4F36A

Crystal structure of nucleoside diphosphate kinase b from trypanosoma brucei, apo form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
141
Chain Sequence
SERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHFYSGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSDSVESAKREIAFWFKAEELVSWTSHSVKQIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Crystal structure of Nucleoside diphosphate kinase B from Trypanosoma brucei, apo form
rcsb
source organism Trypanosoma brucei brucei
total genus 42
structure length 141
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4f36A00
3ZTSA 1NDCA 1UCNA 2ZUAA 3Q89A 5BXIA 3FBFA 5CAAA 1PKUA 4FKYA 3B54A 1NSPA 1MN9A 1S59A 1NDKA 2AZ3A 1ZS6A 4F4AA 1WKJA 3BH7B 1B4SA 2HVEA 1BUXA 1PAEX 3DKDA 3VGUA 3FCVA 1JXVA 4W98A 2DXDA 1WKKA 3JS9A 1HLWA 1K44A 1KDNA 2B8QA 3MPDA 3EE3A 3FBEA 3EVWA 3GPAA 2BEFA 3NGSA 4ANDA 1XIQA 4ANEA 3DDIA 3FCWA 3PJ9A 4UOFA 1VYAA 3EVOA 4ENOA 4F36A 2B8PA 4S0MA 1NSQA 4DUTA 3L7UA 3ENAA 1NDPA 3EICA 1LEOA 1NDLA 1BHNA 3BH6B 4O0NA 3BBBA 3VGTA 3VVTA 3ZTQA 3PRVA 1B99A 3EM1A 4UOHA 1NHKL 1NLKL 2HVDA 3WX8A 1NSKL 3ZTPA 3VGVA 3ZTOA 5C7PA 1BE4A 1WKLA 3ETMA 2CWKA 4C6AA 3FKBA 1S5ZA 1F6TA 4UOGA 1NCLA 3Q83A 4HR2A 3VGSA 3EVMA 1NB2A 1LWXA 1F3FA 3FBBA 3Q8UA 3EMTA 3Q8VA 2DYAA 1NPKA 2DY9A 4FKXA 4CP5A 3Q8YA 1NUEA 1HHQA 3Q86A 4KPCA 1EHWA 3FC9A 3B6BA 1W7WA 3BBCA 2BX6A 4DI6A 3ELHA 4EK2A 3NGTA 2HURA 4DZ6A 2NCKL 5CABA 2VU5A 1HIYA 5IOLA 1U8WA 3R9LA 2DXFA 1MN7A 1XQIA 3FBCA 1S57A 3VVUA 4WBFA 4ANCA 3NGUA 3ZTRA 3GP9A 2AZ1A 2DXEA 3EJMA 3G2XA 3BBFA 3NGRA
chains in the Genus database with same CATH superfamily
2N4CA 3M32B 2KHDA 4PXCA 3Q89A 4WE1A 3Q8SB 2VDHA 3ZZZA 1S0VA 2ZVSA 4IQXA 1TP7A 3N4WA 4I2PA 3G9CA 4ZVTB 4ZMMA 1IR0A 1VC0A 4TKTA 3JTNA 5B0DA 3SZ2A 4DL0C 2QG9B 4KFBB 4RW4B 1Y10A 4ID5B 1SUQA 3ZZPA 2QC3A 4J9VA 1GXLA 3THPA 4S0MA 4ZPAA 1YZ6A 5HJYA 2HZAA 3IR5B 2V2QA 4PUOA 3KHLA 2PGCA 1VOMA 4YN3B 1KSPA 4EZ9A 2JLGA 2MZRA 3OR2B 4CLZA 2VPXB 2V68A 2HHQA 4X2BA 3MM5B 1N4LA 1RT1A 2LEPA 3CCMS 1B7FA 2DRBA 1WF0A 1HWLA 4O3QA 4OYOA 1KD1T 5KFTA 5IOLA 3BGOP 1CJTA 2F8EX 2BJ1A 1P8GA 4P2FA 1W25A 4LFCJ 1UVIA 2DEIA 5H9FJ 1TTHB 3TEHB 1C0UB 1ZPWX 5G0RA 4NLYA 3DLKA 1LW0A 3H2VE 3NCPA 4AT1B 3JXOA 3PZPA 2DGSA 1SQEA 2KM8B 1X5TA 1P9QC 3D6TB 3ENWA 1P6TA 3GMGA 1RLDA 5KTQA 5KFNA 2E5JA 3TARA 2Z0GA 1F5CA 1OQ6A 2K2PA 4EWTA 3J80U 4WIQA 5HVFA 3PJ9A 1RT5A 3BSOA 1ZM2A 3GCXP 4YY3F 3LP1B 4LFBF 3D28A 3ZTQA 4ZPDA 2VQEJ 3EM1A 4JUZA 1C1BB 2L9WA 2HNZB 2VG7B 3I4PA 4OI1A 4IOAQ 1NCLA 4IO1A 3UE2A 3R6GB 3KHGA 2KH9A 2W9CA 2AT1B 1ZYQA 2ZOFA 3PVXA 3I0SA 2LFVA 1R0CB 4G1PA 3E8OA 3HI9A 2FC9A 3ZXWA 2R8KA 1WTBA 1HIYA 4URSA 1VJWA 3EGVA 3WIUA 2FJAB 4J9KA 4ZIVA 1IBLJ 4MAKA 2HG4A 4L3NA 3H5XA 4NRTA 1UMJA 2XGQA 5JVHQ 1GNKA 1H72C 4B3OA 2F5GA 1VQYA 3G6XA 1YJTA 1S1UA 1R3NA 2GMHA 1B4SA 4NCGB 1YJVA 4C8MA 4PQUA 4NYPA 2UXDF 2DNLA 2Q1LA 3GJTB 5DJBA 3FK4A 4JV5F 1I51B 2AGOA 2NREA 2L41A 1U1QA 3BF4A 1ZA2B 1CS4B 4DLGA 2ATCB 2EVZA 1TL7B 4DX5A 4ENOA 3EVOA 1D9DA 2P9CA 2Y1IA 4XAKA 1OWXA 2IJRA 4Q5VA 4ETZA 2YTCA 4ZA1A 1CQNA 4JI8J 5A6WA 4P2XA 3CCWA 3IM8A 3MEGB 3RAQA 3AXKA 2OO4A 2ILZA 4NEZA 1YJNS 2GO8A 4RNOA 1LWFA 1MU2A 1GAOA 1CPZA 1P27B 2J9CA 5F41A 4N56A 1EQ0A 1HI8A 5BXIA 2YNHA 2IRUA 3G4SS 1PGZA 5HJXA 5H1SV 3HHNB 4HHJA 3UI3A 1FJGJ 4KJIA 3O3LA 2KXNB 5AXNA 1REVA 2YKMB 2JFKA 2ADCA 1Y4ZB 1M5VC 3AY0A 4CLSA 1JLBB 2F4VF 1FWPA 4K8RA 2QV6A 4ECQA 3AOCA 3HF5A 2QL9B 4RZRA 2IAJB 1ZBTA 3OQ2A 4DG1A 5GADI 3DRXA 1D09B 2AMCB 1UTAA 1FDDA 3EVMA 3D1HA 2EKYA 2UUBF 2ZZMA 3MEDA 3IR6B 3FEZA 1Q82T 2IM0A 3A13A 2D74B 1F2HA 1GMUA 3CMES 2DNMA 1IKXA 3QIDA 4C0BA 1F2GA 3BEGB 1TL3B 2MKJA 2B56A 3OJSA 3TUZC 1MWQA 2OPRA 1XMBA 5L1KA 3BPDA 5KFVA 2RDJA 2GA7A 1JKHA 5DDOC 2DH9A 3AXMA 3PTWA 2AYGA 1TL1B 2EXUA 1FFWB 4WXWA 3L4BC 1ROFA 3ZZYA 5GAGU 3HMJG 2PMWA 3SFGA 3PY8A 1U6FA 3BGRA 2DGTA 1EP4A 3PR5B 1FD2A 4ZJLA 5HANA 5HMWA 1WJ9A 1M1KT 2DO0A 2BXJA 2VIHA 3UW1A 2AJ0A 1VBXA 9ATCB 4ZVPB 1YQHA 1VQ5S 1Q1KA 4NEYA 2V0NA 3VAJA 3M2VB 4QIVA 4TYBA 4XPEA 3CJKB 4Q0BB 2LA4A 1HW8A 3HZGA 3NOGA 1MSWD 4UZBA 3PM9A 3D68A 2E1CA 2XEXA 3DLBA 8ATCB 1EARA 2P6TA 5AE2A 2KI2A 3VAKA 1Q86T 4NZ7A 1FRXA 3CJTA 3BQ1A 5EUHA 2FY8A 3GCWP 2QYCA 3HXMA 3CCQS 2C2RA 4OZJA 1TKXB 4ER8A 2BM1A 3EGNA 3DGPB 5J2PB 5DM7Q 2D69A 3I5BA 1KVIA 2YVSA 1EX8A 2HFZA 4ZHRB 4YHHF 2M52A 1HQEA 4QIEA 1SKUB 4PYDA 3QRPA 4RUBA 4L75A 1HWIA 2KT5A 2PA8D 4TY9A 2E5GA 4B3RJ 3HD2A 1RAHB 5CQGA 1N34F 4KAIA 3M8RA 1NLKL 4DZDA 5EDWA 4WKYA 4LT6A 4ECTA 3FKBA 5KFBA 1NJIT 4DV1J 2VHGA 5FIIA 3MPYA 4GKJJ 1FXDA 4LF8F 1XNQJ 2W4CA 4Y0FA 4LREA 4CLUA 2AHOB 4P7VA 4NA3A 2R7SA 4N8OA 1PILA 1RISA 2ZE2A 2CNNB 3D6HB 4DV5F 5E5NA 3KK1A 3ICLA 1R8HA 4MKAA 1CJUB 3DHWC 3IGNA 3OTDA 5IQQA 2HK2A 2E7XA 2WSFC 1PBUA 1FK9A 3V6DB 3KNAA 2VG6A 3KXDA 4P72A 4WP3A 3SSQA 3FRYA 3WDOA 1FNXH 4J91A 2EFVA 3MEEA 4RW9A 5K8PA 2MQQA 2AV5A 3SDEA 2VKZG 2ZM6F 4MKBA 3HHLD 2AJ1A 2ROEA 2EC2A 4JOUA 2J0SD 4ZVOB 4M63A 3DI6B 3CNQP 1Y5LB 2QA4G 2HEKA 4LIRA 2BW7A 2ZJQQ 4LSNB 1UETA 1RT7B 1XNRJ 2GZOA 2PT0A 1NHKL 4LIWA 4WTOB 3ZO7A 1LWEA 1GTEA 1KBRA 2GHVC 2XCPA 5BYRA 4IQMA 5K5MA 2OMLA 2AQ4A 1FKPA 2XGPA 1O5JA 4CO5A 1SBRA 1RA7A 4QWCA 5CD4H 5AXKA 2OEKA 4ZLJA 3NWRA 4Q8EA 3A8IA 1EZZB 3CUNA 4IUFA 3JSYA 1R31A 1YHQS 4KGKA 1JJHA 4CM2A 4AUKA 1DARA 5K8MA 4DR7F 4JI6F 2AW0A 2JJ4D 1L3KA 4Z2XA 3TAMA 4IR1A 1NHVA 5ETPA 5HROA 4WP9A 3FEYB 4ZVFA 8RUCA 3R3TA 3Q2TC 3ILIA 1U2RA 3BN7A 5IS2A 3CE8A 1DQAA 3SIPB 3KLHB 1S9FA 4WP8A 2FJBB 1ZAWA 2H4YB 4CIOA 1FRKA 3OL7A 2H5IB 3IWXA 2FQQB 4RBTA 1PJ7A 2W4DA 2Z2LA 4NYZA 1NJWA 3JAMU 2ZHAA 3GIMA 1RADB 3WX8A 4M5JA 1WC0A 3G96A 2CPYA 2DHAA 4U8VA 2VA3A 2KJVA 1M5PC 2WOMB 5I3PA 3Q86A 4Y2CA 3ELHA 3R1LA 2G0CA 3W66A 2HQIA 2BA9A 3QSIA 4QYZJ 1FJ7A 3W61A 4KT0C 2NXUA 3IM9A 1N5YA 4QWAA 1J5EJ 3DOLB 4V19X 4EMDA 3IGVA 4IG0B 4OHVA 3S01A 3OL8A 3LANA 2ZNZA 5IV3A 4I6AA 4JI3J 3M6XA 3R7NB 1G6BA 2OI2A 4EBEA 2H54B 2Q66A 1XN9A 1Y9OA 3TA1A 4NLGA 2W4PA 3MFIA 3W2VA 4ECWA 2JEGA 4J9NA 3T1YF 3DLEB 5DLGA 1JB0C 3QJLA 5LXRA 3PW4A 1FFSB 4ZIWA 2U1AA 2MHEA 3EMTA 1DQ9A 4M95A 2AGPA 5HBMA 2L08A 3CJQA 3FEXB 5I42B 3QZ8A 2BE7D 2XNRA 4OYWA 2M7SA 4CWBA 4ZVEA 2HHSA 1HBOA 3SQGA 2J9DE 3R5AA 4HDHA 2XSJB 1R8AA 2HIQA 4O3SA 1KTQA 3LP0A 3NLCA 4IG3A 5LM7E 5DLFA 4WJBA 2CQIA 2MJNA 3GYGA 3M2RA 1NKBA 5CXTA 2Q79A 2CPIA 3FDSA 1JLEB 4LF6J 4RW8B 4CO1A 3HSZA 3QGPA 2DGVA 1M0SA 3M8ZA 4R0EA 1HNIA 1M1GA 5D0GA 3MUMP 4A46A 2FVCA 2WCXA 4QU6A 2WSCC 3ZC4A 2EG1A 2O67A 5K20B 1G3OA 2ZWOA 1N8RT 3GIJA 3CCRS 2GJFA 3UR0A 1OQ3A 2DJWA 5LSLA 3G6VA 3OUYB 1KOHA 3UCZP 1TV6B 2V2ZA 2RF2A 1MROB 1QAJA 3IG1A 1OYEA 5HVHA 4ED0A 1ZTTA 3RB3A 3G8TA 3JYTA 1DURA 3AOAA 4OX9J 1ZM3A 1RT2A 2MTLA 2SXLA 1U1LA 1FFGB 2GVZB 3BPSP 3CD7A 3E01A 5CYQA 5DS7A 3RBZA 4DV7F 2YNGB 1VQSA 1YVFA 1PJ6A 2GQCA 2QLWA 3KDNA 4AD6A 2VUGA 1WEZA 1K1SA 3A1YG 2IVMA 2CNOB 3I0RB 3T9NA 4C97A 4O3RA 1YRXA 1S0NA 2Q43A 1HHTP 1HNWF 3CCLS 4Y34A 2MKSA 4FDFA 2JDJA 3FQLA 2ZD1B 3MCMA 1YKWA 1WEXA 3DLGB 1V3SA 3A3OB 1UVLA 3UQSA 2CWXA 3MECA 3NGKA 2DK2A 2O5DA 3HDSA 2ZFHA 2BQRA 2D3ZA 4V19J 5GVQA 2RNEA 3LALA 2CQGA 1IM4A 2HWHA 3DGVA 2BKNA 4IFVA 4GKKJ 1S4EA 4JI4J 2XMTA 5LJ5Y 5B0GA 4LVNP 2CQBA 3FFIB 4KKOA 4LSLB 5CZXA 2NZCA 1K73T 1HNVA 2KT2A 5F8NA 3ZNUA 3I96A 3BZQA 2QT7A 4C3LA 1RT4B 1N48A 4DL3A 4DR2F 2R7XA 4U7CA 4DXLA 3U1LA 2JH3A 4E0DA 3W5XA 4NLVA 4FN5A 2A2DA 2HBZB 2HNYB 1SC4B 2G2YA 1FEEA 3NNAA 2P5VA 1FHTA 5HK4A 1HNXJ 2F1FA 2UV8G 4IH5A 3AHPA 2JEIA 3VTIA 2VG5B 5B7WA 1ITPA 3KUGA 4NOHA 3EZ5A 4R25A 4K4WA 2R8GA 2J9DA 2QE5A 1CEZA 4USMA 2LKZA 1X31C 4B9TA 5IM0A 2ZUGA 4Z37A 1BC6A 2LECA 3HULA 3QATA 4QJVA 4YB5A 2KVQE 4PG8A 2V94A 3RB4A 1N52B 1RWKB 4N76A 5C7PA 1E6YA 2UUAJ 4BLGA 1K47A 1X4EA 1RTIA 3IS9A 3ZFVA 2N7YA 2RQCA 4J9RA 3X3UA 4AQYF 3ULHA 2A6MA 2DXFA 5KFHA 2H9ZA 4OJ1A 4JI0F 2OLWA 3NBPA 5KT7A 4L76A 1CG2A 3T1HF 3N01A 1SV5B 3MM7B 2YKQA 2C2EA 2IHR1 3CGIA 1S4FA 3MMAA 1IBKF 3O5TB 2J7KA 4WTYA 1U7LA 2LQJA 1U02A 5DZ6A 2FD2A 4RNHA 4KIAA 3OTEA 4UZCA 3M1VA 1C0TA 2FJXA 2CNLB 3W5ZA 3TZXA 2FHMA 2IFXA 2W2OP 2APOA 2BANB 5KFXA 3MHYA 2KG1A 3GB0A 3W64A 1NDPA 2E5HA 2V8PA 1I6JA 1GXTA 2RE1A 5HQMA 4L73A 3W65A 4FXWA 4USIA 2YPZA 2ZEJA 4QIGA 1FDAA 1FKOB 2QLJB 2Y1LB 5DZ7A 1FTRA 3KOAA 1U2FA 4CH0S 3HZEA 3CULA 4CCHA 3MFHA 3NG8A 2X1GA 5CHCB 3P5TL 1DLOB 2VU5A 1RYRA 2DVIA 3WZ0A 4KY3A 1TZ0A 4A8OA 3UFCX 1WOSA 2XS7A 4B3MF 5ADZA 1KQFB 4NCBA 2OGUA 2V9WA 3BDEA 3O44A 3U1NA 1S6QB 4DUYJ 4OYBA 2FVPA 2LQ8A 2R7OA 4F02A 1N54B 2QO3A 4DR3F 4KBIA 3GSIA 7FD1A 2DPIA 1Q95G 1JLGA 1YJ7A 2CJKA 4ECZA 2WVBA 2W7OA 2GO9A 4DPYA 4DUZJ 4PZVA 3MMCB 4P2SA 5M2RA 2HFUA 4F4YA 1OPIA 1EIYB 4LJMA 3Q8PB 3MM8B 2A18A 5L1JA 3C66A 3M9NB 1RWWB 4PKDB 3PIPQ 3UCGA 4LSZB 4JI2J 1RI7A 4OX6A 4WE1B 2R7RA 2EBEA 1LK7A 2A1BA 1N6QB 5DDQC 3TI0A 2GVDA 1YX2A 5IV4A 3KDOA 1Y5NB 3NNHA 4RUCA 4XTTA 2XMUA 1SQFA 3AODA 1MMNA 2PIIA 4DR1F 2VPZB 4EYHB 4MK7A 2R7UA 1S6PA 3T41A 2HHUA 2CKWA 2ZNYA 5D0RA 2HFVA 3CD6S 2MZJA 2ACYA 3QAUA 3NCQA 1JLAB 2V4QA 3NOCA 3D9BA 3PR4A 3OVAA 5GAGI 2XMJA 3K7RA 2QLBB 1FDNA 5F3TA 1TR0A 2V2VA 1VMBA 3DRRA 1U4BA 3NMAA 2P9GA 5C2CA 1EETA 1OY8A 2UU9J 1TAQA 3LH2S 2VPWB 4KTQA 4OI0A 5IXUA 2LVWA 1U1PA 4DQSA 2JX2A 5C42B 2MKHA 3G6ES 2BOPA 3IXQA 5KFFA 4B9NA 2RT3A 4Q2MA 2C2MB 5E3AA 1PSDA 2YKAA 7AT1B 4LVOP 4WKRA 3NAHA 2MZSA 2VFRA 2Y1RI 1S1TA 4OZ5A 1RTHB 4LQ3A 3THVA 2OMOA 4NLTA 3FJ2A 2WBMA 1U48A 1VI7A 1QAXA 2DIVA 4MH8A 3I5AA 1AUSL 3ITHA 2BW2A 4C2MA 2J6SA 2BQUA 4QR0A 2ZH3A 3RGIA 1PC4A 4DS4A 5AJ3J 2CJAA 2HHHF 1UVMA 2JC0A 3DYAB 2M0GB 3QIPA 3M4XA 4L3KA 4EGLA 3J7AN 3O8WA 4FBUA 1JLFA 3RRGA 4F0HA 4G6VB 1LW2A 3EGZA 2YY3A 2GHWA 3MR7A 1Y7PA 3I4HX 3AJ1A 3PRVA 5C25A 2MY8A 3KJQB 4ES1A 1F5AA 3MCOA 4IRKA 3MMJA 2FLNA 3PIOQ 2ZKTA 1MG7A 4BC9A 2C3YA 1IBKJ 2PFDA 2XO7A 1S1UB 3K5OA 4OI4A 4PQUB 1YRTA 3J7YU 3MR3A 1UFWA 2R8IA 4PPDA 1RKIA 2CFXA 2ZWPA 2IVFB 3PW7A 2YNFA 3TUPA 4BDPA 3L7PA 3MWBA 5SUHA 2NS1B 4C8OA 4NLQA 3I31A 1KLNA 2VC0A 3HHLB 1KEKA 1N32F 5HQLA 5FD1A 1YLXA 2POKA 2YX1A 3ZNJ1 3HO1A 4MT1A 3HJVA 1AFIA 4RW7A 5KFRA 1CJKB 4KE5A 1JMTA 1XK8A 1NB7A 2B9EA 4CLFA 4USJC 4DS5A 1AA1B 4DX7A 1YTYA 1U49A 1F60B 1X5PA 4KO0A 1MWZA 2CJQA 2X1FA 3GYXB 4WIIA 1OY6A 2Y0SD 4ZPBA 2GCFA 1BQNA 2KDOA 3Q8UA 5DM6Q 1EHWA 2HQCA 1KWMA 4CLWA 3T9ZA 2ZBCA 3CW2C 3V4IA 5C24A 3FMBA 4B3TF 1JWWA 1SJRA 2YBVA 3M8PB 3BN4A 5E3QA 2ZJRQ 2EFNA 1R6YA 1U25A 5A76A 3W9IA 4O0IA 1X7VA 5EHHA 2HAIA 2YWFA 1AZSB 2O3DA 1WDTA 1VR6A 1H7WA 3MGJA 2RB7A 4JV2A 3AA8A 2RQ4A 1WKKA 4MYUA 2GMLA 3H8YA 2IRXA 3MOJB 3B4DA 2Q6BA 2RKIB 3KG4A 3KLEB 5THWA 2GNKA 1N36J 1RTDA 3EICA 2HNDA 4GO7X 2R4FA 2KRBA 4JP8A 4UOHA 1NSKL 3S8SA 3SI8A 1Q8LA 1ZA1B 3A8JA 1U24A 1LFWA 