2XO6A

Deinococcus radiodurans isdra2 transposase y132f mutant complexed with left end recognition and cleavage site
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
PLEMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKFIESQHDKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords TRANSPOSASE
publication title DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 34
structure length 134
sequence length 134
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01797 Y1_Tnp Transposase IS200 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Transposase IS200-like 2xo6A00
2A6OA 2FYXA 2VHGA 2XMAA 2A6MA 2F5GA 2XM3A 2XO6A 4ER8A 2VICA 2VIHA 2XQCA 2VJUA 2VJVA 2F4FA 2EC2A
chains in the Genus database with same CATH superfamily
1GXLA 3H5YA 4DL0C 2BKNA 4WZMA 3GP9A 2JEIA 3G6YA 2UUAJ 3BGOP 4TXSA 4DV4J 3GWCA 4JI8J 3L9ZA 1UVMA 2UVRA 1PJ7A 2LDYA 2OI2A 1UPPA 4DU8A 2WTFA 1WTFA 2BMBA 3E01B 3W61A 3CVKA 1VQSA 1S77D 5D6GA 4M8LA 4ZPWR 4RNFA 2J0SD 1D8ZA 2X1FA 1NDLA 3ONQA 5A8KB 3G6VA 1C2PA 1IJEB 4F36A 2RT3A 1FNMA 3PHTA 1LWCA 2HGLA 1K0TA 1NB2A 4RW8B 1S72S 3KUEA 2KM8C 4ZPVR 3QJPA 3FEXB 3OFFA 5BYSA 1VRUB 1G3OA 2ZC3A 1QM9A 4RW6A 1U1OA 3PIPQ 5L9XA 3TUJC 4OX9J 2H65B 2OFHX 4PWUA 4RW4A 4I69A 4XPEA 3IN5A 2LP4A 3DDIA 2KDOA 4RU2A 3VZIA 2VICA 3DLKB 2QSFA 5KG7A 2R7VA 2OUGA 5L38A 1F5CA 3TI0A 2PI4A 2MDAA 1N32J 2NSBA 3PEHA 2HVDA 5CCLA 1FWLA 1RB0A 1MG7A 2CPYA 3IGVA 1CJUA 2KKHA 3R5DA 4M5JA 4CI0B 3M7VA 3QRQA 4CLLA 1XIQA 2R2RA 2JLEA 2GJIA 3BF4A 1S9EB 2BRLA 4FF1A 3PKMA 1RTHA 1TL7B 2CDQA 2FTRA 2YNIB 3M05A 1TUVA 1N36F 2B43A 2C2EA 1DQ9A 1RTIB 5D0GA 2E1AA 3I56S 2QX0A 2V9WA 2RS2A 4PG6A 4DQIA 3HKWA 2OPPA 4F26A 1L3SA 3QGPA 2ZBRA 4M94A 1KP6A 5DDRC 1N5YA 1TAQA 4DL3A 1NDCA 3DGPA 3GQCA 2M2BA 1IKXA 1ULRA 3FZBA 1WD6A 3CJ3A 4USMA 2XO6A 4N8OA 3D0GE 1OSDA 1SC1B 2VKZG 1REVA 3QBCA 3I4PA 2M52A 4KAIA 3M1VA 1JLGA 4OZNA 3MEDA 1SJ4P 2M8DB 3D1HA 4K4ZA 3FSIA 2KM8B 3JQMA 4LSZB 4KGKA 4AL6A 1X8DA 2Q79A 1SKSA 3K8WA 1MN7A 2UUTA 3BM7A 3PY8A 3OQ2A 3M30B 2W8LA 3BGLA 3B78A 1RTIA 2ZOFA 2DO4A 3KHHA 4K8RA 3W3SA 4ID5B 3D3CJ 4YEAA 5ETKA 1EIYB 4Z37A 4NEZA 1JWWA 3HJVA 3KG4A 1T9WA 2YKMB 4PABA 4WF9Q 3DFEA 2EK6A 2F4VF 1UEUA 4FYWB 4U95A 2C28A 4F67A 1PO6A 1I6JA 4NOHA 2IY5B 3UCUP 3CMQA 2GMHA 2UXDJ 3SMZA 3R6GB 1RHUB 2LDIA 5EHHA 5HBMB 4GVLA 1ZTWA 1PBUA 4DR3F 2CVIA 3CF5Q 2WRMA 2GFFA 4CLUA 5JUMA 1UTAA 2HRTA 5GAGU 5FLXU 3QZ7A 2GS8A 1RTJA 4NWBA 2W8KA 2ZWOA 4WU3A 4WK1A 1GEHA 3EE3A 2FDNA 3ZFVA 2HFUA 3AXMA 4C4WA 4ICLB 3HVTB 1BMQB 2DNZA 2HYIB 3CPWR 2XNQA 2Z58B 5THWA 3KJQB 3ICLA 2VG6B 1RT1B 2AGQA 4YN3B 2KN4A 1FA0A 2DD8S 1SL0A 5EX0A 3KMQA 3J80Y 1HYSB 4P6QA 2ALZA 3KJVB 4OJGA 4K4WA 3T1YJ 1FE4A 5CZVA 2ROEA 2B51A 4A8SA 1YBTA 1NJZA 3US5A 2DY9A 2I5JB 2RF2B 3HD2A 4NZ7A 3NMAA 2RH3A 2VFRA 2Y1IA 3VALA 3SZ2A 1MU2A 2GHPA 3I87A 2R8IA 3TUIC 2Y1RI 4K4YA 1HNXF 3BKTA 3QFWA 1Y9OA 1UFLA 2OMLA 4GKJF 3DLBA 1M5OC 3GYNA 5C25A 5IT4A 1WC1A 1U24A 2KXHA 3MECA 4I2QB 1UA1A 4NZ6A 2RD5C 1RK8A 5E41A 1XJWB 2FZKB 3AA8A 3OVAA 3CJ8A 1GMWD 1JMTA 3C6UB 5EGYA 1S5ZA 5E7OB 2OPSB 3Q24A 1S1UA 2FYXA 4UT4A 1QE1B 2CWXA 2V9KA 1LWEB 5EWGA 2K7KA 3OD2A 2K06A 1FX2A 3DRPB 2GQ2A 1WC0A 1S49A 3QO9B 1YZ7A 3LPYA 2GVZB 5L1LA 4QIVA 2DY1A 4MAKA 4ZP8A 4C8MA 4RW7B 4IO9Q 1CQMA 2VUGA 1R8BA 1Y3JA 8ATCB 2R7SA 2CQ2A 4ZVTB 3PJXA 2VJUA 2XMJA 1IBMJ 2R7RA 5CZXA 2XULA 4L3KA 1EARA 2P2CB 3EGWB 2IVFB 2C1EB 4KJIA 4AQYF 3K7RA 5AE1A 4RO0A 4TLRA 2QFIA 4AYBD 4QW8A 1S12A 3RAQA 2H54B 2CPXA 2EBGA 1EETA 3MUMP 3RR7A 1GMUA 4U96A 4CO4A 2Z56B 2ZWPA 2NLWA 3NGKA 5IC4B 1VRTB 4B9MA 4FF2A 2OSRA 2MJUA 3BH6B 4TVAB 1UW9A 2ROGA 3OXLA 5J2QB 1Q5VA 4TN2A 2IRUA 3CD0A 1HNIA 4V19X 2AJ4A 4X4RA 2CPHA 1HIYA 4ZIVA 1AZSB 5KFZA 4WYWA 2EEYA 2GMLA 1Y10A 5U47A 2APOA 3B6BA 3ZXWA 1WG5A 3MAHA 3PW2A 3LAMA 2F8HA 3TEGA 5CXTA 1RCOB 4ANDA 3BGRA 4LQ9A 3GG0A 1NXIA 1S1XA 1RT4A 1NCLA 4WPAA 1NH7A 4DJBA 1TK8A 4CLYA 1RHRB 4OI4A 1KTVA 5DETA 2WSEC 4PXEA 2E1PA 3UPFA 5B0AA 4P9SA 1S6PB 4RW9A 3H5XA 3FQKA 3GR0A 4C8NA 3UVJA 1N36J 3M32B 4F4XA 1KHVA 1Q8LA 2D1CA 4Z2XA 4W92B 5B0CA 2C42A 1N5TA 5LOQA 5DG7A 2NCKL 3PVXA 1A9NB 2HK2A 3CXCR 3MMCA 2XMWA 1VQNS 1U4BA 3QLHB 1NK5A 1XBWA 3GYXB 4N7TA 5L39A 2DRDA 2EWHA 2HG4A 3ZZOA 1VQOS 4KPYA 1HWUA 2RU3A 4N77A 3CCSS 5DDOC 5B0DA 1RT3B 3SFUA 4QIFA 1SJ3P 4NZ0A 2IDEA 2VA2A 2DIUA 2YX7A 3CCZA 1RHMB 1PCAA 4O44A 5AE2A 2ZBPA 3OJUA 2L48A 4WK3A 5HVHA 2RIJA 1RHJB 5C2GA 3T1AA 3W2WA 2XLKA 1P9YA 3FCWA 3DOMA 4EEYA 1AUDA 1OY8A 3MEGA 1JXEA 4OHYA 3CJKA 4ED1A 4NLXA 3LO3A 1OS5A 1SH3A 3RZAA 3MCNA 1RDRA 2JLGA 3T5JA 1GXTA 4NXNF 1F6TA 2FPHX 1X4BA 1WI8A 4F50A 4HH0A 2X3GA 2QYCA 2CIMA 5KFFA 2WVDA 4ILMA 2HNZA 5K8PA 1S6OA 1UVJA 1UW4A 3BSNA 2EKNA 2HFZA 5AT1B 1WOSA 4DF4A 3QLHA 2F4VJ 2WVBA 4HHJA 4RX6A 4K59A 1PJ5A 2DXEA 4DV1F 2DGXA 4M5DA 3PTWA 4H4KC 3MM7A 1D9DA 2JFDA 4FNIA 3GONA 2XMMA 1FRXA 2E5JA 3AH6A 2VZ9A 3PR4A 1X7VA 1Q8BA 4G65A 1FRHA 3PO4A 3V6DA 3MCSA 5KFOA 3PW5A 3PX4A 2YXLA 4WP9A 5DRKA 3ZTOA 1T3OA 2X1AA 4TLQA 1EHWA 3KLHB 4DX6A 2G2OA 4DPOA 4NA2A 3MD1A 5LL6d 3GCWP 4ZVHA 3J7Z5 2A18A 2XS7A 1JLAA 3UFCX 3FGVA 4UUWA 1LEOA 2BW7A 1P6TA 3B4MA 3KJFB 3U1NA 2G1DA 1Q78A 2V6AA 2DH8A 4Y65A 3KK1B 3KDOA 1WDDA 3PRBA 1TKZB 3OHBA 4HT5A 2HKEA 3VWSA 3HT3A 1YITS 2A1BA 2V68A 5C7PA 1MWYA 3C15A 2F40A 3OFEA 3RJMB 3P6YC 4D3HA 2HHSA 4ELTA 3BSOA 3W5XA 2GZOA 2IM1A 4K4XA 1FEEA 3FMWA 1AW0A 2AMCB 4GKJJ 1HKAA 3TVYA 1C0TB 4USUA 1RAGB 1KVJA 4M5HA 2GJ2A 1UZDA 4ZOSA 3I9V9 2D9PA 1M0SA 4BWMA 2ZH6A 1E6VB 1EQMA 1QDUB 1VQLS 2HHHF 3JSMA 3QGIA 2YWHA 4C11B 4Z7CA 1FDAA 4UQGA 2VBXA 2J7WA 2DK2A 4HI1A 1UA0A 2GHVC 2CQ4A 2CQBA 3NWRA 3M6VA 4JB8B 5HQMA 5D4PA 3CSKA 3V6JA 1NK0A 5GADU 4FF3A 2LQ8A 5IV4A 3DYAA 2LXFA 2HS4A 3T9ZA 4WXOA 3A8EA 4DX7A 1SJQA 3DM2A 1T95A 4Y3CA 3M8QB 1FK9B 4ZP9A 2BKPA 5KFGA 3L95X 4IRDA 2ZHAA 5IWAF 3J7ZT 5A0YA 1HNVB 5F8JA 3KMSA 4CLFA 1RADB 4N8NA 1CULA 1PAUB 3MMAA 1FE0A 3IS9A 3CCVS 2VFUA 3RW7A 3T1HJ 2E5LF 4AQYJ 1CEZA 4N5SA 1T05B 1NZ8A 2FZGB 3O8WA 2MZ1A 3OUYA 3QAUA 2HIQA 3Q89A 4OZJA 1OYEA 1OIAA 1O8BA 3AQPA 2FVSA 1MMDA 3MR7A 4EZ9A 1IKWB 2QLXA 2YX1A 2R7TA 1S0NA 1LW2A 2FVPA 3OPKA 2LVWA 2R3VA 2VBYA 3R5GA 1B99A 2KYXA 3DOKB 4F4ZA 1MSWD 2V2QA 5KG1A 1T9UA 3OR1A 4GVBA 4MIBA 2GVDA 3SCIE 5CABA 1LWFA 1WSVA 3A4TA 2KFZA 3CIZA 2DPIA 5IM0B 4DR7F 1JXLA 2BM0A 1VOMA 2MLYA 2L41A 2NXUA 3M8QA 3GCXP 3BR9A 3P4UB 2CQ1A 4ZS6A 2R42A 3AXKA 4MKYA 3MAAA 3QAEA 4QCLA 4TYAA 3BZQA 1IKYA 3QNWB 2BR0A 3W1YC 4HT7A 2OIHA 3R5AA 2UVWA 3QIDA 4H4OB 2L9WA 4RBVA 2G0IA 1XK8A 4HKQA 1GQEA 2QN6B 3W2VB 5AXLA 4NRTA 4Q43A 4NYOA 4MMOA 1S0MA 4U7UD 1UPMB 3N79A 1RWOB 2L9NA 3L4BC 2VASA 3CJ4A 4MKVA 3BBBA 3I96A 3MR2A 1LFPA 4NI2A 4OI6A 4WWSA 2C2DA 5HVFA 1BQMB 2Z4PA 1SH2A 1LWXA 3N01A 1Z2ZA 3BGFA 1WKJA 3T41A 4TNOA 1X31C 1HR0J 5KG5A 4B3MJ 1J5OA 2VQEJ 4ZIWA 1DTQB 4JYAJ 2GMJA 3G8SA 1H0HB 3M2VA 3T6JA 4N76A 2ZD1A 3BB5A 4LFBF 5CYJA 3CB4A 3M6XA 1H2TZ 1S4FA 3D54A 5RUBA 3T9NA 2Z2LA 4BWJA 2I8EA 3TEHB 4HEA9 4ANCA 4DZ6A 3J7YU 4KO0B 1F5AA 1XR7A 4H4OA 5LJ3Y 3J81U 5HMXA 2F65A 3WZ0A 1RAHB 5ETSA 3D6FB 3AA9A 4NXNJ 1DAXA 2GV1A 3N6LA 3BYPA 1K8AT 2W2MP 5C42B 2RQMA 2VFVA 4KR0B 4LR7A 1T94A 1I94F 2AEJA 3IO1A 1V3ZA 4WCEQ 3M2RB 4R5PA 3P5BP 4WE1A 2IAJA 1BLUA 4EBDA 4O3OA 5J2PB 2ZVSA 3K5PA 3AOCA 4CLZA 3LP1B 2UP1A 4OJHA 1U49A 3H7HB 1NK8A 4DV1J 3ZZZA 3B54A 5H1SV 1VBKA 1KR4A 2W2QP 2B5JA 4K4VA 1A7GE 1DTTB 1K0VA 2JC0A 3EUNA 1G4CA 1IM6A 2FGOA 3CCMS 1CS4A 2E44A 5F3TA 2HPUA 1UCNA 2MQOA 2VJVA 3ZO7A 1S6QB 1BD6A 1U1PA 4DG1B 1OQ6A 4ZLPA 3GIMA 4DI6A 1CJVA 5IS2A 1YJUA 3MM6B 4ZLJA 1C1BA 3KLGA 1FKPA 3W9IA 3HHLC 2VFSA 3GILA 4F25A 4HTJA 3Q8YA 1K44A 3UCZP 2RS8A 4WFZA 4ZVRB 2C2MB 1TKXA 3UCGA 4W98A 2ZH7A 4DR4F 4J9KA 3R2DJ 3LPEA 1GMVA 4RBTA 1DHMA 1JLBB 4R8UB 3FQLA 4DV3F 2ATLA 2OLWA 4DFMA 2BOAA 2XG8A 3LOUA 3TRGA 1LV5A 4NCBA 3QWPA 4NXMF 1V3SA 1ZM3A 4Q2MA 1UMJA 2KL8A 2AHOB 2KRRA 2GQQA 3U1LA 5JVGQ 1WKKA 1ZM9A 1ZAXA 3WDOA 4DXLA 1UEKA 1KTQA 4I1TA 1FD2A 2FJXA 2XQCA 5HN0A 4TKTA 2O5DA 4HDGA 3Q23A 1JQGA 1B4SA 4YB5A 2BA9A 3MM6A 5E3AA 2HHHJ 2HMIA 2I2YA 5K9FA 5B0GA 1URNA 1IM4A 2JWNA 1VQ4S 3I82A 3SSRA 3C16B 5F9NA 4ERDA 4MH8A 2UUCJ 4NLOA 3DLJA 4ECZA 1S4EA 3DRSB 1SUQB 2YVSA 4X4PA 2KXFA 2J9CA 3QZ8A 1GK8A 1NSPA 4FXWA 5CAAA 3BREA 2ADCA 3JB9k 2H1YA 3M6WA 3D7SB 1WC6A 1RBOB 3OR2B 4HL9A 2EFGA 5HLFB 2KVQE 1XTZA 5KFDA 1U26A 3T5HA 2WONB 1ICEB 1RT7B 4R25A 2YPZA 4B9NA 5CYQA 3IRXB 4N47A 4HH1A 1FI4A 3A8JA 3ZZYA 4M63A 1T9TA 4UF4A 3JSBA 3HHLB 2NXJA 1ZM4A 1SJRA 4QJVA 4AUKA 2E5LJ 1SCJB 1JLCA 2CQPA 3ULHA 1NBEB 1P1TA 2OPQB 4LF9F 1YLXA 3JQKA 5IOLA 5FDLB 4O0NA 2HEKA 2QT7A 5MAOA 4V1Ak 3RRHA 1WJ9A 3I32A 4BLGA 3CCRS 2XY7A 5KFKA 1NPKA 2K3KA 3RBEA 4UUXA 3DHXA 2LFVA 3K2YA 2X1BA 1N34F 2J9DA 1TL5A 3CWJA 3HSZA 4JBCA 3RTVA 4W4MA 4ZPTR 1MROA 4PWWA 3OTOF 2HFNA 4YB1P 2VG5B 4I7FA 2FY1A 4M5IA 4DR7J 5A8RA 3RBZA 3TUZC 1TV6B 2YQ1A 1FJ7A 2DEJA 5L1KA 1NUEA 2HAIA 2CQDA 3K0JA 5I42B 1FXDA 3BQ1A 2CJ9A 2WHOA 2DPJA 4FYVB 1WTBA 2XC9A 3L7UA 2ZE2B 3NLCA 1DRZA 4QYZJ 4A8OA 5KFJA 4KC5A 4ELVA 2MGZB 3V2UC 4F8RA 1DQAA 4X4SA 3MTJA 4QR1A 3MOJB 2AWZA 4DR6J 3SSQA 1U2RA 5FDLA 3DGVA 2YWEA 3KTQA 4ED2A 1TQLA 1Y00A 1L3TA 3KLVA 4OX7A 2YQ0A 2I9SA 2EPIA 2UU9F 3MM5B 1NB7A 1TL4A 2X7IA 1U0HB 2CDRB 3EVWA 1S1VB 3C14B 2EXUA 4ZVGA 3BBCA 5KFSA 2IRYA 2JL9A 2NYHA 3OLAA 3Q8QB 1IR2A 1CLFA 3K8VA 4LFBJ 4IR9A 2FLLA 1VJWA 1ZA2B 1TUWA 1CVJA 4DCOB 4YUDA 2WOMB 1L3UA 3PJWA 4OYBA 4CTAA 4ETZA 4YOEA 2BJ3A 2YNFB 3KXDA 3RB6A 4RPFA 3HM9A 3ZTQA 2IFXA 1AT1B 4U67Q 2FVRA 1ROFA 4LF5F 2BJ9A 2VPYB 3DOLB 1U6FA 1VLYA 2WVFA 1C1CB 4LF6F 3GZ7A 1SC4B 3O1LA 1X9WA 4O3RA 1DLOB 1X9MA 4B3OA 2IDLA 3IG1A 4QOTA 3CJRA 2QMWA 1HBMB 3I31A 1LXNA 2B8QA 3GTYX 3AODA 3GFXA 4WP3A 2AU0A 1RGVA 4F04B 2EK1A 4CYUB 4LFAF 2NUHA 4PG5A 3U7JA 3ET6B 1ZTTA 2I1RA 4MTPA 2LEPA 2IA6A 4DL6A 1RWUA 3IR7B 1HHQA 1IBCB 3GFHA 5K14B 3QATA 1S99A 2NXCA 4C0BA 2HNDB 1NSQA 4X65F 1FT8A 2FLOA 4OYAA 1Y5IB 1VQMS 1N33F 3LH2S 3AB4B 1BHNA 3K57A 2E7VA 5DZ6A 4PQUB 1BQNA 3RB4A 1SB6A 1IQZA 3NCRA 3HCXA 1OY6A 2QG9B 2K3IA 1S97A 1R8PA 3POTB 1HBOB 3WC2A 4PUOB 3AAWB 2QA1A 4DR4J 1NSKL 3TAMB 4H54A 2W9BA 2L9DA 3NBPA 2JNJA 2OTLS 