3TVKA

Diguanylate cyclase domain of dgcz
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
AIRSNMDVLTGLPGRRVLDESFDHQLRNAEPLNLYLMLLDIDRFKLVNDTYGHLIGDVVLRTLATYLASWTRDYETVYRYGGEEFIIIVKAANDEEACRAGVRICQLVDNHAITHSEGHINITVTAGVSRAFPEEPLDVVIGRADRAMYEGKQTGRNRCMFIDEQNVINRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diguanylate cyclase DgcZ
publication title Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli
total genus 52
structure length 172
sequence length 172
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tvkA00
1HPZB 1SH2A 2GIQA 3DLGB 4EO8A 4KO0B 1IKWB 5K14A 5DQIA 3JYTA 5DLFA 3LP0B 5DG7A 5F8MA 3EPGA 1LW2B 1TP7A 3IGVA 4B3OA 1RT3B 5C24A 3TVKA 1RT6B 3M8PB 1QUVA 4KSEB 4NCGB 4K4VA 3QLHA 4ED2A 3PW2A 4YMEA 4H4MA 2FJXA 3BSOA 2ZD1B 4DEZA 4J9LA 3M9NB 3KHRA 3DRSB 3G6VA 4ZHRB 2HAIA 5KFWA 4J9PA 4K4YA 5J2MA 4Q0BB 4K4SA 3ITHA 3OL7A 1S0MA 2R8JA 4KB7A 4ED6A 4O3SA 1HNVA 1S1XB 2RDIA 3DRRA 3GV5B 2QE5A 3RBDA 4IQXA 3PHEA 1JLQB 4IOBA 4OL8A 1RT5B 1TKZB 2YNGB 2DPJA 5HROA 4HKQA 2ZE2B 2D3ZA 5KFRA 4WZQA 1C1CA 2WRMA 1C0UA 3PVXA 1JLFB 1MU2A 1J5OB 4X2BA 4MK7A 5KFJA 4XPCA 1S6PA 4G3IA 2HNDB 1K1QA 3MEEB 4ZPBA 2BR0A 2I5JA 1FKPB 1RTIB 2HNZB 4IFVB 4ECSA 4IFYA 1S6QA 1S9GB 5KT6A 3Q8RB 1FKOB 2FLPA 3SFUA 4LSLB 4O4GB 4LQ3A 1HYSB 4KHMA 5EUHA 4O3RA 4U7CA 3LANA 4IRKA 2BRKA 2VG6A 3KJVB 1GX6A 3PW7A 3CDUA 3PJWA 4NLPA 4RW7B 1EP4A 1TV6A 2IA6A 4ICLB 1BQNB 1XR6A 2B6AA 4MIAA 4Y3CA 2ASDA 5I42B 1REVB 2WK4A 1QE1A 1S1VB 4M95A 3FQKA 1S9EA 5DQGA 3I0RA 4Q8EA 5KG4A 4LSNB 3LP1A 4O44A 3UQSA 4ECWA 3V6DB 3HVTA 2YNIB 3D5MA 4QW8A 4RNOA 3RB6A 2E9RX 4NRTA 3BR9A 4KE5A 5CYQB 1HQUA 4Y2CA 4RNMA 5KFFA 1S1TB 3SFGA 3HKWA 2XGPA 1RTJB 2WB4A 2WOMA 4DL6A 4NYZA 1TL1A 5HBMA 4ZMMA 2QV6A 3CO9A 3G6YA 5L1LA 3V81A 5C42A 1JKHB 1JLAB 3HHKA 3LAMA 4MK9A 4NLSA 3BSAA 5CYMB 4YP3A 2YNHB 4EBEA 3M8QA 4G1QB 2E9ZA 3GV8B 1TKTA 2FJVA 2B5JB 4RW6B 4F4WA 3OSPA 1HMVA 2FVRA 3DLGA 4KO0A 2BQUA 1KHWA 4ZVGA 5DGBA 3I5BA 3LP0A 1LW2A 4NLRA 2GIRA 3RBEA 4JV0A 3DI6B 4NLXA 3NBPB 3G6XA 4TXSA 1SV5B 4WE1A 2W8LA 2RDJA 4GC6A 3M8PA 4RW4B 2VG5A 3DLKA 3QZ8A 1DLOB 1GX5A 1XR7A 2YKNB 3CJ2A 5F9LA 4HYKA 5KG5A 4ID5B 2ZD1A 4RW9A 1LWEB 3DRSA 4ZHRA 4R5PB 4EEYA 4WYWA 2C28A 3UDLA 4JV2A 5KFOA 5HP1B 4ECTA 1TL3B 2W9CB 4RNHA 3NAHA 4RW8A 3H98A 3DYAA 1RT4A 4NLOA 4O3PA 5HLFB 1JLBB 1TKZA 4J9QA 2HMIB 4JV1A 2IM3A 4URQU 1JLFA 3KLVA 4URSA 4K4UA 3QIPB 3DLEB 4KBIA 4ECUA 3RB4A 3MEEA 4K50A 1S49A 5KFCA 1IKVB 1FKPA 1RTIA 2HNZA 3IGNA 3MEDA 4O3OA 2D7SA 3CJ0A 1SUQB 1S9GA 1UWBB 4XO0A 1FKOA 1HYSA 3KLGB 4LSLA 1U09A 4O4GA 4QWAA 5F8HA 2FLNA 3VQSA 1LWFA 2WCXA 1N5YB 2UVRA 3MTKA 3QYYA 3KJVA 4ZP6A 3BQ0A 1C0TB 4IG0A 4RW7A 2C22A 1R0AB 2O5DA 1BQNA 2BE2A 4ICLA 4ZPCA 3TAMB 5KFPA 5I42A 1S1UB 1LW0B 5FDLA 2FVCA 3FDSA 1C1BB 3V6DA 2RKIA 1WNEA 1KHVA 5KFZA 2XC9A 2B43A 4ZVEA 1RTHA 5F8NA 2XCPA 3PW0A 2IMWP 5CYQA 3T19A 2JEGA 3MR2A 4PQUB 5KG0A 4KFBB 1RA6A 2WONA 3ISNC 2F8EX 3LP2B 3GIKA 2VG7A 4TYAA 5EWFA 4WZMA 4IR9A 3IN5A 3BSCA 3KK1B 1JLAA 3DM2A 4J9MA 1N48A 4IG3A 3ICLA 4KV8B 1JLCB 4RU9A 3KLEB 2JEJA 3NMAA 4IH6A 3KLFA 5KFXA 4RW6A 2R2SA 4IR1A 4WFYA 2AX1A 2HWHA 5C25B 3KLHA 3KK2B 1EETB 5KFQA 1IKYB 4MH8A 2OPRB 5KFYA 4Q44A 2ILZA 3NBPA 3KMSA 4FBTA 2XI3A 5JXSA 3QGGA 4RW4A 1LWCA 4TLRA 2V4RA 1DLOA 2YKNA 4I2PB 3V6KA 2BQRA 4FBUA 2W9BB 4ID5A 1RTDB 3G86A 1HNIB 3BGRB 5F8LA 5KG2A 1JIHA 2W8KA 5EDWA 2AGPA 4H54A 5HP1A 4ECYA 2W9CA 4DL3A 1S1WB 2RF2A 5J2PB 3PR5B 5KFAA 2R8HA 1VRUA 4DL2A 3BREA 2AWZA 2OPQB 1T94A 4IKAA 4MFBA 3C6UB 4H4OB 3JSMB 1DTTB 4EYHB 1K1SA 1N56A 1BQMB 2BANB 2JC0A 2HWIA 1JLEA 2R2UA 3FFIB 4ED7A 1VRTA 3GYNA 1JX4A 4IDKB 2R8GA 2YKMB 3DLEA 3MEGA 4I2QB 4WFZA 3DOLB 2AGOA 2CJQA 2IJFA 5J1EB 3KNAA 2ASLA 3FSIA 2IAJB 3RAXA 4KKOB 2D3UA 3QGIA 3KK3B 4ECXA 3GILA 5F8JA 2W9AA 1UWBA 2R2RA 4Q43A 1CSJA 2ALZA 3KLGA 4DG1B 5KT5A 3IS9B 3GV7B 3MR3A 1RT2B 1N6QB 5J2QA 4I7FA 4IH7A 3OSNA 4LQ9A 4F4YA 5KT3A 5KT7A 3T5JA 4R0EA 2AQ4A 4RNFA 3V4IB 3E01A 3DMJB 4J9SA 1D1UA 1R0AA 3NAIA 3QO9B 3TAMA 3CJ4A 2IBKA 1TKXB 1S1UA 1LW0A 2YNFA 4YQWA 4MK8A 1C1BA 1RDRA 4QWCA 4NLVA 4IRDA 4J9NA 4NLUA 4RNNA 1HPZA 1IKWA 4XPEA 5DGAA 2AU0A 4EO6A 1IKXB 5KFKA 4ZVFA 1FK9B 1RT3A 3N6LA 5C24B 2UVWA 3PZPA 1KLMB 1RT6A 4NCGA 3H59A 4KFBA 3H2LA 2CKWA 2BRLA 3QLHB 4WYLA 3QIDA 3RB0A 3QZ7A 3BQ1A 5J2NB 4J9OA 1RA7A 5KFIA 5J2MB 4Q0BA 3PR4A 4WFXA 5I3UB 3KLEA 4M94A 1S1XA 3T5LA 1HNVB 1T03B 1IM4A 3C6TB 3M9OB 4U6PA 2BQ3A 2GC8A 4Q8FA 5KFHA 1EETA 1JLQA 3HVWA 5L1JA 4F50A 2FJWA 1IKYA 1RT5A 2OPRA 2YNGA 3NGDA 2ZE2A 2OPPB 4URGA 4O4RA 2FVPA 2HNYB 1S0NA 3PW5A 1J5OA 2ZKUA 2HNDA 4MIBA 1RTDA 3BGRA 2I5JB 4IFVA 5KFGA 3I5CA 3T5HA 2C2DA 3Q8PB 4PWDA 1JLGB 1S6QB 2WTFA 5KFDA 2C2EA 1RYRA 1S1WA 4TY9A 1RYSA 2FVQA 3HVAA 3I5AA 1XR5A 4ZVHA 4FS2A 2OPQA 1W25A 3JSMA 4ECZA 3C6UA 4H4OA 4TY8B 1DTTA 3DRPB 3UPFA 4ECQA 1EP4B 3DDKA 1BQMA 2JLEA 3N6MA 4EBDA 2BANA 1REVA 2IC3B 4J9RA 1S1VA 3FRZA 4ED1A 3H4DA 3GIMA 1S9EB 5J1EA 1NNDA 3MF5A 2XGQA 3H40A 4LSNA 3TQ1A 3RAQA 2J6TA 2IAJA 3LP1B 4NLTA 4KKOA 3OLAA 5D3GB 3HVTB 2YNIA 3H5XA 4QWBA 3OL6A 5KFUA 4ZP9A 1RT1B 2IM0A 3MR5A 1DTQB 1S1TA 3V4IA 4QWEA 1RTJA 3IRXB 2E9TA 1D0EA 1QAJA 4ZP8A 