1P1TA

Nmr structure of the n-terminal rrm domain of cleavage stimulation factor 64 kda subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'DPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cleavage stimulation factor, 64 kDa subunit
publication title Recognition of GU-rich polyadenylation regulatory elements by human CstF-64 protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p1tA00
1YHQS 2I2YA 1VQNS 4QPTA 2J76E 2DO4A 3CCLS 1P1TA 2KM8B 1VQ5S 1FJEB 3LQVA 3VALA 2N3LA 2DIVA 2K3KA 5DDOC 1SJ3P 5GMKa 2VOPA 2GHPA 2KFYA 3RW7A 5LXYA 1R8HA 2MZTA 2N7CA 1WG5A 2CPJA 1X4EA 2FHOB 2MPUA 1OPIA 2KN4A 2MXYA 1N8RT 1WHVA 1OIAA 1KD1T 1S72S 5LJ3Y 2F3JA 2CQIA 2X1BA 4UY8T 1VQ6S 1K8AT 5MLCV 4CH1A 2QEXS 2AYEA 2M8DB 2DGQA 2DNGA 2YH1A 1H2VZ 5H1SV 3Q2TC 1VC5A 3US5A 2M7SA 1YITS 1U6BA 2RU3A 1WG1A 2CQPA 2KU7A 1U2FA 1X4HA 3P49B 2E5GA 2ZJRQ 1VQMS 1G2EA 1JJ4A 2EVZA 3ZZYA 3BO4A 2MQQA 1R8PA 1PO6A 4BS2A 1X4DA 4Y0FA 3CUNA 3MURP 2CJKA 1NJIT 2MGZA 3BEGB 1JMTA 2LCWA 2O3DA 2BZ2A 1U1LA 2SXLA 2MZSA 1VQOS 5CXTA 2RT3A 3CMES 1VQ9S 3CCSS 3THPA 2FY1A 5FJ4A 1UAWA 2CQ0A 2JX2A 1YI2S 3CCRS 2DH8A 2B0GA 3CCQS 4ED5A 4A8XA 2DHAA 2UP1A 3CC4S 1YIJS 4WFBQ 3FEXB 1VQ4S 5IFMA 2KM8C 3VAHA 1K73T 3PIOQ 1P27B 2MQLA 1YJWS 3UD3P 2QFJA 2LMIA 4LJMA 2DITA 5D77A 3CCMS 2DNLA 2ADCA 2MSTA 3CCJS 5JVHQ 1U1MA 1W2BR 1FXLA 1Q7YT 4Z2XA 5DM7Q 3MOJB 4CH0S 2MKKA 2XS2A 3N9UC 1M90T 5HL7Q 3U1LA 3CMAS 2DNYA 1FJCA 5GVQA 3MUVP 1H2UX 4QU7A 2M0GB 2DGVA 3Q2SC 2LQ5A 3TP2A 2MZ1A 2KRRA 3L3CA 2M9KA 1X5OA 3CC7S 5GAEU 4IUFA 2U1AA 2FPHX 4IOCQ 2VOOA 2CQGA 3SXLA 4LMZA 4QU6A 2KXHA 3VAFA 1KQSR 2J0SD 2FC8A 2OJ3A 3B4MA 1WEZA 2L41A 3CXCR 2M4MA 3P3DA 3UD4P 1F9FA 1SJ4P 3V4MA 1PGZA 2KYXA 4FXWA 4TU7A 2JVRA 2RUGA 2G1DA 2RRBA 1DRZA 2DHGA 2RS2A 3G96A 3NS5A 1URNA 2DO0A 4W92B 3CD6S 2JWNA 3MD1A 2E5IA 1WF1A 4QQBA 4C7QA 2BOPA 1D9AA 2A3JA 2DISA 2AYGA 1U1QA 3DXBA 5IQQA 4TLQA 3EX7B 1Q82T 1YTYA 3CCES 1S79A 2MZQA 4UQTA 3CPWR 2OIHA 2XS7A 1WHYA 2K8GA 2KHCA 3HI9A 1KC8T 2CPFA 2YTCA 4J5OA 1RK8A 3FEYB 2MZJA 1M1KT 2NZ4A 4IOAQ 4WFNQ 2MSSA 3MUMP 3UCGA 3MI7X 4LIRA 3BO3A 3VAJA 4FXVA 4PKDB 2VODA 3VAGA 3EGNA 2CQHA 4CIOA 2MKHA 1QVGR 2DGTA 4V19X 2RS8A 2MQOA 2MY8A 1YJ9S 2N3OA 2X1FA 2KH9A 1N88A 5D78A 5LSOA 1JJ2R 2DHXA 1WWHA 1WF2A 3I56S 1KOHA 3H2VE 3G8SA 3G4SS 3P5TL 1YWXA 1M5VC 1WF0A 4OZ0A 3IWNC 2CPEA 4ZKAA 2G0CA 1M5PC 1Q86T 1BY9A 1X4FA 2LECA 2RQ4A 2DB1A 2OTJS 1WI6A 3BS9A 2CQ2A 1VQKS 4YB1P 3BO2A 3UCZP 3R1LA 4WCEQ 2YKAA 3UWTA 1FHTA 1H6KX 2CQCA 2G4BA 2PE8A 2N82B 5LXRA 4ERDA 4W90B 3VAMA 2JRSA 1WHWA 4C4WA 2DGUA 3SMZA 2XS5A 5HO4A 3J7ZT 2MHNA 1D8ZA 1O0PA 5IM0B 2AYMA 2KT5A 2L08A 4OZ1A 3MDFA 2KVIA 2MJUA 2X1GA 1OO0B 5IM0A 3R1HA 2MJNA 1U1PA 2PEHA 3VAKA 1X5TA 1A7GE 1U1NA 1X4AA 1A9NB 2M2BA 2M52A 1UW4A 2HZCA 3B4DA 2MKIA 1SJRA 2MZRA 2LXUA 2RQCA 2WBRA 1SXLA 2DGXA 3VAIA 4PRFA 4Y00A 1X4CA 2J8AA 4F25A 2KI2A 1U6FA 2F9JA 5DDPC 1NO8A 1X4BA 2MQNA 5LSLA 2OTLS 4WKRA 3J7YU 2MQMA 1FNXH 3ULHA 2L9WA 2DGOA 3U1MA 3CCUS 1QM9A 4F02A 1X5PA 3NS6A 3SDEB 2CPZA 5DDQC 2DNKA 2DNRA 2FC9A 3SDEA 3NNCA 2JVOA 3H2UB 2I38A 4RU2A 2DH7A 2DGWA 2LEAA 3UE2A 2LEBA 3G6ES 2M8HA 1K9MT 4YOEA 1HL6A 4YUDA 3CTRA 3OW2R 3MXHP 1RKJA 2DIUA 3TO8A 2XNRA 2GO9A 2CPDA 2MYFA 1M5KC 1NU4A 3S8SA 3THTA 2ZJQQ 1OWXA 2CPIA 2Q79A 3R27A 3S7RA 5DDRC 4WFAQ 2D3OR 2VONA 2XSFA 2LYVA 3VF0B 2LA6A 2MB0B 3G9CA 1QVFR 2KG0A 1CVJA 5ITHA 2YWKA 2M70A 2MY7A 1HD1A 2D9PA 1DBDA 3NNHA 4C0OC 4CQ1A 2LA4A 2DH9A 3CCVS 2DGSA 2CPXA 5EN1A 3DLLQ 2XNQA 2DNOA 1M5OC 3K0JA 3MUTP 2KRBA 2CQDA 2ADBA 4TU9A 1WHXA 4F26A 2EK6A 2EK1A 3I55S 3NMRA 5DM6Q 1FT8A 2CQ3A 1B7FA 1SJQA 1UFWA 3EGZA 4M5DB 2CQBA 1WG4A 2MQPA 2HGLA 2U2FA 2MGZB 2AYBA 1WELA 1WTBA 1U1RA 2HVZA 2RNEA 1VQ8S 2CPYA 3S6EA 2HYIB 1H2TZ 1X4GA 1AUDA 3CULA 1WI8A 5DETA 2MKSA 1U1KA 2M88A 1Q81T 1VQLS 3RW6A 3G8TA 2DNHA 1VQPS 2F9DA 3IRWP 3CF5Q 2KXNB 2CQ1A 2DNPA 2KG1A 2HGMA 1VC6A 3HHNB 3CC2S 5LJ5Y 1U1OA 2OSRA 1ZZNA 2DNMA 5JVGQ 2V94A 2NLWA 5GAHU 1JJHA 2AD9A 1HD0A 2J0QD 5CA5A 1VBYA 2CQ4A 2OSQA 1VBXA 4PR6A 4EGLA 1HA1A 3P6YC 2E44A 1DZ5A 3G71S 2ERRA 3PIPQ 1XN9A 3NNAA 5GAGU 2RRAA 4IO9Q 2HGNA 1UP1A 1X0FA 3MD3A 2DNZA 5CYJA 2RVJA 2E5JA 1VQ7S 2CPHA 4WF9Q 1FO1A 3UCUP 2MKJA 2LXIA 2MKCA 1N52B 4TU8A 1WEXA 1FJ7A 2LKZA 2MMYA 2YH0A 1VC0A 2E5HA 2KXFA 3D2WA 2DK2A 2DNQA 2QA4S 1N54B 3S01A 2X1AA 1YJNS 1VBZA 1L3KA 3TYTA 5BJRA 1IQTA 5GADU 3ZZZA 2D9OA 1ZZFA 1DHMA 3LPYA 4P6QA 3JB9k 1KOOA 2DHSA 1ZH5A 1X5SA 4U67Q 1WEYA 2DNNA 2XB2D 1SJFA 2ZJPQ 4WIIA
chains in the Genus database with same CATH superfamily
