2XO6A

Deinococcus radiodurans isdra2 transposase y132f mutant complexed with left end recognition and cleavage site
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
PLEMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKFIESQHDKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein/dna
molecule keywords TRANSPOSASE
total genus 34
structure length 134
sequence length 134
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2xo6A00
2XO6A 2VJUA 2XQCA 2VJVA 2FYXA 2XMAA 2VICA 2F4FA 2EC2A 2VHGA 2F5GA 2VIHA 2A6OA 2XM3A 2A6MA 4ER8A
chains in the Genus database with same CATH superfamily
2DJWA 3OR1B 3LOUA 4A8QA 2VBYA 1N5YB 3W61A 1VISA 1LKZA 2JEGA 5LXYA 4OZ0A 1Z2LA 2FLPA 5G0RA 2IY5B 2XBPA 3CW2C 1EQ0A 4HYKA 5AE2A 2VFRA 4KYZA 3FCVA 1DY3A 2ASYA 1NBEB 5H9FK 1KOHA 1SC3B 3O2IA 5KTQA 3MCNA 1X4GA 2C2DA 5DDQC 4UW2A 3DRPA 2YNGB 1D9AA 3HHLC 1HMVB 3EMTA 4DG1B 2QA4S 3VGSA 3FZBA 3ILIA 3UR0A 4RUCA 4DZ6A 4A8YA 5IM0A 3EGNA 3OBIA 5AE1A 5HP1A 4PPZA 4DQIA 5CD4H 2ZBCA 4DU8A 3PW2A 4DR1J 1KWMA 2ATLA 2XLKA 2KB2A 2ACYA 4QOTA 1SJFA 1SXLA 3CCMS 1VIXA 3DLGA 4EEYA 3CD7A 4DS5A 2OP5A 3QJPA 3ILOA 5DQGA 5D3GA 2ROGA 2VDHA 3JSMB 4HHUA 1R0AB 5EGYA 2K1RA 3T6JA 4ES2A 3FDSA 4UY8T 2D3OR 1CEZA 4NPOA 1FDNA 4MT1A 1XMBA 2E9ZA 1TKXA 3MZIA 6FD1A 3GMGA 2NXCA 5T7LA 1OIAA 3CJQA 1DRZA 3LAMA 1MN9A 1PCAA 4HT7A 4ITSA 1U1PA 1RTDB 3PJ9A 2YH0A 4OYZA 3TX8A 2W9BB 1HNVB 2CZ9A 4O44B 3EPGA 4LF8F 1BE4A 5KFUA 2OPQB 1VRTB 4NRTA 5THWA 4MFBB 4B3SJ 4O3RA 2B5JB 3W2VB 3NLCA 1GTHA 1XR7A 4G3IA 2WW4A 3TVZA 5JJBA 1BGXT 4DR1F 4WFZA 1VQ7S 3AT1B 4QIVA 4UTGA 3TA0A 2HZVA 3CJ8A 4K7QA 2ZOGA 1K0TA 3M30B 5ETMA 1XK8A 1GEHA 1ULRA 2M9KA 3M8YA 3QFWA 1DBDA 4OYOA 4ED8A 2MLXA 4C7QA 1OWXA 2DNNA 2OPQA 1MMLA 2KVIA 3CWJA 2FHOB 2HQIA 2J8SA 3P5TL 3M1VB 3QWPA 2BM0A 4IH6A 3AD8C 1JLAB 2MQQA 1DHMA 2XWYA 3Q8UA 1L5UA 5F8JA 1VC0A 1LWFA 4CP5A 1JXLA 4KGMA 1VRQC 2I8EA 4FXVA 5LT5A 3DRRA 2FZCB 2E5JA 4A46A 2I6WA 3D6TB 4DV6J 2Z8QA 1DTTA 2C3YA 2O67A 3ENWA 1YJ9S 1FKAF 1WEZA 3AOBA 3GJQB 4HHHA 2YPYA 4Y2KA 4F0KA 1VQLS 3KTQA 2JLGA 4HACA 1KDNA 3O6QA 3TZWA 1NCLA 5HATA 4Q5VA 1O8BA 1U6ZA 3KLEB 4DV5F 1XBWA 1UFLA 4DI6A 4DSJA 3MTKA 2WVDA 4IFYA 5C25A 1NB7A 2OI2A 1F60B 2R8KA 2G0IA 2V4JB 1XMOJ 3MMBB 2DHXA 1HLWA 2XM3A 1JLQB 3D1QA 5K14A 1HWKA 3KLFB 1ZZNA 2OGUA 4BBYA 2H4WB 4CT9A 3AQOA 4LRAA 3ZZUA 4P9SA 1FDDA 2ZOFA 3TZXA 4WU2A 2DR7A 2A2CA 4GKKF 2B6AB 4R8UB 1PKUA 1BMQB 5J2MA 2YKPA 3MD3A 1KD1T 3NL0A 2HRTA 2V50A 3CJ4A 4WU3A 3GCXP 1K1SA 3K57A 4MK7A 3I6PA 4FPIA 3ZXWA 2KT2A 4OYXA 3BYPA 4RBTA 4DL6A 1Q7LB 3PYFA 3WC2A 3MR2A 5LSLA 2BANA 2GJFA 2IM3A 5L1KA 5L9NA 3LGNA 4LT6A 2CJ9A 2HNDA 3I87A 3OSNA 3W65A 4WYWA 3BBBA 2XSJB 2BJ1A 4B02A 3MGJA 5KFEA 2KM8B 2ZH6A 3MEDA 1KONA 3MM6B 4OYAA 1F3VA 1VQOS 1T8EA 2OPPA 1D9FA 2BJ9A 5LMNJ 2XGQA 2B9WA 2XHCA 3MCSA 3QIPB 3RZAA 3BSOA 5L1JA 3TUPA 2KFZA 2K2PA 2L9WA 2VBZA 2F4VF 3OFHA 1FWLA 3PJWA 2R8GA 3NGDA 3CDUA 4C8ZA 3G2XA 3NG8A 2M8HA 3TOQA 5ETSA 1S9GA 3G82A 1X5SA 2HFNA 1GXUA 2AYEA 2GW8A 1WEYA 3DOLA 2Z2LA 2M7SA 4IOBA 3A8JA 2FVRA 3MCMA 3DYAA 2LMIA 1Y3KA 2B5JA 1P6TA 2VICA 2A1BA 3QIPA 3ILLA 1T9TA 3BEGB 3L9ZA 1MMDA 1RHJB 2BRKA 4CDIA 4JI3J 2RE1A 2JNJA 1SCJB 2YKMA 1J2VA 1NZAA 4KHPF 3LWLA 4TXSA 4HTIA 1EQMA 5AT1B 2UV8G 2BJ3A 2R8IA 1EKRA 1OSDA 2LU1A 2C2MB 4ZLJA 2I5JB 3K59A 4DV2J 3P8BB 4R5PB 2FPHX 2V63A 3OD2A 5J2NA 1IJEB 1WHYA 3RW6A 5KFDA 4P2FA 1Q81T 2D9PA 2HQFA 3UD4P 5B0FA 5CAAA 3BQ2A 5K8PA 4DR6J 7FDRA 3U1MA 2QLXA 3I5BA 5HJXA 2RF2A 4KV8B 1H98A 2XO7A 1DQ8A 2UU9J 2F8HA 3AOCA 3EDQB 3DM2A 3MMJA 4WXOA 1UL3A 2YPZA 3LAKA 2EFQA 5H9EJ 2DISA 3LTOA 4LVOP 2IBOA 3UN3A 2VIHA 1CS4B 4KJIA 3H40A 5GAGI 4G1PA 1WKJA 5K8MA 4DWIA 1OPZA 1YBAA 2AEMA 5IT0A 8ATCB 5C25B 1LW2A 3E3XA 1JJ4A 1NJYA 1U24A 4URGA 2B4OA 4RW4B 3PV8A 1TL1A 4MH8A 2FZGB 3R7SB 9ATCB 2UVRA 3IFEA 4IR9A 2KFNA 2HZCA 3CEDA 3CUNA 3CCRS 2G1HA 4F4YA 1WHXA 3PTWA 1LW0A 5HQMA 3DRXA 1HWLA 3J7AN 2CQ0A 2NQPA 1SKRA 1LFPA 1Y7PA 2C2ZB 3KUEA 3V4IB 1CJTA 2RU3A 2AJ1A 3UDLA 1KHVA 2C22A 3RBXA 4G1QA 2ABYA 1SJQA 3OVSA 2HMIB 5HSPA 1GX5A 3LP2B 2MKHA 1K47A 1T9YA 2BACA 1RWPB 1ZM2A 2RS8A 3BN7A 3CDAA 3IGNA 4CLZA 2YWKA 5GAHU 4KSEB 4J9OA 4JI2J 2Y1IA 4KPCA 2LXFA 1FTCA 4JI0J 2D7SA 3CULA 1UW4A 1HNIA 1DTTB 2DY9A 5I4MA 4X4RA 3JSRA 4YN3B 3Q89A 2FC8A 4FYWB 2HMIA 3TAQA 2W8KA 4K59A 4C4WA 4UUWA 1LOUA 4USKA 2OD6A 4O4GB 3GE9A 3F73A 1T95A 5AXKA 1RT6B 3EZOA 3IMQJ 1GMWA 4GO7X 4F4XA 3OUYB 3QZ8A 2IIHA 3HMJG 5MLCV 2LYVA 3KJNB 3UR3C 1TV6B 2P5VA 4O0IA 2UXDJ 2V9KA 2HWIA 3NCRA 1RQ0A 1UMJA 2ZBPA 4LFAJ 3HULA 4DSEA 1FRHA 1U6FA 2LQJA 1ELOA 2WVEA 1TAUA 4A4JA 4MYTA 2HQCA 4NEYA 4ZVTB 3JXOA 1N54B 2J6UA 4IRDA 3FCWA 3I4PA 1S6PB 4F2SA 1SC6A 2B6AA 4R8UA 2QO3A 5J2MB 4QWEA 5LMNF 4ZCMA 2QV6A 4ZVFA 3FFIB 4FDFA 3PX6A 2C42A 4P71A 1IKVA 4YY3F 1HYSB 3TUIC 2RRAA 1GNKA 1NPRA 3R5AA 2MJUA 1YITS 3CJTA 4Y28C 1TK8A 1RYSA 1IR2A 2FJBB 2R7RA 1B0TA 2QC3A 1FE4A 5DRKA 2EI5A 4Q2LA 2Z56B 1UETA 3CMES 4DSFA 1V3RA 2ZFHA 3IC1A 2ASJA 4I0WA 3S8SA 1IQZA 2ZDPA 3G71S 1NPKA 1VRTA 2HURA 1H74A 4NXMF 3LP1B 2PIIA 1S12A 2PD1A 1YI2S 1ZOTA 2Z30B 5IFMA 2W4CA 2F4FA 4LIRA 1JJCB 1ZBTA 1AFJA 4LUBA 4RBUA 1F9HA 2BE9B 2DXEA 1R43A 2QLBB 3RAMA 4RZRA 3T1YJ 3SI8A 1RUSA 3C6UA 4OI2A 3ITHB 3A12A 2M52A 4OYBA 3KLGB 2EG2A 1W2IA 2JVRA 3AJDA 1UPMB 1QSSA 1EIYB 4RUAA 5KG1A 4WIQA 1F2GA 1C1CA 4QJVA 2KG1A 4DDFA 2C2NA 1B7YB 2CIMA 2DD8S 2QL5B 5A8RB 3OHBA 1S4FA 4JB8B 1TP7A 2VG7A 3GYXB 3NEKA 4KT0C 4TY9A 5HVFA 2EKNA 4OHVA 3FEXB 5HN0A 3IWNC 3QJLA 4DUYF 3C2PA 3VTIA 1WC6A 5E33A 4X4QA 2FY1A 2PA3A 4TKTA 4ANCA 3RR7A 8AT1B 5HMWA 4JI1F 4QWAA 4DV4J 1KQSR 5HMYA 3D5MA 4KTQA 2E7WA 3FEYB 3R5BA 2FJEB 1JLEA 2IA0A 3CO0P 2DGOA 3M6XA 4N8OA 4OZ5A 5EX3A 2YNIA 3FZ2A 3D2WA 3VAJA 4EZ6A 4DR4F 3BGRA 3PCOB 2DH7A 2XO6A 5IZHA 5DJBA 1HR0J 2UUAJ 2CYYA 2OEKA 4OYIA 4GKJJ 2HVIA 2U2FA 2EC2A 2FHJD 2EVZA 1CS4A 1RU1A 2EK1A 1FVQA 4DV1J 1WNEA 1Q16B 3TJ9A 1LK5A 4L6V3 2A2DA 3BGOP 3A8EA 1IBCB 3AY0A 3M2RB 3MFIA 2XULA 2YWFA 3FJ2A 1YZ6A 2WONA 1ZETA 1PILA 3ZZOA 4UT4A 3N79A 3PHTA 1F2HA 4QWBA 4NMLA 1N5QA 1RBAA 3JB9k 4Q44A 4LQ9A 3OJSA 2HVHA 2UU9F 1TUWA 1NDCA 2J7WA 4JBCA 2M3DA 3BDPA 4I4BA 2VQEF 4B17A 3A1YG 2MDAA 1WJ9A 4HL9A 2V2KA 4FVMA 3DLLQ 4OZLA 4P2XA 2LU2A 2FLOA 4ZVOB 5EHHA 1S7HA 2FLLA 4WK1A 2Y8WA 2ZBIA 4WTYA 3MR5A 3HO1A 2XI3A 2YX7A 1IR0A 4RW6B 4C48A 4C98A 1DTQB 1YJNS 4V19X 1I5OB 2DNPA 1RAHB 5H9FJ 4CZCA 3SYZA 3QPIA 4FYXB 4P73A 2AIRB 3ICLA 2ZUGA 1UEVA 3GFHA 3LGHA 4H4MA 4EO6A 5DG8A 1D0EA 2GHPA 1TKTB 1IN0A 1XQIA 5BXIA 3LF0A 1K1QA 2W25A 1X4DA 2IM1A 3KLHB 4Y2AA 1RACB 2RQKA 1HIYA 3I5AA 2CPFA 1G2EA 2PT0A 1DAXA 1U1QA 4CNYA 1MWQA 1WOOA 2YWWA 3GG0A 3VZIA 4AXIA 4NLQA 2RVJA 4ZN3A 3P3DA 3MAAA 1QUVA 1TKZA 1NK5A 1NAQA 5BR8J 3O8WA 1W25A 4U8YA 2GGPA 2YKMB 4ED1A 2PI4A 1PJ6A 1SVDA 1N0VC 3OUYA 4ELVA 1DARA 4CO1A 2O1PA 3OHAA 1DLOB 1S79A 2Y0SD 4J9SA 4JI6F 3GFYA 3IP0A 3KDNA 3GILA 2FJDB 4I2PA 4DCJB 4TQRA 2HS3A 1U49A 2GJIA 3JSMA 1UVJA 1HQUB 1VHFA 1Q82T 2CZVC 4WJBA 2G9OA 4J9LA 3PKMA 1QE1B 2H1YA 3EPIA 2J76E 3HK2A 5HLFB 4FS2A 5DG7A 1GFWB 2GJ2A 3H4DA 2GQQA 4G6VB 4CYUA 1KVKA 1DLOA 5KOWA 4Q43A 2ZZNA 4LFBJ 4KGXB 1IM4A 2DPIA 1D09B 1YQHA 4DX8H 3W8PA 5IXUA 2KHCA 2KYXA 1UCNA 3R1HA 4O3NA 2OEJA 2Q43A 5AJ3F 2E5LJ 1Q8IA 4W4MA 2MZJA 3BB5A 3DM2B 3BGRB 1K9MT 4P2MA 1J5OB 1RLDA 2P9EA 4DJBA 1WSVA 3JSYA 3UCUP 3GR1A 4B3TJ 3K8VA 2QYCA 2MJNA 2KTQA 5ETNA 1Q79A 3M4XA 1RTJB 1BUXA 3HFKA 4CCHA 2XLJA 2EEYA 4HR2A 1S6QB 4PRFA 3B4DA 2NSBA 4ED0A 4U9RA 4UZCA 1RYRA 2XWXA 3M1VA 4PCQA 2Z2MA 3N6NA 3CD5A 2R2RA 4ZDNA 2DH8A 2LEBA 3RRGA 2BBEA 4DL0C 2HGMA 3M8ZA 3PYGA 1Q0NA 4Y2MA 2W7OA 1UZDA 2XMVA 4LREA 4OI4A 1MROB 3I0SA 4PG5A 5LOQA 4OQJA 1WC1A 1RTJA 3QO9B 4NX9A 4CTAB 1MG7A 3W9IA 4IKAA 4CO3A 2W7PA 2AJQA 4DV7J 4G1QB 4ZS6A 3GG1A 2YNHA 4N77A 3OTOF 2COLA 4MFBA 2IM2A 2FTRA 4H4OA 5J1EA 3C15B 4Q8EA 1TMMA 2DO4A 2V2QA 3DOMB 1FI4A 2HGNA 1YRUA 2ZH5A 1UVIA 4RBVA 1NO8A 2OFGX 3SMZA 4ZVHA 1GH8A 1JLCA 2ADCA 1RWNB 3VVUA 1JLEB 4QPTA 3MWBA 4DUTA 5CXTA 2ILYA 1WC0A 4PG8A 2CNNB 4FS1A 3BO2A 4A8XA 4RW8B 4PR6A 1OMSA 5DQHA 3D67A 4WFNQ 4X64F 4UF4A 4QR1A 4J90A 2W2NP 4O4GA 5E0OA 3WHIA 2IAJA 3EYZA 3T5LA 4CLWA 3GV8B 3MAQA 3GFXA 2IA6A 3OTCA 2X7IA 2FYXA 1AT1B 4JI2F 3KNAA 4IDKB 2IJNA 2JC0A 1GMUA 2GGPB 3MI7X 1C0TB 2K3IA 4ANEA 1HNXF 3R2CJ 4NLUA 1HYSA 4K5RA 4CQ1A 4OJ3A 2CJKA 4TY8A 1S1VB 2XS5A 2E29A 1LNQA 4X62J 3SIPB 3I9V9 4C8KA 4JV5J 2KRRA 4DCPB 3G86A 1YJWS 1NPPA 2DGXA 3BREA 3I0RB 5DZ7A 2XQCA 4DSIA 4WWSA 4AL6A 3MEDB 3MM6A 1KVIA 2HSEB 2GO8A 1CJUB 3NWRA 4Z37A 3SCJE 3IM8A 4CM2A 3SXLA 2YNFA 1FKPA 1VJQA 3VGVA 5GAHI 3CJKB 3L95X 5KFBA 3GJRB 4P72A 4KRWA 2J9DA 3MMCA 1NH8A 2V34A 2PO4A 4H4MB 4B3SF 2ZITA 3ELHA 3QRQA 2IMWP 5KT7A 4WE1A 4YEAA 4E2FB 3GJTB 4QW9A 1YGYA 1VQNS 3TUZC 2RAQA 4X84A 3OR1A 2NREA 3T5HA 2QLFB 4YDDB 4DR4J 1UJ5A 1FRKA 1L3KA 3CDEA 4ES1A 4ZKAA 4NLVA 4KB7A 1WI8A 5LMUF 3MD1A 2GNKA 3G6VA 5A8RA 2DRDA 4M5LA 3ULHA 2VJUA 4K50A 3DRYA 3RRKA 2B0GA 2DXFA 3PW5A 2XMJA 3MMCB 5DG9A 1B3TA 1U2CA 1U7LA 3QFHA 4JUZA 2RKIA 1V5IB 5KFGA 3DRSA 1MMNA 3SEOA 4R5PA 5SZTA 4R0JA 1KSPA 3GWCA 5DDOC 2PGCA 5HAOA 4ED3A 5E5NA 3W2VA 2HKEA 2IDLA 3DRPB 2HYIB 4ID5A 3OTDA 2CRLA 4K0KJ 4X65F 1N33F 4KHPJ 1S7IA 1XEZA 2LEAA 4WP9A 5HBMA 3R5GA 2BABA 4B08A 1P1LA 1DQAA 2KJVA 5AXNA 2D74B 3OW2R 1FHTA 5KFWA 4HT5A 4ECWA 3KHGA 3Q2TC 1FKOA 3T5JA 4E0DA 1R6VA 4FF4A 5EN1A 3PW4A 1NUEA 4OX8A 3J80Y 2ZOMA 2A6OA 3L7UA 3NS6A 2R3VA 1NJXA 4J37A 2YY3A 3RTVA 4DF4A 2YNIB 2B3TB 5HVGA 3DRRB 4DV4F 4RW7A 3R97A 4ID8A 4DQQA 1PC5A 3U27A 4FYDA 1N32J 4M95A 4DR7J 2MGZB 3L3CA 1B0VA 1VS3A 4DX5A 1U25A 4NYZA 5DETA 1B70B 3KLEA 4PAAA 4ZHRB 1VQ6S 4C2MA 4A8FA 3KLGA 1VQMS 3TEHB 3RB4A 2MQ8A 3M2RA 3ZZPA 2CPYA 2QYGA 1HNWJ 3CF5Q 2FD2A 1AA1B 3LALA 2HVZA 4HH0A 4B3RJ 2MMYA 1FT8A 1H7XA 2CJQA 1X4FA 2QZ8A 2IYGA 3QT6A 1RHRB 4R25A 4WTOB 1UA0A 2VHGA 1KP6A 3HKWA 1YZ7A 3IGVA 1UVMA 2AGPA 3QRPA 2ZBQA 3UI3A 5DLGA 4ZCLA 1SL2A 1T3NA 1K0VA 2H3EB 2BQRA 2QSFA 1H3DA 4Y65A 4M8LA 4Q45A 2PDAA 2WSFC 2IVMA 5HMZA 1F9FA 1ZM3A 2XY5A 2EFGA 1RISA 4LFAF 1KS2A 1RAOA 4PPDA 4X4SA 4DQRA 2BUNA 3QLHB 1OS5A 3DLEA 2AV5A 2ZJRQ 5DO2A 2DGQA 2QMUB 