3ENWA

Substrate and inhibitor complexes of ribose 5-phosphate isomerase from vibrio vulnificus yj016
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
TQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEEIKGAVSSSVASTEKLEALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREKIVAAIADKFICIVDGTKAVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITDNGNVILDVYGMKITNPKQLEDQINAIPGVVTVGLFAHRGADVVITGTPEGAKIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of substrate and inhibitor complexes of ribose 5-phosphate isomerase A from Vibrio vulnificus YJ016
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3enwA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3enwA01
1UJ4A 3O1LA 2PA3A 3TUIC 1PBTA 3HN6A 3OBIA 2QRRA 3W7BA 2RQMA 3NZEA 4R7TA 3TUZC 4GMKA 2BKVA 2LQJA 2RI0A 3CSSA 3E15A 2H9ZA 2I9SA 5JJBA 1UJ5A 4TM7A 2QSWA 4L5IA 3ICOA 4L51A 3S1TA 3MWBA 1VL1A 2P9EA 4NMLA 3LOUA 3AB4B 1FS5A 1YBAA 3BXGA 4GO7X 2LVWA 2J0WA 1Y89A 3OFGA 2RQKA 1SC6A 2PC6A 2P9CA 3DDNA 3OFFA 2QMXA 3ENVA 2R5FA 1PSDA 5FIIA 3P96A 4GO5X 2FGCA 4PWUA 4L4YA 3IBWA 3ENQA 1JT9A 2JOQA 3CH7A 3LUYA 1O8BA 1LKZA 4IO1A 3MTJA 1NE7A 2MDAA 3OFHA 4L50A 3TUJC 1XTZA 3OC6A 4L5JA 1HOTA 1ZPVA 2P9GA 2DTJA 1FS6A 3TX2A 2BKXA 3BXEA 3BXFA 1M0SA 4X84A 1KS2A 1Y7PA 2CDQA 2J0EA 3DC2A 2WU1A 1FRZA 1RWUA 4OQPA 1HORA 3K5PA 3AB2B 3ENWA 3MAHA 2J0XA 3N0VA 3KV1A 3IXQA 4M8LA 3L7OA 3U7JA 1YGYA 1FSFA 2W48A 5IT4A 3DHWC 2GNPA 3NWPA 3DHXA 2NYIA 4L4ZA 5HJ5A 2KO1A 2QMWA 3UW1A 3EB9A 3KWMA 4GO1A 1UJ6A 3OFEA 3EFBA 1LK5A 3AAWB 2OKGA 2DT9A 5IS2A 2RE1A 3LWDA 2RI1A 4LUBA 5IT0A 4OQQA 1LK7A 4TM8A 1DEAA 4R9NA 3HHEA 1U8SA 3NRBA 2O0MA 5T41A 2F8MA 1CD5A 3CEDA 3BXHA 2F1FA 3E7FA 3LHIA 2JHEA 2ZHOA 1FQOA
chains in the Genus database with same CATH superfamily
5C52B 1OB2A 4JI7J 5BNTA 1F6BA 3AX6A 4NLWA 4XPIA 4CMGA 1Y9EA 1E6WA 3D3CJ 5HJYA 3DYAA 4HKQA 1O1YA 4W8HA 3U5ZB 2ZKIA 4KV7A 5IT9U 4JI8B 1ODTC 4WU3A 3LI2A 4FKMA 3ZWXA 1W0JD 5KFCA 3IWNC 3EBLA 1SJQA 4QQKA 1HQ2A 2PS3A 5CK4A 1OGYA 1A88A 3MB8A 4QQRA 3ILIA 4YT2A 2V58A 3JQRA 1M1YA 3DMHA 1Y42X 5JMNA 4P36A 2F64A 3QUTA 1MZVA 5D5PA 3KQNA 4OXNA 5EPOA 4FLMA 1VL8A 4WSOA 2C9YA 5ALHA 2NIPA 1DB3A 1T0IA 3GWGA 3AR4A 4XPCA 2HO4A 3FUCA 3VAMA 1SY7A 5HJEA 1C7IA 1NW6A 4MUBA 2BZ1A 2OOSA 2F1KA 4OMCA 4DNQA 2QFIA 4RUKA 5ARBA 1YMVA 4XGNA 2MJUA 2D4HA 2G13A 3W63A 1W44A 4FI3F 4INJA 5EDWA 2QS9A 1WC4A 1SH0A 3IGNA 4KN9S 5A05A 1C2YA 3QX8A 4FK8A 2CQGA 4FHCA 1Y00A 4GKKB 1B8VA 4HLDA 2LEPA 1RAEA 4EG4A 1WOOA 5F7ZA 1T2VA 1B41A 5ADHA 4B7CA 4MK4A 5AKYA 4C87A 1K98A 2PWYA 4ZQCB 4C3KA 3JSAA 3VAJA 4I19A 1VL1A 4QPTA 3AIOA 1CEXA 1K0VA 3JQ9C 2VSXA 1WF2A 5EHNA 2O5CA 1NRIA 2NYRA 3V1YA 4GO5X 1O6CA 3WIBA 2AGOA 2H18A 8GPBA 3PJWA 3RJMA 2A8YA 3GCDA 1J00A 5FPQA 1H8HA 1OYWA 2ZOSA 3BL5A 4B9LA 1H22A 3RV4A 3ZBUA 5JD5A 4RTSA 1W4CA 3UNYA 2QN1A 2EARA 2IFXA 4WD3A 1FPQA 3GB0A 3QLVC 4N3CA 3AAWB 4G6VB 4YMUA 2D1QA 3H4BA 4AP6A 4V38A 5JNLA 5KJEA 2FUCA 1PUXA 1S96A 1SUFA 1NC3A 4WOBA 1GPUA 5GADU 4CF3A 5J1NA 3PDWA 4G81A 4UQLA 1KZ7B 3H1PA 4H0NA 2YQ3A 1P9QC 1BEUB 4LS3A 1C3VA 4ZVTA 1RYEA 2GGPB 4TVAB 3U4CA 4KOAA 1U7XA 3FTNA 4I0WB 1OFHA 4GZ3A 1XYYA 4IYRA 3D3WA 1M2OA 4UE6A 4UHHA 4ZITA 1KRWA 4M0UA 4AO7A 2OEPA 3K6SB 4P7KA 2VJKA 1E1RD 2VPZB 3O8NA 3ZWCA 1AKQA 5JFGA 1X9MA 2HVEA 2VC1A 2RQKA 3EA5A 2YXEA 3EYAA 2P35A 1N7IA 4HMPA 1UWLA 1E7SA 4M8KA 1CEEA 3ZH2A 4C4OA 4D25A 1C3XA 4QYWA 3VV3A 1UJMA 1KO8A 4E21A 1PFGA 4L6CA 2HFSA 2WWVD 3M32A 4M1OA 1F5BA 1A4IA 3HP6A 1VPTA 5GV8A 3O6QA 3K0CC 4EAQA 4ODIA 2ZJ7A 2JL1A 1U3CA 1HQKA 1RHJA 2R65A 1IOLA 5AXMA 3K7EA 3HP4A 2M0GB 3NRCA 2HAIA 4HVZA 5LMNJ 2QNIA 4TSFA 2OV3A 2BFCA 3OCUA 4XUCA 4M0EA 2CVHA 3T9ZA 1I1QB 1PO6A 3ZH9B 5C80A 2P77A 1O5IA 3O4RA 1KJYA 3FCSB 3C3WA 4BNVA 5C9ZA 1RW4A 3NS6A 3L0PA 1Q0PA 2FB0A 3VHXA 4OI4A 2Q62A 5FNVA 4QUDA 1HNXJ 2XA9A 3RH0A 4OZJA 5IQ6A 3QVJA 2BHNA 3G49A 3I37X 4KAFA 1X0FA 5K5MA 1OA1A 3CIZA 1FXRA 1YSCA 1WUTA 4DR1B 1NR1A 2XSJA 3CLRD 5L45A 5AW8A 1NQWA 3LXUX 2B4AA 1OQAA 1BDHA 2DQ4A 3NTVA 4F97A 2VPTA 4B09A 2Z57B 1E94E 2HGZA 2XB6A 1OZAA 1YI8A 4ZVPA 2QL7B 2R47A 2C22A 1UC5B 4LRTB 4F12A 4NEGA 1WF0A 4IGIA 4V1CI 3GCZA 1IN7A 4YIKA 1VPLA 4AG6A 4ZDIA 3N79A 4TXNA 1Y3FE 4ZHSA 3GA5A 3PA6A 3DXZA 5DRTA 2PRYA 5DX1A 4UCQA 1RSCA 1NK7A 1LGYA 2CNNA 1XD2B 4ED9A 2HK2A 2NSBA 4YNBA 1SM4A 2GZSA 3NAMA 4R1NA 3KG2A 4JK3A 4B81A 1H1TA 2C7QA 5ETJA 2OV8A 4L4RA 3M70A 2GUWA 2XMSA 1K68A 5L3SA 3DFZA 3L49A 4JJGA 5FI0B 2WTXA 2ACKA 1YXMA 4RORA 1DINA 4QARA 1XT6A 3DE6X 1NN5A 5EPUA 4HB3A 4CYMA 4F6LA 1Q22A 4IG0A 4UMFA 4X44A 4PEOA 4WPAA 1Q1EA 4OPMA 1KI6B 1D2MA 1NMEB 4IOBA 3D31A 4LVOP 5EJGA 2DBZA 2YRXA 4AG3A 3QVMA 4PO1A 3RK4A 1KRHA 1HQCA 2PA8D 2VHCA 4E13A 2P9GA 5GINE 1YJBA 3SXLA 4HX5A 3T1YB 4GKJJ 4ZKEA 3GRAA 3KJQA 2G9RA 4A46A 2P7IA 1MEEA 3MAHA 5IT5A 2BEKA 2L08A 1B6GA 3FMGA 2FR1A 2AW0A 5H83A 2AL7A 4DC0A 2GZAA 4II2A 1AQJA 1R27B 1EQ2A 1VLMA 3PEVA 4M22A 1B0TA 1RAEB 1CVIA 3LW5C 3I23A 2HN9A 4B6OA 4W5JA 4DM3A 1JRLA 2IZ7A 5A4MS 3UWKA 4YECA 4MYDA 4H1WA 4RETA 1KF0A 5KHLB 2YHIA 4IHJF 3M2VA 3G82A 3JSRA 3OCZA 1RTDB 5IWAB 4WMLA 2QV7A 3AYZB 3BICA 3HNPA 3RODA 3BQNB 4E12A 5JROA 