3TVKA

Diguanylate cyclase domain of dgcz
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
AIRSNMDVLTGLPGRRVLDESFDHQLRNAEPLNLYLMLLDIDRFKLVNDTYGHLIGDVVLRTLATYLASWTRDYETVYRYGGEEFIIIVKAANDEEACRAGVRICQLVDNHAITHSEGHINITVTAGVSRAFPEEPLDVVIGRADRAMYEGKQTGRNRCMFIDEQNVINRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Diguanylate cyclase DgcZ
total genus 52
structure length 172
sequence length 172
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tvkA00
4GC7A 4MKAA 5CYMB 2BANB 4ZP6A 2ILYA 2AQ4A 4NCGA 3T5LA 1RTJB 3NAHA 4QPXA 5C25B 4O4GB 3JYTA 1TKTB 3M8PB 4RZRA 2VG5A 4KFBB 1C0TA 5KG3A 1C1CA 5F8JA 2ZE2B 5DQIA 2R2RA 4ED3A 3V81B 3V6DA 3KOAA 2I5JA 4NLUA 4K4WA 1LWEA 4LSNA 4KHMA 3KK3A 5FDLB 3JSMA 3T19A 3TQ1A 2BQ3A 3DRRA 4F4YA 4Q44A 3V6DB 1VRTA 3CDEA 1TL1B 4Q45A 4QWAA 2ASJA 3E01A 4ECTA 5KFIA 2WCXA 3IS9A 3DYAB 3KLEB 2HNYA 3KLGB 2DPIA 4B3OA 3UDLA 2AGOA 2BANA 1DLOA 5KFJA 3KLHB 4TYAA 5F8LA 4O44B 5KFUA 1TP7A 4QWCA 1Z4UA 4Y2AA 4ECQA 1XR7A 4J9SA 5HROA 4ECVA 3CJ0A 5KFMA 4ECWA 3I5BA 1T94A 2RKIA 4KV8A 3KLHA 1TQLA 4J9LA 2YNHB 3G6VA 2VG7B 2HNDB 4NLQA 1JKHB 3NL0A 4O3SA 3KMSA 1JLFB 3KLIB 5J2PB 3KLFA 5KG6A 4LQ9A 4OL8A 1C2PA 3DDKA 4R5PB 1RT2A 1NHUA 2ILZA 4QW8A 3OL6A 5J2NB 2AU0A 2FLNA 5KFCA 3KLFB 4YR2A 4ECXA 4FBTA 3LALA 4DEZA 1LW0B 5EUHA 4F4ZA 1KLMA 4NLGA 4WYLA 3OSNA 3G6YA 2R8IA 5C24B 4ECUA 4ZPCA 3KNAA 4NZ0A 1DTTB 4IFYB 1C0UA 3MEEA 1JX4A 3LAKA 5I3UB 3JYTB 1RT5B 1LW2A 5KFFA 4Q0BA 4R8UB 1HQEA 1RT1A 1QE1B 5KG1A 2XC9A 3PW5A 2VA2A 2YNGA 1DTQB 1LWEB 5I42A 2V0NA 2ZD1B 3PJXA 3Q8PB 5HROB 4R5PA 4U7CA 2FJWA 4IFVA 3RAXA 1JLGB 3GYNA 3HVAA 4NLVA 2C22A 2YKNA 2OPPA 1S4FA 4RW6B 5JXSA 3M9NB 1N4LA 5KG0A 5F8IA 1N5YB 1D0EA 1J5OA 3BSOA 5DGBA 1RTIA 2IC3B 1LW2B 3FDSA 5C5JA 4R8UA 5F8NA 4IG0B 3PR4A 2W7PA 1RA6A 3CVKA 1RT3B 3QGIA 3MEEB 3OSPA 3BSNA 2FVSA 2IAJB 3C6TA 3LANA 3GIMA 1JLAA 1FKOA 3DOLB 3PJWA 4O3QA 4Y3CA 4I2QB 5KFQA 3ICLA 4YR3A 1KLMB 2YNIA 1RYRA 3Q8QB 3DOLA 5DLGA 5KG7A 4TN2A 4KO0A 3N6NA 2ZE2A 3KLGA 5F9LA 4ECSA 5KFDA 1RYSA 4IRKA 2BE2B 4MFBA 5KFVA 2XWYA 1ZETA 1S49A 2WRMA 3QLHB 3RBEA 4RNOA 5L1JA 2FVPA 2AX0A 4NLWA 2W9BA 2IBKA 1KHVA 4HKQA 4PWDB 1QE1A 1D1UA 4I2PA 4DL3A 1SH3A 3KK1B 4ZHRA 5KFNA 4DL4A 4Y34A 3DYAA 5J1EB 3DLGB 3BR9A 4MKBA 1C0UB 1QAJA 1S1TA 3OL7A 1TKTA 3D28A 1JLEB 1TVRA 3M8PA 3H5XA 1LWFB 2IM0A 4TLRA 5DQHA 1HPZA 1HQUA 1RT7B 1JLQA 3H5UA 2AX1A 5EWEA 2R8KA 3I5CA 3IS9B 2HMIB 3HVWA 3KLEA 2FVRA 3RB0A 2WHOA 2BE2A 1TL1A 2FJVA 5C25A 3DRPA 3E51A 3CJ4A 3DRSB 3LP0A 5J2PA 4LSLB 1S9EB 2D3UA 3I0RA 2R8GA 1W25A 3GV5B 4RUAA 4TY8A 1TL3B 1RTDB 3PW2A 2FLLA 1IKVA 1TV6A 3DLKB 3MEGB 3HKWA 4HYKA 1T05B 3FFIB 4G1QB 4PQUB 5CYQB 2QV6A 3KHGA 1I6JA 1FKPB 5F8GA 1UWBA 2HNDA 5KT3A 1JKHA 2IM1A 4H4MA 4H4OA 1JLGA 2O5DA 3KLVA 3DOKB 3MEDA 2OPRB 3OLAA 1RT4B 2UVVA 5KT2A 2B5JA 4ECYA 4KSEB 3M8QB 5JUMA 3T1AA 4EYHB 4NLPA 1S9EA 4QWEA 2B6AA 1GX5A 4WYWA 2V4RA 2YKMA 3PW4A 4PWDA 2JEGA 4B3OB 1SH2A 3CJ5A 2VG6B 4ICLA 2W7OA 2HNZB 1C1CB 1RT5A 1LWCB 4PQUA 1HYSA 3I0SB 4NLTA 4IG3A 1N6QB 2EC0A 1S1UB 1QAIA 2WONB 1T03B 5KT4A 3H5YA 3IGNA 3V4IA 2BR0A 5FDLA 3JSMB 3GIIA 4TXSA 1SUQB 1S97A 4M94A 4RW4B 3UQSA 3BJYA 1T3NA 1LW0A 1XR6A 4ID5B 2WOMA 3QZ7A 2CJQA 4ZVFA 1C0TB 1EP4B 1S0NA 3DI6B 3IGVA 2DPJA 2BQUA 3OLBA 5KG4A 4DG1B 4KE5A 2W9CB 3BSCA 3QGHA 5CYMA 1YVFA 2YNFA 1TKZB 5L1KA 2WB4A 2B43A 3LP1B 4MH8A 4RW6A 4EO6A 3M9MB 2C2EA 4X2BA 1S9GA 1IKWA 4RW7A 2IJNA 3KJVA 5KFZA 4G3IA 4KBIA 4MIAA 5KFLA 4J9RA 4K4XA 4DL2A 1TKXB 1SUQA 4K4YA 1S6PA 2BRKA 4IQXA 3V81A 3HVTB 2FJXA 1RT2B 3BGRB 1LWCA 4IH7A 3I0SA 1S0MA 5D3GB 3DLEA 1WNEA 5F8HA 4J9PA 5HP1B 3RB6A 4MK7A 1JLBA 3QGGA 4RNNA 3MR2A 5KFYA 4NLOA 5EWFA 1IKXB 4TY9A 1IM4A 1K1SA 1RT6B 2UUTA 1RAJA 3IG1A 3ITHA 5K14A 4RW7B 1S48A 4Q8FA 3DMJA 1HYSB 4IG0A 4EYIB 2OPSA 5HBMB 2V4QA 5DG7A 5L1LA 4XPEA 2FVQA 2YNGB 3MTKA 4KKOB 1BQNA 5KFWA 1JLFA 4MIBA 1S0OA 2F8EX 2CKWA 2XGQA 1HPZB 4ED0A 1HNIA 4WXWA 2YNHA 4LQ3A 3FQLA 4URSA 2JEFA 4XPCA 2HWIA 1T05A 1S6QA 5I3UA 3KHRA 2RF2B 3MR6A 4R0EA 1S1XB 3GV8B 3GILA 3MR3A 3PW0A 1EP4A 1FK9A 4I7FB 4KO0B 4ZP9A 2IM2A 4K50A 2QE5A 3HHKA 5KFRA 4H4MB 4ZPBA 5KFXA 1JLBB 4JV0A 1HMVA 2R8HA 2UVWA 2OPSB 1REVA 5HBMA 3MR5A 3GQCA 2IAJA 3V6HA 2W9AA 5L1IA 5EDWA 4DL7A 1IKWB 3BGRA 4NRTA 5KT5A 2HMIA 5KFHA 5DGAA 3ISNC 5KFGA 1HNIB 4WXOA 3DRRB 2YKMB 4H54A 4YQWA 3T5KA 1RTHB 2YNIB 4IR9A 2XI2A 4LSNB 1IKYA 1C1BA 5C42A 3IN5A 1HNVB 3V6JA 4NLXA 4KV8B 4EEYA 2E9TA 2B5JB 4PUOA 2RF2A 3KHLA 5DG8A 1SV5B 5KFAA 5KFOA 5DG9A 3GV7B 2JLEA 4RW8B 4I2PB 1R0AB 3H2LA 4KKOA 2IMWP 3PZPA 3DM2B 4O3NA 1MU2A 2XGPA 1EETA 2RKIB 2AGPA 2R2TA 1S1TB 4MFBB 3QIDA 1N48A 5K14B 3FSIA 2R8JA 3VQSA 2R2SA 1RA7A 4TY8B 3NBPA 2E9RX 1HNVA 1MU2B 1XR5A 2UVUA 4RW4A 3NMAA 4ED1A 2UVRA 3V4IB 1BQNB 3RAQA 4NLRA 4K4TA 4NLDA 1MMLA 3NBPB 4RW9A 3NKYA 4WFXA 1SV5A 2ASLA 3DLEB 2IJFA 4WE1A 2GIQA 1JXLA 4WZQA 3E01B 2VG6A 3NGDA 2HNZA 4ED6A 1RTIB 2IC3A 4RUCA 4RW9B 4Q8EA 3PVXA 3UR0A 1S1WA 1S1VA 1RT7A 3I0RB 4EBDA 3CWJA 3QO9B 4K4UA 4O3PA 4IOBA 4TYBA 2ALZA 3KJVB 5D3GA 1IKVB 3MEGA 3QIPA 4O4RA 4Y2CA 4M95A 4PUOB 3SI8A 3EPIA 2J6TA 2C2RA 3PR5B 4ICLB 4J9OA 3PW7A 5L9XA 3RBDA 3OL9A 5KFEA 4NCGB 