3TVKA

Diguanylate cyclase domain of dgcz
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
b'AIRSNMDVLTGLPGRRVLDESFDHQLRNAEPLNLYLMLLDIDRFKLVNDTYGHLIGDVVLRTLATYLASWTRDYETVYRYGGEEFIIIVKAANDEEACRAGVRICQLVDNHAITHSEGHINITVTAGVSRAFPEEPLDVVIGRADRAMYEGKQTGRNRCMFIDEQNVINRVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diguanylate cyclase DgcZ
publication title Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 52
structure length 172
sequence length 172
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tvkA00
2YKNB 4URSA 3KLIA 4KBIA 4MK9A 4FBTA 3QYYA 1JLGB 4JV2A 2IA6A 4R8UB 5F9LA 1RA7A 3PR4A 2QV6A 2BQ3A 4ID5A 5L1JA 3DRRB 4KB7A 3CDWA 2XI3A 4M94A 4O4RA 2XC9A 3V6HA 3RB4A 1RDRA 1C0TB 2JC0A 3RB6A 1JKHA 4ECZA 1LW0B 3LP1B 5DLGA 5I42B 3FQLA 2HNDA 3GILA 5DQIA 2J6TA 3OL9A 2W7PA 2WTFA 2OPSB 2QE5A 2WOMB 2RDJA 1REVA 3Q8PB 2R2SA 4F50A 2HAIA 3KHHA 1KHVA 1VRUB 3D28A 4TQSA 3KK1A 5KG5A 4HKQA 1HQUA 4XPCA 1JLEA 2V0NA 4MIAA 4I7FB 1SV5B 5EDWA 1S1XA 3OL8A 4IDKB 3RB3A 2OPQA 1IKWB 1K1SA 2AGPA 2WRMA 4YR0A 5J2NA 3IGNA 1RT2B 3HHKA 1RTHA 2YNIB 4NLTA 2YNHA 1LWCB 3UQSA 4ECTA 3DOKA 5J2MB 5L1LA 1T03B 5KG3A 5KFAA 4ED2A 1S10A 3FRZA 4LSNA 2ZD1A 4WXOA 2AGQA 4I2PB 3KLHA 4QW9A 1C1BA 1HARA 5DGBA 4H4MA 4IQXA 3VQSA 1S9GA 5L9XA 4FS2A 3MEGB 4YP3A 5C42A 3KK3A 1NNDA 1HNVA 3GV5B 5HP1A 2VG7A 1FK9A 2CJQA 2W9BB 2YNFA 4NZ0A 4HYKA 4ECRA 3IG1B 3NBPB 5KFCA 3E01B 5KFGA 3RBDA 4JV0A 4YMEA 2E9ZA 3MR6A 4RNMA 3H5SA 4RNOA 3M9NB 5F8HA 1T3NA 3OSPA 3C6TB 1IKXA 1TP7A 2W7OA 3ISND 2D3ZA 5F8GA 3KMQA 1MU2A 4IR9A 2F8EX 4DL6A 2FVQA 2VA3A 1RT4A 2HWIA 2VG6A 2B5JA 3GV7B 2BE2A 5DG9A 2XI2A 3SI8A 1RTIA 3T1AA 4IG0A 2R8HA 4NCGB 4RNHA 3DMJA 2IAJA 4FBUA 4ZVGA 4ZMMA 3MECA 3DLGB 1LWFB 4DL7A 5KFRA 4DEZA 5FDLA 1RTJA 1Z4UA 4O4GB 3JSMB 1IKYA 4IG3B 4R5PB 2B6AB 4ED0A 2XGQA 4NLXA 1TL3A 2AX1A 3DLEA 5KFXA 2ALZA 2AU0A 4EBEA 4YR3A 3DM2B 1QE1B 4NLOA 1KLMB 1RT3A 2W8KA 5C25A 4X2BA 1HMVA 4MIBA 2D41A 4ZHRA 5EUHA 1UWBB 1TKXB 5HLFA 1TVRA 2UVWA 1S9EB 5CYMA 2FJWA 5KFKA 2BRKA 4NLYA 4PUOB 3PZPA 1ZTTA 4KSEB 5KT2A 2I5JB 3DI6A 1ZETA 4MKBA 1SUQB 4K4VA 1S4FA 3KJVA 3H5YA 1YVFA 1CSJA 1S6QB 5CYQB 5KG7A 4J9QA 3PW4A 1N6QB 3DOLA 4Q0BA 4IFYB 2XWYA 4EO6A 4DL3A 4J9MA 4TY8A 3V4IA 4ECSA 3BQ0A 1S1TB 3EZUA 4H4OA 5D3GA 4O44B 1HQEB 4JV1A 1IKVB 2W9AA 2AX0A 2YKNA 2ZKUA 4KE5A 2UUTA 4ZPAA 5KFMA 3KLFB 2FVPA 4Y3CA 4MFBB 2BR0A 2D7SA 4RW7B 1JLGA 3Q8RB 4R8UA 4WYLA 4Q45A 4J9KA 1S1WB 3M9OB 4O3PA 3DRRA 1JLQB 5C5JA 3H59A 4RW4B 3G6VA 1C0TA 4QWEA 3BSAA 2C2EA 2E9RX 3DDKA 4NLRA 5HBMB 3E51A 1LW0A 3LP1A 3QLHB 3PJXA 5I42A 5DG7A 4PQUB 4WZMA 3IS9B 1S6PA 2OPSA 2WOMA 2XGPA 1W25A 3NAHA 1OS5A 2R8IA 2AQ4A 2I1RA 1FKOB 5KT6A 4PWDB 4K4ZA 4IH7A 2YKMB 1VRUA 4URQU 4ECWA 2C2RA 3I0RB 2BRLA 2FLLA 3QO9B 1RAJA 2ATLA 3QGHA 4I7FA 1SV5A 4ICLB 3HVTB 1VRTB 4IDKA 4YQWA 3FQKA 3TQ1A 1GX6A 1T94A 2RF2B 4IOBA 4IKAA 2OPPB 1IKWA 4IH5A 4QWDA 4OL8A 4K4UA 1U09A 1TV6B 1C1CB 1RT2A 2YNGB 3M8PB 4LSLB 1RT6B 2YNIA 3MTKA 2O5DA 1SH3A 1LWCA 5KT4A 1TKTB 3FSIA 2IC3B 2ILYA 3DRPB 5J2MA 3N6MA 1T05B 1T03A 1KHWA 1S49A 3CO9A 3IRXB 5JXSA 4B3OB 3LP2B 3KMSA 4F4XA 2RDIA 4I2PA 3Q8QB 4ZVFA 2W9CB 4WXWA 3G6XA 2JLEA 1BQNB 3MEGA 2C2DA 4U6PA 2W9BA 5F8IA 3IG1A 3NBPA 3E01A 4TY9A 4F4WA 3QIDA 2AWZA 2B43A 2R8JA 3HVAA 4ZPCA 1JLCB 2WONB 2BANB 2UVRA 3C6TA 4ED6A 4TN2A 3MR3A 3NL0A 5KT7A 4J9NA 4TYBA 4ZP6A 1JLFB 4Q8FA 3TAMB 3MF5A 2IBKA 5KFIA 2FLPA 3LAMA 3DYAB 5K14B 4TYAA 4QWAA 3KLEB 4NCGA 3GYNA 1I6JA 3OSNA 3DLGA 1JX4A 1LWFA 1DLOB 4ED8A 3JSMA 4O4GA 4QWCA 4IG3A 4R5PA 1N48A 2D3UA 4MK7A 3ICLA 1MMLA 3G86A 4Q44A 3DM2A 4H54A 5DG8A 1QE1A 5DGAA 1KLMA 2V9WA 5KFOA 5EWEA 3SFGA 2HNZB 3CJ4A 2ZE2B 3KK2B 1UWBA 1TKXA 4I2QB 2V4QA 1S9EA 3RAXA 4DG1B 4NLSA 3GIJA 3QIPB 4J9LA 1JLAB 1S0OA 1S1VB 3T5HA 1S9FA 4PUOA 2I5JA 4ZVEA 5KFLA 3NAIA 1C2PA 3JYTB 4TQRA 3FFIB 4MK8A 3I5CA 3T5JA 1S6QA 5CYQA 3PVXA 1N6QA 2HNYB 4KAIA 1SH0A 3PHEA 4IFYA 3G6YA 4IRKA 3PW7A 5T14A 2UVVA 1S1TA 1S48A 2WK4A 1RTDB 4O44A 1HQEA 1IKVA 5F8MA 3KLFA 4LQ9A 5HROB 4QW8A 3CJ3A 3LAKA 4MFBA 4RW7A 5KFNA 1R0AB 1RYRA 5I3UB 3CVKA 4K4YA 3CJ5A 3DRSB 3NGDA 1FKPB 3EPGA 2XCAA 1S1WA 3RBEA 2VA2A 1JLQA 4RW4A 2R2UA 4GC7A 3CJ2A 4F4ZA 5HBMA 3QLHA 2FLNA 4KHMA 1S97A 4PQUA 4YR2A 2R2RA 3IS9A 2JEJA 2IM3A 4IRCA 3FDSA 4RNNA 3GIMA 2ILZA 1FKOA 3PJWA 4DL5A 3LALA 4ZP7A 4PWDA 4RUAA 2YKMA 3BSCA 3I0RA 4J9SA 3NMAA 3QO9A 4ZP9A 2R8GA 1HPZB 4NLQA 5L1KA 4WE1B 5C24B 2JC1A 3HVTA 4ICLA 1VRTA 5KFPA 1HNIB 2HMIB 1EETB 2RF2A 5KFYA 2OPPA 3I0SB 3MR5A 3H98A 4FS1A 2UUWA 4ED7A 1DTQB 2BQRA 2IJNA 1XR6A 1TV6A 1LWEB 4KO0B 1C1CA 3M8PA 2YNGA 4LSLA 5KFVA 3OHBA 1RT6A 2XCPA 3BJYA 4K4TA 4WFYA 4NLGA 1TKTA 4ZPBA 1JLBB 2IC3A 3DRPA 5KG6A 1ZTWA 1T05A 4G3IA 3IRXA 4EYIB 4M95A 1IM4A 3MEDB 3LP2A 4ZP8A 2HWHA 3MFIA 1N56A 4B3OA 3EPIA 4IFVB 4RUCA 1EP4B 4URGA 3KLGB 2W9CA 2BQUA 4TLRA 3KHLA 4K50A 3LP0B 1BQNA 4EBDA 3MEEB 3N6NA 4QWBA 1TKZB 4KFBB 5J2QB 3H5UA 4NRUA 4ECQA 4NLWA 5F8JA 4RW8B 4DL4A 3KOAA 1N5YB 2FJXA 3I5AA 4KKOB 4ZPDA 5J1EB 1JLCA 5KFBA 3QZ8A 2WONA 4MH8A 1J5OB 3V6KA 2BANA 4NYZA 4J9RA 5KFWA 3C6UB 3MFHA 5KFHA 4RW9B 4K4WA 4J9PA 1JLFA 4G1QB 1RYSA 3TAMA 1QAJA 1HYSB 1RT1B 2RKIB 