3ENWA

Substrate and inhibitor complexes of ribose 5-phosphate isomerase from vibrio vulnificus yj016
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
b'TQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEEIKGAVSSSVASTEKLEALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREKIVAAIADKFICIVDGTKAVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITDNGNVILDVYGMKITNPKQLEDQINAIPGVVTVGLFAHRGADVVITGTPEGAKIEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
molecule tags Isomerase
source organism Vibrio vulnificus
publication title Crystal structures of substrate and inhibitor complexes of ribose 5-phosphate isomerase A from Vibrio vulnificus YJ016
pubmed doi rcsb
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3enwA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3enwA01
2OKGA 2J0WA 4LUBA 2I9SA 3OBIA 3DHWC 2RQMA 3E15A 3K5PA 4L50A 3DC2A 4GMKA 1LK7A 2PC6A 2QSWA 3CSSA 3UW1A 3IXQA 2ZHOA 1NE7A 2H9ZA 4IO1A 4L4YA 4L4ZA 2WU1A 4L5IA 1Y7PA 3KV1A 1FQOA 3ICOA 1FS6A 3DDNA 3NZEA 3AB2B 4M8LA 1LK5A 3LUYA 5IT0A 2QRRA 3TUJC 2JHEA 1KS2A 4L5JA 1PSDA 1FRZA 2RI1A 3CEDA 3AAWB 4R7TA 2PA3A 4TM8A 3BXGA 2F8MA 2NYIA 3ENWA 3ENVA 3OFFA 3O1LA 2FGCA 4GO1A 4L51A 4OQQA 2LQJA 3AB4B 3TUZC 5IS2A 1ZPVA 1LKZA 2J0XA 3DHXA 2P9EA 1XTZA 3NWPA 3MWBA 1JT9A 5T41A 1FS5A 1YBAA 2DT9A 3KWMA 2R5FA 2W48A 2CDQA 2DTJA 2QMXA 2MDAA 4PWUA 3HN6A 2QMWA 3OFHA 3BXHA 3P96A 3MAHA 2KO1A 2J0EA 2O0MA 2JOQA 2BKVA 1CD5A 3LWDA 1SC6A 4R9NA 5FIIA 1YGYA 1HORA 1VL1A 2RE1A 4NMLA 3CH7A 5HJ5A 1O8BA 1HOTA 1M0SA 3S1TA 5IT4A 2F1FA 2P9GA 1Y89A 3BXFA 2GNPA 3TX2A 1UJ4A 2RI0A 3OFEA 4X84A 1U8SA 3OC6A 4TM7A 3MTJA 3ENQA 3L7OA 5JJBA 4GO5X 3U7JA 3EFBA 3HHEA 3BXEA 1RWUA 1UJ5A 3N0VA 2P9CA 3IBWA 3LHIA 2LVWA 2BKXA 1PBTA 3NRBA 3OFGA 3W7BA 1DEAA 1FSFA 3EB9A 4GO7X 3TUIC 3E7FA 4OQPA 2RQKA 3LOUA 1UJ6A
chains in the Genus database with same CATH superfamily
3ZHSA 4ZI7A 4LTNA 4QOIA 4REQB 2C94A 1E62A 3QX8A 2P8IA 3M6UA 1N54B 2V7GA 2VO1A 1BCRA 4UU1A 4LSGA 2Q6CA 1TM1E 3D2CA 2Q2VA 1JS1X 1S5ZA 2GCEA 2DBQA 2FRVA 1JPJA 1GQ2A 1RHUB 3VDQA 3JAMY 3RG2A 3M2RB 5JY1A 3PFKA 1D2CA 1M1YB 1DO0A 2V69A 3ZHQA 3LY5A 3FHLA 2MSLA 1BROA 2B5VA 2C2MB 2J9ZB 4J94A 1TL7A 3K7RA 1ELOA 3LD9A 2OQVA 1T6BY 5IS2A 3L6DA 4KHZA 4N77A 4MIYA 4TXMA 4ARVA 2IFTA 3Q7EA 4EPWA 3M4ZA 2L41A 1HT2E 3TIIA 5EJAA 4TXHA 4Y67A 1WORA 1FXWF 3NC4A 3C6TA 1PCAA 4EVSA 3CWJA 2JZOA 2AS0A 4JROA 4GPD1 1U81A 4HB0A 5MDHA 1XTUA 2XMSA 3PITA 3FI9A 3QTLA 2MSCB 5C42B 2IBSA 1IVYA 4PLFA 2X9LA 2BWJA 3COYA 3RSLA 3TQ1A 3F9RA 2QTMA 2G5PA 1H4TA 3H1BA 2DPMA 2BJHA 3BSOA 4BV3A 1NFQA 1W6UA 2PUBA 2ZBCA 2X58A 2GM5A 3M9NB 4Q4AB 3UHFA 1F0KA 3T0IA 2BEVB 5LOVA 2RDMA 2XJ9A 4E94A 2RC6A 4OYRA 4FI3F 2JAXA 4WFAQ 1NMXA 3O3MB 4C2TA 1EJBA 5FA5A 5BNZA 1GFZA 4HP8A 3ZGNA 3AEXA 4RJJA 3THVA 4XGKA 2AGQA 1ZCAA 3CW9A 4H77A 2BKOA 1JPUA 1EB0A 2GTHA 3J81Y 2JFNA 4CLSA 2PANA 3G8BA 4YRAA 2C7VA 4Y0AA 1RTTA 3TRFA 2XUFA 2GHRA 3KZXA 4DV2B 2GJ8A 5GAGI 1OZAA 2PMZD 1V8FA 1OPIA 3QWBA 1LXCA 1J22A 1S4QA 3U6KA 5CDTA 1AD2A 3N2EA 5KFTA 4BNMA 1OSCA 1B8PA 3IQEA 1EJ6A 4YHHF 2OV1A 4G2NA 2B61A 4NCGA 1EVZA 3HWX1 5ENVA 3P9ZA 2ODNA 3KELA 3CCQS 3ZJUA 2GSDA 3PX6A 1TTQB 4CLYA 5BMVB 1QOPB 3BE6A 1CQZA 2OO7A 3KLBA 2FD2A 4L7VA 3AD7C 3CPJB 3C3AA 1FYFA 4XWOA 4RETA 1Q7TA 5CT6A 2DGUA 1N33F 2E1CA 2I66A 2V96A 2ZTSA 4P36A 4ADSG 5IN5A 2C2EA 2JRSA 3D6MB 2WYVA 4I7EA 5BOSB 4LAFA 4K28A 1ZLYA 5JVDA 4XVQA 2QLTA 2Z4PA 1ZBQA 4KREA 3GEBA 4XYBA 2N42A 1YITS 4HMQA 1BWPA 1FA9A 1X8JA 2Y0BA 1SB8A 4EX7A 4YMTA 4P34A 3O3NB 3DI6B 3M2PA 1R8QA 5H1YA 2WSIA 3MTJA 4CG0A 2BANA 1DELA 2EHJA 4WLEA 1S0VA 2F3SA 2FEMA 2FUEA 5EN4A 3T3PB 5A0FA 2JARA 2I6SA 3AP1A 4FFPA 1J27A 1UZNA 2G2OA 3IHKA 3LAWA 3EUAA 4E3WA 4LT6A 3DTVD 4I5DA 5DQGA 3PX7A 4ZCSA 4C6HA 4QWAA 1R9MA 1ZGGA 2Y1RI 3ZZPA 3O1JC 4Y6OA 3LKVA 5KTMA 1F6WA 1RBQA 1X80B 2CYCA 2NO0A 4JKIA 5HSPA 4AY4A 4ZI2A 2JW5A 2AHOB 1RQ0A 1REQA 4L8LA 1TTTA 5JOQA 1PN3A 3EBPA 2RONA 4F45A 1FXUA 3NMUF 2JLWA 1GTG1 3LK6A 2Z2IA 1K4KA 3UJHA 4CMAA 5LU9A 5HO4A 1OU4A 1AUQA 2FHMA 5DXAA 2Y1GA 2HSZA 3ILXA 4ZEWA 1C0IA 1XP5A 3QBDA 4U7GA 1LFAA 3ZV5A 3WJAA 1W1IA 3EWIA 2OOKA 5AVJA 4D43A 3JWPA 4IRDA 4HS9A 5D3KA 2LMIA 4FX2A 4IV0A 2X19A 1I33A 1EFRD 4GFDA 4EKYA 4HXFB 1JZQA 1N52B 3PFIA 2D74B 2P5UA 2J4DA 1RI1A 1FTWA 3H17A 2YKPA 3JD4A 2E5WA 1W88A 2H1YA 3BWDD 4JOCA 4IICA 1TVMA 1VLHA 4CWAA 2C2KB 4POOA 3GIIA 2IY7A 4L4YA 3Q8RB 3NOQA 2V3WA 5TB5A 4CMHA 1AOXA 4C01A 5T14A 2H4YB 3QNUA 1S7IA 3K6KA 4KITB 1VQKS 1FW8A 2PLRA 1X6VA 4ECRA 5AXCA 2JF0A 4LR9A 1J9GA 2BH9A 4GLJA 5FWYB 4S12A 2R85A 5C42A 1E2KA 2ZT5A 2IUUA 3D1VA 2XLIA 1Q1ZA 2DVIA 4LFCF 1HE8B 2PPLA 5T3YA 2FHKA 2OGTA 1G8YA 2YPZA 1ZD3A 1QH9A 4G0YA 4IZHA 2VQFF 3DOOA 1ZICA 1DAKA 2HAIA 1YVEI 1VK8A 1EFRA 3STXA 1PR0A 1M2KA 4X62F 3L7KA 5AHRA 1D5CA 4USHA 3P0JA 3E22B 2M5YA 4KFBA 4D45A 4UT4A 4HNSA 3H7IA 4YRGA 1M1YA 4LF9J 3E9DA 3DHNA 1Z47A 2PNFA 3PJRA 3MUNA 3OBBA 2BMFA 4GQBA 5JALA 3IPAA 3JV7A 4H6VA 4P93A 5IYZA 1E1MA 1YUMA 2YTCA 4YRFA 4B83A 4U96A 1SQEA 4UAUA 2K87A 4UUQA 4H7KA 2PS3A 5ALUA 2G0NA 5C0OE 4XWAA 4OYIA 2HQOA 1CUZA 4BEWA 4GX2A 3JAWB 1V3TA 1G3OA 4KNYA 1KQNA 3I32A 1FFYA 