3WIUA

Crystal structure of pro-s324a/l349a
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKIAPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Requirement of the insertion sequence for activation of Tk-subtilisin
rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 130
structure length 395
sequence length 395
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3wiuA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3wiuA02
1Y9ZA 2SNIE 3Q40A 2P4EA 2W2OP 1GA1A 1KE2A 1AU9A 2X8JB 3GCWA 4AKSA 2SBTA 2W2OA 1SIOA 4WOBA 3GCWP 3D43A 1THMA 2W2PP 1Y4AE 3DE2X 2PWBA 3ZXXA 3F7OA 2Z58B 4JP8A 1SN7A 3F49S 1BH6A 3DE7X 1EGQA 1TM4E 1R0RE 3DE0X 1OT5A 4H6WA 1SIUA 1Y3BE 2ID4A 1WMDA 1S02A 1Y4DE 3H42A 1SELA 4OV6B 5CW1A 1IAVA 3I2YX 3DW1X 4B5LA 3WIVA 1Y3FE 2WUVA 1R6VA 3AFGA 2SICE 2HD4A 1BJRE 1AH2A 3TECE 5AVKA 2E1PA 3WIUA 4HVLA 1PEKE 1TO1E 3BX1A 1SIBE 4Z2AA 1CNMA 2WUWE 1SUDA 1S2NA 2DP4E 4I0WB 2XRMA 3CNQS 3OSZA 2PWAA 3CO0P 1C3LA 3Q5GA 3CNQP 1BE6A 3CO0S 4OMCA 1WVMA 3WHIA 3TI9A 4CFZA 1SBIA 3P5BA 1TK2A 3PRKE 3QTLA 2DUJA 1Y1KE 2SECE 3A3PB 4FONA 1R64A 2ZRQA 2WV7A 1C9JA 3P5BP 3I30X 5I9SA 1Y33E 3LPCA 1TM1E 4KB5A 1YJCA 3VTAA 3DE3X 1TM5E 2ZWPA 3A3NB 1SCDA 1TMGE 1ZVJA 2ZWOA 2HPZA 2Z57B 1Y3DE 2Z2XA 3SQOP 4KPGA 1SBCA 1HT3A 3TI7A 2QTWB 3VV3A 3A3OB 3VYVA 1A2QA 1T1EA 3DVQX 3UNXA 1C9MA 3EIFA 2Z30A 1SCNE 5ARCA 5AVJA 3L1KA 2ID8A 4C3VA 5ARDA 2TECE 3I37X 2Z56B 2V8BA 3DE6X 1YJAA 3GCXA 3BPSA 2Z56A 2Z2YB 5AQEA 5JXIA 5K7SA 1Y48E 1SUPA 1KDYA 1AF4A 5ARBA 1BFKA 1NLUA 4LVOA 4DWWA 4M1ZA 3SICE 4NE9C 5JXJA 2Z2ZA 4C3UA 1Q5PA 1V5IA 4GI3A 1GTJ1 1EA7A 3BGOP 1AV7A 4WOCA 3VSBA 3AJ9A 1V5IB 1SBTA 1T1GA 2Z30B 1YU6A 1DUIA 2Z2YA 3DE1X 3AJ8A 1SUAA 2GKOA 1TECE 1PTKA 1C9NA 1YJBA 1UBNA 1SUEA 1GCIA 1Y34E 3QFHA 1WMFA 3GT4A 5B1EA 3LPAA 4YN3B 1GA6A 1SBHA 3I34X 3ZXYA 1SUBA 1LW6E 1SH7A 1KE1A 3A3PA 2PKCA 5AMXA 1VSBA 2IXTA 4ZOQI 1BFUA 3F7MA 1P7VA 2W2QP 1AK9A 2PMWA 1V6CA 1SCJA 1T1IA 2IY9A 3LXUX 5FFNA 2W2NA 3PTLA 5FBZA 1ST2A 3DVSX 3DW3X 4CG0A 1ZVKA 4ZARA 1GA4A 3SQOA 2W2MP 3BGOS 2B6NA 3T41A 4KG7A 4H6XA 4CFYA 5FAXA 1SBNE 3WQBA 2WWTA 2PQ2A 4H6VA 2W2MA 4HX2A 1IC6A 1TM3E 4YN3A 2PMWB 4BWGA 2G4VA 2PRKA 4DZTA 2ST1A 2Z57A 1AQNA 1GTG1 1MPTA 4OV6A 1PFGA 1CSEE 1DBIA 3D9QX 5JMOA 3H42B 1NDUA 4NE9A 3HJRA 1BE8A 2DQKA 2X8JA 1AVTA 1XF1A 4J94A 3EE6A 1TM7E 4NMXB 1KDVA 3VHQA 5B1DA 1OYVA 3A3NA 1P8JA 4MZDA 4NMXA 1WMEA 2W2PA 4AKTA 5SICE 3QMPA 1S01A 1SVNA 1PJ8A 1JEAA 1KDZA 3DVRX 1SPBP 3A3OA 1SCBA 4NE7A 1P7WA 1Y3CE 1SPBS 1SCJB 2W2NP 3DDZX 5JXHA 3EDYA 3GT3A 3VV2B 1NDQA 1WSDA 1OYOA 3DE4X 4OMDA 3VV2A 1SUCA 3DWEX 1TO2E 5JXGA 1ST3A 2XTJP 4K8RA 1ITPA 4RYDA 4DJ5X 1MEEA 2Z58A 2PYZA 2XTJA 3GCXP 3BPSP 2QTWA 1GTL1 1SCAA 4LVNA 3DE5X 4K8RB 3DYBA 1GT91 2W2QA 3LPDA 1GNSA 1GNVA
chains in the Genus database with same CATH superfamily
3B38A 3WLOA 2FRDA 2Y1OA 2EKLA 1N5IA 5JNTA 3LNTA 2GKGA 3I4LA 3DDKA 4EW6A 5KFYA 3EVZA 2VPTA 1WC4A 5G0RB 2O48X 1QHHA 2EL9A 3OE7D 3VX3A 4DR2F 4D4JA 1UIRA 4OXYA 2ZS8A 2QYGA 5BOSA 2F9JA 1R8JA 3DVLA 3IEVA 4CM3A 2I4MA 4CYMA 2P4HX 1JH9A 2JCSA 3SSQA 4RXMA 1P4HA 2Z5FA 5DWVA 4HAYA 4B5LA 1PWXA 4ECRA 4R7TA 5EY5B 1M8FA 2PPLA 3AJDA 3BM7A 2V6GA 4BO8A 5CABA 3KPYA 4UTOA 1N5MA 3G0BA 2GGPB 3RVRA 3AH6A 2J3JA 4LOAA 1EK0A 3WDKA 1CERA 4LNHA 2NX2A 3CCTA 2G0TA 1OKKA 3NHBA 2BM1A 1HYGA 4A73A 4ZCIA 2V7EA 4AX8A 1JZSA 1C3LA 1FFXB 1C3OB 2P4QA 3O4FA 1FXUA 3ZFVA 5IJ0B 1PRYA 1SL0A 4O0NA 5KTTA 1U5AA 3JAMU 1E3LA 4RTSA 2FMUA 1DTQA 4B80A 2JLEA 1U1NA 2IIQA 1YDMA 3CEAA 3NNCA 4MGKR 1A9PA 2C54A 1QPGA 3U7HB 4IM7A 10MHA 1SXJC 3W8NA 4OYWA 4FMCB 4TV9A 2PMDA 2GVZC 1R8HA 2PSDA 2WILA 3QA3E 4XYGA 2B7CB 2CL6X 2C7VA 4MGHA 2QG6A 2ZVIA 2HPZA 4B4VA 5T3YA 2X0KA 3EWSA 3BWXA 5FNVB 4B74A 1TVRB 1SA0A 2GFHA 3IBWA 4ZEOA 4HEQA 1JEJA 2C94A 2M9MA 1W36B 5AVWA 2RC6A 3ZH2A 4XE5A 4DV5F 3SX4A 3P2IA 4DKJA 3SBDA 4LFAB 3I37X 1JTEA 1KVKA 4D99A 4XQCA 2VPYB 3PKJA 1VBFA 1W5SA 3DHYA 1YFKA 1RRFA 1NKCA 3TVTA 2ADOA 1N5JA 1C29B 4ED2A 5F2OA 3FSXA 2WG0A 2XYPA 2FPGA 3HBNA 4NJMA 5I01A 2XWXA 3D7SB 4CMIB 3WLTA 3AOAA 2V8HA 3QLHA 5AT1B 5EIXA 2Q0QA 1V5IB 4EVIA 4MIAA 5FWAA 4C97A 1T05A 2DHRA 3BV8A 3FF4A 4GP6A 2HWTA 2PPVA 4X6YA 4EG4A 3ECSA 1LDEA 4R2WA 2V54A 2Y4NA 3F2VA 3RRXA 5DDQC 3CMES 3ADDA 3LPAA 4XD2A 4DR2B 3EJMA 5DHPA 4L6CA 4KBFA 2WMNB 3ZO7A 3EGCA 5RUBA 4WZBE 1XZCA 4RBNA 2BHSA 1KMIY 1Z2AA 3X1ZA 1ATIA 1GXSA 4Y30A 2BCJQ 2C2MA 4Q4DA 4ZMRA 1RHMA 3QEMA 2FDXA 3WGLA 1YC5A 4CO5A 4QSMA 1GGMA 2NXJA 2B4PA 1JRLA 1T0PA 3LQ2A 2MZ1A 2NVUB 2E5GA 4MR7A 2GBLC 3A8JA 2EERA 1L5KA 5A6SA 3QGMA 1GZUA 4KJIA 4BV8A 2BX6A 2ZB7A 1RHUB 5AKYA 1FWKA 3OT9A 1S9FA 3QY0A 4BFXA 3K58A 3O75A 4UNRA 3WZLA 2AVDA 1YT5A 3OESA 4MCHA 4B3DA 4TTAA 1MPTA 1CSEE 4O4LA 3G68A 4K4UA 1NKSA 1K9MT 2GYWA 4PRFA 1CUEA 1J2EA 4NBRA 4JSRA 1DKLA 5B1DA 4EIWA 1IY9A 2HNDA 2WU0A 3B8HA 4C7MA 3RVSA 2Y1IA 3D0IE 3JQAD 4OQYA 3I73A 3QKRB 4HTJA 4CR8A 5JZSA 1HEUA 3F8SA 4CV1A 3P0RA 3M33A 1GAJA 4ENOA 4G4SP 1U6ZA 2GGSA 4QUHA 1YRUA 1VI5A 4CT0A 1PIWA 4KXUA 5EZ6B 3EG5A 4PGAA 3G5TA 2GCEA 5DEOA 4HT7A 1KQSR 1WSDA 2XMTA 3WIDA 1XN9A 2EFEB 2WOJA 3T1OA 3ZI0A 4P2XA 2I0XA 4URZR 3O21A 