1LW2B 5J2PB 1TL1B 3DYAA 5K14A 4ECYA 2VG5B 3KLEA 1K1QA 4F4YA 3RAQA 1QAIA 3GIIA 4IH6A 4EYHB 3BSNA 3IGVA 2OPRB 1RT5B 3UPFA 4ECVA 2V4RA 4RW6B 3V6DB 1DLOA 1S1UB 3CIZA 3OL7A 3DLKB 1C0UB 1BQMB 3V81B 4KV8B 1RT7B 3QGGA 3T5KA 1S0MA 2WHOA 1DTTB 1S6PB 1TQLA 2IM1A 2IM0A 4Y2AA 4QPXA 3ITHB 2FJVA 3CDUA 5KFJA 3BQ2A 3BGRB 3M8QB 3OL6A 3N6LA 2HNZA 2ZE2A 3KK2A 3PW0A 3BSOA 4I2QA 2GIQA 3KLIB 3OHAA 4DG1A 5L1IA 3QIPA 1JLAA 2ASDA 1S1VA 3CDEA 3UDLA 4NLVA 5KG2A 5KFEA 3PR5B 3JYTA 2JEIA 4Q8EA 4ID5B 3FFIA 1RA6A 5DLFA 2ASLA 2HNYA 1D1UA 4Q43A 1JKHB 4ED3A 2B6AA 1JIHA 4K4XA 2HNDB 1RTDA 3Q8SB 1REVB 2FVRA 2WB4A 3TVKA 2J6SA 2E9TA 5HROA 2W8LA 1R0AA 5I3UA 3UR0A 3OLBA 3DRSA 5JUMA 3KK1B 1FKPA 1HQUB 3M9MB 1JLEB 1S1XB 4WFZA 5DQGA 4GC6A 4NLUA 5KG4A 3H4DA 2AGOA 1SUQA 3KHRA 5F9NA 3MR2A 3D5MA 4WFXA 5F8NA 2OPQB 4U7CA 4ECUA 3GIKA 2UVUA 3SFUA 2WCXA 5J2NB 1RTHB 4IR1A 1GX5A 3BREA 2YNHB 4EBCA 2IMWP 3DOKB 3LANA 5KFTA 5KFUA 1HPZA 3HKWA 4LSNB 2ZD1B 4WE1A 5C24A 4O3NA 5KFQA 4RNFA 4EEYA 4WZQA 3KLHB 1HNIA 1C1BB 4XO0A 5KFDA 1EETA 1XR7A 2DPJA 2HMIA 3I0SA 4H4MB 1WNEA 1S9GB 1DTQA 5C42B 3KK3B 1HNVB 5HP1B 2VG7B 1FK9B 4MKAA 4ECXA 2YNFB 4ZVHA 1LWEA 4KO0A 3T5LA 4RZRA 5DQHA 4Y2CA 4XPEA 2IJFA 4NLPA 1JLBA 4NLDA 3KLVA 2J6UA 3KNAA 1IKXB 3MEDA 2C22A 1MU2B 2R2TA 4IFVA 3H4BA 3KLGA 1EP4A 4TXSA 1N4LA 1RT4B 3ISNC 2VG6B 4R0EA 1S0NA 3H5XA 3LP0A 2C28A 2B5JB 3T19A 4KHRA 2BE2B 3MEEA 5KT5A 1TKZA 3CJ0A 4KFBA 5KT3A 3QZ7A 5J2QA 1RTIB 1XR5A 4O3SA 4IG0B 4JUZA 3GV8B 1QUVA 3DMJB 2IAJB 3GQCA 4RW8A 4Y34A 5KFSA 5KG1A 2R8KA 4ED1A 1N5YA 4EO8A 3MECB 3HVWA 4KKOA 5KFZA 2CKWA 5J1EA 3PW5A 1J5OA 3PW2A 3CWJA 1RTJB 5FDLB 1IKYB 3C6UA 2GIRA 2IM2A 1TL3B 3DLEB 5KFFA 3KHGA 4RW9A 3QGIA 2FVSA 2OH2A 2JEFA 4G1QA 4O3OA 3NKYA 4NRTA 3BR9A 3BQ1A 1HYSA 1RT3B 1RT1A 2FVCA 1LW2A 2RKIA 4J9OA 5J2PA 1TL1A 5C25B 3H40A 1HMVB 2VG5A 4ZHRB 3I5BA 5HLFB 1TVRB 1NHVA 5CYMB 2OPRA 1D0EA 2ASJA 1RT5A 3V6DA 2EC0A 4RW6A 4DL2A 4O3QA 5KG0A 1S1UA 3DI6B 3H2LA 4WYWA 3IN5A 3RB0A 3DLKA 1C0UA 3KJVB 1BQMA 3V81A 4KV8A 1RT7A 4IRDA 4RU9A 4Q0BB 4LQ3A 2GC8A 1DTTA 1NHUA 3DOLB 5F8LA 4K4SA 5EWGA 3ITHA 5EWFA 3V6JA 2DPIA 1SH2A 2JEGA 4TY8B 3OLAA 3V4IB 3BGRA 3M8QA 5D3GB 4O3RA 4H4OB 1JXLA
chains in the Genus database with same CATH superfamily
3RTVA 1B99A 4YN3B 3SXLA 3NWGA 2W7AA 3HI9A 2QV6A 5B0FA 2JC0A 1VI7A 1NK5A 1U1KA 3W9IA 5CZXA 4GMKA 4JI4F 4HKQA 2AEMA 4XIUA 1UJ4A 2F3JA 4E2FB 3G82B 2OPQA 4HHUA 3NGRA 2RQMA 1SIWB 1B4SA 5L1LA 3ELHA 4KGVB 4CRJA 1HWLA 2CWKA 3FKBA 4I2PB 3KLHA 1HARA 3VQSA 1S79A 3DFEA 1DJ0A 1JNRB 4LFAJ 3T1YJ 4IR9A 4RBTA 3GZ7A 3QWPA 2MZJA 3A8EA 2HVIA 3CD0A 1QTNB 1QE1B 4DR7J 3EGZA 4MIBA 5LXRA 2DH9A 3QWUA 4RL1A 2H3EB 5BXIA 4MKBA 3BKFA 5CYQB 4Q0BA 4DUTA 2CQ2A 4EO6A 2E5GA 4LF5F 1D8ZA 4JV1A 5ETOA 2YKNA 2D7SA 3PKYA 4J9KA 3MUTP 4ANDA 4B3TF 3O3LA 3TWZA 3NAHA 3U1NA 1F3VA 3MCOA 4O0NA 1NBEB 4LF6F 2DIUA 3N01A 4X64F 1UPMB 3D9BA 4JOUA 3EVMA 4QWDA 4RO0A 3HJFA 4K4UA 1U09A 1I1GA 3J7YI 1RT6B 1XMOF 3N4WA 4ZVFA 3G6XA 2BKNA 3CO0P 1Q86T 3NBPA 3KTQA 3HVAA 1JLCB 1VQPS 3KG0A 2PC6A 2RVJA 2IBKA 4CTAA 2VFRA 3OBIA 3H7HB 2MHEA 4HH1A 4PWWA 4I6AA 4IG3A 4UOFA 3IBFB 2ZE2B 3QIPB 4ERDA 5G0RA 4MK8A 3EGVA 3BPSP 3WZ0A 4DV7F 1B70B 4CLPA 4F02A 2AJ0A 3C2PA 2FZGB 1S48A 1CLFA 3M2RB 2VIHA 1IKVA 1U8WA 1RABB 4WIQA 1URNA 4A46A 2XCAA 6FDRA 2BXJA 4KHMA 4PQUA 3VAMA 4WF9Q 5EGYA 3GFHA 3HMJG 1CEZA 4PXDA 1WKJA 2DGWA 5A2QY 2V69A 3BN7A 2UUCF 3KYLA 1S99A 3CDBA 4KHPF 3LH2S 4NLGA 3HKZD 1T05A 4QIWD 4OZ5A 3CUNA 4URGA 4K50A 1U1RA 1TKZB 1RP5A 3TUPA 1WKKA 4DL4A 1Q16B 1S7HA 1U7LA 2WONA 3S8SA 1UFKA 3MFHA 2QLJB 2CUYA 4K4WA 4J9PA 5J2PB 2HWTA 2VASA 2V4RA 2XB2D 3BH6B 1KTVA 3KWMA 4OZ3A 5I4MA 2VU5A 3AY0A 3WIUA 4ED5A 3U7JA 1ZA1B 4WWSA 3VQTA 4DV5F 1PG5B 1O6XA 3UVJA 3M4XA 4HLBA 5HJYA 4B3MJ 3NCPA 1TUGB 4NXMJ 2X3GA 4X4OA 4ECUA 2XG8A 3K57A 2B4VA 4CO4A 2YNHB 3WQPA 2UXDF 4EEYA 5KFDA 2DPJA 5CD4H 1H2UX 5T7LA 3J7A1 1LWEA 4KO0A 2AP6A 3KLVA 1WWHA 2DRAA 2C22A 2EFNA 1RT4B 4KC5A 2C28A 4OZJA 2BE2B 1FTRA 2FD2A 1KNZA 1VQ8S 2ZWOA 3M8ZA 3BQ1A 5LMUJ 2RUSA 5BYRA 5CYMB 3RYLA 2KT3A 2FJDB 3DI6B 5DDPC 2R7XA 2CNLB 3B54A 1V3SA 1VQLS 2NCKL 1JXLA 2HBRB 3OW2R 4DUYF 2EFQA 2DGUA 4O4RA 4ECZA 3LP1B 2WTFA 2OPSB 2WOMB 3QQCD 4OIXA 1VRUB 2G13A 2L48A 1FX2A 2DR6A 4MIAA 1IBLF 2FY1A 2HBQB 1T0TV 3RB3A 3MURP 1Y5IB 2QX0A 2CADA 3CCSS 4DUZJ 1U02A 3QAUA 5IV3A 3K5LA 2AIRB 5KG3A 2BM1A 2ZD1A 1CS4B 2MKHA 4C9DA 1SC1B 3W8GA 4QW9A 3ZZZA 4F3OA 3KK3A 2RIJA 4RJVA 1HNWJ 2RQCA 1HNZJ 3CCLS 2ROGA 3OR1B 1RI7A 2E7WA 4HR2A 2FVQA 3J7ZT 4KGMA 2E5LJ 1F60B 4AXJA 5IT4A 1CULB 2XHWA 2OLWA 4ZMMA 2HYIB 3DHWC 1NZ8A 1Z4UA 3M2UB 3ZNJ1 2AV5A 9ATCB 2GVZB 2MQLA 1FD8A 3KUHA 3VTIA 4ZHRA 3QJPA 2W4CA 3H5YA 3C14B 5LXYA 3BDPA 2UUTA 2ZBQA 4Y3CA 1RHKB 3Q8RB 4WYLA 4NEYA 4O23A 1C0TA 2KFZA 1HHSA 4OYAA 2YKMB 4PPZA 2H5EA 1RHRB 3Q86A 2GHVC 1IKWA 2LECA 4X65J 3M30A 5ETKA 3M8PB 2ASYA 1U45A 1WUUA 2UUAJ 2C3YA 3QPIA 3AJ1A 3MI7X 2PI4A 2FJAB 2Q43A 3J81j 2FC8A 4X84A 3BO3A 2VBWA 3QIDA 4X4QA 1ITPA 4X4RA 4KT0C 1DZ5A 2Z30B 1RAAB 4F04B 2H65B 3IBWA 3LAMA 5K14B 3OR2A 4PRFA 1APSA 3NRBA 2HFVA 3ILLA 3MM7A 4MK7A 3ICLA 4FXWA 1TUVA 5DG8A 4C11A 4D3GA 2DXEA 1RUSA 2HNZB 