2XI2A 3PJXA 1TL1B 3IG1B 5KFLA 5HBMB 5EWEA 3QGHA 4YR0A 3DOKB 4ECRA 1JKHA 1TKXA 5C42B 5CYMA 4YR3A 1OS5A 2YNHA 4G1QA 3KLIB 3H5YA 3D28A 1RT7B 3ISND 1ZTTA 2B5JA 4NZ0A 2AX0A 2XWYA 1HMVB 3NL0A 2DPIA 2FLLA 3EPIA 1IKXA 1TQLA 4KAIA 3MECB 1FK9A 3DI6A 1SV5A 4ECVA 4WE1B 1KLMA 2UVUA 4F4ZA 3V6JA 1N4LA 2OPSB 2VG5B 3DLKB 5KT4A 5L1KA 2V9WA 1S48A 1S97A 3T1AA 1LWEA 4RW9B 4R5PA 5J2NA 5KFTA 1T05B 2ASJA 5I3UA 3KOAA 3UR0A 2ATLA 1TL3A 4Y2AA 1T03A 4F4XA 3C6TA 2WHOA 1S9FA 1ZETA 4RW8B 1TVRB 3LALA 4QPXA 3DYAB 3OL9A 1RT4B 5JUMA 4MKAA 5HLFA 1JLBA 4DL4A 3I0SB 1S0OA 3CWJA 2OPPA 2AGQA 2HMIA 1S4FA 1YVFA 2HNYA 5F9NA 3OHAA 5DG8A 3QIPA 4K4ZA 1JXLA 4IH5A 5KFMA 4EYIB 5KFVA 1T3NA 4FS1A 1IKVA 3OL8A 2VA2A 2EC0A 2UUTA 1SH3A 2W7PA 1C2PA 3MEDB 2I1RA 1SUQA 4NLDA 3Q8SB 3RB3A 1JLGA 3Q8QB 1S10A 1QAIA 4RUCA 3CDEA 1N5YA 1HQEB 2JC1A 1LWFB 4ZPDA 3M9MB 2W7OA 1HARA 1C0TA 4NLGA 4TY8A 4IG0B 2R8KA 3DRPA 3CIZA 2IM1A 3KHHA 3SI8A 4PUOB 2BE2B 4NLYA 5DG9A 3H5SA 2IC3A 1I6JA 1RAJA 2IJNA 4R8UB 5FDLB 1ZTWA 4ED8A 3OLBA 2RKIB 4TQRA 2VA3A 5D3GA 4RZRA 5K14B 1NHUA 5C5JA 5F8IA 3JYTB 4K4WA 4DL7A 2J6UA 4NLWA 1RTHB 1RT1A 4TYBA 4B3OB 3H4BA 2V0NA 4MKBA 3PW4A 4PQUA 1DTQA 3IRXA 2J6SA 2WONB 3CJ3A 4K4TA 3LP2A 4NLQA 4H4MB 4RUAA 4PWDB 3IG1A 2VG7B 4O3QA 3DOKA 5KG1A 3KK1A 3ITHB 3DM2B 4KV8A 3GQCA 1JLCA 4IG3B 3KLIA 2ILYA 2UVVA 4YR2A 1RT7A 3DRRB 3FQLA 5KG6A 3KLFB 2D41A 5C25A 3GIIA 4TQSA 4TN2A 3KK2A 4QW9A 3KLHB 4ZP7A 3CDWA 3MECA 5KFNA 3OHBA 5DLGA 5HROB 1C1CB 2IM2A 1C0UB 1MU2B 5T14A 2OPSA 1LWCB 1S6PB 4I2PA 3KMQA 5KG7A 2W9BA 5KFBA 3BSNA 4O3NA 3LAKA 1HNIA 4J9KA 4QWDA 4JUZA 3KHGA 1Z4UA 5F8GA 3KHLA 4IFYB 1T05A 2JEIA 5L1IA 3BQ2A 4GC7A 3BJYA 5J2PA 5KFSA 3T5KA 2RF2B 4EBCA 1VRUB 1TVRA 2VG6B 1NHVA 4MFBB 3I0SA 5DQHA 1TV6B 4IRCA 4Y34A 2B6AB 4ED0A 3FFIA 1JLEB 4IDKA 1VRTB 5KFEA 2YKMA 1QE1B 4I2QA 3V6HA 3DOLA 3MEGB 4K4XA 3I0RB 2XCAA 4O44B 3H5UA 3KK3A 3N6NA 3GIJA 4DL5A 4WXWA 4DG1A 4KHRA 3IS9A 3MR6A 1N6QA 1RT2A 5KG3A 5KT2A 5J2QB 4I7FB 2UUWA 1HQEA 4Q45A 1HQUB 1MMLA 3CJ5A 3E01B 3DMJA 2WOMB 3MFIA 4NRUA 2V4QA 2R8IA 4ED3A 3MFHA 3QO9A 4PUOA 2R2TA 4ZPAA 3E51A 3V81B 5L9XA 3CVKA 3NKYA 4R8UA 2OH2A 2YNFB 5EWGA 2JEFA 1SH0A 3M8QB 2C2RA 1TKTB 4WXOA 2FVSA 3EZUA
chains in the Genus database with same CATH superfamily
1SH2A 5K14A 3HHEA 2G2OA 3PX6A 4K2JA 1YRUA 5I3PA 4LF1A 4DEZA 2UXCF 2HAIA 2CQ2A 4Q0BB 3JQKA 2ZOFA 4WJBA 2HVDA 3D0IE 4IOBA 4N47A 4OL8A 1C1CA 2FHOB 2D9PA 3UVJB 3HMJG 4ZPBA 2BR0A 3ET6B 3CD5A 3JSBA 1FKAF 5E2QA 1AXQA 1EP4A 2Y0BB 3QNWB 4DSJA 2QMXA 4JI1J 2F3JA 1VBZA 4B02A 4DQQA 1YLXA 1ZZNA 3L7OA 1SJ3P 4DU8A 4N76A 2PI4A 1PAEX 3VAFA 3IN5A 1JLAB 2Q6CA 1R8AA 2CRLA 3Q83A 4RW6B 1NSPA 1HMVA 4C48A 1LW2A 5K9FA 2GIRA 2GNKA 2DT9A 5L9NA 2NS1B 2XNQA 1SB6A 4A46A 3M6XA 3M2RB 4K7QA 2IA0A 2HS0A 4UZCA 2VOOA 4UQGA 1MSWD 2G2ZA 1HWKA 2MDAA 3A8EA 4KBIA 4WU2A 2O3DA 4NZ7A 1YQHA 2IHR1 4K5SA 2LDIA 4XO0A 2CA9A 3I56S 5E3AA 2WCXA 3QYYA 5A8RB 2V8GA 3C14A 3I31A 2KM8C 1AROP 4Y6IA 1WOOA 1LW0B 1WJ9A 2KI2A 3UDEA 3L9ZA 3OW2R 3EVMA 5CYQA 4QCLA 4QIVA 5B0CA 5KG0A 3R5AA 2DNKA 1JLCB 2JEJA 4ZN3A 2HWHA 3KK2B 2DEJA 4KHPJ 1IKYB 3T9NA 3TX0A 2OFGX 1O8BA 2ZBQA 1U8WA 1FDNA 3DN9A 3V6KA 3MPVA 2CQBA 5F8LA 5D0HA 4JI6J 1L3SA 1H0HB 4BC7A 3GIRA 4DL3A 5CD4H 2R8GA 1VRTA 2QRRA 2ZJRQ 2CJQA 4EU0A 2DCUB 3GV7B 1RQ0A 2Y1LB 4R0EA 3IWLA 1X4CA 4DX7A 4EMDA 4OYPA 3MUTP 3LO3A 1F0XA 1HPZA 3GFXA 4L72B 1PJ5A 2YWGA 2PSZA 3BQ1A 4UF4A 5U47A 5DO2A 4DR6F 3QATA 2HEKA 5L1JA 2KRRA 5A0YA 3OTDA 4RR5A 4LF9J 1D09B 1VBYA 1WKLA 2O01C 3H7HB 3Q8PB 2WTFA 4ED6A 2OPQA 4P71A 2NYIA 2BZ2A 1REVA 2IC3B 3TNVA 3FRZA 1GTHA 1OSDA 3OFEA 1NDCA 1IBKF 2XSFA 1ZPWX 3JQMA 3OTOF 3PJXA 4WBFA 2RS8A 3H5YA 2XULA 4HACB 3Q22A 3HPOA 1Q8IA 1N4LA 2V9WA 3KJQB 1HW9A 1VMBA 4F4XA 3D68A 2WHOA 1S9FA 2OTLS 3LALA 1RT4B 3CGIA 3I55S 2HMIA 1T9UA 1RHKB 1RBOB 5E3RA 3T6JA 4DR5J 3HCXA 3M6UA 2VA2A 3OL8A 2ZJPQ 3ENVA 3DLJA 4NEYA 1H6KX 2B0GA 4DV3F 3AJ2A 2FQQB 4DV6J 1SJRA 2HVZA 3A3NB 2FHMA 2LU2A 5D6GA 3PFEA 3DLHA 1KVJA 4P2MA 5CD4A 2ZC4A 1IBMF 2P5VA 4H4MB 2VG7B 1VFJA 3DRRB 3BM7A 3K58A 2Y8WA 2AEFA 3SYZA 2UV8A 1M5KC 1NSAA 1R43A 2JEIA 2YQ0A 1DURA 1KTQA 4Q5VA 2G13A 1VRUB 1SQEA 2NXUA 2HKEA 3LQVA 2DRAA 2IBOA 3AD7C 5H9EJ 3SSSA 1U1MA 2XO6A 3NKYA 2QZ8A 1TKTB 4WXOA 1OQ6A 2HK3A 3DLGB 4JI0J 3TANA 5ETPA 3J81Y 1XMOF 2CADA 5IT9Y 2ZD1B 3GPAA 1DRZA 4K4YA 4K4SA 2CG4A 1N34F 4DQRA 3IMQJ 4LF8F 4KGMA 3K89A 5HROA 2D3ZA 2NXNA 3HHLB 4N77A 3HVRA 2WSEC 2HNZB 2Z2YB 3RAMA 2FC9A 4OHXA 3A4TA 5E5NA 4NLPA 2KXNB 1NEEA 2UUAJ 4NL5A 1Y3KA 2XG8A 5JMNA 4M95A 4Q8EA 4QW8A 2HHUA 1HQUA 1X8DA 1S1TB 2XMKA 5H1SV 4NYZA 4PG4A 3UN5A 4DV7F 5CYMB 4DLEA 3GV8B 2FVRA 1I94F 1N32J 1TL7A 3G6XA 1RWNB 4NLXA 1SV5B 3QFWA 2YWWA 4RW4B 2CQ0A 3HO1A 4HYKA 2V8PA 2Z57B 4C8KA 2BOAA 5K8MA 4EEYA 3DDIA 5HP1B 4RNHA 2B9WA 4F7VA 1B7FA 4CLSA 1FJCA 1NK6A 4YHHF 2WVBA 3QIPB 2MZJA 1S7IA 4ERDA 3W3SA 2KU7A 4GKJF 2KFYA 1UVJA 4USIA 2RKIA 4WKRA 3FSYA 2XC9A 2E5HA 4QR1A 5E0OA 3ISNC 3LP2B 2DJWA 2Y1IA 2NUHA 2BW2A 2VIHA 2CIMA 4N5SA 2GAGC 2MB0B 5GMKa 1AFIA 1X4DA 4PG8A 3AQPA 5BYSA 1NRKA 4F3MA 3NWGA 3R5DA 1I5OB 4JI8J 3W9IA 3UCUP 4DL2A 1VQ9S 4USMA 3DGVA 4IDKB 2ASLA 4HH1A 2F7VA 2OHDA 