3ENWA

Substrate and inhibitor complexes of ribose 5-phosphate isomerase from vibrio vulnificus yj016
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
b'TQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEEIKGAVSSSVASTEKLEALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREKIVAAIADKFICIVDGTKAVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITDNGNVILDVYGMKITNPKQLEDQINAIPGVVTVGLFAHRGADVVITGTPEGAKIEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title Crystal structures of substrate and inhibitor complexes of ribose 5-phosphate isomerase A from Vibrio vulnificus YJ016
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Isomerase
total genus 68
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3enwA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3enwA01
2FGCA 4L51A 3ENVA 4IO1A 2DT9A 2LQJA 1O8BA 1SC6A 3U7JA 3ICOA 2PC6A 1UJ5A 4GMKA 5T41A 2LVWA 1FQOA 3OBIA 4L4YA 3NRBA 2RI1A 3CSSA 2H9ZA 4L5JA 3DDNA 2O0MA 3BXEA 3L7OA 3ENQA 2OKGA 3KV1A 4OQPA 2NYIA 1PSDA 3BXFA 1ZPVA 1FS6A 3DHWC 3BXGA 2BKVA 1YBAA 3IBWA 2KO1A 2GNPA 1FSFA 4L50A 1NE7A 3EB9A 2QSWA 3HHEA 4L4ZA 2MDAA 4R9NA 1DEAA 3OFFA 4L5IA 1HORA 2JOQA 2P9CA 3LUYA 2WU1A 3MAHA 3OFEA 2PA3A 3UW1A 2P9GA 3KWMA 4GO5X 3OC6A 3E7FA 2RI0A 4LUBA 5HJ5A 2P9EA 1HOTA 1FRZA 4TM7A 2F8MA 3W7BA 1KS2A 3S1TA 1CD5A 5JJBA 2RE1A 1Y89A 2I9SA 1LK5A 3NZEA 5IT4A 1UJ6A 3LWDA 2J0EA 4PWUA 4M8LA 3BXHA 2W48A 2RQKA 3AAWB 4GO1A 3CH7A 2DTJA 2JHEA 3OFHA 2BKXA 1M0SA 3K5PA 3P96A 3HN6A 2R5FA 3TUZC 3LOUA 3CEDA 1FS5A 1Y7PA 3AB4B 5FIIA 3LHIA 1JT9A 1YGYA 4GO7X 3OFGA 5IS2A 3MTJA 4OQQA 1LK7A 3ENWA 3N0VA 2QMWA 3DHXA 3DC2A 1RWUA 2F1FA 2J0XA 2J0WA 4X84A 3EFBA 2CDQA 3AB2B 1PBTA 1UJ4A 3MWBA 3TUIC 1LKZA 2QRRA 3IXQA 3O1LA 2RQMA 2QMXA 3E15A 4NMLA 3TX2A 1XTZA 2ZHOA 1VL1A 1U8SA 4R7TA 3TUJC 5IT0A 4TM8A 3NWPA
chains in the Genus database with same CATH superfamily
3A4VA 5DLFA 1XEXB 3M8WA 4DSIA 2M2IA 4FQ7A 1P73A 4BHQA 1NF8A 4O4LB 2GN9A 1H3DA 2GKOA 1RRFA 2HHXA 3OPMA 3WFIA 4J49A 3SLKA 4F4XA 4DGSA 1T95A 1R2QA 1Z18A 2CXQA 3R5DA 3JQAD 1XO1A 4EQ6A 3FDFA 4CDGA 2GPNA 3FUYA 4PZYA 1RYEA 4IWYA 1ISGA 3ZV6A 3D6FA 1ZISA 3OE7A 3FYTA 1F6DA 1J5OB 2FKNA 3HP1A 2H4HA 2XRZA 1P3JA 3SP1A 2O4CA 3MAAC 4NIMA 2CDCA 3ROQA 4ESOA 1AE1A 4ECYA 3FBFA 2DCUB 3CN7A 4MQBA 3JSMA 1TQ8A 3KSMA 2WUFA 3Q8PB 1Q14A 1NE2A 1SH7A 2QL7A 2YZMA 2W6ID 2M8DB 2ZI3A 1QSGA 4ZP8A 1QV6A 3AK4A 3TUJC 4ENWA 1VK8A 4Q1EA 1Q8IA 1ORTA 3T7SA 4LRYA 3KHHA 5I4KA 3SQOA 1JK9B 2H0AA 3SZRA 3T0GA 1NVAA 3OIGA 4RHCA 1VL2A 3GGPA 1GQ2A 1KI4A 1SKAA 1GCAA 5I01A 1V43A 5IYZB 5F9MA 1TX4B 1C0TB 5TMEA 4CG1A 2Y6UA 3G49A 4GVPA 4LJ6A 2YX7A 3KXIA 3AD7C 2I1VB 4HDQB 3ZGLA 1VQ4S 3HVJA 1TEVA 3VDNB 3L4BC 5CGQB 1DBPA 3R7DA 2VAPA 4EHAA 1U0FA 3SYTA 2C2RA 4R2KA 1WQ3A 3GSIA 4AN4A 3V4ZA 4YR9A 1GXTA 1MVOA 4PHGA 1DSSG 2WILA 1EE2A 3U27A 4L75A 4Z54A 1EVKA 2Z5VA 2XD9A 3GRYA 4CNYA 1NLMA 4FHCA 2X0KA 2AQKA 2X23A 3USZA 1YQUA 2YV3A 2GBLA 5LMUJ 3OUZA 2BMEA 4R0NA 5KQSA 5EGSA 3DT6A 4JJAA 3W06A 3FPAA 5LPNA 4D9KA 3G2KA 4E5KA 2V6FA 4D3ZA 4K7JA 5MLCV 4X1IA 1RBOB 3G0IA 3MEDA 1UP4A 2DJWA 5EZYB 2G2YA 2Q3HA 4N5DA 3RF7A 2O3QA 3F96A 2A59A 3ZNQA 1CLFA 4FK8A 1HA1A 5EUMA 2IMWP 1SCDA 1X7ZA 2ADFA 1BQ3A 3LPDA 4QPCA 4AMUA 4B81A 3I34X 1GTSA 1IM2A 5A6SB 3RYLA 2XR1A 4DRXB 3UFBA 1WG1A 2G17A 3C5VA 4D9NA 4F04B 3MPOA 1Z5PA 1YIDA 3MTIA 4ZPDA 3DLEA 4OOFA 1ZOTA 5GJBA 3MFHA 2QD2A 4X7PA 1K6XA 2OSBA 2Z56A 1TEXA 4ZPBA 1SOWA 4B7XA 5KG7A 5D3QA 2ZM6B 3P96A 5CPFA 4X44A 3E4DA 3NALA 4NICA 3PFEA 4Q3EA 4NF2A 2C4WA 4TRRA 2RG7A 4W5NA 2CNDA 3LM8A 2AXQA 4NATA 1Z35A 1TJ4A 1CJKA 1D9AA 3NIFB 5JQGA 2J9ZB 1OYEA 5GIPE 4ICIA 2AUMA 2AR0A 1NU8A 4ZAXA 3PYXA 3BYRA 2YNGB 4OQNA 2UUPA 2AD1A 2H57A 2IODA 3ABOB 4RD4A 1Q5VA 3NFYA 5FXMA 1GRVA 2EGGA 4HGPA 3NRCA 4J03A 4XARA 3U02A 1JLRA 4O5AA 1MH9A 2ZZKA 4MV3A 2UVPA 1PKUA 4TSKA 4NYZA 2BFEA 3IALA 2WJIA 5L1IA 1QJ4A 2B94A 2ZUUA 3BDIA 4EGFA 4CKYA 5FOWA 2VZ0A 3NBKA 5LD2C 1K73T 1XELA 3UH0A 4JC8A 3V3KA 4YR3A 2ACYA 5EJ7A 4ND2A 1DFGA 1RJGA 4NLDA 4X60A 2B8TA 5HAOA 1VHLA 3VAGA 2GZHA 3KUXA 5KQLA 2IHVA 4DS5A 4FWTA 2HVHA 3ITNA 4LHZA 3ZWNA 2AB0A 3EA4A 1UMDB 1ZA1B 1JDNA 5C24B 3MI7X 1FVHA 1JPVA 1B26A 5HQTA 3O6QA 3NUZA 3OQHA 1NVKA 4KAJA 3L2OB 2G06A 3VH3A 3F6EX 2BFWA 1O89A 4AXBA 4H7EA 3WJAA 2RC6A 2FRDC 2AZTA 3G0GA 2ON6A 1AHPA 3E82A 1VE6A 2NSLA 2XXJA 4TQAA 4E33A 1EIWA 4E88A 2MLZA 3KTQA 1V6SA 1JBEA 3O2QB 3DFFA 1ILEA 3IHKA 4HWKA 3BF4A 4F3QA 5JCOC 3NL0A 5DHFA 1QIIA 3FBWA 2ZB7A 4QOTA 4G56A 1HNIB 2GZMA 5EPEA 2DIUA 3H11A 1Y4DE 1RWNB 1AXGA 4DV0J 3JARA 1MUUA 3ELWA 2Y9HA 1BMDA 1M2VB 5EXEA 1M1HA 5L46A 2GAJA 1U4OA 3KDAA 6REQB 4PO9A 1IZ8A 2WA2A 1YHZA 4QGAA 2RFLA 3O8LA 1Y3HA 3ETHA 1XZAA 2L2QA 4B40A 1H6CA 4ARCA 2A3JA 1JG1A 5KUTA 4EH1A 4MB2A 3VU8A 1IY8A 1FRLA 4F56A 3BDEA 2Y0DA 5JS6A 4B7ZA 3GLKA 3Q8SB 2W7OA 4QTYA 1RUSA 4PYMA 2C5EA 3EFHA 3QJGA 2Z2IA 2BBTA 3WLAA 3A36A 3LUBA 4GX0A 3PTAA 4GYJA 2AMYA 1VI2A 1EVIA 5I45A 4U6SA 3VO9A 4PR0A 2R84A 1X6VA 3E58A 4CMIB 1SELA 2I2XB 4J6FA 1VE7A 2OIHA 1UZMA 2WOOA 3FJ2A 3V48A 1DV1A 1P7ZA 3UTDA 1ZZGA 1PYSB 2C1EA 3BBBA 2OD7A 2XNDA 4MAMA 1A9ZA 4FXVA 4RKRA 3UHJA 3ZDFA 3GFHA 2B8QA 