4I2QB 4C98A 4NLSA 4J9LA 2FTRA 3LF0A 1SKWA 1WI6A 3T1HF 3MEKA 1J5EJ 4IFYA 3ZTRA 4IRKA 3FRYA 2OFHX 4HT5A 1Q81T 2PFDA 1RYRA 4ZPWR 3CCTA 2DHAA 1B7YB 5D15A 2C2KB 1DY3A 2LCWA 3PEJA 2APOA 2H5IB 4J9SA 2CAJA 3NMAA 3QO9A 2R8GA 5K8PA 3IA0A 4YDXA 2HMIB 3FBBA 5LSLA 1DTQB 1FTCA 4OZNA 1NDCA 2QEXS 3PY8A 1TFYA 2DGXA 1HD0A 1UETA 3DLHA 4EYIB 3CJQA 3LP2A 2K1RB 1T7PA 1KOHA 2QT7A 2E5HA 3U1MA 3A3OB 1R8AA 4F4YA 1NDKA 2DR9A 1OIAA 5ETPA 2E1PA 2Z2ZA 2G2ZA 3V81B 2IM0A 1VDHA 4LFAF 2WSEC 4DU7A 1NO8A 3LOUA 1H6KX 2DXDA 5KG2A 4DR5J 2MTLA 2BDPA 1NKEA 1H7WA 4EWTA 1JIHA 2NYIA 2V4JB 1Q95G 1FJGJ 2YKPA 4DR7F 4LIRA 4NYPA 3D0IE 2HBYB 4C48A 2AGOA 5D77A 3MMAB 4Y00A 2VDIA 1RTHB 3KDOA 4QQBA 5LSRA 4LSNB 4OYIA 3VCDA 1LWXA 2MQQA 1RWVB 5DQHA 4DX5A 2VC1A 3MEDA 3VWSA 2J0SD 4CNYA 2IA0A 2ROPA 1N4LA 3LGNA 3HFVA 4R0EA 5KT5A 3FEZA 1NJIT 1XR5A 1Y9OA 4OX8A 4BBYA 1WHVA 5IQQA 4EO8A 1UVLA 4KKOA 3HVRA 2GIRA 5KFFA 3C8YA 3SIPB 1B7FA 3W3SA 4BC7A 1RT5A 2MQOA 4OZ2A 2LA4A 1RT7A 1X7VA 5H9EJ 2IIHA 1NHUA 2G0JA 3HULA 1W26A 3MMCB 3VGVA 4TY8B 2KFNA 2F8HA 4USIA 1UP1A 3KLIA 2HGNA 4CT8A 2Q3PA 4DSJA 1UA1A 2RH3A 3TUJC 4C8LA 1REVA 3BBCA 5EN1A 3FUYA 1P9QC 4CH1A 3Q2SC 3W1YC 2HRTA 1UZDA 3KJNB 1H38A 4GKJJ 3QRQA 3PYFA 3AJDA 5GAEU 4WP9A 3AA9A 5LOQA 2RSQA 3LGHA 5B0BA 4ZA1A 1GQEA 4ECTA 3DOMB 4DSEA 2EFGA 2IRYA 2R7TA 5D6GA 1OO0B 2MKJA 3IMQJ 5KFCA 4F7VA 1VQSA 4AL5A 1TP7A 2W7OA 2QLBB 1ZM2A 5K8OA 4CIOA 1KSPA 3IXQA 1RQ0A 1RHUB 4DN9A 4DX7A 2IFXA 4O4GB 2NXJA 1LEOA 4N47A 1KLMB 1TKXB 1X4FA 2HHPA 2AEJA 5L46A 1T9YA 4ECSA 4DV6F 4ZJOA 1U0SA 3I32A 2X51A 2DH8A 2CZVC 2YX7A 1VIOA 3H8YA 1S6PA 2VD3A 4W90B 4C3KA 2I1RA 1FKOB 2VBZA 2GMJA 2R7OA 3I0RB 5EHHA 3DNCA 3QGHA 1UEVA 2F8MA 2DNQA 1YDLA 5E0OA 5A8WB 3ZZUA 4FYVB 2UU9J 1JXVA 4USTA 1W7WA 1O5JA 2YNGB 4LSLB 1S5ZA 3DRPB 3N6MA 2X1GA 1KHWA 5IC4B 4K8RA 5JXSA 3M2VB 3KMSA 4NXMF 4AXIA 4OJGA 4ZPCA 2QA4S 3IC1A 2AYEA 1S76D 3SQGA 2FQQB 2WVFA 3NNCA 1DLOB 3KJQB 4ED8A 4DR6J 3VAFA 4CLFA 2V5HG 3A8JA 2L41A 4B9VA 5DGAA 4ELVA 4NOHA 1Q1KA 4DL0C 4JBCA 3RAXA 4DG1B 2DNMA 3OFHA 3JYTB 1C2PA 2O66A 3HD1A 4HEA9 1S6QA 1N6QA 3D4JA 3I6PA 5A0YB 4K2XA 5T14A 2WK4A 2CQIA 2ZC4A 1Q7LB 3CVKA 1N54B 2VQFJ 4F4ZA 1VLYA 5HBMA 3X3UA 2OSQA 2GJIA 3M8RA 4RNNA 3QRPA 2ZITA 4PWDA 2QA1A 2LDIA 3PCOB 2N82B 5JMNA 1FJCA 5C24B 1CQNA 2XWXA 5KFYA 3FJ2A 4DPUA 3I4PA 2XHCA 1PIEA 1WOPA 3FBCA 1NMEB 3MAAB 3AD7C 2LEBA 3UNYA 3PX0A 1N0UA 3NGTA 4USMA 1SKRA 4J9RA 2HHWA 4OYPA 3UFCX 4DUZF 2O3DA 2RKIB 1TL1B 3GIIA 4GO7X 2R3VA 4ECVA 3H25A 3L7OA 3KXDA 1DRZA 4OLPA 4F0MA 1BQMB 1HNWF 4KV8B 1HNZF 3CCRS 3RR7A 2C3PA 2NXUA 2E5LF 1RK8A 2ASDA 1XEZA 1A6LA 1CPZA 3NOGA 1UZHA 1G6BA 1UFLA 2B6AA 3WHIA 4OYBA 2OEKA 5I3UA 3OLBA 1JB0C 4PR6A 4DPXA 4LF1A 5F9NA 4WFXA 2OEJA 1ZH5A 1WOOA 2HQDA 4AL6A 3EWGA 4M5JA 2XO7A 4ELUA 2YWKA 3LA0A 2DO0A 3G9CA 2M4MA 4WZQA 2SXLA 3H90A 1VBKA 3R97A 1U1NA 4PABA 1EHWA 4DMZA 3D6FB 4IFVA 3MM8A 4OYZA 3C3LA 2P2CB 4IG0B 4NYOA 4LIWA 2DVIA 2ZH8A 4X65F 2CKWA 4E8UA 2MGZB 4XAKA 2V34A 3U27A 4O3OA 1LW2A 1RJJA 2UUAF 3AXKA 1P1LA 1HIYA 3IR5B 3RB0A 3KJVB 1N8RT 1QSYA 3TI0A 4FKXA 4OX9F 4OQJA 4URSA 1AUSL 4DFMA 1ZA2B 3LWMA 2MKCA 5B0DA 2RUGA 5DLGA 1VQKS 2HRYA 2KT2A 2PDAA 3M1VB 2P6TA 4BCAA 4TQSA 5CA5A 3OL8A 3M6UA 1HBOB 3H42A 1X5OA 1J5EF 1T9UA 1RT2B 4OHWA 3MDFA 3G6ES 3GONA 3CCZA 3FEXB 3OUYB 1S0VA 1U6FA 2HS0A 4KTQA 2HFOA 4PXEA 2FZKB 4N7TA 1U26A 2F8EX 5M2RA 5DG9A 3R2DJ 4JI5J 3E2EA 4RNHA 2IAJA 4PKDB 5A6PA 4L72B 1LWFB 1OWXA 1SL1A 5KFXA 3J7YU 4YR3A 3K5PA 2B51A 4Z2XA 4NLYA 2Z2LA 3PZPA 3N0VA 5KT2A 4DV2J 5AE1A 2DKOB 3IR7B 3V4IA 2W9AA 2GGPB 1JLGA 1Y5LB 3H0PA 2B4UA 3ZZ0A 2DHXA 3I56S 4FVMA 2BE9B 2ABYA 3EUNA 5KT6A 3AA8A 1HBNA 2DEIA 1PO6A 1FJEB 1GX6A 4HT7A 4DR5F 2CQ1A 1PJ6A 1G4CA 1TKTB 1FJGF 2CZ9A 3W7BA 1L3VA 4WXWA 1NDPA 3GTYX 3DDNA 2Q66A 4ALZA 1ZM4A 3F41A 1SJ4P 1KFDA 3NL0A 1UAWA 5F41A 3GYNA 3CE8A 3ZC4A 3UR3C 3JSMA 4G65A 4JI3J 1N48A 3G86A 4ZPTR 1AYEA 5KFOA 3I9ZA 2J0QD 4WBFA 1HWIA 5DJBA 1ZS6A 4WKYA 3NS7B 4DX8H 3HXMA 1N5TA 3W63A 1RBLA 3D6MB 4N77A 2B9WA 2FJEB 3GG1A 1K44A 3NGDA 2Y8WA 4RPFA 4U8YA 2HVHA 2BV3A 1SQEA 1FA0A 2V9KA 4QYRA 2R2RA 3FDSA 3PJWA 1WSVA 3O44A 4WE1B 1NM2A 4UOCA 3WX4A 2DGSA 1JQGA 4CO2A 2UUWA 2IJNA 2NQPA 1SI9A 3CB4A 2R4FA 3MEEB 2VBXA 3W8PA 4RW8B 5J1EB 4HTJA 3W2VB 4MH8A 1EARA 2ZBIA 1XQIA 3IO1A 3EZOA 4JI1J 2DYAA 2ZJQQ 3J80Y 1OY6A 1MNEA 1L5UA 1PAUB 1JK9B 5LSOA 4U7UK 1YJUA 3OHAA 1UKUA 1U4BA 1YITS 2K8GA 3PR5B 2ZH1A 2MXYA 2HNYA 1JKHB 2HNDB 1FXRA 3MMJA 2WW4A 1HQUB 1S1XB 5DQGA 4NLUA 4JYAJ 5F8NA 2ATCB 1EQ0A 2HVEA 1E6YA 1JJ4A 3AB2B 2MLYA 1HPZA 3M8WA 2NXCA 3VGTA 2JDJA 5HP1B 3W9JA 3WX8A 3SV3A 3J81U 4NZ7A 3RBXA 4NLDA 1K0TA 1CG2A 2AJ1A 1LXNA 2QN6B 5KOXA 3H5XA 2B5JB 2O01C 3CF5Q 3DMJB 1UTAA 2UU9F 1Z2ZA 4HL9A 3TQEA 4F8RA 2X1BA 4ZCMA 1TVRB 4C7QA 5DM7Q 3SCKE 1HW8A 1X4CA 4O3QA 1S1UA 5KG0A 1VC0A 3HHDA 4PG4A 4PEOA 1E6VA 3OQ2A 2IYGA 3V6JA 1VBZA 1NH8A 2I0XA 2LLZA 2EKNA 5D3GB 2J9DE 1WC6A 4YDDB 2XY7A 1VJWA 4WU3A 3DRRB 1HQ2A 3V6HA 4J7CA 1YK9A 4DR6F 5FJ4A 1F9FA 1O0PA 3UD5A 3QBCA 2JSXA 5E3RA 4I7FB 2V2VA 5C7PA 4LF9J 2YPZA 1AT1B 1LK5A 2HEKA 2WRMA 3E8OA 5GADI 4HI1A 4YR0A 3MGJA 1VIXA 4NX9A 1T03B 3UCUP 2OHDA 2VKRA 1C1BA 