3KDOA

Crystal structure of type iii rubisco sp6 mutant complexed with 2-cabp
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
436
structure length
435
Chain Sequence
YDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITLGFVDLLRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based catalytic optimization of a type III Rubisco from a hyperthermophile
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
total genus 135
structure length 435
sequence length 436
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3kdoA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3kdoA01
1UZHA 1BXNA 1RCXB 2V68A 3A13A 3FK4A 1IR1A 2V67A 1EJ7L 1RUSA 1RLCL 2V6AA 4LF2A 3RUBL 1AA1B 1RLDA 1WDDA 1YKWA 3ZXWA 2OEKA 2VDHA 4F0HA 4F0MA 3A12A 4MKVA 3AXMA 1RCOB 3KDOA 9RUBA 2V63A 4LF1A 5HANA 1GEHA 2CXEA 3WQPA 1GK8A 3RG6A 4HHHA 5HAOA 2RUSA 2D69A 2YBVA 5C2GA 2OEJA 5C2CA 5HJYA 2OEMA 2VDIA 5RUBA 1IR2A 1RBOB 1IWAA 2OELA 2V69A 3NWRA 1RBLA 4NASA 1TELA 2ZVIA 5HATA 1RXOB 1UW9A 1UPMB 5HJXA 1RBAA 4F0KA 5HQMA 1SVDA 2QYGA 3AXKA 1AUSL 1UZDA 4RUBA 1RSCA 3KDNA 5HK4A 8RUCA 1UWAA 5HQLA 2CWXA 1BWVA 3QFWA 1UPPA
chains in the Genus database with same CATH superfamily
3WX4A 3OLEA 3HHLB 3TC6A 5HQ8A 3UGRA 4PBGA 2DNPA 3TNOA 3OTOJ 2DIJA 2W3ZA 5D38A 4AX7A 4PRWA 5TQLA 2WPBA 2O55A 3WF1A 3WLTA 1CQMA 1KLYA 1HNVA 4DBSA 5DF0A 3OR2A 4HSNA 3NCOA 2HQIA 4OZ5A 2VBWA 4KV8B 3W70A 3KS5A 5MHBA 1JZ8A 1RZMA 4C91A 3NZQA 4QAIA 3H2NA 3H2EA 2Z0IA 4XSMA 4GY0A 2Z56B 1BWVA 3NAIA 3W2KA 3N2BA 3ZIZA 4EF8A 2HQFA 5DQGA 1Q6EA 4Q2MA 4BA0A 1AJZA 1LLWA 5H1SV 4H7ZA 3AJ7A 1HBOB 4WBFA 4NE9C 1C1BB 3EEZA 3FEZA 4UTWC 5KFRA 3F2DA 1Y11A 1X6UA 2OSXA 2A6MA 2OELA 3BH6B 2J47A 1JRBA 5EBUA 4LSLB 3M0KA 5EMMA 3KJVB 4K8EA 4NI3A 5A6LA 1RTDB 1OFQA 4LFCF 4LF5F 2BJ7A 1BQMA 2IMRA 3CK5A 3UNTA 1PV8A 2BHYA 4REQA 1TAQA 4PSRA 3S2CA 1HWIA 3AISA 2JL9A 4G1KA 4LBRA 1MN9A 3VOHA 1RHRB 2G3FA 3H7VA 2WW4A 5C2CA 4NXMF 5EMYA 1X60A 2MLYA 3AD8C 3CD6S 1F8IA 4B5NA 3A4JA 4LUYA 1YDVA 3ZMRA 4KGJA 1HJUA 1T9VA 3ELHA 2PGFA 1K1QA 5A6JA 2HG4A 3AA8A 5EB8A 1P0DA 1T6MA 1NWUA 4LGXA 4LF2A 4FN5A 3SSRA 3G1DA 1JPHA 4J9RA 3G1AA 4LFBJ 1X0FA 3MM6A 5IFPA 3N19B 3LYEA 3BR9A 2PRHA 3TK7A 1Q6FA 4PABA 1B4SA 1ZL1A 4MZ1A 2JRSA 2Q6ZA 3SCWA 2H48B 1WNOA 2MKCA 2L41A 2HE5A 1Q6OA 3M4XA 1CYGA 4ZMGA 2DXFA 1R46A 5FESA 3GD6A 1XH0A 2RH3A 5CYJA 5J1NA 3ZO9A 4A29A 4Q33A 2BY0A 3BGUA 3HPXA 1BYAA 1KLZA 3NS5A 3PZIA 1SKRA 5DMLA 4ZTYA 3TLLA 4Q8EA 1U6ZA 4PR4A 2GGJA 3EWUA 3UCCA 4ZMMA 1A9NB 1NMEB 2BV3A 3MO4A 1V3SA 1E0UA 3LHUA 4TY8B 4ID8A 1XD1A 3SMZA 1P7TA 3NCRA 4KY3A 3ZFHA 3VYLA 2F8EX 5AB3A 4S1FA 4EK2A 1JVNA 2CLLA 3DNCA 3FRYA 3W71A 2WM1A 4HPJA 7A3HA 1HTIA 4MWAD 4WY0B 4ZPVR 2P9GA 2ADBA 1P0KA 2MQ8A 4KF1A 4UFJA 1TU0B 4PMJA 1LNQA 3L7UA 1AFSA 3SCKE 3W5YA 3MOJB 4HNLA 3POHA 5AHIA 1KONA 1NZAA 3ENWA 2ZTKA 1V8EA 1BQCA 4ED8A 3OVRA 4IIEA 5MAOA 3WLLA 2FZCB 1GVEA 5E3RA 3J80Y 2ALYB 3TYTA 1ZENA 1HJWA 4QWBA 3DFPA 4K8RA 2VWTA 1F5ZA 5FSDC 3TVZA 4PCPA 1IKYB 1FNMA 4NZCA 4Q8WA 4JTCA 1E6VB 4W93A 1TMQA 3MKVA 1W5NA 2GIFA 3W00A 3A8IA 3HJEA 3A64A 3DRXA 1PCAA 4H9XA 3KLHB 1OYBA 2LCWA 2XYHB 5F8GA 2Y1HA 1BXBA 3KBJA 3QLHA 3W7JA 4IFRA 4Q44A 3R7MA 3KCOA 3IJLA 2E68A 2XG8A 1N34F 1AW5A 3ZZ0A 4PWDA 3DOPA 5IHSA 4EGLA 1IKXA 4ZQMA 4E2BA 1U0HB 4X4TA 1N6QB 1DTQA 3VGEA 3AQPA 2A5HA 3TQ0A 1T94A 5H2ZA 2QMXA 3VZIA 3R8HA 4KBXA 5KAKA 4NMLA 1TRIA 2C2OB 2XNRA 2OU4A 1WUUA 5RUBA 3M1VB 1JLCA 3V0TA 5C8BB 4L6OA 3OTOF 2VDGA 3N13A 3KDNA 3SY1A 3AHPA 2APOA 1FWDC 3ZM8A 2V8PA 1F9FA 1U25A 2Z8QA 3H2FA 3SCJE 1GVIA 4BI7A 2PMWA 2ATSA 4X0NA 2HFZA 4JKMA 4HP5A 4CQAA 4ZSTA 2KYXA 4HT5A 4C6OA 3M2RA 4B3RF 3UETA 1YJWS 1MQPA 1V3HA 2ZUNA 1WC5A 1BWEA 4IQXA 1LT8A 1AQ0A 4N9CA 1JRCA 4EWND 4JHZA 5DY3A 4AMCA 2GGPB 2NXUA 1XIDA 2UXCJ 4I64A 3N11A 3ALFA 3LHVA 1DBDA 1FHVA 3BF4A 3RMJA 5A6AA 5I42B 2BX7A 2L3MA 4K4XA 1GEHA 3RMEA 4TO8A 3ZFVA 2ZDSA 3C0LA 1MZHA 3MMDA 2YKQA 4AQYJ 4QG8A 3AROA 2QKFA 3KLIB 1NFPA 2BM1A 3PYFA 2YCLB 3Q8YA 2VT0A 2EG2A 2XGPA 2WLYA 3KM8A 4FZVA 1SQ7A 4LUSA 2QNEA 2FLNA 3SCNA 4O4GB 3L5LA 3PK7A 1TL7A 3QKZA 1V93A 4TUFA 2G96A 2A1BA 3PF3A 4HNNA 2UY3A 4UUXA 9RUBA 3MAHA 1H0HB 5CG0A 3WDIA 2AKMA 4AMAA 5D3GA 4GJJA 4ZCLA 2UUBF 5FA5A 3CHEA 3UP8A 1V3ZA 1UUQA 4N47A 3QGVA 5KFWA 4FXRA 1ELSA 4ZN3A 3M64A 5FACA 3VUSA 2UY5A 3A5VA 1UVLA 3QIDA 3AOCA 1IT8A 1XBVA 3GIJA 3I5AA 1KBIA 2KKHA 4CM2A 2A3EA 3OXGA 2OPSA 1UZ4A 1GOOA 2ZDOA 3GDMA 4L3KA 4ZIWA 3ABSA 4EAMA 4PUJA 1FCBA 1YX1A 3KUMA 2WZMA 2DZSA 2JE8A 2W9CA 2IJNA 1U2RA 3PHEA 2WKLA 3CUFA 3ZR4A 4BFAA 4C6IA 3BH7B 3QZEA 5FKYA 2D2GA 4ADUA 5D0EA 1UTAA 3BH4A 3VHQA 1I2OA 3WL1A 4JD4A 3DDNA 4C6FA 1DIEA 2PA3A 2RJZA 4YVXA 2PAJA 5I24A 3DFHA 4KFBB 2RHGA 2FJXA 4Q6JA 1WKJA 3DLKA 4MSSA 3W73A 1U6BA 1HQTA 1W32A 4WD0A 2HMCA 4MFEA 4LR9A 5H6HA 1RWVB 1N7KA 4XD3A 2NYHA 4YS2A 4ZXOA 4QPTA 4JI4F 3H22A 1O4UA 4XG1A 3CXOA 1K3UA 3EX2A 3W66A 2OJPA 1NF7A 4R7OA 2GGGA 4MIMA 2Q1LA 1JUEA 3B4UA 3GU0A 4RR5A 1GVQA 4DUWA 1MROA 2ZH2A 1ZCCA 4H6QA 2ABYA 3MUMP 2QA2A 4FNIA 4NZFA 2M70A 3TX8A 2HWGA 4AIBA 4NF7A 3GU2A 2EI5A 1A5KC 3GK0A 3T55A 4CNZA 3N6LA 4D8LA 3PNIA 3OODA 1XEZA 2Q43A 3Q2DA 