1XMOF 4UY85 2YKOA 4ZLPA 2Q3PA 4EWTA 3SFGA 2VUGA 5G0RB 4YMEA 4LJMA 2BM1A 4B3OB 4OJHA 3J81U 4ECXA 5IV4A 1JLBB 4NA3A 3DLHA 2HWHA 2DR5A 4IG3A 1RWVB 2OPPB 4I7FA 4DX6A 1FFSB 3HVAA 1FRJA 4J9UE 2DNLA 3BBCA 2WZ1A 3LH2S 3MECA 4QZVB 4LF4F 1AFIA 2Z57B 3L7OA 3TWZA 3D1OA 4DV6F 2PFFB 4YY3J 1D9DA 4JV0A 3FSXA 1YHQS 3B54A 3CTRA 3DHWC 2R2UA 5J2QA 1QE1A 2GX8A 1QDUB 5IOLA 2RNEA 2DNGA 2WAQD 1IJFB 4MYUA 4YUDA 4DV0J 2OIHA 4ZVRB 1KOOA 2HNYA 2ZBRA 1S48A 1HNIB 3OL8A 4AL7A 3RR8A 3A3OB 2LLZA 2V69A 2Z58B 2RDIA 2R7XA 3PVXA 4PQUB 3VQSA 2DB1A 2HG4A 3CDWA 1PBUA 2PEHA 2GVDB 1ZM4A 3D6FB 4ECVA 3V6HA 1RT6A 3SCKE 3HHLD 4Y2IA 2GVZB 3HF5A 3PRDA 5E3PA 1VQYA 3J7YU 2E1CA 4GKKJ 4F02A 1JB0C 1CULB 1F5CA 1X7VA 2AYBA 2KJWA 2JFKA 3AFGA 3KJVA 3NGTA 3US5A 5CABA 3PR5B 3ETOA 4ICLB 4TYBA 3CJKA 3K5LA 1TZ0A 2OAUA 3NGRA 1QVGR 4TVAB 3C8YA 1X9MA 3AODA 1S4EA 2F40A 2HQ3A 2MZSA 1VBZA 1N34F 3K89A 1FXLA 3MMAA 5F8IA 2VFVA 2I9SA 2KDOA 2B9EA 3BZQA 4GO5X 1Y5LB 1HPZB 2PEBA 1S99A 1KLMA 2CQ3A 2R42A 4KV8A 2VONA 2IVYA 4ZK7M 3OXLA 5I42A 3HSZA 5IC4B 4KIAA 2AZ3A 2ROEA 2F5GA 2FIUA 3GFZA 1U09A 3WIVA 3OT9A 4IUFA 2JFDA 3D0GE 3M8PB 2Z4PA 4C0BA 3PM9A 2V4RA 4ZVUB 3G6ES 1NH7A 1UTAA 5GAEI 4Q0BB 2EG1A 3K5NA 1M1HA 1NJIT 4JV1A 1CJKB 1HBNB 1Q8LA 1IKWB 1HMVA 2V4QA 1C4AA 2R7UA 2AD9A 1DJ0A 2ILZA 5ETTA 3PR4A 5IT9Y 5I3UA 4P52A 2X1FA 5J2PA 1SJ1A 2XMKA 3K5OA 1D8ZA 3QGPA 3VCDA 1DFDA 4CLLA 2CUYA 4DCOB 3MF5A 2J5AA 1T05A 3JAMU 4K4TA 3EUNA 1IBMJ 1WTBA 4CNZA 1ROFA 1NRKA 2MKIA 1JLCB 3BKFA 2CJBA 2EXUA 3MM7A 1EETB 5EWEA 2JJ4D 3MTJA 2DVIA 4IRKA 3K5MA 5GAGU 2N3OA 4L74A 2NR0A 1B4SA 4EU0A 3MM9B 2DRBA 3IAM9 3MM5A 4C3LA 4W90B 2KZZA 4I2QA 1WG5A 3MMBA 4OZ3A 2Q79A 1HARA 5D0HA 2BE7D 3KHLA 3T5KA 2JZ5A 3QIDA 4LRFA 4XAKA 4F0MA 2PSZA 2F1FA 4DV2F 5CYQB 3DOKA 3W64A 3C16A 2CPIA 2E7XA 4NASA 1LFWA 5A6PA 1FX2A 1WDTA 4U6PA 2ZE2B 4P75A 2BRLA 1R7IA 1WOSA 4FXWA 3DDIA 3H8YA 3IM9A 3JTNA 2JSXA 1FEHA 2RQCA 2OMOA 3AD9C 3FQLA 2DNOA 3CIZA 5JXSA 2BQUA 1NK4A 1REGX 3D0HE 3J7Z5 1S97A 2L9DA 2VU5A 3MHYA 2OLWA 4LSZB 2ZM6J 1KRPA 1TL3B 2KT5A 3MPWA 3RAQA 5D8HB 4LSNB 2J0SD 4ZIVA 2YBVA 3T1HF 4LF7F 1N5VA 3UDVA 3SZ2A 3MEGA 5C2GA 1RXOB 2WCXA 4NLOA 2HFOA 5EUHA 5HK4A 2UUWA 2V8HA 3W5YA 1UJ6A 1O6XA 5DZ6A 2PMHA 4ZMMA 1XIQA 5D0RA 5KFFA 1CG2A 1O0PA 2MKJA 1CLFA 4ZP6A 1GT8A 2EW9A 3K17A 2RDJA 4DR5F 4C0HA 3GU0A 3PW0A 3DXSX 2HVDA 3ISZA 3IN5A 2DHGA 3I5CA 3O44A 1VK8A 3QLHA 3QWUA 2RU9A 3H5UA 5A8WA 4ZITA 2DTJA 2KI2A 1QAJA 1Y4ZB 4N5SA 1U0HB 4LBHA 1HL6A 1MLAA 4ZVSB 3KFWX 1NKCA 4OZ1A 1FESA 4MK8A 2M2BA 3W62A 3CSKA 5KFOA 2KZMA 2ERRA 2OTJS 1ICEB 3HFZB 3N5FA 4B3MJ 2XMMA 3QGIA 4DV7F 1E6YB 4U67Q 1H7WA 2KXNB 4ECYA 1S0OA 2OSRA 4KGZB 3GIJA 4BLGA 3UVJA 4MMOA 4I6WA 4USVA 1TV6A 2Y9HA 1CQMA 3T3FA 1SL1A 2AYGA 1YJVA 2OSQA 4NLYA 2J8AA 4UUXA 2HWTA 2DEJA 1U02A 3FMBA 1VBXA 2HNZA 3ZNJ1 4CLKA 4ED5A 4KH0B 3IAS9 5CYMB 4ZPDA 1M5VC 1S6PA 1T05B 2UVWA 2XS2A 4DR5J 2FVCA 1EX8A 4FYVB 2GVZA 1N8RT 3TUJC 3DHXA 2R8HA 3ZTQA 1P9YA 2V8VA 5F8GA 1H72C 2D41A 2DGSA 1AZSB 1UKUA 4A48A 2WOMA 4X4UA 1WF0A 1YRTA 3CJ0A 3OQ2A 3Q23A 3PY8A 2EC0A 1RDRA 1RT4A 1PO6A 2E5LF 2DNYA 4M5HA 5SUHA 3OR2B 4FPRA 1VQ5S 5CA5A 4D3GA 2CQIA 3G87A 1HQ2A 4QYZJ 4IH5A 5GAEU 3N4WA 4O4RA 1X60A 1T3OA 2BOAA 3BBFA 5L38A 2E5HA 3R9LA 1T03B 1H2TZ 4USJC 2IRXA 1X0FA 1FK9B 1D1UA 1HI8A 1X4BA 4NXNJ 1Q7YT 4LRBA 3THVA 2RH3A 4F50A 2H5IB 1IKXA 4N76A 5T41A 3NKYA 2RDDA 3C6TB 2DH9A 3BF4A 3IS9B 1RZMA 4OHZA 4C3MA 5HQLA 1NK6A 4C3KA 1E6VA 3QYYA 2FVSA 2ZNZA 4ETZA 5C5JA 3M9OB 4KR0B 1C1BA 2IJFA 2UVVA 1FCAA 4WKRA 2QLJB 4CO5A 4ZPCA 5LJ3Y 2UUAF 5DLFA 2QIFA 1J27A 2J6TA 5BR8F 2HHSA 2L08A 4MK9A 2WTFA 2RRNA 4FVCA 3CVKA 4WF9Q 1EP4B 3J7YI 2KXHA 4NA2A 2QT7A 2JEFA 2UXBF 5CQGA 1YDLA 5HMXA 3CIMA 2W2QP 4YB5A 5B08A 2P9CA 3KUHA 3R3TA 4ERDA 4DFJA 2RRBA 1YJUA 5KFXA 1NDKA 1R31A 1FRLA 3BR9A 4KGKA 1PC4A 5BYSA 3Q8YA 4DUYJ 2PE8A 4R0EA 4Y6IA 2I38A 4QBUA 5IV3A 5KFKA 4FBUA 1F9EB 2RT3A 5A0YA 4MIBA 2VOPA 5ITHA 2MQPA 3M8SA 2G2YA 2BR0A 2OELA 3RG6A 4YHHJ 1RAGB 3CJSA 1LV5A 4JI5F 5KG5A 3I0RA 4FNHA 1F5AA 1OY6A 5LXRA 2ASDA 2PN6A 1OYDA 3SQOP 4ZA1A 1TUGB 5KFPA 4EBDA 3C3LA 2XGPA 2EKYA 2DGUA 4Z2XA 3LUYA 4FN5A 4XDCA 2BE2A 2IRYA 4DR2J 3SCIE 3BQ1A 4RNOA 4B9TA 4ECSA 1SKUB 1BXNA 1TU0B 2IPOB 4M5DA 3KK1B 1WUUA 2JWNA 2CVIA 2IAJB 4JI4F 1DQ9A 5C42A 4XK8C 1PBAA 5CYMA 1YIJS 1AUDA 1SQGA 4MAKA 3NBPB 2HHQA 4QPXA 2QMWA 1M1KT 2BJEA 4C8LA 2DNZA 2V68A 3UD5A 2RB7A 1UW9A 2HFUA 3DLEB 3UD3P 2VQFF 3OXGA 2QN6B 2EBGA 1AZSA 2IMOA 3G8SA 3MXHP 2NXEA 4LBPA 4AYBD 2GIRA 1HBMA 1N52B 1NNDA 3DRSB 1CJUA 4ZPVR 3VAMA 3T9NA 3I32A 2CPJA 1S1TA 2K8GA 2IHR1 1MNEA 3IBWA 1MW7A 1RKIA 2XMUA 4ZJOA 1BD6A 2HK2A 4YP3A 4E98A 3J80U 1XNRJ 3EGZA 4MIWA 4A8WA 3V81B 1PIEA 2QA2A 1X0PA 5H1SV 2AYMA 1REVA 3D66A 1IBLJ 4OHYA 3AA8A 2MLZA 5IQQA 2VG7B 1CJKA 2FVQA 2QEXS 3ONQA 1KNZA 1HNVA 2HNYB 3FVYA 2DT9A 2W4PA 2C3UA 3HD1A 3NGUA 4WE1B 3H2UB 4KE5A 5KT3A 1S1TB 4QCLA 1URNA 3MM7B 2UXCJ 1RWMB 2CG8A 3GR0A 1FJGF 2VPYB 4L72B 3V81A 2FJWA 1Q5VA 2H54B 3UCZP 4LQ3A 4ED4A 2IM0A 4RW7B 2HRYA 4X65J 4AUKA 1U48A 1Y11A 3VHQA 4NXNF 2J9CA 2BA9A 4OZ2A 3HCXA 5L8RC 5DM6Q 2YX4A 4JV2A 1S10A 3D3BJ 5T14A 3OTEA 4LR7A 3ET6B 2PC6A 3DXBA 2R2SA 5FD1A 4YR0A 3P96A 1XNQJ 3LP0A 2KH9A 3AA9A 3M2UA 1R0AA 1RT4B 1S1UB 4PYAA 4J9QA 1ITPA 5JUMA 4MIAA 1AXQA 2N7YA 1WKLA 2XMTA 1VDHA 1X8DA 5I42B 3NMRA 2D69A 4TU8A 4NCGA 2AU0A 1UEKA 1KQFB 4WBFA 1FTRA 3U1NA 6AT1B 4X4PA 3PIOQ 3I56S 3D3CJ 4O3QA 2KRBA 1JIHA 1HFEL 1RAJA 1QSYA 4WP8A 3KG1A 3HZEA 1N6QB 1YK9A 1ZM9A 2WBMA 3BKUA 3P4UB 4KO0B 2OH2A 3NY0A 1R0CB 1C0TA 4QIGA 3PW7A 1RKJA 4F04B 2W9CB 2YH1A 1SH0A 1FX4A 2AEJA 3M8QA 4O23A 4B9SA 1S76D 2NXJA 1VBKA 2CNKB 2F8MA 3M2VB 3G8QA 4L73A 4ZP7A 4A8OA 3BH6B 5K8OA 2R7WA 3HZGA 2MQNA 5J1NA 3X3UA 1MWYA 3M30A 1RT3A 4DPXA 2ALZA 1YRXA 4DFPA 2HFVA 1Q78A 4IYQA 4KHMA 4X62F 4JV5F 2H5JB 2BVZA 2V94A 3ZZRA 5LL6d 3AAWB 1RHKB 4XPEA 3DLKB 3PHEA 2XCAA 4V19J 3MPUB 4DL7A 3E51A 4B9LA 2OJ3A 5J2QB 3I82A 3OSPA 1RA7A 3M05A 4KAIA 1KFSA 4BC7A 1FRXA 1X31C 4JYAJ 2V8PA 3RBZA 4ZPTR 4MTPA 2XSFA 3SV4A 1PAUB 4GC6A 1FXRA 4K2XA 4ELTA 2OPSA 5B09A 4XTTA 2XYPB 2HGLA 1NM2A 2VG5A 3DMJB 4I2PB 4DV3F 5E3RA 2FUG9 2D3ZA 3ZC4A 2HNZB 4P2SA 1XC9A 3WBZA 1H38A 2YXLA 4OHWA 1UVLA 4KQZA 5LMUJ 4YS2A 1HBOB 4QWDA 2APOA 3JQJA 3EX7B 2M70A 1WDDA 3N0VA 1G3OA 3KJVB 3HJVA 4CH1A 2HBRB 4ECTA 2JRSA 1NSKL 1CBKA 3TJAA 2HIYA 2W2OP 5E7OB 2JHEA 4NLWA 5KFNA 3W3SA 2BYCA 2FJVA 2IVFB 3ZO7A 5JVGQ 1U1NA 4OL8A 5F41A 1OPIA 1X4AA 1WG1A 2JLEA 1RT2B 2WOMB 2Y1LB 7AT1B 5HBMB 1N36F 2CNOB 4TYAA 2PMWA 2MY8A 5IWAF 1KLMB 1ZAXA 3DC2A 1VQSA 2BOPA 3KG0A 3T1AA 2E5IA 2HBZB 5KFLA 4DL2A 5LSRA 2KL8A 3CCTA 3OL7A 2W4DA 5AXMA 3BGUA 3CD6S 1RWOB 4W92B 1GXTA 2N3LA 3UQSA 3LP0B 1HA1A 5F0UA 4DHVA 5ETOA 3T19A 1IKXB 2HVEA 2ADBA 5D15A 1PGZA 3M9MB 2VFSA 4BC9A 3IRXA 2DR9A 4C8MA 2BKNA 2QGFB 1V5VA 4XO0A 4DR3J 2DPJA 2C2KB 1FF2A 3TI0A 5ETPA 5LSOA 3HSGA 4WXWA 3HI9A 3HLUA 3MEEB 3TR5A 4NLPA 2CQBA 1RTIB 1Q1KA 1REVB 5KG2A 1SKSA 4OFZA 1RCXB 4M63A 2HHHJ 4ZJLA 4DZDA 4LFCJ 1N6QA 4HKQA 4X66J 2ZD1A 5EWFA 1PYTA 2EFNA 2AT1B 4KFBB 4M5JA 2GZOA 3FRZA 5F0WA 5KFJA 3C14B 1D3WA 5AE3A 4RNNA 2VFUA 3DCAA 1TAQA 5KFYA 2UUBJ 2MHNA 2NXNA 3B4MA 1U47A 4LF7J 4ZP9A 1KVJA 1SH2A 3DLGB 4LR8A 4K8RA 4ZVGA 4EI2A 5KT6A 2QLWA 2ZM6F 4K4WA 1FFWB 1FKOB 2WSEC 4Y34A 3MUMP 2R7QA 3HKZD 4KFBA 2KXFA 1TL5A 2K7JA 3D6MB 4FKYA 2DBBA 2DGVA 3L09A 3M6UA 5FDLB 5F3TA 5D77A 3UWTA 1RAAB 4NOHA 2VODA 2K1RB 4JI6J 3CC2S 3OR2A 4F25A 5KFZA 1S6UA 3VZHA 2RS2A 2HBQB 2O5DA 3JQKA 5D4LA 3KNGA 2B43A 3AOAA 3RUBL 2FC9A 1HQEB 4TU7A 2ROPA 2OPSB 3W7BA 5HROA 2DXDA 1N36J 3ZNUA 3I31A 3SSRA 2IBKA 1U6BA 2XS7A 2HHHF 4LFCF 1KBRA 1WD6A 3KK1A 4NCAA 1Y0HA 3MM9A 1S1WB 3KG4A 4N8NA 4URQU 1FNXH 2O01C 1I51B 1LW2B 2MEWA 1SPBP 2DY1A 3SDEB 5F9NA 1J5EJ 4OX7A 4ZVQB 1DTQA 3ZTPA 1FD2A 1UEUA 5M2PA 1C1BB 1CQNA 1Q8BA 1VI7A 2CQDA 2ZEJA 3M8QB 4I67A 4DSLA 3CD0A 3MPYA 4P10A 3SCLE 1N4LA 2OEMA 3GIMA 3RBEA 1QTNB 3MEKA 3KHHA 4G1IA 4J5OA 1N56A 1JJ2R 1HBMB 2C28A 3MPDA 1M5PC 2B8QA 2GA7A 5E2QA 2NUUG 4U8VA 4CLTA 1P9QC 1QD1A 2B51A 2GHWA 1YKWA 2JC1A 3BM7A 3DOMA 1RK8A 3NP5A 5CH7B 4RNFA 1SV5A 2ZKUA 2VDIA 5HQ8A 4UOCA 4LSNA 4AQYJ 4CM0A 2B7CB 4F0HA 3CCLS 3WZ0A 1GMWD 3VAGA 2J7UA 2FJAB 4DOZA 3VALA 2XI2A 1F1BB 1WF1A 4B9UA 1BY9A 3BV8A 3H0PA 5KT5A 1Y9OA 4OI6A 5LJ5Y 3S6EA 4DL3A 2KT3A 3JYTA 4ES3A 3QT8A 2DITA 1NSPA 5DQIA 3Q83A 1IM6A 3H2VE 1S5ZA 3WX4A 2B8PA 4J9NA 4MKYA 3V6DA 2VKRA 2VG6A 2CZ4A 1U4BA 4Q2MA 4DV3J 5K14B 4CH0S 1V6HA 3OFEA 4UZBA 3KLFA 3HPOA 2QE5A 2YKQA 3IRWP 3TO8A 4QR0A 1RTZA 1YSJA 2V5HG 2ZHBA 2KHDA 4X2BA 1NHUA 4IR1A 3Q86A 1F3FA 3KK2A 2Y8YA 4LIWA 5D78A 3HSJA 5I3UB 4TQSA 1AROP 2IYIA 1M90T 2V67A 1FJEB 1A6LA 1Y00A 2FGOA 4OMFG 4B9NA 3GYGA 5RUBA 1TKDA 3QQCD 3QJJA 1SKWA 2HPUA 1N88A 1SH3A 2BJ7A 2VG6B 2BANB 5F8NA 1ZYQA 4NI2A 1FRMA 2C2OB 5DM7Q 5T7LB 1CULA 4F4AA 2E5GA 1ACMB 1T03A 5KG0A 2CJXB 3A4TA 2UZAA 5FLXY 2CPXA 2ZWOA 3RW7A 4GMKA 4OJGA 5FDLA 5D4PA 3B78A 3S01A 4TU9A 2W9BA 2AQ4A 2MKYA 4IO1A 3OLBA 4ATNA 3GYNA 4LF6J 3NNCA 1LK7A 4Y00A 3MM5B 1TL4A 3V4MA 2W9AA 1QLNA 4CWBA 1UP1A 3BDEA 4M5KA 4PXDA 1HNZF 1BC6A 1TL1B 1NK8A 2DGWA 2R9LA 1J5EF 1FJ7A 4NXMJ 2GHVC 3PDNA 4ECRA 4OJ1A 3EXCX 4IOCQ 1QVFR 2IC3A 5L46A 4K4SA 2WHOA 5JMNA 1NK7A 3MUVP 4Q8FA 3AD7C 3OVBA 1TK5A 2WRMA 2YTCA 1FA0A 1Y5IB 2QSWA 3MEEA 3QMQA 2XMAA 2RKIB 1EP4A 1RT3B 4YDXA 4HI2A 4CI0B 5B0CA 1TL7A 3FK4A 2ZH9A 1YTYA 2XY7A 4O3SA 3SDEA 1FNMA 2A10A 3QGHA 2W8LA 2CJYB 3H98A 2YKNB 1RTHA 1EAYC 2DNRA 1CSJA 1R8BA 2VPZB 3E8OA 4NZ7A 4TNOA 3TNVA 4PXCA 3UDEA 5D3GB 1U0SA 2EBEA 2CG4A 1IBLF 2GIQA 3SSQA 1RLCL 1RT5B 4NL5A 2LCWA 2RIJA 3R5CA 3CJ5A 3R5JB 3K0JA 4KHRA 4J9KA 3RB6A 1JLBA 1KTQA 3GP9A 3QT5A 1FE0A 5B0DA 1IWGA 2MYFA 4OZJA 3CC4S 4EO8A 1U1LA 4F67A 4AE5A 3C6TA 4ECQA 2AP6A 4B3RF 5E3QA 2RHQB 3KLIB 1SBRA 1SV5B 2BX6A 1PG5B 2M4MA 3U1LA 2HHPA 1Z1ZA 4HHJA 3SFUA 4EFAC 1TELA 4EBEA 4FF1A 4KGVB 3HHLB 3WX8A 5F8LA 3J81Y 3MUTP 4QIWD 1BQNB 3I96A 1U2RA 4DFKA 2NZCA 3QSYB 1LWEA 2HHUA 2DCLA 1NJZA 4IH7A 2MGZA 3C46A 3FBFA 1ZZFA 4MKBA 5KOXA 2R7TA 2C3MA 4LSLB 3S1TA 2V2ZA 1VBYA 3H20A 2Y3YA 4JI0F 2KYZA 3VQTA 1FXDA 1ZTWA 4PWUA 2NSCA 