4DZDA 2J5AA 1HQEB 3VZHA 2YNGA 4DV3J 2GIRA 4C8ZA 3PHEA 4QZVB 2W7OA 2G13A 4NXMJ 1KQKA 4KKOA 1M5VC 4J9VA 4KFBB 2A6MA 3CDBA 4ECWA 2MKSA 3UE2A 1R0AA 4KT0C 4CM2A 1O51A 1HBNB 2Y0SD 4DUTA 3KUHA 4LSLB 3K5LA 1EJ7L 3CCWA 4PWDA 2H5EA 4XO0A 2EG2A 1CJTB 4JV0A 3PX6A 1X5OA 3TQEA 3C6TB 2BJ7A 1FKOB 4OLOA 2WW4A 2XS2A 2MSTA 3EDRB 1X4EA 3V81A 2B6AB 1UWBA 1DFDA 3TYTA 1YK9A 1MNEA 1TMJA 3SQOP 1M5HA 4CO3A 5HK4A 2IJRA 2HHWA 3SV3A 2BANA 2WZ1A 3OFHA 1RT6B 3QIPA 5J2NA 1V9OA 4B02A 3H5UA 4ECQA 3GJSB 3CEDA 2DGWA 4CDIA 4QWEA 2HFOA 2K1RB 4FS1A 4M5NA 5ETRA 3TJ8A 4LF7F 2H9ZA 4Q7AA 1RWWB 1NKCA 1RTDB 2CJAA 1FVQA 5I3PA 2LXUA 2KZMA 3S8SA 1UFWA 1VR6A 4ED6A 2RKIA 4IR1A 4LSNA 4USKA 2HURA 4ED8A 2CG8A 3NOCA 2W2NP 3V6HA 4O4GA 3JTOA 2IC3B 3KLEA 4LF9J 3KJNB 1JX4A 2WSFC 4IFYA 4ECSA 3W64A 4K4SA 4EU0A 1A0OB 1RZMA 2YKPA 3HVRA 1QLNA 2DBBA 5D0EA 2YBVA 1BWVA 2I0XA 4BS2A 1KQFB 3I0RB 5F9LA 2CJYB 2IYIA 1NJWA 9RUBA 4QWBA 2C22A 5KFIA 3EMTA 2IHR1 4LIRA 3ITHB 3Q2TC 3Q22A 4ES2A 1B70B 4TY9A 4QYRA 2HLUA 2GO8A 2ADBA 3VAMA 4HYKA 2OGUA 1UZHA 2MLXA 3OTOJ 4EWTA 1F0XA 4L73A 1MMNA 1KLMA 2A2DA 2FIUA 1LOUA 5HJXA 3PJ9A 1SKUB 2DEIA 3M8SA 4DV7F 4JV2A 3GG1A 4B9TA 1BQXA 2VDIA 3G4SS 3DN9A 1HPZA 4QQBA 3DMJB 7AT1B 3WX8A 2AGPA 2UU9J 2EW9A 2CG4A 5DQHA 2WAQD 2KG1A 5T41A 3TNVA 1VIXA 5HATA 4Q0BB 3CC7S 2ASJA 1N0VC 2VF3A 2HHVA 4K5SA 2LLZA 4OI0A 4N56A 3ZTPA 2C3YA 3RG6A 3MUTP 4H4MA 5IZHA 1S48A 2V2VA 3RB0A 2WBMA 4ZCIA 4JV5F 4DEZA 4ECTA 1B7YB 1VHIA 3VAGA 2DR5A 2KFYA 3KG1A 2MZQA 1R8HA 3BJYA 1U1NA 4WKYA 2IM0A 2BKOA 3IRWP 4U7CA 2RUSA 2OEKA 2X51A 3V4IA 1X4CA 4LRFA 3LP2A 4LF5J 1DQ8A 3LQVA 2AYEA 3C2PA 1M1GA 4TY8A 3OSPA 3TZWA 2YWGA 4Y28C 2D3O1 4B3TF 4IOBA 4MFBB 2C3PA 1X0FA 1LW0A 4O3PA 2ALYB 4PZVA 1HBUB 1NRKA 3SQGA 2AGOA 4F7VA 4DV2F 3FBEA 3CCTA 1M5KC 3N6NA 2N82B 4G1IA 2Z2YB 1R3NA 4DR5F 2JRSA 4NL5A 4ZHRA 4PXCA 2ILZA 3OHAA 2AZ3A 4YFUA 3D1OA 2UXBJ 4EMDA 2YKQA 1HD0A 1NK7A 1PBAA 3K58A 4DLGA 4C48A 2W9AA 2FZCB 4CO2A 4X65J 3PYEA 5F0WA 1XNRF 1N33J 4XDCA 4BC7A 4FXDA 3PNIA 4ED5A 2RQCA 3PEJA 2QMXA 4KY3A 2W9CA 3IR6B 2YKAA 2B4VA 5J1NA 2F8EX 4ES1A 2YH1A 1YBUA 4ZPDA 2BE2A 4O23A 4DUZJ 1TK0A 2W4CA 1VGYA 2HNYA 4MK7A 1C0UA 1TKDA 3TOQA 2CJXB 4J9OA 3KLIA 3UN2A 4HTIA 5HQLA 1SC6A 1IN0A 1K1QA 2FY8A 5HQ8A 5E0OA 2UUBJ 3CT9A 1ZBTA 3HX9A 3KNAA 2KT2A 4OQJA 4IO1A 3THPA 4G1QB 5GAEI 2R8GA 2QRRA 4LJMA 3BKUA 1Q82T 1TU0B 2IVMA 5D3GA 3N9UC 1L3VA 4TU7A 1QY7A 5E33A 1GNKA 2ASYA 2GAGC 5G0RA 1ZYQA 2V4JA 4ETXA 2OD6A 2FC8A 1KC8T 2ERRA 3W62A 2RRAA 3I9ZA 3ZZ0A 2O01C 4K7QA 1TL3B 2LECA 2CQCA 2HBQB 2POKA 1OMSA 1YJWS 1OYDA 3OL7A 1E6YA 3X3UA 1VMBA 1SIZA 5IQ6A 2R2TA 4ZCMA 3MM8B 2Q66A 3M8ZA 1ZS6A 4LRDA 2RHSB 1NDKA 4R0EA 1JLFA 2U2FA 4ZP6A 3FBBA 2HHXA 1NAQA 3NEKA 3H4BA 2N4DA 3VTIA 1RBLA 4LF7J 3I6PA 2ZZNA 3HZEA 1ZAVA 1U6BA 3MHYA 5LSRA 1XMQF 3EX7B 2E9RX 1QAXA 2OPRA 1U2FA 1XR6A 5KG3A 5BYQA 2ZH3A 2RQKA 1N56A 1UEVA 3MF5A 1IBLF 1RI7A 1IWGA 2PI5A 1TKTA 1TL3A 3BPDA 2E66A 3CJ0A 2BOPA 1ZH5A 4UW2A 2PC6A 3H2LA 3GLJA 4EBCA 3MM8A 1NKEA 3DI6B 1IVZA 2QA2A 1F60B 4EYIB 1YRTA 2CJKA 3M8PA 2P8IA 3W9HA 4BBYA 3E51A 2FVQA 3MI7X 4PXDA 3WIUA 1OPZA 4XDDA 4D3GA 3GIIA 3OXGA 2MTLA 2A3JA 2PE8A 3F0NA 4NLPA 1S1WA 2LYVA 1VQ7S 1TL1B 4B3SF 1MWQA 2H48B 4NYZA 1WOPA 3PW4A 3H2VE 3EPIA 4LF1A 4MJKA 3VAKA 2DNYA 1B0TA 4HLBA 3UN5A 1WUUA 2KI2A 1HQUA 1X60A 3PX0A 2DNRA 2JLFA 4DV7J 2AF6A 3JYTB 5DS7A 1WF1A 4A47A 3MMBB 2CZVC 4YR2A 3KNGA 2W4DA 3TUPA 1NEEA 5L1IA 2FB0A 3S6EA 2GNKA 4DWIA 2PA3A 3MTKA 3KKFA 1RT5B 1FWKA 3CO0P 1YHQS 1TFYA 5FD1A 4DHVA 3EXCX 2ASLA 2MSSA 4FBUA 3T5KA 4QWDA 1HMVA 4YDXA 4EBEA 4NYPA 3TA0A 2VL1A 4DMZA 4BHQA 2BE9B 1FFWB 1VCTA 3D66A 1NPRA 2CQ3A 1FJEB 3W60A 2V8GA 3KK3B 2HFSA 3G6ES 3R8YA 4IG3A 4YR3A 1KNZA 4CWBA 3M4XA 1HARA 2KO1A 3LTOA 1M1HA 1NJYA 3PR5B 2UVVA 4F3QA 2VKRA 2E5GA 3I0SB 2E1RA 1JLEB 4CLKA 4EYHB 4Y2MA 2B7CB 1RWPB 3SBMA 4KB7A 2DKOB 3MM9A 4EI2A 1FCAA 5B08A 1HNZF 4DSKA 4LR9A 3DLEA 2E9ZA 3UNYA 3CCLS 4KV8A 1RT5A 3LGNA 4PXBA 2ACYA 1S9GA 1QSYA 1VBZA 1GTEA 3WIVA 1ZZFA 1YJRA 2B9WA 3DRRA 3ZZTA 4DV2J 1XC9A 2P9EA 3DLHA 5KFQA 2MKJA 3DLGA 2Y1LB 3ZZPA 4J9RA 4DR5J 5J1EA 3G6XA 1VC5A 3Q8UA 2BABA 3KK3A 4LREA 5GMEA 4DU7A 5HI7A 5HO4A 1Y11A 3Q86A 5F8LA 2VQFF 2VOOA 3IAS9 5A8WB 3MEEA 1F3FA 5HVGA 1YX2A 1JLEA 4HR2A 1KOOA 4IDKB 2DXFA 3CW2C 4J91A 2N4CA 1NZAA 4F2RA 4IOCQ 4U7UK 2DT9A 2FQQB 3OVBA 1FRLA 1FERA 5CYMB 4NCGB 5AJ3F 4KBIA 1K47A 5D4LA 2BX6A 2ZJQQ 3IBWA 4GO7X 4MKBA 1WEYA 4CIOA 1MLAA 2CFXA 5KG4A 4JI0F 4OZ0A 4QBUA 2RQ4A 4A8XA 5J2MA 1J2VA 3IMQJ 4DOZA 1EP4B 2DXDA 2DNGA 1F9HA 1WHYA 2KJVA 2LU1A 2DNMA 1PAEX 2WBRA 1T9YA 2N7YA 1Y4ZB 2D9OA 2KHDA 4DR2F 2F3JA 3GV5B 3EM1A 2KB2A 3PO5A 3RB3A 3E01A 2YKNB 1WC4A 1WELA 3HHNB 2UUWA 2KTQA 1YRUA 5HL7Q 3AB2B 5M2UA 5D4OA 5A8KA 4RZRA 2HWIA 2CKWA 4YHHJ 4J9UE 4RW8A 1R43A 3R1LA 1FFSB 2M88A 3E2EA 2QC3A 3W66A 2CA9A 2VG7B 2OD4A 2B0GA 1VRUA 4OYWA 1N48A 1NMEB 4J9SA 5HP1B 3NS6A 3EJMA 2V69A 4W90B 2ZVIA 1TAUA 1MMLA 4URGA 2B9EA 2WSCC 3N5FA 3LGMA 4Z7YA 4J9QA 3GSIA 3DLKA 1U45A 2MYFA 3KUGA 5DQIA 4WFYA 5HMWA 2CJQA 4DQQA 2O1PA 1WG4A 3SSSA 1QTMA 1GXUA 5JXSA 4RUCA 4DR1F 3F41A 2JEFA 5ETNA 3UQSA 4DS4A 1KRPA 4OL8A 4FYDA 3NY0A 3HHDA 3BO4A 5HMYA 1APSA 2U1AA 4E98A 1NK9A 5KFNA 3FK4A 2DHXA 3F44A 1ZM2A 3OL9A 4ZVQB 1QAJA 3I55S 1S9EA 3WHIA 2ZKTA 2VV5A 2FHKA 1NDPA 4KPCA 2QLFB 1QVFR 1YGYA 4OZ1A 1TL7A 1RTZA 2HHUA 5DLGA 2NZCA 4ELUA 2YNIA 4Q2LA 1XMQJ 1GFWB 4USIA 1U8WA 4M5KA 4L72B 3Q2SC 1RAFB 5LMUF 3FSYA 2ZM6F 1IJFB 4XTTA 5ETOA 3KLFB 3MFHA 3PYDA 2DNLA 1H72C 1DJ0A 3SFGA 3LGHA 3D0IE 3BBFA 2F9JA 2ZH2A 2B9YA 3BN4A 3FFIB 3VHQA 5CHCB 4IQXA 2R7XA 2LQ5A 4YB6A 4KGVB 3GJQB 2RVJA 3H42A 1P1LA 1VQKS 1RBAA 4DFPA 1FHTA 3CJTA 5C24B 3DXBA 4PPDA 4ED4A 4DSEA 1SPBP 1U8SA 3V5RA 1AB8A 3EGNA 4UOGA 5D0HA 4B3SJ 2RRBA 1W2BR 2PSZA 2MKIA 3PXGa 3VGUA 4DPUA 4M95A 5KT6A 3FKBA 3GJTB 2WCXA 5L8RC 3IAM9 3TZXA 5LJ5Y 1ZPWX 2E1CA 2BM1A 5EN1A 3M30A 1CC8A 2BEFA 3GR1A 4ID5A 1VRQC 5DDPC 2DYAA 2CXEA 3P96A 4KHPF 1J5EF 2IM2A 1YVFA 1WKLA 2QLWA 2YKMA 2JZ5A 3FBFA 1LXJA 1L3KA 3UD4P 4NLQA 3RAXA 4ZCLA 2EFPA 1T03B 3OTCA 4GC6A 4KHMA 5I3UB 3A13A 3CDAA 3D0HE 1HI1A 2V63A 1DARA 2DGVA 5HBMA 1EAYC 1HI8A 4JI7F 1FRJA 4X4TA 1P9QC 4FVCA 3M2UB 2V67A 2NSCA 1SI9A 1FF2A 1JNRB 1HQ2A 2YX4A 1RJJA 4FF4A 2DB1A 3TAPA 3BO3A 1V5IB 3JAMU 2KHCA 2DO0A 1I5OB 4LMZA 3K5OA 1RWKB 2R7WA 2KT3A 4ICLA 5H9EJ 3HVTA 4P72A 1G1XA 1FDDA 4XAKA 2KZZA 3MCMA 1DBDA 3VAJA 2VG6A 1R27B 1RT1A 3TAQA 4P2MA 1HNZJ 2GW8A 2HK3A 4JI1F 4OV6A 3HJFA 1HYSA 3H5SA 3KJVA 5H9FJ 1YIJS 3IBFB 4FNHA 1ZA1B 9ATCB 1SV5B 2QTWA 3AHPA 4RJVA 1CG2A 2B4PA 1NNDA 2D7SA 2I5JA 4NLWA 3ISZA 2RF2A 1JKHB 1SH0A 2HIYA 2ZBCA 1S1TB 1H6KX 2ZDOA 1HLWA 2HWHA 1PSDA 4LFCF 4DL5A 4KGZB 1U02A 2EC0A 4HACB 4MK8A 3IWNC 1KHWA 2O66A 1ZOTA 3ETMA 4IKAA 1GX6A 3QJJA 2VOPA 1HW9A 2VQFJ 2JEGA 2DH9A 4I2QA 5HROB 1VC0A 1PIEA 3FVYA 2DTJA 3M9OB 1H7WA 3PFEA 2MQQA 2ZKUA 2DCLA 1YRXA 1FX4A 2AJ1A 3C6UA 2M3DA 1KVIA 4K4TA 1UVNA 2OPSA 5AJ3J 4HHHA 2Q3PA 2ZOMA 1JXVA 1S0VA 1XEZA 1QE1A 2FGCA 3R5CA 4JI0J 1FTRA 2MPUA 1AFJA 1LWEA 3CJQA 2JVRA 3RU0A 3RBDA 3DRPA 2ASDA 3QO9A 3DU5A 1CJKB 3SDEB 2FHJA 4X4VA 2GVZA 2J9EA 4IFVB 2BJ1A 3DHWC 1HWKA 3D5MA 2FC9A 4RW7A 4DR2J 1O0PA 2AJ2A 4X4OA 3L3CA 4QWAA 2GO9A 1DURA 5D78A 4CO5A 2HVEA 1SJ1A 5K5MA 1F9FA 2NZ4A 5IT0A 1NK4A 2NYIA 1PG5B 3FDSA 1RP5A 2ZH5A 4LT6A 3NNCA 4K2XA 4OX9F 1VRTA 1Q7YT 2FJEB 2E5HA 5J2QA 5J1PA 3W5YA 1XWLA 4UOFA 5F8HA 1N32F 1AZSA 1AA1B 1WEXA 3THTA 1JB0C 4USJC 2HZCA 4IFVA 3BKFA 4ZVEA 3LP0B 1WDTA 3HFZB 4C8YA 4OV1A 5CD4H 2HRUA 1LKZA 4CLSA 3G71S 1T0TV 3NL0A 1H7XA 1N54B 2QLJB 3EPGA 3MWBA 3OT9A 1UL3A 4F4KA 2G2ZA 1S6PA 3GPAA 1Q86T 2E9TA 2K2PA 4QPTA 1JJ2R 4NLUA 1JLQB 1FTCA 3NGUA 1N6QB 1XNQF 5CD4A 1D8YA 3M32A 4A48A 1TVRB 1U1KA 1HWJA 1H74A 4QPXA 1JJ4A 2PMWA 3BGUA 1U1QA 2H51B 5KFCA 2KT5A 3RYLA 2AZ1A 3EGZA 3TZZA 4OZLA 2XY6A 2ZH4A 1IR1A 5BYRA 5EUHA 1XMBA 1YBAA 4GC7A 2P6TA 3MOZA 1YJ7A 4NA1A 3FRYA 1RT3A 2PO4A 3AFGA 4CZCA 3BDPA 3JSRA 2OH2A 4OIXA 4QIEA 2VONA 4DR3J 1QUVA 5KG6A 2R2UA 3ILJA 3G8QA 2DNHA 3H8YA 1Q53A 4CH0S 2W1BA 5GAHI 1X4GA 1QD1A 3LA0A 1VBYA 4WIIA 4DX5A 2M4MA 4LRAA 3A8IA 2RDIA 2HHTA 3THVA 1PYOB 2ZH8A 3NS7B 1H2UX 2G2YA 4KH1B 3DRYA 4I2PB 1VC6A 1KS2A 1IKVB 4Y2IA 4KHPJ 3G82B 4OYPA 2J0QD 4OYMA 2IYGA 4CNZA 1Z4UA 2MKYA 4J90A 3MAQA 3MFIA 4O3NA 5IT9Y 5D0RA 3AD7C 1VQPS 5KFXA 1WSRA 3NAHA 4LR8A 3P45B 4C2MA 3AQOA 3NRBA 5ADZA 1REGX 1XERA 4ZLNA 1SQEA 1VFJA 4O4RA 2KH9A 1J27A 2BQRA 1DZ5A 4CH1A 3KK2B 4Q45A 2GGPB 1Y3KA 2X1GA 1HNXJ 1IQTA 4P75A 1VQYA 1BUXA 2J8SA 4F0HA 1FKAF 3KLHA 2HQIA 2WVEA 3SV4A 3NS5A 1RE1B 2RE1A 4KIAA 2D3ZA 2NUUG 2OKQA 3OW2R 4JI6F 1S9FA 5H9FK 4JUZA 3EVOA 4ATNA 3OVSA 3H20A 1KBRA 3CC2S 2C2OB 4WYLA 1NHUA 3CD6S 2AX1A 2XSJB 4AXJA 1S76D 4JI1J 3KK1A 3T1YF 3VAIA 2GC8A 5D77A 1T3NA 1EZZB 2KYZA 2Z57B 2CNOB 2VFTA 4DSLA 1RHKB 4OLPA 1TKZA 1RA7A 1RWMB 2RB7A 2YY3A 1HW8A 2XCAA 1NU4A 2PMZD 2GA7A 1HHSA 2AQ4A 3R3TA 4MIAA 4LFCJ 2V8VA 1L5UA 3MR3A 3W65A 2HAFA 3BH7B 3M8RA 1LWCB 5A2QU 4DS5A 1C0TA 3LWLA 3MR6A 1FO1A 4GRSA 1FXLA 2F8MA 4FP9A 2VD3A 4JI4F 1FVSA 2MKHA 4DQSA 4GMKA 1E6VA 3GIKA 3H98A 1N8RT 1FFGB 3SCJE 2PDAA 2G0JA 1XQIA 4V19J 4C11A 4RW6B 3LANA 3RGIA 1Q8KA 3H59A 2ABYA 2DR7A 4RW4B 5M2RA 1TUGB 1XR5A 4ITSA 1VQ6S 3I5AA 3HULA 4P10A 4H4KA 5E2QA 2F63A 1S7IA 3BO2A 4FKXA 2F4FA 1WC5A 5B0EA 4FPRA 2BACA 5IV3A 1CJUB 4Q8EA 4DV6F 1IWAA 4QIGA 5HMZA 3ZC4A 1Q4RA 1UETA 4DV5F 4WFXA 1FK9A 2XGQA 1F5BA 5DGAA 2Z2ZA 1IBMF 1N0UA 3O6QA 1HNVA 2ZNYA 1RTHB 4Q5VA 4TQRA 3GV8B 2ZUGA 1TTHB 1UKUA 3CD5A 3MURP 1HI0P 1SC3B 1K73T 5B09A 5F8GA 1T05A 2HZAA 1YTYA 1B64A 3CCQS 3R5BA 2HVHA 5K8MA 1LK5A 5KFYA 2OPPB 3IP0A 1N88A 4CM0A 4JP8A 5DG9A 4DPTA 2CZ4A 4DBQA 1N5YB 1IKWA 1KOHA 3CJ5A 3DGPB 3LUYA 3IWLA 4P2XA 1IKXB 4FN5A 4YMEA 3PCOB 3DOKA 3HFVA 1HWIA 1REVB 2LA6A 1VJQA 4ZN3A 3ZZRA 5DLFA 1BE4A 3CNQP 1YZ6A 3M1VB 1JLGB 4NPOA 1KD1T 4TYBA 2FHOB 3NAIA 5IM0A 3MEDB 1WI6A 2G0CA 3BS9A 4OYOA 3TJ9A 3IM8A 4UQTA 3KG0A 5C5JA 5EWFA 3O5TB 4M5MA 2KU7A 2AYMA 4NLYA 3ETOA 3W2VA 1XMOF 3PDNA 2ILYA 5I3QA 4AE5A 2BJ8A 2QZ8A 3QT8A 1D0EA 2CWKA 1XNQJ 3AJ2A 3O2IA 2DRBA 2DGSA 4X64F 5K20B 4EK2A 1YSJA 2W2OP 1WORA 4I4BA 1RU2A 