3TVKA

Diguanylate cyclase domain of dgcz
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
AIRSNMDVLTGLPGRRVLDESFDHQLRNAEPLNLYLMLLDIDRFKLVNDTYGHLIGDVVLRTLATYLASWTRDYETVYRYGGEEFIIIVKAANDEEACRAGVRICQLVDNHAITHSEGHINITVTAGVSRAFPEEPLDVVIGRADRAMYEGKQTGRNRCMFIDEQNVINRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Diguanylate cyclase DgcZ
total genus 52
structure length 172
sequence length 172
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tvkA00
3DLKB 2OPSA 4QWCA 4PWDB 3V6DB 4ED2A 1CSJA 3LAMA 2V9WA 3T5KA 1LWCB 5KT6A 4KV8A 1RT1B 1LW2A 1S6PA 3PW4A 2FLPA 4RW7A 1HYSA 4WZMA 3KHRA 2E9RX 1SH3A 3KHHA 3KNAA 1HMVA 4GC6A 1VRUA 2B5JB 1TKXA 2BANB 1S97A 2UVVA 4TQRA 3I5CA 2VG5B 3DOKB 3UPFA 3DLEB 3QYYA 4F4ZA 1S0MA 1S1TB 4Q44A 4K4VA 4KKOB 5KFAA 4I7FB 5KFOA 2IC3B 1DTTA 3V6DA 1RTHB 4O3NA 1EP4A 2WONA 5KG3A 5DQGA 1TVRA 3EPGA 4KV8B 3DRRA 3EZUA 2YNIA 2HNDA 3N6NA 4NLSA 3GIKA 4NLVA 3MR3A 3H4DA 3DOLA 3E01B 4MIAA 4KAIA 3V81A 3KLEB 1RT3B 3DMJA 3CJ5A 3FRZA 1REVA 1TL3A 3IRXB 3TAMB 4DG1B 4ECQA 1RYRA 2W9CB 1EETB 1S1XA 3UR0A 4RW8A 4B3OA 1C0UA 2HNZB 2F8EX 2FVSA 4LSLA 4O4GA 5F8MA 4J9QA 1DTTB 1RTDA 3IGNA 4EBDA 4DL3A 1U09A 3CJ0A 4X2BA 3OL7A 2JEGA 1S1UB 1C0TB 3LP0A 1T05B 1C1CB 1S1VA 5FDLB 2BQ3A 1SH0A 2RKIB 3N6MA 3KLHB 4H54A 4ED8A 5J2PA 3KLIA 3MEGB 1TV6B 2XCAA 4O4RA 5KFTA 3NAIA 1TKZB 1TQLA 2VG7B 4EEYA 2OPPA 1REVB 1TL3B 3IRXA 3PJWA 2W8LA 1J5OB 4NYZA 3KMSA 4PUOA 1RT7A 4RW9A 3QZ7A 2JEIA 3ITHB 3V4IB 3ISND 1RTJB 4KFBB 4QW8A 5KG6A 2FVPA 5C5JA 3OSPA 4DL4A 4K4XA 3FFIA 3UDLA 1S6QB 3CO9A 3BGRA 4ICLB 4XPEA 1XR7A 4PQUA 1JLQA 2W7OA 1LWCA 5EWEA 4ZVFA 2AGOA 1IM4A 4G1QB 3DLGA 2C2DA 4DL2A 2B5JA 2RDJA 4ECVA 4TY8A 2C22A 4IH6A 3MEDB 5JUMA 5F8LA 2RDIA 1C2PA 1N6QB 2WK4A 1S1TA 4H4OA 3IG1A 3FFIB 3KK2B 1C0TA 1HQUB 1MMLA 3KLVA 2OPSB 4PWDA 1HNVA 1JIHA 4MFBA 4ZPDA 3H2LA 3OLAA 2JEFA 2UVUA 5HBMB 4Y2CA 3M8PB 4NLGA 3KOAA 4PUOB 3NKYA 5KFSA 3PHEA 4U6PA 3GV8B 3MEDA 4Q8EA 2AX0A 1QE1A 3BQ1A 3DDKA 4JV0A 3BSOA 4ZPBA 1JKHB 3CWJA 2D3UA 2JC1A 4RW8B 3PW5A 4B3OB 3NBPA 1JX4A 4NLOA 5KFQA 5DQHA 4J9RA 3PW7A 4DEZA 4RNNA 2YNGA 3QO9A 4TLRA 5KT3A 3DOLB 3FQLA 4IDKB 4ZMMA 1OS5A 2YNIB 3M8PA 3LP1A 2YNFA 3HVAA 4IOBA 5J2NB 3TVKA 5KFHA 5KFJA 5KFCA 4WYLA 3DOKA 2VG7A 2FJXA 5C24B 3MECB 3NGDA 3C6UA 1RT2A 2OPQB 3QIPB 4F4YA 2QE5A 5F9LA 1LWEA 5DLGA 3H5XA 1JLGA 1S4FA 1T03B 3BSCA 2ASJA 2ATLA 1QAJA 3JSMA 1TKXB 2BANA 3QLHA 4NCGA 1TKTB 3MF5A 1HNIA 1KLMA 1S6QA 4IFYA 4IG3A 1C0UB 2HNZA 4ZVGA 4RW7B 1HYSB 2WTFA 4O3SA 3IS9A 3NL0A 2XI2A 3KJVB 5C42A 3QZ8A 5KFIA 4TN2A 2OPQA 3QIPA 5KFWA 5J2MA 3I0SB 4J9PA 3C6TA 2UUTA 3GV7B 1KHWA 5K14B 5J2QB 4EO6A 4R0EA 4OL8A 4FS1A 3V6HA 5L1LA 1EP4B 3MR6A 1RTJA 4RW4B 4NLUA 5FDLA 4ZPAA 2HNDB 4J9OA 1VRTA 1C1BB 3BSAA 3M9OB 5F8HA 3BGRB 4ICLA 1N4LA 4PQUB 2OPPB 3FSIA 3H4BA 4NRTA 1UWBB 4ECRA 4I7FA 1VRUB 4WXWA 5KG5A 5EWGA 2GIRA 5C25A 2W9CA 2E9TA 2ZKUA 3V4IA 1T05A 4ECZA 4Y34A 5KFVA 5KT7A 5CYQB 2IM1A 4ECWA 3M9NB 4J9LA 4O44A 4RW4A 4URSA 3VQSA 4K4SA 4J9NA 3LP2B 1RT6A 3HHKA 4ID5B 2UVRA 4I2QA 5J2PB 3TAMA 3KLHA 4Q0BB 3RBEA 5F8IA 2D3ZA 4KB7A 4R5PA 2W8KA 5KFZA 4O3PA 4TY9A 1RT4B 1HPZB 3QGHA 4TYAA 2C2EA 1S1WB 4O44B 4IR1A 3H5YA 1JLEB 3E01A 1S1UA 4ECSA 3DLEA 4KHRA 5KFUA 2QV6A 3DM2A 3KK1A 3D5MA 3OL9A 1KLMB 3CDUA 3JYTA 4QPXA 2IBKA 3CIZA 3BREA 1T3NA 2BRLA 3M8QA 5KG0A 3RAQA 1RT2B 2WONB 3RAXA 4KFBA 2HAIA 5I3UB 5CYMA 5KFEA 5J2NA 2AQ4A 5J2MB 4KE5A 3T1AA 3QGIA 5J1EA 5DGBA 5HROB 1N6QA 2WRMA 1FK9B 1S9EA 4EO8A 2ASLA 3KLIB 3MEGA 2BE2B 1MU2A 1FKPA 1HQUA 5T14A 3DM2B 2YNHB 3KK1B 1S9GB 3QLHB 4JUZA 4YMEA 5D3GB 1D1UA 4IH7A 3EPIA 5CYMB 5DG8A 1RDRA 4ZP8A 2WOMB 2AGQA 1RT4A 4RUCA 1LW0B 3ISNC 4MFBB 1QUVA 4WFYA 1JLFB 5HLFB 3V81B 1JLQB 1RA7A 2YNFB 1D0EA 3GIJA 3T5LA 1ZETA 4RW6B 5L1JA 4ED3A 5L1IA 3D28A 2WCXA 4WXOA 3PW2A 2IM0A 3I0RA 1RTIB 4EYHB 2AGPA 2J6UA 3FQKA 3KK2A 1GX5A 4IKAA 4KKOA 4MIBA 3UQSA 4F4XA 3PJXA 3KHLA 2YKNB 3DRPA 1SV5B 5F8GA 2HMIA 5KT5A 2RF2B 3DRSB 1N5YB 5C25B 3CDEA 1TV6A 3MFHA 4MKAA 4IQXA 2IM3A 3IS9B 4MH8A 1KHVA 3NAHA 1RT6B 4WYWA 3GV5B 5DLFA 1JLBA 2R2RA 1FKPB 4NCGB 4NRUA 1HARA 4FBTA 2XI3A 3BSNA 4QWBA 3FDSA 4R5PB 2I1RA 1S9GA 3ITHA 4NZ0A 2FLNA 2O5DA 4YQWA 1TP7A 3DLKA 4Q0BA 4XO0A 4ZHRB 5KFPA 3TQ1A 3LP2A 2FVQA 3MECA 2RF2A 3DRSA 3KMQA 2AX1A 1BQMA 5KFNA 3HVWA 4M95A 4F50A 3DI6A 3ICLA 4MK9A 4TXSA 1IKVB 3T5HA 3LANA 3KJVA 2HNYB 5KFRA 4YP3A 2IA6A 4KO0B 2D41A 2YNHA 4IFVA 3I0SA 4RUAA 3JSMB 5KFBA 5CYQA 5EUHA 1QAIA 5F9NA 3E51A 3N6LA 3Q8QB 2IJFA 2VG6B 4IH5A 1LWEB 3DYAB 5KFDA 4WE1B 2W7PA 1TL1B 2YKNA 4H4MA 2B6AB 5EDWA 5KFYA 1IKWB 2GC8A 4ED1A 4J9SA 1HNIB 4IFYB 4IG3B 2VA2A 1BQNB 5L1KA 3DMJB 5KT4A 1LWFA 1FK9A 1S9EB 2CKWA 1SUQA 3G86A 3MEEA 5L9XA 2R2SA 4ED7A 4K4UA 3SI8A 1T94A 3GYNA 4IG0B 4QWAA 2HWHA 3M9MB 5HP1B 2DPJA 4EBEA 3C6TB 2UVWA 4RNHA 1LW0A 1TKTA 3KLGA 4MK7A 4ED0A 3GILA 1DLOA 2RKIA 5KFKA 2W9AA 2HMIB 4M94A 1S0OA 1LW2B 2IMWP 4F4WA 1Z4UA 4NLWA 5KFXA 4Q45A 2D7SA 3G6YA 2J6TA 4O3RA 1JLEA 5HBMA 3NMAA 4Q43A 5KFLA 1HMVB 3CJ2A 3LAKA 3H5SA 2R2UA 1UWBA 3I0RB 2WOMA 4KO0A 2DPIA 1S0NA 1NNDA 4IR9A 1EETA 4JV2A 4ID5A 3GIIA 4J9MA 5K14A 4DL7A 5J2QA 4RW6A 4J9KA 4JV1A 1W25A 