3KDOA

Crystal structure of type iii rubisco sp6 mutant complexed with 2-cabp
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
436
structure length
435
Chain Sequence
YDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITLGFVDLLRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase
publication title Structure-based catalytic optimization of a type III Rubisco from a hyperthermophile
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Lyase
total genus 135
structure length 435
sequence length 436
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3kdoA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3kdoA01
2RUSA 5HATA 4RUBA 4F0MA 2CWXA 1IWAA 3ZXWA 3QFWA 5RUBA 1RXOB 4NASA 2OEJA 2QYGA 1AA1B 2OEKA 3KDNA 1RLDA 5C2GA 1UWAA 2ZVIA 4MKVA 1TELA 1RCXB 2OEMA 1RUSA 1IR2A 1RLCL 2OELA 1UZHA 5HJXA 1RCOB 4F0HA 2YBVA 2V68A 2VDHA 8RUCA 5HAOA 2V67A 3KDOA 3AXKA 1GEHA 4HHHA 9RUBA 1RBOB 4LF2A 2V6AA 1BWVA 1BXNA 1EJ7L 5HQLA 1RSCA 2V69A 3WQPA 1UPPA 1RBAA 1UPMB 1YKWA 3RG6A 1SVDA 3NWRA 5HK4A 3FK4A 2V63A 1GK8A 5HJYA 3AXMA 1RBLA 4LF1A 3A12A 1IR1A 2CXEA 1AUSL 1UW9A 5HANA 1UZDA 5HQMA 2D69A 5C2CA 2VDIA 4F0KA 1WDDA 3A13A 3RUBL
chains in the Genus database with same CATH superfamily
4NYPA 3SUWA 1QLNA 3IRWP 3PNIA 3GDTA 4C48A 1Q2RA 1VJQA 1J2VA 3DHUA 1I1GA 2XYHB 2F2KA 3N4EA 3CHVA 3VHQA 4IRCA 3CQJA 3BSGA 4MOZA 1WI6A 1Q6RA 3VMPA 4M5NA 1RT3A 1SO4A 3RRAA 3GTFA 4JV5F 4J91A 1RT6A 1CXKA 1I6JA 2XYGB 3C6UA 3LCWA 1CLXA 4ES3A 4A3RA 1P8GA 1EQCA 3SY1A 4E8UA 2RJGA 2VKZG 4PG4A 1UD4A 4NJIA 3N9KA 1BQNA 1VJIA 3CUXA 2CQBA 4DXVA 2BABA 4FEZA 5KG7A 1HWKA 3ICLA 5DX7A 3S7RA 3UYCA 1EIXA 3RB3A 4K38A 3BC9A 4KV8B 3THUA 3S9ZA 2OMLA 3LOTA 3TA6A 3DUGA 5FLXY 4FNIA 4DR3F 1E9LA 1WDSA 4LT9A 2R2RA 3H4DA 2ABYA 1MMNA 3KLVA 3TN4A 2KFYA 1BHGA 3NZQA 4LNCA 1VK8A 2XWEA 2K1RB 3HHEA 2AKWB 4LF9F 1XNQF 1RTJB 2PDAA 2FPVA 3FGVA 1QXLA 3DOKB 4BR1A 1PX3A 2PLJA 5D38A 1K70A 3TAKA 2EPLX 3H7UA 3N25A 2HVIA 3E5BA 3L7OA 1GYLA 4PMXA 3VC5A 2B4PA 5HI7A 3HHLC 1P1MA 5D32A 3KLEA 3UW1A 3UG3A 3R3TA 2RF2B 2ZADA 2MUCA 3SZ8A 4AVNA 1TTIA 2YWHA 3SQGA 4X60A 3FV9A 1W17A 2XIQA 4PB5A 4K0KJ 1S49A 3JSMB 1IUJA 2BODX 4KC5A 3TW9A 4US5A 5IQQA 2VFRA 1ZP4A 5IZHA 2P9GA 1F8IA 5REQB 4FK9A 4WEVX 2YFOA 3IK2A 2XMVA 2VGGA 2NZLA 2YPIA 2KJWA 3BMVA 1J5OA 2CQ0A 1QW7A 1GH8A 3JSBA 3MM9B 4HI1A 3M44A 3PRBA 2MPUA 2E4TA 4X3ZA 8CGTA 1FKWA 4X63A 2BKOA 2QKFA 2C2EA 4TV6A 5HANA 4MZYA 2RNEA 3BCDA 5BOFA 1G2EA 3HPAA 4F0KA 5CGQA 3QWUA 3P4UB 3CMGA 3RLVA 4CQDA 3DOLA 3JAMU 4YEAA 4S1FA 4JOMA 2NXUA 3S1VA 3D3CJ 3VK5A 4TU8A 2MQNA 4K2XA 3WIJA 4RPFA 4JFTA 3P7YA 2C2RA 1N5SA 5IRPA 1GVFA 3CCES 3A5FA 1ITUA 2HRWA 3J7Z5 5C42A 2XU2A 1UR1A 1U25A 3EXYA 3N73A 4NLQA 1JXVA 4L9YA 3BJYA 5BXTA 3A1YG 1SW0A 4JDBA 1E6RA 4M82A 4X2PA 3CIXA 1KS2A 2OFJA 4GJJA 2XFYA 5ETMA 1SQEA 2AYMA 1VBZA 1V79A 4JI1J 4RZBA 1TK0A 2J9XA 2J62A 1TL3A 4X4OA 4WWSA 4A3HA 5HDRA 3CCTA 1VQLS 1UR8A 3PWAA 4NL5A 3T41A 2V2DA 1CBKA 2DK2A 4F0LA 2PDIA 2COLA 3EX3A 4MAKA 2DH9A 1OX4B 2NT1A 1TRIA 4M81A 1NSAA 2IAJB 3GYXB 5BR8F 3W7CA 1TVRA 4YQWA 2G37A 2BXJA 8ATCB 4MZ1A 1RQ0A 2AGOA 1JPIA 2PMHA 4IPLA 2IUZA 4WKFA 9XIAA 4ZIVA 3QJJA 4REQB 2VU5A 3S6TA 3GD6A 3QHNA 5FF2A 4A46A 4B5SA 2MKHA 5HSPA 1MG7A 2A2CA 1B70B 2HSAA 1TMHA 3BBCA 1L0PA 5LHEA 1SQGA 2I8EA 2HE8A 5E6ZA 4TKTA 4URIA 1QAXA 4XBSA 3M8PB 4DR1J 3FYPA 2I0XA 1SKRA 1LZOA 2YXXA 1PBAA 4DYJA 3O44A 4WZHA 4LF6F 2VL1A 4XZ9A 1BXBA 1K8AT 1ZBKA 3PRDA 2A3BA 1AUSL 3BLLA 4ASTA 2GJXB 1TSIA 3UG5A 1R0AA 3BPDA 5KG4A 5LJ3Y 1WELA 3QEZA 3EVMA 4FLQA 4ZR8A 2NUHA 4O0IA 4PC8A 7ODCA 3J7YI 2UUCJ 3B0XA 1Z8AA 4HT3A 2DSVA 1Q7ZA 2E7XA 4ZP7A 1DTUA 1ZM3A 4DV6F 3APGA 4DR7F 4H4KA 3FUYA 4RUBA 2ASHA 2X1UA 1I6NA 1FH7A 2YLLA 3NGUA 1G6BA 2XMTA 1DVJA 2YH0A 3FBBA 4RNMA 5KT7A 1FWFC 1HHTP 1V0KA 1CI1A 3D1HA 4WKRA 2HBQB 3CM4A 4WCEQ 2J79A 3L2LA 2D1CA 2G97A 3VABA 5E70A 3V75A 1PWLA 2Y24A 3MI6A 2N7YA 2HXTA 5GNZA 2YB1A 2YCJA 3R8RA 3UGRA 4MJKA 3D0HE 3NTYA 5ETRA 2OEMA 2VRKA 3VINA 2ZKUA 3NQCA 3UE2A 1QNPA 4IXHA 2DIUA 3PJWA 1G69A 5ADZA 3T5KA 2B9EA 2VNCA 3G8TA 2O3DA 1NXIA 4D1JA 3LTOA 3U48A 1TR1A 4DR4J 3MMWA 4Y2AA 3K59A 3W07A 4TX9A 2E40A 2BJ9A 2IQ0A 1YZ7A 1CS4A 2DORA 5I07A 3ZSSA 1BYDA 5I2UA 2GVEA 1WHYA 3BAJA 2FLIA 3W2VA 5DLFA 4FPRA 2MXYA 3VDHA 1X7FA 3OPSA 4H04A 1M53A 4GGBA 2IM2A 2E5JA 2B7BB 1NDWA 3IO1A 2MQPA 2GK1A 3L21A 4FZVA 5KFJA 5CZSA 3GR7A 1SJQA 3GV8B 2XNRA 2BVTA 3TVAA 1Y5IB 4IQJA 4GINA 2OPRA 3LAMA 2XMAA 4ICCX 3RO8A 3SBFA 4Z2HA 