5JVGQ 1G2EA 3CD7A 1P1TA 3GV5B 3I82A 2RQ4A 2VQFF 1FDNA 4N5SA 4RNMA 5K8MA 3OV7A 2EK6A 5F8HA 2KXHA 2D3ZA 4LFCJ 1DQAA 1XWLA 4DL6A 2OP5A 2JVOA 2VG6A 3OXLA 1QJHA 3MECA 1YQHA 4PG6A 4NLXA 1NDLA 2IRXA 1TTHB 1ELOA 1A9NB 5C25A 4JI6J 1CJVB 1UWBB 3ZTOA 4P2FA 3SV4A 3ET6A 1KWMA 4BS2A 4K4VA 4P7VA 2XYPB 4C3MA 2FHJA 4XTTA 2UUBJ 3GCXP 1I94J 4RW7B 1BWVA 2AZ1A 3N5FA 4NA2A 4QWEA 5HL7Q 1FVQA 3QLHB 4CLWA 5I42A 3THVA 2K7KA 4P6QA 2AF6A 4A8OA 3EGWB 4USJC 1S6OA 3Q83A 5CYJA 1FRXA 4OL8A 4ZVPB 4NA3A 1P27B 1SKSA 7FDRA 1I5OB 1LWCA 2FLPA 4K5SA 1Y4ZB 4G1IA 2HHHJ 1D3WA 3C16B 4IOAQ 2VICA 4I69A 2CPHA 3HO1A 1FESA 3WC0A 2VC0A 3UCGA 3D3CJ 4Q8FA 1KQFB 5H9FK 3KLEB 2MJUA 4K7QA 3OTEA 5HQ8A 2KXFA 2XMUA 4K5RA 1XN9A 2MHNA 2DNYA 2XO6A 1S9EA 1S0OA 4ZVEA 4MYUA 2AJ2A 3G8SA 1SIZA 4DXLA 2R7UA 2J7UA 3EYZA 1FFSB 1LQ9A 2QL9B 1OSCA 4RLEA 1YLXA 5HROB 4MFBA 4KJIA 2VA2A 1JLQA 3UCZP 4J9VA 4GC7A 4CP5A 3N5BA 4YR2A 4W92B 2LQ8A 1QVFR 5U47A 3NNHA 2LQ5A 4FYWB 3HVTA 4M8LA 1SJFA 4ZLJA 2FYXA 4WU2A 5D0HA 3BJYA 1NPKA 4RUHA 1EIYB 1R8BA 2BQUA 4QWBA 4KFBB 1IR0A 2P9GA 4QIGA 2WSFC 2ADBA 5A8RA 3I5AA 1Q0NA 5FLXY 1U6ZA 1NK6A 3SBMA 2EFOA 2RAQA 5K20B 2E1CA 2FC9A 3R5DA 1C0UB 3QGGA 1NK9A 2WHOA 4DV0J 3N79A 2CPFA 3QMQA 3BGRB 3GJSB 3RGIA 2JH3A 5GVQA 5L1IA 1JLAA 5E3CA 2PMZD 4JI5F 5B0GA 1RA6A 5DLFA 1S72S 2MZTA 2MLZA 5BYSA 2DNPA 1X9MA 1DFDA 2ZFHA 1HBUA 3T6JA 2R9LA 1BGXT 4NPOA 1FKPA 1JNZB 3VAHA 5KAKA 2XSJA 3MM9A 3TEHB 2K7JA 2I6WA 4DV2F 2CQ4A 2VOOA 3CCVS 4K59A 3BREA 4WTYA 5C2CA 1RU2A 2HS3A 1GXUA 4CDIA 3I0SA 4H4MB 1S9GB 5ETQA 2XNQA 4XPEA 2GMHA 2L3MA 5BR8J 2BJEA 3TO8A 4MKVA 3GQCA 2QIFA 1RKJA 3PACA 2YWWA 4A8FA 5RUBA 3DLEB 3QGIA 2OH2A 1VOMA 1HYSA 1RAOA 1U1OA 3IN5A 3AOCA 3CULA 5FD1A 5DO2A 1KKHA 1G7CB 2HHSA 5EWFA 3G4SS 2P8IA 1U24A 2HZVA 1KC8T 4LSZB 4GVBB 2LXFA 3G8QA 2RJZA 4USVA 3MAHA 4CO1A 3BYRA 3HHLA 1QAYA 5B0EA 3OL9A 3KHHA 4CYUA 4ANCA 2CDRB 4XPCA 3A8IA 1HWUA 4A8KA 4IDKB 3FK4A 2BZ2A 2CIMA 1HFEL 2CPJA 1NZAA 5J2MB 2E1MC 1RHQB 2Q1LA 3IG1B 5KFGA 4OV1A 4BC9A 2DRDA 3JQMA 1A7GE 2GVDA 1V9OA 4NCGB 8AT1B 3TUIC 3HHLC 2XGQA 3SDEB 1CC7A 2UVWA 5KFKA 2EWHA 1Z2LA 4QU6A 1SUQB 2A1BA 2A2DA 3DOLA 1CJTB 2HPUA 4DL3A 4J9MA 3CCQS 2N3OA 3EZUA 2A10A 2ZKUA 1SL0A 4Q45A 2DBBA 3TJ9A 5C5JA 2OMOA 2NSBA 4JI1F 4FVCA 1X5SA 3BSAA 3FCWA 5G4DA 3SCJE 2F4VJ 1YRTA 1QSSA 2AQ4A 3QAEA 1XNQJ 3DU6A 4YQWA 1F3FA 3FQKA 3CD6S 3OT9A 4IH5A 4L76A 2P5VA 1QD1A 5A8KA 3MTKA 2D69A 3CJKA 8ATCB 3IRXB 4A8QA 3AH6A 4JYAF 2BACA 2CFXA 2AWZA 2XEXA 4ZVSB 2KG0A 4UW2A 4CCHA 2QYCA 2BUNA 3TAMB 2XY5A 3F44A 1D9DA 5DZ6A 4QWAA 4NI2A 1I6JA 5E3AA 3OVSA 2GCFA 3OSNA 3ILIA 3R8YA 1ZAXA 5HVHA 3MM5A 3LPEA 3JQJA 4ATNA 4J5OA 2AYBA 3W2WB 2V4QA 3GIJA 1SPBP 3FFIB 2ZM6J 3PVXA 1ICEB 3VHQA 2HS4A 4OI6A 2PMWA 1FT8A 3CJ3A 2F65A 3EPGA 1S1WA 2E44A 1QTMA 4RW4A 4L3NA 2HHVA 1S97A 2HFSA 4RU2A 2CVIA 4KH0B 3GIMA 1HHQA 4RUAA 5L8RC 3TVYA 4AUKA 4I6WA 1FRHA 2DTJA 3EX7B 4I56A 3PM9A 3HP6A 3CJSA 3CC7S 4BHQA 4ILRA 1IQTA 3RU0A 1C1CA 2XMVA 4WFYA 4G3IA 3M05A 3QT6A 4M63A 4KYZA 1N56A 1KOOA 1EP4B 2O67A 6AT1B 1FNOA 3PJ9A 4NRUA 4LF9F 4P9SA 1FHTA 1WEXA 4JB8B 4NE9C 3A4TA 2GQQA 1H0HB 3EMTA 2BANA 9RUBA 1JJHA 4LF4J 4IH6A 4ZS6A 2UUCJ 3V6DB 3MPYA 2K2PA 2VV5A 2FJVA 5KFJA 4LFCF 3RRGA 5D4LA 5AXMA 4K4XA 4FF2A 2HHXA 4BDPA 1NH7A 2J6SA 3EXCX 1N36J 1R0AA 4JI6F 1X60A 2MQNA 3BZQA 2QFIA 4WFZA 3PXGa 2WVCA 2YH0A 2OPQB 4U7CA 3QT7A 3DU5A 4F4AA 3HHNB 4CLYA 2UUBF 1I94F 3KLHB 3D54A 1ZOTA 2QZ8A 4XO0A 2IJFA 3SCIE 5M2PA 2HGLA 3KLGA 1YBAA 5AE2A 1KDNA 2IJRA 5J2QA 2CVEA 5KG1A 4DV3J 1W2IA 3KNGA 3U1LA 1MMNA 4FYXB 5IM0A 1FFGB 4NRTA 3M7VA 5CXTA 2UXDJ 3H40A 4RR5A 4TU7A 1DAXA 3NNAA 2M8HA 2HHHF 3DLKA 4N56A 3GU0A 4Q0BB 2GAGC 3P3DA 2JEGA 4C0HA 4ETXA 1H72C 2YKNB 3TX8A 4Y6IA 4JV2A 2IA6A 3ENQA 1GTEA 3IWLA 3RB4A 3BGLA 4WK3A 1VHIA 3BKUA 2AJFE 4OX7A 1VQMS 3D28A 3DGVA 4IO9Q 4ZJQA 3GFZA 1H98A 1TMJA 3DHXA 4ES1A 3IGNA 4DPYA 5KFAA 2LXIA 5GAHI 4UF4A 1X0FA 1HNVA 3NBPB 1L3KA 3FSXA 1MU2A 4CTAB 4ZVRB 4Y2KA 2DEJA 4C4WA 3DC2A 1GTHA 5FDLA 1IKYA 4IG3B 3G87A 2AYGA 1ZAWA 3HCXA 1RT3A 4NL5A 1FF2A 4F25A 2FGOA 5G0RB 3HDSA 4ZJLA 2FJBB 4DX6A 5H1SV 4DV1J 3MUVP 1IKVB 2GJFA 2AX0A 4ZPAA 2GV1A 2BR0A 2Z2YB 5J1NA 3PO5A 3UN2A 3OXFA 2E9RX 1LFPA 4PQUB 2D9PA 4DV0F 1N33J 2GHPA 3ILOA 2BRLA 3OTCA 3CNQP 3TQ1A 4IKAA 2OIHA 1IBCB 1T95A 2CG4A 3V2UC 2YNIA 1T05B 1YZ6A 4YY3J 3GCWP 4CLUA 2UXBJ 2U1AA 2W2QP 2H51B 3JSRA 4CLKA 2WONB 1Y0HA 3GR0A 2IHR1 4EI2A 2FGCA 5BR8F 3MMBA 1OY8A 2JOQA 2HK2A 1OPZA 2JWNA 4CLTA 1Q5VA 4PUOA 4DQQA 3ZTSA 3T9NA 1GK8A 2QG9B 3NOCA 1ZBTA 1FXLA 2F63A 1GMWA 4JI7J 3UVJB 4UOGA 3T6BA 5CCMA 1HR0J 1KR4A 4X4VA 2FLNA 1WORA 1PSDA 2NZCA 3HJVA 4DI6A 3BSCA 3AD9C 1MLAA 1S77D 2OPPA 3MR5A 1WG1A 5T7LB 1TV6A 1LWEB 4KO0B 4K4TA 3TP2A 4QIEA 2HLTA 3QGPA 2J7WA 2IC3A 4ZP8A 2KZZA 2CNNB 2ZUAA 1OSDA 1WC0A 3VAKA 1BQNA 5GAGI 2CG8A 4LJMA 4DOZA 3JAMU 5ETSA 3K5MA 3ZZPA 4QZVB 1VYAA 1VISA 2WZ1A 3R7SB 1CJKA 1UVKA 3KFWX 4U7UD 1R8PA 5SUHA 2C3MA 1U1QA 1UJ6A 3CIZA 4DCOB 1IJFB 4OZ1A 1N5QA 1AXQA 4UQGA 3N6LA 1VR6A 4PXCA 1UVJA 4Q8EA 2ASLA 3S6EA 1TK5A 5MAOA 2C1EB 4R25A 2BJ7A 5GMKa 4MTPA 1M5HA 3L3CA 4OI2A 1IBKJ 1P8GA 2I8EA 2DB1A 1NLKL 4M5GA 5E2QA 4EBCA 