2XY7A 5KFSA 3VAIA 2W01A 2CIMA 3FGVA 1RBOB 3C16B 4I2QB 1IKYB 2PC6A 2NXEA 1XQIA 4H4KC 4NI2A 4B3SJ 2CJYB 1N0VC 2XM3A 1JQGA 1QSYA 1YJ9S 4DBQA 1HA1A 2RSQA 4CM0A 4DV2J 4GVBB 1S59A 2RH3A 1V3ZA 5ETOA 1WELA 2EEYA 4UUWA 5J2NA 4KH0B 4ED2A 2ZBRA 1JXEA 2OPPB 2VFTA 2GGPB 4F3QA 2R2UA 3MPDA 4DCOB 2B4OA 1EJ7L 4DV3F 2CQ3A 2AP6A 8AT1B 1LNQA 1H74A 5DG8A 4ID8A 1S1VB 1M90T 1IKVB 2J6TA 2W9AA 2AX1A 3RAXA 4K7QA 2ASJA 1NUEA 4H4OB 3JTPA 3WHIA 1OSCA 1Z4UA 2FY1A 4OJ3A 6FD1A 2FZKB 5HMXA 2UUTA 2P6SA 5T7LA 2IRYA 4LF5J 1QE1A 1Q7LB 2B5JA 1RT3A 1LFPA 5HN0A 2ZVIA 2YQ0A 1CC7A 2ASLA 4NLRA 4KHPF 5CCMA 3FZBA 3K5PA 4JV0A 2BMBA 3L95X 4CQ1A 3HX9A 3T5KA 2KXHA 2VB6A 3M8SA 5AXMA 3AA9A 1HMVB 4I0WA 4ILRA 2B51A 2RDIA 3CMAS 3NL0A 3EVWA 4FS2A 7FDRA 3G82A 4ANDA 4K4ZA 4OFZA 2BE2A 3OTOJ 1FRLA 1PYOB 2DGUA 4RJVA 3X1LB 4OIXA 2JL9A 2HHVA 2AWZA 2NUHA 2HVIA 4WZMA 1RTJA 1YITS 5B0AA 2CPDA 4X66F 4O3NA 1RBLA 1F3FA 2E1RA 2XTJP 2BM0A 3G8QA 1U6BA 4P75A 2C42A 4M5GA 4PR6A 5IC4B 3CDUA 4HHHA 2MGZB 3K17A 2IBKA 1ULRA 1VRUB 3ENQA 4NXNF 4NLUA 3OR1B 3RG6A 3V81A 1DZ5A 3ISND 3EJMA 1C1CB 2RJZA 4EO6A 2DPJA 3MUVP 4K0KJ 2VQFJ 3KHHA 3QJPA 3GQCA 3IFEA 5DQIA 3FBFA 2E7VA 2N82B 2H1YA 2HBRB 3IBFB 4EI2A 3M30A 4TU9A 4TU7A 4TN2A 1VQOS 3PW0A 2VZ9A 3HT0A 2UXBJ 4I7FA 4ZLLA 1HLWA 5E7OB 4LBPA 3JQKA 2G0JA 4I68A 1KQGB 1WC4A 2E9ZA 2KL8A 2IA0A 4KV8A 3P96A 1JLQA 2X3GA 2QFJA 2DR6A 4FNHA 4CO2A 4HTJA 4B9LA 2IC3A 4B3TJ 3GSDA 1CLFA 3HVTB 2M88A 1DFDA 3T6BA 1OS5A 3SV4A 5HSPA 4MYTA 3BREA 1RWUA 1I5OB 5KT4A 5K14B 4CNYA 3UN5A 3NGDA 4K59A 4LF4F 2C3MA 4LR9A 4J9OA 3UDEA 2DNQA 5ETLA 5LMNF 2W2QP 3AT1B 2RDDA 1FD8A 3J81Y 4QWEA 1N33F 3RBDA 1RQ0A 5A0YA 4C11A 4JBCA 1NBEB 4ZCKA 1UCNA 2N7CA 3AQOA 2P2CB 1T9WA 4Q44A 3SSRA 4W92B 3CTRA 2H5EA 2DGQA 5HP1A 3MM6B 4OHXA 1RZMA 1VC5A 5LMUJ 3C6TA 2Y8WA 2AYBA 4WFAQ 4ZPWR 3PKYA 4F4WA 1S1XB 3M6UA 3IRXA 2MKKA 4P7TA 4WFYA 2BJDA 4M5IA 1HYSA 4DV0F 3H42A 1T9VA 4K50A 4DSLA 4PAAA 4QWDA 4JYAJ 3KG0A 5EX0A 3BO3A 2JEJA 4ZVHA 4NLDA 3R2CJ 2HMIA 3M32A 3VAGA 2KO1A 2LXIA 5EWFA 2GJ2A 3ETMA 3CCUS 2CWKA 1SJ4P 2MMYA 2W8LA 4UUXA 4LF9F 1JLCB 2HHXA 2QGFB 1YI2S 5E3PA 2OD4A 2I0XA 1JXLA 4C98A 3DM2B 4R0JA 3QT6A 1YZ7A 1WACA 1KTVA 1NJYA 4KFBA 2AZ1A 3QLHB 4RW4A 2LYVA 1E6VB 4OZLA 3L09A 4ID5A 1RGVA 3UD4P 2JRSA 4JB8B 4QW8A 4GVLA 4WFNQ 3QPIA 1GXUA 2F7VA 2FHJA 3P45B 4J7CA 3W8GA 4Y6IA 2JNJA 3CB4A 2CJ9A 4USHA 1RHKB 2VDIA 3VGUA 1URRA 1VQMS 3ONQA 2MZTA 3OR2A 2R8JA 1XR7A 3DRPB 3OXLA 2QMXA 3C6UB 4N5SA 3MM5A 1JJ4A 3ET6B 4C4WA 4KC5A 2ZH1A 3K58A 1SQGA 1UEVA 2RVJA 4UOFA 3HFVA 1M5SA 4DV4J 2MQNA 2F65A 1C0UA 2V4JB 2EK1A 2VBZA 1RWPB 2YNIB 2W9BB 2QX0A 4ZP7A 3BYRA 4RKUC 5CYJA 4DQRA 3LAMA 4ED8A 2HFSA 3S7RA 1R0AB 4E8UA 3LW5C 5K8OA 2DNKA 3FQKA 3SQGB 3MTKA 3PNIA 2CQ4A 1YBTA 5H9EK 1PC5A 5F0UA 2HQ3A 2GC8A 2XHCA 2AYMA 4G1QB 4DFKA 2FJDB 3LP1A 4OYIA 2XZWA 4JI7F 2OTJS 1WEYA 3NEKA 3N9UC 1C1BA 2YWGA 2HNZA 2VG7A 3NWGA 2XNQA 2ZKUA 1O0PA 1U1OA 4W4MA 2RRBA 2PMZD 1UP1A 1OSDA 1CULB 1A6LA 2C28A 3AOBA 4TQSA 3PJXA 5G4DA 2Y3YA 2HFOA 5DO2A 4NXNJ 4HH1A 1RK8A 3KYLA 1DQ8A 1O8BA 3Q8QB 5ETVA 1NMEB 1FWKA 2NQPA 1HNZF 2IDEA 2K06A 1G7CB 3RW7A 2EWHA 4NCGA 1FXLA 4C8KA 1X0FA 3B6BA 3QT7A 3Q24A 1WF2A 3MZIA 1RWOB 2ZITA 5A8WB 1U8WA 5L1IA 2RAQA 1BWEA 4J5OA 1CS4A 2VC1A 2A6OA 4ZVGA 2RU3A 2EFQA 1TL7A 3HPOA 1UJ6A 3SCIE 4ED4A 3I5CA 5IWAJ 4QYZK 2UVRA 1HD0A 2I9SA 2FTRA 3QSYB 3BKUA 1S7HA 3MMBB 2BYCA 3BQ2A 5DDRC 4NMXA 2UVVA 4F4KA 3TR5A 3MEGA 1IKWB 4QIWD 3RAMA 3NGSA 4CLLA 1FXRA 5KFQA 4LF4J 4KYZA 4NXMF 2VBYA 1TMJA 3TVYA 3A12A 1GT8A 1BHNA 5L38A 1N33J 4ALZA 2FYXA 4B9VA 3UN2A 4UTGA 1IBMJ 1WSRA 4CRJA 4C8LA 4A48A 2XZTB 4DV6F 1XMQF 2DY9A 4FKXA 4ED6A 2HAFA 2XY5A 2CQCA 2YKMA 4A8WA 3QRRA 3GG1A 1MN7A 2MZ1A 4X64F 2DB1A 3GFYA 3TVKA 1X9WA 4K4UA 1JLBA 2DXEA 1H73A 1T9TA 1SC6A 2VJVA 4DV0J 4KKOB 3I55S 4ECSA 1NK5A 2XYHB 1NM2A 2LLZA 3H2UB 2IAJA 3OSNA 2YPYA 4F4ZA 3D1QA 1T8EA 2FGCA 2LEBA 1TUWA 3TAQA 1TUGB 4JI5J 1XC9A 1GX5A 5HL7Q 2XHWA 3WIVA 1SXLA 2BKPA 2HS4A 1X4BA 4KHMA 3LO3A 3BM7A 1WI6A 4RU9A 1S97A 1UPPA 3OXGA 4CO3A 2DNPA 3KLVA 4CLKA 4X62J 4LFAJ 1UVNA 4EFAC 3VGTA 3R8YA 1TL3A 5GMDA 2K1RB 1FX4A 4DR6F 2ZDOA 4C8ZA 3GV5B 1TAUA 5KG2A 1NH7A 2ZH7A 2XG8A 2PE8A 2D3O1 3IMQJ 1HR0J 3M8WA 1BQMB 4O4RA 1HWKA 1V6HA 2MKIA 4DJBA 2ACMA 3QGHA 5D15A 2OFHX 3RBEA 1BGXT 1FA0A 1TL1A 2VICA 2J7WA 4FP9A 4ZLPA 3FUYA 2RS8A 1LK5A 2YXLA 2FHJD 2RHQB 3IO1A 3D2WA 3UNGC 4OQJA 5J2QB 4TQRA 1J2VA 2GS8A 3OSPA 5HMZA 4A4JA 4EBCA 2DHHA 4YR2A 1UVKA 3M2VA 2DR9A 5J2MB 4EEYA 3CJKA 4Q0BA 4F50A 3DRSB 1GTHA 1PJ5A 1P9YA 4OZ2A 4A8XA 2FB0A 2Z2MA 3PEJA 1TFWA 3R97A 3EUNA 1AFJA 3L7UA 4PWDB 1BY9A 4QPXA 4DEZA 2OPQB 1XWLA 3PDNA 3HHEA 3T5LA 4A47A 1N5VA 3OVSA 2V34A 5B0BA 4I6YA 4DHVA 3D0GE 5KT6A 2FLOA 5M2PA 3WC0A 1TKXA 1HL6A 1NJXA 2NCKL 3DGPA 3OFFA 3PYGA 1WHVA 2BJ7A 3V6HA 5J2PA 1S79A 2OKQA 1NK6A 2KVIA 5E2QA 3RRHA 1S9EB 4ZHRA 1T9YA 5KFGA 1VISA 3UDVA 2XMMA 3GYNA 1UJ5A 1WI8A 5FDLB 4J9LA 2OHDA 1F9FA 4G1IA 2ILYA 1U0SA 2OP5A 2OJ3A 3KJVB 3NS5A 1RT6B 1YIJS 1XIQA 3J80Y 3A4TA 4OL8A 1QJHA 4LBIA 1CJUA 5F8IA 3GG0A 5KFYA 3OT9A 3UNYA 4YP3A 2HK3A 1S49A 3V6DA 4MIWA 1NB2A 1NAQA 3PV8A 3TO8A 4CP5A 2GAHC 5F8GA 2HBYB 2JZ5A 2BVZA 5KT5A 4RO0A 3R9LA 4BC7A 4Y2AA 3HK2A 3NRBA 5J1EB 3GP9A 3UWTA 2K7KA 2V8VA 3MPVA 3ZZRA 2J0QD 1EQMA 2FJVA 3DI6A 1KQKA 1TVRB 1X60A 4LSNA 1RT7A 1NDKA 2WB4A 4F4AA 5EGYA 3D3BJ 3G86A 1TKTB 2UP1A 4GRSA 1KRPA 5DG9A 1D0EA 4DSEA 1QSSA 1RABB 2C2NA 3OFHA 1Z1ZA 4DV6J 1XMQJ 5KOXA 3CJ3A 2H51B 4N8NA 2FIUA 1UWBB 1CBKA 3IP0A 1LWCB 1HBMB 1AXQA 4AXIA 1S9GB 1NSQA 3SQOP 2Z8QA 4X64J 4KGVB 4E2FB 3BH6B 3KNGA 4HYKA 1RHMB 1C4CA 2C22A 3TJ8A 5KG0A 2H5JB 3M8QB 1YWXA 1UA0A 1RTZA 2FJWA 2R2TA 4QBUA 1VRTB 4TU8A 1M5HA 1KLMB 1UEUA 3FCHA 3FC9A 5HLFB 3IBCB 5EX3A 2FLLA 2HLTA 1LKZA 1VQ6S 4LF7J 1RCXB 3KLHA 4H4MB 2YX7A 4CYUB 1UZHA 2PN6A 1T7PA 2CYYA 2YWKA 2ZHOA 2KHCA 4DR5J 2HVHA 1XMOJ 2KJWA 2ASDA 1WG5A 4DSIA 4DL6A 2XLKA 4HHUA 3P3DA 3CDBA 4UQGA 4QIFA 3VALA 1CSJA 1GK8A 3BS9A 2QL5B 5KFCA 2WOMA 2W1BA 4GO5X 1REGX 3BKTA 4DQQA 1VLOA 2E1PA 3CXCR 2V5HG 2E1MC 3P8BB 3UDLA 1QAIA 3DOLA 2MPUA 2NPIA 5B08A 2BRKA 3LWMA 2AD9A 3HSDA 4IG0A 3TYTA 4ED7A 1KC8T 3HFZB 3I6PA 2DRDA 3D67A 4DI6A 3IBWA 4DF4A 5FLXU 1R89A 4WBFA 3V4MA 1K0VA 2ZH6A 5KG6A 1X4HA 2NXCA 3P5BP 3R5CA 1KONA 2AJFE 3U7JA 1NKEA 1JLFB 3C14B 2XC9A 1RBAA 3P6YC 3DLEA 4LR8A 1VQPS 1XJWB 4CNZA 2ZH2A 3CPWR 2Y1JA 1IWAA 1RXOB 3JS9A 4FF4A 3KLGB 3HHLC 3QGIA 1FJEB 1SL1A 2YH1A 4WXOA 3EX7B 5L1LA 2WHOA 3JTOA 2BABA 3M9MB 4PWWA 5D4NA 4X4SA 1FNOA 3WX4A 1VIOA 2I38A 4H54A 4FYWB 3RRKA 4PG6A 2IM2A 1CQMA 2MLXA 2LXFA 1FJCA 3BGUA 2N3OA 5HI7A 4KPCA 2XSJA 5A8KB 4C0HA 4LF1A 3GJRB 4YY3J 4LFBJ 5C5JA 3I32A 3W5YA 1FF2A 2ZOMA 4DR4F 4FBTA 2HZVA 3BR9A 2B3TB 2J0XA 4ECXA 4OI2A 2VFSA 4AXJA 2AZ3A 3Q23A 2E66A 1JLEA 4RW8A 2XWXA 3M05A 1TL4A 2IMOA 3K5MA 1VBZA 1FKAF 1T3NA 3TAPA 2DNHA 1TK0A 2PMHA 1NRKA 4KO0B 2JVRA 1R0BG 1VHIA 2R9LA 4DL4A 2UUCF 2C3OA 3GJSB 5AE1A 2HHTA 4DL5A 2CZ9A 2VBXA 2KB2A 4F4XA 4M5DB 3OUYA 3SV3A 2UXDJ 1H2VZ 1TV6A 3ZTPA 4JV5J 1MROA 3QO9B 4R5PB 2UXCF 2CQPA 3R7BB 1B70B 4A8SA 1LWXA 4U7UD 2M70A 1S1WB 1SJ3P 1T05B 3V2UC 1U0HB 4YOEA 3AD7C 2HURA 1K9MT 1HPZB 3L9ZA 1TKDA 2BJEA 5F8HA 1UVJA 1QUVA 4ANCA 3Q8RB 3J7A1 3N6NA 4C3MA 2GVZA 2E29A 1SKRA 3TZWA 4OLOA 4ZVQB 4ETXA 3I87A 4JI1F 2YNGA 4NZ0A 4OYMA 4QW9A 4U96A 2KFZA 4DMZA 3I0RA 5RUBA 1CJVB 3JQMA 2AJQA 2QJ3A 5IZHA 4PQAA 1YJUA 5MAOA 3EPIA 2I5JB 1DTTB 1UW4A 3VAMA 2Z2YB 1TU0B 1UZDA 4FVMA 3JSMB 5T41A 1SIWB 1PCAA 1F1BB 4YFUA 4Q2LA 4YS2A 1KS2A 4N47A 4CZCA 2ZD1A 4IDKB 4RW6B 2Z56B 3DLGA 2E5LF 2HRUA 5KFJA 5BR8F 3GFZA 1B0TA 4PG4A 3T3FA 4K5SA 4B02A 4ZCIA 1ZZNA 2GHPA 4K2XA 3K8VA 3QYYA 5ETTA 2FLPA 1WUUA 4PPZA 2F4VJ 3C15B 1PAUB 5D8HB 3C2PA 1GMVA 3PX4A 3W63A 3OLBA 3FFIA 4LSLA 3DOKB 2OPSB 4DPTA 4DFJA 3CCZA 2WRMA 3RW6A 2LU2A 2DGOA 1B64A 2UUBJ 3KWMA 3CJSA 3TW0A 1RT4A 4J9UE 2OIHA 4QPTA 4FVCA 5D4OA 4LRDA 2U2FA 1T03B 3DDKA 1HQ2A 5A8RB 3BKFA 2KZMA 2DHSA 3AAWB 2HNYA 3MUTP 4LRFA 3N28A 4LFCF 4J90A 3CIZA 3JAMY 3UPFA 1TL5A 1BE4A 1I3OB 5IT9Y 1IJFB 2VG5A 3BDPA 3QFHA 4NE9C 2LDIA 1NPKA 4HH0A 2V8GA 1FERA 4YB7A 5DG7A 4CLYA 3POTB 1O51A 3CVKA 3RJMB 1DHMA 3CC4S 3B4MA 3PW5A 4CT9A 3OW2R 1UJ4A 1H38A 4RU2A 1QVGR 1ZZFA 1S48A 5L9NA 1FRMA 1OMSA 4DL2A 4G3IA 4DU8A 1RAIB 2DNNA 5DDPC 5KG7A 2MDAA 2A10A 4OV1A 3BV8A 5CA5A 1SKSA 2K7JA 2KU7A 4RUAA 4F2SA 1YBUA 2OEMA 2ALYB 3BB5A 5KFUA 5GAEU 5DRKA 4TLRA 4DUTA 3OHAA 3CC2S 3MD3A 3M7VA 4RL1A 2BJ8A 4WCEQ 3D66A 1HKAA 1IBLF 1SV5A 1TKZB 4N77A 3KJNB 4CTAB 4F26A 4PXBA 3GTYX 3LAKA 3MM7A 3PACA 2GQQA 3Q83A 4E98A 2RRAA 4V1Ak 5LXYA 4C8YA 3E51A 4YHHJ 1S76D 1V3RA 3DU6A 3D6MB 2I6WA 1RHQB 2HKEA 3QWPA 3HT3A 1S57A 5ETNA 3MAAB 3W2WB 1N34J 3VAHA 3V5RA 1Q53A 4USKA 4P9SA 4CLPA 2BANA 1HBUB 5D3GB 5GAHU 3D0IE 1XR6A 2AEMA 4KV8B 1AROP 2WVCA 1WC6A 2CZ4A 4B17A 5M2UA 4LF8J 1Y00A 2YKNB 4J9MA 1BXNA 3RR8A 3OFEA 1RAJA 2OH2A 1FKOA 4OHYA 3OD2A 4DV5J 1Y0HA 4O44B 3H40A 4JI8F 2HBQB 3KK2B 1KFDA 2ZH4A 2PI5A 4YEAA 1DLOA 3KFWX 2WBRA 1NZAA 1NK8A 1MW7A 1UFKA 5A2QU 5FJ4A 3D3CJ 3CJ0A 3OXFA 2RS2A 4MKVA 3QFWA 2W2PP 3KMQA 1TUVA 3GILA 3EWGA 2ZM6J 2YQ3A 1S6QA 2AIRB 4DWIA 3LQVA 1YJRA 1FJGF 3GV7B 1H98A 2EKNA 4MK8A 1PBAA 4CI0B 2HS3A 2VV5A 1LXJA 4OZNA 4NX9A 3MPUB 2A3JA 2MQMA 4R8UB 3MMCA 2LQ9A 3R5JB 4CH7A 2YQ1A 2F3JA 1Z2LA 2WK4A 4MFBB 3MM8A 1GEHA 3FCVA 1RAFB 5I3UB 4GC6A 4F3MA 2GMJA 1B0PA 1SCJB 2VBWA 4X65F 4CLTA 1FNMA 2R7WA 1SH3A 1N6QA 2EFPA 4DR7J 4JI6J 4ZCLA 3JSBA 4ELVA 2LCWA 3FCWA 5KFOA 2CQHA 4FPIA 4RNMA 3PYFA 2DGXA 1YRUA 1LEOA 4NLPA 2WAQD 3U1MA 2CA9A 2HQGA 1UEKA 4U9RA 4UY85 3DLJA 2D7SA 4F7VA 1JLAA 1APSA 1D9AA 3RTVA 1UL3A 3HJFA 3CD0A 2AKWB 3KLFB 3MR2A 4OMFG 3CCTA 4FYYB 3QNWB 4U7UK 2CPZA 1Z2ZA 2F40A 5HAOA 4XIUA 3K2YA 3DOMB 2VODA 3ZZUA 2LQ5A 1WORA 3JB9k 2E7WA 3UVJB 3MURP 2CJXB 2KFYA 4KGZB 5C42A 3DXSX 3LA0A 2AYEA 5CYMB 4O3OA 1V5IB 1U26A 2O1PA 5IC6B 4P10A 3DFEA 1Q78A 2YWHA 3CCJS 4PXDA 2XBPA 1HBNB 2AEFA 3LGNA 4O4GB 1RTHA 1NSAA 2FDNA 5D4LA 4AE5A 3BSCA 2X51A 3JQJA 3DMJB 2G9OA 4I4BA 1UAWA 4A8KA 2GV1A 4IFYB 4OZ0A 2IA6A 4DPUA 3D1OA 2WZ1A 4P71A 3H4DA 2BJ9A 4EZ6A 2CADA 4TVAB 5IT0A 2JSXA 3N5FA 3VAFA 3CIMA 2HQFA 2MKCA 3DYAA 4PEOA 3T1YJ 4IR9A 1EB0A 1DTQB 2B6AB 3DLHA 2O66A 4EU0A 2ERRA 1W26A 2LDYA 4A8QA 3MEKA 5HMYA 2YWEA 4ZJOA 2NZ4A 3T5JA 4Q45A 1HQUB 5F8MA 5CD4A 2W7AA 2QEXS 1WKJA 4HDGA 1W2BR 4B3RF 4HEA9 3ETOA 5L39A 2W7PA 2MQPA 4KR0B 1U6ZA 5EN1A 4K2JA 1ZETA 2XMWA 4DV1F 2XWYA 4NA2A 4WK1A 4Y3CA 3Q2SC 4NLSA 3G8SA 4GKJF 4B9UA 3GWCA 1XNQF 4ICLB 2EI5A 1ZTWA 1KVJA 2CUYA 4O23A 4K4XA 3KK3B 2DNZA 1H3DA 1IUJA 2JWNA 2DT9A 2B7CB 3LPYA 3HHLA 4X4PA 1X4CA 2JLEA 1H2TZ 3H7HB 4LMZA 4HACB 2E9TA 2OTLS 4EK2A 2QLXA 5KFMA 3LP2B 4Y65A 