5CHCB 2VBXA 1E3JA 5K9FA 1VHWA 1L4EA 1WPQA 3FVRA 4Q4CA 4AECA 3CLRD 2KHCA 3DRPA 3ONWA 1WL8A 4QYXA 2NTJA 2AQHA 4PG6A 1S76D 1U3FA 2EEPA 4DUPA 3K1TA 1Y63A 7MHTA 3DXXA 4EGQA 1PCXA 2BGTA 3VSDA 1GITA 1BEUB 2X4DA 4R9RA 4H7PA 3HYRA 3DOLB 4F5YA 3LUCA 2W1BA 2HNYB 2JL9A 2G0JA 5EEHA 3CZ4A 4U7DA 5DTMA 2CPZA 2HHHJ 3GG2A 3PUIA 4LGYA 2PUEA 1N2CA 4GYWA 2WP8J 4X1IA 1PWZA 4RY2A 1L7VC 3HR7A 4Y00A 2VH5R 4HT5A 1L5FA 4DR3J 4GQAA 1MO5A 3EF1A 4TXSA 3GLKA 4FINA 1PJQA 4LSZA 4W5JA 3CJ0A 3L49A 3TFQA 4QXRA 3K0AA 2QG9B 1K0VA 5FI5A 3RDPA 2X0FA 4DCNA 3QATA 1JJFA 4UHEA 3CHYA 4JY7A 4ZKDA 2WJ3A 3DQQA 1M1UA 3V6LA 1NU6A 2RKBA 5AKXA 4TX1A 4F4XA 1J00A 1YQGA 5J2TA 4CEIA 2NLOA 1XHFA 3D1QA 2CEKA 2PL5A 2BGKA 2WBMA 3P0EA 5AI8A 1ZBDA 2CJYA 1FC0A 4RW6B 2O7QA 2XNSA 3AVYA 3ZKAA 1XQ9A 2NUAA 4V1Ak 3LFTA 3BMCA 4MLDA 4Y2RA 1GYQA 2QTVB 4MGYR 4RVSA 5CTJA 2Q50A 3QEKA 4PO1A 5F0UA 3OHBA 3CJQA 4NI5A 3H4MA 3KOWA 2GPNA 1P4RA 1SHKA 3AQPA 1XG5A 1J8QA 2OM2A 2TRSB 5G53C 3LP1B 3L6RA 4BRWA 2B9EA 4MVJH 5L38A 3K8VA 2GOYA 3EXHC 3GUCA 4XUGB 1NLZA 2A35A 2JCBA 3FPAA 4M53A 1Y5MA 4DDMA 3B6JA 2DJWA 1F0YA 5JRDS 4RFLA 3GN1A 5I42B 2D13A 2MXYA 2H06A 1G17A 1CEYA 5A76A 1VDMA 5GAEU 2Q2OA 4C0QC 5L8RC 3CGIA 3HUFA 2VZEA 2Q3PA 1IJBA 1KA9H 2Q3HA 4UUMA 2X9VA 4HZIA 4IQ8A 1ISJA 2JKVA 4X20B 3IV7A 4PFJA 5LFAA 4ZYWA 4NK5A 4O2BF 5K0BA 1CQMA 3RQSA 2NUTA 5T7BA 1UK8A 8AT1A 2C98A 2IX9A 3ZN2A 4UHDA 5FJIA 3K2IA 3CF4G 4TT3D 3WQSB 4DF4A 2YY6A 1JHRA 4Q7MB 4V0NA 4IFTA 1X0VA 3TLJA 3MQ2A 1QP4A 3OTHA 3ZR4B 4FDLA 2YJ5A 3HLYA 4DCUA 4V19J 2PH5A 3Q3IA 1ML3A 4XPCA 1DWOA 1QB8A 1ULHA 3RHFA 1EUCA 5KI6A 2XTNA 4OQQA 3F78A 4YQEA 4TXNA 1I4OA 2ZYTX 4L9RA 1ZCFA 3U1LA 4B02A 2IY7A 2XZTB 5LQMA 4OHKA 5B7WA 5CGZA 3ZVLA 3PZBA 5IC6B 1NFFA 4KO8A 1JIIA 4XSVA 2VQ3A 4AJEA 5K03A 2V5AA 4UBJA 1V8DA 4UULA 1U49A 2M32A 2VK2A 3W4JA 1KF0A 3LY5A 1LK7A 4GYYA 3L7UA 4P74A 4MKGA 1R0SA 4E46A 3A4LA 1S1TB 1UFWA 1ZICA 2OTCA 3OECA 2JVJA 3MUEA 5KQGA 1VC5A 2BJ7A 2WONA 3V5NA 3R3TA 3TLEA 3FTNA 3GCGA 3CZAA 5KFUA 3SLRA 3H25A 3CD6S 5U1PA 1XRJA 3LMKA 3OLAA 3AL3A 1OYVA 1NRJB 2NUPB 4J1NA 1FU7A 2QPLA 3O7MA 2DM6A 1TT7A 1N2IA 2A9KA 2XPCA 5CIWA 2D3OR 1AKQA 4B9LA 4EFLA 2QLTA 4CDGA 1N8KA 3ZC3A 1RT3B 4DBVO 2LEBA 4H3SA 1XN4A 1ECLA 4W98A 4A2WA 2I7VA 1H2HA 3GP3A 2OXEA 4LNUA 4ZZ2A 5GIOE 4LS3A 2IW3A 4EA8A 2AYGA 1YR2A 4KGXA 3HNOA 2O8BA 4NZZA 3M9NB 2XGMA 3CRMA 2XADA 1MABB 4ANDA 3J7A1 5AXCA 4E5MA 3HE3A 3UWSA 3AILA 1VISA 1S8NA 3GWGA 1VE6A 3NWOA 1XDZA 4B3HA 1TJ3A 2WTMA 1GTL1 3FRHA 2G67A 2HQBA 1K9VF 4YIKA 4AI6A 6FDRA 4MS3B 4W5NA 1L7PA 1TMOA 2VOEA 5JS7A 3L07A 4QPTA 1VFPA 4AK9A 4QXOA 2VTBA 4RKYA 3VMMA 4MRVA 2GWRA 2YUIA 4W7SA 3H1BA 1OT3A 5C8YB 3D3NA 3GXOA 3OIDA 2NO5A 2YYZA 2Q8QA 5A4JA 4KGZA 3I6MA 1YQHA 2DGUA 4D44A 1UZLA 4H4EA 2PVPA 5CYMA 4IKAA 2RQ4A 2ZIFA 3A1SA 5HP4A 3IO5A 3MC1A 2ZUVA 5HYVA 2Q66A 1NDPA 4DT1B 2C84A 3H19A 2PSSA 4IWXA 2GZRA 2C88A 4NNPA 4QLOA 3D8NA 2M98A 3NVDA 2HJGA 1OYEA 1KVSA 1QO9A 2FB0A 5AKLA 1Z4UA 1RIFA 4MYDA 1MC8A 3V7UA 3BD8A 3K15A 2LCIA 2C2YA 4CLLA 3PUJA 4HB2A 4XR4A 1SQEA 1U2SA 1CG6A 2HRQA 4GPEA 2DQYA 3BHIA 4ZVUA 1QE5A 1VJTA 2JDID 3WYAA 3AO0B 1JHZA 2NZUG 1EYZA 1YIJS 1XOIA 4P7JA 5ALWA 3ICVA 4B08A 1RI2A 5EMLA 2GCGA 2Y76A 3Q41A 1EUDA 2C2KA 4LJKA 1JLRA 1LNZA 1Y6GA 1PYTA 5AXMA 1JR4A 1ISPA 4MOWA 5AM1A 2FA9A 4QDZA 2F9MA 3PC7A 4NBKA 4KQ9A 3DOJA 1BUXA 4I55B 3TSCA 4QVIA 1GFWA 4Q6BA 4OJ1A 4J75A 1QLNA 3HP6A 3I2IA 1V8OA 1UJCA 3KYJB 2YHSA 3PL5A 5AHXA 5KYUB 2Z98A 4PZUA 3MZIA 3VMFA 3VO2A 4YMSA 2HPVA 4IDGA 2Z56B 2OK7A 2C0QA 1VI2A 1YJAA 2YWCA 5KNLA 5JZMA 4GDFA 2O8VA 4DYDA 1VIMA 1W44A 3SBXA 3ES9A 4L74A 3ZDYB 5HP1A 1QC5B 1RHMB 2C07A 5LQUA 3C7DB 2HSEB 4WESB 2ORVA 5CW2A 5DRKA 1FIUA 3CRRA 1XMXA 4HMOA 3SR0A 1Y8QA 1BVUA 4WZAB 4IQFA 4IICA 1MROA 1ZI6A 1FQKA 5CVUA 4RADA 1M6YA 4P2FA 1J22A 4MP6A 3WAJA 4ETMA 5E3RA 1JWAB 4C21A 2P5UA 2AXEA 4KITB 3RUPA 2VICA 5IT9Y 2RQKA 3QWBA 2DGVA 3L46A 4QRDA 5JWHA 4D0GA 2I99A 4HNRA 1N7GA 1WBBA 1KAEA 1FSSA 4HC4A 5F12A 1EJ0A 1D7AA 3N2NA 4QJVA 1WIWA 2QS9A 4IIVA 5HE8A 3OURA 3HHNB 1VSQA 3D4NA 3LHDA 4CIYA 2E1RA 4P3OA 1SOWA 2J4FA 4F3OA 1FSFA 2W11A 1SBNE 3WYBA 5LP6A 2FHMA 2PUVA 2Q99A 4EHHA 4FHGA 4LX0A 4PWZA 5EN4A 3TA0A 4FYMA 5CM2Z 3KOOA 1BDMA 3PR5B 3HUTA 3O8OB 2I54A 4Z8XA 3SDEA 2EKZA 1EAYC 2CNBA 1M1GA 4W5RA 4KKXB 2FZ4A 4G6ZA 2J5XA 4JA0A 3V6HA 2PGXA 3VKUA 3O4GA 4ODIA 1ID1A 2A0FA 4J9KA 1BE4A 1YRXA 3ETEA 3AFIA 1XTRA 3DLJA 1T9YA 2GFFA 3F8WA 2HHAA 4BO7A 1RWXB 1W6UA 2K87A 4JI1B 1MU2A 1PUXA 2WBLC 3PT9A 4YDXA 3PYGA 2G07A 4HNAB 3QJJA 4IDAA 5J2QB 4IS2A 3F6RA 1C4CA 1ISRA 1AA6A 2CEAA 2W2LD 3LXMA 4QIGA 5IDQA 4KRWA 5IUJC 4F50A 2CLHB 1GPNA 2ZD1A 4EUNA 3ZIAD 4YJGA 3A25A 2XI4A 1YZYA 3WQPA 3LDGA 3D54A 2GVDB 4QUJA 3IHTA 2ZOMA 2GYVA 1X1DA 2VP3A 4DJ5X 2Z9DA 4DTIA 2V1XA 5ALXA 1GPMA 3WGUA 1U1DA 2GA8A 3PX7A 3ENAA 4MTPA 3GDGA 3BXHA 1IQTA 4E12A 1RRMA 5KFLA 1QLHA 4RJ2A 3CNOA 2YKMA 2WM9B 3CDEA 4XAKA 3BGSA 1IMOA 4L4YA 4WKCA 4JK3A 4XB6B 1XR6A 1S48A 3C15B 3PNQA 2IVYA 4FBGA 3AXKA 2H4FA 4IV8A 2C1EB 5B64A 1PIEA 1IN6A 3WJ7A 4CM5A 2CDRB 2X8WA 1LRLA 3QUAA 1SB9A 4IMRA 2OM6A 3C39A 4Q1AA 1E2KA 2ACWA 2XMZA 1B14A 4JFAA 4DLUA 1QO7A 