2XO6A

Deinococcus radiodurans isdra2 transposase y132f mutant complexed with left end recognition and cleavage site
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
PLEMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKFIESQHDKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSPOSASE
publication title DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein/dna
total genus 34
structure length 134
sequence length 134
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2xo6A00
2VIHA 2A6MA 2FYXA 2VICA 4ER8A 2EC2A 2A6OA 2XQCA 2XMAA 2XO6A 2VHGA 2F5GA 2VJUA 2VJVA 2F4FA 2XM3A
chains in the Genus database with same CATH superfamily
4X4NA 4L74A 1LWCA 4K4SA 1HWKA 3SIPB 5M2RA 1XNRF 4IOAQ 3SFUA 5IT9U 2BJ3A 2D1CA 2WOMB 4ZOSA 4U95A 5DZ6A 1H74A 1KVJA 2HFVA 4IDKB 3AJ1A 4FYXB 2E5HA 3NNAA 3T1YF 2RDIA 3DFEA 4NEZA 3RBDA 1RT5A 4N8NA 4V19J 1RLCL 5IT0A 1U47A 2KG0A 1CSJA 5A2QU 3A8EA 1M5KC 3ZC4A 2QA1A 4QR0A 2KM8C 4P7VA 3WC2A 4ECQA 3PG9A 4OJ1A 2JEIA 1QY7A 2UUBJ 1FRIA 3HVRA 4KY3A 3QRPA 4ZITA 2CQ1A 3CDEA 4PABA 3MMCB 1TKDA 1OQ3A 3TEGA 4ZIWA 4GRSA 4OI2A 5DG7A 2ZOGA 1T9TA 4PCQA 3K89A 2AU0A 2MY8A 2RAQA 4QU6A 3QMQA 4DR1F 4IRKA 3CMES 1U1LA 1W2IA 2RJZA 2B9EA 1C1CB 1WKJA 1FA0A 2C3MA 1VBYA 1KVKA 4EI2A 1BY9A 1HNVA 2BQRA 1T7PA 1WKLA 4CLSA 1BUXA 3BR8A 1RWVB 5D8HB 5F8MA 4KGMA 2XNRA 3NGSA 2DNLA 6FDRA 3I87A 5B0EA 4CM2A 2MTLA 2QLJB 2GA7A 3KNGA 1QSLA 3P8BB 4LRAA 3EPGA 5HMYA 3QT5A 4Q0BB 5BYSA 2BOAA 4HEA9 4FXDA 2IPOB 3OR2B 3R5DA 3MM8B 1RLDA 3ZZZA 4GO7X 1WNEA 4LQ9A 4I67A 3BQ2A 1FJ7A 1Q95G 5D4LA 4PUOA 1TUGB 4I7FB 4UOGA 1HKAA 1HNIA 2Z2YB 4DQRA 2MQOA 1VRTA 4OL8A 2VJVA 1TK0A 3MM5A 3VGSA 1U24A 1NPPA 3J81U 3I96A 3ENVA 5D4NA 2W7OA 1VJQA 1Q86T 4CLWA 2CVEA 1KONA 2DBBA 1K8AT 3HFZB 2AW0A 3JSYA 2R2SA 1QTMA 2GJ2A 3QZ8A 4ELTA 5M2UA 3EVOA 4BWMA 2JHEA 3JS9A 3JAMU 2CDRB 5K20B 2P9GA 4LVNP 2BKOA 4WK3A 2XZWA 2MKHA 1G2EA 3VAGA 5KFRA 5IT4A 5B09A 2OP5A 1U2FA 4DV6J 2W2OP 4LMZA 3VGTA 1UJ4A 4N41A 3HKZD 5AE1A 3NGKA 5A2QY 4NA3A 5T14A 2DHAA 5ETMA 4FYWB 3HT3A 2RRAA 1BWEA 1K1SA 3T1HF 2E9TA 4OQJA 1UW4A 2UUAJ 2JJ4D 2QIFA 2VJUA 2BKPA 3VZIA 3PIPQ 4LJMA 1RISA 1YJTA 4WYLA 1XC9A 1WHWA 4DR4J 2ZUAA 4QWBA 5L39A 1FK9B 1V3RA 4TU9A 1R8AA 3QT8A 4DFKA 4ELUA 4M5KA 3HK2A 4JI3F 2PO4A 5DDRC 4KHMA 1KHWA 1OJ4A 1N0VC 2YQ0A 3AHPA 3K8WA 4ZPTR 2E1RA 5D0HA 3T9ZA 1UVKA 3E51A 1SKRA 3OQ2A 2UU9J 4LF2A 2BOPA 1D9AA 3L3CA 1EJ7L 4ER8A 4M5DB 5ETLA 4CP5A 4L76A 1JLQB 1YQHA 1OIAA 4DR7J 3MM7B 3BGUA 2DXFA 2DIUA 2LEPA 4C8ZA 3LWLA 1MSWD 3D6MB 5J1EB 4DL3A 4J90A 2DXEA 3N6MA 3CPWR 1IM6A 1IM4A 1AW0A 4N5SA 1AZSB 2FUG9 3CC4S 2EKNA 3LP1A 2KG1A 3DHXA 3G82A 4ZLLA 3J81Y 2BW7A 2B3TB 1LW0B 4K0KJ 2E1CA 2F4VJ 2WSCC 1U09A 2HRUA 2HQIA 4M95A 4K4XA 4WPAA 2W8LA 4KSEB 2MLZA 4A8KA 2RU9A 3JAMY 1RHUB 3W65A 1RHJB 1S1VB 4Q2LA 4UZCA 4PQAA 1EP4B 4PXDA 1PCAA 1ROFA 3D67A 2BV3A 4QOTA 3IS9A 3MXHP 4RW6A 3DLBA 4H4OA 5CYMB 2MJNA 2E66A 3HPOA 3CJKA 1NSPA 2QFJA 3RTVA 4NLQA 1NHKL 2Z0GA 1F3FA 1B7FA 4OYAA 2R2TA 1M5PC 1QSSA 2HGMA 3U1MA 3VAJA 1T9UA 4ZVQB 3AOCA 1PC5A 3ILJA 4ED8A 4KB7A 2YKAA 2ILYA 1WI6A 4DPWA 3GFXA 3HCXA 4AQYF 1E6VA 2WONA 1GTEA 1VC0A 1VI7A 2YWEA 2VG6B 2EEYA 2XYGB 2GQQA 5B7WA 4M8LA 3MR5A 1HYSA 4OYBA 1FKOB 3BPDA 2UVVA 1FI4A 1ACMB 1MU2B 2W7PA 2JLEA 5LXRA 2E1AA 3ISZA 3MI7X 3DOMB 4QQBA 2MZRA 4RUBA 1M90T 3GSDA 4DPYA 5K5MA 2V94A 4IH7A 4F4AA 3UQSA 1YX2A 4B9UA 2VF3A 3BYPA 1NKBA 5CCMA 3ILOA 5M2PA 2D3ZA 2HHTA 2DRAA 1QAJA 5L46A 2GC8A 3NWGA 3FC9A 4OLPA 5DRKA 5D4OA 8AT1B 1T05B 2ZKUA 2HQCA 1GXLA 1FFWB 1XMOF 3KTQA 5J2PB 1HBMA 1OYEA 1O5JA 3NBPA 2ZBIA 3TR5A 3PJXA 1RXOB 1JLCA 5EWGA 4AL6A 2G2ZA 2ZBCA 3K0JA 1PKUA 2H54B 3PIOQ 3VVTA 2V4QA 1Q78A 5F9NA 4NLWA 3KMSA 3SSRA 1F3VA 2J7KA 4NLSA 3DI6B 1RBAA 3C14A 3OR1A 4ZP8A 2I9SA 4WFAQ 3GR1A 2UUBF 1S7HA 4YOEA 4EBEA 2MKKA 4KE5A 3KLIA 5A8WA 1IKWA 2AT1B 2CJAA 3DMJB 3QZ7A 3FEYB 3M8SA 3G8TA 2IJNA 4QIVA 1G1XA 4M5IA 3HHLB 3KDNA 3UWTA 1SJ3P 3Q23A 1NLKL 2V4RA 4WK1A 2CQ2A 1S1WA 2F8HA 3JYTA 3VCDA 4DZ6A 3N79A 2WRMA 2KHCA 2I0XA 3NAHA 3U02A 5KFNA 1VJWA 2VPXB 3V81A 4FF1A 1FDDA 4KBIA 4EWTA 3H20A 3MPVA 4DSIA 1OSDA 2XGQA 4M63A 4NPOA 3IBCB 3R1LA 4PEOA 1HMVA 3NMRA 1OPIA 2PMHA 4ED6A 4ES1A 1S49A 3HMJG 1VLOA 1OPZA 4HVZA 4FPIA 3EDQB 3QIDA 4USJC 2J8SA 1JLAB 4FVCA 2GO8A 3T41A 2R7OA 3PO5A 4QCLA 4ECWA 1X0FA 2CPDA 1XMBA 4HI2A 1Z2ZA 1S4FA 2DNMA 3HHKA 5F8JA 5FD1A 2IRYA 4OHWA 3R5AA 5BJRA 3ET6A 2UUTA 1ZPVA 2F8EX 1T03B 1RWOB 1TR0A 2LU2A 3M8RA 2QC3A 3C8YA 1IQZA 2E9RX 1IKYA 4KV8B 5GADU 3EGNA 3MCNA 2W4DA 4RBUA 2FJVA 2GVZB 3W8PA 3PVXA 2Q66A 4P73A 3CD6S 2L48A 5IXUA 4BHQA 2FIUA 3PRVA 2JVOA 3BF4A 3AODA 2LA6A 2PA3A 1FNMA 4OYIA 5F0WA 1ZM4A 2XSJA 2XGPA 1UMJA 3T1AA 2N4DA 2GVDA 4KPYA 5KT7A 4MT1A 5LJ3Y 2AEFA 1J5EF 2OGUA 2B43A 2ERRA 4XDDA 4WFZA 4WZMA 3M7VA 4P9SA 4RWXA 2UUAF 4CT8A 4QW9A 2ROGA 3ZTRA 1TFWA 2YKMB 1B0TA 2ZBRA 1RACB 1NO8A 2ALZA 3R6GB 4DQQA 2WW8A 4DDFA 2CFXA 3ELHA 3GZ7A 2IA6A 2C2ZB 3BGRB 1XTZA 1PYSB 1S6OA 4KGVB 2DXDA 3F41A 5GAHU 3OW2R 2BMBA 2PMZD 2OSRA 3QFHA 5FLXU 4DBQA 1PBAA 3FBCA 5AJ3J 2OMLA 3MEGA 1Y5LB 4ZVTB 4K5SA 2GJFA 1JXEA 4RNMA 1QJHA 1YLXA 1LWXA 2E5GA 2F7VA 4Q5VA 3QWUA 2FHJA 3A1YG 4ZVHA 2QSFA 2ALYB 4IG0A 3MEDA 4Y65A 2ASYA 5CXTA 1LFWA 1YJWS 2AJQA 3W5XA 2OFHX 1GX5A 1BXNA 2B5JA 4PPDA 4JI5F 5DG9A 2A0FB 1S0NA 2LU1A 4DR7F 2BJ1A 2E7WA 5T7LA 1HBUB 2VHGA 2KRRA 3DOKB 5HLFB 3MURP 4DPOA 4DQPA 4QPXA 2R7QA 2RSQA 1HFEL 3A4TA 2B9XA 1UZDA 5A0YA 2H48B 3G87A 2DHHA 2EK1A 2UVUA 3FQLA 3I5BA 2VUGA 3I4HX 4K0KF 4PQUB 4DL7A 2F4VF 2D3OR 3EDRB 3GJTB 2IC3B 1YJ9S 3KLHB 1J2VA 4DX7A 3M2RA 5E2QA 3DLKA 1MW7A 4IG3A 2ZITA 4NYZA 1CJVB 4PWDA 4OZ2A 3MPYA 1SQEA 2E5LF 3GONA 4F3OA 4ECRA 3ITHA 1RP5A 1UVIA 2N7CA 3D6FB 1P1TA 2HEKA 3BB5A 4LVOP 1HARA 4KQZA 2R8HA 2HVDA 3P4UB 1K0VA 2VDHA 2AP6A 2HURA 3HVTB 1UJ6A 4J5OA 4USVA 4B9TA 4JI4J 2UXCJ 1X5SA 5KFYA 1VRQC 4HT5A 4KRWA 2AQ4A 1QAYA 5ETQA 3J7YU 2BA9A 2M70A 4NI2B 2RB7A 3P5BP 4P52A 1VQOS 3UD5A 2OEMA 2XBPA 2IA0A 1WG5A 3Q8SB 1KLNA 2R2RA 2ZNZA 3BKUA 3IFEA 1U7LA 3QJJA 2ZZMA 1N33F 3OL6A 3BM7A 5FLXY 2HG4A 4RO0A 2A6OA 4EFAC 1U45A 2HHXA 4B9SA 3CF5Q 3MM9B 5KFDA 3UO0A 2ZBPA 1KFDA 4AUKA 2DR5A 3FSIA 1M1KT 2QSWA 4K8RA 1RAHB 2MLYA 3PW7A 2NZCA 2V8PA 1NB7A 2MSTA 1I5OB 2HK2A 1K73T 3GIIA 4P74A 1RTJA 2PFDA 2V8VA 1PBUA 1NCLA 1IR2A 1J5OA 3V6DA 3TAMA 3MUMP 3CCRS 5THWA 1YBAA 2XQCA 1IQTA 1SUQB 4IUFA 4DF4A 2DH9A 3QAEA 1ZAVA 3C2PA 1HNZF 1CULA 1CQMA 3EGWB 2M3DA 1GK8A 2W01A 1S6QA 2YNIA 1QSYA 4PWUA 2M8DB 2ABYA 2FJEB 1WC4A 2QMWA 5KG4A 1XR6A 1R0BG 1JK9B 5ETOA 1V5IB 3FCWA 5D0GA 1WG1A 3C19A 1UTAA 4USWA 2XZDB 4ZCKA 3CEDA 4DPUA 4USIA 2H5JB 1DTQB 3K5PA 2PMWA 3OXGA 1G4CA 2LEAA 3ETOA 2C2KB 2AGOA 3PYDA 2FC8A 4ECXA 3D5MA 2OPPA 3MF5A 5KOWA 3NS6A 1RT6A 3QGIA 3I0SA 3BN4A 2F65A 1RADB 1H0HB 1H7XA 3I0RB 3Q8PB 1IBMF 2LEBA 1QE1B 4A8XA 5D3GA 3WHIA 1UETA 3MPDA 4QIFA 2YBVA 2BVZA 3AD7C 4QYZK 1SJ4P 3Q83A 3UW1A 3VQTA 4TNOA 4U7CA 2CKWA 1N52B 2N7YA 2D69A 2D3O1 2YNFB 1VRUA 4JV5J 2X1BA 1DLOA 1IJEB 2I8EA 2YQ3A 4RPFA 1H38A 3BSOA 2KXHA 2JEJA 3ZTQA 4N77A 3AOBA 1RT2B 1JJCB 1Q1KA 4CO0A 2FLNA 4DV1J 3DYAA 4LSLB 2MQNA 2C3OA 2VIHA 4WE1B 4OZ1A 2HNDA 2Z8QA 3PR5B 5KG2A 1RAGB 2CRLA 5CA5A 2J0QD 4C8YA 1UL3A 2KT2A 1S6UA 3A3PB 3KJQB 4ELVA 1JNZB 5B0BA 3OD2A 5J2MB 4XPCA 2AJFE 2QE5A 3QAUA 3SBMA 3TZXA 1YJNS 5E7OB 4Q45A 3HDSA 1EQ0A 4NMLA 3SSQA 4F0MA 1YRTA 2V69A 2HHWA 5DDPC 1SH0A 3DRYA 4F02A 1RWUA 3BN7A 3H25A 3UI3A 1P6TA 2L9WA 3HP6A 1HWLA 4NLXA 2RVJA 3KLVA 2HFUA 2OPRA 4FDFA 3PW0A 3IWLA 1Q16B 5I3PA 1KDNA 3CCUS 1YTYA 3KHHA 2JWNA 1RT1A 3C15A 3O44A 1AUSL 2Y9HA 2RQ4A 4AFFA 2GGPB 5T41A 2J6UA 2O67A 1MWQA 4IH5A 1Q79A 4WFYA 2M52A 4LQ3A 1R31A 3FSYA 3KK3A 3EGVA 2EFNA 3BEGB 2V63A 3E3XA 2ZNYA 2C28A 3RJMB 1ZAWA 2AV5A 3IC1A 4ZVGA 1NH8A 2HLUA 1KFSA 5FJ4A 2M7SA 2QA2A 3DHWC 5EX0A 1ZZFA 3KHRA 2I5JB 5KFIA 1C1BB 1T3OA 2YKNA 2GZOA 3KYLA 5DQIA 4HYKA 3G4SS 4Y34A 2J5AA 1C0UB 3TA1A 2BXJA 2YXLA 4ZPAA 3UE2A 1ICEB 5AJ3F 3W64A 4EBCA 3M1VA 3PO4A 3BSNA 1D1UA 1TKZA 1UFKA 2YWWA 2ZKTA 3R2CJ 3PTWA 1KKHA 3CW2C 2XMKA 4DLEA 4NZ6A 2J9EA 2VZ9A 1XEZA 2LCWA 3EMTA 3MFIA 3C6UA 2HQFA 1CJKA 3MECA 2B51A 2XMAA 1L3UA 1MWYA 5LOQA 2W7AA 1M1HA 2FHOB 1RKJA 4UY8T 4AD6A 2KT5A 2HKEA 5KT6A 1S0VA 1RT3A 4GC6A 1G7CB 3CIMA 3SCIE 3TARA 2NYHA 1H6KX 2KN4A 2DNKA 2P9EA 4B3OB 3R7NB 1URRA 2CJYB 4OX8A 4B08A 2JLGA 4OX7A 2RUGA 4CZCA 2W9AA 1T11A 1LWEB 3MFHA 5HP1B 4TY8A 2V2QA 2CNOB 3RW7A 6AT1B 4YP3A 4USHA 1FJGJ 1DHMA 1RABB 2YNHA 4LFBJ 2VFRA 5LT5A 1U1OA 3O1LA 4LF8J 2B56A 1VYAA 2ATCB 3VZHA 1FEEA 1NK0A 3F44A 1FKAF 2W9CB 2AX1A 1RU1A 3MPWA 4RUCA 2V5HG 3POTB 4NXMJ 4IR9A 4J9UE 1TVRB 2IMWP 3RRHA 4G6VB 4WU3A 3I4PA 3OUYB 1MMLA 3FFIA 4F0HA 3QO9A 1VGYA 3MMAB 3AJDA 4RBTA 1X4DA 4JI4F 3DRPA 2MXYA 4MKBA 5GMKa 2UXCF 2XM3A 2HAFA 3CJ0A 3PYEA 3K5LA 5KT2A 4LRBA 4N8OA 1O8BA 1UA0A 3M32B 1TKTA 4QYZJ 3N01A 4IOBA 1LV5A 4PPZA 1FXLA 1JKHA 2H3EB 4QW8A 1WTBA 1SC4B 2AHOB 4ZK7M 3CCVS 3WDOA 4H4MA 2QGFB 4DCPB 4H54A 1R6VA 4NYPA 4ZCLA 2OIHA 2A6MA 5K8PA 2ZJPQ 4DSKA 1NHUA 3E01A 1YGYA 2EFQA 4UT4A 1Y3JA 3RB3A 4W90B 2DGVA 2OD6A 4TYAA 4CO3A 1NAQA 3GJRB 3ONQA 4DL6A 4F4KA 1OYDA 8RUCA 3CT9A 3T19A 3KLEA 4X4PA 4FBUA 3SCLE 2DEJA 1TV6B 2GMLA 1DTTB 1R0AA 1Z4UA 4RLEA 1A6LA 2B9YA 3HJVA 2PC6A 2KT3A 2YPYA 5KFQA 4PG6A 1YK9A 2OFGX 3HX9A 4UTGA 1SL2A 2H5EA 3EICA 1UEKA 2D9OA 2ZOFA 3P49B 1GTHA 5B08A 4I56A 4C9DA 2VL1A 3OJSA 3M2UA 3D2WA 2MB0B 4WZQA 4V19X 1LWFA 2LQ8A 4UF4A 2IVFB 3TVZA 1NDPA 4ANCA 1DAXA 4LF4J 3QWPA 3JSMA 3J7AN 4OHYA 3G71S 2E5JA 4F4XA 2SXLA 1KQFB 3HO1A 2V8GA 2HNYA 5J2NB 1NSQA 4F26A 1LQ9A 1ZM2A 2D3UA 2L41A 1N5YA 3M9OB 1TUVA 4ED4A 4X84A 1RDRA 3H5UA 2R7TA 2DR7A 2YH0A 1W2BR 4C8MA 3O3LA 2FY8A 1FESA 3IRWP 1JLBB 4X4QA 3R6LB 4FVMA 3PFOA 2DPJA 1KQGB 2EG2A 3R7SB 2MKSA 1LK5A 5C24A 4FYDA 5C5JA 1CEZA 4B3MJ 4CI0B 2G0CA 2FLLA 2RDDA 2R4FA 4C8KA 1MG7A 4M5NA 1GQEA 3KMQA 1D9FA 1KEKA 3M4XA 3C16A 3EM1A 1AXQA 3NCPA 1U1QA 1RTIB 5C7PA 2GAHC 4TKTA 4N76A 2E5IA 4PXEA 1D8YA 3KUEA 2L3MA 1S1XA 1AROP 2P6TA 1AB8A 4QBUA 1RTHA 5L38A 2WVDA 4DV1F 3JSBA 4EMDA 2HAIA 5C42A 2CJKA 4O0NA 4I4BA 5GAEI 2Y1IA 5B0CA 4UOHA 1N32J 1Q7LB 5E3CA 2EC0A 3MAAA 