3ENWA

Substrate and inhibitor complexes of ribose 5-phosphate isomerase from vibrio vulnificus yj016
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
TQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEEIKGAVSSSVASTEKLEALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREKIVAAIADKFICIVDGTKAVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITDNGNVILDVYGMKITNPKQLEDQINAIPGVVTVGLFAHRGADVVITGTPEGAKIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
publication title Crystal structures of substrate and inhibitor complexes of ribose 5-phosphate isomerase A from Vibrio vulnificus YJ016
pubmed doi rcsb
source organism Vibrio vulnificus
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3enwA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3enwA01
2BKXA 3EFBA 3MWBA 3HHEA 2I9SA 4L4YA 3LWDA 3KWMA 1FS6A 1XTZA 1NE7A 3ENVA 1FRZA 1LK5A 3KV1A 3AB2B 2R5FA 1LK7A 2NYIA 3BXHA 4IO1A 5IS2A 2J0XA 2QMWA 1SC6A 3EB9A 3ICOA 2F8MA 4L5JA 3HN6A 2JOQA 2ZHOA 3P96A 4PWUA 3TUZC 3LUYA 3O1LA 4GMKA 1YGYA 4M8LA 3S1TA 1KS2A 3L7OA 2LVWA 1HORA 1O8BA 5IT0A 2F1FA 3AAWB 1DEAA 3NZEA 1U8SA 3ENQA 2RQMA 3TUJC 3N0VA 3MTJA 4LUBA 3LHIA 3OC6A 1CD5A 2RI0A 2WU1A 2PA3A 3DHWC 2MDAA 3NRBA 3CH7A 5HJ5A 1UJ5A 2KO1A 2PC6A 2GNPA 4X84A 3MAHA 2W48A 3BXGA 1Y89A 2P9EA 1JT9A 3OFHA 2P9GA 3OBIA 3E15A 1YBAA 2RE1A 2OKGA 3OFGA 3ENWA 3U7JA 4OQQA 1ZPVA 2LQJA 4GO5X 1M0SA 2QSWA 4R7TA 1PSDA 3W7BA 4L5IA 3OFEA 1UJ6A 3OFFA 4L50A 1HOTA 4TM8A 3IBWA 5T41A 1FS5A 2QMXA 3CEDA 2J0EA 3TX2A 1PBTA 4GO1A 3K5PA 1Y7PA 2DT9A 4OQPA 2RQKA 5JJBA 3E7FA 4TM7A 1LKZA 3DHXA 3NWPA 3UW1A 1RWUA 2QRRA 3AB4B 2BKVA 1FSFA 3CSSA 2DTJA 4GO7X 4L4ZA 3LOUA 3TUIC 2JHEA 2P9CA 2O0MA 5FIIA 1VL1A 4R9NA 2H9ZA 4NMLA 2FGCA 3BXFA 2J0WA 3BXEA 4L51A 1FQOA 3DC2A 3DDNA 1UJ4A 5IT4A 2CDQA 2RI1A 3IXQA
chains in the Genus database with same CATH superfamily
4MK7A 3GFVA 4TLLB 3DD1A 3KR0A 3D64A 4HZGA 2FMUA 4DQDA 2CL5A 4Z7OB 1KY2A 4HP8A 1L5MA 5G1OA 3A6KA 4RCYA 4G1UC 3PPYA 1PQPA 4P4LA 1KHVA 5HMWA 4Q3OA 2DUJA 1UT5A 3OFJA 5PNTA 1UBMS 2BEJA 1D04A 3C6QA 2POKA 3GPBA 2RGRA 1M5UA 3VMFA 4PYLA 4RF4A 4HDKA 3HBJA 2RJNA 2CDBA 3I1IA 1CW2B 1OYWA 2VQDA 4QTYA 3W7AA 3HZHA 1LFDB 3OM8A 1YA6A 1RT3A 4NBLA 4B02A 5AUNB 1BMQB 1R10A 4ID3A 2H1LA 4TXJA 2OTLS 2B51A 3MM4A 3VISA 2XOKD 3S4YA 5B0DA 3FKJA 1V1JA 4RTKA 4QDJA 1CQMA 3P4XA 1JW9B 3GEEA 3GRFA 4ZHQF 4FHFA 5KFIA 1P2TA 2WVDA 1XQVA 2N47A 4QOFA 3EY9A 3Q5EA 1M54A 5ELXA 1G98A 4NZ0A 2EJUA 2HDHA 4HUJA 3U60B 2DGSA 4B7ZA 2FDCA 4I4TA 3DNMA 2LFVA 1ZITA 2JF0A 1ZJ4A 2OFPA 2AJTA 1Q0UA 3GJ4A 4OYZA 3Q4GA 3I05A 5B37A 4WKCA 2W6QA 2F9FA 4Q9HA 2G5TA 3CCWA 2VU5A 2V9CA 3ZK8A 4MFBB 4LYGA 1WEYA 3F78A 2VOEA 5C42B 1X0XA 1QGUB 1QE0A 3ZCXA 1SK9A 2HHJA 5LQUA 3I5UA 2W2VA 4YN3B 4RMGA 1N2ZA 3VUEA 5IN5A 2DNHA 3DZBA 3T1TA 2IK8A 3K5LA 3LT4A 1K1SA 1YV9A 3LY8A 2FZ4A 2BKAA 1T9VA 2ZJ0A 2NXNA 2EWHA 1CJUA 1VLMA 3AOEC 1C3EA 3FHCB 4CLOB 4XEHA 4IV8A 5CVVA 3WYFA 4HPXB 5CTAA 3TXXA 5H1YA 1P1BA 1PLKA 2OWEA 1Z13A 1MGPA 3L4BC 2E1CA 4M7WA 3D54A 3MF4A 4HVTA 3X0DA 2AUTA 2ZBEA 2PV7A 2G17A 2JLGA 4WCEQ 2PLWA 3KSUA 2H1IA 2PN1A 2E66A 1XAJA 4B47A 4OL0A 3DLGB 2DNYA 2D1SA 1QFMA 3MMPA 3R6TA 3H59A 3E23A 5MFPA 3KQMA 4U2KA 4KTVE 2HNKA 3P9IA 5D87A 1QIJA 4M5NA 2WDPA 2G9OA 4BFVA 2RKIA 3BAFA 1IOZA 4NK5A 3HXKA 1LXNA 1OROA 1V3ZA 2OELA 1KO5A 1LH0A 4IQ0A 3B54A 1WNEA 1NIPA 4IHJA 4QARA 2WG2A 4YY3B 2G4BA 1XCLA 3DOJA 1GUBA 3C3PA 4QU6A 4LPKA 1GPAA 1SBYA 7REQA 4BGVA 2APOA 4DZTA 2P0EA 1TZCA 1N9ZA 2PWAA 2B9WA 3D8HA 4NE7A 1Y81A 4GM1A 4FLFA 1X15A 5LSRA 1LNZA 3JQAD 3U81A 5AXCA 1IUPA 4LHVA 2ORVA 4DNOA 1I33A 3ETEA 5ICCA 2ZWIA 4J2OA 4P3OA 3DZCA 1GT8A 4QU0A 1H4VB 2QVYX 1WXDA 3KNZA 1TV6B 1FY2A 1S72S 4U0KA 1A0OA 2OSVA 3MEGB 1IEWA 2VNKA 2C2HA 2B6NA 4LF9J 4OYAA 1NXTA 4D6PA 1Y9DA 1G1XA 4W5JA 5BUSA 3AEQB 1BE6A 3MGGA 3IG1A 2PMEA 3G0HA 3TXAA 1SCBA 2HWXA 1DAKA 1LBHA 3I3OA 1VMBA 1MT0A 3FPEA 4K8RB 1GDDA 4CG3A 1ZMXA 4H7PA 4L0DA 3RB3A 3EVGA 5LLDA 2UDPA 4GL4A 3ECAA 2IBKA 5HJ7A 4RE5A 1EESA 2DITA 5KNDH 2VFTA 1EVZA 4AM8A 4D98A 1PNOA 4TS9A 3ULHA 2GD2A 5HQLA 2BI8A 4P3PA 3HL0A 2HZAA 2F4VB 3PW4A 5LMNB 3K71B 1G4UR 1RZ3A 3ELUA 1FXWF 2YHIB 3FPGA 4BHTA 1SH0A 5BOVA 1LLQA 2FOIA 3IBCA 2QYOA 4H17A 3NGKA 3RTEA 1JWWA 4CP5A 3BH6B 4J3FA 1H3EA 1ZUWA 2E37A 1QHGA 2ZRDA 2AJ0A 3MOZA 1X5PA 4K0KB 5A0TA 3PIRA 3TLGB 3KZCA 2RDJA 4X8OA 2J87A 1PLJA 4BO4A 1RMYA 4YB6A 3W05A 3NCHA 5SY6A 2IV2X 1GTSA 2WQZA 4U02A 2AA3A 4PNPA 2EFPA 5IZCA 2XIQA 4INOA 3AWDA 4EW1A 1DFHA 4NCKA 1JTVA 3GFHA 3TZQA 3DFUA 2V63A 2BKPA 4ABTA 3SFGA 2QR5A 4C9BA 1C0PA 3IKLA 5A5FA 4MWSA 3T1YJ 5T3YA 1AKRA 3EFBA 5KWJA 1NMYA 3DMTA 4L6CA 5IEJA 1ISMA 3R6GB 4BQPA 2OENG 3RODA 4ETZA 4YJGB 1E1QA 2DBBA 3RS2A 3QLTA 1EDDA 1ZQ1A 2WAAA 5KQMA 4O0MA 3MR2A 3AC0A 1BOFA 2O2DA 1I6LA 3J7AC 3ZCVA 3GX1A 4F4FA 2HPUA 1XR7A 1NJYA 1XN9A 4NPAA 1QE3A 3DUFA 5A6PA 2J9FB 3L02A 2P9YA 4WZZA 5C35A 2L42A 2WD7A 2ZT6A 2BYCA 1R6UA 2AXPA 3ZTSA 1V9SA 2KBEA 3W9JA 3A1WA 4M7PA 3EJ6A 2XRZA 4QTTB 3QNWB 1JFVA 1UDWA 1HWYA 1RBMA 2QJ3A 3NB0A 1W93A 1YVFA 1RBQA 3A8JA 2HNDB 4TZ6A 3K1AB 1KQSR 3ZU4A 1XNGA 3EODA 3OMLA 5JNWA 5BURA 2ROEA 3GSIA 3N4WA 5AVJA 2RJOA 