4RIHA 2BKUA 1VTKA 2NUPA 1K8YB 1F6TA 1DO2A 1XKQA 3R8FA 2B94A 2AA3A 2HQCA 2G83A 3NBZC 4D8UA 3C39A 1P8GA 1JU3A 3JAWB 1PUIA 5G4KB 3LP6A 2E1PA 4HAIA 4J9VA 3QJ5A 1XCLA 4ED2A 3ENWA 4NMXA 1TZ0A 4NNPA 4IJ5A 1KMHB 5BWLA 1MW9X 1AUDA 4OH1A 3EFBA 2Y3IA 4BMNA 3J7YI 1T43A 4OX9B 3DF7A 2QR2A 4LSZA 2LFVA 3LT2A 1Z2CA 1RI1A 2PXXA 3KIPA 2O8BB 1K1SA 1GQQA 1FKOA 1PILA 3L0OA 2YNMA 4MQFA 4QYMA 5ALWA 4C1NA 1DY3A 1WXXA 1KGSA 5K0CA 1ZNQO 3TSWA 3M4ZA 1Z6GA 4LF8F 4AD6A 1WBBA 5SV2A 3GD7A 3N75A 5JVDB 4KQ1A 4K3UA 2B56A 2JIDA 1RIIA 1Z3IX 5JSKA 2LKDA 1VE3A 2PC6A 1GKIA 4IQXA 2ZM5A 1T7PA 3BJRA 5A4DA 1WTAA 1J2TA 3GEPA 1JG6A 2ALZA 2YVSA 4RH1A 3E3OA 4ARCA 4P2BA 4UW2A 4NENA 1CUCA 2D1CA 2HQDA 3T7DA 5CCEA 1M6YA 1PJ5A 4JZKA 5U9CA 1ZGJA 1RQLA 5AW7A 2QTMA 3LECA 3UZUA 4FE3A 2X58A 1P6QA 5EJ7A 2AQ8A 3KKLA 3KQOA 2I38A 2W22A 2MHEA 5THKA 4J0HA 4RMJA 2Z1NA 3G6VA 2QRPA 2AQIA 1QU3A 5IG2A 4F4AA 1Y3DE 2ZUTA 4A8YA 3IR7B 3AF0A 5HK8A 3GG9A 4A03A 4BMCA 1ZNWA 3H2HA 4JI4B 2BFEB 5FNVB 1K44A 2H4ZA 2DUJA 4YQZA 2DGSA 2FZCB 1WD7A 2HK8A 2HPVA 5KKAA 3GELA 2ATCB 3W1WA 4QU9A 5AHXA 3F7TA 1Y3JA 5DYYA 3LHKA 1T9VA 2O8VA 1ITZA 3C98A 4F9EA 1NW7A 5FF9A 5JCZA 3LPEA 1GZ7A 5B6PA 1JA1A 5HG0A 2NTJA 5BR8B 2YHAA 1YRXA 2JK1A 2BY4A 3ANMA 3OUTA 2XNDA 4UNNA 2A86A 3FF4A 3ZLJA 2FZGB 2VHJA 3QKSA 4YJ2F 1ZA2B 3AFMA 2NX2A 2QX6A 3D5MA 4L3VA 1NRKA 5DNVA 1K88A 2PLRA 1JI0A 2NW6A 1GY8A 3ICLA 1R5JA 3FSRA 3RT1A 1Y9DA 1X39A 1Z2DA 1U8EA 2WSMA 1UJ6A 1Y5NA 2FQXA 3ZQ4A 5HP1B 3FVTA 3UMMA 4DFPA 1MH1A 2VZEA 1CE8A 3TLCA 1GSAA 4WJKB 2ID9A 2NZUG 3ZGNA 4KN5A 4GC7A 3PI7A 3CJ2A 4P52A 4L5CA 4C0AC 3ROGA 4FCTA 2VASA 1Z73A 3C87A 1SCKA 2L19A 2X3FA 1QD1A 3EXHC 5HILA 3KZNA 5EJ6A 3PDNA 4XDZA 1EG2A 1JTFA 1GXUA 4ES6A 3ULHA 3TX8A 1HZZC 2CXOA 2H5JA 5EINA 1ZHHA 1Z36A 2FZGA 1X2BA 3KZMA 2KS6A 1KLMB 3IAS1 4Q02A 3B3AA 3ZWMA 2MDAA 1HA3A 4Y0FA 3NV9A 2WFAA 3T7KA 1YL7A 1DRUA 2OFXA 3OOEA 1TYEB 3GBVA 4DN6A 4OFXA 2IZOA 3TAQA 2E4YA 3WBBA 1R5NA 1KFEB 1WCV1 2IYOA 1TLTA 4JV2A 3PGJA 4FFSA 5ALYA 1ZR2A 1N5QA 3RBXA 3LZDA 4ZPCA 3B7PA 3FNGA 3IV7A 3TIIA 4LBYA 3S1AB 1E6YB 2B7BA 2OKGA 4XDGA 4LF4F 5KFGA 3ESDA 2IYGA 4KVGA 4Y0VA 3ROTA 1NG1A 4DKJA 1JIXA 2KN4A 2UZIR 1R6TA 4YRCA 2B4RO 4FS8A 4B3XA 4ER3A 4YRGA 5AXNA 3GFTA 5AVZA 5KOHB 5AK3A 2V67A 1TJ4A 5LZ7A 4AS3A 5MGNA 5C42A 2O4UX 3VRHA 1N6QA 2BX6A 2QX8A 4FNMA 3BKWA 3PF8A 1BWRA 2IXEA 1F9EB 3U4AA 4ESOA 1TKZB 3VHXB 4Q8EA 5HGXA 1H74A 4KQ6A 3C6BA 3HV0A 2DPHA 2OAUA 3Q15C 4NYMQ 5CDTA 3H5NA 4PFKA 4V39A 2VPXB 2ZQ5A 5E2IA 3NVDA 4BKMA 4RXUA 4OP3A 4GL2A 2ZDGA 1U45A 4QQBA 3L7PA 1Z15A 4FXWA 2JLFA 3FHTA 4NA1A 1A9OA 5U47A 5HIAA 3LH5A 3CRQA 5BMVB 1A76A 5L4SA 1H6CA 2ZW9A 4FF1A 4JXXA 2VOEA 4H4EA 1QVWA 4DV6J 1PYDA 1L7EA 1DMSA 3GLIE 1JWWA 1IBRA 4M8NE 1FSZA 4UZEA 1IOVA 3L1JA 4R3WA 4EWLA 2VKQA 2QMYA 3TDNA 4IDNA 2X3YA 5K8MA 4H15A 4PLVA 4TTSA 4Y2KA 2X4DA 2GZRA 5EIXA 1IJFB 5AE2A 4C7BA 1BQ4A 2PX5A 1RR6A 2VHXA 3INRA 3MT7A 4X66J 4LJSA 3KTAA 3JALA 1NAQA 1UBNA 3BBLA 2R5FA 2WUFA 1JLQA 4D0GA 4YUZA 4D9BA 1S9GA 3WLMA 3D6VA 5TF4A 4GX0A 2PMHA 5J9FA 4L50A 3TJAA 2VJYA 1Z6XA 1RPTA 1JKJB 3A4IA 3RREA 1NLZA 4USJC 2ZM6F 2Z04A 3HPRA 3E22A 2Z3VA 3P2JA 2NU8B 4FKYA 2I62A 1ZRMA 4M49A 4G5SA 1A72A 3IT1A 3CUUA 1PQYA 2QAGB 4UHDA 1XTUA 2VA2A 3ZY2A 2PKWA 2M7SA 1RCXB 3SS8A 1IVNA 3ZE7A 3QF4A 2FSGA 1Q1KA 4HUQB 3O1HB 2OO7A 3NTLA 3BR8A 2BKVA 4M1EA 2IV7A 2MINB 2QTNA 4QUBA 4IDHA 2R11A 4I6YA 2W7OA 2ABYA 3DJYA 3CD7A 4PO9A 1O9BA 3OPYB 4KY3A 1GAQA 5KQPA 1RYHA 5AJYA 1W1IA 1GPMA 1F0YA 3UEOA 2ZBIA 4NV0A 3LF2A 3BS9A 4M9SA 2R8KA 4FYXB 1V2HE 1G5FA 3B5EA 1GQRA 1LPPA 1CERA 1UBRS 4N0PA 3BGRA 5U1PA 4DLYA 2HMAA 3OURA 1JQEA 2E1MC 1UBKS 5FLKA 2YFQA 1J2EA 3DKIA 1T0JB 3X3UA 5TRTA 1FW8A 4FJ1A 5TC4A 2HFVA 3FFTA 1N0IA 1EUCB 3HR8A 2AWZA 4G0NA 4BV9A 1P0MA 3W61A 3KAJA 3HPQA 2CJKA 3VX3A 5GGYA 3GVIA 3MOJB 1JHMA 3G82B 5L53A 1P1IA 3DAYA 3OIWA 3V1NA 3DQQA 2QLXA 3NY0A 3VR6D 1K7XB 3PFGA 3KJVB 4WEOA 1K0TA 4BLVA 1HLGA 5DK4A 4G0UA 1U7TA 5AJXA 4WPGA 2E9SA 2WLTA 4TS9A 1SHTX 2X6QA 3GEGA 2DPLA 3PJFA 3H1FA 5B7GA 3M32B 1E0KA 4PXAA 3SZMA 4NBLA 1XNRF 1U9CA 4W8GA 3EEIA 1SXLA 5HF9A 1QE1B 1Q77A 2V3VA 4YJHB 5EXPA 3H65A 3WO1A 4BGIA 1LX7A 3GUUA 5DI3A 1SHJA 1FQKA 1WD6A 2RH3A 2M6KA 3SC2A 3PRYA 2DBVO 5ITHA 1ND6A 3LWMA 4AJJA 3R2JA 3NXZA 1KEZA 1MU2B 1GV0A 2A6MA 1CSJA 4D3FA 1YGYA 1C4WA 4RTJA 1WS6A 1SJ9A 5I3UB 1DCKA 3TOVA 1Z08A 1G5RA 4J49A 1VPDA 2WZCA 3FTDA 3AI1A 3M6VA 1DQPA 2IHKA 4C9DA 3MAJA 2DLCX 2XHWA 1Y5IA 5IJ9A 2Z98A 3HG7A 1IBLF 2NG1A 4QDZA 5H70A 4UW9A 1MU0A 4Q9HA 3BSFA 2VQ3A 1ZM9A 4KFRA 2OMKA 2FN8A 5JUWA 4NH0A 1PGJA 1GD1O 5LP6C 2CLEB 5EGSA 3I9V9 5T57A 2RILA 2OXCA 4DX8H 1QCZA 1T8YA 1TA9A 4QNNA 4DREA 5HVNA 3POTB 3O9MA 1V39A 3NT5A 4CQMA 2AZTA 1BNCA 2ZDOA 2ZOFA 2OR3A 4CKEB 4ZZ3A 2FCRA 9ATCA 3L0ZA 1EKSA 1QQ7A 1K9VF 2ODNA 4X8HA 1BHNA 1JLRA 3SFGA 1PJ3A 1XL0A 3EYWA 3EDRA 4Q6WA 3C3AA 3TEJA 2ZBPA 2FUG6 1V8ZA 3I55S 2X1MA 4ZOLF 4EG3A 3BB1A 4HUQA 1AHHA 4N3BA 5J1SB 2PPVA 4UMEA 2YFKA 3H4TA 4TL8A 1JIUA 3HVJA 1X60A 1YG0A 5ETVA 2QTBA 2HLDA 2GNPA 2ET6A 2CDNA 3EZ7A 4KQJA 2QXTA 3ECAA 2FFBA 4KAIA 4X2BA 4MW9A 3D7MA 2VWGA 1EETA 1SL2A 2H65B 4BJ3A 3A3OB 3PHLA 4NIMA 3SS7X 1GO2A 3IQFA 3OXGA 