1L4HA 1TUBA 2GHQA 1G21E 2W4QA 1U3UA 3LC0A 2BKUA 3V6HA 1L8XA 2M9KA 3K5MA 2RUGA 2G83A 4YK7A 2XZWA 4L51A 3EZNA 1ZC4A 1FU8A 1Y63A 1RYYA 2AQIA 4HY3A 3TO8A 5CB0A 1U1KA 3U44B 4YN3B 2CK3D 2KYRA 4OQNA 1CJBA 4RCYA 1XL1A 4CTKA 3VRHA 1G6HA 2Y93A 1T9YA 1VL1A 3PFGA 4IOLA 2BFMA 3OQJA 2XGGA 1I2CA 5KJEA 5THKA 1T4MA 5B1YA 1B8VA 4DNXA 5DO2A 2PSJA 4LMBA 2V7QA 1NATA 4QDKA 4IKEA 3IS9B 1R9NA 4Z4HA 4X3PA 4DV4J 1PS0A 4ZKDA 5IK2D 3HWWA 4BCCA 1VKOA 5AXMA 4A92A 2ES4A 1L3BA 4ZTBA 4JUAA 1UCNA 3H8WA 2P1DA 4X44A 4BV8A 4UUMA 5TJ9A 4Q1BA 3CSSA 3I28A 2Z2JA 3JWEA 1GUFA 2AJBA 3KALA 3V6LA 4ZVSB 2WZQA 4DV6F 2O06A 4NBUA 3ITKA 1G4AE 4Q3OA 2APOA 1HKHA 4IDQA 1W2WB 1PYDA 4UQLA 3SR0A 3T5BA 3KLGA 4M5MA 2AD1A 1CJKC 4QBGB 4JJIA 2G7MC 1Y48E 2FSPA 1K7SN 4J29A 1V71A 2OOSA 3O4JA 5KYXA 5CVCA 5TMPA 2HK8A 1PCXA 4AJ1A 1X7DA 5G4DA 1YRYE 3R3WA 2I2YA 1DBSA 5BSWA 3HVIA 3FPHA 2I3BA 4LWZA 1H2TZ 1GCIA 4I8XA 2G25A 1OWNA 5JVDF 4DN0A 3WL5A 3CCZA 2WWGA 2VOPA 3WE7A 2HD4A 1AUPA 5IT4A 5FTLA 2EC5A 1W0CA 2W9BB 4B35A 4GX1A 2B7BB 2QVLA 3ZNQA 4CN9A 1JSXA 1K2VN 3UVEA 1JIHA 3TO5A 4BFXA 2FWAA 4H31A 1F12A 3GK3A 4A0QA 1ZO8A 4JVLA 3QKRB 4UJ5A 5A4KA 1WVIA 2ZKLA 3EVWA 2D1CA 4OMDA 4DXDA 1VLYA 1DAFA 2QN1A 1A9RA 2XSJB 4HTFB 3IAM6 4JYBA 2HO5A 3FOCA 3AZQA 5SZHB 3QA3E 1IXYA 2AJQA 4ARCA 5HIJA 4LF8J 3ZXUB 1L5ZA 3IOEA 3V4VB 1AMUA 3IOMA 1YCFA 3AFOA 3VC1A 1FVQA 4D98A 2P6PA 5ABPA 1Q77A 1W4BA 3E1SA 3JTEA 4FQ5A 5JCJD 3ZXIA 4R2JA 1NK5A 2BRUA 2F3RA 3E7DA 3I9V6 1J4AA 3LP8A 3AUUA 2BGTA 3UF0A 1NJYA 2V7WA 2WP0A 4WPAA 4DV3F 2AEFA 3CMAS 5T6BA 5ECYA 3SIPA 2GK3A 2BZGA 3WISA 2FVSA 4RL1A 3ZJVA 2QC3A 5IVPA 1CHDA 2C97A 1D4OA 4KQHA 1VR6A 4KR9A 3REQB 4YV2A 2YDXA 3FUWA 3VR0A 5J2QB 2V59A 1MSWD 4B6FA 1O0CA 2WPNA 4KDCA 2I1VB 2DBVO 3EYAA 4D46A 1CUXA 3CYFA 1II0A 3TVKA 1U2DA 4OV6B 1U47A 3GCDA 1FWKA 5J4LA 2QTWB 3DMJB 1KDVA 2CJBA 2J7UA 5HK4A 1EFVB 2GH1A 1CFZA 4DOMA 2VYVA 1TZ0A 4QYSA 4BEVA 4JNCA 4HSEA 1FFXA 3WZ2A 1S76D 4ARZB 1E1YA 2Z8YA 3CLTC 3ENWA 4KFBB 4FFSA 3FMIA 621PA 3PUWA 4BYGA 5C1PA 2JLVA 2YV5A 1IUJA 1XZAA 3V42A 4IUDS 1YMQA 5LQRA 2AZMA 2QX6A 5IKOA 3JY6A 1YBFA 5DM60 3JYQA 4WERA 2QN6A 2J5XA 1PJCA 1VRVA 3Q0TA 4I08A 4NBSA 3LUDA 2PSEA 3VF0B 3PDNA 5E6SB 3HUEA 4B4DA 4LJAA 1RZMA 2JBAA 3TX2A 3SAJA 4EB0A 1U6FA 3H8SA 4P4UA 3I96A 4RZRA 1A97A 3GWZA 3L0ZA 5T7BA 3N1UA 5AI5A 1DFIA 3HC7A 4R31A 1T8SA 3RRGA 3PT9A 5LM3A 5LNK1 3VAFA 4TQAA 4DR2B 4LR8A 3LQ4A 2XWSA 3V8QA 2B36A 4DNOA 4NV1A 4PYLA 1LNSA 2Q6VA 4CQMA 3A3NA 4IO1A 3RDPA 4G97A 3QV2A 4K4YA 3PJ9A 3S2FA 1P4RA 4I6GA 4NNOA 4GR4A 1CG6A 1KZ9A 2GLXA 5HS6A 4IJVA 5D8DA 1WKLA 2BA9A 1J00A 4W1QA 4R7TA 2SKDA 2RILA 2X7HA 4EFNA 1WVGA 2XCPA 3OJLA 3N8NA 1Y8CA 1QNLA 1RBMA 4ETZA 2G0TA 3DTVB 3OOJA 1D9AA 4QUAA 4EGSA 4KQGA 3W78A 2P2DA 1H65A 4D5EA 2OPRB 3I52A 1RAOA 2XNJA 2P4EA 4I4BA 5EP2A 4OV1A 1QB8A 3BEOA 1EGAA 3L93A 4C7BA 1DIGA 4MAMA 2ZE5A 1WI6A 3V2UA 4L8WB 4IIDA 1UL3A 3T1VA 4QEZA 3LQRA 2UXCF 3IMQJ 5K0JA 3I55S 3E53A 5LJ3Y 16PKA 2KQUA 3BREA 4HWTA 4ND8B 2R8YA 2ZITA 1D7AA 2FEKA 1ZSVA 2YQZA 2HDHA 4BP3A 3MMNA 5F8GA 2GFHA 1SBCA 3LRTA 2RGAA 2W6OA 1LSJA 2VAPA 4WESA 1V3SA 1XCGB 3ZE7A 3JQ6A 3M9LA 3X3HA 5HM8A 4INAA 2P6RA 1GR0A 3ENKA 3IT1A 2ZIVB 2DGTA 1T4BA 4CEJB 1SBHA 1L5QA 4MEAA 3MJHA 3QVGA 3Q3VA 1YJNS 4H7EA 4KRXA 1E2BA 3N75A 3DJYA 2O2YA 1WZ2A 3AT1A 5JMWA 3G5UA 5L1KA 3S6EA 4KPGA 1EMDA 2HLDD 4FB5A 4ID8A 3ZDFA 5EJ7A 2W98A 2K06A 3Q8KA 4TKLA 4ZHSA 2G04A 5AOBA 3C3PA 1N7IA 2WHPB 2BM1A 4K9MA 2O23A 1Q0ZA 1H94A 3O84A 4LPKA 1DC7A 4BFVA 2COLA 1IJEA 2P6UA 4A1FA 1ZD1A 2R00C 3BMNB 3AIOA 1RISA 1Q6YA 3MPOA 4NS4A 3HJGA 2B1IA 1ZNQO 2XZDA 3QFSA 4QM6A 1NOJA 1JJ4A 4FUTA 3QEOA 5A6PA 3ESDA 1KERA 3B9QA 4PO1A 3R2JA 3WSWA 5A71A 4RU9A 1E9AA 4D42A 4B3TB 2A9QA 2A0FB 4N9QA 2OYSA 3FNIA 3WL3A 1ONSA 5K0CA 4MV3A 4G1QA 4BU0A 3INRA 3AH6A 4IXWA 1NQAO 4N5IX 4ONEA 5LU8A 3MW8A 3VR4H 1YL5A 4LC0A 4FKYA 1ZW6A 1ZA1A 2XVZA 2BFAA 1VHQA 3IJRA 1AXEA 1L4YA 2QTVA 1JDJA 5F21A 5I7WA 3VJKA 1VCIA 3UXHA 3R6GA 1S79A 5K51A 4ILMA 2PN6A 1BHNA 3VV2B 1Q2UA 2RAQA 1LWCB 4F1KA 1IBMF 1TKRA 4Z2YA 1VSTA 3D0HE 2HMSA 1RU2A 4MKFA 3BB4A 2F4VF 2GA8A 5BRJA 5KYGA 4Y0VA 2WUEA 1XYYA 4F3RA 1YZHA 5CLLA 1NQOA 1BQEA 1Y3FE 4ED1A 2JATA 5BSEA 1UEUA 4L3OA 2J32A 3CUVA 3O38A 1S1UB 1KVTA 4WZMA 1EX8A 4O8ZA 1C9DB 4MTPA 1UAGA 3EMBA 3L8EA 4KKXB 3CUKA 2BJ1A 1T9WA 5EA2A 1P1TA 5ED4A 1SC3B 1RJ9B 2R62A 4OMUA 4EZ9A 2UXDB 4ZS6A 5B08A 3V4MA 1FESA 1P9QC 2BFCB 1OASA 3SLRA 3UAXA 3WFJA 3RB0A 3O91A 2IWHA 4PGGA 2NU6A 2W70A 3A6JA 2ZIEA 2YKGA 1X77A 2WYOA 1TMKA 3B5EA 4XM1A 5AI0A 3HU2A 5CT9A 1FSGA 2OILA 3H19A 1DQAA 1WS6A 3RFTA 5A4FS 1UP6A 1RB0A 2L69A 5GAGU 1RYNA 2I4LA 4QT4A 2RH5A 2GGPA 4DDTA 1XMOJ 1XALA 2MOKA 1TJ5A 1S10A 5TVGA 2VLIA 1ZR4A 2FRXA 3W62A 1PGJA 5LJ5Y 2X76A 1Y7IA 4ARAA 5EX3A 3HVJA 2FSVA 2B1GA 2ZUAA 3K15A 4OIMA 3CJQA 3U9TA 1UBOS 1SH7A 1FE8A 1MO3A 3ZD9A 1O4WA 3PHJA 3GIKA 3FIJA 1I2DA 5IXUA 3EOBI 2QTZA 3RIHA 1KHVA 4MIWA 3IKTA 4IGAA 1LEOA 2JGJA 4O3RA 3OQPA 1PYOB 4XM2A 1URNA 1WF6A 2RG7A 3H05A 1Z63A 1P6XA 2DR9A 4UVGA 1Y0HA 4XCXA 4A1OA 1L5HA 1KDZA 3U81A 4JVNA 4X4SA 1KVIA 2VTKA 5KG5A 3DHXA 3C7DB 4P6QA 4OHOA 3ELHA 1Q5VA 1NXSA 4DPYA 4QQ8A 3JYPA 3ADAC 1IU9A 4WGGA 4DSZA 