3O2IA 1LW0B 5KFKA 1AXQA 1SJ3P 1C0UA 3FC9A 3HVTB 4RL1A 3BH7B 3GG1A 2VA2A 2FGCA 1O8BA 4ZCLA 2D69A 3OXFA 2ZC3A 4RW8A 4UY8T 5HMXA 1J5EJ 2KYZA 3I5CA 3HD2A 4OQJA 1VC5A 4WK1A 2RU3A 4PQUA 2AEFA 4DZ6A 1RTDA 3OTDA 2CWKA 2ZZNA 4FNHA 4C8NA 3IM9A 1NDCA 4NA2A 2RT3A 2XLJA 4XK8C 2B0GA 2EFOA 5H9EJ 1R8BA 3DFEA 4EFAC 1KVIA 1V5VA 3IS9A 4F3OA 2I1RA 3LA0A 3TUPA 1VBKA 4CO0A 3R9LA 3CJRA 1C4AA 2R8IA 5I42B 1Q7YT 5CCMA 2JLGA 1EX8A 3KJFB 5HL7Q 2V67A 1GTEA 4LBHA 1TKZA 3X1LB 4OYAA 2VDHA 4I2PB 3ET6B 2U1AA 3MM6B 4ECYA 2KXHA 4U8YA 4O3RA 5FLXU 3CXCR 4Q8FA 4OYZA 1RUSA 2YKMA 4FXWA 3LO3A 2W7AA 5G0RB 5I3PA 3KJVB 4I1TA 5I4MA 4F2SA 1RADB 1WF1A 2D3UA 4B9MA 1HWJA 3EX7B 3WC0A 3V6DB 4N41A 1L5UA 2P9CA 1NSKL 1TL4A 1S6QB 2CIMA 1NEEA 4ED1A 1CJVA 3MUMP 1FDNA 4MMOA 2HHWA 3TX0A 3ETMA 1BC6A 3JQKA 2N3OA 2KH9A 2HQDA 5F8GA 5AJ3J 3GYXB 3QBCA 2DHXA 4XO0A 1QAIA 1QUPA 1R89A 3KG0A 1X4FA 3RU0A 5CQGA 2W9AA 5D0EA 2VICA 4NLYA 2ZOGA 3GP9A 3N5FA 2GV1A 2VBXA 4ERDA 2BANA 5HQLA 1Z4UA 5EHHA 4G6VB 3NGKA 5JJBA 3R1HA 4L73A 2GFFA 3AJ2A 3MWBA 5KT3A 4QR2A 3GSIA 3M6XA 1T9UA 1M1HA 1N32F 4PXDA 2HHPA 3GJQB 3TA0A 2J8AA 3M8QA 3G82A 3Q86A 4RNNA 1AYEA 4WKRA 1RT6B 4OHVA 1P1LA 3SCKE 2YKNA 5K8PA 2CAJA 2C3UA 1RWOB 3CWJA 4X4NA 2UZAA 1WDTA 2JEGA 1HL6A 3OW2R 2DHHA 4FYXB 3CE8A 3BGOP 3R5CA 2MYFA 3DDKA 2GZOA 4ALZA 2R8KA 1UEVA 4DV3J 4R8UB 4RW6B 5GAGI 3QJPA 2VU5A 2V0NA 3QGHA 1FFGB 1NHUA 1YK9A 4ID5A 3J7YI 3H40A 4DQSA 5J2NB 1S1UA 3ITHB 2QLBB 2LA4A 4DX5A 1RT2A 1ZAWA 3GE9A 5EN1A 4BCAA 1D3WA 4NI2B 3JSYA 4ZDNA 1P6TA 1BHNA 2W4PA 4ZPVR 2HGLA 5F3TA 1CJUB 2CPYA 1KHVA 3S6EA 1S0MA 1WI8A 1U1KA 1Q5VA 2M88A 3RBXA 1ZPWX 4KO0B 3IRWP 1REVB 5KFUA 2JLEA 4OZLA 1KLMB 1GK8A 4RW7A 3JQMA 5BYRA 3EDRB 1ULRA 2R7QA 3QRPA 5RUBA 3CCZA 2ZM6F 5HVHA 5DG7A 4JI8F 2AGPA 1MW7A 2MKJA 3BKFA 1JWWA 2RKIB 3P5BP 3KLEB 1N54B 3MAHA 1DLOB 2H5IB 4J37A 2UXBF 4LR8A 4UOCA 4GKKJ 4LRFA 1X5SA 4XIUA 3R7NB 1NZ8A 3KK3B 4ZP9A 3OQ2A 3UDLA 3ENVA 1VQNS 2F4VF 1JKHB 4K4YA 1GFWB 1RWVB 2WW4A 4I64A 2VG7A 4OYOA 3KYLA 3BV8A 3EE3A 2MZTA 3POTA 4ZS6A 2KN4A 2OEJA 2E1MC 4LVOP 4ZA1A 1VQ6S 4DMZA 2HHXA 2EG1A 2DGQA 2UV8A 1T95A 1YITS 4YY3J 3CO0P 2ZBIA 2RD5C 1LWXA 1FFWB 3QIPA 4LF1A 2C2RA 5AXNA 1I94F 1PO6A 3THVA 2MGZA 1T03A 4P75A 2BZ2A 1OSDA 2HEKA 2OLWA 1TL7B 3CCRS 2F1FA 4F3MA 1FD2A 2Z57B 4DPUA 2GAGC 1DTTB 5J1PA 2V63A 1XNRJ 3CC4S 1A6LA 3GMGA 3CJTA 3TQEA 1ZTTA 2OP5A 4GMKA 4Z2XA 4FYVB 3BSNA 1SIZA 1FJCA 5L46A 1JQGA 1NK7A 2R42A 2KRRA 3MCOA 2RQKA 4IG3B 2ZDOA 4DFJA 3AT1B 3KNAA 5L9NA 2OMLA 1F3VA 4E8UA 3AD8C 1S97A 4LFAF 2B6AA 2CFXA 1IKYA 2YNIB 1Q79A 2H4YB 4KE5A 1D9AA 2A3JA 4J9RA 4P9SA 2QYGA 5ETKA 1S79A 2FTRA 2P6SA 3OSPA 1S6PA 4TVAB 2HVHA 3RUBL 4JUZA 2FZCB 4DV5F 3UDVA 1YX2A 2VQEF 1HNWJ 3PNIA 3PW7A 3OT9A 5HN0A 3D67A 2RS8A 1UJ4A 5D78A 3PYEA 3DLBA 4FN5A 4JI2F 3IG1B 3UO0A 5LMUJ 1XBWA 5KT5A 4GO7X 3KUHA 5U47A 2ATLA 2PN6A 4X62J 1IJEB 4A8OA 4QYZJ 2ZD1B 5GMDA 4ENOA 3QGIA 1K0VA 2ZUGA 3SSQA 2XS5A 2HRTA 1FXDA 2FJDB 3AODA 2L08A 1BUXA 2VG5B 2WVDA 4MYTA 1NDKA 2CKWA 1TKDA 1ZM2A 4OV6A 4HI1A 2HHHF 5KFPA 4ZVFA 4I6YA 4LBPA 1WKLA 3DLEB 1RAJA 3UR3C 3SDEB 5DG8A 4QWDA 5C24A 3NNCA 1U0HB 1HYSB 3GFHA 1WKJA 4DV2J 3BF4A 3IFEA 1K9MT 3O8WA 2BKOA 4KPCA 2HBQB 4DQPA 2HHSA 1OYEA 3THTA 2Y9HA 1IBCB 1QAXA 4ECQA 2JEFA 2XSFA 2R2RA 4RBUA 1M1GA 1T8EA 1BWEA 1UTAA 1HNIA 2FVSA 2QL9B 2C2NA 3MR2A 4P7VA 4WZMA 4X66J 1YRTA 3ELHA 1MN7A 1QJHA 4J9PA 4ZVUB 4X84A 3JAMU 1HQUA 2CQBA 4F2RA 1TK8A 4CLTA 2QA2A 4GKJF 3FCVA 4BWJA 2YQ0A 4HH0A 4MFBB 5DETA 2J9DA 2BW2A 4OHYA 1YVFA 1BXNA 2C2ZB 3DI6B 4DV4F 1OQ6A 2DNMA 5JVGQ 3AFGA 1MWYA 2CZ4A 2E9ZA 5CD4H 2XG8A 1HWLA 3M30B 3RZAA 2LU1A 1HA1A 4Z37A 5J1EB 4PZVA 4OJ1A 2C28A 3CB4A 4URSA 4WF9Q 2BJEA 1PJ6A 1S4EA 1UJ5A 5KFNA 2E5HA 1FDBA 2DNQA 1PYOB 2W8KA 2F8EX 2P9EA 3NMAA 4ZLNA 3IR5B 3WC2A 3B8HA 2IAJB 4AD6A 4O0NA 3I5AA 2J76E 3DLKA 2KM8B 4X64F 5LMNF 1WTFA 5C42A 2CPJA 1RHUB 3R5JB 2B5JB 1RP5A 3PW5A 2QA4G 1S1WA 3U1NA 2BV3A 1K8AT 1EETA 4WZQA 4CH1A 3GIKA 2H3EB 3WQPA 2XY7A 1JLCB 8RUCA 1T9XA 2Y3YA 4CT8A 2ZEJA 2UU9F 4QIGA 1RT3B 2UUTA 1VQMS 3CDUA 4Y0FA 3HO1A 2O3DA 2BEFA 3K5OA 4UOHA 3WHIA 2SXLA 4F36A 2YPYA 3IWLA 2O67A 1NK4A 1BQMA 3QQCD 5FLXY 3A3OB 2ZBRA 2VPWB 2CVIA 3UD5A 1PC4A 4LJMA 4DCPB 3T1HJ 2ADCA 3DRRA 4HDHA 1TKTA 2F8MA 4QYRA 4EUVA 3DM2A 1NCLA 3GJTB 2MZ1A 4U96A 2OEKA 4YR2A 3FSYA 3CCTA 2Y0BB 5KFAA 4LMZA 3CD0A 1B4SA 3OTEA 3VTIA 1WORA 4NLSA 1WEZA 1S1TB 2HHUA 5D4PA 4F4ZA 2DJWA 1TP7A 3HMJG 2K7JA 1Q8IA 3I9ZA 3ILLA 2JVRA 1URNA 1U02A 2JFDA 2BJDA 2BM0A 2RE1A 2VFVA 5HBMA 1U1QA 3ISND 5IQQA 3W62A 1V6HA 3CCES 2D1CA 5L1LA 3OV7A 3T3FA 1VMBA 3T5HA 2W9CA 4ZN1A 4NASA 3LWMA 2X3DA 7FD1A 3FQLA 3BN4A 1Y0HA 1GXUA 2ZFHA 4MAKA 3UDCA 2OPQB 1KR4A 2Z2YB 2I0XA 2C1EB 4O3NA 3NKYA 4NYOA 3VV2B 3IWNC 3C15B 2OTJS 2FHKA 2OHDA 2QTWA 1LFPA 4UT4A 1H6KX 1VDHA 2N82B 4C4WA 3NL0A 1R3NA 2XZDB 5F8HA 4NLDA 1XR5A 1T11A 4CLSA 3O44A 4LF4F 1KFDA 1XK8A 1U1NA 3W9IA 3JSMB 2WSEC 3MGJA 1KHWA 5D0HA 2AZ3A 4PWDA 1EQ0A 1LQ9A 3SFGA 1X4BA 2K1RA 1HNXJ 5DS7A 2L9WA 4FS1A 4RWXA 2VD3A 3EICA 2CNLB 1N5SA 2DH7A 1CS4B 5CYMA 4M5NA 3HHKA 2RIJA 4ZMMA 3BQ0A 2EC2A 5A0YA 2ZNYA 4AL6A 5KFHA 1R0BG 3AY0A 1OYDA 2VONA 3K17A 3RR8A 5ITHA 2M3DA 5KT4A 2PD1A 3NNHA 2FVQA 2ZH2A 3F0NA 2RDJA 3MUTP 1HWKA 3Q89A 2ZE2A 4DJBA 2Y1LB 1ZBTA 1WKKA 2HNZA 4USKA 4M5DB 4DR3F 2BXJA 2VBYA 3F56A 3NBPA 2CJXB 2YNHA 2BM1A 3NOGA 3LW5C 1PJ5A 5B08A 3UI3A 2F9DA 3CF5Q 3HHNB 2HGMA 5LJ5Y 4FPIA 1ZZNA 4ANEA 5E3PA 1V3ZA 3PJXA 1RU1A 3FGVA 2E66A 3JYTB 4YN3B 2MEWA 2AMCB 4WFYA 5GAGU 2IJNA 1X0FA 2LXIA 2VC0A 3M32A 4ZP6A 1WEXA 1FJ7A 1SKRA 4FP9A 4F7VA 3QMQA 3F73A 5DQHA 4EBCA 1C1BB 4PAAA 3IAS9 3CDAA 4I6WA 2FHJA 2UXCJ 2YWWA 5A8WB 4KGKA 4Y3CA 4IG0B 1RBOB 3GV8B 1P1TA 3J7AN 3WBZA 2UUAJ 4AL7A 1LW2A 