4F36A

Crystal structure of nucleoside diphosphate kinase b from trypanosoma brucei, apo form
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
141
Chain Sequence
SERTFIAVKPDGVQRNLVGEIIKRFENKGYKLVGLKLLQPTEEQAKQHFYSGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGSDSVESAKREIAFWFKAEELVSWTSHSVKQIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Nucleoside diphosphate kinase B from Trypanosoma brucei, apo form
rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 42
structure length 141
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4f36A00
4HR2A 1W7WA 3Q8UA 1VYAA 3VGUA 5CAAA 4KPCA 4W98A 3WX8A 1NLKL 3Q86A 3GP9A 4ANCA 4O0NA 5C7PA 2HURA 1U8WA 3G2XA 2DY9A 3PJ9A 4UOHA 1JXVA 3EM1A 3GPAA 3EJMA 5BXIA 1BE4A 1MN9A 3DKDA 1NDCA 3L7UA 2DXFA 2AZ3A 1HHQA 4WBFA 1NHKL 3FBBA 1MN7A 2DYAA 2B8PA 1WKJA 1KDNA 4CP5A 3BBCA 3VVUA 3BH6B 1XIQA 3R9LA 3FBFA 3FC9A 2DXEA 4DI6A 4F4AA 1NDLA 3ELHA 2B8QA 1F6TA 1PKUA 1BUXA 1NB2A 2BX6A 2CWKA 3FCWA 4FKXA 1NSKL 4F36A 1EHWA 3JS9A 1NDKA 4ANEA 3Q89A 3EICA 3ZTOA 1HIYA 1BHNA 3ZTQA 1NCLA 4C6AA 3FCVA 4ANDA 4EK2A 1S5ZA 3BBFA 3VGTA 5CABA 3EVMA 3NGTA 3FBCA 3Q8YA 1S57A 3EVWA 3NGUA 3FKBA 2ZUAA 1NDPA 2DXDA 2HVEA 3BH7B 3Q83A 1HLWA 2BEFA 1WKKA 3ZTPA 1NPKA 1PAEX 3VGSA 1F3FA 1LWXA 3Q8VA 1S59A 3ZTRA 4FKYA 2AZ1A 4DZ6A 3EVOA 3NGSA 4S0MA 1K44A 3ETMA 3BBBA 1WKLA 3B6BA 3EE3A 1B99A 2VU5A 1ZS6A 1NSPA 2HVDA 3B54A 3DDIA 3EMTA 4UOFA 1NSQA 3VGVA 3MPDA 3ZTSA 1XQIA 5IOLA 1B4SA 1UCNA 1NUEA 3ENAA 4UOGA 4ENOA 3VVTA 2NCKL 3PRVA 4DUTA 1LEOA 3FBEA 3NGRA
chains in the Genus database with same CATH superfamily
1Y11A 8ATCB 1QUPA 2BYCA 2FPHX 2IC3B 1YLXA 4IO1A 4U95A 1JB0C 1EQMA 5IT0A 4ES1A 1U2FA 4EBEA 1ZM4A 2EK1A 2FY8A 5GADI 1R6VA 1CQNA 1NLKL 1H6KX 1P1TA 1RHQB 1SXLA 3BO2A 2BANA 1IM4A 4M94A 2HFZA 1S9FA 3I31A 3W64A 1RP5A 2YQ1A 4ZCKA 2DIVA 2VUGA 2XHCA 4Q2MA 4C8ZA 1YBTA 4LT6A 3MFIA 4CZCA 2FVQA 2J7UA 4RJVA 1ZH5A 4F50A 3T5JA 1N8RT 2RUSA 2AMCB 1N0VC 5GMEA 1LFWA 1TKTA 3QIPA 1D9AA 2NSCA 2I1RA 1IBMJ 3EJMA 3E2EA 2RJZA 1T3NA 1M0SA 4ECSA 4KHMA 4DR5F 1FKPA 5HSPA 3MM9A 4LVNP 3J80U 4GKJJ 2J76E 1N34F 4WBFA 2QL5B 1T9XA 2VFRA 2DYAA 4PYDA 2MKSA 1X4BA 1ZA1B 3IR7B 2P9CA 3BPSP 2P6TA 4QR1A 3TA0A 1R43A 4TXSA 4ECZA 1D3WA 1S1UA 1U6FA 1T94A 1X7VA 4DBQA 3VVUA 4EO8A 2CZ9A 4ECYA 3CDUA 2XYPB 3A8IA 3L7PA 1S9GB 2DNZA 2UXBF 4FZVA 2DH9A 2IPOB 1RT2B 1OYDA 1WI8A 2D69A 1S6OA 3AFGA 3OFHA 1SL2A 4LMZA 1LWEA 3UCGA 2RVJA 1S1VA 2ZNZA 4CNZA 1KD1T 4X4UA 1F5BA 3MD1A 5HANA 3T5LA 2CPHA 1NB2A 3M8WA 5JVHQ 1XMOJ 1NK9A 2ZJQQ 1FERA 2GJFA 1YBUA 2AJ0A 2VPWB 1F60B 2YVSA 4NASA 1TK8A 1KC8T 3BGRA 1XWLA 2V50A 4ANEA 2E29A 2XWXA 2PE8A 2HLTA 3ITHB 1RACB 1S48A 3TNVA 4NXMJ 4DS5A 4NLSA 2CJ9A 3AOCA 5J1NA 3CUNA 1EQ0A 2DGTA 5L1IA 4HDGA 3SSSA 4ZVQB 1RWVB 1M5KC 2RSQA 1RLDA 2VONA 3A13A 4OHYA 5A76A 2GIQA 4ANDA 3T5KA 1AROP 1JLGA 5HMYA 2JL9A 4O3OA 5B7WA 1HNZJ 2CQCA 4RW9A 5IM0A 3HI9A 4NXNF 5KTQA 3NGUA 2C1EB 3QT7A 3OUYA 1AZSA 5HVFA 3RAQA 3C3LA 1SIWB 3GQCA 3DLGA 2AJ2A 3T1HF 2M70A 3ISNC 1HBNA 5L38A 2M88A 4RL1A 5KOXA 1I1GA 3QAUA 3BZQA 3D3CJ 4DF4A 4BCAA 3Q8VA 2HVHA 5L1JA 2XMUA 2QMUB 1FESA 3ENVA 2XLKA 4PWDB 3UR0A 2YXLA 3OXGA 1X0PA 4ZP8A 5IQ6A 2Q3PA 2V4JA 1RTZA 1T7PA 2ASYA 1UVJA 4OHZA 1KONA 1OY6A 2LQJA 2XYHB 3B6BA 3DI6A 3O1LA 4I4BA 4P2SA 4KT0C 2QRRA 4BWJA 1DQ9A 1B99A 1KR4A 4EU0A 1K9MT 1NSPA 2IVYA 3T6BA 2XB2D 4UOFA 2EFVA 2ZM6J 1MMDA 3M30B 3MEDB 1RCXB 3PR5B 3RBEA 3W65A 1IR0A 3A3NB 4HT5A 4ETZA 2FHJA 2EG1A 2ZWOA 4MKVA 1HYSB 4JP8A 4KSEB 3QT5A 3F73A 3PEHA 2V4RA 3PRVA 1H72C 5A0YB 1URNA 4LFCJ 2AIRB 4HR2A 2Z2MA 4FXDA 3CJQA 2OPQA 4M8LA 4WU3A 4Z7CA 2FQQB 3Q8UA 4ZITA 2FIUA 2DNPA 4CTAA 4X4QA 1N5YB 4IDKB 4OJGA 5E5NA 2JC0A 3WZ0A 3TUJC 1T03B 1N5SA 3M8PB 2CYYA 2DR5A 4X64F 4OX6A 2VQEJ 1TKXB 2ZH5A 3FEXB 1DARA 4MT1A 2NXEA 5HK4A 5DG9A 2KN4A 2MJNA 2XMJA 2FLPA 4LFBF 3MUVP 2HLUA 2HNYB 2BQRA 3N28A 2GVDA 5B0GA 3AJ2A 4RNHA 2OEJA 5KG0A 2UXDF 2UVUA 5BYRA 2RHQB 1MMNA 2YX4A 3W63A 3EPIA 1JXVA 3CD7A 1U26A 1TQLA 2XSJA 5D0EA 2MQLA 1LWCA 2MPUA 3SSQA 1VQYA 1R8HA 2Z56B 1A7GE 1FXLA 5D0RA 3UDVA 4C3KA 1SL0A 1VRTA 1RWPB 2EBEA 2XNQA 3NAIA 3TR5A 3H2UB 4ITSA 4X66F 2PA3A 1YRUA 2KG0A 4Y65A 2HK3A 4D3GA 3FRYA 3E51A 3KJQB 3NS6A 4B3MF 3DOMB 3GJQB 5F41A 3THPA 5CD4H 3RB3A 2DB1A 2FC9A 2JRSA 3KJVA 3V81B 4C8NA 1N36J 1JJCB 3PVXA 2E1CA 2VQFF 4R5PB 4P73A 3MM5B 1F2HA 1ZBTA 3MTKA 3QSIA 3BBCA 4TQRA 5HQ8A 2AGPA 4PUOB 5I3QA 2D41A 3W5XA 3K5OA 2YQ3A 2BW2A 1VI7A 2DNRA 4PWWA 3EXYA 4MAKA 3RB4A 4LBPA 2EXUA 1JLBA 5B0FA 3IM8A 3OT9A 1UVKA 3S8SA 4MK7A 1Q78A 2V67A 1RKIA 4P72A 1OQ3A 4KHRA 1FJ7A 3DOKA 4DSFA 1VS3A 3ISND 1CULA 2H5JB 4FKXA 3RAMA 1QE1A 3IWXA 3MR5A 2K2PA 5I3UA 1AUDA 2ZEJA 1XBWA 2FHKA 3MAHA 5C2GA 4K4UA 5LJ3Y 1NDKA 4J9NA 3BSAA 2WONA 3J7Z5 1OY8A 4ZVOB 1TR0A 3NBPA 2QGFB 4EWTA 4GO7X 1CJKA 4OX9J 1JJHA 2ZC4A 1Q95G 2FZGB 2RQ4A 1N56A 1KSPA 1KEKA 4I68A 4F0MA 4A8QA 5KFIA 2PA8D 1Y4ZB 1YJ7A 2QLJB 4Y2MA 1S6PB 4KRWA 4NI2B 4P71A 1TZ0A 1U0SA 1HL6A 4XPCA 3H4BA 2XO7A 2ADCA 1IM6A 3T41A 2HAFA 2E5LF 2DK2A 3JXOA 5I3PA 3M32A 2E1MC 2F9DA 3FCHA 2DITA 2Y1LB 1S12A 1HBOB 3I87A 2AKWB 3IRXA 4WFBQ 3ICLA 4M5LA 4NLUA 4XDCA 4E98A 3Q0AA 4BDPA 4C11A 3PACA 4QZVB 3R8YA 2NYHA 3BKTA 4NA3A 3W3SA 2W9AA 1RWOB 3GCWP 4WXWA 3IN5A 3N6LA 1EIYB 2HVZA 3PRBA 1WF0A 4TKTA 4BC7A 1N52B 3T1YJ 2H9ZA 2F3JA 5BR8F 4ZVFA 1PBAA 4CYUA 4N56A 4ES3A 4DV0J 1XNQF 1IBLJ 4Q0BA 1X4DA 3ZTSA 2ZHAA 2MSSA 3QO9A 4ZJQA 5ITHA 4CLSA 2V6AA 4UQGA 3M8SA 1QAXA 4DFJA 1RT6B 2K7JA 3ENAA 4CT8A 2UV8G 4CLWA 5AE3A 6AT1B 2MKYA 2OUGA 1SJ1A 4N5SA 1TL3A 3DXBA 3TJAA 2J9DE 2WZ1A 4RX6A 3SCIE 1M1KT 4LF9F 1F1BB 4LF8J 3VGUA 1KQKA 1M90T 3D1HA 1EJ7L 2F4FA 4HACA 4O44B 1YVFA 2RHSB 3VR1A 3OTOF 1V3RA 4WIIA 2QJ3A 4J91A 5EX0A 2C42A 2KDOA 3ILOA 2DGSA 3DLKB 3BGFA 3SZ2A 4DQPA 1RAJA 5HLFA 4BS2A 1C0TB 3GFXA 1L3TA 2JEGA 2PGCA 3NNAA 2KHDA 5EGYA 4IRCA 2VBXA 3KLIB 1DQAA 4BBYA 2IM0A 4X65F 2FTRA 5AT1B 1M1GA 3GU0A 3RRKA 2B6AB 1VC0A 3KK2A 1BQMB 4CLYA 1S10A 4IOAQ 3TAQA 3QWUA 4WKRA 4IG0A 3RW6A 3GPAA 4ED7A 2QLFB 3NOCA 4WFZA 3TVKA 4CO5A 2R7QA 2Y1JA 2WW8A 4DHVA 3QFWA 4ZLNA 5IZHA 4I7FB 1X9SA 3CF5Q 1NDCA 3FGVA 2UVVA 2HGMA 2ZD1B 3FEZA 3BPDA 3UNGC 3H7HB 4RW6B 1DLOB 4CIOA 5D3GA 4UUXA 3K89A 4WXOA 3QSYB 3CJTA 2AEMA 1JQGA 4ICLB 3OHBA 2B4VA 2HWTA 5CZVA 3I0RB 2J0XA 2CPFA 4R0JA 1V5VA 2GZOA 4PXCA 4X66J 5KFKA 2HFOA 1HARA 2JOQA 2HWIA 1ZM3A 3F0NA 5J1EB 3EX7B 5L1LA 4GKKF 1DURA 5KFOA 3CWJA 3PG9A 3TEHB 4ZHRB 5LXYA 3IXQA 4KH0B 4WFNQ 3L3CA 3FBFA 1Q79A 1RT1B 4EBDA 5K14B 3UVJA 3US5A 4DL6A 1SKSA 1VMBA 3FC9A 4TLRA 4KHPJ 2FB0A 4F4AA 1NDLA 2AYMA 4QU6A 1IN0A 1CJUA 1HI1A 4NLOA 2ZOFA 4P10A 4DX7A 2HQFA 5E33A 1U8SA 4F67A 4RW7A 3WHIA 2UU9J 4KE5A 4WFYA 3MOJB 4QJVA 2CVIA 2CWKA 3OTBA 2CPXA 2WBMA 4USKA 1PJ5A 1NSKL 4KFBA 3JYTA 1Y9OA 1HPZB 5LMNF 2W2QP 3H8YA 2DTJA 4YB7A 3S01A 2N4CA 3BQ1A 2LLZA 2XI2A 1FK9A 4FVCA 1KKHA 1S7IA 2KJVA 3SQOP 1VJQA 4I56A 3VGTA 3U02A 2QV6A 3M8QB 3CPWR 2KT2A 3MMCA 2KM8C 1ZAXA 2IMWP 2C3MA 4ES2A 3PIOQ 3PR4A 3CCJS 3D3BJ 3IBFB 1YI2S 1MWQA 2ILZA 4MIBA 2XCPA 2RB7A 1L3VA 1HHSA 1TKZA 2EFGA 2M5YA 2QIFA 3HHLD 5BJRA 1UWAA 2LP4A 4F4KA 1BXNA 2N3LA 3D0IE 3T5HA 1S59A 1HWUA 2CQIA 1EP4B 3ILJA 2HZVA 1XN9A 4OZ3A 3M2RA 2E5LJ 3D66A 1IBKJ 3HHKA 2RRBA 3UQSA 3GIIA 4AL6A 3VAMA 1RISA 3C16B 1Q53A 5E7OB 1Q4RA 5B08A 2UVRA 3AHPA 1RZMA 3VHQA 3MM6B 2CKWA 3TRGA 5D0HA 2HRUA 2LMIA 5F0WA 3VAKA 4ECTA 5KT2A 3I5BA 3UN3A 3M9NB 4NEZA 3W61A 4QCLA 1OSCA 1S97A 1KWMA 2ZVIA 3T1YF 1FFSB 2XS7A 5BR8J 2CPZA 2L9WA 2NZCA 1TKTB 3GTYX 3OR1B 2CJQA 2V9KA 2D1CA 1KLNA 1P9QC 4F2SA 1XNQJ 3LW5C 2E5GA 3CC4S 1RCOB 2IDEA 3W8PA 2V2KA 3FQLA 3TJ8A 5DDPC 4JI8J 2EW9A 4C98A 3MECB 4FXWA 4WP8A 2DHXA 2QT7A 1SV5A 4GC6A 1QSLA 2EFPA 3MR2A 1P8GA 2K1RB 4RUBA 3V6HA 1EAYC 3FDSA 3H0PA 4H4KA 5KFLA 1G4CA 1S1UB 5ETMA 4JV1A 4LF8F 4CLZA 1DRZA 3KTQA 1UVNA 2CFXA 4KV8B 1FRXA 2B4UA 1FWLA 3EDQB 4TLQA 1NPRA 1H2TZ 1CJVB 1RT4B 4LSNB 5DRKA 5KFUA 3NGDA 1A9NB 1JKHB 5JMNA 4QOTA 4QQBA 4ZVGA 2AQ4A 5E3QA 2OAUA 3QPIA 1S1VB 4K5SA 1MN9A 3KK1B 4DN9A 2L9DA 3CJ8A 4P75A 4DCPB 5FDLA 4NCGB 1U4BA 1XK8A 1YGYA 5CD4A 1TKDA 3CJ2A 3DLJA 3VZIA 2J0QD 3NGKA 2FZCB 1NHKL 3H5SA 4FNIA 4F4XA 4IQXA 4C8KA 1KTVA 3Q2SC 4WE1B 1UVMA 2L41A 2COLA 4CCHA 3GSDA 4ZLLA 3MUTP 2CQ0A 5EUHA 3QIDA 4RU9A 2QA2A 5HAOA 4EO6A 1DTTB 3K5MA 3BH6B 3R9LA 3HDSA 4ECWA 4A8KA 3C46A 3ZZRA 4LF7J 4ILMA 3MCMA 1RT7A 3A3OB 3GJRB 2J9EA 4ELVA 3H2LA 3G86A 5EWEA 2FJAB 1S6UA 4KTQA 1NJYA 2OI2A 1JLAA 1WC3A 2A10A 2C2KB 3T1AA 2HK2A 3KLVA 1VOMA 4ZP7A 1YIJS 4PG6A 1UEUA 2CNOB 3PX6A 4LF4F 2BJ3A 4CO0A 4K4VA 3NY0A 5ETOA 2UUWA 1LW2A 1X9WA 4OI6A 4OI3A 1D0EA 1UFKA 2NQPA 1S1WB 1K1SA 4HHHA 4RPFA 1YZ7A 3VTIA 1MW7A 4WIQA 3KMQA 1MWYA 2VV5A 4IFYA 3ZZTA 2IMOA 1DHMA 1GQEA 2CDRB 2JC1A 2MGZA 5GADU 2VQEF 4P7TA 3O5TB 1B3TA 1Q86T 5J2PB 3FRZA 1ICEB 1EZZB 2GMJA 1M5HA 2DNNA 2JLEA 3CIMA 3G6YA 4NMLA 1NU4A 3MEDA 3T1HJ 1G3OA 1D9DA 4IH5A 2H5EA 1UA1A 2UUAF 3HMJG 1YSJA 4ECQA 2YKMA 1HYSA 3PW4A 3IWLA 2V0NA 1U2RA 1F9FA 1VQMS 3QATA 1R31A 3K5NA 1RQ0A 3A3PB 3LP1A 3QT8A 1N6QB 1SCJB 4NZ6A 4TYAA 1FRLA 1TL7B 2OPQB 3HKWA 4NL5A 2KB2A 1HD0A 2WW4A 3DHXA 3I56S 3KJNB 5FIIA 4DV7J 1V3ZA 1RYRA 1HWKA 2HQCA 1Q7LB 2LU1A 5E3AA 4F04B 4URQU 4YP3A 1GNKA 2ZM6F 2RU9A 4J9MA 4B9VA 2K7KA 4ZCMA 5HI7A 2VPZB 2Y1IA 4PQUA 2GS8A 1XJWB 2HZAA 1ZA2B 3LAMA 3SDEA 3G8TA 2PEBA 2OFGX 1LW0B 1EETA 2VFTA 2HVDA 3EMTA 4G1QA 3JSMA 2HWHA 1BLUA 1I94J 2Z30B 4JI4F 4RW9B 5IM0B 4V19J 3HT0A 3CCMS 4DR3F 3JSBA 2BR0A 2ZH8A 1T05B 4FF1A 4QWCA 2LDYA 3KWMA 4OYAA 3KLGB 3MFHA 5H1SV 1UFLA 3IAS9 4QW9A 1KFSA 3DLGB 1SKUB 2WAQD 3MEGB 3DRYA 5HJXA 4QWDA 1HBUB 3BSNA 3HHEA 3BKUA 4DR3J 1ZTTA 1AXQA 4I2PA 1BGXT 3HPOA 3TEGA 1R0BG 3IA0A 1VYAA 3OFEA 4RBVA 4LIRA 5CAAA 1D09B 2RT3A 5EN1A 2Z8QA 3CXCR 1AA1B 4B3TJ 1SQGA 3TAMB 4CO2A 3N9UC 2DPIA 1B7FA 2WBRA 1PJ6A 2CQHA 4F0KA 3G82A 2NXNA 1WEYA 3HVAA 4ANCA 1FF2A 4JI8F 4ZMMA 2LXIA 3HLUA 4PPDA 1CC7A 3UI3A 2RILA 3AT1B 3DRSA 4NMXA 5EHHA 5L39A 4M5IA 1HR0F 5E41A 2F4VF 1WC4A 5ETLA 2E66A 3UW1A 4YHHF 3MAQA 1U47A 2HVIA 4ILLA 1NJXA 1O51A 1U24A 2KYXA 2MLZA 4NA1A 2NZ4A 1RTJA 2KL8A 1XC9A 3PZPA 3VZHA 3CCWA 4HH0A 1Z4UA 2PT0A 2XG8A 3LALA 3AA9A 3GWCA 3TJ9A 4CLFA 3KYLA 4IKAA 4ZVHA 1N36F 1WDDA 4CTAB 5KFEA 3ZNJ1 1M1HA 2DHGA 4A48A 2XS5A 1UW4A 3AAWB 1R7IA 4Z7YA 1WHYA 4U7UK 2FVRA 5CHCB 2Y9HA 1R89A 2V34A 4L6V3 4FS1A 3R27A 5F3ZA 1RYSA 3HSZA 1TUGB 3S6EA 4ZP9A 4JI4J 1FRMA 2E1RA 2CAJA 4H4KC 2V63A 5A2QY 3W62A 2W9CA 2F8MA 4ELUA 4U7UD 4F8RA 4ED3A 4RO0A 1QAYA 3RG6A 5M2PA 4LR7A 3CO9A 3OL7A 2R8IA 3PX4A 2NPIA 3D4JA 4PXBA 2CJKA 3MXHP 1VQSA 3QRPA 2M0GB 1LWCB 2DHSA 5GAGU 1GXTA 2R4FA 4F4ZA 3CCVS 1IBMF 4CLTA 2NLWA 1Y10A 2HIQA 3TI0A 3RR8A 4HH1A 