2GWNA 3BGLA 3GK0A 4GC4A 4K1WA 3QY8A 4V19J 3LLDA 3I10A 1OPIA 1RK6A 5HMFA 5CA5A 3IS9A 3DMJA 4DZ5A 1NVMA 4DBDA 2CESA 1DWAM 4NI3A 4P7VA 1UKPA 4DV0J 2DISA 1Q8AA 2YNFA 4W5UA 3UR7A 3HF5A 4WYWA 3U1LA 3DRPB 1HBMA 1P27B 2D24A 3DN5A 5I00A 1S1TB 2AMCB 1EC7A 2JLFA 3HIJA 3ONCA 4J4KA 4QDWA 1HFEL 1E40A 1HPZA 1A80A 1CQNA 2D69A 2OSYA 4TY8B 4ZB2A 5D2WA 2HVNA 4AISA 5F0WA 3FA5A 2B7NA 3WQCA 2DITA 2FDNA 2MKSA 2CLKA 1QBAA 5K4XA 4J9LA 2UVWA 3AMLA 3RFAA 1HNVA 2HKEA 3ZZYA 3ZFHA 3ZTOA 4U3AA 1RALA 2OGYA 4L65A 2X0SA 3OQEA 3LCFA 5GAHU 1HIZA 3VMNA 2Q09A 3KWSA 3T1GA 3T1YJ 4BFAA 1Z44A 1ZPTA 2WQPA 1DWGM 1Y65A 4PCPA 3UNTA 4KESA 1TZ7A 2CLMA 2EWHA 1XKYA 1M5VC 2OZTA 1VEMA 1MXSA 3E6EA 9XIMA 4NXNF 2GFTA 4QYRA 4UOFA 3NQBA 4HU0A 1NQKA 2Y0SD 4HA3A 4U7UD 1XYMA 2Y2WA 1XDLA 3CUZA 3HJVA 2VC5A 4NZ6A 1FD2A 4O1BA 1PILA 3L95X 2ZCGA 1OGGA 4PTNA 3KTCA 3E96A 4JTKA 3N6MA 1UEKA 4MG4A 4O3RA 4OMFG 1G3OA 5DG9A 1S1WA 4K4XA 4Y9NA 2YZRA 3WQOA 1R9YA 2CQ2A 1CULB 2I16A 4PPDA 1GEQA 1TZ9A 2NLYA 4JTCA 4JI8J 1PKNA 3VIIA 2DIEA 4FF1A 2YL9A 4MHBA 5MAOA 2WZIA 4LBHA 2VBXA 4AD5A 4IIEA 4Z0JA 2HPUA 4F67A 1MROB 4WY0A 5CYMA 4UZSA 1R30A 3KK2B 5G5IA 1HVXA 2BUNA 4PRRA 2YWEA 2YPYA 3ET6A 3HFYA 1EJUC 1E55A 4FXRA 1TTJA 4GY0A 5LSLA 1L8PA 3TMQA 2N4DA 2HNZB 5LOQA 2R7RA 3FX4A 4O28A 1EGMA 2B6AB 1FE4A 1R89A 4XUYA 2YKPA 4W8BA 4ZQPA 2X09A 1TO3A 2VEFA 1S9GA 4DPUA 4DQQA 2Z1VA 3RAQA 5GADU 3N5BA 4HHJA 3UT0A 4AXNA 1DTTA 2QT7A 2L9DA 4JI5F 2ASLA 1JAEA 1LOSA 4IF2A 4IMCA 3SCPA 3DI0A 3OGVA 3MY9A 2BANB 4KWWA 3BH7B 4DEZA 5F3ZA 1E5JA 3MCMA 4NJJA 3ZNUA 2A4AA 3SW6A 1LNQA 4FF7A 4PXCA 2XY5A 2DH2A 4CN6A 3QGIA 3DG6A 3N6NA 4ZA0A 1VFOA 3JUGA 2J47A 3GG7A 2VO5A 4N47A 3WD4A 4R9XA 2ZH4A 4BS2A 3KOFA 1XR7A 4JV5J 3KLKA 3PJTA 4C2MA 4QEHA 3F2DA 1E4IA 3MUXA 1U1NA 2QV6A 1KRCC 4NL1A 3R7MA 1U2CA 1YDLA 3IVSA 4R85A 1LYXA 1S9EA 3SDEA 4HYKA 3OHMB 1E6YB 4HB7A 3W02A 3LXAA 4DI8A 3PR4A 3NNHA 3QTGA 2Z4GA 3CUHA 1RHUB 3WBAA 3AMCA 2VG7A 3BPWA 3S3GA 3XINA 2ROEA 4FKXA 5KT2A 2KRRA 2ADCA 2V5KA 2DGWA 3LPGA 3R13A 5IHRA 2ZICA 4DUOA 1O6IA 1NWRA 1OD0A 1XNQJ 4C11A 3FCHA 2UVVA 5JXQA 3NAHA 3IGHX 1FRKA 3MWBA 3B0PA 1VIOA 4LVAA 2FTWA 3W1RA 4CCHA 2QJMA 1HNYA 3M0XA 4TIMA 4KPCA 4XTDA 1WXJA 5KFSA 3EMQA 3D3BJ 1C7TA 1BTCA 2DZSA 4OLPA 3VIPA 3QT7A 3UP8A 3DYMA 3L9CA 3MDWA 4DV2F 1MMLA 2D3ZA 1FWRA 4IMDA 1T95A 1GG0A 2HCVA 1IKVB 4KB7A 4ZVRB 3R10A 3QO9B 3DHWC 2LEBA 3PPHA 3VOCA 2CLHA 1TIWA 1VZWA 3GILA 3G8SA 1RT1B 4U2ZA 5AHIA 2VUNA 3VGFA 1MN7A 1MXGA 4NA2A 1E9YB 1XX1A 4D71A 4B3LA 4H8UA 4KEUA 3EWUA 2FZCB 3IC1A 4L3KA 4DNMA 3UDEA 3N3MA 4WJ8A 5E5CA 1XRSA 3TQ0A 3W75A 3M41A 3IUDA 1BF2A 4A48A 1RVGA 4UUWA 3S9YA 2WZTA 1OC6A 4LF1A 4IZGA 1AH3A 3NSNA 2YA0A 4QLKA 2X0HA 2E5BA 1MLAA 4L7ZA 1XLKA 3U57A 4W7WA 1HNIA 3AODA 3OFHA 1PGZA 5HWMA 2LFVA 1R8BA 4DSKA 3CE8A 2FLPA 1KRMA 4MWAE 2PLCA 1S0MA 2WB1D 2N7CA 1TYGA 4LSLA 3MVIA 4WFAQ 3NL0A 1HL9A 4IDKB 4D6DA 1IT8A 4DQWA 4ZB5A 2J8AA 3V2UC 5A8KB 1LL7A 1R8PA 4GVGA 4Q8FA 2CQDA 3TP2A 1XBZA 1JLAB 3KLIB 3WX8A 3UWYA 2PWUA 3UPBA 1F6PA 3NNTA 4M6QA 4L1GA 3GFYA 1C0UB 3NOEA 2P8CA 4WIIA 1FEHA 1G0CA 4TLRA 4FIRA 1M7PA 3AMGA 2BY3A 3M07A 2A3EA 4J3VA 2M70A 2W62A 3D54A 3TX0A 2G0CA 2DPIA 3CL6A 4I7WA 3G8QA 3B04A 5A6WA 2MJNA 3PO5A 5LXEA 2X1BA 2QZRA 1KVJA 4MIAA 5J2QB 2OXNA 2PDMA 2VA2A 2OELA 4KGVB 2W67A 2KG1A 3P81A 4NMLA 1LW2B 6A3HA 4JI7J 3GTHA 4PQUA 2J9EA 4U6PA 3PZVA 5AYXA 2VEGA 1OS5A 3I0RB 1RJJA 2E0PA 5DELA 1VCTA 2MLZA 3R6LB 4EXQA 4YIWA 2YQ1A 3IN5A 3W7NA 2E1MC 1KGUA 3NZ1A 4H4IA 3G77A 2D3NA 3SQLA 1REVB 4XZBA 4IOCQ 4GZJA 1SPBP 4ZHRA 1SKSA 2UV8G 4YN5A 6TAAA 3H2FA 3BQ0A 3CF5Q 1W37A 5KG0A 1RBOB 2BXYA 4IP7A 3PKMA 1W2VA 3P62A 4HDHA 3NDZA 5FSDC 1FRMA 3GSDA 1POJA 2J8SA 3NEHA 1DHKA 4XPEA 3SECA 2G3NA 5JXSA 3DC0A 8XIAA 1R43A 3NWRA 1WWHA 2VFHA 5AHNA 4LF6J 3VDCA 3I4KA 1XQIA 3I9V9 2VIHA 1O7AA 1VQOS 3W2WA 3KX6A 1NSKL 1XH1A 3TOYA 2BNJA 4AHPA 2CLFA 1FT8A 1OMSA 2HHVA 1E0UA 1TTQA 5C9ZA 3HO8A 1K9MT 3W85A 3JS3A 4EUVA 1TKZA 4AIEA 2K2PA 2ZDSA 2OU4A 4ED4A 4DV6J 3H21A 5EHHA 2Z0IA 1PZ3A 4DR7J 2I17A 5LL6d 4J7CA 4WSHA 2FHJA 3Q2SC 1KFEA 1VJZA 4DPWA 5HQMA 1A5UA 1PKYA 1SL2A 1KQSR 3J7HA 3TC7A 3H12A 3NCRA 3BYRA 4CLFA 4IICA 4GQBA 4DJDD 1KR1A 3THQA 1M6JA 1N0UA 4CLLA 1TV3A 3WEOA 5BYQA 2RGMA 3HG4A 3OGRA 4AEFA 2GGEA 1S6QA 3T42A 3AU2A 4EAMA 1S3HA 1TTPA 2I9EA 4MKAA 2QMWA 1XYCA 4IYQA 5ETTA 3HF3A 3H26A 4NI8A 1FRBA 1HNXF 4C1KA 4CP5A 3N1AA 2GMJA 4FO4A 1Z6KA 3B78A 3TZFA 3MAAA 5BXIA 4DF8A 3GXMA 4GUFA 4WD0A 3UO0A 5CBBA 3C56A 3M0LA 1RKIA 