2GVZB

Crystal structure of complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with mant-atp and mn
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
188
Chain Sequence
QSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase type 5
publication title Broad specificity of Mammalian adenylyl cyclase for interaction with 2',3'-substituted purine- and pyrimidine nucleotide inhibitors.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase
total genus 52
structure length 188
sequence length 198
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 2gvzB00
4OYIA 1AZSB 4WP3A 3UVJA 1AZSA 4USUA 4OYAA 3C15A 4CLYA 4OYMA 3MAAB 1YBUA 1WC4A 3MAAA 2GVDA 4WP9A 4NI2B 1WC0A 4CLFA 1U0HB 1CULB 4CLWA 4USTA 2GVZB 5IV4A 1TL7A 1FX4A 4WPAA 4CLLA 4OYZA 5D0EA 2QV6A 1CJVB 2BW7A 1TL7B 4CM0A 1CJVA 3C14B 1AB8A 1YK9A 4NI2A 1YBTA 4CM2A 1CJTB 1Y10A 1U0HA 1WC6A 4P2XA 1CULA 3MR7A 2GVZA 4USVA 4P2MA 1WC3A 1CJUB 3ET6B 4CLTA 5D15A 3R5GA 5D0GA 4CLZA 5D0RA 4CLKA 4P2FA 1CS4B 3C14A 1Y11A 4OYWA 1CS4A 4OYOA 4OZ2A 4OZ3A 5IV3A 4OYPA 1CJTA 4WP8A 4OYXA 3UVJB 1CJKB 4OYBA 3C15B 1CJKA 2W01A 4CLPA 3C16B 2GVDB 5D0HA 4USWA 3C16A 1CJUA 4CLSA 3ET6A 4CLUA 1WC1A 2WZ1A 1WC5A 3G82B 3G82A 1FX2A
chains in the Genus database with same CATH superfamily
4K0KF 1KQGB 3KLEB 3VVTA 1D9AA 3L7UA 4USUA 3BEGB 4FKYA 3UDEA 1TK5A 3MAAA 1RKIA 1RT1B 5E3CA 2UP1A 3HHLC 1SQFA 1BLUA 3TX0A 1S6PB 4JV5F 2RS8A 4JYAJ 2XHCA 3GIMA 2VBYA 1VHFA 2IRUA 1TTHB 2MGZA 4IH5A 4KKOA 2BE2B 5ITHA 2XI2A 4DR2J 1YJNS 5C2GA 3T5LA 5LXRA 3F41A 3FSIA 4MIWA 4Y3CA 3HHLD 3BO2A 2XWXA 4C3KA 4PG5A 5GAEI 3T5KA 5EWEA 3HMJG 5D15A 4O44B 3RB0A 1K0VA 1V6HA 4F04B 2C3YA 1VCTA 2K3KA 2N3OA 4UT4A 3IM9A 4PZVA 2DH7A 4RZRA 3C6UB 4NYZA 1WSVA 5AXMA 3NOCA 3BZQA 4YDXA 2R7OA 3BSOA 3IRXA 3QRPA 2Y0SD 2F4VF 3FFIA 2B8QA 4P7VA 5CCLA 1RAGB 3D1OA 2VBXA 1FTRA 8AT1B 3N0VA 1RSCA 2ROGA 3G71S 4C3MA 2JFKA 3QMQA 3HLUA 4ZCMA 2G4BA 3HFKA 3BSNA 5GAGI 3M9NB 4RNOA 3K59A 5CYQB 4UY8T 2VFTA 1LWFA 1HIYA 2O1PA 2RJZA 4LSLA 3W9IA 3VZIA 1FI4A 1X0PA 3V2UC 4DV6F 2JLEA 5HBMB 4CZCA 3I0SA 1F6TA 2D7SA 3NGTA 2KJVA 4P2XA 3CMAS 2DEJA 4N47A 2DRAA 1IKXA 2CQHA 4IQXA 2QL5B 2G1DA 1N48A 3GILA 4ID8A 2MLXA 2Z2ZA 1CEZA 5AJ3J 5L1JA 1NZ8A 1L3SA 1HMVB 3OUYB 2M2BA 4Z2XA 1NH7A 4DBQA 1IBCB 2PN6A 3AH6A 2IBKA 4LF7F 2UV8G 1QTNB 4XDDA 4RNMA 2YPYA 3GMGA 4PQUB 1S9GB 2P2CB 5E7OB 2LQ8A 3H0PA 2F65A 3BBCA 1HNXJ 4K2JA 3TVYA 3LP0B 3LANA 1XTZA 2M5YA 5KFEA 1RTHA 2F7VA 4ES1A 3PYDA 1CG2A 5MAOA 5IT9Y 5DZ7A 5E3RA 5HLFB 2R7UA 6FDRA 1CC8A 2BKNA 4WTYA 1KDNA 3MMAA 4B9LA 4OYZA 3CJ2A 3BN4A 3G6VA 4PG6A 2ZBIA 2RU3A 1HI8A 4EYIB 1P9QC 1WKJA 1F60B 1VS3A 3RR8A 4MFBA 3UCGA 3MEDB 3R5GA 3EXYA 1AUSL 2FIUA 3AOCA 4QR2A 2GHPA 4ANCA 1TK8A 4FP9A 1M5KC 3ZZOA 4BLGA 4LREA 5F8NA 2X1BA 1NEEA 3FNNA 4FF3A 4UY85 1NMEB 5J2NA 2GS8A 1SH3A 2NLWA 1WACA 2VC0A 3V81A 2HNDA 4C8KA 4IFVB 2HRUA 5I3UA 1FJGJ 3IAS9 2FJVA 1X8DA 1R8AA 2CWXA 5KT4A 1WC0A 3LQVA 3QT7A 3LP2B 3J81U 1IKWB 2A1BA 3H2VE 3OR2A 3TEHB 2ILYA 1AW0A 4YMEA 3HVTB 2HHXA 5G0RB 3LF0A 3F0NA 2ADCA 3FMBA 5K8PA 4JOUA 3N6NA 3X3UA 4P2SA 3BKFA 1TELA 5ETNA 1SIWB 3VGTA 2RHQB 4RWWA 3POTA 2BEFA 4RW8A 3TZWA 4WFAQ 1U6BA 2Q6BA 5IV3A 4DL4A 1LW2A 2YWKA 4OYBA 2LDIA 1TV6B 3QJPA 3GYGA 1NHUA 3LP1B 4UF4A 3H90A 4QPTA 2B43A 1FKPA 3C2PA 2HFSA 4LBHA 4X65J 5DG7A 3H98A 4ECWA 4J7CA 3E3XA 1V5IB 3R1HA 1TMJA 5J2MB 3KDNA 1HQ2A 3C8YA 3JTOA 5KFBA 2GQCA 2MZRA 2WTFA 2CG4A 1GX5A 2H9ZA 3K58A 3GV7B 3U1MA 3VCDA 1J5OA 3DOLB 4FNHA 1BD6A 2R7XA 4B3TF 3TP2A 2GNKA 4G6VB 1U1RA 2ZJRQ 1S1XB 2HRTA 3MM8B 1CJTB 1U0HA 2JSXA 2R7QA 3PDNA 2BZ2A 3A3PB 1TKXB 1X4DA 3MR3A 2AD9A 1S57A 2JEJA 4GC6A 5I42A 4I7FA 3LAMA 2RHSB 2UUBF 2E7XA 3CTRA 3VAFA 4JI1J 2UXCJ 4CLPA 1HBUB 1OIAA 2AW0A 1KBRA 2YWWA 1LFWA 1IWGA 2KT2A 5CD4H 3BKTA 3CJKA 3VZHA 3P6YC 3M8ZA 1G3OA 2Y9HA 2A10A 1YBUA 2QLXA 1NKCA 3AJ2A 3A8KA 5KFYA 4LFAF 4N41A 1FE0A 5LJ3Y 1VDHA 2OSQA 2QLFB 3NNAA 4NRUA 1ICEB 4WCEQ 1C0UB 4C9DA 5T7LB 1K44A 2VFUA 5A0YA 1JLAA 2AF6A 4NRTA 2OPPA 3RJMB 2WVCA 2R8IA 2G9OA 1OYDA 1AT1B 3RAQA 2CQCA 4OZ0A 2D9PA 1E6YB 2CNKB 5A2QU 2FTRA 4QU6A 4HR2A 4NLXA 4DX5A 3TANA 2O3DA 3CJTA 3PW2A 1YIJS 3HVWA 3DC2A 1E6VA 1PJ6A 4OYXA 1LKZA 2OEKA 1OS5A 1V3ZA 4X84A 4USJC 2KM8C 4MK9A 2ASLA 2FVCA 1RWOB 1KLMA 2CPIA 3RRGA 1IBMF 4E98A 2RRNA 1C4AA 4PYDA 2W24A 3I32A 2HBZB 1NJWA 3TZXA 1U47A 3NMRA 3QIDA 2UVVA 2B3TB 2BBEA 4CI0B 4YY3F 4X4OA 3BBFA 2J8AA 5IV4A 5D4LA 3AFGA 2V9WA 4KH0B 2CG8A 3DOMA 2PA8D 1YJTA 4OZNA 1FNMA 3TEGA 3BGRA 4HDHA 1XERA 2JOQA 2LCWA 2OD6A 4CM2A 4UUWA 2V2ZA 3KWMA 4RJVA 2V4JB 1B7FA 3NGUA 3DLHA 3ZTPA 4WBFA 4Q8EA 2HGMA 5GAHU 2YH1A 2Q43A 3FC9A 3D66A 3PYFA 4MKYA 1IKYB 4EGLA 3Q8SB 3N01A 3GZ7A 2CADA 1JXVA 3I9ZA 1U4BA 3DRPB 2CQDA 1N5VA 1WOPA 3FGVA 3DLGA 4AE5A 2V67A 1T3OA 3DI6B 1JLQB 4DUYF 2YKMB 4DDFA 1JLGB 2NSBA 4TY9A 1R31A 1T11A 1NKBA 3H8YA 5D4NA 3GFXA 1HHTP 2W2PP 2BM0A 2NUUG 4OQJA 5KOWA 1D0EA 2PO4A 4DU7A 2HK2A 3DMJB 2CDRB 1S9EA 3HSDA 4ZPVR 1NPKA 4NI2B 2CDQA 1J5EF 2RDDA 1F5AA 3NGDA 4WIQA 3DLJA 4RNHA 3N28A 3R5CA 2CPZA 3D0GE 1SC3B 2DNMA 3I6PA 1TKDA 2IYGA 3EGNA 2PE8A 1FRHA 3MAQA 1PBAA 1S79A 3CSKA 4I6YA 3UQSA 1SXLA 3BR9A 2AJ0A 2F63A 2HFVA 2KT3A 3CIZA 4DFJA 1REVA 1KVKA 2HFZA 4BBYA 3BO3A 5IWAF 4JP8A 2YKNB 1Q81T 1Q53A 4ZVOB 2CWKA 1C0TB 2FZGB 3NWGA 3NKYA 5D4OA 3VAKA 1APSA 3W64A 1KQKA 3MFHA 2DGVA 1CJKA 4NEYA 3GQCA 1LWXA 2JX2A 2OH2A 3D67A 4DV4F 2BJDA 3QWPA 4GVBB 4U95A 3M6UA 2BABA 2CQ1A 3DLBA 2V8GA 1WC1A 3Q8YA 2QA2A 1PJ5A 4QYZK 2PEBA 1KQFB 4IH6A 4E8UA 1CVJA 1K47A 5IT9U 4OJHA 3FQKA 2FUG9 2H65B 4WIIA 1QE1B 2EI5A 2Q3PA 3KK2B 2BYCA 2B4PA 4XAKA 1DZ5A 1U09A 4JI7J 2XWYA 1RCOB 1VC6A 3FVYA 1FVQA 2KFZA 1RWKB 4ZLPA 2VG7B 3DOKA 5HROB 2XGPA 1I94F 4NLPA 1I1GA 3P5BP 1T9TA 1UEVA 3FZBA 1RT5A 5DGAA 2XMWA 4LF1A 3KXDA 2OJ3A 1M1HA 3M1VA 1VQOS 2QTWA 4WFBQ 1DBDA 1NM2A 1YZ7A 5KFJA 3PRBA 4JI6F 1JXLA 1S1WB 1TL1B 3EPIA 4X62F 3DXBA 2R7WA 3ITHB 4UOFA 1T05B 1NK6A 3HFZB 2KYZA 1JJ4A 2C2KB 3GIJA 1NK8A 2M9KA 1YITS 4Y2KA 3O44A 2GQ2A 2EKYA 2KU7A 3GSIA 5KFPA 2FHKA 2LEBA 1FE4A 3OSPA 4NCBA 2C3PA 1RT1A 4QR1A 2Z2LA 1TUGB 2VODA 1FRLA 1FKAF 2VFRA 3QLHB 1U26A 3SSQA 5E41A 2DGTA 1LWEA 3RAMA 3TX8A 3QFWA 4K4VA 2KXHA 2H51B 2W7OA 2U2FA 2YNGB 1RBLA 2XYPB 5LSOA 4ZVEA 5GMKa 3PYGA 1BQNB 1H2TZ 1JKHB 5LXYA 1N6QB 2QFJA 3ILLA 3RAXA 4ELUA 4O44A 4PPDA 3K7RA 2GW8A 4DSKA 1QUVA 2APOA 2UU9F 3TA0A 4CYUA 2GIQA 3IGVA 4LQ3A 4UTGA 4LQ9A 2HIQA 4IQMA 3C6UA 3A8IA 3IR5B 1PG5B 2DJWA 1C1BB 2ZD1B 3W2WA 4AXIA 4OX9J 2QRRA 5JXSA 3M7VA 4M5MA 4MJKA 3UD3P 2NXJA 1X7VA 1FTCA 4K4ZA 2CYYA 3MFIA 4G3IA 4J9OA 2V69A 2N3LA 1Y3JA 3R5BA 2RRBA 1L3UA 3PY8A 5CYQA 1IKVB 3R97A 4YDDB 2AQ4A 2M7SA 4NXMF 2J9EA 3T1HJ 4WFXA 3V6DB 2VQEF 1PC4A 1RT3B 2HGNA 4LMZA 5HBMA 5EX0A 2MKIA 2D74B 3G8SA 5IC4B 3B54A 3P3DA 4HEA9 3ZTQA 5L9NA 3OPKA 1SCJB 2OP5A 2GJIA 1NKEA 1G2EA 1S7IA 4JV1A 2R8GA 2VPXB 3MPWA 1DTTB 5GVQA 1G1XA 3MEGB 2DVIA 3PG9A 2HNYB 1RLDA 1UW9A 1RUSA 2WCXA 1HMVA 4G1PA 4WP8A 4KC5A 1Y7PA 3ZZZA 3OUYA 2QL9B 2V68A 3SFGA 3GJQB 3IBCB 3UWTA 3MEEB 3ZTRA 1RHQB 1MU2A 2KL8A 5B09A 3IXQA 5T41A 4OYAA 3JSRA 1GTHA 3LP0A 2W1BA 2X3DA 1KD1T 1WNEA 2HLUA 1U1QA 3SXLA 4J9MA 4A46A 1NDCA 3TA1A 4TYBA 3SEOA 2H5EA 1M1KT 2MMYA 3DN9A 3IBFB 2ZOGA 1WDTA 3V4MA 1N88A 4PWDB 4J9PA 1QAYA 1R0AB 1FDBA 3AB4B 1CULA 2KTQA 3RBZA 3D0HE 4C98A 3CCZA 1FD8A 3MEDA 2B51A 1N4LA 4CWBA 5EUHA 2UXBJ 3CO9A 1GAOA 3C6TB 4GKKJ 1IUJA 4C97A 2FLPA 1ZAXA 5LMNJ 4DL2A 4ZIVA 4IO9Q 1TFYA 3EJMA 2ILZA 2Y3YA 2QYCA 1X4GA 2W4CA 3T6JA 1UETA 5KFZA 2CPYA 3D1HA 2P9EA 1X5TA 1GMWA 3L4BC 4TN2A 4IFVA 2DPJA 1NXIA 1Q86T 2IC3B 1SC1B 3KJVA 2ZM6J 4DV3J 2BE7D 2LFVA 3HHLA 5KTQA 3OTEA 3LP2A 2XSFA 3T9ZA 4J9VA 1IKWA 2I0XA 3A3OB 3PKYA 4KGXB 5G0RA 1QSYA 1VQNS 3W8GA 2CZVC 3HK2A 3DNCA 3G96A 2ZH7A 1HBMB 2G0CA 3CJSA 3U02A 1HQEA 2OEMA 1FD2A 4ZCKA 4ZA1A 1OSDA 3DRRB 4ETZA 5KFFA 2J7UA 3BBBA 1JLFB 2XZDB 2VPWB 1IJEB 4I6AA 1Y0HA 2GVDB 1TV6A 1I3OB 5E33A 1ZZNA 4PG4A 1SJQA 3O3LA 3FK4A 2ZHBA 3I9V9 4ATNA 1FNOA 4WYLA 1XNQF 2HVHA 1VOMA 2HHVA 1X4FA 4WKRA 2WONA 2Y8WA 2PEHA 1KKHA 4KQZA 1EX8A 4DL0C 1DFDA 2DHHA 5GADU 2ACMA 4I6WA 3K8WA 1T9XA 1RTIA 5K5MA 2HWTA 5KT5A 1S1XA 2BM1A 4E2FB 2GFFA 5GAHI 1VQ6S 1X4EA 1CSJA 2BOAA 2ZZMA 4TU7A 3KNGA 4B9NA 3NRBA 4IR1A 3R6LB 1FWLA 2RSQA 5CABA 4CLKA 4Z7YA 1RBOB 4O3QA 4RW9B 2J0QD 2CJQA 1YQHA 2AJ2A 2XNRA 1ZAWA 2HS0A 1UW4A 4LF5J 1OPIA 4CLSA 1HBUA 4DR5F 2I5JB 2JEGA 4QBUA 2HHHJ 1CC7A 2UUCF 2JVRA 2B4OA 2VASA 2YWHA 1BGXT 1TL7B 4OV1A 4DFKA 1BUXA 2HHUA 4DSJA 1D8ZA 5C2CA 2CUYA 5K9FA 1O0PA 1T9WA 2CPJA 3DCAA 4WJBA 2NREA 4Q5VA 5IOLA 3CCSS 1LK7A 3ONQA 2NZCA 4QIEA 1I6JA 2AV5A 7FDRA 4YP3A 2K7KA 3BYPA 2LDYA 5CZVA 2LQ5A 1YVFA 3O5TB 2PMZD 4F26A 1VRTB 4ZHRA 3NS5A 1C0UA 3MR2A 1TKTB 1S4EA 2I6WA 1H72C 1E6YA 3EZUA 1S1TB 4J9SA 1N34J 3I31A 3RBEA 1TUWA 4ILMA 2DGSA 3GG0A 3SIPB 1YRXA 3AD7C 3KK3B 4YEAA 5KT3A 4ID5B 2ALYB 4F2SA 2R8KA 1SUQB 4JI2F 1KLNA 1RYRA 4RUBA 5F0UA 3EVMA 4CDIA 3FMWA 1RAOA 3T41A 4MK8A 2K2PA 3BQ0A 1IR0A 4PPZA 2V50A 2LEPA 1W7WA 4OJ3A 5L1KA 2FHJD 4K5RA 2X51A 5E0OA 1LNQA 1H2UX 5HK4A 2KXNB 2DR8A 1JXEA 2DNPA 2JZ5A 1FFGB 4M8LA 2L3MA 2MKHA 1LXNA 5IXUA 4NCGA 1VRUA 1UFLA 1SL1A 4DEZA 1XN9A 3HSZA 3OHAA 1UJ5A 4RWXA 2LECA 4ECXA 2P6TA 2CJBA 2V4JA 1W25A 2K3IA 2FC8A 2Z8QA 5HP1B 3T5HA 3L3CA 3OTOJ 3ENVA 3U1LA 5ETLA 1Z2ZA 5K8OA 1U02A 1N5QA 1ZETA 5DDRC 1VQ9S 3JQJA 4EUVA 2QMUB 2BRKA 3VR1A 3HPOA 5HQMA 3L7PA 3DI6A 4DPOA 1JLQA 2YKMA 1RWWB 5C5JA 4A4JA 3RB4A 5C24B 1TFWA 3AD8C 4ZP7A 4L3KA 2JEIA 1B70B 1L5UA 3MXHP 3TJ8A 2DR9A 2ZE2B 2XS2A 4MKAA 4J9RA 1FWPA 3DMJA 5DLFA 4OIXA 1CPZA 2ZNZA 4ANDA 4ED1A 4AXJA 2DYAA 2XBPA 3BN7A 4AL6A 4F3QA 3CF5Q 2R7SA 1NZAA 2V2KA 3SV4A 2PIIA 1GNKA 3IN5A 5M2PA 2ZC4A 3M05A 1KEKA 1XWLA 1RT4B 2OHDA 2HNZA 3OVSA 1YRUA 4QWAA 4LIWA 4UQTA 1VK8A 3GP9A 2VG5A 2VG6B 1U1NA 4G1QB 3VQSA 2NYHA 5DDQC 1TL3B 2YKNA 5B0AA 1JLCA 5AE3A 1WG4A 5D0RA 2XZWA 4NLSA 3DLLQ 4ZN3A 4OZ2A 4HKQA 3KMSA 2VJVA 5D77A 3CMQA 8RUCA 3N6MA 4IYQA 4UUXA 2NUHA 3LGMA 1HBOA 1T7PA 4LBIA 3R3TA 2WZ1A 2DNNA 3VV2B 1A6LA 5F8LA 4O3OA 4UZCA 3RW6A 3VQTA 4MIAA 4FS1A 4O4GA 3ENAA 2LXFA 3H5XA 4DN9A 1M90T 1RB0A 2DHXA 3VVUA 1OMSA 1QE1A 3HULA 4LF9F 3KK2A 1T03B 3ILOA 4ED7A 3CDAA 3PJXA 1EB0A 2M4MA 3FEZA 4B9SA 1R0BG 5HVFA 4K4XA 3NXZA 3M2RA 3LWLA 2VG7A 2WOMB 4QYRA 2VU5A 5HROA 2VFSA 3MPUB 1NK9A 2FLLA 4DQPA 3TAQA 3OFHA 1K9MT 2MXYA 3ZZYA 1JWWA 2RUGA 5BR8F 2B9EA 2M3DA 2ZWOA 4YHHF 1NJZA 5JJBA 2O66A 2FJXA 2CIMA 4OL8A 3H5SA 2WSCC 2RUSA 2JFDA 5IM0B 