4KO0B 1V3ZA 4A46A 1AFIA 3VF0B 3K2YA 4CCHA 3BS9A 4OZJA 4KGZB 3MZIA 3IR5B 5ITHA 2VFTA 2B0GA 3MMJA 4LF1A 2VG5A 4CTAB 2X3GA 4RW4A 3C14B 1RWNB 4LUBA 2FB0A 3PFEA 4HDHA 2CQBA 2K1RA 5DQHA 3KK1B 1HNXJ 4UOFA 3ZZOA 3R1HA 2IVYA 4DS4A 2V4JB 2KJWA 1RUSA 4C11B 4A8YA 3US5A 1UA1A 4C4WA 1CJUB 2C2MB 4OHXA 3J7ZT 2NPIA 1OO0B 2VG7B 1EZZB 3N6NA 4M1KA 1D3WA 3GV5B 1HBNB 2ZD1A 3EZOA 5D78A 3V81B 3PACA 3IXQA 1ZTWA 5K9FA 3FZBA 1Y0HA 2C1EB 1KLMB 3H2UB 5I3UB 3FJ2A 2BANA 3GFYA 1HHTP 4GKJF 2GAGC 1TUWA 1HPZB 5KFBA 4IFYB 1NK4A 9ATCB 2BE2B 1B0PA 4V1Ak 2QMXA 3ADAC 3WIUA 4IFVB 3IR7B 5DJBA 3KLFA 4GVLA 5ETVA 3IMQJ 1B70B 2CADA 2DISA 2DCUB 2ZJRQ 1E6YA 3ZZRA 5JVGQ 2E7XA 1VQ7S 3MR7A 5FDLA 3DRRB 1KQKA 4USTA 3AFGA 1XNRJ 4WBFA 2XWYA 1Q8LA 4ZJLA 5SUHA 3MOJB 5HBMB 3RR7A 3PDNA 3EUNA 1X9SA 1N6QB 2EBGA 1JJ2R 3T1YJ 1FVQA 1N4LA 5KFJA 3SZ2A 3NNCA 4MTPA 4QPTA 3OFGA 5D77A 4F36A 4HKQA 2HZAA 1VBKA 3NLCA 3MMBB 3V4IA 3NS5A 3PJ9A 1O51A 2KZZA 5G0RB 3TA2A 3U1LA 3B8HA 2B8QA 2MY7A 1KSPA 1T94A 2CPFA 5DS7A 2G13A 3Q8VA 3GQCA 4JI7J 4WTOB 2CPJA 3ZNUA 1N88A 5ETKA 4KKOB 4HACB 3CDUA 1L5UA 1NPRA 3GCXP 3QGPA 5KG3A 3GG1A 1PO6A 1SXLA 1EARA 3W2VB 2WK4A 4EU0A 2XYPB 1XWLA 1LXJA 1B4SA 1RBLA 2YQ1A 3SFGA 4TN2A 4LF8F 5DQGA 1D09B 3OSPA 4YUDA 4RW9B 1T9WA 5IC6B 4I69A 2ZZTA 4ERDA 4ZHRB 2GMJA 4MKAA 1H2VZ 4ED7A 2B6AB 4RW7B 2ZVSA 4Z7YA 4OZ3A 2DKOB 1YITS 2XYHB 3BBFA 1RWXB 3NP5A 4DPXA 4HI1A 2U1AA 1O0PA 5DM6Q 2FZCB 2V8HA 2FLOA 5HSPA 3GIKA 4K59A 3TZZA 4Y2CA 2LQJA 1F60B 4ZPBA 2IYIA 2XLKA 4USUA 2ZVIA 1VFJA 3M6XA 1MROA 2DK2A 4ZJQA 3UR0A 3RB4A 1F1BB 2OSQA 4ZA1A 1ZA1B 2VICA 3ISNC 3D54A 1T02A 1JJHA 1VQMS 4ILMA 4DHVA 3RAQA 1SL1A 5LSRA 3H4BA 2EBEA 2XLJA 4KGKA 4G1PA 2FVPA 2CJ9A 3H5SA 2K7JA 4R0JA 2XCAA 1NK6A 2IM2A 2ZZNA 2Q79A 3R27A 1RTZA 1Q0NA 5FIIA 4R8UB 1FKPA 1ITPA 2CA9A 2V34A 4YS2A 4Q8EA 1QVGR 1B3TA 3MHYA 1JLEA 1NZAA 4FNHA 3TUPA 3TVKA 1Q7YT 5JUMA 4LBHA 3RAXA 3QRRA 4DMZA 3W2WB 1S76D 3CB4A 1HHQA 1PIEA 4U8VA 2X3DA 1WG4A 1MN9A 1R3NA 5A8KA 5KFGA 3DRSB 4DQIA 5MLCV 3M2VA 4LSNA 4U96A 1CPZA 3M30A 2B4OA 2ZOMA 5C2CA 2OH2A 1REVA 1FX4A 4LF6J 4EBDA 3ZZYA 2HMIA 4LF4F 2YNGA 3KK2A 2ZE2A 2PFFB 1KHVA 2XULA 2MLXA 4JI6J 3UNGC 5K14A 1NK7A 3IG1A 4GO5X 3LP0A 4IO9Q 5E3QA 3PRBA 4L73A 3M6VA 1UVNA 4WU2A 3R5GA 2M2BA 4J9KA 2V0NA 2GCFA 2JEFA 4Q8FA 2VDIA 2WOMA 3S7RA 4TY9A 3DCAA 1QD1A 4IDKA 3BSAA 3BGFA 4J9NA 3SV3A 1H72C 4I6WA 1JX4A 3DU5A 3I5CA 2UXBJ 2O01C 3JSRA 3G6ES 2R8KA 4B3MF 2N82B 4YR2A 2DJWA 1OY6A 4B3SJ 1K0TA 2KI2A 5HVGA 4IQMA 3SYZA 4EEYA 4ED3A 2VB6A 4ENOA 1LOUA 3R7BB 2H5IB 5A8RB 3MMCA 1NJIT 4J9RA 7AT1B 1QDUB 5LM7E 2HVEA 2DHGA 1U8WA 2BM0A 3THTA 2L9NA 2B7BB 2MQ8A 2W9BB 1X9WA 3TANA 2DTJA 4C8OA 4NLTA 2CUYA 3ZXWA 1N32F 3TA0A 4QWDA 1C1CA 1VR6A 1HQ2A 4FXWA 2OPQB 3IWXA 3O2IA 1TKXB 1VOMA 3FRZA 2MEWA 1XNQJ 4ECTA 5L1LA 1JLFB 1LKZA 2IBOA 1G3OA 4M94A 1TFYA 2UUWA 4X65F 1D9DA 4Q0BA 2NR0A 4CLUA 4ZPCA 3KUGA 3OXFA 3OR2A 3NMAA 2HZCA 3MM8A 4DV3F 2MQQA 2JC1A 3G2XA 1UWBB 1VK3A 2HBQB 1EKSA 2LDIA 2Z57B 4I7FA 3Q24A 1NHVA 2VU5A 4DL4A 1RT4B 1ZM9A 4WJBA 2NPFA 3S1TA 1RAAB 4ID5B 4XO0A 4C2MA 3BREA 2Z56B 3NS7B 1YWXA 3IBFB 3D7SB 3V5RA 2VFSA 4R5PB 4DV0J 5JMNA 1YSJA 1SBRA 4X4VA 2XS7A 2P2CB 2ZC3A 4URGA 4PG7A 4NA1A 4J9OA 3G6YA 1PYTA 4JOUA 1T9XA 3B4MA 1WC5A 3QSYB 7FD1A 1KD1T 3AT1B 1BQXA 3OBIA 3PX6A 1QM9A 5IM0B 3KHGA 3TQ1A 4J9MA 4BC7A 1RTDB 4LRDA 3QBCA 3TEHB 1KP6A 2G0IA 2B7CB 4YB7A 2G1DA 1I1GA 3D3CJ 3TQEA 4H4KA 2IAJB 2RF2B 1XMOJ 3IA0A 4I6YA 2DR9A 2ROPA 2ASLA 2XZTB 4L3KA 4B02A 2BZ2A 3U27A 2HFSA 1FK9A 4DN0A 4WFBQ 5HQLA 1HLWA 4XAKA 2OO4A 3AB2B 2VKZG 1CG2A 2F63A 4C48A 4AT1B 3MUTP 1U0HA 5KT3A 4X4TA 3S8SA 1IKVB 2HFZA 3GILA 2RU3A 2OPSB 4MFBB 1TL1B 1S48A 3KHLA 5JVHQ 4JI7F 3M8QB 1S0OA 2CPIA 4A8OA 4DZDA 1SV5B 3OVSA 3KG1A 1FE4A 3A12A 4WXWA 2BRLA 1PYOB 4ZP9A 4M5DA 1JLGB 3KKFA 2Z58B 1JLQA 1FVSA 3MM7A 5E41A 1YJUA 3J81j 5EGYA 2LA4A 5J1EA 3RUBL 2GQCA 3OTBA 5I3QA 3MEEB 4RR5A 1AZSA 4QZVB 3M9NB 3RG6A 5EUHA 2Q6CA 1M5SA 1EETB 3GFHA 4FF4A 4YDDB 1LW0A 3UN2A 2MZSA 2FPHX 2KDOA 1EB0A 1K9MT 4GC7A 2FQQB 3GIRA 3PX4A 1S1VA 2FZKB 2Y1RI 3OL8A 1SC1B 2IM3A 1OY8A 2R3VA 3JQKA 1EP4A 2P6SA 5E3RA 3P3DA 2PSZA 2DNYA 2EXUA 4HHUA 5CYMA 2V2VA 2NS1B 4DU7A 3FKBA 3JQMA 1LK7A 2EC2A 3H59A 3LF0A 4HDGA 3T5HA 3K58A 1BC6A 3MWBA 1ZM3A 3L7UA 2OKQA 2ASDA 4YHHF 1EX8A 3N28A 1MLAA 2FVCA 1VCTA 1BQNB 2GQ2A 5IT9Y 4RNOA 2R7UA 2OI2A 4F25A 2VD3A 4X4RA 5CZXA 3R5JB 3CCZA 4RKUC 1VQ6S 3FSXA 1OQ6A 1C2PA 3N5FA 2U2FA 3NXZA 5E33A 3TVYA 3BO2A 3KNAA 1NDCA 2KZMA 2MSSA 2XI2A 3HHDA 2VG6A 3GR0A 3S01A 1VQ8S 4UW2A 4WWSA 1J5EJ 1SKUB 2ZBQA 4NCBA 1WC3A 5HO4A 2LXIA 5ETNA 4K4VA 1VHFA 4LBPA 3UD3P 4C98A 1FKOA 2AGQA 2WW4A 1KBRA 2ZH5A 1MU2A 3UFCX 1B7YB 2HHSA 2VA2A 4OYZA 2VPWB 5J1NA 1X4FA 5KFCA 4LF6F 3DOMA 3BBBA 4XIUA 2MQMA 3ZZ0A 2W4PA 3UCUP 3DLEB 4R25A 3WZ0A 1S9EB 2IRXA 4ZVRB 1TL3B 4A8FA 1I94F 4ECSA 3DLHA 1SQFA 2W4CA 4JI6F 2C3UA 4KH1B 1HQUB 2GNKA 4A8MP 2JFDA 1T05A 4DEZA 2RQMA 1XJWB 5GAGU 2MGZB 5KFMA 3TUIC 4F7VA 5J2PA 3M8YA 1PC4A 3CO9A 3K59A 2YX7A 3Q89A 2PT0A 3ZZUA 1U1KA 4DV2J 1N56A 2UXBF 2CZVC 1Y9OA 4JI5J 4YB1P 5KFHA 3NGRA 4I2QB 4OYOA 2VKRA 2QTWA 3A13A 3LA0A 3ICLA 2EVZA 4NLPA 2P5VA 4B3SF 5HK4A 3PW2A 4O3SA 5H9EJ 4NLOA 1U49A 1VC5A 4DSFA 1RCOB 1TAQA 3FBBA 1S9GB 4IRDA 1NJZA 2KB2A 3DMJA 1O6XA 3WIVA 1WC0A 3D1QA 4RJVA 4RU2A 2JFKA 1TQLA 3SDEB 1ZBTA 3HHLA 1VIOA 2LMIA 4J9SA 3CCJS 3THVA 4LRFA 2YWHA 3RRKA 5F0UA 3DU6A 3P5TL 4NLGA 2E5LJ 4QR2A 4X4UA 4KC5A 1RE1B 1FXDA 4C3MA 1NB2A 1XNQF 3D3BJ 1CJTB 4LRCA 4A8SA 1GFWB 1QTNB 1CLFA 5GMDA 3HT0A 1KQSR 4G1QB 4O3OA 1X4GA 2CPEA 2R7XA 4NA2A 3S6EA 5IZHA 2KXFA 1FNXH 2XNQA 1IUJA 1NSAA 2UZAA 3ILIA 1GEHA 1JLAA 4UOCA 3J7A1 1K47A 4Y3CA 4F2SA 1LW2B 1MNEA 3LPYA 4K4ZA 1GAOA 2K7KA 1QLNA 2R8JA 1NDKA 5CZVA 5LSOA 1FFGB 3OPKA 3L7OA 4DSLA 4HL9A 2QX0A 2OAUA 1BQMB 4Y28C 2F5GA 1BGXT 1N33J 4P2FA 2AGPA 4ZVSB 1R8BA 2W2QP 3PW4A 1H2UX 1CC7A 2GFFA 1X4CA 4DV0F 2CQCA 1T03A 1GMWA 2DIVA 4WP8A 5HQMA 3DLJA 4QWAA 2K8GA 2ZH2A 4KV8A 1S1TB 3QT7A 1R8PA 2H4WB 4J37A 4O23A 3GV7B 2F1FA 2GVZA 2ZM6J 2WSEC 3BH6B 2NYIA 2PGCA 3SEOA 2XMJA 5IQQA 3DOLB 1C4CA 4K2JA 5LXYA 3VAKA 1SJQA 5CAAA 4DG1B 4XTTA 1P9YA 1XQIA 3W66A 3EYZA 1C4AA 1DY3A 3KUHA 3B6BA 1RAJA 1Y11A 3C6TB 1S1UB 4PG5A 3RB6A 4O3NA 2IYGA 4RNNA 2IRUA 4DSJA 4G65A 1F9HA 1FWLA 5BR8F 1RHKB 1PSDA 2VG5B 1WDTA 1R0CB 1YBUA 3CD7A 1HNZJ 2YKMA 3AB4B 1WDDA 1UP1A 4H4KC 3KLGB 5AXKA 1IKXB 2N4CA 4UY85 3UDEA 5DLFA 4DSEA 1UEVA 5CD4A 2IDEA 1DURA 2CQDA 3KG4A 1YG0A 3L9ZA 5KFXA 3BGRA 2DO0A 2RS2A 3SSSA 1S59A 5GADI 5A76A 4UUXA 5BXIA 2YWFA 1SQGA 5A6PA 2JRSA 2YKOA 4NLDA 2UVRA 1U4BA 4N47A 4CYUB 1HA1A 5KFWA 3OXLA 2O66A 3UR3C 3SCKE 1RKIA 3BKTA 1REGX 1ELOA 3DLGB 2PIIA 1HBOB 4ED1A 1IWGA 1NXIA 2ZH4A 1RAIB 1IBMJ 5HROB 3W5YA 3C3LA 3WX8A 3BH7B 1K1QA 4ZDNA 5HQ8A 3K5OA 3D68A 2X51A 2YPZA 4YR0A 1HBUA 3LP2B 2HGLA 1H7WA 3DOKA 3I9ZA 1FF2A 1CBKA 5HLFA 1IVZA 3OJUA 1S12A 3JTOA 2W2PP 5KFUA 4M5GA 1NSKL 1M5VC 4ZN1A 3X1LB 5C2GA 6FD1A 1SKWA 1GMVA 4DR5J 5RUBA 2LLZA 2W2MP 3HKWA 2ZUGA 5GAHI 3UVJB 4PQUA 4LF5F 2HGNA 2R9LA 4DUTA 1RT7B 1RWWB 4ZP7A 3PCOB 2EFVA 2R7VA 4JI8J 2HFNA 1WEXA 2IC3A 3KLHA 1ULRA 2Q1LA 4U9RA 5JJBA 3THPA 2PDAA 4ZKAA 1MWZA 4MAKA 4NL5A 1CJVA 4ZVUB 2ZDPA 3KWMA 4OJGA 1IXKA 2KM8B 3TOQA 1VK8A 2CQ4A 3CCES 3GYXB 3RBZA 3TAQA 2J6SA 3VTIA 2Q43A 3W9JA 4WXOA 2FGOA 1NUEA 1RB0A 1RI7A 5DLGA 4OI0A 2ZH8A 4FYVB 1UVMA 4NCGB 2AMCB 5E3PA 4ECZA 4DQSA 2HIQA 2KFZA 3HVTA 1JWWA 3LGHA 3BGLA 2AF6A 1UFLA 3HHLD 2J0WA 2UP1A 5KFOA 3IM9A 1NU4A 2K2PA 1F5AA 3F0NA 4NI2A 3PHTA 3IGVA 1WEZA 4RW8B 5CQGA 4D3GA 1VHIA 2DB1A 3GPAA 4E8UA 2CAJA 1YRXA 2BJ9A 3VR1A 4TU7A 3NNHA 3PX0A 1U1RA 5HMWA 3CC7S 4AL5A 5DDOC 2AZ3A 2DNZA 1LXNA 4OZNA 4O44B 4BC9A 5I42B 2COLA 4PWWA 4X66J 4KFBB 4MIWA 1DQAA 3BJYA 3OLAA 3M8ZA 4RX6A 2V68A 2BE9B 4A4JA 3MM9A 4I2PB 3TO8A 1PJ5A 2DPIA 5F8GA 3OHAA 1XERA 4DI6A 3IR6B 1W7WA 3VAHA 2RUSA 3AA8A 4F2RA 4Q44A 2DNQA 2ZH3A 4WIIA 3G96A 4J7CA 3L4BC 3G8QA 3DGVA 2RKIB 1KS2A 2DH7A 3NGUA 2KYZA 1U6ZA 4DOZA 3AQOA 3DM2B 3NG8A 4C6AA 4B9NA 2PEBA 4BWJA 5DGAA 4FBTA 2HWTA 2VBWA 2G9OA 2V8DA 4C97A 2A18A 1MMDA 4AE5A 4C8LA 4CH0S 1SUQA 3J7YI 1TAUA 4NLVA 3W63A 5LMUJ 2IBKA 2E44A 1GMWD 1KNZA 1EAYC 3I6PA 2AJ1A 4A8WA 2J9CA 4X64J 4BDPA 2GJIA 3FCHA 2FVQA 2ADBA 2B8PA 2OLWA 3BQ1A 3BDPA 4DV2F 5F8IA 1D0EA 2K06A 3FK4A 5AXMA 2RHSB 3LGNA 3AD8C 3ZTSA 3OV7A 4NLUA 4ZJOA 4DPTA 3VQSA 2BJ8A 4CLZA 1H2TZ 3MM6B 4ZVPB 2WAQD 1DTQA 2FLPA 5CABA 3NOCA 1MN7A 3HVWA 5MAOA 4EZ9A 2J7WA 1IJFB 3AJ2A 2YWGA 1ZPWX 2XS5A 3G8SA 4PG8A 3VGUA 3CJ8A 2DNNA 3I0RA 1QE1A 2QL9B 2E1MC 4OX9J 1SKSA 5E3AA 3GFZA 3ENWA 2YH1A 4IKAA 1S0MA 3HHLC 3RGIA 2XWXA 2M5YA 1N5SA 5B0GA 3LAKA 4B9VA 2YNFA 3LW5C 4CO4A 4U7UD 3BQ0A 3ZTPA 3B82A 1T9VA 4L75A 4LF7J 3AH6A 2APOA 3W62A 5EWEA 4JYAJ 3EGZA 1N0UA 3TAPA 1RT2A 1ZAXA 2ZC4A 4OV1A 5CYQB 2PI5A 4LSLA 4ZS6A 1WF2A 1NNDA 4WE1A 2C3PA 1U2CA 4TLQA 3M9MB 3EE3A 9RUBA 3J7Z5 1CS4B 2IY5B 4KYZA 2Q3PA 4F04B 5J2MA 1HW9A 2PN6A 2XHWA 4O4GB 4ICLB 1FWKA 1I51B 4Z2XA 4XDCA 3UDVA 3M8PB 2CPYA 5D0EA 1L3VA 2CQHA 2JOQA 5ADZA 3D66A 3ZNJ1 3T3FA 3H2LA 4YQWA 1FD2A 1WOOA 4OYMA 1HWIA 4RL1A 1IBLF 1DBDA 1NM2A 1IN0A 1WOSA 1R7IA 2ZM6F 1FRHA 4LR9A 4B9LA 2DD8S 1HD1A 1RYSA 1C0TB 1RU2A 2GGPA 2QFIA 2JLFA 1HR0F 1B99A 3W61A 2YTCA 3WC0A 3KOAA 2VQFJ 1OWXA 2I1RA 4DL2A 2MDAA 1A9NB 5HI7A 1N48A 3KJVB 2HVZA 5C25B 1M1GA 1P27B 5J2QB 4HTIA 1TL7B 1FRMA 2I5JA 3MD3A 2CQIA 1DZ5A 2RIJA 1C1BA 5B0FA 4CNYA 2NQPA 4EGLA 2IM0A 3TYTA 1C0UA 2NXCA 3OLBA 2WTFA 3PW5A 4ZP6A 2XMMA 2HNZB 4P72A 3CNQP 2DGOA 4DR3F 5B0AA 3CCLS 2FJXA 3A3OB 1FCAA 3DGPB 3HF5A 3I32A 1LNQA 2DGQA 4O3RA 3M05A 3IGNA 3FGVA 1AYEA 2R8GA 3E2EA 3SQOP 2CQGA 4TXSA 3PXGa 3MR3A 5KG5A 3IRXB 2BJDA 3LALA 4JB8B 4MH8A 3HI9A 2X1FA 1EIYB 1Y4ZB 4U7UK 3AOAA 2ZEJA 3CTRA 1S6PB 4C0HA 4B3OA 4K4WA 4GKKJ 1T3NA 2OJ3A 3QLHB 3VWSA 1HQEB 5HANA 3SQGB 3TJ9A 1X5PA 4DR5F 4N56A 5G4DA 3RZAA 5KFSA 4DL5A 1LWCB 5KG1A 4DFJA 1LWEA 2Y3YA 2J0SD 4DWIA 4TVAB 4C3LA 2FHJD 5HP1A 3CD5A 3I82A 4JI8F 2ZWPA 4DFPA 3BSCA 1S99A 1Z1ZA 4LIRA 2DVIA 1RT5B 2X1AA 2WVEA 4A48A 2KVIA 2L08A 5J1PA 2VQEF 1NJYA 2BE7D 2W9CA 1HWUA 4TLRA 1LEOA 3TUJC 1FRKA 1OY9A 2V67A 