4JN8A 5CAHA 3FNDA 2LYVA 2KT3A 1XW8A 3E0LA 3RJYA 1LUCA 3AO0A 4AD2A 3ZZRA 4F67A 3SSQA 4OZLA 3E0FA 3O6CA 1WAWA 3LV6A 1TTIA 5H8MA 4GUFA 2W2PP 3DI6B 1SB6A 2GQQA 4ZZ9A 1IN0A 1HI1A 1YEYA 3V35A 4AHOA 1RAAB 1ADOA 3MA8A 5LXXA 1J18A 2FHCA 3CZ8A 1TMLA 4P2VA 3FSXA 1ONRA 3GDBA 4H04A 4NJHA 2YGYA 5A2CA 2RU9A 2VG7B 2R9LA 2O7SA 2R1MA 1I1GA 4JCMA 1UUOA 2MKSA 3C56A 4UTJA 4DV1F 4F4WA 1C8XA 4DPPA 4IGMA 4DZAA 2JH3A 4EKJA 3LS9A 3M0XA 3JTOA 1V3LA 2WBKA 4O54A 2LEPA 1Z48A 1ZY9A 5A8MA 1HBUA 3B0XA 1NPKA 3TA6A 1UFWA 1S76D 4NXNJ 1X5TA 3C2OA 3RLVA 3CS2A 5ADZA 1THFD 2IVYA 4WSJA 3JRKA 1IEIA 3UG5A 4CLPA 1FRHA 3QMQA 4ML4A 2NX3A 1P6CA 1YDLA 3K57A 4UTWA 3M6XA 3UJSA 2WW5A 1QW9A 4PTVA 2N4CA 3RAOA 3F56A 2MANA 3AAMA 4PEEA 3HA1A 3B0PA 2D3UA 1U30A 3C3NA 5H1WA 2YPIA 3WJZA 4F2SA 1ICPA 4DYKA 3LQLA 4IISA 2E9LA 2DT9A 4B9SA 1Q8IA 5AE1A 3MEKA 3ZZYA 3BMVA 2XMJA 3N79A 2QEXS 3SZ8A 2D2JA 1CSJA 1BYCA 5H8UA 5DN1A 4JN6A 2MKJA 4CVUA 1LBLA 2Q8XA 3MJMA 2PIIA 1IXPA 4DJFC 2CPIA 2CPUA 3R13A 3L9ZA 4LWWA 1FY6A 2HZVA 1C29A 4OYWA 2CLMA 2XSXA 4FF5A 5KZEA 4G3IA 3W1AA 1SJBA 2OQYA 2B7OA 2NX9A 3N2CA 1IEXA 2DCLA 2XTJP 4ELVA 4A22A 4IIDA 3VNDA 4AX6A 4NYOA 1RK5A 3R0DA 2MQOA 2DGQA 1VKFA 1R8PA 3ONQA 5DCEA 3S5YA 1D8CA 4TMBA 3I5CA 2GGEA 4LBUA 4Y28C 1JCTA 3QIPB 1AL7A 1VYSX 1LEOA 3DUGA 2ZD1A 1JKHA 3EMQA 1FVQA 5K14A 5H9FJ 1QI4A 5ETQA 4KH1B 3FJNA 4YHHJ 1SW7A 4G1NA 2AGQA 2NUWA 4FX7A 4P8WA 1M7JA 1V3IA 4GIRA 4ZLNA 2VFEA 1FCVA 3WH9A 4IDKA 2P50A 2R7XA 3DHXA 5AXMA 1XFBA 3CZEA 2L48A 4N77A 2LP4A 3BE7A 3BJFA 3RUBL 2X1GA 3QZ6A 1E5NA 4XX6A 1R31A 4I68A 4CD7A 1OGBA 2F7FA 4LQ1A 3KOXA 3FYYA 3CUGA 2WQDA 1S5MA 1HN1A 4C98A 4GVIA 3T1YF 3OO2A 3MWAA 1OK6A 4G7FA 1L6GA 4CD4A 4OHVA 4Z2KA 2I2YA 1E4LA 5C25A 3TXVA 1HIYA 2O67A 3T44A 3OUYA 3MSYA 3FRZA 1EGMA 2DR7A 4ILSA 3M6UA 2QUTA 1N33F 4DV3F 1XH1A 5HL7Q 4WSHA 2V3DA 5D4OA 4J1OA 4WF9Q 4NY2A 2Y5SA 4ACZA 2XWEA 3DFSA 4PMYA 1NLKL 3LXCA 1GK8A 4ZEPA 3I87A 3B8VA 4DQRA 3BDPA 2VZTA 3MB9A 3LWMA 3MM5B 4DUZF 3L4XA 3AZSA 3JUGA 1GKQA 3RBZA 4UIOA 3WEZA 5I3JA 3G86A 4C2MA 3W3OA 2XIBA 1Q45A 3ARPA 5I2UA 5FI8A 1KOOA 1OJ4A 2Z4PA 1QK2A 2Y1RI 1A4MA 4IQEA 3CSKA 1VF8A 3GY1A 2B56A 3WQCA 4OZ0A 4EOUA 5A6SA 4QWEA 4KBIA 1SO5A 4URQU 4PB4A 2QVNA 3E51A 4ERDA 3W7KA 3Q22A 1U1NA 1EKRA 3EOSA 3W37A 1B9ZA 3VZZA 5IC6B 2V2QA 2V3GA 2RHSB 1O1ZA 3AYRA 2V67A 1B0VA 1S1XB 2B3TB 1U1JA 1NU5A 3NQ7A 4RE3A 4MK9A 3IK2A 2VPWB 5BW6A 4I5RA 5K9DA 2D23A 1JULA 2PDKA 1WDRA 2KM8C 4H8VA 4LRDA 2B4UA 2G5WA 3UJFA 2M8HA 3K1GA 1ZCOA 1APSA 2CWNA 2QF7A 3D66A 4PQUA 4X66J 4XQ6A 2AAAA 3CHCA 4RBVA 4R33A 3CJ5A 4USUA 4DYJA 2LEAA 3GIYA 2PDXA 4O8RA 4DV1J 3VUPA 4W92B 4K68A 2H90A 3HHLC 2WZTA 3I5BA 3VNJA 1JPIA 4C8ZA 2V0TA 4JI2F 1W9BM 3HPZA 4G9PA 3QZAA 2D3O1 1NDYA 3PY8A 1P6TA 3QO9A 1XYAA 5HBMA 1DEDA 4F2TA 3Q8VA 4M82A 3MQTA 4ANDA 3QZ8A 4JYAF 1MNSA 3WF2A 2HE8A 3KNGA 3LPEA 4R9XA 1PB0A 3UZZA 1PBUA 3BV4A 2DUZA 3J81Y 3OVAA 5BNKA 1GOWA 2I6WA 3PRVA 1W3TA 3DN9A 2BRKA 1O5JA 1QSSA 3WD1A 2EFQA 4OYXA 2YWEA 2VWSA 3MMBB 2FC9A 4E8GA 3RB3A 1AD4A 4CCEA 1DWJM 4ATLA 3K0JA 2R7TA 3LTPA 2G2YA 2HVZA 4XO0A 4ERIA 4B02A 2J27A 1VQYA 4PUNA 1RUSA 1SMDA 2BM0A 1R6WA 3HI9A 3IM9A 3S3GA 1Q2RA 4XAFA 3NM3A 1PEZA 4YYFA 2DO0A 1ZJBA 1GX6A 2DGWA 3MCMA 3A24A 5HNRA 4MNMA 1LLOA 2O7QA 4BDPA 3O8WA 1E6QM 4X9YA 4OOUA 3UBPC 5IS2A 4H4OA 2VQUA 2HS0A 1KD1T 1H73A 1JXEA 4HOXA 1S57A 2OGYA 2V4RA 1AW0A 4AL7A 2HSEB 1NM9A 2NXJA 1R8CA 1VLWA 4PG6A 3FFIB 1QNPA 4A21A 4K2JA 2J25A 4DZ6A 2U2FA 3CJKB 3LBCA 4A8XA 2HHXA 4JAWA 4O12A 3OGSA 1XRFA 4IOAQ 3WK2A 5E7OB 1VOMA 2XO7A 1Y7PA 3MEGB 1Q3NA 5CC5A 1F05A 3MVIA 3VD9A 4DAFA 3EICA 3DLLQ 1YRXA 2OIHA 1N36J 1RISA 4IIBA 4AYGA 3WNKA 3CC4S 3W5XA 2RT3A 3R1HA 3EXYA 4EYIB 5M3WA 4CQ9A 4C7QA 4V1YA 1S0OA 4GYFA 1HNIA 3OBAA 4W7VA 1RWMB 2C3MA 3R6GB 2OMLA 1I6JA 3UR5A 3NL3A 3TIMA 2WC4A 3PBGA 3AAWB 3BQ0A 3M0IA 3LU2A 3PNUA 2QA4G 4NYYA 2BHZA 3PPCA 3DRSB 5DLGA 4WE1B 3NQAA 4D6FA 2YQ1A 3W1LA 5IRPA 3M2VB 4O3NA 3PM9A 4RW9B 3VOIA 3ILIA 2Z1WA 5CPQA 3C15B 1LROA 1SI9A 2X3DA 2HHQA 3NGRA 1XDLA 2GJNA 2L9NA 1J5OB 1EOKA 5GADI 4PPZA 2ZH3A 2JHEA 1RP9A 3W2MA 3L0GA 1EIYB 1X6NA 2GDQA 5DDQC 4RV8A 3U1LA 4DV6F 3O44A 5ECUA 1J5TA 1CXHA 3NL6A 1MMLA 2DIUA 2B6AA 2X05A 1JXVA 3SCVA 4GC7A 5E9AA 3R5GA 2WV8A 5I02A 1V6TA 3UCZP 4QU7A 3D5HA 1QI3A 3AYSA 3MUTP 5HJYA 1M6JA 3NO5A 1JYWA 2QMUB 1NDVA 2HS8A 4EI2A 4HYVA 2FYXA 1MWZA 3E0IA 2FHJD 5DBUA 1FFGB 3O0FA 1JLAA 3NBPA 3DDKA 2C22A 3W6MA 1N5VA 1J0HA 1EZWA 1UKSA 3CZJA 4JTQA 2XHCA 5KFLA 5EWFA 3IR7B 4DI8A 1JK9B 4Z0SA 5EA9A 4HTYA 2V5LA 5G2WA 1JQXA 1PWLA 2WMHA 1R9YA 3I6RA 2DV0A 2OWXA 2BVTA 4V19X 2F9DA 5FL0A 2PP0A 4RE0A 4D1IA 3TOQA 5LZLA 2A2CA 5EY5A 3PX0A 3BOFA 3PTQA 1W3KA 3NQGA 3JZUA 5SZTA 3TYBA 2ZVSA 2JVRA 2ZJQQ 2N7YA 2OPQB 2IMWP 1MXGA 3WMSA 3CO0P 2BBFA 3HFTA 3MC5A 3ITTA 1K8XA 1TYGA 5DRCA 1WI8A 1J12A 2XINA 4NX9A 5LSRA 2DEIA 3UXKA 3WDJA 1RAJA 1SR9A 2GFFA 1GCYA 1JCYA 1S5TA 1Z69A 1UR0A 4UNKA 3VOJA 1NK5A 3W8GA 1SSGA 2IKIA 5F2LA 2QLYA 4TX9A 3LNMA 3DMJB 1NDZA 1TQLA 4CLFA 2GQ3A 1VBXA 5CH7B 5M5DA 1DXFA 4GYKA 4DJDD 2VFDA 1KBJA 4RW7B 4LC6A 4U7UK 3KUHA 1VLIA 3FBBA 2E1MC 3HSDA 4RW3A 5E0CA 1JPDX 4DV4F 1ZJIA 3UZWA 5REQA 