3O1NA 1JLFB 1P1TA 4DX6A 1ULRA 2KJVA 5IFTA 1GQIA 2BMBA 4JKKA 2GJFA 4F4AA 4H3DA 1C8VA 2UUTA 4I8DA 5A6AA 1X5TA 2R94A 1SUQB 1KM1A 2F8EX 2HNDB 4FALA 4JQ2A 5A8WA 3ZJ8A 3USBA 1VHIA 3RLUA 4AZ7A 4MGGA 5E0CA 1PC5A 1WC0A 2OR2A 1VPQA 4Y6IA 1A3XA 1NJIT 4MUZA 3R6GB 2RAGA 4N9DA 2R82A 3F5KA 4ZJQA 4XO7A 3GLJA 3VD5A 4B4FA 2VCCA 3CV6A 1R2RA 2DZXA 5LIWX 1A49A 1T96A 2IKHA 1FCBA 1VRTA 1EIBA 3NQMA 2CPEA 2L9NA 4R7JA 1UIPA 1SO3A 3BS9A 4D6CA 3MM6B 4KAIA 4O15A 4F0SA 2IDEA 4Q8QA 5CBJA 1IR0A 4H54A 1T11A 2A6LA 1KLMB 4QOTA 3VOGA 4EKJA 3L3CA 2G2YA 1UJQA 1CPUA 3GG0A 3OA5A 3RHGA 3OEXA 1D3GA 2XG8A 4JV0A 4Y9PA 4TOQA 3ITOA 5H8MA 4Q45A 3IIZA 2VZUA 3UPWA 3R7BB 4ANDA 4M5DA 2BV9A 3ISIX 4UTKA 3J7YU 1UKOA 4TN2A 3G1XA 2J7KA 1YTEA 4NYZA 3S0CA 3MAHA 1I5OB 2J27A 4DJFC 1CGUA 3PZTA 3BVJA 3T09A 1BF6A 1V7AA 4EBCA 3ENLA 3GYNA 4JTTA 1RP8A 2QTWA 4PUJA 4Z7CA 4F4KA 3CO8A 3WSUA 1GOXA 3FNDA 2WHLA 4LBRA 5BYWA 5GMDA 3MMAA 1O5KA 1M5HA 4F4ZA 3KJVB 1U5HA 2NW0A 1SJRA 3NOGA 2X16A 4ZPTR 2WPGA 2EG1A 4NXNJ 3IJ6A 5FEWA 2P2CB 3HM9A 1QY7A 1S2UA 1ITCA 4PZVA 4FXWA 4KYZA 2JLGA 3PW4A 3UPMA 4LSNB 5I3IA 2BA9A 1U48A 2DR6A 2ZH8A 4IWWA 3H5XA 3HSZA 2Z30B 2PU0A 1TX0A 1UROA 4IP4A 1S0NA 2Q66A 2VEPA 3NMRA 1FA2A 3NDOA 4FI4A 1WOSA 1U5JA 3DI6B 2CPYA 5HMEA 4DUWA 2XYLA 1Z69A 5I24A 1K44A 3LAKA 4DCOB 4NAEA 3K7RA 3REQB 3W7BA 2W66A 2HQ3A 4JI2F 3ADAC 1OHLA 4O3OA 3SCWA 3C16A 4F3MA 2NXCA 3KK3A 4X4NA 1ADSA 1AH4A 1OWQA 4GVIA 1FHVA 4Y3CA 2QVNA 3G1HA 3LBCA 3ZO9A 1S79A 1BWVA 3SFGA 4W87A 3NGSA 3DDKA 1F4AA 4C8MA 5FD0A 4NLOA 1Y10A 2W2MP 4V19X 2I14A 5CABA 1ZM2A 1XSJA 3CT7A 3MHFA 4LSBA 4MMWA 4ZENA 2CLIA 2V5CA 4JI5J 5CKSA 3RRXA 4BC7A 1GCYA 1YPFA 4A29A 1FESA 4J1OA 1VQSA 3N4WA 1UWTA 5IBXA 2NX3A 3GLCA 3ARTA 4OUEA 2YQ3A 1X0FA 3ISNC 3KG1A 3T5JA 2ZZNA 2BOGX 2DVTA 3HFTA 4DN1A 3V4IA 3F56A 3RW6A 3AWOA 3HGRA 3ID7A 2ZH3A 1FKXA 2WHKA 2CYYA 2ILYA 4W4MA 2C14A 4A22A 1TK8A 4D6GA 1J6OA 2G4FA 1FX6A 3MR5A 3RBDA 2NWRA 1HI8A 2AIRB 1S4FA 4HZ7A 4F79A 3ZZUA 2IKGA 4P2MA 3FQLA 4KGXB 4OZ3A 4WYLA 1KRPA 2CADA 3RIKA 4W88A 2PI6A 1B90A 3U7BA 1RHQB 3VM5A 3FBEA 3NZRA 3CD0A 2HPMA 2QT3A 1XQKA 3MCSA 3NQAA 4DF1A 3VKJA 2P6SA 5D77A 3G24A 3FGCA 1Q78A 4JBCA 4L64A 2HBYB 3FVYA 4LVOP 4IRKA 3SCRA 3CIWA 1VLYA 1QDSA 2MZ1A 5HN0A 1P6BA 1C92A 4OJGA 1NOUA 2E7WA 1M5PC 2O9PA 3K5OA 2KT2A 4YCOA 5H9EJ 4JTAA 2VA3A 5A8MA 3FSUA 3A5VA 2HK2A 4DV2J 2Y3YA 5I3HA 5KFMA 3A4XA 1CJUB 4E3TA 4NZ5A 3VDGA 3ANUA 4C6BA 3MS8A 1XEZA 3N13A 2ROPA 4PWWA 4NY2A 4TX8A 4JNMA 3W8GA 2Y8UA 1A0OB 1VQ4S 3PTWA 4AQLA 2OZ0A 2YKQA 1URNA 4XAYA 1FVSA 1ZRQA 2DNZA 4YTQA 5EL1A 2CW6A 4K68A 6REQA 1UETA 4FNSA 2H48B 3RU0A 1XMOJ 1NWUA 5C2XA 1Y0HA 2D7SA 1PTDA 2OHDA 3KKFA 3PIOQ 7FDRA 1ZJBA 3K5PA 4LYKA 4O19A 2C6QA 2MQQA 1GJWA 5C25A 2VZSA 2ATLA 2VV5A 2VFGA 2PDLA 3WEZA 2ZM6F 4FNRA 2HIQA 2PLKA 3RW7A 2QCLA 4RZ6A 2POTA 1K7FA 1E6SM 4WZMA 3UA3A 4LSZB 4AQYF 3PW7A 4E6MA 1LBLA 4Q7NA 4FSAA 1O4UA 2ONEA 3FZBA 2A7RA 4C5ZA 4CM0A 5DJBA 1R46A 1LM1A 1XQLA 2F63A 5B7ZA 4ZQRA 1OFPA 5CAKA 1IJEB 4Y0FA 1JQXA 4JX6A 4QE4A 4FF3A 3CPRA 3VFLA 2QUTA 4R34A 3PW5A 4UQGA 2ZHAA 4AVOA 1G1XA 1QO2A 4NLUA 3AICA 1EJWC 3YPIA 2OI2A 5C8BB 2JF6A 3VGEA 3CJ0A 1VEPA 1MFUA 3ZJ6A 2NUYA 4UXDA 3SM0A 2YKAA 1KKRA 2FVSA 1YPIA 4OZ5A 3THTA 2DDXA 4CD6A 1QJHA 5E41A 1NK6A 1SFLA 3KS5A 1FRLA 1R27B 4RPQA 2WAQD 2VX7A 3KAOA 1DZ5A 2Q02A 1KXVA 1N56A 4Y00A 3SRDA 3MUVP 4MADA 3W27A 2MKJA 2AAAA 2F8HA 4B3MF 4L76A 4QFUA 4S3DA 4G1IA 1UVJA 3MEDA 2J8FA 1VBRA 4XZLX 4AYSA 3F7JA 1KTBA 1TQLA 4S3BA 5C24A 2YKOA 2KL8A 4GVBA 2R7TA 2C1GA 4KFPA 4IUGA 4M24A 1B2YA 4DWSD 4F04B 1AXQA 4I2PB 3S1UA 2QAFA 4R33A 4P10A 1TVLA 1IGSA 2PFHA 3E49A 4OOZA 1IXPA 2J9DE 1EP3A 1E6PA 3OIXA 2JKAA 1F6YA 2MGZB 3KLLA 1DJHA 2WSQA 3AJ1A 3BGGA 3KL3A 5KETA 3QOKA 1UD6A 2JE8A 1R86A 3D7SB 1TPWA 1NM9A 1T02A 1O68A 5DMMA 3BPSP 3NSMA 4HZ6A 3TQVA 3PNZA 2RVJA 4XIUA 2V2HA 4C8KA 4PUNA 4AFFA 3KZSA 4HLBA 3NIYA 2VL4A 2HHXA 1GW1A 2ZUWA 3TJ4A 4H9TA 2I57A 3E0WA 3T08A 3HHLB 3UFCX 2QCCA 5HA7A 2HHSA 1XP3A 2GMLA 4B5WA 4OFCA 1WX0A 4BZYA 2R1LA 4D6FA 3TJ9A 4XIMA 3MZIA 2G95A 2P3EA 3C2YA 1MWQA 2HVHA 2VR2A 3W76A 2KZZA 4PMOA 1VD6A 4J9JA 3UBPC 5AYZA 1ZZMA 2CKWA 3UNYA 5A6JA 2MKCA 4KV8A 5F8JA 2RRNA 3RLGA 4A8SA 2GAHC 1KFJA 4IH6A 3GX9A 3W5YA 4TVDA 2RUSA 1FWPA 1HNXJ 2HQAA 2BX7A 3WUBA 3KCOA 1WDPA 1Z7AA 5AE3A 4A8FA 3BGJA 2DHGA 3LMYA 2R24A 4LJ3A 2EK1A 5AE1A 3G1FA 2J24A 4E3VA 4US5D 2K1RA 4KMQA 3D68A 3B9NA 4ZVSB 3OHAA 2BE2A 1RTJA 4K7QA 4MWAD 2KXFA 3DOKA 3J81j 1B0IA 5F1UA 1V93A 1KQYA 4ELUA 