3TVKA

Diguanylate cyclase domain of dgcz
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
AIRSNMDVLTGLPGRRVLDESFDHQLRNAEPLNLYLMLLDIDRFKLVNDTYGHLIGDVVLRTLATYLASWTRDYETVYRYGGEEFIIIVKAANDEEACRAGVRICQLVDNHAITHSEGHINITVTAGVSRAFPEEPLDVVIGRADRAMYEGKQTGRNRCMFIDEQNVINRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Diguanylate cyclase DgcZ
total genus 52
structure length 172
sequence length 172
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tvkA00
1S1UB 1HYSA 4J9SA 5KT6A 3LP2A 1S1WB 2B6AB 3DMJA 4EBEA 3C6UA 1YVFA 2R2RA 4J9LA 3TAMB 4ZHRA 1IKWA 2W8KA 4EBDA 2AU0A 5L9XA 1T03A 3CJ2A 3QIDA 2W9BA 2V4RA 3LP2B 3V6JA 2UUWA 4DEZA 2FVRA 4EO6A 5KFMA 2W8LA 3DOLA 4KV8A 3BSOA 4H4MA 1RTHB 4LSNA 2FLPA 2AQ4A 1JXLA 3KLFA 5DQHA 2OPRA 3NBPA 4TXSA 3QLHA 3SFUA 4DL5A 4RNMA 3V6HA 4EEYA 3KHLA 2HNYB 3DLEB 1S1XA 3GYNA 5C25A 5EUHA 5KFFA 4TN2A 4QWEA 2BR0A 3MR6A 4J9KA 1R0AA 2VG6A 4QWDA 1EP4A 3RAQA 3DDKA 1Z4UA 4MK8A 3NAHA 3T5LA 4I2QB 3RB6A 5D3GA 5KG7A 2CJQA 2W9CA 1S6PA 2R2TA 5EDWA 3RAXA 5JUMA 3HVTB 5F8LA 2OPRB 3NBPB 4O4GA 4F50A 3SI8A 5J2MB 3H4DA 4RU9A 3H59A 3M8PA 4NLGA 4HYKA 3KMSA 2HMIA 4EBCA 2BQUA 3ICLA 3RBDA 4O3PA 3N6LA 2RF2B 4WYLA 5FDLB 3MECA 4J9PA 4G1QB 4ECVA 1D0EA 4K4WA 1SH3A 4H4OA 4ZP9A 3HVTA 2E9TA 4ECSA 1K1SA 3OL6A 1ZETA 1S1WA 2B6AA 3DMJB 3MR3A 1RT6A 3G86A 2OPQB 1RTIA 4O3QA 4ECXA 2ATLA 4O3OA 3MEGA 1FK9A 5K14A 4ED3A 2BE2B 2ILYA 1NHVA 2W9AA 1HQEA 1N6QB 1SUQB 3KLEB 1C0UA 1FKOA 4ECYA 3N6MA 4TY8B 2YKNA 1S97A 3CJ0A 4ZP7A 1BQNA 4GC7A 2RKIB 4KV8B 4Y3CA 3TQ1A 2ZKUA 5KT7A 4R8UA 2XWYA 3HVAA 4NLYA 2FVQA 4K4YA 3MF5A 1TKZB 2B5JB 5CYQA 3KLHA 1LW0A 3FDSA 1I6JA 3DRRA 1BQMA 2GIQA 2WB4A 1TL3B 4PUOA 3PZPA 4WFXA 2VG7B 5KFVA 5J2QA 3QYYA 1J5OA 2IMWP 4B3OA 1IKXA 4MKAA 3M9OB 3PJXA 4J9MA 3UPFA 4ECZA 4DL2A 1TL1B 4ECWA 3H5XA 4O4GB 1JLBB 3FSIA 2D41A 2VA2A 1C1BB 1JLQA 4IFYB 3KJVA 3M9NB 2GC8A 4NLOA 4O4RA 3BR9A 4KB7A 4IQXA 3OL7A 2J6TA 3MTKA 5DQGA 4K4SA 5CYMB 2ALZA 3MEEA 1JIHA 5C42A 1K1QA 2D3ZA 4ZP8A 3BREA 2IM3A 4KE5A 3RB0A 1JLEB 4Y2CA 1DLOB 4ID5B 5L1JA 1S9GA 2O5DA 3G6YA 1N6QA 2WTFA 4QW9A 3MFIA 3KHHA 3MEEB 3DLGA 4RW7B 4WYWA 3SFGA 4MH8A 4ED6A 1LWEB 1C0TA 2IM0A 5KFQA 4IR9A 3IN5A 2IBKA 3IG1B 3KLVA 2WK4A 3NGDA 1IKWB 1VRTB 5EWEA 1S9FA 1S6PB 2XC9A 2E9RX 4NLTA 1UWBA 2QE5A 3GV8B 5F8NA 3IRXA 4WFZA 2I5JB 2IM1A 2RKIA 3DLGB 5KT4A 3KLIA 1QE1A 1J5OB 2D3UA 4ICLB 4HKQA 2VG7A 4Q44A 4FS1A 4FBUA 2E9ZA 4RW6B 4ED2A 1LWFA 1IKYA 3IS9A 4TQSA 3PW4A 3Q8SB 4WE1A 1RA7A 4K4VA 4RUAA 4O3SA 5KFZA 5T14A 4IKAA 4MKBA 4NLQA 2OPQA 5EWFA 1RT6B 2ILZA 2XI2A 4Q8FA 1RT5A 3E01A 4YR2A 1JLBA 3BQ1A 1IKYB 3KK2A 5C25B 3V81A 4PQUB 3HKWA 3H5SA 4MIAA 3QLHB 5KFRA 3KK1A 4IRCA 3PW5A 5F9LA 5KFWA 3H98A 5I3UA 1C1CB 1S1TB 3MR2A 3ITHA 4IG3A 4DG1B 4ZVEA 4QW8A 1N4LA 3QIPB 2C2EA 1S1UA 1RT1B 2FLNA 2FJWA 3M8PB 1LWCB 1HYSB 3V6DB 4U7CA 3DRSB 1RA6A 4J9QA 1D1UA 3BGRA 4IH7A 3KLGA 3G6VA 3QGIA 4URGA 5KT3A 4MFBB 3CDUA 4J9NA 4OL8A 3TVKA 4I2PB 4R8UB 4K4TA 3ISND 4RW4A 1C0TB 2YKMB 4XPCA 1RDRA 1CSJA 3DM2A 3QGGA 5KFEA 1OS5A 2VA3A 3HVWA 4F4XA 5C5JA 4TYBA 2OH2A 1TVRA 5C24A 1GX5A 1RAJA 4FS2A 4IDKB 1HPZB 1DTQB 1LW2A 4I7FA 4Q0BB 2HAIA 3I5BA 1N5YB 3KLFB 4WXWA 4MIBA 3GILA 3GV5B 4F4ZA 4ECTA 1RTHA 4LSNB 3EPGA 4ED7A 1HNIB 1XR7A 2IAJB 1KLMB 2VG6B 3BSAA 3GQCA 1RTDA 3IRXB 1C1BA 1JLQB 1JLGA 1TKXA 4IFYA 3CDEA 4RW4B 3VQSA 5KG5A 1WNEA 2FVPA 4MFBA 3DRPA 4RNOA 2WOMA 4RW9B 4NLXA 2C2DA 3C6UB 3HHKA 3PW0A 3OL8A 5KG3A 3CO9A 2R8JA 1LWEA 3I0RB 3LP1A 2BQRA 2EC0A 2JEIA 4RW7A 4TLRA 3BSCA 1S1TA 5J2QB 4LSLB 4KHMA 5KFAA 5DG8A 5J2MA 1KHWA 3OLBA 3QGHA 2YNFA 2ASLA 3LANA 1ZTWA 1U09A 1TKZA 2B5JA 3KLHB 1RT2B 2B43A 4ED0A 3CJ5A 2UVVA 2D7SA 4K50A 1HNVA 4PWDB 3UDLA 1FKPB 4R5PB 3BJYA 3BQ2A 5KG1A 3MEDA 1S0MA 2ASJA 3ISNC 3QO9A 4TY9A 4Q8EA 4TY8A 4Q43A 3H5YA 3G6XA 4ZMMA 3KK3A 2QV6A 3IS9B 1HMVB 5DLGA 5KG2A 2YNFB 4O44A 3KLGB 3Q8QB 1EETA 5KT2A 2YNHB 3QZ7A 4ICLA 2F8EX 2HNDB 3QO9B 3JSMA 5J2NB 5KFUA 4KFBA 3Q8RB 5F9NA 5DLFA 5J1EB 2YNGA 5HBMA 2YKMA 5KT5A 1HNVB 4PWDA 3NKYA 1T03B 2UVRA 3KK1B 1JLAA 1VRTA 4ECUA 4RNHA 3KK2B 3V81B 4PQUA 5KFSA 4KHRA 1QAJA 2RF2A 3IG1A 2R8IA 1KLMA 1C2PA 4TYAA 4JUZA 1RT1A 3JYTB 1HNIA 3LAMA 4EYHB 2AGQA 5J2NA 5DGAA 2V0NA 2HMIB 4FBTA 4NRUA 3M8QA 3LALA 3DLKA 3H5UA 2HNZB 4RW8B 3H2LA 2R2UA 2R8GA 1RTJA 4JV2A 1MU2A 2V9WA 4GC6A 3I0SB 3PVXA 4JV0A 4I2QA 3PR5B 1QE1B 4IG0B 1GX6A 1TV6B 4NYZA 1ZTTA 1FK9B 1EP4B 4ZPDA 1T94A 1DTTA 5KG6A 1REVB 4R5PA 1RTIB 1KHVA 4I2PA 3FFIB 1RT7B 4NLPA 4K4XA 3T5HA 4WZMA 4G3IA 2OPPB 2OPSA 4I7FB 1T3NA 1T05B 1SV5A 3M8QB 2WONA 3OL9A 3I5AA 4IDKA 5HROA 5KG0A 1TP7A 4QWAA 2XCPA 3ITHB 4DG1A 3MFHA 5KFCA 3OLAA 4EO8A 5KFGA 1IKVA 5KFJA 3C6TA 4KO0A 2XCAA 2J6UA 2XI3A 2AWZA 2W9BB 4ZPBA 3DI6B 3DRPB 1RYSA 1BQMB 3DRRB 4PUOB 4K4ZA 1VRUA 3DRSA 1RTDB 1RT7A 2YNGB 1JLFB 5JXSA 4DL4A 1S0NA 5D3GB 1REVA 4ZPAA 5F8GA 4KFBB 2BRLA 4IFVB 2JC0A 1HQUB 2W7PA 4RNNA 3KJVB 3V6KA 1S1VA 2HWIA 4ZP6A 2C2RA 2YKNB 1R0AB 5L1LA 3T19A 4RW6A 3UQSA 5DGBA 2XGQA 4IH6A 4XPEA 3KLEA 1DLOA 1S4FA 4WXOA 1IM4A 1HPZA 1N56A 1TVRB 5C24B 3BSNA 1HQUA 3MEDB 5CYMA 2IA6A 4QWCA 5EWGA 4KAIA 4NLRA 2VG5A 1S9EB 3DYAA 4QWBA 3PHEA 1TL3A 1RT4B 