1UWBB 4IH5A 5KT6A 2RDJA 5DLFA 1JLQB 4RW8A 4YP3A 1RTHA 3QYYA 3OHBA 3OHAA 3KHHA 1TKXA 4DL6A 1R0AA 2V9WA 5F9NA 2HNYB 5KG5A 3NAIA 4ZVEA 1TV6B 3DLKA 2XCPA 5KG2A 4ZVGA 1S10A 4ZMMA 4F4WA 4JUZA 2B6AB 1IKXA 4YMEA 2OPQA 2GIRA 3UPFA 5HP1A 4ED2A 4EO8A 1VRUA 3EPGA 2W9CA 3BQ2A 3DRSA 3LP0B 4F4XA 1JLAB 1FK9B 2W8KA 4XO0A 1S1UA 2J6UA 1RT3A 2I1RA 4WE1B 4MK9A 2ZKUA 3IG1B 1S9GB 3ITHB 3CIZA 5HLFA 3KK1A 1KHWA 2J6SA 1GX6A 3T5JA 1BQMA 3BQ0A 4O3RA 4K4ZA 3Q8SB 2VA3A 4ECRA 3N6LA 3KK2A 3H4BA 2FLPA 2XCAA 4RU9A 3H4DA 4J9KA 4I7FA 4NYZA 3MEDB 1RT4A 3QIPB 3CJ2A 1RDRA 1S6QB 2WK4A 4IH6A 4O4GA 5KT7A 3IRXB 4IDKA 3KK2B 3DM2A 4ZHRB 1IKYB 1C1BB 1DLOB 3I5AA 2YNFB 4ZP8A 4IR1A 3LP1A 2BQRA 3C6UB 3TAMA 4I2QA 1S1WB 1S1VB 3SFGA 4K4SA 4RNHA 4QW9A 2XI3A 3CDUA 5CYQA 3DRPB 5HLFB 3IRXA 4IDKB 1LWFA 4KHRA 5KFKA 3RB4A 2C28A 5J2MA 4Q0BB 3DI6A 3SFUA 2JC1A 2D41A 3OL8A 1VRTB 1RT6A 4FS1A 4J9QA 4H4OB 4MK8A 4NRUA 5C24A 5C42B 4KB7A 1QUVA 1TKZA 5KFBA 4Q43A 3M9OB 3BQ1A 4EBEA 3LAMA 4IRDA 3H98A 2IM3A 4QWDA 3CO9A 3CDWA 2I5JB 3M8QA 4FS2A 3MECA 4DL5A 4WZMA 4IRCA 4J9MA 5J2NA 1S9FA 5J1EA 3Q8RB 1REVB 1JLCB 4ZPAA 2GC8A 4K4VA 2D3ZA 3MECB 4RNFA 5I42B 4WFZA 2AGQA 1N56A 2JEIA 1JIHA 1S6PB 3FRZA 2BRLA 5KFSA 1NHVA 1HQUB 2W9BB 2OPQB 4GC6A 3FQKA 2UUWA 3GIKA 2JC0A 3H59A 3CJ3A 3FFIA 3G86A 4G1QA 2W8LA 4ZVHA 1FKOB 4IFVB 3LP2B 5EWGA 3T5HA 3DLGA 4O3OA 4O44A 3H40A 4ID5A 5J2QB 3BREA 1ZTTA 1DTQA 1FKPA 5DQGA 1BQMB 2RDIA 1HQEB 1SH0A 3C6UA 1RT1B 3H5SA 5KFTA 3MF5A 2VG7A 3TAMB 4ED7A 4EBCA 4DG1A 1JLCA 3D5MA 5J2QA 1T03A 3QLHA 2FVCA 3DMJB 2OPRA 3N6MA 1OS5A 1DTTA 2R2UA 4ECZA 3HVTA 4U6PA 3GIJA 4KAIA 2OH2A 4TQRA 3BSAA 2WOMB 1VRUB 4URQU 1J5OB 3QO9A 1ZTWA 4QWBA 4LSLA 4URGA 2YKNB 3QZ8A 4NLYA 4RNMA 3MFIA 4FBUA 2WONA 2ATLA 2WTFA 4ZPDA 3C6TB 4ED8A 1S1XA 2VG5B 4KFBA 4YR0A 4JV1A 3DOKA 4IG3B 5J2MB 1N6QA 4IKAA 1TL3A 2ZD1A 1RTDA 1EETB 3V6KA 4F50A 4IFYA 4JV2A 5T14A 5F8MA 3ISND 4NLSA 3G6XA 3MFHA 3RB3A 5KFPA 3KLIA 4ZP7A 2C2DA 2IA6A 2E9ZA 1HMVB 4WFYA 3KK3B 2ASDA 3PHEA 2D7SA 2OPPB 1U09A 1NNDA 1K1QA 2HAIA 3TVKA 4J9NA 1N5YA 4TQSA 3KMQA 3EZUA 1JLEA 1TVRB 2JEJA 2HWHA 3LP2A 2AWZA 1CSJA 1HARA 1RTJA
chains in the Genus database with same CATH superfamily
1U8SA 4PYAA 4RWWA 1TK5A 1NXIA 3HSZA 4YUDA 1G2EA 4HT5A 4QPXA 5C25B 3MPUB 3W5XA 3JYTA 2HK2A 5L8RC 3CCLS 4PCQA 3MM5A 5AXLA 1FJGJ 4CM2A 1FNMA 3GR0A 4LF5F 1B70B 2Y1RI 3V81B 5C2CA 3VAGA 1S12A 3NGKA 1QLNA 1BWVA 3N0VA 4WFBQ 5FDLB 2MEWA 2XEXA 3JSMA 1VQ5S 3IR5B 4DPOA 4F4YA 1U6BA 3CDEA 4JYAJ 1M5PC 3RR8A 4QWAA 4ECTA 3GYGA 2NLWA 2B9EA 1MN9A 2YWFA 3R6LB 2HNYA 3CE8A 4ES1A 3KLGB 3Q23A 1AUDA 2DPIA 2UZAA 3OVSA 2OMLA 3VAHA 4AD6A 2GGPA 3PYDA 1N36J 1PYSB 2AGOA 1HL6A 1DLOA 1T3OA 2YPYA 2DGUA 2NYHA 2XY5A 1HW9A 2QMWA 3LH2S 4TYAA 4O44B 3C2PA 4M5KA 4N56A 4J9SA 4LIWA 3CJ0A 4ECVA 1ACMB 2VJVA 1H2VZ 1HI0P 1X4GA 5B0EA 3CTRA 2BJDA 2HNDB 3ENAA 2DXDA 3NL0A 4O3SA 5IM0A 3KMSA 1JLFB 4F4KA 4CIOA 5B0GA 3CMQA 1RB0A 2XLJA 2G2OA 5IWAF 4FKYA 5ITHA 4PXCA 4LQ9A 4OL8A 1AT1B 5ETNA 1UVKA 1CJUB 5E3PA 2KTQA 2B4VA 4FBTA 3W61A 1YG0A 4QZVB 6AT1B 3P4UB 4YR2A 2XM3A 2X7IA 2EEYA 3NGTA 5EUHA 2KYXA 4PG5A 3VAMA 4F4ZA 2AJQA 1GH8A 3B4MA 4NLGA 2R8IA 2PIIA 3OSNA 3G6YA 2LQ8A 3LWLA 3B54A 3M2VA 3ENVA 2W4PA 1R6YA 1C0UA 2OEKA 1JX4A 4JP8A 4PXDA 3JYTB 3K0JA 1YBUA 1RT5B 4S0MA 4C0BA 4C8ZA 4FYVB 3MMCB 3T9ZA 4NEYA 2GIFA 2OGUA 1BHNA 5IM0B 3KDNA 1DTQB 2VA2A 2YKOA 2PA8D 3MD1A 5I42A 2P2CB 2MKSA 3VGTA 4U8VA 3OPKA 3M30B 3CCUS 1VHFA 3BR8A 3JTPA 2ZD1B 1M90T 1PBAA 2BX6A 4FN5A 2C2OB 1U2FA 2RAQA 2EK1A 4W98A 2NZCA 4U7CA 5D6GA 5JVGQ 3K2YA 1F9FA 1YTYA 3RAXA 5HVHA 1IN0A 2P6SA 3FK4A 4NLVA 5SZTA 1GNKA 1RWKB 1RWPB 2LXUA 2BVZA 5JXSA 1N4LA 4DZDA 1QSYA 2GGPB 3BSOA 1M5VC 3K5PA 4OX6A 4J9UE 1RTIA 2IC3B 3FDSA 3RU0A 5C5JA 4R8UA 4BC9A 4OX8A 2VICA 1RA6A 1VGYA 1RT3B 1YRTA 2AKWB 3CVKA 3QGIA 5DDPC 1E6YA 2IAJB 3C6TA 3BSNA 1EZZB 3GIMA 5ETPA 1NK4A 4JV5F 1GTEA 4B3RF 2A0FB 4I2QB 5KFQA 2B9XA 2OHDA 3ICLA 3GYXB 1IWAA 2DH7A 3IO1A 4G1PA 3TA2A 4O0IA 2M70A 1RYRA 3Q8QB 1OY6A 2E1CA 5DLGA 4QYRA 3I6PA 1H7XA 1YBAA 2ZE2A 4F25A 1T0TV 3M6UA 5F9LA 4CDIA 1U1MA 4IRKA 4OX9J 5KFVA 2ZH8A 1HHSA 1S49A 2JSXA 2YWGA 3RBEA 2PN6A 5L1JA 4HKQA 3HK2A 5IV4A 1KHVA 3G96A 3ELHA 2XHWA 1UPMB 3C8YA 4I2PA 1SPBP 3NGSA 2BJ9A 4DL3A 4ZHRA 3PRDA 4Q2MA 2MJUA 4ZPWR 4N7TA 2CVIA 4PZVA 4KH1B 1WKLA 3BR9A 2NSBA 1JXEA 1R0BG 5HVFA 3D28A 3V2UC 1JLEB 2MQPA 3OL7A 2CPFA 4EK2A 3H5XA 4UZCA 2IM0A 4DV0J 1S6UA 2Y1IA 4TVAB 3TI0A 1LFPA 4CNYA 4CCHA 1RT7B 2HVHA 2AX1A 3RRHA 1RCXB 1LFWA 2CZVC 2R8KA 3HVWA 4ZVUB 3KLEA 1KONA 2DNMA 2BE2A 4A46A 5HANA 1HHQA 4PXEA 4FVCA 2ASYA 3DRPA 3ILLA 5E2QA 3AA8A 4P73A 1WEZA 1RHMB 4RBUA 3S8SA 2VODA 1AW0A 1WOOA 2PFFB 2EFNA 2KZZA 3PX0A 1JJCB 2CWKA 3I0RA 4BWJA 4ED5A 8RUCA 2XO6A 5HAOA 2L9WA 1RISA 3G82B 1IKVA 2DT9A 4GKKJ 4ZLJA 2HRUA 5CYQB 4DPUA 3PDNA 3TRGA 2CQIA 3FBCA 2ZH6A 2DR5A 3KHGA 1EB0A 1T8EA 1L3SA 2HGNA 1WWHA 3H2VE 1A0OB 2KN4A 1TL7A 3P45B 4LFAF 4HACA 3THPA 1IR2A 5C2GA 4CLUA 5CYJA 1JLGA 4PWWA 3KLVA 4C8OA 2H4YB 1GTHA 2EG1A 2OD6A 3MEDA 3OLAA 3PV8A 1TFWA 5KT2A 4NOHA 4DU8A 2JJ4D 4C7QA 4GKJF 3M8RA 4DLEA 1R3NA 1SC4B 4FF1A 1SJQA 2N3LA 3C15B 4NLPA 5M2UA 