1WNEA 4LQ9A 2WHOA 4QW9A 4I2PB 1DTQB 3V6KA 1SV5A 1S1WA 4O3OA 4LSNB 4ECYA 2C28A 3DYAA 3OSNA 1JLAA 2C2RA 3DRRB 2W9BB 1RTIA 1N56A 2OH2A 3QGGA 2GIQA 4IDKA 3DLGB 1IKXB 1S48A 3LALA 3QIDA 1NHUA 1LWFB 3DRPB 2HNYA 1IKYA 4RNMA 1JKHA 3KK3A 5KG4A 4TQSA 4DL6A 3T5JA 4EBCA 4KHMA 1XR5A 1RYSA 4RNOA 1S49A 4R8UB 2V0NA 2VG6A 1JLAB 4ZHRA 3H98A 3PW0A 5KT2A 1C1BA 1RAJA 4RZRA 2BRKA 2ZE2B 3MFIA 2BR0A 4LQ3A 1JLFA 5HLFA 3CDWA 5F8JA 4ZP9A 1HQEA 3RB0A 2IM2A 4ZVEA 2BE2A 1TVRB 2YKMA 3T19A 3Q8RB 2XCPA 1I6JA 4NLRA 2XGQA 4RW9B 3RB6A 4KBIA 4WE1A 3I5BA 4I2PA 3KLFA 3MR2A 2FVRA 1JLBB 3RBDA 1ZTWA 4DL5A 1S1XB 4ZP6A 1S9FA 3KLGB 4IRKA 4K4ZA 4IFVB 4IRCA 1TL1A 4H4MB 4YR3A 3KHGA 2FJVA 1C1CA 3GQCA 4ECXA 4EYIB 2JC0A 3HVTB 4KSEB 4U7CA 1JXLA 2IAJA 4NLQA 1YVFA 4O4GB 3OHAA 3MTKA 1RTDB 4WFXA 1N5YA 1BQNA 3OL8A 2OPRA 3PR5B 1GX6A 2FLLA 1RT3A 3I5AA 4H4OB 2BQRA 4NLXA 5EWFA 4YR0A 1BQMB 1JLCB 4G1QA 2E9ZA 2VG5A 2XWYA 2B43A 2ZD1B 5KFGA 3SFUA 3MR5A 1DLOB 3CJ3A 3RB4A 4LSLB 2ASDA 3M8QB 1S10A 4RNFA 3GIMA 4NLDA 3H40A 2WB4A 4URQU 3V6JA 4DG1A 1RTHA 4HYKA 2EC0A 3LP0B 4IG0A 2B6AA 1NHVA 3G6XA 3BQ0A 1N48A 4QWDA 1JLGB 4ECUA 2ILYA 1FKOB 3NBPB 4NLTA 1MU2B 2W9BA 1J5OA 4MK8A 4ZVHA 2V4RA 2I5JA 5I42A 2ZD1A 1IKWA 5KG1A 2IC3A 4WFZA 4FBUA 5D3GA 3CVKA 3RB3A 1DTQA 2UUWA 5DGAA 1SH2A 3IG1B 4TYBA 5C42B 3HVTA 1SUQB 3MEEB 5I3UA 1R0AA 4G3IA 1RT5B 3C6UB 2IJNA 4Y2AA 3KK3B 4Y3CA 2HWIA 1S1VB 5J1EB 4K4TA 4NLPA 5HROA 1IKYB 4K4WA 1FKOA 3H59A 3OHBA 1T03A 1RA6A 3PVXA 4K4YA 2VA3A 3KLEA 4Q8FA 4TY8B 5DQIA 1RT7B 3SFGA 4GC7A 3IN5A 2R8JA 3OL6A 5HP1A 1TKZA 5KG2A 3CJ4A 3G6VA 4FS2A 1R0AB 4LSNA 1QE1B 2JLEA 3IGVA 4HKQA 2R8HA 2IAJB 2R8KA 2FVCA 4ECTA 1K1SA 3DI6B 5KFMA 2YKMB 2ALZA 5KG7A 5F8NA 2AU0A 4R8UA 2FJWA 2OPRB 4ZPCA 2R8GA 5C24A 3BJYA 3PZPA 5DG9A 1HNVB 2J6SA 2ZE2A 3Q8PB 3HKWA 1K1QA 3H5UA 3JYTB 2JEJA 2R8IA 2BQUA 5DG7A 1XR6A 5JXSA 4IRDA 3KLFB 2XGPA 3Q8SB 5KFFA 4O3QA 4XPCA 4ZP7A 3BQ2A 2AWZA 1RT5A 2CJQA 4RU9A 2V4QA 4K50A 1HPZA 4URGA 4WZQA 1RT1A 1S6PB 3OLBA 1ZTTA 2R2TA 1IKVA 4ED6A 2XC9A 1JLCA 1IKXA 2YNGB 3QO9B 4QWEA 4MKBA 4NLYA 3BR9A 2I5JB 5I42B 3PR4A 4YR2A 4I2QB 3LP1B 1VRTB 2ILZA 1HQEB
chains in the Genus database with same CATH superfamily
2A1BA 2CVIA 2OPSA 2PMWA 4QWCA 4N8OA 1D09B 1WKKA 1J5EF 1CSJA 1KVKA 1PIEA 4DV6F 4HTJA 2HVIA 4YHHJ 2YKPA 3W64A 2OELA 1HFEL 1LW2A 2EWHA 2KN4A 3K5OA 5CCMA 4QJVA 4X66F 2ZDOA 3PW4A 1HYSA 2XMMA 4WZMA 1SH3A 1OWXA 1ICEB 3FCWA 5T7LA 1VRUA 4O0NA 2XO6A 4KHPJ 4CRJA 1QVFR 2LQ9A 2LU2A 4C8OA 2IRUA 2RMLA 5AXKA 4ANCA 3UPFA 4ZPTR 3IBWA 2AMCB 4Q44A 4FNIA 4EFAC 4GKJJ 1Y3JA 2X1GA 3A8EA 3R6GB 1FWKA 3M2VA 5DQGA 1DQ9A 4RBVA 3N6NA 4NLSA 3GIKA 2QLBB 4NEYA 4ED4A 2MLXA 2VH7A 3C19A 3MR3A 1FE0A 2PFFB 4F7VA 2LDYA 5G4DA 1REVA 1TL3A 1A7GE 3GMGA 3WX8A 2CDRB 1EETB 3FNNA 2GMHA 3UR0A 2UZAA 3PX6A 4M5KA 4LSLA 4J9QA 4W90B 1VJWA 2LCWA 3B4DA 3DLJA 3IGNA 5FD1A 4EBDA 2RSQA 1TAUA 1U1LA 2NPIA 2BJ7A 2BJ9A 3K8WA 3BPSP 2Z8QA 1T05B 4JI4F 2GGPA 2RKIB 1RU1A 1IXKA 1P8GA 2DKOB 4C4WA 2E1AA 4P52A 3MI7X 2AYEA 2A0FB 1TKZB 1TQLA 4PXBA 1X5TA 2AJFE 4PUOA 3WQPA 4A46A 1UWAA 1JK9B 2J8SA 5HANA 2MDAA 1V9OA 3HCXA 2B0GA 4DV4F 3CDBA 4RW9A 5LMNJ 3KJNB 4BCAA 4LF5F 1T7PA 2PDAA 4LFBJ 4KFBB 1DHMA 4K8RA 3I55S 1N34J 1TL7A 1YJNS 2WVEA 4JI4J 2ZH5A 4AL7A 3FFIA 5K8MA 4JYAJ 4Z7CA 3CO9A 1KS2A 3BGRA 1T11A 1XR7A 1JLQA 4QYRA 2AW0A 4FDFA 2YKOA 1VHIA 2BOAA 3RG6A 1M5SA 3CC4S 1TUVA 3M05A 3DLGA 3DCAA 4J90A 3BZQA 4LF5J 1RWUA 2B5JA 3S8SA 2YX7A 5MLCV 2NSCA 2C22A 5JUMA 1VQ7S 1TAQA 1GTEA 2V2ZA 2LU1A 3MM5A 5CD4A 1J5OA 4V19J 1PILA 4WFNQ 1X9WA 3FFIB 3R2CJ 2CQ0A 1RK8A 3MWBA 1HQUB 4PWDA 2PEBA 1F3FA 1HNVA 5H9EK 5EHHA 3OJUA 4RU2A 2RIJA 1DFDA 3BGLA 3MURP 1UVJA 2EK1A 3TWZA 2ERRA 5DRKA 2JEFA 2UVUA 1C4CA 3BYRA 4I6AA 2KHDA 3SDEA 3JQKA 1FJEB 3OFEA 4PUOB 1G7CB 2HG4A 3NG8A 4JOUA 4W4MA 5KFSA 4DV5J 3GV8B 1VIXA 4U95A 3DC2A 3HSZA 4OMFG 4IOAQ 3PW5A 1JKHB 1FNMA 2D3UA 2JC1A 2XSFA 2QLJB 4NLOA 4EZ9A 1QD1A 1WWHA 2AJ4A 3UD4P 2HBQB 3WX4A 1HKAA 2GZOA 1N52B 2L9NA 3AHPA 3M7VA 3QO9A 4OX8A 3VZIA 4X4TA 2D9OA 1ZAWA 3VAHA 5H9EJ 4WK1A 3EM1A 5GADU 3MUMP 4DHVA 5HQMA 4P7VA 3DOKA 1DQAA 1H7WA 2OUGA 1GK8A 3FZ2A 4HEA9 3R7NB 3UW1A 4ZLLA 2EFQA 3NGDA 3TZYA 3OUYB 2OPQB 1QTMA 4CO1A 3Q89A 4USWA 2DHXA 3QGPA 4JI1J 3H5XA 1T03B 2ATLA 2ASJA 2I2YA 3D66A 2CQIA 3HT3A 2HHPA 4OZ0A 3W63A 4IG3A 1KLMA 1Q7YT 4ZVGA 1C0UB 1HYSB 2PO4A 1FD2A 1X60A 3KUHA 2M8HA 3QWUA 2XI2A 3CJSA 4O3SA 3NL0A 4QIFA 1DJ0A 4L73A 3U1LA 1RI7A 3C16B 5C42A 4TN2A 3GR1A 2ZH8A 5IWAF 2ZOFA 3QIPA 5E7OB 5HI7A 2DITA 5DZ7A 1HBOB 5A8RA 5KFWA 3I0SB 1VRQC 1YJ7A 4CZCA 1FE4A 5HL7Q 1NBEB 1SVDA 1WACA 3V6HA 1KQSR 2KH9A 1RTJA 1GXTA 2J7KA 1CQNA 2CRLA 2WVBA 4NLUA 1X4CA 4ZPAA 2HQDA 1N32J 1MW7A 3M2RB 1NDLA 2RUSA 3NNCA 1RWMB 2DGOA 4B17A 5F8HA 4C48A 4WFBQ 4ZN3A 1N4LA 1AW0A 5JVHQ 3H4BA 3UCZP 4X4SA 3BKUA 1OPZA 3AA9A 1W7WA 4I7FA 4PXEA 4WXWA 5KG5A 5CZVA 1E6YB 3PACA 2ZKUA 3V4IA 1T05A 1FVQA 3MEKA 5ETRA 4ILLA 4Y6IA 1H74A 2KVIA 2IM1A 5CYQB 3R5BA 1IR1A 3UD3P 3TA0A 1GMVA 5JMNA 2KFNA 4U9RA 4OI1A 2DCUB 1S6UA 2H51B 1X9MA 2UVRA 1XNQJ 2CA9A 4Q0BB 4I69A 3BKFA 2A2DA 3D0GE 1BUXA 1VQYA 3QJJA 2EEYA 2Y0SD 1SL0A 3JSBA 4KB7A 4L75A 