2MSTA 3MM8B 1X4EA 4ZPWR 3WC0A 5A8KA 2JH3A 3ISNC 4ZP8A 2G4BA 2AZ1A 4DPUA 2CDRB 3IR7B 2W9CA 2WB4A 4DR2F 2C2RA 5KG3A 2E1PA 1Q95G 1XNRF 1OO0B 2XEXA 1YJ7A 3KK3B 1BWEA 3VF0B 1LWFB 4K4UA 4WK3A 2AHOB 3ZZYA 4S0MA 1YLXA 4XPCA 1CJTB 4YB1P 5CD4A 3HT3A 3CCUS 4RW9A 1HD1A 1S1XA 3CC7S 4EMDA 2OHDA 3W2WA 5F3ZA 4YHHF 4WIIA 1Y3JA 3M7VA 5D4OA 4ZIWA 2X3DA 1SJ4P 3DLKA 3TA2A 4NLGA 2UUCJ 2WBRA 1ZAVA 2DNMA 1QAXA 2P2CB 3UFCX 2GQ2A 3ETMA 5C2CA 1VLYA 1NKEA 3PO5A 3U02A 2XHWA 5KG6A 4PUOB 5C42B 1NEEA 3UDCA 4DEZA 3DGVA 4Y2CA 3BQ0A 2A6MA 1X5OA 3NBPA 4QQBA 4Y0FA 4EGLA 3D9BA 1BQMA 2ZKTA 2WVCA 4DQPA 4LF9F 4CLUA 2FY8A 1X4CA 3EJMA 1ZA2B 3MR6A 3MAAB 3CNQP 3UPFA 1D8YA 1JLGB 3UN5A 3WQPA 4ILLA 3V2UC 3FBCA 3C66A 4F3QA 1KC8T 2AJ0A 2LQ8A 1LEOA 4NA1A 3P45B 4WPAA 3CCQS 3K58A 3EXYA 3PYEA 3FKBA 2YNGA 4LR9A 1T94A 1HWIA 1Z4UA 1S72S 2UUCF 4KPYA 2R7SA 1RTHB 4JYAF 2NYIA 1DZ5A 1E6VB 2RD5C 2DEIA 1CC7A 4LF5F 3PG9A 4NLSA 4DXLA 4RWXA 2OPRA 3HXMA 4H4KA 3RB3A 2RF2B 5A76A 3HVTB 2UP1A 4YFUA 2HS4A 1C2PA 2HIQA 3TAPA 4PWDA 1PJ7A 2NYHA 3QAUA 1AB8A 3DNCA 4JI7F 1WELA 4FF2A 2K7KA 3NMAA 1H2VZ 1OQ3A 2E1MC 3BH7B 3RJMB 2M0GB 1XJWB 2CFXA 2WK4A 5KG4A 4LF9J 2XLIA 3SSSA 1IBKF 1FERA 1SUQB 3AJ2A 5HL7Q 1S0MA 2ZE2A 4B9VA 1RWXB 3PO4A 2LDYA 1UWBA 2HAFA 3K7RA 1WACA 1NDLA 1S9EB 2F65A 2F4VJ 2DR6A 2Q66A 5HI7A 1RWKB 1KEKA 4CRJA 2XB2D 3MURP 3VWSA 3BGFA 4RW8A 3OTBA 3LQVA 2OMLA 4USTA 2VOOA 3R7BB 1TQLA 3G4SS 1YVFA 2C3OA 2DKOB 3ET6A 3W9JA 4U95A 1R8CA 2DNQA 4K4XA 3BYRA 5C24B 3FSIA 1EB0A 4KH1B 1SUQA 2FB0A 1I1GA 2LKZA 2GMHA 1P27B 2NLWA 1OJ4A 4FYYB 4USHA 3R6LB 2R4FA 2Y1RI 3GIIA 2AF6A 4DQSA 3K5PA 3RRHA 2XCPA 4P7TA 2BW7A 4BWJA 4U96A 2KM8C 4DUZJ 4OI0A 1HW9A 1IWAA 2OUGA 3L7PA 1RGVA 4ILRA 4U7UK 4CLFA 1GTEA 1P8GA 2MQLA 3GB0A 1HKAA 1G6BA 2J0WA 4CT8A 4NE9C 2XTJP 2Y0BB 4NLXA 3G6YA 1MROA 5KFVA 3HD2A 1N5SA 3TQEA 2LA6A 3R6GB 1M0SA 2VZ9A 4DLGA 4I7FB 4DF8A 2CWXA 3EM1A 1FKPB 2N4CA 1UPPA 2LA4A 4LF4J 1LXNA 2CNLB 2LP4A 3PJXA 2CKWA 2B9YA 2L48A 4ZPAA 3CCJS 4RL1A 1I94F 3KLIA 1MU2B 1FEEA 2D3O1 4L76A 2CQHA 2VC0A 1LWCA 4C6AA 5L1LA 1S59A 4C9DA 2NXUA 3H2LA 4ETXA 4AD6A 3CCVS 3OFGA 1X4HA 4IFVA 5CYQA 2WW8A 4RUBA 1OY9A 5HROB 1RWUA 3TZZA 2MKSA 4K4VA 1TUVA 1VIOA 2MKCA 3NWGA 4NEZA 4V1Ak 3GV5B 4IO9Q 1S1WA 4LF6F 1RADB 2OO4A 3FFIA 1MSWD 4F3OA 4HDHA 2KU7A 4B3MF 2QTWA 3KMQA 4ER8A 1B7FA 2VV5A 1X9SA 3DI6B 3LP2A 2ZC3A 1F5BA 5B0AA 1KR4A 3RU0A 1UWAA 2OTLS 2ALYB 4BHQA 4CYUB 3IG1A 1HI1A 3OXFA 4M5MA 5GMDA 4WCEQ 4TY8B 2V0NA 1T9UA 3N6MA 1N48A 1VQ4S 1UVNA 4ID5B 3QRRA 3IA0A 1WTFA 1DURA 4YB7A 2V2VA 4OV6A 2YX1A 2VQFJ 5IWAJ 4RKUC 1K44A 1ZH5A 3DN9A 1HBOA 3AXMA 4I6YA 4DN0A 1WHVA 4DSKA 1R89A 2RILA 2MY7A 1SIWB 2D1CA 4MJKA 5B0GA 3ZTSA 3B6BA 5IT4A 5A8WB 4FF3A 1RSCA 2CPEA 2HAIA 5ETKA 3KYLA 2DRAA 2X1AA 2BKOA 3IR6B 3C6UB 4JI4J 1U0HA 4PYDA 4CLSA 4RU9A 1TK0A 1S6OA 2FDNA 1IBKJ 1HNZJ 4M94A 2G13A 3R5DA 5AJ3J 5GMEA 3CGIA 2N7CA 1RABB 3PXGa 3NAIA 2NCKL 4PG6A 1ZAWA 2W24A 3BJYA 3K8WA 2ZJQQ 2CQ4A 3NS7B 3N01A 2LDIA 2ATCB 3N5BA 1QAYA 3H7HB 4GVLA 4BDPA 4NZ6A 3Q8SB 3EZ5A 4J9PA 1ZA1B 4HH1A 4DPWA 3QO9A 1VQPS 1RJJA 2MZTA 3CMAS 2E7VA 2W01A 5BJRA 2G2OA 3Q8PB 1VHIA 5A6WA 2YQ0A 5KFHA 1U26A 1X5TA 2XZDB 3QGGA 2F7VA 3K2YA 4GVBB 1HQUA 2Z2ZA 4PG7A 3KK2B 3CJ3A 2D9OA 3D1HA 3ENQA 1WC5A 3IXQA 4DMZA 2AGOA 2W7AA 2DCUB 3NOCA 5L9XA 3HVRA 2ZHAA 1UAWA 3D54A 2BXJA 2NPFA 4ECUA 4A8KA 2BJDA 2CXEA 4LF2A 1K73T 2BDPA 1JWWA 3GTYX 2QRRA 2HHWA 2XG8A 2UXBJ 2CQPA 2ZHOA 4JOUA 2M88A 3C16B 1EZZB 2GIFA 4GVBA 2P9GA 3VAFA 4RWWA 4CLYA 1YJTA 2VBXA 2ZH3A 4EYHB 5K20B 3M8RA 4BWMA 2DHHA 4IFYB 4Q7AA 4ANDA 3RAXA 1HWJA 5KFRA 1V9OA 3VAHA 4B3OA 2AWZA 3HHEA 3M2UB 1F0XA 1LWCB 1Q86T 3D6HB 2B7BB 7FD1A 1NB2A 2X1BA 3OFFA 2KFYA 4AQYF 1KN6A 2DK2A 5ETRA 3H42A 4I69A 2RUGA 3R8YA 4PZVA 1VJWA 3ISND 1M5OC 3O5TB 3KLVA 3OL9A 3MM8A 2E1AA 5GADI 3FBBA 3VR1A 3RGIA 3M6WA 2V8GA 3OV7A 3CPWR 1SJ3P 3W2WB 3PX0A 2H51B 4KO0A 3MOZA 3GQCA 4J7CA 4I6AA 3LWMA 2FZKB 3TZYA 2B4UA 2VQEJ 1HQEA 4USMA 3UCGA 2PA8D 3TW0A 2ZH8A 1WC3A 1UFKA 1RAIB 2BQ3A 3KLHA 2I0XA 4NYPA 4OX6A 5KFTA 2VF3A 3UNYA 3GCWP 3EWGA 5F8MA 2A0FB 2GVDA 4K4YA 1A9NB 5BYRA 1PYOB 1URRA 4HVZA 1FFGB 3KHRA 3CE8A 1K8AT 4OHXA 4H4OB 5J1EB 4FXDA 4FP9A 1LXJA 2Q6BA 2N82B 4J91A 1CPZA 1LQ9A 2IFXA 4ICLA 4TLQA 3CCWA 2L41A 1T0TV 1TMJA 2AW0A 3KKFA 1NU4A 1SB6A 4DPYA 3AHPA 4F7VA 1BQNA 1KHWA 4J9VA 4CIOA 3T1YF 2W2PP 2WONB 1PJ5A 4ZVEA 5F9LA 1VGYA 1QSLA 3DOLB 2FGCA 4HACB 5K9FA 3VGTA 1UVKA 4DS4A 5GADU 2FVPA 3F41A 1UZHA 3BKTA 2KG0A 3VV2B 4ZLLA 5IQ6A 3CCES 1S0VA 4HLBA 2QL7B 1U8SA 3HHDA 4K4ZA 4O3PA 3T9ZA 1IKYA 2X51A 4B9MA 4UOFA 1C0UB 2E9RX 4NI2B 1CVJA 2H9ZA 3I9ZA 3VAKA 2HRUA 1HBNA 3CCSS 2LVWA 2DHSA 2I5JA 3BSCA 4OLOA 4M5DB 4UOHA 1G7CB 2DNKA 1HWUA 2HS0A 3C14A 3MDFA 2OKQA 4ZOSA 2ZH2A 1U8WA 4HI1A 2X3GA 4NCBA 1JQGA 1RT2A 3BSAA 1VFJA 1GQEA 2XYHB 3GV7B 1N32F 4ECZA 4QU6A 2VB6A 3LW5C 4RJVA 4YR2A 1RBLA 1NK9A 4P7VA 3JQMA 3NNHA 1FK9A 2XYGB 1U1RA 4GRSA 3ZZTA 2HHVA 1KFDA 2XNRA 1HD0A 2F3JA 4BCAA 1JKHA 4ZHRA 1U1OA 3RYLA 3I4HX 2MSSA 4IG0A 5C24A 3TVYA 2VFTA 2QX0A 3PFEA 2F9DA 3DU5A 4I2QB 4RW4A 3LGMA 1JK9B 1YG0A 2KN4A 3CB4A 5GVQA 1WG4A 4UQGA 4DUZF 1FNOA 1TTHB 1WWHA 4MKVA 2EK6A 2MHEA 1S77D 2YWGA 4LF5J 3E2EA 4IRCA 1LWXA 2LQ5A 3CJ2A 3AH6A 2RQ4A 3TVKA 3GSDA 2I2YA 4IG0B 4M5GA 3NCPA 3HT0A 2XZWA 1AYEA 1AUSL 4J9MA 4ED6A 1APSA 1AW0A 1T02A 3QBCA 1H2UX 1ZPVA 3GZ7A 2HHTA 1R6YA 1MN7A 3ADAC 2HBYB 3NAHA 1RBOB 5J2PB 2H4YB 3DKDA 3R27A 1VC5A 3HHLA 2RMLA 3W63A 3MEGB 1T9WA 1Y5NB 2NPIA 2QFJA 4EZ9A 4X4VA 4PKDB 2OFHX 1WKKA 2JLFA 3W60A 3ZTRA 2F8EX 1I6JA 2NZ4A 3NGKA 1TL7B 5C7PA 1XMQF 4IG3B 1QUPA 3FC9A 1R8PA 2DYAA 2MLYA 4ZCKA 3KMSA 3LA0A 5H9EK 2Q6CA 1B99A 3ZZ0A 3PFOA 3CXCR 1Q8KA 1SI9A 1IBMF 4ILMA 4U7CA 2G1DA 4O44A 4N56A 2BMBA 4LMZA 5KT2A 1WSRA 3R1LA 1RT5A 4ZJQA 1S9EA 1U1MA 1GK8A 2XZTB 2VPWB 2MKKA 1N33J 2P6TA 4ZN1A 3SV3A 3HFVA 1IUJA 4C0OC 5IT9U 1YBUA 3H5SA 3JTPA 4H4KC 2AX0A 5MAOA 2HZAA 1RAEB 3BR8A 3FSYA 4TN2A 4DBQA 4YR3A 3Q2SC 1JX4A 1GAOA 4Z7CA 2AKWB 2HFZA 5HANA 2O3DA 2XC9A 3TAMB 1X9WA 2VA3A 3HJFA 3N9UC 5KFMA 1E6YA 5GMKa 1FO1A 3FQKA 2WSCC 4G65A 4PXBA 3J7ZT 4DX7A 3Q8RB 1R8HA 4JI8J 1N5YA 2VA2A 4QIFA 3NNAA 1HNXJ 3PRBA 3C15A 1GXLA 2XY6A 3F0NA 3PRVA 1VR6A 2B56A 2EFPA 3M2VA 1LW0B 2ZWPA 5D0GA 1EARA 3N6LA 1FVSA 4FKXA 1H73A 1VQ9S 2XMWA 1BLUA 2FLNA 5FJ4A 4WFYA 1NK0A 4RLEA 4RU2A 3ILJA 1RHQB 2GQCA 3TX0A 5KFQA 3KWMA 2XNQA 3P6YC 4ZPBA 2RQMA 4FZVA 2G0CA 3GLJA 4K2JA 4D3HA 4ENOA 3L4BC 4DV1F 2ZZMA 1N5TA 1FJGJ 2DIVA 4P6QA 1Q53A 3M8WA 1P1TA 1QJHA 1KKHA 5KFSA 3MR3A 2GCFA 2QA1A 4AFFA 1UA1A 1FDBA 2QMXA 4J9RA 1M5KC 2V8DA 4U7UD 2A3JA 3CO9A 1NLKL 1S9GB 3G82B 2CVEA 1NDPA 1TFWA 4L75A 5U47A 2R2TA 3R2DJ 4DL5A 4H54A 1XN9A 2LEPA 3DYAB 4USUA 3FNNA 2FJXA 1S9FA 1WORA 3A8KA 4DV0F 4DFMA 3P49B 3HP6A 1JXVA 1W2BR 3G8TA 4M5NA 2P6SA 1HHTP 1FD8A 2IC3B 4PQAA 2C3PA 2NUHA 2POKA 2ZNYA 5K8NA 5EDWA 4ZLNA 5JVHQ 1HBUA 1NKBA 1YWXA 1RT1B 3DGPA 3BSNA 1QM9A 4PWDB 2VH7A 4ELUA 4EYIB 1G4CA 4K0KF 5I3QA 1QAIA 2HNDB 3CCZA 1QY7A 3V6KA 2J0QD 1U2FA 1SQEA 2LQBA 3TARA 4P74A 3GSIA 3MPVA 3GJSB 5DDRC 3G9CA 5ETVA 4DPTA 4B3TF 4KC5A 3JTOA 4RX6A 1NJWA 2MZ1A 3AXKA 8RUCA 3BO3A 4IOAQ 2NS1B 1FWKA 1RT1A 4YQWA 3W5XA 5CHCB 3T1HJ 3D68A 4FNIA 4PWWA 2ZH7A 2AGQA 5B0BA 3OTOJ 2KO1A 2W1BA 5A2QY 3V5RA 2PMZD 1NHKL 3ZFVA 1SQFA 1ZS6A 2RHSB 5HJYA 2KVQE 2ZC4A 4C11A 1RAFB 2CQ2A 2OPRB 2VPXB 4OYPA 1H6KX 2MB0B 1HPZA 2G0JA 4LRDA 4C8YA 1L3UA 4PXEA 3NCQA 3CJRA 3B82A 3B8HA 1HNWF 3G6XA 3N28A 3O1LA 4IQMA 4CO0A 3AB2B 3JAMY 1PYSB 2ZUAA 2KKHA 4LSLA 2IDEA 4NZ0A 4DU7A 2B9XA 2YWEA 5KG7A 1GX6A 3WDOA 2JX2A 2VJVA 4Q0BA 1NZ8A 5G4DA 2YKAA 3TAMA 1OY8A 2CQ1A 4JP8A 1S49A 3H4BA 2ZD1B 1IR1A 2Z0GA 5AXLA 1ZTTA 1S6QA 1T9VA 2L3MA 1EHWA 4URSA 3PZPA 5DGBA 4CLPA 5J2NB 2MPUA 3EVWA 4LF1A 5EX0A 4QW8A 3LO3A 3I55S 6FDRA 1VC6A 2HEKA 1I3OB 4NWBA 4WYLA 1WHWA 2VBWA 3AB4B 1CJVB 1F6TA 3A3NB 4EK2A 3PIPQ 2QG9B 2PFDA 2DNHA 3SQGB 1S1XB 3IWXA 3NS5A 1JLFA 3EICA 4RO0A 1NSAA 1HI0P 1KTVA 3UW1A 1OYEA 2RSQA 3GONA 3M6VA 5CYJA 2DO0A 5KT4A 2B4VA 2Q1LA 3NGSA 5HVHA 1L3TA 3D4JA 1BHNA 1JLAA 3W8GA 4N41A 1TR0A 1B0PA 5E41A 2MZQA 2J6SA 2K06A 3V6DB 3IO1A 2YQ1A 3DLBA 2HHXA 4IQXA 1VK3A 3IG1B 2CPHA 3MR7A 3DOKB 5EWGA 3UNGC 1S57A 3EVMA 2DHAA 5E3AA 4WZQA 3WIUA 3TEGA 3RB0A 3GIKA 3PACA 1ZPWX 2VC1A 1HHSA 4QYRA 2AJ2A 5IM0B 3THPA 5HP1B 5KFAA 1R27B 1V3ZA 2MZRA 3CT9A 2FHMA 1XWLA 3QNWB 5HLFA 5M2UA 4OX9J 2N4DA 1R0BG 3THTA 1N34J 2J7KA 4QR2A 1RHUB 1R8AA 2MXYA 3TA1A 1RB0A 2G2ZA 2GV1A 3GIRA 3IWLA 4IFVB 4C8OA 5CCLA 2Z2YB 5E3CA 3E01B 3POTB 4NRUA 4NLDA 4O3OA 2C1EB 1RHMB 3EGVA 3PNIA 1RWWB 3TJ8A 3M9NB 3ZZZA 3FBEA 4NYOA 1FRIA 4F2RA 4RW6A 3DLJA 2VD3A 4YOEA 2QFIA 3H5XA 2UV8A 2CA9A 5ETQA 4OX9F 2LXIA 3W1YC 1TVRA 4N47A 2EPIA 1XNQF 3M32B 4RNMA 4C8NA 3KUGA 4JI1J 2GFFA 2WVFA 4I64A 1FDAA 4HDGA 4A8MP 3KOAA 1WI6A 4DR6F 1S1UA 1OSCA 2CADA 3FEZA 2J9EA 1YJRA 3LPEA 2H5EA 4F8RA 4F36A 3LANA 4M1KA 2E66A 4NCGB 2ZJPQ 1Q5YA 1BQMB 2R7OA 3R7NB 4OI3A 3A13A 1VRUA 3QT7A 4OLPA 1WOPA 4NLRA 3VAIA 1IKYB 4I56A 2J0XA 2AEFA 4OYMA 2QJ3A 3C19A 3DFEA 4OV1A 4AT1B 4F26A 4WFBQ 1L3VA 2CPDA 1XERA 3S7RA 3RBDA 1T9XA 4HTJA 2UXCF 3HHNB 4K5SA 1VQ8S 2HW3A 2DIUA 4CH7A 3UN2A 1I94J 1UFWA 3TQ1A 4XDDA 3HDSA 1WEXA 4GKJF 3HSDA 1EKSA 1O51A 2MQMA 2M8DB 2GMJA 4PQUA 3JS9A 2QL9B 2VASA 2BV3A 4LRCA 2V9WA 4QIEA 4E8UA 2F9JA 2FQQB 1FWPA 3O3LA 3TP2A 3TRGA 1G1XA 2IJRA 2D3UA 2JOQA 3HVTA 2J9DE 2P8IA 4F4WA 1KQGB 3IR5B 1SL0A 3OLAA 1LWEB 1W26A 1VOMA 4WFXA 4Y3CA 3W66A 2HQGA 4EUVA 3V6JA 1Q4RA 3F56A 2R7VA 5CZXA 2GMLA 1OQ6A 5M2RA 3V4IA 1M5HA 1JKHB 2CDQA 3ITHA 2UUBF 3IBFB 2UUTA 2VL1A 4RPFA 3DDKA 5A8KB 2VKZG 1J5OA 1T7PA 5IC6B 1XR5A 2UVUA 1UWBB 2HLTA 4PABA 9RUBA 3TANA 1C1CB 3FRYA 2BE2B 1RU2A 2OD4A 2CPZA 1M5SA 3KDOA 3GPAA 5IS2A 4X66F 3MOJB 4RNHA 4ED7A 2F63A 2BZ2A 2VG5B 3DMJA 3FUYA 2DR8A 4O0NA 4X4TA 4M5IA 2GAGC 3X1LB 4I68A 3EZUA 1MWZA 3ENAA 1IQTA 1SC4B 4DR3F 3MCOA 2UXDF 3DI6A 2Y1JA 3OL6A 2R8JA 4AL5A 2WB1D 4WFAQ 2LECA 2E9TA 3QSIA 3D7SB 4JI7J 1SJRA 1A0OB 1RP5A 3H59A 1TKTA 4QWCA 1UJ4A 4CTAA 5CZVA 1HW8A 1VQKS 2HK3A 3H5YA 4PUOA 3EDRB 4LFBF 3SQGA 4XIUA 2HQDA 1WC4A 5ETLA 5L1IA 2E44A 1VLOA 4RUHA 