3ENWA

Substrate and inhibitor complexes of ribose 5-phosphate isomerase from vibrio vulnificus yj016
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
TQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEEIKGAVSSSVASTEKLEALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREKIVAAIADKFICIVDGTKAVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITDNGNVILDVYGMKITNPKQLEDQINAIPGVVTVGLFAHRGADVVITGTPEGAKIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title Crystal structures of substrate and inhibitor complexes of ribose 5-phosphate isomerase A from Vibrio vulnificus YJ016
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Isomerase
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3enwA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3enwA01
4GO5X 2JHEA 2LQJA 1DEAA 2RE1A 3AAWB 3BXEA 3TX2A 4L4ZA 3K5PA 2KO1A 2I9SA 5T41A 4IO1A 2RQKA 5FIIA 2F1FA 5IT0A 2FGCA 2MDAA 3UW1A 1HORA 1LKZA 1XTZA 2H9ZA 1LK7A 3P96A 2P9GA 3DC2A 1FS6A 2W48A 4GO7X 3OFEA 3AB4B 4R7TA 3CSSA 3MAHA 3W7BA 2DT9A 1PSDA 3AB2B 1SC6A 3CH7A 3LWDA 4GO1A 2BKXA 4X84A 3KV1A 3NZEA 3ENVA 3O1LA 2P9EA 4L5JA 3L7OA 3E15A 4OQQA 4L5IA 1ZPVA 1FS5A 3EFBA 3IBWA 3LOUA 1LK5A 4R9NA 1FRZA 3CEDA 1Y89A 1NE7A 1M0SA 1U8SA 3BXHA 2LVWA 3NWPA 2PC6A 4GMKA 1FSFA 3E7FA 4NMLA 3MWBA 3ENQA 3TUJC 3TUIC 5IT4A 1YBAA 2QSWA 1Y7PA 5IS2A 2P9CA 3HN6A 2RI1A 4PWUA 3N0VA 1KS2A 1RWUA 3OFFA 1YGYA 1O8BA 4M8LA 1FQOA 2R5FA 3U7JA 4LUBA 2O0MA 2GNPA 2WU1A 4L50A 1CD5A 4OQPA 1UJ4A 3KWMA 3LUYA 2F8MA 3IXQA 4TM8A 5HJ5A 2QRRA 2RI0A 3S1TA 1VL1A 4L4YA 2OKGA 1UJ5A 2CDQA 1UJ6A 3BXFA 3OFGA 3HHEA 1HOTA 3LHIA 3OBIA 3ENWA 2PA3A 3OC6A 3DHWC 2QMWA 3ICOA 2J0WA 1JT9A 2JOQA 2BKVA 2J0XA 2J0EA 2RQMA 4TM7A 3BXGA 3DHXA 3NRBA 2NYIA 2ZHOA 3DDNA 3MTJA 5JJBA 3OFHA 4L51A 3TUZC 1PBTA 2QMXA 3EB9A 2DTJA
chains in the Genus database with same CATH superfamily
4XH9B 3KT3A 5JCOC 3TECE 1SKRA 3GFSA 2C9BA 4Q1FA 3QWPA 1NJGA 2RU3A 3LVRE 1SG9A 2A86A 3KXDA 1FNBA 3N86A 4G0MA 1QO0D 3SFVA 2KJVA 4H4OA 5FJJA 1SB6A 3QO9A 1ODJA 1YCHA 1MQAA 3ZWPA 4V2UA 3Q7PA 2BUAA 2IMWP 2RGNA 2PS9A 3HUFA 3DDWA 1NSAA 3PRBA 2O5RA 2NU9A 2VZEA 4PWYA 2DB1A 4H4CA 2RILA 5AVRA 4IQFA 1V95A 3GP5A 1SJ9A 3P5SA 1MFZA 2BACA 3IO3A 1ZJYA 1F1JA 3FYTA 3RS7A 2IXTA 2RKIA 1RT2B 2VUIB 2IUTA 4P38A 4DSLA 4H1TA 1THGA 4Q48A 4DUGA 2OZVA 1M1UA 3H18A 4M53A 4PRKA 3PEYA 1MW7A 1VLVA 3D0IE 4EYOA 2WINI 3AGPA 2XMJA 4LHVA 2VAVA 5F5LA 1ICIA 5BSMA 2ZH5A 4TL8A 1T5SA 1EWQA 5KYKA 4R0MA 1TD1A 4JI4F 4CQMA 3K70D 3K2IA 1M66A 3SR3A 4F9TA 1UXGA 1CLFA 3Q0IA 2A9PA 2VBCA 5F51A 5LA6A 3RB8A 3EZ2A 5FTNA 1CQJA 2WIGA 1NLFA 2J7PA 4E94A 1Y63A 1PBUA 3RD5A 3JQBA 4P36A 2GCEA 4GE3A 2IUSA 3KUXA 1D03A 1BE1A 1W0JA 3EFOA 4TRRA 3A9CA 3SOZA 3ETOA 4DU7A 3HC7A 5HRUA 1KAEA 4EBBA 4E5PA 3RKUA 4MWCA 1PR9A 2XY7A 5TRTA 2QEQA 4KQIA 2PCLA 2NPFA 1U8YA 3EIOA 4MV7A 3QWAA 4CNQA 2L48A 5SZTA 3BH7B 1PKEA 2FZCA 4QXRA 4DV5B 4OFZA 3BRQA 3LC0A 2ZAGA 1TPZA 3OUYB 1B7GO 2XD4A 4CEJB 4OKSA 1SHLA 2D74B 4C4AA 1L4BA 2EQBA 2HPAA 1GEEA 2Q0XA 3SQMA 3DL0A 3EIHA 1V3UA 1H6CA 3MECA 3OY7A 2OB2A 1QIKA 3M0EA 3MD0A 3A0UA 4E6PA 3EGVA 1G20B 2QVGA 4BDSA 4YGYA 1NVAA 4U2GA 1X1RA 1XZHA 5L9XA 4NK5A 2XCSB 2QTTA 1HEYA 3DEIA 2H1IA 3EVAA 3DB2A 2B6NA 2WJAA 5JQGF 3BWMA 1L5VA 3T7SA 1RQLA 2MLXA 1U26A 3GLFB 3L7KA 4PGGA 1C9JA 1DQPA 4XCQA 2UUWA 5A76A 1BEUB 3SHOA 2QTNA 3LPNA 4OAOA 2ZRJA 1HDOA 2PGCA 4AAYA 4C2MA 1T0JB 1YBVA 5LJ3Y 1UZDA 4QGFA 2VVTA 4G6VB 3FBGA 4Q8FA 1HOTA 1T29A 2VK8A 3OM9A 4P84A 4MUYA 5HFAA 3KQUA 4P3OA 4MV5A 3D1QA 3O8WA 1QIGA 3RAJA 1WLYA 4P8RA 2E21A 2JJMA 2AHOA 1NR1A 2VOOA 1JYSA 1WHSB 1KEEB 1WIWA 1MPTA 2X9VA 3L09A 4MRAA 4ZC8A 2L9WA 3AAWB 3HGMA 1KNZA 3ZFVA 2EL9A 1RTZA 1SKYB 1LWCA 1RXUA 1NYTA 4O0NA 2RRNA 1GCGA 3GPLA 2Y99A 1XTUA 3H5LA 2IUUA 2I6GA 2K3IA 1QFYA 3HDTA 5ALIA 5HIKA 4PPDA 5CM9C 1JALA 4TLDA 3X1KA 2O8NA 4WZAB 2X1GA 1S0OA 2VXBA 3L0ZA 1DC3A 3RANA 4MVYA 4H0FA 2DE0X 1XLTA 5D51S 2CIMA 1RC1A 5A6SB 2MLZA 1FMFA 4DWVA 1G8SA 2R42A 3NTVA 2C1ZA 3EG9B 4PC3A 4I66A 4K6FA 4BB9A 2NS1B 3HA5A 1TU0A 1KFBB 5DKFA 6LDHA 1N2EA 2Q7DA 3VU0A 4YO7A 4J0DA 4DPUA 3U0VA 3PNVA 4BNLA 4NLGA 4Q18A 4I5DA 1TAHA 5LKRA 1M7HA 2RIRA 1GZ3A 3EEYA 2SECE 1NOKA 4JOSA 3FFTA 4N3AA 2QZ8A 3D0RA 1BH2A 2Y1FA 2ZXFA 4F7DA 1F2VA 1RP5A 3TRKA 2BGJA 5DULA 121PA 2A35A 1UXJA 2CQIA 2DR5A 1JMYA 5FV7A 2E85A 3TAMB 4ZOSA 3ZVLA 1WTFA 3SQNA 2IVFB 4H0CA 3ZNQA 2R96A 4TV8B 3IHLA 3RWBA 1J6UA 4D3XA 2UVPB 4OLHA 2BEUA 1JLMA 2FAXA 4UUMA 1KQNA 2V6FA 1R8SA 4R54A 5EWJA 2IEZA 3PLAE 3Q86A 4LRSB 2UVQA 2GZ3A 2XKBA 4RVFA 3PZRA 3CD7A 2V55B 1DU4A 2Q5LA 1CZRA 4TLCA 3CD5A 4Q4HA 1KY2A 2IBTA 4I1RA 4F3NA 4DLWA 5JAOA 3IRUA 3TP2A 2ROQA 2NPOA 5HF5A 3BAFA 3WKEA 2JLUA 4DV1B 4H7JA 3M6WA 1HGXA 4GI1A 2DYAA 2DNNA 4H7HA 4XYEA 4S04A 3FDSA 1FF2A 1X7YB 3BZUA 3BO4A 1HZJA 3AB7A 3GCWA 4UNPA 4W5RA 1NMEB 5ALEA 4ZALA 2YWEA 4DARA 2UUOA 5A0YA 3USCS 4KXUA 2LTAA 2EX0A 1JPJA 2HIYA 4OMCA 4QOEA 4B3MF 2X0DA 1XKQA 2XMBA 5T14A 1OT3A 1W0CA 2NZ8A 3HSYA 4O4HA 4G1PA 4R31A 4U6PA 5H9FJ 4HDSB 2BX6A 2ETVA 4EECA 1GAWA 2IC5A 5KWVA 3D0GE 5K3EA 1RLMA 1GV1A 3CUKA 5IKXA 2OM2A 3V1TC 2Q0QA 3TSYA 4B5KA 3C6UB 2W7OA 2XNHA 4K88A 2RGDA 