2VDWB 1ZH6A 3V34A 2I38A 1HFEL 4UNQA 1BXZA 2B3TB 2XGMA 4RMHA 3E2MA 5ALTA 2VPXB 3U3JA 1I2AA 3IN5A 1DTTA 3AHHA 3G3EA 3W61A 2YBEA 5CU7A 1MMNA 1NW8A 2I0XA 4DR5F 2Q29A 3OOWA 4PLZA 4D8XA 2KT5A 3E22A 2C2NA 1DLIA 1EZZA 5K3AA 4QJVA 2EFYA 3V00A 4ARIA 2V9PA 1MA3A 3L0BA 3VH2A 3KJQA 3C5EA 3GJQB 3IR6B 4M5JA 1IBKB 4DJAA 3IGFA 4ZODA 5ARBA 4B6EA 4EJSA 1B8NA 1EINA 1T11A 5DHSA 3DAFA 1AH2A 3MQFA 5EHIA 2IHYA 5KU1A 1NLZA 1IKWA 5K8TA 3GFFA 2BTOA 4CU5A 3ZBQA 1Y3AA 2F67A 5TEWA 3CIFA 4OY3A 3V7UA 4EBCA 3HUUA 1HFWA 1KS9A 4MPPA 1ESEA 3DWEX 3TAHA 3SJAA 5J3JA 1OIAA 1OXMA 4LPKA 2MQLA 3B6JA 2ZBVA 5CVVA 3VVCA 3DBLB 3G0HA 3M6XA 3C6QA 5D3GA 1RBYA 3VAJA 1CEQA 4Z9XA 4HUTA 5MFPA 4JL8A 5C53B 1K8YB 3TQHA 2NU9B 2QP9X 3CC4S 2J7WA 3SICE 4EECA 5GIOE 4MGEA 5FIUA 1KKMA 3C97A 1EETA 3CJ3A 4N12A 4Q4DA 2BHNA 2J4DA 2D3WA 1NDCA 1JLLB 4JA2A 4JJGA 3AUFA 3AUSA 4RWZA 5LJ5Y 1XMQF 3MWBA 3LC2O 1DC7A 3C39A 2ZJ8A 4FYIA 1LLDA 2KT3A 3FQKA 3ZZYA 3AR3A 5A8WA 3G6KA 1PX2A 2O0HA 1Q86T 5K2MA 3R6LB 2IHR1 4K2HA 3UK1A 4RU9A 2OPRB 3AOAA 3BMXA 2EGUA 4DPOA 3RT1A 5AJXA 1LLQA 2PA8D 1LUAA 1URRA 1DIRA 3RFFA 5K3BA 5LJLA 4KCGA 1S72S 4YCBA 3V4RA 3EVGA 3RC3A 4Q45A 3BMCA 3CVWA 4XCQA 9RUBA 2LBPA 3QXXA 4JUIA 1D2CA 4I1UA 4C4XA 4EVRA 1NW9B 1Z06A 2QRVB 1GZSA 4O6VA 3QYYA 3ZDXB 4G01B 3WWYA 3CS3A 4ALZA 3RVMA 2Q7DA 2ZJBA 3GCZA 2RAVA 3EBPA 2HWYA 3RWMB 2JGEA 1IL0A 3A2MA 2RG1A 2GIFA 3MPYA 1H66A 4QFBA 2AGOA 4FFDA 3NGUA 4FCWA 3AXMA 4HYYA 5JI2E 3BCRA 2MMGA 5H68A 3ZDDA 4F3NA 2XTZA 4EEYA 2H1IA 3IPCA 4FP9A 2EARA 3KQUA 1FRNA 2AV5A 3JQMA 2QI9F 1C9DB 5KPJA 2DHSA 3D6MA 3I6IA 2Y1OA 2EFDB 3GY0A 3NWEA 4QR2A 3RM3A 4BB6A 4YJKA 1T03A 2QUAA 2UXDF 2Q7OE 3TBFA 1P2UA 3V4OA 1U2RA 1AIPA 2XD4A 3NHAA 3A3YA 4O3NA 4ZCIA 2I9SA 4ATNA 1H4SA 3A3OB 2BTQB 4H27A 2AEEA 4X71A 1XEZA 5B0CA 3MM8A 2JLZA 2MTBA 2D2IA 5EL0A 1SD2A 2C7BA 2E4UA 2R48A 4TN1A 2E48A 5KFDA 2WW4A 2VYQA 3AJ1A 2YINC 4B48A 1VSVA 3J80Y 2Z3VA 2RGXA 4LGVA 4BAGA 5HS6A 4HRVA 2WD8A 1S2DA 2Q4EA 3MRTA 5BPHA 4C5CA 3CDWA 1Y5LA 2C1ZA 2IWHA 3HBJA 4DDWA 1MWQA 3GEBA 1BEEA 2HBQA 3NG8A 1RK8A 2OG2A 1CBUA 4MTPA 1M2WA 1K9MT 4CM9A 4XUCA 1S6YA 1T4BA 3WAGA 3MM6A 1S4QA 4HPWA 2W24A 4H1WA 3CW2C 5BVHB 4MZDA 3ZIDA 4TQSA 1IHDA 4B3JA 3N01A 4GLLA 1SVSA 1G3UA 1MOQA 2WSYB 2XT0A 5J2NB 3NIGB 3T1VA 3FWZA 2AQHA 2IEIA 4C3UA 2H4FA 3OZWA 4M37A 1ETHA 1RW4A 5I47A 2G76A 2QG4A 5IJ9A 2Y9PB 4N0MA 2DQKA 3AXKA 2IDMA 4AIRA 1V8OA 3ET5A 2PK3A 4WV3A 3VJRA 4S12A 2JH9A 1HDEA 1YR8A 1T1EA 2H4YA 4PCLA 4LF9J 2IDZA 5FH9A 3REGA 2W8BB 5EFOA 1GKLA 2IA6A 4OQDA 4KHPB 3EUEA 5FOVA 2PY6A 5L95A 1XHLA 1USIA 4DA9A 4RABA 1EUCA 2JLGA 1H2EA 3OLWA 4LZNA 5HK4A 5K9FA 3AHCA 1VP9A 2E6UX 2Q5LA 4BV8A 4R1UA 1GYQA 1PJ7A 1SL2A 2WKSA 2C4MA 5IQQA 5JAQA 1DMSA 1V5GA 2VH5R 4DSKA 1RXOB 3LT0A 1WPRA 2NXJA 4QUAA 3AX6A 1JLAB 3I04A 4U7FA 5JLJA 1ABBA 3CXRA 2K3IA 1ODIA 1TF7A 4MS4B 4YHHJ 3TD6A 4ESVA 1L4KA 3CSUA 2BKLA 2Q4OA 4M98A 1YZUA 2JFPA 2Q62A 5CG2A 3TQSA 3P52A 2CJ9A 4QJ4A 1WV0A 3SZLA 4OXXA 1VISA 3NBUA 4AL6A 2C8VA 5DS7A 3ADPA 4ZFNA 3I87A 3E84A 1E2HA 4ECRA 1K5DA 5KTYA 4OGLA 1Y37A 3A9WA 5KAMA 1C8LA 3ENVA 5CD4A 3LP1A 4DSTA 4GBJA 1F0XA 5CB4A 4L8YA 4MOWA 3ECSA 2UYCA 2ABWA 1P7PA 2VG6A 2HEKA 1ZNQO 3BJIC 3O7WA 3UQZA 1QFMA 1MIOB 4KYTA 4L4ZA 121PA 3V8BA 2C0PA 3E2IA 5DZ7A 1L4BA 2WAYA 2RGAA 5C8YA 2PR2A 4HJXA 3WDMA 1X19A 2FAXA 5DB4A 4D45A 3U31A 3V6DB 4I8XA 1W9HA 4UBKA 1FEEA 3PDHA 3B5EA 1P44A 3DKDA 2JGAA 2P9YA 2QTLA 1CZRA 3HKZD 1A5SB 4MUJA 1SCBA 1LDNA 4L6IA 3P2OA 1OXTA 3H2BA 2EFGA 4HEA9 3D0HE 1RCXB 3HVHA 4BNNA 5H1SV 1IOVA 3FVWA 2JL9A 3DONA 5G3YA 4AYTA 3A58B 4MWEA 1L7RA 5BVGA 2P6MA 4ZP7A 2RGUA 3DOMA 3AG6A 2O6HA 4EHIA 1VJQA 1LBIA 3BILA 4OX9Y 4J2OA 2ZR0A 2P2ZA 3WIVA 3D1JA 1XWFA 4QU8A 3DM5A 1TKRA 4O8ZA 4JYAB 4LZLA 3BSSA 5EX3A 1DJLA 3Q23A 3I04M 2FMFA 2FWJA 2HBYA 3PYEA 1P2TA 3JR3A 2Y3IA 4PSUA 1REVB 3A6HA 1XPUA 4X1KA 1VXRA 1IM4A 1N2GA 4L72A 3HSGA 1MXFA 1UKEA 3CJSA 4G1PA 1NNSA 3NHRA 3DOKB 4ZOLA 3WGNA 3FY4A 4CKZA 3SQWA 4K5SA 3UPFA 3O21A 1XHFA 4YDHB 2K3KA 2DNLA 3ZWBA 5DM2A 4MIYA 2VTDA 4PAWA 4L3WA 2DTJA 5E3QA 3OFHA 2VG5B 4MV0A 2V7VA 1SXJB 4RKYA 4QX6A 3CMES 1W2GA 4CZCA 2ZWAA 1BU5A 2DHGA 1PQUA 2R2SA 3FDZB 4LQ3A 3H8YA 3L6OO 5IMBA 5LCXA 4L2IB 3EX7C 2FHJA 4YDSA 3HFSA 3ZI4A 3GV0A 3F1LA 4ZWNA 4WFZA 3G89A 3A9UA 3FRIA 2W58A 1TGVA 2PZ8A 3QQPA 2NAFA 4IG4A 2IAJB 2Q41A 2QZSA 1Q3HA 4FR2A 5HSGA 3FFWA 4D26A 3D1OA 2H1YA 4DEYA 2IX9A 5BW8A 1WMFA 4UZFA 2F3QA 1AX9A 2JFUA 5FOSA 5EQFA 2Q2OA 3FE2A 2GEJA 2YRXA 1P91A 5G2OA 4YP6A 1XA4A 3OVMA 1RI4A 5KSZA 3RFXA 2FEPA 4TXNA 5F2KA 4M0EA 1RTJA 3VFDA 4G25A 4JI6F 3DV0A 3G7UA 3PLAE 4FONA 1XIVA 4HMQA 1X7DA 2BZ1A 4I4TF 4DUYJ 1V8FA 2Z8ZA 2VP6A 5K8PA 1CPYA 2PM8A 3L8ZA 1WKKA 4ND4A 3SXJA 4L1KA 4TSRA 3RK0A 4BJHB 4CF4A 1K88A 1W5AA 4LF5B 1H3NA 5SICE 5KQRA 2IELA 2EFEB 2Z95A 1SGWA 4R8SA 3DLHA 4ZO4A 2O2HA 3SC2A 4PPNA 4ED8A 1P74A 2IA5A 5LQRA 4CETA 2QS9A 1LI7A 1G19A 2O06A 4QTZA 4MDEA 4IPTA 1YQXA 3KE9A 4P92A 1MJNA 1M0EA 4I9GA 2RJZA 5HHTA 3LUHA 4IRUB 1CUGA 2Y92A 3NNDA 3IIMA 3PUJA 1L1QA 1VLOA 1WUKS 1PT7A 4N65A 3OTOJ 4Q8EA 3ORSA 2ZS9A 1J97A 2IEDA 2XKBA 4DS4A 2VP0A 3W9HA 1SUBA 3KLIB 3QRQA 5IMSA 1AMNA 2K1RB 2AT1B 3EDMA 4I4NA 2VBYA 5FOXA 