1AA1B 2V4RA 9ATCB 2YKMA 4DHVA 5FJ4A 4L74A 2JEGA 3KUHA 5CHCB 2PI5A 3Q2TC 2HNZB 2V2ZA 3AHPA 4CLTA 4IG3A 2KYZA 1R6VA 1LOUA 3OTDA 2E5IA 1T03B 3DXBA 2NCKL 1NDCA 4DCPB 4K2JA 4DV4J 2Q1LA 2XY7A 1R8HA 3GJRB 2HHUA 2BJEA 2DHSA 1XR6A 3UN5A 4CLWA 1V5IB 1FDBA 1RQ0A 2D3O1 1RABB 1PAUB 2HZCA 3HHLA 4FP9A 4I6YA 1DQAA 1EP4B 4ZVFA 3QZ7A 3EXYA 1S0NA 3DI6B 3L7PA 3R8YA 5EHHA 1K0VA 1YIJS 4A47A 4RWXA 3ISZA 5KG4A 3OLBA 4JI5J 4DG1B 3G8TA 5CQGA 2EFQA 3BSCA 3QGHA 3FCWA 2AJ2A 5CYMA 3J7ZT 1HBNB 3Q86A 2N7CA 1HNXF 2DHGA 5F3ZA 4OI0A 4X2BA 5IQ6A 4CH7A 3IP0A 1N32F 1UZDA 1S9GA 2VFVA 3TAPA 1IKWA 3DGVA 2VV5A 2QSFA 2IRXA 1FJGF 4K5RA 2IJNA 3ZFVA 1NH8A 1NPPA 5KFZA 1X60A 1ZAVA 4KBIA 5D0RA 3U1NA 2ZHBA 4FF4A 4C4WA 1HI1A 2GMLA 1VQMS 3IWNC 4XK8C 5F3TA 4E0DA 4RUBA 2J9CA 4HI2A 3CUNA 1SUQA 1AB8A 1FRMA 2EWHA 3V81A 4LF8F 3UWTA 2QEXS 1GXTA 1D9DA 4C48A 1RT2B 2HIYA 2KT3A 3EVWA 1TU0B 1LWCA 1NAQA 1T9WA 2JX2A 3POTA 4J90A 4DQRA 1WNEA 1UJ4A 4J9PA 1OWXA 3CCES 1X0PA 1SQGA 4RNNA 3ZTPA 3NNAA 4CO4A 4NLOA 5EWFA 1DARA 1U4BA 3LA0A 2E1AA 2AZ1A 4P7TA 1K1SA 2V4JB 2O01C 1VBZA 1FTRA 3Q2SC 4RW7B 5DDRC 1JXVA 4Q8FA 2GCFA 2DNOA 2V4QA 5DG7A 1W2BR 4PRFA 4QU6A 3E3XA 4P6QA 3W63A 4XPEA 2YNGB 2FVQA 1LKZA 1MLAA 4KKOB 4ZPTR 5KFWA 2OTLS 2UUBJ 1DQ9A 2XGQA 2QFIA 1SCJB 1ZPWX 4WXWA 3ZTOA 3AD8C 4URSA 3D0HE 2JEFA 4XPCA 3OVBA 1S6QA 1YBTA 1IXKA 3W2VA 1IBMF 2BUNA 2JNJA 1RSCA 2AYMA 2X3GA 4BCAA 3GV8B 2GQ2A 1EP4A 3EXCX 2GJ2A 3M1VB 1KBRA 1T9YA 5HQ8A 4ERDA 2FHMA 1SVDA 2QE5A 1KR4A 2FUG9 3S7RA 1Q86T 1U49A 2AF6A 4DS4A 2R8HA 2MZJA 1AYEA 2EKNA 3PCOB 1B3TA 4U96A 1REVA 4M5GA 2VPZB 5HBMA 3ZTQA 3MOZA 2DJWA 3D54A 2RQCA 4DR3J 4DL7A 1IKWB 2CPIA 2V63A 3JSRA 2K3IA 3I55S 2HMIA 1X9MA 1ZBTA 2DB1A 5KFHA 5DGAA 5KFGA 1HNIB 3V5RA 3KFWX 4P7VA 4WU2A 3OVAA 2YQ3A 2YNIB 3IFEA 4USJC 2XI2A 4LSNB 1NKCA 1K9MT 1M5KC 4KV8B 5ETTA 1B99A 2QZ8A 5GMEA 1JJ2R 3BGLA 4J37A 4CTAA 2E9TA 4OX7A 2V5HG 3O8WA 4KHPF 2G2YA 3OTOJ 1Q7YT 5G0RB 1SV5B 2HLTA 2LKZA 4EGLA 5KOWA 2JLEA 2HVEA 3GLJA 2BM0A 3L7UA 3H2LA 1RTZA 2J76E 4K7QA 3R7NB 2CWXA 4DPXA 4LRBA 2DGQA 1N5QA 1HFEL 1ZS6A 2JL9A 2RKIB 1B4SA 2DCUB 4LF1A 1F2HA 2XGPA 4MFBB 3QIDA 2MZTA 3D0IE 4FXVA 5K14B 1N48A 5LL6d 2H9ZA 4OZNA 4DQSA 4TY8B 1FERA 2E9RX 2XNRA 4IUFA 1HNVA 1U24A 2UVUA 1D9FA 3NMAA 1FDNA 4EFAC 5GAGI 3GTYX 3F56A 2CQGA 4NLRA 1LV5A 3NKYA 2XB2D 2A18A 1FWKA 3ULHA 4F0KA 3IM8A 1S59A 5AE3A 2GIQA 2ABYA 2EBGA 1U2CA 2L9DA 1KC8T 2IC3A 1RTIB 1KTVA 2HG4A 2HFNA 2M4MA 2OP5A 3M2VB 4RUCA 3UR0A 3PVXA 3N4WA 4AL5A 4DV1F 5D8HB 2C3OA 3CWJA 4B9SA 3CGIA 3QO9B 4UUWA 4BLGA 1GXUA 2IBOA 1CJTA 4XDCA 2LQ9A 5D0GA 4O3PA 3T1YF 2ALZA 4X66J 2MGZB 3KJVB 2HHPA 2GFFA 1YDLA 4X4OA 1QSLA 1LK5A 1A9NB 1YJ9S 3PR5B 1YJVA 2MTLA 5GAHI 1I5OB 1RZMA 4K2XA 4OLOA 5L9XA 1VC5A 4I68A 2ZZNA 2DO0A 4WBFA 1U6ZA 3KHHA 3QYYA 1RAAB 2BA9A 2PT0A 2MKKA 1V3SA 2FDNA 3G8QA 3OHAA 2V9WA 5F9NA 1NJYA 2J9DE 2XYGB 3BGOP 1RI7A 2CPDA 3G82A 3NAIA 1SKWA 1FJ7A 3NGRA 4JI3F 4L3KA 4ZOSA 1WJ9A 4ZMMA 4F4WA 1OSDA 2R7SA 3OTBA 4LRCA 2H65B 3S6EA 3W2WB 3BN4A 2HHXA 2M7SA 2QA1A 2C2NA 2XSJB 4XO0A 2XTJP 4ID8A 4CLPA 1FNOA 4WE1B 2HWTA 1XEZA 3IG1B 3QFHA 1KHWA 4GVLA 3CCTA 5KOXA 2HZVA 2MLZA 3T5JA 1BQMA 2R42A 4K4ZA 1LK7A 5EN1A 4R0JA 3K5OA 4OI6A 2MKHA 1UKUA 2CJBA 4P2SA 3VGVA 2N4DA 3Q8YA 3EM1A 1BXNA 3R5GA 2WVDA 4CO5A 1Y5LB 3H4BA 1UVIA 5B7WA 2N3OA 2C3UA 1RT4A 2CNNB 4Y2MA 4PXBA 1UJ5A 3W2VB 1RAOA 3IRXB 4LBIA 2F8HA 3QJJA 4C97A 1DLOB 3I5AA 4DV5J 4NXMF 2LYVA 4OJ1A 4I2QA 1S1WB 1S1VB 2QL5B 3HHEA 3DGPB 2WW8A 4OHWA 4RNHA 2CIMA 5LMUF 2ZDOA 5G0RA 4U8YA 3SMZA 3VF0B 2C28A 3DI6A 3SFUA 3EZ5A 1LEOA 1RWUA 1WELA 1TL5A 1GK8A 4ZLNA 2HS0A 2F63A 2I6WA 4ZJQA 1I94F 4FZVA 4A8SA 4NRUA 2DNNA 2Y0BB 3MI7X 1HR0F 4Q43A 2CDQA 3M9OB 3BQ1A 3H98A 4NPOA 2DEIA 2EK6A 3I96A 4FS2A 3R7BB 4DL5A 3R3TA 2XYPB 3Q8RB 2YY3A 1NDLA 1P6TA 1JLCB 1LXJA 3TZYA 2APOA 1HWJA 3I31A 2H3EB 3NCQA 1WTFA 2JEIA 2J7UA 4EUVA 4K0KF 3FRZA 2BRLA 3CEDA 3GONA 4NZ7A 1HNZJ 2OPQB 1F9HA 1OO0B 1RWNB 4NX9A 5C7PA 1VC6A 2GJFA 1VYAA 2KVQE 1IWGA 5DO2A 4B08A 5EWGA 1PYTA 2W2PP 4KGKA 2KG1A 4X4TA 4DSLA 1WC6A 2Y1LB 4LRDA 3UI3A 3HZEA 5GAEI 4WJBA 4YY3J 2EFOA 3BREA 4MTPA 1RGVA 1DTQA 1ZTTA 2E5LJ 2KXHA 3ETOA 5B0FA 4CM0A 1BGXT 1FKPA 4N8NA 4IQXA 4ED7A 2ROEA 4JI0F 1QTNB 4EBCA 4DG1A 3D5MA 5IS2A 5J2QA 2IHR1 1C4CA 3W5ZA 2ZM6F 2PMZD 3DMJB 1RAFB 1F1BB 3CJTA 1DTTA 2R2UA 4OYPA 1ROFA 3BH6B 3TJ8A 5T7LB 2MZQA 1MWQA 2ZZTA 3BSAA 3W66A 1VRUB 4U6PA 3BS9A 4URQU 2I2YA 3CW2C 1RHJB 2CPXA 1VJQA 4C98A 2CQCA 4OV6A 2WONA 2ATLA 1VQ7S 1X9SA 2HK3A 1S1XA 2VG5B 1N54B 4YR0A 4AYBD 4YHHJ 1N5SA 1H2UX 1RTDA 3OL9A 4PG6A 1FDAA 2E5HA 4IFYA 4F50A 3MM9A 2RRNA 2R7QA 2YH0A 3D3BJ 4LREA 3T3FA 3MFHA 4C8KA 1YJTA 1WEYA 1YZ7A 4ZP7A 4OYZA 4OI3A 5KFPA 5LMNF 4G6VB 3KK3B 1X0FA 3C15A 2XG8A 5CZXA 1N5YA 1U09A 2P6TA 2YBVA 4WP9A 5E0OA 3PO4A 4B9UA 4TQSA 2K06A 4FVMA 3EZUA 5HQMA 2JEJA 4F3QA 3BYPA 1LQ9A 2DITA 5AT1B 4ETZA 3IAM9 2OEMA 4AQYJ 5J2NA 2LA4A 1RTJA 1UWAA 4L3NA 3UN3A 4C3MA 3GJTB 3CJ8A 1R7IA 1OYDA 3NG8A 7AT1B 1VC0A 2MQ8A 2J0SD 3QRPA 1FFGB 4DPYA 1S99A 2A2CA 2XMVA 4DV6F 4NCGA 1Z2ZA 3B6BA 4HVZA 3CJKB 5AXNA 1R8PA 1U1PA 1TMMA 4Q2LA 4PWUA 4O4GB 3M8PB 4RZRA 2RJZA 3QQCD 