2QN6B 2HK2A 4X4OA 2QYGA 3BKUA 3OSNA 4USWA 4J9SA 2ZOMA 4LF2A 1TKXB 5A2QY 5K5MA 1T95A 2GMJA 3HHDA 3V4MA 2ZVIA 1HBMB 1NJIT 3H59A 3ELHA 4WYLA 2DHAA 4MJKA 5I3UB 1J5EJ 2J9EA 2BQ3A 1RT5A 2YNGA 4A8QA 4DI6A 2EVZA 2WVFA 4LF7J 4IFVA 4DV2J 1ZA2B 1YHQS 2V67A 3VVUA 1A7GE 3R1LA 1JB0C 1MNEA 4B17A 2K1RA 4USTA 4JI4J 3PCOB 4ED1A 3H4DA 4RUHA 3MF5A 2BKNA 1ZPVA 3OLAA 1VRQC 3H0PA 1ELOA 2GMLA 3W65A 3HHNB 3BS9A 2VODA 3TP2A 2R7VA 4ZS6A 3RBXA 4F4KA 3Q8YA 5KT4A 4BHQA 1TAQA 4RW9B 4R5PA 1S57A 3KOAA 3W63A 5ADZA 1EB0A 5JUMA 5HLFA 1JLBA 1S4FA 5F9NA 3OHAA 1IBLJ 2UXBF 2CXEA 4C8ZA 1IKVA 2GHPA 1C2PA 3Q8QB 2OI2A 1C0TA 1YJRA 2R8KA 2BE2B 1YG0A 1MWYA 5HQMA 1YJTA 3G4SS 1NHUA 4K4WA 4WWSA 1KN6A 2J8AA 3PO4A 2VFVA 4O3QA 1AZSA 1A6LA 2YKPA 2M70A 3G8QA 1FXLA 2KYZA 2ACYA 4K2XA 5KFNA 5J1NA 5FD1A 3QJLA 1C0UB 1MU2B 1FNOA 4M8LA 1HNIA 2DHXA 2HQIA 4GC7A 2K3IA 2RJZA 3SQOP 2VG6B 4FZVA 4OHZA 1TUGB 3EGVA 1FRIA 5KFEA 2EWHA 2J0SD 4B9VA 3W2WA 4CO5A 3WIUA 1S4EA 2YQ1A 5EWGA 1FF2A 3M8QB 1VC0A 3NS5A 4E98A 4H4KA 5DLFA 4KO0B 5DG7A 3W61A 2VKZG 2LLZA 1PC4A 4DUZF 4ED2A 4OI4A 4FYXB 2B4VA 4ZHRB 5J2MA 4AFFA 1LFWA 1U8SA 3PHEA 1UJ4A 1U6ZA 1WHXA 1P9YA 4DN0A 2L3MA 4HT7A 4NXNJ 3P45B 4LSLB 4S0MA 2KDOA 3G2XA 1SKUB 3VF0B 4PEOA 1TV6A 2B6AA 5I42B 2JNJA 4NOHA 3I0RA 1NHKL 3T9ZA 8RUCA 1LWXA 4B08A 3GJRB 2HQGA 2WOMA 3MPDA 4RWWA 3C15A 3BBCA 2LEAA 2QJ3A 2QFIA 3RR7A 1MWQA 2X3GA 4DCOB 1RHJB 2RVJA 3FGVA 1KOOA 4F4AA 2W9CB 4RW8A 3AAWB 2W2MP 2KFZA 3D1QA 2QG9B 2UU9F 3DLEB 4IYQA 1S49A 2MLXA 1XC9A 4O4GA 2W24A 1J27A 3VQSA 4IG0A 4KR0B 3ZZPA 1TKDA 1RWOB 5KFZA 1R8BA 2FHJD 1M90T 3B4MA 5IC4B 2YXLA 1O5JA 2GGPB 1IM6A 4IG3A 3KLEB 3MM6B 1VBKA 3KLFA 5IQ6A 1BUXA 1TFWA 3IR6B 3KMSA 2Y8YA 2XI3A 3WC2A 4C8YA 3R5GA 2Q43A 4ID5A 1RTDB 1TR0A 4LR9A 4OMFG 3C6UB 3QAUA 4H4OB 1UEVA 4NASA 4DV1J 1B99A 1JLEA 1JX4A 2YKMB 4I2QB 2AGOA 4KKOB 1U4BA 2E5LF 2ZM6J 1Q16B 2Y1JA 1RAGB 2M88A 3E01A 1WD6A 3K7RA 3AXMA 3L4BC 2YNFA 3AJ1A 5LMUJ 3LPYA 2NSCA 1EQ0A 5LMNF 3PZPA 2R7OA 2OKQA 3K5MA 2BRLA 3TUIC 4PXEA 1RADB 4M94A 1CG2A 3C6TB 1NJYA 3AT1B 2CQIA 2FJWA 3PFOA 2OPRA 3IR5B 3HHLD 2FVPA 1JXVA 4QIWD 1SC1B 1URNA 2H65B 1L3VA 1HQ2A 1S1WA 1U6FA 5T7LA 3F41A 2QLXA 3SBMA 4AL6A 2CWXA 4NLTA 4QIFA 5D3GB 2YNIA 4DUYJ 5C2GA 5ETQA 3M2VA 3PTWA 3JS9A 4LRAA 2C3PA 2WSFC 1B0VA 4ECRA 1JKHA 4ENOA 4TVAB 3WQPA 4NZ0A 1RWMB 2U1AA 2MSSA 1WACA 1R89A 2ZWPA 1KONA 2W1BA 3BH6B 3CXCR 1S48A 1PYOB 1K47A 4FKYA 1P6TA 2Z58B 4DL4A 2BW7A 3RRGA 2OMOA 3A13A 1M1HA 3MM7B 4FS1A 2C3OA 2MZ1A 5JJBA 2CPEA 4USHA 3VGVA 2CQPA 4NLYA 1NB7A 1NSQA 1RAJA 2ZHBA 2IJNA 3NGTA 1FWKA 3JYTB 5F8IA 2IRUA 1BXNA 1RI7A 2LMIA 4PYDA 2WONB 4F0HA 1FD2A 4PWDB 3DOKA 1MROB 3ZZUA 1S5ZA 2M8DB 9ATCB 4W92B 3EDQB 3MM8A 4ILMA 2QA2A 1O0PA 5GADU 1XTZA 3MAAB 3WIVA 4YS2A 4BCAA 1XMQJ 4KY3A 2JOQA 3SDEA 3FFIA 4Z7CA 4WP3A 4KHRA 1W2IA 1LK5A 3R2CJ 3BEGB 2V4QA 4M63A 4PUOA 3E51A 5L9XA 2OSQA 3CMQA 1AUDA 3MM9B 3GB0A 4MIWA 3M8PB 1QUVA 4K4VA 2XYGB 4PG6A 3DRYA 4C6AA 3BSOA 2LQ8A 2E5IA 3U27A 3QAEA 1SL1A 1IJEB 1CJTA 3RBZA 4UOHA 4HKQA 4WZQA 5KFRA 1C4CA 2I5JA 2SXLA 4DPYA 1Q81T 3Q8RB 1EKRA 1TL4A 3G9CA 3BN7A 1XR6A 1RKJA 4J37A 1RU1A 3TVZA 4FF4A 3SQGA 4C3LA 3AD8C 4Y2CA 3PKYA 5KFFA 3BO3A 4X64J 1IR2A 1V5VA 2CDRB 2NQPA 1WHYA 2Z56B 3ZTRA 4ED4A 2BQUA 3I5BA 2RSQA 2HS3A 5HQ8A 1H98A 1NPPA 4G65A 2VG5A 3Q0AA 1XR7A 2VDIA 4X4QA 4KQZA 1Z2ZA 3CD7A 5L46A 2VBYA 4USUA 3HF5A 4B9SA 4ECUA 1PJ6A 3HSJA 4ZLLA 2WBMA 3AFGA 3W5YA 4DCPB 1ZM9A 3KJVA 3I96A 3EMTA 3TAMB 4CYUA 2DR9A 4LRFA 1IWAA 3RZAA 2ZNYA 2DXEA 2MQNA 3J7A1 4B3TF 2ZNZA 2AYBA 3AHPA 3W2VA 2VPYB 3PRDA 4CH1A 1GK8A 2W01A 4HR2A 1N36J 4KV8B 3ICLA 3NMAA 5M2RA 2VFRA 1NKEA 1NZAA 5FIIA 5C25B 3F73A 2X1GA 3QGGA 4KHPF 1YBTA 4F8RA 3SMZA 4ECYA 2IMOA 1HBOA 2RF2A 5KFAA 1J2VA 4MFBA 1T94A 3OBIA 2IRXA 1N56A 2IFXA 3MUMP 2LEBA 3DOLB 3W66A 5J1EB 2VJUA 4OZ1A 1LQ9A 4HTJA 4OI6A 3OR2B 5KT7A 2JX2A 4PZVA 1U7LA 5HMYA 3PKMA 5HVGA 3EZOA 3O5TB 1FDDA 3N4WA 4I69A 2HBQB 4AQYJ 2XBPA 2H4WB 3N6LA 4DS5A 2RQ4A 2E1PA 4DF8A 1QD1A 5J2NB 4OZ3A 3M2UA 1I51B 2RHQB 3SCJE 4P10A 3M9OB 3A8KA 2VPWB 4C8LA 1JLQA 1VI7A 5CA5A 2JFKA 2ZKUA 4MIBA 3I4HX 2QLBB 3SV3A 2LQBA 4LF9F 1K0VA 1HNWF 2LXIA 1E6VB 3D2WA 1RHQB 3H5XA 1RT1B 2IM0A 4B9MA 1QAJA 1M0SA 2G0CA 4RPFA 2AW0A 4KYZA 2XWYA 1VK3A 4OYOA 1MW7A 2E66A 1N5QA 2UXCJ 3K57A 4WE1B 4YOEA 1OY8A 3BH7B 3DGPB 1U02A 2DK2A 3PRVA 1ZAXA 2UP1A 1U48A 1YJ9S 5HMXA 2HFOA 3OQ2A 3Q8VA 3MEDB 3MMCA 4TNOA 2CPJA 1QAIA 2XMJA 4DR5F 3PYGA 1VC6A 4X4VA 3P6YC 1AA1B 3E3XA 1DAXA 2XY6A 5FDLB 2V94A 4DWIA 3HM9A 4NI2A 3QT5A 2NPFA 3H4BA 4DV6F 4PQUA 3NOGA 3B4DA 3PY8A 4UY85 4AXIA 2MMYA 4K4TA 1RHUB 4RUAA 3PEHA 4ZCMA 2QIFA 1SJQA 2HHXA 2J0QD 2GHWA 2HPUA 1R8CA 3JSRA 2HRYA 5EN1A 1CJVA 2ROGA 5C2CA 1WTFA 1SPBP 3KFWX 2P6SA 1B7YB 3CIMA 3D6TB 3W5ZA 2ZH8A 4M5IA 1U1KA 1H3DA 2FLOA 2FYXA 3BO4A 3OVAA 4GMKA 2V4JB 1FJ7A 3IS9A 2UUWA 4Q45A 1MMLA 4DR2F 3IC1A 3MFIA 1M1KT 4A8YA 1B0PA 1V6HA 1JMTA 1FTRA 3DFEA 1IJFB 4EO8A 1IKWB 2XHWA 3LP0B 3THPA 4B3OA 1DQ8A 4KSEB 4ER8A 4JI0F 1BMQB 3TW0A 4K0KF 4MYUA 4GO7X 1N52B 3Q86A 4CTAA 3M32B 2WRMA 1J5OB 5KFJA 1S6PA 2ZZMA 3MM5A 1S12A 3D66A 1APSA 1ZM2A 2FLPA 4LVNP 4DSIA 1BWVA 2P9CA 2CDQA 