1PJ6A 2O23A 3L7OA 3PKIA 1IBMJ 1W4BA 4DQRA 1J23A 1GTEA 4CM9A 2V2KA 1UZNA 1PJ3A 3FM9A 1C0LA 3M3HA 4B32A 3ZV4A 4B31A 2EZ9A 3AF5A 2MZ1A 1UWLA 4XUGB 3GJRA 1RWOA 3I82A 1U7WA 3RFTA 3V81B 1B0PA 3Q10A 4NCGB 1RADA 4FYXA 4JJIA 2WE7A 1V6AA 2QAGC 5DLDA 3M8KA 4W5WA 1ISHA 3GFRA 5A4IS 4RAQA 1MROB 1LBQA 2DHXA 3BXGA 2WRZA 4YT2A 1QIHA 5LL6P 4DBLC 4ANEA 4C4TA 3G88A 3OHSX 3FOWA 2XCAA 5J3JA 2OFGX 1I7LA 1NI4B 3R3XA 3MFHA 1F8FA 4K28A 1C1CA 3KSMA 2OBYA 5KFPA 5AK0A 2VJUA 2XGQA 3LC7O 4IWYA 4QBGB 3IDQA 1Q0ZA 4JB0A 1KJQA 2MKKA 4IOJA 2A4MA 1K68A 4ZDKA 3H5XA 1P4GA 5I7SA 1QTRA 3WJ7A 4P54A 4X4SA 2OV1A 2I0XA 2HMUA 5BUQA 4QU0A 5EQTA 5T8KC 2PFFB 2RH8A 4DJJA 1BDMA 1IAVA 1A96A 2H57A 1ZONA 5KDLA 4LF8B 4IS3A 3WRYA 3N2KA 2AOTA 4LZNA 3D4NA 4YR7A 5CYMA 3ETEA 2CXSA 2G9NA 1N5DA 1NC3A 2Z1MA 1GT91 3L4BA 1DCTA 1UF9A 3TLGA 4NJEB 3IBCA 1UPTA 1EUYA 3NXZA 4R8KA 4XRGA 4Y6IA 4K0KB 4KQ9A 2PRKA 4D3YA 1N0VC 5LLTA 2FWPA 1KBRA 4HWRA 1XZEA 5M5BA 3LUAA 1YQTA 3PCTA 5FI1B 5HGXA 1KI6A 5EN1A 3RJ5A 4QVKA 1DINA 4IIVA 3SNHA 1NHWA 3EOAI 1N5JA 4EG6A 1I33A 1UEKA 4R8UB 3H5RA 1KZYC 5E6SA 2EDCA 1PR4A 2NVUA 1Y8CA 2GD2A 5JHHB 1FNDA 4EKNB 4M8SA 1C1HA 1CS4A 4UBMA 5ULLA 3M81A 1MP0A 3PPYA 3Q3JB 3VVTA 2L19A 1TUIA 3ZQKA 2PBLA 3KZXA 3NW9A 2A0UA 5HZHA 3ZK9A 5F0UA 4ZQHA 2C9ZA 1T9DA 1JXVA 2GEFA 2OSRA 4CLDA 3ZG6A 3A1DA 3A4YA 4Y2IA 5LA6F 4CMCA 3I55S 4R9UC 5G02A 2C4VA 3HHEA 4P6VF 1RJWA 1DO8A 1HFKA 2I54A 4QIGA 2PZEA 3DFIA 1Z2DA 4HCJA 5HLFA 3ETCA 5F8JA 2FG5A 1HT3A 1C14A 4ENVA 4DL5A 5FIUA 3SE0A 3WNDA 4M0DA 1SC9A 2ZTSA 1LFDB 4QYIA 5DP2A 2H9ZA 1IEVA 3DS8A 5DM1A 3JU3A 3T5AA 1M2EA 1JI0A 3I61A 3DAPA 3ECAA 3AM5A 4G5SA 1NDPA 3TVTA 1EU1A 2OCLA 3HO8A 1QV6A 1Q0TA 4BO0A 3MXTA 4F4CA 4LOAA 5BMVA 1QD1A 4KGXA 4IKPA 5KTYA 2OG1A 3JARA 2MQ8A 2EYQA 4F96A 4UBIA 4MAFA 2BJ3A 2TRSB 1OC2A 2R65A 3KQKA 3F6EX 1LDGA 1RPTA 3FTFA 1K1QA 2N42A 3KQHA 2I1WA 2YRWA 1K08A 2Q66A 1UBFA 2MSCB 4DCOA 5F7JA 3H17A 1N0HA 2FR8C 2VRCA 4J16A 4PIPA 3TRIA 1CUAA 5K0CA 1NXXA 1RWNB 3D5EA 1N33B 4O4IF 1NVGA 1ZZNA 5KG4A 1W9HA 2APOA 5AW7A 2CJAA 4LFCF 1ZJJA 1T3SA 1T5BA 4WN9A 3D66A 2IC3A 2PR7A 1J5EJ 1CZNA 2AJ0A 1O7JA 4P4UA 3EGZA 3LC1O 4RX6A 1CEQA 4RH0A 2C4NA 4DQKA 1GAJA 1Z4MA 1NK8A 3GMGA 1T4MA 4N7TA 1VGRA 1NKBA 4WMLA 2HA7A 1I2DA 4IH7A 5DDPC 3SQOP 1PX0A 4YT4A 2IWHA 1CP3A 4BGVA 4QR1A 1E3WB 2N0SA 4B6FA 1MJGM 4XM1A 2Z8QA 1HL3A 2OPPA 3J80U 1YDGA 3R6DA 1JKJA 5K3DA 2DPXA 5DBFA 1VI7A 2RS8A 5G0UA 3NAMA 3TR0A 4O4RA 2DISA 4YWJA 4FFBB 4XQCA 4DXLA 5IJXA 2BBWA 2AOUB 4M1WA 1PVDA 4P74A 2R6AA 1VYHA 4ZD6A 1C1XB 4N0PA 3T7JA 3LZDA 2BKPA 5AE3A 4AROA 4ED3A 1TK0A 1GUAA 2IHJA 5FQNA 5EIAA 3LCJA 3AJ1A 3M2VB 2PMHA 3DGFC 3E9EA 1SUWA 3L05A 4DEVA 2PUBA 4FJ1A 3TYXA 1SXHA 4FBMA 4LC9A 3FCVA 1ZZFA 1D4OA 2PMDA 3M6IA 3R9KA 4S1NA 1P31A 2WM8A 1UBGA 2QVYX 3IQXA 5L3SA 1M1ZA 3CH5A 4LHEA 1TLFA 5EKDA 2VKQA 3JSYA 2Z2XA 1SL2A 3DHYA 2EWHA 3G2QA 2IHYA 3W5HA 3R7AA 2CC2A 3KYDA 1JTVA 1QWOA 3K9QO 4FSHA 4RQAA 4AL4A 5KHOC 2LYVA 5E9QA 1SH0A 5I9TA 1GAOA 1WB6A 2W2QA 1PYOA 4Q3EA 2O5CA 1C8VB 5NULA 5LQMA 1XQIA 5AI9A 4KWEA 3HX9A 4QNNA 3S6EA 1V3QE 3EZ6A 1ZI9A 3RNOA 3IAM1 4AKEA 5DT9A 1I1OA 3UWMA 3VGTA 4G1QA 1W5FA 3GLGB 4BRSA 4LUCA 1FDTA 4LFAF 1SIUA 2QMQA 4OX9B 1AY0A 2HLNA 3LKVA 1USKA 2A2DA 5J2TB 3DHXA 3D2BA 3X1XA 3CVYA 3AJAA 1P7ZA 1G55A 1R5BA 5H59A 1N36B 3C70A 1BE6A 4OJNA 4M0KA 2EXXA 2FOXA 3AETA 3OFNA 1FXDA 3MJHA 1DPFA 3SSMA 5J1NA 2ZCUA 4GSYA 1NNI1 3LP2A 5KPJA 1UZAA 4O4HF 2QTAA 1NY5A 1SRQA 2FSVC 4OXNA 4YLEA 3L49A 3B3JA 2X5NA 4UHBA 4FGLA 2NTYC 1FKOB 3G5UA 1O5TA 3M9XA 3RV3A 5L9AA 4BY9E 1OILA 5AH0A 3CY6A 2VPIA 1P2FA 1XG5A 3LRXA 2LXFA 2VHCA 4NEHB 4N6GA 4IFVA 3GY0A 4NPAA 3OZSA 1FXRA 1IN5A 5JPCA 3E8SA 3CPHA 4C4SA 4QAQA 1XEAA 3W4IA 2DPYA 1YI2S 1BDBA 2C5FA 4HB2A 1O54A 3NRBA 4X20B 2HWWA 3THVA 2HUPA 2BQ3A 3H1AA 3WK4A 1FJGB 2B98A 4QYWA 2ICAA 3U4CA 3J81A 1JAZA 5SYAA 3ZY4A 2OB1A 1XE3A 3DPUA 3TVKA 4M1MA 5C5EA 2H5JA 3WL8A 5DX8A 1NAHA 1MEOA 3VZHA 2YNFB 1R6AA 4HUTA 5JJKA 3AWDA 2WT4A 3CTPA 2IP4A 5IVHA 4LMZA 3I6ZA 1HQUB 4BZZA 5KYXA 4V0ME 4LRAA 3C41J 4DABA 2J6BA 4M8IA 1KH2A 2QJ3A 3PQ8A 4AT1A 2WZCA 3RT9A 1VKZA 5DWVA 1ZOLA 5L6LB 3COJA 5EYPB 3QK7A 2Y71A 3L92A 2Y0DA 1JR3D 1KHHA 2VD3A 2PAFA 4S1OA 4EIWA 3PXAA 2IQ5A 2OPSB 3AKCA 3JQ9A 2H92A 2GVDA 4R0VA 3T3IA 5HTOA 1JWLA 1G7CB 1FJXA 2ASVA 1WELA 4BN5A 2VXCA 4EL5A 4IJWA 4LVNA 1SBRA 4RNOA 1YS9A 1VJGA 1E18A 1RBQA 2OI2A 4FZVA 1OSNA 3ZQUA 2YNHA 2VFRA 4NU5A 4DX5A 4GQAA 4Y1RB 4YREA 1EIZA 1UEUA 3I34X 3UTDA 3PACA 2O01C 1U80A 5BR1A 4QPCA 2JDIA 3L41A 3GAAA 2KFNA 2QI9F 1GPUA 2V50A 5CZXA 1UVJA 1E3DA 2H5IA 4G1MB 3FBEA 1NUHA 4Q7JB 2G5TA 4DR1F 5CLIA 1YJWS 1OAKA 3HR7A 3NNHA 3C16A 2QN7A 2IW1A 3GLIA 2A30A 3CIMA 5D0HA 4OXRA 4TLMB 3R5XA 3FMGA 1T2FA 1GYPA 2JAUA 3A6JA 3PFKA 5J5AA 3OD2A 4LREA 4O5OA 4CKBB 3KU4A 2A9FA 3NKFA 4FCVA 1K88A 5BYQA 3R3ZA 1FMLA 4DMFA 4PWUA 5GPBA 4B5LA 4OA5A 3F8SA 2FUKA 1ATIA 2W58A 5IJZA 1IG3A 2ZH2A 2CNLA 1D0IA 2FZEA 3ZHYA 3I0ZA 3INNA 5DDOC 4WW0A 5JECA 1THMA 4JUAA 4MTCA 1U6KA 4GVLA 5MHTA 1CFJA 5HYVA 3QU5A 2PUJA 1TLTA 2BZ2A 3K0AB 3AY3A 1WG8A 3EODA 5ETOA 1ZM7A 4H77A 4DX6A 4LDJA 2M6LA 4IV5A 3SY8A 5HN0A 2DULA 1FWKA 3TNLA 4ZVQB 2QD5A 3WA6A 5EPUA 