3C87A 5DF1A 3OC0A 4U2EA 1TT5A 1K6XA 3PYFA 2XQIA 1R10A 4JI7J 3NHLA 4PSAA 3LQVA 1RI1A 4CKWA 2G2OA 2PL3A 5K8MA 4BEJA 4UNSA 5GAJA 3HL0A 3HHLC 1YACA 3VH3A 3UN3A 2XE4A 1BJTA 2VP2A 2RJOA 3CTMA 3CIOA 1CNMA 1H0KA 4UHKA 4DMMA 5KDLA 1ZBTA 2Y99A 4XD7A 1T91A 3ZS9A 4D4LA 2NU6B 4QSHA 1K8AT 2WSSA 1MA3A 2IEZA 3AEKA 1OE0A 2BELA 4HDQB 2G5TA 4ZDNA 3B5IA 2XT9A 1MFZA 2FUG9 3TI9A 3TSYA 3W5AA 1WABA 4G8JA 4A6XA 2GC8A 1COWA 3S7ZA 3T1QA 4OOFA 1Y8ZA 3H8VA 1C9KA 1KVRA 4OBEA 1BQMA 1Q95G 1UBEA 3ACDA 4JFRA 1NR7A 1YVUA 3GLIE 5HJYA 3PHEA 3B9PA 1M54A 1FNCA 1ZCJA 1EKRA 2OBNA 2VWPA 4KVZA 1O57A 4UUPA 3DXBA 2AI1A 4ZAGA 2KDOA 2I4TA 1MRZA 5I7SA 3R1HA 2IRYA 4DFKA 2FJBB 1TYEB 4TVBA 5MN4A 3UC9A 4JIMA 4LF6F 4ZI2A 2C04A 4JVMA 1NYQA 4I5DA 1R9GA 4L07A 4KK3A 2Y3YA 1MORA 4A8WA 2VK4A 2ASLA 4RF5A 3C5EA 4Y98A 2CFXA 4JI2J 4QU8A 3W6NA 4G1IA 4ZDJA 1JDBC 1HFEL 3NGUA 1SHLA 3PXXA 4DV5J 3PFIA 4KE5A 4Y2PA 2EKPA 1P9NA 1Y3HA 3Q72A 4C3UA 4WN9B 1KJWA 1LD3A 1Y7LA 4GO7X 3SCJE 4YYZA 1JE1A 4JI1J 5DLYA 1QONA 1N6QA 4ZV4A 3NAQA 4BNXA 3NOXA 2ZJBA 5A7FA 1T1GA 2OPPB 5H5JA 4CKCB 4QXAA 1XN1A 3MK31 5D1NA 3AI7A 4C7OA 4OHUA 1DHMA 3QXJA 3V6DB 2A5GA 1S1XA 4NU8X 2Q5QA 4X1KA 2ADCA 1V4VA 3ZQUA 1WTAA 4H1HA 4DCJB 3NWGA 2I9KA 1A50B 3KTOA 1PAEX 3MDFA 3SBOA 2Q9AA 2B98A 3OZVA 1SO8A 1PQ4A 4JOQA 4NZPA 3J7YI 3LXUX 4JC0A 5FWXB 2C7RA 1IOLA 3K9QO 4WXMA 1U7ZA 1S4QA 1WHTB 5K20B 5JC8A 3MOZA 3FHTA 4IF6A 2KBEA 1Z0ZA 3DM2B 2RMKA 4JL5A 1OI7A 1NJ1A 2BDEA 3GAFA 1AQJA 2BA9A 3AONB 5H7XA 1UOOA 3D2WA 5CNJA 4KHPJ 1TQDA 3TCXB 2ZDQA 4Z3KA 1ZD4A 3EPGA 2Z4TA 3RR7A 3BEGB 3K0JA 3UJ9A 2WWVD 5ALVA 2IDMA 1YD7A 4FOLA 1LB1B 5DM0A 3ZWNA 3KQPA 1EEHA 3O4HA 2F43B 1H66A 2FF5A 2AJQA 3EVWA 5KFCA 1S5PA 4CQJA 4NRUA 3KQKA 2COKA 1Y1RA 4ID3A 4A0RA 4LC9A 1GFIA 4FGKA 5JALA 4NYOA 4U6PA 5E3PA 1T9DA 3GN2A 4NOJA 2X5KO 3BHMA 1MQ9A 5EXPA 1HC7A 2YWDA 4YLEA 2N47A 3VAKA 1XR5A 5BOVA 3WL4A 2V2QA 4RZXA 4QZVB 3P20A 1P5FA 2R8IA 2F4VB 1ZS6A 4V38A 4EYOA 1HARA 3WWYA 4H7KA 1FX0B 4K8RA 3K94A 2HBZA 4CQ1A 3CF6R 4QTZA 5C1DA 1C1HA 2YTCA 4GMDA 1NIPA 1C0PA 4J4HA 4MS4A 2O07A 3PPIA 5HCIA 4TTSA 1A76A 1XRQA 5T14A 5IKMA 2ATCB 2XAUA 1DAKA 3CC4S 2XSJA 4FYPA 2MDAA 3KBBA 2QPAA 2Y2UA 2JAPA 1RMTA 3T3DA 3R7SA 4QJBA 2JGMA 5ICGA 1B8VA 3G0CA 5KSPA 1CFZA 1TKBA 4CLHA 3GG9A 3DE2X 3TVYA 3U3RA 3QIPA 4ZCMA 4YUDA 3EEFA 3S5UA 3WMWA 1FDRA 1MQAA 3LP0A 3VHXB 2APOA 5D3KA 1DELA 1NX6A 4EJFA 1JBKA 2FW0A 3NL0A 1Y1QA 1W1UA 2OO4A 4R1MA 1NMSA 5AI0A 1VOMA 2HQRA 1EDBA 3A13A 2J8SA 1VQKS 1T6NA 1GSAA 1IPFA 4F84A 1B3BA 2CUTA 3C3PA 3RFFA 3BQ9A 1IKYB 2P9BA 2PQMA 3FMGA 2XAAA 4G9EA 1YR7A 2DFPA 4HD8A 5F9HA 4U8YA 1SU7A 3KWMA 5CA0A 4ECEA 1H0SA 2VRCD 1RTHA 3N6MA 4OHYA 1GGJA 1U3WA 2WQZA 4Y7DA 2O0JA 2YV4A 5LSLA 3PYMA 2R6R1 3ZDCA 1GR1A 5D6OA 1WI6A 1WHSB 2BHNA 4NZMA 3UAZA 3TAMB 1XTJA 3ASYA 4BC7A 1OZFA 4W99A 4F3MA 1KSFX 2J9DE 2VUIB 4ND1A 5I48A 4FWBA 3WBKA 4NG4A 4GX0A 1H3NA 2ZE8A 5FLXU 1AIPA 5AK4A 2G0NA 1O89A 2FFAA 5J5VA 2QA4G 2MSEB 1MHPA 2QY9A 5B7GA 1WOOA 3O4IA 2XT6A 3AG5A 3K1JA 2X7IA 5KFKA 4A47A 1Y3JA 2BRUA 1N5RA 4OX6A 3SIPB 2OWDA 5HCUA 4H7EA 4C6RA 4NBTA 1G5PA 4DXDA 1XNRJ 3P71T 4O4JB 1KOJA 4TRJA 3DTYA 1SCNE 4PU0A 1D6MA 4QPJC 3QV2A 1R88A 5JPDA 3TQSA 1F9AA 2QL7B 3K0AB 1IH8A 1WHXA 3MM9A 2JZCA 2X22A 2OP5A 3HNPA 2NYHA 3SF0A 3BZUA 5ELXA 1ADJA 4L8FA 4E14A 4C0AC 3V2UC 3GIRA 3KK1A 1R0ZA 2CCJA 4LVOA 1GPJA 4TLDA 1JT9A 1Y7IA 4BLGA 2ZSKA 1RABB 3REQB 3ZY2A 3FZEA 1VIVA 1P73A 2O8BB 2NO1A 1QAXA 3S5JA 1E3TA 4DV1J 3N87A 4QPDA 4UQTA 4HPXB 3JSMA 3BF8A 2WD7B 2U1AA 3U4AA 1YK1A 2HRZA 4B79A 8LDHA 3JYTB 3CT9A 2LDBA 5EWLA 4M9XA 1ZK4A 2AZXA 1KLNA 3GBVA 4DRZA 2DY1A 1ADBA 1Z33A 4LYAA 2MMGA 4OFXA 5JRJA 4AT1B 1J8FA 3EWNA 1ROFA 4YDSA 4NLLA 3FN4A 2VJKA 5HUQA 2ZSAA 1RQLA 1XROA 3KDOA 2VOPA 2HTEA 2Q43A 2V98A 3GGJA 2OL4A 2G9NA 3SC6A 4Q12A 3LDAA 4QM6A 1BTOA 1XDGA 2ZCJA 3OLVA 1J6UA 3R09A 4OL0A 1U28A 3AB7A 3Q2IA 1JVBA 3DV2A 2RGRA 3OKCA 3NRJA 2A5YB 2QVBA 4B8ZA 4NLRA 2EL7A 1Q7CA 1SAYA 2QLMA 4CCHA 2YRWA 1B76A 2QRMA 2I6FA 5LLDA 3FHLA 4ZAVA 3HB1A 2HNDB 2FXVA 5E1MA 4HH4A 5DQIA 1DZ5A 1RHKA 4M9CA 4XX0B 4M0KA 3HFKA 1BNCA 1GCUA 3W2IA 1DQ9A 2BEVB 2YV5A 2WICA 2J3HA 2ZM5A 3PSAA 1FTWA 2VSOA 5ADUS 4RPFA 1Q57A 3TGWA 4U9IS 5B0FA 2PBLA 1VE1A 8OHMA 1I0ZA 4JYAB 1VE3A 2UXCB 2VF2A 4KRGA 4NV0A 3CC2S 1RTIA 4POOA 4X9XA 1X86B 2XGJA 4MCAA 3CY6A 4GAEA 1MAUA 3ZDDA 5TIIA 3V8BA 2ZIUB 1YDGA 3CV3A 2FMTA 2OELA 1RE1A 2Q3JA 5AJHA 1KYYA 1YXMA 4RDIA 5FBQB 4K9QA 3DE5X 2P90A 5DGHA 2ZLBA 1V48A 4IO9Q 1YMQA 3KPJA 1E9EA 4F3RA 4QQFA 4KDCA 1W76A 4W92B 1AQIA 4GOJA 4WE3A 1GEGA 1F5CA 4WZQA 4KXLA 2P6PA 5KG7A 1LV8A 3WFZA 5FR2A 2NYVA 1H2FA 2H5LA 1EFCA 1EUZA 4QE3A 2HBQA 3JQGA 4RUBA 3I9MA 4AYTA 2EHJA 5JVDA 5BSFA 3NKVA 1U7OA 1WG8A 1NI4B 4DR5F 4BVBA 4GNRA 4RQBA 3NEKA 2AG1A 4TTRA 3GLIB 5FDFA 3Q7SA 1WUJS 4JGBA 3HVIA 3GAZA 4EX7A 2KLHA 3IAM9 4Q0BA 2UZ4A 1CJKA 2ECPA 1A2BA 3GEIA 3N2EA 2EP5A 2YX1A 4UNIA 3GUYA 3NCTA 1SUDA 3CT6A 1JPUA 1D4ZA 1RXOB 1T3LA 3IQIX 3EXEB 1Z5NA 2DNHA 3N2IA 4FFRA 1VBZA 5I3ZA 3EZOA 5JZOA 4MAMA 1MP0A 1J2VA 2VP0A 3T9BA 1LSJA 4YALA 2WAXA 4BNJA 2C9ZA 5J5CA 3I04M 2OSVA 3PE3A 1Q83A 3HJGA 2E6UX 3OJFA 3T4EA 3QEBZ 5LSRA 