3WIUA

Crystal structure of pro-s324a/l349a
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKIAPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Requirement of the insertion sequence for activation of Tk-subtilisin
rcsb
source organism Thermococcus kodakarensis
total genus 130
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3wiuA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3wiuA02
3I2YX 5ARCA 5JXGA 1SIUA 1LW6E 1SCJB 3P5BP 2ID4A 1GA4A 1V5IA 2Z2XA 1OYOA 1Y34E 4B5LA 4RYDA 1NDQA 4OV6B 4ZARA 1V6CA 1WMFA 3EE6A 3H42B 1YJAA 1SCNE 3A3OB 1KE2A 1SIOA 3DW1X 4DJ5X 4HX2A 2WWTA 3OSZA 1AK9A 2IY9A 3PTLA 3DDZX 5FBZA 4NMXA 2Z2YB 3DE3X 3LPAA 3AFGA 3SQOA 1Y33E 1SUPA 1CSEE 1SUBA 4J94A 1R6VA 1TMGE 3F49S 2PRKA 2ZWPA 3GCWA 3DE2X 4WOCA 2PWBA 2QTWB 2Z56A 2Z30B 5FFNA 1P8JA 1AV7A 1TM4E 1EGQA 2W2QA 1SIBE 2W2PA 2W2QP 2W2PP 1TM1E 1S2NA 4JP8A 3WHIA 3VV3A 2HD4A 2WUWE 2GKOA 3L1KA 1VSBA 4H6VA 4OMCA 1C9NA 3F7OA 1SH7A 1TM5E 2Z57A 2X8JB 5I9SA 1Y1KE 1R0RE 2WUVA 4K8RB 2WV7A 1XF1A 1TECE 2W2MA 5B1EA 3A3NA 1SCDA 2XTJA 4MZDA 2XTJP 2Z58B 3P5BA 2P4EA 2E1PA 1SN7A 1KE1A 1BE6A 2PKCA 1GNSA 2HPZA 3LXUX 1PEKE 1ST2A 1BFKA 1HT3A 5ARDA 3WQBA 1SCJA 3CNQS 3I34X 1BH6A 1JEAA 3CNQP 4DZTA 4C3UA 4YN3A 3F7MA 1NLUA 2SECE 1MPTA 1UBNA 2G4VA 4NE9C 1PFGA 1P7VA 4M1ZA 3DE6X 3WIUA 4H6XA 1BE8A 5JXIA 5JXHA 1SELA 5B1DA 3A3OA 3TI9A 1GTJ1 1SUCA 1C9MA 2PWAA 2ST1A 1Y4DE 1SVNA 2V8BA 2SICE 1A2QA 1GNVA 4FONA 3WIVA 1GA1A 1WVMA 2W2NA 1TM3E 2W2NP 1ZVJA 2IXTA 3DYBA 1Y9ZA 1GCIA 1T1GA 4CFZA 4LVOA 1Q5PA 3VTAA 3QTLA 3HJRA 1BFUA 4WOBA 5AVJA 1ZVKA 1TK2A 4C3VA 3GT4A 1WMEA 4KPGA 1CNMA 4H6WA 5AMXA 1YJCA 3EDYA 2SBTA 1S02A 2QTWA 1IC6A 1OT5A 2Z30A 1AQNA 3TECE 1AU9A 1SBCA 3BPSA 4GI3A 2B6NA 1KDYA 3BPSP 3I30X 3DE0X 3VV2A 4NE7A 3DE4X 3BX1A 2PMWA 3DE1X 3VSBA 3GT3A 1IAVA 3DE7X 1THMA 1S01A 3DVQX 4KB5A 2Z57B 1EA7A 3DVRX 4K8RA 3A3PA 1SCAA 2Z2ZA 3LPCA 4NE9A 1SCBA 2ID8A 1OYVA 1YJBA 1SBNE 5SICE 3CO0S 3QFHA 1GA6A 2ZWOA 1SUEA 4AKSA 4CFYA 3CO0P 1V5IB 3DW3X 2PQ2A 4OV6A 1Y3DE 1Y4AE 1AF4A 4ZOQI 3EIFA 1TM7E 4BWGA 1GTG1 1P7WA 4YN3B 3BGOS 1GT91 3H42A 1ITPA 2ZRQA 3Q40A 4KG7A 5ARBA 3BGOP 3T41A 3QMPA 3LPDA 1Y3BE 3DWEX 2DQKA 3D9QX 3UNXA 4DWWA 1SBTA 1TO2E 1MEEA 1SBHA 4NMXB 1PJ8A 2Z2YA 1WMDA 2DUJA 1WSDA 2XRMA 3GCXA 3GCXP 1ST3A 1T1IA 4CG0A 1DBIA 3PRKE 5FAXA 1R64A 3ZXYA 3SQOP 3AJ9A 3Q5GA 1T1EA 5CW1A 4OMDA 1C3LA 4Z2AA 1C9JA 2Z56B 3DE5X 3GCWP 2SNIE 3AJ8A 3VYVA 3ZXXA 3VHQA 4HVLA 1TO1E 3TI7A 5JXJA 5AVKA 3DVSX 1Y48E 2PYZA 1KDVA 1YU6A 4AKTA 1Y3CE 3VV2B 4LVNA 5K7SA 1PTKA 2DP4E 2PMWB 2X8JA 1NDUA 3I37X 4I0WB 3SICE 5JMOA 1AH2A 1SPBS 1KDZA 1AVTA 2TECE 3A3NB 1SUAA 1GTL1 1SBIA 3D43A 2W2OA 1SPBP 1DUIA 2W2OP 2Z58A 3A3PB 1BJRE 5AQEA 1Y3FE 2W2MP 1SUDA
chains in the Genus database with same CATH superfamily
1UM9B 2CQ1A 1A0OA 3L6CA 2XNHA 4WLFA 1T6XA 2Y6UA 2PL1A 4LDJA 2ZWIA 2JEIA 1AIPA 5A7FA 4ZVTB 3H5RA 2UXCB 3DEFA 4KSEB 1UXKA 3DLPX 2PANA 4ZQIA 1GTMA 5M2PA 4OV6B 4YCAA 3BXOA 5EZYF 3TPFA 2DNZA 1J2TA 2IYVA 4W7IA 3SLRA 3GSDA 1TW2A 1YZLA 4Q6WA 5F9MA 4KGMA 3GLFB 3OE1A 1DL5A 3KKZA 1UP4A 3LI2A 4AXXA 2WJJA 4EWLA 4HYEA 3RYHB 5FHRA 4CU5A 4DNXA 1DAMA 4O3QA 5IASA 1LK0A 3CZQA 3A9TA 5I7EA 2AZXA 4WFQA 5EMLA 5FA5A 4M5HA 2W6CX 2X0RA 3U0VA 3SIPB 3R76A 4QJ5A 1VIXA 2X0FA 4P2BA 4JEMA 4DQDA 2P9TA 1J0XO 1NJ8A 4OKSA 1YONA 3BSYA 4DBZA 4Z0NA 5EIBC 4Y2IA 4ZQHA 3FAKA 4D0GA 5LMCA 2ES4A 1ZZNA 4JBWA 5HJ5A 1XTSA 2QW8A 3EMDA 3ZKWB 2WAAA 1JYSA 3PD0A 2JKYA 1PJTA 2EWWA 5EHXA 2JLGA 5T41A 5ELXA 4PX5A 2VJVA 2O52A 4ROTA 4R8LA 1H8HD 3DWGA 3LQKA 4EKIA 1Q6ZA 1P45A 4BTLA 1L5HB 4JDUA 1MN7A 2XE6A 4HTFB 4BMOB 2GDJA 3TL2A 1WWKA 5FPPA 1QTNA 5AW1A 2E4XA 3FWPA 3F97A 4N5NA 3ZBTA 4A7PA 1LWCB 3OC6A 3CW8X 2IU6A 3CDAA 1GZ6A 2QZPA 3PFNA 4S0MA 2UZ1B 4C2MA 3G9TA 2HRBA 1TIBA 4G86A 2Q3MA 3CEHA 1CEZA 2I99A 4ZCQA 4ZODA 3SFVA 1BEEA 1J8QA 3LQ1A 3GJ7A 2AR7A 2PRYA 3F96A 3O38A 2OFPA 2IEYA 4RW8A 1OH8A 2HPAA 1CKEA 2BJEA 1B0PA 3AFNA 3B1XA 4IJQA 2W4DA 3MJFA 4UREA 4LIWA 2GN4A 3KOAA 4MRRA 1PFVA 2NT4A 3MCZA 4GI1A 4UQPA 2ERYA 1Z9BA 2GHQA 4A15A 1KRPA 5DT9A 4DS5A 1BS2A 1XALA 2W2VA 1W5BA 1VKHA 5INTA 3DM5A 5IMSA 3LP5A 2X8BA 3MTGA 2VQEF 4Y9SA 2JIQA 3PEFA 4C0OC 3RUFA 3D0QA 3QTTA 4JSYA 3S2SA 4NYMR 3JYLA 3RSQA 2VG6B 3FDZA 3ZQ6A 1HE1C 2D0PB 5ALXA 3I1JA 4DLLA 4E12A 5TPZD 2O8FB 5KYNA 4EA6A 3RVMA 2W6JA 2C0QA 4BO6A 4TMVA 5CYOA 3SR4A 1XZNA 4NBWA 4FUTA 1OXKB 3W65A 1ZCZA 5KYKA 4Q4HB 3L1JA 1YQWA 4GR4A 2JEYA 5TXGA 2O0HA 4KB5A 1GTVA 1UA0A 3II6X 3IUSA 4FLFA 2VQFB 1WDDA 4FWIB 4OI3A 2K1RB 3BMNA 2HIMA 2WIAA 5DM1A 4GEKA 4B34A 4EA9A 1E8MA 4B4DA 3AI2A 3G2JA 4MYSA 4BO7A 4D41A 3EGXB 5IC5A 3U7FB 4JR2A 1NGSA 3EEIA 3A4LA 4PEVA 1ZLYA 3X1WA 4F8EA 4MRSA 2FJ0A 1RBLA 4CT8A 4ZEOA 1BDBA 5AXDA 1GXTA 2OPRB 3N75A 1D04A 3CLTC 3ES9A 2E9SA 2ZRQA 1UZDA 5K03A 1ZINA 2X58A 3GP9A 4TQUS 1P4AA 2J0QA 3L7YA 1XL0A 2RNEA 5DN9A 4XI9A 1QV7A 3HCDA 4WCDA 3P0EA 4RGBA 3C3PA 4UUBA 1B0UA 1P62B 2TMGA 2HSZA 4OZ1A 1Y6ZA 3OTCA 1GGNA 1IATA 2A0WA 4DXAA 3NVMB 5AVXA 1Q8LA 3I09A 2JAOA 4NRTA 2P2LA 2OPSA 1GTZA 2R7LA 4HEA9 2ENWA 2BFWA 3AXKA 3LVQE 1LW0B 3JQFC 3EHDA 3E9RA 3W4JA 3ZJVA 3W7BA 