2Z30B 3H90A 4KIAA 3PJWA 3M1VB 2AIRB 1S1VB 3AH6A 2VL1A 3O2IA 3OJSA 3D5MA 2GQQA 2IVMA 3ZO7A 1WEXA 3SFGA 1SI9A 3CO9A 1SIZA 4MK9A 3HHKA 5B08A 1YJ7A 2J7KA 2G0JA 3EZ5A 5KAKA 3RBEA 1CBKA 4DX5A 4DR6J 1FE4A 2XQCA 2YKNB 1N32F 5ETVA 2BDPA 3BGFA 3TUJC 2FD2A 2QC3A 3HHLC 3N01A 2DB1A 2MY8A 1CULA 2WW4A 1TKZA 3FCWA 1JLFA 2QA4G 3MURP 4CDIA 1RTIA 4ZVQB 4O3OA 3KLGB 5BYQA 2IIHA 3BQ0A 1XWLA 3GJTB 3IP0A 5MAOA 5B0EA 2LXFA 2JDJA 1SC4B 2KT5A 2CJXB 1ZAWA 2B43A 2XCPA 2RHSB 1T8EA 2VBZA 4EFAC 4TYAA 3MCSA 3ZXWA 1IXKA 1I3OB 1UPPA 1HLWA 2VD3A 4DPUA 1NJZA 1PBAA 2BQRA 4FBUA 5AE3A 3B6BA 5KG2A 4ZN1A 4H54A 2JJ4D 2LP4A 1KOHA 2AWZA 4ZVUB 1OYDA 2BANB 3ZZZA 1M5PC 5IT4A 3US5A 3GYNA 4G1PA 1KTVA 1KD1T 4ECXA 3QGIA 3GILA 5CAAA 1CSJA 1S72S 3RG6A 2AQ4A 5G0RA 2LYVA 2NZCA 4M5DB 3CULA 1G1XA 2PT0A 3HSZA 3O1LA 3HULA 4BLGA 1Q78A 2DKOB 2E7VA 2HLUA 1TFYA 1KLMB 4Y00A 3MCMA 1R8PA 1HI0P 2LEPA 3QZ7A 2D1CA 4LJMA 4Q0BA 3T5LA 1T03B 4FF1A 4U6PA 2GC8A 2ZH6A 1J5EF 3HK2A 3IRWP 3ET6A 4ELUA 2IDLA 3TAQA 2C2DA 2ZBRA 5IOLA 1S6QB 2GFFA 1KQFB 5KFDA 4GVLA 3CNQP 2F65A 1FNXH 3VGTA 3JSMA 3UPFA 1BQMA 2JLEA 4JOUA 5E3PA 3BV8A 4JI4F 3LP1B 4LF6J 3HVTB 4W98A 4C8OA 4EUVA 1LNQA 2XNRA 5I3QA 1FWPA 3S7RA 3V4IA 3D67A 2LQJA 3SIPB 1PKUA 3QGHA 3CCLS 3D28A 1XMOJ 4M1KA 3FZ2A 2IVFB 4LMZA 1BHNA 1XNQF 4KGXB 1CQNA 1RAEB 2D9OA 3DC2A 3CCSS 3M2RA 1QVFR 2IVYA 4FVMA 3UR0A 2PI5A 1HBNB 2KL8A 2GVZB 1AYEA 3SSQA 2VFSA 1OY6A 4P74A 1UVNA 2GJFA 2EC0A 3RB3A 1IBLF 3T6BA 4D3GA 4NA3A 4X4PA 2JC1A 4D3HA 2YWFA 4F3OA 1U1OA 2LQ5A 4R8UB 3OLBA 4RZRA 5K14B 5C5JA 3PW4A 3PYEA 4AYBD 2ZH4A 2Z2LA 1JLCA 2WBRA 2J0WA 3SCIE 3UDCA 4TQSA 4CO1A 4U67Q 3KK2A 1WOSA 2GW8A 3CDWA 4OJ1A 1C1CB 4YY3J 4DR7F 4J9KA 4QWDA 4JUZA 3GMGA 5F8GA 2UUCJ 3BQ2A 3N5FA 2JL9A 2RH3A 4QZVB 4YHHJ 3I0SA 5DM7Q 2PMWA 2XMAA 1X4EA 3A3PB 3SCKE 2JLGA 2AYEA 4O0IA 2LECA 4NRUA 3J7ZT 4DS4A 5AXKA 2HGNA 5F8MA 1LW2B 4OLOA 4CZCA 4W4MA 1X60A 5BR8J 1FO1A 2XYPB 1RHRB 2K7JA 1RGVA 4IQXA 2KRBA 1R7IA 3D1HA 2RNEA 1Q5YA 1QAXA 1YBAA 4NXNF 3FEYB 3RRHA 4CLKA 2JFDA 3CDUA 4ZVTB 2OD6A 1QE1A 1OO0B 4MAKA 4C9DA 2PO4A 4OYBA 3BR9A 5CYQB 2ZDPA 2EPIA 1X5TA 3CEDA 3TA0A 4ZMMA 5K8OA 2POKA 2CQGA 2K2PA 4Y28C 2V34A 2B5JB 3OSPA 4HACA 2Y1RI 1VQ8S 1GMWD 2LDYA 2XSJB 5DETA 5KG5A 3DRSA 3BZQA 3EXCX 2GJ2A 2VQEF 1KDNA 1RT4A 1CVJA 7AT1B 4F3QA 5DS7A 4HDHA 3G96A 1MN7A 4QU6A 1BC6A 1UMJA 5F8HA 1U47A 1JNRB 1DY3A 2UVRA 4LRDA 3R6LB 2K7KA 3LGHA 4C3KA 5ITHA 3NNCA 1XN9A 1VQNS 1TMJA 1BQXA 2A1BA 1Y9OA 4ZVEA 5F8NA 2G1DA 2JEGA 2UXDJ 4DV5F 1RA6A 2H5IB 2MHNA 2DHGA 3R5CA 2VG7A 5EWFA 3VAJA 3I32A 1FJGF 4J9MA 2DBBA 3CJTA 3WC0A 1XJWB 1UVKA 3BPSP 3B82A 3OXFA 3NBPA 5A0YB 3TZWA 1SC6A 2MQLA 4K59A 4I2PB 1VGYA 3KG0A 5AE1A 3CJRA 1LXJA 2E1RA 3G86A 3OJUA 1VRUA 5A8WA 2OPQB 5L39A 4TU9A 2R2UA 4ED7A 2KYXA 1A0OB 4DBQA 3HKZD 4DV1F 4LFCJ 2CJYB 4WTYA 3THVA 4F4YA 3FEXB 5DM6Q 2R7QA 5LSOA 1X4BA 4QWCA 4OZLA 3QRRA 2CJKA 3CW2C 1E6YB 4LIWA 4KFBA 3HT3A 2FJAB 5LMUF 4ANEA 3W9HA 1HNVB 2KKHA 2N3OA 2ZHAA 4DQSA 3HVWA 5FLXU 3S8SA 3CB4A 2XMUA 1PGZA 4ZPVR 3KWMA 1AW0A 4LFBJ 1RYSA 2CZ9A 4PRFA 3I5AA 2DGWA 2O1PA 3N6MA 1RABB 2LXUA 1S9EB 1FTCA 2C1EB 5F3TA 3J7YI 2EKYA 2IAJA 2KTQA 3RR8A 5THWA 4N8OA 3EM1A 1S1TA 4ZLPA 4C0OC 1HI8A 4XAKA 1U24A 5CYMA 3THTA 3J81j 4KAIA 1FK9A 4NA2A 1SV5A 3MUVP 1UL3A 1FJEB 4CLUA 3UR3C 1BE4A 1AFJA 1U25A 1FRKA 3DYAB 3OL9A 4FDFA 3EE3A 2GO9A 3QIPA 5HSPA 4IH5A 2EG2A 2DNHA 1SC3B 1SJFA 2Z2MA 3FSXA 2YQ3A 2J0XA 4O0NA 2GO8A 4RO0A 3EGWB 5D4OA 4TQRA 3PNIA 4B9LA 3AOBA 1HR0J 2J6SA 2VPZB 1NLKL 3LP2A 1BLUA 4C8MA 1NUEA 1SKWA 3PM9A 4L3KA 5KG6A 3AA9A 1AUSL 2JLFA 5HROB 2HIQA 3KHGA 2YKOA 3O44A 3U7JA 3HFVA 1NJXA 2UU9J 2J8SA 2M52A 4OYWA 4IDKA 3V6HA 3MEGB 3TEHB 1L3TA 2ZH9A 4U7UD 2QA4S 3HI9A 5J2QB 4I7FB 1HQUB 3CJ5A 3BGUA 4IO9Q 1K44A 4Y2MA 1KFDA 2C2RA 1Q95G 2GA7A 2FVSA 2GIQA 1IBCB 3M6WA 2HGLA 2VU5A 2AJ0A 4KB7A 4G1IA 3HT0A 2MQOA 3MMBA 2R7RA 4XPCA 3MHYA 3IA0A 3OTEA 2BEFA 2X7IA 3BDEA 2R9LA 1X0FA 3NOCA 4TKTA 4JI5F 2W7AA 5ETNA 1NPRA 4MMOA 3IXQA 2ABYA 1RWPB 1CPZA 2COLA 5D4PA 4LSNB 2BJ9A 2AZ1A 4BWMA 4A47A 4I4BA 2B9XA 5KOWA 4DL6A 3BSAA 2YNHB 2MGZB 4X64F 3TA2A 3FC9A 2AJ2A 2XMTA 3QZ8A 5F9LA 1CJKA 4RW9A 4ECTA 1TL3B 4FPRA 1S6OA 3GFHA 2AV5A 2P6TA 4K50A 1HHSA 1FKPA 4U96A 1FKOA 1HYSA 2YKQA 3MCNA 4ELVA 2B56A 4AT1B 2EBEA 5HVHA 2O5DA 2BE2A 5B0BA 4FXDA 4MYTA 2NXJA 4OZ2A 2XWXA 1ZOTA 4QOTA 5A8KB 2DR6A 3F56A 1CQMA 1SL2A 2HG4A 3IBCB 4OHVA 1JNZB 2LCWA 4IR1A 3LGNA 2L9NA 5KFQA 2PGCA 2W9BB 3MCOA 4ZOSA 2VZ9A 3E8OA 2JZ5A 3IFEA 5J2PB 4EZ9A 3GG1A 2G1HA 2K1RB 2V2ZA 1YZ7A 1DJ0A 3UWTA 3HSDA 3FVYA 2VC0A 2D3UA 3KK3B 1EIYB 4Q43A 3NS7B 5KT5A 4KH0B 1N5VA 1RT2B 4OHWA 4RU2A 1IQZA 1ZS6A 1UA1A 3RRKA 3DMJB 2ZBPA 1C1BA 1GFWB 1H38A 4CRJA 3IWXA 3HD2A 1UTAA 2MEWA 3RGIA 1TK5A 4BC9A 1TZ0A 3PR4A 2DEIA 4A8WA 1R3NA 4Q8FA 1UVLA 2XZWA 2MJNA 3UW1A 5ETLA 4R25A 5AJ3F 1VIOA 3C2PA 1PIEA 1RYRA 1TAUA 2QGFB 3ZTSA 3DNCA 2E29A 3EWGA 3DDKA 2KJWA 4LR8A 4MT1A 3GIMA 2J6TA 2ZKTA 4ZP9A 2Z8QA 4ETZA 1NK0A 2V69A 2W4DA 5EWEA 1TL1B 3EVWA 2H51B 2VBXA 2XMWA 2AX0A 1QAYA 1VHIA 4CM2A 1GH8A 1FI4A 1H74A 2JVOA 5L38A 1Z1ZA 3DLKB 5IS2A 2ZH3A 4CO4A 1UA0A 4M5LA 4CNZA 2E7WA 4ZVRB 2HNYA 1C4AA 1QJHA 