1UDCA 3K0CA 5NLLA 3VGPA 2R25B 1SV5B 3IEVA 5TF0A 4QC2A 5LZ7A 3B6EA 4BFVA 1X87A 5HM8A 1QCCA 3WYEA 1U4OA 3EISA 4RTKA 4OMDA 2CFRA 3N87A 1FSGA 1NAIA 2Z1NA 3PCRB 2P6RA 3TZXA 4YV1A 1WSDA 2FJPA 1PQPA 3ITDA 2D5BA 2FP4A 5HQLA 3LYUA 3OZBA 3C3BA 1FERA 3CZ5A 1Z2NX 3Q2KA 3I04A 3WNBA 5B4VA 5FUQA 2XVMA 3T5TA 4DDVA 2YYYA 4NE9C 3G9XA 1NUUA 5EQJB 1ADCA 5BWNA 5K01A 3TF5A 1ZPDA 3DE3X 4MJXA 3ZW8A 3M8ZA 4DPTA 1BWSA 2BMEA 2HQDA 3VSAA 1YRXA 1XEWX 1Z6ZA 4HSEA 1V5VA 3FROA 4D4JA 1YVFA 2O1XA 1QLHA 4KWTA 5IVIA 5C25A 2W8LA 4QZVA 5DLPA 3B82A 1JRLA 4Q16A 2WR8A 4HUJA 4WK0B 2CNWA 1LFAA 3FXAA 1H0KA 2W4DA 1DY3A 3FPCA 1Z88A 2OBMA 2QWXA 1D1PA 1NXQA 1YCGA 4EUHA 1SCIA 3W05A 3RAXA 2NXJA 4FT4A 3WV4A 2DJ5A 2H4WA 1ORRA 1CZKA 1C1DA 1S48A 1SBHA 1EP1B 4A8OA 3PGXA 5K14A 3OCWA 2F8MA 1EVEA 4CCYB 2ZBQA 2YPZA 1SB8A 3Q41A 4ZRDA 2OMOA 4YUYA 2U1AA 1CBKA 2YQZA 1F2HA 1P9QC 2KPOA 2EI5A 2HL6A 1STOA 1KR2A 4FC6A 1IQTA 2HSEA 4P9SA 3EDOA 4OHOA 1EDBA 5EKUA 3MR6A 2AUNA 1T1EA 3Q72A 1HNNA 3RRYA 4XDDA 3VO1A 2NT3A 4JI6B 1BYUA 2BFDB 2YS7A 4K4ZA 1EXNA 3DMNA 2H2FA 1AXQA 1FFWB 4UZCA 4NA1A 2H1SA 3N0TA 5LOVA 1XJ0A 1AF7A 1W96A 3BA6A 4CTMA 2C3PA 4UZBA 3CLRC 3I9V1 5CM2Z 1ODFA 3RVLA 1X19A 3H2SA 3UJ6A 1P4JA 3RUCA 1PSWA 4N56A 2AX1A 2W6CX 3CBGA 1FFHA 1OY1A 3L9WA 1M8KA 4I2QA 1X7WA 5AVWA 5M3BA 4OZ1A 5BWOA 3WC2A 5CD4H 5ADWA 3G0DA 3ZE6A 1M8GA 3GGJA 2G2OA 5LQRA 1NVVR 3VDQA 4QJIA 3OE1A 3SC2B 2HCTA 2ZRHA 3E5MA 3OTWA 3OHBA 1HBNA 1LH0A 1JTFA 1F60B 4BKOA 1JXQA 2FZGB 1KOHA 3DM9B 4EG1A 2R68A 4H7IA 4UOQA 2B5OA 1F8YA 2I6WA 1I9GA 1QZZA 4D9KA 3HYLA 3LP5A 1UWBA 1BRMA 3C1AA 4UCWA 4WSOA 2E4UA 4NDZA 4RNNA 2ZR7A 4ED9A 4RNDB 5B36A 1UPXA 4JP3A 5E7QA 2ZM5A 5JZOA 3P5BA 2M2IA 2RC6A 3GWGA 1M5KC 4NI2A 1VQNS 4H0NA 4H6WA 1ZGZA 4N5IX 2WG1A 3KZNA 4BQQA 2B4YA 3ELDA 3RVJA 5ADHA 3AG6A 2C00A 4JD5A 4MVJI 1HZZA 3EPRA 4LPSA 3I23A 5KQMA 1MRSA 2I78A 4FE7A 4MKXA 4DC0A 4KBFA 4TQRA 3BK2A 2V8HA 1LW6E 2UZ4A 2EJWA 3I9LA 3LG2A 3GH3A 3AFNA 4CKEB 1Z29A 1C30A 2UXBJ 2R97A 2Q49A 2PE5A 3WRVA 4L4RA 3C7TA 2UYGA 4MS3A 1JIXA 3CBQA 3GPIA 3IEIA 5GZ1A 4CMBA 3CSKA 1U4NA 3EBOA 3IIEA 2V3VA 3UMSA 1P5HA 5YASA 1VCNA 2RBGA 3CD6S 1B0TA 4LRFA 2LWIA 3OXGA 4FEEA 3RS4A 1LPBB 3GT3A 3LQRA 2CV1A 1FT8A 3E9CA 2CCKA 1UOEA 2XPCA 3S8EA 3IH5A 1PZFA 4R8LA 4B4UA 3NBFA 2ZJAA 3UC9A 4KX3A 1M1YA 3PIDA 5EJ9A 5DGXA 3BMNB 4L8YA 3SV4A 1LZLA 3PHCA 2IIQA 2GZOA 4LV8B 4QHYA 1SQGA 2A3NA 1R1DA 3FVQA 2CLSA 1OFHA 1NG1A 3MFIA 5L1IA 4RACA 1KHVA 2YMQA 4CTNA 5AXMA 2E5LF 3QSYA 1GA1A 4J1SA 3UVJB 3ABOB 1S1XB 4G0VA 1F3LA 3QE9Y 5CEEA 2V6AA 3W5SA 1VQ6S 1QB8A 3GCWP 1JQGA 2OK7A 3G9QA 1BKSB 3FHOA 3A36A 3LPAA 1UJ2A 4OJMX 2PSDA 5B1IA 3IODA 3WXMA 2HDOA 3FHCB 1T9VA 4QU5A 3J7Z5 1T8SA 4A8TA 3FYHA 4EFKA 1GZVA 5KTMA 4MVJG 2Q8NA 1X9HA 3PFEA 3D8NA 3LF0A 3LTNC 3BWXA 4XIGS 3KZMA 4U6QA 1FY2A 3OEHA 1JLGA 4Q3BA 1BFDA 1EX1A 1QC5B 1TE2A 4UJ3A 1E9VA 5IWCA 1EK2A 3A6HA 4Z7YA 2Q1XA 3G9ZA 4Q24A 5AUPB 2Q5IA 3KCQA 4LAFA 3BGFA 3MEQA 3ADKA 1JDUA 2WZQA 4ZYVA 3UATA 2OUGA 2A58A 4O63O 4O2BA 2I22A 4ECTA 4A2CA 5KNDA 1M5UA 2GYVA 1J8DA 3HP7A 4IL5A 3ZNUA 1E7SA 1F9EA 3DM2A 3RVPA 3JD4A 3HDGA 1Q7YT 1U7UA 3AQIA 4YHHJ 4I4IA 1L7RA 4L5IA 2DC1A 3BB5A 4D9CA 5CD1A 2ZDOA 4MSUA 4YUWA 2JLCA 1FTNA 2EQ5A 1XNJA 3TANA 4TT3A 4EJFA 4NECA 3O38A 1BUXA 5DFAA 4IDGA 3FOEC 1FEHA 2XQKA 2A6MA 2ALYB 5G1NA 1G7TA 4KGKA 3NAQA 1PR6A 5JSQA 4ZV4A 4C88A 1DOZA 1I3LA 3MMAB 2AXNA 4I50B 2GEJA 4LQ3A 2IGBA 4C8NA 3N7AA 3W9BA 2GIFA 1Q0NA 1HIYA 2XD9A 1A97A 3AW9A 5F2EA 4M1OA 1PJSA 4ZVUA 3L1HA 1FS6A 4ZCMA 4ZCLA 3B38A 4F46A 1KFCB 3QRPA 1UUFA 1UKZA 4Y2AA 3FFXA 3C6XA 1SIOA 3UKOA 3J7AC 3ZOKA 2YWKA 4ZKAA 2ECQA 1YQ9A 5JO9A 5A3QA 2ZJ7A 2IFTA 3OZTA 2PGOA 1ZXXA 3R6TA 4MH8A 1BJKA 2H7CA 821PA 1WSAA 1K0UA 2XGSA 4LGMA 2NGRA 3KVYA 1IQPA 4JV0A 3A04A 4Q1EA 1QHGA 1LDNA 1YKFA 1DJLA 2AYGA 2JJ4D 1QH8A 2IDMA 4HBGA 2D0OB 3P2IA 4P08A 4RD3A 2CNOA 1T3NA 3EE6A 2EFDB 2X41A 4GZLA 3W0LB 2UXCF 2KKHA 3EQ8A 3LX5A 4F9EA 5IMBA 3HJRA 3V7WA 2E9RX 4K9MA 3AOCA 3UK1A 3ZGXA 4RZRA 1D9XA 1KI7A 3JQQA 1GQRA 2QIOA 2EWWA 4U39A 2FFAA 3I39X 4DAOA 3C3WA 4NLQA 5A8WB 2CLLB 2ZDHA 3HN2A 4QRIA 3BIFA 3VMFA 2CYCA 1KZHA 3KAPA 1TEHA 1T1SA 5DHAA 3L8ZA 1RRVA 2I33A 2QAGB 3WHLA 1YDMA 1CVLA 1WC0A 3AR9A 1Y89A 4PIVA 4C0SA 4Q4DA 1EP2B 4DT1B 5KJ1A 1YD7A 3CEPB 5CHCB 1S76D 4QWEA 5F7OA 3MWEA 5K8IA 3PK0A 4X6UA 2VG7B 1OBHA 4JYMA 1QG0A 4CO4A 5HMXA 1XRPA 4LBHA 2I4LA 3TD6A 4Q05A 4DJDC 3KR2A 3EIUA 3CO5A 3OA2A 1GFWB 1RHRB 2A5LA 3UNGC 1LC3A 1QTNB 5A4AA 3LBHA 4HDRA 1E5QA 3IVXA 4KGDA 4X24A 5K0SA 1VCHA 2GBLA 1TZCA 5HZMA 3NJ8A 2FY8A 3O8OB 1GUFA 1Y4ZB 3ZXUB 5C5CA 4A8JC 3QOYA 4UULA 2X2FA 3JWGA 4D42A 1FYXA 2IYGA 1NULA 1NJIT 2GJKA 1FX0B 3SCIE 4NG4A 3S7RA 1IBMB 3T6KA 3VI3B 2FPGB 1QLWA 3H2JA 3DGPA 4ES2A 4QPTA 4M94A 2KI2A 3V4MA 1VK3A 3KLBA 3MR2A 4C3LA 5C7IO 4W5NA 4C4XA 2O3DA 1IKYB 4ZDNA 1FVFA 2ODWA 3KFLA 4ZIRA 4OHYA 3PRKE 4YRLA 4DJ5X 2Q5QA 1V5IA 3DEJA 2NCKL 4O44B 5IT9U 2QMYA 4G84A 4K6MA 3JAWA 1ZGHA 1NKVA 1Z8NA 2DY9A 1Z4PX 3MHPA 3ICOA 3X0DA 3US5A 3ONFA 3ESQA 2NREA 5ILGA 3DOEA 2VA3A 3NT2A 3GDOA 4K03A 1R4NB 4D80A 5FWXB 1F1BB 1SEPA 4UVHA 1Q53A 1E2EA 3IRWP 2IU3A 3GJSA 1EX6A 1OKKA 1Z08A 1D4ZA 2H0RA 2C3YA 5IAOA 4Z5XA 