1GQSA 3TEMA 5DBHX 4C2TA 3KAPA 3SR3A 3HY6A 3FLEA 2Y67A 4Q1BA 2Z08A 1ZI6A 2LW7A 4R84A 5AIBA 1FDIA 4FT2A 3ZDDA 2Q1XA 3T0GA 3JQMA 1JKMA 4YJ2F 4CCAA 3IT3A 4MLZA 2DIUA 4HS4A 4K4VA 1YI0A 2VZEA 1WW3A 3QWIA 2GK7A 1LTKA 5BSEA 4MOWA 5KFPA 5B1SA 1YQUA 3K0AB 2VPZA 3AD9C 3HYNA 3KU4A 1U25A 2GKSA 3SVLA 3RSQA 2ZOFA 3GLFA 2WWVD 3Q10A 2OM2A 2WTFA 1TQHA 2P4UA 4K2JA 3FVTA 1AGPA 1HOTA 3LOPA 1H3DA 5DDRC 2EC0A 4OP1A 3FCUB 1RAGA 5KNBD 4X91A 2GJAA 1DO2A 5BWCA 1OLXA 2VDKB 1NI3A 1NJ1A 1H6AA 2VN8A 1WOOA 3P0HA 3UQZA 3LBAA 3GAFA 3JQ7B 3QJYA 4Q8FA 4AMVA 4QYZK 1ZC4A 4K4UA 4X7BA 1Z35A 1N3BA 4DL7A 1GSOA 2P67A 4W9RA 5IT9A 4LBWA 3D3BJ 4V3BA 1LD3A 5JDIC 2DERA 4C2BA 2AVNA 2Y9HA 3ZTPA 4B3BA 4MYDA 3GZ7A 2OV8A 2D6FA 4FUQA 3GELA 3MAAC 3CSUA 3WC0A 2A9RA 4TMKA 4O3OA 3ZWBA 4XR4A 4EVIA 3DLTA 4BP9A 3FUWA 1C4OA 9MHTA 4IWXA 1U0OC 2D41A 4J9RA 4UUMA 3G0BA 4NXMB 4JI4B 3C8UA 1L5UA 2IPLA 1U2CA 3T3NA 4R1MA 2V4RA 3A3YA 1QTIA 4JJZA 3CJQA 4G65A 3R8YA 4TXHA 3KHSA 3UATA 5JYCA 3GI1A 1W2HA 4UULA 3CR7A 2CK3D 3RB6A 2ZYAA 4MIKA 3DZKA 3IPAA 2J5RA 2P5SA 3ZKWB 2B30A 1JG6A 5EXPA 1EFPA 4Q03A 3O0TA 3N5BA 4QO8A 4DT1B 4K4YA 1P62B 1Z33A 4NA3A 4DOZA 1MZVA 2WSEC 3V2UC 2B25A 3M9LA 4Y6IA 2A0XA 3OW2R 3CF0A 2PLRA 1HQ2A 5KT7A 2OGSA 4LA4A 3LGNA 5CXSA 3WLLA 1OI4A 4IXTA 5CABA 3NBFA 4OJHA 3E84A 4GLBA 3X43A 1SHKA 1FEZA 3GFOA 3G82B 1TKZB 2VWQA 4GZLA 4KPEC 4FFLA 2ISCA 2XMSA 4GMDA 3HZZA 4O4JA 4RK0A 3B12A 1X92A 4R01A 2MGZB 1FTSA 4NLYA 3LC1O 2ODAA 4L4SA 2C95A 3QFSA 3Q2SC 3NGMA 4U7JA 3UMBA 1IBKB 2F64A 3UOGA 4ZAGA 3BM5A 4XDCA 3BQMB 1DTTB 2A5YB 3KYJB 3C5CA 1H4TA 3KYBA 1G7TA 2XD4A 2NVBA 3OR1A 3UCGA 1U6IA 5DZ6A 3RE1A 2FWNA 3EAFA 5LCXA 3EZFA 3SSQA 5CW1A 1OR8A 3W3SA 4RU2A 1BQ3A 3H4IA 2VXBA 3C16B 4ZQFA 3H5IA 3G9TA 1SHTX 3E0XA 4ZP9A 4PR6A 3ZY3A 4TN1A 3ZBPA 3B78A 3V4VB 3DE5X 1SO8A 2BDUA 1BHJA 4TMVA 2YXPX 3GHHA 2UXCB 3LDHA 3PZBA 1VSQA 1R0AB 1L3KA 3Q87B 3TJMA 4EK2A 1FP4A 5EL0A 2WHYA 1UPXA 4U67Q 4GLOA 5IVDA 3EZNA 4YREA 4F8YA 3QWHA 1TM5E 3QY9A 4KGXB 4HQRA 4X64F 1KD1T 3RHZA 4RVDA 2V6JA 1V4NA 4YAGA 5EMLA 4HX5A 3ZWXA 2BTOA 2A9VA 2GV1A 2HCBA 4RZ2A 4LR7A 3ASYA 2IHVA 3HI9A 1KDTA 3BF4A 3D1QA 2NPFA 4L4YA 1B8NA 2JCYA 1DQ9A 2HK8A 5K9ZA 1FNMA 4GOXA 3WBZA 3V9PA 3L7CA 4DMMA 4RO0A 4H6VA 2QRMA 3M2UA 3BG5A 5B57C 2H5EA 1GWNA 1O6CA 2XQFA 1DBSA 5L1JA 2X7IA 2GCPA 5HIKA 4Y2XA 4AC9A 5AKEA 1DRWA 5ESXA 5IXYA 2PLNA 1G6Q1 2W2KB 1F1BB 1QYVA 4PNHA 3CCJS 3KLVA 2WYWA 3ZV3A 3M8ZA 5FO1A 3DKKA 1E58A 2WIJA 5TQJA 4JOSA 1XLTC 2M6LA 1R12A 3HYRA 1ZIPA 1Y80A 2AOTA 4DV1F 1LWXA 2P5UA 1EZZB 4WP8A 1L3UA 2EKBA 2WUEA 3E1KA 5E7MA 2XD9A 4ETNA 2YKMA 3KOYA 4L6V3 3A14A 3DVAA 5C18A 5B64A 1R4MA 3RB0A 1I14A 2ZE8A 4ILLA 2JX2A 3WRVA 4LY9A 4TRMA 4NCHA 1ML3A 5KVVA 3VR4A 1JLBB 4W8GA 3R1IA 4KCGA 2R87A 1ADBA 4HAWA 2YWDA 3IP3A 1KTVA 4C0HA 2O8CA 2ZRNA 3OLCX 1YQQA 1Z4UA 4EECA 4RLHA 1MU2B 3IGVA 3P3DA 3QT5A 3GGJA 2ZDGA 3QIAA 3PSAA 1TDJA 5JISA 1P9QC 2O1XA 3UJDA 2JK1A 3FMPB 1DELA 3Q2OA 4ZJZA 5LQDA 3MUTP 3FR7A 2DU8A 4MSUA 3LIPA 1HWJA 3RVNA 4MP3A 4B6QA 4MUYA 3DAGA 3BXGA 4QBHA 3GT3A 1M33A 2F3TA 4DV1J 3KZKA 4OXNA 3CDAA 1Z22A 1NJSA 2EWMA 4EABA 1EP4B 3F3MA 2YRXA 2EWWA 1G3UA 1UINA 2F90A 3U7IA 1V25A 3K9QO 3U4AA 3O7MA 1Q81T 2X77A 1U28A 1S0MA 1CEXA 1N2EA 3HP1A 1JG2A 5KYUB 4IGKA 2WTXA 5BN5B 1N5YB 4OA8A 5E9AA 1WD6A 1IHXA 3FRIA 2Q1WA 3GRRA 4K50A 2IYSA 1WNFA 1GCIA 1RYFA 4BVJA 8ABPA 2EFEB 5ALPA 2J6HA 1S1WA 3ED5A 2VQEB 4FE7A 4YRMA 3T7AA 3WMFA 5HDBB 3GV5B 4A10A 4IF4A 3MEDA 4YXWA 5CAEB 3SM3A 4S05A 1L7PA 2I99A 2PMCA 4Q1VA 4ILEA 2B0CA 3UB4A 2XF8A 1X5OA 2Y1CA 4HQFA 4R1PA 4QECA 5E6RB 3OR2B 4UHHA 1J0CA 1HSZA 4DY6A 3V4IB 1LSSA 4DHWA 3BREA 5JZSA 5D01A 3REQA 4BWGA 1FPQA 3G8TA 3BIFA 3NFYA 2PX4A 1RT2A 2BP7A 2P3LA 4DR3B 3DJFA 4CL8A 2GSDA 4ID5A 6FD1A 2JBAA 1Q1EA 2Z9CA 4Q1FA 3QELA 4LJ5A 4RNCA 4XX1A 3W5JA 5REQA 1Z88A 2PQ6A 1E8DA 1GFWB 1I2CA 2PEBA 1JE1A 2QL7B 1JHZA 2AFVA 4XUDA 1T95A 3ZEAA 3O1JC 4Q4LA 3FZ2A 5LYJB 1D0VA 2IYPA 3LA6A 5TGTA 1L5ZA 4I6EA 4IRXA 4RENA 2WFLA 1ZH8A 4OB6A 2B8PA 3PW0A 4LOLA 3VF0B 5E2QA 5AW7A 2CZ4A 2VC0A 1FP7A 1J8VA 3PC2A 3PHCA 3TL2A 3NBPA 1DC7A 1YONA 1L3SA 2X7JA 3KR2A 4B85A 4COOA 5K8IA 1CHNA 4YJFA 1JNYA 2YDYA 3LBNA 3PVCA 1XD8A 1TGVA 5MN4A 3AMVA 5KKCA 3RQIA 4LFCF 2ONZA 4P86A 2IIPA 4NRTA 4ZO8A 5J47A 2B7LA 1HM5A 5TT0A 4F7VA 4QOEA 2BJWA 2IYIA 1K7CA 1PKUA 4NZNA 1AKUA 4JVSB 3Q8UA 2ODWA 3EDYA 1HH4A 3RF6A 4NOJA 2O2JA 3UPFA 1E79A 2WVJA 5HKKD 3TOXA 1OLUA 2HZ7A 3PD7A 3TGWA 2W4PA 4BFUA 2XTZA 1ANKA 3V7WA 1EHIA 4WV3A 3AB4B 4EMSA 3IUNA 1G3IA 3SHVA 3BGLA 4YT2A 4EJFA 5BQFA 3LCVB 1P2UA 3I37X 2CG4A 4M0FA 3VA7A 5KG1A 5IXJA 1CRPA 1JUDA 1VJRA 3H7IA 2BELA 2JEGA 4PQUA 4DV6B 3T9CA 4ZAFA 2AZMA 3T6KA 5IK2D 3QKRA 5AW9A 4DBQA 4QE3A 4DIDA 4XLTA 1Z6GA 2ORYA 3GPCA 1ZN9A 4EB0A 5ETPA 2QP4A 1EQ2A 4RU9A 3W9IA 2B8JA 4OFBA 2QL9B 2OO5A 2SKEA 1VI7A 3FC9A 1QTQA 3UAOA 3ADKA 5F98A 1HPZB 1CQIA 3K58A 3SEQA 2PZ8A 2Q6BA 4P92A 3COWA 4O5AA 1G2PA 3UJ7A 1EWVA 1DQZA 2KT5A 4DL3A 3LQ4A 4NV1A 1HE1C 3R24A 4R40A 3X2FA 2DEUA 4HNHA 4RHYA 3GPAA 3SXJA 3ZY2A 4OQNA 1P27B 3R7WA 2QM3A 4NCNA 3CLTD 4ETIA 3OJXA 2DGTA 4TKVA 2WPNA 4UZFA 4CM3A 4KO1S 1NXVA 3J81j 1O9GA 1Q77A 2ZBRA 1YRHA 3GA0A 5EOVA 3IV7A 