4JV1A 3HFSA 3T1YJ 1P72A 3S8SA 1M5HA 3GV0A 4NLTA 4AULA 1ZA1B 2PNJA 1NPPA 4FU0A 3BXPA 2HRDA 5IVIA 4DSEA 1KAQA 5K3FA 4LK3A 2DRBA 5AHRA 3X1WA 2REQA 2D5AA 3VZPA 1CF4A 1X8LA 5F5XA 5MN5A 3B6ZA 3UMSA 2PEYA 2A2DA 3T5GA 3AD7C 2DB3A 1G2QA 1XLTC 4PQRA 2AFVA 2ZOGA 3ZU5A 5BURA 1GP2A 1SVLA 4R51A 1VK3A 4FDMA 1Z4NA 1Z0KA 4C0OC 1L3TA 2ZJ2A 3RRNA 4LZAA 1HQCA 3N59A 3SNKA 4OYAA 2XLIA 2WPDA 4CQMA 2XWPA 3AUXA 1WEXA 5D01A 4CM1A 4DQXA 1C1YA 1F2TA 5FPPA 3E51A 3RC9A 2RARA 3R3ZA 2ZRCA 4FT4A 1PUIA 2FVRA 1G8PA 3KQVA 1XELA 3QX9A 3QUQA 1HURA 1AUPA 3KIPA 3UMBA 3A1TA 3U0BA 5TGZA 2WF8A 1ZK2A 1XTSA 5KYXA 3M6IA 3S6EA 4YAOA 1ZGGA 2KXFA 1UXKA 2PLFA 5K14A 2PZJA 3BMQB 4OZ0A 1JLGA 1LDNA 4OJGA 1M6EX 2BMEA 3LUKA 2MGZB 3E8SA 1H6DA 1XNHA 5ES4B 1QLJA 3H2GA 2JLGA 2DTDA 1LPBB 1I7QB 3QFHA 4B3XA 1NCLA 1Z16A 3GDWA 5DISB 3CONA 1IVNA 1V1MB 2DCUB 4PNZA 4ZOLF 3K8OE 2DF8A 3Q8YA 4JI8B 1D8TA 4N3AA 4D9FA 3QXHA 4MAFA 2XY4A 3DZCA 2FGKA 3SD7A 5C24B 5HKAA 3HF5A 4KXFB 3L0IB 1PCAA 1RNLA 4O4LB 3C4VA 5CK4A 3AI1A 4I3FA 1RC1A 4ZIRA 4IX1A 2E6KA 3DCJA 1U0JA 5SY9A 3UW1A 1P77A 5CZVA 1DI0A 1YBHA 2C9YA 3M8PA 3NO4A 4B7AA 2R0QC 2ONYA 2ORED 4NYIR 2E44A 3I53A 2IS4A 3AL0C 2QQ5A 3SLGA 2UVVA 3HWRA 4D80A 4RWXA 2KLBA 3GYGA 1HNIB 4QU9A 5E4FA 1P7YA 2DNYA 2J3EA 1CJKC 1U0GA 4OJYA 1Y6ZA 3ICPA 5E9AA 1HR0J 3QELA 2Y1DA 4WESA 3LBNA 1DV1A 3VSAA 4FR2A 5A8KB 4CH1A 4B31A 1H2YA 2J0XA 2VSXA 3OFFA 2QN9A 4MKAA 3A6LA 1I01A 4TKMA 1U2FA 1K5DA 2C4TA 2NP6A 4ZOAA 5KKNB 5J1PA 2HNZA 4FEYA 2OI2A 3DF7A 1TZCA 5LZ5A 3MR7A 1WSBA 3KZNA 3ZY4A 3JTOA 5CXQA 1UKCA 3KZVA 3VV2A 5K0NA 3FPHA 2HQOA 1TNDA 4I9FA 1ZD5A 5A6VA 3SFZA 1M1XB 1QS0A 2Q1WA 2IYEA 1S7IA 2HRBA 4BLWA 1ATZA 1NNEA 4D9MA 3MN1A 5ETNA 5C4MA 1KZGB 4V3BA 2EHDA 4D25A 3MZ0A 3LRTA 4G0YA 1WTFA 4L8LA 1NXWA 1QYDA 2CHVA 4Y8VA 2GJ4A 3WBBA 4IG3B 4B87A 1C1DB 3BN4A 1UWVA 2HYDA 3QMQA 2AJLI 4LHVA 5HJ7A 5KVAA 5KVQA 1A4RA 4EWTA 3G8CA 3VR5H 2JAXA 1TB4A 4YV1A 2EEZA 3IJEB 2CN1A 5EPOA 4FILA 1R6UA 4C8NA 2LRHA 2GEBA 5CFRA 3T6KA 3GD7A 1UANA 1L0BA 2YOFA 5AI6A 1HNXJ 1EEXB 1NBMA 2EBHX 4UMEA 3ZWYA 5FDLB 4YO8A 2PRYA 3NUGA 2LV8A 3LKVA 1VPDA 3NHRA 1TAUA 2JLWA 4JI2B 4MJXA 3GCZA 4ZXPA 1K06A 4YREA 2VJUA 2VYND 2LCFA 2WUWE 2AR9A 4KREA 4MGIR 3MCMA 2C2RA 4R8MA 3PYXA 3SJBA 4BRSA 3EY4A 3CN9A 2BY4A 3K1ZA 2FFBA 2IDKA 1S0UA 4F4HA 2FDNA 3UPUA 1WNTA 4JLWA 4QUEA 1IDN1 1E66A 1MLAA 2ZR7A 5C52B 1JG3A 1KJNA 1WHSA 2DUWA 2BLNA 1NJWA 5HAOA 2FLWA 3OQHA 4BNLA 4EYEA 1BXGA 3DHVA 1G59A 1E6LA 3M2PA 4FT2A 2BGGA 1UODA 1K4KA 2QMZA 1LA2A 4M8LA 1G42A 4N7JA 3ZHUA 4JGIA 1W7WA 3E53A 2QX9A 7FD1A 5IKOA 1YQEA 5IH3A 2IIVA 1Y3DE 2QX8A 3JQKA 4ZRNA 4BLSA 3ABZA 1G6HA 2M2BA 5B3LA 3LYUA 1WEKA 4NH0A 1LY1A 2VYVD 1O6FA 3I5YA 1P4AA 3NNNA 4IF4A 4OZ1A 3DVQX 1MJHA 3AHJA 4J43A 2YPYA 4WACA 1IBKJ 4JS0A 1KIFA 1TEXA 1XZPA 3FGNA 5AP9A 3Q9SA 2JI9A 1MO6A 3KUHA 3OHMA 1Z07A 3EASA 4W8HA 2VG5A 1CQIA 1HNXB 3N4WA 521PA 4URVR 4A8JA 4BKQA 2BZ0A 3PJFA 4NMMA 3BTSA 1XXHE 1JXLA 1FXSA 3Q98A 1C0TB 3WKDA 2HNZB 4TWRA 1FE0A 1D1TA 1YIOA 2F55A 5F73A 3O4VA 1T1RA 5EE1A 2QM0A 4DQLA 2J67A 2OHJA 4NU0A 1TL1A 3DC7A 3ZU3A 1ZTTA 2O4CA 2IS2A 3H5YA 4Q3KA 1YKGA 2QLJA 1KI8A 5H82A 2GDJA 2HBYB 4QODA 2XUGA 1JWLA 2YVLA 4K50A 5IC6A 3EM1A 4OKNA 1XCMA 1T5SA 3QE3A 2CF6A 2P2ZA 1W34A 1G4AE 4OSOA 1WY5A 4AUEA 2X4GA 2BFAA 5BR8J 3EJWA 1Z7BA 4DANA 1W6RA 2VKQA 3B5EA 3OOHA 3E15A 3I3OA 5JXSA 3EUNA 4DW8A 5LQRA 5CEJA 2VQFF 5EP4A 1W5EA 2ZOFA 4BXOB 4R7ZA 1QZTA 2BW0A 5B0AA 2W2MP 1ZDMA 1V37A 4WZ6A 5D7BA 4TV8F 4PV7A 3ZWMA 4HLQB 3DXYA 1KQOA 2MDTA 4JLDA 3QKTA 4MUHA 2UXCJ 2DK2A 1Z62A 4HMPA 1KOFA 4OYPA 4I5GA 1TCUA 1TAQA 3QGPA 2BONA 3VAZA 4TS1A 4CV3A 2FJWA 2FPPA 3Q89A 2AYYA 2VHTA 1LBQA 2AI2A 4X20A 1CJTA 4YAEA 1MIOB 4IFIA 1Y5IA 2QMUA 1EWTA 4LWOA 1ZM4A 3R5BA 2HQFA 4PTLA 4OI2A 1RA6A 5SYMA 1V0JA 5JJLA 4OYYA 1PJ3A 1DQNA 2YOHA 1EQAA 3M8KA 1QZZA 3NBUA 1D07A 1P19A 2PFKA 5INTA 1XTPA 4IVQA 5B0GA 2PMZD 2VPZA 2ATCA 1OA1A 1OROA 1JHYA 4DQVA 3UGJA 4GSYA 3TOXA 1F2TB 3NM6B 3LLSA 4MTLA 5JJIA 1R5JA 1LPAB 3GLIA 4R1NA 2DBYA 3WFJA 2OHDA 3FBCA 2KW5A 4ZOLA 5J1SB 1W96A 2WKWA 4RPGA 5G0TA 1ZZEA 2VR1A 2QRHA 1KE2A 2JIQA 3H2IA 5EE9A 1ABBA 1YZGA 4F2SA 4ZHRA 3QXGA 4DMGA 4XFKA 4OGKA 1JNZB 3PFKA 2WU8A 1ABEA 3BL6A 1ISMA 4PAQA 1KFCB 3KPWA 4IIJF 4JR0A 4DSLA 1E9CA 1LQUA 4JB2A 4QGHA 4AN4A 1VSTA 3HBLA 3PUVA 5DEIA 1X13A 2W6JD 1VC6A 2EG9A 5BWNA 3C6MA 1O8CA 1WZCA 2QRNA 2ID4A 5AW8A 3R8XA 4EA7A 4KUHA 3ROMA 4WZBB 1RB0A 3AI2A 2XCQA 1DHRA 1CXZA 3VU3A 2D9PA 1BU8A 3CCSS 5F8GA 2ZHAA 1PR3A 5KMGA 3IN5A 6REQB 2XUQA 2PX6A 2Y05A 2PR2A 4B0OA 1IQRA 4EBDA 2X2PA 3I1FA 2DQSA 4LQLA 3OFVA 4DYVA 4Y2YA 3FMFA 2X5OA 1HW8A 1LBTA 1SH2A 1SBIA 2DGTA 1IKXB 4WOPA 3ELYA 3TL3A 2CPEA 1N3YA 5AH0A 4LRCA 2AOUB 4D79A 2XQFA 3QEAZ 1XPRA 4LAFA 2G13A 4WCDA 1C7EA 4GRIA 2PU7A 3WLQA 1WKJA 4PW0A 2EQBA 2BW2A 2BGWA 4TZKA 1KETA 4FGUA 3D67A 3D1OA 4OHCA 4YHHF 5HTKA 4ILMA 3F0TA 4FWIB 1YI8A 4H7HA 3EVEA 3K0CA 2V58A 4TLEA 4GKKJ 1U0FA 1F6TA 2NU9B 3R6LB 2X8LA 1RZVA 3VJKA 3NOCA 3PHCA 3VXKA 5KG4A 2VIHA 3UO8B 5HOQA 5AVJA 2F8EX 1TVEA 5DB4A 2QTNA 3KL4A 4PC6A 4HUJA 5FUYA 4JOBA 2YWKA 5IRCD 3S2SA 2ZBQA 3DGFC 4GM4A 5FUQA 3UCZP 5JIBA 4G89A 