3R5SA 1FRIA 1FFGB 5KT7A 4L0MA 1JEDA 1WC4A 4KOAA 1JV2B 1DQPA 1U6BA 2ZC4A 3GRRA 1PC5A 5CCLA 1QB8A 2CVPA 4RK0A 1QNLA 4E32A 1KH3A 4ZEVA 4FGWA 1OWLA 1G3RA 2WV7A 1NK9A 2FJPA 5FNVB 1PZFA 1F8GA 4ZQFA 2QC3A 1XZLA 4KX3A 4GE3A 1SKQA 4LDJA 1W36C 3DE6X 5KX5B 3HJAA 1DX6A 1CS4A 2D0IA 1ZD9A 1M2FA 4Z7NB 2HZCA 2IPXA 2VHTA 5F78A 4B3SF 3HLTA 3GE9A 4K9KA 3I2IA 5DSZA 2DY0A 2C2EA 2HPVA 3LUPA 3LQQA 3HKWA 5F9HA 4NH0A 2ZRFA 1VG9B 4YT4A 2DQZA 5CB6A 2WONA 1GLNA 3GIWA 5B1IA 2GZRA 3ZDCA 3MEEA 4ESHA 1JKHA 1GVHA 3QT7A 1PLKA 4MA5A 1WZEA 1LZLA 3FVYA 4B2PA 4Z2AA 4YQEA 3HY6A 2GRUA 1DTWA 1NDLA 3CEMA 5HO4A 2GCOA 3FOFC 1OSCA 1OX6A 4GC6A 1CF9A 2YY6A 4KWTA 1QE5A 3QGPA 4V0KA 3B3JA 1OV6A 1WACA 1XZJA 1QF9A 5ALEA 4LG1A 3W90A 4NZ9A 2YH2A 4WGGA 3CT4A 1C2PA 5L40A 2OMEA 1OWMA 1S57A 4BWFB 4YRCA 5AKHA 5JATA 3HC7A 3M6MD 3LNTA 4IOJA 1AZSB 2AHOB 4NR0A 3CMAS 3DRRB 1VBMA 4O4GB 3PQ6A 3MIIA 3BMNB 5KVSA 4X45A 1ISFA 1WUHS 2SKCA 2BFPA 2LPMA 4YB6A 1VECA 2CADA 1BA2A 4NA3A 4B3MB 3ZTSA 3HT0A 2M1XA 1PI3A 1SU8A 1T9VA 2JF0A 4LCJA 2CWDA 3DBHB 4A6XA 4FMPA 2IHUA 1IKYB 1YR6A 2FPIA 1QG4A 2IKQA 2VEOA 2C42A 3GUVA 3KB8A 1XD8A 2FEKA 1M9NA 2VH1A 3CH6A 1HLWA 2ASEA 3B8HA 1R37A 2HK3A 4DX6A 1TUGA 3QX7A 3PEVA 3E9RA 5K3DA 2PUBA 1XGKA 2D54A 3M5WA 3FMWA 2RGYA 2TYSB 5A3QA 5A4JA 4M8LA 5F3WB 1YJ5A 3HKCA 2F6RA 3QU9A 1T8UA 5JDIC 4M9CA 1TZKA 1NQ5A 3KIPA 2AE2A 1JG6A 5AVWA 2OSVA 1RTDB 2ZT7A 5A3SA 3K70B 3C4JA 4C89A 4Q5VA 3F6RA 2VG7A 1ZMRA 4REOA 3WK5A 2O6LA 3GLJA 4WYLA 1FMFA 3U4CA 2GPWA 1UCNA 4KMMA 1HBOA 1S2NA 3SCJE 3PHJA 3GFGA 3GQBA 1PS8A 3OLXA 1DUVG 1WJ9A 3ZGOA 1NA5A 2R0QC 2BR3A 4C7QA 3DRSA 3QIPA 2ZRQA 1VRUB 4DR3F 1QZTA 3MINB 4R8RA 2OHFA 1BVUA 2QMYA 1SU7A 4N7JA 2YJ3A 3DVAB 3PYLA 4C48A 2PEBA 3D7SA 4EJMA 1X13A 4R3WA 3IQWA 3T38A 3DUWA 4UXHA 2XCTB 1IQTA 2DGDA 4D8UA 4DDUA 1C9NA 3GTYX 2OA0A 2SECE 4KV8A 1ODJA 1L5UA 2PKQO 3GDHA 1LDGA 2C31A 1XVIA 1SC1A 3UAOA 2MQNA 4RW4B 1NWCA 3MK31 4J4BA 5DXJA 2B6HA 1R6BX 2ZH8A 2GHQA 2CDRA 5C5DA 1CB0A 3LOPA 5CIYA 3U4QA 3KYBA 5KQGA 3KZKA 1ZNZA 5LN1A 5EKUA 5HOQA 3IJEB 1U3WA 1MORA 1P4AA 3ZR4B 5CEJA 4ZC1A 5M34A 2NUTA 2XLBA 2R8HA 1QK4A 3DLCA 1WHTA 4XDCA 1ZGCA 1V1MA 3Q2SC 1KQNA 1ZKMA 2HA7A 3RR2A 1PKXA 1X77A 3C6TA 4RULA 1KVJA 3PEEA 3DO6A 3CJKB 1Z34A 4M9RA 4NXMJ 4MR7A 4QAJA 3P5SA 1CHDA 1F17A 4NAUA 5KG3A 1KTIA 4NI5A 3PNKA 5LOVB 1L7DA 3S1AB 4RACA 4YY3F 1HPZA 2RUGA 2P2CB 1GGNA 1CD5A 3O4VA 4IDKB 3JYOA 3J80A 1IY1A 5GOZA 2W5UA 4F60A 1QHGA 1N1MA 1XZFA 3MPVA 3G82C 3P4XA 1CUVA 3D81A 4LF4F 1LW6E 3TZEA 4U2DA 1W1WA 4DIDA 1VKZA 1HBMA 3JQJA 1RT6A 2OFGX 4DLEA 4DG1B 4HGRA 3V1TC 4RF5A 4X61A 1I5OB 2GO9A 2WHPB 3NVMB 1KZYC 2BKPA 5DOVA 4I66A 3OO1A 1DLJA 2JFWA 1ZIXA 3EICA 3LP0B 1YBUA 5EEGA 4TL7A 2VDVE 3JVIA 1S1TA 3A9TA 3QBVA 3PUIA 5K5EA 4AMGA 5JDCA 5FRDA 2B2XA 1L4UA 1QP7A 2HQFA 2IM3A 4EGAA 3OR2B 3GOQA 3C3MA 4GPBA 2NSDA 3MMBA 1SN7A 3FCCA 4Y6RA 3BF7A 3A3NB 1KWMA 3KK3A 2VHEA 3SHTA 2Y6VA 2BTEA 2PA3A 1YOVB 4U3JA 4IDGA 4CIVA 2XAUA 2HN9A 1GTVA 3H20A 1LTQA 2ZRMA 1IOWA 1XCPA 3R7NB 5IUKC 4JOCA 1T9CA 2FFBA 3GMSA 3QWIA 3ZD9A 4YLYA 3IAS1 1JJAA 5I7UA 5H9EK 3VKUA 1ZIDA 2C04A 3I76A 4HLCA 4LRFA 4LFCB 4NYIR 1FTSA 5EP2A 1D6SA 5D0EA 3P9RA 4BX2A 3SWWA 3L6RA 4CWBA 1T3HA 3VNBA 4LRTB 1M83A 3CW9A 3VOSA 5BPFA 4V1CI 2QY9A 1SD1A 1MD9A 4MKAA 1W52X 4NPCA 1Q50A 3ZZTA 4DWJA 2AU0A 2FMIA 4BJ3A 2EG2A 5AE2A 2I1QA 3AFMA 3K1AB 3M3HA 4ZHSA 2GHTA 1RT7B 2OFFA 3M30B 1YX2A 3MS7A 3PA6A 3PXDA 1FBNA 4QASA 4OMDA 3OL8A 3M8PB 3FTNA 3KFLA 3EDRA 3K5WA 1U5BA 4N5IX 2PRJA 2HMUA 5CA0A 3GPIA 4CBVA 1EUYA 3H59A 1KVSA 1GG8A 3QOYA 2BBOA 1R0AB 1YCFA 3OF2A 4BTVA 4IDFA 2N7YA 2MDAA 3FCSB 3ITDA 1ZW6A 2V63A 1N5KA 2R4FA 5HE9A 2HKIA 3OEED 3RSZA 1C1DB 2V03A 3RT9A 1MOSA 2A58A 3RARA 4QXAA 4BFVA 1ZITA 2FI1A 1E6YA 1SCKA 4OAPA 2J5QA 5J4HA 1EMDA 1PTJC 3DF7A 2X8AA 1D07A 4YI5A 4CHTA 6LDHA 1OY9A 1W75A 3ZLTA 1XA3A 2WF6A 3CINA 4M8SA 1VSQA 4IOCQ 1AXRA 3FAKA 1VDMA 3IFSA 4DQQA 1JLFB 3AUJB 4M21A 1J1ZA 2NM0A 3L1JA 1R00A 4AX4A 1NRJB 2KHDA 3IH5A 3L6EA 4UU7A 1YTYA 3R7AA 5BV8A 2XQGA 2RT3A 5BOSA 1CEXA 1Y7LA 3D7MA 3DCJA 2ZK7A 3MWKA 2XPCA 3ROKA 5DYTA 4ZIRA 1TF5A 4YRKA 2YKOA 1P9LA 2JLAA 3KJNA 3TQIA 1UBJS 2AYBA 5A03A 1F9FA 2C2MB 4U8GA 4CF5A 1ZVQA 5EP4A 4X62B 1DKPA 4JI5B 4ZZIA 4JU8A 1WEYA 2H2GA 3J7AC 4M5HA 1X2EA 2GAHC 5JARA 4JHLA 5DDOC 4YAGA 4HAOA 4H4KC 4IQ4A 3GAAA 4UOCA 4GM1A 4J0FA 3IG1B 4ZA2A 1Z4OA 4JCCA 3TZ6A 2B8NA 4G0ZA 4QWMA 1NXOA 4TMWA 4RA9A 4ZEOA 3T12A 5BSVA 4DPWA 2ZE7A 1SVLA 3ML1A 4GE0A 2IJNA 1YZ6A 4PLFA 3DZHA 2AFRA 1DNPA 5GOTA 1VTKA 1G7SA 5KNCD 1A9YA 4Z3DA 2ZE6A 1XFDA 1EFAA 3WLOA 5ALUA 4L95C 5KVQA 4RQAA 3VNVA 3DNMA 3U7GA 4HR2A 1H38A 2HGNA 3SSQA 5E4YA 421PA 2E4ZA 2C61A 2R8PA 4BO0A 2OKGA 3C70A 3CLTC 4DC9A 4KW7A 5IJZA 3PC4A 1G8AA 1YS9A 5CA1B 1VHQA 4CTAB 1A77A 2QSWA 4EGCB 3ABZA 1MN6A 1ZH8A 3QUCA 2G1PA 4BNXA 2CPEA 1TCAA 4G5YA 5AXKA 4RZHA 1E1QA 5DTEA 1MJGA 3FLEA 2Q0HA 5A5VA 4GDMA 4MIOA 3LWMA 5CYPA 1IXSB 1YDHA 4QW9A 1TYAE 3TSWA 3CMCO 3CPJB 3IPRA 4HG2A 3RLIA 2BW0A 1P4RA 3EXHA 2YFYA 2ZB2A 5KKCA 3ZVLA 3ZGZA 4Q43A 4CQMD 3ZW9A 1PDOA 3JSRA 3OJWA 4ECVA 4KQWA 5G0TA 3WYFA 1BEUB 2E3JA 3G2XA 3EDYA 3E9NA 4URGA 2FSIA 4CEJB 1S9DA 2VSFA 4NJEA 3K5MA 1DE0A 3IP1A 