1LDMA 4FW9A 5HJYA 2E6UX 3JVVA 1CVRA 3NATA 3LBHA 4O5OA 1KYIA 1WPGA 5ERXA 1ZETA 2BGGA 3V1TC 5ADWA 3IDQA 1PJCA 2ZRCA 1G8AA 1SZPA 5T67A 1PJZA 3T1HJ 1R5JA 5J2TF 2VOOA 2PSFA 2BFCA 4DG1A 1SG0A 1BWVA 2D7SA 3NALA 3N53A 3OKPA 3HFGA 3OTIA 2F00A 1Q0NA 2C00A 2Q07A 3WLRA 1RWMB 3V6JA 1E9CA 3A0RB 1HQEA 4JMPA 4L27A 4C1BA 3BE6A 4JQSA 1G5PA 4PYRA 1XDBA 1YJVA 1Q7TA 3QHPA 1FRNA 1IDN1 3Q9LA 3RO7A 5F0WA 3GMGA 4OQYA 1TTHA 1IG3A 5J5AA 2XZLA 1C9YA 2PUHA 2H5IA 3G5LA 2Z30B 1GQQA 4DQLA 3T5KA 2PZGA 2IHTA 1N2XA 3GEDA 4ZCLA 3IS9A 2GFIA 2WYVA 5FP0A 3T3EA 5B3AA 1UXJA 3HU1A 3ADOA 1U7OA 1GAEO 2BE2A 1ZRNA 3OXGA 2R7VA 1UOQA 5CLLA 2GASA 3UNYA 5J2MB 4DPLA 2ZJ5A 2HHCA 1R00A 2MMCA 1TAUA 3H9EO 5CJ2A 2EZTA 2OB1A 1U5AA 2UVRA 1SQGA 3H90A 5F2KA 2O01C 1W6UA 4EEKA 3DHEA 3RYHB 3I2FA 4KWHA 1JDBC 1RQPA 4RWZA 4Q1EA 2HF7A 2Z57B 2X1AA 4Y1EA 2Y1XA 1YB6A 5DTJA 3AM5A 4EW2A 2ASLA 3GMTA 2Q45A 3G17A 2F67A 2G5CA 4U7DA 4E6PA 1I2MA 1QU2A 1UC5B 2H2HA 3PC7A 5I7RA 2SCUB 4FOSA 1VRTA 1WEHA 5DBGA 5HCUA 3T12A 1GU0A 1NVUQ 2QDXA 2OVFA 3Q23A 3BN3A 1T8RA 2IWHA 5FDFA 3PJWA 5IRCD 4JI0F 3NHMA 1PZXA 4JP1A 2CDQA 1LPNA 1LPSA 5HVNA 2BEUA 1QVVA 4ZOBA 5HM6A 4BNWA 4V19X 2NVUA 3I53A 4YJHA 3DEAA 3GH1A 1ESCA 4HF7A 2G1HA 1M2NA 1FFXB 2AJFE 1XCJA 4ED9A 3VAAA 1VFNA 3BRWA 5AHWA 4GI2A 2VG5A 3UMJA 3WGZA 2DD8S 2BGLA 1UDXA 3UMGA 2PR2A 5BQOA 3UT5A 1I6KA 2I2XB 5JCXA 4DGSA 1Y89A 3NONA 3W8DA 3IIKA 1IULA 4TSKA 1RDRA 5EXTA 1KZYC 1PBUA 4LF4F 4AG6A 4ZVUA 3MYYA 2PLAA 1KP3A 4X3CA 2WF9A 2QMZA 5ETOA 4Q3LA 1T8EA 1VZ3A 1IY0A 2DH8A 2R7SA 1ZYUA 4D96A 5JAHA 4EI7A 4F67A 1TAGA 4JI0J 4LQ3A 3PPIA 5DM7Q 1ZTTA 1LNSA 3B9RA 5KNLA 1M6VA 3MVEA 5A9SA 3O2IA 1TMJA 2GBGA 1ZYQA 3RSSA 1YDLA 2C1ZA 2R1ZA 4DSFA 3BXFA 2J0WA 2Y0DA 5HG0A 4DLWA 5BN4B 2HFKA 3HHEA 3KQQA 1YB5A 4WVFA 1P2FA 4C03A 1YQ9A 1ZZEA 4NWBA 3E82A 4UCQA 1NNEA 3MHTA 2AK2A 3S2IA 5FOVA 3W78A 1GQRA 3TIGA 4BJHB 1YWGO 3GUYA 1DBQA 2PR7A 4GSKA 3KHHA 1N2CA 3K4QA 2DHHA 3E2PA 2HMUA 2C78A 1U2PA 2H16A 1WVMA 1SQ6A 2KW5A 4YRGA 3G82C 2YYSA 4LF4J 1D4ZA 3B48A 2HRDA 4FYVB 3D02A 3WLQA 1A9PA 4OSEA 5FA8A 4YRRA 4NZ6A 1JR3A 3E15A 1RE1B 2E5IA 2R2SA 4R1QA 2B7CB 2YZGA 4BGEA 2D3ZA 4LOAA 2VHUA 3MGCA 1EWKA 2IAJB 1QVAA 2XYVA 2FZKA 3COYA 1ZK0A 2O9JA 4ISCA 2IMWP 3DL4A 4I64A 4LQ4A 5AVOA 1A7JA 3BHJA 3OZXA 2OL4A 1CU1A 2AFRA 2JATA 4PAMA 4OV6A 4IGIA 2XMZA 4WKNA 3NW9A 2XOEA 5IJ9A 3C16C 4WWSA 2ODPA 2F65A 1NLZA 5CXUA 2PPVA 3EHDA 4BPBA 5K8NA 3EOBI 4YBZA 4ZGBA 2J0XA 3E9QA 4R9UC 2YVLA 3ELBA 2UKDA 1VMKA 1Z07A 2H29A 3UCXA 4FKZA 4WERA 3VR0A 1UBNA 1T03A 5EWLA 1JLSA 1POWA 4TROA 2XTAA 1UOEA 2DKFA 5KFJA 3NG1A 4CKCA 3L1HA 3E70C 1ECLA 4Z99A 3B2QA 2XGOA 3W63A 3VAMA 1E3WB 2N75A 3HJTA 1MO3A 2XGQA 2GZOA 1X0PA 3OT4A 1GKYA 3ZFVA 3SCZA 3TQSA 1J56A 4N9WA 3JXOA 1WACA 1XVIA 3KFLA 1A3CA 2RARA 3QW4B 3KS9A 5BV1A 4ZVGA 3AXKA 2ILTA 3QEMA 4BV3A 4UHDA 4HUTA 1Z16A 4JLMA 3A4YA 4BUZA 3NIFB 1HDZA 3T95A 1XEZA 1NJIT 1J7KA 4H7EA 5TE9A 1KEWA 2QYSA 4FZRA 4ZVFA 3X1ZA 3NEJA 3PQFA 2D5LA 4L5JA 5HQ3A 1T6NA 3RIGA 4LHYA 1QLWA 2JLEA 3MD0A 3JSYA 1QIIA 2R7KA 2OBXA 2PS1A 1RCOB 1JX4A 3DDZX 3EC7A 3SYLA 1SJFA 1A98A 5CX1B 3N9UC 1GPUA 3PVZA 3NANA 4QJBA 4DIUA 2BJ1A 3F49S 4ZYTA 2NMVA 2ZT5A 5C1BA 1T13A 3KTFA 1D2HA 3UK2A 2F9JA 3LY9A 1BXKA 1S2OA 3IJEB 4A46A 3I2KA 1B6GA 2E5GA 3B82A 5JYDA 1RT1A 2WTMA 4F25A 2GN4A 2PANA 5EZYA 4C5CA 4DNPA 4CEIB 3M1LA 5IKEA 1EP3B 3PIIA 3G2LA 1OMSA 3K94A 1I3OA 3EEFA 5FWDA 4Z49A 3LNTA 2CQ4A 2JLFA 1I4EB 2DHXA 1SVOA 4P4NA 2GLUA 1KDYA 1KS9A 2IDKA 4MV4A 1BSVA 3LUGA 5A6SB 1QHHA 4CDIA 4LYHA 5CXXA 1BA3A 5ALNA 5BSRA 3SFVA 1ZNQO 2FZVA 5IC4A 2HVHA 4OHBA 5BNIA 5G02A 1SUWA 4USJC 2BH9A 3CY6A 3IGFA 2ADBA 2QL6A 4KPUB 1M34B 4TQGA 2FVPA 3D81A 5IASA 1D1SA 1GM5A 1L7NA 1E2GA 1G5RA 4RZIA 3JQEA 3LCMA 4LJYA 3WQSB 2H4YA 1SXJB 4PZDA 2IRWA 2R97A 1A50B 1NHUA 4OG2A 4NBNA 1MHPA 2BBSA 5J1PA 3OJCA 1UBTS 2K06A 1TVKB 3O92A 5EGNA 3LVQE 3ZWWA 1U2ZA 1NBEB 4J29A 3UWDA 1XTKA 3OOWA 4NYZA 2NU8A 3OG9A 3NL0A 2I3ZA 1KC8T 4I50B 4MW5A 121PA 2V96A 3H97A 4A91A 5JROA 1YOVB 4PGGA 2CDAA 3THWB 4QWDA 2QSYA 4R3WA 4J0FA 4DPKA 4Z54A 2PKEA 5ER9A 3V6DA 2VK8A 2YKOA 1VJ0A 1JXEA 2RH3A 1MFPA 2ATCA 4MQEB 4DF4A 4GC7A 2WWIA 4PZEA 1ZM7A 1KLNA 1H9CA 4ZZ3A 3U17A 3TF5A 1VIMA 5I4IA 5ED4A 1RKXA 1U98A 1R8CA 1PT8A 5ERGB 5GAEU 2HKEA 3OHBA 3NBUA 5BW4A 5LB2A 1YAHA 2G7MC 1Q7LB 5FLXY 3AEZA 1TCCA 2FWMX 2Z5VA 3D5TA 4GBMA 4Y65A 2GZSA 2QN1A 3K6KA 1M6NA 1H74A 1SC4A 4C0KA 1SUDA 1M75A 2P5TB 4QYIA 4CZCA 2CYCA 4MB2A 5CA0A 5F3WB 3VR6A 5HI7A 1NW8A 4PO3X 3ESDA 1TMYA 3WL6A 2ORIA 1XEAA 3I4HX 1B7YB 4I1PA 4I2VA 2ISQA 3RC7A 3UJAA 4MA0A 1RHJB 4C0LA 1QQAA 4MJKA 2XTJA 3TCNA 2QGFA 2IUTA 3CR8A 3U44A 1N5LA 3L7LA 4BASA 2PMKA 4U63A 4D0NA 3H65A 1AUXA 4FWTA 2VUIB 2EBGA 1AMNA 1QG2A 2ZNYA 3FNRA 3HB4X 2A4MA 3IQEA 2CMKA 5EUQB 5I7OA 3L0BA 1UBEA 3G96A 3HVAA 2V03A 4KKXB 5BWLA 4LYYA 1KJ9A 4RL6A 5TPWB 3VTKA 3V7UA 1U0EA 3F8TA 1H0RA 3RJ9A 3ZW9A 1ZR2A 2Z58A 3KZNA 2OZVA 5CDTA 5IVHA 2Q5JA 4FFOA 5KYYA 4X20B 4JT9A 4GKKJ 2G80A 2B4TO 3I4LA 1XVTA 3UJCA 4QOJA 2FPPB 3WQQA 3HVJA 2GUWA 4IXNA 1T4CA 1Q8IA 2ZRBA 4EG7A 4CPDA 1ULHA 2I9KA 2I4OA 3YASA 3TX2A 2B61A 3N5CA 4QBGB 4C7VA 1IYZA 1SKQA 4TWRA 1DCTA 2JLRA 5EUHA 4REMA 