FORA 3TRKA 2LBPA 1R4MA 5DGXA 2RILA 4UPEA 1H0HA 1SI9A 1PZGA 3OC0A 3ZJ5A 4Q82A 3R4CA 4KE6A 1JLFB 2BFFB 2HFOA 3A7EA 2FW1A 3B53X 1BU8A 2QMXA 3B60A 5AESA 1ST3A 1WDTA 5KG6A 4LV8B 2AEJA 3HMJG 2XA1A 2WKWA 2FXIA 4O2AB 1O87A 2QMUB 1IZZA 1GPAA 3CS3A 5KUTA 1VQNS 3P9RA 3BZQA 5M2RA 1U8UA 4HJRA 4YYEA 3WWCA 2V98A 4YRKA 4HTIA 2R8ZA 4A8OA 3M82A 2X42A 1YX2A 4ZVUA 1LC0A 4C8ZA 3AOEC 2RJZA 1TVKB 5T8KC 5HBMB 5JEEA 4BVAA 3KIPA 4COOA 2OXRA 3OM0A 2E7VA 1MBZA 4PNZA 3ZHVA 1G3MA 3KWMA 2YXPX 2CPJA 3D6TB 4J9QA 3COPA 3SOPA 1TM2A 3M6IA 3A05A 4AJLA 3NHYA 4ZQIA 1QBKC 3N5BA 5LDGA 4KE9A 3VZBA 1PR9A 2WMYA 4ZJZA 3DOFA 1SVIA 1CDDA 2J9DA 1LTKA 2JCXA 3MB5A 3WFJA 3J7A1 4P4GA 4AO7A 3WYCA 3ER6A 3MM7A 3R7WB 3PP8A 2OV1A 2J6IA 1IOVA 2ECKA 3ONWA 3L07A 5CPFA 4A46A 4M60A 4OJNA 4FGUA 2LEAA 2QJRA 1I3OA 2P8JA 2ZIEA 3R74A 4MVJM 1PT6A 2D6FA 3B2EA 5DNAA 4ZVQB 4JB8B 2YNGB 4JZKA 1B74A 2AHOB 4CF4A 5ITSA 3R8YA 2ERRA 3RS0A 4BJ1A 1RXIA 2B1GA 3LO8A 3P1JA 4S24A 2JS7A 1KDVA 1RACB 3C85A 4MLPA 3ZCUA 3A2KA 3WJAA 1CY4A 2RD2A 3UYKA 5JDIA 4MFBB 1M8KA 5DBIA 2IBSA 4DEVA 3NBAA 5JCPA 4KXQA 4F5WA 4W7IA 1QFSA 4E46A 1P73A 2VF8A 3A2LA 4DLVA 4PC3A 4HT3B 1XSEA 4JIMA 1V48A 5LXYA 1FU4A 3F3YA 4PBRA 1TL1A 3L0ZA 1S5ZA 4HG2A 3ESRA 4JV5B 3R0ZA 2I80A 2ZYRA 4EGLA 1QLHA 4J03A 2D2EA 4JJEA 5B58C 4H1VA 3FTDA 3ZNNA 1S1VA 2O3JA 3D3WB 5AHXA 4V0ME 3G9CA 3C24A 2QRVA 3ZXUB 1EEXB 5AI0A 3MEGB 1GO2A 2O8VA 2HHSA 1V45E 1BX1A 1VYTA 4EY8A 4PZPA 1DL5A 3E9EA 3C3KA 2L82A 4LIPD 1UMDB 3W2IA 3QWPA 2YJ4A 1OLSB 4LGYA 4MXDA 4DS5A 4I1YA 1QRDA 5B4TA 3U2QA 1SOVA 2JNWA 2O06A 2Z8XA 1QVGR 4PQEA 3H04A 3NAMA 1VZ2A 3CGIA 4JI0F 3AFNA 3HJTA 2IIBA 3PFFA 4WH0A 3BS4A 4EKYA 4DZDA 3W5VA 4NX2A 5K0BA 3W5AA 1VISA 3I61A 3GGPA 1ARZA 4XGRA 3REFA 3QKIA 1KY4A 3VGUA 5D4NA 5FFFA 1B0VA 3KO8A 1FTQA 4NLGA 2IZOA 4MUXA 4XYGA 4ZI5A 3EX7C 4NBTA 2FLWA 1W46A 3GJ4A 2VJPA 2VYVD 4H7IA 1LTQA 2AL7A 4O4HB 3DLTA 1CC8A 4V19X 4K0KJ 3GF4A 2ZSAA 2ZLBA 4C7OB 4JQYA 4ZTBA 4L95C 4KV9A 5EQJB 4BO7A 2O8BA 4RV4A 3SLKA 4ZA2A 5KREA 4AKGA 3WL8A 3HKCA 3MHPA 3V32A 3HP1A 3F6RA 2IYZA 2QO3A 3Q8QB 5THWA 2HQFA 2B4PA 2LQ8A 3I32A 2XGMA 1SQEA 2PGAA 4OQYA 5FWDA 3IAHA 1YK0A 3EHEA 4J5OA 4R8VA 3EW9A 2ZH4A 5LA6F 4Q5IA 2OLJA 4WZQA 2DRIA 