2GVZB

Crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
188
Chain Sequence
QSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Adenylate cyclase type 5
publication title Broad specificity of Mammalian adenylyl cyclase for interaction with 2',3'-substituted purine- and pyrimidine nucleotide inhibitors.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 52
structure length 188
sequence length 198
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 2gvzB00
3UVJB 2W01A 4OZ2A 3ET6A 1CULA 3C14A 4NI2B 3C15B 2QV6A 1CJVA 1YBTA 1Y10A 4OZ3A 3MAAB 3R5GA 5D0RA 1WC6A 4CLKA 2GVDB 1WC5A 1CJUB 5D0GA 1CJTA 4USTA 1TL7A 5IV4A 4OYWA 1U0HB 1FX4A 1YK9A 4OYXA 1AZSB 3G82A 3C16A 4OYIA 4OYMA 4P2FA 1CS4B 4CLWA 1Y11A 4P2XA 4USWA 2GVZA 1WC1A 1CJKA 4CLZA 3UVJA 4CM2A 4CLPA 3ET6B 1CULB 3C14B 1CJVB 4CLSA 1AB8A 4CLLA 4OYPA 4NI2A 1WC3A 3C15A 1FX2A 4OYZA 3MAAA 4CLUA 5D15A 1WC4A 4OYBA 1YBUA 4WP8A 1CJTB 4WP9A 1TL7B 4CLFA 4USVA 2GVDA 4P2MA 1CJUA 5D0HA 4OYOA 5IV3A 1U0HA 3MR7A 3G82B 3C16B 4CLYA 2BW7A 4CM0A 1AZSA 4OYAA 4USUA 1WC0A 4CLTA 2GVZB 1CS4A 4WPAA 1CJKB 4WP3A 2WZ1A 5D0EA
chains in the Genus database with same CATH superfamily
4CH0S 1P1TA 2J6SA 2RH3A 2G1DA 4QWAA 2EK6A 4PYDA 1Q7YT 1IBLJ 4QU6A 3ISZA 3KG4A 1VQ4S 3MD1A 4CIOA 1M5VC 1RT4B 5KG4A 3CCJS 3MR2A 2MHEA 4DZDA 4UTGA 4UY8T 3Q0AA 2W7OA 1EP4A 3JSMB 1Y4ZB 2AEJA 4FKYA 4G65A 3D1QA 3KK3A 4IDKB 3BPDA 2E1PA 4K50A 1OMSA 4C6AA 3KOAA 4EMDA 4HHHA 4N56A 1F1BB 2CDQA 3N4WA 3HSDA 1QJHA 2C28A 1SKWA 2ZD1A 2MJNA 3PYEA 1KTVA 3FSIA 3GV8B 3PJ9A 5AT1B 4DR1J 4NA2A 1TP7A 2PMWA 1JLGA 4DG1B 1D9FA 5ITHA 2UU9J 3TEHB 2FC8A 3BO2A 1ZA1B 5KFFA 4CLTA 4MTPA 2A3JA 1NJXA 4RNHA 2GGPA 4HI2A 2YKMB 3QJJA 1S1WA 2AF6A 2RU9A 5KFXA 3M32B 1J27A 3NCPA 3MPVA 1GFWB 1WF1A 4OJHA 4F3MA 1N5VA 3W9HA 3F56A 3I0RA 2CPDA 1MROB 1N34J 3FCHA 4U6PA 2MJUA 2KYZA 4ZK7M 2BKOA 3R5BA 2XZTB 2Y0BB 2AGOA 4N8OA 1Y7PA 4DR7F 1OY6A 4K7QA 2PMZD 4HLBA 1YZ6A 1H73A 2F4FA 1I94J 1QSSA 1IKVA 2AJ0A 4ANCA 1FNMA 2IAJA 3R3TA 2HQ3A 3KLFB 1NK6A 4QOTA 3CD6S 3CO0P 2POKA 5T41A 3HZGA 5K9FA 3HDSA 4C8MA 1J5EJ 3QATA 1NK9A 3PKYA 2V68A 2PT0A 3IAS9 2B8QA 5RUBA 4LBHA 2CXEA 1IM4A 2BM1A 3W5YA 4DF4A 2GO9A 2XS2A 3VWSA 4J9SA 4ZHRA 2W9BB 3TVZA 4WZQA 1N36J 3ILJA 3LO3A 2B4VA 5DLFA 1SXLA 3E8OA 2VFRA 1RHQB 4G1QA 5SUHA 1EQMA 3HZEA 3GR1A 3QGHA 3N9UC 2OH2A 5FJ4A 1NSAA 2FGCA 3RRKA 2IBKA 5C25B 3BN7A 1P8GA 4KV8B 4F50A 1UA1A 3FFIB 3HULA 3P5TL 2C2ZB 4IKAA 1U1PA 2G1HA 5MAOA 3CPWR 5KAKA 4DUTA 1XMQJ 3BGFA 1MMDA 1S0NA 1N5QA 3MZIA 3W5XA 2XYGB 1MWQA 3NNHA 2OPPB 4M5NA 2FVPA 2GNKA 3M2VB 5SZTA 2OTLS 3MOZA 1REGX 2BANA 1RE1B 4C8ZA 1X9MA 2ZH2A 4LFBJ 4Q0BB 1S1TA 3QNWB 5E3AA 1HQ2A 1WC0A 3CE8A 4C0HA 1BQMA 4F26A 4FNHA 3UD3P 2XB2D 4YHHF 3IBCB 1RLCL 3AA8A 1V5IB 4LF5F 1G3OA 5GAEI 4RWXA 3KMSA 1AXQA 4I2QA 2ZC4A 1TVRB 3NGRA 4TY9A 5LMUJ 2KZMA 3FBCA 7AT1B 3LP2B 1XTZA 2FDNA 3WBZA 2KN4A 5HK4A 2R7TA 2BBEA 3TNVA 3X1LB 2MKYA 2V4QA 3HSGA 1U4BA 2CJQA 1C1BA 2RU3A 1HPZB 1VISA 1MG7A 3O1LA 5D15A 2GQCA 3NBPB 3MMAB 1KP6A 2VFUA 4USVA 1IWGA 4K5SA 3R2CJ 5D0HA 2W9CA 4DQQA 1N6QB 4LRAA 3W7BA 5E0OA 1FDDA 4O23A 2DHSA 3FBBA 1REVA 5ETRA 1P1LA 2HKEA 4RNNA 5L46A 5KFHA 3C15B 3VF0B 1VQOS 4L72B 2W7PA 3RTVA 3KUEA 4NPOA 4EZ6A 3KLIA 2B7CB 2XBPA 4NEYA 3BPSP 3T5KA 3QJPA 5CYQA 2J0XA 2ZJPQ 2YWHA 4WFNQ 4DX7A 2MQPA 4U9RA 2P9EA 4LQ3A 1UW4A 2GJ2A 3OT9A 2MEWA 3D6FB 1VR6A 3W60A 2VA2A 2KXFA 1LW2B 5KFEA 1U6FA 4ZJOA 4QYZK 2JVRA 3PW5A 1R8HA 3V6KA 1FEHA 1GX6A 4A48A 4KSEB 3D3CJ 2HBRB 1QSYA 4KC5A 4ZVQB 2GAHC 1ZPVA 2CFXA 5HBMB 4K0KJ 3AA9A 1R0AA 3QIPB 1W2IA 1FXRA 4HH1A 4O44A 2CQDA 2WVEA 4IFYA 1SJ4P 5GADU 1VQLS 4DUYF 4GVLA 4QW8A 1ZYQA 2P8IA 2MPUA 4Q5VA 2HNZB 2OPSA 4YMEA 3DLGB 2MGZA 3A3NB 4I2PA 4O0NA 3CUNA 1R8CA 1R27B 4KBIA 1WC5A 1X7VA 2EFPA 2HNYB 2W2QP 2ZH3A 4ELUA 4NLDA 3OUYA 4OI0A 5K14A 2C3UA 5CXTA 2DRAA 2H51B 3HM9A 3G82A 2RKIA 3RBEA 2XSJA 3DGPA 1HI8A 5IC6B 4LF7J 1HBNB 1RBAA 4WIIA 4A47A 3W65A 5J2NA 1YBUA 2ZITA 4DL6A 4IFVA 4KHPF 4P2MA 3E01B 2C2KB 5GVQA 3M2UB 3LPEA 4Q45A 1UVIA 2BV3A 2XYPB 3M1VA 2M5YA 1RWUA 3PYGA 4RNOA 2JLFA 4J9RA 3K59A 1UL3A 3ZTSA 4DF8A 2B9YA 4JV5J 3RUBL 3V6DB 1D9AA 3QT6A 4IG0A 2FY1A 2FHOB 2CWKA 1U1OA 3I4HX 4ZVOB 4ZVUB 1SUQA 3SFUA 4CO4A 4KHRA 2V63A 2EPIA 2HG4A 4UF4A 1AZSB 2HQGA 3GE9A 8RUCA 3DRSB 3CCTA 1RAOA 2HSEB 3AD7C 4P71A 4F4YA 4N47A 3CCVS 1HMVB 3DM2A 3UFCX 2L9NA 3BSNA 4LRDA 1LXJA 4HT5A 3MM6A 4XDDA 3EX7B 4DCJB 4JV0A 4F04B 4PAAA 2DEIA 2RILA 2ZNYA 3CO9A 4ZOSA 1S6UA 4M95A 1PYTA 4HKQA 3W64A 3DNCA 3ZZTA 1HNXF 1R89A 3M6XA 1RCOB 2VZ9A 2OD4A 1BGXT 2ZOGA 3MM7A 2DNPA 3ZZZA 4IUFA 2QSWA 5EWGA 1XNRF 2BRKA 2RQMA 1MN7A 1J5EF 1HWKA 2ASDA 1S6QB 3R2DJ 4X64J 1DTQA 1ITPA 1VQ7S 4TN2A 1NKBA 2GV1A 4OL8A 3GJSB 2CPHA 1RBLA 4U67Q 5B0BA 1NPKA 4JI1J 1M1GA 2GJFA 2ZUAA 7FD1A 5KOWA 1FERA 3LUYA 4J9UE 4F36A 2B4OA 1VI7A 1B0TA 3W62A 1FFSB 2C2OB 4JI6F 2ILZA 1JLCB 2R7WA 4CLUA 4XAKA 4WIQA 2JNJA 4N5SA 1SJQA 2A2CA 3SDEB 4TLQA 3KKFA 3EYZA 2VBWA 3C46A 2BQUA 3ICLA 5I3UA 4A8OA 3CF5Q 3NRBA 1AUDA 4IH6A 1YRUA 2HS0A 4L75A 3U1MA 1NDPA 4AFFA 4URQU 3K89A 4DR5J 4QQBA 2Q66A 4IOBA 4NZ7A 1LXNA 2KVQE 2F4VJ 2MLXA 2ZNZA 1WNEA 4LFBF 3Q8SB 3LA0A 2QLBB 3HSJA 4LF2A 3CJKB 4NWBA 2C2RA 1ZAWA 1H7WA 4DBQA 3W2WB 4QR2A 3DRPB 4WFYA 4ZCLA 2H5EA 4RBVA 2IC3A 1YKWA 2V4JA 4CO1A 3Q89A 4H4MA 1HQEB 1G4CA 1RTDA 3MURP 4X62J 2MKIA 3SSSA 1VRTA 2V2QA 5IQQA 1KRPA 3PY8A 5LMUF 3QLHA 3H7HB 1EHWA 4KPCA 4FF4A 2MQOA 2XHWA 2BZ2A 3M30B 2CQ2A 2JZ5A 4Y34A 1RHJB 2HHWA 2FJBB 3KWMA 3CXCR 3IWNC 3BGRB 2KKHA 3UDCA 4K4TA 3TR5A 3BEGB 3W3SA 2XM3A 1X4GA 1CJTA 1UPPA 3IP0A 1ZM2A 4OQJA 3EDQB 1U0HB 1D9DA 3CVKA 1UWBA 1DLOB 1HBUA 3QWPA 3FDSA 1FKOA 3EGNA 2HK3A 3BJYA 3CCLS 1YVFA 2VIHA 3I31A 3BF4A 1RTJA 3DI6A 2ZM6F 1VQNS 4DX8H 3PJXA 4LF4F 1XQIA 2VQFJ 2KG1A 1RKJA 2CQPA 5E3RA 4BWJA 3MGJA 5DDRC 2DH9A 1N5YB 2J9EA 2DT9A 2ALYB 1Z2LA 1RU1A 2ZFHA 4OV1A 4FVCA 4F3OA 1YJ7A 5KFNA 3NG8A 1XMOF 4K4ZA 2QL7B 3LF0A 2XY6A 1H72C 2LQ8A 3GSIA 3MAAB 4RUAA 1IR2A 3C6TA 3ETMA 2LEBA 1S9GB 2YY3A 3MEKA 4DPUA 4R0JA 3MMBB 1RQ0A 2KXHA 4NLUA 4UOHA 2EW9A 3MEGB 3BGOP 5EX3A 3H8YA 4F3QA 2D69A 2DJWA 2MB0B 3GIJA 2RAQA 3D2WA 2XYHB 2NSCA 3MMCB 3B6BA 1H3DA 2LXUA 3HFZB 4L6V3 3KK2A 1G6BA 1OPIA 1Q8BA 3AJ2A 3HHLA 1F5AA 1UVLA 2CIMA 3G6VA 4WP9A 3ZTOA 1IBKJ 3SYZA 1M1HA 1OY8A 2E29A 1D09B 1T9VA 5F3ZA 1FJGJ 3CCQS 1KFDA 2BJ7A 4Y6IA 3MR7A 1HFEL 5KG2A 3AB2B 2WVFA 3BKFA 4ERDA 5DDOC 2MQNA 1SKRA 1JMTA 2HHUA 3KLHA 2WK4A 4G1IA 4J7CA 2J0SD 4IYQA 1R7IA 2ZHAA 2RUGA 4R0EA 4A8KA 4X65J 3HHDA 2PC6A 2BXJA 1TKZA 4W4MA 5T14A 1PJ5A 1VIXA 1XEZA 2E5JA 2Z0GA 3WX8A 1RLDA 4NLGA 1HHTP 1AT1B 4QYZJ 2R2UA 4DR3J 3IMQJ 3C2PA 2H3EB 3JQMA 4NE9C 2MKJA 2C2EA 4TY8A 4YR2A 3FZBA 4ECTA 2V4RA 1RTIB 3QGIA 5FDLB 2CQ1A 3IFEA 4NLTA 4OYPA 4I1TA 5H9EJ 2XLIA 4JI2F 4XPEA 4CRJA 2M2BA 5CA5A 2KFZA 4C4WA 3TWZA 4AQYF 2FIUA 3OL8A 2EK1A 4C11A 2HWHA 4HT7A 2WVBA 3R5AA 3G71S 4IR1A 2DR8A 1EZZB 5J2PB 1TKXA 1VJWA 1IJEB 4OZ2A 3BH6B 1YBTA 2QYCA 4WCEQ 1FTRA 2Z2MA 2ZWOA 1ZH5A 1F9EB 2KJVA 2CQCA 4X66J 1JLAA 3I32A 3QT7A 4NYPA 5CZVA 2DNZA 3GFXA 2VJUA 1Q8KA 5L1IA 6FDRA 4QBUA 4N41A 4LFCJ 2N3LA 3F0NA 1KNZA 3Q8PB 1K73T 3GILA 4NX9A 3D6HB 2ROGA 3UVJA 1XMBA 3FCVA 1CJVB 1UZDA 3UDVA 4CLSA 2WSEC 4CLLA 4BLGA 1YJRA 2FD2A 1NK7A 1EQ0A 3UR3C 3UD4P 2PFFB 1QAXA 2XGQA 3CT9A 3PVXA 5BR8J 1EB0A 1W26A 4MK8A 4C98A 3BSAA 3DOLB 2U2FA 5C42B 2UXBJ 2J0QD 1Y3KA 2VG7A 4RW7B 1CG2A 1TELA 2CJ9A 1TK8A 3K5LA 3LALA 1U1RA 2UXDJ 2XGPA 4GKKJ 4MAKA 3GCWP 4B3MJ 4JI0F 1S7HA 4PKDB 5LJ3Y 1RACB 4M8LA 4YY3J 1SQGA 3E3XA 4NCGB 3BDPA 2XNQA 1JLQA 2VBZA 3WC2A 3V5RA 1S97A 3OJSA 5JVGQ 5ETMA 5L39A 4U7UD 3CCES 1HHSA 4WU3A 2HHQA 3NOGA 3KTQA 4B9NA 1P9QC 3J80U 4FF3A 2Q6CA 4KFBA 2BKNA 3MECB 1ZA2B 3BSOA 1HBOB 1CJKA 4OJ3A 4O3SA 2ZBIA 3W5ZA 3MCMA 2AIRB 1S4EA 1Q81T 3V6JA 5DM6Q 4QPTA 3MEEB 4OZ1A 1FXLA 1X0FA 2B6AB 1RZMA 2W2PP 3UW1A 3ENVA 1HYSB 1H6KX 4NA3A 2DY1A 4C8NA 4LIWA 2V5HG 1FRMA 1GEHA 2R7OA 4LF1A 4CLYA 2BW7A 3KJVA 3I0SA 2XS7A 1NK5A 1IKYB 1R3NA 4G3IA 1HNWF 3GCXP 1OYEA 2DNOA 4NCBA 3R1HA 4DV7J 3LP1B 2QV6A 3IWXA 4I7FA 1U2RA 3GJQB 4OZ3A 2B4PA 4F4ZA 4H4KA 3AB4B 1JQGA 3KDNA 3KUHA 2XI2A 3NWRA 3T5LA 1RGVA 2YKOA 3OFFA 3POTA 4B3RJ 4U8VA 4CTAB 5ADZA 4J37A 1RT1A 2QN6B 2FGOA 1S6PB 5K8MA 2B7BB 1YITS 4XO0A 1TL1B 3MMJA 3HKZD 4ECUA 4CLWA 5IT9Y 4J9KA 1ZBTA 4ECXA 1HA1A 1Y5IB 2BE2A 1DURA 3P6YC 1C0UB 3I9ZA 4CO2A 1VBYA 2U1AA 4ILRA 5K8PA 5I3PA 1JLFB 4NLPA 2CG8A 2YKNB 4M1KA 5EDWA 4GO5X 2ZBPA 5F9LA 2F65A 4ZVRB 5ETPA 4KPYA 1N0UA 3LAKA 2XG8A 2XI3A 2LEAA 1TKTA 4U8YA 3CCSS 1KKHA 2G2YA 4FYYB 5IS2A 3GFHA 1VQ9S 3AJ1A 2NZCA 1DZ5A 3CDAA 4ZPWR 1AA1B 3WIUA 4QR1A 4LVNP 5A0YB 1VS3A 4I6YA 2X51A 2IIHA 3OLAA 4GC6A 3MXHP 2J5AA 4E8UA 4PG7A 4MFBB 5JXSA 3M8PA 3OL7A 2HK2A 3MR5A 2IMOA 3DRXA 3RR8A 4HYKA 3HF5A 3CTRA 2OFGX 2IM0A 2HVIA 2W2OP 3K5MA 4JI8F 4QCLA 3LOUA 4OHVA 2A18A 3HD1A 4FVMA 1KD1T 2ZDOA 1T9WA 3I4PA 2XMWA 2CJXB 3K57A 3L7UA 2YWWA 1PILA 3KLHB 2QFIA 3W2VB 4F8RA 4CLFA 2G0IA 2DGOA 5J2MA 1APSA 5GAHU 2ZDPA 5KFGA 2QGFB 2E5LF 3TAMA 4BC7A 2ERRA 1FJCA 4OI2A 3WIVA 3W1YC 2LMIA 3AJDA 3BGUA 1SC3B 1W7WA 4R8UB 1N8RT 3CJ0A 3J81Y 3QZ7A 4B3SJ 1OYDA 1HLWA 5G0RA 1IKWA 3JQJA 2YQ0A 2VFVA 1BXNA 4IOCQ 3N28A 2HS3A 5AJ3J 3LWLA 2O01C 2ABYA 5H9FJ 2L9WA 5D4LA 2HYIB 2K7JA 3SMZA 4DL5A 1WF2A 4QWDA 4ED1A 3RBDA 1XR5A 1JKHB 4L74A 5K8NA 3HHKA 2VC1A 1VC5A 4X4PA 3DRRB 3H20A 4PG5A 2YNIA 1WC3A 2CNOB 1F0XA 4ZCIA 4HTJA 2MZTA 4LF9J 3N5BA 2ASLA 2HMIB 1HBMA 4DR6F 4YFUA 3EUNA 4JV1A 4ZCKA 4GMKA 1CPZA 7FDRA 5IM0A 1H74A 4KH0B 3H4BA 3SXLA 2CQBA 1Q86T 2IM3A 1O8BA 3KDOA 2O1PA 4AL6A 1Y3JA 2WRMA 3BQ1A 1GMUA 3ENQA 2DRBA 1ZM3A 2F8EX 4TYBA 1WTFA 2BJ8A 2FJAB 4WK1A 1SJFA 3Q22A 4F02A 4GKJJ 3IAM9 1T3OA 4OLOA 4ID5B 3J7A1 3IG1A 1KWMA 1XN9A 3N6LA 3FBFA 4TU7A 1F2GA 1WC4A 1XR6A 3PW0A 1Q79A 2XZDB 2VKRA 1QSLA 2KXNB 2RQKA 2FUG9 5LSRA 1HNVA 2OP5A 3R5DA 3T1HJ 3IA0A 3OL9A 3QRPA 3O8WA 3UD5A 2V9WA 3FSXA 2V2ZA 4UQTA 1PYSB 4WF9Q 3GFZA 3ET6A 3MM9A 5KOXA 4J91A 5DRKA 5K20B 1QAYA 2VHGA 2HNDB 3I96A 5CD4H 1FT8A 3TJ9A 2DBBA 3ISND 1UP1A 2W7AA 2WW4A 4OHZA 3MM8A 2Q43A 1KQFB 2J6TA 2ZHOA 1U6ZA 2ZUGA 3D0IE 3GIKA 4KGMA 1QM9A 2F8MA 3GU0A 4UOFA 1S0OA 1EKRA 3K5PA 3G8QA 1FK9A 4C3LA 2IHR1 4NI2A 4LF8F 1WTBA 3MTJA 2JOQA 3S1TA 1PYOB 4E2FB 1RWMB 2LQBA 2Q6BA 2K2PA 2KDOA 1JX4A 3QIDA 2XMVA 4ZP6A 8ATCB 2WONA 5IV3A 3HVAA 2GZOA 3EVOA 3LTOA 2GS8A 4OYAA 2ZZTA 4B08A 2CZ9A 1FD2A 5IWAJ 5LMNF 2CUYA 2SXLA 4DL2A 1RI7A 2QTWA 4O4GB 1R0CB 1LWCB 