4CXMA 2Z9BA 3EGDB 2BP7B 3KQVA 2V6JA 5ICSA 1DOAA 2P75A 1NPRA 2ISSD 5BR8B 1ZVJA 3V8VA 2C88A 4QYMA 2OPRA 2PDAA 1EETB 1SU7A 2Q2QA 2YH2A 3R40A 2XSJA 3AFGA 5K5EA 3IR6A 1MX5A 3LP1B 4Q12A 5HM6A 3E22A 4ZAFA 5AKYA 3IP1A 4TY9A 2PNJA 2C7BA 4QDUA 3TAQA 3PFNA 1GTMA 3T9NA 5IYZF 1FP7A 1XDUA 4LDAA 1W1UA 4GL4A 3F2VA 4EPXA 1RI3A 5DYTA 4CFSA 4DR2F 1J99A 4GGMX 1RQRA 4M0MA 1HYBA 1E2MA 1GNLA 1QH9A 4Y28C 4J7XA 3LYHA 5KVQA 3KSAC 3OBBA 1U2EA 3BSWA 5JUWA 2YXEA 2LECA 4CPDA 2M6SA 4NR0A 4X41A 5FR1A 1GGHA 5E9AA 5EZSA 2GN9A 3ADCA 1FYWA 1CNMA 2VPPA 4TWJA 3KTDA 3PNIA 3ZGYA 2LUOA 2ESRA 4FFRA 4IGEA 1JVSA 4LOJA 3CVUA 4X1YB 5AJ3J 3NDRA 1NONA 3AR4A 2Y4NA 2GMLA 2F90A 4QUIA 3I2JA 1UBKS 3RHTA 3GFPA 4K9KA 4PFQA 3WK7A 2VF7A 1ZZEA 3K6SA 4JBHA 2I6UA 4DQ0A 4K50A 2MHCA 4M1ZA 4L6IA 3OL7A 5IARA 3COZA 1YGYA 1Z6GA 4RYLA 1E8MA 1HWIA 5KBYA 5CAAA 3KOWA 3WWCA 2OG2A 4WU3A 1ZA1B 2WWXA 1MW8X 1NQOA 3C3MA 3L0SA 4MW1A 1GOTA 3C39A 1PUIA 1KXJA 5EIBC 1JG4A 1URPA 2W90A 3M4JA 2VDUE 2YX7A 3FVTA 3KG1A 1O08A 2ZFHA 3O1IC 2YVKA 4L4UA 4R81A 2C4WA 1XDSA 3V2UA 4W1RA 3QE4A 4L8LA 2MT9A 1MJNA 1VHFA 3IV9A 4ZVRA 4JV2A 3TZWA 4M1TA 1MD9A 4IUBS 2ZUFA 2NSDA 3CLUC 4WDRA 5HF6A 5M34A 3EZFA 3G8SA 3TMKA 3ZBPA 5EHGA 5K8VA 1E6YA 2ZRAA 1HFJA 2F3PA 1VG0B 4D0RA 3JQAA 3OV7A 1UP1A 5CDYA 1IDOA 1EP3B 3I12A 3O3OB 1SOUA 3ZZRA 1HQKA 4HZUB 2WWTA 1MJ5A 4ISBA 1JJAA 4V02A 5F8LA 2DPIA 2EGHA 5A71A 1KI4A 1J0DA 4JI6J 3BFXA 4LMBA 4EHHA 2ZJYA 4DL3A 2O6LA 2P6UA 1J5EB 1RSZA 3DMDA 5KWSA 4LF9F 4NLXA 1DJMA 4MRPA 4DCGA 3SIPB 3AR3A 4OSPA 3ZW9A 3IGNA 1LTQA 1N8SA 4ENPA 3PQDA 3RFCA 4DWJA 4IRUB 4ZI7B 3LPDA 2CK3A 4TTQA 2MTLA 4RZ3A 1REGX 3CSSA 4PNZA 4KPEC 4NEQA 4TQUS 4FFNA 3DZBA 2YCLA 2A92A 4QBTA 1QUVA 1YL6A 2Z8XA 3W5IA 1R0AA 3FB1A 4CMIA 3NL0A 3UDEA 5AJYA 4EUFA 5K6RA 3VV3A 3AP1A 4HDNB 3Q8YA 4Z4HA 4TUYF 1RJGA 1IHOA 2V4MA 3AR5A 3C3PA 3FUVA 5EE5B 1AA9A 4G3IA 3K7RA 2XGOA 3EXG2 4KYVA 3ABQB 1Z6XA 4JI7J 1FP4A 3GV0A 2J5RA 3UN2A 4KJZA 2J76E 2OEJA 4RVUA 4EHDA 2NO9A 1ZBDA 2IL1A 1Y8QB 2EFNA 2VLIA 4QHTA 1X4DA 3UB4A 3TLCA 1J42A 1G17A 2ZRIA 3G02A 4U7UD 2JBAB 1QGUB 2RF2B 2YWBA 3BWBA 5FH9A 4UMVA 4C7VA 4AJ4A 3EYZA 4KT0C 4MVJP 4F6RB 2Z2KA 3PQEA 5AKZA 4H7FA 3OZVA 4Z1MA 1Y37A 4NXNB 3ZU4A 3PJ9A 4P4LA 1PT7A 2YZGA 4O3QA 2WEKA 4QX6A 1VXOA 2R11A 3TTWA 2A7QA 4DY4A 1IYZA 4BPBA 3UR3C 2O19A 3P5TL 4OH1A 3ONDA 4BMYA 2OCXA 1VM6A 2JDJA 4FYYA 4MITA 2GPWA 4NU6A 2QRJA 1P0MA 2FPIA 4B71A 2VQ6A 4U7DA 3E81A 4M9XA 5FA5A 3ZV3A 2D8AA 2W9CA 2FH5B 2JIQA 3KV3O 4U3JB 2O7RA 1WU8A 3T35A 3CEHA 4LXHA 3TO5A 1ECJA 2XYQA 1H23A 3NH6A 3VGVA 3IG1B 3PI6A 3OSZA 5HS6A 3C45A 3LUFA 1E96A 5JAIA 3KDOA 1ZD2P 3AQPA 2Q2WA 4M9UA 3SFGA 4M0FA 1DBIA 3PWSA 2B4QA 2HU5A 3OZIA 1S5ZA 2GQQA 2BRUC 3T9FA 3P4UA 5CBKA 1WF1A 3RK4A 1OPZA 4LJ5A 3E23A 2PKCA 3PWZA 1SC4A 4LSGA 2OVBA 3GBSA 3STUA 4HH0A 4NV1A 2WFAA 4XLZA 3I6BA 2P90A 3RVSA 4RHCA 2VAPA 4AF7A 2VDQB 3PDJA 1U49A 4YJGB 3H4VA 1K5DA 1X8JA 2GPNA 3WGKA 3ONVA 1XRJA 4FK8A 3DYAA 4DLZA 3OLWA 4MUEA 2HA6A 1IE3A 3O6QA 1VDZA 1KP3A 5TXGA 4B7XA 3QNWA 2AG0A 1VQ9S 1MO4A 4MRVA 2ZOFA 3FMOB 1FXLA 3PXCX 4FOPA 3SLRA 1FESA 3PW2A 3ILSA 1N34F 2R4TA 3AERA 4AG3A 1UJMA 5CB0A 1U63A 4EA9A 1VPEA 4NBLA 2QE7D 3RTBA 5IW8A 5AM3A 4JDUA 1HL6A 1V96A 3BBLA 5HFJA 1M3SA 2YY5A 3FEZA 4ZP1A 3CF5Q 1C2PA 2M9KA 1DX4A 3HDVA 4HTFB 4E4RA 1RS0A 4Z99A 3NBPB 1K7CA 3HVUA 2WK4A 2VBWA 3WL3A 1UA0A 1RTJB 4O4IA 2X42A 3IALA 3W3AA 4JJ8A 4PNEA 1LQTA 3M34A 3GUVA 5B1HA 3DJFA 4MIOA 2EG2A 3C3JA 5F9MA 3ZTTA 3PHTA 3EH2A 2PLRA 5GWXA 1BGXT 2YVSA 3E7DA 5LDHA 4Z3OA 1N9KA 2J0QD 3OVSA 5FO0A 4LV6A 1W29A 3UCZP 4B0PA 1XHEA 1FNSA 5FPSA 2JA2A 3MMZA 3TG2A 1P45A 1R0CB 5JJCA 2JD1A 1WKBA 4EW6A 4RU2A 2VP9A 1E6EA 3QRRA 1E89A 5C7PA 2J6SA 4MMXB 3EVFA 3JZMA 3DBLB 4Q7EA 2VG6B 3ZNNA 5JS8A 1HETA 4JKIA 2YV3A 4XIUA 3HKDA 1VLQA 1DJ0A 4AKIA 1UJCA 3G7UA 3PF8A 1U2DA 4ZO8A 4HD8A 4DRZA 1HI1A 3EGEA 3FDZB 2DNOA 3VH4A 3CRNA 3LGAA 5K8MA 2YIVX 2P9FA 4AJHA 4MARA 3DDUA 2CLOB 2R00C 2C78A 2OE2A 5FTLA 2YNGB 4Y9UA 3HY6A 4ZDIA 2I34A 2O48X 5DYWA 4IH9A 4EELA 3TH5A 1WPRA 3GARA 4DPXA 2Q6KA 1HBMA 1ZHFA 3BXHA 4E7PA 2DR9A 2XKAA 3NCRA 4PFSA 2ZB3A 1SUQB 4QYZJ 4PX9A 5JZVA 4B3CA 4P4SA 5LJLA 4TMFA 4KIAA 2XMKA 3Q7RA 4DW8A 4G5RA 4GNKA 3IOCA 4JLUA 1BXRA 2WVEA 4EMSA 2R1TB 2XUDA 4EJ6A 3HVTB 5D3ZA 3UV7A 2P2GA 2BW0A 4KPUA 3J7ZT 5CW2A 3O44A 3LVQE 4NS4A 1E1NA 3PS9A 2EDAA 5H1SV 4G9BA 3DXZA 2BI8A 2DBQA 4KR3A 1PFYA 4HLQB 2A9JA 4KIUA 3K0JA 4GBED 4KBIA 1G6BA 5CB8A 2PT7A 3NGUA 1BS9A 1XU9A 3IM9A 1TTTA 2NZWA 3SQXA 3GGSA 3QU4A 4E88A 4BUZA 4MV1A 4ID5B 8ATCA 5J9FA 1VI5A 3C7DB 3CC7S 4A10A 2Q46A 1VFNA 3B2QA 4CLHA 2J4CA 2DNGA 5E2IA 4DIOA 2HREA 4EUEA 4DLGA 3IR7A 3N6NA 4IDKB 4ZLNA 1PV4A 4O5AA 1FJHA 5EMNA 2ONCA 1VS3A 2HBQB 4D8YA 4NQZA 5KI6A 4WFIA 1ZH5A 1UQTA 3E03A 4H4DA 5C52B 1FTGA 2G08A 5TQ0B 3U60B 1SUCA 3ZZPA 4F2DA 3TN7A 4CLRB 4QUAA 1I24A 3RGIA 4X4RA 5GMOA 1XKTA 4N0QA 3K32A 4DCCA 2X76A 1GGVA 4XWOA 4NZMA 2CEKA 2IPXA 1LJUA 3UA3A 2FR1A 2GN2A 1IATA 4UT4A 1JLEB 4KRYA 2DOKA 4JU9A 4GZ6A 7ABPA 4R3UC 3ZCVA 1ZUWA 3C66A 1A2KC 1MCZA 5F1KA 1GYRA 2I6XA 4PCUA 3MJSA 4QQKA 4LZPA 2C84A 3QW2A 3NHUA 3ER6A 1XZGA 3DQQA 5KMGA 4LI0A 5FFMA 3V33A 1IBCA 2E82A 4LF2A 3AEXA 