5H1SV

Structure of the large subunit of the chloro-ribosome
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
LKYPRRILDVYQILQSPIITEAAIKNIADENSLLFTVDVRADKKMIREAISNFFGVKVRKVNTLIRPDGTKKAYIMLNKEYNASELAKKIGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S rRNA
publication title Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
pubmed doi rcsb
total genus 14
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5h1sV01
3V4MA 2YTCA 5GADU 2FC8A 2F9JA 2KN4A 4ZKAA 2MKIA 2NLWA 5LJ3Y 3CCMS 1CVJA 4F25A 5IM0A 2ZJQQ 1YIJS 3R1HA 2B0GA 2EK6A 1OIAA 2KFYA 5DM7Q 3P6YC 2LCWA 1VC0A 2LA4A 4CH0S 3BO3A 3NS5A 2NZ4A 2F3JA 3VAMA 3ZZYA 3CCES 4WF9Q 3MD1A 1M1KT 1QM9A 2OIHA 4Y0FA 2DGTA 1JJ2R 4TLQA 3UCGA 2E5IA 4WKRA 3MUVP 3MD3A 1Q82T 1DRZA 4ERDA 2CQ3A 4QPTA 3HHNB 2J0SD 1B7FA 2KYXA 1K9MT 3BEGB 3RW7A 1HL6A 3CC7S 2RQ4A 1N54B 2MGZB 2XB2D 1Q7YT 1W2BR 2XNRA 4C0OC 2AD9A 1PGZA 3CXCR 3EGZA 3NNHA 2MQLA 4LJMA 1OWXA 1D8ZA 2WBRA 3CC4S 2M70A 3J7ZT 3CF5Q 2LKZA 2N3LA 1WG4A 1SXLA 2N82B 2JWNA 2JVOA 5DDPC 3NS6A 2G1DA 2L08A 2DO4A 2MQNA 2DH7A 1UP1A 2XS5A 3US5A 2X1AA 2EK1A 3MI7X 1KD1T 1M90T 4F02A 3ZZZA 3CPWR 2M7SA 1HD0A 4EGLA 4PKDB 2CPEA 1UW4A 4CIOA 2HZCA 2N3OA 1RK8A 2DNYA 1R8HA 3CCJS 3N9UC 2MSSA 4M5DB 1JJ4A 5IQQA 2DNKA 1FJEB 2QFJA 2KHCA 1A9NB 2DH9A 2CPHA 3UCUP 2I38A 3LQVA 2KT5A 1SJQA 2DIVA 2QA4S 2CPIA 3DLLQ 1FJ7A 2U1AA 2L9WA 2DNNA 1BY9A 3FEYB 2MQPA 1WF1A 3R27A 2CQ4A 2D9PA 2PE8A 2MZSA 1H2UX 5JVHQ 1VC5A 3I55S 4Z2XA 3CCSS 2VOPA 4W92B 2E44A 2E5HA 2RQCA 3HI9A 1KQSR 1OO0B 1U2FA 3MURP 3S6EA 2DO0A 3NMRA 2XNQA 1S79A 1S72S 1M5KC 2M9KA 1U6FA 2AYEA 1HA1A 2RRBA 1VQPS 1VQ5S 4WFAQ 3CMAS 2CQPA 3VAHA 1SJFA 1U1PA 3G96A 1O0PA 5CXTA 3H2VE 5D78A 1X4GA 3JB9k 1AUDA 4CQ1A 2FY1A 4YOEA 2M88A 2MPUA 2DK2A 2U2FA 3EGNA 3CUNA 4IOAQ 5D77A 1X5OA 2MJUA 3THTA 3MUTP 2MKKA 1U1OA 2DGUA 3SDEA 2KXFA 2DHXA 2ZJPQ 4C4WA 2HGMA 4W90B 2KM8B 2CPDA 3VAFA 2MKSA 1WWHA 2CPJA 2MKHA 1SJRA 2MB0B 2J8AA 3UD4P 1FT8A 1Q86T 1YJ9S 1HD1A 2CQIA 2G0CA 2OTJS 1NU4A 1G2EA 5LXYA 1WI6A 1WG1A 2M8DB 4C7QA 1WHVA 5IFMA 5GAEU 3D2WA 4UY8T 2XS2A 2K8GA 2DNPA 2LECA 1H6KX 1VQ8S 3Q2TC 5LSOA 2DNLA 3ULHA 4ED5A 3H2UB 2RU3A 1U1RA 1X4CA 2MXYA 2DHAA 1A7GE 2MZ1A 1ZZNA 1YITS 2KM8C 4TU7A 2CQCA 1X5SA 3P3DA 5HO4A 2MHNA 1VQLS 2DGQA 1VQMS 1WEZA 1YJNS 5DDOC 1DBDA 2DISA 5LXRA 3VAIA 2A3JA 1D9AA 2UP1A 3MXHP 2GO9A 2MY7A 2D9OA 2JX2A 2Q79A 4OZ1A 2DB1A 3CCQS 1U1NA 5BJRA 2CQ2A 3MUMP 5LSLA 4LIRA 3NNCA 2MZRA 2LQ5A 3VF0B 2G4BA 3CCRS 1XN9A 2BZ2A 4CH1A 5IM0B 1UFWA 1WEYA 1WHXA 2XSFA 2DNZA 2MQQA 1YI2S 1VC6A 2DGXA 3NNAA 2CQGA 4OZ0A 1JMTA 2DHSA 3L3CA 2HVZA 2XS7A 1U1KA 2L41A 1P27B 2DGSA 3S01A 1NJIT 1YWXA 4UQTA 1X4AA 2M0GB 2RUGA 2DNGA 1VQ9S 3CULA 2AYBA 5GAGU 3UCZP 3BS9A 3SXLA 3VAKA 2AYGA 2KRBA 2SXLA 2ERRA 2I2YA 1M5OC 2LYVA 1X0FA 4QQBA 1K73T 1VQKS 2DNHA 1WELA 2MYFA 2DITA 4PR6A 2MQOA 1K8AT 1ZH5A 2VODA 2AYMA 2MY8A 2KVIA 2KXHA 2DNQA 2DGWA 1URNA 2MQMA 3TYTA 2KG1A 3CMES 2CJKA 2OTLS 2LEAA 3TO8A 2MMYA 4IO9Q 2VONA 3SMZA 3IWNC 2DNRA 1VQOS 3CD6S 1DHMA 1X4DA 2DIUA 2DNMA 1N88A 2CQBA 4V19X 2MGZA 1X4BA 4LMZA 2LXIA 1WF0A 2YWKA 1U1LA 1U1MA 4PRFA 5MLCV 3UD3P 1VBXA 3LPYA 2MKJA 2MZJA 3BO2A 2CPYA 4FXWA 1U1QA 1FJCA 1R8PA 1YTYA 3U1MA 3R1LA 2F9DA 5GAHU 3P49B 1X4FA 2FHOB 4F26A 1OPIA 5DM6Q 2CPXA 3OW2R 2LA6A 3S8SA 2OJ3A 3RW6A 2ADCA 2E5JA 2OSQA 2V94A 1N8RT 1P1TA 1UAWA 2EVZA 4YUDA 3CCVS 5EN1A 2FPHX 4WIIA 4P6QA 4WCEQ 3G8SA 2LEBA 1WHYA 1YJWS 2KRRA 2RRAA 3G6ES 2X1GA 5GVQA 2RS2A 2M4MA 1L3KA 3THPA 1VQ4S 1X5TA 2MSTA 2HGNA 5FJ4A 1M5VC 4TU9A 4QU6A 1WTBA 2RS8A 3G71S 2RT3A 2RVJA 3S7RA 3CCLS 2YH1A 4U67Q 2CQ1A 4WFBQ 1QVGR 1DZ5A 2X1FA 3UE2A 3U1LA 1WHWA 1WF2A 5LJ5Y 4WFNQ 2BOPA 2E5GA 2KXNB 4A8XA 2X1BA 4BS2A 2N7CA 5HL7Q 1H2VZ 1VQNS 3SDEB 2HGLA 2O3DA 3G9CA 1WEXA 3CTRA 4IOCQ 3MOJB 1KC8T 5H1SV 3VAGA 3EX7B 2DH8A 3B4DA 3VALA 1SJ4P 5JVGQ 1QVFR 1KOHA 2CPZA 4IUFA 1X4EA 2M8HA 3DXBA 1YHQS 3CC2S 2MJNA 2MZQA 4QU7A 2VOOA 2OSRA 1FHTA 2KU7A 1IQTA 2MKCA 2DNOA 2DHGA 4FXVA 1KOOA 1H2TZ 4YB1P 1X5PA 1JJHA 1PO6A 5ITHA 1WI8A 2DGVA 3PIPQ 5GMKa 1FNXH 1M5PC 2FC9A 2YKAA 5CYJA 1NO8A 2K3KA 3PIOQ 3B4MA 2RNEA 3CCUS 2GHPA 3J7YU 1X4HA 5DDRC 1VQ7S 2PEHA 2KH9A 5DETA 2JVRA 3Q2SC 1FO1A 2ZJRQ 2ADBA 3G8TA 2CPFA 5CA5A 2JRSA 2YH0A 4TU8A 1N52B 1ZZFA 1Q81T 2HYIB 3IRWP 2CQ0A 1U6BA 4Y00A 2CQDA 3UWTA 2D3OR 2DGOA 3I56S 1VBZA 3FEXB 3MDFA 2M2BA 2KI2A 1VBYA 2LXUA 3BO4A 2CQHA 2M52A 2J0QD 1RKJA 4RU2A 2MZTA 1F9FA 3P5TL 3G4SS 3K0JA 2J76E 4J5OA 2QEXS 2LMIA 5DDQC 1WG5A 3TP2A 1FXLA 1SJ3P 3VAJA 2KG0A 1VQ6S
chains in the Genus database with same CATH superfamily