5LXYA 1R8HA 1M0SA 2GVZB 4ZLPA 2YKQA 1OIAA 4B3OA 1RWXB 2P5VA 2X1BA 1NB7A 3LF0A 4ED2A 4Q0BA 1I3OB 2E9TA 2AYEA 2IJFA 4NCGA 4DG1B 2FD2A 3I6PA 1RABB 2ZJRQ 3EPIA 2EVZA 4C2MA 2CJKA 1I1GA 3W2WB 3M8RA 1U1LA 3SI8A 5CXTA 3CSKA 4L72B 3T1YJ 4Y2CA 1IN0A 2FY8A 3L4BC 2YXLA 3P8BB 4WE1B 1XNQF 5ETMA 1X8DA 3GJRB 4PABA 1KTQA 3AJDA 4C48A 1UVJA 1CJKB 1N56A 1M90T 4PUOB 4IR1A 1RAIB 2E5LJ 4NZ7A 3TEGA 2I5JB 5JMNA 4PYDA 2LQ5A 3BSCA 4N8NA 4OZ2A 2V2ZA 5H9FJ 3N6MA 4H4OB 2B9EA 4OI4A 2ZITA 4DL7A 1SPBP 5CHCB 2EWHA 4K4WA 4FS2A 3UD4P 4LF5J 4KHMA 2QJ3A 2KO1A 3OXGA 2HQIA 3K59A 2Q3PA 2V50A 5HP1A 4KRWA 2LQJA 1VK8A 1HFEL 5K8NA 5DG9A 3V6KA 5HANA 1LW0A 3HVTA 3MR6A 1NDLA 2V8PA 2VF3A 5KFRA 3VGTA 3ILJA 3QLHA 5IV3A 1LWEB 3TAMB 2JEIA 4Y2AA 4YDDB 4WFNQ 4L76A 2CNOB 5KFYA 3OL6A 3UCGA 2Y1RI 2QV6A 3CD5A 5B09A 2KFNA 4B08A 3RBDA 3G8QA 4RNHA 2RUSA 1FNMA 1JJ2R 1TL3B 4YR0A 2XC9A 1P9QC 3TNVA 1TL5A 4ZVTB 2FVPA 2CPEA 4JI5J 2IDEA 4J9KA 3SYZA 3FSXA 3R5DA 2QYCA 1XMOF 4YB1P 3BO2A 1XR7A 1PBUA 2BE2B 2YKAA 1UWBA 3IRXB 2HWHA 1C4CA 4XPCA 2PMHA 5A2QU 2DGUA 5J2QB 3SMZA 1W26A 1C2PA 4MK7A 3MPVA 3AOBA 1OO0B 1S0NA 1A7GE 4I2PA 4ED8A 1WC3A 4MKBA 3VGSA 1OPZA 3ET6A 4RPFA 3C16B 2DR8A 3RRGA 2XEXA 3MM6A 1U6FA 2OTLS 1Y10A 3U1MA 1FJGF 4F0HA 4DCOB 1HHTP 5G0RA 4U8VA 3KJVA 3HLUA 4LF8J 2D41A 4RW4B 3CJ3A 3JAMY 3V6DA 4EMDA 2ZJQQ 3S7RA 4DPTA 2D3OR 1S6QA 1MMLA 1IVZA 4CQ1A 1W2IA 3K5LA 2BKPA 3L95X 3G87A 2NXNA 4USWA 3DLLQ 2XNQA 3C8YA 3H25A 1RT7B 1WHXA 1ZAVA 3MCNA 4C97A 2WRMA 1JK9B 3EGZA 1UL3A 1Y3KA 4B3TJ 2E29A 3AOAA 2RU9A 1TFWA 3TA1A 2IM1A 3HX9A 4WTOB 2JH3A 4TNOA 1IWAA 3C14B 2KG1A 3GCXP 1OY6A 2DCLA 1T9WA 1VRTA 2B9WA 1XERA 2GJ2A 4DEZA 3FBEA 1VBXA 3PTWA 4ZN3A 4HTJA 3G71S 2HGNA 4K4SA 2JZ5A 1OY9A 5B0GA 1BMQB 5CZXA 1RT6A 3MM9A 4DV7J 2YH0A 2DT9A 3MM8A 3SFUA 1CC8A 2XI3A 2V9WA 4JB8B 4HL9A 1NJZA 5BJRA 4QWEA 4RO0A 5LL6d 2D9OA 3LPYA 4NZ0A 1C1CB 2QSWA 4XPEA 4RUCA 1YHQS 3B6BA 2V2KA 4R8UA 5D0RA 5HLFB 4C11B 2LDIA 4DPOA 5AJ3F 2MXYA 5J2NA 2Y1JA 1FRIA 5EWGA 2QEXS 2XYHB 2IMWP 2GS8A 4NI2A 2UUCJ 2G9OA 4JP8A 2CQPA 2KU7A 1U2FA 3ONQA 1IQZA 1VYAA 4YHHF 4JI6J 4U95A 1NJIT 3QO9A 3D5MA 1PAEX 2KL8A 4KO0A 4ED5A 3KLFB 1REVA 2W01A 3MEDB 2R7RA 2DHAA 2G2OA 3HHLD 1VQYA 3FUYA 5IFMA 1P27B 1YJWS 1D0EA 2JOQA 2QFJA 1KLMA 2F4FA 2HVDA 2DNLA 4CLFA 1OQ3A 3NGUA 3GR1A 1S12A 4QR0A 3OL7A 3ZZUA 3SSSA 2GVDB 4CO4A 2M0GB 4UF4A 2WVEA 5KFCA 1YBAA 1Y5IB 3SXLA 4P73A 3QIDA 5D4OA 2OJ3A 4IYQA 3WX8A 6FD1A 1DY3A 3KLEA 1DLOA 4GVLA 4DV3F 1NLKL 2G1DA 2EPIA 4ZPCA 2WOMB 4LFCF 2C3YA 2DO0A 3PXGa 4LF7F 2JWNA 2XHWA 3KK3A 5KFZA 4QQBA 1RAAB 4HEA9 3OTOJ 1RE1B 2CUYA 3MEKA 4FDFA 3OPKA 3GYGA 5KOWA 4QW8A 2CNNB 4ETZA 1UJ6A 3MAAB 2WBMA 4IFVB 2NSCA 1VK3A 5CABA 2BMBA 1HW9A 3AXKA 1R43A 4PKDB 2C3OA 5AE1A 1QVGR 1YRUA 2MY8A 4IRKA 4DS5A 3N79A 4ETXA 1YWXA 4OZ0A 1TL7A 3LANA 3DYAB 3T6JA 1DTTA 5KFSA 5E3AA 3D1QA 5T7LA 4DR7J 3D68A 2FHMA 3PX0A 1N6QB 1C0TB 3BZQA 1WNEA 1D8ZA 1WACA 5IM0A 3TI0A 3FZBA 2OPPB 4U6PA 2XLIA 2Q6CA 5AE3A 3DRPB 4WK3A 2XO7A 2RQCA 1R0AB 4K7QA 2J0WA 2NPFA 4NLVA 4I56A 4ZIVA 3OL9A 1ZPVA 2QE5A 4F02A 3MR7A 3OXLA 3K5MA 2QLXA 5DDQC 2NXUA 3H2UB 1PSDA 1ZA1B 5HI7A 1JB0C 3PRDA 1LV5A 1NBEB 4EU0A 1F6TA 1MU2A 2IJRA 2DIUA 3UPFA 3DOKB 2NUHA 2NSBA 4J9QA 3R6LB 4RWWA 3I87A 3G6XA 1CVJA 2COLA 3DRSA 1GAOA 1FEEA 1HD1A 3ZZ0A 2Z58B 3PFEA 1IR0A 4LQ9A 2CQDA 2ZH1A 4TU9A 4CLKA 4JI4F 3HVWA 4L75A 4ZPAA 5DM6Q 2DXEA 4FKYA 3IG1A 2QRRA 2ABYA 3QJJA 1SQFA 3KG4A 4LF2A 5IWAJ 1VQ8S 4ECVA 1S9FA 2V8HA 4NYZA 4OYPA 5E33A 3G8TA 4B3MF 1S9EA 2KXNB 2DNPA 1RKIA 2AJ4A 1VRUB 3IM8A 4PXBA 2HLTA 3EYZA 2HMIA 4JI1J 1HD0A 2RAQA 2VG5A 2DXDA 4DQQA 4FBTA 2W1BA 2VHGA 1VHIA 1N48A 5GMEA 1XJWB 2RRAA 4CRJA 2F7VA 3KWMA 3FKBA 1UVLA 1GXTA 2CPHA 4DV6F 2EC0A 4OI1A 2N4DA 4LSNA 5FDLB 4EI2A 4ILLA 1R31A 3DLEA 4PPDA 1JLFB 4NLGA 5EGYA 4PWUA 4JOUA 1U0HA 4LRBA 1HYSA 3ZXWA 1VBZA 3H20A 1XQIA 3U7JA 2V8VA 2FB0A 4ECZA 4D3HA 3OR1A 2XB2D 3KLVA 1FFSB 2P9GA 1RT4B 1TL1A 4HI2A 3GIJA 2K3KA 1LKZA 3ZTSA 4AQYF 3D3CJ 3CJ8A 1S57A 4MIAA 5L9XA 3SCJE 5DLFA 2CQIA 1NM2A 5LMUF 2HFOA 2R7VA 2LQ8A 1VRQC 2AWZA 1S59A 2MQQA 4UUXA 1W7WA 4QIEA 3H42A 4K4ZA 4MFBA 2GQ2A 2FY1A 1RHRB 4OZJA 2IBKA 2NCKL 4J7CA 3J80Y 3DI6A 3LGMA 2CRLA 1YIJS 4IO1A 1XIQA 4HACA 5AXLA 4KGXB 3B54A 3M30A 3FVYA 5DM7Q 4LRAA 2Q1LA 1ZAXA 3C6UB 3QATA 5J1EA 3MEGB 5ETLA 2OGUA 1X5OA 1Z2LA 1R7IA 2HZVA 2FPHX 2FYXA 1NSAA 3OUYA 1DAXA 5KFMA 4OYWA 1KQSR 2RJZA 2GNKA 4M63A 2L48A 4N7TA 5KFXA 2AGQA 4ZVSB 3FDSA 4DWIA 5D4LA 1AT1B 4ZCMA 1VJQA 2IAJA 5C2CA 2WHOA 4CP5A 5IT9U 4IKAA 3IAM9 3MMAB 5KG2A 1WHYA 5CZVA 2B5JA 2GQQA 2YTCA 4USTA 2BA9A 3K7RA 3H5UA 2CVEA 1JLCA 5IZHA 2V69A 3PVXA 3ZTPA 3ISZA 4B3RF 1NPKA 1RT3A 5LSOA 3Q8QB 2MKYA 2E1PA 1KOHA 4WP3A 2XCPA 5HK4A 2LECA 1X9WA 5KFTA 3W61A 2BE9B 1TK0A 2CJ9A 1IKXB 1HBNB 4MKVA 3VHQA 1NNDA 3MPDA 4DFPA 1KBRA 2KVQE 4KPYA 1RWMB 4OZ1A 1H73A 2CXEA 2PEHA 3VAKA 1REGX 2HFVA 4ER8A 4A4JA 1IBLF 4OFZA 4LSLB 3HFZB 1S0VA 4EBDA 4NXNJ 4Y2KA 3HSGA 1RTHB 3NAHA 5LSLA 1IBKF 2MQMA 2ZNZA 1S1TA 4PG5A 4DR4J 4HHUA 1RSCA 4YQWA 3UN5A 5IS2A 1S99A 3L09A 3IBWA 3R5BA 3RB0A 2LEAA 4USIA 4YUDA 2PA8D 4DV1J 3DLJA 3MXHP 2IVMA 3KLHA 1FRXA 3QZ8A 2XZTB 