1N5SA 4LRDA 4N41A 2VD3A 5CQGA 1F0XA 4I4BA 4DZDA 2MJUA 1FRLA 2JDJA 3PYEA 2K7JA 3M2VB 2G9OA 3M1VB 1U1QA 1VBXA 4DDFA 4U7UD 1R31A 1RE1B 1V3SA 2P8IA 4IR1A 1WI8A 4DR5J 1RU2A 1M5HA 1S1UA 2BM0A 3DLEA 5KFUA 1HQ2A 3DM2A 3T9NA 3D5MA 3OL9A 1R6VA 3JYTA 4QPXA 3TJ8A 6FD1A 2DO4A 2VFTA 3RAXA 3QATA 2MGZA 2WONB 4V19X 2KYXA 3HO1A 1O6XA 4KGXB 1NXIA 4F4AA 1FA0A 3BH7B 3MUVP 3NGSA 1CS4A 2P9CA 1FK9B 1S9EA 2N7YA 2MQNA 4P2SA 4UQGA 2ASLA 1KFSA 1R8CA 4JB8B 1HQUA 4B3SJ 5SUHA 2J9DA 1NJYA 4E8UA 1UJ4A 5AJ3F 2VBWA 4OZLA 3QLHB 4A8XA 4WTOB 3Q8UA 4P9SA 2HK3A 2WW4A 3MAAA 2D9PA 1RJJA 2QL5B 1NKEA 1D1UA 2NXCA 4OI0A 1MLAA 4MKVA 4WWSA 4PKDB 1HD1A 2KM8C 2OO4A 1W2IA 1RB0A 3V5RA 1RDRA 3QRQA 4NEZA 2M4MA 2WOMB 4LFAF 2KG0A 4RUCA 1LW0B 2WW8A 4DR4J 4ZVTB 1CS4B 1XIQA 2CWXA 4WFYA 3OVSA 2BW2A 6FDRA 1JLQB 2IHR1 1WG4A 1TK8A 1XTZA 3AD7C 4F4KA 1HA1A 4DLEA 4CYUB 2MKIA 1ZETA 2XSJA 3UE2A 3C15B 4CH1A 4GVLA 2VONA 1TKDA 4NI2B 2IM0A 1ZZFA 2QMXA 3F41A 1VK3A 5AXLA 4AL6A 2J6UA 3CNQP 3UQSA 3M6UA 4MIBA 4F4XA 1LK7A 1L3KA 4WK3A 4QIWD 1YITS 2FIUA 4HI2A 4U67Q 4OFZA 1UETA 5C25B 4BS2A 3SCLE 1TV6A 3MFHA 2HHSA 4IQXA 1SBRA 2V6AA 2VFSA 2MY8A 3LUYA 1U26A 4USVA 1JLBA 2R2RA 1FKPB 2UXBJ 1HARA 4LVOP 4FBTA 4QWBA 1SI9A 2DT9A 2FLNA 1S9GA 4LF8J 2K8GA 5ETTA 3DLKA 1P9QC 5DDQC 5ETVA 1YWXA 5AE1A 3TJAA 5D4NA 3MECA 4DU7A 1G1XA 2BW7A 2RH3A 5KT6A 1BE4A 3MM9B 5JVGQ 3QJPA 4MK9A 4G1IA 4H4KC 1IKVB 2Y3YA 2L08A 2GJIA 4UW2A 5KFRA 5BJRA 4YP3A 2IA6A 3OVAA 2YH0A 2RAQA 5D0HA 1KVJA 5DM7Q 2EXUA 1NDCA 3WDOA 1BLUA 2XMUA 3UD5A 3TEGA 3MPWA 3I0SA 4RUAA 3EX7B 1RWKB 2E1MC 2JH3A 1WC0A 2VPYB 5CYQA 3E51A 3PM9A 3LW5C 1QAIA 4NZ6A 1LWEB 1AYEA 1EHWA 4YB6A 1E6YA 1RAEB 2YKNA 4RBUA 2IVFB 4TU7A 1T9XA 3PX4A 4CT9A 2PA3A 3L7PA 4K2JA 2LQJA 1WDTA 2V2VA 4IG3B 1BQNB 1WC6A 3DMJB 2PFDA 2XULA 3OTEA 2U2FA 5DZ6A 5L1KA 1WEYA 2UUBJ 4J9UE 2CKWA 4QR0A 2Y9HA 2A6MA 1UEUA 3UCUP 1HD0A 2HBRB 2Z2ZA 2F1FA 1VQLS 2QA1A 3U7JA 2FY1A 1CULB 4I67A 2HWHA 2DISA 3JTNA 3TJ9A 4EBEA 3MR7A 2AV5A 4AE5A 1N33J 4RNHA 2C2MB 1TKTA 4Z7YA 2DD8S 2H5JB 3HT0A 4L74A 1WDDA 4F25A 2EFPA 2ZH2A 1EKRA 3KG1A 1TFWA 5KFKA 4YHHF 3B54A 5IT9U 2MZ1A 4HL9A 2IMWP 2DGWA 1Z4UA 4NLWA 2XLJA 2X7IA 5H9FK 5F3TA 5A8KB 2MKHA 5E0OA 5KFLA 3CJ2A 3LAKA 1UWBA 2GVDB 3I0RB 3MAHA 2ZH7A 1IBKF 2DIUA 2HFOA 2DPIA 1NSKL 1X4BA 2VPXB 3QT8A 4FXWA 3J80U 3MTJA 3D7SB 1Q4RA 3Q86A 5HJXA 2QL7B 4OHZA 1SV5A 3H2VE 3M2UB 1V5VA 4O3OA 4DV7J 5HO4A 1HWJA 2CPIA 5A2QU 4ECYA 3DNCA 3DYAA 3QRPA 3UN3A 3OSNA 2VASA 3OTDA 2GIQA 4IDKA 3FBCA 3O2IA 3LALA 2Y1JA 2RD5C 1N5QA 2M9KA 3M8ZA 2A6OA 1LWFB 1OY8A 5KAKA 3DRPB 2DGVA 2R7UA 1FWPA 1JB0C 3FEXB 3EGZA 5HMZA 1ZZNA 1WTFA 2R7QA 5I4MA 3MOJB 3F73A 1LFWA 4TQSA 1AT1B 3C46A 3T5JA 4EBCA 4HR2A 2GQ2A 3ZZOA 4R8UB 2DR8A 4ZHRA 4OJ3A 5KT2A 4FPRA 2EKNA 2UUBF 3MFIA 1NK4A 4K5RA 3OR2A 4JI6J 1N0VC 3U1NA 4OJGA 4DZ6A 3AJDA 5ETKA 2KB2A 2XSJB 3RR7A 3O3LA 1TELA 2ZNYA 1YZ6A 4G6VB 2XCPA 4OYMA 3H2UB 3O44A 1MROA 4RW9B 5AE2A 5GAHI 4FVCA 3DGPA 2UXDF 4I2PA 1SCJB 4K0KF 2QFIA 3OFGA 3TZWA 2ZJQQ 2VQEF 1NJWA 3GCXP 3T6JA 2KXNB 4LFCF 2SXLA 3O1LA 5C2CA 3P49B 1S1XB 1VJQA 3HJVA 1BY9A 4YR3A 3GQCA 1PO6A 4C0HA 2DHAA 2QIFA 3CPWR 2JC0A 1IJFB 3F0NA 3HVTB 1HBUB 4Q7AA 3LF0A 5MAOA 3MMBA 4C3KA 3EGVA 4YB7A 1PC5A 3MTKA 4J9VA 4F0KA 2H3EB 4DS4A 1F9EB 3UVJB 3OTOF 1N5YA 1WEZA 3OL8A 2OPRA 4WP8A 3PR5B 2FLPA 2FLLA 2CQCA 4MT1A 1X4DA 2G0JA 3MD3A 3VAKA 4YR0A 4DFMA 1QM9A 4RPFA 1YLXA 3RB4A 3NRBA 4M5DB 5KFGA 3MR5A 1DLOB 3EWGA 4NA3A 3MAQA 3CXCR 4XAKA 1OQ6A 1VQ8S 4MYTA 3GIMA 3LH2S 3H40A 1RWVB 2UUAJ 3G87A 2WB4A 3V6JA 1RTHA 1U24A 2DNMA 3R8YA 3LP0B 3J81Y 4JI2J 4ILRA 1LWXA 1YBUA 1T02A 1GMWA 4BWJA 4NL5A 3L3CA 2DXFA 4ZA1A 4QWDA 1M90T 1HWKA 3A8IA 4QBUA 5E3CA 3OVBA 5EN1A 1MU2B 3AY0A 2W9BA 2CNOB 1VIOA 1XK8A 2MZTA 1O8BA 2W1BA 2I5JA 2I9SA 4ZCMA 3D6FB 3PIOQ 4DQSA 1IKWA 2X51A 2XMWA 4JI7F 2VOPA 3CVKA 2XMTA 1TTHB 1K44A 3NEKA 1DTQA 3S6EA 3ELHA 2HYIB 4XDDA 2EG1A 1TMMA 1U45A 2QEXS 3HVTA 3T9ZA 5I3UA 4M5GA 4G3IA 3NXZA 1X5PA 2MQOA 1RT5B 3C6UB 4DS5A 2IJNA 3DOMB 3KK3B 1A9NB 3HI9A 4Y3CA 2ZVSA 4K4TA 4NLPA 1IKYB 3I4PA 1SXLA 5BYSA 3KLEA 2VODA 4OYBA 2DY9A 1RT7B 3CCWA 3EZOA 4F0MA 4OX9J 3X1LB 2HURA 2V2KA 3GJQB 2F9JA 2HFNA 5CYJA 2CZ9A 5KG2A 2D3O1 4FXDA 4FS2A 1H72C 3CCJS 2ZH4A 2J8AA 5IV4A 2QFJA 2G13A 2JLEA 2K3IA 2VKZG 4USUA 4X64J 2ZZMA 4K7QA 4JI8J 2ALZA 1GQEA 1FWLA 2AU0A 2R8GA 1WOSA 1S12A 2B9EA 5C24A 3FRYA 3KYLA 2ZE2A 1FT8A 1K1QA 3WIVA 1SC3B 3C16A 3QWPA 4TU8A 5J1PA 4PRFA 5DG7A 3KLFB 4DV2J 4BBYA 1JXVA 5CHCB 1X4AA 3GJSB 1GT8A 4ZP7A 1OO0B 2I0XA 3EVOA 5ADZA 1JJHA 4ZITA 4XPCA 4DSEA 2ROGA 1RT5A 2CJQA 2V68A 4RU9A 3RR8A 4ER8A 1RT1A 5ETOA 2PI5A 1X7VA 2E5JA 3OV7A 2XS7A 2LEAA 2HGLA 3FBFA 2WSCC 3O6QA 3JSYA 4CLLA 2XC9A 1TR0A 2UXBF 4PYDA 1Z2ZA 2IVMA 2YNGB 5AJ3J 4QWEA 4DV4J 3UO0A 5D4LA 4DCPB 2LQBA 2I5JB 3MPUB 3GJRB 1RLDA 2CNLB 3WIUA 1VRTB 5HMWA 5D78A 1JMTA 1RSCA 3FBBA 4PWDB 1V3RA 1U1NA 2AJ0A 1PJ7A 4ED2A 2GQQA 3D6MB 4TLQA 4MKYA 2W24A 1HHSA 4KV8A 1RT1B 3PV8A 1F2HA 2OTJS 2W2OP 1ZAXA 3KHHA 5HAOA 1HMVA 1ROFA 4GC6A 2UU9F 2B5JB 1B4SA 3HSGA 1OSCA 1TZ0A 1WC5A 3FGVA 1OSDA 4HACA 1YI2S 1DURA 4CCHA 1RWOB 2EW9A 2BXJA 3RGIA 1UKUA 2CNNB 3QNWB 