1MMLA 4NCGB 2IC3B 4Y34A 4WZQA 1LW0B 5L1IA 5CYQB 2DPJA 4YR3A 2YNIA 5J2PA 4G1QA 3IGVA 1S6QA 5FDLA 1QAIA 3NL0A 1JX4A 2IM2A 4YQWA 3GIMA 2IJNA 2FJXA 4U6PA 2R8KA 1S49A 2IJFA 3PW2A 5HROB 4J9RA 2C28A 4O3NA 2YNHA 2WONB 1SV5B 3Q8PB 2AGOA 1S10A 2ZD1A 2XGPA 2OPPA 1SUQA 5L1KA 1HQEB 1JKHA 4F4WA 2W9CB 4M94A 4YR0A 4NLSA 5I42B 4QPXA 2VG5B 5KFDA 3OSPA 3DOKB 1QUVA 1JLFA 3PR4A 2UVUA 5HLFB 4IRKA 1FKPA 2JC1A 4NLDA 3RB3A 1VRUB 2RDIA 3KHGA 3I0SA 2HWHA 5KFLA 3RBEA 3EZUA 1C0UB 1FKOB 1N5YA 4ID5A 1W25A 3OHBA 1RTJB 2V4QA 4M95A 3CJ4A 3CJ3A 2R2SA 5HLFA 3QZ8A 3T5KA 3OHAA 4O3RA 5HP1B 2FVCA 4B3OB 3UR0A 1RT3B 4KBIA 2W7OA 4ZPCA 1XR6A 2UUTA 4KSEB 2OPSB 1JKHB 3KMQA 2FLLA 2AX1A 1RT4A 4NCGA 3D5MA 4XO0A 3E51A 1S9EA 3DYAB 1HARA 1RT3A 3NAIA 3QIPA 4URQU 1IKVB 4KKOA 5DG9A 3MR5A 1NHUA 5KFOA 1C1CA 3I5CA 3KHRA 4H54A 1S1XB 2HNYA 3DLEA 4DL3A 1TQLA 3LAKA 2AX0A 3KNAA 4X2BA 3PW7A 1TKTB 3T5JA 2BE2A 4Q45A 5C42B 3E01B 2WCXA 4MK9A 2I1RA 3JYTA 4URSA 3DM2B 4WE1B 4IG0A 2WHOA 2R8HA 4JV1A 4NRTA 4H4OB 4DL6A 4K4UA 2ZD1B 2ZE2A 4IR1A 3FQLA 4ZHRB 3TAMA 2JEFA 3MECB 1TL1A 1XR5A 3T1AA 5KFYA 3V4IB 3FRZA 4NZ0A 4ED1A 1S1VB 3IGNA 3V6DA 1N48A 1LWCA 3KLIB 2ASDA 4H4MB 4LQ3A 5KFHA 3FQKA 3MEGB 1IKXB 1SH0A 4IG3B 2CKWA 2I5JA 3CDWA 3I0RA 3LP1B 4Y2AA 5I3UB 1UWBB 5KFBA 3BQ0A 2YNIB 5J2PB 3OSNA 2WOMB 4RW9A 2RDJA 2FJVA 4IRDA 1JLCA 2IC3A 2J6SA 4RNFA 3DI6A 1SH2A 3GIKA 5HBMB 3C6TB 4KO0B 5F8IA 5HP1A 4ZVFA 5KG4A 5KFNA 1S9GB 5DG7A 1RT2A 2DPIA 4IOBA 3RB4A 1LWFB 1JLEA 3H4BA 1HMVA 5KFKA 3DLKB 4RW8A 3GIJA 2C22A 4ED8A 1RYRA 3CIZA 1DTQA 4NLVA 4ECQA 1S0OA 3FFIA 3NMAA 4IFVA 3DOKA 4R0EA 3DOLB 1DTTB 5F8JA 4KKOB 5I42A 3LP0B 1TV6A 4DL7A 2JEJA 2UVWA 4RUCA 4EYIB 3KOAA 1JLAB 5KFIA 4YMEA 4NLWA 3CWJA 3BGRB 4ZVHA 4YP3A 1JLGB 1TKXB 4ZVGA 2FVSA 3M9MB 4RZRA 4LSLA 2WRMA 5J1EA 4WFYA 5F8HA 4MK7A 4F4YA 4J9OA 2BQ3A 4Q0BA 2HNDA 3JSMB 1S6QB 2BANB 1T05A 5KFPA 3V4IA 4TQRA 2ZE2B 1LW2B 3D28A 1NNDA 2AGPA 1RT5B 3CVKA 2IAJA 3LP0A 3PJWA 3GIIA 5F8MA 1BQNB 2BRKA 3GV7B 5DQIA 3H40A 4ECRA 1S48A 4IH5A 4LQ9A 1EETB 2GIRA 4NLUA 1MU2B 5KFTA 5KFXA 1TKTA 1JLCB 3EPIA 2JEGA 4O44B 2JLEA 2HNZA 3N6NA 3KK3B 2BANA 5K14B
chains in the Genus database with same CATH superfamily
1S1UB 2EWHA 4ZJQA 5G0RB 5ETNA 2VDIA 4J9SA 1PAUB 5HVFA 1S1WB 5A8RA 3G71S 2DCLA 2MTLA 1T9VA 1M90T 2VOPA 3KJNB 4WFBQ 1KVKA 3W5XA 5BR8J 2ZM6J 2AU0A 2K3IA 4DSIA 4DSLA 2F5GA 4LF6J 1T03A 2R7QA 3CDAA 5C2CA 2V4RA 4DQPA 4DEZA 2NXUA 4A46A 2FGCA 4EU0A 2W8LA 3DOLA 2UV8A 2MZRA 4LSNA 4FYXB 4WP3A 4QYZJ 1Q16B 2Z2LA 3CO0P 3VWSA 1TK8A 1QAXA 1V5VA 2XTJP 2YWKA 3IC1A 3ILLA 4C8LA 4KTQA 3MM7B 3ILIA 4DL5A 2ZH3A 1NK5A 1MLAA 3V6HA 3AD8C 1S1XA 4DV7F 2LU2A 5EUHA 4K5SA 2BR0A 5IWAJ 1NKCA 3SSRA 4DPXA 1FRMA 4ZK7M 1TMJA 5A8WB 2HZCA 1MMNA 4MK8A 5B0FA 3H90A 1YIJS 1AFJA 1BQXA 1RAEB 2K3KA 3QAEA 1NSQA 4DFMA 4LFCJ 3J81j 3R27A 3RAXA 4DLEA 4NMXA 2PI4A 4USKA 4CT9A 4ZLJA 1EB0A 5T41A 4B08A 3M8PA 4M63A 3C16A 2NXNA 1SI9A 4C98A 2JJ4D 1T9WA 2LQJA 2MGZB 3KMSA 4K4TA 3RBDA 3M2VA 2BQUA 1HWJA 1V3ZA 4Y2IA 1T02A 4L73A 4DN9A 1RACB 4J9PA 3IO1A 2QMUB 3TZZA 4G1QB 2R7XA 4FVCA 4HI1A 1SH3A 4KQZA 5SZTA 1VQMS 3VAIA 2CWKA 5HK4A 3U27A 3TP2A 1RBOB 3TWZA 2B6AA 3DMJB 1FXRA 4BHQA 3MR3A 2ZBPA 3G4SS 5LM7E 3F73A 4ECXA 1RAIB 4PG4A 2ATLA 1OO0B 4JV5J 2GO8A 1FK9A 3M8WA 2MQPA 1CJTA 4QZVB 2KYZA 5K14A 3EYZA 1JMTA 1LFPA 2BE2B 1REGX 2ILYA 3AOBA 1NZAA 4J91A 2W9AA 1U8SA 5CABA 1DAXA 1UZDA 2DH9A 5E3CA 1RLCL 1Q8KA 2F9DA 3NY0A 3W2WB 2EFGA 4AYBD 3WC0A 4F4AA 3SIPB 3HO1A 2CJBA 4TY8B 2IRXA 1RLDA 4ZJOA 2FHMA 1I94J 4GC7A 5A0YB 3MI7X 2YPYA 4W92B 1VQNS 2ZKUA 4CYUB 4R8UA 3UDEA 1PYTA 5B0AA 1HBMA 2RHQB 3FDSA 1BQMA 3D1QA 3DRRA 1WG5A 1M5PC 1JNZB 5KFVA 5IXUA 3W5ZA 2YH1A 4OX9F 1U0SA 3IWLA 4CNZA 1J5OA 2VUGA 4MKAA 3M30A 3UO0A 2OMLA 5A0YA 3M9OB 1ZZFA 2CJAA 4JI4J 2G4BA 3AA8A 3K7RA 4IUFA 4X4VA 4ECZA 5B09A 2MEWA 2QC3A 1CJKA 4O4GB 2UUCF 1LXNA 4JI7F 1O5JA 2RUSA 2E7VA 1IJFB 3FSIA 1C1BB 2B56A 2G1HA 3PIOQ 1UVNA 1LK5A 4D3HA 4NXMF 3SBMA 2KFYA 4DPUA 2QG9B 3O2IA 2ALZA 4U7UD 2EEYA 3VAHA 2C3YA 1K1QA 3KTQA 1LQ9A 4RBUA 3BREA 2IM3A 3EM1A 4CH0S 4ENOA 4B9UA 4CLWA 2Z30B 3HX9A 4ID5B 3JAMY 3PIPQ 1FTCA 2MKHA 4MMOA 2WVEA 4I0WA 4MJKA 3MMAA 4XK8C 2R7WA 1TK5A 1RWVB 4P10A 5ETPA 3NNHA 1HQ2A 2W4PA 2WSFC 3SFGA 3HPOA 4KRWA 2D69A 1WTFA 3A8EA 1UETA 3M8ZA 5KFQA 2IM0A 3A13A 3NS5A 2IBKA 4XIUA 3C8YA 1N32J 2PGCA 3JSRA 1R7IA 1KR4A 3KNGA 4OZ0A 4F0KA 4PQAA 1HBOA 2E9RX 1DY3A 3EVMA 2MKIA 3SV4A 1UWBA 1X4FA 2QE5A 5F0WA 4DUYJ 1APSA 4C8ZA 5LSRA 1PIEA 4OYOA 3ETOA 5GADU 4J90A 1ACMB 5C7PA 1FRHA 3BPSP 3UW1A 1XMOJ 3C14A 1J5OB 2D3UA 1OWXA 1PAEX 3TVYA 3GCWP 2A10A 2UV8G 4PPZA 3R3TA 2EFQA 1CVJA 2Z8QA 2VH7A 2CPJA 2XEXA 2MZ1A 5CXTA 2FYXA 2ZWPA 2AEJA 4WE1A 2GX8A 3CD5A 2V2KA 2XMWA 2ZZTA 3FMBA 4O3SA 2GVZA 4MKBA 5EWFA 2OPQA 3NWGA 3FCWA 4Q8FA 4P74A 4GRSA 2VPXB 4M5DA 5HQMA 3C46A 4ES1A 3NGRA 2B4PA 1IKYB 3CE8A 3MCMA 2LEPA 3TQEA 3KK2A 3V81A 1YTYA 3R2CJ 3H5SA 2DGQA 4MIAA 5D4OA 4LVNP 2G13A 1GFWB 3KK1A 1PYOB 2RHSB 3Q22A 1G1XA 3PW5A 5F9LA 1FI4A 5IV4A 1MROA 4UUWA 5ETVA 4JI4F 5M2UA 1IBMJ 2G1DA 4BLGA 3UDCA 2J0WA 4QW8A 4Q0BB 3RRGA 1N54B 1EQMA 1LWCB 2HMIA 1VBXA 1NAQA 2VPYB 5HAOA 