2XNRA 1SV5B 3ILOA 5SUHA 5IT0A 3O6QA 3MF5A 3A3NB 1H0HB 1QVFR 4O4GB 3PEHA 2E9RX 3ZNUA 1HR0F 3BYRA 3NP5A 2AEJA 5EUHA 5J2PB 1VISA 3DN9A 2KFZA 1F2HA 3MEEB 3QZ7A 1FX2A 2AJ1A 1Y11A 2O66A 1VIXA 4CH7A 5D3GB 4ZK7M 5DLGA 1W25A 2RNEA 3M1VB 3I32A 2ZH8A 2KHDA 2MKSA 2XMTA 1HHSA 1Q81T 3RW6A 3NGSA 1FK9B 2FLLA 2AJQA 2AD9A 1NB2A 2GAHC 4URGA 3M2RB 3JSMA 4CDIA 2JNJA 3MM5B 4EGLA 2LQBA 1N36F 2DR7A 3NNAA 1HBUA 5KFEA 4W98A 1HIYA 1RA6A 3PR4A 4QJVA 3T5KA 1K1QA 3V81B 4B9VA 1YJTA 3PDNA 1HPZB 1Z2ZA 2C2KB 1R6YA 4OJHA 1N5YB 1CS4A 1WC6A 4IDKB 3A8IA 2BW7A 4U7UK 2DHSA 2E7VA 2NZCA 4B3SF 2B4PA 2DNNA 4JV0A 2XSJB 4I2QB 3W60A 1S1VA 2V2QA 4ZVRB 3LWLA 3BGFA 5AT1B 1HBOB 3ENWA 1JLAB 3NWRA 1S72S 2RQMA 1RAHB 2LLZA 4CZCA 2V9KA 2YH1A 1Y7PA 4ZVPB 1EIYB 3Q2TC 1U6BA 2LDYA 4M5DA 3MM7B 4UOFA 2BJ7A 1YZ7A 3PJ9A 5F0UA 1Q0NA 5HROA 4OYBA 1ZA2B 2MZSA 3CMES 2ZZMA 3CCSS 1T3NA 2CQ0A 3NXZA 3MFHA 4RNMA 1BE4A 3T5LA 1CPZA 1SL2A 3ZZPA 3UQSA 4TQSA 4PG8A 4W4MA 4HYKA 2XQCA 1WDDA 1NK6A 1HNVB 1TKZB 1XMQJ 2HAFA 3L3CA 1HQEA 3AOCA 4ZHRB 3AH6A 4IH5A 1S7HA 3LPEA 4E0DA 3NS7B 2JEJA 5B0DA 4ECRA 2J0SD 3KK2B 3CJSA 4CLWA 2V8DA 1VLYA 4MIBA 1N32J 3PCOB 1C1BA 5F9LA 1FTRA 4OYMA 1TTHB 5KFVA 3I82A 1JLBA 4J9NA 4ZPWR 3JTPA 4W92B 3CD6S 2YX1A 3U27A 1RHJB 4IG0A 4PG7A 4DV0F 1YTYA 4O4RA 2MDAA 4UQTA 2GVZA 2XS7A 1WD6A 3D0HE 2K8GA 1QAYA 2AIRB 1I6JA 2HS0A 3LAKA 4I69A 1T05B 4X4UA 2EBEA 3H0PA 5F3ZA 2A2CA 4M5LA 3H59A 4UY85 4DG1A 5A6WA 4UZBA 2KZZA 4ZJLA 3MR5A 3GONA 2MQOA 2FJAB 3ISNC 4FF2A 2WW8A 1SUQB 1SL1A 1NH7A 1WF2A 1WWHA 5IQ6A 3H2VE 3G8SA 3BQ2A 3QPIA 4CLZA 1M5PC 2CJQA 2E7WA 1XC9A 3QGGA 1UFLA 2J9DE 4ZOSA 1XWLA 4W90B 1DQ8A 2ROGA 1RTZA 5L8RC 3PZPA 3GIRA 1CJKA 5KOXA 2FJBB 5KFDA 2F63A 3W3SA 4A8YA 2I5JA 2VQFF 2QLFB 4DS4A 1XR6A 2WBRA 4A48A 3NRBA 1Q8KA 3C46A 5F8LA 4P71A 4DR2J 4JI8J 4MIWA 2J5AA 2PT0A 3M05A 1K47A 3BGLA 3VGVA 4KJIA 4O3PA 2NYIA 2GCFA 3CTRA 2VDIA 3T5JA 2Z2LA 3S8SA 1QAJA 4G1QB 2UXBJ 1F1BB 1GT8A 2HHQA 3KK1B 2F8HA 5L38A 1HNZF 3Q23A 2HFSA 5CYQA 4OHWA 2FJWA 4NRTA 1LWEA 3TAMA 5MAOA 4PXEA 2YWKA 4L6V3 2MY7A 2F4VJ 1RQ0A 1WUUA 4KKOB 3D0IE 2XY6A 4WPAA 1RT2B 2DH9A 3G6YA 1IR2A 2W4DA 4I7FB 3WZ0A 1XTZA 2ADBA 3Q8YA 2GQCA 1UA0A 3OR2B 4TY8B 1VCTA 3NMRA 1JLQB 4IQMA 2KZMA 5GADI 2A6MA 2BJ3A 1FWLA 1SH0A 3CO9A 3H4BA 1KQKA 1FF2A 3OFGA 1APSA 2BE2A 4C8LA 3IRXA 1I94J 4MK9A 3CULA 3W2VB 1AB8A 2RHQB 3NOCA 3J81j 4OX9J 5J2QA 2XGPA 4O44B 2PC6A 1VFJA 1SVDA 3D66A 3EZUA 2V94A 4RW7B 2NLWA 1VHFA 3TAPA 2G2ZA 3D9BA 1K1SA 3HP6A 1YG0A 4LFBF 4C8OA 2APOA 1N0VC 1S49A 3KLIA 3UCUP 1WJ9A 2OUGA 2B7CB 4I0WA 3DGPB 1N52B 3R8YA 4IR9A 4ZP8A 2IDLA 2EEYA 1GX5A 1NK5A 4ITSA 3W64A 3DXSX 2AQ4A 4USMA 2YWFA 5DJBA 4B9SA 3G86A 1KRPA 1U47A 2X1AA 3TYTA 4K0KF 2CDRB 1ZZFA 3GFYA 4RW4A 2E1RA 1U7LA 2VFSA 7AT1B 3T9NA 4UTGA 4LFAJ 4UQGA 1SQGA 4LF6F 4C3MA 3ZFVA 2FZKB 2DCUB 3NGDA 2R2SA 1B0VA 5F9NA 4KFBB 3TVYA 4OLOA 2VB6A 3R2CJ 1UEUA 1RT7A 2OH2A 4RLEA 5H1SV 1V9OA 1KWMA 1LXNA 3BBFA 1S1XB 1TMMA 3R5AA 1JJ4A 3BO4A 2AJFE 4DV5J 2LCWA 2H5JB 5KT6A 2DD8S 3JS9A 3ZTRA 3THPA 4WKYA 3C14A 4LR9A 4JI2J 5CD4A 2PGCA 3LGHA 2HQFA 4WBFA 1FRJA 3M8WA 2KKHA 1Q7LB 2QMWA 1ACMB 4QR1A 3V2UC 4QWBA 5L1IA 4AUKA 3I0SB 2AX1A 4B9TA 1DURA 1NAQA 2UUBF 3KLGB 4Y2MA 1X7VA 3MUVP 1UPMB 5IT9Y 4OX6A 4K4TA 4YEAA 3SV3A 4OI0A 3N28A 3L9ZA 4DDFA 4ICLB 3D1OA 3KHHA 5EX0A 4BC9A 1PGZA 3HKZD 2ZOMA 2HHHJ 1UZDA 1C1CA 4MH8A 1N0UA 3E51A 4N56A 4CO2A 1FX4A 2OEMA 2GO8A 4PG4A 5THWA 3GZ7A 1NHKL 5HLFA 2AX0A 4C11A 5ETQA 1KDNA 2J6SA 2ZUAA 3HI9A 1SI9A 4PPZA 2V4QA 1JXVA 3E01A 2K7KA 3JTNA 3MI7X 4KGZB 1RAOA 4LIRA 1HMVB 3UW1A 2Y0SD 3A13A 2DGTA 1YJ9S 2GMHA 3N4WA 4ZCKA 4EO8A 3I56S 3F41A 3O1LA 1CULB 3Q8UA 1U26A 3NEKA 4ZJOA 1CLFA 3NCRA 5B0BA 3MPYA 3IBCB 3KLFA 4EO6A 5C7PA 2R8GA 3FMWA 5M2RA 2C3PA 3GU0A 2PFFB 3OD2A 1GMWD 4A46A 1SH3A 2JRSA 2F5GA 4GKJJ 4TYBA 4C8ZA 2C2OB 2K2PA 5B0AA 4C3KA 2KVIA 1CQNA 1RU2A 2GVDA 5KT7A 3TJAA 4NCBA 2K06A 4DV4J 4ECXA 2GA7A 2MKIA 3LGNA 3K5PA 2R8JA 4A8MP 2XMJA 1QM9A 3W5YA 2W2PP 3I4PA 2DNRA 3I0RB 3IO1A 2HVEA 4K5RA 4YR3A 4QPXA 3QAUA 2AU0A 5HMYA 3OVBA 2P6TA 2R7TA 5K14B 3HSJA 4OJ3A 5KG1A 2YWEA 4RKUC 5DDRC 1B64A 4IFVA 3G9CA 2Z4PA 4KT0C 1HNIB 3M9MB 4NA1A 4X64J 5LMNJ 2CPXA 3AA9A 1FTCA 3K0JA 3NG8A 2IRUA 4DL3A 1WC1A 2EK1A 3KJQB 3SZ2A 2UXDJ 1PYTA 4LVNP 1H7XA 2A1BA 1AA1B 1JXLA 2U2FA 4LBIA 4BWMA 3DYAA 2LQ9A 2UU9J 1TVRA 1NKCA 2JLFA 4CLPA 5DZ7A 1N6QA 3NGTA 1C0TA 3D7SB 2W9BB 4RBTA 2H4WB 2LXFA 2GHVC 3DDIA 2OPPA 1VBYA 2EFNA 5KT2A 1OJ4A 1IKWB 4PR6A 1CQMA 1SKUB 1XN9A 1FDDA 2FLOA 1R0AA 2XI2A 3HFVA 3MD3A 2QLWA 4KR0B 2E5JA 1GMUA 3GFZA 1FKOB 2LKZA 4DQIA 1QE1B 2Z8QA 2ZDPA 1B3TA 3DHWC 3IN5A 3OJSA 1YJNS 2QX0A 2WVFA 1SCJB 3PY8A 1S77D 1DHMA 1RHMB 1G6BA 3DOKA 4KHPF 4WFZA 2M9KA 2M5YA 2LEPA 3H5YA 4YDXA 3W5XA 2KFYA 4CLLA 4C6AA 3TZZA 2NS1B 3ZZOA 3GV5B 1EETB 1FKPB 2F3JA 1J27A 4FYWB 2WCXA 4LR7A 3EMTA 2M7SA 4TXSA 3CJKB 3FBCA 2E1CA 2RH3A 2E5GA 4DLGA 3ZNJ1 1CSJA 3NGRA 3CUNA 3RB4A 3HF5A 5JUMA 4X65F 3PR5B 3FJ2A 1RTJA 1VQ9S 1BQMB 1UAWA 1JNZB 2XMAA 2BUNA 2IM0A 4WWSA 3D6MB 1U45A 1VRUA 3H5XA 2KM8C 3ADAC 3PW4A 3CCMS 3GB0A 3CCJS 2ASLA 1FXLA 2IYGA 1TKTB 3MPWA 1L3UA 1IJFB 4CNYA 4DUZJ 