1P1TA

Nmr structure of the n-terminal rrm domain of cleavage stimulation factor 64 kda subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
DPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cleavage stimulation factor, 64 kDa subunit
publication title Recognition of GU-rich polyadenylation regulatory elements by human CstF-64 protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1p1tA00
1HA1A 4TLQA 4LJMA 1X4EA 3UCGA 3VAHA 1KC8T 2DO0A 3CPWR 1WEXA 1X5OA 3NS6A 2E5GA 2DNHA 3SXLA 3SDEA 4Y00A 2I38A 4LIRA 2KXNB 2LMIA 3I55S 1A7GE 3CCSS 2DISA 2XS5A 1FO1A 2EK1A 3IWNC 2SXLA 5D77A 2LEAA 1X4GA 2M7SA 3P3DA 2KN4A 2M9KA 4WKRA 1M5KC 2XSFA 2ADCA 3P49B 2YH0A 1VBXA 1FJ7A 3G4SS 3VAMA 2G0CA 2DGQA 1UW4A 1QM9A 1VQPS 3UD4P 4YUDA 2DNMA 1VQKS 2MQOA 1VQMS 2QEXS 2OTLS 1L3KA 2CPFA 2MZRA 1U2FA 3SMZA 2X1GA 5H1SV 5DDQC 3ZZZA 3H2VE 2DNPA 4C7QA 2U1AA 3UCUP 2KRRA 4W90B 2CQ1A 4PR6A 2BZ2A 2CQHA 4CIOA 5D78A 4IOCQ 1YHQS 1X4CA 1YI2S 3FEYB 5BJRA 1YJ9S 2KHCA 2RVJA 5DM6Q 1VQOS 3RW6A 3CC2S 4TU8A 3V4MA 2X1BA 1WEZA 2QFJA 2XNQA 2MYFA 5CXTA 2XB2D 3B4DA 1DZ5A 2MJNA 2DITA 4PRFA 2LYVA 4J5OA 2DNLA 4OZ1A 2FPHX 2LA4A 2M0GB 1VC6A 1CVJA 5LXYA 2E44A 3LPYA 3MUVP 2X1AA 4M5DB 1M5VC 2CPXA 5DETA 2VOOA 2N3OA 2HYIB 3CXCR 3MUMP 2MPUA 1NO8A 3J7ZT 2VONA 3CCRS 2LCWA 1FJEB 2BOPA 2MHNA 1R8HA 3G71S 1U1KA 2KRBA 3LQVA 4BS2A 3U1MA 3K0JA 2O3DA 4YB1P 1M5PC 1X5SA 2RT3A 2AD9A 5CA5A 2MKKA 2CQ0A 3S01A 2UP1A 5GVQA 5IM0B 4ZKAA 5IFMA 1YTYA 1H6KX 1Q7YT 3VAKA 1DRZA 1X4FA 3CULA 1KD1T 3G8TA 3CCUS 1WG1A 2J76E 3ULHA 2JX2A 3JB9k 1U1NA 2B0GA 2MJUA 4ED5A 1WELA 1N54B 1YITS 3P5TL 2E5HA 2KXFA 4FXWA 2MSSA 4IOAQ 1D9AA 2CQIA 3VF0B 5LJ5Y 2LA6A 2DIVA 2JVOA 3N9UC 2DK2A 2LXUA 2PE8A 3TP2A 1OIAA 4TU7A 2MQMA 2F9DA 3CCJS 2YTCA 3MXHP 2L41A 2CPZA 3ZZYA 4F25A 4C0OC 5CYJA 1X5PA 2XNRA 2AYEA 1YWXA 1VBYA 2KG0A 2CJKA 3OW2R 2MQQA 1WTBA 3CCES 2YWKA 3TO8A 2VOPA 1P27B 2MKJA 5LXRA 2ZJRQ 1QVGR 2M2BA 1K73T 3BO3A 2RRBA 2HGMA 5EN1A 2DNNA 1S79A 2XS2A 2J0SD 2DH9A 2VODA 4UQTA 4QPTA 2U2FA 2ZJQQ 1O0PA 2YKAA 2KM8C 1UP1A 1JJ2R 1WHYA 3DXBA 2EK6A 3VALA 1P1TA 5GAGU 3UD3P 2F3JA 1SXLA 2A3JA 1U1MA 2WBRA 1VBZA 2HZCA 2DGXA 3MOJB 1K9MT 1FT8A 3U1LA 2DNZA 5FJ4A 1SJFA 4WFBQ 1W2BR 4QQBA 2CPHA 1OPIA 1KOOA 2DO4A 1X5TA 2LKZA 1PO6A 1WWHA 2M4MA 5JVGQ 2DNGA 2XS7A 3Q2TC 3CMAS 3G8SA 4LMZA 5LSOA 1HD0A 2DNKA 5ITHA 1YJWS 2MQPA 5HL7Q 1Q81T 5GAHU 2OJ3A 1URNA 2MZTA 2ZJPQ 4PKDB 3G9CA 3J7YU 1BY9A 1U1PA 3MD3A 2OIHA 2MMYA 2DIUA 1PGZA 2JWNA 2QA4S 2MSTA 3CUNA 2FY1A 1WHWA 3NNAA 2GO9A 2MKIA 4F26A 2MGZB 3MURP 1WF2A 3BS9A 2HGLA 3L3CA 1H2UX 3DLLQ 2OTJS 2RS2A 2MKSA 2MZJA 1SJ4P 1K8AT 3S6EA 3VAJA 4F02A 2DNYA 4IO9Q 2G4BA 2NZ4A 2HVZA 2KT5A 1U1QA 1WHVA 4UY8T 3UE2A 3US5A 3R1HA 1VQ7S 2N82B 2LQ5A 5HO4A 3Q2SC 1QVFR 2CPJA 1U6BA 3MI7X 1RK8A 2MY8A 5IM0A 3S7RA 2M52A 1RKJA 4C4WA 1VQ6S 2RS8A 1VQ5S 3CMES 3PIPQ 2FC8A 3G6ES 2L9WA 2FC9A 3R1LA 2RRAA 4WF9Q 1WI6A 4YOEA 1YJNS 1Q82T 3R27A 1UFWA 2LEBA 3CD6S 4FXVA 2MZSA 1JJHA 3S8SA 3CCLS 2F9JA 1OWXA 2OSQA 2M70A 1N88A 3B4MA 2DHAA 1N8RT 2MKCA 2L08A 1H2VZ 2DNOA 3UCZP 3SDEB 3THTA 1HL6A 1IQTA 1D8ZA 3NNHA 3H2UB 1N52B 4WFAQ 2MQNA 3CC4S 2D3OR 2AYMA 1G2EA 3HI9A 1R8PA 2K8GA 2DNRA 2FHOB 4WFNQ 1SJ3P 5DDRC 3HHNB 2RQCA 3EX7B 4EGLA 4QU6A 2CQ2A 4Y0FA 3BO2A 1WF1A 2N7CA 1OO0B 2ERRA 2CQPA 4CQ1A 2DGWA 1KQSR 4CH1A 3VAFA 2DNQA 1ZZNA 3VAIA 1NJIT 3RW7A 2CPDA 3CC7S 5DDOC 2KU7A 1UAWA 2MY7A 1WEYA 4P6QA 2YH1A 1FNXH 1U1LA 1FJCA 1SJQA 4TU9A 2G1DA 1Q86T 2DB1A 1S72S 3P6YC 2HGNA 3NMRA 1JJ4A 3EGZA 2ADBA 2KYXA 1U6FA 1AUDA 3CCQS 1HD1A 1H2TZ 2DGUA 2KVIA 1FHTA 2KG1A 2KM8B 1M5OC 2CPYA 1WG5A 3D2WA 2KXHA 2RUGA 2RNEA 3THPA 2MB0B 4QU7A 2CQ4A 2DHGA 2OSRA 1M90T 2Q79A 5MLCV 3PIOQ 3I56S 2M8HA 5JVHQ 2MKHA 1FXLA 1U1RA 1B7FA 1X0FA 1VC0A 3CTRA 2M8DB 2LECA 2KFYA 4ERDA 2NLWA 5DM7Q 1DBDA 1VQ8S 4U67Q 2RU3A 4OZ0A 5LJ3Y 1X4BA 2PEHA 2KH9A 3NNCA 2CQDA 1F9FA 1U1OA 2LXIA 3VAGA 4WIIA 1KOHA 4WCEQ 3MD1A 2CQ3A 2CPIA 3CCMS 2CQCA 2MGZA 2MZ1A 2E5JA 5GAEU 2DGSA 2D9OA 1VQLS 5GADU 2J8AA 2MXYA 3G96A 3IRWP 5IQQA 1M1KT 1A9NB 3EGNA 1VC5A 2DGTA 2DHXA 2EVZA 4V19X 1X4HA 1JMTA 2RQ4A 3FEXB 1X4DA 2DH8A 2E5IA 1NU4A 2JVRA 2N3LA 2V94A 5DDPC 1X4AA 2KI2A 2AYGA 2MZQA 4A8XA 2D9PA 2CPEA 1WHXA 2JRSA 1ZZFA 2K3KA 2DH7A 1VQ4S 5GMKa 2AYBA 2J0QD 2X1FA 3CF5Q 1VQ9S 2DHSA 3BO4A 3UWTA 2DGOA 2CQBA 4RU2A 3MUTP 4W92B 3BEGB 3TYTA 4Z2XA 2MQLA 4CH0S 1YIJS 2I2YA 4IUFA 3MDFA 1XN9A 2GHPA 3NS5A 5LSLA 3CCVS 1DHMA 1WI8A 1WG4A 2M88A 2DGVA 1WF0A 1ZH5A 2CQGA 1VQNS 1SJRA
chains in the Genus database with same CATH superfamily