3TAPA 2VEKA 2PDCA 2CQBA 1XICA 4MJKA 1P0NA 1OZQA 2PWVA 1XIQA 3BM7A 1YK9A 3VIJA 2HFVA 3ZOAA 4Y7EA 3GXMA 5J2NA 1LQ9A 3SI9A 2YCLA 1UETA 3ITOA 2ERRA 3PJXA 2C3ZA 1AMYA 4GO7X 3EGVA 1FRJA 1BQGA 4LUSB 4QQ3A 4L9XA 3VDGA 4YR3A 1JL8A 4A8WA 1VQNS 3W88A 2DNKA 4D3GA 4BQ3A 3DM2B 2ZITA 3BN4A 4A8FA 4F0RA 5LNSA 1U2FA 1D9FA 4NHVA 1AA1B 1K03A 5A6BA 4BI5A 3IVUA 4PCFA 3PJUA 4GG9A 3D0IE 4FBTA 4F79A 1SL0A 4B9LA 1XC4A 1DJQA 1QTMA 3V4MA 1VPXA 1UVIA 1O0PA 1W3IA 3A22A 2ZADA 3M5XA 3MZIA 1D8ZA 3GDKA 3DI0A 4DV5F 4RNIA 3RO6A 4DPWA 4U5IA 1MU2A 2CU0A 3CYVA 2MZ1A 3M0MA 3CIWA 1DHKA 1UWAA 2CWXA 5BU6A 4GO9A 1X5PA 5K9FA 4A05A 3CE8A 1K70A 1U1HA 1XIIA 4CLYA 2DIKA 2W9CB 4M5LA 1DJZA 3H55A 1FX6A 1U7LA 4H8UA 2OYKA 2OB3A 5B7ZA 1JCMP 4V33A 2VB6A 2W01A 2NVDA 4DR1J 4D3HA 2W9BB 2NLWA 2ZBTA 4FPIA 3R7BB 4G8TA 2OGJA 3R0UA 5G1YA 3KWSA 1QLNA 3BS9A 4USHA 1TV5A 3MR7A 5EFDA 3DHFA 5T7LA 4C0HA 1D3HA 4UZUA 2AJ1A 3I56S 4LF5J 2JIWA 4HD5A 1FFQA 5EX0A 1UR2A 2ABAA 4LAZA 2F4VF 1LQ0A 4K1GA 3QLHB 4O4VA 1VHFA 2LLZA 4E8UA 4UNLA 2DNYA 4YB5A 4O10A 5FJUA 1NH8A 3CDEA 3O6DA 2DW7A 2YDRA 3ARQA 3WQ4A 3ENQA 4CU6A 2JLGA 2ZM6J 1Z89A 3IARA 2R91A 4ZQOA 4MH8A 1VCVA 2N82B 2GJXB 1DV7A 4TIMA 3G6VA 5DFAA 4Q7AA 2DSWA 1W9UA 2ZX6A 5BR8F 4FF7A 1AQFA 2GGHA 2OKTA 4A2RA 3PR2A 5TAOA 4DRSA 1HKAA 3M1ZA 2EFPA 2PI6A 3FBCA 1FKAF 3G6MA 2QMJA 5FJRA 1REVA 2CXGA 1C9WA 3G1VA 4YLWA 4DV2F 4EEYA 1EETB 2ZOMA 3CQHA 4Z1BA 3FJ2A 3IIPA 4IZGA 2NSCA 4B5XA 5GAEU 3BLOA 1N5YB 1CJVB 4P74A 4J5NA 1OYCA 4NRRA 1FWWA 2VD3A 4CO0A 3MI7X 2HHTA 1RAKA 1RY8A 2Y3YA 2ACQA 1Q16B 4M5NA 4LFAJ 1LT7A 5ETNA 1LLZA 1SH0A 3FLUA 1MMDA 4E3VA 5I3GA 4KTQA 4XAZA 2BG5A 3PYGA 1DZ5A 4WUIA 1VQ8S 3OFEA 4BEQA 4EXAA 4M5GA 4O1EA 3RU0A 3TV8A 4MAZA 4P75A 2Q6CA 3MT1A 1T0TV 3HD2A 4EVZA 2KN4A 2V8VA 5E3QA 3LCGA 4XUYA 3PW5A 3VAMA 4UFIA 1IYXA 2QSWA 1U1QA 4KJIA 2NLYA 2HBXA 3DRRA 3AXXA 1NJJA 3RB4A 4YMEA 2FTYA 1GUVA 4DWSC 1WE5A 3KLIA 1Q66A 1OM0A 2BGSA 3STPA 4IMAA 3N4FA 3K89A 3WN6A 1C1BA 1EDTA 5TIMA 4DNHA 2HNDA 4IFVB 2OKQA 2Y70A 3H6OA 4PG8A 3EDEA 1C93A 5DQHA 2EJAA 4DB7A 2DNGA 1X5SA 1SC4B 1RA0A 3M0JA 3VCRA 1UD2A 4PFMA 2V3FA 1P9YA 5HJLA 4H7VA 4ZQPA 1K1SA 1I0BA 3P74A 2ZC1A 4C6EA 2JFEX 3T1GA 4CH0S 4A8YA 1OYDA 3ZZOA 4RW4A 3MKKA 3HFZB 1A3XA 1ECQA 3R8RA 2UUAF 3S01A 2CA9A 2CJYB 3AI0A 2AYBA 4BLGA 4PUEA 5LJ3Y 3K4WA 4CZCA 4HK6A 3CCES 4X4QA 4LUJA 3B4DA 2FMOA 3RILA 2HS6A 5BMXA 1US3A 3QIPA 5DJBA 2WSRA 1WUEA 1JKHB 4RWXA 3WLSA 3L09A 5I00A 1YJ9S 2OLHA 3HHNB 4KRTA 2MQLA 4WF7A 2QR6A 1E6RA 2LA4A 3FCWA 5CYMA 4O3QA 1EHWA 4J3TA 3LM3A 3ABZA 3H2AA 2LEBA 1B0IA 3ZJKA 1GMWD 5FD0A 2E5IA 4MYTA 4NLWA 3W9IA 5CC7A 1MW3A 4OJHA 1DQ9A 4X0VA 5KFYA 1WAUA 1ISXA 4Y9AA 5E1QA 5HINA 1EQCA 3FCHA 4M51A 4QQUA 9XIMA 2JEPA 2R24A 2OPRB 4XAKA 4RK8A 5BOEA 5GVJA 3G4SS 1Q81T 1U1OA 3WQDA 2X0HA 4DNMA 2BKNA 4CNSA 3EZ5A 4OI0A 3W7HA 4KETA 1KFBA 1V6HA 3NWRA 1GVSA 1JCLA 1GOKA 5HR7A 2AHOB 3CMES 2O9TA 4C1NB 2YJQA 4LV9A 4ZCMA 4YL2A 2OLAA 3BGRB 1F76A 3MD3A 4OHZA 2C0HA 5K8NA 4EZ9A 1T99A 2V50A 4DQQA 1XTZA 4HDGA 1VJIA 3WDPP 4C6NA 1EJXC 4Y9OA 3TCSA 3RITA 1NELA 3NGFA 1H2VZ 4XUGA 4FNUA 5ETMA 2QV5A 1CEZA 3DOLB 4YCPA 2O9RA 1VLOA 2QCMA 5K2ZA 1FE0A 2PN6A 4IMDA 1XNQJ 4AXKA 3T3FA 1PX8A 2VU5A 3C2VA 2F9RA 4HDHA 3DECA 4MKSA 1FRKA 3CEDA 2QJMA 4WDWA 4Q8OA 4AIEA 3LHZA 3L21A 4MVAA 2YKMA 4XISA 3F4CA 3UVJA 4WIIA 3HG4A 1HKWA 2HQCA 2Y1IA 2G3NA 3ZS4A 4AFYA 3BURA 2OD6A 2LDYA 3AA9A 3FNNA 3MDFA 1RT3B 3MUXA 1M04A 3H21A 3HQOA 2OSYA 4AZIA 3H59A 5I3PA 4F36A 1O68A 4ROQA 2XNQA 1N33J 3DFEA 1HNVB 3F7JA 3J7ZT 1XS2A 2EVZA 4HACA 2QDHA 1DHMA 4GH3A 4KT2A 2W61A 3UJRA 1F9EB 3KDOA 2GUUA 4OJYA 2SXLA 4RR4A 1JD9A 1IKXB 1U0HA 3ZWSA 2HAFA 2X1BA 3OHAA 1RT2A 3LA0A 3KOZA 4FXFA 1E0TA 3QW3A 2VP8A 4WXYA 2ZXBA 1YDYA 3MO7A 2V69A 4IPLA 4ETXA 2NWRA 3BLPX 1JNRB 1HMVA 3D46A 1JNZB 2MSSA 4EXBA 2BYCA 2XLJA 1HNWF 3NZGA 1S97A 5F8HA 4O13A 1HQUA 3CV1A 2CIPA 2X41A 4A46A 2J24A 4N9EA 4UQGA 4LNYA 1DJGA 1DJWA 1E56A 3IIVA 3IGUA 2BJ3A 4O4RA 4QE4A 4AWTA 2GMJA 1UMLA 4LRFA 4A8KA 1U6FA 1HHQA 3P67A 2E8YA 1DTTA 1PIIA 1T3OA 1XIFA 1Q6LA 4QWDA 2DD8S 4BY3A 2IHR1 3CMJA 3L5AA 2XMVA 2WOMA 1XLJA 1TE6A 3OR1B 4I4BA 5IFMA 4K2XA 3GSMA 2QZ8A 5B0DA 2ZZTA 4K0KJ 3T9PA 2GGPA 3DFTA 4QSHA 2AU0A 4NL5A 5CD4A 2OD4A 1G3OA 3SRKA 2WCSA 4HN8A 5HPCA 1SPBP 4E0CA 5C5YA 3W1YC 5FJOA 1TMJA 3E3HA 2NSXA 1RK6A 2WYSA 3TR2A 1LORA 1E15A 1GZJA 3QC3A 3UY8A 1KNZA 3QGAC 1R0CB 3ENAA 2ZZ7A 4OBRA 3MUZ1 1YZ6A 4N8OA 1UASA 2O0TA 3PSVA 3CJPA 2NV1A 4U4MA 1NOWA 3RPDA 1S12A 1TKZB 1OK4A 3WBXA 3GR0A 5EFFA 3C2YA 4ZPDA 3X3UA 1SJFA 1MUCA 1KWMA 2MZTA 4J2PA 1QBAA 4NRSA 1IZKA 1CIUA 4RNHA 3UD5A 2A21A 3EWXA 2REQB 4L3NA 5IXUA 4ED4A 1J0JA 3STFA 1H51A 3B4MA 3QJJA 1Z2ZA 4NL1A 1BF2A 2FTWA 4ZVUB 1M1KT 4KO0B 2BJEA 2O3DA 3TEHB 2VFGA 3R5AA 3U02A 1YHTA 1OFRA 4O1CA 4AVFA 3U4FA 1US0A 4YPJA 1G4EA 1W9VA 1WC1A 2HRYA 3LP2B 3PBVA 4MB1A 1TIWA 1BMQB 3MF5A 3TA2A 1OT1A 4R7WA 3CJKA 4KPLA 1RJJA 2YIHA 1NXIA 3GSDA 5J04A 2IVFB 4P7NA 1PYFA 1TREA 4DYEA 5H8PA 2ZWZA 1FXQA 1WKYA 4RU9A 2QLXA 3GXTA 2BE7D 1PAMA 4JTUA 4K4TA 3TQEA 5FLXU 1K8ZA 4ZODA 2YWHA 2PGRA 3MSRA 5I5RA 2BKOA 1TO3A 1U5JA 2ZZ2A 3TZFA 1BF6A 1ZS2A 2EKCA 3NQCA 5I3UA 