1P1TA

Nmr structure of the n-terminal rrm domain of cleavage stimulation factor 64 kda subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
DPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Cleavage stimulation factor, 64 kDa subunit
publication title Recognition of GU-rich polyadenylation regulatory elements by human CstF-64 protein
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p1tA00
2KM8C 2DHSA 2HGMA 2E5IA 4Z2XA 3BS9A 3CUNA 2EK1A 3CMES 3G9CA 2K3KA 5CA5A 1U1PA 3B4DA 1RKJA 2AYEA 1WHVA 1QVGR 3J7YU 2KH9A 1Q7YT 5BJRA 1U1LA 2QA4S 2YH0A 1CVJA 3D2WA 1ZZNA 2XNQA 2KYXA 5IFMA 1X5TA 1VC6A 1YIJS 2J0QD 1N52B 1FNXH 3R1LA 3MDFA 2I38A 5EN1A 3FEYB 2FHOB 4LMZA 2MZJA 3EX7B 2OTJS 2J8AA 3TO8A 2U1AA 4C0OC 4UQTA 2MZRA 1FJEB 4UY8T 2E5GA 2AYBA 1VQ5S 3S6EA 2CQIA 4WF9Q 1L3KA 3CC7S 2N3LA 2CQBA 2CQCA 3K0JA 2KG0A 2DGUA 1VQ7S 4TU9A 4WCEQ 1VBXA 2MQQA 5LXYA 1N54B 2UP1A 1WF2A 3VAHA 4Y00A 2LXIA 3CPWR 2MJNA 4QQBA 1M5PC 1X4EA 1M5KC 3PIPQ 1NO8A 2RNEA 2DNQA 1WEYA 1X4GA 3S7RA 1N8RT 2MZQA 5GMKa 2DIVA 4W90B 3U1MA 5IM0A 2LCWA 2DIUA 1VC0A 2XS7A 2KFYA 1A7GE 3LPYA 3VAGA 1VQKS 1M5VC 3G8SA 2MZ1A 2MZTA 2MQOA 3I56S 2CQGA 4LIRA 3S01A 3G71S 2KXHA 4IO9Q 3UD4P 3JB9k 1WHYA 2MKHA 3CF5Q 1JJHA 3THPA 2L08A 2CQ2A 1FHTA 2RS2A 4J5OA 2HYIB 3UWTA 5GAEU 5DDRC 5LSOA 3CC4S 1U6BA 2LECA 4ERDA 2M8DB 1ZZFA 5GVQA 3SDEA 1FJ7A 3N9UC 3CC2S 3I55S 2JVOA 3MOJB 1VQOS 3MD1A 3DXBA 1KOOA 2M0GB 4F02A 3NS5A 2KXFA 2XNRA 2CQ0A 2KRBA 1WEXA 2LKZA 3VALA 1H2UX 2DH7A 5DM7Q 2GO9A 4BS2A 3V4MA 2WBRA 5DDOC 2MXYA 2MGZB 1DHMA 2DNOA 3G8TA 1YJ9S 1FO1A 4PRFA 2RU3A 2AYMA 1X5PA 3H2VE 1U1MA 2E5JA 4YB1P 2GHPA 1FXLA 2DGOA 2G4BA 3R1HA 2NLWA 4LJMA 2YH1A 1VQ8S 5CYJA 1PGZA 2CQ1A 2AD9A 2L9WA 2M7SA 1VC5A 2X1GA 3CCLS 2O3DA 2DGVA 1S72S 2M8HA 2QFJA 2HGLA 1DBDA 4P6QA 2E44A 2JWNA 3BO3A 1U6FA 2RVJA 2G0CA 2V94A 2DB1A 5LSLA 3VAKA 3RW7A 1SJ4P 3UCUP 2DNZA 1HD1A 1HA1A 2MB0B 2DNNA 2J76E 5FJ4A 2DK2A 2N7CA 1Q81T 2E5HA 2DGWA 1WHXA 1YHQS 1VBYA 2OSRA 2QEXS 1B7FA 2MQPA 2CQ4A 2YTCA 3VAJA 1WF0A 1HD0A 1KQSR 1RK8A 3Q2TC 4V19X 3MI7X 3MUTP 5JVHQ 2DNYA 2DGSA 1YITS 1X5SA 1ZH5A 5D77A 2KM8B 2VONA 2PE8A 2MPUA 1UAWA 1DRZA 3R27A 2MSTA 2FY1A 2CQDA 3P3DA 3P5TL 3VF0B 2HGNA 4YUDA 3NNAA 1HL6A 5DDPC 2F3JA 3ZZZA 2JX2A 4FXVA 3EGNA 2ZJPQ 1KD1T 3CD6S 1M5OC 4C4WA 3HI9A 2CJKA 4RU2A 2CQHA 1WELA 4U67Q 2VOPA 1SJ3P 2DO4A 5ITHA 3G4SS 2I2YA 2DNKA 5LJ5Y 1WHWA 2FC8A 4QPTA 1KOHA 4OZ0A 2JVRA 1H2VZ 2KRRA 3TYTA 1S79A 1UP1A 3U1LA 2KHCA 1R8PA 1OPIA 4F25A 5IM0B 2CPJA 2F9JA 1K9MT 2KN4A 1SJQA 3CCRS 4CH0S 1R8HA 2M4MA 2M88A 1K8AT 2AYGA 1IQTA 2L41A 4WFAQ 2DGQA 5LXRA 2DNMA 1YI2S 2SXLA 2KI2A 2M9KA 2RQCA 1X4FA 3TP2A 3CXCR 1X4CA 1K73T 2MKCA 4OZ1A 3US5A 4TU7A 1YWXA 1M1KT 1OO0B 2MQLA 1AUDA 3PIOQ 4F26A 2MQMA 4YOEA 2DO0A 2MKIA 1VQNS 1WTBA 1WI6A 1VQLS 2RS8A 1QM9A 2U2FA 4FXWA 2CPZA 1F9FA 1Q82T 1SXLA 5D78A 3IRWP 5CXTA 2DNPA 3B4MA 3SDEB 2RQ4A 2D3OR 3NMRA 3MURP 3CCMS 3S8SA 3L3CA 3THTA 2KXNB 1Q86T 1JJ4A 2X1AA 4ZKAA 2XS2A 1PO6A 1A9NB 3CCJS 1VQMS 3CCSS 2EVZA 2PEHA 4CIOA 3HHNB 1U1OA 2CQPA 2DHXA 4WFBQ 3CTRA 2MY8A 2CPXA 1G2EA 4IOAQ 3CULA 5HO4A 1P1TA 3CCES 2LQ5A 2RT3A 4ED5A 1WEZA 5LJ3Y 1U1KA 1YJNS 3P6YC 5HL7Q 2N82B 1VQPS 4TLQA 1M90T 1FJCA 2MY7A 2N3OA 2D9OA 2LMIA 2JRSA 3NNCA 2XSFA 2DISA 2K8GA 3VAIA 2MYFA 2DNLA 3EGZA 1SJFA 2OSQA 3NNHA 4WFNQ 5GADU 2CPIA 2KVIA 2CPFA 3UD3P 1OIAA 2DGXA 2CPYA 3MUVP 4PR6A 4QU7A 1URNA 2DHAA 2DITA 2Q79A 1WF1A 1XN9A 4EGLA 2YWKA 2MZSA 1D9AA 2MJUA 2G1DA 2M70A 2LYVA 4C7QA 2MHNA 2X1FA 2MKKA 1D8ZA 2MKSA 1VQ4S 1VQ6S 4IOCQ 3VAMA 2FC9A 4CQ1A 2DNRA 3MXHP 5DDQC 1WG1A 2HVZA 2KT5A 1FT8A 1VQ9S 2HZCA 4PKDB 3UCGA 2DNGA 3BEGB 1KC8T 2F9DA 3VAFA 1JJ2R 3RW6A 2ADBA 1U1NA 2MQNA 2B0GA 1N88A 2NZ4A 2DHGA 4QU6A 1H6KX 2BZ2A 2RRBA 2X1BA 1VBZA 2DNHA 2LXUA 3G6ES 1NJIT 4WKRA 3P49B 3ZZYA 2XS5A 3Q2SC 1X4BA 5JVGQ 1YTYA 2OIHA 2EK6A 1WG4A 1U2FA 5DM6Q 2ZJRQ 1X4DA 2BOPA 2MKJA 4A8XA 3H2UB 3SXLA 1WWHA 2CQ3A 1OWXA 3FEXB 2VODA 1UFWA 3IWNC 3BO4A 2MGZA 2CPEA 2CPHA 3OW2R 5GAHU 3UCZP 2CPDA 5MLCV 2OJ3A 4Y0FA 1X5OA 1X0FA 2DGTA 2VOOA 2MSSA 2J0SD 3DLLQ 3NS6A 5IQQA 2LA4A 2M52A 3CCQS 1WI8A 2LA6A 3CCUS 2MMYA 1BY9A 1W2BR 3ULHA 4IUFA 1U1RA 1X4AA 1P27B 1QVFR 2KU7A 1WG5A 1UW4A 3SMZA 3UE2A 4W92B 5H1SV 4TU8A 1NU4A 1X4HA 3CMAS 2RUGA 2DH9A 2M2BA 2FPHX 2ADCA 3MD3A 5GAGU 2ZJQQ 5DETA 2YKAA 1JMTA 1YJWS 3LQVA 1DZ5A 2LEBA 2RRAA 4M5DB 2KG1A 3MUMP 2XB2D 4WIIA 2OTLS 2DH8A 3CCVS 2A3JA 1SJRA 3G96A 2LEAA 3BO2A 1H2TZ 1U1QA 1O0PA 2D9PA 2ERRA 3J7ZT 4CH1A
chains in the Genus database with same CATH superfamily