3N6MA 1BQMA 1WWHA 4NASA 4DL2A 1R7IA 4R0JA 1RKJA 1OWXA 3C19A 4I6AA 1BC6A 1DTQA 1GAOA 3J81j 3A12A 5ETVA 2QA4S 1PILA 2R8KA 3DLLQ 1QSSA 4CO1A 3G87A 3IM9A 2CPZA 3V6KA 4J9MA 1BWEA 3PYFA 2ACMA 2AJQA 4WTYA 2OO4A 2KFNA 2ZDPA 2DVIA 1RTJB 1TELA 4RL1A 4NLDA 2NPFA 2QE5A 2UZAA 3CDWA 1R0CB 1M90T 4KO0A 3NGDA 2PMHA 1RYRA 3MXHP 5GAGI 4IH6A 3AOAA 2XM3A 3JSYA 2C2RA 1Y5LB 3D4JA 2B3TB 2NREA 4ILRA 1UP1A 2ZFHA 3ILIA 1FDBA 1FEHA 1VQ5S 4A8MP 4J7CA 2MY8A 3HF5A 4ZPCA 3E3XA 5ETLA 1U1RA 4PPZA 5C42A 3VAHA 4ZP7A 5GVQA 3M2RA 2ZHBA 1PC4A 3TO8A 5J2PA 3HHKA 4U9RA 5F8MA 1VQ8S 4QU6A 3LP1A 3NGRA 1S0OA 1KVKA 4ZJQA 3WBZA 2N3OA 4X62F 2VODA 1RUSA 2OFGX 3CMAS 1MU2B 1X9SA 1IXKA 4OYIA 4CT8A 2VH7A 1DTTA 2W4PA 2G4BA 4RNNA 3MCOA 2EI5A 4IRCA 3GV7B 4USVA 1U0SA 3SYZA 1EQ0A 5KFHA 5C25B 1VQ9S 4OZ5A 5GMDA 3MECB 2VC0A 4ZKAA 1S6QA 3VQTA 4DG1A 2J7UA 2QJ3A 3BPSP 2ZITA 1T7PA 4JI6J 2CAJA 5A76A 4DN9A 4ECVA 2C2ZB 4B17A 3DCAA 5T7LB 1S10A 2V34A 2FJBB 2P9GA 2DRAA 1UVIA 4CNYA 3I5BA 4YY3F 3SXLA 1S1UB 2JFKA 1LFWA 2DHSA 3VGVA 2Y3YA 5JJBA 1JJHA 4EZ6A 2PT0A 1R6VA 3FEYB 2YH0A 4X66F 1X0PA 4DF8A 3A1YG 1JLBA 4R8UA 4NEYA 2DJWA 3PW0A 2ZNZA 1FXRA 2FLNA 2GHWA 1XN9A 3N5BA 4GKKF 2RHQB 1VK8A 2QV6A 3NOGA 1SXLA 4C3MA 4ALZA 5I4MA 2PFFB 4YS2A 4RNOA 5IWAJ 2WVCA 3R27A 3LALA 2V8DA 2XMAA 4LF8F 3JQJA 3TZYA 2CVEA 3VGTA 3DU6A 1EETB 4JI4J 2H3EB 3UDLA 1SL2A 3J7AN 4ZVOB 1KONA 1OQ3A 5T7LA 2BRKA 5DM6Q 4OYXA 2XNRA 4S0MA 2XI2A 3C16A 1D9AA 1WG1A 4XIUA 4PYDA 5T14A 3CGIA 3DRSA 3UI3A 4LF4F 2CPEA 1HNIB 1SUQA 1W25A 1CSJA 4ZLLA 4QR2A 2XY5A 2XS5A 5JMNA 5KTQA 3MPVA 3N0VA 3OR2A 4LBHA 2KXNB 4PG4A 2E5IA 4DV6J 3MEKA 1QJHA 5HLFA 3UW1A 1UAWA 2J0XA 4YB7A 4DV5J 4DFJA 4MK9A 3BGRB 2WONA 3FJ2A 1S1XB 1RT4B 1RT7A 3JS9A 2XLIA 1QUPA 5EX3A 3IRXA 4HHUA 4DQPA 1YKWA 2FJDB 4RUAA 3PFOA 2XWXA 2X3DA 3K5NA 4QW9A 3T1HF 2WB1D 2MEWA 3HHLA 1QAIA 4RW9B 2DGQA 4X2BA 3UVJB 1FRKA 5DJBA 2JX2A 2L08A 3GIRA 2OPQA 1U2CA 4C9DA 3L09A 3VR1A 3BYRA 4A8YA 3MMCB 2IJFA 1LK7A 5L9NA 2ZEJA 3I4HX 2QEXS 4ZITA 4CT9A 1RHQB 4LQ3A 4P71A 4X4QA 4J9NA 3QRPA 4DPYA 3NCQA 4ZA1A 6AT1B 2VHGA 2VG5A 2O67A 1TV6A 4O44B 1B7FA 3UR0A 4OHWA 1N5SA 2AYBA 2A0FB 2XYPB 2PGCA 3W2WB 4ER8A 5I42A 3MR5A 3DOMB 1KKHA 3CC4S 3MEGB 1EX8A 4G6VB 5KT2A 3C66A 3CJKB 2ZE2A 2IM3A 3UDVA 2HVZA 3AJ1A 2HLTA 3W7BA 1R8AA 2DGUA 3CMES 1XMOJ 2MGZA 4WP8A 2C3UA 3HKZD 4KHRA 2C3OA 2HNZB 2CQ0A 4X64J 2VBZA 3U1MA 4DV0F 3OL8A 1RAOA 3ISNC 2CNKB 3MM5A 2HGMA 2YTCA 3Q0AA 3RBXA 4UOCA 1WEZA 1HL6A 4P74A 1I94J 1U0HA 4B08A 1S1VA 1HR0F 4KTQA 2JHEA 3C14A 4B3MF 2VQEF 3VCDA 3QWUA 4HVZA 4CRJA 4JYAF 4UTGA 2FHJD 3H0PA 4M5DB 3RW6A 2J6TA 3MM7B 3OLBA 1KEKA 1Q79A 2JJ4D 3MPUB 1HD1A 2ZJRQ 1F9EB 2QO3A 2RNEA 3BV8A 4UOHA 4JI2F 3QGHA 3P3DA 3V6DB 5ETQA 2LQJA 4OZ2A 2KVIA 2WOMA 4USTA 2M70A 4C3KA 2YNFA 5E3PA 3O3LA 2Q6BA 1JLAB 3DDNA 2M9KA 3OTDA 3O44A 1QAYA 2CJBA 3MDFA 1ITPA 1R6YA 3DOLA 1YI2S 2V5HG 3IC1A 4RWXA 5KT5A 4KYZA 5CA5A 1C1CA 2R7QA 1N52B 3DC2A 2VPWB 4NLTA 3ADAC 3T19A 4DUYF 1DLOA 3D6HB 1RYSA 2B8PA 3SCKE 3N28A 1HBMA 1RKIA 2FJVA 3C15B 4L3NA 1AXQA 4CYUA 3NGSA 4X62J 1BY9A 3ET6A 3AJDA 3HD1A 3W8PA 1KWMA 2VIHA 2VPXB 4C98A 1B0PA 3IGNA 2FHMA 3ZTRA 3PG9A 5K14A 2L3MA 2AEFA 3FMBA 2HNDA 3KYLA 2MHNA 3BR8A 2XZDB 1RWVB 3RUBL 2XYHB 3JSMB 3X1LB 3VF0B 4EO6A 2D3UA 4TU9A 4YQWA 2IMOA 2YKOA 4PR6A 2R2SA 4PQUA 1G2EA 5F8IA 3NXZA 5LXRA 2K8GA 1RSCA 2JDJA 3CULA 4YY3J 3ENWA 2OTJS 2EFOA 4C8KA 2LEAA 1NSAA 5FLXY 3FSXA 3POTA 1HBOA 1VISA 4B3RF 2A10A 4PUOA 3H90A 1S7HA 2WB4A 2ZH1A 1RU1A 3TAMA 2Z8QA 3A3PB 4U8YA 4C8OA 5KOWA 2UVUA 2QGFB 4X66J 3CUNA 3R5JB 2IVYA 3DYAB 1HQEA 2MQPA 3DM2B 3W8GA 2Y8WA 4OMFG 4X84A 2XLJA 5GADI 1TR0A 1WHVA 1CC7A 4GKKJ 4KFBA 5LMNF 3M9NB 5A0YB 5HANA 2DHHA 1RAEB 2OEJA 4O0IA 5AXNA 1CULB 3MMAB 1HBNA 3IS9B 3PYGA 4LF8J 5SUHA 4LSLA 2JSXA 5IQQA 2DCUB 2AYGA 1WHXA 4WFBQ 1CJTA 4RNHA 3C6TA 3OUYB 4WXWA 1FKOA 5KFUA 4A8FA 5EDWA 2UUCF 3MPWA 3WQPA 2B6AA 1Q81T 1LW2B 4NMLA 4LF4J 2OJ3A 1YG0A 3JAMY 4J9PA 8AT1B 4ZPAA 2K7JA 5KAKA 3OR1B 1RT6A 4GVBB 4DLEA 4DFKA 1N34J 2GVDB 2XMVA 5DQGA 1LWFB 4NMXA 3H40A 2LKZA 3D3BJ 2V4QA 3MD3A 1HFEL 4IG0B 6FDRA 3A8KA 4WFAQ 2F7VA 1FESA 3SEOA 4QYZK 4CP5A 3EZUA 4FZVA 2K1RA 3D9BA 3HSGA 4ZDNA 7FD1A 5E3QA 2J6UA 1WOOA 3MAAB 5A6PA 1FNXH 1UJ4A 1IKYB 1RTDA 4FDFA 4DDFA 1P8GA 4BC9A 1H73A 3GFYA 4FVMA 3PV8A 4OYZA 1X5TA 2HQGA 2PEHA 1U1LA 1AYEA 3L7PA 1MWZA 3GU0A 2V50A 2IC3A 2QMUB 3ISND 4GO5X 2COLA 4M5LA 1S57A 3FBCA 1AFIA 2QSWA 4CH7A 3PIOQ 4NI2B 2HBZB 1T11A 1SVDA 4EFAC 1KDNA 3I0RA 3MPDA 2H4YB 5L46A 1F2HA 2YNHB 1J5OB 2GIFA 4J37A 3PKYA 3K59A 2MZRA 4Y0FA 1JNZB 3H25A 3ITHA 2R7OA 4L74A 3K89A 3J7A1 2LCWA 4DL7A 3M2VB 4IG0A 2ZD1B 4LBPA 4ZVSB 4LF2A 5K8NA 1U6ZA 2XMKA 4ID8A 2J7KA 3AD8C 4ENOA 1YWXA 2GQCA 3M9MB 1D09B 1KSPA 1VHFA 1SKRA 2HQDA 3EICA 3J7YI 2XB2D 4DR6F 2F5GA 2OAUA 1OJ4A 1X4DA 3DMJA 4NLGA 5LM7E 1VK3A 4LF6J 3HFKA 1U1MA 2CYYA 3ILOA 2CQHA 4K0KF 3HVAA 4DV0J 4Y34A 2NR0A 1V5VA 1Q0NA 2D41A 3JTPA 4R5PB 1X4FA 4WE1B 3CD7A 2IAJB 2GX8A 3H4DA 4Q0BA 4ED7A 2AJ0A 3EXYA 4O3QA 2C3MA 2YNHA 2EKYA 3HK2A 4DPXA 1O6XA 2B5JB 4LFAJ 1SKWA 5IFMA 2XI3A 4I6YA 2QIFA 2W24A 2XHWA 1DY3A 2ZZMA 4JI2J 3LW5C 2Q1LA 2AJFE 4DL4A 1CS4B 3QT5A 2FVCA 4Q44A 3UDEA 3HSJA 3PZPA 1H3DA 4UY85 2MXYA 2E1MC 1CJVB 2CQGA 3HZGA 1C1BB 1R0BG 3KLGB 1FKPB 1B0VA 3R7NB 4F3OA 4NX9A 2DITA 2PN6A 2AKWB 3D2WA 1SJFA 1RISA 4I64A 1SQFA 3V4MA 2J8AA 1TKXB 3RRGA 2OSQA 2QFJA 4DUYJ 1B3TA 2ZUAA 4MFBA 1SIWB 4OFZA 5KFLA 1HBUA 2XMUA 3T3FA 4I56A 2CZ9A 2JH3A 3ENAA 3S01A 3S7RA 4RWWA 4BCAA 2MJNA 1T9XA 1R31A 4A46A 1YJTA 2H4WB 2NPIA 5SZTA 2E7XA 4G3IA 2AW0A 1RQ0A 4Q8FA 3TJAA 2V4RA 1KFDA 4F0MA 5KFWA 2KRBA 1TMMA 1FJGF 2XYGB 2P5VA 1FD8A 5ITHA 3K17A 4C0HA 4NLRA 2HMIB 4AFFA 4USWA 3UR3C 5KFEA 2I6WA 3GE9A 1U47A 4OHXA 2QL9B 2R9LA 1N4LA 2RUGA 4E2FB 4B3RJ 2DR8A 2CPJA 2IJNA 4B9SA 4ECRA 3M8WA 2EC2A 4A4JA 5LT5A 2HQCA 2OELA 5AXKA 4ECUA 3G86A 3CCUS 3G9CA 5GAEU 5DO2A 1IBKF 4AL5A 3JXOA 1RACB 2PD1A 2YWWA 1YJ9S 4C6AA 4UY8T 4OI2A 2LQ9A 5LMNJ 4G1QA 5CYQB 2ZBIA 4LVNP 3EWGA 5LSLA 1EB0A 3HI9A 4OJ3A 3UD5A 3OJSA 4TU8A 4DPWA 4L6V3 2PIIA 2HHPA 5KG2A 1FWPA 1JLCB 3NG8A 2MQMA 3BN7A 3M6UA 1CPZA 5KT7A 4P7VA 3SCLE 5BR8F 3CCJS 3B82A 4LIWA 2DNOA 1OY9A 2XCPA 2UXCF 3I5CA 3G96A 1Q95G 1ZAWA 2XWYA 1WACA 3KHRA 2WW8A 1SQGA 2NS1B 5CH7B 2MQ8A 1GX5A 2FJWA 4MT1A 1QSLA 4KQZA 4AT1B 3TA1A 1SBRA 2JVOA 3FC9A 2RDJA 2Y9HA 2Y0BB 1MROB 4IUFA 4I7FB 5KFPA 4CQ1A 5A8RB 1YJNS 2ZZTA 4JI3F 1Z1ZA 1I51B 3TARA 5A6WA 2EFQA 1K1SA 4ECYA 4ZCKA 3J80U 4FYYB 1W26A 1R89A 3HP6A 2EVZA 2W2PP 5F0UA 3S1TA 5KFRA 4XK8C 2B56A 1IUJA 4PG8A 3CE8A 2VC1A 2GIQA 2W01A 3SIPB 1T02A 2CRLA 4YR0A 3Q8RB 2MQLA 3OTBA 2W25A 1VS3A 4NRUA 2J0WA 5LSOA 5F3ZA 3H2UB 1PKUA 4L75A 1PC5A 2DNQA 3VAFA 3NMRA 2DHAA 2MQNA 1BGXT 5K8OA 2XGPA 5A2QY 2V0NA 2DNKA 3DI6A 3EGVA 4JV1A 1RLCL 3Q8PB 2R8HA 4Y2AA 2RJZA 1V6HA 2AEMA 2VPZB 3ELHA 2QYGA 3L7OA 1F1BB 2V94A 4ZVFA 1EKRA 1TL1A 1Y7PA 3FEZA 4JV5J 4C3LA 3FNNA 2R4FA 3C46A 4CTAB 1JIHA 4QU7A 1NHVA 4DX8H 3B4DA 1F3VA 3UD3P 3OFGA 1M5SA 3EYZA 3JYTA 2HHQA 3ZNJ1 5HSPA 1T9VA 3MMBA 4ED0A 1OPIA 1Y0HA 1CBKA 4F3MA 2ATCB 2VDHA 3MZIA 2BUNA 2WK4A 4LUBA 4USHA 4KH0B 4NLSA 2FJAB 3TVKA 3HT0A 4B3OB 4K0KJ 1BXNA 2HBYB 3IG1B 3KDNA 5E3RA 4B3TJ 1VLOA 2XZWA 1C4CA 4C8LA 1UJ5A 5DG8A 2FLPA 3CDUA 3HDSA 4DN0A 4KGMA 2LEBA 2RILA 1HHTP 3EVMA 5D15A 3WX4A 2BJDA 1ACMB 5B0FA 1U25A 1X4AA 5CQGA 4UZBA 1ZETA 3PACA 1KFSA 4ES3A 3GSDA 3DNCA 3HHLD 3ENQA 3I0SA 1Q7LB 1S6UA 4LRBA 1NHKL 1NK6A 3DXSX 2E7WA 4PYAA 1XNRJ 3CDEA 4XPCA 4NE9C 1BQNB 2OEMA 1S59A 3D68A 3IWXA 5C2CA 4P7TA 5M2PA 3TW0A 1X5SA 2XMTA 1WF0A 2F1FA 1RA6A 1NPPA 2W9BB 2RU9A 5GMKa 1O5JA 3NBPB 5HAOA 1URRA 1V3RA 3C8YA 4E8UA 5JVHQ 3TX0A 3J81Y 1VYAA 1QTNB 2YNGB 3LF0A 1N5QA 5KG0A 3NP5A 1D1UA 4OZ3A 4EO8A 4PRFA 4FBTA 3QFHA 2OMOA 4KKOB 4K2JA 2NXEA 2LU2A 1CQNA 1OSCA 2UXBF 2CPFA 1R0AB 3RR8A 1K9MT 3QT6A 5D4NA 1VI7A 3QYYA 4FPIA 4F4WA 2PEBA 5A8WA 3HPOA 2CNLB 2DIVA 4M1KA 3FRZA 4YP3A 4PWDB 1FJGJ 4UZCA 2A2CA 4IDKA 5DM7Q 3D1QA 3EDQB 2XTJP 4URQU 2Q43A 5F8NA 4WJBA 5CYMA 3LWMA 4FS2A 4NCGA 1AUSL 3R1HA 3V81B 1UWBB 2RSQA 3UDCA 4DSIA 2D69A 3QSIA 4DUZF 4JI5F 2GJFA 1F2GA 3NKYA 3W63A 3FUYA 1EP4A 4MYUA 2AV5A 2BANB 3AD9C 2YWFA 3QIPB 5J2NB 2M0GB 3FCHA 1N5VA 3HXMA 2AP6A 1KN6A 5KFBA 3MGJA 4FYXB 3R9LA 5AXMA 1I3OB 4RNMA 2V8HA 2UUBF 3OTEA 4CLWA 3OXFA 2HFVA 1IBKJ 1X5PA 3QQCD 1H2VZ 1NLKL 4IQMA 2YKNA 2D3OR 1JK9B 2F9DA 2IA0A 1M5PC 3RRKA 2BYCA 3EZOA 2Z2MA 3IBCB 2JOQA 4ZK7M 2CPDA 3UNGC 3G2XA 2RKIB 4LSNB 3R2CJ 2VG7A 3KFWX 2RDDA 1FDNA 4O4GB 3KLEB 2ZOGA 3Q83A 4AXIA 5HP1A 5BR8J 3BSCA 4WTOB 2IBKA 3MMJA 1IBLJ 4IFYB 4QR0A 1PJ6A 2Y1JA 4WIQA 1RLDA 4X4UA 2G1HA 4I6WA 3FCVA 3DKDA 2UXCJ 4PKDB 4RR5A 1YDLA 1Q1KA 1U09A 3IR5B 2UV8A 1I1GA 1WNEA 2BBEA 3CCES 4P73A 1W7WA 4RUBA 4RBUA 1YQHA 3TVZA 3BSAA 4PG7A 3FZ2A 2PFDA 4DSJA 2M5YA 3HMJG 2Z30B 2I38A 2DR9A 3TP2A 4JI3J 4TQSA 3VVUA 5KFAA 5CCMA 1KLMB 5LXYA 2GCFA 3BQ0A 1NJIT 2UV8G 3ILLA 2BZ2A 5DZ7A 3WC0A 3TX8A 5IT9U 2FD2A 4B9LA 4IH7A 5FJ4A 2XZTB 2DNNA 1GMWA 4BDPA 2EBEA 3ZZUA 3KOAA 1HPZB 2EFVA 2XSFA 1PYTA 2IIHA 3NWGA 4G1PA 4PEOA 3IXQA 3KLFA 2YQ3A 4A8QA 2EFNA 1H38A 2LMIA 1GH8A 6FD1A 3EZ5A 4WZQA 3KHLA 2IPOB 1VIOA 4I67A 2B9XA 1D3WA 4ZMMA 3FFIA 1T8EA 2Q6CA 4KGXB 4H4MB 2LXIA 5C24A 4U6PA 4AL7A 3QRRA 3P49B 2QL5B 3N4WA 2HZVA 3CIMA 5KT4A 4RLEA 4C7QA 1WF2A 3HO1A 2MMYA 1HNWF 3T5LA 4RUHA 3B8HA 4PQAA 3R6LB 2R7UA 2NQPA 2MHEA 3V4IB 3LP2B 3CO9A 3ENVA 3NCPA 4CLTA 2HGNA 4OJ1A 2HS0A 4P52A 2BVZA 4HDHA 4NLVA 2QL7B 2ZC4A 4ZVPB 4TY8B 2Y8YA 2HVIA 3GB0A 3QGGA 4Y00A 3R7BB 3UN3A 1KQSR 2MZTA 1LW0B 4PAAA 2XBPA 4KSEB 1TFWA 2BJEA 3TQ1A 1T03A 3SQGB 2ROPA 3GYGA 3DRXA 3AT1B 5I3UA 3D6MB 4EGLA 2IBOA 4L76A 4KRWA 2V2KA 5E5NA 4DCPB 1H98A 4ZHRB 5L1JA 4F4YA 3GIJA 4A8WA 3M2UA 4OHZA 3KWMA 3OL6A 1IR0A 1FJCA 3RAMA 5D8HB 2ZH9A 2ZJPQ 2JEJA 3W9JA 4QIWD 4EUVA 2CADA 1U7LA 2RRNA 4YDDB 2W9CB 2CNNB 1Y5NB 4P2SA 5ETPA 1OO0B 2QLBB 2MLZA 3QMQA 2YPYA 4F2SA 2BE2B 3TA2A 4A8KA 2HNYB 2IRXA 3F73A 3UWTA 2M8HA 1KQGB 1C0UB 2UUAF 2P9CA 1SV5A 2LA4A 4DV4F 4B9VA 3KLIB 4JI8F 2D74B 4Y2CA 2CPIA 2OP5A 1FRMA 1JKHA 4P2FA 5B7WA 4LBIA 1S1TA 4ANEA 2V2ZA 3DDKA 2XO7A 3OV7A 4HACA 3VGSA 