1QCWA 2ZBPA 1MW3A 3T6JA 1UVLA 1JMTA 2VELA 4PBEA 4NJGA 4NRUA 1IWPA 3BE7A 2HISA 4EPKA 2E29A 2F7VA 4IFOA 2B5JA 3ARPA 4A8YA 2J0QD 4QWCA 4AZHA 1AQMA 1QVGR 4RWXA 3JSMA 2P8BA 2GVGA 3WBEA 1H63A 3J81U 2HK1A 1XLLA 5HPCA 3GR1A 1NWSA 3FAXA 1M7JA 4X22A 1NHUA 2E25A 4CRJA 1DP0A 4YN3B 1PCAA 3RU8X 1GOWA 5E3RA 1AL7A 3LCHA 1VRXA 2KO1A 1EDGA 4D3HA 4WHBA 1TU0B 3LGDA 5CZXA 1HNZF 1ZGDA 2ATMA 3TVYA 3SCKE 3PY8A 1M65A 1P6CA 1R7AA 4J5OA 1WORA 4N9BA 4DFJA 2Y62A 3VGBA 3GDKA 1XS2A 3PY2A 4UFLA 1OFOA 5HK4A 2ZRXA 1N5VA 2CC0A 3FIGA 4Q7BA 1KVIA 1E6VB 1I94F 3LEPA 5I3GA 2EXOA 3FEQA 5AN7A 1UKQA 3FSIA 2BV3A 2PAJA 2OO6A 4RL1A 2PDWA 4ZTXA 1I0BA 1TV7A 2G3IA 3PTKA 3INPA 3DGVA 1V3JA 4KTQA 5K20B 2ALYB 1F9EB 1F5BA 1UCNA 4EXAA 1FHDA 3KK1B 4JTEA 3MTWA 1R6YA 4WKHA 2MZTA 3QFEA 4ADUA 1CWYA 1QHZA 3MJYA 2WMHA 3DFNA 4JNZA 5HMXA 1HG3A 3TAQA 3SCUA 3A3WA 2ZA3A 2E5LF 5E09A 4UTFA 4NXSA 2HHTA 3C52A 3STFA 4GUIA 2WVDA 4XKMA 3MHYA 4ED2A 2ZXBA 4RE4A 3SFKA 3UJ2A 3S9IA 4CLSA 3KZPA 4IG0B 2DZTA 1CYGA 3EDJA 2IAJA 3LPFA 4L75A 1UWAA 3HJZA 4HPGA 4RZRA 4W92B 2YY3A 3N9SA 3CIZA 2YJQA 1KBBA 1ONWA 3HURA 2B51A 2QLYA 1EYWA 3I55S 3B6BA 4REQA 2AX0A 1EX5A 3IACA 2PUZA 4UR9A 1C9DA 3ENQA 4NNAA 4FR1A 1UASA 1QSYA 3TQ1A 2PA3A 5IOBA 2XY7A 1WCGA 2NS1B 3PPCA 3KW3A 4ACZB 4Q4RA 4TXEA 3R89A 1FA0A 1OIFA 3VNLA 2PEBA 3H7HB 1RHMB 1QVFR 5EGRA 1WOOA 2YX1A 3IWXA 3F4DA 3T78A 2IJNA 2DW7A 4Q4KA 3SSRA 4ZVGA 3LGMA 2J7UA 3WIVA 1KD1T 4UTTA 4K4WA 1H2UX 1DE6A 4IQEA 4EZ6A 1G67A 3B4YA 3OBKA 4ES1A 3I87A 4JV2A 1S59A 1JCXA 1XLDA 3SADA 4MF4A 2FZNA 3ITHB 3VX1A 3EXCX 2DQXA 4F4XA 2GA7A 5I6SA 4ZVQB 4OU1A 4U67Q 4P61A 5C5JA 1RU1A 4FP9A 1QHOA 5AKQA 4POCA 4W89A 5LIXX 3WKZA 1JUBA 4OYOA 3UR0A 4C6IA 2H8XA 1A0EA 4ZOEA 3C3UA 4JTRA 3AYSA 2VYOA 1JKHB 2VKRA 3TUPA 3I32A 3BL3A 3P5ZA 3SEPA 3WD0A 1UA0A 2P50A 1T0TV 1YIXA 1S6OA 4JPGA 3NQDA 4P8XA 4HU8A 1XFBA 1V5IB 2H4YB 1Y0EA 1W9PA 3VDBA 3L66A 1NM2A 4I6VA 1B0VA 4YWIA 3O7UA 2XZWA 3QFHA 1HKIA 2WOMB 4DF2A 4I9TA 4K4VA 3QGAC 2CHNA 1HL2A 4PYSA 1NOFA 1FDZA 5H8PA 1OYDA 2MKKA 2NYHA 2PFFB 4HJFA 2P0OA 1BSLA 4PODA 4ZJOA 3K1GA 1SW3A 5HQEA 2G96A 5EYWA 3BZGA 3GAYA 4RXGA 4JIEA 3I3EA 2UWFA 1D7KA 1E9ZB 3BSNA 3GVRA 2XC9A 4PTMA 5KG5A 3QFWA 5HP1B 4GKJJ 3K1DA 4A8OA 3O6DA 2BX6A 2D9OA 5CH9A 1HQTA 2W1BA 2RS2A 3RZAA 1RLDA 8TIMA 4KCWA 3GVVA 2ZC1A 1B3WA 3V0TA 1VC6A 4DFPA 1S99A 4DXLA 1PKLA 2WBMA 3K5MA 1EP1A 3VTIA 1E1CB 1RZMA 5FJIA 4C6PA 1X4FA 3EX2A 4QBUA 2OX1A 3D6TB 1W2BR 3PVFA 5E6YA 1DPMA 3OTRA 4WGXA 1V6HA 3GONA 4UT4A 2GQ3A 5A8QA 2NSOA 2YH1A 2HNHA 1GXUA 1VQ6S 4CU6A 2ATSA 2ZDOA 3V0UA 2V2VA 1U1KA 1F61A 1B4SA 4S23A 4GUGA 2UXDF 1E0XA 3DRPA 3EWBX 1XICA 2Y1LB 3R7SB 1YBUA 1S1TA 2UY3A 3NZGA 1M41A 4A4JA 1HR0J 2YNGB 2GOKA 3B9DA 1FDDA 5AYYA 3KXDA 5J1PA 1UWUA 4TY8A 2XS7A 1N8WA 3M2RB 5CPLA 2EFVA 1GOKA 3L4WA 4WGHA 3A21A 3ZR4A 4XBKA 4HNVA 1MZHA 2VUYA 2JGQA 2PC4A 3DYOA 3R11A 2HAFA 3MEEA 3M0MA 3PZOA 3UN2A 4D8ZA 3GIJA 1XLJA 1DY3A 3W7OA 3G6LA 3AIRA 5CZKA 3VIGA 1WDTA 3PUOA 1OT1A 5G4EA 5E3QA 4PGLA 4PMNA 1YJVA 1LORA 2GO9A 2KFZA 4WDUA 1FFQA 4JZ5A 2NVDA 4IG2A 4PUDA 2E68A 3UR8A 3R5EA 4J5NA 4Y28C 1P0KA 1QWGA 4Z37A 5JMUA 2DT0A 3FDGA 3P60A 2C0AA 4HHPA 3CAVA 2SFPA 3CHFA 5I3FA 1A7GE 1NK8A 3AB2B 1DAXA 5AXLA 2DSZA 2DIKA 1H38A 2E9RX 3MC5A 5G2HA 3IWPA 1VQ7S 1L2QA 2W9BB 4WJXA 2SXLA 1IKXB 3E1F1 4UQCA 1ADOA 3UZ5A 2FZGB 2INEA 1SZFA 3KVMA 5HWJA 3ALFA 4LBUA 3KL0A 4HCDA 2BW7A 1UBSA 3F5JA 2VQTA 2NUWA 2YNHB 1CULA 5HBMB 3N12A 2H90A 2OKOA 4Z08A 1XIEA 2B7QA 3LS9A 1Q66A 1MEHA 1YXYA 2MHEA 3NKYA 3WC0A 5EX0A 4NNBA 3P5TL 1L9WA 2FVMA 2J7CA 1VI7A 4ZZ9A 2GHVC 4YUDA 3VCRA 1OO0B 4MK9A 4LBSA 4KCVA 4R8UB 3KK2A 2B4UA 3HVAA 4WCJA 4E4FA 4K4UA 3IK4A 2M3DA 3LSBA 4WKYA 4CNYA 1NPPA 2R8JA 1ZSXA 2Q3RA 4PG5A 5TQLA 4YCPA 2HNZA 1QNOA 5EU9A 2B6AA 4OQVA 3O5TB 4RUHA 4MLJA 1ELSA 3LTSA 1S2AA 3DLEB 4I7VA 3C2EA 1XBXA 3VZZA 2YNIB 3EX7B 5E5NA 4E8DA 4ZQMA 4YTSA 5I3PA 2XSJA 4BF9A 1X4BA 2H3DA 4HL9A 3CT2A 4HVXA 3HB9A 3ARWA 1PAEX 2BANA 2QYCA 2CLEA 3KDOA 4CUCA 1YDVA 1FWGC 3BW4A 1RWMB 5CLTA 2OPQB 2QULA 3LMZA 4DF0A 1YRUA 1JF5A 2B31A 3G1RA 3TI0A 2U1AA 4TR9A 4TVUA 2EEYA 3UW6A 2QA2A 3K8KA 1RTIA 3RG6A 3WC2A 2KAUC 2OLHA 3MUCA 4DQPA 3BGUA 4DPXA 5IT9Y 2QCMA 1BQXA 1WP6A 3VCNA 1OX5A 2G50A 2ZFAA 4JQ4A 4UQEA 4O1FA 2K7KA 4AAJA 4D6JA 4ECVA 5A6KA 3LENA 4CI0B 1W9VA 3MEKA 3SCVA 6AT1B 1RAKA 1E71M 4EZ9A 2HJPA 2GVZB 1EX1A 3THAA 4P7RA 3Q8QB 3TSBA 3N2TA 1DJNA 3DLKB 4HHLA 2BKPA 3CCSS 2WKLA 2DJLA 3H7RA 4CVWA 3SIZA 4HU4A 3RCYA 1VQ9S 4M5LA 2Y7GA 