4UT4A 4Z2XA 3CJKB 4MIAA 1I94F 5B0FA 2C3PA 1QVGR 3I0SB 4BC9A 3JTPA 4QIWD 4QJVA 2XLJA 5HVGA 4LMZA 3J7Z5 1FJEB 5ETMA 4MK8A 1TVRA 1VQ5S 4WF9Q 1ZPWX 3PG9A 3GIJA 3ADAC 4MYTA 1QAXA 2QA2A 2R42A 2XMUA 2CA9A 3K5NA 4DU8A 2E9TA 2V6AA 5J2NA 1V3SA 3JSBA 1M5VC 4H4OB 5L8RC 4E0DA 1OY8A 5KFTA 2DPIA 2W9CA 2O67A 1HBMB 1T05A 1DLOB 1FHTA 3A3PB 3MCSA 1KTVA 3WC0A 3PYDA 4DFJA 1KKHA 2F8HA 4NL5A 2ALZA 3KHRA 1A6LA 1FTRA 1DTTB 4TXSA 4BS2A 2QJ3A 2WBRA 1NJZA 4LVNP 3MPWA 2HFOA 1BHNA 2AEFA 3NKYA 4RW4B 1RTDA 1JLAA 1UJ4A 1MMLA 4DV3J 2IM2A 4OHWA 2R4FA 3GSDA 2RILA 1JLGA 2R2RA 3BSOA 4CO4A 1S9GB 3NOGA 1DURA 4DSKA 2EEYA 1E6VB 5GADI 2L9NA 2JWNA 2QG9B 2GVZB 1FFWB 1RT4A 2YWWA 4C9DA 1S6UA 3R97A 1EKRA 1ZA1B 4OI0A 1C0UB 3R3TA 5K14A 2Q43A 2OD6A 2E5LJ 2RF2A 3MI7X 1X5SA 4I7FA 4CNYA 4IYQA 4TYBA 4NWBA 1TKZA 3MWBA 4ZVPB 1F1BB 4YDXA 3JYTA 2G0IA 1M5OC 4CO0A 4PEOA 4DI6A 4KY3A 1T9XA 4J9MA 4X65J 3KLVA 1NB7A 1QUVA 2V69A 5HBMB 1S0VA 2RKIA 4PG5A 4B3TJ 2KHCA 1X9MA 1Y7PA 2HKEA 2QYGA 4LSNA 3CCRS 1MSWD 1M0SA 1K8AT 1IQTA 2GIRA 1X0PA 5GAGI 1CJVB 3PJXA 1X4CA 5M2RA 2FJEB 3D3BJ 2UXBJ 3CDEA 5IV4A 2PC6A 2HVDA 3UR0A 2BJ8A 2MKIA 4DV5J 4JV2A 3QFWA 1QLNA 3I6PA 1AUSL 3SDEB 4M5GA 1RTJA 3THTA 1UA0A 2X1AA 3ZXWA 3KOAA 3PV8A 3I9ZA 3TZXA 5EWEA 1R0AB 3CCES 2LQ5A 4P9SA 4XDDA 2G0JA 4Y65A 1ACMB 1RHUB 1FJCA 1U49A 3TQ1A 3C16A 3VAIA 3Q8RB 2J6UA 3CCZA 4E98A 3BREA 5ETPA 1FXDA 3OJUA 3ZZUA 2OMOA 2O66A 3L4BC 1Q8LA 2KHDA 4RWWA 2FHMA 4X4PA 2NREA 1RYSA 3HHEA 4RW6A 4Q7AA 2YPZA 2CZ4A 9RUBA 1OJ4A 1UJ5A 1VK8A 3OXFA 1AB8A 4LF7J 3W66A 1ZPVA 2R7OA 2XGQA 3TZWA 2R7UA 2I9SA 2J9CA 3NGTA 4HHUA 2ZJRQ 1UJ6A 1OY6A 4RWXA 5J2QA 1CEZA 1JLCA 1HYSB 4A8XA 2P9GA 1WWHA 4P72A 5I3UA 4JBCA 2HNYB 4DV4F 2G1HA 1YRUA 3GCWP 3P4UB 5GAHU 1NKCA 4OYZA 3M6VA 3SSQA 2FHJD 1KRPA 1SL2A 4N56A 1R0BG 3NS6A 3RRKA 4E2FB 4ANEA 3OXGA 2V2KA 2XZDB 3LF0A 4ID5A 2FVPA 2NR0A 2NPIA 2ACMA 2V9WA 1B70B 1SC1B 2QGFB 1QSYA 1JKHB 4N41A 3ILLA 2PD1A 2QLWA 1VRUA 1DTQA 2GQCA 1C0TA 1TFWA 2OEKA 3LQVA 2PMHA 2FGCA 3MUMP 2OO4A 1GK8A 2OTLS 3MM9B 3DKDA 2D9PA 4CH1A 4PYAA 1WC5A 4PCQA 2RRNA 4B3MF 1U1PA 5SZTA 1RT5B 1RKJA 2IDLA 3OTOJ 5D4PA 5KFBA 3KK1A 4MT1A 1XNRF 2B6AA 3LP2A 3D2WA 1HNWF 2GHVC 4JI3F 2HBZB 4NXNJ 3OL8A 2ZC3A 4LFAJ 1EP4B 5HVHA 2DXDA 5BR8F 2MQQA 3OR1A 1OQ6A 4DL2A 1F5AA 3V2UC 2LXIA 1WJ9A 4LBHA 4KB7A 1R6YA 3H90A 1O5JA 5CQGA 3OVAA 2C2RA 3EYZA 5F9LA 1YBAA 2VL1A 5AT1B 4M5MA 4ID8A 3V6DA 2A1BA 2HVEA 4B3OA 2UVVA 2VPXB 1WHYA 3NS7B 2D69A 4ZHRA 5CD4H 5IS2A 2NXJA 1TL4A 3HD1A 5A8WB 4OX9F 3JTOA 2RQKA 4DSFA 1IWGA 3K89A 4ED0A 4JYAJ 3SI8A 1K1SA 3T1HJ 2KRBA 1S7HA 3HT0A 4ZPAA 2DR6A 3UDEA 4QR1A 3C6UB 1KQGB 5DM7Q 4XDCA 4EUVA 4C3MA 2H1YA 3F0NA 1KONA 1YJ9S 4NRTA 5E3CA 2AYMA 2E5JA 5E3PA 2GHPA 1U02A 5A8KB 1IKXA 1Q5YA 1SIZA 5CYJA 2C2KB 2DR5A 3OV7A 4JI4F 1RWNB 1PCAA 3AOAA 4JV5J 3KK3B 2WW4A 3KJFB 4NLTA 2HFUA 3E2EA 1FDBA 4OJ1A 3W62A 1GH8A 2GVDA 2DNNA 2YKPA 2E5HA 2GHWA 1UFLA 3D54A 3KHLA 1H98A 5KFRA 1HQ2A 4ZVSB 2XULA 3GFYA 5D77A 2CUYA 5I3QA 3I31A 1IBLJ 1YRXA 3C46A 1F3VA 2FY1A 3PW2A 1O6XA 2NSBA 3M1VA 3MECA 1FXRA 4DLGA 1YX2A 4KQZA 2JLGA 2HRUA 4AD6A 2H51B 4G1PA 2CJKA 4RU2A 1RHQB 2PDAA 4F4ZA 1SJ3P 3CB4A 3E01B 4BWJA 5KFUA 2ZBRA 3WX8A 3C19A 4X84A 2E29A 1FI4A 2M3DA 4UUXA 4OFZA 2B4PA 4EYIB 2VFTA 3US5A 3PIOQ 1HR0J 4YR2A 1EKSA 1WTBA 1QM9A 2OPSB 1T95A 3IRWP 3PYEA 1K0TA 3A1YG 4HI1A 3L3CA 5K20B 3QRRA 3CJ0A 4WIQA 5DZ7A 3TEHB 1G7CB 2IHR1 4RUAA 4CT9A 3MM7B 2CPXA 1WOOA 1RAEB 4CLZA 3HKZD 5KFJA 1FWPA 2VIHA 2GQ2A 2XWXA 2K8GA 1LW0A 1HW8A 5DGAA 1NM2A 2QMXA 4JI2F 3Q8PB 5DZ6A 2Z2ZA 4QU7A 2DEJA 1TTHB 2DCUB 4CI0B 1DFDA 5A6PA 4TY8B 2MHNA 2HHXA 1F3FA 3MHYA 1TR0A 2ZKTA 4ER8A 3D4JA 1RAGB 2ADBA 3P45B 4MKBA 3ELHA 4J7CA 4PYDA 3JQJA 2QLJB 3QJPA 3CDBA 2X1BA 3M2UA 3ENQA 1RBLA 3CIMA 3TVKA 4K4VA 1NSKL 1S1XA 4C0BA 3Q8UA 1OWXA 3CT9A 2XMTA 3WC2A 1NK4A 3DDIA 5HMZA 5F8IA 3OTBA 2AEJA 3QATA 1I5OB 3K5OA 3PW0A 1UFKA 3C15B 3JSYA 2XMJA 1WG5A 3SMZA 1EJ7L 5LMUJ 3P8BB 2DH9A 4PUOB 1X7VA 1RWUA 1V9OA 2LQBA 1S1VB 1DZ5A 2CAJA 1LWCA 4I6WA 3D67A 2FY8A 2A2DA 2H5JB 3PEHA 2IAJB 1Q0NA 2B5JA 3FBFA 4OYMA 2XBPA 4DSIA 1IXKA 4LSLA 3B4DA 4KHPJ 2UUAJ 5D0HA 3QJLA 1IWAA 4K50A 2MDAA 3QYYA 2ZBCA 3VR1A 3A12A 1MMNA 3ETMA 3OL7A 2JLFA 4UY8T 4DR2J 3S6EA 3OHBA 1VIOA 4LF5F 1TUWA 1TP7A 1NK8A 2DRBA 1N8RT 4C2MA 3AH6A 2XMKA 3DRPB 2LCWA 4UOGA 4A47A 2L9DA 3G8SA 5D4NA 4QIEA 2MQOA 2BANB 4N7TA 1TV6B 2FIUA 2HIQA 3AB2B 3UD4P 4NE9C 3ENVA 3UW1A 5DQGA 2HYIB 2DR9A 3RAMA 1C1BA 4ZP9A 1FVQA 3CC4S 1FRHA 3LANA 2DXFA 1BQXA 1NHVA 2M0GB 3K8WA 4WBFA 2XNRA 4DV0F 9ATCB 5GMDA 2DPJA 4PWUA 5CH7B 2BJ3A 3CVKA 2KT3A 4RR5A 3RB6A 3T5LA 5KFWA 4F4YA 1VQ8S 5F0UA 3FC9A 5J2MB 2QFJA 4ECWA 4P6QA 2BEFA 2YVSA 4C3LA 4ETXA 2DNZA 4UW2A 3DLJA 4NOHA 4K4TA 1IKVA 3W2WA 4B02A 3ILIA 2OPPA 1GFWB 4CO3A 2E9ZA 1RK8A 5FLXY 3PYFA 3GMGA 3H5SA 4J9KA 3AD7C 5F8GA 3FUYA 3H2LA 4WFZA 2C2EA 1DRZA 2LDIA 2EXUA 1YVFA 4PZVA 1OSDA 5HP1A 1EB0A 3RTVA 4UOCA 1HNVB 2A2CA 4LR8A 4IFVA 3QIDA 1B3TA 2CQHA 4KH0B 3ICLA 2B7CB 1Q53A 3GLJA 2VOPA 3FSYA 4DWIA 4DR7J 2DNKA 4D3GA 3Q8SB 4X66J 2VKRA 2HBQB 1H2VZ 3AJ1A 2YX4A 5JJBA 3HO1A 3QZ7A 3GJQB 2KN4A 1FWKA 1SKUB 2ZD1B 3M8QB 2Z8QA 1N5VA 2I8EA 4DL7A 1AUDA 3RB3A 3CNQP 1PYSB 1RHJB 2CPZA 5E0OA 1Q82T 1N32F 3QGGA 1URRA 1ZM9A 3UVJA 4HEA9 1XTZA 3A3NB 1PO6A 2AKWB 3ITHA 2BW7A 3F56A 3HHNB 1FD8A 2IJNA 2DHXA 3QAUA 2MY8A 2CYYA 1TKTA 4AYBD 4JI1F 1P1TA 3DRSA 2B8PA 1U1KA 4ZPTR 4QYRA 3GIKA 2JRSA 3W2VA 3R7NB 3H0PA 5A8RA 3EGZA 2IY5B 3SV3A 5D8HB 4DCOB 1WF1A 3AT1B 1RHKB 4F36A 1UVMA 1PILA 2MZSA 2GX8A 3HP6A 1S1WB 2HNYA 1HNIA 1NDPA 2X3GA 2FVCA 4ZVHA 2Y1RI 1FKPA 2WTFA 2HQ3A 4PABA 4NZ7A 2PI5A 1XJWB 2LFVA 2ZOFA 4J91A 2B4VA 2BABA 3R2DJ 1SKRA 2DNHA 2HWTA 2XS5A 2V34A 5DM6Q 4LQ3A 4DUTA 3FEXB 