1CULA 1LW0A 2DIUA 3LANA 3O3LA 1F3FA 3UNGC 2NXCA 1A9NB 2AZ1A 1FCAA 3DOMB 2YNGB 3GJRB 5HROA 1FA0A 5FLXY 4DV2F 3AOAA 4ECRA 1WACA 1P9YA 4ZVTB 4AYBD 1DTTA 1TZ0A 4RW4B 1RWVB 2RF2B 1RWOB 1X5TA 1MN9A 4PUOA 3VAHA 3JAMY 3DMJB 2DK2A 2YNFA 4CCHA 1RHUB 4JI4F 9ATCB 4DR4J 3EPGA 4LSNA 2MKSA 2HFNA 4U95A 4B9MA 2Y1IA 3ENAA 5A6PA 4B3RF 1UTAA 4B3OA 4URSA 1EETA 1G1XA 3C16B 2JX2A 2XO7A 4RW8B 3FMBA 4RZRA 3PX6A 1RWNB 4ZP8A 1Q1KA 2OPRA 1URNA 3B78A 1AROP 3PDNA 4KT0C 3FJ2A 4B9SA 3G6YA 2H5JB 3D67A 2MQQA 3WQPA 2DR9A 2H48B 5K8OA 1RWPB 1S1XA 2EBGA 2CG4A 4DHVA 1HD1A 4ZPDA 3BBCA 2OFHX 2BJ9A 5E7OB 2OGUA 3PNIA 2HWTA 1S9EA 3VGTA 3C8YA 2UVVA 4PYAA 4P2SA 2P5VA 4NXNF 1CS4B 2HLUA 3TARA 4USWA 2DEJA 4R25A 4ECWA 5GADI 3EXCX 1FESA 2HRYA 1ZAVA 1UEVA 1SV5A 2BUNA 5BYQA 4RW9B 2M8HA 4JOUA 1O0PA 3ZZOA 2C22A 5EN1A 4JUZA 2Z4PA 4O3PA 4F4WA 4ELVA 2ZBQA 5C24B 5GAGU 2GHWA 4DMZA 2XNRA 2H4YB 4B9TA 2DHXA 4P10A 1V3ZA 4WP3A 5D0EA 5GMEA 4P72A 4DV6F 3K2YA 4UUWA 2IM2A 4OX8A 3A8EA 4CYUB 2X1BA 3H59A 4DV4J 2DHGA 2QA4G 1WHWA 1CVJA 2E9ZA 1T3NA 1HQUA 5ETSA 5KG6A 4ECZA 4ILLA 3GTYX 2W1BA 4P73A 3DCAA 1E6YB 1NPPA 4DSEA 4F2SA 2QZ8A 2KYXA 1H0HB 1F9HA 3VVUA 2R8IA 4P7VA 3T1AA 4OZNA 3WHIA 4Y2AA 2R2TA 3RU0A 1JWWA 3R5CA 1KQKA 4KHMA 3UNYA 4JYAF 2R8GA 1IKXB 1RAGB 5AJ3F 1TAUA 1XIQA 3GV5B 2J0WA 2E1RA 2XWYA 5DG9A 4XTTA 5LOQA 4OI1A 1RHKB 3IR6B 3SCIE 2ZZNA 3GYXB 5BJRA 2FLOA 4ER8A 1T9UA 4ZLLA 2LU1A 2RJZA 4WPAA 1TMMA 1WF0A 4ICLA 3LP0B 3KJFB 1NZAA 3T6JA 4J9LA 5HLFB 4EBDA 3IN5A 4DUZF 3C14A 4DQPA 2CPFA 5HQ8A 4J9OA 4JI3J 3O6QA 4LF9F 1G7CB 3M2RB 3QFHA 1Q5YA 3V4IB 1UZHA 1RYRA 2I5JA 3AH6A 3FNNA 3PKMA 3I87A 1RJJA 3OXFA 3P8BB 3CJQA 2HIYA 3FZ2A 1S49A 3IC1A 3W9IA 3OTOJ 3S01A 2NUHA 1U1NA 2JLEA 1RAAB 2AYEA 4LJMA 1U1QA 4RW6B 4KKOB 2DGSA 2YWKA 4PWDB 3TA2A 1U02A 2RQ4A 4M5KA 4WP8A 5LXRA 4WXWA 4WU2A 4FNIA 2VH7A 1M5HA 2VQEF 3K17A 3CNQP 4M5IA 2LA6A 2MQMA 3CJ8A 3OFHA 1ZZFA 2N7CA 3CDWA 2UUCJ 1XNQF 2UVWA 3TQ1A 2AX1A 2FYXA 4KGXB 4TNOA 2NR0A 5KFKA 3T3FA 2KO1A 1T03A 3FMWA 2QA1A 5L1JA 4J9MA 2RDDA 3H5YA 4MYUA 2E5HA 1OQ3A 2BABA 4NRTA 4CNZA 2DR6A 4UT4A 1S9FA 1U24A 4NYOA 4ZMMA 4KE5A 2R2RA 4FS1A 1FRXA 4FKXA 1GMVA 3J81j 1HR0F 4MKAA 2PGCA 3ILIA 3MEDA 3NS5A 5CYMA 2R2SA 3PEJA 4HACA 2AYGA 3H5UA 2Z58B 2VA3A 2HRUA 1O6XA 1VK3A 2OI2A 5GMDA 1L3SA 3PM9A 4RJVA 2QX0A 4DZ6A 2DNKA 2G0CA 4QZVB 4S0MA 2XC9A 3RAQA 4FZVA 1M1KT 3QQCD 5EWFA 1CJUA 4OYOA 3FRZA 3D1HA 4LQ9A 4R5PB 4Y65A 4UUXA 3V2UC 2YQ3A 1SCJB 6AT1B 2ACYA 4KY3A 3DHWC 4IG3B 5A2QU 2HHSA 2YH1A 2AYBA 2OEJA 1HNIB 4RBUA 4OX9F 3MM5A 2YBVA 4U96A 4OJ1A 4P74A 1EIYB 3Q83A 4BWMA 2F9DA 2BA9A 4C9DA 2VG5B 1TL7A 4Y00A 3N6NA 1RSCA 3SSQA 4M5DB 3E51A 4X4SA 3DC2A 1FKPA 3BYPA 5J1EB 3IS9B 3A8IA 2YTCA 3SCJE 2WOMB 3DU5A 2KFYA 4O3OA 1CBKA 4B9VA 4USJC 3ZTQA 3MUVP 3HHNB 2HHPA 3P4UB 1K44A 5KFIA 3VZIA 3AD8C 5IT9U 1RADB 1FX2A 2A2DA 2XMJA 1RT5A 3IRXB 2Z2LA 4OHYA 3DLKA 3RW7A 1N32J 1TV6A 2FLNA 1DQ9A 4L76A 5A8KB 1E6VA 1X9WA 4OZ5A 3OD2A 4IO9Q 2XULA 1N5SA 4PZVA 4LR7A 4JI5F 4O3RA 3TQEA 3UE2A 4QWBA 2L41A 3T9ZA 3ITHB 4FDFA 1AYEA 2QRRA 4DFKA 1GX5A 2W01A 4DR4F 5B0EA 2NXEA 2GX8A 2KJWA 1QE1A 4DDFA 3T1YJ 3EZOA 1VRUA 1S59A 2CNKB 1IBCB 3SEOA 5AXMA 2K1RA 3CDEA 1DBDA 2IA0A 2V94A 4DN0A 1MWYA 2CPEA 1HNZF 3FEXB 3VV2B 2K3IA 1M5PC 1VQSA 1YJTA 1WD6A 3CMES 4MKVA 2GVZA 2P9GA 2ZHBA 4ZIWA 2KZZA 1NNDA 2EFGA 1UFWA 1TU0B 2V34A 4OFZA 5KG0A 1U1MA 1WORA 2ASYA 4PQUA 3VQTA 1K1SA 1Y5NB 4NZ0A 3OR1A 3UCZP 2V0NA 3W66A 5EHHA 2A1BA 3R27A 1HWIA 2QLJB 2FPHX 3QJLA 3M6VA 2KM8B 3L3CA 1HIYA 4KJIA 2O67A 3HFKA 3VZHA 2HHHJ 4UY85 3TZXA 2N4DA 3OR2A 4I56A 3I6PA 1JJCB 4LRCA 2GFFA 4DQSA 2A6OA 2E9TA 2AW0A 2E66A 5M2UA 4HEA9 2GVDB 3D6MB 4IQXA 1PIEA 3SV4A 1FRJA 2EC2A 5DGBA 3BQ2A 3QRQA 1D3WA 4WE1B 4F25A 4K5RA 4P52A 2V8HA 3BB5A 1QUPA 4A8XA 3WC0A 2VG6B 2UVRA 1RT2A 4RWWA 4B9UA 2DXFA 1LWEB 2C3YA 1BQXA 2M8DB 1PGZA 2P2CB 5J2QA 4PRFA 3DLEB 1DQ8A 2C3PA 3HFVA 4M63A 2UXCF 3V81B 2HS4A 3AODA 1PCAA 3QO9B 3NOCA 2XEXA 5HQLA 2XCAA 1C1CA 3NAHA 3U7JA 2ZJQQ 3TP2A 4QPXA 1J5OA 2ADBA 4FPIA 2VC0A 3KLGB 2HVHA 1LQ9A 4OYWA 5I4MA 5KT3A 3RB0A 4LFAF 3HX9A 2LEPA 2K8GA 4PG6A 3KK1A 2GJIA 4F0HA 1F5CA 1SIWB 1QAIA 1BHNA 1U26A 4IO1A 4JI3F 2B9XA 1S1VA 4NA1A 1R43A 2AQ4A 2PI4A 2RHSB 3SCLE 2NXJA 3DDNA 5I42A 4G1PA 1PJ7A 4NMXA 5KFUA 2HURA 5A8RA 3CEDA 1RCXB 2I38A 3CB4A 1C0TA 2CKWA 1VQPS 1R8AA 1MU2B 5LSOA 3GLJA 5T7LB 3CJ2A 5L38A 2ZKUA 4DV1F 3B54A 2EKYA 2LLZA 4NLVA 4M5JA 1FD8A 3VALA 4DQRA 1RUSA 4QYRA 2F1FA 4H4KC 1JLEB 3G96A 1U2CA 1X5PA 4TKTA 4NXMJ 3ONQA 4ZP7A 3A1YG 2LDIA 4LSLB 3L09A 1IXKA 4CNYA 2D9OA 3O2IA 3D9BA 1HKAA 2GIFA 2B5JB 2RE1A 4LREA 6FD1A 3H0PA 4K4YA 5E41A 3UCUP 2XQCA 5F41A 4UZCA 1TUWA 2IJFA 3HVTA 1SL0A 1LFWA 2DNLA 3US5A 4W98A 5KT5A 2LU2A 3LQVA 3ZZUA 3M6WA 2DNHA 1LWFB 1FI4A 5DLGA 2MKCA 4AE5A 1T9TA 3GWCA 5HSPA 3UN5A 5IT4A 1ELOA 4LVOP 3DDKA 1KN6A 3UCGA 2JHEA 2FVRA 1JLBA 3TUIC 1FFGB 2MQ8A 1RDRA 5KFWA 2Y9HA 2UUBJ 4WKRA 4RKUC 2PO4A 5KFAA 3K5NA 4I6WA 2QYGA 1M5OC 3KG1A 4XPCA 1FWKA 3P49B 3Q8YA 2UUAJ 4K2JA 5L8RC 2FZGB 1WOPA 1HWJA 1YJUA 4ED8A 5DO2A 4OI4A 4QIGA 4WFZA 2VB6A 3ZZRA 2YNHB 1NHKL 1OSDA 3BYRA 2VUGA 1RT7A 1BWVA 1YWXA 2CQGA 5JVHQ 4ED4A 2EXUA 4C2MA 4LBPA 3ZTRA 2OEKA 3OSNA 1NMEB 4QR0A 2XMMA 3P3DA 3KLEA 3TW0A 1FWLA 2LECA 4EEYA 1T8EA 3RBXA 1KOHA 1PBAA 1HW9A 4LF6F 4H4OB 3KJNB 5HN0A 4QW9A 1UVNA 2RDIA 5AXLA 3C6UA 1KHWA 2YX4A 1TAQA 4GVBB 1RT6B 4USMA 1NAQA 4HTIA 3H5XA 3BM7A 1RT3A 3BKUA 5IXUA 3SSRA 1X4BA 2PFDA 1U25A 2LYVA 3QMQA 2QIFA 3SQGA 5EGYA 5D3GB 4DU8A 2D41A 3A13A 3H40A 2JJ4D 4B3TJ 1T05A 2XTJP 2V9KA 5CD4A 3PIOQ 3HVWA 4TQSA 1U2FA 2ZH5A 1KDNA 4PXDA 5LL6d 1KONA 2OPQB 1MMNA 3PO5A 1NXIA 4KO0B 1S76D 1KOOA 4KH1B 4MT1A 2K3KA 4HL9A 3O5TB 2RVJA 2QC3A 3LW5C 1H2VZ 4HI1A 1SPBP 3IO1A 3MR3A 2L3MA 2FQQB 3IXQA 2ZE2A 1BQNA 3DKDA 3DOKA 5U47A 3G87A 1YGYA 3HP6A 2R42A 1WOSA 2PEHA 4FS2A 3UO0A 1FTCA 5A8WB 4DR2J 5IQ6A 5HP1A 2I1RA 3PFEA 4FYVB 2IFXA 4FF1A 3PW7A 3LGNA 1KLMB 3OV7A 4OIXA 3VQSA 1IBMJ 3U27A 3W8PA 1WHXA 4LRBA 4FXVA 2IMWP 2RSQA 5GAHI 2FJVA 1T9XA 2E7XA 3U1LA 1N33J 3DYAB 4DV5F 3MUMP 3TO8A 3S6EA 3BBFA 3D66A 2I8EA 2OLWA 1XBWA 2MZJA 3QFWA 2PN6A 1K1QA 1YQHA 3KXDA 1YLXA 3SBMA 3C66A 1XK8A 4NLRA 2R7QA 3JSBA 1L5UA 5L1LA 1GAOA 4M5GA 2RNEA 2DNMA 2H1YA 3R7NB 2ZVSA 4USKA 4DV0J 4ECSA 1EP4B 4DJBA 1UEUA 1N48A 3FSYA 2ZJRQ 1PC4A 3KK3B 3MPDA 5AE2A 2V50A 4ITSA 3M8QA 1TL3A 2DD8S 5F8JA 2VDIA 1S1UA 5C5JA 3M8RA 3FUYA 4CDIA 2ZD1B 3QGPA 2XZWA 3JYTA 3PW2A 4ZPAA 4JI7F 2MDAA 3CJTA 4ED2A 1JLGB 1CSJA 2DNQA 1IBLF 3VGSA 3B4MA 1V6HA 2GC8A 4F4AA 2GMLA 2HGMA 1D8YA 1R8BA 4QWEA 3EVWA 3MPUB 2GGPB 4OYMA 4RNMA 1S1WB 1U1LA 3GG0A 3NGKA 3J7YI 2CJAA 1TKDA 2IYIA 1B64A 2JWNA 2NXUA 2DH8A 5A8RB 1W25A 1IJFB 4RR5A 2DXDA 3T19A 1SB6A 3KNAA 3CSKA 2HFOA 3I0RB 4EUVA 1NJYA 5BYSA 1KEKA 1TL5A 1TL4A 1RT4A 2QA2A 2EFVA 2RS8A 2MY7A 5D6GA 1MNEA 4ED7A 1UVJA 1KS2A 2KVIA 2UVUA 2C2MB 2DIVA 3JSMA 1WG5A 5C2GA 4PG4A 4DR1F 2CPZA 1SJ1A 3OSPA 1IKVB 3I5BA 2UU9F 2HHTA 4IDKA 2LXFA 2E7WA 3FC9A 2IAJB 2BACA 5C2CA 1UKUA 2JRSA 2XCPA 5KFCA 2DTJA 2C1EB 4DR7J 1SJ3P 1B3TA 4ZN3A 4USHA 1VFJA 3G2XA 1KQGB 4DG1A 2NQPA 4URGA 3RZAA 2VKZG 4XDCA 4ZHRB 3QT8A 1NPRA 2WCXA 2UUTA 1A6LA 3ZNJ1 4QWCA 3GSDA 3IBFB 1N34F 1BD6A 1NHUA 2YKMA 4Y3CA 1R6VA 4G1QB 3M32A 2PSZA 3GG1A 1TUVA 2DY9A 1I94F 2V2KA 5KG5A 1MROA 3V6HA 3GZ7A 2H5IB 5DDQC 3DLHA 2ZC3A 4PPDA 2YX1A 3VTIA 2LVWA 4WFXA 2A10A 1FRLA 1VIOA 1VC6A 3NCRA 5F8LA 2BKPA 2AT1B 3BV8A 3HT0A 3KLFA 2D3OR 1N36F 4RL1A 4ZLNA 2M3DA 5HJYA 1VC0A 4Y2IA 2X3GA 2GA7A 1VK8A 2BANB 1R8PA 1S1TB 2DGUA 2PMHA 3N6MA 2YKQA 1JJHA 1X4EA 3HXMA 3NAIA 1BQMB 2W9BA 1VBKA 5HVHA 2Z8QA 1K9MT 3JQKA 1RABB 2Q79A 3MTKA 4PCQA 1MMLA 4LUBA 3D1OA 1XMQF 4I6AA 4I2QB 4RUHA 2MSSA 2E44A 1M0SA 5C25A 1F5BA 3TVYA 4KV8A 4YHHJ 3CD7A 1RA7A 3TJ8A 1NBEB 3MAHA 1BWEA 5FIIA 3FFIA 1RWXB 3F73A 3HKWA 1FHTA 2W9AA 1NU4A 5KFLA 2DNNA 1VRQC 5CQGA 1RYSA 2B43A 2JFDA 1C1BB 1NHVA 3IR7B 4F4XA 1RWWB 3BREA 4V1Ak 3ZNUA 4Q7AA 4K2XA 4DPXA 2KM8C 2OPPA 2DVIA 1K0TA 2FC9A 2DNRA 4CLKA 1X4DA 3OQ2A 3M2VA 1X31C 2W9CB 1WKLA 4USTA 2QLFB 4P75A 2B8PA 1I51B 2XY5A 4A8SA 3FKBA 1RBOB 5E5NA 2XWXA 4Q0BA 4PQAA 5F8HA 3ENWA 3HJFA 2KTQA 3PYDA 1REVB 2LQ5A 1SL2A 3LAMA 1Y11A 2VFSA 3PR5B 2BE7D 1U48A 2QL5B 3TA1A 3GB0A 3CW2C 2DHAA 1CLFA 4EYHB 4ZN1A 3VVTA 4ZLJA 3KLIB 3E2EA 1X60A 4L73A 4RUCA 1V9OA 2GQ2A 5CYQB 1TVRA 4PWWA 4ES2A 1ZTTA 2HAFA 2CVEA 4DFMA 4TLRA 4B3TF 2FHKA 3LP2A 4IRCA 4RU2A 2B9EA 5DETA 3CC7S 2V8PA 3CJ5A 2R7UA 3EICA 1SC1B 1HPZA 2FJEB 5E3CA 4ZS6A 3NBPA 1NH7A 3MMAA 4Q43A 3DLLQ 4AD6A 5JJBA 1IN0A 4V19X 2YXLA 1R0AB 1N6QA 2FTRA 2VD3A 2FZCB 4E98A 4O44B 2BJEA 4IFYB 2PD1A 2YVSA 2EG1A 5ETKA 2OPSB 4EK2A 4NASA 2MGZB 5DQIA 1S77D 4LR9A 8AT1B 3CMQA 4I2PB 1I6JA 3C15A 5HMXA 4HR2A 5ETVA 3JTOA 2RHQB 2UZAA 3SV3A 2ZH7A 4K4UA 4A4JA 1QDUB 3OUYB 4DUYJ 5K14B 2E7VA 2PIIA 2JEJA 3ZZYA 1NUEA 3G82B 2N3OA 1SKUB 2RKIB 1JXEA 2XSJB 1GT8A 3DGPB 1FVQA 1VQ6S 1H98A 1D1UA 1UFKA 4YOEA 1N0VC 2BJ1A 1KTQA 2E1MC 4K0KF 3HO1A 3A3PB 3FRYA 1WDTA 5CAAA 1LW2A 3H5SA 4D3HA 3AXKA 5J2NB 3P96A 3BN4A 3EJMA 4UZBA 1B99A 4IFVB 1YJWS 1UW9A 2XMAA 3D6TB 1WHYA 4ZPBA 3U1NA 2LP4A 4B9LA 2W4DA 2CNNB 4M5LA 1R6YA 1OPZA 1YRXA 5HBMA 3M1VB 1Q53A 2ILYA 3QIPA 5F3TA 4EBEA 2JFKA 3VAFA 2WVCA 2Y8WA 4KHPJ 2HNZA 1D0EA 3PHEA 3IM9A 3HT3A 3DLGA 4OI6A 4IG0B 3IGVA 4LF7F 4FYDA 1SUQB 4X4UA 2HNYA 1SH0A 2MZSA 2V8DA 5F8MA 2MYFA 3OXLA 3FQKA 2DYAA 2VF3A 3DM2B 1U6BA 1C4CA 2CNLB 4TVAB 1HBNA 3OHBA 3MM6B 3ULHA 3L4BC 3DXBA 3LGMA 3TZWA 5FD1A 1XC9A 3AOCA 2HZAA 1BLUA 3KHLA 3TUZC 2JEFA 2VDHA 4IRKA 3PTWA 4N7TA 2BOPA 5IZHA 3DFEA 3AHPA 2XMUA 3GR0A 5KG7A 1U47A 3E01A 3M2UA 4ZPTR 2Z2ZA 3VGUA 1HWLA 5KT2A 4JV5F 3SCKE 4OZLA 3T41A 2PA8D 3M8ZA 3MM7B 2AP6A 2LFVA 5F0WA 1EARA 3QSIA 3TOQA 4ENOA 5AXKA 1KSPA 4NLOA 2RRBA 4I68A 1D8ZA 2G2ZA 2LCWA 2FJXA 1YIJS 4NMLA 4WTYA 3OVSA 1U7LA 3FEZA 1DTQB 4ZPVR 2W2MP 1HNXJ 2RRNA 3RRHA 3TZYA 3V6DA 1WELA 2CADA 3QYYA 1UJ6A 1KR4A 5F0UA 1XNRJ 1KBRA 5DZ6A 1AZSA 3OL6A 1F3VA 3GQCA 3BR8A 3MR6A 2XLKA 1VDHA 1WG1A 3DRSA 3JSRA 1HMVA 2QA4S 2DNGA 2KB2A 4ECQA 2FVCA 3L95X 1IQZA 3T9NA 3T5HA 2DB1A 5HMWA 3UDEA 1A0OB 2V67A 3KUGA 4Q8EA 2RMLA 3HLUA 3LWMA 5I3UB 3JS9A 4GC7A 2RUSA 2E1AA 4X64F 1QY7A 1WOOA 4JI6J 2B3TB 1FDNA 5M2RA 4C0OC 4NEZA 4JI1F 4LT6A 4IH5A 1TK5A 2FVSA 3GPAA 3TAPA 1XWLA 9RUBA 5CZXA 3KNGA 3KMQA 3UWTA 5F9NA 1S6QA 1HWUA 2R3VA 3THPA 4PABA 2HHXA 5HVFA 1SH2A 4H54A 1PKUA 2JL9A 2J76E 5KFPA 1X9SA 3PRVA 4AUKA 2H9ZA 3BH7B 2B51A 4ELTA 4K4WA 4F67A 