3MM7A 5LXRA 4DSJA 3D6HB 2J0WA 5JUMA 1P6TA 1ZZNA 3UR3C 4PZVA 1RHRB 1R8AA 1VIXA 3UFCX 1W2BR 2YY3A 1ZM9A 4DL4A 5E3RA 3HHLB 1UKUA 2FC8A 3P3DA 5KFSA 1N88A 3I5CA 2FLLA 1T3OA 1FTCA 1F5CA 1HIYA 2E1PA 3MM5A 3MM8A 4ZLJA 3OTOJ 4O0IA 1KHWA 2VASA 2KG1A 1FJGJ 1PYTA 3DRRA 5KG2A 4EYIB 1ZTWA 2M7SA 3DLLQ 3WC2A 3MR3A 4A8MP 4A8WA 2OPSA 3BR9A 4HDHA 3TOQA 4FF2A 3RYLA 3FBCA 4RBUA 3EGVA 1JLBB 4OYZA 5DZ6A 3HKZD 5GVQA 5D78A 1FJGF 4X65J 1E6VA 2DJWA 1JMTA 2W9BA 2OSQA 8AT1B 5D77A 1HWIA 2HVEA 1R0AB 5CXTA 4PG7A 1I5OB 1GMWA 3P96A 5E0OA 2PFDA 1CULB 3BEGB 1MLAA 3CCUS 2Y8WA 4JI5F 4DU8A 2D3ZA 4J9KA 2UUAJ 1FA0A 2DNLA 5KFNA 4PCQA 4HACB 3QQCD 3LA0A 3OTDA 3SBMA 5IV4A 4PWDA 1JJ2R 4RKUC 1FRHA 1QTNB 1RBAA 1QM9A 2GO8A 2OPRB 3CJSA 4R8UA 2AEJA 2G2OA 4JI5J 1FWPA 2HHPA 1X4EA 2R7TA 5CH7B 3TUPA 1WNEA 3J7ZT 3BJYA 1AUSL 1NSQA 4ZKAA 1FE4A 3CO0P 4L76A 3OTEA 1LK7A 1WC1A 2R8GA 5AXNA 4LF9J 3NP5A 3KK2B 1PCAA 2Y0SD 2OMOA 2FLOA 2QL7B 3ZZZA 4ED5A 4OL8A 2GO9A 2DEJA 4ZPAA 3NGRA 4LREA 2C22A 4OZ2A 4QPTA 1I6JA 2RKIB 3DHWC 4GVBB 4W98A 2ZH2A 1KS2A 3JB9k 2BDPA 2PI5A 1D8ZA 2HPUA 1GX6A 1BQXA 1M5PC 3WX8A 2RQCA 1O6XA 4ICLA 1U7LA 1YRTA 4FF4A 4DR7J 1KBRA 1T9TA 2ZJPQ 3LP0A 2KZZA 5F0UA 2L3MA 3SQGA 3ZNUA 4K4SA 3DOLB 1F0XA 3P5BP 4Q2LA 1TUVA 1TVRB 1IKXB 2V2ZA 1YDLA 3QZ8A 4ED8A 1UMJA 2CG8A 2HFUA 1SKWA 2C2OB 4TY8A 5DG8A 2JFKA 1NZ8A 1FFWB 4NPOA 3W2VA 1RT6A 2CQ1A 5IT4A 1WTBA 4ID8A 4DLGA 5HP1B 2CQ3A 1L3SA 2BACA 1JLQB 3OXLA 1WG1A 3JSYA 1DY3A 1UFWA 1TL3B 2M52A 3R5GA 4R25A 5KT7A 2R7WA 4F4WA 2J6SA 5A6PA 4RUCA 4LR9A 2WOMB 3FFIA 5K9FA 1BY9A 2Y1RI 2MQPA 3BO3A 5ETTA 2P2CB 2AT1B 2YPZA 3B82A 2VC1A 2WVDA 3HULA 5T41A 1BC6A 3HSGA 2GQCA 2GMLA 2EC0A 2ACYA 3L9ZA 3EPGA 1JNRB 1U09A 2HKEA 1X5SA 4NLGA 2H4WB 3P4UB 2KXFA 3HVTA 4OYPA 1OPIA 1U0HB 1RJJA 2EWHA 2DRDA 2O67A 3BYRA 4MK9A 4OV6A 4PABA 4Y00A 5FLXU 3CNQP 4V19X 2Z0GA 1Q5VA 4ATNA 2ZJRQ 2CNLB 4H54A 3AB2B 2Q79A 5JVGQ 4WP9A 3M2VB 5A8RA 2DNQA 1PKUA 4JV5J 2E1AA 1NXIA 4LFAJ 4I7FA 4ZVTB 2DIUA 1P27B 4U8VA 5KFQA 5DLFA 5AXKA 4DU7A 1LV5A 1HQEA 4ID5A 2RUGA 2FHOB 5IFMA 5T14A 2FYXA 4EBCA 1RE1B 1NEEA 4GO5X 3OJSA 4P6QA 3VAGA 2RQKA 1WEXA 3C6UB 2WONB 3G96A 2ROEA 1NK0A 5F8NA 3CIZA 2X3GA 3NBPB 3H5UA 4HHJA 1HWLA 2OKQA 8RUCA 4C8OA 3OR2A 3QYYA 4NLRA 3TVYA 4OV1A 4UY85 2JLFA 2LCWA 5D0GA 3NL0A 2EKYA 4M5HA 2I6WA 1NK8A 3PYGA 3SYZA 1VBXA 4YFUA 2OLWA 2IY5B 1FI4A 3Q8RB 2ASDA 1CJUB 3DMJB 2DHAA 1WORA 2AW0A 1F5AA 1U45A 1S76D 3MUMP 2KFZA 3M32B 2DNOA 2Y3YA 2GIFA 2YPYA 3BDEA 5KFJA 2KU7A 4URSA 3TUZC 1SC6A 1LWXA 4U96A 4GMKA 4K4XA 2K3KA 2H1YA 4LUBA 1TAQA 4QIVA 2V94A 3WBZA 1FJEB 2M8DB 2CPJA 2HQIA 1GMUA 3OQ2A 4I2QB 5GMDA 5IC4B 2D3UA 3OLAA 4KGZB 1XMQJ 3MPUB 4JI3F 2G2YA 2BJDA 4F2RA 3VV2B 1CLFA 2U1AA 3WQPA 4KIAA 1FO1A 2JX2A 6FDRA 2N4DA 3R97A 4YB1P 1KRPA 4CYUB 1L5UA 3DFEA 3MPDA 3HJVA 1GT8A 2L08A 4OFZA 5DLGA 1T02A 3CJ5A 4H4MB 2ZH9A 4QR2A 4C3MA 2XY5A 4WZMA 4M5KA 3J81Y 3H5YA 4YOEA 2ZH6A 4R0EA 5KFVA 3GCXP 1AT1B 4AE5A 2JJ4D 4G1PA 3PNIA 2R3VA 4K7QA 4P2XA 1TKZB 1IXKA 2BA9A 2V8VA 3D28A 5H9EK 1HNWJ 1WELA 2CJYB 2MZSA 2UUCJ 2E7XA 4NCGA 1PGZA 3NKYA 1YTYA 4OIXA 4FVMA 4QYRA 1SC4B 4O44A 1XERA 3IM9A 2C28A 1VQNS 2BANB 3DRXA 3A8EA 2BRKA 2XCAA 4E0DA 2VHGA 2J7WA 2C3PA 2DO4A 1H0HB 1KP6A 2GHWA 3AA8A 3D0GE 4MIWA 4OHXA 4Y3CA 2GJIA 2F8HA 3AB4B 2P5VA 3J81j 3BN7A 1PAUB 2X1GA 4UOHA 4QIWD 4LQ9A 1NK5A 4BHQA 4DL7A 3D54A 4KGMA 2ZH7A 4DV1J 1FKPB 2HG4A 2G9OA 4ZCIA 3MM9B 1VBKA 2JWNA 4I6WA 3SFGA 1JX4A 1VLOA 2QSWA 2HSEB 1FRIA 1SV5B 4RW6A 5K8NA 1JLCB 2B8PA 3CTRA 1HI0P 2IBKA 3HSDA 4JV2A 2BOAA 2HQDA 5FJ4A 2RRNA 4RNOA 4EZ9A 2GX8A 3I0RA 4B9LA 5B0DA 1VBZA 3EGNA 1U48A 2PFFB 4B9MA 2NYIA 5J1EA 2BJ1A 2XM3A 1VQLS 4USUA 2UZAA 2R9LA 4C7QA 1H74A 1UZDA 4CLUA 1VQPS 3QNWB 2ZBCA 2J6TA 5LJ5Y 2LVWA 5HQMA 2OD6A 2W8LA 2ZWPA 2VKZG 3O8WA 2MKIA 4N41A 1KVIA 2XWYA 1WWHA 3CEDA 1WOOA 1RSCA 5KT5A 4X62J 1LWFA 2MZJA 3Q8PB 1H38A 3KK1A 2VPXB 3OHAA 1FDDA 2DR6A 1UL3A 1HWJA 2IJNA 4MKYA 1FNXH 2BX6A 3OXFA 3OSPA 5KG3A 3KG4A 4USHA 3V6JA 1VR6A 2H4YB 2VG6A 4WE1A 4GVLA 2UU9F 2CPDA 3D6MB 4ETXA 2YTCA 2ZC3A 5A2QU 3L09A 2QFJA 4LFAF 2FDNA 4PXEA 2HBQB 3GONA 1TV6A 5KFRA 4CRJA 2DRBA 4PQAA 2HHHJ 4ZP6A 3I96A 3FQKA 3I55S 2OO4A 2HHXA 1DTTA 3CCLS 2LQ9A 4A8SA 3DXSX 2AEFA 3HFKA 1LXJA 3BR8A 2L9NA 3KUEA 3RTVA 2XMMA 3IS9B 1EETB 1LW0A 3W8GA 2FJDB 4EUVA 4YDDB 5HMZA 5KFDA 5CYJA 2WK4A 5CABA 1NJZA 4CI0B 4L3NA 4CH0S 3GLJA 4CLLA 3PFEA 1AZSB 3LUYA 2WVBA 1D1UA 5A8KB 2XMKA 4F7VA 2R8JA 4WYWA 4USMA 4G1IA 3GFYA 3HD2A 2PD1A 5E2QA 4X4VA 3ILLA 4K8RA 3POTA 5K8PA 2BEFA 2HW3A 4EMDA 1CBKA 3QRQA 4KGKA 2AJFE 1RAIB 1UWBB 1WJ9A 3C66A 5LSRA 3HX9A 4DZ6A 3M2RB 2A6OA 1JLFB 2FJXA 4GKJF 4J90A 1X4HA 3ETMA 5F8JA 1Q8KA 2OFHX 4LRDA 1OQ6A 1MROB 3RB6A 2GC8A 3RAXA 4YUDA 1RT3A 3EE3A 5J2PA 4N76A 2QC3A 3V2UC 1AFIA 1ZS6A 3B54A 3M30A 1FTRA 2ATLA 3BS9A 1WHXA 1RTIB 2XHWA 3BGOP 1NJWA 4ED1A 2HAIA 3PDNA 3HFZB 2VZ9A 4M5MA 4DR1J 2P8IA 1JJ4A 2BMBA 3ILIA 2GGPA 4K59A 5B0EA 4ALZA 5F8LA 3KHHA 1QY7A 3TARA 4C97A 3BSCA 3C6TA 2DR9A 2HRYA 3OR1A 4J9SA 3OD2A 3TZZA 4NYOA 2VKRA 3OJUA 4L73A 1FEHA 2BE2B 2RE1A 4IOCQ 1NB7A 4WWSA 1X4AA 4LF4J 2ZITA 2MQQA 2XMVA 5HN0A 3LPYA 5HATA 1DJ0A 2UUCF 3N01A 5JXSA 2CADA 4QW8A 2DHHA 2J5AA 2IM1A 5FD1A 2W9CB 2MYFA 5C7PA 2EFOA 2NR0A 5I42A 4XAKA 3ISZA 3N6NA 4RU2A 4UT4A 2HNDA 5IXUA 3KLGA 1FT8A 4DZDA 1VQ4S 1NH8A 3DRPA 2X1AA 3MF5A 2HHSA 2ASJA 2OSRA 2XLJA 1FKOA 2O3DA 3AH6A 3GIJA 4HVZA 1BE4A 2Q6BA 2RS8A 2X51A 2B5JA 2MDAA 1DFDA 2QYCA 1XR5A 3MM7B 4NLYA 5BYSA 1K47A 5FDLB 5HO4A 1LOUA 3EUNA 4DUZF 1MMLA 1UVIA 2MEWA 3FBBA 4N8OA 2VD3A 4NXNJ 2LEBA 2VC0A 5IWAF 4DV7F 1SJRA 3G82B 3V81A 3M8YA 1PIEA 3NEKA 4KGXB 3ZZYA 4CP5A 5J2QB 3DLEA 3C14B 5GAHU 3JQKA 4LIWA 4DFMA 5KFMA 2P9GA 5D8HB 2QE5A 4UZCA 1XIQA 1U02A 5MAOA 2IJFA 4JOUA 1DZ5A 4ZPBA 2PMWA 4JYAJ 3JTOA 5GAHI 1XNRF 1BWVA 1RT7B 1GMWD 2V4QA 5DQGA 4B3SF 1GFWB 4LRBA 1PC4A 5KFYA 1F2GA 4USIA 2HHQA 3RBZA 2F65A 2MQNA 3TZXA 1BQNB 1RWWB 4G6VB 4LR8A 1SB6A 5DM6Q 1QSSA 3RRGA 2DRAA 4F02A 1Q16B 4DSIA 2QX0A 3CCTA 4LF6J 3SMZA 4FS2A 5LOQA 2HFVA 1QE1B 4HYKA 3FCWA 3W5YA 4YMEA 3FZ2A 1KQGB 4OZLA 2VODA 2IRUA 4TU7A 3PRDA 1C1BA 1VQ7S 1U1NA 1RBOB 1H73A 1S1WA 2Y0BB 3GFHA 1WACA 3QLHA 3R7SB 3SSRA 7FD1A 2ZH4A 3C2PA 1WOSA 2B4OA 2V8DA 3B78A 1J5OA 2B56A 1PYOB 4GC7A 1SJFA 2YBVA 1LFPA 1J5EJ 1NNDA 4B9TA 1B0TA 1TMMA 2QO3A 4DXLA 2BOPA 2VG5A 4X4SA 3NGTA 2QFIA 3TQ1A 4IG3A 1S57A 4CH1A 2HHHF 2W2NP 1WSVA 3DU6A 4MTPA 5H9FK 2VDHA 2DD8S 2YKMB 3W1YC 1N54B 1HNXF 1H7XA 2J9DA 1B0PA 4UQTA 1FX4A 2ZKTA 2CPIA 3V6DA 2XGPA 2XBPA 1WI6A 2YWFA 1N6QA 3IAM9 2GW8A 4DR2J 2XTJP 3HHLA 2FJWA 4Q7AA 1VDHA 3H40A 2LEPA 1SUQA 1T95A 2O1PA 4PR6A 1R8CA 1HHTP 2R7VA 3MM8B 1JIHA 1VBYA 1X0FA 4OI4A 5D15A 1JLEA 2XZWA 1UVLA 3VGVA 2VQFJ 5F8MA 3MCOA 1TVRA 3IR5B 4G1QB 2UVWA 1HNWF 4HI1A 3M6UA 4L3KA 4TY8B 1T05A 3DDNA 2RMLA 2RDJA 7AT1B 3PTWA 4HI2A 4YB6A 2AJ1A 4Z37A 3DGVA 3CMAS 3VVTA 3UCZP 4J9RA 3JQMA 3DDKA 4ZJOA 1SH3A 3ET6B 1HBMA 4F3QA 1OSDA 3I9ZA 3U1NA 4ZN3A 4DR1F 4I2PB 3FFIB 2IVMA 3LPEA 1X5TA 3NRBA 2BXJA 1RDRA 4M5NA 3PXGa 2MZTA 3W5ZA 1ZAVA 1NKBA 2M9KA 3U27A 4B02A 2U2FA 3TAMA 1TL1B 2H65B 4I1TA 1YWXA 4JI2F 4B08A 4R8UB 4QIEA 2AJQA 3E01A 3KNGA 4USWA 3DCAA 3S7RA 2Q43A 2E7VA 3FJ2A 3I0SA 5DO2A 2Z4PA 2DNKA 3UDCA 1FD8A 1V9OA 4JI2J 4OZ0A 1CS4B 4D3HA 4Y0FA 5B0AA 2GVZB 5KG1A 1RWXB 4AXJA 1CJTA 1QUVA 3B4DA 3EM1A 3D0HE 4U67Q 2Z2LA 2DCUB 1HNXJ 1QTMA 1RTJB 4IRDA 1KOHA 2ASLA 1Y3KA 2C2RA 3DLHA 4I6YA 2D7SA 1HR0J 2CG4A 2R7XA 4C8YA 5AE1A 4IH7A 1E6YB 2IDLA 3C15B 5KT3A 2RKIA 2C2EA 2AZ3A 2MQOA 4TNOA 1HHQA 2AGQA 4EZ6A 2AF6A 4QWAA 1UPMB 4CWBA 5DG7A 2VFSA 3HCXA 3GZ7A 1FRKA 1O8BA 4WYLA 4NLXA 5THWA 2WSFC 3UDLA 4DUYJ 1CSJA 4HHUA 4KB7A 3SCKE 2I0XA 3TYTA 4W90B 5DS7A 3CCQS 1RLCL 1T11A 3D9BA 3KLEA 4Y2KA 2OMLA 1R6YA 3MEEB 3AD7C 4ZHRA 1S77D 1BMQB 1OS5A 1Y0HA 1IKWA 1NRKA 1WG5A 3KLFB 4RW8B 4JV5F 2UXDJ 4OI2A 5IWAJ 1WHWA 1UETA 3OL9A 1N4LA 1IJEB 4NCBA 2F40A 4LRAA 3V4IB 4DI6A 2RDIA 4DV0F 2OH2A 4OYOA 4RWWA 1RI7A 3EGZA 2A6MA 1F6TA 1VQ9S 1U25A 1K0VA 4MKAA 3IBCB 4JYAF 1T0TV 4RUHA 4NRUA 2OJ3A 2JLGA 2JVRA 1XNRJ 5C42B 2VFVA 4KFBB 3JYTB 3T9NA 3AY0A 3QRRA 4LRCA 1RA7A 1TUWA 1F9EB 4ZVPB 1GEHA 4DPOA 5IT9U 2JEFA 3PHEA 1N5VA 1U0HA 3HM9A 2UXCF 2XSFA 5KG7A 5RUBA 2JHEA 4ZPTR 1XMBA 3DRRB 3U1LA 2HNZB 1IQTA 4OJ1A 1X8DA 1DAXA 4NA2A 5A8WA 3FMWA 3MMAA 3EVMA 2OPSB 4OI1A 2YWWA 3N5BA 3HSJA 3GILA 2YKNB 1RT5A 4BC9A 3PJXA 4H4MA 3IRWP 2UXCJ 1RHKB 2GFFA 2QZ8A 4USVA 5CQGA 2C2DA 2JH3A 2W01A 3PIPQ 4A47A 2C2ZB 1X5OA 2J7KA 1B70B 4M1KA 4PWUA 2CJBA 3WIVA 4CDIA 2RU3A 3CSKA 4CLKA 3ZXWA 4IO9Q 4U9RA 1TL4A 1NJIT 3QFHA 3DC2A 2AZ1A 2V5HG 3EVOA 1SJQA 4O4GB 4DV6J 5J2NA 2DO0A 4JI0F 5LSOA 3LO3A 1RWKB 2B9YA 2K06A 3WDOA 2JDJA 2PO4A 3AQOA 1TL5A 4DR2F 5HL7Q 2WB4A 1GTHA 4C0BA 3J7AN 1KLMA 3FEYB 3SEOA 4O3RA 2KVQE 4MMOA 5CYQA 2A3JA 5LMUJ 2WVFA 3M8ZA 5G0RB 3F41A 2EK6A 1LKZA 1N0UA 2MHNA 3DMJA 4A8OA 3RR7A 4ZIWA 4DG1B 3RB0A 3VQTA 3PW5A 2N7CA 3NCRA 1IJFB 2CJXB 3MAAB 5DETA 4ELTA 2GCFA 1MG7A 2ZBPA 1G6BA 2E5JA 3B8HA 3G87A 3MECA 4FPIA 2CUYA 4KPCA 4OLOA 1Y3JA 4DDFA 1VQOS 1FCAA 4X4NA 5HBMB 2Q1LA 1KQFB 1FXDA 5LMNJ 3D1QA 2W2OP 4Q43A 2HFNA 2ALZA 3LP0B 2Z2YB 1XEZA 3LAKA 3DOLA 3SQGB 2W4PA 5GAEU 4K5RA 2GV1A 2MQ8A 2NS1B 1U8WA 3G2XA 3LANA 3KLHA 3FZBA 4HT7A 1D9FA 1R27B 3C19A 4ZA1A 1SL1A 2YWKA 1R8BA 4WJBA 3J81U 1R3NA 4DSEA 2MY7A 4YDXA 3MPVA 4I0WA 1LWFB 1IWGA 1JLQA 1LNQA 3LWMA 3IG1A 1QAIA 3U7JA 3IGNA 2NSBA 3D1OA 2WOMA 2EI5A 3J80Y 2YKQA 2OIHA 2I9SA 1EX8A 2DNYA 3M2UA 4FYXB 4UY8T 4OQJA 3MR6A 1RBLA 4KC5A 2XYGB 3AD9C 1BD6A 2GAGC 4TVAB 2ERRA 2H51B 4WCEQ 5MLCV 2R7SA 3D5MA 3D68A 1S99A 3EZUA 2NXCA 5IC6B 4WTYA 4YB5A 3NCQA 2KI2A 1U6BA 3KK3A 2IVFB 4A46A 5FLXY 5EDWA 2QA1A 5D4OA 1SBRA 2M4MA 3Q23A 4ED0A 4Q8EA 1S4EA 2NUUG 2J8SA 3M6XA 3A8JA 4QWEA 5CZXA 2E44A 1DBDA 1WF2A 2ZDOA 1JLAB 2J8AA 4KAIA 3NG8A 4DSKA 2BM0A 1W2IA 1IWAA 2ZVSA 4CO3A 3JTPA 4Q45A 3HF5A 1UAWA 4F0HA 5EWFA 3IWNC 1HQEB 5KFAA 3LGMA 1LW2B 1S9EA 4G3IA 1RA6A 1AFJA 5L9XA 2BKPA 5LT5A 1U1LA 1W25A 3W9JA 1FVQA 2HIYA 2MLXA 1DQ8A 2O01C 3H2VE 1JLFA 1UW9A 2AWZA 3C6UA 1RAEB 4Z2XA 2BV3A 2C2NA 4DQQA 2D3OR 1FWKA 5HROA 2MGZB 3N79A 4B3OB 2HHUA 1YBAA 3U1MA 3DM2A 1HA1A 3K58A 1RWMB 4LQ3A 3MWBA 1ITPA 2HGLA 1H3DA 2FJEB 4ZVSB 3ZZ0A 3G6XA 7FDRA 3DN9A 1Q82T 3PW7A 4DV3J 1UZHA 1KHVA 3A4TA 2AYGA 4Q8FA 3AXMA 2GGPB 1FRJA 4DL5A 4LBHA 4WFXA 2HHTA 1YJWS 3O2IA 3I6PA 3LOUA 4HTJA 2N7YA 1NBEB 1OPZA 1HLWA 1RXOB 2HQ3A 2LA6A 2PSZA 1S79A 4NZ0A 3ZTPA 2KFNA 2BE2A 2DPJA 2VG6B 1YQHA 1IUJA 1RK8A 1Z1ZA 3RU0A 2HHVA 4RW4A 2VBYA 3NGSA 5C25B 1K44A 3TQEA 2MZQA 1WKLA 5L9NA 3V6KA 1YJ9S 1RU2A 3SDEB 2DR8A 2IIHA 2UV8A 5J2QA 2ZBQA 1QJHA 4X4TA 5DDOC 3Q8SB 2XNRA 3HJFA 1YRXA 1MSWD 4KKOB 