3TANA 2MTLA 5CYMB 2K1RB 1VMBA 3TA1A 2ZC4A 1XERA 4DX8H 3ZNUA 4RLEA 2FZGB 1SV5A 4DCPB 3W9HA 3ZZOA 2R8KA 2B9EA 3CCQS 3KNAA 2I5JA 4AUKA 1EQ0A 2GGPB 3U7JA 2UV8G 2F65A 3IA0A 2IVFB 3GFXA 2ZH6A 3KUGA 1CJUB 4LF4F 5D0GA 2ZVSA 2ASDA 2BR0A 1IBMJ 2H4YB 1S1UB 4DQPA 2NUUG 3EJMA 2YNHA 4YR3A 2VDIA 1JLQA 1G6BA 2VDHA 2HRYA 3PR4A 1RTIA 2IA6A 1VC6A 2HMIA 3TOQA 4WZQA 3TJAA 4P7VA 3C6TB 4MKVA 4N8OA 3MFHA 4ES3A 4HDGA 4KV8A 3HF5A 2G13A 4O4GA 3DLEA 5A8WA 2BQRA 3D1QA 5G0RB 1RABB 3MFIA 3NRBA 3TW0A 1VQKS 2LXFA 1KFDA 4NLRA 4IR9A 1UPMB 3CEDA 2HNZA 2X7IA 3TAMB 2O5DA 2L08A 1QE1B 2MQ8A 2YKNB 1NDLA 3MMJA 1S9EB 3EPIA 4F4AA 8ATCB 4ZJQA 3BPDA 4F02A 3AJDA 3HVTA 3T9NA 3KK3A 5HQ8A 4PXCA 5B0EA 1HWJA 1FO1A 4LFCJ 2H4WB 3GE9A 3PEJA 4ZPCA 2LU1A 4C97A 4YQWA 1N56A 1F60B 3H25A 4EO6A 4AE5A 2VBYA 2W24A 4LBIA 2R7QA 4XIUA 1VC5A 4X64F 4JOUA 4JI7J 2QYCA 2P6SA 2V94A 2V2VA 3W9IA 1EARA 4OX8A 4ZLNA 5KFMA 4DHVA 5F3ZA 1CG2A 1Q81T 4WZMA 3SCKE 2JFDA 4Z7CA 3EM1A 3B54A 3H4BA 2IRUA 5K8NA 4BDPA 2YTCA 1NZAA 2HAIA 4DL0C 1NZ8A 3K59A 5JVHQ 2DNYA 1IM6A 3DM2B 1CS4A 1UAWA 3EWGA 2LP4A 1D0EA 1B0TA 3HHLC 3GYGA 3P5TL 1RT6B 4MIBA 2Z0GA 4QYZJ 2RH3A 3QGHA 3N79A 1CQNA 3O5TB 1R31A 2J0XA 4DN9A 1RT7B 2A6MA 2IYGA 3GFHA 2HPUA 2XSJA 3U1LA 1R8PA 4F25A 2OPRB 2FLOA 2F40A 3WQPA 3HKWA 2NYHA 4DJBA 4LF9F 4B3SJ 2DNMA 1LWEB 4DF8A 4LF6J 2PT0A 3KLEB 3HHLB 2VA2A 4DL6A 4Q2MA 3RRHA 4JI6J 3MAAA 3W5XA 1IKWB 3QGPA 1OS5A 1L3VA 1AFIA 5KG7A 1WKKA 1HI8A 3KLGB 1U0SA 2CQPA 3DGPA 3AFGA 3O2IA 1KP6A 2RT3A 3PTWA 2CNNB 4OI6A 1E6YB 5B0CA 3T5KA 2J6TA 2E9RX 4FNHA 4RBUA 3CJ2A 2VV5A 1SVDA 2UXCJ 1BQMA 1S6OA 1XBWA 4OYIA 3MMCA 4FDFA 2AF6A 3HT3A 3QBCA 3VAMA 1LW2A 2AV5A 4IRKA 3MXHP 1WG1A 2HVZA 1TFYA 1FT8A 4DR1F 3FSIA 3UCGA 2UUBJ 1FRXA 3OUYA 4RUBA 2NZ4A 2OLWA 2RRBA 1VBZA 1NJIT 5JVGQ 1WG4A 1U2FA 1ZA2B 4ICLA 2HHHF 1T9VA 2YNGB 3N28A 4NLQA 3GTYX 4OQJA 4U6PA 4WFXA 6FDRA 1JNRB 3EXCX 2HVIA 1X0FA 2C2DA 1S77D 2DEIA 1SUQA 2P9EA 3GB0A 3BR9A 2F63A 1TL5A 2KL8A 4DQIA 4GRSA 4PPDA 4G1QB 5CYQA 1U1RA 2MEWA 1YJTA 4KGVB 1ZOTA 4MKAA 3GG1A 4RJVA 1NU4A 2VICA 1LOUA 4PWDB 4CTAB 1NLKL 3TZYA 3DFEA 1SJRA 2LEAA 2VQFF 3BO2A 2CXEA 3ONQA 2ERRA 4K4WA 1RA6A 2W2QP 3BS9A 3CUNA 2PFDA 1TL1A 1UPPA 1UWBA 3WIUA 2IC3A 3KUEA 3M2VA 3DRPA 2QO3A 2W8KA 3NEKA 1TL7B 2IJRA 4ILMA 2R7XA 1TV6A 5KOXA 3A8KA 3KJQB 4DV1F 3TR5A 2AYBA 1Z1ZA 4FS2A 4USVA 1ULRA 4IR1A 1Y00A 5C25A 4DL5A 3D68A 4K4YA 4CLKA 4ES2A 4LF8F 4OHXA 3J7A1 1XIQA 1WEYA 3JSMB 4R25A 5IM0A 2NCKL 2XS7A 1VLOA 3MMBB 3VAGA 3MTKA 4C8OA 3VGUA 3GJTB 3BKUA 1EZZB 1KLMB 3EXYA 5DGBA 3G71S 1PC5A 3JSRA 3THPA 2DHHA 3I32A 4J5OA 1Q4RA 4CYUA 1RXOB 4LT6A 1F0XA 1ZZFA 4Y2AA 3OR2A 3GR1A 2CDRB 1VQOS 3LALA 1KOOA 3DN9A 2CNOB 1HMVA 2LKZA 3D0GE 2WBMA 2V8VA 3IN5A 2J9EA 5KFHA 4USUA 3W63A 3QQCD 3I96A 2DNOA 4L73A 3SEOA 3H2VE 3L9ZA 4NXMJ 4CCHA 2IVYA 5BYSA 3AQPA 2NLWA 1KVKA 2COLA 2AD9A 4A48A 1TKXB 4KKOA 3FK4A 7AT1B 5LSRA 1RJJA 1XR5A 2V8DA 1WC1A 4KSEB 3UDLA 4QR0A 2GAHC 3M6WA 3UCUP 1HA1A 2JZ5A 2R8HA 1SH0A 2FHKA 3I9V9 4QIGA 3DDNA 5CZVA 1YHQS 2N7YA 5CCLA 1WF0A 4F50A 2ZFHA 1LWFB 2JEGA 1W2IA 2HNDA 4TNOA 3R27A 1RT2B 2E7WA 2AJ1A 3T1AA 3R7BB 3KLHB 5KFYA 4WXWA 2F3JA 1Q8IA 1MWZA 3ENAA 3DU5A 2WSCC 3QJJA 4LRAA 5T7LB 4ZN1A 3ILJA 2ZITA 2FC8A 4DL3A 3FRZA 4O44A 2EI5A 4B9VA 2CPJA 3MEGB 1BQNA 2GFFA 3PJ9A 4DEZA 1RADB 3KNGA 1UMJA 3DMJA 1ZAXA 1Q95G 1REVA 1NK5A 2YNIB 3IG1B 3D6HB 3NMRA 1P8GA 2DBBA 2YX7A 4NLUA 4ZKAA 1KBRA 2EPIA 5E33A 2E5LF 1QSLA 3W5ZA 4C8LA 3Q8VA 2Z56B 1HBOB 4R5PA 1WEZA 2WK4A 1VQSA 1VQPS 1N5QA 4FVMA 2IPOB 5M2UA 5L46A 4WFNQ 2P6TA 2DGXA 4ED4A 2YKOA 4F0HA 2DHAA 2V0NA 4X65F 4F3QA 3IM8A 2WCXA 3J7AN 3VTIA 1VHIA 2K1RA 4CP5A 2LQJA 1HWIA 1R43A 5THWA 1EETA 3VGTA 4Q43A 2YXLA 5F8LA 1XMOF 2KKHA 4DFKA 3IAS9 1OMSA 5C24A 2ALYB 4WP3A 3PYGA 2MGZA 4FF1A 1O8BA 2B9YA 3UFCX 2JNJA 2DGTA 4DV6F 2ZUAA 3V81B 2XHWA 2IA0A 3GJSB 5IQQA 2EFVA 1N5YA 2D3UA 3ETOA 1RT1B 3FRYA 1D9DA 3HVRA 4DV7J 2BW2A 1UW9A 4OJ3A 3I4HX 4XPEA 1UW4A 1HWUA 4ZVEA 2GNKA 3TUZC 1BXNA 4FNIA 2ZHAA 4NEYA 3M8RA 1YJWS 2BE2B 1N33J 2IBOA 1U47A 3ET6B 3VCDA 1HNZF 2XYGB 2PIIA 1QAIA 2DYAA 3MM8B 4TQSA 4KGKA 2VQEF 3CJ3A 3HFKA 3O44A 1UTAA 5IWAF 2YH0A 2R8GA 5G0RA 2WSFC 1OSCA 2KYXA 3OXLA 3PVXA 1YIJS 1FNXH 4QCLA 3R1LA 3H59A 3DU6A 1TL3B 2JH3A 3CD7A 4ZLJA 4JI8J 1S6QA 1RWKB 3PX0A 4ZIVA 1L3KA 1CJKA 3PW5A 4QR2A 4NMLA 3PJWA 4U8VA 2KZZA 3HZGA 2DRDA 2FJWA 2MZQA 5LOQA 1S9FA 4QIVA 4NYOA 3I4PA 5JUMA 2ZVIA 5A0YA 4IG0B 4FYXB 1MU2A 2AZ3A 1UEVA 4LIRA 4A8YA 1YJ7A 2KXHA 4O3QA 3KLFA 2VC1A 2FD2A 2VG7A 3UWTA 5GAEU 3TUJC 4NRUA 5LL6d 4AT1B 5KFPA 1ICEB 1AT1B 3NS5A 4USWA 4TYAA 3IGNA 1RT3B 1FK9A 1H2UX 4J9VA 3BSCA 3OTOF 1M1GA 1XNQF 5EUHA 1PYTA 1WOSA 1RI7A 3LP1B 2WRMA 1WSRA 4J9NA 1JLBA 2Z2LA 4LFAF 1DBDA 1S6PA 1YDLA 4HHHA 2DB1A 1BGXT 1SJ4P 2RD5C 5DG7A 2CADA 4GKKF 5FJ4A 3HDSA 1RT6A 4P75A 5KG0A 4K0KF 2OUGA 1XR6A 5T41A 3NGUA 4FF3A 2Y0SD 2VKZG 5ADZA 5KFIA 4Q2LA 2CJBA 4MFBB 3EVWA 5CCMA 1EQMA 3NGDA 3ZZTA 3SCLE 3CSKA 3VWSA 2WSEC 4IRDA 2N4DA 5HVFA 3FBCA 2BE9B 3MMAB 3QGIA 2FDNA 4JYAF 5D3GA 2YX1A 4USKA 5HJXA 2VB6A 2ZJPQ 3HI9A 4OV6A 4ZK7M 2Q6CA 4NPOA 4ZPWR 2ZM6F 1H7WA 2LVWA 3G4SS 4I2QB 1HQUA 