3QXHA 4CQLB 4WACA 1F6WA 2OGZA 4S1PA 2XTJP 4R6WA 3OVAA 5DYTA 4RAQA 3DKRA 4HNAB 3OFVA 2I54A 5M5BA 4LSZB 1KVIA 4JI5F 2WWGA 3QWBA 1YBUA 2OAP1 2J4CA 2JIBA 5B7PA 3GUUA 1TZ0A 3K8ZA 1IVZA 1M8JA 1KSPA 1HDCA 3CM0A 2PQMA 5EDWA 5C5JA 4J3NA 4A2QA 4X7PA 4D46A 5JASA 5A8RA 3SY8A 1Q53A 3RGGA 1Z6TA 3SSAA 4R2KA 1FRIA 4OMFG 4FYJA 2IE8A 4KH0B 2DT5A 5JI2E 1UVMA 1Z34A 1B16A 5I3UA 5AVUA 3UEOA 3ND8A 1EFDN 4FUTA 1CUYA 1WG5A 3JRWA 4GVXA 4B3OB 4OHXA 4NV3A 3FNFA 4XUEA 2YW2A 1HR0F 2W2NA 2HJVA 4F3NA 1PCXA 1B0ZA 3C19A 2DFTA 3KB6A 1VJ1A 2XWBF 1ISRA 2DR9A 2QT0A 1QPZA 2GO9A 2PL9A 3FI0A 3I2IA 4B34A 1JLGA 3Q8PB 4J37A 1QTNA 4XPZA 1LLCA 4ETMA 4ED4A 3NY0A 4B5KA 4ZZ2A 2FZ5A 4IQFA 3JASA 2I3AA 4X6UA 4ZQCB 3BEGB 1TMOA 1ZGZA 1N5TA 3JD3A 3I9V1 3LIIA 4JI5J 5JATA 2MKSA 3QFTA 5AW4A 1P1FA 5EWMB 1UMCA 4U7HA 1H5UA 3CLHA 5CD9A 1UETA 1G9TA 2BZ1A 4KQ2A 4GS5A 4J4BA 3RRYA 2CF5A 4ND4A 1UZMA 2XQGA 1S01A 2J0UB 4C2AA 1CY1A 4NXNJ 5FLXU 4UHFA 1H93A 1USKA 2BM0A 4JV5F 4L3NA 3H0EA 3IT0A 4EX6A 4HQKA 2PVSA 2EC5A 3CXUA 4RD0A 5BNFA 3A1FA 1RWNB 5DMHA 3D4JA 1IOLA 1MO5A 2QP3A 2M2BA 2KRRA 4W8HA 2W2NP 3VAKA 4NATA 2PX6A 1KO7A 1EUZA 5TF0A 2WHOA 2OR3A 1Z9BA 4YC7A 2ZEJA 3V1NA 3FH0A 2DXIA 4PCUA 1OFTA 5BWNA 4LF7J 2FYXA 2IEAA 2ZPUA 3FPHA 3KQOA 1ZA2A 3HPQA 1ELOA 1E6MA 1NMXA 1ZHHA 2BACA 4LRAA 5DLQC 3A7DA 1PJLA 1E1QD 2C3YA 2UUPA 5HTKA 5BQPA 3OZ7A 1G6HA 1FUUA 1LWCA 4LVUA 2NUTB 2KS6A 2LCWA 1O8CA 3KALA 4YUYA 3MM6B 3ZYZA 5KUTA 4JV5J 4BNIA 4Q7LA 5CZVA 4LRQA 1IWBB 2C1XA 2O7NA 1WHXA 1IXKA 3MB8A 5E9QA 1PR5A 3UM9A 1M1KT 3K7RA 1XDGA 3WGKA 4IUFA 3NEAA 3OLZA 4UMVA 2X6QA 2G76A 5CYQA 1YZHA 3A1UA 3JTEA 4X1KA 1KVJA 5IW8A 2P0YA 1OT3A 3WL5A 1PT6A 3HV0A 1OHHA 4GPZA 3OCYA 3HDYA 3LZ6A 5K3FB 1QRSA 3SXLA 4UBMA 4ZOLF 3CVUA 9ATCA 3P0EA 1XLUA 3D3QA 5E1MA 3K2QA 2VH5R 3W6ZA 1CB0A 3MM5B 2B20A 1RLJA 3MD1A 2XQVA 4NG4A 3IQDB 5D1HA 4TXSA 1RYSA 2L08A 5T6BA 3PNLA 1GMWA 2AMYA 2IJRA 2GWHA 2FEOA 2Y1LA 1II8B 5IM0A 2JPDA 3QG1A 3AL0C 3OZBA 3KXKA 3V81A 1L4UA 1WUYA 4PG4A 2WOMA 3TMYA 1G42A 4J75A 4AE5A 1U2SA 3GJQA 3ADPA 4J5OA 4DKXA 4DPWA 1W5TA 2OBMA 1YS9A 2E21A 3W5CA 4ALIA 2LR0A 2RAVA 2PL1A 4AT1B 3AZQA 3JV7A 1YI1A 3TRKA 3BA1A 3KQNA 1IUNA 1VJTA 2XVZA 4ZT7A 3R0VA 1PKEA 1HT1E 3LMKA 3U56A 5KT5A 4ID8A 2CJXB 3GJ0A 4HACA 4JYAJ 2RU9A 4OREX 3QKWA 4NZ9A 4DN9A 3ZTWA 2KG1A 2LKDA 1RKJA 3UAXA 3O9ZA 1PR6A 1F8YA 3LT1A 3OZRA 4NBRA 4BXOB 4RCZA 1FDBA 2OGTA 4DR2B 1BVHA 1JMYA 3FBFA 3TX0A 2K7FA 1N0HA 1FI4A 5H9VA 3LO8A 3FN4A 4YRDA 3CUEF 1XTQA 3ISJA 4F0HA 1GUFA 2V8DA 1Q11A 4B43A 5K5EA 4HJRA 4NZ7A 1RJJA 1JLLA 1VMEA 2X15A 1J23A 1GZ3A 4P7TA 4ZREA 4MVJA 4XTTA 2GMJA 1SBIA 5DGCA 1CUJA 1VPVA 2O3SA 3R4VA 1II9A 2P30A 1JHYA 1PN3A 5D3MA 4HWRA 1L7DA 1A5AB 1Y6RA 1CRLA 2SKDA 1C4KA 4NF2A 2DGXA 2DCUB 2YH1A 3NS6A 3IR7B 2F9DA 3ET4A 3PR1A 1WMFA 4ARZB 1WBJB 2VDVE 3M32B 3M5DA 5EYPB 1EFAA 3KDSE 3O90A 4L5YA 2ZBQA 5LXTA 3LHIA 3QITA 5GVSA 3DDIA 3MYRA 5DRYA 2CAJA 3MUOA 3DOHA 2LEAA 4C8ZA 3WXBA 3I6YA 2QX4A 1DP4A 3QVOA 5F3TA 2H9AA 2R8XA 3IVGA 2DUNA 5FUMA 4AYWA 4CLRA 3WRYA 3DZHA 1GRVA 3PC3A 2RB7A 4RY8A 5I9SA 3OXLA 4L22A 1WSWA 4CIAA 1CQXA 4GXTA 3HP4A 1BZYA 5BRJA 1CRZA 5AE3A 2JHPA 1NQXA 3KQYA 3TQIA 4MVJP 2DKOA 1KH1A 4OYRA 4XWTA 2I7CA 4RL1A 2AE2A 5KVAA 3D6FA 1Y9ZA 1E4EA 2XMQA 4USVA 4W98A 4QPTA 2ZH1A 1L2TA 1GGHA 1L4BA 3ZCRA 3FCOA 1C9JA 4ACAA 4JFAA 3H9BA 4R5HA 2HHHB 4IFIA 3QUCA 2J3DA 2XUGA 4UDXX 2YZ2A 4OJKA 1U4BA 2X23A 1P4HA 4JJFA 2K3KA 4RF2A 1B2LA 3JQ6A 3UN1A 3NTXA 5KJ6A 4B3GA 4YLYA 5TS3A 1EK1A 1CVLA 3KTOA 5IH7A 4BNUA 4DCOB 3IB3A 2RS2A 2QPTA 3V1UA 1HNIA 1BLUA 5KFCA 2MSLA 1CLUA 5FYDA 1YZTA 1Q78A 3GGOA 1OWPA 4DPYA 1Y5MA 2I78A 2E1AA 3C8ZA 1UKCA 3N0WA 1GG9A 2X4DA 1BVUA 2YV2A 1FNSA 1VJCA 3O82A 3EGNA 3SSOA 3TJRA 1PJ5A 3ISTA 3AHPA 4LRWA 5EJAA 1UBOS 3R97A 3VTIA 2UZ4A 1GRQA 1OXXK 2PRIA 2M32A 2FP4A 2H0AA 1IZ9A 4DAOA 1Z25A 1K86A 3EPRA 1E0DA 1W46A 2CXQA 1IJFA 4HEA1 3ELYA 3VVBA 3PBKA 5F5LA 4KXLA 3MF5A 1TI7A 3BJRA 5I4MA 2QZ8A 4X93A 4DZ6A 2J67A 3JQAB 3VOBA 5K2OA 1PZEA 4K03A 1TIBA 4HH4A 2LDXA 4CMCA 3OHAA 1ATIA 1PSWA 4ZCRA 2V9KA 2F1KA 3A8EA 1V48A 4NU8X 4YV2A 1ACMA 2FJXA 5GJWC 1ZGBA 4OGFA 2I1VB 2X2PA 4JBIA 1U0LA 3OQMA 3J81A 5IT9Y 2P1RA 2QI9C 3EZYA 1WC3A 1Q6ZA 3NEYA 3OMXA 3AY7A 1V1MB 3QTTA 5DCUA 1L3IA 1OC2A 2UZAA 3M2RA 4WUVA 3I9NA 4YGYA 1D7OA 1THGA 1NV8A 2X2FA 3AG6A 5F52A 3EM1A 1HMVB 3NNAA 4DDVA 4QIVA 4D43A 1YJNS 5K4HA 5DK4A 2LRHA 1WDDA 2HWKA 3D8SA 4UTXA 4PWDB 3PC8A 3B6MA 3OJ0A 1SJ3P 5C80A 1WUUA 3AIKA 3LK6A 2ZIEA 1A72A 1ECFA 4TTIA 3DDSA 3T99A 4QFCA 3ETNA 4XRGA 2OPPA 3R0QA 1D2GA 4MZDA 2E5LF 2WOJA 1LGYA 2EVWX 4OA5A 2NUPB 3PDUA 4YRFA 3TEJA 6ABPA 4MWCA 3ZQJA 3NVAA 2VC2B 5EN1A 1ZICA 3FOZA 3KVRA 2C2MA 3BL5A 1U9IA 1RTHB 1SXJC 2VJDA 3AHJA 3H5TA 1AKNA 3M6IA 1NFQA 4MPTA 4RHEA 3CX4A 1MC4A 4HQ6A 4IIBA 3JZAA 5A05A 1P0PA 4MS3B 4WN9A 3VR4D 4IG3A 3RFFA 3M6UA 2YNFB 2CHQA 2Z8QA 3Q40A 3ESBA 3KZVA 3V8NA 1GKIA 2XDWA 5HGJA 2NS1B 4YR2A 3KK3B 2WLTA 4BZZA 1YRTA 4CM4A 2VA9A 3LYAA 1XV5A 1GNVA 3EGVA 3GNQA 1X8XA 5TB5A 3ETDA 4CI9A 5SYMA 1Z15A 4TV8A 3RREA 3WMRA 4PTZA 1XMQF 3H1TA 1U04A 3WB9A 2W6PA 2QAJA 1FFSB 4MDEA 3E9RA 3T8YA 4L8WB 3JSMA 1MB9A 4KOEC 2E5LJ 1J25A 2NYIA 5DHPA 4WJZA 4E5UA 