3GIMA 2H5EA 3IR6B 2W4PA 3L7OA 4NXNF 1LW2B 1DTTA 3HHLC 4Q7AA 1FERA 4MFBA 1M5KC 3BGOP 3EXCX 5F9LA 4B3SJ 1UW4A 5L38A 1HNZJ 2QSWA 3RGIA 4CLKA 2IM1A 4ZIVA 3PJ9A 4DQIA 2P5VA 3FVYA 1HI0P 1Q8LA 3MM9A 3W62A 5I3UB 1AT1B 2HHHF 4JI3J 3DRRA 1GT8A 1X4CA 1Y5LB 4DG1B 3EJMA 5K5MA 3V4MA 2F4VJ 2JFDA 2AMCB 1T8EA 4OZ1A 2M0GB 3CNQP 5DZ6A 3DRPA 2J6SA 3MUVP 4I6WA 3HFVA 2LCWA 4ETZA 1KNZA 3OTEA 3M2RB 5ETSA 2KRBA 5J1EA 1T9UA 2XMWA 2O3DA 4YB1P 4ED1A 2FJWA 2B3TB 2G2ZA 1FESA 4X65F 3TEHB 2ZM6F 2HS4A 2IJRA 3BYRA 3GP9A 4NX9A 4B3MF 2AHOB 4RR5A 3X1LB 1C4CA 4EO6A 4KE5A 3W65A 5EWEA 5KT4A 4A8WA 4DUZJ 3IS9B 4WZMA 1V6HA 3LWMA 1OIAA 1HYSB 3KLGA 1S4EA 2CPZA 1N5QA 2R2TA 2Q6CA 2C28A 3C66A 2W9AA 1TELA 3OW2R 4I67A 4F3QA 4FS1A 2IM2A 4KSEB 1QSLA 3HMJG 2R7RA 2DNNA 2XS2A 3POTB 1UZHA 1U49A 3AJDA 2YKAA 3M6VA 1TK8A 3BKUA 4DLEA 4O3OA 1R0BG 1SXLA 3LGNA 4I6AA 4CO0A 1YJUA 4FP9A 1MW7A 1OY6A 3MMJA 1HBOB 3PW7A 5KFMA 4OYMA 1KQKA 1HD0A 1GH8A 4GRSA 3P8BB 5DLFA 1F60B 2WVCA 2AJ4A 2CJYB 2W7AA 2WRMA 2YPYA 2ZJPQ 1Q5VA 1MU2B 2O5DA 2A6MA 2PN6A 2BM1A 1JX4A 2B4OA 1TTHB 5I4MA 3DU5A 3DLLQ 2JC0A 3DM2B 1WDDA 1BC6A 1QJHA 2EFGA 1YZ6A 3PO4A 1XJWB 4AL6A 1KBRA 4I1TA 2HQFA 2FVQA 3DGPA 3VR1A 3RR7A 1VRUB 2FC8A 5E3CA 1NZ8A 3TRGA 3CD6S 3F41A 4FXVA 2MZSA 4FXDA 5L9XA 5KFOA 1SKUB 2L08A 4X66J 1KTVA 1UFKA 3THTA 1RAJA 4LSLA 5HP1B 4QWAA 2HRUA 3CC4S 2IJNA 4WP3A 2XSJB 4DR4J 5CD4H 2F8EX 3J81Y 2JEIA 3D3BJ 1T3NA 1SJ3P 3OVBA 4CO5A 5L1LA 4OI0A 4OZ5A 5HROB 4Y0FA 2FJDB 4FBUA 4YB7A 4CQ1A 3H4BA 1RB0A 3CC7S 1URRA 1HNVA 4I0WA 4RBUA 2YH1A 4FS2A 1RCXB 4LF7J 1JJ4A 2V8HA 2ADBA 4G1IA 1IBLF 1SC1B 2AX1A 1W2IA 2P6SA 4NWBA 4DX5A 4KV8B 1TFWA 3QRQA 4DQSA 1T9XA 1WDTA 1TMJA 5L8RC 3D2WA 1UEVA 3KLVA 4B9LA 3W1YC 2WZ1A 4RU9A 4C97A 3A8JA 2BJEA 5KOWA 2MLZA 5L39A 3LP1A 4U95A 2CQDA 1F9FA 4FKYA 5K8MA 3VAGA 4MK7A 1B70B 2ZDPA 2EC0A 3TUJC 1H7WA 3CDWA 1JKHA 4LIWA 1HBMA 5CYMA 3PNIA 1BD6A 5GAEU 4OX9J 3Q8YA 3H59A 3E01A 4M5KA 1HMVA 1JXEA 4NLTA 5IQQA 2QLFB 2IBOA 1FK9A 3MAQA 1UZDA 1CJTB 2RQ4A 2XWYA 1DLOA 2D3O1 3SQOP 2UXDF 2JDJA 3OFEA 3W9HA 3FBFA 3SV3A 3NXZA 1ZM2A 2R8IA 1S5ZA 1BQMB 4XK8C 1HHSA 1WI8A 3VZHA 3HVTA 4N76A 1IVZA 2OPQA 2HBRB 5H9FJ 2VD3A 4DUYF 4FF4A 3PDNA 2RRNA 2GIQA 3R6GB 3CWJA 5K14A 2LEAA 1X4GA 2PEBA 2ASJA 1JNZB 5AJ3F 4JI1J 2XBPA 1FRXA 2HIQA 3OTBA 5AXLA 3OQ2A 5E2QA 5HK4A 4DN0A 3SMZA 3K57A 3C19A 5IT0A 4B9VA 2U1AA 1CC7A 1RTJA 2AT1B 4ANCA 4EYHB 4RW9B 4BWJA 5GMEA 1TL7B 2F65A 3AH6A 5CH7B 4JI0F 1XIQA 4HL9A 3V6DA 4DPXA 1LWEB 1M5VC 3AA9A 1IKYA 3KKFA 4Y6IA 1FRKA 1EKSA 1Q4RA 1U1KA 3NWGA 3BDEA 1XERA 4YFUA 5ETVA 2HRYA 3R6LB 4ZHRA 3T1HJ 2BE2A 1WSVA 5I3QA 3CCUS 1U1NA 5KFEA 1QSYA 4X62F 3KLGB 1IBMJ 4IFVB 2YKPA 2D3ZA 3ZZPA 2J9DE 2LXUA 3Q89A 2VFUA 1LWXA 3LGMA 4KBIA 4JOUA 1SL0A 1PJ6A 2AYEA 2Q1LA 4ZN1A 1MN7A 5LMNF 4DS4A 3KHRA 4Y2KA 2RRBA 4RBTA 5MAOA 4YDXA 2CNLB 1HI8A 1YK9A 3N28A 3VALA 3AJ1A 3MOJB 2EBEA 1HQ2A 3LTOA 3IAM9 3I0SB 4U6PA 1GEHA 4LR7A 1FE4A 1PSDA 1O6XA 5JVGQ 5LSOA 2MQPA 3DDKA 3CGIA 2L9NA 1HHQA 1NHVA 1S99A 2CVIA 4C8YA 3MD3A 2AW0A 4H4OA 2C42A 2YKOA 2C2OB 4IG3B 3EZOA 2I5JA 4DV2F 3FZ2A 2E7WA 2RS2A 2VBWA 3PG9A 2OPRA 1IKVA 5J2NB 3S6EA 2IMOA 3ILIA 3PXGa 3DMJB 1MWZA 1B3TA 2OI2A 1DQ9A 2HVZA 1QSSA 3US5A 2WSCC 4DPUA 4XPCA 5GMDA 4YP3A 2HHHJ 2Y0SD 1P1LA 2YKQA 1GAOA 4C3LA 1NBEB 1X9MA 2L9WA 3D0IE 2QSFA 1WI6A 2HEKA 5G0RB 1S9FA 1B0TA 4IR9A 3CCLS 1N88A 5FIIA 2UUAJ 2ATLA 4LUBA 2CYYA 2UVRA 2POKA 2FHOB 4OLPA 3RU0A 4X65J 1HNVB 4K4VA 3VQTA 3GLJA 2ZM6J 1WF1A 2B6AB 3LUYA 4EK2A 5IV4A 1SJQA 3SCIE 1D0EA 1S59A 3IM8A 1KVIA 3TAMB 2GAHC 2XYPB 3PFOA 4F4YA 4HKQA 4KHMA 3T6BA 2WVEA 2UU9F 1MMLA 1KEKA 1EX8A 1K47A 4K5SA 2GNKA 3MAHA 3G6XA 5F8JA 1JKHB 3KJQB 4Q0BA 1HBMB 1XR7A 3MCSA 4B3TJ 3ZZOA 5A8WB 4V19J 3PKYA 4PXCA 4R8UA 3RBDA 1BMQB 3HP6A 1UEUA 1FK9B 3DDIA 4C3MA 2IRXA 1DLOB 2C3PA 2DGSA 4DF4A 2B7BB 5A8KB 4XPEA 3IRWP 2HNDA 4R5PB 2FHMA 2ZH3A 5A8RB 3R5BA 4A8QA 1OJ4A 2KI2A 2AYGA 5D6GA 3I87A 3HHLD 4NLOA 3SCKE 1NKCA 1U2CA 1R89A 3GZ7A 2DBBA 3HSZA 3GIKA 1TU0B 2QGFB 4A8KA 4Y2MA 5K14B 2YWHA 2ZITA 4PXEA 3NS6A 2J6UA 1JLCB 4LIRA 2DEIA 2OAUA 2BYCA 2OPPA 2YH0A 3TX8A 5D0HA 2DNMA 3MR5A 4UOCA 3DDNA 1Y5IB 4UQGA 1RADB 4ECTA 4YEAA 4U7UD 2QN6B 3M1VA 3QIPA 4DSJA 1CPZA 4Q8EA 4GMKA 5IC4B 4ECYA 1T95A 2AZ3A 3O3LA 4RO0A 4A46A 1YBUA 2XB2D 2DITA 3OXFA 2VC1A 1VK3A 2E44A 3MMBA 2BJ9A 3OXGA 1TFYA 2R8KA 3ELHA 3HM9A 3VVUA 2A2DA 4G1QA 4ZHRB 2BE2B 2YKMB 1RT2B 1IWGA 3LH2S 3K0JA 2HNZA 1V3ZA 2J9EA 1RBAA 3HVWA 3BSAA 4O3QA 4F2RA 1SL1A 1U09A 2W2QP 3S01A 1IBLJ 1FF2A 1YTYA 4ICLB 4DSKA 4W98A 3DI6A 2VQEJ 1UL3A 5FLXU 3VWSA 3CJ2A 1IWAA 1U8WA 3LO3A 2BE9B 1NCLA 4ZLNA 2FLLA 4NRTA 4ATNA 3VQSA 2D7SA 4OV1A 1J5EJ 2FZKB 2IAJA 3HO1A 1HLWA 2VIHA 2XZTB 3DRSA 5HQLA 4B3RJ 4J91A 3FBBA 1F9HA 2V50A 2ZKTA 2K1RB 2PA3A 2J8SA 3U1LA 2UXDJ 4N8NA 1TP7A 1RGVA 2HNYA 1CEZA 3CJSA 2DO4A 4U8VA 1FKPA 3AQOA 1KHVA 2DXFA 4DSEA 1YJWS 1JLEB 1T05A 3HKZD 1ZETA 2H54B 2YNIA 3HPOA 1NK0A 5D0GA 3RB6A 3TUZC 4DLGA 2YNGA 3R9LA 3T9NA 4AYBD 4CLPA 3MURP 3JTNA 3Q8VA 3UW1A 3NWRA 2ZHAA 1KWMA 5KFGA 4DV1F 3T5JA 4C8OA 2IMWP 4DV7F 1PYOB 4LBIA 4K5RA 3EVMA 5KG5A 2N82B 1AZSB 4NLXA 2CPJA 4NL5A 4DEZA 4C4WA 4UZCA 3ZTSA 4CM2A 4CCHA 2VV5A 5EDWA 2HIYA 3C6TA 2NXNA 4JI0J 4JYAF 1FFSB 3BQ2A 1TKXA 1T7PA 4DZDA 1U4BA 2XLJA 3Q8QB 2ZHBA 3RYLA 2LVWA 2Y1RI 4A8FA 5SZTA 3ZZTA 1S0NA 4DQPA 1VFJA 4RW7A 1GMUA 3IO1A 4LSNA 3RW7A 3CIZA 4OI4A 2D74B 4DF8A 1RJJA 2DXDA 4TU9A 2G1DA 4AFFA 3H2LA 2XLKA 2ZOFA 1CLFA 4M94A 4ZITA 3CVKA 4ED7A 1PAEX 5GAGI 2H51B 4XAKA 4Q0BB 2GVZA 3H98A 3QZ8A 1R7IA 2KL8A 4QWDA 1WOPA 3IMQJ 5MLCV 3WIVA 4KPYA 3FQLA 3CCTA 1X0FA 3CTRA 1HBUB 1JLAA 1NJXA 1F5AA 4ERDA 5LMNJ 3C2PA 1RDRA 4CZCA 4OZ0A 2HBYB 4K4SA 1B64A 1S4FA 1TL1A 3TWZA 3JSYA 2XGQA 1CJKA 4EMDA 2WW4A 4Z37A 1KFDA 1L3UA 2AQ4A 1VQLS 2HFSA 3KUGA 5GADU 3TA2A 4M5LA 3MFIA 3KMQA 5A2QY 2JVRA 2B4PA 1LW0A 4QJVA 2CPEA 4LREA 5KFUA 4DFJA 1CULB 3UWTA 4CP5A 2A2CA 3W5ZA 2PGCA 3BGLA 2W4DA 1RABB 3ITHA 4DV2J 3OVSA 1HA1A 2EFOA 4GKKJ 1A6LA 3T9ZA 2VFVA 4LF9J 3GYGA 2R8JA 1RAIB 5F8MA 4Y2AA 2XSFA 2IM3A 3QGPA 3UVJA 1QY7A 3QIPB 2ROEA 1UMJA 1U2FA 2RSQA 2QMWA 3H2VE 1S9EB 3GR0A 4M1KA 4DV4F 2VUGA 1RT7B 4CIOA 1X60A 3MMBB 3CIMA 4OL8A 1VQOS 4B02A 3M8QB 4LRCA 2HFZA 1U26A 2NPFA 3B4DA 3K5PA 4LSZB 3MMAA 5HI7A 3DC2A 1RU1A 2MPUA 5EWGA 5KFWA 4WFYA 2V34A 1LXJA 2B8PA 1FD2A 3QIDA 1Q95G 2W2NP 1T3OA 5HJXA 4KGZB 3VAKA 1X4FA 1KD1T 1FDDA 1PJ7A 4LVNP 3EWGA 3EZ5A 4NI2A 3G6YA 2KXFA 1B0VA 4DHVA 2IAJB 1KQGB 2XY7A 2LA6A 4JI8F 3MM6B 4IH6A 2BMBA 2RDDA 4CLSA 3D0GE 1UA0A 2ACMA 1YWXA 4NYPA 4OYBA 3CCES 1S0VA 4QWEA 1JLFA 5B0FA 3V6KA 2E1MC 2V68A 4J9KA 4JI5F 4DU8A 1DFDA 4KGVB 2DH9A 3R8YA 3IAS9 4OZLA 2HNYB 3T5LA 5C5JA 3FJ2A 3TUIC 4AT1B 1SJFA 1R8CA 1AW0A 3QATA 1HWJA 2BBEA 3EPGA 3MECB 4PG5A 2L3MA 3OTDA 2ZUAA 1BWEA 4NYZA 3KLEA 3SQGA 5GAHU 4C8MA 3G9CA 2ASDA 4PG7A 5BYQA 2E9ZA 3MR7A 3L9ZA 3PRVA 3L3CA 4QR0A 2VL1A 1WNEA 1RU2A 4USTA 4OHZA 3EMTA 3D68A 2NZ4A 4A8OA 3P45B 4NOHA 3TI0A 5HSPA 1QUVA 3FSIA 3MHYA 1RKJA 1VQ6S 1VRTB 1TKXB 1FRJA 3NRBA 5DG8A 2HAIA 2FYXA 1R6VA 4UZBA 3WC0A 4ED2A 2DHAA 1H2VZ 4DSLA 4X4TA 1IQTA 4YR3A 2K7JA 4IQMA 3O2IA 3FSYA 4RW8B 4ILRA 2AWZA 3HFKA 2DNRA 4GVLA 2J7KA 1VJQA 4EGLA 1IM4A 2NXJA 2UUCF 3BQ1A 5ETLA 5DJBA 2ZDOA 3BN4A 3PYGA 4OQJA 5ETOA 1CQMA 2W8LA 3IM9A 1BQXA 5F41A 2W9CB 4DN9A 3DHWC 2GAGC 1ZYQA 1QTNB 1JLAB 4YQWA 1HWUA 3DCAA 3W9IA 4DL5A 4NZ7A 1Z4UA 3FEZA 1TL1B 1U1RA 3PO5A 2M3DA 2HFUA 1Y9OA 1YJRA 4ZVSB 4OZ2A 1N6QA 3FFIA 2KH9A 3NNCA 2XMJA 1E6VB 2RAQA 2KVQE 2V2KA 4RKUC 4CNYA 3MD1A 4B9UA 1K44A 4RNMA 1KKHA 1IQZA 3PACA 5KFCA 1TK0A 3OXLA 3C15B 3CO9A 4KAIA 1GXUA 1P8GA 4O44A 4RNNA 3MCOA 2R2UA 1YBAA 2ZE2B 4V19X 1CSJA 1X4HA 4QWCA 3M2VA 2MHEA 1NU4A 2GS8A 4C11A 1UPPA 2MZQA 3ZNJ1 4I64A 4USMA 3ITHB 5B0DA 1VQ9S 2C22A 4NEYA 5T7LA 2DVIA 3WX8A 4K4WA 4Z2XA 4CH0S 3OTCA 5C24A 1VMBA 4Q2MA 2KJWA 3OHAA 4FBTA 4OIXA 4UUWA 1QD1A 3KLFA 4J9NA 3BF4A 4DV1J 1YG0A 5IS2A 3PRDA 1HW8A 2LMIA 4P10A 4EO8A 4CO2A 1HWLA 3M32A 3I32A 1VBXA 2ZBIA 4K0KF 3DFEA 2Q3PA 3IP0A 4DJBA 4UOHA 1L3KA 1T9YA 5T14A 2XZDB 2EXUA 3QZ7A 1XWLA 4JYAJ 3BB5A 4PEOA 1FTRA 1Y3JA 3MMAB 1NEEA 4ZVPB 2LP4A 2YX1A 4ZJLA 2QLJB 2X1BA 2V8DA 1YLXA 1H3DA 1NAQA 5LXYA 3OUYB 2IYGA 2L48A 1TMMA 2XTJP 4DL2A 1J2VA 3E51A 3KWMA 2BOPA 1FXRA 3LQVA 4U7CA 1S48A 3OJUA 4DR7F 1NH7A 2RT3A 5CA5A 1GMWA 4JV5J 2Z8QA 1H0HB 1ZTWA 3AOAA 3W66A 3O1LA 1Q7YT 3ULHA 4RNOA 5GAEI 3A8IA 5B09A 2FIUA 1KVKA 3ETOA 2H1YA 2LFVA 4KPCA 3T19A 1RAHB 3DYAA 2FHJA 3R2DJ 4TU7A 1HNIB 1P9YA 2IA6A 2L41A 3ZZYA 5K9FA 1F3FA 2XNRA 4OV6A 2KG0A 5KTQA 1FCAA 5J2PB 3Q22A 1GTEA 3CDEA 3MEDA 1MMNA 4GVBA 2NPIA 3CJ5A 3UFCX 4QIFA 4UQTA 2B5JB 4GC6A 1SUQB 3FK4A 5KFSA 2F3JA 1NK4A 2DGXA 1K9MT 5IQ6A 5I42A 3SQGB 3JSBA 1QE1B 1KOOA 2KJVA 1X5TA 4RZRA 2DNGA 3Q2TC 4P73A 3NGKA 3HZEA 4ID8A 1KN6A 4ECSA 2JJ4D 5D8HB 2QFIA 4A4JA 2KHDA 3C6UA 3ZO7A 2FY8A 1ZS6A 1S6PB 2GA7A 3HT0A 2HGLA 4MYUA 1H2UX 1KQFB 2ACYA 1WTFA 1UJ4A 2WB4A 2OH2A 2DR8A 4PUOA 1KTQA 4OHYA 2ZHOA 4DPTA 3LP2B 2LQJA 1P9QC 4AE5A 4UY8T 2VFRA 4ECRA 2LQ5A 1Y7PA 3Q2SC 4KGKA 4YMEA 4DV4J 4ZPTR 3OL8A 1VQ5S 3FMWA 3MCNA 3PIPQ 1TUWA 4WF9Q 3QSIA 3R27A 2LEBA 2IYIA 4D3GA 1JJHA 4IRKA 2Y1LB 2JEFA 4ZVOB 4C3KA 1RWUA 4I2PA 1XMQF 3K89A 3R5CA 2P9EA 3NKYA 1CJVB 1Y11A 4ZCLA 4C8ZA 4WFNQ 2ABYA 2CDRB 3HHNB 1X0PA 4TVAB 4EZ9A 2OKQA 3H0PA 3KJNB 3FKBA 2JHEA 1S12A 1HQEA 4CH1A 1VJWA 5DDOC 1GX5A 4OX7A 1R8AA 4KO0A 3BPDA 2AJ2A 2HGNA 3HDSA 5HBMA 1YRXA 4ZLJA 1RAFB 3CCQS 1T9VA 1BLUA 1MSWD 1B7YB 4A47A 2KXHA 1N6QB 1GXTA 1REVB 4Y3CA 1UFLA 1N48A 2KO1A 3IXQA 4JI5J 3TVKA 4C2MA 4WIIA 2VG5A 2OUGA 1FX4A 2R7UA 1SV5B 3JSMA 3KHGA 1H7XA 5U47A 2E5JA 3IBCB 5D4LA 1QUPA 3IR7B 1A9NB 2DGTA 1JWWA 1U47A 1FTCA 1WJ9A 3BR8A 4WJBA 4B17A 1WC0A 4C98A 2ILZA 4KH0B 1Q53A 5C24B 4O4GB 5HJYA 3RB4A 5GMKa 4DZ6A 2L9DA 3BO4A 4F3OA 2MQLA 1YIJS 2IC3B 2GQQA 5DQIA 3CCVS 3QGIA 1PYSB 1UW9A 2Z2ZA 1VOMA 3H90A 4YR0A 4E2FB 3DKDA 4TQSA 1UJ6A 4HHJA 2NYIA 3M4XA 2FJBB 4UOFA 1JLBB 4DL3A 2XMUA 2DTJA 1BUXA 3H42A 3D6MB 2BW7A 4RJVA 2Z2YB 2CDQA 2XHWA 2VG6B 2OTLS 2F8MA 3HJVA 3IA0A 4PZVA 5FDLA 2ZD1A 1D9DA 2MLXA 1JIHA 3IWLA 5D78A 3AB2B 3BGUA 3PJWA 2CZ4A 3NOCA 2WOMA 5CXTA 4PXBA 4DBQA 2XO7A 1N56A 5E3PA 1Y5NB 2HBZB 5KT5A 3DLKA 2BQ3A 2RQKA 3O6QA 1MN9A 1FJEB 3W63A 2HK3A 3NAHA 2VICA 3U1MA 1OY8A 5J2MB 3I4HX 2K7KA 3L4BC 4GO5X 2OEMA 4GC7A 3UPFA 1VISA 2GGPA 4ZKAA 7FD1A 3TA1A 3W2VB 4PWDA 2GVDA 2DR5A 4QYRA 2MJUA 2I1RA 2Z56B 3DYAB 4M8LA 2XY5A 3PW4A 1XMOF 4FXWA 4OI1A 2CQIA 1E6YA 2IVYA 2M5YA 3TP2A 2K2PA 1N33F 2F9DA 4J90A 5IWAF 4ZCKA 3BH7B 1BGXT 4CLZA 4GKJF 4NZ0A 3NMAA 2MQQA 1WTBA 3BR9A 4ZPDA 2MLYA 1RWKB 4R0JA 5B7WA 4UT4A 2QJ3A 2EKNA 1VBZA 5F3TA 3I9ZA 4QIVA 2XM3A 2RF2B 4RW6A 4OHVA 1IBKF 1ZPWX 3C6UB 2DR6A 1TK5A 4ZN3A 3RBEA 5ITHA 1XC9A 2VJUA 3N6LA 2E7XA 1NLKL 1S9GA 1S49A 2PFFB 4C8LA 1C0UA 2YKNA 2IRUA 3PW0A 2P9CA 2FUG9 2X3DA 1FKOA 1XNRJ 1RBOB 5KFVA 5DGAA 2MGZB 3CE8A 5HLFA 2F7VA 