3JSBA 4C97A 1TKZB 5FIIA 4KKOA 2WVBA 1VCTA 2CQCA 4EBCA 1JJHA 3ZTOA 3UVJB 1MU2A 1U45A 5LM7E 1X5PA 3HM9A 5A0YB 5KAKA 1RT7A 4Z7YA 3FMWA 2LXUA 5B7WA 3DGPB 3FGVA 4BS2A 4AXJA 1NMEB 2K3KA 3MAHA 4TLRA 1CC8A 1XTZA 4LVNP 3U7JA 4X4OA 1XMQJ 1JNZB 3HHKA 1B64A 1Z2ZA 2ZH1A 4QU7A 1YX2A 3DDNA 2FHJA 4KKOB 1VRUB 1WF2A 1H0HB 3KJFB 4IDKA 4UOGA 1HBUB 3J7A1 3UO0A 3HX9A 5K5MA 1FJCA 1JLQA 5B0EA 3G96A 2I1RA 3W5ZA 2E1RA 3HVWA 3KXDA 4ALZA 3SBMA 4DPOA 2AJFE 3J81j 2W2MP 4W98A 4DN9A 3AQPA 4LBIA 5HO4A 2MQOA 3KK3A 4DLEA 1VYAA 2GAHC 1GMVA 1JMTA 1XR6A 3LPYA 5L39A 1O5JA 2DGTA 1L3SA 3E01A 2YVSA 3POTA 4PG4A 2RJZA 3T41A 3VVTA 3PKYA 4LF8J 5KFIA 2XSJA 4WKYA 2A18A 3EVOA 4OIXA 4YB6A 4MKAA 4DL4A 2RUSA 1TKXB 2AX1A 3DU6A 2QA4G 1C0UA 4F4ZA 2C2EA 3F44A 3P5BP 4JI8F 2JDJA 4USWA 3PYDA 2H65B 3OJUA 1R3NA 3VGUA 5KFCA 1PAEX 3MFHA 2HFSA 1T11A 3EE3A 3FCHA 3M32A 2B4PA 4X4NA 3MMAB 1W7WA 4L3NA 4KY3A 4WP3A 4DG1A 3NXZA 2YKNA 1SIZA 4PEOA 1JNRB 3OVAA 1SC1B 3LP1A 4N7TA 4L3KA 3W9HA 1IXKA 3IRXB 3BPSP 4F3MA 3I0SB 4X64J 3A8IA 4I1TA 2BEFA 2SXLA 4A47A 1JLGA 2EWHA 4F4KA 4JI3F 3M8PA 5D4NA 1YBTA 1RA6A 3PEHA 1RTIA 3PX4A 2AMCB 2CQGA 2JEJA 1JLFB 1RI7A 3Q8VA 2BKPA 1IKWA 2CAJA 3A3PB 1HR0F 3NRBA 3Q24A 5ADZA 4GC7A 1BWVA 4OYWA 1VMBA 2V6AA 1V3SA 5J1PA 1C4CA 1CJVA 2YQ3A 1QTMA 3BPDA 5F8HA 4ED2A 3PEJA 1PSDA 4QYZK 5A2QU 3BS9A 3CMQA 3T6BA 2BW2A 2LFVA 4NLTA 2LQ9A 1TFYA 1RE1B 3IBCB 3ENVA 2M5YA 2IRUA 5DS7A 2CWKA 3AJ1A 4NMXA 1EETA 2HLUA 2PI5A 1RTDA 5DGAA 3MECB 4OZNA 5D6GA 3Q22A 3CDBA 3EGWB 1NHVA 4USIA 4C11B 3BO4A 2V4JA 5CCMA 4KBIA 3NOGA 4RR5A 5D0EA 3D0IE 2JVOA 4CO2A 3H25A 2ZH4A 1KLNA 4FBTA 3QAEA 2ZZTA 1EJ7L 3D28A 2FHKA 3BGLA 1JXEA 4WZMA 3OPKA 1RT7B 3IS9A 5I3PA 1S1VA 3TYTA 5BYQA 2H48B 2JL9A 2O66A 1BQXA 2GS8A 2X1GA 2EFVA 4ZCIA 2GC8A 5DDPC 3JYTB 2BJ8A 2ACMA 1S0NA 4RW9B 2ZDOA 1KQKA 2YWHA 2YNFB 1M1GA 1Y10A 2ZVIA 1A7GE 2EFOA 2YNHB 2L9NA 3UE2A 3Q0AA 1N0UA 1RCOB 4UQTA 1IKVB 2AJ4A 5FLXU 4DR7F 2ZVSA 2MTLA 3KJQB 3QZ7A 3H90A 3BN4A 4HEA9 1TL3A 4ZVPB 4OI1A 1TVRB 4DV5J 2ASLA 2CJAA 3QATA 2GO9A 4JI5J 1IVZA 4CO4A 1NSQA 4A8SA 1U1KA 2JEIA 2U1AA 1NXIA 1HHQA 3Q8QB
chains in the Genus database with same CATH topology
2XO6A 2VJUA 2XQCA 2VJVA 2FYXA 2XMAA 2VICA 2F4FA 2EC2A 2VHGA 2F5GA 2VIHA 2A6OA 2XM3A 2A6MA 4ER8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XO6 A;  2VJU A;  2XQC A;  2VJV A;  2FYX A;  2XMA A;  2VIC A;  2F4F A;  2EC2 A;  2VHG A;  2F5G A;  2VIH A;  2A6O A;  2XM3 A;  2A6M A;  4ER8 A; 
#chains in the Genus database with same CATH topology
 2DJW A;  3OR1 B;  3LOU A;  4A8Q A;  2VBY A;  1N5Y B;  3W61 A;  1VIS A;  1LKZ A;  2JEG A;  5LXY A;  4OZ0 A;  1Z2L A;  2FLP A;  5G0R A;  2IY5 B;  2XBP A;  3CW2 C;  1EQ0 A;  4HYK A;  5AE2 A;  2VFR A;  4KYZ A;  3FCV A;  1DY3 A;  2ASY A;  1NBE B;  5H9F K;  1KOH A;  1SC3 B;  3O2I A;  5KTQ A;  3MCN A;  1X4G A;  2C2D A;  5DDQ C;  4UW2 A;  3DRP A;  2YNG B;  1D9A A;  3HHL C;  1HMV B;  3EMT A;  4DG1 B;  2QA4 S;  3VGS A;  3FZB A;  3ILI A;  3UR0 A;  4RUC A;  4DZ6 A;  4A8Y A;  5IM0 A;  3EGN A;  3OBI A;  5AE1 A;  5HP1 A;  4PPZ A;  4DQI A;  5CD4 H;  2ZBC A;  4DU8 A;  3PW2 A;  4DR1 J;  1KWM A;  2ATL A;  2XLK A;  2KB2 A;  2ACY A;  4QOT A;  1SJF A;  1SXL A;  3CCM S;  1VIX A;  3DLG A;  4EEY A;  3CD7 A;  4DS5 A;  2OP5 A;  3QJP A;  3ILO A;  5DQG A;  5D3G A;  2ROG A;  2VDH A;  3JSM B;  4HHU A;  1R0A B;  5EGY A;  2K1R A;  3T6J A;  4ES2 A;  3FDS A;  4UY8 T;  2D3O R;  1CEZ A;  4NPO A;  1FDN A;  4MT1 A;  1XMB A;  2E9Z A;  1TKX A;  3MZI A;  6FD1 A;  3GMG A;  2NXC A;  5T7L A;  1OIA A;  3CJQ A;  1DRZ A;  3LAM A;  1MN9 A;  1PCA A;  4HT7 A;  4ITS A;  1U1P A;  1RTD B;  3PJ9 A;  2YH0 A;  4OYZ A;  3TX8 A;  2W9B B;  1HNV B;  2CZ9 A;  4O44 B;  3EPG A;  4LF8 F;  1BE4 A;  5KFU A;  2OPQ B;  1VRT B;  4NRT A;  5THW A;  4MFB B;  4B3S J;  4O3R A;  2B5J B;  3W2V B;  3NLC A;  1GTH A;  1XR7 A;  4G3I A;  2WW4 A;  3TVZ A;  5JJB A;  1BGX T;  4DR1 F;  4WFZ A;  1VQ7 S;  3AT1 B;  4QIV A;  4UTG A;  3TA0 A;  2HZV A;  3CJ8 A;  4K7Q A;  2ZOG A;  1K0T A;  3M30 B;  5ETM A;  1XK8 A;  1GEH A;  1ULR A;  2M9K A;  3M8Y A;  3QFW A;  1DBD A;  4OYO A;  4ED8 A;  2MLX A;  4C7Q A;  1OWX A;  2DNN A;  2OPQ A;  1MML A;  2KVI A;  3CWJ A;  2FHO B;  2HQI A;  2J8S A;  3P5T L;  3M1V B;  3QWP A;  2BM0 A;  4IH6 A;  3AD8 C;  1JLA B;  2MQQ A;  1DHM A;  2XWY A;  3Q8U A;  1L5U A;  5F8J A;  1VC0 A;  1LWF A;  4CP5 A;  1JXL A;  4KGM A;  1VRQ C;  2I8E A;  4FXV A;  5LT5 A;  3DRR A;  2FZC B;  2E5J A;  4A46 A;  2I6W A;  3D6T B;  4DV6 J;  2Z8Q A;  1DTT A;  2C3Y A;  2O67 A;  3ENW A;  1YJ9 S;  1FKA F;  1WEZ A;  3AOB A;  3GJQ B;  4HHH A;  2YPY A;  4Y2K A;  4F0K A;  1VQL S;  3KTQ A;  2JLG A;  4HAC A;  1KDN A;  3O6Q A;  3TZW A;  1NCL A;  5HAT A;  4Q5V A;  1O8B A;  1U6Z A;  3KLE B;  4DV5 F;  1XBW A;  1UFL A;  4DI6 A;  4DSJ A;  3MTK A;  2WVD A;  4IFY A;  5C25 A;  1NB7 A;  2OI2 A;  1F60 B;  2R8K A;  2G0I A;  2V4J B;  1XMO J;  3MMB B;  2DHX A;  1HLW A;  2XM3 A;  1JLQ B;  3D1Q A;  5K14 A;  1HWK A;  3KLF B;  1ZZN A;  2OGU A;  4BBY A;  2H4W B;  4CT9 A;  3AQO A;  4LRA A;  3ZZU A;  4P9S A;  1FDD A;  2ZOF A;  3TZX A;  4WU2 A;  2DR7 A;  2A2C A;  4GKK F;  2B6A B;  4R8U B;  1PKU A;  1BMQ B;  5J2M A;  2YKP A;  3MD3 A;  1KD1 T;  3NL0 A;  2HRT A;  2V50 A;  3CJ4 A;  4WU3 A;  3GCX P;  1K1S A;  3K57 A;  4MK7 A;  3I6P A;  4FPI A;  3ZXW A;  2KT2 A;  4OYX A;  3BYP A;  4RBT A;  4DL6 A;  1Q7L B;  3PYF A;  3WC2 A;  3MR2 A;  5LSL A;  2BAN A;  2GJF A;  2IM3 A;  5L1K A;  5L9N A;  3LGN A;  4LT6 A;  2CJ9 A;  2HND A;  3I87 A;  3OSN A;  3W65 A;  4WYW A;  3BBB A;  2XSJ B;  2BJ1 A;  4B02 A;  3MGJ A;  5KFE A;  2KM8 B;  2ZH6 A;  3MED A;  1KON A;  3MM6 B;  4OYA A;  1F3V A;  1VQO S;  1T8E A;  2OPP A;  1D9F A;  2BJ9 A;  5LMN J;  2XGQ A;  2B9W A;  2XHC A;  3MCS A;  3QIP B;  3RZA A;  3BSO A;  5L1J A;  3TUP A;  2KFZ A;  2K2P A;  2L9W A;  2VBZ A;  2F4V F;  3OFH A;  1FWL A;  3PJW A;  2R8G A;  3NGD A;  3CDU A;  4C8Z A;  3G2X A;  3NG8 A;  2M8H A;  3TOQ A;  5ETS A;  1S9G A;  3G82 A;  1X5S A;  2HFN A;  1GXU A;  2AYE A;  2GW8 A;  1WEY A;  3DOL A;  2Z2L A;  2M7S A;  4IOB A;  3A8J A;  2FVR A;  3MCM A;  3DYA A;  2LMI A;  1Y3K A;  2B5J A;  1P6T A;  2VIC A;  2A1B A;  3QIP A;  3ILL A;  1T9T A;  3BEG B;  3L9Z A;  1MMD A;  1RHJ B;  2BRK A;  4CDI A;  4JI3 J;  2RE1 A;  2JNJ A;  1SCJ B;  2YKM A;  1J2V A;  1NZA A;  4KHP F;  3LWL A;  4TXS A;  4HTI A;  1EQM A;  5AT1 B;  2UV8 G;  2BJ3 A;  2R8I A;  1EKR A;  1OSD A;  2LU1 A;  2C2M B;  4ZLJ A;  2I5J B;  3K59 A;  4DV2 J;  3P8B B;  4R5P B;  2FPH X;  2V63 A;  3OD2 A;  5J2N A;  1IJE B;  1WHY A;  3RW6 A;  5KFD A;  4P2F A;  1Q81 T;  2D9P A;  2HQF A;  3UD4 P;  5B0F A;  5CAA A;  3BQ2 A;  5K8P A;  4DR6 J;  7FDR A;  3U1M A;  2QLX A;  3I5B A;  5HJX A;  2RF2 A;  4KV8 B;  1H98 A;  2XO7 A;  1DQ8 A;  2UU9 J;  2F8H A;  3AOC A;  3EDQ B;  3DM2 A;  3MMJ A;  4WXO A;  1UL3 A;  2YPZ A;  3LAK A;  2EFQ A;  5H9E J;  2DIS A;  3LTO A;  4LVO P;  2IBO A;  3UN3 A;  2VIH A;  1CS4 B;  4KJI A;  3H40 A;  5GAG I;  4G1P A;  1WKJ A;  5K8M A;  4DWI A;  1OPZ A;  1YBA A;  2AEM A;  5IT0 A;  8ATC B;  5C25 B;  1LW2 A;  3E3X A;  1JJ4 A;  1NJY A;  1U24 A;  4URG A;  2B4O A;  4RW4 B;  3PV8 A;  1TL1 A;  4MH8 A;  2FZG B;  3R7S B;  9ATC B;  2UVR A;  3IFE A;  4IR9 A;  2KFN A;  2HZC A;  3CED A;  3CUN A;  3CCR S;  2G1H A;  4F4Y A;  1WHX A;  3PTW A;  1LW0 A;  5HQM A;  3DRX A;  1HWL A;  3J7A N;  2CQ0 A;  2NQP A;  1SKR A;  1LFP A;  1Y7P A;  2C2Z B;  3KUE A;  3V4I B;  1CJT A;  2RU3 A;  2AJ1 A;  3UDL A;  1KHV A;  2C22 A;  3RBX A;  4G1Q A;  2ABY A;  1SJQ A;  3OVS A;  2HMI B;  5HSP A;  1GX5 A;  3LP2 B;  2MKH A;  1K47 A;  1T9Y A;  2BAC A;  1RWP B;  1ZM2 A;  2RS8 A;  3BN7 A;  3CDA A;  3IGN A;  4CLZ A;  2YWK A;  5GAH U;  4KSE B;  4J9O A;  4JI2 J;  2Y1I A;  4KPC A;  2LXF A;  1FTC A;  4JI0 J;  2D7S A;  3CUL A;  1UW4 A;  1HNI A;  1DTT B;  2DY9 A;  5I4M A;  4X4R A;  3JSR A;  4YN3 B;  3Q89 A;  2FC8 A;  4FYW B;  2HMI A;  3TAQ A;  2W8K A;  4K59 A;  4C4W A;  4UUW A;  1LOU A;  4USK A;  2OD6 A;  4O4G B;  3GE9 A;  3F73 A;  1T95 A;  5AXK A;  1RT6 B;  3EZO A;  3IMQ J;  1GMW A;  4GO7 X;  4F4X A;  3OUY B;  3QZ8 A;  2IIH A;  3HMJ G;  5MLC V;  2LYV A;  3KJN B;  3UR3 C;  1TV6 B;  2P5V A;  4O0I A;  2UXD J;  2V9K A;  2HWI A;  3NCR A;  1RQ0 A;  1UMJ A;  2ZBP A;  4LFA J;  3HUL A;  4DSE A;  1FRH A;  1U6F A;  2LQJ A;  1ELO A;  2WVE A;  1TAU A;  4A4J A;  4MYT A;  2HQC A;  4NEY A;  4ZVT B;  3JXO A;  1N54 B;  2J6U A;  4IRD A;  3FCW A;  3I4P A;  1S6P B;  4F2S A;  1SC6 A;  2B6A A;  4R8U A;  2QO3 A;  5J2M B;  4QWE A;  5LMN F;  4ZCM A;  2QV6 A;  4ZVF A;  3FFI B;  4FDF A;  3PX6 A;  2C42 A;  4P71 A;  1IKV A;  4YY3 F;  1HYS B;  3TUI C;  2RRA A;  1GNK A;  1NPR A;  3R5A A;  2MJU A;  1YIT S;  3CJT A;  4Y28 C;  1TK8 A;  1RYS A;  1IR2 A;  2FJB B;  2R7R A;  1B0T A;  2QC3 A;  1FE4 A;  5DRK A;  2EI5 A;  4Q2L A;  2Z56 B;  1UET A;  3CME S;  4DSF A;  1V3R A;  2ZFH A;  3IC1 A;  2ASJ A;  4I0W A;  3S8S A;  1IQZ A;  2ZDP A;  3G71 S;  1NPK A;  1VRT A;  2HUR A;  1H74 A;  4NXM F;  3LP1 B;  2PII A;  1S12 A;  2PD1 A;  1YI2 S;  1ZOT A;  2Z30 B;  5IFM A;  2W4C A;  2F4F A;  4LIR A;  1JJC B;  1ZBT A;  1AFJ A;  4LUB A;  4RBU A;  1F9H A;  2BE9 B;  2DXE A;  1R43 A;  2QLB B;  3RAM A;  4RZR A;  3T1Y J;  3SI8 A;  1RUS A;  3C6U A;  4OI2 A;  3ITH B;  3A12 A;  2M52 A;  4OYB A;  3KLG B;  2EG2 A;  1W2I A;  2JVR A;  3AJD A;  1UPM B;  1QSS A;  1EIY B;  4RUA A;  5KG1 A;  4WIQ A;  1F2G A;  1C1C A;  4QJV A;  2KG1 A;  4DDF A;  2C2N A;  1B7Y B;  2CIM A;  2DD8 S;  2QL5 B;  5A8R B;  3OHB A;  1S4F A;  4JB8 B;  1TP7 A;  2VG7 A;  3GYX B;  3NEK A;  4KT0 C;  4TY9 A;  5HVF A;  2EKN A;  4OHV A;  3FEX B;  5HN0 A;  3IWN C;  3QJL A;  4DUY F;  3C2P A;  3VTI A;  1WC6 A;  5E33 A;  4X4Q A;  2FY1 A;  2PA3 A;  4TKT A;  4ANC A;  3RR7 A;  8AT1 B;  5HMW A;  4JI1 F;  4QWA A;  4DV4 J;  1KQS R;  5HMY A;  3D5M A;  4KTQ A;  2E7W A;  3FEY B;  3R5B A;  2FJE B;  1JLE A;  2IA0 A;  3CO0 P;  2DGO