3HPRA 4UC0A 4BATA 1EM8B 4HKQA 1CKEA 3NDBB 2WE8A 1HD0A 1YZ7A 3KOUA 1G8JA 4WK1A 1XMQJ 1Y3JA 4FU0A 2B37A 2EATA 4KQFA 3I72A 3IELA 4UUPA 1GTEA 4I1IA 1XZEA 3DOMB 4X66F 2VT2A 2FFAA 4NBWA 5T5QA 1QG2A 2NVOA 5CZXA 2LRHA 4WBSA 5JATA 2VUTA 4FE7A 4B8YA 2RF2A 5L3QB 2W8KA 2ZQYA 4IFEA 1VIOA 4P82A 4HMOA 1SD5A 3G2QA 2J8ZA 1IBMB 1XFDA 1ZMXA 3I0SB 3OVMA 2XRYA 4EK9A 1GAOA 1E0JA 4F2GA 4U9IS 5DIZA 2W0MA 3VNRA 4DHEA 1U1IA 1MC5A 3ENZA 4O4GB 1KS2A 4C3ZA 1O1YA 1QU3A 1IWPB 2VODA 3ONEA 1RIFA 3RSQA 1ZG3A 3LPNA 2MQPA 4LVNA 1H0RA 1Y5IA 3QKIA 3EZYA 3OFJA 1W1UA 4LOJA 2MR5A 2Z3VA 3COJA 4OI4A 3DD1A 3SCKE 2XADA 2ZTLA 5E6UB 4GXNA 2JNWA 4MKAA 1J5OB 4G36A 4L85A 4E33A 2GHPA 1NF2A 4MQBA 5E3IA 2VC1A 4M0EA 3SC3A 3OOHA 1PUXA 4U6SA 2F7VA 3QU2A 1FJGF 1W94A 5ADWA 2P1ZA 1IOZA 2QLLA 1OBVA 5J2UA 4QM7A 4AZWA 5F1OA 1VIAA 4MROA 3V9AA 2LKZA 1CV2A 5HCUA 3CJTA 3PPYA 4PYRA 2C42A 1RT2B 4S1WA 2UYHA 2GI4A 1S2LA 4MVJP 5ETSA 1K92A 2QN8A 2AJ0A 4V0ME 2QRQA 4J9MA 3GUVA 3I31A 5UKDA 2DRDA 2VOEA 1FYVA 1N1GA 1IQUA 3B85A 1KI8A 4MVJM 3QLVC 2OPPB 3KKQA 4A27A 4RZSA 1IXKA 3GU0A 3SBMA 5K20A 4KIJA 2VSXA 1HHSA 4XUEA 4A6XA 4K8OA 2BSAA 2N7YA 3R1IA 2VHCA 2G6TA 1AQJA 3AEZA 1HYQA 4CIXA 5EJIA 1TQHA 4YP1A 1UWCA 1G8MA 2ETVA 4BX8A 3ZZYA 2Q5IA 2UP1A 3IVCA 1ROFA 4B9UA 1M66A 1KQOA 3X1DA 3MCUA 3MAQA 1W5SA 2GZMA 3K6RA 2IBKA 4AWXA 2DUWA 3E51A 1H6DA 2IHKA 4BWGA 1RT2A 4CO2A 3H99A 3M6IA 3JWJA 1OX4A 1SXPA 2X4DA 3W2VA 4RW8A 3ZHRA 1I6LA 2M7SA 2JC3A 4H7JA 2I7TA 5I9IA 3TGLA 3QEJA 2UXCB 1VBZA 5JJCA 3GCWA 1CR6A 4CEHB 4LJ4A 1R50A 1NVDA 1NFRA 1BE1A 2ATIA 5EIWA 2AFHB 3P9CA 4A0SA 3VX4A 3CNOA 5KFIA 2YWGA 4GPBA 2ZE6A 3RU2A 3EFEA 4EYIB 2PTHA 1WULS 4NK4A 4O3SA 1TDJA 2GK7A 1O94C 2P5VA 5IT0A 4NRDA 3QKRA 4Q24A 1JMYA 1S9EB 1URPA 4YMVA 1RMQA 3RHZA 5DLYA 1U2CA 2CPHA 2WD7B 3ER8A 1NPPA 4FF2A 4TKTA 2WV7A 1J56A 1TRHA 2GETA 3EE6A 1G7RA 3NP9A 4Y2SA 1KQFA 4ILEA 3GJ7A 4NLSA 2O7VA 4I1UA 3BHIA 5JVGQ 4UHCA 3W0LB 3LQ1A 1GTRA 4CMCA 2QDXA 5NULA 3EUFA 3N2IA 1P1LA 1Q1KA 5B58C 2J3QA 1QE0A 3NJ4A 2M88A 2CDRB 4OH1A 2E87A 2UVPA 2WG0A 4PSUA 1KJ8A 3K1AB 4P81A 1UQUA 3D5EA 1KC8T 1D6SA 1MROA 3A1UA 4CFYA 3FIUA 3DOEA 4CDGA 4Q43A 2DNKA 2X0RA 4OQXA 4ALNA 3TGWA 3OKAA 1L3UA 4ANCA 3HU1A 3Q5EA 2NZ2A 2HQGA 1WWHA 3UXYA 1FX0A 1TVKB 4UNQA 3TLXA 2BM8A 3ZKWB 3U31A 3EPIA 4MUIA 4NEGA 1PG5B 3KU1A 2YKMB 3P5TL 2P6MA 1H73A 4DCCA 3DAYA 3HHLA 4K4XA 2FU5C 4MPJA 2HKIA 3FSJX 5C8VA 1FXDA 1VPEA 1CDEA 1HDIA 2CHFA 1CUGA 3W1YC 5JISA 1NBEA 4RVCA 1ULTA 3PZBA 5CA0F 2NACA 3SHQA 1U63A 2ACWA 2CQGA 2VHWA 4QR2A 1OV4A 5U4XA 4OXXA 2JIMA 1RAFB 1Y3IA 4IHQA 4V0KA 2VA8A 4W8OA 4E22A 2VK1A 2RGCA 4PANA 3CQ9A 2DJIA 3Q10A 4B8ZA 4TZ0A 3UNXA 4AZ3A 3BRSA 4H7IA 2ZVJA 4TMTA 1GNSA 3E5MA 1K68A 1K0TA 5LWHA 4YCDA 3G9TA 3HNRA 4HXEB 1DXHA 4I4IA 4LRXA 1EP2B 4PSDA 1VLZA 5DP2A 3KXKA 4I5EA 1PQYA 3UYLA 3SY8A 5B3KA 2H5JB 3S6JA 1SI9A 2QM0A 3ON5A 3EIOA 5C1IA 4CO1A 2W0SA 4QBTA 1YDWA 4Z0PA 3G23A 2XOEA 4Q93A 1J8DA 3ZIAD 2JNJA 2NNLD 5HRCA 5DSXA 1FMFA 1F7VA 1Z4OA 1QS0B 2DNYA 4RPIA 1PJRA 4J4HA 5FH9A 4EDFA 3T3FA 4EMTA 2ZBIA 2OFPA 1BC5A 2O54A 5EIBD 5CCDA 1PX0A 2IS1A 4Q0BA 5LDHA 3QIPA 3UMVA 2P5YA 4HTAA 1WHXA 1D2EA 4WN9A 1XCLA 4J7AA 4NENA 4I0WA 3HR7A 5JC1A 5HJYA 4QBUA 1S6QA 4MVJG 5JLJA 1AQNA 1G42A 4V3CA 1WDLA 4DIDA 2IEZA 3FBBA 4GLBA 3GMGA 4INOA 1MB3A 4G4JA 1YHNA 4UEKA 2G9RA 3KJFA 4XAKA 1NMSA 3ZK9A 4P52A 5JAIA 2Q0SA 3B9PA 1N2EA 2FQYA 1CZHA 221PA 4RXMA 4XRRA 4M0UA 3RAXA 4DM3A 3CVOA 3G5LA 3IQIX 4XXHA 1SIUA 3TCXB 1FSSA 2FGCA 4GO1A 4L8FA 3KHHA 3F4BA 1KQ3A 3A1TA 3EVMA 4NDAA 4DR5F 1H2EA 1XMJA 2DPYA 2I03A 3BE4A 2G80A 4YPOA 1P5HA 4RXUA 5JMNA 1I5OB 4PRLA 5TY0A 3IRXA 1KPHA 3WAGA 1WQ3A 2G5GX 5A8WA 1OZFA 5DRYA 4TVAB 5BUZA 3SR4A 1F5AA 1JWLA 2YNHA 2ZQ5A 2ZRKA 5EUMA 3V3TA 1YUBA 2C8KA 3K0EA 2NG1A 5B64A 3WYAA 4IDFA 2PQ0A 3QPAA 3V81B 4YMHA 4DCOB 2GD6A 5LQSA 2FVCA 2J45A 3K4QA 1NM5C 2PRKA 4CM4A 1N1MA 3RUEA 3QVOA 4WCDA 2P9QA 1L7AA 3H2ZA 4N8SA 2CJFA 4J6EA 2VHGA 4DV3B 2V68A 1C1CB 2BRUC 1YKGA 1OIVA 2XTAA 4B9VA 1G0NA 5BP7A 1F17A 4F4CA 4DG8A 2VICA 1P2FA 3C14B 1U28C 3CLSC 4Q7EA 2O8FA 1J49A 2ZI6A 4O3QA 3WK4A 1WELA 5K8JB 1TUEA 4YMUA 1S49A 1I2ZA 5CFRA 1XJWB 4HUJA 1B6SA 4RD4A 5A8WB 3UTDA 2VIHA 4C0OC 2VBZA 4MB6A 5INTA 3MECA 3ST7A 3ZVKA 4BJ3A 1XWFA 2CLIB 2ONKA 1K9VF 5HJ7A 3ETGA 4X20B 2A2DA 4DNQA 4AP9A 1GR1A 4G09A 4QWBA 3FCEA 1UEKA 2VNHA 2ASJA 1WY7A 4AJKA 4FFWA 2HYIB 1RRGA 3WOHA 3SYNA 4D74A 2JHCA 2O7RA 3MQ2A 1K7CA 2QTHA 4HPJB 1S8AA 4NYJR 3MWKA 4GMXA 1IB6A 3TA1A 3H4BA 1SCIA 4J3FA 5F52A 2W2MP 3CLSD 3ZR4B 4EB8A 1KBQA 3HEBA 4PZCA 5FAXA 1E3TA 3UGJA 1FVHA 4WRRA 1UP7A 1GADO 3E2EA 1MC1A 2V9CA 3ZYZA 1SKUB 4RTSA 1AFIA 2AG1A 5K8UA 3QV1A 4PFJA 3R9XB 1RABB 4LE0A 1GQQA 2HI0A 4M46A 5H9EK 3MPDA 3ZTPA 1RU3A 1GQOA 2FRDC 4I7FA 2VH7A 4RKRA 3BCUA 2DNLA 2QGFA 4RGVA 1JFLA 4JCOA 2CC2A 2XMDA 1SKBA 4GXQA 1GNLA 1E5DA 3KQTA 4PQUB 4HT3B 1OJ7A 3CB4A 3NHYA 3LA8A 1JJHA 2C58A 4Y30A 2V7VA 3OTHA 4IEFB 1NKBA 1FNDA 5FJ4A 2I55A 1VA4A 2VH2A 2HVIA 5ES4B 1JQAA 4FSXA 3JQ7A 3W6NA 1VRCA 3LHFA 2D2XA 1UBHS 5FRDA 1PSWA 2K3IA 1I3KA 2HXSA 4OFWA 4QU7A 5THWA 3ROFA 5IH7A 3ME5A 4ANFA 4X1KB 1SL0A 2ZRPA 2PMWA 4XARA 5FADA 1CVJA 3ZHVA 2BHNA 3QP9A 2HEKA 4Q3BA 2JFPA 