2ZBQA 2HLUA 2BJ3A 1KKHA 2GQ2A 1CJKA 1FO1A 2X1BA 1X8DA 3VZHA 4QZVB 3F41A 2VF3A 1X5OA 1WNEA 3ILOA 2E1AA 2FHOB 4DL7A 3FVYA 4M8LA 2WSEC 3MTJA 4LUBA 3CEDA 1XNRF 2KN4A 3WBZA 5AXLA 1JXVA 3IRWP 4KB7A 1Q7YT 1N88A 3FSXA 2CPEA 3M2UB 1M5OC 4I56A 1C4AA 5LT5A 3PFEA 3BQ0A 3HFKA 2GJIA 1IN0A 3N6LA 1U2CA 2WONB 2MQ8A 1CVJA 1RACB 1A9NB 3I82A 3CO0P 2PSZA 3AB2B 3M8PA 3VHQA 3W9JA 3DC2A 2HQDA 2FGOA 3ENVA 1AZSA 3WQPA 1VQKS 2J7UA 4AYBD 1C2PA 4ZOSA 4DV7J 2GIFA 3KHRA 3CCSS 1IWGA 2ZBPA 3A8EA 5KFIA 1J5OB 5HO4A 2XMVA 2XMKA 4X65J 1K0TA 2DKOB 4QOTA 2AF6A 4OZ1A 2N3LA 4IYQA 1B3TA 2RKIA 4B9SA 3KLEA 5U47A 1HNWJ 4TY8B 1MN9A 1TK8A 1IXKA 2V4RA 3SCKE 4U8YA 2IDLA 2W25A 3TX8A 3CDEA 1F0XA 2PD1A 4P6QA 3FMWA 1TQLA 4RNFA 3W3SA 2L48A 3LPEA 3THTA 3KLIB 3ZZTA 3C16A 4I2QA 3MM9B 3LOUA 5E3RA 1IKYA 2ZH8A 3TNVA 3TVZA 2VJUA 1RB0A 3HSJA 1SH2A 3VV2B 2E9RX 3D0HE 2M2BA 2H48B 1P1LA 2KG0A 2R2SA 2HFNA 3H98A 4O0NA 3HP6A 1KHVA 4I2PB 1M1HA 3RB6A 4JV1A 1VBYA 5KFZA 4GVBA 2DO4A 1J5EF 3VGSA 1X9MA 4HI2A 3QRQA 3C46A 1SI9A 5DGAA 1HHQA 4J9PA 2D9OA 4FYXB 2CG4A 1SUQB 2OPPA 3NCRA 2GGPA 3TA0A 2XCAA 4ZVUB 2KYZA 4JI3F 1Q5YA 4X4TA 4PUOB 3BBFA 4DR2J 1SC1B 1RYSA 1NDCA 1S77D 2C3UA 1KN6A 4FXVA 1FRHA 1I1GA 4TNOA 4DSKA 1S1VA 1RT1B 1U8SA 2AGQA 2DY1A 1IKVA 2EW9A 2H3EB 2XMAA 1YJWS 1S99A 1IJEB 4X4UA 2JC1A 3SCJE 1CJTB 4W90B 3PXGa 1O6XA 3NKYA 1QAYA 3TJ9A 4H4OA 1IM6A 4CT8A 2IJFA 1FVSA 4USVA 5G0RB 1R27B 3DLKB 1LW0B 3J7Z5 1VQ9S 4OLPA 1HI1A 1S7IA 2EC0A 4QR2A 2HS0A 2BKOA 3QBCA 2HHWA 4QR1A 2JFDA 2RUGA 3TZYA 1GX6A 4Y28C 3KG1A 1Q5VA 3DLLQ 3GR0A 3BBCA 2IY5B 3PCOB 2R3VA 1HMVA 2NUUG 5B09A 1KVKA 1ZPVA 4PG5A 4J37A 5KFLA 1RT5B 5D0EA 2ATLA 2VPYB 2CPJA 4DPXA 4J9QA 5KG3A 1G1XA 3CC7S 1WOOA 4RLEA 2W9CB 3JSRA 2Z58B 2HVEA 3OHBA 3I0SB 2LP4A 1OO0B 4AQYJ 4LF6F 4KQZA 4JI0J 1LQ9A 1N56A 3T1HJ 3PW2A 4UW2A 2DCUB 2MGZA 2L3MA 2XSFA 1VRUA 4B3OB 2JEFA 4ECYA 3DRYA 3OR1A 2J6UA 1XR5A 3H5UA 5GMKa 1C1CA 1SH0A 2G4BA 1WTFA 3OL9A 2M4MA 3ZTOA 5JXSA 1UFLA 2B9YA 1L3TA 3HVAA 4DX6A 3K8WA 2Y9HA 4L74A 2BE9B 2CDQA 3EXYA 1X9SA 3VQTA 1U09A 3CT9A 4Q8FA 2QMWA 4OX9F 3NGUA 2G2ZA 2M5YA 3TX0A 5H9EJ 2LA6A 2GX8A 2XQCA 4F0KA 2HGMA 5KFPA 3NS7B 3HVRA 5CAAA 5IFMA 1PKUA 2QSFA 1H0HB 1QDUB 4ZDNA 5F8JA 3H20A 3HVTA 1PG5B 3LUYA 1PAEX 3DKDA 5F9LA 1WDDA 5DETA 4UY8T 1LWFB 1WOPA 3BO2A 1MU2B 5K14A 2X7IA 3CJ8A 4P74A 3S6EA 2DCLA 2ZJPQ 2V50A 1K1QA 1D9FA 4B3MJ 4ZP6A 3CMQA 2YNHB 1QY7A 2JVOA 4AL7A 5F0WA 2CXEA 1MNEA 2OAUA 2IM1A 3TQEA 1IBCB 2WVDA 1RLCL 3K5LA 1U1RA 4DR3J 2WB1D 5KFWA 3WC2A 3W9HA 1REVB 4PABA 4LQ9A 2ZHBA 3MM6A 5B0CA 3OV7A 2DITA 2J8AA 3PO4A 1ZOTA 2PA3A 2W2MP 1S1XA 4GKKF 4JI4F 5IT9U 2IBOA 2J8SA 1S12A 1SJ1A 5H9FK 4C0OC 3V6JA 2HWTA 4DG1B 5KT2A 3CD5A 4TLQA 1AYEA 2C1EB 4BHQA 3MEDB 3U27A 2MQLA 2MYFA 4NLWA 2WW4A 2FHKA 4DR1J 1JLCA 1XBWA 1IKXB 5D77A 3FBEA 3OJUA 3IC1A 4ES2A 3BJYA 5BYQA 3DM2A 4DLEA 4ZKAA 4D3HA 1SB6A 2G13A 3CF5Q 4F36A 2R2RA 3QLHA 2OPRB 1E6VA 2C2DA 1B99A 4A8FA 1VLYA 2JHEA 1T9XA 4ZITA 1HNXF 1JKHB 3NY0A 3HM9A 2R42A 1NJZA 2QIFA 4FF3A 4USWA 1EKRA 2PFFB 4ATNA 2H65B 5A6PA 2ZOGA 3UO0A 4N41A 3DRPA 3BGRB 1FRIA 3C6UA 4NA1A 3DDNA 3ISNC 4Q7AA 1EP4B 3ET6A 4DN0A 4XK8C 3US5A 3OTBA 3ZTSA 3K0JA 2I8EA 1NSPA 4F2RA 4ELUA 2V4JA 2ZH5A 4IH6A 3SYZA 1AT1B 2YNIA 2CAJA 2W9BA 1FX2A 2KFNA 5GAEI 2UUAF 4HT7A 5D0HA 1M5KC 2PDAA 3PEHA 1R0AA 2M8HA 3QQCD 2BEFA 3IAS9 3PJWA 1PYSB 4MTPA 3SMZA 1DRZA 3L7OA 4OI6A 4X4VA 5ETQA 2BDPA 2EG2A 4OZ3A 1J27A 4ILLA 1VHFA 4G1QA 3HHKA 3ZZ0A 2HHHJ 4PCQA 3K59A 1S72S 3OLAA 2R7QA 4IRCA 1UWAA 4Q43A 3F0NA 4DSFA 2HPUA 1S6OA 3UN3A 4C48A 2CRLA 4WF9Q 4FPRA 1HQEB 5GAHI 2D1CA 4DU7A 1MWYA 1UPMB 3H4BA 3PHTA 1RDRA 5AT1B 3E2EA 2MJUA 1CULA 2E44A 4FYDA 2DEJA 5KFKA 3NGRA 4O3PA 2C3PA 2K3KA 2QN6B 5CCLA 4L6V3 1RA6A 1RHRB 1RWXB 2AEJA 4IRDA 2BOAA 3AD8C 2P9EA 4X4QA 1Y3JA 1SL0A 2B4VA 4ED1A 1KDNA 2ZE2B 3KK1B 2FC8A 2NXNA 5A8WA 2IM3A 4DOZA 1FK9B 1RHUB 2CDRB 2VKRA 1N32J 2J5AA 2VG6B 1GMWA 3HD1A 1FE0A 4OX7A 2DNRA 4K4SA 2G1HA 3P4UB 2LXUA 3GE9A 1RU1A 3MEEB 4RW9B 3SDEB 4DUYF 4XDDA 4ILMA 3MMBA 3N6MA 1NK9A 4ZPCA 1IKWA 1HI0P 2N4DA 3TJAA 1LWEB 5K9FA 3ILJA 4DUZF 1FKPB 2B4PA 2CNKB 2J76E 1Y11A 3TOQA 3OBIA 1HARA 4L72B 4OYAA 2DHGA 2DXDA 3RUBL 5KFDA 4HT5A 1K44A 4JI2F 3VQSA 2RRNA 1FEHA 3MOZA 1FT8A 1W2IA 4ANEA 4CH1A 4TYAA 3EDRB 1N5TA 2B4UA 3TAMB 3R5GA 3NP5A 1ZH5A 1JK9B 4RR5A 5HROB 4YQWA 5LJ3Y 2NXJA 3TZZA 1F6TA 2RQMA 1BLUA 3MAQA 1BMQB 2VA2A 4Y2MA 4F0MA 4CDIA 1T9UA 4F04B 2GIQA 3L3CA 2XYGB 2V2KA 4A8YA 3OFGA 1KNZA 1D1UA 1Y5IB 1AB8A 3PHEA 1SJFA 2W8KA 3LF0A 2UU9F 3HLUA 2WVFA 4OYZA 4K5RA 4URGA 1S0MA 4PXEA 3J7ZT 2K1RA 3HSGA 3PO5A 2BV3A 4OX8A 3SEOA 1BQMA 2O01C 3EE3A 1YGYA 3KKFA 2DHXA 3I9ZA 1HHSA 1RAOA 1N5YB 2RHSB 2AX0A 1VYAA 4TXSA 2XO6A 2WW8A 3EYZA 1AUDA 2LQBA 2K3IA 4RX6A 3Q22A 1WG1A 3RU0A 4C6AA 1VQNS 5J2QA 1H2UX 4DV3J 5E41A 4C3KA 5BJRA 5J1PA 5AJ3F 3M9OB 3GV8B 2OSQA 3GIKA 5J2MA 5EWGA 5ETKA 3W2VB 3DRSA 3MR6A 2F8MA 2HHPA 4M5NA 1UA1A 4PWUA 1RCOB 5KG1A 2HRTA 3G6YA 4XO0A 1NZ8A 4PWDA 3VR1A 4M1KA 1NKCA 2OPQA 5KG4A 1K8AT 2KYXA 5ETSA 3MDFA 2KT3A 2VONA 1DBDA 4IKAA 3LWLA 5MLCV 1L3SA 5L9XA 2P8IA 5KFAA 5HBMB 3DHXA 4QYRA 4DPWA 1T11A 4KHPJ 1X4GA 2CPHA 3CDWA 2PI4A 4DQPA 1OYDA 3NS6A 5HATA 1Q0NA 1S9EA 4C7QA 4LRCA 1SVDA 4HI1A 2WTFA 1HBOB 2L9NA 2CQ0A 3RYLA 5FDLA 4UOGA 1HFEL 5HQ8A 3AJ2A 2DYAA 3LP0B 2MSSA 4IG3B 1FTCA 2KKHA 5B0EA 1RE1B 3T5HA 1FRJA 3U02A 5I4MA 3M2RB 2F9DA 3KJVA 1XERA 1RJJA 1RT6A 4FZVA 4FNIA 2NSBA 1A0OB 1U1NA 5IQ6A 4X66J 1G2EA 2QA2A 1HNIB 4NPOA 1P1TA 3CJ4A 3R27A 1H7XA 2A2CA 2HVZA 1L3UA 1JNRB 1NU4A 1VQLS 3A3PB 5LSRA 5E33A 4P2MA 3VF0B 1VFJA 4ZLNA 4RUHA 4M5LA 1YSJA 3EXCX 4WFZA 4J9SA 1G4CA 1ZM4A 2RF2B 1GMWD 2B8PA 3IG1B 4DQIA 5J1EA 1RSCA 4K4YA 4DFPA 1EKSA 1R6VA 3W62A 1NEEA 2CZVC 2MLZA 3JYTB 1TVRA 2MHNA 4WYLA 3UDCA 1VDHA 4WYWA 1RT2B 4ITSA 2BX6A 1TKTA 2NYIA 3QAEA 2F9JA 4DZ6A 4I1TA 3E01B 5CYQB 4BWMA 1MMDA 1BD6A 2D3UA 4X84A 5C2GA 1FCAA 3G2XA 1ELOA 2OUGA 1UWBA 2FZCB 1LWCA 1HBMA 1S9GA 2VASA 4PRFA 5ETRA 5DQGA 1N36F 1T94A 2HSEB 2GAGC 4XDCA 3M8QA 1BUXA 1WC3A 4ED3A 3AQPA 5LMNJ 4ZPVR 1NXIA 1VRTA 3GJQB 1WSVA 3TANA 2DGWA 4C9DA 2RIJA 1Q79A 5K8NA 1KLMA 2RD5C 4AL6A 2AJ4A 4KPYA 5F8LA 5HLFA 2EBGA 4M94A 3MECB 1Q16B 4H4MA 5JVGQ 2XI2A 4CYUA 3ENAA 4NLXA 3SBMA 2HGLA 4B3SF 2CJBA 2KM8C 1WG4A 1WHYA 2Y0BB 2PEBA 3R7SB 1SJQA 2V6AA 4HTIA 3N79A 4ZP9A 3PYEA 5JUMA 4IFVB 4FF1A 1F9EB 4DV2F 4DN9A 4WWSA 2Z57B 3HKZD 5LSOA 2EFGA 1N5SA 2NYHA 1NK4A 1HNVB 2GFFA 2FVQA 1S6UA 3QMQA 4KHRA 2J0WA 2YX4A 4WFBQ 5ITHA 4FF2A 2UVWA 3A8KA 2MB0B 2G0IA 2ROGA 4LF9J 4KSEB 2YKOA 1FDBA 5D6GA 4K4TA 2F4FA 3BH7B 2B9WA 4P73A 3N5BA 3RR7A 2DBBA 4BS2A 1SIZA 2UZAA 2VFUA 3CCES 4PG7A 1UW9A 1Q8KA 1I94F 4DCJB 3RB0A 2IPOB 4AL5A 2DR5A 5AE3A 5ETMA 5F9NA 4N7TA 4LF5F 1MLAA 1S5ZA 3NXZA 1YK9A 3C14A 1JIHA 1TELA 1V5VA 5IM0B 1IQTA 2GIRA 3KLGA 2H4WB 2PEHA 1XEZA 3F56A 4Y00A 3AH6A 4DX8H 1GQEA 3AFGA 3UR3C 3D5MA 3EDQB 2LEAA 4H4KA 1E6YB 3B54A 3PG9A 3OTOF 1RTIB 1UKUA 1OY9A 3IS9B 1RWNB 3HVWA 3H5SA 3GIIA 2QYGA 2Z4PA 2EPIA 4LF2A 3GR1A 5A8KA 4UOCA 5KFEA 4RPFA 3NBPB 1RAEB 4X4OA 2V63A 4YR0A 2RILA 3J7YI 4RNNA 2BZ2A 4K4VA 1NNDA 2YH0A 1JJCB 4ZPTR 2QRRA 4JI7J 1QLNA 5SZTA 1T02A 3MMAB 1R8BA 1X4AA 3FZ2A 1Y3KA 4ZVRB 4K0KF 2VQFF 2R7VA 2C2ZB 1DY3A 4FXDA 2M9KA 1Q81T 3M1VB 1C0TB 3ISZA 3FSYA 2M3DA 1SL2A 1NO8A 2UXBF 3FBCA 3SCLE 1VC6A 3BGFA 1PIEA 3LGMA 2R7TA 2B0GA 4LR7A 3DU5A 2F63A 1HNZJ 3TP2A 4B9MA 1QM9A 3T1AA 4M5DA 3N0VA 2B43A 3VWSA 4KGXB 3QO9A 4R5PA 1TFYA 4OV6A 3EZUA 1YBAA 4EYIB 1S1WA 1T05A 5I3QA 4ZCMA 1U0HA 1HPZA 3QZ7A 2B7BB 1ZM9A 3K57A 1HWJA 2V8DA 2QA1A 1AW0A 3VVTA 3J81j 4BCAA 4YDXA 1WKLA 2K8GA 2NR0A 3H25A 4NYOA 4MIAA 2COLA 3C3LA 1NPRA 1IVZA 1H6KX 3FBBA 2RQKA 3IA0A 3TUJC 2QFIA 1LV5A 4YMEA 1CJVA 1URNA 2X1AA 4NXMJ 4WK3A 4MKYA 1JLGB 4FYVB 4ED5A 2UV8A 3RBXA 5LMUF 2FPHX 5CABA 1A7GE 2I5JA 1DTTA 3I56S 2C2KB 1VK8A 4NASA 3DN9A 1WC5A 4MK9A 2EFOA 3JSMA 4IOBA 2FVSA 1ACMB 1NPPA 2MXYA 3R1HA 2WVEA 4IDKA 4RW6A 2CQDA 1QTNB 2OFGX 4JYAF 2QSWA 1NH8A 3EPGA 5E3CA 4XPCA 4U6PA 2GVDB 3MPWA 1FVQA 2VFVA 3HHDA 3D54A 3O2IA 3S1TA 1D3WA 5KT3A 1RAGB 3FNNA 3PRDA 1S6PB 3C15A 3TQ1A 5CZVA 3F44A 1BWVA 4HL9A 3RZAA 3A3NB 2ADBA 1T95A 2JLFA 4RWWA 3QGGA 2DTJA 3GZ7A 3T6JA 3GONA 3AD9C 3DOKA 1MMLA 2DNGA 3LTOA 2OPSA 1KQSR 4OYPA 3SSSA 3H0PA 4YB6A 4ES3A 3GIRA 4ERDA 3MI7X 3UD3P 3DRRB 4WPAA 4YB1P 1PO6A 1NK7A 3M6VA 2D41A 1EETB 3D7SB 5GADU 2ABYA 3FSIA 4IH7A 1T03A 4BWJA 3VZIA 4ZS6A 1X0PA 3MD1A 1FE4A 5A8RA 3ZTRA 2F8HA 4DR6J 2L9DA 2DH7A 1I94J 3ILLA 1Q8IA 3Q0AA 2ZUAA 2CG8A 2VD3A 2A0FB 5D4PA 3EZOA 5EWEA 3CJ2A 2FZGB 5D78A 2W2NP 2VOPA 1QSLA 4DV4F 3IWNC 4NCAA 4NZ6A 4ECUA 2ZC4A 4QCLA 1B7YB 1OJ4A 1S1TB 2RUSA 2NLWA 2V67A 4OI3A 1SC3B 2BR0A 2VOOA 1FWLA 3POTA 1KHWA 2EK6A 5LL6d 3ITHB 4USUA 2J9EA 2QZ8A 1QD1A 4F67A 1BQXA 1U47A 2HVDA 2C2OB 4OHWA 3VGVA 2CPXA 2VL1A 1L5UA 4KRWA 4QU7A 5L46A 3OL6A 2YKPA 5LOQA 1JJ2R 3PRBA 3UCUP 4P52A 4B08A 3QIPB 5L8RC 3SXLA 4RWXA 2V9KA 1LW2B 2V8HA 5IT4A 4DSJA 2R8HA 2HZCA 5FLXY 3R6LB 1IR1A 2KRRA 1IR2A 1RWMB 5C25B 1WHWA 3M8YA 2CVEA 4GMKA 4ECRA 1TKZA 2XS2A 4CTAA 3FRZA 4U67Q 1ZAXA 2OD6A 2RU9A 5I42A 3W7BA 1F3VA 1RAAB 4X4RA 4Z7CA 1SKWA 2IYIA 3BO4A 3DDIA 2YNFB 2DR7A 1GH8A 1VRQC 3MAAA 5DQHA 3W2WA 2X3DA 3MCNA 1YG0A 1IQZA 2MLYA 4LRAA 1HBUA 5D3GA 1NHUA 2AJ2A 2PO4A 3R5BA 4HR2A 1VK3A 4DDFA 2NSCA 4RW7B 2YKNA 3H5YA 2DRAA 3Q8YA 5IWAF 1SPBP 4D3GA 4LRBA 3KTQA 4ZK7M 4WU3A 1U1KA 3J81U 1ZAVA 2LMIA 3CJ5A 4NL5A 2XYPB 4O44A 2AU0A 4U95A 3KK2A 3ZZOA 4NLOA 3MXHP 3BYPA 4ZVSB 2CVIA 3CJRA 1XTZA 2DR8A 3K5NA 1HD1A 2Z2ZA 1RP5A 4YDDB 2CQ1A 1S0OA 2BRLA 1BQNB 2ZDPA 2DIUA 4I67A 4W98A 2HGNA 3GU0A 1IBMF 2OEJA 1WC1A 4I69A 3V4IB 5C24B 2KTQA 4FS1A 3GPAA 2CQ2A 1D8ZA 5E0OA 2B9XA 1T3OA 3H2LA 4WZQA 2NPFA 1D8YA 2QMUB 3R5DA 4WFXA 2ZH9A 2FVRA 2FUG9 2XI3A 4ECVA 1R7IA 3TA2A 4R8UA 6FDRA 5CH7B 4OHZA 4QQBA 3C8YA 2IVYA 4ZP8A 2MZQA 1RKJA 2KZZA 3MR5A 4BBYA 4MFBA 2IIHA 5I3UA 3PKMA 2M8DB 3NGTA 1R8CA 1F9HA 3HCXA 4JI5F 3UD5A 3G71S 3KUEA 2FJEB 1DJ0A 2VH7A 1R8PA 3TRGA 1RTDB 2YWWA 2E5IA 2HNDB 1CC8A 4YUDA 3MCSA 3IN5A 2MKYA 4KH1B 4USTA 4X62F 4LFAF 2Y8YA 2XULA 4M5KA 3I9V9 4UQTA 3EGWB 4F8RA 4Y2KA 2OELA 1U45A 4AFFA 3KUHA 1VGYA 3W1YC 2QA4S 4NI2B 3CCVS 1OPZA 1HR0F 2QTWA 3MAHA 4RBVA 2CPFA 3OTCA 1RUSA 3KLFA 2QL7B 1ICEB 3NMRA 2IJNA 1R43A 2XLIA 4MIBA 3BBBA 2LU1A 3H59A 3KJFB 3DOMA 3IWLA 5T14A 4RBUA 5J2NB 2XS5A 3MF5A 3ADAC 3UVJA 1QUPA 5F3ZA 1WF1A 3O1LA 2BBEA 5CYMA 3Q8VA 1PYTA 3D6FB 1W7WA 5HVGA 3K89A 2BACA 4A8MP 1VIXA 1VQ8S 1Q4RA 4F3OA 3GLJA 4NRUA 4GC7A 5KG5A 1EAYC 3B78A 4NMLA 1HBNA 1U1MA 1JNZB 3VCDA 2DNOA 4O4GA 1N0UA 4I64A 1WD6A 1WHXA 3PX6A 3DCAA 4M5HA 4EUVA 4HVZA 2W24A 3DMJA 2XY6A 2HWIA 4IO9Q 4IFYA 4MMOA 4I6WA 2D3OR 1V9OA 3PFOA 3AB4B 4DFMA 2MSTA 5T7LB 1DAXA 1QE1B 1RWVB 3W8PA 2B5JB 1RT3B 1RU2A 2BUNA 3OPKA 6AT1B 4OJHA 2JOQA 3IR7B 1T0TV 5GMEA 1NDLA 1DTQA 2B6AA 3CSKA 4G65A 3QWUA 1QTMA 2DNYA 3NNCA 3O6QA 5B0FA 3QJJA 9RUBA 3IAM9 3LGHA 4KGMA 1KOOA 3F73A 3NAIA 1HQUA 3CO9A 2DISA 4Z7YA 2BQ3A 1OIAA 3BGLA 4F25A 4ZJQA 3OVBA 4NWBA 4ZN1A 1F5BA 3G87A 3G82B 4EO8A 1KFSA 2BE2B 4DPOA 3C19A 4CO4A 4DF8A 2QLFB 1TK5A 1X4FA 3CWJA 2VQEF 4ELTA 3V6KA 1RTJB 3BSNA 4ICLA 2MY7A 2Q6CA 2G1DA 4ZN3A 2Q3PA 4HKQA 2I1RA 3E3XA 4X4NA 3QT8A 3KK3A 4C8NA 5KAKA 5DGBA 1QVFR 3DNCA 3CDAA 3T19A 2XLJA 2ALZA 2B8QA 3KMSA 4URQU 1N5QA 4DR4J 5J1NA 1Q8BA 4HACA 3V81B 3H90A 4Y2IA 4HLBA 3LP2A 3R2DJ 2ASYA 4MJKA 4QWBA 2ZZNA 5JJBA 2ZZTA 2GW8A 2IMWP 1VQ4S 1S10A 3M30B 1RHJB 3HKWA 2HW3A 2IYGA 2HIYA 3M6WA 4YR3A 2Z30B 4EBDA 3GFXA 4I7FB 2UUCJ 2HYIB 4OYXA 2KXFA 3TEGA 2UVUA 3BSAA 3P49B 1HW9A 1VJQA 3M2UA 4PYAA 3PYDA 1JLQB 2MEWA 2ROPA 3VVUA 3B8HA 4UT4A 1HWUA 1LXNA 2ZBIA 3DXBA 2XB2D 2IC3B 2G2OA 1B0VA 1GFWB 3SFUA 2UXCJ 1FI4A 1X5SA 4FKYA 2WONA 1NK0A 1ZS6A 1YDLA 3PX0A 2MQOA 4DCPB 4M5MA 3QT5A 1FESA 1X4DA 5JMNA 2DH8A 1VBKA 5A0YB 4C11B 3D4JA 3TWZA 4OJGA 2RMLA 4JI1J 1LOUA 2OSRA 1JX4A 1VQ7S 1J5OA 4WU2A 1WWHA 4LF7F 3B82A 1VS3A 5HP1B 2HRYA 2DD8S 5A2QY 2ZC3A 4CO0A 5KOWA 4DR5F 3C6TB 4UF4A 3GFHA 4TY8A 1VCTA 5BYSA 1XMOF 3AJDA 1KR4A 1L3VA 3TUIC 3IRXB 2UUWA 2I2YA 1HYSB 1TMMA 3KLIA 2E5LJ 3BR8A 1KP6A 2V69A 3W60A 3MM9A 5BR8J 2XZDB 4IOCQ 4LBHA 2D9PA 2HMIB