1BQMB 1TB3A 3E02A 3G1DA 3OV7A 2GJRA 3W23A 1WDDA 2X2YA 3Q4DA 1GKRA 2FHBA 4IXXA 2MJUA 5KFQA 2ALDA 4PYAA 3LRKA 1O95A 2E6AA 1GPFA 4WTYA 3GTNA 4MUPA 1EJXC 2WWDA 2CPUA 2NQ9A 1UWIA 3W25A 4CEXC 1IKVA 4KHMA 3TN3A 4LVGA 1ENUA 3QO9A 4P74A 1MWOA 4PEOA 4FS2A 1Q81T 3U2EA 1RVKA 1IZKA 3O8WA 1XG3A 1RT1A 1SC6A 1T9TA 2G8ZA 3E5PA 3EA2A 3DBPA 1TL5A 1XIDA 3W4RA 1V0MA 3OZMA 4ZXOA 1LQ9A 1J93A 1UZHA 1UKTA 5HJXA 3O2LA 1E73M 3W1UA 3UD4P 5AXNA 1HNZJ 3U02A 1FVQA 1IIGA 1E43A 5B0DA 1KBKA 4GBUA 3GU0A 5A6MA 4CLYA 1D8WA 4QEEA 2B9WA 2RU9A 1AFSA 1VAHA 4S3FA 3H4BA 4KBIA 4NLRA 5HVFA 2DPJA 1WF0A 4WVXA 1Q13A 1R2SA 2W92A 1O0PA 2ASJA 4ATWA 3I6PA 1LROA 2OQLA 3CZGA 4OV4A 1I94J 4H9XA 2DNYA 3OFEA 4ACYA 3WH5A 5A8KA 4PRFA 2FVKA 3ELFA 3EKGA 4L1XA 3JXOA 4M5GA 1MDLA 4RUCA 4B08A 1JLAA 1CZ1A 2WSYA 3KLIA 1E6XM 2CQ1A 3O07A 4L3NA 1P1LA 1EA0A 1JDCA 2PE4A 2JNJA 4KQNA 4NCGB 1QHPA 1Z89A 4I67A 2VX4A 3A3NB 1TJPA 2IMWP 1Z2LA 3UI3A 4TVAB 3SN0A 3SURA 4AWSA 2FGLA 4ZPAA 4C5YA 1ZPWX 4MT1A 4FXJA 4GIAA 3MR2A 1EHWA 2BGSA 4BCAA 2HPIA 1U02A 2FIQA 5AC4A 4JY9A 2ZC4A 2WSRA 2CBIA 4MJ4A 2MB0B 3W0KA 4J3WA 3DFEA 3C15B 2TAAA 1TVNA 3NQ2A 2B4GA 3I0RA 3OHIA 3M5VA 2O5DA 2ZDPA 1KQKA 3WL1A 1E9IA 2Q79A 5E0FA 3S2JA 4XSMA 1KRAC 5KINA 2QEXS 4KRWA 4PRTA 2GSEA 2P88A 1REVA 5M2FX 1WBJA 2W4DA 2QYGA 4HNOA 3WH6A 5GAGI 4MJ2A 5FJJA 4B5UA 1RB0A 1ZTVA 4XZMX 4C1LA 2IC3B 1CSJA 5D37A 4NIRA 4X9SA 2AMXA 1PSCA 1P48A 3BSCA 4Q7AA 1VRDA 2FHJD 2HG4A 1IKYA 3OGSA 4G1NA 3I3DA 1K9TA 4TYAA 3BAWA 2VG5B 3M2VA 4RK8A 2VHLA 3F5LA 3UZWA 1KBRA 5JVLA 3AD8C 4AEEA 2JEJA 3W84A 3V5CA 4R0EA 3U2OA 1VC5A 3SCQA 4H1ZA 3LSCA 4C3MA 3BURA 4CVUA 3VCDA 5K8MA 1OQFA 1KOHA 3S2NA 2WBGA 2O7QA 2BOEX 3IJLA 4UQAA 1FP9A 1TKKA 3K8VA 5CC7A 2D2HA 3TYDA 3HD2A 1OM0A 3STPA 4IPIA 4AZCB 3RYLA 3UWZA 1WHVA 3PBYA 1XKJA 1SIWB 2OYKA 3RRKA 1Q7LB 1EGZA 1IIHA 2GHPA 3N0VA 4JQAA 4GIEA 1RYSA 1LDCA 1PE1A 2DUZA 2WW5A 5AJ3F 5KMYA 1Q7MA 4RW8A 1DJQA 3P8IA 1XCWA 3AHPA 2ALRA 2OT0A 3T05A 3O3RA 3H5YA 3AAMA 1U1RA 2DZPA 1EUAA 1YSJA 2TMDA 3VGUA 3DN9A 1NZ8A 3OVSA 1FWEC 4DUYF 1OPZA 1QPNA 3VAGA 1TV5A 4DELA 1JLBB 2R9LA 1OCBA 4CO4A 4IX2A 4LIRA 4OQJA 3FJNA 3D2WA 1U0HA 1CJKB 3N2BA 1JLFA 3ABQA 4KO0B 1ZFJA 3TFXA 3DRRB 2J9DA 1XDMA 2F6KA 1S1RA 2NUUG 3IM8A 3HGSA 3L4BC 2BJ3A 5J2PB 3KRSA 3G6YA 4R27A 3V6HA 4YB5A 1P7TB 4NAFB 2B7PA 2ZITA 1BHNA 3EOLA 3ANYA 4JFWA 4JS3A 2BEFA 2HNDA 3N9UC 3VVTA 2AQ4A 4HIBA 3OXGA 5GVJA 1H51A 3IUHA 2ZX5A 3G2XA 2X2GA 5AE2A 2P5NA 2D20A 3B8TA 2F5GA 1OX6A 5D9PA 4WJBA 1IHIA 4B3OA 3SR7A 4QYZJ 4N77A 2PP0A 5D6GA 5JUMA 2RDIA 3MM6A 1W1A1 4KE5A 1TG7A 2ZXQA 3K89A 1YJUA 5EA9A 4AFYA 1KLMA 1PV8A 4ZP6A 5ABGA 1KO0A 1OFAA 2NQZA 2MQOA 2WM0A 4C8ZA 4LY4A 1QW8A 3L23A 3ZO7A 2B81A 2ICSA 2UXDJ 4EI2A 3SCIE 5DO2A 1PYFA 4ER8A 4OX9J 1F1BB 3GHUA 1H7WA 3QHMA 1I4NA 4GKLA 3UWWA 3MVTA 5EBUA 2AV5A 1AQHA 3DAQA 3PYDA 4KH1B 1Q3NA 2GO8A 1JD7A 1Q8KA 3PHAA 3CV2A 3R27A 3OJUA 1VQKS 3IMQJ 2ZFHA 2J6UA 4KEZA 3VIHA 4Q4QA 3UYIA 4OZ2A 4FLSA 2R7OA 2WVVB 4DX8H 2LDYA 3RO6A 2AZ1A 1U4BA 1LQ2A 2G3FA 4W84A 2AGQA 3I7SA 1LFWA 4DUTA 2Z00A 3NYDA 1TR9A 4O18A 1W3JA 1ZBWA 4B9YA 1LT7A 3S8HA 1SU5A 1TUXA 1SXLA 5ETPA 2NYIA 2ZKTA 1RAJA 4HMNA 2BOPA 1OABA 3NQFA 1JF6A 3TDFA 2CUYA 5KFRA 3KJVA 3LXBA 1U6FA 1VFFA 1KQGB 3M5ZA 3PHEA 3W62A 1A5KC 3EYPA 2C3MA 2X05A 4ED7A 1B7FA 2DV0A 4CO2A 3MM8B 1TPEA 3R25A 4MDPA 3R12A 5KFGA 1K77A 1HIYA 3F2BA 4PUEA 2DHSA 1F74A 5EPDA 4FF2A 4Q32A 2GDUA 3TR9A 1NK7A 1W5QA 4IIGA 4IR1A 1XGDA 4YYFA 2HQIA 1REGX 3IP0A 3B54A 3TJ8A 4JHMA 5ETQA 3P5BP 1U1LA 4LX4A 3DI6A 4QX4A 1S1XA 2WMFA 4DPOA 1L6GA 3HD1A 1D7FA 3IPWA 1N33F 2HS6A 3AA9A 4WFNQ 1WXZA 1C1BB 1XYAA 2L08A 2WMGA 4PCFA 2UUBF 1Q6FA 2I5QA 5KFZA 5I02A 3M6UA 4H41A 1J27A 2GUBA 3EYZA 4RU2A 3ARVA 3PZQA 3PZMA 1XW8A 2CPZA 2UXBJ 1EETB 3KE0A 2OEKA 1TUVA 1KTNA 3UCCA 3JAMY 2DXEA 4NQ1A 3I65A 4KBXA 1SH0A 2C2OB 3CCVS 3MOZA 3ILJA 1WPCA 1UC5A 2FH8A 1GYMA 3FY1A 1JLGB 1WE5A 4GC7A 2PB1A 3KBJA 2RU3A 2EKCA 3S83A 5I3JA 1Z2ZA 1RT6B 3FRYA 3OHBA 1S2WA 1VJWA 4V2XA 1WF1A 2DT2A 3GU1A 3H5UA 2DKOB 4IMAA 2W3ZA 4Z1CA 4O0KA 1PS9A 1UJ4A 3IIVA 1UH3A 2VMFA 1I60A 5D9NA 5T8GA 1BQNB 1DRZA 4IQMA 3W37A 4IMFA 4A8XA 3WUGA 4OI6A 1LG1A 4FB7A 3TUJC 1ZZFA 2DZBA 3RX3A 1FCAA 1JX4A 1WYIA 4WX2A 1C9WA 2ZRYA 4JXCA 4QSHA 5H1SV 4DAIA 3GXDA 1BLUA 2P9CA 3H70A 2AT1B 4LVFA 3WBYA 4IGMA 1JUEA 3UNDA 3J80U 3QBUA 3I0SB 2BACA 2OAUA 4IH3A 3R6IA 3HMJG 2G0JA 4H9ZA 1XBYA 3GZ3A 3PX0A 1H7RA 3ITCA 5DG8A 2VD9A 2X3GA 4ECXA 3H55A 1PAUB 3BLKA 4EWJA 5KOWA 2BS9A 1IQZA 3T6BA 