3DLBA 2XY5A 5KFOA 2NXEA 3HHLD 4IQMA 4DV7F 1RAFB 1VOMA 1EP4A 2DBBA 3AXKA 4B3MF 4M5MA 3C14A 5IV3A 3DRRA 2WSFC 3SCKE 3EZUA 2YNIA 4OHXA 4C8MA 3ZZRA 4A8SA 5T41A 2DGQA 1YJWS 3CD6S 2CPDA 3DOLA 3E01B 4MIAA 3NCRA 4O23A 3V81A 4ITSA 3IFEA 4CTAA 1UFKA 4DV6J 1RHQB 3TAMB 2X1FA 3GP9A 3UDCA 1RYRA 3Q2TC 1S1XA 5KOWA 2MGZB 4RW8A 1RBAA 2HNZB 1S57A 2BX6A 5AXMA 3MGJA 1KR4A 4O4GA 5E3QA 2Z4PA 3FCHA 3W61A 3KUEA 4DL3A 3ONQA 1O51A 4Z37A 4LREA 2V8GA 4C11B 4GO7X 2RRNA 4FF4A 3TZXA 1WOOA 2CAJA 4RLEA 5FDLB 1SH0A 2RQ4A 3KLHB 2HZVA 3IA0A 3W9IA 5LXRA 2FJAB 2QLXA 4WP3A 4C98A 5GAHU 1U49A 1HW9A 4EEYA 2OPPA 1U6BA 1REVB 1TL3B 1XJWB 2P2CB 3L4BC 1OYEA 4I56A 2W8LA 5B0DA 1MWZA 1J5OB 3NGKA 5D4PA 1YTYA 1EQMA 1MWQA 5F41A 3ITHB 1PGZA 1AZSA 5C5JA 1R0CB 1Y7PA 4K4XA 1CLFA 4BDPA 2UXCJ 2VOOA 2AHOB 4PQUA 4LRAA 5IT0A 2W7OA 3FC9A 3ZTOA 3HSDA 3FMBA 4AUKA 2DVIA 2HFSA 3KDNA 1X4GA 4KTQA 2LECA 5DS7A 2NREA 3ULHA 1O5JA 4DL2A 3QJLA 1HBMA 1CEZA 4CQ1A 4TY8A 1NEEA 4ENOA 4IH6A 3Q0AA 3MEDB 1KNZA 1UA1A 1NHKL 1RABB 5F8LA 6AT1B 2RDIA 3QAUA 2WK4A 3C15A 4X4QA 2J9EA 1S1TA 3R27A 1K73T 1S76D 1HI8A 1O0PA 4IYQA 2IDLA 4ES2A 2QA4G 4DV3F 1U47A 1JIHA 2PA8D 3G8TA 1U1PA 3TQEA 5LXYA 5DDOC 3J7A1 1NK6A 4ZDNA 4TKTA 4Y2CA 2FHJA 4XK8C 3AOBA 4NE9C 4DV0J 1PKUA 1Y00A 3SMZA 2AYBA 1FESA 1WEXA 1SJ3P 1M5VC 4CTAB 3PHEA 2DNGA 4C8NA 4U6PA 4LF6F 1FDNA 2AX0A 4Q8EA 2HS3A 3BSOA 4RW8B 5BR8J 5GAGI 2HFZA 3B4MA 1FCAA 5KFQA 5DQHA 4C8KA 1N32F 2KVQE 5IT9Y 4J9RA 2EBGA 2C2KB 4OIXA 2UVVA 4RNNA 4TLRA 4AXIA 5KT3A 2CJKA 1UVIA 2AEFA 4TNOA 2HSEB 2DNRA 4X62J 5FLXU 4DR1J 2YWFA 3ENAA 4IOCQ 3HDSA 1HL6A 3LP1A 2YNFA 3PTWA 2UU9J 1KOOA 1P9YA 1U8WA 4HI1A 1KVIA 2V94A 4A47A 2BM1A 3J7YU 4FKYA 3MMAB 2L41A 3FUYA 3M32B 1REGX 1LWEA 1JLGA 4CLUA 1S4FA 1Z1ZA 2O66A 3GSIA 3BSCA 4L3NA 2VBZA 4CLZA 1QAJA 1WF1A 2KZZA 4FYYB 1UPPA 2CQBA 4YDXA 1YRUA 4IFYA 1RGVA 3KNAA 4EK2A 2KZMA 1UVNA 4NYPA 3IS9A 1WSVA 8AT1B 3KJVB 3TUJC 3QBCA 3K89A 2KDOA 3DLHA 3QZ8A 3AFGA 3BV8A 1T9YA 1WKJA 1VBZA 2X3DA 3S01A 2FHMA 2OPQA 1SKRA 4C0BA 2UUTA 2KJWA 3M6VA 4EO6A 1G6BA 4R0EA 4QR2A 5H9FJ 5SZTA 4WCEQ 2GHPA 1WD6A 4OLOA 2PC6A 3M2UA 4RW4B 3R5GA 4NA1A 2E29A 4OYZA 4B9MA 1C1BB 3M9OB 1R8BA 1VLYA 2IVYA 5B08A 1XMQJ 4ICLA 4P2FA 3J7YI 1UWBB 2POKA 4ECRA 1KRPA 1NM2A 1VRUB 5B0BA 1VQSA 2FTRA 3OT9A 5A8KA 3P5BP 3VZHA 5C25A 1EB0A 3GZ7A 1HIYA 2XYHB 4ECZA 5D4OA 5HQLA 2A2CA 4OYAA 3IAS9 2AP6A 3ET6A 4KC5A 2M5YA 2QTWA 1FXRA 2Y8YA 4YEAA 4J9NA 3IXQA 2I38A 3P6YC 1K0VA 2K06A 3C14B 2VF3A 5A0YA 3BGUA 3TAMA 4D3GA 1FD8A 2RS8A 4ZJQA 3KLHA 4IO9Q 1HNXJ 1HBNA 5KTQA 1SC6A 5F8IA 2CPZA 4ES3A 4R5PA 2W8KA 2ZEJA 1SKUB 2HIQA 1SJQA 2ZJRQ 2KXHA 5D0GA 3IC1A 3OTCA 3EICA 3R5AA 4KRWA 5K8NA 1VC0A 2CPXA 1JLEB 2YWKA 2DY1A 1KQKA 3NNAA 4PAAA 2JL9A 3E01A 3G2XA 3VF0B 4KHRA 1JNRB 4PZVA 3KK1A 2CXEA 3W2VA 3CIZA 3NOCA 3THTA 4P10A 5KG0A 3NNHA 3JQMA 1NUEA 4AQYJ 5ETMA 4KFBA 3W8GA 2R7WA 2HAIA 2Y1IA 4P6QA 5CYMA 1U6FA 3LGHA 4FP9A 5KFEA 4LUBA 2YWEA 1VQ4S 5C7PA 5M2UA 3PFEA 3MM9A 3TX8A 5CAAA 1IJEB 1FFSB 2IFXA 1VMBA 3NS6A 3QGIA 4OZ5A 3RBZA 1QAYA 3BGOP 3D1HA 4CO4A 3OTOJ 2LEBA 2N3LA 4USKA 3RAMA 4LR8A 3T6BA 4OQJA 2XY6A 3KLIB 3FKBA 2BE2B 1M0SA 1FKPA 1SPBP 2XEXA 3MEGA 3TYTA 4AXJA 4YFUA 3DM2B 2YNHB 4R0JA 2HS0A 1S9GB 1GTHA 2MPUA 3HZEA 5CH7B 5D3GB 4IRDA 3MM6A 4BWMA 2M2BA 3UN5A 2NXNA 4IH7A 5AXNA 3EPIA 2RRAA 2E1PA 2ZHOA 5CYMB 1UCNA 5DG8A 3LTOA 4WU3A 4ZP8A 5F3ZA 3P4UB 1NJIT 1NCLA 1RT4A 1ZM2A 3Q22A 3ISNC 2ASYA 2YKQA 2ZH1A 1JNZB 2QC3A 2UXDJ 1B0PA 3D6TB 4DJBA 1JLFB 2MQ8A 5HLFB 2ZH3A 1RA7A 2A3JA 2YNFB 4S0MA 1D0EA 3M2RA 2VFVA 1P6TA 4M5JA 1BWVA 5L1JA 1IBMJ 5L1IA 2WCXA 1T0TV 1VQPS 2JFKA 3CW2C 4WXOA 5ETLA 1RTIB 3ZTPA 5IQQA 4M1KA 3FQKA 1RBLA 1GX5A 3KK2A 2RQKA 4Z2XA 5D77A 4TVAB 3K0JA 4ETZA 2C1EB 2RRBA 2VFUA 2YKNB 3AA8A 2BJ3A 4LIRA 2C42A 2HVZA 1T9WA 1WC4A 3LA0A 4WTYA 4ZKAA 4UUXA 3CDEA 4F2RA 4MKAA 4ZLJA 1B3TA 4UY85 4WYWA 2J9CA 1KHVA 1RT6B 2CUYA 3L7OA 3NAHA 3QPIA 2MZQA 4GVBA 1QJHA 4KYZA 3VVUA 1R8HA 2I1RA 2XTJP 2O5DA 1TP7A 4UOFA 1FFGB 1HNZF 4XO0A 4ZHRB 3CJ8A 1GXUA 1JQGA 3LP2A 3ISZA 3OUYA 2ZBRA 4HHJA 5HVGA 4DSKA 2AX1A 2WBRA 2YKAA 4ZS6A 1XN9A 3DI6A 3LANA 3KFWX 4ZCLA 3W60A 2J76E 4KO0B 2D41A 4Q2LA 3M4XA 2PSZA 2GA7A 2YNHA 3BGFA 5GMEA 2M88A 3M1VA 5B09A 4U8VA 1U1KA 3JSMB 1FX4A 3KNGA 3U27A 5KFBA 1CJKA 1NPKA 1S5ZA 1JJ2R 3RW6A 4JI0J 1R6YA 3DYAB 2HAFA 4WE1B 1EARA 5KFDA 5E41A 2B6AB 2W7PA 3BEGB 3QT5A 2NS1B 2OI2A 1QLNA 1JJCB 4IFYB 1VQMS 3QT7A 2VQFJ 2VA2A 2MEWA 2M8DB 3R7SB 1UEVA 3EVWA 1LWFA 1Y9OA 3CD7A 1BXNA 1SUQA 3MEEA 5L9XA 4ED7A 3ADAC 3BN4A 3DDIA 4LF7J 2VJUA 5HP1B 3MM5B 3PX0A 3T3FA 2BKOA 2BJDA 4DU8A 2QL9B 3W5YA 2KHCA 2F9DA 1LW0A 1HR0F 2OGUA 3NS7B 4B3TF 5JJBA 2KG1A 3HP6A 4ED0A 1DLOA 2KRBA 2HMIB 5IM0A 4M94A 1H2UX 4GMKA 1LW2B 4LRBA 3MDFA 5K8OA 3K57A 1P1LA 1Q8LA 2J6TA 1JLEA 9RUBA 2HFUA 4Q43A 2XM3A 4LJMA 2WOMA 2YWWA 3Q8VA 4KO0A 2HGNA 3OXGA 3GIIA 4ILMA 5K14A 2D3OR 4Y28C 3MD1A 4RW6A 4JV1A 3PYGA 2WHOA 2A10A 4QW9A 4I2PB 1UZDA 1A6LA 3GJTB 2CQDA 2ZOGA 1BHNA 2JLFA 1Q5VA 5I3PA 4ZLPA 1JLAA 1NO8A 1ZA1B 2NR0A 1KKHA 3DRRB 3EVMA 3E8OA 3IR7B 5LSLA 4HH0A 3HM9A 1N56A 1X4HA 3DLGB 2C2OB 3G82B 2HGMA 3NS5A 3BO4A 4C8LA 3QIDA 4LBPA 