A;  3M6X A;  4N8O A;  4OZ5 A;  5EX3 A;  2YNI A;  3FZ2 A;  3D2W A;  3VAJ A;  4EZ6 A;  4DR4 F;  3BGR A;  3PCO B;  2DH7 A;  2XO6 A;  5IZH A;  5DJB A;  1HR0 J;  2UUA J;  2CYY A;  2OEK A;  4OYI A;  4GKJ J;  2HVI A;  2U2F A;  2EC2 A;  2FHJ D;  2EVZ A;  1CS4 A;  1RU1 A;  2EK1 A;  1FVQ A;  4DV1 J;  1WNE A;  1Q16 B;  3TJ9 A;  1LK5 A;  4L6V 3;  2A2D A;  3BGO P;  3A8E A;  1IBC B;  3AY0 A;  3M2R B;  3MFI A;  2XUL A;  2YWF A;  3FJ2 A;  1YZ6 A;  2WON A;  1ZET A;  1PIL A;  3ZZO A;  4UT4 A;  3N79 A;  3PHT A;  1F2H A;  4QWB A;  4NML A;  1N5Q A;  1RBA A;  3JB9 k;  4Q44 A;  4LQ9 A;  3OJS A;  2HVH A;  2UU9 F;  1TUW A;  1NDC A;  2J7W A;  4JBC A;  2M3D A;  3BDP A;  4I4B A;  2VQE F;  4B17 A;  3A1Y G;  2MDA A;  1WJ9 A;  4HL9 A;  2V2K A;  4FVM A;  3DLL Q;  4OZL A;  4P2X A;  2LU2 A;  2FLO A;  4ZVO B;  5EHH A;  1S7H A;  2FLL A;  4WK1 A;  2Y8W A;  2ZBI A;  4WTY A;  3MR5 A;  3HO1 A;  2XI3 A;  2YX7 A;  1IR0 A;  4RW6 B;  4C48 A;  4C98 A;  1DTQ B;  1YJN S;  4V19 X;  1I5O B;  2DNP A;  1RAH B;  5H9F J;  4CZC A;  3SYZ A;  3QPI A;  4FYX B;  4P73 A;  2AIR B;  3ICL A;  2ZUG A;  1UEV A;  3GFH A;  3LGH A;  4H4M A;  4EO6 A;  5DG8 A;  1D0E A;  2GHP A;  1TKT B;  1IN0 A;  1XQI A;  5BXI A;  3LF0 A;  1K1Q A;  2W25 A;  1X4D A;  2IM1 A;  3KLH B;  4Y2A A;  1RAC B;  2RQK A;  1HIY A;  3I5A A;  2CPF A;  1G2E A;  2PT0 A;  1DAX A;  1U1Q A;  4CNY A;  1MWQ A;  1WOO A;  2YWW A;  3GG0 A;  3VZI A;  4AXI A;  4NLQ A;  2RVJ A;  4ZN3 A;  3P3D A;  3MAA A;  1QUV A;  1TKZ A;  1NK5 A;  1NAQ A;  5BR8 J;  3O8W A;  1W25 A;  4U8Y A;  2GGP A;  2YKM B;  4ED1 A;  2PI4 A;  1PJ6 A;  1SVD A;  1N0V C;  3OUY A;  4ELV A;  1DAR A;  4CO1 A;  2O1P A;  3OHA A;  1DLO B;  1S79 A;  2Y0S D;  4J9S A;  4JI6 F;  3GFY A;  3IP0 A;  3KDN A;  3GIL A;  2FJD B;  4I2P A;  4DCJ B;  4TQR A;  2HS3 A;  1U49 A;  2GJI A;  3JSM A;  1UVJ A;  1HQU B;  1VHF A;  1Q82 T;  2CZV C;  4WJB A;  2G9O A;  4J9L A;  3PKM A;  1QE1 B;  2H1Y A;  3EPI A;  2J76 E;  3HK2 A;  5HLF B;  4FS2 A;  5DG7 A;  1GFW B;  2GJ2 A;  3H4D A;  2GQQ A;  4G6V B;  4CYU A;  1KVK A;  1DLO A;  5KOW A;  4Q43 A;  2ZZN A;  4LFB J;  4KGX B;  1IM4 A;  2DPI A;  1D09 B;  1YQH A;  4DX8 H;  3W8P A;  5IXU A;  2KHC A;  2KYX A;  1UCN A;  3R1H A;  4O3N A;  2OEJ A;  2Q43 A;  5AJ3 F;  2E5L J;  1Q8I A;  4W4M A;  2MZJ A;  3BB5 A;  3DM2 B;  3BGR B;  1K9M T;  4P2M A;  1J5O B;  1RLD A;  2P9E A;  4DJB A;  1WSV A;  3JSY A;  3UCU P;  3GR1 A;  4B3T J;  3K8V A;  2QYC A;  2MJN A;  2KTQ A;  5ETN A;  1Q79 A;  3M4X A;  1RTJ B;  1BUX A;  3HFK A;  4CCH A;  2XLJ A;  2EEY A;  4HR2 A;  1S6Q B;  4PRF A;  3B4D A;  2NSB A;  4ED0 A;  4U9R A;  4UZC A;  1RYR A;  2XWX A;  3M1V A;  4PCQ A;  2Z2M A;  3N6N A;  3CD5 A;  2R2R A;  4ZDN A;  2DH8 A;  2LEB A;  3RRG A;  2BBE A;  4DL0 C;  2HGM A;  3M8Z A;  3PYG A;  1Q0N A;  4Y2M A;  2W7O A;  1UZD A;  2XMV A;  4LRE A;  4OI4 A;  1MRO B;  3I0S A;  4PG5 A;  5LOQ A;  4OQJ A;  1WC1 A;  1RTJ A;  3QO9 B;  4NX9 A;  4CTA B;  1MG7 A;  3W9I A;  4IKA A;  4CO3 A;  2W7P A;  2AJQ A;  4DV7 J;  4G1Q B;  4ZS6 A;  3GG1 A;  2YNH A;  4N77 A;  3OTO F;  2COL A;  4MFB A;  2IM2 A;  2FTR A;  4H4O A;  5J1E A;  3C15 B;  4Q8E A;  1TMM A;  2DO4 A;  2V2Q A;  3DOM B;  1FI4 A;  2HGN A;  1YRU A;  2ZH5 A;  1UVI A;  4RBV A;  1NO8 A;  2OFG X;  3SMZ A;  4ZVH A;  1GH8 A;  1JLC A;  2ADC A;  1RWN B;  3VVU A;  1JLE B;  4QPT A;  3MWB A;  4DUT A;  5CXT A;  2ILY A;  1WC0 A;  4PG8 A;  2CNN B;  4FS1 A;  3BO2 A;  4A8X A;  4RW8 B;  4PR6 A;  1OMS A;  5DQH A;  3D67 A;  4WFN Q;  4X64 F;  4UF4 A;  4QR1 A;  4J90 A;  2W2N P;  4O4G A;  5E0O A;  3WHI A;  2IAJ A;  3EYZ A;  3T5L A;  4CLW A;  3GV8 B;  3MAQ A;  3GFX A;  2IA6 A;  3OTC A;  2X7I A;  2FYX A;  1AT1 B;  4JI2 F;  3KNA A;  4IDK B;  2IJN A;  2JC0 A;  1GMU A;  2GGP B;  3MI7 X;  1C0T B;  2K3I A;  4ANE A;  1HNX F;  3R2C J;  4NLU A;  1HYS A;  4K5R A;  4CQ1 A;  4OJ3 A;  2CJK A;  4TY8 A;  1S1V B;  2XS5 A;  2E29 A;  1LNQ A;  4X62 J;  3SIP B;  3I9V 9;  4C8K A;  4JV5 J;  2KRR A;  4DCP B;  3G86 A;  1YJW S;  1NPP A;  2DGX A;  3BRE A;  3I0R B;  5DZ7 A;  2XQC A;  4DSI A;  4WWS A;  4AL6 A;  3MED B;  3MM6 A;  1KVI A;  2HSE B;  2GO8 A;  1CJU B;  3NWR A;  4Z37 A;  3SCJ E;  3IM8 A;  4CM2 A;  3SXL A;  2YNF A;  1FKP A;  1VJQ A;  3VGV A;  5GAH I;  3CJK B;  3L95 X;  5KFB A;  3GJR B;  4P72 A;  4KRW A;  2J9D A;  3MMC A;  1NH8 A;  2V34 A;  2PO4 A;  4H4M B;  4B3S F;  2ZIT A;  3ELH A;  3QRQ A;  2IMW P;  5KT7 A;  4WE1 A;  4YEA A;  4E2F B;  3GJT B;  4QW9 A;  1YGY A;  1VQN S;  3TUZ C;  2RAQ A;  4X84 A;  3OR1 A;  2NRE A;  3T5H A;  2QLF B;  4YDD B;  4DR4 J;  1UJ5 A;  1FRK A;  1L3K A;  3CDE A;  4ES1 A;  4ZKA A;  4NLV A;  4KB7 A;  1WI8 A;  5LMU F;  3MD1 A;  2GNK A;  3G6V A;  5A8R A;  2DRD A;  4M5L A;  3ULH A;  2VJU A;  4K50 A;  3DRY A;  3RRK A;  2B0G A;  2DXF A;  3PW5 A;  2XMJ A;  3MMC B;  5DG9 A;  1B3T A;  1U2C A;  1U7L A;  3QFH A;  4JUZ A;  2RKI A;  1V5I B;  5KFG A;  3DRS A;  1MMN A;  3SEO A;  4R5P A;  5SZT A;  4R0J A;  1KSP A;  3GWC A;  5DDO C;  2PGC A;  5HAO A;  4ED3 A;  5E5N A;  3W2V A;  2HKE A;  2IDL A;  3DRP B;  2HYI B;  4ID5 A;  3OTD A;  2CRL A;  4K0K J;  4X65 F;  1N33 F;  4KHP J;  1S7I A;  1XEZ A;  2LEA A;  4WP9 A;  5HBM A;  3R5G A;  2BAB A;  4B08 A;  1P1L A;  1DQA A;  2KJV A;  5AXN A;  2D74 B;  3OW2 R;  1FHT A;  5KFW A;  4HT5 A;  4ECW A;  3KHG A;  3Q2T C;  1FKO A;  3T5J A;  4E0D A;  1R6V A;  4FF4 A;  5EN1 A;  3PW4 A;  1NUE A;  4OX8 A;  3J80 Y;  2ZOM A;  2A6O A;  3L7U A;  3NS6 A;  2R3V A;  1NJX A;  4J37 A;  2YY3 A;  3RTV A;  4DF4 A;  2YNI B;  2B3T B;  5HVG A;  3DRR B;  4DV4 F;  4RW7 A;  3R97 A;  4ID8 A;  4DQQ A;  1PC5 A;  3U27 A;  4FYD A;  1N32 J;  4M95 A;  4DR7 J;  2MGZ B;  3L3C A;  1B0V A;  1VS3 A;  4DX5 A;  1U25 A;  4NYZ A;  5DET A;  1B70 B;  3KLE A;  4PAA A;  4ZHR B;  1VQ6 S;  4C2M A;  4A8F A;  3KLG A;  1VQM S;  3TEH B;  3RB4 A;  2MQ8 A;  3M2R A;  3ZZP A;  2CPY A;  2QYG A;  1HNW J;  3CF5 Q;  2FD2 A;  1AA1 B;  3LAL A;  2HVZ A;  4HH0 A;  4B3R J;  2MMY A;  1FT8 A;  1H7X A;  2CJQ A;  1X4F A;  2QZ8 A;  2IYG A;  3QT6 A;  1RHR B;  4R25 A;  4WTO B;  1UA0 A;  2VHG A;  1KP6 A;  3HKW A;  1YZ7 A;  3IGV A;  1UVM A;  2AGP A;  3QRP A;  2ZBQ A;  3UI3 A;  5DLG A;  4ZCL A;  1SL2 A;  1T3N A;  1K0V A;  2H3E B;  2BQR A;  2QSF A;  1H3D A;  4Y65 A;  4M8L A;  4Q45 A;  2PDA A;  2WSF C;  2IVM A;  5HMZ A;  1F9F A;  1ZM3 A;  2XY5 A;  2EFG A;  1RIS A;  4LFA F;  1KS2 A;  1RAO A;  4PPD A;  4X4S A;  4DQR A;  2BUN A;  3QLH B;  1OS5 A;  3DLE A;  2AV5 A;  2ZJR Q;  5DO2 A;  2DGQ A;  2QMU B;  1XMO F;  4UY8 5;  2YKO A;  4ZLP A;  2Q3P A;  4EWT A;  3SFG A;  2VUG A;  5G0R B;  4YME A;  4LJM A;  2BM1 A;  4B3O B;  4OJH A;  3J81 U;  4ECX A;  5IV4 A;  1JLB B;  4NA3 A;  3DLH A;  2HWH A;  2DR5 A;  4IG3 A;  1RWV B;  2OPP B;  4I7F A;  4DX6 A;  1FFS B;  3HVA A;  1FRJ A;  4J9U E;  2DNL A;  3BBC A;  2WZ1 A;  3LH2 S;  3MEC A;  4QZV B;  4LF4 F;  1AFI A;  2Z57 B;  3L7O A;  3TWZ A;  3D1O A;  4DV6 F;  2PFF B;  4YY3 J;  1D9D A;  4JV0 A;  3FSX A;  1YHQ S;  3B54 A;  3CTR A;  3DHW C;  2R2U A;  5J2Q A;  1QE1 A;  2GX8 A;  1QDU B;  5IOL A;  2RNE A;  2DNG A;  2WAQ D;  1IJF B;  4MYU A;  4YUD A;  4DV0 J;  2OIH A;  4ZVR B;  1KOO A;  2HNY A;  2ZBR A;  1S48 A;  1HNI B;  3OL8 A;  4AL7 A;  3RR8 A;  3A3O B;  2LLZ A;  2V69 A;  2Z58 B;  2RDI A;  2R7X A;  3PVX A;  4PQU B;  3VQS A;  2DB1 A;  2HG4 A;  3CDW A;  1PBU A;  2PEH A;  2GVD B;  1ZM4 A;  3D6F B;  4ECV A;  3V6H A;  1RT6 A;  3SCK E;  3HHL D;  4Y2I A;  2GVZ B;  3HF5 A;  3PRD A;  5E3P A;  1VQY A;  3J7Y U;  2E1C A;  4GKK J;  4F02 A;  1JB0 C;  1CUL B;  1F5C A;  1X7V A;  2AYB A;  2KJW A;  2JFK A;  3AFG A;  3KJV A;  3NGT A;  3US5 A;  5CAB A;  3PR5 B;  3ETO A;  4ICL B;  4TYB A;  3CJK A;  3K5L A;  1TZ0 A;  2OAU A;  3NGR A;  1QVG R;  4TVA B;  3C8Y A;  1X9M A;  3AOD A;  1S4E A;  2F40 A;  2HQ3 A;  2MZS A;  1VBZ A;  1N34 F;  3K89 A;  1FXL A;  3MMA A;  5F8I A;  2VFV A;  2I9S A;  2KDO A;  2B9E A;  3BZQ A;  4GO5 X;  1Y5L B;  1HPZ B;  2PEB A;  1S99 A;  1KLM A;  2CQ3 A;  2R42 A;  4KV8 A;  2VON A;  2IVY A;  4ZK7 M;  3OXL A;  5I42 A;  3HSZ A;  5IC4 B;  4KIA A;  2AZ3 A;  2ROE A;  2F5G A;  2FIU A;  3GFZ A;  1U09 A;  3WIV A;  3OT9 A;  4IUF A;  2JFD A;  3D0G E;  3M8P B;  2Z4P A;  4C0B A;  3PM9 A;  2V4R A;  4ZVU B;  3G6E S;  1NH7 A;  1UTA A;  5GAE I;  4Q0B B;  2EG1 A;  3K5N A;  1M1H A;  1NJI T;  4JV1 A;  1CJK B;  1HBN B;  1Q8L A;  1IKW B;  1HMV A;  2V4Q A;  1C4A A;  2R7U A;  2AD9 A;  1DJ0 A;  2ILZ A;  5ETT A;  3PR4 A;  5IT9 Y;  5I3U A;  4P52 A;  2X1F A;  5J2P A;  1SJ1 A;  2XMK A;  3K5O A;  1D8Z A;  3QGP A;  3VCD A;  1DFD A;  4CLL A;  2CUY A;  4DCO B;  3MF5 A;  2J5A A;  1T05 A;  3JAM U;  4K4T A;  3EUN A;  1IBM J;  1WTB A;  4CNZ A;  1ROF A;  1NRK A;  2MKI A;  1JLC B;  3BKF A;  2CJB A;  2EXU A;  3MM7 A;  1EET B;  5EWE A;  2JJ4 D;  3MTJ A;  2DVI A;  4IRK A;  3K5M A;  5GAG U;  2N3O A;  4L74 A;  2NR0 A;  1B4S A;  4EU0 A;  3MM9 B;  2DRB A;  3IAM 9;  3MM5 A;  4C3L A;  4W90 B;  2KZZ A;  4I2Q A;  1WG5 A;  3MMB A;  4OZ3 A;  2Q79 A;  1HAR A;  5D0H A;  2BE7 D;  3KHL A;  3T5K A;  2JZ5 A;  3QID A;  4LRF A;  4XAK A;  4F0M A;  2PSZ A;  2F1F A;  4DV2 F;  5CYQ B;  3DOK A;  3W64 A;  3C16 A;  2CPI A;  2E7X A;  4NAS A;  1LFW A;  5A6P A;  1FX2 A;  1WDT A;  4U6P A;  2ZE2 B;  4P75 A;  2BRL A;  1R7I A;  1WOS A;  4FXW A;  3DDI A;  3H8Y A;  3IM9 A;  3JTN A;  2JSX A;  1FEH A;  2RQC A;  2OMO A;  3AD9 C;  3FQL A;  2DNO A;  3CIZ A;  5JXS A;  2BQU A;  1NK4 A;  1REG X;  3D0H E;  3J7Z 5;  1S97 A;  2L9D A;  2VU5 A;  3MHY A;  2OLW A;  4LSZ B;  2ZM6 J;  1KRP A;  1TL3 B;  2KT5 A;  3MPW A;  3RAQ A;  5D8H B;  4LSN B;  2J0S D;  4ZIV A;  2YBV A;  3T1H F;  4LF7 F;  1N5V A;  3UDV A;  3SZ2 A;  3MEG A;  5C2G A;  1RXO B;  2WCX A;  4NLO A;  2HFO A;  5EUH A;  5HK4 A;  2UUW A;  2V8H A;  3W5Y A;  1UJ6 A;  1O6X A;  5DZ6 A;  2PMH A;  4ZMM A;  1XIQ A;  5D0R A;  5KFF A;  1CG2 A;  1O0P A;  2MKJ A;  1CLF A;  4ZP6 A;  1GT8 A;  