3BFPA 4G9GA 1NHVA 2V7PA 3HSDA 1GM5A 3P45B 1L1RA 4Q24A 2BJ8A 4EO9A 1ZRMA 3QEAZ 1EIYB 4DXHA 1JMTA 1HBNA 4L51A 4DV1J 4XZ3A 5G3ZA 1H05A 1BCSA 1P7VA 5ADWA 3P0RA 2MQMA 1YUNA 4UASA 1Z38A 1BSVA 3TW0A 3HA3A 5CVCA 2CMDA 1ZAWA 4U39A 1JA0A 1AB5A 4OXQA 1XWWA 3C0KA 1E6KA 3QKWA 1I51A 1R3NA 5ALFA 4JLVA 3ISNC 2RB4A 1AKTA 4LJSA 3KKOA 1GX6A 2EK1A 3WLTA 3D0KA 4WE1A 3UYLA 2ZT6A 5JXHA 2WQ6A 3WGYA 3NGTA 2JSXA 2WTUA 1LW7A 3TOZA 3D3QA 4HHJA 5JQGF 2DWQA 4BCDA 3SYKA 3KKFA 4KC5A 1J7KA 2KXFA 3B38A 4NV3A 1G4CA 3OY2A 3O8DA 3JYTA 1EHWA 3ZIUA 3B6BA 4BVAA 1HXHA 2W7TA 1XMOJ 1XN9A 4B02A 3H5IA 3PCOB 1ZOLA 5KFHA 2YWJA 2VTEA 4EKEA 3VSCA 2O3SA 2ETXA 3MPDA 4YB8A 4X1YA 4WFNQ 2HLHA 2KZZA 3GEGA 1GEHA 1VXOA 3BO2A 1DL5A 2ZUAA 1Z2ZA 4TLMB 1LU9A 2OCBA 1MJGM 4JELA 2QA4G 1GG5A 3C1AA 5DISB 1A8UA 1XK7A 1MB9A 2DPMA 3CDAA 5ENVA 4OBWA 4XM2A 1ZBQA 2B5VA 2QMEA 3OVSA 2WI8A 3HJGA 3WMWA 2UUAF 2WU4A 4QRIA 3UJCA 1VQMS 4DJDC 3NAZA 4ALIA 1RACB 2YNHA 4JI0J 3QPUA 4J4HA 2BHSA 1GIAA 1OI7A 2ZNYA 3INTA 1GQEA 4UOEA 4IH6A 2CUNA 4Q1CA 3K57A 1R8AA 3C6MA 1RTKA 4TVSA 4ZRMA 4LVNP 4A1OA 3A8KA 3TA1A 2MJNA 1SG6A 3JD1A 1WKJA 2C0QA 1RAAA 9GPBA 3CX4A 5KJ6A 4IM7A 13PKA 4JBWA 1FLDA 2QD3A 2OBYA 5EIEA 2WVGA 4CKWA 1E2IA 4P81A 5K3FB 4ER6A 1UWBA 4F45A 1WBJB 1SIWA 3SJBA 1QFSA 2JLYA 1VG0B 2V7TA 3HCCA 4H3KB 2HRTA 3G2PA 5FBHA 3EBOA 1QNFA 1RXIA 3KTAA 3LRTA 4HVAA 4LVOA 4A0GA 5EKXA 3EOZA 1PJ8A 5F8IA 2HF9A 4RCVA 1KU6A 1DWPA 4XFDA 1X4CA 1EFRA 1QHNA 4H4MB 5DDPC 4KR9A 3N5BA 3ZNNA 3A1DA 4K03A 3F97A 1RTIB 4QUHA 2FSVC 1OOEA 4QVGA 2GQQA 1P1FA 1RCUA 1BN6A 3VSDA 3OPVA 4RDIA 4BZWA 3S40A 4Q00A 2NZYA 3ZDYB 4P2FA 1VSBA 3T9NA 4KAFA 4CEHB 3IMEA 5K8JB 4RKUC 4YN3A 3G1WA 1YKWA 4KMSA 4Z4GA 4KITB 4B3TJ 1UL3A 4A2PA 3QYFA 2ALZA 5IBRA 1N33F 1P3Y1 3OTQA 1QLJA 4LECA 1KRXA 2NSJA 5A2QA 2HT1A 4PU0A 3K9FC 4FFBB 1KJ8A 2JASA 2V5HG 2FHJD 4UHKA 2GM9A 3V55A 1FDOA 2XBLA 3CXUA 2GVDA 5HI7A 1YO6A 1F8XA 3O0DA 2JIMA 4EUEA 4MVJH 1CUAA 2WOMA 5FBRB 2BRUA 5CHCB 4UVIA 1QDUA 3SBEA 1UBCA 3OFVA 2M6LA 2X1AA 3Q8RB 2VRWA 3GT3A 3ZH9B 3T3MB 5DI3B 2FJAB 5HMYA 1YZFA 3RYFA 4Y3UA 4KIAA 1G2PA 5JZMA 4AF7A 5HRUA 1JLKA 2QGZA 4M94A 3NZEA 1HYGA 1FP1D 3EIQA 2RGGA 1JPUA 4TTPA 4NAHA 4ERNA 1ZMOA 3EVWA 3K0AA 3R2JA 3QVUA 3M89A 4B6JA 4MI3A 3HL0A 2GK3A 2LA4A 4B9UA 2LXNA 4FYHA 1Q4RA 4K4TA 1PR2A 3ER6A 2ANCA 4D97A 4R69A 4KTQA 3HYSA 3KDPA 1X1BA 3KPWA 2HPHA 4GYWA 1IN1A 2PGXA 2JARA 2YVUA 3NFRA 4HNUA 5I9SA 2WF7A 3I2HA 1WULS 4W63A 1KFBB 2F48A 3W3AH 3NHFA 3KMQA 4CM4B 3WKCA 4BGUA 1DURA 3GEEA 4PWZA 4UBLA 2RHLA 4R84A 4PN7A 3DEZA 3NHUA 3OUYA 2DXEA 3ETCA 3DFEA 1ZGJA 5REQB 1NH7A 1UBFA 2K7KA 2B0GA 4XIJA 2OWDA 2BT4A 1ZYUA 3P9NA 4YXWD 5CCDA 1MT3A 5TPWA 4LBYA 1KAGA 4BNFA 1RI2A 4I9FA 5BURA 1VJTA 3R9WA 3LSYA 5BNTA 3V1NA 2JBHA 4PEVA 4WXOA 2BH9A 2J3KA 2R47A 4JI2B 4J5OA 1DDGA 5IWAB 2V34A 5CNMA 5GQSA 2CWXA 4RPIA 2OGUA 2MJLA 5SV2A 4JV2A 3H99A 4WOJA 1RWUA 2MINA 5KYUA 1EQ2A 3MB5A 1DAEA 4R1QA 3L07A 1SHKA 4GMXA 1SKWA 4US0R 3BR8A 2ORVA 2WYOA 2DBBA 4QUDA 3TARA 4ER8A 4RM3A 1TU0A 1MEOA 3H8VA 4FT2A 4C4PA 3MD0A 2NSYA 2PL9A 4M89A 2L41A 1BGVA 1M5PC 1NI4B 2G2OA 2KZMA 1WOSA 5EMNA 4IIJB 3K89A 1HORA 2WOJA 3S2ZA 3ZTOA 2OPSB 3MWLA 2IBTA 2H9AA 1Z2NX 3WNDA 3DCNA 3H5TA 3FOBA 5D01A 1ZM2A 2BX6A 1G55A 1IPHA 1F51E 5J2PB 2OBFA 1RHUB 1TMOA 1E94E 7GPBA 1FJEB 3FUXA 3VGJA 1LTKA 3DBIA 4JLPA 4FFOA 2C5AA 1YD7A 2JFVA 3ZHTA 1KPGA 2KLBA 4MUFA 3K9CA 2XGSA 2AR9A 3MR7A 2CXHA 1VCMA 3RNLA 2ZT5A 4QPDA 3A04A 3H1FA 2W2PA 5K0JA 2BD0A 2VYVD 3VO8A 4BMNA 2VOPA 3I30X 3QSYA 1KKHA 2PZKA 4B79A 1S1WA 5D3MB 1W88B 3S44A 1ACLA 3F5MA 5E95A 5K8UA 4NRTA 5H16A 1EB8A 3Q2KA 1C8VB 4EAQA 5IXUA 5JNRA 3LY9A 3V7YA 1SHUX 1EM8A 1V96A 2LFVA 1GJRA 4IWNA 3S55A 4CDMA 1P0MA 3AUTA 3NY0A 2RRBA 2Q4TA 1X9WA 3KUDA 2IUSA 3WIDA 3F1KA 1QH0A 1MEJA 3KR9A 2VNJA 3T3FA 3EY9A 4LBHA 2KFYA 4UDYX 4URYR 4KO8A 3RRNA 3OCYA 4E2FA 4FU0A 2H1OA 3GD7A 4RKFA 4QG3A 4L7VA 4O2BA 1JYSA 2ZOGA 4UTVA 2IUEA 2X7XA 2J9FB 4BRZA 4B83A 3C8MA 5JG7A 3WLLA 4QICA 1O95C 2OBXA 2X0DA 4OQMA 2GI4A 1J21A 5GTDA 3EIWA 4V02A 2I4TA 4NECA 1H1TA 3NWRA 4QPJC 1DQ8A 3GPLA 3WGGA 1VI5A 4Y2PA 3D5EA 3S2GA 1DEHA 3BC1A 3JAKB 3FRYA 3UUWA 5K6RA 5LZ2A 2PMKA 4DHVA 2D41A 3JWHA 2JGMA 4BQSA 2G63A 1H1LB 3IELA 2R8YA 2IPOB 5DIFA 3JQRA 1OZ0A 4TWIA 3D6TB 4AM8A 1CQIA 4BC1A 3T5BA 3OM8A 5K14B 3RSLA 1XNQJ 3GR0A 1U45A 3EZGA 3DDSA 3KKMA 1M1NA 2F1IA 5CVEA 4QARA 1SMKA 4L5BA 4DJEC 4BXOB 1I5RA 4EO8A 1M8FA 3WRXC 3FMOB 1EB0A 4B75A 3DMPA 4BBJA 3DXYA 2RJNA 2A2ZA 2QRPA 4TTQA 1MOZA 5EWMA 3KJEA 2C9MA 5KYYB 1TA0A 5EXXA 1MC8A 2OFWA 1N7HA 3N2LA 2YWGA 5CBPA 3HBAA 3S7RA 3GP5A 4BQIA 3SEAA 5AESA 1I94B 4FHGA 4ZLLA 4AP5A 4CLRB 3ED1A 3P9PA 1DUSA 4IQGA 3NNAA 4DR2B 4XJSA 3PT9A 3AETB 1T94A 3A6GA 3A4TA 1G3IA 3T6JA 5LJIA 2JLRA 2BJ3A 4Q34A 3L06A 1LC0A 2FD2A 2D06A 3NRBA 1EX9A 4UVHA 3TZBA 5BV0A 3QQ5A 1YJAA 2C7RA 3EARA 1V5IB 3H75A 1JLSA 1LOUA 3IULA 3WWDA 5CNJA 4Q3BA 4YMEA 5BRAA 2VFUA 4X65J 4OX7A 1HYQA 3RRHA 4QBIA 4AJOA 3CSKA 3KJIA 5JCJA 2LXUA 1TUEA 3OZEA 4HB0A 2A5JA 5CLLA 5D51S 1ZD3A 4R1TA 1ORRA 1UOOA 2QTMA 2VK2A 1M7HA 1YDMA 2HJSA 3ZLUA 1KSPA 3GBVA 3EUWA 2J3LA 4FLFA 1LXJA 3U3ZA 4Y67A 4IHAA 4JLUA 4GNKA 3UH1A 3EVFA 3VC1A 3DEKA 