1V1MA 2DNQA 2OXTA 1RSZA 2B5JA 3RBVA 1HDCA 1OI3A 2O3UA 4CLRB 3M2PA 5IXJA 1UINA 3LRTA 4F3YA 4F7WA 3L7NA 4UF4A 3OPYI 3R3VA 2QU7A 4Y1RA 1QP4A 1UT5A 5CB4F 3O44A 1MEJA 4BNFA 1RWOA 3RS0A 1B8UA 4FUQA 2QYGA 1Y0BA 4S1VA 2MZRA 3MUVP 1U8FO 5CFZA 2X41A 3PTAA 4GKKJ 2D2XA 3E2EA 5J2UB 4C2TA 3UMRA 1AZWA 1XQIA 1W5SA 3KVOA 2QD2A 3NCQA 3KELA 1FMTA 1KQPA 2R42A 3D7RA 3OFND 2M98A 1O9HA 1S5ZA 3GB9A 1EWTA 3UN3A 5FOUA 1NHVA 1LV7A 2JGJA 3ZLUA 1VQSA 1VI2A 4RE6A 1U24A 1P75A 2HL6A 2BJ8A 2J33A 2OYCA 1HWLA 3KJQB 2NPFA 3CIFA 4INJA 4XWYA 4P84A 3GSIA 3HR4A 3CVUA 1GKLA 3OIGA 5BSTA 3DLCA 3GV7B 4XIJA 5IWAB 4AJ2A 3T1YJ 3DD1A 1IXKA 3C2PA 4L0QA 1HNNA 1XWIA 5AI0A 4IUDS 3IIKA 4MVXA 1TKBA 4XDHA 3Q15C 3L1UA 3DV0A 3PJWA 4N77A 1QOQB 4ITSA 3MAHA 3I12A 3DFKA 3HCWA 2C7QA 3QPWA 1ESMA 5EPEA 4TKLA 1TU0A 1DBQA 3WWEA 5EJ8A 3V33A 2XGJA 2I0FA 4AZ3A 2P41A 5BR8B 4ZTBA 1N5TA 1UVJA 1FFSB 3H2ZA 4WGGA 9LDTA 2LQ5A 1SC3A 1RYDA 2XTJP 2IHJA 3AUJB 4EPYA 3CA8A 1GTSA 3HLKA 2QZJA 2PQMA 4B3DA 2IIVA 4EX6A 3C8YA 2F1KA 3AUFA 3U48A 5F1PA 1XDBA 3GLJA 4D5GA 3D6TB 1I2MA 4CT5A 1I3OB 1TZJA 2ZJBA 2D0OB 7FDRA 1Y5NB 1GV0A 1KO4A 2OFHX 1C3JA 2P2DA 4F2SA 2GNPA 1I7NA 2PO7A 2DGOA 5GAGU 2ZYGA 3JQEA 1F38A 1PD1A 1I2ZA 4RKRA 4HFNA 5HIMA 3MWDA 1P2BA 1M33A 4CTJA 3GLIE 4ENQA 3GG2A 4M5DB 1TYAE 3X1XA 1EB0A 2BJDA 5T4HA 3GFXA 2VPYB 1ZU4A 2AWNA 2ZT5A 4FMDB 1HI9A 2FPPA 4ZI7B 3IPRA 5G40A 1L4BA 5JQGB 2QD5A 1J00A 4IMJB 1FXRA 4C0KA 4OQLA 4UUNA 5FA6A 1HNWB 3A4VA 1OXTA 1J06A 4QYRA 4RU9A 4V0SA 3FOAA 5F4BA 2XBUA 4DCUA 3DRYA 1KPIA 3MR6A 4ANDA 3FUTA 2V8OA 2VK4A 2JFWA 3BKXA 4M88A 2CQCA 1SCQA 2IBKA 2H9YA 1WHSA 4O0MA 1A71A 3W9UA 1NMYA 4GKKF 1I7LA 3IAUA 4GMGA 4JJZA 1OY6A 3CTRA 3IJPA 4J0HA 3B2QA 3QKRA 4KGVA 3BXGA 4LZLA 1XQVA 1Z22A 3M4ZA 1R0BA 1WUYA 4QYTA 3OY7A 4AD8A 3IVAA 2GZOA 4QYZK 4K8OA 1T0HB 3WXMA 3K5IA 4Y6QA 2PVSA 2CDBA 1ZN7A 4P7FA 3WLFA 1EX7A 1U4OA 2HGNA 5HQMA 1ZH8A 5DHFA 1W5EA 4C7MA 2Q7OE 1GQYA 4UASA 1IN1A 1BGVA 4YROA 1LJLA 3UJBA 3C3LA 4II7A 1E6EA 2Y3IA 2GHRA 1WTAA 2AW3A 2ZRNA 4KN8A 5FV4A 2RGAA 2XOKA 3ENKA 1XTIA 1QMPA 4HI1A 3HRHA 4C8ZA 3O4GA 2RDJA 4MQLA 1Q16A 2WOOA 3HFKA 1WUTA 1N4AA 4EY6A 3DRPB 1DEKA 3B6IA 1ADCA 1JN0A 1ESZA 3CM0A 4Q9KA 2F8EX 1ZOIA 4WGFA 4JXZA 3HCBA 1Y1SA 3G4SS 1Q8KA 3DVAB 5I42A 3A6FA 2QVYX 4QOSA 4GKBA 5KJFA 3IUBA 4M49A 5EX0A 4NS4A 3H8YA 2CLIB 1VIYA 3O8QB 4JL5A 2ZC4A 2B8WA 3TYTA 1N57A 3IL2A 1NH7A 4ANEA 1ZVMA 3GEIA 2CKWA 2GHTA 3MGKA 1TL5A 1IN0A 4J2OA 3LP0A 1LFDB 5CNJA 3LTOA 3JPWA 3K09C 2X3YA 1G1XA 1FY2A 4PXBA 1JRLA 4PC1A 5C2CA 1U48A 5IM0B 1OH5A 3DQQA 3CRZA 4H2DA 2PUDA 5JADA 4R0VA 5EEGA 2PE8A 2PM8A 4XSVA 4PZ0A 4FHGA 2KVQE 1HMYA 5DLPA 5L1IA 2BFDB 3FH0A 2QL7B 2XO7A 1ZJYA 1B73A 4NARA 1E9FA 3LVBA 2A1BA 3A1CA 1I9GA 2GN0A 3A9RA 3AKCA 4WIIA 1Z6XA 3ER6A 2G25A 2DOKA 1YHZA 3BWVA 1SVKA 2AGVA 2H8KA 2GVNA 4TS9A 3WNQA 2V65A 2QUBA 4G6VB 4DJ5X 4NX9A 1U9IA 1FDUA 3KEFA 5MAOA 1NBMD 4U9HS 1V9LA 5BYSA 5EINA 3VC7A 1N6LA 4ZDIA 3SM3A 3TE7A 3F6PA 4M8NE 5LCXA 4XD2A 3U62A 5BPFA 1PR4A 3FPSA 4B3OA 3S27A 3AFGA 4MWOA 4GYJA 3V7WA 1BQ4A 3AP3A 4M3NA 1YZ3A 3THYA 4B17A 4TMXA 5LOVF 3SQDA 4J29A 2O3QA 4RL4A 4MWCA 1NC3A 2CJ9A 4AB1A 4BQFA 3RTBA 4EEZA 3GRYA 4JODA 3MOJB 2WM8A 3WOVA 5GZ3A 4IFTA 5E6UA 3VJRA 3TLXA 5LP6A 5DDOC 4D3ZA 3UE2A 4DN6A 3UK7A 1OBOA 3WHIA 3FYUA 4C0JA 4R1MA 4K4VA 4B7UA 3TK1A 1IKVA 1BW9B 2WJYA 2HHTA 4P98A 1NYQA 1DEOA 5I9SA 2QAGA 3FR7A 4FEAA 1SEPA 5AXAA 3UF0A 4DA0A 5HSGA 1DOZA 3Q89A 3RAEC 3FJYA 3AG5A 1DXHA 1KEVA 4LQLA 3VTIA 2VPZA 4M0UA 4TLEA 2PKCA 1NQXA 5I3UA 4PBSA 3CU5A 2VYFA 1U1OA 2E3JA 4MVJH 3GDFA 2RI6A 1SQ0A 1YOVA 3I92A 3EOZA 1ZH2A 3KZOA 1P0IA 1NLYA 1ZOOA 1JDPA 2VOOA 2FLVA 2FY1A 2X19A 1N6KA 2WSEC 1FDRA 1EAMA 4YDSA 5E41A 1S1MA 2VDWA 2OLJA 5BOVA 1RAIA 2DLDA 2JFXA 4FONA 4XWTA 2DHXA 3K5HA 2OQ2A 4ZTZB 5KFOA 2YQ5A 3H6GA 3IS3A 1ODCA 1GN9A 2BY4A 1XMIA 1OT3A 5CHEA 1R6UA 3M6WA 4MPJA 1S1XA 2BEFA 1ZHOA 4D3YA 1R3NA 1EJ6A 5HZMA 3N6RA 2F9JA 4EBFA 2EEYA 5BYBA 1EVJA 1K98A 3KOOA 1JXOA 4CRWB 4W9NA 1N2EA 4MGYR 3VISA 4Q1DA 1KDYA 4JV2A 2C4HA 3WGLA 1BE0A 1U4SA 1BN6A 1LX7A 3DE1X 3HKCA 2H1YA 2IQ5A 1RZRA 1CERA 1PS8A 2JFPA 1U8TA 4K2HA 4K81B 4Z4EA 5JWOA 4MICA 1ISJA 1L3KA 3C3BA 4LRCA 1EA7A 1JIVA 2WNIA 4DEZA 4Z53A 3KXDA 2FA9A 5ABPA 2X3UA 4I2PB 5D5QA 4M86A 3WLHA 1U6FA 2ZRLA 4NXMJ 1KSHA 4HLNA 2F1FA 4OFXA 1EWRA 2Z43A 4PC6A 5HP1B 1PZNA 3P27A 3ZI7A 4OGKA 4W1PA 3PXGa 2Z9DA 5EUHA 2ZSKA 4NLDA 1TUGA 3W5YA 1NUQA 1NVXQ 4AFFA 4JBHA 3KJHA 2ZU0C 5EYPA 4I1SA 3ZTQA 1M6VA 4MWBA 1P7WA 5EWJB 2R79A 4BS2A 3A4YA 4LSZB 4L85A 1OBHA 4TKZA 1RLCL 4KXFB 1KOFA 3R6LA 3OJSA 3E01B 4QX6A 2IP2A 3UO0A 2I2AA 1XDZA 4DLZA 3HZHA 1RUSA 3LIPA 2IYPA 2WP8J 4K03A 2YTZA 2R4FA 3TPZA 1NZFA 1VJRA 2MOKA 2ZH6A 3KXKA 3KJZA 2VNJA 3EGWA 3EVGA 3SHOA 4G07A 3AH8A 2QZ9A 4W5TA 4B9SA 5IEBA 2P65A 5A9TA 4ARZB 2FQ1A 1Z0DA 2ZJ5A 2QGFB 2DKOA 1QCDA 1Z7GA 2E21A 1WC5A 2W9CA 2V6JA 4Y6LA 1CUZA 4ID5A 2C29D 1Z5GA 3G8YA 4RZ2A 3LY8A 1KSJA 3TBFA 1U0HC 3JWJA 1NBOA 4DQVA 1KBRA 4O23A 5BQ3A 3AETB 3IDFA 2IOFA 4WXMA 3QYYA 1C3EA 4MVYA 1ADGA 2VDUE 1RCOB 3O2JA 3NAZA 3PDWA 2AGOA 2HK9A 1OX5A 1K2VN 4AY4A 4FFSA 1QVRA 2VN8A 1MJHA 1XTPA 5HN0A 3IBYA 5IKXA 