2EW9 A;  3K17 A;  2RDJ A;  4DR5 F;  4C0H A;  3GU0 A;  3PW0 A;  3DXS X;  2HVD A;  3ISZ A;  3IN5 A;  2DHG A;  3I5C A;  3O44 A;  1VK8 A;  3QLH A;  3QWU A;  2RU9 A;  3H5U A;  5A8W A;  4ZIT A;  2DTJ A;  2KI2 A;  1QAJ A;  1Y4Z B;  4N5S A;  1U0H B;  4LBH A;  1HL6 A;  1MLA A;  4ZVS B;  3KFW X;  1NKC A;  4OZ1 A;  1FES A;  4MK8 A;  2M2B A;  3W62 A;  3CSK A;  5KFO A;  2KZM A;  2ERR A;  2OTJ S;  1ICE B;  3HFZ B;  3N5F A;  4B3M J;  2XMM A;  3QGI A;  4DV7 F;  1E6Y B;  4U67 Q;  1H7W A;  2KXN B;  4ECY A;  1S0O A;  2OSR A;  4KGZ B;  3GIJ A;  4BLG A;  3UVJ A;  4MMO A;  4I6W A;  4USV A;  1TV6 A;  2Y9H A;  1CQM A;  3T3F A;  1SL1 A;  2AYG A;  1YJV A;  2OSQ A;  4NLY A;  2J8A A;  4UUX A;  2HWT A;  2DEJ A;  1U02 A;  3FMB A;  1VBX A;  2HNZ A;  3ZNJ 1;  4CLK A;  4ED5 A;  4KH0 B;  3IAS 9;  5CYM B;  4ZPD A;  1M5V C;  1S6P A;  1T05 B;  2UVW A;  2XS2 A;  4DR5 J;  2FVC A;  1EX8 A;  4FYV B;  2GVZ A;  1N8R T;  3TUJ C;  3DHX A;  2R8H A;  3ZTQ A;  1P9Y A;  2V8V A;  5F8G A;  1H72 C;  2D41 A;  2DGS A;  1AZS B;  1UKU A;  4A48 A;  2WOM A;  4X4U A;  1WF0 A;  1YRT A;  3CJ0 A;  3OQ2 A;  3Q23 A;  3PY8 A;  2EC0 A;  1RDR A;  1RT4 A;  1PO6 A;  2E5L F;  2DNY A;  4M5H A;  5SUH A;  3OR2 B;  4FPR A;  1VQ5 S;  5CA5 A;  4D3G A;  2CQI A;  3G87 A;  1HQ2 A;  4QYZ J;  4IH5 A;  5GAE U;  3N4W A;  4O4R A;  1X60 A;  1T3O A;  2BOA A;  3BBF A;  5L38 A;  2E5H A;  3R9L A;  1T03 B;  1H2T Z;  4USJ C;  2IRX A;  1X0F A;  1FK9 B;  1D1U A;  1HI8 A;  1X4B A;  4NXN J;  1Q7Y T;  4LRB A;  3THV A;  2RH3 A;  4F50 A;  2H5I B;  1IKX A;  4N76 A;  5T41 A;  3NKY A;  2RDD A;  3C6T B;  2DH9 A;  3BF4 A;  3IS9 B;  1RZM A;  4OHZ A;  4C3M A;  5HQL A;  1NK6 A;  4C3K A;  1E6V A;  3QYY A;  2FVS A;  2ZNZ A;  4ETZ A;  5C5J A;  3M9O B;  4KR0 B;  1C1B A;  2IJF A;  2UVV A;  1FCA A;  4WKR A;  2QLJ B;  4CO5 A;  4ZPC A;  5LJ3 Y;  2UUA F;  5DLF A;  2QIF A;  1J27 A;  2J6T A;  5BR8 F;  2HHS A;  2L08 A;  4MK9 A;  2WTF A;  2RRN A;  4FVC A;  3CVK A;  4WF9 Q;  1EP4 B;  3J7Y I;  2KXH A;  4NA2 A;  2QT7 A;  2JEF A;  2UXB F;  5CQG A;  1YDL A;  5HMX A;  3CIM A;  2W2Q P;  4YB5 A;  5B08 A;  2P9C A;  3KUH A;  3R3T A;  4ERD A;  4DFJ A;  2RRB A;  1YJU A;  5KFX A;  1NDK A;  1R31 A;  1FRL A;  3BR9 A;  4KGK A;  1PC4 A;  5BYS A;  3Q8Y A;  4DUY J;  2PE8 A;  4R0E A;  4Y6I A;  2I38 A;  4QBU A;  5IV3 A;  5KFK A;  4FBU A;  1F9E B;  2RT3 A;  5A0Y A;  4MIB A;  2VOP A;  5ITH A;  2MQP A;  3M8S A;  2G2Y A;  2BR0 A;  2OEL A;  3RG6 A;  4YHH J;  1RAG B;  3CJS A;  1LV5 A;  4JI5 F;  5KG5 A;  3I0R A;  4FNH A;  1F5A A;  1OY6 A;  5LXR A;  2ASD A;  2PN6 A;  1OYD A;  3SQO P;  4ZA1 A;  1TUG B;  5KFP A;  4EBD A;  3C3L A;  2XGP A;  2EKY A;  2DGU A;  4Z2X A;  3LUY A;  4FN5 A;  4XDC A;  2BE2 A;  2IRY A;  4DR2 J;  3SCI E;  3BQ1 A;  4RNO A;  4B9T A;  4ECS A;  1SKU B;  1BXN A;  1TU0 B;  2IPO B;  4M5D A;  3KK1 B;  1WUU A;  2JWN A;  2CVI A;  2IAJ B;  4JI4 F;  1DQ9 A;  5C42 A;  4XK8 C;  1PBA A;  5CYM A;  1YIJ S;  1AUD A;  1SQG A;  4MAK A;  3NBP B;  2HHQ A;  4QPX A;  2QMW A;  1M1K T;  2BJE A;  4C8L A;  2DNZ A;  2V68 A;  3UD5 A;  2RB7 A;  1UW9 A;  2HFU A;  3DLE B;  3UD3 P;  2VQF F;  3OXG A;  2QN6 B;  2EBG A;  1AZS A;  2IMO A;  3G8S A;  3MXH P;  2NXE A;  4LBP A;  4AYB D;  2GIR A;  1HBM A;  1N52 B;  1NND A;  3DRS B;  1CJU A;  4ZPV R;  3VAM A;  3T9N A;  3I32 A;  2CPJ A;  1S1T A;  2K8G A;  2IHR 1;  1MNE A;  3IBW A;  1MW7 A;  1RKI A;  2XMU A;  4ZJO A;  1BD6 A;  2HK2 A;  4YP3 A;  4E98 A;  3J80 U;  1XNR J;  3EGZ A;  4MIW A;  4A8W A;  3V81 B;  1PIE A;  2QA2 A;  1X0P A;  5H1S V;  2AYM A;  1REV A;  3D66 A;  1IBL J;  4OHY A;  3AA8 A;  2MLZ A;  5IQQ A;  2VG7 B;  1CJK A;  2FVQ A;  2QEX S;  3ONQ A;  1KNZ A;  1HNV A;  2HNY B;  3FVY A;  2DT9 A;  2W4P A;  2C3U A;  3HD1 A;  3NGU A;  4WE1 B;  3H2U B;  4KE5 A;  5KT3 A;  1S1T B;  4QCL A;  1URN A;  3MM7 B;  2UXC J;  1RWM B;  2CG8 A;  3GR0 A;  1FJG F;  2VPY B;  4L72 B;  3V81 A;  2FJW A;  1Q5V A;  2H54 B;  3UCZ P;  4LQ3 A;  4ED4 A;  2IM0 A;  4RW7 B;  2HRY A;  4X65 J;  4AUK A;  1U48 A;  1Y11 A;  3VHQ A;  4NXN F;  2J9C A;  2BA9 A;  4OZ2 A;  3HCX A;  5L8R C;  5DM6 Q;  2YX4 A;  4JV2 A;  1S10 A;  3D3B J;  5T14 A;  3OTE A;  4LR7 A;  3ET6 B;  2PC6 A;  3DXB A;  2R2S A;  5FD1 A;  4YR0 A;  3P96 A;  1XNQ J;  3LP0 A;  2KH9 A;  3AA9 A;  3M2U A;  1R0A A;  1RT4 B;  1S1U B;  4PYA A;  4J9Q A;  1ITP A;  5JUM A;  4MIA A;  1AXQ A;  2N7Y A;  1WKL A;  2XMT A;  1VDH A;  1X8D A;  5I42 B;  3NMR A;  2D69 A;  4TU8 A;  4NCG A;  2AU0 A;  1UEK A;  1KQF B;  4WBF A;  1FTR A;  3U1N A;  6AT1 B;  4X4P A;  3PIO Q;  3I56 S;  3D3C J;  4O3Q A;  2KRB A;  1JIH A;  1HFE L;  1RAJ A;  1QSY A;  4WP8 A;  3KG1 A;  3HZE A;  1N6Q B;  1YK9 A;  1ZM9 A;  2WBM A;  3BKU A;  3P4U B;  4KO0 B;  2OH2 A;  3NY0 A;  1R0C B;  1C0T A;  4QIG A;  3PW7 A;  1RKJ A;  4F04 B;  2W9C B;  2YH1 A;  1SH0 A;  1FX4 A;  2AEJ A;  3M8Q A;  4O23 A;  4B9S A;  1S76 D;  2NXJ A;  1VBK A;  2CNK B;  2F8M A;  3M2V B;  3G8Q A;  4L73 A;  4ZP7 A;  4A8O A;  3BH6 B;  5K8O A;  2R7W A;  3HZG A;  2MQN A;  5J1N A;  3X3U A;  1MWY A;  3M30 A;  1RT3 A;  4DPX A;  2ALZ A;  1YRX A;  4DFP A;  2HFV A;  1Q78 A;  4IYQ A;  4KHM A;  4X62 F;  4JV5 F;  2H5J B;  2BVZ A;  2V94 A;  3ZZR A;  5LL6 d;  3AAW B;  1RHK B;  4XPE A;  3DLK B;  3PHE A;  2XCA A;  4V19 J;  3MPU B;  4DL7 A;  3E51 A;  4B9L A;  2OJ3 A;  5J2Q B;  3I82 A;  3OSP A;  1RA7 A;  3M05 A;  4KAI A;  1KFS A;  4BC7 A;  1FRX A;  1X31 C;  4JYA J;  2V8P A;  3RBZ A;  4ZPT R;  4MTP A;  2XSF A;  3SV4 A;  1PAU B;  4GC6 A;  1FXR A;  4K2X A;  4ELT A;  2OPS A;  5B09 A;  4XTT A;  2XYP B;  2HGL A;  1NM2 A;  2VG5 A;  3DMJ B;  4I2P B;  4DV3 F;  5E3R A;  2FUG 9;  2D3Z A;  3ZC4 A;  2HNZ B;  4P2S A;  1XC9 A;  3WBZ A;  1H38 A;  2YXL A;  4OHW A;  1UVL A;  4KQZ A;  5LMU J;  4YS2 A;  1HBO B;  4QWD A;  2APO A;  3JQJ A;  3EX7 B;  2M70 A;  1WDD A;  3N0V A;  1G3O A;  3KJV B;  3HJV A;  4CH1 A;  2HBR B;  4ECT A;  2JRS A;  1NSK L;  1CBK A;  3TJA A;  2HIY A;  2W2O P;  5E7O B;  2JHE A;  4NLW A;  5KFN A;  3W3S A;  2BYC A;  2FJV A;  2IVF B;  3ZO7 A;  5JVG Q;  1U1N A;  4OL8 A;  5F41 A;  1OPI A;  1X4A A;  1WG1 A;  2JLE A;  1RT2 B;  2WOM B;  2Y1L B;  7AT1 B;  5HBM B;  1N36 F;  2CNO B;  4TYA A;  2PMW A;  2MY8 A;  5IWA F;  1KLM B;  1ZAX A;  3DC2 A;  1VQS A;  2BOP A;  3KG0 A;  3T1A A;  2E5I A;  2HBZ B;  5KFL A;  4DL2 A;  5LSR A;  2KL8 A;  3CCT A;  3OL7 A;  2W4D A;  5AXM A;  3BGU A;  3CD6 S;  1RWO B;  4W92 B;  1GXT A;  2N3L A;  3UQS A;  3LP0 B;  1HA1 A;  5F0U A;  4DHV A;  5ETO A;  3T19 A;  1IKX B;  2HVE A;  2ADB A;  5D15 A;  1PGZ A;  3M9M B;  2VFS A;  4BC9 A;  3IRX A;  2DR9 A;  4C8M A;  2BKN A;  2QGF B;  1V5V A;  4XO0 A;  4DR3 J;  2DPJ A;  2C2K B;  1FF2 A;  3TI0 A;  5ETP A;  5LSO A;  3HSG A;  4WXW A;  3HI9 A;  3HLU A;  3MEE B;  3TR5 A;  4NLP A;  2CQB A;  1RTI B;  1Q1K A;  1REV B;  5KG2 A;  1SKS A;  4OFZ A;  1RCX B;  4M63 A;  2HHH J;  4ZJL A;  4DZD A;  4LFC J;  1N6Q A;  4HKQ A;  4X66 J;  2ZD1 A;  5EWF A;  1PYT A;  2EFN A;  2AT1 B;  4KFB B;  4M5J A;  2GZO A;  3FRZ A;  5F0W A;  5KFJ A;  3C14 B;  1D3W A;  5AE3 A;  4RNN A;  2VFU A;  3DCA A;  1TAQ A;  5KFY A;  2UUB J;  2MHN A;  2NXN A;  3B4M A;  1U47 A;  4LF7 J;  4ZP9 A;  1KVJ A;  1SH2 A;  3DLG B;  4LR8 A;  4K8R A;  4ZVG A;  4EI2 A;  5KT6 A;  2QLW A;  2ZM6 F;  4K4W A;  1FFW B;  1FKO B;  2WSE C;  4Y34 A;  3MUM P;  2R7Q A;  3HKZ D;  4KFB A;  2KXF A;  1TL5 A;  2K7J A;  3D6M B;  4FKY A;  2DBB A;  2DGV A;  3L09 A;  3M6U A;  5FDL B;  5F3T A;  5D77 A;  3UWT A;  1RAA B;  4NOH A;  2VOD A;  2K1R B;  4JI6 J;  3CC2 S;  3OR2 A;  4F25 A;  5KFZ A;  1S6U A;  3VZH A;  2RS2 A;  2HBQ B;  2O5D A;  3JQK A;  5D4L A;  3KNG A;  2B43 A;  3AOA A;  3RUB L;  2FC9 A;  1HQE B;  4TU7 A;  2ROP A;  2OPS B;  3W7B A;  5HRO A;  2DXD A;  1N36 J;  3ZNU A;  3I31 A;  3SSR A;  2IBK A;  1U6B A;  2XS7 A;  2HHH F;  4LFC F;  1KBR A;  1WD6 A;  3KK1 A;  4NCA A;  1Y0H A;  3MM9 A;  1S1W B;  3KG4 A;  4N8N A;  4URQ U;  1FNX H;  2O01 C;  1I51 B;  1LW2 B;  2MEW A;  1SPB P;  2DY1 A;  3SDE B;  5F9N A;  1J5E J;  4OX7 A;  4ZVQ B;  1DTQ A;  3ZTP A;  1FD2 A;  1UEU A;  5M2P A;  1C1B B;  1CQN A;  1Q8B A;  1VI7 A;  2CQD A;  2ZEJ A;  3M8Q B;  4I67 A;  4DSL A;  3CD0 A;  3MPY A;  4P10 A;  3SCL E;  1N4L A;  2OEM A;  3GIM A;  3RBE A;  1QTN B;  3MEK A;  3KHH A;  4G1I A;  4J5O A;  1N56 A;  1JJ2 R;  1HBM B;  2C28 A;  3MPD A;  1M5P C;  2B8Q A;  2GA7 A;  5E2Q A;  2NUU G;  4U8V A;  4CLT A;  1P9Q C;  1QD1 A;  2B51 A;  2GHW A;  1YKW A;  2JC1 A;  3BM7 A;  3DOM A;  1RK8 A;  3NP5 A;  5CH7 B;  4RNF A;  1SV5 A;  2ZKU A;  2VDI A;  5HQ8 A;  4UOC A;  4LSN A;  4AQY J;  4CM0 A;  2B7C B;  4F0H A;  3CCL S;  3WZ0 A;  1GMW D;  3VAG A;  2J7U A;  2FJA B;  4DOZ A;  3VAL A;  2XI2 A;  1F1B B;  1WF1 A;  4B9U A;  1BY9 A;  3BV8 A;  3H0P A;  5KT5 A;  1Y9O A;  4OI6 A;  5LJ5 Y;  3S6E A;  4DL3 A;  2KT3 A;  3JYT A;  4ES3 A;  3QT8 A;  2DIT A;  1NSP A;  5DQI A;  3Q83 A;  1IM6 A;  3H2V E;  1S5Z A;  3WX4 A;  2B8P A;  4J9N A;  4MKY A;  3V6D A;  2VKR A;  2VG6 A;  2CZ4 A;  1U4B A;  4Q2M A;  4DV3 J;  5K14 B;  4CH0 S;  1V6H A;  3OFE A;  4UZB A;  3KLF A;  3HPO A;  2QE5 A;  2YKQ A;  3IRW P;  3TO8 A;  4QR0 A;  1RTZ A;  1YSJ A;  2V5H G;  2ZHB A;  2KHD A;  4X2B A;  1NHU A;  4IR1 A;  3Q86 A;  1F3F A;  3KK2 A;  2Y8Y A;  4LIW A;  5D78 A;  3HSJ A;  5I3U B;  4TQS A;  1ARO P;  2IYI A;  1M90 T;  2V67 A;  1FJE B;  1A6L A;  1Y00 A;  2FGO A;  4OMF G;  4B9N A;  3GYG A;  5RUB A;  1TKD A;  3QQC D;  3QJJ A;  1SKW A;  2HPU A;  1N88 A;  1SH3 A;  2BJ7 A;  2VG6 B;  2BAN B;  5F8N A;  1ZYQ A;  4NI2 A;  1FRM A;  2C2O B;  5DM7 Q;  5T7L B;  1CUL A;  4F4A A;  2E5G A;  1ACM B;  1T03 A;  5KG0 A;  2CJX B;  3A4T A;  2UZA A;  5FLX Y;  2CPX A;  2ZWO A;  3RW7 A;  4GMK A;  4OJG A;  5FDL A;  5D4P A;  3B78 A;  3S01 A;  4TU9 A;  2W9B A;  2AQ4 A;  2MKY A;  4IO1 A;  3OLB A;  4ATN A;  3GYN A;  4LF6 J;  3NNC A;  1LK7 A;  4Y00 A;  3MM5 B;  1TL4 A;  3V4M A;  2W9A A;  1QLN A;  4CWB