2C8LA 3RLFA 2IRUA 1A0OA 2FJDB 2O1SA 3VR3A 3BDAA 2FKAA 5I5GA 1A71A 5ETMA 1WUJS 3D8BA 3O91A 4QXOA 3T3OA 3HEAA 3KTAB 2V8OA 1TCBA 5CT4A 1BQ4A 4HFNA 1PS9A 3CRVA 5FBRB 1OV6A 3NR2A 3VCDA 2MSNA 3T3GA 3AP2A 2OZEA 3HSGA 2XF2A 5CLGA 3BB3A 2R1VA 3NHAA 1P9LA 1X9IA 3IEUA 3UQYS 3EGXA 4CTAA 3HZGA 1G0NA 5ITHA 3F73A 4BC9A 2FMUA 2IU4A 1AZTA 4WJBA 3AFHA 2DNPA 1PT5A 2FDXA 5TF4A 5KYWB 4QM6A 1QF9A 4JLMA 2YTZA 5IN5A 4J3NA 1LRJA 1QWSA 1X39A 2BTOA 2WVHA 4QA9A 2HIGA 5DTJA 4E51A 1H8HA 1I7QB 1PFVA 3G2PA 2X6TA 4WP8A 3CKYA 1FYDA 3ZWQA 5BYRA 3RIYA 2LQJA 4DSAA 1E5XA 3ZHRA 3CX8A 3O2SB 4H59A 4GS5A 2CV2A 1SC1B 3GMIA 4WH0A 3GLSA 2YVUA 2IEBA 3ZR4B 5BR8J 2FR0A 1LWFA 4NCHA 4RLHA 4Z8YA 2YV2A 2ZBVA 2WAOA 2DKOB 3NBZC 1SD1A 2J4DA 3DTTA 3PQCA 1LUAA 3TJZA 5I9IA 4FYKA 1GGMA 3K35A 2W4PA 3UMVA 1IHDA 4CEHB 4WRRA 3T5LA 1JP7A 2GCGA 4UNRA 1AROP 4LJ8A 1HPZB 2AJ1A 5ETTA 1U8UA 2XH8A 2Q9BA 4TXSA 5CT8A 3R9LA 1F48A 2X7IA 3V4SA 1ZETA 3VBEA 4I2VA 4BLOA 5BQFA 1Y1KE 3NYIA 1OLOA 1QSYA 1E62A 2HK8A 5CJPA 5EWEA 1FP1D 2YICA 4LRTB 5BSKA 4GC9A 5EJ6A 4ALNA 2BEWA 3Q85A 3K1AA 2W6IA 2AVDA 2FN4A 4X90A 3NVKI 3KLHA 4LYEA 4FDFA 1RAIB 1B1CA 2BE2A 5D7NA 2A57A 2CE2X 2RK6A 4E5VA 2JLWA 4BFXA 5ALPA 3C8UA 3PX7A 3OM8A 1FXSA 3EPGA 1U98A 3D8TA 3RI3A 4CIDA 1IWGA 2Y9MB 2YY7A 4L22A 1E3TA 3CV3A 3HABA 1NM2A 2GAOA 4XD7D 3GC6A 5CYOA 2V7BA 1Q44A 3BM5A 1YDEA 5F7XA 1YHQS 1P8AA 3OZRA 3CM0A 4PYNA 3EMDA 2VA8A 3L0CA 4MV4A 3BWVA 1LRLA 1U0JA 3N58A 3UV3A 2VOPA 2IEDA 1W5AA 3QBTA 3AV3A 2UXBB 1AD2A 4ZHQB 3CRRA 1IQRA 4AU1A 3PYGA 1WEYA 3GG9A 4U7HA 4DI6A 1HTTA 5FOXA 2KT2A 5ECWA 3HWX1 4UNIA 4LGCA 2W4MA 1NBIA 2ASJA 1J49A 4MWGA 4KN8A 1K3FA 4RWZA 4LUBA 3Q7EA 4JQCA 1GILA 3BK1A 1UFQA 1M2KA 4IG9A 2FMHA 1DLIA 4LFBJ 1MX1A 1NZAA 1CJTA 4QGSA 2HGZA 3GR6A 1CJUB 5GADU 3M1VA 2ZRDA 1DKOA 1NKTA 4CLTA 4UQGA 4I55B 5BOSA 2FW0A 1DDGA 9ATCB 1WSRA 1Y9ZA 5EKTA 1D09A 2WAAA 5DBEX 1L4UA 1O97D 3JQDA 1FTYA 1GLGA 3VHXB 1M2JA 5TARA 4ZMMA 1Y5MA 3VPXA 4DZRA 2RMKA 3ZLUA 1O96B 2QPTA 1KZ1A 4P3NA 2ZW9A 2CZVC 1L1RA 2D0IA 1P5ZB 5AKJA 4DMUB 3G5MA 3FYCA 2GW8A 4RHXA 1KPHA 1ZNZA 4Q1AA 2FFJA 1AGYA 4DIDA 4GQBA 1P1LA 5BQXA 1RE1B 1KNQA 2RG7A 1T5IA 1HUQA 1UOOA 1U2TA 4P5EA 3MUVP 1FVSA 4PQUB 1JQJC 1OXKB 3K96A 1S4EA 4I7FB 2VYVA 3GZ7A 1RYBA 1RAGA 4ZT4A 4MI3A 1XPOA 3N0VA 3GR1A 1RKIA 2NP7A 2Q41A 2ET6A 2JVKA 4LCBA 4N49A 1DT3A 3BHMA 4QFBA 1G4HA 3VOSA 4JJFA 2OHJA 3WL7A 3ADAC 3ZIUA 1G21E 4MVJD 1II8A 1M2NA 1KARA 5CJJA 1SUFA 4UAVA 4IUFA 2ZK7A 2LFVA 2FYXA 1P5RA 1SQ0A 4K2HA 3R7WA 5ECYA 4QXQA 1ECBA 2AFIE 3FJ1A 2NZYA 1YHNA 4FD2A 1X38A 5SICE 1YJAA 4X64F 2RBEA 3W79A 5IWAB 2COEA 1A2OA 2W0SA 3OFVA 2AR7A 3AL2A 4GFDA 4I5EA 3EJ6A 2G0IA 2EJVA 2QENA 1XCMA 2VPQA 4OL0A 2H3EA 4D46A 2B4RO 5E4FA 3V8MA 1NQXA 3AUXA 3RS9A 1PLKA 4YHHB 4WPAA 3OQIB 3NC0C 1W4RA 2TS1A 2EP5A 3KUKA 5TVGA 3ETNA 4B75A 4GECA 1ADGA 3DLIA 4E1VA 3ABIA 5DS7A 3AUKA 4ZZIA 2B8PA 2OJ3A 3EXAA 5GM1A 3E4CA 2O5DA 4PPFA 3GLHA 1Y5IB 3WLEA 4C78A 2AJ2A 2O2YA 5EL0A 3ZV5A 1Q22A 1W44A 3EK2A 1HF3A 1T2DA 4NONA 5J2QB 4AWXA 1KYIA 2XHWA 5LUBA 4FLMA 2GJFA 3PNMA 5I48A 3KYJB 2PSZA 3HEMA 4BEWA 2ZWVA 3DMTC 3W5BA 4QPDA 4GM4A 3LGNA 1Z35A 3OCZA 3ZTWA 1Y1SA 2P2CB 1K8ZB 3THXB 3BBPA 1NQAO 4URSA 3G7SA 4TVOA 3A1WA 3IBSA 2G1AA 3OIYA 3TIGA 2C77A 4XK8C 2E5FA 2H2AA 4IW3B 3B6IA 4TN1A 5H3HA 2DGOA 2PSJA 4N0MA 4NOHA 1Z4KA 1ZM9A 3NHZA 4S2UA 2FJEB 3HT0A 3PX0A 3IQGX 4NXNJ 4CKXA 4NI5A 4BXOA 2A9KA 2BFAA 2V7XA 1WXXA 4UAJA 2RB4A 1TL3B 3NVDA 2EERA 1LEHA 1V4VA 4DR5B 3D5MA 4Y8VA 1C8KA 2Y2VA 1BXNA 5I51A 4R69A 1IWPB 3DVQX 1N32F 1IIRA 2HNAA 4WWSA 4Q0MA 4L4SA 1XK8A 4C4OA 4RNCA 1TFWA 1I5EA 4MXDA 2K7JA 2AGOA 3QXSA 3OWOA 4TS4A 1N1EA 3Q3EA 3B3AA 1V41E 5DHFA 1X9WA 5IVPA 2A14A 3AVXA 5IJ0B 1U2ZA 2HNBA 1B00A 2DJWA 4CNZA 1OH7A 2MCFA 5GV7A 4A8JB 1CUVA 4MIKA 3CE6A 1R7IA 1AS0A 5F64A 4MUGA 5KQPA 1CUWA 1TQHA 2LEAA 3DMJA 4LJKA 1U2GC 1V37A 1K27A 3B7WA 2FJBB 3OR1B 4O2AF 3D6VA 4F92B 3R5JA 2OWEA 1ZD3A 1ZG3A 5F52A 3I9JA 4PSDA 4MI9A 1FFYA 1NL3A 1BHNA 3O4HA 5IF9A 3K4QA 4FQ5A 1SOVA 2EKNA 1GTZA 2XB9A 2ONJA 1EE1A 2GDZA 5HF8A 3KALA 3DRPB 3E3LA 2P78A 4M99A 3PVZA 3B70A 4RYDA 3TAUA 4UHEA 2XOKA 2IJGX 2PYDA 2HHUA 4BN4A 1MN6A 3RTEA 1M75A 5CYPA 4NESA 1XR7A 2VUSA 3MM7B 4HMOA 1S9GA 2ZRMA 4Q3NA 2IDEA 2Q4RA 1JDVA 2NZJA 2XMUA 4HAWA 2GR9A 2QQGA 4QUJA 5BV0A 5M2QA 3IUPA 5DV9A 2OM6A 2V9PA 1Z8FA 1SCJA 2FEPA 1RRFA 1GV0A 4BNWA 4BFLA 2HQFA 1JFRA 5DISB 4FILA 3ZGVA 1E3LA 5HOQA 4IIJF 5D1HA 3SZRA 3RRXA 4O4JF 4D8VA 1RLIA 1EPUA 2XVXA 4KAXA 3TA2A 2DWCA 1VBYA 1J90A 4HXGA 1AQJA 3GB0A 1BXGA 1UMBB 1ZSVA 2A5DA 3RYTC 1BSVA 1XAIA 5DNUA 3FFBA 1Q2XA 4RKEA 3Q23A 1JIIA 1TADA 1Y8RA 4B3BA 3NKYA 2AYMA 3A3OB 1VYUA 1IXZA 2BEKA 1MGPA 3LDGA 3ZWAA 4NP6A 5UKDA 3RBXA 1JHZA 1KFEB 1MJHA 4KSYA 5FB3A 4AS3A 3P9QA 2B7CA 2Y76A 3CPJB 1M34B 2FHPA 2JPDA 1UTAA 3QLVA 4ER8A 1R8YA 5HBMB 3QLJA 6AT1B 2XOEA 2CADA 2Z08A 1NT4A 2CFCA 5HUJA 3G8DA 1GTHA 2XNRA 3G9CA 4CT9A 1BA3A 3NHFA 5AVVA 1B6SA 3OQMA 3SYTA 1ULZA 1PG2A 3KK2A 4I08A 3PPIA 4RKWA 1H1DA 3F1KA 2HAEA 1S10A 1WLSA 3T1TA 8MHTA 3H5UA 2IM2A 2G88A 1YRTA 4OIXA 1X0PA 4FYJA 4AG5A 1J0EA 3A3YA 2CQ1A 4MWBA 2A1UB 4JEIA 1RT7A 3EUAA 4LSNB 5F8IA 1MBZA 1G7RA 3N8GA 3I56S 4RZIA 