3AD9C 1IKWA 3T6JA 3O6QA 1EHWA 3EDQB 4Q8EA 2GA7A 3M6UA 3T5JA 2A6OA 1J2VA 2HWHA 4C8KA 4KPCA 1IR2A 1MN7A 3EDRB 1LNQA 3DOLB 1VIXA 2ZZNA 2DNPA 4M5LA 2Y0BB 4K4SA 1Q86T 3LGNA 4X2BA 1V5IB 1P9YA 2YQ0A 2AJFE 5DQIA 5HAOA 1U0HA 1REGX 1B64A 4YN3B 4PXEA 4DF4A 2WONB 4M1KA 3LTOA 1UCNA 4DUZF 4DR5F 1IBLF 1CQMA 1H0HB 3P6YC 2N82B 3NLCA 4M8LA 3PRDA 1BUXA 5ETVA 2JSXA 2PI4A 1HWLA 2VG5A 2APOA 3NNHA 2KVIA 3PX4A 5I42A 3KLIB 3UDVA 2DITA 4FVCA 2YWEA 1RHRB 2ABYA 2LU2A 1JLFA 2X1FA 1GMWA 1RE1B 1YGYA 3TAQA 3M2RB 3SQGA 4PKDB 2EBGA 3OVBA 1XWLA 3ISZA 4IRCA 4OV1A 4GMKA 4P73A 1UETA 1AZSB 4WXOA 3OFGA 2DHGA 1H6KX 1S48A 2LXUA 3P49B 1YTYA 4H54A 4C0HA 1NBEB 3IWNC 1S7IA 4U9RA 3M05A 2CPHA 5KFVA 4DX6A 3OW2R 4USMA 2XI3A 4WWSA 1SB6A 5BXIA 4DV2F 1FKOA 4KO0B 3QNWB 3M8YA 2VFSA 1NJXA 3MEDB 4NCGA 2UU9F 5F0WA 1C1CB 4XO0A 5HROA 4DDFA 2FPHX 4P10A 1SH3A 5HLFB 3AY0A 2RU9A 2BUNA 4M5DB 3LP0A 1IKYA 3R5DA 2DH8A 2ZH3A 3G96A 4DL4A 4DOZA 5L1JA 2EC0A 3AAWB 2DHSA 2HGMA 2W2PP 3RR7A 2AGQA 1HKAA 2KH9A 4H4KC 5B09A 3KYLA 1NDCA 2XEXA 5ETSA 3MR5A 1N0UA 2I38A 7FDRA 4HYKA 1WOPA 2JLEA 2FHOB 4OZLA 5B0BA 5DLFA 1UWAA 3OTCA 4DG1B 2V4JB 5BYQA 4B3MJ 1KR4A 3M8PB 4LVOP 1RAJA 1M5PC 4QQBA 4EZ6A 4HL9A 2CJQA 4CWBA 1Q79A 1XNRJ 2XMMA 4XTTA 3TI0A 4W90B 1HNWJ 6AT1B 1AROP 1T3OA 1UVLA 4JI3J 4ED2A 2LLZA 1Y4ZB 3OQ2A 3CIZA 2I6WA 2OEMA 1KFSA 5F8MA 3RYLA 5BR8J 3M9OB 5J1EA 4H4MA 5LMUF 3QIPB 2R3VA 5KFGA 3RBDA 4ES1A 1V6HA 5RUBA 4RW8A 5DG8A 3KDNA 2V63A 3I55S 3DXBA 4OLOA 2OAUA 4I69A 5C2GA 3V4MA 2G2YA 2C3MA 2UXDF 1RWPB 4HH1A 1FFSB 1X5PA 5ETOA 3IXQA 4JV0A 4N5SA 1TUGB 3MPYA 1IBKF 5B7WA 3L7PA 4R0EA 3ZTRA 3DYAA 2X1GA 2O3DA 4DR2F 2CJYB 3G82B 3Q86A 3IC1A 1S1TB 2J7WA 3ZZRA 1LWFA 3R5JB 1K44A 1N0VC 2BJEA 5KG2A 3V6KA 3NG8A 2HQDA 1J27A 5AXKA 1GMVA 2QEXS 2CWKA 2BX6A 1HHQA 1B0VA 1JXVA 2YKQA 2V4RA 2BM1A 3IP0A 4YB6A 3NBPA 3POTB 2KM8B 5IZHA 3BN7A 3NXZA 3DRRA 4BBYA 1HL6A 4M5JA 1Q5VA 4ZP7A 4C4WA 1S99A 3EVOA 2RQMA 5FD1A 5ITHA 3FCHA 2FJAB 2QZ8A 3V6HA 1WHWA 2DR7A 4WTYA 3BGRA 3FQKA 3SSSA 2XY7A 4KIAA 1HBUA 2VPWB 2RB7A 5LXRA 2AQ4A 3R7SB 3IRXB 4C3KA 3K58A 1HNXF 4TU7A 2HRTA 1ZETA 5J2PB 3CD0A 1CJTA 4Q0BA 3O1LA 1RWOB 3MEEA 3X1LB 2P9CA 3D66A 3D28A 2I0XA 3LAKA 2KXNB 2ZH9A 3GYXB 1H72C 4DU7A 5L9XA 4PQUA 4DR4F 5HO4A 1CPZA 3G6VA 5LJ3Y 2BRKA 2KJWA 1T9WA 5AE2A 5HL7Q 3HXMA 4OIXA 3V4IB 4WE1A 3DOKB 4K5RA 1JLEB 2VFRA 1HHTP 1NAQA 1URNA 2Q79A 3PHTA 2Y3YA 2YNFB 1D9AA 4X66F 3GPAA 1PYOB 4LR7A 1K0VA 2MKSA 1U4BA 4QOTA 4USTA 2DNRA 4NASA 1ZBTA 2UUCF 3DOMA 1LFPA 2HZCA 3JQKA 1WC0A 4ECQA 2O01C 3IM9A 1NJWA 3UI3A 1HPZA 4M95A 5KFDA 3C14A 4DX5A 2KTQA 4P7TA 4FF2A 3NWRA 2JEIA 1SH2A 1TUVA 3LH2S 4F3OA 3RBZA 2QL9B 3OSNA 1I51B 1DARA 5KG4A 5KFKA 4Y0FA 1XEZA 2AW0A 3QLHB 2HHWA 3WZ0A 5G4DA 5C42B 2KYZA 2K7JA 2DCLA 5H9EJ 1OY9A 2QSFA 2CJAA 3HM9A 3D1HA 3QO9B 2XCAA 2ZJQQ 4YY3F 3KK2A 2VG6A 1DJ0A 1VGYA 1KLNA 4WIIA 1SL0A 1D8YA 1U1QA 2E5IA 3M32A 3TJ8A 2EK1A 4IFYA 4I2PA 4UQGA 1VI7A 4EBEA 1UZDA 2V67A 5IFMA 2OH2A 2DJWA 3TUPA 1Y5IB 2WVEA 3SYZA 4J9RA 3Q89A 4OHYA 2DRAA 5AXNA 2DKOB 3R2CJ 3TVZA 1WF2A 1RTHA 1CSJA 4NYZA 1X4EA 5ETLA 4ED7A 1FD2A 4UY85 2MZ1A 4EO8A 4URSA 2QLXA 3QRPA 3IS9B 2EC2A 3DRYA 3S01A 1YG0A 1ZS6A 2PMZD 4AQYF 1Y3JA 2BVZA 4LF5J 2CQ2A 5IV3A 4DSLA 5HANA 4ATNA 4S0MA 1S59A 2DT9A 3MOJB 4B9SA 1AFJA 4X62F 5IT0A 1R8BA 3GIRA 1WUUA 2XQCA 3DLGB 5KG1A 1CLFA 1FDAA 5EX3A 3G8TA 4URGA 3PO4A 4F0KA 1KS2A 4KPYA 2CVEA 4HT5A 1GTEA 2AWZA 1CULB 1CC8A 2DGVA 1LWXA 3MR6A 4CDIA 1NK9A 3M8SA 2R7VA 2GMHA 1D09B 4LIWA 1UL3A 3UO0A 2RDDA 2PFFB 4L6V3 4QWCA 3IMQJ 2E1CA 5A2QU 4CO5A 1N6QB 2ATLA 1X8DA 1Y11A 5DLGA 1KQSR 3UQSA 3OPKA 2DGSA 3E51A 4MMOA 2LDYA 1T9YA 1ZAWA 1R3NA 3PNIA 4TVAB 4QWAA 5EDWA 5F9NA 1T9UA 2HGNA 2ZUGA 3GV8B 1TVRB 2XMVA 1GMUA 2Z30B 4U8YA 2ILYA 4PXBA 1S79A 5J2NB 1OPIA 3PFEA 2WB1D 4J9SA 3N5FA 3K5MA 1X4FA 3CJ5A 3TWZA 2W9CB 3SSRA 2LEPA 5CABA 1T05B 3H40A 1VQNS 5DRKA 2ZHOA 1FRJA 3KHHA 2AJQA 3BH6B 4RL1A 3H20A 1C4AA 1HHSA 4QWEA 2YWGA 3RB4A 3LO3A 3KG4A 2NQPA 2CNLB 4TN2A 4KTQA 1U1OA 1Z2ZA 1T02A 2NXUA 2UVWA 4KH1B 1LXJA 1RTDB 1SKSA 1JLAB 3PM9A 2MY7A 3EUNA 3L09A 1N32J 4DPYA 4NMXA 4A8WA 2DNLA 4KFBB 1T03A 3I82A 4YHHF 4EBCA 2GIQA 5E3RA 4OJHA 4NI2A 4KGXB 2XY5A 4JI1J 2IM0A 3NAIA 2ZH4A 1RT4B 4FS1A 4F4WA 1FCAA 1SQFA 3HX9A 4CQ1A 3FNNA 3G87A 1IQZA 2PA3A 3PHEA 2DNGA 2BJ9A 3BEGB 4B17A 5K14B 3V5RA 4LF6F 1NCLA 1U1NA 1Q8BA 1MROA 4JI5F 2B0GA 1N88A 4QU6A 1EX8A 4QW8A 5B08A 4USHA 2ASYA 2BV3A 3TZZA 3IBFB 3LPEA 4I7FB 3ZTOA 1JWWA 3M7VA 3Q24A 4TLRA 3RG6A 1MNEA 1TKZB 1RWXB 4DPOA 3JYTB 1B4SA 4WP8A 4ZVQB 4M5DA 1TK0A 1GAOA 4DQSA 1W25A 4ELTA 3W7BA 2RKIB 2C3YA 3M9NB 1VJQA 2F4VJ 4LSNB 4TU8A 3CMAS 4YS2A 1PJ6A 5EHHA 2HG4A 1IR0A 3N4WA 3HSJA 4RW9A 3PRVA 4CO1A 3RRGA 2FJXA 3W8PA 4CLWA 4IG3A 4LF4J 5CZXA 2HHUA 1WKLA 4FYYB 1RTJB 3MM6A 5BJRA 2BKNA 4ZVUB 4DX7A 2PA8D 3BM7A 1CVJA 4ILRA 4AXJA 3DI6A 2OTJS 1NSPA 3T1YF 4EWTA 5DO2A 1LEOA 1FWLA 1VBXA 3C16B 4Y00A 4ZP8A 1RCXB 4RBVA 3UDCA 4F67A 3OLAA 4WK3A 2KFYA 2XI2A 3VGVA 1HBNA 4J9OA 4ANCA 4X4NA 2BMBA 3I56S 5GAHI 2AJ4A 4K8RA 2UV8A 2R7WA 3HFZB 1Y5LB 4RW6B 2IRXA 4FBTA 4WPAA 2QA4G 1GX5A 4MTPA 5LSOA 3HVAA 4PWWA 4ED3A 3N9UC 1RWVB 