2VG5A 4QJVA 5KG3A 2DBBA 3MOJB 3RBZA 2ZWPA 2BJ3A 2IVYA 2J9DA 5DQIA 2R2RA 3TWZA 1FO1A 3KOAA 4MYUA 1NJIT 1V6HA 4KHMA 4Z7YA 2K7KA 3ZZTA 3HP6A 3TQ1A 2VBYA 2BQ3A 1NM2A 3DRRA 1RBLA 4Q44A 1VRTA 1TL1B 9RUBA 5HO4A 3M8WA 3E01A 2QSWA 3KDOA 1X5OA 2FYXA 3CF5Q 4B3OA 3ZNUA 4CLFA 4PYDA 3UNGC 3CIMA 3PNIA 3HD1A 5D4PA 2L48A 5F8LA 3P49B 1WI8A 5KFUA 3FVYA 5HI7A 3FC9A 4Y2AA 2HVIA 3NP5A 2J0WA 1VIXA 4DL0C 2X1AA 5KFMA 3AOBA 5IFMA 4ECWA 1L5UA 3NNCA 2IY5B 1T94A 2J0XA 2IA0A 2RKIA 3P3DA 3VGSA 1RLDA 2GQQA 3ZZYA 2NXJA 2VG7B 2DIUA 1JKHB 1MMNA 3ZZZA 3W3SA 4HDHA 5M2RA 5B0DA 3KLIB 3PXGa 2HBRB 1KOHA 1OYEA 3FBFA 3LGHA 1N5TA 3MMCA 3KLFA 1ZOTA 4LJMA 1FE4A 2E66A 3PKMA 4R5PB 1WDTA 1RT2A 2ILZA 3IXQA 4LFBF 2RRBA 1FEEA 5J2NB 5KFCA 1IM6A 5J1PA 3A3OB 1GT8A 3EGVA 3LALA 4DEZA 4ECXA 1VQLS 5EX3A 2V8HA 3BH7B 1KLMA 2YX4A 3O6QA 1WUUA 4ZCLA 3BO3A 3JQKA 3P5BP 2YWHA 3DOMA 2FHOB 5ETSA 3HFKA 3PKYA 1YJWS 5K8NA 2M9KA 1UVMA 2ACYA 3HSJA 2OLWA 5KFFA 3L95X 1RJJA 4DJBA 4R8UB 4Q0BA 1HQEA 5H1SV 2QL7B 3G6ES 1FT8A 2E7WA 3PW5A 3WIVA 4CI0B 4DMZA 2JFKA 1LWEB 1QD1A 2ZHOA 2V0NA 3ZZ0A 3CC2S 4DFKA 2DO4A 4OYXA 3WHIA 2R9LA 3BO4A 4ILRA 3PJXA 2DNPA 1DBDA 4USHA 3AOAA 2XMAA 3Q8PB 4R5PA 2RB7A 2XY6A 2FJWA 4JI3J 3A8KA 4IFVA 1JLGB 3GJSB 3HVAA 2Z2YB 2XMWA 3M30A 2C22A 1NK0A 2R7TA 2PMHA 5F8IA 3OXLA 2GX8A 3ZZPA 1RWOB 1ZZFA 1MSWD 3BEGB 3FMBA 2FHKA 4MT1A 1LW2B 1WDDA 5K9FA 4P71A 2QLBB 1DRZA 1TUVA 1L3UA 3ENWA 1NMEB 3EYZA 2HQFA 1SJ3P 1VQPS 1FKOA 3C16A 2LXFA 2I8EA 3PX6A 1VRQC 4KC5A 4NCAA 3W7BA 1WC5A 5E3CA 5DETA 3HO1A 1DURA 4DV2J 4F04B 2XO7A 3M1VA 3I9ZA 5KFDA 5D3GA 3TR5A 1PSDA 1V3RA 2HGLA 1T02A 1LNQA 2FC8A 2K8GA 4MFBA 1ZETA 2L9NA 3OTOF 1IVZA 4P2XA 4CO2A 3EVMA 2YWKA 5HJYA 2FVPA 2IBKA 4PWDB 1SL0A 4B3MF 1OMSA 2RRAA 1VCTA 3D1OA 1SH3A 1UJ6A 5ETOA 3KK1B 2UXCF 3MTJA 4Y34A 8AT1B 5HQLA 1D9AA 1FXRA 1B0VA 3SQOP 3TUPA 4CLKA 1QAJA 4B9MA 3M8PA 2AYGA 1FX2A 3BBBA 1M1HA 1HPZA 5K8MA 1YZ6A 5DDQC 2DR7A 1VHIA 2DNZA 4DV5F 2QGFB 1T9VA 1WEXA 2GQCA 2DRDA 3GFZA 5IWAJ 4RR5A 4J91A 2QT7A 3IS9B 4KIAA 4H4KC 3W8GA 1TL1A 2XMUA 4QU7A 3AH6A 3UR3C 2MQOA 2V2VA 2ZJQQ 2FZGB 4WFAQ 3N9UC 2BOPA 4LF9F 4ILMA 1GMVA 1S9EB 1XMBA 2EFGA 2RUSA 5A8KA 2E1PA 1ZZNA 2JRSA 3GV5B 4RUAA 4X4UA 2CG8A 2PFDA 3PW2A 2FLLA 1O51A 1V9OA 3ZC4A 3MEGB 3UVJA 2MXYA 4N47A 3HKWA 4HYKA 3LGMA 1T05B 2FQQB 4G1QB 4YY3F 3H2UB 2DXFA 2E5LF 3UN2A 3AAWB 1I6JA 2KFNA 1NDPA 2KT2A 1QVGR 5CD4H 1T9TA 2RQKA 1UWBA 1JKHA 1KVKA 2B8QA 2IM1A 2KHCA 4H4MA 4HL9A 5K20B 3D66A 2EI5A 4H4OA 3R5JB 4JB8B 2KM8C 2BABA 2PEHA 1S76D 2OPRB 4F3OA 1RKIA 2B5JA 4KH0B 4HEA9 2B7CB 2LQBA 5GVQA 2KM8B 4ECYA 1P1TA 2MKIA 1TELA 1U2RA 4FYYB 1S9EA 1I3OB 3LF0A 2AD9A 1GX5A 1TL4A 4PWDA 3PW4A 3UCZP 3DU6A 3QT7A 2G1HA 3AODA 1W7WA 1SH2A 3BGUA 3CJ5A 2VG6B 3DNCA 4IO1A 3KTQA 4DQIA 1RT5A 4PQUA 3PM9A 3I0SB 4NLTA 1N6QB 4ZPVR 2XSJA 3UE2A 1L3VA 1S1UB 3M32A 1WC0A 2LEBA 4LF7F 2WONB 1SC1B 3OFGA 4TNOA 1RHKB 2VBXA 4XDDA 3ZXWA 4R25A 4QIEA 2FD2A 5KT4A 3MXHP 2HGMA 3N28A 4P2FA 3K17A 3GSIA 3OR2A 5DRKA 1MROA 1IR0A 1O6XA 2HZAA 1NBEB 1PJ5A 3OR1A 3UQSA 1T3NA 4LF4F 1IQTA 2XSFA 4ID5B 2WOMA 3QSIA 5LSRA 4DBQA 4LBPA 2XYHB 5B0BA 1G4CA 2VQFF 1C0TB 2F9DA 4KR0B 3LWMA 2DPJA 5HVGA 1NK5A 2Z2ZA 1H98A 1PGZA 2J0QD 4HDGA 1X4DA 4ZCKA 5A8RB 2XS2A 2QG9B 3TVZA 3UD3P 2OFHX 2RUGA 2YNFA 1U1LA 3X3UA 1URNA 3CCZA 3AB2B 4DR7J 4AXJA 4LR9A 1XTZA 2MKJA 4ELTA 1KLNA 1PAEX 1Y3JA 4GKKF 2OTJS 1NKBA 2GW8A 4N77A 1N88A 1TKDA 5E3RA 1WF2A 3D67A 3Q24A 1NK9A 4K4XA 4DL2A 4OYIA 1I94J 2F65A 4DR4F 2POKA 3OR2B 3M05A 1SIWB 1OJ4A 2BRKA 1KP6A 1H2TZ 1X4BA 4M5MA 5E3AA 2D9PA 4DQQA 2L41A 2GVZA 3W62A 4OI4A 2CZ9A 2IMOA 1HBUA 4X65J 2A10A 5BYSA 4B3SJ 2V8VA 5HP1B 2HFVA 2X51A 3W2WA 2Z30B 1RBAA 1WKJA 5KFYA 1RE1B 1IKXB 2E5GA 1OPZA 2ERRA 1Y00A 7FD1A 1U1RA 3PTWA 1RAJA 3IG1A 5K14A 5HMZA 4YDDB 1S48A 1U02A 2JDJA 3DMJA 1HYSB 4DX7A 4HHJA 1V5VA 2BDPA 4IG0A 5HBMB 4WKRA 3LOUA 2B7BB 2JHEA 1BQNA 3N5BA 5GAHU 4MIBA 2MHNA 3AT1B 3W5YA 1HPZB 1ZAWA 3GFXA 1HNIA 2VF3A 2MLXA 4LQ3A 1KQKA 3FQLA 4X64J 1B64A 2HWIA 1T05A 2RS8A 3BDEA 5BYQA 2Z57B 3SDEB 2VZ9A 4WK1A 1S1XB 1HBMB 3PW0A 3EDRB 4I7FB 2EKYA 2RU9A 3DLHA 1UETA 3HHKA 3HI9A 1WI6A 1VJWA 2DNRA 4ZPBA 4ZIWA 2FLOA 4JV0A 1RWWB 2KO1A 3GP9A 1M5HA 2ZH7A 1SXLA 2NPIA 4OYWA 4U95A 5GMKa 4DUTA 3V6HA 3MR5A 3GQCA 2Y1JA 1L3TA 2XZTB 1WSRA 2FJBB 2K1RA 5SUHA 2MSTA 5L1IA 4QIFA 2I0XA 3F73A 4NMXA 1X31C 5L39A 3SZ2A 4PAAA 3GWCA 3ISNC 3DRRB 2YKMB 2BW2A 4H54A 3AJ2A 4B02A 4KGZB 1KFSA 3QJLA 2D69A 3MM7B 5LMNJ 4W92B 3OJUA 2B4UA 2BKPA 1IKYA 1C1BA 2CYYA 3I32A 4OZLA 3V6JA 4LF8J 1DQ8A 3W64A 3O44A 1HI8A 2V34A 2N7YA 4DR5J 3IBCB 3D1HA 5F0UA 3DLBA 4PUOA 5L9NA 2LU1A 3BN7A 5RUBA 3K5NA 2Q6CA 3WDOA 2ACMA 3H8YA 4DSIA 2FJAB 4ZIVA 3GV7B 2WSCC 4LF7J 3NLCA 2WAQD 2WSEC 1CJVA 4CYUB 2QLXA 4UQGA 2HBYB 4KKOA 1R0AB 4B3TF 2RQMA 5A2QU 4LF9J 3DM2B 2ROPA 3A3PB 1NRKA 2VFSA 2X1FA 4DI6A 4DR1F 3QJPA 2K1RB 1UEUA 3FSIA 2GHWA 2YTCA 3VQSA 2MYFA 2BM1A 1RA7A 2H5EA 1HBOB 3A12A 4HTJA 3FSXA 1XR5A 4WU3A 4OI1A 2EFVA 3RZAA 4B9VA 4RW4A 2ZZMA 2VFUA 2UVRA 2V94A 1BQNB 1G3OA 3UDVA 3RAQA 1G7CB 3P8BB 4K4TA 1MMLA 3HJVA 2ASLA 3OUYB 3DLEB 2XBPA 3VCDA 1N8RT 1JXLA 3SDEA 1FFSB 3NGDA 4OZ0A 2HNZA 