4P82A 1IG3A 1LK7A 1ZUWA 1ZXBA 1ZMBA 3FR7A 1BWPA 1UKCA 3C6ZA 3K8VA 1N2CA 1O8CA 5IC5A 1X1SA 4JX8A 3BE5A 3JU3A 3RJ9A 2GFHA 2B1QA 4HI1A 4W8GA 2VU5A 2J0UB 4JMLA 5C8YF 1UOQA 2W2LA 1EVYA 5K5MA 4AAYA 3KOZA 3W8NA 1UEKA 1CJSA 4DCJB 2GNPA 2NVWA 3GT0A 2ZAGA 3VPAA 5AT1A 3H2GA 1C3OB 2MR6A 3OFEA 1O0CA 1M34E 4RA6A 4WNYA 4A91A 5L6MB 4NFLA 1OH5A 2Z30B 5JY6A 2XI3A 3W8DA 5D6NA 1N6HA 2DNQA 4IHQA 3EW9A 3M49A 1EX7A 1YCDA 2LIVA 4I81A 2FPPB 4LBPA 3L41A 1JHRA 3GLSA 4QU9A 2CHUA 4JR0A 4KHRA 1QCYA 1V6HA 1XQXA 4JJEA 1XU9A 3GFVA 1TL3B 5FYDA 2CNNA 3AIKA 4DV4J 1BC5A 3UD4P 1BD6A 3IV9A 4M3NA 5AW1A 5BR8B 5ICSA 3COVA 4Y1RA 1PR6A 3ROMA 4K81B 4N5HX 1GKIA 3CPWR 3IOMA 4A82A 1W4BA 1T8TA 5EX0A 1C0PA 3ZXSA 1PG5B 5L3VA 3CUSA 4H2DA 3ZI0A 3PNSA 2JNWA 4GRSA 3RRZA 1PUXA 3PRVA 1E92A 4BLSA 5KFTA 1IUPA 3VYTB 2E7VA 5C1OA 1DKRA 4DMMA 3MQ2A 2PWBA 4X4SA 1MDBA 4PZPA 3N8DA 1FT8A 3NCQA 5A4AA 1G5HA 2J48A 2PXXA 4AZVA 4PQAA 1R9GA 2CMKA 4BQNA 1A9PA 3OQNA 2B20A 4BLRA 1EX1A 1XTTA 4LJYA 1XMVA 1FXSA 4YRPA 1EX6A 1P0QA 4DV2J 2NP7A 1LBHA 4CR8A 2GMJA 2W8LA 3W8EA 4HH1A 4DQXA 4F2DA 1U7TA 4EB0A 4W82A 2V8PA 4UDOA 3TIFA 1Y9DA 4CJXA 821PA 2UUCJ 1BKDR 1KJNA 3JQ7B 2HD4A 3HABA 1J1IA 1UDAA 4U7TB 4OL0A 5JYDA 3Q8WA 2HH9A 1PZMA 2HFJA 2YC4C 4F4ZA 2LUOA 2Z9DA 4UNRA 2WVFA 2G2ZA 1VKNA 1JQJC 3MN1A 4ZTUB 4WFAQ 1LV7A 3ROFA 1HHQA 4WFBQ 2IV3A 4QDXA 4MPRA 4DMKA 3R4VA 1UXKA 3ZWYA 4G86A 4A47A 1U7WA 3KZNA 3TB6A 4EG0A 3HYTA 4ZVQB 1N5OX 4A8QA 3WK6A 4EYIB 5LA6B 1HD0A 3FKSA 4S2EA 2G1HA 4Z4EA 2F4VF 5FLXY 2ZOMA 5KAPA 4TM7A 4YAUA 2QBYB 2C5FA 3HDTA 2ACWA 1TYDE 4ZI7F 2ONJA 3VNUA 2BFFB 1BC6A 4GPTA 2ZDOA 1NB7A 3LCMA 5MF6A 2IYTA 2WV9A 4TTVA 2PA0A 3JTPA 3LY7A 3C8HA 1K2VN 1LH0A 3VU9B 4ZVUB 3MSCA 3I6YA 5E1DA 4LFAJ 2CMHA 4GX5A 1W0KD 4OZ5A 4HHUA 4WWHA 1V5EA 1VA4A 1WMDA 1RYSA 4NE9A 3MR5A 4GVLA 1MU0A 4GL2A 4RCYA 5CFRA 2POQX 3PFWO 1QSYA 4J9PA 1S6PB 2XTAA 4X63A 1CUFA 5A5FA 4QXMA 2BSQA 4CV2A 2JBAA 1NVMB 3QK7A 2QL9A 4TS3A 1C41A 2CZCA 2YDYA 1GTMA 3QJLA 1TD9A 4PQUA 5K0BA 3BBLA 1E5DA 1TZ0A 3GFPA 4IW3B 1A3CA 1RSCA 4HZGA 1GH8A 3KL2A 1NK6A 1S2OA 3F78A 1SKBA 3PQ3A 2Y0SD 3HRHA 1G16A 3GAFA 4S1OA 1PK9A 1I7QB 2P9QA 3EXIA 1KBOA 1RABB 3HULA 2A2CA 3SZMA 4BB0A 4IV5A 5KTOA 4RX6A 5EJIA 1GQOA 1I24A 5JNLA 2XADA 1YFJA 3LA6A 4ZANA 3GD5A 1JAIA 3NHLA 4KIUA 4YUYA 1FK9A 4XAKA 1GTZA 3NS6A 4BGIA 2NGRA 1KERA 2YFHA 4RWEA 3OTDA 2JHGA 1C4CA 2GAOA 5FPQA 5KFOA 2J6SA 2WSLA 4AJKA 3RAEC 3IE2A 1SUAA 1XK6A 4EBBA 2FG5A 1FJXA 2FX3A 4HQ0A 1U7OA 3IBCA 4MQMA 2GARA 3GT4A 2OEJA 1N36F 2K4MA 3DULA 3HCPA 3PPXA 4XFJA 5A5GA 1KD1T 3OVAA 5DGHA 2WHRA 3HG7A 3VTKA 1DZ5A 1R7RA 1U8AA 2CJYA 1FVSA 3UVJB 1NUAA 1DBWA 1OJLA 1Y9JA 2J9GA 4L0QA 4U67Q 3F0TA 5IANA 2H85A 4HL9A 2BE7D 4TYWA 1IBLJ 1UEJA 6AT1A 3PQ7A 3V7NA 3JSAA 2B6NA 4O4IB 3VYSB 3RVBA 1E7QA 2OSRA 4J1TC 1XLWA 3OP1A 1O77A 2ZSHA 1JJ2R 3HR7A 4QU0A 1BG6A 2FVQA 4M7RA 1NPDA 1YQ9A 1L5VA 1RJEA 1HE3A 3MNFA 5ENZA 1LNZA 1APSA 1OJ7A 1Y42X 1SU6A 1JLBA 1GUZA 1D3AA 3L8YA 3N0RA 1HQEB 3Q3EA 4IBOA 1WUTA 2O8BA 3AIIA 5J5AA 3V80A 4JWTA 2J0XA 4X84A 1TO6A 1BVYF 1XR3A 4QGSA 3IP5A 2ZYDA 3PXGa 3IAS6 2E9SA 3QKSA 2VA8A 4JUCA 2R7XA 2LIPA 3FHCB 4QU6A 3ONNA 4C0OC 1F6BA 2O2SA 3CF5Q 3G2LA 3SCLE 1ZUIA 3DPUA 1VQLS 4HGZA 4BN5A 1N25A 4NEHB 5H3HA 1E1KA 1U8YA 3RYIA 1I1QB 1NSKL 1T0PA 3OOSA 2B4VA 1E0JA 4LHYA 4O0IA 1OZFA 2P2DA 1HSOA 2JC3A 4S04A 3QSIA 3TPCA 4CF3A 3X0DA 2CJAA 2FJ0A 2G5GX 5BQ3A 4G24A 1FJGB 2PRIA 2B5JA 3NPAA 3TLCA 1N6NA 5F8NA 3D64A 2GBGA 3N2YA 3L79A 2UUBF 5CQGA 2IOQA 3P2IA 2O2IA 2DBZA 2XX3A 4X66F 4O25A 2JVIA 4FYPA 3NX4A 4Q18A 4XA8A 2BXJA 2L0XA 2QRQA 1DPGA 2PHZA 2DNMA 2HNZA 1ZHHA 2YNFA 4PHCA 1MW7A 4CO3A 2CZQA 4KDRA 5AK0A 3DMNA 3ZY6A 3EOBI 1NJYA 5KT6A 1VCTA 3ZV5A 4IOAQ 4Y7DA 1ONSA 2MKIA 4ALNA 1C7EA 4YWHA 1XLTA 2MOKA 1FC0A 3A9VA 5IKOA 1NQXA 1MN9A 4MVJE 2H7VA 4U1RA 1LGYA 4R81A 1ADJA 4ZHQA 3HI9A 2OKQA 1VBFA 2AW0A 1XMSA 4EZEA 1FRKA 2NPFA 3FHLA 4C0LA 5K45A 3KJFA 1LW0B 2HSZA 1KQSR 4UE3S 3F7TA 3BWXA 2DZDA 3AOEC 2YHAA 3SR3A 2PH3A 4C8OA 2OM6A 2PGLA 1O5IA 3PJDA 2CYAA 1ZN9A 5KFVA 1VYVA 2O5VA 4MJ7A 3Q8YA 3R7SB 2VFRA 4LYGA 3ZKWA 1LFAA 1HDOA 2AD9A 3T1HJ 4BWGA 4H54A 1L5YA 3SSOA 1DKLA 4GS5A 3W5IA 3AYZB 5FIIA 1FDBA 3OQBA 4ZOEA 5C51B 2B43A 1XVAA 5JXIA 1NW5A 4HX5A 4LXYA 2QRHA 2K7JA 1LF5A 4IVPA 1FJHA 4U7PB 4ALLA 2G0TA 2YXDA 1MC5A 2KI2A 2NYHA 1IUJA 1EM6A 2CAJA 3T5GA 1R9JA 1UAAA 3S1LA 1CS0B 4JUZA 4JI3B 3KU1A 1RU1A 4JNCA 1PP4A 2JHCA 1Y8QA 1TLTA 4W5RA 4GMHA 2C22A 1U49A 1MO3A 3B1WA 2V4JA 4PEOA 3AM1A 3SF0A 4HNAB 3CZ9A 4JASB 3H5NA 4BNWA 5E7JA 4UHBA 5KDLA 1GK8A 4ZOAA 3MFYA 1OLUA 1HWYA 1SQ0A 2ZDPA 4D9EA 4KMRA 4DR6J 4DRZA 2IPMA 4D3XA 5CDTA 3OPYA 4HVLA 5EJ5A 3PT5A 1B0TA 3GAMA 4MRMA 1X39A 2Q9UA 4CMCA 4GKBA 3O74A 4BAZA 2CQBA 3AR6A 2E5HA 2XZDA 3AVOA 1Z12A 2OBBA 2ZANA 5AI0A 1HDYA 3AONB 1RBLA 4HDSA 2PLAA 2H2IA 4QYRA 3KAKA 2GD1O 1YJVA 2F8TA 2VQFF 4E12A 2OSQA 3LHDA 1CZNA 3GIMA 3UK7A 3D0IE 2PUHA 4EY6A 2A88A 2BR5A 3TBHA 3AEYA 1T5SA 4X41A 3FSGA 3NGSA 1ZK1A 3S2YA 4PPGA 5D85A 3GZJA 4CUJA 5CVTA 2EZTA 5ETRA 4BMPB 1M1YA 1JXVA 1OJ4A 4HT5A 2FHOB 2W6ZA 4P98A 2IGBA 5CBKA 1YAJA 3PIDA 4G5GA 3WGKA 2FG7C 4ALKA 4PLGA 4LXUA 3LCRA 2PS9A 4W6ZA 1F1JA 4HTAA 1EDOA 1EJBA 