A;  1UP1 A;  3BDE A;  4M5K A;  4PXD A;  1HNZ F;  1BC6 A;  1TL1 B;  1NK8 A;  2DGW A;  2R9L A;  1J5E F;  1FJ7 A;  4NXM J;  2GHV C;  3PDN A;  4ECR A;  4OJ1 A;  3EXC X;  4IOC Q;  1QVF R;  2IC3 A;  5L46 A;  4K4S A;  2WHO A;  5JMN A;  1NK7 A;  3MUV P;  4Q8F A;  3AD7 C;  3OVB A;  1TK5 A;  2WRM A;  2YTC A;  1FA0 A;  1Y5I B;  2QSW A;  3MEE A;  3QMQ A;  2XMA A;  2RKI B;  1EP4 A;  1RT3 B;  4YDX A;  4HI2 A;  4CI0 B;  5B0C A;  1TL7 A;  3FK4 A;  2ZH9 A;  1YTY A;  2XY7 A;  4O3S A;  3SDE A;  1FNM A;  2A10 A;  3QGH A;  2W8L A;  2CJY B;  3H98 A;  2YKN B;  1RTH A;  1EAY C;  2DNR A;  1CSJ A;  1R8B A;  2VPZ B;  3E8O A;  4NZ7 A;  4TNO A;  3TNV A;  4PXC A;  3UDE A;  5D3G B;  1U0S A;  2EBE A;  2CG4 A;  1IBL F;  2GIQ A;  3SSQ A;  1RLC L;  1RT5 B;  4NL5 A;  2LCW A;  2RIJ A;  3R5C A;  3CJ5 A;  3R5J B;  3K0J A;  4KHR A;  4J9K A;  3RB6 A;  1JLB A;  1KTQ A;  3GP9 A;  3QT5 A;  1FE0 A;  5B0D A;  1IWG A;  2MYF A;  4OZJ A;  3CC4 S;  4EO8 A;  1U1L A;  4F67 A;  4AE5 A;  3C6T A;  4ECQ A;  2AP6 A;  4B3R F;  5E3Q A;  2RHQ B;  3KLI B;  1SBR A;  1SV5 B;  2BX6 A;  1PG5 B;  2M4M A;  3U1L A;  2HHP A;  1Z1Z A;  4HHJ A;  3SFU A;  4EFA C;  1TEL A;  4EBE A;  4FF1 A;  4KGV B;  3HHL B;  3WX8 A;  5F8L A;  3J81 Y;  3MUT P;  4QIW D;  1BQN B;  3I96 A;  1U2R A;  4DFK A;  2NZC A;  3QSY B;  1LWE A;  2HHU A;  2DCL A;  1NJZ A;  4IH7 A;  2MGZ A;  3C46 A;  3FBF A;  1ZZF A;  4MKB A;  5KOX A;  2R7T A;  2C3M A;  4LSL B;  3S1T A;  2V2Z A;  1VBY A;  3H20 A;  2Y3Y A;  4JI0 F;  2KYZ A;  3VQT A;  1FXD A;  1ZTW A;  4PWU A;  2NSC A;  2MST A;  3MM8 B;  1X4E A;  4ZPW R;  3WC0 A;  5A8K A;  2JH3 A;  3ISN C;  4ZP8 A;  2G4B A;  2AZ1 A;  4DPU A;  2CDR B;  3IR7 B;  2W9C A;  2WB4 A;  4DR2 F;  2C2R A;  5KG3 A;  2E1P A;  1Q95 G;  1XNR F;  1OO0 B;  2XEX A;  1YJ7 A;  3KK3 B;  1BWE A;  3VF0 B;  1LWF B;  4K4U A;  4WK3 A;  2AHO B;  3ZZY A;  4S0M A;  1YLX A;  4XPC A;  1CJT B;  4YB1 P;  5CD4 A;  3HT3 A;  3CCU S;  4RW9 A;  1HD1 A;  1S1X A;  3CC7 S;  4EMD A;  2OHD A;  3W2W A;  5F3Z A;  4YHH F;  4WII A;  1Y3J A;  3M7V A;  5D4O A;  4ZIW A;  2X3D A;  1SJ4 P;  3DLK A;  3TA2 A;  4NLG A;  2UUC J;  2WBR A;  1ZAV A;  2DNM A;  1QAX A;  2P2C B;  3UFC X;  2GQ2 A;  3ETM A;  5C2C A;  1VLY A;  1NKE A;  3PO5 A;  3U02 A;  2XHW A;  5KG6 A;  4PUO B;  5C42 B;  1NEE A;  3UDC A;  4DEZ A;  3DGV A;  4Y2C A;  3BQ0 A;  2A6M A;  1X5O A;  3NBP A;  4QQB A;  4Y0F A;  4EGL A;  3D9B A;  1BQM A;  2ZKT A;  2WVC A;  4DQP A;  4LF9 F;  4CLU A;  2FY8 A;  1X4C A;  3EJM A;  1ZA2 B;  3MR6 A;  3MAA B;  3CNQ P;  3UPF A;  1D8Y A;  1JLG B;  3UN5 A;  3WQP A;  4ILL A;  3V2U C;  3FBC A;  3C66 A;  4F3Q A;  1KC8 T;  2AJ0 A;  2LQ8 A;  1LEO A;  4NA1 A;  3P45 B;  4WPA A;  3CCQ S;  3K58 A;  3EXY A;  3PYE A;  3FKB A;  2YNG A;  4LR9 A;  1T94 A;  1HWI A;  1Z4U A;  1S72 S;  2UUC F;  4KPY A;  2R7S A;  1RTH B;  4JYA F;  2NYI A;  1DZ5 A;  1E6V B;  2RD5 C;  2DEI A;  1CC7 A;  4LF5 F;  3PG9 A;  4NLS A;  4DXL A;  4RWX A;  2OPR A;  3HXM A;  4H4K A;  3RB3 A;  2RF2 B;  5A76 A;  3HVT B;  2UP1 A;  4YFU A;  2HS4 A;  1C2P A;  2HIQ A;  3TAP A;  4PWD A;  1PJ7 A;  2NYH A;  3QAU A;  1AB8 A;  3DNC A;  4JI7 F;  1WEL A;  4FF2 A;  2K7K A;  3NMA A;  1H2V Z;  1OQ3 A;  2E1M C;  3BH7 B;  3RJM B;  2M0G B;  1XJW B;  2CFX A;  2WK4 A;  5KG4 A;  4LF9 J;  2XLI A;  3SSS A;  1IBK F;  1FER A;  1SUQ B;  3AJ2 A;  5HL7 Q;  1S0M A;  2ZE2 A;  4B9V A;  1RWX B;  3PO4 A;  2LDY A;  1UWB A;  2HAF A;  3K7R A;  1WAC A;  1NDL A;  1S9E B;  2F65 A;  2F4V J;  2DR6 A;  2Q66 A;  5HI7 A;  1RWK B;  1KEK A;  4CRJ A;  2XB2 D;  3MUR P;  3VWS A;  3BGF A;  4RW8 A;  3OTB A;  3LQV A;  2OML A;  4UST A;  2VOO A;  3R7B B;  1TQL A;  3G4S S;  1YVF A;  2C3O A;  2DKO B;  3ET6 A;  3W9J A;  4U95 A;  1R8C A;  2DNQ A;  4K4X A;  3BYR A;  5C24 B;  3FSI A;  1EB0 A;  4KH1 B;  1SUQ A;  2FB0 A;  1I1G A;  2LKZ A;  2GMH A;  1P27 B;  2NLW A;  1OJ4 A;  4FYY B;  4USH A;  3R6L B;  2R4F A;  2Y1R I;  3GII A;  2AF6 A;  4DQS A;  3K5P A;  3RRH A;  2XCP A;  4P7T A;  2BW7 A;  4BWJ A;  4U96 A;  2KM8 C;  4DUZ J;  4OI0 A;  1HW9 A;  1IWA A;  2OUG A;  3L7P A;  1RGV A;  4ILR A;  4U7U K;  4CLF A;  1GTE A;  1P8G A;  2MQL A;  3GB0 A;  1HKA A;  1G6B A;  2J0W A;  4CT8 A;  4NE9 C;  2XTJ P;  2Y0B B;  4NLX A;  3G6Y A;  1MRO A;  5KFV A;  3HD2 A;  1N5S A;  3TQE A;  2LA6 A;  3R6G B;  1M0S A;  2VZ9 A;  4DLG A;  4I7F B;  4DF8 A;  2CWX A;  3EM1 A;  1FKP B;  2N4C A;  1UPP A;  2LA4 A;  4LF4 J;  1LXN A;  2CNL B;  2LP4 A;  3PJX A;  2CKW A;  2B9Y A;  2L48 A;  4ZPA A;  3CCJ S;  4RL1 A;  1I94 F;  3KLI A;  1MU2 B;  1FEE A;  2D3O 1;  4L76 A;  2CQH A;  2VC0 A;  1LWC A;  4C6A A;  5L1L A;  1S59 A;  4C9D A;  2NXU A;  3H2L A;  4ETX A;  4AD6 A;  3CCV S;  3OFG A;  1X4H A;  4IFV A;  5CYQ A;  2WW8 A;  4RUB A;  1OY9 A;  5HRO B;  1RWU A;  3TZZ A;  2MKS A;  4K4V A;  1TUV A;  1VIO A;  2MKC A;  3NWG A;  4NEZ A;  4V1A k;  3GV5 B;  4IO9 Q;  1S1W A;  4LF6 F;  1RAD B;  2OO4 A;  3FFI A;  1MSW D;  4F3O A;  4HDH A;  2KU7 A;  4B3M F;  2QTW A;  3KMQ A;  4ER8 A;  1B7F A;  2VV5 A;  1X9S A;  3DI6 B;  3LP2 A;  2ZC3 A;  1F5B A;  5B0A A;  1KR4 A;  3RU0 A;  1UWA A;  2OTL S;  2ALY B;  4BHQ A;  4CYU B;  3IG1 A;  1HI1 A;  3OXF A;  4M5M A;  5GMD A;  4WCE Q;  4TY8 B;  2V0N A;  1T9U A;  3N6M A;  1N48 A;  1VQ4 S;  1UVN A;  4ID5 B;  3QRR A;  3IA0 A;  1WTF A;  1DUR A;  4YB7 A;  2V2V A;  4OV6 A;  2YX1 A;  2VQF J;  5IWA J;  4RKU C;  1K44 A;  1ZH5 A;  3DN9 A;  1HBO A;  3AXM A;  4I6Y A;  4DN0 A;  1WHV A;  4DSK A;  1R89 A;  2RIL A;  2MY7 A;  1SIW B;  2D1C A;  4MJK A;  5B0G A;  3ZTS A;  3B6B A;  5IT4 A;  5A8W B;  4FF3 A;  1RSC A;  2CPE A;  2HAI A;  5ETK A;  3KYL A;  2DRA A;  2X1A A;  2BKO A;  3IR6 B;  3C6U B;  4JI4 J;  1U0H A;  4PYD A;  4CLS A;  4RU9 A;  1TK0 A;  1S6O A;  2FDN A;  1IBK J;  1HNZ J;  4M94 A;  2G13 A;  3R5D A;  5AJ3 J;  5GME A;  3CGI A;  2N7C A;  1RAB B;  3PXG a;  3NAI A;  2NCK L;  4PG6 A;  1ZAW A;  2W24 A;  3BJY A;  3K8W A;  2ZJQ Q;  2CQ4 A;  3NS7 B;  3N01 A;  2LDI A;  2ATC B;  3N5B A;  1QAY A;  3H7H B;  4GVL A;  4BDP A;  4NZ6 A;  3Q8S B;  3EZ5 A;  4J9P A;  1ZA1 B;  4HH1 A;  4DPW A;  3QO9 A;  1VQP S;  1RJJ A;  2MZT A;  3CMA S;  2E7V A;  2W01 A;  5BJR A;  2G2O A;  3Q8P B;  1VHI A;  5A6W A;  2YQ0 A;  5KFH A;  1U26 A;  1X5T A;  2XZD B;  3QGG A;  2F7V A;  3K2Y A;  4GVB B;  1HQU A;  2Z2Z A;  4PG7 A;  3KK2 B;  3CJ3 A;  2D9O A;  3D1H A;  3ENQ A;  1WC5 A;  3IXQ A;  4DMZ A;  2AGO A;  2W7A A;  2DCU B;  3NOC A;  5L9X A;  3HVR A;  2ZHA A;  1UAW A;  3D54 A;  2BXJ A;  2NPF A;  4ECU A;  4A8K A;  2BJD A;  2CXE A;  4LF2 A;  1K73 T;  2BDP A;  1JWW A;  3GTY X;  2QRR A;  2HHW A;  2XG8 A;  2UXB J;  2CQP A;  2ZHO A;  4JOU A;  2M88 A;  3C16 B;  1EZZ B;  2GIF A;  4GVB A;  2P9G A;  3VAF A;  4RWW A;  4CLY A;  1YJT A;  2VBX A;  2ZH3 A;  4EYH B;  5K20 B;  3M8R A;  4BWM A;  2DHH A;  4IFY B;  4Q7A A;  4AND A;  3RAX A;  1HWJ A;  5KFR A;  1V9O A;  3VAH A;  4B3O A;  2AWZ A;  3HHE A;  3M2U B;  1F0X A;  1LWC B;  1Q86 T;  3D6H B;  2B7B B;  7FD1 A;  1NB2 A;  2X1B A;  3OFF A;  2KFY A;  4AQY F;  1KN6 A;  2DK2 A;  5ETR A;  3H42 A;  4I69 A;  2RUG A;  3R8Y A;  4PZV A;  1VJW A;  3ISN D;  1M5O C;  3O5T B;  3KLV A;  3OL9 A;  3MM8 A;  2E1A A;  5GAD I;  3FBB A;  3VR1 A;  3RGI A;  3M6W A;  2V8G A;  3OV7 A;  3CPW R;  1SJ3 P;  3W2W B;  3PX0 A;  2H51 B;  4KO0 A;  3MOZ A;  3GQC A;  4J7C A;  4I6A A;  3LWM A;  2FZK B;  3TZY A;  2B4U A;  2VQE J;  1HQE A;  4USM A;  3UCG A;  2PA8 D;  3TW0 A;  2ZH8 A;  1WC3 A;  1UFK A;  1RAI B;  2BQ3 A;  3KLH A;  2I0X A;  4NYP A;  4OX6 A;  5KFT A;  2VF3 A;  3UNY A;  3GCW P;  3EWG A;  5F8M A;  2A0F B;  2GVD A;  4K4Y A;  1A9N B;  5BYR A;  1PYO B;  1URR A;  4HVZ A;  1FFG B;  3KHR A;  3CE8 A;  1K8A T;  4OHX A;  4H4O B;  5J1E B;  4FXD A;  4FP9 A;  1LXJ A;  2Q6B A;  2N82 B;  4J91 A;  1CPZ A;  1LQ9 A;  2IFX A;  4ICL A;  4TLQ A;  3CCW A;  2L41 A;  1T0T V;  1TMJ A;  2AW0 A;  3KKF A;  1NU4 A;  1SB6 A;  4DPY A;  3AHP A;  4F7V A;  1BQN A;  1KHW A;  4J9V A;  4CIO A;  3T1Y F;  2W2P P;  2WON B;  1PJ5 A;  4ZVE A;  5F9L A;  1VGY A;  1QSL A;  3DOL B;  2FGC A;  4HAC B;  5K9F A;  3VGT A;  1UVK A;  4DS4 A;  5GAD U;  2FVP A;  3F41 A;  1UZH A;  3BKT A;  2KG0 A;  3VV2 B;  4ZLL A;  5IQ6 A;  3CCE S;  1S0V A;  4HLB A;  2QL7 B;  1U8S A;  3HHD A;  4K4Z A;  4O3P A;  3T9Z A;  1IKY A;  2X51 A;  4B9M A;  4UOF A;  1C0U B;  2E9R X;  4NI2 B;  1CVJ A;  2H9Z A;  3I9Z A;  3VAK A;  2HRU A;  1HBN A;  3CCS S;  2LVW A;  2DHS A;  2I5J A;  3BSC A;  4OLO A;  4M5D B;  4UOH A;  1G7C B;  2DNK A;  1HWU A;  2HS0 A;  3C14 A;  3MDF A;  2OKQ A;  4ZOS A;  2ZH2 A;  1U8W A;  4HI1 A;  2X3G A;  4NCB A;  1JQG A;  1RT2 A;  3BSA A;  1VFJ A;  1GQE A;  2XYH B;  3GV7 B;  1N32 F;  4ECZ A;  4QU6 A;  2VB6 A;  3LW5 C;  4RJV A;  4YR2 A;  1RBL A;  1NK9 A;  4P7V A;  3JQM A;  3NNH A;  1FK9 A;  2XYG B;  1U1R A;  4GRS A;  3ZZT A;  2HHV A;  1KFD A;  2XNR A;  1HD0 A;  2F3J A;  4BCA A;  1JKH A;  4ZHR A;  1U1O A;  3RYL A;  3I4H X;  2MSS A;  4IG0 A;  5C24 A;  3TVY A;  2VFT A;  2QX0 A;  3PFE A;  2F9D A;  3DU5 A;  4I2Q B;  4RW4 A;  3LGM A;  1JK9 B;  1YG0 A;  2KN4 A;  3CB4 A;  5GVQ A;  1WG4 A;  4UQG A;  4DUZ F;  1FNO A;  1TTH B;  1WWH A;  4MKV A;  2EK6 A;  2MHE A;  1S77 D;  2YWG A;  4LF5 J;  3E2E A;  4IRC A;  1LWX A;  2LQ5 A;  3CJ2 A;  3AH6 A;  2RQ4 A;  3TVK A;  3GSD A;  2I2Y A;  4IG0 B;  4M5G A;  3NCP A;  3HT0 A;  2XZW A;  1AYE A;  1AUS L;  4J9M A;  4ED6 A;  1APS A;  1AW0 A;  1T02 A;  3QBC A;  1H2U X;  1ZPV A;  3GZ7 A;  2HHT A;  1R6Y A;  1MN7 A;  3ADA C;  2HBY B;  3NAH A;  1RBO B;  5J2P B;  2H4Y B;  3DKD A;  3R27 A;  1VC5 A;  3HHL A;  2RML A;  3W63 A;  3MEG B;  1T9W A;  1Y5N B;  2NPI A;  2QFJ A;  4EZ9 A;  4X4V A;  4PKD B;  2OFH X;  1WKK A;  2JLF A;  3W60 A;  3ZTR A;  2F8E X;  1I6J A;  2NZ4 A;  3NGK A;  1TL7 B;  5C7P A;  1XMQ F;  4IG3 B;  1QUP A;  3FC9 A;  1R8P A;  2DYA A;  2MLY A;  4ZCK A;  3KMS A;  3LA0 A;  5H9E K;  2Q6C A;  1B99 A;  3ZZ0 A;  3PFO A;  