2PI4A 1NMEB 1YJUA 1B4SA 2DH7A 5A8KA 4NYZA 5DDRC 2FVCA 4QR0A 2JNJA 1QVGR 2AHOB 2IBOA 1HBUA 2VG7A 2ILYA 3CJRA 3TUIC 2IYGA 2V8GA 1RTHB 1TTHB 2MKJA 1SVDA 5IS2A 4IQMA 1UJ6A 4X62F 3PKYA 2VICA 1Y5IB 4KQZA 1GX5A 4DOZA 5M2RA 4OYWA 3ZO7A 4F25A 3E3XA 4NE9C 3UE2A 1ZETA 2AU0A 4NWBA 2QSFA 1MROA 4O3NA 4F26A 3O3LA 1XTZA 3DRSB 3RJMB 1NO8A 2KZMA 4YQWA 2FVSA 1SQEA 4B9NA 2VJUA 1MNEA 3GMGA 2VBWA 2HURA 3H5XA 2O66A 1WDTA 2ZE2A 3UPFA 2I5JB 3PYDA 2CPEA 5L8RC 1RAGB 1QSYA 3C6TB 1S1XB 2DKOB 3DNCA 1S1TB 2KO1A 2CA9A 2XMTA 3DKDA 3IR6B 3ZZOA 1RWUA 2M2BA 3CCSS 3PYEA 1YZ6A 4J9VA 9RUBA 3W2WB 2AX0A 3W9IA 5KFBA 2JZ5A 1RABB 1WC5A 4CLPA 1OYEA 4ZLPA 1O0PA 3OL6A 4YEAA 1JLCA 1C1BB 2W1BA 4DUYF 1JK9B 2YNHB 2XMWA 3D6TB 4B3SJ 4K2XA 5T7LA 4MYTA 2WSCC 5D4PA 2R7RA 2DNGA 3N4WA 3HXMA 1SJ3P 3I9V9 1IVZA 3Q24A 2KRRA 5HMWA 4O23A 4M5DB 2HBYB 5LSLA 4A8FA 4K4ZA 4YY3J 2QYGA 2IFXA 4C0OC 5AXLA 2G0CA 1KQSR 1S9GA 3OVAA 1I94F 2POKA 2KXNB 5D4NA 4A8XA 3ELHA 4DMZA 5SZTA 3QGHA 1FKOB 2CDQA 3W66A 1IKVA 3MCSA 3JQJA 4NLVA 3CVKA 3CDBA 3OFFA 3MDFA 3R5AA 2A18A 2ZFHA 4ZS6A 1RB0A 3FVYA 4X84A 2MZRA 2LKZA 3CMQA 2CQPA 2MY8A 4DX6A 4X64J 4DLEA 4MKBA 1RAAB 3BGRB 3R6GB 3QJJA 2YH0A 4DR6J 3ITHA 1OIAA 3NXZA 2HFSA 3J7YU 1TV6B 5HVGA 4B3TF 5EX3A 4MK8A 4FN5A 1C0UA 5KFXA 2VA2A 3MHYA 1QD1A 2GJ2A 1X4GA 4EK2A 1VC6A 3BBFA 3FSYA 3IS9A 3P6YC 2JSXA 4Y34A 3X3UA 2WVEA 4H4OA 2MHEA 2ALYB 1X60A 4L75A 3TA2A 5J1PA 3ZZUA 2XLIA 5J2MA 3QAEA 4DWIA 1E6VB 4JI1J 2W9BB 2ADBA 2YNFA 2DXDA 4MFBB 4DX8H 4PG5A 3PO5A 4IFVA 1KN6A 3BH7B 3Q83A 2XY6A 3ET6A 2YX1A 4L74A 3R7NB 5HJYA 5KFHA 3I32A 4P74A 3POTB 1PAEX 4JI1F 2N82B 4M95A 3TVZA 4WK1A 2D9PA 1HMVA 2W4DA 3ENWA 5K5MA 4QWBA 3CDAA 1UWBA 3H90A 4DUZJ 2LU2A 2OP5A 4S0MA 4W4MA 1R8PA 4LBIA 2A0FB 5KFFA 3Q8QB 3NNHA 4PAAA 1ZPVA 1XR6A 2CXEA 1FNOA 2KYZA 5D6GA 3GR1A 4NYPA 3R5CA 4WZQA 1B64A 2FHJD 5CA5A 5ETPA 3DGPB 1I51B 3Q22A 1RADB 1Q8LA 3CJ3A 2VG5B 2BRLA 4E8UA 2BJ8A 3UDEA 4MYUA 1F3VA 1K0TA 3W60A 3THVA 1APSA 3CD6S 1EB0A 2ABYA 2NXJA 2GVZA 2CJAA 1CJTB 4QPXA 2ZZNA 5ETNA 2CZ4A 3LGNA 1Y5LB 1HQUA 1S6QA 2RF2B 1OWXA 3MR7A 3V6DB 2VIHA 1DTQA 2R7UA 1PBUA 3JTNA 4GRSA 3GG0A 4GVBA 2HS4A 3QBCA 4DS4A 2R2SA 4DR6F 1EARA 2WVCA 3VAHA 4C0HA 4B3RF 1SUQB 3GR0A 3KDOA 2AYEA 1LQ9A 2F1FA 1VLYA 5ETVA 1NM2A 5H9EJ 1T03A 3R2CJ 3Q86A 2LECA 2CQGA 1TKXA 3GP9A 4NLPA 4K4YA 4UW2A 4Y6IA 3K5LA 4M63A 4DJBA 1UJ4A 2XS2A 2QA4S 1IKXA 4DEZA 4OX7A 1SH2A 3GYNA 4P2FA 2ZBIA 2C3YA 1C4CA 2GVDB 5CYMA 5I42B 3W2VB 1PG5B 3QJPA 2PMHA 1WG4A 3R5BA 3X1LB 5HP1A 3LGHA 1FKAF 1CG2A 1RU1A 2FGCA 2Z57B 2VBZA 3BV8A 2CWXA 4I67A 1KTQA 2R2RA 1REVB 3L7UA 5CCLA 5DGBA 3BGLA 2B5JB 3PEJA 2XQCA 2QA4G 2WCXA 5DJBA 1MU2A 1IKYA 3K7RA 3BN4A 1YJRA 4QYZK 4ZVEA 5DQIA 2C2MB 2MKCA 3E01B 4Y2CA 3KJVB 3CB4A 3GE9A 4F3OA 3THTA 1J2VA 2CRLA 3QZ7A 3I0SB 4RLEA 4R5PA 2R8HA 4V1Ak 4ZJLA 1BWEA 2E5IA 5DZ7A 5ADZA 1AYEA 5ETKA 3H25A 2HNZA 2BKNA 1YHQS 2VA3A 1VJWA 3T3FA 2EPIA 2UUTA 3AD8C 5A8WB 4DCJB 5E3PA 1YJVA 1Q81T 1PC5A 4OYMA 1S0MA 2YNGA 2I8EA 1H2VZ 4OYBA 3TX8A 4X4RA 1VK3A 4IUFA 3VAFA 1G7CB 1BUXA 1HNVB 1E6YA 2EBGA 1V5IB 2QLWA 4ID5B 2VFUA 4DPXA 3DOKB 4K2JA 4CQ1A 2YQ0A 3UD3P 4LSLA 3OFGA 2GAHC 3KUHA 4F36A 3QJLA 1QLNA 3M7VA 4NLDA 1HNIB 3Q89A 3AOBA 5BYQA 4ECXA 1QDUB 3CULA 1VHFA 2KRBA 3QLHB 4B9UA 1NHVA 3OR2B 3LWLA 1TK5A 4NOHA 1CJKB 3ZTQA 4WKYA 3RW7A 2OGUA 4DPUA 3KLFA 2VF3A 4RW8A 3MURP 1TAUA 2ZBRA 1VHIA 1C1CA 3CE8A 4LJMA 4ZPVR 3S1TA 2HGNA 3QGGA 3M4XA 4JB8B 4IG3B 3DYAB 2HBRB 3K5PA 1NDPA 1J5EF 1FEEA 2XMAA 3TW0A 2LQ8A 2O5DA 3MZIA 2FD2A 3CJKB 3SFUA 3VWSA 2A2CA 2DGUA 2BJ7A 2XEXA 3BYPA 4QIFA 5AE2A 3PX0A 3BQ0A 2JEJA 3MAAA 1FX2A 1WKKA 3PFOA 4DV4J 2UUBJ 1GH8A 3VGSA 3T19A 2AD9A 4RUAA 3ZTRA 5B0BA 1N33F 2CVEA 2KH9A 4LVOP 4C8MA 2M3DA 4IYQA 1TP7A 3T9ZA 2FJBB 3VQSA 3NOGA 2RIJA 3QWPA 4O3PA 4C2MA 3M6VA 4IR1A 3MMBB 3FNNA 4CT9A 1REGX 3MOZA 4UTGA 3OW2R 2FJVA 4OJ3A 2IAJB 4AXIA 3R3TA 1JLEB 2VU5A 2J6UA 3KHRA 3K57A 2XZDB 3CDEA 2GHVC 1ROFA 3P8BB 5IQQA 3NWGA 4XPEA 4A8YA 4Q0BB 2YKNA 3AJ1A 3N0VA 1UCNA 4AUKA 3QO9B 3ZC4A 2QTWA 1NK4A 5L1KA 1FVSA 3PM9A 4L72B 3M9MB 3CJ4A 2ZKUA 2IC3A 2MSTA 2Z2ZA 3OSNA 3R6LB 4ECRA 2MQMA 2DISA 4MH8A 1KVJA 3VAJA 2G13A 2QG9B 3L4BC 1M5VC 3KOAA 3UNYA 3SI8A 5SUHA 1MWZA 1TL1A 1RAHB 1VQ6S 1SJ4P 3I82A 1RAOA 3KG0A 1C0TA 3A1YG 4JUZA 3HP6A 4WTOB 4N8NA 5C24A 3LH2S 5KFGA 3NMAA 5G0RA 3TA1A 2DY9A 3PCOB 4DR5J 4AL5A 2DNMA 2HYIB 9ATCB 1RTDA 1X4FA 4KO0A 2BE9B 2QL9B 3D6FB 4PG4A 2HHWA 5H9FJ 2XY7A 4ECUA 4DV3F 3IFEA 3MMJA 3E8OA 5BXIA 4FBTA 1TFYA 1GMVA 4QIGA 3W7BA 1IBKF 1HI8A 3J7YI 1T8EA 2MKKA 3GV8B 4IRKA 2KKHA 2R42A 3BKFA 1H7WA 4NCAA 4J9OA 2EVZA 3R5JB 2IYIA 2EC2A 5IV3A 3M8RA 2BQUA 4PG8A 4DV6F 3HVRA 2ZZMA 2OD4A 3SIPB 3KLEB 1U1PA 3PKMA 3P49B 4B3OA 2EFQA 2YWEA 1VQKS 1Q8IA 3I5AA 2W25A 4ZN1A 2A1BA 4DPWA 4YS2A 3KLHB 3UCUP 2CQ2A 4JI3J 4O3SA 1RT1A 4DPTA 4DFKA 4FF3A 4RNMA 3J7A1 2YKAA 4K0KF 2VL1A 2B8QA 2EKNA 2JVOA 3MPYA 4ZPDA 3LP2A 1IR1A 1FDNA 1FD2A 2J9CA 2W7AA 3I4HX 3NLCA 2WB1D 4J9QA 2HRTA 2YKPA 1U49A 4K0KJ 1X4CA 2HZCA 4J5OA 3M2UB 2I2YA 5C42A 3GSIA 4N47A 4FBUA 3MGJA 4ERDA 1EHWA 1KOOA 2LYVA 3JS9A 3NWRA 1T9YA 3L95X 1NKCA 1HPZA 2W2MP 4OHWA 3TANA 2KHCA 2G1DA 2YX7A 2W8KA 3EICA 1FK9B 4ZK7M 2RDDA 2BQ3A 1K8AT 2L48A 3BM7A 1SQFA 2DGWA 3RZAA 5K8MA 3K59A 4LF5J 4C6AA 2DY1A 3O6QA 1VRUA 1S5ZA 2AX1A 3M1VB 4ZVUB 1SC1B 1S72S 1K73T 2HMIA 3MMAB 4HEA9 3CGIA 4JBCA 4RWXA 3QGIA 3ULHA 2F7VA 4UZBA 2E9TA 3MMCB 4YR0A 2HS0A 4KY3A 2V8PA 2R2TA 2VOOA 1CQMA 2B9XA 4XTTA 5D4LA 1IBCB 4MIAA 5DQHA 3WC0A 1WC6A 3OVSA 4NXMF 4RZRA 3R1LA 1NPKA 3PV8A 2D3O1 2W7OA 2OPPA 3KDNA 3OBIA 2PN6A 5F9NA 5AXMA 3LTOA 4OZNA 3BO4A 4K4WA 4FKYA 4ER8A 1S0NA 3OLBA 2F5GA 3HFVA 4J9UE 2IRYA 2V4JB 1A0OB 3EZ5A 4O4GA 1FDAA 1S4FA 2DH8A 3BBBA 5J2NB 1HKAA 1FE0A 1FFGB 1ZPWX 3DI6B 4F3MA 4F4YA 1B7YB 1RT3B 1NZAA 3DM2B 5HMXA 2GHPA 3H4DA 4J9PA 1GAOA 2B3TB 1IQZA 4B9SA 4JI6J 1S0VA 1N33J 1Y7PA 1RTIA 4ZCLA 3UO0A 5HVHA 4PEOA 1XQIA 2FUG9 5IOLA 2ZZTA 1U1KA 4WF9Q 1SIZA 2ZE2B 2I5JA 3DU5A 1VQ5S 2FHMA 4DV5J 4DG1A 2RD5C 5KG5A 3G8QA 3QIPB 3G6ES 1S1TA 2LA4A 2NCKL 1N48A 4RNNA 1LEOA 3KG1A 3T6JA 3TX0A 4ZIVA 1K1QA 3GJSB 4XDDA 5KG6A 1W7WA 2XO6A 2LXFA 2G0JA 3GYXB 4AYBD 1PJ7A 3NS5A 4DQIA 1QVFR 1OO0B 4AD6A 3FSXA 3KHLA 4JV0A 2Y8YA 3RRHA 4ED2A 2Q6CA 3UN2A 4DF8A 4J7CA 1X5PA 4N7TA 2RQMA 2YNHA 4LF5F 1VISA 3M9OB 2YNIB 3A12A 3DLBA 2RRAA 5T7LB 4N77A 4ED4A 2HNYA 1A6LA 3GV7B 2V2QA 5IT9Y 5KOWA 1TK0A 2HNDB 2UP1A 2K8GA 1YKWA 2BM1A 4KKOA 1Z2ZA 1RGVA 2LXUA 3SCJE 4QBUA 4DX5A 1G1XA 3TAPA 3DRPB 3HO1A 3O44A 2C3UA 1RT4A 4ZPCA 1JKHA 1CVJA 2YWHA 2X3DA 1WSRA 1LWEB 2A2DA 4LF1A 5DGAA 1RTHA 4FXVA 3ETOA 4DFPA 2JFDA 3CMES 3RBXA 3W9HA 1TMJA 3IG1B 1D8YA 1J27A 5B0CA 1SKRA 1HQ2A 2W7PA 2E9ZA 5E3CA 1ULRA 5F3TA 2DBBA 1MN7A 2W2PP 4K4TA 1WKJA 3HZGA 2F8EX 1IR2A 3WX4A 1RHMB 3CCZA 3C14A 2PEHA 3DLEB 2SXLA 5F8GA 4FYDA 4TQSA 3IC1A 2H48B 3QMQA 1ZYQA 4UF4A 1N34J 2DEIA 3CD5A 4FNHA 3GYGA 3RGIA 2LDIA 4QYZJ 1V3SA 3KK3B 2D74B 4DV5F 4KJIA 2DXEA 5J2MB 1FHTA 2XGQA 5GAEI 1S1XA 1BQNA 4KR0B 1Q8BA 4C48A 2OEMA 1VRQC 2YNFB 3FK4A 4MFBA 4LSZB 1U6ZA 2GIRA 4HTIA 4EI2A 3CCRS 1VFJA 2R8KA 1JXEA 4DSLA 3PO4A 3HHLC 2UXBJ 3W2WA 3D67A 1W26A 1H98A 1U1RA 5EWGA 3LF0A 3N6MA 2BE7D 2AGOA 1HMVB 4OYIA 4PRFA 4C3LA 1G2EA 2BBEA 4YN3B 1PO6A 1J5OB 3ZTOA 4IFYB 2V9WA 4CO1A 2QEXS 5K8OA 4DL3A 2F4VJ 1NCLA 3R7BB 5HROB 4EYHB 5DM7Q 4YHHJ 1NK6A 4M5DA 1NKEA 2Q66A 1Q0NA 3Q8YA 1RT2A 2G1HA 3UN5A 3M05A 3PW0A 2ZUAA 4DQRA 3ZZPA 1EKRA 1YITS 2BJ9A 3CJ0A 1NPPA 3I4PA 1LXNA 1WOPA 3ADAC 4OZ5A 4P52A 4WPAA 5A0YA 4EGLA 3R1HA 1HNZF 4ZPWR 4OI0A 5CCMA 4NLTA 3LP1B 2QN6B 4TN2A 1NK7A 6FD1A 2MB0B 4C4WA 4NZ7A 5L46A 1NAQA 3IBWA 1RAFB 4KH1B 1N5YA 4IDKA 4J37A 4LF2A 3CCES 1IBLF 2CQBA 4RW4B 3TO8A 3M8PA 3G71S 2VJVA 1TELA 4PQUB 2ZH3A 2KTQA 2D9OA 2H3EB 3JAMY 2RS2A 1UPPA 3KNAA 4FDFA 1WUUA 1JLGB 2OEKA 3CDWA 2OELA 3DDIA 2CQ4A 3KFWX 4BWMA 2E9RX 2JEIA 2ROPA 4OX8A 3CC7S 1JWWA 3OUYB 5CYMB 3GFZA 3G4SS 1EKSA 3ONQA 5KFCA 3JSRA 1GXLA 4UOGA 4YY3F 3BREA 4IFVB 2XSJB 4O4RA 4PPZA 4JI6F 4AL7A 1WTFA 1HBMB 2MLYA 2CNNB 4DUTA 4ZOSA 2H5IB 3MEGA 3FBEA 3NCPA 5F9LA 1HBNB 1VRTB 2LFVA 1REVA 1C4AA 1KVKA 1CC8A 2BZ2A 2HS3A 3KHGA 2XI3A 3GIMA 3G6VA 1RKJA 4K50A 1IKYB 2GQ2A 3M6WA 1U1OA 2FY1A 5A6WA 2YH1A 1VCTA 3PY8A 3DOMA 1TU0B 2DVIA 4FYVB 3P5TL 2LQ5A 4ED6A 3VCDA 3HZEA 1Q1KA 4IR9A 3HK2A 5ETRA 2EEYA 2ZH1A 3DGPA 1CPZA 1I3OB 4Y2AA 4CNYA 3GV5B 4PYAA 4DCOB 2B43A 2FZKB 4LF6F 3EWGA 1L3UA 1CS4A 5C5JA 2LQBA 2B6AA 2KT3A 2KVIA 3PJ9A 4FPRA 1BQMA 1VGYA 4URGA 1OMSA 4DR4F 2V68A 2DGQA 1B0VA 4KYZA 3GIRA 4PXDA 2N3OA 3CW2C 1L3KA 4FP9A 1AB8A 5KG4A 1NSAA 5KT4A 3KMSA 2R2UA 3ENQA 1Q7YT 2C3OA 5K20B 1ZZFA 2RAQA 1X9MA 1DTQB 3C15A 2CIMA 4U8YA 3AXKA 1U1QA 3R2DJ 2K3IA 3AOAA 3BSOA 3OVBA 2IJRA 1AW0A 4OHVA 3EYZA 1M5SA 3BQ2A 4DV4F 2G4BA 3BDPA 4RNFA 3NAHA 1ZM2A 2MZ1A 3OPKA 1S0OA 2V8HA 3MEEA 2XC9A 1R0CB 1IKWB 5KFZA 1RWNB 2B51A 5I4MA 2MXYA 5GAGI 2ATCB 4RBTA 1HFEL 2BVZA 3H98A 3K8WA 3V4IA 1S6PA 1YK9A 3BF4A 4EFAC 2IM2A 2QMXA 4NI2A 4BLGA 2QLBB 1YJNS 3P45B 1CEZA 4LFCF 3EGWB 2ZNYA 1GXUA 2KT5A 2V2VA 2B7BB 3HVWA 4Y2IA 1IKVB 2VB6A 3KUGA 2BKOA 3CJKA 5M2UA 2G0IA 2W24A 2MMYA 1OJ4A 5LM7E 5C2CA 1N5QA 3EDRB 3FUYA 3MD3A 3MPWA 2M8HA 4DR7F 2MKHA 3A8KA 4DV2J 3CD0A 3OV7A 2NREA 3QGPA 1VK8A 3UWTA 2R7OA 2VOPA 4LFBJ 2MJUA 2CZVC 2B9WA 2P6SA 3GB0A 1FDBA 4PUOA 2FLNA 1KNZA 1C0UB 2WRMA 3K17A 4OLPA 2AP6A 2G2ZA 2GNKA 2ACMA 2RNEA 3PJWA 3V4MA 2BABA 2KM8B 3VALA 2E5HA 3M8QA 3PW2A 2CPYA 1WD6A 3SV4A 3JAMU 1RT5B 3EVWA 4H4OB 3AJDA 3RUBL 3VF0B 3CC2S 1PYSB 2YNGB 1SC3B 2ROGA 4DQSA 2PIIA 3HD1A 4TU8A 2H54B 3HHDA 3IMQJ 4ZVRB 1N5TA 4I69A 2NUHA 3TP2A 1HNVA 4DL2A 1R0AA 4EEYA 1M5OC 4HL9A 1HD1A 2XULA 3HT3A 4LSLB 3TZWA 5I3UB 2MTLA 4USTA 1EP4A 3SXLA 2ZHBA 3NNCA 4X4PA 2IA6A 5KFTA 3FMBA 4G65A 3KJFB 4CM0A 1KFDA 3L7OA 5KFWA 1F9HA 2VH7A 2IM3A 5AJ3J 3C16A 1URRA 4C8LA 2OPRA 3DLKA 2HEKA 1Y5NB 5HLFB 4NEYA 4NX9A 2YWGA 3K8VA 2OTLS 1KLMB 4USJC 3TWZA 1C1CB 2ZUGA 5CYQB 4XK8C 4ZDNA 4KHPF 2W4CA 2CNKB 4OYXA 1WEZA 2IRXA 5C24B 5AJ3F 3KLIA 4XIUA 4B3MJ 2FVPA 3AODA 4DPYA 3GG1A 1NUEA 4OJHA 2NPFA 1RTDB 2AYBA 2ZOGA 3UD4P 4ILRA 4KO0B 3NMRA 3G9CA 3D2WA 2WSEC 3IRXB 4KBIA 1HBOA 1UEKA 1UTAA 2HQGA 1NH7A 1HQUB 1ACMB 1S6QB 2RF2A 3H42A 4TYBA 5ETSA 4C11B 4DV2F 2ZD1A 4WFAQ 2F63A 3AQPA 4P7VA 3V5RA 3Q2TC 1QAJA 1DLOA 2EFNA 5D3GB 2K1RA 4DN0A 5HBMA 4OX9F 4KPYA 3SV3A 2J0SD 3PYFA 2BW7A 4IOBA 4A4JA 1UP1A 4O3QA 4O0NA 4M5GA 5F8IA 5JJBA 1GK8A 1SPBP 4B3RJ 4KV8A 3PHTA 2KXHA 3C8YA 2PDAA 1P9YA 4CO4A 2DGOA 4HLBA 2GA7A 4LSNA 4WK3A 3OTCA 1S49A 5K14A 3UVJB 3NS7B 4AFFA 4Q44A 4I64A 4Q5VA 3CT9A 1YX2A 2YKOA 3IO1A 3D7SB 2WHOA 1UEVA 2PMZD 3WIUA 5GMKa 3H20A 4RW7B 4X2BA 5KT6A 2DR7A 4NLQA 2ZHOA 3G8SA 1T9UA 2DXFA 1U2CA 3F56A 3ZFVA 1XMQF 2BJEA 1MU2B 1VQ8S 3GIKA 2BUNA 4PKDB 5LL6d 1KDNA 3VAIA 1Y00A 1N32J 1HW9A 2APOA 3KXDA 4UUWA 3TZYA 4J9LA 1FXRA 3HVTB 5G4DA 4JI0J 2DGVA 3OL8A 3IP0A 1VIOA 5HQLA 2DCLA 1WC0A 1P1LA 1RHUB 1VRUB 1SH0A 4DL0C 4YR3A 1XMOF 2DNHA 2Z58B 3M1VA 3KKFA 1NHUA 4OMFG 2HMIB 1PSDA 2IA0A 4M5JA 4XO0A 1LK5A 4IG0B 3LQVA 3HHNB 5LMUF 2GMHA 2EG2A 3EZOA 3M2VA 2X1BA 2VDIA 3UD5A 4E2FB 5A8RB 1U1MA 1TFWA 2KFYA 2FGOA 2AV5A 4I6AA 1T9WA 4JI7J 1XR7A 5DDQC 1S9EB 1ZAWA 4QU7A 3B4MA 3QT6A 3FSIA 3N5FA 3MTJA 4MJKA 2B0GA 4HKQA 1SI9A 2DT9A 2OPPB 2B9EA 1PILA 2DGXA 2CQDA 1WHVA 1WF1A 1HNIA 3BB5A 4OZJA 1ELOA 4JI7F 2QMWA 2WTFA 2V69A 1BHNA 4TU9A 4P9SA 2B7CB 2ZDPA 1OY9A 1HW8A 2RH3A 1UJ5A 3F44A 4LRFA 3FCVA 3MM6A 4CM2A 3R5DA 4WU2A 5KFPA 4FYWB 1VC5A 4AQYJ 2PC6A 4DR4J 4P2MA 4FYYB 2QLXA 1V6HA 2P9EA 3FKBA 4DV1F 1YJTA 3DYAA 3LP2B 3MI7X 5B09A 1UA0A 4Y28C 1FJCA 1ZOTA 2B4PA 3MEKA 4RR5A 2X1FA 3EXCX 1RUSA 1YG0A 1JNZB 3RBDA 1RHJB 4IH6A 4UOCA 4B17A 1TL7A 4NLWA 4AQYF 2E7WA 5KAKA 1F3FA 4X4OA 1JXLA 3MCNA 1T9VA 1FNMA 1N32F 2VPYB 5C25A 4NRTA 4OZ1A 2KJWA 4GKKJ 3K0JA 4I2QA 4W92B 3K2YA 1GTEA 2UUBF 3SCLE 1Z2LA 5U47A 3BGUA 2GQQA 1H2UX 2YNIA 1Q5YA 3MMBA 3JSMB 2AJ4A 4ECVA 2IHR1 3IGVA 4YR2A 4LF7F 2IAJA 1S7HA 4C9DA 4TY9A 2OHDA 2XZTB 1O5JA 2ZOMA 3H59A 4WP3A 4KGVB 3GJTB 1C2PA 1CJVA 5ETQA 2LEAA 4CH7A 2OTJS 4ENOA 4U7CA 2X7IA 5F8HA 2I38A 2VG7B 2NXUA 1X31C 4AT1B 2HBZB 4U6PA 2F9JA