1BC6A 2PSZA 1NK0A 3BM7A 4PQAA 1VBZA 3LUYA 1NK4A 3T9NA 2MGZB 4KKOB 4KRWA 4F0MA 2MY8A 3AA8A 2NYIA 4J9KA 5HMXA 4ZITA 1HL6A 4IO1A 4DUZF 2MY7A 4A8MP 1EETB 3AJDA 2OSRA 3MEKA 2OKQA 4ZVTB 1HW9A 4ZVGA 2L48A 1NDPA 4C8NA 1S49A 3ICLA 2RB7A 2VH7A 1IQTA 1BQXA 4DR3J 1BQNA 5LL6d 3ADAC 4C11A 1AFJA 2DNQA 2K8GA 3IRXB 2AT1B 2RS2A 3TQ1A 2CVIA 5DZ6A 4J9QA 2BW2A 3FFIB 4KFBB 3AOBA 4PYAA 2FJBB 5J1PA 2ZZTA 1N54B 2ZDPA 1BMQB 3WX4A 3KTQA 3CD0A 2J6TA 3UI3A 2O5DA 1F5BA 1C1BA 1R0CB 4N8NA 1VHIA 1LWFB 4DV5J 3HJFA 4FNIA 3TW0A 1D9FA 4LSLB 3LW5C 1KQSR 3HDSA 2YNHB 3CO0P 2DR7A 4IOAQ 4LF2A 1S6OA 3ZZRA 4PG7A 1FFSB 2VPYB 3HXMA 3Q89A 3GG1A 2NQPA 1YJ9S 2ZBCA 4B3SF 3OL6A 4LF4J 3V6DA 4AT1B 1RT3A 1SC6A 5HMYA 3KUEA 4LF8F 1FNXH 2HIYA 4ZVRB 2OD4A 5L1IA 4M63A 2Z2YB 1WOOA 4NLVA 4GO7X 2Z4PA 1FERA 4IFYA 1DTTA 3KDOA 4Y2MA 2V4QA 1VJQA 4ZCLA 4DSEA 4I4BA 3PRDA 2G0JA 4NLYA 3PZPA 2R2TA 1HWUA 3MEEA 4YN3B 3DLEB 1AFIA 4P6QA 5KT2A 2D1CA 3W3SA 4S0MA 3MMAB 2UXDJ 4EEYA 2RAQA 2BQRA 3ILJA 3THPA 3DDNA 2YPZA 4A8KA 1R8PA 2EFPA 2IRXA 5KFOA 1RJJA 4FPRA 1FX4A 4A8QA 1Z1ZA 4Q43A 2IMWP 2E5HA 4X4PA 1CJVB 2DB1A 2IDLA 3NWRA 2MSSA 1Q8BA 3CVKA 1F9EB 2GHWA 3D54A 1KFDA 2DNHA 3BJYA 3FBFA 2M52A 2V2QA 1N0VC 2OLWA 2DCLA 4DZ6A 1SKWA 3WC0A 1ULRA 5IQ6A 3ZC4A 2HRYA 1X9WA 5GMDA 1MMDA 3VGUA 1B7YB 3PEHA 3LA0A 5CYMB 3LH2S 2VBZA 2EK1A 5A6PA 2KXFA 2ZC3A 5BXIA 3OR2B 1KONA 9RUBA 4O4RA 2B4VA 3MM5B 3FUYA 3CC4S 1EQMA 2DRBA 3CCVS 4JI0J 2COLA 3EDRB 1WTBA 4CO2A 1UEUA 2BE9B 3DXSX 3GE9A 3WC2A 2BQ3A 3QSIA 3JQKA 2VD3A 3H2LA 1XNRF 3G87A 3J7ZT 2V8PA 5KFLA 3RYLA 1Q7YT 1LW2B 1Q79A 2D3UA 1Z4UA 4P2MA 4FDFA 5F9NA 1FKPB 3MMCB 2YH0A 1S0MA 4JI8J 3GFYA 4PABA 3DRRA 4MKBA 1RXOB 5KFUA 2LA4A 1VLYA 5DJBA 3NNCA 1RZMA 2N4DA 3SQGA 2RQ4A 3MURP 3DRXA 1SJ4P 1DRZA 2W01A 4EZ9A 3FQLA 4IG0A 3ET6A 1WHWA 2GO9A 1QSSA 3AA9A 3DHWC 2H48B 1RI7A 1RAHB 2IJNA 3ZZUA 4NLQA 4O3SA 2EFQA 4ED5A 4WZMA 3RUBL 2QJ3A 3GONA 5F41A 2HQ3A 2EFNA 3RRHA 4F2RA 3KJQB 4Y65A 3V4IB 1U0HB 9ATCB 2NPFA 4U67Q 1Q8KA 3PW7A 1O6XA 2CPFA 1PO6A 3VHQA 3EX7B 4IDKA 2MSTA 3JSMB 2XS5A 5I42B 4I7FB 4ILLA 5KFRA 4F0HA 4EFAC 4B08A 4J91A 1MMNA 3PW0A 2ZH4A 1DQ9A 2QA4S 1H7WA 3FEYB 4DV1F 3QYYA 5DO2A 3CJKB 3EXCX 4DI6A 5DM7Q 4RW9A 1NU4A 1OYEA 1ZM9A 2CXEA 5J2PA 4BC7A 2HAIA 4OI4A 4OLPA 3J7Z5 5AT1B 4DL7A 2A0FB 3CJ0A 1RADB 3W1YC 3J81j 2W9BB 3C46A 3MHYA 2OPPB 3Q8PB 3DYAA 4X66J 4ED4A 4ZPCA 5F8HA 1EHWA 3BDEA 4ZS6A 2IHR1 1VRTA 3R1LA 1TKTA 1E6VB 4G1IA 3M2UB 1TZ0A 1FF2A 4J5OA 5E3PA 3Q8UA 2PGCA 1LWCB 1FRIA 3GR0A 1S1TA 3G6ES 5LMNF 3FCHA 3BPSP 3LGNA 2YWEA 2DH9A 5L1LA 1VI7A 3KK3A 1HNWF 4DR7F 2J0SD 4JUZA 2QT7A 5B0CA 1SKUB 3HD1A 4ID5A 1SUQA 1F2HA 1Y9OA 2IDEA 2KVQE 3PJ9A 3VGSA 4DSIA 2R8HA 5I3PA 1IR2A 3MUVP 1SI9A 3LOUA 3SCLE 2MZ1A 4RBTA 1FX2A 3DOMB 1HWIA 1PAEX 3DM2B 5D6GA 1VBKA 1QAXA 5KFWA 4KT0C 1SV5A 2XCPA 4DX6A 4NMLA 4QIWD 3PHEA 5LMUF 4PKDB 5F3ZA 3JTNA 3RZAA 4X64J 2BOPA 4RNFA 3DU5A 4X4VA 3AB2B 1FRJA 1B0PA 3HFVA 2XS7A 2EKNA 4P72A 4DR1F 5CHCB 3CC7S 1A9NB 2LQBA 1QD1A 3KKFA 4DHVA 2MKCA 1R7IA 2ZH3A 2WSEC 3WIUA 4K8RA 3MR5A 2MPUA 2DNGA 5HP1A 4Z37A 2B8PA 1WDDA 2NZ4A 3TZYA 2XTJP 2B6AA 4K59A 4CTAA 3NEKA 4DV2F 2DBBA 1S9EB 1YHQS 3CCRS 3T19A 1B64A 3CUNA 1U45A 2WK4A 4LFCF 1AZSB 4OX8A 3R2CJ 1A0OB 5CH7B 2ZBPA 3W66A 3SSRA 4DQSA 4DR4F 2HVDA 4ZVHA 4I67A 2HWIA 1REVB 3Q24A 2XYGB 3H20A 3TAMA 1WWHA 4HLBA 2R2SA 2IFXA 4RU9A 3C3LA 3CNQP 1N32J 3CC2S 2MB0B 3ENQA 4C3LA 4WWSA 1RT4A 2DNLA 3FSYA 3FBBA 2WVBA 4K0KJ 1WF1A 5A8KB 3IAM9 1QAJA 1FDDA 1NB7A 3GCXP 2W7AA 2VG6A 4ES2A 5ETPA 1X4HA 1TL3A 5IC6B 1RWPB 3DRSA 1HW8A 1FDAA 1XJWB 3AQPA 4JV5J 4USMA 3T1YF 3K5LA 1D09B 1N5TA 3PO5A 2CQ2A 2NS1B 1AA1B 1RT2A 2JDJA 3GLJA 1HNZF 2DHGA 4Y28C 3ETOA 4DL3A 1H38A 4NEZA 2MZJA 4OX7A 2AIRB 3IG1B 3HM9A 1T9YA 4DOZA 3PACA 4WXWA 2P5VA 4ZJOA 1X4CA 5A6WA 1IR1A 5IT0A 5HJXA 1N36F 2RKIA 2PA3A 1OY6A 4WTOB 4KGVB 3G8QA 4K4TA 2CZ4A 1T03A 2EVZA 1FEEA 4CNYA 7AT1B 4ZP6A 3OT9A 5DDOC 3HHKA 3BDPA 3DLKB 1T0TV 3JSBA 4C8MA 4TLQA 2F4VJ 2NSCA 3EUNA 4FBTA 4USVA 1EAYC 4GC7A 5CYJA 5A8WB 3PFOA 4TXSA 3W62A 3N5BA 2C2OB 4NYPA 3MOJB 3T3FA 4ECQA 3QJLA 1XIQA 4C0BA 3ZNJ1 4ZLNA 1DTQA 3BF4A 2E5GA 1S48A 4DLGA 2EBGA 2EWHA 1RHJB 1UPPA 1WEXA 1P27B 2FHJA 2DRDA 3EGZA 3M8RA 4DV6J 5ETVA 1GQEA 5IM0A 2GAGC 3MUTP 4QZVB 1U6ZA 5HO4A 3UCZP 1Q8IA 5CZXA 3RU0A 1LWEB 1C1CA 1R6VA 1UTAA 4URGA 3Q2TC 5JMNA 3EZ5A 3D9BA 2FB0A 2MQ8A 1PGZA 5KFVA 3KNAA 3GTYX 1EETA 2DD8S 4LF7J 4K7QA 3QNWB 2Q1LA 2W2QP 3Q8VA 3F56A 4CYUB 1BWVA 4CO0A 4FXVA 1G6BA 4IG3A 2LXUA 1RWUA 3UN2A 4H4KC 5D3GB 2PFFB 3W2WB 1IJFB 2AZ1A 4KGKA 1Q82T 1CS4B 5F8GA 2LEAA 2AGPA 3QO9B 4KFBA 4XDCA 4OYPA 1OPZA 3O1LA 3BGFA 3C16B 2X1AA 4TQRA 3CMES 4B3RF 3MTJA 2EXUA 3V6KA 2V8HA 3QATA 5K8NA 1NSPA 4HT7A 3PVXA 4M5KA 5EX3A 1DHMA 4BWJA 2XZTB 2AX1A 3OR1B 2OFHX 1VGYA 2LYVA 3KLIB 4KIAA 2AWZA 2YNHA 3T1AA 2QZ8A 4DWIA 2E5LJ 1XMOF 1S12A 4LRBA 1GK8A 2HQCA 2KHCA 3GYXB 2DO0A 4AL5A 1HR0F 4F67A 5MLCV 3UO0A 1RWNB 4Q8FA 4NZ6A 2W4DA 2AEMA 4QJVA 2B5JB 2JJ4D 3VALA 1WHVA 3P4UB 4Q2MA 4H4MB 2PMWA 3TWZA 1M5HA 3KJFB 2J9DA 2VONA 4L73A 5ETKA 2IJRA 4NE9C 4B3MF 1JQGA 2YKOA 4Y2CA 1HLWA 5H9EJ 4FS2A 1MU2B 4AD6A 1ZZFA 3WBZA 2R2UA 2AGQA 5B0FA 3OQ2A 3ZZTA 2GA7A 4PWWA 2Z57B 3R7BB 2G2OA 1QDUB 4P74A 3NGSA 4R0EA 1SBRA 3DLEA 2NPIA 2KT5A 1SPBP 4LSZB 3CIMA 3F44A 3NMAA 7FD1A 3M9OB 3MM9B 1P1LA 1Q5VA 2KVIA 3PCOB 3MWBA 3AJ1A 2Q66A 5B0GA 2N7CA 5K8MA 2UVUA 4N8OA 3VAHA 2C42A 1CULB 3OFFA 3A8EA 1KOOA 2HFOA 2VL1A 2O01C 3OJUA 1CJVA 3CEDA 4EBDA 2MQLA 3AT1B 5B0BA 4MYTA 3PIOQ 2BVZA 2IPOB 5LSRA 4OZJA 3BSCA 4YB1P 2Q79A 1JK9B 4P2FA 2CQPA 2KG1A 2ZH2A 1TMMA 2ZVSA 1RWMB 4B3TJ 1VQMS 3FBCA 3RGIA 3KJVB 5CYMA 1U1OA 1U6FA 2FVRA 1MLAA 3HHLB 3D2WA 5FDLA 5DG8A 3GYNA 1S59A 5FLXY 3KLHB 2VBWA 1HA1A 2E7WA 1RHUB 4CRJA 1NJXA 4ERDA 5I3QA 3MM5A 1NK5A 1WKKA 3DU6A 1TP7A 2EW9A 3MOZA 2Y1IA 1G7CB 2OPQB 3CDEA 4ED3A 4F4KA 3D6HB 2ZJPQ 3DFEA 1HQEB 4OMFG 4DV7F 3D7SB 3W5XA 2GHVC 2W2NP 1N33J 1OSCA 4NASA 1AYEA 5CA5A 3K5OA 2B56A 4CNZA 2M88A 3NCQA 3CT9A 2V9KA 1HI0P 3MMCA 4DPXA 1RAFB 4CO1A 4DPYA 2QFIA 4RW6A 4KGMA 4LFAJ 4NL5A 5K14B 2E44A 2RU9A 3PX6A 2WONB 2LU2A 2ZITA 1MN7A 4USWA 3OJSA 2JEFA 1L3KA 3KLFB 3DKDA 3D1QA 5GAEU 2BV3A 3PFEA 5KG5A 2D3ZA 3GU0A 1UEKA 4RX6A 3E01B 1BY9A 3EVOA 2HVIA 1RTIB 4UOHA 3R5AA 2I1RA 3MECA 4OLOA 5M2RA 3V4IA 1T3NA 5L38A 4A8WA 1QVFR 3CD6S 3IS9B 1J2VA 4P9SA 4HDGA 2VJUA 3LWMA 3JSMA 2VHGA 5DM6Q 3V6JA 2HSEB 2ZKTA 3MF5A 2NXCA 2EC2A 2JLFA 2QL7B 4ALZA 1Q95G 4RBUA 1IBMJ 4URQU 3I96A 2OFGX 2XCAA 2GVZA 4NA1A 1Z2LA 3BQ1A 3MPYA 4CLZA 3GPAA 4ZPWR 1W26A 4YY3J 1L3TA 4ZPBA 1S99A 1XK8A 4K5SA 1X60A 3UCUP 3PEJA 2AYEA 5HVGA 2ZDOA 4OI3A 4ED6A 4Y0FA 2DCUB 4KY3A 3WZ0A 2XSJB 1RU1A 3IWXA 1X4AA 1U1PA 4ZHRB 1S1VB 2W9BA 4GKJF 1P9YA 2ZVIA 1K73T 1WG1A 1SB6A 1X5PA 3A12A 3UN3A 1RLCL 4PXBA 3OD2A 3QSYB 1LV5A 2AP6A 4CLWA 5KFKA 3P5TL 3GJTB 4ZN1A 1K8AT 2HS3A 2YKPA 3SFUA 2RMLA 2OAUA 4DUYJ 4IRDA 4X4TA 3PJWA 4Q0BA 4DG1B 1U1KA 1RAEB 2OGUA 1XEZA 3M2UA 5KG2A 4ER8A 3SDEB 4WE1A 1LWCA 4QOTA 4ZVQB 2CRLA 4I0WA 2L9WA 4ZVSB 1J5EJ 4NYOA 1WEZA 4M95A 3K2YA 5F8IA 6FD1A 3K5PA 3OTBA 3IM8A 4A8XA 1SIZA 1H0HB 2OMOA 4WF9Q 3MUMP 1YDLA 2BQUA 2VKZG 4M5IA 2K1RB 3M2VB 1F3FA 2QEXS 4NCGB 1VRUB 4RUAA 2NCKL 4HHUA 1S1UB 1FJEB 2G2ZA 3DM2A 3LALA 4FN5A 5H9FJ 4KO0B 5DLGA 5IWAJ 2MQQA 1TVRB 4CLFA 3I5CA 2VDIA 2JHEA 3MR6A 2V63A 1URNA 4ELVA 5HATA 2DTJA 2XGQA 1KHVA 1NJIT 4JB8B 2P6SA 3J7YI 2DY1A 5I4MA 3R8YA 2CA9A 3MMJA 4ZK7M 4DV4J 1BHNA 2AJFE 4HL9A 1FRXA 1UA1A 1WC3A 4F4AA 2F3JA 3H25A 1VMBA 1C2PA 2KB2A 2YNIB 1I5OB 4QIVA 4JV0A 2KDOA 4IH7A 4F4YA 4OZ3A 1YG0A 1HNIA 1VBYA 2Z56B 2GJFA 1FK9A 2B9YA 4FYVB 4DV0F 1S0VA 2FVSA 1YZ6A 2DNKA 2LXIA 2DNYA 3D0IE 2YX1A 3AQOA 1DLOA 2HWHA 1AZSA 4LT6A 2G2YA 3OL9A 3CB4A 5EHHA 3LGHA 4JI6J 1NCLA 2HBQB 2IAJB 2DK2A 2HNZB 4X62J 3NS7B 4USTA 2RDJA 2DGQA 3DGVA 2V8VA 2RRAA 2VG5B 4KJIA 2R42A 2ZH5A 4ZKAA 1JLCB 2AEJA 3MPDA 1QVGR 2VOPA 4FXDA 2CQ0A 4F25A 3CJ5A 2UV8A 1VC5A 5KG7A 2ZHOA 1SJRA 2W25A 1NSQA 5CXTA 5A8KA 1HBOB 4QYZJ 3HZGA 5KFSA 1YJ7A 4OJGA 4Z7CA 4OYWA 2C2RA 1R27B 4I68A 3G86A 3TOQA 1H3DA 1MN9A 4O4GB 1WD6A 3OL7A 1B0TA 1M5SA 1IN0A 2MZTA 1U1MA 4OJ1A 5F8MA 4R5PB 4NXNJ 3RB6A 5E5NA 3IG1A 3KMQA 1U2RA 5DRKA 3CCWA 3PW4A 3M2RB 2PI5A 3KUGA 1KVJA 1TU0B 4CO3A 3H2UB 4C6AA 4CCHA 4IR9A 2KFYA 4ZLJA 2UU9J 1HHQA 1BQMA 4QCLA 3GFHA 3CD5A 3DLKA 5LOQA 3U27A 4I2QA 1FJCA 4F3OA 1HYSA 5IS2A 1EKSA 2KM8B 3JXOA 2FQQB 4Y2IA 3MM7B 3US5A 5A8WA 1MW7A 1UVJA 2QSWA 2YQ3A 1F1BB 1VQYA 3HSJA 2W8KA 3WIVA 1XR6A 3EM1A 4QU7A 4R0JA 4QR0A 3QIPB 1DJ0A 1NAQA 4NXMJ 5FLXU 4B02A 2VQEJ 1JLBA 4ECVA 3DRYA 1WC5A 1UWBB 4C0HA 1B4SA 1GTEA 4W98A 4DQIA 4ZLLA 4MH8A 3OVAA 3CCMS 4AQYF 1QAIA 3PX4A 2AJ4A 4FYDA 3FBEA 3Q86A 4Y00A 5LT5A 1LK5A 3UD5A 3TAPA 1ZA1B 1X9MA 5CQGA 3K5NA 1RQ0A 4C11B 4OI0A 2FDNA 3OLAA 3VTIA 3IMQJ 1XMBA 4JI3F 4HVZA 3ZZ0A 3ELHA 1UP1A 1MMLA 3JQMA 3P96A 2ZHAA 2P9CA 1S97A 3BGUA 1VR6A 5D3GA 2Q6CA 2XG8A 1CS4A 2E5JA 1CQNA 2X1GA 3QO9A 2XYHB 2OTJS 3N6LA 1WKLA 1VFJA 5D0HA 3C16A 4ZOSA 2KRBA 2F9DA 1FJ7A 3W63A 4DCPB 4OZLA 5HQ8A 4B3OA 3W7BA 3CGIA 1T9UA 5EWGA 2QGFB 3NG8A 1EIYB 2EG2A 3IC1A 4CQ1A 4WFZA 4KPCA 2BANB 3TRGA 1YKWA 3OR1A 1ZM3A 3QZ8A 1VYAA 1KHWA 3KLIA 4L75A 5EGYA 1T94A 2R9LA 2VIHA 5T14A 3AXKA 1SH0A 3OW2R 4LFBF 3QWUA 2MQMA 4FXWA 1IBKF 2J6SA 1QLNA 3W61A 4IFYB 2HQGA 4KV8B 2BKOA 4R8UB 1IBLF 2J0XA 2CVEA 1RTJA 2B5JA 2FZCB 3M30B 3EGWB 1Y10A 1WC6A 5KFIA 1YGYA 2B7CB 1OY9A 4H4MA 1NBEB 2JWNA 4CLTA 1XMQF 3CDUA 1GMWD 2MQPA 2YX7A 4A8OA 3HKWA 2RF2A 1JNZB 4LUBA 3G2XA 2VF3A 3IRWP 3HF5A 4YR0A 4DX7A 2LLZA 3BGOP 3CCES 4DPWA 2VA2A 4TY8B 2OI2A 3VAJA 2KJWA 5KFHA 4LRDA 3TR5A 2C2EA 1NB2A 4ITSA 1Y3KA 2FJAB 2R8JA 1S0OA 1HFEL 4OZ1A 4JI5F 5KOXA 4RU2A 2YTCA 1WEYA 3RB3A 4WK1A 3MM9A 4USKA 3A8JA 1N56A 2J5AA 1X31C 4KPYA 2QO3A 2C1EB 2IY5B 1KVIA 4TU8A 4RPFA 1YJWS 4ENOA 4JV2A 4LF6F 2DPIA 1HBNB 1MROB 2F8EX 2LP4A 3DDIA 3TARA 3HJVA 2L9DA 1FKOB 1SJ3P 3M8PA 2EPIA 4DQQA 1YBAA 1XNQJ 4EK2A 4TKTA 4FF1A 5KFTA 3EGVA 3RG6A 4Y2AA 1CBKA 2HQDA 1FVSA 3LO3A 3TZZA 3GV8B 3G9CA 1DQ8A 4PXCA 1EP4A 1U8WA 4JYAF 5HMWA 3EYZA 3Q8QB 1B3TA 3SMZA 1S10A 3MCMA 3QGPA 1V3RA 4DR2F 2EK6A 2QA1A 4QWDA 2IBOA 4DR6J 1GMUA 1RK8A 4UW2A 5L39A 3OSNA 2V0NA 3G82B 3THVA 3KLHA 2XEXA 4MAKA 4F4ZA 1VQKS 4C4WA 1M5VC 1ZAVA 5C25B 3CCUS 3M6XA 3OXGA 4CT8A 4ZPTR 4A47A 3I56S 2C28A 5BYQA 2OPQA 4X4RA 5DGBA 2U1AA 4ZMMA 2ZH9A 2V94A 4LBPA 4YOEA 5H9EK 4DR5J 4J9UE 4DL6A 4P75A 3SQGB 1YJRA 3UNYA 1YBTA 2UUCJ 1SJ1A 2UUTA 1UJ4A 3AODA 1UVNA 