2AJ2A 3GYNA 1U0HB 3POTA 2OD4A 2GIQA 2QA4S 3N6LA 2Y8WA 4MKVA 1TVRA 1XR7A 3GB0A 2LQ5A 5KFLA 3OUYA 3QSIA 2ZFHA 3B4DA 1X8DA 5HVHA 3MMAA 1ZS6A 5HAOA 4RUHA 2RQCA 1FTRA 4NYOA 4G3IA 1F5CA 1DQ8A 4MIAA 3D1OA 4CRJA 4NZ7A 3QJLA 4OYXA 1KVIA 2R7WA 2BJEA 3M32A 1X60A 3CMQA 2DGSA 2D7SA 2NXUA 4J9QA 1HNVB 1FFSB 1NH7A 4X66F 2OTLS 3R8YA 3W7BA 2QT7A 5KFPA 3DXBA 2KVQE 2BDPA 2ZHBA 4GKJJ 2XMWA 5E0OA 4CLYA 5IWAJ 3OHBA 5GMEA 4G1IA 1WD6A 4DLGA 4CQ1A 2J7UA 4R0EA 5KAKA 1UEUA 2HVHA 2KRBA 4CT9A 4PUOB 2W8KA 2C2OB 2HHUA 1TV6A 1HNIB 1DTTA 4FZVA 4EYIB 4K4YA 1VRTB 2EKYA 1U6BA 2P8IA 3MM5B 3PEHA 4E98A 2J0XA 1SVDA 1HNWF 2RQKA 5DG8A 1YZ7A 4F67A 5LMUF 2BM1A 2RRNA 4U6PA 1BD6A 1WELA 4X64F 2ACYA 2LECA 3W60A 5D4PA 2EPIA 1N36F 3ZO7A 2EW9A 3K17A 2A2DA 5J2NA 3FEZA 5L1JA 1APSA 4Y2AA 4ECYA 1WSVA 2ATLA 5ETSA 3EX7B 1JB0C 2CZ4A 4C0BA 1FRLA 4UZBA 2AX0A 1WSRA 4ZMMA 5LMNF 2DNGA 1VIXA 3FNNA 2YKPA 2XB2D 3GIMA 3N5BA 4URSA 2O5DA 4CLPA 1FJCA 1JLBA 2Z30B 4F8RA 4ED2A 4CH1A 4CLLA 4PXBA 2JVRA 3H4DA 3H2VE 4ALZA 4OX9F 1I3OB 3NKYA 4IO1A 2W2NP 3LAMA 3I5AA 2VPZB 3HVAA 2MZQA 3HD1A 1FWPA 3BV8A 4RWWA 2OMOA 3QYYA 4LF9F 4KHPF 2BQUA 3L95X 2MZJA 1RTIA 5DDQC 4LF7F 2CQ0A 3R9LA 1FT8A 4KPCA 2XCPA 4JYAF 4NOHA 2HRYA 2YKQA 3D0HE 3OSNA 1YKWA 2D74B 5KT4A 1LFPA 3JQJA 4QYRA 5IV4A 4OZ0A 1B64A 3EVMA 2MHNA 3AXKA 3HM9A 4KO0A 5EDWA 2CWKA 1NKEA 1KTQA 4YMEA 1UJ5A 3H42A 3ZZPA 2NXJA 5KT5A 4N7TA 2WVCA 3CCTA 3UN5A 2MYFA 4CTAA 3GE9A 2MKIA 5HJXA 4CLTA 2IFXA 3KDOA 4W98A 3R2DJ 4Z7CA 2KYXA 4B3RJ 3LP1B 3OFEA 3KK1A 2VV5A 3AXMA 4P71A 3G82B 2RS8A 4EYHB 3HZGA 2F4FA 2AIRB 1CC8A 2V4JA 3N4WA 2CPXA 4LREA 1Q81T 3FBEA 1RAOA 2C3YA 4NZ0A 2HFOA 1HD0A 4C11A 1RCXB 4DCJB 1T95A 3I31A 1CJUA 4M5MA 5L8RC 3R97A 2VG7A 2PE8A 5B0DA 5A6WA 1HBNA 4CO1A 1URNA 2VQFF 3IS9B 4X4OA 2JSXA 2QL7B 4RW6B 4H4OB 4FF2A 4P10A 2LYVA 2ADCA 1KLMA 5I3UA 2HHVA 3CJKB 1YI2S 2DO4A 3J80U 1YZ6A 2J8AA 4YEAA 1AA1B 4WIQA 2QV6A 2G2OA 2XTJP 4TQSA 2Y0SD 1HPZA 3KXDA 4JP8A 4A47A 4IFYA 4ANDA 3QPIA 2BE2A 4I68A 2G2YA 4FPRA 2CQPA 5JXSA 2Q6BA 2WHOA 2N3OA 4IFVA 4O3PA 5DETA 3HD2A 2Z2MA 4WFNQ 4DUZJ 3P45B 1E6VB 1M0SA 2WONB 3T6JA 2JEGA 3CC2S 2E29A 1QAIA 2Z2LA 3DRRA 4ECUA 1X5TA 4UUWA 1HWJA 2AJ4A 1SC6A 1EQMA 2QG9B 5EWFA 2V2KA 4CDIA 3MR6A 1IBKJ 3CO0P 3BPSP 1Y00A 4FN5A 5IS2A 1T9YA 5HBMA 1WACA 2HBZB 1HYSB 1JJ4A 3H5XA 1N6QA 1M5HA 3CGIA 4ED0A 3CIZA 1HHSA 3NY0A 4QR1A 4IOCQ 3NL0A 1U1NA 2HK3A 4WKRA 2IJFA 3NGDA 1TMMA 2MKCA 2YY3A 4DXLA 1Y5NB 3MMBA 2VBYA 5KG6A 5H1SV 5G0RA 2CDQA 4DV6F 1SJRA 3LQVA 4GKKF 2O3DA 3X3UA 1R43A 1JXVA 1RBOB 3PKMA 1Q8IA 1JMTA 3IO1A 4KKOA 4BBYA 4HACA 4EZ6A 1D8ZA 4YB6A 4CLFA 1NEEA 4RZRA 1F6TA 4RBVA 1HBMB 1UKUA 3NBPB 5KFFA 2XLIA 1R8HA 4I0WA 3W2VA 3UD4P 2E1PA 3H0PA 2IIHA 3RR8A 2J9DE 4OI6A 2CJXB 1JLCB 3BBCA 4P2XA 4P6QA 3NCQA 2KHDA 4DR4F 5LJ5Y 1S72S 4JUZA 1F5BA 2QZ8A 2L9DA 1VISA 3LO3A 4RW9A 2YWKA 3QRQA 1RK8A 2CPHA 4ZHRA 3BO4A 3OTOJ 3OR1B 1P9QC 2B6AA 4X65J 4RW7A 1FDBA 4AXJA 3ILLA 3OVAA 1KRPA 4CIOA 3GMGA 2QO3A 1FTCA 3LPEA 3KLIB 2HBRB 2E9ZA 5A8WB 1IKWB 1BMQB 4W4MA 2ASJA 2M0GB 3EZUA 4P2MA 4IQXA 4DV5J 3J80Y 4DV3J 3EPIA 1VQKS 3MDFA 3PZPA 2W24A 5L9NA 3CJ3A 5F8LA 4RNFA 2UU9F 4NRTA 4CWBA 4OFZA 1S1WB 1HI0P 3JYTB 3IM8A 3VVUA 2XMVA 2HIYA 5GVQA 4FS1A 1TU0B 3H7HB 1U2RA 2LQ9A 4X62J 3NEKA 4XK8C 4Q2MA 1Y10A 1PAEX 3MEKA 1WC1A 1UZHA 2RNEA 3T6BA 2VFVA 2BX6A 1U1MA 5K8NA 4F4YA 1B0VA 2EFOA 1N54B 3HSZA 1HMVB 4ZLPA 3I9V9 3W9HA 4L6V3 1GX6A 5CHCB 5IWAF 2AZ1A 2F40A 4DV4J 4Y2IA 1IBCB 3QGGA 1N5TA 4DF8A 4R8UA 4ZLNA 4Y2KA 4DFMA 4P2SA 2J76E 2AEMA 2CG4A 2WVFA 4K7QA 3M6WA 3W2WA 2HRTA 3ISND 5AE3A 2EI5A 2XY6A 2DGUA 3DRSA 2H4YB 4RNHA 3MCMA 3ET6B 2NLWA 4QWCA 5KOXA 3D6HB 2EG1A 5EN1A 4WKYA 4ANEA 1U02A 3V4MA 3LH2S 2GV1A 3TZWA 1IKYB 2KJVA 1X9MA 2JH3A 2P9CA 5KFAA 2VOPA 1VC6A 3T9NA 1P1LA 5EHHA 4NLRA 4DR6J 4IH6A 1FDNA 1FX2A 2CZ9A 1VQPS 3CXCR 2G0JA 1EKRA 2XSJB 2V9KA 2BJ7A 2GVDB 2OHDA 3HJFA 3NWRA 4HLBA 5DZ7A 1PGZA 4ETZA 2V9WA 2A3JA 1X7VA 5HMXA 4U67Q 4KAIA 2WB1D 1WEYA 3R5BA 1SI9A 3GYGA 4KHRA 2CVIA 3QIPA 2LKZA 2G4BA 3OFHA 4OZLA 4YY3J 2I38A 2RE1A 2PD1A 2XS2A 4K4UA 3IN5A 2RT3A 1N34J 4KH0B 2ZJQQ 5KG0A 2DH8A 1WWHA 1WOPA 4NLYA 4JI2J 3JXOA 1S57A 4GVBA 4F4ZA 1KR4A 2QYGA 4BCAA 4ILLA 1N5QA 4Y00A 3MEGB 1UAWA 2KKHA 3GP9A 5A8RA 2VC1A 2LDYA 1RAFB 2W9BA 2HZVA 4DU8A 4KJIA 3DXSX 3KJFB 4IG0B 3EWGA 3MEDB 4ETXA 3PHEA 2HQDA 2IJRA 2B5JB 2FC9A 4FXVA 4EO6A 2OPQA 1TKXA 2A10A 2DGWA 3A8JA 2QLWA 1ZZNA 2WSFC 5LSLA 2UV8A 5T7LB 3FVYA 5SZTA 1QUVA 1JLFA 3TUZC 1VMBA 5KG7A 4ECVA 3CDAA 4WP9A 5A0YB 4EUVA 3GLJA 1FRJA 3B78A 4YHHJ 1RWMB 2DHSA 4B3RF 2QLBB 2AEJA 5KFEA 4ID8A 4J9PA 1P8GA 4ZCIA 1AT1B 3NGTA 5DO2A 3DKDA 4DJBA 2FVSA 2MZTA 3L7PA 4KIAA 4DR2J 1UWBA 2WBRA 4ZVEA 4OJHA 4JI1J 5BYQA 1Q8BA 3RU0A 1A7GE 1RT4A 1PILA 3M2RB 3DLKB 4IG3B 4PWDB 2DNRA 3FZ2A 4ID5A 1IR1A 4F3MA 4LIWA 3ITHB 4R5PA 4QIEA 5F41A 1W25A 3RB0A 3VGVA 3EXYA 3Q2SC 4W92B 2HHHJ 2VOOA 5EX3A 1NPKA 4M5HA 1F0XA 1FEHA 4ITSA 1TL4A 1KN6A 3K8VA 3QNWB 3AQPA 1WUUA 3TW0A 2ZH1A 1TL5A 4DX8H 4ZVOB 1NJXA 1UWAA 5IM0A 3IAM9 1NBEB 3D9BA 2NSBA 5IQ6A 1RTDA 1I94J 2MHEA 4NXNJ 3RBEA 2QRRA 1JIHA 3H5YA 2C2EA 3MR2A 4DUZF 3H40A 4CH7A 2CWXA 2H1YA 1WKKA 3G9CA 2OUGA 3JTNA 3MAQA 1YJVA 3FMWA 3JTPA 2IAJA 2RF2A 3T5KA 3ULHA 1SC3B 1IBKF 2QYCA 2Z2ZA 2M88A 5KFKA 4MYTA 3TZYA 4F4WA 3M6UA 1S97A 3HHEA 4HTJA 3GCWP 5AT1B 3NRBA 2CNNB 1Q5YA 2Z4PA 4ZLJA 1WHXA 3TX8A 1KOHA 4XPEA 4J9LA 4C3KA 1NZ8A 2VH7A 1I6JA 2K3IA 3IAS9 1RA7A 2RH3A 3QATA 2RHQB 2KH9A 2CXEA 3MTJA 1IKVA 4X4SA 3NOGA 3O6QA 1RTJB 2MQPA 2OPSA 4MFBA 4DX6A 4HT7A 1TL1A 2JC0A 1F2GA 1S77D 2UXDJ 3C66A 1J5OB 2MKJA 2KL8A 2MJUA 3FDSA 1FJEB 2AYGA 2UV8G 3V6DB 3TAMB 4CO5A 3M8QA 2XMTA 3DLLQ 3CSKA 1SV5A 2HVIA 4FNIA 2DR8A 3DDKA 4RUAA 4EO8A 2QA4G 2FHMA 3NAIA 4DV7J 2NUUG 4OX6A 2CG8A 1CULB 4ES3A 1JLGA 1S6QB 1KC8T 2YNIB 4OI1A 2RMLA 2BRKA 3PYGA 3UDCA 4C7QA 3OL9A 3R3TA 1V5VA 3GG0A 1F9EB 3MAHA 4IYQA 3MUVP 2HS4A 1SPBP 4ZCMA 3Q0AA 4KGXB 2IDLA 4OHVA 3LWMA 3PEJA 3MEEA 1BE4A 1RWKB 2O1PA 1VQ4S 3CCWA 3CWJA 1BHNA 3DRXA 2KFYA 3PY8A 3OTOF 2HW3A 1YRUA 2XHCA 2UUCJ 1EETA 1KTVA 1A0OB 3H8YA 4HH1A 4DUYJ 2B9WA 1CQNA 4KT0C 3WX4A 5D15A 2C2RA 2OPPB 1RT6B 1Y3KA 2HS3A 2NZ4A 2UVWA 3I0SB 4WF9Q 2XSFA 2NSCA 2C22A 4DV5F 4PRFA 4E2FB 1WC6A 4B17A 5D3GB 1YIJS 1L3TA 3F73A 3ENQA 2VBXA 3E8OA 4MMOA 3L09A 2M9KA 2ZH6A 2EFPA 4X62F 4FKYA 2G1HA 1ZH5A 1VRUB 2R42A 1DLOB 4CO2A 3CJRA 1YHQS 3Q22A 3CMAS 4TYBA 2WBMA 1OS5A 7FDRA 1HW8A 3F56A 3OTEA 3K5MA 3K5NA 2QLFB 2AYEA 3FBFA 2MPUA 1BQNA 1SB6A 1YBTA 3DYAB 4DV4F 1U26A 2HNDB 2LXUA 1XBWA 1WORA 5L9XA 4LFAJ 2YX1A 2VBZA 4ZN3A 1NDLA 4YFUA 4NASA 1XN9A 4NX9A 3HSJA 2F3JA 2QN6B 2MMYA 2RD5C 2ROEA 3GV8B 1RHMB 4OI3A 4UQGA 4K2XA 2QL5B 2NREA 1QAXA 1UW9A 5BR8J 4URQU 5BYRA 3VALA 3K57A 5H9FK 5KFZA 1UCNA 2BR0A 1WF0A 2VFUA 2OPRB 4ZPWR 4KTQA 1GMUA 3AAWB 2DITA 1S9FA 1U8SA 2ZH9A 3DLEA 1YVFA 1S9EA 4RU9A 2F9JA 2D9PA 3FCVA 3CULA 4MJKA 4YR3A 2DY9A 3MTKA 4USMA 4EK2A 2N3LA 1TL3A 1RT1B 4QJVA 1S10A 3RW6A 3C15B 4DR6F 4O4RA 2GMHA 1HQUA 3W5ZA 1KWMA 2HPUA 3IWNC 3SXLA 2VASA 1TTHB 4BLGA 5HATA 3KK3B 2WCXA 1R89A 2MGZA 2FZGB 2HWHA 5L1IA 3P96A 1WI8A 2WZ1A 1L3SA 2GIFA 3V6HA 4WYWA 1X31C 3G86A 1Q5VA 3CJ5A 4X2BA 4ATNA 5F3TA 3LUYA 3A8KA 5IFMA 3M8WA 2JDJA 4I2QA 4JV2A 3VAIA 2YKNB 4YY3F 1FRXA 1TK8A 1X0PA 1JNRB 4ED5A 1N34F 2GHPA 3V6KA 2QJ3A 2FJBB 4JI2F 2Y1LB 1JQGA 4QIWD 2I6WA 2AJ0A 4FS2A 1S9GA 2B4PA 1H98A 3M1VB 1NMEB 3UN3A 3CCSS 3FQKA 4J91A 1FO1A 4I1TA 2FYXA 1JXLA 1TKZB 1IWAA 2YX4A 1OSCA 3DC2A 5DGBA 3D28A 4LF5J 3ZTOA 3SDEA 2GHVC 2PA8D 1VQYA 2XEXA 4M5LA 2JX2A 1TK5A 3D6TB 3Q8QB 3RYLA 2CPZA 2H65B 3BDEA 3C6UB 1DARA 5GAGI 1CJKB 3MECB 1N8RT 1RGVA 4DN9A 2KXNB 2HSEB 2F9DA 4NEYA 1UVLA 2BQ3A 1YJ7A 2DGXA 5CH7B 3LGMA 4WP3A 2RDJA 1Q82T 2R8IA 2MZ1A 1CJTA 3CD0A 4JI0J 2B4UA 1RT3B 3MCOA 3MGJA 4G1QA 4ZPDA 4OYPA 2IM1A 4MYUA 5F3ZA 4LBIA 5E5NA 1AUDA 4CNZA 4YN3B 1HI1A 2HHQA 3FRYA 3UCGA 3KJNB 4DR2F 4TY8B 4Y2MA 4J9VA 1SH2A 1J27A 4JI1F 3CCMS 2LVWA 1LW2A 1F2HA 4PG4A 3D1HA 2FHKA 4FYYB 4K5RA 2YNHB 2ACMA 1G6BA 1S7IA 4WCEQ 2FJWA 3G6XA 1BQMA 1RZMA 3ZZTA 1UFWA 3KFWX 3RAMA 3AY0A 4JV5F 1K44A 2HHHF 1S1TA 4AL7A 1YDLA 1GH8A 1PJ7A 1RHQB 3UCZP 3PKYA 2JL9A 3FFIB 2DNHA 3QO9B 4YB5A 4L72B 2XC9A 3DOLA 3DRPB 3U7JA 2DYAA 1XMQJ 5HJYA 4PAAA 1RQ0A 4DG1A 2J9DA 2XO6A 3B54A 2BACA 1RYRA 1TELA 2M4MA 4NXNF 2Y0BB 3C6TA 2NXNA 2QEXS 1S1UA 4F50A 1PG5B 1NK9A 2NCKL 1TKTB 3LTOA 3CDWA 3HLUA 1JKHB 2NXEA 1Q53A 1RHRB 1XIQA 3HFKA 4M5JA 2Y1JA 4DL0C 4H4MB 3EJMA 1FD8A 4O0IA 4QU7A 3KLGA 1IKXA 3SV4A 1TP7A 4NE9C 4OYWA 2BUNA 3E01B 2ILZA 1Q8KA 3ZFVA 2GIRA 4OZ5A 1HL6A 4TU8A 4LR7A 2LP4A 2X7IA 4B3TJ 4PYAA 3DI6A 3TNVA 1SIWB 1TZ0A 2AYMA 3KLEB 4LFCJ 2AKWB 1NKCA 2YVSA 1IR0A 3BO3A 4CYUA 2R7SA 2GX8A 1R0AB 2UXDF 5KFTA 4K50A 3DLGA 1HBOA 1WTFA 3VAFA 5HROA 2GW8A 1U6FA 1FDAA 4DV7F 1W26A 3M2UB 5H9FJ 1ZTTA 1LWFB 3MOZA 2WVBA 1XK8A 4PZVA 2DRBA 3PNIA 2LFVA 3FUYA 4AYBD 5K8OA 1F9FA 3JSMB 2WB4A 1YJRA 3LP2A 2DNPA 4ZPVR 4P75A 3GJSB 1Y5IB 4CLKA 1H73A 4IRCA 4FF3A 1BLUA 2HNYB 8ATCB 4FP9A 5CCLA 3IBWA 3CUNA 1FNOA 3BKFA 4MK9A 5U47A 1HI8A 5ETTA 1N5YB 3LOUA 4PR6A 2H9ZA 1RWPB 2UUCF 4K4TA 5GAEU 4DUYF 3UVJA 1RT7A 2KO1A 1SL0A 1N5VA 2CIMA 2XMUA 3G6VA 2HS0A 3A3NB 3DDIA 2FGCA 4IR1A 4NCAA 1KOOA 1T8EA 3H90A 2DNOA 2V50A 1WF1A 5C24B 1ZETA 3O8WA 4E0DA 2D41A 2CQ3A 2FTRA 3BYRA 3TP2A 1VQLS 1X5OA 2MKYA 3CCQS 3PRDA 3Q8UA 4NRUA 1NK8A 5L1KA 3OVBA 2IHR1 3TI0A 1R27B 2QLXA 1VS3A 3C16B 2R7RA 5CD4H 4NCGA 1WJ9A 5F8NA 5HMZA 2ZWOA 3V6JA 3VAMA 5CYJA 2HQ3A 2OTJS 1X4EA 4MKYA 1GXUA 1S1XB 1IBLJ 1DJ0A 1RTHB 1SCJB 3GJQB 5I4MA 3W9IA 2HQGA 3CJSA 1R6YA 1WHVA 5C42B 2F8MA 4RW8A 4L3NA 1V6HA 5ETRA 3U1NA 4DR1J 4LFAF 3QQCD 3WQPA 1HR0J 2VC0A 3QFWA 1FJGF 4ILRA 1EHWA 2AYBA 4ZIVA 2PI4A 4LFBF 4Q7AA 2LXFA 3MAAB 3MD1A 2K3KA 4O44A 3CVKA 5I42A 1U25A 4KFBA 5LL6d 3ENAA 4F3QA 1QVFR 3R5CA 2ZHOA 2V2ZA 1VQ9S 4Y6IA 4WTYA 3DN9A 1PJ6A 1M5OC 4DS5A 2BEFA 4USKA 1T0TV 4NXMF 4I2PA 2BW2A 4QIGA 4RW4B 4ZVFA 1ZYQA 5HVFA 3DDNA 2K1RB 2CNLB 3UPFA 4YDXA 1NK5A 1L3KA 2E7VA 2DRDA 3FMBA 2FJAB 3HHNB 2RKIA 3OTCA 5K8MA 3EZ5A 2FVRA 3TJAA 3T5JA 3DM2A 2ZH7A 4JV0A 4PYDA 4OHZA 4DR3J 2NUHA 4U8YA 1MMNA 1X4BA 