1PGZA 3T6BA 5KT3A 2AD9A 1KLNA 2O3DA 5D3GB 3P5TL 3HLUA 1P27B 1QVGR 4IH5A 4WKRA 5HROA 5G0RB 2V4JB 1VBXA 3MUVP 2H5JB 2P6SA 5KFTA 4OHVA 2SXLA 3F56A 3GMGA 5HJYA 1RXOB 4MKAA 4CLPA 2BQUA 2DGOA 3ZNUA 1Z2LA 3CJSA 1E6YB 1YJVA 3PRVA 1LNQA 4JI5J 3QPIA 1C4AA 3NNAA 3AY0A 5DDQC 1U48A 1Q8IA 4ZN1A 2DISA 1CJKA 4I0WA 4U8VA 3SDEA 4F4AA 1TZ0A 4DR1J 3OSNA 4ZVUB 1HA1A 3W5ZA 1JLFB 4RU9A 4B9UA 2IMWP 1RT2B 2E29A 4Y6IA 4K4UA 3E8OA 5DGBA 4WFNQ 2AT1B 4LVOP 1UVLA 4YHHF 3GJRB 2N7CA 2DNPA 5F41A 2OPRB 4PCQA 2FUG9 5AE3A 1NKBA 5LMUJ 3U02A 1RABB 4O3SA 4OX6A 2JC1A 2ZBQA 2VBWA 2NXNA 4MIWA 1AROP 1TKTB 2CUYA 3HSDA 1RAIB 2ZM6J 2C2KB 4QWCA 2XEXA 1RAJA 1FRIA 1SL1A 4ZPBA 3IFEA 4ILLA 4I68A 2H5IB 2PA8D 3PM9A 2YWKA 7FDRA 2MZJA 2EG1A 3QJLA 2GAHC 3M8PB 5EWEA 3ZTSA 4NA3A 4FXVA 3OBIA 2AX0A 5IC6B 2BDPA 3TWZA 1NO8A 3PRDA 3LP0A 1ELOA 1TP7A 1NM2A 2RAQA 4ED3A 2M7SA 1S1WB 3HHEA 1RT2A 2W7AA 4DQRA 4Y2KA 4DCJB 2KG0A 3LAKA 1Q5YA 2MKKA 2CQIA 4WU2A 3K5MA 2MB0B 2KJWA 4HI2A 1ZPVA 1HQUB 1X4HA 1RWXB 3NNHA 2W7PA 2OHDA 1JLQA 1UJ6A 1N6QA 1A6LA 3D6TB 2HS3A 2AIRB 3A3OB 3C3LA 1WHWA 2V8PA 1TVRA 5G4DA 2N3LA 3AOBA 1MN9A 3CTRA 2VA3A 1PYSB 3VVTA 4K50A 5BJRA 1J5EJ 2HWTA 2VU5A 4IOAQ 3G8TA 1UFKA 4C97A 2J76E 4JOUA 5E3CA 4CO0A 4N41A 4RKUC 4J5OA 2BXJA 2LQBA 1HMVB 3D67A 3VQSA 5MLCV 1JJCB 2UXDF 1EKSA 1S79A 4FKYA 1W2IA 5H9EK 2DHGA 4JI7J 4IYQA 5GAHU 2J6SA 3HVWA 4K5RA 3IA0A 3NGTA 4WBFA 3VV2B 3R7SB 2MZSA 3A3NB 5IXUA 1HWLA 2BV3A 4IG3B 5ETMA 4DSFA 3BDEA 5KFMA 1HNWJ 5B0BA 1RCXB 2HQ3A 5ETTA 4F0KA 4ZJLA 3GFZA 1Q16B 2B4OA 3TR5A 4ZJOA 4MYTA 3MM9B 4X4NA 5BXIA 1GTHA 1G6BA 2BW2A 2HW3A 3DLEB 4I2PA 2XHCA 2MKCA 1GT8A 1IKVA 1MW7A 2RMLA 5KOXA 2DH7A 1UVKA 1RAAB 4KV8B 4OI3A 3G82A 5FIIA 1NH8A 1S9GB 2B4UA 1NJXA 3U27A 2A6OA 2BE7D 3QSYB 4KE5A 3DRRB 1WC3A 4AD6A 1RWNB 3DLGB 3JTNA 3QT7A 4F02A 2J9DE 1VDHA 3KK2A 3CJ2A 4J9LA 5J1EB 2G9OA 2GGPA 4URSA 1LQ9A 1R8CA 2MY7A 5KFVA 3Q8SB 3D28A 2HSEB 4OI1A 3P8BB 3BQ2A 1ZZNA 1M1KT 3Q8VA 2HBRB 2BQ3A 4NCAA 1G7CB 1FNOA 2R8JA 4E0DA 1TK5A 3MEEB 3R97A 2HQFA 4IRKA 2B7BB 4ECXA 3M8YA 2C2NA 4CCHA 2DGTA 2QA4G 2DR6A 3PW7A 4C0OC 8RUCA 3BEGB 3KHGA 3UO0A 2XSJA 4LRCA 4OX8A 3TANA 2HRYA 1UWAA 3MPYA 1D9FA 4M5GA 2ZHOA 3SI8A 2Z0GA 5J2MB 2VB6A
chains in the Genus database with same CATH topology
2A6OA 2FYXA 2VHGA 2XMAA 2A6MA 2F5GA 2XM3A 2XO6A 4ER8A 2VICA 2VIHA 2XQCA 2VJUA 2VJVA 2F4FA 2EC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6O A;  2FYX A;  2VHG A;  2XMA A;  2A6M A;  2F5G A;  2XM3 A;  2XO6 A;  4ER8 A;  2VIC A;  2VIH A;  2XQC A;  2VJU A;  2VJV A;  2F4F A;  2EC2 A; 
#chains in the Genus database with same CATH topology
 1GXL A;  3H5Y A;  4DL0 C;  2BKN A;  4WZM A;  3GP9 A;  2JEI A;  3G6Y A;  2UUA J;  3BGO P;  4TXS A;  4DV4 J;  3GWC A;  4JI8 J;  3L9Z A;  1UVM A;  2UVR A;  1PJ7 A;  2LDY A;  2OI2 A;  1UPP A;  4DU8 A;  2WTF A;  1WTF A;  2BMB A;  3E01 B;  3W61 A;  3CVK A;  1VQS A;  1S77 D;  5D6G A;  4M8L A;  4ZPW R;  4RNF A;  2J0S D;  1D8Z A;  2X1F A;  1NDL A;  3ONQ A;  5A8K B;  3G6V A;  1C2P A;  1IJE B;  4F36 A;  2RT3 A;  1FNM A;  3PHT A;  1LWC A;  2HGL A;  1K0T A;  1NB2 A;  4RW8 B;  1S72 S;  3KUE A;  2KM8 C;  4ZPV R;  3QJP A;  3FEX B;  3OFF A;  5BYS A;  1VRU B;  1G3O A;  2ZC3 A;  1QM9 A;  4RW6 A;  1U1O A;  3PIP Q;  5L9X A;  3TUJ C;  4OX9 J;  2H65 B;  2OFH X;  4PWU A;  4RW4 A;  4I69 A;  4XPE A;  3IN5 A;  2LP4 A;  3DDI A;  2KDO A;  4RU2 A;  3VZI A;  2VIC A;  3DLK B;  2QSF A;  5KG7 A;  2R7V A;  2OUG A;  5L38 A;  1F5C A;  3TI0 A;  2PI4 A;  2MDA A;  1N32 J;  2NSB A;  3PEH A;  2HVD A;  5CCL A;  1FWL A;  1RB0 A;  1MG7 A;  2CPY A;  3IGV A;  1CJU A;  2KKH A;  3R5D A;  4M5J A;  4CI0 B;  3M7V A;  3QRQ A;  4CLL A;  1XIQ A;  2R2R A;  2JLE A;  2GJI A;  3BF4 A;  1S9E B;  2BRL A;  4FF1 A;  3PKM A;  1RTH A;  1TL7 B;  2CDQ A;  2FTR A;  2YNI B;  3M05 A;  1TUV A;  1N36 F;  2B43 A;  2C2E A;  1DQ9 A;  1RTI B;  5D0G A;  2E1A A;  3I56 S;  2QX0 A;  2V9W A;  2RS2 A;  4PG6 A;  4DQI A;  3HKW A;  2OPP A;  4F26 A;  1L3S A;  3QGP A;  2ZBR A;  4M94 A;  1KP6 A;  5DDR C;  1N5Y A;  1TAQ A;  4DL3 A;  1NDC A;  3DGP A;  3GQC A;  2M2B A;  1IKX A;  1ULR A;  3FZB A;  1WD6 A;  3CJ3 A;  4USM A;  2XO6 A;  4N8O A;  3D0G E;  1OSD A;  1SC1 B;  2VKZ G;  1REV A;  3QBC A;  3I4P A;  2M52 A;  4KAI A;  3M1V A;  1JLG A;  4OZN A;  3MED A;  1SJ4 P;  2M8D B;  3D1H A;  4K4Z A;  3FSI A;  2KM8 B;  3JQM A;  4LSZ B;  4KGK A;  4AL6 A;  1X8D A;  2Q79 A;  1SKS A;  3K8W A;  1MN7 A;  2UUT A;  3BM7 A;  3PY8 A;  3OQ2 A;  3M30 B;  2W8L A;  3BGL A;  3B78 A;  1RTI A;  2ZOF A;  2DO4 A;  3KHH A;  4K8R A;  3W3S A;  4ID5 B;  3D3C J;  4YEA A;  5ETK A;  1EIY B;  4Z37 A;  4NEZ A;  1JWW A;  3HJV A;  3KG4 A;  1T9W A;  2YKM B;  4PAB A;  4WF9 Q;  3DFE A;  2EK6 A;  2F4V F;  1UEU A;  4FYW B;  4U95 A;  2C28 A;  4F67 A;  1PO6 A;  1I6J A;  4NOH A;  2IY5 B;  3UCU P;  3CMQ A;  2GMH A;  2UXD J;  3SMZ A;  3R6G B;  1RHU B;  2LDI A;  5EHH A;  5HBM B;  4GVL A;  1ZTW A;  1PBU A;  4DR3 F;  2CVI A;  3CF5 Q;  2WRM A;  2GFF A;  4CLU A;  5JUM A;  1UTA A;  2HRT A;  5GAG U;  5FLX U;  3QZ7 A;  2GS8 A;  1RTJ A;  4NWB A;  2W8K A;  2ZWO A;  4WU3 A;  4WK1 A;  1GEH A;  3EE3 A;  2FDN A;  3ZFV A;  2HFU A;  3AXM A;  4C4W A;  4ICL B;  3HVT B;  1BMQ B;  2DNZ A;  2HYI B;  3CPW R;  2XNQ A;  2Z58 B;  5THW A;  3KJQ B;  3ICL A;  2VG6 B;  1RT1 B;  2AGQ A;  4YN3 B;  2KN4 A;  1FA0 A;  2DD8 S;  1SL0 A;  5EX0 A;  3KMQ A;  3J80 Y;  1HYS B;  4P6Q A;  2ALZ A;  3KJV B;  4OJG A;  4K4W A;  3T1Y J;  1FE4 A;  5CZV A;  2ROE A;  2B51 A;  4A8S A;  1YBT A;  1NJZ A;  3US5 A;  2DY9 A;  2I5J B;  2RF2 B;  3HD2 A;  4NZ7 A;  3NMA A;  2RH3 A;  2VFR A;  2Y1I A;  3VAL A;  3SZ2 A;  1MU2 A;  2GHP A;  3I87 A;  2R8I A;  3TUI C;  2Y1R I;  4K4Y A;  1HNX F;  3BKT A;  3QFW A;  1Y9O A;  1UFL A;  2OML A;  4GKJ F;  3DLB A;  1M5O C;  3GYN A;  5C25 A;  5IT4 A;  1WC1 A;  1U24 A;  2KXH A;  3MEC A;  4I2Q B;  1UA1 A;  4NZ6 A;  2RD5 C;  1RK8 A;  5E41 A;  1XJW B;  2FZK B;  3AA8 A;  3OVA A;  3CJ8 A;  1GMW D;  1JMT A;  3C6U B;  5EGY A;  1S5Z A;  5E7O B;  2OPS B;  3Q24 A;  1S1U A;  2FYX A;  4UT4 A;  1QE1 B;  2CWX A;  2V9K A;  1LWE B;  5EWG A;  2K7K A;  3OD2 A;  2K06 A;  1FX2 A;  3DRP B;  2GQ2 A;  1WC0 A;  1S49 A;  3QO9 B;  1YZ7 A;  3LPY A;  2GVZ B;  5L1L A;  4QIV A;  2DY1 A;  4MAK A;  4ZP8 A;  4C8M A;  4RW7 B;  4IO9 Q;  1CQM A;  2VUG A;  1R8B A;  1Y3J A;  8ATC B;  2R7S A;  2CQ2 A;  4ZVT B;  3PJX A;  2VJU A;  2XMJ A;  1IBM J;  2R7R A;  5CZX A;  2XUL A;  4L3K A;  1EAR A;  2P2C B;  3EGW B;  2IVF B;  2C1E B;  4KJI A;  4AQY F;  3K7R A;  5AE1 A;  4RO0 A;  4TLR A;  2QFI A;  4AYB D;  4QW8 A;  1S12 A;  3RAQ A;  2H54 B;  2CPX A;  2EBG A;  1EET A;  3MUM P;  3RR7 A;  1GMU A;  4U96 A;  4CO4 A;  2Z56 B;  2ZWP A;  2NLW A;  3NGK A;  5IC4 B;  1VRT B;  4B9M A;  4FF2 A;  2OSR A;  2MJU A;  3BH6 B;  4TVA B;  1UW9 A;  2ROG A;  3OXL A;  5J2Q B;  1Q5V A;  4TN2 A;  2IRU A;  3CD0 A;  1HNI A;  4V19 X;  2AJ4 A;  4X4R A;  2CPH A;  1HIY A;  4ZIV A;  1AZS B;  5KFZ A;  4WYW A;  2EEY A;  2GML A;  1Y10 A;  5U47 A;  2APO A;  3B6B A;  3ZXW A;  1WG5 A;  3MAH A;  3PW2 A;  3LAM A;  2F8H A;  3TEG A;  5CXT A;  1RCO B;  4AND A;  3BGR A;  4LQ9 A;  3GG0 A;  1NXI A;  1S1X A;  1RT4 A;  1NCL A;  4WPA A;  1NH7 A;  4DJB A;  1TK8 A;  4CLY A;  1RHR B;  4OI4 A;  1KTV A;  5DET A;  2WSE C;  4PXE A;  2E1P A;  3UPF A;  5B0A A;  4P9S A;  1S6P B;  4RW9 A;  3H5X A;  3FQK A;  3GR0 A;  4C8N A;  3UVJ A;  1N36 J;  3M32 B;  4F4X A;  1KHV A;  1Q8L A;  2D1C A;  4Z2X A;  4W92 B;  5B0C A;  2C42 A;  1N5T A;  5LOQ A;  5DG7 A;  2NCK L;  3PVX A;  1A9N B;  2HK2 A;  3CXC R;  3MMC A;  2XMW A;  1VQN S;  1U4B A;  3QLH B;  1NK5 A;  1XBW A;  3GYX B;  4N7T A;  5L39 A;  2DRD A;  2EWH A;  2HG4 A;  3ZZO A;  1VQO S;  4KPY A;  1HWU A;  2RU3 A;  4N77 A;  3CCS S;  5DDO C;  5B0D A;  1RT3 B;  3SFU A;  4QIF A;  1SJ3 P;  4NZ0 A;  2IDE A;  2VA2 A;  2DIU A;  2YX7 A;  3CCZ A;  1RHM B;  1PCA A;  4O44 A;  5AE2 A;  2ZBP A;  3OJU A;  2L48 A;  4WK3 A;  5HVH A;  2RIJ A;  1RHJ B;  5C2G A;  3T1A A;  3W2W A;  2XLK A;  1P9Y A;  3FCW A;  3DOM A;  4EEY A;  1AUD A;  1OY8 A;  3MEG A;  1JXE A;  4OHY A;  3CJK A;  4ED1 A;  4NLX A;  3LO3 A;  1OS5 A;  1SH3 A;  3RZA A;  3MCN A;  1RDR A;  2JLG A;  3T5J A;  1GXT A;  4NXN F;  1F6T A;  2FPH X;  1X4B A;  1WI8 A;  4F50 A;  4HH0 A;  2X3G A;  2QYC A;  2CIM A;  5KFF A;  2WVD A;  4ILM A;  2HNZ A;  5K8P A;  1S6O A;  1UVJ A;  1UW4 A;  3BSN A;  2EKN A;  2HFZ A;  5AT1 B;  1WOS A;  4DF4 A;  3QLH A;  2F4V J;  2WVB A;  4HHJ A;  4RX6 A;  4K59 A;  1PJ5 A;  2DXE A;  4DV1 F;  2DGX A;  4M5D A;  3PTW A;  4H4K C;  3MM7 A;  1D9D A;  2JFD A;  4FNI A;  3GON A;  2XMM A;  1FRX A;  2E5J A;  3AH6 A;  2VZ9 A;  3PR4 A;  1X7V A;  1Q8B A;  4G65 A;  1FRH A;  3PO4 A;  3V6D A;  3MCS A;  5KFO A;  3PW5 A;  3PX4 A;  2YXL A;  4WP9 A;  5DRK A;  3ZTO A;  1T3O A;  2X1A A;  4TLQ A;  1EHW A;  3KLH B;  4DX6 A;  2G2O A;  4DPO A;  4NA2 A;  3MD1 A;  5LL6 d;  3GCW P;  4ZVH A;  3J7Z 5;  2A18 A;  2XS7 A;  1JLA A;  3UFC X;  3FGV A;  4UUW A;  1LEO A;  2BW7 A;  1P6T A;  3B4M A;  3KJF B;  3U1N A;  2G1D A;  1Q78 A;  2V6A A;  2DH8 A;  4Y65 A;  3KK1 B;  3KDO A;  1WDD A;  3PRB A;  1TKZ B;  3OHB A;  4HT5 A;  2HKE A;  3VWS A;  3HT3 A;  1YIT S;  2A1B A;  2V68 A;  5C7P A;  1MWY A;  3C15 A;  2F40 A;  3OFE A;  3RJM B;  3P6Y C;  4D3H A;  2HHS A;  4ELT A;  3BSO A;  3W5X A;  2GZO A;  2IM1 A;  4K4X A;  1FEE A;  3FMW A;  1AW0 A;  2AMC B;  4GKJ J;  1HKA A;  3TVY A;  1C0T B;  4USU A;  1RAG B;  1KVJ A;  4M5H A;  2GJ2 A;  1UZD A;  4ZOS A;  3I9V 9;  2D9P A;  1M0S A;  4BWM A;  2ZH6 A;  1E6V B;  1EQM A;  1QDU B;  1VQL S;  2HHH F;  3JSM A;  3QGI A;  2YWH A;  4C11 B;  4Z7C A;  1FDA A;  4UQG A;  2VBX A;  2J7W A;  2DK2 A;  4HI1 A;  1UA0 A;  2GHV C;  2CQ4 A;  2CQB A;  3NWR A;  3M6V A;  4JB8 B;  5HQM A;  5D4P A;  3CSK A;  3V6J A;  1NK0 A;  5GAD U;  4FF3 A;  2LQ8 A;  5IV4 A;  3DYA A;  2LXF A;  2HS4 A;  3T9Z A;  4WXO A;  3A8E A;  4DX7 A;  1SJQ A;  3DM2 A;  1T95 A;  4Y3C A;  3M8Q