3HHEA 4IG0B 3ET6B 3B6BA 4I2PA 1RT7A 3SYZA 4PWUA 3SQOP 4H4KA 4UOGA 3I4HX 1IVZA 3G4SS 1BE4A 4V1Ak 5K14A 1H73A 3ZFVA 4N56A 4AL7A 1FDNA 2GIRA 4J9LA 3KLFA 1VIOA 3DDKA 5HSPA 3KYLA 2JL9A 2M8HA 5HJYA 2E5LF 5CAAA 4RUHA 5KFDA 2R4FA 2XMMA 3E01A 4IDKB 3FRZA 3M8QA 2DY9A 2DH8A 3C15A 4CLYA 5AJ3F 4B17A 4FF4A 4LIRA 5HVHA 3TUJC 2ASDA 3IS9A 1URRA 2DR6A 4IUFA 2F9JA 2HQFA 3GR1A 2MKJA 4I64A 4JI2J 2C2MB 3J7AN 2AHOB 5DQHA 1PSDA 1P8GA 2QYGA 4FPIA 1NH8A 2VPZB 1KTVA 5J2PB 2AEFA 1HNXF 3Q23A 1JJHA 3H5YA 4EO6A 4X4SA 2FJWA 1JIHA 2C3UA 4YB5A 1Y4ZB 2PT0A 3KJNB 5KT6A 3R6GB 3VGVA 4RW4A 2V6AA 3C14A 4H4OA 2QMXA 1RA6A 1TK0A 2XY6A 2O67A 3QAEA 1KN6A 4F3MA 4AFFA 2KKHA 3ZXWA 2DR5A 4HHHA 5E3QA 3DYAB 2R7TA 1ACMB 3MZIA 1VQPS 2HS4A 1X4BA 2RQKA 1ZOTA 2Z58B 3D6TB 2QA4G 2HHWA 2XSJA 3HD2A 3IR7B 3CULA 3GFZA 3UVJA 5ETMA 1S1VA 1X0FA 1T9VA 2EFOA 4RR5A 2D3O1 3AHPA 1NPPA 1ZM2A 3QPIA 1RHKB 3TUPA 5F8JA 4BDPA 1JMTA 3VAMA 2Z0GA 1WSRA 3MCSA 3C66A 1NDKA 3NL0A 1U1LA 4DS5A 4DG1A 4YUDA 3W9HA 3PXGa 3SDEA 3HT3A 1FJGF 5IQQA 2WW4A 4KAIA 1PYOB 2W2OP 2QLJB 3MMBA 4ICLB 4Y6IA 1MG7A 4P7TA 3QT8A 3HZEA 1R8BA 3MPVA 1UCNA 3KLGB 2IRYA 2F8MA 1SV5B 3R7SB 5D8HB 4RO0A 1CJUA 3BQ2A 2ZKUA 1QSLA 4DF4A 3L95X 2K1RA 3M2VA 1M5OC 1VLOA 3VAIA 1ROFA 1F2GA 1JJCB 2XI3A 1HPZB 1S1UA 5J1EB 2QLWA 4FVMA 4KO0A 1H2VZ 4KR0B 3RBXA 1TVRA 1FRKA 3IGNA 1N33F 2P8IA 2WHOA 2MTLA 4WFYA 3NBPA 4WPAA 5ETTA 4A8SA 4B9VA 3VF0B 4X65F 1NK7A 2RD5C 5DDPC 2B6AB 4YFUA 4CTAB 3UR0A 1TKZB 1R89A 3I5BA 4HTIA 4CH7A 3GB0A 3S6EA 5K20B 3OV7A 2IM0A 2YNIA 4CT9A 5L8RC 1XR5A 4LF9J 1YLXA 3HVRA 4BC9A 1FXDA 4KGZB 1X9SA 1HD0A 2AJQA 2R2RA 4TNOA 4YR3A 2JRSA 2AYBA 2VFVA 4PEOA 4ZJQA 2GMLA 3JYTA 4HH1A 3PX0A 3AOAA 2LKZA 2H54B 2BJ9A 1KWMA 1RTDA 5BYRA 4FYXB 3TAMB 1RABB 4WP3A 1H6KX 4DUTA 1UA0A 4ZIWA 1V3SA 2XLJA 1EZZB 4D3GA 5BR8J 3R7NB 2D69A 5RUBA 4WKYA 3GJSB 1D1UA 2ZBRA 3BH7B 4YHHJ 2D41A 4K4UA 2IAJA 5DQGA 4U8VA 1Q8LA 4ECYA 1GMVA 4JI1F 4NA3A 2UXCF 3M32B 2Y1LB 1AROP 4LJMA 5KFCA 3DRSB 3MM6B 1N5SA 1VQ4S 3K0JA 1H74A 1UZDA 4UZBA 4ECZA 1FHTA 3NOGA 2MZQA 1RT2B 2E9ZA 5D4PA 2V2VA 2PFDA 3I0RA 2IYIA 4WXOA 3PYEA 3BPDA 3A4TA 2A18A 3MI7X 5H9FK 3QT5A 1HNVB 2DGUA 3KLVA 4DUZJ 2C2NA 2V5HG 2XM3A 3GSDA 2CZ9A 3FJ2A 1CQMA 3EMTA 2AX0A 3Q22A 3JTPA 2RKIB 4R5PA 3P49B 2MHNA 3Q8RB 2HZAA 3IA0A 2E66A 3OTDA 1ZA2B 3HSGA 2DKOB 2ASJA 3ZO7A 4CO5A 4GVLA 1R6YA 2DIUA 2GZOA 2F4FA 2VQFJ 3R5DA 1PYSB 2EG1A 2FJDB 3BR8A 1O51A 3CJ8A 5AXKA 4W90B 3F73A 2BA9A 1DTQB 3NAIA 4BS2A 4ZCIA 3D3CJ 1UZHA 4QW9A 4TQSA 2DGXA 1TAQA 2XMUA 3FCVA 1KFSA 1WI6A 3MM7A 1A7GE 4GO5X 4EI2A 2G13A 4KBIA 2CPHA 2BJ1A 4X4NA 4ECTA 4QWCA 1VQLS 4PCQA 3S7RA 4C7QA 3O6QA 3QIPA 4B3SJ 5JVHQ 1C1CB 2M70A 3W5YA 3OXFA 2AYMA 4QW8A 4LF8J 1NJYA 2E1CA 4OHYA 1UWBA 1GT8A 1T02A 1KTQA 3I82A 4XIUA 2W2MP 2J9CA 3ISNC 2GGPB 1WF2A 2KYXA 3ILIA 4FKXA 2MHEA 3NGRA 4DSFA 3DGPA 4IG3B 2QG9B 5ADZA 5AE1A 1S76D 2DEIA 3RRKA 3ISND 2FLNA 3QRQA 3SCKE 3M8YA 3H59A 2HMIA 3GIKA 2HHTA 1WI8A 4OHWA 5J2QB 1U49A 3TJAA 4LVNP 1P6TA 1N5YB 3PNIA 2JC0A 2K7JA 3TI0A 3B78A 2UZAA 3T6BA 4O3RA 3CWJA 1WTFA 1O5JA 1RAJA 4XPEA 3HT0A 1TR0A 4DMZA 2OPSB 1UPMB 1NSAA 5H1SV 2HGLA 1OY8A 3JAMY 1RAAB 2ROPA 5GMEA 2QIFA 1GX6A 2BMBA 4M5DA 4WU2A 2RDIA 3S8SA 3P8BB 5IT4A 1ZYQA 1U7LA 4PUOA 2BANA 4JBCA 1WC4A 4PG8A 3SI8A 4U7UK 2UUWA 1W2IA 4OV6A 3G6YA 5DQIA 2HZCA 4QQBA 3HI9A 2E29A 1P1TA 3GIRA 3KLEA 4P73A 4CLLA 5IFMA 1PILA 2J0WA 4KV8A 3CCJS 4R8UA 3NLCA 3M30A 1S6PA 3FCWA 3D5MA 4EBEA 5C7PA 2B9WA 2BE2A 4NXNF 8ATCB 4DSLA 2ATLA 2OUGA 4JI7F 2A6OA 2E1AA 4F36A 2FLOA 5HI7A 1Q1KA 3QGIA 4TY8A 4MYUA 1AXQA 4CLUA 1VRQC 3MCNA 1XNRJ 1FWKA 5GADI 2GO8A 3V6HA 1WJ9A 4I1TA 3Q0AA 4KHPJ 3CJQA 3ZZPA 5B0EA 2PD1A 1UJ6A 2ZH8A 5DETA 3R27A 3D4JA 3J80Y 1KS2A 4K50A 2CQBA 4RW7B 1HBNA 1MROA 3CCQS 2RILA 3PW5A 1RCXB 3GWCA 1EJ7L 1FKOA 3OFEA 5HAOA 4LRAA 2D3OR 4YR2A 2ERRA 2NXUA 3TA2A 5FDLB 1SKRA 5FIIA 4WU3A 3UDCA 1Y5LB 4EO8A 4M5HA 2BUNA 2J9DE 2KG0A 2RT3A 2VKRA 1IWAA 1RHRB 2YWFA 1T95A 5B08A 3UD4P 3L7OA 4JI4J 4N76A 3NS6A 4QIFA 2X1FA 3G82A 4NX9A 2VICA 2FY8A 3TJ9A 1H98A 3HHNB 4HH0A 4ANEA 1D9DA 3V5RA 5C25A 5KG4A 3M8WA 4BWMA 4DV1J 4E0DA 1J27A 2GAHC 2X3GA 4PQUA 1S9GA 2ZUAA 1SQGA 3EDQB 2MYFA 4M94A 1MNEA 1DAXA 2YNFB 4NWBA 4RW6B 3OL8A 3HO1A 3HX9A 4OX9F 2L08A 2DXFA 1YRTA 5HLFA 2E1PA 1OO0B 1NRKA 4TU9A 1RACB 4I56A 2KRRA 3L09A 2AJ1A 2CJYB 4IOCQ 2AGOA 1LOUA 3T1HF 5ETQA 2L9NA 3MECB 3Q83A 1UVMA 1LXJA 3VWSA 2HFUA 3A3NB 3O8WA 1OQ6A 2Y0BB 4NLGA 2H5JB 3GJRB 5CD4A 2B0GA 3EZOA 4U8YA 2JVOA 3IWNC 3N9UC 3X1LB 2FD2A 2WVFA 4HI1A 1ZTTA 1RHMB 1ELOA 4Q45A 2BR0A 2GQQA 2ZWPA 1F5CA 2W4PA 1YSJA 3QAUA 3TQEA 2GVZB 4HACB 4ILRA 4ZVPB 4U96A 1HNWJ 4DR7J 1RP5A 4OI1A 4C0OC 3O2IA 2AMCB 2I8EA 1NPRA 2YX4A 3CDWA 4CM0A 2Z30B 4C2MA 5KT7A 1PKUA 2OTLS 6AT1B 3KG0A 4LSNB 1DY3A 5LJ5Y 3IP0A 2N82B 2DT9A 2HG4A 3HVTA 4V19X 2UUAJ 3BGLA 1X5OA 1VISA 1UAWA 3FZ2A 4UOCA 3H4BA 1RKJA 5LMUJ 4F0KA 1IQZA 4FVCA 1KP6A 2GCFA 1XR7A 1W2BR 1NHVA 2BX6A 1HQUB 1N0UA 2WBRA 2ROEA 4DR1J 1RTZA 5HQLA 4NCAA 2MLZA 1OWXA 4NLTA 4OX6A 2DHAA 3OXLA 2B4UA 1OJ4A 1WELA 2ZH6A 4Q0BB 1UMJA 3W60A 3CJRA 2UXBF 3LP1A 1JLEB 1F3VA 2FVQA 2YKQA 2HAFA 2ZNYA 3BV8A 2C2ZB 3JSYA 3S1TA 1AUDA 4WE1B 3E51A 2ZOMA 3CPWR 4ED2A 4GKKF 5EN1A 4F50A 1RT6B 5B7WA 4J9NA 1U8SA 3AD9C 5J2MA 1TAUA 1VJWA 1HARA 4DV2J 2DITA 3CCLS 4P10A 3ENWA 3MGJA 1JX4A 3H4DA 5FD1A 3DOLA 4LFCJ 4K4WA 3R2DJ 2EBEA 3KK1B 2HK3A 4DX8H 3Q2SC 4DR6F 2DNRA 2ZM6F 4HTJA 4ICLA 4DV3F 4WK3A 4DR4J 3MM8A 1CJTA 4K4SA 3KLGA 2VOOA 2XMTA 2MQOA 2BJ3A 1TKXA 2XLIA 1GEHA 1U48A 1V5VA 4U7UD 3SCIE 1T8EA 5J1NA 1HWKA 5F9LA 1F9HA 2FZKB 2RQMA 3NY0A 3SV3A 1R3NA 1HPZA 4ECRA 3OLBA 5J1EA 2AU0A 4MTPA 1EARA 4LVOP 5E3AA 4FZVA 1UL3A 2RE1A 2ZFHA 3ZTOA 4FYYB 3A1YG 5SUHA 1WOSA 4MMOA 2GMJA 3T1YJ 2QX0A 1YJUA 1HNZJ 1XC9A 3A13A 4NLOA 2BJEA 1HNIB 4KB7A 2IVFB 1FK9B 3MR7A 2MZSA 3WHIA 1TKZA 2KI2A 4B9MA 4WYWA 1WHXA 2E9RX 2RIJA 3TUZC 2IM2A 1YWXA 4RL1A 5T7LA 3THTA 2NXEA 2WB4A 1N36J 3W65A 2G1HA 3JAMU 1DLOB 2ZJQQ 2OEJA 1M1GA 4CP5A 1RDRA 1FCAA 2FGCA 3I4PA 4Q7AA 1GXTA 3CCTA 2W9CB 2FGOA 3H5UA 2QN6B 4OZ5A 4N7TA 2QSFA 3HVAA 3NAHA 3QRRA 1PBUA 3PKMA 4L3NA 3EE3A 2VUGA 1ZM4A 2GMHA 2FHMA 2YKAA 3PR4A 1HHSA 4NMXA 4L76A 4PXDA 1SH2A 4TYAA 5AE2A 4DJBA 4LF5F 3OVBA 3M32A 1RU2A 1HI1A 3ZNUA 2C2DA 2HHHF 4ZP9A 1TL4A 3MM6A 4ES3A 2CFXA 3RTVA 3WQPA 3PHTA 4DZDA 1F9FA 1NDLA 1U2FA 5DS7A 1JJ2R 1QTMA 2FY1A 2Y8YA 2DNZA 3GIIA 2B9XA 2XO7A 1HNVA 5F0WA 4DS4A 4C8ZA 3H40A 2XB2D 4MK7A 1HD1A 1KRPA 1FA0A 2EFVA 3BYRA 1IKYA 2XLKA 2WAQD 1BQMB 1RYSA 2QMWA 4GRSA 3DRPA 3I55S 5A76A 2A2DA 1N34F 4M5LA 3JS9A 3LAKA 2OPRB 1VC0A 3J80U 1JLGA 1FT8A 3U1NA 4I2QB 1HYSB 1Q7LB 4LRFA 4WFNQ 5D0EA 4ZJLA 3KUHA 2J7WA 4LR8A 4B3RJ 4USHA 3R9LA 5KFXA 4FYWB 1WHYA 2HZVA 4OI6A 4OHXA 4NI2A 4LR7A 2HVEA 3D28A 3T5JA 4R25A 1D3WA 2H4WB 1ITPA 1JLBB 3TYTA 1S9FA 2J6UA 2Z2MA 4KSEB 2W7PA 1Q16B 2HKEA 2ACYA 1U25A 4OYOA 1XMOJ 3ETMA 1NHKL 2XHWA 3EVWA 5D78A 4NA2A 2VC1A 1QJHA 5C42B 4NLWA 1HR0J 1REGX 2MKSA 5EWFA 4M5NA 3RBDA 1Q4RA 2E1RA 1C0TA 1NNDA 2YXLA 1ZH5A 4RUCA 3CJ3A 2OIHA 2WBMA 4G65A 2ALZA 5KFQA 1S6QB 4DPUA 2HYIB 3OTOF 2GGPA 4AUKA 4NOHA 3IR6B 1UFWA 2VZ9A 4GVBA 4B3MJ 4J37A 1S72S 3MD3A 2HLTA 2DIVA 2ATCB 4P52A 2BXJA 2QV6A 4NLUA 4N77A 3LTOA 3MTKA 2ZZNA 2FYXA 2IA6A 3UDVA 1LEOA 5J2QA 5FJ4A 3BH6B 4ED8A 4QWBA 3PRVA 1N5YA 3B82A 3KOAA 4MT1A 4B9TA 2ABYA 4N5SA 4B3OB 2FHOB 1Y00A 1OQ3A 4F8RA 5A8RB 1NO8A 4U9RA 1PJ7A 1Y11A 3PR5B 2OPSA 2DGOA 1UVIA 2IVMA 3NGKA 3P45B 3SZ2A 3HCXA 2M8DB 1FEHA 2E9TA 2KFNA 3MD1A 3K89A 3W2VB 3HHDA 3M6VA 4QIGA 1LW0B 1S1WA 4LRCA 1TL1A 4URSA 1SVDA 1QM9A 4DXLA 3ITHA 2EC0A 1ZTWA 4GMKA 4ZVFA 3W5ZA 3MAAB 1SKSA 2DNOA 2XMAA 1T05A 5KG0A 3RR7A 4USIA 1UWAA 1RTJB 2AYGA 1Y5IB 1HWJA 5ETSA 3OFGA 1TUVA 4YB6A 2OO4A 2LQJA 2E5IA 1GH8A 5BJRA 3PV8A 3FEXB 1MSWD 4OHVA 2RF2B 2JNJA 4OHZA 1DARA 2D9OA 1V9OA 4DF8A 2QC3A 5KAKA 4KH1B 4KE5A 4Q2LA 1FXLA 3SSSA 3TUIC 3KG4A 4J90A 1FESA 3J7A1 3BO4A 4HI2A 3QLHA 4L74A 2IM3A 4L72B 4M5GA 4YB7A 2FC9A 2B7BB 4D3HA 2YNGA 4C48A 2LA6A 4DV7J 3UFCX 1JKHA 1N6QA 4XO0A 2V8DA 2PI4A 3KHHA 2XMJA 4IOBA 3M4XA 2H1YA 2F1FA 2V34A 4K4YA 1RWXB 2HQIA 1WORA 2VQFF 2ZH1A 1RE1B 4OYMA 3VAGA 2OMLA 1YJVA 3M8PB 2ZD1A 4PRFA 2BRLA 1R8HA 2FJEB 4RNNA 2CQ4A 4EYHB 2LQ9A 4LR9A 4W4MA 3SBMA 4RW7A 1VQ8S 2BACA 2JLGA 1EP4B 3I0SB 4O0NA 1K1QA 1UVLA 2YQ0A 1IKVA 1UFKA 5M2UA 1IKXB 1PC5A 1B0VA 2NXNA 2VB6A 2WSFC 1R8CA 4ZPAA 2MDAA 2HVZA 2RQCA 4EBCA 1U0SA 3AXMA 1FXRA 5THWA 2GJ2A 3PO4A 2ZEJA 2CJAA 5DG9A 2VDHA 3N79A 4PAAA 3D6MB 4ZVUB 3MEGA 2HNYA 2XY7A 4DR3F 2UUBJ 1SL0A 1SC4B 3S01A 1K1SA 4OI2A 1SQEA 2XNQA 2FPHX 2C3OA 1RTHB 4EZ6A 2CJXB 4DN0A 3G8TA 3LPYA 2XC9A 2XULA 1FRMA 2C22A 3HKZD 1EKRA 3I5AA 1U2CA 4I2PB 1RT7B 2L41A 3BS9A 2CKWA 3MDFA 2YNFA 1ZBTA 3QFHA 1PYTA 4DV5F 1WF0A 1KOHA 2ZOFA 3RW7A 4K2XA 4UQGA 1S77D 2SXLA 4MFBB 2RVJA 4WZQA 3KFWX 3QBCA 2UVWA 4NLRA 4GKJJ 4PWDA 5KFAA 5KG6A 4EU0A 4ED0A 5SZTA 1KR4A 1R0AA 2M0GB 1YI2S 1HWLA 4DL5A 5J2NB 2CJKA 3FRYA 3K57A 2I2YA 3M8QB 4MKVA 3C15B 4I69A 5LSLA 2YWGA 4LF4F 3EWGA 1S0NA 2IVYA 3NP5A 4C8OA 2CPEA 4YS2A 2IA0A 1L3VA 2BJ8A 2CAJA 3V81B 3FDSA 1KC8T 2HNDB 3C6TA 3NNHA 3MCOA 2RNEA 1GXLA 1PAUB 4OYIA 5I3UB 2W9AA 4H54A 2H4YB 4IKAA 2HURA 2N4CA 2CPXA 4X4QA 2J7KA 2P9GA 3W9JA 3D6FB 1Q78A 4MIBA 1NSKL 4HACA 5GAGU 2IJFA 3LPEA 4X4UA 3IFEA 4RW4B 1WUUA 2GC8A 3C14B 3FKBA 2IC3A 2WVDA 4F4XA 2HPUA 3BB5A 4H4OB 4AYBD 1Q5YA 4ELTA 1S4FA 1QUPA 1U24A 2ASYA 4LSNA 2UXDF 4O0IA 3POTB 1JNRB 4CO4A 4RW8B 2GV1A 2LVWA 3D68A 2MJNA 4A8FA 1WG5A 2I38A 1UVKA 1PCAA 1HBMA 3UVJB 3B8HA 1LFPA 4DLEA 5E2QA 3CXCR 4FF2A 2JH3A 1I51B 1HQUA 4YQWA 4O3PA 5KFMA 2KZZA 4KHPF 3AY0A 2CJ9A 3M9MB 1JLFA 4NPOA 2PMHA 3OBIA 1DURA 2DXEA 2KO1A 2GVDA 3CD7A 3M6WA 2HHPA 3D3BJ 1JLEA 4XTTA 3AAWB 1H7XA 2X7IA 1J5OB 1JB0C 2NR0A 2CNNB 1M5PC 2H3EB 1RT6A 4HT5A 3MMBB 1TL5A 4DV0J 4BCAA 1RGVA 3CW2C 4CH1A 2BW7A 3DHXA 5L9XA 1K0TA 1AB8A 5LM7E 4P71A 4L6V3 1KNZA 3CJ4A 2H5IB 4HHJA 3UPFA 1RBAA 3E2EA 2HEKA 4NZ0A 1UKUA 2XMVA 3B4MA 1CJUB 2WB1D 3JB9k 4JI0F 1VIXA 4RKUC 3KK1A 4A48A 2VA3A 2YY3A 4JI4F 2HBRB 3B4DA 1M0SA 3M8SA 2IMOA 3W8PA 2GIFA 4F4WA 2OELA 2J76E 1RISA 4QPXA 2ADBA 2CQIA 2W8LA 5EDWA 1TQLA 3UDLA 2CPDA 3NBPB 5BYSA 4KHMA 3FSXA 3IWLA 3WDOA 1X5SA 1KSPA 1B99A 4DFPA 4JI8F 2XQCA 3G6XA 2HFNA 2POKA 3OTCA 3N4WA 2I5JA 3GV5B 3H7HB 5CCMA 2E7VA 3QJJA 1F0XA 2HW3A 1FFWB 4IRCA 2DXDA 2XMKA 4O23A 4RLEA 1TL7A 2IIHA 1SL2A 4KTQA 5A0YB 1JLAB 2N7YA 3TNVA 4U7CA 2V4RA 2KZMA 2XO6A 1DQAA 3KHGA 4W92B 2CQGA 2YBVA 