5C2CA 5JMNA 2CXEA 2B9XA 3BB5A 2YNIB 3W9IA 4ZVTB 3K2YA 2ZC4A 3OTEA 2IY5B 3MEDB 2HZVA 3VAMA 1S48A 2IMWP 1RHMB 2GMJA 2V4JA 2J0SD 5GAEI 5A2QY 4GO7X 2XB2D 3SCLE 1BGXT 2MQLA 4A8OA 3PM9A 1T94A 3QZ8A 1D8ZA 4ES2A 5KFWA 3I0RA 4LF2A 2VF3A 1LQ9A 1UP1A 2VBYA 5CYQB 1X0PA 2E66A 3HHLC 4DQSA 1M90T 1NK8A 2WONB 1C0UA 4EGLA 2VUGA 4CIOA 4ZIWA 1RB0A 4Y2IA 1LFWA 3VWSA 2GCFA 2IDLA 3O3LA 2QO3A 1Y5NB 2Z4PA 2QL7B 1HHQA 3JSMB 3BYRA 1PC4A 1H38A 1VR6A 4MT1A 2ROPA 4DU7A 1XQIA 4GKKF 4F50A 4YFUA 1RT5B 2JEFA 1VQPS 3KUEA 1TL4A 4B3SF 3J81U 1UA1A 1KN6A 1PILA 4OI2A 5D78A 1FERA 3CUNA 4M8LA 1D9FA 4IOAQ 4HI2A 4XPEA 2OPQB 1QUVA 4DR7J 1TTHB 1L3SA 2VPZB 2FD2A 2CPJA 1RT7A 1SJRA 3N6MA 4PXBA 3PHEA 3DDKA 5CYQA 4O4GA 3HVAA 4OYPA 3WC0A 2YX4A 3G82B 4ZA1A 2CJAA 2FJXA 1M1GA 4OZ3A 1RWKB 5E3CA 2MHNA 3R6GB 1UPMB 3PHTA 4Q0BA 2OKQA 1WEZA 4KGVB 2VH7A 4KR0B 2MY7A 5J2MB 2WHOA 2MLYA 2XHCA 2G4BA 1JB0C 2G1HA 1EX8A 3D1OA 4OZ0A 3PR5B 1JMTA 2WSCC 1F2HA 3QYYA 2XS7A 3UDVA 3T6JA 2OUGA 3KK2B 3OFGA 2O5DA 1X4AA 4ELUA 3FC9A 1M5OC 2LYVA 4HACA 2YNGB 2DNHA 4PR6A 5KFXA 2QL9B 3I96A 2C2NA 3VGUA 2WK4A 1S1XB 1RT2A 3PYGA 3QQCD 2MMYA 5B0AA 3CD6S 1DHMA 4RW9B 2IJRA 1OY6A 4NI2A 5EX0A 4FXWA 1HQEB 1Z1ZA 4UW2A 1K1QA 4BDPA 1U8WA 2C28A 4ECSA 2V2KA 2R7SA 1T7PA 3OSPA 5DM6Q 1NXIA 2FTRA 2OEMA 1GXUA 1R0AB 4U8YA 2ADCA 2DY9A 3UDEA 1BE4A 1AFJA 1Z2ZA 3C2PA 2ZBPA 4J7CA 2R2SA 4YUDA 2ZZMA 3OLAA 3DU6A 2EG2A 1S9GA 2OHDA 5I4MA 1UKUA 1UETA 4LFBF 2CWKA 1GK8A 4TU9A 2ZH6A 4K4UA 2Y0BB 2FJVA 2YH1A 3HK2A 4DR5F 2APOA 1QVGR 5KT4A 2YKMA 1YQHA 5HBMA 1VQNS 2O3DA 3DKDA 1IBMF 3QJLA 2KDOA 3OR1B 4ZHRA 3M30B 3DFEA 4DV6J 1U02A 4DS4A 3PJ9A 5JVGQ 1OYDA 4LF6J 3LGNA 2KT3A 3M8YA 2M8HA 1YHQS 2H3EB 2A1BA 2EEYA 4YN3B 4YB1P 1WI8A 1QY7A 4LR9A 1SKWA 2GIRA 2Y8WA 3B4MA 3FJ2A 2VC0A 1AZSA 1X4HA 3BDEA 4KKOB 3D0GE 4TYAA 2A2CA 2VA2A 2CPFA 5ETKA 2Q43A 5KT7A 4DSJA 2RDIA 3N5BA 4LRCA 4PXCA 4KH1B 3OV7A 4FYWB 2DD8S 2QLXA 4B9TA 1PYSB 5LOQA 1NHVA 2MZTA 4ANCA 1T9VA 1WG5A 4DBQA 3TZZA 2G0IA 2CAJA 3CCMS 4M5LA 1PCAA 5I42A 2R7UA 5DM7Q 3BGRB 3EXYA 3MR7A 2NZ4A 5GMDA 1LWEB 2DHHA 4OFZA 4I4BA 1JJ2R 3DRSB 3FK4A 3CMQA 3UCGA 1FFSB 3MFIA 1KQKA 3OVAA 3M9MB 1SL1A 2LU1A 1KWMA 3HT3A 2YWHA 3R7NB 4JI1F 1IM4A 1PGZA 3EZ5A 1DTTA 3DLBA 2N82B 4F8RA 2JVOA 5B0GA 1IR1A 2X1AA 2EK1A 4KGMA 3ZZZA 2OI2A 3TWZA 4A8FA 4GKKJ 2LFVA 4I6YA 1VMBA 3I0SA 3TANA 4B3SJ 3KK1B 1S77D 3GONA 3LP2A 2QFJA 2QIFA 4MIWA 2CPHA 2E5LF 2I38A 3NXZA 2ZD1A 3QIPB 1FRIA 4XO0A 2XCAA 1UVNA 2MQPA 2PSZA 3TAMB 3HT0A 4USTA 3KK3A 4Z2XA 1VHIA 4YR2A 3MURP 2DO0A 4J91A 4XPCA 1VQ5S 2V8HA 2L9NA 4P10A 1XC9A 3D0HE 5CXTA 2XYGB 3H2VE 2RKIA 1Y3JA 2A18A 4I2QA 1RADB 3KHHA 1S9EA 5KFCA 2B9YA 2DHXA 1EETB 1NEEA 4ECUA 2MB0B 5KFZA 3I87A 2FJWA 2JLGA 4ZK7M 3KJVA 2R8JA 3C3LA 1WSVA 2D3UA 4UY8T 1XNQF 5HJYA 3ETMA 5HP1A 5A6PA 1F60B 2PC6A 2IJNA 2B4OA 3TX0A 4KO0B 4ZJOA 4DSEA 3W5ZA 3JTPA 3Q8UA 3M32A 1U2RA 1NK5A 1TL5A 3IXQA 1IBKF 1FWKA 3QO9B 2Q79A 2FDNA 1BD6A 1TV6A 3P96A 2HIYA 2P9CA 1N5YB 3W5XA 4DV7F 4DSFA 2W8KA 2DHSA 2GQCA 2IRYA 1YJTA 2Z2LA 1OSCA 3BN7A 3CULA 2Q66A 2OPRB 2YNHB 4LREA 4ZN3A 3BSCA 2KRBA 1MWZA 1FK9A 3H90A 1T05B 5ETPA 1HPZA 1NMEB 1QD1A 4Y3CA 2MY8A 3HX9A 1IKVA 5A76A 2MQMA 2XSJA 4LQ9A 1FDBA 3CDBA 3OL7A 1V3SA 3HCXA 2GIFA 1DLOB 1HBUA 1C1BB 3QFHA 3LALA 2XMTA 1N88A 3M1VA 4LFBJ 4O3NA 1R6YA 4RBVA 2LXIA 1XJWB 1U1LA 4Y2KA 4PRFA 3N28A 1TL7A 4ECYA 3RB6A 3ENWA 3M6WA 4CI0B 4DR5J 4F4ZA 4B3TF 5ETTA 4EZ6A 3PFEA 3DDIA 4G6VB 4RNOA 4BWMA 1GX5A 2OP5A 5IS2A 5DQIA 1IBMJ 5HMWA 2EVZA 2BJEA 3K7RA 4RBTA 1IVZA 1RLCL 2B43A 3MMAB 4I1TA 4GC6A 2X1FA 3U1LA 3ET6B 2YWWA 1NPRA 1JLBB 1H2VZ 2VBWA 3G9CA 2CJYB 4CM0A 2GJIA 2W01A 8ATCB 4B9MA 5KAKA 3CT9A 4QU7A 4OLOA 1KOOA 5K8OA 2EBGA 1X5PA 1PYOB 5KG1A 2V69A 5CYJA 1RABB 1KR4A 4ANDA 1J27A 3DRPB 4E8UA 3W63A 1FO1A 1TKDA 3FCVA 3BQ0A 3LAMA 4PWDA 4CNYA 5D0GA 2R4FA 2BE2B 2XMUA 4CT8A 1MU2A 4DDFA 4X62F 3AOAA 4XK8C 4Q7AA 4ECVA 5E41A 4ZCLA 1N34J 4IQXA 4U7CA 2I5JA 2GC8A 3AD8C 4LF7J 2CZ4A 4ID5B 1JLAA 4NZ7A 4NA1A 3ZNUA 5GADU 3KNAA 1ELOA 2ZOMA 3KLEB 4JI1J 2ZUAA 3RRGA 3EMTA 1Q79A 2VG5A 4LT6A 1FTRA 1UVMA 4CLPA 3ZZYA 3JAMU 2WVEA 4KHRA 2DGTA 2ZHAA 4AT1B 5DO2A 3HHNB 4IQMA 4KQZA 1NPKA 2GGPA 3LA0A 5LMUF 3KDOA 3BEGB 2C2EA 3ILJA 2E5LJ 4O3OA 4CYUA 3CXCR 2WOMA 2FUG9 1WUUA 2WBRA 4NLTA 3NS6A 4LF1A 3FBEA 6FD1A 1RT6A 4KV8A 2ZNZA 4RWXA 2ZEJA 3DU5A 3OL8A 2R7TA 1KRPA 1FTCA 3UCUP 2LDYA 5KFLA 2DPJA 4CLTA 1L3VA 4B9NA 4FS2A 3NGSA 2UUBF 3CSKA 2RDDA 1UEUA 1DTQA 2QLBB 4R5PB 3GZ7A 1KQSR 3S6EA 4WKYA 4WK1A 5RUBA 1Y5IB 2OMOA 4IYQA 1VRTB 2NXJA 1XNQJ 3CJ5A 1HQUA 3GSDA 4EZ9A 1SJFA 3HHLA 4ECZA 4M5MA 3WZ0A 2FY1A 3OFFA 4PQUB 1O5JA 1HWIA 1S76D 3QZ7A 4CNZA 2MKSA 1WWHA 2XMJA 2MKHA 1IBKJ 4C98A 5KFIA 2KZMA 4C0BA 3RRHA 4K5SA 2VG7A 3U1NA 3K8WA 1FI4A 3MM9B 3BH6B 3R3TA 4DV7J 4IRCA 1PJ6A 3CIMA 3GIKA 4WK3A 2AJ4A 2QL5B 3R9LA 3KLVA 3M9NB 1P6TA 2LQ8A 4OLPA 1FNMA 1D9AA 2BDPA 2EW9A 1Y9OA 4LIRA 4KGKA 2E9RX 2LQ5A 4JI8F 5L38A 3MM6A 2W9AA 3ZFVA 3OVBA 2GAGC 2BZ2A 2HBYB 1Q95G 4RW8A 1K44A 3A13A 4WU3A 3WX4A 4TY8B 1XMBA 3CJRA 5EWEA 2W9CB 2OD6A 3OVSA 1UPPA 2FHKA 4MH8A 5KT6A 3SXLA 3TJAA 5CAAA 3HF5A 2C3UA 2AIRB 4QQBA 4PG4A 1HHSA 1AB8A 4P73A 3FEZA 1DARA 2HVDA 4JI4F 2EFOA 4B3TJ 4ZVPB 3FZBA 3PKYA 2NR0A 2OTLS 2JC1A 3WQPA 2V2VA 1GX6A 1X9MA 2VV5A 2JL9A 2DR8A 2YWKA 4FF3A 4KTQA 1RBOB 1RAOA 5B08A 2VJVA 3BDPA 1NCLA 5IT9U 3H98A 3V6DA 4AQYF 2HRUA 2EXUA 1PBUA 3CJQA 3S1TA 4ECXA 1NK0A 1VIXA 2CPXA 1YSJA 2E5JA 1RAIB 1QAYA 4ZVOB 3GFHA 1RCOB 4NYPA 3PNIA 1KHVA 1TMJA 4NLPA 5IXUA 2X1GA 3C15B 1IXKA 4AYBD 1UEKA 2D3O1 3OR2A 3AD9C 2VB6A 4NA2A 2E7VA 2MKYA 2AWZA 3DM2A 4MIAA 2UVWA 3MM7B 3A1YG 1U0HA 4M1KA 2QFIA 5C42B 3RYLA 2IYIA 3W9JA 5FLXU 2DJWA 1I1GA 1DFDA 3B54A 2XM3A 4OX6A 4O44B 1NSKL 2HMIB 