2GXSA 4Q9JA 5CLFA 2Z58A 4F60A 4K4UA 4Q2LA 4HEQA 3L8HA 1WL8A 4FXPA 5GAJA 3BGWA 4H7JA 3MJVA 5IH7A 5E7JA 2HHQA 2VJDA 2RKBA 1CBKA 3QJPA 3A4IA 2J08A 3PXDA 4MUHA 4HZGA 4RH3A 5H16A 3HTXA 2FWBA 2W6ZA 4PZPA 5AW7A 3JQBA 3R6GB 3I9V1 4HX2A 4H4EA 4GC7A 2A0YA 4EB3A 1Y5IB 4C7KA 1RLUA 3H1GA 5FWXA 3B5JA 4HZUB 2HT1A 4UEQA 1SUPA 3VUEA 2NZ8A 1AN9A 5DI9A 4DUZB 2DPMA 1BVRA 3VZQA 2I6GA 2ZIWB 4IIEA 4PC3A 4L0DA 4PNEA 1JHVA 4BEJA 5JOQA 3I0ZA 3R8XA 2O2SA 3QXSA 3OCWA 4QJIA 2R3SA 2D3UA 1JFFA 3WGVA 4L4SA 4Y18A 2C78A 1VMAA 4Y6PA 1X7WB 4HF7A 1H2VZ 1GFWA 2F1JA 4MA5A 2GEJA 1DJNA 5KBYA 4WXWA 5A4KA 1W19A 1ULAA 1ZUHA 2PFGA 3MTAA 4R2IA 4RKEA 4ZLNA 4NXMF 3PXGA 3H7HB 1ISSA 1WXGA 4PV7A 5CNKA 5D84A 5LKAA 4DX5A 1LFAA 3ZDBA 2J6TA 1V4NA 3AD8C 3TEJA 3AYZB 4MLCA 3R2JA 3V4LA 4M98A 3FVWA 4Q1BA 5ITSA 1FXDA 2JGMA 4WBFA 4YRRA 1KFBB 3L46A 4R8UB 3DOJA 2E29A 2UUPA 4DRXA 3V8BA 1KYYA 1RWMA 3E0QA 3U26A 1RWVA 3IM8A 2MQPA 1JP7A 3KJNA 1Y89A 2VDOB 1EUQA 1RT5A 1SVMA 1BCRA 4IDEA 4WSOA 4RHTA 2YWRA 4Z49A 1X7XB 4DUGD 3NKYA 2YNIB 4I55F 4ZJQA 4Z2XA 4GO1A 1JR4A 1UM8A 1B1CA 2FGKA 5HO4A 5ETMA 4UCWA 5K45A 5IVDA 1XX6A 1SIWA 1AGNA 2AYMA 2DFTA 3UAYA 2QXYA 4DIKA 1DT5A 1FSFA 1C2PA 1Z12A 3PR3A 1VQ4S 3QJ5A 2W93A 4RR5A 4HH1A 3Q6NA 5CXUA 1R7IA 2FW8A 3AH6A 1V8PA 4AWBA 4OYIA 2WB2A 3G49A 3U7QB 4P9SA 3LTNC 4DPYA 1OR8A 2C2ZA 3J81A 1KYVA 4OQMA 4P4UA 2XNJA 1AQNA 5DB4A 3D6HA 4IHKA 2OV4A 3SQGA 5KHLB 4OXXA 4P2MA 4D3SA 1JILA 4HXFB 1B8OA 2OB2A 4KYZA 2NO5A 3CRNA 3TTUA 1F20A 1DZ5A 1RWNA 1ZXXA 3DKKA 1Q92A 3A3PA 3BIWA 4MO2A 2ID8A 7AT1B 1JA0A 2BEUB 3VDXA 3EDQB 4ND8A 3MM5B 1M2KA 4RM2A 1ZSYA 3Q8UA 3L4JA 4RK4A 3DLKB 2GEDA 1YJ8A 4OGFA 1QAQA 1SD1A 5EJ9A 3RAGA 2CD7A 3SLGA 4LXUA 2J5RA 4BWVA 3Q11A 3BGRA 1NQTA 2ISSD 3EIFA 4B3XA 1KN6A 4F0HA 3BO2A 1Z45A 2XHEA 4KG7A 3H98A 4J1SA 5U4QA 1NKTA 4CHGA 1RTHB 5J2TF 2ZYSA 4JLVA 4C8KA 3NKVA 2C7GA 4GLBA 3LUCA 3ZWXA 4CMJA 1M2HA 1C9YA 4ZVQB 4C3OB 1L1EA 2ZXEA 2KTQA 4ZAZA 4CCYB 1E2FA 3T5HA 4WIAA 3OWXA 2FFRA 1J8MF 1Q0LA 1RA6A 4UZBA 2FKNA 2HLTA 2JDID 2FVCA 2VJKA 3OFNA 3IAM9 2QE7D 1I1OA 1YHNA 4HQKA 4GXRA 3PB3A 2FV8A 4FQ7A 5C24A 2DT9A 5LZ8A 4CI9A 4IR1A 3UICA 3B2EA 1CJSA 3V6MA 1HETA 5E33A 4NS1A 3JRWA 1SBQA 4TYQA 2BE7A 2XT0A 1OILA 1EVZA 4DRYA 4IDQA 3QUCA 3WLNA 4JP1A 1PBTA 2MSCB 1EXNA 3A6GA 2P68A 2ZBUA 2XC9A 1XLUA 2RDIA 1P29A 2EBGA 4BGIA 5KVQA 4YK7A 1Z5PA 5HAOA 2M5YA 1BQNA 1LWEB 2OLWA 1NJZA 1NDQA 4OQPA 2IL1A 4YAEA 1X2BA 4XSGA 1O54A 4DLEA 4EVRA 4HH4A 2JI7A 4N8SA 3OZFA 1KWGA 2ZIXB 1XZFA 4TMWA 1A72A 3PYEA 1U2EA 3GOHA 2FZGA 2OGUA 1ZNZA 3GFYA 1WA5A 3BGVA 1P9YA 4L95C 4U0KA 2Z1MA 4IRKA 1SXQA 5I3QA 1FU8A 3S70A 2JRLA 3KB2A 1A6LA 3LW5C 3V1KA 3GMDA 2VS1A 3IEXA 3O2QB 3GFSA 5KPDA 2VUGA 3IFSA 2HMVA 1FRJA 1WPQA 2P27A 3CPHA 3EBPA 3KQMA 4OATA 4UTGA 3BH6A 4C5BA 2Q6LA 4RMJA 3N8GA 3RC7A 5D4OA 1RXCA 1UEUA 4FE4A 5CVDA 5FQOA 4QPZA 1N8SA 4IQ0A 3N7TA 1WI8A 4UDXX 3FW1A 2IIBA 3PHTA 2RH8A 1RYHA 4ZCKA 2B4UA 1JEDA 2XOXA 2YXNA 3AIKA 5DP2A 4AS1A 3LLSA 4K6GA 1N5KA 1D1TA 3A3NA 2HN9A 5I7HA 3TLCA 1DQSA 3RSLA 1PJZA 2R86A 3AM3A 2OBYA 1JFLA 5LDHA 3BE4A 1RHMA 1GNSA 3TE6A 2YL2A 2MINB 4Z4FA 1S6OA 3OQIB 4MVWA 5LNK6 3IPXA 5CABA 3OP4A 4H7EA 1IHPA 5ADWA 3BEGB 4JI6B 4LRQA 3IXQA 1P3JA 1R18A 2P5SA 2OCIA 5J47A 1ISRA 3DHEA 1URRA 5H68A 4TWBA 4DVGA 4HAWA 1TRHA 4NQZA 1NVMB 5FI5A 1BWSA 3MTJA 3K0AA 1J5EJ 1H0HA 1T2AA 2FN4A 1E4EA 1AGYA 2XQCA 2QSJA 2EYUA 3D9BA 1ZJJA 2CF5A 1TCBA 2QF7A 3N8IA 2FPXA 4PYIA 2CADA 3DLEA 4PGMA 1CK4A 4XEUA 2JVIA 5TS3A 2W2NA 3CR3C 3DULA 3Q8QB 3JSBA 1RD4A 3EJMA 3AFIA 4LRDA 5HKLA 2IAJB 5CVCA 4I2QA 2ZJZA 1A3CA 1M67A 3BF8A 4C3VA 4TMZA 3ZO7A 2RHCA 3TZQA 3B1JA 3EEBA 1E5TA 5FP0A 2ZNYA 5HGXA 2F8SA 2Z30A 2KB2A 2BUCA 2EV9A 3GV0A 4NATA 1IM6A 1PKXA 1E9EA 1G9SA 4N76A 3M8QA 2QEQA 4H4MB 2OHJA 4OSOA 3KQYA 4TLRA 3SY8A 4YJFB 2BGLA 4XXHA 3C5WP 1ZTWA 3DMHA 5JCOC 3VU0A 5J2NA 3EOBI 2IA5A 2Q41A 2JK0A 1QAOA 1CJTC 5DHAA 2RG7A 3E3NA 5DP1A 5E0KB 3GCDA 1OX4A 4GH5A 3FQKA 3CRW1 1DO2A 1QH8A 1FFWA 1Q1EA 4K1LA 2QORA 1CUBA 3FCAA 4Y2XA 5I4CA 4DT1A 3G0IA 1QIMA 2PNFA 3COSA 4JLDA 1W52X 3G6VA 4PTLA 5EMMA 2OL4A 1SCIA 1BOFA 1U9CA 1PAUB 2O6LA 3LGHA 3PI7A 4EO7A 4NYZA 2HZCA 4DDTA 1U6IA 1J0DA 1IQPA 4LJ9A 2QV0A 5LYJF 4R7GA 1EYZA 5DHTA 4PGAA 2CV1A 3G02A 2HU5A 2QVBA 3O21A 4QYIB 4E94A 2GBLC 4JEHA 4X1YA 1N2XA 5JEEA 4JCOA 3SV3A 3CDWA 2B56A 2FGCA 5GOTA 3RYCB 3FI0A 1OAOC 5H1SV 3NC0C 4DSTA 1FB5A 3GD7A 3IOMA 1KO5A 5E3RA 1IKXB 1GQFA 3ZLBA 2GEUA 4LJ7A 1L5UA 2H31A 1R64A 3B89A 3Q5DA 1YVFA 1DO8A 2BL4A 4JI2J 1ZOTA 4BQPA 2OHOA 4QT0A 4CTNA 4TYYA 5K0CA 2ISQA 1VJDA 2IV2X 1T2FA 4B3RJ 1U2FA 1KJIA 4Y1GA 2CPZA 1FT8A 2AX0A 4HXGA 1ODJA 5ENZA 3L92A 3QMQA 2JLUA 3U6KA 4M5KA 1P5JA 3WKDA 1T9TA 1RRVA 4CLWA 4DN0A 5F3ZA 2CFOA 4BP1A 3JWPA 3HU1A 2EFNA 3OQ2A 3NT4A 2O5VA 3PENA 1A95A 3MXTA 1NBIA 2WHEA 1PQYA 4B9AA 1C4OA 1QYXA 1RSCA 1J5EF 3G85A 3ER9A 3WB9A 5JPCA 3H90A 1W34A 2AV6A 4L72A 1B99A 4CIVA 1I6LA 4TV8F 5K3EA 1R0LA 4B3TJ 1WXDA 2VFVA 2HEGA 3SQLA 4CF6A 2VG5B 1V95A 3HMKA 2CUTA 2Y1LB 3D3WA 1YB2A 1ZI8A 3LF2A 4W6ZA 1EQUA 2EJUA 2PFFB 1QOZA 3DEKA 3QH4A 2I2WA 2GN8A 1NJYA 1JI0A 4MINA 3QLVA 4YV2A 4L08A 1A7JA 4QIEA 2YH0A 