4AJ4A 2DECA 1W52X 4B8ZA 4LHZA 2VZ8A 1V8PA 4CNYA 5A1TA 4UHFA 5JOQA 2C2GA 3M30A 1FYEA 2YXLA 2QFJA 1NJXA 3ZCQA 3V55A 3D0QA 1QPGA 2XWPA 3SSSA 3GVXA 5L3QA 2P69A 5CYQB 2C03A 5FOUA 5G0RA 4OL0A 2ARKA 4TY8B 1EFPA 2L17A 3LKZA 2JZ5A 3HZGA 2DWUA 1Y5MA 4KCGA 2IRXA 3HI4A 2CNLB 5L40A 2XXJA 2WT8A 2HGLA 2UZ0A 1DMRA 2IA6A 3DT8A 4R7ZA 4RNHA 3GXBA 1Z26A 1FXRA 4R41A 3R27A 3B1YA 2ALJA 2G83A 1SU7A 1O94C 4RSHA 1Y5LB 2G40A 2K2WA 1GUAA 3KQPA 3WJ2A 4A10A 1GAXA 2E2WA 4NZOA 4XFJA 4YV7A 3G8QA 5D4LA 2L3MA 3FVWA 2CFIA 3WRVA 3AJ8A 4F93B 3ZWMA 2BE7D 1V26A 1PW5A 4CIOA 4UNNA 4DW8A 5GPBA 1IBCA 3PVSA 4HNAB 2O4CA 2KI5A 1OXBB 1QZXA 4F3YA 3PL5A 4RIFA 4Y34A 3SE0A 4DCPA 3DMDA 5EXPA 2XQKA 2JRLA 4KOAA 3FAKA 3JS9A 1H23A 4MI6A 3QF4A 4F2HA 1DAKA 1TKXA 5FDLA 2SKCA 1G5TA 1I4OA 3PENA 1A9TA 3QPWA 1FDUA 2VH2A 4GVXA 2PJRA 3O91A 3IESA 5H3LA 1WQ4A 4WLUA 4KGVB 4ZPVR 3L7CA 4NBVA 5IVDA 2HQBA 4MJLA 1SVSA 5ENDA 3KLFA 4DNFA 4ZVPB 3H0KA 1A76A 4KNYA 3F7MA 4OXYA 4PQFA 3VH4A 1DELA 2C00A 1W2IA 2XD4A 4KWTA 5KYKA 1PV4A 3EZ7A 2C2OA 2WTEA 2VG5B 3QXCA 4DLKA 4YACA 1KEVA 3GHHA 5LMUJ 1N9GB 1E99A 1Y5IA 5J2TB 3AHCA 1P5ZB 1LBQA 2AZTA 4EYOA 2WJVA 4WOBA 5BSUA 4F50A 1W0CA 1XZPA 1U5BA 3MIZA 2FEOA 4HYYA 3SICE 2O8EB 4UXJA 2O19A 3NHPA 5EPOA 3OQIB 2FD2A 4C0HA 3UWDA 3K5PA 2RCYA 3T9BA 1Q1AA 4TV9A 1UKZA 1XP5A 2P2LA 3O8WA 2X58A 3KXIA 2PFKA 2FJVA 5JPIA 3K0EA 4LK2A 3QGHA 2AF3C 4I2PA 4GYYA 5AFSA 3O4IA 1KI8A 5HM6A 1ZJ5A 1F3VA 3EYAA 1OWXA 5JLJA 1JALA 5C25A 1NZDA 4HVCA 2LU1A 3EDQA 3K2BA 3EZ6A 3KDPA 2IL1A 2NU9B 3W05A 4H6WA 5A2QU 4F1WA 1CSJA 5JH7F 4MA5A 4J8PA 5JD6A 2NTJA 1WWKA 5EZSA 2V67A 2I2AA 1W0KD 1D3AA 3X1LB 3SVZA 2CQ2A 1FMLA 4K9OA 3L7YA 4IHKA 5K6RA 1YDGA 4ZALA 4GOLD 1L7XA 4X4OA 1T2AA 4RD3A 4G0XA 4CO1A 2VQDA 3ZXWA 3NTLA 5EJMA 1E2KA 3K0AA 5H1YA 3TVKA 1O0BA 3KKFA 4IUCS 4AQYJ 1T15A 1UOQA 2C2MA 5LLDA 3N2GB 2W4DA 4MVJD 3USES 2FEXA 1NIJA 1TF7A 2QN2A 4Y2KA 4UEKA 5ELMA 1F3OA 5ED0A 1OYYA 4ZVKA 3LUYA 5JC1A 2CXQA 4PO3X 1F5NA 5CD9A 5CD1A 4M1EA 4B8WA 3GUZA 4DDTA 3V4LA 5LMCA 1RBQA 2WNIA 3RAQA 1IULA 1E6UA 1KLMB 1ZMXA 5E6RB 4J9NA 4X93A 5L8RC 2OC4A 3UAGA 4DUZJ 4XE5A 1WUHS 1TA4A 4X20B 2A88A 4MIBA 2GN0A 5BN3B 1EK1A 1TO6A 1PWHA 5EJ7A 4L3OA 2HRUA 1VE5A 4IIJA 