5ETRA 4DR3F 3MD1A 4B9TA 2X3DA 4LUBA 3I5BA 1FDNA 5J2QB 1JLCB 2YKMA 5I3UB 3MR3A 1UA1A 4DS5A 4I64A 2XG8A 4HACA 5KFFA 3FDSA 3CJ4A 2DGOA 4TKTA 2QSWA 1FX4A 3KJVA 2QA1A 4NLWA 1ZM3A 4ID5B 2EFGA 3BSNA 1U2CA 3KXDA 2J0WA 2ZOGA 5EX0A 5HJYA 2XZTB 1VRUB 3U02A 1DTQB 1X9SA 1F5BA 2MB0B 1D1UA 3BGUA 3MCOA 1AXQA 3DLKB 4X64J 2OPQA 1B7FA 1ELOA 4ZPBA 1Q78A 4RO0A 1IR1A 2DY9A 2MLZA 3BV8A 4DS4A 4BC7A 4KHMA 2B6AB 2IMOA 1TKDA 3LP2B 1J5OA 3J81U 2W25A 3IRXA 1VR6A 1U25A 4RNMA 4RW7A 3TX0A 3OR1B 5H9FK 2BJ1A 3BPSP 3AQOA 4ZITA 3I5AA 5E7OB 1SJQA 3T5HA 1R0CB 2M88A 5HN0A 2DGQA 1D9FA 3V6DB 3EGVA 1FNOA 4B3OB 2W9BA 3IR7B 3V6JA 2ASLA 4ZHRB 1N5SA 1P9QC 4CLPA 3KJNB 3TVYA 3CJKA 4EFAC 2B3TB 2D3OR 4DR6F 4LF9J 3I0SA 3CCJS 2DVIA 4Q5VA 2PEHA 3T9ZA 3K5PA 1G2EA 1FRLA 2IJFA 3BJYA 3JAMU 1O51A 1NDKA 3BR8A 4UOHA 1M90T 4OZ5A 2G9OA 1TELA 4B9MA 1IKXB 5F8JA 3VQSA 4R0JA 3AJ2A 3D6MB 5L1KA 3CO0P 4FXDA 4H4OA 2IDEA 3LGHA 1UVKA 2PSZA 2F8MA 2ZWOA 1KTQA 1Y9OA 2MJUA 3QSIA 1X60A 3A8EA 3NWGA 2FC9A 2GVDB 1HBMA 3E3XA 2MLYA 1DLOA 1VQ9S 2J5AA 1FJGF 2F9DA 3NY0A 2B4OA 1PG5B 3D6FB 4KRWA 4OZ3A 3W9JA 2BOPA 1DTTA 2O1PA 2IYIA 2VODA 3QT6A 4DR1J 4RW4A 3HSZA 3M1VB 4O3RA 1J5EF 2OD4A 2IRYA 2MSSA 1IBCB 2XLKA 2B51A 5K9FA 1S9GA 1E6VA 1B7YB 4FPRA 1R27B 3GILA 2HHHJ 4IUFA 4WYLA 4RNOA 2GVZA 4IQMA 4BHQA 2ZH7A 4TY9A 2QIFA 2WAQD 1YK9A 3BKFA 2E7XA 3PR5B 3MD3A 5DETA 3HHLD 4B08A 1C0UA 2RRAA 2KG1A 2Y9HA 3CCVS 3G6XA 4BCAA 2F8EX 4F4XA 3GJRB 3FGVA 4K7QA 2BKOA 4RUHA 5CA5A 2NUHA 1ZAVA 1JJCB 2FB0A 4P2MA 2I1RA 5IT9U 3ZNJ1 1FF2A 3RUBL 3LOUA 4GKJF 2LQ9A 4ZMMA 3FEYB 2Z58B 5KT3A 1TAUA 4U95A 3QZ8A 4OHVA 5C2CA 3NCQA 2DGUA 1GEHA 7FD1A 3LWMA 3DNCA 4HTJA 4A8FA 1T11A 5HBMA 2HFZA 3FBEA 5HMWA 1U7LA 2NPFA 2DIUA 3IAM9 1N4LA 1OQ3A 3LPYA 2GV1A 1RWWB 3M9MB 2MZTA 1CJVA 4FYDA 2MHEA 3R5GA 2HZVA 2OGUA 5K5MA 3J80U 1PJ7A 4QYZK 4LF8J 2RS2A 4X4RA 1VCTA 4OYAA 4MAKA 1SIWB 3RJMB 5AXLA 3SDEA 1N33F 3RGIA 5FIIA 3M2UB 2KO1A 5E3QA 2XCPA 2CQ0A 1WEXA 3R5AA 1GMWD 1UEKA 5IC6B 1S1XB 4ECVA 1EIYB 1R0AA 2MXYA 2VBZA 4K5SA 4PRFA 3NCRA 1G1XA 4O3SA 4L72B 4JI8F 2BE7D 2W9AA 2E44A 4HKQA 2RVJA 4U96A 5LSLA 2EKYA 2AHOB 1GXUA 1PC4A 5HQLA 2H54B 2WW8A 4V19J 4Q44A 1ROFA 2KFNA 1YBTA 1LWCB 3G2XA 2WHOA 2B5JB 4OYBA 1YITS 4L3NA 4V1Ak 4LSLB 4ZP6A 5AJ3F 1HYSA 1YLXA 3VZIA 4N47A 4DQQA 1VK3A 3VF0B 4BLGA 1TK8A 2KB2A 4HT7A 5H9FJ 2IFXA 5ETTA 3G8QA 2R8JA 1NH8A 2FUG9 2DO4A 2BYCA 4P2SA 5HQMA 4J9PA 3DC2A 2JVRA 5J1PA 1JKHA 4AXIA 2VC0A 4FPIA 4I1TA 4WFAQ 4ILLA 1N34F 2M9KA 2RQCA 5DS7A 4WYWA 1YWXA 1KN6A 3MM9A 1N36F 1R8CA 4YOEA 2DO0A 1WI6A 4HH0A 3UD5A 1C1BB 1F9FA 1RT5A 2RQ4A 4KFBA 5E5NA 4LFBJ 2XMAA 3H4DA 1X9WA 2WZ1A 2BOAA 3PACA 3CWJA 3CCWA 2BRLA 3QMQA 4BWMA 1YJNS 2R7SA 1RTZA 4GVBB 4TLQA 1EP4A 2C1EB 4ZPVR 2XSFA 4B3RJ 4WP9A 2G2ZA 5ETKA 2CPFA 3UD3P 1PJ5A 1VLYA 1GQEA 4Y3CA 4Q8FA 4EGLA 2ASJA 2LYVA 1VJWA 3TA0A 1VBKA 3W5YA 4ECRA 1PAEX 3BQ1A 1FRIA 1IKVB 4RX6A 3W2WB 2AMCB 2OPPB 4HTIA 5LM7E 3EMTA 4I6AA 2C2ZB 5D6GA 4OYXA 2C2NA 2ZH8A 2R8IA 5KG5A 3ISNC 1ZYQA 1WDDA 3C6UA 2AX0A 1T7PA 1VDHA 5ETQA 2KVQE 1I1GA 4YEAA 3EVMA 4CLLA 5HP1B 2VUGA 4AL7A 1XMOJ 2HFSA 3RAQA 3NOCA 4IFVB 5A8KA 2QC3A 2M52A 5LMNF 1U2RA 3TUIC 2LA6A 2RIJA 1H73A 1UVJA 1QVFR 4F0MA 1MWYA 1U26A 3CJSA 3MAQA 2XO7A 2D1CA 4DV6J 4YP3A 3K5LA 2XYHB 3CJRA 4DFMA 3QT5A 1AYEA 2Z2MA 5I3PA 1RHMB 2VHGA 1R6VA 1RQ0A 1NHKL 3CMES 3OLBA 3Q0AA 1FVSA 3UVJB 5LT5A 1Q7YT 2OEJA 4YFUA 4X4QA 1FFGB 3T41A 1HARA 2HHTA 2XNQA 2VJUA 4OL8A 1X5TA 3ITHB 3C66A 3D9BA 2HLUA 2J8AA 4U7CA 1TKTB 2BXJA 2E5GA 3DRSB 1HNZJ 3T3FA 1WC6A 4NX9A 2N3LA 5B0GA 5KT2A 1YKWA 2KG0A 3TQEA 4WCEQ 3W2VB 3GONA 2VQEJ 4OI3A 3E01A 2MJNA 3TNVA 5A8RB 4ECSA 4CH7A 5IWAJ 2ILZA 3GCXP 1RU1A 2W7AA 5GMKa 4OLPA 3U1MA 4G6VB 2FJVA 1N48A 1A7GE 4ECTA 2J7KA 5K8MA 3BYRA 2BM0A 1SBRA 1HNIB 3W64A 4NEZA 4C8MA 1WDTA 3N0VA 1FKPB 2HQIA 1YZ6A 5DDRC 3A4TA 5KFSA 2A18A 2ZNYA 2OPSA 4UOFA 3HFVA 2N4CA 2V8HA 1LQ9A 2VD3A 4KHRA 3C3LA 2W1BA 2EG2A 3MM7A 3OBIA 5DDOC 1G3OA 1GXLA 1DHMA 4LSZB 4PPZA 3PY8A 3RBXA 3OFFA 2QLFB 2VFUA 3DLKA 1SV5B 1PGZA 2L3MA 2I5JB 1MG7A 4DPWA 4P74A 1S72S 1YJUA 1U6ZA 2EW9A 3CDWA 4TY8A 3PFOA 2HAFA 4JI0F 1XNQJ 2HK2A 1HD1A 4O4RA 1IM4A 4A8SA 3DLHA 2ROGA 1BD6A 3W60A 2YNHB 1PBUA 1SC4B 1JLQB 4O3PA 3Q83A 4FKYA 2OMLA 1RWMB 2QLBB 2F1FA 3QRQA 3JS9A 1S0MA 1RTIB 1NSAA 2PE8A 2B8QA 4TQRA 4NLGA 1FESA 4GKKJ 4FN5A 2C22A 2HMIB 3BH7B 4K0KJ 3BB5A 5DDPC 2D74B 3AA9A 3EGNA 3GU0A 3NP5A 3CMQA 2V9KA 3B8HA 2NZCA 4Z7YA 5KFAA 4KYZA 3H98A 4KV8B 2B43A 4O4GB 2MKYA 2ZH2A 2WVFA 3C15A 3DLEB 3TYTA 4RU9A 2CKWA 1KQFB 1MN9A 2M4MA 2CDQA 4PUOA 4Y28C 4O3OA 2SXLA 2HBYB 1S1VA 3TP2A 1K73T 2HNZB 1OO0B 3PXGa 2ZM6J 4GC6A 4OYPA 2KDOA 3N5BA 1JIHA 2Y8YA 2IAJA 4DUYF 4I68A 3W61A 1SXLA 2FLLA 1DY3A 3CCMS 4OZJA 4JP8A 2EFOA 1RCOB 3HVTB 2EVZA 3BKTA 1RLDA 3ZTPA 2AU0A 4WFBQ 4LF1A 1S4FA 4W98A 5KT6A 3G6YA 4HI2A 1NKBA 5KFLA 3BN4A 2W2OP 3R9LA 1SQEA 4ZVTB 1SKWA 1WORA 1OIAA 2GJFA 4EZ9A 2CPYA 3F41A 1RDRA 2YWKA 3GR0A 3CDAA 2BANA 4HHJA 4DUZJ 2G1DA 4DR5J 2FZKB 1QD1A 2V2QA 1QY7A 1F2GA 1YJVA 3KUHA 4C8YA 3BBFA 4NLVA 5C7PA 1RAFB 3M4XA 1X4BA 1PIEA 5D4OA 5KT4A 1CS4B 4CM2A 3DRXA 4OHZA 1XMQF 3OD2A 3RB0A 1APSA 