chains in the Genus database with same CATH topology
4HR2A 1W7WA 3Q8UA 1VYAA 3VGUA 5CAAA 4KPCA 4W98A 3WX8A 1NLKL 3Q86A 3GP9A 4ANCA 4O0NA 5C7PA 2HURA 1U8WA 3G2XA 2DY9A 3PJ9A 4UOHA 1JXVA 3EM1A 3GPAA 3EJMA 5BXIA 1BE4A 1MN9A 3DKDA 1NDCA 3L7UA 2DXFA 2AZ3A 1HHQA 4WBFA 1NHKL 3FBBA 1MN7A 2DYAA 2B8PA 1WKJA 1KDNA 4CP5A 3BBCA 3VVUA 3BH6B 1XIQA 3R9LA 3FBFA 3FC9A 2DXEA 4DI6A 4F4AA 1NDLA 3ELHA 2B8QA 1F6TA 1PKUA 1BUXA 1NB2A 2BX6A 2CWKA 3FCWA 4FKXA 1NSKL 4F36A 1EHWA 3JS9A 1NDKA 4ANEA 3Q89A 3EICA 3ZTOA 1HIYA 1BHNA 3ZTQA 1NCLA 4C6AA 3FCVA 4ANDA 4EK2A 1S5ZA 3BBFA 3VGTA 5CABA 3EVMA 3NGTA 3FBCA 3Q8YA 1S57A 3EVWA 3NGUA 3FKBA 2ZUAA 1NDPA 2DXDA 2HVEA 3BH7B 3Q83A 1HLWA 2BEFA 1WKKA 3ZTPA 1NPKA 1PAEX 3VGSA 1F3FA 1LWXA 3Q8VA 1S59A 3ZTRA 4FKYA 2AZ1A 4DZ6A 3EVOA 3NGSA 4S0MA 1K44A 3ETMA 3BBBA 1WKLA 3B6BA 3EE3A 1B99A 2VU5A 1ZS6A 1NSPA 2HVDA 3B54A 3DDIA 3EMTA 4UOFA 1NSQA 3VGVA 3MPDA 3ZTSA 1XQIA 5IOLA 1B4SA 1UCNA 1NUEA 3ENAA 4UOGA 4ENOA 3VVTA 2NCKL 3PRVA 4DUTA 1LEOA 3FBEA 3NGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HR2 A;  1W7W A;  3Q8U A;  1VYA A;  3VGU A;  5CAA A;  4KPC A;  4W98 A;  3WX8 A;  1NLK L;  3Q86 A;  3GP9 A;  4ANC A;  4O0N A;  5C7P A;  2HUR A;  1U8W A;  3G2X A;  2DY9 A;  3PJ9 A;  4UOH A;  1JXV A;  3EM1 A;  3GPA A;  3EJM A;  5BXI A;  1BE4 A;  1MN9 A;  3DKD A;  1NDC A;  3L7U A;  2DXF A;  2AZ3 A;  1HHQ A;  4WBF A;  1NHK L;  3FBB A;  1MN7 A;  2DYA A;  2B8P A;  1WKJ A;  1KDN A;  4CP5 A;  3BBC A;  3VVU A;  3BH6 B;  1XIQ A;  3R9L A;  3FBF A;  3FC9 A;  2DXE A;  4DI6 A;  4F4A A;  1NDL A;  3ELH A;  2B8Q A;  1F6T A;  1PKU A;  1BUX A;  1NB2 A;  2BX6 A;  2CWK A;  3FCW A;  4FKX A;  1NSK L;  4F36 A;  1EHW A;  3JS9 A;  1NDK A;  4ANE A;  3Q89 A;  3EIC A;  3ZTO A;  1HIY A;  1BHN A;  3ZTQ A;  1NCL A;  4C6A A;  3FCV A;  4AND A;  4EK2 A;  1S5Z A;  3BBF A;  3VGT A;  5CAB A;  3EVM A;  3NGT A;  3FBC A;  3Q8Y A;  1S57 A;  3EVW A;  3NGU A;  3FKB A;  2ZUA A;  1NDP A;  2DXD A;  2HVE A;  3BH7 B;  3Q83 A;  1HLW A;  2BEF A;  1WKK A;  3ZTP A;  1NPK A;  1PAE X;  3VGS A;  1F3F A;  1LWX A;  3Q8V A;  1S59 A;  3ZTR A;  4FKY A;  2AZ1 A;  4DZ6 A;  3EVO A;  3NGS A;  4S0M A;  1K44 A;  3ETM A;  3BBB A;  1WKL A;  3B6B A;  3EE3 A;  1B99 A;  2VU5 A;  1ZS6 A;  1NSP A;  2HVD A;  3B54 A;  3DDI A;  3EMT A;  4UOF A;  1NSQ A;  3VGV A;  3MPD A;  3ZTS A;  1XQI A;  5IOL A;  1B4S A;  1UCN A;  1NUE A;  3ENA A;  4UOG A;  4ENO A;  3VVT A;  2NCK L;  3PRV A;  4DUT A;  1LEO A;  3FBE A;  3NGR A; 
#chains in the Genus database with same CATH topology
 1Y11 A;  8ATC B;  1QUP A;  2BYC A;  2FPH X;  2IC3 B;  1YLX A;  4IO1 A;  4U95 A;  1JB0 C;  1EQM A;  5IT0 A;  4ES1 A;  1U2F A;  4EBE A;  1ZM4 A;  2EK1 A;  2FY8 A;  5GAD I;  1R6V A;  1CQN A;  1NLK L;  1H6K X;  1P1T A;  1RHQ B;  1SXL A;  3BO2 A;  2BAN A;  1IM4 A;  4M94 A;  2HFZ A;  1S9F A;  3I31 A;  3W64 A;  1RP5 A;  2YQ1 A;  4ZCK A;  2DIV A;  2VUG A;  2XHC A;  4Q2M A;  4C8Z A;  1YBT A;  4LT6 A;  3MFI A;  4CZC A;  2FVQ A;  2J7U A;  4RJV A;  1ZH5 A;  4F50 A;  3T5J A;  1N8R T;  2RUS A;  2AMC B;  1N0V C;  5GME A;  1LFW A;  1TKT A;  3QIP A;  1D9A A;  2NSC A;  2I1R A;  1IBM J;  3EJM A;  3E2E A;  2RJZ A;  1T3N A;  1M0S A;  4ECS A;  4KHM A;  4DR5 F;  1FKP A;  5HSP A;  3MM9 A;  4LVN P;  3J80 U;  4GKJ J;  2J76 E;  1N34 F;  4WBF A;  2QL5 B;  1T9X A;  2VFR A;  2DYA A;  4PYD A;  2MKS A;  1X4B A;  1ZA1 B;  3IR7 B;  2P9C A;  3BPS P;  2P6T A;  4QR1 A;  3TA0 A;  1R43 A;  4TXS A;  4ECZ A;  1D3W A;  1S1U A;  1U6F A;  1T94 A;  1X7V A;  4DBQ A;  3VVU A;  4EO8 A;  2CZ9 A;  4ECY A;  3CDU A;  2XYP B;  3A8I A;  3L7P A;  1S9G B;  2DNZ A;  2UXB F;  4FZV A;  2DH9 A;  2IPO B;  1RT2 B;  1OYD A;  1WI8 A;  2D69 A;  1S6O A;  3AFG A;  3OFH A;  1SL2 A;  4LMZ A;  1LWE A;  3UCG A;  2RVJ A;  1S1V A;  2ZNZ A;  4CNZ A;  1KD1 T;  4X4U A;  1F5B A;  3MD1 A;  5HAN A;  3T5L A;  2CPH A;  1NB2 A;  3M8W A;  5JVH Q;  1XMO J;  1NK9 A;  2ZJQ Q;  1FER A;  2GJF A;  1YBU A;  2AJ0 A;  2VPW B;  1F60 B;  2YVS A;  4NAS A;  1TK8 A;  1KC8 T;  3BGR A;  1XWL A;  2V50 A;  4ANE A;  2E29 A;  2XWX A;  2PE8 A;  2HLT A;  3ITH B;  1RAC B;  1S48 A;  3TNV A;  4NXM J;  4DS5 A;  4NLS A;  2CJ9 A;  3AOC A;  5J1N A;  3CUN A;  1EQ0 A;  2DGT A;  5L1I A;  4HDG A;  3SSS A;  4ZVQ B;  1RWV B;  1M5K C;  2RSQ A;  1RLD A;  2VON A;  3A13 A;  4OHY A;  5A76 A;  2GIQ A;  4AND A;  3T5K A;  1ARO P;  1JLG A;  5HMY A;  2JL9 A;  4O3O A;  5B7W A;  1HNZ J;  2CQC A;  4RW9 A;  5IM0 A;  3HI9 A;  4NXN F;  5KTQ A;  3NGU A;  2C1E B;  3QT7 A;  3OUY A;  1AZS A;  5HVF A;  3RAQ A;  3C3L A;  1SIW B;  3GQC A;  3DLG A;  2AJ2 A;  3T1H F;  2M70 A;  3ISN C;  1HBN A;  5L38 A;  2M88 A;  4RL1 A;  5KOX A;  1I1G A;  3QAU A;  3BZQ A;  3D3C J;  4DF4 A;  4BCA A;  3Q8V A;  2HVH A;  5L1J A;  2XMU A;  2QMU B;  1FES A;  3ENV A;  2XLK A;  4PWD B;  3UR0 A;  2YXL A;  3OXG A;  1X0P A;  4ZP8 A;  5IQ6 A;  2Q3P A;  2V4J A;  1RTZ A;  1T7P A;  2ASY A;  1UVJ A;  4OHZ A;  1KON A;  1OY6 A;  2LQJ A;  2XYH B;  3B6B A;  3DI6 A;  3O1L A;  4I4B A;  4P2S A;  4KT0 C;  2QRR A;  4BWJ A;  1DQ9 A;  1B99 A;  1KR4 A;  4EU0 A;  1K9M T;  1NSP A;  2IVY A;  3T6B A;  2XB2 D;  4UOF A;  2EFV A;  2ZM6 J;  1MMD A;  3M30 B;  3MED B;  1RCX B;  3PR5 B;  3RBE A;  3W65 A;  1IR0 A;  3A3N B;  4HT5 A;  4ETZ A;  2FHJ A;  2EG1 A;  2ZWO A;  4MKV A;  1HYS B;  4JP8 A;  4KSE B;  3QT5 A;  3F73 A;  3PEH A;  2V4R A;  3PRV A;  1H72 C;  5A0Y B;  1URN A;  4LFC J;  2AIR B;  4HR2 A;  2Z2M A;  4FXD A;  3CJQ A;  2OPQ A;  4M8L A;  4WU3 A;  4Z7C A;  2FQQ B;  3Q8U A;  4ZIT A;  2FIU A;  2DNP A;  4CTA A;  4X4Q A;  1N5Y B;  4IDK B;  4OJG A;  5E5N A;  2JC0 A;  3WZ0 A;  3TUJ C;  1T03 B;  1N5S A;  3M8P B;  2CYY A;  2DR5 A;  4X64 F;  4OX6 A;  2VQE J;  1TKX B;  2ZH5 A;  3FEX B;  1DAR A;  4MT1 A;  2NXE A;  5HK4 A;  5DG9 A;  2KN4 A;  2MJN A;  2XMJ A;  2FLP A;  4LFB F;  3MUV P;  2HLU A;  2HNY B;  2BQR A;  3N28 A;  2GVD A;  5B0G A;  3AJ2 A;  4RNH A;  2OEJ A;  5KG0 A;  2UXD F;  2UVU A;  5BYR A;  2RHQ B;  1MMN A;  2YX4 A;  3W63 A;  3EPI A;  1JXV A;  3CD7 A;  1U26 A;  1TQL A;  2XSJ A;  5D0E A;  2MQL A;  1LWC A;  2MPU A;  3SSQ A;  1VQY A;  1R8H A;  2Z56 B;  1A7G E;  1FXL A;  5D0R A;  3UDV A;  4C3K A;  1SL0 A;  1VRT A;  1RWP B;  2EBE A;  2XNQ A;  3NAI A;  3TR5 A;  3H2U B;  4ITS A;  4X66 F;  2PA3 A;  1YRU A;  2KG0 A;  4Y65 A;  2HK3 A;  4D3G A;  3FRY A;  3E51 A;  3KJQ B;  3NS6 A;  4B3M F;  3DOM B;  3GJQ B;  5F41 A;  3THP A;  5CD4 H;  3RB3 A;  2DB1 A;  2FC9 A;  2JRS A;  3KJV A;  3V81 B;  4C8N A;  1N36 J;  1JJC B;  3PVX A;  2E1C A;  2VQF F;  4R5P B;  4P73 A;  3MM5 B;  1F2H A;  1ZBT A;  3MTK A;  3QSI A;  3BBC A;  4TQR A;  5HQ8 A;  2AGP A;  4PUO B;  5I3Q A;  2D41 A;  3W5X A;  3K5O A;  2YQ3 A;  2BW2 A;  1VI7 A;  2DNR A;  4PWW A;  3EXY A;  4MAK A;  3RB4 A;  4LBP A;  2EXU A;  1JLB A;  5B0F A;  3IM8 A;  3OT9 A;  1UVK A;  3S8S A;  4MK7 A;  1Q78 A;  2V67 A;  1RKI A;  4P72 A;  1OQ3 A;  4KHR A;  1FJ7 A;  3DOK A;  4DSF A;  1VS3 A;  3ISN D;  1CUL A;  2H5J B;  4FKX A;  3RAM A;  1QE1 A;  3IWX A;  3MR5 A;  2K2P A;  5I3U A;  1AUD A;  2ZEJ A;  1XBW A;  2FHK A;  3MAH A;  5C2G A;  4K4U A;  5LJ3 Y;  1NDK A;  4J9N A;  3BSA A;  2WON A;  3J7Z 5;  1OY8 A;  4ZVO B;  1TR0 A;  3NBP A;  2QGF B;  4EWT A;  4GO7 X;  1CJK A;  4OX9 J;  1JJH A;  2ZC4 A;  1Q95 G;  2FZG B;  2RQ4 A;  1N56 A;  1KSP A;  1KEK A;  4I68 A;  4F0M A;  4A8Q A;  5KFI A;  2PA8 D;  1Y4Z B;  1YJ7 A;  2QLJ B;  4Y2M A;  1S6P B;  4KRW A;  4NI2 B;  4P71 A;  1TZ0 A;  1U0S A;  1HL6 A;  4XPC A;  3H4B A;  2XO7 A;  2ADC A;  1IM6 A;  3T41 A;  2HAF A;  2E5L F;  2DK2 A;  3JXO A;  5I3P A;  3M32 A;  2E1M C;  2F9D A;  3FCH A;  2DIT A;  2Y1L B;  1S12 A;  1HBO B;  3I87 A;  2AKW B;  3IRX A;  4WFB Q;  3ICL A;  4M5L A;  4NLU A;  4XDC A;  4E98 A;  3Q0A A;  4BDP A;  4C11 A;  3PAC A;  4QZV B;  3R8Y A;  2NYH A;  3BKT A;  4NA3 A;  3W3S A;  2W9A A;  1RWO B;  3GCW P;  4WXW A;  3IN5 A;  3N6L A;  1EIY B;  2HVZ A;  3PRB A;  1WF0 A;  4TKT A;  4BC7 A;  1N52 B;  3T1Y J;  2H9Z A;  2F3J A;  5BR8 F;  4ZVF A;  1PBA A;  4CYU A;  4N56 A;  4ES3 A;  4DV0 J;  1XNQ F;  1IBL J;  4Q0B A;  1X4D A;  3ZTS A;  2ZHA A;  2MSS A;  3QO9 A;  4ZJQ A;  5ITH A;  4CLS A;  2V6A A;  4UQG A;  3M8S A;  1QAX A;  4DFJ A;  1RT6 B;  2K7J A;  3ENA A;  4CT8 A;  2UV8 G;  4CLW A;  5AE3 A;  6AT1 B;  2MKY A;  2OUG A;  1SJ1 A;  4N5S A;  1TL3 A;  3DXB A;  3TJA A;  2J9D E;  2WZ1 A;  4RX6 A;  3SCI E;  1M1K T;  4LF9 F;  1F1B B;  4LF8 J;  3VGU A;  1KQK A;  1M90 T;  3D1H A;  1EJ7 L;  2F4F A;  4HAC A;  4O44 B;  1YVF A;  2RHS B;  3VR1 A;  3OTO F;  1V3R A;  4WII A;  2QJ3 A;  4J91 A;  5EX0 A;  2C42 A;  2KDO A;  3ILO A;  2DGS A;  3DLK B;  3BGF A;  3SZ2 A;  4DQP A;  1RAJ A;  5HLF A;  4BS2 A;  1C0T B;  3GFX A;  1L3T A;  2JEG A;  2PGC A;  3NNA A;  2KHD A;  5EGY A;  4IRC A;  2VBX A;  3KLI B;  1DQA A;  4BBY A;  2IM0 A;  4X65 F;  2FTR A;  5AT1 B;  1M1G A;  3GU0 A;  3RRK A;  2B6A B;  1VC0 A;  3KK2 A;  1BQM B;  4CLY A;  1S10 A;  4IOA Q;  3TAQ A;  3QWU A;  4WKR A;  4IG0 A;  3RW6 A;  3GPA A;  4ED7 A;  2QLF B;  3NOC A;  4WFZ A;  