1GTHA 4U7CA 4J9QA 2HBYB 2ADBA 1D1UA 2HVHA 6FDRA 1FJ7A 8AT1B 2OD6A 4MFBB 3OV7A 3CCJS 2E1AA 4A8FA 4DX6A 3MXHP 4DCPB 2JWNA 2VODA 2YKMB 4XPCA 1WHYA 4ZCLA 2VA3A 4F4XA 3CJ8A 5C5JA 4TYBA 2OH2A 3D68A 3PTWA 4O3RA 1GX5A 1RAJA 4U8YA 1HPZB 4EMDA 4F2RA 2QT7A 2YY3A 3SDEB 1LW2A 4DUZF 2RILA 2XMMA 2ZDOA 4I7FA 3I5BA 3HMJG 2CWXA 4QPTA 5DS7A 2ZUGA 4HHJA 3ZZOA 3KLFB 1SC3B 1J5EF 3N4WA 2HG4A 4RKUC 1RTHA 1SPBP 1Q5VA 2AJ0A 2BYCA 1OIAA 2MHEA 4ANDA 2Y0BB 3EDRB 2VBWA 3EPGA 2RRAA 4FN5A 2WSCC 3AAWB 1KLMB 2VG6B 3GQCA 3IRXB 1C1BA 1TKXA 4OYIA 5AE2A 3CDEA 4B9VA 2NPIA 2HZAA 4OYMA 2VV5A 2PMHA 2VKRA 4BC9A 3TZXA 2VF3A 2WOMA 4RW9B 2DH8A 2YWFA 4JI2F 4X4UA 3ZC4A 3OL8A 4WU3A 5AJ3J 3PW0A 2P6TA 3I0RB 4ZIWA 1FEHA 4GKJJ 3BGFA 2JEIA 1S1TA 3FCVA 1WF2A 2XZTB 3M7VA 4P2FA 1S79A 4N77A 2YNFA 4CT8A 2HQCA 3UD4P 3D3CJ 3C2PA 3IR6B 1ZBTA 1OQ3A 4FYWB 4X65F 4ED0A 3TAPA 3S8SA 1U1OA 2F63A 4PWDB 3RG6A 2ZITA 3Q2TC 1U02A 3OVSA 1NDCA 1HWIA 1GT8A 1R6YA 2IVMA 3ISNC 3D4JA 4Q43A 3GJTB 2VQEF 3VGSA 4ZMMA 3SCIE 2DKOB 2QV6A 3IS9B 4DCJB 1R0CB 5HVGA 5KAKA 5KG2A 2YNFB 2XYGB 5L46A 3CSKA 3Q8QB 2ZUAA 1VQYA 2EI5A 2RT3A 1WOSA 3UVJB 2CJKA 2DO0A 2YNHB 1CJTB 1P9QC 1NM2A 1Q7LB 4KFBA 2CXEA 5DLFA 1UEVA 2EFOA 2IDEA 2MLZA 1X0PA 2B8QA 2DJWA 3M4XA 4V1Ak 1UCNA 3NKYA 2A2DA 2GA7A 2YH0A 5I3PA 4ECUA 2XMJA 2O3DA 2V8VA 3KK2B 3V81B 1QAJA 2ZNZA 4P7TA 1VJQA 4M5DB 1C2PA 4TYAA 1UFKA 2HHPA 4O23A 1HNIA 2PFFB 3CJKA 2AGQA 3MCSA 5DGAA 2V0NA 2FTRA 4DX8H 4NRUA 1VR6A 5LSOA 3A1YG 1W2IA 2HNZB 3H5UA 2LP4A 2MYFA 3TJ9A 3EX7B 3OBIA 1J5EJ 4KH1B 3TNVA 4UUXA 2CYYA 3DXSX 4O0IA 2DHSA 4OFZA 1SC4B 4EGLA 3KYLA 4IG0B 2QA2A 2MY8A 2E5HA 1CS4B 4GO7X 1FK9B 4Z7CA 3MMBA 3K58A 5LMNF 2FY1A 1T94A 2XSJB 4HLBA 1RAAB 1OY6A 1RTIB 4L72B 4R5PA 1IVZA 1VI7A 4DR3F 3MGJA 4OLOA 2C3PA 2PI5A 5F0UA 4K4XA 1FD8A 3W60A 2CQ3A 3VCDA 2JHEA 2LU1A 2XLIA 4G3IA 2QRRA 1QD1A 4ZKAA 4KGVB 2NSBA 4PYDA 2D9PA 3PKMA 1SV5A 4F8RA 2WONA 2QIFA 1BMQB 2AJ4A 2R9LA 4LRCA 1S72S 1TP7A 4LRFA 5CZXA 3BB5A 1PKUA 2BM0A 4ZVTB 5KFGA 6FD1A 4FZVA 2GJFA 3C6TA 2HHHJ 1M5SA 4PXCA 4WU2A 4OYAA 4ZPBA 4AT1B 1Q78A 1N5VA 3DHWC 3MMCB 3V2UC 3L09A 5H9FK 4B17A 2K7JA 4KC5A 1CULA 2EFPA 3GLJA 4OI3A 4FKXA 5ETQA 3SSQA 3W1YC 2MQLA 3DRSA 1RTDB 1RT7A 2ALYB 3O5TB 1JLFB 3MWBA 3S7RA 4ZLLA 1UVKA 1REVA 1T3OA 2BRLA 1SCJB 3BKUA 4Y6IA 2QMWA 4IFVB 2VICA 2W7PA 1HQUB 2IA0A 4RNNA 2CADA 3GU0A 3KJVB 4AE5A 5GADI 2YKNB 1XBWA 5L1LA 5BYQA 2CAJA 4Y00A 4FPIA 2XGQA 3CCVS 1DURA 1OSCA 5K8OA 1W26A 4C3KA 4L6V3 2M8HA 4HDHA 4ZPWR 5DZ7A 3TO8A 1PCAA 3R7NB 4A8XA 1N56A 1F60B 2YKAA 3AFGA 3MEDB 3GZ7A 5CYMA 5EWGA 2HQIA 4ZCMA 2AJ1A 3DYAA 2DISA 2JH3A 5THWA 2XO6A 3BO2A 3K17A 3MOZA 4YHHJ 1LW0B 1KC8T 4BC7A 4A8KA 5IQ6A 1P1TA 5J2PA 1I94F 1NPKA 3I9ZA 1N33J 2NSCA 3DOMB 1KD1T 1S6QA 5HMZA 3NL0A 3DCAA 4DOZA 4DLGA 2FJXA 4U6PA 4N76A 1U1QA 2IRUA 2G0CA 1RAFB 3PFOA 4FP9A 2WONB 3DGVA 3TX0A 4WK1A 2EPIA 3Q8PB 1S10A 1K73T 4DR7F 1SUQA 5L1KA 4WK3A 1YI2S 3D2WA 1YDLA 3MM6A 1NKEA 1VQ7S 1X4AA 5LMNJ 4USTA 4YR0A 2GQCA 3D6FB 2JLFA 1VIXA 1JXEA 3ZTPA 4BWJA 2DNHA 3BH6B 1RP5A 2CA9A 2E29A 3Q89A 5KFDA 3JTNA 3OJSA 1FKPA 1X4CA 4QOTA 1Q86T 1RBAA 4TU9A 3CD7A 2HWHA 3RBEA 1FKOB 3EZUA 2DHGA 3QQCD 1JJCB 3QFWA 1RTJB 4ID5A 4XAKA 5H9FJ 4CM2A 3OHBA 2XY5A 4LFBJ 3DLJA 4ETZA 3IBWA 3O3LA 2BE9B 2DNPA 4MKVA 3PG9A 2WW4A 3RBZA 3QAUA 1VQLS 4PRFA 1YJUA 2V69A 5EN1A 1FX2A 1D09B 1T9UA 1XR6A 2CPDA 3DN9A 1NK8A 1EHWA 1S59A 2OPSB 4YEAA 4KGXB 3MZIA 2ZBIA 3QT6A 1RT4A 3M6XA 4J9VA 4NCGA 2A1BA 1SKWA 2C2OB 4ZPTR 3TVZA 1S9EA 2MY7A 1RT3A 5L38A 4ZOSA 4HDGA 4DV0J 1SC1B 1NJZA 5DG9A 4ES2A 1C1CA 3T6JA 2KRBA 4LF1A 2MPUA 3HT0A 3PXGa 1W7WA 2KTQA 1P8GA 2MSTA 4USMA 1SQFA 1AYEA 4FXVA 1OQ6A 3NLCA 3PW7A 3OFFA 1TKTB 3I96A 3R5JB 3ZZZA 2GHVC 2QLJB 2BE2A 4Q45A 4YS2A 2WCXA 3D1HA 1Q5YA 3QWUA 2QLWA 1XWLA 3J80Y 2QL5B 1RHKB 4XDDA 3HKZD 1YJWS 4HH0A 4URSA 2BUNA 5L8RC 1VK3A 2R8HA 2HHHF 2L08A 5EGYA 2KN4A 4DL6A 2V9KA 3I31A 1T8EA 2ZVIA 3UD5A 2J7KA 3TAMA 3MECB 4YB7A 1TL1A 1XR5A 5KFYA 4A47A 3V4IB 2Y1IA 2DIVA 4NZ0A 1SBRA 1S1VB 1M5KC 1F9HA 4EZ6A 1U1RA 2G2ZA 3PO5A 1D9DA 3PRBA 4FNIA 4IG3B 3I0RA 4LF8F 4Y2AA 2IMOA 3AY0A 3H20A 5AXLA 1UA0A 2BOPA 1J27A 3IA0A 3JTOA 5J2PB 2RDJA 3BQ0A 4IRDA 4I68A 1RZMA 2CNNB 5T7LA 3OQ2A 2UU9F 3R1LA 4RNFA 2Q1LA 3PEHA 2DT9A 2D9OA 2CQDA 5KTQA 3B54A 4LF9F 4Q2MA 4N5SA 3QRQA 1V3RA 2FJEB 3KG0A 4LBIA 1SJFA 1AUDA 1LFWA 3QRPA 4ZVFA 4ZVSB 3HM9A 2H54B 3R9LA 1S9GB 3OTOJ 1RT2A 2DGOA 1UWAA 2DPIA 1UVIA 1LWFB 1FDNA 1VQSA 2MSSA 4JYAJ 2KDOA 2CPYA 2C22A 1F2HA 1IWGA 1VOMA 1DTQA 1M1HA 2MQ8A 1Q81T 3CGIA 1LWXA 2KRRA 3ETMA 3DOKA 4IFVA 5DZ6A 3ISZA 1GXTA 1K0VA 1PG5B 4OLPA 1TV6A 5HJYA 2FHJD 4AQYJ 2JEJA 1X4DA 1NH7A 4U7UK 3B4DA 1ZM4A 4FXWA 2Y3YA 4C48A 4RUCA 1JLAB 5KFIA 4OI4A 4WPAA 3CCSS 1FERA 1SVDA 1JLGB 4F3MA 2RE1A 1ZAVA 2FD2A 1FESA 3UCGA 4F4YA 1PJ7A 2OHDA 4DSEA 3QJPA 4QIVA 2HNDA 1WELA 1BD6A 3CJQA 5E3RA 3JSMB 1S6QB 3CMES 2HGNA 4USUA 2BANB 1VQOS 3P6YC 5KFPA 4UZBA 2DO4A 2KL8A 2V34A 4ZLPA 5CCLA 3THVA 1U1NA 4C4WA 5B0DA 2D3O1 2YQ1A 3R6GB 2V50A 2AGPA 2AT1B 1H3DA 3CVKA 3GYGA 5C2GA 4UTGA 1AW0A 2H65B 4CNYA 1PYSB 5F8MA 3W9IA 3JS9A 3HHEA 3H40A 3QRRA 1IQTA 1RK8A 1NJIT 4LQ9A 1EETB 