1KN6A 1TELA 4NL5A 4OYIA 2HNDB 3N6LA 5FDLA 1FRHA 2VOOA 4LF4J 2QGFB 3HHLC 2R2UA 4QU6A 1JLFA 4EWTA 3MMCA 2XMUA 2XO6A 4RZRA 3A4TA 4Q45A 1RJJA 4P10A 1MWQA 4A8FA 1UW9A 1RAFB 4ZIWA 4TU7A 2PSZA 4XDDA 2RRBA 1JLGB 3G96A 1EARA 2ASJA 4K4XA 2DY1A 4C7QA 3H8YA 1LWCA 3CJ5A 1TZ0A 2VJVA 4QCLA 1RT4A 4TLQA 3JQJA 3BKTA 3GLJA 1D8YA 3TJ9A 1NXIA 3WIUA 2FJEB 2B43A 5E2QA 4KGMA 5AXKA 4QBUA 1R8CA 4HTIA 1IM6A 2NREA 3PHEA 4FXVA 2VODA 4IQXA 4CM2A 4V19X 1J2VA 2H54B 2X1FA 2GJIA 2OPRB 1UKUA 3BGRB 4M95A 3MFIA 3VR1A 2HHVA 1B0PA 3HZEA 1HARA 4DZDA 3PX6A 4MKYA 1JLEB 2R7OA 1TFYA 5HAOA 2POKA 1KQGB 3CT9A 2ZBQA 2WB1D 2MHNA 3EVOA 4ZPTR 1ROFA 4Q5VA 2EFGA 3MEGA 1UW4A 2HZCA 4E98A 1RAEB 1HW8A 3W66A 1SJRA 3LTOA 4PWDB 3A8EA 2VPZB 2XMWA 3DDNA 1XMBA 3MPUB 2WSCC 5FD1A 1MROA 1L3VA 4I68A 3MECB 2HVIA 5KFBA 1Q8LA 4UOGA 1PAUB 2JVOA 3DU5A 3UE2A 2M8HA 3A3PB 3TZXA 3TAQA 1CBKA 5GAHI 2ZKTA 5CH7B 4IRDA 3MMAA 1OWXA 2CPIA 2Q79A 5BR8F 1EB0A 2BDPA 2LYVA 3HXMA 2G1HA 2P2CB 2W2NP 5HVGA 2AT1B 1DBDA 4R25A 3HFKA 2HNYA 1BWVA 3DOLA 4ZP7A 5KTQA 2ZE2B 1Q8BA 4MT1A 3SIPB 4PXCA 1M5SA 4BC7A 3I55S 1RHKB 1B0TA 1UFWA 2HBZB 3HHLB 4N47A 4C8YA 4XAKA 2HRYA 4Y34A 3IC1A 3A8JA 1EZZB 4F0KA 2YNFB 1N34J 1IKXA 4ANCA 1VQPS 2BABA 4OLPA 1U1OA 2ZHAA 2HK2A 3M9NB 3ZTOA 4Q43A 4NA3A 2XHCA 4DF4A 4DBQA 1EJ7L 2ZBPA 3M6VA 1Y5NB 1XNQJ 3HHDA 3Q8RB 2AEMA 1H7WA 5ETSA 1T9TA 5CYJA 2RVJA 4LUBA 1FO1A 1RTHA 5IV4A 4BBYA 1QSLA 4X4PA 4ZVEA 4YB7A 3D2WA 2DK2A 4EEYA 4DR5F 1X9MA 4YB6A 1O5JA 4R5PB 5GADU 5KG0A 4OL8A 3VZHA 2IIHA 2AW0A 1SJFA 3BBCA 3V4IB 4OJGA 2NXCA 3ILIA 3CCLS 3RRKA 2QZ8A 4NWBA 3HSZA 1TKXB 4PEOA 5DDOC 3VGUA 4B9LA 1VQSA 3PW0A 1RTIB 4O4GA 1X60A 3FSIA 5H9EK 2RRNA 2RDDA 2VPXB 5J2PA 3PO4A 4FF4A 4C3LA 3DMJA 3LAMA 3MEEA 2MQ8A 4DFKA 5C5JA 1E6YB 1SB6A 3MURP 3D6TB 3BEGB 1J5OB 3LOUA 3HVAA 2AV5A 3M1VA 3M2VB 1YI2S 5B0EA 1FK9A 2BRKA 3TARA 5BYQA 3FEXB 3HSDA 3PV8A 5KFFA 1XMOJ 4C0BA 4HVZA 3R7SB 2LMIA 5JVHQ 1PYSB 4CH0S 1QUVA 2A0FB 2W4CA 1H2UX 3EUNA 2DGVA 3K5NA 3KUEA 2IVYA 2ZVSA 3V81A 1UWAA 3CDWA 2DBBA 1N33J 1HPZA 1E6VB 4DR6J 2FC8A 3B4MA 3ENAA 2D7SA 4WTYA 5DZ6A 3OTCA 4NLPA 1NKBA 4IDKA 2FQQB 2VV5A 5HP1B 2CG4A 2G0IA 1LWFB 2QMUB 2CDQA 4DUTA 1FJGJ 4QWAA 5KFIA 4FNIA 5DQIA 2BOPA 2XSJA 2P8IA 2IYIA 1GMVA 4I2QA 1H74A 3W9HA 3MCMA 1EP4A 2XGQA 2BR0A 3AAWB 1UVMA 4EBEA 3QLHB 2OIHA 3RB3A 1UFKA 1HBOA 4RUHA 1F5CA 1JLAA 3SQGB 4GRSA 2DXFA 1DJ0A 1FWPA 2FUG9 2EBGA 4NEYA 4B9NA 1MLAA 3IR6B 3KDOA 3PG9A 2OI2A 4WP8A 3BPDA 1U24A 1RT1B 3MM7A 3UNGC 3TX8A 2V34A 2XCAA 4ZKAA 4OHXA 3VCDA 3S1TA 2CQ2A 1VS3A 1YRXA 2KDOA 4DN9A 1UWBB 4IH7A 2G4BA 5EWFA 4JYAF 4ZVHA 3DU6A 2W8LA 5IC6B 3VZIA 4KV8B 5BYSA 2HK3A 4O3SA 1VLOA 2H9ZA 2MJNA 4AT1B 1HNVA 1YZ6A 2UVWA 1FNOA 3FQKA 1X4AA 4X4SA 2HURA 1ELOA 4ZHRA 5HMZA 1MSWD 3EGVA 1YBTA 1X4CA 4X4VA 3KK2A 3J7YU 3EGWB 3ULHA 1PILA 2DGOA 2ZKUA 4XTTA 5F0WA 1RLCL 3PRVA 3PFOA 1BD6A 4YB5A 3T6BA 1SL0A 3FZ2A 2DRDA 3G6ES 4X4OA 4C9DA 2YQ1A 3TO8A 5F41A 2HQGA 3ENQA 1DQ9A 1YQHA 3QYYA 3GILA 2RB7A 4DLEA 1RCOB 4ED7A 3U02A 3RR7A 2ZHOA 1T05A 4K5SA 1DQAA 1SC6A 2XBPA 4Q7AA 4P74A 5M2UA 4M1KA 4P2FA 1M5HA 1SUQA 4JI0F 1H98A 2GIQA 5L39A 1B7FA 2NPIA 3TW0A 1EHWA 3M6WA 4K4UA 2JC0A 1T3OA 3H90A 5J1NA 4FZVA 4Y2IA 4CI0B 4YHHJ 1XMQF 2OAUA 1RWNB 3C19A 3AD9C 1VRTB 4JI7J 2OSRA 1IR1A 1JNRB 1RWKB 1NMEB 4NE9C 5SZTA 1XEZA 3RB6A 2JDJA 3D6HB 4H4MB 1PKUA 3P6YC 2E44A 3KHLA 1DFDA 2BYCA 4NLQA 1U2RA 1VI7A 3MM9B 2ACYA 3HCXA 3MM8B 4G65A 2W2OP 1KVKA 3KMSA 1D9FA 3J80U 2R4FA 3CW2C 1RHQB 3JB9k 1KOOA 5ADZA 4FPRA 4WIIA 2W2QP 4G1QA 2BE7D 3BN7A 3KK1A 2DO4A 1VQ5S 4ES2A 4NLOA 1YGYA 3IP0A 4LFCJ 3PKMA 2DIVA 2MTLA 3RW7A 4LF7J 4QZVB 1R0CB 2R7XA 2FHOB 4KKOA 2BJ8A 4BLGA 2BQUA 3L7UA 4I7FA 2M8DB 2DNGA 3Q22A 2BQ3A 3CJQA 1URRA 3OR2A 1UCNA 4TY8A 1WG1A 1JLQA 1X4HA 4FYDA 3CNQP 3OLBA 2XZWA 3QO9B 3M8PB 2RSQA 1JMTA 4JV2A 3DKDA 2J9EA 3NLCA 3W2VA 4S0MA 4A8XA 1K0TA 2O5DA 4O44A 4N8OA 3UD3P 3CIZA 5KFQA 4DUYF 4P7TA 1L3SA 1W2BR 3K89A 1WC0A 3MOJB 5I42A 4G1IA 4DR2F 5F8NA 5GVQA 2R7UA 3LH2S 4QU7A 4CO3A 2CNKB 3DGPA 4OZ5A 4WP9A 1QSSA 4IOCQ 2CQGA 4DFMA 4NLWA 2BOAA 4TLRA 2X3GA 1S6UA 1T02A 4PYAA 3CIMA 2M4MA 4F0MA 3FCHA 3V4MA 2DR9A 4ZLJA 3H4DA 1HI0P 2DHGA 2RS2A 1S9GB 3QGPA 3L7PA 5I3UB 2X7IA 2EI5A 1MMNA 4JV5J 4A8WA 2FVCA 2Q43A 3FRYA 1Q82T 1S48A 4F4WA 2Y8WA 1J5EF 4KFBA 3VVUA 3SQOP 1HWUA 1BQNB 2XMMA 3TJ8A 1RK8A 3FEYB 4QYZK 3Q8PB 3DC2A 3FMBA 2PMZD 2C22A 1CG2A 2A2DA 1TUWA 1S1XA 2EG2A 4HH1A 5ETTA 4P2MA 3G6VA 4NZ6A 3JSRA 4OX9F 3Q83A 5HSPA 1R8AA 2QL5B 1NK8A 1SBRA 4CYUB 2RF2B 3K8WA 1SH2A 2HPUA 2Z2MA 4X2BA 4JI4J 2V4JB 4OZNA 3MTJA 3UCZP 3R1LA 4C8KA 2WK4A 2MLZA 2QG9B 5T7LB 5LXRA 3D0GE 1V5IB 2ASDA 4FVMA 2YNGB 4P2XA 4OI3A 3I0SA 2Z56B 4ZITA 5IM0B 1G4CA 1AFIA 2CG8A 3KLGA 2B8PA 4B3MJ 5A6PA 2J6TA 3DOMB 1A9NB 2B51A 2IA0A 2F65A 2GGPB 1IBMJ 4ICLA 5KG5A 4HDGA 3SCIE 3VAIA 3BJYA 1LOUA 3UNYA 4AFFA 4DPWA 1TR0A 2PMWA 4G1PA 4TKTA 4USJC 3HKWA 3NS6A 1HLWA 3CMQA 4DV6J 3NWGA 2KJVA 2WTFA 4OX8A 3D1HA 1FRLA 3EWGA 1GEHA 1K44A 2HQ3A 1KS2A 1MU2B 1Q95G 4DX6A 4O0IA 2D3O1 1B70B 3H5SA 1F5BA 2B8QA 3LUYA 2GO9A 2GMLA 2CPDA 3IWXA 3LP2B 2A18A 2Y8YA 2GHWA 4ED0A 4USHA 4A8SA 4HT5A 3BH6B 2LA6A 2WSFC 