2BEVA 5JNLA 2DX7A 1ZDMA 2KM8B 3DE2X 1VHTA 2P4UA 2D4HA 3AB7A 1E77A 3JYTA 1GA6A 4F72A 4WFQA 2WAYA 1O89A 4L5IA 8LDHA 1LXJA 2OGWA 2BKLA 2GV1A 4BAZA 1JDPA 2O3SA 1ADJA 1GEGA 3EMKA 2RHOA 3OPKA 1TYEB 2Q29A 4IIJF 2F55A 4UHEA 3RVLA 3QRPA 1T3ZA 4ZOBA 2RQCA 4NJOA 3RU9A 4RBNA 1HZZC 2HEGA 5CD1A 1MD9A 4J2HA 4OGGA 1HQYE 4WDQA 2VG7A 1N5MA 4OBEA 2BTQA 4MK8A 3HYNA 3RSZA 4JN6B 2YV2A 2HNAA 3N5BA 4E2XA 3SYRA 3CVKA 1C8VB 2QD5A 1DC5A 5KTOA 3LYUA 3NOCA 1M0SA 5P21A 5IVHA 3KYLA 3QX7A 2G9OA 1AURA 2GKOA 1Z4MA 4XD7A 5CA0A 2X1MA 1V8OA 3PRVA 2X0EA 1AX9A 1BOFA 3B1YA 1AXRA 4IDKA 4PG5A 1MHTA 2OCLA 5EWLB 1YGYA 4DAEA 1WW8A 1HETA 1Z75A 4P75A 1HOXA 2QVXX 3KLIA 4JI6J 4BKPA 4YMLA 3L7UA 3AY6A 4KVGA 2N47A 1W8DA 4AF6A 1CIVA 5HMYA 1C9EA 3PQ7A 4R2IA 2BKEA 2CNDA 3GEPA 2UZ1A 5AM3A 1IK4A 4ZLJA 2NXEA 3L6UA 2AD9A 5D3GB 3A3KA 2YOFA 3Q3EA 4YRZA 5IAKA 3RUIA 3DFUA 2CQ1A 4ZT7A 1TQ6A 3F56A 1LJLA 4B08A 2XODA 4OJNA 5K0GA 1KI6A 2IU4A 2P79A 2UYCA 1UFQA 3QGGA 4KK4A 1KJ9A 4BVBA 3QQ5A 4J1SA 1SZPA 2H9IA 4KH0A 4YJ2A 2R7KA 1H3EA 5KDLA 3ABSB 1Y89A 1HE4A 1NP7A 2ZYAA 3OTWA 3LQKA 1KQSR 1FUUA 2GIFA 3NKFA 4NONA 4TT3A 1RYEA 3ZGZA 4IDBA 3NATA 4ERNA 2MZ1A 3UWKA 2HQBA 4TXLA 4DV2F 1SC9A 2VBIA 4E8UA 4L57A 4B6SA 3ZGOA 4H0CA 5LA6B 1I6KA 1K7XB 2D5IA 1RZVA 3MM7B 1TJNA 2L3MA 4X66J 1S6PA 1C1XA 2QRMA 1G2IA 3M2UA 2IYOA 4E32A 4JI5J 3AF4A 1QH8A 4BNIA 2X0DA 4MS4A 4DV1J 1G2EA 3DMTC 2YQ0A 4MK4A 2Z4RA 4JSYA 5IJAA 3IG1A 3WY9A 2QWXA 1T5BA 3E61A 4I3FA 3Q72A 2PUTA 4M6WA 3D7SB 1YR1A 4WOCA 5EHNA 4KFRA 3AOBA 1FKPA 4MRNA 3MT8A 5D0EA 2R7QA 3QVJA 3DZIA 1TCUA 4AYTA 2D1FA 2BR3A 3W8GA 4K8RA 4NMLA 1N7GA 4XDZA 4JI4B 3NBUA 2CZCA 3Q0AA 3H3XA 2CW5A 1RYMA 1WSWA 5TF4A 1T9XA 1VP9A 3SCIE 3E3OA 3GJQB 4ZZ3A 2GQ0A 1YZTA 4N3CA 1GU1A 1ESEA 4RY2A 1HL3A 4KH1B 5BSUA 2BN4A 5I4BA 3NCQA 2FVYA 4B84A 4BBJA 2JS7A 4JI1F 5JYCA 3UD5A 1C2PA 4L9WA 3HHLD 1WHTA 3QBVA 2FB0A 1MAVA 5B0GA 2ANBA 1MTZA 2R8ZA 3D3CJ 2O52A 3JQEA 3FSXA 1WDTA 5CYMA 4K3UA 1KYIA 1N5YA 2KMLA 2Y3IA 3V46A 3WL6A 3SDBA 2R2SA 5B09A 5DTJA 3WGJA 3A3YA 3KKEA 2LKDA 1LTHR 4YHHB 4GICA 4RV9A 1XXHE 4Q9HA 2ZTMA 3OJCA 1YQTA 1IJKA 3CULA 1E4YA 3NAMA 3S1TA 3BZWA 2GZSA 1S1WA 4QARA 5FI3A 3UO8B 7AT1A 3AOEC 4KGZB 1DKUA 2HM7A 1J8VA 2OMKA 3ZUGA 5KNLA 2NMVA 4ENVA 4HB3A 1ZYUA 1HLFA 4RPFA 5PNTA 2CVQA 2BMVA 5CR9A 5M2RA 1S1VA 3QPVA 3WB0A 4XUGB 4PPGA 4PSKA 3U5ZB 2VA3A 5B6JA 5H9EJ 2DPIA 3GI1A 1U2EA 2VF2A 2O2GA 3VU9A 1PV2A 3B20A 1KO1A 4B34A 2W4IA 1AK9A 5F1PA 4RZ2A 2FPSA 4NMXB 2E4AA 2FP4B 2FPPA 1QTQA 2QMYA 1RJGA 3CG4A 4RCZA 4YO8A 4LF4J 2H18A 4DU8A 3U4MA 1P6UA 1Y0BA 2NYVA 5SY6A 6FD1A 5ERYA 1I7SB 4LDNA 2FLVA 4DV5B 1BJTA 3LT0A 4A6DA 5E4JA 1L7MA 3UCGA 5REQB 3AKEA 3ZQKA 2C2GA 2FVRA 1VFNA 2FN3A 1DLIA 2V0CA 1D9FA 3ND7A 5K3CA 3NTQA 4C9DA 2OD2A 3KLIB 5ADUS 1E5VA 4PLTA 1EFTA 4LIPD 4AZSA 3KVRA 5DGIA 3HVTB 1TM3E 4NXMB 2PGAA 4BN4A 2R4TA 3V4RA 1PBUA 4GVLA 3TI0A 2MB0B 3O03A 2Q1TA 1QGDA 2X9QA 2HHTA 4KGVB 3AR8A 4QXOA 3WLPA 2HL6A 2E5LJ 1PJBA 2QE7D 4AECA 3C8DA 1IEVA 3CLUD 2Z4SA 1C3EA 4ZN3A 1U4BA 1TT5A 1XNRB 5C5JA 3KUUA 4G0XA 2HWIA 5TX7A 1RS0A 2FMHA 1P44A 3GIWA 1LW6E 3U17A 3DXSX 1QONA 1QFYA 2H3EA 1N9GB 2RRAA 2B6NA 2J3LA 4NYJQ 5E3CA 5AJUA 4DBVO 2P3OA 3IIMA 3BVPA 4CETA 1JA9A 3ICPA 5SZKB 1AC5A 2VSNA 4R84A 4C8MA 1FJEB 3TE6A 5D7NA 2PIAA 4YROA 3BC1A 1TAUA 1Y4UA 3GP8A 5D2CA 3G5MA 2AOUB 1T94A 4Z9XA 3UGQA 2XB2A 4TS4A 3EDRB 4B3RF 2WBMA 2A67A 3TX0A 3EQ7A 4Y2VA 2BEWA 3DOMA 1JN0A 4PTZA 2MINB 4CG1A 4DQRA 1BD6A 2GWRA 4Y1RA 1HSZA 2KBFA 4MVJE 2IYLD 4UAVA 1NPYA 1TQ2A 3TNFA 2M0GB 1QV9A 3HP7A 1DJNA 3BK2A 2QJOA 1AM4D 2GC8A 4K6OA 5AK3A 3V2UC 1NP3A 2G1HA 1TTHA 3C15A 2NTNA 3IP3A 3MAJA 5I3QA 3JXEA 2WSEC 1JQ5A 3I0NA 5KNDD 1SC3A 3PC6A 1R6VA 2XXAA 4LQ9A 1YZVA 2M2BA 3HFSA 2EG1A 3CH5A 3E2MA 3BD6A 4B4OA 4D9JA 2CL5A 1V48A 2CBGA 3EARA 3R6LA 1NW6A 1T9HA 3C3DA 3ZY2A 3PKIA 3EHEA 3QELB 1NYRA 5HQMA 1OQ3A 2AFIE 1NXPA 5LXTB 1TU4A 4NOKA 4UU8A 3K8OE 3S8EA 1HO3A 3OM1A 1Y4ZA 1N48A 4UU7A 3OSPA 2VBXA 3FZQA 5CH8A 2DCMA 3LUBA 4ER5A 1HBJA 4WLOA 4QYZK 4ZT6A 4WNAA 5KX5B 1X1BA 2ECOA 1FRMA 3HXLA 3OT4A 1WQ4A 5DYGA 5FP0A 5I7HA 3RUHA 1H72C 1UK9A 4Y2XA 3MPUA 4O3MA 1S1CA 3FNEA 2PJZA 3MTBA 3GVXA 3INGA 3ORHA 5KOJA 1EK2A 1B6TA 3E4CA 4DDVA 4YT4A 3KUHA 1ZKMA 4JUCA 1BQ3A 3L4JA 3FPGA 1U5BA 1NK6A 1Y8AA 1H0KA 1KDNA 2C28A 3LH5A 4NENB 3TUPA 4KPYA 2C2BA 1KQGB 2GCOB 3O8RA 5DZ6A 3JATB 2PPVA 2XUAA 4F6LA 5CQGA 4KGKA 1QHIA 4B44A 3HB0A 4FZJA 1ISHA 1GZSA 1IIRA 3OE4A 4LCEA 1KMQA 2DRIA 3ODPA 4G4GA 2AN5A 3C15B 1AKTA 2V45A 4NNJA 4XTCS 1OLOA 2Q8PA 3I5MA 3JD1A 5KBYA 4G5HA 2MZQA 2IEAA 4JBNA 4FW9A 5AQ1A 2XT9A 1R0KA 4JC0A 3A4NA 4IOKA 4KQ6A 3PKJA 2WU3A 1SCAA 3TK1A 1UOOA 4B3CA 1EX9A 3OD2A 1TUBB 2V9PA 3W9UA 2Z5VA 2LQ5A 1KOLA 4D3XA 4YONB 3GEMA 4M53A 1A4RA 3FOFC 1ZOTA 3OZAA 4UNNA 5BO5A 4C11A 1Q7BA 4N12A 2VR1A 3G89A 4M9SA 3V00A 1AKRA 2BE2B 5CB4F 5KFVA 1V4VA 3DZBA 2YOGA 4JBCA 1DWQA 1WG5A 5AE2A 1UW4A 4HLBA 5AK4A 2LXIA 1EWVA 1L5SA 2HRYA 1YD7A 4L0DA 4ITVA 3QHAA 2KB2A 3QPBA 2AJLI 1GL9B 2N4DA 1OVMA 1QE5A 2IAJB 4EPRA 1NX6A 3VDMA 3WIVA 1PW7A 4P84A 4MITA 4P86A 1NUQA 1FUIA 3EVZA 3I73A 3D43A 3MT9A 3W90A 4KJIA 4JI3J 4CYUA 5L3QA 1NMYA 4EB3A 4N1AA 2FJXA 3D2BA 3N87A 4M89A 