2YX7A 5HSPA 2PA3A 1B3TA 1UL3A 3EE3A 2JLEA 2E5IA 4XDCA 3VAKA 2GS8A 4NASA 3N6NA 2R7RA 3JSYA 3R5AA 3CNQP 4I4BA 2DNMA 3GSIA 2I8EA 3LP2A 2RQCA 2E44A 2B7BB 3C6UA 4EBEA 2R2RA 3FGVA 3NWRA 1RWWB 4PYAA 3TAMB 5DDRC 4HI2A 2W8KA 1RCXB 2O66A 4LIRA 3GFHA 4DR1F 2W9BA 2JFKA 4I56A 2RU9A 2UUWA 4Z37A 2CQHA 5BXIA 5IWAF 4KV8A 3BBBA 3TANA 1OY8A 3LWLA 4DR4F 3CD0A 1JXLA 2J7WA 2OPRA 3NBPA 3SFUA 1MSWD 1D8ZA 3T9ZA 4EEYA 1RHRB 3GJQB 2HNYB 2XMVA 3GYNA 5KFFA 3G8SA 2HQGA 3HHNB 4J9KA 4P7VA 3T41A 4DFJA 4J7CA 4ZIVA 3HP6A 3RAQA 1XNQJ 1Z4UA 2EW9A 3PYGA 3RB6A 5F8LA 3M2RA 3K59A 2VC1A 2CJQA 1QLNA 1S6PA 4NI2A 4ZN3A 2R2TA 2PEBA 1WG4A 1WWHA 2Z2MA 2H5EA 5ETSA 2OPRB 3NBPB 4K8RA 1ZM9A 3GYXB 4O4GA 4USHA 4AXJA 1J2VA 3UFCX 1H72C 2Z56B 2CPEA 4RU9A 2HQFA 3T1YF 2XYPB 1IBLF 1FEEA 4NLGA 1KSPA 3E8OA 3FBCA 1F9FA 4H4KC 2DK2A 4Q7AA 1MWYA 4CH1A 3PY8A 2OSRA 3SCKE 1IXKA 4H4OA 3U1MA 4PR6A 1K1SA 1YX2A 2ZVSA 4DHVA 1ZETA 2F4VF 1RT6A 3GR1A 1ZPWX 2QYCA 1Q8IA 3CT9A 3K2YA 4KT0C 1GTEA 2CVEA 2FC9A 3SQGB 2XMAA 2BJ3A 5LT5A 4ED3A 1I1GA 1X9WA 1HKAA 1NHVA 1X9MA 4EFAC 4HT7A 1SUQB 4OHWA 2XLKA 3H2UB 1FKOA 2QZ8A 1WEYA 1WF1A 2FZKB 2V8PA 3N6MA 3BS9A 4YUDA 2C1EB 2BKNA 1SXLA 1WOPA 2ZBQA 3CUNA 3OW2R 2Y1JA 4Y3CA 3TQ1A 2PO4A 3L9ZA 3BR8A 3HVAA 3NOCA 4K4YA 3MF5A 4W98A 1AT1B 5CYQA 3AJ1A 1LW0A 5D0HA 8RUCA 3OUYB 3CCQS 3W3SA 1Q4RA 4Y28C 4PUOA 4DR2J 1X4HA 4JI8F 2QLBB 2VG7B 4DR5J 4K0KF 4ZVOB 4OJ3A 2GGPA 2QL9B 2Z57B 1NZ8A 1IKXA 4ZJLA 4B3OA 5AXMA 1B7YB 3PJXA 3QSIA 4U96A 1MMDA 1U0HB 3UPFA 1RWUA 2JRSA 4DL2A 1XIQA 1BUXA 2DNZA 4LF4F 3H5XA 4E8UA 5CYJA 2AD9A 3NP5A 4DSFA 1VS3A 2JSXA 4WTOB 2UXBJ 1GXLA 1VLYA 4AUKA 5H1SV 1JLQA 3J7Z5 3KJVA 1UTAA 4O4RA 1R6VA 4IQXA 1UVLA 3HCXA 5CYMB 2B9XA 3MEEA 2CQCA 1JIHA 4LRBA 2EBGA 2D3ZA 2KM8C 1NB7A 3ZZYA 3KXDA 1WEXA 1DLOB 3D6TB 5A6WA 5L1JA 1UJ5A 4Z7YA 3P3DA 1N6QA 3C14B 3KHHA 5HJXA 3ZNUA 2DVIA 2CRLA 2DGVA 4RW7B 4ZS6A 2HLTA 2PE8A 4MH8A 5ETOA 4ED6A 3BO4A 1VBZA 4ER8A 1LWEB 1CJUB 1Y3JA 3IN5A 1NLKL 3W64A 3IG1B 1Y00A 2B4OA 3GCXP 2ZM6F 4RWXA 2C2KB 3MM6B 4F7VA 1L3VA 5B0BA 3CJSA 4UZCA 3WDOA 2C2NA 2FHKA 5EWEA 4NLTA 2XC9A 2ZJQQ 1S9FA 2KVQE 1YJTA 3GV8B 2I5JB 2FC8A 2RKIA 2HVEA 2QLFB 1OY9A 4HH1A 2ACYA 4N47A 1E6YB 4NCAA 2YXLA 4ICLB 4I69A 4Q44A 2KG1A 4FS1A 4B02A 4ES3A 3SYZA 3M6UA 4ED2A 1LWFA 2XZWA 3TA2A 1IKYA 2MZQA 4Y0FA 4TQSA 3PW4A 2PSZA 2D1CA 2RIJA 3IAM9 4M5NA 4EI2A 4F3OA 4CH7A 1N5SA 1UAWA 4LT6A 2C3UA 3TRGA 1JXVA 4K4VA 5KFZA 5BJRA 1N5QA 1B4SA 4PG5A 4UQGA 1RT6B 2ILZA 4NXNJ 1RT5A 4EWTA 3ZTSA 3KG1A 2IIHA 2VQFF 3P96A 2AYBA 2UXBF 1WD6A 2MJUA 1YRXA 3UWTA 5GAEI 4ZPVR 5KFRA 2V2QA 2ZOFA 2EK6A 3HJVA 3TJ8A 3AHPA 3Q23A 1C1CB 3HVRA 1JB0C 5IV3A 3N5BA 3MR2A 2L3MA 3HFVA 3ITHA 4ZVEA 2XM3A 4B3MF 2C2EA 4B9NA 1HYSB 1RT1B 2HIQA 2ZOGA 5GMKa 2HRTA 2W1BA 2YWHA 2QL7B 1WSVA 2VFTA 3I6PA 2LCWA 1IWAA 3OTEA 3DRSB 3NS6A 5GMDA 5AE1A 3BGRA 3TI0A 2OEJA 4N41A 1WC4A 3CJRA 3QGIA 3LQVA 3ZXWA 2XYHB 4URGA 4AL5A 4ZVPB 1DFDA 2DB1A 1T9XA 4OYPA 2C42A 3BN7A 1KEKA 1WKLA 2X1FA 3A8JA 5DM7Q 2AZ3A 2BJ1A 1OS5A 2WVDA 3L7OA 2EXUA 3V4MA 4QU6A 4MKYA 4QCLA 5GAGU 4FS2A 4LRAA 2E7WA 1DTQB 1SIZA 1EKSA 3DC2A 5B0EA 2D74B 2BXJA 3I32A 2HAIA 1WF0A 4C97A 2AYGA 4WXWA 4PG8A 4NZ7A 5MLCV 2HHUA 1R31A 4FF4A 3U02A 4CLFA 4ED7A 4LF5F 5K5MA 3K89A 1XR7A 2YKOA 2IAJB 1RAOA 4E2FB 3MHYA 4IFYA 4RW4B 2N7CA 2DHXA 1WNEA 2FVPA 2XS2A 2P9GA 1U25A 2M8DB 2VDHA 1Y5IB 5E7OB 3VGVA 5E41A 2C2DA 2KZMA 5CH7B 4YFUA 3HSJA 1IR0A 2CQBA 3MAAA 2R8JA 3LP1A 4CO4A 1M1KT 4QR0A 4OI1A 3VV2B 1FDAA 3BSCA 1WEZA 1VQ4S 1NDPA 5KFAA 3CD6S 3HDSA 4F2SA 2V68A 3TUJC 3J7AN 2R7OA 2D3OR 1FE4A 1U09A 3U1LA 2B43A 3FVYA 2JEFA 3DLBA 2ZZMA 1AROP 2JOQA 4K50A 5D0GA 2EKNA 1GK8A 4DS5A 3UDLA 1FKPB 1QJHA 3LUYA 2W2PP 4C6AA 3DLHA 1FVQA 2F3JA 3GPAA 3HK2A 3MEDA 1BGXT 4PAAA 4A8QA 4TY9A 5E5NA 4Q8EA 4TY8A 1VRQC 3J7YU 2YVSA 3KK3A 3LTOA 1AXQA 2KZZA 4YN3B 1HMVB 1IM6A 1FDBA 3PYDA 2W2OP 1H73A 2W24A 4O44A 3KLGB 2NYIA 1RWNB 4UOCA 4F02A 2W7AA 5KT2A 4ICLA 3EGNA 4MYTA 2J9EA 2HNDB 3JSMA 2N7YA 4B9MA 2WVFA 2AEMA 2MQMA 4LF2A 5F9NA 1FE0A 2AJFE 2H1YA 3HHDA 1AA1B 2YKMA 3M1VB 4CLYA 4PWDA 2XBPA 2IFXA 5IQQA 1T03B 2V5HG 2UVRA 3KK1B 1KQSR 2DEIA 3LGMA 2VBXA 3WHIA 4AD6A 4D3GA 2M7SA 4PQUA 1DHMA 3IBCB 3TEHB 3VZIA 3IG1A 1O8BA 1RHMB 1U7LA 2GIFA 2NLWA 1KOHA 4JUZA 3W8PA 1RT1A 3O6QA 1LEOA 1Q0NA 2KJVA 3LAMA 4ZCIA 3H25A 2MGZA 2HMIB 4DS4A 4FF3A 1FJEB 5E2QA 3RRHA 2DR9A 3LALA 2IYIA 2MZJA 1L3TA 4JV2A 1FNXH 2KFNA 1RTJA 4QIFA 1JK9B 3ENWA 4NYPA 1N0VC 1N33F 1MU2A 1B7FA 2HS3A 3VR1A 4GC6A 4WFAQ 2V9WA 1FXLA 3CEDA 1QE1B 3NGKA 4NYZA 4TNOA 2IPOB 1ZTTA 1ZPVA 2W2MP 1EP4B 5A8WA 4ZPDA 3CF5Q 5KG6A 1U1LA 3HFKA 1F9EB 4I2PA 1HBNA 2UUBF 1RT7B 2NYHA 2V2ZA 4NLPA 1EZZB 1NDLA 3E3XA 3T5HA 4ZLNA 1MN9A 3DU5A 1VGYA 2ROPA 4I7FB 4YDXA 4UOGA 2HS0A 3MMCA 1T05B 1UP1A 1L5UA 3W9JA 2BJEA 2G2YA 5HROA 2XCPA 1N88A 4DG1A 2DR6A 2W25A 1GMVA 1HBUB 3OLAA 1SL0A 4ELVA 2XY7A 1KTQA 1IKVA 2Z2YB 4KO0A 1KLNA 2J6UA 2MLXA 2AWZA 1N5TA 2RD5C 2LDIA 3K57A 1RYSA 2DNYA 4PUOB 4DZDA 4K4ZA 4OYWA 1VRUA 2FQQB 4GMKA 4X4PA 3UCZP 5JXSA 1CJUA 1S0NA 5IM0A 3D7SB 5D6GA 2QN6B 3MAHA 3T5KA 5M2PA 4DV5F 4ZDNA 3H2VE 2CPZA 3MCNA 2AIRB 2COLA 2HWIA 4DI6A 3OTOF 3DLLQ 