2X5XA 3KRTA 1CJVA 5ETTA 1N5JA 3TWZA 3DCYA 5AICA 1GWNA 2FTKE 5U47A 1D0VA 1L5GB 4HI2A 4HX2A 1U7DA 5B2FA 3OE7D 2I71A 1U90A 2OGZA 4EGSA 3EDQB 3I4FA 4MV4A 4GYYA 4L0DA 1Z6TA 3GVIA 3GXBA 2HK9A 2OESA 3Q2IA 2I6TA 2G67A 5FT9A 3DZFA 4ETMA 1OLOA 4WHMA 1I0ZA 4MW7A 2OZKA 1J5EF 4XJVA 1ZGAA 2NUUG 4M0CA 5L4NA 1KPHA 2W2TA 3CZAA 3R5GA 5ECDA 4UVGA 1XP5A 5I7HA 3AB7A 1SZCA 1FERA 1ID1A 1TQ4A 2FX2A 5CYJA 5IHXA 2ZI7A 3PFGA 3I1FA 3N2GB 5TT1A 2XWQA 4NOLA 3QEMA 4RAOA 5CA0F 5KHLB 3ACCA 1JI3A 4ZDNA 3UANA 2MSNA 1XR7A 4IRXA 3AOCA 4QO8A 3QBCA 1OASA 3OLCX 1VIMA 5JW6A 2VPWB 2FN7A 2F1OA 4O33A 3DDNA 2ENUA 1U7XA 4Y2AA 2BDPA 1SD5A 1FFBA 1U1CA 2BE2B 1XJ0A 3HVWA 1S2MA 1QKJA 3EF0A 4EMDA 4FFVA 3H1TA 3Q7PA 2WZCA 3KZCA 1Q1GA 2OV4A 1UFQA 2IIBA 4LXTA 1D6MA 1XTQA 4KUEA 3PDCA 4QELA 2DXFA 2WINI 5T7BA 4ZXFA 3GZNB 3P0FA 3TRGA 1EFTA 2QG9B 2J4CA 1X9GA 4FYXA 4BLUA 2NU7B 2OMKA 4ZAFA 1H5QA 2GGPB 1QAIA 3R3SA 4B6OA 3W60A 3QJJA 2ERYA 3RRXA 5JU6A 4US1R 3EZ2A 2N3LA 3EH1A 1VQ8S 1L7QA 4BPRA 5T6MA 3U1TA 5TDHA 4PHHA 3ZHOA 3HFVA 2L9NA 4Y2SA 1GARA 4DWIA 2R5NA 4V1Ak 3SDEA 4FYYA 2GEFA 2DNNA 1ZM9A 4WBNB 1R1DA 3ZWWA 1U31A 2P11A 3R0JA 4EVQA 4TUYB 2Q28A 2OEMA 3A4YA 3NNNA 1CVIA 5KWIA 3KSAC 3R4CA 3AVTA 2ZHAA 3GFYA 5LQNA 4N82A 1EUZA 5HKAA 1ZG3A 2XWYA 5DNDA 1EVLA 1ECFA 1U1PA 4QPTA 3S70A 3LT2A 2MZJA 1EP2B 1Z62A 5KZMB 3IKTA 5J5CA 1NJ5A 2VJAA 1RHKA 4DR4F 3JYQA 5HMLA 4Q3OA 4LE1A 3HGQA 1KWGA 4FB5A 2UDPA 3IO5A 3DLLQ 4JEHA 4KR7A 1CULC 1KI1A 1IDN1 1QX3A 3UJBA 1IFXA 5D6OA 1STOA 1N2SA 4LSLA 2OL4A 3IXMA 2ECKA 3UO0A 4UTRA 2FTRA 1OR8A 2EATA 1HBUB 3HVTB 3ZWQA 2B35A 1RBQA 1VMEA 4OJMX 1OQ3A 3PIIA 3W63A 2PX5A 2EW2A 2EBUA 2XMDA 1JDUA 3GA0A 3VM6A 1TK9A 2QAGA 2AG0A 3W8RA 2JAUA 1E89A 3GB0A 4I4LA 3DLKA 4FIDA 3QRPA 2H9IA 2AOWA 3ICPA 3N2ZB 3OE5A 3HFGA 3EHDA 1YWGO 4WBFA 3OQOA 4JEIA 4GKJF 2WKQA 3UBMA 4BY9E 2F2TA 1FLAA 3DBOB 1DS6A 4QYXA 5E6RB 3N87A 2B6AA 5EJ4A 4NEQA 2ID7A 4GQBA 3ILIA 1W2IA 1JS1X 3R76A 4NLVA 4FEAA 4JLMA 2UZAA 5EZ5A 1DGQA 4LKRA 4QFMA 2X0FA 4ETIA 4M9UA 2IYFA 2F8LA 1ZAVA 2HLUA 2NZ2A 1PYOB 4TV9A 4YB1P 2LU2A 2BM0A 4AWXA 1R0RE 5EIFA 4FSXA 4TLLB 4WKNA 1H2BA 3PR2B 1PJ4A 1CRZA 4NLYA 2NV2B 2JEJA 4JI8J 4KBFA 1XJWA 1W2HA 4MVJG 1RT2B 3KETA 4OGGA 2A3NA 3PTLA 1LDMA 3SIRA 4KO4S 4MH0R 1KQGA 3B9QA 2F5GA 3QXGA 3HYNA 1P7CA 4UPEA 2EBGA 3GVXA 3R5KA 2WD9A 2ZBDA 5C7OO 2MHEA 1HQUA 5JZ9A 3UMGA 1ULTA 1PBAA 4D79A 8OHMA 2EFVA 4FKYA 1QLNA 4R3NA 3IX7A 5F21A 4S24A 1JEEA 3GLGE 4TTRA 4A8JB 1PV1A 2HA2A 3ZWOA 5AP9A 2CPFA 4Z2XA 3LXRA 1YR2A 1KOFA 4C2UA 4YP1A 3HNRA 2ONYA 3R9IA 3D8HA 1CY7A 5FLXA 1R10A 2WLTA 3JCZA 4LIRA 1G18A 4KQ6A 2ZUVA 1P72A 4J3FA 2Q5JA 1YJCA 2GJ8A 4LQLA 5LLTA 4I6AA 5C42A 1AUQA 4M6WA 1W5BA 5HILA 1Y48E 1OWPA 3VJMA 4RWWA 1NKCA 2D2FA 4GX2A 5DHTA 1A71A 4O02B 3AVVA 3NQ41 2W2NP 4JGGA 3NDRA 2FPOA 2IEZA 4TN2A 1TB4A 4TYAA 1MROB 3WX0A 4LJRA 3DL0A 4W5QA 4BNGA 3OMXA 2RDMA 2RHHA 4ZVOA 3NCRA 2IY7A 2I2WA 2GCEA 3NGLA 4HAVA 4N6GA 4DIMA 1U81A 3AUKA 2G1JA 1D09B 2JCBA 1ZLYA 1LW2A 3N6NA 1D6NA 4BIMA 2W6NA 1AW0A 3IIIA 1YU6A 1NR7A 2XNDD 4R31A 1GNQA 2PNJA 1QH8B 2WJZB 1D9DA 1WF6A 3B60A 1GADO 2FC9A 5DG7A 1D1SA 3OJCA 5AW9A 4D8WA 4MRPA 1B8OA 3VX3A 2LGJA 1YS1X 1EZ1A 4GC5A 3OZXA 4D0LB 3C3DA 2IFXA 3RB6A 4QGFA 2CHQA 4ZU3A 3MMCA 1YDWA 1IXZA 4I55B 1CVRA 2VQEF 3PNPA 1DJ0A 1WMSA 2IZ5A 3N70A 3V8MA 1Y6RA 4M7WA 4MLCA 2RE8A 4YR7A 3Q12A 1P8AA 1U7ZA 4MGIR 3IGVA 1XTRA 4F5YA 4CUKA 3UK2A 1XC7A 3V9PA 4BVGA 2G1KA 2MSWA 1MH1A 4REQA 2VDLB 1DXYA 3BKXA 1FHTA 4XPZA 2I5JA 1Z6GA 2XB2A 2I6GA 5DN9A 3LU1A 3PFCA 3IR7A 4C20A 3QEBZ 1T24A 1FKOB 1G8KA 4M1EA 4BATA 1ECJA 2NXUA 1RYNA 2OG1A 4MS1A 3NBPA 4P84A 4NZYA 5I9NA 1CJTC 5E8RA 3ILJA 4B7CA 3TTTA 5G1PA 1UXOA 1Z25A 3T9ZA 4WEQA 2VOJA 3RS2A 4ZVNA 1N5VA 2M8HA 2O8NA 4EG7A 1WKCA 2AYXA 1GZUA 5CNIA 3R5XA 3GJZA 1A8SA 5TLSA 1A5ZA 1KI2A 4P3KA 1EUDB 2GBLC 3N3BC 1JHQA 2XCQA 4ZDIA 3T3EA 1HIYA 2CEKA 4K9RA 1KJQA 5IFMA 4YUAA 2DGWA 3E7FA 1AKEA 4DIEA 5EUQB 4GL4A 2M4MA 1JJHA 2V1UA 1R66A 2WEKA 3PHEA 4LIWA 1X9MA 3D4PA 2P6OA 1JFLA 3KLMX 1HWUA 3U9LA 4BEBA 4QXQA 5ALQA 1WLYA 3MD3A 2DNYA 4KYIB 3AFHA 2BUCA 1IQUA 2KBEA 1OPRA 2QLFB 3L7KA 4LJMA 4G8DA 4UMEA 4C2AA 4Y2XA 5BYAA 2O19A 4KQXA 4C4ZA 3M33A 1TL7B 1FFSA 1K06A 4A10A 1LNSA 1WHYA 2ZYVX 4UD6A 4I6WA 5HJ2A 4L02A 3B20A 1Q95A 4Z9AA 1KQOA 2WBLC 4WCVA 3MEGB 4IYRA 4RF2A 3FSIA 1AKNA 1F8FA 1DCMA 1KMIY 1X7XB 1KO1A 4BVKA 3SJUA 5H1YA 5TE9A 5CEEA 3RYHB 5CURA 5FKJA 3CC7S 4AMYA 3SNHA 3TTUA 4G1QB 4K87A 3OH8A 1FXUA 3JRWA 5TPZA 4PZUA 2JFFA 1F60B 2IXDA 3VR1A 4DPUA 4DV7J 1Y89A 4Q93A 1L7VC 1QVWA 1JTVA 5D86A 4MV1A 3JWPA 3F3SA 2BY4A 1GNSA 3PLNA 2DCLA 3SYMA 1PS9A 2ZSEA 4EHBA 1PV2A 5C0OE 2VT3A 2XSFA 1XKXA 5HVFA 4DYVA 1KE1A 3QNWA 4LRQA 2GQ2A 4K0KJ 4N49A 4TTJA 3BJMA 1Y00A 2A78A 3RHZA 1G7TA 4GH5A 2AZMA 3ROPA 4MUIA 1XNJA 3KLEB 4XEHA 2DR7A 4XVCA 4KQGA 2OCIA 1G38A 2BABA 4IXMA 3NS7B 3QF4A 1LI4A 1BDMA 4ZQCB 4R83A 4ZP1A 4LYYA 2ZAOA 4NEGA 4RNOA 3BA1A 3AQ4A 1RXWA 2WSFC 5KYWA 3M2VB 3I0MA 1GTRA 4IDOA 2XVAA 1E2JA 4N54A 1O08A 1C1BB 1HOTA 3EIFA 2OECA 2ZTVA 1U1EA 2FSFA 1I3MA 3LPCA 3ABRB 1JLGA 2RGRA 2E9RX 4O8CA 1WXWA 4KPFC 3WLFA 5IKXA 1JEYB 1IWOA 2GBIA 2Z09A 3ET4A 2ZQYA 5CIWA 1WPQA 1E3LA 2HK6A 