chains in the Genus database with same CATH topology
3ZTSA 1NDCA 1UCNA 2ZUAA 3Q89A 5BXIA 3FBFA 5CAAA 1PKUA 4FKYA 3B54A 1NSPA 1MN9A 1S59A 1NDKA 2AZ3A 1ZS6A 4F4AA 1WKJA 3BH7B 1B4SA 2HVEA 1BUXA 1PAEX 3DKDA 3VGUA 3FCVA 1JXVA 4W98A 2DXDA 1WKKA 3JS9A 1HLWA 1K44A 1KDNA 2B8QA 3MPDA 3EE3A 3FBEA 3EVWA 3GPAA 2BEFA 3NGSA 4ANDA 1XIQA 4ANEA 3DDIA 3FCWA 3PJ9A 4UOFA 1VYAA 3EVOA 4ENOA 4F36A 2B8PA 4S0MA 1NSQA 4DUTA 3L7UA 3ENAA 1NDPA 3EICA 1LEOA 1NDLA 1BHNA 3BH6B 4O0NA 3BBBA 3VGTA 3VVTA 3ZTQA 3PRVA 1B99A 3EM1A 4UOHA 1NHKL 1NLKL 2HVDA 3WX8A 1NSKL 3ZTPA 3VGVA 3ZTOA 5C7PA 1BE4A 1WKLA 3ETMA 2CWKA 4C6AA 3FKBA 1S5ZA 1F6TA 4UOGA 1NCLA 3Q83A 4HR2A 3VGSA 3EVMA 1NB2A 1LWXA 1F3FA 3FBBA 3Q8UA 3EMTA 3Q8VA 2DYAA 1NPKA 2DY9A 4FKXA 4CP5A 3Q8YA 1NUEA 1HHQA 3Q86A 4KPCA 1EHWA 3FC9A 3B6BA 1W7WA 3BBCA 2BX6A 4DI6A 3ELHA 4EK2A 3NGTA 2HURA 4DZ6A 2NCKL 5CABA 2VU5A 1HIYA 5IOLA 1U8WA 3R9LA 2DXFA 1MN7A 1XQIA 3FBCA 1S57A 3VVUA 4WBFA 4ANCA 3NGUA 3ZTRA 3GP9A 2AZ1A 2DXEA 3EJMA 3G2XA 3BBFA 3NGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTS A;  1NDC A;  1UCN A;  2ZUA A;  3Q89 A;  5BXI A;  3FBF A;  5CAA A;  1PKU A;  4FKY A;  3B54 A;  1NSP A;  1MN9 A;  1S59 A;  1NDK A;  2AZ3 A;  1ZS6 A;  4F4A A;  1WKJ A;  3BH7 B;  1B4S A;  2HVE A;  1BUX A;  1PAE X;  3DKD A;  3VGU A;  3FCV A;  1JXV A;  4W98 A;  2DXD A;  1WKK A;  3JS9 A;  1HLW A;  1K44 A;  1KDN A;  2B8Q A;  3MPD A;  3EE3 A;  3FBE A;  3EVW A;  3GPA A;  2BEF A;  3NGS A;  4AND A;  1XIQ A;  4ANE A;  3DDI A;  3FCW A;  3PJ9 A;  4UOF A;  1VYA A;  3EVO A;  4ENO A;  4F36 A;  2B8P A;  4S0M A;  1NSQ A;  4DUT A;  3L7U A;  3ENA A;  1NDP A;  3EIC A;  1LEO A;  1NDL A;  1BHN A;  3BH6 B;  4O0N A;  3BBB A;  3VGT A;  3VVT A;  3ZTQ A;  3PRV A;  1B99 A;  3EM1 A;  4UOH A;  1NHK L;  1NLK L;  2HVD A;  3WX8 A;  1NSK L;  3ZTP A;  3VGV A;  3ZTO A;  5C7P A;  1BE4 A;  1WKL A;  3ETM A;  2CWK A;  4C6A A;  3FKB A;  1S5Z A;  1F6T A;  4UOG A;  1NCL A;  3Q83 A;  4HR2 A;  3VGS A;  3EVM A;  1NB2 A;  1LWX A;  1F3F A;  3FBB A;  3Q8U A;  3EMT A;  3Q8V A;  2DYA A;  1NPK A;  2DY9 A;  4FKX A;  4CP5 A;  3Q8Y A;  1NUE A;  1HHQ A;  3Q86 A;  4KPC A;  1EHW A;  3FC9 A;  3B6B A;  1W7W A;  3BBC A;  2BX6 A;  4DI6 A;  3ELH A;  4EK2 A;  3NGT A;  2HUR A;  4DZ6 A;  2NCK L;  5CAB A;  2VU5 A;  1HIY A;  5IOL A;  1U8W A;  3R9L A;  2DXF A;  1MN7 A;  1XQI A;  3FBC A;  1S57 A;  3VVU A;  4WBF A;  4ANC A;  3NGU A;  3ZTR A;  3GP9 A;  2AZ1 A;  2DXE A;  3EJM A;  3G2X A;  3BBF A;  3NGR A; 
#chains in the Genus database with same CATH topology
 2N4C A;  3M32 B;  2KHD A;  4PXC A;  3Q89 A;  4WE1 A;  3Q8S B;  2VDH A;  3ZZZ A;  1S0V A;  2ZVS A;  4IQX A;  1TP7 A;  3N4W A;  4I2P A;  3G9C A;  4ZVT B;  4ZMM A;  1IR0 A;  1VC0 A;  4TKT A;  3JTN A;  5B0D A;  3SZ2 A;  4DL0 C;  2QG9 B;  4KFB B;  4RW4 B;  1Y10 A;  4ID5 B;  1SUQ A;  3ZZP A;  2QC3 A;  4J9V A;  1GXL A;  3THP A;  4S0M A;  4ZPA A;  1YZ6 A;  5HJY A;  2HZA A;  3IR5 B;  2V2Q A;  4PUO A;  3KHL A;  2PGC A;  1VOM A;  4YN3 B;  1KSP A;  4EZ9 A;  2JLG A;  2MZR A;  3OR2 B;  4CLZ A;  2VPX B;  2V68 A;  2HHQ A;  4X2B A;  3MM5 B;  1N4L A;  1RT1 A;  2LEP A;  3CCM S;  1B7F A;  2DRB A;  1WF0 A;  1HWL A;  4O3Q A;  4OYO A;  1KD1 T;  5KFT A;  5IOL A;  3BGO P;  1CJT A;  2F8E X;  2BJ1 A;  1P8G A;  4P2F A;  1W25 A;  4LFC J;  1UVI A;  2DEI A;  5H9F J;  1TTH B;  3TEH B;  1C0U B;  1ZPW X;  5G0R A;  4NLY A;  3DLK A;  1LW0 A;  3H2V E;  3NCP A;  4AT1 B;  3JXO A;  3PZP A;  2DGS A;  1SQE A;  2KM8 B;  1X5T A;  1P9Q C;  3D6T B;  3ENW A;  1P6T A;  3GMG A;  1RLD A;  5KTQ A;  5KFN A;  2E5J A;  3TAR A;  2Z0G A;  1F5C A;  1OQ6 A;  2K2P A;  4EWT A;  3J80 U;  4WIQ A;  5HVF A;  3PJ9 A;  1RT5 A;  3BSO A;  1ZM2 A;  3GCX P;  4YY3 F;  3LP1 B;  4LFB F;  3D28 A;  3ZTQ A;  4ZPD A;  2VQE J;  3EM1 A;  4JUZ A;  1C1B B;  2L9W A;  2HNZ B;  2VG7 B;  3I4P A;  4OI1 A;  4IOA Q;  1NCL A;  4IO1 A;  3UE2 A;  3R6G B;  3KHG A;  2KH9 A;  2W9C A;  2AT1 B;  1ZYQ A;  2ZOF A;  3PVX A;  3I0S A;  2LFV A;  1R0C B;  4G1P A;  3E8O A;  3HI9 A;  2FC9 A;  3ZXW A;  2R8K A;  1WTB A;  1HIY A;  4URS A;  1VJW A;  3EGV A;  3WIU A;  2FJA B;  4J9K A;  4ZIV A;  1IBL J;  4MAK A;  2HG4 A;  4L3N A;  3H5X A;  4NRT A;  1UMJ A;  2XGQ A;  5JVH Q;  1GNK A;  1H72 C;  4B3O A;  2F5G A;  1VQY A;  3G6X A;  1YJT A;  1S1U A;  1R3N A;  2GMH A;  1B4S A;  4NCG B;  1YJV A;  4C8M A;  4PQU A;  4NYP A;  2UXD F;  2DNL A;  2Q1L A;  3GJT B;  5DJB A;  3FK4 A;  4JV5 F;  1I51 B;  2AGO A;  2NRE A;  2L41 A;  1U1Q A;  3BF4 A;  1ZA2 B;  1CS4 B;  4DLG A;  2ATC B;  2EVZ A;  1TL7 B;  4DX5 A;  4ENO A;  3EVO A;  1D9D A;  2P9C A;  2Y1I A;  4XAK A;  1OWX A;  2IJR A;  4Q5V A;  4ETZ A;  2YTC A;  4ZA1 A;  1CQN A;  4JI8 J;  5A6W A;  4P2X A;  3CCW A;  3IM8 A;  3MEG B;  3RAQ A;  3AXK A;  2OO4 A;  2ILZ A;  4NEZ A;  1YJN S;  2GO8 A;  4RNO A;  1LWF A;  1MU2 A;  1GAO A;  1CPZ A;  1P27 B;  2J9C A;  5F41 A;  4N56 A;  1EQ0 A;  1HI8 A;  5BXI A;  2YNH A;  2IRU A;  3G4S S;  1PGZ A;  5HJX A;  5H1S V;  3HHN B;  4HHJ A;  3UI3 A;  1FJG J;  4KJI A;  3O3L A;  2KXN B;  5AXN A;  1REV A;  2YKM B;  2JFK A;  2ADC A;  1Y4Z B;  1M5V C;  3AY0 A;  4CLS A;  1JLB B;  2F4V F;  1FWP A;  4K8R A;  2QV6 A;  4ECQ A;  3AOC A;  3HF5 A;  2QL9 B;  4RZR A;  2IAJ B;  1ZBT A;  3OQ2 A;  4DG1 A;  5GAD I;  3DRX A;  1D09 B;  2AMC B;  1UTA A;  1FDD A;  3EVM A;  3D1H A;  2EKY A;  2UUB F;  2ZZM A;  3MED A;  3IR6 B;  3FEZ A;  1Q82 T;  2IM0 A;  3A13 A;  2D74 B;  1F2H A;  1GMU A;  3CME S;  2DNM A;  1IKX A;  3QID A;  4C0B A;  1F2G A;  3BEG B;  1TL3 B;  2MKJ A;  2B56 A;  3OJS A;  3TUZ C;  1MWQ A;  2OPR A;  1XMB A;  5L1K A;  3BPD A;  5KFV A;  2RDJ A;  2GA7 A;  1JKH A;  5DDO C;  2DH9 A;  3AXM A;  3PTW A;  2AYG A;  1TL1 B;  2EXU A;  1FFW B;  4WXW A;  3L4B C;  1ROF A;  3ZZY A;  5GAG U;  3HMJ G;  2PMW A;  3SFG A;  3PY8 A;  1U6F A;  3BGR A;  2DGT A;  1EP4 A;  3PR5 B;  1FD2 A;  4ZJL A;  5HAN A;  5HMW A;  1WJ9 A;  1M1K T;  2DO0 A;  2BXJ A;  2VIH A;  3UW1 A;  2AJ0 A;  1VBX A;  9ATC B;  4ZVP B;  1YQH A;  1VQ5 S;  1Q1K A;  4NEY A;  2V0N A;  3VAJ A;  3M2V B;  4QIV A;  4TYB A;  4XPE A;  3CJK B;  4Q0B B;  2LA4 A;  1HW8 A;  3HZG A;  3NOG A;  1MSW D;  4UZB A;  3PM9 A;  3D68 A;  2E1C A;  2XEX A;  3DLB A;  8ATC B;  1EAR A;  2P6T A;  5AE2 A;  2KI2 A;  3VAK A;  1Q86 T;  4NZ7 A;  1FRX A;  3CJT A;  3BQ1 A;  5EUH A;  2FY8 A;  3GCW P;  2QYC A;  3HXM A;  3CCQ S;  2C2R A;  4OZJ A;  1TKX B;  4ER8 A;  2BM1 A;  3EGN A;  3DGP B;  5J2P B;  5DM7 Q;  2D69 A;  3I5B A;  1KVI A;  2YVS A;  1EX8 A;  2HFZ A;  4ZHR B;  4YHH F;  2M52 A;  1HQE A;  4QIE A;  1SKU B;  4PYD A;  3QRP A;  4RUB A;  4L75 A;  1HWI A;  2KT5 A;  2PA8 D;  4TY9 A;  2E5G A;  4B3R J;  3HD2 A;  1RAH B;  5CQG A;  1N34 F;  4KAI A;  3M8R A;  1NLK L;  4DZD A;  5EDW A;  4WKY A;  4LT6 A;  4ECT A;  3FKB A;  5KFB A;  1NJI T;  4DV1 J;  2VHG A;  5FII A;  3MPY A;  4GKJ J;  1FXD A;  4LF8 F;  1XNQ J;  2W4C A;  4Y0F A;  4LRE A;  4CLU A;  2AHO B;  4P7V A;  4NA3 A;  2R7S A;  4N8O A;  1PIL A;  1RIS A;  2ZE2 A;  2CNN B;  3D6H B;  4DV5 F;  5E5N A;  3KK1 A;  3ICL A;  1R8H A;  4MKA A;  1CJU B;  3DHW C;  3IGN A;  3OTD A;  5IQQ A;  2HK2 A;  2E7X A;  2WSF C;  1PBU A;  1FK9 A;  3V6D B;  3KNA A;  2VG6 A;  3KXD A;  4P72 A;  4WP3 A;  3SSQ A;  3FRY A;  3WDO A;  1FNX H;  4J91 A;  2EFV A;  3MEE A;  4RW9 A;  5K8P A;  2MQQ A;  2AV5 A;  3SDE A;  2VKZ G;  2ZM6 F;  4MKB A;  3HHL D;  2AJ1 A;  2ROE A;  2EC2 A;  4JOU A;  2J0S D;  4ZVO B;  4M63 A;  3DI6 B;  3CNQ P;  1Y5L B;  2QA4 G;  2HEK A;  4LIR A;  2BW7 A;  2ZJQ Q;  4LSN B;  1UET A;  1RT7 B;  1XNR J;  2GZO A;  2PT0 A;  1NHK L;  4LIW A;  4WTO B;  3ZO7 A;  1LWE A;  1GTE A;  1KBR A;  2GHV C;  2XCP A;  5BYR A;  4IQM A;  5K5M A;  2OML A;  2AQ4 A;  1FKP A;  2XGP A;  1O5J A;  4CO5 A;  1SBR A;  1RA7 A;  4QWC A;  5CD4 H;  5AXK A;  2OEK A;  4ZLJ A;  3NWR A;  4Q8E A;  3A8I A;  1EZZ B;  3CUN A;  4IUF A;  3JSY A;  1R31 A;  1YHQ S;  4KGK A;  1JJH A;  4CM2 A;  4AUK A;  1DAR A;  5K8M A;  4DR7 F;  4JI6 F;  2AW0 A;  2JJ4 D;  1L3K A;  4Z2X A;  3TAM A;  4IR1 A;  1NHV A;  5ETP A;  5HRO A;  4WP9 A;  3FEY B;  4ZVF A;  8RUC A;  3R3T A;  3Q2T C;  3ILI A;  1U2R A;  3BN7 A;  5IS2 A;  3CE8 A;  1DQA A;  3SIP B;  3KLH B;  1S9F A;  4WP8 A;  2FJB B;  1ZAW A;  2H4Y B;  4CIO A;  1FRK A;  3OL7 A;  2H5I B;  3IWX A;  2FQQ B;  4RBT A;  1PJ7 A;  2W4D A;  2Z2L A;  4NYZ A;  1NJW A;  3JAM U;  2ZHA A;  3GIM A;  1RAD B;  3WX8 A;  4M5J A;  1WC0 A;  3G96 A;  2CPY A;  2DHA A;  4U8V A;  2VA3 A;  2KJV A;  1M5P C;  2WOM B;  5I3P A;  3Q86 A;  4Y2C A;  3ELH A;  3R1L A;  2G0C A;  3W66 A;  2HQI A;  2BA9 A;  3QSI A;  4QYZ J;  1FJ7 A;  3W61 A;  4KT0 C;  2NXU A;  3IM9 A;  1N5Y A;  4QWA A;  1J5E J;  3DOL B;  4V19 X;  4EMD A;  3IGV A;  4IG0 B;  4OHV A;  3S01 A;  3OL8 A;  3LAN A;  2ZNZ A;  5IV3 A;  4I6A A;  4JI3 J;  3M6X A;  3R7N B;  1G6B A;  2OI2 A;  4EBE A;  2H54 B;  2Q66 A;  1XN9 A;  1Y9O A;  3TA1 A;  4NLG A;  2W4P A;  3MFI A;  3W2V A;  4ECW A;  2JEG A;  4J9N A;  3T1Y F;  3DLE B;  5DLG A;  1JB0 C;  3QJL A;  5LXR A;  3PW4 A;  1FFS B;  4ZIW