4B3SJ 4E0DA 5D0GA 1Q4RA 1HW8A 2MSTA 1LWFB 3NWRA 2D3O1 2HVHA 1U45A 2VKRA 1I6JA 1NM2A 1PJ7A 2B7CB 1P1LA 7FDRA 1KNZA 1Q1KA 3ONQA 4NZ6A 1JJCB 2MPUA 3IRXA 2DGSA 4NWBA 3IG1A 3D54A 2DGVA 2KXHA 2GGPA 2HRTA 1O51A 1DHMA 3MM6A 2ILYA 3GSIA 4PPZA 2CJ9A 2W4PA 2QSWA 4QW9A 3G8SA 3LTOA 2IM2A 3BKTA 1Q8KA 1LWCB 3IO1A 2CG8A 5KG7A 1IUJA 2ZUGA 2MZRA 3PRBA 1RJJA 4EBCA 3TR5A 2OELA 1MG7A 1TV6B 2B6AB 1S59A 2YKMA 3CCQS 4I2QA 2MYFA 3I0RB 4UTGA 1RAIB 1UJ6A 5RUBA 4GVBA 2GV1A 3D3BJ 5KT2A 2DGOA 4OZ0A 1SBRA 3J7YU 2V68A 2WOMB 2ZBIA 2R2TA 4B3TJ 1KBRA 1LV5A 1KQKA 3L7PA 1XBWA 2D69A 3FZBA 4XIUA 3NP5A 2OEJA 4AL7A 4YMEA 2FJXA 3FBEA 4J9PA 4N8NA 1S1XB 2RDIA 5CXTA 4CO3A 1OIAA 3IBFB 2M2BA 2X3DA 3ETOA 1Y4ZB 2ZE2B 2F9JA 2RRNA 3GSDA 1YJVA 4MK7A 4EGLA 3M7VA 3S6EA 2KT2A 2XZTB 2KH9A 1KR4A 3D6FB 3SFUA 4O4GB 3QWPA 5FLXY 3ENQA 4OJGA 3IR7B 1HA1A 2GMHA 5BJRA 4ANDA 4ZPTR 2IA6A 4OV6A 4F02A 5KG4A 3U02A 1WI6A 2VUGA 2F4VF 3K0JA 4MKVA 2MLYA 4RNMA 1FWLA 2DGTA 2CUYA 2HZCA 4TXSA 4GC6A 4W90B 4ID5B 4KPCA 1PBUA 5D0EA 2KHCA 3W8GA 4NCAA 3BYPA 1L3KA 1PAUB 1RXOB 5IC6B 4URQU 2CQHA 2DR7A 1U1PA 3MM7A 3L3CA 3IGNA 4DSLA 1YGYA 3UCZP 1S9GA 1LK7A 1HNWJ 1N5YB 1QVGR 2M9KA 3ZTPA 1WOPA 4L76A 4RW7A 5HN0A 1W26A 3GFYA 4DMZA 2FVCA 5IM0A 3V6DA 1WNEA 2NSBA 3CJKA 2FZGB 3D6HB 1OSCA 3OTCA 2IMWP 3W8PA 4FPIA 3OD2A 2WONA 2F8EX 3GIKA 2XS2A 4LF4J 4DZDA 3MDFA 3Q23A 4IH6A 1RE1B 5D0RA 2W2QP 2OPRB 1YWXA 1DLOA 4PKDB 3DOMB 1JIHA 3MAAA 2HIYA 6FD1A 1S1WB 2R8HA 5T7LB 2OFHX 2JC0A 2JSXA 2ZH7A 4WFZA 1DQAA 1F5AA 2R2RA 4ZIWA 2QTWA 3ISZA 1D1UA 1F9EB 2QLFB 1U1RA 1YIJS 3Q89A 4OI0A 8ATCB 2GIFA 1T02A 1HHQA 2JH3A 3MM9A 3CDAA 3Q24A 3GFZA 1TTHB 3TJ9A 2EEYA 1VQYA 3KKFA 3WX4A 3ILOA 4NMLA 4RLEA 4DV4F 3K59A 3CCZA 1U0HB 3B78A 3BGRA 1QSSA 1KKHA 5EGYA 1NU4A 1ZYQA 4J90A 2XS7A 1DZ5A 1M5HA 2YVSA 2OMLA 1Q5VA 4C98A 4DR2J 4XDDA 5BXIA 2HBZB 4LF6F 1MLAA 5AT1B 4M5GA 3LOUA 3DOKB 3G82A 4OX6A 2CAJA 3QSYB 2M3DA 1OS5A 3NCRA 3QSIA 1FE0A 5GMDA 4K0KJ 3MM8B 2QT7A 2UVUA 1ULRA 3T3FA 2LA4A 1GQEA 4G6VB 1K73T 1FNMA 2F1FA 3HDSA 1F60B 2C3UA 2GVDB 1S0OA 4L6V3 3CWJA 4UW2A 3KTQA 2BJ8A 2DGUA 1F6TA 3IAM9 1JLGA 2B3TB 5HMZA 2F8MA 2IM1A 4PUOB 4RJVA 2K8GA 4ED8A 3TQEA 4P2XA 3UO0A 4NYPA 2H48B 3UD3P 1PO6A 1RTHB 2RQKA 2D3OR 1OMSA 3CO0P 1FXDA 1WDDA 4KV8A 3BR8A 3FQLA 1YRXA 5C25A 1D9DA 4LF5J 3KLHB 1CJTB 2UUBJ 2BJ1A 3MECA 3WBZA 1F5BA 1SCJB 5IWAJ 5T14A 2BX6A 2CNKB 4GKKJ 2RRBA 2QFJA 4FKXA 4YY3F 4UT4A 2B51A 5KFSA 5D78A 2HFUA 1TVRA 2UUCF 4Y34A 1RACB 3HSGA 3DOLA 3M05A 2AZ3A 2XY5A 3GIJA 1DBDA 3MR6A 2HS4A 3P4UB 4ZLJA 1F3VA 3OR2A 2RS2A 3ENWA 4DQPA 5D77A 3I87A 4QPTA 2AEMA 3MD3A 5KOXA 3EPGA 1N54B 5A6WA 3HP6A 3M9NB 4CO2A 1VQ7S 2PFDA 1VC5A 3ITHA 1S0MA 3M30B 3DXBA 5BR8F 5HATA 1OQ3A 2XMVA 1SVDA 1WC0A 2DISA 3FK4A 4IFYA 4GRSA 5H9FJ 4KHMA 4O3RA 2EK1A 1KSPA 3KJVB 2Q79A 2ACMA 1WELA 4CYUB 1E6VA 2KG0A 4O44A 4LBPA 2C2NA 5DDPC 4BWJA 4NRTA 1TK8A 1WI8A 5M2PA 4OYMA 4WK1A 3RU0A 2OD4A 5DDQC 3VR1A 2A18A 5DDOC 4WE1A 4CP5A 4DFPA 3CMAS 3DGPA 3OFFA 2B7BB 2CNOB 4FYDA 2PN6A 5GADI 4Z37A 4L74A 2N3LA 1FESA 1VQ4S 5H9EK 3MEDA 3H25A 4DX8H 2YWEA 5HQLA 2NR0A 4IO1A 1WWHA 4RKUC 5GAEU 3MTKA 5CZXA 1WEZA 2YH0A 3W1YC 4FVCA 5FDLA 4DSEA 1XEZA 3GR0A 1H7WA 3ILIA 3F0NA 2Y3YA 1M1GA 1OPZA 2UXDF 4RU9A 4F2RA 1G3OA 3ZFVA 1XNQJ 1SJ4P 2VV5A 3HLUA 5KFYA 2OGUA 4FBTA 2AD9A 1S76D 3RW6A 4X62F 2W2NP 3ADAC 2MZSA 3P49B 4R0JA 2HRUA 4NA1A 4P9SA 1B3TA 4V1Ak 3T1HF 1R8HA 1LEOA 4J91A 4KH1B 2IRYA 3MMAB 1SL0A 3I9V9 1F2HA 2F63A 3TUZC 1UEUA 1L5UA 2ERRA 4LFCF 2KN4A 1R0AA 2HAFA 3GJQB 3QO9B 1YI2S 3F44A 4OIXA 1UVIA 1S1UA 2IYGA 4MK8A 3JB9k 4P73A 3NNAA 4HHJA 4NLUA 4HI2A 1IKWA 1RZMA 2V2KA 4AXJA 4UY8T 3ZZTA 3QIDA 4ILRA 2APOA 2ADBA 2BE7D 4DR7J 4PR6A 3JAMU 3UE2A 3M32A 1V9OA 3L09A 1J5OA 3BO2A 3T5HA 5KFGA 3CD0A 3I5CA 2K06A 1X9SA 3X3UA 2QL7B 4KGZB 1TMMA 3NMRA 5CHCB 4LFBF 1UW9A 1X7VA 1S1VA 2AMCB 3EJMA 2FJEB 2A6MA 2DH9A 1UCNA 2R7UA 2MJUA 4NI2B 1XERA 1UWAA 3TAPA 1UEKA 2PIIA 1WG4A 2KFNA 1FDAA 3MPYA 4QBUA 4RBVA 2F4FA 5HJXA 1QM9A 3VAIA 1UPMB 3T1AA 1KVIA 2FJDB 3QJPA 3MD1A 4Y2AA 3P96A 4FYWB 3TWZA 4X4NA 3C16B 2OPPA 2YPZA 5ETMA 1YVFA 1JQGA 4PXBA 3DU6A 3OT9A 2VASA 2UUTA 4NLDA 2BXJA 1UETA 2DD8S 1DQ9A 1CJUA 3NY0A 4Z7YA 5D15A 4JV5J 1PYTA 3O3LA 2VA3A 2NZ4A 3KXDA 4B3OB 2OP5A 4C11B 1DTQA 1QSLA 1OWXA 1HR0F 2KZZA 2LFVA 1GMUA 5LSRA 4CTAB 1N0UA 3UN2A 1RAOA 4HHHA 3L7UA 1DFDA 4HH0A 2OPSA 1S6PB 2ZC3A 1X31C 3MM5B 2VQEJ 1VS3A 1V3SA 2IDEA 1CS4A 5LM7E 2EBGA 4E8UA 3TI0A 3IBWA 4FP9A 1FRHA 4DDFA 3SV4A 4ZCIA 4CI0B 1KP6A 5HO4A 3MEKA 1HQEA 1UW4A 4M5DA 2R8IA 4PABA 4M5MA 2YX4A 4LRCA 1XK8A 5LJ3Y 4DV5J 2V8VA 2ZHOA 3K2YA 1FJGJ 2H5JB 1WKKA 4J9LA 3KHRA 1VHFA 2ZDOA 2QE5A 2GJIA 4U9RA 5B0FA 1CULB 1TKZB 3DCAA 1JLFB 3EGZA 3JTOA 1K1QA 4UUXA 1WF0A 1RTIB 3QFHA 2UV8G 1S6QA 1VQKS 3LANA 5DRKA 4FN5A 4M5HA 3O6QA 2ASDA 1YJWS 2WK4A 4B3MF 4Q2MA 4YB1P 3LP1A 3HVTA 3NEKA 3EYZA 2E9RX 3D0HE 4YDXA 5B7WA 3V81A 4B9NA 4G1QB 4F4WA 1G7CB 3WX8A 1KEKA 4JI7J 4HDGA 3DI6B 2RDJA 2E7XA 1PILA 4YN3B 1F3FA 1SJ1A 2RD5C 2GVZA 4O3PA 2A10A 3MEEA 4F2SA 1FHTA 2J76E 1SUQB 4PWWA 5A2QU 5EX0A 2RU9A 2DXDA 3OFHA 2EFVA 3CC2S 2C22A 4ICLA 3B8HA 1B4SA 2W2PP 1RHMB 3PIPQ 1R6YA 2J5AA 