1UJ6A 2HWHA 1X4EA 4NLQA 2R42A 2DNOA 4X62J 3HKWA 5ITHA 3HFKA 3D3BJ 1R6VA 3N79A 2DGVA 4ZVUB 5GMKa 3HM9A 2ZVIA 1F9HA 3EVWA 1F5CA 4PABA 1KSPA 1URRA 4TLRA 3G8TA 1AYEA 3BGLA 3M2UB 4PXEA 1W7WA 4QYZK 2VQEF 3Q89A 5A8WB 4Y2AA 1VIOA 2W4DA 5AXLA 1NSAA 2VFTA 2A10A 3K0JA 1VYAA 1I3OB 2CKWA 3BKTA 2KG0A 5LMUJ 3LTOA 1HYSA 2AT1B 5HAOA 2WSEC 1CVJA 2ZJQQ 2E7XA 2A6MA 3TQ1A 3DRYA 1HBMB 4YB5A 4C11B 2AGPA 1FD8A 5C25A 5KFPA 2QYGA 1TVRA 4WKRA 4HHHA 1FF2A 3W2WB 1LW2B 4C6AA 1S6QA 1HL6A 4ZVEA 1BC6A 3FMWA 1NH8A 5IC6B 3OFEA 2UUBJ 5H9FK 2OD4A 1PC5A 1S1TA 3LWMA 1TAQA 4U9RA 3LH2S 2UUWA 1G3OA 3MAAB 3ZZRA 4H4OA 3IR6B 3PEHA 1PJ7A 2V8VA 3H40A 1AT1B 1HNXF 3FBCA 2YQ3A 3KWMA 3NY0A 3FCHA 5KTQA 2XMWA 5FD1A 1RTIA 2W7OA 3AJ2A 5JVHQ 2J9DA 1CULB 3MMBB 2B6AA 3W2VA 4DX5A 2RQCA 3BKUA 1IKXB 1WKKA 1SKUB 1VDHA 2XNQA 1NHUA 2R7XA 1KLMA 3W8PA 2HAFA 3OHBA 3NAHA 3AB2B 3EGNA 3THTA 2J7WA 3MUTP 3PVXA 1G7CB 4I64A 3VAFA 2J8AA 3UD4P 2EKNA 4DL6A 1QJHA 3D2WA 1NHKL 4C7QA 3I9V9 4CP5A 3SFGA 2F65A 3MPVA 3H2UB 5C5JA 2ZDPA 2V67A 1I51B 2XYPB 1FNOA 2HPUA 1RCXB 1VBKA 3W3SA 4PUOA 1UVIA 3T5KA 1VQMS 1R8CA 5DDOC 1B3TA 2DISA 2R9LA 2HQFA 1YVFA 1JLCB 2W2MP 4DU8A 3IS9A 1X9SA 3NNCA 2HBZB 1RTHB 1O51A 4A8WA 3IA0A 4JI4J 1JLQA 4D3HA 1IUJA 1YBAA 4DX8H 4F2RA 3R2CJ 1N6QB 2B4PA 3PJXA 2HNZB 2FVQA 2LVWA 1B99A 3LO3A 3LP0B 2RUGA 3H20A 1PIEA 1BQNA 1ZOTA 4F4WA 2BACA 4I2PB 4MKAA 3B6BA 4K0KF 2OPSB 1ZM9A 2KXHA 4OJ3A 4AQYJ 4NYOA 4DF4A 2Y8YA 4G1IA 1TK8A 1RUSA 1JKHB 3UN5A 1H98A 4LSNA 4IO9Q 3IWXA 2V8DA 2L9DA 7AT1B 1X4DA 3KHRA 1WOOA 2EFGA 5CYMB 3GIJA 1HFEL 1U47A 4B3OA 1YKWA 3DLEB 2XI3A 2HBRB 4FYDA 1FJGF 3EDRB 3ZZ0A 6AT1B 5F8MA 5BR8F 3O6QA 3PW0A 4FXDA 3GCXP 3GJTB 3J80Y 4WIIA 3CD7A 2KRRA 3SEOA 3LP0A 5T41A 4C8LA 3A8JA 5F8NA 5LT5A 3MZIA 1X5TA 4GMKA 3THPA 5FJ4A 2Z56B 3GFYA 4NE9C 2C2ZB 5HLFA 4Q45A 4K4YA 3OJUA 1JK9B 1NK9A 2WVBA 3VQTA 4ZLJA 4X4UA 4RNHA 3PDNA 1XBWA 4WP9A 3M9OB 4C8ZA 3SDEB 3MOJB 2BJ1A 2VQEJ 1NZ8A 2HNDB 2OAUA 2QSFA 4WFXA 5D3GA 3E01B 1EKSA 2FQQB 3DOKB 1SIZA 5CD4H 4PPDA 4DG1B 4C3KA 3J7YU 1H73A 1Q8BA 5E3RA 3P45B 2EI5A 5F9LA 1NRKA 4Z7CA 2ZJRQ 2CFXA 2JRSA 3PRDA 4O3SA 4WTOB 3C19A 4KC5A 2CQ0A 4Y00A 5KFTA 5CZVA 1F9FA 2FIUA 3I82A 3HKZD 3M2RA 4L76A 2YTCA 1ZM2A 3W7BA 2PO4A 4FPIA 4Y28C 4ZDNA 5IOLA 1GMWA 2VBZA 1UEVA 1F5AA 2DR5A 1VC0A 1A0OB 1UVJA 1LW0B 3TX8A 4KB7A 3QMQA 2AJQA 2VZ9A 3RUBL 1OY9A 3PJWA 1VLOA 2L3MA 4LRFA 5A2QU 2GVZB 2AJFE 4OHXA 4NRUA 2HFZA 2I1RA 4EBDA 5HN0A 2WVFA 1VOMA 2B7CB 4DR1F 1QUPA 3UN2A 3MTKA 3MI7X 3U02A 2M7SA 1NUEA 1QE1A 2HFVA 4M5JA 4LSLB 3M2VA 3MEGB 4RL1A 1FJEB 1HIYA 3J7Z5 2W8LA 3AA9A 5HROB 4L72B 1KVJA 2XZTB 4NCGB 2C1EB 2J8SA 4DPYA 3M8QA 3AH6A 2V2QA 2HFOA 3N0VA 1P8GA 2D9PA 2IA0A 5CQGA 2HLTA 3H0PA 5ETQA 1RKIA 4CRJA 1FVQA 3FNNA 3RB4A 5K20B 3CMAS 1H74A 1GEHA 1D9DA 3R5GA 3MWBA 2GMHA 3A3NB 1EQMA 1P9QC 1D09B 4LF8J 2MQ8A 1X5OA 1U1OA 4GVBB 2DTJA 1M5HA 5E7OB 4B3MF 2AF6A 1HBOB 2WZ1A 4J9MA 5CCLA 2HNYA 1S57A 1C1CB 3UR3C 2HS0A 2NXUA 1GMUA 3D68A 2XY6A 1X4CA 4LFAF 4GKJF 2ZE2A 5CH7B 1SQFA 2MZ1A 1AXQA 1GFWB 2DGQA 4QWCA 4AXIA 5HI7A 1U48A 2UP1A 3IMQJ 2JHEA 4QIWD 3M7VA 3CCQS 4LR7A 3IGNA 4NMLA 5SZTA 3JTOA 2HFSA 2DGXA 3MMCB 4LR8A 2YKQA 1EJ7L 2L41A 1MMDA 2GQ2A 5HK4A 5KT3A 3NGTA 2M0GB 3EXCX 4KY3A 1AA1B 5GAGU 1XMQF 5HVFA 3T1AA 2XCPA 2MYFA 2GAHC 1FKOA 1T03A 3C6UB 3LGMA 2GV1A 2MQOA 3N6NA 3LP1A 2CG4A 2GNKA 3PFOA 1GAOA 4EI2A 2F4FA 5BR8J 1R8BA 4H4MA 4DF8A 3O5TB 3GIMA 1C4AA 3BGUA 2DIUA 5T7LA 2W4PA 4YDDB 1T0TV 5KG2A 4OYMA 2N4CA 5KFQA 2CPYA 3WC2A 1BQMB 3RGIA 2CJXB 3D0IE 1F0XA 4ICLA 3W62A 4EEYA 5KFGA 1W2IA 3PKMA 3G86A 4RO0A 2LQ9A 4XAKA 1SCJB 1V3ZA 3FFIB 1H3DA 4DL4A 3R5BA 4J90A 2JLEA 1RT4B 2M4MA 4QWDA 4QU6A 3E8OA 4KE5A 5ETOA 3E2EA 2R2UA 5J2NA 3DGPB 4QYZJ 2XZWA 2LEPA 5LJ5Y 4WFNQ 1TUWA 3HJFA 1R0CB 1FXDA 1ZETA 1R0BG 2KB2A 1OPZA 3V81A 3PG9A 3C16A 1Y11A 2GJFA 3DOLB 1TK0A 1H2TZ 1JJHA 1ZYQA 2F8MA 2W25A 4DZDA 1FNXH 1KHWA 5B0BA 3ITHB 3CCUS 1S59A 1RWNB 4WIQA 5DQGA 5DETA 1WKLA 3Q2SC 2PI5A 1ZM3A 5KFEA 1TQLA 1Q81T 4HDHA 2BV3A 3CEDA 2F4VF 3FEXB 2CA9A 2CZVC 2CQHA 1DY3A 1DQAA 4F4XA 2IM3A 2NUUG 4LVOP 1KEKA 2HRTA 4J5OA 2LMIA 3BBFA 3GCWP 1LWFA 2EFNA 3O2IA 2ZH7A 2K1RB 3Q8RB 4DR2F 2J0XA 2NLWA 2VFRA 4ECTA 5LJ3Y 2NPIA 3A8EA 2DCUB 5H9FJ 4N76A 4DR6F 4FF2A 4DR1J 3GV8B 3QAEA 2MTLA 5J2PA 3CCES 2O1PA 1QM9A 4PEOA 4UZBA 3DLKA 1DRZA 4CT9A 3ZC4A 3SSSA 5D0HA 4QPTA 4C8MA 4X4PA 4OIXA 4RUHA 3TZYA 5A0YA 1MSWD 2QA2A 4B08A 3GPAA 2UV8G 1Q7YT 4LIWA 4PQAA 2QT7A 5L9NA 5FDLB 1U25A 3PZPA 1RWXB 2F5GA 1WG4A 3ZTQA 2XO7A 2MQNA 4KHPF 5A8KA 3GB0A 3TA0A 1FKPA 1HD0A 3TNVA 1VHFA 4NEYA 2MSSA 1N56A 2UVVA 1JLFA 3R5AA 1Z2LA 1X31C 1A9NB 2DH9A 2E1CA 2JFDA 1P9YA 4IG3A 4N41A 4UTGA 4DV5J 2YKNA 2MZSA 4P74A 3J7A1 1H2UX 1RAHB 3K17A 1SL2A 3MM5A 4WFAQ 3H4DA 1S6OA 5E3QA 4LFAJ 3JB9k 3CD0A 1WNEA 4GKJJ 3TJ9A 4DEZA 4DL2A 5D77A 3HD1A 5A8RB 2FHMA 3KXDA 2HHSA 4GRSA 1R89A 3ZZUA 2N4DA 5J1EA 4LF9F 1C0TA 3CCZA 2ZH8A 1HARA 1PJ5A 5GAEU 1RWMB 1RTDB 5C24B 4F0KA 4Y34A 1VQ8S 2HLUA 1VJQA 4IG0B 1W26A 4EO6A 1KTQA 3QGHA 2E1AA 1A7GE 1NDPA 2KM8C 2CQCA 3H25A 2XWXA 1D1UA 1BXNA 4WU2A 2JEGA 2Y0SD 2CJ9A 2VDHA 3CJKB 2CQ2A 3PRVA 2YWEA 1JNRB 1N33F 4U96A 4DL5A 