1UFWA 1RLCL 3KFWX 3UNYA 2CPEA 4LR9A 4N8NA 3FMBA 1RUSA 5J2MA 2D3O1 2XSJB 1X4AA 2KU7A 1UVNA 1Z2LA 4OI2A 2RHQB 4DV2J 1NPRA 2YKAA 3ENWA 1QTNB 4R8UB 2A3JA 4ZS6A 3B82A 1H2TZ 2UU9J 3J7ZT 4IH7A 4D3HA 3MAAB 5L39A 4J90A 4DLEA 3B78A 4B9UA 4HVZA 1OPZA 4ZN3A 3U27A 5BYRA 2ATCB 5JMNA 1WKJA 2XM3A 4C8NA 1DQ9A 2J0QD 5FDLB 1H38A 2G2OA 3D1OA 3DGPB 3BDPA 3K2YA 3HCXA 1RZMA 3MPVA 1HNVA 2HBRB 3R5BA 4UZBA 2BQ3A 3CC7S 2CQBA 2XTJP 4ELVA 1HIYA 5U47A 2UP1A 1N54B 1FEEA 2JC0A 2JJ4D 3IR5B 1M5KC 2C42A 5E3AA 1NO8A 2DD8S 2DNQA 3BSAA 1BQMB 3T19A 3BQ2A 4LF2A 2HSEB 2FLNA 2ACYA 3MMCB 2K7KA 5F8HA 2ZD1A 3MF5A 3M8QA 1LW2B 1VRTB 3W65A 4YB7A 4NLXA 4XPCA 2W4CA 4K2XA 4PXDA 3OUYB 2B56A 4DV3F 1FJ7A 3AD8C 2R9LA 1RSCA 3W8GA 4DCJB 2Z2YB 3N6NA 1RISA 4ICLB 3ILOA 4ELUA 2HS0A 1T3NA 4DPXA 4DZ6A 1FTCA 3AXKA 2UUWA 1YBUA 1NPKA 4UF4A 1BLUA 1F9EB 4ZDNA 1SUQB 2YH1A 2GW8A 3K7RA 2H5IB 2BJDA 1NMEB 2HGLA 5CYQB 4U7UK 2YBVA 3GZ7A 3QT7A 2K2PA 5C5JA 2UXDJ 3Q23A 1NRKA 1NKEA 2PN6A 1S1WA 3TEGA 2AJ0A 1IBKJ 2DK2A 2HFNA 2DGWA 3KG0A 4OX6A 2OSRA 2VPZB 1U45A 2EKNA 3VAJA 2V5HG 1HLWA 3M8WA 4DQRA 5DQHA 1TL1B 4U7UD 1UWBB 1RBOB 4ZPDA 4EMDA 2VASA 1ZH5A 2IC3B 3FQLA 3M2VB 5JXSA 3D7SB 4B3TF 1JNZB 4XAKA 5CYMA 1JK9B 3P3DA 1YZ7A 1XR7A 4ZVOB 4NA3A 4CLFA 1KD1T 3CD6S 4KE5A 3ZFVA 1GX6A 1CC7A 3ZTSA 1U24A 3DHWC 4KGZB 5C25B 2I2YA 2UXBF 2GGPA 3CJ8A 1HWKA 2PEBA 4DV5F 1UP1A 2HQGA 1WACA 4M5HA 5IM0B 1CJUA 1R8HA 2IM1A 1YI2S 3EE3A 2FVSA 1S1UA 2GJIA 1N5TA 2MKCA 4OZ1A 2ZBPA 2CZ9A 4JUZA 2MQMA 4GVBA 4CYUB 4Y2KA 3GYNA 2RS8A 2V2ZA 4FXWA 3VGSA 3TJ9A 2VA3A 2AGPA 3MURP 3OR2B 5L38A 2HIYA 1GXTA 4IKAA 5SUHA 3QWUA 4FF4A 4F2RA 1V3ZA 4K4UA 1HMVB 2AX1A 2HZAA 3HLUA 1HNXJ 2W8LA 1S0OA 2PO4A 3C6TA 1QDUB 4FKXA 4LBPA 2IIHA 2N3OA 2D9OA 3NNCA 1SL1A 2DISA 2OSQA 2E7VA 5A2QY 2CPIA 4IH5A 4KKOB 4LF7F 3Q8QB 1DQAA 4DR4J 3EPGA 1IVZA 3OTDA 2V68A 1QAJA 1U48A 4GC7A 4DMZA 1VQ4S 2GC8A 3TAMA 4RKUC 4ZA1A 1I94J 3THVA 1QE1A 3FCVA 1KC8T 3VAFA 3TARA 2YKNA 1KHVA 1XMBA 1S9EA 4RNHA 1Y10A 3MCMA 4HDHA 2IBKA 2W2MP 3ZZYA 5KFZA 4J9UE 2MLXA 2HNDB 4YDDB 3AXMA 3H2UB 3SXLA 4PG6A 2UUCJ 2HHSA 5AXMA 3FVYA 1XK8A 3HHKA 1AW0A 4ZCIA 3K8VA 2GCFA 2W4PA 3EZUA 3M6XA 3DLLQ 3NL0A 3OTEA 1MW7A 5HMYA 4O44B 2CWXA 3D0IE 3QT8A 3QSYB 2BA9A 4A8OA 2Z4PA 1RAHB 1LFWA 1BQNB 4I56A 3IWLA 1NXIA 1VS3A 2CG8A 4OI4A 1FRKA 2FGOA 3H7HB 2LEBA 2RDJA 3BZQA 3ZC4A 3DMJB 1JQGA 4PG7A 1KEKA 1REVB 3C8YA 3OL6A 5B0AA 4NXNF 4X4TA 3D5MA 5IC4B 3MAHA 4WU3A 4M5IA 1TQLA 2WB4A 3G9CA 3DM2A 1WHVA 3IGVA 1U1LA 3WX4A 4YY3J 1ZZNA 3PO5A 1N52B 3HJVA 3MDFA 5HK4A 3EX7B 5L1LA 2XGPA 2U1AA 4R5PB 1BC6A 1VQ7S 1V5VA 2CNKB 1RT7A 3CPWR 4ZVFA 3PIPQ 1EAYC 1QUPA 4QWBA 2DIVA 2OPRA 1VC0A 1KNZA 1LWEA 3T1HF 3KLEA 1Q16B 1WTFA 3HHLA 2HURA 3L95X 2MKHA 4QPXA 2F4VF 1H3DA 3VHQA 5HMXA 3F44A 1HI1A 2WVCA 5A76A 1EETB 1I3OB 3NGKA 4P2FA 2LECA 2QX0A 2M8DB 4ETZA 5IQ6A 3CC2S 2W2NP 4OX7A 3P96A 2OKQA 3BF4A 2KXFA 4P71A 2NS1B 2ROPA 5K8OA 2FVQA 3KLGA 4JV5F 4AQYJ 2ZH5A 2GO9A 5C24B 3BGOP 3MOZA 3W1YC 3NAHA 3VV2B 2MGZB 1E6YA 1S10A 1FXLA 1T9TA 3R1HA 3KDOA 3PW4A 1FRMA 2C2MB 2BJ7A 2CQ1A 3EGWB 1N5YB 4X62J 2J8SA 4F4KA 2CRLA 3CO9A 5EWFA 2G0CA 4WU2A 2KFZA 3MR2A 3JQMA 2J76E 4PG4A 3PDNA 2WOMB 1TMJA 4NA2A 4GVLA 3FFIB 4ZLLA 2CQ4A 3BYPA 5KFEA 2MQPA 3MPUB 3DHXA 4MK7A 2RMLA 2POKA 4P2XA 3MUTP 3CE8A 2BKPA 5L9NA 3NGRA 1RAAB 4P52A 1NK0A 2YNGA 1FDDA 2ZBQA 2CQDA 4J9LA 2C28A 2JX2A 4G3IA 1S6QB 3GWCA 5GAEI 2L48A 3CW2C 1CJKB 4ANDA 2HHQA 1HR0F 4G1QA 2GMLA 1KOHA 4YR0A 4QW9A 3R6GB 1RA7A 4ZLPA 4EBDA 2F9JA 4RBTA 4CNZA 5KT7A 2Z57B 1F5CA 4PWDA 1KHWA 5A0YB 4CTAA 1MU2B 4URQU 5KAKA 3KLFB 2MQLA 4J9QA 2NXEA 2VG7B 1VQLS 3IFEA 4LQ9A 2YY3A 4DV4J 5KTQA 1JJ4A 3HHDA 4DPUA 1TL7A 4A8KA 4CLYA 5H9EK 1FK9B 2JC1A 4PG8A 2M5YA 2H3EB 2LMIA 4NYPA 3VZHA 2HQCA 3HMJG 3QPIA 3AA8A 1KDNA 2VJVA 4B9LA 3I87A 3KKFA 3JSMA 3BBCA 1JLBB 4PR6A 3MMBA 2GAGC 1S6PB 1S97A 4WK1A 1KLMA 6FD1A 2M70A 2MKKA 4IOCQ 2XY6A 3E8OA 5E2QA 3UN3A 1IJEB 2KT5A 4A8QA 1HI0P 3UPFA 1M1HA 2HLTA 1U8SA 3J81Y 4ZJLA 4YHHJ 4C11B 3GP9A 3PRBA 3AODA 2VU5A 4Y34A 3DLBA 3Q2SC 4K59A 2W7PA 1X4DA 2DXEA 4DXLA 3C2PA 4LRBA 1PAUB 2AP6A 3EZOA 4J37A 3UCZP 5D3GB 5MLCV 2C3OA 2AGOA 2WVDA 1C2PA 4JI5J 2VOOA 4ITSA 2YWHA 1T8EA 4R8UA 3H5UA 2VH7A 1TKXA 3J81j 1BY9A 3QAEA 1HQUB 2RDIA 4MIWA 2E1MC 5KG3A 2RSQA 5H1SV 3CDUA 5E41A 4KHPF 4CZCA 5D4LA 2UUAF 2M2BA 2C2OB 1AA1B 2FZCB 3M8ZA 5FDLA 2VBXA 2QL5B 2GQQA 2V8PA 4OX9J 4RUCA 3SQOP 1ZTTA 3OL9A 4ZIWA 2KM8C 1FNMA 1RU2A 2HW3A 1BMQB 3JAMY 2K3KA 2AYEA 3U1NA 2QA4S 1JX4A 1RT2A 3KLHA 1U0HB 4GO7X 2MZJA 3TO8A 2QTWA 3FSXA 2MZRA 5CHCB 4E8UA 3LGMA 2CQIA 4FP9A 3IBCB 4JI4J 1NUEA 1VRTA 5T7LA 4C6AA 2FLPA 1B99A 3NCPA 2XO6A 3D6TB 3RR8A 2VG5B 1UEUA 2RE1A 1NNDA 3MEGA 5I42B 5M2PA 3T1YJ 1P6TA 1GT8A 4NLOA 1VYAA 2HFVA 1JLFB 4IO9Q 2ZZMA 1JJHA 4ECXA 3SQGB 8RUCA 3MGJA 1QJHA 2YNIA 5IOLA 5CAAA 4DSJA 2BBEA 2AT1B 3GV5B 1U6BA 3IG1A 1VOMA 3OJSA 2F7VA 2JVOA 2R2TA 1F9HA 1HQEB 5A6WA 3PW7A 3VALA 2A10A 1S5ZA 1HBOA 1KVJA 1U09A 2RJZA 3PZPA 4A8MP 1FKOB 4LJMA 4ECZA 4DR3J 1VQYA 1QAYA 2ZE2B 2M8HA 2H65B 4NCGB 4I67A 2D7SA 3BO3A 1U6FA 2AZ1A 5J1NA 3VAKA 5HROB 5L1IA 3D0HE 1MWQA 5HI7A 3PKMA 3EICA 3SZ2A 2FJBB 