2IC3B 2V4JB 4Y28C 4X2BA 2J8AA 4H4MB 2DHHA 1RTDB 2F8HA 3K58A 1VRTB 1JLCA 2Y0SD 4DR5F 3VAMA 5EUHA 3EE3A 2FHJD 4Y2MA 3OW2R 3QLHB 2G2OA 2W2NP 3SDEA 2F5GA 2EFOA 3NWGA 4A8QA 1M5KC 5AXNA 3TA0A 4U7UK 4ZVEA 2UUWA 2CQ3A 2F4VF 2F9JA 4IR9A 4MKBA 5IC4B 3J80Y 2C3OA 2L9DA 2H54B 4E0DA 1PO6A 5G4DA 3QT5A 3CWJA 4OYZA 5BYRA 5DZ7A 3Q2SC 5ETOA 3PFOA 1CJTB 3AAWB 2IY5B 4CP5A 3H4DA 3QRRA 4MKYA 4FF2A 1UWBB 2LQ9A 3RGIA 2R7SA 1HBUB 4X62F 3Q23A 4O3QA 5KFTA 4JBCA 1FKOB 3CJKA 2VPXB 1IUJA 4QIFA 4OZJA 3EM1A 3W2WA 2VPYB 2P6TA 3DRPA 5IFMA 1VOMA 1RTJB 3DI6B 2B9WA 2CRLA 5D0RA 2CDRB 1HQEA 5KT7A 4PWUA 1JJ4A 4NOHA 3G6ES 4M94A 1M5SA 1NSQA 2Y8YA 3D3BJ 4C8YA 4P9SA 2KH9A 4UOCA 1NJWA 3M30A 3M6UA 4QJVA 2ZM6J 1LK5A 4P2XA 4LF4J 4J9QA 4PG8A 2BEFA 1Y0HA 4KGVB 3GIIA 2XSFA 2NSBA 3BGRA 3C6TB 2DO4A 4ZVSB 4OX7A 3OVBA 3IM8A 1OQ6A 4AT1B 3OTEA 4MK7A 3AD9C 3UN2A 2Z30B 2Q3PA 1XMOJ 3PXGa 2HW3A 1U0HA 5HANA 1YJVA 1DLOA 2VQFF 3N79A 1HARA 2GMJA 3Q8RB 2PA3A 3PHTA 4ID8A 2G9OA 1VQKS 2IRYA 1ZPWX 2H65B 4ALZA 3KK2B 4MIBA 1Y10A 4OHXA 1T95A 3HHLB 2QSFA 4RPFA 2ZBRA 4EO6A 5H9EK 4WFAQ 4JP8A 1U1KA 1NH8A 1N5YA 3RBZA 1VHIA 2IRXA 3NY0A 1SC6A 3M9NB 2I0XA 5E3QA 5LM7E 3JTPA 1RTHA 3EDRB 3ZZPA 3EGWB 3PX4A 1TKZB 5KG1A 2EC0A 3MAAA 1SKSA 2QLXA 1QUVA 5L9XA 4A8WA 1S9GA 1NRKA 3PEHA 1Q95G 2HPUA 1UFLA 3MMBA 2L48A 1GXUA 4DQIA 2BOAA 1ZM4A 5DQGA 2PEBA 3MEGA 2Y1LB 3ILLA 2D9PA 3M8SA 1IBKF 4TY8B 1U8SA 1FJGF 5KFJA 1VCTA 2VICA 2H4WB 3NLCA 1T94A 3D68A 4PR6A 4NZ6A 3D54A 2ALZA 3MMCA 1C4AA 2OEMA 3RAMA 4RUBA 3BSCA 4X4NA 2CZ4A 2IVMA 3FBEA 4FXDA 2WVDA 4LIRA 4C11B 2N7YA 2YWFA 4X65F 4KTQA 5IT0A 4YS2A 4EBCA 3TAQA 2HFVA 3AXMA 2QL9B 3HK2A 5L1KA 1TKXB 4JI2J 2CJYB 5MLCV 1RK8A 4DR3F 2ZH9A 4CM2A 4AQYJ 5LT5A 4LRFA 1GMWD 1Y5LB 2AKWB 1VLYA 3GJTB 3ISNC 1OO0B 2WAQD 2CVIA 3QAUA 4MIAA 1JLAB 2C3MA 3CDBA 2GHVC 4K4SA 4MMOA 3NMAA 2ROEA 4WWSA 2AEFA 1GTHA 1GQEA 3UVJB 2DITA 1ZS6A 1RTIA 2M88A 3CJ4A 3PRDA 4YN3B 1FFWB 5FDLA 5EWEA 5HI7A 1EJ7L 2CQ0A 3PW4A 1SJRA 1GNKA 1IQTA 3OTCA 1WC6A 3ZZ0A 1S4FA 5JUMA 1GH8A 3UQSA 1NLKL 1SH3A 4RLEA 3MWBA 1YHQS 2I6WA 5D4PA 5LSLA 2VG7B 3VR1A 2BDPA 4K59A 3D0GE 2FJWA 4X66F 5J2PA 3D4JA 3G6XA 5THWA 5F8NA 2ZEJA 4LFCF 4X84A 1JLQB 2P9CA 4Q2MA 1T02A 4CO0A 4P6QA 3PX0A 2KG0A 1BY9A 4DSIA 3W9JA 2NXNA 4ECYA 3UN3A 3W8GA 1RAIB 2CJBA 2HQCA 2M0GB 1U0SA 1QLNA 4KFBB 2R4FA 1RB0A 4JI0J 5B0AA 3SI8A 5BR8F 1CJKB 3NEKA 4WK3A 4DLEA 3I9V9 2M7SA 4K4XA 2NCKL 3D28A 2UXBF 1UAWA 2FLPA 1DQAA 2D3O1 3NS7B 4Y0FA 1CJVA 4X4VA 3H98A 2A0FB 4DN9A 5HQMA 1X4CA 2OKQA 2QFJA 2UXDF 4LBIA 4GKKF 1FNXH 3KYLA 1F60B 4B3MF 4C48A 3IBWA 3RYLA 4YY3F 5B08A 3KJVB 3GV7B 3I0SB 2DR7A 4OX6A 3DOLA 5C42A 4TU9A 3VGVA 4P2FA 1HW8A 4RW7A 2JC1A 2V2VA 4YB1P 1DFDA 3M9OB 4I7FB 1NSKL 3N5FA 1QVGR 2Q1LA 1XERA 4O4RA 3PACA 1X4HA 4NCGA 1VHFA 2ZH4A 3POTB 1HNWJ 2CZVC 2WBMA 3DLJA 2BM0A 5KFQA 3R8YA 1RT1B 3GP9A 4KQZA 4NLSA 4DEZA 4Z7YA 2E9RX 4ANEA 3FGVA 2MXYA 3MECA 2BE2B 1KLNA 4OMFG 2HVDA 3GIMA 2DKOB 1HBOA 2HBZB 3H42A 1UVKA 2AGQA 3EVMA 4EI2A 4YB5A 3HVRA 4FP9A 2HVEA 3SQOP 4RBTA 1S79A 1CEZA 4HDHA 2VL1A 4KB7A 3J7Z5 3MEEA 4P7TA 4DV7F 2B6AA 1OS5A 5KFYA 1DHMA 1HYSA 4Y2KA 2OSRA 4OYXA 1TKTB 3CCRS 2IJNA 2MKKA 1IKYA 1ACMB 3RAXA 1S0VA 2BQ3A 1FKAF 4I4BA 4KGKA 4DL3A 4EGLA 2ADCA 3LP1A 2OMLA 3JXOA 3ADAC 1VQMS 3M8PB 2WSFC 1P6TA 3K7RA 3WDOA 2JLGA 2NYIA 3SFGA 4Y2CA 3TEGA 3Q2TC 4CI0B 3CJSA 3KHRA 3BQ0A 1PG5B 4CTAA 3RB4A 1S6PA 4RNFA 1TL1A 4PPZA 2AX0A 2AU0A 5H9FK 1XJWB 1Q16B 3PIPQ 3MOJB 1VBXA 3K5OA 1C0UA 2P6SA 2AHOB 2N4CA 1H2UX 1JLFA 1K47A 2R9LA 2MMYA 5J2MB 4BBYA 2YKNA 5M2PA 3R5JB 3IR5B 3H2VE 3I5CA 4ZP9A 1RTHB 4C97A 4JI8J 3TAMB 1SC4B 3CIMA 1HI1A 1FX4A 2M9KA 4HHJA 4KGZB 1OIAA 3I82A 2FVQA 3OBIA 4U7CA 4CT9A 3CCUS 2F63A 3KLVA 2BJ3A 5ETTA 3LH2S 2QLWA 3EZ5A 2NYHA 4BCAA 4Z2XA 4C8KA 5G0RB 1IKWB 5A0YA 2E5LJ 1Q78A 1RHMB 4ZVPB 3W61A 1U09A 4C0BA 2NPIA 3MI7X 4DX6A 4MFBA 3TZZA 3HMJG 1UWAA 2O66A 2ZWPA 5D78A 5DM7Q 2FLLA 1U49A 4ZVFA 2AMCB 3OTBA 5KTQA 2BMBA 4CO5A 2BX6A 4DXLA 4GRSA 2YQ1A 1FRHA 2I9SA 3NL0A 4YDDB 5E33A 2Y3YA 3DU6A 2YNIB 5A76A 1IR0A 1UETA 3EWGA 4FBUA 1RAFB 4ECVA 3KG0A 1HBMB 3PO4A 1YG0A 1MSWD 2VPZB 3L9ZA 3W2VA 5D0GA 1TR0A 4M5MA 5B0GA 4B3SF 1I1GA 5IM0B 3L7OA 3OFGA 4YUDA 4HHUA 4BC9A 3KFWX 3DRYA 2CA9A 4ZJLA 2LKZA 1O51A 1SL1A 4EWTA 3QSYB 1PC5A 4DR6J 2ZH1A 1UCNA 4R8UA 3V4MA 2HGLA 1A7GE 4YP3A 1FJ7A 3R7SB 4KYZA 4CWBA 1B7YB 4ES1A 1AW0A 2DNYA 3AT1B 2KT2A 4X4QA 4USUA 5I3QA 2XLJA 3S7RA 4N77A 2WHOA 2DH7A 2FHMA 2NZ4A 3IG1B 2MHNA 1NJZA 1Y00A 3SZ2A 1JKHA 2UV8A 1HI0P 1FWPA 1SVDA 1ROFA 4DS4A 3PV8A 3DRRA 3ZTPA 3C3LA 4DCOB 2J9DA 1URRA 2HMIA 1NB2A 4OLPA 1HNVB 1N5TA 3Q8QB 3R9LA 4YB6A 3DDIA 4ETXA 4OHWA 4ATNA 2J9CA 2VODA 1CQMA 2HVZA 4C3KA 3THTA 1S57A 2IVFB 3FVYA 2EG2A 3NXZA 2XS5A 5KFZA 3ET6B 3M9MB 3MM9B 1HD0A 3NS6A 2KL8A 3CCZA 2IDLA 3I5AA 4ED3A 4GKJF 2DGQA 2FB0A 3GYGA 2FZKB 4Z7CA 3EGZA 2EFNA 3CC2S 3CJRA 3MM8B 4WKYA 1QAJA 2JDJA 4DSFA 5H1SV 4RU9A 2CYYA 1CQNA 2EKNA 2OSQA 2F40A 2KRRA 2D7SA 2COLA 3T1HF 4ID5A 1FK9B 3AQPA 4NI2B 1TFWA 1JXLA 3VCDA 3A8JA 2GCFA 5D8HB 1IM6A 1G2EA 2WONB 2F3JA 4DPYA 2R7RA 4ZA1A 2AJFE 4FPRA 4WJBA 5DDPC 4CO3A 1KVJA 1SIZA 4LF8J 3BO4A 3MUTP 2GAGC 1CULB 2LA4A 1LW0B 1Q0NA 2YH0A 1TUGB 5J1PA 4J9VA 2VBXA 2X3DA 4KIAA 4ED0A 2HNDA 5HROB 5LMNJ 1LWXA 2J8SA 3EGVA 1RXOB 5D4OA 1TMJA 2R7XA 4OI3A 1DTTB 4EFAC 1FEEA 2HLTA 1YX2A 1WUUA 4PUOB 4IOAQ 1NSPA 4QIEA 5EX0A 3T6BA 2V8GA 2YNFB 2QO3A 5A2QY 4J90A 4LSNB 2M52A 5IWAF 4DCPB 4DV2J 4V19J 3R5GA 2OUGA 3UPFA 1ZETA 4ZCMA 4A8YA 2CPJA 4TQRA 3AY0A 4DU7A 2MLZA 3HCXA 2X7IA 4B3OB 1EETB 5BXIA 1V3SA 2ZOMA 2A6MA 2HRTA 1S12A 2X1AA 3MCSA 3JB9k 4EU0A 5B7WA 1F9FA 2K7KA 4DSKA 4JI4J 4DFJA 3CCMS 2OPRB 4X4RA 2VOPA 2HBQB 3HHLC 1Q8LA 3TVKA 4YDXA 5GAEU 1YDLA 1VGYA 4O4GA 1VYAA 1AFIA 4W90B 1LWCA 3NP5A 2APOA 2YWEA 2FHJA 1S1XB 2DRDA 4AL5A 4DPTA 3ZFVA 1VQ5S 2G0JA 3MCOA 2NPFA 2BYCA 2YX7A 4FN5A 1S9EB 3DOMA 4CQ1A 2DGXA 3I55S 2YNGA 4WTOB 1S10A 4L3KA 2JC0A 1QTMA 1KVKA 4BS2A 1WKKA 3CD5A 2G13A 3AQOA 4RW4A 4TYAA 5C7PA 2RF2A 4FYWB 1T9YA 1T7PA 1SV5B 4DI6A 3DMJA 2JSXA 2JEGA 4NXNJ 1ZZNA 3KHGA 2BVZA 1HHQA 2XHCA 3OTDA 2WB1D 4I67A 4A8FA 3M05A 3I56S 3HHEA 1NDLA 2GIRA 2DO0A 4DPWA 2HFZA 3C16A 1F6TA 3R6GB 4RW8A 5CCLA 5KT4A 5CCMA 1N56A 2AZ3A 2KI2A 4G6VB 3PRBA 1WJ9A 5HATA 4Q8FA 3SIPB 3IGNA 5F8GA 4DLGA 1N4LA 3R6LB 1AUSL 2KT3A 3OXGA 4LSZB 3CULA 2ZBCA 1S72S 3CCWA 1HQUB 3HPOA 4EYIB 1VQYA 3J7AN 4DV6J 1RA6A 3W63A 4IH7A 2HHVA 2O3DA 2Y1RI 5D4NA 1VJQA 2OAUA 3NGDA 1CS4A 1OJ4A 3DGVA 4ZIVA 1QVFR 3J81U 1QD1A 1H38A 3D7SB 2XY7A 1UA0A 3S8SA 5B09A 4ZPCA 1X0PA 2GHPA 3WZ0A 1V3RA 4QU7A 2NLWA 2Z56B 3M8YA 4ED6A 1Q8IA 4RW9A 3H25A 2V8VA 2AJ4A 4HVZA 4LMZA 1RP5A 1LV5A 4DV4F 2CWXA 1U45A 2PI5A 3P5BP 5C24A 4ICLB 2KU7A 1NK4A 4JYAJ 2CQIA 2ROPA 1R31A 3OVAA 1AFJA 2CJKA 2HBYB 3C14B 2OO4A 4ANDA 4NL5A 2OIHA 1L3TA 2GMHA 2DGWA 1JK9B 4CYUA 1N88A 1Q7LB 2HWIA 1H2TZ 2I5JB 2E5IA 5CYJA 1YI2S 2QG9B 2R8KA 2IJRA 5E2QA 3Q8UA 1Q82T 4YQWA 5HJXA 1S0MA 5HMYA 4DUZJ 1E6YA 3ELHA 4ZVGA 1PAEX 2BRLA 3R7BB 2DXEA 2NS1B 1BC6A 3KJQB 5DG7A 2XMKA 2HIQA 2BQRA 3J7YU 2YPZA 3MPWA 1S5ZA 1IKXA 5K5MA 3A12A 4M5HA 4F7VA 1S6OA 2QE5A 5IV4A 2BR0A 3CGIA 2YWGA 1N52B 5HMZA 5AE3A 3AFGA 4C3MA 3B8HA 2N82B 4WYLA 3BR9A 5KFBA 3FK4A 4ZDNA 4DOZA 2BW2A 1S48A 4CLZA 3LP0A 1T11A 1O5JA 4K8RA 5HLFA 1Z1ZA 4UQGA 2WSCC 1NO8A 5HO4A 2AV5A 3TX8A 2VQEJ 3OTOF 1WEYA 1T03B 3HD2A 3M2RA 4ZKAA 3V4IA 1JNZB 5ETNA 3PZPA 4DL4A 2W8LA 2CAJA 3C19A 1XNQJ 2AJ1A 5LXYA 5KG3A 3A8KA 2VV5A 4B02A 1GMWA 3MEDB 2HEKA 3GFYA 5CYMB 4CT8A 3BKTA 2HQDA 4HACB 1WKJA 4NLQA 2B4UA 3MD3A 1SQFA 3TUPA 3BDEA 1FNOA 4RW6A 4HH0A 4KKOA 3G86A 1Q4RA 4PWDA 2UUCF 3HJVA 2WBRA 5DJBA 1WG4A 3FQLA 2KHCA 1HR0J 2LXIA 1CJUB 2NUUG 5J1NA 4YR0A 2C2NA 3DLBA 3MCNA 4OYIA 1NKEA 1JXVA 3L7PA 4IQMA 4PXCA 5ETQA 4ETZA 3QAEA 4DX5A 5L9NA 3MM5B 4I0WA 3VAJA 3NGSA 2JVOA 2EEYA 3UR0A 5KFRA 3WX4A 2X1GA 4UW2A 4Q2LA 4DSJA 1TL7B 2OELA 2DR5A 2VPWB 1WDDA 2K06A 5DQHA 3G4SS 2JH3A 1FKPB 4OX9J 1TFYA 2C2DA 3GIRA 1U8WA 4ZLPA 3TANA 1JB0C 4A8MP 1JNRB 1XR7A 3OJUA 1S99A 1UJ4A 3H2LA 4ZJQA 2CQHA 2ZOFA 3QWUA 4RO0A 3PYFA 1OSCA 1YJNS 1RT5B 1NB7A 4MK9A 4BHQA 3CD0A 4FXWA 4DPOA 1WSVA 3G9CA 3DLKB 2DCUB 5FLXU 1EAYC 1TV6B 2RDJA 3IWLA 1E6VB 3UI3A 4DL7A 2QMXA 3NGUA 2ACMA 5JMNA 3DXSX 2V6AA 4R5PA 5CABA 2FJDB 3M8WA 2V69A 3LGHA 1NDCA 2KT5A 2RQCA 3JAMU 4IG3A 4AXIA 5KFSA 2EI5A 3BGLA 2ZVIA 4ZVHA 1RU2A 1HNIA 1QE1B 1UMJA 2MKHA 1VRUB 3DN9A 4O0IA 5GMKa 3QBCA 4CH1A 2K1RB 4JI5J 2HFUA 3Q24A 1TK0A 2VG5A 3BBBA 4X4OA 1H7XA 2W25A 4NRUA 1ZAXA 4DV3J 2IYGA 1IR1A 2EVZA 4F2RA 4MIWA 5A6WA 4M5DA 2Y1JA 5J1EA 2GVZB 1EX8A 3IS9A 5F8IA 1N32F 4DFPA 3EXYA 1RTZA 2WOMA 1Y9OA 3A3OB 4UOGA 3MF5A 2MQLA 2GQQA 2EFQA 4PQUB 1HNZJ 3PG9A 3OR1B 3IRXA 1KQSR 2IBOA 2J7WA 1UJ5A 2VASA 3MAQA 2RRAA 3NNCA 1NEEA 1B0VA 1RAEB 3T1YF 2W4CA 5A8KA 2C42A 1ICEB 3N0VA 3KHHA 1PSDA 2OJ3A 5DS7A 2F7VA 2VBYA 1V5VA 2WTFA 4WZMA 3GONA 2MTLA 3ITHA 3OR2B 1WI8A 3OHAA 2QT7A 1DRZA 3O44A 1YSJA 4WFBQ 1QTNB 3TRGA 1FF2A 5KT6A 4USIA 3J7ZT 4WXOA 4PXBA 1FJEB 2GW8A 2ZH6A 2YKAA 1R0BG 3JTNA 2IRUA 3GYNA 2HZCA 3FEYB 3RRGA 2ZZMA 2OD6A 2ZKTA 1W2BR 2VU5A 1RT2B 3A4TA 2KRBA 1NK8A 1IVZA 2R8JA 2HHHF 3TJAA 5J2QB 2JEIA 2J6UA 1PBUA 3GMGA 3OLBA 3X3UA 1SQEA 1VBZA 1DY3A 4XK8C 3MFIA 5KFOA 4QIWD 4FBTA 1FXDA 1VLOA 2IM1A 2XMTA 1FE4A 4EO8A 4DSLA 1C1CB 2D1CA 4OZ0A 1J5OB 3OPKA 2UXCJ 5CH7B 1RISA 2J7KA 2CPYA 1WEXA 2GVDA 4JB8B 4IRDA 1N54B 3TX0A 1NCLA 3KK1B 4RX6A 3NMRA 4HDGA 2DISA 4B17A 4WE1A 2WZ1A 3RB6A 2M70A 2ATCB 3G8SA 1S1VB 2VG6A 4YR3A 2E1CA 2KFNA 1LEOA 3H2UB 1B70B 3M7VA 4LFAJ 5I42B 3N01A 1YTYA 5DG8A 1LWEA 1BMQB 2WW8A 2MZ1A 3DLEA 1Z2ZA 2YPYA 1LOUA 1C0TB 2HGNA 3V81A 4MYTA 4DS5A 1LNQA 1MLAA 2W24A 1WC1A 3K8VA 1K0VA 3QO9A 3HSZA 2FY8A 1PJ6A 2E5GA 1AB8A 1SBRA 4FYXB 1X4FA 1YZ7A 4X4TA 1M90T 2RD5C 4Q44A 3DHXA 3PCOB 1LKZA 1VMBA 5HAOA 3NNAA 3THVA 4TU8A 3KLGA 1CC8A 1LFPA 3Q8VA 3CJ3A 3T5JA 4F4KA 1RWKB 2QMWA 3PJWA 1FVSA 3G8TA 4DV1J 2I2YA 5AE1A 4YEAA 2AWZA 2AJQA 1EKSA 3NCQA 3F44A 2GIQA 2EBEA 1Z4UA 4QIVA 3HVTB 3MDFA 2CPXA 4I69A 2GO8A 5B0CA 1X8DA 1TTHB 1UPMB 2PE8A 3F41A 1K8AT 2OMOA 2VOOA 2CQ4A 4ED5A 4I64A 4C8OA 2DGTA 3RR7A 2HFSA 3MPYA 4NXMF 1YBAA 1MU2A 1B7FA 2IDEA 4CLPA 2UP1A 1PAUB 2D3ZA 5T7LA 3RW6A 1I3OB 3UDLA 1L3KA 1WHVA 2NREA 1JLBB 4L3NA 1MWZA 2O5DA 1KFSA 3P45B 1UEKA 1BE4A 1HL6A 2Z2YB 3TUJC 1JLEA 2RB7A 1NKCA 2EWHA 2DCLA 4DL0C 1RAHB 2HQFA 2QEXS 2B0GA 3QZ8A 1KHVA 3ETOA 3Q86A 4LSLA 3BS9A 3EPIA 3H90A 5D77A 1OY9A 2XO6A 1Q5VA 1JJ2R 