4YB6A 2ZD1B 3HZGA 3K8WA 2KM8B 1N32J 3EXYA 3SCLE 2B7BB 3KK3B 2F4VF 1K47A 3LGMA 4OV6A 4HACA 3TR5A 2R2TA 3H4BA 3AJ2A 1S0NA 3LP0A 1XNQF 1Y00A 3H2VE 3QZ7A 2ZHAA 3NGUA 5K5MA 3PW5A 1KN6A 1J5OA 4NASA 4QIVA 5GADU 3CCWA 4F26A 3NGSA 3W65A 4ZHRB 2D1CA 5DRKA 1NSKL 5AT1B 1NJZA 3R1HA 1M1HA 1KRPA 4JV5J 3NMRA 5F8LA 1S59A 4K4SA 1SH2A 3CSKA 3MHYA 2YH1A 4QPTA 1JJCB 4KBIA 1SC6A 5F9LA 4ID5A 4KB7A 4M5DA 5B0CA 1C0TB 3CEDA 2OTLS 1FWLA 3QFWA 1JLEA 2XBPA 2V2QA 2L9NA 1HLWA 1YJWS 1N88A 2ZBPA 1IKWB 3TA1A 2ZM6F 3ILJA 3UDCA 1VLOA 1S57A 1R0BG 2Q6BA 3ULHA 2HQ3A 2GQCA 2L9WA 1TZ0A 3C66A 2Z56B 4PCQA 1P9YA 2COLA 1ZZFA 1FK9A 1WJ9A 2VG7A 2YNFA 2Y3YA 2E9ZA 4Y28C 3D6TB 4G1PA 4AT1B 2HWIA 4GRSA 2DT9A 3DLLQ 1YZ7A 2XI2A 2RS2A 2C3OA 1VJQA 1RTIA 3OR2B 1FEEA 4UZCA 1JXEA 1RHMB 3MM7B 3QJLA 2CJKA 4C11B 2W8KA 1PCAA 3GYXB 4GVLA 2K3KA 2ZDPA 2D41A 3R6LB 4P71A 1HWJA 1S4FA 5KG7A 2F9JA 3WBZA 4CT9A 4IFYB 1VQYA 2QMWA 5KFMA 2RILA 1Y3JA 3SYZA 4LF4F 2MZRA 4Q5VA 2HVDA 2C2EA 2H5JB 3HM9A 3E51A 2Y1IA 3PJXA 1X4BA 2XGPA 4K4ZA 4IH7A 4ECWA 2FLLA 3QO9B 2NUUG 2V8PA 2KT5A 1G3OA 2UV8A 1LKZA 3PIPQ 4F2SA 4P2XA 1KVIA 3BDEA 3P6YC 2ZZMA 4DV6J 5KT4A 2ILYA 4HHHA 1KQKA 1XNRJ 5CCLA 4FNHA 3LP2B 1N36F 2Y0SD 2RDIA 1LOUA 2W9BA 2BX6A 3DXBA 4FPIA 4GO5X 1BC6A 4LRDA 3M32A 1GXTA 4CWBA 2HKEA 1RXOB 2RRNA 2V2KA 3AAWB 3PIOQ 2JLGA 1HNXJ 3VGSA 1MMLA 1Q79A 2LQJA 2NUHA 5AXKA 2QL7B 4IOCQ 4DV3F 4M5MA 2ZEJA 3ZTQA 4QCLA 1IR2A 4FPRA 2PA3A 1SBRA 2DGOA 2VFVA 2MZ1A 1QLNA 4QW8A 4NCAA 3DLBA 2EG1A 2LP4A 2Z8QA 4DHVA 2WVDA 4R0JA 2RU3A 4IRCA 3IS9A 2J5AA 4M5KA 1NAQA 2QRRA 2ZUGA 1IWAA 1O8BA 2V8GA 3WC2A 2EXUA 3JS9A 3OD2A 5L1KA 4DZ6A 4ICLA 2B8PA 1VRTA 1K8AT 2B8QA 2RF2A 2KN4A 4ED7A 1JJ2R 3OHBA 1FKAF 1RAIB 4OZLA 4PYAA 5J1PA 3L7UA 4M95A 3MEDB 3MFIA 1Q7YT 3ZZTA 2W9CA 2XMMA 5F3ZA 2EFPA 5HQLA 4KKOB 4I4BA 3UD4P 4ZLLA 4X4TA 4C0BA 3DDIA 4CI0B 1VMBA 3E3XA 3ZZRA 3DYAA 2V68A 4EYHB 5D4NA 1RT5B 2D9OA 1Y3KA 1RT7B 2CA9A 2MQMA 1TQLA 1FJ7A 4UUXA 2MSSA 4ZOSA 2XQCA 3TUZC 3BSOA 2E5JA 3KLIB 3UDLA 3HSZA 2JEIA 5HO4A 1CJUA 4RWWA 3CMQA 4Q43A 4YUDA 2KO1A 1REVB 4WCEQ 2LKZA 3FNNA 5T41A 4P2SA 4GC6A 4DV4J 4TNOA 1YRUA 5CABA 3GIKA 2ZH5A 4DCPB 5B7WA 4DV1F 2R7VA 3LANA 4CNZA 2UZAA 4OI4A 2H54B 4C8NA 3B78A 5KFQA 4EGLA 1HNIA 1EETA 1XR7A 1F2GA 1FRMA 1WC4A 4DR3J 5B0AA 3TW0A 4MMOA 1CBKA 2J6UA 1DURA 5HI7A 1WC1A 1N33F 1QM9A 2XY6A 1YBUA 4OJHA 2POKA 2MQ8A 4UY85 4PG5A 5L39A 1N5YA 2WB1D 3W5ZA 5KFZA 1Y7PA 2IM2A 4RW9A 2FVSA 2JNJA 4G1QA 4L75A 1F9HA 2LA6A 3NKYA 1RT1A 3JTNA 3GFYA 4YY3F 2UXBF 4FF3A 2VG5A 2CJYB 1IJEB 3NG8A 4HI2A 2N7CA 3G8TA 3NWRA 2XLIA 4IRDA 4L73A 3TJAA 3ITHA 4I68A 2DPIA 2ZDOA 3BQ2A 5HATA 1N52B 1H3DA 3JTPA 3GG0A 4LR7A 3R7BB 4OJ1A 2RDJA 4DFPA 3MR7A 1XK8A 3AOBA 1KHVA 3IAS9 3PRVA 1PAEX 1H2VZ 3W62A 3IAM9 2WVEA 4ID8A 2PN6A 4NLTA 3UQSA 4OX9J 1BXNA 2CYYA 1U0HA 4S0MA 4WXOA 4JI7F 4ILLA 1MN9A 1VGYA 4DQIA 1R8HA 1HR0F 3RBDA 4JV0A 2FUG9 1MWYA 3KMQA 2HQFA 4H4KA 2VONA 3SQGB 3SI8A 4B9LA 1XBWA 2KJVA 2PE8A 2QGFB 1TL4A 2HK3A 2RRBA 2X7IA 2YKOA 1GMUA 3D0GE 4USHA 1UL3A 2Z4PA 2CPYA 1RU1A 1FE4A 3NXZA 4AQYJ 1S6QB 1N6QB 4Q2MA 3D67A 1AB8A 4H4OA 4DSFA 2FVPA 3DKDA 2X1FA 1KLNA 2EC2A 5HBMB 4PAAA 4F67A 4PWDB 4H4KC 2C2RA 3R5BA 1EJ7L 3TNVA 4J37A 5CZVA 3EGNA 3TRGA 1ZPVA 1KD1T 4WKRA 2ZWPA 3MPVA 2H4WB 3UN5A 5D0RA 1WC3A 2I9SA 4U96A 3CO9A 3MEGA 1U2CA 5B09A 1GFWB 2CQHA 1IBKF 3E01A 2QTWA 2H1YA 4LBIA 2BM0A 3C6TA 1FI4A 3MM6A 1RAGB 3MR3A 4DR2J 1M1KT 3D1OA 3IWXA 1YJTA 5DS7A 4YS2A 4U8VA 3US5A 3TARA 2XM3A 1N32F 4JI2J 2HHTA 5CHCB 3EM1A 3CTRA 4MIWA 3HX9A 3FVYA 1IQZA 2V9WA 3D3BJ 1X4AA 1HKAA 3T5HA 2I5JA 1F9EB 3UI3A 2DISA 1SH0A 3AQOA 2HG4A 5FIIA 2UVVA 2GA7A 4O44A 5KFNA 5I3UB 2MZSA 2M2BA 4C97A 5GAEI 2R2UA 1LK7A 1KEKA 2A6OA 1AUDA 3FMBA 5D0GA 4JV5F 2ILZA 2CPXA 4FDFA 2Y9HA 2MQPA 2L08A 1L3TA 1F0XA 1D8YA 3OFEA 2MYFA 4USKA 3CCJS 1HI0P 5KFVA 4AYBD 3H20A 5B08A 3K17A 4IFVB 3MM8B 2E1RA 4V19X 2VKZG 3KOAA 2HFUA 3AQPA 2XS5A 4F0HA 4F36A 3KG1A 1NSAA 2RHSB 1LW2B 2KHDA 1R6YA 2RD5C 2DNRA 1WTFA 1B0VA 4X4NA 2KRBA 4QJVA 2IM1A 1R89A 2JLFA 3BGOP 2V2ZA 2CQGA 3KK2A 1OQ6A 1F2HA 1S1VA 3O6QA 3CDEA 1F1BB 2QFJA 4KPYA 3DGPA 1RTDA 3Q8SB 1PBAA 1O51A 5HQMA 4L3KA 4LRFA 3NCQA 5KG4A 1U1LA 1PJ7A 1SUQA 3MR2A 1RAEB 5HANA 1FDAA 2R7RA 2DNHA 4P74A 4RNFA 1QY7A 1NU4A 2PEBA 2UV8G 2JJ4D 4YHHJ 5CQGA 5A2QU 2ROEA 3QSIA 4NLPA 1IM6A 4Z37A 1NJYA 3PX4A 5ETNA 4LVOP 3EE3A 2IAJB 2XLJA 4DF4A 4OX6A 3EVWA 3RZAA 5H9FJ 1WI8A 4P72A 4X4PA 1WF0A 3C6UA 3RRHA 4A8MP 2GW8A 2C42A 1XNRF 2MLXA 4DCJB 1X8DA 3A12A 2PI5A 3K0JA 2KHCA 2JL9A 2A2CA 2KXNB 2J9EA 1U6BA 3HK2A 3VF0B 3V4IB 3VALA 3EJMA 2PMHA 4I67A 4FBTA 1JLGB 3HHEA 3K58A 1U8SA 1FE0A 1HNXF 5M2UA 3BGFA 3R5JB 4KQZA 3PG9A 5E5NA 2ZBCA 3OTOJ 2WBMA 3PFEA 3KK1A 1HBNB 2IVMA 4K2JA 3GB0A 3NGKA 1IUJA 3JTOA 5J2NA 1Z1ZA 3BO4A 2ZOMA 1MROA 1FNXH 1PBUA 1KVJA 3CIMA 3IWNC 5DGBA 2LYVA 1ZM3A 2Y1RI 4CM0A 1TUWA 4FXVA 2DR5A 2DRBA 4OYOA 1MG7A 2P9CA 2ZJRQ 1LXJA 2O1PA 1HD1A 2GO9A 2VA3A 2CPEA 2G2YA 3PYEA 4OI1A 1PYOB 4CH7A 2BJDA 1YWXA 1VC5A 2GAHC 3OFGA 2QMUB 5KFRA 3JSMB 1TL3A 2RT3A 2AU0A 4EBEA 1VK8A 3C15A 1HMVA 1UEUA 5EUHA 5HLFA 1J27A 2BRKA 2I2YA 4QR0A 4ANEA 2IMOA 2Z2MA 5DM6Q 5E3PA 4DQSA 