3I6PA 5LSOA 1FFWB 3QAEA 2APOA 1NSPA 1MMNA 4ZVQB 1RADB 2HNYA 1VI7A 2FYXA 1IKYA 1C4AA 3H25A 3D68A 1HHTP 1RXOB 1F3VA 2XG8A 2MZJA 4RNMA 4MTPA 2DR7A 3IO1A 5E3AA 5IFMA 4HHUA 4I6WA 3CD5A 3W5XA 1N36F 1I5OB 1H38A 4QU6A 3T1YF 4RNOA 1RYSA 1S49A 3TAPA 4NXMF 1HNWJ 1UL3A 2OHDA 3D2WA 2AIRB 4CLPA 3H98A 3DN9A 1NJXA 4LFCJ 1RAJA 2PE8A 4NX9A 2BRKA 5G0RB 1JLFA 4J91A 2QRRA 5HLFA 4ZP9A 5DM6Q 1HQEA 3CJKA 3AODA 3N01A 2VFRA 3N28A 3RB0A 2BE2A 4LF4J 2V63A 2YKMA 1OY6A 2QSFA 2ZUAA 3PYDA 3J7Z5 1VQ9S 2EFGA 4FNHA 3MPYA 3UCGA 5E2QA 1UJ6A 4OI6A 5B0GA 4CLFA 5A6PA 4DFPA 4QOTA 2ZM6F 1WHWA 2FVRA 1JLBB 1YRXA 2B7BB 2IIHA 2V67A 1SC1B 2KT2A 3NWRA 2FZGB 2Y1RI 3R5JB 3TP2A 2P9EA 3KLGB 3HVRA 1DARA 4IFVB 1S9FA 1F5AA 1XMOF 1DBDA 1TL1A 3GYGA 4H4MB 4OX9F 2ZHAA 4WF9Q 2CZVC 1G2EA 2QYGA 1YSJA 3SZ2A 4FF2A 4DFKA 4B3RF 4LF4F 3GFYA 4AYBD 4KSEB 4P2XA 2G0CA 4ZLNA 4NLQA 4DV1J 3JB9k 1FDAA 4WIQA 3OHAA 2HLTA 1RTDB 1LQ9A 1RZMA 1YK9A 2N4CA 4B02A 3JQJA 3SSRA 2VDHA 1BQNA 2JVRA 2ZBIA 4YY3F 1XERA 1RT3A 3I5AA 4NLXA 1W2BR 1URRA 2R9LA 4Y2KA 1NK5A 2XWYA 2ZD1B 2HKEA 4PG6A 3D3BJ 4FF3A 3G8QA 4NPOA 1IR0A 2RQMA 2W01A 3M8QB 4OYPA 4M63A 5HK4A 4RNFA 4P73A 4X62F 3BS9A 2DXDA 4FN5A 4URQU 4DG1A 4HYKA 3HULA 4B9TA 1HBOA 2N7CA 1IQZA 2GW8A 2DHGA 1CULA 1NHVA 2ALYB 3D0IE 2LXFA 3N79A 3PYFA 4LRCA 2MQQA 1FRXA 2HBYB 2B8PA 1KD1T 3CCZA 4ECUA 1HI1A 2CDQA 2ILYA 2J0WA 4ZVSB 4F36A 5AE3A 1VC5A 1AA1B 1LEOA 3TR5A 3TI0A 1N54B 2F65A 3P3DA 3VQTA 1YGYA 1ZOTA 2ZD1A 3TVYA 5KG1A 3K59A 4FBUA 3EDRB 3IMQJ 7FD1A 3OFFA 4OYXA 4F3MA 1M5OC 1JJ4A 1VISA 5M2PA 2VUGA 3HX9A 4QYZJ 3IG1B 3P8BB 1Q8IA 2XYPB 4TYBA 5C42B 1WG5A 2RDDA 1F9HA 1QDUB 1NPRA 1SUQB 2XZWA 3MEEB 4WP9A 2HWTA 3WHIA 2GVZA 4KQZA 3TRGA 3CMES 4Y2AA 3K17A 1BQXA 4JI3J 2C3PA 2O67A 3M8SA 1FVSA 2XNRA 3D0HE 3I87A 4OHYA 3OHBA 2YH1A 1FJ7A 1T03A 2LP4A 4JI2F 1RA6A 3MCNA 4ATNA 4DPOA 3PIPQ 3NOGA 2XLIA 3HFVA 3C66A 1LOUA 3NCPA 2VA3A 3IM8A 2LQ8A 3VR1A 2DNQA 1HWIA 2HS4A 4RX6A 3GCWP 3IN5A 5EX3A 2R8JA 1NLKL 3OL6A 5HP1A 1S6OA 3CJ4A 2EC2A 4OYIA 4DV2F 2UUCF 1V5IB 3L7UA 4JI3F 1BWEA 3IGVA 1NH7A 1NSAA 3W62A 3OJSA 2VC0A 2R8HA 4ECTA 4HKQA 1K1SA 5KFMA 1NH8A 4KH0B 1F5CA 5HMYA 2FHOB 2MSTA 2FJWA 4OI2A 1U1MA 3MMJA 4XTTA 5DG9A 3PZPA 2J6SA 1YBTA 2DTJA 2H54B 2O01C 3Q8PB 3CCRS 2MLYA 2JEJA 1HBUA 1XR6A 1WHVA 4DX6A 2B8QA 1ELOA 2YTCA 4PR6A 3VGSA 3Q8SB 2CQHA 4CM0A 4DR7F 2HQIA 5GMKa 2CQ1A 3HHLB 3W7BA 3BQ2A 3KXDA 3P45B 4WJBA 2AWZA 1Y10A 3R7BB 4C3LA 2DYAA 1RACB 2LFVA 5K8PA 1HPZA 1KOHA 2CZ4A 4URGA 5CCLA 5LJ3Y 5C2GA 4C97A 3KTQA 1FEHA 4UOGA 2YBVA 2L3MA 4B3SF 2BA9A 1JLCA 3T1HJ 3ILOA 1J27A 2W2PP 2FC9A 3BR9A 3PR4A 3OXLA 1WTBA 2HQFA 5A0YB 2V5HG 4YR2A 3THVA 2ZFHA 1IVZA 3CCLS 5B0EA 4DPXA 4KH1B 3SIPB 3ZC4A 3V6DB 3ZFVA 4F67A 2Q43A 1U2FA 1S79A 2RT3A 2V9WA 3LO3A 3T5KA 1YJRA 3R5DA 4CNYA 4DI6A 1NDKA 3PRVA 4RW7A 5A8WA 2Z2MA 4F2SA 3KHRA 1R0BG 2GHWA 4FKXA 1U2CA 1UMJA 2AKWB 2M0GB 3ET6B 4JI0F 1H73A 2VG5B 3DOKB 2CYYA 1Y0HA 2ACYA 2VU5A 2CJBA 3DLEB 3QYYA 4QIVA 4DSFA 1UW9A 1S1TB 4K4VA 2J7UA 3FSXA 4KKOB 1KONA 3ILLA 3RRKA 1DTTA 5CD4H 1RTHB 2DK2A 2VPZB 1LK5A 3MCOA 4O3NA 2WONA 2DHHA 3VWSA 1F1BB 4F3QA 2M52A 2KM8B 3EPGA 1LXJA 4KV8B 7AT1B 2F63A 2HNDA 3SQGB 2HHHJ 4NLVA 3CJQA 2BJ8A 5HN0A 4B9UA 3THPA 5IC4B 3H4DA 2HIYA 4KAIA 2V69A 1J5EJ 1R89A 3CJ5A 3FRZA 3IRXB 1UJ5A 3CEDA 4DV5F 4ECQA 4LF8F 1SQFA 4X65J 1GMWD 2W9CB 1CJTB 2MLZA 1IWGA 2F8EX 3GFZA 5IQ6A 2BBEA 1DTTB 2HVDA 2XBPA 1U09A 3MM6B 3PHTA 2O1PA 3EXCX 4PQAA 2VL1A 1NZAA 1C0TB 3ENVA 3LP0A 3QFWA 4P7TA 2MKSA 3UNGC 1S1VA 3PXGa 1NDPA 3N6MA 4DV0F 2MTLA 1U0HB 2DNZA 4H54A 4USMA 3KLIA 3MEGB 1TV6B 4ED8A 2B9YA 2YQ3A 3UVJA 5KFTA 3BO2A 3B78A 3NAIA 2VQEJ 1VQ6S 4X4UA 2IYIA 3PJWA 4QIGA 1FXDA 4NYZA 2HHTA 2RILA 2YXLA 1RT7A 2CQ3A 2DIVA 3BM7A 2FLOA 3MMAA 1YHQS 1L5UA 3HFZB 4PWUA 3QZ7A 2ADBA 3V4IB 2JLGA 2E66A 3ISND 1PCAA 1RTJB 4QW8A 3IR6B 4NI2A 5KG6A 2FVPA 3OSPA 3C2PA 5CZXA 4DQQA 2OLWA 1S77D 2VJVA 3UDLA 1S6QB 3R3TA 3UR3C 2CPEA 3AD9C 4A48A 2L9WA 3P96A 4ZVFA 1IN0A 2DNPA 3UFCX 1XEZA 3CC2S 2AGOA 1AROP 3DLLQ 2HK2A 1GMUA 4KIAA 5B0CA 2KTQA 2G1DA 1XBWA 3PO4A 5IWAJ 4QPTA 3KG4A 2RDJA 2F8MA 4ECVA 4B9VA 4JI1F 2LVWA 2NXJA 4DR6F 1FERA 1WC1A 1NK7A 1N6QB 1V6HA 2Z2LA 3AOCA 4CO3A 1H7XA 4ES1A 4H4OA 4X84A 3KK2B 2DNHA 1C0TA 3KLVA 1MMLA 2EFOA 2GQCA 2KYZA 5D6GA 4OJ1A 2RB7A 4MFBA 3AAWB 3CCTA 4ZN1A 3H2LA 3OLAA 2LLZA 2JJ4D 2L48A 2QA2A 2OSRA 3IBFB 1X5SA 3LOUA 3M8PB 4I1TA 4ID8A 4LBIA 5HBMB 4NLGA 1FRMA 3W1YC 4Q5VA 3KOAA 4DX8H 3MEDA 1YG0A 2DXEA 4CP5A 3BQ1A 3DDKA 1BD6A 9ATCB 4JV0A 4DR5F 4ZPBA 2Z57B 3D3CJ 5IT4A 5DJBA 3NBPA 2OP5A 1FXLA 5HSPA 3UI3A 3PW7A 2XMJA 1CBKA 1WC3A 4DEZA 1R8AA 2YNGA 2KFZA 2W7AA 2R7OA 2FC8A 3W5ZA 1BMQB 3FQLA 1FRIA 2M3DA 4I0WA 4GKJF 3BN7A 1K47A 3PRBA 4IDKB 4YN3B 1OS5A 3FJ2A 3M8PA 4N5SA 4IOBA 3HVAA 4FYXB 2NPFA 3TVKA 5KFHA 5KFJA 5FLXY 4WYLA 2Q3PA 2VG7A 5C24B 2YPZA 1RT2A 4FZVA 3CIMA 2DGSA 3PDNA 2QE5A 4F4YA 2GX8A 5F9LA 2DR5A 1KDNA 4EI2A 2QLWA 3JSMA 4DLGA 4FF1A 2LYVA 1WKLA 3QLHA 4HTIA 2B4VA 1TKTB 4NCGA 4BC7A 3WBZA 1HNIA 3H7HB 1S6QA 2CPFA 1ZM3A 2HNZA 2QYCA 3K2YA 4RW7B 2WTFA 2VICA 1YDLA 3ZZZA 4A8WA 4RWWA 3RUBL 2F5GA 2J7WA 3N0VA 4LT6A 5KFIA 1JXEA 3HK2A 