4ALZA 4ZVHA 2CQGA 2NPFA 3AJDA 4ZPDA 2B5JB 1FRXA 2ACYA 4DQIA 1XNRF 1HNIA 1YWXA 4WZQA 1WKJA 3K5LA 1VQ9S 2AYBA 1TP7A 4ECRA 2RIJA 3QWUA 2VD3A 2QA4G 2W1BA 3H59A 1S1UA 2DITA 2DXDA 1G6BA 5JJBA 1FDAA 4DI6A 1Y0HA 2EBEA 3TAPA 1N32F 2HHUA 4OYXA 4DV3F 3M8SA 1D3WA 2LEAA 2BOAA 2GA7A 2XG8A 1JXLA 3OFHA 2HVHA 5DRKA 1TKZA 3GE9A 1EP4B 2HHHF 3HDSA 1SH0A 3OTCA 4PYDA 2MKJA 1E6YA 2X51A 2XMVA 4CLZA 4LRAA 4RUBA 5KFNA 4DLGA 4F26A 3KJNB 1KFDA 1PAEX 1OS5A 4RW6A 4USJC 3W61A 4DUZF 1D0EA 3FUYA 2FPHX 1TUVA 3L95X 3ENAA 3RTVA 5GVQA 3IAM9 2RS8A 2CADA 3W5YA 2BEFA 1CJTA 2RVJA 2FJBB 1ULRA 2ASYA 4ILMA 2HQDA 1WHWA 1WF2A 3HHDA 2KXNB 4ZPWR 1KP6A 3C6TA 2Y3YA 3SQOP 1KC8T 3JSYA 2DXFA 3VAGA 4YR3A 1SJ4P 3UNYA 3BM7A 2DVIA 1QAXA 4F36A 2BM0A 4TQSA 2MJNA 2F4VJ 2GVDB 4C0HA 4O3RA 4KJIA 1RBLA 3C66A 2YNFB 4B9VA 2AEFA 3T1YF 1IKYB 1FRLA 1MROB 3KUGA 3DLGA 2QX0A 1VQ7S 2BRLA 4CO2A 2ADBA 1S6UA 3H5UA 1EZZB 1D8YA 2KFZA 4DR2J 3F56A 4DR6J 1ZPWX 3UWTA 2D3OR 3HZGA 3I56S 1VK3A 5CABA 2LXUA 2BXJA 1VS3A 3P5TL 3FRZA 3SSQA 4OI0A 3P4UB 2X7IA 4ECWA 1UWBA 2RF2B 3VAJA 2DRAA 3A3OB 2NYIA 4I7FB 2FC8A 4CLLA 3PX4A 3BGOP 4HI1A 4TVAB 4ZPCA 2EK6A 2VDIA 4TY9A 1RQ0A 4WF9Q 1HMVA 2Q6BA 5K14B 4KHPJ 2E5IA 1JX4A 5BYSA 4ITSA 4BHQA 4P7TA 1S0MA 4N8OA 4DPXA 3MR2A 4KGZB 5IZHA 4ES3A 1XR5A 4I69A 4UOFA 3KOAA 1S4FA 2YX1A 4LJMA 4K4WA 3Q8YA 3IC1A 2N3LA 5DDPC 2G1DA 1S0VA 3RG6A 3RBEA 3MCOA 2C3PA 3FQKA 2J6SA 1TL1A 2FGCA 3K58A 4WYWA 2M3DA 1UW4A 3POTA 1RK8A 2DNYA 3HVTA 2OFGX 4ED8A 1R8HA 3CCJS 4GVLA 4M5DB 5CCMA 3I5CA 4HLBA 1E6VA 2XTJP 1L3UA 2FVRA 2ZWPA 1SJQA 4C8NA 5I3PA 2NUHA 3EM1A 3CDAA 1OYEA 1GXTA 3I55S 4LF9J 3SYZA 2CUYA 2M9KA 1CS4A 2L48A 1F3FA 1U1PA 3OUYA 2R8HA 3D4JA 1TR0A 2QMUB 4CM2A 2ZFHA 3O8WA 2PD1A 3IG1A 4M5NA 1N4LA 4RBUA 2HGMA 1YK9A 4RJVA 5M2UA 1UFKA 4IFYB 4IDKB 5HQLA 5L1IA 3AAWB 3SQGA 1JLGA 1APSA 1WG1A 5IFMA 1U49A 2IAJB 4FVMA 3D6HB 4DCPB 1LK5A 3MECB 4HTJA 2P2CB 3IAS9 1REVA 1XNRJ 2B7BB 3EZUA 3DMJA 1Y00A 3P5BP 2CNNB 4JI6F 3TA2A 4RW7A 4MYUA 4FS1A 3DRRA 4Q2LA 1XR7A 3FVYA 3JTNA 3T5HA 5IWAF 2C3YA 4RNNA 1U26A 1N32J 4MMOA 2MQQA 4DV3J 5DGBA 4DPOA 4WFYA 2HVZA 1U1KA 3S01A 4NPOA 2AQ4A 3Q23A 2I2YA 4NLWA 3IR7B 2HHHJ 4N7TA 1WD6A 1X0FA 3MCNA 1K73T 2V4JB 3UDLA 4M94A 3RR7A 4KHMA 3WHIA 5F8JA 1ZH5A 2F40A 3NBPA 1WC3A 2C22A 3IFEA 4NMXA 2EPIA 3V4IA 3I0RB 4DUZJ 4WTYA 1UL3A 1SB6A 3ILLA 1H7WA 4CLSA 3FBBA 2MGZA 3IM9A 1C0UB 1NK4A 3CDWA 3PY8A 1KQFB 5MLCV 2MZJA 2E1PA 1LWCA 4QZVB 3U1MA 5KG5A 2A2DA 1X7VA 1IBCB 4LRBA 1OPIA 2ATCB 1RTZA 3WIUA 4ED3A 4A48A 1P1LA 3OL9A 2Z2YB 4P2SA 2E1MC 5E0OA 2DYAA 3UDCA 2IBOA 1VFJA 2PMHA 2QTWA 3C8YA 4Q43A 3T1YJ 4QYRA 3H7HB 1S49A 4ZPVR 4WFBQ 1KKHA 3MTJA 2KYZA 1CJKA 4ZOSA 4MYTA 3M6VA 9RUBA 3N6LA 3M4XA 3OXGA 1WEXA 4IOCQ 3EICA 4BC9A 4ZVFA 3TW0A 1RT7B 4HVZA 3O1LA 1YBTA 2CNOB 3NOGA 5EWFA 5KT5A 5BXIA 1EAYC 2HWTA 4WP3A 4O4GB 1IWAA 4L6V3 2VPYB 2BRKA 3U7JA 1J5OA 1RT1A 1RU1A 4CLKA 2CJQA 4ZJQA 4TNOA 5K8NA 3JYTA 2W2OP 1RWWB 1FEEA 4LSZB 3HSGA 2R7OA 4Y2MA 3SV4A 1FD2A 4Q0BB 1SVDA 1S6PA 2XO6A 2HWIA 1F6TA 3KHLA 4JV1A 2IVMA 2ILYA 3NGDA 2AMCB 4OZ2A 4QW9A 3I32A 1RGVA 3SI8A 3MM8A 3JQMA 3GG1A 1GT8A 3TP2A 1KTVA 4CO0A 1VQ6S 4W4MA 4CCHA 4TXSA 2H1YA 1NJWA 4CH7A 3KLHA 1YIJS 4HACB 4X65F 2AW0A 3T6BA 1S0OA 4N5SA 4NZ0A 5EDWA 2F3JA 2WBMA 4IKAA 2OIHA 1RT2B 1CJUA 2VPXB 2IBKA 3QLHA 4F4YA 3J7AN 2KYXA 3GJRB 4C8OA 1UVLA 3CJ4A 3FCWA 3RW7A 4UOGA 2AD9A 2WB4A 4NI2B 2V9KA 3PYDA 2H9ZA 4DFPA 1OWXA 3J7ZT 4TKTA 4CLYA 4Y65A 3NG8A 2CPEA 3SBMA 3M8PA 3CO9A 3Q8QB 1S9GB 3NRBA 3N9UC 4QW8A 4DR4F 3VCDA 2AJ2A 1S1WA 3LQVA 4NLGA 2KT5A 2CPIA 1TKTA 1LKZA 1HHTP 3GFXA 3KLIA 2DNNA 4QBUA 3KNGA 3DOMA 4ECQA 4F67A 1TU0B 2PE8A 3GYXB 4G1QA 3THVA 2YKMB 4WE1A 4PYAA 5HBMB 3MMJA 4U95A 4N8NA 4DWIA 1S1VA 4HEA9 5EWGA 4ZHRB 3A3PB 4RLEA 1Y4ZB 3PW2A 1ZPVA 1N0VC 4PG8A 4ILLA 4YDXA 1BUXA 5D0RA 2IDEA 4JI6J 3TUIC 2R7WA 2KM8B 1HNWF 1AZSB 5AXKA 3LPEA 2CVEA 1F9EB 1DQ9A 2G0CA 3LOUA 4DCOB 1HNVA 4MFBA 5IWAJ 1WI6A 1I6JA 3CJ0A 2AKWB 3D1QA 2UUTA 1KNZA 1Q78A 3ULHA 1ICEB 1Q53A 1TELA 2V0NA 3V5RA 3DYAA 2GZOA 2ZH2A 1WC1A 2HG4A 2VBXA 2GO9A 2D9OA 1ZAVA 2Y1IA 2R8IA 4A8YA 5I42B 2XSFA 1B4SA 3NNAA 3NS7B 1J2VA 1RYSA 4L3NA 4CLUA 1P27B 5I3UA 5DQHA 2BVZA 1T9UA 4X4RA 1WC0A 3H5XA 2AYGA 3GWCA 4K4VA 1NDCA 4BBYA 2CNLB 2AEJA 3AD7C 4U8VA 3JXOA 3R7BB 4ZP9A 1DTTB 2E29A 3TYTA 4UOCA 3G6VA 2ASJA 3CB4A 4KSEB 1O6XA 4V19X 1TFWA 3W8GA 3RB3A 1QDUB 2H5IB 3BO2A 3I0SB 4ATNA 1T11A 3VVUA 3LP2B 4OZJA 4B9LA 3R2DJ 3QRPA 3GV5B 2ZD1B 5J1NA 3S8SA 3RW6A 4JOUA 5KFAA 1EKRA 4DL0C 3IRXA 4V19J 3J80U 3KK3B 3SSRA 1V9OA 3RAMA 1YJWS 5DS7A 3OJSA 3PRBA 3EGWB 2HGNA 3R6LB 4IFVA 2EFVA 5K5MA 4DCJB 1NJYA 4U67Q 3UE2A 2YPZA 2VPWB 1S4EA 3AY0A 2P6TA 2RKIB 4K4SA 2E5GA 1CBKA 4A8XA 4BS2A 2XI2A 4I2QB 3MF5A 5LSRA 1S9EB 3MCSA 2HW3A 1RAEB 2G2ZA 5BYQA 1SPBP 4QR1A 2ZNYA 1FKAF 2RB7A 3CC2S 3KJVB 3QSIA 2DHGA 4EBEA 5HP1B 1LOUA 1HQ2A 1R7IA 2E9TA 5KFDA 4YEAA 2WVDA 3TRGA 3TQEA 2K7JA 3J7YI 4J9SA 2OPPA 2DY1A 2W2NP 3ISND 3M32B 4TU8A 3KLGA 4PZVA 2BYCA 4X65J 1TL3A 2HYIB 4JV5F 4F0HA 1TV6B 5HQ8A 4LUBA 2DGOA 1ZBTA 1NB7A 2Z57B 2M2BA 2R2RA 5G0RA 3BBBA 1DAXA 1G1XA 2QEXS 3QRRA 2C42A 3CO0P 2NCKL 3LANA 4P71A 4NLXA 3IO1A 