4WLUA 2WZQA 1NDLA 2GJ2A 3TZKA 1ADFA 2HSWA 1CIJA 3D0HE 1LRJA 1UBUS 2QM3A 1C7FA 4JJIA 4PWDA 4DV7J 4IOMA 2TMYA 1GFZA 1QDLB 2ZYWX 2I9SA 3ZWQA 5K2MA 4QGGA 2CQ2A 4CH7A 2J0QD 3BSNA 4MWTA 3KYBA 2IRWA 3B89A 5L53A 1TMYA 1LXNA 3WR5A 1WG5A 3MG9A 2F6RA 3K5LA 4CO3A 3E2PA 2R84A 2QNBA 1DB3A 1RT6A 1ZOPA 1VL6A 5F1OA 4EO4A 2HZAA 1PO6A 4Q39A 4YEAA 4DNOA 4WX2B 4KYUA 5FL7A 5HN0A 2VEOA 3RC7A 2WJWA 3ORRA 4K6HA 2MYTA 5TB5A 3BDAA 1MX5A 1F9EB 3WQBA 5D3GB 1TIBA 1WKKA 1KH1A 4IRXA 1IUKA 1J97A 3TEJA 3P1JA 4M36A 2HL6A 1P1CA 1TC2A 3DAFA 3ZTTA 4DC0A 1X7WA 4F38A 4XIUA 1W36D 1U99A 1M1YA 4D9GA 3T1TA 2XUDA 1PTJC 3B6EA 3WYNA 2D0IA 4USIA 1XF1A 2J9XB 1T3OA 3LF2A 1K75A 2HVZA 2CPDA 1LKZA 4IGFA 3U6KA 2P9QA 2OKGA 1YZUA 4OQ4A 4KV8B 4ZHQF 3HB0A 4IYJA 4MJ7A 4CF6A 2IYSA 4KVGA 4A46A 2GIQA 1SV5A 5KCZA 1GQRA 5JS1A 4FD3A 4LBHA 1RC0A 2Z0GA 4FB5A 5AR1A 2IITA 4Q44A 3MMBA 2FVPA 4R1SA 2G7MC 1Y6FA 2GAHC 3STTA 1XZMA 3IS9B 3D3KA 4GWGA 4HGRA 2BFNA 5FWNA 3DLHA 4WN3A 4F4KA 2AUTA 3MJ4A 3TO5A 4DU8A 3TCKA 1VE5A 1D3AA 3JVEA 3THVA 3ZIDA 3BTOA 2Q5JA 3NDIA 4ENSA 3G49A 1IZ8A 5EJ2A 1T9WA 1MZVA 3HZEA 6CHYA 4EYGA 4OI1A 3WX8A 2LGJA 1WD7A 3O8WA 3I01A 4NDNE 2IELA 2Q6TA 5LA6B 2DFKB 4KTTE 2B34A 4K6MA 4EABA 1TVKB 4FNMA 3DEIA 3GLFA 1TP7A 3DV0A 4NQZA 4TS9A 3ESBA 3WDOA 3Q86A 1J9ZA 5JSZA 3UPTA 5ULLA 2X3FA 2HRRA 2IU4A 5L4SA 4HQ6A 3THWB 2D3ZA 5KREA 3OZAA 4ED3A 3LUGA 5TPZA 1C7RA 2QA2A 3MWKA 4HUQA 3IQXA 4X64B 2BYCA 2F3UA 5CNKA 2LNDA 2BJHA 4L4SA 3MJFA 4Q7QA 2BPOA 3GFRA 2XGOA 2HFKA 3BEOA 2ZRFA 3JRNA 4HTFB 2WPNA 2F8SA 1GT6A 2VD3A 3MCVA 3R41A 5KAMA 3NAHA 3A26A 4F26A 4WE1B 3H11A 3I5AA 2IF0A 3RTGA 1T94A 3SZRA 4Q18A 1C1BB 4K4ZA 1ZN9A 1ZM7A 3UTDA 2QYSA 1JQEA 3V1UA 4DCGA 4LJLA 2WYOA 3RWMB 1HBUB 2QN6B 5H9EK 4OFWA 4HNTA 3V8QA 2Q4RA 4FFBB 4CKXA 3IKLA 1PN3A 3OJEA 4Z53A 5BQFA 1GMVA 1C8VB 1V3RA 5EYPA 3VAGA 4WH0A 4GOMD 4DJFC 1PWYE 3I2FA 3AFMA 4ESOA 3ZBPA 5CA1F 4DV7B 2F65A 2NXUA 2NP7A 1Q82T 4BUCA 2Y6VA 2RGEA 3M7VA 2XM3A 1X9SA 2Y4OA 4KB5A 3AJEA 1SB8A 2QRRA 4XYEA 2O3TA 3PIIA 3VZCA 2X0RA 3KU4A 2J3DA 5FI1B 1FS5A 4L27A 2WMOB 2QW8A 2WUEA 1C41A 3HJAA 1A7GE 1TQ6A 1S10A 2ZBIA 2RHWA 3O8RA 3LHKA 4D9EA 2I66A 4KY3A 1ZNWA 5T5QA 1X1SA 2HXYA 1N9GB 2XMUA 2VJMB 3HUUA 1FP6A 2EF1A 5DASA 3RU3A 1T8RA 4DA6A 2HBZB 4GLJA 2R48A 3TA1A 2AIRB 1FUKA 2BWJA 1DHTA 3A10A 4D6PA 5JFTA 2CHUA 3ABOB 4YQYA 4D92A 3NGRA 4ZOSA 1ICIA 5JSUA 2E49A 1IR1A 3PJEA 4HP8A 4BLPA 3ZHQA 1M3SA 1RLDA 3AF3A 5AIBA 4UAJA 4RK4A 4URUR 4C2UA 1AUXA 1XU7A 3E4CA 3HBJA 2BVNA 3AB2B 3M4XA 4DUZB 3QU5A 3CSUA 2GN1A 3BB4A 2OPRA 4WQMA 4MITA 2VXCA 3GZ7A 4A8SA 2EFOA 1Q3KA 4BKMA 1XMOB 4K0KB 1V3VA 1GL7A 3DZHA 2OV3A 3HXPA 5K0EA 3WC0A 3NGDA 3L7AA 1CUDA 3O8QB 5PGMA 2F67A 4MRPA 1KQFB 1NZJA 1CZKA 4H1TA 4KN8A 2AFHB 1VL1A 4DJJA 1FRMA 2XGSA 5DQGA 4YVFA 3T0FA 3M49A 4MT1A 3R0VA 2A5LA 2ONCA 1JL3A 1AXRA 1KQNA 2DKNA 4AYWA 4NJEA 2Z3WA 1A8PA 3A2LA 4DX7A 2PQ2A 2FVQA 5DYGA 3HPQA 1UPFA 3V1YA 1ZLYA 4X24A 3QYPA 1SKAA 3PFNA 2PMWB 4E33A 1Z5UA 5A3JA 4HDMA 4EKIA 3W5XA 1DBIA 2VP5A 3TXAA 3LPEA 3GA5A 3IO1A 1K6JA 5I7FA 4RNFA 5G4KB 4J94A 1VSVA 1FRZA 3WJ1A 5HMWA 1CE8A 2WD8A 3GPDG 1D4FA 4L7VA 1O5JA 1WQ4A 1BRMA 3MMCA 4ZPAA 4DN0A 3T95A 4UW9A 4BB6A 2QRGA 4K9MA 1NAHA 1ZEJA 1GTVA 1DRZA 3EZXA 1SXJD 3ZLVA 5ILOA 3RVDA 5GMEA 1ARZA 2VJMA 5D8DA 3TZQA 1AFJA 3K20A 4CLOB 2GVNA 4IV0A 1NC3A 3JQRA 1GUBA 3BDIA 1U02A 3FHCB 4TV9B 1H1LB 3GQCA 1NKVA 1J0CA 2A2CA 2P6SA 3WZMA 4HAUA 3QWAA 2PGJA 1QJHA 5BR8B 3OWXA 1PS8A 1QP8A 1VBNA 5BNWA 5FV4A 4NOHA 3DYBA 2ZYVX 4QU7A 2XV1A 2AXNA 1UPCA 1KGDA 1X1EA 2IXBA 1DJLA 1AB5A 1UAWA 3SF8A 2Q6CA 3RJTA 1XTBA 1BGWA 1H23A 4J0CA 3S28A 5LZ7A 3LC2O 1W4BA 4MEAA 3DH0A 1DO2A 1ULAA 2DKOB 2AWZA 5AW4A 3GLRA 4A8FA 1ZN2A 1NVEA 1TM4E 3CO9A 3CLTD 1CVJA 1E5DA 3PR1A 2RT3A 4G07A 2I5JB 4RSHA 1AA9A 3IGNA 4O4GA 2NN3C 2Z6AA 3NM5A 5BWLA 4W82A 2B43A 2KL8A 3N74A 4TUYB 2HSGA 2VG6B 1VHJA 2Q46A 3A1CA 4P4NA 2AGQA 4AXIA 5AW3A 3E22B 3MB5A 4F97A 5ADWA 3M2UA 1H2ZA 3JWEA 3OTEA 4R1UA 4EJ0A 4RZRA 1XZBA 4P22A 3UJNA 1IB0A 2GQQA 1P0FA 2C4UA 1WXQA 1XEFA 3EGVA 5F35A 2FH5B 2VAPA 1YAHA 1ZKMA 2HHSA 1WB6A 4JBNA 1U1PA 5C1OA 5LZ2A 1HMVB 1U8YA 1L9XA 1CY7A 3LX6A 3O92A 4IFYB 3OEEA 3JR7A 1KC1A 1K1SA 2RD2A 2HYIB 3C3LA 3U1VA 3QPWA 3ELBA 1SBRA 5ICCA 2LLZA 1PQWA 3V5RA 2XZLA 4DQQA 3DLIA 1XCLA 3T3PB 3Q2SC 4O29A 1AHPA 4DDFA 2DNPA 2FMXA 3H9QA 2MKSA 3CLKA 1YRAA 1E9RA 5CDUA 4RF2A 2K7ZA 1FJGF 3OCWA 1IHPA 4JZKA 4UUQA 1NQTA 3DI6B 1ODTC 3NBYC 3GFQA 4MB2A 2VPWA 4PPGA 5C25A 1HRDA 2QVYX 4TQ9A 4DG9A 4R41A 2FSPA 5KVVA 2UZ1A 4AZ0B 1GX6A 5ERGB 3ABQB 1XDWA 5IULC 2HMUA 4B1FA 2XHEA 2ZREA 4UW2A 1U2GA 1QTQA 3FLMA 3FVQA 4U7UD 2J9YB 1DMSA 4ES2A 4WADA 3HKEB 3UAOA 3WMRA 1NB2A 3D6MB 4OXRA 4ZKAA 3TQEA 3N8DA 2F3SA 5COAA 1MO3A 2G6BA 3R7NB 1HTBA 3UNYA 4RHTA 1HA3A 1T0BA 2I1VB 3JQAB 3KUEA 1NK7A 1QX4A 1RMYA 1U7HA 4LSNB 1S96A 2NOAA 1FFGB 4YS2A 2B5WA 1R6DA 1QJCA 3E3AA 1E2NA 4BECA 3S70A 2C9CA 4MWZA 3KQTA 3K5HA 5IK2A 4L1KA 4JDPA 1WCIB 3FRIA 4N5LA 5BN3A 3OU2A 2J6BA 4LYYA 2DRAA 2V3VA 3RFUA 2Y1CA 4IJ6A 2WP0A 3E48A 4GO1A 2OXTA 5I8ZA 3E7XA 3LA6A 4KQIA 2GX8A 3KVYA 2Q1XA 2VBGA 4ND6A 1D5CA 5LJIA 3OEHD 2Q5IA 4MV3A 1MPXA 4G1EB 