3E51A 5F1PA 5K20A 2BCJQ 1XIQA 2QGFB 4U8VA 1NPDA 5FLXU 1MQ9A 3FGZA 2YQ4A 1UFVA 2XBMA 5J2UF 1QQBA 2VDRB 2CPFA 1N56A 1HURA 2G28A 2HCFA 2QUJA 1HE4A 4A48A 2AZ3A 1EJ2A 1T6XA 2E1RA 3G6KA 4NLDA 1Z4LA 3PL1A 3A6GA 4F8RA 4LXYA 1R12A 1SN7A 1SCKA 3EXFA 4IZ6A 2PO4A 1EUDB 5HF9A 1RWBA 5CCDA 5KNBH 3T7DA 2O2IA 5EUCA 3DLGA 2XJ4A 1TA4A 2KZMA 4EG5A 3P97A 1NVFA 2EEPA 5JT1A 3NNAA 2EZ8A 3JWJA 4OATA 1KDRA 2HHHF 1YOVA 1JW9B 2WWRA 3NASA 4M7OA 1U0FA 5L46A 1T3GA 1TL5A 3LE8A 2J0WA 1VQ5S 2J9XB 2FWMX 2PPLA 4GP6A 5ITZB 1VE7A 3TGPA 4PCAA 5AVZA 1O95C 2C5EA 2NO1A 3I6YA 4IJVA 1XMBA 4YAOA 1JVNA 3MYRA 1YULA 4PXSA 3M82A 4UVEA 1V3SA 1EJ6A 1PHRA 4K9RA 2MGZA 4LMAA 1R0BA 3TRHA 1G8HA 1TB4A 3OEHD 2V3WA 1WF6A 2H9AA 3CX3A 2EP8A 1DXHA 1K7SN 5E8RA 3D81A 2H1VA 3H5AA 2PMWA 3SDZA 4KY3A 2QTRA 1QR6A 2C2BA 1BH6A 3TIVA 3GXOA 4C6TB 4UEJA 2XMSA 2YMMA 5GGYA 1DI0A 1E63A 3UK6A 5DLFA 1Z7BA 4ZN1A 1L3VA 5KG7A 1VJTA 3OPYB 3PQ6A 3K9FC 3PA6A 3DFZA 5C81A 3LT4A 2O7QA 3NM5A 1AZSA 3OQ6A 4EQ6A 2G04A 2LQBA 4R68A 3CVVA 1ID8A 4G5OA 3GP8A 2ZXUA 4TVAB 3N2GB 2REQB 3ITHA 2HJRA 1Q91A 3QJLA 5CLHA 4RA6B 3H5WA 4R2XA 4TS9A 2IYNA 3A0RB 3GROA 2QA2A 3T5CA 1VJRA 2WFMA 3T3FA 2D1TA 1TJNA 4S3MA 4FGSA 1MWYA 3BH6B 5DX0A 3GFHA 4PX3A 4OYPA 3BJEA 3FLAA 4EHFA 2JHEA 1QGED 4AMZA 5KT2A 1XR5A 2Q1UA 3M6VA 2BVZA 2D4AA 4PS0A 1C29B 1XCOA 4HN4B 3ZTRA 3YASA 1YZFA 2VIIA 1ZD1A 4BE9A 3HPOA 4HPJB 2ZTVA 4ARZB 3BF7A 4FDVA 4LXIA 4B2YA 1OX5A 1R6VA 1JLFB 2Q62A 3U9TA 5CB6A 4BV2A 3EGNA 1TMKA 2A67A 4GWKA 1SQFA 4O0IA 2LE0A 1KAHA 2I9PA 4NYZA 4FFWA 5K8CA 5LDGA 4K4YA 2OKGA 4IAOA 5KSOA 1ZMOA 3K72B 2IXDA 2QTFA 4K86A 4BO8A 5ALTA 3AJDA 3D1OA 3FBBA 1RRPA 3PL5A 4L0CA 1EJBA 3H7IA 4MIEA 3U62A 4UJ5A 3HKWA 2MDTA 2JGEA 2BANA 1TJ4A 3TW0A 2RGYA 3EMBA 3ZCQA 4U7PB 2ZWAA 1KTIA 4UUAA 2QVCA 2WT8A 3CZ4A 5KJ6A 5F3RA 3T38A 3AESB 3GF4A 2GSWA 4PLVA 1HD1A 4BNGA 2GFIA 3EZOA 2NAPA 3Q0TA 1TUVA 3HHNB 1P9WA 4RMNA 4FDTA 5J63A 2GARA 4BQOA 3OMWA 5KHLB 2BFMA 3KZVA 1VISA 5I9SA 1NNLA 4OKIA 2JFGA 1QP4A 2QV0A 1XWLA 4RA9A 2IPOB 3KJVA 4TVSA 4WOBA 3KSUA 2CD7A 4H7KA 4NHEA 2BH9A 3VISA 1JMTA 1KQKA 1WF2A 4HEQA 1GG2A 2FA9A 3NDBB 3CLVA 3CZCA 2CNNA 1CULB 4CO0A 3UB3A 2QLBA 1P91A 1TK2A 4H6VA 3DV9A 1IL0A 1ZAYA 3NANA 4JI7B 2O2EA 1R0SA 2W01A 1CCWA 3VPDA 2FNAA 5B7NA 3RT1A 5JD5A 3RS8A 4GOOD 4D9NA 1RB0A 2RVJA 1Y9DA 2CJFA 2O4CA 2WF6A 3DZHA 1M6YA 3D6FA 4DG9A 3ADPA 3H2VE 3CCCA 4BNMA 3QG1A 4TYYA 5CYGA 4PABA 1QRRA 5IYZA 4OYYA 3N3BC 3H0EA 3LLSA 1HORA 3I9KA 1XWWA 2GEVA 2WM9B 3LZ6A 2W43A 1EFDN 1WCV1 2VH7A 5SZHB 4ND8B 1IVZA 5SY4A 3NIWA 2BW7A 4ZJUA 3W6NA 4D8TA 4KW7A 4NPOA 4JI5B 2O8EA 1IHYA 2I7CA 2QM8A 4PZYA 2VP3A 3EICA 3EIEA 1X9MA 2EFVA 2I99A 3L0PA 3MI7X 4H17A 1GHTA 1KNXA 3MD1A 1JJ4A 3VI4B 3U2QA 2GYWA 4V39A 4I99A 2JS7A 3PFFA 3R6LB 3UFCX 3CXRA 4MQFB 3B1FA 1NKSA 2ZAMA 4Z0TA 2OHVA 1FU7A 1D4AA 1GA4A 4BASA 2QZPA 3DAGA 4KGVB 3DMYA 2K7KA 3JQJA 5DN6D 2GAAA 4KDCA 1DLOA 5FNVA 2YKNA 4RY9A 4NPHA 3M4ZA 2BFOA 4TMWA 4X8MA 2FZ5A 2LQ8A 4Q43A 4CTJA 3KKKA 5JAMA 1HYEA 3H3FA 4GOLD 3MPUA 4EVQA 5I42B 2P1ZA 2FD2A 5J2MA 5BUCA 2PI5A 2FQQA 3UMFA 4YNBA 2JI6A 1B3TA 3BQMB 3WLTA 1RHKA 5ESXA 4JYAJ 2O8FB 4PICA 1QMGA 1SKUB 1G3QA 4GICA 3KK3A 5D84A 1SZJG 1GVHA 5EWGA 3GZNA 4EGFA 4D0SA 1JHOA 1PKXA 4YUXA 4HX5A 5K6AC 3AUSA 3CLTD 3TZKA 2KFYA 4DR3F 3DBRB 1U5AA 2HCJB 2NO7A 2C92A 3D0HE 4BNVA 5LJIA 3RREA 1CJUC 3RIGA 3UQSA 5IWAJ 2BBTA 4DLLA 2DR0A 3E3NA 3BMOA 5DGTA 4A5SA 3NHMA 2IZ5A 2R62A 4MVXA 5FPTA 3PEVA 3M5DA 1J21A 5DHUA 4LKRA 1UBSB 4ZOEA 5GONF 5C46F 4Y9TA 1L3UA 2J8AA 3Q7QA 5DHQA 3ZKWA 1R0BG 3ESBA 1Z82A 2KX7A 2HNYB 4XI9A 3WDOA 1E1RA 3JYOA 1C3OB 1RI7A 1PZEA 2QEXS 3AUYA 2BEFA 4QWCA 2TMKA 3G8CA 3M1YA 3LC2O 1G18A 4MW2A 1OXVA 4Y6PA 1QGAA 4R5PB 2VS1A 3WRWA 3D7MA 2YVAA 4PGAA 1QP7A 4WNAB 2Z58B 3Q8KA 3C5EA 4V03A 4MGKR 4C0HA 1EDEA 1N6HA 4N5HX 1IN1A 3GFXA 4I1UA 2O2SA 5HDBB 1S1TA 3JVDA 1RWXB 2B4UA 1H3NA 1V7QA 3BSFA 1DBPA 4UEQA 1GU7A 5JH7F 1JDNA 1RPJA 4ZJQA 3SYNA 3OT9A 3ZN2A 4FHGA 3I92A 4BE7B 3IJ5A 1KI9A 3HJNA 2C22A 1K3TA 4P92A 1YB2A 4C87A 4UM5A 4ZEXA 4W63A 4GXRA 1TVRA 2LPMA 4TUYA 2R8JA 4N40A 2G9RA 4DR5J 4YK7A 4PVDA 1T9AA 1KDNA 2KMLA 4QIHA 1D0VA 1TUGA 4RZQA 3TA0A 1CLEA 2CVIA 3EC7A 4DV2B 1ND5A 2ZI3A 3JYHA 3AC0A 1UOQA 4S35A 4BU1A 2JLEA 2ATIA 3M1LA 1X14A 4OI1A 1MHPA 3H3XA 3OMXA 5LWQA 2HRDA 3PTAA 1E1QD 3MNFA 5B1EA 2VZ0A 2IEYA 1VG9B 5EERA 4RMJA 3B6ZA 2GAGC 2HXYA 4ED6A 4WESB 3BXFA 2JJYA 3OPNA 5EY5B 3S2GA 4U7WA 4EBDA 1W4LA 1LW2A 1YZ6A 4ARVA 2GMWA 2HK6A 4XPIB 2GIQA 4G97A 3EZGA 1JYFA 4KWCA 4XCXA 1FUKA 2IJFA 5BYAA 4RMHA 3TD9A 5DQIA 3HR8A 1HA1A 2ZHBA 3T1HF 3M9MB 4GOND 3BCHA 3LPYA 4I5IA 3T54A 5K4AA 1YQDA 4DMLA 2PRSA 1N1DA 3NTOA 2CNBA 5AK6A 1SOMA 3PNPA 4B35A 3BZQA 3K4PA 4PWDA 1VQYA 4Z3DA 4L5BA 4FWBA 5B64A 5AM5A 3H40A 2GRUA 3KEMA 2VQEB 1JB0C 1FNNA 3ER8A 1OXXK 1FKPB 2JEIA 1U1CA 3O3MB 2JLGA 2JFFA 4LGVA 4C4PA 3SQLA 3N5KA 3MRTA 1HDCA 4NWBA 5CYQB 4M1EA 4NOJA 4FF3A 1KGDA 2NUTA 3VFDA 2XO7A 1RAHB 3X3UA 3KC2A 2J0SA 4ZGWA 1WDKA 3D67A 2WF9A 5BV1A 4CM6A 3ISJA 4BJ1A 2X3FA 3DXBA 1N2HA 1RJDA 3ZNPA 2ZITA 1I1GA 4G0WA 2IP1A 3IAM9 3HBFA 1ESEA 2IZ6A 1WC1A 4K26A 2Q4DA 1EAYA 3QEBZ 5TGZA 1L8QA 4H1HA 4POAA 5FBQB 3PEHA 1JLCA 5CITA 