2IY8A 3PFOA 4DC1A 3UCEA 2DNQA 2ZI4A 2HIGA 4QIWD 1NSQA 3DLLQ 3SOZA 3UMVA 1QFYA 4L51A 1NP3A 3E5NA 1KQOA 4F3KA 4WXEA 2NU6B 3LVRE 4PICA 1J0XO 2KJVA 1XMIA 4L3NA 5AXDA 3DBHA 3TLXA 1P72A 1FYWA 2O4CA 2V2VA 3SM9A 1EMDA 5E3QA 3WK6A 1N3LA 2IYEA 1RNLA 2XY7A 1Q0SA 1R0SA 3RVDA 1M2KA 1XQYA 2XO6A 4LDZA 3G13A 4MVJA 5EQTA 4HNQA 2GQCA 4KKVA 2UXCJ 1CQZA 2X42A 1D7OA 1K8AT 4I4TF 3I87A 1E1LA 3IX7A 1H5QA 4G97A 5BSMA 3O0TA 4YRTA 5J2QA 3Q0IA 4HQOA 4LUCA 1QYWA 4PLPA 4F56A 3T7AA 3ZI0A 4ZYLA 2UXCB 1CR6A 5A2QY 2FMFA 1ZX1A 1LPSA 1WKLA 3LBNA 4CM7A 2H2FA 1J4AA 2DH7A 3M2UA 3IIKA 3TD9A 1F8GA 2HPAA 1TP7A 4CN9A 4RDCA 4A27A 5GMKa 3I9V1 2BYCA 4Q9IA 2HD4A 3NOGA 1PJ4A 5KQLA 3QE2A 4PC1A 4GPBA 5CYPA 4B4OA 1YHYA 1GTHA 4GMDA 3GLIB 4FF3A 3W5UA 2IMWP 4QJIA 1JQKA 1IZ9A 1IKWB 4DILA 3X1WA 4OMDA 3O74A 2MHCA 4P5PA 5DW3A 3CJSA 4W1SA 4BZQA 2VATA 3G8BA 4XVUA 2FFQA 3ZJTA 5DX8A 4WGFA 1BXZA 1I2CA 4P2FA 1NN3A 3O4GA 6REQB 3CPJB 1TUGB 1K3FA 2W48A 3Q8YA 4IFTA 5BR4A 1IJEB 2YOHA 1CRPA 3O31A 5FORA 2KM8B 1VSTA 5DYGA 1LK5A 4XD2A 3NOQA 1JEQA 3KPJA 4D0SA 5IVPA 3GAAA 3VKHA 3W5AA 4LRCA 2PS0A 4EHBA 3FSIA 2P40A 2IH4A 4RIGA 4JGBA 1O2DA 3MTEA 4UAUA 3ZE6A 4X1KB 2BJEA 3H98A 1ADCA 1XD2A 1UFWA 4JP5A 1U04A 1V5FA 3G8YA 3GFQA 4ZYWA 2W2LA 1DIBA 3KLNA 4ALIA 1G2QA 2UVWA 4MJKA 1SMKA 4P31A 4P54A 4U9UA 2A1UB 1KAEA 3PPWA 1NVAA 1U47A 4XDDA 1SKBA 4BO6A 4JB3A 1Y63A 3LUBA 1H23A 1GTEA 4X61A 5HL7Q 3SHFA 3FOZA 1NNLA 1ZINA 2GBIA 4TSRA 1JR3E 1BXNA 2ORED 3BGOP 2MYNA 4DR1F 4PZCA 2IXDA 3CEHA 3SWWA 2PMDA 1WA5A 2PGXA 2HRQA 5RUBA 4LZJA 4ETZA 2M4MA 3ZJUA 2Q3LA 4HYKA 2X2EA 2GBLC 2DMRA 5AM1A 5GONF 4BMYA 4G36A 4BZZA 1REVB 4U2EA 2QRGA 2X15A 4AVYA 4AL7A 5F4BA 3R97A 3OR2A 2AVNA 4EAAA 3GFPA 3H0CA 4OQZA 2PWPA 3B3GA 3HXQA 3KK1A 3CC8A 2VC0A 3DHYA 1HWYA 3T1YJ 3MTIA 4JC0A 1KDYA 3ULKA 9RUBA 4U63A 4ZRNA 1QS0A 2GRAA 4E2FB 2VJCA 2DK2A 3AM3A 1C30B 2RMKA 4R25A 3LRPA 3A7DA 1C8BA 3AP1A 1ZH0A 3IQXA 3VPDA 2EZ8A 3FZNA 1EFRA 1MVOA 1M1HA 5KINB 3TTYA 5HZGA 4D2IA 3P71T 3CIMA 5C81A 2GBFA 3DMTC 4MFBA 3KLHA 5TR9A 4ZPBA 1CUIA 2ECFA 3TNVA 2VYVA 3BHIA 3HFRA 1L5FA 1A9SA 4DUZF 3RJTA 1POXA 4NJEA 1N5KA 1MH9A 2RKIA 5FLYA 3WX4A 3NWGA 1IR1A 1NW5A 2NYAA 4CNBA 621PA 3KHGA 1XEXA 2J33A 2LDXA 4LIRA 3KC2A 1WOYA 9ABPA 1TECE 4BB5A 2IIQA 3QQ5A 2A2CA 2ZE5A 2OHIA 1YK0A 1PL8A 1XN1A 1KMQA 1RJWA 1R9MA 4CKCB 4CLPA 4OHCA 5CD1A 3E2MA 4UZCA 3GU0A 4DLBA 3H2IA 1FNDA 4TROA 5KG5A 2PBZA 1NQ5A 4EO9A 2P3QA 4B9AA 4C3OB 2I8LA 5LSAA 1DWQA 1RADA 1RT7B 4UPDA 5A71A 2P5SA 4W6QA 5K4GA 1AD2A 1IWOA 4BBJA 3PWSA 3PRHA 4G0MA 3AR5A 3BDEA 3PUWA 3F49S 4AJ2A 2FVCA 5JV5A 4A1FA 1XKTA 1Q2UA 5FOTA 3AR8A 1Q82T 2FW1A 4OYMA 3USCS 1R0XA 1N8NA 3KQQA 5DBOA 2FHKA 3FZEA 2W4DA 4R7ZA 3TRGA 2TECE 5LQAA 1A7KA 5EJEA 3D6FA 5I7OA 1CUXA 3SNHA 2C9MA 4HQLA 4JI6J 2FUG9 5AXBA 3WYEA 4N8DA 1BMQA 3M81A 2EWHA 4EBEA 3I9FA 1NKVA 2J0QA 4YCAA 5BUQA 2Y68A 4P8RA 4NEYA 1SR8A 2V98A 3Q5EA 4H17A 3IWXA 1JMYA 5MLCV 1KNXA 3SQOA 3SXJA 3FEYB 3BCSA 2A5DA 5FWXA 3CB4A 2GKOA 2NR0A 1Z17A 3CSUA 2Z5LA 1JAHA 1QG6A 1T9ZA 4DGQA 3TRDA 5G4DA 2I2WA 2DWUA 3AEKB 4H7HA 3HT0A 5J2TF 3UJBA 5DHFA 4MWCA 2O2XA 2RUSA 1CRZA 3AT1A 3C24A 3RSFA 2LDIA 5LXYA 4YPOA 5IAGA 2FN3A 3LSYA 1RP7A 1HL7A 3VALA 4HFJA 3BSYA 3OIUA 3BYZA 1RHKB 1HNVB 3F4LA 2WJ6A 3FWYA 2MOKA 4URXR 2UYGA 4DUYJ 2A67A 3H4DA 4YV7A 2V0CA 3UW1A 4X7MA 1DNPA 5J2TB 2LDYA 1T94A 3R6LB 1HMVA 2IIBA 5A0YA 2HBQA 2ZWPA 3A1WA 2ONZA 3PCXA 1KBOA 2Z9CA 4II3A 1S9EB 1YDMA 2KFZA 5IC4A 4PHGA 1VHJA 2IA6A 4AN0A 2R00A 4LX0A 3FB1A 1N3YA 1L5NA 3ONWA 1XWFA 1IB0A 2HPUA 2EJTA 2HT6A 2PGLA 1BDMA 1T25A 1FDNA 4J7UA 1K63A 3LP0A 2QMEA 5ITSA 3DM9B 3HZZA 2IVYA 3PGVA 4TXLA 5DEOA 4OHRA 5HMMA 4GRAA 2DNMA 4X84A 4YXWA 4WLUA 3FKJA 3UBTA 2O06A 3OW2R 5DI3B 3K09A 5BR8F 2COKA 3A8KA 3HWRA 2XTAA 4JUDX 3QU5A 4FZ5A 1EVYA 2FOLA 4QEZA 3ILLA 3RHTA 4DDFA 1SUSA 2Q49A 2ZRBA 1Q0TA 2FVXA 5BVGA 3GOHA 4YN3A 1PD1A 4MGIR 1X86B 3TNDA 5F41A 1P5ZB 2WABA 2AXEA 1YULA 2BFBB 2FE4A 2NUBA 2CVFA 2OO5C 2X9GA 1RZ3A 2UUBB 1N4AA 1UINA 1AOXA 1OAOC 4B8YA 4BTVA 1PL6A 1H0RA 3V7NA 5B1YA 4IIXA 3OETA 2W9BB 3IXMA 2CG4A 1EVIA 5HW0A 3F2VA 3RIHA 3CKYA 1IBKJ 1Q7CA 4M88A 2KHCA 3BERA 2Q50A 2P3OA 3U09A 1I13A 1E6MA 3ZDFA 3WV5A 3BBBA 1E7RA 5TS2A 4C04A 2RH4A 2I4MA 3KLEA 3SR4A 1CRQA 2CFRA 3LYLA 2QRNA 3OLQA 1AGYA 1PR1A 1UDXA 3CPWR 5JC1A 2CEAA 2VAPA 1SPBP 2Y8EA 2J3LA 2BLNA 4RE6A 3VWSA 3L1VA 5KTQA 5JHHB 2DGTA 1YZUA 5BSKA 1V6AA 1QB7A 1X4CA 2CVQA 4JFRA 3MOGA 1EUYA 1CLEA 1LK7A 1MX9A 4CT0A 4RDXA 3MMAA 2NNLD 1TPYA 4DFDA 3IS9B 1S6UA 1Y9OA 3FDXA 3AIMA 1NHWA 1TAUA 3S1AA 2PR7A 4WF9Q 3THRA 5JS8A 4ZCPA 1WL8A 4MCJA 4HLNA 3FLBA 2I9SA 2P1ZA 5CYMA 1CQIA 1EDZA 4LXQA 4F5YA 2P5TB 4WXMA 1L3VA 3D7NA 2VSNA 3C97A 3WLQA 4CLEA 2YKPA 2N9UA 4DLGA 2R6FA 3TA2A 3SQDA 2XUJA 2O5RA 3ESAA 3AI7A 4BNFA 3L4KA 1T8PA 5BN3B 4JY7A 1SCJB 3PHJA 4HDRB 1GYPA 4NEQA 1GTJ1 2X1AA 2HNDA 4INAA 1ZSNA 3NGKA 3AT1B 1OGIA 2H1OA 2C28A 2XDQB 1Y4ZB 4ZOEA 1KAGA 2X5NA 1HBJA 4RJTA 5H81A 2QYOA 2J7PA 3TQSA 1RAOA 1Y81A 4NBWA 1UP4A 3A14A 2P0YA 3PCRB 2YKOA 3PLRA 3BXPA 1QRUA 2VQEJ 3H2SA 1SHKA 3M1YA 2JAQA 1L7DA 1X7VA 2ST1A 3DTYA 4A23A 4TLRA 1NBME 2P30A 1E3JA 1LV5A 1Z0AA 2ZQYA 3DOLA 4HR7A 1PIWA 