2NUXA 5HULA 2KU7A 3KLEB 1HKKA 1S77D 3TWAA 3DCPA 3WQDA 3SQGB 1AJ2A 2A6NA 3WH7A 1TE6A 2DHHA 2YWKA 4NILA 3FVMA 3PBGA 3TCSA 5KT3A 1PJ6A 1NOWA 1EYEA 3RR4A 2BRKA 5CJ5A 4KETA 4MLRA 2Y1HA 1NWTA 1I51B 3FC9A 2BB0A 1CECA 1QJWA 4L80A 4I6WA 2PTWA 4H6RA 3VWSA 4A4AA 3D6MB 1CJUA 2QPSA 4MKNA 4BQ3A 3KBWA 3RYSA 4HHUA 2VG6B 5KOXA 3HO1A 1IEVA 3DFHA 4JYEA 1EEXA 5LJ5Y 2OGJA 3RMEA 4QCEA 2XFFA 1YXCA 4JIIX 3T4CA 2NXEA 1O51A 3DOLB 5DM6Q 3Q8SB 5E0OA 3W3OA 3L2IA 1XRTA 4O3SA 1LJYA 1VLIA 4Y2WA 2LVWA 3BMXA 4USUA 1D9FA 4FS9A 4ZO6A 2KHDA 1M3UA 3MW7A 5FEXA 4DJBA 1X38A 3CTRA 4QXIA 2HHPA 2OH2A 3URQA 4I68A 5CXTA 2JQXA 2XSBA 3GFZA 2PRHA 3AD9C 4IH7A 5KFNA 4KT0C 4J27A 2RSQA 2WBRA 1ONRA 1FDYA 2C19A 4PEKA 2XSFA 4KGMA 1QDUB 3WK0A 2EG6A 1HW8A 3KP1A 1GFWB 2UU9J 1W5MA 4IOTA 4NEZA 3GWQA 1WDRA 4RJEA 1Q4NX 4GQ0A 3AOCA 2FZBA 3D4JA 2HMIB 3MHUA 2OYLA 3S1WA 2Y89A 1GQLA 3NGRA 3BW3A 4HYVA 4RDWA 1Q5VA 3EGWB 1M1HA 5LSMA 1XLCA 5LIUX 1THFD 5H9EK 4E4PA 3EDDA 2XHWA 1L5UA 4DWSC 3QY7A 3QNWB 1NFBA 1EKSA 3OU8A 3A3XA 1XUZA 1M5KC 2V5LA 5I77A 3QQ0A 3A3HA 2JFDA 4HTYA 2V8VA 2J77A 4RPPA 3UDCA 1XL9A 1K8XA 2W2PP 3FEZA 3BQ6A 3CHEA 3C3LA 4OV6A 3GH5A 4N41A 1SGJA 2DVUA 3AQUA 4XD4A 1HBNB 3U2ZA 3CC7S 4F2RA 1M7OA 1UHVA 5B7YA 1N54B 3GB6A 1S5ZA 5B7WA 4ELTA 3CYJA 1VLWA 4P7NA 5C9UA 5JH1A 2ADAA 3DFPA 1R3TA 1N48A 4H9VA 4EPDC 1GHSA 1T8XA 3M5YA 3SSQA 3CGTA 2BW2A 5F4SA 2Z1KA 3UXLA 3QC3A 2IPOB 2KX9A 3B4UA 4RCXA 2LXUA 1JB0C 3AO0A 3MMCB 3SN4A 1JLEB 2E9TA 4YVVA 1WV2A 5CBIA 1WHWA 1VIWA 3KFWX 1R0AB 2E1RA 4I2PA 2CVEA 3THDA 3MP5A 3D67A 4ID8A 4I5XA 4PL1A 4B4HA 3RRHA 1WKFA 4JEQA 1U1PA 4HPJA 1CC8A 2B8PA 3BH6B 3R5AA 2H65B 4MFDA 5HVGA 4RR4A 1GWJA 3M5XA 5K8NA 2WC4A 3P6YC 1Y7VA 4PMZA 2MGZA 1BC6A 1EQ0A 3URNA 5A1AA 4NT0A 1YLXA 2YGYA 2RRBA 3PNUA 1Q7YT 3NCQA 2NR0A 4R3UA 2IXVA 4DV1F 3N17A 4LBPA 1H4PA 3FBFA 4A8MP 4MWAC 2I9SA 1RV8A 3UQSA 1JZ3A 3NVDA 5G4WA 1OFBA 3HHLA 3DHFA 2EFGA 4D6IA 1F6TA 3LWMA 3WL0A 2WCXA 3M32A 3UN3A 3W1LA 4IL0A 1GUVA 5AJ3J 3EICA 1MYRA 4GYFA 2QMXA 3NR0A 4PSRA 1S6UA 3IGVA 3PKYA 3EEGA 4J9VA 2CEQA 1LRNA 1CS4B 1W5PA 2DJXA 1E0VA 1K7XA 3NVTA 1UYQA 3QGVA 2DO4A 4DUYJ 3O16A 5D02A 4GI6A 4I7UA 1YJ9S 4V27A 5DCBA 1E1EA 1J0KA 3GSMA 3CAKA 1JXEA 4H4MB 3M7SA 4RE3A 3B8UA 4MTVA 3LP2A 4JTHA 4ZQNA 1VQTA 4ECRA 4K7VA 4WKAA 1RJQA 2V8GA 1PJ9A 2WB4A 1Q0NA 3CXOA 2GJNA 3IWNC 3EX6A 1XIHA 3OVGA 2Q1LA 3CXCR 1LL4A 1P5BA 3I4EA 2DH7A 4AIBA 3IS9B 4LCSA 5HINA 4ECLA 4CN4A 3QW4B 1C93A 1M5SA 1OWXA 3G1SA 2RHSB 3AJ7A 2ZC8A 1QBBA 2Y7EA 4P2VA 5KZ6A 3BLEA 3HX9A 3P84A 2P8IA 3GP9A 3BREA 2Z7GA 1UTAA 4PYDA 2FGZA 2PP1A 1U7LA 2KYXA 2DUXA 3PM6A 3RPDA 2JEGA 3R2CJ 3LTYA 5JQ9A 1K6WA 4K8RA 4USJC 3VGVA 3NS7B 4F4WA 2JL9A 5M03A 2OP5A 2OD4A 1Q6EA 4F7VA 1K8CA 3NQ7A 4U7UK 1U6BA 5L6UA 3ENAA 2DJWA 3AY0A 2VCBA 1H09A 2ZZ4A 2BQUA 2RJZA 1HNVB 2XQCA 5A5WA 5HWNA 1HBOB 1IR2A 1KKOA 1WUEA 3VGHA 4ADTA 4U7CA 4GYKA 3ORWA 4W5ZA 3QQ1A 1CGXA 3VM7A 1NO8A 1EB0A 1FWNA 2W2NP 3D6NA 3CK5A 4MH8A 2FJWA 2LKZA 3I5AA 2LQ9A 1N8RT 3GCXP 2BHZA 2XSAA 1LXJA 3PP7A 5AY7A 3CQKA 3S47A 1Y3JA 2WHJA 3WQ5A 4EX4A 3QLHA 4OBTA 2ISWA 2FVCA 1QI3A 4IMEA 3LI0A 1KXQA 4IFVB 4PMVA 3PYGA 1M7XA 4GYJA 4JTLA 1TWWA 4C7GA 1RPXA 1RSCA 3EWDA 4DBEA 2OWCA 3VVGA 4LQ3A 1IN0A 1J01A 6PTDA 1GORA 1VGYA 4C6LA 4CCZA 1EIYB 2ZBTA 3FFIA 3LOUA 1LG2A 3ETMA 4KHRA 1XWYA 3PR2A 3PACA 1GVIA 4IG0A 3ZWSA 3KLGA 3FOKA 4XO6A 5FA5A 5F4XA 1YJWS 3ET6B 1SW7A 1NJZA 3B8VA 1N33J 3SUSA 4W8LA 4RBUA 4W7UA 3C6TA 1ZETA 1K73T 4LVDA 4EO8A 1SKWA 5D33A 5G0RB 3NM1A 2HVMA 2CBUA 3BO9A 2XO7A 2UUBJ 4ECYA 1CPZA 2D1ZA 4HDGA 4GQRA 1PIFA 1UJ5A 3FHQA 3Q2TC 1VMBA 5H91A 3AI0A 1LEOA 4OHWA 1HJVA 4HH1A 1DTTB 4ACZA 1AZSB 1QR7A 2JWNA 5DETA 4JYAF 1N8FA 5DDPC 3D5HA 1RAFB 5CXPA 4O54A 1S46A 1H98A 3Q83A 4W86A 4MB3A 1QUMA 1W5NA 5CYJA 1KFLA 2JDJA 3RJMB 2QGHA 2YYTA 1CB7B 3SYZA 4ZO8A 3NA8A 2J8GA 4MKSA 4LVBA 4PFHA 5BYRA 2YKNA 3FN9A 3IIPA 2Z1WA 3B4MA 4YOEA 3T3FA 2FZKB 2C2ZB 3P80A 4B02A 2HBVA 1S9EB 3SDEB 2Y5JA 2GLKA 4F2BA 3EGZA 1IXNA 4HYWA 4GO5X 2VB6A 3AXHA 1N7KA 4C6QA 2M88A 3X3UA 2UZ9A 3KUHA 2W4XA 3L4UA 3EMZA 2G4BA 2QJHA 3OTBA 4YHHF 3ILLA 1B30A 5ENLA 1V9OA 3HQPA 4Z42C 4F0HA 4DX3A 3M0JA 1TPB1 2Z2UA 4KQZA 4F50A 1AT1B 3Q24A 3R9LA 2QZ8A 4CLZA 1R0MA 3F03K 5IOLA 5I0DA 1A5NC 2QEZA 3C4UA 3U6WA 2WOMA 3CEPA 1Q6GA 1KNWA 2CNCA 4DZ6A 3LX9A 3EXSA 2BKNA 1EKOA 1H62A 3MFHA 2VC7A 3GXNA 3M6YA 4AIOA 3SXLA 2CZDA 3OVRA 4B3TF 1WDWA 4DPPA 5IT0A 3RR8A 4ED8A 3EOUA 3D6HB 5BYSA 4JL1A 4N56A 3Q94A 2DP3A 2GZOA 3NM3A 4P2SA 2DIJA 