3DRSB 2MB0B 3DNCA 2KG0A 2R2TA 4RW6A 2LP4A 3LP0B 3W1YC 4EZ6A 3ITHA 1HMVA 1JJCB 4A47A 4Q2LA 4AQYJ 2KRBA 1TV6B 3TVKA 2EK6A 2C42A 2R8HA 1CULA 2FZGB 2MQPA 1T0TV 2VL1A 3RBZA 4IFYB 4HR2A 1CJUA 2HYIB 3Q0AA 4N77A 1KP6A 4LF9J 1S9EB 2DRAA 4OV1A 3RYLA 2DNHA 2B7BB 2QC3A 2DPJA 2IM3A 4RW9B 2HMIB 3QSYB 5GAHU 3VQSA 3MZIA 2WVBA 4NEZA 3W63A 2ERRA 1FESA 4IO9Q 1RYRA 4GC6A 4LSNB 4NPOA 3AJ1A 5C2GA 1VC0A 2V68A 3WIVA 2ZC4A 2RKIA 3I0RA 3TWZA 3E2EA 1F2GA 4DI6A 1T7PA 1I51B 4RUBA 3QT8A 4J91A 4UUWA 2BBEA 2W2MP 4HT7A 4U67Q 5K14A 3OR1B 4DL6A 1GH8A 3OTBA 2GX8A 1T94A 3Q8SB 4F4KA 2HHTA 1SC1B 1TL1B 4QPTA 1UPPA 1JKHA 2YWGA 2YX4A 5AXMA 5C25B 2FHJD 5LT5A 2VZ9A 4DSJA 2ATCB 1KD1T 2OPSB 3OFHA 1ZM4A 3V5RA 3FBFA 6FDRA 1Y5LB 3P49B 2O01C 2LU2A 1RT5B 4O3OA 1NPPA 4M5KA 4ELTA 4B3RJ 1P8GA 3N01A 3KNGA 4NMLA 2WB4A 1RA7A 2GMJA 2C2MB 1U4BA 1HI8A 1QTNB 4DL2A 2JX2A 3LALA 5A8RB 2WONB 3AQPA 3I96A 2VIHA 4F04B 2W9BA 4HACB 2VG6B 3SSRA 2MQLA 2N4CA 3OFEA 1IKWA 4RJVA 1PC5A 3Q2SC 1YKWA 3HDSA 3EVMA 3QFWA 4IUFA 3T19A 1RCXB 1FKOA 4IG3A 3A8KA 3OUYB 3UVJB 2HZAA 1QE1A 1F9EB 4GKKF 1IBLJ 2DR6A 5EDWA 2L41A 4DU8A 1F9FA 2J8SA 2I6WA 1HQ2A 4QWCA 2KYXA 9RUBA 3BR9A 2QMXA 1IBKJ 4DOZA 2YNIA 2EFVA 4DL5A 2DISA 1S5ZA 5KG3A 2AYGA 3DGVA 1RZMA 1NSQA 3OHAA 4L3NA 3I9V9 1YJRA 2J7KA 3BREA 2L9NA 2KHCA 2UXDF 3WX4A 1WSVA 4YY3F 2CPFA 1FKPA 1IXKA 1Q16B 1FI4A 2MSSA 4UW2A 5K8OA 3CVKA 2IC3B 3P45B 1RB0A 1KONA 3N5BA 3CJKA 1ZTWA 3DRXA 3CDEA 4ELUA 1HR0J 4Z7YA 2B56A 2ZWOA 2ZH5A 2HFZA 1M5VC 4DX8H 5CAAA 4ECUA 1XNRF 2G0JA 4H4KC 5FIIA 1BY9A 4U9RA 3HZGA 3OJUA 4GVBB 1IKVB 3GPAA 3DLGB 1RAGB 4M5IA 4PWWA 1DTQB 1UVNA 5LOQA 3CJ4A 4OX7A 2ZD1A 1U09A 5F8IA 3VAMA 1WHWA 3PYGA 3H7HB 2OD6A 1O0PA 2XY5A 2G2YA 1L3TA 2J7WA 4WYLA 3AQOA 2HNDA 1RGVA 3B4DA 3KHGA 4F25A 3BSOA 5DDPC 2YX7A 1N36J 1RISA 1OMSA 3CCUS 1UEKA 3SDEA 1JLGA 5DGBA 3QAEA 4YOEA 3KLHB 3M2UB 2W24A 3R2DJ 3EM1A 4R0EA 1GX6A 3LP1B 2RHSB 3KKFA 3QT6A 4C0HA 2XMVA 4OI2A 1HNWF 1LNQA 3TUJC 3KDNA 4B3SJ 2M70A 1TUVA 3MAQA 5T41A 4LREA 3QT5A 3K8VA 4CNZA 4TY9A 4FF1A 4CM0A 4RU9A 1KQFB 2UVUA 2YQ3A 3FFIB 2Q6BA 1UMJA 4DSEA 4F26A 2OPRA 3BGRA 4M5HA 4OMFG 4X62F 2YPZA 2VFUA 4PCQA 2FGOA 1WG4A 3PACA 4JI3J 2OELA 2AYBA 4XDCA 1TQLA 2YWHA 5KG4A 1JLEA 1F60B 1X4GA 4ED4A 3GV7B 4AE5A 4DUZF 4NXMJ 2YVSA 3FK4A 1ICEB 3GG0A 3IA0A 2ZOFA 1VC6A 2V2VA 3JTOA 4K4VA 5IOLA 1JJHA 5CA5A 1CJTB 1HI1A 3MMBB 1HBUB 3BGUA 1HBMB 1P9YA 2BKNA 1UVIA 3H98A 1AZSB 3M9OB 3GIMA 2HLUA 3DRYA 4YMEA 4DX7A 4DV2F 1N4LA 3MECA 3D28A 1IUJA 1UVKA 2O1PA 1PBAA 3RJMB 1WEYA 1ZM9A 2BJ1A 2OKQA 5K9FA 4ZVOB 5A76A 2I2YA 1S1VB 5E41A 1FJEB 3VALA 2N3LA 4LIWA 4CO1A 5J2MB 4HLBA 4X66F 1U49A 1OPIA 1N8RT 3KUGA 3ICLA 2MHEA 4OZ3A 4V19J 1UETA 3J81U 4DV0J 1RWPB 2VBZA 4USVA 3R3TA 2BVZA 3PRBA 4AYBD 1SC3B 2BJ9A 4KY3A 3HHLA 2CADA 1G2EA 5KFWA 1R8PA 4BS2A 1PJ7A 4LT6A 2PA3A 1KEKA 5HROB 3UDEA 2JC1A 3TVZA 4DSIA 1VQOS 5KG6A 4WU3A 2YNFA 5KG7A 5H9FK 5ETNA 4RX6A 4F50A 2VUGA 4DCJB 3IMQJ 1K73T 1B99A 1RBAA 3M8SA 3QJLA 1YSJA 4FF3A 4KAIA 2ILYA 3U1LA 3OSNA 2E1AA 1HQEB 5E3RA 1LK5A 2AHOB 1H38A 1OS5A 5HQ8A 4DR1J 4K2XA 1WOOA 2VQFJ 1TAUA 2QSFA 2DVIA 1NZAA 4U7UD 3JSBA 4R5PA 3T41A 1G3OA 1QY7A 1DRZA 1JLBB 1EKSA 3M7VA 3MD1A 2E5IA 3V4IA 4WXWA 2LFVA 3V6JA 1U0SA 2ILZA 1G7CB 1TKXA 2DEIA 3RAQA 3CPWR 1RTIA 4LRCA 2J0XA 1KC8T 2DRBA 5DGAA 2MZJA 4ZVGA 2R7WA 2VJUA 1M1KT 2JL9A 3HD1A 1HNZJ 2DEJA 2AKWB 2HAIA 2HWIA 4ATNA 3EXYA 3VAGA 3EGNA 2VH7A 2JHEA 4CTAB 2VKZG 3QWPA 1E6YA 3AD7C 1N34F 1AW0A 3D54A 5EX3A 2OPQA 3G4SS 1J5OA 4QOTA 1Q86T 3M2VA 3C15A 2W7PA 3KG1A 3B78A 1WI6A 4KC5A 5HJYA 1VQKS 4ILMA 2PDAA 1NDPA 4WCEQ 3T1HF 3DLHA 3M8ZA 2PE8A 8ATCB 1IM4A 3RAXA 4NLRA 1Y00A 3KMQA 4E2FB 2QIFA 5G4DA 2X1GA 3P96A 1U6ZA 1U1PA 1X5TA 2NQPA 4NLTA 2M2BA 4V1Ak 5B0FA 4F4AA 3MCSA 1E6VA 3C6TB 2MQNA 2Q66A 1F3FA 1FNXH 1S0OA 1H3DA 4LFBJ 2VFRA 4KQZA 2I38A 1LWFA 2DGWA 3D4JA 3V6HA 3BPSP 5A8KB 4F3QA 3Q24A 4K0KJ 4NX9A 2UVVA 5CYQB 2W25A 5E5NA 1T9YA 3SQGA 1C0UB 2AF6A 3GCWP 4EZ9A 2PI5A 2CYYA 5IXUA 4LF6J 1V3RA 2D9PA 4K59A 3FRZA 4DSFA 2WVCA 3CCVS 2QL7B 2N7YA 4RW8B 5ETPA 2DGSA 3T9ZA 5E0OA 4QIFA 2MLXA 1JXEA 1RT1A 2UUWA 2XWYA 4PQUB 2CQ3A 1RTDB 1SJQA 1FVSA 1LFWA 2WZ1A 1WTBA 1U1RA 2IMOA 2KT2A 3GFXA 2H51B 4R0JA 3RRHA 3TQ1A 2MLYA 1R6VA 2FVRA 4J90A 3M8YA 3CC2S 3HULA 2KT3A 4M5GA 3IS9B 4KV8A 1D09B 1N33F 1DARA 4DR6F 1FEHA 3JYTA 5IC4B 1U8SA 1HNXF 1N5TA 3MMJA 3N6NA 1DZ5A 2QO3A 2ACMA 4YP3A 3KLIB 4DQRA 2MKCA 2UUBJ 3NCQA 3GR0A 1VJWA 2KXFA 4ZCIA 2QA4S 1X0PA 1RI7A 1SIWB 2YKMB 5M2PA 1IQTA 3ZZZA 4P6QA 2GIFA 2RDIA 3OVAA 5A8WA 4MK8A 4J9SA 5E3QA 1YJUA 4KIAA 2IFXA 3BDEA 4CLUA 2GHPA 1Q1KA 2N7CA 2B9XA 2MPUA 1LXJA 5GAEI 1S76D 3C2PA 5LJ3Y 2ZBCA 1CJVB 1KNZA 7FDRA 2I8EA 3OBIA 1H2VZ 2BRLA 4F8RA 3AHPA 1VIOA 2JFKA 3RGIA 1G1XA 4NLXA 1FDAA 3K2YA 4FYYB 2HKEA 1I5OB 3CEDA 3W2WA 2XTJP 3UN2A 2ALZA 2XM3A 4F67A 3H2LA 1FD8A 2PEBA 2ZH3A 2DH8A 3CCQS 3NAIA 3QFHA 1AROP 4WE1A 2C2DA 4OHZA 5K5MA 1VQ4S 5ETRA 3VAHA 4HKQA 5D6GA 4H4MA 2OFHX 2BANB 4BHQA 2C3MA 3BSAA 2RILA 2QFIA 3N9UC 4LQ3A 3AXMA 3CMAS 2DNYA 4PUOA 3D3BJ 2L9DA 3CC7S 2W7OA 1NUEA 4RUAA 3NY0A 3CD7A 3M8QB 3G82B 2UXCF 4NLUA 2VPYB 3SV4A 4H4OA 4ECWA 