7AT1B 3HN3A 1QM9A 5EWEA 3DERA 4A8QA 1DE6A 1D9AA 3SZ2A 2WCAA 3E49A 4FDFA 4FKXA 3NQEA 3C66A 3V75A 2EBGA 4NNAA 2GHWA 3S1TA 2QCDA 1PZ1A 1U8WA 3KCJA 1ZOTA 5HNNA 4X4RA 2J9CA 4I7WA 3SYZA 2VX5A 3G1SA 1YMYA 3GH5A 3D3AA 2IY5B 2XI3A 3IR5B 4YHHF 1S38A 5MF5A 4UFLA 3E5PA 1OF6A 1PKUA 2PDJA 3MI3A 4U31A 5EU9A 1LWIA 4TTUA 3A9BA 2YL9A 3SN0A 3NOCA 4IH5A 4WQ6A 4ILMA 1PX3A 5THWA 3WC2A 4MK7A 1WO2A 3CZKA 4UXDA 1LWJA 1JJCB 2QCGA 5LIXX 3N2MA 3E2SA 1MLAA 1N8WA 4AEEA 4MMOA 2HRTA 2VX4A 1IXKA 4PFHA 1D9EA 2JJ4D 2Z2YB 3V6KA 4BQ2A 2X30A 1ZM4A 2J0QD 3CT2A 3NURA 4B15A 3WD4A 4I2QA 4FOKA 2ZA3A 2FGOA 1G5AA 1VQOS 4GKKJ 1I2NA 1J2BA 5A2BA 1DYSA 1HA1A 1L6YA 5IT0A 2IJRA 3WQFA 5IOLA 4C8YA 1OO0B 5C9ZA 4L9YA 4J9SA 4JI1F 3SQSA 4FLRA 4MG4A 3OHIA 2MLXA 3BC9A 2X1SA 1C7SA 4M63A 5FJ4A 2J0XA 5F8MA 2COLA 1SJCA 1JD7A 4WPAA 1HUVA 1Q86T 2AKZA 1TZ7A 4TX6A 1KXHA 4XVDA 5BWFA 3CIZA 3LTYA 1M9HA 4UOCA 3R5EA 3BGOP 1UZDA 3R10A 1JZ3A 1LF1A 1PKNA 2IYIA 1EXPA 3DAQA 2EF9A 3EX4A 2WAQD 1RY0A 5DZ6A 4C3MA 1FWFC 3MP5A 1F3XA 3TJ9A 2QLBB 2WB4A 4TY9A 3KHRA 2ZX8A 2V5JA 1VBUA 2P5NA 3EWBX 3MU7A 5AYZA 3B8IA 3I3EA 1MUWA 3EDKA 3R79A 3CEUA 3W22A 4PA8A 1IWAA 1RBLA 4GCAA 3NOGA 5D3GB 1PYOB 3DG6A 5AXNA 3CUZA 5CJ5A 1E3ZA 1A4LA 3FDKA 3GUGA 2Z00A 5CKSA 1ZJHA 1C8YA 2GCFA 4PGLA 3UZXA 3A8EA 3TUUA 3LH2S 1C0TB 1B70B 3BARA 1X1OA 1RADB 4JI3F 1I0DA 3L65A 2GNKA 2IDEA 3CD7A 4Z2JA 2D0HA 4L6V3 1Q82T 5LGXA 4JOUA 2A3JA 3LPFA 5A8WB 1CI1A 5IC4B 5A6MA 4PR6A 5DDRC 5ETSA 4LXFA 4ZOBA 1FD8A 1I94F 1PYTA 2QO3A 4L7ZA 3RLUA 2XSJB 2V4JA 1DXEA 3CCWA 1N55A 4IRDA 4AZ7A 3PTMA 2MNRA 1LBMA 4CDIA 1JJKA 1C0UB 4MB4A 3HU7A 4X61A 1JLFA 3L4ZA 2FVSA 2LLEA 2AWZA 5AZ1A 2QUNA 4XWUA 1U2YA 5DRKA 2D69A 5A6KA 4DF0A 4F48A 3NL0A 4WDTA 1D0EA 3WQGA 4A48A 1UW9A 3JS9A 3AALA 2PDQA 3QT8A 4ECZA 2XFYA 4M24A 2CLEA 3VIOA 4JIQA 1BE4A 4JI7F 4N6FA 2HWHA 2UP1A 1WG1A 4MGGA 4Q7NA 2EC0A 4LREA 2CKRA 2X3GA 1KM0A 1VQKS 3IGNA 5I23A 2AD9A 4TV6A 1HL2A 4U28A 4C8KA 3SJ3A 3PKYA 4IKAA 4QU6A 3PWGA 3WD2A 3EWCA 3RAQA 3CQJA 4GNVA 4ZK7M 2DP3A 1WKLA 2CQ3A 4PEOA 3WNPA 4WP9A 1ZFJA 3NSNA 3RX4A 2EBEA 4HNVA 3DRPB 4WYWA 3WQ8A 2QPUA 3PEHA 5T7LB 4MK8A 1FWRA 1AUSL 4R88A 4X4UA 1GZGA 1WDTA 2W4PA 4LW7A 3OXLA 3PUOA 2XIIA 4Z7CA 3W1TA 2XS2A 1FTXA 2B7CB 1BKSA 2G95A 3W1PA 4AB4A 1J96A 3ES7A 4B91A 3KTSA 4LF1A 3GNOA 2CQ2A 3D1QA 4MIBA 1MW0A 2CVIA 4G1IA 1TMMA 1LKZA 4WFAQ 1K9MT 4HI2A 3F5KA 2VVNA 1OYAA 1CULB 3CTLA 4RJVA 1SUXA 2JEIA 2XM2A 3BSAA 2P9EA 4L80A 3REQB 1E40A 4JI2J 3BLKA 1UPPA 5KZDA 3KLFB 1XP3A 4NNCA 2HDJA 4DQWA 3LAKA 2ZZNA 2KZMA 3U27A 2V5DA 3TI0A 3QY8A 4CD5A 1REVB 2OPQA 1GQKA 2KXFA 2NX1A 4A3RA 3P96A 5GNYA 1EEPA 1HW6A 3GFHA 5E5CA 1VIXA 1N5YA 1NK4A 3AHZA 1KTVA 3VE9A 2QTWA 1F4HA 3PZ9A 1FDZA 4JEJA 1ZZNA 3KVMA 1UD8A 2A79A 2J7GA 3KOWA 2JKPA 4GYPC 4CU8A 3RZAA 3TMLA 1OX5A 2IXVA 4FLSA 1GQEA 3SQLA 3CL7A 4LUBA 5BOOA 4EUVA 1B30A 3F41A 5E5NA 5J2MB 1PILA 2NXHA 2PP3A 1EH9A 4RPPA 4E38A 3KNAA 5JXSA 2FVMA 5REQB 4DLMA 4U10A 4JQ3A 1I9CB 1K4HA 1WC0A 4IG3A 1S79A 1PJ7A 3CPWR 4ATNA 3UVIA 1SUQA 3D6MB 3T09A 3ZO7A 1RWWB 2FB3A 3JAMY 1J6PA 2C91A 5HR6A 2EG1A 3QSIA 3O2LA 5DQPA 3DRRB 1OEPA 5H91A 4HHLA 2ZBRA 2ZE0A 3RLGA 2V8ZA 2JKEA 3V6DA 3B8DA 2JWNA 2DYAA 2ATLA 2J9ZA 1RK8A 1PJ9A 2E0PA 1X7FA 1DL3A 3AMGA 6CGTA 3G8QA 4GUGA 4O4WA 4DXLA 4ELTA 5G5IA 5LA0A 2M0GB 5FEPA 1X31C 3WQEA 3R43A 4NLUA 3ITYA 4NXSA 2QG9B 4AW7A 3A3XA 4YUDA 3MI6A 3TJ8A 1VJWA 5CCLA 4ZQNA 5HBFA 1YJVA 1V4YA 1ML1A 1RV8A 5IT9Y 3FSYA 1GWJA 4LALA 2WC3A 1LXNA 1P1XA 4PSPA 1G7CB 3CTRA 4DJFA 2MMYA 4CLLA 4A8LA 2PU1A 3W7NA 5IDZA 2P2CB 4J7CA 5K20B 5AOUA 1H3GA 1Q79A 4G56A 3R58A 4IP5A 1QUVA 2HNYA 1XLMA 4KE5A 4DX3A 1UMJA 2VFHA 3I82A 3MFIA 5CGMA 1Q7YT 3USBA 4M5IA 2YXGA 4FPRA 4NLSA 4UOZA 3XINA 2CQIA 5KFJA 2JLEA 6XIAA 2AGKA 4MB5A 1RWPB 5C25B 4JV0A 1KR1A 4OWGA 4CKQA 1EBHA 1OG6A 4OBTA 1BQXA 2NUHA 3RB0A 1IQTA 1P0BA 3LW5C 1BEUA 2I5IA 4YEAA 3P5YA 4DELA 3H4BA 3TMQA 1UA3A 4G7EA 3JSMA 4OGZA 2DNNA 3MR2A 4LFAF 1H2UX 2E9RX 1K44A 1QWGA 1GJPA 4O57A 3PHAA 1JNDA 4GK8A 2UY2A 3NNAA 4YWIA 1EX1A 1X6LA 3URBA 2W63A 1KBBA 4OI3A 1EIBA 4P9SA 3PBYA 1ZBCA 2VICA 1CEOA 4OQVA 4PMUA 5LNWA 3PTWA 4FEZA 4GGHA 1R47A 5C7HA 1NQKA 3G18A 1TVPA 4F50A 2XYPB 3P61A 5D2WA 4HK7A 2BACA 1S46A 1TB3A 4B9UA 3VIMA 3WJXA 2DR6A 4OE7A 1TA3A 4Q4RA 1EYWA 1RR2A 5CBIA 2VEGA 5HMYA 1C90A 1QUMA 3P3BA 4NA3A 3WYZA 1E6SM 3KZPA 5DS7A 4FZIA 3A3NB 1DJHA 2VKZG 2ASJA 3IP0A 3IVSA 3M9NB 2ZUVA 4AEFA 1RQEA 2NZCA 4RW5A 4Z17A 3KRSA 2A10A 1Q0NA 3TA9A 1V3RA 4AD5A 2FKPA 2XY7A 3AU2A 1A47A 2PD1A 2HS3A 5J2PB 3SXLA 1TUVA 3GIMA 2G4BA 2ZZ3A 5KFIA 2OPPA 2MY8A 3PB0A 3APTA 1GQJA 4Y65A 3URAA 4B4FA 4J9NA 2KVIA 3TLQA 2YNFA 4JPGA 1JDAA 5J1EA 2M2BA 3Q45A 1NWSA 1EYEA 1E9IA 2FHBA 1T9WA 2QGFB 1ZGDA 3GLJA 3UDLA 2QPXA 2B81A 5IM0B 4ZGYA 1XCFA 1WJ9A 1VQ6S 3OVQA 3I4PA 3Q65A 5TNVA 3SR7A 2KO1A 4DR3F 3W1UA 3OL7A 2UWFA 4FNRA 4LVAA 3CDAA 3QM3A 4QIFA 2PB1A 1FVSA 1R3QA 4ECLA 3OXFA 3C0JA 3TYUA 4E98A 4DSIA 2V30A 2DQXA 4P2SA 4PC8A 3DGPA 5ETLA 3TAMB 2G0JA 2ONEA 1KLNA 3B3DA 1LWHA 4WKAA 4FVMA 4Q43A 2JIEA 4DOZA 3NPXA 4ALZA 2W6RA 2CBJA 3O07A 5D6GA 1QAIA 2H65B 4OV9A 5HAOA 1QSLA 9XIAA 1K9TA 1ODUA 1PZ0A 2WJEA 2WOMB 