B;  1FK9 B;  4ZP9 A;  2BKP A;  5KFG A;  3L95 X;  4IRD A;  2ZHA A;  5IWA F;  3J7Z T;  5A0Y A;  1HNV B;  5F8J A;  3KMS A;  4CLF A;  1RAD B;  4N8N A;  1CUL A;  1PAU B;  3MMA A;  1FE0 A;  3IS9 A;  3CCV S;  2VFU A;  3RW7 A;  3T1H J;  2E5L F;  4AQY J;  1CEZ A;  4N5S A;  1T05 B;  1NZ8 A;  2FZG B;  3O8W A;  2MZ1 A;  3OUY A;  3QAU A;  2HIQ A;  3Q89 A;  4OZJ A;  1OYE A;  1OIA A;  1O8B A;  3AQP A;  2FVS A;  1MMD A;  3MR7 A;  4EZ9 A;  1IKW B;  2QLX A;  2YX1 A;  2R7T A;  1S0N A;  1LW2 A;  2FVP A;  3OPK A;  2LVW A;  2R3V A;  2VBY A;  3R5G A;  1B99 A;  2KYX A;  3DOK B;  4F4Z A;  1MSW D;  2V2Q A;  5KG1 A;  1T9U A;  3OR1 A;  4GVB A;  4MIB A;  2GVD A;  3SCI E;  5CAB A;  1LWF A;  1WSV A;  3A4T A;  2KFZ A;  3CIZ A;  2DPI A;  5IM0 B;  4DR7 F;  1JXL A;  2BM0 A;  1VOM A;  2MLY A;  2L41 A;  2NXU A;  3M8Q A;  3GCX P;  3BR9 A;  3P4U B;  2CQ1 A;  4ZS6 A;  2R42 A;  3AXK A;  4MKY A;  3MAA A;  3QAE A;  4QCL A;  4TYA A;  3BZQ A;  1IKY A;  3QNW B;  2BR0 A;  3W1Y C;  4HT7 A;  2OIH A;  3R5A A;  2UVW A;  3QID A;  4H4O B;  2L9W A;  4RBV A;  2G0I A;  1XK8 A;  4HKQ A;  1GQE A;  2QN6 B;  3W2V B;  5AXL A;  4NRT A;  4Q43 A;  4NYO A;  4MMO A;  1S0M A;  4U7U D;  1UPM B;  3N79 A;  1RWO B;  2L9N A;  3L4B C;  2VAS A;  3CJ4 A;  4MKV A;  3BBB A;  3I96 A;  3MR2 A;  1LFP A;  4NI2 A;  4OI6 A;  4WWS A;  2C2D A;  5HVF A;  1BQM B;  2Z4P A;  1SH2 A;  1LWX A;  3N01 A;  1Z2Z A;  3BGF A;  1WKJ A;  3T41 A;  4TNO A;  1X31 C;  1HR0 J;  5KG5 A;  4B3M J;  1J5O A;  2VQE J;  4ZIW A;  1DTQ B;  4JYA J;  2GMJ A;  3G8S A;  1H0H B;  3M2V A;  3T6J A;  4N76 A;  2ZD1 A;  3BB5 A;  4LFB F;  5CYJ A;  3CB4 A;  3M6X A;  1H2T Z;  1S4F A;  3D54 A;  5RUB A;  3T9N A;  2Z2L A;  4BWJ A;  2I8E A;  3TEH B;  4HEA 9;  4ANC A;  4DZ6 A;  3J7Y U;  4KO0 B;  1F5A A;  1XR7 A;  4H4O A;  5LJ3 Y;  3J81 U;  5HMX A;  2F65 A;  3WZ0 A;  1RAH B;  5ETS A;  3D6F B;  3AA9 A;  4NXN J;  1DAX A;  2GV1 A;  3N6L A;  3BYP A;  1K8A T;  2W2M P;  5C42 B;  2RQM A;  2VFV A;  4KR0 B;  4LR7 A;  1T94 A;  1I94 F;  2AEJ A;  3IO1 A;  1V3Z A;  4WCE Q;  3M2R B;  4R5P A;  3P5B P;  4WE1 A;  2IAJ A;  1BLU A;  4EBD A;  4O3O A;  5J2P B;  2ZVS A;  3K5P A;  3AOC A;  4CLZ A;  3LP1 B;  2UP1 A;  4OJH A;  1U49 A;  3H7H B;  1NK8 A;  4DV1 J;  3ZZZ A;  3B54 A;  5H1S V;  1VBK A;  1KR4 A;  2W2Q P;  2B5J A;  4K4V A;  1A7G E;  1DTT B;  1K0V A;  2JC0 A;  3EUN A;  1G4C A;  1IM6 A;  2FGO A;  3CCM S;  1CS4 A;  2E44 A;  5F3T A;  2HPU A;  1UCN A;  2MQO A;  2VJV A;  3ZO7 A;  1S6Q B;  1BD6 A;  1U1P A;  4DG1 B;  1OQ6 A;  4ZLP A;  3GIM A;  4DI6 A;  1CJV A;  5IS2 A;  1YJU A;  3MM6 B;  4ZLJ A;  1C1B A;  3KLG A;  1FKP A;  3W9I A;  3HHL C;  2VFS A;  3GIL A;  4F25 A;  4HTJ A;  3Q8Y A;  1K44 A;  3UCZ P;  2RS8 A;  4WFZ A;  4ZVR B;  2C2M B;  1TKX A;  3UCG A;  4W98 A;  2ZH7 A;  4DR4 F;  4J9K A;  3R2D J;  3LPE A;  1GMV A;  4RBT A;  1DHM A;  1JLB B;  4R8U B;  3FQL A;  4DV3 F;  2ATL A;  2OLW A;  4DFM A;  2BOA A;  2XG8 A;  3LOU A;  3TRG A;  1LV5 A;  4NCB A;  3QWP A;  4NXM F;  1V3S A;  1ZM3 A;  4Q2M A;  1UMJ A;  2KL8 A;  2AHO B;  2KRR A;  2GQQ A;  3U1L A;  5JVG Q;  1WKK A;  1ZM9 A;  1ZAX A;  3WDO A;  4DXL A;  1UEK A;  1KTQ A;  4I1T A;  1FD2 A;  2FJX A;  2XQC A;  5HN0 A;  4TKT A;  2O5D A;  4HDG A;  3Q23 A;  1JQG A;  1B4S A;  4YB5 A;  2BA9 A;  3MM6 A;  5E3A A;  2HHH J;  2HMI A;  2I2Y A;  5K9F A;  5B0G A;  1URN A;  1IM4 A;  2JWN A;  1VQ4 S;  3I82 A;  3SSR A;  3C16 B;  5F9N A;  4ERD A;  4MH8 A;  2UUC J;  4NLO A;  3DLJ A;  4ECZ A;  1S4E A;  3DRS B;  1SUQ B;  2YVS A;  4X4P A;  2KXF A;  2J9C A;  3QZ8 A;  1GK8 A;  1NSP A;  4FXW A;  5CAA A;  3BRE A;  2ADC A;  3JB9 k;  2H1Y A;  3M6W A;  3D7S B;  1WC6 A;  1RBO B;  3OR2 B;  4HL9 A;  2EFG A;  5HLF B;  2KVQ E;  1XTZ A;  5KFD A;  1U26 A;  3T5H A;  2WON B;  1ICE B;  1RT7 B;  4R25 A;  2YPZ A;  4B9N A;  5CYQ A;  3IRX B;  4N47 A;  4HH1 A;  1FI4 A;  3A8J A;  3ZZY A;  4M63 A;  1T9T A;  4UF4 A;  3JSB A;  3HHL B;  2NXJ A;  1ZM4 A;  1SJR A;  4QJV A;  4AUK A;  2E5L J;  1SCJ B;  1JLC A;  2CQP A;  3ULH A;  1NBE B;  1P1T A;  2OPQ B;  4LF9 F;  1YLX A;  3JQK A;  5IOL A;  5FDL B;  4O0N A;  2HEK A;  2QT7 A;  5MAO A;  4V1A k;  3RRH A;  1WJ9 A;  3I32 A;  4BLG A;  3CCR S;  2XY7 A;  5KFK A;  1NPK A;  2K3K A;  3RBE A;  4UUX A;  3DHX A;  2LFV A;  3K2Y A;  2X1B A;  1N34 F;  2J9D A;  1TL5 A;  3CWJ A;  3HSZ A;  4JBC A;  3RTV A;  4W4M A;  4ZPT R;  1MRO A;  4PWW A;  3OTO F;  2HFN A;  4YB1 P;  2VG5 B;  4I7F A;  2FY1 A;  4M5I A;  4DR7 J;  5A8R A;  3RBZ A;  3TUZ C;  1TV6 B;  2YQ1 A;  1FJ7 A;  2DEJ A;  5L1K A;  1NUE A;  2HAI A;  2CQD A;  3K0J A;  5I42 B;  1FXD A;  3BQ1 A;  2CJ9 A;  2WHO A;  2DPJ A;  4FYV B;  1WTB A;  2XC9 A;  3L7U A;  2ZE2 B;  3NLC A;  1DRZ A;  4QYZ J;  4A8O A;  5KFJ A;  4KC5 A;  4ELV A;  2MGZ B;  3V2U C;  4F8R A;  1DQA A;  4X4S A;  3MTJ A;  4QR1 A;  3MOJ B;  2AWZ A;  4DR6 J;  3SSQ A;  1U2R A;  5FDL A;  3DGV A;  2YWE A;  3KTQ A;  4ED2 A;  1TQL A;  1Y00 A;  1L3T A;  3KLV A;  4OX7 A;  2YQ0 A;  2I9S A;  2EPI A;  2UU9 F;  3MM5 B;  1NB7 A;  1TL4 A;  2X7I A;  1U0H B;  2CDR B;  3EVW A;  1S1V B;  3C14 B;  2EXU A;  4ZVG A;  3BBC A;  5KFS A;  2IRY A;  2JL9 A;  2NYH A;  3OLA A;  3Q8Q B;  1IR2 A;  1CLF A;  3K8V A;  4LFB J;  4IR9 A;  2FLL A;  1VJW A;  1ZA2 B;  1TUW A;  1CVJ A;  4DCO B;  4YUD A;  2WOM B;  1L3U A;  3PJW A;  4OYB A;  4CTA A;  4ETZ A;  4YOE A;  2BJ3 A;  2YNF B;  3KXD A;  3RB6 A;  4RPF A;  3HM9 A;  3ZTQ A;  2IFX A;  1AT1 B;  4U67 Q;  2FVR A;  1ROF A;  4LF5 F;  2BJ9 A;  2VPY B;  3DOL B;  1U6F A;  1VLY A;  2WVF A;  1C1C B;  4LF6 F;  3GZ7 A;  1SC4 B;  3O1L A;  1X9W A;  4O3R A;  1DLO B;  1X9M A;  4B3O A;  2IDL A;  3IG1 A;  4QOT A;  3CJR A;  2QMW A;  1HBM B;  3I31 A;  1LXN A;  2B8Q A;  3GTY X;  3AOD A;  3GFX A;  4WP3 A;  2AU0 A;  1RGV A;  4F04 B;  2EK1 A;  4CYU B;  4LFA F;  2NUH A;  4PG5 A;  3U7J A;  3ET6 B;  1ZTT A;  2I1R A;  4MTP A;  2LEP A;  2IA6 A;  4DL6 A;  1RWU A;  3IR7 B;  1HHQ A;  1IBC B;  3GFH A;  5K14 B;  3QAT A;  1S99 A;  2NXC A;  4C0B A;  2HND B;  1NSQ A;  4X65 F;  1FT8 A;  2FLO A;  4OYA A;  1Y5I B;  1VQM S;  1N33 F;  3LH2 S;  3AB4 B;  1BHN A;  3K57 A;  2E7V A;  5DZ6 A;  4PQU B;  1BQN A;  3RB4 A;  1SB6 A;  1IQZ A;  3NCR A;  3HCX A;  1OY6 A;  2QG9 B;  2K3I A;  1S97 A;  1R8P A;  3POT B;  1HBO B;  3WC2 A;  4PUO B;  3AAW B;  2QA1 A;  4DR4 J;  1NSK L;  3TAM B;  4H54 A;  2W9B A;  2L9D A;  3NBP A;  2JNJ A;  2OTL S;  4DZD A;  2J5A A;  1HQE B;  3VZH A;  2YNG A;  4DV3 J;  2GIR A;  4C8Z A;  3PHE A;  4QZV B;  2W7O A;  2G13 A;  4NXM J;  1KQK A;  4KKO A;  1M5V C;  4J9V A;  4KFB B;  2A6M A;  3CDB A;  4ECW A;  2MKS A;  3UE2 A;  1R0A A;  4KT0 C;  4CM2 A;  1O51 A;  1HBN B;  2Y0S D;  4DUT A;  3KUH A;  4LSL B;  3K5L A;  1EJ7 L;  3CCW A;  4PWD A;  2H5E A;  4XO0 A;  2EG2 A;  1CJT B;  4JV0 A;  3PX6 A;  1X5O A;  3TQE A;  3C6T B;  2BJ7 A;  1FKO B;  4OLO A;  2WW4 A;  2XS2 A;  2MST A;  3EDR B;  1X4E A;  3V81 A;  2B6A B;  1UWB A;  1DFD A;  3TYT A;  1YK9 A;  1MNE A;  1TMJ A;  3SQO P;  1M5H A;  4CO3 A;  5HK4 A;  2IJR A;  2HHW A;  3SV3 A;  2BAN A;  2WZ1 A;  3OFH A;  1RT6 B;  3QIP A;  5J2N A;  1V9O A;  4B02 A;  3H5U A;  4ECQ A;  3GJS B;  3CED A;  2DGW A;  4CDI A;  4QWE A;  2HFO A;  2K1R B;  4FS1 A;  4M5N A;  5ETR A;  3TJ8 A;  4LF7 F;  2H9Z A;  4Q7A A;  1RWW B;  1NKC A;  1RTD B;  2CJA A;  1FVQ A;  5I3P A;  2LXU A;  2KZM A;  3S8S A;  1UFW A;  1VR6 A;  4ED6 A;  2RKI A;  4IR1 A;  4LSN A;  4USK A;  2HUR A;  4ED8 A;  2CG8 A;  3NOC A;  2W2N P;  3V6H A;  4O4G A;  3JTO A;  2IC3 B;  3KLE A;  4LF9 J;  3KJN B;  1JX4 A;  2WSF C;  4IFY A;  4ECS A;  3W64 A;  4K4S A;  4EU0 A;  1A0O B;  1RZM A;  2YKP A;  3HVR A;  1QLN A;  2DBB A;  5D0E A;  2YBV A;  1BWV A;  2I0X A;  4BS2 A;  1KQF B;  3I0R B;  5F9L A;  2CJY B;  2IYI A;  1NJW A;  9RUB A;  4QWB A;  2C22 A;  5KFI A;  3EMT A;  2IHR 1;  4LIR A;  3ITH B;  3Q2T C;  3Q22 A;  4ES2 A;  1B70 B;  4TY9 A;  4QYR A;  2HLU A;  2GO8 A;  2ADB A;  3VAM A;  4HYK A;  2OGU A;  1UZH A;  2MLX A;  3OTO J;  4EWT A;  1F0X A;  4L73 A;  1MMN A;  1KLM A;  2A2D A;  2FIU A;  1LOU A;  5HJX A;  3PJ9 A;  1SKU B;  2DEI A;  3M8S A;  4DV7 F;  4JV2 A;  3GG1 A;  4B9T A;  1BQX A;  2VDI A;  3G4S S;  3DN9 A;  1HPZ A;  4QQB A;  3DMJ B;  7AT1 B;  3WX8 A;  2AGP A;  2UU9 J;  2EW9 A;  2CG4 A;  5DQH A;  2WAQ D;  2KG1 A;  5T41 A;  3TNV A;  1VIX A;  5HAT A;  4Q0B B;  3CC7 S;  2ASJ A;  1N0V C;  2VF3 A;  2HHV A;  4K5S A;  2LLZ A;  4OI0 A;  4N56 A;  3ZTP A;  2C3Y A;  3RG6 A;  3MUT P;  4H4M A;  5IZH A;  1S48 A;  2V2V A;  3RB0 A;  2WBM A;  4ZCI A;  4JV5 F;  4DEZ A;  4ECT A;  1B7Y B;  1VHI A;  3VAG A;  2DR5 A;  2KFY A;  3KG1 A;  2MZQ A;  1R8H A;  3BJY A;  1U1N A;  4WKY A;  2IM0 A;  2BKO A;  3IRW P;  4U7C A;  2RUS A;  2OEK A;  2X51 A;  3V4I A;  1X4C A;  4LRF A;  3LP2 A;  4LF5 J;  1DQ8 A;  3LQV A;  2AYE A;  3C2P A;  1M1G A;  4TY8 A;  3OSP A;  3TZW A;  2YWG A;  4Y28 C;  2D3O 1;  4B3T F;  4IOB A;  4MFB B;  2C3P A;  1X0F A;  1LW0 A;  4O3P A;  2ALY B;  4PZV A;  1HBU B;  1NRK A;  3SQG A;  2AGO A;  4F7V A;  4DV2 F;  3FBE A;  3CCT A;  1M5K C;  3N6N A;  2N82 B;  4G1I A;  2Z2Y B;  1R3N A;  4DR5 F;  2JRS A;  4NL5 A;  4ZHR A;  4PXC A;  2ILZ A;  3OHA A;  2AZ3 A;  4YFU A;  3D1O A;  2UXB J;  4EMD A;  2YKQ A;  1HD0 A;  1NK7 A;  1PBA A;  3K58 A;  4DLG A;  4C48 A;  2W9A A;  2FZC B;  4CO2 A;  4X65 J;  3PYE A;  5F0W A;  1XNR F;  1N33 J;  4XDC A;  4BC7 A;  4FXD A;  3PNI A;  4ED5 A;  2RQC A;  3PEJ A;  2QMX A;  4KY3 A;  2W9C A;  3IR6 B;  2YKA A;  2B4V A;  5J1N A;  2F8E X;  4ES1 A;  2YH1 A;  1YBU A;  4ZPD A;  2BE2 A;  4O23 A;  4DUZ J;  1TK0 A;  2W4C A;  1VGY A;  2HNY A;  4MK7 A;  1C0U A;  1TKD A;  3TOQ A;  2CJX B;  4J9O A;  3KLI A;  3UN2 A;  4HTI A;  5HQL A;  1SC6 A;  1IN0 A;  1K1Q A;  2FY8 A;  5HQ8 A;  5E0O A;  2UUB J;  3CT9 A;  1ZBT A;  3HX9 A;  3KNA A;  2KT2 A;  4OQJ A;  4IO1 A;  3THP A;  4G1Q B;  5GAE I;  2R8G A;  2QRR A;  4LJM A;  3BKU A;  1Q82 T;  1TU0 B;  2IVM A;  5D3G A;  3N9U C;  