1N36F 3O8WA 3NBPB 4M5DA 1TKDA 2EKYA 4TQRA 3VAJA 4K0KJ 4K50A 4K7QA 1S6OA 3U1NA 3M6WA 2V63A 2QX0A 4JI6F 1RTDA 4FNIA 4HVZA 4F7VA 1TKTA 2H4WB 3M8RA 1C1BA 2MY8A 5IM0A 4Y2CA 3FGVA 3CMES 3AODA 3LGHA 4IH7A 2RRAA 4BC7A 2JZ5A 1TZ0A 1FDAA 1GTHA 3ILLA 3BZQA 1BE4A 4LQ3A 2DNOA 1PC4A 1C0TA 1N52B 2GMJA 1ZTTA 3ZNUA 4TNOA 2D3OR 1HQEB 3SEOA 3MEGB 2K8GA 3GONA 5HATA 4DR7J 3C16A 3MPUB 2O66A 2CQ2A 3V2UC 2ZBPA 4NLVA 5HBMB 4ANDA 3FCWA 2CWKA 3QO9A 1NJIT 3TJ9A 2KU7A 5KFNA 3M9MB 3MOZA 5IV3A 3M8ZA 3DGVA 1S1XB 3NGTA 4I7FA 4CI0B 3EGZA 1J27A 3PFEA 1AUDA 4QZVB 1TVRB 2KVIA 1FHTA 4QBUA 3RRGA 2XZWA 4J9OA 4UY85 3OBIA 3NEKA 2RNEA 2MB0B 1EP4A 1PG5B 2MKHA 1FXLA 1AUSL 3V4IB 1OYEA 2ZNZA 1BQNA 3QT8A 2VA3A 4KRWA 2V4JB 3P4UB 2J7WA 5HANA 1BXNA 8AT1B 2CPIA 3D3CJ 1RT1A 2D9OA 4WYWA 4RBVA 4G6VB 3PW5A 2MXYA 4IG0A 4P2MA 1S1UA 4MTPA 3HSDA 2BQUA 3MEEB 4HEA9 3RB3A 1X4AA 4LF1A 4MKVA 2GW8A 5ETRA 1VGYA 4X4NA 2OD6A 1NSKL 3MUTP 3BEGB 3TYTA 2ZH6A 5LSLA 3EPIA 1DHMA 2DGVA 1SIWB 4TLQA 4KB7A 5E3AA 4QW9A 4CYUB 2DNHA 4Y00A 1S6QB 2DCLA 2YNHA 2H9ZA 2DISA 2XS5A 3GFHA 2SXLA 5D77A 2FZGB 2OHDA 4KC5A 4WKRA 2CG4A 4WU3A 2ADCA 2ZD1B 3HKWA 3UD4P 3TQEA 2Q43A 1FDNA 2JSXA 4NLGA 5DLGA 3ENVA 1VK8A 5ETPA 2CJAA 5L1JA 2EG2A 4JUZA 1N32F 4DL6A 4IOCQ 1YHQS 4ECVA 4AQYF 1NSQA 4TU8A 1WC6A 2OLWA 1RT5A 3GILA 2I0XA 3ENWA 3AAWB 1NPPA 1B0PA 4LF8J 2V4QA 2CVEA 3FNNA 1ZM9A 4DCPB 4O3NA 3SBMA 4OJ3A 2LXFA 2NXEA 2YVSA 5LSRA 2GC8A 1V5IB 1Z1ZA 3G71S 4FF3A 4C6AA 4DL0C 4WZQA 2HRTA 2RHSB 4WFZA 4X4SA 2V2QA 5CABA 2Q6BA 3JB9k 1N54B 3CW2C 1YITS 4EWTA 1AA1B 5EUHA 5GADI 5CZXA 3RBXA 5A0YB 4IOAQ 3M2UA 5EGYA 1M1HA 1LV5A 3GYNA 3H25A 4OYAA 2DIVA 3N9UC 4E8UA 2MEWA 1HARA 3OFFA 2FJAB 3BBFA 1X5PA 4DMZA 4A48A 1ITPA 2VDIA 2AJ0A 4C0HA 1SKRA 2YWKA 1R0AA 5BR8F 2ZJRQ 3CSKA 4L75A 2YX4A 4ZVUB 2ZBQA 4JV1A 2ZJQQ 1NUEA 3DOLB 1N0UA 2KM8C 1TV6B 1Z2ZA 2OEKA 4CNZA 1F2HA 4RNFA 1L3SA 2CRLA 2CPHA 2YKNB 1CS4A 3HHLA 1FKOB 3NCPA 5H9FK 3VGVA 4AL5A 1NXIA 5HL7Q 3H7HB 1FNOA 2EC2A 4ZVQB 1IR0A 5HLFB 2RKIA 3EE3A 2DIUA 1NPRA 2QA4S 1V3SA 1SQFA 4GO7X 1EAYC 2FY1A 4F26A 3R5GA 5D4OA 1RTDB 3W2WA 1SJ4P 1RWVB 3QFHA 3HXMA 5E41A 2KZZA 2DNYA 3ET6A 2G4BA 2BJ3A 3MPVA 2J6TA 3CEDA 4X4RA 1AXQA 3NAIA 3I9V9 1HKAA 3OL6A 4WE1A 3H8YA 5J2QA 3P96A 4YOEA 1Q82T 2BACA 2BRKA 5B0AA 3KHHA 3B4MA 4F36A 2UXBF 4HTJA 2F63A 3IG1A 1HL6A 3A12A 1HBNB 3Q86A 2WONB 3HD2A 2AYMA 4ITSA 4DUTA 2GFFA 3KK3A 2RQCA 3T5KA 5CHCB 5D0RA 5HVFA 4I7FB 2FJEB 1YBTA 2QO3A 3TW0A 1GK8A 2DR9A 4ID5A 1OY9A 2HWHA 1UAWA 3B8HA 3M30B 3X3UA 1RTHA 2DB1A 3KG0A 3D5MA 2BVZA 2KYXA 1EP4B 4CH7A 1KVJA 1H2TZ 3J7AN 5CAAA 4TLRA 3ZC4A 2V8VA 4ECZA 3OPKA 2OSRA 2EFNA 2Q79A 3PIOQ 5JVHQ 2KB2A 4GKJJ 2RIJA 1B7FA 4NMXA 3DOMA 3PM9A 3N5FA 2P6TA 4X84A 5LJ3Y 1F3VA 4HDGA 3GWCA 2GCFA 1I94F 4IG0B 5GAHI 2CQ3A 4E0DA 4ZPVR 2B9YA 3DLEB 1V3RA 3MEKA 3KLIA 1IBKJ 1UVKA 1U0SA 4L76A 3QJLA 2EVZA 5E3QA 4JI2J 1VQSA 3WHIA 2CG8A 4CLWA 3N6NA 3BN7A 1F6TA 1JLGA 2DT9A 1KDNA 3GG1A 2HHVA 3MM5A 2X1FA 5C25B 1LKZA 2KTQA 2CQBA 4FNHA 2DR7A 4WKYA 2W7OA 2GJFA 4Y65A 4IUFA 2GHPA 4ECXA 2A18A 3HX9A 3RR8A 3AY0A 4PQUB 2UVUA 3GIRA 1P6TA 1ZH5A 4B3OA 1SJRA 4KFBA 4AUKA 3HF5A 2VHGA 1KC8T 2IPOB 3SDEA 1HQUA 2I38A 1CC8A 4M5HA 1FNMA 4YN3B 2R7TA 3C46A 2M9KA 5D3GB 3DHXA 3M6UA 2G0CA 3NCRA 3QRRA 3MM8A 1YZ7A 4YUDA 1FWKA 3H5SA 3JAMU 4NA1A 3HULA 1Y3KA 2MZRA 1CBKA 4DXLA 1T11A 1RT5B 3ADAC 1APSA 2Y1IA 2CQ1A 5KFXA 4PR6A 1VRQC 2R7SA 2CADA 4M5NA 5DM6Q 2RVJA 4YY3F 4OX8A 2B43A 1SJ1A 2BJ8A 3OT9A 3K8WA 3Q0AA 3D6HB 3LPYA 3AD8C 1ZM4A 2ZH5A 2N3OA 2RU9A 3CCRS 1D09B 4FPIA 2R4FA 2Y0BB 2ZC4A 1RYRA 2ZOGA 4DFMA 2CQ0A 4LFAJ 3KXDA 2HURA 2UV8A 4CT8A 2E5LF 1TUGB 4F0MA 4CO1A 3NL0A 4FYVB 4ZP7A 2IM0A 4C48A 4O4RA 3IRXB 4LFCF 3EYZA 1ZA1B 3LP0B 5DRKA 3JTOA 4WFXA 2UV8G 3QLHA 3UNGC 2YTCA 4BLGA 4Q5VA 4F50A 3RAQA 4DWIA 2IBKA 5CYJA 1WC3A 3CD5A 3DNCA 5KOXA 1Q7LB 1RLCL 1K1SA 2LDYA 2MKJA 1QVGR 3BO3A 1RTIB 5BYRA 2KZMA 3KDNA 1S1VA 4C8KA 2WK4A 2HWTA 4DFKA 2VG7A 4MK9A 2JNJA 3DXBA 2AEFA 1U1MA 2WBRA 3THVA 2XMKA 5FJ4A 1CS4B 3HHLB 2V5HG 1XBWA 3MWBA 1LXNA 1OQ3A 1S6UA 4J9QA 3CDAA 4RWXA 3UI3A 4ED3A 3Q8PB 2PD1A 4DV6J 4UUXA 4ZP8A 2ZBCA 3AOBA 3HHKA 2ALYB 2RKIB 2M4MA 3DLBA 4WIQA 2VBZA 1XMBA 3J80Y 4H4MA 3G8SA 2DY9A 1NH8A 3KNAA 1FXDA 2I6WA 9RUBA 2QYCA 2CJQA 2BANA 3W2WB 5LT5A 2MSTA 4QYZK 2XYGB 2HVIA 3MCMA 3BS9A 3NCQA 1I1GA 3I31A 2MKSA 1VIXA 1IKWB 4IO9Q 3T3FA 1LK7A 4NA2A 1WHVA 4IFYB 5T41A 1OSDA 2RH3A 1L3TA 1GFWB 4OX6A 1WD6A 1N32J 1RK8A 5AE1A 3GPAA 5ETQA 2V4RA 3IG1B 5LM7E 1W7WA 1UFWA 1C1CB 5LL6d 4K8RA 2AP6A 3H20A 2VKRA 2JEJA 4U8YA 1D8ZA 4MJKA 1VLYA 3DLGA 1DTTB 2HLUA 4KR0B 4MFBB 4M5JA 2HFVA 5DDRC 4HHUA 3EX7B 2HVHA 2APOA 2O67A 4PPDA 4X4VA 3LWLA 4KIAA 4UF4A 1U8SA 3RTVA 3DLJA 1HI1A 1EETA 3MM9B 1ACMB 1EB0A 4RUAA 3I5AA 3DRRB 4ZVTB 3RJMB 3P5BP 2AU0A 1RT4A 2Z2LA 4K2XA 2RUGA 1LFPA 4L73A 4OJ1A 3DRPB 3I56S 3HT3A 4ZVFA 2V2VA 4XTTA 2AX0A 3PX6A 3VGUA 2RU3A 2WCXA 5BR8J 2AJFE 3EGWB 5IC6B 1RBLA 3PZPA 4WP8A 3ZFVA 5J1EB 2OPSA 4J9VA 3KYLA 1XK8A 5F8HA 1N4LA 4JP8A 3GFYA 1MG7A 4CTAA 4M5IA 2BABA 2V9WA 3G96A 4NXMF 3FEXB 1T9WA 1MROA 3L09A 2DYAA 4BHQA 1NMEB 4KFBB 3CF5Q 3TUPA 3RRHA 1HQUB 2Z58B 