3CXC R;  1Q8K A;  1SI9 A;  1IBM F;  4ILM A;  4U7C A;  2G1D A;  4O44 A;  4N56 A;  2BMB A;  4LMZ A;  5KT2 A;  1WSR A;  3R1L A;  1RT5 A;  4ZJQ A;  1S9E A;  1U1M A;  1GK8 A;  2XZT B;  2VPW B;  2MKK A;  1N33 J;  2P6T A;  4ZN1 A;  3SV3 A;  3HFV A;  1IUJ A;  4C0O C;  5IT9 U;  1YBU A;  3H5S A;  3JTP A;  4H4K C;  2AX0 A;  5MAO A;  2HZA A;  1RAE B;  3BR8 A;  3FSY A;  4TN2 A;  4DBQ A;  4YR3 A;  3Q2S C;  1JX4 A;  1GAO A;  4Z7C A;  2AKW B;  2HFZ A;  5HAN A;  2O3D A;  2XC9 A;  3TAM B;  1X9W A;  2VA3 A;  3HJF A;  3N9U C;  5KFM A;  1E6Y A;  5GMK a;  1FO1 A;  3FQK A;  2WSC C;  4G65 A;  4PXB A;  3J7Z T;  4DX7 A;  3Q8R B;  1R8H A;  4JI8 J;  1N5Y A;  2VA2 A;  4QIF A;  3NNA A;  1HNX J;  3PRB A;  3C15 A;  1GXL A;  2XY6 A;  3F0N A;  3PRV A;  1VR6 A;  2B56 A;  2EFP A;  3M2V A;  1LW0 B;  2ZWP A;  5D0G A;  1EAR A;  3N6L A;  1FVS A;  4FKX A;  1H73 A;  1VQ9 S;  2XMW A;  1BLU A;  2FLN A;  5FJ4 A;  4WFY A;  1NK0 A;  4RLE A;  4RU2 A;  3ILJ A;  1RHQ B;  2GQC A;  3TX0 A;  5KFQ A;  3KWM A;  2XNQ A;  3P6Y C;  4ZPB A;  2RQM A;  4FZV A;  2G0C A;  3GLJ A;  4K2J A;  4D3H A;  4ENO A;  3L4B C;  4DV1 F;  2ZZM A;  1N5T A;  1FJG J;  2DIV A;  4P6Q A;  1Q53 A;  3M8W A;  1P1T A;  1QJH A;  1KKH A;  5KFS A;  3MR3 A;  2GCF A;  2QA1 A;  4AFF A;  1UA1 A;  1FDB A;  2QMX A;  4J9R A;  1M5K C;  2V8D A;  4U7U D;  2A3J A;  3CO9 A;  1NLK L;  1S9G B;  3G82 B;  2CVE A;  1NDP A;  1TFW A;  4L75 A;  5U47 A;  2R2T A;  3R2D J;  4DL5 A;  4H54 A;  1XN9 A;  2LEP A;  3DYA B;  4USU A;  3FNN A;  2FJX A;  1S9F A;  1WOR A;  3A8K A;  4DV0 F;  4DFM A;  3P49 B;  3HP6 A;  1JXV A;  1W2B R;  3G8T A;  4M5N A;  2P6S A;  1HHT P;  1FD8 A;  2IC3 B;  4PQA A;  2C3P A;  2NUH A;  2POK A;  2ZNY A;  5K8N A;  5EDW A;  4ZLN A;  5JVH Q;  1HBU A;  1NKB A;  1YWX A;  1RT1 B;  3DGP A;  3BSN A;  1QM9 A;  4PWD B;  2VH7 A;  4ELU A;  4EYI B;  1G4C A;  4K0K F;  5I3Q A;  1QAI A;  2HND B;  3CCZ A;  1QY7 A;  3V6K A;  2J0Q D;  1U2F A;  1SQE A;  2LQB A;  3TAR A;  4P74 A;  3GSI A;  3MPV A;  3GJS B;  5DDR C;  3G9C A;  5ETV A;  4DPT A;  4B3T F;  4KC5 A;  3JTO A;  4RX6 A;  1NJW A;  2MZ1 A;  3AXK A;  8RUC A;  3BO3 A;  4IOA Q;  2NS1 B;  1FWK A;  1RT1 A;  4YQW A;  3W5X A;  5CHC B;  3T1H J;  3D68 A;  4FNI A;  4PWW A;  2ZH7 A;  2AGQ A;  5B0B A;  3OTO J;  2KO1 A;  2W1B A;  5A2Q Y;  3V5R A;  2PMZ D;  1NHK L;  3ZFV A;  1SQF A;  1ZS6 A;  2RHS B;  5HJY A;  2KVQ E;  2ZC4 A;  4C11 A;  1RAF B;  2CQ2 A;  2OPR B;  2VPX B;  4OYP A;  1H6K X;  2MB0 B;  1HPZ A;  2G0J A;  4LRD A;  4C8Y A;  1L3U A;  4PXE A;  3NCQ A;  3CJR A;  3B82 A;  3B8H A;  1HNW F;  3G6X A;  3N28 A;  3O1L A;  4IQM A;  4CO0 A;  3AB2 B;  3JAM Y;  1PYS B;  2ZUA A;  2KKH A;  4LSL A;  2IDE A;  4NZ0 A;  4DU7 A;  2B9X A;  2YWE A;  5KG7 A;  1GX6 A;  3WDO A;  2JX2 A;  2VJV A;  4Q0B A;  1NZ8 A;  5G4D A;  2YKA A;  3TAM A;  1OY8 A;  2CQ1 A;  4JP8 A;  1S49 A;  3H4B A;  2ZD1 B;  1IR1 A;  2Z0G A;  5AXL A;  1ZTT A;  1S6Q A;  1T9V A;  2L3M A;  1EHW A;  4URS A;  3PZP A;  5DGB A;  4CLP A;  5J2N B;  2MPU A;  3EVW A;  4LF1 A;  5EX0 A;  4QW8 A;  3LO3 A;  3I55 S;  6FDR A;  1VC6 A;  2HEK A;  1I3O B;  4NWB A;  4WYL A;  1WHW A;  2VBW A;  3AB4 B;  1CJV B;  1F6T A;  3A3N B;  4EK2 A;  3PIP Q;  2QG9 B;  2PFD A;  2DNH A;  3SQG B;  1S1X B;  3IWX A;  3NS5 A;  1JLF A;  3EIC A;  4RO0 A;  1NSA A;  1HI0 P;  1KTV A;  3UW1 A;  1OYE A;  2RSQ A;  3GON A;  3M6V A;  5CYJ A;  2DO0 A;  5KT4 A;  2B4V A;  2Q1L A;  3NGS A;  5HVH A;  1L3T A;  3D4J A;  1BHN A;  1JLA A;  3W8G A;  4N41 A;  1TR0 A;  1B0P A;  5E41 A;  2MZQ A;  2J6S A;  2K06 A;  3V6D B;  3IO1 A;  2YQ1 A;  3DLB A;  2HHX A;  4IQX A;  1VK3 A;  3IG1 B;  2CPH A;  3MR7 A;  3DOK B;  5EWG A;  3UNG C;  1S57 A;  3EVM A;  2DHA A;  5E3A A;  4WZQ A;  3WIU A;  3TEG A;  3RB0 A;  3GIK A;  3PAC A;  1ZPW X;  2VC1 A;  1HHS A;  4QYR A;  2AJ2 A;  5IM0 B;  3THP A;  5HP1 B;  5KFA A;  1R27 B;  1V3Z A;  2MZR A;  3CT9 A;  2FHM A;  1XWL A;  3QNW B;  5HLF A;  5M2U A;  4OX9 J;  2N4D A;  1R0B G;  3THT A;  1N34 J;  2J7K A;  4QR2 A;  1RHU B;  1R8A A;  2MXY A;  3TA1 A;  1RB0 A;  2G2Z A;  2GV1 A;  3GIR A;  3IWL A;  4IFV B;  4C8O A;  5CCL A;  2Z2Y B;  5E3C A;  3E01 B;  3POT B;  4NRU A;  4NLD A;  4O3O A;  2C1E B;  1RHM B;  3EGV A;  3PNI A;  1RWW B;  3TJ8 A;  3M9N B;  3ZZZ A;  3FBE A;  4NYO A;  1FRI A;  4F2R A;  4RW6 A;  3DLJ A;  2VD3 A;  4YOE A;  2QFI A;  3H5X A;  2UV8 A;  2CA9 A;  5ETQ A;  4OX9 F;  2LXI A;  3W1Y C;  1TVR A;  4N47 A;  2EPI A;  1XNQ F;  3M32 B;  4RNM A;  4C8N A;  3KUG A;  4JI1 J;  2GFF A;  2WVF A;  4I64 A;  1FDA A;  4HDG A;  4A8M P;  3KOA A;  1WI6 A;  4DR6 F;  1S1U A;  1OSC A;  2CAD A;  3FEZ A;  2J9E A;  1YJR A;  3LPE A;  2H5E A;  4F8R A;  4F36 A;  3LAN A;  4M1K A;  2E66 A;  4NCG B;  2ZJP Q;  1Q5Y A;  1BQM B;  2R7O A;  3R7N B;  4OI3 A;  3A13 A;  1VRU A;  3QT7 A;  4OLP A;  1WOP A;  4NLR A;  3VAI A;  1IKY B;  4I56 A;  2J0X A;  2AEF A;  4OYM A;  2QJ3 A;  3C19 A;  3DFE A;  4OV1 A;  4AT1 B;  4F26 A;  4WFB Q;  1L3V A;  2CPD A;  1XER A;  3S7R A;  3RBD A;  1T9X A;  4HTJ A;  2UXC F;  3HHN B;  4K5S A;  1VQ8 S;  2HW3 A;  2DIU A;  4CH7 A;  3UN2 A;  1I94 J;  1UFW A;  3TQ1 A;  4XDD A;  3HDS A;  1WEX A;  4GKJ F;  3HSD A;  1EKS A;  1O51 A;  2MQM A;  2M8D B;  2GMJ A;  4PQU A;  3JS9 A;  2QL9 B;  2VAS A;  2BV3 A;  4LRC A;  2V9W A;  4QIE A;  4E8U A;  2F9J A;  2FQQ B;  1FWP A;  3O3L A;  3TP2 A;  3TRG A;  1G1X A;  2IJR A;  2D3U A;  2JOQ A;  3HVT A;  2J9D E;  2P8I A;  4F4W A;  1KQG B;  3IR5 B;  1SL0 A;  3OLA A;  1LWE B;  1W26 A;  1VOM A;  4WFX A;  4Y3C A;  3W66 A;  2HQG A;  4EUV A;  3V6J A;  1Q4R A;  3F56 A;  2R7V A;  5CZX A;  2GML A;  1OQ6 A;  5M2R A;  3V4I A;  1M5H A;  1JKH B;  2CDQ A;  3ITH A;  2UUB F;  3IBF B;  2UUT A;  2VL1 A;  4RPF A;  3DDK A;  5A8K B;  2VKZ G;  1J5O A;  1T7P A;  5IC6 B;  1XR5 A;  2UVU A;  1UWB B;  2HLT A;  4PAB A;  9RUB A;  3TAN A;  1C1C B;  3FRY A;  2BE2 B;  1RU2 A;  2OD4 A;  2CPZ A;  1M5S A;  3KDO A;  3GPA A;  5IS2 A;  4X66 F;  3MOJ B;  4RNH A;  4ED7 A;  2F63 A;  2BZ2 A;  2VG5 B;  3DMJ A;  3FUY A;  2DR8 A;  4O0N A;  4X4T A;  4M5I A;  2GAG C;  3X1L B;  4I68 A;  3EZU A;  1MWZ A;  3ENA A;  1IQT A;  1SC4 B;  4DR3 F;  3MCO A;  2UXD F;  3DI6 A;  2Y1J A;  3OL6 A;  2R8J A;  4AL5 A;  2WB1 D;  4WFA Q;  2LEC A;  2E9T A;  3QSI A;  3D7S B;  4JI7 J;  1SJR A;  1A0O B;  1RP5 A;  3H59 A;  1TKT A;  4QWC A;  1UJ4 A;  4CTA A;  5CZV A;  1HW8 A;  1VQK S;  2HK3 A;  3H5Y A;  4PUO A;  3EDR B;  4LFB F;  3SQG A;  4XIU A;  2HQD A;  1WC4 A;  5ETL A;  5L1I A;  2E44 A;  1VLO A;  4RUH A;  3JSB A;  4C97 A;  1TKZ B;  5FII A;  4KKO A;  2WVB A;  1VCT A;  2CQC A;  4EBC A;  1JJH A;  3ZTO A;  3UVJ B;  1MU2 A;  1U45 A;  5LM7 E;  1X5P A;  3HM9 A;  5A0Y B;  5KAK A;  1RT7 A;  4Z7Y A;  3FMW A;  2LXU A;  5B7W A;  3DGP B;  3FGV A;  4BS2 A;  4AXJ A;  1NME B;  2K3K A;  3MAH A;  4TLR A;  1CC8 A;  1XTZ A;  4LVN P;  3U7J A;  4X4O A;  1XMQ J;  1JNZ B;  3HHK A;  1B64 A;  1Z2Z A;  2ZH1 A;  4QU7 A;  1YX2 A;  3DDN A;  2FHJ A;  4KKO B;  1VRU B;  1WF2 A;  1H0H B;  3KJF B;  4IDK A;  4UOG A;  1HBU B;  3J7A 1;  3UO0 A;  3HX9 A;  5K5M A;  1FJC A;  1JLQ A;  5B0E A;  3G96 A;  2I1R A;  3W5Z A;  2E1R A;  3HVW A;  3KXD A;  4ALZ A;  3SBM A;  4DPO A;  2AJF E;  3J81 j;  2W2M P;  4W98 A;  4DN9 A;  3AQP A;  4LBI A;  5HO4 A;  2MQO A;  3KK3 A;  4DLE A;  1VYA A;  2GAH C;  1GMV A;  1JMT A;  1XR6 A;  3LPY A;  5L39 A;  1O5J A;  2DGT A;  1L3S A;  3E01 A;  2YVS A;  3POT A;  4PG4 A;  2RJZ A;  3T41 A;  3VVT A;  3PKY A;  4LF8 J;  5KFI A;  2XSJ A;  4WKY A;  2A18 A;  3EVO A;  4OIX A;  4YB6 A;  4MKA A;  4DL4 A;  2RUS A;  1TKX B;  2AX1 A;  3DU6 A;  2QA4 G;  1C0U A;  4F4Z A;  2C2E A;  3F44 A;  3P5B P;  4JI8 F;  2JDJ A;  4USW A;  3PYD A;  2H65 B;  3OJU A;  1R3N A;  3VGU A;  5KFC A;  1PAE X;  3MFH A;  2HFS A;  1T11 A;  3EE3 A;  3FCH A;  3M32 A;  2B4P A;  4X4N A;  3MMA B;  1W7W A;  4L3N A;  4KY3 A;  4WP3 A;  4DG1 A;  3NXZ A;  2YKN A;  1SIZ A;  4PEO A;  1JNR B;  3OVA A;  1SC1 B;  3LP1 A;  4N7T A;  4L3K A;  3W9H A;  1IXK A;  3IRX B;  3BPS P;  4F3M A;  3I0S B;  4X64 J;  3A8I A;  4I1T A;  2BEF A;  2SXL A;  4A47 A;  1JLG A;  2EWH A;  4F4K A;  4JI3 F;  3M8P A;  5D4N A;  1YBT A;  1RA6 A;  3PEH A;  1RTI A;  3PX4 A;  2AMC B;  2CQG A;  2JEJ A;  1JLF B;  1RI7 A;  3Q8V A;  2BKP A;  1IKW A;  2CAJ A;  3A3P B;  1HR0 F;  3NRB A;  3Q24 A;  5ADZ A;  4GC7 A;  1BWV A;  4OYW A;  1VMB A;  2V6A A;  1V3S A;  5J1P A;  1C4C A;  1CJV A;  2YQ3 A;  1QTM A;  3BPD A;  5F8H A;  4ED2 A;  3PEJ A;  1PSD A;  4QYZ K;  5A2Q U;  3BS9 A;  3CMQ A;  3T6B A;  2BW2 A;  2LFV A;  4NLT A;  2LQ9 A;  1TFY A;  1RE1 B;  3IBC B;  3ENV A;  2M5Y A;  2IRU A;  5DS7 A;  2CWK A;  3AJ1 A;  4NMX A;  1EET A;  2HLU A;  2PI5 A;  1RTD A;  5DGA A;  3MEC B;  4OZN A;  5D6G A;  3Q22 A;  3CDB A;  3EGW B;  1NHV A;  4USI A;  4C11 B;  3BO4 A;  2V4J A;  5CCM A;  4KBI A;  3NOG A;  4RR5 A;  5D0E A;  3D0I E;  2JVO A;  4CO2 A;  3H25 A;  2ZH4 A;  1KLN A;  4FBT A;  3QAE A;  2ZZT A;  1EJ7 L;  3D28 A;  2FHK A;  3BGL A;  1JXE A;  4WZM A;  3OPK A;  1RT7 B;  3IS9 A;  5I3P A;  1S1V A;  3TYT A;  5BYQ A;  2H48 B;  2JL9 A;  2O66 A;  1BQX A;  2GS8 A;  2X1G A;  2EFV A;  4ZCI A;  2GC8 A;  5DDP C;  3JYT B;  2BJ8 A;  2ACM A;  1S0N A;  4RW9 B;  2ZDO A;  1KQK A;  2YWH A;  2YNF B;  1M1G A;  1Y10 A;  2ZVI A;  1A7G E;  2EFO A;  2YNH B;  2L9N A;  3UE2 A;  3Q0A A;  1N0U A;  1RCO B;  4UQT A;  1IKV B;  2AJ4 A;  5FLX U;  4DR7 F;  2ZVS A;  2MTL A;  3KJQ B;  3QZ7 A;  3H90 A;  3BN4 A;  4HEA 9;  1TL3 A;  4ZVP B;  4OI1 A;  1TVR B;  4DV5 J;  2ASL A;  2CJA A;  3QAT A;  2GO9 A;  4JI5 J;  1IVZ A;  4CO4 A;  1NSQ A;  4A8S A;  1U1K A;  2JEI A;  2U1A A;  1NXI A;  1HHQ A;  3Q8Q B; 
#chains in the Genus database with same CATH homology
 2XO6 A;  2VJU A;  2XQC A;  2VJV A;  2FYX A;  2XMA A;  2VIC A;  2F4F A;  2EC2 A;  2VHG A;  2F5G A;  2VIH A;  2A6O A;  2XM3 A;  2A6M A;  4ER8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...