4QLJA 2WHMA 4ROPA 2VA2A 5M03A 2JALA 1A80A 1YPIA 3MMAB 1EP4B 5A8KA 3BMXA 1WF1A 4QQBA 1N2VA 4QWCA 2HNZA 4C8MA 3QBCA 4RKUC 1BLIA 2OQHA 4DWSD 2G3MA 2ZZ6A 1QPNA 5CYMB 4P8VA 2JQXA 2DXEA 4B9TA 3LI0A 3AQUA 4Y2KA 4N9DA 2OSRA 1TG7A 4W9TA 5ETTA 2NSBA 1CTNA 2QUMA 4KCTA 4NEZA 3AFGA 2HV5A 5EKYA 2X7VA 3WBZA 2WZIA 3STGA 4JNZA 2Q6BA 2P6TA 1A3WA 3TEGA 2OSWA 2C15A 1N4LA 2G9OA 1VI7A 3RW6A 1S6UA 3L4YA 1S49A 4F3OA 2PI4A 2Z2UA 2ZUUA 2BQ3A 3WDQA 4OUEA 2G1HA 4U5KA 1LOLA 4HTBA 2FHJA 5DDOC 4UOHA 1RDRA 1CX9A 5CABA 3LM7A 2K1RA 2V63A 4GMEA 3CUIA 3BDKA 4DLFA 4HCHA 2ZX9A 1GPFA 2XMAA 4HL9A 2GZOA 3BGRA 2FTRA 4IUFA 1V0LA 3WENA 1FD2A 5C5JA 2ZVIA 1Y5WA 3PCOB 3I7QA 4EXQA 3S4TA 4MDOA 1SC3B 4GI8A 3GX9A 1U0SA 2FGZA 1OVDA 4J9PA 1SJ1A 1TKXB 1H7NA 4FX6M 3W7RA 3AHVA 1I3OB 4BWMA 1DQ8A 1K47A 3EDQB 1H38A 4FS1A 3SN1A 1RD5A 1UA1A 1S2UA 4DL7A 3A3WA 4NI2B 4RUAA 3BYRA 1X4AA 2E1RA 2BZNA 3M2VA 3TX9A 2H54B 1FJ7A 4PEKA 1CS4A 2Z29A 4I6VA 5E70A 4NRTA 1M7XA 3H25A 3SFKA 3QRRA 3GYXB 2W9BA 4PTDA 3U57A 5GAHU 1LV5A 4TYAA 3WSUA 3T2PA 4FOUA 1NJZA 1P6BA 1NJYA 3NFUA 4HPGA 1QBBA 1F6YA 5C42A 3AD7C 2NQPA 3RBDA 3BJSA 1EP2A 2R1NA 3QTPA 1VIZA 4ZR8A 4RDZA 2C1IA 2EHHA 3P14A 4AWSA 3BO4A 3GO2A 4H4MB 3CD0A 2FFCA 3JS3A 1LQ2A 2VV5A 4Y2MA 4I6WA 3VPLA 1IUJA 5CZTA 1Y7VA 2XO6A 4DR2J 4JDBA 2BA9A 1SQFA 3WLPA 2J9YA 3AWOA 3KHHA 5EX3A 3MPGA 5LL6d 5M1TA 4DMZA 1FHUA 1GQIA 4JN7A 2Y0SD 2D24A 1NK9A 1QJWA 1ZZFA 2PTXA 4JEQA 2QGYA 3P80A 1KRBC 1RJPA 1IWPA 3ZNJ1 5KFVA 3K8KA 2HKEA 3QT7A 3EOLA 2WVFA 2YR1A 2ZE3A 3TFXA 3RR4A 2EK6A 1WXYA 4NCGB 1WX0A 2E7VA 1JLQA 1QOXA 4O0ZA 3QHOA 4FF2A 1QPQA 1S77D 1B1YA 4JYDA 4RX6A 1D7KA 3EX1A 3PFOA 4JHMA 3ILOA 4JTEA 1RCOB 2A7RA 4PCNA 2FDSA 2OT0A 4ZB5A 1CJTB 3T2QA 1NO8A 3OQ2A 3LCFA 2BASA 2ALRA 3QGKC 1PKLA 4X66F 1TAUA 4ED3A 2P8CA 3D2WA 3GV8B 2Z28A 4IFKB 4O1BA 4DQPA 1OJXA 3LP1B 1KRPA 3SUSA 4QIEA 2IC3B 3J81U 3GFYA 3HHKA 1T11A 3AXKA 3CCZA 1T96A 5C54A 2PCEA 1XK8A 2PDGA 2PGCA 4C0OC 2CLOA 3V4BA 4DPOA 4JTDA 1UQYA 3PUEA 2JSXA 4CO1A 3I0RA 1IKWB 3GG0A 3MP3A 4IH3A 3W1MA 2QMKA 1PIGA 4XD5A 4PMZA 1OFBA 4NLDA 1RA5A 1NH7A 1ULRA 4Y0FA 1OFEA 4PZVA 4M6VA 3W29A 4E2OA 1O1HA 2BEFA 2DU2A 4GX9A 4LS2A 4LC8A 1XNQF 5HULA 2FDNA 4JFUA 4DJFD 3QSYB 3NL2A 3CC1A 2B4OA 2KVQE 3P49B 2AOSA 2NQZA 3I7SA 2VONA 1XQKA 2R14A 2C1GA 4Z2XA 3VD3A 1YIXA 2IAJB 1XIHA 2GK1B 2TODA 4URSA 4CLSA 1HP5A 1H98A 4JX5A 3NP5A 3X1LB 3PB2A 5I3DA 4QX4A 3WUEA 4LAUA 7REQA 2FLOA 4NLYA 4RW4B 4X4SA 3URNA 3NQ2A 1SMAA 4OV1A 3U8GA 1YBAA 2A6LA 3NEVA 3GYCA 1FK9A 4GNKB 3B8TA 4X2PA 1HIZA 1GVYA 1OFPA 3GXIA 1PAUB 2JEQA 1E4IA 2OMOA 3KBNA 1IEQA 3CASA 5LNVA 4OMFG 3E02A 3ARZA 4KHRA 4JTSA 1DJNA 3N25A 4DBQA 1K0VA 2MGZB 3DOMA 4IOBA 1HR0J 5I79A 4NJIA 2FJAB 1P48A 3QT5A 3VMPA 1QDUB 2NQHA 1W2VA 2LU1A 4RLIA 4KKXA 4M19A 1R6VA 3QRHA 2K8GA 4MY1A 3GZ7A 2IPGA 3V36A 1JLFB 3DXSX 2DZUA 2QQ6A 1T0OA 2UBPC 2R2TA 3G8RA 1JJHA 3RRHA 1W1A1 2N3LA 1OX6A 3LHWA 1H2JA 4BKNA 4Z1CA 1XMOF 3WBEA 2YBVA 2I38A 1R9XA 1Q7QA 3ET6A 5LHEA 1D3WA 3BUVA 2QGHA 1GAOA 4M29A 1ZAVA 3ZTRA 1LWCB 5KOWA 2OLWA 5B0BA 4X65F 2EC2A 3B8HA 5CXTA 3E6EA 3LGHA 2GUYA 1IWBA 3CH9A 3RGIA 3KK3B 3VMNA 1XSJA 5AKQA 1RT7B 2KRRA 2GJXA 2KXNB 4YYCA 2YA1A 2WVVB 3ITHA 2ZBQA 4YTRA 1HYSA 3I0SB 3TKFA 1X97A 1RCQA 3DHWC 3PPGA 5LMUJ 2P76A 2UVUA 3OL9A 2E1AA 3IRXA 4GMKA 3ZTQA 2BS9A 5G4EA 4IRKA 3W23A 4X64F 1UCWA 1S7HA 4O1FA 3LGGA 4RUBA 3NQFA 2GX8A 3L12A 1QD1A 2OWCA 1I5OB 1JWWA 3EVWA 3QTGA 1GVRA 4CD8A 1KR0A 3P0XA 2YKMB 4Z0JA 1Q53A 3VGUA 1OGGA 4W84A 2XVKA 4ZO7A 2ZE2B 4X4NA 3UPBA 4ZL1A 3GXNA 2V34A 5CD4H 2V0NA 2XVLA 4FS9A 1E5JA 3ZT6A 3VAHA 2P0IA 2DHHA 1WOAA 1DRZA 1F8MA 2HHUA 2ADAA 5CC3A 2ZUMA 1NOUA 1MMNA 1S6QB 4JUZA 1RT5B 4MJMA 1TR9A 4KCUA 3BQ6A 1JDCA 1QO2A 3QR0A 2NZ4A 1RLCL 2E5LJ 2BVWA 2QA1A 1JIHA 4WTOB 2EG6A 2MDAA 3PWIA 3TWBA 2YXLA 1NEEA 1NUEA 1F5CA 1UBSA 3EXTA 1EO5A 3U4AA 1DLOB 1XYMA 1QOPA 4ZHRB 5FF0A 4GXMA 4N02A 2VR2A 1SJ3P 4K37A 4C97A 2ASLA 4KWOA 3MPDA 2G0WA 4ZO6A 1SZEA 1XR6A 2CJXB 3EDRB 5KT6A 4ZQCA 3JSYA 1JDDA 4J7RA 1C9DA 4LF9J 2ZCGA 3R12A 3G22A 4HT3A 3OFGA 1PBGA 1FWGC 4FNHA 2EEXA 2PMQA 5HDRA 4IOTA 3M8PB 1UQZA 4V2XA 3WBAA 2VGBA 5AFDA 3BLFA 4LANA 4Q4MA 1J11A 2NXGA 3O6QA 4EPEC 3NM1A 2D20A 1LFWA 1PIEA 4YTSA 4JFSA 4LF7F 2PC6A 2C79A 1XMQF 1D8YA 2BVYA 2GPTA 5F8NA 3QRQA 3W1XA 2VPYB 4N5SA 4I6YA 4DM1A 3FDSA 3JSRA 4JZ5A 4WTYA 2F6UA 5M2UA 3C3LA 4WJBA 3DX5A 5JJBA 1S9EA 4QR6A 3AB2B 4UOQA 4B2DD 4XAPA 1GOIA 2Y8UA 2ZHOA 3KK2B 4N8NA 4H9YA 4O14A 2C2ZB 4YB1P 2HVOA 4UFKA 1WHVA 1VC4A 4FLOA 1EX5A 2ZDRA 3EWYA 3RU6A 3ITVA 3U5UA 2V4QA 4DQSA 4NAEB 4H19A 2R3VA 1UC4A 3I4EA 3LD5A 4E0DA 5L1JA 2Z2AA 1R7AA 5BRPA 3NSMA 3C16A 3QQ0A 4JV1A 1TKZA 2DNQA 4JV2A 1TVRB 2DY1A 4AZHA 4YHGA 1YBTA 2CXEA 1S9FA 3GG7A 3WH5A 3ABXA 3XIMA 1PPIA 4LX4A 4XBJA 4L73A 2ZUSA 4DBDA 1UMYA 4AF0B 3BAWA 3F4WA 4L4LA 3HQPA 3AH6A 4B3ZA 3SQOP 3UJEA 4LVFA 2X0YA 2VASA 2R7VA 2TPSA 3KTXA 4K8HA 2V68A 4FSAA 2YCEA 2PFFB 1CXIA 3MPVA 1AH3A 3AS0A 3LPYA 3WQ5A 2XUCA 4H1ZA 2CPEA 4HPNA 4IJCA 3LP2A 4DX7A 3APYA 1E51A 2BJ8A 1BSLA 3OZPA 3BPWA 1V0KA 1CQNA 1URRA 4LR8A 2CERA 2OTJS 2CADA 2V5CA 1JDFA 5D9NA 4MUZA 2D9PA 4CGTA 3CJSA 3U3HA 3KZSA 2QFJA 