3BGOP 3R6LB 2DH7A 3UNGC 3NCQA 4DR4J 2XB2D 1Y7PA 4OZ1A 2FZGB 1DLOA 1IM4A 2HK2A 4ZVQB 3UCUP 1HQUA 2XMTA 2IA6A 2F65A 2KU7A 4NLRA 1VK8A 1RU2A 3HHLB 1S9EB 2HBZB 1FRJA 1XQIA 2DGSA 1BE4A 4Y34A 5T7LB 4MYUA 2K2PA 2LVWA 4EK2A 2YNIA 4YOEA 2IJRA 4O0NA 4DV7J 4WP9A 4CLSA 1Y0HA 2IJNA 4HACA 4LR9A 3ENVA 1S49A 4NXNF 1H74A 3ZTOA 2KKHA 5FD1A 5SUHA 1XMBA 2V2VA 2C28A 4JI5J 1IR1A 1SV5B 1RGVA 2E1MC 3ZZRA 2VPZB 5JMNA 2ZD1A 2BVZA 2XGPA 1NJWA 1TK0A 1NSAA 1HNWJ 1NU4A 2W9CB 2W2NP 4QBUA 2BW7A 4KHPJ 4CTAA 1FCAA 4L3KA 3PEJA 3HZEA 5I42B 1X5PA 1X4BA 2VG5B 2I9SA 2GMJA 1U1PA 1QUVA 3G9CA 4X4TA 3PR4A 5HLFB 4NA1A 4NLDA 4P72A 3RB3A 1VRUB 3Q86A 3KHGA 1MN7A 2FGOA 3ELHA 3C19A 1FWKA 2RUGA 1SJ1A 1AFIA 2BBEA 2R2SA 2GV1A 3D66A 5D4NA 3QZ8A 1F3FA 1RWMB 5ITHA 1H2VZ 1RT3B 1Z2ZA 4FNHA 1VIOA 4A48A 5IC4B 2W7OA 4RBVA 3O8WA 2P2CB 3G6ES 1ZH5A 5D4LA 1FRLA 2NZCA 2GVDA 1KVIA 1HFEL 7FDRA 4URQU 3DYAB 5ADZA 1HARA 3QSYB 4LMZA 3KFWX 3PRVA 2PFDA 4KKOA 2GO9A 5ETRA 1NHUA 4OZ5A 3W62A 3B4MA 5KFOA 3J81U 2UP1A 2RRNA 3RAMA 1KFDA 2KFZA 4H54A 1S1XB 3EGWB 3H42A 1WORA 3D9BA 5IFMA 4OYBA 2RQKA 4LF7J 4OJ1A 2XMKA 4X84A 5DDQC 1TU0B 5LOQA 1Z2LA 3H8YA 4M5HA 4MK9A 3JYTA 3OXLA 2DNLA 3K8WA 5ETLA 3ADAC 4X66F 5DDPC 4WE1B 2WHOA 3QT5A 2RSQA 2AP6A 3MURP 2JX2A 3FUYA 3A4TA 4NRTA 1KTVA 1QAYA 3QMQA 4L76A 3FQLA 4ZHRB 4IR1A 3DHXA 4B9SA 3HFZB 1YQHA 2GJ2A 3FRZA 1RB0A 2DXEA 2ZWOA 3G8QA 3UN3A 2FPHX 1U0HA 1LWCA 2F1FA 4P71A 5LXYA 3V6DA 2ASDA 1D8YA 3MEGB 2E7XA 3PRDA 2ASYA 2CKWA 2I5JA 3ENQA 3N5FA 4Y65A 4JI0F 4WTYA 1EARA 3THPA 2BOAA 4ZITA 1VQPS 1RKJA 2J0XA 3UD3P 1ITPA 2WOMB 1HBOB 4RW9A 3R7SB 1JLCA 1JJHA 1MWZA 2B9EA 2LECA 4WJBA 2NREA 2K1RA 2NQPA 3DI6A 3N28A 2CQ0A 9RUBA 1FXDA 2MKJA 1S77D 1HWLA 3MD3A 4KO0B 1NDKA 4C8NA 1N34F 3OVAA 2FJAB 2NCKL 4DMZA 3RZAA 1HWKA 3UN5A 3CB4A 2FB0A 1FFSB 3Q8YA 5KFNA 3SV3A 2NXEA 2HFSA 5DG7A 1OPIA 2N3OA 1VISA 9ATCB 2HHXA 4LSZB 1UA1A 3GE9A 1RYRA 4ED8A 3BBFA 3LA0A 1Q82T 3FFIA 1D9FA 3RGIA 2CPFA 4R0EA 7AT1B 2Z58B 2BM1A 1WC0A 4KKOB 1FO1A 3WBZA 4C8OA 3QATA 4USWA 2MKSA 4HTJA 4DUTA 2E66A 4DR6F 3VAFA 1HD0A 2GMHA 4FYVB 4PG6A 3HJFA 1LKZA 1PJ6A 4DR1J 3KOAA 1NBEB 2KT2A 4YP3A 2EVZA 4ZVGA 1PILA 2FVSA 2BX6A 3DGPA 4YDDB 4RZRA 1G3OA 4WFYA 2J0SD 4FF2A 4J9OA 3MUVP 2ZH7A 3M30B 4Q0BA 1PGZA 1KVJA 5M2RA 3IXQA 1FFWB 5J1PA 5GAHU 3J7ZT 1Q1KA 2VIHA 4JI3J 4F04B 3V4IA 5IC6B 2QLXA 4TQRA 3JTPA 4M5MA 2VU5A 1VQ8S 1GMUA 3IRWP 3R5GA 2W01A 5K9FA 2AF6A 1FRKA 1NNDA 1TL7A 4GVLA 3LP0A 3PJWA 3GIIA 1DJ0A 1SIWB 2BRKA 1B0VA 1OMSA 4JB8B 3GV7B 4MTPA 4DPWA 4X4QA 1S48A 4IH5A 3CC4S 2BJ9A 3HF5A 5KFTA 1TKTA 4RBTA 3EPIA 4W90B 4C8YA 2GW8A 2HNZA 1FRIA 3KK3B 1UPMB 3O44A 2YWWA 3BZQA 1HA1A 5DRKA 1HYSA 2IBOA 2R7VA 1R8BA 1N36F 4G1IA 1CPZA 3M32A 2Y0SD 2Z0GA 5KT6A 4GKKF 4FF1A 5IT9U 3V5RA 1EJ7L 2XHCA 3S01A 1YVFA 2L48A 3ET6A 4LJMA 2ZH9A 1M5VC 3IWNC 1S6UA 2OFGX 1QVGR 5D0EA 3EWGA 2MB0B 5L9XA 2J0QD 1KONA 2AEFA 3CJ2A 3QIDA 4ZA1A 2KHDA 3LP2B 2FVRA 1OYDA 4EO6A 2HFZA 5KFMA 2DR7A 3BSOA 5GVQA 1RTHB 3TW0A 2FLPA 3P49B 2VB6A 3H7HB 2AQ4A 1WUUA 2B8PA 3ZZPA 4TXSA 2IHR1 3S1TA 4X4OA 3X1LB 1IBCB 3DLEB 4MIWA 5C25A 3Q2SC 4TN2A 3FK4A 5AJ3F 3F41A 3W9HA 4OJGA 1R0AA 2BDPA 4QWDA 2J8AA 5HANA 2VPWB 2E5GA 1FJGF 2XLJA 4DF8A 4DX7A 4QYRA 2HAFA 1RJJA 1TL7B 1YKWA 2P5VA 3NAHA 4I2QB 1FD2A 4JI1J 5KOWA 5D3GA 4OHVA 2MZTA 2RVJA 2W9CA 5EDWA 5JUMA 5MAOA 4F50A 2ZH2A 2HS4A 2Z2ZA 1R43A 1X5TA 4ERDA 4WFNQ 3H59A 4UOHA 1Q53A 5K8NA 4A8YA 4ZVUB 2UUAF 2HK3A 2OIHA 4GKJF 3LGHA 3ICLA 4B3MJ 4JI3F 2F8HA 4O3PA 2IRYA 4HACB 1R8PA 2JLGA 3FEZA 3ZZTA 4LF9J 2QYGA 3LPYA 4RL1A 3N6LA 2RF2B 1H7XA 4WYLA 2MQNA 2GJIA 1R3NA 2B4VA 3OFHA 3GB0A 3HT3A 3EGVA 4K4WA 4ECVA 3UDVA 4OX8A 4ZP9A 3Q0AA 3BDEA 2VHGA 2E9TA 4ECSA 4JOUA 4OZ3A 3OXGA 2J8SA 4CLLA 1JQGA 3G86A 4O3QA 1YHQS 2YX4A 5G0RA 2V67A 4H4KA 2C2MB 2DHHA 2UXDF 4LR7A 3CCTA 5IT9Y 2WVCA 4CLZA 4F0HA 1HQEA 1WI8A 2EG2A 4PXBA 3L3CA 5JVHQ 2A3JA 4RLEA 3ZO7A 1XMQJ 2KH9A 2OMOA 2H5IB 3CW2C 1YBAA 4C0OC 2YKNA 1YGYA 1S97A 1E6YA 1T95A 3CJ0A 4ILMA 1CBKA 2J76E 4ZP7A 2DRAA 2GQ2A 4NOHA 4J5OA 1YWXA 2RKIB 3HD1A 4KV8B 2KT3A 5KT7A 1EAYC 1TL4A 4ELUA 2XWYA 2FVQA 3P5BP 2HQ3A 4DFPA 3VGUA 1TKZB 1BXNA 2B5JB 1H6KX 1S5ZA 2MXYA 3KLHA 3I56S 1WG1A 2OUGA 3JQMA 4C7QA 2WB4A 1I6JA 4ZVRB 1EX8A 4F26A 1WSRA 3D1OA 3PZPA 4V19J 5J2QA 3TJAA 3QYYA 3MM5A 4OQJA 2FZCB 2KB2A 4I1TA 5D0RA 2BKOA 3M05A 2IVFB 1KS2A 4ECWA 1WKJA 4RX6A 5ETKA 1G6BA 3M8RA 2MJNA 1YJ9S 1FT8A 4DPOA 2XY6A 1UPPA 2DY1A 3W65A 3MUMP 1X31C 1LK7A 2GC8A 3M9NB 1K0TA 3PX6A 2FY8A 1XEZA 3OL7A 2GAGC 3MMBB 1WI6A 4JI5F 1UJ4A 3E2EA 2FDNA 4R25A 3CXCR 1RE1B 4KGKA 2C2ZB 2ZH4A 5AE3A 1SQEA 1JLEB 2DNOA 1CJKB 4JP8A 3FC9A 1S9GA 2O5DA 2CQ2A 3MM7A 2DXFA 4OI2A 4C11A 5IT0A 2WTFA 3G6YA 1HD1A 3MFIA 3MEEB 3UR3C 4F3QA 2OP5A 2FLOA 2V8DA 4KIAA 1NK7A 2U2FA 3GFXA 1CJVA 1O0PA 2Y1RI 2NXCA 3NGDA 2QX0A 3W63A 4NL5A 4OJHA 5U47A 4X64F 1Z1ZA 4X64J 1L3SA 1QUPA 5DJBA 2CNOB 3AD7C 1NUEA 2HGMA 3LH2S 4WFZA 1I3OB 2IM1A 3IM9A 1PC5A 2F4VJ 3DKDA 1KQKA 4CO2A 1H38A 1S6OA 1X0FA 3K5PA 1RHQB 1ZS6A 4LIWA 2Q43A 4DUZJ 1EIYB 2OGUA 1VQKS 4HKQA 1FHTA 1DQ9A 3TX8A 1VCTA 4RW6B 1M5HA 3P4UB 3IS9A 3W7BA 2LXUA 3Q8VA 3Q8SB 3A3NB 3RW7A 2HHWA 