1Q79A 1SQFA 2VB6A 2AYEA 4DDFA 4I1TA 4Q8EA 1S1WA 1S1VA 4DPTA 1XK8A 3UCGA 2M8DB 1U48A 3FEZA 4I56A 4IOBA 4QCLA 1VI7A 4CNZA 4NL5A 5I3PA 1VDHA 4O4RA 2YKQA 4OHYA 1PG5B 3DXSX 3FBBA 5AE1A 3EPIA 3HHLB 3AB4B 3SI8A 2OELA 3N5FA 2DEJA 3GCXP 2AP6A 1WSVA 3PW7A 1APSA 1R31A 2KFYA 2XMKA 2RDJA 5E41A 2W1BA 1XMQJ 1NJWA 1SJ4P 1JLQB 1VR6A 4DL6A 5D0EA 3CJQA 3I56S 4YOEA 4DSJA 2E1RA 2HNYB 1VLOA 2MDAA 1CLFA 1VQKS 1EJ7L 1TV6B 2H4WB 3CD5A 1JNRB 3DLKA 4P52A 5CABA 3Q0AA 1HNWJ 3CULA 2QMXA 2YH1A 2HHTA 4LFBJ 1YQHA 5K5MA 3HLUA 2MPUA 3GB0A 2B6AB 3D1QA 4JUZA 2OPQA 4BC7A 1NO8A 2HQDA 5IV3A 4NA1A 3AY0A 5ADZA 5HP1A 1VRUA 2FIUA 2V2QA 2W9CA 2QIFA 1CC7A 3EPGA 3BQ2A 1JLAB 2GNKA 1WC1A 2J5AA 3UD5A 4PG7A 1NCLA 1H3DA 2BBEA 1RT3A 4FPIA 4ZN3A 1IUJA 2ZKUA 5AXKA 3ITHB 3J80Y 5HLFA 2KFZA 4C3LA 4P75A 4DR2J 2J6SA 4A8FA 3UD4P 1NH7A 5LT5A 1Q8BA 2FB0A 3VAJA 4O3RA 1DAXA 2VA3A 1VQYA 4F0HA 1S4EA 5HK4A 1GFWB 3KK2A 4A4JA 1TK8A 2BW7A 1FRIA 5HSPA 2F9JA 2FLPA 3NS6A 2KI2A 2JLGA 4J9KA 1REGX 3MEDB 1FCAA 4KHPJ 2LU2A 2VDHA 3CJ2A 1X5PA 3THVA 2V4JA 4IH6A 4EI2A 3K5LA 1NB7A 2VBWA 3KK2B 1IKYB 1C1BB 4GVBB 4JI5F 1Y4ZB 4ZP8A 3LP1A 2BQRA 3C6UB 3VV2B 3SFGA 3VQTA 4QW9A 1U1OA 5CYQA 1IJFB 4BDPA 2DTJA 4X66F 2C2ZB 3IRXA 1LWFA 3C66A 5F0WA 3RB4A 4Q0BB 4DSFA 5J2MA 2C3PA 3OL8A 2DR6A 3J81Y 4F02A 1CC8A 4OYBA 3FSYA 2VONA 3CMAS 4H4OB 4CO0A 4I4BA 2MQLA 1ZM2A 4ED4A 4X4PA 2GVDB 1UFWA 2LQ5A 4P74A 5C24A 1QUVA 1TKZA 4IRDA 1YSJA 3LAMA 2ZC3A 2PD1A 3H42A 2RSQA 5LXRA 3MECA 2KL8A 4WK3A 3HFVA 4IRCA 3C14A 3D4JA 2BACA 4J7CA 4MYTA 2XZWA 4NZ6A 5DM6Q 1Y10A 1F5CA 2OFGX 2DGXA 5J1EA 3FGVA 1N5VA 2DRBA 3N01A 4CQ1A 2R7XA 1IR1A 2O67A 2G9OA 2GC8A 4ZPAA 1NLKL 3MECB 4DPWA 4RNFA 5HN0A 3KG0A 2AGQA 4K4VA 3MM8B 1JIHA 4B9TA 3Q89A 2KHDA 3D7SB 4TU9A 3CJ3A 4G1QA 3MM6B 2IA6A 1QAYA 3HM9A 2F7VA 3HD2A 3T5HA 4LF5J 2AJFE 4CTAB 1EKRA 4O44A 2DGOA 4Y00A 7FDRA 4QIVA 4CZCA 3QWPA 5M2PA 2CQ3A 3QAUA 2JOQA 4AXIA 3TAMB 2AQ4A 3H5SA 3CMES 2ZBPA 3M8ZA 5KFTA 3MF5A 2VG7A 2RD5C 3BV8A 4DV3F 3CD0A 4DLGA 4AL6A 2FVSA 2FVCA 3R5CA 5DZ6A 5T41A 3T41A 4X65F 1NK8A 3HVRA 1S0VA 4IO9Q 4LMZA 3K89A 1FXDA 1P1LA 1OS5A 2MJNA 2W2NP 3GIJA 3B4DA 1MNEA 4M8LA 2NQPA 1JJ4A 1J5OB 2ZEJA 2F8MA 3QO9A 4QWBA 3OW2R 4URGA 3EJMA 4P9SA 3HFZB 4NLYA 4M5JA 4RNMA 3QT8A 5T7LA 5FD1A 2NUUG 4C11A 5HMYA 1P9QC 3B82A 4KFBA 3DOKA 4ZCIA 5J2MB 2ZJRQ 4IKAA 2UUAJ 1EETB 4E8UA 5T14A 4A8QA 3OFFA 1FI4A 4NLSA 2WVEA 1QJHA 3NNHA 1SBRA 3KLIA 2NXUA 3R9LA 3S01A 1A6LA 4DCJB 1HWKA 1UEVA 2D7SA 1NNDA 2OPPB 1PCAA 3TVKA 3W60A 4J9NA 5A0YA 2M52A 3J7A1 2KJVA 1JLEA 2AIRB 2E5JA 2CAJA 3HHLD 4DSEA 3LPEA 4NA3A 1TR0A 1NZAA 1CSJA 1HARA 1M5SA 2AW0A 4K5SA 5JMNA 1FD2A 2KT5A 1U1NA 1RADB 4TLQA 4UQTA 4MKAA 2LEPA 3G87A 4U67Q 2Q66A 1X5TA 3PYEA 5B0AA 2BANB 1Q81T 1XNRF 2ILYA 4G1IA 3FEYB 2Q79A 3MM8A 1P9YA 5CA5A 1RTJB 1NSAA 2UV8A 3NAHA 2F5GA 1TKTB 3QWUA 4KFBB 3H7HB 1C0TA 3RRGA 4F36A 2LP4A 3L9ZA 2HEKA 2OJ3A 3V6DA 4ED3A 1GMWD 2I5JA 1TUWA 1SJ1A 1LWEA 1E6VB 4M5DA 3EE3A 4LSNA 1KQFB 4YDXA 3KK3A 1UCNA 3HHDA 4UOFA 1ZH5A 1K47A 2GJIA 3T19A 2RS2A 2QLWA 3MAHA 2QJ3A 4QR1A 5BXIA 4PR6A 4Q45A 2OD4A 4Z7CA 2W24A 3V6DB 2ASJA 1VQ9S 4OJ3A 1NSKL 1R43A 2WCXA 3MGJA 4LUBA 2VQFJ 2QA4G 1N34F 4NXNF 1RU1A 2ZC4A 5G4DA 3IM9A 4WWSA 3PRBA 5ETKA 3UDLA 2LFVA 3A8EA 2AV5A 1J5EJ 1PBUA 2LMIA 2BANA 1Q82T 5KFJA 1NHKL 3FMWA 4DV6J 3PEJA 5D4LA 2AT1B 4K59A 1Z4UA 2HAFA 1H6KX 2PEBA 1XR7A 4NASA 4ECQA 5HROA 2FHJD 4P10A 3DOMB 3SV3A 4KV8A 1U1KA 3CCWA 4UY85 4TU8A 1TQLA 2UXBF 3MAAB 4NLQA 2B0GA 2B8PA 4ANEA 2VH7A 4ZJLA 1U47A 1E6VA 3TZXA 1ZYQA 4JI0J 1F6TA 3HJFA 5J2PB 4RX6A 2RU3A 3VZIA 2QX0A 5KG6A 4W4MA 4WP3A 1C2PA 1NHUA 5CD4A 3CXCR 1KFDA 3KG4A 4DFPA 2AU0A 2U1AA 2FLNA 4F2RA 3F41A 3KLFB 1TAUA 4MAKA 3WC0A 1LW0B 3A13A 3IWXA 3SIPB 4F2SA 1Q16B 2XQCA 3BBFA 2NREA 4WYLA 2CZ4A 1D8ZA 3RG6A 4WKYA 4QBUA 2MQMA 2KDOA 2DVIA 2D9OA 1DTTB 2YKPA 3QRQA 3LAKA 2JH3A 3QT6A 2CJYB 3O3LA 4ES3A 3HF5A 1SJRA 2RQ4A 1OY8A 2RILA 1RT1A 1JMTA 1QE1B 5D78A 5KG1A 2XC9A 2VQEJ 4PEOA 2YNGA 5D4OA 3M2RB 5E3QA 1Q53A 1XERA 4DUZF 5HJXA 2DNLA 3BKFA 4L72B 4RKUC 1SL1A 2F4VF 1UEKA 5D77A 1BMQB 1CJTB 1UFLA 3J7AN 2RMLA 1FJCA 2LCWA 2YKNA 3DFEA 1S4FA 4RW6B 3M9NB 1N5YB 2E29A 5KG0A 2ZBQA 2Q6BA 1B7FA 1U45A 1J5OA 1CJKB 4E98A 5DGBA 4IG0B 2KXFA 3GJQB 2D1CA 1XBWA 1OSCA 3OQ2A 2R7UA 3LANA 1JLAA 1R27B 3DOLB 1T9UA 1R0CB 3K7RA 3PJWA 1CQNA 3TYTA 1RKJA 3CJRA 3AD7C 2DH8A 4ITSA 2EC2A 2KKHA 4Y3CA 4C8MA 3TUJC 3O2IA 1KLMB 3OXFA 2YNIA 1CS4A 3SCLE 4YR3A 5KG7A 1WC3A 1VQOS 3KLGA 4ZS6A 1OPIA 2LVWA 3G9CA 5KTQA 1O5JA 4FPRA 4LR7A 2AEMA 2I38A 3PFOA 2VHGA 1NSPA 1UW9A 2QYGA 2XWYA 1PJ6A 3QBCA 2WRMA 3BB5A 4LVNP 1BD6A 4NI2B 4Y28C 4EWTA 4ER8A 1WG1A 2K7JA 2QLJB 2W2OP 3TX0A 3G8SA 2W9BA 4A8YA 3R5BA 1NEEA 2GO9A 3KKFA 1XN9A 4CYUA 3MDFA 1Y7PA 1VQ6S 4DN9A 3NXZA 1K44A 5KFNA 2XULA 3EX7B 5J1EB 3DLGB 3JAMU 1QM9A 4MIWA 2GAGC 2X1BA 4DR1J 4ZVQB 1TKTA 3JTOA 1TVRA 3TEHB 2UUAF 5IZHA 1LWFB 2PI4A 2CADA 1XMOJ 2DXEA 4LRFA 4DV4F 1Y3KA 3H5UA 2AEJA 2N82B 4JI6J 3BKUA 3K59A 2EPIA 4DXLA 4FYDA 2FGOA 2W4CA 4OFZA 2GA7A 1VOMA 2FJVA 4QPTA 5C25A 1JJHA 2DK2A 2OIHA 1QVFR 4RLEA 4ETXA 4JI8F 3WX4A 1KWMA 2KB2A 2DGSA 5LJ3Y 2ZH3A 4FNHA 2HS3A 