3C14A 3AXKA 4F25A 5IM0A 3F73A 5F8LA 1FK9B 2W9BA 3OTOF 2B0GA 1OIAA 1HPZB 1N5QA 3BO3A 3NS5A 1IKVB 2RQKA 1S7IA 2XSJB 3DRXA 1HBUB 1FX4A 2BKNA 1Q8IA 3TZWA 4J37A 3RR8A 4U7UD 4ILRA 3NMAA 1LNQA 2V68A 4DR4J 4I56A 3M1VB 2KFNA 3UQSA 4C0OC 1RHKB 1TL7B 4BWJA 2HIQA 2QRRA 4OYIA 1S0NA 5MAOA 2KL8A 2XS5A 3L7OA 4A8SA 2JNJA 2I6WA 4C9DA 3ZTRA 3QGPA 3HO1A 1ZS6A 2R7QA 1OMSA 3TUZC 2I8EA 3CW2C 4X4QA 2XHWA 1C2PA 4ELVA 2GHVC 2M5YA 1FJ7A 2U1AA 4KH0B 2L9WA 4CTAA 2XULA 2JOQA 1MN9A 1RHUB 2QMXA 3QPIA 3EE3A 1Q5YA 2LDIA 1UTAA 4IR9A 1Q8LA 4DN9A 3K5MA 4NLVA 1U6FA 4J9LA 3OT9A 1K47A 1IKWA 2DRDA 1AUDA 2U2FA 3OQ2A 2VU5A 2KXFA 1WDTA 4DUYF 1CJVA 1EQ0A 1FFGB 4UZCA 4FNHA 4R8UA 4ZP6A 2B8PA 5LMNF 2DR6A 1GTEA 1IN0A 2OTJS 3DN9A 3G6XA 4H4KC 5ETNA 1S9FA 4PAAA 2Z8QA 2DNLA 2WSFC 4PWDB 1SI9A 1MU2B 3UVJA 1ZZNA 2J0WA 4HKQA 2XY7A 1VQLS 1K1SA 5E3PA 2I5JB 1JLAB 5BJRA 2MZRA 1YZ6A 4CH1A 4K50A 3VHQA 5J2QA 1HBNA 1S99A 2VG5B 4DV2F 3BQ1A 4J9PA 4DR3F 3D9BA 4UUXA 1TKXA 2PFDA 5ETRA 2FZCB 1RWOB 3BS9A 3VAKA 2AP6A 5KG4A 2P9EA 5F0WA 4DQQA 2H4YB 5GAGI 1B0PA 2GGPB 4G1PA 3W64A 4UUWA 4CYUB 4CO4A 2WOMB 1T9YA 2K7KA 3Q8SB 3D3CJ 1UWAA 2LLZA 3T9ZA 4NXNF 4L74A 3TVZA 1UZDA 2KT2A 2V9WA 1RT6B 4MAKA 4OX8A 4PCQA 2YWFA 4KV8B 4LMZA 1YGYA 3MGJA 1V5IB 3MOZA 5K8PA 4A46A 3OL6A 3LPYA 1UCNA 4AE5A 4ZITA 2IC3A 4QWAA 2R7RA 1S97A 4KPCA 1N48A 2ROGA 5HMXA 1Q5VA 1YJ7A 2NXCA 4QWBA 3OW2R 1GMVA 4IOBA 4MKBA 4WJBA 4C8KA 2XYHB 3OLBA 1DTQB 2BW7A 2BR0A 2UVRA 4PXDA 1H7XA 3ENVA 4FKYA 1HQUB 3G71S 2RT3A 2C2MB 3S7RA 3HHLB 3CCLS 3GSIA 1RAFB 1GH8A 1NDKA 3T19A 5HVGA 2FHJD 2J6UA 2V5HG 3I4PA 1RTJA 1JLEA 4L3KA 2X1BA 3HVRA 4YR0A 2XMKA 4NOHA 2BANA 1UVKA 4UT4A 3EX7B 1RT3A 1HLWA 3OBIA 4NWBA 3VALA 2CPZA 3IP0A 4RUCA 4JV5J 4LBPA 2MZQA 2VOOA 2VG7B 3IGVA 3RB0A 4M5HA 2RE1A 3L09A 2Y9HA 2QN6B 5THWA 3KG1A 2YKAA 1SUQA 1MLAA 4B02A 2KJVA 1TUGB 4RX6A 5C7PA 3I4HX 5ETMA 1HI0P 3M8WA 2C2KB 2BBEA 2R2TA 4MKYA 4DL7A 3MPYA 3F44A 5SUHA 3OTOJ 4USHA 4QWEA 3BKFA 3MM6B 3TI0A 5I3QA 3GJSB 4RW8B 2J76E 1UZHA 4YMEA 4RZRA 2OO4A 3AA8A 2JEIA 5T14A 1HWJA 3HZEA 4KFBA 5F41A 2RU9A 4DQRA 4USVA 3GJQB 4I67A 3IBCB 5M2PA 3KLFA 1GTHA 4TLQA 5A6WA 1RISA 2WVCA 2YY3A 2BE7D 4NLSA 4USIA 1J5EF 4RW4A 2XMAA 3H8YA 4PG6A 4RUAA 2QV6A 3AB4B 4LBIA 4JBCA 3V6DB 5HMZA 4GC7A 2NQPA 2JWNA 1U45A 1T9WA 4ED2A 1U6ZA 4DHVA 2ALYB 3OPKA 1SV5A 1KVKA 1B7YB 3DI6A 1CSJA 3D28A 1SH3A 5IQQA 2DNKA 3BSOA 3CJ3A 3OR2B 4QPXA 3EVOA 2QLFB 3DM2B 2ZBIA 3ZTOA 3JSRA 1F5BA 1U0HB 4DUYJ 3R5CA 1PBAA 4XDDA 2UU9F 5LMNJ 3WX8A 3QJPA 4RNMA 1PSDA 2JEJA 2V4QA 3LGHA 4CO3A 1OO0B 1RA7A 2ZVSA 2GQQA 1HW8A 3KUHA 3T1HF 2OH2A 1O0PA 1FVSA 2MPUA 1I94F 2ABYA 3DHWC 2ZZTA 2Y1LB 2ZJPQ 2CZ9A 3MEEA 1QAJA 1KFSA 1YJ9S 1FRHA 3ONQA 1F3VA 3CNQP 2DT9A 2K2PA 2EG1A 5GAHI 4ZVSB 2HVIA 4DV2J 3K89A 5D4OA 1U1RA 2Z30B 2DHAA 5KOWA 4DR3J 1ZA1B 2DXEA 4DS5A 2QLJB 3TUPA 2R8GA 3TVKA 2XGPA 2VG6A 1VRUA 2DBBA 4NASA 1JXEA 2CDRB 1HYSB 3CCRS 2LQJA 1WHXA 3R8YA 1N5SA 4QOTA 3LW5C 2J6TA 4NXNJ 2RHQB 5C25B 4L75A 4H54A 3UCZP 1GNKA 4ZS6A 1TVRB 4EYIB 5F0UA 2YNIA 1S6QB 3MEDA 2HQCA 2PMZD 1XK8A 4P7VA 2BQ3A 3IM8A 2HHPA 2DNRA 3PCOB 4YB6A 4G3IA 1S1TB 2V8PA 3FQLA 2XY5A 3WDOA 1X4BA 3D6MB 1RAAB 1U1MA 4H4OB 4USKA 1FJCA 2HK3A 5KG3A 1R8PA 2UVUA 3E3XA 4DPTA 4ELTA 4ED1A 2WONA 2C3MA 1RTIB 1MMNA 3GP9A 3G8QA 3BQ2A 1DQ8A 4F4AA 2PI4A 3RZAA 2FLLA 2NSBA 4HH0A 2IMOA 1WHYA 2B6AB 2RRAA 3W2VB 1T9XA 2RS2A 2MSTA 1WTBA 3D67A 4AFFA 3W9HA 3JSMA 1KLMB 5LL6d 4WP8A 1HI1A 5U47A 4J9OA 1RT5A 5H1SV 2J7UA 4OYAA 3KMQA 2VQFF 4UF4A 1RWUA 5F3ZA 1U2CA 3DXBA 2OSRA 1FHTA 3ZZOA 1IQTA 2MKCA 4J9VA 2B56A 2OPQA 1UMJA 1TZ0A 2PDAA 3KFWX 1NO8A 3SV3A 5EGYA 2RUSA 3J81j 2HHQA 2H4WB 4PUOB 5CA5A 4KYZA 3D1HA 2XGQA 3IS9B 3M8RA 3G82A 3MPUB 2CQDA 3GMGA 1YBUA 1RWVB 3D6FB 1JLQB 2M52A 4MTPA 4OX9F 1UJ4A 1FXLA 5J2MA 2AZ1A 4F0MA 5D6GA 1RHQB 4R0EA 1J5EJ 1BQNB 4ZMMA 3NWRA 2MKIA 2CVIA 3NCRA 4LF4F 4MK8A 4Q2MA 4FZVA 4NL5A 5FIIA 5KOXA 3KK2A 2I0XA 4M95A 3MD1A 4JI8J 3IN5A 3AOCA 4A8KA 5D0EA 4LSNB 2YNGA 4HTIA 1XMOF 1B7FA 2ASLA 3MAQA 4MK7A 5L9XA 3ZZPA 2H51B 3CC7S 2RQ4A 4OL8A 1HR0F 3NOCA 4B3OB 1S1XA 2HVEA 2W7PA 2VIHA 2M70A 4P2FA 4NLOA 5ETLA 3CJ8A 2WTFA 4LVNP 2ZKTA 2DO4A 5DLFA 2UU9J 1KD1T 1VCTA 2PN6A 4RW9A 4S0MA 4PKDB 2HZCA 1IJFB 4YQWA 2FJDB 4F3OA 4MIBA 5KG6A 2BQUA 3T1HJ 1HQEA 3UO0A 1JJ4A 4K4ZA 4J9UE 4ES1A 1I94J 3LWLA 4D3GA 5HLFB 1R0AA 1WDDA 1WF1A 2E44A 2YXLA 5AT1B 1U2FA 2D69A 3ISNC 3NMRA 4FYXB 1WSRA 2F8EX 2G0JA 2IPOB 4DJBA 2HAIA 2ZBCA 3GLJA 4FYVB 5D3GB 2BA9A 4CQ1A 2G9OA 3ICLA 2CJBA 5L8RC 3K8VA 3OR1A 3M30A 1ZA2B 2O67A 3AFGA 1WC6A 3FZ2A 2RD5C 1AW0A 3R5DA 2FZGB 3BSAA 3CE8A 1G2EA 3VV2B 5HMYA 2XS2A 2AGQA 2KVQE 1N34F 3Q2TC 4X64F 2LXFA 3QFWA 4LF7F 4OZLA 3HSJA 2B9EA 2MXYA 4KKOA 1X5SA 3ISZA 3P3DA 1RAGB 2ZBRA 3CCWA 4E98A 1PYTA 2YKOA 2BJ3A 3M2RB 4OZ1A 4ENOA 2E1RA 1GXLA 3VF0B 1QSSA 2OELA 2KHDA 2HK2A 4OZ5A 3PW4A 3DC2A 2JLFA 3K59A 4UOHA 4KIAA 3KYLA 2AHOB 5IQ6A 3HSDA 4H4KA 1MNEA 4CLWA 2ZOGA 1RHRB 3CGIA 1KQGB 2NXNA 3D6TB 3SCKE 3BR9A 2F8HA 2GHWA 4K4TA 3BGRA 2KTQA 1LWEA 1VK8A 3JQKA 4ETXA 3DRSA 4KGXB 4WWSA 3TO8A 3LUYA 4ZCKA 3IWNC 4Y2CA 2DNMA 3MEKA 1QE1B 1JWWA 3NLCA 3M2VB 4LQ3A 4DSKA 2QLWA 5L39A 3TZXA 