5KFVA 3W8GA 4HHHA 2HWIA 2AD9A 4I64A 2ZD1B 3HULA 2OELA 4O3QA 3OT9A 3FEXB 3PM9A 5KTQA 3Q8RB 3HFVA 4BS2A 2LQBA 2JZ5A 2BANB 2EK6A 3CJ2A 1RA6A 1S5ZA 3CDBA 3K7RA 1FXRA 2BKNA 4OMFG 4DCOB 3OL7A 3SCJE 3LANA 4QWEA 3UDLA 5F9LA 3MM6A 3VV2B 3PJWA 3KG0A 3ETMA 2HBYB 5F8HA 3UNYA 3PYFA 4GMKA 3KLFB 3P6YC 1AFJA 1DRZA 2MQLA 3O5TB 3HZEA 1VQ5S 2PEHA 1E6YB 2VPYB 5FDLB 3OFFA 3CJTA 3EVWA 2R2UA 1RSCA 3T1HJ 4C8NA 1UPMB 3I55S 1X4AA 2RRBA 2FDNA 5D0RA 3Q86A 2CJBA 3MCSA 2HHPA 1UPPA 3V2UC 2C42A 2M8HA 2OEKA 2V6AA 1H3DA 2VQEJ 1FERA 1SH3A 2DY1A 2X1GA 2ZDOA 4PXCA 4UQTA 2FD2A 3N9UC 2QMUB 3A8IA 3GTYX 3V4IB 4JI0F 1DFDA 4JI3J 4A8QA 2GHWA 1VBZA 3Q8YA 5CYQA 3OTDA 2BABA 4TQRA 4OV6A 1V3SA 5DM7Q 4C0OC 4PKDB 3MPUB 1CS4A 4D3HA 2VODA 3QGHA 2DR6A 3W1YC 3GWCA 5AE2A 2VONA 3CJ4A 4NMXA 2XI3A 4O4GA 1VQSA 5HL7Q 4ICLA 3QIPB 2BYCA 2C2NA 3D0GE 2A1BA 3M8PA 1S4EA 1VQNS 3D4JA 5HN0A 1GT8A 2CJQA 1U48A 3T5LA 1OMSA 1FHTA 1Y7PA 4FKXA 1DQ9A 4ES2A 3AA9A 2EWHA 4P7TA 4S0MA 2Y8YA 4LT6A 4GVBB 1QUPA 2B4VA 1UVJA 2BBEA 2GO9A 1VBXA 5AXNA 1NJWA 3NCRA 2OEJA 3QT6A 2W1BA 3BGOP 3TRGA 3PV8A 4F0KA 3IP0A 3SMZA 1NRKA 1SJ1A 5ETPA 4OI4A 1C0TA 2CNKB 4Y0FA 1GNKA 4NWBA 3I56S 3VHQA 1CVJA 3DNCA 1XMQF 2I2YA 2AWZA 4AXIA 1U0SA 4WFXA 2JNJA 4MK8A 1Z2LA 2KU7A 1PAUB 1ZOTA 3HSDA 1MROB 1RJJA 2VA3A 1RAEB 2IMOA 4MK7A 2H51B 3KJVA 1HNWJ 2FJDB 5C25A 3PR4A 4Z37A 4MIBA 1VLYA 2C2DA 3GU0A 5J2QA 4B9MA 4LSZB 2POKA 2W25A 3D0IE 1HIYA 2XG8A 1X4HA 3EXCX 1TL7A 3CJQA 4Q43A 3SI8A 1HNXF 1N36J 3H98A 3Q2TC 1SJFA 4HH0A 1Q4RA 4LR8A 1BWVA 3AD9C 2DEIA 3TX0A 1XR5A 2RILA 2HNZA 3RRGA 1FKPB 4B3TF 4AQYJ 1JLEB 2HYIB 5IC4B 2DT9A 4LFCF 2KTQA 4OJ3A 1FE0A 2DGTA 3TJ8A 5LMNJ 4JBCA 4HHJA 3DGPA 1TMJA 1S79A 5IOLA 3JB9k 2ZHAA 4I6AA 4HR2A 5A8KB 3RBXA 4CM0A 3WBZA 3M2VB 4LSNB 2A2CA 1VDHA 3QJPA 3GSIA 3M30B 4OIXA 2HLTA 3GIJA 3C46A 4DX5A 1V9OA 3N0VA 5AXLA 2XO7A 1WHYA 5D6GA 2GS8A 1R8CA 1REVB 2J6TA 2FY1A 5IV3A 3BR9A 2XY7A 2HMIB 3IRXA 3HSGA 1ZA2B 2YNGB 3KK2B 2KFNA 4JV1A 3HXMA 5H9EK 2DCLA 4LF9J 2EFGA 2ZE2B 4KHPJ 3TWZA 1S6PA 1GXTA 3BZQA 2CYYA 4OLOA 2XY5A 2DHXA 5K14B 3QLHA 3CE8A 1HQEA 1SIZA 3SQGA 3IG1B 1U1PA 4KR0B 3W3SA 3LP0B 2IVMA
chains in the Genus database with same CATH topology
2VIHA 2A6MA 2FYXA 2VICA 4ER8A 2EC2A 2A6OA 2XQCA 2XMAA 2XO6A 2VHGA 2F5GA 2VJUA 2VJVA 2F4FA 2XM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VIH A;  2A6M A;  2FYX A;  2VIC A;  4ER8 A;  2EC2 A;  2A6O A;  2XQC A;  2XMA A;  2XO6 A;  2VHG A;  2F5G A;  2VJU A;  2VJV A;  2F4F A;  2XM3 A; 
#chains in the Genus database with same CATH topology
 4X4N A;  4L74 A;  1LWC A;  4K4S A;  1HWK A;  3SIP B;  5M2R A;  1XNR F;  4IOA Q;  3SFU A;  5IT9 U;  2BJ3 A;  2D1C A;  2WOM B;  4ZOS A;  4U95 A;  5DZ6 A;  1H74 A;  1KVJ A;  2HFV A;  4IDK B;  3AJ1 A;  4FYX B;  2E5H A;  3NNA A;  3T1Y F;  2RDI A;  3DFE A;  4NEZ A;  3RBD A;  1RT5 A;  4N8N A;  4V19 J;  1RLC L;  5IT0 A;  1U47 A;  2KG0 A;  1CSJ A;  5A2Q U;  3A8E A;  1M5K C;  3ZC4 A;  2QA1 A;  4QR0 A;  2KM8 C;  4P7V A;  3WC2 A;  4ECQ A;  3PG9 A;  4OJ1 A;  2JEI A;  1QY7 A;  2UUB J;  1FRI A;  3HVR A;  4KY3 A;  3QRP A;  4ZIT A;  2CQ1 A;  3CDE A;  4PAB A;  3MMC B;  1TKD A;  1OQ3 A;  3TEG A;  4ZIW A;  4GRS A;  4OI2 A;  5DG7 A;  2ZOG A;  1T9T A;  4PCQ A;  3K89 A;  2AU0 A;  2MY8 A;  2RAQ A;  4QU6 A;  3QMQ A;  4DR1 F;  4IRK A;  3CME S;  1U1L A;  1W2I A;  2RJZ A;  2B9E A;  1C1C B;  1WKJ A;  1FA0 A;  2C3M A;  1VBY A;  1KVK A;  4EI2 A;  1BY9 A;  1HNV A;  2BQR A;  1T7P A;  1WKL A;  4CLS A;  1BUX A;  3BR8 A;  1RWV B;  5D8H B;  5F8M A;  4KGM A;  2XNR A;  3NGS A;  2DNL A;  6FDR A;  3I87 A;  5B0E A;  4CM2 A;  2MTL A;  2QLJ B;  2GA7 A;  3KNG A;  1QSL A;  3P8B B;  4LRA A;  3EPG A;  5HMY A;  3QT5 A;  4Q0B B;  5BYS A;  2BOA A;  4HEA 9;  4FXD A;  2IPO B;  3OR2 B;  3R5D A;  3MM8 B;  1RLD A;  3ZZZ A;  4GO7 X;  1WNE A;  4LQ9 A;  4I67 A;  3BQ2 A;  1FJ7 A;  1Q95 G;  5D4L A;  4PUO A;  1TUG B;  4I7F B;  4UOG A;  1HKA A;  1HNI A;  2Z2Y B;  4DQR A;  2MQO A;  1VRT A;  4OL8 A;  2VJV A;  1TK0 A;  3MM5 A;  3VGS A;  1U24 A;  1NPP A;  3J81 U;  3I96 A;  3ENV A;  5D4N A;  2W7O A;  1VJQ A;  1Q86 T;  4CLW A;  2CVE A;  1KON A;  2DBB A;  1K8A T;  3HFZ B;  2AW0 A;  3JSY A;  2R2S A;  1QTM A;  2GJ2 A;  3QZ8 A;  4ELT A;  5M2U A;  3EVO A;  4BWM A;  2JHE A;  3JS9 A;  3JAM U;  2CDR B;  5K20 B;  2P9G A;  4LVN P;  2BKO A;  4WK3 A;  2XZW A;  2MKH A;  1G2E A;  3VAG A;  5KFR A;  5IT4 A;  5B09 A;  2OP5 A;  1U2F A;  4DV6 J;  2W2O P;  4LMZ A;  3VGT A;  1UJ4 A;  4N41 A;  3HKZ D;  5AE1 A;  3NGK A;  5A2Q Y;  4NA3 A;  5T14 A;  2DHA A;  5ETM A;  4FYW B;  3HT3 A;  2RRA A;  1BWE A;  1K1S A;  3T1H F;  2E9T A;  4OQJ A;  1UW4 A;  2UUA J;  2JJ4 D;  2QIF A;  2VJU A;  2BKP A;  3VZI A;  3PIP Q;  4LJM A;  1RIS A;  1YJT A;  4WYL A;  1XC9 A;  1WHW A;  4DR4 J;  2ZUA A;  4QWB A;  5L39 A;  1FK9 B;  1V3R A;  4TU9 A;  1R8A A;  3QT8 A;  4DFK A;  4ELU A;  4M5K A;  3HK2 A;  4JI3 F;  2PO4 A;  5DDR C;  4KHM A;  1KHW A;  1OJ4 A;  1N0V C;  2YQ0 A;  3AHP A;  3K8W A;  4ZPT R;  2E1R A;  5D0H A;  3T9Z A;  1UVK A;  3E51 A;  1SKR A;  3OQ2 A;  2UU9 J;  4LF2 A;  2BOP A;  1D9A A;  3L3C A;  1EJ7 L;  4ER8 A;  4M5D B;  5ETL A;  4CP5 A;  4L76 A;  1JLQ B;  1YQH A;  1OIA A;  4DR7 J;  3MM7 B;  3BGU A;  2DXF A;  2DIU A;  2LEP A;  4C8Z A;  3LWL A;  1MSW D;  3D6M B;  5J1E B;  4DL3 A;  4J90 A;  2DXE A;  3N6M A;  3CPW R;  1IM6 A;  1IM4 A;  1AW0 A;  4N5S A;  1AZS B;  2FUG 9;  3CC4 S;  2EKN A;  3LP1 A;  2KG1 A;  3DHX A;  3G82 A;  4ZLL A;  3J81 Y;  2BW7 A;  2B3T B;  1LW0 B;  4K0K J;  2E1C A;  2F4V J;  2WSC C;  1U09 A;  2HRU A;  2HQI A;  4M95 A;  4K4X A;  4WPA A;  2W8L A;  4KSE B;  2MLZ A;  4A8K A;  2RU9 A;  3JAM Y;  1RHU B;  3W65 A;  1RHJ B;  1S1V B;  4Q2L A;  4UZC A;  4PQA A;  1EP4 B;  4PXD A;  1PCA A;  1ROF A;  3D67 A;  2BV3 A;  4QOT A;  3IS9 A;  3MXH P;  4RW6 A;  3DLB A;  4H4O A;  5CYM B;  2MJN A;  2E66 A;  3HPO A;  3CJK A;  1NSP A;  2QFJ A;  3RTV A;  4NLQ A;  1NHK L;  2Z0G A;  1F3F A;  1B7F A;  4OYA A;  2R2T A;  1M5P C;  1QSS A;  2HGM A;  3U1M A;  3VAJ A;  1T9U A;  4ZVQ B;  3AOC A;  1PC5 A;  3ILJ A;  4ED8 A;  4KB7 A;  2YKA A;  2ILY A;  1WI6 A;  4DPW A;  3GFX A;  3HCX A;  4AQY F;  1E6V A;  2WON A;  1GTE A;  1VC0 A;  1VI7 A;  2YWE A;  2VG6 B;  2EEY A;  2XYG B;  2GQQ A;  5B7W A;  4M8L A;  3MR5 A;  1HYS A;  4OYB A;  1FKO B;  3BPD A;  2UVV A;  1FI4 A;  1ACM B;  1MU2 B;  2W7P A;  2JLE A;  5LXR A;  2E1A A;  3ISZ A;  3MI7 X;  3DOM B;  4QQB A;  2MZR A;  4RUB A;  1M90 T;  3GSD A;  4DPY A;  5K5M A;  2V94 A;  4IH7 A;  4F4A A;  3UQS A;  1YX2 A;  4B9U A;  2VF3 A;  3BYP A;  1NKB A;  5CCM A;  3ILO A;  5M2P A;  2D3Z A;  2HHT A;  2DRA A;  1QAJ A;  5L46 A;  2GC8 A;  3NWG A;  3FC9 A;  4OLP A;  5DRK A;  5D4O A;  8AT1 B;  1T05 B;  2ZKU A;  2HQC A;  1GXL A;  1FFW B;  1XMO F;  3KTQ A;  5J2P B;  1HBM A;  1OYE A;  1O5J A;  3NBP A;  2ZBI A;  3TR5 A;  3PJX A;  1RXO B;  1JLC A;  5EWG A;  4AL6 A;  2G2Z A;  2ZBC A;  3K0J A;  1PKU A;  2H54 B;  3PIO Q;  3VVT A;  2V4Q A;  1Q78 A;  5F9N A;  4NLW A;  3KMS A;  3SSR A;  1F3V A;  2J7K A;  4NLS A;  3DI6 B;  1RBA A;  3C14 A;  3OR1 A;  4ZP8 A;  2I9S A;  4WFA Q;  3GR1 A;  2UUB F;  1S7H A;  4YOE A;  4EBE A;  2MKK A;  4KE5 A;  3KLI A;  5A8W A;  1IKW A;  2AT1 B;  2CJA A;  3DMJ B;  3QZ7 A;  3FEY B;  3M8S A;  3G8T A;  2IJN A;  4QIV A;  1G1X A;  4M5I A;  3HHL B;  3KDN A;  3UWT A;  1SJ3 P;  3Q23 A;  1NLK L;  2V4R A;  4WK1 A;  2CQ2 A;  1S1W A;  2F8H A;  3JYT A;  3VCD A;  4DZ6 A;  3N79 A;  2WRM A;  2KHC A;  2I0X A;  3NAH A;  3U02 A;  5KFN A;  1VJW A;  2VPX B;  3V81 A;  4FF1 A;  1FDD A;  4KBI A;  4EWT A;  3H20 A;  3MPV A;  4DSI A;  1OSD A;  2XGQ A;  4M63 A;  4NPO A;  3IBC B;  3R1L A;  4PEO A;  1HMV A;  3NMR A;  1OPI A;  2PMH A;  4ED6 A;  4ES1 A;  1S49 A;  3HMJ G;  1VLO A;  1OPZ A;  4HVZ A;  4FPI A;  3EDQ B;  3QID A;  4USJ C;  2J8S A;  1JLA B;  4FVC A;  2GO8 A;  3T41 A;  2R7O A;  3PO5 A;  4QCL A;  4ECW A;  1X0F A;  2CPD A;  1XMB A;  4HI2 A;  1Z2Z A;  1S4F A;  2DNM A;  3HHK A;  5F8J A;  5FD1 A;  2IRY A;  4OHW A;  3R5A A;  5BJR A;  3ET6 A;  2UUT A;  1ZPV A;  2F8E X;  1T03 B;  1RWO B;  1TR0 A;  2LU2 A;  3M8R A;  2QC3 A;  3C8Y A;  1IQZ A;  2E9R X;  1IKY A;  4KV8 B;  5GAD U;  3EGN A;  3MCN A;  2W4D A;  4RBU A;  2FJV A;  2GVZ B;  3W8P A;  3PVX A;  2Q66 A;  4P73 A;  3CD6 S;  2L48 A;  5IXU A;  4BHQ A;  2FIU A;  3PRV A;  2JVO A;  3BF4 A;  3AOD A;  2LA6 A;  2PA3 A;  1FNM A;  4OYI A;  5F0W A;  1ZM4 A;  2XSJ A;  2XGP A;  1UMJ A;  3T1A A;  2N4D A;  2GVD A;  4KPY A;  5KT7 A;  4MT1 A;  5LJ3 Y;  2AEF A;  1J5E F;  2OGU A;  2B43 A;  2ERR A;  4XDD A;  4WFZ A;  4WZM A;  3M7V A;  4P9S A;  4RWX A;  2UUA F;  4CT8 A;  4QW9 A;  2ROG A;  3ZTR A;  1TFW A;  2YKM B;  1B0T A;  2ZBR A;  1RAC B;  1NO8 A;  2ALZ A;  3R6G B;  4DQQ A;  2WW8 A;  4DDF A;  2CFX A;  3ELH A;  3GZ7 A;  2IA6 A;  2C2Z B;  3BGR B;  1XTZ A;  1PYS B;  1S6O A;  4KGV B;  2DXD A;  3F41 A;  5GAH U;  3OW2 R;  2BMB A;  2PMZ D;  2OSR A;  3QFH A;  5FLX U;  4DBQ A;  1PBA A;  3FBC A;  5AJ3 J;  2OML A;  3MEG A;  1Y5L B;  4ZVT B;  4K5S A;  2GJF A;  1JXE A;  4RNM A;  1QJH A;  1YLX A;  1LWX A;  2E5G A;  2F7V A;  4Q5V A;  3QWU A;  2FHJ A;  3A1Y G;  4ZVH A;  2QSF A;  2ALY B;  4IG0 A;  3MED A;  4Y65 A;  2ASY A;  5CXT A;  1LFW A;  1YJW S;  2AJQ A;  3W5X A;  2OFH X;  1GX5 A;  1BXN A;  2B5J A;  4PPD A;  4JI5 F;  5DG9 A;  2A0F B;  1S0N A;  2LU1 A;  4DR7 F;  2BJ1 A;  2E7W A;  5T7L A;  1HBU B;  2VHG A;  2KRR A;  3DOK B;  5HLF B;  3MUR P;  4DPO A;  4DQP A;  4QPX A;  2R7Q A;  2RSQ A;  1HFE L;  3A4T A;  2B9X A;  1UZD A;  5A0Y A;  2H48 B;  3G87 A;  2DHH A;  2EK1 A;  2UVU A;  3FQL A;  3I5B A;  2VUG A;  3I4H X;  4K0K F;  4PQU B;  4DL7 A;  2F4V F;  2D3O R;  3EDR B;  3GJT B;  2IC3 B;  1YJ9 S;  3KLH B;  1J2V A;  4DX7 A;  3M2R A;  5E2Q A;  3DLK A;  1MW7 A;  4IG3 A;  2ZIT A;  4NYZ A;  1CJV B;  4PWD A;  4OZ2 A;  3MPY A;  1SQE A;  2E5L F;  3GON A;  4F3O A;  4ECR A;  3ITH A;  1RP5 A;  1UVI A;  2N7C A;  3D6F B;  