3E27A 4HO1X 1MN6A 1WEHA 2JB9A 2V9CA 2F3TA 3ETOA 1JMVA 4MSUA 3LP1A 1CU1A 1PNOA 2CA9A 3II6X 1NBME 4FKZA 4CU2A 5A6WA 1DRKA 2RGGA 3N2KB 1Y1LA 1RKIA 4C4XA 3BPDA 4EI2A 1EUDB 2OD4A 2QF7A 2UUAJ 1NDUA 4YLGA 4PM4A 5LU8A 5ALUA 2D0PB 1IJKA 2NSLA 3CCJS 4LXUA 4D3DA 3O8QA 3GDOA 3MRSA 5C37A 4Z0TA 2XRYA 1AKMA 1BEEA 2J59A 4Z2XA 4JWKA 1EFUA 3QU7A 3Q8WA 2W2PA 2LE0A 3G2QA 2G83A 4US2R 3MUOA 2JGIA 1UW9A 1IXKA 4BVHA 4ZT5A 3OFND 1ZOSA 2GETA 5HROB 1ZMXA 1QR2A 1FX4A 2TYSB 1K27A 1LPSA 3BR8A 2XDWA 1B73A 5DLPA 2GXSA 1U5BA 3CVKA 3SHTA 2GASA 3ICWA 4C4YA 3VX4A 1ZWLA 4G1CA 1CQPA 4ZHRB 1VQYA 2QBYA 5DX0A 3Q7IA 4KL8S 2NQPA 1NKTA 5CAAA 2QL5B 2VQSA 4QTYA 4Y1RA 4URXR 3L0SA 4POAA 1NI4A 4BNKA 4UM9B 5AI4A 5HSPA 3PIDA 4LF5B 4UREA 2WFAA 3CWZA 1IJFB 4I55A 3GJ0A 1Z4IA 2ZYUX 2ILYA 1L4BA 4LXYA 1QYWA 2AN5A 4BPRA 2H54B 5IV3A 4PZEA 4YB1P 1F06A 4B9VA 2Q3DA 4WECA 3G59A 2VDNB 1ENPA 4Z4EA 1DLOA 4OREX 4X92A 3JW8A 4FFOA 4YR9A 2ALJA 2VBWA 3OZCA 5I9TA 3AF5A 1XXHA 4X54A 4M1OA 5HBRA 2Y6UA 2IU6A 3P3DA 1L7DA 4EOGA 3K2BA 1KO8A 5HMYA 3AFGA 2WAAA 2OT3B 2NADA 4ZU1X 4LWZA 1U1QA 4JI8J 4KC5A 2B7CA 1MRSA 4YRZA 1GYPA 2J4DA 1LC3A 2IU3A 2PIDA 1AMUA 2BJ3A 1H9AA 3ICEA 5FNZA 3TIFA 2PT6A 3KDAA 4AKEA 3FMBA 2C2HA 4HV4A 3TKAA 3IDAA 2GR9A 4LRSB 2O7SA 4HRYA 1W4CA 5E1BA 3LAWA 1SKUB 3NAIA 1UP4A 3N2YA 4DSNA 3AVOA 4Q66C 3RBEA 3EZLA 5JY1A 3IRWP 1E0AA 1H73A 1GPYA 1BDBA 1MSWD 3R2DJ 3GLTA 5A5VA 2XOXA 3FWNA 3JWJA 2GHRA 2AZ4A 4HEA9 1AKRA 1E4VA 1MV8A 2EZUA 4DA0A 4EBBA 1S5ZA 1NOJA 4CIWA 1GNRA 2IZZA 4L5YA 4P4SB 4RY0A 3G6VA 4L4XA 4AP9A 4ALJA 4DV2F 2ZKUA 3BK2A 2GZDA 4DDVA 5MHTA 2OBLA 3RAXA 3SQOP 4UD6A 3R1IA 4EVQA 1XIVA 2TMDA 2XO7A 3ZZYA 4KXNA 4HZUB 5ENZA 4U9HS 2WBRA 3V8MA 3Q8LA 5KJCA 2PFGA 2ZAYA 1LTQA 5IAAA 4HXEB 2H65A 3VC2A 2VT7A 3E03A 4ZT6A 4D0RA 2IH4A 5JNSA 4P71A 4LQ3A 5M5BA 4ZP7A 3DE6X 1VL5A 1HIYA 3TRFA 3AEXA 4LRFA 2C3OA 2XZWA 3DOKA 1XX6A 1XJWA 2X6RA 1GO2A 4ZAZA 2Q3EA 4GKBA 1LNSA 4E0DA 3FZGA 3RAPR 3BGOP 3QK7A 2R8OA 4RDHA 4RM2A 1C7IA 2CWKA 1NRWA 4YHHJ 4I68A 5HVHA 1BWSA 1RKVA 1AHNA 1UF9A 1SG0A 4PXEA 4S35A 5HILA 1YJBA 4O3FA 3KLEA 4PICA 5DX8A 2PI5A 2F3QA 4E2ZA 5HZGA 4EY5A 3ZU6A 2WQ6A 6YASA 3UFCX 3ZXYA 1F4PA 4K88A 2J09A 2Z9BA 1FNBA 3C8HA 2MINA 3O74A 2CDNA 3IBSA 4EFAC 3FPBA 4MIEA 3WX0A 1XRSB 3UD5A 4QG3A 4PVDA 2LPMA 3NCQA 1IL0A 4RWEA 1RAFB 1N92A 3W6PA 1FCAA 4QBHA 2EFVA 1ZOIA 3INGA 4G0ZA 5THWA 4H6XA 2HH9A 1UMCB 2PUFA 1VIAA 4WKNA 2W2MA 2IK8A 2LKDA 2QORA 3ICCA 3MRTA 2DZDA 1KVQA 2EW9A 2QVZX 2DNOA 1RHUA 4GOOD 3WWOA 4ZCTA 3AINA 1JQAA 1YQTA 3LBYA 4OX9F 1P4JA 2RHTA 3EXHB 2RKIB 1NDCA 2Q41A 2ZIAA 2AN9A 2W43A 1FKOB 1FFCA 3UN5A 1VG9B 4ZP9A 3A3NA 4NYPA 3WK4A 5C35A 3OMWA 3NCRA 1PJAA 1NPYA 3OM0A 3TL2A 2C4HA 1S72S 2DHSA 1KOOA 1J5OB 1XVLA 5IZHA 1PO7A 1TLFA 5K8PA 5I3UA 4O4IB 4X1YA 3F3YA 1T25A 3H5VA 5A5GA 3KLFA 4GRAA 4TN5A 1DJPA 4IMPA 3OQIA 3MLBA 3KB2A 4N0EA 3FPGA 4GL2A 1PZMA 4MYHA 3AVXA 1ST3A 4NFYA 3AK4A 1RRVA 1XNRB 3PDIB 3RAFC 3OE7A 2AT1A 2XHZA 4IJKA 1SK8A 1PD0A 1SCUB 3G2NA 1U3UA 3PNIA 2DRIA 1L7BA 4PIVA 1D2MA 1Z28A 3SX2A 3DLEB 2RGAA 1RYRA 5GM2A 2FG5A 5GADU 3PHBE 1VM6A 3RAJA 2DXFA 2VLBA 4KSBA 3EK2A 1FFWB 4I4TA 1KRHA 2Z1NA 1OXSC 5T6BA 5CNMA 4V1CB 3K8WA 3G6KA 3PHIA 4EO6A 5EWJB 2BN4A 4H4KC 5KEIA 1DQZA 1L5YA 2E5IA 1SUIA 5JASA 2C4NA 2JJ8A 1XZAA 4RLSA 4JI0J 4ZVQB 4J3FA 3RS8A 4KYIB 1GZ5A 4IOKA 4FMDB 1NLYA 4CRWB 4RPKA 3E7FA 1NLFA 1JI0A 1VGQA 3LGAA 1RTTA 4CEHB 2JD1A 1F3LA 3UH1A 4NJOA 3EQ6A 4ABTA 3CJRA 4F5ZA 5CM9C 4AL5A 2VQEJ 1BE0A 2QT1A 4F9GA 3ZZRA 1TO6A 1JMTA 2RS8A 4K5RA 3VNBA 1JFFB 4JL8A 3ZWDA 1U8CB 1FBNA 1X15A 1NXVA 2R6GA 4B9TA 4C0BA 4LDJA 4B9MA 2P7IA 3EDQA 2B9XA 3W1VA 2FKNA 4PG7A 6GPBA 1PDVA 1O2DA 5I7AA 3BWMA 3M9MB 5EN1A 3K96A 4A26A 1TC1A 3V4MA 1W36C 1XZQA 2GVDA 2GBGA 4YRIA 3RSLA 5AHOA 4G5YA 2XI3A 2O2XA 1N2EA 1Q7EA 4FOOA 4HDMB 3EC1A 1KARA 1VJGA 1WXFA 1SNYA 5KFGA 1Y4ZA 2FQYA 4YUYA 3W1EA 5JZ9A 1L5MA 1CUBA 2L48A 1RPNA 3QOWA 1US8A 3HVTB 8ABPA 2HBRA 1FSZA 4EPWA 5EFOA 2UKDA 5KS2A 4B73A 1J2UA 1TA9A 2XCUA 2X3DA 4ZDWA 2VTDA 3JSRA 1R6BX 2XJ9A 3HZRA 5C32A 4OHRA 1WSWA 3WLFA 1GU0A 1IOWA 1NV8A 1QIFA 3L1IA 4J16C 1ACMB 4IRMA 3K59A 3E70C 2A3NA 3DQZA 1WB4A 1ZC3A 1QTNB 2I3BA 2PYIA 3M4NA 2CVEA 4Z9FA 4B2IA 3GLGB 2VA3A 1G5TA 4W1PA 1GK8A 2IMOA 4WYLA 3JWIA 5KCMA 4LTDA 5IYZB 2DR8A 5DSXA 3TZZA 3D7KA 1VQMS 4EZEA 1OJLA 4Q03A 3FKJA 1EX6A 1DAMA 3TIGA 3TSOA 3EQZA 2ATVA 1NE7A 3LWDA 3NRCA 1V45E 3DMTA 3M6VA 4ZP8A 1RLOA 1PQUA 2QRKA 4V2IA 4PINA 1KI3A 3WICA 3GLFE 2IXFA 3ISTA 3C5CA 5KMGB 3HZZA 1E2QA 1DKMA 4B3TB 4OX9J 1RT5B 1O08A 2ZPUA 5NULA 2GAAA 1WNEA 3NHMA 1KI6A 4PRLA 3N7AA 3T7AA 1RXCA 3RKSA 5J2NA 1E3QA 1FX1A 1DRVA 1BA3A 2H3HA 4YB5A 4FD2A 2ZB2A 3CNEA 1EFAA 3R24A 4UOEA 4C5CA 3IPRA 1YVFA 2O6LA 3RV4A 3D81A 3C8DA 1ZM2A 3HHKA 5KNDD 2VYQA 1U2CA 1IR0A 4CIVA 2IF2A 4TYBA 3GEPA 3S0JA 5A1TA 4MVJM 1QFSA 2BGUA 5K0SA 4ICIA 5F5LA 1S3IA 2Y1EA 2OVFA 2BVZA 1AN9A 2WKRA 5TMDA 2HGMA 2JFBA 3HM2A 5KDOA 1J99A 2H4YA 3W4IA 2NVWA 3HCEA 3IDSA 3KYLA 1P7WA 1M6VA 3KO8A 2ZRBA 4YUXA 2I1RA 1HI1A 1NOKA 1PR1A 2IJFA 3RRKA 3N6LA 3N0XA 1G63A 1O94A 3CIMA 1XZLA 2NXWA 4P54A 4I2VA 5FHRA 3IS3A 1NNDA 5IASA 5EVCA 2UYOA 3HN2A 4DLNA 