1VL0A 1LOUA 1MHTA 4JBXA 3K1YA 2EJWA 1UFWA 1NEEA 2WONA 2VATA 4YR7A 1R43A 5KWEA 4HGYA 4CIDA 2O0JA 3GHHA 1XEZA 1M5PC 2IZ5A 3KPJA 3MS4A 3WNZA 1ONBA 2DUNA 1S0OA 4KITB 5DIZA 2IZZA 3BVPA 3QQPA 1ZK4A 2NX2A 2PU7A 3AW8A 2AC7A 3HU3A 1Z62A 1GCAA 4QGFA 1GXLA 2Z57A 2RH5A 1JAIA 3RWMB 2Z6UA 4R71A 4B2IA 1C0UA 4H0NA 3E23A 2UKDA 2HZAA 2X4DA 3FPCA 1HBNB 3EPJA 5A76A 4CJXA 3ELBA 2NTNA 4LE1A 5LQKA 1HT3A 4KDCA 3UUFA 1GSHA 2HR1A 3NNSA 4HS4A 1U8EA 1NMXA 1G7CB 5IV4A 4B3GA 2DAPA 4TY9A 2XZTA 3AIOA 4U96A 1NXVA 4OGWA 1L4GA 3DE6X 3JVVA 3MMSA 1CLFA 1JEJA 1Z3CA 4I5IA 1EWYA 2O5CA 2DH6A 4TKUB 3CQ9A 4JI2F 1ZNXA 3FDJA 3MWBA 4IWYA 4NQRA 1IXYA 1HYGA 1QGUA 2IUYA 3D8HA 5ALYA 1I1HA 2YWEA 3DCAA 3EXYA 1RBOB 2BOAA 4B3RF 4RIFA 1G2PA 4IEFB 3CW9A 1YBTA 4O4LF 4NA3A 3MCWA 4PFSA 1BMTA 1SKSA 3O1JC 4CW7A 4F04A 1T9YA 3WDOA 2MIIA 3P26A 2ZIGA 3L02A 4DCGA 2C9CA 5BN3B 4CV3A 4NENA 4R2JA 1OYWA 4AL5A 4C6TA 1UK6A 4FF3A 2RHTA 2WRZA 4X8HA 5DGIA 4CM8A 3HL4A 1K68A 5KQGA 3O0TA 3SJAA 1VGYA 2IE0A 5CEEA 3HVRA 1RJFA 3HN2A 3MG9A 4MKFA 3MTDA 4O29A 4OHXA 4LBPA 1XEWX 2DFNA 5C8YA 4A4JA 3K5OA 5ERYA 2VHUA 4N8EA 5HSPA 5LOVA 3MCAA 1JLAA 3WQRA 4FR0A 2C3UA 3GK3A 2NU9B 4B3TF 1KDOA 2XM3A 3AQIA 2BJ3A 1W0JD 4AZ0B 4LYYA 1IHDA 4MLPA 2ZYUX 1VGVA 3SS8A 5FTNA 3VKUA 2WUGA 2P2CB 3QOXA 3RV3A 1Q7CA 4DMRA 3D6MA 4QBKA 1X5OA 1VRUB 2AD9A 1CC7A 8RUCA 2RDMA 1R3UA 2Z8XA 2NU7A 1XVUA 3FHTA 3DZGA 3IKMB 3NWJA 2HGSA 3ZU6A 3O2IA 3FPBA 1SCUA 5AOBA 4ZT2A 1CUAA 1WDTA 3ZU2A 3ICQB 4IUCS 2BSQA 2FW0A 3BMQB 3C7KA 2QRHA 1IM4A 3C6YA 3G6YA 2PUWA 4WKGA 1HZZC 1E60A 4RHCA 3SSSA 1HYQA 2PPLA 1NV9A 2WF5A 4B1FA 4QOEA 3FTDA 3IAFA 2I8CA 1YA8A 4B80A 3R7SA 4EATA 2Z95A 2B20A 4ALLA 3STVA 1CHDA 1S2IA 2WU8A 4WZZA 1JLEB 3U1VA 2Z56B 1RA7A 4DNQA 3R3HA 1OB5A 1JZTA 1YLXA 4BEVA 3T9FA 1RQ2A 5B6JA 4QDUA 2AUMA 4IDHA 4CLUA 1RI3A 3Q88A 4P71A 3AZQA 4EJSC 3TINA 4DXHA 4MPRA 2HBQA 2JLWA 1FQWA 5ETRA 4POAA 4KMOA 5FPHA 2Z83A 1C0EA 1XSEA 4LXHA 3OSUA 3N59A 1AGRA 1H8ED 4IH5A 2ZVDA 4CIBA 3LHIA 3PDUA 5FOWA 5JAPA 1XPJA 4ELVA 1HW8A 2A5FA 4GP7A 4Y0FA 2CWDA 2PD4A 4RFSA 1W36B 4Y34A 4QJ4A 1T13A 1EZZA 3DTVB 2GUWA 5EJMA 1KVIA 4OZNA 1FMJA 3DRXA 4NFSA 3GU3A 2WWWA 2QRNA 1ODLA 2RMKA 3KKPA 1RHKA 5TR9A 4KKVA 1MKYA 3SK0A 3SV4A 4RWEA 4TV9B 1LJ8A 4U7JA 2KM8C 1B0ZA 1TT5A 4LJLA 4JJAA 2FMTA 4RTRA 1SXJB 3MWJA 4HDMA 4OHFA 2P3SA 4HNHA 4Z7QB 3MGGA 5EWMA 2X5XA 4L78A 4CTAA 5AVSA 2G0JA 1KI1A 3INTA 5K0JA 4Q5IA 4ANFA 4EB6B 1XXHE 5IZCC 4TRJA 1P39A 4B40A 3WX4A 3UAGA 4LS3A 2DJIA 5C42B 5BQPA 2A9FA 1PGNA 3FNBA 4LNHA 4LK2A 4D4GA 3P2KA 5D3GB 2W98A 3A9UA 2MZSA 2XNDD 3I2IA 5L9NA 5KIAA 4JX9A 3KHLA 2D62A 3ROPA 1I51A 1O96A 4L07A 4X4NA 1NDKA 2CPYA 1K92A 4X0EA 1DDGA 2JFNA 1XP5A 4F4DA 4GM4A 1V26A 4NPAA 1TU3A 1XQWA 1B6GA 2QR2A 1ZA1B 4OX9B 2ZIEA 3GMGA 4FX2A 3U13A 2BJVA 4U7CA 3QA3E 2NUTA 2ATLA 3HFSA 5DI3A 1TVCA 1Q8IA 1GLNA 4F6RB 2C7VA 2GEKA 1ZKDA 2WRMA 5A0FA 4AMGA 1TCCA 4LYHA 3O94A 1XVTA 2QW1A 2AYZA 1D9AA 4YH1A 2YR0A 1N56A 1I4TD 3WLEA 1ORIA 3BH7A 2YHUA 2FMXA 1G20B 1DQ9A 3FCVA 1YRHA 5FOQA 4M94A 1P8AA 5M5BA 1SVLA 4A6DA 3I5AA 3D2WA 4C8YA 5CHYA 3PXAA 3I4FA 1NKVA 1TEHA 2IVYA 4OZLA 5DWVA 3IBTA 1YE5A 4L0CA 1UFLA 2WLSA 3A3KA 4RPIA 1GPLA 2C2OA 1NZJA 1JVNA 3EXIB 3MMCA 3DV9A 5HIJA 3EVNA 2GR9A 4I6GA 1LS1A 1VRWA 1S9EB 1HRKA 1W5AA 5KTSA 2Q7XA 4R1PA 2BKVA 2PUAA 1UANA 3RS9A 2WVEA 4CM4A 2B9WA 3ZZ0A 1ESDA 4C03A 1KF0A 5DW0A 1AKWA 1FXWA 5M2RA 3IUEA 1NA5A 1R4ZA 2YXEA 1U3WA 3SZ3A 3AIMA 4ZU3A 1G5QA 1VECA 2AJ0A 3I04A 4Y0AA 5JS8A 2KMLA 1JHRA 4F21A 1LPBB 3FKBA 4INOA 2RILA 3QFSA 2PGCA 4G4JA 2JDIA 3G6XA 2NSYA 3PW2A 2P1RA 2YWGA 1QRUA 4U6QA 1QOPB 4ZVUA 3WICA 3KEQA 4CFYA 3OF3A 1LBEA 1L5NA 2PT9A 4BFZA 2BFPA 3INNA 4PO3X 3ET6A 1PGZA 3VXKA 2UUCJ 4PYKA 5HATA 3CCWA 4IP0A 4MYCA 3IPYA 4FKBA 1W4AA 2GYWA 2Q0QA 5CZXA 4MMYB 4DQKA 1RTIB 1YZ6A 1GDDA 1WABA 3D9QX 3GJTB 4HH0A 2QAJA 2F9MA 1UPMB 3GGCA 3DGEC 1PJ8A 4BTEA 3H9JA 4RNFA 2ZYHA 4K59A 1RXEA 1F12A 2FTKE 4N82A 1YJWS 2UXDJ 3GT7A 4GSKA 5EUCA 1XTTA 4MQ4A 4IXMA 1C3OA 1FFXA 3FE2A 1BXGB 3JSXA 2ACVA 1MO4A 1T0JB 5SYNA 4M5MA 4OMDA 3RH0A 3TVTA 3M3PA 4I64A 2I38A 1H05A 1TQDA 2CCGA 4FIDA 2BBOA 4I55A 2R65A 4HFRA 5TV2A 2VWPA 2W1BA 4PBRA 1T5OA 4O3FA 4XYBA 1DTTA 3S1TA 4NV1A 1J9ZA 4NLRA 5G4KB 2PZJA 1QO0A 2UYYA 3ZWCA 2PMWB 4RZSA 5CCBA 1L4HA 1K4MA 4PQEA 1H4SA 5ESRA 2AMCB 3DTNA 3CX6A 4RY8A 2BDUA 1ICEB 1FUKA 4YV1A 3P8ZA 3ZV6A 2YNFB 3LBYA 3G6KA 2RFLA 4PRKA 1KJNA 3MTIA 4S1NA 4UTZA 3PVSA 1ESCA 1PQ4A 5CAAA 5BQFA 3H40A 5CNIA 4IDNA 5KNDA 4N12A 5I8WA 2PKEA 2Q4RA 4CP5A 5EJ7A 4PWDA 3EVEA 3D3QA 4KSBA 2QUHA 4E3ZA 3CKLA 4QREA 1GU7A 3QWPA 3EG9B 3SF8B 2CYAA 4C0WA 1S1VA 2B6AB 3E22B 2AKEA 4QNRA 1JPNA 3FCUB 1KZ4A 1GG5A 2LNDA 4Z4GA 3VJLA 4MUYA 3RU7A 4G4SO 2QTAA 2JATA 1UK9A 1CTQA 4C21A 3QNMA 4RHYA 2B36A 5MDHA 2YQ4A 4RD3A 4L6IA 2O3DA 4XWWA 4WXEA 2AF4C 4X62J 2CDCA 1NPPA 4BLSA 2WB1D 1GPWB 2X7JA 3L6RA 4EUKA 1E5VA 3CG0A 2I91A 5A2GA 2XWJI 4WP3A 1DGQA 1J2VA 4BV9A 4PTZA 1V1RB 2M2BA 3MNFA 5HRAA 1MA3A 3ZDZB 4MP3A 1PEDA 5J2TA 4F4HA 3M2VA 3CD7A 1E9BA 4F96A 3GO4A 1W75A 1SR8A 4HEJA 3UAVA 4AFNA 3RS7A 3ICVA 1D4OA 3ETNA 3V6DB 4P80A 2O01C 3EQ2A 2Z4RA 2UUCF 1H9BA 2EBFX 