1W0JA 3E2MA 5LQRA 3GHYA 3AP2A 2E9RX 2WWRA 5AM4A 2GBIA 2P40A 4XQ9A 3K9BA 2XB2A 2YR0A 1BX3A 4FOPA 1RABB 4LRUA 2XZWA 3W6NA 4D8WA 2UAGA 3IO1A 4B4KA 5AOBA 3HFRA 4EAQA 4H2DA 5ITVA 1Y0HA 3BMQA 3TZWA 1MEEA 3VTZA 1S8FA 1DLOA 2NO4A 1TTPB 3ZNUA 4G09A 2XBLA 4YXFA 4ZS6A 2WJVA 3W9HA 1XVAA 1XKTA 3DNCA 3RTGA 2NVWA 4J9KA 1KI6A 3QU2A 1G3RA 4IWNA 3D8NA 3ZU3A 1RYBA 2ZAOA 2C1EA 2HIGA 3SX2A 1J5OA 4K2HA 2QC3A 2QYHA 3SI7A 1OPIA 3GLIB 3PLAE 5ES3A 3QJPA 2F43B 2N3ZA 2VDWA 3PW2A 4R83A 2IPXA 1Z45A 4YXWD 4GYKA 2XB9A 1VL1A 3M7IA 5GZ1A 2E1RA 4JVNA 2AOUA 4RA9B 3WWYA 1Z7GA 2AZXA 1HBOA 3U1LA 1EETB 3T3HA 2PYDA 6GPBA 2G0TA 1T15A 1RAAB 1MG5A 1P6UA 4HZUB 5IT9U 4E30A 4D81A 1H65A 2FJPA 2CPFA 2FB0A 3EQZA 4OHWA 2YVAA 4M5GA 4DEXA 1RPNA 2ZTLA 2GPTA 5JSZB 1JDBB 3JARB 4BRZA 3K5OA 2X19A 1V2HE 3UWKA 4QWBA 3ZV4A 3HKWA 2PUTA 4D92A 3OFHA 5BWMA 5D0GA 2RE1A 4YRTA 3CH6A 3TLJA 1I3KA 5KFBA 1KSFX 2ETVA 2IV7A 1L5HB 1DHRA 2C9MA 1QHIA 5RUBA 2DM6A 1EJBA 4CMJA 4F4ZA 2YN4A 5EXEA 4ITUA 1NBIA 3CD0A 5BW5A 3FDZA 2C5EA 3LFHA 3K1JA 3PL1A 1A88A 2WC1A 1GNLA 4CCYB 1JDTA 1W85A 1NUAA 4JC8A 2XRFA 1RAFA 4BTLA 1S1VB 4KGZB 4NU5A 3NV9A 5C1DA 3DKPA 2B6HA 2OKCA 5CK5A 4AJPA 3GLTA 4XQEA 1X1QA 4ZC8A 2HJ9A 1GR1A 2X9VA 2WF8A 2QTVB 2CYAA 4HBGA 4RTRA 1KFKB 1LC3A 1XBTA 4ZVSB 3F8SA 5C7LO 5GZ3A 1IUKA 2ZWMA 3ZGNA 1M1YA 3QMMA 5B2FA 3DOKB 3C7DB 5HKAA 3RROA 4C78A 1RT7B 5I9TA 4HB0A 2RS8A 3O84A 5JYEA 4X62F 1PT5A 1F6TA 2VT3A 2VZ8A 1Q3KA 2VAVA 5I5EA 4PX3A 1RZRD 2Y05A 1AMUA 2CZGA 5JSFA 3OTOF 2QJFA 2VT6A 4GXQA 2IDMA 5AJTA 2FY1A 3NBMA 4MCAA 5CB4B 3NS7A 3THYB 5LVAA 1P4SA 1MC1A 4PZ9A 4A73A 2HX1A 2W6ZA 3FLAA 2BI4A 4N3AA 3SYZA 2IXBA 3F4LA 1WOMA 3PXCX 1N6PA 4A1FA 4FF4A 3BQ2A 1KR4A 3OLYA 1WELA 2OHVA 1R0LA 2IT1A 4NI5A 2O8DA 4ND2A 4XIUA 4YR7A 2AV5A 1NJ8A 1HETA 4TL9A 1RAJA 4WXMA 4PZCA 4CHGA 1MF7A 3VZPA 4ZD6A 3KLHA 4HAIA 3VR5A 1YZ6A 3HU3A 2R7RA 4DNQA 3GYBA 4YI5A 5JS2A 3HRHA 3MRXA 4BQSA 1M66A 2IYVA 1K0FA 2ENWA 2H9IA 2HEGA 1M0SA 4Z3DA 2PFFB 2D3WA 3AR4A 3OTOJ 2W6CX 5BUZA 2JIDA 4WLEA 4XQGA 1RP1A 1Z5VA 5KTQA 4IOAQ 4AKHA 2B3TB 3H42B 1USWA 4WA8A 4F4DA 1XU7A 4KFCA 2FR8C 1T36A 1DBDA 3KQSA 4KV8A 1XC9A 5BMVB 2E85A 5GV8A 1Y4DE 5M7EA 3MZ0A 3M1VB 3GFTA 3FTCA 3QLHB 3OLQA 3ABQB 4CYUA 2I6SA 2DUWA 1PJBA 3H7HB 1YDFA 1QM5A 1FWLA 2H1VA 3G89A 3ANTA 4CMHA 1TCVA 1KEPA 1ZU4A 1P9LA 1KYVA 1ZCZA 2G77B 3BRQA 3A2NA 4Q47A 4QVKA 2UV8A 1KY4A 4PU0A 4Q0BA 2FR1A 4LJAA 3TG8A 1M76A 4IZIA 1DQ8A 5K09A 2BJDA 1Y42X 2WI8A 4D57A 2DR0A 4F2HA 4OTZA 4BVAA 1LTHR 1PQYA 5I8ZA 1DIGA 3D3KA 3RJMB 2ASYA 4B3TF 2B4PA 4KR7A 3NDPA 4L8YA 3IT1A 4ZT5A 2FUG6 3IILA 3U4HA 2R0QC 4F06A 2FV8A 3DWIA 2GQ2A 1HE3A 3CCFA 3WE7A 3KHKA 4QR0A 1HARA 1MT3A 4HYTA 4OD0A 2QDKA 3DBHB 5LOQA 2R5WA 1LZLA 1ZD8A 4DS5A 4D4MA 1JIKA 2FUNB 4KQEA 3KG4A 1XT6A 4RJ2A 2JOQA 4EFKA 2BM8A 3HB9A 2D9OA 3R3ZA 1NYQA 3HJRA 3TN7A 1X1CA 1POXA 2XCOA 1GAXA 1IONA 4KHZA 1R4ZA 5ALVA 1KJIA 2ONYA 2M6SA 4FDUA 2QTMA 2VSXA 3FPFA 3LDFA 1IFXA 4X64J 1YD7A 3KBBA 1XEWX 4G5OA 5EA2A 4NH0A 3K5NA 1A6LA 5CG1A 1L7AA 1IEQA 3SIPA 1Q95G 1CBKA 3VC3A 2PG3A 4UNQA 1TZKA 1JLFB 4MR9B 3VJRA 4OX7A 3LPEA 1AHIA 4HH1A 2YL2A 3LPYA 2WB2A 2CXSA 4HDNB 3FBGA 4X4QA 1Z4OA 4LWOA 2PGNA 4Q9DA 4NULA 2E7VA 2JFXA 1QAOA 4MW4A 5AOVA 2ZH6A 4W1PA 2V4JB 4F2SA 4ZC1A 1WABA 4EO8A 3AKDA 3K5HA 4L4ZA 3CCLS 5CZXA 2BR5A 3OZVA 4Y2YA 2ZI6A 3IIIA 1JIVA 2QIOA 2XE6A 4MEJA 4YH1A 4R2MA 4CM2A 2FTRA 1H85A 2VNIA 3HA2A 5J2QA 3MCUA 4OIXA 4DMCA 4CTAA 1AOXA 3G02A 1KEUA 5KNBH 5AVXA 3K7EA 4QVIA 3BO2A 3SQMA 1XTSA 4RC9A 1T2AA 4NASA 4B5LA 4DV7F 2H1YA 4LS3A 1E3MA 1FEEA 4J3JA 4N18A 3A6FA 3K2IA 4TQSA 3IKMB 3MMCA 2IOFK 2ZTVA 1HLFA 4X4NA 3A3NA 4E09A 3MUVP 3VTFA 4O4LB 1T8UA 1PI3A 2WSLA 3K09C 1TJ5A 2VDLB 1GUZA 3M8PB 2QTLA 1OI3A 5GMOA 1VE5A 4YRJA 1FE4A 5CYMB 3MRTA 5AVYA 4X4OA 3KKMA 3LLCA 2ZJ2A 3WHLA 3AW9A 1Y0BA 4LY6A 4B3DA 4IHQA 1R0RE 1W2WB 4C7OB 4XQ0A 4UCXA 3HN7A 4IO0A 1LA2A 5A3JA 1D1TA 2VLBA 5J23A 4H3VA 4KN5A 3U27A 3LJKA 2Q5CA 1JR3D 4FNAA 3V8QA 4BZPA 3BFKA 1RM3A 3KB1A 4LGCA 3EFEA 4DV7J 2CNKB 4ITSA 1P0FA 4BIIA 4ECVA 4FSHA 2BC9A 4IGAA 1RK8A 2JIZD 1FRXA 3MCMA 1Y9JA 3MXTA 4FFWA 2AIRA 4GC9A 4WTYA 4NI2B 4QBTA 2G1KA 2QSFA 3QE2A 2Z5FA 3NNSA 4K87A 2QMYA 2R751 3VSEA 4LHWA 4M63A 1C0EA 1QQ5A 4MW0A 3UJHA 4F3OA 4R98A 5JY6A 2YXBA 5JCPA 4ZDJA 2X14A 2OV3A 2RNEA 3C2QA 4R8KA 5KYXB 1CF2O 4EFAC 4NNOA 3I0SB 3GJSB 1KHTA 3B2NA 2POCA 2P9BA 4K40A 3WHIA 2ODTX 2VICA 1C7EA 1R6AA 3KQKA 3BYPA 3RV4A 4RFSA 4LE1A 2AJ4A 2IITA 4AZ0A 4QSHA 2ZDHA 1MW9X 4GXNA 4DF3A 4BCBA 2Q8QA 2YUTA 3Q3GE 4GPEA 1JWBB 4DUGD 2JFNA 3CPJB 1KONA 3HDHA 1G4CA 3W3ZB 2F7SA 5BYQA 3RTAA 3VZCA 3Q22A 2REQB 1C1DA 3HRKA 3K35A 3UWMA 2M52A 5A03A 1FTCA 2OO4A 5H9WA 4O4HF 3LUPA 4CDGA 3IMKA 1Z68A 3KLEB 3MECB 4E2ZA 3M4ZA 1RWPB 3NTLA 3RAGA 2HXGA 3WC4A 2VI5A 3D4NA 3DM2B 1V6CA 2C61A 3DOLA 4MIBA 4YROA 1PQWA 4Q4HA 1JEQB 5TGZA 3VDNB 4NFLA 3EVNA 1ZH4A 4RV5A 2J8SA 1L7VC 2H18A 3K6SB 4BGIA 4Q9JA 3A9SA 1R5NA 5LQCA 4N4AA 1KOJA 1OB5A 2AG1A 4LFCJ 5IJWA 3M89A 1PFYA 3LH5A 4WBNF 3OQOA 3IXQA 4QU5A 1Q8KA 4LVOA 3F96A 1NMEA 1ULSA 2LVBA 4TKMA 1TR0A 1FNCA 1JBQA 4ALLA 1WUIS 2EGUA 4TVBA 1PRYA 3IBYA 3M4NA 3PPVA 4J9OA 3DMGA 1C4XA 2RHQB 2FW0A 3ZCUA 5KG5A 