4LTDA 5JXGA 4FOLA 4X00A 5PGMA 1OH5A 1P7PA 4YBZA 4JOQA 1YZFA 4EFDA 2C3YA 4D8TA 4CF6A 5CYGA 3D5TA 4WTYA 4P0TA 5E2IA 4HVLA 1QLHA 1HARA 3HH8A 3DOKA 1OSNA 5G0VA 1KEEB 5J5CA 1K5GA 2FR1A 3LFUA 1PEYA 4H7FA 2IPOB 5I45A 3E1GA 4YV1A 2E4WA 4YRQA 4W6ZA 4B6PA 1ID8A 4RTKA 1VISA 4PXEA 4MMOA 3Q11A 3TAPA 5KEIA 1CLUA 1NO8A 2RH9B 2UZ3A 4GX0A 4RAQA 1RWQA 5TRTA 1SKMA 1NWHA 2YUIA 1DOZA 4MH0R 3ZK8A 2YJNA 3EXG1 1H3NA 4J07A 1QAJA 4ID5A 2CB0A 3ZZUA 4GO7X 3TQOA 1E2IA 3QAUA 1T1IA 2HS0A 2H4FA 3PTLA 1YS9A 4NCGB 5GVRA 2YNFB 3BN4A 1XZJA 3I6MA 3K6SB 3OIVA 1M5VC 4X64F 4CZCA 1Z29A 5AMXA 1RHKA 1HE2A 4NE2A 3H83A 3AF0A 3RKRA 1HEIA 2GD0A 2N1BA 1W25A 3ETNA 1RZRD 1KU6A 3OTBA 1WO8A 1GZ5A 2FOXA 3QNMA 4NWBA 4EA7A 3ADCA 1E7SA 3H98A 3KKNA 3R0ZA 4Z4GA 3BV8A 1P4JA 4QRIA 5I9BA 4M1YA 2FN8A 2ZH4A 3BK7A 5CNJA 4MICA 4NP6A 1QGOA 3GG1A 1ZPDA 5TEVA 4K4UA 4CKWB 3AF5A 4Q7QA 3NUZA 5LM7E 3CCSS 2JAPA 4G0WA 1JG6A 1EIYB 3O4GA 3CLTD 3OQ6A 4W98A 4B85A 2ZJ3A 4ALJA 1NN5A 2IC3A 5L3RA 3VI4B 4IP0A 4ZHRA 4C87A 4N5HX 3DI6A 2H85A 1R0CB 1SNYA 3DLCA 4NULA 1U1LA 1FEEA 3THSA 5LLTA 3Q6IA 5KHAA 2UKDA 2VDIA 1B2RA 2V7TA 3CNQP 4RK5A 2C84A 4FF3A 4HZUB 3RVPA 4YY3F 4JOBA 2HBZA 1JUDA 5BN1A 1FP7A 4DX7A 1GPMA 3BUSA 2I9KA 4P7FA 4C0AC 5BUCA 3CD5A 2VQFB 1R37A 2YN4A 4QFDA 1X5TA 2PJRA 2G1JA 2E5FA 2WE7A 3AIIA 2QZ4A 3HCRA 4TKMA 2DR8A 1OXUA 3VR1A 1WB9A 2DB1A 4OX9J 3LHSA 2WU0A 4N03A 2WTEA 1R5OA 3P27A 1ENZA 2HFZA 1EXVA 3G82C 1CQIB 5M2QA 3U0VA 4K6KA 2BELA 3CJSA 3GXOA 4YCAA 4MH8A 4IR1A 4E15A 1QYVA 1S7HA 2CF5A 2DFTA 2W71A 3KUEA 2VKQA 1AF4A 3U48A 4JWKA 4AQDA 4BQRA 2VH5R 4AL7A 5IKXA 4JV5B 4YOEA 2KSQA 4WN9B 4HN2A 4ZYZA 1Z0SA 4ZEVA 1NE2A 2ZJBA 4C5AA 3ULKA 2IIBA 4MW6A 2R47A 3F2VA 4XX1A 3NP5A 2C8LA 1K98A 2O8VA 2IIQA 3R6TA 1XTKA 2KI2A 1FLAA 1YAJA 1VMBA 3GUYA 1JG7A 2PCLA 3OCYA 3LDHA 1CRLA 2C5HA 4IINA 2NLWA 1YGPA 3R3YA 3P20A 1L7NA 3OLQA 3KK0A 4RVGA 4Q3NA 1A5SB 4LRCA 1FX0B 1OD6A 1IXRC 5KO2A 1TCAA 4MS3A 1TZJA 3ZI0A 3IA7A 3PR4A 4MXDA 4UMEA 1WHSB 3P0IA 4HXYA 2J87A 4CP5A 1T24A 1Z4PX 1Q2XA 1V6CA 3KTOA 1Y10A 5HJ2A 1C0EA 2KS6A 1NI3A 2NU9B 2QLFB 4JU9A 1L8LA 4NLQA 3AYXB 2P9YA 3R7DA 2O07A 4G8JA 3C87A 4XUCA 3LWMA 3KJFB 4G9EA 4K0KJ 5F4ZA 3G9QA 4Y18A 2YPYA 2GHIA 5K3FB 1VE7A 4DB2A 4X41A 3TQTA 1USUA 3OLYA 3U5TA 4G37A 1UPMB 3DT8A 1TEVA 4IQ0A 2IZ1A 1RPAA 3PNMA 4MX8A 1SB9A 4RZIA 2ZDHA 2I3DA 3G0IA 3P4YA 3PSHA 1EAYC 5AKGA 1T3NA 4FGJA 1KSJA 1NVMB 4B2YA 3T7KA 4KWHA 3BBCA 1EXMA 2W2KA 2B98A 2WFMA 2RI1A 2CUYA 1U8XX 1X1QA 4LYGA 2V34A 3MURP 1CVLA 4AS3A 3O93A 2PRIA 4W5TA 5BXYA 4LMRA 4D25A 1NUEA 1U7DA 1UVLA 1TYDE 2ZYHA 4UZBA 1I8TA 5JAOA 1NZJA 2HFVA 1JXAA 4Y1FA 5SV2A 2OCGA 4DR2F 5EZSA 3SSRA 2QIFA 4Y9SA 1VP3A 5MN6A 1DU4A 3ET5A 3I2GA 3WX8A 3DXZA 2LA4A 3BKFA 1NBAA 2WHEA 1H1LB 4EWLA 3AM3A 3CXCR 4ZQHA 4TQSA 4URYR 5HEKA 4KQMA 1U8UA 3TE7A 2O2ZA 5JDCC 1SQ5A 3R5BA 4MUNA 2B2XA 3RS9A 2Q7OE 1ODSA 4QRDA 4TTSA 3NLLA 4QA9A 2R11A 2YVAA 1S4MA 3E0QA 3GJSA 2MSKA 1Q0UA 4DDFA 1F48A 1Q11A 2E85A 4TKUB 2DJWA 3M89A 1U4OA 3VBEA 3BWMA 3E9RA 1JLFA 5DI9A 4DSLA 4UOEA 5K45A 4FCCA 5T7LB 3KLGB 2HRBA 1X9WA 4LI3X 1KMHA 2AVNA 4UBIA 4X4VA 1WG1A 3GMDA 2OXFA 2GYUA 3KVYA 3DYBA 1BDBA 1EXDA 4USJC 3MNFA 1X9GA 1XU7A 3H4MA 2OEPA 2DO0A 3HG7A 3A4IA 4Z49A 4WKNA 3FLBA 2O59A 4P73A 4CUZA 1T35A 3JSMB 2DH7A 3GZ7A 4X1YB 4OLAA 1RI4A 2IYYA 4H54A 2VRCA 2OK7A 4MQ5A 2E1MC 3L4BC 5DYNA 3H2GA 1PF7E 5JAQA 4AS1A 4F4DA 2ONYA 5EGSA 3KPVA 4FVTA 5H16A 1Z2DA 3UG7A 1XCMA 5EIXA 1JNXX 2BR4A 1PO7A 3HHPA 3DOHA 1QHGA 5KQPA 1MRNA 1Z2EA 4CCWA 4DNFA 1T5OA 4TYNA 3QFWA 2QW0X 4YRNA 2AFIA 4DDMA 3THTA 5DLFA 4BN0A 3FAKA 1SVIA 5AW8A 2PUAA 3HLTA 4TV9A 1Q4RA 2C2ZB 4QWMA 2JEFA 5KQLA 1Z13A 2IS6A 1R8XA 5KYUA 2GPBA 2JFUA 2ERCA 2J0UA 4FF1A 4HYQA 2Q3FA 5HTKA 3LIIA 4XVHA 3DU5A 5EWGA 1XR7A 2EG9A 1MMFB 3ZBUA 1U8WA 2ILZA 1LBHA 2QGNA 5CA1B 4JX9A 2WD7A 3OC6A 1CY2A 2IHJA 4XQGA 4JGBA 1YBUA 3BXEA 1VE9A 1QB7A 1QFZA 1FSFA 3B36A 3K31A 1BC6A 1VM6A 4KRWA 2ZBGA 2AW5A 4KFTA 3LNTA 4GUAA 2GARA 1KS9A 2K2WA 3I5UA 4JCCA 4RKEA 1Z0IA 1W29A 5K3OA 5FWXB 4QUIA 3AIMA 2K4MA 3FMFA 4DQXA 5K6AC 1GRRA 1R2QA 4OH7A 3L0DA 1NQ5A 4B2LA 1UXGA 4RK1A 3V4FA 2JZ5A 3TVZA 1Q95A 2AC2A 1IJBA 3W2IA 5D4PA 4X65J 1FVFA 2B4QA 1SV5B 2O7QA 5AIAA 4YEDA 1HPLA 1UPUA 2NU6B 1LS1A 5JFOA 4L22A 2AHRA 1TK0A 4Z7JA 2RI6A 1JYEA 5BRAA 1YJRA 1EP9A 4ZQIA 1E6KA 1OLUA 1WKVA 4DS4A 5DNCA 4B2IA 1DC6A 4OHBA 3FMVA 1FHTA 4KUEA 1LWNA 4FYXA 3TIXB 4F7WA 2H5LA 5ETJA 1G1MA 4L0MA 4JQSA 5EIOA 2Q3BA 4XWYA 1A7KA 4NLRA 5HRUA 5ETRA 4BNLA 1QPZA 4BNVA 2XLBA 4BJ5A 1VL6A 4LJ7A 3O4IA 3BPSP 1JKFA 4DL9A 1VJCA 5EINA 1E32A 1FF2A 3H4TA 5GTDA 4C43A 4D9GA 1EWTA 1L5GB 4M22A 1CBKA 4ZVNA 3U19A 4IIYA 3NBPA 1EUYA 1G4CA 4MLCA 5CK5A 1II8A 2PZJA 3AR4A 2IU0A 1PAUB 1YO6A 5GP1A 3ZKAA 1KEZA 3WLRA 2ZBUA 5IJXA 3V1TC 2RGGA 4Z7YA 4LBZA 4DIFA 2XMJA 3SN6A 1RWPB 1YE5A 3R3ZA 5G4KA 3OCXA 3M6VA 3ZXSA 1U7ZA 1A0OB 3UJBA 4MGZR 5HRAA 2H48B 4PAAA 3T6JA 2IY9A 2LDIA 1S1TB 1PZXA 5IKEA 3MBKA 4A03A 1AUVA 3GA5A 3DEJA 3MS2A 1MKYA 2E5IA 3UJ9A 1LB1B 3ZDZB 3SBEA 2OPBA 1QV7A 3G2JA 3BKTA 4QYIA 1ZBDA 2MCFA 5IKPA 4DDKA 1E4EA 4MKIA 2E2WA 1DT3A 3NBPB 4G3IA 1UM9A 3LHKA 5ITZB 4HL6A 3G0CA 4G5GA 4L5YA 2OHGA 1LZKA 1RA7A 4MVXA 3PGKA 