2BXJA 2A6OA 2ZH9A 2XCPA 4H54A 2M88A 2VC0A 4RWWA 2F4VF 2W9BA 1YVFA 1MNEA 4PWUA 1NK6A 3FBCA 2E5GA 4O23A 2GQCA 1KLMA 4RW4A 3MM8B 3P3DA 1EKRA 5AT1B 3A13A 1RAOA 3FUYA 2E1AA 2GJIA 3G4SS 4HR2A 3B54A 1VQPS 1NRKA 1HR0J 1FA0A 2FVCA 2E7VA 3M8PA 3OL9A 4O0IA 2X1GA 4Y34A 4MIWA 3TR5A 4X4UA 4Q43A 4MAKA 4MK8A 2KHCA 3GG0A 5RUBA 4JI7F 2C2NA 2MJNA 2H5IB 3S1TA 3UDLA 5DO2A 2WVBA 3ILOA 2HZAA 1RWWB 3ZTOA 2X1AA 4NXNJ 4TYAA 2RE1A 2C2KB 2VOOA 1RWXB 5F0UA 4G1PA 2NSCA 2ZKUA 2VBYA 4KYZA 1FKAF 1M5PC 5KFDA 2CZ9A 2B9WA 4ECQA 3A4TA 3WBZA 3DGPB 2VJVA 1F9EB 1DRZA 3CT9A 3CULA 5CYQA 1BHNA 1LWCA 3CMQA 1ZAVA 2E5HA 5B0BA 4WU2A 3BSCA 2HBQB 3CJ0A 2YNFA 2RMLA 4HACA 3KJVA 3VF0B 4DS5A 3CJ4A 3OR1A 5KT2A 1UWBA 2DK2A 4LSLB 2QC3A 2ALZA 4FYXB 5KFHA 3K58A 2W01A 1SC4B 2O01C 3GR1A 1C2PA 2VG7B 1NK8A 4N8OA 3Q8SB 1I6JA 1RWPB 2B51A 3N4WA 2CNNB 2JOQA 2HGMA 3GYXB 4EI2A 1TKZA 2HZCA 5KFYA 4B3MJ 3C3LA 5DG9A 2DNZA 3OR2A 4ED6A 4F4ZA 1Q78A 2OD4A 1UETA 5JUMA 2LKZA 3UR3C 2HHPA 2YWGA 5ADZA 1SB6A 4XDCA 3QRPA 3LP1B 3IGVA 5I3UA 2OFHX 1CJUA 5E7OB 4LRFA 4ZCMA 4LR8A 4DG1A 2HVEA 3DXSX 3TAQA 4F04B 3GSDA 2PIIA 1M1GA 2R9LA 1PAUB 1RAEB 2GO9A 5CYMB 4DR4F 3MR3A 3E01B 4EBCA 3KHLA 2R2SA 1HMVB 4J9RA 4DCOB 2K3IA 2YWWA 3FRYA 4P7TA 2RS8A 1NKBA 4PG8A 3G6ES 2FVPA 5F8IA 2EFPA 1KR4A 1G3OA 2M70A 1U6ZA 3HVTB 2OPQB 2DD8S 5EWFA 2VPWB 3NNHA 2BM0A 3ISND 1NJYA 2AV5A 4ZPWR 3K59A 2AIRB 1HYSA 1G2EA 3NGSA 3LW5C 4N41A 4ECWA 1H98A 2PDAA 1NB2A 3BO2A 2JL9A 4ZMMA 2N7CA 1EETB 4OX9F 2HFOA 1EHWA 3U27A 3ZTPA 2FVRA 1N5VA 2DNQA 4X64F 3D1OA 4I4BA 4P6QA 1OS5A 3POTA 1FE0A 1U1LA 4DV0F 1RT4B 4LFCJ 3G86A 2Z4PA 1RTJB 3HJFA 2XLIA 1UPMB 2VB6A 3CB4A 2FTRA 1HBOA 1M5OC 2CPYA 3ICLA 1Q0NA 2QMUB 3T1YF 4RX6A 2DHGA 1WC1A 1M90T 3MFHA 3PCOB 2M8HA 3V6DB 3K5OA 4YR2A 2B8QA 1IKYB 1DBDA 3IBWA 4U67Q 1X4BA 4CTAB 3BM7A 4U96A 3AFGA 1MU2A 3I5BA 4MKBA 2FZCB 3TANA 5ETMA 1GXLA 3OL7A 3R3TA 2KT3A 3DM2A 4OI6A 4NRUA 1MROB 3EGNA 2R7OA 4JI1F 1RSCA 1U0HA 2Y1JA 1N5SA 2E5IA 2DH8A 4A8XA 1NZAA 3MZIA 5ETNA 4J7CA 1IM6A 2XMAA 3MDFA 1RWOB 4G3IA 3E3XA 1U25A 1X5OA 5D15A 2B9XA 4KT0C 3RG6A 3BGRA 3QJJA 2KN4A 5KG3A 5KFBA 5KFRA 3P49B 4USJC 3SSSA 3VAMA 2HQCA 5JMNA 1OYDA 3T1HF 5L46A 3EUNA 3ZZZA 4C7QA 4DPWA 5J1PA 4ED8A 4KV8A 3BPSP 5HMYA 1HNXF 4H4OB 3ILJA 4P7VA 5EX3A 5E5NA 2I5JB 3AT1B 2DNLA 1BWVA 1CVJA 3K8VA 4DUYJ 3BGFA 2A1BA 5DETA 3BKTA 8ATCB 2OPRB 1IKVB 2HZVA 3HSJA 2NCKL 3M7VA 4OYIA 2EEYA 4K59A 1PCAA 5AJ3J 4P52A 2DRAA 5CYQB 4L74A 1X5SA 1RI7A 1L5UA 1LWCB 4ELVA 2NUHA 2MKKA 3GFXA 4HACB 3NP5A 1QAJA 2PI4A 5B0GA 2FLNA 3P5TL 4J9SA 1ZOTA 2MSSA 3F56A 4NYOA 4UOGA 4JV2A 3KG4A 5KFFA 2C1EB 4DQQA 5D0EA 1BQMA 2C2MB 3RUBL 2LLZA 2VDHA 3SSRA 3TO8A 1TKZB 2Y8WA 1SI9A 4G65A 1K73T 3OR2B 4NXMJ 5C2CA 4DPOA 1JJ2R 1WHYA 4OYWA 1VI7A 3UD3P 2JEGA 4BDPA 2R7XA 4ZVHA 1HNWF 4NE9C 4X62J 2GIFA 1CJUB 5HMWA 1WWHA 4U7UK 5IZHA 1R27B 1EQMA 2QZ8A 2EFVA 1LK5A 1F0XA 4RW9A 4PKDB 3J7YU 3ZZ0A 2UUAF 2JH3A 1TL7A 5KG6A 3OSPA 4R8UB 3GSIA 3TOQA 1HIYA 3ENAA 2OEJA 1WF2A 1NDLA 4NMLA 1LWEA 2ZC3A 1KSPA 4F02A 2HNDB 1MLAA 3PYEA 1RQ0A 4LF5F 2JLFA 1SH3A 4NEZA 3EVOA 2UVVA 2Z30B 3S7RA 4IQXA 1SPBP 2PSZA 1YJNS 4JI7J 3BKFA 1MWYA 3S8SA 4DI6A 5C2GA 3AXMA 4YHHF 3L95X 2ZFHA 4IFVA 4ZCIA 2HQDA 1AFJA 4O3PA 4LT6A 4A8YA 2FJXA 3UCZP 2UVWA 2ROGA 3H2UB 2W8KA 2MQNA 3MF5A 4DL4A 3K5NA 2OPPB 4B3TF 2JFKA 3PYFA 9ATCB 4URSA 4KHPF 4F4XA 2HS3A 1DY3A 1JXLA 1FVSA 3R7NB 3HVRA 2CPDA 1FJCA 3GV5B 3KG1A 1R31A 1U6FA 4L3KA 3M1VB 3I0SA 1D1UA 2V6AA 3Q24A 1FEEA 3R7BB 4KGMA 2N4DA 1KFSA 3NS7B 1UJ5A 2VPZB 4Q44A 3VV2B 1PBUA 2PEHA 4G1QB 4DR5F 3T41A 1RUSA 2HNZB 4NLRA 4N47A 4I69A 4IG3A 4ZVRB 1U0HB 4Y28C 3BREA 3BDPA 5J2NA 3TJ8A 2B4VA 3DI6B 3DMJA 3FZBA 2GO8A 1X4DA 5L1IA 4MKYA 4DCJB 1LNQA 2HKEA 1RHQB 2UU9J 5BXIA 4EFAC 3SV4A 2X51A 4LRDA 3IWXA 2DHSA 5ETTA 4MYTA 5G0RA 3BGRB 4TYBA 2EPIA 1VQNS 4LJMA 3I96A 1ROFA 3DRSB 4ALZA 2WSFC 4NLUA 3PR4A 3M8SA 3I55S 3CCSS 1FO1A 1SC3B 3W8GA 2M7SA 3A3PB 2YPZA 4DSIA 4HI1A 2CJBA 2VH7A 3NGUA 3SZ2A 5KFKA 1RA6A 4YDDB 3FBEA 1VBKA 3AOCA 2B6AA 2VPXB 1PC5A 4WXWA 1VQMS 1FKPB 3NOGA 2BKNA 2CFXA 4W90B 1T05B 2J5AA 2VQEF 3FC9A 4EU0A 2YNIB 3TAMA 2H5JB 4USIA 2P2CB 3NGRA 3UN5A 2YNGB 2K06A 1DZ5A 2GQ2A 4J9MA 1VC6A 5IOLA 3MTKA 2IDLA 1J5EF 3A8KA 3GCXP 2CPXA 2YQ0A 4ZVEA 3CXCR 3MUMP 4B9SA 1TQLA 4CO4A 2RDJA 2MHNA 4P74A 4X64J 5A8WA 4B3RF 3T5HA 4DV0J 4NLYA 4QIGA 2G2YA 3O44A 4X4OA 1FRIA 2UP1A 3UDEA 5F8GA 5A8KA 1WG1A 1WELA 4R5PA 1R43A 5A8RA 3C6TB 3T1YJ 2W4CA 3QGGA 1FRLA 1DTQA 3OJSA 3CJRA 2XGPA 2VFTA 6FD1A 3R5DA 4C0OC 4DSFA 2QG9B 3PX0A 4RW7B 2VOPA 4I68A 1P27B 4IKAA 3HVAA 4EUVA 3EVWA 4LSNB 3SI8A 1JLCA 2KYZA 5HVHA 1NK9A 4QPTA 5K8PA 5L1KA 1O0PA 1UP1A 3J80U 4N77A 2EK6A 3KK1A 2B9EA 4KGXB 1JXVA 2NS1B 5F8LA 3UDCA 2GVZB 3GE9A 4XO0A 1Y0HA 4ILMA 1UVNA 2FLOA 4BBYA 1U48A 4DR6F 1G7CB 4QPXA 2MZTA 2MMYA 1VDHA 1CJKB 3CUNA 1DARA 1FDBA 3NNAA 3TVYA 4MMOA 2ZZNA 1N5TA 2MDAA 4TXSA 3CO0P 2FGOA 3EZUA 1ZM3A 4PYAA 5HN0A 4IYQA 2YKMA 1RT2A 4J9LA 3UO0A 1LW0B 3FCHA 4ICLA 1HNXJ 5H9EK 3R1LA 1SH0A 3KOAA 2FB0A 1KS2A 1NDPA 3VVTA 2IHR1 3QT7A 3F0NA 2CJ9A 3GQCA 1QDUB 2XY6A 3PKMA 3NG8A 4WFAQ 2HHUA 2VQFF 4FVCA 3M9OB 5EHHA 2DXEA 