1UW9A 3PYFA 3PO4A 4RUAA 5T14A 1WHWA 1EKRA 2LQBA 4IKAA 1WJ9A 4NLQA 3BDPA 2EG1A 3KJFB 1OSDA 4C2MA 2CPHA 1RWOB 2CG8A 2HGLA 4HHHA 1JLBA 5G4DA 3BQ1A 5C25B 3RJMB 1FKAF 3HKWA 5LSLA 5I4MA 5AXNA 2AJ2A 2X3DA 4X65J 3QLHB 3BGUA 3Q83A 3J7A1 1GH8A 2OELA 3D0IE 2RDDA 2BABA 4P2MA 5LL6d 3EXCX 1S12A 1S1TB 3US5A 1RTZA 3VQTA 4BCAA 3M2VB 1G2EA 1FJCA 3G2XA 4IG3A 4P9SA 3QIPB 2GQQA 3AD9C 2FLNA 1ELOA 3M8PB 2XS7A 4CO5A 2OKQA 3EZOA 1GXUA 1RA6A 1F5BA 2ROGA 2L9NA 2VFRA 4IH7A 4PWWA 2R7SA 1RSCA 1HBMB 5KT3A 1KWMA 4OL8A 4DV1F 4DFKA 4R8UB 4RW4A 1C0TB 5IOLA 1RDRA 1CSJA 1SJRA 3AH6A 2FJDB 3DM2A 1N36J 4JI0J 1VMBA 2BACA 3J7YI 1KRPA 4QIGA 2YQ0A 4FYDA 3G82A 4IDKB 4DX5A 3FBEA 5ETMA 1WTBA 3W2WA 3UI3A 3GILA 3GV5B 3OR2B 4LSNB 4K2JA 1GQEA 3R8YA 1C4AA 2WBRA 1JWWA 3CCUS 5FIIA 3ZTRA 3CIMA 2XWXA 1RTDA 1G7CB 5KG5A 2KVIA 4UY8T 1N0UA 4L3NA 3HULA 4DV6F 1FNMA 4MFBA 4LFCF 5DM6Q 2F4FA 2O01C 4GVBB 4NLXA 3UN2A 1ICEB 2X3GA 3C6UB 3PV8A 2RQMA 1FDDA 3SCJE 2Y9HA 2VJVA 2GHWA 4CO0A 1FTRA 2H9ZA 2BQRA 2EC0A 4RW7A 1IBMF 3FZBA 4X4SA 4LSLB 1RWKB 4KHMA 4G6VB 1KHWA 2P6SA 3OLBA 3BM7A 2DNNA 3QGHA 3THTA 1LV5A 3R97A 2PMZD 1UEUA 3CJ5A 2XNQA 2HRUA 3RRKA 1SC6A 2D7SA 1NK9A 2UVVA 3ZTQA 1HL6A 1R8HA 2WAQD 4CI0B 2VBZA 1MG7A 4MT1A 4UF4A 4R5PB 3BJYA 1RKIA 2JVOA 3HI9A 3BQ2A 2A6OA 2UXCF 3AQPA 2ASJA 4OYZA 3MTJA 4DU7A 3H5YA 3G6XA 2HW3A 2ZKTA 5DLGA 2DBBA 5HQLA 3I82A 1KFSA 3SDEA 3I55S 2P9EA 4HL9A 1WC3A 1YSJA 4QR2A 4ZCKA 1YJNS 3T3FA 2V8HA 3QO9B 1RU1A 3BH7B 3MM8A 5KFUA 3J81Y 1SKUB 1UVMA 3FMWA 1KOOA 5HBMA 2GNKA 3EUNA 4PPDA 1HNVB 5KT5A 4ANCA 1JLAA 1IJEB 1PBAA 3TA1A 1HWUA 2V94A 4RNHA 4N56A 1N52B 3TEGA 2GMLA 5KFSA 4KHRA 2R8IA 3B8HA 2NXJA 3PM9A 5HO4A 1A0OB 4B3TF 4GKKJ 4HVZA 4NZ6A 3JYTB 4EYHB 2H51B 2LQ9A 2V4JB 2HVDA 2FHJA 2ZEJA 3GIRA 4LRDA 5CD4A 2ZH6A 1IN0A 4FBTA 1XNRF 1XN9A 1UVJA 3GP9A 2R2UA 1OJ4A 3QT7A 1CC8A 3H2LA 3QJLA 3CCES 3FEYB 4LUBA 3Q8UA 5LJ5Y 4DUYF 3I0SB 2H48B 4PKDB 4A8WA 1NCLA 1WHXA 2ZC3A 3TARA 4JI2J 4M5JA 2DR8A 1GX6A 2N4DA 1Q8LA 2XO7A 2M0GB 1FNOA 1REVB 4NXMJ 2QA4S 1KHVA 3M8YA 5JVGQ 3FFIB 5E0OA 4CLKA 3AB2B 4OV1A 4DR7J 1I51B 5K20B 1IBKJ 2CFXA 4WZMA 2OPPB 1SJ4P 3CCWA 4TKTA 3M8QB 3OL9A 1QM9A 3DDIA 3G82B 4IDKA 2GHPA 4FPRA 3VAJA 2UUAJ 4UY85 3C15A 4QWAA 3MFHA 1AB8A 3P8BB 5D15A 4B9LA 1FWPA 3MEKA 2XI3A 1NRKA 4C11B 3DI6B 3OFEA 1BQMB 3DRRB 1OPZA 3GG0A 2EKYA 4E0DA 1RHUB 1HHTP 1WACA 1HR0J 3OUYA 1IBLJ 2Q6CA 4DV1J 2ZFHA 2YNGB 2YWEA 5J2MA 4OZJA 4C3MA 5D3GB 5F8GA 3F0NA 4KFBB 4ANEA 2X1GA 2JC0A 3V6KA 1S1VA 1R0AB 1HHSA 3HLUA 5E3PA 4OX7A 3T19A 2YKPA 4RW6A 3UQSA 1XMQF 1KNZA 2PIIA 2OO4A 4IH6A 2H4WB 4ED4A 2DIUA 5RUBA 4XPEA 1X9SA 1HPZA 1P6TA 5E3QA 3VALA 1PJ5A 4OMFG 3GONA 3T9NA 4QWCA 1NKBA 3NOGA 4KAIA 3CJKB 1CQNA 3N9UC 4QWBA 4M5IA 4C8MA 3PHEA 1X5OA 1TL3A 3WQPA 1H0HB 1MMLA 1RT4B 2G0JA 4NCGB 4AL7A 2DYAA 4YR3A 4G1QA 2ABYA 2DNGA 3IGVA 1U4BA 3N01A 3L7UA 3PJ9A 1VHIA 2BW2A 3ET6B 4X62J 2MKKA 1QAIA 3NXZA 1JX4A 2IM2A 3GIMA 3OFGA 1B99A 1YK9A 3MCOA 2CJYB 2R8KA 2IJFA 3HHLC 4QU7A 2QJ3A 1AZSA 1I5OB 2YNHA 4USIA 2L41A 2AGOA 2UZAA 1A6LA 2IVYA 1KBRA 1HQEB 4WBFA 1VBKA 4K0KJ 5K8MA 2F40A 3BV8A 1X7VA 4RJVA 5DDOC 2H3EB 2LDYA 1CG2A 3GJSB 4CYUA 1VQ5S 4B3SJ 5F41A 3OSPA 1N8RT 3KJQB 1JLFA 5IS2A 3QT8A 3IR7B 3MD1A 3MPVA 4DBQA 2LYVA 3I0SA 5KFLA 2CNLB 1C0UB 2LLZA 1WHVA 3CCMS 1DRZA 3NCRA 4HTIA 3CDBA 1K8AT 2HURA 1V5IB 2J9DE 2A0FB 4QR1A 5A2QY 3CJ4A 5LMUF 2MLYA 4RUBA 3NNCA 1CLFA 3CULA 3WX8A 1L3KA 5HLFA 1VJWA 3OHAA 5HP1B 2ZHOA 4B3TJ 4B3OB 3UR0A 1O51A 1HNXF 4KBIA 4ZPCA 4P52A 4A8OA 2PEHA 2UUTA 4CTAB 3POTB 5CD4H 2HHQA 4C0BA 4NWBA 3FEXB 2E5JA 2FLLA 1BLUA 2LFVA 5BR8F 3D5MA 3JB9k 1S76D 1BY9A 2H5JB 2ZZNA 3E51A 1VDHA 3W8GA 5HN0A 3NAIA 3RW6A 4LFAJ 2EC2A 1P27B 4DV3J 4WKRA 2DGXA 4LF5J 3MR5A 4PG7A 4QJVA 5L39A 3C15B 3EVOA 4FYYB 2NUUG 1Q95G 1YLXA 2HLUA 1FF2A 3D3BJ 3KHRA 3DLEA 4CWBA 4DL3A 1D3WA 1TQLA 2U1AA 3LAKA 3NEKA 4NX9A 3KWMA 1YJVA 4ATNA 1B0TA 1Y3KA 3K5OA 3CMQA 2EFVA 1VLOA 1FVSA 1U6FA 4DV0F 2E1PA 2I1RA 2GVZB 4KPYA 2JL9A 4WF9Q 4P75A 4AQYF 1NJXA 1BHNA 1TL5A 4X66J 4DXLA 1K44A 3IR5B 2B7CB 4JV1A 1U1KA 1HNWF 4K4UA 3GWCA 3FSYA 3MMJA 2XG8A 4I64A 3Q24A 4AFFA 1VC0A 3ILOA 1YBTA 4HT5A 2MMYA 4H4MB 2RB7A 4IO1A 3FJ2A 3FQKA 4OIXA 4CP5A 1IKXB 1B0PA 1SH0A 2IDLA 2KYXA 3CDWA 4FKYA 3T6BA 1MROB 2CQ4A 3M2UA 1UWBB 2B4UA 3OTBA 2GCFA 2N3LA 1V9OA 3UVJA 2DY9A 2FJVA 2G9OA 3TUZC 3TR5A 2W4CA 2IC3A 3NG8A 4YY3J 1RUSA 2ZDPA 1WC5A 2ZJPQ 3J80U 4WCEQ 1RBLA 3VTIA 5CZVA 5HBMB 3C6TB 5D4PA 5HP1A 4DV6J 4OYXA 1PO6A 2QGFB 1JJ2R 4K5RA 1U47A 1RCOB 2ADCA 3UE2A 2BMBA 1HIYA 4IOBA 1U2CA 2HHVA 4RU2A 4CCHA 3DLKB 4RW8A 4WKYA 2H4YB 3NMAA 1HBNB 2B9YA 4KR0B 2FUG9 3LOUA 3GSDA 1XJWB 2J7UA 4OX9J 3NCPA 5I42A 1GMWD 1TTHB 2HFVA 4DL7A 2MQOA 4HEA9 1FA0A 2OTJS 1HW9A 2UUBJ 5DO2A 4EYIB 2RJZA 3IBFB 3BPDA 2N82B 3FNNA 3PNIA 3R5BA 4NLWA 3R2DJ 1HLWA 3PACA 1CEZA 3GG1A 3M9MB 4LSLA 2KHCA 2ZBRA 4NPOA 4F36A 5J1EA 5F8HA 1SL2A 2QEXS 4FXDA 3FCHA 4U9RA 3BYPA 4I6YA 4C8KA 3RR7A 3TYTA 1NEEA 2M52A 3BYRA 4YB5A 3I4HX 4ID8A 2QA1A 4PWUA 2HBQB 1GMWA 4OX6A 4F0MA 2V63A 2QMXA 2OFHX 1P1LA 3LO3A 3D28A 3M2RB 5A8KB 7FD1A 2VD3A 4RUHA 4WWSA 1D9AA 1RADB 2UXCJ 2QSFA 1HNXJ 1X5SA 3NMRA 1BQNB 