3D0HE 2B5JA 2DGVA 4WBFA 5KFVA 2HZVA 1T0TV 4CZCA 1RT7B 3OFEA 4W92B 4AXJA 4J9PA 2HQIA 2BE9B 4J5OA 3VHQA 2W8KA 1JIHA 3BO3A 4C7QA 1RKIA 1GXLA 1C2PA 3KLEB 1NJIT 1UVMA 3JSYA 5HVGA 3R97A 1GXTA 4KRWA 4C8LA 1LWFA 1NZ8A 3CC4S 4DWIA 1GK8A 2LQJA 1ZOTA 5HL7Q 1FDAA 3IRWP 3U02A 5E3PA 4AL7A 2UUBF 2RT3A 3ZC4A 3C6UB 2MZQA 3NGTA 4N8NA 4KR0B 2VFTA 2RS2A 4LF5J 2UUAF 1RT3B 2AEMA 2PDAA 1J2VA 1FO1A 1DARA 4LF6J 5KFDA 3VAGA 1FDBA 3SQGB 4JV2A 3M4XA 2M4MA 1BUXA 5ETLA 4PXEA 1I5OB 1WSRA 2L08A 1F2HA 1T05B 2AYMA 1DJ0A 4O3NA 2BJDA 1IWAA 1L3VA 3VAIA 1WEZA 2J7UA 4NLWA 5IOLA 2DPIA 4ZITA 3CIZA 4ILMA 4J9NA 3HI9A 5B0FA 3QPIA 2YNHA 4PEOA 5DGAA 2HAIA 5B0DA 3TI0A 2LDYA 2MSTA 4BDPA 1YJ9S 4NLYA 3ZXWA 2ZE2B 4DV3F 1BQNB 2AD9A 1NDKA 3DOKB 3VAKA 3FCWA 4CH7A 1P27B 1ZM9A 1L3UA 3QGGA 1X5SA 2IA6A 5HP1B 4MJKA 3B4DA 3NKYA 1RAJA 4H4OA 3RB3A 1KC8T 3MFHA 5KFMA 5CHCB 2D74B 1RHRB 2D3UA 1RT6A 4GVBA 2RIJA 4OJGA 3K8WA 3K0JA 4OYBA 1KVIA 4YB7A 4D3GA 3AOBA 1DAXA 2UV8G 4NCAA 2KHDA 2MZRA 4LR8A 4GO7X 1S7IA 3RG6A 2W4PA 3EZUA 1FRIA 3D5MA 3EMTA 3PR4A 5D3GA 4NLXA 1NM2A 2B56A 2IPOB 1MW7A 2CPIA 2AJ2A 1YRTA 2VJVA 2QMUB 4NYZA 2OPQA 3TYTA 1CC7A 4MH8A 2R8HA 4KO0A 4WYWA 2MLYA 1OWXA 2R7VA 2YKPA 4TXSA 4DR2F 3R1LA 4DV5J 5GAGI 2QJ3A 4XIUA 5LJ5Y 3MHYA 1WI6A 4F0MA 1X5OA 4F0KA 2VONA 2OHDA 3HHLD 1YK9A 1GTEA 2OTJS 3LPYA 1ZTWA 1IBMF 3M8QB 4EZ9A 1TL3B 4A46A 4Z37A 1S1UB 3RJMB 5A8WA 1SI9A 3BZQA 2AGPA 3B82A 2Z57B 1N33F 1B4SA 1FE0A 3JYTB 2DPJA 4KAIA 1X4AA 4OV6A 2J9DE 1VQ8S 1KLMA 2WB4A 3ILOA 1ULRA 1LK7A 2ASJA 2G4BA 4ES3A 4K4VA 2IVYA 3ZO7A 1FRKA 2X1FA 1B0PA 2ATLA 1TQLA 2ZH8A 1WWHA 1NK0A 3CMAS 4CM0A 3DYAA 2MY8A 4N76A 4DV0F 4JI7J 3CDUA
chains in the Genus database with same CATH topology
3UVJB 2W01A 4OZ2A 3ET6A 1CULA 3C14A 4NI2B 3C15B 2QV6A 1CJVA 1YBTA 1Y10A 4OZ3A 3MAAB 3R5GA 5D0RA 1WC6A 4CLKA 2GVDB 1WC5A 1CJUB 5D0GA 1CJTA 4USTA 1TL7A 5IV4A 4OYWA 1U0HB 1FX4A 1YK9A 4OYXA 1AZSB 3G82A 3C16A 4OYIA 4OYMA 4P2FA 1CS4B 4CLWA 1Y11A 4P2XA 4USWA 2GVZA 1WC1A 1CJKA 4CLZA 3UVJA 4CM2A 4CLPA 3ET6B 1CULB 3C14B 1CJVB 4CLSA 1AB8A 4CLLA 4OYPA 4NI2A 1WC3A 3C15A 1FX2A 4OYZA 3MAAA 4CLUA 5D15A 1WC4A 4OYBA 1YBUA 4WP8A 1CJTB 4WP9A 1TL7B 4CLFA 4USVA 2GVDA 4P2MA 1CJUA 5D0HA 4OYOA 5IV3A 1U0HA 3MR7A 3G82B 3C16B 4CLYA 2BW7A 4CM0A 1AZSA 4OYAA 4USUA 1WC0A 4CLTA 2GVZB 1CS4A 4WPAA 1CJKB 4WP3A 2WZ1A 5D0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UVJ B;  2W01 A;  4OZ2 A;  3ET6 A;  1CUL A;  3C14 A;  4NI2 B;  3C15 B;  2QV6 A;  1CJV A;  1YBT A;  1Y10 A;  4OZ3 A;  3MAA B;  3R5G A;  5D0R A;  1WC6 A;  4CLK A;  2GVD B;  1WC5 A;  1CJU B;  5D0G A;  1CJT A;  4UST A;  1TL7 A;  5IV4 A;  4OYW A;  1U0H B;  1FX4 A;  1YK9 A;  4OYX A;  1AZS B;  3G82 A;  3C16 A;  4OYI A;  4OYM A;  4P2F A;  1CS4 B;  4CLW A;  1Y11 A;  4P2X A;  4USW A;  2GVZ A;  1WC1 A;  1CJK A;  4CLZ A;  3UVJ A;  4CM2 A;  4CLP A;  3ET6 B;  1CUL B;  3C14 B;  1CJV B;  4CLS A;  1AB8 A;  4CLL A;  4OYP A;  4NI2 A;  1WC3 A;  3C15 A;  1FX2 A;  4OYZ A;  3MAA A;  4CLU A;  5D15 A;  1WC4 A;  4OYB A;  1YBU A;  4WP8 A;  1CJT B;  4WP9 A;  1TL7 B;  4CLF A;  4USV A;  2GVD A;  4P2M A;  1CJU A;  5D0H A;  4OYO A;  5IV3 A;  1U0H A;  3MR7 A;  3G82 B;  3C16 B;  4CLY A;  2BW7 A;  4CM0 A;  1AZS A;  4OYA A;  4USU A;  1WC0 A;  4CLT A;  2GVZ B;  1CS4 A;  4WPA A;  1CJK B;  4WP3 A;  2WZ1 A;  5D0E A; 
#chains in the Genus database with same CATH topology
 4CH0 S;  1P1T A;  2J6S A;  2RH3 A;  2G1D A;  4QWA A;  2EK6 A;  4PYD A;  1Q7Y T;  1IBL J;  4QU6 A;  3ISZ A;  3KG4 A;  1VQ4 S;  3MD1 A;  4CIO A;  1M5V C;  1RT4 B;  5KG4 A;  3CCJ S;  3MR2 A;  2MHE A;  4DZD A;  4UTG A;  4UY8 T;  3Q0A A;  2W7O A;  1EP4 A;  3JSM B;  1Y4Z B;  2AEJ A;  4FKY A;  4G65 A;  3D1Q A;  3KK3 A;  4IDK B;  3BPD A;  2E1P A;  4K50 A;  1OMS A;  4C6A A;  3KOA A;  4EMD A;  4HHH A;  4N56 A;  1F1B B;  2CDQ A;  3N4W A;  3HSD A;  1QJH A;  2C28 A;  1SKW A;  2ZD1 A;  2MJN A;  3PYE A;  1KTV A;  3FSI A;  3GV8 B;  3PJ9 A;  5AT1 B;  4DR1 J;  4NA2 A;  1TP7 A;  2PMW A;  1JLG A;  4DG1 B;  1D9F A;  5ITH A;  2UU9 J;  3TEH B;  2FC8 A;  3BO2 A;  1ZA1 B;  5KFF A;  4CLT A;  4MTP A;  2A3J A;  1NJX A;  4RNH A;  2GGP A;  4HI2 A;  2YKM B;  3QJJ A;  1S1W A;  2AF6 A;  2RU9 A;  5KFX A;  3M32 B;  1J27 A;  3NCP A;  3MPV A;  1GFW B;  1WF1 A;  4OJH A;  4F3M A;  1N5V A;  3W9H A;  3F56 A;  3I0R A;  2CPD A;  1MRO B;  1N34 J;  3FCH A;  4U6P A;  2MJU A;  2KYZ A;  4ZK7 M;  2BKO A;  3R5B A;  2XZT B;  2Y0B B;  2AGO A;  4N8O A;  1Y7P A;  4DR7 F;  1OY6 A;  4K7Q A;  2PMZ D;  4HLB A;  1YZ6 A;  1H73 A;  2F4F A;  1I94 J;  1QSS A;  1IKV A;  2AJ0 A;  4ANC A;  1FNM A;  2IAJ A;  3R3T A;  2HQ3 A;  3KLF B;  1NK6 A;  4QOT A;  3CD6 S;  3CO0 P;  2POK A;  5T41 A;  3HZG A;  5K9F A;  3HDS A;  4C8M A;  1J5E J;  3QAT A;  1NK9 A;  3PKY A;  2V68 A;  2PT0 A;  3IAS 9;  2B8Q A;  5RUB A;  4LBH A;  2CXE A;  1IM4 A;  2BM1 A;  3W5Y A;  4DF4 A;  2GO9 A;  2XS2 A;  3VWS A;  4J9S A;  4ZHR A;  2W9B B;  3TVZ A;  4WZQ A;  1N36 J;  3ILJ A;  3LO3 A;  2B4V A;  5DLF A;  1SXL A;  3E8O A;  2VFR A;  1RHQ B;  4G1Q A;  5SUH A;  1EQM A;  3HZE A;  3GR1 A;  3QGH A;  3N9U C;  2OH2 A;  5FJ4 A;  1NSA A;  2FGC A;  3RRK A;  2IBK A;  5C25 B;  3BN7 A;  1P8G A;  4KV8 B;  4F50 A;  1UA1 A;  3FFI B;  3HUL A;  3P5T L;  2C2Z B;  4IKA A;  1U1P A;  2G1H A;  5MAO A;  3CPW R;  5KAK A;  4DUT A;  1XMQ J;  3BGF A;  1MMD A;  1S0N A;  1N5Q A;  3MZI A;  3W5X A;  2XYG B;  1MWQ A;  3NNH A;  2OPP B;  4M5N A;  2FVP A;  2GNK A;  3M2V B;  5SZT A;  2OTL S;  3MOZ A;  1REG X;  2BAN A;  1RE1 B;  4C8Z A;  1X9M A;  2ZH2 A;  4LFB J;  4Q0B B;  1S1T A;  3QNW B;  5E3A A;  1HQ2 A;  1WC0 A;  3CE8 A;  4C0H A;  1BQM A;  4F26 A;  4FNH A;  3UD3 P;  2XB2 D;  4YHH F;  3IBC B;  1RLC L;  3AA8 A;  1V5I B;  4LF5 F;  1G3O A;  5GAE I;  4RWX A;  3KMS A;  1AXQ A;  4I2Q A;  2ZC4 A;  1TVR B;  3NGR A;  4TY9 A;  5LMU J;  2KZM A;  3FBC A;  7AT1 B;  3LP2 B;  1XTZ A;  2FDN A;  3WBZ A;  2KN4 A;  5HK4 A;  2R7T A;  2BBE A;  3TNV A;  3X1L B;  2MKY A;  2V4Q A;  3HSG A;  1U4B A;  2CJQ A;  1C1B A;  2RU3 A;  1HPZ B;  1VIS A;  1MG7 A;  3O1L A;  5D15 A;  2GQC A;  3NBP B;  3MMA B;  1KP6 A;  2VFU A;  4USV A;  1IWG A;  4K5S A;  3R2C J;  5D0H A;  2W9C A;  4DQQ A;  1N6Q B;  4LRA A;  3W7B A;  5E0O A;  1FDD A;  4O23 A;  2DHS A;  3FBB A;  1REV A;  5ETR A;  1P1L A;  2HKE A;  4RNN A;  5L46 A;  5KFH A;  3C15 B;  3VF0 B;  1VQO S;  4L72 B;  2W7P A;  3RTV A;  3KUE A;  4NPO A;  4EZ6 A;  3KLI A;  2B7C B;  2XBP A;  4NEY A;  3BPS P;  3T5K A;  3QJP A;  5CYQ A;  2J0X A;  2ZJP Q;  2YWH A;  4WFN Q;  4DX7 A;  2MQP A;  4U9R A;  2P9E A;  4LQ3 A;  1UW4 A;  2GJ2 A;  3OT9 A;  2MEW A;  3D6F B;  1VR6 A;  3W60 A;  2VA2 A;  2KXF A;  1LW2 B;  5KFE A;  1U6F A;  4ZJO A;  4QYZ K;  2JVR A;  3PW5 A;  1R8H A;  3V6K A;  1FEH A;  1GX6 A;  4A48 A;  4KSE B;  3D3C J;  2HBR B;  1QSY A;  4KC5 A;  4ZVQ B;  2GAH C;  1ZPV A;  2CFX A;  5HBM B;  4K0K J;  3AA9 A;  1R0A A;  3QIP B;  1W2I A;  1FXR A;  4HH1 A;  4O44 A;  2CQD A;  2WVE A;  4IFY A;  1SJ4 P;  5GAD U;  1VQL S;  4DUY F;  4GVL A;  4QW8 A;  1ZYQ A;  2P8I A;  2MPU A;  4Q5V A;  2HNZ B;  2OPS A;  4YME A;  3DLG B;  2MGZ A;  3A3N B;  4I2P A;  4O0N A;  3CUN A;  1R8C A;  1R27 B;  4KBI A;  1WC5 A;  1X7V A;  2EFP A;  2HNY B;  2W2Q P;  2ZH3 A;  4ELU A;  4NLD A;  3OUY A;  4OI0 A;  5K14 A;  2C3U A;  5CXT A;  2DRA A;  2H51 B;  3HM9 A;  3G82 A;  2RKI A;  3RBE A;  2XSJ A;  3DGP A;  1HI8 A;  5IC6 B;  4LF7 J;  1HBN B;  1RBA A;  4WII A;  4A47 A;  3W65 A;  5J2N A;  1YBU A;  2ZIT A;  4DL6 A;  4IFV A;  4KHP F;  4P2M A;  3E01 B;  2C2K B;  5GVQ A;  3M2U B;  3LPE A;  4Q45 A;  1UVI A;  2BV3 A;  2XYP B;  3M1V A;  2M5Y A;  1RWU A;  3PYG A;  4RNO A;  2JLF A;  4J9R A;  3K59 A;  1UL3 A;  3ZTS A;  4DF8 A;  2B9Y A;  4JV5 J;  3RUB L;  3V6D B;  1D9A A;  3QT6 A;  4IG0 A;  2FY1 A;  2FHO B;  2CWK A;  1U1O A;  3I4H X;  4ZVO B;  4ZVU B;  1SUQ A;  3SFU A;  4CO4 A;  4KHR A;  2V63 A;  2EPI A;  2HG4 A;  4UF4 A;  1AZS B;  2HQG A;  3GE9 A;  8RUC A;  3DRS B;  3CCT A;  1RAO A;  2HSE B;  3AD7 C;  4P71 A;  4F4Y A;  4N47 A;  3CCV S;  1HMV B;  3DM2 A;  3UFC X;  2L9N A;  3BSN A;  4LRD A;  1LXJ A;  4HT5 A;  3MM6 A;  4XDD A;  3EX7 B;  4DCJ B;  4JV0 A;  4F04 B;  4PAA A;  2DEI A;  2RIL A;  2ZNY A;  3CO9 A;  4ZOS A;  1S6U A;  4M95 A;  1PYT A;  4HKQ A;  3W64 A;  3DNC A;  3ZZT A;  1HNX F;  1R89 A;  3M6X A;  1RCO B;  2VZ9 A;  2OD4 A;  1BGX T;  2ZOG A;  3MM7 A;  2DNP A;  3ZZZ A;  4IUF A;  2QSW A;  5EWG A;  1XNR F;  2BRK A;  2RQM A;  1MN7 A;  1J5E F;  1HWK A;  2ASD A;  1S6Q B;  3R2D J;  4X64 J;  1DTQ A;  1ITP A;  1VQ7 S;  4TN2 A;  1NKB A;  2GV1 A;  4OL8 A;  3GJS B;  2CPH A;  1RBL A;  4U67 Q;  5B0B A;  1NPK A;  4JI1 J;  1M1G A;  2GJF A;  2ZUA A;  7FD1 A;  5KOW A;  1FER A;  3LUY A;  4J9U E;  4F36 A;  2B4O A;  1VI7 A;  1B0T A;  3W62 A;  1FFS B;  2C2O B;  4JI6 F;  2ILZ A;  1JLC B;  2R7W A;  4CLU A;  4XAK A;  4WIQ A;  2JNJ A;  4N5S A;  1SJQ A;  2A2C A;  3SDE B;  4TLQ A;  3KKF A;  3EYZ A;  2VBW A;  3C46 A;  2BQU A;  3ICL A;  5I3U A;  4A8O A;  3CF5 Q;  3NRB A;  1AUD A;  4IH6 A;  1YRU A;  2HS0 A;  4L75 A;  3U1M A;  1NDP A;  4AFF A;  4URQ U;  3K89 A;  4DR5 J;  4QQB A;  2Q66 A;  4IOB A;  4NZ7 A;  1LXN A;  2KVQ E;  2F4V J;  2MLX A;  2ZNZ A;  1WNE A;  4LFB F;  3Q8S B;  3LA0 A;  2QLB B;  3HSJ A;  4LF2 A;  3CJK B;  4NWB A;  2C2R A;  1ZAW A;  1H7W A;  4DBQ A;  3W2W B;  4QR2 A;  3DRP B;  4WFY A;  4ZCL A;  2H5E A;  4RBV A;  2IC3 A;  1YKW A;  2V4J A;  4CO1 A;  3Q89 A;  4H4M A;  1HQE B;  1G4C A;  1RTD A;  3MUR P;  4X62 J;  2MKI A;  3SSS A;  1VRT A;  2V2Q A;  5IQQ A;  1KRP A;  3PY8 A;  5LMU F;  3QLH A;  3H7H B;  1EHW A;  4KPC A;  4FF4 A;  2MQO A;  2XHW A;  2BZ2 A;  3M30 B;  2CQ2 A;  2JZ5 A;  4Y34 A;  1RHJ B;  2HHW A;  2FJB B;  3KWM A;  3CXC R;  3IWN C;  3BGR B;  2KKH A;  3UDC A;  4K4T A;  3TR5 A;  3BEG B;  3W3S A;  2XM3 A;  1X4G A;  1CJT A;  1UPP A;  3IP0 A;  1ZM2 A;  4OQJ A;  3EDQ B;  1U0H B;  1D9D A;  3CVK A;  1UWB A;  1DLO B;  1HBU A;  3QWP A;  3FDS A;  1FKO A;  3EGN A;  2HK3 A;  3BJY A;  3CCL S;  1YVF A;  2VIH A;  3I31 A;  3BF4 A;  1RTJ A;  3DI6 A;  2ZM6 F;  1VQN S;  4DX8 H;  3PJX A;  4LF4 F;  1XQI A;  2VQF J;  2KG1 A;  1RKJ A;  2CQP A;  5E3R A;  4BWJ A;  3MGJ A;  5DDR C;  2DH9 A;  1N5Y B;  2J9E A;  2DT9 A;  2ALY B;  1Z2L A;  1RU1 