1L3V A;  4TU7 A;  1QY7 A;  5E33 A;  1GNK A;  2ASY A;  2GAG C;  5G0R A;  1ZYQ A;  2V4J A;  4ETX A;  2OD6 A;  2FC8 A;  1KC8 T;  2ERR A;  3W62 A;  2RRA A;  3I9Z A;  3ZZ0 A;  2O01 C;  4K7Q A;  1TL3 B;  2LEC A;  2CQC A;  2HBQ B;  2POK A;  1OMS A;  1YJW S;  1OYD A;  3OL7 A;  1E6Y A;  3X3U A;  1VMB A;  1SIZ A;  5IQ6 A;  2R2T A;  4ZCM A;  3MM8 B;  2Q66 A;  3M8Z A;  1ZS6 A;  4LRD A;  2RHS B;  1NDK A;  4R0E A;  1JLF A;  2U2F A;  4ZP6 A;  3FBB A;  2HHX A;  1NAQ A;  3NEK A;  3H4B A;  2N4D A;  3VTI A;  1RBL A;  4LF7 J;  3I6P A;  2ZZN A;  3HZE A;  1ZAV A;  1U6B A;  3MHY A;  5LSR A;  1XMQ F;  3EX7 B;  2E9R X;  1QAX A;  2OPR A;  1U2F A;  1XR6 A;  5KG3 A;  5BYQ A;  2ZH3 A;  2RQK A;  1N56 A;  1UEV A;  3MF5 A;  1IBL F;  1RI7 A;  1IWG A;  2PI5 A;  1TKT A;  1TL3 A;  3BPD A;  2E66 A;  3CJ0 A;  2BOP A;  1ZH5 A;  4UW2 A;  2PC6 A;  3H2L A;  3GLJ A;  4EBC A;  3MM8 A;  1NKE A;  3DI6 B;  1IVZ A;  2QA2 A;  1F60 B;  4EYI B;  1YRT A;  2CJK A;  3M8P A;  2P8I A;  3W9H A;  4BBY A;  3E51 A;  2FVQ A;  3MI7 X;  4PXD A;  3WIU A;  1OPZ A;  4XDD A;  4D3G A;  3GII A;  3OXG A;  2MTL A;  2A3J A;  2PE8 A;  3F0N A;  4NLP A;  1S1W A;  2LYV A;  1VQ7 S;  1TL1 B;  4B3S F;  1MWQ A;  2H48 B;  4NYZ A;  1WOP A;  3PW4 A;  3H2V E;  3EPI A;  4LF1 A;  4MJK A;  3VAK A;  2DNY A;  1B0T A;  4HLB A;  3UN5 A;  1WUU A;  2KI2 A;  1HQU A;  1X60 A;  3PX0 A;  2DNR A;  2JLF A;  4DV7 J;  2AF6 A;  3JYT B;  5DS7 A;  1WF1 A;  4A47 A;  3MMB B;  2CZV C;  4YR2 A;  3KNG A;  2W4D A;  3TUP A;  1NEE A;  5L1I A;  2FB0 A;  3S6E A;  2GNK A;  4DWI A;  2PA3 A;  3MTK A;  3KKF A;  1RT5 B;  1FWK A;  3CO0 P;  1YHQ S;  1TFY A;  5FD1 A;  4DHV A;  3EXC X;  2ASL A;  2MSS A;  4FBU A;  3T5K A;  4QWD A;  1HMV A;  4YDX A;  4EBE A;  4NYP A;  3TA0 A;  2VL1 A;  4DMZ A;  4BHQ A;  2BE9 B;  1FFW B;  1VCT A;  3D66 A;  1NPR A;  2CQ3 A;  1FJE B;  3W60 A;  2V8G A;  3KK3 B;  2HFS A;  3G6E S;  3R8Y A;  4IG3 A;  4YR3 A;  1KNZ A;  4CWB A;  3M4X A;  1HAR A;  2KO1 A;  3LTO A;  1M1H A;  1NJY A;  3PR5 B;  2UVV A;  4F3Q A;  2VKR A;  2E5G A;  3I0S B;  2E1R A;  1JLE B;  4CLK A;  4EYH B;  4Y2M A;  2B7C B;  1RWP B;  3SBM A;  4KB7 A;  2DKO B;  3MM9 A;  4EI2 A;  1FCA A;  5B08 A;  1HNZ F;  4DSK A;  4LR9 A;  3DLE A;  2E9Z A;  3UNY A;  3CCL S;  4KV8 A;  1RT5 A;  3LGN A;  4PXB A;  2ACY A;  1S9G A;  1QSY A;  1VBZ A;  1GTE A;  3WIV A;  1ZZF A;  1YJR A;  2B9W A;  3DRR A;  3ZZT A;  4DV2 J;  1XC9 A;  2P9E A;  3DLH A;  5KFQ A;  2MKJ A;  3DLG A;  2Y1L B;  3ZZP A;  4J9R A;  4DR5 J;  5J1E A;  3G6X A;  1VC5 A;  3Q8U A;  2BAB A;  3KK3 A;  4LRE A;  5GME A;  4DU7 A;  5HI7 A;  5HO4 A;  1Y11 A;  3Q86 A;  5F8L A;  2VQF F;  2VOO A;  3IAS 9;  5A8W B;  3MEE A;  1F3F A;  5HVG A;  1YX2 A;  1JLE A;  4HR2 A;  1KOO A;  4IDK B;  2DXF A;  3CW2 C;  4J91 A;  2N4C A;  1NZA A;  4F2R A;  4IOC Q;  4U7U K;  2DT9 A;  2FQQ B;  3OVB A;  1FRL A;  1FER A;  5CYM B;  4NCG B;  5AJ3 F;  4KBI A;  1K47 A;  5D4L A;  2BX6 A;  2ZJQ Q;  3IBW A;  4GO7 X;  4MKB A;  1WEY A;  4CIO A;  1MLA A;  2CFX A;  5KG4 A;  4JI0 F;  4OZ0 A;  4QBU A;  2RQ4 A;  4A8X A;  5J2M A;  1J2V A;  3IMQ J;  4DOZ A;  1EP4 B;  2DXD A;  2DNG A;  1F9H A;  1WHY A;  2KJV A;  2LU1 A;  2DNM A;  1PAE X;  2WBR A;  1T9Y A;  2N7Y A;  1Y4Z B;  2D9O A;  2KHD A;  4DR2 F;  2F3J A;  3GV5 B;  3EM1 A;  2KB2 A;  3PO5 A;  3RB3 A;  3E01 A;  2YKN B;  1WC4 A;  1WEL A;  3HHN B;  2UUW A;  2KTQ A;  1YRU A;  5HL7 Q;  3AB2 B;  5M2U A;  5D4O A;  5A8K A;  4RZR A;  2HWI A;  2CKW A;  4YHH J;  4J9U E;  4RW8 A;  1R43 A;  3R1L A;  1FFS B;  2M88 A;  3E2E A;  2QC3 A;  3W66 A;  2CA9 A;  2VG7 B;  2OD4 A;  2B0G A;  1VRU A;  4OYW A;  1N48 A;  1NME B;  4J9S A;  5HP1 B;  3NS6 A;  3EJM A;  2V69 A;  4W90 B;  2ZVI A;  1TAU A;  1MML A;  4URG A;  2B9E A;  2WSC C;  3N5F A;  3LGM A;  4Z7Y A;  4J9Q A;  3GSI A;  3DLK A;  1U45 A;  2MYF A;  3KUG A;  5DQI A;  4WFY A;  5HMW A;  2CJQ A;  4DQQ A;  2O1P A;  1WG4 A;  3SSS A;  1QTM A;  1GXU A;  5JXS A;  4RUC A;  4DR1 F;  3F41 A;  2JEF A;  5ETN A;  3UQS A;  4DS4 A;  1KRP A;  4OL8 A;  4FYD A;  3NY0 A;  3HHD A;  3BO4 A;  5HMY A;  1APS A;  2U1A A;  4E98 A;  1NK9 A;  5KFN A;  3FK4 A;  2DHX A;  3F44 A;  1ZM2 A;  3OL9 A;  4ZVQ B;  1QAJ A;  3I55 S;  1S9E A;  3WHI A;  2ZKT A;  2VV5 A;  2FHK A;  1NDP A;  4KPC A;  2QLF B;  1QVF R;  1YGY A;  4OZ1 A;  1TL7 A;  1RTZ A;  2HHU A;  5DLG A;  2NZC A;  4ELU A;  2YNI A;  4Q2L A;  1XMQ J;  1GFW B;  4USI A;  1U8W A;  4M5K A;  4L72 B;  3Q2S C;  1RAF B;  5LMU F;  3FSY A;  2ZM6 F;  1IJF B;  4XTT A;  5ETO A;  3KLF B;  3MFH A;  3PYD A;  2DNL A;  1H72 C;  1DJ0 A;  3SFG A;  3LGH A;  3D0I E;  3BBF A;  2F9J A;  2ZH2 A;  2B9Y A;  3BN4 A;  3FFI B;  3VHQ A;  5CHC B;  4IQX A;  2R7X A;  2LQ5 A;  4YB6 A;  4KGV B;  3GJQ B;  2RVJ A;  3H42 A;  1P1L A;  1VQK S;  1RBA A;  4DFP A;  1FHT A;  3CJT A;  5C24 B;  3DXB A;  4PPD A;  4ED4 A;  4DSE A;  1SPB P;  1U8S A;  3V5R A;  1AB8 A;  3EGN A;  4UOG A;  5D0H A;  4B3S J;  2RRB A;  1W2B R;  2PSZ A;  2MKI A;  3PXG a;  3VGU A;  4DPU A;  4M95 A;  5KT6 A;  3FKB A;  3GJT B;  2WCX A;  5L8R C;  3IAM 9;  3TZX A;  5LJ5 Y;  1ZPW X;  2E1C A;  2BM1 A;  5EN1 A;  3M30 A;  1CC8 A;  2BEF A;  3GR1 A;  4ID5 A;  1VRQ C;  5DDP C;  2DYA A;  2CXE A;  3P96 A;  4KHP F;  1J5E F;  2IM2 A;  1YVF A;  1WKL A;  2QLW A;  2YKM A;  2JZ5 A;  3FBF A;  1LXJ A;  1L3K A;  3UD4 P;  4NLQ A;  3RAX A;  4ZCL A;  2EFP A;  1T03 B;  3OTC A;  4GC6 A;  4KHM A;  5I3U B;  3A13 A;  3CDA A;  3D0H E;  1HI1 A;  2V63 A;  1DAR A;  2DGV A;  5HBM A;  1EAY C;  1HI8 A;  4JI7 F;  1FRJ A;  4X4T A;  1P9Q C;  4FVC A;  3M2U B;  2V67 A;  2NSC A;  1SI9 A;  1FF2 A;  1JNR B;  1HQ2 A;  2YX4 A;  1RJJ A;  4FF4 A;  2DB1 A;  3TAP A;  3BO3 A;  1V5I B;  3JAM U;  2KHC A;  2DO0 A;  1I5O B;  4LMZ A;  3K5O A;  1RWK B;  2R7W A;  2KT3 A;  4ICL A;  5H9E J;  3HVT A;  4P72 A;  1G1X A;  1FDD A;  4XAK A;  2KZZ A;  3MCM A;  1DBD A;  3VAJ A;  2VG6 A;  1R27 B;  1RT1 A;  3TAQ A;  4P2M A;  1HNZ J;  2GW8 A;  2HK3 A;  4JI1 F;  4OV6 A;  3HJF A;  1HYS A;  3H5S A;  3KJV A;  5H9F J;  1YIJ S;  3IBF B;  4FNH A;  1ZA1 B;  9ATC B;  1SV5 B;  2QTW A;  3AHP A;  4RJV A;  1CG2 A;  2B4P A;  1NND A;  2D7S A;  2I5J A;  4NLW A;  3ISZ A;  2RF2 A;  1JKH B;  1SH0 A;  2HIY A;  2ZBC A;  1S1T B;  1H6K X;  2ZDO A;  1HLW A;  2HWH A;  1PSD A;  4LFC F;  4DL5 A;  4KGZ B;  1U02 A;  2EC0 A;  4HAC B;  4MK8 A;  3IWN C;  1KHW A;  2O66 A;  1ZOT A;  3ETM A;  4IKA A;  1GX6 A;  3QJJ A;  2VOP A;  1HW9 A;  2VQF J;  2JEG A;  2DH9 A;  4I2Q A;  5HRO B;  1VC0 A;  1PIE A;  3FVY A;  2DTJ A;  3M9O B;  1H7W A;  3PFE A;  2MQQ A;  2ZKU A;  2DCL A;  1YRX A;  1FX4 A;  2AJ1 A;  3C6U A;  2M3D A;  1KVI A;  4K4T A;  1UVN A;  2OPS A;  5AJ3 J;  4HHH A;  2Q3P A;  2ZOM A;  1JXV A;  1S0V A;  1XEZ A;  1QE1 A;  2FGC A;  3R5C A;  4JI0 J;  1FTR A;  2MPU A;  1AFJ A;  1LWE A;  3CJQ A;  2JVR A;  3RU0 A;  3RBD A;  3DRP A;  2ASD A;  3QO9 A;  3DU5 A;  1CJK B;  3SDE B;  2FHJ A;  4X4V A;  2GVZ A;  2J9E A;  4IFV B;  2BJ1 A;  3DHW C;  1HWK A;  3D5M A;  2FC9 A;  4RW7 A;  4DR2 J;  1O0P A;  2AJ2 A;  4X4O A;  3L3C A;  4QWA A;  2GO9 A;  1DUR A;  5D78 A;  4CO5 A;  2HVE A;  1SJ1 A;  5K5M A;  1F9F A;  2NZ4 A;  5IT0 A;  1NK4 A;  2NYI A;  1PG5 B;  3FDS A;  1RP5 A;  2ZH5 A;  4LT6 A;  3NNC A;  4K2X A;  4OX9 F;  1VRT A;  1Q7Y T;  2FJE B;  2E5H A;  5J2Q A;  5J1P A;  3W5Y A;  1XWL A;  4UOF A;  5F8H A;  1N32 F;  1AZS A;  1AA1 B;  1WEX A;  3THT A;  1JB0 C;  4USJ C;  2HZC A;  4IFV A;  3BKF A;  4ZVE A;  3LP0 B;  1WDT A;  3HFZ B;  4C8Y A;  4OV1 A;  5CD4 H;  2HRU A;  1LKZ A;  4CLS A;  3G71 S;  1T0T V;  3NL0 A;  1H7X A;  1N54 B;  2QLJ B;  3EPG A;  3MWB A;  3OT9 A;  1UL3 A;  4F4K A;  2G2Z A;  1S6P A;  3GPA A;  1Q86 T;  2E9T A;  2K2P A;  4QPT A;  1JJ2 R;  4NLU A;  1JLQ B;  1FTC A;  3NGU A;  1N6Q B;  1XNQ F;  5CD4 A;  1D8Y A;  3M32 A;  4A48 A;  1TVR B;  1U1K A;  1HWJ A;  1H74 A;  4QPX A;  1JJ4 A;  2PMW A;  3BGU A;  1U1Q A;  2H51 B;  5KFC A;  2KT5 A;  3RYL A;  2AZ1 A;  3EGZ A;  3TZZ A;  4OZL A;  2XY6 A;  2ZH4 A;  1IR1 A;  5BYR A;  5EUH A;  1XMB A;  1YBA A;  4GC7 A;  2P6T A;  3MOZ A;  1YJ7 A;  4NA1 A;  3FRY A;  1RT3 A;  2PO4 A;  3AFG A;  4CZC A;  3BDP A;  3JSR A;  2OH2 A;  4OIX A;  4QIE A;  2VON A;  4DR3 J;  1QUV A;  5KG6 A;  2R2U A;  3ILJ A;  3G8Q A;  2DNH A;  3H8Y A;  1Q53 A;  4CH0 S;  2W1B A;  5GAH I;  1X4G A;  1QD1 A;  3LA0 A;  1VBY A;  4WII A;  4DX5 A;  2M4M A;  4LRA A;  3A8I A;  2RDI A;  2HHT A;  3THV A;  1PYO B;  2ZH8 A;  3NS7 B;  1H2U X;  2G2Y A;  4KH1 B;  3DRY A;  4I2P B;  1VC6 A;  1KS2 A;  1IKV B;  4Y2I A;  4KHP J;  3G82 B;  4OYP A;  2J0Q D;  4OYM A;  2IYG A;  4CNZ A;  1Z4U A;  2MKY A;  4J90 A;  3MAQ A;  3MFI A;  4O3N A;  5IT9 Y;  5D0R A;  3AD7 C;  1VQP S;  5KFX A;  1WSR A;  3NAH A;  4LR8 A;  3P45 B;  4C2M A;  3AQO A;  3NRB A;  5ADZ A;  1REG X;  1XER A;  4ZLN A;  1SQE A;  1VFJ A;  4O4R A;  2KH9 A;  1J27 A;  2BQR A;  1DZ5 A;  4CH1 A;  3KK2 B;  4Q45 A;  2GGP B;  1Y3K A;  2X1G A;  1HNX J;  1IQT A;  4P75 A;  1VQY A;  1BUX A;  2J8S A;  4F0H A;  1FKA F;  3KLH A;  2HQI A;  2WVE A;  3SV4 A;  3NS5 A;  1RE1 B;  2RE1 A;  4KIA A;  2D3Z A;  2NUU G;  2OKQ A;  3OW2 R;  4JI6 F;  1S9F A;  5H9F K;  4JUZ A;  3EVO A;  4ATN A;  3OVS A;  3H20 A;  1KBR A;  3CC2 S;  2C2O B;  4WYL A;  1NHU A;  3CD6 S;  2AX1 A;  2XSJ B;  4AXJ A;  1S76 D;  4JI1 J;  3KK1 A;  3T1Y F;  3VAI A;  2GC8 A;  5D77 A;  1T3N A;  1EZZ B;  2KYZ A;  2Z57 B;  2CNO B;  2VFT A;  4DSL A;  1RHK B;  4OLP A;  1TKZ A;  1RA7 A;  1RWM B;  2RB7 A;  2YY3 A;  1HW8 A;  2XCA A;  1NU4 A;  2PMZ D;  2GA7 A;  1HHS A;  2AQ4 A;  3R3T A;  4MIA A;  4LFC J;  2V8V A;  1L5U A;  3MR3 A;  3W65 A;  2HAF A;  3BH7 B;  3M8R A;  1LWC B;  5A2Q U;  4DS5 A;  1C0T A;  3LWL A;  3MR6 A;  1FO1 A;  4GRS A;  1FXL A;  2F8M A;  4FP9 A;  2VD3 A;  4JI4 F;  1FVS A;  2MKH A;  4DQS A;  4GMK A;  1E6V A;  3GIK A;  3H98 A;  1N8R T;  1FFG B;  3SCJ E;  2PDA A;  2G0J A;  1XQI A;  4V19 J;  4C11 A;  4RW6 B;  3LAN A;  3RGI A;  1Q8K