3DRYA 5IZHA 5DQIA 4RWWA 4OV6A 4CZCA 2FJBB 2K1RB 4NLUA 2GIRA 1YITS 3A3OB 5KFXA 2K06A 3QJJA 3MM9A 1JLCB 5EHHA 1NJYA 4O44B 2NR0A 2W4DA 2YKQA 5FJ4A 5K14B 3H4DA 3JQKA 1UJ6A 1YBUA 2HQDA 3LF0A 3ULHA 5FLXU 3BKTA 5CQGA 5HVHA 5HATA 1K9MT 1KQFB 2M9KA 2B6AB 3DMJA 2ZH1A 2N4CA 2YPZA 4G1PA 4LF7F 1F1BB 1BC6A 4B3RF 4J9LA 4ZHRA 1P9YA 4KJIA 3T1HF 1IKWA 4EBDA 5HL7Q 4CO3A 4C9DA 4NA3A 3M8SA 2Q6BA 3D0GE 3V6JA 1UFWA 1YG0A 2M5YA 1F5CA 3PHTA 4DCOB 3UNYA 2CPXA 3N79A 2AHOB 2CDRB 4H4MA 5CAAA 3W2VB 1EQ0A 3KLFA 4BBYA 5DQHA 4RO0A 2K7KA 3QLHA 2Y8YA 2CIMA 2VQFJ 4OZNA 2OEMA 4RNMA 3EVWA 1X60A 4IQMA 4YB6A 3MR7A 4X62F 3KHLA 5A6PA 2ZJRQ 1OYEA 4DDFA 1RABB 4QWEA 1YZ7A 5CA5A 3MR6A 1FWLA 1TR0A 2VG6A 2BA9A 3B78A 3NGTA 3SQOP 1EP4A 5DETA 3DDKA 4QIEA 2G0IA 1H7WA 3T5LA 5IM0B 3LW5C 4YB1P 1UEKA 5KG7A 2OAUA 3CCRS 1Q79A 3IFEA 3HVTB 3ZNJ1 5B08A 1NSPA 4GO5X 4F67A 3SI8A 2HVIA 5J2MB 1NPPA 1SKRA 1XTZA 4L75A 4HYKA 8ATCB 3WC2A 4EBCA 2KO1A 4JBCA 2RNEA 1HNZF 5FDLB 4OZ2A 1DBDA 3MECA 1FFGB 2DNQA 4USJC 1D0EA 2HVZA 3TUIC 2C3MA 3HVTA 4DU8A 2MHNA 1GEHA 3OL6A 2VC0A 4USVA 1TKDA 1A7GE 1CJVB 1ROFA 1S1WA 4IYQA 2PC6A 2OI2A 1RTIA 2OPQB 5A8RB 4UT4A 2KM8B 2DTJA 4O3OA 3R1HA 3M6WA 4WIIA 3MEGA 2QSWA 4NCBA 2Q66A 1CS4A 1S4EA 4I6AA 5JJBA 3PX0A 4PXEA 4LF6F 3MOJB 1N6QB 1H98A 1IR2A 3JAMU 2E5LJ 1RXOB 3KLEB 4LFBF 1C0UA 3X3UA 2DXDA 4ECYA 3BKFA 2DRDA 3QWPA 3SCLE 3W2VA 3SSSA 4DR5F 1BQNA 1XERA 4JI8J 4OHYA 1MWQA 2BJ8A 2RMLA 4DV5J 1L3UA 4Y2KA 3BN4A 4CRJA 3FRYA 2OEKA 4NLYA 2F7VA 4DQSA 2XS5A 2ZH8A 1T11A 4X4NA 3I87A 1NK0A 2MQQA 2GIQA 1GAOA 1TL3B 3KUHA 5B0GA 4WFXA 5EX0A 1SB6A 2QFIA 1WKKA 2R4FA 2IMWP 4KGZB 3TUPA 1U6BA 4KY3A 1Y9OA 1Y5NB 3MAQA 4J9MA 1RAHB 2XNRA 3JSBA 3A8IA 4ZN1A 1HNZJ 3MMAB 3TZWA 1S7IA 1TL1B 1NB2A 1XK8A 4QQBA 2GVDB 2DGWA 3A12A 3AA9A 1JLBB 2X1BA 2D41A 3PFEA 4IFYB 3KDNA 4ITSA 2A18A 4DPYA 2VA2A 4A8MP 4NLOA 1U1MA 1FJGJ 3BR9A 2VBYA 4KB7A 2RH3A 3OJUA 1KKHA 2AZ1A 2J6TA 1DARA 3MTKA 5DQGA 4K4SA 3D6HB 3D54A 5C42A 1TFYA 4ZP8A 3JXOA 2HHSA 4KE5A 5A8KA 3DXBA 3RB0A 4JI7J 4Y2CA 1SQGA 4ALZA 2FHOB 4P2SA 3FSXA 4UOFA 1FX4A 1SJQA 4QW9A 2YBVA 4IOCQ 2RQ4A 4WP8A 2WVBA 3DLGA 4WYWA 2BV3A 3AOCA 1URNA 1C0TA 4IR9A 2R7TA 4J37A 4I67A 1NPRA 1B64A 5BYSA 3KLVA 2WK4A 4AL6A 2K8GA 3OVBA 3AODA 3ILJA 4U8VA 1IKWB 1VRTB 1UMJA 1S6PB 4NI2B 2KXNB 1HI0P 3QBCA 2EK1A 1YRUA 5F8NA 1AZSB 1F0XA 2G2OA 2CQ1A 3IRXA 4R0JA 3VF0B 1U8WA 2ZHBA 3I4PA 2M70A 3HZGA 3L95X 3DLGB 5KT4A 3KLIA 1QE1A 2YTCA 1LNQA 1AUSL 3IMQJ 2HYIB 1NXIA 1PC4A 4LREA 2VG7A 4FBUA 2E9ZA 4JYAF 5GAHI 1NMEB 1UKUA 1QVFR 3MUTP 4DPTA 2YWGA 5B0CA 3VHQA 2QO3A 4CQ1A 1RA7A 2V6AA 4PXDA 4U95A 3HSDA 1YJ7A 3CCZA 3MDFA 4C3LA 2DGUA 2XI2A 2LQ5A 3E01A 4OHXA 1RAGB 1UFLA 4DR3J 4YR2A 4PQUB 1V6HA 4L74A 1Q8BA 3C3LA 2Y8WA 3BBCA 4PABA 2KXHA 4QIWD 2IY5B 1R0BG 1GNKA 4IRCA 1TFWA 5IT4A 4UW2A 3OR1B 5KOXA 5KFWA 3M2UB 3H98A 5I3UA 1JJ4A 2E1CA 1F6TA 5J1NA 3RBXA 4DG1B 1TUVA 1N4LA 2APOA 1S1UA 2HRYA 3C16B 2FJWA 1Y10A 1X4GA 4B3RJ 3DGPB 4S0MA 2CQIA 2RS8A 3EJMA 3KLGA 4N8NA 3G6VA 1QSSA 5D8HB 4YY3F 3CDUA 4J9NA 2BKPA 3TVKA 2M2BA 4I2PB 3VGTA 2A6MA 3ISND 1KDNA 2CUYA 1S57A 3A8KA 2LA4A 3NGSA 5CHCB 2XSJA 1ZM3A 3QGGA 5KFEA 4TU7A 3HVWA 2SXLA 4CLTA 4G65A 1VYAA 1TVRA 3AJ2A 3H0PA 5C24A 5I3QA 4ECQA 5E3AA 4DQQA 4DJBA 2QA4G 3GR0A 1SKSA 2QFJA 3PDNA 1YZ6A 1N5YB 2E5LF 4YHHF 3NGUA 4F4ZA 2JVRA 1Y4ZB 4MIBA 2RAQA 4ECTA 4K59A 1N34J 5K8PA 1VBYA 1XC9A 4DV3F 4RR5A 1HNIB 3TAQA 2J9CA 4LFAF 3OT9A 3DNCA 3ZZUA 3BSAA 4LVOP 1RHJB 1Y5LB 1JLQB 1JLGA 2VFSA 2WZ1A 2R42A 3VQSA 1XMOF 3IWXA 1CULB 1URRA 2NZ4A 1R27B 4DSJA 3CTRA 3HSZA 3DRPA 5HQ8A 5D78A 4RNOA 2CQPA 2NS1B 1HW8A 3WIUA 3S6EA 3POTA 3HHKA 4WIQA 1F3VA 2CZ4A 2POKA 2LKZA 3CO9A 5KG3A 1M5OC 1LWEA 2L9WA 2M4MA 1X8DA 3QGPA 3W66A 4DQRA 4TLRA 5J2QB 1M0SA 5DG8A 1YRTA 4TU8A 2KXFA 2LEAA 2OD4A 2P9CA 3HD2A 3OR1A 4GVBA 3TA0A 1ZOTA 2KI2A 3LANA 1ZTWA 2ASLA 2DD8S 1TKZA 1JNRB 1H2TZ 1RISA 1RT2B 2B5JA 2KT5A 3NRBA 3KLHB 3MPDA 3BF4A 1HNVA 3CC2S 3A3PB 4B3SF 4ELTA 1XNQF 3OTCA 4TLQA 1K47A 4P2XA 4ETXA 5KG1A 4V19X 4DF4A 4MAKA 2AJQA 1S0MA 1LOUA 3QO9A 1F5AA 4Q5VA 2WSEC 3CC7S 1LXJA 4LF4J 2VFVA 2UXDJ 4AXIA 5GAGI 2RRBA 2CZ9A 5B7WA 2BJ7A 3KG4A 3R5DA 2HBRB 3M6VA 1EETA 2QTWA 3NS7B 3QZ7A 3KKFA 3WIVA 2CQGA 2F8EX 2GZOA 4K2XA 2HPUA 5J2NB 2ZNYA 4DZ6A 3Q8RB 2M3DA 3MPYA 1U45A 5J1EB 2ROEA 1QSLA 2LXIA 2PMWA 2YNGA 1TELA 3JQJA 3VZHA 1MNEA 1DQAA 4DQIA 3RR8A 1DQ8A 2CPIA 2X51A 1M1GA 3ZZ0A 1U2FA 3NNAA 3T1HJ 2R7UA 1VRTA 2KJWA 2I38A 4LBHA 2X1AA 2DITA 2AYEA 2RF2A 2DCUB 1KLMA 4EUVA 1R89A 1U48A 2W2QP 3OXFA 5AT1B 2B9WA 5J2NA 4PEOA 3QPIA 4IOAQ 4E98A 2EFNA 3MAAB 4LBPA 3M8QA 1PSDA 2PN6A 3DLKA 4RW8B 3VVTA 1ZZNA 2R8GA 3QFHA 4TVAB 3AOAA 1ZA1B 6AT1B 5HMXA 1ZA2B 3DRXA 3PVXA 1W2BR 5H9EJ 2HHTA 2IYGA 2L9DA 2AMCB 3AT1B 4I2QA 4JV0A 3O1LA 5F3ZA 1TV6B 3PR5B 4IO9Q 2V8GA 4P6QA 1S0VA 3IM8A 1DTTA 1E6VA 2HFOA 3D6MB 1R8AA 4JI6F 4DN0A 3P45B 4M8LA 4W4MA 3R7BB 1R8CA 4CO1A 1UW4A 1ZAWA 3PYEA 2OPSA 1IUJA 1T3NA 4NYOA 4OZLA 4BDPA 1NSKL 3HHLD 2I6WA 3I5AA 2VFUA 2OTLS 3RU0A 3T1YJ 5KG0A 4C0HA 3ITHB 5KFCA 4EO8A 3KDOA 5KFJA 1UZHA 3SEOA 4BWMA 1TUWA 2XCAA 2W9BB 2XHWA 4DV2F 1VC5A 3K8VA 2PT0A 3DRPB 5H9EK 3BEGB 