2GN6A 4Y1FA 2MYNA 3VU9A 4Q3CA 1DT3A 4K50A 1XN9A 4V02A 4O4HB 5K5EA 4L3WA 3JAMA 2HIHA 3D64A 4JBYA 3ZYCA 3D4LA 3IP7A 1F4PA 3I82A 2VT7A 3C7TA 2QLJA 1SJ1A 4OZ3A 2IDKA 3WISA 1LQTA 2VSNA 3MEGA 3CUTA 1ESNA 1WP4A 3N6NA 2H5LA 3NS7A 3NS6A 4CF3A 2H1WA 3JSAA 3NHUA 1E62A 4AS3A 4MYTA 3TG8A 5COQA 4DCTA 4ISBA 3L82B 2I2DA 2FEOA 4DR7J 4JELA 1Y8QA 2XMWA 3A9CA 3NXSA 3UH1A 5JZMA 3IVMA 4H27A 1VJCA 4ARSA 4RTJA 3AEUB 5AUOB 1U09A 3WIVA 4QOIA 1RCUA 4AF8A 3CC2S 1OZFA 4E5MA 2A6MA 2OV8A 5EJGA 1OSNA 1UBUS 3U49A 3JSMB 1E3MA 3PWZA 1ZUNB 2P30A 2GLUA 3D0OA 4YRLA 2WTEA 1YRYE 2O0KA 4ZAFA 4ID8A 5BYKA 1Z5UA 3FNGA 2QRUA 3H2GA 4R8MA 1VJGA 5GMOA 2CQDA 5K01A 4A47A 1JEQB 1JWBB 3AT1A 3J81k 2IRYA 2W8LA 2BVZA 3FYDA 1XGKA 3C1UA 2EKNA 3C7CB 1OJLA 2QTLA 1XCLA 1MO2A 4EYHB 1M7GA 1Q0UA 1Z6QA 4ZC1A 3WAGA 3CIOA 3TTYA 4OH7A 2RCNA 1MB0A 3PKIA 5ICMA 2IEAA 4EFMA 3IAHA 5H81A 3U1TA 4DCOA 4AMBA 3N53A 3L1IA 1KQFB 4BNUA 1YVEI 3R2CJ 2O5DA 2E5JA 4YB8A 4JYAB 2I2BA 3TM5A 3JD2A 3VNQA 4PCLA 2BFOA 1JU4A 4JI1B 3CLSD 4A5OA 4GW3A 4BWJA 1V5EA 3KJFA 1UVNA 1AF4A 2ASEA 3K1TA 1L3UA 2ZCVA 1KOHA 1NTRA 5BWCA 1GRNA 4P83A 2FW7A 4JI0J 1GZUA 2QROA 3LDHA 3BCRA 3U9SA 4PN3A 4KMSA 5C32A 1Z5ZA 3A1SA 4IJKA 1JBQA 1XN1A 4X62F 2QN6B 1S0VA 4EHLA 1TCAA 5FPKA 2GSDA 1M74A 4D42A 1UBOS 1OTHA 1DTQB 4L3KA 1FDNA 3H9BA 4MR9B 2HX1A 4MI9A 5EJ2A 1JLFA 2ZIVB 1KDRA 2Q62A 5CT6A 2G83A 3BB1A 1Y9AA 3TAMB 5JLAA 2Q6OA 3E61A 4LXIA 4UNRA 4HHJA 3MMJA 1U0LA 1XIVA 1ULTA 2CXTA 2FGJA 5JECA 2A88A 1TAGA 3AXTA 2RHMA 1UL3A 5K20B 1S6PA 2Y0BB 5E38A 2RBEA 4ZYWA 4JVSB 2PIDA 4KN6A 4PX3A 2PT0A 2IM0A 2J9XB 3ASVA 4CL2A 4ZVOB 1Y3CE 2HWKA 4CLDA 2GBIA 3HSSA 4F85A 4TS4A 2ZJPQ 5FNZA 3UMVA 3JARB 2VNSA 3ZI0A 1XDGA 4Y2YA 3R75A 1NC1A 4WP9A 4C11B 5KT3A 4BUCA 3JY6A 5I3ZA 3GOQA 2IKSA 1WG4A 1CZUA 4HPXB 3ZGLA 2XECA 4KLRA 3TTVA 1Y3FE 2ZKLA 2HOQA 1V3ZA 1BCSA 2FB9A 4PQGA 2XMRA 1AXRA 1JTFA 4BNGA 3NTLA 5K6RA 1XNQJ 5JPIA 2WWRA 2QMWA 4DR7F 5F35A 4LGYA 4B6QA 3GN1A 5SV2A 4LPKA 1W581 4NYOA 4EMTA 1FVHA 5HROA 5KDLA 2F4VJ 1JR3D 4ZHRB 1JJFA 3JXEA 4B4UA 4B3HA 3UA3A 3HKBA 2V9WA 3LHKA 5LJ5Y 1UODA 3BGLA 3NBAA 1A1VA 1E2DA 3OSZA 1X8JA 4Y9DA 3JQFA 4LMZA 2PJZA 2DGVA 4IOBA 4X1IB 5A8KB 4JQCA 4X4VA 2V0GA 4HT7A 4NECA 3R1HA 2LYVA 4ILLA 1NQUA 3ESYA 4IS2A 2DNNA 2HLNA 3N1UA 5HJYA 3ZLJA 3WLJA 2CNLA 3G5TA 1R12A 2QA2A 4AUKA 3ORQA 1R27A 5K8NA 4DE5A 5DLDA 5LYJA 3RB4A 2RGBA 4PEOA 3JQGB 4DLWA 2J5AA 1V6AA 3LT1A 1RJEA 1Z39A 1AZTA 2PXHA 1A7KA 1NK6A 1PT5A 3BYZA 5HK4A 2HHSA 5H3CA 4FFDA 2P6SA 2YY3A 3O74A 2ZWAA 5A71A 4MKBA 4G01B 2YWKA 5DXAA 1TNDA 4M54A 5FF9A 1YR6A 1D0EA 2W2MA 3G82C 5KYXB 2FPSA 3RR7A 3KK1B 3GG9A 4Q02A 4JI0F 4WXYB 4K7JA 3G8BA 1JS1X 3KVNA 4PIVA 1EX6A 3AR3A 4GZ3A 1XRLA 5ARDA 3NG8A 2J0UA 3I3OA 3CNQP 3MOSA 1ACLA 4C3UA 1S97A 4AMYA 2OENG 3EUAA 1SXPA 2F43A 3NUZA 4ILMA 2A3JA 3T3IA 2KT3A 4RW9B 1JSRA 4X7MA 1JLLB 2JSXA 1HFKA 4C5CA 1WO8A 3BRQA 4UDOA 4XQGA 2X9QA 3COYA 2GD0A 3IURA 4CQMD 3PGA1 4OZ0A 3LO5A 5JU6A 4QBHA 1ZD5A 3T1YF 1EI9A 3AMVA 4U5QA 1KY4A 1RFLA 2QBYB 3P2MA 5M29A 2FJEB 5FWYB 5IHPA 5KOHB 4FN5A 2LXFA 4TV8A 1TAQA 2C8VA 3HA5A 2XCIA 2HNDB 1RTKA 3IRWP 4KPGA 3W5IA 4CUKA 3GXOA 5EE9A 3W9IA 2NO1A 2C28A 3KB8A 4P9NA 1Q0ZA 5DTJA 4ECZA 4Z9XA 3C16C 4E5UA 1VR6A 2DBZA 4QXQA 3H75A 1CDOA 4JH0A 2YASA 1OB2A 2EX1A 4JBCA 3N5BA 3M30B 5SYAA 1NK9A 2P2YA 2P9ZA 1DEHA 1XNQF 3UJDA 3FRZA 4XW2A 3PEVA 2GZ2A 2RKWA 2JFFA 3UG7A 3C2QA 4LHVA 1UXJA 1RYZA 1FI4A 1CVIA 2F4VF 3OTOJ 1B2LA 3N2KB 2OBNA 3Q12A 4XGKA 1KSPA 1XRMA 2BRUC 1K7FB 1UKZA 2OK7A 4ALIA 1H0SA 3DHYA 3VZHA 2C92A 3WK5A 4RSMA 1VL2A 1KXJA 5ARBA 1CUGA 1XROA 1YS1X 3M33A 1L4UA 2TRSB 3EMBA 2GGSA 5H9WA 1NLKL 2V7UA 1DE0A 4WCFB 4CODB 2IPLA 3EDRB 4QO8A 1IOLA 1NQVA 1TUVA 3MMPA 3CLUD 2BIFA 5DPMA 5C8YF 1H4TA 1QPBA 3AJ9A 2HRZA 1BXZA 2A35A 1I6MA 4UBLA 5BSKA 1DKLA 3T94A 3KXIA 4EO4A 1M1NB 4WJBA 2H48B 2C2DA 5DBEX 1VRTB 4JV5J 4GQAA 1X0PA 2NYVA 3RJMB 5IDWA 10MHA 2LLZA 1RHRB 1L3BA 3UJNA 4BRUA 2JC1A 3SDEB 1FESA 1EM6A 3GAMA 3TX2A 1FNBA 1DRJA 4W7SA 4FGLA 2QY6A 2JGAA 4D3XA 3ZNJ1 1ZNYA 1GJRA 2R8OA 1UVMA 1SAYA 4UW2A 4MDHA 3PPVA 4ELUA 2Q50A 1VRVA 4Q3EA 4O4LA 1A82A 3CMAS 4PGGA 2CDQA 3J81j 4GM1A 5ETJA 4R9UC 4KR2A 1JIKA 2DVIA 4LZAA 5AJUA 1FJ2A 2ZTUA 4HAXA 2X5KO 5ICCA 4DDWA 4CV2A 5DK4A 4BVKA 3N6VA 3H4IA 5H4HA 2QTBA 1QJCA 4Z3KA 2OD6A 1LC0A 2XMPA 2GAHC 4KDEA 2PSHA 1L6IA 5JJBA 5F7XA 2VFRA 3WSVA 2O2EA 2TYSB 4Y6OA 2P6TA 1M1ZA 4CWBA 3WGQA 1VBNA 4IDAA 1SIOA 4QUBA 2EFYA 1JHUA 1NJIT 2VK2A 4I4TA 1B1AA 2GNOA 4BIMA 1AA6A 1AK9A 1CDEA 3V7UA 1YCHA 4YYEA 4BNYA 3ZWBA 1AKVA 3P5TL 4OB8A 4HQNA 3PEUA 4II2A 1HQUB 3TWZA 4ISCA 4ALKA 4KXWA 1C1DB 2ERRA 4CKBA 5CD9A 4N18A 3TOXA 2IXEA 1X9WA 2BM8A 1NHWA 4Q37A 2ZB7A 3D0IE 5C1OA 3BDIA 2G17A 3K09A 2CXXA 1UETA 2WB4A 2ZUBA 4A0SA 2G1HA 1DHTA 4WBSA 4F9TA 1XKTA 4QDZA 2QL6A 4C0SA 3KZCA 1Q8BA 1WEKA 2AMLA 2W4PA 3KM0A 5U9CA 3VPBA 4TWIA 1HXHA 3EGIA 1ULSA 5AK0A 1JIQA 3OTOF 2C0CA 2IHR1 3RANA 1B00A 4LUBA 3RM3A 4RMHA 3SZGA 4YREA 3REQB 4JYCA 4E1BA 1UBRS 2ZBIA 1JLBA 2J87A 4I9GA 1R6DA 3P9XA 1KWMA 3S2ZA 3WQHA 2PK3A 2Z2KA 3UM9A 3IQHX 3T0FA 2FR8C 1IKWB 4LXTA 5K6AC 3TYXA 3CSSA 5DETA 3TVZA 4A8FA 2LGJA 2Y1IA 3KDSE 