4HDHA 1PBUA 2UV8G 1VBYA 1QSLA 1XNQF 2DJWA 3C6TA 3GPAA 4HH1A 3GV7B 2AZ1A 2U1AA 5K14B 5L46A 1SJ1A 4QU7A 1OY9A 2ZM6J 2GCFA 5L1LA 1EP4B 1SQEA 2P5VA 2GGPB 4ZIVA 2MKJA 4C7QA 3PNIA 3OQ2A 1MG7A 1RAOA 4J9OA 1UA0A 2DGUA 1NKCA 2G2OA 2FD2A 4HACB 3BGRB 3IBCB 4UOCA 3FSIA 2RNEA 3AQOA 1BGXT 5BYQA 3M8YA 1KC8T 5EWGA 4QQBA 3PKYA 4NOHA 2QZ8A 2W9CA 1VGYA 2FHKA 2MHNA 2OMLA 2UV8A 3FEYB 2FJEB 5KT7A 4W92B 2ZH9A 4ECWA 1FHTA 4F26A 5DDPC 1RQ0A 3MUTP 4J9LA 2XZTB 4RW4A 4URSA 3QMQA 1RBOB 1RUSA 2QMWA 2EFNA 2WVDA 3RZAA 4K4SA 3BO3A 2MYFA 1N0UA 2FQQB 2BE9B 2D1CA 2VKRA 2ZZTA 4ID5B 2N4DA 4I2QA 4PG5A 5FIIA 1S99A 5CA5A 3RBEA 1B64A 2AJQA 3CCUS 3EGWB 4L3KA 3I31A 5KFZA 4UZBA 1U48A 4K59A 1H6KX 1NB2A 1XNRJ 4O3PA 3U02A 1SJ4P 4TY9A 2R4FA 1RT4B 2GAGC 1XQIA 2EKYA 3NY0A 3CJTA 1OPIA 1CJTA 4MJKA 4NZ7A 4OV6A 4TU9A 3QGHA 3SXLA 2C2EA 1S1WB 2DGTA 1WF2A 1QAXA 3EGNA 3JS9A 3H5YA 3FMWA 1SQGA 1H3DA 1EJ7L 1RKIA 3CT9A 3D6HB 4ECSA 1ZM9A 4FVMA 2R7SA 1XC9A 4ALZA 4EUVA 4LFAJ 2J0SD 3CDUA 3OD2A 2C2NA 4JI5F 3RAQA 1VFJA 2CPJA 2AYMA 1RAHB 3MPDA 4OZ3A 5J2NA 2E5IA 4QCLA 4EWTA 3IWNC 2HBZB 5J1EA 4I68A 5HROB 1N6QA 1Q16B 4I64A 3EXYA 4FYWB 1Q95G 1QVGR 4EO8A 1WHYA 3SV4A 2OD6A 1VDHA 1DQ8A 1Q53A 1U25A 1NK0A 2HLUA 2JWNA 2HEKA 3GWCA 4N76A 3KK1B 1Z2LA 1K0TA 4RUHA 1TK5A 2AT1B 1HNZJ 3J7ZT 4JUZA 1F2GA 3BPDA 1YBAA 3UDEA 4N56A 4O0IA 1G4CA 3UWTA 1RHMB 2KT5A 4N8NA 1IBLF 2AGQA 2ZBPA 5B7WA 3QRRA 1FRJA 3DHWC 1IR2A 1QUVA 2PEHA 2OFHX 3CC7S 3V81B 4F8RA 1S59A 1PC4A 4Q2MA 2GMLA 3T5LA 2F4FA 4RJVA 4BC9A 4RW6B 4Y00A 4ED3A 3CJRA 2Z2YB 3E3XA 3MOZA 3PW2A 2XHWA 1HHQA 4U7UK 4EYHB 4GRSA 4NXNF 2ZBCA 4X4PA 1PSDA 4USHA 3CO0P 3PJXA 2Y1LB 3KHLA 3ENWA 3IAM9 4DQIA 1U02A 1D8ZA 1SV5B 3DRPA 4FYVB 4J37A 3HD1A 5KT5A 2RF2B 1G3OA 1NMEB 2RHQB 2L9DA 2ZNZA 3DRSB 4OYWA 3SDEB 3IS9B 3WC2A 4C3MA 2EPIA 2F40A 2AF6A 5DLFA 1R7IA 2ZJPQ 3LWLA 2R7RA 2XI3A 3BSNA 3FDSA 4NZ0A 7FDRA 3ITHA 4PYAA 2E1RA 3GTYX 4Q0BA 2GV1A 1F5BA 5KFPA 2E5HA 2UUCJ 4OX7A 4M5IA 4L72B 2RF2A 3B6BA 3DRSA 4IO1A 5HJYA 3KMQA 1RHUB 1BQMA 4PPZA 4LMZA 4UQTA 2V50A 5LOQA 4JP8A 4I6YA 1F60B 4M95A 4P75A 2R7TA 3KJVA 3PKMA 2HNYB 5IXUA 4XDCA 4UF4A 2D74B 3PFOA 4CWBA 1CG2A 1B7YB 4K2XA 2VBXA 4WKYA 3ZZYA 3G8SA 3A1YG 5F9NA 3N6LA 1FDBA 4KGKA 4DQRA 1VS3A 2DB1A 3JXOA 2VIHA 3DGPB 1DRZA 3HSJA 3N5BA 5EDWA 1HR0J 2LEPA 3M30B 3QSYB 2MZSA 4GO5X 4ED1A 1TUGB 1HNIB 1I51B 4JI6F 2IY5B 2VPWB 3PCOB 1RAIB 5A8RB 1RP5A 1X9SA 1Y5IB 1FK9A 1S9EB 4PPDA 2R2SA 1GFWB 2M7SA 4PG7A 2AZ3A 1U4BA 4EZ6A 4K4UA 3K5MA 2MQPA 3TEHB 1T94A 3FK4A 3GYNA 3B82A 4IG0B 4CT8A 4QWAA 3M9MB 2B3TB 2P6TA 3BQ0A 3DFEA 2DPJA 3CGIA 1HNWF 2R7XA 3C6TB 2UVWA 4AFFA 4OI4A 1MNEA 4NWBA 5LSRA 3KLGA 4YOEA 4CLTA 8RUCA 3A3PB 2RKIA 2KJVA 1B7FA 2GHVC 4C8YA 1CC7A 2W9AA 4A4JA 2XYGB 3D54A 2RHSB 2OSQA 5LT5A 4F4WA 1TL4A 2AEMA 2W4PA 4Y65A 1S0OA 3G6YA 4DN0A 4O3RA 1UVKA 2LQ5A 2R42A 2IYGA 2DRBA 3BH6B 1HMVB 3VALA 5E3PA 3H5SA 4CDIA 2E7XA 1IQTA 3L09A 1S0NA 1EETA 5F0WA 4ID5A 4J9MA 5J2QA 1WNEA 1B0VA 4J9KA 4QYZK 1W25A 1APSA 3DHXA 4DR1F 1DTQB 3W9JA 3V6KA 2OEKA 1S1WA 2MKKA 4LSNB 2C28A 3TX0A 1KBRA 4OHWA 3G4SS 4B9LA 2GJ2A 4GKKJ 3BKTA 2W9BB 4DSIA 4G1PA 3QGGA 4AD6A 1VQOS 1IKXB 2EFVA 4USIA 1NHUA 3HMJG 2DNOA 3DXSX 3V4MA 4NASA 1SJRA 2HHVA 2A18A 2G1HA 3CSKA 3CMAS 2NUUG 1YIJS 2WVCA 4DL6A 1Y11A 2JFDA 1CJVA 4ED5A 2HHWA 2IRXA 2J0XA 4DL0C 2GO9A 4DUTA 1M5PC 2VG6A 1JLAB 2ZWPA 1KEKA 4ZPVR 5B0FA 3PW0A 4M8LA 4DR2J 1YRTA 3DU5A 1L3TA 2KO1A 2ZE2B 2BR0A 2BV3A 4LQ3A 3NGUA 2MJNA 2NCKL 1LFPA 2V34A 3CDWA 4Y0FA 2F4VJ 2WBMA 1TUWA 3U1MA 2HRYA 4NYOA 2GMJA 1TMJA 2K2PA 1TVRB 3EJMA 1T95A 3LQVA 4ZVEA 1CJUB 3A12A 1VQNS 3T19A 2COLA 3Q8RB 1FNXH 4NLRA 2FUG9 2KT3A 2VHGA 2XGQA 2KRRA 1I6JA 4JYAF 4G65A 4F02A 2XHCA 3VAGA 5F8JA 4KBIA 4B3MJ 3I5BA 3HHLC 3MM7A 3EUNA 4X65F 4RR5A 3H20A 2GAHC 1WSRA 2Z30B 2QO3A 1CQMA 4GVBB 4DL5A 4X4OA 2N82B 1AXQA 1B70B 3E2EA 1N5VA 5ETQA 3AT1B 3HHLA 1N36J 1S4EA 4ECXA 2E5LF 1T8EA 3JTOA 1BC6A 3AXMA 4U7CA 1X5OA 4DF4A 3RJMB 4DUZF 4WFXA 3HPOA 1ZS6A 2QJ3A 4DX7A 5DDRC 2W4DA 3AQPA 3CTRA 3BDPA 4ZVUB 2MSSA 4X4RA 2DEIA 3J80Y 3GONA 2BQRA 1DAXA 1NK9A 2Z0GA 2NQPA 3MXHP 3ETOA 1BQMB 3LPEA 4G1QA 4MAKA 5IC6B 1U1OA 2E9ZA 2GO8A 3SFUA 4CM2A 1N33F 2B9WA 4LSLB 2MQMA 1LNQA 4DQPA 2C3MA 4JV5F 2WSEC 2W25A 2ATCB 1KP6A 5BR8F 2ACMA 3BF4A 3GE9A 1XMOJ 4HHHA 4UY8T 2RU9A 4P2MA 2B6AA 2VC1A 2JOQA 2NUHA 2NSBA 1YJ9S 1SIZA 3HHNB 1X4EA 1N48A 1M1GA 1M1HA 2PI4A 1JLGB 3C8YA 3DRXA 4ZOSA 3US5A 3ZNUA 2MHEA 1FKOB 3NBPB 3ZTSA 4NLTA 5A76A 3GLJA 1ITPA 1Q81T 4HVZA 3PEHA 5T7LB 3WZ0A 3ZZ0A 2V4RA 5I42A 3VAFA 1M5KC 4V1Ak 4WFZA 5D3GA 4CLWA 2XS2A 1WF0A 2UUWA 2B4OA 1SH2A 3CCES 1RWXB 1UW4A 5THWA 1FRHA 2DH9A 1PAUB 4WPAA 3CCVS 4DR4F 3SCJE 4IUFA 1SB6A 5E3RA 1D9FA 1N88A 2MQLA 3M30A 2W2NP 3T1HF 3H59A 2UUAF 4PABA 2NYIA 1ZH5A 4Q8FA 3FCVA 2DNNA 4K4YA 4B3RJ 4E0DA 5DQIA 3ZXWA 3HHDA 3CCQS 2BZ2A 3SFGA 2HQ3A 3O8WA 2Q66A 2NZ4A 5L38A 1PAEX 1TKZA 2XB2D 3ILIA 3G6VA 4DR7J 1QE1B 1UFWA 1KLNA 4YY3J 1H2VZ 2IAJB 2FVCA 2PMHA 3KJQB 2X3GA 5KG7A 1GXLA 2CQ2A 1JWWA 1OMSA 1TL7B 2DHSA 4R8UA 2JVOA 1XMQF 2DNKA 2V2QA 4J7CA 2CVEA 4YUDA 3RRHA 1T3OA 3H5UA 3HKWA 3POTB 3Q2SC 3JYTB 2R8IA 2BQUA 5LMUJ 3H8YA 1OYDA 