2Z4PA 5CCMA 2WW8A 3GMGA 1QY7A 5A76A 3RTVA 2VONA 4DL4A 3L7PA 2Q79A 3D67A 3KUEA 4ZPAA 1T0TV 1RQ0A 5LJ3Y 2PDAA 4ZP6A 2C2RA 1S7HA 2I2YA 1KN6A 3QNWB 2VASA 3SXLA 2XULA 5DGBA 4DWIA 2LA6A 4QYZK 3KLEA 2HWTA 4CIOA 1S4FA 4HR2A 5GMEA 4WXOA 2WBMA 5A2QU 5EX3A 2LQ8A 3U7JA 1TVRB 1WC6A 2BJDA 5C24B 3BSNA 2ZC4A 3CJTA 1KP6A 2F9JA 2V4JA 4N7TA 1N32F 2VG5A 4NEZA 2ERRA 1WOOA 2JZ5A 4KH0B 4Y2MA 2B0GA 4DR6J 2IC3B 4WZQA 5L1IA 2MKCA 5CYQB 2DPJA 3D0HE 2RS2A 4KGMA 1QSYA 3HSGA 4U67Q 3VAMA 3VAGA 1WC1A 2DNKA 2I0XA 5FDLA 4YQWA 4KHPF 1XNRJ 1QTNB 2AYMA 3TZYA 3C66A 4M1KA 1NO8A 3MM8B 1B70B 5AXKA 3PW2A 3FBBA 2JNJA 5HROB 4J9RA 1U24A 2HEKA 4O3NA 1HI8A 2KG0A 2ACMA 2ZHAA 2OPPA 5HMYA 3DU6A 4F4WA 2PD1A 1JKHA 3OD2A 2R3VA 2DR5A 2MDAA 2O67A 3LWMA 2MZSA 4M94A 4K7QA 2O1PA 1WDTA 3EGZA 4NLSA 5FLXY 4LR8A 4QPXA 3HHLA 4M5GA 2XMUA 3DOKB 2ZH5A 4IRKA 2UVUA 3AJDA 1U26A 2JC1A 1NK6A 4I6WA 1RWXB 2RDIA 4ED5A 2PA8D 2CG4A 2HIYA 4NMLA 4Q2LA 2BZ2A 3ENAA 1N5YA 1V3SA 2GFFA 1W25A 1Q7YT 1VQ6S 4FDFA 2VJUA 2V4QA 4CLUA 4M95A 4NE9C 3CJ3A 5LMUJ 2B51A 3G87A 1CQMA 2MKYA 3IP0A 4N8OA 2C3OA 2JDJA 1TZ0A 2FVCA 3F44A 2AW0A 5HI7A 2GGPB 4A4JA 5HMWA 4DV4F 4F4KA 4JV5F 1T7PA 2XSFA 1NHKL 4KSEB 2DNRA 3OPKA 2DRBA 1JKHB 2FIUA 3L4BC 4M5KA 3KMQA 1MW7A 2AX1A 5D77A 1ZAXA 2AV5A 2ZOMA 4PCQA 4KYZA 4XO0A 4DSKA 1YJRA 3QIPA 3M1VA 1IKVB 3EXYA 2J5AA 2VL1A 2E1RA 3I5CA 3ONQA 2CZVC 5L9NA 1Y11A 4NEYA 2HNYA 4FVMA 3DOMA 1TAUA 1S99A 4X2BA 2AX0A 3CCLS 3AQOA 3RUBL 4NA2A 1ZYQA 2CJXB 3MM9B 4OI0A 1H2UX 3T5JA 5C42B 1KQGB 2GAHC 2J9DA 3DFEA 3E01B 1HI1A 2X7IA 1CC7A 2DGTA 2CVIA 5LXRA 4J9UE 3DM2B 2VOOA 1PBUA 4P73A 1FRXA 3LPEA 1ULRA 4IG0A 3GFZA 3V6DB 1NK4A 1TUGB 4DV2J 2P8IA 4JI6J 4H4OB 4DL0C 2ZD1B 2ZE2A 2YX1A 3T1AA 4ED1A 3IGNA 1N48A 5E33A 3KLIB 3AXKA 1U49A 1VFJA 5KFHA 3SQGA 1U2RA 3K5NA 5ETTA 4X4RA 4LQ3A 3LP1B 1BWEA 2Q3PA 3SMZA 3PX4A 2EBEA 4CDIA 5I3UB 4HHUA 2VQEJ 1SL1A 4RPFA 2ATCB 3GJRB 3GTYX 2YNIB 3P5TL 4OI6A 5KFBA 3OSNA 4CLPA 2YQ3A 4M5LA 2ZBCA 2J6SA 1VHFA 1G4CA 1SH2A 2DEJA 3GIKA 3F56A 2NUHA 2LXFA 2VZ9A 2B3TB 4ILRA 3K5LA 2CDQA 3M32B 2NPFA 2HKEA 3FZ2A 5F8IA 2HZVA 1TAQA 3WZ0A 3PKYA 5KG4A 4F25A 3B82A 4ILLA 3OR2A 3R5CA 1QDUB 3RYLA 3RB4A 4B9TA 2BEFA 1JLEA 2LMIA 3H4BA 1HMVA 5KFKA 1RI7A 3GIJA 1U6ZA 3CIZA 4NLVA 2A2CA 3B6BA 3AXMA 3TOQA 3ZFVA 3CPWR 2BE7D 3HXMA 1S0OA 4BS2A 2OLWA 3EMTA 3MPUB 1F2GA 3DOLB 1DTTB 1E6VB 5F8JA 3OTDA 2HFUA 1RWPB 3LP0B 4OHZA 3U1NA 3W61A 5BYRA 1NH8A 2UVWA 4XTTA 1HR0F 3MPWA 2F8MA 2DHAA 3W5YA 4YMEA 3CWJA 3BGRB 3FKBA 4ZVHA 1TKXB 1TMMA 1C4CA 1IQZA 5F3TA 1DZ5A 2HSEB 2AKWB 3GFYA 2WRMA 2CJ9A 3FBFA 1ZM2A 1HBUA 4MK7A 1O6XA 3BGLA 3I9V9 3MM5B 4Z2XA 2BQ3A 3VVUA 1BWVA 4A8SA 3G8TA 3SZ2A 3K0JA 2CNKB 2JFDA 2XZDB 2M88A 1T05A 1T9YA 1VQ9S 3AB4B 4DR2F 2VKZG 2ZE2B 1LW2B 1IBKF 3WX4A 3PCOB 3LGNA 3BO3A 1SJ3P 3G96A 2UU9J 3EZ5A 3CMAS 3K5MA 1RT5B 2LEBA 2IAJA 2XQCA 2HFNA 4CM0A 2Y1LB 4JI1F 2WB1D 1X4EA 4PZVA 4EZ9A 4ECRA 5GAEU 4LF8J 4UQTA 3KUGA 4DV4J 1VC6A 2OJ3A 2UUCJ 3EDQB 3KNAA 3EICA 1HHQA 1MU2B 3IAS9 4KPCA 2JEGA 3N0VA 1QTMA 3DDNA 2RU3A 2OSQA 2BANA 1T9TA 1A9NB 1WDDA
chains in the Genus database with same CATH topology
1S1UB 2EWHA 5G0RB 4J9SA 1S1WB 5A8RA 3G71S 2DCLA 1M90T 2VOPA 4WFBQ 2AU0A 2K3IA 4DSLA 1T03A 2R7QA 3CDAA 2V4RA 4DQPA 4DEZA 2NXUA 4A46A 2FGCA 4EU0A 2W8LA 3DOLA 2UV8A 2MZRA 4LSNA 4QYZJ 1Q16B 2Z2LA 1TK8A 3VWSA 4C8LA 1QAXA 3IC1A 2YWKA 4KTQA 3MM7B 4DL5A 2ZH3A 1NK5A 3V6HA 1S1XA 4DV7F 2LU2A 5EUHA 4K5SA 2BR0A 1NKCA 3SSRA 1FRMA 4ZK7M 5A8WB 2HZCA 1MMNA 4MK8A 5B0FA 1YIJS 1AFJA 1BQXA 2K3KA 3QAEA 4DFMA 3RAXA 3R27A 2PI4A 4DLEA 4CT9A 5T41A 4B08A 3M8PA 4M63A 1SI9A 4C98A 2JJ4D 2MGZB 2LQJA 3KMSA 3RBDA 2BQUA 2HMIA 3M2VA 1HWJA 1V3ZA 4Y2IA 1T02A 4DN9A 4J9PA 3IO1A 4G1QB 2R7XA 4FVCA 4HI1A 1SH3A 4KQZA 5SZTA 1VQMS 3VAIA 3U27A 3TP2A 2R7VA 2B6AA 3DMJB 1FXRA 4BHQA 3MR3A 3G4SS 3F73A 4ECXA 1HNXF 4PG4A 2ATLA 1OO0B 2GO8A 1FK9A 2MQPA 4QZVB 2KYZA 5K14A 2ZH7A 1JMTA 1LFPA 2BE2B 2ILYA 2W9AA 1NZAA 1U8SA 1DAXA 4CZCA 2DH9A 5E3CA 3W2WB 2F9DA 2EFGA 4AYBD 3WC0A 3HO1A 2CJBA 4TY8B 2IRXA 2FHMA 4GC7A 5A0YB 3MI7X 4W92B 1VQNS 2ZKUA 4R8UA 5B0AA 1HBMA 3FDSA 1BQMA 3D1QA 3DRRA 1WG5A 1M5PC 1JNZB 5KFVA 5IXUA 2YH1A 4OX9F 3IWLA 4CNZA 1J5OA 2VUGA 4MKAA 3M30A 2OMLA 5A0YA 3M9OB 1ZZFA 2CJAA 2G4BA 3AA8A 3K7RA 4IUFA 4X4VA 4ECZA 5B09A 4O4GB 2UUCF 1LXNA 4JI7F 1O5JA 3FSIA 1IJFB 1C1BB 2B56A 3PIOQ 1UVNA 1LK5A 4D3HA 4NXMF 2KFYA 3O2IA 2ALZA 3VAHA 2C3YA 1K1QA 3KTQA 1LQ9A 4RBUA 3BREA 2IM3A 4CH0S 4B9UA 3HX9A 4ID5B 3JAMY 3PIPQ 1FTCA 2MKHA 4MMOA 4MJKA 4I0WA 4XK8C 3MMAA 2R7WA 1TK5A 3NNHA 2W4PA 3HPOA 2WSFC 3SFGA 4KRWA 1WTFA 3A8EA 1UETA 5KFQA 2IM0A 3NS5A 2IBKA 4XIUA 3C8YA 2PGCA 3JSRA 1R7IA 1KR4A 3KNGA 4OZ0A 4PQAA 1HBOA 2E9RX 2MKIA 3SV4A 1UWBA 1X4FA 2QE5A 5F0WA 1APSA 4C8ZA 5LSRA 3ETOA 5GADU 1FRHA 1J5OB 3UW1A 2D3UA 1OWXA 3TVYA 2UV8G 2A10A 4PPZA 3R3TA 2EFQA 1CVJA 2Z8QA 2VH7A 2CPJA 2XEXA 2MZ1A 5CXTA 4WE1A 2GX8A 3CD5A 2V2KA 2XMWA 3FMBA 4O3SA 4MKBA 5EWFA 2OPQA 3NWGA 4Q8FA 4M5DA 2VPXB 3C46A 4ES1A 2B4PA 1IKYB 3CE8A 3KK2A 2LEPA 3V81A 1YTYA 3H5SA 2DGQA 4MIAA 5D4OA 4LVNP 2G13A 3KK1A 3Q22A 1G1XA 3PW5A 5F9LA 1MROA 4UUWA 4JI4F 5M2UA 2G1DA 3UDCA