A;  2U1A A;  2MHE A;  3EMT A;  1DQ9 A;  4M95 A;  2AGP A;  5HBM A;  2L08 A;  3CJQ A;  3FEX B;  5I42 B;  3QZ8 A;  2BE7 D;  2XNR A;  4OYW A;  2M7S A;  4CWB A;  4ZVE A;  2HHS A;  1HBO A;  3SQG A;  2J9D E;  3R5A A;  4HDH A;  2XSJ B;  1R8A A;  2HIQ A;  4O3S A;  1KTQ A;  3LP0 A;  3NLC A;  4IG3 A;  5LM7 E;  5DLF A;  4WJB A;  2CQI A;  2MJN A;  3GYG A;  3M2R A;  1NKB A;  5CXT A;  2Q79 A;  2CPI A;  3FDS A;  1JLE B;  4LF6 J;  4RW8 B;  4CO1 A;  3HSZ A;  3QGP A;  2DGV A;  1M0S A;  3M8Z A;  4R0E A;  1HNI A;  1M1G A;  5D0G A;  3MUM P;  4A46 A;  2FVC A;  2WCX A;  4QU6 A;  2WSC C;  3ZC4 A;  2EG1 A;  2O67 A;  5K20 B;  1G3O A;  2ZWO A;  1N8R T;  3GIJ A;  3CCR S;  2GJF A;  3UR0 A;  1OQ3 A;  2DJW A;  5LSL A;  3G6V A;  3OUY B;  1KOH A;  3UCZ P;  1TV6 B;  2V2Z A;  2RF2 A;  1MRO B;  1QAJ A;  3IG1 A;  1OYE A;  5HVH A;  4ED0 A;  1ZTT A;  3RB3 A;  3G8T A;  3JYT A;  1DUR A;  3AOA A;  4OX9 J;  1ZM3 A;  1RT2 A;  2MTL A;  2SXL A;  1U1L A;  1FFG B;  2GVZ B;  3BPS P;  3CD7 A;  3E01 A;  5CYQ A;  5DS7 A;  3RBZ A;  4DV7 F;  2YNG B;  1VQS A;  1YVF A;  1PJ6 A;  2GQC A;  2QLW A;  3KDN A;  4AD6 A;  2VUG A;  1WEZ A;  1K1S A;  3A1Y G;  2IVM A;  2CNO B;  3I0R B;  3T9N A;  4C97 A;  4O3R A;  1YRX A;  1S0N A;  2Q43 A;  1HHT P;  1HNW F;  3CCL S;  4Y34 A;  2MKS A;  4FDF A;  2JDJ A;  3FQL A;  2ZD1 B;  3MCM A;  1YKW A;  1WEX A;  3DLG B;  1V3S A;  3A3O B;  1UVL A;  3UQS A;  2CWX A;  3MEC A;  3NGK A;  2DK2 A;  2O5D A;  3HDS A;  2ZFH A;  2BQR A;  2D3Z A;  4V19 J;  5GVQ A;  2RNE A;  3LAL A;  2CQG A;  1IM4 A;  2HWH A;  3DGV A;  2BKN A;  4IFV A;  4GKK J;  1S4E A;  4JI4 J;  2XMT A;  5LJ5 Y;  5B0G A;  4LVN P;  2CQB A;  3FFI B;  4KKO A;  4LSL B;  5CZX A;  2NZC A;  1K73 T;  1HNV A;  2KT2 A;  5F8N A;  3ZNU A;  3I96 A;  3BZQ A;  2QT7 A;  4C3L A;  1RT4 B;  1N48 A;  4DL3 A;  4DR2 F;  2R7X A;  4U7C A;  4DXL A;  3U1L A;  2JH3 A;  4E0D A;  3W5X A;  4NLV A;  4FN5 A;  2A2D A;  2HBZ B;  2HNY B;  1SC4 B;  2G2Y A;  1FEE A;  3NNA A;  2P5V A;  1FHT A;  5HK4 A;  1HNX J;  2F1F A;  2UV8 G;  4IH5 A;  3AHP A;  2JEI A;  3VTI A;  2VG5 B;  5B7W A;  1ITP A;  3KUG A;  4NOH A;  3EZ5 A;  4R25 A;  4K4W A;  2R8G A;  2J9D A;  2QE5 A;  1CEZ A;  4USM A;  2LKZ A;  1X31 C;  4B9T A;  5IM0 A;  2ZUG A;  4Z37 A;  1BC6 A;  2LEC A;  3HUL A;  3QAT A;  4QJV A;  4YB5 A;  2KVQ E;  4PG8 A;  2V94 A;  3RB4 A;  1N52 B;  1RWK B;  4N76 A;  5C7P A;  1E6Y A;  2UUA J;  4BLG A;  1K47 A;  1X4E A;  1RTI A;  3IS9 A;  3ZFV A;  2N7Y A;  2RQC A;  4J9R A;  3X3U A;  4AQY F;  3ULH A;  2A6M A;  2DXF A;  5KFH A;  2H9Z A;  4OJ1 A;  4JI0 F;  2OLW A;  3NBP A;  5KT7 A;  4L76 A;  1CG2 A;  3T1H F;  3N01 A;  1SV5 B;  3MM7 B;  2YKQ A;  2C2E A;  2IHR 1;  3CGI A;  1S4F A;  3MMA A;  1IBK F;  3O5T B;  2J7K A;  4WTY A;  1U7L A;  2LQJ A;  1U02 A;  5DZ6 A;  2FD2 A;  4RNH A;  4KIA A;  3OTE A;  4UZC A;  3M1V A;  1C0T A;  2FJX A;  2CNL B;  3W5Z A;  3TZX A;  2FHM A;  2IFX A;  2W2O P;  2APO A;  2BAN B;  5KFX A;  3MHY A;  2KG1 A;  3GB0 A;  3W64 A;  1NDP A;  2E5H A;  2V8P A;  1I6J A;  1GXT A;  2RE1 A;  5HQM A;  4L73 A;  3W65 A;  4FXW A;  4USI A;  2YPZ A;  2ZEJ A;  4QIG A;  1FDA A;  1FKO B;  2QLJ B;  2Y1L B;  5DZ7 A;  1FTR A;  3KOA A;  1U2F A;  4CH0 S;  3HZE A;  3CUL A;  4CCH A;  3MFH A;  3NG8 A;  2X1G A;  5CHC B;  3P5T L;  1DLO B;  2VU5 A;  1RYR A;  2DVI A;  3WZ0 A;  4KY3 A;  1TZ0 A;  4A8O A;  3UFC X;  1WOS A;  2XS7 A;  4B3M F;  5ADZ A;  1KQF B;  4NCB A;  2OGU A;  2V9W A;  3BDE A;  3O44 A;  3U1N A;  1S6Q B;  4DUY J;  4OYB A;  2FVP A;  2LQ8 A;  2R7O A;  4F02 A;  1N54 B;  2QO3 A;  4DR3 F;  4KBI A;  3GSI A;  7FD1 A;  2DPI A;  1Q95 G;  1JLG A;  1YJ7 A;  2CJK A;  4ECZ A;  2WVB A;  2W7O A;  2GO9 A;  4DPY A;  4DUZ J;  4PZV A;  3MMC B;  4P2S A;  5M2R A;  2HFU A;  4F4Y A;  1OPI A;  1EIY B;  4LJM A;  3Q8P B;  3MM8 B;  2A18 A;  5L1J A;  3C66 A;  3M9N B;  1RWW B;  4PKD B;  3PIP Q;  3UCG A;  4LSZ B;  4JI2 J;  1RI7 A;  4OX6 A;  4WE1 B;  2R7R A;  2EBE A;  1LK7 A;  2A1B A;  1N6Q B;  5DDQ C;  3TI0 A;  2GVD A;  1YX2 A;  5IV4 A;  3KDO A;  1Y5N B;  3NNH A;  4RUC A;  4XTT A;  2XMU A;  1SQF A;  3AOD A;  1MMN A;  2PII A;  4DR1 F;  2VPZ B;  4EYH B;  4MK7 A;  2R7U A;  1S6P A;  3T41 A;  2HHU A;  2CKW A;  2ZNY A;  5D0R A;  2HFV A;  3CD6 S;  2MZJ A;  2ACY A;  3QAU A;  3NCQ A;  1JLA B;  2V4Q A;  3NOC A;  3D9B A;  3PR4 A;  3OVA A;  5GAG I;  2XMJ A;  3K7R A;  2QLB B;  1FDN A;  5F3T A;  1TR0 A;  2V2V A;  1VMB A;  3DRR A;  1U4B A;  3NMA A;  2P9G A;  5C2C A;  1EET A;  1OY8 A;  2UU9 J;  1TAQ A;  3LH2 S;  2VPW B;  4KTQ A;  4OI0 A;  5IXU A;  2LVW A;  1U1P A;  4DQS A;  2JX2 A;  5C42 B;  2MKH A;  3G6E S;  2BOP A;  3IXQ A;  5KFF A;  4B9N A;  2RT3 A;  4Q2M A;  2C2M B;  5E3A A;  1PSD A;  2YKA A;  7AT1 B;  4LVO P;  4WKR A;  3NAH A;  2MZS A;  2VFR A;  2Y1R I;  1S1T A;  4OZ5 A;  1RTH B;  4LQ3 A;  3THV A;  2OMO A;  4NLT A;  3FJ2 A;  2WBM A;  1U48 A;  1VI7 A;  1QAX A;  2DIV A;  4MH8 A;  3I5A A;  1AUS L;  3ITH A;  2BW2 A;  4C2M A;  2J6S A;  2BQU A;  4QR0 A;  2ZH3 A;  3RGI A;  1PC4 A;  4DS4 A;  5AJ3 J;  2CJA A;  2HHH F;  1UVM A;  2JC0 A;  3DYA B;  2M0G B;  3QIP A;  3M4X A;  4L3K A;  4EGL A;  3J7A N;  3O8W A;  4FBU A;  1JLF A;  3RRG A;  4F0H A;  4G6V B;  1LW2 A;  3EGZ A;  2YY3 A;  2GHW A;  3MR7 A;  1Y7P A;  3I4H X;  3AJ1 A;  3PRV A;  5C25 A;  2MY8 A;  3KJQ B;  4ES1 A;  1F5A A;  3MCO A;  4IRK A;  3MMJ A;  2FLN A;  3PIO Q;  2ZKT A;  1MG7 A;  4BC9 A;  2C3Y A;  1IBK J;  2PFD A;  2XO7 A;  1S1U B;  3K5O A;  4OI4 A;  4PQU B;  1YRT A;  3J7Y U;  3MR3 A;  1UFW A;  2R8I A;  4PPD A;  1RKI A;  2CFX A;  2ZWP A;  2IVF B;  3PW7 A;  2YNF A;  3TUP A;  4BDP A;  3L7P A;  3MWB A;  5SUH A;  2NS1 B;  4C8O A;  4NLQ A;  3I31 A;  1KLN A;  2VC0 A;  3HHL B;  1KEK A;  1N32 F;  5HQL A;  5FD1 A;  1YLX A;  2POK A;  2YX1 A;  3ZNJ 1;  3HO1 A;  4MT1 A;  3HJV A;  1AFI A;  4RW7 A;  5KFR A;  1CJK B;  4KE5 A;  1JMT A;  1XK8 A;  1NB7 A;  2B9E A;  4CLF A;  4USJ C;  4DS5 A;  1AA1 B;  4DX7 A;  1YTY A;  1U49 A;  1F60 B;  1X5P A;  4KO0 A;  1MWZ A;  2CJQ A;  2X1F A;  3GYX B;  4WII A;  1OY6 A;  2Y0S D;  4ZPB A;  2GCF A;  1BQN A;  2KDO A;  3Q8U A;  5DM6 Q;  1EHW A;  2HQC A;  1KWM A;  4CLW A;  3T9Z A;  2ZBC A;  3CW2 C;  3V4I A;  5C24 A;  3FMB A;  4B3T F;  1JWW A;  1SJR A;  2YBV A;  3M8P B;  3BN4 A;  5E3Q A;  2ZJR Q;  2EFN A;  1R6Y A;  1U25 A;  5A76 A;  3W9I A;  4O0I A;  1X7V A;  5EHH A;  2HAI A;  2YWF A;  1AZS B;  2O3D A;  1WDT A;  1VR6 A;  1H7W A;  3MGJ A;  2RB7 A;  4JV2 A;  3AA8 A;  2RQ4 A;  1WKK A;  4MYU A;  2GML A;  3H8Y A;  2IRX A;  3MOJ B;  3B4D A;  2Q6B A;  2RKI B;  3KG4 A;  3KLE B;  5THW A;  2GNK A;  1N36 J;  1RTD A;  3EIC A;  2HND A;  4GO7 X;  2R4F A;  2KRB A;  4JP8 A;  4UOH A;  1NSK L;  3S8S A;  3SI8 A;  1Q8L A;  1ZA1 B;  3A8J A;  1U24 A;  1LFW A;  2XY7 A;  5KFS A;  3VAI A;  2W01 A;  2CIM A;  3FGV A;  1RBO B;  3C16 B;  4I2Q B;  1IKY B;  2PC6 A;  2NXE A;  1XQI A;  4H4K C;  4NI2 A;  4B3S J;  2CJY B;  1N0V C;  2XM3 A;  1JQG A;  1QSY A;  1YJ9 S;  4DBQ A;  1HA1 A;  2RSQ A;  4CM0 A;  4DV2 J;  4GVB B;  1S59 A;  2RH3 A;  1V3Z A;  5ETO A;  1WEL A;  2EEY A;  4UUW A;  5J2N A;  4KH0 B;  4ED2 A;  2ZBR A;  1JXE A;  2OPP B;  2VFT A;  2GGP B;  4F3Q A;  2R2U A;  3MPD A;  4DCO B;  2B4O A;  1EJ7 L;  4DV3 F;  2CQ3 A;  2AP6 A;  8AT1 B;  1LNQ A;  1H74 A;  5DG8 A;  4ID8 A;  1S1V B;  1M90 T;  1IKV B;  2J6T A;  2W9A A;  2AX1 A;  3RAX A;  4K7Q A;  2ASJ A;  1NUE A;  4H4O B;  3JTP A;  3WHI A;  1OSC A;  1Z4U A;  2FY1 A;  4OJ3 A;  6FD1 A;  2FZK B;  5HMX A;  2UUT A;  2P6S A;  5T7L A;  2IRY A;  4LF5 J;  1QE1 A;  1Q7L B;  2B5J A;  1RT3 A;  1LFP A;  5HN0 A;  2ZVI A;  2YQ0 A;  1CC7 A;  2ASL A;  4NLR A;  4KHP F;  5CCM A;  3FZB A;  3K5P A;  4JV0 A;  2BMB A;  3L95 X;  4CQ1 A;  3HX9 A;  3T5K A;  2KXH A;  2VB6 A;  3M8S A;  5AXM A;  3AA9 A;  1HMV B;  4I0W A;  4ILR A;  2B51 A;  2RDI A;  3CMA S;  3NL0 A;  3EVW A;  4FS2 A;  7FDR A;  3G82 A;  4AND A;  4K4Z A;  4OFZ A;  2BE2 A;  3OTO J;  1FRL A;  1PYO B;  2DGU A;  4RJV A;  3X1L B;  4OIX A;  2JL9 A;  2HHV A;  2AWZ A;  2NUH A;  2HVI A;  4WZM A;  1RTJ A;  1YIT S;  5B0A A;  2CPD A;  4X66 F;  4O3N A;  1RBL A;  1F3F A;  2E1R A;  2XTJ P;  2BM0 A;  3G8Q A;  1U6B A;  4P75 A;  2C42 A;  4M5G A;  4PR6 A;  5IC4 B;  3CDU A;  4HHH A;  2MGZ B;  3K17 A;  2IBK A;  1ULR A;  1VRU B;  3ENQ A;  4NXN F;  4NLU A;  3OR1 B;  3RG6 A;  3V81 A;  1DZ5 A;  3ISN D;  3EJM A;  1C1C B;  2RJZ A;  4EO6 A;  2DPJ A;  3MUV P;  4K0K J;  2VQF J;  3KHH A;  3QJP A;  3GQC A;  3IFE A;  5DQI A;  3FBF A;  2E7V A;  2N82 B;  2H1Y A;  2HBR B;  3IBF B;  4EI2 A;  3M30 A;  4TU9 A;  4TU7 A;  4TN2 A;  1VQO S;  3PW0 A;  2VZ9 A;  3HT0 A;  2UXB J;  4I7F A;  4ZLL A;  1HLW A;  5E7O B;  4LBP A;  3JQK A;  2G0J A;  4I68 A;  1KQG B;  1WC4 A;  2E9Z A;  2KL8 A;  2IA0 A;  4KV8 A;  3P96 A;  1JLQ A;  2X3G A;  2QFJ A;  2DR6 A;  4FNH A;  4CO2 A;  4HTJ A;  4B9L A;  2IC3 A;  4B3T J;  3GSD A;  1CLF A;  3HVT B;  2M88 A;  1DFD A;  3T6B A;  1OS5 A;  3SV4 A;  5HSP A;  4MYT A;  3BRE A;  1RWU A;  1I5O B;  5KT4 A;  5K14 B;  4CNY A;  3UN5 A;  3NGD A;  4K59 A;  4LF4 F;  2C3M A;  4LR9 A;  4J9O A;  3UDE A;  2DNQ A;  5ETL A;  5LMN F;  2W2Q P;  3AT1 B;  2RDD A;  1FD8 A;  3J81 Y;  4QWE A;  1N33 F;  3RBD A;  1RQ0 A;  5A0Y A;  4C11 A;  4JBC A;  1NBE B;  4ZCK A;  1UCN A;  2N7C A;  3AQO A;  2P2C B;  1T9W A;  4Q44 A;  3SSR A;  4W92 B;  3CTR A;  2H5E A;  2DGQ A;  5HP1 A;  3MM6 B;  4OHX A;  1RZM A;  1VC5 A;  5LMU J;  3C6T A;  2Y8W A;  2AYB A;  4WFA Q;  4ZPW R;  3PKY A;  4F4W A;  1S1X B;  3M6U A;  3IRX A;  2MKK A;  4P7T A;  4WFY A;  2BJD A;  4M5I A;  1HYS A;  4DV0 F;  3H42 A;  1T9V A;  4K50 A;  4DSL A;  4PAA A;  4QWD A;  4JYA J;  3KG0 A;  5EX0 A;  3BO3 A;  2JEJ A;  4ZVH A;  4NLD A;  3R2C J;  2HMI A;  3M32 A;  3VAG A;  2KO1 A;  2LXI A;  5EWF A;  2GJ2 A;  3ETM A;  3CCU S;  2CWK A;  1SJ4 P;  2MMY A;  2W8L A;  4UUX A;  4LF9 F;  1JLC B;  2HHX A;  2QGF B;  1YI2 S;  5E3P A;  2OD4 A;  2I0X A;  1JXL A;  4C98 A;  3DM2 B;  4R0J A;  3QT6 A;  1YZ7 A;  1WAC A;  1KTV A;  1NJY A;  4KFB A;  2AZ1 A;  3QLH B;  4RW4 A;  2LYV A;  1E6V B;  4OZL A;  3L09 A;  4ID5 A;  1RGV A;  3UD4 P;  2JRS A;  4JB8 B;  4QW8 A;  4GVL A;  4WFN Q;  3QPI A;  1GXU A;  2F7V A;  2FHJ A;  3P45 B;  4J7C A;  3W8G A;  4Y6I A;  2JNJ A;  3CB4 A;  2CJ9 A;  4USH A;  1RHK B;  2VDI A;  3VGU A;  1URR A;  1VQM S;  3ONQ A;  2MZT A;  3OR2 A;  2R8J A;  1XR7 A;  3DRP B;  3OXL A;  2QMX A;  3C6U B;  4N5S A;  3MM5 A;  1JJ4 A;  3ET6 B;  4C4W A;  4KC5 A;  