2J9CA 1HWIA 4X4QA 4ZPBA 3TZXA 4ED0A 3FCVA 1JLQA 4DV7J 3BSOA 5KFQA 3UVJB 4USVA 4C9DA 3VAFA 1M5HA 4URGA 4KH1B 2I9SA 1DURA 2WBMA 5DGBA 1WEYA 4RLEA 3DLHA 1RYSA 1PILA 3W8PA 1TAUA 4Y2IA 2OFGX 3P6YC 2HHSA 2K1RA 4X4PA 2W7PA 4RNHA 1I51B 1VS3A 3M05A 1U02A 4QCLA 2RILA 5I3PA 2XC9A 3BH6B 2HMIA 3FQKA 3F44A 1X8DA 2H3EB 1UVLA 1JLEA 2WVFA 1YRTA 3JAMY 2F8HA 3I5CA 1FFGB 3D6TB 1KP6A 3I0RA 4CDIA 2DJWA 2YWEA 3EXYA 2HAFA 4GKKF 1R0CB 3OFHA 4NZ6A 2H4YB 4LF9F 2EW9A 4DU7A 4NCAA 3LA0A 3CJTA 1HNWJ 2BDPA 1F1BB 4RUHA 4NI2B 1UVIA 1JMTA 4FYYB 4OYXA 2J0WA 1AZSA 3SSQA 2D9PA 3SIPB 4QWBA 4IH5A 1ZZFA 1NB7A 4F0HA 3PX4A 5HVGA 4W92B 1UVMA 2G1HA 1WC4A 1NM2A 3OFGA 4LF6F 1HW9A 3PRBA 1JLFB 5K20B 5A76A 1PYTA 3GU0A 3QJPA 3W64A 1FFWB 1A7GE 1RACB 5KFAA 4LF5J 1F5CA 3RB0A 2YWFA 3RRKA 1VCTA 3DU6A 2HK2A 3TZWA 2Z57B 2V9KA 5M2RA 2G0JA 4P72A 1Q16B 1F2GA 3PYDA 5AXMA 3CJ8A 2BJ7A 1U7LA 5K8OA 4NA3A 2PMWA 4Q2LA 3UCUP 3KLEB 4R0EA 4YHHJ 2BRLA 1YX2A 1H72C 1YI2S 3FEYB 1YJ9S 4URQU 3BQ0A 4NLSA 4F8RA 1IXKA 4USKA 1XQIA 4J5OA 2DHHA 2F5GA 1FI4A 1FJGF 1OQ6A 4XDDA 3A3OB 1HBUA 4DX8H 4KHPJ 2HYIB 1I3OB 1R8HA 2QT7A 4H4KA 2WW8A 4TN2A 3W7BA 2HHWA 2GV1A 3PHEA 1LQ9A 1H6KX 4JI4F 1ZA2B 1DTQB 1U2RA 4ED5A 2BEFA 2E1PA 2QA2A 3GJRB 2WAQD 2CJXB 5LJ5Y 3N0VA 2NXCA 1B99A 3PJXA 3HZGA 3KFWX 3QPIA 4LBHA 2PE8A 5HMZA 1N5YA 1CULA 4DR5J 3MXHP 4QIWD 4F25A 2IVFB 3V6HA 2GJ2A 1IKXA 1LOUA 3MM7A 2D1CA 3KK1B 3PR5B 4QYZJ 3CJ3A 5K8NA 2M2BA 4JBCA 3GJSB 3PHTA 5F0WA 2FVSA 1EQ0A 4NCBA 2QE5A 4M5GA 4PYDA 4ZDNA 4DR3F 2HSEB 1VYAA 1W2BR 4CLLA 2CNOB 3GJQB 5DZ7A 2XS7A 4JI8J 4H4KC 4LMZA 1S9EA 1S7HA 3MPWA 1UEKA 2FDNA 1RT7A 2LDIA 3FFIB 2QLXA 4KQZA 4DV5F 4DV3F 1T0TV 2JWNA 3M8QA 1MWQA 1RCOB 2KDOA 2BX6A 3Q8UA 1RKIA 2MKIA 1XNQF 3D6FB 4K4TA 2OTJS 1W25A 4LR9A 2I8EA 4O44B 1KONA 4UTGA 2XHCA 2KT5A 3M2VB 3VGTA 5LOQA 3R1HA 4C11B 3O5TB 1T94A 2LU2A 4C8NA 1QVFR 4N7TA 5D4PA 2QYGA 5KG1A 3HK2A 3T1AA 5T7LB 3DOKA 1RHUB 2ZH1A 3A3NB 3LANA 4ZP6A 3R5AA 4OMFG 4Q45A 4WTOB 4PG6A 2PO4A 3AA8A 3KLFB 4N5SA 3MM6A 1RHKB 2R3VA 3ZZRA 4OZNA 1JLQB 1YSJA 2XQCA 5AXKA 3M32B 3U7JA 4QU6A 3BBBA 5L9NA 3PW2A 1Q79A 2OMOA 5KG4A 3Q83A 5CQGA 2VZ9A 2E29A 1H73A 2X7IA 1U45A 3NMRA 1SVDA 5FD1A 1D3WA 2EFQA 1GQEA 2HMIB 2RJZA 3V81A 3WZ0A 5A6WA 3I0RB 2OGUA 4M5MA 4QU7A 3LPEA 4ZPCA 3MECA 2DY1A 1HHTP 2M8DB 2LECA 4P75A 1Z2LA 4PCQA 5G4DA 1U1OA 3IGNA 1S1TA 3ZTQA 4WCEQ 3D1HA 2YBVA 5HMXA 2E9RX 3TQ1A 3QWUA 1V9OA 2V8PA 2Z2MA 1YRUA 4IR1A 3PEHA 4TY8A 2UUCJ 4ZJQA 4USWA 5C7PA 4BCAA 1Q1KA 1VC5A 1MMDA 2DHXA 3E8OA 2XCAA 1WORA 2AGPA 1WHXA 1YDLA 1FEHA 4DR6J 2UUTA 1RT6A 2J0QD 5KT3A 1VRTA 1EJ7L 1X31C 3AQPA 3TEGA 4U9RA 1REGX 2YXLA 2C2ZB 3MPDA 3JQMA 3K7RA 4K4YA 2CQGA 4LVOP 3DN9A 4OLOA 3AJ2A 3MEDB 1FRMA 3OTOF 4GVBB 3CCZA 3TZZA 4F2SA 2EK1A 2LQ8A 4RW8A 5M2PA 5C42A 1ZAWA 2KKHA 1NDCA 1R3NA 1X9WA 4J9PA 2W2MP 2W2PP 4DPYA 1QM9A 5I42B 1ICEB 3GV8B 4JV5F 2FGCA 2MQOA 3SFGA 3WIUA 5H1SV 2WB1D 2C2EA 2DNPA 2W2OP 2R2RA 2KRRA 4WPAA 3MTJA 2VU5A 2W9CA 1SKWA 2PC6A 2CQHA 4OJHA 1RA7A 5BJRA 3CCWA 5KG7A 2VQFJ 1RTZA 2QFJA 4FVMA 2MYFA 5IT9U 3UNYA 1W26A 4HH0A 2LYVA 3H5YA 2EBGA 3JYTA 4ZOSA 2BUNA 3WDOA 3JQJA 2DRBA 2ZOMA 4YS2A 3KUEA 4PUOB 3QFWA 4ETXA 1E6VA 4PABA 1FRHA 3HSGA 1VIOA 4OYPA 3MAAA 2CXEA 1H74A 3TNVA 4V1Ak 1IR1A 2OP5A 2BOAA 3C15A 2R42A 3OLBA 1RAGB 3LALA 2JX2A 1N5YB 2ZE2A 2UZAA 3UDVA 1K0TA 2V0NA 4N56A 4ANEA 1D9AA 3GTYX 3AHPA 3A1YG 4DR2F 4I2PB 2JVOA 4CWBA 6AT1B 1IKXB 3MM7B 3CCJS 2QA4G 1TAQA 2CWXA 3QBCA 1QAIA 1TL4A 4DR1F 3VCDA 3ZZUA 3QNWB 5JJBA 1S79A 2B56A 2VODA 2U2FA 2BQRA 5KFLA 4ECUA 4KO0B 4NASA 1P1TA 4FZVA 4I56A 1J5OA 4EZ6A 2DRDA 3BBCA 3MMCA 4CLYA 4WTYA 3CD7A 4OI2A 3G87A 1NKEA 1OPIA 4IRCA 4IO1A 1D8YA 1JJCB 4CLFA 2DNKA 5E33A 4LF6J 1Q81T 2OJ3A 4J37A 3TX0A 2OIHA 2VG5B 3B82A 5DG7A 4PWWA 3JSMB 1WHWA 3MGJA 1WOSA 3OUYA 1PKUA 1SKSA 2AEJA 1DAXA 3TAPA 3KMSA 1K8AT 2VF3A 2ZWOA 3QWPA 4LFBF 4B9MA 2UXCF 3H4DA 4S0MA 3FRZA 4WP9A 3DOKB 3UE2A 1LWFA 3OLAA 3GIIA 2J9DA 3JSRA 4HHHA 1LFWA 1U6BA 2BKPA 1WSRA 2QL5B 1JK9B 2N4CA 2M52A 2HFNA 3RAMA 1K1QA 2IIHA 1RHMB 2A10A 5KT7A 4HT5A 4FF2A 1OPZA 4MIBA 2RQMA 1FJGJ 2F9JA 3UQSA 2Q66A 2E9TA 2A0FB 2JLGA 4AD6A 1KHWA 2YQ1A 4K2JA 2E1RA 4Z7YA 1HNIA 2AGQA 3KK2A 4DL7A 3HI9A 4HH1A 3LF0A 2BE7D 2C3MA 2BJDA 5J2PA 1OO0B 2ERRA 4JI4J 4KHRA 4A8SA 3V81B 1VHIA 3QAUA 5BYSA 2NUUG 1Q8KA 1YJTA 3KTQA 5FDLB 2B5JA 1SUQA 2IFXA 2XULA 1S72S 1L3VA 1NSPA 2LQBA 2VFSA 2DGUA 1K0VA 2UUBF 2EG1A 1RLDA 5CZVA 2BJ1A 1NK5A 1QE1A 3GJTB 2WOMB 5AE3A 2NXUA 1S1TB 3HHDA 1XMQJ 3WC2A 3DLKB 2Y8YA 4USUA 1X7VA 4FDFA 2Z0GA 2VPYB 4TY8B 4Z7CA 2HWIA 1S6PA 1IJFB 3J7YI 2CQCA 2GGPB 4WWSA 4AXIA 1IN0A 4PWDB 2J8AA 4DR3J 1FWPA 2GVDB 2FQQB 1RT6B 3UN2A 3LP2A 3D4JA 1HFEL 1YJ7A 3BYPA 2N3LA 1E6YB 2ZWPA 3ENQA 3J81U 1WACA 2DH7A 4DDFA 3CJKA 4RU2A 1WOOA 2PFDA 4DV5J 1S0OA 3M6XA 4DV3J 2XMMA 2ZZTA 2NREA 3GFZA 1S57A 4RL1A 1XNQJ 5F8NA 1NJWA 5C42B 1X4EA 4L72B 4F67A 3BJYA 3CPWR 1WEXA 1RAAB 2KXNB 2W25A 2HS0A 3IWNC 6FDRA 3C14A 1CJVA 3N5BA 4B08A 2YY3A 3IFEA 2E1CA 4RW6B 4B9NA 2VASA 3N01A 4A8MP 4O3RA 3H5XA 3M8YA 3PEJA 4P9SA 4LRBA 5LMUF 3H40A 4ZVGA 3JYTB 1S9GB 4K4XA 1C0UB 4CRJA 1WEZA 5DQHA 3SCLE 1R6YA 4PRFA 