3R7SB 2ZOFA 2RH3A 1X4FA 4X4NA 2BUNA 3FKBA 2OJ3A 3M8QB 2HEKA 5L46A 2OSQA 4JI3F 1QAIA 1UAWA 1LK7A 2EKYA 4OJ1A 1NKBA 2VQFJ 4JI0F 2LEBA 3KK1A 5L1JA 2MLZA 1M5VC 3QIPA 1YG0A 4ZCMA 4K59A 5E33A 2LQBA 1ACMB 1JQGA 2CQ1A 3TAMA 1VI7A 3BN4A 1SH2A 3E51A 3PO5A 3ZXWA 4F7VA 3KJFB 1HNXJ 5HL7Q 2HGLA 4ZLPA 2ZWOA 2HFUA 3PR4A 3I6PA 3F41A 2WB1D 5DJBA 1QVFR 4IUFA 6FDRA 5EX3A 3W1YC 3GR0A 2HNYB 4DQPA 1VJWA 4HT5A 3BH7B 2VHGA 1CQNA 4ZCIA 1KBRA 4IR1A 2FC9A 4Q5VA 2Z2MA 1EETA 2NS1B 3AHPA 4OX9J 4YHHF 4I0WA 2ZE2B 4P52A 2PT0A 2G13A 2KH9A 1X60A 2RDJA 1H0HB 1FRMA 1ZZFA 4LF4J 1X9WA 2C2OB 2ZDOA 1XERA 4OI1A 4KO0A 4QR2A 2YVSA 2C2DA 1S10A 2PIIA 1EIYB 1WORA 3IBWA 4NLRA 4DPUA 3VTIA 4BCAA 1SJ3P 3QO9A 1XMOJ 3NGRA 2A6OA 2RMLA 1RYRA 4NLYA 4ZKAA 3NKYA 4UQGA 1N5YA 1HR0J 1Q16B 1TK5A 2K3IA 1FKOB 3DGVA 1T03B 2LCWA 3LP1B 1YZ7A 5ETSA 2GIQA 4C3LA 5AE1A 2OPRA 2YNHA 2FLNA 5F8GA 4H4MB 2BKPA 3VZHA 2CQ3A 1T05A 2FY8A 3OD2A 1K9MT 1LXJA 5T7LB 3Q8PB 1N54B 1IJEB 4FNIA 1DLOA 2X3GA 4K0KJ 3Q86A 3NCPA 1C1BA 2PFFB 2B4UA 4JI7F 4RR5A 3UI3A 3RBDA 3AODA 3US5A 4ICLB 3DHXA 2N3OA 2ZH5A 4KAIA 4FBTA 2HKEA 2GO8A 2R7VA 3EDQB 1BWVA 5E3AA 2RJZA 1FRKA 4OJHA 3EJMA 1SJ1A 5J2NB 3BYPA 4E2FB 3RBZA 4C2MA 3CCSS 2VOPA 1C4CA 1XEZA 1FJGJ 5D4LA 2F7VA 2VKRA 3MMAA 4JI2F 1FDDA 3EPIA 4J9KA 2AYEA 5DG7A 4NLUA 4X64J 2PGCA 2KJWA 3V81B 1M0SA 3C16B 3ET6A 4YOEA 2V4RA 3K5OA 3JSBA 1JLBA 7FDRA 3TEHB 4W90B 1MWYA 2HQGA 2UXDF 3ADAC 4WXWA 1HD1A 2CQIA 3T3FA 4ED6A 1T9TA 5DZ7A 3PYEA 1HWLA 1NSPA 3FGVA 4XTTA 5LSOA 3D66A 2RSQA 3DRPA 4PPZA 1YITS 2D74B 4V1Ak 3GFZA 2WCXA 1YJUA 3VR1A 1YRTA 5HO4A 2ASDA 2Y1JA 4URQU 1DBDA 5LXRA 2EC2A 4LF5F 3UFCX 5K9FA 1LWFB 3K57A 4WPAA 1MG7A 2JX2A 5K8MA 4DX7A 4EWTA 5LSLA 3SCJE 2BE2A 3PO4A 3TA1A 2R3VA 3B82A 1WTFA 4O23A 1YLXA 4NCBA 4EMDA 1YI2S 2AJ1A 1FE0A 1UFLA 1AUSL 2J7KA 2D1CA 2AV5A 2DGSA 3GYGA 4X4TA 4ID5A 5J2PB 3PEJA 2P9GA 3DLKB 3KLEA 3EGVA 2ERRA 3L4BC 3G6YA 1U4BA 2ATLA 1WELA 1XIQA 4J9NA 1IBLF 1N5TA 2FGOA 3QRQA 2KKHA 5A0YB 3I5AA 4ZP7A 2DGWA 3PX0A 2UXBF 1JXVA 4JI5F 3GTYX 2CJKA 3Q83A 3FDSA 4JI3J 2D41A 4N56A 4JYAF 1YDLA 2IFXA 4JI0J 5A8KB 2XEXA 4QCLA 1FKPB 3WBZA 3QT5A 2XQCA 1NPPA 1T3NA 3I5BA 3A12A 1RWPB 1JLFB 2F9DA 2EC0A 3L7UA 1L3TA 1NH7A 3H4BA 2ZKUA 2O01C 2RRNA 2X3DA 1XWLA 4QIEA 4IG3B 4ED7A 2YKNB 4L73A 1S12A 4P6QA 4WCEQ 3DLHA 3MM5B 1PAUB 3ILOA 3FBFA 2MDAA 1BWEA 2UZAA 3M8ZA 4LFCF 4YY3F 4YHHJ 2Y1RI 3QATA 4R5PA 1BLUA 2VFVA 5KFRA 1QTNB 2BE9B 1Z4UA 3GR1A 1VRTA 2QG9B 3B4DA 1VGYA 4JV2A 2ZHBA 5J1EB 1C0TB 1WOSA 3HSZA 4K2JA 4M5KA 2BX6A 4PQUA 5DG8A 5G4DA 2LP4A 2YBVA 3GG0A 1CC8A 3MR3A 2B3TB 2BJ8A 2D7SA 3QIDA 4ZPTR 2JVRA 1YJVA 1IQZA 2ZZNA 1DURA 4CLFA 4JUZA 3MM9A 4PG7A 1SIWB 1RE1B 4KRWA 1HWUA 1U6BA 4B3RF 4B3MJ 1RZMA 5AJ3F 3W66A 2NXEA 3OXLA 2J5AA 4AL6A 1HNIB 4M63A 4R0JA 1UA0A 1O8BA 2NREA 3MFHA 2F9JA 4BLGA 3TEGA 2P8IA 3GYNA 4E0DA 2Z2ZA 1S1UB 4PWUA 4EUVA 2QA1A 4TY8A 4JI7J 3CD5A 2RHSB 2W9CA 2EFPA 3JS9A 2COLA 1FE4A 3FSIA 4OI4A 1MW7A 4HR2A 3D7SB 1TFYA 3EPGA 2F1FA 1GQEA 1BHNA 5F9NA 1TKZB 2CYYA 5E2QA 5F8HA 5KG7A 1Y10A 4J9QA 4QR0A 4EK2A 4WFZA 4OYWA 1XMQJ 4DX6A 1E6YB 3L7PA 4F04B 1SXLA 1IR0A 4J9RA 4OV6A 4F02A 4RW6B 1ZAXA 5KFSA 3RU0A 4BC7A 2OFHX 4I68A 3IBFB 4JI2J 4Y6IA 2RAQA 1FWPA 4CZCA 4I6WA 4ZLLA 3H42A 2EWHA 1CJTB 3K5PA 1MMLA 3QAUA 2UXDJ 1L5UA 3ZTSA 3HFZB 3C6TB 3C15A 3AXMA 4M5IA 2V8GA 4HL9A 3J81Y 4R25A 1N0UA 3MM7A 2HQ3A 1V5VA 3BV8A 1X4GA 1CQMA 5IC4B 5C42A 2CIMA 2DK2A 4K4XA 3FMBA 4IH5A 4O44A 1M1HA 3RAQA 3DLGB 2HMIA 4LF5J 1SKRA 5HQMA 4P72A 4A47A 4F3QA 1B0TA 1NU4A 3ZZTA 5LXYA 3DXSX 4NX9A 1VQYA 2DNPA 2AX1A 1ZTTA 2I9SA 1NJXA 4ED5A 3C46A 1RACB 2CDQA 1U0SA 3A8IA 4PWWA 3VGTA 2XC9A 4YS2A 3M2UA 1YJNS 1T8EA 2W24A 1U7LA 1UWBB 3MXHP 2K06A 5A8WA 1U1NA 1IBLJ 1EB0A 2ILZA 2UXBJ 4HYKA 3A8KA 1VC6A 4JI5J 3RAXA 3P8BB 4FP9A 5IV3A 3PX6A 1HMVB 4JYAJ 5HVHA 2SXLA 2DKOB 2V50A 1Q0NA 1HBMA 3IR5B 4C11A 4FYYB 3VQSA 4F4KA 3ZO7A 1NJZA 4ETZA 4G65A 3W2WA 4W98A 3SMZA 3DDNA 1LW2A 1Q4RA 5B0DA 1VQOS 1WJ9A 1NK6A 2UXCF 1N5VA 1YRXA 3HFVA 2W4CA 3NEKA 1BMQB 2VFSA 1TL1B 2HFNA 3QGIA 4CWBA 2MEWA 3BF4A 3POTB 3UW1A 1UW9A 3HVTB 4TYBA 1U1QA 4O3PA 3R1LA 4LFCJ 4YY3J 3MPDA 1E6VB 2H54B 5AXMA 5GADI 4ZP8A 3MAAA 2XBPA 3T5LA 1U09A 4LF8F 1KLNA 1EHWA 1CS4B 2J9CA 1MN7A 3U27A 2OGUA 1DZ5A 3OUYB 1CC7A 1EARA 4AXJA 1CULA 3MMBA 2BOPA 1DJ0A 3IG1B 1TAUA 5F3TA 1IKXA 2OEJA 4QIVA 2WAQD 2BABA 1RSCA 1K0VA 4B3RJ 1KDNA 1NK7A 3SQGB 1JLGB 1H72C 5AJ3J 1YRUA 3VGSA 4OV1A 2BJ9A 2K3KA 3PIOQ 3AT1B 2RQMA 1REVB 4X66F 3DMJB 2W2PP 3HVWA 4RW7B 2UV8A 3DRRB 3K5NA 2XMMA 2D3ZA 1WOPA 4NXMF 4MK9A 1N36F 1VBZA 3MDFA 4DV0F 4IO1A 4RU2A 2VKZG 2BJ7A 1JLCA 3D5MA 4KPYA 2JSXA 1RTHA 4ID8A 2GMLA 2HRYA 1RXOB 1PG5B 4Z37A 3R1HA 4EO8A 2NYHA 1F2GA 3P6YC 3V2UC 1N6QA 2IA6A 2HNZA 3NBPB 2NSCA 4OHZA 2KO1A 2Z0GA 1N33J 2DRBA 4I2PA 3MUVP 3V4IB 1SQGA 2WW4A 1VISA 2OPSA 3QGGA 4QIGA 3AOBA 3L9ZA 1TMMA 2MGZB 1W2BR 3NNHA 3PACA 5J1PA 2BW2A 2ZBQA 1LWCB 3ENQA 1U24A 2OMLA 2XLIA 1JKHA 1QTMA 3TOQA 5D15A 5CYMA 2H48B 2NZCA 5CZXA 3DLEA 3W60A 4FF4A 1CPZA 1NB2A 4B17A 3DLLQ 1S5ZA 1WC4A 3OTBA 1Y5LB 1YJRA 5EUHA 2CQ4A 3AQPA 4FDFA 1CJKB 4KT0C 1V3RA 4CDIA 2E5HA 3H2LA 4FVCA 3DLJA 1S79A 5KFKA 1M5KC 