5IT9Y 1VBYA 3HULA 3LP0B 5ETNA 1IKYB 2FHJA 2KZMA 4ZJOA 3IO1A 3Q2TC 4V19X 4DR7F 4EK2A 4L75A 4ZOSA 5KFQA 2MPUA 3EZ5A 3N6LA 4LREA 1UKUA 3I0RB 1M5HA 4KBIA 1UVIA 3RAXA 5F41A 2YWFA 4FZVA 3NNAA 3ZZZA 3MM5B 3LA0A 2B9XA 3H5XA 4QZVB 3TAPA 3NMAA 4JI2J 3V81A 2RHSB 3RBEA 1RT1A 3GQCA 4EI2A 2GMJA 3J80Y 4B9NA 3KWMA 1RGVA 3L7UA 2ZWPA 2JEFA 4CH0S 3TRGA 2PGCA 5K8PA 2AYGA 4XK8C 4OMFG 1F6TA 2BE2A 1RAIB 3ET6A 5J1EB 2EFPA 4H4MB 1BWEA 4F26A 4AFFA 4RW8B 3MM8A 2VZ9A 3FZ2A 5D78A 2B4UA 2QL7B 4ENOA 1NJYA 2R7RA 1RYRA 1VQMS 1YSJA 1IN0A 3CTRA 1TL3A 1TU0B 2J6SA 3JXOA 4NZ0A 4DN0A 4HLBA 3OHAA 3SCJE 2K06A 5KG6A 4DR6J 2MYFA 1DQ8A 3DYAB 2RAQA 1G4CA 4K4XA 4X4VA 5F8NA 4FYVB 4ZCMA 2V50A 4IG0A 1M5SA 3G86A 4QWDA 1D8ZA 4NCBA 1SC3B 5AE3A 2R2SA 3IR6B 1RAOA 3N6MA 2H5EA 3O8WA 3F73A 1NK6A 1WNEA 3RW6A 3OT9A 4UUWA 4MKYA 3HSGA 4RPFA 4OJGA 3G6ES 4OZNA 2OIHA 3FCWA 1K47A 2EK6A 4O23A 3NBPB 3HVWA 8AT1B 1RT3A 3H5YA 1LXNA 2FJDB 4F04B 3DRRB 2Y1IA 2JFKA 1L3UA 4LFBF 4A4JA 1FJGJ 3MZIA 2CPDA 2OJ3A 2BQUA 1X5OA 1IBMF 2J0SD 3K17A 3LP1A 3ZO7A 5D15A 3CCUS 2MMYA 2XZWA 3JTNA 3ULHA 4M94A 4MK9A 2IM3A 3BGRB 4B3RF 2J9DE 4EU0A 1ZM4A 2VBWA 1X4HA 1NB2A 2XYPB 1HBUB 2XLIA 4N77A 5D0EA 1T0TV 4ECYA 4A46A 1J5EJ 3H8YA 4KC5A 2OELA 1CJTB 1VRQC 2GS8A 4MFBA 5KFNA 2EG1A 2F5GA 4DV0J 2HQFA 5KOWA 2Y1JA 4Q0BB 4OZ2A 3MEEB 2ZEJA 1S57A 3SCIE 2ZDPA 2JEJA 3SBMA 3J7YU 3OFEA 3ZZPA 2EFQA 4F2SA 4IOBA 1BWVA 2P8IA 4PQUB 2E66A 3MMAA 1R7IA 4IDKB 5EN1A 1MMDA 4KT0C 3LAMA 5FLXU 3RU0A 1FX2A 3MPDA 3BBBA 2VPYB 2FVRA 2W7OA 1T94A 2CQCA 3TA2A 3H42A 3M30B 4NZ6A 1S4EA 3VAHA 4WE1B 2LQ8A 4I2QA 4KGMA 1JB0C 3CD5A 1X4GA 1LK5A 4GKJJ 5KFOA 2EWHA 1W7WA 2CQGA 3JB9k 3CF5Q 1SQGA 3DOMB 1PBAA 4IQXA 4LFCF 3DOLA 3UNGC 4ERDA 1I6JA 5GVQA 4NLYA 4X4OA 1HPZB 3N01A 4DPTA 3C14B 4DSEA 4OYOA 2B9WA 4M5KA 1IUJA 2JL9A 1LKZA 4JI7F 4CO2A 3GIIA 2WONA 2IMWP 2QRRA 2RUSA 4RNFA 4OI1A 4Y2CA 1RBAA 2RU3A 1U1MA 1B0PA 2DTJA 1S49A 3K57A 2HS3A 2WOMA 2M7SA 1FE0A 3FFIA 3CCLS 1NK7A 1L3SA 2XHCA 3KLIA 4JV1A 4YMEA 3SV4A 3MR7A 3VQTA 1L3TA 4ZVRB 3BDEA 1RACB 5KT5A 1KSPA 3QFHA 3M2RA 2N7CA 2ZDOA 3KK2B 3WHIA 3PX6A 1QSSA 2VG6B 2HK3A 1W26A 1MLAA 1JLGB 1FEHA 4NLPA 1S76D 2GJ2A 1AZSA 4F7VA 3AHPA 3HK2A 2OFHX 2ZHBA 3UR3C 2UVUA 3M32B 2UVRA 1GTHA 4IFYB 3ZZ0A 5IT4A 4I2PB 1LK7A 4I0WA 4X4SA 3W3SA 3HD2A 3RZAA 3WBZA 2D3ZA 4YUDA 4B3SF 1ZM2A 3M30A 4N76A 4KO0A 2E1AA 4X4UA 1X31C 2X51A 2RF2B 1RTHB 5AJ3J 2DY1A 3MEDA 2K3IA 4JI6F 2KRRA 2R7TA 1C1CA 4K2JA 2J9DA 1ITPA 4M63A 1K9MT 2HVHA 3AB4B 3KG1A 4I4BA 2AEMA 2UUTA 2H48B 4IO1A 2QE5A 2KI2A 1NHUA 4KAIA 3CXCR 5HLFA 5HATA 1C4CA 3CJQA 1YJRA 1V3RA 3OSPA 2U2FA 3FEZA 5CXTA 4QBUA 3HJFA 1JXLA 1NPPA 4DFPA 3TX8A 3WDOA 2XS2A 3J7YI 2UXCF 1N34J 1NEEA 1VFJA 4CIOA 3Q22A 1A0OB 1Y5NB 3T6BA 2ZNZA 4IOAQ 2JDJA 3CULA 5KFXA 3GFZA 1N36J 4ED5A 3FBBA 4DG1A 2V4JA 5I4MA 4YB5A 3M8PA 4KJIA 4C8ZA 2AIRB 4L3KA 4C11A 2UUBF 2CFXA 3MUVP 5GMEA 4H4KA 1R89A 3P5BP 2NYIA 2OI2A 4PAAA 2HEKA 4Q45A 2XMWA 4EYHB 3QIPA 4OYWA 1K1QA 3FZBA 2GZOA 2P5VA 2J7UA 1GNKA 1Q1KA 4UTGA 1VISA 1HFEL 2BZ2A 4LRFA 4WKRA 2VFVA 4HR2A 2ZBIA 3GSIA 1RP5A 1SI9A 1VHFA 1TZ0A 2MKJA 2AJ2A 3CCTA 1RKIA 1Y0HA 1OYEA 3WIVA 4DZDA 4M5NA 3BO4A 2B7BB 2YPYA 4C98A 4K4ZA 4NA1A 4G1IA 2YQ1A 3AOCA 3DGVA 2LA4A 3A3OB 5KFCA 1WI8A 3G82A 2QFIA 3IWXA 4DBQA 3LWLA 1S1TA 2FQQB 1P27B 4RNNA 4QIFA 3UE2A 5MAOA 3KMQA 4O0NA 3R8YA 1TMMA 1PKUA 2WVBA 2ADCA 1TAQA 4ED6A 5LMNJ 2KT2A 2XC9A 2BDPA 4ALZA 1FKAF 3IBWA 4MYUA 3MCNA 2XWYA 3PKYA 4FYWB 3POTA 4I6YA 1TK5A 4CLUA 1C0TB 4AL5A 2CIMA 4C0OC 2W01A 4UQTA 1IJFB 3A13A 4MJKA 1CBKA 1Z4UA 1F2HA 3GV7B 3K0JA 4EEYA 1YQHA 4TU9A 5LXYA 5AE1A 4UZCA 2RNEA 3S7RA 3DXSX 1T03B 1WC4A 3KK1B 3VVUA 2KJVA 4LRDA 4NI2B 2QN6B 1HQEA 2E1RA 2C3UA 5DJBA 2YQ3A 1R8AA 1S0NA 4Y6IA 3VVTA 5J2PA 4WJBA 1QTMA 2OHDA 2UZAA 4ED8A 4NXMF 1WC3A 2A0FB 1MROB 3AOBA 1SPBP 1NH7A 2ZE2A 2GO8A 4L74A 3S1TA 2DH7A 5T14A 2Y1LB 2E1PA 2OFGX 5HSPA 4YB1P 3V4IA 2G4BA 1JXEA 3DOKA 1JLEA 1H74A 2L9WA 1L5UA 2QV6A 3BQ0A 2F4FA 4NLSA 3X3UA 1S12A 2NXCA 2VF3A 3ISND 2EBEA 2YNFA 3RW7A 2FTRA 2Q3PA 3I0RA 3BGFA 4WTOB 3Q8YA 1P1LA 5CD4A 3OFHA 3MM5A 1WHXA 4L76A 2V4QA 4NLDA 4RW9B 2JHEA 2PMWA 4WKYA 1XC9A 1HD0A 4F8RA 4IG3B 4CLTA 3QWPA 4JI0J 1NSQA 3MM6B 4W4MA 2VONA 3ZTQA 1Y3KA 4CT8A 2MSTA 1FE4A 2CG4A 3DI6B 1Q7LB 2HHPA 4FXVA 4AL6A 1WELA 3QLHA 5F3TA 4U67Q 2QT7A 2Q1LA 5LJ5Y 4PQAA 4QPTA 3O3LA 4OZ0A 5C42A 2EFNA 4NCAA 3QO9A 1HBNB 2L41A 3MECB 4IH6A 2W4DA 2FYXA 1BE4A 1SC6A 2NXNA 3L7OA 1M1KT 3B6BA 4CM0A 4F3MA 4Y2MA 1KQKA 1WSVA 4Z37A 3GG0A 3KHGA 4CRJA 1FERA 2P2CB 3B4MA 4KR0B 3S8SA 1A9NB 4LRCA 4C48A 3CCSS 4CLSA 2YKMB 2BACA 3BGLA 3DDKA 4DUYJ 4HACB 3R5CA 3D3CJ 1SJ1A 2NSCA 3KJVB 2H9ZA 4O3NA 1SJFA 4WFYA 3MEKA 2V8GA 5GADU 2JOQA 4ZCLA 2Q6BA 3SFGA 4O0IA 3R6LB 2CJXB 1XN9A 1SCJB 2QMUB 3KTQA 3IS9A 4ED1A 2ZH1A 2QMWA 4C7QA 4RZRA 2VQFJ 1XQIA 1VQ6S 2DR8A 2IVMA 4Y2IA 2CVIA 5DDQC 1KWMA 3DCAA 4G65A 1OYDA 3SIPB 1LW0B 2Y8WA 1JJ2R 3LUYA 4GO5X 2OPQB 1RB0A 2MQNA 1PSDA 3I5CA 4ZVGA 2CJ9A 2HS4A 2ROEA 3A8JA 5EGYA 1U8WA 2GIFA 4MH8A 5B0DA 3GIMA 1WD6A 4JB8B 4DV1J 3UN5A 3CGIA 4DV7F 2R2UA 2CQ3A 1ZTWA 3UN2A 4ZCKA 3DLGA 3KMSA 1J5OB 2CZVC 1D3WA 4USJC 3HPOA 5EWGA 1KVIA 2ZZTA 5DG9A 1Q8KA 4FBUA 2Q66A 2ZKUA 1CULA 4RW7B 5D0RA 1XMQJ 3MTJA 1W2BR 1FA0A 3A8IA 3SFUA 2D41A 4W92B 2ZOMA 1DAXA 2OP5A 1YRTA 4USIA 3NGSA 3OVSA 3CJTA 2RUGA 3HZEA 3FKBA 2HWIA 3FMWA 5GAGU 3LW5C 4IDKA 1JMTA 2HHVA 3HSDA 4ECUA 1HW9A 2W9BB 1LV5A 1H7XA 5IXUA 1N6QA 2XB2D 1UZHA 3FJ2A 3PCOB 1O0PA