1REVA 3B6BA 2D3UA 2QLWA 4M5DB 3I6PA 3MAAB 3D66A 3D67A 4WK3A 1SV5A 1TKTB 4P2XA 1C1BB 5GVQA 5IM0B 2G2OA 2Y9HA 3EM1A 3G8TA 1SIZA 1A0OB 4TKTA 2RHQB 1HWKA 1RISA 2CA9A 3W5YA 3WX4A 3T6JA 3VHQA 1AFIA 4WK1A 2V2ZA 4IDKA 4CM0A 4O4GA 1C0TB 3K17A 4ELUA 3F73A 2QA1A 2OELA 2MQMA 4O0NA 2IC3A 1IR2A 3C16B 2XMVA 1NDKA 1ZAXA 1XNRF 1M5SA 4QIEA 1J5OB 5LXRA 3QO9B 3MMCB 4DOZA 2GHWA 1JLBA 3PV8A 3HFZB 1OSCA 1UVJA 4USHA 1IBCB 2WSEC 1XMOJ 3ISNC 4QQBA 3R7SB 2VG6A 4HTIA 3TJAA 3NY0A 2E66A 4NLWA 2BR0A 4LRAA 5DQGA 3CMAS 2PA8D 3D28A 4LF4F 3UR0A 5B0EA 2WVDA 1NJZA 2P9GA 1BQNB 1N33J 3QT6A 2CIMA 3MPYA 5IWAJ 2LEPA 4RUCA 1BY9A 3OTOJ 3H5UA 4R25A 2XYHB 2GX8A 5DS7A 4FYDA 1RT1B 1RT3A 4ZLPA 2UUWA 2C2RA 1LWFB 2AZ1A 2ZEJA 2NR0A 1S1UB 2VA2A 3QGHA 3N79A 2FLPA 2DCUB 3Q8RB 3VTIA 1U1QA 2IY5B 1DQ8A 4IOBA 1VQ7S 3EDQB 4HLBA 3W61A 5J2MA 2DPIA 4ES2A 4PG4A 1XR6A 1RP5A 2ZVSA 2IRYA 4K4UA 3ISZA 3W2VA 3W60A 3IC1A 2HPUA 4RUBA 2HVDA 1SCJB 1T9TA 3KK2B 3TVZA 1QTMA 1QLNA 1S76D 2YNHB 2QL9B 5B0CA 1DQAA 1JNRB 1S0MA 1N36J 3QAEA 4MKAA 2RD5C 3KLHA 3GCWP 1XR5A 4LF2A 5CCLA 3PVXA 2MQ8A 1VLOA 4JI6J 2DGWA 4KJIA 3KJFB 1ZZNA 1FNXH 1AB8A 1Q86T 2B7CB 2IVMA 5AXNA 4DR2J 5HQMA 4KKOA 3EICA 2KG1A 2KM8B 2RF2A 8RUCA 1TL3A 2QIFA 3ETMA 4MIAA 2NYHA 4DR1J 4P2SA 1UKUA 5DM7Q 3JS9A 1RE1B 1VQ8S 3LOUA 2O1PA 3CCMS 3GIJA 2MGZA 3NBPA 5F9NA 1M1KT 2XG8A 2BW2A 3CJKB 3IR5B 2V94A 1TL5A 3M2UB 3SCJE 3HD1A 7FDRA 2NZCA 2ZH8A 2IDEA 1DJ0A 4HDHA 1KLNA 4KTQA 3TZYA 4OHXA 2V67A 2C2DA 1CQNA 3C14B 3TA0A 1R0AB 4PPZA 4LF8F 1M0SA 3UCGA 3VAHA 4QR2A 4NLPA 1GNKA 4LFBJ 3SXLA 2UXCJ 3I4PA 3GB0A 1Q8BA 3FDSA 2DPJA 1N34F 2XI3A 3MEGA 1WKKA 3BV8A 3K5LA 3CD0A 4DQRA 1VQKS 1JQGA 2QEXS 3AD9C 3QT5A 5IXUA 5IT4A 3GV7B 1Q5YA 1S1XA 3KUHA 2KFNA 2OO4A 1TVRA 1U24A 1VR6A 2DKOB 1KRPA 3RW6A 3L7UA 3CC2S 3DRYA 4UW2A 3G82A 4OZ3A 3EDRB 5F3ZA 2H65B 1PIEA 4ER8A 1C4AA 1ULRA 3V4IA 1RHJB 4FPRA 4ZS6A 2ZH2A 1NO8A 3J7ZT 1EIYB 4HYKA 2F1FA 1PBAA 3ET6B 4NPOA 2GMHA 2V4JA 2ILYA 3FMBA 4I2QA 2YQ3A 2LQ9A 3R97A 1XTZA 3G8QA 5SUHA 4OHWA 2FHKA 2AD9A 4DFPA 4P2FA 5IFMA 3A8EA 2UUBJ 4WE1B 4IDKB 2J76E 5J2QB 2B0GA 1YJVA 2XWXA 1R8BA 3QQCD 4C0BA 2R7QA 3MEEA 2XO6A 2B4UA 2R7VA 2N7YA 4AQYJ 5CCMA 3L7PA 4EBDA 2COLA 3OV7A 4NLQA 4D3HA 3KDOA 3KK3B 1PJ5A 2GHVC 3M8WA 2KFZA 3R2CJ 4CYUA 3HLUA 1S6QA 4ID5B 2GIRA 4CO3A 1RTHB 1RWNB 2W24A 4WXOA 2BKOA 4OJGA 1F5BA 2A3JA 1O8BA 2CKWA 1FT8A 1SQGA 3CDBA 4I6YA 4XIUA 3D9BA 4ZA1A 2F40A 2MKYA 4HT7A 4K4ZA 2J7UA 1FX2A 3RZAA 3DOMB 2XEXA 5H9EJ 1RT3B 4OYOA 1NPKA 2EI5A 1LEOA 1FWLA 2PMHA 1PGZA 3MR6A 4P71A 2R8HA 2CZVC 1T03A 1T02A 2BV3A 4MT1A 3IN5A 2CAJA 4CLUA 1QAXA 1RHRB 2ZUGA 2PI5A 3KLIB 4IRDA 4PXDA 5AE2A 3J7A1 5HO4A 1JLGB 1S7IA 2AJ1A 3QYYA 3G6VA 3VZIA 5LMUJ 4B3SF 3MI7X 2AEMA 3IBFB 3MM5B 1HNZF 7AT1B 2FC9A 3OVAA 4B3OB 1YGYA 2AKWB 5A0YA 1N8RT 2MKCA 3KLHB 4JI3F 2FJVA 3SDEB 1SL2A 3QMQA 4O3SA 2R8GA 5KFJA 4ES3A 1O5JA 4QW8A 2IJFA 1KQSR 3VAIA 4KKOB 1QAYA 1HPZA 2QTWA 1NK7A 4ELTA 1JB0C 3DOLA 1TL3B 4ES1A 4CT9A 4F3MA 4JI2F 1TV6A 2HHQA 4NCGA 1S1WA 2RB7A 3E2EA 3W5XA 1WG5A 4X2BA 2G13A 2FD2A 3BSNA 4ZLLA 2UXBJ 4CLTA 4ZK7M 2QRRA 2KFYA 4DUZF 2F4FA 3RAXA 5D4NA 3KNGA 2LXIA 1G4CA 1S97A 3D1QA 4M95A 2MZ1A 1Y10A 1GX6A 4FF1A 4YB6A 2JLEA 5HQ8A 1UWAA 1NHUA 2ZH4A 2WTFA 5J1NA 4WBFA 5KFPA 1I5OB 5DDPC 4LF4J 3PY8A 2G0IA 2JRSA 5A6PA 5CD4A 2P8IA 2W1BA 3G2XA 4J9UE 3QLHB 4OFZA 4EEYA 3MR2A 3UN3A 2JC1A 1ZBTA 2HHTA 4RPFA 3D54A 1WF0A 2VBXA 1EARA 4BC9A 1CG2A 2YX7A 1I94J 2DO0A 2NQPA 1S1VB 1HBNA 5KT6A 2WONA 1YQHA 4L6V3 1SH2A 4AL7A 4OI3A 1O51A 1FJ7A 3SYZA 4ILLA 2DGQA 1LW2A 4QOTA 1NSAA 4F4WA 4LFAF 1NNDA 3Q23A 1D9FA 2CPFA 1FD8A 3AD7C 1RWMB 5DDQC 5THWA 4H4MB 3LAMA 3M30A 2QMXA 3G82B 3HCXA 2ASYA 2BZ2A 1TUVA 1YKWA 2BANB 2C3OA 3JXOA 4DX6A 1RXOB 2V8GA 2XNQA 2RDIA 1SQEA 1WUUA 4L3NA 4I2QB 2FPHX 2LA4A 1GMVA 5A2QU 4X66F 2VONA 4FKXA 4ZIWA 4Q8FA 5KFIA 5KG0A 1UA1A 4BS2A 1ZPVA 2XI2A 4E98A 2CUYA 3DRXA 4AXJA 3M2RA 3C8YA 3OD2A 3DLEA 4ENOA 4F4KA 3W3SA 3U02A 4M63A 2QLBB 2ROPA 2Y3YA 4DV6F 2OMLA 1S77D 4QR1A 4LF7F 3EGVA 3NGDA 3D0HE 4YY3J 2LU1A 3DLGB 4ZJOA 5E0OA 5M2UA 5C25A 1AROP 2D69A 3K5MA 5FLXY 3IS9A 4PQUA 1VBYA 2CJKA 5E3RA 4PQAA 3ZTRA 4ED4A 5EN1A 1EZZB 2ZBRA 2CNKB 2J0SD 1SC6A 1G1XA 3WQPA 4W4MA 3GMGA 3J7Z5 1FVQA 5B08A 4OYZA 5GAGU 5D3GA 2E5LJ 2NSBA 2GMLA 4WFBQ 4LQ9A 3QSYB 2HQ3A 2KT2A 1X9SA 1PO6A 3OSNA 4FN5A 4BWMA 1T03B 4NLDA 2ATCB 1URNA 2HG4A 5EX0A 4F4AA 1N0VC 1U1PA 5KFZA 2OPSB 1G6BA 1TR0A 1N34J 1OMSA 4EYIB 2GZOA 4JB8B 5KAKA 3RBZA 2MZJA 3CJQA 2XMTA 2HHXA 4LBPA 3CDUA 3V6JA 2C3YA 1NHKL 4ZP9A 3J81j 2PMZD 2HLTA 2VKZG 4MH8A 3AB4B 3ZXWA 2R7WA 2HQIA 1RZMA 3IRXA 2W9BB 1OWXA 2OSQA 3M9NB 3LP0A 2ZH7A 1VRUA 1Y4ZB 2IA0A 3NLCA 5KG2A 1KLMB 3D7SB 4RW4B 3SFUA 1R8PA 1HPZB 2HQGA 3K2YA 5HP1A 4NCGB 2AF6A 2CQPA 2XSJA 1GMWD 3HHEA 4EBEA 4HI2A 1RTIA 1S1WB 4PAAA 2QL7B 3M8PB 1V5VA 5JXSA 3JQKA 2MY7A 2HW3A 2DEJA 2ZVIA 2WHOA 3FSXA 4F0KA 1S10A 5HROA 5ETKA 3LAKA 1H38A 3AXKA 3ONQA 1HD1A 3R5JB 1SBRA 2QV6A 4KY3A 5HAOA 4ZPAA 2ZZMA 2X3GA 5KFTA 2RUSA 1WKLA 1WC5A 3THPA 2FHJD 2CQ4A 4YB5A 2AGOA 3W9JA 1IBMF 2G9OA 1VC0A 1B4SA 2NLWA 2BA9A 4TY9A 2H48B 2C3UA 2EWHA 1UTAA 4WYLA 1WKJA 1IUJA 1KOHA 4B9TA 1VHFA 2V69A 3B78A 3PTWA 3JTPA 2AJQA 5IT9Y 3V5RA 1IKWA 1XEZA 3N6MA 1AYEA 1Y00A 2ASLA 1ELOA 1VQYA 2D41A 1HR0F 2MTLA 4IFYA 2J0XA 2YNFB 1Q8IA 3KJVB 3OR1B 2PT0A 2ZNYA 4DX7A 1UWBB 2K3KA 1VQ4S 2AYBA 1IJEB 1CJTA 3I82A 4JV0A 2DGOA 3VGSA 4FYWB 1UCNA 2I2YA 3OHBA 1XN9A 3NS5A 3UD5A 1WG4A 3TARA 1C1CA 4OZJA