2ZH1 A;  3K58 A;  1SQG A;  1UEV A;  2RVJ A;  4UOF A;  3HFV A;  1M5S A;  4DV4 J;  2MQN A;  2F65 A;  1C0U A;  2V4J B;  2EK1 A;  2VBZ A;  1RWP B;  2YNI B;  2W9B B;  2QX0 A;  4ZP7 A;  3BYR A;  4RKU C;  5CYJ A;  4DQR A;  3LAM A;  4ED8 A;  2HFS A;  3S7R A;  1R0A B;  4E8U A;  3LW5 C;  5K8O A;  2DNK A;  3FQK A;  3SQG B;  3MTK A;  3PNI A;  2CQ4 A;  1YBT A;  5H9E K;  1PC5 A;  5F0U A;  2HQ3 A;  2GC8 A;  2XHC A;  2AYM A;  4G1Q B;  4DFK A;  2FJD B;  3LP1 A;  4OYI A;  2XZW A;  4JI7 F;  2OTJ S;  1WEY A;  3NEK A;  3N9U C;  1C1B A;  2YWG A;  2HNZ A;  2VG7 A;  3NWG A;  2XNQ A;  2ZKU A;  1O0P A;  1U1O A;  4W4M A;  2RRB A;  2PMZ D;  1UP1 A;  1OSD A;  1CUL B;  1A6L A;  2C28 A;  3AOB A;  4TQS A;  3PJX A;  5G4D A;  2Y3Y A;  2HFO A;  5DO2 A;  4NXN J;  4HH1 A;  1RK8 A;  3KYL A;  1DQ8 A;  1O8B A;  3Q8Q B;  5ETV A;  1NME B;  1FWK A;  2NQP A;  1HNZ F;  2IDE A;  2K06 A;  1G7C B;  3RW7 A;  2EWH A;  4NCG A;  1FXL A;  4C8K A;  1X0F A;  3B6B A;  3QT7 A;  3Q24 A;  1WF2 A;  3MZI A;  1RWO B;  2ZIT A;  5A8W B;  1U8W A;  5L1I A;  2RAQ A;  1BWE A;  4J5O A;  1CS4 A;  2VC1 A;  2A6O A;  4ZVG A;  2RU3 A;  2EFQ A;  1TL7 A;  3HPO A;  1UJ6 A;  3SCI E;  4ED4 A;  3I5C A;  5IWA J;  4QYZ K;  2UVR A;  1HD0 A;  2I9S A;  2FTR A;  3QSY B;  3BKU A;  1S7H A;  3MMB B;  2BYC A;  3BQ2 A;  5DDR C;  4NMX A;  2UVV A;  4F4K A;  3TR5 A;  3MEG A;  1IKW B;  4QIW D;  3RAM A;  3NGS A;  4CLL A;  1FXR A;  5KFQ A;  4LF4 J;  4KYZ A;  4NXM F;  2VBY A;  1TMJ A;  3TVY A;  3A12 A;  1GT8 A;  1BHN A;  5L38 A;  1N33 J;  4ALZ A;  2FYX A;  4B9V A;  3UN2 A;  4UTG A;  1IBM J;  1WSR A;  4CRJ A;  4C8L A;  4A48 A;  2XZT B;  4DV6 F;  1XMQ F;  2DY9 A;  4FKX A;  4ED6 A;  2HAF A;  2XY5 A;  2CQC A;  2YKM A;  4A8W A;  3QRR A;  3GG1 A;  1MN7 A;  2MZ1 A;  4X64 F;  2DB1 A;  3GFY A;  3TVK A;  1X9W A;  4K4U A;  1JLB A;  2DXE A;  1H73 A;  1T9T A;  1SC6 A;  2VJV A;  4DV0 J;  4KKO B;  3I55 S;  4ECS A;  1NK5 A;  2XYH B;  1NM2 A;  2LLZ A;  3H2U B;  2IAJ A;  3OSN A;  2YPY A;  4F4Z A;  3D1Q A;  1T8E A;  2FGC A;  2LEB A;  1TUW A;  3TAQ A;  1TUG B;  4JI5 J;  1XC9 A;  1GX5 A;  5HL7 Q;  2XHW A;  3WIV A;  1SXL A;  2BKP A;  2HS4 A;  1X4B A;  4KHM A;  3LO3 A;  3BM7 A;  1WI6 A;  4RU9 A;  1S97 A;  1UPP A;  3OXG A;  4CO3 A;  2DNP A;  3KLV A;  4CLK A;  4X62 J;  4LFA J;  1UVN A;  4EFA C;  3VGT A;  3R8Y A;  1TL3 A;  5GMD A;  2K1R B;  1FX4 A;  4DR6 F;  2ZDO A;  4C8Z A;  3GV5 B;  1TAU A;  5KG2 A;  1NH7 A;  2ZH7 A;  2XG8 A;  2PE8 A;  2D3O 1;  3IMQ J;  1HR0 J;  3M8W A;  1BQM B;  4O4R A;  1HWK A;  1V6H A;  2MKI A;  4DJB A;  2ACM A;  3QGH A;  5D15 A;  2OFH X;  3RBE A;  1BGX T;  1FA0 A;  1TL1 A;  2VIC A;  2J7W A;  4FP9 A;  4ZLP A;  3FUY A;  2RS8 A;  1LK5 A;  2YXL A;  2FHJ D;  2RHQ B;  3IO1 A;  3D2W A;  3UNG C;  4OQJ A;  5J2Q B;  4TQR A;  1J2V A;  2GS8 A;  3OSP A;  5HMZ A;  4A4J A;  4EBC A;  2DHH A;  4YR2 A;  1UVK A;  3M2V A;  2DR9 A;  5J2M B;  4EEY A;  3CJK A;  4Q0B A;  4F50 A;  3DRS B;  1GTH A;  1PJ5 A;  1P9Y A;  4OZ2 A;  4A8X A;  2FB0 A;  2Z2M A;  3PEJ A;  1TFW A;  3R97 A;  3EUN A;  1AFJ A;  3L7U A;  4PWD B;  1BY9 A;  4QPX A;  4DEZ A;  2OPQ B;  1XWL A;  3PDN A;  3HHE A;  3T5L A;  4A47 A;  1N5V A;  3OVS A;  2V34 A;  5B0B A;  4I6Y A;  4DHV A;  3D0G E;  5KT6 A;  2FLO A;  5M2P A;  3WC0 A;  1TKX A;  1HL6 A;  1NJX A;  2NCK L;  3DGP A;  3OFF A;  3PYG A;  1WHV A;  2BJ7 A;  3V6H A;  5J2P A;  1S79 A;  2OKQ A;  1NK6 A;  2KVI A;  5E2Q A;  3RRH A;  1S9E B;  4ZHR A;  1T9Y A;  5KFG A;  1VIS A;  3UDV A;  2XMM A;  3GYN A;  1UJ5 A;  1WI8 A;  5FDL B;  4J9L A;  2OHD A;  1F9F A;  4G1I A;  2ILY A;  1U0S A;  2OP5 A;  2OJ3 A;  3KJV B;  3NS5 A;  1RT6 B;  1YIJ S;  1XIQ A;  3J80 Y;  3A4T A;  4OL8 A;  1QJH A;  4LBI A;  1CJU A;  5F8I A;  3GG0 A;  5KFY A;  3OT9 A;  3UNY A;  4YP3 A;  2HK3 A;  1S49 A;  3V6D A;  4MIW A;  1NB2 A;  1NAQ A;  3PV8 A;  3TO8 A;  4CP5 A;  2GAH C;  5F8G A;  2HBY B;  2JZ5 A;  2BVZ A;  5KT5 A;  4RO0 A;  3R9L A;  4BC7 A;  4Y2A A;  3HK2 A;  3NRB A;  5J1E B;  3GP9 A;  3UWT A;  2K7K A;  2V8V A;  3MPV A;  3ZZR A;  2J0Q D;  1EQM A;  2FJV A;  3DI6 A;  1KQK A;  1TVR B;  1X60 A;  4LSN A;  1RT7 A;  1NDK A;  2WB4 A;  4F4A A;  5EGY A;  3D3B J;  3G86 A;  1TKT B;  2UP1 A;  4GRS A;  1KRP A;  5DG9 A;  1D0E A;  4DSE A;  1QSS A;  1RAB B;  2C2N A;  3OFH A;  1Z1Z A;  4DV6 J;  1XMQ J;  5KOX A;  3CJ3 A;  2H51 B;  4N8N A;  2FIU A;  1UWB B;  1CBK A;  3IP0 A;  1LWC B;  1HBM B;  1AXQ A;  4AXI A;  1S9G B;  1NSQ A;  3SQO P;  2Z8Q A;  4X64 J;  4KGV B;  4E2F B;  3BH6 B;  3KNG A;  4HYK A;  1RHM B;  1C4C A;  2C22 A;  3TJ8 A;  5KG0 A;  2H5J B;  3M8Q B;  1YWX A;  1UA0 A;  1RTZ A;  2FJW A;  2R2T A;  4QBU A;  1VRT B;  4TU8 A;  1M5H A;  1KLM B;  1UEU A;  3FCH A;  3FC9 A;  5HLF B;  3IBC B;  5EX3 A;  2FLL A;  2HLT A;  1LKZ A;  1VQ6 S;  4LF7 J;  1RCX B;  3KLH A;  4H4M B;  2YX7 A;  4CYU B;  1UZH A;  2PN6 A;  1T7P A;  2CYY A;  2YWK A;  2ZHO A;  2KHC A;  4DR5 J;  2HVH A;  1XMO J;  2KJW A;  2ASD A;  1WG5 A;  4DSI A;  4DL6 A;  2XLK A;  4HHU A;  3P3D A;  3CDB A;  4UQG A;  4QIF A;  3VAL A;  1CSJ A;  1GK8 A;  3BS9 A;  2QL5 B;  5KFC A;  2WOM A;  2W1B A;  4GO5 X;  1REG X;  3BKT A;  4DQQ A;  1VLO A;  2E1P A;  3CXC R;  2V5H G;  2E1M C;  3P8B B;  3UDL A;  1QAI A;  3DOL A;  2MPU A;  2NPI A;  5B08 A;  2BRK A;  3LWM A;  2AD9 A;  3HSD A;  4IG0 A;  3TYT A;  4ED7 A;  1KC8 T;  3HFZ B;  3I6P A;  2DRD A;  3D67 A;  4DI6 A;  3IBW A;  4DF4 A;  5FLX U;  1R89 A;  4WBF A;  3V4M A;  1K0V A;  2ZH6 A;  5KG6 A;  1X4H A;  2NXC A;  3P5B P;  3R5C A;  1KON A;  2AJF E;  3U7J A;  1NKE A;  1JLF B;  3C14 B;  2XC9 A;  1RBA A;  3P6Y C;  3DLE A;  4LR8 A;  1VQP S;  1XJW B;  4CNZ A;  2ZH2 A;  3CPW R;  2Y1J A;  1IWA A;  1RXO B;  3JS9 A;  4FF4 A;  3KLG B;  3HHL C;  3QGI A;  1FJE B;  1SL1 A;  2YH1 A;  4WXO A;  3EX7 B;  5L1L A;  2WHO A;  3JTO A;  2BAB A;  3M9M B;  4PWW A;  5D4N A;  4X4S A;  1FNO A;  3WX4 A;  1VIO A;  2I38 A;  4H54 A;  4FYW B;  3RRK A;  4PG6 A;  2IM2 A;  1CQM A;  2MLX A;  2LXF A;  1FJC A;  3BGU A;  2N3O A;  5HI7 A;  4KPC A;  2XSJ A;  5A8K B;  4C0H A;  4LF1 A;  3GJR B;  4YY3 J;  4LFB J;  5C5J A;  3I32 A;  3W5Y A;  1FF2 A;  2ZOM A;  4DR4 F;  4FBT A;  2HZV A;  3BR9 A;  2B3T B;  2J0X A;  4ECX A;  4OI2 A;  2VFS A;  4AXJ A;  2AZ3 A;  3Q23 A;  2E66 A;  1JLE A;  4RW8 A;  2XWX A;  3M05 A;  1TL4 A;  2IMO A;  3K5M A;  1VBZ A;  1FKA F;  1T3N A;  3TAP A;  2DNH A;  1TK0 A;  2PMH A;  1NRK A;  4KO0 B;  2JVR A;  1R0B G;  1VHI A;  2R9L A;  4DL4 A;  2UUC F;  2C3O A;  3GJS B;  5AE1 A;  2HHT A;  4DL5 A;  2CZ9 A;  2VBX A;  2KB2 A;  4F4X A;  4M5D B;  3OUY A;  3SV3 A;  2UXD J;  1H2V Z;  1TV6 A;  3ZTP A;  4JV5 J;  1MRO A;  3QO9 B;  4R5P B;  2UXC F;  2CQP A;  3R7B B;  1B70 B;  4A8S A;  1LWX A;  4U7U D;  2M70 A;  1S1W B;  1SJ3 P;  1T05 B;  3V2U C;  1U0H B;  4YOE A;  3AD7 C;  2HUR A;  1K9M T;  1HPZ B;  3L9Z A;  1TKD A;  2BJE A;  5F8H A;  1UVJ A;  1QUV A;  4ANC A;  3Q8R B;  3J7A 1;  3N6N A;  4C3M A;  2GVZ A;  2E29 A;  1SKR A;  3TZW A;  4OLO A;  4ZVQ B;  4ETX A;  3I87 A;  4JI1 F;  2YNG A;  4NZ0 A;  4OYM A;  4QW9 A;  4U96 A;  2KFZ A;  4DMZ A;  3I0R A;  5RUB A;  1CJV B;  3JQM A;  2AJQ A;  2QJ3 A;  5IZH A;  4PQA A;  1YJU A;  5MAO A;  3EPI A;  2I5J B;  1DTT B;  1UW4 A;  3VAM A;  2Z2Y B;  1TU0 B;  1UZD A;  4FVM A;  3JSM B;  5T41 A;  1SIW B;  1PCA A;  1F1B B;  4YFU A;  4Q2L A;  4YS2 A;  1KS2 A;  4N47 A;  4CZC A;  2ZD1 A;  4IDK B;  4RW6 B;  2Z56 B;  3DLG A;  2E5L F;  2HRU A;  5KFJ A;  5BR8 F;  3GFZ A;  1B0T A;  4PG4 A;  3T3F A;  4K5S A;  4B02 A;  4ZCI A;  1ZZN A;  2GHP A;  4K2X A;  3K8V A;  3QYY A;  5ETT A;  2FLP A;  1WUU A;  4PPZ A;  2F4V J;  3C15 B;  1PAU B;  5D8H B;  3C2P A;  1GMV A;  3PX4 A;  3W63 A;  3OLB A;  3FFI A;  4LSL A;  3DOK B;  2OPS B;  4DPT A;  4DFJ A;  3CCZ A;  2WRM A;  3RW6 A;  2LU2 A;  2DGO A;  1B64 A;  2UUB J;  3KWM A;  3CJS A;  3TW0 A;  1RT4 A;  4J9U E;  2OIH A;  4QPT A;  4FVC A;  5D4O A;  4LRD A;  2U2F A;  1T03 B;  3DDK A;  1HQ2 A;  5A8R B;  3BKF A;  2KZM A;  2DHS A;  3AAW B;  2HNY A;  3MUT P;  4LRF A;  3N28 A;  4LFC F;  4J90 A;  3CIZ A;  3JAM Y;  3UPF A;  1TL5 A;  1BE4 A;  1I3O B;  5IT9 Y;  1IJF B;  2VG5 A;  3BDP A;  3QFH A;  4NE9 C;  2LDI A;  1NPK A;  4HH0 A;  2V8G A;  1FER A;  4YB7 A;  5DG7 A;  4CLY A;  3POT B;  1O51 A;  3CVK A;  3RJM B;  1DHM A;  3CC4 S;  3B4M A;  3PW5 A;  4CT9 A;  3OW2 R;  1UJ4 A;  1H38 A;  4RU2 A;  1QVG R;  1ZZF A;  1S48 A;  5L9N A;  1FRM A;  1OMS A;  4DL2 A;  4G3I A;  4DU8 A;  1RAI B;  2DNN A;  5DDP C;  5KG7 A;  2MDA A;  2A10 A;  4OV1 A;  3BV8 A;  5CA5 A;  1SKS A;  2K7J A;  2KU7 A;  4RUA A;  4F2S A;  1YBU A;  2OEM A;  2ALY B;  3BB5 A;  5KFU A;  5GAE U;  5DRK A;  4TLR A;  4DUT A;  3OHA A;  3CC2 S;  3MD3 A;  3M7V A;  4RL1 A;  2BJ8 A;  4WCE Q;  3D66 A;  1HKA A;  1IBL F;  1SV5 A;  1TKZ B;  4N77 A;  3KJN B;  4CTA B;  4F26 A;  4PXB A;  3GTY X;  3LAK A;  3MM7 A;  3PAC A;  2GQQ A;  3Q83 A;  4E98 A;  2RRA A;  4V1A k;  5LXY A;  4C8Y A;  3E51 A;  4YHH J;  1S76 D;  1V3R A;  3DU6 A;  3D6M B;  2I6W A;  1RHQ B;  2HKE A;  3QWP A;  3HT3 A;  1S57 A;  5ETN A;  3MAA B;  3W2W B;  1N34 J;  3VAH A;  3V5R A;  1Q53 A;  4USK A;  4P9S A;  4CLP A;  2BAN A;  1HBU B;  5D3G B;  5GAH U;  3D0I E;  1XR6 A;  2AEM A;  4KV8 B;  1ARO P;  2WVC A;  1WC6 A;  2CZ4 A;  4B17 A;  5M2U A;  4LF8 J;  1Y00 A;  2YKN B;  4J9M A;  1BXN A;  3RR8 A;  3OFE A;  1RAJ A;  2OH2 A;  1FKO A;  4OHY A;  3OD2 A;  4DV5 J;  1Y0H A;  4O44 B;  3H40 A;  4JI8 F;  2HBQ B;  3KK2 B;  1KFD A;  2ZH4 A;  2PI5 A;  4YEA A;  1DLO A;  3KFW X;  2WBR A;  1NZA A;  1NK8 A;  1MW7 A;  1UFK A;  5A2Q U;  5FJ4 A;  3D3C J;  3CJ0 A;  3OXF A;  2RS2 A;  4MKV A;  3QFW A;  2W2P P;  3KMQ A;  1TUV A;  3GIL A;  3EWG A;  2ZM6 J;  2YQ3 A;  1S6Q A;  2AIR B;  4DWI A;  3LQV A;  1YJR A;  1FJG F;  3GV7 B;  1H98 A;  2EKN A;  4MK8 A;  1PBA A;  4CI0 B;  2HS3 A;  2VV5 A;  1LXJ A;  4OZN A;  4NX9 A;  3MPU B;  2A3J A;  2MQM A;  4R8U B;  3MMC A;  2LQ9 A;  3R5J B;  4CH7 A;  2YQ1 A;  2F3J A;  1Z2L A;  2WK4 A;  4MFB B;  3MM8 A;  1GEH A;  3FCV A;  1RAF B;  5I3U B;  4GC6 A;  4F3M A;  2GMJ A;  1B0P A;  1SCJ B;  2VBW A;  4X65 F;  4CLT A;  1FNM A;  2R7W A;  1SH3 A;  1N6Q A;  2EFP A;  4DR7 J;  4JI6 J;  4ZCL A;  3JSB A;  4ELV A;  2LCW A;  3FCW A;  5KFO A;  2CQH A;  4FPI A;  4RNM A;  3PYF A;  2DGX A;  1YRU A;  1LEO A;  4NLP A;  2WAQ D;  3U1M A;  2CA9 A;  2HQG A;  1UEK A;  4U9R A;  4UY8 5;  3DLJ A;  2D7S A;  4F7V A;  1JLA A;  1APS A;  1D9A A;  3RTV A;  1UL3 A;  3HJF A;  3CD0 A;  2AKW B;  