2CYAA 3ENNA 4DR2J 5ETMA 2CVHA 3EW7A 4JI5B 3L3BA 1I24A 4IIUA 4ATNA 1ZR4A 3V6KA 1EFDN 2FJVA 1Q74A 4KFTA 1W59A 2RDDA 4FDFA 1G9TA 3HDGA 2OWEA 4U1RA 1UM9A 4FX5A 2M8DB 4WOJA 4OMFG 1HKUA 3V55A 4ZOBA 1BZYA 2V2KA 3CPHA 3R9XB 2ERRA 4B3RF 3EG9B 2H2AA 4EB8A 4WVFA 5KT6A 3D0KA 2F9FA 2Q6VA 3KSBC 1Z35A 3MAAA 2J5QA 1GQ2A 3LS2A 3DLCA 2Z09A 1ZYUA 3I2YX 4MW4A 1N25A 1C1BA 3C70A 4QIWD 3KJQA 2HG4A 3W6OA 1VKJA 2O5CA 3IIKA 4LHYA 1VRCA 5C25B 2HV8A 1A98A 5DMXA 4IG9A 4IDDA 1VKRA 4Q4JB 3RD5A 3PJ9A 3ZCSA 2VDWB 4LFBB 1JLFB 4OJ3A 1CJTC 1U6BA 2FTRA 1XMQF 1E8NA 2RGBA 2YXDA 2NZCA 2GIFA 1ZD3A 4I36A 4NBUA 2B9YA 4JLVA 2CY0A 4DCOB 2O2HA 4GQBA 1W2GA 2OE2A 2EI5A 9ATCB 3I04A 1FNOA 4JX8A 3VJLA 4D8WA 7MDHA 4D9BA 4EATA 5JSKA 2UZ3A 2CHEA 3IRVA 3V1LA 1EZ4A 3ZD7A 3FVWA 1SL2A 4DUZJ 1R0XA 3AEUA 1FYWA 3BMQA 4F86A 4Y2TA 2GX6A 5G0RA 4INJA 3ZWKA 1UPBA 2JL1A 3KJNB 1E6WA 2IA5A 7ABPA 3KSAC 1U2DA 4AN0A 2VF8A 2FEKA 2KVIA 1A04A 3E8OA 4MQUA 2D4AA 1VDZA 4MIWA 3BK1A 4V39A 4UTZA 3FH0A 3MS4A 1H1LA 3KT8A 4PWYA 4BZWA 2IPNA 4W6QA 3BICA 1WP4A 1M5VC 4TTIA 2IYGA 2WYHA 4C2TA 3SSMA 2IC3B 1OMOA 4CTAB 5DLGA 3EZ9A 3SXPA 5ALQA 2G2YA 5DM1A 1QAMA 4F7DA 1T9CA 5BV8A 3WBFA 2HJ9A 4AMUA 3S8EA 1E0SA 1HDIA 3NXSA 2WY2D 4IIJA 4EFMA 4QL3A 3HBAA 2GN6A 3VOAA 3SYRA 5BSHA 4MRAA 2B8NA 2M88A 4PQGA 2HCBA 3AGQA 1T26A 1QWOA 3P2KA 3P0FA 1JLLB 3MECA 1DS6A 4HAVA 4HI2A 3F9IA 3G6XA 3U39A 1NJFA 4DQSA 2PRSA 1WR8A 1F5BA 3AFOA 4AL7A 3QZ7A 3I39X 1N5YA 4U7CA 1OI3A 3FWYA 4PABA 3TXYA 4KIWA 4JL6A 1RTZA 2AJ1A 1QH1A 3FLEA 1Y7PA 1IVYA 2BOAA 4UT4A 1CUUA 3IT0A 3MT7A 2H51B 1WWKA 4IHKA 3R8YA 1NBHA 4D8XA 5CEFA 1ONSA 1PT6A 1SCJA 1BMQB 2M2IA 2XYQA 1GNQA 2A88A 3M32A 2JCYA 4PHGA 1E79D 2J3IA 1RQ7A 4TS3A 3O2IA 4I4TB 4OFBA 1RS0A 3D4OA 1L3KA 3BL8A 2HLPA 4E2WA 2QVCA 1YWGO 2P4SA 1HRKA 2JBAB 2RHMA 1OZ0A 2X9LA 5DBIA 3SDBA 4AZSA 1N2SA 1S77D 3OCXA 1TM3E 4YN3A 3C6ZA 1SGWA 1YFJA 1PGOA 3ZWOA 2R9LA 3VAYA 4DCPB 4NE9A 1WBDA 4JENA 3L18A 5C8DA 3ILSA 3T9CA 3IEUA 3PW4A 4KGDA 5CLQA 2V4JB 5A7HA 1JIJA 4XYLA 1VP3A 2F64A 1Z4PX 3MFHA 2ZPAA 3QKIA 4NONA 3ODGA 1WOYA 3N58A 5JBQA 4PCUA 1MOSA 3URMA 5EMHA 3U6BA 3T61A 4DFDA 4DC9A 2AX3A 3GMSA 3NBQA 3RBDA 3AGPA 4PKDB 2GAJA 2VDHA 1XDDA 4IYRA 1NDQA 5CCDA 2GM9A 4C30A 4HXYA 5E6UB 4TLRA 2OPQB 1X5TA 3PHJA 1ZKDA 4OL8A 3UK6A 3KLMX 4PANA 3RFXA 4XAQA 1T9HA 3NXKA 1JJHA 1H69A 4HGOA 1YCDA 4HFRA 5TV2A 2X2FA 3C0KA 2GLTA 3EQ8A 1H05A 1NIJA 4PX9A 2WI8A 5LOVA 1GG5A 3OHPA 2QDKA 4HLNA 3M4YA 2YYAA 3A7DA 4U00A 2K7KA 4KXMA 1YH3A 3DLGB 2EATA 3UBTA 3F56A 1Q12A 3S6JA 1WDTA 4WOBA 2PJDA 3IBTA 1X19A 5K1ZA 3ZK7A 2M3DA 5I4MA 5AK5A 2H5EA 2O8NA 4N01A 4DHVA 2I6QA 1NHKL 1YQUA 1TKAA 1QE1A 1Z2CA 1UEXC 2FRVA 1DEOA 1P8AA 1EVZA 2Y8WA 4ZYTA 2DEIA 2FZGA 4YRFA 3AF6A 3DBHA 3OTWA 4J9LA 1V3SA 3L8GA 3O9MA 3LPYA 2O06A 4DNFA 2NXCA 4RABA 3HKDB 3JS5A 5FOUA 2ZJ0A 2BFEA 2WJIA 3DYAB 4UM8B 5AJWA 1JQDA 5C24A 4KQZA 4MR8B 5K3EA 1H4TA 3L6OO 1FMTA 1OWXA 4N7RA 5GAGI 1ENZA 4FZRA 1G20A 4WL0A 1TL5A 5IXYA 3K5PA 2Y0CA 4LBPA 2N9UA 2VC2B 4D4HA 2V65A 3NHJA 4TXJA 5IYZF 2D2VA 4PNPA 3G1TA 2O2GA 5G4LA 1JJ2R 3U5ZB 1BD3A 4B3GA 1Z56C 2Y1XA 3IO3A 2QJWA 1E20A 4GKJF 1I80A 4AMGA 5E6SB 1RLUA 2RKWA 3B36A 4OXIA 4B3CA 4OKSA 3JQAA 3T5MA 2NT3A 4ZMSA 2I1LA 1YRLA 1RYFA 4NMHA 3PDIA 4RV4A 3AR3A 1RRGA 3UKDA 3GPLA 1R2QA 1PR9A 3TZ6A 3SCZA 3SHQA 4OD0A 3ZWPA 4ZLPA 1RYEA 5T7LA 1YULA 3RTEA 3ZNOA 3QVUA 3GK3A 2G77B 1RK8A 5EESA 3VAFA 1VBXA 3B51X 4NRDA 5E7OB 4JYBA 4QWWA 5F5NA 2XC9A 3A9WA 3RS0A 4BKPA 2R7TA 1H4VB 1RT9A 4C78A 1ZO8A 4G1PA 4JWTA 1DDIA 3I5CA 3OWOA 2B99A 3DMRA 1VIDA 3TJ9A 4UPVA 2WCXA 1Y9EA 2ZRGA 1Q0ZA 1Y1SA 2IDLA 3LWBA 4Y2SA 1T11A 3TEFA 3WRYC 2WOOA 1B1AA 3WA6A 3NDRA 1V3UA 2DR3A 4OXXA 3I9ZA 3MWDB 2R7QA 2HM7A 3AVVA 5JJBA 2XULA 1NRIA 1OX4A 1XRPA 5IX8A 4KKOA 2BBEA 1HQUA 1N36J 3ELHA 4RE5A 4ZVTB 2VWHA 3U4MA 2WA2A 2YQ1A 5EINA 1FYDA 1KOHA 5HBMA 1J09A 4DTCA 5FKJA 3LLCA 3C6QA 1NK8A 3L0CA 4XOIA 3G2XA 4X66B 1KSGA 1PTKA 3QA9A 4DR7F 1RAJA 2XKJE 2ZG6A 3ESRA 3AIIA 2GVZA 3TOSA 3JQDA 1UMBA 4FEEA 2L0XA 2NQTA 5CB4B 1U0TA 3WK7A 4DV6B 1JQ3A 4AJKA 3PEWA 5EEGA 1Z5VA 4KAXA 1A2OA 3OE4A 3HUEA 4JJ7A 4X7MA 4FXWA 2P2YA 2W4PA 3H17A 3I9OA 4CI9A 2HDHA 4FWTA 3PQFA 2OO7A 2IXGA 3DVSX 4ZVOA 4M88A 3GJ4A 1E7RA 2ODQA 2PTHA 2Z8YA 1GQEA 2CE2X 5FAXA 4CKCA 5FOVA 4JB8A 1Y00A 4RQAA 2Z2KA 4L0QA 3S99A 3L79A 3VC3A 1RAHB 4YP7A 1BVHA 4JKOA 1DIBA 3PEVA 4YK7A 2R7NA 4N8OA 4KGMA 3G2IA 3WHPA 1QWSA 2POCA 1C0KA 5DS7A 5IEJA 1H2XA 3JD2A 1Z15A 1Q19A 4R8VA 2A1UB 1M2VA 2BZGA 4N1AA 3OIYA 4AKIA 1CR0A 3SDSA 4WZAE 3GD5A 1N78A 2V94A 4JJAA 1T9BA 2OGSA 1GILA 4AJPA 1M9NA 2CLOB 5EA2A 3GT7A 2NXNA 3CJ8A 1UP6A 2PZ8A 1CULA 1XCJA 2B3TA 1FO1A 2C2GA 4OJNA 2OP0A 5HQ3A 3MT9A 5F7JA 4IG0B 4H17A 1XNRF 4XQ9A 1AT1B 4R31A 3E9NA 5M2PA 4CIDA 4B3FX 1QORA 3KETA 1G64A 1AG9A 1PWEA 1Q0NA 2CPXA 3O1HB 4ZVTA 1MN7A 4HPJB 1TQ2A 1V5EA 1O97D 3HA7A 4IDOA 1YDWA 1MH1A 3UKOA 4HDRA 5MAOA 2O2YA 2GJAA 4F11A 2JA2A 3T1YB 1XRLA 1JIVA 2REXB 1CUGA 2B8QA 4USUA 5KWSA 1ZZFA 4B5KA 4LR7A 5IQ6A 1DJNA 1OB2A 5ENVA 3CUWA 1BS9A 1EKSA 4KVFA 2JLBA 1SJ4P 2XXBA 4PBSA 1NP7A 5C31A 4EG1A 1W9MA 3OXGA 3EIQA 3NOQA 4EGLA 3M9WA 1QU2A 4UMDA 3BBLA 2QUZA 