A;  3H59 A;  2ABY A;  2DR7 A;  4RW4 B;  5M2R A;  1TUG B;  1XR5 A;  4ITS A;  1VQ6 S;  3I5A A;  3HUL A;  4P10 A;  4H4K A;  5E2Q A;  2F63 A;  1S7I A;  3BO2 A;  4FKX A;  2F4F A;  1WC5 A;  5B0E A;  4FPR A;  2BAC A;  5IV3 A;  1CJU B;  4Q8E A;  4DV6 F;  1IWA A;  4QIG A;  5HMZ A;  3ZC4 A;  1Q4R A;  1UET A;  4DV5 F;  4WFX A;  1FK9 A;  2XGQ A;  1F5B A;  5DGA A;  2Z2Z A;  1IBM F;  1N0U A;  3O6Q A;  1HNV A;  2ZNY A;  1RTH B;  4Q5V A;  4TQR A;  3GV8 B;  2ZUG A;  1TTH B;  1UKU A;  3CD5 A;  3MUR P;  1HI0 P;  1SC3 B;  1K73 T;  5B09 A;  5F8G A;  1T05 A;  2HZA A;  1YTY A;  1B64 A;  3CCQ S;  3R5B A;  2HVH A;  5K8M A;  1LK5 A;  5KFY A;  2OPP B;  3IP0 A;  1N88 A;  4CM0 A;  4JP8 A;  5DG9 A;  4DPT A;  2CZ4 A;  4DBQ A;  1N5Y B;  1IKW A;  1KOH A;  3CJ5 A;  3DGP B;  3LUY A;  3IWL A;  4P2X A;  1IKX B;  4FN5 A;  4YME A;  3PCO B;  3DOK A;  3HFV A;  1HWI A;  1REV B;  2LA6 A;  1VJQ A;  4ZN3 A;  3ZZR A;  5DLF A;  1BE4 A;  3CNQ P;  1YZ6 A;  3M1V B;  1JLG B;  4NPO A;  1KD1 T;  4TYB A;  2FHO B;  3NAI A;  5IM0 A;  3MED B;  1WI6 A;  2G0C A;  3BS9 A;  4OYO A;  3TJ9 A;  3IM8 A;  4UQT A;  3KG0 A;  5C5J A;  5EWF A;  3O5T B;  4M5M A;  2KU7 A;  2AYM A;  4NLY A;  3ETO A;  3W2V A;  1XMO F;  3PDN A;  2ILY A;  5I3Q A;  4AE5 A;  2BJ8 A;  2QZ8 A;  3QT8 A;  1D0E A;  2CWK A;  1XNQ J;  3AJ2 A;  3O2I A;  2DRB A;  2DGS A;  4X64 F;  5K20 B;  4EK2 A;  1YSJ A;  2W2O P;  1WOR A;  4I4B A;  1RU2 A;  3N6M A;  1BQM A;  1WWH A;  4NAS A;  4DL2 A;  1R7I A;  4R0J A;  1RKJ A;  1OWX A;  3C19 A;  4I6A A;  1BC6 A;  1DTQ A;  1GAO A;  3J81 j;  3A12 A;  5ETV A;  2QA4 S;  1PIL A;  2R8K A;  3DLL Q;  1QSS A;  4CO1 A;  3G87 A;  3IM9 A;  2CPZ A;  3V6K A;  4J9M A;  1BWE A;  3PYF A;  2ACM A;  2AJQ A;  4WTY A;  2OO4 A;  2KFN A;  2ZDP A;  2DVI A;  1RTJ B;  1TEL A;  4RL1 A;  4NLD A;  2NPF A;  2QE5 A;  2UZA A;  3CDW A;  1R0C B;  1M90 T;  4KO0 A;  3NGD A;  2PMH A;  1RYR A;  3MXH P;  5GAG I;  4IH6 A;  3AOA A;  2XM3 A;  3JSY A;  2C2R A;  1Y5L B;  3D4J A;  2B3T B;  2NRE A;  4ILR A;  1UP1 A;  2ZFH A;  3ILI A;  1FDB A;  1FEH A;  1VQ5 S;  4A8M P;  4J7C A;  2MY8 A;  3HF5 A;  4ZPC A;  3E3X A;  5ETL A;  1U1R A;  4PPZ A;  5C42 A;  3VAH A;  4ZP7 A;  5GVQ A;  3M2R A;  2ZHB A;  1PC4 A;  3TO8 A;  5J2P A;  3HHK A;  4U9R A;  5F8M A;  1VQ8 S;  4QU6 A;  3LP1 A;  3NGR A;  1S0O A;  1KVK A;  4ZJQ A;  3WBZ A;  2N3O A;  4X62 F;  2VOD A;  1RUS A;  2OFG X;  3CMA S;  1MU2 B;  1X9S A;  1IXK A;  4OYI A;  4CT8 A;  2VH7 A;  1DTT A;  2W4P A;  2G4B A;  4RNN A;  3MCO A;  2EI5 A;  4IRC A;  3GV7 B;  4USV A;  1U0S A;  3SYZ A;  1EQ0 A;  5KFH A;  5C25 B;  1VQ9 S;  4OZ5 A;  5GMD A;  3MEC B;  2VC0 A;  4ZKA A;  1S6Q A;  3VQT A;  4DG1 A;  2J7U A;  2QJ3 A;  3BPS P;  2ZIT A;  1T7P A;  4JI6 J;  2CAJ A;  5A76 A;  4DN9 A;  4ECV A;  2C2Z B;  4B17 A;  3DCA A;  5T7L B;  1S10 A;  2V34 A;  2FJB B;  2P9G A;  2DRA A;  1UVI A;  4CNY A;  3I5B A;  4YY3 F;  3SXL A;  1S1U B;  2JFK A;  1LFW A;  2DHS A;  3VGV A;  2Y3Y A;  5JJB A;  1JJH A;  4EZ6 A;  2PT0 A;  1R6V A;  3FEY B;  2YH0 A;  4X66 F;  1X0P A;  4DF8 A;  3A1Y G;  1JLB A;  4R8U A;  4NEY A;  2DJW A;  3PW0 A;  2ZNZ A;  1FXR A;  2FLN A;  2GHW A;  1XN9 A;  3N5B A;  4GKK F;  2RHQ B;  1VK8 A;  2QV6 A;  3NOG A;  1SXL A;  4C3M A;  4ALZ A;  5I4M A;  2PFF B;  4YS2 A;  4RNO A;  5IWA J;  2WVC A;  3R27 A;  3LAL A;  2V8D A;  2XMA A;  4LF8 F;  3JQJ A;  3TZY A;  2CVE A;  3VGT A;  3DU6 A;  1EET B;  4JI4 J;  2H3E B;  3UDL A;  1SL2 A;  3J7A N;  4ZVO B;  1KON A;  1OQ3 A;  5T7L A;  2BRK A;  5DM6 Q;  4OYX A;  2XNR A;  4S0M A;  2XI2 A;  3C16 A;  1D9A A;  1WG1 A;  4XIU A;  4PYD A;  5T14 A;  3CGI A;  3DRS A;  3UI3 A;  4LF4 F;  2CPE A;  1HNI B;  1SUQ A;  1W25 A;  1CSJ A;  4ZLL A;  4QR2 A;  2XY5 A;  2XS5 A;  5JMN A;  5KTQ A;  3MPV A;  3N0V A;  3OR2 A;  4LBH A;  2KXN B;  4PG4 A;  2E5I A;  4DV6 J;  3MEK A;  1QJH A;  5HLF A;  3UW1 A;  1UAW A;  2J0X A;  4YB7 A;  4DV5 J;  4DFJ A;  4MK9 A;  3BGR B;  2WON A;  3FJ2 A;  1S1X B;  1RT4 B;  1RT7 A;  3JS9 A;  2XLI A;  1QUP A;  5EX3 A;  3IRX A;  4HHU A;  4DQP A;  1YKW A;  2FJD B;  4RUA A;  3PFO A;  2XWX A;  2X3D A;  3K5N A;  4QW9 A;  3T1H F;  2WB1 D;  2MEW A;  3HHL A;  1QAI A;  4RW9 B;  2DGQ A;  4X2B A;  3UVJ B;  1FRK A;  5DJB A;  2JX2 A;  2L08 A;  3GIR A;  2OPQ A;  1U2C A;  4C9D A;  3L09 A;  3VR1 A;  3BYR A;  4A8Y A;  3MMC B;  2IJF A;  1LK7 A;  5L9N A;  2ZEJ A;  3I4H X;  2QEX S;  4ZIT A;  4CT9 A;  1RHQ B;  4LQ3 A;  4P71 A;  4X4Q A;  4J9N A;  3QRP A;  4DPY A;  3NCQ A;  4ZA1 A;  6AT1 B;  2VHG A;  2VG5 A;  2O67 A;  1TV6 A;  4O44 B;  1B7F A;  3UR0 A;  4OHW A;  1N5S A;  2AYB A;  2A0F B;  2XYP B;  2PGC A;  3W2W B;  4ER8 A;  5I42 A;  3MR5 A;  3DOM B;  1KKH A;  3CC4 S;  3MEG B;  1EX8 A;  4G6V B;  5KT2 A;  3C66 A;  3CJK B;  2ZE2 A;  2IM3 A;  3UDV A;  2HVZ A;  3AJ1 A;  2HLT A;  3W7B A;  1R8A A;  2DGU A;  3CME S;  1XMO J;  2MGZ A;  4WP8 A;  2C3U A;  3HKZ D;  4KHR A;  2C3O A;  2HNZ B;  2CQ0 A;  4X64 J;  2VBZ A;  3U1M A;  4DV0 F;  3OL8 A;  1RAO A;  3ISN C;  2CNK B;  3MM5 A;  2HGM A;  2YTC A;  3Q0A A;  3RBX A;  4UOC A;  1WEZ A;  1HL6 A;  4P74 A;  1I94 J;  1U0H A;  4B08 A;  1S1V A;  1HR0 F;  4KTQ A;  2JHE A;  3C14 A;  4B3M F;  2VQE F;  3VCD A;  3QWU A;  4HVZ A;  4CRJ A;  4JYA F;  4UTG A;  2FHJ D;  3H0P A;  4M5D B;  3RW6 A;  2J6T A;  3MM7 B;  3OLB A;  1KEK A;  1Q79 A;  2JJ4 D;  3MPU B;  1HD1 A;  2ZJR Q;  1F9E B;  2QO3 A;  2RNE A;  3BV8 A;  4UOH A;  4JI2 F;  3QGH A;  3P3D A;  3V6D B;  5ETQ A;  2LQJ A;  4OZ2 A;  2KVI A;  2WOM A;  4UST A;  2M70 A;  4C3K A;  2YNF A;  5E3P A;  3O3L A;  2Q6B A;  1JLA B;  3DDN A;  2M9K A;  3OTD A;  3O44 A;  1QAY A;  2CJB A;  3MDF A;  1ITP A;  1R6Y A;  3DOL A;  1YI2 S;  2V5H G;  3IC1 A;  4RWX A;  5KT5 A;  4KYZ A;  5CA5 A;  1C1C A;  2R7Q A;  1N52 B;  3DC2 A;  2VPW B;  4NLT A;  3ADA C;  3T19 A;  4DUY F;  1DLO A;  3D6H B;  1RYS A;  2B8P A;  3SCK E;  3N28 A;  1HBM A;  1RKI A;  2FJV A;  3C15 B;  4L3N A;  1AXQ A;  4CYU A;  3NGS A;  4X62 J;  1BY9 A;  3ET6 A;  3AJD A;  3HD1 A;  3W8P A;  1KWM A;  2VIH A;  2VPX B;  4C98 A;  1B0P A;  3IGN A;  2FHM A;  3ZTR A;  3PG9 A;  5K14 A;  2L3M A;  2AEF A;  3FMB A;  2HND A;  3KYL A;  2MHN A;  3BR8 A;  2XZD B;  1RWV B;  3RUB L;  2XYH B;  3JSM B;  3X1L B;  3VF0 B;  4EO6 A;  2D3U A;  4TU9 A;  4YQW A;  2IMO A;  2YKO A;  4PR6 A;  2R2S A;  4PQU A;  1G2E A;  5F8I A;  3NXZ A;  5LXR A;  2K8G A;  1RSC A;  2JDJ A;  3CUL A;  4YY3 J;  3ENW A;  2OTJ S;  2EFO A;  4C8K A;  2LEA A;  1NSA A;  5FLX Y;  3FSX A;  3POT A;  1HBO A;  1VIS A;  4B3R F;  2A10 A;  4PUO A;  3H90 A;  1S7H A;  2WB4 A;  2ZH1 A;  1RU1 A;  3TAM A;  2Z8Q A;  3A3P B;  4U8Y A;  4C8O A;  5KOW A;  2UVU A;  2QGF B;  4X66 J;  3CUN A;  3R5J B;  2IVY A;  3DYA B;  1HQE A;  2MQP A;  3DM2 B;  3W8G A;  2Y8W A;  4OMF G;  4X84 A;  2XLJ A;  5GAD I;  1TR0 A;  1WHV A;  1CC7 A;  4GKK J;  4KFB A;  5LMN F;  3M9N B;  5A0Y B;  5HAN A;  2DHH A;  1RAE B;  2OEJ A;  4O0I A;  5AXN A;  1CUL B;  3MMA B;  1HBN A;  3IS9 B;  3PYG A;  4LF8 J;  5SUH A;  4LSL A;  2JSX A;  5IQQ A;  2DCU B;  2AYG A;  1WHX A;  4WFB Q;  1CJT A;  4RNH A;  3C6T A;  3OUY B;  4WXW A;  1FKO A;  5KFU A;  4A8F A;  5EDW A;  2UUC F;  3MPW A;  3WQP A;  2B6A A;  1Q81 T;  1LW2 B;  4NML A;  4LF4 J;  2OJ3 A;  1YG0 A;  3JAM Y;  4J9P A;  8AT1 B;  4ZPA A;  2K7J A;  5KAK A;  3OR1 B;  1RT6 A;  4GVB B;  4DLE A;  4DFK A;  1N34 J;  2GVD B;  2XMV A;  5DQG A;  1LWF B;  4NMX A;  3H40 A;  2LKZ A;  3D3B J;  2V4Q A;  3MD3 A;  1HFE L;  4IG0 B;  6FDR A;  3A8K A;  4WFA Q;  2F7V A;  1FES A;  3SEO A;  4QYZ K;  4CP5 A;  3EZU A;  4FZV A;  2K1R A;  3D9B A;  3HSG A;  4ZDN A;  7FD1 A;  5E3Q A;  2J6U A;  1WOO A;  3MAA B;  5A6P A;  1FNX H;  1UJ4 A;  1IKY B;  1RTD A;  4FDF A;  4DDF A;  1P8G A;  4BC9 A;  1H73 A;  3GFY A;  4FVM A;  3PV8 A;  4OYZ A;  1X5T A;  2HQG A;  2PEH A;  1U1L A;  1AYE A;  3L7P A;  1MWZ A;  3GU0 A;  2V50 A;  2IC3 A;  2QMU B;  3ISN D;  4GO5 X;  2COL A;  4M5L A;  1S57 A;  3FBC A;  1AFI A;  2QSW A;  4CH7 A;  3PIO Q;  4NI2 B;  2HBZ B;  1T11 A;  1SVD A;  4EFA C;  1KDN A;  3I0R A;  3MPD A;  2H4Y B;  5L46 A;  1F2H A;  2YNH B;  1J5O B;  2GIF A;  4J37 A;  3PKY A;  3K59 A;  2MZR A;  4Y0F A;  1JNZ B;  3H25 A;  3ITH A;  2R7O A;  4L74 A;  3K89 A;  3J7A 1;  2LCW A;  4DL7 A;  3M2V B;  4IG0 A;  2ZD1 B;  4LBP A;  4ZVS B;  4LF2 A;  5K8N A;  1U6Z A;  2XMK A;  4ID8 A;  2J7K A;  3AD8 C;  4ENO A;  1YWX A;  2GQC A;  3M9M B;  1D09 B;  1KSP A;  1VHF A;  1SKR A;  2HQD A;  3EIC A;  3J7Y I;  2XB2 D;  4DR6 F;  2F5G A;  2OAU A;  1OJ4 A;  1X4D A;  3DMJ A;  4NLG A;  5LM7 E;  1VK3 A;  4LF6 J;  3HFK A;  1U1M A;  2CYY A;  3ILO A;  2CQH A;  4K0K F;  3HVA A;  4DV0 J;  4Y34 A;  2NR0 A;  1V5V A;  1Q0N A;  2D41 A;  3JTP A;  4R5P B;  1X4F A;  4WE1 B;  3CD7 A;  2IAJ B;  2GX8 A;  3H4D A;  4Q0B A;  4ED7 A;  2AJ0 A;  3EXY A;  4O3Q A;  2C3M A;  2YNH A;  2EKY A;  3HK2 A;  4DPX A;  1O6X A;  2B5J B;  4LFA J;  1SKW A;  5IFM A;  2XI3 A;  4I6Y A;  2QIF A;  2W24 A;  2XHW A;  1DY3 A;  2ZZM A;  4JI2 J;  3LW5 C;  2Q1L A;  2AJF E;  4DL4 A;  1CS4 B;  3QT5 A;  2FVC A;  4Q44 A;  3UDE A;  3HSJ A;  3PZP A;  1H3D A;  4UY8 5;  2MXY A;  2E1M C;  1CJV B;  2CQG A;  3HZG A;  1C1B B;  1R0B G;  3KLG B;  1FKP B;  1B0V A;  3R7N B;  4F3O A;  4NX9 A;  2DIT A;  2PN6 A;  2AKW B;  3D2W A;  1SJF A;  1RIS A;  4I64 A;  1SQF A;  3V4M A;  2J8A A;  1TKX B;  3RRG A;  2OSQ A;  2QFJ A;  4DUY J;  1B3T A;  2ZUA A;  4MFB A;  1SIW B;  4OFZ A;  5KFL A;  1HBU A;  2XMU A;  3T3F A;  4I56 A;  2CZ9 A;  2JH3 A;  3ENA A;  3S01 A;  3S7R A;  4RWW A;  4BCA A;  2MJN A;  1T9X A;  1R31 A;  4A46 A;  1YJT A;  2H4W B;  2NPI A;  5SZT A;  2E7X A;  4G3I A;  2AW0 A;  1RQ0 A;  4Q8F A;  3TJA A;  2V4R A;  1KFD A;  4F0M A;  5KFW A;  2KRB A;  1TMM A;  1FJG F;  2XYG B;  2P5V A;  1FD8 A;  5ITH A;  3K17 A;  4C0H A;  4NLR A;  2HMI B;  4AFF A;  4USW A;  3UR3 C;  5KFE A;  2I6W A;  3GE9 A;  1U47 A;  4OHX A;  2QL9 B;  2R9L A;  1N4L A;  2RUG A;  4E2F B;  4B3R J;  