4PXEA 5HANA 3MAHA 5D0GA 3JYTB 2BDPA 1I94J 2A2CA 1RTDB 2CNLB 2VV5A 5AXNA 1LQ9A 4F7VA 2DO4A 1NUEA 3H42A 4M5JA 4TVAB 4DCJB 1KLMB 2YQ1A 4F02A 3TO8A 2C3MA 2XY5A 2A3JA 1HKAA 3PM9A 3BKUA 5HL7Q 2W9CA 1S7HA 5AXLA 3CDBA 1N8RT 4WP9A 3L9ZA 3I87A 2GX8A 1IXKA 2MKYA 3K17A 1MWZA 1N52B 5ETOA 3KG1A 3KHLA 2KN4A 3E8OA 2Y1JA 1IM6A 5IZHA 2IM1A 4DQRA 2MEWA 3UN5A 2DGWA 5KFGA 2HHQA 3TVKA 5HMZA 5JUMA 2HBYB 3BGRB 1CLFA 4KYZA 3I0RB 2UUAF 2MQNA 3J81Y 3QGGA 2QE5A 3WX8A 2AKWB 3QZ7A 1O8BA 1VQ5S 5HN0A 1VQSA 2CQ3A 3QGHA 2WVEA 1XQIA 5KG3A 4TLRA 4AQYJ 4CIOA 4X66F 2WW8A 3C19A 4EMDA 3DLGB 3K8VA 3CE8A 2BJ7A 2MLYA 2ZBQA 3QQCD 4ZP8A 4IRKA 4Q44A 4DPTA 2AZ3A 1BXNA 4JI3J 5B0DA 3R5JB 4OFZA 4FBUA 2BKPA 2LMIA 3NCRA 4ECUA 2KH9A 1IM4A 2R7RA 1FO1A 2OPRA 3SCJE 3EICA 3BREA 2EEYA 5C24A 2JC1A 1MWQA 2HHSA 4A8YA 3UW1A 1VBXA 1RAIB 4KHRA 1QY7A 4X2BA 4DU8A 4HYKA 3QT6A 2YVSA 3ISZA 2ZE2A 2R7VA 4XPCA 2FVPA 4C8LA 1GFWB 1NLKL 2MKKA 2DISA 1EQ0A 3EPGA 3PIPQ 1YTYA 4U6PA 4NZ7A 2A6MA 1RA7A 2UVRA 1SJFA 1BWEA 1MWYA 2WRMA 3BSAA 4X64F 2F40A 3GCWP 4LFBJ 3TVZA 1CJKB 4NLDA 2RH3A 1ZS6A 5C42A 3UNGC 1IBKJ 4RBVA 1ZPWX 4O3NA 4G1QA 3UE2A 5ETRA 4XK8C 3IBWA 1IBLJ 2Y1RI 3N5FA 1C4CA 5G4DA 2K06A 1PIEA 5U47A 4BHQA 3DGPB 1S6QA 1RWVB 2J8SA 1XMQJ 1ZPVA 2MJUA 5KG1A 2KHDA 4ZPDA 2HMIB 2PC6A 3K5MA 2DHSA 2I9SA 2CNOB 2R3VA 1R43A 1YX2A 3OHBA 1XBWA 2PDAA 3DOKB 1S6UA 2G0IA 2EFGA 1Y5NB 1YK9A 5L46A 1VQ7S 4EWTA 5JVGQ 1RT5B 4CH0S 2ZUGA 4ZDNA 4PR6A 2E1MC 4JI5J 3M1VB 3IO1A 4DFMA 4M1KA 4M5DB 1VK3A 3ULHA 2WOMA 5A2QY 3UR3C 3PTWA 3J7YU 5A8RA 2F8HA 3ZTSA 1GXUA 4B9UA 4ETXA 4V19J 2LU1A 1Q0NA 3HP6A 4C8YA 4PUOB 1D8YA 4ECSA 2QLBB 5F3TA 1S5ZA 4LF6J 3U7JA 4Y34A 4QWEA 3W2VA 5KFNA 1N32F 1G4CA 3KHRA 3NCPA 1LW0A 2F5GA 4DCOB
chains in the Genus database with same CATH topology
4OYIA 1AZSB 4WP3A 3UVJA 1AZSA 4USUA 4OYAA 3C15A 4CLYA 4OYMA 3MAAB 1YBUA 1WC4A 3MAAA 2GVDA 4WP9A 4NI2B 1WC0A 4CLFA 1U0HB 1CULB 4CLWA 4USTA 2GVZB 5IV4A 1TL7A 1FX4A 4WPAA 4CLLA 4OYZA 5D0EA 2QV6A 1CJVB 2BW7A 1TL7B 4CM0A 1CJVA 3C14B 1AB8A 1YK9A 4NI2A 1YBTA 4CM2A 1CJTB 1Y10A 1U0HA 1WC6A 4P2XA 1CULA 3MR7A 2GVZA 4USVA 4P2MA 1WC3A 1CJUB 3ET6B 4CLTA 5D15A 3R5GA 5D0GA 4CLZA 5D0RA 4CLKA 4P2FA 1CS4B 3C14A 1Y11A 4OYWA 1CS4A 4OYOA 4OZ2A 4OZ3A 5IV3A 4OYPA 1CJTA 4WP8A 4OYXA 3UVJB 1CJKB 4OYBA 3C15B 1CJKA 2W01A 4CLPA 3C16B 2GVDB 5D0HA 4USWA 3C16A 1CJUA 4CLSA 3ET6A 4CLUA 1WC1A 2WZ1A 1WC5A 3G82B 3G82A 1FX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYI A;  1AZS B;  4WP3 A;  3UVJ A;  1AZS A;  4USU A;  4OYA A;  3C15 A;  4CLY A;  4OYM A;  3MAA B;  1YBU A;  1WC4 A;  3MAA A;  2GVD A;  4WP9 A;  4NI2 B;  1WC0 A;  4CLF A;  1U0H B;  1CUL B;  4CLW A;  4UST A;  2GVZ B;  5IV4 A;  1TL7 A;  1FX4 A;  4WPA A;  4CLL A;  4OYZ A;  5D0E A;  2QV6 A;  1CJV B;  2BW7 A;  1TL7 B;  4CM0 A;  1CJV A;  3C14 B;  1AB8 A;  1YK9 A;  4NI2 A;  1YBT A;  4CM2 A;  1CJT B;  1Y10 A;  1U0H A;  1WC6 A;  4P2X A;  1CUL A;  3MR7 A;  2GVZ A;  4USV A;  4P2M A;  1WC3 A;  1CJU B;  3ET6 B;  4CLT A;  5D15 A;  3R5G A;  5D0G A;  4CLZ A;  5D0R A;  4CLK A;  4P2F A;  1CS4 B;  3C14 A;  1Y11 A;  4OYW A;  1CS4 A;  4OYO A;  4OZ2 A;  4OZ3 A;  5IV3 A;  4OYP A;  1CJT A;  4WP8 A;  4OYX A;  3UVJ B;  1CJK B;  4OYB A;  3C15 B;  1CJK A;  2W01 A;  4CLP A;  3C16 B;  2GVD B;  5D0H A;  4USW A;  3C16 A;  1CJU A;  4CLS A;  3ET6 A;  4CLU A;  1WC1 A;  2WZ1 A;  1WC5 A;  3G82 B;  3G82 A;  1FX2 A; 
#chains in the Genus database with same CATH topology
 4K0K F;  1KQG B;  3KLE B;  3VVT A;  1D9A A;  3L7U A;  4USU A;  3BEG B;  4FKY A;  3UDE A;  1TK5 A;  3MAA A;  1RKI A;  1RT1 B;  5E3C A;  2UP1 A;  3HHL C;  1SQF A;  1BLU A;  3TX0 A;  1S6P B;  4JV5 F;  2RS8 A;  4JYA J;  2XHC A;  3GIM A;  2VBY A;  1VHF A;  2IRU A;  1TTH B;  2MGZ A;  4IH5 A;  4KKO A;  2BE2 B;  5ITH A;  2XI2 A;  4DR2 J;  1YJN S;  5C2G A;  3T5L A;  5LXR A;  3F41 A;  3FSI A;  4MIW A;  4Y3C A;  3HHL D;  3BO2 A;  2XWX A;  4C3K A;  4PG5 A;  5GAE I;  3T5K A;  5EWE A;  3HMJ G;  5D15 A;  4O44 B;  3RB0 A;  1K0V A;  1V6H A;  4F04 B;  2C3Y A;  1VCT A;  2K3K A;  2N3O A;  4UT4 A;  3IM9 A;  4PZV A;  2DH7 A;  4RZR A;  3C6U B;  4NYZ A;  1WSV A;  5AXM A;  3NOC A;  3BZQ A;  4YDX A;  2R7O A;  3BSO A;  3IRX A;  3QRP A;  2Y0S D;  2F4V F;  3FFI A;  2B8Q A;  4P7V A;  5CCL A;  1RAG B;  3D1O A;  2VBX A;  1FTR A;  8AT1 B;  3N0V A;  1RSC A;  2ROG A;  3G71 S;  4C3M A;  2JFK A;  3QMQ A;  3HLU A;  4ZCM A;  2G4B A;  3HFK A;  3BSN A;  5GAG I;  3M9N B;  4RNO A;  3K59 A;  5CYQ B;  4UY8 T;  2VFT A;  1LWF A;  1HIY A;  2O1P A;  2RJZ A;  4LSL A;  3W9I A;  3VZI A;  1FI4 A;  1X0P A;  3V2U C;  4DV6 F;  2JLE A;  5HBM B;  4CZC A;  3I0S A;  1F6T A;  2D7S A;  3NGT A;  2KJV A;  4P2X A;  3CMA S;  2DEJ A;  4N47 A;  2DRA A;  1IKX A;  2CQH A;  4IQX A;  2QL5 B;  2G1D A;  1N48 A;  3GIL A;  4ID8 A;  2MLX A;  2Z2Z A;  1CEZ A;  5AJ3 J;  5L1J A;  1NZ8 A;  1L3S A;  1HMV B;  3OUY B;  2M2B A;  4Z2X A;  1NH7 A;  4DBQ A;  1IBC B;  2PN6 A;  3AH6 A;  2IBK A;  4LF7 F;  2UV8 G;  1QTN B;  4XDD A;  4RNM A;  2YPY A;  3GMG A;  4PQU B;  1S9G B;  2P2C B;  5E7O B;  2LQ8 A;  3H0P A;  2F65 A;  3BBC A;  1HNX J;  4K2J A;  3TVY A;  3LP0 B;  3LAN A;  1XTZ A;  2M5Y A;  5KFE A;  1RTH A;  2F7V A;  4ES1 A;  3PYD A;  1CG2 A;  5MAO A;  5IT9 Y;  5DZ7 A;  5E3R A;  5HLF B;  2R7U A;  6FDR A;  1CC8 A;  2BKN A;  4WTY A;  1KDN A;  3MMA A;  4B9L A;  4OYZ A;  3CJ2 A;  3BN4 A;  3G6V A;  4PG6 A;  2ZBI A;  2RU3 A;  1HI8 A;  4EYI B;  1P9Q C;  1WKJ A;  1F60 B;  1VS3 A;  3RR8 A;  4MFB A;  3UCG A;  3MED B;  3R5G A;  3EXY A;  1AUS L;  2FIU A;  3AOC A;  4QR2 A;  2GHP A;  4ANC A;  1TK8 A;  4FP9 A;  1M5K C;  3ZZO A;  4BLG A;  4LRE A;  5F8N A;  2X1B A;  1NEE A;  3FNN A;  4FF3 A;  4UY8 5;  1NME B;  5J2N A;  2GS8 A;  1SH3 A;  2NLW A;  1WAC A;  2VC0 A;  3V81 A;  2HND A;  4C8K A;  4IFV B;  2HRU A;  5I3U A;  1FJG J;  3IAS 9;  2FJV A;  1X8D A;  1R8A A;  2CWX A;  5KT4 A;  1WC0 A;  3LQV A;  3QT7 A;  3LP2 B;  3J81 U;  1IKW B;  2A1B A;  3H2V E;  3OR2 A;  3TEH B;  2ILY A;  1AW0 A;  4YME A;  3HVT B;  2HHX A;  5G0R B;  3LF0 A;  3F0N A;  2ADC A;  3FMB A;  5K8P A;  4JOU A;  3N6N A;  3X3U A;  4P2S A;  3BKF A;  1TEL A;  5ETN A;  1SIW B;  3VGT A;  2RHQ B;  4RWW A;  3POT A;  2BEF A;  4RW8 A;  3TZW A;  4WFA Q;  1U6B A;  2Q6B A;  5IV3 A;  4DL4 A;  1LW2 A;  2YWK A;  4OYB A;  2LDI A;  1TV6 B;  3QJP A;  3GYG A;  1NHU A;  3LP1 B;  4UF4 A;  3H90 A;  4QPT A;  2B43 A;  1FKP A;  3C2P A;  2HFS A;  4LBH A;  4X65 J;  5DG7 A;  3H98 A;  4ECW A;  4J7C A;  3E3X A;  1V5I B;  3R1H A;  1TMJ A;  5J2M B;  3KDN A;  1HQ2 A;  3C8Y A;  3JTO A;  5KFB A;  2GQC A;  2MZR A;  2WTF A;  2CG4 A;  1GX5 A;  2H9Z A;  3K58 A;  3GV7 B;  3U1M A;  3VCD A;  1J5O A;  3DOL B;  4FNH A;  1BD6 A;  2R7X A;  4B3T F;  3TP2 A;  2GNK A;  4G6V B;  1U1R A;  2ZJR Q;  1S1X B;  2HRT A;  3MM8 B;  1CJT B;  1U0H A;  2JSX A;  2R7Q A;  3PDN A;  2BZ2 A;  3A3P B;  1TKX B;  1X4D A;  3MR3 A;  2AD9 A;  1S57 A;  2JEJ A;  4GC6 A;  5I42 A;  4I7F A;  3LAM A;  2RHS B;  2UUB F;  2E7X A;  3CTR A;  3VAF A;  4JI1 J;  2UXC J;  4CLP A;  1HBU B;  1OIA A;  2AW0 A;  1KBR A;  2YWW A;  1LFW A;  1IWG A;  2KT2 A;  5CD4 H;  3BKT A;  3CJK A;  3VZH A;  3P6Y C;  3M8Z A;  1G3O A;  2Y9H A;  2A10 A;  1YBU A;  2QLX A;  1NKC A;  3AJ2 A;  3A8K A;  5KFY A;  4LFA F;  4N41 A;  1FE0 A;  5LJ3 Y;  1VDH A;  2OSQ A;  2QLF B;  3NNA A;  4NRU A;  1ICE B;  4WCE Q;  1C0U B;  4C9D A;  5T7L B;  1K44 A;  2VFU A;  5A0Y A;  1JLA A;  2AF6 A;  4NRT A;  2OPP A;  3RJM B;  2WVC A;  2R8I A;  2G9O A;  1OYD A;  1AT1 B;  3RAQ A;  2CQC A;  4OZ0 A;  2D9P A;  1E6Y B;  2CNK B;  5A2Q U;  2FTR A;  4QU6 A;  4HR2 A;  4NLX A;  4DX5 A;  3TAN A;  2O3D A;  3CJT A;  3PW2 A;  1YIJ S;  3HVW A;  3DC2 A;  1E6V A;  1PJ6 A;  4OYX A;  1LKZ A;  2OEK A;  1OS5 A;  1V3Z A;  4X84 A;  4USJ C;  2KM8 C;  4MK9 A;  2ASL A;  2FVC A;  1RWO B;  1KLM A;  2CPI A;  3RRG A;  1IBM F;  4E98 A;  2RRN A;  1C4A A;  4PYD A;  2W24 A;  3I32 A;  2HBZ B;  1NJW A;  3TZX A;  1U47 A;  3NMR A;  3QID A;  2UVV A;  2B3T B;  2BBE A;  4CI0 B;  4YY3 F;  4X4O A;  3BBF A;  2J8A A;  5IV4 A;  5D4L A;  3AFG A;  2V9W A;  4KH0 B;  2CG8 A;  3DOM A;  2PA8 D;  1YJT A;  4OZN A;  1FNM A;  3TEG A;  3BGR A;  4HDH A;  1XER A;  2JOQ A;  2LCW A;  2OD6 A;  4CM2 A;  4UUW A;  2V2Z A;  3KWM A;  4RJV A;  2V4J B;  1B7F A;  3NGU A;  3DLH A;  3ZTP A;  4WBF A;  4Q8E A;  2HGM A;  5GAH U;  2YH1 A;  2Q43 A;  3FC9 A;  3D66 A;  3PYF A;  4MKY A;  1IKY B;  4EGL A;  3Q8S B;  3N01 A;  3GZ7 A;  2CAD A;  1JXV A;  3I9Z A;  1U4B A;  3DRP B;  2CQD A;  1N5V A;  1WOP A;  3FGV A;  3DLG A;  4AE5 A;  2V67 A;  1T3O A;  3DI6 B;  1JLQ B;  4DUY F;  2YKM B;  4DDF A;  1JLG B;  2NSB A;  4TY9 A;  1R31 A;  1T11 A;  1NKB A;  3H8Y A;  5D4N A;  3GFX A;  1HHT P;  2W2P P;  2BM0 A;  2NUU G;  4OQJ A;  5KOW A;  1D0E A;  2PO4 A;  4DU7 A;  2HK2 A;  3DMJ B;  2CDR B;  1S9E A;  3HSD A;  4ZPV R;  1NPK A;  4NI2 B;  2CDQ A;  1J5E F;  2RDD A;  1F5A A;  3NGD A;  4WIQ A;  3DLJ A;  4RNH A;  3N28 A;  3R5C A;  2CPZ A;  3D0G E;  1SC3 B;  2DNM A;  3I6P A;  1TKD A;  2IYG A;  3EGN A;  2PE8 A;  1FRH A;  3MAQ A;  1PBA A;  1S79 A;  3CSK A;  4I6Y A;  3UQS A;  1SXL A;  3BR9 A;  2AJ0 A;  2F63 A;  2HFV A;  2KT3 A;  3CIZ A;  4DFJ A;  1REV A;  1KVK A;  2HFZ A;  4BBY A;  3BO3 A;  5IWA F;  4JP8 A;  2YKN B;  1Q81 T;  1Q53 A;  4ZVO B;  2CWK A;  1C0T B;  2FZG B;  3NWG A;  3NKY A;  5D4O A;  3VAK A;  1APS A;  3W64 A;  1KQK A;  3MFH A;  2DGV A;  1CJK A;  4NEY A;  3GQC A;  1LWX A;  2JX2 A;  2OH2 A;  3D67 A;  4DV4 F;  2BJD A;  3QWP A;  4GVB B;  4U95 A;  3M6U A;  2BAB A;  2CQ1 A;  3DLB A;  2V8G A;  1WC1 A;  3Q8Y A;  2QA2 A;  1PJ5 A;  4QYZ K;  2PEB A;  1KQF B;  4IH6 A;  4E8U A;  1CVJ A;  1K47 A;  5IT9 U;  4OJH A;  3FQK A;  2FUG 9;  2H65 B;  4WII A;  1QE1 B;  2EI5 A;  2Q3P A;  3KK2 B;  2BYC A;  2B4P A;  4XAK A;  1DZ5 A;  1U09 A;  4JI7 J;  2XWY A;  1RCO B;  1VC6 A;  3FVY A;  1FVQ A;  2KFZ A;  1RWK B;  4ZLP A;  2VG7 B;  3DOK A;  5HRO B;  2XGP A;  1I94 F;  4NLP A;  1I1G A;  3P5B P;  1T9T A;  1UEV A;  3FZB A;  1RT5 A;  5DGA A;  2XMW A;  4LF1 A;  3KXD A;  2OJ3 A;  1M1H A;  3M1V A;  1VQO S;  2QTW A;  4WFB Q;  1DBD A;  1NM2 A;  1YZ7 A;  5KFJ A;  3PRB A;  4JI6 F;  1JXL A;  1S1W B;  1TL1 B;  3EPI A;  4X62 F;  3DXB A;  2R7W A;  3ITH B;  4UOF A;  1T05 B;  1NK6 A;  3HFZ B;  2KYZ A;  1JJ4 A;  2C2K B;  3GIJ A;  1NK8 A;  2M9K A;  1YIT S;  4Y2K A;  3O44 A;  2GQ2 A;  2EKY A;  2KU7 A;  3GSI A;  5KFP A;  2FHK A;  2LEB A;  1FE4 A;  3OSP A;  4NCB A;  2C3P A;  1RT1 A;  4QR1 A;  2Z2L A;  1TUG B;  2VOD A;  1FRL A;  1FKA F;  2VFR A;  3QLH B;  1U26 A;  3SSQ A;  5E41 A;  2DGT A;  1LWE A;  3RAM A;  3TX8 A;  3QFW A;  4K4V A;  2KXH A;  2H51 B;  2W7O A;  2U2F A;  2YNG B;  1RBL A;  2XYP B;  5LSO A;  4ZVE A;  5GMK a;  3PYG A;  1BQN B;  1H2T Z;  1JKH B;  5LXY A;  1N6Q B;  2QFJ A;  3ILL A;  3RAX A;  4ELU A;  4O44 A;  4PPD A;  3K7R A;  2GW8 A;  4DSK A;  1QUV A;  2APO A;  2UU9 F;  3TA0 A;  4CYU A;  2GIQ A;  3IGV A;  4LQ3 A;  4UTG A;  4LQ9 A;  2HIQ A;  4IQM A;  3C6U A;  3A8I A;  3IR5 B;  1PG5 B;  2DJW A;  1C1B B;  2ZD1 B;  3W2W A;  4AXI A;  4OX9 J;  2QRR A;  5JXS A;  3M7V A;  4M5M A;  4MJK A;  3UD3 P;  2NXJ A;  1X7V A;  1FTC A;  4K4Z A;  2CYY A;  3MFI A;  4G3I A;  4J9O A;  2V69 A;  2N3L A;  1Y3J A;  3R5B A;  2RRB A;  1L3U A;  3PY8 A;  5CYQ A;  1IKV B;  3R97 A;  4YDD B;  2AQ4 A;  2M7S A;  4NXM F;  2J9E A;  3T1H J;  4WFX A;  3V6D B;  2VQE F;  1PC4 A;  1RT3 B;  2HGN A;  4LMZ A;  5HBM A;  5EX0 A;  2MKI A;  2D74 B;  3G8S A;  5IC4 B;  3B54 A;  3P3D A;  4HEA 9;  3ZTQ A;  5L9N A;  3OPK A;  1SCJ B;  2OP5 A;  2GJI A;  1NKE A;  1G2E A;  1S7I A;  4JV1 A;  2R8G A;  2VPX B;  3MPW A;  1DTT B;  5GVQ A;  1G1X A;  3MEG B;  2DVI A;  3PG9 A;  2HNY B;  1RLD A;  1UW9 A;  1RUS A;  2WCX A;  1HMV A;  4G1P A;  4WP8 A;  4KC5 A;  1Y7P A;  3ZZZ A;  3OUY A;  2QL9 B;  2V68 A;  3SFG A;  3GJQ B;  3IBC B;  3UWT A;  3MEE B;  3ZTR A;  1RHQ B;  1MU2 A;  2KL8 A;  5B09 A;  3IXQ A;  5T41 A;  4OYA A;  3JSR A;  1GTH A;  3LP0 A;  2W1B A;  2X3D A;  1KD1 T;  1WNE A;  2HLU A;  1U1Q A;  3SXL A;  4J9M A;  4A46 A;  1NDC A;  3TA1 A;  4TYB A;  3SEO A;  2H5E A;  1M1K T;  2MMY A;  3DN9 A;  3IBF B;  2ZOG A;  1WDT A;  3V4M A;  1N88 A;  4PWD B;  4J9P A;  1QAY A;  1R0A B;  1FDB A;  3AB4 B;  1CUL A;  2KTQ A;  3RBZ A;  3D0H E;  4C98 A;  3CCZ A;  1FD8 A;  3MED A;  2B51 A;  1N4L A;  4CWB A;  5EUH A;  2UXB J;  3CO9 A;  1GAO A;  3C6T B;  4GKK J;  1IUJ A;  4C97 A;  2FLP A;  1ZAX A;  5LMN J;  4DL2 A;  4ZIV A;  4IO9 Q;  1TFY A;  3EJM A;  2ILZ A;  2Y3Y A;  2QYC A;  1X4G A;  2W4C A;  3T6J A;  1UET A;  5KFZ A;  2CPY A;  3D1H A;  2P9E A;  1X5T A;  1GMW A;  3L4B C;  4TN2 A;  4IFV A;  2DPJ A;  1NXI A;  1Q86 T;  2IC3 B;  1SC1 B;  3KJV A;  2ZM6 J;  4DV3 J;  2BE7 D;  2LFV A;  3HHL A;  5KTQ A;  3OTE A;  3LP2 A;  2XSF A;  3T9Z A;  4J9V A;  1IKW A;  2I0X A;  3A3O B;  3PKY A;  4KGX B;  5G0R A;  1QSY A;  1VQN S;  3W8G A;  2CZV C;  3HK2 A;  3DNC A;  3G96 A;  2ZH7 A;  1HBM B;  2G0C A;  3CJS A;  3U02 A;  1HQE A;  2OEM A;  1FD2 A;  4ZCK A;  4ZA1 A;  1OSD A;  3DRR B;  4ETZ A;  5KFF A;  2J7U A;  3BBB A;  1JLF B;  2XZD B;  2VPW B;  1IJE B;  4I6A A;  1Y0H A;  2GVD B;  1TV6 A;  1I3O B;  5E33 A;  1ZZN A;  4PG4 A;  1SJQ A;  3O3L A;  3FK4 A;  2ZHB A;  3I9V 9;  4ATN A;  1FNO A;  4WYL A;  1XNQ F;  2HVH A;  1VOM A;  2HHV A;  1X4F A;  4WKR A;  2WON A;  2Y8W A;  2PEH A;  1KKH A;  4KQZ A;  1EX8 A;  4DL0 C;  1DFD A;  2DHH A;  5GAD U;  2ACM A;  4I6W A;  3K8W A;  1T9X A;  1RTI A;  5K5M A;  2HWT A;  5KT5 A;  1S1X A;  2BM1 A;  4E2F B;  2GFF A;  5GAH I;  1VQ6 S;  1X4E A;  1CSJ A;  2BOA A;  2ZZM A;  4TU7 A;  3KNG A;  4B9N A;  3NRB A;  4IR1 A;  3R6L B;  1FWL A;  2RSQ A;  5CAB A;  4CLK A;  4Z7Y A;  1RBO B;  4O3Q A;  4RW9 B;  2J0Q D;  2CJQ A;  1YQH A;  2AJ2 A;  2XNR A;  1ZAW A;  2HS0 A;  1UW4 A;  4LF5 J;  1OPI A;  4CLS A;  1HBU A;  4DR5 F;  2I5J B;  2JEG A;  4QBU A;  2HHH J;  1CC7 A;  2UUC F;  2JVR A;  2B4O A;  2VAS A;  2YWH A;  1BGX T;  1TL7 B;  4OV1 A;  4DFK A;  1BUX A;  2HHU A;  4DSJ A;  1D8Z A;  5C2C A;  2CUY A;  5K9F A;  1O0P A;  1T9W A;  2CPJ A;  3DCA A;  4WJB A;  2NRE A;  4Q5V A;  5IOL A;  3CCS S;  1LK7 A;  3ONQ A;  2NZC A;  4QIE A;  1I6J A;  2AV5 A;  7FDR A;  4YP3 A;  2K7K A;  3BYP A;  2LDY A;  5CZV A;  2LQ5 A;  1YVF A;  3O5T B;  2PMZ D;  4F26 A;  1VRT B;  4ZHR A;  3NS5 A;  1C0U A;  3MR2 A;  1TKT B;  1S4E A;  2I6W A;  1H72 C;  1E6Y A;  3EZU A;  1S1T B;  4J9S A;  1N34 J;  3I31 A;  3RBE A;  1TUW A;  4ILM A;  2DGS A;  3GG0 A;  3SIP B;  1YRX A;  3AD7 C;  3KK3 B;  4YEA A;  5KT3 A;  4ID5 B;  2ALY B;  4F2S A;  2R8K A;  1SUQ B;  4JI2 F;  1KLN A;  1RYR A;  4RUB A;  5F0U A;  3EVM A;  4CDI A;  3FMW A;  1RAO A;  3T41 A;  4MK8 A;  2K2P A;  3BQ0 A;  1IR0 A;  4PPZ A;  2V50 A;  2LEP A;  1W7W A;  4OJ3 A;  5L1K A;  2FHJ D;  4K5R A;  2X51 A;  5E0O A;  1LNQ A;  1H2U X;  5HK4 A;  2KXN B;  2DR8 A;  1JXE A;  2DNP A;  2JZ5 A;  1FFG B;  4M8L A;  2L3M A;  2MKH A;  1LXN A;  5IXU A;  4NCG A;  1VRU A;  1UFL A;  1SL1 A;  4DEZ A;  1XN9 A;  3HSZ A;  3OHA A;  1UJ5 A;  4RWX A;  2LEC A;  4ECX A;  2P6T A;  2CJB A;  2V4J A;  1W25 A;  2K3I A;  2FC8 A;  2Z8Q A;  5HP1 B;  3T5H A;  3L3C A;  3OTO J;  3ENV A;  3U1L A;  5ETL A;  1Z2Z A;  5K8O A;  1U02 A;  1N5Q A;  1ZET A;  5DDR C;  1VQ9 S;  3JQJ A;  4EUV A;  2QMU B;  2BRK A;  3VR1 A;  3HPO A;  5HQM A;  3L7P A;  3DI6 A;  4DPO A;  1JLQ A;  2YKM A;  1RWW B;  5C5J A;  4A4J A;  3RB4 A;  5C24 B;  1TFW A;  3AD8 C;  4ZP7 A;  4L3K A;  2JEI A;  1B70 B;  1L5U A;  3MXH P;  3TJ8 A;  2DR9 A;  2ZE2 B;  2XS2 A;  4MKA A;  4J9R A;  1FWP A;  3DMJ A;  5DLF A;  4OIX A;  1CPZ A;  2ZNZ A;  4AND A;  4ED1 A;  4AXJ A;  2DYA A;  2XBP A;  3BN7 A;  4AL6 A;  4F3Q A;  3CF5 Q;  2R7S A;  1NZA A;  2V2K A;  3SV4 A;  2PII A;  1GNK A;  3IN5 A;  5M2P A;  2ZC4 A;  3M05 A;  1KEK A;  1XWL A;  1RT4 B;  2OHD A;  2HNZ A;  3OVS A;  1YRU A;  4QWA A;  4LIW A;  4UQT A;  1VK8 A;  3GP9 A;  2VG5 A;  2VG6 B;  1U1N A;  4G1Q B;  3VQS A;  2NYH A;  5DDQ C;  1TL3 B;  2YKN A;  5B0A A;  1JLC A;  5AE3 A;  1WG4 A;  5D0R A;  2XZW A;  4NLS A;  3DLL Q;  4ZN3 A;  4OZ2 A;  4HKQ A;  3KMS A;  2VJV A;  5D77 A;  3CMQ A;  8RUC A;  3N6M A;  4IYQ A;  4UUX A;  2NUH A;  3LGM A;  1HBO A;  1T7P A;  4LBI A;  3R3T A;  2WZ1 A;  2DNN A;  3VV2 B;  1A6L A;  5F8L A;  4O3O A;  4UZC A;  3RW6 A;  3VQT A;  4MIA A;  4FS1 A;  4O4G A;  3ENA A;  2LXF A;  3H5X A;  4DN9 A;  1M90 T;  1RB0 A;  2DHX A;  3VVU A;  1OMS A;  1QE1 A;  3HUL A;  4LF9 F;  3KK2 A;  1T03 B;  3ILO A;  4ED7 A;  3CDA A;  3PJX A;  1EB0 A;  2M4M A;  3FEZ A;  4B9S A;  1R0B G;  5HVF A;  4K4X A;  3NXZ A;  3M2R A;  3LWL A;  2VG7 A;  2WOM B;  4QYR A;  2VU5 A;  5HRO A;  2VFS A;  3MPU B;  1NK9 A;  2FLL A;  4DQP A;  3TAQ A;  3OFH A;  1K9M T;  2MXY A;  3ZZY A;  1JWW A;  2RUG A;  5BR8 F;  2B9E A;  2M3D A;  2ZWO A;  4YHH F;  1NJZ A;  5JJB A;  2O66 A;  2FJX A;  2CIM A;  4OL8 A;  3H5S A;  2WSC C;  2RUS A;  2JFD A;  5IM0 B;  1BC6 A;  2PSZ A;  1NK0 A;  3BM7 A;  4PQA A;  1VBZ A;  3LUY A;  1NK4 A;  3T9N A;  2MGZ B;  4KKO B;  4KRW A;  4F0M A;  2MY8 A;  3AA8 A;  2NYI A;  4J9K A;  5HMX A;  4ZIT A;  1HL6 A;  4IO1 A;  4DUZ F;  2MY7 A;  4A8M P;  1EET B;  3AJD A;  2OSR A;  3MEK A;  2OKQ A;  4ZVT B;  1HW9 A;  4ZVG A;  2L48 A;  1NDP A;  4C8N A;  1S49 A;  3ICL A;  2RB7 A;  2VH7 A;  1IQT A;  1BQX A;  4DR3 J;  1BQN A;  5LL6 d;  3ADA C;  4C11 A;  1AFJ A;  2DNQ A;  2K8G A;  3IRX B;  2AT1 B;  2RS2 A;  3TQ1 A;  2CVI A;  5DZ6 A;  4J9Q A;  2BW2 A;  3FFI B;  4KFB B;  3AOB A;  4PYA A;  2FJB B;  5J1P A;  2ZZT A;  1N54 B;  2ZDP A;  1BMQ B;  3WX4 A;  3KTQ A;  3CD0 A;  2J6T A;  3UI3 A;  2O5D A;  1F5B A;  1C1B A;  1R0C B;  4N8N A;  1VHI A;  1LWF B;  4DV5 J;  3HJF A;  4FNI A;  3TW0 A;  1D9F A;  4LSL B;  3LW5 C;  1KQS R;  3HDS A;  2YNH B;  3CO0 P;  2DR7 A;  4IOA Q;  4LF2 A;  1S6O A;  3ZZR A;  4PG7 A;  1FFS B;  2VPY B;  3HXM A;  3Q89 A;  3GG1 A;  2NQP A;  1YJ9 S;  2ZBC A;  4B3S F;  3OL6 A;  4LF4 J;  3V6D A;  4AT1 B;  1RT3 A;  1SC6 A;  5HMY A;  3KUE A;  4LF8 F;  1FNX H;  2HIY A;  4ZVR B;  2OD4 A;  5L1I A;  4M63 A;  2Z2Y B;  1WOO A;  4NLV A;  4GO7 X;  2Z4P A;  1FER A;  4IFY A;  1DTT A;  3KDO A;  4Y2M A;  2V4Q A;  1VJQ A;  4ZCL A;  4DSE A;  4I4B A;  3PRD A;  2G0J A;  4NLY A;  3PZP A;  2R2T A;  1HWU A;  3MEE A;  4YN3 B;  3DLE B;  1AFI A;  4P6Q A;  5KT2 A;  2D1C A;  3W3S A;  4S0M A;  3MMA B;  2UXD J;  4EEY A;  2RAQ A;  2BQR A;  3ILJ A;  3THP A;  3DDN A;  2YPZ A;  4A8K A;  1R8P A;  2EFP A;  2IRX A;  5KFO A;  1RJJ A;  4FPR A;  1FX4 A;  4A8Q A;  1Z1Z A;  4Q43 A;  2IMW P;  2E5H A;  4X4P A;  1CJV B;  2DB1 A;  2IDL A;  3NWR A;  2MSS A;  1Q8B A;  3CVK A;  1F9E B;  2GHW A;  3D54 A;  1KFD A;  2DNH A;  3BJY A;  3FBF A;  2M52 A;  2V2Q A;  1N0V C;  2OLW A;  2DCL A;  4DZ6 A;  1SKW A;  3WC0 A;  1ULR A;  5IQ6 A;  3ZC4 A;  2HRY A;  1X9W A;  5GMD A;  1MMD A;  3VGU A;  1B7Y B;  3PEH A;  3LA0 A;  5CYM B;  3LH2 S;  2VBZ A;  2EK1 A;  5A6P A;  2KXF A;  2ZC3 A;  5BXI A;  3OR2 B;  1KON A;  9RUB A;  4O4R A;  2B4V A;  3MM5 B;  3FUY A;  3CC4 S;  1EQM A;  2DRB A;  3CCV S;  4JI0 J;  2COL A;  3EDR B;  1WTB A;  4CO2 A;  1UEU A;  2BE9 B;  3DXS X;  3GE9 A;  3WC2 A;  2BQ3 A;  3QSI A;  3JQK A;  2VD3 A;  3H2L A;  1XNR F;  3G87 A;  3J7Z T;  2V8P A;  5KFL A;  3RYL A;  1Q7Y T;  1LW2 B;  1Q79 A;  2D3U A;  1Z4U A;  4P2M A;  4FDF A;  5F9N A;  1FKP B;  3MMC B;  2YH0 A;  1S0M A;  4JI8 J;  3GFY A;  4PAB A;  3DRR A;  4MKB A;  1RXO B;  5KFU A;  2LA4 A;  1VLY A;  5DJB A;  3NNC A;  1RZM A;  2N4D A;  3SQG A;  2RQ4 A;  3MUR P;  3DRX A;  1SJ4 P;  1DRZ A;  2W01 A;  4EZ9 A;  3FQL A;  4IG0 A;  3ET6 A;  1WHW A;  2GO9 A;  1QSS A;  3AA9 A;  3DHW C;  2H48 B;  1RI7 A;  1RAH B;  2IJN A;  3ZZU A;  4NLQ A;  4O3S A;  2EFQ A;  4ED5 A;  4WZM A;  3RUB L;  2QJ3 A;  3GON A;  5F41 A;  2HQ3 A;  2EFN A;  3RRH A;  4F2R A;  3KJQ B;  4Y65 A;  3V4I B;  1U0H B;  9ATC B;  2NPF A;  4U67 Q;  1Q8K A;  3PW7 A;  1O6X A;  2CPF A;  1PO6 A;  3VHQ A;  3EX7 B;  4IDK A;  2MST A;  3JSM B;  2XS5 A;  5I42 B;  4I7F B;  4ILL A;  5KFR A;  4F0H A;  4EFA C;  4B08 A;  4J91 A;  1MMN A;  3PW0 A;  2ZH4 A;  1DQ9 A;  2QA4 S;  1H7W A;  3FEY B;  4DV1 F;  3QYY A;  5DO2 A;  3CJK B;  3EXC X;  4DI6 A;  5DM7 Q;  4RW9 A;  1NU4 A;  1OYE A;  1ZM9 A;  2CXE A;  5J2P A;  4BC7 A;  2HAI A;  4OI4 A;  4OLP A;  3J7Z 5;  5AT1 B;  4DL7 A;  2A0F B;  3CJ0 A;  1RAD B;  3W1Y C;  3J81 j;  2W9B B;  3C46 A;  3MHY A;  2OPP B;  3Q8P B;  3DYA A;  4X66 J;  4ED4 A;  4ZPC A;  5F8H A;  1EHW A;  3BDE A;  4ZS6 A;  2IHR 1;  1VRT A;  3R1L A;  1TKT A;  1E6V B;  4G1I A;  3M2U B;  1TZ0 A;  1FF2 A;  4J5O A;  5E3P A;  3Q8U A;  2PGC A;  1LWC B;  1FRI A;  3GR0 A;  1S1T A;  3G6E S;  5LMN F;  3FCH A;  3BPS P;  3LGN A;  2YWE A;  2DH9 A;  5L1L A;  1VI7 A;  3KK3 A;  1HNW F;  4DR7 F;  2J0S D;  4JUZ A;  2QT7 A;  5B0C A;  1SKU B;  3HD1 A;  4ID5 A;  1SUQ A;  1F2H A;  1Y9O A;  2IDE A;  2KVQ E;  3PJ9 A;  3VGS A;  4DSI A;  2R8H A;  5I3P A;  1IR2 A;  3MUV P;  1SI9 A;  3LOU A;  3SCL E;  2MZ1 A;  4RBT A;  1FX2 A;  3DOM B;  1HWI A;  1PAE X;  3DM2 B;  5D6G A;  1VBK A;  1QAX A;  5KFW A;  4KT0 C;  1SV5 A;  2XCP A;  4DX6 A;  4NML A;  4QIW D;  3PHE A;  5LMU F;  4PKD B;  5F3Z A;  3JTN A;  3RZA A;  4X64 J;  2BOP A;  4RNF A;  3DU5 A;  4X4V A;  3AB2 B;  1FRJ A;  1B0P A;  3HFV A;  2XS7 A;  2EKN A;  4P72 A;  4DR1 F;  5CHC B;  3CC7 S;  1A9N B;  2LQB A;  1QD1 A;  3KKF A;  4DHV A;  2MKC A;  1R7I A;  2ZH3 A;  2WSE C;  3WIU A;  4K8R A;  3MR5 A;  2MPU A;  2DNG A;  5HP1 A;  4Z37 A;  2B8P A;  1WDD A;  2NZ4 A;  3TZY A;  2XTJ P;  2B6A A;  4K59 A;  4CTA A;  3NEK A;  4DV2 F;  2DBB A;  1S9E B;  1YHQ S;  3CCR S;  3T19 A;  1B64 A;  3CUN A;  1U45 A;  2WK4 A;  4LFC F;  1AZS B;  4OX8 A;  3R2C J;  1A0O B;  5CH7 B;  2ZBP A;  3W66 A;  3SSR A;  4DQS A;  4DR4 F;  2HVD A;  4ZVH A;  4I67 A;  2HWI A;  1REV B;  3Q24 A;  2XYG B;  3H20 A;  3TAM A;  1WWH A;  4HLB A;  2R2S A;  2IFX A;  4RU9 A;  3C3L A;  3CNQ P;  1N32 J;  3CC2 S;  2MB0 B;  3ENQ A;  4C3L A;  4WWS A;  1RT4 A;  2DNL A;  3FSY A;  3FBB A;  2WVB A;  4K0K J;  1WF1 A;  5A8K B;  3IAM 9;  1QAJ A;  1FDD A;  1NB7 A;  3GCX P;  2W7A A;  2VG6 A;  4ES2 A;  5ETP A;  1X4H A;  1TL3 A;  5IC6 B;  1RWP B;  3DRS A;  1HW8 A;  1FDA A;  1XJW B;  3AQP A;  4JV5 J;  4USM A;  3T1Y F;  3K5L A;  1D09 B;  1N5T A;  3PO5 A;  2CQ2 A;  2NS1 B;  1AA1 B;  1RT2 A;  2JDJ A;  3GLJ A;  1HNZ F;  2DHG A;  4Y28 C;  3ETO A;  4DL3 A;  1H38 A;  4NEZ A;  2MZJ A;  4OX7 A;  2AIR B;  3IG1 B;  3HM9 A;  1T9Y A;  4DOZ A;  3PAC A;  4WXW A;  2P5V A;  4ZJO A;  1X4C A;  5A6W A;  1IR1 A;  5IT0 A;  5HJX A;  1N36 F;  2RKI A;  2PA3 A;  1OY6 A;  4WTO B;  4KGV B;  3G8Q A;  4K4T A;  2CZ4 A;  1T03 A;  2EVZ A;  1FEE A;  4CNY A;  7AT1 B;  4ZP6 A;  3OT9 A;  5DDO C;  3HHK A;  3BDP A;  3DLK B;  1T0T V;  3JSB A;  4C8M A;  4TLQ A;  2F4V J;  2NSC A;  3EUN A;  4FBT A;  4USV A;  1EAY C;  4GC7 A;  5CYJ A;  5A8W B;  3PFO A;  4TXS A;  3W62 A;  3N5B A;  2C2O B;  4NYP A;  3MOJ B;  3T3F A;  4ECQ A;  3QJL A;  1XIQ A;  4C0B A;  3ZNJ 1;  4ZLN A;  1DTQ A;  3BF4 A;  2E5G A;  1S48 A;  4DLG A;  2EBG A;  2EWH A;  1RHJ B;  1UPP A;  1WEX A;  1P27 B;  2FHJ A;  2DRD A;  3EGZ A;  3M8R A;  4DV6 J;  5ETV A;  1GQE A;  5IM0 A;  2GAG C;  3MUT P;  4QZV B;  1U6Z A;  5HO4 A;  3UCZ P;  1Q8I A;  5CZX A;  3RU0 A;  1LWE B;  1C1C A;  1R6V A;  1UTA A;  4URG A;  3Q2T C;  5JMN A;  3EZ5 A;  3D9B A;  2FB0 A;  2MQ8 A;  1PGZ A;  5KFV A;  3KNA A;  3GTY X;  1EET A;  2DD8 S;  4LF7 J;  4K7Q A;  3QNW B;  2Q1L A;  2W2Q P;  3Q8V A;  3F56 A;  4CYU B;  1BWV A;  4CO0 A;  4FXV A;  1G6B A;  4IG3 A;  2LXU A;  1RWU A;  3UN2 A;  4H4K C;  5D3G B;  2PFF B;  3W2W B;  1IJF B;  2AZ1 A;  4KGK A;  1Q82 T;  1CS4 B;  5F8G A;  2LEA A;  2AGP A;  3QO9 B;  4KFB A;  4XDC A;  4OYP A;  1OPZ A;  3O1L A;  3BGF A;  3C16 B;  2X1A A;  4TQR A;  3CME S;  4B3R F;  3MTJ A;  2EXU A;  3V6K A;  2V8H A;  3QAT A;  5K8N A;  1NSP A;  4HT7 A;  3PVX A;  4M5K A;  5EX3 A;  1DHM A;  4BWJ A;  2XZT B;  2AX1 A;  3OR1 B;  2OFH X;  1VGY A;  2LYV A;  3KLI B;  4KIA A;  2AWZ A;  2YNH A;  3T1A A;  2QZ8 A;  4DWI A;  2E5L J;  1XMO F;  1S12 A;  4LRB A;  1GK8 A;  2HQC A;  2KHC A;  3GYX B;  2DO0 A;  4AL5 A;  1HR0 F;  4F67 A;  5MLC V;  3UO0 A;  1RWN B;  4Q8F A;  4NZ6 A;  2W4D A;  2AEM A;  4QJV A;  2B5J B;  2JJ4 D;  3VAL A;  1WHV A;  3P4U B;  4Q2M A;  4H4M B;  2PMW A;  3TWZ A;  1M5H A;  3KJF B;  2J9D A;  2VON A;  4L73 A;  5ETK A;  2IJR A;  4NE9 C;  4B3M F;  1JQG A;  2YKO A;  4Y2C A;  1HLW A;  5H9E J;  4FS2 A;  1MU2 B;  4AD6 A;  1ZZF A;  3WBZ A;  2R2U A;  2AGQ A;  5B0F A;  3OQ2 A;  3ZZT A;  2GA7 A;  4PWW A;  2Z57 B;  3R7B B;  2G2O A;  1QDU B;  4P74 A;  3NGS A;  4R0E A;  1SBR A;  3DLE A;  2NPI A;  2KT5 A;  1SPB P;  4LSZ B;  3CIM A;  3F44 A;  3NMA A;  7FD1 A;  3M9O B;  3MM9 B;  1P1L A;  1Q5V A;  2KVI A;  3PCO B;  3MWB A;  3AJ1 A;  2Q66 A;  5B0G A;  2N7C A;  5K8M A;  2UVU A;  4N8O A;  3VAH A;  2C42 A;  1CUL B;  3OFF A;  3A8E A;  1KOO A;  2HFO A;  2VL1 A;  2O01 C;  3OJU A;  1CJV A;  3CED A;  4EBD A;  2MQL A;  3AT1 B;  5B0B A;  4MYT A;  3PIO Q;  2BVZ A;  2IPO B;  5LSR A;  4OZJ A;  3BSC A;  4YB1 P;  2Q79 A;  1JK9 B;  4P2F A;  2CQP A;  2KG1 A;  2ZH2 A;  1TMM A;  2ZVS A;  1RWM B;  4B3T J;  1VQM S;  3FBC A;  3RGI A;  3KJV B;  5CYM A;  1U1O A;  1U6F A;  2FVR A;  1MLA A;  3HHL B;  3D2W A;  5FDL A;  5DG8 A;  3GYN A;  1S59 A;  5FLX Y;  3KLH B;  2VBW A;  1HA1 A;  2E7W A;  1RHU B;  4CRJ A;  1NJX A;  4ERD A;  5I3Q A;  3MM5 A;  1NK5 A;  1WKK A;  3DU6 A;  1TP7 A;  2EW9 A;  3MOZ A;  2Y1I A;  1G7C B;  2OPQ B;  3CDE A;  4ED3 A;  4F4K A;  3D6H B;  2ZJP Q;  3DFE A;  1HQE B;  4OMF G;  4DV7 F;  3D7S B;  3W5X A;  2GHV C;  2W2N P;  1N33 J;  1OSC A;  4NAS A;  1AYE A;  5CA5 A;  3K5O A;  2B56 A;  4CNZ A;  2M88 A;  3NCQ A;  3CT9 A;  2V9K A;  1HI0 P;  3MMC A;  4DPX A;  1RAF B;  4CO1 A;  4DPY A;  2QFI A;  4RW6 A;  4KGM A;  4LFA J;  4NL5 A;  5K14 B;  2E44 A;  2RU9 A;  3PX6 A;  2WON B;  2LU2 A;  2ZIT A;  1MN7 A;  4USW A;  3OJS A;  2JEF A;  1L3K A;  3KLF B;  3DKD A;  3D1Q A;  5GAE U;  2BV3 A;  3PFE A;  5KG5 A;  2D3Z A;  3GU0 A;  1UEK A;  4RX6 A;  3E01 B;  1BY9 A;  3EVO A;  2HVI A;  1RTI B;  4UOH A;  3R5A A;  2I1R A;  3MEC A;  4OLO A;  5M2R A;  3V4I A;  1T3N A;  5L38 A;  4A8W A;  1QVF R;  3CD6 S;  3IS9 B;  1J2V A;  4P9S A;  4HDG A;  2VJU A;  3LWM A;  3JSM A;  2VHG A;  5DM6 Q;  3V6J A;  2HSE B;  2ZKT A;  3MF5 A;  2NXC A;  2EC2 A;  2JLF A;  2QL7 B;  4ALZ A;  1Q95 G;  4RBU A;  1IBM J;  4URQ U;  3I96 A;  2OFG X;  2XCA A;  2GVZ A;  4NA1 A;  1Z2L A;  3BQ1 A;  3MPY A;  4CLZ A;  3GPA A;  4ZPW R;  1W26 A;  4YY3 J;  1L3T A;  4ZPB A;  1S99 A;  1XK8 A;  4K5S A;  1X60 A;  3UCU P;  3PEJ A;  2AYE A;  5HVG A;  2ZDO A;  4OI3 A;  4ED6 A;  4Y0F A;  2DCU B;  4KY3 A;  3WZ0 A;  2XSJ B;  1RU1 A;  3IWX A;  1X4A A;  1U1P A;  4ZHR B;  1S1V B;  2W9B A;  4GKJ F;  1P9Y A;  2ZVI A;  1K73 T;  1WG1 A;  1SB6 A;  1X5P A;  3A12 A;  3UN3 A;  1RLC L;  4PXB A;  3OD2 A;  3QSY B;  1LV5 A;  2AP6 A;  4CLW A;  5KFK A;  3P5T L;  3GJT B;  4ZN1 A;  1K8A T;  2HS3 A;  2YKP A;  3SFU A;  2RML A;  2OAU A;  4DUY J;  4IRD A;  4X4T A;  3PJW A;  4Q0B A;  4DG1 B;  1U1K A;  1RAE B;  2OGU A;  1XEZ A;  3M2U A;  5KG2 A;  4ER8 A;  3SDE B;  4WE1 A;  1LWC A;  4QOT A;  4ZVQ B;  2CRL A;  4I0W A;  2L9W A;  4ZVS B;  1J5E J;  4NYO A;  1WEZ A;  4M95 A;  3K2Y A;  5F8I A;  6FD1 A;  3K5P A;  3OTB A;  3IM8 A;  4A8X A;  1SIZ A;  1H0H B;  2OMO A;  4WF9 Q;  3MUM P;  1YDL A;  2BQU A;  2VKZ G;  4M5I A;  2K1R B;  3M2V B;  1F3F A;  2QEX S;  4NCG B;  1VRU B;  4RUA A;  2NCK L;  4HHU A;  1S1U B;  1FJE B;  2G2Z A;  3DM2 A;  3LAL A;  4FN5 A;  5H9F J;  4KO0 B;  5DLG A;  5IWA J;  2MQQ A;  1TVR B;  4CLF A;  3I5C A;  2VDI A;  2JHE A;  3MR6 A;  2V63 A;  1URN A;  4ELV A;  5HAT A;  2DTJ A;  2XGQ A;  1KHV A;  1NJI T;  4JB8 B;  2P6S A;  3J7Y I;  2DY1 A;  5I4M A;  3R8Y A;  2CA9 A;  3MMJ A;  4ZK7 M;  4DV4 J;  1BHN A;  2AJF E;  4HL9 A;  1FRX A;  1UA1 A;  1WC3 A;  4F4A A;  2F3J A;  3H25 A;  1VMB A;  1C2P A;  2KB2 A;  2YNI B;  1I5O B;  4QIV A;  4JV0 A;  2KDO A;  4IH7 A;  4F4Y A;  4OZ3 A;  1YG0 A;  1HNI A;  1VBY A;  2Z56 B;  2GJF A;  1FK9 A;  2B9Y A;  4FYV B;  4DV0 F;  1S0V A;  2FVS A;  1YZ6 A;  2DNK A;  2LXI A;  2DNY A;  3D0I E;  2YX1 A;  3AQO A;  1DLO A;  2HWH A;  1AZS A;  4LT6 A;  2G2Y A;  3OL9 A;  3CB4 A;  5EHH A;  3LGH A;  4JI6 J;  1NCL A;  2HBQ B;  2IAJ B;  2DK2 A;  2HNZ B;  4X62 J;  3NS7 B;  4UST A;  2RDJ A;  2DGQ A;  3DGV A;  2V8V A;  2RRA A;  2VG5 B;  4KJI A;  2R42 A;  2ZH5 A;  4ZKA A;  1JLC B;  2AEJ A;  3MPD A;  1QVG R;  2VOP A;  4FXD A;  2CQ0 A;  4F25 A;  3CJ5 A;  2UV8 A;  1VC5 A;  5KG7 A;  2ZHO A;  1SJR A;  2W25 A;  1NSQ A;  5CXT A;  5A8K A;  1HBO B;  4QYZ J;  3HZG A;  5KFS A;  1YJ7 A;  4OJG A;  4Z7C A;  4OYW A;  2C2R A;  1R27 B;  4I68 A;  3G86 A;  3TOQ A;  1H3D A;  1MN9 A;  4O4G B;  1WD6 A;  3OL7 A;  1B0T A;  1M5S A;  1IN0 A;  2MZT A;  1U1M A;  4OJ1 A;  5F8M A;  4R5P B;  4NXN J;  3RB6 A;  5E5N A;  3IG1 A;  3KMQ A;  1U2R A;  5DRK A;  3CCW A;  3PW4 A;  3M2R B;  2PI5 A;  3KUG A;  1KVJ A;  1TU0 B;  4CO3 A;  3H2U B;  4C6A A;  4CCH A;  4IR9 A;  2KFY A;  4ZLJ A;  2UU9 J;  1HHQ A;  1BQM A;  4QCL A;  3GFH A;  3CD5 A;  3DLK A;  5LOQ A;  3U27 A;  4I2Q A;  1FJC A;  4F3O A;  1HYS A;  5IS2 A;  1EKS A;  2KM8 B;  3JXO A;  2FQQ B;  4Y2I A;  3MM7 B;  3US5 A;  5A8W A;  1MW7 A;  1UVJ A;  2QSW A;  2YQ3 A;  1F1B B;  1VQY A;  3HSJ A;  2W8K A;  3WIV A;  1XR6 A;  3EM1 A;  4QU7 A;  4R0J A;  4QR0 A;  3QIP B;  1DJ0 A;  1NAQ A;  4NXM J;  5FLX U;  4B02 A;  2VQE J;  1JLB A;  4ECV A;  3DRY A;  1WC5 A;  1UWB B;  4C0H A;  1B4S A;  1GTE A;  4W98 A;  4DQI A;  4ZLL A;  4MH8 A;  3OVA A;  3CCM S;  4AQY F;  1QAI A;  3PX4 A;  2AJ4 A;  4FYD A;  3FBE A;  3Q86 A;  4Y00 A;  5LT5 A;  1LK5 A;  3UD5 A;  3TAP A;  1ZA1 B;  1X9M A;  5CQG A;  3K5N A;  1RQ0 A;  4C11 B;  4OI0 A;  2FDN A;  3OLA A;  3VTI A;  3IMQ J;  1XMB A;  4JI3 F;  4HVZ A;  3ZZ0 A;  3ELH A;  1UP1 A;  1MML A;  3JQM A;  3P96 A;  2ZHA A;  2P9C A;  1S97 A;  3BGU A;  1VR6 A;  5D3G A;  2Q6C A;  2XG8 A;  1CS4 A;  2E5J A;  1CQN A;  2X1G A;  3QO9 A;  2XYH B;  2OTJ S;  3N6L A;  1WKL A;  1VFJ A;  5D0H A;  3C16 A;  4ZOS A;  2KRB A;  2F9D A;  1FJ7 A;  3W63 A;  4DCP B;  4OZL A;  5HQ8 A;  4B3O A;  3W7B A;  3CGI A;  1T9U A;  5EWG A;  2QGF B;  3NG8 A;  1EIY B;  2EG2 A;  3IC1 A;  4CQ1 A;  4WFZ A;  4KPC A;  2BAN B;  3TRG A;  1YKW A;  3OR1 A;  1ZM3 A;  3QZ8 A;  1VYA A;  1KHW A;  3KLI A;  4L75 A;  5EGY A;  1T94 A;  2R9L A;  2VIH A;  5T14 A;  3AXK A;  1SH0 A;  3OW2 R;  4LFB F;  3QWU A;  2MQM A;  4FXW A;  1IBK F;  2J6S A;  1QLN A;  3W61 A;  4IFY B;  2HQG A;  4KV8 B;  2BKO A;  4R8U B;  1IBL F;  2J0X A;  2CVE A;  1RTJ A;  2B5J A;  2FZC B;  3M30 B;  3EGW B;  1Y10 A;  1WC6 A;  5KFI A;  1YGY A;  2B7C B;  1OY9 A;  4H4M A;  1NBE B;  2JWN A;  4CLT A;  1XMQ F;  