2D3UA 1HNXJ 2FC9A 5BYRA 3AXKA 2R8GA 4MMOA 1Q5VA 5CCMA 1QSSA 1Q4RA 2HBQB 2VBZA 2YX7A 4TY8A 3TQEA 4D3GA 1TL3B 2RE1A 2UXDJ 5ETRA 3W9IA 1TV6A 1VMBA 3DLKB 2HFOA 3OTEA 3FFIB 3VZHA 1YX2A 4PQUB 1A7GE 5BR8F 1MG7A 4HLBA 1YJ7A 2GAHC 3F44A 2JVRA 1FKPB 2AZ3A 2ZVSA 5KT3A 1KN6A 3D9BA 3NEKA 2HQ3A 1R8CA 4AE5A 1KEKA 2Y8YA 1SC6A 2O5DA 2M8HA 3OFHA 4CLLA 3DOKB 1TTHB 3MURP 2UVVA 1RT4B 1F3FA 3MPYA 4ANDA 2MB0B 3M8QB 3MM6A 5JUMA 2HQGA 3A4TA 4ZKAA 4CRJA 2CQBA 4QWEA 3BYRA 4FF3A 2B6AA 2UXCJ 4WYWA 3CC7S 3MHYA 3KNGA 4A48A 3WIUA 4DF8A 1HHTP 1YLXA 1C1CB 1LWCB 3MCNA 1HYSA 1EHWA 1F3VA 2FZKB 2EC0A 2ZWOA 3GE9A 4UOGA 3PY8A 2YWWA 3TZZA 2ZJPQ 3AXMA 1J27A 1F60B 4DV0F 5FDLA 2DNKA 3JSMB 3GIIA 4E2FB 5A8KB 2ZNZA 1FRJA 3J80U 3CD7A 5E5NA 4A8KA 1UVJA 4ZVPB 2AEFA 2ZOMA 4JOUA 2HYIB 2GV1A 1ICEB 2AJ0A 2MMYA 3IGVA 4OIXA 5AXMA 5A2QY 2G1DA 2GVZB 3RR7A 2C2MB 2C2EA 3GR1A 4ANCA 2IDLA 3HDSA 1ZPVA 3ILOA 5MAOA 4B3MJ 2DRAA 1FTCA 1RK8A 3DU5A 1TKZB 5L1KA 1PC4A 2WB4A 3LP1B 4RW6A 5DJBA 4EO6A 3ONQA 3B8HA 3L7OA 1F5AA 3MM9B 5LSLA 3K57A 3VAKA 3QGPA 4GRSA 3M6VA 2DGTA 4F0MA 2G0IA 4FXDA 2DISA 3FNNA 4O0NA 3T6BA 2XWXA 2KZMA 4MIAA 5A0YB 4PABA 3KUEA 4J9RA 1TKXB 2Q43A 3IR7B 3P5TL 2D3OR 5CXTA 4K4YA 1S6PA 4BBYA 4D3HA 2BE7D 2HHQA 3QFWA 1RHQB 2DHHA 1ULRA 1N34J 1W2IA 3BGRB 2CJXB 5IT0A 1PJ7A 3C14B 3I0SA 2NXEA 1S0MA 5D3GB 3D68A 1Q0NA 2ATCB 1OIAA 2CNLB 3K8WA 1CBKA 1UTAA 2V8PA 4LIRA 5F8HA 5GADI 1L3KA 4DS5A 1NKEA 3A8IA 1JLBA 3QGGA 4KJIA 3MR2A 3MWBA 1KKHA 2L08A 2GS8A 4JV5J 1RBOB 3HHNB 1VQSA 2LDYA 4Q7AA 5LJ5Y 4LFCJ 4UT4A 3ITHA 2E7XA 3DLJA 4OYAA 2B3TB 2F4FA 1PYOB 2HQIA 3SV4A 2Z4PA 4EYIB 3OTCA 3JS9A 1TL7B 5LSOA 3JB9k 3J7Z5 3DGPA 3MTKA 5ETMA 5L38A 2AMCB 1IBCB 1JLFA 4HHHA 3ZTRA 2F8EX 1FF2A 2CKWA 1FRHA 3KWMA 3RTVA 2EBEA 2AYBA 4Y65A 1WTBA 4X4NA 1Q7LB 3POTB 5IT9U 3LUYA 1N33F 2BZ2A 2RF2B 3MPVA 3V4MA 3MMBB 3MR6A 3FKBA 1WHVA 3MR3A 1NK6A 3E2EA 1FK9A 4ZP9A 4KO0B 2IM2A 4K50A 4A8OA 4H4MB 1SKUB 3HHLC 5KFXA 2IYIA 1JLBB 4FYWB 2IVFB 2G0JA 3SQGA 3AA9A 1VK8A 1ZA2B 2FJDB 5HATA 3TUIC 4FF2A 4DR7F 2OPSB 3US5A 1N32J 1S5ZA 2LQJA 5EDWA 4Y0FA 3MUVP 4WPAA 3DC2A 2SXLA 4WXOA 1FEHA 3EDQB 3T5KA 1ZAXA 1C4AA 2Y0SD 4H4KA 4OZ2A 4LF4J 1J2VA 5C42A 3OD2A 1HNVB 3IN5A 3DN9A 1PILA 4DUZJ 4OYOA 4EEYA 4X64F 3UDEA 3CJSA 2J8SA 4DSKA 2F4VJ 1KTQA 3JSBA 3MMBA 1FNXH 5DG8A 3M2UA 2OKQA 3OUYA 2PC6A 5KFOA 1RAHB 3GMGA 4RW8B 8ATCB 2OMOA 3J81U 1Y11A 1H7WA 2KVIA 2MZSA 3MPDA 3K5MA 4GVBA 3NOGA 1NJZA 1MU2A 2ADCA 1WF1A 3BM7A 3ZO7A 1S1TB 2BJ1A 4KPCA 3Q8UA 2HBZB 2R2SA 3CCMS 3NBPA 4OYMA 4DF4A 4KTQA 4J5OA 2VKZG 4OJGA 3HZGA 4ZJOA 4ZITA 2CXEA 4TU7A 1NPRA 3EGWB 4RBVA 3MM7A 5D4NA 4Z37A 2R7WA 2P8IA 4B9NA 4JI7F 4CO3A 4HTIA 2IRUA 1HBOA 4RW9A 1IBLF 1EIYB 1SL2A 3TEGA 3ZTSA 4WE1A 1B0TA 3GPAA 2ZNYA 4MKYA 4CP5A 4ZA1A 4WZQA 3F0NA 3E01B 1S57A 4B3SF 2C42A 4A8XA 4ED6A 1S72S 1WG4A 4RW9B 2DY9A 4DN0A 2BV3A 2VC1A 2Y9HA 2V2KA 3I0RB 3IRWP 1CJVB 1HQ2A 4EBDA 1UA1A 3CCSS 2R4FA 4C6AA 4BS2A 2QMUB 5CCLA 4TYBA 1S6OA 2RHQB 1IKVB 1AUSL 2GMJA 3QIPA 2R7OA 3HMJG 4M95A 4V19X 4PUOB 2R7VA 5FIIA 4OMFG 2DNGA 3BPSP 3MD3A 2C2RA 4ICLB 4J9OA 2NSCA 2PO4A 4CLZA 4NCGB 5DLFA 1UP1A 3M6WA 1FWPA 4YP3A 1RTHA 4Y6IA 1TKXA 1QDUB 5I3QA 1EX8A 1GAOA 1HLWA 1TK0A 5KG5A 5THWA 5I4MA 1RHUB 2H54B 4ZVEA 4ES2A 5B08A 2XCPA 3DLLQ 2W01A 4EZ9A 3LPYA 3EVOA 4ZVGA 3KJNB 2DH9A 2GZOA 5D0HA 2QYCA 1S10A 2X1GA 4G65A 4YMEA 1IKXA 5L46A 1UAWA 2HHHF 4DU7A 2HS4A 4ED2A 4YB7A 3AQOA 4EO8A 4DZ6A 3DRSA 3LP0B 5K8PA 4NA2A 2W8KA 4C2MA 4QR2A 2J6UA 4UF4A 1O8BA 2X3DA 3VWSA 2VOOA 1HWUA 1S9GB 2JLFA 3CIZA 1BC6A 2ZITA 2E1MC 4ZLLA 1MMDA 1RWXB 1FFWB 3RJMB 1G1XA 2B4PA 4DX8H 4ECRA 1NUEA 3ET6A 5IT4A 3M6XA 3CCJS 4NI2A 5LM7E 4AL7A 4RU9A 3BPDA 1RDRA 1HNWF 2WK4A 4ZK7M 3CPWR 4IOAQ 1RUSA 4IDKA 4DCOB 3AOCA 4RPFA 3TARA 4IR1A 1CEZA 4OHVA 4QYZJ 3R5DA 1H38A 2J7KA 1EKSA 4AFFA 3CDUA 1BQXA 4ATNA 1TMJA 2PDAA 3EUNA 3NS5A 4HR2A 3T1YJ 2JC1A 4FYXB 4M5NA 4OZ1A 3M8YA 5ETQA 1RT6A 3H90A 4F4AA 1H73A 3TJAA 2DYAA 4USVA 2VDIA 3VAFA 4USUA 4DR2F 4DR4J 4EBEA 1RACB 1MROB 3MEKA 4B9LA 1FVQA 2IM3A 3TJ9A 1S7IA 2V69A 1N0VC 2FZCB 2V8DA 3CDWA 1BUXA 3M8QA 4OX9F 5K8OA 3IMQJ 3UFCX 2VU5A 2VPWB 3M8SA 1SQEA 5B09A 3KJFB 1N33J 4QIWD 1S9FA 1XNQF 1REVB 3SSQA 5I42B 4WFZA 4CT8A 1N56A 3EWGA 3P96A 1PIEA 1S6PB 5KFSA 1IBKJ 1NHVA 1GEHA 1XIQA 3FQKA 2UUWA 3GIKA 2JC0A 3JTNA 1FJEB 1ITPA 3FFIA 2CRLA 3TA1A 4ZVHA 1FKOB 2CFXA 3C16B 4IFVB 1HKAA 3LP2B 5H9FJ 4F7VA 3AQPA 1M0SA 4WP8A 2C2KB 2HVZA 2BJ8A 2JWNA 3DLGA 4O3OA 6FDRA 3H40A 4ID5A 3DCAA 1H72C 3RW6A 2DNYA 3DHWC 3M2RA 4K8RA 5EGYA 3O5TB 3QRRA 2HURA 1RAEB 1SH0A 4ED0A 2CPHA 3MAAA 4DV7J 1JLCA 3QATA 2A2DA 1U0HA 2BOAA 3ADAC 3NOCA 3GCWP 1NDKA 2V6AA 4NEZA 4XAKA 5JVHQ 1S7HA 4A8MP 1FKAF 2XLIA 2OPRA 2XS5A 5A6PA 4ECZA 4HHUA 5DZ7A 2IFXA 4U7UK 1OQ3A 4KAIA 4UTGA 5HL7Q 4TQRA 3D6TB 2OH2A 4XTTA 2JVOA 2HPUA 3PG9A 4JI8J 2V9KA 2MQNA 4USMA 3QZ8A 2Y3YA 1URRA 3HSGA 2AJ1A 3SXLA 1N36F 3MZIA 5AE2A 3MFIA 1EQ0A 3MCOA 5LMUJ 2A3JA 3NCRA 3NS7B 4ZPDA 1RAIB 3TOQA 4C0OC 2W25A 1UVLA 4JV1A 4YB6A 4IG3B 3DDNA 4X4QA 2KXNB 3V6KA 2PSZA 4CH0S 2VPXB 3GSDA 1HIYA 3ISND 3G6XA 2ZDPA 5BR8J 3OBIA 3QT5A 3CT9A 4K4UA 3SQGB 4WFYA 2WBRA 3MUTP 2EVZA 