A;  2ZFH A;  4OV1 A;  4FVC A;  4F3O A;  1YJ7 A;  5KFN A;  3NG8 A;  1XMO F;  4K4Z A;  2QL7 B;  3LF0 A;  2XY6 A;  1H72 C;  2LQ8 A;  3GSI A;  3MAA B;  4RUA A;  1IR2 A;  3C6T A;  3ETM A;  2LEB A;  1S9G B;  2YY3 A;  3MEK A;  4DPU A;  4R0J A;  3MMB B;  1RQ0 A;  2KXH A;  4NLU A;  4UOH A;  2EW9 A;  3MEG B;  3BGO P;  5EX3 A;  3H8Y A;  4F3Q A;  2D69 A;  2DJW A;  2MB0 B;  3GIJ A;  2RAQ A;  3D2W A;  2XYH B;  2NSC A;  3MMC B;  3B6B A;  1H3D A;  2LXU A;  3HFZ B;  4L6V 3;  3KK2 A;  1G6B A;  1OPI A;  1Q8B A;  3AJ2 A;  3HHL A;  1F5A A;  1UVL A;  2CIM A;  3G6V A;  4WP9 A;  3ZTO A;  1IBK J;  3SYZ A;  1M1H A;  1OY8 A;  2E29 A;  1D09 B;  1T9V A;  5F3Z A;  1FJG J;  3CCQ S;  1KFD A;  2BJ7 A;  4Y6I A;  3MR7 A;  1HFE L;  5KG2 A;  3AB2 B;  2WVF A;  3BKF A;  4ERD A;  5DDO C;  2MQN A;  1SKR A;  1JMT A;  2HHU A;  3KLH A;  2WK4 A;  4G1I A;  4J7C A;  2J0S D;  4IYQ A;  1R7I A;  2ZHA A;  2RUG A;  4R0E A;  4A8K A;  4X65 J;  3HHD A;  2PC6 A;  2BXJ A;  1TKZ A;  4W4M A;  5T14 A;  1PJ5 A;  1VIX A;  1XEZ A;  2E5J A;  2Z0G A;  3WX8 A;  1RLD A;  4NLG A;  1HHT P;  1AT1 B;  4QYZ J;  2R2U A;  4DR3 J;  3IMQ J;  3C2P A;  2H3E B;  3JQM A;  4NE9 C;  2MKJ A;  2C2E A;  4TY8 A;  4YR2 A;  3FZB A;  4ECT A;  2V4R A;  1RTI B;  3QGI A;  5FDL B;  2CQ1 A;  3IFE A;  4NLT A;  4OYP A;  4I1T A;  5H9E J;  2XLI A;  4JI2 F;  4XPE A;  4CRJ A;  2M2B A;  5CA5 A;  2KFZ A;  4C4W A;  3TWZ A;  4AQY F;  2FIU A;  3OL8 A;  2EK1 A;  4C11 A;  2HWH A;  4HT7 A;  2WVB A;  3R5A A;  3G71 S;  4IR1 A;  2DR8 A;  1EZZ B;  5J2P B;  1TKX A;  1VJW A;  1IJE B;  4OZ2 A;  3BH6 B;  1YBT A;  2QYC A;  4WCE Q;  1FTR A;  2Z2M A;  2ZWO A;  1ZH5 A;  1F9E B;  2KJV A;  2CQC A;  4X66 J;  1JLA A;  3I32 A;  3QT7 A;  4NYP A;  5CZV A;  2DNZ A;  3GFX A;  2VJU A;  1Q8K A;  5L1I A;  6FDR A;  4QBU A;  4N41 A;  4LFC J;  2N3L A;  3F0N A;  1KNZ A;  3Q8P B;  1K73 T;  3GIL A;  4NX9 A;  3D6H B;  2ROG A;  3UVJ A;  1XMB A;  3FCV A;  1CJV B;  1UZD A;  3UDV A;  4CLS A;  2WSE C;  4CLL A;  4BLG A;  1YJR A;  2FD2 A;  1NK7 A;  1EQ0 A;  3UR3 C;  3UD4 P;  2PFF B;  1QAX A;  2XGQ A;  3CT9 A;  3PVX A;  5BR8 J;  1EB0 A;  1W26 A;  4MK8 A;  4C98 A;  3BSA A;  3DOL B;  2U2F A;  5C42 B;  2UXB J;  2J0Q D;  1Y3K A;  2VG7 A;  4RW7 B;  1CG2 A;  1TEL A;  2CJ9 A;  1TK8 A;  3K5L A;  3LAL A;  1U1R A;  2UXD J;  2XGP A;  4GKK J;  4MAK A;  3GCW P;  4B3M J;  4JI0 F;  1S7H A;  4PKD B;  5LJ3 Y;  1RAC B;  4M8L A;  4YY3 J;  1SQG A;  3E3X A;  4NCG B;  3BDP A;  2XNQ A;  1JLQ A;  2VBZ A;  3WC2 A;  3V5R A;  1S97 A;  3OJS A;  5JVG Q;  5ETM A;  5L39 A;  4U7U D;  3CCE S;  1HHS A;  4WU3 A;  2HHQ A;  3NOG A;  3KTQ A;  4B9N A;  1P9Q C;  3J80 U;  4FF3 A;  2Q6C A;  4KFB A;  2BKN A;  3MEC B;  1ZA2 B;  3BSO A;  1HBO B;  1CJK A;  4OJ3 A;  4O3S A;  2ZBI A;  3W5Z A;  3MCM A;  2AIR B;  1S4E A;  1Q81 T;  3V6J A;  5DM6 Q;  4QPT A;  3MEE B;  4OZ1 A;  1FXL A;  1X0F A;  2B6A B;  1RZM A;  2W2P P;  3UW1 A;  3ENV A;  1HYS B;  1H6K X;  4NA3 A;  2DY1 A;  4C8N A;  4LIW A;  2V5H G;  1FRM A;  1GEH A;  2R7O A;  4LF1 A;  4CLY A;  2BW7 A;  3KJV A;  3I0S A;  2XS7 A;  1NK5 A;  1IKY B;  1R3N A;  4G3I A;  1HNW F;  3GCX P;  1OYE A;  2DNO A;  4NCB A;  3R1H A;  4DV7 J;  3LP1 B;  2QV6 A;  3IWX A;  4I7F A;  1U2R A;  3GJQ B;  4OZ3 A;  2B4P A;  4F4Z A;  4H4K A;  3AB4 B;  1JQG A;  3KDN A;  3KUH A;  2XI2 A;  3NWR A;  3T5L A;  1RGV A;  2YKO A;  3OFF A;  3POT A;  4B3R J;  4U8V A;  4CTA B;  5ADZ A;  4J37 A;  1RT1 A;  2QN6 B;  2FGO A;  1S6P B;  5K8M A;  2B7B B;  1YIT S;  4XO0 A;  1TL1 B;  3MMJ A;  3HKZ D;  4ECU A;  4CLW A;  5IT9 Y;  4J9K A;  1ZBT A;  4ECX A;  1HA1 A;  1Y5I B;  2BE2 A;  1DUR A;  3P6Y C;  1C0U B;  3I9Z A;  4CO2 A;  1VBY A;  2U1A A;  4ILR A;  5K8P A;  5I3P A;  1JLF B;  4NLP A;  2CG8 A;  2YKN B;  4M1K A;  5EDW A;  4GO5 X;  2ZBP A;  5F9L A;  2F65 A;  4ZVR B;  5ETP A;  4KPY A;  1N0U A;  3LAK A;  2XG8 A;  2XI3 A;  2LEA A;  1TKT A;  4U8Y A;  3CCS S;  1KKH A;  2G2Y A;  4FYY B;  5IS2 A;  3GFH A;  1VQ9 S;  3AJ1 A;  2NZC A;  1DZ5 A;  3CDA A;  4ZPW R;  1AA1 B;  3WIU A;  4QR1 A;  4LVN P;  5A0Y B;  1VS3 A;  4I6Y A;  2X51 A;  2IIH A;  3OLA A;  4GC6 A;  3MXH P;  2J5A A;  4E8U A;  4PG7 A;  4MFB B;  5JXS A;  3M8P A;  3OL7 A;  2HK2 A;  3MR5 A;  2IMO A;  3DRX A;  3RR8 A;  4HYK A;  3HF5 A;  3CTR A;  2OFG X;  2IM0 A;  2HVI A;  2W2O P;  3K5M A;  4JI8 F;  4QCL A;  3LOU A;  4OHV A;  2A18 A;  3HD1 A;  4FVM A;  1KD1 T;  2ZDO A;  1T9W A;  3I4P A;  2XMW A;  2CJX B;  3K57 A;  3L7U A;  2YWW A;  1PIL A;  3KLH B;  2QFI A;  3W2V B;  4F8R A;  4CLF A;  2G0I A;  2DGO A;  5J2M A;  1APS A;  5GAH U;  2ZDP A;  5KFG A;  2QGF B;  2E5L F;  3TAM A;  4BC7 A;  2ERR A;  1FJC A;  4OI2 A;  3WIV A;  3W1Y C;  2LMI A;  3AJD A;  3BGU A;  1SC3 B;  1W7W A;  4R8U B;  1N8R T;  3CJ0 A;  3J81 Y;  3QZ7 A;  4B3S J;  1OYD A;  1HLW A;  5G0R A;  1IKW A;  3JQJ A;  2YQ0 A;  2VFV A;  1BXN A;  4IOC Q;  3N28 A;  2HS3 A;  5AJ3 J;  3LWL A;  2O01 C;  2ABY A;  5H9F J;  2L9W A;  5D4L A;  2HYI B;  2K7J A;  3SMZ A;  4DL5 A;  1WF2 A;  4QWD A;  4ED1 A;  3RBD A;  1XR5 A;  1JKH B;  4L74 A;  5K8N A;  3HHK A;  2VC1 A;  1VC5 A;  4X4P A;  3DRR B;  3H20 A;  4PG5 A;  2YNI A;  1WC3 A;  2CNO B;  1F0X A;  4ZCI A;  4HTJ A;  2MZT A;  4LF9 J;  3N5B A;  2ASL A;  2HMI B;  1HBM A;  4DR6 F;  4YFU A;  3EUN A;  4JV1 A;  4ZCK A;  4GMK A;  1CPZ A;  7FDR A;  5IM0 A;  1H74 A;  4KH0 B;  3H4B A;  3SXL A;  2CQB A;  1Q86 T;  2IM3 A;  1O8B A;  3KDO A;  2O1P A;  4AL6 A;  1Y3J A;  2WRM A;  3BQ1 A;  1GMU A;  3ENQ A;  2DRB A;  1ZM3 A;  2F8E X;  4TYB A;  1WTF A;  2BJ8 A;  2FJA B;  4WK1 A;  1SJF A;  3Q22 A;  4F02 A;  4GKJ J;  3IAM 9;  1T3O A;  4OLO A;  4ID5 B;  3J7A 1;  3IG1 A;  1KWM A;  1XN9 A;  3N6L A;  3FBF A;  4TU7 A;  1F2G A;  1WC4 A;  1XR6 A;  3PW0 A;  1Q79 A;  2XZD B;  2VKR A;  1QSL A;  2KXN B;  2RQK A;  2FUG 9;  5LSR A;  1HNV A;  2OP5 A;  3R5D A;  3T1H J;  3IA0 A;  3OL9 A;  3QRP A;  3O8W A;  3UD5 A;  2V9W A;  3FSX A;  2V2Z A;  4UQT A;  1PYS B;  4WF9 Q;  3GFZ A;  3ET6 A;  3MM9 A;  5KOX A;  4J91 A;  5DRK A;  5K20 B;  1QAY A;  2VHG A;  2HND B;  3I96 A;  5CD4 H;  1FT8 A;  3TJ9 A;  2DBB A;  3ISN D;  1UP1 A;  2W7A A;  2WW4 A;  4OHZ A;  3MM8 A;  2Q43 A;  1KQF B;  2J6T A;  2ZHO A;  1U6Z A;  2ZUG A;  3D0I E;  3GIK A;  4KGM A;  1QM9 A;  2F8M A;  3GU0 A;  4UOF A;  1S0O A;  1EKR A;  3K5P A;  3G8Q A;  1FK9 A;  4C3L A;  2IHR 1;  4NI2 A;  4LF8 F;  1WTB A;  3MTJ A;  2JOQ A;  3S1T A;  1PYO B;  4E2F B;  1RWM B;  2LQB A;  2Q6B A;  2K2P A;  2KDO A;  1JX4 A;  3QID A;  2XMV A;  4ZP6 A;  8ATC B;  2WON A;  5IV3 A;  3HVA A;  2GZO A;  3EVO A;  3LTO A;  2GS8 A;  4OYA A;  2ZZT A;  4B08 A;  2CZ9 A;  1FD2 A;  5IWA J;  5LMN F;  2CUY A;  2SXL A;  4DL2 A;  1RI7 A;  2QTW A;  4O4G B;  1R0C B;  1LWC B;  1CUL A;  1LW0 A;  2DIU A;  3LAN A;  3O3L A;  1F3F A;  3UNG C;  2NXC A;  1A9N B;  2AZ1 A;  1FCA A;  3DOM B;  2YNG B;  3GJR B;  5HRO A;  1FA0 A;  5FLX Y;  4DV2 F;  3AOA A;  4ECR A;  1WAC A;  1P9Y A;  4ZVT B;  4AYB D;  1DTT A;  1TZ0 A;  4RW4 B;  1RWV B;  2RF2 B;  1RWO B;  1X5T A;  1MN9 A;  4PUO A;  3VAH A;  3JAM Y;  3DMJ B;  2DK2 A;  2YNF A;  4CCH A;  1RHU B;  4JI4 F;  9ATC B;  4DR4 J;  3EPG A;  4LSN A;  2MKS A;  2HFN A;  4U95 A;  4B9M A;  2Y1I A;  3ENA A;  5A6P A;  4B3R F;  1UTA A;  4B3O A;  4URS A;  1EET A;  1G1X A;  3C16 B;  2JX2 A;  2XO7 A;  4RW8 B;  3FMB A;  4RZR A;  3PX6 A;  1RWN B;  4ZP8 A;  1Q1K A;  2OPR A;  1URN A;  3B78 A;  1ARO P;  3PDN A;  4KT0 C;  3FJ2 A;  4B9S A;  3G6Y A;  2H5J B;  3D67 A;  2MQQ A;  3WQP A;  2DR9 A;  2H48 B;  5K8O A;  1RWP B;  1S1X A;  2EBG A;  2CG4 A;  4DHV A;  1HD1 A;  4ZPD A;  3BBC A;  2OFH X;  2BJ9 A;  5E7O B;  2OGU A;  3PNI A;  2HWT A;  1S9E A;  3VGT A;  3C8Y A;  2UVV A;  4PYA A;  4P2S A;  2P5V A;  4NXN F;  1CS4 B;  2HLU A;  3TAR A;  4USW A;  2DEJ A;  4R25 A;  4ECW A;  5GAD I;  3EXC X;  1FES A;  2HRY A;  1ZAV A;  1UEV A;  1SV5 A;  2BUN A;  5BYQ A;  4RW9 B;  2M8H A;  4JOU A;  1O0P A;  3ZZO A;  2C22 A;  5EN1 A;  4JUZ A;  2Z4P A;  4O3P A;  4F4W A;  4ELV A;  2ZBQ A;  5C24 B;  5GAG U;  2GHW A;  4DMZ A;  2XNR A;  2H4Y B;  4B9T A;  2DHX A;  4P10 A;  1V3Z A;  4WP3 A;  5D0E A;  5GME A;  4P72 A;  4DV6 F;  3K2Y A;  4UUW A;  2IM2 A;  4OX8 A;  3A8E A;  4CYU B;  2X1B A;  3H59 A;  4DV4 J;  2DHG A;  2QA4 G;  1WHW A;  1CVJ A;  2E9Z A;  1T3N A;  1HQU A;  5ETS A;  5KG6 A;  4ECZ A;  4ILL A;  3GTY X;  2W1B A;  4P73 A;  3DCA A;  1E6Y B;  1NPP A;  4DSE A;  4F2S A;  2QZ8 A;  2KYX A;  1H0H B;  1F9H A;  3VVU A;  2R8I A;  4P7V A;  3T1A A;  4OZN A;  3WHI A;  4Y2A A;  2R2T A;  3RU0 A;  1JWW A;  3R5C A;  1KQK A;  4KHM A;  3UNY A;  4JYA F;  2R8G A;  1IKX B;  1RAG B;  5AJ3 F;  1TAU A;  1XIQ A;  3GV5 B;  2J0W A;  2E1R A;  2XWY A;  5DG9 A;  4XTT A;  5LOQ A;  4OI1 A;  1RHK B;  3IR6 B;  3SCI E;  2ZZN A;  3GYX B;  5BJR A;  2FLO A;  4ER8 A;  1T9U A;  4ZLL A;  2LU1 A;  2RJZ A;  4WPA A;  1TMM A;  1WF0 A;  4ICL A;  3LP0 B;  3KJF B;  1NZA A;  3T6J A;  4J9L A;  5HLF B;  4EBD A;  3IN5 A;  4DUZ F;  3C14 A;  4DQP A;  2CPF A;  5HQ8 A;  4J9O A;  4JI3 J;  3O6Q A;  4LF9 F;  1G7C B;  3M2R B;  3QFH A;  1Q5Y A;  3V4I B;  1UZH A;  1RYR A;  2I5J A;  3AH6 A;  3FNN A;  3PKM A;  3I87 A;  1RJJ A;  3OXF A;  3P8B B;  3CJQ A;  2HIY A;  3FZ2 A;  1S49 A;  3IC1 A;  3W9I A;  3OTO J;  3S01 A;  2NUH A;  1U1N A;  2JLE A;  1RAA B;  2AYE A;  4LJM A;  1U1Q A;  4RW6 B;  4KKO B;  2DGS A;  2YWK A;  4PWD B;  3TA2 A;  1U02 A;  2RQ4 A;  4M5K A;  4WP8 A;  5LXR A;  4WXW A;  4WU2 A;  4FNI A;  2VH7 A;  1M5H A;  2VQE F;  3K17 A;  3CNQ P;  4M5I A;  2LA6 A;  2MQM A;  3CJ8 A;  3OFH A;  1ZZF A;  2N7C A;  3CDW A;  2UUC J;  1XNQ F;  2UVW A;  3TQ1 A;  2AX1 A;  2FYX A;  4KGX B;  4TNO A;  2NR0 A;  5KFK A;  3T3F A;  2KO1 A;  1T03 A;  3FMW A;  2QA1 A;  5L1J A;  4J9M A;  2RDD A;  3H5Y A;  4MYU A;  2E5H A;  1OQ3 A;  2BAB A;  4NRT A;  4CNZ A;  2DR6 A;  4UT4 A;  1S9F A;  1U24 A;  4NYO A;  4ZMM A;  4KE5 A;  2R2R A;  4FS1 A;  1FRX A;  4FKX A;  1GMV A;  3J81 j;  1HR0 F;  4MKA A;  2PGC A;  3ILI A;  3MED A;  3NS5 A;  5CYM A;  2R2S A;  3PEJ A;  4HAC A;  2AYG A;  3H5U A;  2Z58 B;  2VA3 A;  2HRU A;  1O6X A;  1VK3 A;  2OI2 A;  5GMD A;  1L3S A;  3PM9 A;  4RJV A;  2QX0 A;  4DZ6 A;  2DNK A;  2G0C A;  4QZV B;  4S0M A;  2XC9 A;  3RAQ A;  4FZV A;  1M1K T;  3QQC D;  