3TVK A;  4CO5 A;  2R7Q A;  2Y1J A;  2WW8 A;  4DHV A;  3QFW A;  4ZLN A;  5IZH A;  4I7F B;  1X9S A;  3CF5 Q;  1NDC A;  3FGV A;  2UVV A;  2HGM A;  2ZD1 B;  3FEZ A;  3BPD A;  3UNG C;  3H7H B;  4RW6 B;  1DLO B;  4CIO A;  5D3G A;  4UUX A;  3K89 A;  4WXO A;  3QSY B;  3CJT A;  2AEM A;  1JQG A;  4ICL B;  3OHB A;  2B4V A;  2HWT A;  5CZV A;  3I0R B;  2J0X A;  2CPF A;  4R0J A;  1V5V A;  2GZO A;  4PXC A;  4X66 J;  5KFK A;  2HFO A;  1HAR A;  2JOQ A;  2HWI A;  1ZM3 A;  3F0N A;  5J1E B;  3EX7 B;  5L1L A;  4GKK F;  1DUR A;  5KFO A;  3CWJ A;  3PG9 A;  3TEH B;  4ZHR B;  5LXY A;  3IXQ A;  4KH0 B;  4WFN Q;  3L3C A;  3FBF A;  1Q79 A;  1RT1 B;  4EBD A;  5K14 B;  3UVJ A;  3US5 A;  4DL6 A;  1SKS A;  1VMB A;  3FC9 A;  4TLR A;  4KHP J;  2FB0 A;  4F4A A;  1NDL A;  2AYM A;  4QU6 A;  1IN0 A;  1CJU A;  1HI1 A;  4NLO A;  2ZOF A;  4P10 A;  4DX7 A;  2HQF A;  5E33 A;  1U8S A;  4F67 A;  4RW7 A;  3WHI A;  2UU9 J;  4KE5 A;  4WFY A;  3MOJ B;  4QJV A;  2CVI A;  2CWK A;  3OTB A;  2CPX A;  2WBM A;  4USK A;  1PJ5 A;  1NSK L;  4KFB A;  3JYT A;  1Y9O A;  1HPZ B;  5LMN F;  2W2Q P;  3H8Y A;  2DTJ A;  4YB7 A;  3S01 A;  2N4C A;  3BQ1 A;  2LLZ A;  2XI2 A;  1FK9 A;  4FVC A;  1KKH A;  1S7I A;  2KJV A;  3SQO P;  1VJQ A;  4I56 A;  3VGT A;  3U02 A;  2QV6 A;  3M8Q B;  3CPW R;  2KT2 A;  3MMC A;  2KM8 C;  1ZAX A;  2IMW P;  2C3M A;  4ES2 A;  3PIO Q;  3PR4 A;  3CCJ S;  3D3B J;  3IBF B;  1YI2 S;  1MWQ A;  2ILZ A;  4MIB A;  2XCP A;  2RB7 A;  1L3V A;  1HHS A;  1TKZ A;  2EFG A;  2M5Y A;  2QIF A;  3HHL D;  5BJR A;  1UWA A;  2LP4 A;  4F4K A;  1BXN A;  2N3L A;  3D0I E;  3T5H A;  1S59 A;  1HWU A;  2CQI A;  1EP4 B;  3ILJ A;  2HZV A;  1XN9 A;  4OZ3 A;  3M2R A;  2E5L J;  3D66 A;  1IBK J;  3HHK A;  2RRB A;  3UQS A;  3GII A;  4AL6 A;  3VAM A;  1RIS A;  3C16 B;  1Q53 A;  5E7O B;  1Q4R A;  5B08 A;  2UVR A;  3AHP A;  1RZM A;  3VHQ A;  3MM6 B;  2CKW A;  3TRG A;  5D0H A;  2HRU A;  2LMI A;  5F0W A;  3VAK A;  4ECT A;  5KT2 A;  3I5B A;  3UN3 A;  3M9N B;  4NEZ A;  3W61 A;  4QCL A;  1OSC A;  1S97 A;  1KWM A;  2ZVI A;  3T1Y F;  1FFS B;  2XS7 A;  5BR8 J;  2CPZ A;  2L9W A;  2NZC A;  1TKT B;  3GTY X;  3OR1 B;  2CJQ A;  2V9K A;  2D1C A;  1KLN A;  1P9Q C;  4F2S A;  1XNQ J;  3LW5 C;  2E5G A;  3CC4 S;  1RCO B;  2IDE A;  3W8P A;  2V2K A;  3FQL A;  3TJ8 A;  5DDP C;  4JI8 J;  2EW9 A;  4C98 A;  3MEC B;  4FXW A;  4WP8 A;  2DHX A;  2QT7 A;  1SV5 A;  4GC6 A;  1QSL A;  2EFP A;  3MR2 A;  1P8G A;  2K1R B;  4RUB A;  3V6H A;  1EAY C;  3FDS A;  3H0P A;  4H4K A;  5KFL A;  1G4C A;  1S1U B;  5ETM A;  4JV1 A;  4LF8 F;  4CLZ A;  1DRZ A;  3KTQ A;  1UVN A;  2CFX A;  4KV8 B;  1FRX A;  2B4U A;  1FWL A;  3EDQ B;  4TLQ A;  1NPR A;  1H2T Z;  1CJV B;  1RT4 B;  4LSN B;  5DRK A;  5KFU A;  3NGD A;  1A9N B;  1JKH B;  5JMN A;  4QOT A;  4QQB A;  4ZVG A;  2AQ4 A;  5E3Q A;  2OAU A;  3QPI A;  1S1V B;  4K5S A;  1MN9 A;  3KK1 B;  4DN9 A;  2L9D A;  3CJ8 A;  4P75 A;  4DCP B;  5FDL A;  4NCG B;  1U4B A;  1XK8 A;  1YGY A;  5CD4 A;  1TKD A;  3CJ2 A;  3DLJ A;  3VZI A;  2J0Q D;  3NGK A;  2FZC B;  1NHK L;  3H5S A;  4FNI A;  4F4X A;  4IQX A;  4C8K A;  1KTV A;  3Q2S C;  4WE1 B;  1UVM A;  2L41 A;  2COL A;  4CCH A;  3GSD A;  4ZLL A;  3MUT P;  2CQ0 A;  5EUH A;  3QID A;  4RU9 A;  2QA2 A;  5HAO A;  4EO6 A;  1DTT B;  3K5M A;  3BH6 B;  3R9L A;  3HDS A;  4ECW A;  4A8K A;  3C46 A;  3ZZR A;  4LF7 J;  4ILM A;  3MCM A;  1RT7 A;  3A3O B;  3GJR B;  2J9E A;  4ELV A;  3H2L A;  3G86 A;  5EWE A;  2FJA B;  1S6U A;  4KTQ A;  1NJY A;  2OI2 A;  1JLA A;  1WC3 A;  2A10 A;  2C2K B;  3T1A A;  2HK2 A;  3KLV A;  1VOM A;  4ZP7 A;  1YIJ S;  4PG6 A;  1UEU A;  2CNO B;  3PX6 A;  4LF4 F;  2BJ3 A;  4CO0 A;  4K4V A;  3NY0 A;  5ETO A;  2UUW A;  1LW2 A;  1X9W A;  4OI6 A;  4OI3 A;  1D0E A;  1UFK A;  2NQP A;  1S1W B;  1K1S A;  4HHH A;  4RPF A;  1YZ7 A;  3VTI A;  1MW7 A;  4WIQ A;  3KMQ A;  1MWY A;  2VV5 A;  4IFY A;  3ZZT A;  2IMO A;  1DHM A;  1GQE A;  2CDR B;  2JC1 A;  2MGZ A;  5GAD U;  2VQE F;  4P7T A;  3O5T B;  1B3T A;  1Q86 T;  5J2P B;  3FRZ A;  1ICE B;  1EZZ B;  2GMJ A;  1M5H A;  2DNN A;  2JLE A;  3CIM A;  3G6Y A;  4NML A;  1NU4 A;  3MED A;  3T1H J;  1G3O A;  1D9D A;  4IH5 A;  2H5E A;  1UA1 A;  2UUA F;  3HMJ G;  1YSJ A;  4ECQ A;  2YKM A;  1HYS A;  3PW4 A;  3IWL A;  2V0N A;  1U2R A;  1F9F A;  1VQM S;  3QAT A;  1R31 A;  3K5N A;  1RQ0 A;  3A3P B;  3LP1 A;  3QT8 A;  1N6Q B;  1SCJ B;  4NZ6 A;  4TYA A;  1FRL A;  1TL7 B;  2OPQ B;  3HKW A;  4NL5 A;  2KB2 A;  1HD0 A;  2WW4 A;  3DHX A;  3I56 S;  3KJN B;  5FII A;  4DV7 J;  1V3Z A;  1RYR A;  1HWK A;  2HQC A;  1Q7L B;  2LU1 A;  5E3A A;  4F04 B;  4URQ U;  4YP3 A;  1GNK A;  2ZM6 F;  2RU9 A;  4J9M A;  4B9V A;  2K7K A;  4ZCM A;  5HI7 A;  2VPZ B;  2Y1I A;  4PQU A;  2GS8 A;  1XJW B;  2HZA A;  1ZA2 B;  3LAM A;  3SDE A;  3G8T A;  2PEB A;  2OFG X;  1LW0 B;  1EET A;  2VFT A;  2HVD A;  3EMT A;  4G1Q A;  3JSM A;  2HWH A;  1BLU A;  1I94 J;  2Z30 B;  4JI4 F;  4RW9 B;  5IM0 B;  4V19 J;  3HT0 A;  3CCM S;  4DR3 F;  3JSB A;  2BR0 A;  2ZH8 A;  1T05 B;  4FF1 A;  4QWC A;  2LDY A;  3KWM A;  4OYA A;  3KLG B;  3MFH A;  5H1S V;  1UFL A;  3IAS 9;  4QW9 A;  1KFS A;  3DLG B;  1SKU B;  2WAQ D;  3MEG B;  3DRY A;  5HJX A;  4QWD A;  1HBU B;  3BSN A;  3HHE A;  3BKU A;  4DR3 J;  1ZTT A;  1AXQ A;  4I2P A;  1BGX T;  3HPO A;  3TEG A;  1R0B G;  3IA0 A;  1VYA A;  3OFE A;  4RBV A;  4LIR A;  5CAA A;  1D09 B;  2RT3 A;  5EN1 A;  2Z8Q A;  3CXC R;  1AA1 B;  4B3T J;  1SQG A;  3TAM B;  4CO2 A;  3N9U C;  2DPI A;  1B7F A;  2WBR A;  1PJ6 A;  2CQH A;  4F0K A;  3G82 A;  2NXN A;  1WEY A;  3HVA A;  4ANC A;  1FF2 A;  4JI8 F;  4ZMM A;  2LXI A;  3HLU A;  4PPD A;  1CC7 A;  3UI3 A;  2RIL A;  3AT1 B;  3DRS A;  4NMX A;  5EHH A;  5L39 A;  4M5I A;  1HR0 F;  5E41 A;  2F4V F;  1WC4 A;  5ETL A;  2E66 A;  3UW1 A;  4YHH F;  3MAQ A;  1U47 A;  2HVI A;  4ILL A;  1NJX A;  1O51 A;  1U24 A;  2KYX A;  2MLZ A;  4NA1 A;  2NZ4 A;  1RTJ A;  2KL8 A;  1XC9 A;  3PZP A;  3VZH A;  3CCW A;  4HH0 A;  1Z4U A;  2PT0 A;  2XG8 A;  3LAL A;  3AA9 A;  3GWC A;  3TJ9 A;  4CLF A;  3KYL A;  4IKA A;  4ZVH A;  1N36 F;  1WDD A;  4CTA B;  5KFE A;  3ZNJ 1;  1M1H A;  2DHG A;  4A48 A;  2XS5 A;  1UW4 A;  3AAW B;  1R7I A;  4Z7Y A;  1WHY A;  4U7U K;  2FVR A;  5CHC B;  2Y9H A;  1R89 A;  2V34 A;  4L6V 3;  4FS1 A;  3R27 A;  5F3Z A;  1RYS A;  3HSZ A;  1TUG B;  3S6E A;  4ZP9 A;  4JI4 J;  1FRM A;  2E1R A;  2CAJ A;  4H4K C;  2V63 A;  5A2Q Y;  3W62 A;  2W9C A;  2F8M A;  4ELU A;  4U7U D;  4F8R A;  4ED3 A;  4RO0 A;  1QAY A;  3RG6 A;  5M2P A;  4LR7 A;  3CO9 A;  3OL7 A;  2R8I A;  3PX4 A;  2NPI A;  3D4J A;  4PXB A;  2CJK A;  3MXH P;  1VQS A;  3QRP A;  2M0G B;  1LWC B;  2DHS A;  5GAG U;  1GXT A;  2R4F A;  4F4Z A;  3CCV S;  1IBM F;  4CLT A;  2NLW A;  1Y10 A;  2HIQ A;  3TI0 A;  3RR8 A;  4HH1 A;  3MM7 A;  5LXR A;  4DSJ A;  3D6H B;  2J0W A;  5JUM A;  1P6T A;  1ZZN A;  3UR3 C;  4PZV A;  1RHR B;  1R8A A;  1VIX A;  3UFC X;  1W2B R;  2YY3 A;  1ZM9 A;  4DL4 A;  5E3R A;  3HHL B;  1UKU A;  2FC8 A;  3P3D A;  5KFS A;  1N88 A;  3I5C A;  2FLL A;  1T3O A;  1FTC A;  1F5C A;  1HIY A;  2E1P A;  3MM5 A;  3MM8 A;  4ZLJ A;  3OTO J;  4O0I A;  1KHW A;  2VAS A;  2KG1 A;  1FJG J;  1PYT A;  3DRR A;  5KG2 A;  4EYI B;  1ZTW A;  2M7S A;  3DLL Q;  3WC2 A;  3MR3 A;  4A8M P;  4A8W A;  2OPS A;  3BR9 A;  4HDH A;  3TOQ A;  4FF2 A;  3RYL A;  3FBC A;  4RBU A;  3EGV A;  1JLB B;  4OYZ A;  5DZ6 A;  3HKZ D;  5GVQ A;  5D78 A;  1FJG F;  4X65 J;  1E6V A;  2DJW A;  1JMT A;  2W9B A;  2OSQ A;  8AT1 B;  5D77 A;  1HWI A;  2HVE A;  1R0A B;  5CXT A;  4PG7 A;  1I5O B;  1GMW A;  3P96 A;  5E0O A;  2PFD A;  1CUL B;  3BEG B;  1MLA A;  3CCU S;  2Y8W A;  4JI5 F;  4DU8 A;  2D3Z A;  4J9K A;  2UUA J;  1FA0 A;  2DNL A;  5KFN A;  4PCQ A;  4HAC B;  3QQC D;  3LA0 A;  3OTD A;  3SBM A;  5IV4 A;  4PWD A;  1JJ2 R;  4RKU C;  1FRH A;  1QTN B;  1RBA A;  1QM9 A;  2GO8 A;  2OPR B;  3CJS A;  4R8U A;  2AEJ A;  2G2O A;  4JI5 J;  1FWP A;  2HHP A;  1X4E A;  2R7T A;  5CH7 B;  3TUP A;  1WNE A;  3J7Z T;  3BJY A;  1AUS L;  1NSQ A;  4ZKA A;  1FE4 A;  3CO0 P;  4L76 A;  3OTE A;  1LK7 A;  1WC1 A;  2R8G A;  5AXN A;  4LF9 J;  3NP5 A;  3KK2 B;  1PCA A;  2Y0S D;  2OMO A;  2FLO A;  2QL7 B;  3ZZZ A;  4ED5 A;  4OL8 A;  2GO9 A;  2DEJ A;  4ZPA A;  3NGR A;  4LRE A;  2C22 A;  4OZ2 A;  4QPT A;  1I6J A;  2RKI B;  3DHW C;  4GVB B;  4W98 A;  2ZH2 A;  1KS2 A;  3JB9 k;  2BDP A;  2PI5 A;  1D8Z A;  2HPU A;  1GX6 A;  1BQX A;  1M5P C;  3WX8 A;  2RQC A;  1O6X A;  4ICL A;  1U7L A;  1YRT A;  4FF4 A;  4DR7 J;  1KBR A;  1T9T A;  2ZJP Q;  3LP0 A;  2KZZ A;  5F0U A;  2L3M A;  3SQG A;  3ZNU A;  4K4S A;  3DOL B;  1F0X A;  3P5B P;  4Q2L A;  1TUV A;  1TVR B;  1IKX B;  2V2Z A;  1YDL A;  3QZ8 A;  4ED8 A;  1UMJ A;  2CG8 A;  2HFU A;  1SKW A;  2C2O B;  4TY8 A;  5DG8 A;  2JFK A;  1NZ8 A;  1FFW B;  4NPO A;  3W2V A;  1RT6 A;  2CQ1 A;  5IT4 A;  1WTB A;  4ID8 A;  4DLG A;  5HP1 B;  2CQ3 A;  1L3S A;  2BAC A;  1JLQ B;  3OXL A;  1WG1 A;  3JSY A;  1DY3 A;  1UFW A;  1TL3 B;  2M52 A;  3R5G A;  4R25 A;  5KT7 A;  2R7W A;  4F4W A;  2J6S A;  5A6P A;  4RUC A;  4LR9 A;  2WOM B;  3FFI A;  5K9F A;  1BY9 A;  2Y1R I;  2MQP A;  3BO3 A;  5ETT A;  2P2C B;  2AT1 B;  2YPZ A;  3B82 A;  2VC1 A;  2WVD A;  3HUL A;  5T41 A;  1BC6 A;  3HSG A;  2GQC A;  2GML A;  2EC0 A;  2ACY A;  3L9Z A;  3EPG A;  1JNR B;  1U09 A;  2HKE A;  1X5S A;  4NLG A;  2H4W B;  3P4U B;  2KXF A;  3HVT A;  4OYP A;  1OPI A;  1U0H B;  1RJJ A;  2EWH A;  2DRD A;  2O67 A;  3BYR A;  4MK9 A;  4OV6 A;  4PAB A;  4Y00 A;  5FLX U;  3CNQ P;  4V19 X;  2Z0G A;  1Q5V A;  4ATN A;  2ZJR Q;  2CNL B;  4H54 A;  3AB2 B;  2Q79 A;  5JVG Q;  4WP9 A;  3M2V B;  5A8R A;  2DNQ A;  1PKU A;  4JV5 J;  2E1A A;  1NXI A;  4LFA J;  4I7F A;  4ZVT B;  2DIU A;  1P27 B;  4U8V A;  5KFQ A;  5DLF A;  5AXK A;  4DU7 A;  1LV5 A;  1HQE A;  4ID5 A;  2RUG A;  2FHO B;  5IFM A;  5T14 A;  2FYX A;  4EBC A;  1RE1 B;  1NEE A;  4GO5 X;  3OJS A;  4P6Q A;  3VAG A;  2RQK A;  1WEX A;  3C6U B;  2WON B;  3G96 A;  2ROE A;  1NK0 A;  5F8N A;  3CIZ A;  2X3G A;  3NBP B;  3H5U A;  4HHJ A;  1HWL A;  2OKQ A;  8RUC A;  4C8O A;  3OR2 A;  3QYY A;  4NLR A;  3TVY A;  4OV1 A;  4UY8 5;  2JLF A;  2LCW A;  5D0G A;  3NL0 A;  2EKY A;  4M5H A;  2I6W A;  1NK8 A;  3PYG A;  3SYZ A;  1VBX A;  4YFU A;  2OLW A;  2IY5 B;  1FI4 A;  3Q8R B;  2ASD A;  1CJU B;  3DMJ B;  2DHA A;  1WOR A;  2AW0 A;  1F5A A;  1U45 A;  1S76 D;  3MUM P;  2KFZ A;  3M32 B;  2DNO A;  2Y3Y A;  2GIF A;  2YPY A;  3BDE A;  5KFJ A;  2KU7 A;  4URS A;  3TUZ C;  1SC6 A;  1LWX A;  4U96 A;  4GMK A;  4K4X A;  2K3K A;  2H1Y A;  4LUB A;  1TAQ A;  4QIV A;  2V94 A;  3WBZ A;  1FJE B;  2M8D B;  2CPJ A;  2HQI A;  1GMU A;  3OQ2 A;  4I2Q B;  5GMD A;  5IC4 B;  2D3U A;  3OLA A;  4KGZ B;  1XMQ J;  3MPU B;  4JI3 F;  2G2Y A;  2BJD A;  4F2R A;  3VV2 B;  1CLF A;  2U1A A;  3WQP A;  4KIA A;  1FO1 A;  2JX2 A;  6FDR A;  2N4D A;  3R97 A;  4YB1 P;  1KRP A;  4CYU B;  1L5U A;  3DFE A;  3MPD A;  3HJV A;  1GT8 A;  2L08 A;  4OFZ A;  5DLG A;  1T02 A;  3CJ5 A;  4H4M B;  2ZH9 A;  4QR2 A;  4C3M A;  2XY5 A;  4WZM A;  4M5K A;  3J81 Y;  3H5Y A;  4YOE A;  2ZH6 A;  4R0E A;  5KFV A;  3GCX P;  1AT1 B;  4AE5 A;  2JJ4 D;  4G1P A;  3PNI A;  2R3V A;  4K7Q A;  4P2X A;  1TKZ B;  1IXK A;  2BA9 A;  2V8V A;  3D28 A;  5H9E K;  1HNW J;  1WEL A;  2CJY B;  2MZS A;  2UUC J;  2E7X A;  4NCG A;  1PGZ A;  3NKY A;  1YTY A;  4OIX A;  4FVM A;  4QYR A;  1SC4 B;  4O44 A;  1XER A;  3IM9 A;  2C28 A;  1VQN S;  2BAN B;  3DRX A;  3A8E A;  2BRK A;  2XCA A;  4E0D A;  2VHG A;  2J7W A;  2C3P A;  2DO4 A;  1H0H B;  1KP6 A;  2GHW A;  3AA8 A;  3D0G E;  4MIW A;  4OHX A;  4Y3C A;  2GJI A;  2F8H A;  3AB4 B;  2P5V A;  3J81 j;  3BN7 A;  1PAU B;  2X1G A;  4UOH A;  4QIW D;  4LQ9 A;  1NK5 A;  4BHQ A;  4DL7 A;  3D54 A;  4KGM A;  2ZH7 A;  4DV1 J;  1FKP B;  2HG4 A;  2G9O A;  4ZCI A;  3MM9 B;  1VBK A;  2JWN A;  4I6W A;  3SFG A;  1JX4 A;  1VLO A;  2QSW A;  2HSE B;  1FRI A;  1SV5 B;  4RW6 A;  5K8N A;  1JLC B;  2B8P A;  3CTR A;  1HI0 P;  2IBK A;  3HSD A;  4JV2 A;  2BOA A;  2HQD A;  5FJ4 A;  2RRN A;  4RNO A;  4EZ9 A;  2GX8 A;  3I0R A;  4B9L A;  5B0D A;  1VBZ A;  3EGN A;  1U48 A;  2PFF B;  4B9M A;  2NYI A;  5J1E A;  2BJ1 A;  2XM3 A;  1VQL S;  4USU A;  2UZA A;  2R9L A;  4C7Q A;  1H74 A;  1UZD A;  4CLU A;  1VQP S;  3QNW B;  2ZBC A;  2J6T A;  5LJ5 Y;  2LVW A;  5HQM A;  2OD6 A;  2W8L A;  2ZWP A;  2VKZ G;  3O8W A;  2MKI A;  4N41 A;  1KVI A;  2XWY A;  1WWH A;  3CED A;  1WOO A;  1RSC A;  5KT5 A;  4X62 J;  1LWF A;  2MZJ A;  3Q8P B;  1H38 A;  3KK1 A;  2VPX B;  3OHA A;  1FDD A;  2DR6 A;  1UL3 A;  1HWJ A;  2IJN A;  4MKY A;  1FNX H;  2BX6 A;  3OXF A;  3OSP A;  5KG3 A;  3KG4 A;  4USH A;  3V6J A;  1VR6 A;  2H4Y B;  2VG6 A;  4WE1 A;  4GVL A;  2UU9 F;  2CPD A;  3D6M B;  4ETX A;  2YTC A;  2ZC3 A;  5A2Q U;  3L09 A;  2QFJ A;  4LFA F;  2FDN A;  4PXE A;  2HBQ B;  3GON A;  1TV6 A;  5KFR A;  4CRJ A;  2DRB A;  4PQA A;  2HHH J;  4ZP6 A;  3I96 A;  3FQK A;  3I55 S;  2OO4 A;  2HHX A;  1DTT A;  3CCL S;  2LQ9 A;  4A8S A;  3DXS X;  2AEF A;  3HFK A;  1LXJ A;  3BR8 A;  2L9N A;  3KUE A;  3RTV A;  2XMM A;  3IS9 B;  1EET B;  1LW0 A;  3W8G A;  2FJD B;  4EUV A;  4YDD B;  5HMZ A;  5KFD A;  5CYJ A;  2WK4 A;  5CAB A;  1NJZ A;  4CI0 B;  4L3N A;  4CH0 S;  3GLJ A;  4CLL A;  3PFE A;  1AZS B;  3LUY A;  2WVB A;  1D1U A;  5A8K B;  2XMK A;  4F7V A;  2R8J A;  4WYW A;  4USM A;  4G1I A;  3GFY A;  3HD2 A;  2PD1 A;  5E2Q A;  4X4V A;  3ILL A;  4K8R A;  3POT A;  5K8P A;  2BEF A;  2HW3 A;  4EMD A;  1CBK A;  3QRQ A;  4KGK A;  2AJF E;  1RAI B;  1UWB B;  1WJ9 A;  3C66 A;  5LSR A;  3HX9 A;  4DZ6 A;  3M2R B;  2A6O A;  1JLF B;  2FJX A;  4GKJ F;  4J90 A;  1X4H A;  3ETM A;  5F8J A;  1Q8K A;  2OFH X;  4LRD A;  1OQ6 A;  1MRO B;  3RB6 A;  2GC8 A;  3RAX A;  4YUD A;  1RT3 A;  3EE3 A;  5J2P A;  4N76 A;  2QC3 A;  3V2U C;  1AFI A;  1ZS6 A;  3B54 A;  3M30 A;  1FTR A;  2ATL A;  3BS9 A;  1WHX A;  1RTI B;  2XHW A;  3BGO P;  1NJW A;  4ED1 A;  2HAI A;  3PDN A;  3HFZ B;  2VZ9 A;  4M5M A;  4DR1 J;  2P8I A;  1JJ4 A;  2BMB A;  3ILI A;  2GGP A;  4K59 A;  5B0E A;  4ALZ A;  5F8L A;  3KHH A;  1QY7 A;  3TAR A;  4C97 A;  3BSC A;  3C6T A;  2DR9 A;  2HRY A;  3OR1 A;  4J9S A;  3OD2 A;  3TZZ A;  4NYO A;  2VKR A;  3OJU A;  4L73 A;  1FEH A;  2BE2 B;  2RE1 A;  4IOC Q;  1NB7 A;  4WWS A;  1X4A A;  4LF4 J;  2ZIT A;  2MQQ A;  2XMV A;  5HN0 A;  3LPY A;  5HAT A;  1DJ0 A;  2UUC F;  3N01 A;  5JXS A;  2CAD A;  4QW8 A;  2DHH A;  2J5A A;  2IM1 A;  5FD1 A;  2W9C B;  2MYF A;  5C7P A;  2EFO A;  2NR0 A;  5I42 A;  4XAK A;  3ISZ A;  3N6N A;  4RU2 A;  4UT4 A;  2HND A;  5IXU A;  3KLG A;  1FT8 A;  4DZD A;  1VQ4 S;  1NH8 A;  3DRP A;  2X1A A;  3MF5 A;  2HHS A;  2ASJ A;  2OSR A;  2XLJ A;  1FKO A;  2O3D A;  3AH6 A;  3GIJ A;  4HVZ A;  1BE4 A;  2Q6B A;  2RS8 A;  2X51 A;  2B5J A;  2MDA A;  1DFD A;  2QYC A;  1XR5 A;  3MM7 B;  4NLY A;  5BYS A;  1K47 A;  5FDL B;  5HO4 A;  1LOU A;  3EUN A;  4DUZ F;  1MML A;  1UVI A;  2MEW A;  3FBB A;  4N8O A;  2VD3 A;  4NXN J;  2LEB A;  2VC0 A;  5IWA F;  4DV7 F;  1SJR A;  3G82 B;  3V81 A;  3M8Y A;  1PIE A;  3NEK A;  4KGX B;  3ZZY A;  4CP5 A;  5J2Q B;  3DLE A;  3C14 B;  5GAH U;  3JQK A;  4LIW A;  4DFM A;  5KFM A;  2P9G A;  5D8H B;  2QE5 A;  4UZC A;  1XIQ A;  1U02 A;  5MAO A;  2IJF A;  4JOU A;  1DZ5 A;  4ZPB A;  2PMW A;  4JYA J;  3JTO A;  5GAH I;  1XNR F;  1BWV A;  1RT7 B;  1GMW D;  2V4Q A;  5DQG A;  4B3S F;  1GFW B;  4LRB A;  1PC4 A;  5KFY A;  1F2G A;  4USI A;  2HHQ A;  3RBZ A;  2F65 A;  2MQN A;  3TZX A;  1BQN B;  1RWW B;  4G6V B;  4LR8 A;  1SB6 A;  5DM6 Q;  1QSS A;  3RRG A;  2DRA A;  4F02 A;  1Q16 B;  4DSI A;  2QX0 A;  3CCT A;  4LF6 J;  3SMZ A;  4FS2 A;  5LOQ A;  2HFV A;  1QE1 B;  4HYK A;  3FCW A;  3W5Y A;  4YME A;  3FZ2 A;  1KQG B;  4OZL A;  2VOD A;  2IRU A;  4TU7 A;  3PRD A;  1C1B A;  1VQ7 S;  1U1N A;  1RBO B;  1H73 A;  1S1W A;  2Y0B B;  3GFH A;  1WAC A;  3QLH A;  3R7S B;  3SSR A;  7FD1 A;  2ZH4 A;  3C2P A;  1WOS A;  2B4O A;  2V8D A;  3B78 A;  1J5O A;  2B56 A;  1PYO B;  4GC7 A;  1SJF A;  2YBV A;  1LFP A;  1J5E J;  1NND A;  4B9T A;  1B0T A;  1TMM A;  2QO3 A;  4DXL A;  2BOP A;  2VG5 A;  4X4S A;  3NGT A;  2QFI A;  3TQ1 A;  4IG3 A;  1S57 A;  4CH1 A;  2HHH F;  2W2N P;  1WSV A;  3DU6 A;  4MTP A;  5H9F K;  2VDH A;  2DD8 S;  2YKM B;  3W1Y C;  1N54 B;  1HNX F;  1H7X A;  2J9D A;  1B0P A;  4UQT A;  1FX4 A;  2ZKT A;  2CPI A;  3V6D A;  2XGP A;  2XBP A;  1WI6 A;  2YWF A;  1N6Q A;  3IAM 9;  2GW8 A;  4DR2 J;  2XTJ P;  3HHL A;  2FJW A;  4Q7A A;  1VDH A;  3H40 A;  2LEP A;  1SUQ A;  1T95 A;  2O1P A;  4PR6 A;  1R8C A;  1HHT P;  2R7V A;  3MM8 B;  1JIH A;  1VBY A;  1X0F A;  4OI4 A;  5D15 A;  1JLE A;  2XZW A;  1UVL A;  3VGV A;  2VQF J;  5F8M A;  3MCO A;  1TVR A;  3IR5 B;  4G1Q B;  2UVW A;  1HNW F;  4HI1 A;  3M6U A;  4L3K A;  4TY8 B;  1T05 A;  3DDN A;  2RML A;  2RDJ A;  7AT1 B;  3PTW A;  4HI2 A;  4YB6 A;  2AJ1 A;  4Z37 A;  3DGV A;  3CMA S;  3VVT A;  3UCZ P;  4J9R A;  3JQM A;  3DDK A;  4ZJO A;  1SH3 A;  3ET6 B;  1HBM A;  4F3Q A;  1OSD A;  3I9Z A;  3U1N A;  4ZN3 A;  4DR1 F;  4I2P B;  3FFI B;  2IVM A;  3LPE A;  1X5T A;  3NRB A;  2BXJ A;  1RDR A;  4M5N A;  3PXG a;  2MZT A;  3W5Z A;  1ZAV A;  1NKB A;  2M9K A;  3U27 A;  4B02 A;  2U2F A;  3TAM A;  1TL1 B;  2H65 B;  4I1T A;  1YWX A;  4JI2 F;  4B08 A;  4R8U B;  4QIE A;  2AJQ A;  3E01 A;  3KNG A;  4USW A;  3DCA A;  3S7R A;  2Q43 A;  2E7V A;  3FJ2 A;  3I0S A;  5DO2 A;  2Z4P A;  2DNK A;  3UDC A;  1FD8 A;  1V9O A;  4JI2 J;  4OZ0 A;  1CS4 B;  4D3H A;  4Y0F A;  5B0A A;  2GVZ B;  5KG1 A;  1RWX B;  4AXJ A;  1CJT A;  1QUV A;  3B4D A;  3EM1 A;  3D0H E;  4U67 Q;  2Z2L A;  2DCU B;  1HNX J;  1QTM A;  1RTJ B;  4IRD A;  1KOH A;  2ASL A;  1Y3K A;  2C2R A;  3DLH A;  4I6Y A;  2D7S A;  1HR0 J;  2CG4 A;  2R7X A;  4C8Y A;  5AE1 A;  4IH7 A;  1E6Y B;  2IDL A;  3C15 B;  5KT3 A;  2RKI A;  2C2E A;  2AZ3 A;  2MQO A;  4TNO A;  1HHQ A;  2AGQ A;  4EZ6 A;  2AF6 A;  4QWA A;  1UPM B;  4CWB A;  5DG7 A;  2VFS A;  3HCX A;  3GZ7 A;  1FRK A;  1O8B A;  4WYL A;  4NLX A;  5THW A;  2WSF C;  3UDL A;  4DUY J;  1CSJ A;  4HHU A;  4KB7 A;  3SCK E;  2I0X A;  3TYT A;  4W90 B;  5DS7 A;  3CCQ S;  1RLC L;  1T11 A;  3D9B A;  3KLE A;  4Y2K A;  2OML A;  1R6Y A;  3MEE B;  3AD7 C;  4ZHR A;  1S77 D;  1BMQ B;  1OS5 A;  1Y0H A;  1IKW A;  1NRK A;  1WG5 A;  3KLF B;  4RW8 B;  4JV5 F;  2UXD J;  4OI2 A;  5IWA J;  1WHW A;  1UET A;  3OL9 A;  1N4L A;  1IJE B;  4NCB A;  2F40 A;  4LRA A;  3V4I B;  4DI6 A;  2RDI A;  4DV0 F;  2OH2 A;  4OYO A;  4RWW A;  1RI7 A;  3EGZ A;  2A6M A;  1F6T A;  1VQ9 S;  1U25 A;  1K0V A;  4MKA A;  3IBC B;  4JYA F;  1T0T V;  4RUH A;  4NRU A;  2OJ3 A;  2JLG A;  2JVR A;  1XNR J;  5C42 B;  2VFV A;  4KFB B;  3JYT B;  3T9N A;  3AY0 A;  3QRR A;  4LRC A;  1RA7 A;  1TUW A;  1F9E B;  4ZVP B;  1GEH A;  4DPO A;  5IT9 U;  2JEF A;  3PHE A;  1N5V A;  1U0H A;  3HM9 A;  2UXC F;  2XSF A;  5KG7 A;  5RUB A;  2JHE A;  4ZPT R;  1XMB A;  3DRR B;  3U1L A;  2HNZ B;  1IQT A;  4OJ1 A;  1X8D A;  1DAX A;  4NA2 A;  5A8W A;  3FMW A;  3MMA A;  3EVM A;  2OPS B;  4OI1 A;  2YWW A;  3N5B A;  3HSJ A;  3GIL A;  2YKN B;  1RT5 A;  4BC9 A;  3PJX A;  4H4M A;  3IRW P;  2UXC J;  1RHK B;  2GFF A;  2QZ8 A;  4USV A;  5CQG A;  2C2D A;  2JH3 A;  2W01 A;  3PIP Q;  4A47 A;  2C2Z B;  1X5O A;  2J7K A;  1B70 B;  4M1K A;  4PWU A;  2CJB A;  3WIV A;  4CDI A;  2RU3 A;  3CSK A;  4CLK A;  3ZXW A;  4IO9 Q;  4U9R A;  1TL4 A;  1NJI T;  3QFH A;  3DC2 A;  2AZ1 A;  2V5H G;  3EVO A;  1SJQ A;  4O4G B;  4DV6 J;  5J2N A;  2DO0 A;  4JI0 F;  5LSO A;  3LO3 A;  1RWK B;  2B9Y A;  2K06 A;  3WDO A;  2JDJ A;  2PO4 A;  3AQO A;  1TL5 A;  4DR2 F;  5HL7 Q;  2WB4 A;  1GTH A;  4C0B A;  3J7A N;  1KLM A;  3FEY B;  3SEO A;  4O3R A;  2KVQ E;  4MMO A;  5CYQ A;  2A3J A;  5LMU J;  2WVF A;  3M8Z A;  5G0R B;  3F41 A;  2EK6 A;  1LKZ A;  1N0U A;  2MHN A;  3DMJ A;  4A8O A;  3RR7 A;  4ZIW A;  4DG1 B;  3RB0 A;  3VQT A;  3PW5 A;  2N7C A;  3NCR A;  1IJF B;  2CJX B;  3MAA B;  5DET A;  4ELT A;  2GCF A;  1MG7 A;  2ZBP A;  1G6B A;  2E5J A;  3B8H A;  3G87 A;  3MEC A;  4FPI A;  2CUY A;  4KPC A;  4OLO A;  1Y3J A;  4DDF A;  1VQO S;  1FCA A;  4X4N A;  5HBM B;  2Q1L A;  1KQF B;  1FXD A;  5LMN J;  3D1Q A;  2W2O P;  4Q43 A;  2HFN A;  2ALZ A;  3LP0 B;  2Z2Y B;  1XEZ A;  3LAK A;  3DOL A;  3SQG B;  2W4P A;  5GAE U;  4K5R A;  2GV1 A;  2MQ8 A;  2NS1 B;  1U8W A;  3G2X A;  3LAN A;  3KLH A;  3FZB A;  4HT7 A;  1D9F A;  1R27 B;  3C19 A;  4ZA1 A;  1SL1 A;  2YWK A;  1R8B A;  4WJB A;  3J81 U;  1R3N A;  4DSE A;  2MY7 A;  4YDX A;  3MPV A;  4I0W A;  1LWF B;  1IWG A;  1JLQ A;  1LNQ A;  3LWM A;  3IG1 A;  1QAI A;  3U7J A;  3IGN A;  2NSB A;  3D1O A;  2WOM A;  2EI5 A;  3J80 Y;  2YKQ A;  2OIH A;  2I9S A;  1EX8 A;  2DNY A;  3M2U A;  4FYX B;  4UY8 T;  4OQJ A;  3MR6 A;  1RBL A;  4KC5 A;  2XYG B;  3AD9 C;  1BD6 A;  2GAG C;  4TVA B;  2ERR A;  2H51 B;  4WCE Q;  5MLC V;  2R7S A;  3D5M A;  3D68 A;  1S99 A;  3EZU A;  2NXC A;  5IC6 B;  4WTY A;  