3CDU A;  1GMW D;  2MQP A;  2YX7 A;  4A8O A;  3HKW A;  2RF2 A;  1JNZ B;  4LUB A;  3G2X A;  2VF3 A;  3IRW P;  3HF5 A;  4YR0 A;  4DX7 A;  2LLZ A;  3BGO P;  3CCE S;  4DPW A;  2VA2 A;  4TY8 B;  2OI2 A;  3VAJ A;  2KJW A;  5KFH A;  4LRD A;  3TR5 A;  2C2E A;  1NB2 A;  4ITS A;  1Y3K A;  2FJA B;  2R8J A;  1S0O A;  1HFE L;  4OZ1 A;  4JI5 F;  5KOX A;  4RU2 A;  2YTC A;  1WEY A;  3RB3 A;  4WK1 A;  3MM9 A;  4USK A;  3A8J A;  1N56 A;  2J5A A;  1X31 C;  4KPY A;  2QO3 A;  2C1E B;  2IY5 B;  1KVI A;  4TU8 A;  4RPF A;  1YJW S;  4ENO A;  4JV2 A;  4LF6 F;  2DPI A;  1HBN B;  1MRO B;  2F8E X;  2LP4 A;  3DDI A;  3TAR A;  3HJV A;  2L9D A;  1FKO B;  1SJ3 P;  3M8P A;  2EPI A;  4DQQ A;  1YBA A;  1XNQ J;  4EK2 A;  4TKT A;  4FF1 A;  5KFT A;  3EGV A;  3RG6 A;  4Y2A A;  1CBK A;  2HQD A;  1FVS A;  3LO3 A;  3TZZ A;  3GV8 B;  3G9C A;  1DQ8 A;  4PXC A;  1EP4 A;  1U8W A;  4JYA F;  5HMW A;  3EYZ A;  3Q8Q B;  1B3T A;  3SMZ A;  1S10 A;  3MCM A;  3QGP A;  1V3R A;  4DR2 F;  2EK6 A;  2QA1 A;  4QWD A;  2IBO A;  4DR6 J;  1GMU A;  1RK8 A;  4UW2 A;  5L39 A;  3OSN A;  2V0N A;  3G82 B;  3THV A;  3KLH A;  2XEX A;  4MAK A;  4F4Z A;  1VQK S;  4C4W A;  1M5V C;  1ZAV A;  5C25 B;  3CCU S;  3M6X A;  3OXG A;  4CT8 A;  4ZPT R;  4A47 A;  3I56 S;  2C28 A;  5BYQ A;  2OPQ A;  4X4R A;  5DGB A;  2U1A A;  4ZMM A;  2ZH9 A;  2V94 A;  4LBP A;  4YOE A;  5H9E K;  4DR5 J;  4J9U E;  4DL6 A;  4P75 A;  3SQG B;  1YJR A;  3UNY A;  1YBT A;  2UUC J;  1SJ1 A;  2UUT A;  1UJ4 A;  3AOD A;  1UVN A;  3HHE A;  4IG0 B;  3ET6 B;  3B6B A;  4I2P A;  1RT7 A;  3SYZ A;  4PWU A;  3SQO P;  4H4K A;  4UOG A;  3I4H X;  1IVZ A;  3G4S S;  1BE4 A;  4V1A k;  5K14 A;  1H73 A;  3ZFV A;  4N56 A;  4AL7 A;  1FDN A;  2GIR A;  4J9L A;  3KLF A;  1VIO A;  3DDK A;  5HSP A;  3KYL A;  2JL9 A;  2M8H A;  5HJY A;  2E5L F;  5CAA A;  4RUH A;  5KFD A;  2R4F A;  2XMM A;  3E01 A;  4IDK B;  3FRZ A;  3M8Q A;  2DY9 A;  2DH8 A;  3C15 A;  4CLY A;  5AJ3 F;  4B17 A;  4FF4 A;  4LIR A;  5HVH A;  3TUJ C;  2ASD A;  3IS9 A;  1URR A;  2DR6 A;  4IUF A;  2F9J A;  2HQF A;  3GR1 A;  2MKJ A;  4I64 A;  4JI2 J;  2C2M B;  3J7A N;  2AHO B;  5DQH A;  1PSD A;  1P8G A;  2QYG A;  4FPI A;  1NH8 A;  2VPZ B;  1KTV A;  5J2P B;  2AEF A;  1HNX F;  3Q23 A;  1JJH A;  3H5Y A;  4EO6 A;  4X4S A;  2FJW A;  1JIH A;  2C3U A;  4YB5 A;  1Y4Z B;  2PT0 A;  3KJN B;  5KT6 A;  3R6G B;  3VGV A;  4RW4 A;  2V6A A;  3C14 A;  4H4O A;  2QMX A;  1RA6 A;  1TK0 A;  2XY6 A;  2O67 A;  3QAE A;  1KN6 A;  4F3M A;  4AFF A;  2KKH A;  3ZXW A;  2DR5 A;  4HHH A;  5E3Q A;  3DYA B;  2R7T A;  1ACM B;  3MZI A;  1VQP S;  2HS4 A;  1X4B A;  2RQK A;  1ZOT A;  2Z58 B;  3D6T B;  2QA4 G;  2HHW A;  2XSJ A;  3HD2 A;  3IR7 B;  3CUL A;  3GFZ A;  3UVJ A;  5ETM A;  1S1V A;  1X0F A;  1T9V A;  2EFO A;  4RR5 A;  2D3O 1;  3AHP A;  1NPP A;  1ZM2 A;  3QPI A;  1RHK B;  3TUP A;  5F8J A;  4BDP A;  1JMT A;  3VAM A;  2Z0G A;  1WSR A;  3MCS A;  3C66 A;  1NDK A;  3NL0 A;  1U1L A;  4DS5 A;  4DG1 A;  4YUD A;  3W9H A;  3PXG a;  3SDE A;  3HT3 A;  1FJG F;  5IQQ A;  2WW4 A;  4KAI A;  1PYO B;  2W2O P;  2QLJ B;  3MMB A;  4ICL B;  4Y6I A;  1MG7 A;  4P7T A;  3QT8 A;  3HZE A;  1R8B A;  3MPV A;  1UCN A;  3KLG B;  2IRY A;  2F8M A;  1SV5 B;  3R7S B;  5D8H B;  4RO0 A;  1CJU A;  3BQ2 A;  2ZKU A;  1QSL A;  4DF4 A;  3L95 X;  2K1R A;  3M2V A;  1M5O C;  1VLO A;  3VAI A;  1ROF A;  1F2G A;  1JJC B;  2XI3 A;  1HPZ B;  1S1U A;  5J1E B;  2QLW A;  4FVM A;  4KO0 A;  1H2V Z;  4KR0 B;  3RBX A;  1TVR A;  1FRK A;  3IGN A;  1N33 F;  2P8I A;  2WHO A;  2MTL A;  4WFY A;  3NBP A;  4WPA A;  5ETT A;  4A8S A;  4B9V A;  3VF0 B;  4X65 F;  1NK7 A;  2RD5 C;  5DDP C;  2B6A B;  4YFU A;  4CTA B;  3UR0 A;  1TKZ B;  1R89 A;  3I5B A;  4HTI A;  4CH7 A;  3GB0 A;  3S6E A;  5K20 B;  3OV7 A;  2IM0 A;  2YNI A;  4CT9 A;  5L8R C;  1XR5 A;  4LF9 J;  1YLX A;  3HVR A;  4BC9 A;  1FXD A;  4KGZ B;  1X9S A;  1HD0 A;  2AJQ A;  2R2R A;  4TNO A;  4YR3 A;  2JRS A;  2AYB A;  2VFV A;  4PEO A;  4ZJQ A;  2GML A;  3JYT A;  4HH1 A;  3PX0 A;  3AOA A;  2LKZ A;  2H54 B;  2BJ9 A;  1KWM A;  1RTD A;  5BYR A;  4FYX B;  3TAM B;  1RAB B;  4WP3 A;  1H6K X;  4DUT A;  1UA0 A;  4ZIW A;  1V3S A;  2XLJ A;  1EZZ B;  4D3G A;  5BR8 J;  3R7N B;  2D69 A;  5RUB A;  4WKY A;  3GJS B;  1D1U A;  2ZBR A;  3BH7 B;  4YHH J;  2D41 A;  4K4U A;  2IAJ A;  5DQG A;  4U8V A;  1Q8L A;  4ECY A;  1GMV A;  4JI1 F;  4NA3 A;  2UXC F;  3M32 B;  2Y1L B;  1ARO P;  4LJM A;  5KFC A;  3DRS B;  3MM6 B;  1N5S A;  1VQ4 S;  3K0J A;  1H74 A;  1UZD A;  4UZB A;  4ECZ A;  1FHT A;  3NOG A;  2MZQ A;  1RT2 B;  2E9Z A;  5D4P A;  2V2V A;  2PFD A;  3I0R A;  2IYI A;  4WXO A;  3PYE A;  3BPD A;  3A4T A;  2A18 A;  3MI7 X;  5H9F K;  3QT5 A;  1HNV B;  2DGU A;  3KLV A;  4DUZ J;  2C2N A;  2V5H G;  2XM3 A;  3GSD A;  2CZ9 A;  3FJ2 A;  1CQM A;  3EMT A;  2AX0 A;  3Q22 A;  3JTP A;  2RKI B;  4R5P A;  3P49 B;  2MHN A;  3Q8R B;  2HZA A;  3IA0 A;  2E66 A;  3OTD A;  1ZA2 B;  3HSG A;  2DKO B;  2ASJ A;  3ZO7 A;  4CO5 A;  4GVL A;  1R6Y A;  2DIU A;  2GZO A;  2F4F A;  2VQF J;  3R5D A;  1PYS B;  2EG1 A;  2FJD B;  3BR8 A;  1O51 A;  3CJ8 A;  5AXK A;  4W90 B;  3F73 A;  2BA9 A;  1DTQ B;  3NAI A;  4BS2 A;  4ZCI A;  3D3C J;  1UZH A;  4QW9 A;  4TQS A;  2DGX A;  1TAQ A;  2XMU A;  3FCV A;  1KFS A;  1WI6 A;  3MM7 A;  1A7G E;  4GO5 X;  4EI2 A;  2G13 A;  4KBI A;  2CPH A;  2BJ1 A;  4X4N A;  4ECT A;  4QWC A;  1VQL S;  4PCQ A;  3S7R A;  4C7Q A;  3O6Q A;  3QIP A;  4B3S J;  5JVH Q;  1C1C B;  2M70 A;  3W5Y A;  3OXF A;  2AYM A;  4QW8 A;  4LF8 J;  1NJY A;  2E1C A;  4OHY A;  1UWB A;  1GT8 A;  1T02 A;  1KTQ A;  3I82 A;  4XIU A;  2W2M P;  2J9C A;  3ISN C;  2GGP B;  1WF2 A;  2KYX A;  3ILI A;  4FKX A;  2MHE A;  3NGR A;  4DSF A;  3DGP A;  4IG3 B;  2QG9 B;  5ADZ A;  5AE1 A;  1S76 D;  2DEI A;  3RRK A;  3ISN D;  2FLN A;  3QRQ A;  3SCK E;  3M8Y A;  3H59 A;  2HMI A;  3GIK A;  2HHT A;  1WI8 A;  4OHW A;  5J2Q B;  1U49 A;  3TJA A;  4LVN P;  1P6T A;  1N5Y B;  3PNI A;  2JC0 A;  2K7J A;  3TI0 A;  3B78 A;  2UZA A;  3T6B A;  4O3R A;  3CWJ A;  1WTF A;  1O5J A;  1RAJ A;  4XPE A;  3HT0 A;  1TR0 A;  4DMZ A;  2OPS B;  1UPM B;  1NSA A;  5H1S V;  2HGL A;  1OY8 A;  3JAM Y;  1RAA B;  2ROP A;  5GME A;  2QIF A;  1GX6 A;  2BMB A;  4M5D A;  4WU2 A;  2RDI A;  3S8S A;  3P8B B;  5IT4 A;  1ZYQ A;  1U7L A;  4PUO A;  2BAN A;  4JBC A;  1WC4 A;  4PG8 A;  3SI8 A;  4U7U K;  2UUW A;  1W2I A;  4OV6 A;  3G6Y A;  5DQI A;  2HZC A;  4QQB A;  3HI9 A;  2E29 A;  1P1T A;  3GIR A;  3KLE A;  4P73 A;  4CLL A;  5IFM A;  1PIL A;  2J0W A;  4KV8 A;  3CCJ S;  4R8U A;  3NLC A;  3M30 A;  1S6P A;  3FCW A;  3D5M A;  4EBE A;  5C7P A;  2B9W A;  2BE2 A;  4NXN F;  8ATC B;  4DSL A;  2ATL A;  2OUG A;  4JI7 F;  2A6O A;  2E1A A;  4F36 A;  2FLO A;  5HI7 A;  1Q1K A;  3QGI A;  4TY8 A;  4MYU A;  1AXQ A;  4CLU A;  1VRQ C;  3MCN A;  1XNR J;  1FWK A;  5GAD I;  2GO8 A;  3V6H A;  1WJ9 A;  4I1T A;  3Q0A A;  4KHP J;  3CJQ A;  3ZZP A;  5B0E A;  2PD1 A;  1UJ6 A;  2ZH8 A;  5DET A;  3R27 A;  3D4J A;  3J80 Y;  1KS2 A;  4K50 A;  2CQB A;  4RW7 B;  1HBN A;  1MRO A;  3CCQ S;  2RIL A;  3PW5 A;  1RCX B;  3GWC A;  1EJ7 L;  1FKO A;  3OFE A;  5HAO A;  4LRA A;  2D3O R;  4YR2 A;  2ERR A;  2NXU A;  3TA2 A;  5FDL B;  1SKR A;  5FII A;  4WU3 A;  3UDC A;  1Y5L B;  4EO8 A;  4M5H A;  2BUN A;  2J9D E;  2KG0 A;  2RT3 A;  2VKR A;  1IWA A;  1RHR B;  2YWF A;  1T95 A;  5B08 A;  3UD4 P;  3L7O A;  4JI4 J;  4N76 A;  3NS6 A;  4QIF A;  2X1F A;  3G82 A;  4NX9 A;  2VIC A;  2FY8 A;  3TJ9 A;  1H98 A;  3HHN B;  4HH0 A;  4ANE A;  1D9D A;  3V5R A;  5C25 A;  5KG4 A;  3M8W A;  4BWM A;  4DV1 J;  4E0D A;  1J27 A;  2GAH C;  2X3G A;  4PQU A;  1S9G A;  2ZUA A;  1SQG A;  3EDQ B;  2MYF A;  4M94 A;  1MNE A;  1DAX A;  2YNF B;  4NWB A;  4RW6 B;  3OL8 A;  3HO1 A;  3HX9 A;  4OX9 F;  2L08 A;  2DXF A;  1YRT A;  5HLF A;  2E1P A;  1OO0 B;  1NRK A;  4TU9 A;  1RAC B;  4I56 A;  2KRR A;  3L09 A;  2AJ1 A;  2CJY B;  4IOC Q;  2AGO A;  1LOU A;  3T1H F;  5ETQ A;  2L9N A;  3MEC B;  3Q83 A;  1UVM A;  1LXJ A;  3VWS A;  2HFU A;  3A3N B;  3O8W A;  1OQ6 A;  2Y0B B;  4NLG A;  2H5J B;  3GJR B;  5CD4 A;  2B0G A;  3EZO A;  4U8Y A;  2JVO A;  3IWN C;  3N9U C;  3X1L B;  2FD2 A;  2WVF A;  4HI1 A;  1ZTT A;  1RHM B;  1ELO A;  4Q45 A;  2BR0 A;  2GQQ A;  2ZWP A;  1F5C A;  2W4P A;  1YSJ A;  3QAU A;  3TQE A;  2GVZ B;  4HAC B;  4ILR A;  4ZVP B;  4U96 A;  1HNW J;  4DR7 J;  1RP5 A;  4OI1 A;  4C0O C;  3O2I A;  2AMC B;  2I8E A;  1NPR A;  2YX4 A;  3CDW A;  4CM0 A;  2Z30 B;  4C2M A;  5KT7 A;  1PKU A;  2OTL S;  6AT1 B;  3KG0 A;  4LSN B;  1DY3 A;  5LJ5 Y;  3IP0 A;  2N82 B;  2DT9 A;  2HG4 A;  3HVT A;  4V19 X;  2UUA J;  3BGL A;  1X5O A;  1VIS A;  1UAW A;  3FZ2 A;  4UOC A;  3H4B A;  1RKJ A;  5LMU J;  4F0K A;  1IQZ A;  4FVC A;  1KP6 A;  2GCF A;  1XR7 A;  1W2B R;  1NHV A;  2BX6 A;  1HQU B;  1N0U A;  2WBR A;  2ROE A;  4DR1 J;  1RTZ A;  5HQL A;  4NCA A;  2MLZ A;  1OWX A;  4NLT A;  4OX6 A;  2DHA A;  3OXL A;  2B4U A;  1OJ4 A;  1WEL A;  2ZH6 A;  4Q0B B;  1UMJ A;  3W60 A;  3CJR A;  2UXB F;  3LP1 A;  1JLE B;  1F3V A;  2FVQ A;  2YKQ A;  2HAF A;  2ZNY A;  3BV8 A;  2C2Z B;  3JSY A;  3S1T A;  1AUD A;  4WE1 B;  3E51 A;  2ZOM A;  3CPW R;  4ED2 A;  4GKK F;  5EN1 A;  4F50 A;  1RT6 B;  5B7W A;  4J9N A;  1U8S A;  3AD9 C;  5J2M A;  1TAU A;  1VJW A;  1HAR A;  4DV2 J;  2DIT A;  3CCL S;  4P10 A;  3ENW A;  3MGJ A;  1JX4 A;  3H4D A;  5FD1 A;  3DOL A;  4LFC J;  4K4W A;  3R2D J;  2EBE A;  3KK1 B;  2HK3 A;  4DX8 H;  3Q2S C;  4DR6 F;  2DNR A;  2ZM6 F;  4HTJ A;  4ICL A;  4DV3 F;  4WK3 A;  4DR4 J;  3MM8 A;  1CJT A;  4K4S A;  3KLG A;  2VOO A;  2XMT A;  2MQO A;  2BJ3 A;  1TKX A;  2XLI A;  1GEH A;  1U48 A;  1V5V A;  4U7U D;  3SCI E;  1T8E A;  5J1N A;  1HWK A;  5F9L A;  1F9H A;  2FZK B;  2RQM A;  3NY0 A;  3SV3 A;  1R3N A;  1HPZ A;  4ECR A;  3OLB A;  5J1E A;  2AU0 A;  4MTP A;  1EAR A;  4LVO P;  5E3A A;  4FZV A;  1UL3 A;  2RE1 A;  2ZFH A;  3ZTO A;  4FYY B;  3A1Y G;  5SUH A;  1WOS A;  4MMO A;  2GMJ A;  3T1Y J;  2QX0 A;  1YJU A;  1HNZ J;  1XC9 A;  3A13 A;  4NLO A;  2BJE A;  1HNI B;  4KB7 A;  2IVF B;  1FK9 B;  3MR7 A;  2MZS A;  3WHI A;  1TKZ A;  2KI2 A;  4B9M A;  4WYW A;  1WHX A;  2E9R X;  2RIJ A;  3TUZ C;  2IM2 A;  1YWX A;  4RL1 A;  5T7L A;  3THT A;  2NXE A;  2WB4 A;  1N36 J;  3W65 A;  