2WK4A 3O0FA 3QBCA 1TV4A 4HEA9 4NLGA 3GHTA 3EB2A 3CSKA 2GPTA 4P5UA 3EA3A 2OLSA 4P6QA 4BDPA 5IFPA 4B3RF 1FXQA 5FAJA 2JSXA 1VFSA 3GXFA 1EARA 1C4CA 2VOPA 2AJQA 3H7VA 3M0YA 2VFIA 4XZIA 2C1EB 1XLEA 2HZGA 4AUKA 1PZ1A 2PA6A 3L67A 4DYKA 3TO8A 5CJNA 4MPQA 2E1WA 3ZWTA 1UW9A 2CZ5A 1YJRA 4CT9A 2OSXA 4V33A 4F8XA 2J66A 4HACA 1KB3A 3H2EA 2VR5A 2UP1A 1TVPA 1FWIC 4XTTA 2YBUA 1TJ0A 4G2DA 1HNIB 2V2CA 4ZEPA 4NXMF 1KW1A 3C5QA 1VFUA 4ZE4A 1JDAA 4PH6A 2DZVA 4TYBA 1X4GA 3FVDA 4UMAA 1HW9A 1S3TC 2HK0A 1EFZA 4ZDNA 3QMSA 1EXBA 4QP0A 3URAA 3ATZA 2PDXA 2YNGA 1JDEA 2BGNE 3M2RA 1XLBA 1S2CA 3W64A 3ZFVA 5L38A 5LXRA 3OZPA 1IEXA 2FGCA 4GE8A 1SO5A 1TIMA 1X1NA 1B9ZA 2R2TA 1R3YA 4K7YA 4RKAA 1HWLA 2HGMA 1U09A 3WF0A 2J76E 3DNCA 1A3WA 2BTMA 4TQSA 1M01A 1VF8A 1EP4A 4X62F 3M9NB 2F4VF 4DOZA 4A8QA 4TU1A 4Y2MA 4DR2F 4FYVB 1M5WA 3WNPA 4J28A 4K4TA 4OV1A 1IWBA 3CASA 1N0VC 3CD6S 4XWUA 3RILA 3WF4A 1Q85A 4EK7A 4Y6GA 5LGZA 3VD3A 4MY8A 1I45A 4ZHRB 4L4MA 4PUMA 4GIRA 3MEGA 4DQRA 1N36F 1IKXA 5CZ0A 3JTNA 2V3EA 3HT3A 5KFTA 3QOMA 1FH8A 4QNEA 1Y00A 2WB5A 3VGSA 4XV0A 4C3KA 5I06A 1RPKA 1QT1A 3BTNA 3V6DB 3B9OA 5LZLA 1T99A 3IWLA 3TA0A 4I9JA 2NCKL 5HBMA 1YHQS 4M7SA 3SRHA 3H59A 2GS8A 1FKOB 2VBWA 1G4PA 2FJUB 3QWPA 2XGPA 1KDNA 4QBXA 1GNXA 4JCMA 4I8YA 2M5YA 2AJ1A 4B9UA 2HWGA 3WLPA 2HHUA 4R8UA 3TCEA 1ZBTA 2BVWA 3OIHA 1R8CA 2P6TA 2IKJA 4I7FA 3MAQA 5FF7A 3DLEA 1V02E 4KHPF 2ZUSA 1WBHA 3HV9A 2YNIA 3E0VA 3A8IA 4CT8A 3MR6A 5AVHA 1HMVA 4RUAA 4GYPC 3RR1A 3IRXB 4U4MA 1Z4UA 4AH7A 3B82A 2XISA 3L7RA 1OF6A 1PC4A 5E33A 1RXOB 3H4WA 2PMZD 4DV1J 2CKRA 2LEPA 3Q8UA 4Q8PA 1X7IA 1US0A 3NSXA 3EWWA 2OPQA 2DR5A 3PB2A 3H98A 1D8CA 4PULA 2WXDM 4PEEA 1IV8A 1TKTB 1KFSA 1S6QB 1VR6A 2DU2A 2XVGA 3CAWA 4XX6A 4J40A 1S7IA 4J35A 1OK6A 2CJ9A 2DXDA 4XZNX 1GHRA 3TYTA 3IAS9 1RA6A 3PZ9A 4J37A 3SBMA 5HVHA 4DL6A 1X97A 1NSPA 1AD1A 3C2RA 3GRIA 4OZOA 4RNIA 4JHZA 4JN6A 3MAAB 3ULHA 1N82A 3HSDA 1XGZA 2Y70A 2YBVA 2BQRA 1R8AA 1N55A 4QWBA 4X4UA 3L68A 4XK8C 4MJZA 4FXDA 2VGIA 1XFCA 2D3O1 3W2NA 4LFYA 4M8UA 1OC7A 5G4HC 1KLYA 4XVDA 5K14B 5A8WB 2XCPA 2H3BA 2F1FA 2W4CA 1ACMB 3BSHA 2OPPB 3AROA 1W2PA 2GOUA 4WRHA 5CCZA 3M6XA 1VPYA 2RD5C 2VC0A 4TLQA 5A8OA 1R0BG 5EWGA 3SQMA 3CTTA 1OCJA 2QGFB 4X0NA 1C2PA 4I56A 3HULA 1VRTB 4IO1A 2ZXAA 5KFBA 4GMKA 2DY1A 5LXYA 3NG8A 4WR3A 1U47A 1E4LA 3MUAA 4B9LA 4ERGA 2WVBA 4UR8A 1UC4A 3C8FA 3TX8A 1DWFM 2IPFA 1HWIA 3VNKA 3V0SA 3SCSA 3WDRA 1DTQB 1A5OC 2CYGA 1FXPA 3CU2A 4QSFA 3GNOA 4LPCA 3W66A 1Q5MA 2HVDA 3TYAA 1GOIA 1NDVA 3ZLGA 1Y8BA 2ZH2A 4WP9A 3OTDA 3TAPA 5CEWA 1IEIA 1ITPA 3CDUA 3NP5A 3DXBA 3KMSA 1VRUB 1YX2A 3GUWA 3BAKA 4K1GA 4R7OA 1PJ5A 1VIZA 2AJ0A 2FHFA 3ZTQA 4AF0A 2OYMA 2AGPA 4E5TA 2NQ5A 3PJXA 1XGEA 2CLOA 5DANA 2Y7DA 1BKSA 2EPIA 4YWSA 4DRSA 4CNTA 2ZX9A 2V4JB 3W71A 4B16A 5FSEC 1K03A 2A1YA 3QMRA 2HS0A 2FB2A 2INZA 3D0IE 2XULA 3W9IA 1W54A 1AZ2A 2HAIA 1VBXA 4XD3A 5I7GA 2Q8ZA 1FTXA 4INFA 4NCGA 1OIAA 4ILMA 4B5NA 4GWEA 4IX0A 1IVZA 1AFIA 3O3LA 4IUFA 2VC6A 1K8YA 1GQNA 2WCGA 2Z56B 2ISDA 4NAEB 2Y0BB 4S0MA 1EQPA 2RGLA 3LYEA 2UY5A 2QA1A 2DNRA 2MHNA 4P52A 1JZ5A 1RADB 3JW7A 1EJ7L 2Y88A 5DM7Q 3KHGA 3PV8A 1GNKA 4O0ZA 1HJUA 3WQPA 2VEKA 4DO4A 2CZVC 3BBFA 5LMNF 1UPPA 1FJ7A 3B8IA 1LTDA 2FJBB 4OI0A 4AUBA 4RNHA 2X3DA 3OXLA 1KBJA 1J11A 5AZ1A 4MAVA 4YY3F 2TODA 2J0SD 3GTXA 3GNRA 3RPTA 3HVWA 4USTA 2EVZA 1T41A 2ZZ1A 2O56A 1Y5LB 3UF9A 7REQB 2HXUA 4UTHA 1XSKA 2IC3A 3PAJA 2QJJA 2R7VA 3C19A 4LS1A 3DDMA 2LECA 3DFYA 4Z2JA 3MBDA 1UVNA 2LQ5A 3ZJ7A 1R3RA 4CZCA 2WO5A 4FBUA 3WFZA 4H7CA 5D2TA 3WLNA 2VG5A 3WLTA 4M29A 1TMQA 2CFXA 2QIIA 2VPXB 4I5RA 1C91A 4BK9A 3OYZA 3TSDA 4F9DA 2FQIA 5GAHI 4UTLA 3CHCA 2Z6IA 2XLIA 1J5EF 1NU5A 3LHUA 5HMSA 3M2UA 2GNKA 4MIBA 3NGDA 4M5KA 1X4HA 3D46A 4C97A 2WONB 2DVIA 2J7DA 1X8FA 4BI7A 1VFTA 4AZCA 1HKAA 1CENA 3M9MB 5AB3A 4YLWA 2W8LA 3CVKA 3KHLA 4ECQA 5BRQA 2VUGA 4YHHJ 1RI7A 4EYHB 2OT1A 4W4QA 1D9DA 1EGVA 3A4JA 1A0DA 4HOXA 3WNMA 1L2UA 2PU1A 3QW3A 1H2JA 3TXVA 3W1QA 2YKMA 3USZA 3QMQA 4DL4A 4L9XA 1RT5B 1JLBA 1T8QA 2ISSA 1UR3M 5I3DA 5DXYA 2YB4A 5CPSA 2PWHA 2J74A 1CJKA 4KO0A 2A6OA 4LH8A 5J2PA 2V6AA 2YX0A 1TJ2A 5KT5A 1X4CA 5HUOA 1WEYA 2WVCA 2NSXA 5KSWA 1P7TA 1MMDA 3M6VA 4CLPA 4NAFA 4B3RJ 2NWSA 3I9ZA 4H2HA 4PCNA 1S1UB 4V28A 1Z32X 4DJFA 3OL9A 3HG5A 1CW2A 1W3HA 4CCEA 3QPYA 2EFQA 4IQXA 5GADI 3HFVA 4Q6JA 4PR6A 4Y90A 1VKFA 1KFKA 3FYOA 1JLCA 1V7YA 2NV2A 5A94A 2FIUA 1BKHA 3BDEA 4PCQA 2DPEA 5C25B 3CLWA 5F4WA 5CSRA 1DJWA 4Y9AA 3VZXA 1HQ2A 3ZLFA 3FA4A 1SV5B 