1OPRA 3L93A 3KK0A 1TA4A 4FONA 2EYQA 1VQYA 2OPHA 4YP1A 2HSGA 5EZ6B 1NTOA 4ZP8A 2VSOA 3VNRA 5KFOA 1RCTE 1FYVA 4ME6A 2JH8A 2DNNA 2FVCA 4JNKA 1JKJB 3Q88A 1A69A 3IQFA 2H1HA 3CEMA 3ONNA 2GCIA 3GRVA 2A67A 3WAKA 1FMFA 2BEVB 3P45B 1YHNA 1Q7BA 3FXAA 3TL3A 2A94A 4PO1A 2HTEA 2C57A 2IVZA 3JWIA 4LRSB 1FVFA 1T2DA 4BATA 4LVOP 1V7QA 5HROB 2PI5A 1I3MA 5HMZA 2HVIA 5TEWA 2MSCB 1Z08A 1P18A 3UMMA 3TLXA 2YNIA 3D3WB 3T1QA 4KXFB 3IAM1 5B08A 1NUUA 4OUKX 2R8PA 3A06A 3WGLA 4LHZA 4EWTA 4UUAA 1EBFA 4LV8B 4E03A 4KMOA 1WF6A 2DBQA 5IX8A 1YU9A 2VJKA 1P1HA 3SMQA 3DV2A 4LZLA 2HNYA 2XWYA 4F2GA 4TV9F 4WTOB 5KTPA 1XMSA 1XE3A 4BPRA 4E2YA 3D4BA 4FSDA 5CT6A 3IA7A 1KH2A 3L0PA 1K7EB 4P31A 2IJNA 4D5EA 2E44A 1YRYE 2VF5X 1CIJA 3T6BA 2NX2A 1B6SA 2FHMA 1B4SA 2VP5A 5EIHA 2OHXA 4RORA 1JZTA 4KDRA 5ARDA 1XNHA 2Z56A 2TMKA 4UTRA 4B9LA 1T05A 3UPUA 4MW6A 1AUQA 2ZYGA 3E22A 2B37A 2H08A 1FQOA 2P6RA 1OY9A 4QUHA 1A9OA 5KJFA 2BUCA 3EVOA 4MIAA 4G2NA 1AIPA 1E2NA 4OMUA 2BCGY 4WZAB 1Q1NA 2R7WA 2ECQA 1EJ2A 1C2YA 1E5LA 4R81A 1WI8A 3CKYA 4P71A 1MJ5A 4GQAA 2C9OA 2IMOA 3NGDA 3CZRA 4AZ3B 1C7FA 3FSIA 2PZBA 3S1TA 3SX0A 5J1SB 1JKXA 3O75A 5FNVB 2VONA 2PRJA 2XI3A 4BYGA 4EJ6A 4LNUB 1CPZA 3VR6D 3KTDA 3BAZA 4CT4B 2PU5A 3CKKA 2GJ8A 2R66A 5IC6A 2QHXA 5KTSA 2D2VA 1LW7A 3A4LA 3LP0A 3G6WA 3HKEA 4JI3F 2J0SA 3IBWA 3ZU6A 1ZY2A 3QXCA 4RW6B 2Z2JA 3JYPA 4JZYA 4N5SA 4LYEA 1CR1A 3NKFA 3Q7TA 4DS3A 2V5HG 5GINE 5JQWA 1OWOA 3CO9A 5I3ZA 1RADB 4C6RA 4Q6BA 4C4YA 3EXEB 2JG3A 1TU4A 1VSBA 2ADMA 4CLHA 5GV7A 3RZAA 4W82A 1CF9A 4F4AA 6AT1B 1GLGA 3AKZA 1Y3KA 1CY6A 3L04A 2ZU0C 1L6IA 4DEYA 2OOKA 2R6HA 5H68A 4NABA 4K6CA 4HB3A 4HN4B 2FUG9 5DQGA 1RM5A 3D5QA 1ETHA 1W0CA 1GL6A 3WWDA 3AEKB 4AUKA 5DYNA 4D9KA 4YX9A 1SUQB 4B9MA 3NXZA 4JI3J 2WHQA 1VXRA 1JFFA 1SUEA 3UN3A 5C9ZA 4X45A 2LTAA 1GKUB 1DAPA 1XELA 1E5XA 1MWYA 2PUFA 4NS4A 5HIMA 4L74A 3V4FA 4C0SA 4YMUA 1VP3A 4PSVA 3QWFA 4JA0A 5KDOA 2P68A 1QNLA 1J1UA 3DXXA 3OCZA 4ZCSA 2D0DA 5CIYA 3OVSA 2DETA 1H2FA 4RK7A 5ALSA 3PPWA 2C42A 2J4FA 4G97A 3KUGA 4YP9A 3A12A 2VFVA 1WSRA 1KI2A 5EPOA 3KHRA 5C53B 5LP6F 3DDNA 1RSCA 3O4JA 4QTUB 3BZBA 3SCIE 2YPZA 1IN4A 3M1AA 5KB3A 4KB5A 3BILA 1IZ0A 1V7PC 3QE3A 2OFWA 3RK1A 2RIRA 4Q1DA 4NFYA 1BVYF 2W9CB 4ECZA 1Y5NB 5CRIA 3K1TA 5LJ3Y 1TZBA 1DIOB 2RC5A 1YTLA 5C1IA 4EA9A 1CJKB 1VKRA 1O4VA 3VDXA 2G9ZA 5FDLA 2VG6B 5EJ5A 2YWRA 3KWJA 4AWXA 4CKXA 4QUJA 4AI6A 2GSWA 5HM8A 4GWLA 3OXFA 2A8YA 1F0KA 4ZITA 2W70A 1DBVO 4ZYVA 1VCMA 3JYTB 1VIDA 3NAQA 3P8BB 1Q7CA 2IWRA 3E3AA 1ZPWX 3G68A 2BGIA 1AFIA 5JZ9A 3GU3A 2APJA 2CDRA 2W4MA 3T0IA 4MUJA 4GO1A 3HLTA 2DP4E 5DYGA 5A4JA 3U1NA 1E1CA 1FFAA 4G41A 1R7RA 3BWCA 3AYZB 2M70A 3V2GA 5FBZA 3QOYA 1R4NA 3ZHBA 2CD7A 2PT6A 2CKMA 2CJ9A 1P1RA 2C2KB 1PNQA 5HSPA 3KLNA 1TKTA 5D3KA 1YZYA 2PO7A 4R69A 3QSGA 1PJQA 3GY0A 4EL5A 1O5TA 4YFYA 2QZ9A 4I14A 3DBVO 2H54A 1J9ZA 1RQGA 1KEEB 2G36A 2ZUSA 1B70B 1AS0A 4QYRA 4Z9YA 2MYPA 1MJFA 5FL3A 3SP1A 2JIMA 1WF3A 5KOJA 3WNQA 3FGPA 4W99A 1PJ6A 5EKDA 5EXXA 3OFGA 1T9KA 2YIVX 1Q3TA 1G38A 4KVGA 2IIHA 1BNCA 3PGVA 4F6RA 1C9DB 1ZEMA 1YUMA 5LOVA 1HF3A 1JS1X 3AIMA 3RBEA 4KREA 1GV1A 2QIFA 2D5IA 4TM7A 1WO8A 4CF4A 3LW5C 5A4MS 1CUZA 1E2IA 2HK6A 4IRDA 4WKPA 4DYVA 1FRHA 3L8ZA 3FBWA 4OQMA 2FWRA 3HDGA 2O8FA 3MWGA 3LP2A 4KSYA 5H02A 4JN6B 1Z6YA 5KYNA 1PNRA 4AZSA 4CM8B 3BSWA 3KC2A 3PICA 2KVIA 3BFJA 1IPFA 1UJ2A 2CNLB 3IUPA 3OPYI 1OHHD 2DPMA 1SQ5A 3PK0A 1USUA 1GD1O 2Q4BA 4LC0A 3AETB 4X1IB 2WDZA 1OA1A 4PICA 2G13A 3KSAC 1QH1B 1QMPA 2V0CA 4H4OA 3P5SA 3PNKA 5CQGA 2EWVA 3UAVA 3O47A 3MJDA 5BSFA 1OH6A 4IWYA 2AQHA 5K0JA 3ITDA 5TMDA 3H5VA 1FRLA 1KFCB 5CR9A 3KUCA 2J85A 4ELVA 1PS9A 1GMWD 4IJWA 1E9SA 1R8SA 1XO1A 1FD8A 3TLMA 5DKFA 9LDBA 2R6GA 4K6MA 2QG9A 2CQ2A 3C39A 5D5HA 2K3IA 4IFVA 1ZONA 3KKFA 1MVOA 3O9VA 2LQ5A 2OZKA 1ZIOA 4LF6F 1QJHA 3RRHA 1MO4A 3DEYX 4PGMA 5KBYA 4L7VA 1VI6A 5EE1A 3A2KA 1JG7A 3AA9A 1MN7A 1RLUA 3HUUA 4M1SA 3TZXA 4DYDA 2VA8A 4B48A 3LQFA 2AG5A 1HA3A 2BOVA 1Z7YA 3N6MA 1KDPA 4WCFC 1YZFA 2JEOA 3UHFA 4OHYA 4OHMA 4ZPDA 3OLAA 3E9DA 3V4LA 5CH7B 3P49B 4P5PA 2YWGA 1V11A 2QLJA 1THTA 1T0PA 2B6AB 4KAIA 2G88A 2YYYA 3GG2A 4B2YA 4BLOA 1D0IA 2AZ4A 1OWLA 3BV8A 4B6JA 1HYSB 1W5AA 3JQCA 3TLBA 4HDKB 5CBPB 3L4EA 2AFIA 2D3O1 4I6GA 2WABA 1TECE 4E1VA 3Q0TA 1JHXA 3BHNA 4PZUA 4RMNA 3DDUA 3TL6A 3CLVA 1QAIA 2OGUA 5P8WA 3L4KA 3B60A 1ENYA 4B1FA 2HAFA 5F9LA 3OWXA 3TYXA 3C7CB 3WX8A 1GXTA 2GPAA 2L48A 3AFOA 5IM5A 1MP0A 5F1OA 4DFMA 5JAOA 2G4VA 3Q3CA 1NT4A 2AD1A 2RMLA 4RDXA 4LF6J 3BJEA 2XIJA 1SOVA 1RI1A 1JN0A 2HA5A 1D9ZA 1DT3A 1GXSA 4XO0A 1E8MA 3CEAA 4H9GA 5JS7A 3IKTA 1B6TA 3BEDA 1XQ6A 4PVCA 3Q3JB 4A9AA 3K9NA 1I5OA 2MINA 3PF9A 2Y0CA 4ZN6A 4JLAA 1KPGA 1E6VA 1AMOA 5LA6F 2GPWA 4JLKA 2ODQA 2HU2A 1QJ4A 4OFXA 3L18A 4NBUA 2P6UA 7YASA 5KC9A 5DB4A 3Q1KA 3QGGA 1G5IA 3CD7A 4HAXA 4FPXA 2V6FA 3G9QA 3PO5A 1PE0A 3HCEA 1VPWA 1H3FA 3EZGA 3D54D 3UB2A 1DWPA 3JALA 1DMRA 5T4BA 4LHXA 1PG0A 4S0MA 4WFJA 4U8YA 1S0UA 5HMYA 4M0CA 3NGXA 2JHFA 3LP1A 2YY6A 4R1NA 2IYOA 2OPSB 5FNZA 5A4AA 1SD5A 4UOGA 4D4LA 1KZGB 1GG2A 4HMQA 3DEKA 1NSYA 4M86A 4O2LA 3IQWA 2C20A 3EE3A 3WSTA 5HOEA 2C7OA 4FKMA 5G1NA 3GZNA 3L77A 4PYAA 4K4XA 1NW6A 2DBYA 5LZ5A 1KE2A 