5JNRA 3B8HA 3NGKA 3QENA 4OB6A 1Z4UA 3W2HA 4JI2J 3ZLJA 3VA7A 4KUGA 2EJVA 3N6RA 5L4LA 1OPZA 1DUVG 3EIHA 4Q6WA 2V8VA 1LDEA 4Q9IA 2LDYA 2GJSA 1X7YB 4M5KA 3IUPA 3EFBA 1HLFA 2DWQA 5EX3A 3I6BA 4LDJA 4GXNA 1VCMA 5TR9A 5CA1B 2ZUSA 2WTMA 3MOIA 3U4GA 2V7QA 3TM5A 3EXHA 1Q16A 5HZKA 1FJXA 1DBQA 5CG1A 3WGMA 3KK1A 1H4QA 4G5QA 1G5IA 2B4OA 1YC5A 5KFYA 3TX8A 3RB6A 4XGNA 5AOAA 2UUPA 2NX2A 4UEQA 2PIDA 1WCWA 3SQDA 2AKWB 2AJLI 2GPWA 3QJPA 1VBNA 1Z9BA 3EXG1 1T1SA 2NUPB 3TZQA 3PGXA 3R8XA 4IR9A 4Q19A 1DAGA 1MGPA 1WOYA 4N65A 3N75A 5HJXA 1JI0A 3LYLA 2XMGA 3BJYA 2WZ1A 3GAFA 2EZTA 2FI1A 3JSMB 3DDSA 4DYDA 5SY6A 4CUKA 3H2VE 1D7AA 5EXEA 4OHPA 3LYAA 3F97A 3MCSA 5T7BA 1U1OA 1EJBA 2JCGA 4UNIA 2ROGA 2MKSA 2KHZA 5DOVA 3ED5A 1FFEA 3MECA 4G4SP 3GIDA 4KPUB 4FUQA 5CX1B 1YJ5A 5B7QA 4DBVO 2YKOA 1SCDA 1U1DA 1OQ6A 3CD6S 3VVTA 3HSGA 1W7WA 3R9XB 1SBYA 2OB2A 3BSCA 3CFYA 1FLVA 2LECA 5E6UB 4F5DA 3EFEA 3C3BA 2X6TA 3O9ZA 3WLKX 4I4BA 1QIFA 3GU0A 2D1TA 4KREA 4GC7A 3VDQA 4KYVA 4LXTA 1FNMA 4IV5A 2CJKA 2ZVDA 4S2UA 3SZMA 3STTA 2JEYA 1NRJB 1I3KA 4FM9A 3MPWA 3RD5A 2RKIA 2GT1A 4XTRA 1E18A 2BDUA 2TS1A 1IOZA 3T1YB 3KB8A 1BDBA 5B0CA 3G1WA 3VR2A 1NKCA 1RYMA 1EDOA 3KOAA 1P27B 4UAVA 1E96A 1AO0A 3A13A 1H2EA 2YHUA 4CHTA 5AK0A 4USIA 4NMXB 4IHJA 1DZ3A 2C58A 1NQWA 3HCCA 1VQ7S 2OM2A 2N7YA 4M0FA 1WZEA 4YB8A 1CYDA 4D8VA 3VJMA 1YFKA 1VQ5S 3AYZB 1YRYE 3AUXA 4DB2A 2R44A 2B8NA 3H5AA 4BYMA 1BW9B 2CG8A 3GEIA 4UATA 3AOGA 4JP8A 1Z62A 4QWAA 1SVWA 3ED1A 3TTXA 3W3AH 2ZIZA 1JRLA 1V16A 3TN7A 4I4CA 1LK5A 2ZU6A 4EUEA 2OENG 2JBAB 4UBOA 4QIVA 1O95A 1KH2A 3R5TA 3ETCA 3FLMA 3OX2A 5J1EA 3HE3A 3B20A 4IUFA 1V37A 1NSYA 4RNDB 5MHTA 4B3OB 2P6NA 2IVMA 4K3UA 4IIBA 1EP3B 3A9RA 5T14A 2XMRA 3ZW7A 2HJHA 2H65A 2B36A 1EETA 4PXSA 1GT91 1TW3A 3LBIA 2DVIA 1Q1EA 4FHZA 4I2NA 3TMYA 4Y8VA 3LF0A 4OQNA 3RU0A 3QO9A 5J5AA 4F6RA 3ZFVA 4O6VA 1G60A 4NICA 1VL2A 2RHCA 2HHLA 4RZSA 1JFRA 3KUEA 5KJ1A 2J0UA 1ESMA 4NXMF 4L72B 2RHHA 5CDGA 2AMJA 5I7HA 2X0DA 4J9UE 1IBKJ 2OMLA 3G2NA 1ZSVA 3MUTP 4IQ8A 3GGJA 2W2NP 4URHA 1PR2A 2IC5A 3TLXA 4WYLA 1HNXJ 2ID7A 1S1UB 1X1DA 4NBRA 5JJIA 5J2MA 5FOWA 1H5UA 5EUHA 1IZ7A 4HX9A 3ZNJ1 3GB9A 3OEYA 3RSCA 3I62A 4ZOAA 8AT1A 2R8EA 4OO3A 3LKBA 3NPMA 4NCAA 