2FHJA 4DXLA 1HA1A 3I31A 3G96A 1LXNA 1FDNA 3AQOA 2N7YA 4QJVA 2M88A 2MJUA 1ZTWA 1RT1B 4K7QA 1J5OB 1NBEB 4AL5A 3SDEA 4O4RA 4C4WA 2CPDA 3JYTB 2H5JB 2HNDA 4RWWA 3I9ZA 2J9DE 1Q86T 1PKUA 5KT2A 1FFWB 1U8SA 3DCAA 4OYBA 2BMBA 3IWLA 3E01A 2M8DB 4F2SA 3UPFA 1S6PB 3DOKA 2LECA 4OQJA 1H6KX 4DG1A 3D54A 5LM7E 5GMEA 3MM8B 1XR6A 4DZ6A 2JJ4D 9ATCB 3MUMP 4USWA 2E7WA 1OSDA 1B0VA 4DOZA 3KLHB 2B9WA 2FJAB 1UFWA 5DZ6A 3M6UA 2YWGA 3KTQA 1NLKL 3CDEA 4RKUC 3HPOA 3N4WA 4UQTA 1FEHA 2UXCJ 3FSXA 4OJGA 1CJUB 4MKVA 3FSYA 3QLHB 5CD4A 2FLOA 5KG0A 1VQKS 3CJTA 3QWPA 3UN3A 1RDRA 5KFUA 5E5NA 5AXNA 2AYMA 4M5GA 2KVIA 1LW0A 4EU0A 1ITPA 1SC1B 2JZ5A 2YX7A 4NYZA 2KG1A 3CMES 3HJVA 2ZITA 4OI6A 5AE2A 2VONA 4HT7A 3VGVA 3QNWB 2GVZA 2ZH9A 1JIHA 2QJ3A 3M8PB 4AL7A 3NP5A 4WZMA 1WACA 4DV5F 2P6SA 1YTYA 4ZVRB 1NSQA 4Q8FA 5KFOA 3OTDA 1S1WB 3SZ2A 4FF1A 1TKTB 1BQXA 3KLIB 3BJYA 4DV4F 3DOMB 2Q3PA 2QMWA 4LSLA 3MEGA 5EN1A 3Q0AA 2ZM6F 3CCTA 4G1QB 4WE1B 3G8SA 1REGX 1T3OA 1S1VB 5HROA 1VQ4S 4NCGA 3GILA 1LWXA 2ZH3A 4DUTA 1QSLA 1M5SA 2FJEB 3ZNJ1 4X66J 4OHVA 3HHLD 2QE5A 1S7HA 2IM0A 3CTRA 2DH8A 3KKFA 1SC3B 3ELHA 2ZH4A 4NXMJ 1N36J 1HNVB 4MFBB 4FXVA 1NKCA 4DV0J 4DFMA 2HHWA 4GVBA 4NCAA 4PG5A 3Q8VA 1HBOA 4ZJLA 3KDNA 1OQ3A 3DYAB 4I6AA 3T9NA 4ED4A 2HURA 1HNZF 1HKAA 2B51A 1LEOA 3V6HA 1C1CA 4ZPAA 2YH0A 1KONA 4URSA 5B0FA 3AJ1A 4A8MP 2KI2A 1IM6A 1V6HA 4RNFA 2DEIA 5DG9A 1RKJA 4B9SA 4QIFA 3HULA 5DDQC 4N77A 5H9EK 5I3UB 4OYZA 5DLGA 1Q1KA 3V4MA 5KFYA 4X4SA 3HHKA 1K0TA 3MMCA 2KFYA 3UD5A 3N5FA 5IV4A 3NWGA 2LA4A 4CH0S 2V34A 2FVSA 2YQ1A 2HSEB 2HHXA 1W25A 3JAMY 3GU0A 2XZDB 4DPWA 1NZAA 1Y3KA 4IRDA 4Y0FA 4K8RA 5B0CA 1RLDA 1SC6A 3MD3A 3A4TA 4OX7A 3C6UA 1T95A 2PA3A 3BREA 1RHJB 3CIZA 3RJMB 5C2GA 3EUNA 3TUJC 3CF5Q 4YP3A 2PMWA 4WXOA 4B9UA 1FXRA 4NRTA 5B09A 3IRXB 4DL3A 2QYCA 1A6LA 4X4OA 2CNKB 4OHWA 1SL0A 2HS3A 4GO5X 2BJDA 1BQMA 3HLUA 5F8IA 4A4JA 4IFVB 2QA4S 3B8HA 3MHYA 3HXMA 3FFIA 1VC5A 1RI7A 3PTWA 1RT4A 2MLXA 3NL0A 2GFFA 4P9SA 4EYHB 2VICA 2XLKA 3DGPA 3M6XA 2QGFB 1RBAA 2HZAA 3NGUA 4AD6A 1VQSA 3BBCA 2MKKA 1ROFA 8RUCA 2DGUA 2UUCF 3V6KA 2F63A 1B64A 1HWKA 3TVYA 2VL1A 1FT8A 4K2XA 3QSYB 4EFAC 2Z58B 3DOLA 1WHVA 2OPPB 1NM2A 3KLGB 2K8GA 3F0NA 1TL3B 3ITHA 1CLFA 4WYLA 2RU3A 3RRKA 3CJSA 3V6JA 3QT7A 2IRUA 5G0RB 3QT6A 2IVFB 2IM1A 4ZLNA 1QSYA 3ETOA 4UY85 1B70B 2DB1A 4C8YA 1QLNA 3C14B 1XN9A 2DR9A 4X4VA 5IM0B 1G4CA 5AE3A 1Y7PA 2W9BB 2PEBA 3L3CA 5D4NA 4ZPBA 4USMA 3NCQA 4NA3A 2O66A 4XIUA 3TJ8A 2K1RA 2HHVA 3T41A 2DNGA 2XLJA 2GJ2A 2DR7A 5KFJA 2ZC3A 3SCIE 2ZHOA 2VODA 4JP8A 2DNQA 2DEJA 2DPIA 2HBQB 3MPWA 4WBFA 2FZKB 1VRQC 4DV4J 2QC3A 3BSNA 2AU0A 3CJ2A 2ALZA 2ZM6J 2CQBA 3OSNA 2ROEA 2JDJA 3JQJA 3UD3P 5IT9Y 3Q22A 4Z7YA 5FDLA 2AEMA 1RP5A 4FPRA 4JV0A 2Q6CA 2XWYA 4ZVGA 4DV1F 3T5JA 3B78A 5GAHU 1NDLA 3P49B 4KBIA 4OHYA 4CTAB 2V94A 1WC5A 1N8RT 1P1TA 3SIPB 3CCVS 3HMJG 3H5SA 4DMZA 1SKSA 1ZAWA 1RU2A 2FVCA 4FBUA 3MR5A 4P2MA 1KVIA 3O44A 5EHHA 4NZ6A 3FRYA 1IKWB 2UUAF 5FLXY 3ZTPA 1YX2A 4TQRA 1HNZJ 2QZ8A 4JB8B 2FYXA 3ILIA 1CJVB 4R8UB 1KOHA 5KFVA 3W65A 4A8QA 3H5YA 3G87A 2VFUA 5A8RA 2G2OA 1M5PC 5ETVA 2RNEA 4HHUA 2GHPA 3MAHA 3UVJB 3PW7A 2PA8D 2B4VA 2WW8A 4P2XA 4XDCA 1FCAA 2J9EA 1JJCB 1VLYA 2VA3A 4ER8A 4ZIVA 1RTDA 3QJJA 1FESA 5C24A 1SC4B 2G2YA 3PV8A 1HNWJ 4IG0A 1UJ5A 5M2RA 3BO4A 1SBRA 4O0NA 4LRDA 5J2QB 1HBNB 3R97A 2IJFA 2OLWA 3EZOA 1TKXB 4MJKA 3CJKA 2MHEA 3BR8A 5HANA 3BPDA 3WIVA 4U7UK 5KFFA 2FVPA 2KN4A 4O0IA 5CHCB 3EYZA 2WRMA 2AGOA 3R5JB 2JH3A 2B5JA 2IHR1 5D4PA 1M1KT 3QT8A 3GV7B 4Q8EA 1IWGA 3GQCA 4DFKA 5BYRA 1Q82T 4ERDA 1R31A 3KJQB 2GS8A 1HW9A 2JFKA 2IRXA 2A0FB 2BQRA 3VVTA 2XNRA 3EGZA 4C97A 2E9ZA 1NKEA 4U6PA 3CC4S 1LFPA 2IC3B 2BM1A 5IT0A 2LKZA 5B7WA 5HATA 2L08A 4CO1A 2DH7A 3CPWR 1EP4A 3KHGA 4HDGA 5B0EA 4K5RA 2H5EA 1RA6A 4OYOA 2Q1LA 2V63A 2KHCA 3G2XA 4CO5A 2DIVA 5L1KA 4URGA 1BY9A 3FEYB 2AJ0A 3R27A 3UNGC 2UUCJ 3CDUA 2R8KA 1RTJB 1X8DA 4W92B 2EFQA 1JLEB 4X84A 1MWQA 5JXSA 3HI9A 2BANB 1S72S 4IRKA 3LAKA 2RRBA 1RT3B 3KG4A 2CQPA 3VAHA 1R3NA 4X2BA 1NAQA 4RU9A 5D8HB 2QSWA 2H65B 3OXFA 2VC1A 1IR2A 1SUQB 3EVMA 3MR6A 3X3UA 3KMSA 1FRJA 1XTZA 2GVDA 5HJXA 1I5OB 1F1BB 3QBCA 2YNFA 4ZVQB 1NNDA 1IKYA 1MROA 3X1LB 4OZNA 2HQIA 2AX0A 2CG8A 1JNZB 4DSLA 4AUKA 4TU7A 1OQ6A 1LV5A 4DR7F 3GIRA 1HI8A 3VAIA 2A3JA 1R43A 4O3QA 4FKXA 4TN2A 1OY8A 4KFBB 1AROP 2V2ZA 8AT1B 1WEYA 2DNZA 3BZQA 3BPSP 3PYFA 4OMFG 5DGAA 2RF2A 4N47A 2IYGA 1GMWD 1NJIT 2B8QA 2BKOA 4I7FA 4DLEA 3KLFB 2ZUGA 3HHEA 3CWJA 3TR5A 1ZM4A 1R27B 1K8AT 2IVYA 4DV1J 1CG2A 4RW4B 5KFHA 3TAQA 3VZIA 1URNA 2ACMA 3NGKA 5K14A 2HS4A 5KFBA 4HHJA 7FD1A 5KFMA 2FLPA 1FWLA 4USUA 5L1LA 2IIHA 5JUMA 4NLDA 1WF0A 4DFJA 1SV5B 2DCLA 1VBXA 3DI6B 4Q44A 3KG0A 2P5VA 4C3MA 2FHOB 3UR0A 2UUAJ 1AFIA 2V6AA 4IH7A 2LA6A 4ZN1A 3BGFA 3MCMA 3PW5A 1OJ4A 1T02A 2W7AA 2IM2A 1RJJA 2C3OA 4M5DA 3G6ES 4EBCA 4IH6A 4DN0A 1L3KA 1Q8KA 2YQ0A 2KZZA 4RPFA 5ADZA 2POKA 3NAIA 5IT4A 3OHAA 4NEZA 1RAJA 3HD2A 3LF0A 2FB0A 1SQEA 2N7CA 2VJUA 2YPYA 3TARA 2W2QP 2LU2A 2C2RA 2CWXA 4FN5A 3GIIA 3MEEB 3DNCA 3HP6A 5H9EJ 2KU7A 2VASA 4F3MA 1PO6A 1Q7LB 4OI3A 4ANEA 3PIPQ 2YKPA 2JC0A 3M05A 3CVKA 1R8AA 5DDRC 3PXGa 2PEHA 3SFUA 2RILA 4IFYA 4IDKA 4C48A 3N01A 1CEZA 4DSIA 4YB7A 2OEKA 3Q24A 1N52B 2IAJA 4DV6F 2HHTA 4LBHA 4LF6F 2VG6B 3RBXA 3MECA 2GW8A 3IRWP 1FX2A 1VRUB 2ZH1A 1VBYA 2AZ3A 4P75A 4ED0A 2J0QD 2CRLA 4HH1A 2GX8A 3G4SS 1FA0A 5HSPA 3EWGA 1KS2A