3H7HB 1E9ZB 1VFFA 2Z2BA 2CKSA 4Y00A 3NRBA 1UR3M 3V0UA 1KFWA 1Q6DA 1DJYA 4X3ZA 1XPYA 5L1LA 3VOGA 4WEVX 3W7EA 3WD3A 5AE2A 3BZQA 1QPOA 2R8JA 1C3FA 3AODA 2Y0BB 3DKDA 2J66A 3GDTA 1KQKA 1LCOA 2W5FA 2YCJA 4EP8C 1BHNA 4X84A 4IG2B 3QAEA 5KZ6A 3RYSA 4PG7A 2M52A 1GYLA 4C3KA 1YE6A 2VZSA 1QMLA 3JTNA 4IP4A 1M5WA 4NPOA 1M01A 4KH2A 3CLWA 4LVBA 1E4NA 1CJUA 3H5XA 4YR0A 1ZAHA 2VC1A 4HVZA 3M6DA 1Y8BA 1BPLB 2I56A 2XSFA 3B8WA 3LCLA 3THQA 5KFHA 5JUVA 3NLCA 5A3HA 3A3HA 3AJ2A 2BJDA 2BXVA 3UXDA 2P1FA 3PEJA 5AN7A 3R3TA 2YKKA 2WMIA 1E70M 3M32B 4WU3A 3PSWA 1Q7LB 2GZXA 1HMVB 3C0SA 1XFCA 3M44A 1ELOA 2HHSA 5DT5A 1SU5A 2XJ7A 4TVUA 2VQFJ 1J0IA 3OR2B 4LOCA 3VOFA 2A4AA 2UUWA 2F84A 1LFPA 3RX2A 4KPYA 1FA2A 1MEHA 1H61A 1L3SA 1TV4A 1NZ8A 3E8OA 1HKMA 3KFWX 5JMNA 1DWHM 1F74A 2GIQA 1QO5A 4NLOA 3LANA 5GMEA 1FA0A 2RIJA 1UH2A 1Q65A 5F1UA 4DV7F 1UIOA 1RQHA 4CO5A 2BY3A 4PYDA 2GVEA 4DFMA 9CGTA 3NGJA 3IWPA 3KJVA 1JI2A 1RABB 2RDTA 3E0WA 4NU7A 4JX6A 3DGPB 2RKIB 1RTDA 3MTWA 1MNEA 1E71M 2RDDA 1UJ4A 3BPSP 1J27A 3MM9A 5BRBA 3AIBA 4K39A 3WK1A 4X4PA 1H1ZA 2AIRB 3UZ5A 2XULA 1B0TA 1EUAA 2YKPA 1YJTA 4FYWB 1V5VA 2E3ZA 2FH6A 3K8VA 2HFNA 3GNRA 3L7OA 4I6AA 4DUXA 1RP8A 2DJWA 3R2CJ 1R8LA 2WVUA 3PR5B 4MIAA 3OGVA 3FC9A 5E6ZA 4K4SA 3AYTA 4H00A 2ZYFA 3C52A 1OABA 1S3HA 2OZTA 3P8IA 1EAYC 2CLPA 2QA4S 2REQA 1AVAA 1JLGA 3KCLA 1NKEA 4WHBA 3JTPA 4GVHA 3THCA 4P5UA 3NAHA 2OI2A 3TJ4A 1XRVA 3M5VA 1LOUA 1H41A 2WXDM 3IIZA 4W8LA 4QIGA 1T8EA 4S0MA 3MURP 2ROGA 2AEMA 5BMWA 3LX9A 3PAOA 3KL0A 2ZH7A 3P5TL 1GPWA 2VD9A 3IUDA 1E0WA 3F03K 3CDUA 4CO3A 3LPGA 1IKVB 4WGXA 4R9OA 5AHMA 3GC4A 4QIWD 4UOGA 2HLUA 2GVGA 2ZRVA 5IT4A 1VFUA 5A8WA 1CGVA 3M6WA 3G1YA 3A3PB 3M8SA 1OCNA 4USWA 1V5IB 4QS6A 3ZLFA 1Q8LA 5AHNA 1IQZA 3RG6A 1ZP4A 2OOGA 2ZA2A 3TFCA 2B5JB 3CWHA 2HFOA 2DH7A 3MVTA 1HD1A 3TYDA 2I7GA 4OIXA 3P5BP 4ID5A 1H60A 4NSBA 1RHQB 2Z2ZA 2OG9A 4MZYA 2WPGA 5A6BD 4B3KA 3PVXA 1WEXA 4HR2A 3N18A 4I8DA 3CB4A 4TVAB 4ZP7A 1RTJB 5B80A 3VU2A 4OFZA 2HVHA 3POCA 1FRBA 3DZ1A 3LOUA 1X4GA 1FDAA 4WXZA 4WYLA 2J7BA 2LXFA 2J7UA 4J91A 5CYQA 2FGLA 3DCAA 2EGZA 3SM0A 1FF2A 5FL1A 3UNGC 3UXIA 1QASA 1UOKA 2IIHA 4JCLA 1UOZA 1Y10A 4GX8A 2RFGA 1OG0A 2YPZA 1G2EA 1ISWA 3OU8A 3Q83A 4BS2A 2HRWA 4BJHA 5LSMA 2QLJB 1QNVA 1T5AA 2FHMA 1F73A 2RMLA 3F5LA 1S7IA 3N01A 3QPYA 1CVJA 1TPH1 1VEPA 5F4SA 2BABA 4NCAA 1WEZA 5D77A 1RTIA 3MXHP 3TTEA 1XDJA 3UU0A 4HNOA 4MLJA 3GILA 1I2QA 1BG9A 1ZTWA 3QJPA 5I0DA 1R8BA 4DDFA 1RE1B 1UJ6A 1HBOA 2KH9A 1TPUA 2EKGA 2QAFA 2R42A 3SUUA 1XPGA 3UA4A 4O18A 1RHCA 7ENLA 2W67A 5LMUF 3ZZZA 2SFPA 3MUVP 1K7XA 4GXPA 3NGUA 3S2LA 4PCSA 2JF7A 4KGMA 5M2PA 1VYRA 3L2LA 2CDRB 4D6JA 1YTYA 2P5VA 1HJSA 3DH7A 2CIMA 1O8BA 3W7PA 2B7NA 4LS1A 1VB9A 1XI3A 4IPNB 4CNYA 1PC4A 3HOJA 4WDXA 5D8ZA 2V9WA 3AS1A 1KFJA 1EJUC 4N9BA 5L8RC 3GFZA 4QJ1A 1XWYA 4B16A 3UYCA 2XPKA 4LS0A 5I3HA 1MYRA 1RWUA 3TP4A 1VRTA 1B7YB 4C6KA 5AYXA 1RKJA 1ADSA 1U1UA 2B7BB 4RBUA 1SYTA 4DN0A 3T81A 4OTKA 3TJLA 3UWTA 4FP9A 1OD0A 3GCXP 1Y5XA 1AH4A 3SCQA 1L3UA 3OTCA 4ZOAA 1A50A 5AYIA 2GVDB 5JVHQ 4IG3B 1MQRA 1Y5VA 3AMDA 5CZ0A 3O1NA 2C2KB 1LOQA 3IV8A 2ZEJA 4DX6A 4XZMX 2E5HA 3WQVA 2PA8D 1N32J 5HA7A 1HGYA 3K4DA 1UKTA 4JI7J 3ELFA 3WCZA 1TK5A 1OC6A 3KLGB 4BWJA 2J13A 5KFOA 1OPZA 1S48A 1QJHA 4CU7A 3MAQA 4O4GA 2O9OA 3MEEA 1CC7A 4PUDA 3ONCA 1P5BA 2CLIA 2JVOA 4DO5A 2D2OA 4O0QA 1BGXT 1J0YA 5J2QB 2A6NA 3M05A 1VJSA 3QMRA 4C6AA 2V4JB 3C5QA 1UL3A 4M0XA 1KFLA 3CLMA 4F2RA 2QE5A 2WQPA 1UWBA 2Y8VA 1SCJB 3DGBA 1KVKA 5A8OA 1TCMA 1XMQJ 3UW6A 5CAKA 3BGFA 4OZ1A 5L9NA 3WNOA 2J7FA 4Z1YA 1KKHA 2DNMA 3M8RA 4QJ4B 1B3OA 1XM3A 2GQ9A 4IJBA 1LWXA 1OIAA 5FAJA 2Q8LA 2XM1A 3MHFA 4I2PB 1KLMB 2A7NA 1YJRA 3RRXA 3UD6A 3UPFA 2DJXA 1S1WA 3NEKA 4YXGA 1DQUA 3HGOA 2LA6A 2G41A 4YMZA 1C4CA 1E6NA 3UZJA 4EPKA 1ECEA 4ZKAA 4LRCA 1U8SA 4FF3A 5G4HC 2ZX5A 4PUMA 4MKYA 3I65A 2EQDA 4GCXA 3QR3A 2J7HA 1FDYA 3LRLA 3KBSA 4NZJA 3U6WA 5HP1A 2N3OA 5HQEA 1W5QA 2HK0A 3N4AA 4MTPA 1JYVA 5C42B 4XZNX 4R5EA 1G6BA 2R7UA 1NJWA 2KZHA 3RR8A 1I94J 4HA0A 3EA1A 2KT2A 2WK4A 1W1B1 2R7QA 2Y7FA 1XLDA 1S9GB 2DEPA 3PHTA 3R6IA 3CBWA 1DTQB 3BW4A 5D8HB 1DJXA 3MSGA 1J0KA 2BY1A 2ACMA 3KK3A 3WLOA 4QCFA 1OWXA 3RCYA 2VC9A 2E4TA 4RZ5A 3I3DA 2PDHA 1X9MA 2V2CA 2AGOA 3SAZA 1V5XA 2AJ4A 4J3VA 3CJ8A 3AQOA 2Y4SA 3AXMA 3G82B 5BYWA 4FK9A 1EP3A 3G1XA 3RCMA 3FHAA 3IRXB 4H8NA 3EBVA 1HZYA 2IS7A 4BBYA 2YDQA 4QBUA 5ITHA 1EC9A 3B8SA 1XBWA 4HBKA 2EFOA 3R7SB 2IFXA 3T78A 2VRJA 4LY4A 2UUBJ 1GG0A 2OHDA 3GXFA 4CQDA 1J0ZA 3S47A 3FGVA 4C5ZA 4X62F 1KVIA 2XMTA 4UMCA 1XXXA 1ZJAA 4MB3A 1EHNA 2WZ1A 2FB0A 3THVA 2BVZA 3T5HA 3MPWA 1MG7A 3KOAA 1NBEB 3MYPA 4TU1A 2QIFA 4DY1A 2CUYA 3EJMA 3WLMA 1HWKA 4QS5A 4LCQA 2G2OA 4HMCA 1AFIA 4M5DA 4M5HA 3R11A 4TTGA 1JQGA 2L9DA 3BKTA 5C9XA 3GH7A 1H5VA 5EYWA 4GA8A 1SFSA 3K5OA 4UZCA 4G1PA 1ALDA 1RAGB 1WYIA 5ETPA 3PJTA 3WNMA 3OPKA 3TUJC 2BP1A 4LV4A 3GB0A 4UMAA 4BEUA 2YL8A 3C8YA 5KZMA 1SJQA 4XKMA 4AYSA 2VELA 3V6DB 1TKKA 1H49A 2HTMA 1F6PA 3WQ6A 4PTNA 3EMCA 3R0KA 1T02A 3H5UA 4DV2J 4PRFA 3W9ZA 4GYPA 8AT1B 3CT7A 4UQAA 1RP5A 5TBOA 1HQEB 3K5MA 3ZWTA 4GQQA 4CNTA 1BQMB 2W2OP 2GA7A 2DIVA 1J93A 2CLFA 2HYIB 5C24A 4RZ4A 