1NK5A 1QV6A 5A5EA 1PIWA 2VDVE 3SQWA 2N0SA 4L6IA 4BTEA 2AMFA 3LGHA 2HPVA 2JI9A 3N3AC 4WHMA 3TQOA 3AFMA 1F0YA 4O0LA 1JU9A 3EJ6A 1NATA 1X4HA 3VPCA 3UT6A 4L3KA 1IE3A 2I6SA 4NZYA 2G82A 5B0DA 2CXSA 3ZHYA 5EIEA 3DV0A 1KQPA 3CYFA 2CRLA 1XNRF 1L9XA 1ZU4A 3RW9A 2IYNA 4JT8A 5D78A 5H70A 1XNQF 4RCYA 1IQ0A 5JSHA 2PVSA 2PMCA 5HROB 1QIMA 1LSUA 3CNOA 1P4JA 5AVYA 1Y4UA 1WP9A 1YI2S 1RXWA 1MV5A 1VR6A 2BABA 1DCFA 3CEHA 3BJRA 5HGXA 4NYJR 1GKUB 4DQSA 2VH7A 2PXAA 5LFAA 3H5VA 4BDTA 4B4WA 1Y80A 2KVIA 5JAUA 1YBTA 4I9FA 2OXTA 2CPYA 1SBCA 1U8ZA 1K66A 1SEVA 3DMPA 1WR8A 3C6TB 2YKQA 4S0MA 4NPHA 2YVUA 3ANXA 3PQ6A 1N2GA 1VSTA 3BCSA 2AFRA 4OZ2A 3AF4A 5BO5A 3F5MA 5D0GA 3E1SA 4PLVA 2DR3A 1K7FB 2CLOB 3WS7A 4FIDA 2K2QB 3BMOA 4ED1A 2V1XA 4R8UA 5E3AA 1JUDA 1KOJA 3BILA 1VMBA 2HNYA 2O20A 3T1TA 3D64A 2V7WA 4YJKA 5DSTA 2DR5A 1NVBA 2NT4A 3FMFA 1TP7A 4UTZA 3A6ZA 1FPQA 3OZIA 4UHHA 4BL5A 5IT9U 3W6UA 4YMWA 3A10A 2ZRDA 1Q6YA 2BEWB 5JR3A 1G7RA 3FSIA 2FUNB 4L4ZA 3UGTA 1KQGB 5KNDH 2HVEA 4KQEA 4S05A 2XNDD 1I2ZA 3GEDA 3GEBA 2N7CA 3FJ1A 2G1JA 4LZLA 1WCYA 2YUTA 4JT9A 4R98A 1NG1A 4ZU3A 4BWMA 1RABB 3KK3B 3QELA 1SBTA 4G89A 2GBFA 3FPJA 2VJMB 1O89A 5AVRA 4MV0A 4P71A 1M0WA 2LU2A 3GEHA 1KFBB 2FETA 2YJ3A 4K05A 4RE5A 4LECA 1B6SA 4HSGA 1SAYA 4Q9NA 3EA5A 3USCS 3E7XA 3KUKA 4M9ZA 5ALEA 2RAQA 3VV2B 1ZGZA 4CXMA 2IBKA 2V8BA 4LHVA 3R1LA 4GBMA 1M1YA 2DNQA 1SD1A 1Y4AE 5JROA 3U4AA 2H8GA 2Z0GA 2H7XA 1X38A 4QRDA 4J16A 4ARIA 5B2ZA 2CJPA 3ZU5A 1OZFA 4I1IA 4MCAA 3PNLA 1NT2A 4FDAA 4DS3A 3GIWA 5AE1A 3R8FA 1GGFA 5B5SA 5IBQA 4MGKR 1Z2DA 4OH1A 1MDFA 3QI2A 3H05A 2JJQA 3EIUA 2N3ZA 3GFXA 3VNAA 4XR4A 4NENA 4WP8A 3SS9X 2O48X 1VCOA 3RUHA 2GCPA 3QVKA 4DC1A 1YI1A 5IU6A 4FGZA 2NTYC 1ETUA 1RLTA 2KRRA 2M1ZA 5AVXA 1P9WA 4ILMA 3OTIA 1XD2A 3BJIC 4KYIB 1P91A 4Z3DA 5ILOA 1URNA 4G86A 4R81A 1FNSA 2HBQA 5K7SA 1K06A 4DFMA 4QT4A 4FC6A 4UOFA 1KLNA 2QY6A 1AFIA 1ZD1A 2CPDA 4NBWA 1FP1D 4LSZA 4FBGA 4PR6A 3RIYA 2CW5A 3R5GA 5CCMA 4N8OA 2WFAA 3GROA 1ENPA 2GYUA 1G2PA 3LLUA 2C2WA 2YJ6A 1ESDA 2G67A 3J81A 5F51A 4QDZA 1Z4QA 4WKOA 4RZ2A 5C5DA 4I56A 1FNDA 1MC5A 4Z2AA 1S2GA 1M3SA 2C54A 1JIHA 1YL7A 4CW7A 1CR0A 2Z2JA 4Y30A 1K75A 4K28A 2C42A 2FSGA 1CE8B 2CNLA 4Y9TA 3TI7A 