3JATA 4OHKA 4E22A 3AOGA 4PYLA 3C8YA 5DBIA 3CPWR 4B3RB 1ZFNA 4LSLB 3LGHA 4DBZA 1MV8A 3TNYA 1EWYA 4DR4J 1WBBA 3WMXA 1YJ7A 5EIEA 4Y6QA 4NA2A 3O2NA 3L93A 2FJ0A 5ES4B 4AZ0B 4WP3A 1WW3A 3WKDA 5REQB 4OFWA 3TBHA 3R2JA 1Y7PA 5AUNB 3H19A 1GPWB 3CNLA 1QZTA 4FS8A 1J8YF 4K4UA 4K8RB 4YV0A 1IUJA 2O5VA 2HIAA 3PD1A 2PEHA 2V0NA 5F3WB 4CDNA 1PZMA 1M9NA 1XRLA 5L7TA 1C4KA 2DCMA 2FHSA 1SJQA 4H2DA 1NTOA 4QUBA 2NYIA 1TIKA 4R1LA 4DUGD 4XUDA 2WAQD 3LWMA 5EINA 1VIMA 1JYEA 3H20A 1UFKA 3HXKA 5FULA 1RYNA 3SJBA 2YQ0A 4X61A 4BEBA 2NSJA 2PUGA 1TTHB 4ZVSA 3MM8A 3ACBA 4CM3A 1Q92A 3ZQJA 5A5DA 3QU7A 4R7ZA 4Q9NA 1EKRA 1DRZA 2DQ4A 4CQMD 4C0BA 1NPYA 3I42A 2CCJA 1AHPA 3QFRA 1VLZA 3K0FB 4Q15A 3CUUA 5LFAA 3M2RA 1YR8A 2AX4A 5DWDA 1ZGAA 4OYOA 2B30A 3P9XA 2G0JA 5IDQA 1XQ6A 3Q40A 3NWPA 2J7PD 2HMVA 4OHXA 1HNIB 4B9TA 4BNYA 4U6NA 2CRLA 4I6GA 2X22A 2P11A 1FFXA 3WGNA 4GGOA 4NRDA 4LF7F 1W0JD 3W8EA 3COVA 4TTAA 1FVXA 1GITA 2X6QA 1NMXA 4R8VA 2JASA 3RU9A 1VSBA 2Q2OA 1USUA 1OB2A 2ZBCA 1RYRA 2HGSA 2HZVA 3L01A 1OFUX 4M5NA 1GLVA 1N7JA 2W2QP 4DEZA 3BREA 5LUAA 4NCXA 3SWWA 1N8NA 1PEDA 3AV0B 2HW8A 1AF4A 2Y1OA 1S89A 4OYXA 3FMWA 2Y1LB 5A5VA 3EAQA 3L7YA 3V4VB 1C7FA 3IS9B 1XL0A 2I67A 3L8HA 1BVHA 2FN3A 1VYAA 1YZLA 2B3TA 4NV3A 1DHTA 3BRWA 1J22A 3ZZNA 1QG4A 4BQNA 2QTVB 2VBZA 2KFZA 2GFHA 5FNVF 1L7DA 3A70A 4CV2A 3DOKB 4B48A 4MUAA 1XWIA 2A33A 4YBZA 3FOFC 1K7EB 2JHCA 3WMEA 4M86A 2QT1A 5A9RA 1YZ7A 5CCXA 1PLLA 2WE8A 3C4JA 5LMUF 2XKKA 5JOQA 3CF6R 2PCJA 2DWUA 5IAKA 2JIPA 2GILA 2AIRB 4RD1A 3BM7A 4LFBB 1FOEB 4RFVA 2KHCA 5J4KA 3NG1A 4C0KA 2WTBA 4H4MB 2BQUA 1AUXA 1RYYA 3H5OA 4N1AA 3DTVB 5D3MB 4IH1A 4MKVA 2EX4A 3UGTA 3CO0P 3QVOA 1FXUA 5C31A 1OWXA 2NXUA 1KMMA 1LV8A 1WHWA 1YCFA 3IB6A 3SP1A 4EGSA 3F5MA 1DC4A 2IIVA 1A4XA 2AKWB 1Y1PA 3L8DA 1Z9BA 3UNYA 3EARA 2WRMA 1RZUA 2Y1IA 1FLVA 2E4WA 1ZOOA 5CIWA 3AW8A 4I9GA 2JL1A 1CR0A 3CJKB 1M2VB 1NF9A 4FVCA 4LSMA 3AM3A 3HJCA 1HDGO 4M5DA 3E01B 4JL5A 3OF5A 4EM6A 4CQ1A 2IYAA 3VVMA 4ZAWA 4YJFA 5HQ3A 3LT5A 3WI7A 3GRPA 1B0UA 2NACA 3OUZA 4ZQGA 2QA5A 4DMHA 3N79A 2FSPA 2KYRA 2HKEA 4DB2A 3JXOA 1INLA 1DAMA 3EVOA 1JHYA 4AO7A 2Q9CA 3IFSA 5KFAA 2QVXX 4YV2A 3EZYA 3EXG1 3I2HA 1YVDA 3BGSA 2FVYA 4KZKA 1PAUB 2FIUA 1BY9A 5FA8A 3U7IA 4MINA 1SHJA 2AR9A 1JHXA 3VGUA 1YMQA 1ESMA 1N5OX 4JI0F 3LDHA 1UBNA 3ZQ6A 3CRZA 5LIPA 4EYIB 1KQFB 4BGIA 1QU3A 3T19A 5CXSA 4PZLA 1A8PA 4YRJA 1M2FA 1N9GA 4LVNP 4UAUA 3BBFA 1U8CB 1AQLA 5IC6B 3TI7A 3H3JA 3C3YA 4PZ9A 4DGQA 1M6VA 2EOAA 4G8DA 3CMCO 4X7PA 5AESA 2ACWA 1M72A 2QP4A 2O06A 1N0IA 3GB9A 5BN3A 3PG5A 4IJ5A 1EGAA 1O6CA 2QR3A 3V32A 3DVAB 3QEMA 3R8XA 4KH1B 3WGLA 4K59A 2LXNA 1KJJA 1YJ9S 3GOQA 2BOVA 5JS6A 3UGJA 3QPVA 3MTIA 1K7FB 3I8SA 3O5TB 4EHIA 2PN1A 3MIIA 3G6WA 3ORRA 4X3OA 1Z2OX 1Z2AA 2QX8A 1YZYA 1PJZA 3DR3A 5DP1A 2ID4A 4EK2A 2P91A 3SJ7A 1MFPA 3ZCTA 3BCUA 1BQNA 3VAGA 5E7JA 2DBVO 2VYFA 4J9KA 4CTKA 3ET6A 5H3LA 4NV0A 2XHZA 3N6LA 4OX8A 2NU6A 3SS9X 2EG5A 1O6ZA 2V6GA 2IYUA 3DE1X 3GIKA 5G1PA 4TMXA 3W04A 1YWXA 4F5YA 3KB6A 4NNOA 1NX6A 3TOZA 3WWEA 5JE8A 2Q28A 3VU9A 4L9SA 3WC4A 2RGGA 2J9FB 2JGDA 1HYSB 3E82A 2XMRA 5TGTA 4FTWA 4JI5J 1U7XA 1C3EA 2RK4A 2SCUB 4QDXA 1T0TV 2C2NA 4X65F 4ZGGA 1U09A 3OVAA 1D8AA 4ZVOA 1N7IA 1VYVA 1EGVB 5FXMA 2DVMA 2ZBPA 1RXEA 3GL9A 1RA6A 3UMRA 3ZD9A 1NBMA 4UFOA 1OX6A 3R7LA 3C1UA 3C3DA 2CBZA 4CM9D 2F4FA 4IOCQ 3I9V9 1NDLA 3R97A 3SHWA 1FQJA 2OFOA 3VSDA 3HFVA 1MVNA 2ZRGA 3AHIA 3A1EA 4OZ3A 4UUWA 4D1YA 3TA1A 2XG8A 4CGYA 2KWIA 2VG5B 1AS2A 1COWA 3D6MA 4FBGA 4NYMQ 2A0FA 3AVUA 1WMEA 1CULC 1E9BA 3MR3A 3J7AN 1ZVMA 4ITSA 2COLA 4TU7A 3EGWB 3DKPA 4P35A 5E2BA 4F85A 4F6CA 3TMYA 4BB0A 5IZ4A 2OZLA 4AM8A 4D92A 2VUTA 3DBIA 1VDMA 1Q3KA 4UNSA 5JD6A 4RF5A 3IAUA 1PGPA 5DLQC 5G4DA 1EBFA 1L4EA 1TL7B 4DIEA 1J1ZA 2GESA 1ZRNA 5AVUA 3SF8B 4EZIA 2AK3A 5JLAA 5HIMA 4QQ8A 3PWKA 4OK3A 1CR6A 3PD0A 1E5DA 3NNDA 4EO4A 2MPUA 1EKXA 2QN1A 2DGTA 4Q4JB 2KBEA 3ZWVA 1ZJZA 4CM8B 3PQ7A 4F50A 1MG5A 3U6BA 1GL9B 5FV4A 1L5FA 2OO3A 4E5MA 1Z4UA 4OREX 2C59A 1WSWA 5HKLA 2A1BA 4R7GA 3V8PA 2XVAA 3GJ7A 4QVIA 3K8ZA 4LBPA 5LQJA 3BMXA 1H8EA 2ZE7A 1R5NA 4UD2A 2F1RA 2HJ9A 1TF5A 1V1JA 4J6EA 1X2BA 3UC5A 2HWKA 3Q83A 1IBKJ 2PKYX 4YCLA 3RG8A 3MXHP 3G68A 1Y4UA 4HY3A 5HUQA 2FGKA 3HGQA 1XFAA 3HJBA 2Q1LA 3UJ3X 4K6OA 3RHZA 1UVNA 1R66A 2X5XA 3UY4A 1OQ6A 4FDLA 1ICEB 3VKHA 2JFKA 2G0NA 1JS1X 2ZM6J 1Q1KA 3VRHA 5I7OA 4HEA1 1KY4A 1SKBA 2QBYA 3KXLA 5FR2A 3FZEA 5E6UA 4LG1A 3DH0A 4GZ5A 2HXGA 4IJQA 2NTEA 4WBFA 2AUTA 5EDWA 4K4XA 2E9TA 1CJCA 1P2SA 4RTLA 2PD1A 3ZHVA 2F3UA 2FPXA 3GWZA 4OYRA 3KLVA 4UU0A 3LMKA 4IYJA 4W9MC 1FCAA 3HSKA 1SD5A 3KTFA 3Q7IA 2WD9A 3CUVA 2XT0A 3BGWA 2NYHA 3H7AA 4O08A 1YITS 1JEEA 4E5YA 1SVDA 1QGZA 1DRJA 2FJXA 4NLPA 4FVMA 4TZKA 4PTYA 1S77D 5J1PA 4PG7A 1QFZA 4BQIA 3NKVA 4EG3A 3OOEA 4FVTA 1OBCA 3AEQB 1K7YA 1YFZA 4CHGA 2QE6A 3E5NA 2ANCA 3BMCA 2V67A 4P0TA 2DFPA 5IRCD 5EJ8A 1T02A 2IMOA 3MCTA 1W47A 1WHTA 4RFSA 1W48A 3FWNA 3KLPX 3ZNOA 3D68A 4DV2J 4J43A 2HS3A 1VPDA 4IDQA 3EVWA 3P96A 2AK2A 1WDMA 2HJWA 1ZM4A 4CM5A 2GO8A 2NZ4A 5JVGQ 4FZJA 1RACB 2YJ3A 3QYYA 3RFXA 2AI2A 3AB4B 4FJ0A 1WWKA 1LW0B 2HBYB 2AC4A 3O1LA 4JHLA 4EFNA 3KHRA 4D4IA 3P5BP 3HFGA 1S6QB 4AKHA 3C5CA 