2VTEA 4WAUA 1JDBB 3CRNA 2B0JA 5AW9A 2PXXA 2V7QD 4R3UC 2WW4A 5KYVA 3ZQ6A 4I5FA 1I51A 5AK3A 3G1WA 3EUEA 2WV9A 1O9GA 1NUAA 4BC9A 1Z2PX 4NBLA 1C9YA 2KZZA 2VA9A 1WDLA 1G8KA 4RJTA 2FR1A 1Q20A 5A9RA 1QQAA 4TZ6A 4QOFA 1T4MA 2HQ1A 3VU1A 3ET5A 1B74A 1WWHA 2DR5A 4UBMA 5KOJA 3I9JA 3EPHA 3K8ZA 2DWOA 1ZU5A 5DG8A 2XUPA 3EPJA 4N0QA 2QROA 3AP2A 4N3BA 2RNEA 5HXAA 3R5JB 5H9VA 3KXPA 2D54A 4R9NA 1KJQA 3P0IA 1WZIA 2HGNA 5FYQA 1N7IA 4MRSA 1ODLA 1JLQB 3AD9C 3GU0A 4XPIB 4N9WA 3RSZA 1WW8A 2O01C 1OFGA 2YMLA 1OFVA 3B85A 1WXIA 2UAGA 4F2PA 1CT9A 1EHIA 3WK5A 1E2IA 1ACJA 3BO2A 3H2BA 4C98A 3CF5Q 2CKWA 4GEKA 4KPGA 2R85A 1NY6A 4WBNA 4FPXA 2WAYA 3IOYA 4DILA 1HZZC 1DBDA 4URWR 4IIBA 4B4OA 3EN0A 3N2ZB 3BAFA 4R0VA 5K8JB 3THYB 1JHUA 4LF7F 1QIHA 3R9XA 3GJ7A 3W8GA 3N7UA 1QAJA 2OBBA 1S1UA 4ZPXA 4BGVA 3EDRA 3G0DA 1UM9B 4Y6QA 4B8WA 2CDRA 1A6LA 4K4TA 3MCZA 4GP9A 2BGIA 5JD6A 1L1RA 1PK8A 3RNOA 5HHTA 1IK4A 2WSEC 1P0PA 1NSTA 1ZA2B 1P8GA 4EK2A 3VPDA 5DIFA 5D4PA 1P0CA 3G2KA 4R0JA 3L7MA 2XF2A 1U7LA 1JLFA 3D7SA 2W2KA 4OGFA 4EO8A 2R6JA 3U2QA 2TMKA 1IXZA 2OYCA 2EFGA 2DBRA 3HL4A 5CT4A 1X1AA 4YBRA 4IDPA 5ALTA 3N0WA 4RW7A 3LOUA 4PX5A 3TQHA 2VJDA 4RL6A 2G36A 3T99A 1SUWA 3K0CC 1P39A 3G0GA 2BMBA 4NSNA 1C0LA 5D7NA 2P6RA 2Y1GA 1HZJA 1UBJS 5JLJA 5HLFA 1YS9A 3IXLA 1CUIA 2D0OB 3BH7A 1VGRA 4HHEA 3ITHA 2XY7A 2FZEA 2AGOA 3T1HF 1C3XA 2QMHA 3KC2A 4EJ6A 1KYQA 5F3TA 2CB0A 2LQBA 1C4KA 1RT4A 4MFBB 3TFOA 1Z6PA 4NLUA 3TAPA 3KR1A 4WFZA 3LHSA 1RE1B 1DX6A 3DL0A 3UENA 2ST1A 4PG4A 1VB3A 3ZHRA 2XUOA 2QRQA 4QG7A 3PC8A 3FPCA 2W6MA 1WCV1 2O14A 3IHWA 4ILKA 4E94A 1NJSA 2GN4A 2F1OA 3IWXA 3MEDA 4RVGA 1YHYA 3UAYA 5BPHA 4RIHA 3C15A 1R0WA 4MWGA 5FTNA 1WMEA 2WABA 2F1KA 2NUBA 1TKCA 1QKKA 4LFCB 1K0FA 1SKWA 1AQYA 2ECFA 3Q3VA 4R54A 3VVMA 3QVGA 2J33A 3KLHA 2R8ZA 4NH4A 3H65A 1NK0A 4KIUA 3EDMA 4FYXA 2JGAA 1N34J 2EJBA 3ZXUB 1S49A 4KUGA 2BGLA 4LJ7A 1VA5A 4DR3B 4TUYA 2RBKA 4IILA 3VTFA 4HDHA 3MQFA 4C06A 1E6KA 1KERA 1R18A 2FZGB 2G04A 3BSOA 1PHPA 3BN3A 4GXQA 4WBNB 1JNRB 3BPSP 1GYRA 5EMJA 1RTJA 4GR9A 2NYAA 3VOTA 2I6WA 2IOHA 5DYNA 4GEGA 3U1BA 5DXJA 3USZA 3O95A 3N8NA 3GLJA 3FNQA 5CVJA 3EZGA 4WCVA 3KLOA 3FYCA 3ZOZA 1HMPA 3MUNA 2RFLA 2AG0A 3DKIA 1RWBA 1N32F 2HMIB 3ANNA 2EF0A 4X85A 2YWWA 5K8NA 2VRBA 4OQEA 1REQB 2FPUA 4X66F 1P75A 1DKNA 1JJBA 2PSZA 4TMYA 4IJWA 4IDQA 3ET6A 4JXJA 4LIWA 1OXUA 2ZCVA 3VTIA 1SZJG 3LGMA 3T5BA 1I7NA 2FW8A 2KWIA 3SZOA 3D2LA 4KR7A 3KUUA 4AWAA 5T67A 2J45A 1CULC 2NMVA 5KNDH 1B7YB 1MXHA 4PZCA 2ZWIA 3PUKA 4ICLA 1B26A 4OATA 4N5NA 1JDPA 5EVJA 4MX8A 4A27A 4R3NA 4RKEA 3VR6D 3IAS1 2C4KA 4I19A 5AOAA 1NWHA 2XCSB 2GLUA 2FSUA 4JP1A 4G01B 3HDQA 3CH7A 1YA4A 2WJVA 3ELWA 3IJRA 4FX2A 1ZJJA 3GHHA 1TX4B 2AVNA 1OB5A 2QUBA 5FF9A 3L8CA 5KG2A 2OPPA 3OXLA 1S12A 4W90B 4Q4JA 2CMGA 5IM5A 1BLUA 4RLHA 1I1OA 1CUFA 1AZSA 3OZFA 2VFSA 4MINA 4PAWA 3OUUA 3NC4A 3D68A 2UDPA 2CZQA 3PQ4A 3PXDA 5KFEA 5F7ZA 2NG1A 4MV1A 4O25A 2JF0A 1GZ3A 3EC2A 4BVFA 2XS2A 2CV1A 1D8ZA 3DOMA 4WXRA 4ITSA 2YIDA 2ZE6A 1OPIA 2FHPA 4ROTA 3SV4A 3AHDA 1UBGA 5F3DA 3GBSA 1NLKL 2C2EA 3DUFB 1NRXA 3C4QA 1HWUA 2P1RA 1JK9B 2CJXA 1W0JD 1S1WA 1E60A 2VSNA 4BCDA 5TS3A 2QJFA 3DHXA 3ZX4A 3NJ4A 3ZWCA 1W8DA 3C3CA 1IBSA 3HN7A 2I4NA 4Q6WA 1OSNA 1NBOA 3OPMA 1GU1A 2KM1A 4LOHA 2R8HA 3Q11A 1E5QA 3DTNA 5KAKA 5FWYA 2F2TA 2TMGA 4EHDA 4E7PA 3H4DA 1MGPA 3OJ0A 2FF7A 5IJXA 2G0CA 2ZKIA 4BN0A 4NENA 1HTWA 4H31A 1WXDA 3W34A 4B3SJ 3FVYA 5FTLA 2HWXA 3OZDA 2F40A 3E5RA 4PYIA 3TSZA 4M95A 1OZHA 4C01A 5D84A 1SVDA 1U3DA 2H1LA 3LKBA 2EBEA 4RK0A 5F3WB 2JLUA 1YUMA 4HADA 3CW9A 1A8HA 2ZPTX 5B57C 4NA3A 1BX1A 3K3PA 4CQMB 3GX1A 1TUEA 4DEXA 1BW9B 2ZVSA 4ZVUB 4HTFA 5DWDA 4A8JC 3GEHA 1T5IA 1P1LA 5C42A 4Z51A 4GBED 2IDEA 1YTUA 4F3CA 4CEHA 3GHYA 2V7GA 1ZQ9A 1VSBA 1NX9A 2CFRA 1J1IA 2MKJA 3I2JA 1DV2A 2ALYB 2WJPA 2O8CB 2YXPX 1ZVVA 5KDDA 4P75A 3IQHX 4ZARA 4CGZA 3CZRA 4DT1A 1U1IA 4DZRA 2I80A 2Y0PA 2F1FA 3G2LA 2WWWA 3RTCA 2R47A 3RS2A 4Q5VA 5IAEA 2OEJA 3NY0A 1NAIA 1ZSVA 3M89A 1K6IA 4AIIA 3MTQA 3AERA 2PRKA 1KTQA 4BGUA 2HKIA 2AZTA 2ZI7A 3FSJX 1DTWB 5IAOA 5B7PA 1H2RS 4LDQA 2GPSA 3GJRB 4EPVA 5BSRA 1DC3A 2ETXA 1ZBQA 3RW6A 1I3OB 4BHTA 1TJYA 2DSNA 1XYVA 3EE6A 3MEEA 4DR5J 3MAQA 4PONA 1QSLA 4EHBA 1RT7A 2B78A 5J4YA 3L2OB 1IR2A 3UMVA 3IPCA 3UJBA 1DPGA 5JFOA 1P6XA 3H98A 1XZIA 3GVCA 1A77A 4FLEA 1KP6A 1D2GA 1FU4A 1JDZA 4FMBB 1AUVA 4OIFA 4LCBA 1OQ6A 4MV9A 2F5GA 3O91A 4ED4A 4COOA 5I3UB 2I6UA 2JDJA 3WBJA 1QGED 1DDGA 1J5EJ 2HEKA 4L6V3 3E3LA 5IAJA 3DOUA 1YJVA 1N9GA 4EUVA 1UVJA 1I3LA 4NLPA 2IVZA 1K7EB 1UPTA 3LZ6A 3U3MA 4Y0AA 3VDQA 2M6LA 3O9VA 3TJRA 3ZEAA 1F2UB 3TO8A 3ABRB 4PWUA 1HNWF 4LBWA 4RHEA 1BCRA 1QCCA 1S4MA 2WTEA 1FDBA 4F4FA 1NUPA 2AZDA 2CJWB 2I7XA 2ZU0C 4P9NA 3C1UA 3LUFA 1X1TA 2CLKB 2XMCA 2X8JB 1W0KD 3SZLA 4XDGA 4HRXA 1NG9A 2E5LB 3V33A 4EI8A 3KJHA 2F8MA 3OUZA 3GMTA 1S2OA 2DR0A 4MRNA 4RPLA 4R81A 5JCPA 4Q0MA 1K7XB 3NGSA 2XRZA 3EFBA 3OV7A 2G25A 4QWBA 4ZJZA 3R5GA 2R3SA 2OFHX 4A9AA 3TNVA 3NTVA 4IDFA 2C2ZB 4EM6A 1DBQA 1NH7A 4PFQA 3JQ8B 3EGDA 5KJ1A 5A9SB 1CV2A 2RAVA 5J5AA 3JQJA 3G23A 3AG6A 1Z73A 4YLYA 2VFTA 3KQYA 4GH5A 3HXTA 1HNXF 4ALNA 4Q3BA 4EGAA 1W25A 2WJHA