3UAWA 3PWKA 1HDOA 4DA0A 2KRBA 1TVMA 1R7IA 3I9JA 4RDCA 4YUYA 1C1BB 5I9BA 4ZCSA 3SDEA 3VAJA 2H1RA 5CDYA 1M5UA 3WB1A 2CWXA 1Q16B 4ECSA 4NX9A 3KVVA 3HO1A 4GW3A 1FVOA 4ZVHA 4DLNA 4MW0A 1F4VA 3KOWA 3AF5A 2XBMA 2ZT6A 5C8DA 3EYZA 1POXA 2FSUA 1L7NA 3GUCA 2H1LA 1Q3HA 2XNCA 3IQIX 1YTYA 1MG7A 1A9SA 1NZ8A 4G09A 4JOBA 2YKNB 2YY3A 4RF2A 1VQ9S 1CK4A 3CZ9A 2ZXUA 2W7PA 2XQJA 2OO4A 1TMYA 2XODA 4AJJA 3KOUA 5CK4A 2XCIA 3B3GA 1UDXA 3MWLA 3PYEA 2FLPA 5FUQA 3I37X 3BWEA 3UA4A 4EO7A 1TLTA 1NURA 3A1FA 1NIPA 1IUPA 1E7WA 2Y68A 2UUOA 5ITVA 1CZLA 3O8OA 4TTTS 1MNEA 3O1JC 1SHTX 1YITS 1H66A 1OXXK 4RM3A 1L5FA 4J3FA 3L4KA 1ZRHA 2WA1A 2Z8ZA 5HLFA 4RKQA 5ICCA 3U56A 3EEIA 1D2NA 3HKWA 2DISA 1T5HX 4JNCA 1IIRA 3ZX5A 1WVMA 2P2YA 2KSQA 5L39A 1K47A 1RQ7A 1PWZA 1A71A 3VVBA 4I3FA 1YOBA 2FPKA 1DT5A 1J2JA 3JQDA 1DC7A 3FWZA 3UANA 4BQQA 1LQTA 4TS3A 4JI1B 4YHBA 5KVCA 2V8GA 3ZWOA 4C5BA 4YI3A 3PHIA 1J39A 4DR4B 4B81A 2YC4C 2HS3A 3L7JA 4JV1A 2AFIA 2LCIA 1P72A 4OYLA 3MWKA 4DA7A 3GG0A 4PHFA 3Q8WA 2H2IA 1SQGA 3MWJA 3EPHA 4HRAA 3KWFA 1OWOA 3DZJA 3QVMA 1KE2A 3B6JA 3QWIA 2NVWA 2QTWB 4FHFA 4UE2A 1PKXA 3DFEA 3W9UA 2QRQA 4GR5A 5LJLA 1TZKA 1Q7BA 3SFUA 3DLHA 2ZK7A 5KTSA 2QNIA 1Y9OA 3K0FA 3ELUA 2Q3PA 2V4MA 2J3KA 2HFSA 2O67A 1TXGA 4NDAA 4BJ6A 4OU4A 3FFIB 4JODA 1KIAA 4OBBA 3C7KA 5AI5A 2BUBA 3GCWA 3H42A 2NU8A 4HEA9 2G4LA 4Z4FA 4IIUA 1NSPA 2J3EA 3ZWNA 4MAFA 3QIPB 2G6BA 1F1BA 3A1CA 1BAPA 5BYKA 1PSZA 3EFHA 4RVNA 5TY0A 1X31C 4N5IX 1VG9B 1LWOA 2GXQA 3ZZTA 2JBAA 1VM6A 2JLFA 4JV5F 5EUQB 3WLTA 3HCEA 5IWAF 1BJRE 3QFHA 1IXSB 1DSSG 2ZSIA 3TLYA 4EHNA 4YRTA 3DDOA 2WJYA 2VJUA 4MMOA 1WOMA 1GPKA 3CCJS 3WIOA 2R79A 1O6GA 5ETNA 4A82A 5AW3A 4L75A 3FFWA 4LGVA 4YR7A 4K40A 2D0IA 1O6FA 4UUQA 1EMDA 1VE1A 1XVUA 3DAGA 3QJ5A 3S1SA 4IH6A 4XIIA 3ZQ6A 4YB6A 4O4JA 3S8EA 1HD1A 1DC3A 3E2IA 3L1UA 1R6XA 1TUWA 1TAUA 1H7WA 4L0CA 3ND9A 1GAEO 1M0SA 3UMGA 4G5RA 2MY8A 3SSNA 1Z6PA 4K0KF 4BLQA 4H7KA 4LF7B 2FPMA 4BQRA 1Y89A 3EVBA 4WFKA 4BGEA 4A8KA 3LY7A 3PDCA 3OQ6A 2WJAA 3EAQA 1G9TA 2ODNA 2G9QA 1R0WA 4J1TA 1YI8A 1X0XA 1XIVA 4U02A 3RRFA 1B7FA 2BELA 3CJ2A 1QVVA 3NM6B 2ZZKA 3BSYA 3IA7A 3P0IA 4L9SA 1F8XA 4RZ3A 3TSAA 4ENWA 3KK3A 1O8BA 3HKEB 1FDBA 1H5NA 5FUWA 1WD5A 3U3OA 