2GC8A 2H5EA 5D8HB 2K3IA 3P3DA 2EFPA 1SJ4P 3PJWA 4H54A 2YKNB 2ZM6J 3QT7A 1X9SA 2UUAF 4URQU 1PG5B 4JV1A 2V8GA 5LM7E 9ATCB 5AE2A 1B7YB 2ZVIA 3OVSA 3DXBA 4EYIB 3K57A 2B4VA 3VWSA 4AXJA 3TOQA 4TQRA 4CWBA 2V6AA 1N5QA 3I5BA 2HWTA 2HSEB 4HHHA 2FLNA 2AP6A 1SJ1A 3IR7B 3E01B 3BDPA 4X4RA 2NZ4A 4ID5B 1NJWA 3BM7A 1S1UB 2PI4A 1X31C 1YBUA 3M4XA 4KH0B 4Q2MA 3FNNA 1NJYA 2QLJB 3T1YF 3M8PA 1RACB 1NHVA 2CJYB 1TL3A 2IHR1 1BGXT 4JI7F 3J7A1 1WF0A 2G0CA 3O3LA 1EKRA 2ZHBA 3IGNA 4M5MA 2HG4A 3UWTA 3GWCA 2EXUA 2UVRA 2IM2A 2E5LF 4DHVA 3L7OA 2QT7A 3KXDA 5ETOA 5HO4A 3QSIA 4JBCA 4ZPBA 4CO5A 2AYMA 1SC4B 1KTVA 5K8MA 1NK0A 1RBLA 4WXOA 3OFFA 1FRMA 4TN2A 3GTYX 1JX4A 1Y9OA 2MZRA 2LXUA 2FIUA 4LF5F 2D74B 3C16A 4Y00A 1S6OA 2R7SA 3CJ0A 5HJXA 4I6AA 1R27B 4P72A 1X5PA 1WOPA 2DR5A 2B3TB 3QRQA 2CPZA 3VVTA 1S9GA 4RU2A 5I3UA 3OHBA 2I9SA 2LEBA 1YJ7A 4NRUA 4Y28C 3MR3A 1RKJA 3E3XA 2GIRA 1RDRA 2XULA 3P4UB 1CEZA 3RTVA 4WFAQ 3C3LA 3EVWA 2XWXA 2VG7B 2HFNA 3K58A 4KHPJ 1BQNA 4NMXA 3POTB 3BYPA 2CZ9A 1WOSA 2GJFA 3CDBA 3RG6A 4RNFA 3PO5A 4WYWA 4JI5F 2E7XA 4Q8EA 3GQCA 5DO2A 4IRCA 4K50A 2HBRB 4WU2A 3QIPB 2HRUA 4CYUA 2RF2A 1YLXA 2V4JA 2MGZB 1WELA 3CGIA 1T03B 2VQEJ 4DPXA 1TVRB 4J9LA 2EKNA 5DRKA 1QDUB 3HT0A 1JIHA 4K2JA 2D3ZA 4QIWD 3TA2A 4X65J 4A8KA 2YNGA 3A12A 3R5GA 2IY5B 2J0QD 4USUA 2KTQA 3DOMA 2GGPA 4WFXA 1UP1A 2FDNA 2IRXA 1SQEA 1VQ7S 1Y3JA 2V4RA 1U8WA 2MMYA 3BBBA 5HATA 2ALYB 3J81Y 2EFQA 4LF8F 5DQGA 1VOMA 4JV5F 2NR0A 2CWXA 3X3UA 1L3KA 2B6AB 3KHRA 5HQMA 4ANDA 1ZH5A 1IKYB 4QIVA 6AT1B 4FKXA 1NJXA 4B02A 1N5VA 3LP2A 3PYFA 5D0GA 3LQVA 2VOPA 1WG5A 3QWUA 3D6FB 4ES1A 3LP0A 4J9VA 2DKOB 1WHVA 3TRGA 1QSYA 1S6PB 3BB5A 4KH1B 4B3TF 3DHXA 2V5HG 1TV6A 3QNWB 2ASYA 3PKYA 3US5A 2B4OA 2BACA 1NKEA 1ZS6A 1VR6A 2PIIA 2HIQA 1FA0A 3HVRA 1RTJB 5CCLA 5JXSA 4N5SA 2JSXA 4IFYA 1D9DA 5FJ4A 3TZYA 4N76A 4OI6A 1S4FA 1FCAA 2VKRA 2XYPB 4RW9A 3EZOA 2UP1A 1RXOB 3EDQB 3MEDA 3J7Z5 1IBMF 1GNKA 2QA1A 3PIOQ 1FE0A 2NXJA 1TUGB 3TUZC 5D77A 4M94A 3W9JA 2VA3A 5EWEA 2MKKA 2XS2A 3ZO7A 2FJXA 2H65B 4DV7F 3AB4B 3TUIC 1KFSA 2JJ4D 3C66A 3HT3A 4X4QA 3ZTQA 3MMCB 3VAFA 2HW3A 4ECTA 1NRKA 1TMJA 1Q53A 2RUGA 5C24B 1Q5YA 3HK2A 2WOMA 2B9YA 3MHYA 1LWCB 4KHRA 5KFOA 4Y6IA 2YY3A 4MJKA 3W7BA 5C25A 2MZQA 4C98A 5HVFA 1OY8A 3MTKA 4I67A 2UUCF 3ETOA 1ITPA 1HKAA 1ZM3A 3MAAA 1HWIA 4KSEB 2OPSA 3PX4A 4ZPDA 3BKUA 5E3CA 5BR8J 2OD4A 4JI6F 4ZLLA 4FVCA 3VAJA 4O3QA 1RLDA 1D1UA 2MKHA 4YFUA 4LF9F 1RT5A 5ETVA 4DL4A 3P5TL 1HQUB 4Z7CA 1RYSA 4MKAA 3HHEA 2RQ4A 2DB1A 3BS9A 5A8RA 1QTMA 5IT4A 2WONA 1FHTA 2CQCA 3AB2B 2VG6A 4DSLA 1GTHA 4L3KA 3R97A 3A1YG 3J7ZT 4YS2A 1S7IA 1SKSA 1F5AA 2J9CA 2KT5A 3MDFA 3M6UA 4HHJA 4IH6A 4NOHA 1ZOTA 3FEZA 2CJBA 5L1JA 1NK9A 2M52A 2AGOA 4DXLA 5T14A 3DRPA 1KLNA 4OIXA 4C8MA 1SXLA 2DGXA 3UVJA 3BR8A 1NO8A 1MROB 2YKOA 1O6XA 1IWGA 5I3QA 3OTOF 2FC9A 4RBVA 3SEOA 2NYHA 4FBUA 1Q4RA 2C2EA 4P52A 2HBYB 4DR5J 4B9UA 5KFJA 3FCWA 1MWZA 4ED3A 3DLKB 4X4TA 3VF0B 2IPOB 1WC4A 5C42B 2G13A 5A2QY 4RNOA 3FBBA 4QW9A 2HNYB 3DOLB 2IC3A 1S1WB 2BX6A 2J6UA 2KB2A 3IXQA 2DNOA 4K8RA 3IBFB 1H72C 3E8OA 3KTQA 2ROEA 1QD1A 2HS4A 3N0VA 1FT8A 3I4HX 2XLKA 1MG7A 4DR7F 1T9VA 4GVBA 1WSRA 1IKVA 3CCWA 4FXDA 3DLGA 2FJVA 2IA6A 3W5ZA 1DTQA 1H2TZ 1U25A 1AUDA 4DF8A 1KVJA 2Z2ZA 2CQ1A 1TU0B 3JXOA 4KTQA 1S10A 1NSPA 3ZZTA 3DRRB 2OSQA 4UZCA 3KOAA 2YBVA 3KFWX 4KB7A 3DM2B 3BQ1A 2DNZA 2UV8G 2HS3A 4TU8A 2ZH6A 4ID8A 1EQMA 2F40A 2H48B 4WJBA 1VGYA 2CJAA 3S01A 3TZWA 1ZETA 3M2UA 3EJMA 2BQRA 3GIIA 2EW9A 4F4YA 2PFDA 3PYDA 3OL8A 2ZJPQ 3PEJA 3LP1A 4LSZB 1AUSL 5HBMB 3O5TB 2ZH9A 2A10A 4Y65A 5GMKa 5BXIA 4CLYA 1X4EA 4WIQA 2DYAA 2W9CB 5F8MA 3EXCX 4P2SA 3I31A 4LRDA 1TK5A 3TR5A 3DMJB 5MLCV 3FFIA 1FWKA 2HIYA 5IWAF 5E7OB 3PW2A 2OMOA 3ZZYA 2RMLA 1X4DA 5KFLA 5B0CA 3IGVA 4J9OA 2VBWA 2XMKA 4ECSA 5F8JA 1LK7A 4Q44A 1O51A 3TANA 4JI1F 1YDLA 1FXRA 3HPOA 1U2CA 4WFBQ 2VASA 4DR3J 4A8QA 4KBIA 4M8LA 4PG6A 1CJTA 2DITA 5D15A 1AFJA 2MSTA 1U1MA 3SBMA 2ROPA 3MMBA 4JYAJ 1HBMA 1Z1ZA 3C6UA 2ZH7A 1AZSA 4BDPA 3MOZA 2CA9A 3TP2A 3QRRA 2YKPA 5GAEU 1PIEA 4EYHB 2Z30B 4ELVA 3Q8VA 2ZH4A 2K1RB 3B82A 2AZ1A 3RAMA 1KKHA 4H4KA 3NS5A 5CYMB 3WDOA 2Z0GA 4MTPA 3KJNB 2VFTA 4O23A 4PQAA 2GW8A 1Y4ZB 5A0YB 1EP4B 5KFGA 4DPYA 3UFCX 5J2MA 3OLAA 4CT9A 2XYGB 4J5OA 1MMDA 1PCAA 4GC7A 2IBOA 2LVWA 4IOAQ 4JI3F 2VC1A 2DPIA 4DSKA 3HM9A 3BO3A 3DCAA 4L74A 2CQHA 4CIOA 3GYNA 4EK2A 4NXMF 1N88A 2A6OA 2IVFB 2EKYA 1GMWA 4KGVB 2HNZB 4J9MA 4G3IA 1LEOA 2H1YA 1FKAF 8AT1B 4ED6A 4JI0J 4DL0C 5KAKA 1FERA 3GSDA 3NBPB 2YNHB 1UA1A 1HBNA 3W8PA 2ZWPA 5B7WA 2OO4A 1NPRA 3TEHB 2MJUA 2PO4A 2FLPA 1TAQA 4M5JA 1WC5A 1U48A 4ZVQB 4MYUA 4LSLA 2CZVC 4PRFA 1MNEA 3EPGA 1EAYC 4ES3A 2KI2A 3T1AA 2F9JA 3W8GA 4I4BA 3M32B 2WAQD 1MN9A 2NUUG 2DNKA 3R7BB 2R3VA 3W65A 3PM9A 4ILRA 1V3SA 3ZZRA 4TYAA 1UZHA 3AA8A 3ZC4A 3CJ2A 2AJ0A 1RWUA 1Q78A 1M5KC 1NU4A 1SV5A 3HJFA 2IRYA 3R27A 4B17A 2OFGX 5L1KA 4F4XA 1LW2B 4D3GA 4CCHA 2L3MA 1FE4A 2QN6B 2ZZTA 4C0OC 1SKWA 4B3OB 4ZJQA 1BLUA 1HHQA 1M5OC 4Q0BB 3G2XA 2HFUA 4CTAA 1GQEA 4NCGB 5K20B 3F44A 4AXIA 3UR0A 2Y1IA 4J9UE 2X51A 3SCLE 1QLNA 1NH8A 5D4NA 4GO5X 4RR5A 2HVZA 5D3GA 1GXLA 2HQCA 5HMWA 1CC7A 1A0OB 1ZYQA 3EZ5A 1VQLS 3NCPA 2R9LA 1BQXA 3VQTA 4DR1F 4DU7A 3RBEA 4KYZA 4NXNF 4IOBA 2CQ4A 3HJVA 2DY9A 4AL5A 4U7CA 1F9HA 4DN0A 3M2RA 3PIPQ 3MM5A 4DR4F 2B4UA 4DUYJ 4NCAA 3C6TA 3PHTA 4OYXA 1KSPA 1OSCA 2NXEA 1F0XA 4DV1F 1N5YA 1RWWB 3R6GB 1FVQA 5LSRA 1YJVA 3UN3A 5A8KA 3GJSB 1FRKA 2KJWA 2J7UA 4NYPA 2AJ2A 2DTJA