2C2ZB 5KFFA 2AJ2A 4X4VA 2GNKA 1UVLA 4LRFA 2E1CA 3BBFA 5IZHA 3HZGA 2F8HA 1S6PB 3OLBA 1J2VA 2G2YA 4DXLA 1EAYC 3DGVA 1IKVA 3HLUA 3K7RA 2GFFA 3Q8YA 1IKXA 4BLGA 4KJIA 3QO9B 2DRAA 2EG2A 4NLYA 3BR8A 3N9UC 4UT4A 1QY7A 2B56A 5I42B 1UPMB 4I2QB 1HBMB 2BOPA 3NKYA 1UAWA 4F0HA 1UZHA 2ILZA 1JKHA 1HQEB 2MY7A 3DLKB 3FVYA 5L8RC 2MXYA 3LWMA 2HMIA 5K20B 3SYZA 3LAMA 2G4BA 2OIHA 4CH0S 1VK8A 8ATCB 1SC4B 1LWCB 2BUNA 2DCLA 1S6PA 1FRKA 3DKDA 3RBDA 4YB1P 2GS8A 2E9RX 3IWLA 1GNKA 3M6WA 4YB5A 4JBCA 4USTA 3R97A 3TOQA 5LJ5Y 1TKXA 2BANB 3HHEA 4WIIA 1WG1A 2ZWOA 1S97A 1WJ9A 3I5CA 4KPCA 4PCQA 3J81U 4TQRA 1P1TA 4UZCA 3W2WA 3W66A 1IM6A 4F4ZA 1S0MA 5D8HB 1A0OB 2H9ZA 5ETSA 3G9CA 5KFAA 4I7FB 4NMLA 2IC3B 1VC6A 2AEJA 3V6DA 1KWMA 1HBNB 2YX4A 1D8YA 5KG3A 1S7HA 3D4JA 4DV3J 4UOHA 4NCBA 1TVRA 4DOZA 2HHQA 4DPYA 1MMDA 3RU0A 3NGRA 3T41A 4PXDA 3JAMU 4C8ZA 3M32A 1VBKA 1Y5LB 1VHFA 4HDGA 4JI8F 3KLEB 1GEHA 2K1RA 1RT3B 3DMJA 1KTVA 4M5LA 3W2WB 4DG1B 4LF6J 3IP0A 4OYOA 3OXFA 4ZCIA 5HMXA 4DWIA 2BJ1A 1FF2A 4B3OA 1EKSA 1C0UA 2FVSA 5F8MA 1RTDA 1PYTA 5FJ4A 4L76A 2H1YA 3CJ0A 1Q8BA 1WHXA 4YS2A 4X2BA 3OL7A 2JEGA 1S1UB 2LKZA 2W2MP 2ZC4A 3JSRA 3UNYA 2N3OA 1X0FA 2B7CB 4ELTA 1I94F 1C1CB 2BQ3A 1R43A 2QGFB 5ETPA 4D3HA 5L9NA 5J2PA 2XCAA 3TANA 2Y0BB 2JNJA 2OEMA 3GR0A 4O4RA 4DPTA 2YVSA 1W26A 2VG7B 4ZK7M 1QSYA 3F56A 2OEJA 3IRXA 1FJCA 2RU3A 3KMSA 1FX2A 3SCIE 1Q5YA 2JEIA 4JI5J 1XMBA 3CCSS 1SJFA 1VQKS 4DR6J 3ZNJ1 4R25A 3GFXA 4DL4A 2KKHA 3PEJA 2BVZA 4RBTA 4LR7A 1I94J 1SIWB 2IBOA 4ICLB 4XPEA 3NWGA 3OW2R 4OI3A 1LWCA 5EWEA 3A3OB 4KY3A 1SL1A 2QG9B 3HKZD 3OTBA 2CJXB 3D1QA 1IM4A 1RCOB 3HF5A 4G1QB 3ZZPA 1UP1A 2C2DA 2DNYA 5D0RA 3I9V9 1K8AT 2QN6B 1WELA 2ADCA 2BMBA 4P74A 4CLKA 3OBIA 1NU4A 5L39A 2OJ3A 2Z56B 4OZ2A 4DX5A 1S0VA 2CQ4A 4M5HA 1U0SA 2HVHA 5LL6d 1C2PA 3PG9A 5BYRA 3H0PA 3IG1A 3AJ1A 4FXVA 3NMRA 2DR9A 2OPSB 1TFYA 1HWUA 1EZZB 1WOPA 2GVZB 5A2QY 1NAQA 2DRDA 2YX1A 3I9ZA 2ABYA 2LMIA 4ZPDA 4CLYA 5G0RA 3R1HA 1S7IA 3K5LA 2Z58B 4DFJA 3X3UA 2CIMA 4HT5A 3C3LA 3CULA 2HQGA 2NZCA 3N4WA 2H5IB 3POTA 1QE1A 4FPIA 2E5GA 2HHHF 3CWJA 4B3OB 3W2VB 2ZZNA 1FKAF 1JX4A 1KN6A 2EVZA 2OFGX 3EYZA 3L95X 2PIIA 3PRDA 1IBKJ 4GKKF 3DOLB 4LF2A 4A8MP 5IM0B 2V9KA 4ZMMA 2ROPA 2YNIB 1YZ7A 3LGNA 2IA0A 2NYHA 3QSIA 3R9LA 4ZPWR 5J2NB 1L3VA 1VQ5S 4E98A 5KFCA 4C9DA 3O5TB 2PD1A 5IS2A 3MECB 3C6UA 5F0UA 5LM7E 3MCMA 3MMCA 3QIPB 3R5CA 5D15A 2AJ1A 4B3TJ 2DR6A 2FY8A 5DLGA 2K3KA 1YJUA 1OIAA 2FGOA 1TKXB 2BANA 3BB5A 2FJBB 3MF5A 5DO2A 2BKNA 3TW0A 2Y8WA 3TUPA 1FNOA 4LBHA 4A8KA 3GFHA 1H0HB 2C3YA 1Q8KA 2JSXA 4A8FA 1RLCL 3AB4B 5J2MA 3GU0A 3TAQA 3GG1A 2B9XA 4LIWA 2IPOB 2XO7A 3SQGA 4J9PA 4NXNJ 1MSWD 1KHWA 5J2QB 1TL5A 4OL8A 2CJAA 1R8PA 4FS1A 3TVZA 3MR6A 4DR3J 3ETMA 2ZUGA 3D1OA 5FDLA 3I32A 1YJTA 1QTNB 2HNDB 1VRTA 3BSAA 4HLBA 4E2FB 2MMYA 4AQYF 2FHJD 4PQUB 2OPPB 3N5FA 2E7WA 4M5NA 4NRTA 4RUBA 1YQHA 1U8SA 4EMDA 3G82A 1DY3A 4PEOA 1KQFB 4OZJA 2GIRA 4DPUA 2OTLS 2F4VF 2E9TA 3SSQA 3RBXA 2XMVA 3T1YJ 4NXMJ 2D69A 1KQGB 4Y34A 5KFVA 4KGVB 2ZC3A 2IDEA 2GIFA 3PO5A 3ENQA 2DH8A 4UUWA 4O44A 3M9NB 3VQSA 2HHXA 3TA2A 4U96A 4OZNA 3IWXA 1RT6A 1X31C 3HHKA 3LP2B 1M1KT 3Q23A 5J2PB 1RHRB 4B9SA 3CDAA 1CPZA 3W8PA 4ZJLA 1NRKA 2D3ZA 3AH6A 4A8YA 4P71A 4FYDA 1ULRA 2FB0A 1N5TA 3AB2B 2QLFB 1EQ0A 2C3OA 4LVNP 1HPZB 1CJVB 2KXFA 4TYAA 4DF8A 1U0HA 2OD4A 4O44B 4H4KA 5KOXA 1Y4ZB 1UVMA 2HZCA 3NCQA 2WVFA 2J0QD 4ERDA 4N47A 2C3UA 1RAAB 2QV6A 1SL2A 1KLMB 3QQCD 4N77A 2IBKA 2J9DE 3BREA 2BRLA 3M8QA 4OZ1A 5LMNF 1RT2B 5B0AA 1T3NA 2XZDB 1Q86T 1PBAA 2HRTA 3JAMY 2F7VA 3KG0A 4X66J 5HQ8A 5I3UB 1T9TA 1Y5NB 1X8DA 2LXIA 5IOLA 2AQ4A 1QUPA 2DNLA 3VHQA 4DR3F 5J2MB 2V8DA 4KE5A 3T1AA 5DGBA 1U6ZA 4KHPF 2W4CA 4WKRA 1ZBTA 2WRMA 3GSDA 1WORA 1MU2A 3ZTRA 5T14A 1FTCA 1CC8A 2F3JA 3NP5A 1YKWA 2I6WA 4KR0B 3SEOA 2BACA 1RWWB 1YJVA 4F04B 4YMEA 5ETNA 1PJ5A 2Q79A 3A4TA 3VAMA 1ZYQA 1RWPB 1NKBA 4DUYF 3DRYA 2BE7D 4ZVOB 4CH7A 5CABA 2DGXA 1FJGF 3A8JA 3MM8A 5BXIA 2BYCA 2K7KA 4MFBB 4OHVA 2CG4A 5HATA 5A8WB 2FJXA 3ILJA 2ZBQA 2CWKA 1H98A 2GJFA 1LXNA 4RL1A 5D0EA 4QIEA 3GIJA 1RWNB 2WZ1A 2ZDPA 2YWHA 4N7TA 3D28A 3JTPA 3LGMA 2CPYA 3MMCB 2JZ5A 4EGLA 1NK8A 2RJZA 4LFBF 2GVDA 3I0RA 5GAGU 2I8EA 2AGPA 3Q24A 4IKAA 4KKOA 3MMBB 4ANEA 1AUSL 3VGTA 4DV1F 4WBFA 3I56S 2BABA 5F8GA 2V4JA 5I3QA 1URNA 1WI6A 2XWXA 3TARA 1N5YB 1PG5B 3FSYA 2P9GA 2VDIA 3HFKA 2IM3A 4MH8A 3GV5B 3K58A 1VCTA 5EGYA 1LKZA 2FDNA 2BJEA 2YQ0A 3FZBA 1Q1KA 3VGUA 1IBLJ 4NCGB 4NRUA 2UP1A 4CO0A 3IRWP 1XNRF 2FGCA 2JHEA 4R5PB 4RWXA 1TU0B 1ZPVA 3HD2A 2V8PA 1FDDA 3SV3A 4YQWA 2FZKB 3Q83A 3R6LB 3VTIA 2V8VA 3BYPA 5LMUF 3TQ1A 1S72S 4DPWA 2EI5A 1NB7A 1D9DA 2FVQA 2BDPA 3GYXB 3S1TA 1FO1A 4RO0A 4ZVRB 3EDQB 1E6VB 4A8OA 5KFNA 1MWYA 2VB6A 2VV5A 3DU6A 3HVWA 3KJFB 2VQFF 4F50A 3ICLA 4TXSA 4CO2A 3T5HA 2HHUA 2CJYB 1CJUA 5GAEI 2MKYA 1R27B 3KKFA 3F44A 1UFLA 2BKPA 3IM9A 2H65B 3SSSA 2HFVA 2QA4S 2HPUA 4IFVA 2KL8A 3CF5Q 1FEEA 1RCXB 5EUHA 1Y3KA 4KT0C 5H1SV 3Q8QB 1AZSB 2IJFA 1FJGJ 2VG6B 4IH5A 1N34F 2VZ9A 2CFXA 1F6TA 1TL1B 4H4MA 2LA4A 2UXCF 3GB0A 5KFYA 1IKWB 2HQCA 2JRSA 2GC8A 1KTQA 1R3NA 2CJ9A 5AT1B 4J9SA 3R2DJ 4HT7A 1QSSA 2MKCA 4CIOA 3PY8A 4DCOB 