3K2YA 1RAHB 4KE5A 4Y2MA 3VZIA 1VQ7S 3AODA 4R8UA 3IR6B 2BVZA 2W2MP 3IP0A 4OHZA 5BYQA 4WZMA 1LW0A 2OTJS 2ZC3A 1X31C 1OY9A 1RLDA 3HLUA 5GMEA 1RHJB 3K59A 1SV5A 1U2FA 4RBUA 3VAJA 1C4CA 4ILMA 2QMXA 2ZVSA 2B4PA 2LEPA 2XTJP 2CQ3A 4P73A 3IM8A 1SCJB 2BOPA 1TKDA 4ZITA 1T9XA 4DV4F 3TJ8A 4U6PA 3CMES 4B02A 1H2TZ 3WDOA 1M5VC 4J9NA 3FGVA 3DLGA 4YFUA 1UJ5A 2MB0B 3HSJA 4R5PA 4DR3F 4C8KA 5AXNA 5MLCV 3DM2A 1FRLA 2C2NA 4ZN1A 1S9FA 5DDRC 3M8YA 5GAGU 2IY5B 1MSWD 2HNYB 2M0GB 4Y65A 3W5XA 3MD1A 1S1TA 1HQEA 3KLFA 4BWMA 3DRXA 3D1QA 3J7Z5 2VBYA 1TL7A 3IM9A 1FRIA 1ZAVA 3CMAS 5F3TA 2N7YA 1E6YB 4ZP7A 3GJRB 2VQEJ 1HPZB 4NLQA 3MPUB 2C2MB 3I31A 2KH9A 2M52A 1RKIA 4FS1A 4ITSA 4B3OA 1S12A 2AD9A 4RUCA 2NXEA 2WVBA 2OGUA 4TLRA 2OFGX 4F4KA 4E98A 2XSFA 1SKUB 3K5NA 2YWHA 3HFKA 2FJXA 4ZPDA 3I55S 1VQNS 4V19J 1WELA 1JLFA 2FDNA 1QAJA 2UP1A 2EBEA 4ECYA 3RAQA 2VPZB 1SQGA 2CPDA 5CD4A 1DBDA 1S1UB 1RADB 1RWKB 3R2CJ 4PG7A 4LT6A 3VAIA 1E6VB 3T5KA 3VV2B 3VVTA 4TKTA 3A8KA 4C8YA 3V4MA 1IXKA 1EKSA 3N9UC 2AJQA 2DHHA 1K0VA 2XMWA 3D1HA 5D0EA 5E7OB 3TZXA 2W25A 2MSTA 1VHFA 4OYMA 3DRSA 3M9MB 1N5VA 3BO2A 3KHRA 4AQYF 2UVUA 1DQ8A 2IMWP 4WFNQ 4RWXA 3AD8C 4JP8A 3QRRA 3R27A 1Q8IA 4LRBA 2J0XA 4OHYA 1C1BB 2AW0A 1AW0A 3T5LA 1X0PA 1OJ4A 4X66J 2DNLA 1JLBA 1WOSA 2QC3A 2IPOB 1WDDA 1K9MT 2VG6B 4JUZA 1QUVA 1B0PA 3MECB 5AXLA 2BJ3A 4CM2A 2CRLA 3GSDA 3KHGA 4J9OA 1I51B 5C25B 3I5BA 3POTA 4QR2A 2OPRA 4RW6A 3ET6B 1XMQF 4WYWA 1DTTA 2XYHB 3FZ2A 3M8QA 4DR2F 4ZLPA 1OMSA 4JI2F 4M94A 2XI3A 3GLJA 1MN7A 1M1GA 1BMQB 3JSYA 5I42B 5DQIA 2W7PA 3L09A 3GJQB 2HHQA 1FDDA 1SB6A 1TELA 7FD1A 3HHKA 1WKLA 3I96A 3ZFVA 1LWCB 3DOKA 4ED2A 1YRXA 2XMKA 1RWMB 5L9XA 3PEHA 4YP3A 5C42A 2FB0A 2VDHA 1HI8A 4WP3A 1IKXA 1VK3A 2IYIA 1KQSR 3FCVA 3M6VA 5AJ3F 1RTJA 1GT8A 3ZNUA 4GKKJ 4LUBA 5DDQC 4LMZA 5IFMA 3UDVA 3UN3A 1AZSA 5C2GA 1LV5A 1S9EB 2G0CA 4AFFA 2E66A 1ZTTA 1UCNA 4AD6A 1YVFA 4WIIA 2YBVA 3Q0AA 3QT8A 3ONQA 3L7PA 4M5LA 5IQ6A 3VR1A 4MFBB 2KDOA 2LQ9A 4LF7J 1JLQB 3IBCB 1LFWA 2VODA 3BR8A 1YJRA 2AHOB 2CNOB 4U9RA 3HVTB 3G82A 3S7RA 4ELTA 4B9NA 4KGZB 3Q89A 3QT5A 1S4EA 1BQXA 1S49A 2EFVA 4A8XA 4F4XA 4I2PA 1SVDA 2JFKA 4KY3A 4TY9A 5A8RB 4MYTA 1UVNA 5KT7A 1HL6A 1UWAA 1TK0A 2F4FA 3MF5A 2KYZA 3DXSX 1Q82T 4OLOA 4TYAA 4DS4A 1RCXB 4YHHF 3LTOA 4A8WA 2GNKA 2YVSA 1QE1A 2DGTA 3CJ4A 1JLAB 4DPTA 3ZZYA 5CYQA 1T3OA 3PHEA 4M5IA 3PW7A 1M90T 2LEAA 5F8MA 1HBUB 1FWKA 4K4YA 1P6TA 1FKPB 4ZVOB 2IDLA 3CJ2A 2XSJB 3MM9B 2RNEA 3Q2TC 2MKIA 2JEJA 4LRAA 2IVFB 3EICA 4WFAQ 1F5BA 3LALA 2QLXA 2KM8C 4B3RJ 1G1XA 1ULRA 4A8YA 1RWWB 1X9WA 4OZ0A 3I0SB 2V6AA 3CCES 2BQRA 1XR6A 2DITA 1EQMA 1RT6A 1N34J 2CJAA 3OTOF 2DR7A 2N3LA 1X4EA 3N6NA 3BV8A 1S6UA 3JSBA 2HVZA 1NB7A 1JLCA 3R6GB 2HHUA 3B6BA 4RX6A 8RUCA 3NS6A 4C0OC 4QYZK 1C4AA 4NMXA 1HYSB 4OYWA 4AL7A 2GMLA 2AZ3A 5LJ5Y 3A13A 5L38A 2NZ4A 2QA2A 1S0MA 4U67Q 3CDUA 3D7SB 1NB2A 3NS5A 2ZE2A 4I6YA 1VQ4S 3RAMA 3QIPA 2ZH9A 1T02A 2MKSA 1HI1A 3OPKA 2BKPA 3HHLB 4G6VB 2FPHX 3M2RA 4DLGA 1Q8BA 1UW4A 2WB4A 2VOPA 5ETLA 4CYUB 2KJWA 1FX4A 5JUMA 2MPUA 2IVYA 1XMBA 5E33A 1RISA 1FWPA 4IR1A 2A0FB 4P7TA 3ENVA 4DS5A 3R5AA 2EK1A 3R7NB 4ECXA 2JX2A 1V3RA 4DR1J 2R42A 2PSZA 2W2OP 3I4HX 1M5SA 1RGVA 1TKZA 2GVDB 1RCOB 4F3QA 3GV8B 1W2BR 4ED1A 3M8SA 3FMWA 3Q8UA 1QVGR 4X4UA 2JEFA 5J2PA 3M6XA 2MKKA 1VBYA 4FKYA 3GE9A 3O1LA 2J9DA 4DSKA 2DJWA 3H2LA 3PDNA 3ZZOA 2FHJD 4NEZA 3DOLB 3RW7A 2Y0BB 3TOQA 4EU0A 1HBMB 2G1DA 2J8SA 1M0SA 2A6MA 1TK8A 2NPFA 3Q22A 1RDRA 2BOAA 2J6TA 2P6SA 3TVZA 1FXDA 4LFBJ 2KG1A 2MY8A 3T1YF 2LMIA 3J7AN 4Z7CA 2CJ9A 3LPYA 2ALYB 2B7CB 2YY3A 1YJ9S 2CQCA 5A8KB 2YNHA 3CJKB 4MJKA 3SSQA 1S10A 5HMYA 3FSYA 2OO4A 5HVGA 4FS2A 3K5OA 2GJ2A 2CJQA 3PO4A 2K3IA 1R8CA 4RNOA 3VZHA 3OSPA 3UWTA 3DLJA 1RT4A 3DRYA 2VQEF 3PNIA 2BE2A 3T1AA 2E7VA 2R8HA 4NI2B 5I3PA 1MW7A 4DL7A 4DEZA 3MM5B 4B9UA 1T9WA 4F0KA 4F3MA 2IDEA 4X62J 2XNRA 2BABA 2M9KA 5CYMA 1VFJA 3DI6A 3EZ5A 2JRSA 2FIUA 3TAQA 2KB2A 4HVZA 3NP5A 1UW9A 2V94A 1TAQA 3K89A 1S1WB 3M9OB 3AB4B 4YB7A 1T8EA 4RW4B 2OELA 3DDKA 3LP1A 3ENAA 2CQBA 2MZQA 3AHPA 2OPSA 2WOMA 3RUBL 3SQOP 4M5HA 4UQTA 1VRUA 2R7QA 4CQ1A 4DZDA 5D78A 4FYYB 1NK8A 1MWQA 2WW8A 3MPWA 1RZMA 1BHNA 4DQRA 1U2RA 3KDNA 2Q6CA 2OKQA 1X9SA 1C1CB 5HMWA 2XS7A 2ZVIA 1CS4A 3T3FA 2R7SA 1YX2A 4P52A 5HK4A 4DSIA 2A3JA 4ZCKA 2F1FA 3OR1A 2J76E 3AXMA 2BANB 2UXCJ 4ZP6A 4BLGA 1CULA 2ZH4A 5EX0A 2HQIA 3M2UA 4X66F 2D3UA 3U02A 3GFXA 2GVZA 1FERA 3FCHA 1EAYC 2KZMA 5KFLA 3CCUS 3I5CA 3C14A 1YJ7A 4I0WA 1MWZA 3CD5A 5KTQA 3BB5A 2BJ1A 2OD4A 3LAKA 4W4MA 3W9HA 2DHGA 1R0AB 2KVIA 3OJUA 1R3NA 2IM3A 3V5RA 1RTZA 1RLCL 3BF4A 4ED4A 2YKMA 5IT9Y 2QO3A 2M8DB 4ZP9A 1YIJS 3PV8A 3T41A 2E7XA 1XERA 3J81Y 1WC5A 2XCPA 3M8PA 1KVKA 2PA8D 5KG6A 2OMLA 2KKHA 4N41A 2HWHA 3PTWA 3BBBA 3KLGB 1U1PA 4XDCA 4F2RA 5DDOC 7AT1B 2E5IA 5J2QB 2GO8A 1QDUB 5E41A 4ECQA 1EB0A 3QZ8A 5IM0B 5KFWA 4NWBA 5L9NA 2BYCA 5K14A 2RS8A 2HFZA 3MCNA 1Q5YA 2VFTA 2AJ4A 4B3MF 1VS3A 2D3O1 3DLKB 4PQAA 5IOLA 3PRDA 1NPRA 2HNZA 4I2QA 4P10A 5KFEA 3HHLD 2AKWB 4GKKF 3D66A 5JJBA 2HSEB 2BA9A 2A18A 1NK4A 1ZYQA 3H4DA 1RWXB 4TU9A 2J9CA 3SFUA 1HA1A 4OJ3A 1UA0A 3CC4S 3ZTPA 2LDYA 1B3TA 5LMUF 3HKWA 4O3NA 