4WPAA 2WUDA 1TIPA 1PC4A 4JJAA 4ZVVA 1EAMA 2XXAB 3OPYB 2XDAA 1G9XA 1RQ0A 2L19A 1X3SA 3AXTA 1FKOA 4WE1B 1L4LA 4O3RA 4BMNA 4WDQA 1TU3A 3LGXA 3JWPA 5AHRA 3LUYA 4H6XA 3BH7A 2BJVA 5CNKA 3E9CA 2YZ7A 3S44A 3W90A 3U0BA 2Z43A 3EZLA 5ILOA 4MI1A 2D69A 3GLHB 2CLCX 3QYFA 5AI5A 3CRNA 1WC6A 4URZR 4Y6QA 1FFGB 4RUKA 2LDYA 2EAUA 4IHJB 2GH1A 5C46F 2EFCB 3HR8A 2VPXA 4FI3C 3RFUA 2DY9A 2AKAB 2NUHA 3HD2A 3MQ4A 1L4FA 4NAVA 2ZIZA 4YK7A 2W83A 3JYQA 1FYEA 1SBCA 4PFJA 5E7JA 3D7LA 1IAVA 2QRPA 1OQAA 1OZ0A 1WOYA 4Y3UA 2XVMA 3BZUA 3TE7A 4C6AA 3LRXA 1FEHA 3EIEA 4OZ5A 1FW8A 4R0NA 2IRUA 2XYHB 2FJEB 1V9CA 1Q3HA 2VWHA 4RJIA 4DJJA 2Q3MA 4PWWA 5JC1A 3QU4A 3NAGA 4IKOA 1GNPA 4PQEA 1X4DA 2SHKA 5BN3B 4YOEA 4UEWA 4GVBB 1A0OB 3HCBA 2YJNA 4TLEA 1L5OA 2E87A 1T34A 4UAJA 4GT1A 1B76A 2D1RA 1G8JA 3DGFC 1YZVA 3TTTA 3K5MA 3SZLA 4ENUA 4XSVA 4X65B 2WZ1A 4RZQA 3CW8X 3D8UA 4IY1A 4LSLA 2EU8A 2XGJA 5HKLA 2QWXA 4E5NA 2FQQB 3ENKA 4PHFA 3KYDB 3QKSB 4TGLA 1C50A 4DEVA 2ZB8A 2PTHA 1SHUX 3CJ5A 2ES4A 3SQGA 1VTKA 3GEMA 3GDGA 4DMLA 2CE2X 2GAHC 2ZBVA 1UFQA 2O7QA 4B9UA 4JLPA 5BV7A 5GAHI 2CL7X 2ZE2B 4M2LA 4YO8A 2DH7A 4S24A 5JVGQ 2ST1A 1OCEA 3LY5A 3T34A 4DA7A 2AG8A 3RWBA 4O2AB 3CLTC 3RSCA 2JD0A 5FYQA 3UHJA 5DDQC 1U1NA 2BD0A 4RVNA 2OSBA 2EKNA 2V0NA 2QJTA 4MJLA 1HR0J 1WQ3A 2Y8EA 3ILYA 3ESYA 1R6XA 1IY8A 2HI0A 5BSKA 3W1VA 1LTQA 3R8XA 1PR9A 4FN4A 4F8RA 2CQBA 2FSVA 1N78A 2KWIA 2OPRA 3D43A 4P53A 1TKDA 2R00A 3S3TA 3RS4A 1HX7A 5HYVA 1RKQA 3OX4A 2G28A 4CUJA 4O4IA 4AJ9A 1AV7A 2X9QA 4KT0C 4O08A 1EWRA 2X3YA 3A31A 4WFIA 2CXPA 1HNVA 1BWEA 4KIWA 1REQA 4TWIA 2UZIR 4P2SA 3VHQA 1H8EA 4JUFA 3D1VA 1P9NA 2Q50A 2NO0A 1ISSA 3VI4B 4G4GA 1W0JD 4QBIA 3I9JA 3BDIA 4F3CA 4U6PA 5B7WA 4B32A 5FB3A 5C24A 2CFSA 1PYSB 4N5HX 1ZHFA 1RT5A 3BE8A 4OPMA 1XZCA 3QVLA 2JD1A 4R2IA 1AUDA 3CTMA 5FOXA 4E70A 4K4ZA 4DL9A 3LYUA 1PQ4A 1Y3JA 1H2EA 1U1IA 2Q8PA 4PKDB 2PSEA 5CT9A 3TA2A 1NNUA 2FE1A 5MHTA 4FX5A 1GPYA 3DUFB 1KGDA 3JQBA 3FB1A 4WGFA 1B99A 2WD7B 3RVMA 3FFAA 4FGZA 4YDDB 2VFUA 3PJGA 2P9GA 5KC8A 1Y3CE 2V2QA 4DBVO 2GCFA 4CMIA 1ZKMA 3D0GE 1QP4A 5ALDA 3G71S 4PLFA 1EFLA 2OMLA 1U7XA 3FTDA 4J9NA 4W5TA 3CVVA 2NP7A 2HSWA 3AV3A 3J81Y 1OYVA 3ONWA 5B0FA 4QOIA 2FCRA 4JR2A 3J7YU 4YIKA 4QDOA 4WNAA 1Z6XA 4PG7A 3HHPA 3DFIA 1EUDA 2O8VA 4G4IA 2QD4A 3HZRA 4P34A 1P2VA 2J8AA 3DHYA 3CO0S 2VVTA 3AT1A 2FFBA 5B6PA 1LF5A 4BFYA 1NKTA 1Y7LA 1O0CA 3THPA 3WIVA 2A9KA 1YZLA 3CUVA 1CQZA 1DJOA 1EFVB 1LX7A 3HWSA 2YS6A 1T6XA 2C59A 1CSJA 3JWEA 3QTBA 2Y1FA 5F8GA 1TQ8A 3WFJA 5KSYA 3MD3A 2KX7A 3PTAA 5EEHA 2CC2A 1VXOA 4NDAA 1BS9A 3ZJVA 2VHEA 3MCVA 2O5VA 2DGDA 3TP2A 3EIHA 4IRKA 1RAEB 1O87A 3SYNA 3IPYA 4D82A 3CIZA 2PSHA 4D4KA 1Z82A 4IIJF 3GZ4A 4AP6A 5DASA 4U6QA 1AKYA 3ZGOA 2CPXA 2CMHA 2YX1A 4JB0A 1P4AA 3B13B 4M9UA 1RAGB 4XM0A 4CKBB 2R8GA 4IXDA 3H1AA 1JQBA 3FFTA 1OLXB 4HWPA 3LKZA 3BUSA 2ZJ8A 2UVQA 4D74A 1V6AA 1YC5A 2OPQB 2ORWA 2W6OA 2F5GA 4BL5A 4WFNQ 2CJWA 2W2LA 4TPKA 3HGTA 1SC3A 5SY9A 3JQKA 4WP9A 1ZH0A 2HA6A 2BFMA 3W2WA 1ZOLA 3PHTA 1YZQA 1XLVA 2IEBA 2EFDB 4YMTA 2WU0A 5F33A 4I6AA 3FWNA 5K9FA 4TLQA 1SU8A 1GTEA 5E7OB 5EX0A 4Y2GA 4YHHB 4FK8A 2HRCA 1CJKC 2VDQB 2ZTSA 4H4KA 3PQ4A 1CJTA 1VCOA 3PQ7A 2W6MA 4H16A 2WPDA 1JI0A 3WGHA 2VTKA 5D7BA 5IT5A 4ZV9A 2V45A 4M1OA 3IIJA 2XLKA 2J30A 2G0IA 4XJVA 4C48A 1J0AA 2J7UA 4RK1A 3SCJE 3AO0B 5JCOC 2FZCB 4JDUA 1UWLA 3UUWA 3AEUA 4KRGA 1M5SA 1HW9A 5AFSA 4K28A 1WV1A 4ECUA 2B99A 1NBAA 4UTGA 5IQQA 3K9HA 1SQFA 4EG0A 1Y1PA 3UK0A 3DA8A 5U47A 3S68A 4ALMA 2H2AA 5IKMA 2I22A 1OQ6A 3PRBA 3M8QA 3HEBA 1Q0SA 4TS1A 1YTYA 4KMMA 4HC4A 5K14A 4P0TA 4KXVA 5LQMA 4RKFA 1MAHA 3R9XB 1HD0A 3G2NA 3HS3A 3QYYA 2KZZA 1HQYE 2NAFA 3KVNA 1X4FA 1JYFA 1PJTA 3CX6A 2COKA 2EZ4A 4M6WA 1XR3A 5CEFA 3O0DA 3J81U 4O4JB 4Y9DA 4KSEB 3W5UA 1S49A 2NUAA 3MLBA 4EZ6A 3JTOA 1K3UB 5L1IA 2YJTD 4F3YA 1A2KC 1VE3A 2J5XA 1PD0A 3JTMA 4RKWA 2CMDA 4M5MA 2GJIA 3QF4A 2MQPA 5HILA 1G21A 4GBJA 3COSA 1KQOA 4Y98A 1G66A 3JSAA 3QBJA 1QVZA 2R8EA 4FEAA 2VD3A 1GOTA 4FIDA 5ICMA 4WOCA 5FQNA 4A8MP 2X58A 3OOJA 1WZEA 2EJBA 4M37A 3DAPA 2JI8A 2RH5A 2O4UX 2HN9A 3QKIA 5ITZA 4RETA 2H65B 2RUGA 4P74A 1WXQA 2YNHB 1PG5A 1BJTA 4AD8A 1NN0A 4DLYA 1WXIA 4BO1A 2HWIA 1P6QA 1OX6A 1OH5A 1VLQA 2WYIA 3D2LA 1SXIA 1P7YA 4P82A 2R8KA 1P0IA 4JUCA 4EG3A 5EMKA 3B4MA 1FP4B 4TUYA 3DMJA 1E9RA 5IPFA 2E49A 3LM8A 3NUQA 1MABA 4Z4GA 5AK0A 2I0XA 2TMDA 2OJ3A 2BDTA 3U4GA 3KPJA 2QM7A 5DT9A 4AMZA 2O5EA 3T5HA 4LXUA 3ZHSA 4ZPCA 2DAPA 4HGRA 4QU7A 4Z4EA 1YQHA 1VJ5A 4EHDA 2IYXA 4I9UA 2V7UA 3VVUA 3HTXA 1BRTA 2ZULA 2MQOA 7AT1A 2JGJA 4XVCA 4RTPA 3RUPA 3QVXA 1BXZA 1RWXB 1VGQA 3S8YA 4WOJA 3WLPA 3NHJA 1VHIA 1JFTA 2CVHA 5KFDA 1X0FA 1THMA 5ECYA 3RSFA 5FBHA 4RV9A 1PGZA 1AXRA 1E2UA 2PMWA 1EP9A 3IHWA 4Q66C 5DN6A 3FZNA 1YA4A 2R79A 3UV3A 4F2WA 4BP1A 3X2SA 3KVOA 4EM6A 4JBWA 4LXIA 1NI4A 2LBPA 2QTAA 3KR1A 5GMKa 3R8FA 3V4ZA 4BWMA 4LZNA 2ZBCA 2BWJA 1SL2A 3PB3A 5B2EA 1MH9A 1B0TA 2DB3A 1GPLA 3C87A 4WZ6A 4UXHA 3GJRB 2AOTB 4AKIA 3T19A 3AFHA 2VF3A 3FE2A 3EAGA 1KWMA 3H5NA 2PZMA 4UW2A 2AFHE 2X40A 3PXGA 2D8AA 1DRZA 4EW6A 2CNWA 2P7IA 1VGRA 4LKOA 4ESVA 4NLQA 2IYTA 3DVAB 4QDXA 3QVMA 2OVBA 3AKEA 1R4MB 1RRKA 5ANRB 3NHAA 4P58A 4IGFA 3CJ0A 