1HNZB 3G8AA 1I6JA 3U16A 1FJGJ 1LFAA 2G1PA 5DG7A 2QD1A 2I67A 5IV4A 5HBMA 3RS9A 1Q0HA 1JHYA 4PPDA 4CE6A 1YZLA 1FEEA 2EHJA 4D3HA 3RU2A 2O66A 1T9BA 2MHNA 1X7DA 4XAKA 4LOHA 3VAHA 1D6MA 2NQ2C 1YA4A 2IGTA 3DLTA 3O1IC 1R0CB 2AFRA 3HMJG 4HLQB 2DNPA 1ZHOA 3PVCA 4J75A 5EWJB 4C0JA 3QSIA 1KVJA 2Y1IA 2PRIA 1OFGA 3WYBA 3OPYI 2HSEA 4KNVA 3B4DA 5CFRA 3GNTA 3QP9A 3ABRB 2GIQA 4KI0A 2OO4A 2C8VA 1XX6A 4I6AA 4KK4A 5L1IA 2DX7A 3DQPA 3MJRA 3EDCA 2EI5A 2UUBF 3N8IA 3NHWA 3OSNA 4LC1A 5IJ0A 5TMBA 2NM0A 3FOCA 1RFLA 1P81A 4HN9A 2YNIA 3KK3A 1SB8A 3LPLA 5B1DA 5EWJA 4B85A 3D7RA 4TRJA 2G70A 1ULSA 2WYWA 1KLNA 5EJMA 2RBEA 2FFHA 5JZVA 2DNOA 1XQ6A 4QT0A 4BRZA 2PX0A 4LXHA 1H6AA 1PBTA 4WHMA 3CJ3A 4KTTE 1CHDA 4DIMA 3HKBA 2VBCA 1UA0A 1T9YA 3KYDB 3HUUA 1GMVA 3R7SB 2PGOA 4REQB 1KY4A 1E4EB 4Q4CA 1OH5A 1WW2A 3KX2A 2L0XA 5GMDA 3SS9X 2FKAA 2XZPA 4I14A 4Z1MD 4G4JA 2E6KA 5JZMA 1HDZA 4YMIA 2PSJA 2GXUA 1TC1A 1AB6A 1R9NA 4M4SA 2BMBA 2MLXA 5EKTA 1FFGA 3TTXA 4B4DA 3FJYA 3BEDA 1NFFA 1CWUA 4TT3A 2NTNA 3IJRA 4LZZA 3TRHA 5BXQC 2GGSA 1PG5A 3H2BA 4M8SA 3WGYA 1UDAA 1GG5A 4RBNA 2HJRA 3QG5A 4D9CA 2ODEA 1FVHA 2RRAA 4ZV7A 1Q14A 4QLAA 1RT7A 4J0DA 5E41A 1XMQB 5F64A 4I1RA 1IR2A 1KZ9A 3LQ1A 1GITA 1G4AE 5B2ZA 1LDGA 1U2DC 4CMBA 1E66A 1BS2A 1FU7A 5ADWA 5KT4A 4LF5B 1GKKA 3KB1A 4RW4A 2XG8A 4L8YA 1OBCA 1U7ZA 1V48A 5DM4A 2FETA 3CG4A 2D3O1 4QJ5A 2FHJA 3L7AA 2VNHA 4TS1A 2VUUA 1TVEA 4WNIA 3FYSA 3GAMA 1U7OA 2YKNB 1SHZA 3STVA 4JUCA 1MT0A 4M9QA 4NK4A 3TBFA 4C3ZA 2VTBB 1EGVB 5KQGA 2DHAA 4JC5A 2CJBA 4MQ6A 1J5EF 821PA 2AF4C 4ZCMA 3RUAA 2Q4DA 1HYSB 4UVGA 1M5OC 4F3NA 2XZDB 5COBA 3CPHA 4HGOA 4M0PA 4H7IA 1Z4JA 2Y9MB 3WGQA 3VHLB 3EA0A 2WG1A 1IBLJ 2IW3A 3UAYA 4RTKA 3UDLA 3GJ7A 1TX4B 3M8RA 1VMDA 2LR0A 1RAFA 4KSBA 1K6EA 4Z7QB 5KNBH 3EOZA 3ORQA 1NJZA 4MQ5A 1ORDA 1SQGA 5ARDA 1EX1A 3I53A 4OEHA 4QWWA 1BC5A 1C7FA 3WR5A 2XMCA 4W4MA 3PHTA 1NG9A 1Z83A 3NALA 1UBCA 3THXB 4HLCA 4LDRA 2ZC4A 3EJ6A 4IFIA 4DLVA 4UTGA 4IV8A 4OI1A 5FOSA 4CLDA 1NHKL 1IN1A 2BFDA 2GEUA 1NSPA 1Y80A 2B78A 3KQUA 4AD8A 3P1JA 1MEJA 2C2NA 2MQMA 4YCLA 4C0LA 1ZFNA 1N8KA 4EJ6A 4KTQA 5LNK6 1GL3A 3RRXA 1Z2EA 5AVXA 2ZXFA 3EGOA 3WX8A 3F6CA 4ROTA 4IHJA 1P6TA 3R74A 5KQSA 4QXMA 2SBTA 4Z49A 3DLGA 2C99A 3SJUA 1HOTA 2GV1A 1TRKA 4M0DA 4PFSA 5ITWA 1BS9A 3ZHRA 10MHA 2VD3A 3DZFA 1DKUA 4B2YA 5SZHB 1XDWA 4IRCA 4KH1A 3NGUA 3UOAB 5HQ3B 2ZSBA 4DXLA 3BFVA 3F0NA 3VR2A 1TU0B 4FYIA 2ZUDA 4TTAA 5A06A 5C7LO 5SZKB 2AN5A 4JYCA 1EWTA 1S9GB 4A0FA 3OU7A 2MMGA 2RFLA 2IDKA 1LLDA 1X14A 5I4MA 2ZDQA 1Z26A 5BWCA 4FVTA 3G9CA 3DXFA 1V41E 2DE0X 3HTXA 3MJDA 2IPXA 2VG6B 3DE2X 4LZPA 3E15A 1L3UA 3K7RA 3LUJA 2WT8A 3JARB 4Y30A 4TLAA 4MIEA 4YK7A 3K4PA 4PXYA 4OHFA 1NBHA 2ZJPQ 3PC4A 3UT5B 5HDBB 4I2QB 1JQ3A 3PGXA 3F9CA 3LP2B 1PWHA 3UG6A 3MI7X 2Q9CA 1UXHA 3EGIA 5J2UB 1NBEB 1K2VN 4W82A 2CJXB 3WS7A 1YB2A 4DQ0A 2KTQA 3W4KA 4MKZA 5AE1A 1UZHA 1SC4B 1RYDA 4C4XA 2GDJA 1K6XA 4ZJQA 5FJ4A 3M0EA 3RFXA 2N3OA 1CQPA 1AM4D 4RPFA 2G5PA 1D9AA 2ODAA 3KHTA 4F91B 1TD1A 1S48A 3CCES 4Z4EA 3TNLA 1G8AA 1FDUA 3MXHP 4EEXA 1ZNZA 1V47A 2F40A 5H0IA 4PCAA 2X77A 2H52A 4OX7A 1HLFA 3W6OA 3HFGA 3OJOA 2BDUA 3L02A 1A96A 4HAWA 4IOLA 5ERGB 4P3KA 4WJBA 3JQPA 1BWVA 1RE1B 1ZL2A 1YC2A 1XMOB 4X71A 2YMPA 3SX2A 5DU2A 3GVPA 4C8MA 4B7ZA 4ENPA 2UVUA 1RLUA 3DMPA 4ITSA 3MPUA 4ZO6A 2BBEA 4BRUA 4HG2A 5BXYA 1DS6A 2GSWA 3OD2A 1Q1GA 1QMPA 4X8LA 1SB6A 1AKMA 1XNQJ 1EIYB 1OBFO 1MDFA 2HDWA 3Q7RA 3VVMA 4DQIA 1J8QA 4QQ8A 1UM9B 2HGMA 1NUTA 1U1RA 1Y1TA 1FMJA 3L1IA 5JCOA 2IP2A 4CFYA 3TBHA 4RA6A 3OWXA 5DLGA 3PEUA 4CKXA 4LFBB 1NXQA 2BJ3A 4PHFA 2BTQA 4JQZA 1NV9A 1DEAA 3CCVS 3GJSB 1BMDA 2B5JB 1FCAA 2EKLA 4JI4F 1EINA 4TMVA 5D3GA 4RSGA 2EHDA 5A5DA 1OAAA 4MVJM 4LMPA 1V5IA 2NSLA 4M5GA 5CDFE 5BUZA 1TDJA 3ONEA 3A9UA 4BNTA 3UMSA 2R8HA 2MY8A 2VFAA 1IVYA 4H6XA 4AXJA 4XGQA 3SJ7A 3NCPA 4AJIA 4XR9A 3K2YA 1S77D 3KOZA 2O9JA 4HKTA 5IC6B 3VGJA 1Y33E 4QODA 4IVRA 2HGNA 5E6RA 4PPNA 4RS4A 2V4RA 2W2QA 1IHXA 3WKBA 2I9PA 1ZIPA 1QAOA 2BKXA 3R1LA 4O0MA 1UCNA 3HHLB 3OFSA 3OOWA 1ZH6A 4CTAB 4V0ME 5HBGA 2VT7A 2B4QA 2M32A 5HO4A 3G4SS 4CCAA 2EBFX 2FFAA 3LQKA 3V81A 1JXLA 3D02A 1HNVA 1OWXA 2O57A 1N36F 5ALNA 1P2VA 2K7KA 2H9AA 2B3TB 2Y1XA 1NHVA 3AJ9A 1UW4A 3OOSA 4EF4A 3HXOA 4H59A 4AX4A 3K9NA 5BN5B 2WHQA 4JOQA 1ZUHA 4AZWA 1VHWA 2C2KA 1ZG3A 3LW7A 4K4UA 3UQZA 2NU7A 3OA0A 3KB8A 2GI4A 3EGXB 2DQKA 3RJ5A 2Y71A 3IPYA 2P4EA 4CM1A 5KVAA 3JALB 4KFCA 4EB6B 5CLQA 3B1ZA 5FQNA 2B1JA 1T0HB 2HNKA 4P3YA 4R2IA 4ACAA 1YOBA 3IOEA 4RUBA 5IM0A 3SC2B 2OKQA 1A97A 2Q6KA 4DV5B 1BHO1 2JLXA 5AVUA 2C3UA 4RPIA 4IDPA 2WYHA 2E9TA 1L1FA 4JL8A 3X1YA 2ZRPA 1G63A 4B2IA 1XNQB 1L7XA 4YROA 4LXYA 3SZUA 4MI3A 2OEMA 3IFEA 1M2JA 3RUIA 4Y2VA 3QEJA 1NXVA 4Y0AA 4ER5A 2DTDA 2YJNA 1KOOA 4XPIB 2BANA 2HBZA 3PG5A 1ABFA 5C2GA 4P82A 1NATA 1J0BA 1I01A 3IVXA 1RYRA 4U6NA 5K8LA 3AGQA 4Y18A 5DW0A 4RD6A 4DPKA 2XBMA 3EFOA 2OP0A 3QK7A 4GP9A 2RAVA 5CM9C 4R8SA 1SIWA 3UUWA 1H73A 4J9RA 1KK1A 4GXTA 2J3EA 4MUEA 3DWFA 5T4HA 1O57A 5AJHA 3EZGA 2ZBUA 3R5KA 3AUSA 3WQPA 2JG3A 3L3CA 5DTRA 4FDTA 1KQFA 1L4KA 5D5HA 1PS9A 2COUA 4GR4A 1P1KA 4BL5A 3MTJA 5JIBA 4CTNA 5TJ9A 1Z13A 1JTEA 1PCXA 4JC4A 3ROEA 1RHUB 