2G1H A;  3JAM U;  1DLO B;  2ZJQ Q;  2OEJ A;  1M1G A;  4CP5 A;  1RDR A;  1FCA A;  2FGC A;  3I4P A;  4Q7A A;  1GXT A;  3CCT A;  2W9C B;  2FGO A;  3H5U A;  2QN6 B;  4OZ5 A;  4N7T A;  2QSF A;  3HVA A;  3NAH A;  3QRR A;  1PBU A;  3PKM A;  4L3N A;  3EE3 A;  2VUG A;  1ZM4 A;  2GMH A;  2FHM A;  2YKA A;  3PR4 A;  1HHS A;  4NMX A;  4L76 A;  4PXD A;  1SH2 A;  4TYA A;  5AE2 A;  4DJB A;  4LF5 F;  3OVB A;  3M32 A;  1RU2 A;  1HI1 A;  3ZNU A;  2C2D A;  2HHH F;  4ZP9 A;  1TL4 A;  3MM6 A;  4ES3 A;  2CFX A;  3RTV A;  3WQP A;  3PHT A;  4DZD A;  1F9F A;  1NDL A;  1U2F A;  5DS7 A;  1JJ2 R;  1QTM A;  2FY1 A;  2Y8Y A;  2DNZ A;  3GII A;  2B9X A;  2XO7 A;  1HNV A;  5F0W A;  4DS4 A;  4C8Z A;  3H40 A;  2XB2 D;  4MK7 A;  1HD1 A;  1KRP A;  1FA0 A;  2EFV A;  3BYR A;  1IKY A;  2XLK A;  2WAQ D;  1BQM B;  1RYS A;  2QMW A;  4GRS A;  3DRP A;  3I55 S;  5A76 A;  2A2D A;  1N34 F;  4M5L A;  3JS9 A;  3LAK A;  2OPR B;  1VC0 A;  3J80 U;  1JLG A;  1FT8 A;  3U1N A;  4I2Q B;  1HYS B;  1Q7L B;  4LRF A;  4WFN Q;  5D0E A;  4ZJL A;  3KUH A;  2J7W A;  4LR8 A;  4B3R J;  4USH A;  3R9L A;  5KFX A;  4FYW B;  1WHY A;  2HZV A;  4OI6 A;  4OHX A;  4NI2 A;  4LR7 A;  2HVE A;  3D28 A;  3T5J A;  4R25 A;  1D3W A;  2H4W B;  1ITP A;  1JLB B;  3TYT A;  1S9F A;  2J6U A;  2Z2M A;  4KSE B;  2W7P A;  1Q16 B;  2HKE A;  2ACY A;  1U25 A;  4OYO A;  1XMO J;  3ETM A;  1NHK L;  2XHW A;  3EVW A;  5D78 A;  4NA2 A;  2VC1 A;  1QJH A;  5C42 B;  4NLW A;  1HR0 J;  1REG X;  2MKS A;  5EWF A;  4M5N A;  3RBD A;  1Q4R A;  2E1R A;  1C0T A;  1NND A;  2YXL A;  1ZH5 A;  4RUC A;  3CJ3 A;  2OIH A;  2WBM A;  4G65 A;  2ALZ A;  5KFQ A;  1S6Q B;  4DPU A;  2HYI B;  3OTO F;  2GGP A;  4AUK A;  4NOH A;  3IR6 B;  1UFW A;  2VZ9 A;  4GVB A;  4B3M J;  4J37 A;  1S72 S;  3MD3 A;  2HLT A;  2DIV A;  2ATC B;  4P52 A;  2BXJ A;  2QV6 A;  4NLU A;  4N77 A;  3LTO A;  3MTK A;  2ZZN A;  2FYX A;  2IA6 A;  3UDV A;  1LEO A;  5J2Q A;  5FJ4 A;  3BH6 B;  4ED8 A;  4QWB A;  3PRV A;  1N5Y A;  3B82 A;  3KOA A;  4MT1 A;  4B9T A;  2ABY A;  4N5S A;  4B3O B;  2FHO B;  1Y00 A;  1OQ3 A;  4F8R A;  5A8R B;  1NO8 A;  4U9R A;  1PJ7 A;  1Y11 A;  3PR5 B;  2OPS A;  2DGO A;  1UVI A;  2IVM A;  3NGK A;  3P45 B;  3SZ2 A;  3HCX A;  2M8D B;  1FEH A;  2E9T A;  2KFN A;  3MD1 A;  3K89 A;  3W2V B;  3HHD A;  3M6V A;  4QIG A;  1LW0 B;  1S1W A;  4LRC A;  1TL1 A;  4URS A;  1SVD A;  1QM9 A;  4DXL A;  3ITH A;  2EC0 A;  1ZTW A;  4GMK A;  4ZVF A;  3W5Z A;  3MAA B;  1SKS A;  2DNO A;  2XMA A;  1T05 A;  5KG0 A;  3RR7 A;  4USI A;  1UWA A;  1RTJ B;  2AYG A;  1Y5I B;  1HWJ A;  5ETS A;  3OFG A;  1TUV A;  4YB6 A;  2OO4 A;  2LQJ A;  2E5I A;  1GH8 A;  5BJR A;  3PV8 A;  3FEX B;  1MSW D;  4OHV A;  2RF2 B;  2JNJ A;  4OHZ A;  1DAR A;  2D9O A;  1V9O A;  4DF8 A;  2QC3 A;  5KAK A;  4KH1 B;  4KE5 A;  4Q2L A;  1FXL A;  3SSS A;  3TUI C;  3KG4 A;  4J90 A;  1FES A;  3J7A 1;  3BO4 A;  4HI2 A;  3QLH A;  4L74 A;  2IM3 A;  4L72 B;  4M5G A;  4YB7 A;  2FC9 A;  2B7B B;  4D3H A;  2YNG A;  4C48 A;  2LA6 A;  4DV7 J;  3UFC X;  1JKH A;  1N6Q A;  4XO0 A;  2V8D A;  2PI4 A;  3KHH A;  2XMJ A;  4IOB A;  3M4X A;  2H1Y A;  2F1F A;  2V34 A;  4K4Y A;  1RWX B;  2HQI A;  1WOR A;  2VQF F;  2ZH1 A;  1RE1 B;  4OYM A;  3VAG A;  2OML A;  1YJV A;  3M8P B;  2ZD1 A;  4PRF A;  2BRL A;  1R8H A;  2FJE B;  4RNN A;  2CQ4 A;  4EYH B;  2LQ9 A;  4LR9 A;  4W4M A;  3SBM A;  4RW7 A;  1VQ8 S;  2BAC A;  2JLG A;  1EP4 B;  3I0S B;  4O0N A;  1K1Q A;  1UVL A;  2YQ0 A;  1IKV A;  1UFK A;  5M2U A;  1IKX B;  1PC5 A;  1B0V A;  2NXN A;  2VB6 A;  2WSF C;  1R8C A;  4ZPA A;  2MDA A;  2HVZ A;  2RQC A;  4EBC A;  1U0S A;  3AXM A;  1FXR A;  5THW A;  2GJ2 A;  3PO4 A;  2ZEJ A;  2CJA A;  5DG9 A;  2VDH A;  3N79 A;  4PAA A;  3D6M B;  4ZVU B;  3MEG A;  2HNY A;  2XY7 A;  4DR3 F;  2UUB J;  1SL0 A;  1SC4 B;  3S01 A;  1K1S A;  4OI2 A;  1SQE A;  2XNQ A;  2FPH X;  2C3O A;  1RTH B;  4EZ6 A;  2CJX B;  4DN0 A;  3G8T A;  3LPY A;  2XC9 A;  2XUL A;  1FRM A;  2C22 A;  3HKZ D;  1EKR A;  3I5A A;  1U2C A;  4I2P B;  1RT7 B;  2L41 A;  3BS9 A;  2CKW A;  3MDF A;  2YNF A;  1ZBT A;  3QFH A;  1PYT A;  4DV5 F;  1WF0 A;  1KOH A;  2ZOF A;  3RW7 A;  4K2X A;  4UQG A;  1S77 D;  2SXL A;  4MFB B;  2RVJ A;  4WZQ A;  3KFW X;  3QBC A;  2UVW A;  4NLR A;  4GKJ J;  4PWD A;  5KFA A;  5KG6 A;  4EU0 A;  4ED0 A;  5SZT A;  1KR4 A;  1R0A A;  2M0G B;  1YI2 S;  1HWL A;  4DL5 A;  5J2N B;  2CJK A;  3FRY A;  3K57 A;  2I2Y A;  3M8Q B;  4MKV A;  3C15 B;  4I69 A;  5LSL A;  2YWG A;  4LF4 F;  3EWG A;  1S0N A;  2IVY A;  3NP5 A;  4C8O A;  2CPE A;  4YS2 A;  2IA0 A;  1L3V A;  2BJ8 A;  2CAJ A;  3V81 B;  3FDS A;  1KC8 T;  2HND B;  3C6T A;  3NNH A;  3MCO A;  2RNE A;  1GXL A;  1PAU B;  4OYI A;  5I3U B;  2W9A A;  4H54 A;  2H4Y B;  4IKA A;  2HUR A;  2N4C A;  2CPX A;  4X4Q A;  2J7K A;  2P9G A;  3W9J A;  3D6F B;  1Q78 A;  4MIB A;  1NSK L;  4HAC A;  5GAG U;  2IJF A;  3LPE A;  4X4U A;  3IFE A;  4RW4 B;  1WUU A;  2GC8 A;  3C14 B;  3FKB A;  2IC3 A;  2WVD A;  4F4X A;  2HPU A;  3BB5 A;  4H4O B;  4AYB D;  1Q5Y A;  4ELT A;  1S4F A;  1QUP A;  1U24 A;  2ASY A;  4LSN A;  2UXD F;  4O0I A;  3POT B;  1JNR B;  4CO4 A;  4RW8 B;  2GV1 A;  2LVW A;  3D68 A;  2MJN A;  4A8F A;  1WG5 A;  2I38 A;  1UVK A;  1PCA A;  1HBM A;  3UVJ B;  3B8H A;  1LFP A;  4DLE A;  5E2Q A;  3CXC R;  4FF2 A;  2JH3 A;  1I51 B;  1HQU A;  4YQW A;  4O3P A;  5KFM A;  2KZZ A;  4KHP F;  3AY0 A;  2CJ9 A;  3M9M B;  1JLF A;  4NPO A;  2PMH A;  3OBI A;  1DUR A;  2DXE A;  2KO1 A;  2GVD A;  3CD7 A;  3M6W A;  2HHP A;  3D3B J;  1JLE A;  4XTT A;  3AAW B;  1H7X A;  2X7I A;  1J5O B;  1JB0 C;  2NR0 A;  2CNN B;  1M5P C;  2H3E B;  1RT6 A;  4HT5 A;  3MMB B;  1TL5 A;  4DV0 J;  4BCA A;  1RGV A;  3CW2 C;  4CH1 A;  2BW7 A;  3DHX A;  5L9X A;  1K0T A;  1AB8 A;  5LM7 E;  4P71 A;  4L6V 3;  1KNZ A;  3CJ4 A;  2H5I B;  4HHJ A;  3UPF A;  1RBA A;  3E2E A;  2HEK A;  4NZ0 A;  1UKU A;  2XMV A;  3B4M A;  1CJU B;  2WB1 D;  3JB9 k;  4JI0 F;  1VIX A;  4RKU C;  3KK1 A;  4A48 A;  2VA3 A;  2YY3 A;  4JI4 F;  2HBR B;  3B4D A;  1M0S A;  3M8S A;  2IMO A;  3W8P A;  2GIF A;  4F4W A;  2OEL A;  2J76 E;  1RIS A;  4QPX A;  2ADB A;  2CQI A;  2W8L A;  5EDW A;  1TQL A;  3UDL A;  2CPD A;  3NBP B;  5BYS A;  4KHM A;  3FSX A;  3IWL A;  3WDO A;  1X5S A;  1KSP A;  1B99 A;  4DFP A;  4JI8 F;  2XQC A;  3G6X A;  2HFN A;  2POK A;  3OTC A;  3N4W A;  2I5J A;  3GV5 B;  3H7H B;  5CCM A;  2E7V A;  3QJJ A;  1F0X A;  2HW3 A;  1FFW B;  4IRC A;  2DXD A;  2XMK A;  4O23 A;  4RLE A;  1TL7 A;  2IIH A;  1SL2 A;  4KTQ A;  5A0Y B;  1JLA B;  2N7Y A;  3TNV A;  4U7C A;  2V4R A;  2KZM A;  2XO6 A;  1DQA A;  3KHG A;  4W92 B;  2CQG A;  2YBV A;  4PXE A;  5HAN A;  3MAH A;  5D0G A;  3JYT B;  2BDP A;  1I94 J;  2A2C A;  1RTD B;  2CNL B;  2VV5 A;  5AXN A;  1LQ9 A;  4F7V A;  2DO4 A;  1NUE A;  3H42 A;  4M5J A;  4TVA B;  4DCJ B;  1KLM B;  2YQ1 A;  4F02 A;  3TO8 A;  2C3M A;  2XY5 A;  2A3J A;  1HKA A;  3PM9 A;  3BKU A;  5HL7 Q;  2W9C A;  1S7H A;  5AXL A;  3CDB A;  1N8R T;  4WP9 A;  3L9Z A;  3I87 A;  2GX8 A;  1IXK A;  2MKY A;  3K17 A;  1MWZ A;  1N52 B;  5ETO A;  3KG1 A;  3KHL A;  2KN4 A;  3E8O A;  2Y1J A;  1IM6 A;  5IZH A;  2IM1 A;  4DQR A;  2MEW A;  3UN5 A;  2DGW A;  5KFG A;  2HHQ A;  3TVK A;  5HMZ A;  5JUM A;  2HBY B;  3BGR B;  1CLF A;  4KYZ A;  3I0R B;  2UUA F;  2MQN A;  3J81 Y;  3QGG A;  2QE5 A;  3WX8 A;  2AKW B;  3QZ7 A;  1O8B A;  1VQ5 S;  5HN0 A;  1VQS A;  2CQ3 A;  3QGH A;  2WVE A;  1XQI A;  5KG3 A;  4TLR A;  4AQY J;  4CIO A;  4X66 F;  2WW8 A;  3C19 A;  4EMD A;  3DLG B;  3K8V A;  3CE8 A;  2BJ7 A;  2MLY A;  2ZBQ A;  3QQC D;  4ZP8 A;  4IRK A;  4Q44 A;  4DPT A;  2AZ3 A;  1BXN A;  4JI3 J;  5B0D A;  3R5J B;  4OFZ A;  4FBU A;  2BKP A;  2LMI A;  3NCR A;  4ECU A;  2KH9 A;  1IM4 A;  2R7R A;  1FO1 A;  2OPR A;  3SCJ E;  3EIC A;  3BRE A;  2EEY A;  5C24 A;  2JC1 A;  1MWQ A;  2HHS A;  4A8Y A;  3UW1 A;  1VBX A;  1RAI B;  4KHR A;  1QY7 A;  4X2B A;  4DU8 A;  4HYK A;  3QT6 A;  2YVS A;  3ISZ A;  2ZE2 A;  2R7V A;  4XPC A;  2FVP A;  4C8L A;  1GFW B;  1NLK L;  2MKK A;  2DIS A;  1EQ0 A;  3EPG A;  3PIP Q;  1YTY A;  4U6P A;  4NZ7 A;  2A6M A;  1RA7 A;  2UVR A;  1SJF A;  1BWE A;  1MWY A;  2WRM A;  3BSA A;  4X64 F;  2F40 A;  3GCW P;  4LFB J;  3TVZ A;  1CJK B;  4NLD A;  2RH3 A;  1ZS6 A;  5C42 A;  3UNG C;  1IBK J;  4RBV A;  1ZPW X;  4O3N A;  4G1Q A;  3UE2 A;  5ETR A;  4XK8 C;  3IBW A;  1IBL J;  2Y1R I;  3N5F A;  1C4C A;  5G4D A;  2K06 A;  1PIE A;  5U47 A;  4BHQ A;  3DGP B;  1S6Q A;  1RWV B;  2J8S A;  1XMQ J;  1ZPV A;  2MJU A;  5KG1 A;  2KHD A;  4ZPD A;  2HMI B;  2PC6 A;  3K5M A;  2DHS A;  2I9S A;  2CNO B;  2R3V A;  1R43 A;  1YX2 A;  3OHB A;  1XBW A;  2PDA A;  3DOK B;  1S6U A;  2G0I A;  2EFG A;  1Y5N B;  1YK9 A;  5L46 A;  1VQ7 S;  4EWT A;  5JVG Q;  1RT5 B;  4CH0 S;  2ZUG A;  4ZDN A;  4PR6 A;  2E1M C;  4JI5 J;  3M1V B;  3IO1 A;  4DFM A;  4M1K A;  4M5D B;  1VK3 A;  3ULH A;  2WOM A;  5A2Q Y;  3UR3 C;  3PTW A;  3J7Y U;  5A8R A;  2F8H A;  3ZTS A;  1GXU A;  4B9U A;  4ETX A;  4V19 J;  2LU1 A;  1Q0N A;  3HP6 A;  4C8Y A;  4PUO B;  1D8Y A;  4ECS A;  2QLB B;  5F3T A;  1S5Z A;  4LF6 J;  3U7J A;  4Y34 A;  4QWE A;  3W2V A;  5KFN A;  1N32 F;  1G4C A;  3KHR A;  3NCP A;  1LW0 A;  2F5G A;  4DCO B; 
#chains in the Genus database with same CATH homology
 4OYI A;  1AZS B;  4WP3 A;  3UVJ A;  1AZS A;  4USU A;  4OYA A;  3C15 A;  4CLY A;  4OYM A;  3MAA B;  1YBU A;  1WC4 A;  3MAA A;  2GVD A;  4WP9 A;  4NI2 B;  1WC0 A;  4CLF A;  1U0H B;  1CUL B;  4CLW A;  4UST A;  2GVZ B;  5IV4 A;  1TL7 A;  1FX4 A;  4WPA A;  4CLL A;  4OYZ A;  5D0E A;  2QV6 A;  1CJV B;  2BW7 A;  1TL7 B;  4CM0 A;  1CJV A;  3C14 B;  1AB8 A;  1YK9 A;  4NI2 A;  1YBT A;  4CM2 A;  1CJT B;  1Y10 A;  1U0H A;  1WC6 A;  4P2X A;  1CUL A;  3MR7 A;  2GVZ A;  4USV A;  4P2M A;  1WC3 A;  1CJU B;  3ET6 B;  4CLT A;  5D15 A;  3R5G A;  5D0G A;  4CLZ A;  5D0R A;  4CLK A;  4P2F A;  1CS4 B;  3C14 A;  1Y11 A;  4OYW A;  1CS4 A;  4OYO A;  4OZ2 A;  4OZ3 A;  5IV3 A;  4OYP A;  1CJT A;  4WP8 A;  4OYX A;  3UVJ B;  1CJK B;  4OYB A;  3C15 B;  1CJK A;  2W01 A;  4CLP A;  3C16 B;  2GVD B;  5D0H A;  4USW A;  3C16 A;  1CJU A;  4CLS A;  3ET6 A;  4CLU A;  1WC1 A;  2WZ1 A;  1WC5 A;  3G82 B;  3G82 A;  1FX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...