1P1T A;  2HEK A;  3BB5 A;  4LVO P;  1HAR A;  4KQZ A;  2R8H A;  2HVD A;  3P4U B;  1K0V A;  2VDH A;  2AP6 A;  2HUR A;  3HVT B;  1UJ6 A;  4J5O A;  4USV A;  4B9T A;  4JI4 J;  2UXC J;  1X5S A;  5KFY A;  1VRQ C;  4HT5 A;  4KRW A;  2AQ4 A;  1QAY A;  5ETQ A;  3J7Y U;  2BA9 A;  2M70 A;  4NI2 B;  2RB7 A;  3P5B P;  4P52 A;  1VQO S;  3UD5 A;  2OEM A;  2XBP A;  2IA0 A;  1WG5 A;  3Q8S B;  1KLN A;  2R2R A;  2ZNZ A;  3BKU A;  3IFE A;  1U7L A;  3QJJ A;  2ZZM A;  1N33 F;  3OL6 A;  3BM7 A;  5FLX Y;  2HG4 A;  4RO0 A;  2A6O A;  4EFA C;  1U45 A;  2HHX A;  4B9S A;  3CF5 Q;  3MM9 B;  5KFD A;  3UO0 A;  2ZBP A;  1KFD A;  4AUK A;  2DR5 A;  3FSI A;  1M1K T;  2QSW A;  4K8R A;  1RAH B;  2MLY A;  3PW7 A;  2NZC A;  2V8P A;  1NB7 A;  2MST A;  1I5O B;  2HK2 A;  1K73 T;  3GII A;  4P74 A;  1RTJ A;  2PFD A;  2V8V A;  1PBU A;  1NCL A;  1IR2 A;  1J5O A;  3V6D A;  3TAM A;  3MUM P;  3CCR S;  5THW A;  1YBA A;  2XQC A;  1IQT A;  1SUQ B;  4IUF A;  4DF4 A;  2DH9 A;  3QAE A;  1ZAV A;  3C2P A;  1HNZ F;  1CUL A;  1CQM A;  3EGW B;  2M3D A;  1GK8 A;  2W01 A;  1S6Q A;  2YNI A;  1QSY A;  4PWU A;  2M8D B;  2ABY A;  2FJE B;  1WC4 A;  2QMW A;  5KG4 A;  1XR6 A;  1R0B G;  1JK9 B;  5ETO A;  1V5I B;  3FCW A;  5D0G A;  1WG1 A;  3C19 A;  1UTA A;  4USW A;  2XZD B;  4ZCK A;  3CED A;  4DPU A;  4USI A;  2H5J B;  1DTQ B;  3K5P A;  2PMW A;  3OXG A;  1G4C A;  2LEA A;  3ETO A;  2C2K B;  2AGO A;  3PYD A;  2FC8 A;  4ECX A;  3D5M A;  2OPP A;  3MF5 A;  5KOW A;  3NS6 A;  1RT6 A;  3QGI A;  3I0S A;  3BN4 A;  2F65 A;  1RAD B;  1H0H B;  1H7X A;  3I0R B;  3Q8P B;  1IBM F;  2LEB A;  1QE1 B;  4A8X A;  5D3G A;  3WHI A;  1UET A;  3MPD A;  4QIF A;  2YBV A;  2BVZ A;  3AD7 C;  4QYZ K;  1SJ4 P;  3Q83 A;  3UW1 A;  3VQT A;  4TNO A;  4U7C A;  2CKW A;  1N52 B;  2N7Y A;  2D69 A;  2D3O 1;  2YNF B;  1VRU A;  4JV5 J;  2X1B A;  1DLO A;  1IJE B;  2I8E A;  2YQ3 A;  4RPF A;  1H38 A;  3BSO A;  2KXH A;  2JEJ A;  3ZTQ A;  4N77 A;  3AOB A;  1RT2 B;  1JJC B;  1Q1K A;  4CO0 A;  2FLN A;  4DV1 J;  3DYA A;  4LSL B;  2MQN A;  2C3O A;  2VIH A;  4WE1 B;  4OZ1 A;  2HND A;  2Z8Q A;  3PR5 B;  5KG2 A;  1RAG B;  2CRL A;  5CA5 A;  2J0Q D;  4C8Y A;  1UL3 A;  2KT2 A;  1S6U A;  3A3P B;  3KJQ B;  4ELV A;  1JNZ B;  5B0B A;  3OD2 A;  5J2M B;  4XPC A;  2AJF E;  2QE5 A;  3QAU A;  3SBM A;  3TZX A;  1YJN S;  5E7O B;  4Q45 A;  3HDS A;  1EQ0 A;  4NML A;  3SSQ A;  4F0M A;  1YRT A;  2V69 A;  2HHW A;  5DDP C;  1SH0 A;  3DRY A;  4F02 A;  1RWU A;  3BN7 A;  3H25 A;  3UI3 A;  1P6T A;  2L9W A;  3HP6 A;  1HWL A;  4NLX A;  2RVJ A;  3KLV A;  2HFU A;  2OPR A;  4FDF A;  3PW0 A;  3IWL A;  1Q16 B;  5I3P A;  1KDN A;  3CCU S;  1YTY A;  3KHH A;  2JWN A;  1RT1 A;  3C15 A;  3O44 A;  1AUS L;  2Y9H A;  2RQ4 A;  4AFF A;  2GGP B;  5T41 A;  2J6U A;  2O67 A;  1MWQ A;  4IH5 A;  1Q79 A;  4WFY A;  2M52 A;  4LQ3 A;  1R31 A;  3FSY A;  3KK3 A;  3EGV A;  2EFN A;  3BEG B;  2V63 A;  3E3X A;  2ZNY A;  2C28 A;  3RJM B;  1ZAW A;  2AV5 A;  3IC1 A;  4ZVG A;  1NH8 A;  2HLU A;  1KFS A;  5FJ4 A;  2M7S A;  2QA2 A;  3DHW C;  5EX0 A;  1ZZF A;  3KHR A;  2I5J B;  5KFI A;  1C1B B;  1T3O A;  2YKN A;  2GZO A;  3KYL A;  5DQI A;  4HYK A;  3G4S S;  4Y34 A;  2J5A A;  1C0U B;  3TA1 A;  2BXJ A;  2YXL A;  4ZPA A;  3UE2 A;  1ICE B;  5AJ3 F;  3W64 A;  4EBC A;  3M1V A;  3PO4 A;  3BSN A;  1D1U A;  1TKZ A;  1UFK A;  2YWW A;  2ZKT A;  3R2C J;  3PTW A;  1KKH A;  3CW2 C;  2XMK A;  4DLE A;  4NZ6 A;  2J9E A;  2VZ9 A;  1XEZ A;  2LCW A;  3EMT A;  3MFI A;  3C6U A;  2HQF A;  1CJK A;  3MEC A;  2B51 A;  2XMA A;  1L3U A;  1MWY A;  5LOQ A;  2W7A A;  1M1H A;  2FHO B;  1RKJ A;  4UY8 T;  4AD6 A;  2KT5 A;  2HKE A;  5KT6 A;  1S0V A;  1RT3 A;  4GC6 A;  1G7C B;  3CIM A;  3SCI E;  3TAR A;  2NYH A;  1H6K X;  2KN4 A;  2DNK A;  2P9E A;  4B3O B;  3R7N B;  1URR A;  2CJY B;  4OX8 A;  4B08 A;  2JLG A;  4OX7 A;  2RUG A;  4CZC A;  2W9A A;  1T11 A;  1LWE B;  3MFH A;  5HP1 B;  4TY8 A;  2V2Q A;  2CNO B;  3RW7 A;  6AT1 B;  4YP3 A;  4USH A;  1FJG J;  1DHM A;  1RAB B;  2YNH A;  4LFB J;  2VFR A;  5LT5 A;  1U1O A;  3O1L A;  4LF8 J;  2B56 A;  1VYA A;  2ATC B;  3VZH A;  1FEE A;  1NK0 A;  3F44 A;  1FKA F;  2W9C B;  2AX1 A;  1RU1 A;  3MPW A;  4RUC A;  2V5H G;  3POT B;  4NXM J;  4IR9 A;  4J9U E;  1TVR B;  2IMW P;  3RRH A;  4G6V B;  4WU3 A;  3I4P A;  3OUY B;  1MML A;  3FFI A;  4F0H A;  3QO9 A;  1VGY A;  3MMA B;  3AJD A;  4RBT A;  1X4D A;  4JI4 F;  3DRP A;  2MXY A;  4MKB A;  5GMK a;  2UXC F;  2XM3 A;  2HAF A;  3CJ0 A;  3PYE A;  3K5L A;  5KT2 A;  4LRB A;  4N8O A;  1O8B A;  1UA0 A;  3M32 B;  1TKT A;  4QYZ J;  3N01 A;  4IOB A;  1LV5 A;  4PPZ A;  1FXL A;  1JKH A;  2H3E B;  4QW8 A;  1WTB A;  1SC4 B;  2AHO B;  4ZK7 M;  3CCV S;  3WDO A;  4H4M A;  2QGF B;  4DCP B;  4H54 A;  1R6V A;  4NYP A;  4ZCL A;  2OIH A;  2A6M A;  5K8P A;  2ZJP Q;  4DSK A;  1NHU A;  3E01 A;  1YGY A;  2EFQ A;  4UT4 A;  1Y3J A;  3RB3 A;  4W90 B;  2DGV A;  2OD6 A;  4TYA A;  4CO3 A;  1NAQ A;  3GJR B;  3ONQ A;  4DL6 A;  4F4K A;  1OYD A;  8RUC A;  3CT9 A;  3T19 A;  3KLE A;  4X4P A;  4FBU A;  3SCL E;  2DEJ A;  1TV6 B;  2GML A;  1DTT B;  1R0A A;  1Z4U A;  4RLE A;  1A6L A;  2B9Y A;  3HJV A;  2PC6 A;  2KT3 A;  2YPY A;  5KFQ A;  4PG6 A;  1YK9 A;  2OFG X;  3HX9 A;  4UTG A;  1SL2 A;  2H5E A;  3EIC A;  1UEK A;  2D9O A;  2ZOF A;  3P49 B;  1GTH A;  5B08 A;  4I56 A;  4C9D A;  2VL1 A;  3OJS A;  3M2U A;  3D2W A;  2MB0 B;  4WZQ A;  4V19 X;  1LWF A;  2LQ8 A;  4UF4 A;  2IVF B;  3TVZ A;  1NDP A;  4ANC A;  1DAX A;  4LF4 J;  3QWP A;  3JSM A;  3J7A N;  4OHY A;  3G71 S;  2E5J A;  4F4X A;  2SXL A;  1KQF B;  3HO1 A;  2V8G A;  2HNY A;  5J2N B;  1NSQ A;  4F26 A;  1LQ9 A;  1ZM2 A;  2D3U A;  2L41 A;  1N5Y A;  3M9O B;  1TUV A;  4ED4 A;  4X84 A;  1RDR A;  3H5U A;  2R7T A;  2DR7 A;  2YH0 A;  1W2B R;  4C8M A;  3O3L A;  2FY8 A;  1FES A;  3IRW P;  1JLB B;  4X4Q A;  3R6L B;  4FVM A;  3PFO A;  2DPJ A;  1KQG B;  2EG2 A;  3R7S B;  2MKS A;  1LK5 A;  5C24 A;  4FYD A;  5C5J A;  1CEZ A;  4B3M J;  4CI0 B;  2G0C A;  2FLL A;  2RDD A;  2R4F A;  4C8K A;  1MG7 A;  4M5N A;  1GQE A;  3KMQ A;  1D9F A;  1KEK A;  3M4X A;  3C16 A;  3EM1 A;  1AXQ A;  3NCP A;  1U1Q A;  1RTI B;  5C7P A;  2GAH C;  4TKT A;  4N76 A;  2E5I A;  4PXE A;  1D8Y A;  3KUE A;  2L3M A;  1S1X A;  1ARO P;  2P6T A;  1AB8 A;  4QBU A;  1RTH A;  5L38 A;  2WVD A;  4DV1 F;  3JSB A;  4EMD A;  2HAI A;  5C42 A;  2CJK A;  4O0N A;  4I4B A;  5GAE I;  2Y1I A;  5B0C A;  4UOH A;  1N32 J;  1Q7L B;  5E3C A;  2EC0 A;  3MAA A;  4KO0 B;  1V3Z A;  4A46 A;  1AFI A;  3VF0 B;  3K2Y A;  4CCH A;  3BS9 A;  4OZJ A;  4KGZ B;  3MZI A;  3IR5 B;  5ITH A;  2VFT A;  2B0G A;  3MMJ A;  4LF1 A;  2VG5 A;  4CTA B;  2X3G A;  4RW4 A;  3C14 B;  1RWN B;  4LUB A;  2FB0 A;  3PFE A;  4HDH A;  2CQB A;  2K1R A;  5DQH A;  3KK1 B;  1HNX J;  4UOF A;  3ZZO A;  3R1H A;  2IVY A;  4DS4 A;  2V4J B;  2KJW A;  1RUS A;  4C11 B;  4A8Y A;  3US5 A;  1UA1 A;  4C4W A;  1CJU B;  2C2M B;  4OHX A;  3J7Z T;  2NPI A;  1OO0 B;  2VG7 B;  1EZZ B;  3N6N A;  4M1K A;  1D3W A;  3GV5 B;  1HBN B;  2ZD1 A;  3EZO A;  5D78 A;  3V81 B;  3PAC A;  3IXQ A;  1ZTW A;  5K9F A;  3FZB A;  1Y0H A;  2C1E B;  1KLM B;  3H2U B;  5I3U B;  3FJ2 A;  2BAN A;  3GFY A;  1HHT P;  4GKJ F;  2GAG C;  1TUW A;  1HPZ B;  5KFB A;  4IFY B;  1NK4 A;  9ATC B;  2BE2 B;  1B0P A;  4V1A k;  2QMX A;  3ADA C;  3WIU A;  4IFV B;  3IR7 B;  5DJB A;  3KLF A;  4GVL A;  5ETV A;  3IMQ J;  1B70 B;  2CAD A;  2DIS A;  2DCU B;  2ZJR Q;  1E6Y A;  3ZZR A;  5JVG Q;  2E7X A;  1VQ7 S;  3MR7 A;  5FDL A;  3DRR B;  1KQK A;  4UST A;  3AFG A;  1XNR J;  4WBF A;  2XWY A;  1Q8L A;  4ZJL A;  5SUH A;  3MOJ B;  5HBM B;  3RR7 A;  3PDN A;  3EUN A;  1X9S A;  1N6Q B;  2EBG A;  1JJ2 R;  3T1Y J;  1FVQ A;  1N4L A;  5KFJ A;  3SZ2 A;  3NNC A;  4MTP A;  4QPT A;  3OFG A;  5D77 A;  4F36 A;  4HKQ A;  2HZA A;  1VBK A;  3NLC A;  3MMB B;  3V4I A;  3NS5 A;  3PJ9 A;  1O51 A;  2KZZ A;  5G0R B;  3TA2 A;  3U1L A;  3B8H A;  2B8Q A;  2MY7 A;  1KSP A;  1T94 A;  2CPF A;  5DS7 A;  2G13 A;  3Q8V A;  3GQC A;  4JI7 J;  4WTO B;  2CPJ A;  3ZNU A;  1N88 A;  5ETK A;  4KKO B;  4HAC B;  3CDU A;  1L5U A;  1NPR A;  3GCX P;  3QGP A;  5KG3 A;  3GG1 A;  1PO6 A;  1SXL A;  1EAR A;  3W2V B;  2WK4 A;  4EU0 A;  2XYP B;  1XWL A;  1LXJ A;  1B4S A;  1RBL A;  2YQ1 A;  3SFG A;  4TN2 A;  4LF8 F;  5DQG A;  1D09 B;  3OSP A;  4YUD A;  4RW9 B;  1T9W A;  5IC6 B;  4I69 A;  2ZZT A;  4ERD A;  4ZHR B;  2GMJ A;  4MKA A;  1H2V Z;  4ED7 A;  2B6A B;  4RW7 B;  2ZVS A;  4Z7Y A;  4OZ3 A;  2DKO B;  1YIT S;  2XYH B;  3BBF A;  1RWX B;  3NP5 A;  4DPX A;  4HI1 A;  2U1A A;  1O0P A;  5DM6 Q;  2FZC B;  2V8H A;  2FLO A;  5HSP A;  3GIK A;  4K59 A;  3TZZ A;  4Y2C A;  2LQJ A;  1F60 B;  4ZPB A;  2IYI A;  2XLK A;  4USU A;  2ZVI A;  1VFJ A;  3M6X A;  1MRO A;  2DK2 A;  4ZJQ A;  3UR0 A;  3RB4 A;  1F1B B;  2OSQ A;  4ZA1 A;  1ZA1 B;  2VIC A;  3ISN C;  3D54 A;  1T02 A;  1JJH A;  1VQM S;  4ILM A;  4DHV A;  3RAQ A;  1SL1 A;  5LSR A;  3H4B A;  2EBE A;  2XLJ A;  4KGK A;  4G1P A;  2FVP A;  2CJ9 A;  3H5S A;  2K7J A;  4R0J A;  2XCA A;  1NK6 A;  2IM2 A;  2ZZN A;  2Q79 A;  3R27 A;  1RTZ A;  1Q0N A;  5FII A;  4R8U B;  1FKP A;  1ITP A;  2CA9 A;  2V34 A;  4YS2 A;  4Q8E A;  1QVG R;  1B3T A;  3MHY A;  1JLE A;  1NZA A;  4FNH A;  3TUP A;  3TVK A;  1Q7Y T;  5JUM A;  4LBH A;  3RAX A;  3QRR A;  4DMZ A;  3W2W B;  1S76 D;  3CB4 A;  1HHQ A;  1PIE A;  4U8V A;  2X3D A;  1WG4 A;  1MN9 A;  1R3N A;  5A8K A;  5KFG A;  3DRS B;  4DQI A;  5MLC V;  3M2V A;  4LSN A;  4U96 A;  1CPZ A;  3M30 A;  2B4O A;  2ZOM A;  5C2C A;  2OH2 A;  1REV A;  1FX4 A;  4LF6 J;  4EBD A;  3ZZY A;  2HMI A;  4LF4 F;  2YNG A;  3KK2 A;  2ZE2 A;  2PFF B;  1KHV A;  2XUL A;  2MLX A;  4JI6 J;  3UNG C;  5K14 A;  1NK7 A;  3IG1 A;  4GO5 X;  3LP0 A;  4IO9 Q;  5E3Q A;  3PRB A;  4L73 A;  3M6V A;  1UVN A;  4WU2 A;  3R5G A;  2M2B A;  4J9K A;  2V0N A;  2GCF A;  2JEF A;  4Q8F A;  2VDI A;  2WOM A;  3S7R A;  4TY9 A;  3DCA A;  