5EWF A;  1CJU A;  4OYO A;  3FRZ A;  3D1H A;  4LQ9 A;  4R5P B;  4Y65 A;  4UUX A;  3V2U C;  2YQ3 A;  1SCJ B;  6AT1 B;  2ACY A;  4KY3 A;  3DHW C;  4IG3 B;  5A2Q U;  2HHS A;  2YH1 A;  2AYB A;  2OEJ A;  1HNI B;  4RBU A;  4OX9 F;  3MM5 A;  2YBV A;  4U96 A;  4OJ1 A;  4P74 A;  1EIY B;  3Q83 A;  4BWM A;  2F9D A;  2BA9 A;  4C9D A;  2VG5 B;  1TL7 A;  4Y00 A;  3N6N A;  1RSC A;  3SSQ A;  4M5D B;  3E51 A;  4X4S A;  3DC2 A;  1FKP A;  3BYP A;  5J1E B;  3IS9 B;  3A8I A;  2YTC A;  3SCJ E;  2WOM B;  3DU5 A;  2KFY A;  4O3O A;  1CBK A;  4B9V A;  4USJ C;  3ZTQ A;  3MUV P;  3HHN B;  2HHP A;  3P4U B;  1K44 A;  5KFI A;  3VZI A;  3AD8 C;  5IT9 U;  1RAD B;  1FX2 A;  2A2D A;  2XMJ A;  1RT5 A;  3IRX B;  2Z2L A;  4OHY A;  3DLK A;  3RW7 A;  1N32 J;  1TV6 A;  2FLN A;  1DQ9 A;  4L76 A;  5A8K B;  1E6V A;  1X9W A;  4OZ5 A;  3OD2 A;  4IO9 Q;  2XUL A;  1N5S A;  4PZV A;  4LR7 A;  4JI5 F;  4O3R A;  3TQE A;  3UE2 A;  4QWB A;  2L41 A;  3T9Z A;  3ITH B;  4FDF A;  1AYE A;  2QRR A;  4DFK A;  1GX5 A;  2W01 A;  4DR4 F;  5B0E A;  2NXE A;  2GX8 A;  2KJW A;  1QE1 A;  4DDF A;  3T1Y J;  3EZO A;  1VRU A;  1S59 A;  2CNK B;  1IBC B;  3SEO A;  5AXM A;  2K1R A;  3CDE A;  1DBD A;  2IA0 A;  2V94 A;  4DN0 A;  1MWY A;  2CPE A;  1HNZ F;  3FEX B;  3VV2 B;  2K3I A;  1M5P C;  1VQS A;  1YJT A;  1WD6 A;  3CME S;  4MKV A;  2GVZ A;  2P9G A;  2ZHB A;  4ZIW A;  2KZZ A;  1NND A;  2EFG A;  1UFW A;  1TU0 B;  2V34 A;  4OFZ A;  5KG0 A;  1U1M A;  1WOR A;  2ASY A;  4PQU A;  3VQT A;  1K1S A;  1Y5N B;  4NZ0 A;  3OR1 A;  3UCZ P;  2V0N A;  3W66 A;  5EHH A;  2A1B A;  3R27 A;  1HWI A;  2QLJ B;  2FPH X;  3QJL A;  3M6V A;  2KM8 B;  3L3C A;  1HIY A;  4KJI A;  2O67 A;  3HFK A;  3VZH A;  2HHH J;  4UY8 5;  3TZX A;  2N4D A;  3OR2 A;  4I56 A;  3I6P A;  1JJC B;  4LRC A;  2GFF A;  4DQS A;  2A6O A;  2E9T A;  2AW0 A;  2E66 A;  5M2U A;  4HEA 9;  2GVD B;  3D6M B;  4IQX A;  1PIE A;  3SV4 A;  1FRJ A;  2EC2 A;  5DGB A;  3BQ2 A;  3QRQ A;  1D3W A;  4WE1 B;  4F25 A;  4K5R A;  4P52 A;  2V8H A;  3BB5 A;  1QUP A;  4A8X A;  3WC0 A;  2VG6 B;  2UVR A;  1RT2 A;  4RWW A;  4B9U A;  2DXF A;  1LWE B;  2C3Y A;  1BQX A;  2M8D B;  1PGZ A;  2P2C B;  5J2Q A;  4PRF A;  3DLE B;  1DQ8 A;  2C3P A;  3HFV A;  4M63 A;  2UXC F;  3V81 B;  2HS4 A;  3AOD A;  1PCA A;  3QO9 B;  3NOC A;  2XEX A;  5HQL A;  2XCA A;  1C1C A;  3NAH A;  3U7J A;  2ZJQ Q;  3TP2 A;  4QPX A;  1J5O A;  2ADB A;  4FPI A;  2VC0 A;  3KLG B;  2HVH A;  1LQ9 A;  4OYW A;  5I4M A;  5KT3 A;  3RB0 A;  4LFA F;  3HX9 A;  2LEP A;  2K8G A;  4PG6 A;  3KK1 A;  2GJI A;  4F0H A;  1F5C A;  1SIW B;  1QAI A;  1BHN A;  1U26 A;  4IO1 A;  4JI3 F;  2B9X A;  1S1V A;  4NA1 A;  1R43 A;  2AQ4 A;  2PI4 A;  2RHS B;  3SCL E;  2NXJ A;  3DDN A;  5I42 A;  4G1P A;  1PJ7 A;  4NMX A;  5KFU A;  2HUR A;  5A8R A;  3CED A;  1RCX B;  2I38 A;  3CB4 A;  1C0T A;  2CKW A;  1VQP S;  1R8A A;  1MU2 B;  5LSO A;  3GLJ A;  5T7L B;  3CJ2 A;  5L38 A;  2ZKU A;  4DV1 F;  3B54 A;  2EKY A;  2LLZ A;  4NLV A;  4M5J A;  1FD8 A;  3VAL A;  4DQR A;  1RUS A;  4QYR A;  2F1F A;  4H4K C;  1JLE B;  3G96 A;  1U2C A;  1X5P A;  4TKT A;  4NXM J;  3ONQ A;  4ZP7 A;  3A1Y G;  2LDI A;  4LSL B;  3L09 A;  1IXK A;  4CNY A;  2D9O A;  3O2I A;  3D9B A;  1HKA A;  2GIF A;  2B5J B;  2RE1 A;  4LRE A;  6FD1 A;  3H0P A;  4K4Y A;  5E41 A;  3UCU P;  2XQC A;  5F41 A;  4UZC A;  1TUW A;  2IJF A;  3HVT A;  1SL0 A;  1LFW A;  2DNL A;  3US5 A;  4W98 A;  5KT5 A;  2LU2 A;  3LQV A;  3ZZU A;  3M6W A;  2DNH A;  1LWF B;  1FI4 A;  5DLG A;  2MKC A;  4AE5 A;  1T9T A;  3GWC A;  5HSP A;  3UN5 A;  5IT4 A;  1ELO A;  4LVO P;  3DDK A;  1KN6 A;  3UCG A;  2JHE A;  2FVR A;  1JLB A;  3TUI C;  1FFG B;  2MQ8 A;  1RDR A;  5KFW A;  2Y9H A;  2UUB J;  4WKR A;  4RKU C;  2PO4 A;  5KFA A;  3K5N A;  4I6W A;  2QYG A;  1M5O C;  3KG1 A;  4XPC A;  1FWK A;  3P49 B;  3Q8Y A;  2UUA J;  4K2J A;  5L8R C;  2FZG B;  1WOP A;  1HWJ A;  1YJU A;  4ED8 A;  5DO2 A;  4OI4 A;  4QIG A;  4WFZ A;  2VB6 A;  3ZZR A;  2YNH B;  1NHK L;  1OSD A;  3BYR A;  2VUG A;  1RT7 A;  1BWV A;  1YWX A;  2CQG A;  5JVH Q;  4ED4 A;  2EXU A;  4C2M A;  4LBP A;  3ZTR A;  2OEK A;  3OSN A;  1NME B;  4QR0 A;  2XMM A;  3P3D A;  3KLE A;  3TW0 A;  1FWL A;  2LEC A;  4EEY A;  1T8E A;  3RBX A;  1KOH A;  1PBA A;  1HW9 A;  4LF6 F;  4H4O B;  3KJN B;  5HN0 A;  4QW9 A;  1UVN A;  2RDI A;  5AXL A;  3C6U A;  1KHW A;  2YX4 A;  1TAQ A;  4GVB B;  1RT6 B;  4USM A;  1NAQ A;  4HTI A;  3H5X A;  3BM7 A;  1RT3 A;  3BKU A;  5IXU A;  3SSR A;  1X4B A;  2PFD A;  1U25 A;  2LYV A;  3QMQ A;  2QIF A;  3SQG A;  5EGY A;  5D3G B;  4DU8 A;  2D41 A;  3A13 A;  3H40 A;  2JJ4 D;  4B3T J;  1T05 A;  2XTJ P;  2V9K A;  5CD4 A;  3PIO Q;  3HVW A;  4TQS A;  1U2F A;  2ZH5 A;  1KDN A;  4PXD A;  5LL6 d;  1KON A;  2OPQ B;  1MMN A;  3PO5 A;  1NXI A;  4KO0 B;  1S76 D;  1KOO A;  4KH1 B;  4MT1 A;  2K3K A;  4HL9 A;  3O5T B;  2RVJ A;  2QC3 A;  3LW5 C;  1H2V Z;  4HI1 A;  1SPB P;  3IO1 A;  3MR3 A;  2L3M A;  2FQQ B;  3IXQ A;  2ZE2 A;  1BQN A;  3DKD A;  3DOK A;  5U47 A;  3G87 A;  1YGY A;  3HP6 A;  2R42 A;  1WOS A;  2PEH A;  4FS2 A;  3UO0 A;  1FTC A;  5A8W B;  4DR2 J;  5IQ6 A;  5HP1 A;  2I1R A;  3PFE A;  4FYV B;  2IFX A;  4FF1 A;  3PW7 A;  3LGN A;  1KLM B;  3OV7 A;  4OIX A;  3VQS A;  1IBM J;  3U27 A;  3W8P A;  1WHX A;  4LRB A;  4FXV A;  2IMW P;  2RSQ A;  5GAH I;  2FJV A;  1T9X A;  2E7X A;  3U1L A;  1N33 J;  3DYA B;  4DV5 F;  3MUM P;  3TO8 A;  3S6E A;  3BBF A;  3D66 A;  2I8E A;  2OLW A;  1XBW A;  2MZJ A;  3QFW A;  2PN6 A;  1K1Q A;  1YQH A;  3KXD A;  1YLX A;  3SBM A;  3C66 A;  1XK8 A;  4NLR A;  2R7Q A;  3JSB A;  1L5U A;  5L1L A;  1GAO A;  4M5G A;  2RNE A;  2DNM A;  2H1Y A;  3R7N B;  2ZVS A;  4USK A;  4DV0 J;  4ECS A;  1EP4 B;  4DJB A;  1UEU A;  1N48 A;  3FSY A;  2ZJR Q;  1PC4 A;  3KK3 B;  3MPD A;  5AE2 A;  2V50 A;  4ITS A;  3M8Q A;  1TL3 A;  2DD8 S;  5F8J A;  2VDI A;  1S1U A;  5C5J A;  3M8R A;  3FUY A;  4CDI A;  2ZD1 B;  3QGP A;  2XZW A;  3JYT A;  3PW2 A;  4ZPA A;  4JI7 F;  2MDA A;  3CJT A;  4ED2 A;  1JLG B;  1CSJ A;  2DNQ A;  1IBL F;  3VGS A;  3B4M A;  1V6H A;  2GC8 A;  4F4A A;  2GML A;  2HGM A;  1D8Y A;  1R8B A;  4QWE A;  3EVW A;  3MPU B;  2GGP B;  4OYM A;  4RNM A;  1S1W B;  1U1L A;  3GG0 A;  3NGK A;  3J7Y I;  2CJA A;  1TKD A;  2IYI A;  1B64 A;  2JWN A;  2NXU A;  2DH8 A;  5A8R B;  1W25 A;  1IJF B;  4RR5 A;  2DXD A;  3T19 A;  1SB6 A;  3KNA A;  3CSK A;  2HFO A;  3I0R B;  4EUV A;  1NJY A;  5BYS A;  1KEK A;  1TL5 A;  1TL4 A;  1RT4 A;  2QA2 A;  2EFV A;  2RS8 A;  2MY7 A;  5D6G A;  1MNE A;  4ED7 A;  1UVJ A;  1KS2 A;  2KVI A;  2UVU A;  2C2M B;  2DIV A;  3JSM A;  1WG5 A;  5C2G A;  4PG4 A;  4DR1 F;  2CPZ A;  1SJ1 A;  3OSP A;  1IKV B;  3I5B A;  2UU9 F;  2HHT A;  4IDK A;  2LXF A;  2E7W A;  3FC9 A;  2IAJ B;  2BAC A;  5C2C A;  1UKU A;  2JRS A;  2XCP A;  5KFC A;  2DTJ A;  2C1E B;  4DR7 J;  1SJ3 P;  1B3T A;  4ZN3 A;  4USH A;  1VFJ A;  3G2X A;  1KQG B;  4DG1 A;  2NQP A;  4URG A;  3RZA A;  2VKZ G;  4XDC A;  4ZHR B;  3QT8 A;  1NPR A;  2WCX A;  2UUT A;  1A6L A;  3ZNJ 1;  4QWC A;  3GSD A;  3IBF B;  1N34 F;  1BD6 A;  1NHU A;  2YKM A;  4Y3C A;  1R6V A;  4G1Q B;  3M32 A;  2PSZ A;  3GG1 A;  1TUV A;  2DY9 A;  1I94 F;  2V2K A;  5KG5 A;  1MRO A;  3V6H A;  3GZ7 A;  2H5I B;  5DDQ C;  3DLH A;  2ZC3 A;  4PPD A;  2YX1 A;  3VTI A;  2LVW A;  4WFX A;  2A10 A;  1FRL A;  1VIO A;  1VC6 A;  3NCR A;  5F8L A;  2BKP A;  2AT1 B;  3BV8 A;  3HT0 A;  3KLF A;  2D3O R;  1N36 F;  4RL1 A;  4ZLN A;  2M3D A;  5HJY A;  1VC0 A;  4Y2I A;  2X3G A;  2GA7 A;  1VK8 A;  2BAN B;  1R8P A;  1S1T B;  2DGU A;  2PMH A;  3N6M A;  2YKQ A;  1JJH A;  1X4E A;  3HXM A;  3NAI A;  1BQM B;  2W9B A;  1VBK A;  5HVH A;  2Z8Q A;  1K9M T;  3JQK A;  1RAB B;  2Q79 A;  3MTK A;  4PCQ A;  1MML A;  4LUB A;  3D1O A;  1XMQ F;  4I6A A;  4I2Q B;  4RUH A;  2MSS A;  2E44 A;  1M0S A;  5C25 A;  1F5B A;  3TVY A;  4KV8 A;  4YHH J;  3CD7 A;  1RA7 A;  3TJ8 A;  1NBE B;  3MAH A;  1BWE A;  5FII A;  3FFI A;  1RWX B;  3F73 A;  3HKW A;  1FHT A;  2W9A A;  1NU4 A;  5KFL A;  2DNN A;  1VRQ C;  5CQG A;  1RYS A;  2B43 A;  2JFD A;  1C1B B;  1NHV A;  3IR7 B;  4F4X A;  1RWW B;  3BRE A;  4V1A k;  3ZNU A;  4Q7A A;  4K2X A;  4DPX A;  2KM8 C;  2OPP A;  2DVI A;  1K0T A;  2FC9 A;  2DNR A;  4CLK A;  1X4D A;  3OQ2 A;  3M2V A;  1X31 C;  2W9C B;  1WKL A;  4UST A;  2QLF B;  4P75 A;  2B8P A;  1I51 B;  2XY5 A;  4A8S A;  3FKB A;  1RBO B;  5E5N A;  2XWX A;  4Q0B A;  4PQA A;  5F8H A;  3ENW A;  3HJF A;  2KTQ A;  3PYD A;  1REV B;  2LQ5 A;  1SL2 A;  3LAM A;  1Y11 A;  2VFS A;  3PR5 B;  2BE7 D;  1U48 A;  2QL5 B;  3TA1 A;  3GB0 A;  3CW2 C;  2DHA A;  1CLF A;  4EYH B;  4ZN1 A;  3VVT A;  4ZLJ A;  3KLI B;  3E2E A;  1X60 A;  4L73 A;  4RUC A;  1V9O A;  2GQ2 A;  5CYQ B;  1TVR A;  4PWW A;  4ES2 A;  1ZTT A;  2HAF A;  2CVE A;  4DFM A;  4TLR A;  4B3T F;  2FHK A;  3LP2 A;  4IRC A;  4RU2 A;  2B9E A;  5DET A;  3CC7 S;  2V8P A;  3CJ5 A;  2R7U A;  3EIC A;  1SC1 B;  1HPZ A;  2FJE B;  5E3C A;  4ZS6 A;  3NBP A;  1NH7 A;  3MMA A;  4Q43 A;  3DLL Q;  4AD6 A;  5JJB A;  1IN0 A;  4V19 X;  2YXL A;  1R0A B;  1N6Q A;  2FTR A;  2VD3 A;  2FZC B;  4E98 A;  4O44 B;  2BJE A;  4IFY B;  2PD1 A;  2YVS A;  2EG1 A;  5ETK A;  2OPS B;  4EK2 A;  4NAS A;  2MGZ B;  5DQI A;  1S77 D;  4LR9 A;  8AT1 B;  3CMQ A;  4I2P B;  1I6J A;  3C15 A;  5HMX A;  4HR2 A;  5ETV A;  3JTO A;  2RHQ B;  2UZA A;  3SV3 A;  2ZH7 A;  4K4U A;  4A4J A;  1QDU B;  3OUY B;  4DUY J;  5K14 B;  2E7V A;  2PII A;  2JEJ A;  3ZZY A;  1NUE A;  3G82 B;  2N3O A;  1SKU B;  2RKI B;  1JXE A;  2XSJ B;  1GT8 A;  3DGP B;  1FVQ A;  1VQ6 S;  1H98 A;  1D1U A;  1UFK A;  4YOE A;  1N0V C;  2BJ1 A;  1KTQ A;  2E1M C;  4K0K F;  3HO1 A;  3A3P B;  3FRY A;  1WDT A;  5CAA A;  1LW2 A;  3H5S A;  4D3H A;  3AXK A;  5J2N B;  3P96 A;  3BN4 A;  3EJM A;  4UZB A;  1B99 A;  4IFV B;  1YJW S;  1UW9 A;  2XMA A;  3D6T B;  1WHY A;  4ZPB A;  3U1N A;  2LP4 A;  4B9L A;  2W4D A;  2CNN B;  4M5L A;  1R6Y A;  1OPZ A;  1YRX A;  5HBM A;  3M1V B;  1Q53 A;  2ILY A;  3QIP A;  5F3T A;  4EBE A;  2JFK A;  3VAF A;  2WVC A;  2Y8W A;  4KHP J;  2HNZ A;  1D0E A;  3PHE A;  3IM9 A;  3HT3 A;  3DLG A;  4OI6 A;  4IG0 B;  3IGV A;  4LF7 F;  4FYD A;  1SUQ B;  4X4U A;  2HNY A;  1SH0 A;  2MZS A;  2V8D A;  5F8M A;  2MYF A;  3OXL A;  3FQK