2FVPA 5K7JA 2B7QA 4CLTA 2RE1A 4DPUA 4R25A 1FK9B 3CCTA 1TTPA 2GIRA 4UUIA 1TK8A 4FNSA 1M3UA 2E5CA 4ZFCA 1EF2A 4QE5A 4HA4A 2J76E 4USTA 2G3IA 2DCUB 3CJ3A 4YY3F 4F3QA 4LAKA 4LRTA 3EVMA 1TPVA 4ZJLA 1UHVA 1S1VB 2V8HA 4UTGA 3EDDA 2X1IA 4OX9J 2XH0A 4LBSA 3S46A 3T5LA 5K14B 1FEHA 4M7TA 4FAMA 4NQ1A 1LXJA 4JQ2A 2MGZA 3WLIA 4R8UA 2LECA 2WCXA 4LF9F 2L9WA 1V77A 1WXJA 3F2BA 2CPYA 3KJNB 2QVHA 4O50A 1QE1A 3BKUA 4QR1A 5AYBA 4ICNA 2HXUA 2K3KA 4QW9A 1BRLB 3G8EA 3TJIA 3Q58A 1FBAA 4CCHA 3CM4A 3MUAA 2Y5JA 4ZB2A 3NQBA 2ISDA 3WNLA 4J9KA 3DHUA 4J3SA 2QS8A 3UN2A 1VBJA 2JEGA 4E4PA 3B9EA 4GVLA 1EWDA 2A3BA 2IQDA 4CWBA 4I67A 4USKA 4HEA9 4E5TA 3MV01 3T1AA 1L5UA 3LCIA 1QNSA 5HMEA 1B5TA 5KSWA 2LFVA 4TY8A 1Q13A 5HNUA 4J9UE 1KRAC 2POKA 4IL0A 1J2VA 2QLWA 3IAPA 2N4DA 3QBUA 3IGHX 4B9ZA 3ADAC 2ZH6A 4JI8F 4I7FA 4HH1A 4HN4A 3DIPA 4L75A 4ZPCA 2AP6A 1KXVA 3DGRA 3ARUA 4AVNA 5KFTA 2XIMA 3GR4A 2XGZA 3EB4A 1OS5A 3SCTA 1KFEA 2BBEA 1M5KC 2AMCB 2YXOA 2MZSA 3IV3A 3RM4A 1AXQA 2HRUA 3C19A 1YE4A 1QNRA 3BVJA 3PO5A 2VXNA 3I4HX 3EXCX 2IBOA 5EWGA 1O95A 3C8NA 3T42A 3UGVA 1FNOA 3O3LA 2XQCA 1MRQA 4DSKA 3H7RA 4HB7A 4S3CA 3N5FA 4KGZB 3MZNA 3SGZA 3K2GA 3QYSA 3VKBA 4P7OA 2ZE2A 1RU2A 4Q8FA 3HHLD 1OCJA 2WWDA 4XPCA 4GY1A 4L6HA 4OV6A 2KL8A 1EX8A 4C6LA 3ITGA 1E6VA 1S1PA 2Z6IA 1KB3A 2VL1A 5E9XA 2HPUA 3GQCA 4WP8A 1UH4A 3LDVA 3CGIA 3W72A 3RRGA 2KJVA 4AXJA 4DVOA 2M4MA 3HFYA 1TE1A 5DANA 4GH1A 1R30A 1JCJA 1X8CA 1ZYQA 3HG5A 4L56A 1SPQA 2PPGA 5KETA 1WACA 2V94A 3NS7B 3R5BA 5A94A 1KC8T 1CXFA 3S2NA 5G0RB 1DLOA 4C6PA 4V27A 3UZYA 3I68A 4MHBA 3HT0A 2MTLA 4KSEB 2Y7GA 4KCWA 2BGNE 3GHRA 8TIMA 3QWUA 3VVUA 4FYVB 3IJ9A 3IWNC 4O0IA 5D05A 4IM4A 2F4FA 3G6LA 4LCRA 2B51A 1O6IA 1F3EA 2KM8B 3GWQA 2A1YA 1RHUB 5U47A 4B3MJ 3QJLA 1TP7A 3ARVA 5AVHA 1V6UA 3N3MA 2ZH9A 2R1PA 3O7UA 3RO8A 3VR1A 2VZOA 4LSLA 1M90T 2ZA1A 4AD0A 1H0GA 2ACSA 4JX4A 3HF3A 3VNLA 3R9LA 3UPMA 4L4OA 3TQPA 4D2JA 2NCKL 4DZDA 1ONXA 3VK5A 3PZPA 4KKOB 1HJQA 4WXOA 1Y0EA 3K5PA 4KGKA 1CJTA 4RNMA 3DC8A 3FW6A 2PLJA 1VMBA 1WHYA 2OJ3A 3Q8UA 3ABRA 4W7WA 3FEXB 4B9YA 3EPIA 5HLFB 1G1YA 1ZUAX 3NXFA 2CJQA 3NG3A 3PV8A 5CEWA 1C8VA 2IM3A 3T5KA 4LCSA 1TL3B 1XNRF 3I31A 1QRQA 4Q0BA 2XN1A 4USIA 4ZITA 1S1TB 2O9PA 4M6PA 3T6JA 3RM9A 2LVWA 4N2YA 3TYAA 1UEUA 5DY2A 2FB2A 2OX1A 1GKPA 3BKFA 3MM9B 1X8DA 4PN2A 1W9XA 4DPXA 1OCBA 5BXPA 1A3HA 4G2DA 4WFBQ 2CPDA 4UW2A 1XLFA 5LMNF 5DG8A 5J1PA 1SKSA 4QJVA 4YTUA 2CNNB 1QXLA 3C16B 4AHPA 3CNYA 1TVRA 1H7PA 1OQ3A 3LP0B 4W4MA 4C6BA 5T8GA 1XMBA 3OD2A 4MMWA 2WJZA 3PZNA 1EP1A 2PZ0A 2XGBA 2MEWA 4DN1A 3A8JA 5D9OA 3VTIA 3Q8SB 3CUHA 5BXTA 3SADA 3FUYA 1NPPA 3I96A 4KPCA 4F4RA 1ZPWX 2GK1A 2FVRA 4IRCA 1CB2A 1OHLA 1AL8A 3MCNA 4YB7A 2DY3A 1CWYA 1P7TB 4S2CA 1FRMA 1UCNA 3DFNA 1T8XA 3QJAA 3FFIA 4JV5J 3RPMA 4N56A 2NR0A 4I3GA 3CAWA 3N15A 4HJFA 1F0XA 2MKHA 2Y7EA 4OZ2A 3HPSA 2WONA 3A4AA 3BL3A 1YRTA 1TJPA 3W7MA 1DY3A 2I9SA 1TV7A 2YW4A 3OFFA 1MRAA 1WOPA 2A3LA 3M8WA 1VRXA 3FY1A 2XCAA 2BJ1A 1Q8KA 3M6VA 4AZBA 4PXCA 4I5XA 1GHSA 1E73M 4D8AA 4N41A 4W85A 1U24A 3MANA 1SR0A 1PL9A 5F7UA 5K4XA 4CLWA 2B5JA 3DLBA 3DLEA 1N0UA 2B9YA 3T0AA 1FWBC 1O66A 1C1CA 5KG4A 4ED2A 2DGVA 1NKBA 4XD6A 5FF3A 2Z57B 4W88A 5GADU 3SFUA 4P7QA 2A2DA 3T0BA 2KG0A 5L9XA 1YPXA 2D1CA 3DHDA 4HZ8A 4JYFA 4QLLA 1K6WA 2BANB 2NS1B 4TVCA 4WCEQ 1EHAA 2YNHA 4JHOA 2IPWA 3I6EA 5AC4A 1ITQA 4ECXA 1NVMA 3DU6A 1JG9A 4U2ZA 2PD5A 3O0KA 2VR5A 1KCKA 3PZQA 3OLIA 4IFOA 1C7TA 1XINA 2D74B 3S0CA 4C60A 1VS1A 4JKKA 3GTXA 3W1NA 1TJ0A 2R7OA 1RBOB 4O53A 5L38A 3D4JA 1QHPA 1N8RT 3OG2A 1FKOA 1BWLA 3G3MA 1V51A 4LRSA 4MIWA 1WORA 2J9DA 3PUDA 1V6WA 4P8UA 3DESA 3A5FA 2QF8A 1WZLA 1FTCA 1WHXA 3SV3A 3CYJA 4OYPA 2VUGA 5K8PA 1E0XA 1RTIB 1X9WA 3D5MA 4XBSA 3KG1A 2WBGA 1E3XA 4L72B 1HLWA 1B3YA 3EA2A 2YFNA 6REQB 1C4AA 1BG4A 1PCWA 1IQ8A 1QUPA 2G0CA 3DYAA 5L6UA 5AT1B 3SN4A 3QOKA 4O8AA 1YNQA 2B9XA 2D7SA 3MM8A 1W5PA 5C7PA 4XPEA 4GE8A 1SV5B 4GI9A 3AB4B 3HTWA 3W75A 4HU4A 1IJFB 5DETA 2VGGA 1CGTA 3HJZA 4KEZA 3VAIA 1WDDA 3CPUA 3V5FA 4P73A 2WSKA 5FF7A 1SZGA 2RKIA 5GAGI 4O17A 1D9DA 2AMGA 3NQMA 3MMJA 3SW6A 1F5AA 3I0RB 1FUYA 5E33A 1WOBA 3PW4A 1N36F 1UROA 4C9DA 1HBNA 4JIPA 3W2WA 1RQBA 3A4XA 2KDOA 4EACA 4IPIA 2DGXA 2FZDA 3PRDA 2VRKA 1DQXA 4NIRA 4PUOB 2DT2A 1YGYA 2RDWA 3ATZA 4LY8A 2GOUA 4A8SA 3IMQJ 1TL7B 3HSJA 3K2YA 2BW2A 4Y34A 1OC5A 1Y00A 5IFTA 3ZZPA 1QI5A 3T1HJ 2VODA 3B05A 1QNOA 1WB0A 3HHEA 1U48A 2FJEB 3CF5Q 2PDAA 1ONWA 2VJUA 2FZ9A 3QPZA 4DR7F 4I8YA 1BWKA 2BMBA 1GMVA 3HJVA 1XYCA 1SGJA 1W5OA 3BICA 3O06A 4JTRA 4OHYA 3F0NA 4JKLA 3MECA 5IV4A 1H72C 5D33A 5DEZA 5KG3A 4ANCA 3PJ9A 3GBDA 5DCDA 3KP0A 4CD6A 1R3VA 3IRWP 1RAHB 3G0UA 3O63A 1V9OA 2PSZA 4W5UA 2ZD1B 1OIMA 1Y5LB 1PZ3A 2XMUA 2OPSB 3WX8A 1MDLA 4AT1B 3T40A 4QIUA 5KFDA 1HJXA 2Y2WA 3RNDA 3M0YA 5J2QA 4MWAC 3B9DA 7TAAA 3FJLA 4ZVHA 4Q4QA 4KEVA 3IO1A 3U7BA 1CLFA 2AQOA 4NAEA 2VC5A 4X64J 4R0EA 4WZQA 5I09A 3LLFA 5F9LA 4A3YA 4ZVJA 2FDMA 2FY1A 4XKYB 1AYEA 3CT9A 4KAIA 5HMZA 3SRDA 3RYLA 1KV8A 4IXXA 3CWOX 2VD8A 3B04A 4BWLA 3UESA 4PULA 3PJWA 4ALDA 4PUUA 1BLUA 1Q95G 3MWCA 2FJVA 3MR6A 1VQ4S 5HMDA 4I2PA 3IS4A 4JNMA 1VQPS 1ZRQA 3BAKA 4PMQA 1LWCA 2I57A 2NPFA 