3KLF B;  3MR2 A;  4OMF G;  3CCT A;  4FYY B;  3QNW B;  4U7U K;  2CPZ A;  1Z2Z A;  2F40 A;  5HAO A;  4XIU A;  3K2Y A;  3DOM B;  2VOD A;  3ZZU A;  2LQ5 A;  1WOR A;  3JB9 k;  2E7W A;  3UVJ B;  3MUR P;  2CJX B;  2KFY A;  4KGZ B;  5C42 A;  3DXS X;  3LA0 A;  2AYE A;  5CYM B;  4O3O A;  1V5I B;  1U26 A;  2O1P A;  5IC6 B;  4P10 A;  3DFE A;  1Q78 A;  2YWH A;  3CCJ S;  4PXD A;  2XBP A;  1HBN B;  2AEF A;  3LGN A;  4O4G B;  1RTH A;  1NSA A;  2FDN A;  5D4L A;  4AE5 A;  3BSC A;  2X51 A;  3JQJ A;  3DMJ B;  2G9O A;  4I4B A;  1UAW A;  4A8K A;  2GV1 A;  4IFY B;  4OZ0 A;  2IA6 A;  4DPU A;  3D1O A;  2WZ1 A;  4P71 A;  3H4D A;  2BJ9 A;  4EZ6 A;  2CAD A;  4TVA B;  5IT0 A;  2JSX A;  3N5F A;  3VAF A;  3CIM A;  2HQF A;  2MKC A;  3DYA A;  4PEO A;  3T1Y J;  4IR9 A;  1EB0 A;  1DTQ B;  2B6A B;  3DLH A;  2O66 A;  4EU0 A;  2ERR A;  1W26 A;  2LDY A;  4A8Q A;  3MEK A;  5HMY A;  2YWE A;  4ZJO A;  2NZ4 A;  3T5J A;  4Q45 A;  1HQU B;  5F8M A;  5CD4 A;  2W7A A;  2QEX S;  1WKJ A;  4HDG A;  1W2B R;  4B3R F;  4HEA 9;  3ETO A;  5L39 A;  2W7P A;  2MQP A;  4KR0 B;  1U6Z A;  5EN1 A;  4K2J A;  1ZET A;  2XMW A;  4DV1 F;  2XWY A;  4NA2 A;  4WK1 A;  4Y3C A;  3Q2S C;  4NLS A;  3G8S A;  4GKJ F;  4B9U A;  3GWC A;  1XNQ F;  4ICL B;  2EI5 A;  1ZTW A;  1KVJ A;  2CUY A;  4O23 A;  4K4X A;  3KK3 B;  2DNZ A;  1H3D A;  1IUJ A;  2JWN A;  2DT9 A;  2B7C B;  3LPY A;  3HHL A;  4X4P A;  1X4C A;  2JLE A;  1H2T Z;  3H7H B;  4LMZ A;  4HAC B;  2E9T A;  2OTL S;  4EK2 A;  2QLX A;  5KFM A;  3LP2 B;  4Y65 A;  2ZBQ A;  2HLU A;  2BJ3 A;  1KKH A;  2GQ2 A;  1CJK A;  1FO1 A;  2X1B A;  1X8D A;  3VZH A;  4QZV B;  3F41 A;  2VF3 A;  1X5O A;  1WNE A;  3ILO A;  2E1A A;  2FHO B;  4DL7 A;  3FVY A;  4M8L A;  2WSE C;  3MTJ A;  4LUB A;  3CED A;  1XNR F;  2KN4 A;  3WBZ A;  5AXL A;  1JXV A;  3IRW P;  4KB7 A;  1Q7Y T;  1N88 A;  3FSX A;  2CPE A;  3M2U B;  1M5O C;  4I56 A;  1C4A A;  5LT5 A;  3PFE A;  3BQ0 A;  3HFK A;  2GJI A;  1IN0 A;  3N6L A;  1U2C A;  2WON B;  2MQ8 A;  1CVJ A;  1RAC B;  1A9N B;  3I82 A;  3CO0 P;  2PSZ A;  3AB2 B;  3M8P A;  3VHQ A;  3W9J A;  3DC2 A;  2HQD A;  2FGO A;  3ENV A;  1AZS A;  3WQP A;  1VQK S;  2J7U A;  4AYB D;  1C2P A;  4ZOS A;  4DV7 J;  2GIF A;  3KHR A;  3CCS S;  1IWG A;  2ZBP A;  3A8E A;  5KFI A;  1J5O B;  5HO4 A;  2XMV A;  2XMK A;  4X65 J;  1K0T A;  2DKO B;  4QOT A;  2AF6 A;  4OZ1 A;  2N3L A;  4IYQ A;  1B3T A;  2RKI A;  4B9S A;  3KLE A;  5U47 A;  1HNW J;  4TY8 B;  1MN9 A;  1TK8 A;  1IXK A;  2V4R A;  3SCK E;  4U8Y A;  2IDL A;  2W25 A;  3TX8 A;  3CDE A;  1F0X A;  2PD1 A;  4P6Q A;  3FMW A;  1TQL A;  4RNF A;  3W3S A;  2L48 A;  3LPE A;  3THT A;  3KLI B;  3ZZT A;  3C16 A;  4I2Q A;  3MM9 B;  3LOU A;  5E3R A;  1IKY A;  2ZH8 A;  3TNV A;  3TVZ A;  2VJU A;  1RB0 A;  3HSJ A;  1SH2 A;  3VV2 B;  2E9R X;  3D0H E;  2M2B A;  2H48 B;  1P1L A;  2KG0 A;  2R2S A;  2HFN A;  3H98 A;  4O0N A;  3HP6 A;  1KHV A;  4I2P B;  1M1H A;  3RB6 A;  4JV1 A;  1VBY A;  5KFZ A;  4GVB A;  2DO4 A;  1J5E F;  3VGS A;  1X9M A;  4HI2 A;  3QRQ A;  3C46 A;  1SI9 A;  5DGA A;  1HHQ A;  4J9P A;  2D9O A;  4FYX B;  2CG4 A;  1SUQ B;  2OPP A;  3NCR A;  2GGP A;  3TA0 A;  2XCA A;  4ZVU B;  2KYZ A;  4JI3 F;  1Q5Y A;  4X4T A;  4PUO B;  3BBF A;  4DR2 J;  1SC1 B;  1RYS A;  1NDC A;  1S77 D;  2C3U A;  1KN6 A;  4FXV A;  1FRH A;  1I1G A;  4TNO A;  4DSK A;  1S1V A;  1RT1 B;  1U8S A;  2AGQ A;  2DY1 A;  1IKV A;  2EW9 A;  2H3E B;  2XMA A;  1YJW S;  1S99 A;  1IJE B;  4X4U A;  2JC1 A;  3SCJ E;  1CJT B;  4W90 B;  3PXG a;  1O6X A;  3NKY A;  1QAY A;  3TJ9 A;  4H4O A;  1IM6 A;  4CT8 A;  2IJF A;  1FVS A;  4USV A;  5G0R B;  1R27 B;  3DLK B;  1LW0 B;  3J7Z 5;  1VQ9 S;  4OLP A;  1HI1 A;  1S7I A;  2EC0 A;  4QR2 A;  2HS0 A;  2BKO A;  3QBC A;  2HHW A;  4QR1 A;  2JFD A;  2RUG A;  3TZY A;  1GX6 A;  4Y28 C;  3KG1 A;  1Q5V A;  3DLL Q;  3GR0 A;  3BBC A;  2IY5 B;  3PCO B;  2R3V A;  1HMV A;  2NUU G;  5B09 A;  1KVK A;  1ZPV A;  4PG5 A;  4J37 A;  5KFL A;  1RT5 B;  5D0E A;  2ATL A;  2VPY B;  2CPJ A;  4DPX A;  4J9Q A;  5KG3 A;  1G1X A;  3CC7 S;  1WOO A;  4RLE A;  2W9C B;  3JSR A;  2Z58 B;  2HVE A;  3OHB A;  3I0S B;  2LP4 A;  1OO0 B;  4AQY J;  4LF6 F;  4KQZ A;  4JI0 J;  1LQ9 A;  1N56 A;  3T1H J;  3PW2 A;  4UW2 A;  2DCU B;  2MGZ A;  2L3M A;  2XSF A;  1VRU A;  4B3O B;  2JEF A;  4ECY A;  3DRY A;  3OR1 A;  2J6U A;  1XR5 A;  3H5U A;  5GMK a;  1C1C A;  1SH0 A;  2G4B A;  1WTF A;  3OL9 A;  2M4M A;  3ZTO A;  5JXS A;  1UFL A;  2B9Y A;  1L3T A;  3HVA A;  4DX6 A;  3K8W A;  2Y9H A;  4L74 A;  2BE9 B;  2CDQ A;  3EXY A;  1X9S A;  3VQT A;  1U09 A;  3CT9 A;  4Q8F A;  2QMW A;  4OX9 F;  3NGU A;  2G2Z A;  2M5Y A;  3TX0 A;  5H9E J;  2LA6 A;  2GX8 A;  2XQC A;  4F0K A;  2HGM A;  5KFP A;  3NS7 B;  3HVR A;  5CAA A;  5IFM A;  1PKU A;  2QSF A;  1H0H B;  1QDU B;  4ZDN A;  5F8J A;  3H20 A;  3HVT A;  1PG5 B;  3LUY A;  1PAE X;  3DKD A;  5F9L A;  1WDD A;  5DET A;  4UY8 T;  1LWF B;  1WOP A;  3BO2 A;  1MU2 B;  5K14 A;  2X7I A;  3CJ8 A;  4P74 A;  3S6E A;  2DCL A;  2ZJP Q;  2V50 A;  1K1Q A;  1D9F A;  4B3M J;  4ZP6 A;  3CMQ A;  2YNH B;  1QY7 A;  2JVO A;  4AL7 A;  5F0W A;  2CXE A;  1MNE A;  2OAU A;  2IM1 A;  3TQE A;  1IBC B;  2WVD A;  1RLC L;  3K5L A;  1U1R A;  4DR3 J;  2WB1 D;  5KFW A;  3WC2 A;  3W9H A;  1REV B;  4PAB A;  4LQ9 A;  2ZHB A;  3MM6 A;  5B0C A;  3OV7 A;  2DIT A;  2J8A A;  3PO4 A;  1ZOT A;  2PA3 A;  2W2M P;  1S1X A;  4GKK F;  4JI4 F;  5IT9 U;  2IBO A;  2J8S A;  1S12 A;  1SJ1 A;  5H9F K;  4C0O C;  3V6J A;  2HWT A;  4DG1 B;  5KT2 A;  3CD5 A;  4TLQ A;  1AYE A;  2C1E B;  4BHQ A;  3MED B;  3U27 A;  2MQL A;  2MYF A;  4NLW A;  2WW4 A;  2FHK A;  4DR1 J;  1JLC A;  1XBW A;  1IKX B;  5D77 A;  3FBE A;  3OJU A;  3IC1 A;  4ES2 A;  3BJY A;  5BYQ A;  3DM2 A;  4DLE A;  4ZKA A;  4D3H A;  1SB6 A;  2G13 A;  3CF5 Q;  4F36 A;  2R2R A;  3QLH A;  2OPR B;  1E6V A;  2C2D A;  1B99 A;  4A8F A;  1VLY A;  2JHE A;  1T9X A;  4ZIT A;  1HNX F;  1JKH B;  3NY0 A;  3HM9 A;  2R42 A;  1NJZ A;  2QIF A;  4FF3 A;  4USW A;  1EKR A;  2PFF B;  4ATN A;  2H65 B;  5A6P A;  2ZOG A;  3UO0 A;  4N41 A;  3DRP A;  3BGR B;  1FRI A;  3C6U A;  4NA1 A;  3DDN A;  3ISN C;  4Q7A A;  1EP4 B;  3ET6 A;  4DN0 A;  4XK8 C;  3US5 A;  3OTB A;  3ZTS A;  3K0J A;  2I8E A;  1NSP A;  4F2R A;  4ELU A;  2V4J A;  2ZH5 A;  4IH6 A;  3SYZ A;  1AT1 B;  2YNI A;  2CAJ A;  2W9B A;  1FX2 A;  2KFN A;  5GAE I;  2UUA F;  4HT7 A;  5D0H A;  1M5K C;  2PDA A;  3PEH A;  1R0A A;  2M8H A;  3QQC D;  2BEF A;  3IAS 9;  3PJW A;  1PYS B;  4MTP A;  3SMZ A;  1DRZ A;  3L7O A;  4OI6 A;  4X4V A;  5ETQ A;  2BDP A;  2EG2 A;  4OZ3 A;  1J27 A;  4ILL A;  1VHF A;  4G1Q A;  3HHK A;  3ZZ0 A;  2HHH J;  4PCQ A;  3K59 A;  1S72 S;  3OLA A;  2R7Q A;  4IRC A;  1UWA A;  4Q43 A;  3F0N A;  4DSF A;  2HPU A;  1S6O A;  3UN3 A;  4C48 A;  2CRL A;  4WF9 Q;  4FPR A;  1HQE B;  5GAH I;  2D1C A;  4DU7 A;  1MWY A;  1UPM B;  3H4B A;  3PHT A;  1RDR A;  5AT1 B;  3E2E A;  2MJU A;  1CUL A;  2E44 A;  4FYD A;  2DEJ A;  5KFK A;  3NGR A;  4O3P A;  2C3P A;  2K3K A;  2QN6 B;  5CCL A;  4L6V 3;  1RA6 A;  1RHR B;  1RWX B;  2AEJ A;  4IRD A;  2BOA A;  3AD8 C;  2P9E A;  4X4Q A;  1Y3J A;  1SL0 A;  2B4V A;  4ED1 A;  1KDN A;  2ZE2 B;  3KK1 B;  2FC8 A;  2NXN A;  5A8W A;  2IM3 A;  4DOZ A;  1FK9 B;  1RHU B;  2CDR B;  2VKR A;  1N32 J;  2J5A A;  2VG6 B;  1GMW A;  3HD1 A;  1FE0 A;  4OX7 A;  2DNR A;  4K4S A;  2G1H A;  3P4U B;  2LXU A;  3GE9 A;  1RU1 A;  3MEE B;  4RW9 B;  3SDE B;  4DUY F;  4XDD A;  4ILM A;  3MMB A;  3N6M A;  1NK9 A;  4ZPC A;  1IKW A;  1HI0 P;  2N4D A;  3TJA A;  1LWE B;  5K9F A;  3ILJ A;  4DUZ F;  1FKP B;  2B4P A;  2CNK B;  2J76 E;  1Y11 A;  3TOQ A;  3OBI A;  1HAR A;  4L72 B;  4OYA A;  2DHG A;  2DXD A;  3RUB L;  5KFD A;  4HT5 A;  1K44 A;  4JI2 F;  3VQS A;  2RRN A;  1FEH A;  3MOZ A;  1FT8 A;  1W2I A;  4ANE A;  4CH1 A;  4TYA A;  3EDR B;  1N5T A;  2B4U A;  3TAM B;  3R5G A;  3NP5 A;  1ZH5 A;  1JK9 B;  4RR5 A;  5HRO B;  4YQW A;  5LJ3 Y;  2NXJ A;  3TZZ A;  1F6T A;  2RQM A;  1BLU A;  3MAQ A;  1BMQ B;  2VA2 A;  4Y2M A;  4F0M A;  4CDI A;  1T9U A;  4F04 B;  2GIQ A;  3L3C A;  2XYG B;  2V2K A;  4A8Y A;  3OFG A;  1KNZ A;  1D1U A;  1Y5I B;  1AB8 A;  3PHE A;  1SJF A;  2W8K A;  3LF0 A;  2UU9 F;  3HLU A;  2WVF A;  4OYZ A;  4K5R A;  4URG A;  1S0M A;  4PXE A;  3J7Z T;  2K1R A;  3HSG A;  3PO5 A;  2BV3 A;  4OX8 A;  3SEO A;  1BQM A;  2O01 C;  3EE3 A;  1YGY A;  3KKF A;  2DHX A;  3I9Z A;  1HHS A;  1RAO A;  1N5Y B;  2RHS B;  2AX0 A;  1VYA A;  4TXS A;  2XO6 A;  2WW8 A;  3EYZ A;  1AUD A;  2LQB A;  2K3I A;  4RX6 A;  3Q22 A;  1WG1 A;  3RU0 A;  4C6A A;  1VQN S;  5J2Q A;  1H2U X;  4DV3 J;  5E41 A;  4C3K A;  5BJR A;  5J1P A;  5AJ3 F;  3M9O B;  3GV8 B;  2OSQ A;  3GIK A;  5J2M A;  5EWG A;  5ETK A;  3W2V B;  3DRS A;  3MR6 A;  2F8M A;  2HHP A;  4M5N A;  1UA1 A;  4PWU A;  1RCO B;  5KG1 A;  2HRT A;  3G6Y A;  4XO0 A;  1NZ8 A;  4PWD A;  3VR1 A;  4M1K A;  1NKC A;  2OPQ A;  5KG4 A;  1K8A T;  2KYX A;  5ETS A;  3MDF A;  2KT3 A;  2VON A;  1DBD A;  4IKA A;  3LWL A;  5MLC V;  1L3S A;  5L9X A;  2P8I A;  5KFA A;  5HBM B;  3DHX A;  4QYR A;  4DPW A;  1T11 A;  4KHP J;  1X4G A;  2CPH A;  3CDW A;  2PI4 A;  4DQP A;  1OYD A;  3NS6 A;  5HAT A;  1Q0N A;  1S9E A;  4C7Q A;  4LRC A;  1SVD A;  4HI1 A;  2WTF A;  1HBO B;  2L9N A;  2CQ0 A;  3RYL A;  5FDL A;  4UOG A;  1HFE L;  5HQ8 A;  3AJ2 A;  2DYA A;  3LP0 B;  2MSS A;  4IG3 B;  1FTC A;  2KKH A;  5B0E A;  1RE1 B;  3T5H A;  1FRJ A;  3U02 A;  5I4M A;  3M2R B;  2F9D A;  3KJV A;  1XER A;  1RJJ A;  1RT6 A;  4FZV A;  4FNI A;  2NSB A;  1A0O B;  1U1N A;  5IQ6 A;  4X66 J;  1G2E A;  2QA2 A;  1HNI B;  4NPO A;  1P1T A;  3CJ4 A;  3R27 A;  1H7X A;  2A2C A;  2HVZ A;  1L3U A;  1JNR B;  1NU4 A;  1VQL S;  3A3P B;  5LSR A;  5E33 A;  4P2M A;  3VF0 B;  1VFJ A;  4ZLN A;  4RUH A;  4M5L A;  1YSJ A;  3EXC X;  4WFZ A;  4J9S A;  1G4C A;  1ZM4 A;  2RF2 B;  1GMW D;  2B8P A;  3IG1 B;  4DQI A;  5J1E A;  1RSC A;  4K4Y A;  4DFP A;  1EKS A;  1R6V A;  3W62 A;  1NEE A;  2CZV C;  2MLZ A;  3JYT B;  1TVR A;  2MHN A;  4WYL A;  3UDC A;  1VDH A;  4WYW A;  1RT2 B;  4ITS A;  2BX6 A;  1TKT A;  2NYI A;  3QAE A;  2F9J A;  4DZ6 A;  4I1T A;  3E01 B;  5CYQ B;  4BWM A;  1MMD A;  1BD6 A;  2D3U A;  4X84 A;  5C2G A;  1FCA A;  3G2X A;  1ELO A;  2OUG A;  1UWB A;  2FZC B;  1LWC A;  1HBM A;  1S9G A;  2VAS A;  4PRF A;  5ETR A;  5DQG A;  1N36 F;  1T94 A;  2HSE B;  2GAG C;  4XDC A;  3M8Q A;  1BUX A;  1WC3 A;  4ED3 A;  3AQP A;  5LMN J;  4ZPV R;  1NXI A;  1VRT A;  3GJQ B;  