2H1OA 2QE7D 2VTBA 4FUTA 4IH7A 4O2RA 4N7RA 2Q3JA 1NFFA 3FOCA 4EZBA 1WUJS 2VIHA 2YW2A 5LM3A 3HKEA 1WEHA 3DLEB 3E01B 5HQMA 5CM9C 3CRW1 4EA9A 1MOPA 3WYEA 4Y2TA 3F6BX 2C78A 2GBGA 3TOQA 1UA0A 1TI7A 2JIQA 2XKBA 2DH8A 1HDIA 3AODA 3J81k 3WQBA 1P80A 2ASYA 1SURA 3EGXB 4D9IA 4M94A 1CJVB 4REQA 1IQZA 3T95A 4XYMA 4V0SA 4TKMA 2HWIA 1U8AA 2X8AA 5JNWA 4P08A 4KBYA 1SA0A 2AXPA 1PT5A 3AHEA 2ZH1A 4RVSA 1OW3B 3I9V6 4JBCA 3FZBA 1JLSA 3H9UA 4NSNA 4PFJA 4JLJA 2XMUA 3OVSA 2B7LA 3CGWA 1ORTA 5EKSA 4BQSA 2YYYA 1N34F 1N54B 4FOSA 5HQTA 2ZRBA 4D6YA 3MMCA 4ZN6A 1VA4A 3CRQA 3EVZA 1VLZA 1WC6A 4EHHA 2QTNA 1SA0B 3BXEA 2XUHA 2WSFC 2OB1A 3EXFA 4YMGA 2SHKA 1KOLA 1QOPB 1ZVJA 1MO4A 4A8QA 4Y7DA 4IXWA 5G2OA 3EMTA 1L5YA 4R68A 3ZU4A 3CG0A 3WZ2A 3UXMA 3WLAA 4CKBA 2GKSA 4O44A 4TLLB 5JANA 3JWIA 1ZMTA 3D6HA 1UMBB 1XWLA 3W1VA 5CABA 3NTOA 3FDJA 2LEPA 2HRTA 2BZ1A 3CZCA 2EG1A 2FEAA 4WPAA 2ASVA 1M33A 2P68A 3H9GA 3OLCX 4DR7J 4JI6F 3LP0B 2WZCA 1AS2A 1W4CA 2HKEA 3M32A 2CBZA 3HA5A 2ETXA 3LYUA 3TBFA 4B6QA 2DY0A 5BV0A 4RUHA 3I05A 4AY4A 1Z2AA 4IGFA 1ZRSA 1JPNA 2XAAA 3BKTA 4EHKA 1G5PA 2TMKA 1OX6A 3QVSA 5EGNA 1J9EA 1FQJA 1XNHA 3HD1A 2XMSA 1X3SA 4HMOA 3U7QA 5B0AA 3MWEA 1S4EA 1N32J 1DTTA 1NFQA 1RKBA 2NLWA 1R8QA 4EGAA 5IJ0B 2CPHA 8RUCA 2QYCA 3CF4A 2ALYB 3R5JB 3V7NA 4RPGA 4BNIA 1N2OA 2I2FA 1OKKA 3K17A 3H2HA 4JBYA 3UBMA 3KLIB 4OLHA 2GEKA 2RGDA 3ET5A 2ZJ5A 2O3QA 5M2PA 1Y82A 1S1TB 3WBZA 4GNRA 3NT4A 3S1LA 1S7GA 3C5HA 3TW8B 5I7EA 1C9DB 3EWGA 1QUEA 1WHSA 3CW2A 3KZOA 4PPQA 1E3MA 1NVDA 4ZYZA 4W5RA 3DRSB 4HFJA 4JLWA 1JFVA 1QH8A 4RKFA 2JFBA 5G02A 1J42A 1GA6A 2RI0A 4WNAB 3V42A 3VJKA 1WG8A 1S5PA 4BKQA 2IW1A 4FDMA 3W5BA 1HNWB 3VVMA 4PC7A 1H2VZ 1A4RA 2UYYA 4TU7A 4QBUA 1OI4A 1PAEX 4RUBA 1IZ8A 1MVLA 3N6MA 5DLQC 3B52X 4LQ3A 4L5AA 4ROSA 3WGIA 2F5GA 3JTNA 3BFPA 1L4NA 4HAYA 4XWKA 2KE5A 3I5CA 4LT6A 3DRPA 2DR2A 1JIIA 3ZDXB 3ZTPA 4ZLLA 1IG3A 3QM1A 2OA0A 1JSXA 1TTTA 4K4YA 3C3EA 4W92B 1Y1KE 4V3BA 2O7SA 2HMUA 4XVCA 2E82A 1Q19A 1F06A 3VBCA 1CJSA 3KX2A 2PWZA 4Y6QA 4D74A 1RDFA 4B6FA 1JKHA 2PRSA 4EO9A 5JS8A 1W29A 1DRWA 4IH4A 4YJHA 3MWFA 1ML3A 3OKPA 1KHTA 4RV5A 1N36F 3D02A 4BKMA 2CPEA 4K4ZA 3S5UA 2QGFB 5ENZA 1GOTA 1JR3E 1HTBA 2JIRA 5JJBA 4X1YB 2IUTA 