1R0RE 1AY0A 1V3VA 3NHUA 3KEFA 1AQYA 4OFBA 4E03A 1B2LA 1GSIA 1C50A 3HL0A 4RBVA 4GYYA 1JH9A 1OY1A 3H5LA 4YALA 1DJLA 2H8KA 2BF4A 2MY8A 2YQ3A 3TQFA 2AZXA 4UXIA 1FMCA 1ZOIA 2IV2X 1KHTA 3EQ2A 2IHR1 3IP9A 4ED3A 4YY3J 2RHTA 2OYCA 1ZC3A 5ARBA 1GZ3A 4WUTA 3GWGA 4HGNA 4JDUA 3AH8A 4X97A 3VVMA 1X1EA 1OWPA 2PHZA 1U7HA 5K3AA 1D8AA 4R9NA 2XITA 4H4KC 3G85A 4MUBA 1RC0A 3I9OA 3ZU6A 4JLUA 4F85A 2OI2A 3VPAA 2PL9A 4LBVA 3TD6A 1UIMA 3U61B 3U7JA 1ZH4A 2QVGA 5KOHA 4R5HA 1ZGBA 1MAHA 2GCPA 2RNEA 1WP9A 3AEKB 3QJYA 5IHXA 1OWOA 3CJ3A 2RIRA 3RK0A 3OIUA 4BFWA 3MMBA 3RVOA 5K8VA 1WEYA 3V8VA 4FCTA 4RQBA 3G13A 3IALA 4PPYA 4XQ0A 4ZZ2A 4P74A 1PS8A 1QO7A 2XZPA 3HVAA 1G9TA 4YR3A 3FKJA 1GQYA 4MJ7A 4JBXA 4CO3A 4F0JA 4A2WA 3QEMB 4YRSA 1M5HA 4CMBA 3V7FA 1VECA 1U8AA 4LKRA 1UA0A 4OQDA 5E38A 2YNHB 4Q2MA 1XMOF 2FUKA 3NCTA 3CXUA 1BE4A 3Q8UA 3AO0B 5KOYA 2XE7A 3QATA 3FBWA 2BJ7A 3TSYA 1KQFB 3QVSA 1X9HA 1O3YA 3JWIA 3V6MA 1HT3A 5AVQA 5BT8A 5HROA 4U2FA 1N2SA 4N7JA 3FYHA 1EYZA 4ZAZA 2H2GA 4YJHB 1V3RA 4CCSA 4CHTA 4CO0A 3SZRA 4TN5A 3GJQA 4D8VA 4D4KA 1E2NA 2VP2A 3JTMA 1IM4A 3PFOA 2OMLA 3PIIA 4XB1A 3PW0A 2RHWA 5DX0A 3SQLA 4ESHA 3D6FA 2J0WA 4WKOA 1RLOA 2RBEA 2DTDA 2FG6C 4OQ4A 1VCMA 1INLA 2GKSA 3WQSB 2JAUA 4FS3A 1BWEA 2O2XA 1Q78A 4DNPA 5H4GA 2GSWA 3ND6A 2VZ0A 3BRWD 3GAFA 3C2PA 2A6PA 1QDEA 5J2QA 1CFJA 5CGZA 5C8YA 2FY1A 1K0FA 1RT1A 2EFYA 2VPYA 4P54A 1L5FA 1BTOA 4V19J 5BMVF 4F2PA 3FQKA 5BN3B 4FDAA 4AM8A 2IRXA 3AZOA 3Q3CA 5J2TA 3L8HA 1BDMA 1L3SA 2W7OA 2QAJA 4V02A 4KQKA 3IV6A 3M7IA 1FOEB 1SJFA 2NT3A 1U26A 1S96A 4FDVA 3FOAA 4C8KA 4WI1A 3PEFA 2HLHA 3K8ZA 3PX4A 2GCIA 1QPGA 2WICA 3FKBA 4P31A 3CCLS 1S9DA 2Q49A 3KQMA 4LNUB 1QHEA 3N07A 3H84A 1XT6A 1DBQA 3WMEA 4DR1F 4JV5J 4ZVRB 5GV8A 5IV4A 2OQIA 1FY2A 1R8HA 4PRZA 4OHKA 3IUBA 2E48A 2KFZA 5JFGA 3L18A 4KPEC 1T8YA 2CCGA 1GCOA 4IIHA 3QQPA 1JAXA 3NHSA 1I4EB 3VO1A 2YIMA 3RC3A 3S55A 2HTEA 2PKRA 3R75A 4QYRA 2XUZA 1ODFA 3GLVA 1YZGA 4K9RA 4EVIA 721PA 3VGSA 1JALA 2XYQA 4RJLA 4CQLA 2VFSA 2PO7A 4HQOA 5ERGB 2OB1A 5SZIA 4JVSB 2VP5A 4EIWA 2DNZA 1LPOA 4X93A 2HLNA 5IH3A 5B1DA 3LCUA 3G02A 2CPZA 1E8NA 4FWIB 3HDYA 5LXRA 4KC0A 1ETUA 1NNUA 1DKPA 1TV6A 2A3RA 4Y1EA 2AV6A 4PNPA 1NJXA 4KYTA 5BNIA 3UMMA 3AOCA 4DV2J 2IEYA 4GI2A 2Q1WA 4UE6A 4M0FA 4C89A 3ESXA 4PR0A 1ZINA 2UZ1B 4LDPA 1HMVA 4DLAA 4LNUA 2DFNA 3WVNA 2H11A 1MOZA 1H2YA 4C5BA 1CJVC 4QOJA 4OUDA 2MLZA 3UKOA 4EKDA 1MU2B 4KLCA 2YBEA 3M1YA 3DV2A 5JS6A 4IRCA 1BLUA 1OPRA 4JUDX 1P5ZB 3D7SA 3ES9A 3V4OA 1TLTA 2FCAA 1VHDA 2FLOA 3HSZA 1RXEA 4BNKA 3AM4A 2XB9A 1FYEA 5DP1A 4K0KF 2Q5QA 3OWOA 3OWHA 5J2PA 1W4ZA 3JVUA 4ZKEA 1OLUB 1VMKA 3KQLA 5J2MA 2GZDA 4NEHB 3M6WA 4X91A 1PGOA 1SXJC 3OR1B 5LLDA 3P32A 4Z9YA 3G5AA 2CKMA 4CE6A 1IR0A 4OI1A 1JKXA 3PV0A 1D9XA 1E1DA 3RM3A 4X0EA 2E9RX 2Y0DA 1M9NA 4GVXA 4E5NA 1SZDA 1KFCB 1SXJA 2EWHA 3QIVA 3NHRA 2RAFA 4P08A 3GDWA 2AKAB 4V1CB 2C9YA 4KAXA 2NQ8A 1ECGA 2QL7B 2DQZA 5CDFA 1NI4A 3PJFA 3MZIA 2JIOA 3EXIA 2Q6OA 4E1BA 2C7QA 4IPTA 3THYA 2WBRA 2V6MA 1G1XA 2IEBA 3AHCA 4BRSA 1M72A 2WVDA 3EX7B 1CUDA 4AAYA 2GQ2A 1IBKF 5AW0A 5JNWA 5AHKA 1P1BA 2BBTA 3TNVA 4GG1A 5K6TA 3HTXA 2O0KA 3TOCA 2QRGA 1U3CA 4HQ6A 1JE0A 1GV1A 2QIOA 2VF3A 2ZBPA 1OIWA 1PDVA 5ALZA 2QHXA 1A96A 1JDVA 1EQAA 2GIQA 1USWA 1ZGAA 2H9AA 4R68A 2C29D 3JQFC 1ISSA 3DBOB 1N57A 4D4LA 3L3CA 1YJBA 3PO4A 2XDQA 4FFDA 4DV6J 1LV5A 3B2NA 5HXAA 1YK1A 4OJ3A 5C32A 1VRTB 4JLAA 4TYYA 1O97D 3ZZ0A 1IY8A 5EDWA 2VC0A 1M75A 1M2GA 4RM3A 5LFAA 5LXYA 2NZYA 4NZMA 4HAVA 3OIYA 4YWJA 3M82A 3OT5A 2GN9A 5EJ4A 4CLTA 1ZS9A 5L4NA 3M1AA 3HSJA 5KSOA 1BWQA 3FDZB 3O8LA 3ZZRA 1Z7YA 4DR5B 5FEMA 1XTPA 3WNVA 4R40A 5KTNA 4D7AA 4E2WA 2YC4C 4MVJA 4UVDA 4MEJA 3RS3A 4YRPA 5FPQA 1GUYA 5AI4A 3RABA 1UWBA 2VTBB 2AYBA 1N77A 4WE1A 5DG8A 2B4PA 1QLWA 5ALIA 5C8YF 5KI6A 1ZM3A 5EXPA 2MKIA 1N88A 2Z83A 3HDTA 3H4VA 2WIDA 3UGTA 2R25B 3ILIA 1BW9A 4J0QA 4FDTA 3C3YA 3UY4A 4P3YA 2AG6A 2WOOA 5BXIA 3ZK7A 3CF5Q 2JH8A 1AIPA 5BMOA 2F00A 4CT4B 1ZI8A 2O0HA 3MRTA 3C98A 4V0RA 5D0HA 2FE4A 5I7OA 4C7XA 2DWPA 1XU4A 2ICAA 5FIUA 2HF7A 2PD1A 1T3TA 3Q85A 4MYDA 2DR3A 3P3DA 2PZKA 4XE5A 1HE1C 2ZT7A 4BO9A 4BRWA 4KHPF 1OAAA 4B3RB 2XMTA 3K1TA 4AMZA 3MWDB 3OZDA 3R0VA 4EYHB 1QVAA 4PTYA 5B5SA 4JQOA 4LQLA 3TZKA 1YHQS 1LSUA 2WU1A 4CM3A 1YF3A 4PWWA 2MSNA 1S0NA 4NYZA 3D4OA 5GY7A 2IYZA 1UW9A 3EXG2 3Q5GA 2BZ1A 1VSUA 2CK3A 2I78A 1QHSA 3E8OA 5AJXA 1SOWA 3D59A 4KEAA 2P9EA 4I67A 4QVIA 4YP7A 4US0R 5CXUA 3FYUA 5BQFA 1EVLA 4JFAA 1Z08A 1SUDA 1XKLA 5LMUB 3EFOB 2ZVPX 3D6MA 3ADBA 2OEKA 1JWAB 3DR5A 2F3JA 2HG4A 3TZZA 5EIFA 2V4UA 2PTGA 4EUEA 2HFKA 3NHKA 3HCPA 1EU1A 4P4NA 2AMLA 3PDUA 3EGIA 3PCTA 4NE9A 1DBDA 4CLLA 1IATA 1V7QA 2YWJA 3NFRA 4C4SA 3CD6S 1O54A 3OMLA 4F04B 1IEWA 1C3XA 1IM5A 2ZZTA 5IVIA 1X94A 4FYDA 3GZNA 3DVAA 2Q4RA 3RADC 2BUNA 2J31A 4G5OA 3OLZA 2VQEF 3WGYA 2NZWA 3EF3A 4WZBB 1J0EA 1HEYA 4Q4JA 1Y9ZA 2YJ5A 1SUSA 1K06A 5A3SA 3CEMA 6AT1B 3TQHA 4GSYA 2JCYA 1RRKA 2GS8A 1FE4A 2P6NA 1FTCA 1ZKDA 4LECA 1BCSB 1NK0A 3UFXB 1OH6A 3MIIA 3VDXA 3U2QA 1QQAA 3CJRA 2ZAMA 1NNI1 3HABA 4DMHA 3KPWA 2YCBA 1P8GA 3D8NA 4ES1A 2RS2A 1XAHA 3DR3A 3OAAD 1N75A 4A0RA 2PWBA 1C0TA 3GT3A 1OSDA 2JGMA 2RJZA 3KLHB 3UI3A 4HDMA 2BBEA 