1MWZA 2PFFB 3KNGA 5L8RC 2ZJQQ 4B3RF 1ICEB 4J9UE 4UQTA 5JXSA 4TLRA 4DCJB 4DR1J 3MAQA 3PR5B 1NPKA 3JSMB 3C19A 3R8YA 1BQMB 2BACA 1EZZB 1Q82T 2HHHF 1RWVB 1IVZA 3MMJA 1X4GA 5J1PA 1UWBA 4DG1B 3MR3A 4IRKA 4JYAF 4LQ9A 2E5JA 4UOCA 4TLQA 3V4IB 2R7XA 3PV8A 1AT1B 1V3ZA 2MQMA 1HWIA 1YK9A 2IYIA 4ZDNA 3QT6A 1YITS 4RNNA 3AOCA 3R2DJ 4RBUA 1U2FA 2UVWA 2VHGA 1A9NB 3POTA 2EFNA 3ETMA 2V2QA 4KGVB 2CNLB 5LSLA 3ZZOA 2OTJS 4CLWA 4JB8B 5IV4A 4OFZA 1EETA 4F50A 1ZZFA 3PW5A 2EFOA 4X4RA 2YPYA 1P1TA 1XIQA 4DZ6A 1YRTA 2VFTA 2GS8A 4YFUA 1W25A 4ECZA 2EC2A 3J7Z5 2DR5A 2JWNA 3BGOP 4PG5A 3H40A 1GXLA 2R7SA 2ZITA 3K17A 4J5OA 3H8YA 1NMEB 4ZP8A 2XI2A 5KFLA 2R4FA 5HBMB 4NE9C 1BGXT 2HGMA 4RX6A 2B5JA 3M8SA 3HXMA 4PXCA 2XSJA 1MN9A 1S97A 3UDVA 3CCRS 1NDLA 4KTQA 2QLJB 3I0SB 1VQLS 2ZEJA 3PYFA 5DG8A 1YKWA 1U0SA 1NJWA 2Q1LA 2Y0SD 2I1RA 4JI5J 3CDEA 4B3SF 1XNRJ 3M9MB 2FZCB 2D74B 2GX8A 5JVGQ 3KHHA 3H5SA 5AXMA 3CC4S 2PDAA 4C0HA 3M8YA 4BDPA 1HWLA 3D1OA 2VH7A 2G2YA 4TYBA 2FZKB 2V0NA 3HJFA 1GMVA 4DR4F 4DU7A 2C2OB 3DM2B 2ALYB 3C46A 3GIIA 2QEXS 5LT5A 5DLGA 1GTEA 2ATCB 1VQ5S 4I2PA 3HZGA 5KFBA 3H20A 3VV2B 4EK2A 3A3OB 2LQ9A 3H2VE 2RILA 2LA6A 4WIQA 4Y65A 3MWBA 1QE1B 3D4JA 1QTNB 3N6NA 2HVIA 2HFNA 4OHYA 1EKSA 4DL5A 5SUHA 3W7BA 2CVIA 4L75A 4A8MP 2GAHC 4H4KC 1HNZJ 1YSJA 4QJVA 3MPUB 2O66A 2HHVA 1E6YA 2Z2ZA 4P72A 4RL1A 4NCGB 1VIXA 3JTNA 3DRSB 4LREA 1S0VA 3OL7A 2NXEA 1HNVA 4K8RA 2CQ1A 3ZNJ1 3GV5B 4WK3A 4QQBA 2DCLA 2CNNB 2V63A 5D4LA 1WG5A 4JP8A 2X1FA 3PVXA 3VGSA 2HFZA 4ECSA 1RLDA 5KT6A 1N33J 3JAMY 3DRXA 3OUYA 1N5TA 4FYYB 2WSCC 4PWUA 3C8YA 4MIAA 4OZJA 4Y3CA 1FEHA 1S9EA 3DHXA 5IFMA 1TUVA 1NKCA 2MTLA 3EGNA 4CIOA 2X1AA 1EARA 1EX8A 4RNOA 1D3WA 4NXMF 4OX9F 1H73A 3BYRA 4OI3A 1HD0A 1RTJB 3D9BA 2QV6A 1VQSA 3G6YA 1WF1A 5M2UA 1KHWA 5DGBA 3NBPB 4Q2LA 1UFWA 4PCQA 1HBUB 1REGX 6FDRA 4OZ5A 1LWEB 3IM9A 2A6OA 3NAHA 3H98A 3DYAA 5A8WB 4WP9A 3CF5Q 2EFQA 5AJ3J 3EICA 1NK8A 4URSA 2ZUAA 2ROEA 2XZDB 3UNGC 5CCLA 1U09A 9RUBA 2I38A 3TA1A 1FT8A 2VBWA 4USVA 2EI5A 1BQNA 3HJVA 4P2FA 1H2VZ 3LWLA 2MKHA 4I67A 4KFBB 2H3EB 3VAKA 4JI2J 1R31A 3BF4A 4WZMA 3BSCA 3KK1B 2J9CA 1HNXF 1KWMA 3LF0A 4ZLNA 3NLCA 4LF4F 1SIWB 1Q8BA 1YBUA 4NPOA 3Q2TC 1D9FA 5GAHU 4XDCA 4BS2A 2N7CA 4EYHB 4NMXA 3MEGA 5ETTA 2IJFA 4UUWA 4MTPA 3FSIA 2IAJB 1NDKA 2YTCA 4ANCA 4ATNA 5J2QA 4I7FA 5KT3A 2V50A 5GAGU 3L95X 3R97A 2CPDA 2IPOB 2CQ4A 1TUWA 2R7TA 1HL6A 3UCGA 1FK9B 3FEZA 5C24B 4DL0C 3H2LA 2CKWA 3QLHB 1LOUA 3VCDA 4LIRA 1Y10A 3NGRA 1RA7A 4PPDA 4N41A 1S0NA 3LH2S 3MTJA 2BYCA 2HQFA 2V8HA 2DRBA 4Y2KA 4CWBA 4ZVHA 1XR5A 4ECQA 1DTTA 1NAQA 2KVIA 3VQTA 4ZA1A 5SZTA 3DXSX 2DNZA 2YWKA 3OR1A 2XGQA 4LSNA 1VQPS 3G8TA 3IWNC 5B0GA 4DLGA 2I6WA 1L3UA 3MR5A 4CLTA 5C42B 2YNHA 2MGZA 3TUPA 4ZVSB 4CLPA 2V8DA 4I6WA 3NL0A 3EPIA 1IKXA 1T3OA 2BJ3A 3DDNA 3WDOA 3N5BA 3T1YJ 2CVEA 2WW8A 2ASJA 2AF6A 1TL3A 2YKAA 1NZ8A 1ZETA 4MKAA 4FF2A 2AGQA 2AP6A 1I1GA 3N0VA 5KFVA 1NB2A 3AQOA 4RWXA 3QBCA 5D8HB 1U1QA 2OSRA 1HARA 2CPHA 4TY8A 3DRPA 5DG9A 2F4VJ 1T0TV 1ZM4A 5HJYA 3PXGa 2YY3A 4I56A 1YDLA 4UOFA 1WHWA 1PSDA 5A8KA 4FNIA 1FERA 1KC8T 4OYXA 3KLIA 1RT7A 4KT0C 3QT8A 3MMBB 4TN2A 4X66J 4LF5F 2UUBF 2W9BA 2GZOA 3LAKA 1UFLA 2GHVC 1Z4UA 2DNLA 1T05A 5IWAF 3CT9A 5J2PA 4GKKF 3T5KA 4ZITA 1NHVA 1LFPA 1M5OC 2ZWOA 1H2TZ 2OO4A 4U7UK 3RTVA 4ED0A 3GLJA 4P6QA 1ZAVA 1IR0A 3H5UA 3KK3A 2FIUA 1RT2A 4WIIA 2A2DA 2F40A 4WTOB 3DMJA 2W2OP 2OLWA 3CVKA 2MQQA 3AJDA 3P8BB 1KFSA 2QYCA 3IGVA 4GO5X 1RT3B 3HFZB 1RT6B 3GG0A 1VQ6S 3PW2A 1CJKB 2E1MC 3TVYA 5LXYA 3G6VA 2RUSA 3A8JA 3PX0A 2DPJA 2HNDB 2KXFA 2JHEA 4J7CA 1FKPB 1FKOB 1HYSB 5EUHA 4U7CA 1X5SA 1RCXB 1GX6A 2VONA 3FBCA 4IOCQ 2VDHA 2YX7A 3M6VA 1F5CA 1TELA 3UQSA 4ECWA 2ZFHA 1VYAA 2ZH2A 2QL9B 1XQIA 3LA0A 4A8KA 2QLWA 3VZIA 2PA3A 1TL1A 5K20B 3LAMA 1WORA 2J9DA 4QIEA 1VQOS 4ID8A 4NLRA 4M5KA 3DLKA 1GX5A 1NSKL 2R3VA 4HI1A 2DNRA 4WYWA 4DV4J 3JTPA 2OEMA 3HX9A 1RUSA 3UVJA 4C8NA 3GCWP 4DX6A 3CJ0A 4QWAA 3FBFA 1SKSA 1LWFA 2A0FB 2AJ4A 2OEKA 2XS5A 5KFPA 1PYSB 4A8SA 2H9ZA 3M4XA 3V5RA 1C1BB 4NCBA 1RTZA 3GZ7A 4QR2A 3ZZRA 3N79A 1U49A 2E1AA 1ROFA 2CQ3A 3PW0A 3R7NB 3ZC4A 3T19A 2RE1A 3MR2A 5E33A 4U95A 4I1TA 4LUBA 1FX2A 1IR1A 1JLAA 2MKIA 3PDNA 1HKAA 4B9TA 4RW6A 2WVCA 4WFYA 2AX1A 3QPIA 2FY8A 1VLYA 5CABA 1LWCA 2V4RA 4KC5A 2W8KA 1T11A 4HT5A 3M8ZA 1Y11A 3NS6A 4WU3A 2AEJA 3S1TA 4DFKA 1V5IB 3VZHA 1X4HA 3RAXA 5F8JA 5A6PA 1N6QB 2BVZA 3OV7A 2OUGA 3BB5A 5A8RA 2CZ4A 5ETOA 3NAIA 2M8HA 1LW0A 3QMQA 5BYRA 4O23A 4X4TA 1YJUA 3GWCA 2AU0A 4ZVFA 2QMWA 4PXDA 4DSKA 1RISA 4F25A 2B4UA 4QR0A 3GCXP 2OIHA 4J9OA 3R7BB 3M8WA 1S1XA 5MLCV 2X1BA 2XLKA 1IKYA 2RQCA 2ZE2A 4TU7A 2HNYB 3D6MB 3FRYA 1FEEA 3DLBA 2VJVA 2B9YA 2DO4A 2C2EA 2FVQA 4FYVB 5IZHA 1EP4B 4ZJQA 4Y2IA 2PMZD 1NNDA 3PACA 3PO5A 5KFUA 1FCAA 1FFGB 1FRJA 3IRXB 2VF3A 3IG1B 4P75A 3ENAA 2ZH1A 4ZK7M 1HMVB 2DPIA 2HVEA 3OPKA 1CC8A 4DR3J 1K9MT 5AXLA 4F4ZA 1NK4A 1WC5A 3OVBA 4A48A 3VAGA 1WSRA 1T3NA 2V5HG 5IV3A 4OQJA 4GVBB 1M5VC 4ILLA 1LKZA 2W7PA 3Q8SB 1FX4A 3GE9A 4AD6A 1QTMA 3QT7A 1N5YA 4ZPDA 3C14B 4QYZJ 1NH7A 1W7WA 2IC3A 4ETXA 1ZTWA 1NK5A 4JV5F 1H72C 4NLQA 3S01A 6AT1B 3ZZYA 3LGMA 2NYHA 2ZVSA 3OHBA 5IT0A 2XHCA 5K8PA 