4DR2B 2PGOA 2I6UA 2VDVE 3BD7A 3DL4A 4KKOB 2X6TA 1TJ3A 5JXIA 5FUQA 4K9SA 4TSRA 3DD5A 3WZ2A 1X8LA 1ZCBA 3DJFA 2A57A 5EJEA 1UVKA 1S79A 3T38A 3AF6A 3ITHB 2JLVA 1M2GA 3KDPA 1JNRB 1URNA 3UWKA 3PNSA 1N6HA 4P4SA 2FRXA 1ZMBA 5FQNA 4DJEC 1KWKA 2ORYA 5EZ5A 3ETEA 3GDHA 1JX4A 4NKRA 1NXTA 3EC7A 2KI5A 4PAAA 1HFEL 3RC8A 4KTQA 2HHXA 5T5QA 4TQAA 5BW8A 1YZHA 1U8XX 4ZPAA 4A2PA 2OHFA 3ZQJA 1Y81A 4X20B 4YJ3B 1B64A 4CUJA 3M8KA 3Q85A 1E1CA 2YZMA 1MU2A 1YRAA 2R6FA 3PY8A 1QE1B 5F8IA 3I55S 1OV4A 4QYSA 3NS5A 3VR3D 1L8AA 2BZGA 4M76B 1EJ2A 1Q4RA 1UZLA 1NSAA 2HBYB 4NCGA 5B08A 4D9BA 1T3LA 4P4NA 5L38A 2A0UA 1EFPB 2BP7A 3IA7A 3AI1A 3RRXA 4YR3A 4JLKA 3OE7D 4KRFA 2MXYA 2UV8G 1BGWA 5FOXA 1JUDA 4IJ5A 3FA2A 3KLPX 1G291 5KYUB 1YB7A 1IJFB 1R89A 2ZRFA 3AL3A 2FUG6 3BGIA 4UM5A 3DS8A 3A6PC 2ATIA 4RVSA 4G2TA 1HFWA 3GROA 1AB6A 4MR8B 3MINB 2V7QD 1H8HA 4A0RA 4EMDA 2OY0A 1RXUA 1Y6RA 4A8QA 3LWBA 2P8IA 1NSTA 1FXWF 1JLCA 5F8GA 1YI8A 3F6BX 2VDQB 2Z5VA 2J5KA 2MEWA 2P5YA 1RT7B 3THOA 2GJKA 3W8EA 4F11A 3G5LA 3NYRA 3RJ9A 1APBA 3TR5A 1I3LA 3BFPA 2DECA 5BVGB 5AI8A 2OSQA 4DREA 1Q44A 3NMAA 2AGQA 4A03A 1ZAKA 4X3CA 3ZDDA 4EX7A 2WU1A 5TQ0B 2IDMA 2W70A 2DHCA 1Z74A 1UMDB 1JQBA 1T3GA 3ZDXB 2HA5A 1IQUA 2O20A 1X1DA 1XQXA 4OAOA 4TPKA 3MM4A 2IHYA 4AL6A 4C97A 1SG9A 3ROKA 1MB3A 1G63A 3H0KA 1CU1A 1FEZA 4L9SA 3SQNA 1VQ9S 5IV3A 3OTWA 3CLSC 2HFOA 1DU4A 5HF9A 1GU1A 2FPHX 4F4UA 3K2IA 1MX1A 2PVPA 2Q3BA 4DNOA 2Q2VA 1TTHA 2VF8A 4E46A 1Z0FA 1OROA 3HDQA 4DTIA 2R5WA 1SUDA 2Z0GA 4C43A 3ZWAA 2CPEA 2RSLA 1GILA 1VE9A 4OQFA 4G97A 4OBBA 1KYQA 1Y34E 1ZH4A 4KH0B 2V7VA 3EVFA 3WO1A 2GD2A 1N8TA 3D3JA 5TPZA 4B6SA 4ZARA 4XYGA 5HDQA 4G0XA 3ZTYA 3AEXA 2IVFA 2YW9A 5D4LA 1RYNA 3EIEA 2VEOA 4KPUB 4BAGA 1HA3A 1JFVA 1UVIA 4NCKA 5D6OA 3LDGA 1TPYA 1NZ8A 2IMOA 1CRWG 3AEKA 2BX6A 5CJJA 1P1HA 3SQOA 1YVUA 3E7DA 1PEAA 5AVQA 1U0HA 5AJZA 2ET6A 2AQKA 2Z5FA 3ILIA 3DZJA 2AIRA 3JATA 3VVCA 5C37A 4TLLB 2VC2B 4HLBA 3AW9A 2D00A 4HDSB 3A8IA 3C98A 2PBLA 3NV7A 4K6HA 4O02B 2MY7A 4IKEA 3MMXA 4QSMA 3MOIA 3BD6A 2VRWA 1LK7A 4WFYA 1EQ2A 2Y4NA 1XKQA 3VTZA 1T03B 4E5VA 3UANA 2X9NA 3HGTA 4Y6RA 3VV3A 4YRMA 5J2QA 1EQ0A 2DC1A 5LJ3Y 3QPBA 1FYWA 4CMKA 2R1ZA 4RDXA 1KJWA 5KWVA 4GPD1 3GZNB 2UYHA 4N9WA 4PR0A 1I2BA 5KAPA 5CTJA 4K3VA 3GVIA 2XMVA 5KTTA 5AKXA 2P4EA 3NBQA 2CNKB 4A3SA 1T9GR 2GBCA 3KMSA 3I1FA 3DDSA 3HI6A 2P69A 3T15A 2AX3A 1FP7A 2B7CA 1CQMA 4IWNA 5TPWB 3P8BB 2IBSA 1QFXA 4I14A 2XYHB 4C3KA 1OBCA 4DJBA 2AHOB 1XRPA 1GZ4A 3PWTA 3DR3A 1LEOA 3B2NA 3KT0A 4IR7A 1Q53A 3T3DA 3F0TA 2JIPA 2ZT8A 2HBZA 2B8QA 3PVXA 1K06A 1NJSA 4CH0S 2WM3A 3S2FA 3RB3A 2XMGA 2X1AA 2DYAA 5CFOA 1GRCA 2OEPA 4LF2A 5FBQB 3T3FA 4RLEA 1U1KA 3QWAA 3BSFA 4LF7J 1E2LA 4DANA 1II8A 2BEVB 2C2BA 2P77A 1E2EA 4DKJA 2PUBA 4YP6A 1WCWA 2C3MA 2AT1A 3E48A 3CB2A 1Z2ZA 5A0TA 5I51A 4FVCA 2Q3DA 1X4BA 2W58A 3F0NA 1MT0A 5C7IO 1FVOA 1F3LA 5B3AA 1OFTA 4IO1A 5BUCA 1QTQA 4AJ4A 3H5OA 3HH8A 3GLUA 2ICAA 2P75A 1M2OA 1EUYA 1VIDA 4Z9AA 2C04A 2ZJ3A 3ZOZA 4KP7A 2XAAA 3ND8A 4E11A 3RBXA 3VR1A 1SCBA 3HF5A 3KLGB 1KEUA 3B8HA 2J5XA 2R1VA 4WU3A 4TTAA 1PL6A 1AQIA 3I83A 2QLTA 3ROFA 2NP7A 3NGXA 4DS3A 2ILYA 4YACA 3AAWB 2LKZA 3F4KA 2J0SD 4GX2A 2LIVA 1D4FA 4LRUA 1U9YA 3ZXWA 2PCLA 1KONA 2R0QC 1A76A 3U7RA 4FF4A 2W90A 1YQDA 1DIBA 3WLSA 2IWHA 3UN5A 1L2TA 3NEPX 5K3CA 1CUJA 1QDUA 2OFOA 4FNMA 3OWHA 1RBQA 1INLA 4KGDA 3FZYA 1YZ7A 4YLEA 1NYRA 2ZYWX 4CDGA 1UZMA 5CW1A 4RTQA 1R8HA 2BI8A 1Q7LB 4LFBJ 3DDHA 3E27A 2VHGA 1JR3A 1JDBC 5K3SA 1WSBA 1SL0A 1GL3A 4RA6A 3AERA 3KUGA 2QUJA 1GNLA 5JO0A 1Z68A 1DQRA 3DRSA 4OX7A 4B6RA 2H1RA 2XX3A 5EPUA 3L4BC 2RGDA 3W77A 5DSZA 1X77A 3MURP 1JDJA 1E99A 1V9SA 1M8JA 4IDPA 1A77A 1GCUA 4NPCA 2E1MC 4DHVA 1H94A 2B69A 2QLBB 1QG2A 4R3NA 721PA 2W2OP 2DB3A 1FLAA 1L4EA 2FLWA 4RS4A 2CHEA 3NBXX 1C1YA 5A03A 4G5FA 3WLOA 1M5KC 3ZV7A 2VP6A 4JU8A 3N2ZB 5L6LB 4MVJP 4PPQA 3PGMA 4GBGA 3M6MD 2OGWA 1T8RA 1REVA 2OEKA 3CLUC 2RGWA 4N3AA 4USIA 2FPUA 1R4NA 4ABTA 3NBPA 1GZ5A 4Z7YA 1W2BR 8ATCB 4IQ8A 3FUWA 2R47A 4LF7F 2JBAB 5TGDA 4C6SA 2FJWA 3S8EA 1YMQA 1HMVA 4CRJA 2QV6A 1C8KA 2P9JA 3G2KA 3QLJA 2VPWB 5LMNJ 3IJEB 5BV1A 2J1LA 1GRVA 2WT8A 4HGOA 4LJ4A 2BGMA 3H05A 3X2SA 2PRKA 5DXJA 1GV1A 4IOAQ 3W3SA 3H13A 1RWXB 2YVAA 2AR0A 1RTJB 3NT2A 1PR1A 2BMFA 4EUFA 2HHAA 2P9YA 1NUAA 2XD9A 3JZIA 1PYOB 3OKAA 2WQ6A 4JT8A 2DXIA 1P5RA 4WN9B 4PSAA 4U6NA 1WC3A 4ZOSA 5CXTA 1SH3A 2Z2MA 1IUOA 1I6KA 4YNBA 4R1NA 5EUQB 1NRJB 2BE9A 3KZNA 3UATA 1SKBA 2X2PA 4PZAA 1N5JA 1S99A 3UG6A 4ZQGA 2FHSA 1G6KA 3BN3A 2PTGA 3I64A 1QIEA 1LWFB 1SOWA 2PN1A 3WWYA 2FOXA 5DO9A 4V0ME 4PZVA 1TOAA 4FFNA 2AN3A 5LQUA 2ZHOA 3QKTA 5FLKA 4ZPXA 3G9ZA 1PZHA 4TL7A 3HU2A 3ZCXA 5EUBA 5U4XA 4QUKA 4AJJA 1GNQA 4DFDA 2FUKA 3S68A 2NV0A 1ZIXA 3H99A 3R44A 1EX1A 3EYAA 1RT4A 2NIPA 1EG7A 1RRMA 2QMUA 5I4BA 2R48A 2FQWA 4L3NA 3TZ6A 2BQRA 3SSOA 5JI3E 2WVDA 4EPRA 4X4OA 5YASA 3IM9A 2X1GA 3HP6A 1W8DA 4CBVA 3FR8A 3DNFA 1EM8A 5JJKA 4JKOA 2XUGA 2ZH2A 1CS4B 3H2HA 1KFDA 3H5WA 3EPIA 3QOWA 1A5SB 1ZM4A 2YJ5A 3Q0AA 1LUAA 4BO5A 2AYGA 3EGEA 5ALVA 1L7BA 4B87A 3JTOA 3K0CC 3X1DA 2GYYA 5E4JA 5KFQA 4X4TA 3ND7A 2FPKA 1JNYA 2QTCA 4TXMA 4EMSA 4MGHA 4FGZA 