chains in the Genus database with same CATH topology
4RUCA 1YHQS 3O2IA 2I2YA 2V2KA 4R8UA 1S1VB 1LW0B 2M5YA 5KFKA 2LEPA 1AXQA 5E41A 1FJEB 5HLFB 4C11B 3H5YA 3VALA 2N3LA 4YDXA 4LIWA 1C0UA 3HVTB 4CO1A 1SJ3P 5J2MB 2KFYA 4HLBA 2LDIA 4DPOA 4X66F 1U49A 5AJ3F 1OPIA 3GG1A 2MXYA 1N8RT 3ICLA 2MHEA 2NS1B 2VA2A 4V19J 5J2NA 1UETA 2Y1JA 2FGCA 1FRIA 1O8BA 4ZCLA 2VBZA 3ZZOA 3GV5B 1EETB 1FKPB 3R3TA 3OXFA 2ZC3A 2BVZA 2F3JA 4RW8A 5HMXA 4UY8T 5EWGA 3PRBA 2KYZA 3I5CA 2QEXS 2WCXA 2IMWP 4AYBD 4OQJA 2G9OA 1VC5A 2M7SA 4TXSA 4WK1A 2RU3A 3CJKB 2CQPA 2KU7A 4PQUA 1U2FA 2E1CA 1RTDA 2RH3A 2E5GA 4DLGA 3ONQA 1IQZA 1CSJA 3HHLA 1G2EA 3OTDA 5KFWA 1R8PA 4YHHF 4BS2A 3CUNA 3RB4A 2ZZNA 1NJIT 3QO9A 3HF5A 5JUMA 4X65F 4FNHA 4LT6A 3PR5B 3FJ2A 2PA3A 1KEKA 5HROB 3D5MA 2JC1A 1RTJA 4C8NA 3TVZA 4DSIA 4NA2A 5KG6A 1VQOS 2RT3A 1VQ9S 1BQMB 4WU3A 2XLJA 1UAWA 2YNFA 1JNZB 4XK8C 5KG7A 2B0GA 2BUNA 2IM0A 2EFOA 4KO0A 4RX6A 4F50A 4ED5A 5H9EJ 1R8BA 2VUGA 3KLFB 3DFEA 1REVA 3MEDB 2R7RA 2DHAA 4EFAC 1KVIA 1U45A 3HHLD 1VRUA 3IS9A 4F3OA 2I1RA 3H5XA 1VQYA 5IFMA 2KM8C 1K73T 1P27B 1YJWS 1D0EA 2JOQA 2QFJA 1KLMA 4CO0A 3M8SA 3PW4A 3CCMS 2DNLA 3GB0A 3CCJS 2ASLA 1C4AA 1FXLA 2R8IA 2IYGA 1OQ3A 1TKTB 5I42B 1Q7YT 3QJLA 3GR1A 5CCMA 3MPWA 1L3UA 1IJFB 1YSJA 4QR0A 2JLGA 4FF3A 4CNYA 4KAIA 5HL7Q 2ILYA 3U1LA 3OSNA 3OL7A 1GTEA 1KN6A 3ZZUA 3SSSA 4CO4A 2E1AA 2M0GB 4NL5A 1TKZA 3X1LB 1HQEB 5KFCA 4I2PB 1YBAA 5E3RA 2HNDB 1LK5A 4WFZA 3N6LA 5FDLA 1H38A 1OS5A 1FRHA 2U1AA 5HQ8A 1Y5IB 4K2XA 2VOOA 3SXLA 3MM6B 3HHLC 4ECYA 2R2UA 4QU6A 2KXHA 1JLFA 3QIDA 4EWTA 3MMCA 2XMUA 4RZRA 5D4OA 1TAUA 4O3RA 2OJ3A 4IYQA 4Q45A 6FD1A 2QSFA 2DVIA 1NZAA 1RJJA 3CXCR 3KLEA 4Q8FA 4A8FA 2YKMA 3JSBA 1DLOA 4R5PA 4DV3F 4FXWA 3LO3A 4TU7A 1G3OA 2PSZA 1QY7A 4XDDA 1DRZA 2G1DA 2RRBA 1JLGB 2W7AA 5G0RB 1JLBB 5I3PA 3KJVB 3G96A 4I1TA 2EPIA 4ZPCA 2ASJA 2WOMB 5I4MA 4LFCF 4K4XA 2C3YA 4F2SA 2DO0A 3PXGa 4LF7F 2JWNA 2XHWA 2E5IA 3MD1A 3KK3A 5KFZA 1WF1A 4QQBA 4C7QA 3V4IA 3H8YA 4WXWA 1LWCA 3CJ5A 1TZ0A 4HEA9 3V6JA 2D3UA 4B9MA 2ILZA 1HWJA 1RT4A 4QCLA 3MEKA 4TLQA 3EX7B 3WC0A 1G7CB 1TKXA 3OPKA 3V6DB 4N41A 5KOWA 1L5UA 1D8YA 2P9CA 2FJEB 4QW8A 3RAQA 2B43A 3CPWR 1RTIA 4ETZA 1TL4A 5E2QA 4KGMA 5AXKA 1UJ6A 1S6QB 2J0XA 2CIMA 2WBMA 4IFVB 1NEEA 4QBUA 1KC8T 4ED1A 2DRBA 5DGAA 2NSCA 1VK3A 1R8CA 2MZJA 4HTIA 4ZVGA 2NREA 2R7WA 1M1KT 3MUMP 2JL9A 1HW9A 1FDNA 3PHEA 2HWIA 2HAIA 4MMOA 1R43A 4ATNA 3EXYA 4FXVA 4PKDB 2VODA 2HHWA 4IQXA 3VAGA 3EGNA 2VH7A 2C3OA 2JHEA 5AE1A 1QVGR 1BC6A 4V19X 1YRUA 4CTAB 2VKZG 3QWPA 1J2VA 2MY8A 2N3OA 2X1FA 2KH9A 1E6YA 1N34F 5F8GA 1AW0A 3GYXB 2GJIA 3D54A 5EX3A 2DHXA 2OPQA 2OPRB 4XO0A 1UKUA 3G4SS 3BGRB 3N79A 4DS5A 1QUPA 1QAIA 4IRKA 1R89A 4ETXA 1YWXA 1J5OA 4M95A 3MFIA 4OZ0A 4QOTA 1Q86T 3LANA 3VR1A 3KG0A 2HHVA 3M2VA 1X4FA 1B0PA 2W7PA 3KG1A 3B78A 3HZEA 1HARA 1WI6A 3DYAB 3RU0A 4KC5A 3T6JA 1VQKS 4ILMA 5CQGA 1DTTA 2PDAA 5KFSA 4WCEQ 2W9AA 3T1HF 3DLHA 3PX6A 4MKYA 1JLEB 5E3AA 3D1QA 4NLYA 2R7OA 2ZOGA 3N5FA 2GV1A 5T7LA 1TFYA 2PE8A 2VBXA 4ERDA 1IM4A 2POKA 3RAXA 1KQGB 2FHMA 3CT9A 3PX0A 4NLRA 1N6QB 1C0TB 1Y00A 3KMQA 3BZQA 2WB1D 2BANA 1Z4UA 2MHNA 1D8ZA 5EHHA 1WNEA 1WACA 4ZPTR 2QIFA 4G6VB 1ROFA 3NGKA 5G4DA 5JJBA 2X1GA 3P96A 5IM0A 1U6ZA 3R1HA 1U1PA 3TI0A 3FZBA 1X5TA 2OPPB 4U6PA 4Q5VA 2XLIA 2NQPA 2EFGA 2GFFA 2Q6CA 3AJ2A 3MWBA 4NLTA 4QR2A 5KT3A 3MEGA 2M2BA 5AE3A 3DRPB 1UW4A 2HZCA 4E98A 3M6XA 1HW8A 4WK3A 1SJRA 1N32F 5B0FA 4PXDA 2XO7A 2RQCA 4PWDB 3A8EA 2HHPA 2VPZB 2XMWA 3DDNA 3MCSA 1XMBA 3TA0A 1E6VA 2J8AA 2J0WA 2NPFA 1R0AB 3C6TB 4NLVA 3M8QA 4I56A 4RNNA 2MQNA 2WSCC 5FD1A 2Q66A 4WKRA 1FNXH 1RT6B 1MROA 4OHVA 3OL9A 1ZPVA 1S0OA 1H3DA 2QE5A 1P1LA 1L3VA 4F02A 3SCKE 3OXLA 4I68A 2YKNA 2VFRA 5K8PA 3K5MA 3MECB 2HVIA 2QLXA 1Q8LA 5DDQC 2NXUA 5KFBA 2JVOA 3DU5A 4KQZA 2C3UA 3H2UB 2I38A 1LWFA 1PSDA 3CWJA 5HI7A 2DGWA 4X4NA 1JB0C 2UZAA 3UE2A 3V6HA 3PRDA 2M8HA 2JEGA 1LV5A 4EU0A 1HL6A 3OW2R 1MU2A 5A8KB 2DIUA 3CE8A 3UPFA 3DOKB 3TAQA 4F3QA 2NUHA 3R5CA 5GAHI 3Q24A 2MYFA 2NSBA 2ZKTA 3DDKA 4ALZA 4NX9A 5CH7B 2UVVA 2R8KA 4IRDA 4J9QA 1UEVA 3MMAA 1OWXA 2CPIA 2Q79A 4RWWA 5CYQB 4R8UB 5BR8F 2BDPA 2W25A 5E5NA 3I87A 3G6XA 2LYVA 4RW6B 3HXMA 3SQGA 5GAGI 1C0UB 3QJPA 1CVJA 2AF6A 2COLA 1GAOA 3DRSA 2PI5A 4EZ9A 2V0NA 3QGHA 1NHUA 1FEEA 2CYYA 5IXUA 1V3RA 1HD1A 3J7YI 2D9PA 4ID5A 1DBDA 4R25A 3ZZ0A 3H40A 3HFKA 4K59A 4DQSA 5J2NB 1S1UA 3FRZA 4DSFA 3ITHB 2HNYA 2LA4A 3DOLA 3PFEA 3CCVS 2N7YA 1RT2A 1ZAWA 4RW8B 2DGSA 3GE9A 3T9ZA 5EN1A 4ZP7A 5E0OA 4QIFA 5KTQA 1IR0A 4BCAA 4LQ9A 2ZE2B 2CQDA 2ZH1A 1D3WA 4TU9A 1Q8BA 1JXEA 3JSYA 4JI4F 3HVWA 1RT1A 4ZDNA 2UUWA 4PXCA 1M5SA 1P6TA 4BC7A 4ZPAA 3I55S 2W4PA 5DM6Q 2XWYA 4PQUB 2CQ3A 1RTDB 1B0TA 1SJQA 4ZPVR 1UFWA 3IG1A 2QRRA 3HHLB 4N47A 2ABYA 3QJJA 2HGLA 1FVSA 1LFWA 4C8YA 3KG4A 4XAKA 1WTBA 2HRYA 1U1RA 1VQ8S