3F9CA 5IDQA 4CHGA 5A7GA 4OXYA 5EY5B 5AMXA 5KOIA 1T0TV 2CT8A 1P6UA 5KG4A 4LOLA 1WW3A 4FQ8A 4PTYA 2CMGA 1YZ7A 1PJLA 2PYDA 1RADA 3BDPA 3OWHA 3W5UA 1BAPA 4CM9D 3IUJA 5A04A 4TXLA 4MDHA 3EWAA 1WCIA 3UMBA 4NG5A 3A31A 3B6ZA 4QXPA 1F2TB 3CBGA 4I64A 4BP9A 5BSTA 2CL6X 1FTWA 2ERXA 4YYEA 2ZVQX 2L69A 4P52A 2ZU6A 4J9OA 1PFKA 2BJVA 5JSKA 3GLVA 1T2DA 2H8GA 3U4DA 4AXIA 3I1YA 5JWOA 3VZHA 3OZVA 1EDZA 4CW7A 1PFUA 5KFGA 1ZM7A 1S4FA 3EXFA 3NNSA 3F7OA 1TM2A 1HWLA 3VF0B 3A0UA 3NXZA 5C2GA 3C6XA 1CRWG 5CX1A 1OF1A 3C3WA 3E9DA 4WFJA 8AT1A 1PG0A 2K7FA 1QE3A 3WMGA 4B3IA 3NTRA 1JHXA 1O58A 3O5TB 2XMGA 3MWDA 2QJTA 2ZYRA 1T9GS 2NQPA 1TL1B 3L7IA 5AVXA 3E9EA 1Y6JA 1YQWA 3L1UA 4KB5A 3Q1KA 3C46A 5KC8A 5KPDA 4TRMA 1UXGA 5TARA 4OFBA 1IKVB 4E2YA 4LGYA 4MW1A 3VRHA 4J29A 3PC3A 4DV0B 4F12A 1VRWA 1H69A 1B4DA 4I50A 5TVGA 4FVTA 4KK3A 1VMIA 3FNQA 3ZQ4A 1X38A 3PGLA 2OLKA 4RGBA 3LYAA 1S6QB 2RJOA 3O83A 1IH8A 4O2BF 2ZZNA 5DI9A 3GCWP 3RVOA 4JXKA 2GJ4A 2VUIB 3FN4A 3I5XA 5GAGU 5J2TB 2SXLA 1JXQA 4G4IA 1NI5A 4WUVA 1VGVA 1T0HB 2QMZA 4Y2VA 4K9PA 1GMVA 1YL6A 2YYAA 1IXRC 3EC1A 1FXRA 1QGUB 4AVYA 4LN1A 2FZWA 5HSPA 1NPYA 3QA3E 2EF1A 2WY2D 3I4PA 1GN9A 4OYHA 2JRLA 4KQIA 3G2OA 3T9AA 3H5LA 4JC0A 1OX4A 4EYOA 1D2MA 5M29A 1VE5A 3CZ4A 3TIGA 3B36A 3MPUB 2IYSA 1WLSA 3W78A 1H4QA 2AK3A 4X94A 3RUPA 3P9QA 2HA4A 3KB2A 4A48A 3OTCA 4MVXA 3GRPA 2XY5A 1PJRA 3BVPA 4PXAA 2D3UA 4I7EA 5HA5A 4PWWA 1KIAA 4AO6A 4IO1A 4FOTA 4AECA 5M2QA 5G0SA 4OYMA 3O3CA 3N6LA 4BVHA 3TW8B 4JT9A 4DFKA 3LDAA 3CO0S 3ENQA 1X80A 5L7TA 3BK1A 4N8SA 1ZUHA 4YJ2A 3UWPA 3EF3A 4QIEA 1NOKA 2BLLA 4DTIA 4R8LA 3PDJA 3VYWA 2WNIA 4O0NA 2WFZA 3U19A 1Y5MA 1EARA 5I7RA 2HHQA 3GG0A 3CD0A 4A0QA 3PC7A 4B33A 3STHA 4E30A 5KOHB 3T94A 4UM9D 1NLFA 3N9UC 3AAWB 5AVYA 2DH6A 4FS1A 4HDMB 1I4EB 1BS1A 5L3QA 2I8AA 3PWKA 4BNLA 1YRHA 4O3PA 2CNLB 2W9CB 2GTIA 4EHDA 4LVCA 4BE9A 3K4HA 3JSBA 5HROA 1EJ0A 1O8BA 2QOEA 3DM9B 1KHHA 3SQNA 4IUCS 1QHYA 3GG2A 2Z9CA 3TEFA 4NLWA 1C7RA 2BJ7A 2CLCX 2OP5A 1CJUB 3F98A 4OHMA 2O3UA 3JY6A 1Q15A 4DA4A 4DR7J 2H0RA 3CHYA 1WJGA 4IG3B 4GI5A 5AHOA 1FNXH 4DN6A 4BMVA 4CRWB 2W25A 1UXHA 1UBUS 4JVNA 1MHPA 1U3FA 5JNSA 2EZUA 2GHWA 2P8JA 4J9QA 3P0EA 4MWDA 3ENAA 3ZGNA 4WIQA 1KYVA 4X9XA 3I1IA 3RTBA 3I9V9 4E4YA 2PEYA 4AYBD 3CZ5A 1R4NA 1RM3A 5CK5A 1T5LA 4FTWA 1TCUA 1UJMA 3H6KA 5I3CA 1P62B 4ZMMA 2Q99A 4FW9A 3HFKA 4EHJA 4HZUA 3S68A 2QRRA 3BMOB 2ACVA 4HRXA 1YZKA 2ACMA 3PEWA 1XYGA 4FFLA 5DU2A 2PKCA 3DXFA 4YJGA 4LPSA 1KYXA 4YP9A 4KJXA 2IWRA 2PXHA 1XTKA 1WSRA 1L5HB 3H13A 1ENYA 1XL0A 5F41A 4G81A 4ZYVA 1U8EA 1FUKA 1VC2A 3HB4X 1KLNA 3AUUA 1W8IA 4TLRA 2R7KA 5AW7A 1XZBA 3PVZA 4DCOA 1P5HA 5T4FA 1WW8A 3KSRA 4FUTA 2WSIA 3N86A 5HIIA 3HCAA 3OKPA 1VQSA 1SXHA 4LZZA 2GEKA 2PX2A 4U6NA 2YKGA 5A9SA 4TZKA 1HK7A 4RUAA 3H4IA 3SU8A 1Z0UA 2P8SA 3GU3A 1KZ7B 1WEHA 4QM6A 5G1NA 4CT4B 1NSAA 1F9AA 2D4HA 2HHTA 1ECPA 5LMNJ 2WUEA 1FU8A 2JCVA 5BV1A 3JW8A 3V4IA 1BWSA 2VJDA 3DOLB 1QORA 3H83A 2NZJA 1TM1E 5KFRA 2R7OA 1OYYA 3O93A 1GKUB 3PW0A 1R3DA 1TRHA 2VAVA 1MABA 2V7GA 3LVRE 4QPZA 3NAMA 3OL6A 2GM3A 3I5CA 3PVSA 2PQ0A 2CLOB 4L8VA 4YAOA 4ZAZA 2R7NA 5IVHA 1BQMA 1SBTA 3EIXA 1PAUB 2LD4A 3D68A 1IVZA 4LK2A 5FULA 5DRYA 1YG0A 3CCVS 4IYQA 5C2CA 1LX7A 2W22A 4KXWA 1Q78A 2IW1A 2G80A 1G2OA 3FR8A 2B7BB 3IUBA 1W6UA 4QECA 2A5GA 1P7YA 2X3UA 3AF2A 4IDHA 4BFCA 4L73A 4IJUA 3S1TA 1JDTA 3KQQA 2O57A 1NVVQ 5DZ6A 1L4GA 3P8BB 4CLTA 3Q11A 2NO4A 3ROZA 2LKZA 1Y4ZB 4PX2A 3V81B 2DGXA 5B1DA 4XWWA 1FUIA 2CZ4A 3E9QA 4LR7A 2RARA 3H05A 2FW1A 4OJ3A 2JIPA 3D8UA 5ALWA 4YRTA 4EFLA 4TZ6A 1XAIA 1TZCA 3BSOA 4KU4A 3KG0A 4RZIA 1Y1TA 3LI2A 3LW5C 4NXNJ 3R23A 5LZ8A 3DGPB 3SZUA 2RI6A 2A9VA 2R9VA 1UMJA 5D87A 3KSUA 3WTCA 3HUFA 1BHJA 3SEQA 5GAEI 4FXDA 1WXIA 4L50A 2OCDA 1IJEA 2FVXA 4DB2A 3P6YC 5FWXA 1L1EA 4ED7A 3ZDAA 4AJ1A 1HI0P 2FWBA 1BS9A 2FHKA 3J7YU 3ZJ5A 3AEXA 1WVMA 1QGZA 4Z9BA 4LX0A 1IULA 4YDDB 3GK3A 3IRWP 2CUYA 2CXXA 1DJQA 3TVYA 4LA4A 2C92A 2X3YA 1D2NA 4LF9B 2FR8A 4QVIA 2HHPA 4KGVB 3VR5A 4F50A 4TSFA 1IBMF 4BU0A 3QE3A 4NK4A 4G0VA 2ZIZA 2EEYA 1UFVA 5KNBH 1LC3A 4F36A 2JNJA 3R7BB 4ENPA 5L8VA 1GQQA 5MDHA 2R8EA 3PEUA 5IXYA 2DNKA 5LZ5A 3ASVA 4IUFA 2ONCA 3FSJX 2AYMA 3KLVA 3UPDA 4BMOB 3GBPA 2IVFB 4Q9HA 3CCJS 4TU7A 4M5KA 2ZJRQ 2DPYA 3UG7A 3TX0A 3G8BA 3HLKA 2W11A 4B9NA 3RU3A 4Y3CA 3O4RA 4AY3A 4ECXA 3IKMB 4YHHB 3E3MA 1KEEA 3EIEA 5JJ5A 3AINA 3HJBA 1R16A 2O3JA 6FD1A 2HHHB 3NM5A 2ECPA 1J5XA 1IZ7A 1CC8A 4B2YA 2AS0A 4B3RF 1NASA 3L0PA 4QUIA 3QWHA 3MYRA 2BQ3A 3E23A 3KOOA 3E7PA 4FHDA 4M1ZA 3MELA 1GUAA 2MLYA 2R2AA 1UPFA 2PT0A 4CMAA 4H17A 3GFXA 1ZMTA 3HHLA 4L4RA 1N8RT 5GADI 3DMDA 3OJFA 5JI3E 5EWFA 3HK2A 3C5WP 5KREA 4KT0C 2DFPA 2I99A 4LFBF 1SC3B 4BZZA 2GFFA 4PWDB 4V19J 5G1OA 3GFRA 1B0VA 2BA9A 3ZY4A 4GD3Q 4LUCA 2XXAA 4TU8A 1QQ7A 4Q4HA 1AUXA 3LX8A 3I12A 2GZ1A 2BC9A 1E5QA 3ZXUB 2RGDA 4RTQA 3L6DA 2FRXA 4PFKA 2NO1A 3L1IA 3VV3A 2VP5A 2H48A 5L1JA 2I4LA 1X4DA 2HWXA 4FUQA 2HT6A 1NHUA 2ZDGA 3MAQA 3OSNA 2F43A 5JXJA 3N8GA 3GIDA 4DV6J 2P2GA 5EMLA 2VWHA 3OIDA 3U4GA 2BFMA 3WJ1A 1P75A 1QAOA 1T91A 2X1HA 5KOYA 4OF4A 3AR9A 1EWKA 1DFDA 3E48A 3V6MA 3FWHA 1XVUA 2IUUA 5JYCA 5A0VA 1F9EB 3KSDO 3G86A 2WPDA 1X94A 4JEUA 4RZSA 