chains in the Genus database with same CATH topology
2KJWA 3OHAA 3GIMA 4FBTA 4OIXA 1MNEA 4OLOA 2H5EA 4UUWA 3IR6B 3AJ2A 4PWUA 1NK6A 2W4PA 3L7OA 2E5GA 3MEDB 3KLFA 4J9NA 4NXNF 1FRMA 3BF4A 3OTOF 1YG0A 5IS2A 3PRDA 1HW8A 4O23A 2LMIA 2GQCA 1KLMA 1LW2B 1DTTA 3CCZA 3HHLC 4RW4A 4Q7AA 2EK1A 4F2SA 1FERA 4RW8A 5M2PA 4EO8A 3MM8B 3P3DA 4MFBA 4CO2A 1HWLA 5C42A 1ZAWA 1M5KC 3M32A 2KKHA 3I32A 1R3NA 1X9WA 4J9PA 2E1AA 3EXCX 2GJIA 1VBXA 3G4SS 5F9LA 2ZBIA 1UW4A 1QM9A 5I42B 4K0KF 5L38A 3GV8B 1VQPS 2QSWA 4JV5F 1NRKA 3DFEA 1FA0A 2Q3PA 2FGCA 2MQOA 2FVCA 4DJBA 1L3KA 2IM1A 3M8PA 3SFGA 3OL9A 4O0IA 5T14A 4DQIA 2P5VA 2X1GA 2WB1D 3FVYA 4Y34A 5H1SV 3QZ7A 2C2EA 1HI0P 2DNPA 4MIWA 2R2RA 1XWLA 2KRRA 1Q8LA 3TR5A 3BB5A 3MTJA 2W9CA 1SKWA 1FTRA 2PC6A 3MM9A 1Y3JA 3MMAB 1NEEA 2CQHA 5I3UB 4X4UA 4OJHA 4Q43A 2HHHF 4MAKA 2YX1A 3DRRA 1RA7A 1GT8A 1X4CA 4MK8A 5BJRA 3CCWA 5KG7A 1Y5LB 4DG1B 2KHCA 3GG0A 5K5MA 3V4MA 2X1BA 2QFJA 4FVMA 2JFDA 2MYFA 2V8DA 4JI7F 2MJNA 1H3DA 4HH0A 2LYVA 3S1TA 3H5YA 2EBGA 1T8EA 1NAQA 4OZ1A 3UDLA 5DO2A 2M0GB 5LXYA 3OUYB 3JYTA 3DRPA 2IYGA 2J6SA 4ZOSA 2BUNA 3WDOA 2L48A 3MUVP 2X1AA 2DRBA 2ZOMA 4I6WA 4TYAA 2RE1A 2VOOA 5F0UA 4DL2A 1J2VA 4G1PA 4PUOB 3E51A 2LCWA 4ETZA 3KWMA 1KNZA 2BOPA 1FXRA 2NSCA 2ZKUA 3OTEA 4ETXA 1E6VA 2VBYA 3M2RB 1FRHA 2KRBA 3LQVA 5J1EA 1VIOA 4U7CA 1S48A 2XMWA 1FKAF 2O3DA 4YB1P 3OJUA 1M5PC 4ED1A 2FJWA 2B3TB 4DR7F 5KFDA 2B9WA 1NH7A 1FESA 2RT3A 3TNVA 4X65F 4ECQA 5CA5A 3WBZA 2OP5A 2Z8QA 1H0HB 1ZTWA 2ZM6F 2HS4A 3O1LA 1Q7YT 1DRZA 3CT9A 3CULA 4NX9A 4B3MF 3X1LB 3OLBA 5CYQA 1C4CA 3LALA 2JX2A 3ULHA 4RNOA 5GAEI 1LWCA 1ZAVA 1N5YB 2E5HA 2ZE2A 2UZAA 1K0TA 5B0BA 4EO6A 5B09A 2V0NA 4N56A 2FIUA 4KE5A 3ETOA 4WU2A 3BSCA 3CJ0A 5EWEA 5KT4A 1D9AA 2YNFA 2RMLA 3KJVA 3VF0B 4DS5A 3CJ4A 3T19A 4A8WA 3AHPA 3A1YG 3OR1A 4DR2F 5KT2A 4I2PB 2JVOA 3IS9B 1UWBA 2DK2A 4LSLB 4WZMA 1V6HA 3DYAA 1IKXB 3LWMA 2ALZA 2FHJA 1OIAA 3MM7B 4TU7A 1HNIB 5KFHA 3CCJS 1HYSB 2IA6A 2QA4G 1TAQA 2L41A 3KLGA 2CPZA 3ZZYA 3K58A 5K9FA 1N5QA 2R2TA 2Q6CA 2C28A 1QAIA 2XNRA 3C66A 3GR1A 2O01C 2W9AA 1TL4A 4DR1F 1C2PA 2VG7B 2KG0A 3OW2R 1NK8A 4N8OA 5KTQA 4I67A 3Q8SB 4F3QA 1FCAA 4FS1A 3VCDA 1I6JA 3ZZUA 5J2PB 2B51A 3N4WA 3Q22A 2IM2A 1GTEA 4KSEB 3CDEA 3MEDA 1QSLA 3HMJG 2JOQA 5JJBA 2HGMA 2R7RA 1MMNA 1S79A 2DNNA 2NPIA 3CJ5A 3UFCX 2B56A 2XS2A 3POTB 4QIFA 4UQTA 2VODA 2U2FA 3GYXB 2B5JB 4GC6A 2BQRA 1SUQB 1U49A 2YKAA 3M6VA 5KFLA 1TK8A 4DLEA 4ECUA 4KO0B 4O3OA 1P1TA 1TKZA 4FZVA 2F3JA 1SXLA 3LGNA 4I56A 4I6AA 5KFSA 1NK4A 2HZCA 2DGXA 1J5OA 4EZ6A 1K9MT 5KFYA 3C3LA 3MMCA 5IQ6A 2DNZA 5DG9A 4CO0A 1YJUA 3OR2A 4FP9A 4WTYA 1MW7A 3CD7A 4ED6A 5I42A 4OI2A 3MMJA 1HBOB 1Q78A 4F4ZA 2OD4A 3SQGB 3JSBA 1UETA 1QE1B 1NKEA 5JUMA 1OPIA 1KOOA 3PW7A 2KJVA 4IRCA 1X5TA 2LKZA 4IO1A 5KFMA 4RZRA 1D8YA 3UR3C 2DNGA 2HHPA 3Q2TC 2YWGA 3NGKA 3HZEA 1KQKA 4ID8A 1KN6A 1HD0A 2DNKA 1SB6A 5E33A 5ADZA 4ECSA 2JJ4D 1GH8A 5D8HB 4XDCA 1Q81T 5DLFA 1F60B 3LP1B 2AJ4A 3IGVA 4A4JA 5I3UA 2OJ3A 2WRMA 2W7AA 2OFHX 2KHDA 4J37A 2ZJPQ 5E7OB 4ZCMA 3C6UA 2OIHA 1MU2B 4DG1A 3DXSX 1S6PB 2VG5B 2O5DA 3B82A 5DG7A 2PN6A 3TAQA 3GSDA 2PIIA 2GA7A 3JSMB 1WHWA 2R9LA 2BM1A 2GO9A 3MGJA 1JX4A 2B4OA 3OUYA 5CYMB 4DR4F 2HGLA 3MR3A 4MYUA 5I4MA 1SKSA 3DU5A 1H2UX 3DLLQ 1KQFB 2ACYA 1WTFA 2JC0A 1DAXA 3E01B 1UJ4A 2WB4A 3DM2B 3KMSA 4EBCA 3TAPA 3QWPA 3KHLA 2R2SA 1K8AT 4B9MA 4LFBF 2OH2A 2UXCF 1HMVB 4J9RA 2DR8A 4PUOA 3H4DA 1KTQA 4OHYA 2ZHOA 1BC6A 1QJHA 2EFGA 3LP2B 2LQJA 1P9QC 3FRZA 3PO4A 3DOKB 4AE5A 4UY8T 2K3IA 3UE2A 4AL6A 2VFRA 1LWFA 3OLAA 3GIIA 2LQ5A 4ECRA 1Y7PA 2J9DA 3Q2SC 3JSRA 4I1TA 4KGKA 4YMEA 1LFWA 1U6BA 3FRYA 4ZPTR 2FVQA 1JK9B 3DGPA 2N4CA 4P7TA 3OL8A 2M52A 2RS8A 3VR1A 1VQ5S 1NKBA 3RR7A 3FMWA 1VRUB 2HFNA 3PIPQ 2FC8A 3RAMA 5E3CA 4PG8A 1K1QA 3G6ES 3TRGA 4WF9Q 2FVPA 2A10A 5F8IA 5KT7A 2EFPA 4HT5A 4FF2A 3R27A 2LEBA 2IYIA 1OPZA 4MIBA 2RQMA 3KTQA 3CD6S 4D3GA 3F41A 4FXVA 2MZSA 1JJHA 4FXDA 1KR4A 2F9JA 5L9XA 1G3OA 5KFOA 2M70A 1U6ZA 3HVTB 4IRKA 3UQSA 2JEFA 2Q66A 2L08A 2DD8S 2OPQB 2E9TA 5EWFA 4C3KA 2JLGA 1KTVA 1RWUA 1KHWA 4I2PA 2VPWB 1RAJA 3THTA 1XMQF 3NNHA 4LSLA 2BM0A 5HP1B 3R5CA 2P9EA 4QWAA 2HRUA 3ISND 2AV5A 1NJYA 3CC4S 3NKYA 4ZPWR 2E1RA 2IJNA 3K59A 1HNIA 1HYSA 1G2EA 2XSJB 2AGQA 3KK2A 4DL7A 5CD4H 3HI9A 4ZCLA 2F8EX 4C8ZA 4WFNQ 3J81Y 2JEIA 1T3NA 3LW5C 4N41A 2ABYA 4HH1A 1SJ3P 3OVBA 4CO5A 5L1LA 4ECWA 3HHNB 1X0PA 3LF0A 4EZ9A 2OKQA 4OI0A 1H98A 4OZ5A 2C3MA 2PDAA 2BJDA 5HROB 2JHEA 4Y0FA 3BO2A 2FJDB 2JL9A 1OO0B 4ZMMA 1EETB 2N7CA 5J2PA 4FBUA 1HQEA 2ERRA 4YB7A 4OX9F 4CQ1A 2HFOA 4KHRA 3U27A 4A8SA 2FVRA 4CH1A 3H4BA 1N5VA 3V81B 2DNQA 4X64F 2W9BA 3D1OA 4I4BA 3QAUA 5BYSA 2NUUG 1VJWA 3CC7S 5DDOC 1YJTA 4P6QA 1OS5A 3POTA 1URRA 1HNVA 1FE0A 4I0WA 4RBUA 5FDLB 2B5JA 1RT4B 4DV0F 1GX5A 1SUQA 4OX7A 4FS2A 1R8AA 2IFXA 2XULA 4KO0A 1S72S