2UUCJ 1ZM3A 1Q5YA 1Q8IA 2M5YA 4X84A 3KJQB 1K1QA 3QMQA 2M2BA 4FDFA 4CH1A 4GO5X 1HW8A 2HVDA 1KDNA 1Z2LA 4V19J 4USTA 2ZH1A 2AWZA 3UNYA 4IOCQ 2PE8A 2ZKTA 4OHXA 1FX4A 5FLXY 3KYLA 3TW0A 1SKSA 1T7PA 2Z56B 4GC7A 2QFJA 2ZBCA 4F67A 3MMJA 4JI1F 5CYMB 2RNEA 4ZP6A 3Q22A 1FE0A 2XMJA 1YGYA 3BDPA 4B3TJ 3GU0A 1YK9A 1DHMA 3MUMP 3T5LA 1OQ6A 2RIJA 1U25A 2DCLA 2KRBA 1TUGB 4ZVRB 1CQMA 2FTRA 2W7AA 4DR5F 5F8JA 3A1YG 3D2WA 1C1CA 2ZVIA 3ILJA 3IR6B 2ZE2B 2VJUA 3UCUP 1NK7A 4ILLA 2V68A 4NWBA 1RP5A 1Y5NB 3IWLA 4ZVOB 4NLUA 2VFRA 3IA0A 4K4WA 4B3RJ 1MN7A 4RO0A 3CB4A 2WVCA 1EARA 5BJRA 4UZBA 1UVNA 3HULA 4GO7X 2HLUA 4LR8A 5KFIA 4OQJA 3IS9A 3DYAB 3KLEB 4P2MA 3T1HF 3G71S 2VL1A 2CNOB 1UPPA 3CJKA 2B9WA 1RAGB 1U8WA 1K0TA 3NY0A 1T11A 3CDAA 2QO3A 2J8AA 4KRWA 4JI2F 3KLHB 2DGVA 4OHZA 2CQHA 1TP7A 4YS2A 4QWCA 4KPYA 1NJXA 2HW3A 1Q95G 1CULB 2IYGA 4JBCA 4DR6F 3VVUA 3O1LA 3PJ9A 2C1EB 2BKOA 3I5BA 3TANA 3KLHA 2B9YA 2CQ0A 2H1YA 2YNHB 3G6VA 4J9LA 1EQMA 2DNQA 3D6FB 3TA0A 2MZRA 2OAUA 4BWMA 2RDDA 4DX6A 4JI7J 2H51B 2VIHA 3KG1A 1IBLJ 1BE4A 3M32B 2CPYA 4F26A 2W4DA 3DDKA 1HD0A 2OO4A 3CDBA 4QW8A 4I6AA 5IQQA 3OL6A 1X5SA 3OJSA 4NXNJ 2G4BA 4NYOA 3HPOA 1AZSA 3GFYA 4YEAA 3BBCA 1KRPA 4M5DB 4U9RA 2XS7A 4ECUA 3KNAA 2GVDA 5C24B 4ZPCA 1UL3A 2AHOB 4NZ0A 4F8RA 2WB1D 4IFYB 2CQ2A 2O1PA 3AFGA 5A8WA 3MEEA 2NXCA 2O3DA 5I3UB 2P9EA 2M3DA 2ZHAA 1VBXA 2LXIA 2OEJA 1LW2A 5J1NA 2F1FA 4DQPA 4PQAA 2DY1A 2G0CA 3H0PA 1D09B 3HKZD 2CUYA 3I4HX 1V3ZA 3PEHA 3ZZRA 2VKRA 2Y8WA 3PACA 1R8AA 4CT9A 3WC2A 2XZDB 2MY7A 3FZ2A 3DRYA 3CSKA 3WBZA 5HROB 2UP1A 4NCBA 4OZ3A 1JQGA 4OZJA 1WOSA 3GYNA 3SCIE 3L3CA 1NPKA 1FDDA 1VQ4S 2OPPA 3GFHA 2HHHJ 3L4BC 1D0EA 1AZSB 1I51B 1ELOA 2CQ4A 4C3KA 3A3NB 2KJWA 4JI4J 3W1YC 5F8NA 3D6MB 4L73A 1UW4A 1DFDA 3FBEA 2LECA 3ILIA 3PR4A 2W7PA 1H0HB 3VAIA 3OSPA 3MEEB 2KG0A 1YI2S 2NZ4A 4X4RA 1CULA 2MKYA 1UZHA 1WC4A 2D74B 3EZOA 2ADBA 3CD6S 2UXBJ 4QOTA 1B7YB 2IDEA 3PFEA 1JK9B 4ZDNA 4O3QA 5JJBA 3M7VA 1Q8LA 1SI9A 1S79A 2WZ1A 1NZ8A 2DR9A 3DOLA 4DFMA 4TN2A 4KO0A 3N6NA 1Y9OA 4WIQA 4ECSA 4LF6F 2RH3A 1RYSA 2EG2A 2BE2B 2VUGA 3JSYA 2M88A 4IYQA 3U27A 3W9JA 4L76A 3QLHB 4C11B 3HX9A 5GMDA 3J81j 2NYIA 3K8VA 4ZVTB 1UFKA 4M5LA 4RNOA 2GHPA 2AX0A 4NLWA 1J5EF 5HMXA 2BJ7A 2MY8A 3RGIA 3SEOA 4ELUA 1QE1A 2VPYB 4Y2IA 1D1UA 2BMBA 1T95A 3MR7A 2FGCA 1XC9A 2XLKA 1ZM4A 3PRVA 5A6WA 4PKDB 3R7SB 4HH1A 3DYAA 4DL4A 3R2DJ 1GQEA 4YN3B 4KQZA 4MKBA 1C0UB 4HH0A 5MLCV 1S1TA 2CJ9A 2IJRA 1FXLA 3RYLA 3VVTA 2ZFHA 1U7LA 2W2QP 2ZUAA 4TLRA 5DQHA 1HQUA 1JLQA 3MPWA 4LFAJ 4ALZA 1YJNS 3ENQA 1OY9A 2MSSA 2P9GA 1F5BA 2V67A 1BY9A 1UMJA 1X4FA 5EWEA 1RWMB 3I5CA 3THTA 2CJKA 3JQMA 3M4XA 2FVRA 3RB0A 2HMIB 2WHOA 1KVJA 2EFPA 4X62F 1MWZA 5CAAA 3H20A 3E51A 3CJ4A 3TZWA 4DUYF 3DRSB 3LP0A 4ZN1A 3JQJA 4DV1J 4LSLB 2RHSB 2MQQA 4M5HA 5J2PA 1K73T 4KY3A 4ENOA 2LDIA 2WSFC 1W25A 4QIGA 2G13A 3IAS9 2Z8QA 3CC4S 1AFIA 3J7YU 1D3WA 3D6HB 1RTDB 1Q78A 1XWLA 1NU4A 2WBMA 3MCSA 4LSZB 3T9NA 3BO2A 3OFEA 3RRKA 2PMWA 1VQ8S 4OV1A 3UDCA 2H5IB 4ZCMA 2QTWA 2QV6A 1X4HA 3ET6B 2CVEA 3R6GB 2G2ZA 4RUHA 2ZH2A 1HBNA 2DNHA 4HT7A 5F8GA 3VTIA 1XMOF 3R27A 2HNDA 3T6JA 2J9EA 1FA0A 4L75A 3D3CJ 4USIA 1G6BA 1KVIA 1SC3B 4QQBA 3TNVA 3B78A 3BGFA 1TFYA 1RLCL 2DHXA 1YKWA 1FRLA 4WF9Q 4WIIA 4C8LA 2Z2LA 1U0HB 4KSEB 2ZH9A 1QAXA 2H48B 3T1AA 1NSQA 4EYHB 1D8YA 2QRRA 2XMTA 4P72A 3SBMA 5DM7Q 3DDIA 4UY8T 1XNRJ 4OZ5A 4B3OB 4EZ6A 2PA3A 5A8RA 4N41A 4JI2J 2W7OA 1KS2A 4ICLA 1K8AT 3MM5B 2KRRA 4N76A 4X4VA 2R3VA 3DKDA 4C8NA 3R2CJ 1WKKA 3TO8A 1GXLA 1KOOA 1QAIA 1F9EB 3CCQS 3H5YA 1I1GA 2P9CA 3IGNA 1CJKA 4WTYA 3V4IA 2BR0A 1KNZA 1WORA 4M94A 4Y2KA 1ZA1B 2M0GB 1SUQB 4TXSA 1S97A 2UUCF 4RW4B 1VBYA 3BJYA 4JI6F 3FCHA 1LW0A 3I9V9 2HIQA 2CJQA 4OI2A 2PGCA 3QNWB 3QAEA 1B0PA 2BQUA 2ZH5A 3EGZA 3FJ2A 2GMHA 1U0SA 3FZBA 3L09A 3NWRA 4KE5A 2FHJA 2W9CB 2QA4S 3WZ0A 2UU9F 4ELVA 1YVFA 1RWVB 2GHVC 2B43A 4MH8A 3M9MB 4KGXB 4EU0A 1O0PA 2V8GA 1KSPA 3LW5C 5DS7A 1JB0C 1GMUA 4NMLA 2RVJA 4RW7A 3SCKE 1PO6A 4I6WA 1DJ0A 5IOLA 2MGZA 4I0WA 4TKTA 3HT3A 3KJVA 4G3IA 5DDOC 3FRYA 5KFLA 1RXOB 2UUBF 1HR0J 3I87A 2ZOGA 3GIRA 4B17A 3C46A 2HFSA 6FD1A 2CPZA 2ZBIA 3U02A 4EMDA 3MMAA 3PIPQ 1M5OC 3HVTB 3UW1A 3NCPA 2B51A 2VASA 2XMMA 4J9VA 4RJVA 2ZUGA 4N8OA 5CZVA 4WCEQ 2FJXA 3EMTA 4IH7A 4KGVB 3T1HJ 3DLEA 4DFJA 3PO5A 1XQIA 3RB6A 1WHWA 4MK7A 4LVOP 2DHAA 3VALA 3U7JA 3OV7A 1IBKF 2FPHX 4TY9A 4AT1B 3ZNJ1 1IM4A 2AJ4A 2HKEA 3GZ7A 4PPZA 1RT6B 1Z1ZA 2HRTA 2UUTA 4RL1A 3U1LA 3VR1A 2UXDF 4OJHA 2HSEB 2CNKB 2VOPA 4QR0A 2OPSA 2DIVA 3AJ1A 1PKUA 5AJ3F 4HACB 4YB5A 4WTOB 5L1LA 1R89A 2EW9A 2VQEF 1S0OA 4NXMJ 2ZOFA 4KYZA 1VQNS 2W8LA 2YNHA 1DY3A 4QYZK 2QA2A 2WW4A 3NRBA 4DV7F 3ETMA 5I3UA 3KHRA 3PX4A 4AUKA 3IBFB 4R0EA 1UA0A 3GILA 2C3YA 2XHCA 2DR8A 3SSSA 2Z58B 2CQPA 4U7UD 1FD8A 3SYZA 5KFRA 1S77D 2MKCA 2YXLA 1MW7A 2CQ1A 2RT3A 3PHTA 3W9HA 1R8BA 1X4EA 2CA9A 5D15A 1AROP 1HMVA 3RBXA 1Q1KA 3UO0A 4C0HA 3TX8A 4DWIA 2A1BA 4C8YA 2DKOB 1VK3A 4CLYA 2UVWA 2MHEA 2Z0GA 1E6YB 2IAJA 2P5VA 2ALYB 2W9AA 1QUPA 4USKA 2KU7A 2VFTA 3BGRA 4NRTA 1VLYA 2WVFA 1WOPA 5KAKA 5KT5A 1QTMA 3DRXA 3AJDA 2K2PA 4MJKA 5H9EJ 1XMQF 4YQWA 1FRKA 1RTHB 1P27B 4IR9A 2NR0A 