chains in the Genus database with same CATH topology
4R0JA 1UA0A 1O8BA 2NREA 2YTCA 3MFHA 1ZM2A 3W7BA 4NLXA 2F9JA 3IO1A 2PO4A 4Y28C 4F25A 5IM0A 3GYNA 3F73A 2B9XA 4ZDNA 5F8LA 4E0DA 1S1UB 2VBZA 1FK9B 4PWUA 1UEVA 2B0GA 3OTOF 2W9BA 1OIAA 3BB5A 1F5AA 2DR5A 1VC0A 2YNIB 1HPZB 1N5QA 4EUVA 3BO3A 3NS5A 2QA1A 4TY8A 3K2YA 1IKVB 2ZC4A 3OTEA 1UVJA 1LW0B 3MEDB 3CD5A 2W9CA 2RQKA 2EFPA 2XSJB 3TX8A 3VAMA 2COLA 1FE4A 4KB7A 3DRXA 1S48A 3QMQA 2IMWP 2AJQA 3FSIA 2VZ9A 1HBUB 4OI4A 1MW7A 1Q8IA 4J37A 1TFYA 3EPGA 2GMJA 3PJWA 2F1FA 3RR8A 1GQEA 2V4JA 4ILRA 3NMAA 2J0SD 2L3MA 5GAEI 5A2QY 5F9NA 1TKZB 2CYYA 5E2QA 5F8HA 5KG7A 4GO7X 4I56A 2AJFE 3M1VB 2KFNA 4OHXA 4NRUA 2XB2D 2HFZA 2I1RA 3SCLE 3UQSA 4QR0A 4C0OC 4J9QA 4EBDA 1BGXT 5HN0A 4BWJA 4WFZA 2MQLA 4A8OA 1VOMA 3PM9A 1T94A 3QZ8A 2HIQA 2QRRA 1D8ZA 1E6YB 3L7PA 2B7CB 4DR1F 4ES2A 5KFWA 1QUPA 3I0RA 1S0NA 1SXLA 1IR0A 4J9RA 5MAOA 1LQ9A 1UP1A 2XS5A 3L7OA 2VBYA 5CYQB 1X0PA 2E66A 3MTKA 3HHLC 4A8SA 3MI7X 3U02A 4DQSA 1NK8A 1M90T 4F02A 2WONB 4RW6B 1ZAXA 5KFSA 3RU0A 4BC7A 2M7SA 4C9DA 1C0UA 4EGLA 2VUGA 3QGPA 3HO1A 1QE1A 2OFHX 2R7QA 4I68A 4CIOA 4Y6IA 4LSLB 3M2VA 3MEGB 3TUZC 2I8EA 4Y2IA 1LFWA 4CZCA 3VWSA 4I6WA 1FJEB 3J7Z5 4X4QA 2GCFA 2W8LA 3O3LA 3AA9A 5HROB 2XHWA 1C2PA 4L72B 4ELVA 2GHVC 1KVJA 2QO3A 2M5YA 4NCGB 1FJ7A 2EWHA 2U1AA 1Y5NB 2Z4PA 3M8QA 2L9WA 3AH6A 3JSMB 4CTAA 1PC4A 3K5PA 2XULA 1MMLA 2HFOA 2JOQA 3N0VA 1P8GA 1H38A 3QAUA 2D9PA 2QMXA 2IA0A 1L5UA 2ROPA 5CQGA 2HLTA 3QPIA 3C6TB 2LDIA 4GKKF 2V8GA 4IR9A 4HL9A 4F50A 1RKIA 4YFUA 1FVQA 1Q8LA 1RT5B 4DN9A 2JEFA 3FNNA 3K5MA 4NLVA 3RB4A 1U6FA 1VQPS 4J9LA 3J81Y 3CMAS 1TL4A 4B3SF 4R25A 1D9DA 1N0UA 1UA1A 1KN6A 1IKWA 3MM7A 2HQ3A 1PILA 4OI2A 3MWBA 5D78A 2GMHA 1X4GA 1FERA 1CQMA 5C42A 2CIMA 1AUDA 1P9QC 2U2FA 2DK2A 4M8LA 3CUNA 4K4XA 1D9FA 4HI2A 4IOAQ 1X5OA 3FMBA 4XPEA 3OQ2A 4IH5A 2OPQB 1QUVA 1U1OA 1L3SA 2VPZB 2KXFA 2DTJA 1M5HA 4O44A 5E7OB 4DUYF 3RAQA 3DLGB 2FD2A 2HMIA 2CPJA 1RT7A 1SJRA 4FNHA 3N6MA 1SKRA 4B3MF 4R8UA 2AF6A 1HBOB 4PXBA 4ZP6A 4A47A 5LMNF 1GTEA 4F3QA 4J9MA 5CCLA 3PHEA 1IN0A 1B0TA 2HNYA 2OTJS 1NU4A 3DDKA 3DN9A 3ZZTA 5LXYA 5CYQA 4O4GA 3G6XA 4H4KC 3DXSX 3HVAA 4NX9A 1C1CB 3UR3C 3WC0A 1S9FA 1VQYA 2DNPA 2HS0A 2NXUA 2AX1A 2YX4A 2Z8QA 2DNLA 2WSFC 4PWDB 1ZTTA 2I9SA 1NJXA 2XY6A 4ZA1A 4ED5A 2CJAA 3C46A 1SI9A 1X4CA 4LFAF 1MU2B 4GKJF 2FJXA 2CDQA 2ZE2A 5CH7B 2MZ1A 1ZZNA 2J0WA 1AXQA 4HKQA 5E3CA 2XC9A 3M2UA 2MHNA 2XY7A 1VQLS 2DGQA 4Q0BA 4QWCA 4AXIA 2OKQA 1WEZA 1YJNS 1T8EA 5HI7A 1K1SA 2W24A 1U48A 2VH7A 1U7LA 1UWBB 4KR0B 5E3PA 2I5JB 2UP1A 2MY7A 3MXHP 2JHEA 5J2MB 2WHOA 4QIWD 1JLAB 3CCQS 5A8WA 5BJRA 1U1NA 2MZRA 3IGNA 4NMLA 2G4BA 5SZTA 1JB0C 4CH1A 3JTOA 4K50A 2ILZA 4HYKA 5J2QA 1VC6A 2DGXA 1HBNA 3D1OA 1S99A 3MMCB 2YKQA 3RAXA 4FP9A 4OZ0A 2VG5B 1JMTA 3PR5B 4DV2F 2WSCC 3BQ1A 3QYYA 2XS7A 3PX6A 3T6JA 2L41A 1MMDA 4J9PA 4DR3F 3KK2B 2GQ2A 4UUXA 1TKXA 5KT3A 3OFGA 2O5DA 1X4AA 2M0GB 1HMVB 3EXCX 4ELUA 5GAGU 3BS9A 3VAKA 2AP6A 1XMQF 2SXLA 1M5OC 3T1AA 2LYVA 5KG4A 2XCPA 2P9EA 5F0WA 2YNGB 2DNHA 4DQQA 2MYFA 1FKOA 1T03A 3C6UB 4PR6A 5GAGI 1B0PA 2GGPB 3LGMA 2GV1A 2MQOA 5KFXA 1HBMA 3IR5B 4G1PA 4C11A 3N6NA 3LP1A 3I96A 2CG4A 4UUWA 2GNKA 3PFOA 1GAOA 4CO4A 2WK4A 3VQSA 4F4KA 1S1XB 1RT2A 2WOMB 2K7KA 3Q8SB 1R8BA 1NJZA 2LLZA 4ETZA 3T9ZA 2MMYA 3W2WA 4H4MA 4DF8A 4NXNF 3SMZA 3DDNA 5B0AA 1LW2A 1Q4RA 3O5TB 5B0DA 3TVZA 3GIMA 1VQOS 3CD6S 1NK6A 2UXCF 1N5VA 1YRXA 1C4AA 2KT2A 1DHMA 2W4CA 2DIUA 3BGUA 2V9WA 1RT6B 5T7LA 2VFSA 4MAKA 4OX8A 1TL1B 2HFNA 3QGIA 2W4PA 4PCQA 4RW9B 4YDDB 2YWFA 4KV8B 4LMZA 1YGYA 5KG2A 3MGJA 3BF4A 3POTB 3UW1A 3MOZA 5K8PA 4A46A 2N4CA 3OL6A 5KFQA 3HVTB 3LPYA 4AE5A 4TYBA 5EX0A 2IC3A 2CPYA 4FXWA 4QWAA 1U1QA 1HQEB 2R7RA 1S97A 1Z1ZA 4UW2A 4O3PA 3WC2A 1K1QA 3R1LA 1BQMB 2ROGA 1N48A 4BDPA 5HMXA 2C28A 4ECSA 2V2KA 2R7SA 1E6VB 1T7PA 3D0IE 3OSPA 1F0XA 5DM6Q 2FTRA 4ICLA 4QWBA 5AXMA 3OW2R 4IOBA 1GXUA 4EEYA 1R0AB 2ADCA 5KFGA 4MKBA 1AFJA 1Z2ZA 4WJBA 5GADI 3C2PA 1W2IA 4ZP8A 2R2SA 4YUDA 4C8KA 2ZZMA 3G86A 3PKMA 3OLAA 2LQ9A 4XAKA 3DU6A 2EG2A 1S9GA 1V3ZA 2XBPA 3FFIB 3OLBA 1H3DA 3T5LA 1U09A 1DTQB 3R5BA 5I4MA 4DL4A 1UKUA 1UETA 4LF8F 4LFBF 2JLEA 2BR0A 1RT4B 2UVRA 4PXDA 2M4MA 1KLNA 4QWDA 1H7XA 3ENVA 4TU9A 4QU6A 3E8OA 4KE5A 2ZH6A 2J9CA 1HQUB 4K4UA 3G71S 3E2EA 2RT3A 2R2UA 2FJVA 5J2NA 3S7RA 3HHLB 4QYZJ 3CCLS 2XZWA 2YH1A 3HK2A 1GH8A 2LEPA 4DR5F 2APOA 3T19A 3U27A 1QVGR 1DZ5A 3OUYB 2FHJD 2J6UA 1CC7A 4AXJA 2V5HG 3I4PA 5LJ5Y 1RTJA 5KT4A 4WFNQ 3MMBA 2YKMA 1YQHA 2BOPA 1DJ0A 1JLEA 5HBMA 2X1BA 3HJFA 3HVRA 4YR0A 3IG1B 1TAUA 5F3TA 1IKXA 2XMKA 4QIVA 1VQNS 4NOHA 2O3DA 1IBMF 2BANA 3QJLA 1UVKA 2KDOA 2WAQD 3OR1B 4ZHRA 3M30B 3EX7B 3DFEA 1RT3A 4DS4A 1FXDA 1ZETA 3OBIA 4NWBA 3VALA 5JVGQ 2BABA 2CPZA 2KB2A 3LGNA 4RUCA 1OPZA 2KT3A 2M8HA 1YHQS 2MZQA 3V81A 1K0VA 2VOOA 1NK7A 3SQGB 2A1BA 1JLGB 2VG7B 3DOLB 3IGVA 3RB0A 1TK0A 1H2TZ 4YB1P 1JJHA 2RE1A 1YRUA 3L09A 4K4ZA 1WI8A