2DR8 A;  2CPJ A;  2IJN A;  4B9S A;  4ECR A;  3M8W A;  2EC2 A;  4A4J A;  5LT5 A;  2HQC A;  2OEL A;  5AXK A;  4ECU A;  3G86 A;  3CCU S;  3G9C A;  5GAE U;  5DO2 A;  1IBK F;  4AL5 A;  3JXO A;  1RAC B;  2PD1 A;  2YWW A;  1YJ9 S;  4C6A A;  4UY8 T;  4OI2 A;  2LQ9 A;  5LMN J;  4G1Q A;  5CYQ B;  2ZBI A;  4LVN P;  3EWG A;  5LSL A;  1EB0 A;  3HI9 A;  4OJ3 A;  3UD5 A;  3OJS A;  4TU8 A;  4DPW A;  4L6V 3;  2PII A;  2HHP A;  5KG2 A;  1FWP A;  1JLC B;  3NG8 A;  2MQM A;  3BN7 A;  3M6U A;  1CPZ A;  5KT7 A;  4P7V A;  3SCL E;  5BR8 F;  3CCJ S;  3B82 A;  4LIW A;  2DNO A;  1OY9 A;  2XCP A;  2UXC F;  3I5C A;  3G96 A;  1Q95 G;  1ZAW A;  2XWY A;  1WAC A;  3KHR A;  2WW8 A;  1SQG A;  2NS1 B;  5CH7 B;  2MQ8 A;  1GX5 A;  2FJW A;  4MT1 A;  1QSL A;  4KQZ A;  4AT1 B;  3TA1 A;  1SBR A;  2JVO A;  3FC9 A;  2RDJ A;  2Y9H A;  2Y0B B;  1MRO B;  4IUF A;  4I7F B;  5KFP A;  4CQ1 A;  5A8R B;  1YJN S;  2ZZT A;  4JI3 F;  1Z1Z A;  1I51 B;  3TAR A;  5A6W A;  2EFQ A;  1K1S A;  4ECY A;  4ZCK A;  3J80 U;  4FYY B;  1W26 A;  1R89 A;  3HP6 A;  2EVZ A;  2W2P P;  5F0U A;  3S1T A;  5KFR A;  4XK8 C;  2B56 A;  1IUJ A;  4PG8 A;  3CE8 A;  2VC1 A;  2GIQ A;  2W01 A;  3SIP B;  1T02 A;  2CRL A;  4YR0 A;  3Q8R B;  2MQL A;  3OTB A;  2W25 A;  1VS3 A;  4NRU A;  2J0W A;  5LSO A;  5F3Z A;  3H2U B;  1PKU A;  4L75 A;  1PC5 A;  2DNQ A;  3VAF A;  3NMR A;  2DHA A;  2MQN A;  1BGX T;  5K8O A;  2XGP A;  5A2Q Y;  2V0N A;  2DNK A;  3DI6 A;  3EGV A;  4JV1 A;  1RLC L;  3Q8P B;  2R8H A;  4Y2A A;  2RJZ A;  1V6H A;  2AEM A;  2VPZ B;  3ELH A;  2QYG A;  3L7O A;  1F1B B;  2V94 A;  4ZVF A;  1EKR A;  1TL1 A;  1Y7P A;  3FEZ A;  4JV5 J;  4C3L A;  3FNN A;  2R4F A;  3C46 A;  4CTA B;  1JIH A;  4QU7 A;  1NHV A;  4DX8 H;  3B4D A;  1F3V A;  3UD3 P;  3OFG A;  1M5S A;  3EYZ A;  3JYT A;  2HHQ A;  3ZNJ 1;  5HSP A;  1T9V A;  3MMB A;  4ED0 A;  1OPI A;  1Y0H A;  1CBK A;  4F3M A;  2ATC B;  2VDH A;  3MZI A;  2BUN A;  2WK4 A;  4LUB A;  4USH A;  4KH0 B;  4NLS A;  2FJA B;  3TVK A;  3HT0 A;  4B3O B;  4K0K J;  1BXN A;  2HBY B;  3IG1 B;  3KDN A;  5E3R A;  4B3T J;  1VLO A;  2XZW A;  1C4C A;  4C8L A;  1UJ5 A;  5DG8 A;  2FLP A;  3CDU A;  3HDS A;  4DN0 A;  4KGM A;  2LEB A;  2RIL A;  1HHT P;  3EVM A;  5D15 A;  3WX4 A;  2BJD A;  1ACM B;  5B0F A;  1U25 A;  1X4A A;  5CQG A;  4UZB A;  1ZET A;  3PAC A;  1KFS A;  4ES3 A;  3GSD A;  3DNC A;  3HHL D;  3ENQ A;  3I0S A;  1Q7L B;  1S6U A;  4LRB A;  1NHK L;  1NK6 A;  3DXS X;  2E7W A;  4PYA A;  1XNR J;  3CDE A;  4XPC A;  4NE9 C;  1BQN B;  2OEM A;  1S59 A;  3D68 A;  3IWX A;  5C2C A;  4P7T A;  5M2P A;  3TW0 A;  1X5S A;  2XMT A;  1WF0 A;  2F1F A;  1RA6 A;  1NPP A;  2W9B B;  2RU9 A;  5GMK a;  1O5J A;  3NBP B;  5HAO A;  1URR A;  1V3R A;  3C8Y A;  4E8U A;  5JVH Q;  3TX0 A;  3J81 Y;  1VYA A;  1QTN B;  2YNG B;  3LF0 A;  1N5Q A;  5KG0 A;  3NP5 A;  1D1U A;  4OZ3 A;  4EO8 A;  4PRF A;  4FBT A;  3QFH A;  2OMO A;  4KKO B;  4K2J A;  2NXE A;  2LU2 A;  1CQN A;  1OSC A;  2UXB F;  2CPF A;  1R0A B;  3RR8 A;  1K9M T;  3QT6 A;  5D4N A;  1VI7 A;  3QYY A;  4FPI A;  4F4W A;  2PEB A;  5A8W A;  3HPO A;  2CNL B;  2DIV A;  4M1K A;  3FRZ A;  4YP3 A;  4PWD B;  1FJG J;  4UZC A;  2A2C A;  4IDK A;  5DM7 Q;  3D1Q A;  3EDQ B;  2XTJ P;  4URQ U;  2Q43 A;  5F8N A;  4WJB A;  5CYM A;  3LWM A;  4FS2 A;  4NCG A;  1AUS L;  3R1H A;  3V81 B;  1UWB B;  2RSQ A;  3UDC A;  4DSI A;  2D69 A;  3QSI A;  4DUZ F;  4JI5 F;  2GJF A;  1F2G A;  3NKY A;  3W63 A;  3FUY A;  1EP4 A;  4MYU A;  2AV5 A;  2BAN B;  3AD9 C;  2YWF A;  3QIP B;  5J2N B;  2M0G B;  3FCH A;  1N5V A;  3HXM A;  2AP6 A;  1KN6 A;  5KFB A;  3MGJ A;  4FYX B;  3R9L A;  5AXM A;  1I3O B;  4RNM A;  2V8H A;  2UUB F;  3OTE A;  4CLW A;  3OXF A;  2HFV A;  1IBK J;  1X5P A;  3QQC D;  1H2V Z;  1NLK L;  4IQM A;  2YKN A;  2D3O R;  1JK9 B;  2F9D A;  2IA0 A;  1M5P C;  3RRK A;  2BYC A;  3EZO A;  2Z2M A;  3IBC B;  2JOQ A;  4ZK7 M;  2CPD A;  3UNG C;  3G2X A;  2RKI B;  4LSN B;  3R2C J;  2VG7 A;  3KFW X;  2RDD A;  1FDN A;  4O4G B;  3KLE B;  2ZOG A;  3Q83 A;  4AXI A;  5HP1 A;  5BR8 J;  3BSC A;  4WTO B;  2IBK A;  3MMJ A;  1IBL J;  4IFY B;  4QR0 A;  1PJ6 A;  2Y1J A;  4WIQ A;  1RLD A;  4X4U A;  2G1H A;  4I6W A;  3FCV A;  3DKD A;  2UXC J;  4PKD B;  4RR5 A;  1YDL A;  1Q1K A;  1U09 A;  3IR5 B;  2UV8 A;  1I1G A;  1WNE A;  2BBE A;  3CCE S;  4P73 A;  1W7W A;  4RUB A;  4RBU A;  1YQH A;  3TVZ A;  3BSA A;  4PG7 A;  3FZ2 A;  2PFD A;  4DSJ A;  2M5Y A;  3HMJ G;  2Z30 B;  2I38 A;  2DR9 A;  3TP2 A;  4JI3 J;  4TQS A;  3VVU A;  5KFA A;  5CCM A;  1KLM B;  5LXY A;  2GCF A;  3BQ0 A;  1NJI T;  2UV8 G;  3ILL A;  2BZ2 A;  5DZ7 A;  3WC0 A;  3TX8 A;  5IT9 U;  2FD2 A;  4B9L A;  4IH7 A;  5FJ4 A;  2XZT B;  2DNN A;  1GMW A;  4BDP A;  2EBE A;  3ZZU A;  3KOA A;  1HPZ B;  2EFV A;  2XSF A;  1PYT A;  2IIH A;  3NWG A;  4G1P A;  4PEO A;  3IXQ A;  3KLF A;  2YQ3 A;  4A8Q A;  2EFN A;  1H38 A;  2LMI A;  1GH8 A;  6FD1 A;  3EZ5 A;  4WZQ A;  3KHL A;  2IPO B;  1VIO A;  4I67 A;  2B9X A;  1D3W A;  4ZMM A;  3FFI A;  1T8E A;  2Q6C A;  4KGX B;  4H4M B;  2LXI A;  5C24 A;  4U6P A;  4AL7 A;  3QRR A;  3P49 B;  2QL5 B;  3N4W A;  2HZV A;  3CIM A;  5KT4 A;  4RLE A;  4C7Q A;  1WF2 A;  3HO1 A;  2MMY A;  1HNW F;  3T5L A;  4RUH A;  3B8H A;  4PQA A;  3R6L B;  2R7U A;  2NQP A;  2MHE A;  3V4I B;  3LP2 B;  3CO9 A;  3ENV A;  3NCP A;  4CLT A;  2HGN A;  4OJ1 A;  2HS0 A;  4P52 A;  2BVZ A;  4HDH A;  4NLV A;  2QL7 B;  2ZC4 A;  4ZVP B;  4TY8 B;  2Y8Y A;  2HVI A;  3GB0 A;  3QGG A;  4Y00 A;  3R7B B;  3UN3 A;  1KQS R;  2MZT A;  1LW0 B;  4PAA A;  2XBP A;  4KSE B;  1TFW A;  2BJE A;  3TQ1 A;  1T03 A;  3SQG B;  2ROP A;  3GYG A;  3DRX A;  3AT1 B;  5I3U A;  3D6M B;  4EGL A;  2IBO A;  4L76 A;  4KRW A;  2V2K A;  5E5N A;  4DCP B;  1H98 A;  4ZHR B;  5L1J A;  4F4Y A;  3GIJ A;  4A8W A;  3M2U A;  4OHZ A;  3KWM A;  3OL6 A;  1IR0 A;  1FJC A;  3RAM A;  5D8H B;  2ZH9 A;  2ZJP Q;  2JEJ A;  3W9J A;  4QIW D;  4EUV A;  2CAD A;  1U7L A;  2RRN A;  4YDD B;  2W9C B;  2CNN B;  1Y5N B;  4P2S A;  5ETP A;  1OO0 B;  2QLB B;  2MLZ A;  3QMQ A;  2YPY A;  4F2S A;  2BE2 B;  3TA2 A;  4A8K A;  2HNY B;  2IRX A;  3F73 A;  3UWT A;  2M8H A;  1KQG B;  1C0U B;  2UUA F;  2P9C A;  1SV5 A;  2LA4 A;  4DV4 F;  4B9V A;  3KLI B;  4JI8 F;  2D74 B;  4Y2C A;  2CPI A;  2OP5 A;  1FRM A;  1JKH A;  4P2F A;  5B7W A;  4LBI A;  1S1T A;  4ANE A;  2V2Z A;  3DDK A;  2XO7 A;  3OV7 A;  4HAC A;  3VGS A;  1PGZ A;  3T6B A;  5KT3 A;  2AD9 A;  1KLN A;  2O3D A;  5D3G B;  3P5T L;  3HLU A;  1P27 B;  1QVG R;  4IH5 A;  4WKR A;  5HRO A;  5G0R B;  2V4J B;  1VBX A;  3MUV P;  2H5J B;  2P6S A;  5KFT A;  4OHV A;  2SXL A;  3F56 A;  3GMG A;  5HJY A;  1RXO B;  4MKA A;  4CLP A;  2BQU A;  2DGO A;  3ZNU A;  1Z2L A;  3CJS A;  1E6Y B;  1YJV A;  3PRV A;  1LNQ A;  4JI5 J;  3QPI A;  1C4A A;  3NNA A;  3AY0 A;  5DDQ C;  1U48 A;  1Q8I A;  4ZN1 A;  2DIS A;  1CJK A;  4I0W A;  4U8V A;  3SDE A;  4F4A A;  1TZ0 A;  4DR1 J;  3OSN A;  4ZVU B;  1HA1 A;  3W5Z A;  1JLF B;  4RU9 A;  4B9U A;  2IMW P;  1RT2 B;  2E29 A;  4Y6I A;  4K4U A;  3E8O A;  5DGB A;  4WFN Q;  2AT1 B;  4LVO P;  1UVL A;  4YHH F;  3GJR B;  2N7C A;  2DNP A;  5F41 A;  2OPR B;  4PCQ A;  2FUG 9;  5AE3 A;  1NKB A;  5LMU J;  3U02 A;  1RAB B;  4O3S A;  4OX6 A;  2JC1 A;  2ZBQ A;  2VBW A;  2NXN A;  4MIW A;  1ARO P;  1TKT B;  2CUY A;  3HSD A;  1RAI B;  2ZM6 J;  2C2K B;  4QWC A;  2XEX A;  1RAJ A;  1FRI A;  1SL1 A;  4ZPB A;  3IFE A;  4ILL A;  4I68 A;  2H5I B;  2PA8 D;  3PM9 A;  2YWK A;  7FDR A;  2MZJ A;  2EG1 A;  3QJL A;  2GAH C;  3M8P B;  5EWE A;  3ZTS A;  4NA3 A;  4FXV A;  3OBI A;  2AX0 A;  5IC6 B;  2BDP A;  3TWZ A;  1NO8 A;  3PRD A;  3LP0 A;  1ELO A;  1TP7 A;  1NM2 A;  2RAQ A;  4ED3 A;  2M7S A;  1S1W B;  3HHE A;  1RT2 A;  2W7A A;  4DQR A;  4Y2K A;  4DCJ B;  2KG0 A;  3LAK A;  1Q5Y A;  2MKK A;  2CQI A;  4WU2 A;  3K5M A;  2MB0 B;  2KJW A;  4HI2 A;  1ZPV A;  1HQU B;  1X4H A;  1RWX B;  3NNH A;  2W7P A;  2OHD A;  1JLQ A;  1UJ6 A;  1N6Q A;  1A6L A;  3D6T B;  2HS3 A;  2AIR B;  3A3O B;  3C3L A;  1WHW A;  2V8P A;  1TVR A;  5G4D A;  2N3L A;  3AOB A;  1MN9 A;  3CTR A;  2VA3 A;  1PYS B;  3VVT A;  4K50 A;  5BJR A;  1J5E J;  2HWT A;  2VU5 A;  4IOA Q;  3G8T A;  1UFK A;  4C97 A;  2J76 E;  4JOU A;  5E3C A;  4CO0 A;  4N41 A;  4RKU C;  4J5O A;  2BXJ A;  2LQB A;  1HMV B;  3D67 A;  3VQS A;  5MLC V;  1JJC B;  2UXD F;  1EKS A;  1S79 A;  4FKY A;  1W2I A;  5H9E K;  2DHG A;  4JI7 J;  4IYQ A;  5GAH U;  2J6S A;  3HVW A;  4K5R A;  3IA0 A;  3NGT A;  4WBF A;  3VV2 B;  3R7S B;  2MZS A;  3A3N B;  5IXU A;  1HWL A;  2BV3 A;  4IG3 B;  5ETM A;  4DSF A;  3BDE A;  5KFM A;  1HNW J;  5B0B A;  1RCX B;  2HQ3 A;  5ETT A;  4F0K A;  4ZJL A;  3GFZ A;  1Q16 B;  2B4O A;  3TR5 A;  4ZJO A;  4MYT A;  3MM9 B;  4X4N A;  5BXI A;  1GTH A;  1G6B A;  2BW2 A;  2HW3 A;  3DLE B;  4I2P A;  2XHC A;  2MKC A;  1GT8 A;  1IKV A;  1MW7 A;  2RML A;  5KOX A;  2DH7 A;  1UVK A;  1RAA B;  4KV8 B;  4OI3 A;  3G82 A;  5FII A;  1NH8 A;  1S9G B;  2B4U A;  1NJX A;  3U27 A;  2A6O A;  2BE7 D;  3QSY B;  4KE5 A;  3DRR B;  1WC3 A;  4AD6 A;  1RWN B;  3DLG B;  3JTN A;  3QT7 A;  4F02 A;  2J9D E;  1VDH A;  3KK2 A;  3CJ2 A;  4J9L A;  5J1E B;  2G9O A;  2GGP A;  4URS A;  1LQ9 A;  1R8C A;  2MY7 A;  5KFV A;  3Q8S B;  3D28 A;  2HSE B;  4OI1 A;  3P8B B;  3BQ2 A;  1ZZN A;  1M1K T;  3Q8V A;  2HBR B;  2BQ3 A;  4NCA A;  1G7C B;  1FNO A;  2R8J A;  4E0D A;  1TK5 A;  3MEE B;  3R97 A;  2HQF A;  4IRK A;  2B7B B;  4ECX A;  3M8Y A;  2C2N A;  4CCH A;  2DGT A;  2QA4 G;  2DR6 A;  3PW7 A;  4C0O C;  8RUC A;  3BEG B;  3KHG A;  3UO0 A;  2XSJ A;  4LRC A;  4OX8 A;  3TAN A;  2HRY A;  1UWA A;  3MPY A;  1D9F A;  4M5G A;  2ZHO A;  3SI8 A;  2Z0G A;  5J2M B;  2VB6 A; 
#chains in the Genus database with same CATH homology
 2A6O A;  2FYX A;  2VHG A;  2XMA A;  2A6M A;  2F5G A;  2XM3 A;  2XO6 A;  4ER8 A;  2VIC A;  2VIH A;  2XQC A;  2VJU A;  2VJV A;  2F4F A;  2EC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...