1F2GA 4GMKA 5IC6B 5FLXU 3GG1A 2QLFB 4NLXA 2HRYA 1FWLA 2YQ1A 5IXUA 2I9SA 2XNQA 5EX0A 2B5JB 2ZH4A 2RF2A 3KHLA 4YFUA 2HQCA 2NXNA 1N52B 4LF2A 5KFAA 5H9FK 1U6FA 5DG9A 1YJUA 1HWLA 4I2PB 4M5IA 4F3MA 4FXWA 4JI1J 2IMWP 3PZPA 1VIOA 1Y0HA 4O3NA 1EETA 2AGPA 3MCMA 4CLSA 2R2TA 3EGNA 3VGUA 3W65A 2YWEA 2R8JA 2YPZA 1M1KT 2YKAA 2QC3A 1MU2B 2W2MP 3BF4A 1T9XA 3OR1B 2BKNA 2BXJA 3JAMY 4NYPA 4ED1A 3V4IB 1ZM9A 2JFDA 3FEXB 4NLDA 3NBPB 1CVJA 1IJEB 2NS1B 1SV5A 4WFXA 3RAMA 4YB1P 2IJFA 3A8JA 5A76A 3Q8VA 2E7VA 2VG6A 3NMRA 2V50A 3IBWA 2CPJA 4ZLPA 1PC5A 3LGNA 3MMAB 1RT7A 3KXDA 4K0KJ 5GADU 4L6V3 5B0CA 3X1LB 3R5AA 5GAEU 2B4OA 1RCOB 3RW7A 1X9WA 4X4SA 3MEGA 1LWXA 1AXQA 3UVJB 4Y2CA 4UW2A 5CH7B 5H9EK 1HWIA 1KD1T 2J6TA 4DR6J 4A8WA 1VBKA 3D0GE 4WFNQ 3RBDA 1QY7A 5KFEA 1UWBB 2F40A 3CO0P 1SIZA 4IH5A 5E7OB 5KT6A 1FHTA 4RW8A 2LEAA 3OHBA 1R0AA 4PPDA 2HHSA 4ZVSB 2R7RA 4JYAF 3PIOQ 3WQPA 3R1HA 1WD6A 2JZ5A 3VHQA 2O66A 3RUBL 5A8WB 3U1MA 5KG2A 1FRXA 1JWWA 4MKVA 4O23A 1LXNA 1FVSA 4V1Ak 4I64A 5LOQA 1XJWB 1X7VA 1P8GA 2B56A 2BEFA 2GIRA 2C3MA 4KT0C 4I67A 3UPFA 4FKXA 4DX5A 4N5SA 1HNZF 1CPZA 4CO1A 4F4XA 1JNZB 1FK9B 3LQVA 1S1UA 1WG5A 2COLA 3R97A 2I1RA 4MK9A 2LLZA 1CG2A 1VISA 4LRAA 3PYGA 3NWGA 3KK1A 3CCRS 1GX6A 3IC1A 5U47A 2Q3PA 3BQ0A 4XIUA 2QN6B 5ETVA 3Q8SB 1VFJA 2IIHA 4DV3J 3N6LA 1SJFA 3P6YC 2XCAA 3H4DA 3GG0A 3I4PA 4I7FA 4NYZA 1YJRA 4LT6A 3QIPB 3G4SS 1YITS 2BYCA 1S6QB 1KQSR 3FCVA 2HHWA 4O4GA 3HXMA 5KT7A 3LO3A 3DM2A 4ZHRB 3WX8A 2YNFB 2YVSA 3TAMA 3SCJE 4M1KA 4CWBA 2IVMA 2H5JB 5ETLA 5HMWA 4K4SA 2XI3A 3KUGA 2VD3A 3DRPB 4JI4F 5HLFB 4IDKB 4KHRA 5KFKA 3TUZC 3M2UB 3J7YI 1X4AA 1HA1A 4DOZA 2N4CA 1WF0A 2D41A 4UOCA 1VRTB 4YHHF 2LA6A 2Z2MA 4FS1A 3OXGA 4J9QA 1HD1A 5GAGU 4MK8A 2WVBA 5C42B 5KFBA 4KB7A 5AJ3J 4NE9C 3S1TA 2K3KA 2QL9B 2GO8A 3CO9A 2I5JB 4QWDA 2ZBRA 2BE9B 4DV2F 2ZM6J 1WHYA 4J9MA 2OSQA 2EXUA 4LF6J 1N0UA 2E44A 1YHQS 3TP2A 2YX1A 3C19A 3HT0A 2MZ1A 1YWXA 4Q5VA 2OSRA 3ZZOA 4Z2XA 3LTOA 2UU9J 2D3ZA 4AQYF 1TZ0A 2IPOB 1AFJA 1YRXA 3BKTA 3R1LA 2W9BB 1HQUB 4GC6A 4OLPA 1RHRB 3H59A 3G86A 1EAYC 3NGUA 4UOHA 3CNQP 3W8PA 2F3JA 4LFCF 1H74A 3N79A 1WACA 2NPFA 1RU2A 1VS3A 3E8OA 3SSRA 1KQGB 2KH9A 2VC0A 5F41A 5J2QB 2YQ0A 4USWA 4RU2A 4BHQA 3HSDA 2CG4A 3MAQA 3ZZUA 2A6OA 5DQGA 4W90B 1BQMB 2RDIA 1BLUA 1HQEB 3C6UA 1RT1B 4FNIA 5E33A 3HCXA 1DZ5A 4FBUA 1T03A 1Q8KA 2HFUA 2OUGA 1IBMJ 3QLHA 2OI2A 3BZQA 3EICA 1Y5IB 2U2FA 1YRUA 2ROGA 1TAQA 4I69A 4PG4A 1GMWA 3N6MA 1XNQJ 2FY8A 1BWEA 3HVTA 4X62J 3JXOA 2IRYA 3TVYA 1U1QA 2DGWA 2WOMB 4GKJJ 1CS4B 5IC4B 4LBHA 2HFZA 1FESA 4RBTA 4DUYJ 1ZTWA 2HHVA 4LSLA 4M63A 2YKNB 1MWYA 1SB6A 2L3MA 1W26A 1U26A 2DD8S 3QSYB 2WTFA 1X8DA 2MLYA 2FJEB 3C6TB 4IQMA 2A6MA 2CPEA 3H25A 4HI1A 4DR3F 4ED8A 3G2XA 2NUHA 1SKRA 3TAQA 1N6QA 1TL3A 2ZD1A 4JV2A 1F0XA 5F8MA 1WHXA 3PYFA 2CQDA 3OT9A 3QPIA 2CDRB 3AD9C 5LXYA 3K58A 3CCVS 3RB3A 2C2DA 2E9ZA 1HMVB 3FUYA 4WZMA 2ASDA 3PHEA 4UUXA 3Q83A 4KGMA 4PG8A 3DHXA 2FY1A 2HAIA 1HBUB 1NB2A 3KMQA 3C3LA 1TVRB 1CJUA 1X4CA 1HBMA 2HWHA 3LP2A 2UV8G 3I82A 1M1GA 4C9DA 2CJAA 1IQZA 2J7WA 5IT9Y
chains in the Genus database with same CATH topology
1U8SA 1TK5A 4RWWA 4YUDA 1G2EA 4HT5A 4QPXA 5C25B 3JYTA 5L8RC 3CCLS 4PCQA 3MM5A 5AXLA 1FNMA 3GR0A 4LF5F 2Y1RI 3V81B 3VAGA 3NGKA 1QLNA 3N0VA 4WFBQ 5FDLB 3JSMA 2XEXA 1VQ5S 3IR5B 4DPOA 4F4YA 3CDEA 1M5PC 3RR8A 4QWAA 4ECTA 2NLWA 2YWFA 2HNYA 3CE8A 4ES1A 3KLGB 3Q23A 1AUDA 2DPIA 2UZAA 3OVSA 2OMLA 3VAHA 2GGPA 2AGOA 1HL6A 1DLOA 1T3OA 2DGUA 2XY5A 1HW9A 2QMWA 3LH2S 4TYAA 4O44B 3C2PA 4N56A 4J9SA 4LIWA 3CJ0A 4ECVA 1H2VZ 1HI0P 1X4GA 5B0EA 3CTRA 2BJDA 2HNDB 3NL0A 4O3SA 5IM0A 3KMSA 1JLFB 4F4KA 4CIOA 5B0GA 2XLJA 5IWAF 5ITHA 4PXCA 4LQ9A 4OL8A 1UVKA 5E3PA 2KTQA 2B4VA 4FBTA 1YG0A 4QZVB 4YR2A 4F4ZA 5EUHA 3VAMA 2KYXA 4PG5A 1GH8A 3B4MA 4NLGA 2R8IA 2PIIA 3OSNA 3G6YA 3LWLA 3M2VA 3ENVA 2W4PA 1R6YA 1C0UA 1JX4A 4PXDA 3JYTB 3K0JA 1RT5B 4C0BA 4C8ZA 3MMCB 3T9ZA 5IM0B 2VA2A 1DTQB 2YKOA 2PA8D 3MD1A 5I42A 2MKSA 3CCUS 1M90T 3OPKA 3M30B 1VHFA 3BR8A 3JTPA 2ZD1B 4FN5A 1U2FA 2EK1A 4U7CA 5JVGQ 5D6GA 1YTYA 3K2YA 1F9FA 3RAXA 1IN0A 2P6SA 4NLVA 5SZTA 1GNKA 5JXSA 2LXUA 1N4LA 2BVZA 1QSYA 2GGPB 3BSOA 1M5VC 3K5PA 4OX6A 1RTIA 2IC3B 3FDSA 3RU0A 5C5JA 4R8UA 4BC9A 4OX8A 1RA6A 1VGYA 1RT3B 1YRTA 3CVKA 3QGIA 3BSNA 5DDPC 1E6YA 2IAJB 3C6TA 2FVSA 3GIMA 1NK4A 4JV5F 1GTEA 4B3RF 4I2QB 5KFQA 2B9XA 3ICLA 3GYXB 4G1PA 2DH7A 3IO1A 3TA2A 4O0IA 1RYRA 2M70A 2E1CA 3Q8QB 5DLGA 4QYRA 3I6PA 1H7XA 1YBAA 2ZE2A 4F25A 3M6UA 5F9LA 1U1MA 4IRKA 5KFVA 2ZH8A 1HHSA 1S49A 2JSXA 2YWGA 3RBEA 2PN6A 5L1JA 4HKQA 3HK2A 1KHVA 3G96A 2XHWA 3C8YA 4I2PA 4DL3A 4ZHRA 3PRDA 4Q2MA 2MJUA 4ZPWR 2CVIA 3BR9A 2NSBA 1JXEA 2MQPA 3D28A 3V2UC 1JLEB 3OL7A 3H5XA 2CPFA 2IM0A 1S6UA 2Y1IA 3TI0A 1LFPA 4CNYA 4CCHA 1RT7B 2HVHA 2AX1A 3RRHA 1LFWA 2CZVC 2R8KA 3HVWA 3KLEA 1KONA 2DNMA 2BE2A 4A46A 4PXEA 4FVCA 2ASYA 3DRPA 5E2QA 3AA8A 4RBUA 1WEZA 3S8SA 2VODA 1AW0A 2PFFB 2EFNA 2KZZA 3PX0A 3I0RA 4ED5A 4BWJA 2L9WA 1RISA 1IKVA 2DT9A 2HRUA 5CYQB 3PDNA 3TRGA 2CQIA 2ZH6A 2DR5A 3KHGA 1T8EA 1L3SA 2HGNA 1WWHA 3H2VE 2KN4A 4LFAF 3THPA 5CYJA 1JLGA 3KLVA 4C8OA 2OD6A 1GTHA 2EG1A 3MEDA 3OLAA