4P7BA 3ZDXB 2C1EB 4O4GA 1SCUB 3TJMA 1U1IA 4JWKA 1VK8A 3W5HA 2I99A 4DQVA 2CDAA 3ZHOA 3U31A 3KDAA 2JRCA 3CYFA 3H40A 1U7PA 1K5GA 4RK6A 3WB0A 3CCUS 3OE7D 3MECA 4TKZA 3IMCA 2FRDC 3IAAA 2WMNB 2H48A 2OPSB 3IRWP 3HCPA 1LW7A 3LCMA 4N76A 1WQ4A 2C4VA 3TO5A 2JFPA 4OU4A 3MLBA 3MFYA 3IN5A 1NSAA 4EGQA 2EYUA 5E7OB 3ZXWA 3OP1A 1TXGA 2EFDB 5AVQA 4FNIA 4N18A 3T1NA 4OY3A 4MIBA 5B5SA 1G5PA 2VHVA 1JP7A 5HQLA 4ZFNA 5SZTA 4DQQA 4NXMB 3RYHB 3KK0A 5CB0A 3KOXA 5K8VA 4IP0A 4WZBB 2AEEA 2OK7A 1C0TA 1DJNA 1CULC 3WMEA 2R1UA 1SQ6A 1YVPA 4ZVPB 5AI9A 4DDUA 1M6WA 1ORHA 2H17A 4QPZA 3RRJA 3P9XA 4FPRA 1TKZA 1Z6ZA 3UT0A 4EGSA 1P0IA 1LSUA 2ERRA 3T4EA 3RBZA 1H65A 1UKUA 5EIHA 4O5OA 1DC7A 3CG0A 2NSJA 1PGOA 3UMGA 4BFWA 2EOAA 4E5VA 1HLDA 4PPZA 1BS1A 3L6DA 4Y2SA 4LKRA 3KE8A 5FTNA 1XR6A 4YJ3B 2B9XA 4RL1A 2ZSDA 2QN6A 4CM2A 1SQ0A 3SZLA 4E6EA 3CRZA 3SSAA 3Q3EA 4K7JA 3L05A 3V4SA 3CGGA 1RC8A 4E3ZA 4JLSA 3I9V6 5BN5A 5C2CA 2I5PO 3IAM1 3AKYA 3MJCA 4YY3J 3TQQA 2G4BA 4DA0A 2CPIA 4CU2A 2J32A 1POWA 2FZKB 3B20A 1TC2A 4EH1A 1M7HA 1GPBA 3T8YA 3L1KA 5G1NA 3BAFA 1TM7E 2Q2WA 3MBIA 4UZSA 1V45E 1VIVA 1HZJA 2FRDA 3ITEA 4L9WA 3DDZX 5JDCC 4J9QA 5AHOA 1RTJB 1ZN8A 4Y65A 2VP9A 2GHPA 3OZVA 4KQZA 4L8GA 4ZZIA 3V4LA 3J81j 2WBMA 2ZE8A 5KTTA 2H7VA 4K1LA 5HPYB 2XLBA 3NO4A 1WULS 1HDCA 3CRW1 3DPSA 3E9MA 1PYOB 3P5SA 3QVUA 3MOZA 1DTQA 4V03A 1S99A 1H2WA 3NTRA 3RS8A 3TL2A 2ATXA 2R6R1 3FCAA 3HN6A 4KI7A 5L8RC 1CULA 2OFHX 2GN6A 1AGXA 1ISFA 2Y67A 3E9RA 1KI2A 4AECA 1QTMA 4BVJA 3NFRA 3HJFA 3H1BA 2RU3A 3NNSA 3OZFA 2R25B 2K2QB 2CZVC 1B2LA 3C4VA 4OG2A 4C0WA 1T8SA 1CS0A 3KKOA 1WABA 2HTEA 3EYZA 4DGSA 5KX5F 3FMPB 1M72A 5IM5A 5CVEA 3P4UA 1ZOIA 2RB5A 1I6WA 1TCBA 4PCQA 1JHOA 1EFHA 3MCZA 1LNSA 1ZRNA 1G8HA 4QZVB 1JA0A 4IVNA 4MRSA 2Z4TA 1D9FA 2XLCA 3VNRA 4BEWA 2IOFA 2Q5OA 5DHQA 3M89A 2KSQA 2ZYHA 3CCJS 4NCBA 4UFNA 2DR7A 3ODPA 5K8OA 2QT9A 1UBSB 3FZ2A 1BX1A 3RU0A 4ZN1A 4Z3OA 3WGVA 2EQBA 1M1XB 1HF3A 4NMHA 1YBMA 3LG2A 3DEZA 5TV2A 4ZA1A 2ILYA 4EMTA 2PEHA 5D2CA 2ZDHA 3W9YA 1JXQA 3MGCA 1XNHA 2UVVA 4B71A 1CJKB 1RI7A 4ZVQB 2V7QD 3BRQA 2C54A 4CMJA 4DQSA 2VU5A 1Q0NA 3OUZA 3QKRB 1LTKA 1W93A 3HV2A 3PO4A 1QUPA 3N2IA 4B3MJ 2XVAA 3BGDA 2GKSA 4Z4CA 2PZFA 3SD7A 1JDBB 2YHIB 3DM2A 4ZHRA 1E2KA 4QZVA 1Z4KA 4G67A 4GFDA 3W9BA 3KBOA 5JVDF 1ISPA 3I04A 2NLOA 1ND5A 4CUJA 3TI0A 4PGHA 2ZYRA 3PZRA 4JXKA 2NOAA 3K09C 2YRFA 4X1KA 4LIPD 3BKTA 2NXNA 5CDFA 1KBQA 1U0RA 3EIHA 3PVZA 2EV9A 5A62A 2BMJA 3HCRA 5GJBA 1QAXA 4V0LA 2OD2A 1LZKA 3U1TA 4DJTA 2ZJBA 3AEUB 4MS4A 5EEGA 3ZGOA 3U13A 3ZX4A 2FZCA 1T3SA 3SXUA 2BCGY 5B0GA 1C8KA 3BMNA 3JPYA 2DZDA 4G9EA 4IFVA 2AT1B 2OUGA 1CQXA 2ZRJA 4JI6F 1I1NA 3HD1A 3X0DA 3CJ0A 5FULA 5JS1A 3D6TB 4ZHQA 5DG8A 3VNVA 1J1UA 5I7AA 3PFNA 3BILA 4NG5A 3SEQA 1SGWA 2NVOA 3KUXA 1V5IB 1DV1A 2H07A 1REVA 2WI8A 3DGFC 1IG0A 2Q2QA 3OLAA 3R4VA 5FLXU 3PXBA 4OQ4A 2E2WA 1S1XA 3UR0A 1FIUA 3KFLA 1L7RA 1NQAO 3E9DA 1TPZA 2Z0MA 3U7IA 3ZTRA 4EEKA 3ZV5A 2WSFC 4WKBA 4IHJB 1JLAB 4F04A 5FUVA 5KFPA 2IK8A 1DL5A 1GKYA 5E0OA 3HQ4O 4F7WA 4MKBA 1UM9A 1A7AA 1TZ2A 1RE0A 1PFKA 5IU6A 2A10A 3RU7A 3T7JA 3W3AD 3FYUC 3LXXA 5JUMA 4OQDA 1UW9A 1N6PA 2ZRMA 2KHDA 4F0JA 5T4FA 1R27A 3Q88A 3A4TA 2NN3C 4X1OA 1QHIA 2GJFA 1DFHA 5L9XA 4QUAA 1KQGB 1JB9A 5I51A 1MOQA 3ZVLA 3RYIA 2G9ZA 2OBXA 4EABA 4F93B 1GG9A 5JH7A 5EZ6B 4FGLA 4M37A 3ZWBA 5U4QA 4YI5A 2BLLA 5AJWA 2Q5HA 3AERA 5JPDA 2BR3A 3ETLA 2FP4B 5GJVC 4XTCS 3MR3A 5D1HA 1VCHA 2GW8A 3RD5A 5ETTA 2WM3A 4QR0A 5DHRA 3TDKA 3G9UA 3RVRA 3VJLA 1Z18A 3TL6A 2KKHA 2B9VA 4HTFB 1ESZA 3UENA 4DCTA 3K94A 5DF1A 2BMDA 2BGWA 3K9BA 4I6WA 2F8SA 4BYMA 3BDPA 5K03A 1I4WA 2O8DA 2ONYA 2L17A 4QAQA 5HP4A 4N39A 2H6EA 1WDMA 2DQSA 1OLXA 2D0OB 3RS4A 4Q7LA 3CLSC 2YKMA 5LP1A 3Q3HA 5BQXA 4F06A 1UC8A 3D7LA 1HV8A 4P80A 1NC1A 5AJ3J 3HSSA 3TGPA 5DHUA 2Z2MA 1QVGR 2Y4NA 5BV8A 1DQZA 1ZD3A 4L5BA 1V3QE 1LY1A 5HIJA 3STWA 3RU9A 3HLKA 1NVKA 1OH6A 2VDKB 1SG9A 1XUOA 2AYEA 3ZGLA 3HVTA 3DI6B 2XB4A 4D43A 3DR5A 4JFAA 3CY6A 1W2BR 3WSTA 1AB5A 2WVJA 2EWMA 4K9SA 3Q7TA 2OCLA 4YMSA 1E3QA 1VYTA 2LP4A 3ZDZB 4XI9A 5CCLA 1BGXT 1DHMA 4JI0F 1W88A 5LNK1 3RRYA 1TKBA 2I8CA 3EF0A 1F38A 1WZ2A 4OL0A 2MZQA 1FHTA 1OIAA 2R6AA 3ICEA 3WHIA 5EE1A 4D97A 1MA3A 1EJBA 4P0PB 2VNKA 2VHEA 3IMKA 1P9OA 1OLXB 3ZC3A 2CK3A 3VPBA 1E2EA 3LBYA 1A9RA 4EBCA 4E33A 1KOLA 3I6IA 3F6RA 1F2UA 1WB5A 2ZIZA 1RZRA 1J5EJ 2MZRA 3H9BA 5ULLA 1X1CA 2B7CA 4E4YA 4DA8A 4N8OA 4BNDB 3AUAA 3E9EA 3KLIB 3CO5A 4XOUA 5H02A 4GGPA 4LIWA 3DDWA 1S3GA 4PSVA 3GLUA 3FGNA 1HLPA 3P0IA 3JPWA 2B5OA 4X7RA 2C4UA 2ENWA 2F59A 1U3DA 3L40A 4Y2JA 2ZH7A 4HEA1 1URPA 3ED1A 2XMTA 1NB7A 1NNUA 1NVBA 4LC9A 4W5TA 2GASA 3H1GA 3JWIA 3OZRA 1KH1A 2QEXS 4LHZA 5LCXA 3TZCA 3MK31 3ZZ0A 4L07A 1AV6A 3LYUA 4DR2B 1RHQA 1YOVA 2WTNA 2CNWD 1Y7PA 1VMIA 3BMQA 3NBPA 2OSBA 4TZKA 2X8BA 1MG7A 3MERA 4LJ8A 3JQ7B 3L79A 2FJUA 4C76A 4Q9KA 4WADA 3VDRA 4UFPA 4RKQA 2CJPA 1UDRA 4DA9A 4HN4B 3BEOA 1YK1A 2XZTB 4F04B 4FFBB 3RB3A 2VPXA 1XE3A 2KYRA 4EHLA 4HXYA 3GW8A 3I6QA 2NU7B 2FQWA 2EERA 2ATCA 3AXTA 5JPCA 3OJWA 1N5IA 1SU4A 2QDKA 1DX6A 2O7VA 3THWA 1DG1G 1SKSA 1O4WA 4RNFA 4KPUB 5IRCD 3VPCA 3GLHB 3WL8A 3ISND 1JSCA 1VQMS 1JLSA 5THQA 1ZH2A 1YACA 