5ER9A 3CDWA 5H4GA 3LECA 1YVRA 5JMNA 2ZKUA 2B4YA 2KM1A 4X4VA 3W60A 1LDMA 1CUYA 1GDDA 2BP7A 5DLEA 5EG5A 1K44A 2VG7A 4X8HA 3EPLA 4XUDA 2GIRA 4BNFA 2NUUG 1DDIA 3UD3P 2KZZA 1YQEA 4TYQA 5B0BA 5LSLA 2MYFA 3HWRA 4FOTA 2PN1A 3SJAA 1CBKA 4ZYUA 2PUBA 1Q5PA 1HLWA 3TQIA 4LQDA 4DT1B 3KHHA 4MAKA 1D2RA 1LGYA 2V63A 3OJSA 3CH7A 4D8WA 3ZWQA 2DLDA 1M83A 1RU3A 5GAEU 2B1RA 4OREX 4PCUA 4IILA 2RUGA 3UJPA 3LUAA 3DZKA 1VBXA 1OE0A 1EUDA 3PUIA 1SC6A 1PLLA 4AKIA 4C6TA 2DWOA 3S8MA 4JSYA 1U2DC 4PYAA 1CWUA 1PJQA 1C4WA 4FBMA 3V5NA 4UZFA 1KARA 4CKEB 4LF8F 4Y98A 3N0TA 2Q3BA 2C7QA 1LWEB 4MGYR 1ZFNA 4KO1S 2YPZA 1H2AS 2AD9A 1JHRA 4OX9Y 1J97A 5IHXA 4UHKA 4DQIA 3HPOA 2RIRA 2PSEA 2LXIA 4I6EA 4ES1A 1NI4B 4BN4A 1AKVA 4XPIA 4L08A 4RZXA 1W35A 3QXSA 1C0KA 4N0QA 5EJ5A 1W47A 4G9BA 2A9OA 1JIUA 2I0FA 2OZPA 5H83A 3PDIB 3RT1A 1OSCA 1W0JA 3DCIA 5LMNB 2WHQA 3GJTA 4J3NA 2JLEA 4Q9HA 5BR8B 5EPUA 2E4VA 4M8KA 4QEZA 1FYDA 4KDFA 5JXHA 3BDVA 4JJGA 5KTOA 2O5CA 1YG0A 4X6YA 1JMTA 3QKRA 1YB4A 1JN0A 2JGAA 5B57C 4C7VA 1XKTA 3UM9A 5T6MA 1XL0A 5EMKA 1N7GA 1NV8A 1WKKA 2VPIA 3PTAA 4KPYA 2QLNA 1GQOA 1M1HA 1RWVB 2YNHB 3UTDA 5E38A 3AR8A 3O74A 2W90A 1JIKA 4KE8A 1CE8A 4M7WA 4PRFA 2Q2QA 2E3JA 4ENTA 1X7GA 1CS4C 1ROFA 5JS1A 3FFIA 2FY8A 4HAUA 4NHOA 4BTVA 4HNTA 3M8SA 2O4UX 3R2JA 3THOA 4BAZA 4QFBA 4QBKA 2FVPA 1DEHA 1MZVA 4WE1A 5KTMA 4O4HA 2PS9A 5CXXA 2OMOA 4QLAA 1R1DA 1TL7B 1AZSC 4LY9A 3RJ5A 1U8CB 4PRKA 3TZWA 5FIIA 1E3DA 5K8JB 5CT5A 4PQUA 3HDSA 3BT7A 3CCTA 1H05A 5BN4B 4K6OA 1M2EA 3S99A 1A6LA 1GV0A 1P7PA 4QAQA 3QW2A 2XTJP 4DCGA 5EWJA 3I2JA 1UVMA 3CJ0A 2O50A 2VDWB 4WWHA 4P4NA 4O4IF 2IXFA 4FZJA 3O3CA 2CDQA 1V9CA 2GCOA 1GL3A 2ANCA 5CLLA 4JLKA 2PT7A 3D9BA 1C8VB 5HZHA 1N7IA 4TWZA 1GEEA 4JI7F 1HD0A 4DQPA 5DNWA 4RO0A 3GGGA 1N4LA 1L3IA 3JR3A 3LSYA 3BSOA 3EICA 3RR7A 5HI7A 3BMNA 1IAVA 1VYUA 1CY2A 4R1TA 3OQBA 5IMSA 3KJVB 1X4DA 4L7VA 4N12A 1N8KA 5IULC 2B20A 4O1IA 3FZNA 4K4UA 3BL5A 4QIWD 2Y6VA 1U2CA 1NKSA 3NH6A 1U7HA 5K8LA 4R7TA 1B00A 2V97A 3C98A 4ZI7F 4TXSA 3KDSE 3JYOA 5E7JA 3KJFA 4DPKA 2Z5VA 4TY9A 1XIQA 4K5QA 4GYJA 3J80A 3TZLA 2WOMA 2KWIA 3NBMA 4LSNA 3FPLA 4PW0A 4CV1A 5FTLA 5BSRA 5AIAA 2QORA 2WW8A 1N3BA 3W9YA 3QXGA 1O4WA 2MJNA 5I8PA 4ACBA 