A;  2DYA A;  2VF3 A;  3DM2 B;  1U6B A;  1C4C A;  2CNL B;  4TVA B;  1HBN A;  3OHB A;  3MM6 B;  3ULH A;  3L4B C;  3DXB A;  3LGM A;  3TZW A;  5FD1 A;  1XC9 A;  3AOC A;  2HZA A;  1BLU A;  3KHL A;  3TUZ C;  2JEF A;  2VDH A;  4IRK A;  3PTW A;  4N7T A;  2BOP A;  5IZH A;  3DFE A;  3AHP A;  2XMU A;  3GR0 A;  5KG7 A;  1U47 A;  3E01 A;  3M2U A;  4ZPT R;  2Z2Z A;  3VGU A;  1HWL A;  5KT2 A;  4JV5 F;  3SCK E;  4OZL A;  3T41 A;  2PA8 D;  3M8Z A;  3MM7 B;  2AP6 A;  2LFV A;  5F0W A;  1EAR A;  3QSI A;  3TOQ A;  4ENO A;  5AXK A;  1KSP A;  4NLO A;  2RRB A;  4I68 A;  1D8Z A;  2G2Z A;  2LCW A;  2FJX A;  1YIJ S;  4NML A;  4WTY A;  3OVS A;  1U7L A;  3FEZ A;  1DTQ B;  4ZPV R;  2W2M P;  1HNX J;  2RRN A;  3RRH A;  3TZY A;  3V6D A;  1WEL A;  2CAD A;  3QYY A;  1UJ6 A;  1KR4 A;  5F0U A;  1XNR J;  1KBR A;  5DZ6 A;  1AZS A;  3OL6 A;  1F3V A;  3GQC A;  3BR8 A;  3MR6 A;  2XLK A;  1VDH A;  1WG1 A;  3DRS A;  3JSR A;  1HMV A;  2QA4 S;  2DNG A;  2KB2 A;  4ECQ A;  2FVC A;  3L95 X;  1IQZ A;  3T9N A;  3T5H A;  2DB1 A;  5HMW A;  3UDE A;  1A0O B;  2V67 A;  3KUG A;  4Q8E A;  2RML A;  3HLU A;  3LWM A;  5I3U B;  3JS9 A;  4GC7 A;  2RUS A;  2E1A A;  4X64 F;  1QY7 A;  1WOO A;  4JI6 J;  2B3T B;  1FDN A;  5M2R A;  4C0O C;  4NEZ A;  4JI1 F;  4LT6 A;  4IH5 A;  1TK5 A;  2FVS A;  3GPA A;  3TAP A;  1XWL A;  9RUB A;  5CZX A;  3KNG A;  3KMQ A;  3UWT A;  5F9N A;  1S6Q A;  1HWU A;  2R3V A;  3THP A;  4PAB A;  2HHX A;  5HVF A;  1SH2 A;  4H54 A;  1PKU A;  2JL9 A;  2J76 E;  5KFP A;  1X9S A;  3PRV A;  4AUK A;  2H9Z A;  3BH7 B;  2B51 A;  4ELT A;  4K4W A;  4F67 A;  2IC3 B;  2V4J B;  4Y28 C;  4X2B A;  2J8A A;  4H4M B;  2DHH A;  1RTD B;  2F8H A;  3K58 A;  1VRT B;  1JLC A;  2Y0S D;  4DR5 F;  3VAM A;  5EUH A;  3EE3 A;  2FHJ D;  4Y2M A;  3OW2 R;  3QLH B;  2G2O A;  2W2N P;  3SDE A;  2F5G A;  2EFO A;  3NWG A;  4A8Q A;  1M5K C;  5AXN A;  3TA0 A;  4U7U K;  4ZVE A;  2UUW A;  2CQ3 A;  2F4V F;  2F9J A;  4IR9 A;  4MKB A;  5IC4 B;  3J80 Y;  2C3O A;  2L9D A;  2H54 B;  4E0D A;  1PO6 A;  5G4D A;  3QT5 A;  3CWJ A;  4OYZ A;  5BYR A;  5DZ7 A;  3Q2S C;  5ETO A;  3PFO A;  1CJT B;  3AAW B;  2IY5 B;  4CP5 A;  3H4D A;  3QRR A;  4MKY A;  4FF2 A;  1UWB B;  2LQ9 A;  3RGI A;  2R7S A;  1HBU B;  4X62 F;  3Q23 A;  4O3Q A;  5KFT A;  4JBC A;  1FKO B;  3CJK A;  2VPX B;  1IUJ A;  4QIF A;  4OZJ A;  3EM1 A;  3W2W A;  2VPY B;  2P6T A;  3DRP A;  5IFM A;  1VOM A;  1RTJ B;  3DI6 B;  2B9W A;  2CRL A;  5D0R A;  2CDR B;  1HQE A;  5KT7 A;  4PWU A;  1JJ4 A;  4NOH A;  3G6E S;  4M94 A;  1M5S A;  1NSQ A;  2Y8Y A;  3D3B J;  4C8Y A;  4P9S A;  2KH9 A;  4UOC A;  1NJW A;  3M30 A;  3M6U A;  4QJV A;  2ZM6 J;  1LK5 A;  4P2X A;  4LF4 J;  4J9Q A;  4PG8 A;  2BEF A;  1Y0H A;  4KGV B;  3GII A;  2XSF A;  2NSB A;  3BGR A;  3C6T B;  2DO4 A;  4ZVS B;  4OX7 A;  3OVB A;  3IM8 A;  1OQ6 A;  4AT1 B;  3OTE A;  4MK7 A;  3AD9 C;  3UN2 A;  2Z30 B;  2Q3P A;  1XMO J;  3PXG a;  2HW3 A;  1U0H A;  5HAN A;  1YJV A;  1DLO A;  2VQF F;  3N79 A;  1HAR A;  2GMJ A;  3Q8R B;  2PA3 A;  3PHT A;  4ID8 A;  2G9O A;  1VQK S;  2IRY A;  1ZPW X;  2H65 B;  4ALZ A;  3KK2 B;  4MIB A;  1Y10 A;  4OHX A;  1T95 A;  3HHL B;  2QSF A;  4RPF A;  2ZBR A;  4EO6 A;  5H9E K;  4WFA Q;  4JP8 A;  1U1K A;  1NH8 A;  1N5Y A;  3RBZ A;  1VHI A;  2IRX A;  3NY0 A;  1SC6 A;  3M9N B;  2I0X A;  5E3Q A;  5LM7 E;  3JTP A;  1RTH A;  3EDR B;  3ZZP A;  3EGW B;  3PX4 A;  1TKZ B;  5KG1 A;  2EC0 A;  3MAA A;  1SKS A;  2QLX A;  1QUV A;  5L9X A;  4A8W A;  1S9G A;  1NRK A;  3PEH A;  1Q95 G;  2HPU A;  1UFL A;  3MMB A;  2L48 A;  1GXU A;  4DQI A;  2BOA A;  1ZM4 A;  5DQG A;  2PEB A;  3MEG A;  2Y1L B;  3ILL A;  2D9P A;  3M8S A;  1IBK F;  4TY8 B;  1U8S A;  1FJG F;  5KFJ A;  1VCT A;  2VIC A;  2H4W B;  3NLC A;  1T94 A;  3D68 A;  4PR6 A;  4NZ6 A;  3D54 A;  2ALZ A;  3MMC A;  1C4A A;  2OEM A;  3RAM A;  4RUB A;  3BSC A;  4X4N A;  2CZ4 A;  2IVM A;  3FBE A;  4FXD A;  2WVD A;  4LIR A;  4C11 B;  2N7Y A;  2YWF A;  4X65 F;  4KTQ A;  5IT0 A;  4YS2 A;  4EBC A;  3TAQ A;  2HFV A;  3AXM A;  2QL9 B;  3HK2 A;  5L1K A;  1TKX B;  4JI2 J;  2CJY B;  5MLC V;  1RK8 A;  4DR3 F;  2ZH9 A;  4CM2 A;  4AQY J;  5LT5 A;  4LRF A;  1GMW D;  1Y5L B;  2AKW B;  1VLY A;  3GJT B;  3ISN C;  1OO0 B;  2WAQ D;  2CVI A;  3QAU A;  4MIA A;  1JLA B;  2C3M A;  3CDB A;  2GHV C;  4K4S A;  4MMO A;  3NMA A;  2ROE A;  4WWS A;  2AEF A;  1GTH A;  1GQE A;  3UVJ B;  2DIT A;  1ZS6 A;  1RTI A;  2M88 A;  3CJ4 A;  3PRD A;  4YN3 B;  1FFW B;  5FDL A;  5EWE A;  5HI7 A;  1EJ7 L;  2CQ0 A;  3PW4 A;  1SJR A;  1GNK A;  1IQT A;  3OTC A;  1WC6 A;  3ZZ0 A;  1S4F A;  5JUM A;  1GH8 A;  3UQS A;  1NLK L;  1SH3 A;  4RLE A;  3MWB A;  1YHQ S;  2I6W A;  5D4P A;  5LSL A;  2VG7 B;  3VR1 A;  2BDP A;  4K59 A;  3D0G E;  2FJW A;  4X66 F;  5J2P A;  3D4J A;  3G6X A;  5THW A;  5F8N A;  2ZEJ A;  4LFC F;  4X84 A;  1JLQ B;  2P9C A;  4Q2M A;  1T02 A;  4CO0 A;  4P6Q A;  3PX0 A;  2KG0 A;  1BY9 A;  4DSI A;  3W9J A;  2NXN A;  4ECY A;  3UN3 A;  3W8G A;  1RAI B;  2CJB A;  2HQC A;  2M0G B;  1U0S A;  1QLN A;  4KFB B;  2R4F A;  1RB0 A;  4JI0 J;  5B0A A;  3SI8 A;  5BR8 F;  1CJK B;  3NEK A;  4WK3 A;  4DLE A;  3I9V 9;  2M7S A;  4K4X A;  2NCK L;  3D28 A;  2UXB F;  1UAW A;  2FLP A;  1DQA A;  2D3O 1;  3NS7 B;  4Y0F A;  1CJV A;  4X4V A;  3H98 A;  2A0F B;  4DN9 A;  5HQM A;  1X4C A;  2OKQ A;  2QFJ A;  2UXD F;  4LBI A;  4GKK F;  1FNX H;  3KYL A;  1F60 B;  4B3M F;  4C48 A;  3IBW A;  3RYL A;  4YY3 F;  5B08 A;  3KJV B;  3GV7 B;  3I0S B;  2DR7 A;  4OX6 A;  3DOL A;  5C42 A;  4TU9 A;  3VGV A;  4P2F A;  1HW8 A;  4RW7 A;  2JC1 A;  2V2V A;  4YB1 P;  1DFD A;  3M9O B;  4I7F B;  1NSK L;  3N5F A;  1QVG R;  2Q1L A;  1XER A;  4O4R A;  3PAC A;  1X4H A;  4NCG A;  1VHF A;  2ZH4 A;  3POT B;  1HNW J;  2CZV C;  2WBM A;  3DLJ A;  2BM0 A;  5KFQ A;  3R8Y A;  1RT1 B;  3GP9 A;  4KQZ A;  4NLS A;  4DEZ A;  4Z7Y A;  2E9R X;  4ANE A;  3FGV A;  2MXY A;  3MEC A;  2BE2 B;  1KLN A;  4OMF G;  2HVD A;  3GIM A;  2DKO B;  1HBO A;  2HBZ B;  3H42 A;  1UVK A;  2AGQ A;  3EVM A;  4EI2 A;  4YB5 A;  3HVR A;  4FP9 A;  2HVE A;  3SQO P;  4RBT A;  1S79 A;  1CEZ A;  4HDH A;  2VL1 A;  4KB7 A;  3J7Z 5;  3MEE A;  4P7T A;  4DV7 F;  2B6A A;  1OS5 A;  5KFY A;  1DHM A;  1HYS A;  4Y2K A;  2OSR A;  4OYX A;  1TKT B;  3CCR S;  2IJN A;  2MKK A;  1IKY A;  1ACM B;  3RAX A;  1S0V A;  2BQ3 A;  1FKA F;  4I4B A;  4KGK A;  4DL3 A;  4EGL A;  2ADC A;  3LP1 A;  2OML A;  3JXO A;  3ADA C;  1VQM S;  3M8P B;  2WSF C;  1P6T A;  3K7R A;  3WDO A;  2JLG A;  2NYI A;  3SFG A;  4Y2C A;  3TEG A;  3Q2T C;  4CI0 B;  3CJS A;  3KHR A;  3BQ0 A;  1PG5 B;  4CTA A;  3RB4 A;  1S6P A;  4RNF A;  1TL1 A;  4PPZ A;  2AX0 A;  2AU0 A;  5H9F K;  1XJW B;  1Q16 B;  3PIP Q;  3MOJ B;  1VBX A;  3K5O A;  1C0U A;  2P6S A;  2AHO B;  2N4C A;  1H2U X;  1JLF A;  1K47 A;  2R9L A;  2MMY A;  5J2M B;  4BBY A;  2YKN A;  5M2P A;  3R5J B;  3IR5 B;  3H2V E;  3I5C A;  4ZP9 A;  1RTH B;  4C97 A;  4JI8 J;  3TAM B;  1SC4 B;  3CIM A;  1HI1 A;  1FX4 A;  2M9K A;  4HHJ A;  4KGZ B;  1OIA A;  3I82 A;  2FVQ A;  3OBI A;  4U7C A;  4CT9 A;  3CCU S;  2F63 A;  3KLV A;  2BJ3 A;  5ETT A;  3LH2 S;  2QLW A;  3EZ5 A;  2NYH A;  4BCA A;  4Z2X A;  4C8K A;  5G0R B;  1IKW B;  5A0Y A;  2E5L J;  1Q78 A;  1RHM B;  4ZVP B;  3W61 A;  1U09 A;  4C0B A;  2NPI A;  3MI7 X;  4DX6 A;  4MFB A;  3TZZ A;  3HMJ G;  1UWA A;  2O66 A;  2ZWP A;  5D78 A;  5DM7 Q;  2FLL A;  1U49 A;  4ZVF A;  2AMC B;  3OTB A;  5KTQ A;  2BMB A;  4CO5 A;  2BX6 A;  4DXL A;  4GRS A;  2YQ1 A;  1FRH A;  2I9S A;  3NL0 A;  4YDD B;  5E33 A;  2Y3Y A;  3DU6 A;  2YNI B;  5A76 A;  1IR0 A;  1UET A;  3EWG A;  4FBU A;  1RAF B;  4ECV A;  3KG0 A;  1HBM B;  3PO4 A;  1YG0 A;  1MSW D;  2VPZ B;  3L9Z A;  3W2V A;  5D0G A;  1TR0 A;  4M5M A;  5B0G A;  4B3S F;  1I1G A;  5IM0 B;  3L7O A;  3OFG A;  4YUD A;  4HHU A;  4BC9 A;  3KFW X;  3DRY A;  2CA9 A;  4ZJL A;  2LKZ A;  1O51 A;  1SL1 A;  4EWT A;  3QSY B;  1PC5 A;  4DR6 J;  2ZH1 A;  1UCN A;  4R8U A;  3V4M A;  2HGL A;  1A7G E;  4YP3 A;  1FJ7 A;  3R7S B;  4KYZ A;  4CWB A;  1B7Y B;  4ES1 A;  1AW0 A;  2DNY A;  3AT1 B;  2KT2 A;  4X4Q A;  4USU A;  5I3Q A;  2XLJ A;  3S7R A;  4N77 A;  2WHO A;  2DH7 A;  2FHM A;  2NZ4 A;  3IG1 B;  2MHN A;  1NJZ A;  1Y00 A;  3SZ2 A;  1JKH A;  2UV8 A;  1HI0 P;  1FWP A;  1SVD A;  1ROF A;  4DS4 A;  3PV8 A;  3DRR A;  3ZTP A;  3C3L A;  4DCO B;  2J9D A;  1URR A;  2HMI A;  1NB2 A;  4OLP A;  1HNV B;  1N5T A;  3Q8Q B;  3R9L A;  4YB6 A;  3DDI A;  4ETX A;  4OHW A;  4ATN A;  2J9C A;  2VOD A;  1CQM A;  2HVZ A;  4C3K A;  3THT A;  1S57 A;  2IVF B;  3FVY A;  2EG2 A;  3NXZ A;  2XS5 A;  5KFZ A;  3ET6 B;  3M9M B;  3MM9 B;  1HD0 A;  3NS6 A;  2KL8 A;  3CCZ A;  2IDL A;  3I5A A;  4ED3 A;  4GKJ F;  2DGQ A;  2FB0 A;  3GYG A;  2FZK B;  4Z7C A;  3EGZ A;  2EFN A;  3CC2 S;  3CJR A;  3MM8 B;  4WKY A;  1QAJ A;  2JDJ A;  4DSF A;  5H1S V;  4RU9 A;  2CYY A;  1CQN A;  2EKN A;  2OSQ A;  2F40 A;  2KRR A;  2D7S A;  2COL A;  3T1H F;  4ID5 A;  1FK9 B;  3AQP A;  4NI2 B;  1TFW A;  1JXL A;  3VCD A;  3A8J A;  2GCF A;  5D8H B;  1IM6 A;  1G2E A;  2WON B;  2F3J A;  4DPY A;  2R7R A;  4ZA1 A;  2AJF E;  4FPR A;  4WJB A;  5DDP C;  4CO3 A;  1KVJ A;  1SIZ A;  4LF8 J;  3BO4 A;  3MUT P;  2GAG C;  1CUL B;  2LA4 A;  1LW0 B;  1Q0N A;  2YH0 A;  1TUG B;  5J1P A;  4J9V A;  2VBX A;  2X3D A;  4KIA A;  4ED0 A;  2HND A;  5HRO B;  5LMN J;  1LWX A;  2J8S A;  3EGV A;  1RXO B;  5D4O A;  1TMJ A;  2R7X A;  4OI3 A;  1DTT B;  4EFA C;  1FEE A;  2HLT A;  1YX2 A;  1WUU A;  4PUO B;  4IOA Q;  1NSP A;  4QIE A;  5EX0 A;  3T6B A;  2V8G A;  2YNF B;  2QO3 A;  5A2Q Y;  4J90 A;  4LSN B;  2M52 A;  5IWA F;  4DCP B;  4DV2 J;  4V19 J;  3R5G A;  2OUG A;  3UPF A;  1ZET A;  4ZCM A;  4A8Y A;  2CPJ A;  4TQR A;  3AY0 A;  4DU7 A;  2MLZ A;  3HCX A;  2X7I A;  4B3O B;  1EET B;  5BXI A;  1V3S A;  2ZOM A;  2A6M A;  2HRT A;  1S12 A;  2X1A A;  3MCS A;  3JB9 k;  4EU0 A;  5B7W A;  1F9F A;  2K7K A;  4DSK A;  4JI4 J;  4DFJ A;  3CCM S;  2OPR B;  4X4R A;  2VOP A;  2HBQ B;  3HHL C;  1Q8L A;  3TVK A;  4YDX A;  5GAE U;  1YDL A;  1VGY A;  4O4G A;  1VYA A;  1AFI A;  4W90 B;  1LWC A;  3NP5 A;  2APO A;  2YWE A;  2FHJ A;  1S1X B;  2DRD A;  4AL5 A;  4DPT A;  3ZFV A;  1VQ5 S;  2G0J A;  3MCO A;  2NPF A;  2BYC A;  2YX7 A;  4FN5 A;  1S9E B;  