1GQEA 4CKBB 4JLMA 2K3KA 2Q7XA 4L8WB 1PAUA 2PKRA 4FGSA 2HB6A 4Y28C 4UC0A 2GQQA 1UMCA 1WUYA 2K87A 2CFTA 1A5TA 2P2DA 1Q83A 4B7AA 3HA7A 3K8OE 1HBUB 3AR3A 5T6BA 2NV2B 5F52A 4F8RA 2CW5A 4ZPAA 1NK6A 5KFJA 3KEGA 3WXMA 1XDBA 4NZMA 1T9CA 1WU8A 2ZUCA 4XFKA 1UMJA 2QVLA 1S9FA 1VIYA 2P41A 1KH3A 3PX4A 3M9XA 1U6ZA 3HEMA 4JI5B 5I4IA 3L7OA 1M0EA 4ARUA 5C3UA 1E2BA 4PONA 4D9JA 1S1WA 3VF0B 5JY6A 4H3SA 2WSIA 2V6JA 1GWNA 2Q41A 3BULA 1BE4A 1H38A 3I04M 2D5CA 3OAAA 1WWKA 4LXGA 4G4SP 1RRMA 2GK4A 4IG3B 1HTBA 2XGQA 3WQRA 1PT5A 3C48A 2VYND 1AZSA 1UC4B 1QGAA 3DFFA 1TVKB 4M5IA 4N7JA 4MYSA 4F92B 1FRIA 2C9ZA 4DBQA 1Y3IA 4TM7A 4CLXA 4CT4B 4LBVA 3G6YA 4Q18A 4XIJA 1XRMA 3T5AA 2ATVA 4XO0A 1OYDA 2PUBA 1IN6A 4BGEA 4BIMA 4LRBA 4X65J 3VNUA 1H6DA 1ZAVA 1CJTA 3ADKA 4UXIA 3N1UA 2MR5A 1WEHA 5LL6d 1FJXA 4AP5A 1PEYA 4AQYJ 3CUWA 1QYVA 2QRVA 3RIXA 1FDAA 3HCXA 4WESA 4ENSA 4K6GA 2WM2A 1Q44A 2VXBA 3VKUA 4OB8A 4PXDA 1SL1A 4B9VA 4BV3A 3L7LA 1DJPA 3TR0A 3IUMA 2CDCA 3NIWA 3R9WA 1BU5A 2VP2A 4C08A 3RASA 4X4TA 3BJEA 4G86A 3OL7A 2NUUG 1HLWA 2EFOA 3PPYA 5ECYA 1MGPA 4PQFA 4DUZB 2C5HA 4QYZJ 5ETMA 1E20A 2XRZA 3G1WA 4LXXA 2YNGA 5BMVA 3GCXA 1K7YA 1HD1A 1QCCA 3MMAB 3RYHA 4LAFA 5BYKA 2OXTA 1MP0A 3NBMA 3TVTA 4JI7F 4LFAJ 4YFVA 4FMPA 4TYAA 2CLSA 2JIMA 5E6UA 5AXCA 1T3TA 1NV8A 3VXKA 2Z4SA 3G8QA 2DFVA 2OQVA 3L7KA 1Z4PX 2DHQA 4E2ZA 2CL7X 3MCWA 4MW7A 3JTMA 5I7EA 3EZYA 5SZIA 4EPXA 2JZOA 4G9GA 2W8BB 3WAGA 2R7MA 2QX4A 2ZD1B 3GEBA 2W6IA 5B12A 3ESCA 1CDDA 2O7RA 1ROFA 3ZDQA 1NWCA 5EYPB 2JIPA 2QJTA 4BXOB 1MMNA 3MAAC 1P2DA 3Q0AA 4HB4A 2R6GA 2FSPA 5DSTA 4LWQA 1OKKD 2GPAA 3D3EA 1UOPA 5ELLA 3VYWA 3UFCX 3O8OB 3JVUA 2W25A 5JBNA 5C51B 2B6AA 1OO0B 1R0AA 2Y0PA 3LZ6A 2QX9A 4GI2A 4RZSA 1NPKA 3TTUA 3W5CA 1OLUB 4D4MA 1Z5VA 4LVOA 3UKDA 3DTVA 1U8WA 4O0LA 3TZBA 1CRWG 3SMVA 5HLFB 5KFIA 5L8VA 5KCMA 3UWSA 4B6FA 4PG4A 5BN4A 1YQTA 1R6AA 3DLHA 4WLNA 2XWPA 1U1NA 3QJPA 2IEBA 3F3KA 1X42A 5JS2A 1KFBB 5KTNA 2ZWOA 4YHBA 2W2OA 3GQBA 4HRAA 2O2YA 2PQ2A 2ETXA 2GJKA 1Q0ZA 1OLUA 4LZNA 2X5OA 2RHGB 4DV2F 4MA5A 4DF4A 2Q5EA 1E5QA 1Z2OX 5HE9A 3KTQA 2H48B 4KRWA 2BJHA 1SO8A 2Y0DA 3OCYA 4GQBA 4NCHA 4LFCB 4C3UA 1XN9A 5KQRA 3KYCA 3IGVA 1TIKA 1QF9A 2JAOA 4GICA 4OQPA 4Z2AA 4OM8A 2FF7A 5KNCH 1GRQA 4MUGA 3VO9A 4O4GB 1FL9A 5DXJA 1W1UA 3GSIA 2BHRA 2VFTA 4ID9A 1PGPA 2OA0A 2Q66A 4DR5F 1KZGB 4GMFA 4CM8A 4MXDA 4HNGA 1BTOA 3LVQE 3TTSA 4G24A 5DGXA 1MKYA 1V96A 5KOIA 2R7NA 4LK3A 4CG0A 2GS9A 1JAYA 2VH5R 5K0LA 3KQKA 3RYIB 2HFZA 4RR5A 4WACA 3W9SA 3BA1A 4O4HB 1L1RA 2FMXA 1U2QA 5KWEA 4O08A 3QM1A 4GS5A 1KTIA 1A0OA 3THYA 2OVBA 3HCWA 3SX4A 4ZD6A 1NPTO 4R5HA 5I6DA 4MMOA 4FYMA 3CFYA 3S2IA 3L0IB 5KFEA 1N48A 3W77A 3WGKA 5F73A 3LPMA 2MYPA 4DQDA 2B3TA 2BFWA 1TT5A 1VE9A 1MN6A 3T06B 3FRZA 1SVIA 2NP7A 3QHQA 2XMUA 3NNDA 1R0RE 3LBFA 1NQXA 3MJ4A 3HGTA 2HA4A 5HJ7A 4C6AA 1JBEA 2BISA 2V59A 4I7FA 1QG4A 1ICEB 4CRJA 3OEEA 2QYCA 2IEYA 3SDSA 3FKBA 1U0JA 5CRIA 1CULB 4B3HA 2J6HA 1U6KA 1TO1E 1O6ZA 3E1GA 3QBCA 3DVLA 2BHSA 3IQGX 3D6MB 3ZNUA 3ZS8A 1W2WB 3NYWA 1RWKB 4TRNA 1NAIA 3NDJA 1Z56C 4BAUA 5AVKA 2BW2A 1V9SA 4L57A 4RW4B 4ZJYA 1Z0JA 4GOXA 5DOVA 5LMCA 4TX1A 2QG9B 3PQCA 4ZQIA 2CWXA 4DG9A 1J09A 3GT3A 4ER6A 4CO2A 3V6DA 5DP2A 4Y9UA 3DZJA 5BNZA 4V0KA 1FFWB 3AL3A 1SIOA 4NI2A 1S6YA 4RJJA 3RNOA 2V9ZA 3MEDA 1JQ5A 5LOVF 4CL8A 2HQ3A 1M1GA 2FQ1A 4DTCA 3TL3A 4O25A 2B1QA 3WIOA 2HHXA 1PCAA 2C59A 3USES 1KSPA 3R3VA 1WHYA 2ZIXA 3EHDA 3ZOKA 2ID4A 1H2YA 1V9LA 5HVHA 2WSLA 4CL3A 1TKRA 2HU5A 5LBIA 3ZTTA 3MJSA 2Z30A 1MQ8B 2CB9A 4HI2A 2ZITA 1DBVO 1RCOB 4MKHA 5KFUA 4D8WA 1SXQA 1MJFA 3E8OA 2ZHAA 2DR8A 1Z35A 3OVBA 1NJGA 5KYTA 1E77A 3FWHA 2DFLA 2I33A 4DPOA 5AUOB 4YAUA 3NHYA 3PRJA 5C7OO 2HT1A 1TEXA 2DHHA 4AK9A 3D2CA 2JJ2D 4CCYB 4ZOAA 1RWPA 4US0R 2D6FA 1FK9A 5JJ5A 1UEVA 2DWOA 3RROA 3BM5A 6CHYA 3FSEA 5E95A 4UD6A 3EGDA 4IFBA 1UWAA 4ZZ0A 2D5BA 1UIRA 3T15A 2DY0A 1B73A 3L46A 3VKFA 2P9EA 3E61A 5JSYA 1VRVA 2NQ8A 3C43A 2IC3A 4KO4S 3OFGA 1XLVA 2P9CA 2WB1D 3AVPA 3DVSX 3TLKA 4QGFA 2OYCA 4BOYA 5TQVA 5E4YA 2YNFB 4IZHA 4CF7A 2X2OA 1GGFA 4IOMA 1OPIA 5I3UA 2GZOA 1KU6A 4WTOA 3L77A 3QO9B 4KLZA 1E5LA 4YMGA 3B3QA 5LMUF 2QV6A 1O0BA 3LPNA 3ORSA 2R6ZA 1KIAA 4BKUA 5CX1B 3DE0X 3PKIA 2BQUA 5FFMA 5IX8A 3RW6A 4XWKA 4N41A 5DWVA 3QFFA 1WF6A 3VU9A 4EZIA 3GBPA 2Y1FA 1BXRA 3Q8XB 3LHIA 3QFSA 4DLXA 3ZXSA 4EKGA 4NA3A 4I08A 2CMFA 1FCJA 1YFLA 3O3NB 2DWQA 4EY3A 1NW4A 1U2TA 1T3LA 1QHXA 2PA0A 3QMVA 4GMKA 4N0MA 3CN7A 4Q2MA 4IJMA 4HGPA 3OCXA 5SYAA 5FUBA 2Y0BA 1EZZB 2GNOA 4LNHA 1XK8A 4KC0A 2QP3A 4QOTA 4F86A 4ZARA 3BGFA 2W5UA 4EATA 3PT9A 1BFDA 2VNSA 4O4HF 1KOGA 5CHCB 2QD5A 1R00A 3UN3A 2XNQA 1KO5A 2KU7A 4JYZA 3O8WA 4LJ9A 4GGOA 2ORWA 3OZWA 4MVWA 5LYYA 3HX9A 4KIUA 2HVDA 5H7XA 1HE8B 5C2JB 4CCHA 4JYPA 1N0HA 1SELA 4RTMA 4PHTA 2CF6A 3N8GA 4YMWA 4MIYA 5JI3E 2LGJA 2DAPA 3CR3C 1GZHB 4W5HA 3VDQA 1HE4A 2QL6A 3ZNPA 1W5SA 4YMVA 2H5IB 2G3YA 4FS3A 2H0AA 3SJZA 4CWAA 1Z5GA 1ZC4A 1B6RA 4LF8B 1OTXA 2UZ3A 3VZIA 4IDBA 1DC8A 3I62A 4N03A 2CV1A 2VFSA 5B3KA 1M66A 4JLJA 1YJ9S 2G1UA 4I7EA 2R7UA 1EFTA 5CK5A 3W9IA 2HA2A 4GM0A 4R16A 2HDNB 4LJMA 2EFGA 1LEHA 4OMFG 1TT5B 1OUMA 2GSDA 1R4ZA 4F96A 2ERCA 5K05A 2PUEA 5M2PA 