3DOMA 4ZIVA 3KHLA 2RQMA 4OI2A 5L1IA 5K8NA 2QSFA 1VOMA 3TEGA 2RDDA 1VRTB 5AE2A 4EI2A 3BBFA 4X4UA 2XEXA 4J9VA 2YWHA 3MOJB 1HPZB 5DQIA 2KZMA 2DNOA 1D9AA 1QY7A 2ADCA 1KQSR 2VFUA 2FHJA 4H4MA 1URRA 2NUUG 3ULHA 3GP9A 2R8JA 3DRRA 5JVHQ 1ZA1B 3IM8A 2Y9HA 3A1YG 3BN4A 4X62J 2HLTA 4X2BA 1U0HA 2DIVA 4CLLA 1T9TA 1S9GB 2F9DA 4LQ3A 3R27A 3T1HJ 4WFAQ 2BRKA 1VBXA 4ITSA 4RW7B 1VR6A 1RBAA 1REVB 4YB7A 2KVQE 5IM0B 2EG1A 3V6DB 4X65F 2CPIA 3CJKB 4LSZB 4DV0F 2MQPA 1N88A 4KE5A 1G6BA 2VQFF 4LFAJ 5F3ZA 1Y5NB 2RT3A 3KG1A 5L1LA 3R7SB 2KG1A 1TKTA 3VAHA 4C3MA 2EFGA 3DLGA 3FCVA 2DNGA 5E7OB 3HZEA 4JV0A 3CCTA 4LR7A 1DLOB 3CJ2A 4JI7F 2QMUB 2ZD1A 2CQCA 2C2MB 2C28A 2C3YA 1FRXA 2GVDA 2BJEA 2HMIB 3KLVA 3N28A 4K4UA 1Q53A 3HHLA 2E44A 2HNZA 1CLFA 2ZBCA 2BMBA 2AT1B 1T7PA 2RRAA 3KDOA 1VJQA 3PHTA 3RUBL 3W9JA 2I2YA 1O6XA 2BA9A 1RTHA 2Z0GA 4X84A 2AJFE 1IQTA 1Z2LA 3U1MA 3C66A 1VISA 1B70B 1N48A 2L48A 2WZ1A 5HK4A 1TK0A 3R3TA 3KLHA 2FHKA 2QA1A 3K8WA 3U1LA 4RW4A 5F0WA 2XMMA 4F04B 2N7YA 3BGRB 5HP1A 5DZ6A 1U2CA 3SEOA 1UKUA 1SKRA 4QYZK 4DR1F 2ASYA 4C7QA 4IKAA 3K8VA 5E3QA 2AJ1A 1YX2A 2PE8A 4ES1A 3W64A 4OX7A 2M4MA 4F0KA 2DNYA 4JI1F 2ALZA 4IQMA 1S79A 2M5YA 2RIJA 5EHHA 4IUFA 1Y5IB 2IBKA 1RSCA 3G82B 4YQWA 1FRLA 3EVOA 4L73A 2Q6BA 1VDHA 2QL5B 2L08A 2Z4PA 5IXUA 3OTBA 3VTIA 3RB0A 2HYIB 5KFIA 3M30A 4HLBA 2PEBA 1EJ7L 2CPZA 2HZVA 2A3JA 1YTYA 2IJRA 1V3RA 3EUNA 1OYEA 1JLGB 3O8WA 1KS2A 2XLJA 2B4PA 5CCMA 1RAHB 3VVTA 1SQGA 3TQ1A 1NO8A 3MXHP 4DOZA 1HI1A 4XTTA 5HANA 1TKXA 2HSEB 1WC3A 1TL5A 1TQLA 4DPWA 4K5RA 3MECB 1HBMA 1TL7B 2HBRB 1NCLA 1NH8A 5I3UA 4A8FA 4F36A 1U1NA 3OXLA 2HW3A 1TVRB 4I6AA 4JI6F 4EWTA 2G0IA 4NX9A 1NBEB 3MI7X 1T9YA 2FTRA 1JXLA 2BKOA 3BGLA 1RB0A 1FVQA 2C42A 2W7OA 2Q3PA 4B3MJ 3T41A 1RAFB 1VLOA 2L9DA 1XNRF 1VJWA 4UOGA 3K5LA 4C4WA 2RKIB 3FCHA 3NCQA 1S7HA 4DL7A 1P27B 4NLWA 3PX4A 3LPEA 4I68A 3ITHB 1P8GA 4JI3J 1EHWA 5CZVA 3BSNA 4U8VA 2J9DE 4IFYB 2HZAA 4DPTA 2DNNA 2R7WA 1U1LA 3RYLA 3CCES 2B8PA 4CT8A 2DXFA 3UNYA 4YB5A 1GXUA 1FFSB 2BV3A 1RP5A 4A8XA 4O44B 3MMAA 4A8OA 4LBHA 3NXZA 3MZIA 4CLYA 2V6AA 3QO9A 5G4DA 5I4MA 2LU1A 2M7SA 3MPWA 1SH0A 1HNZF 3EX7B 3EDRB 4I64A 2XYHB 4M5JA 3KMQA 1TP7A 3AB4B 1UP1A 4C97A 3UD4P 3D3CJ 4NYOA 5KFWA 2XO7A 4B3RJ 2MKCA 3CCMS 2KT3A 2P9GA 3FNNA 3LWMA 1RT5B 2YNGB 1NK7A 1C0UA 1MU2A 4G3IA 1T9VA 3CSKA 2CPXA 1ZM3A 4IFVB 3TOQA 4X4SA 4CQ1A 2CZVC 3WHIA 1HD1A 2VG6A 2HHHJ 3PW7A 1N33F 2HFVA 1RWXB 2WB1D 3NGKA 5FJ4A 4JYAJ 3QQCD 4OJ3A 1BD6A 4YB6A 2KM8B 3RB6A 3ZZ0A 2WB4A 1WG1A 3VWSA 4YP3A 3M8QA 2E9ZA 3OVSA 4KO0A 3CDBA 3KJFB 3UFCX 2L9WA 3NG8A 2NLWA 1VK8A 4ZHRA 4R5PB 1BY9A 1CC7A 4DF4A 2E1CA 4NLOA 5HLFB 1JLBB 3C16A 4JBCA 3DU5A 4QIGA 4CLZA 4E2FB 3CMES 1IKVB 2D7SA 1AB8A 2BUNA 4LSLA 2MZTA 4ZCKA 1RBLA 2HURA 4ZP6A 1C0TB 3TARA 1Q7YT 1R0AB 3CJ8A 3KDNA 5I42A 1S1UB 1M5SA 4IOAQ 2KO1A 1EQMA 1KHVA 4ZPWR 4CO0A 3GJSB 4WP8A 2N4CA 4CH0S 3P5TL 4CCHA 4A4JA 4C11A 4CH7A 1AZSB 4IR9A 3K5NA 4JI2F 5B0AA 1H2UX 4C2MA 5LL6d 3HD1A 1RLCL 3NRBA 1HNIB 2MHEA 2PD1A 5EDWA 2AGPA 2W9CA 3BBBA 1N8RT 4TU8A 3EXYA 2ZOGA 3DLEA 1FXRA 4V19J 2H54B 2UUAF 4IH7A 3T5JA 1JXEA 3W2WB 1NDPA 1Q8LA 3CJ4A 2MKSA 2BBEA 3VGUA 4IRDA 4XPEA 5DGAA 4EO6A 4DR4J 5T41A 4USJC 1Q79A 1RU2A 3MAHA 4OYIA 5J2MB 4WFXA 3KLEA 2WVDA 3QRQA 1XMBA 1IM4A 4ZVOB 1R27B 2AYMA 4ES3A 1QUPA 2OPPB 4URGA 3I4PA 5CH7B 1RTDA 2LKZA 1ACMB 5LJ5Y 4PAAA 1PCAA 4KGKA 1CJUB 4LRBA 4FS2A 3C6UA 4H4OA 5GAEI 2XB2D 1IBKJ 4HTIA 1B64A 4KKOA 1RAAB 4QWBA 3OTOJ 5DZ7A 2PC6A 3QWUA 1RWUA 1DTQB 2CJAA 5HVFA 3C15B 2GCFA 3FKBA 4WCEQ 4G1QA 4CM0A 1ZTTA 2DH7A 1RKIA 2DY1A 2FLLA 3DI6A 4ECVA 2OPSB 3PIOQ 1Q86T 2NCKL 4L3NA 3T1YF 1CS4B 4DPOA 3C6TA 3LW5C 4RW8B 3C3LA 1UFKA 2VC1A 2KB2A 2C3MA 4JI8F 1X5PA 2DHHA 4K4ZA 4DHVA 1T9WA 2C2ZB 3ILLA 2XTJP 1SUQA 2OAUA 5ETRA 4DV3J 3LUYA 1HQEB 2AHOB 4NLGA 4IG0B 3A12A 3CIZA 3SI8A 3WZ0A 2AYGA 3CUNA 4NXMJ 4ZVPB 4OX9J 2CPYA 2BM0A 5D3GA 5E41A 2J6UA 1IBMJ 4WPAA 2RUGA 1FDBA 3CJ3A 2DNPA 5KG1A 3K5OA 4IG3B 1U26A 3KLFB 3I9ZA 2D41A 4CNYA 1IWGA 2LVWA 4ZP7A 1WF2A 3OFGA 2FJBB 4X66F 1HWJA 3QRPA 3H2UB 2DNMA 3BJYA 2HHQA 4LF7F 4DV2F 2EXUA 2FGOA 1JLEB 3SXLA 1ZBTA 1YZ6A 2OJ3A 3BPDA 4WXWA 4DG1A 5KG3A 5AXNA 3GTYX 2FPHX 3E01B 2V2VA 4ED3A 4MKYA 3V81B 2CJBA 2OH2A 2YNFB 2JEFA 3KYLA 3FUYA 3JYTA 4FNHA 3MOZA 4BBYA 1N34J 1HNXJ 3KJNB 4AL5A 3CPWR 3W5XA 3ZNUA 3J80U 4LF8J 3ZTQA 4PWDA 4OYAA 4O3SA 4V19X 3CCWA 1MROA 4DFMA 2B8QA 3U1NA 1QDUB 3RBDA 3P5BP 4CLFA 3X1LB 3MEEB 2J7WA 2FB0A 1NKBA 2RU3A 7FD1A 2GQCA 2DHSA 5ETSA 2X51A 2ZZTA 4ICLB 2IY5B 3H42A 1X4FA 3FQKA 5DQGA 3R1HA 4DUTA 2YNIB 4ALZA 3VALA 3TJAA 3M2VB 1FFWB 4DV7J 4DJBA 3HKWA 2XGPA 5IQQA 5HBMA 1I94J 1JKHB 4NLSA 4OJHA 4EBEA 1SQFA 3GU0A 4ZVGA 2MZQA 2W8LA 5F41A 4XK8C 4RBTA 3M8PA 1Q0NA 2F8HA 2CYYA 2HQCA 4ED5A 4JV2A 1S99A 2B4OA 2FUG9 4CT9A 3G6ES 3CD6S 2IM3A 3GONA 4GKJJ 2EFPA 5KFCA 2V9KA 3GR1A 3SSRA 1UWBB 1W2BR 2FLNA 1UZDA 2BABA 3FDSA 1WC4A 4QU7A 2H5EA 2B9EA 2CPFA 3POTB 3DM2A 5E3CA 2R2SA 4EZ6A 2P9EA 1EETB 4WFNQ 2ILZA 2A2CA 4DPXA 4P2SA 3TYTA 4Y0FA 5DJBA 3B54A 1EAYC 4Z2XA 2N82B 3BREA 1K1SA 3SDEB 3FFIB 4FXWA 3CJQA 4F67A 3Q8UA 1R6VA 2RB7A 2G4BA 3W62A 2MQ8A 1KVKA 1KQGB 1K0TA 3TAMA 3P3DA 