3DOM A;  4CQ1 A;  2DGX A;  3I55 S;  2YNG A;  4WTO B;  1S10 A;  4L3K A;  2JC0 A;  1QTM A;  1KVK A;  4BS2 A;  1WKK A;  3CD5 A;  2G13 A;  3AQO A;  4RW4 A;  4TYA A;  5C7P A;  2RF2 A;  4FYW B;  1T9Y A;  1T7P A;  1SV5 B;  4DI6 A;  3DMJ A;  2JSX A;  2JEG A;  4NXN J;  1ZZN A;  3KHG A;  2BVZ A;  1HHQ A;  2XHC A;  3OTD A;  2WB1 D;  4I67 A;  4A8F A;  3M05 A;  3I56 S;  3HHE A;  1NDL A;  2GIR A;  2DO0 A;  4DPW A;  2HFZ A;  3C16 A;  1F6T A;  3R6G B;  4RW8 A;  5CCL A;  5KT4 A;  5CCM A;  1N56 A;  2AZ3 A;  2KI2 A;  4G6V B;  3PRB A;  1WJ9 A;  5HAT A;  4Q8F A;  3SIP B;  3IGN A;  5F8G A;  4DLG A;  1N4L A;  3R6L B;  1AUS L;  2KT3 A;  3OXG A;  4LSZ B;  3CUL A;  2ZBC A;  1S72 S;  3CCW A;  1HQU B;  3HPO A;  4EYI B;  1VQY A;  3J7A N;  4DV6 J;  1RA6 A;  3W63 A;  4IH7 A;  2HHV A;  2O3D A;  2Y1R I;  5D4N A;  1VJQ A;  2OAU A;  3NGD A;  1CS4 A;  1OJ4 A;  3DGV A;  4ZIV A;  1QVF R;  3J81 U;  1QD1 A;  1H38 A;  3D7S B;  2XY7 A;  1UA0 A;  3S8S A;  5B09 A;  4ZPC A;  1X0P A;  2GHP A;  3WZ0 A;  1V3R A;  4QU7 A;  2NLW A;  2Z56 B;  3M8Y A;  4ED6 A;  1Q8I A;  4RW9 A;  3H25 A;  2V8V A;  2AJ4 A;  4HVZ A;  4LMZ A;  1RP5 A;  1LV5 A;  4DV4 F;  2CWX A;  1U45 A;  2PI5 A;  3P5B P;  5C24 A;  4ICL B;  2KU7 A;  1NK4 A;  4JYA J;  2CQI A;  2ROP A;  1R31 A;  3OVA A;  1AFJ A;  2CJK A;  2HBY B;  3C14 B;  2OO4 A;  4AND A;  4NL5 A;  2OIH A;  1L3T A;  2GMH A;  2DGW A;  1JK9 B;  4CYU A;  1N88 A;  1Q7L B;  2HWI A;  1H2T Z;  2I5J B;  2E5I A;  5CYJ A;  1YI2 S;  2QG9 B;  2R8K A;  2IJR A;  5E2Q A;  3Q8U A;  1Q82 T;  4YQW A;  5HJX A;  1S0M A;  5HMY A;  4DUZ J;  1E6Y A;  3ELH A;  4ZVG A;  1PAE X;  2BRL A;  3R7B B;  2DXE A;  2NS1 B;  1BC6 A;  3KJQ B;  5DG7 A;  2XMK A;  2HIQ A;  2BQR A;  3J7Y U;  2YPZ A;  3MPW A;  1S5Z A;  1IKX A;  5K5M A;  3A12 A;  4M5H A;  4F7V A;  1S6O A;  2QE5 A;  5IV4 A;  2BR0 A;  3CGI A;  2YWG A;  1N52 B;  5HMZ A;  5AE3 A;  3AFG A;  4C3M A;  3B8H A;  2N82 B;  4WYL A;  3BR9 A;  5KFB A;  3FK4 A;  4ZDN A;  4DOZ A;  2BW2 A;  1S48 A;  4CLZ A;  3LP0 A;  1T11 A;  1O5J A;  4K8R A;  5HLF A;  1Z1Z A;  4UQG A;  2WSC C;  1NO8 A;  5HO4 A;  2AV5 A;  3TX8 A;  2VQE J;  3OTO F;  1WEY A;  1T03 B;  3HD2 A;  3M2R A;  4ZKA A;  3V4I A;  1JNZ B;  5ETN A;  3PZP A;  4DL4 A;  2W8L A;  2CAJ A;  3C19 A;  1XNQ J;  2AJ1 A;  5LXY A;  5KG3 A;  3A8K A;  2VV5 A;  4B02 A;  1GMW A;  3MED B;  2HEK A;  3GFY A;  5CYM B;  4CT8 A;  3BKT A;  2HQD A;  4HAC B;  1WKJ A;  4NLQ A;  2B4U A;  3MD3 A;  1SQF A;  3TUP A;  3BDE A;  1FNO A;  4RW6 A;  4HH0 A;  4KKO A;  3G86 A;  1Q4R A;  4PWD A;  2UUC F;  3HJV A;  2WBR A;  5DJB A;  1WG4 A;  3FQL A;  2KHC A;  1HR0 J;  2LXI A;  1CJU B;  2NUU G;  5J1N A;  4YR0 A;  2C2N A;  3DLB A;  3MCN A;  4OYI A;  1NKE A;  1JXV A;  3L7P A;  4IQM A;  4PXC A;  5ETQ A;  4ETZ A;  3QAE A;  4DX5 A;  5L9N A;  3MM5 B;  4I0W A;  3VAJ A;  3NGS A;  2JVO A;  2EEY A;  3UR0 A;  5KFR A;  3WX4 A;  2X1G A;  4UW2 A;  4Q2L A;  4DSJ A;  1TL7 B;  2OEL A;  2DR5 A;  2VPW B;  1WDD A;  2K06 A;  5DQH A;  3G4S S;  2JH3 A;  1FKP B;  4OX9 J;  1TFY A;  2C2D A;  3GIR A;  1U8W A;  4ZLP A;  3TAN A;  1JB0 C;  4A8M P;  1JNR B;  1XR7 A;  3OJU A;  1S99 A;  1UJ4 A;  3H2L A;  4ZJQ A;  2CQH A;  2ZOF A;  3QWU A;  4RO0 A;  3PYF A;  1OSC A;  1YJN S;  1RT5 B;  1NB7 A;  4MK9 A;  4BHQ A;  3CD0 A;  4FXW A;  4DPO A;  1WSV A;  3G9C A;  3DLK B;  2DCU B;  5FLX U;  1EAY C;  1TV6 B;  2RDJ A;  3IWL A;  1E6V B;  3UI3 A;  4DL7 A;  2QMX A;  3NGU A;  2ACM A;  5JMN A;  3DXS X;  2V6A A;  4R5P A;  5CAB A;  2FJD B;  3M8W A;  2V69 A;  3LGH A;  1NDC A;  2KT5 A;  2RQC A;  3JAM U;  4IG3 A;  4AXI A;  5KFS A;  2EI5 A;  3BGL A;  2ZVI A;  4ZVH A;  1RU2 A;  1HNI A;  1QE1 B;  1UMJ A;  2MKH A;  1VRU B;  3DN9 A;  4O0I A;  5GMK a;  3QBC A;  4CH1 A;  2K1R B;  4JI5 J;  2HFU A;  3Q24 A;  1TK0 A;  2VG5 A;  3BBB A;  4X4O A;  1H7X A;  2W25 A;  4NRU A;  1ZAX A;  4DV3 J;  2IYG A;  1IR1 A;  2EVZ A;  4F2R A;  4MIW A;  5A6W A;  4M5D A;  2Y1J A;  5J1E A;  2GVZ B;  1EX8 A;  3IS9 A;  5F8I A;  1N32 F;  4DFP A;  3EXY A;  1RTZ A;  2WOM A;  1Y9O A;  3A3O B;  4UOG A;  3MF5 A;  2MQL A;  2GQQ A;  2EFQ A;  4PQU B;  1HNZ J;  3PG9 A;  3OR1 B;  3IRX A;  1KQS R;  2IBO A;  2J7W A;  1UJ5 A;  2VAS A;  3MAQ A;  2RRA A;  3NNC A;  1NEE A;  1B0V A;  1RAE B;  3T1Y F;  2W4C A;  5A8K A;  2C42 A;  1ICE B;  3N0V A;  3KHH A;  1PSD A;  2OJ3 A;  5DS7 A;  2F7V A;  2VBY A;  1V5V A;  2WTF A;  4WZM A;  3GON A;  2MTL A;  3ITH A;  3OR2 B;  1WI8 A;  3OHA A;  2QT7 A;  1DRZ A;  3O44 A;  1YSJ A;  4WFB Q;  1QTN B;  3TRG A;  1FF2 A;  5KT6 A;  4USI A;  3J7Z T;  4WXO A;  4PXB A;  1FJE B;  2GW8 A;  2ZH6 A;  2YKA A;  1R0B G;  3JTN A;  2IRU A;  3GYN A;  2HZC A;  3FEY B;  3RRG A;  2ZZM A;  2OD6 A;  2ZKT A;  1W2B R;  2VU5 A;  1RT2 B;  3A4T A;  2KRB A;  1NK8 A;  1IVZ A;  2R8J A;  2HHH F;  3TJA A;  5J2Q B;  2JEI A;  2J6U A;  1PBU A;  3GMG A;  3OLB A;  3X3U A;  1SQE A;  1VBZ A;  1DY3 A;  4XK8 C;  3MFI A;  5KFO A;  4QIW D;  4FBT A;  1FXD A;  1VLO A;  2IM1 A;  2XMT A;  1FE4 A;  4EO8 A;  4DSL A;  1C1C B;  2D1C A;  4OZ0 A;  1J5O B;  3OPK A;  2UXC J;  5CH7 B;  1RIS A;  2J7K A;  2CPY A;  1WEX A;  2GVD A;  4JB8 B;  4IRD A;  1N54 B;  3TX0 A;  1NCL A;  3KK1 B;  4RX6 A;  3NMR A;  4HDG A;  2DIS A;  4B17 A;  4WE1 A;  2WZ1 A;  3RB6 A;  2M70 A;  2ATC B;  3G8S A;  1S1V B;  2VG6 A;  4YR3 A;  2E1C A;  2KFN A;  1LEO A;  3H2U B;  1B70 B;  3M7V A;  4LFA J;  5I42 B;  3N01 A;  1YTY A;  5DG8 A;  1LWE A;  1BMQ B;  2WW8 A;  2MZ1 A;  3DLE A;  1Z2Z A;  2YPY A;  1LOU A;  1C0T B;  2HGN A;  3V81 A;  4MYT A;  4DS5 A;  1LNQ A;  1MLA A;  2W24 A;  1WC1 A;  3K8V A;  1K0V A;  3QO9 A;  3HSZ A;  2FY8 A;  1PJ6 A;  2E5G A;  1AB8 A;  1SBR A;  4FYX B;  1X4F A;  1YZ7 A;  4X4T A;  1M90 T;  2RD5 C;  4Q44 A;  3DHX A;  3PCO B;  1LKZ A;  1VMB A;  5HAO A;  3NNA A;  3THV A;  4TU8 A;  3KLG A;  1CC8 A;  1LFP A;  3Q8V A;  3CJ3 A;  3T5J A;  4F4K A;  1RWK B;  2QMW A;  3PJW A;  1FVS A;  3G8T A;  4DV1 J;  2I2Y A;  5AE1 A;  4YEA A;  2AWZ A;  2AJQ A;  1EKS A;  3NCQ A;  3F44 A;  2GIQ A;  2EBE A;  1Z4U A;  4QIV A;  3HVT B;  3MDF A;  2CPX A;  4I69 A;  2GO8 A;  5B0C A;  1X8D A;  1TTH B;  1UPM B;  2PE8 A;  3F41 A;  1K8A T;  2OMO A;  2VOO A;  2CQ4 A;  4ED5 A;  4I64 A;  4C8O A;  2DGT A;  3RR7 A;  2HFS A;  3MPY A;  4NXM F;  1YBA A;  1MU2 A;  1B7F A;  2IDE A;  4CLP A;  2UP1 A;  1PAU B;  2D3Z A;  5T7L A;  3RW6 A;  1I3O B;  3UDL A;  1L3K A;  1WHV A;  2NRE A;  1JLB B;  4L3N A;  1MWZ A;  2O5D A;  1KFS A;  3P45 B;  1UEK A;  1BE4 A;  1HL6 A;  2Z2Y B;  3TUJ C;  1JLE A;  2RB7 A;  1NKC A;  2EWH A;  2DCL A;  4DL0 C;  1RAH B;  2HQF A;  2QEX S;  2B0G A;  3QZ8 A;  1KHV A;  3ETO A;  3Q86 A;  4LSL A;  3BS9 A;  3EPI A;  3H90 A;  5D77 A;  1OY9 A;  2XO6 A;  1Q5V A;  1JJ2 R;  3D0H E;  2B5J A;  2DGV A;  4WBF A;  5KFV A;  2HZV A;  1T0T V;  4CZC A;  1RT7 B;  3OFE A;  4W92 B;  4AXJ A;  4J9P A;  2HQI A;  2BE9 B;  4J5O A;  3VHQ A;  2W8K A;  1JIH A;  3BO3 A;  4C7Q A;  1RKI A;  1GXL A;  1C2P A;  3KLE B;  1NJI T;  1UVM A;  3JSY A;  5HVG A;  3R97 A;  1GXT A;  4KRW A;  4C8L A;  1LWF A;  1NZ8 A;  3CC4 S;  4DWI A;  1GK8 A;  2LQJ A;  1ZOT A;  5HL7 Q;  1FDA A;  3IRW P;  3U02 A;  5E3P A;  4AL7 A;  2UUB F;  2RT3 A;  3ZC4 A;  3C6U B;  2MZQ A;  3NGT A;  4N8N A;  4KR0 B;  2VFT A;  2RS2 A;  4LF5 J;  2UUA F;  1RT3 B;  2AEM A;  2PDA A;  1J2V A;  1FO1 A;  1DAR A;  4LF6 J;  5KFD A;  3VAG A;  1FDB A;  3SQG B;  4JV2 A;  3M4X A;  2M4M A;  1BUX A;  5ETL A;  4PXE A;  1I5O B;  1WSR A;  2L08 A;  1F2H A;  1T05 B;  2AYM A;  1DJ0 A;  4O3N A;  2BJD A;  1IWA A;  1L3V A;  3VAI A;  1WEZ A;  2J7U A;  4NLW A;  5IOL A;  2DPI A;  4ZIT A;  3CIZ A;  4ILM A;  4J9N A;  3HI9 A;  5B0F A;  3QPI A;  2YNH A;  4PEO A;  5DGA A;  2HAI A;  5B0D A;  3TI0 A;  2LDY A;  2MST A;  4BDP A;  1YJ9 S;  4NLY A;  3ZXW A;  2ZE2 B;  4DV3 F;  1BQN B;  2AD9 A;  1NDK A;  3DOK B;  3VAK A;  3FCW A;  4CH7 A;  1P27 B;  1ZM9 A;  1L3U A;  3QGG A;  1X5S A;  2IA6 A;  5HP1 B;  4MJK A;  3B4D A;  3NKY A;  1RAJ A;  4H4O A;  3RB3 A;  1KC8 T;  3MFH A;  5KFM A;  5CHC B;  2D74 B;  1RHR B;  2D3U A;  1RT6 A;  4GVB A;  2RIJ A;  4OJG A;  3K8W A;  3K0J A;  4OYB A;  1KVI A;  4YB7 A;  4D3G A;  3AOB A;  1DAX A;  2UV8 G;  4NCA A;  2KHD A;  2MZR A;  4LR8 A;  4GO7 X;  1S7I A;  3RG6 A;  2W4P A;  3EZU A;  1FRI A;  3D5M A;  3EMT A;  3PR4 A;  5D3G A;  4NLX A;  1NM2 A;  2B56 A;  2IPO B;  1MW7 A;  2CPI A;  2AJ2 A;  1YRT A;  2VJV A;  2QMU B;  4NYZ A;  2OPQ A;  3TYT A;  1CC7 A;  4MH8 A;  2R8H A;  4KO0 A;  4WYW A;  2MLY A;  1OWX A;  2R7V A;  2YKP A;  4TXS A;  4DR2 F;  3R1L A;  4DV5 J;  5GAG I;  2QJ3 A;  4XIU A;  5LJ5 Y;  3MHY A;  1WI6 A;  4F0M A;  1X5O A;  4F0K A;  2VON A;  2OHD A;  3HHL D;  1YK9 A;  1GTE A;  2OTJ S;  3LPY A;  1ZTW A;  1IBM F;  3M8Q B;  4EZ9 A;  1TL3 B;  4A46 A;  4Z37 A;  1S1U B;  3RJM B;  5A8W A;  1SI9 A;  3BZQ A;  2AGP A;  3B82 A;  2Z57 B;  1N33 F;  1B4S A;  1FE0 A;  3JYT B;  2DPJ A;  4KAI A;  1X4A A;  4OV6 A;  2J9D E;  1VQ8 S;  1KLM A;  2WB4 A;  3ILO A;  1ULR A;  1LK7 A;  2ASJ A;  2G4B A;  4ES3 A;  4K4V A;  2IVY A;  3ZO7 A;  1FRK A;  2X1F A;  1B0P A;  2ATL A;  1TQL A;  2ZH8 A;  1WWH A;  1NK0 A;  3CMA S;  4CM0 A;  3DYA A;  2MY8 A;  4N76 A;  4DV0 F;  4JI7 J;  3CDU A; 
#chains in the Genus database with same CATH homology
 3UVJ B;  2W01 A;  4OZ2 A;  3ET6 A;  1CUL A;  3C14 A;  4NI2 B;  3C15 B;  2QV6 A;  1CJV A;  1YBT A;  1Y10 A;  4OZ3 A;  3MAA B;  3R5G A;  5D0R A;  1WC6 A;  4CLK A;  2GVD B;  1WC5 A;  1CJU B;  5D0G A;  1CJT A;  4UST A;  1TL7 A;  5IV4 A;  4OYW A;  1U0H B;  1FX4 A;  1YK9 A;  4OYX A;  1AZS B;  3G82 A;  3C16 A;  4OYI A;  4OYM A;  4P2F A;  1CS4 B;  4CLW A;  1Y11 A;  4P2X A;  4USW A;  2GVZ A;  1WC1 A;  1CJK A;  4CLZ A;  3UVJ A;  4CM2 A;  4CLP A;  3ET6 B;  1CUL B;  3C14 B;  1CJV B;  4CLS A;  1AB8 A;  4CLL A;  4OYP A;  4NI2 A;  1WC3 A;  3C15 A;  1FX2 A;  4OYZ A;  3MAA A;  4CLU A;  5D15 A;  1WC4 A;  4OYB A;  1YBU A;  4WP8 A;  1CJT B;  4WP9 A;  1TL7 B;  4CLF A;  4USV A;  2GVD A;  4P2M A;  1CJU A;  5D0H A;  4OYO A;  5IV3 A;  1U0H A;  3MR7 A;  3G82 B;  3C16 B;  4CLY A;  2BW7 A;  4CM0 A;  1AZS A;  4OYA A;  4USU A;  1WC0 A;  4CLT A;  2GVZ B;  1CS4 A;  4WPA A;  1CJK B;  4WP3 A;  2WZ1 A;  5D0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...