1M1YE 1VRQC 3ZGVA 4R1LA 4LXTA 3T95A 1FXDA 5AKXA 4UREA 3C14C 3HZRA 1GLNA 2NO7A 2XUOA 3NBAA 1NIPA 1IDOA 4ITVA 1SZPA 3SGLA 3ILYA 1E2PA 1FJGF 2X0NA 2V0GA 3MTGA 1GCUA 3J7AC 2XO7A 3UKJA 2JHGA 4EI2A 3D8UA 2CXQA 2XCQA 1Z0UA 4M1KA 3AINA 4XLTA 4EI7A 2Z09A 3CRMA 3KL4A 1N5TA 4RQBA 1GL6A 4OSPA 2FI1A 2R8IA 5KHOC 2PN6A 2O20A 4TTTS 4WA8A 3T4PA 2G1HA 2Y1DA 4WZAB 1JKHA 2H1VA 1OXKB 1ZWKA 1G2OA 3PZPA 1BQ3A 1N6IA 1B74A 2R48A 4RKYA 2WZDA 4FFMA 4BIIA 4NLUA 2YKNA 1I7PA 5DXAA 3HU5A 3N6LA 3BGWA 3WK5A 3IDZA 1Y8AA 5CG1A 3A36A 4Y2IA 2A9FA 1WSDA 1SVSA 3EFHA 4KDFA 3UY4A 5G2OA 3VYUB 2CLHB 2VQDA 2DEIA 4ELTA 2HXSA 4AKSA 1EUDA 2X9NA 2MYFA 4OSOA 1CG6A 4Q9NA 1RXOB 2OY0A 3DL7A 1H2HA 4DBLE 1RI2A 3ZCRA 5KTMA 1G4CA 1G7CB 2AJQA 2JIZD 3O9ZA 5EIAA 2D0DA 3UYLA 1FU4A 3HYCA 3MR2A 2YCBA 2CZ9A 1NJ1A 3FNBA 2FJEB 1SCUA 4E7OA 1C4XA 1UTAA 1UKZA 5D7BA 4N8NA 2ASDA 3QUCA 3DHWC 3RFFA 3E82A 2G2OA 2CMHA 4Z4FA 3URKA 2YQ0A 2JS7A 1KIFA 2EFPA 1XLTA 3C6KA 4KHZA 2JSXA 2C57A 3FAZA 2ERYA 1PQUA 3PDJA 1Y6RA 3BKUA 2UZ1B 2OESA 2P9JA 2WZQA 4Y8VA 3BQ2A 1HDRA 2FPRA 3ZNJ1 4A3SA 5HNKA 3OOYA 1YJNS 3TA0A 3TQOA 4U95A 3U4QA 2OQ2A 2LEAA 1KONA 2OHGA 3G2QA 1W87A 4P35A 3UXEA 1B14A 2B30A 1JWBB 3QENA 3RAFC 2AOXA 1LQ2A 4AWXA 5LOVB 2R1TA 3LGAA 4E51A 4UAVA 3KR1A 5B08A 3UD5A 5CA0B 4HT3B 2GA7A 2EQ5A 4CH1A 1FBNA 4HR2A 2PJRA 3CH7A 2IZ1A 3J80Y 4WKYA 1NDQA 4OGWA 3W66A 4JLKA 1BA3A 1IFXA 3ILHA 1NYRA 4DZZA 4TSFD 1S72S 3T6KA 2VDUE 3QNWA 1GDTA 1EWRA 3BE4A 1PG0A 5C1OA 2JBAA 5K45A 1COZA 1V5GA 2RONA 3BD6A 3MRVA 4YRSA 1HYHA 3EG9A 1JHQA 4C7OB 3TKAA 3ABSB 4N40A 4PBTA 2MQQA 2IDZA 1MDBA 4XCVA 5I9BA 2WF5A 4QUJA 4OCZA 3R3XA 1TUEA 1HSZA 4U2GA 4S1WA 1I8TA 5AKEA 5HGJA 3FWPA 3JYTB 3PIPQ 5JZOA 3I05A 4HRVA 4KLAA 2BMEA 3T3MB 5ALDA 4CCYA 3RAXA 2VP4A 1CLUA 1VIAA 4Q3AA 3N0TA 1ZJ4A 2FUEA 2IFTA 5DQIA 1LPAB 5K3AA 3N8NA 4CLOB 1YBAA 5EL0A 3TFOA 2WMYA 3HA2A 3HHLC 2BE2A 5TQ2A 2MMCA 4J2OA 2HHHJ 3E2PA 2G1AA 1CP2A 3EG9B 3PKZA 4CGZA 4P4UA 4E88A 3PNLA 4EKYA 3KG0A 4X6LA 5FDFA 4ZYZA 1L7QA 1PYTA 2UZ4A 2QY6A 2I76A 3QTBA 3HSDA 2XDQA 5A9RA 2ZI6A 2YXBA 2EKQA 5IDXA 1N36B 1VOMA 4N7BA 4TL7A 3OV7A 4INZA 3UUGA 1MWYA 4JSRA 2R2SA 4RHXA 3NJRA 2VPWB 2RHQB 3NRBA 3T7TA 7AT1B 1PLJA 2GC8A 2ZT7A 2RHDA 3WWZA 1JFTA 1P33A 5E7IA 1L5MA 2JCVA 4Y6PA 5GAHU 1SBHA 4DMLA 1SUCA 2AHOA 1FXWA 4KXLA 1QVZA 3O44A 9GPBA 2H9ZA 1MAVA 1SURA 2GEKA 4UU7A 4FQ7A 4AF6A 1UPAA 3UHFA 1KYTA 3FBWA 3OZDA 1XTJA 4R54A 4QELA 4LYGA 3P45B 4CKYA 3FH0A 2PLWA 1R3DA 4ENOA 2HHQA 1SH3A 2IZ6A 2QYSA 3ORRA 1YDEA 2X7IA 3E7PA 4Q5VA 3I2YX 4YQYA 1KQSR 4JJ7A 3RBEA 5KYKA 3N87A 3OTDA 4BFUA 1RA6A 3P97A 5C1IA 4YB5A 4GGMX 5I4BA 2X3UA 2JAHA 2OC9A 2C2XA 1FNBA 3MS4A 4JHLA 1Q5PA 1EXDA 5L3QB 2VUSA 1HE5A 3NOVA 3OFJA 5CFQA 1O58A 4NBUA 4RXMA 1I30A 1EE9A 1EM6A 4WFAQ 4M1YA 2JAUA 4ZQGA 2KZZA 1YVUA 1CJKC 4CLHA 2HMTA 3VKWA 1QDUB 3K71B 3OM8A 4H7FA 3ONQA 3CH6A 2DUMA 1H4SA 1ISIA 4YJHA 3T1HF 2PBLA 4MUFA 4H1UA 3PX0A 1YVEI 3O9VA 3F9RA 4IJWA 5BR1A 1P75A 3US5A 2VYCA 5DDQC 1AN0A 4OHBA 1QSLA 3T0FA 3GDFA 3EWAA 2P6OA 1U1GA 1PKEA 3JYPA 1T1EA 3HBNA 1HOXA 4LHYA 1Q53A 3FNQA 2RGBA 1YJTA 3VHQA 1VGYA 3SQMA 4JT8A 3CLUC 2MSKA 3ZTYA 5MHTA 2F65A 2P5UA 2R4FA 3UAGA 3W6PA 3S55A 4BMSA 2F4VF 3P6YC 1VFNA 2HGLA 3MM7B 4XA8A 1VBNA 4M7PA 2DNYA 3KT6A 1KVUA 5LYJA 3V2UA 1SVNA 1ZTWA 5KG1A 3FBFA 3TXXA 3TQEA 3ASUA 2WP0A 5JQWA 2X86A 3QVVA 2JEGA 4I8IA 5DX0A 2QSZA 4N48A 4EGAA 4FMCB 2BFDB 3RV3A 3L8MA 5F2KA 4OMUA 1ICIA 2YV5A 1UL1X 1X3SA 3BWVA 4Q5IA 1VG9B 3DEJA 5LBTA 2QN9A 2GIRA 3B1VA 3IV9A 4E09A 1EP4A 2W9CA 1EKXA 3ROMA 3RSLA 2PMWB 2ZJYA 4DV6B 1DAPA 1VMAA 2POQX 2BEUB 3COYA 4CR7A 3G5MA 2XTJA 3T19A 4Z0TA 1ID1A 1SB9A 2P75A 1FDOA 1N0VC 4AULA 6LDHA 2W00A 1YQDA 1JEQB 1E0SA 3H2KA 5CLHA 5DYIA 5C7YA 1BMFA 4NE7A 2YV3A 4NASA 4W9RA 4FYPA 4NDAA 5FFFA 1LWEB 5LPNA 4Q44A 2VPYB 3GJZA 2O1PA 2XGJA 3PV0A 1ZGCA 2AZ1A 1ORTA 2X6TA 3CX6A 4KRFA 4RZXA 3BN3A 4HSGA 1ZIDA 1E2HA 1IQTA 4N01A 4L74A 5CCDA 2DH9A 3M1VB 3B36A 3GLHA 1VL5A 2IRYA 1HR0J 2O8FB 2J3IA 5IYZF 3N28A 1PFQA 3RR2A 3Q3VA 1NX9A 3GWCA 2KPOA 3TQ1A 5HFJA 1RB0A 4MEJA 4MW0A 1JZSA 3QKRA 5KSWB 2R8XA 2R751 2VL7A 4DR4F 1YS1X 4HB0A 4V0OA 1A9NB 3HMQA 3FCXA 1M5RA 2L82A 1IXRC 4BY9E 3JQJA 1ADJA 2NSCA 3M82A 4DPTA 2YNGB 2CC2A 5EP4A 3UB2A 3G8DA 4JI1B 3AB4B 4TKLA 5KFMA 3R8CA 4EL5A 2IMOA 4YUVA 2HWUA 3DD1A 1NSTA 2IBTA 2YV1A 4L73A 2DXEA 1T8TA 4BVBA 3NWOA 1JU4A 3C3YA 1Z47A 2ZSHA 3SCKE 3VNBA 1HYGA 2FQQA 1U7WA 2O6LA 1AS3A 1B43A 1WB4A 3O5TB 1S1TA 3Q9LA 4FI3C 3M6WA 4BO2A 1DRZA 1G8MA 3RVLA 3WK7A 1G64A 2FD2A 3QKTA 3D1JA 4B3TJ 2AD9A 5AYVA 2DBBA 1ULTA 1JEYA 1NJFA 3V4FA 3WIEA 2CL0X 2X9QA 3GPBA 1TVRA 3HJHA 4MKGA 5F8GA 1YX2A 3I0SB 2XI2A 1HMYA 2VUTA 2Z2JA 4BNYA 3L9WA 3AW8A 3BJMA 2NU9B 4ERDA 3AXSA 2GUGA 2DF8A 4WH0A 3ZCUA 2XUFA 4P92A 3RO7A 5B1SA 5C18A 5K0JA 1PL7A 1Y5MA 2GYUA 4CKCA 5K2MA 2XCIA 1S1XB 4RCYA 3EF1A 4KQFA 5J2UF 1SCQA 1YJ8A 2BKPA 1Q57A 2G1DA 4HEJA 4FYXA 2MT9A 2FLNA 1XZEA 2CKMA 1DJQA 3L4EA 7ADHA 1N75A 3BXGA 1Z8DA 1XEXB 3ICPA 4EY7A 4K4VA 3K0HA 1ZAXA 5EJ2A 1DIRA 2CZCA 5BSHA 4Q45A 5L1JA 2ZULA 1HNNA 1RZMA 3S2SA 1ZK1A 1EYZA 1UUFA 4Z9YA 2IM1A 1K5DA 3KJZA 1NBEA 5CA0A 3R5DA 2HA7A 8RUCA 1ECJA 3IBFB 2BMWA 3HDQA 