3EXG1 3GR0A 5J5AA 1WVIA 3UQYS 1NBMA 4BV2A 1EFVA 1YCGA 4WL0A 2JZCA 2DRDA 3AB2B 1L5LA 2UU9B 1T02A 1JYFA 4XPIB 1BJKA 1HWIA 4S0XA 2EXXA 3BL6A 4C8OA 1WEXA 1FS5A 2BHLA 3P9QA 1VS3A 4GVBB 1Q2XA 1CV2A 3PQEA 3ZHQA 3BB5A 3P9YA 1ORRA 4HJXA 4X54A 1GG2A 1O6BA 4U7DA 2B21A 1PZXA 1KVRA 1SD5A 2IK8A 4CLEA 3L7LA 5DGCA 4YRKA 1KZ7B 3HACA 1PR5A 2V3CC 1YUNA 5HCNA 4QZVA 2XE4A 1BDJA 3AOCA 1TFRA 3TQEA 2DGUA 5LMNF 3RB0A 1NBEA 1WUUA 3ZKAA 3C6ZA 2FETA 2CQPA 1M1YB 2BKEA 3I42A 4DV3B 1S72S 1KHVA 221PA 1D1PA 4TROA 4G9GA 621PA 5ELMA 3ZU5A 5CAEB 3I8OA 5A8RB 1O6ZA 4JR0A 4BJ3A 2FRDC 1R9GA 3OIDA 3RS5A 1F60A 5JFTA 1LDYA 4WZAE 4MR7A 2GJ8A 1JDTA 1HBOB 2QIOA 3KG0A 3IDAA 1EQMA 4PGFA 3NYIA 5JI2E 3R3TA 2V9CA 2VRNA 5JCOA 2OVBA 1RCXB 3LP1B 1CJTA 1PJRA 2BM9A 4WVFA 2ZGVA 2X1LA 4MPTA 3FWYA 3I4LA 1GAOA 3D3EA 2AKAB 2HTEA 2EW2A 3E82A 1U31A 4QRDA 2GAFA 1AHPA 1CJVB 2EP5A 2GI4A 4BBPA 5EHZA 3RSHA 3HP7A 1T1RA 3LF0A 3B1WA 4NV0A 4XE5A 1P1IA 1OE0A 4KGZB 3GF4A 3OETA 1JDSA 2BKOA 2EG5A 4LJ5A 3LFUA 2GH1A 1B7FA 1E2UA 3BWDD 2ID4A 2EPIA 4JB8B 4ECXA 2GBLA 3SXUA 3HVUA 3Q0IA 2CNNB 1DXQA 1SM4A 5H59A 2DHSA 2LVWA 1H7WA 1OAOA 1Z8HA 3HVWA 1X9GA 1KEZA 5DNAA 1H9AA 5JH7B 2XF2A 2HJHA 3CH5A 3ZS9A 4DG9A 1E3DA 2YFYA 2N4CA 2G9UA 3F6RA 1NMEB 3DW1X 3ZC3A 2KG0A 4QQ8A 2G6BA 2RI1A 2E5HA 1R31A 3FCOA 2QRKA 1T9AA 2BUAA 5BW6B 3HZRA 5D4NA 2B6HA 5HLFA 3CCBA 4KNVA 2XNSA 3FGZA 4TU9A 3T52A 3FMPB 4IXWA 4G5YA 3V4OA 4FNHA 2BBWA 3TUZC 1IBLJ 3DTYA 2CQ2A 5G3ZA 2DCUB 4EF5A 1XU7A 4DBLC 4M83A 1C0LA 1SJ3P 1JSCA 1T9XA 2J3HA 2DVMA 1VIAA 1PG2A 3LMKA 3QGMA 1IQ0A 2MYUA 1JNXX 5JBNA 3PHBE 1X4GA 2ECQA 1VLQA 2FCAA 2XZOA 3CJKB 2EJTA 4L6CA 2KT2A 3IAS6 3QBDA 5EIFA 4YJ2F 3GY0A 1NW7A 4B3MJ 4I4TF 1CETA 5JBQA 1N5OX 2HDNB 1G21E 1WQ3A 1D7OA 2PZFA 4N39A 2RSQA 4BEBA 1SCJA 3PX2A 4DDKA 3SQWA 4EYOA 2DKNA 3VR3A 2VP2A 4LWPA 4LJ6A 3VKVA 2FSUA 4LMAA 1OX6A 1NVEA 1Q50A 4FCTA 2CVFA 1MOPA 3O4FA 3OPVA 1X70A 3C8UA 2XI4A 3N5CA 3M9WA 2H1VA 3BK7A 3QWIA 1Y80A 3X1YA 2IH5A 1BC6A 4V2UA 2NCKL 4ED2A 1TTQB 3LPNA 3OQVA 2R8EA 3D6NB 1QUVA 5G4LA 3C14B 4EO8A 2PWZA 1FTYA 1JHXA 2NSBA 3AP2A 2I3ZA 4JC8A 4DG1B 3JQ7A 2JLXA 3LY5A 2Q5EA 4LF8B 2QMOA 2IXDA 2SBTA 1ATZA 1AZSB 1RAGB 4QA9A 2ZOSA 3TTWA 2G67A 3F4LA 4OL0A 4ZIVA 4FS8A 3DE0X 4DR6B 1EARA 1GD1O 3CPSA 4WXPA 2IVZA 4MUXA 3QVGB 2QRRA 2Z1NA 2Y27A 1L5FA 2C8JA 1UH5A 1O08A 3DCJA 2QJFA 3LZDA 4YAGA 4JYZA 1ND6A 1DBSA 3MT9A 3O26A 2C96A 2JNWA 2RF2B 3VGUA 4NLVA 2IGTA 5LZ4A 3GBSA 4Y2VA 1IYZA 3ZVLA 5F3RA 1UPCA 3H4TA 2D5CA 3GW8A 4JVMA 2QTVA 1M2NA 1GDHA 2I6QA 2Y6VA 2M0GB 4DV0B 3FAZA 4M38A 3K70D 5LZ7A 1LWOA 4G1UC 5E7OB 3P97A 1J21A 1CRPA 3DXSX 4UZFA 2E89A 4LFAB 1K7CA 5DASA 1S59A 4HPJB 2FJDB 3DOMA 3VR4H 3GG1A 4JGGA 1OCEA 4FYJA 1IBLF 1JIIA 2C5LA 3B53X 3C87A 5B7WA 5I9TA 3FTQA 3AWIA 1JIJA 2AC2A 4CG0A 2GAIA 4K1XA 1OY8A 4DF3A 5BNZA 1KXZA 2MSEB 4BGDA 1XK6A 3L8YA 1F1BB 4AP5A 4C8MA 5C34B 2V4JB 3IUPA 1RISA 1VBXA 5BXIA 2AFHA 4DUGA 1HQEB 1SU7A 2O2ZA 4I6JA 1D2GA 2D1CA 4B3MF 1N1EA 1B41A 1TQ4A 3IVXA 1N0HA 4O4IB 3H17A 4B76A 4U7FA 1VL6A 1IZ8A 4K9NA 4DLRA 2N1BA 3W61A 3FDXA 4IG3B 2X9VA 1DDOA 5KNBD 3HBMA 2VDIA 3FVYA 4X60A 4W5QA 3GLGE 1BROA 1HYBA 1DTSA 5GJCA 3D1LA 1SBIA 2NVUB 3BYPA 3DLTA 2ZBQA 4ZPCA 3LYHA 5JW6A 2B99A 5E2IA 4LQ4A 2E5FA 1GZ7A 3LXRA 3N86A 3JTNA 2Q5IA 3ZTRA 1OYOA 3UV3A 4LNUA 2ZB4A 4MTCA 3MZ0A 3TDNA 1P1TA 1A7UA 1HZZA 4R6XA 3SEZA 4I4BA 1LGYA 3QE0A 4YAWA 2CT8A 1WXQA 4YRBA 4LOLA 4M0FA 4YBRA 4MJKA 1D2NA 1H85A 2IBTA 4OI1A 3F5FA 3MMBB 2B61A 4URZR 3WKCA 5ADZA 1QF7A 1CJKC 4PSCA 4MAKA 4J7AA 1CR1A 2VKQA 1RXVA 1PG5B 3IBFA 1SJFA 4RCZA 3UN1A 1FU4A 4NPOA 1GXUA 3JVIA 1NLFA 4QXOA 5A9SB 2XMUA 1NN5A 4G4GA 4EJSA 1XJWA 1G9XA 3NHWA 4ER3A 2VZ0A 2BM1A 4ML3A 1EBFA 3DOLA 1CT9A 1UP7A 1U28C 3G17A 5G0WA 1GSOA 2JCBA 1S9DA 2OT3B 4OPMA 5JYEA 1H6DA 1M5RA 3I0SA 3P0IA 2FX2A 3L1KA 3WMEA 3ZBPA 1NTOA 3DT9A 3INRA 3K0KA 4DJJA 4EVSA 4MIEA 2WM9B 1RT1A 5IXSA 2R97A 1RU2A 4RV4A 2QLLA 5JHGB 1NM2A 3NTQA 5ALHA 5BNTA 1CEYA 2BGNA 1KY3A 2E4WA 5JD6A 5K2MA 4DA4A 4Q8EA 3DGPA 3Q7TA 3QNWB 2CLHB 3PYLA 1QYVA 2QE7A 4PNHA 2LU2A 1VQYA 2Y1CA 2UXBB 5A1TA 4RLSA 3A1TA 1X1AA 4D4JA 2I1LA 2HQFA 5IZCA 4M1ZA 3IRUA 4CYMA 1S7HA 2OHVA 1PBAA 3VPDA 5JZSA 5MN4A 4Y2PA 4UPDA 1X1SA 2VQDA 2BYTA 2B8NA 1IDN1 1A2QA 3UC5A 4QPCA 2HCTA 4UXJA 3M70A 3SDBA 3ESXA 3K8YA 2CE7A 4BB0A 3DAGA 3T06B 3CRQA 4DIFA 2J0SA 2JFVA 1Y6QA 4ZP7A 4RELA 1LC3A 3EOAI 3N79A 3DM2A 4RABA 3IC5A 1EIWA 2ZT7A 4QEKA 1YS6A 4J0GA 4OU5A 4HLDA 2C1EB 5E9QA 4XJSA 4L51A 1F9EB 5EWFA 2B6NA 2PY6A 3D7NA 4BRWA 3AJ1A 4ZS6A 2EDCA 1I2AA 1XI2A 2H54B 3HGQA 4ON9A 2O8CB 3VA7A 2YVKA 2D3O1 2HJGA 2QUIA 1WDKA 5FPTA 4TN5A 2K87A 3LLVA 3TSOA 2XCLA 4BS9A 1QLWA 4URWR 1N25A 4RETA 5F9LA 5SZJA 4N3CA 3GFQA 4LSWA 2O2JA 2YV5A 4WY2A 1F6BA 5JQWA 1H1LB 3JQAD 4RKYA 4CLFA 2BFMA 3JYTB 1Y4AE 4V3CA 4U3JB 7REQA 4YUZA 1X0FA 3RVSA 5DE3A 2WOMB 2VSXA 1GQRA 4MQUA 4NZNA 1VYHA 3A9WA 3OFJA 1K8ZB 2RU9A 2G3YA 1N7IA 3LUPA 2XWYA 4DIOA 1GPJA 3RBEA 2XKAA 3EQ6A 3IUJA 2WD7B 1V0JA 4WIQA 5DNYB 4W5NA 4PY2A 2GPBA 2CFIA 3FQLA 1P81A 1KQGA 3FLMA 3FOCA 1Y37A 2Y1EA 3ZY2A 3TFQA 2DBVO 1HNIA 3CD6S 3RSZA 2ZDGA 3N6XA 3U2QA 3HVTB 1QIHA 3EGZA 