2RQ4A 1A49A 5KMYA 3KLEB 1U5HA 3WC0A 2NXCA 4DPQA 1YVFA 4GI4A 3IJIA 1PKMA 1E43A 5BOFA 5D0RA 2UUTA 2R8GA 5LIKX 1ZBVA 4LU0A 2DNRA 2PUZA 3W63A 4R85A 2GW8A 2C2DA 1MVYA 4K59A 4HU8A 5HP1B 3GDRA 3HSZA 1WKFA 2A18A 5KG0A 2B6AB 1BYBA 4GACA 2BWGA 1EA0A 2WK2A 5CA5A 2UXBJ 2FGBA 5C9UA 5HUPA 2E7WA 2DGSA 3KHLA 2WZEA 2CPHA 4LQ9A 3TONA 3A12A 3VA8A 4D6HA 3R27A 3CL6A 3W2JA 3NGTA 3AHXA 1PVNA 3HURA 1BVWA 5H9FK 3D54A 2OZ0A 2WJDA 2FZBA 3FJ4A 3SURA 3VD4A 3V1PA 1EKOA 4WFXA 2X2YA 4L61A 4J9OA 1DTUA 1RKIA 3DKJA 2J7DA 3TR5A 4GFSA 2PU0A 5C55A 1ZTTA 4MWAE 4I5UA 1FWNA 3T19A 4RW8A 5A1AA 3W60A 2W8KA 3NMRA 2G13A 4B9NA 4LF7J 2CETA 3ILLA 3RLHA 3GU9A 1WC3A 1KXQA 4X22A 4I90A 3GNNA 5JMUA 4AD1A 1HARA 3GIQA 4D6IA 2HBYB 2DRAA 1R9ZA 3IGXA 5JIWA 4PMXA 4KFPA 3PG8A 1HGWA 2A3CA 2FIUA 5GAHI 4JB8B 3T0TA 3S1GA 3TU9A 2ASYA 3OSNA 2QCNA 1KRMA 3HV8A 4EZ6A 1DTNA 4W90B 3GDLA 4PMOA 4QLKA 1OSEA 4D6GA 1VRTB 2RRNA 3C6UA 4MLRA 4GC6A 1UWIA 3WFAA 2A0FB 5KFCA 5D09A 4EWJA 1MW2A 1FWPA 2VL4A 1D3CA 3A4WA 3S5NA 3MPUB 1FTRA 2M9KA 2W1BA 2GVDA 4G1QB 3GKFA 1H7RA 2GUBA 4PAAA 1KM2A 3K8LA 5JIPA 3F4DA 3IFEA 3BAIA 2DR5A 1M41A 1TPEA 3BLIA 4U96A 2NQ9A 3MUY1 3A9IA 3C46A 3RW7A 4OYBA 3H20A 4XZ9A 4NXKA 1E1CA 2W92A 4B5TA 3N2TA 2FZGB 3WK0A 3SCRA 2CHNA 2QUUA 2V38A 3H24A 3BSOA 3D1HA 4QG6A 4IQDA 4MUPA 1KGWA 3DM2A 3TA0A 4ANEA 2BGQA 1FKPA 1NRKA 3QMSA 3NA8A 2E7FA 4NAFB 3VGSA 2XCPA 1KRCC 3VKKA 5IDIA 2V81A 3MMBA 2PE8A 4ZXLA 4IR1A 3LUYA 1S2CA 3D0GE 3E2VA 2YBUA 4ERGA 1HT6A 2E1DA 4IMFA 5CZSA 3D6HB 4DUVA 3RXZA 1TWDA 3U48A 2OEMA 3DC0A 1HD0A 3FSUA 2CQ0A 4DHGA 4YTQA 3ZZUA 3FEMA 2F8HA 1K1DA 3NAVA 3TP2A 1WKDA 2B7PA 3PTDA 3RIKA 2KJWA 1FWLA 3NSXA 1N56A 4K0KF 5F8JA 4QAWA 2WVCA 1PIFA 1RWOB 3FYOA 1VBRA 4O0KA 4JOMA 4OBSA 2B4GA 2QJNA 3OTDA 3TX0A 3KYLA 2JX2A 2YX4A 3B6BA 1PKYA 3CHVA 4FS2A 3D6FB 3BAXA 4U8YA 4YDDB 8XIMA 1FWJC 2XFWA 3W01A 1TR1A 3U9IA 2WSYA 4CEUC 3CULA 3H2OA 4WZMA 3WG6A 4DZ5A 3QC0A 3DOKB 3HGRA 4ADTA 5XIMA 4FXJA 1ZAJA 1OX4A 1JPKA 3F1QA 2J9DE 1HP4A 1J8VA 1QFEA 3BYPA 1GVOA 1NK8A 2CW6A 3CMGA 2C0AA 1VK8A 1IKVA 3VIGA 4LRAA 1NFGA 1RVKA 1YTKA 1EQMA 4LFCJ 5TF0A 3LGEA 3MOZA 5BYRA 4JI6J 3FKKA 4PTXA 3S5OA 1Z2LA 2QCFA 2DH2A 1XH2A 4U3AA 4M5KA 1JZ7A 1HVXA 4GWEA 3PIPQ 3WFLA 4HZMA 3VX1A 1NK7A 4C8NA 4KYZA 3V16A 4JI4J 3GNXA 2WMGA 1UAWA 4QXIA 4ID5B 3TTQA 5GNXA 2VM8A 4A4JA 1P27B 3EZOA 1AZSB 2IM0A 3FYPA 4DWIA 4ZSUA 3L5MA 1YPFA 3KXQA 4LNCA 2ZRWA 5E6YA 1U09A 4KHPJ 2YX0A 2VBYA 2K06A 3CMFA 1LL6A 3C0QA 3RBEA 2RJHA 2LU2A 2DPEA 3BAJA 3NIYA 3TSMA 1KW1A 1M53A 5B7YA 4OZNA 1WZAA 2HFSA 5F0UA 1MXSA 3PN8A 2KXHA 4A8IA 4IR9A 5CZJA 2GAGC 2OKOA 3FDGA 5DG9A 1SIWB 2BDQA 3BW3A 1JR1A 2YWWA 4ZPWR 3EPGA 4NNBA 1VIWA 4QP0A 1W6TA 3VC5A 1HKKA 1GNKA 4QR0A 3SIPB 1K8YA 2W25A 3VGGA 3TVAA 5DXXA 1FXRA 4NZ5A 3N14A 4PQUB 4UWMA 3KWXA 1BGGA 4WP3A 4RCXA 1S5NA 3MBDA 5JBEA 4B3OB 1UR4A 2YNGA 3K8WA 2BXZA 3OBKA 3W65A 3LENA 2X1FA 4AZCA 3NOEA 4YN3B 4ED7A 3PXGa 4USMA 1YBUA 4ASTA 1XKYA 4EBEA 1NDPA 3IBFB 1WUFA 3H2MA 3SO7A 3M07A 8RUCA 3OQ8A 4HGXA 4J3WA 2NQJA 2QV6A 4GO8A 1E1FA 1ITXA 2FIQA 1Q5MA 4PMNA 4OLOA 1JXJA 4O15A 4NLRA 1EDQA 4ZPBA 3GWCA 4CQ1A 3EYZA 5KFGA 1HNXJ 2IA6A 3CTTA 3R1ZA 1WWHA 3O5TB 1C92A 3IGSA 4KHMA 2NUXA 2X1TA 3L2MA 4TYBA 4S23A 4NT0A 1XX1A 1IT0A 4ORMA 1KC7A 1S3TC 4KHPF 3KXDA 5LSLA 2DUAA 4YIWA 3HVTA 3CQ0A 1A5AA 2OFJA 4WU2A 1EJRC 3T4CA 3G6ES 3W84A 4L4MA 4LBHA 1PX4A 3E12A 5C24B 5CCMA 4KKOA 3WMLA 2XWXA 3FCVA 1IEVA 4GPNA 2YLLA 4TQTA 1M5PC 1Q5YA 3GUWA 2MUCA 5HLFA 2AL1A 1PJ5A 5B0EA 1VFTA 3KRBA 3D0HE 3QY6A 3LBOA 4GKTA 5JXQA 3TJAA 1V02A 4TLRA 3S5ZA 2RQMA 1UJQA 2R1LA 3EX3A 2Z30B 5B0CA 3CUXA 4U2YA 3BLDA 3ZLGA 4LTSA 4GUHA 4UTFA 1TKTA 3LWLA 1JI1A 3OYZA 3QLLA 4HMNA 3EAUA 3NNHA 4RE2A 3ONBA 2O5DA 1QR7A 2BOGX 1HL6A 3W7DA 3L2IA 1FX4A 4PRRA 3SY5A 4A47A 5GVQA 1VBYA 2NYIA 5HQMA 4WX2A 1VR6A 1TWSA 2WMKA 3LP0A 1Q4RA 3J7Z5 3MY9A 2EW9A 3N5BA 1ROFA 3UVAA 4PKDB 3XISA 2GC8A 4DJDC 4RKAA 3MEEB 3THPA 2VCCA 3HPOA 3MEGA 3KOFA 3W02A 2W2NP 2XBPA 2EWHA 1KWKA 3EGNA 4DL4A 1EJWC 3K13A 4EU0A 1KXTA 4MKVA 2HPIA 1YJUA 3PM6A 3QQ1A 3TW6A 1FX2A 4JTGA 5FJIA 4KO0A 4UQDA 2N7CA 1PDZA 2QDDA 4IO1A 4FX8A 4UOFA 4B3RJ 3IANA 2OX4A 4PUKA 2PS2A 2KI2A 2DZWA 5I07A 3V3WA 1ICQA 3WBYA 2YX1A 1NF0A 3LNPA 4WK3A 4RDYA 1HF6A 4DXXA 3LRMA 2CDQA 1PE1A 1KDNA 3GJRB 3MWBA 3UW1A 3TQVA 3WIVA 2Y0FA 4DI9A 1RT4A 1K7EA 2PGWA 3SI8A 1ZETA 5IWAF 1OYEA 3WUFA 2WNNA 4TOQA 1XC6A 1NKCA 2ZX7A 2J6SA 1DWIM 3LI1A 2QYGA 2GDUA 1JYNA 3CMQA 1YQ2A 3FHQA 2BOFX 1XIGA 2PO4A 1T9XA 2X51A 1U02A 2PRMA 1VS3A 2E5GA 6A3HA 3SSJA 4CH7A 1F2GA 1A5SA 4GZ7A 1UYQA 1Z4UA 4UZSA 2CZVC 2VEMA 2GV1A 3G96A 2QCDB 2YY3A 2TYSA 2BANA 3AIWA 3IUHA 3W5ZA 4Z1DA 1W9DM 3VZHA 4NJKA 3IAM9 3INPA 3OLGA 4ZPTR 3SGGA 3OT9A 1N0VC 1T95A 3W38A 3PYEA 1DURA 2VEPA 1W3HA 4AG0A 1Q4WA 1B99A 4ICLB 4IG0B 3THTA 4ECUA 4QHRA 2ZKMX 5AHLA 3P8BB 4PWUA 1H11A 4HOWA 1DWAM 3L0KA 4WCJA 3OZYA 1VEMA 1S10A 2UU9J 4OX9F 3FMBA 2FJKA 2PBOA 1FKOB 3SCLE 1QPKA 4NUWA 1U47A 3VNZA 4ZP6A 3SJNA 4AY8A 1S4FA 2X16A 1N8FA 1E55A 2VZUA 4M8LA 6FD1A 2Z6JA 2WANA 3MTKA 1W8SA 4H41A 3WLKX 3ZTOA 3MMUA 3PR4A 3S9ZA 1X0PA 1RJRA 4FPSA 1LW2A 3PDNA 1O5QA 2GJRA 2QJGA 4AIOA 1NAL1