4R1PA 2RK4A 2VXOA 3IMCA 3PHLA 3GP9A 3Q41A 1YULA 3K30A 3QFFA 3QI2A 1APBA 2OMOA 2HHAA 1GT6A 5IT9Y 4R8KA 3HYCA 5DZ7A 5C4IA 5CD4A 3KDNA 3VZDA 3GJ8A 3VHXB 4FFBA 4QHTA 2PC6A 2OE2A 2CQ4A 5K14A 1SHTX 3BWBA 5C51B 3AB2B 2C4UA 3RRXA 3ZHUA 3SS7X 4M88A 1Z6XA 2CJYA 4I3GA 2JHAA 1RU1A 3BXGA 4YY3B 1EG2A 2ZPAA 1XXHB 4AJIA 1LW2B 3AB3A 1D4FA 3G88A 3JTPA 3BF8A 2A1TS 4TYMA 1SG0A 2X8BA 1VGVA 3OE5A 3HRKA 2NPIA 5AJWA 5ITZA 4HFMA 1CQXA 3KL4A 3M8KA 4C6SA 3NWGA 3QIPB 2A2CA 3FGZA 4D0RA 2IRYA 5LP6A 2UDPA 4TRMA 1HYEA 4CM8A 4WCFA 1EVYA 3DGPA 4K4ZA 2Q7XA 3O9VA 1MUUA 3U7QB 3CDAA 1TQ4A 3NRJA 1DT5A 1HDGO 1E2MA 2ZRFA 1CZNA 1SD2A 5B58T 3VR3A 3C14C 3EDQA 2I22A 3LXRA 3H9JA 1V5EA 1ULZA 5K20B 1H8ED 3OUYA 4LUBA 3ELDA 4TKUA 3AJ2A 3I6ZA 3V55A 4F2DA 2BCEA 3GRKA 3GJSB 3VZBA 4NOMA 4M3NA 5L3ZA 2ETXA 4CH7A 1E1RD 4CKCB 4MW4A 1H3FA 1RQNA 4HKTA 4F36A 3C4JA 3EXEA 4UTVA 1LK5A 1HY3A 4IYJA 2XS2A 3V7YA 3HACA 2GO7A 1RDRA 4QPDA 1WC3A 2I3GA 2HMYB 1E98A 3HCCA 3BHMA 1RTZA 1JSZA 3K73O 1J8YF 3ASYA 5AJYA 2VJMA 3GV7B 2HMIB 1UEIA 1GMWA 3C19A 4LGVA 3AUAA 4H0FA 1CK4A 1A9TA 5KYTA 1VHWA 1QIJA 2QNBA 1ZITA 4JLPA 3JQPA 4DR1B 3U1TA 1TLLA 2FX3A 2O1SA 2WI8A 4EOGA 1TZCA 3ZE9A 4WOBA 5F9NA 1BKYA 2AK3A 4ICIA 1G60A 4V0SA 1WC4A 2O1PA 4IRUB 2ZS8A 2PLFA 1GPYA 5F8JA 4X4TA 2WF8A 4DPKA 5J23A 4JV2A 2WF6A 3LIPA 1UKBA 2F6RA 3QUAA 1KWGA 4NLTA 2V94A 4QOHA 4QXRA 3WJ1A 5KCMA 2Z6QA 3HFKA 2MMCA 4NG4A 2C3OA 3JQQA 2HFSA 4JASB 1ZIOA 2OFWA 5EHZA 4N3BA 1UBRS 1SPBP 1NDPA 2CFSA 4G81A 2L0XA 3DLEA 4OZ2A 2CQIA 5IV3A 2YN2A 5JCXA 1YASA 3ZHYA 4ZDWA 1LF0A 4WA7A 4GECA 4ZI7B 2CZVC 1EQ0A 1W35A 1RT3A 2F48A 5F4BA 5K05A 3WV4A 4DIOA 2HLUA 5KTQA 3MG9A 2XMBA 1HWJA 4JEUA 1K2WA 3T7RA 1PE0A 3IVRA 4KO0B 2A9RA 3WGVA 4OYWA 2QD2A 2W2OP 4I1OA 5CLGA 2P91A 2GN4A 1W7WA 2GVZB 1ZVQA 1UZDA 3WYCA 4EYKA 2W48A 3V8EA 4JBGA 3VZCA 4FMPA 4PGAA 1SR8A 2IPXA 3TGPA 2QUJA 4DSIA 1Q1QA 4ANDA 2D00A 2EBEA 5BR4A 1E3LA 3GH1A 5CUQA 1SULA 4ZC8A 1V43A 3DDIA 5HMXA 3B1VA 3LHDA 4HNVA 1E94E 1ABBA 2NO1A 1G3IA 4MKHA 3S2YA 2I2BA 4HDKA 3U40A 4UQOA 2G5TA 1IY2A 2FZ4A 5F8NA 5JHHB 5BNWA 5D4NA 1UJBA 3B5IA 4CLEA 2GBGA 1Q79A 3TOXA 2PQMA 2B8PA 1CEEA 1FTSA 2NU7B 4WTOA 3MJRA 1JHUA 3CE8A 4YAUA 2G5CA 1ZEMA 4RLFA 1PU2A 3V6KA 3QQCD 1OGIA 3MCNA 1A9SA 1H2UX 2KH9A 3CBGA 3TQIA 3IXLA 2DKOA 2CLHB 2XH8A 3CX7A 5HE9A 4OXKA 3WWZA 2BCGY 1B26A 1GNRA 4F0HA 4JP5A 1USVA 2HIYA 3GLRA 2IZ7A 4WXOA 1USKA 4D9MA 1I3NA 4OZ0A 4BBZA 2CLSA 5FBLB 2H7VA 2OC4A 5I7RA 2VP4A 1XTTA 4L4XA 1V16B 1NIJA 3NYRA 2IHZA 2G40A 3TLAA 3E9YA 1L3TA 2VP9A 2C2HA 2J0VA 1JR2A 4ZREA 3DHWC 1M6HA 1IKXB 5DX1A 2QTWA 2OL4A 2HYDA 2R2GA 4WWSA 4EW1A 4QG7A 1CUFA 1JVNA 4IQ4A 2YY6A 2OCIA 2Z58B 2CV1A 5B3JA 3IHTA 1WV0A 2JKVA 3NWRA 1AZSA 4WECA 5JRJA 2D4AA 1CB0A 5FOXA 4PIVA 3DCNA 1XC9A 3WA6A 2IPNA 3R9KA 4WK0B 3TR6A 4HRVA 4R9UC 1DS6A 3N28A 4ZA2A 3SIPB 4U95A 4C0BA 4YV0A 4YUYA 2MGZA 3NWJA 4X5OA 4LE1A 1NB7A 1A2OA 1PUJA 3CB2A 3BQNB 5DM6Q 4N54A 4JI8B 4RELA 1CQMA 3LPMA 1EHCA 3G1WA 5C24B 2ZM6J 4JKYA 5FPPA 1E0SA 3MQFA 2Z56B 4YCSA 3OC0A 3DUFB 4PIMA 3SIRA 4I9HA 2ONCA 2GWHA 3HFZB 4MVJD 5DCUA 4ON9A 3NCHA 2AQ8A 1RPNA 2R6AA 2M70A 2EC2A 2DHEA 2RHRA 2VJYA 5CA1F 3VMMA 3UICA 1ONOA 1G8AA 1MJHA 2WUGA 4EPYA 4ZP6A 3L6CA 1NR1A 2GS9A 2OPHA 3HJAA 4V03A 1TJ4A 1A71A 1ESZA 2EC0A 3A1CA 4NZ9A 1JBKA 2YNGA 4FC7A 4IKPA 2G71A 2IUSA 5IZCA 4JJGA 1UBEA 2A5JA 4ZFNA 1DTQA 4Y8VA 1E9DA 3NANA 1BXNA 3G8CA 4O23A 3LCVB 1V7PC 1JV2B 4G1BA 4LUCA 3WS7A 3H5XA 4WXHA 1KP2A 4XSVA 5B4UA 1O4VA 1J9EA 1M5TA 4XQEA 2G4BA 3VGPA 1R4AA 4CLOA 2HCBA 3CT9A 2B25A 3QIDA 4AO7A 4P32A 2QL9A 4JV0A 3L0OA 3QX9A 1OB2A 2QLJB 5ETVA 4FS8A 3WWYA 4TV8F 5B2EA 3GONA 1HK7A 3G6ES 4K26A 1MOPA 2IYEA 1FU7A 2I7XA 1X80A 1NOIA 3WZLA 5KOJB 1RLJA 2BDUA 4OL8A 1G18A 5LJIA 1V5VA 3NI2A 3FPBA 2ZANA 1UJ2A 2IPLA 3T7JA 1SCNE 5E95A 4IUYA 5ALYA 3E70C 2B0CA 5DLGA 4HVTA 4D80A 4GPZA 2J6UA 3P7MA 1JJBA 3FI0A 1E69A 2V4RA 3OM8A 3I01M 5HMWA 1W93A 3V80A 1G4UR 1V8DA 3F7MA 3WP1B 4IILA 1RAHB 4C4AA 2D3ZA 2XW6A 2BIFA 2BEKA 2FKNA 2WRZA 4P83A 2WSSA 4DSNA 3BA1A 4DPLA 4WIIA 3PT5A 2OPRA 4TQUS 4TMKA 3QVMA 3HVHA 3OKPA 1R4MA 4LMZA 5F8MA 3ZQUA 4RIIA 1HUQA 1RUSA 3L7BA 5EP1A 2BGNA 4NIMA 1KLMA 3O4VA 1PTKA 1SKWA 3TA0A 5BT9A 3RAPR 3IDFA 2JFVA 2LQ8A 4AVYA 1BN6A 1C7FA 5GZ1A 3W8DA 1C8KA 5FBHA 4RKWA 3T7CA 2COKA 4ZARA 1K6JA 2QX0A 4EL0A 4OZ5A 1BE6A 2K7KA 1A9PA 3AF3A 4P7TA 3H2JA 4AJ9A 1G21B 2QBYB 2WHQA 5DM4A 3N9UC 2A0UA 4LN1A 2HHQA 1I5EA 1LPBB 3OQBA 3NHFA 4USIA 1R7RA 1UDCA 3I34X 1ISPA 3TARA 2FMFA 5CFOA 2ECPA 4QSHA 5U9CA 3T3NA 5F98A 4JC4A 1ZA1B 5T4EA 3IKVA 2PMWB 3AT1B 3NBQA 3L3BA 4JI1B 4W90B 1PL8A 3OECA 4GZMA 3GU3A 3UMCA 1YB7A 5FNVF 5C8YB 4EHBA 5F1KA 4Q7AA 3N2ZB 1M76A 2XZLA 3ZNOA 3ESZA 5CDGA 1C0LA 2ZH8A 3P2IA 4I2VA 1N1DA 4F2RA 3ADOA 2FRDA 2FPHX 8ADHA 3P5BA 2IFXA 1BWRA 2ZFHA 3D4BA 3F97A 4WFBQ 3DEFA 3TZCA 1PIWA 1T9ZA 3PC8C 1NJWA 3IIIA 3DSRA 3UXEA 3JTNA 2HNBA 1VYVA 4Q9KA 1JDZA 2OWEA 3PU6A 4OREX 1LRLA 2BTQB 1A98A 1NNEA 1CR0A 4WQMA 2VPXB 3R3XA 3HV0A 3UW1A 2CJPA 4ZU3A 1Y9EA 1YQQA 1AZWA 5AXDA 5M5BA 3N5CA 4IM7A 5H3HA 1P6QA 2F65A 2ZKUA 3S29A 1PGQA 1S1MA 1CQJA 4GEKA 3COZA 5LA6F 3KSDO 2HPZA 1U8CB 4CQNA 2R96A 3NKLA 1C7ZA 3ZWVA 3EUEA 2RDIA 