4L74A 2YXLA 5A6WA 4M5NA 3TA0A 1VCTA 2HMIA 2W1BA 4LF7F 1DTQA 4NZ6A 1HNVB 2CXEA 1TFWA 1XTZA 1L3SA 2RE1A 3QATA 3KNAA 1TR0A 2W4PA 2XMTA 3SZ2A 1MU2B 2K1RA 3NLCA 4TXSA 2KVQE 3CJ0A 2HBZB 1PYSB 2ZHOA 4PYDA 5KFSA 5FDLB 1IKYB 2YX4A 1RT3B 5LM7E 1FCAA 4LBHA 1NHVA 2EEYA 2ASJA 2EC0A 4TVAB 4LBPA 2CDQA 3RBZA 3P4UB 1WHWA 3V81A 4RU9A 2GC8A 2VFSA 1BY9A 3J80U 4O3RA 1TMMA 3MXHP 5L1JA 2KU7A 2OUGA 2V4JA 4F50A 1M5OC 2HAIA 4ER8A 4IO1A 3MTJA 5ADZA 5KG5A 2I38A 3W61A 2QSFA 3LO3A 1NEEA 3MMAA 1GNKA 1K1SA 1RTHA 1WHXA 2YNIB 3K8VA 4LSNA 2QLFB 2EW9A 4B9TA 3BS9A 2OD6A 4DLEA 1NNDA 2E29A 4NZ0A 4ECRA 4DFKA 4LF8J 1VQOS 3M9NB 2VB6A 4KIAA 4L6V3 1BUXA 4NXNJ 1QUPA 4CLSA 4B3RF 2DNNA 2NYHA 4I64A 4UT4A 4FBUA 4C3LA 2QJ3A 3P8BB 1DQ9A 1KP6A 4PWUA 2AX1A 1TAUA 2ALZA 1IN0A 1RSCA 4M1KA 4YB1P 1N34F 4NLOA 3MMBB 4TU8A 2MDAA 3I87A 1VQ5S 4LREA 4PUOB 3NY0A 4USUA 3MMCA 4TY8A 3BQ0A 1VRQC 3PYGA 5IXUA 4ZCLA 4MAKA 3F0NA 4O3PA 5IV4A 4DQPA 5IS2A 2QLWA 4NLRA 3R3TA 2LFVA 2VFUA 2HQCA 5AE3A 3OTBA 1RAJA 4FZVA 2EKYA 2OPPB 3TEGA 2W01A 4EK2A 3I9V9 1TV6B 2ACYA 1HHTP 4JI0J 2PEHA 2IC3B 3DOMA 1WEZA 2YKAA 4DSLA 3Q8QB 1R31A 2PD1A 1BQNB 2C2DA 2J7KA 4A4JA 4DDFA 2G1HA 2UVRA 4ED6A 4TN2A 1XJWB 1U48A 5KFIA 3THPA 1CJKB 5LJ3Y 3DN9A 4DN0A 1YI2S 1JX4A 4O4GA 3TX0A 4DR1F 3QSYB 4Q44A 1PKUA 1KLMA 5HAOA 2NR0A 3UDEA 1Q8KA 3SFGA 4UTGA 4ENOA 2FY8A 1TKXA 2J0WA 3A1YG 1EZZB 3L95X 2DY9A 3OTDA 3LW5C 2CPIA 5A76A 3QNWB 4P75A 4ES2A 5CAAA 3AT1B 3RBEA 2G0IA 3THTA 2Y8YA 1WG4A 1Q53A 1M5KC 1FKOA 3I0RA 2PO4A 4ZKAA 2VJUA 5A8WA 2MY7A 2YNGA 4LSLA 1KBRA 4ZPBA 4LFBF 3DRPA 4HACB 2KYXA 1WG5A 1ROFA 3M2VA 4O0IA 3EPIA 3LP0B 4EFAC 3W5YA 1U1MA 2HGMA 2QSWA 1J5OB 1TU0B 5KFHA 1SJQA 1REGX 1K1QA 3BSNA 3UPFA 1XIQA 1DLOA 1SC3B 2W2PP 2KTQA 2ZH3A 4DG1A 3OXGA 3JYTA 4ID5B 3W64A 4M5DB 1Y10A 5A0YA 2HURA 4ZN3A 3CT9A 4D3HA 2W8LA 4X62F 1NCLA 3W66A 4E0DA 4C8OA 1JLEB 1I3OB 1GAOA 3D5MA 4KPCA 1V5VA 1KS2A 1VQ6S 3R1LA 4ZPVR 1GX5A 4C8MA 4Y2IA 2JFDA 3KKFA 5C24A 1IBMJ 1FFWB 1U47A 4DPOA 2VG7B 1FK9B 3HD2A 2YNFB 2NSCA 2NS1B 4K0KJ 2G4BA 2B9XA 1F5CA 3MAAA 3SSSA 3IRWP 3ETMA 2ZZNA 3B8HA 1RTIB 2ADCA 2DGVA 1BE4A 3CC2S 4NA1A 3PW2A 3CWJA 4CO3A 1X5PA 5FLXU 2CZ4A 2FZCB 2RKIA 1TL1A 2NXNA 4GKJF 2WBRA 5HMXA 1NSPA 1BQMA 4KV8A 4LQ3A 3BM7A 1LNQA 2UXCF 2CQDA 3AFGA 1RA7A 1GEHA 2V8VA 4Y0FA 3CDWA 1T9TA 3G2XA 5HJXA 2NREA 3VVUA 3Q8PB 2IBOA 2ZZTA 3ISZA 5EDWA 3HSGA 2F5GA 1L3UA 1UPPA 2AGQA 2D3OR 1RE1B 4N8OA 1JMTA 1QSLA 2YKQA 1YTYA 6FD1A 2W9BB 4AE5A 4HYKA 2AMCB 5SZTA 3MR6A 1SJRA 3P5BP 3ISND 3BH7B 3M32B 5IT9U 2J8AA 3GV7B 4IG0A 4U95A 5HMZA 2XULA 4FP9A 2MGZA 4HH0A 2C3UA 4IYQA 2M5YA 5DETA 1BD6A 4X2BA 2RU9A 4LRCA 1RB0A 2DD8S 4FYDA 5DZ7A 3F56A 4LF2A 3KJVA 1CSJA 2DH7A 2YWFA 1NKBA 1GMWD 2XLKA 2EG2A 2BMBA 2VL1A 2XMJA 4Q2LA 4C6AA 1VQ9S 3HF5A 3GIRA 3G6VA 4ZK7M 3IS9B 2ZH7A 1W25A 5IWAJ 2DK2A 3M1VA 3OJSA 1BLUA 3RJMB 4URQU 3X1LB 1F5AA 2ATLA 1NPPA 3JQKA 4ICLB 1VRTB 1HBOA 2RF2B 2B3TB 2ZKTA 1RT2A 1N5SA 1SH3A 2VHGA 3FSIA 3D2WA 3R9LA 3WIVA 1NXIA 2W9CB 3OUYA 2HLUA 5IC6B 1Q4RA 5ETRA 4F4WA 4WPAA 2Z57B 2VPXB 2PGCA 2V50A 4ETZA 1J2VA 2HIYA 5LL6d 1U25A 3DYAB 2R7WA 4B17A 4FF1A 1FDBA 1LWFA 4QWCA 4HDHA 5CH7B 2KL8A 2ZNZA 2VPYB 4ZIVA 5HN0A 4OHVA 5H9EK 2GQ2A 2MEWA 1NK0A 1NJWA 1WEYA 4B3SJ 3NAIA 3L4BC 1CJUB 3T5JA 2XMAA 4KAIA 3R5GA 2KRRA 3ETOA 1YJNS 2LU2A 4OFZA 2GGPA 1FRJA 1PJ5A 2CQPA 2F40A 4B9MA 4USWA 3FEYB 3TYTA 5IT0A 4DL5A 5ETTA 5EX3A 1NRKA 1HNIB 3GWCA 1EETB 1AFJA 1JWWA 2EPIA 1ZZNA 1TKTA 1ZTWA 4X4SA 1Y11A 1FEHA 1K73T 3KG4A 1UMJA 1GXLA 1Q8LA 1D9AA 3SEOA 1F6TA 3PX6A 1R27B 1N5YB 2DNZA 4JI8J 3MUMP 2V8HA 3A3NB 4UZBA 3K7RA 3HT0A 1BWEA 4RW9B 4G1QB 3QFHA 1RT1B 2VG5B 3R5CA 3W60A 2JZ5A 1X4DA 4KH1B 4LF8F 3ITHB 4EZ9A 3OL6A 3EVOA 5THWA 2GIQA 4NXNF 1R43A 2MKYA 2VJVA 3M30B 2HFNA 4DF8A 1YJVA 3TVKA 1RWNB 3F73A 4Z7YA 4EUVA 3KJFB 2DCLA 4NMLA 2WCXA 2EBGA 2LVWA 2MJNA 4QU7A 2GZOA 1U0HB 4DR4J 1S7IA 5KFUA 5D8HB 4WE1A 3KUEA 2YX1A 4ZVHA 4RZRA 1FO1A 3EDRB 1YBTA 4WFBQ 3MOZA 1X4HA 2BJ9A 3T19A 3MEEA 3BBFA 2OEMA 2HZCA 4MKYA 4RW8A 1TL5A 3GP9A 4QOTA 3AOAA 3HVWA 5J1EA 3W2VA 3G96A 4JI0F 4FXDA 4MT1A 3RRKA 1ACMB 3MPDA 2ZJPQ 3VAGA 4EMDA 2ZOGA 2ERRA 4DL2A 3DCAA 2B9YA 2OAUA 2ZBRA 1RBAA 2RMLA 5EWGA 4C8ZA 1V6HA 4H4OB 2K06A 2XZTB 2AT1B 2EVZA 1EX8A 3PR4A 2YWEA 1H7XA 2LQBA 3FBFA 1JKHA 2HNDA 3CJTA 2QE5A 2B9EA 3RG6A 3ZXWA 1KFSA 1HQUA 2QYGA 5BJRA 1S1XA 1ZPWX 4RBVA 2V63A 2M3DA 3S01A 1M5PC 1HWKA 2AGPA 2XS2A 1EKRA 3BKTA 2DO4A 2M7SA 2BEFA 2RB7A 5LMNJ 2YQ1A 4IQXA 3MEGB 5HP1A 4ZIWA 3E01B 4YMEA 3CGIA 2W2NP 2Y1LB 3C6TB 2AEFA 3MM6B 3FZBA 4N8NA 2B5JA 2YWGA 2VPWB 2YQ0A 2RDDA 3DMJA 4ZVQB 4V1Ak 1YG0A 4LVNP 1SL2A 1IR1A 2QA4G 1DHMA 3C19A 2LXUA 1TVRA 2V67A 2I5JB 2DNGA 1ZETA 1OYDA 3PW4A 2VUGA 2BKOA 1PC5A 5D3GA 4O44B 4CLLA 1V3ZA 3GJTB 1WSRA 4ZLNA 3LWLA 3DRRA 3H59A 4KGKA 3HFZB 3D6HB 4BWJA 2HQGA 5ETMA 1PC4A 3RR8A 1KTQA 1H74A 2R8IA 2GX8A 4LR8A 4QIFA 2HIQA 4I7FA 3OVAA 4YOEA 2DY1A 4IOBA 3T9ZA 1U49A 1FVSA 4CLZA 4WTOB 4JI3F 4KR0B 1T03A 1T9VA 1ZM9A 3GPAA 3JAMY 2LU1A 5F8IA 4WP8A 3TA2A 2B43A 2R8JA 4ZVTB 1NKCA 1NK7A 3Q8YA 4TYBA 1FNMA 1DARA 1VC6A 2OSRA 1IBMF 2CJXB 1OPIA 4J90A 5HSPA 3B4MA 1SC4B 2BJ8A 4K0KF 4IQMA 3MZIA 