4ALJA 4DRYA 1M2KA 4X6YA 3O4IA 4YC7A 1E2DA 3OV7A 2WKPA 4Z5XA 2FE1A 2CF5A 5J2MB 1BDBA 3STWA 5DGCA 3C45A 1ZL0A 3R6DA 4YAKA 4ES1A 4P4LA 2QDKA 1USGA 2OGSA 3RHFA 1L4LA 3EGEA 4DGQA 1KFKB 1K8QA 3Q8KA 2EWVA 2HMTA 1THTA 1I3NA 1O5TA 2IYUA 3VZDA 1X4BA 3PX6A 2TECE 5EPOA 4TVKA 3ZXYA 2Z3WA 2HCFA 4F4FA 2V2ZA 1JDJA 3LXUX 2IRXA 3GFTA 1OH8A 4TYPA 5EIBD 1QH1A 3VZSA 4KXUA 3DTTA 3SQLA 1L7XA 1G7CB 5H70A 3GLHA 4IR9A 3E3LA 4QCLA 1GEGA 1B8PA 1I1GA 1JHDA 1NSFA 2Q6TA 3ADAC 4OJKA 4R1NA 1HG0A 3KHLA 4XLTA 1RI3A 2QI9C 3W6UA 4DMFA 3O9VA 2W2OP 3N58A 5CB4F 4HXGA 2HQDA 4JK3A 4DQDA 4Y2CA 4FJ1A 4ZVEA 2R1VB 2FJEB 2IS1A 1HNWB 1SCAA 5CFNA 3IUQA 4LHXA 2CDAA 2ZATA 4YS2A 1DAGA 1TW2A 4IOKA 2X5JO 3OQJA 4R8MA 4KO0B 1FNOA 2ZR9A 3QWFA 5FTNA 1VRTB 2RNEA 4WFXA 4PYKA 3SMQA 3N6VA 3ECAA 4NMXB 4ZHQF 4LZPA 3D8NA 2OVFA 1TZMA 1C81A 2WJJA 3STVA 2A1UA 5EN1A 2H92A 4PYJA 4EF5A 5HKKA 2Z2XA 3WR5A 4CM8A 3OJSA 5A9TA 1BWEA 1TE2A 4AMBA 2R7VA 1NKEA 1TAGA 4NVRA 3K0FA 2FLLA 3K9BA 1VDHA 2FY1A 4O08A 4R9VA 4CIWA 4UEWA 4RM2A 3V8NA 1WF1A 2DETA 6NULA 4ASUA 4S1PA 4NCGB 4PLVA 5C5JA 2GD2A 3NIWA 4OSOA 4DUYB 4Q0MA 1FRMA 4MKBA 3A8IA 4W5HA 1IY2A 3KPUA 2QN7A 4LF8J 4AJHA 1TKTB 5FI5A 3VC3A 1RRMA 3QNUA 1RC0A 1S0NA 3EJMA 1MQ9A 1NJ6A 1NHKL 1W49A 4RLEA 2Q2QA 2C7OA 3FYUA 2HNYA 1KF0A 2A35A 4MI6A 2NTYC 2XMMA 2AI3A 3BH0A 1A4IA 2ZRBA 3JWIA 2C4TA 1OKKA 2AUTA 3QPBA 4IXWA 4JYZA 1FP4B 4DVGA 2IXEA 1D4AA 1SC4B 5KWSA 3ND7A 1RAFA 3RRKA 1YAHA 1N9KA 4ZOLF 1ADFA 4NI2B 4D4IA 3OTOB 5M7EA 2AH5A 1GU7A 2R86A 3SJZA 4ZMBA 3DI6B 3V8PA 3TTXA 3L77A 4G0QA 3CY6A 4JENA 4PPQA 3UMFA 3CD5A 1VIDA 2VXBA 4NHEA 1I01A 2DRIA 2Q3EA 5F64A 4F71A 3CYFA 2QB5A 4UUBA 2O4UX 4CLHA 4LMZA 4C07A 1BX1A 2Q2NA 3GLQA 1CLUA 2WMYA 1RJWA 4BE7B 4OD0A 4QGBA 3MAJA 4QREA 4DR1J 4HQNA 4ARZA 5IVKA 2YJNA 2B4TO 1PF7E 3T5MA 1H85A 4QYZJ 1R27B 3TYXA 1Z17A 2NU8A 3NIDB 4D0RA 3VAFA 3TGWA 2XUZA 2CWWA 1A76A 5FUXA 3NVAA 1QGED 2X2OA 3Q15C 4FVMA 5FEMA 4RXMA 4RW8A 2UXBJ 2PMZD 3QAEA 2Q3PA 5HJXA 1A7KA 1N5DA 5THKA 1JIUA 1RP7A 5L7YA 4HOYA 2RD5C 3PWTA 2HK7A 4IIXA 3PBKA 4LOHA 3M9WA 4ZCMA 1JT2A 2BJ1A 1WV1A 4D81A 3NOQA 2G40A 5D15A 2O14A 5J2UA 3VPCA 3BEGB 1H6KX 3L0IB 1JP7A 4YAIA 2FWPA 1XUOA 4F5WA 5EQTA 2VPPA 1GPAA 1YIAA 3PG9A 3THTA 2OPPB 4N6OA 4IICA 2VRCA 4X85A 2RC5A 4I69A 2DWOA 2D1TA 2Q07A 3U3DA 5DTQA 4M5GA 2P91A 4DSZA 3OLQA 2L42A 4KE5A 3NP9A 1ZGZA 4LVNA 1O0SA 1NKVA 2CHVA 3H84A 3URKA 3FZGA 3C14A 3AKDA 2V4MA 3K5OA 3MERA 5LMZA 3C3JA 4HEQA 3UKDA 5FUYA 3JSYA 5G4KB 1XD9A 2QX9A 1CIPA 3PC6A 1N2HA 4C21A 1I3CA 3PRYA 1YVRA 2ZE2B 3LBHA 3J81U 1H2YA 2DR0A 3DMYA 2RKIA 4Q48A 5JRJA 2WFMA 3ETLA 2PI5A 1MMDA 5JS1A 1GDHA 5HDBB 1X14A 1VBKA 3BXEA 3TZYA 3EMKA 1KNXA 4FJ2A 4WLEA 5DNEA 2GF2A 2H51A 2JCYA 5C46F 3WNVA 4IH7A 2FN8A 4BNKA 1YASA 2OGWA 4TL6A 1N5MA 1E1QD 1MCZA 2LE0A 1SUCA 3BB1A 1T0UA 1NZAA 1XZGA 1M34B 3GDWA 1T4CA 4KLAA 3FCXA 3IAM6 4DZZA 4ZN1A 4GOOD 3DO8A 3OC6A 4DV5B 2JAPA 5T3YA 2VZ9A 1A96A 3ABIA 1U0TA 5E2AA 2Y3YA 1I30A 2H3HA 2O48X 3ZZZA 1OZHA 4BNDB 2X4DA 2WJGA 3LZDA 4E8UA 4LC9A 5JCZA 1G21A 1U0LA 1DAKA 1TJYA 3LHIA 5EIBC 2GVZA 1JXOA 5CDUA 3VR4A 4RBTA 1SWVA 2QTVA 3C6BA 2VF5X 4R3UC 5CT5A 1BXGB 4BDSA 4M9QA 4P6QA 4MWZA 2JIDA 5AWFC 3H2JA 3Q2TC 2XYGB 3MJFA 1CX9B 1PJBA 4C0QC 1SCQA 4ZVSA 5J1EA 4JVLA 1P60A 4QQRA 3QVKA 4L57A 1Q74A 1YR3A 2IIHA 4BRUA 5KTPA 1IZZA 1HE2A 1CQNA 3WAKA 1DKOA 3KQPA 2BVNA 2Q50A 1ACMB 3TNJA 4YRZA 2C82A 4NONA 1X7GA 4EKNB 4N8DA 2I34A 2P3SA 3ZCRA 4WE3A 1MAUA 3O3LA 4HC4A 2D7JA 4NCXA 3TNFA 3MFIA 1NYTA 3OPXA 1Q5YA 3LUYA 1B76A 1EAYA 1HMVA 3ZCQA 4MLZA 3LDFA 2GHIA 4Q4CA 2XQJA 3ID6C 3BUSA 3VHXA 2IBKA 1JLHA 1MN7A 2CQPA 1IMOA 2O1PA 3OQIB 3JQKA 3V4VB 1N3LA 1LK0A 3FG9A 5HE8A 4PXSA 4NFYA 3VUFA 4IEEA 1QANA 3MJCA 4PCVA 1QDEA 4TKUA 1T7PA 1PR4A 4LBZA 1SKUB 1RHMB 1GPH1 3VJKA 4K5QA 3UJ3X 4RORA 2O3TA 2WAMA 4DFPA 2JFZA 3ZWAA 3E7DA 2VASA 3E9CA 5E4TA 4EI8A 6ABPA 3PEYA 2J6UA 2MLXA 3M9NB 3AQIA 4AZ0A 3NJ4A 1U99A 4G5HA 1B2RA 4TV9F 2WAXA 1OY6A 2AEJA 1Q11A 4AUMA 1TVMA 4CZ2A 3V4MA 1GPJA 2XDWA 3BS9A 5GONA 4EY5A 1PD0A 4W4TA 4KLNA 5L9AA 5AW5A 3UMSA 3LY8A 4X3OA 1KJ9A 2GUGA 1YK9A 4ECQA 2PV0A 1QK3A 1QQTA 1JR3A 4CO5A 3L7AA 2ORIA 2Z1DA 3DRPB 2RH5A 2AFHA 4YJFB 5ECGC 4N5SA 1T9HA 4JQZA 4R51A 1ONBA 4RJIA 2Q4BA 2GAGC 3L84A 4K9LA 4DCPB 4PYOA 2W7AA 3RAGA 2H65B 1LEHA 2EXXA 1OU4A 3LUFA 1VMAA 5HF6A 4O0LA 3OT5A 4ZU1X 3RBXA 1FU7A 2I7VA 3U81A 1RTZA 1Y33E 2BEKA 4GAEA 2GQ0A 1XBTA 2IP4A 4DJ5X 2QRUA 1EFRD 2L9WA 3KAJA 2HF7A 4V1CB 5JPDA 3A3PB 4BNUA 1AA6A 1DCKA 3P19A 5CJJA 4RE6A 5M2PA 1T9AA 3CCES 1YB5A 2P41A 4P71A 2O1SA 3A1VA 4KFUA 4RV5A 4ENRA 4B2LA 1J2EA 3AXSA 4DUZF 2ZU0C 4V39A 2QVLA 3RIGA 1SFRA 5LU9A 1YMVA 1PKEA 3GIJA 2FUG6 4AL5A 1ORVA 4LS3A 1T0JB 4XYBA 3BGVA 1RE1B 2CPXA 1W4AA 4YAWA 3U6BA 4W1SA 5TV2A 2C03A 2CQGA 3OW2R 3RU2A 3GEHA 5CRIA 3K5HA 2RKOA 4FNAA 4UAUA 1U9CA 1OAAA 4Y8VA 3KLGA 2QN6A 1TVRA 2J5BA 2HZ7A 1RA7A 3UUGA 3GJRA 1DHRA 3MCMA 3M3PA 2YWRA 4F6RA 3VH4A 3KJXA 3QRWA 4FT4A 2XHEA 1RIIA 4QATA 3PW5A 3U37A 4ELTA 3UZUA 2ZJOA 3IURA 2IIQA 5KFPA 3R3HA 4KE8A 3DZCA 1FS4A 1QO7A 4E2WA 1XV5A 3OZIA 5JT1A 1E8MA 3V46A 2CKMA 1XDBA 3FSEA 2WKRA 2FWMX 3TVTA 1RNLA 5FV4A 2JLCA 1SCUB 1TC2A 1NHGA 4E7PA 3N5CA 4QIWD