1QD1 A;  4IDK A;  3BSA A;  3BGF A;  4J9N A;  3SV3 A;  1H72 C;  4I6W A;  1JX4 A;  3DU5 A;  3I5C A;  2UXB J;  2O01 C;  3JSR A;  3G6E S;  2R8K A;  4B3M F;  2N82 B;  4YR2 A;  2DJW A;  1OY6 A;  4B3S J;  1K0T A;  2KI2 A;  5HVG A;  4IQM A;  3SYZ A;  4EEY A;  4ED3 A;  2VB6 A;  4ENO A;  1LOU A;  3R7B B;  2H5I B;  5A8R B;  3MMC A;  1NJI T;  4J9R A;  7AT1 B;  1QDU B;  5LM7 E;  2HVE A;  2DHG A;  1U8W A;  2BM0 A;  3THT A;  2L9N A;  2B7B B;  2MQ8 A;  2W9B B;  1X9W A;  3TAN A;  2DTJ A;  4C8O A;  4NLT A;  2CUY A;  3ZXW A;  1N32 F;  3TA0 A;  4QWD A;  1C1C A;  1VR6 A;  1HQ2 A;  4FXW A;  2OPQ B;  3IWX A;  3O2I A;  1TKX B;  1VOM A;  3FRZ A;  2MEW A;  1XNQ J;  4ECT A;  5L1L A;  1JLF B;  1LKZ A;  2IBO A;  1G3O A;  4M94 A;  1TFY A;  2UUW A;  4X65 F;  1D9D A;  4Q0B A;  2NR0 A;  4CLU A;  4ZPC A;  3KUG A;  3OXF A;  3OR2 A;  3NMA A;  2HZC A;  3MM8 A;  4DV3 F;  2MQQ A;  2JC1 A;  3G2X A;  1UWB B;  1VK3 A;  2HBQ B;  1EKS A;  2LDI A;  2Z57 B;  4I7F A;  3Q24 A;  1NHV A;  2VU5 A;  4DL4 A;  1RT4 B;  1ZM9 A;  4WJB A;  2NPF A;  3S1T A;  1RAA B;  4ID5 B;  4XO0 A;  4C2M A;  3BRE A;  2Z56 B;  3NS7 B;  1YWX A;  3IBF B;  3D7S B;  3V5R A;  2VFS A;  4R5P B;  4DV0 J;  5JMN A;  1YSJ A;  1SBR A;  4X4V A;  2XS7 A;  2P2C B;  2ZC3 A;  4URG A;  4PG7 A;  4NA1 A;  4J9O A;  3G6Y A;  1PYT A;  4JOU A;  1T9X A;  3B4M A;  1WC5 A;  3QSY B;  7FD1 A;  1KD1 T;  3AT1 B;  1BQX A;  3OBI A;  3PX6 A;  1QM9 A;  5IM0 B;  3KHG A;  3TQ1 A;  4J9M A;  4BC7 A;  1RTD B;  4LRD A;  3QBC A;  3TEH B;  1KP6 A;  2G0I A;  2B7C B;  4YB7 A;  2G1D A;  1I1G A;  3D3C J;  3TQE A;  4H4K A;  2IAJ B;  2RF2 B;  1XMO J;  3IA0 A;  4I6Y A;  2DR9 A;  2ROP A;  2ASL A;  2XZT B;  4L3K A;  4B02 A;  2BZ2 A;  3U27 A;  2HFS A;  1FK9 A;  4DN0 A;  4WFB Q;  5HQL A;  1HLW A;  4XAK A;  2OO4 A;  3AB2 B;  2VKZ G;  1CG2 A;  2F63 A;  4C48 A;  4AT1 B;  3MUT P;  1U0H A;  5KT3 A;  4X4T A;  3S8S A;  1IKV B;  2HFZ A;  3GIL A;  2RU3 A;  2OPS B;  4MFB B;  1TL1 B;  1S48 A;  3KHL A;  5JVH Q;  4JI7 F;  3M8Q B;  1S0O A;  2CPI A;  4A8O A;  4DZD A;  1SV5 B;  3OVS A;  3KG1 A;  1FE4 A;  3A12 A;  4WXW A;  2BRL A;  1PYO B;  4ZP9 A;  4M5D A;  1JLG B;  3KKF A;  2Z58 B;  1JLQ A;  1FVS A;  3MM7 A;  5E41 A;  1YJU A;  3J81 j;  5EGY A;  2LA4 A;  5J1E A;  3RUB L;  2GQC A;  3OTB A;  5I3Q A;  3MEE B;  4RR5 A;  1AZS A;  4QZV B;  3M9N B;  3RG6 A;  5EUH A;  2Q6C A;  1M5S A;  1EET B;  3GFH A;  4FF4 A;  4YDD B;  1LW0 A;  3UN2 A;  2MZS A;  2FPH X;  2KDO A;  1EB0 A;  1K9M T;  4GC7 A;  2FQQ B;  3GIR A;  3PX4 A;  1S1V A;  2FZK B;  2Y1R I;  3OL8 A;  1SC1 B;  2IM3 A;  1OY8 A;  2R3V A;  3JQK A;  1EP4 A;  2P6S A;  5E3R A;  3P3D A;  2PSZ A;  2DNY A;  2EXU A;  4HHU A;  5CYM A;  2V2V A;  2NS1 B;  4DU7 A;  3FKB A;  3JQM A;  1LK7 A;  2EC2 A;  3H59 A;  3LF0 A;  4HDG A;  3T5H A;  3K58 A;  1BC6 A;  3MWB A;  1ZM3 A;  3L7U A;  2OKQ A;  2ASD A;  4YHH F;  1EX8 A;  3N28 A;  1MLA A;  2FVC A;  1VCT A;  1BQN B;  2GQ2 A;  5IT9 Y;  4RNO A;  2R7U A;  2OI2 A;  4F25 A;  2VD3 A;  4X4R A;  5CZX A;  3R5J B;  3CCZ A;  4RKU C;  1VQ6 S;  3FSX A;  1OQ6 A;  1C2P A;  3N5F A;  2U2F A;  3NXZ A;  5E33 A;  3TVY A;  3BO2 A;  3KNA A;  1NDC A;  2KZM A;  2MSS A;  2XI2 A;  3HHD A;  2VG6 A;  3GR0 A;  3S01 A;  1VQ8 S;  4UW2 A;  4WWS A;  1J5E J;  1SKU B;  2ZBQ A;  4NCB A;  1WC3 A;  5HO4 A;  2LXI A;  5ETN A;  4K4V A;  1VHF A;  4LBP A;  3UD3 P;  4C98 A;  1FKO A;  2AGQ A;  2WW4 A;  1KBR A;  2ZH5 A;  1MU2 A;  3UFC X;  1B7Y B;  2HHS A;  2VA2 A;  4OYZ A;  2VPW B;  5J1N A;  1X4F A;  5KFC A;  4LF6 F;  3DOM A;  3BBB A;  4XIU A;  2MQM A;  3ZZ0 A;  2W4P A;  3UCU P;  3DLE B;  4R25 A;  3WZ0 A;  1S9E B;  2IRX A;  4ZVR B;  1TL3 B;  4A8F A;  1I94 F;  4ECS A;  3DLH A;  1SQF A;  2W4C A;  4JI6 F;  2C3U A;  4KH1 B;  1HQU B;  2GNK A;  4A8M P;  2JFD A;  1T05 A;  4DEZ A;  2RQM A;  1XJW B;  5GAG U;  2MGZ B;  5KFM A;  3TUI C;  4F7V A;  5J2P A;  3M8Y A;  1PC4 A;  3CO9 A;  3K59 A;  2YX7 A;  3Q89 A;  2PT0 A;  3ZZU A;  1U1K A;  4DV2 J;  1N56 A;  2UXB F;  2CZV C;  1Y9O A;  4JI5 J;  4YB1 P;  5KFH A;  3NGR A;  4I2Q B;  4OYO A;  2VKR A;  2QTW A;  3A13 A;  3LA0 A;  3ICL A;  2EVZ A;  4NLP A;  2P5V A;  4B3S F;  5HK4 A;  3PW2 A;  4O3S A;  5H9E J;  4NLO A;  1U49 A;  1VC5 A;  4DSF A;  1RCO B;  1TAQ A;  3FBB A;  1S9G B;  4IRD A;  1NJZ A;  2KB2 A;  3DMJ A;  1O6X A;  3WIV A;  1WC0 A;  3D1Q A;  4RJV A;  4RU2 A;  2JFK A;  1TQL A;  3SDE B;  1ZBT A;  3HHL A;  1VIO A;  2LMI A;  4J9S A;  3CCJ S;  3THV A;  4LRF A;  2YWH A;  3RRK A;  5F0U A;  3DU6 A;  3P5T L;  4NLG A;  2E5L J;  4QR2 A;  4X4U A;  4KC5 A;  1RE1 B;  1FXD A;  4C3M A;  1NB2 A;  1XNQ F;  3D3B J;  1CJT B;  4LRC A;  4A8S A;  1GFW B;  1QTN B;  1CLF A;  5GMD A;  3HT0 A;  1KQS R;  4G1Q B;  4O3O A;  1X4G A;  2CPE A;  2R7X A;  4NA2 A;  3S6E A;  5IZH A;  2KXF A;  1FNX H;  2XNQ A;  1IUJ A;  1NSA A;  2UZA A;  3ILI A;  1GEH A;  1JLA A;  4UOC A;  3J7A 1;  1K47 A;  4Y3C A;  4F2S A;  1LW2 B;  1MNE A;  3LPY A;  4K4Z A;  1GAO A;  2K7K A;  1QLN A;  2R8J A;  1NDK A;  5CZV A;  5LSO A;  1FFG B;  3OPK A;  3L7O A;  4DSL A;  4HL9 A;  2QX0 A;  2OAU A;  1BQM B;  4Y28 C;  2F5G A;  1BGX T;  1N33 J;  4P2F A;  2AGP A;  4ZVS B;  1R8B A;  2W2Q P;  3PW4 A;  1H2U X;  1CC7 A;  2GFF A;  1X4C A;  4DV0 F;  2CQC A;  1T03 A;  1GMW A;  2DIV A;  4WP8 A;  5HQM A;  3DLJ A;  4QWA A;  2K8G A;  2ZH2 A;  4KV8 A;  1S1T B;  3QT7 A;  1R8P A;  2H4W B;  4J37 A;  4O23 A;  3GV7 B;  2F1F A;  2GVZ A;  2ZM6 J;  2WSE C;  3BH6 B;  2NYI A;  2PGC A;  3SEO A;  2XMJ A;  5IQQ A;  3DOL B;  1C4C A;  4K2J A;  5LXY A;  3VAK A;  1SJQ A;  5CAA A;  4DG1 B;  4XTT A;  1P9Y A;  1XQI A;  3W66 A;  3EYZ A;  1C4A A;  1DY3 A;  3KUH A;  3B6B A;  1RAJ A;  1Y11 A;  3C6T B;  1S1U B;  4PG5 A;  3RB6 A;  4O3N A;  2IYG A;  4RNN A;  2IRU A;  4DSJ A;  4G65 A;  1F9H A;  1FWL A;  5BR8 F;  1RHK B;  1PSD A;  2VG5 B;  1WDT A;  1R0C B;  1YBU A;  3CD7 A;  1HNZ J;  2YKM A;  3AB4 B;  1WDD A;  1UP1 A;  4H4K C;  3KLG B;  5AXK A;  1IKX B;  2N4C A;  4UY8 5;  3UDE A;  5DLF A;  4DSE A;  1UEV A;  5CD4 A;  2IDE A;  1DUR A;  2CQD A;  3KG4 A;  1YG0 A;  3L9Z A;  5KFX A;  3BGR A;  2DO0 A;  2RS2 A;  3SSS A;  1S59 A;  5GAD I;  5A76 A;  4UUX A;  5BXI A;  2YWF A;  1SQG A;  5A6P A;  2JRS A;  2YKO A;  4NLD A;  2UVR A;  1U4B A;  4N47 A;  4CYU B;  1HA1 A;  5KFW A;  3OXL A;  2O66 A;  3UR3 C;  3SCK E;  1RKI A;  3BKT A;  1REG X;  1ELO A;  3DLG B;  2PII A;  1HBO B;  4ED1 A;  1IWG A;  1NXI A;  2ZH4 A;  1RAI B;  1IBM J;  5HRO B;  3W5Y A;  3C3L A;  3WX8 A;  3BH7 B;  1K1Q A;  4ZDN A;  5HQ8 A;  3K5O A;  3D68 A;  2X51 A;  2YPZ A;  4YR0 A;  1HBU A;  3LP2 B;  2HGL A;  1H7W A;  3DOK A;  3I9Z A;  1FF2 A;  1CBK A;  5HLF A;  1IVZ A;  3OJU A;  1S12 A;  3JTO A;  2W2P P;  5KFU A;  4M5G A;  1NSK L;  1M5V C;  4ZN1 A;  3X1L B;  5C2G A;  6FD1 A;  1SKW A;  1GMV A;  4DR5 J;  5RUB A;  2LLZ A;  2W2M P;  3HKW A;  2ZUG A;  5GAH I;  3UVJ B;  4PQU A;  4LF5 F;  2HGN A;  2R9L A;  4DUT A;  1RT7 B;  1RWW B;  4ZP7 A;  3PCO B;  2EFV A;  2R7V A;  4JI8 J;  2HFN A;  1WEX A;  2IC3 A;  3KLH A;  1ULR A;  2Q1L A;  4U9R A;  5JJB A;  3THP A;  2PDA A;  4ZKA A;  1MWZ A;  4MAK A;  4NL5 A;  1CJV A;  4ZVU B;  2ZDP A;  3KWM A;  4OJG A;  1IXK A;  2KM8 B;  3TOQ A;  1VK8 A;  2CQ4 A;  3CCE S;  3GYX B;  3RBZ A;  3TAQ A;  2J6S A;  3VTI A;  2Q43 A;  3W9J A;  4WXO A;  2FGO A;  1NUE A;  1RB0 A;  1RI7 A;  5DLG A;  4OI0 A;  2ZH8 A;  4FYV B;  1UVM A;  4NCG B;  2AMC B;  5E3P A;  4ECZ A;  4DQS A;  2HIQ A;  2KFZ A;  3HVT A;  1JWW A;  3LGH A;  3BGL A;  2AF6 A;  1UFL A;  3HHL D;  2J0W A;  2UP1 A;  5KFO A;  3IM9 A;  1NU4 A;  2K2P A;  1F5A A;  3F0N A;  4NI2 A;  3PHT A;  3IGV A;  1WEZ A;  4RW8 B;  5CQG A;  4D3G A;  1VHI A;  2DB1 A;  3GPA A;  4E8U A;  2CAJ A;  1YRX A;  2BJ9 A;  3VR1 A;  4TU7 A;  3NNH A;  3PX0 A;  1U1R A;  5HMW A;  3CC7 S;  4AL5 A;  5DDO C;  2AZ3 A;  2DNZ A;  1LXN A;  4OZN A;  4O44 B;  4BC9 A;  5I42 B;  2COL A;  4PWW A;  4X66 J;  4KFB B;  4MIW A;  1DQA A;  3BJY A;  3OLA A;  3M8Z A;  4RX6 A;  2V68 A;  2BE9 B;  4A4J A;  3MM9 A;  4I2P B;  3TO8 A;  1PJ5 A;  2DPI A;  5F8G A;  3OHA A;  1XER A;  4DI6 A;  3IR6 B;  1W7W A;  3VAH A;  2RUS A;  3AA8 A;  4F2R A;  4Q44 A;  2DNQ A;  2ZH3 A;  4WII A;  3G96 A;  4J7C A;  3L4B C;  3G8Q A;  3DGV A;  2RKI B;  1KS2 A;  2DH7 A;  3NGU A;  2KYZ A;  1U6Z A;  4DOZ A;  3AQO A;  3DM2 B;  3NG8 A;  4C6A A;  4B9N A;  2PEB A;  4BWJ A;  5DGA A;  4FBT A;  2HWT A;  2VBW A;  2G9O A;  2V8D A;  4C97 A;  2A18 A;  1MMD A;  4AE5 A;  4C8L A;  4CH0 S;  1SUQ A;  3J7Y I;  1TAU A;  4NLV A;  3W63 A;  5LMU J;  2IBK A;  2E44 A;  1GMW D;  1KNZ A;  1EAY C;  3I6P A;  2AJ1 A;  4A8W A;  2J9C A;  4X64 J;  4BDP A;  2GJI A;  3FCH A;  2FVQ A;  2ADB A;  2B8P A;  2OLW A;  3BQ1 A;  3BDP A;  4DV2 F;  5F8I A;  1D0E A;  2K06 A;  3FK4 A;  5AXM A;  2RHS B;  3LGN A;  3AD8 C;  3ZTS A;  3OV7 A;  4NLU A;  4ZJO A;  4DPT A;  3VQS A;  2BJ8 A;  4CLZ A;  1H2T Z;  3MM6 B;  4ZVP B;  2WAQ D;  1DTQ A;  2FLP A;  5CAB A;  3NOC A;  1MN7 A;  3HVW A;  5MAO A;  4EZ9 A;  2J7W A;  1IJF B;  3AJ2 A;  2YWG A;  1ZPW X;  2XS5 A;  3G8S A;  4PG8 A;  3VGU A;  3CJ8 A;  2DNN A;  3I0R A;  1QE1 A;  2QL9 B;  2E1M C;  4OX9 J;  1SKS A;  5E3A A;  3GFZ A;  3ENW A;  2YH1 A;  4IKA A;  1S0M A;  3HHL C;  3RGI A;  2XWX A;  2M5Y A;  1N5S A;  5B0G A;  3LAK A;  4B9V A;  2YNF A;  3LW5 C;  4CO4 A;  4U7U D;  3BQ0 A;  3ZTP A;  3B82 A;  1T9V A;  4L75 A;  4LF7 J;  3AH6 A;  2APO A;  3W62 A;  5EWE A;  4JYA J;  3EGZ A;  1N0U A;  3TAP A;  1RT2 A;  1ZAX A;  2ZC4 A;  4OV1 A;  5CYQ B;  2PI5 A;  4LSL A;  4ZS6 A;  1WF2 A;  1NND A;  4WE1 A;  2C3P A;  1U2C A;  4TLQ A;  3M9M B;  3EE3 A;  9RUB A;  3J7Z 5;  1CS4 B;  2IY5 B;  4KYZ A;  2Q3P A;  4F04 B;  5J2M A;  1HW9 A;  2PN6 A;  2XHW A;  4O4G B;  4ICL B;  1FWK A;  1I51 B;  4Z2X A;  4XDC A;  3UDV A;  3M8P B;  2CPY A;  5D0E A;  1L3V A;  2CQH A;  2JOQ A;  5ADZ A;  3D66 A;  3ZNJ 1;  3T3F A;  3H2L A;  4YQW A;  1FD2 A;  1WOO A;  4OYM A;  1HWI A;  