3A1WA 4ZO9A 3FUXA 5DHQA 3QIPA 4C7XA 4DLVA 3VVMA 2Q0XA 4WNCA 3T1QA 5FUMA 2J4FA 3RJ5A 5BRJA 4ZFNA 3DQZA 1USVA 5LMZA 4U2CA 1EFCA 3K8OE 1Y1PA 5FLXU 5DOVA 1GOTA 5I4IA 4AT1B 4I50F 3IDZA 1Q0RA 1KYIA 3U4QA 5EIEA 3O8CA 1L9XA 3PCOB 3FOEC 2WC1A 4D79A 3BGSA 2E4UA 5G3YA 3MM7B 5AW0A 2YWXA 4I6AA 2XKJE 4DSOA 4D7AA 2QJTA 1GP2A 4JNCA 3PS9A 1LW2B 1P9OA 3PX7A 1LK5A 3OJEA 1KPGA 4TLQA 1BDHA 4LTDA 2D74B 2RUGA 1XKXA 5SUHA 3MFHA 3FSXA 2NZWA 1IN7A 4V0OA 4BWMA 3F3SA 5D0GA 2HIYA 2VAMA 2UXDF 1QVWA 4G09A 2I67A 4A0HA 4TMYA 3WGKA 2H92A 2L82A 2HPVA 3EQZA 3WBJA 2ON6A 5KFWA 1CWUA 3V4SA 5LA6A 1T8YA 4BWYA 1JH8A 1U0BB 4QIWD 3IR5B 1HEIA 4FMCF 3OL7A 3ONQA 3H4VA 4S1TA 3RREA 2M7SA 1RWBA 2I6WA 4AP6A 2GHVC 3DDWA 4C7JA 3U44A 2DPIA 2ODQA 4XA8A 2O2HA 1TZ2A 1NN1A 3FCHA 2QE5A 3L93A 1E3LA 3SIWA 4ZT3A 1Y7PA 3WLPA 2I5PO 4NV3A 3WIBA 1MOSA 3MHYA 2XIJA 3TJMA 2PFDA 2BGRA 1VFJA 3CUUA 4PZEA 5CDFA 3F4BA 4LA4A 1X7ZA 3URKA 4MIKA 2JKVA 3LCRA 4ZJPA 4MV0A 3VO9A 1YJVA 2CLLB 1ZCJA 5KKCA 2OUKA 2MB0B 2PX3A 5H9EJ 3EZGA 4YAOA 4K6MA 1M75A 2WAQD 3RU9A 2DNGA 4NK4A 4ZITA 1S48A 3KSAC 1RAAB 4WJLA 4UEKA 1M7HA 4R2KA 4JASB 4F06A 4TY8B 2B1JA 3THWB 2HHPA 3LX8A 1IBMJ 5AT1A 5FTJA 4BLUA 2CFXA 1R16A 4NI2A 5KFIA 2Q7DA 2FG7C 3BHIA 4WCVA 4CF7A 4YLYA 3UVJB 3E9MA 3PZRA 4HGPA 3KFVA 1B8NA 4JROA 1MJGA 2RCYA 5H0IA 3HUFA 3I0NA 2VPIA 3FGNA 1Q2UA 3EWAA 1C1CB 1IZ7A 2RB5A 2Z3ZA 1LEHA 3OUTA 3FI9A 1KRWA 2JLZA 4MVJE 4ARCA 5DCWA 1QF6A 4QWBA 2RGXA 2L48A 5F7OA 2HWTA 2WVAA 5GTDA 2O2DA 3NONA 3AK4A 2HT6A 1IJBA 4D80A 2MR5A 3V8PA 4B02A 4XVQA 3MJ4A 4NK5A 4XARA 3PGVA 3EFBA 4MS4B 1XPOA 2A2DA 4F3NA 1UDXA 2ZBRA 5BVHB 3KYCB 5LMUB 4OZ2A 2CBXA 3VZBA 4GMKA 4RUAA 1VLYA 1O95C 5ECDA 1D1UA 2HAFA 3HHLD 4HDGA 1N5DA 1OYVA 4OYZA 3PDIB 3TZKA 4P52A 1E32A 4URSA 5F7JA 4R5PA 1IN8A 1ZVQA 3RIHA 2VD3A 3KZMA 3I28A 4GPBA 5SYMA 1DWOA 2VZLA 3TW8B 4HNAA 5KYGA 1TMOA 5C53B 3SZOA 4PO9A 3RBDA 1YK0A 1UJ6A 1QPZA 1DI0A 1TW3A 2OGSA 1NV8A 4KHRA 1JEOA 1RGVA 2WNSA 3CONA 2I4LA 1RLMA 3M8WA 1D1SA 4X6LA 5EN1A 4D3HA 1XU9A 1R5OA 1S8FA 1M34A 4OUDA 1LX6A 3DFZA 5IUKC 1VQMS 4TYBA 1VPTA 4QTXA 3EXG2 2WHPA 4QDTA 2FN3A 1GUFA 1ETHA 2Z2LA 5TLSA 4GKJJ 2WJ6A 2C1ZA 1C3LA 4LWQA 1U8SA 1Y1TA 2SNIE 1N8KA 3VYVA 3O82A 1F1JA 3J7AC 3EPPA 4YEDA 4JOQA 2PL3A 1XD2B 4YCBA 1DJQA 4XOIA 4BBYA 1J5OB 4DUPA 1EB9A 5LU9A 3MB8A 1LBSA 4MV7A 4E1VA 1O6XA 4GS5A 2N7YA 2GILA 1SU6A 4N0MA 2Y9MB 3K70C 3HT0A 1TKXA 5AIBA 2P2SA 1FTNA 1L1QA 5AW2A 1QG4A 2DD8S 4XIGS 4KI7A 3GPLA 2R7TA 3VMMA 4GL2A 1KNZA 1X15A 2DHEA 2HV8A 3BJMA 2XGMA 2X5NA 4ZMRA 4ZZIA 1IBMF 3BICA 1CZKA 4RJVA 4Z0TA 4HMOA 3BFKA 1Y4ZB 1BMFD 4OHVA 1DXOA 1FUYB 2AFIA 4MS3B 4P35A 4HYQA 1Z06A 3KTQA 2LQJA 4OYHA 2Q2WA 4LSGA 4C9BA 2P3OA 2CQ0A 1TR0A 3PW4A 2ARKA 2P7HA 2F8MA 1U1EA 2WSCC 5IC6A 3T7RA 4LZZA 3WMGA 2IBMA 4X64B 3I52A 2A3NA 3KWJA 5IOLA 1YRUA 2Y77A 5J63A 1OFUA 2AOXA 4Q4AB 4Y2GA 3GFTA 4NA2A 1T4GA 3OLBA 1H65A 1W0JA 1B43A 2FSFA 3P19A 1OIVA 2I8EA 3THSA 3KOMA 3NAQA 3QXXA 2GJ9A 2NGRA 3WYFA 2CAJA 3O8LA 1ZI6A 2DNYA 2GPJA 3TZYA 4CLTA 4PAWA 3L0CA 4IF6A 3W1WA 1RKQA 1MLAA 1XWLA 1AKUA 3U7JA 4K4ZA 1QORA 4ARVA 2WUWE 3K05A 3T1NA 3KOZA 1NT2A 1DXYA 3U56A 4FGJA 4LVCA 3J7YU 3U4GA 3GFRA 2QD1A 2HVEA 2IOHA 4AZWA 1RI4A 1HT1E 2J46A 4S2UA 3H1EA 4W5JA 4FMBB 3NIDB 2UV8A 4F50A 4DQLA 2C4NA 4WRRA 3AJAA 1MP0A 1RMYA 1YJUA 2AJBA 4NASA 4HB4A 1ZGZA 2VCEA 4UC0A 4C7OA 1G6BA 4B4VA 2CVOA 5EWLA 4WWSA 1N2ZA 8GPBA 1XYVA 2VHJA 2PZGA 4L5JA 1OY9A 3A28A 2HZBA 3OV7A 2H16A 2AA3A 2YUTA 3DRRB 1PV1A 3R7WA 4UE3S 5HYVA 2BGGA 3WGTA 4PANA 2JFBA 4B3CA 1C4WA 4ZP1A 3SS7X 1H8EA 3TA1A 1QIIA 1SVOA 1OYYA 5C25B 2ZBGA 3OXGA 5EAIA 3F7NA 4GKJF 4KSYA 5BWOA 3UDEA 3L0DA 4KXXA 3AR8A 4K6FA 4IG4A 4CKXA 1MTOA 4OZ5A 1RABB 5FJIA 1X5TA 1QWOA 4AMUA 3GZ4A 4YI3A 2BABA 3QHAA 3KALA 5CYJA 3EGDA 4GYKA 1AT1A 5TJHA 1XEWY 4C08A 1E3QA 1RPZA 1ZGAA 2A9VA 2MJUA 2Y1DA 3Q8PB 2OLEA 4PXDA 2CJQA 3WDSA 3Q3CA 1XKLA 3DL2A 3G82A 1CF2O 1P77A 5JYDA 3LU1A 4YMTA 1N1GA 3Q41A 2IIQA 1BWPA 1YDMA 4PHFA 2GDZA 5HKBA 3R7NA 4ENVA 2WKQA 2XVZA 1U4NA 8LDHA 3ENQA 1T9KA 2E37A 2YVSA 1QS0A 4A73A 2Y0CA 3LLMA 3JAKA 4KFSA 4CKCB 3OHSX 4FHDA 1R00A 5DTIA 3OXFA 4DMUB 1A0OB 2X1BA 2XNDA 5D0EA 3V4MA 4KREA 1RU1A 1P19A 2CDAA 4EIWA 2QLWA 4X84A 4OHMA 2QSWA 3PX3A 3OTDA 1ZISA 1EB8A 3LGSA 5ILOA 2GJIA 1QLJA 1YQTA 3JXOA 1TELA 5WRFA 3SG0A 2O2CA 5CJPA 2YMLA 4YFVA 3WX0A 5D86A 2ACYA 3LIIA 4ETMA 3LT5A 1JG6A 3G8QA 1RXIA 3SYRA 3OT1A 4ZAGA 3MERA 4KR0B 4YJ2A 5CUQA 4K2JA 4BKOA 3W2HA 2AJTA 3O75A 1QZTA 2J6BA 3MUFA 2XRMA 4GZLA 1E6WA 1Z36A 2ZR7A 2PWYA 1U7OA 3Q3JB 2ZTSA 1OZGA 2MKCA 3R9KA 3A1YG 4IFEA 2IXAA 3H25A 1N1MA 1JSZA 2HFKA 3C16A 1E77A 1X60A 4KDFA 5B7PA 4GT1A 1DQYA 1UJ5A 1YK9A 3KUXA 5JS6A 1NNDA 2ZS9A 1LXJA 3NKLA 1G8JA 1IZYA 2CDRB 3HLYA 1MBZA 4KNYA 3IDOA 3OL9A 4YRGA 4PYAA 3DZDA 5K8PA 3CCCA 2BF7A 5REQB 3QUSA 4YUDA 3GLFE 2J4CA 2VBGA 2W7OA 4ZAVA 1QTNB 2BRUA 2YVUA 4V39A 3C3KA 3HXTA 3HKZD 1GYPA 1TQ8A 1T4CB 5F73A 2V4MA 5AQEA 4DMLA 4HDKB 3ZHTA 4QQBA 2OHDA 3KUEA 1VQ1A 2Z1DA 2YHBA 1YDHA 2GVDB 1Q0HA 3SR3A 2VSOA 4P34A 3AVQA 4EGCB 3EVOA 3EIHA 3DZKA 4RW8B 5IKOA 2FH5B 1NYTA 4N47A 5CDYA 3QVUA 2NVWA 1QIDA 1N32B 4HATA 4V1CA 2NUAA