4YB5 A;  3NCQ A;  2KI2 A;  1U6B A;  3KK3 A;  2IVF B;  4A46 A;  5FLX Y;  5EDW A;  2QA1 A;  5D4O A;  1SBR A;  2M4M A;  3Q23 A;  4ED0 A;  4Q8E A;  1S4E A;  2NUU G;  2J8S A;  3M6X A;  3A8J A;  4QWE A;  5CZX A;  2E44 A;  1DBD A;  1WF2 A;  2ZDO A;  1JLA B;  2J8A A;  4KAI A;  3NG8 A;  4DSK A;  2BM0 A;  1W2I A;  1IWA A;  2ZVS A;  4CO3 A;  3JTP A;  4Q45 A;  3HF5 A;  1UAW A;  4F0H A;  5EWF A;  3IWN C;  1HQE B;  5KFA A;  3LGM A;  1LW2 B;  1S9E A;  4G3I A;  1RA6 A;  1AFJ A;  5L9X A;  2BKP A;  5LT5 A;  1U1L A;  1W25 A;  3W9J A;  1FVQ A;  2HIY A;  2MLX A;  1DQ8 A;  2O01 C;  3H2V E;  1JLF A;  1UW9 A;  2AWZ A;  3C6U A;  1RAE B;  4Z2X A;  2BV3 A;  2C2N A;  4DQQ A;  2D3O R;  1FWK A;  5HRO A;  2MGZ B;  3N79 A;  4B3O B;  2HHU A;  1YBA A;  3U1M A;  3DM2 A;  1HA1 A;  3K58 A;  1RWM B;  4LQ3 A;  3MWB A;  1ITP A;  2HGL A;  1H3D A;  2FJE B;  4ZVS B;  3ZZ0 A;  3G6X A;  7FDR A;  3DN9 A;  1Q82 T;  3PW7 A;  4DV3 J;  1UZH A;  1KHV A;  3A4T A;  2AYG A;  4Q8F A;  3AXM A;  2GGP B;  1FRJ A;  4DL5 A;  4LBH A;  4WFX A;  2HHT A;  1YJW S;  3O2I A;  3I6P A;  3LOU A;  4HTJ A;  2N7Y A;  1NBE B;  1OPZ A;  1HLW A;  1RXO B;  2HQ3 A;  2LA6 A;  2PSZ A;  1S79 A;  4NZ0 A;  3ZTP A;  2KFN A;  2BE2 A;  2DPJ A;  2VG6 B;  1YQH A;  1IUJ A;  1RK8 A;  1Z1Z A;  3RU0 A;  2HHV A;  4RW4 A;  2VBY A;  3NGS A;  5C25 B;  1K44 A;  3TQE A;  2MZQ A;  1WKL A;  5L9N A;  3V6K A;  1YJ9 S;  1RU2 A;  3SDE B;  2DR8 A;  2IIH A;  2UV8 A;  5J2Q A;  2ZBQ A;  1QJH A;  4X4T A;  5DDO C;  3Q8S B;  2XNR A;  3HJF A;  1YRX A;  1MSW D;  4KKO B;  2PI4 A;  1NME B;  1YJU A;  1B4S A;  2DH7 A;  5A8K A;  4NYZ A;  5DDR C;  2FVC A;  4QR0 A;  2JNJ A;  1QVG R;  2AHO B;  2IBO A;  1HBU A;  2VG7 A;  2ILY A;  3CJR A;  3TUI C;  2IYG A;  2V8G A;  1RTH B;  1TTH B;  2MKJ A;  1SVD A;  5IS2 A;  4IQM A;  1UJ6 A;  4X62 F;  3PKY A;  2VIC A;  1Y5I B;  4KQZ A;  1GX5 A;  4DOZ A;  5M2R A;  4OYW A;  3ZO7 A;  4F25 A;  3E3X A;  4NE9 C;  3UE2 A;  1ZET A;  2AU0 A;  4NWB A;  2QSF A;  1MRO A;  4O3N A;  4F26 A;  3O3L A;  1XTZ A;  3DRS B;  3RJM B;  1NO8 A;  2KZM A;  4YQW A;  2FVS A;  1SQE A;  4B9N A;  2VJU A;  1MNE A;  3GMG A;  2VBW A;  2HUR A;  3H5X A;  2O66 A;  1WDT A;  2ZE2 A;  3UPF A;  2I5J B;  3PYD A;  2CPE A;  5L8R C;  1RAG B;  1QSY A;  3C6T B;  1S1X B;  2DKO B;  3DNC A;  1S1T B;  2KO1 A;  2CA9 A;  2XMT A;  3DKD A;  3IR6 B;  3ZZO A;  1RWU A;  2M2B A;  3CCS S;  3PYE A;  1YZ6 A;  4J9V A;  9RUB A;  3W2W B;  2AX0 A;  3W9I A;  5KFB A;  2JZ5 A;  1RAB B;  1WC5 A;  4CLP A;  1OYE A;  4ZLP A;  1O0P A;  3OL6 A;  4YEA A;  1JLC A;  1C1B B;  2W1B A;  4DUY F;  1JK9 B;  2YNH B;  2XMW A;  3D6T B;  4B3S J;  4K2X A;  5T7L A;  4MYT A;  2WSC C;  5D4P A;  2R7R A;  2DNG A;  3N4W A;  3HXM A;  1SJ3 P;  3I9V 9;  1IVZ A;  3Q24 A;  2KRR A;  5HMW A;  4O23 A;  4M5D B;  2HBY B;  5LSL A;  4A8F A;  4K4Z A;  4YY3 J;  2QYG A;  2IFX A;  4C0O C;  5AXL A;  2G0C A;  1KQS R;  1S9G A;  3OVA A;  1I94 F;  2POK A;  2KXN B;  5D4N A;  4A8X A;  3ELH A;  4DMZ A;  5SZT A;  3QGH A;  1FKO B;  2CDQ A;  3W66 A;  1IKV A;  3MCS A;  3JQJ A;  4NLV A;  3CVK A;  3CDB A;  3OFF A;  3MDF A;  3R5A A;  2A18 A;  2ZFH A;  4ZS6 A;  1RB0 A;  3FVY A;  4X84 A;  2MZR A;  2LKZ A;  3CMQ A;  2CQP A;  2MY8 A;  4DX6 A;  4X64 J;  4DLE A;  4MKB A;  1RAA B;  3BGR B;  3R6G B;  3QJJ A;  2YH0 A;  4DR6 J;  3ITH A;  1OIA A;  3NXZ A;  2HFS A;  3J7Y U;  1TV6 B;  5HVG A;  4B3T F;  5EX3 A;  4MK8 A;  4FN5 A;  1C0U A;  5KFX A;  2VA2 A;  3MHY A;  1QD1 A;  2GJ2 A;  1X4G A;  4EK2 A;  1VC6 A;  3BBF A;  3FSY A;  3IS9 A;  3P6Y C;  2JSX A;  4Y34 A;  3X3U A;  2WVE A;  4H4O A;  2MHE A;  2ALY B;  1X60 A;  4L75 A;  3TA2 A;  5J1P A;  3ZZU A;  2XLI A;  5J2M A;  3QAE A;  4DWI A;  1E6V B;  4JI1 J;  2W9B B;  2ADB A;  2YNF A;  2DXD A;  4MFB B;  4DX8 H;  4PG5 A;  3PO5 A;  4IFV A;  1KN6 A;  3BH7 B;  3Q83 A;  2XY6 A;  3ET6 A;  2YX1 A;  4L74 A;  3R7N B;  5HJY A;  5KFH A;  3I32 A;  4P74 A;  3POT B;  1PAE X;  4JI1 F;  2N82 B;  4M95 A;  3TVZ A;  4WK1 A;  2D9P A;  1HMV A;  2W4D A;  3ENW A;  5K5M A;  4QWB A;  3CDA A;  1UWB A;  3H90 A;  4DUZ J;  2LU2 A;  2OP5 A;  4S0M A;  4W4M A;  1R8P A;  4LBI A;  2A0F B;  5KFF A;  3Q8Q B;  3NNH A;  4PAA A;  1ZPV A;  1XR6 A;  2CXE A;  1FNO A;  2KYZ A;  5D6G A;  3GR1 A;  4NYP A;  3R5C A;  4WZQ A;  1B64 A;  2FHJ D;  5CA5 A;  5ETP A;  3DGP B;  1I51 B;  3Q22 A;  1RAD B;  1Q8L A;  3CJ3 A;  2VG5 B;  2BRL A;  4E8U A;  2BJ8 A;  3UDE A;  4MYU A;  1F3V A;  1K0T A;  3W60 A;  3THV A;  1APS A;  3CD6 S;  1EB0 A;  2ABY A;  2NXJ A;  2GVZ A;  2CJA A;  1CJT B;  4QPX A;  2ZZN A;  5ETN A;  2CZ4 A;  3LGN A;  1Y5L B;  1HQU A;  1S6Q A;  2RF2 B;  1OWX A;  3MR7 A;  3V6D B;  2VIH A;  1DTQ A;  2R7U A;  1PBU A;  3JTN A;  4GRS A;  3GG0 A;  4GVB A;  2HS4 A;  3QBC A;  4DS4 A;  2R2S A;  4DR6 F;  1EAR A;  2WVC A;  3VAH A;  4C0H A;  4B3R F;  1SUQ B;  3GR0 A;  3KDO A;  2AYE A;  1LQ9 A;  2F1F A;  1VLY A;  5ETV A;  1NM2 A;  5H9E J;  1T03 A;  3R2C J;  3Q86 A;  2LEC A;  2CQG A;  1TKX A;  3GP9 A;  4NLP A;  4K4Y A;  4UW2 A;  4Y6I A;  3K5L A;  4M63 A;  4DJB A;  1UJ4 A;  2XS2 A;  2QA4 S;  1IKX A;  4DEZ A;  4OX7 A;  1SH2 A;  3GYN A;  4P2F A;  2ZBI A;  2C3Y A;  1C4C A;  2GVD B;  5CYM A;  5I42 B;  3W2V B;  1PG5 B;  3QJP A;  2PMH A;  1WG4 A;  3R5B A;  3X1L B;  5HP1 A;  3LGH A;  1FKA F;  1CG2 A;  1RU1 A;  2FGC A;  2Z57 B;  2VBZ A;  3BV8 A;  2CWX A;  4I67 A;  1KTQ A;  2R2R A;  1REV B;  3L7U A;  5CCL A;  5DGB A;  3BGL A;  2B5J B;  3PEJ A;  2XQC A;  2QA4 G;  2WCX A;  5DJB A;  1MU2 A;  1IKY A;  3K7R A;  3BN4 A;  1YJR A;  4QYZ K;  4ZVE A;  5DQI A;  2C2M B;  2MKC A;  3E01 B;  4Y2C A;  3KJV B;  3CB4 A;  3GE9 A;  4F3O A;  3THT A;  1J2V A;  2CRL A;  3QZ7 A;  3I0S B;  4RLE A;  4R5P A;  2R8H A;  4V1A k;  4ZJL A;  1BWE A;  2E5I A;  5DZ7 A;  5ADZ A;  1AYE A;  5ETK A;  3H25 A;  2HNZ A;  2BKN A;  1YHQ S;  2VA3 A;  1VJW A;  3T3F A;  2EPI A;  2UUT A;  3AD8 C;  5A8W B;  4DCJ B;  5E3P A;  1YJV A;  1Q81 T;  1PC5 A;  4OYM A;  1S0M A;  2YNG A;  2I8E A;  1H2V Z;  4OYB A;  3TX8 A;  4X4R A;  1VK3 A;  4IUF A;  3VAF A;  1G7C B;  1BUX A;  1HNV B;  1E6Y A;  2EBG A;  1V5I B;  2QLW A;  4ID5 B;  2VFU A;  4DPX A;  3DOK B;  4K2J A;  4CQ1 A;  2YQ0 A;  3UD3 P;  4LSL A;  3OFG A;  2GAH C;  3KUH A;  4F36 A;  3QJL A;  1QLN A;  3M7V A;  4NLD A;  1HNI B;  3Q89 A;  3AOB A;  5BYQ A;  4ECX A;  1QDU B;  3CUL A;  1VHF A;  2KRB A;  3QLH B;  4B9U A;  1NHV A;  3OR2 B;  3LWL A;  1TK5 A;  4NOH A;  1CJK B;  3ZTQ A;  4WKY A;  3RW7 A;  2OGU A;  4DPU A;  3KLF A;  2VF3 A;  4RW8 A;  3MUR P;  1TAU A;  2ZBR A;  1VHI A;  1C1C A;  3CE8 A;  4LJM A;  4ZPV R;  3S1T A;  2HGN A;  3QGG A;  3M4X A;  4JB8 B;  4IG3 B;  3DYA B;  2HBR B;  3K5P A;  1NDP A;  1J5E F;  1FEE A;  2XMA A;  3TW0 A;  2LQ8 A;  2O5D A;  3MZI A;  2FD2 A;  3CJK B;  3SFU A;  3VWS A;  2A2C A;  2DGU A;  2BJ7 A;  2XEX A;  3BYP A;  4QIF A;  5AE2 A;  3PX0 A;  3BQ0 A;  2JEJ A;  3MAA A;  1FX2 A;  1WKK A;  3PFO A;  4DV4 J;  2UUB J;  1GH8 A;  3VGS A;  3T19 A;  2AD9 A;  4RUA A;  3ZTR A;  5B0B A;  1N33 F;  2CVE A;  2KH9 A;  4LVO P;  4C8M A;  2M3D A;  4IYQ A;  1TP7 A;  3T9Z A;  2FJB B;  3VQS A;  3NOG A;  2RIJ A;  3QWP A;  4O3P A;  4C2M A;  3M6V A;  4IR1 A;  3MMB B;  3FNN A;  4CT9 A;  1REG X;  3MOZ A;  4UTG A;  3OW2 R;  2FJV A;  4OJ3 A;  2IAJ B;  4AXI A;  3R3T A;  1JLE B;  2VU5 A;  2J6U A;  3KHR A;  3K57 A;  2XZD B;  3CDE A;  2GHV C;  1ROF A;  3P8B B;  5IQQ A;  3NWG A;  4XPE A;  4A8Y A;  4Q0B B;  2YKN A;  3AJ1 A;  3N0V A;  1UCN A;  4AUK A;  3QO9 B;  3ZC4 A;  2QTW A;  1NK4 A;  5L1K A;  1FVS A;  3PM9 A;  4L72 B;  3M9M B;  3CJ4 A;  2ZKU A;  2IC3 A;  2MST A;  2Z2Z A;  3OSN A;  3R6L B;  4ECR A;  2MQM A;  2DIS A;  4MH8 A;  1KVJ A;  3VAJ A;  2G13 A;  2QG9 B;  3L4B C;  1M5V C;  3KOA A;  3UNY A;  3SI8 A;  5SUH A;  1MWZ A;  1TL1 A;  1RAH B;  1VQ6 S;  1SJ4 P;  3I82 A;  1RAO A;  3KG0 A;  1C0T A;  3A1Y G;  4JUZ A;  3HP6 A;  4WTO B;  4N8N A;  5C24 A;  3LH2 S;  5KFG A;  3NMA A;  5G0R A;  3TA1 A;  2DY9 A;  3PCO B;  4DR5 J;  4AL5 A;  2DNM A;  2HYI B;  9ATC B;  1RTD A;  1X4F A;  4KO0 A;  2BE9 B;  2QL9 B;  3D6F B;  4PG4 A;  2HHW A;  5H9F J;  2XY7 A;  4ECU A;  4DV3 F;  3IFE A;  3MMJ A;  3E8O A;  5BXI A;  4FBT A;  1TFY A;  1GMV A;  4QIG A;  3W7B A;  1IBK F;  1HI8 A;  3J7Y I;  1T8E A;  2MKK A;  3GV8 B;  4IRK A;  2KKH A;  2R42 A;  3BKF A;  1H7W A;  4NCA A;  4J9O A;  2EVZ A;  3R5J B;  2IYI A;  2EC2 A;  5IV3 A;  3M8R A;  2BQU A;  4PG8 A;  4DV6 F;  3HVR A;  2ZZM A;  2OD4 A;  3SIP B;  3KLE B;  1U1P A;  3PKM A;  3P49 B;  4B3O A;  2EFQ A;  2YWE A;  1VQK S;  1Q8I A;  3I5A A;  2W25 A;  4ZN1 A;  2A1B A;  4DPW A;  4YS2 A;  3KLH B;  3UCU P;  2CQ2 A;  4JI3 J;  4O3S A;  1RT1 A;  4DPT A;  4DFK A;  4FF3 A;  4RNM A;  3J7A 1;  2YKA A;  4K0K F;  2VL1 A;  2B8Q A;  2EKN A;  2JVO A;  3MPY A;  4ZPD A;  3LP2 A;  1IR1 A;  1FDN A;  1FD2 A;  2J9C A;  2W7A A;  3I4H X;  3NLC A;  2WB1 D;  4J9Q A;  2HRT A;  2YKP A;  1U49 A;  4K0K J;  1X4C A;  2HZC A;  4J5O A;  3M2U B;  2I2Y A;  5C42 A;  3GSI A;  4N47 A;  4FBU A;  3MGJ A;  4ERD A;  1EHW A;  1KOO A;  2LYV A;  3JS9 A;  3NWR A;  1T9Y A;  3L95 X;  1NKC A;  1HPZ A;  2W2M P;  4OHW A;  3TAN A;  2KHC A;  2G1D A;  2YX7 A;  2W8K A;  3EIC A;  1FK9 B;  4ZK7 M;  2RDD A;  2BQ3 A;  1K8A T;  2L48 A;  3BM7 A;  1SQF A;  2DGW A;  3RZA A;  5K8M A;  3K59 A;  4LF5 J;  4C6A A;  2DY1 A;  3O6Q A;  1VRU A;  1S5Z A;  2AX1 A;  3M1V B;  4ZVU B;  1SC1 B;  1S72 S;  1K73 T;  2HMI A;  3MMA B;  4HEA 9;  3CGI A;  4JBC A;  4RWX A;  3QGI A;  3ULH A;  2F7V A;  4UZB A;  2E9T A;  3MMC B;  4YR0 A;  2HS0 A;  4KY3 A;  2V8P A;  2R2T A;  2VOO A;  1CQM A;  2B9X A;  4XTT A;  5D4L A;  1IBC B;  4MIA A;  5DQH A;  3WC0 A;  1WC6 A;  3OVS A;  4NXM F;  4RZR A;  3R1L A;  1NPK A;  3PV8 A;  2D3O 1;  2W7O A;  2OPP A;  3KDN A;  3OBI A;  2PN6 A;  5F9N A;  5AXM A;  3LTO A;  4OZN A;  3BO4 A;  4K4W A;  4FKY A;  4ER8 A;  1S0N A;  3OLB A;  2F5G A;  3HFV A;  4J9U E;  2IRY A;  2V4J B;  1A0O B;  3EZ5 A;  4O4G A;  1FDA A;  1S4F A;  2DH8 A;  3BBB A;  5J2N B;  1HKA A;  1FE0 A;  1FFG B;  1ZPW X;  3DI6 B;  4F3M A;  4F4Y A;  1B7Y B;  1RT3 B;  1NZA A;  3DM2 B;  5HMX A;  2GHP A;  3H4D A;  4J9P A;  1GAO A;  2B3T B;  1IQZ A;  4B9S A;  4JI6 J;  1S0V A;  1N33 J;  1Y7P A;  1RTI A;  4ZCL A;  3UO0 A;  5HVH A;  4PEO A;  1XQI A;  2FUG 9;  5IOL A;  2ZZT A;  1U1K A;  4WF9 Q;  1SIZ A;  2ZE2 B;  2I5J A;  3DU5 A;  1VQ5 S;  2FHM A;  4DV5 J;  4DG1 A;  2RD5 C;  5KG5 A;  3G8Q A;  3QIP B;  3G6E S;  1S1T A;  2LA4 A;  