1GLNA 2JEIA 4OV6A 3CRZA 2V3CC 1EA7A 1XQVA 2LWIA 3BD7A 3ER6A 4M5IA 3H20A 2ZYGA 2EJTA 2JGDA 1V25A 3QYFA 4RS4A 5TARA 5FWAA 4Q6WA 2F43A 1M34E 3RC7A 5DG7A 4E2ZA 1RYRA 4R5MA 3EYWA 1IXSB 2IELA 2Q3HA 3HBJA 3I30X 4X8LA 1JQLB 5E7IA 4MUAA 6GPBA 1N9GA 5BYQA 3TPFA 4TMVA 3IR5A 1DADA 2RH4A 4BDSA 3PE3A 4N0DA 4I6YA 2DTEA 3X0DA 3R5TA 4FOTA 4KE6A 1YFLA 1DLOB 2O3UA 4CU2A 2W43A 3EOAI 2Z1NA 3LOPA 1EFPB 1TA0A 2PSSA 5A7FA 1LSOA 1C0PA 1NDQA 1GUBA 4MMZB 1NA5A 2K1RB 2AZDA 4E46A 3ZN2A 3EA0A 4I9GA 4AYWA 5LXTA 1WIWA 1NLUA 3OZTA 3MBOA 1DURA 3IDZA 3IWXA 1WDWB 5I3PA 2YJ3A 2QAIA 1T3HA 4P7BA 1IIBA 2GEVA 5E41A 2K2QB 3M3PA 3FFIA 5FA8A 2VBFA 1MFZA 1TGVA 4QASA 5I7FA 2P6SA 4ZAWA 3R7AA 1R0YA 3FUUA 4B7XA 4B7CA 2W24A 1TPZA 1YS7A 3AONB 2EVZA 5TGDA 1UF9A 1EM8A 1EI9A 3SJAA 3ORFA 3PXDA 5I7UA 3AVQA 1GDDA 2Q8NA 1NM2A 1RAJA 5J47A 2ABYA 1J5PA 1O96A 5CDHA 1OU0A 3RR7A 4FXOA 3BBFA 3W06A 2HSJA 4M5DB 3W9JA 1RAHA 3GP5A 4LC9A 1L5VA 1NTOA 4CRJA 3STYA 2R84A 4Y00A 3J7ZT 3BIWA 2R7LA 3BJIC 4TL8A 4KL8S 2GK6A 3E15A 4Y3CA 1JIIA 1MA3A 3S2SA 4DWOA 3KZMA 2RK6A 4BVAA 2M6SA 2OBBA 4D0GA 3ZH2A 1OI3A 2PX6A 3P4UA 3K70B 3I04M 3W79A 2NX2A 4YEAA 1O5OA 2A33A 2Y2UA 2GJIA 2DXIA 5B6PA 2O3DA 2VDWB 4CTAB 4L15A 2JFFA 4F0MA 3CUTA 1VMEA 3GUCA 4IO0A 2QZPA 2GYWA 1F6BA 4WFJA 4NTZA 1Y8ZA 2VYVD 2ZCUA 2E7WA 1Q1BA 5KFSA 3P96A 1CWUA 4PZ0A 1O77A 3IWLA 5H81A 1Q74A 4ZPXA 2DHSA 2LGJA 1VYTA 4R1SA 2HMUA 4CM9D 3DWEX 3SLKA 4C8LA 1JTFA 3DL4A 3OTDA 4RYLA 5I8WA 4BQNA 2MEWA 3ICEA 3SJCA 3RAEC 1WZIA 2OV2A 5KDDA 1T4CA 3CKLA 2OPQB 3QA9A 4XIUA 2BPOA 1WQ1R 2R6GA 4ID3A 3K1JA 1U9ZA 3EEBA 4G6ZA 4JL6A 2QYTA 5JWOA 1FJGB 2BW2A 3IRXB 4LSLA 5EAIA 3PLAE 2QV0A 4C3UA 3FEXB 1MPTA 3LVRE 1EETB 3VH3A 2C9OA 1CIPA 3PPVA 3Q9UA 1JLQB 3OO1A 1S9FA 3EWAA 2ISQA 5SZJA 3AEQA 2WJHA 3OE1A 4EHLA 2W93A 3FJ2A 4P2BA 4AXXA 2FEWB 3OR1A 3RSCA 3K0BA 2FC9A 4CGZA 2QL5B 2X9NA 2AGPA 3C4QA 5A3JA 1DQRA 2NSBA 3RAGA 4HZGA 2E7VA 3SQOA 1DGQA 3HRHA 1IY1A 1F2UA 2FNAA 3VOAA 3OT1A 4IV5A 1C9YA 2DTJA 1HDRA 3D0GE 4O1HA 2FPLA 5FDLA 1NQVA 3EFHA 3RKUA 1QF6A 4BFTA 2MJNA 1OUMA 4LBWA 3WKCA 1WZUA 4QPNA 1PNVA 1EE2A 4Q5VA 1H2ZA 3BDEA 4QBFA 1COZA 4D9HA 5AOAA 4IDOA 1P1RA 1IHUA 2LLZA 4O4RA 1WSBA 1RHUA 3CUSA 1GO2A 4JYCA 4MW1A 4EO6A 3TBHA 1ACJA 2VA2A 1CUHA 5EWMB 3LUHA 2F3UA 2I5PO 2X8JB 1IZZA 2QKYA 2QL6A 1BHSA 3BB5A 2JA2A 4YB5A 1SJ4P 3DU6A 2B4AA 3R24A 4PZYA 3GMSA 4U7TB 1QFSA 2V8GA 2FY8A 1NZAA 2G1UA 2FPIA 1XRNA 1MF7A 2G4CA 2YR0A 4D97A 4FE4A 2AKEA 3BXZA 3UPUA 2D2EA 2QEQA 1QANA 1YNOA 1HT0A 3CONA 1V9LA 4Q7JB 5HNKA 3MM8B 4ECAA 3NAIA 2R8HA 4YAJA 8OHMA 5KT6A 3SQDA 4GI1A 5AJVB 3HD2A 2XR1A 1OHHA 3JQCA 3PPIA 3KK3B 1RWMB 1RCUA 2X40A 1TUGA 3RYFA 1B99A 4ZCQA 3A9VA 1OWXA 3MMXA 1H74A 2GD2A 4JVMA 1N8SA 5EMNA 4KV8A 3OQHA 2IIVA 2PMEA 4PPDA 1FFGB 5B7WA 1FP4A 4II2A 2YZMA 4HBZA 5FYQA 1EX6A 1LW0A 4CNQA 1TCBA 3PWTA 5AVRA 5KJ6A 1BU8A 3VR4A 3D6UA 5JTUA 1HE3A 4DIEA 4WZBA 1V96A 3ETCA 3U1MA 1SZCA 3O8BA 5IPFA 3RRZA 3VSEA 3AHFA 2X3DA 3Q8QB 1E5QA 3MEEA 2KT5A 2WZCA 4F86A 4FGUA 4NJMA 2CFIA 1N5RA 5G0SA 4TU7A 2HAFA 5LXTF 3WK8A 1RRMA 4Q7KA 2HMWA 1I1NA 3Q1KA 4E2YA 4J4TA 1S89A 5KNCD 4V1Ak 3NVDA 2OVFA 4Q9IA 1D9ZA 2Q5CA 2PT5A 1RABA 1VYUA 3E01A 2VUIB 2Y27A 2AJ1A 2BJWA 1FYDA 5CJPA 3RTBA 1WNEA 2I2WA 3T5JA 1YONA 4PO9A 4H6XA 4LF9F 4RY8A 5KVAA 3OIFA 3Q3IA 1XYGA 2CXEA 3VKFA 1M5OC 1QF7A 4ZANA 4RDIA 3VAYA 1FK9B 1Z15A 4E6PA 2Q5FA 4B7AA 4LJYA 1D1PA 4Z4IA 3SYLA 5ITHA 5KG2A 2YV3A 5DCYA 4BP1A 4WIAA 4CQLB 1L3VA 5BMVA 1P62B 3RJZA 4ZVUB 1Z16A 1V6HA 3KJQA 3GFTA 4FN5A 4TOIA 2C7GA 2B21A 3BMOA 4AJLA 3HXKA 1G5HA 4ALMA 4MYHA 1Y1TA 4F4UA 4FONA 3OIWA 3R0QA 3D7NA 3QF4B 4YB7A 2GN0A 4GNRA 3EY4A 4ML3A 3KYDA 2E66A 2VHQA 4OI3A 5JUMA 2E82A 4Y6PA 1BQXA 1REQB 2AHOA 2BMBA 1W73A 4D3ZA 1SM4A 3S70A 4L5CA 3LBHA 4QJ4A 1ZZGA 1P33A 2AMFA 2V2ZA 2ODAA 5E4TA 2D54A 1SC4B 2FSVC 2J4CA 3DMFA 2OAEA 4F4KA 2BHLA 3C85A 1I30A 1U04A 2PVPA 4KLAA 5JZMA 2ZD1B 2N7CA 4KHRA 4CG2A 1UMDA 4RZUA 4ENOA 5BR8J 5E9JA 2WJGA 1GGHA 3RHSA 5DASA 3ZTTA 1RE1A 2X3GA 5JJBA 1YBVA 2VBYA 4IOJA 3TMAA 2GUWA 3EMVA 5CA0B 6REQB 4Q4LA 3LXUX 4LS3A 5EIHA 1UXIA 2KRRA 2DQYA 4UCWA 3GFGA 5BWNA 3B7WA 4CKCA 2H4YA 3Q3JB 1Z0ZA 3WGZA 3TW6A 3BPDA 3NBMA 3ZJYA 2W4PA 2UYOA 1N0VC 3KO8A 5FO1A 2AYXA 3ZIUA 2QQGA 5ALTA 5IZHA 2PUDA 4Q1DA 2UXDJ 1Y37A 5ALDA 5K3DA 3H6KA 3AR5A 4PHHA 2HBQA 3ID6C 1PJLA 1IQRA 4RL4A 1Y1QA 4KQXA 3HT0A 1GUDA 5A1JA 3DTNA 4IV8A 5AHOA 3EGOA 3MJCA 2YYSA 1Z3IX 2LXFA 4ZN1A 2D2FA 3EWSA 2LU2A 3TZXA 1PKEA 4JB0A 3KPUA 1YDHA 1SXGA 5K2OA 4PFKA 4J9KA 2BRKA 4PKDB 2NTVA 4DREA 4CL2A 4HQ0A 3O1IC 2JIZA 1E1QA 3GG9A 2VPIA 2DGXA 3VGTA 3RTCA 3DDUA 4EUSA 2D7CA 4H27A 4JBHA 7AT1B 4QJ5A 3P9KA 3UGKA 2V97A 4KBGA 1RKUA 3ASZA 2CQ2A 5FLKA 2O5RA 4P58A 1XDUA 1WXIA 3EGNA 5JDIC 1OWMA 1CR4A 1JFFA 3KVVA 4BNFA 2OKCA 4FIDA 3D7LA 4EF5A 3IDQA 1NVXQ 3BKUA 2PMKA 4A9AA 4UD6A 3GNSA 1UOQA 3MXOA 1XG5A 5JBIA 3WX0A 4XGIA 1PGZA 1P7YA 3RVSA 1KI1A 4UASA 3V4PB 1G21A 2QBYA 4LREA 2LUOA 3PNSA 3HCBA 5KFUA 3H40A 5BR8B 4DSUA 5KNCH 2C7BA 2A3NA 3Q8YA 4G0QA 3HZHA 1TU3A 1W96A 4QC2A 4H7PA 1VL0A 1Q3TA 1TKZA 2BHTA 2J9CA 4YCNA 1FKOA 3IS3A 2R1ZA 2F63A 2IXAA 1XF1A 3TLGB 4MMYB 3EDYA 1NSTA 1DBRA 3OUUA 1JQDA 1YIAA 4NU0A 2C2NA