1L4MA 1LI4A 1O4VA 4ZT3A 2ZZTA 1CKEA 2A9RA 1QYCA 2CB0A 1TA0A 5AJHA 4RNMA 3BD6A 2BKAA 3KLFB 1W1UA 1YHYA 3L4SO 3BL8A 3OOJA 1AX9A 3U80A 5D01A 4J0GA 1UINA 2PX3A 2LRHA 1DEXA 5IAEA 4A8MP 5GAGU 2Z98A 4ID9A 3QSYB 1NP7A 2BKXA 4EUSA 1U6ZA 1RMYA 4FKBA 3B54A 3WSTA 2YXNA 2MY7A 3JQ8A 3D4IA 4LBIA 5T5QA 4QGBA 3K4QA 4AX4A 1O97C 1Z7EA 4JU9A 2NGRA 2GBPA 1D9XA 2XEXA 5HA5A 1CUHA 2PEBA 4RUCA 1A9XB 2WJIA 2VHGA 1OU0A 4A9AA 2FHJD 1Y4ZB 5LT5A 1FEEA 2XMJA 1MUUA 3SCZA 1II9A 5DCLA 4B2YA 1O0SA 1SQ6A 2FMKA 1QTQA 2O5DA 2WIBA 4Z0PA 2G04A 4KFSA 2PFGA 2HCFA 5BQ5A 1CRZA 2R7SA 4WU2A 2C22A 5AR1A 5LR6A 1P4AA 2WONA 1KR4A 2DF8A 3C4QA 3AHFA 2AU0A 3ILYA 1D9DA 2F48A 2V7GA 3ROQA 3UH1A 1SHZA 4U2KA 4HD8A 4KO4S 2BMWA 4LF8B 4REMA 2ZE7A 1GRRA 4UUPA 3AVTA 5E6SA 5KFZA 3RNOA 4WK3A 3NV9A 1NK7A 1TJ5A 1QGAA 2RGNC 5FIUA 3N70A 1UXHA 4ZPCA 3IUJA 3LBNA 2WYUA 5CR9A 3HR7A 2LMIA 3I2YX 2E6KA 3NX4A 2XYVA 3D54A 3PQ7A 1GMWA 1H2HA 1GH8A 4BB6A 2CVFA 2XY6A 4QWEA 3Q4GA 4LUCA 1HYEA 5KWJA 3FFBA 2KM8B 2FVCA 5KPDA 1FFDA 3EXCX 3GRRA 1RT6B 1H0HB 4DLWA 1BVUA 1UEIA 3OTDA 4IVPA 3A1EA 4RCZA 3IQWA 4BNZA 2GHPA 4NLUA 2QJWA 3Q7IA 4JOCA 1CQMA 4N54A 3EJMA 3MPDA 1YH3A 4AO8A 2WFMA 1W5SA 4DSEA 3R9WA 1J0DA 3F6YA 4IDQA 1AYEA 1JA0A 1OFTA 2H17A 3C6UA 1XKQA 4EQZA 1NMSA 1V3ZA 2EK6A 1NE7A 2GFFA 2W71A 3K8ZA 4YAIA 5CBPB 3OVBA 1AQ6A 2WR8A 2HGMA 1XMBA 13PKA 1ZOOA 3CNQS 4CKYA 5TSDA 2P5YA 1KAQA 4FC7A 3ST7A 4NZ0A 3JZDA 4FWTA 4OK6A 5L6LB 3UPTA 2HCRA 1DRZA 2PKQP 2QMOA 4ZP8A 2H5IB 2F59A 1ONBA 1V5VA 2XADA 4UU0A 3KAPA 3LH5A 2CXPA 4IG3A 4M5JA 3QX8A 2FVRA 4UT4A 1TNDA 3AF6A 1AKNA 4PR0A 5FULA 2C9DA 4FI3C 1ZYUA 4K9MA 2WM2A 4NWBA 4LSLB 2OFOA 1YB1A 3V8VA 3LQQA 4ZIWA 3OQPA 1FI4A 1P39A 5FUVA 5KFOA 4YONB 1S97A 2WICA 1W36B 4CLFA 5C4IA 4O25A 2RKBA 3D6FA 2XHEA 4X1KB 5LKRA 3C3JA 3MUMP 1G9XA 1TO1E 3LBHA 4IJVA 2OCDA 4PCVA 1TEXA 3BCHA 1S76D 4BZPA 2JLYA 1VJQA 4XEHA 1TW2A 3L8EA 3HDQA 3H9CA 1P4SA 4QGHA 1OJ7A 4A8JC 2H07A 1EZ4A 2V9KA 4QUGA 5L38A 4NLYA 5FNVA 1PV2A 1M7GA 4B9VA 4XWGA 3RG8A 3A36A 1BE6A 1KU6A 4QIEA 1BHJA 2O66A 3MT0A 1TIPA 3COYA 1YKFA 1HEIA 3AESB 1M34B 1TELA 2W2KB 4YRPA 5CCXA 1ZI6A 1AXRA 3D6UA 5HUQA 4K4WA 1RRMA 1QCZA 1YQTA 5IUKC 1JEYB 3Q3HA 2H51A 2IITA 2MXYA 1ZJJA 2XCQA