1WSV A;  3TAN A;  2DGW A;  4C9D A;  2RIJ A;  1Q79 A;  5K8N A;  1KLM A;  2RD5 C;  4AL6 A;  2AJ4 A;  4KPY A;  5F8L A;  5HLF A;  2EBG A;  4M94 A;  3MEC B;  1Q16 B;  4H4M A;  5JVG Q;  2XI2 A;  4CYU A;  3ENA A;  4NLX A;  3SBM A;  2HGL A;  4B3S F;  2CJB A;  2KM8 C;  1WG4 A;  1WHY A;  2Y0B B;  2PEB A;  3R7S B;  1SJQ A;  2V6A A;  4HTI A;  3N79 A;  4ZP9 A;  3PYE A;  5JUM A;  4IFV B;  4FF1 A;  1F9E B;  4DV2 F;  4DN9 A;  4WWS A;  2Z57 B;  3HKZ D;  5LSO A;  2EFG A;  1N5S A;  2NYH A;  1NK4 A;  1HNV B;  2GFF A;  2FVQ A;  1S6U A;  3QMQ A;  4KHR A;  2J0W A;  2YX4 A;  4WFB Q;  5ITH A;  4FF2 A;  2UVW A;  3A8K A;  2MB0 B;  2G0I A;  2ROG A;  4LF9 J;  4KSE B;  2YKO A;  1FDB A;  5D6G A;  4K4T A;  2F4F A;  3BH7 B;  2B9W A;  4P73 A;  3N5B A;  3RR7 A;  2DBB A;  4BS2 A;  1SIZ A;  2UZA A;  2VFU A;  3CCE S;  4PG7 A;  1UW9 A;  1Q8K A;  1I94 F;  4DCJ B;  3RB0 A;  2IPO B;  4AL5 A;  2DR5 A;  5AE3 A;  5ETM A;  5F9N A;  4N7T A;  4LF5 F;  1MLA A;  1S5Z A;  3NXZ A;  1YK9 A;  3C14 A;  1JIH A;  1TEL A;  1V5V A;  5IM0 B;  1IQT A;  2GIR A;  3KLG A;  2H4W B;  2PEH A;  1XEZ A;  3F56 A;  4Y00 A;  3AH6 A;  4DX8 H;  1GQE A;  3AFG A;  3UR3 C;  3D5M A;  3EDQ B;  2LEA A;  4H4K A;  1E6Y B;  3B54 A;  3PG9 A;  3OTO F;  1RTI B;  1UKU A;  1OY9 A;  3IS9 B;  1RWN B;  3HVW A;  3H5S A;  3GII A;  2QYG A;  2Z4P A;  2EPI A;  4LF2 A;  3GR1 A;  5A8K A;  4UOC A;  5KFE A;  4RPF A;  3NBP B;  1RAE B;  4X4O A;  2V63 A;  4YR0 A;  2RIL A;  3J7Y I;  4RNN A;  2BZ2 A;  4K4V A;  1NND A;  2YH0 A;  1JJC B;  4ZPT R;  2QRR A;  4JI7 J;  1QLN A;  5SZT A;  1T02 A;  3MMA B;  1R8B A;  1X4A A;  3FZ2 A;  1Y3K A;  4ZVR B;  4K0K F;  2VQF F;  2R7V A;  2C2Z B;  1DY3 A;  4FXD A;  2M9K A;  1Q81 T;  3M1V B;  1C0T B;  3ISZ A;  3FSY A;  2M3D A;  1SL2 A;  1NO8 A;  2UXB F;  3FBC A;  3SCL E;  1VC6 A;  3BGF A;  1PIE A;  3LGM A;  2R7T A;  2B0G A;  4LR7 A;  3DU5 A;  2F63 A;  1HNZ J;  3TP2 A;  4B9M A;  1QM9 A;  3T1A A;  4M5D A;  3N0V A;  2B43 A;  3VWS A;  4KGX B;  3QO9 A;  4R5P A;  1TFY A;  4OV6 A;  3EZU A;  1YBA A;  4EYI B;  1S1W A;  1T05 A;  5I3Q A;  4ZCM A;  1U0H A;  1HPZ A;  3QZ7 A;  2B7B B;  1ZM9 A;  3K57 A;  1HWJ A;  2V8D A;  2QA1 A;  1AW0 A;  3VVT A;  3J81 j;  4BCA A;  4YDX A;  1WKL A;  2K8G A;  2NR0 A;  3H25 A;  4NYO A;  4MIA A;  2COL A;  3C3L A;  1NPR A;  1IVZ A;  1H6K X;  3FBB A;  2RQK A;  3IA0 A;  3TUJ C;  2QFI A;  1LV5 A;  4YME A;  1CJV A;  1URN A;  2X1A A;  4NXM J;  4WK3 A;  4MKY A;  1JLG B;  4FYV B;  4ED5 A;  2UV8 A;  3RBX A;  5LMU F;  2FPH X;  5CAB A;  1A7G E;  2I5J A;  1DTT A;  3I56 S;  2C2K B;  1VK8 A;  4NAS A;  3DN9 A;  1WC5 A;  4MK9 A;  2EFO A;  3JSM A;  4IOB A;  2FVS A;  1ACM B;  1NPP A;  2MXY A;  3R1H A;  2WVE A;  4IDK A;  4RW6 A;  2CQD A;  1QTN B;  2OFG X;  4JYA F;  2QSW A;  1NH8 A;  3EPG A;  5E3C A;  4XPC A;  4U6P A;  2GVD B;  3MPW A;  1FVQ A;  2VFV A;  3HHD A;  3D54 A;  3O2I A;  3S1T A;  1D3W A;  5KT3 A;  1RAG B;  3FNN A;  3PRD A;  1S6P B;  3C15 A;  3TQ1 A;  5CZV A;  3F44 A;  1BWV A;  4HL9 A;  3RZA A;  3A3N B;  2ADB A;  1T95 A;  2JLF A;  4RWW A;  3QGG A;  2DTJ A;  3GZ7 A;  3T6J A;  3GON A;  3AD9 C;  3DOK A;  1MML A;  2DNG A;  3LTO A;  2OPS A;  1KQS R;  4OYP A;  3SSS A;  3H0P A;  4YB6 A;  4ES3 A;  3GIR A;  4ERD A;  3MI7 X;  3UD3 P;  3DRR B;  4WPA A;  4YB1 P;  1PO6 A;  1NK7 A;  3M6V A;  2D41 A;  1EET B;  3D7S B;  5GAD U;  2ABY A;  3FSI A;  4IH7 A;  1T03 A;  4BWJ A;  3VZI A;  4ZS6 A;  1X0P A;  3MD1 A;  1FE4 A;  5A8R A;  3ZTR A;  2F8H A;  4DR6 J;  2L9D A;  2DH7 A;  1I94 J;  3ILL A;  1Q8I A;  3Q0A A;  2ZUA A;  2CG8 A;  2VD3 A;  2A0F B;  5D4P A;  3EZO A;  5EWE A;  3CJ2 A;  2FZG B;  5D78 A;  2W2N P;  2VOP A;  1QSL A;  4DV4 F;  3IWN C;  4NCA A;  4NZ6 A;  4ECU A;  2ZC4 A;  4QCL A;  1B7Y B;  1OJ4 A;  1S1T B;  2RUS A;  2NLW A;  2V67 A;  4OI3 A;  1SC3 B;  2BR0 A;  2VOO A;  1FWL A;  3POT A;  1KHW A;  2EK6 A;  5LL6 d;  3ITH B;  4USU A;  2J9E A;  2QZ8 A;  1QD1 A;  4F67 A;  1BQX A;  1U47 A;  2HVD A;  2C2O B;  4OHW A;  3VGV A;  2CPX A;  2VL1 A;  1L5U A;  4KRW A;  4QU7 A;  5L46 A;  3OL6 A;  2YKP A;  5LOQ A;  1JJ2 R;  3PRB A;  3UCU P;  4P52 A;  4B08 A;  3QIP B;  5L8R C;  3SXL A;  4RWX A;  2V9K A;  1LW2 B;  2V8H A;  5IT4 A;  4DSJ A;  2R8H A;  2HZC A;  5FLX Y;  3R6L B;  1IR1 A;  2KRR A;  1IR2 A;  1RWM B;  5C25 B;  1WHW A;  3M8Y A;  2CVE A;  4GMK A;  4ECR A;  1TKZ A;  2XS2 A;  4CTA A;  3FRZ A;  4U67 Q;  1ZAX A;  2OD6 A;  2RU9 A;  5I42 A;  3W7B A;  1F3V A;  1RAA B;  4X4R A;  4Z7C A;  1SKW A;  2IYI A;  3BO4 A;  3DDI A;  2YNF B;  2DR7 A;  1GH8 A;  1VRQ C;  3MAA A;  5DQH A;  3W2W A;  2X3D A;  3MCN A;  1YG0 A;  1IQZ A;  2MLY A;  4LRA A;  1HBU A;  5D3G A;  1NHU A;  2AJ2 A;  2PO4 A;  3R5B A;  4HR2 A;  1VK3 A;  4DDF A;  2NSC A;  4RW7 B;  2YKN A;  3H5Y A;  2DRA A;  3Q8Y A;  5IWA F;  1SPB P;  4D3G A;  4LRB A;  3KTQ A;  4ZK7 M;  4WU3 A;  1U1K A;  3J81 U;  1ZAV A;  2LMI A;  3CJ5 A;  4NL5 A;  2XYP B;  4O44 A;  2AU0 A;  4U95 A;  3KK2 A;  3ZZO A;  4NLO A;  3MXH P;  3BYP A;  4ZVS B;  2CVI A;  3CJR A;  1XTZ A;  2DR8 A;  3K5N A;  1HD1 A;  2Z2Z A;  1RP5 A;  4YDD B;  2CQ1 A;  1S0O A;  2BRL A;  1BQN B;  2ZDP A;  2DIU A;  4I67 A;  4W98 A;  2HGN A;  3GU0 A;  1IBM F;  2OEJ A;  1WC1 A;  4I69 A;  3V4I B;  5C24 B;  2KTQ A;  4FS1 A;  3GPA A;  2CQ2 A;  1D8Z A;  5E0O A;  2B9X A;  1T3O A;  3H2L A;  4WZQ A;  2NPF A;  1D8Y A;  2QMU B;  3R5D A;  4WFX A;  2ZH9 A;  2FVR A;  2FUG 9;  2XI3 A;  4ECV A;  1R7I A;  3TA2 A;  4R8U A;  6FDR A;  5CH7 B;  4OHZ A;  4QQB A;  3C8Y A;  2IVY A;  4ZP8 A;  2MZQ A;  1RKJ A;  2KZZ A;  3MR5 A;  4BBY A;  4MFB A;  2IIH A;  5I3U A;  3PKM A;  2M8D B;  3NGT A;  1R8C A;  1F9H A;  3HCX A;  4JI5 F;  3UD5 A;  3G71 S;  3KUE A;  2FJE B;  1DJ0 A;  2VH7 A;  1R8P A;  3TRG A;  1RTD B;  2YWW A;  2E5I A;  2HND B;  1CC8 A;  4YUD A;  3MCS A;  3IN5 A;  2MKY A;  4KH1 B;  4UST A;  4X62 F;  4LFA F;  2Y8Y A;  2XUL A;  4M5K A;  3I9V 9;  4UQT A;  3EGW B;  4F8R A;  4Y2K A;  2OEL A;  1U45 A;  4AFF A;  3KUH A;  1VGY A;  3W1Y C;  2QA4 S;  4NI2 B;  3CCV S;  1OPZ A;  1HR0 F;  2QTW A;  3MAH A;  4RBV A;  2CPF A;  3OTC A;  1RUS A;  3KLF A;  2QL7 B;  1ICE B;  3NMR A;  2IJN A;  1R43 A;  2XLI A;  4MIB A;  3BBB A;  2LU1 A;  3H59 A;  3KJF B;  3DOM A;  3IWL A;  5T14 A;  4RBU A;  5J2N B;  2XS5 A;  3MF5 A;  3ADA C;  3UVJ A;  1QUP A;  5F3Z A;  1WF1 A;  3O1L A;  2BBE A;  5CYM A;  3Q8V A;  1PYT A;  3D6F B;  1W7W A;  5HVG A;  3K89 A;  2BAC A;  4A8M P;  1VIX A;  1VQ8 S;  1Q4R A;  4F3O A;  3GLJ A;  4NRU A;  4GC7 A;  5KG5 A;  1EAY C;  3B78 A;  4NML A;  1HBN A;  1U1M A;  1JNZ B;  3VCD A;  2DNO A;  4O4G A;  1N0U A;  4I64 A;  1WD6 A;  1WHX A;  3PX6 A;  3DCA A;  4M5H A;  4EUV A;  4HVZ A;  2W24 A;  3DMJ A;  2XY6 A;  2HWI A;  4IO9 Q;  4IFY A;  4MMO A;  4I6W A;  2D3O R;  1V9O A;  3PFO A;  3AB4 B;  4DFM A;  2MST A;  5T7L B;  1DAX A;  1QE1 B;  1RWV B;  3W8P A;  2B5J B;  1RT3 B;  1RU2 A;  2BUN A;  3OPK A;  6AT1 B;  4OJH A;  2JOQ A;  3IR7 B;  1T0T V;  5GME A;  1NDL A;  1DTQ A;  2B6A A;  3CSK A;  4G65 A;  3QWU A;  1QTM A;  2DNY A;  3NNC A;  3O6Q A;  5B0F A;  3QJJ A;  9RUB A;  3IAM 9;  3LGH A;  4KGM A;  1KOO A;  3F73 A;  3NAI A;  1HQU A;  3CO9 A;  2DIS A;  4Z7Y A;  2BQ3 A;  1OIA A;  3BGL A;  4F25 A;  4ZJQ A;  3OVB A;  4NWB A;  4ZN1 A;  1F5B A;  3G87 A;  3G82 B;  4EO8 A;  1KFS A;  2BE2 B;  4DPO A;  3C19 A;  4CO4 A;  4DF8 A;  2QLF B;  1TK5 A;  1X4F A;  3CWJ A;  2VQE F;  4ELT A;  3V6K A;  1RTJ B;  3BSN A;  4ICL A;  2MY7 A;  2Q6C A;  2G1D A;  4ZN3 A;  2Q3P A;  4HKQ A;  2I1R A;  3E3X A;  4X4N A;  3QT8 A;  3KK3 A;  4C8N A;  5KAK A;  5DGB A;  1QVF R;  3DNC A;  3CDA A;  3T19 A;  2XLJ A;  2ALZ A;  2B8Q A;  3KMS A;  4URQ U;  1N5Q A;  4DR4 J;  5J1N A;  1Q8B A;  4HAC A;  3V81 B;  3H90 A;  4Y2I A;  4HLB A;  3LP2 A;  3R2D J;  2ASY A;  4MJK A;  4QWB A;  2ZZN A;  5JJB A;  2ZZT A;  2GW8 A;  2IMW P;  1VQ4 S;  1S10 A;  3M30 B;  1RHJ B;  3HKW A;  2HW3 A;  2IYG A;  2HIY A;  3M6W A;  4YR3 A;  2Z30 B;  4EBD A;  3GFX A;  4I7F B;  2UUC J;  2HYI B;  4OYX A;  2KXF A;  3TEG A;  2UVU A;  3BSA A;  3P49 B;  1HW9 A;  1VJQ A;  3M2U A;  4PYA A;  3PYD A;  1JLQ B;  2MEW A;  2ROP A;  3VVU A;  3B8H A;  4UT4 A;  1HWU A;  1LXN A;  2ZBI A;  3DXB A;  2XB2 D;  2IC3 B;  2G2O A;  1B0V A;  1GFW B;  3SFU A;  2UXC J;  1FI4 A;  1X5S A;  4FKY A;  2WON A;  1NK0 A;  1ZS6 A;  1YDL A;  3PX0 A;  2MQO A;  4DCP B;  4M5M A;  3QT5 A;  1FES A;  1X4D A;  5JMN A;  2DH8 A;  1VBK A;  5A0Y B;  4C11 B;  3D4J A;  3TWZ A;  4OJG A;  2RML A;  4JI1 J;  1LOU A;  2OSR A;  1JX4 A;  1VQ7 S;  1J5O A;  4WU2 A;  1WWH A;  4LF7 F;  3B82 A;  1VS3 A;  5HP1 B;  2HRY A;  2DD8 S;  5A2Q Y;  2ZC3 A;  4CO0 A;  5KOW A;  4DR5 F;  3C6T B;  4UF4 A;  3GFH A;  4TY8 A;  1VCT A;  5BYS A;  1XMO F;  3AJD A;  1KR4 A;  1L3V A;  3TUI C;  3IRX B;  2UUW A;  2I2Y A;  1HYS B;  1TMM A;  3KLI A;  2E5L J;  3BR8 A;  1KP6 A;  2V69 A;  3W60 A;  3MM9 A;  5BR8 J;  2XZD B;  4IOC Q;  4LBH A;  2D9P A;  2HMI B; 
#chains in the Genus database with same CATH homology
 3ZTS A;  1NDC A;  1UCN A;  2ZUA A;  3Q89 A;  5BXI A;  3FBF A;  5CAA A;  1PKU A;  4FKY A;  3B54 A;  1NSP A;  1MN9 A;  1S59 A;  1NDK A;  2AZ3 A;  1ZS6 A;  4F4A A;  1WKJ A;  3BH7 B;  1B4S A;  2HVE A;  1BUX A;  1PAE X;  3DKD A;  3VGU A;  3FCV A;  1JXV A;  4W98 A;  2DXD A;  1WKK A;  3JS9 A;  1HLW A;  1K44 A;  1KDN A;  2B8Q A;  3MPD A;  3EE3 A;  3FBE A;  3EVW A;  3GPA A;  2BEF A;  3NGS A;  4AND A;  1XIQ A;  4ANE A;  3DDI A;  3FCW A;  3PJ9 A;  4UOF A;  1VYA A;  3EVO A;  4ENO A;  4F36 A;  2B8P A;  4S0M A;  1NSQ A;  4DUT A;  3L7U A;  3ENA A;  1NDP A;  3EIC A;  1LEO A;  1NDL A;  1BHN A;  3BH6 B;  4O0N A;  3BBB A;  3VGT A;  3VVT A;  3ZTQ A;  3PRV A;  1B99 A;  3EM1 A;  4UOH A;  1NHK L;  1NLK L;  2HVD A;  3WX8 A;  1NSK L;  3ZTP A;  3VGV A;  3ZTO A;  5C7P A;  1BE4 A;  1WKL A;  3ETM A;  2CWK A;  4C6A A;  3FKB A;  1S5Z A;  1F6T A;  4UOG A;  1NCL A;  3Q83 A;  4HR2 A;  3VGS A;  3EVM A;  1NB2 A;  1LWX A;  1F3F A;  3FBB A;  3Q8U A;  3EMT A;  3Q8V A;  2DYA A;  1NPK A;  2DY9 A;  4FKX A;  4CP5 A;  3Q8Y A;  1NUE A;  1HHQ A;  3Q86 A;  4KPC A;  1EHW A;  3FC9 A;  3B6B A;  1W7W A;  3BBC A;  2BX6 A;  4DI6 A;  3ELH A;  4EK2 A;  3NGT A;  2HUR A;  4DZ6 A;  2NCK L;  5CAB A;  2VU5 A;  1HIY A;  5IOL A;  1U8W A;  3R9L A;  2DXF A;  1MN7 A;  1XQI A;  3FBC A;  1S57 A;  3VVU A;  4WBF A;  4ANC A;  3NGU A;  3ZTR A;  3GP9 A;  2AZ1 A;  2DXE A;  3EJM A;  3G2X A;  3BBF A;  3NGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...