4RJJA 4CLKA 2XDQA 1DTWA 3JQDA 2ZRAA 3I2GA 2W58A 1SUBA 3TUPA 4IQ4A 2FSUA 2IQ5A 4OHPA 3ILIA 4ON9A 1NVWQ 4QXQA 3QEBZ 1D6SA 3MGJA 4Q21A 4ZAXA 1EEXB 2BIFA 2WJWA 2B8QA 3ZZ1A 1I94F 1PR0A 4LJ9A 2PM8A 4N7TA 4LWZA 2WNIA 4JFRA 2BFEA 5IUKC 3EPIA 2AHRA 3H1FA 1B0AA 1XK8A 2XB4A 4KK3A 1GL3A 3A1TA 4Z9AA 4A27A 2HFZA 3I9MA 4B2IA 3IRVA 1EGAA 4GYWA 3WZMA 3D6AA 4RM2A 5BVGB 3A1DA 3ABRB 3L3BA 4CMGA 2GRUA 4BBYA 1YO6A 1XLWA 2GPBA 4N48A 2GBFA 4MT1A 3O5AA 1Z74A 2VQFB 4UFPA 3MEEA 2J9DE 3V4PB 8ATCA 2BQUA 2XCTB 4XCQA 2ZJ6A 2ASEA 3C5VA 2MYUA 5B7NA 1T5OA 4L8LA 1XMQJ 4IDNA 3H84A 4P22A 4LXHA 2YQ3A 2XADA 4D5GA 4K4WA 3CT4A 1DCKA 4EI8A 5CPFA 2M8HA 1SKMA 4C3LA 4B6PA 1IM8A 4RYLA 2J45A 4D8XA 3TTWA 2ZIGA 1HTTA 1ACJA 1CQJB 2Y76A 1T24A 3HO8A 2LU1A 2BYTA 1T2UA 2XRYA 2LCFA 4JI8F 1Y1KE 1I94J 1FOEB 2NG1A 2GIFA 1PZNA 2BJ8A 3CINA 3ZJYA 4XEUA 4C1NA 2P4SA 4TQRA 4JC5A 1J33A 5JRDS 5DXFA 5G4DA 1O4WA 2GJSA 1FL9A 4R2HA 5IS2A 1VRWA 3IM8A 2JFGA 2BGRA 1C41A 5SZKB 2WW4A 1L8AA 3REQB 3PSHA 1BHO1 3BSOA 2VSFA 3SZUA 1BCSA 2L2QA 4OHRA 2A78A 4YCBA 2CVZA 4RW4A 1QIEA 2H4FA 3AF0A 2GGPA 3EW9A 4BVLA 4ER0A 4ID5B 2JBAB 1EVEA 4QNNA 1VHTA 1F2UB 3DEHA 1KAHA 2B5WA 1JMTA 4X54A 1S9GB 4F1WA 3RGWS 3N2GA 5TMEA 5REQB 5E3QA 3Q8LA 2QMHA 721PA 2HHUA 3I04M 4BB6A 2R1VB 1V5VA 3QVKA 5B3JA 5G4KA 4FBUA 3UV7A 5HQJA 2W4CA 2AXNA 2ZYWX 3NCTA 4XB6B 4FQ8A 3TR5A 4B33A 4RTQA 2WFLB 4YP3A 1KRHA 3B6BA 1PIWA 4D99A 5BXQC 1V2GA 2YKNA 1XRPA 2CY0A 2H2GA 2OUIA 3ITHB 2JCVA 4CF5A 3KJZA 4EKIA 3NBPB 1C9EA 3F4KA 1JLKA 5K8MA 4OQXA 1E79D 3BB3A 4YJFB 3JTPA 3P9NA 1GVNB 4W7HA 5J1EA 2J76E 1G7SA 3GU0A 2GA7A 1OTYA 3UH1A 2AEMA 2JW5A 2BHLA 2H8GA 1MEJA 1JDZA 4A8QA 3M8WA 2WWWA 3LGMA 1S7IA 2VBZA 3ZWPA 2OMEA 3UFXA 1LXJA 4UU1A 4YJ3A 4YR0A 3UBMA 4BFCA 2J9RA 3K31A 4XGQA 1MJGM 1SKYB 5EXSA 4CLXA 2NXCA 3TAXA 1JALA 4AUEA 2PUWA 3F2IA 4X3PA 4ZLLA 5LDDC 3FCYA 4EUNA 3EEYA 3SZ3A 4GX0A 1DOHA 2E18A 1TC1A 4HRYA 2K8GA 4G07A 1S1UA 2XE4A 1IKVB 1PBTA 1F8UA 2EI5A 1P2GA 1XTRA 3RR2A 2CPYA 2GYYA 3CX3A 3CQ9A 5E1DA 4TLAA 1JQKA 3M3DA 6PFKA 3H5LA 1LI5A 3VNVA 4OAQA 2CQ1A 2EDAA 3SV4A 3TBFA 1KMQA 3WWPA 1VKHA 4MKBA 2JEJA 1P2BA 4Z9FA 5FWYA 4CBVA 4XFJA 3RKRA 4P9NA 1RU2A 1KO1A 4R6XA 4I9NA 4L1KA 2CSXA 1J39A 4X62J 4WH0A 1G8HA 3R44A 2PIIA 4EY3A 2AC4A 3ZCQA 3MTDA 3QPWA 1XN1A 2MYFA 4HVCA 4PC2A 1RTDB 3EOZA 5M34A 3MJRA 3GRYA 4POAA 4DS4A 3H1PA 4FX2A 1F9AA 4B3RB 1XF9A 4BDPA 2EBWA 3R6LA 2PGJA 2VJYA 4IDDA 3WWCA 1E8NA 2W7OA 3R7WB 4AJEA 1AD2A 7ADHA 3A32A 5TDHA 2ZAMA 3OF2A 1GMVA 2X6RA 3F90A 2WJZB 4TKVB 1ZGHA 1NR5A 5HP1A 3BXZA 1C8LA 4DLAA 2UVWA 3P2MA 1Z6PA 2GMHA 2C8KA 1Q1GA 4PTLA 1K7XB 4GPBA 4JLJA 5I7HA 4HLBA 1EX8A 2P78A 2GEKA 1NRWA 1HHTP 4U1RA 3V80A 3H3FA 1BE1A 2O5DA 3E9NA 5DSZA 1XZDA 1H05A 1E6EA 2CLLB 4LF5F 5KHOC 1XROA 3VR4H 3OQBA 4I2PA 3SE0A 2BFCB 4DG1B 1P33A 2WJPA 1QOPB 2DNZA 5DG7A 1TJ3A 2QD5A 4PRYA 4KR9A 5CT4A 1Y8RB 4GMXA 3UW3A 5KFFA 1IBLB 3TAHA 4IEFB 1DJQA 2M4MA 1HQEB 1Y3BE 1V3SA 5A76A 4F1KA 4C6TA 1NZDA 3HUEA 2Y2VA 1DJPA 3WI7A 2FJVA 5K3AA 3Q8YA 4R2WA 3PFEA 3ILHA 3KYCA 1MD9A 1PU2A 1TTHB 1ODSA 1LBTA 1KSHA 1XXHE 1VI5A 3ZWMA 2VXCA 4IKEA 3HBMA 2H5IB 3WBBA 2M9MA 4UY8T 4RZSA 2XNSA 3K92A 2PBLA 1FTGA 1M5HA 2CB9A 3L8CA 5FV4A 4FOLA 3BM7A 1RZUA 5K05A 3CDEA 1GAJA 4BAZA 3BPSA 2MEWA 2B2CA 3G3EA 3QT6A 3WFZA 3AHGA 4CIOA 1YRBA 5HBGA 2O1EA 5MDHA 2BE2B 3W2TA 5KFKA 2P3SA 3WDKA 4LF5J 1KJNA 3NC1C 4DVGA 2ECPA 4L08A 2DX7A 1AA1B 1IXZA 2IYEA 5C8YF 1H0SA 4Q9KA 5ALEA 2Y4NA 1CDDA 4B3TJ 4MV6A 3EULA 1G4HA 3AY6A 4L15A 3FDXA 2Q6CA 3A70A 4CNZA 1GNQA 1Q0PA 1LPBB 3PHGA 1Y6JA 3PENA 1F5SA 4XDYA 1J5XA 2F3SA 1ORIA 1FJ7A 4LW8A 3LO5A 4ABYA 3EK2A 4K86A 4NQZA 4N39A 1ZGJA 5DXAA 3A04A 1WDLA 2MHCA 5C32A 2IHYA 1R18A 3A27A 1VRTB 4F45A 3C46A 5HVFA 2ZPAA 1V1RA 3BRWD 3BD6A 3BPSP 4FCCA 5JV5A 5I9MA 4S1OA 1I1NA 3NBYC 4PV7A 3HVRA 3F46A 3FHJA 1PZHA 1ORVA 3IR5A 4XWAA 4G0VA 4BLWA 4EG1A 4D56A 3FUTA 2NVUB 5FBKA 1NUTA 1D9XA 1IC6A 4WCFB 3PUZA 3N7TA 3TYTA 2HFVA 2YH0A 1D2NA 4WT7A 2WSIA 1Q6YA 1BJRE 2EL7A 1DC8A 2HMTA 2V1UA 2HGNA 5H81A 1SV5A 3LANA 3A6GA 5BR8F 1Q84A 2ZYSA 3T7IA 4LYJA 3UT5B 4KFBA 1DPGA 2PAAA 1HEIA 5KEIA 4V0QA 4LGVA 3QKTA 2V7WA 4EZEA 2XHCA 5IF3A 2DSTA 3O4RA 4AECA 1VG8A 2YV5A 4TVKA 3RFXA 4ZVUB 4H1VA 3P0JA 1VC2A 3OD5A 5FLEX 4ENQA 2PZAA 4IJ6A 4C06A 4V1CA 3IUYA 4NFHA 5I3PA 5HCIA 1BKSB 2QA5A 2ODEA 5HX7A 2DISA 2F4NA 3FD8A 1M6VB 1AKQA 3T3FA 1ZS6A 3N6LA 4ODIA 3U7EB 1IY1A 1E6UA 1N5OX 3CBGA 1KI4A 1VJGA 1FJEB 4B3MF 3A36A 2WP8J 4WADA 2OHOA 1K8ZB 4E31A 2ZXFA 2EZ9A 4P2MA 3CLRD 5KOWA 1K8QA 1KPIA 2QKYA 1DV1A 1JLCA 5KOXA 1FJGF 4ARSA 3IOCA 1H0HB 1K5DA 4TXNA 5AW5A 4AX8A 1LV8A 1XALA 4EH1A 4ECXA 1N2CB 4EMTA 4FLMA 4PR3A 4ZCQA 2KL8A 1XXLA 3SD7A 1Z75A 1L1QA 1XEXA 2CBZA 4F04A 2JHAA 1VHLA 3HQ4O 4ED8A 1H6KX 2DG2A 3AM1A 3U1VA 5CGQB 3R5KA 2ZM6F 1Z3IX 3W1WA 5AD1A 4IOJA 1R0KA 4C4TA 4ERDA 5BY2A 2OP5A 4RBNA 1Z8FA 3C7KA 2LCQA 4DXAA 2P6SA 1AC5A 1YMUA 4GE0A 4Q05A 3VX3A 1JG3A 1UFVA 3M30A 2ZR8A 4GOLD 3ONQA 1TPZA 2EQBA 4B3MJ 1F5NA 4KV9A 3LLUA 2BVNA 5E3IA 4K3VA 1QAYA 3LUAA 1UPAA 3EN0A 5L8VA 4OV6B 3BIXA 2O52A 3IQIX 3WQRA 2X76A 2WR8A 5IJ9B 1YDHA 4QGFA 1IQPA 4DPTA 3GYNA 1UXKA 1E0SA 1GKKA 1EB9A 4IEIA 1OBCA 3MM7A 3RVSA