chains in the Genus database with same CATH topology
4WU3A 2FJXA 4Z2XA 3BS9A 3CJKB 4MIAA 3CUNA 1TQLA 1TL1A 2WB4A 1I94F 3G9CA 3DM2A 4IG3A 1UWBA 5B0FA 5CZXA 2HHUA 1WHVA 1RTJB 2C3PA 3IGVA 3MM6A 2IC3A 1QVGR 5BJRA 1U1LA 3M2VA 3DRPA 2PA8D 2QO3A 3BM7A 1CVJA 3WX4A 4ILRA 3I0SB 4AXJA 1ZZNA 4BC9A 3JTPA 4QIWD 4QJVA 3PO5A 1N52B 2W8KA 2XLJA 3MDFA 3DI6A 4ILMA 4LMZA 3EX7B 2OTJS 5L1LA 2XGPA 2R7XA 2U1AA 3T1YF 4EWTA 1TV6A 3J7Z5 5KOXA 1FJEB 4DV1F 3TR5A 4MK8A 2AYBA 1TVRA 1VQ5S 1Z1ZA 1ZPWX 4R5PB 4WF9Q 5DO2A 1BC6A 4FS2A 3GIJA 1ULRA 1VQ7S 4IR1A 1VBXA 4MYTA 1Y00A 1QAXA 5C25A 2QA2A 1RT7A 4Y00A 4ZP8A 4DL5A 3CPWR 4K4YA 4ES2A 4LF8F 4ZVFA 3PIPQ 2XMUA 4OHXA 4RBVA 3K5NA 2E9TA 3J7A1 1WEYA 3UDCA 1QUPA 4QWBA 4F67A 5J2NA 2DIVA 3JSMB 4R25A 5IM0A 1V3SA 2OPRA 3OLAA 1VC0A 2XS7A 3JSBA 3MMBB 4WK3A 3MTKA 2KFYA 2XI2A 3VAGA 4C8OA 1M5VC 4H4OB 1HBNA 4J9OA 1KNZA 4X4NA 1KLMB 1LWEA 3I56S 3T1HF 3KLEA 5L8RC 5GAHI 2AJ4A 3EXYA 1Q16B 1WTFA 2UV8A 3HHLA 4E0DA 2R7WA 5DGBA 3G71S 3L95X 5KFTA 2MKHA 2DPIA 4QPXA 1PC5A 2W9CA 2F4VF 2O67A 3JSRA 1HBMB 1Y5LB 4RW6B 3I32A 2IRXA 3THPA 1H3DA 1T05A 1DLOB 4FBTA 1FHTA 5HMXA 3MCSA 1Q4RA 3F44A 4J5OA 1HI1A 2QA4G 1KTVA 1EETB 1GX5A 4MTPA 3NGKA 4LT6A 5LSOA 3WC0A 3HVAA 2LECA 2M8DB 1F0XA 1ZZFA 4Y2AA 4ETZA 4ED3A 5IQ6A 3OR2A 3N9UC 3GR1A 4DFJA 3CC2S 2F8HA 4DR3F 4OX7A 4NL5A 1VQOS 3MD1A 3P96A 2ALZA 4B9TA 3LALA 3KHRA 2OKQA 3BF4A 1KOOA 3DN9A 1A6LA 4LUBA 2KXFA 1HMVA 3I5BA 2NS1B 2ROPA 2LKZA 5K8OA 2FVQA 3D0GE 1FDNA 1FTRA 3KLGA 1DTTB 5J2QB 4JV5F 1JLCB 2WBMA 2YKMA 4TXSA 2ZH5A 2GO9A 2V8VA 3MOZA 5C24B 3IN5A 4BS2A 5I3UB 3NAHA 2WBRA 1NJZA 3MR3A 2J9EA 4LVNP 5KFHA 1UA1A 3MPWA 4DS5A 4I64A 2MGZB 2HFOA 2DNOA 3I96A 3NKYA 4RW4B 1E6YA 2XG8A 3SEOA 5KFFA 1RTDA 3FDSA 3H2VE 1JLAA 4CCHA 3CJ4A 2IVYA 1UJ4A 1S10A 1FXLA 5BYSA 1MMLA 2DGOA 4TKTA 2QSWA 2IM2A 3AQPA 4OHWA 2R4FA 3R1HA 2NLWA 3GSDA 3KJVA 2QA1A 2RILA 4NLWA 3PW4A 1FRMA 1JLGA 2CQ1A 2R2RA 3BSOA 2COLA 3EGWB 2AD9A 4CO4A 4A48A 1N5YB 1S9GB 1DURA 4DSKA 1TKXB 4KKOA 1E6VB 1ZM3A 4ID5B 4F4KA 2CRLA 2EFGA 3BSNA 5GADI 5LSRA 1RJJA 2L9NA 1XR5A 2J0WA 2ZOGA 2JWNA 2V8DA 3CO9A 5EWFA 4KSEB 5EX0A 2G0CA 3UDLA 4QR0A 4WU2A 1RT4A 2KFZA 3MR2A 1VRUB 3M6WA 3UCUP 3U02A 4C9DA 1DTQB 1S6UA 1X9SA 1HA1A 1F5BA 2JZ5A 2R8HA 2MB0B 1D1UA 2J76E 3BGUA 4PG4A 1SH0A 2FHKA 3I9V9 4QIGA 4OI0A 3PDNA 1C0UB 1AXQA 3DDNA 5CZVA 3R3TA 1YHQS 2N7YA 2WOMB 3DLKB 2OPQA 5K14A 5CCLA 2Q43A 1B7FA 4NA2A 2MQPA 3FFIB 2CQ4A 5KFEA 2OD6A 1WF0A 2RF2A 3DHXA 4MK7A 1ELOA 4F50A 2RMLA 2POKA 3MI7X 4ZPBA 3MUTP 1Q78A 3CE8A 5L9NA 2ZFHA 1LWFB 1X5SA 2JEGA 1NK0A 1W2IA 2HNDA 4I7FA 4DS4A 2YNGA 4BC7A 4TNOA 3R27A 4KHMA 1RT2B 2B6AB 2E7WA 1FDDA 2IMOA 4CNYA 3LP2B 1TKDA 1J5OA 2AJ1A 3T1AA 4IYQA 3KLHB 2CQDA 4TYBA 4NWBA 1TKZA 2W25A 4WXWA 5KFYA 2F3JA 1Q8IA 3MWBA 4J9LA 4YDXA 2C28A 3JYTA 2JX2A 4G3IA 3IRXA 1S6QB 1MWZA 3GWCA 5GAEI 1M5OC 3DU5A 2L48A 2WSCC 3QJJA 4CO0A 1U25A 5T7LB 4RNMA 4J9MA 4RW7A 3KLVA 1NB7A 3OR1B 2HHQA 1QUVA 2ZITA 1HR0F 3AQOA 4G1QA 2FC8A 2GMLA 1KOHA 4DL3A 5HBMB 3FRZA 4YR0A 2RKIA 4O44A 1S0VA 4PG5A 4QW9A 3I5AA 2KHCA 1X9MA 1RA7A 4ZLPA 1Y7PA 2EI5A 4EBDA 4B9VA 4LSNA 2CPJA 2F9JA 3MEGB 4RBTA 1BQNA 5E7OB 1SJQA 3CCRS 4CNZA 2GFFA 1MSWD 5KT7A 4DEZA 1M0SA 3T5HA 1F5CA 2M88A 1K8AT 4PWDA 1KHWA 5A0YB 5HN0A 2GIRA 1IQTA 2DGQA 1D9FA 1X0PA 4CTAA 3V6DB 1MU2B 4URQU 5GAGI 1FNOA 3PJXA 4B3OB 2W9BA 1X4CA 5M2RA 3KNGA 5KAKA 1UMJA 2FJEB 3KLFB 3IR7B 3V6JA 2MQLA 2ASLA 3DMJA 4ZHRB 4J9QA 1ZAXA 3CDEA 1REVA 2PC6A 2VG7B 1N5SA 1P9QC 3UR0A 2MKIA 1NK5A 1VQLS 4JV2A 2YNIB 1QLNA 3TVYA 3I6PA 3CJKA 3IG1B 4EFAC 3IFEA 2B3TB 4LQ9A 3SDEB 2D3OR 3NMRA 1P8GA 2DBBA 2YX7A 2YY3A 5KTQA 1RTJA 3THTA 1UA0A 1JJ4A 4DR6F 4NLUA 2X1AA 4ZKAA 3KOAA 3HHDA 3I0SA 3CCJS 2EPIA 5E33A 2E5LF 2DVIA 4Q5VA 2PEHA 3PV8A 4A8KA 3T9ZA 3K5PA 1FK9B 3I9ZA 2JC1A 1QSLA 1G2EA 4C8LA 4PG8A 5EWEA 1R0AB 1FRLA 1HBOB 2IJFA 2LQ5A 3CCES 3BJYA 4R5PA 1WEZA 2WK4A 1VQSA 2M5YA 1O51A 4XDDA 4Y65A 3BR8A 1VQPS 1M90T 1FJCA 4OZ5A 1N5QA 2LMIA 4NYPA 1U49A 4FVMA 2G9OA 3VZHA 3TQ1A 3HMJG 3QPIA 5M2UA 3AA8A 3VAIA 3Q8RB 4B9MA 1IKXB 5F8JA 2J6UA 3VQSA 4R0JA 4B9LA 3AJ2A 3CCZA 4E98A 4WFNQ 5L1KA 3BREA 3I87A 3KKFA 3JSMA 2P6TA 2DGXA 4FXDA 1JLBB 2YKOA 4PR6A 3MMBA 1FXDA 2DHAA 2V0NA 4H4OA 3OJUA 4X65F 1S6PB 1UVKA 2PSZA 2F8MA 3ZZUA 2OMOA 4F3QA 1S97A 2O66A 4WK1A 1KLMA 1KTQA 6FD1A 1Q8LA 1Y9OA 2KHDA 2MJUA 4RWWA 2FHMA 2M70A 4X4PA 2WCXA 2MKKA 2NREA 3VTIA 3A8EA 4IOCQ 3NWGA 2XY6A 3HHEA 3E8OA 2FC9A 5E2QA 1RYSA 2K1RA 1IJEB 1HBMA 2LQJA 3E3XA 4RW6A 4Q7AA 1HWIA 2KT5A 4A8QA 1HI0P 1DLOA 3UPFA 1VQ9S 2CZ4A 1R43A 2J5AA 5THWA 1FJGF 1EETA 1UJ5A 2HLTA 2F9DA 1VK8A 1U8SA 3OXFA 3J81Y 4Q43A 4C11B 1ZPVA 2R7OA 5F8LA 2B4OA 1XMOF 2XGQA 3PRBA 4Y34A 2KKHA 3DLBA 4KRWA 2R7UA 2I9SA 2J9CA 3Q2SC 4DFKA 4K59A 3IAS9 2W7PA 2ZJRQ 1UJ6A 1X4DA 4RWXA 2BOPA 1DTTA 5J2QA 2O1PA