4RL1 A;  1IBL F;  1DBD A;  1NM2 A;  1IN0 A;  1WOS A;  1R7I A;  2ZM6 F;  1FRH A;  4LR9 A;  4B9L A;  2DD8 S;  1HD1 A;  1RYS A;  1C0T B;  1RU2 A;  2GGP A;  2QFI A;  2JLF A;  1HR0 F;  1B99 A;  3W61 A;  2YTC A;  3WC0 A;  3KOA A;  2VQF J;  1OWX A;  2I1R A;  4DL2 A;  2MDA A;  1A9N B;  5HI7 A;  1N48 A;  3KJV B;  2HVZ A;  5C25 B;  1M1G A;  1P27 B;  5J2Q B;  4HTI A;  1TL7 B;  1FRM A;  2I5J A;  3MD3 A;  2CQI A;  1DZ5 A;  2RIJ A;  1C1B A;  5B0F A;  4CNY A;  2NQP A;  4EGL A;  2IM0 A;  3TYT A;  1C0U A;  2NXC A;  3OLB A;  2WTF A;  3PW5 A;  4ZP6 A;  2XMM A;  2HNZ B;  4P72 A;  3CNQ P;  2DGO A;  4DR3 F;  5B0A A;  3CCL S;  2FJX A;  3A3O B;  1FCA A;  3DGP B;  3HF5 A;  3I32 A;  1LNQ A;  2DGQ A;  4O3R A;  3M05 A;  3IGN A;  3FGV A;  1AYE A;  2R8G A;  3E2E A;  3SQO P;  2CQG A;  4TXS A;  3PXG a;  3MR3 A;  5KG5 A;  3IRX B;  2BJD A;  3LAL A;  4JB8 B;  4MH8 A;  3HI9 A;  2X1F A;  1EIY B;  1Y4Z B;  4U7U K;  3AOA A;  2ZEJ A;  3CTR A;  1S6P B;  4C0H A;  4B3O A;  4K4W A;  4GKK J;  1T3N A;  2OJ3 A;  3QLH B;  3VWS A;  1HQE B;  5HAN A;  3SQG B;  3TJ9 A;  1X5P A;  4DR5 F;  4N56 A;  5G4D A;  3RZA A;  5KFS A;  4DL5 A;  1LWC B;  5KG1 A;  4DFJ A;  1LWE A;  2Y3Y A;  2J0S D;  4DWI A;  4TVA B;  4C3L A;  2FHJ D;  5HP1 A;  3CD5 A;  3I82 A;  4JI8 F;  2ZWP A;  4DFP A;  3BSC A;  1S99 A;  1Z1Z A;  4LIR A;  2DVI A;  1RT5 B;  2X1A A;  2WVE A;  4A48 A;  2KVI A;  2L08 A;  5J1P A;  2VQE F;  1NJY A;  2BE7 D;  2W9C A;  1HWU A;  4TLR A;  1LEO A;  3TUJ C;  1FRK A;  1OY9 A;  2V67 A;  2AJ2 A;  3GYN A;  1U0H B;  3POT A;  2OD4 A;  2GIQ A;  2QA4 S;  3N6L A;  2Y8W A;  4MKV A;  1TVR A;  1XR7 A;  3GB0 A;  2LQ5 A;  5KFL A;  3OUY A;  3QSI A;  2ZFH A;  3B4D A;  1X8D A;  5HVH A;  3MMA A;  1ZS6 A;  5HAO A;  4RUH A;  2RQC A;  1FTR A;  4NYO A;  4G3I A;  1F5C A;  1DQ8 A;  4MIA A;  3D1O A;  4CRJ A;  4NZ7 A;  3QJL A;  4OYX A;  1KVI A;  2R7W A;  2BJE A;  3M32 A;  1X60 A;  3CMQ A;  2DGS A;  2D7S A;  2NXU A;  4J9Q A;  1HNV B;  1FFS B;  1NH7 A;  4X66 F;  2OTL S;  3R8Y A;  3W7B A;  2QT7 A;  5KFP A;  3DXB A;  2KVQ E;  2BDP A;  2ZHB A;  4GKJ J;  2XMW A;  5E0O A;  4CLY A;  5IWA J;  3OHB A;  5GME A;  4G1I A;  1WD6 A;  4DLG A;  4CQ1 A;  2J7U A;  4R0E A;  5KAK A;  1UEU A;  2HVH A;  2KRB A;  4CT9 A;  4PUO B;  2W8K A;  2C2O B;  2HHU A;  1TV6 A;  1HNI B;  1DTT A;  4FZV A;  4EYI B;  4K4Y A;  1VRT B;  2EKY A;  1U6B A;  2P8I A;  3MM5 B;  3PEH A;  4E98 A;  2J0X A;  1SVD A;  1HNW F;  2RQK A;  5DG8 A;  1YZ7 A;  4F67 A;  5LMU F;  2BM1 A;  2RRN A;  4U6P A;  1BD6 A;  1WEL A;  4X64 F;  2ACY A;  2LEC A;  3W60 A;  5D4P A;  2EPI A;  1N36 F;  3ZO7 A;  2EW9 A;  3K17 A;  2A2D A;  5J2N A;  3FEZ A;  5L1J A;  1APS A;  4Y2A A;  4ECY A;  1WSV A;  2ATL A;  5ETS A;  3EX7 B;  1JB0 C;  2CZ4 A;  4C0B A;  1FRL A;  4UZB A;  2AX0 A;  1WSR A;  4ZMM A;  5LMN F;  2DNG A;  1VIX A;  3FNN A;  2YKP A;  2XB2 D;  3GIM A;  3N5B A;  4URS A;  2O5D A;  4CLP A;  1FJC A;  1JLB A;  2Z30 B;  4F8R A;  4ED2 A;  4CH1 A;  4CLL A;  4PXB A;  2JVR A;  3H4D A;  3H2V E;  4ALZ A;  4OX9 F;  1I3O B;  3NKY A;  4IO1 A;  2W2N P;  3LAM A;  3I5A A;  2VPZ B;  3HVA A;  2MZQ A;  3HD1 A;  1FWP A;  3BV8 A;  4RWW A;  2OMO A;  3QYY A;  4LF9 F;  4KHP F;  2BQU A;  3L95 X;  2MZJ A;  1RTI A;  5DDQ C;  4LF7 F;  2CQ0 A;  3R9L A;  1FT8 A;  4KPC A;  2XCP A;  4JYA F;  4NOH A;  2HRY A;  2YKQ A;  3D0H E;  3OSN A;  1YKW A;  2D74 B;  5KT4 A;  1LFP A;  3JQJ A;  4QYR A;  5IV4 A;  4OZ0 A;  1B64 A;  3EVM A;  2MHN A;  3AXK A;  3HM9 A;  4KO0 A;  5EDW A;  2CWK A;  1NKE A;  1KTQ A;  4YME A;  1UJ5 A;  3H42 A;  3ZZP A;  2NXJ A;  5KT5 A;  4N7T A;  2WVC A;  3CCT A;  3UN5 A;  2MYF A;  4CTA A;  3GE9 A;  2MKI A;  5HJX A;  4CLT A;  2IFX A;  3KDO A;  4W98 A;  3R2D J;  4Z7C A;  2KYX A;  4B3R J;  3LP1 B;  3OFE A;  3KK1 A;  2VV5 A;  3AXM A;  4P71 A;  3G82 B;  2RS8 A;  4EYH B;  3HZG A;  2F4F A;  2AIR B;  1CC8 A;  2V4J A;  3N4W A;  2CPX A;  4LRE A;  1Q81 T;  3FBE A;  1RAO A;  2C3Y A;  4NZ0 A;  2HFO A;  1HD0 A;  4C11 A;  1RCX B;  4DCJ B;  1T95 A;  3I31 A;  1CJU A;  4M5M A;  5L8R C;  3R97 A;  2VG7 A;  2PE8 A;  5B0D A;  5A6W A;  1HBN A;  4CO1 A;  1URN A;  2VQF F;  3IS9 B;  4X4O A;  2JSX A;  2QL7 B;  4RW6 B;  4H4O B;  4FF2 A;  4P10 A;  2LYV A;  2ADC A;  1KLM A;  5I3U A;  2HHV A;  3CJK B;  1YI2 S;  2DO4 A;  3J80 U;  1YZ6 A;  2J8A A;  4YEA A;  1AA1 B;  4WIQ A;  2QV6 A;  2G2O A;  2XTJ P;  4TQS A;  2Y0S D;  1HPZ A;  3KXD A;  4JP8 A;  4A47 A;  4IFY A;  4AND A;  3QPI A;  2BE2 A;  4I68 A;  2G2Y A;  4FPR A;  2CQP A;  5JXS A;  2Q6B A;  2WHO A;  2N3O A;  4IFV A;  4O3P A;  5DET A;  3HD2 A;  2Z2M A;  4WFN Q;  4DUZ J;  3P45 B;  1E6V B;  1M0S A;  2WON B;  3T6J A;  2JEG A;  3CC2 S;  2E29 A;  1QAI A;  2Z2L A;  3DRR A;  4ECU A;  1X5T A;  4UUW A;  1HWJ A;  2AJ4 A;  1SC6 A;  1EQM A;  2QG9 B;  5EWF A;  2V2K A;  4CDI A;  3MR6 A;  1IBK J;  3CO0 P;  3BPS P;  1Y00 A;  4FN5 A;  5IS2 A;  1T9Y A;  5HBM A;  1WAC A;  2HBZ B;  1HYS B;  1JJ4 A;  3H5X A;  1N6Q A;  1M5H A;  3CGI A;  4ED0 A;  3CIZ A;  1HHS A;  3NY0 A;  4QR1 A;  4IOC Q;  3NL0 A;  1U1N A;  2HK3 A;  4WKR A;  2IJF A;  3NGD A;  1TMM A;  2MKC A;  2YY3 A;  4DXL A;  1Y5N B;  3MMB A;  2VBY A;  5KG6 A;  5H1S V;  5G0R A;  2CDQ A;  4DV6 F;  1SJR A;  3LQV A;  4GKK F;  2O3D A;  3X3U A;  1R43 A;  1JXV A;  1RBO B;  3PKM A;  1Q8I A;  1JMT A;  3IO1 A;  4KKO A;  4BBY A;  4HAC A;  4EZ6 A;  1D8Z A;  4YB6 A;  4CLF A;  1NEE A;  4RZR A;  1F6T A;  4RBV A;  1HBM B;  1UKU A;  3NBP B;  5KFF A;  2XLI A;  1R8H A;  4I0W A;  3W2V A;  3UD4 P;  2E1P A;  3H0P A;  2IIH A;  3RR8 A;  2J9D E;  4OI6 A;  2CJX B;  1JLC B;  3BBC A;  4P2X A;  4P6Q A;  3NCQ A;  2KHD A;  4DR4 F;  5LJ5 Y;  1S72 S;  4JUZ A;  1F5B A;  2QZ8 A;  2L9D A;  1VIS A;  3LO3 A;  4RW9 A;  2YWK A;  3QRQ A;  1RK8 A;  2CPH A;  4ZHR A;  3BO4 A;  3OTO J;  3OR1 B;  1P9Q C;  2B6A A;  4X65 J;  4RW7 A;  1FDB A;  4AXJ A;  3ILL A;  3OVA A;  1KRP A;  4CIO A;  3GMG A;  2QO3 A;  1FTC A;  3LPE A;  3KLI B;  2HBR B;  2E9Z A;  5A8W B;  1IKW B;  1BMQ B;  4W4M A;  2ASJ A;  2M0G B;  3EZU A;  4P2M A;  4IQX A;  4DV5 J;  3J80 Y;  4DV3 J;  3EPI A;  1VQK S;  3MDF A;  3PZP A;  2W24 A;  5L9N A;  3CJ3 A;  5F8L A;  4RNF A;  2UU9 F;  4NRT A;  4CWB A;  4OFZ A;  1S1W B;  1HI0 P;  3JYT B;  3IM8 A;  3VVU A;  2XMV A;  2HIY A;  5GVQ A;  4FS1 A;  1TU0 B;  3H7H B;  1U2R A;  2LQ9 A;  4X62 J;  3NEK A;  4XK8 C;  4Q2M A;  1Y10 A;  1PAE X;  3MEK A;  1WC1 A;  1UZH A;  2RNE A;  3T6B A;  2VFV A;  2BX6 A;  1U1M A;  5K8N A;  4F4Y A;  1B0V A;  2EFO A;  1N54 B;  3HSZ A;  1HMV B;  4ZLP A;  3I9V 9;  3W9H A;  4L6V 3;  1GX6 A;  5CHC B;  5IWA F;  2AZ1 A;  2F40 A;  4DV4 J;  4Y2I A;  1IBC B;  3QGG A;  1N5T A;  4DF8 A;  4R8U A;  4ZLN A;  4Y2K A;  4DFM A;  4P2S A;  2J76 E;  2AEM A;  2CG4 A;  2WVF A;  4K7Q A;  3M6W A;  3W2W A;  2HRT A;  3ISN D;  5AE3 A;  2EI5 A;  2XY6 A;  2DGU A;  3DRS A;  2H4Y B;  4RNH A;  3MCM A;  3ET6 B;  2NLW A;  4QWC A;  5KOX A;  3D6H B;  2EG1 A;  5EN1 A;  4WKY A;  4ANE A;  1U02 A;  3V4M A;  3LH2 S;  2GV1 A;  3TZW A;  1IKY B;  2KJV A;  1X9M A;  2JH3 A;  2P9C A;  5KFA A;  2VOP A;  1VC6 A;  3T9N A;  1P1L A;  5EHH A;  4NLR A;  4DR6 J;  4IH6 A;  1FDN A;  1FX2 A;  2CZ9 A;  1VQP S;  3CXC R;  2G0J A;  1EKR A;  2XSJ B;  2V9K A;  2BJ7 A;  2GVD B;  2OHD A;  3HJF A;  3NWR A;  4HLB A;  5DZ7 A;  1PGZ A;  4ETZ A;  2V9W A;  2A3J A;  1X7V A;  5HMX A;  4U67 Q;  4KAI A;  2WB1 D;  1WEY A;  3R5B A;  1SI9 A;  3GYG A;  4KHR A;  2CVI A;  3QIP A;  2LKZ A;  2G4B A;  3OFH A;  4OZL A;  4YY3 J;  2I38 A;  2RE1 A;  2PD1 A;  2XS2 A;  4K4U A;  3IN5 A;  2RT3 A;  1N34 J;  4KH0 B;  2ZJQ Q;  5KG0 A;  2DH8 A;  1WWH A;  1WOP A;  4NLY A;  4JI2 J;  3JXO A;  1S57 A;  4GVB A;  4F4Z A;  1KR4 A;  2QYG A;  4BCA A;  4ILL A;  1N5Q A;  4Y00 A;  3MEG B;  1UAW A;  2KKH A;  3GP9 A;  5A8R A;  2VC1 A;  2LDY A;  1RAF B;  2W9B A;  2HZV A;  4DU8 A;  4KJI A;  3DXS X;  3KJF B;  4IG0 B;  3EWG A;  3MED B;  4ETX A;  3PHE A;  2HQD A;  2IJR A;  2B5J B;  2FC9 A;  4FXV A;  4EO6 A;  2OPQ A;  1TKX A;  2A10 A;  2DGW A;  3A8J A;  2QLW A;  1ZZN A;  2WSF C;  5LSL A;  2UV8 A;  5T7L B;  3FVY A;  5SZT A;  1QUV A;  1JLF A;  3TUZ C;  1VMB A;  5KG7 A;  4ECV A;  3CDA A;  4WP9 A;  5A0Y B;  4EUV A;  3GLJ A;  1FRJ A;  3B78 A;  4YHH J;  1RWM B;  2DHS A;  4B3R F;  2QLB B;  2AEJ A;  5KFE A;  4ID8 A;  4J9P A;  1P8G A;  4ZCI A;  1AT1 B;  3NGT A;  5DO2 A;  3DKD A;  4DJB A;  2FVS A;  2MZT A;  3L7P A;  4KIA A;  4DR2 J;  1UWB A;  2WBR A;  4ZVE A;  4OJH A;  4JI1 J;  5BYQ A;  1Q8B A;  3RU0 A;  1A7G E;  1RT4 A;  1PIL A;  3M2R B;  3DLK B;  4IG3 B;  4PWD B;  2DNR A;  3FZ2 A;  4ID5 A;  1IR1 A;  4F3M A;  4LIW A;  3ITH B;  4R5P A;  4QIE A;  5F41 A;  1W25 A;  3RB0 A;  3VGV A;  3EXY A;  3Q2S C;  4W92 B;  2HHH J;  2VOO A;  5EX3 A;  1NPK A;  4M5H A;  1F0X A;  1FEH A;  4ITS A;  1TL4 A;  1KN6 A;  3K8V A;  3QNW B;  3AQP A;  1WUU A;  3TW0 A;  2ZH1 A;  1TL5 A;  4DX8 H;  4ZVO B;  1NJX A;  1UWA A;  5IM0 A;  3IAM 9;  1NBE B;  3D9B A;  2NSB A;  5IQ6 A;  1RTD A;  1I94 J;  2MHE A;  4NXN J;  3RBE A;  2QRR A;  1JIH A;  3H5Y A;  2C2E A;  3MR2 A;  4DUZ F;  3H40 A;  4CH7 A;  2CWX A;  2H1Y A;  1WKK A;  3G9C A;  2OUG A;  3JTN A;  3MAQ A;  1YJV A;  3FMW A;  3JTP A;  2IAJ A;  2RF2 A;  3T5K A;  3ULH A;  1SC3 B;  1IBK F;  2QYC A;  2Z2Z A;  2M88 A;  5KFK A;  4MYT A;  3TZY A;  4F4W A;  3M6U A;  1S97 A;  3HHE A;  4HTJ A;  3GCW P;  5AT1 B;  3NRB A;  2CNN B;  1Q5Y A;  2Z4P A;  4ZLJ A;  1WHX A;  3TX8 A;  1KOH A;  4XPE A;  4J9L A;  4C3K A;  1NZ8 A;  2VH7 A;  1I6J A;  2K3I A;  3IAS 9;  1RA7 A;  2RH3 A;  3QAT A;  2RHQ B;  2KH9 A;  2CXE A;  3MTJ A;  1IKV A;  4X4S A;  3NOG A;  3O6Q A;  1RTJ B;  2MQP A;  2OPS A;  4MFB A;  4DX6 A;  4HT7 A;  1TL1 A;  2JC0 A;  1F2G A;  1S77 D;  2UXD J;  3C66 A;  1J5O B;  2MKJ A;  2KL8 A;  2MJU A;  3FDS A;  1FJE B;  2AYG A;  2UV8 G;  3V6D B;  3TAM B;  4CO5 A;  3M8Q A;  2XMT A;  3DLL Q;  3CSK A;  1SV5 A;  2HVI A;  4FNI A;  2DR8 A;  3DDK A;  4RUA