3VZCA 5JLJA 1RT4B 1DUIA 4DXAA 2DT8A 3IHTA 3I0SA 1Q6ZA 2P4QA 2ZYHA 1VCTA 2MR5A 1KKMA 4EAQA 2RH5A 4X3PA 4P31A 4KXQA 3MPDA 2EFEB 3DZCA 4EDFA 1NBHA 4OB6A 1A4IA 1CETA 1FUEA 2AOWA 4LF6B 2XYPB 3QPDA 2CQCA 2VRCD 2ZTMA 4H18A 3V6DB 5IBCA 3TR6A 2JFXA 3LTEA 2QD2A 2XQCA 3MWGA 3UVEA 4ND2A 2IEGA 5E4YA 5DHPA 3D2WA 2WFLA 3J81U 1LF5A 1RC8A 3CLKA 4CDMA 2PMEA 5FYDA 2O0HA 4CLPA 4BIMA 4ZVTB 2VQEJ 2XUJA 1U1LA 1FBTA 1HDYA 5IEBA 2O1PA 2IELA 1U99A 3DGEC 2Z57A 3DUFB 1I30A 1X1CA 2Q2NA 1OLSA 4PLPA 3FVYA 2OV6A 1L7QA 2EW1A 4O2AA 2NUAA 1XWFA 2FRDA 1MVOA 3CE8A 2BOAA 1NV8A 3F0TA 3ZK7A 1TM5E 3FWHA 3W9IA 2CPDA 4HGPA 3SBOA 4KDEA 3NU1A 5SYNA 4UQOA 3WLLA 4LSZA 4EVRA 1G8GA 4ESVA 4KK3A 3RYIA 3IQFA 1I1HA 4TSRA 2GX8A 4L15A 2YJNA 1Z5UA 1X7VA 2ZYGA 1PGQA 3I8XA 4C04A 3O31A 4NJMB 1XRNA 5GAJA 2J87A 2V97A 4H7PA 2CKMA 4CFZA 3UT6A 3H2UB 2BGRA 4E15A 2AD1A 2ZCVA 1B70B 1HBUA 1B0VA 4PO9A 1O0SA 4UPEA 3K5PA 2DPGA 4OX6A 4Q7LA 4Q21A 1RYDA 4IIJA 4B3RJ 1QSSA 4O4JA 1W59A 3N07A 3ZZ1A 4DLYA 5LLDA 1KDZA 5JATA 1CUHA 2ECPA 4DDHA 1KWMA 3TLYA 3LQYA 2UUTA 4AVYA 1WDWB 4URYR 4AJ9A 3OWHA 3I6PA 2M5YA 1DX6A 3C3CA 2X9NA 1KR4A 3WK6A 3L9XA 1NW3A 1I3MA 4DCTA 3FPKA 5I3QA 3K9LA 1P74A 1VE5A 2O8DB 1B6GA 2Y4OA 2D2XA 2QX9A 3QFHA 4F3KA 4USMA 1LK5A 4H1WA 2YMLA 4QREA 1N75A 2N9UA 5AT1B 1DG3A 2FSIA 5ALSA 5JW6A 1R10A 2YHIB 1GNTA 1R27A 4QBUA 4HDKA 4QO8A 3CCUS 2XRYA 1JEOA 1DC6A 5KFMA 4F2PA 3W77A 1ONOA 1V47A 2WWFA 3MB8A 1HYGA 4XW2A 3M4XA 2YKOA 1RRCA 3S1TA 1LPSA 2PUAA 1HD0A 4PAOA 1T9UA 3IIIA 2DHSA 2EW9A 5CUQA 4AUMA 3A7EA 3OPMA 4JZKA 5TQVA 1ATZA 3QKRA 3C8MA 1JEAA 4ETIA 3KCNA 3OFND 1M5RA 3F74A 2FV8A 3K9WA 3B4DA 6FDRA 2VHWA 2HSGA 3RJMB 1PGOA 1WS6A 2P27A 2FHMA 3W2VA 3GVHA 4MR9B 2QVLA 1MA0A 5CK5A 2KG0A 1PILA 1WVGA 1XZBA 2Q1TA 1QE1B 1Z17A 4GR4A 2N1BA 5AVKA 2JZ5A 1XALA 4G0XA 1UMCB 1KJ9A 3IUMA 4INOA 2FSUA 3ASUA 4WP9A 3I01A 5F9NA 4ID3A 5J2UA 3VR4A 3LVFO 4AZTA 3MM5A 2QGNA 4GRAA 1L6RA 5ALOA 4L4YA 1E4OA 3RB4A 5C7YA 4RPFA 3HK2A 3MMBA 4MW7A 2DLCX 4MLCA 1KY5A 4JLBA 4MW6A 4CU5A 4XWAA 4PG4A 3QKIA 3SS8A 1VLOA 1R4MA 3A2MA 3W7VA 2RI6A 1WNFA 3I4HX 4NA3A 2Q3MA 3ET5A 3KQOA 4YRQA 2CB0A 3U3OA 1QANA 1R0XA 5FBZA 2GD6A 5B3LA 3TR5A 4FGJA 4V0LA 1RPNA 1RIIA 4WFXA 1D2GA 4NZZA 1NSYA 4ED7A 3FVVA 3RG6A 2C2ZA 4HQKA 3AKDA 2J9EA 2ZPTX 1SBIA 4L85A 5LQUA 1ODLA 2X19A 4DA6A 3OX3A 5JMNA 4QDJA 3UCUP 2ZD1B 3BERA 2FF5A 2YOFA 5H1YA 4B6PA 4USJC 1HQEB 4W5OA 5LSOA 1G66A 1XCBA 4WGGA 3FY4A 4FFVA 3GJYA 3MINA 1XVVA 4YN3A 2JKYA 1NVEA 1E2HA 4IMRA 1D1QA 2SHKA 3EGIA 2XT9A 1TZMA 4DQPA 4J0IA 1NVMB 5JADA 2NXEA 3H59A 1PL6A 1WC5A 1BQ3A 2JDID 4GPBA 3VSBA 3MOZA 4PNHA 4OX9Y 1XVTA 1JWBB 3OJ0A 5IXJA 3TRJA 4MIYA 3R4CA 1Q8KA 3FTQA 4FKXA 4WE3A 1JLLB 4ALIA 3D3BJ 4KKOA 4U00A 1XTZA 4IQGA 3CA8A 3L79A 4C7JA 2ZI4A 1KAQA 2VPZA 2NXCA 3GG1A 4KPCA 3TPCA 3DOIA 1PJLA 3FGNA 1QKIA 1ZH8A 1P61B 4AIRA 2BY4A 3E05A 4JYAB 4QGGA 1U3TA 1IJFA 1GADO 1MB4A 1GPYA 2O5EA 4XWWA 5C1PA 4NCIA 1Y7HA 4FGUA 2HK2A 4P2SA 1MW9X 3ZV7A 1M2WA 1Z5NA 2J45A 3FE2A 3WX4A 3MOSA 4N0DA 3LXXA 5I3UA 2BGLA 5J47A 1O94C 3WADA 4L9AA 4JT2A 1E2GA 2HPHA 1XDBA 1IM4A 3ILXA 4NULA 2RQMA 3PC6A 1E66A 4UOZA 4UASA 4I5GA 5EUMA 3HNRA 4AJ1A 1YKGA 4LOIA 3Q89A 2QSJA 5KVSA 1C2TA 3OOHA 4R0JA 1Z8HA 5FWDA 1RWWB 1ZTWA 1MO5A 4EB3A 3WBKA 1PQYA 4RE5A 5AW3A 4LNUB 3RYFA 3DXFA 4OGFA 4JZYA 1KMCA 3IAFA 4H4KC 2OFPA 3KELA 2QLTA 3VUFA 4NNJA 1S8FA 3JZAA 1UAAA 1E6CA 3RRZA 3UH0A 3L8CA 3O4VA 4CG2A 4I9HA 5U1PA 5AVTA 2AN1A 2XX3A 1UPPA 4B9NA 3GK3A 5EFZA 3HL4A 4B6JA 3DMHA 1VRCA 1CYDA 3LSYA 3QMPA 4UU1A 4K8OA 3H97A 1KK3A 4WY8A 4TKTA 4UFPA 1RT2A 1QYRA 5K0GA 1M5PC 1Q8IA 2GZHA 2WF5A 4C7XA 4M5LA 3D1JA 4G5XA 2QD4A 4CO2A 3DW3X 5K0FA 2VNHA 5JS2A 5IV3A 4PBRA 1KH3A 2O14A 1LSSA 1ORTA 3N6XA 2QMXA 3IR5B 5CYJA 3AU9A 3OJXA 3PJRA 2LU2A 3MEEA 3PHLA 1GTJ1 2GCIA 4OLBA 3HJHA 5KOJB 3EXEB 4PM4A 5C8YB 1E99A 3W2FA 2BMAA 1J5XA 1T5HX 1ZUNB 2P65A 1DUSA 3KLGB 1KYWA 6CHYA 3SJZA 5FWAA 2PWAA 1VHTA 4EFAC 4EG0A 3RRJA 3ZLJA 2CNWD 4WUTA 3G4SS 4BMXA 5CAEA 2IUEA 5A4KA 2IS6A 1ENOA 2RH3A 3OUTA 3V1NA 1FJ7A 4M21A 4TTSA 2G07A 1QVRA 3O9MA 3RADC 4JNKA 3L7NA 1XMXA 1RKJA 4IJUA 1DEOA 1E9CA 4IIBA 2R9LA 3FCUB 1MHTA 3D8UA 3NM6B 3VX3A 3HTXA 1S79A 4ZOLB 3JAMU 4C4WA 2Q3LA 2WONB 3DAFA 2HKIA 2HWUA 1QUFA 4KYIB 3OAAA 1TM2A 2GMJA 3EQZA 4D3DA 1VZ3A 5CLJA 4OXYA 1JV2B 2H29A 1GZ6A 4YGXB 4MK7A 4HI1A 1QE0A 1P0CA 1AA6A 2AX0A 3QVMA 1RFLA 5RUBA 2V7QA 1L5GB 1QB7A 2YN4A 4Q4AB 3PE6A 4EYGA 2W7PA 3E8OA 4KSEB 4J75A 4BCCA 4C11A 2HLHA 2AI3A 4OYBA 4TY8B 5CJ2A 4RIIA 2HWYA 1YBUA 3TO8A 1T0HB 2BRKA 3RIHA 4R2LA 1ZPVA 5I01A 3NIFB 3E9YA 2ZH9A 5IFKA 3K1JA 1IQ0A 2KM8C 2QJRA 3D4IA 1VGVA 1WE2A 3ENQA 3SHQA 2Q7OE 2JLSA 2NOAA 2XCLA 5DTIA 2Y1RI 1SL1A 4EQZA 4MUFA 2ATXA 2J3KA 4QJBA 4N3BA 3ABSB 1ZITA 3SMQA 3F3KA 2OQIA 4CKCA 1VPLA 4D2IA 3WGGA 4O02B 4L08A 4ZQCB 2JAOA 2XE6A 3WB9A 3ZGOA 1A72A 4CN9A 3EDRA 4L78A 3ZWNA 5JPIA 3G86A 3EYWA 1MZPA 2MYNA 5CDHA 2VFVA 1W2HA 2QLJB 1QE5A 3A6FA 1USWA 1FRIA 4LQLA 2P4SA 4Y6RA 1KZ4A 2W7TA 1PDVA 2C4UA 1YC2A 3JYPA 1IKXA 1N2ZA 3D54A 4PLWA 1PWZA 4ES3A 4DM3A 1VLLA 1DZ5A 4DR4B 4D56A 1VBZA 4WCFB 4QLAA 3JQ7B 3R8CA 2G06A 3F78A 3KFVA 1SPXA 4J1TC 1TL7C 4DV0B 3RE1A 1FXWF 5J4VA 1YO6A