2LXUA 5KT4A 3A13A 2IMOA 3G86A 4C6AA 4JV5J 4CYUA 1IBMF 1PJ6A 3BDEA 3SI8A 5GADI 4QR1A 3R1LA 2YWGA 3VAJA 4LF9F 4ELVA 3RTVA 4KGMA 3TA1A 3TNVA 2XQCA 2X1AA 2AYGA 4J5OA 3P5TL 4MK7A 1KSPA 3GILA 2XLKA 1I3OB 3AOAA 1I1GA 2J5AA 5KFXA 1K9MT 4Q45A 2CADA 3SQOP 2D7SA 5HBMA 3NMAA 3AD8C 2E7VA 1B99A 2R2UA 3OPKA 2EK6A 3QFHA 5E33A 2FZCB 2OMOA 3OFHA 4PG4A 4ZVPB 3K8VA 1NNDA 4OV1A 4IR9A 4JV2A 4DL7A 5J1NA 2PN6A 4DN9A 3G96A 2AD9A 1SKSA 2PMZD 4AL5A 3A3NB 4LQ9A 1U1RA 1RHJB 2ZKTA 1XWLA 1D3WA 1Q78A 1Q0NA 2R3VA 2MZRA 3S7RA 3UDVA 5ITHA 2ZITA 4USJC 1HWLA 2C2RA 2NXUA 4AT1B 1RTIA 2DEJA 4DR2F 2OH2A 1V3ZA 2NLWA 4P72A 1FI4A 1S48A 4UTGA 3OR2B 4WFAQ 1UTAA 4DUZJ 1H2TZ 2HRUA 4PXCA 4CNZA 3UN2A 1MN7A 4BHQA 4NA2A 3MM8B 3ZTQA 2VBYA 1WUUA 2QSWA 3DOMA 5KG4A 3KK3A 1HI0P 4KHMA 4LF7F 1XR5A 3FBEA 2V0NA 3DXBA 2IRYA 3TZZA 3D67A 5A6WA 4CO5A 5K5MA 1C1BA 2CPHA 4RZRA 2G0IA 2B4PA 1RKJA 1NSQA 2RVJA 2ZVIA 4DSJA 3KWMA 2IM2A 4JI7J 2O3DA 2ZOMA 4RKUC 5RUBA 3MZIA 3NLCA 4W98A 2XS5A 2WB1D 5DETA 1N8RT 5GMDA 1SKWA 2MB0B 3RB6A 2OAUA 3TUIC 4WE1A 2ROEA 2YQ1A 3KLFA 3BBCA 3V2UC 3MR2A 1ZAVA 1ZA2B 4MIWA 4L6V3 3D9BA 2FPHX 2KFYA 3EMTA 2LA6A 1ZTWA 4K4ZA 4ZP6A 1AFIA 3OR1A 3CUNA 4IRKA 5M2RA 4IRCA 4LR9A 3KHGA 2FJVA 4M5DA 1C1CA 5GVQA 2XY7A 1CVJA 2X1BA 2IJRA 4EYIB 1MN9A 4PWWA 3ZZUA 1T9UA 1JXLA 3CCMS 1U2RA 2HZAA 1ACMB 2IAJA 1YVFA 2WAQD 3DDNA 1Q79A 4O4GB 4OX6A 3CB4A 4CI0B 1Q82T 4Y2MA 3VAIA 3W9HA 3M8WA 1F9FA 3ZO7A 1GX6A 4H4OB 2H4YB 2BEFA 2B51A 1IUJA 5EWFA 1E6VA 1JLCB 3CE8A 2VG5A 3QT6A 2B43A 2Q6BA 3MAAB 3HXMA 3CJ3A 3KDOA 2ASDA 1LV5A 1S10A 1VLOA 1OQ3A 3RYLA 2CG8A 4NLDA 1TK0A 3RRGA 3B8HA 2CQGA 1YX2A 4DUYJ 2EC0A 3MHYA 4X4NA 4ELUA 2HW3A 4IG0A 1GH8A 1T9VA 3I82A 3G6XA 3CMQA 3VGVA 4LF1A 1MROB 2DO0A 2QX0A 2V4JB 2ZHBA 2E44A 2PT0A 3HJFA 1OJ4A 3VV2B 4C2MA 4QZVB 2V8HA 3TO8A 3ZZTA 2CQPA 1Q7LB 2JX2A 2Q6CA 4MK8A 4ZVHA 3M6XA 4ZJOA 3RW7A 2EBEA 2XMKA 2IC3A 4F3OA 3RB3A 4ANDA 2HVEA 5DGAA 3G6ES 4WU2A 1RTZA 1NZ8A 3J7AN 2DH7A 1X4FA 2KI2A 1R0AA 1HLWA 3IR5B 2OKQA 4C0OC 1B0TA 3MCSA 1EIYB 2HWIA 2W2QP 4KPYA 1S1VB 1ZPWX 5J1EB 5HROA 1AUDA 4YDDB 2CNKB 4K4WA 1FKOA 1NJZA 1ZM4A 2M70A 2PGCA 2YPYA 4A8QA 3PJ9A 1FTRA 2P6SA 2YY3A 3PVXA 2H4WB 4ZCKA 2E5LJ 4TY8B 1UEKA 3J81j 1CJKB 3KUGA 5U47A 3FEZA 3L9ZA 3BBBA 3H42A 3OR1B 2H5EA 3TUZC 4GC7A 1NPPA 2H48B 3H90A 4OJHA 5GAEU 4KGZB 2ZH6A 1AFJA 1RAGB 4ETXA 3LPYA 4MMOA 4LSNA 1R0AB 3M8RA 1IBCB 2KU7A 2RE1A 4B08A 1L3SA 2R8KA 3DI6B 2RQCA 4C11A 2YKMB 4MYUA 3A8KA 1X0PA 1U7LA 2FJDB 4PG8A 2XMAA 3CD0A 5F8NA 3CJKB 1VR6A 2LDIA 2OPRB 2RUGA 4K5SA 3GIRA 4Y2IA 4ZPCA 3VVTA 4DCJB 3BJYA 5CXTA 1HNVB 4OLPA 3VCDA 3G71S 1DZ5A 4NMXA 3AJ2A 4B9NA 2G2ZA 2QT7A 5JXSA 4U8YA 3MM7B 1GAOA 2XGPA 3GG0A 4DSLA 4O3QA 4DBQA 5E5NA 1EX8A 4NCAA 1KFDA 3MPVA 3K5NA 1RHKB 4LSZB 4X64F 2R7VA 5EX0A 1IWAA 2V4QA 4K50A 3I4HX 1D9AA 3NGTA 5HVFA 4K0KJ 4WZQA 4XIUA 1ZTTA 2XNQA 2R2TA 4ZIWA 1PYOB 4EU0A 1AB8A 4ED6A 5K9FA 2K1RB 3W65A 3K5PA 1PYSB 4DMZA 1HNXF 3WC0A 3W3SA 1HW8A 2Q1LA 4MKBA 2RS2A 2B4UA 3EE3A 4CLSA 1P27B 3I96A 3SBMA 4LF9J 1VYAA 5HVHA 1L3UA 1RISA 2QMUB 3LP1B 3EZ5A
chains in the Genus database with same CATH topology
2A1BA 2CVIA 2OPSA 4QWCA 4N8OA 1J5EF 1CSJA 4DV6F 4HTJA 2HVIA 2YKPA 5KT6A 2VQFF 1HFEL 1LW2A 2EWHA 2KN4A 3K5OA 5CCMA 4QJVA 4X66F 2ZDOA 3PW4A 1HYSA 2XMMA 4WZMA 1SH3A 1OWXA 5T7LA 1VRUA 1QVFR 2LQ9A 2LU2A 4C8OA 2IRUA 2RMLA 5AXKA 3UPFA 4ZPTR 3IBWA 4Q44A 4FNIA 4EFAC 1Y3JA 2X1GA 3A8EA 3M2VA 5DQGA 1DQ9A 4RBVA 3N6NA 4NLSA 3GIKA 2VH7A 3MR3A 2PFFB 1FE0A 2LDYA 5G4DA 1REVA 1TL3A 1A7GE 3GMGA 3FNNA 1EETB 3UR0A 2GMHA 2UZAA 3PX6A 4LSLA 4J9QA 4W90B 1VJWA 2LCWA 3B4DA 3DLJA 3IGNA 5FD1A 4EBDA 2RSQA 1TAUA 1U1LA 2NPIA 3K8WA 1T05B 2Z8QA 4JI4F 2GGPA 2RKIB 1IXKA 1P8GA 2E1AA 4PXBA 3MI7X 2AYEA 1TKZB 1TQLA 1X5TA 2AJFE 4PUOA 4A46A 1JK9B 2MDAA 1V9OA 4DV4F 2B0GA 4LF5F 3CDBA 4RW9A 4BCAA 1T7PA 2PDAA 4KFBB 1DHMA 3I55S 1YJNS 2ZH5A 4AL7A 3FFIA 5K8MA 3CO9A 1KS2A 3BGRA 1XR7A 1JLQA 4QYRA 2AW0A 2YKOA 1M5SA 3CC4S 1TUVA 3M05A 3DLGA 3DCAA 3BZQA 1RWUA 2B5JA 3S8SA 2YX7A 5MLCV 2NSCA 2C22A 5JUMA 1VQ7S 1TAQA 1GTEA 3MM5A 2LU1A 4V19J 1PILA 4WFNQ 1X9WA 3FFIB 2CQ0A 1RK8A 3MWBA 1HQUB 4PWDA 1HNVA 5EHHA 3OJUA 4RU2A 2RIJA 1DFDA 3BGLA 3MURP 1UVJA 2EK1A 2JEFA 2ERRA 5DRKA 2UVUA 1C4CA 4I6AA 2KHDA 3SDEA 1FJEB 3OFEA 4PUOB 1G7CB 2HG4A 3NG8A 4JOUA 5KFSA 3GV8B 1VIXA 3DC2A 4IOAQ 4OMFG 3PW5A 1JKHB 1FNMA 2D3UA 2JC1A 2XSFA 4NLOA 4EZ9A 1WWHA 3UD4P 2AJ4A 3WX4A 3VZIA 1N52B 2L9NA 3AHPA 4OX8A 3QO9A 4X4TA 2D9OA 1ZAWA 3VAHA 5H9EJ 4WK1A 5GADU 3MUMP 4DHVA 4P7VA 3DOKA 1DQAA 1H7WA 3FZ2A 3UW1A 4HEA9 3NGDA 3OUYB 2FJXA 2EFQA 2OPQB 1QTMA 4CO1A 2DHXA 3QGPA 3H5XA 1T03B 2ATLA 2ASJA 2I2YA 2CQIA 3HT3A 2HHPA 4OZ0A 4IG3A 1KLMA 1Q7YT 4ZVGA 1C0UB 1HYSB 2PO4A 1FD2A 4O3SA 2M8HA 3QWUA 2XI2A 3NL0A 4QIFA 1DJ0A 5C42A 3U1LA 1RI7A 4TN2A 3GR1A 2ZH8A 5IWAF 2ZOFA 3QIPA 5E7OB 5HI7A 2DITA 5A8RA 1HBOB 5KFWA 3I0SB 4CZCA 1FE4A 5HL7Q 1WACA 3V6HA 1KQSR 2KH9A 1RTJA 1GXTA 2J7KA 1CQNA 2CRLA 4NLUA 1X4CA 4ZPAA 1MW7A 3M2RB 3NNCA 2DGOA 4B17A 5F8HA 4WFBQ 1N4LA 1AW0A 5JVHQ 3H4BA 3UCZP 4X4SA 1OPZA 3AA9A 4I7FA 4PXEA 4WXWA 5KG5A 5CZVA 1E6YB 3PACA 2ZKUA 3V4IA 1T05A 1FVQA 3MEKA