A;  4EO8 A;  2QA4 G;  2FHM A;  3NAI A;  4DV7 J;  2NUU G;  4OX6 A;  2CG8 A;  1CUL B;  4ES3 A;  1JLG A;  1S6Q B;  1KC8 T;  2YNI B;  4OI1 A;  2RML A;  2BRK A;  3PYG A;  3UDC A;  4C7Q A;  3OL9 A;  3R3T A;  1V5V A;  3GG0 A;  1F9E B;  3MAH A;  4IYQ A;  3MUV P;  2HS4 A;  1SPB P;  4ZCM A;  3Q0A A;  4KGX B;  2IDL A;  4OHV A;  3LWM A;  3PEJ A;  3MEE A;  1BE4 A;  1RWK B;  2O1P A;  1VQ4 S;  3CCW A;  3CWJ A;  1BHN A;  3DRX A;  2KFY A;  3PY8 A;  3OTO F;  2HW3 A;  1YRU A;  2XHC A;  2UUC J;  1EET A;  1KTV A;  1A0O B;  3H8Y A;  4HH1 A;  4DUY J;  2B9W A;  1CQN A;  4KT0 C;  3WX4 A;  5D15 A;  2C2R A;  2OPP B;  1RT6 B;  1Y3K A;  2HS3 A;  2NZ4 A;  2UVW A;  3I0S B;  4WF9 Q;  2XSF A;  2NSC A;  2C22 A;  4DV5 F;  4PRF A;  4E2F B;  1WC6 A;  4B17 A;  5D3G B;  1YIJ S;  1L3T A;  3F73 A;  3ENQ A;  2VBX A;  3E8O A;  4MMO A;  3L09 A;  2M9K A;  2ZH6 A;  2EFP A;  4X62 F;  4FKY A;  2G1H A;  1ZH5 A;  1VRU B;  2R42 A;  1DLO B;  4CO2 A;  3CJR A;  1YHQ S;  3Q22 A;  3CMA S;  4TYB A;  2WBM A;  1OS5 A;  7FDR A;  1HW8 A;  3F56 A;  3OTE A;  3K5M A;  3K5N A;  2QLF B;  2AYE A;  3FBF A;  2MPU A;  1BQN A;  1SB6 A;  1YBT A;  3DYA B;  4DV4 F;  1U26 A;  2HND B;  2LXU A;  1XBW A;  1WOR A;  5L9X A;  4LFA J;  2YX1 A;  2VBZ A;  4ZN3 A;  1NDL A;  4YFU A;  4NAS A;  1XN9 A;  4NX9 A;  3HSJ A;  2F3J A;  2QN6 B;  2MMY A;  2RD5 C;  2ROE A;  3GV8 B;  1RHM B;  4OI3 A;  4UQG A;  4K2X A;  2QL5 B;  2NRE A;  1QAX A;  1UW9 A;  5BR8 J;  4URQ U;  5BYR A;  3VAL A;  3K57 A;  5H9F K;  5KFZ A;  1UCN A;  2BR0 A;  1WF0 A;  2VFU A;  2OPR B;  4ZPW R;  4KTQ A;  1GMU A;  3AAW B;  2DIT A;  1S9F A;  1U8S A;  2ZH9 A;  3DLE A;  1YVF A;  1S9E A;  4RU9 A;  2F9J A;  2D9P A;  3FCV A;  3CUL A;  4MJK A;  4YR3 A;  2DY9 A;  3MTK A;  4USM A;  4EK2 A;  2N3L A;  1TL3 A;  1RT1 B;  4QJV A;  1S10 A;  3RW6 A;  3C15 B;  4DR6 F;  4O4R A;  2GMH A;  1HQU A;  3W5Z A;  1KWM A;  2HPU A;  3IWN C;  3SXL A;  2VAS A;  1TTH B;  4BLG A;  5HAT A;  3KK3 B;  2WCX A;  1R89 A;  2MGZ A;  2FZG B;  2HWH A;  5L1I A;  3P96 A;  1WI8 A;  2WZ1 A;  1L3S A;  2GIF A;  3V6H A;  4WYW A;  1X31 C;  3G86 A;  1Q5V A;  3CJ5 A;  4X2B A;  4ATN A;  5F3T A;  3LUY A;  3A8K A;  5IFM A;  3M8W A;  2JDJ A;  4I2Q A;  4JV2 A;  3VAI A;  2YKN B;  4YY3 F;  1FRX A;  1TK8 A;  1X0P A;  1JNR B;  4ED5 A;  1N34 F;  2GHP A;  3V6K A;  2QJ3 A;  2FJB B;  4JI2 F;  2Y1L B;  1JQG A;  4QIW D;  2I6W A;  2AJ0 A;  4FS2 A;  1S9G A;  2B4P A;  1H98 A;  3M1V B;  1NME B;  3UN3 A;  3CCS S;  3FQK A;  4J91 A;  1FO1 A;  4I1T A;  2FYX A;  1JXL A;  1TKZ B;  1IWA A;  2YX4 A;  1OSC A;  3DC2 A;  5DGB A;  3D28 A;  4LF5 J;  3ZTO A;  3SDE A;  2GHV C;  2PA8 D;  1VQY A;  2XEX A;  4M5L A;  2JX2 A;  1TK5 A;  3D6T B;  3Q8Q B;  3RYL A;  2CPZ A;  2H65 B;  3BDE A;  3C6U B;  1DAR A;  5GAG I;  1CJK B;  3MEC B;  1N8R T;  1RGV A;  4DN9 A;  2KXN B;  2HSE B;  2F9D A;  4NEY A;  1UVL A;  2BQ3 A;  1YJ7 A;  2DGX A;  5CH7 B;  3LGM A;  4WP3 A;  2RDJ A;  1Q82 T;  2R8I A;  2MZ1 A;  1CJT A;  3CD0 A;  4JI0 J;  2B4U A;  1RT3 B;  3MCO A;  3MGJ A;  4G1Q A;  4ZPD A;  4OYP A;  2IM1 A;  4MYU A;  5F3Z A;  4LBI A;  5E5N A;  1AUD A;  4CNZ A;  4YN3 B;  1HI1 A;  2HHQ A;  3FRY A;  3UCG A;  3KJN B;  4DR2 F;  4TY8 B;  4Y2M A;  4J9V A;  1SH2 A;  1J27 A;  4JI1 F;  3CCM S;  2LVW A;  1LW2 A;  1F2H A;  4PG4 A;  3D1H A;  2FHK A;  4FYY B;  4K5R A;  2YNH B;  2ACM A;  1G6B A;  1S7I A;  4WCE Q;  2FJW A;  3G6X A;  1BQM A;  1RZM A;  3ZZT A;  1UFW A;  3KFW X;  3RAM A;  3AY0 A;  4JV5 F;  1K44 A;  2HHH F;  1S1T A;  4AL7 A;  1YDL A;  1GH8 A;  1PJ7 A;  1RHQ B;  3UCZ P;  3PKY A;  2JL9 A;  3FFI B;  2DNH A;  3QO9 B;  4YB5 A;  4L72 B;  2XC9 A;  3DOL A;  3DRP B;  3U7J A;  2DYA A;  1XMQ J;  5HJY A;  4PAA A;  1RQ0 A;  4DG1 A;  2J9D A;  2XO6 A;  3B54 A;  2BAC A;  1RYR A;  1TEL A;  2M4M A;  4NXN F;  2Y0B B;  3C6T A;  2NXN A;  2QEX S;  1S1U A;  4F50 A;  1PG5 B;  1NK9 A;  2NCK L;  1TKT B;  3LTO A;  3CDW A;  3HLU A;  1JKH B;  2NXE A;  1Q53 A;  1RHR B;  1XIQ A;  3HFK A;  4M5J A;  2Y1J A;  4DL0 C;  4H4M B;  3EJM A;  1FD8 A;  4O0I A;  4QU7 A;  3KLG A;  1IKX A;  3SV4 A;  1TP7 A;  4NE9 C;  4OYW A;  2BUN A;  3E01 B;  2ILZ A;  1Q8K A;  3ZFV A;  2GIR A;  4OZ5 A;  1HL6 A;  4TU8 A;  4LR7 A;  2LP4 A;  2X7I A;  4B3T J;  4PYA A;  3DI6 A;  3TNV A;  1SIW B;  1TZ0 A;  2AYM A;  3KLE B;  4LFC J;  2AKW B;  1NKC A;  2YVS A;  1IR0 A;  3BO3 A;  4CYU A;  2R7S A;  2GX8 A;  1R0A B;  2UXD F;  5KFT A;  4K50 A;  3DLG A;  1HBO A;  1WTF A;  3VAF A;  5HRO A;  2GW8 A;  1U6F A;  1FDA A;  4DV7 F;  1W26 A;  3M2U B;  5H9F J;  1ZTT A;  1LWF B;  3MOZ A;  2WVB A;  1XK8 A;  4PZV A;  2DRB A;  3PNI A;  2LFV A;  3FUY A;  4AYB D;  5K8O A;  1F9F A;  3JSM B;  2WB4 A;  1YJR A;  3LP2 A;  2DNP A;  4ZPV R;  4P75 A;  3GJS B;  1Y5I B;  4CLK A;  1H73 A;  4IRC A;  4FF3 A;  1BLU A;  2HNY B;  8ATC B;  4FP9 A;  5CCL A;  3IBW A;  3CUN A;  1FNO A;  3BKF A;  4MK9 A;  5U47 A;  1HI8 A;  5ETT A;  1N5Y B;  3LOU A;  4PR6 A;  2H9Z A;  1RWP B;  2UUC F;  4K4T A;  5GAE U;  4DUY F;  3UVJ A;  1RT7 A;  2KO1 A;  1SL0 A;  1N5V A;  2CIM A;  2XMU A;  3G6V A;  2HS0 A;  3A3N B;  3DDI A;  2FGC A;  4IR1 A;  4NCA A;  1KOO A;  1T8E A;  3H90 A;  2DNO A;  2V50 A;  1WF1 A;  5C24 B;  1ZET A;  3O8W A;  4E0D A;  2D41 A;  2CQ3 A;  2FTR A;  3BYR A;  3TP2 A;  1VQL S;  1X5O A;  2MKY A;  3CCQ S;  3PRD A;  3Q8U A;  4NRU A;  1NK8 A;  5L1K A;  3OVB A;  2IHR 1;  3TI0 A;  1R27 B;  2QLX A;  1VS3 A;  3C16 B;  2R7R A;  5CD4 H;  4NCG A;  1WJ9 A;  5F8N A;  5HMZ A;  2ZWO A;  3V6J A;  3VAM A;  5CYJ A;  2HQ3 A;  2OTJ S;  1X4E A;  4MKY A;  1GXU A;  1S1X B;  1IBL J;  1DJ0 A;  1RTH B;  1SCJ B;  3GJQ B;  5I4M A;  3W9I A;  2HQG A;  3CJS A;  1R6Y A;  1WHV A;  5C42 B;  2F8M A;  4RW8 A;  4L3N A;  1V6H A;  5ETR A;  3U1N A;  4DR1 J;  4LFA F;  3QQC D;  3WQP A;  1HR0 J;  2VC0 A;  3QFW A;  1FJG F;  4ILR A;  1EHW A;  2AYB A;  4ZIV A;  2PI4 A;  4LFB F;  4Q7A A;  2LXF A;  3MAA B;  3MD1 A;  2K3K A;  4O44 A;  3CVK A;  5I42 A;  1U25 A;  4KFB A;  5LL6 d;  3ENA A;  4F3Q A;  1QVF R;  3R5C A;  2ZHO A;  2V2Z A;  1VQ9 S;  4Y6I A;  4WTY A;  3DN9 A;  1PJ6 A;  1M5O C;  4DS5 A;  2BEF A;  4USK A;  1T0T V;  4NXM F;  4I2P A;  2BW2 A;  4QIG A;  4RW4 B;  4ZVF A;  1ZYQ A;  5HVF A;  3DDN A;  2K1R B;  2CNL B;  3UPF A;  4YDX A;  1NK5 A;  1L3K A;  2E7V A;  2DRD A;  3FMB A;  2FJA B;  3HHN B;  2RKI A;  3OTC A;  5K8M A;  3EZ5 A;  2FVR A;  3TJA A;  3T5J A;  3DM2 A;  2ZH7 A;  4JV0 A;  4PYD A;  4OHZ A;  4DR3 J;  2NUH A;  4U8Y A;  1MMN A;  1X4B A;  5KFV A;  3W8G A;  4HHH A;  2HWI A;  2AD9 A;  4I64 A;  2ZD1 B;  3HUL A;  2OEL A;  4O3Q A;  3OT9 A;  3FEX B;  3PM9 A;  5KTQ A;  3Q8R B;  3HFV A;  4BS2 A;  2LQB A;  2JZ5 A;  2BAN B;  2EK6 A;  3CJ2 A;  1RA6 A;  1S5Z A;  3CDB A;  3K7R A;  1FXR A;  2BKN A;  4OMF G;  4DCO B;  3OL7 A;  3SCJ E;  3LAN A;  4QWE A;  3UDL A;  5F9L A;  3MM6 A;  3VV2 B;  3PJW A;  3KG0 A;  3ETM A;  2HBY B;  5F8H A;  3UNY A;  3PYF A;  4GMK A;  3KLF B;  3P6Y C;  1AFJ A;  1DRZ A;  2MQL A;  3O5T B;  3HZE A;  1VQ5 S;  2PEH A;  1E6Y B;  2VPY B;  5FDL B;  3OFF A;  3CJT A;  3EVW A;  2R2U A;  1RSC A;  3T1H J;  4C8N A;  1UPM B;  3I55 S;  1X4A A;  2RRB A;  2FDN A;  5D0R A;  3Q86 A;  2CJB A;  3MCS A;  2HHP A;  1UPP A;  3V2U C;  2C42 A;  2M8H A;  2OEK A;  2V6A A;  1H3D A;  2VQE J;  1FER A;  1SH3 A;  2DY1 A;  2X1G A;  2ZDO A;  4PXC A;  4UQT A;  2FD2 A;  3N9U C;  2QMU B;  3A8I A;  3GTY X;  3V4I B;  4JI0 F;  1DFD A;  4JI3 J;  4A8Q A;  2GHW A;  1VBZ A;  3Q8Y A;  5CYQ A;  3OTD A;  2BAB A;  4TQR A;  4OV6 A;  1V3S A;  5DM7 Q;  4C0O C;  4PKD B;  3MPU B;  1CS4 A;  4D3H A;  2VOD A;  3QGH A;  2DR6 A;  3W1Y C;  3GWC A;  5AE2 A;  2VON A;  3CJ4 A;  4NMX A;  2XI3 A;  4O4G A;  1VQS A;  5HL7 Q;  4ICL A;  3QIP B;  2BYC A;  2C2N A;  3D0G E;  2A1B A;  3M8P A;  1S4E A;  1VQN S;  3D4J A;  5HN0 A;  1GT8 A;  2CJQ A;  1U48 A;  3T5L A;  1OMS A;  1FHT A;  1Y7P A;  4FKX A;  1DQ9 A;  4ES2 A;  3AA9 A;  2EWH A;  4P7T A;  4S0M A;  2Y8Y A;  4LT6 A;  4GVB B;  1QUP A;  2B4V A;  1UVJ A;  2BBE A;  2GO9 A;  1VBX A;  5AXN A;  1NJW A;  3NCR A;  2OEJ A;  3QT6 A;  2W1B A;  3BGO P;  3TRG A;  3PV8 A;  4F0K A;  3IP0 A;  3SMZ A;  1NRK A;  1SJ1 A;  5ETP A;  4OI4 A;  1C0T A;  2CNK B;  4Y0F A;  1GNK A;  4NWB A;  3I56 S;  3VHQ A;  1CVJ A;  3DNC A;  1XMQ F;  2I2Y A;  2AWZ A;  4AXI A;  1U0S A;  4WFX A;  2JNJ A;  4MK8 A;  1Z2L A;  2KU7 A;  1PAU B;  1ZOT A;  3HSD A;  1MRO B;  1RJJ A;  2VA3 A;  1RAE B;  2IMO A;  4MK7 A;  2H51 B;  3KJV A;  1HNW J;  2FJD B;  5C25 A;  3PR4 A;  4Z37 A;  4MIB A;  1VLY A;  2C2D A;  3GU0 A;  5J2Q A;  4B9M A;  4LSZ B;  2POK A;  2W25 A;  3D0I E;  1HIY A;  2XG8 A;  1X4H A;  3EXC X;  1TL7 A;  3CJQ A;  4Q43 A;  3SI8 A;  1HNX F;  1N36 J;  3H98 A;  3Q2T C;  1SJF A;  4HH0 A;  1Q4R A;  4LR8 A;  1BWV A;  3AD9 C;  2DEI A;  3TX0 A;  1XR5 A;  2RIL A;  2HNZ A;  3RRG A;  1FKP B;  4B3T F;  4AQY J;  1JLE B;  2HYI B;  5IC4 B;  2DT9 A;  4LFC F;  2KTQ A;  4OJ3 A;  1FE0 A;  2DGT A;  3TJ8 A;  5LMN J;  4JBC A;  4HHJ A;  3DGP A;  1TMJ A;  1S79 A;  5IOL A;  3JB9 k;  2ZHA A;  4I6A A;  4HR2 A;  5A8K B;  3RBX A;  4CM0 A;  3WBZ A;  3M2V B;  4LSN B;  2A2C A;  1VDH A;  3QJP A;  3GSI A;  3M30 B;  4OIX A;  2HLT A;  3GIJ A;  3C46 A;  4DX5 A;  1V9O A;  3N0V A;  5AXL A;  2XO7 A;  1WHY A;  5D6G A;  2GS8 A;  1R8C A;  1REV B;  2J6T A;  2FY1 A;  5IV3 A;  3BR9 A;  2XY7 A;  2HMI B;  3IRX A;  3HSG A;  1ZA2 B;  2YNG B;  3KK2 B;  2KFN A;  4JV1 A;  3HXM A;  5H9E K;  2DCL A;  4LF9 J;  2EFG A;  2ZE2 B;  4KHP J;  3TWZ A;  1S6P A;  1GXT A;  3BZQ A;  2CYY A;  4OLO A;  2XY5 A;  2DHX A;  5K14 B;  3QLH A;  3CE8 A;  1HQE A;  1SIZ A;  3SQG A;  3IG1 B;  1U1P A;  4KR0 B;  3W3S A;  3LP0 B;  2IVM A; 
#chains in the Genus database with same CATH homology
 2VIH A;  2A6M A;  2FYX A;  2VIC A;  4ER8 A;  2EC2 A;  2A6O A;  2XQC A;  2XMA A;  2XO6 A;  2VHG A;  2F5G A;  2VJU A;  2VJV A;  2F4F A;  2XM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...