3WYNA 2EU8A 3T38A 4KXUA 3H17A 3R7AA 1DZ3A 4MP3A 1NQTA 4Q05A 3WBFA 3RG6A 5JSZB 2WKRA 1FRQA 2F7SA 4GZ6A 1QK5A 3VZHA 3VGSA 3AUTA 3OLZA 4FNOA 1QMGA 4NTZA 4ER7A 4O23A 2BRKA 3VC1A 4P22A 2GYVA 3V6MA 1XO1A 1OWMA 4YT8A 2QN3A 3CKLA 3V8RA 5J2NB 4G8CA 2D4AA 2CQ3A 4LC0A 3T1HB 3DE3X 4OLPA 1KZHA 4J16A 1VGVA 3ESXA 5CP8A 5DLFA 3LOUA 2H1SA 4HDKB 1RU2A 3JD2A 1SFRA 3S8SA 1P8JA 3JQQA 4RD0A 4Z2XA 4G37A 2Q6LA 1U1QA 3OWOA 2GEBA 4L4XA 2PNFA 5AKKA 2R7AA 2BTQB 2GPJA 4J9PA 5I42A 1FPMA 1XTIA 5THWA 1X7ZB 4O2BA 3A31A 3VZCA 2D9OA 2WU1A 1D6NA 3B6IA 1NBAA 1R2QA 2F00A 4RTLA 4OJGA 4QOGA 1ULZA 2TMKA 2J4DA 1BD4A 2YDXA 2FAXA 4M95A 1W48A 5HKKA 4DU7A 2OCBA 4EVSA 1KHHA 4J0KA 1ZN9A 4B7XA 3LA0A 4R05A 3MINA 2OUIA 4EGFA 4LY9A 1N5VA 2FQQB 3ILJA 1OSNA 3IP5A 2GM9A 4AL5A 4EI9A 5KNBA 1MW7A 2CD7A 1WUJS 1VFPA 3I96A 3DU5A 1ZCJA 2FHJD 4LR9A 4TN5A 1VI6A 5H9VA 3R7BB 2CLMB 4B4VA 4XWTA 4HWTA 3FLEA 4BVKA 1D0IA 3MJTA 1TJ5A 2EG2A 1FY2A 2LE0A 2X0FA 3EEYA 3REQB 2LKCA 4AT1A 2HLNA 2MQ8A 3ASVA 2KBFA 3FX2A 4N6OA 4AUNA 3GCGA 2AR9A 4QIEA 4OQLA 2CLKB 3CO0P 2V4MA 4OX8A 1LH0A 1D6JA 1A04A 1BHJA 2Y76A 4A0GA 2XB9A 4HNSA 1Q81T 1QIIA 2ZJ1A 4DWIA 2WK4A 1YQEA 4A4DA 2EBWA 3TE7A 3RZAA 2VQFF 3PXGA 1WO8A 3F67A 4C7MA 1UFOA 2DHEA 3AUKA 1I10A 4CQ1A 3WHPA 4GEKA 5EJAA 5TX7A 4G1MB 4TT3D 4P2SA 4NONA 4B6PA 3IIMA 1MOZA 4MV7A 3WJ7A 4DS4A 2GTPA 4WXWA 4EG5A 3PTWA 3E05A 2QLTA 1T0TV 4BLOA 2HV9A 3WGNA 3TSAA 2AMJA 4AJKA 4WT7A 1O95C 1FX1A 2XF2A 3O5AA 2AJ1A 1EESA 3TO8A 3Q2TC 1OZ0A 3CVKA 3KE9A 4DSFA 3WHLA 5DTMA 3OT1A 1JILA 4MI6A 1ZK3A 1W4BA 1N2CE 3NORA 4MTPA 4JOCA 3AOGA 1O96A 4U8GA 1U2PA 2X23A 2EC2A 1M0TA 3HXLA 1Q20A 4XB2A 3ZIUA 5AVRA 1BVHA 2QG9A 2QZ4A 5KYXB 3DONA 4QT4A 1DHTA 3X1KA 4D3GA 1NKBA 2YL2A 3GRCA 3OVAA 3B3FA 1UIMA 3LC2O 2CLDX 3NW9A 1DARA 4U9RA 4MR9A 4QEDA 1QSGA 1B2RA 3NC4A 1KAQA 3C15C 2XWXA 4HTIA 3CCTA 5LSRA 1EFKA 4QOFA 4MIWA 1GNPA 4ILEA 1R4MA 2CDRA 4EYIB 1QAQA 3SU8A 5DQGA 4HGZA 1DBQA 1U5AA 5JDIA 2QRRA 3TB4A 4YQFA 4GC6A 4KO8A 3PQ5A 3WLEA 1GQ2A 2NGRA 2OQIA 2WIGA 3CEAA 2ADMA 2YZGA 3PGA1 4LPSA 1C1HA 3E9YA 1T4CA 3KCQA 4WY2A 1IXSB 5EE0A 2E4ZA 4HK4A 2F1HA 2ZYWX 4G85A 5JWRA 5K1ZA 2VDHA 3PR2B 1N32J 3IUSA 1GN8A 5HFAA 1RHQB 4XRRA 2GLUA 1Z5OA 4MUKA 4WK0B 4UM5A 4LTNA 2VAXA 2OI2A 1SUIA 2KB2A 4MUMA 1HBNB 3ZU3A 4OYLA 1E92A 4QPCA 2CQHA 3F0TA 1J0AA 3W06A 4ZMMA 1JDPA 1AUXA 5AW2A 5DV9A 3V4VB 4WP3A 1P91A 5A1TA 4GLOA 2EFHB 1SKUA 3D0HE 4UHEA 4L3KA 2WNHA 5AI6A 2HHTA 13PKA 3L0DA 4ARAA 4QREA 4CQMB 3KVVA 1K7CA 5FB3A 4NMWA 4PBSA 4JX9A 3GJXC 5IK2D 3A3PB 2FDXA 2HK6A 3G2IA 4QW9A 3BE8A 2QXYA 3EGVA 1RU3A 1OBOA 3LS2A 4USUA 3KUDA 1SBRA 2HRBA 2BBOA 1COWA 1DBRA 1D3WA 2CD9A 1EGAA 4F3TA 3BSSA 2PQ6A 4C8LA 4FX5A 4E5KA 1OC4A 2YJ4A 4PX5A 1AMOA 3HB5X 1TGVA 3HFZB 1H0KA 2P2NA 3EQ2A 5LLSA 4BMXA 3MM4A 2PO4A 3OU2A 2ZVJA 2RHRA 1E1MA 2OB2A 1RBZA 3L7MA 2FR0A 4YJFB 5IC6A 2C42A 3IP1A 1RABB 2CVEA 4M1ZA 2VFRA 3SFVA 1V4NA 3IHKA 3KKZA 4C7JA 2Y8YA 2FPOA 4MDYA 1SC3A 3Q40A 1FDIA 1G7RA 1KBRA 1Q15A 2YC2C 1TKXB 3ESBA 3WNDA 3KEOA 1N34J 1IONA 1D4AA 2OPQA 1H5NA 4RUHA 5FI5A 4YB1P 2Z5FA 1TL4A 1UOOA 1LJUA 4CLSA 4YS2A 1M2HA 5TT1A 2BXJA 3OAAD 3I56S 2WD8A 4JP3A 2BGUA 2QLFA 3VYRB 2OBBA 2WJAA 2HBYB 3P5BA 3EPKA 1S4FA 4KW7A 3Q5GA 4FXDA 2W7AA 4LDQA 1GAEO 1ZOTA 1GTSA 5A3QA 5KVSA 1X9SA 3QX3A 4Q2LA 2J9FA 3QQPA 4D9GA 2BACA 4DJ5X 4ND1A 1PK7A 4Y0NA 4MPPA 4NBKA 3NHSA 2V6AA 3CO0S 4XD7D 1X7WB 2JA1A 2MQLA 2OD6A 2RF2A 1T1SA 2JKVA 1R37A 1VL0A 4CM9D 2C7RA 1RWVB 1Y7LA 5KFRA 2IVFB 4TQUS 3U5TA 3IR6B 2JGNA 1JH9A 3QSGA 3R3TA 1M7BA 3FXAA 4MVJE 4DFMA 2HC9A 2P68A 2BGMA 1XC7A 4EF6A 3NIFB 2DQZA 4O4IF 3SQGA 1N57A 1YU9A 2PSEA 3U0VA 2O0MA 1PEDA 2IL1A 2VHUA 2F2TA 2P27A 2IY9A 2OPSA 1TQ6A 2QT7A 2I2CA 3BXZA 3G0DA 3KT8A 2JC3A 3S4YA 1FTYA 4GBED 3NS7B 3RWOA 3Q8RB 4ERNA 4YAOA 3EAFA 5E6RB 1DXOA 3CMES 3WMWA 3RBDA 3DMFA 3ELBA 3QHPA 2DNKA 1KEWA 2CXXA 2RB4A 3T5TA 3WB9A 1SVMA 5GP1A 4AZ3A 4RCVA 2CLIB 4F9TA 4M87A 3LX6A 2ZJRQ 3C6UB 1WCIB 5CBPA 4RO0A 3LUDA 3SYNA 5L95A 3A4LA 4NENB 1ZPVA 3GNLA 1JLCA 5AKGA 2XGMA 3PYLA 1VQ9S 3P94A 1HI1A 1KBZA 1KPGA 5ESXA 3BRWA 1M5TA 5KFVA 4QFBA 1VIOA 1YTLA 4DLLA 4DSZA 2G67A 8AT1A 3BQ1A 3EIWA 3N8DA 3V6LA 2CV2A 4IH4A 1CUZA 4R9NA 1SQ5A 3RGGA 2HNDB 1E7YA 4HRXA 1L8LA 1VI5A 4X1YA 5AXAA 4OI6A 3GG0A 2H1LA 5BN3A 2XUIA 2QPAA 721PA 2XRYA 2VJDA 2UUWA 2CLLB 5FL7D 3WSWA 3OTQA 2AIRB 2H1IA 2IPNA 4Q4HB 1BXGA 3GFSA 2FZ5A 3GYGA 2OWEA 3EFEA 5KFOA 1LC0A 4L0DA 4GP7A 2V55B 1ZQ9A 1SI9A 2UXDF 3IS3A 3Q8WA 2J0QD 1J42A 1ZK2A 1KR5A 1QGYA 1Y8ZA 3L5KA 1AZTA 3OG9A 4KE9A 2Z8XA 2ZBCA 1U5BA 1XV5A 3E1KA 5CG2A 3SSMA 1BN7A 5DIZA 4EWTA 4P9NA 3EISA 2YUIA 3B9PA 5CXSA 4HADA 5F8IA 2CZ4A 4I4BA 2FU5C 4NU8X 5JXGA 1TL7C 2WFLA 3WISA 5KWSA 2XMAA 3O8QA 3ZD9A 1HT0A 1SH7A 4PWZA 1KXZA 3QPAA 1UR5A 2FP3A 1EZ1A 2CLCX 4DA6A 3PFBA 2GHIA 2QE7D 1MB2A 3SDZA 1AMNA 3N6VA 4FINA 4ERXA 3C6QA 4D41A 3LNCA 4WASA 4CHTA 3H83A 1K1EA 1D5WA 1KEVA 3HA5A 3LQ2A 2H2AA 4QQNA 5LR6A 3C4QA 3H19A 3ZCTA 4Q01A 2FLVA 2ZSUA 2H2IA 3K5LA 1NH8A 3QYPA 4NYIQ 1T5TA 4D1YA 4XQEA 4WY5A 1PFUA 2DPYA 4FEEA 4KACA 4A26A 3CQ9A 4PUOB 3UD3P 2OSRA 3CUNA 3BMNB 1FTSA 4LWPA 4PZEA 3LKZA 4J4BA 1JR3A 4ZJLA 1NR5A 3AL2A 1R6BX 3OMWA