2CQDA 1KRPA 1RDRA 4NLVA 4DSFA 1Y00A 2DY9A 5EX3A 3R5BA 3AODA 5GMEA 1JJ2R 4NCGA 4YDDB 1U2RA 2HFSA 4NEZA 4USKA 4OX8A 1WTBA 4LBIA 1ZH5A 2N4DA 2C2KB 4O4RA 3JSYA 3UN3A 3CTRA 2I5JB 2FDNA 4YEAA 3BDPA 4TY9A 1RWWB 1FVSA 3W60A 5HL7Q 3SZ2A 3PG9A 2I8EA 4EBDA 8AT1B 2JVRA 4J9RA 1RCOB 1UZHA 5J1EA 3TJ8A 1JWWA 5CQGA 1UAWA 3SQGB 1WUUA 1R0CB 1RTJA 4QWEA 3ILJA 4YR0A 2DIUA 4WFBQ 4YR3A 3DKDA 1S77D 3V2UC 3CE8A 2YX1A 3FJ2A 3TO8A 3TZXA 1HBUA 2VG5B 4FXVA 4DR3F 1VQMS 1LWEA 5J2NA 3OXGA 4KPYA 2ATLA 2BM1A 2J7UA 2UXBJ 4QPXA 2I0XA 2NREA 2DTJA 3I82A 1X9WA 2H1YA 5A76A 3TX8A 1OJ4A 2MLZA 1MMNA 4EYIB 4DQIA 3NNHA 1QSYA 2FY1A 1SH3A 2HBYB 3QGPA 1QLNA 4RUCA 1GEHA 1JK9B 2ZM6F 2O67A 1G4CA 2BKPA 2DGQA 1RT1A 4DXLA 2XY7A 2W4CA 1WKJA 3IAS9 3CCUS 3W2VB 3N9UC 2DVIA 5DDRC 2ROPA 3NGUA 3KK1A 3GQCA 3ZTOA 4OLPA 1GMWA 2KHDA 2DR8A 1FD8A 1X9MA 5HAOA 1HBOB 2RF2B 3OUYB 2BE9B 2HQ3A 2MKYA 4MFBB 4IRCA 3AB2B 1FRMA 2P2CB 5LXRA 2H4YB 2DO0A 4KRWA 4C0BA 3CCVS 1JJHA 3A8IA 4ELTA 2Q66A 4DUYF 1WSVA 3MFHA 2WVEA 4HHUA 4ZPAA 3TZZA 2EKNA 2ZH5A 5HI7A 4HVZA 1RK8A 4F0MA 4DUZJ 2QO3A 3EZUA 5C24A 3FBBA 3TVKA 2BJDA 2W25A 3QLHA 2F5GA 2DNQA 4I6YA 3M2UB 1WHVA 3D0GE 2HQDA 1KLNA 3FMWA 1JLQB 4WKYA 1Y5LB 1WC6A 1HWUA 4ZJOA 3GYGA 1TU0B 1HFEL 2HHPA 3KUGA 3KG4A 3PYDA 1X4AA 1BQNB 2RAQA 5D4NA 3PEJA 1GXTA 3J7AN 2V4JA 4FF3A 2RMLA 1Y7PA 3DHWC 2R42A 3AOAA 5C42A 4OYZA 4DFJA 3SCLE 3UI3A 4LFAF 2FJVA 1LXNA 1UVMA 3LP0A 2HHWA 3NCPA 1WEYA 2BJ7A 2ZZNA 1SXLA 3D7SB 4P52A 3DLLQ 2EK6A 3UDLA 5KFOA 2PEHA 1HIYA 4J9QA 1ITPA 1B0TA 4JV1A 1XMQF 1DARA 3RB4A 4DN9A 2MY7A 2P8IA 3MMCB 4WF9Q 4OI1A 2AJQA 4ES2A 3M1VA 1OPIA 5B0DA 4ZPCA 4ZKAA 2E5GA 3PJ9A 4AE5A 4F26A 1IN0A 1K8AT 1P9QC 4PG7A 4U8YA 4OZNA 4PQUB 2MKKA 2FC8A 2FGCA 2HHTA 1N0VC 1GAOA 5KFXA 2DH8A 1D8YA 2MXYA 3CC7S 4MH8A 3G87A 4Q44A 3AD9C 3VAMA 2MKJA 1CJVB 1WDTA 2YKNA 2CWKA 5H9FK 1DTTB 2WAQD 2GQ2A 5KTQA 2BOPA 1NK9A 2HWIA 2E5LJ 1PC5A 3OR1B 3M8RA 3KNAA 1FA0A 4HL9A 1VCTA 2W9AA 3KLGA 3IS9B 3K5PA 4ZJLA 4P7VA 4RNFA 2KJVA 3J81U 1R0BG 4YUDA 2DYAA 5IT9U 5LMNJ 4J9NA 2PMHA 3AY0A 1T9XA 1IKXB 5KFKA 1RT3A 3TZYA 1RT6A 2M0GB 4PQAA 4AUKA 2XM3A 5KFHA 1PG5B 3HFKA 1H7XA 3NGDA 3J80Y 2AKWB 3MGJA 2HNDA 2CFXA 1BWEA 2G9OA 3RW7A 3R9LA 3HVAA 4TY8B 3DRPB 4LVOP 2BANA 1Y0HA 3KUEA 1UJ5A 3TRGA 3RAQA 5F0UA 3OL6A 4RUBA 2DGXA 2VB6A 3AXKA 2E9TA 1D0EA 2VPXB 5HMWA 1WC1A 3KUHA 3CJSA 2YBVA 3KLIB 3R5JB 1RT7B 3ISND 1U6BA 2EW9A 1N36F 1GT8A 1KLMA 2DRDA 1CEZA 4KJIA 3V6JA 5L1KA 2NPIA 5LOQA 5KFTA 1T05B 1T03A 5GAHI 3I6PA 5C7PA 4N56A 2L41A 4UZBA 1MMDA 4B9UA 2DITA 3FMBA 5KFMA 1F2GA 3QJJA 4QYRA 2YH1A 1S10A 1HHTP 3E2EA 3NGSA 3BKFA 1RWKB 1JJ4A 1GNKA 4X65J 4M5NA 4DV0J 5GAGI 1NXIA 1Q7LB 2UZAA 2PA8D 3Q2SC 3RJMB 2VQFJ 3G71S 5B09A 2NXCA 1D8ZA 4MKBA 4AQYF 1X0PA 1N5SA 2HWTA 3AA8A 1F9FA 4Q7AA 2UVVA 4YR2A 3JQJA 3MR7A 1Y3JA 1S6UA 3CCJS 2HHSA 2JRSA 4HEA9 4I0WA 4JI3F 4O3NA 2K3KA 5ETKA 4LT6A 2U2FA 4PYAA 4OV1A 1YJNS 1HBNA 3UD5A 2VOPA 5DQHA 1F1BB 5GVQA 3R6GB 3GYXB 4K4XA 2VICA 2XLIA 2XCAA 3JXOA 1OY9A 1N6QA 4ZCLA 1G2EA 1F9HA 5G0RB 1X5OA 2QX0A 4P7TA 5CYJA 4N7TA 4R8UA 3VHQA 2I9SA
chains in the Genus database with same CATH topology
1HPZB 1SH2A 4EO8A 3MD3A 1IKWB 5K14A 5KOXA 2XHWA 5DQIA 3LP0B 3HHEA 3THPA 1N54B 3EPGA 3PX6A 2KZMA 2DNOA 5A6WA 4B3OA 1YRUA 1D9AA 1QY7A 1DQ8A 2ADCA 4KSEB 4JI0F 3HP6A 1KQSR 2VFUA 2FHJA 3TW0A 4K0KF 4H4MA 4MYUA 5I3PA 1URRA 4DEZA 3M9NB 2UXCF 2HAIA 1N52B 2NUUG 2CQ2A 4GO7X 3ULHA 4CO2A 1VQ7S 3ITHA 1VC5A 1S0MA 2R8JA 4Q0BB 3M30B 3DXBA 3DRRA 5JVHQ 2ZOFA 4WJBA 4CTAA 5BR8F 3D0IE 3A1YG 4IOBA 4N47A 4OL8A 3BN4A 3M32B 1C1CA 2WRMA 2HLTA 1OQ3A 1J5OB 2XMVA 2FHOB 5KFJA 4X2BA 1S6PA 2D9PA 2DIVA 2ZZMA 3HMJG 2DISA 4ZPBA 2BR0A 3MM5A 3CD5A 1APSA 4IFYA 1S9GB 1ZM2A 2FLPA 3JSBA 2F9DA 4LQ3A 5H9FJ 4LVNP 4DSIA 4KHMA 1FKAF 5E2QA 4O3RA 2EK1A 3R27A 1AXQA 2P9CA 4WFAQ 2CDQA 1KSPA 2BRKA 3KJVB 4KIAA 2Q79A 3PJWA 3M1VB 1VBXA 4ITSA 4RW7B 1EP4A 1WELA 1REVB 4DSJA 2QMXA 4YB7A 1S1VB 1E6VA 2KG0A 5IM0B 2F3JA 2EG1A 1VBZA 3AH6A 3V6DB 4O44A 2VL1A 4B02A 4X65F 2CPIA 3O2IA 3OJSA 4DQQA 3CJKB 3D5MA 4DV0F 2GQQA 2IVMA 5DDPC 1ZZNA 4BWJA 4NRTA 2MQPA 1N88A 1WEXA 1G6BA 3L7OA 4KE5A 1SJ3P 1TK8A 4N76A 3SFGA 1WI8A 2VQFF 2PI4A 5M2PA 5F3ZA 1SI9A 1Y5NB 2RT3A 3CO9A 3KG1A 5L1LA 3VAFA 1SIZA 4MK9A 1JLAB 2Q6CA 1R8AA 3HHKA 2CRLA 4WK1A 3RU0A 5B08A 3IN5A 2OD4A 2KG1A 1TKTA 3VAHA 2J7KA 4RW6B 4C3MA 1HMVA 5DDQC 2EFGA 3DLGA 3VR1A 2A18A 2DNGA 3EZ5A 5E7OB 3HZEA 1LW2A 5K9FA 2GIRA 5KAKA 3RBEA 5DDOC 2GNKA 4JV0A 2DT9A 3CCTA 4WE1A 5L9NA 1FE4A 1DLOB 2NS1B 2YKNB 1N32F 2XNQA 1SB6A 3CJ2A 4JI7F 4A46A 2ZD1A 2CQCA 3M6XA 4DFPA 3M2RB 3CMAS 3DGPA 3OFFA 2C28A 2B7BB 2BDPA 3BGFA 2IA0A 2HS0A 3TUJC 2VOOA 2FD2A 1FRXA 2C3YA 4FYDA 2PN6A 4UQGA 3HHLC 3N01A 2DB1A 2MY8A 5GADI 4Z37A 1TKZA 1MSWD 2BJEA 2HMIB 2N3LA 3KLVA 1JLFA 1HWKA 2MDAA 3A8EA 3N28A 4K4UA 1Q53A 1FESA 2QA4G 4KBIA 4WU2A 2O3DA 3MURP 4NZ7A 1VQ4S 1YQHA 3HHLA 2E44A 1RTIA 2HNZA 1CLFA 2IHR1 3MEDA 4K5SA 2LDIA 4O3OA 3H25A 4DX8H 2YWEA 4XO0A 2ZBCA 3I56S 3KLGB 5E3AA 2NR0A 4IO1A 1WWHA 4RKUC 5GAEU 2WCXA 3MTKA 5BYQA 5CZXA 3QYYA 3BQ0A 5A8RB 2V8GA 1WEZA 1T7PA 2RRAA 3I31A 1XWLA 2KM8C 1AROP 2YH0A 5MAOA 4Y6IA 5B0EA