2NCK L;  1N48 A;  4RNN A;  1LEO A;  3KG1 A;  3T6J A;  3TX0 A;  4ZIV A;  1K1Q A;  3GJS B;  4XDD A;  5KG6 A;  1W7W A;  2XO6 A;  2LXF A;  2G0J A;  3GYX B;  4AYB D;  1PJ7 A;  3NS5 A;  4DQI A;  1QVF R;  1OO0 B;  4AD6 A;  3FSX A;  3KHL A;  4JV0 A;  2Y8Y A;  3RRH A;  4ED2 A;  2Q6C A;  3UN2 A;  4DF8 A;  4J7C A;  1X5P A;  4N7T A;  2RQM A;  2YNH A;  4LF5 F;  1VIS A;  3M9O B;  2YNI B;  3A12 A;  3DLB A;  2RRA A;  5T7L B;  4N77 A;  4ED4 A;  2HNY A;  1A6L A;  3GV7 B;  2V2Q A;  5IT9 Y;  5KOW A;  1TK0 A;  2HND B;  2UP1 A;  2K8G A;  1YKW A;  2BM1 A;  4KKO A;  1Z2Z A;  1RGV A;  2LXU A;  3SCJ E;  4QBU A;  4DX5 A;  1G1X A;  3TAP A;  3DRP B;  3HO1 A;  3O44 A;  2C3U A;  1RT4 A;  4ZPC A;  1JKH A;  1CVJ A;  2YWH A;  2X3D A;  1WSR A;  1LWE B;  2A2D A;  4LF1 A;  5DGA A;  1RTH A;  4FXV A;  3ETO A;  4DFP A;  2JFD A;  3CME S;  3RBX A;  3W9H A;  1TMJ A;  3IG1 B;  1D8Y A;  1J27 A;  5B0C A;  1SKR A;  1HQ2 A;  2W7P A;  2E9Z A;  5E3C A;  1ULR A;  5F3T A;  2DBB A;  1MN7 A;  2W2P P;  4K4T A;  1WKJ A;  3HZG A;  2F8E X;  1IR2 A;  3WX4 A;  1RHM B;  3CCZ A;  3C14 A;  2PEH A;  3DLE B;  2SXL A;  5F8G A;  4FYD A;  4TQS A;  3IC1 A;  2H48 B;  3QMQ A;  1ZYQ A;  4UF4 A;  1N34 J;  2DEI A;  3CD5 A;  4FNH A;  3GYG A;  3RGI A;  2LDI A;  4QYZ J;  1V3S A;  3KK3 B;  2D74 B;  4DV5 F;  4KJI A;  2DXE A;  5J2M B;  1FHT A;  2XGQ A;  5GAE I;  1S1X A;  1BQN A;  4KR0 B;  1Q8B A;  4C48 A;  2OEM A;  1VRQ C;  2YNF B;  3FK4 A;  4MFB A;  4LSZ B;  1U6Z A;  2GIR A;  4HTI A;  4EI2 A;  3CCR S;  1VFJ A;  2R8K A;  1JXE A;  4DSL A;  3PO4 A;  3HHL C;  2UXB J;  3W2W A;  3D67 A;  1W26 A;  1H98 A;  1U1R A;  5EWG A;  3LF0 A;  3N6M A;  2BE7 D;  2AGO A;  1HMV B;  4OYI A;  4PRF A;  4C3L A;  1G2E A;  2BBE A;  4YN3 B;  1PO6 A;  1J5O B;  3ZTO A;  4IFY B;  2V9W A;  4CO1 A;  2QEX S;  5K8O A;  4DL3 A;  2F4V J;  1NCL A;  3R7B B;  5HRO B;  4EYH B;  5DM7 Q;  4YHH J;  1NK6 A;  4M5D A;  1NKE A;  2Q66 A;  1Q0N A;  3Q8Y A;  1RT2 A;  2G1H A;  3UN5 A;  3M05 A;  3PW0 A;  2ZUA A;  4DQR A;  3ZZP A;  1EKR A;  1YIT S;  2BJ9 A;  3CJ0 A;  1NPP A;  3I4P A;  1LXN A;  1WOP A;  3ADA C;  4OZ5 A;  4P52 A;  4WPA A;  5A0Y A;  4EGL A;  3R1H A;  1HNZ F;  4ZPW R;  4OI0 A;  5CCM A;  4NLT A;  3LP1 B;  2QN6 B;  4TN2 A;  1NK7 A;  6FD1 A;  2MB0 B;  4C4W A;  4NZ7 A;  5L46 A;  1NAQ A;  3IBW A;  1RAF B;  4KH1 B;  1N5Y A;  4IDK A;  4J37 A;  4LF2 A;  3CCE S;  1IBL F;  2CQB A;  4RW4 B;  3TO8 A;  3M8P A;  3G71 S;  2VJV A;  1TEL A;  4PQU B;  2ZH3 A;  2KTQ A;  2D9O A;  2H3E B;  3JAM Y;  2RS2 A;  1UPP A;  3KNA A;  4FDF A;  1WUU A;  1JLG B;  2OEK A;  3CDW A;  2OEL A;  3DDI A;  2CQ4 A;  3KFW X;  4BWM A;  2E9R X;  2JEI A;  2ROP A;  4OX8 A;  3CC7 S;  1JWW A;  3OUY B;  5CYM B;  3GFZ A;  3G4S S;  1EKS A;  3ONQ A;  5KFC A;  3JSR A;  1GXL A;  4UOG A;  4YY3 F;  3BRE A;  4IFV B;  2XSJ B;  4O4R A;  4PPZ A;  4JI6 F;  4AL7 A;  1WTF A;  1HBM B;  2MLY A;  2CNN B;  4DUT A;  4ZOS A;  2H5I B;  3MEG A;  3FBE A;  3NCP A;  5F9L A;  1HBN B;  1VRT B;  2LFV A;  1REV A;  1C4A A;  1KVK A;  1CC8 A;  2BZ2 A;  2HS3 A;  3KHG A;  2XI3 A;  3GIM A;  3G6V A;  1RKJ A;  4K50 A;  1IKY B;  2GQ2 A;  3M6W A;  1U1O A;  2FY1 A;  5A6W A;  2YH1 A;  1VCT A;  3PY8 A;  3DOM A;  1TU0 B;  2DVI A;  4FYV B;  3P5T L;  2LQ5 A;  4ED6 A;  3VCD A;  3HZE A;  1Q1K A;  4IR9 A;  3HK2 A;  5ETR A;  2EEY A;  2ZH1 A;  3DGP A;  1CPZ A;  1I3O B;  4Y2A A;  4CNY A;  3GV5 B;  4PYA A;  4DCO B;  2B43 A;  2FZK B;  4LF6 F;  3EWG A;  1L3U A;  1CS4 A;  5C5J A;  2LQB A;  2B6A A;  2KT3 A;  2KVI A;  3PJ9 A;  4FPR A;  1BQM A;  1VGY A;  4URG A;  1OMS A;  4DR4 F;  2V68 A;  2DGQ A;  1B0V A;  4KYZ A;  3GIR A;  4PXD A;  2N3O A;  3CW2 C;  1L3K A;  4FP9 A;  1AB8 A;  5KG4 A;  1NSA A;  5KT4 A;  3KMS A;  2R2U A;  3ENQ A;  1Q7Y T;  2C3O A;  5K20 B;  1ZZF A;  2RAQ A;  1X9M A;  1DTQ B;  3C15 A;  2CIM A;  4U8Y A;  3AXK A;  1U1Q A;  3R2D J;  2K3I A;  3AOA A;  3BSO A;  3OVB A;  2IJR A;  1AW0 A;  4OHV A;  3EYZ A;  1M5S A;  3BQ2 A;  4DV4 F;  2G4B A;  3BDP A;  4RNF A;  3NAH A;  1ZM2 A;  2MZ1 A;  3OPK A;  1S0O A;  2V8H A;  3MEE A;  2XC9 A;  1R0C B;  1IKW B;  5KFZ A;  1RWN B;  2B51 A;  5I4M A;  2MXY A;  5GAG I;  2ATC B;  4RBT A;  1HFE L;  2BVZ A;  3H98 A;  3K8W A;  3V4I A;  1S6P A;  1YK9 A;  3BF4 A;  4EFA C;  2IM2 A;  2QMX A;  4NI2 A;  4BLG A;  2QLB B;  1YJN S;  3P45 B;  1CEZ A;  4LFC F;  3EGW B;  2ZNY A;  1GXU A;  2KT5 A;  2V2V A;  2B7B B;  3HVW A;  4Y2I A;  1IKV B;  2VB6 A;  3KUG A;  2BKO A;  3CJK A;  5M2U A;  2G0I A;  2W24 A;  2MMY A;  1OJ4 A;  5LM7 E;  5C2C A;  1N5Q A;  3EDR B;  3FUY A;  3MD3 A;  3MPW A;  2M8H A;  4DR7 F;  2MKH A;  3A8K A;  4DV2 J;  3CD0 A;  3OV7 A;  2NRE A;  3QGP A;  1VK8 A;  3UWT A;  2R7O A;  2VOP A;  4LFB J;  2MJU A;  2CZV C;  2B9W A;  2P6S A;  3GB0 A;  1FDB A;  4PUO A;  2FLN A;  1KNZ A;  1C0U B;  2WRM A;  3K17 A;  4OLP A;  2AP6 A;  2G2Z A;  2GNK A;  2ACM A;  2RNE A;  3PJW A;  3V4M A;  2BAB A;  2KM8 B;  3VAL A;  2E5H A;  3M8Q A;  3PW2 A;  2CPY A;  1WD6 A;  3SV4 A;  3JAM U;  1RT5 B;  3EVW A;  4H4O B;  3AJD A;  3RUB L;  3VF0 B;  3CC2 S;  1PYS B;  2YNG B;  1SC3 B;  2ROG A;  4DQS A;  2PII A;  3HD1 A;  4TU8 A;  2H54 B;  3HHD A;  3IMQ J;  4ZVR B;  1N5T A;  4I69 A;  2NUH A;  3TP2 A;  1HNV A;  4DL2 A;  1R0A A;  4EEY A;  1M5O C;  4HL9 A;  1HD1 A;  2XUL A;  3HT3 A;  4LSL B;  3TZW A;  5I3U B;  2MTL A;  4UST A;  1EP4 A;  3SXL A;  2ZHB A;  3NNC A;  4X4P A;  2IA6 A;  5KFT A;  3FMB A;  4G65 A;  3KJF B;  4CM0 A;  1KFD A;  3L7O A;  5KFW A;  1F9H A;  2VH7 A;  2IM3 A;  5AJ3 J;  3C16 A;  1URR A;  4C8L A;  2OPR A;  3DLK A;  2HEK A;  1Y5N B;  5HLF B;  4NEY A;  4NX9 A;  2YWG A;  3K8V A;  2OTL S;  1KLM B;  4USJ C;  3TWZ A;  1C1C B;  2ZUG A;  5CYQ B;  4XK8 C;  4ZDN A;  4KHP F;  2W4C A;  2CNK B;  4OYX A;  1WEZ A;  2IRX A;  5C24 B;  5AJ3 F;  3KLI A;  4XIU A;  4B3M J;  2FVP A;  3AOD A;  4DPY A;  3GG1 A;  1NUE A;  4OJH A;  2NPF A;  1RTD B;  2AYB A;  2ZOG A;  3UD4 P;  4ILR A;  4KO0 B;  3NMR A;  3G9C A;  3D2W A;  2WSE C;  3IRX B;  4KBI A;  1HBO A;  1UEK A;  1UTA A;  2HQG A;  1NH7 A;  1HQU B;  1ACM B;  1S6Q B;  2RF2 A;  3H42 A;  4TYB A;  5ETS A;  4C11 B;  4DV2 F;  2ZD1 A;  4WFA Q;  2F63 A;  3AQP A;  4P7V A;  3V5R A;  3Q2T C;  1QAJ A;  1DLO A;  2EFN A;  5D3G B;  2K1R A;  4DN0 A;  5HBM A;  4OX9 F;  4KPY A;  3SV3 A;  2J0S D;  3PYF A;  2BW7 A;  4IOB A;  4A4J A;  1UP1 A;  4O3Q A;  4O0N A;  4M5G A;  5F8I A;  5JJB A;  1GK8 A;  1SPB P;  4B3R J;  4KV8 A;  3PHT A;  2KXH A;  3C8Y A;  2PDA A;  1P9Y A;  4CO4 A;  2DGO A;  4HLB A;  2GA7 A;  4LSN A;  4WK3 A;  3OTC A;  1S49 A;  5K14 A;  3UVJ B;  3NS7 B;  4AFF A;  4Q44 A;  4I64 A;  4Q5V A;  3CT9 A;  1YX2 A;  2YKO A;  3IO1 A;  3D7S B;  2WHO A;  1UEV A;  2PMZ D;  3WIU A;  5GMK a;  3H20 A;  4RW7 B;  4X2B A;  5KT6 A;  2DR7 A;  4NLQ A;  2ZHO A;  3G8S A;  1T9U A;  2DXF A;  1U2C A;  3F56 A;  3ZFV A;  1XMQ F;  2BJE A;  1MU2 B;  1VQ8 S;  3GIK A;  2BUN A;  4PKD B;  5LL6 d;  1KDN A;  3VAI A;  1Y00 A;  1N32 J;  1HW9 A;  2APO A;  3KXD A;  4UUW A;  3TZY A;  4J9L A;  1FXR A;  3HVT B;  5G4D A;  4JI0 J;  2DGV A;  3OL8 A;  3IP0 A;  1VIO A;  5HQL A;  2DCL A;  1WC0 A;  1P1L A;  1RHU B;  1VRU B;  1SH0 A;  4DL0 C;  4YR3 A;  1XMO F;  2DNH A;  2Z58 B;  3M1V A;  3KKF A;  1NHU A;  4OMF G;  2HMI B;  1PSD A;  2IA0 A;  4M5J A;  4XO0 A;  1LK5 A;  4IG0 B;  3LQV A;  3HHN B;  5LMU F;  2GMH A;  2EG2 A;  3EZO A;  3M2V A;  2X1B A;  2VDI A;  3UD5 A;  4E2F B;  5A8R B;  1U1M A;  1TFW A;  2KFY A;  2FGO A;  2AV5 A;  4I6A A;  1T9W A;  4JI7 J;  1XR7 A;  5DDQ C;  1S9E B;  1ZAW A;  4QU7 A;  3B4M A;  3QT6 A;  3FSI A;  3N5F A;  3MTJ A;  4MJK A;  2B0G A;  4HKQ A;  1SI9 A;  2DT9 A;  2OPP B;  2B9E A;  1PIL A;  2DGX A;  2CQD A;  1WHV A;  1WF1 A;  1HNI A;  3BB5 A;  4OZJ A;  1ELO A;  4JI7 F;  2QMW A;  2WTF A;  2V69 A;  1BHN A;  4TU9 A;  4P9S A;  2B7C B;  2ZDP A;  1OY9 A;  1HW8 A;  2RH3 A;  1UJ5 A;  3F44 A;  4LRF A;  3FCV A;  3MM6 A;  4CM2 A;  3R5D A;  4WU2 A;  5KFP A;  4FYW B;  1VC5 A;  4AQY J;  2PC6 A;  4DR4 J;  4P2M A;  4FYY B;  2QLX A;  1V6H A;  2P9E A;  3FKB A;  4DV1 F;  1YJT A;  3DYA A;  3LP2 B;  3MI7 X;  5B09 A;  1UA0 A;  4Y28 C;  1FJC A;  1ZOT A;  2B4P A;  3MEK A;  4RR5 A;  2X1F A;  3EXC X;  1RUS A;  1YG0 A;  1JNZ B;  3RBD A;  1RHJ B;  4IH6 A;  4UOC A;  4B17 A;  1TL7 A;  4NLW A;  4AQY F;  2E7W A;  5KAK A;  1F3F A;  4X4O A;  1JXL A;  3MCN A;  1T9V A;  1FNM A;  1N32 F;  2VPY B;  5C25 A;  4NRT A;  4OZ1 A;  2KJW A;  4GKK J;  3K0J A;  4I2Q A;  4W92 B;  3K2Y A;  1GTE A;  2UUB F;  3SCL E;  1Z2L A;  5U47 A;  3BGU A;  2GQQ A;  1H2U X;  2YNI A;  1Q5Y A;  3MMB A;  3JSM B;  2AJ4 A;  4ECV A;  2IHR 1;  3IGV A;  4YR2 A;  4LF7 F;  2IAJ A;  1S7H A;  4C9D A;  4TY9 A;  2OHD A;  2XZT B;  1O5J A;  2ZOM A;  3H59 A;  4WP3 A;  4KGV B;  3GJT B;  1C2P A;  1CJV A;  5ETQ A;  2LEA A;  4CH7 A;  2OTJ S;  4ENO A;  4U7C A;  2X7I A;  5F8H A;  2I38 A;  2VG7 B;  2NXU A;  1X31 C;  4AT1 B;  2HBZ B;  4U6P A;  2F9J A; 
#chains in the Genus database with same CATH homology
 4HR2 A;  1W7W A;  3Q8U A;  1VYA A;  3VGU A;  5CAA A;  4KPC A;  4W98 A;  3WX8 A;  1NLK L;  3Q86 A;  3GP9 A;  4ANC A;  4O0N A;  5C7P A;  2HUR A;  1U8W A;  3G2X A;  2DY9 A;  3PJ9 A;  4UOH A;  1JXV A;  3EM1 A;  3GPA A;  3EJM A;  5BXI A;  1BE4 A;  1MN9 A;  3DKD A;  1NDC A;  3L7U A;  2DXF A;  2AZ3 A;  1HHQ A;  4WBF A;  1NHK L;  3FBB A;  1MN7 A;  2DYA A;  2B8P A;  1WKJ A;  1KDN A;  4CP5 A;  3BBC A;  3VVU A;  3BH6 B;  1XIQ A;  3R9L A;  3FBF A;  3FC9 A;  2DXE A;  4DI6 A;  4F4A A;  1NDL A;  3ELH A;  2B8Q A;  1F6T A;  1PKU A;  1BUX A;  1NB2 A;  2BX6 A;  2CWK A;  3FCW A;  4FKX A;  1NSK L;  4F36 A;  1EHW A;  3JS9 A;  1NDK A;  4ANE A;  3Q89 A;  3EIC A;  3ZTO A;  1HIY A;  1BHN A;  3ZTQ A;  1NCL A;  4C6A A;  3FCV A;  4AND A;  4EK2 A;  1S5Z A;  3BBF A;  3VGT A;  5CAB A;  3EVM A;  3NGT A;  3FBC A;  3Q8Y A;  1S57 A;  3EVW A;  3NGU A;  3FKB A;  2ZUA A;  1NDP A;  2DXD A;  2HVE A;  3BH7 B;  3Q83 A;  1HLW A;  2BEF A;  1WKK A;  3ZTP A;  1NPK A;  1PAE X;  3VGS A;  1F3F A;  1LWX A;  3Q8V A;  1S59 A;  3ZTR A;  4FKY A;  2AZ1 A;  4DZ6 A;  3EVO A;  3NGS A;  4S0M A;  1K44 A;  3ETM A;  3BBB A;  1WKL A;  3B6B A;  3EE3 A;  1B99 A;  2VU5 A;  1ZS6 A;  1NSP A;  2HVD A;  3B54 A;  3DDI A;  3EMT A;  4UOF A;  1NSQ A;  3VGV A;  3MPD A;  3ZTS A;  1XQI A;  5IOL A;  1B4S A;  1UCN A;  1NUE A;  3ENA A;  4UOG A;  4ENO A;  3VVT A;  2NCK L;  3PRV A;  4DUT A;  1LEO A;  3FBE A;  3NGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...