2DGQA 4H54A 4JI4J 3G71S 1CJVA 3KK2B 1UWBA 3CDAA 4CO5A 1S1VB 3S1TA 3CW2C 3CPWR 3OFFA 2OI2A 4J91A 3G6YA 3DGPB 2PT0A 1RTDB 1D9FA 4LQ9A 1CVJA 4PXBA 1YGYA 4RW7A 3CJ5A 5E3QA 3SMZA 2EI5A 4ZDNA 3D0HE 3QLHA 1AROP 1B64A 1HBMA 2VH7A 4ES3A 1SJ3P 2JC1A 2GIFA 3H98A 2B56A 1X4GA 1HW9A 2H9ZA 5KOWA 2B0GA 2KI2A 4HTIA 4EBDA 2BBEA 3C16A 3H5UA 5F8JA 2ZHBA 4FF4A 3D68A 4NYZA 5IZHA 4LF5J 2Y1JA 3C6UB 4CO0A 1H73A 3HSDA 4W98A 1Q78A 3KLEA 4B3TJ 1FD2A 1OYEA 4DFJA 2NPIA 3OL7A 3TZWA 2ZOFA 4EZ6A 4KRWA 1S6PB 4QPXA 1CC8A 4LF6J 3PW0A 3A3PB 4X64J 2Q79A 3O8WA 4NLVA 1MMDA 1B0TA 4UUWA 4QBUA 3HPOA 2WSCC 1XMOJ 2FVRA 5HROA 2XZWA 3KUGA 1UVIA 2F9DA 3UR0A 5ETVA 3L9ZA 3KK1B 4XDDA 4HHJA 1WF2A 4N76A 4DJBA 5J2NB 4P2MA 3CJ8A 4KGXB 1MROB 3HZEA 4HDGA 3SSRA 5HVFA 4MKAA 1RWOB 1VBXA 1WF1A 4Y2CA 3Q24A 3B82A 5IWAF 2CQ0A 2IRUA 2CWXA 4A47A 4KHRA 5KT3A 2YPYA 4KFBA 4O3SA 1OQ3A 2X3DA 2D74B 2R8KA 3CJRA 4DV7J 2HW3A 1TL3B 2U2FA 4B9SA 3C46A 2GHWA 1AA1B 3BR9A 5F0UA 2JVRA 3C15B 1HMVB 4OYXA 5HLFB 1D0EA 2YQ3A 1WDTA 4C2MA 1C0UA 1A0OB 2HRUA 2DIVA 2FHOB 3OLAA 3BGRA 3BYPA 2B4OA 2FHKA 3B4DA 4MK9A 1N0VC 3QYYA 4CH0S 4R8UB 2ZH6A 3MD3A 2BQ3A 4KHPJ 2XC9A 3RB6A 1LW0B 3GILA 3FQLA 3BPDA 2R2SA 5JVHQ 2V0NA 2RRAA 1SV5B 5F0WA 5D4OA 1XMQJ 4NCBA 4B3SF 2FHMA 3H2UB 1YHQS 2DCUB 2ZH2A 4TLQA 3FRZA 1WACA 1NHKL 2N4DA 4H4MA 1S9GA 3P45B 2DXFA 2H48B 3LQVA 2VF3A 1AFIA 3FC9A 3H5SA 1T3NA 3HT3A 2GFFA 5F8GA 1IWGA 4A8SA 1RACB 5D4PA 2HAFA 2CJBA 1RWUA 2XYGB 4QYZJ 4ZVGA 3DLGB 2AYMA 1YKWA 1URRA 4R5PB 2B6AB 4ED0A 3DLEA 2DNKA 4DV5J 3DM2B 3UNGC 2FJWA 2BE7D 1R7IA 3JB9k 4KSEB 3P96A 3MAQA 4J9QA 4JI8F 2GS8A 2XWYA 2MMYA 1S1TB 1HQEB 3KLFB 4GVBA 4UOHA 4RKUC 1TL7B 5AJ3J 3CCMS 5DG7A 1OS5A 3O2IA 2HZAA 4IDKA 4DBQA 1T94A 3UE2A 1GMVA 3GR1A 3NEKA 2G9OA 2VZ9A 2O5DA 4J9UE 3ENWA 5J2MA 1KONA 2X1AA 1SQFA 3PHTA 1NJXA 4B3OB 4WJBA 4FN5A 2JLEA 3TAPA 3IG1A 3PRBA 5I3QA 3MCMA 1QAXA 2PFFB 2NLWA 4OHXA 3ZO7A 2Z0GA 1JLFB 4DR4F 3BN4A 2W4DA 4DUYJ 4NCGA 1FRKA 5LT5A 1UVMA 3LUYA 3PKMA 3SDEA 1X5TA 1IVZA 5EWEA 1PGZA 1IBLJ 4PZVA 2G2OA 1WHYA 2ACMA 1CQMA 3RW6A 4TQRA 1SJ1A 3GMGA 1RWPB 1CJTA 4XK8C 2F7VA 2RQKA 1V5IB 4UY8T 4DPWA 3DRSB 3JXOA 1UFWA 2C2OB 3Q23A 3BEGB 5K8NA 4QR1A 2RHQB 3BGUA 2BW2A 4OI3A 3GSIA 3IFEA 5KFPA 5GMDA 4IUFA 2Z58B 1Y5NB 2M88A 3EDQB 1JLBB 3IRXA 1IM4A 1UEKA 1D09B 3KHLA 5GAHU 1KQGB 2L9DA 4WK1A 5ITHA 1R0CB 4NLWA 3TZYA 3M6WA 2XZDB 1YSJA 5KFBA 3P49B 3V6KA 1RYSA 5LMNF 3TAMA 1PYTA 1QAIA 3POTB 3IGVA 2OPRB 4RW6B 1WTBA 4ZCIA 2H4YB 1DTTB 4Y2AA 2DNOA 1T11A 3M8QB 2BW7A 3W2WA 2DR8A 3FFIA 2YTCA 1D1UA 4ED3A 4FNIA 4B08A 3VGUA 3FBEA 3OVBA 2E9TA 2QL5B 2KFYA 3CXCR 4ZVUB 1WD6A 4YEAA 4Q7AA 2M70A 2E1AA 3NCRA 4OI0A 4LR9A 4CZCA 2C2ZB 4YB5A 3Q8VA 3DOKB 2WAQD 5KFTA 2N4CA 5K9FA 4DU8A 3PFOA 2CPZA 1WNEA 1RAFB 3N28A 4RUBA 5C42B 2JHEA 2P9EA 2ZNYA 1NUEA 1RBOB 1IKXB 3PYDA 2V8DA 3MWBA 3ADAC 2OJ3A 1EP4A 4DWIA 3ISNC 3O5TB 2PIIA 3MCSA 3T1HJ 4A48A 3GYGA 4Y34A 1SXLA 1NSQA 4OMFG 1RTJB 2FLOA 3TZZA 3MOJB 3UW1A 4I1TA 2DHSA 2FVCA 3UO0A 1AZSB 2W24A 4PPDA 1R6VA 3QJJA 3TANA 1PILA 3V6DA 1GH8A 3UD3P 4PG8A 2CNKB 1XC9A 3P5TL
chains in the Genus database with same CATH topology
2J9DE 4YDDB 1N52B 3RTVA 3SXLA 3NWGA 2W7AA 3HI9A 2XY7A 1H3DA 3JTPA 1VJWA 4WU3A 3MXHP 2QV6A 5L1JA 3DRRB 5B0FA 3GG0A 2KU7A 3V6HA 2JC0A 4OJ1A 4DR6F 5FJ4A 1VI7A 1NK5A 1U1KA 2V4JA 1F9FA 2RDJA 4DFPA 1O0PA 4F50A 1M5OC 5CZXA 2HAIA 1XK8A 1KHVA 4GMKA 4IO1A 3MTJA 3IAS9 5ADZA 4JI4F 2JSXA 5KG5A 4HKQA 2I38A 5E3RA 4I7FB 4XIUA 1H2VZ 2QSFA 1UJ4A 3LO3A 1NEEA 2F3JA 3IAM9 2OPQA 3MMAA 1GNKA 1K1SA 2RQMA 1SIWB 2PN6A 4ID8A 1LK5A 2WRMA 3E8OA 5GADI 4YR0A 4HI1A 1RTHA 1WHXA 2YNIB 3MGJA 4NLTA 1VIXA 4NX9A 3UQSA 2CYYA 5L1LA 1T03B 3UCUP 3K8VA 4LSNA 4WXOA 4JI7F 4ILLA 1HWLA 4I2PB 1VGYA 2EW9A 2VKRA 1C1BA 3KLHA 4B9TA 1HARA 3BS9A 5JVGQ 2OD6A 3VQSA 3CD7A 1S79A 4DLEA 4DQIA 1G2EA 1P1TA 3GV5B 1NNDA 2E29A 1R8HA 3I82A 1HR0F 2RQ4A 3DFEA 4NZ0A 1FDNA 2VQFF 1DJ0A 4N5SA 4ECRA 4DFKA 3RBDA 4JV0A 1JNRB 4RNMA 5K8MA 3OV7A 1VQOS 3M9NB 2EK6A 2VB6A 4KIAA 5F8HA 2KXHA 4L6V3 2FUG9 1MWYA 2D3ZA 3KMQA 1DQAA 4H4KA 1XWLA 4IR9A 4DL6A 4RBTA 2OP5A 2JVOA 1QUPA 2VG6A 3GZ7A 3QWPA 2VONA 4B3RF 2DNNA 3SQGB 2MZJA 3OXLA 3SI8A 4B9LA 4I64A 4FBUA 4C3LA 1QJHA 1XBWA 3MECA 2KJVA 3A8EA 2PE8A 1DQ9A 1YQHA 4PG6A 4NLXA 4PWUA 2HVIA 2AX1A 3CD0A 1TL4A 1IN0A 2ALZA 1TAUA 4M1KA 4YB1P 1QE1B 2IRXA 2RRBA 3MMBB 1ELOA 4NLOA 2YKOA 2MDAA 4TU8A 3D0GE 1A9NB 3I87A 3EGZA 5C25A 4USHA 4MIBA 1UL3A 5LXRA 1UWBB 1VQ5S 2DH9A 4PUOB 2Z4PA 3QWUA 3SV4A 2CPYA 4BS2A 4MKBA 1FE4A 4K4VA 4P7VA 1S6QB 5CYQB 4Q0BA 1N6QB 2CQ2A 4Q2MA 4EO6A 3MMCA 4TY8A 4C3MA 2E5GA 2FHJA 4LF5F 3BQ0A 4H4OA 1D8ZA 4JV1A 4DSFA 2YKNA 2FVPA 2D7SA 4RW7B 5IXUA 4ZCLA 2X1FA 4MAKA 3PKYA 4J9KA 1KLNA 4O3PA 3MUTP 3N5FA 4NA2A 4B3TF 4DQPA 3O3LA 4QWEA 5HL7Q 5IS2A 2QLWA 4NLRA 3R3TA 1FVQA 3QLHB 5HBMB 5I42A 2VFUA 3THVA 2K7KA 4P6QA 2AF6A 5AE3A 3NAHA 3U1NA 4F67A 4A8OA 4PWDB 4H4KC 2C2RA 3OTBA 3R5BA 4LF6F 3EGWB 1RAJA 4USJC 1S6OA 2DIUA 3TNVA 3N01A 4FZVA 5CYJA 4J37A 5CZVA 4X64F 4JOUA 1FRXA 2EKYA 3EGNA 1ZPVA 3TRGA 1KD1T 4QWDA 2OPPB 4OL8A 4WKRA 3HJFA 4NA3A 3I9V9 4K4UA 3MPVA 1U09A 1I1GA 1P27B 3J7YI 1TV6B 2ACYA 1SKSA