2DHAA 1N2VA 3EKZA 4EACA 4DN9A 1SSGA 4NXMJ 3CC4S 3ZZPA 4H6KA 3VZYA 3EVOA 4DYEA 2VPYB 4LF8F 1EDTA 3BOLA 2C3YA 3JB9k 1JDFA 3TJXA 1QAYA 1TV8A 4KF1A 4Q4SA 2BFGA 2OIHA 1YJ7A 3DU6A 2FYMA 1YX1A 3UEQA 4MKYA 3GY1A 1VC4A 4JI6J 3RM8A 3R5JB 4HSHA 3PM9A 1N6QA 2WVVA 1A5BA 2QG9B 1MRQA 1A5SA 5F41A 4K8HA 3H20A 2ZH1A 4QIEA 3K4DA 1S2VA 1Q8BA 4GJIA 1ZJIA 4PUUA 3IM9A 4NLVA 4X62J 3K8MA 3NFUA 5DT5A 3SFWA 4ZQOA 2F4VJ 4DV5F 3PX4A 3CEUA 1UZ1A 5LM7E 3SCLE 1VYPX 4FVCA 1S2TA 4DUZF 3T9PA 4FYYB 4YL2A 1QUPA 2OO0A 4AD1A 1FRHA 3AQOA 4CO1A 3MM8A 1QRQA 5K5MA 5FJUA 4UMBA 3QV8A 3TTOA 1FKPB 1DIEA 4O12A 3W74A 4MB5A 2A10A 1Q65A 1VPXA 3UR5A 4FYDA 2QCFA 1RISA 3GIYA 2ZE2A 5C24B 1IYXA 3Q67A 3T1HJ 2DRDA 4GVBB 2CJBA 3AYVA 2R7UA 1KN6A 2HS8A 3PUEA 1WF2A 3WJSA 3J81Y 4JI4F 5DY2A 1F3VA 3SCTA 3AMDA 1OCQA 4ZIWA 1KLZA 4IL2A 2FJXA 5LA1A 2V9DA 5L8RC 2KZHA 4S3EA 2NLIA 1GVRA 2NV1A 1WNEA 2HFUA 4JTUA 2ZWYA 4NU7A 4ZS6A 1GK8A 1LV5A 1M1KT 2UY2A 1UVKA 1QPQA 1EETA 3WNOA 4DLFA 1QPKA 4KHPJ 2GGHA 2VEIA 4DIAA 2GV1A 5T9CE 4RBTA 1F3XA 2Z2MA 1IR1A 4M63A 3WNKA 3AIVA 2R42A 2GJLA 1AW1A 5CSUA 3EWZA 3QVQA 2V5DA 1JLGA 3CEDA 2FDMA 5GAEI 1PG5B 2XS2A 2J7HA 1YRXA 2JHEA 4ENOA 1L3SA 1PDYA 2CDQA 3M1ZA 3T2QA 4EIVA 1ZENA 3BLPX 5ABFB 3CCZA 4FKYA 3E2VA 1MUWA 3NPWA 2QFIA 4OWGA 2VZ9A 3OFFA 2NX1A 3S01A 1IBLF 2DBBA 4B17A 4F02A 1PIIA 3AS3A 3G8EA 3N01A 4KRTA 2EHHA 5FKYA 1PUDA 1XIBA 3H22A 5C2GA 1FX4A 3D0GE 3WELA 1ZL1A 1QVBA 1R7OA 4O44A 5A2CA 1CIUA 4YR3A 2BE2B 4ZN1A 3I0SA 5D4OA 5L1KA 1SUXA 3G0UA 4O4VA 1CX9A 3I6RA 2HHWA 4CGTA 3FSYA 3VOJA 3FNNA 1IJFB 1RY8A 1HZYA 1NEYA 1A4MA 4J9SA 3EZOA 4TMBA 4UOHA 3O9NA 2B5JB 3C0QA 3Q8RB 1XTZA 1YNYA 3T7VA 2VGBA 1HD0A 3DKDA 4I5UA 1NUEA 2W6RA 4GKKJ 5F7UA 4FOUA 1JPDX 5E3AA 4H9UA 4ORMA 1TQJA 1A5CA 3C0SA 1JNZB 4QIFA 5A8PA 1PB0A 3ZR5A 2JOQA 4Q2MA 5LSRA 3GM8A 3N5FA 1FJEB 1LW0A 1V8EA 4RDZA 4IPPA 1FFGB 3CGIA 4ICLB 4PKDB 1KNZA 3R8YA 1JIBA 3FDSA 2PMQA 2XNQA 2WTFA 3IV3A 2VG6A 2ACSA 1IT0A 4USKA 1OSEA 3POTA 3KOWA 4ZPWR 4UFHA 3R5CA 2VD8A 2EF9A 3HGOA 2QNEA 3LHWA 4YVXA 5HOSA 2CQ4A 4GD0A 4DR6J 1RBLA 4CIOA 3G71S 3AFBA 3THCA 4BWJA 3R2DJ 2R8GA 1XJWB 4H8NA 1NJYA 1PO9A 4QAWA 4IFYB 1UA7A 2P0IA 1TR0A 4AB4A 4ADSA 2QLFB 3W9JA 3NXZA 1ICQA 4B9ZA 4BHYA 4JYDA 4RE0A 1MNSA 2LQ8A 3HHKA 4MY9A 4CNOA 2NVCA 2A7NA 1ZU8A 4DL5A 3KTSA 3R43A 3QGPA 5HO4A 2PO4A 1HWJA 1EH9A 3E2RA 4PXDA 3MPYA 3M7WA 1IWAA 3PIPQ 2RILA 3CO9A 2E9MA 3MI2A 4Y9MA 2HMIA 3TUUA 2WLZA 2E7VA 2QR6A 4OE7A 2VEMA 4GJ1A 4XUGA 3VILA 2VZVA 2YL5A 2J25A 5DRCA 3STEA 1EDQA 2OB3A 3MOJB 1AMKA 4H19A 2JC0A 1TV6B 4ZVPB 4LAUA 1LRTA 2FPHX 1RACB 1KTQA 1SQ7A 1YE6A 1S48A 2H1YA 2EG2A 1MFVA 1BYBA 2WANA 4QW8A 1HUVA 5FACA 1P0EA 3VFCA 2H5EA 1XD1A 4GC3A 1HBNA 4X66J 2REQB 3AS0A 4WF7A 3ITXA 4AY1A 2XCAA 4O4WA 2KDOA 3TNVA 1E3XA 3K5LA 3VZIA 2WVUA 2QL9B 2XM3A 3MV11 2I38A 4J9MA 3CBWA 3EMCA 1JZ8A 1VBYA 5MF5A 2GGPA 5LMNJ 2B0MA 1XUUA 4K2JA 2VH7A 3W60A 1RAOA 3LERA 2LEAA 1WZAA 4C9DA 1YK9A 2GC8A 1LQAA 3MMCA 4YY3J 2OTLS 1JLEA 4ZCMA 4CU7A 4QR1A 3LRMA 2OSQA 2V2KA 2DNMA 4DLGA 3AJXA 2YZ5A 4Z0SA 1J0IA 4G3IA 3CL8A 2FB3A 4JHOA 4IR9A 2XWYA 2XIIA 2IKIA 1LLWA 3PW2A 4DUXA 1O5XA 2AL1A 1A6LA 1AYEA 3MUMP 1QI5A 2MSTA 1NH6A 1YDNA 2WKGA 3VNJA 3I4HX 2V63A 3HHLD 3KHRA 4NZ0A 4U33A 4I9AA 4XD6A 5A0YA 3G5EA 3TFCA 1U2YA 5K9FA 1ZAXA 3HZEA 1F9CA 2GDVA 1N5QA 1W3TA 4ICNA 2VF3A 4UNKA 2ZUTA 3VXGA 3A64A 4UBPC 3CJRA 1AMYA 2M7SA 4F66A 4DM2A 1NNDA 1HQEB 1EPVA 4ECZA 2CJKA 3TYUA 4LV4A 4G56A 3ONBA 3VNYA 2QN6B 3B0YA 4B2DA 2Z2LA 5IC6B 4DBQA 2ZZ2A 3A23A 4XK2A 4XTIA 4HT7A 1HO1A 4UCGA 1EEPA 4M1RA 4IGHA 3Q22A 3AISA 4ZOSA 4DX7A 1B1YA 1X9SA 2X1SA 2ZUVA 3X1LB 3AZRA 3N9RA 4HN4A 2PZ0A 3I5CA 3CDEA 3W5XA 3NO3A 4CNNA 2ZZMA 4LTSA 4J3ZA 1I2RA 1GTHA 4AZGA 3CB4A 4LF4F 4NZFA 2K3IA 3HSGA 1JYXA 4PMJA 2B3TB 2QLXA 4KJIA 4ROQA 2IXUA 2JC1A 4FF4A 3RU6A 1HL6A 4K36A 2PWEA 1ZCOA 1MQRA 3OL7A 4DV7J 4MDOA 4Q8VA 4IKAA 5IWAF 1JG9A 3OG3A 3MZ2A 2OPSB 4H4MA 3GQCA 3WD3A 1S0VA 5CC5A 3SMZA 3CMES 2CZ4A 3VAFA 3B8WA 7CGTA 2JEIA 3BO3A 4GGHA 1R3NA 3TOPA 4LAOA 3MSYA 3RLHA 4OYAA 2VONA 2RUGA 1FXDA 3GS6A 5MKGB 4YB6A 3TA2A 5I42A 5A6PA 5JVGQ 2UY4A 2OKQA 4LQ9A 2HNYB 2HHHJ 1IBKJ 3KL5A 3TYCA 1MRAA 1V0LA 1AH0A 4J90A 5D2XA 1XC9A 4O52A 2FHOB 1CBGA 1CC7A 3BJTA 3BO4A 4GY1A 4WBFA 3SFUA 3ME3A 1J0HA 2CG8A 3TEGA 2JEPA 2CVIA 2E8YA 2P53A 3NPVA 1FQ0A 4UB9A 5DQGA 3K4AA 4LF7F 4RW3A 3GU9A 4QG9A 3MEEB 4BWLC 3WZ0A 3QZ6A 3WH8A 5BMWA 3LF0A 1KOOA 1LLOA 1KM5A 3UCGA 1C7SA 1HBOA 3DBNA 3KM8A 3W3SA 3WK1A 1P9QC 1YNQA 3PUGA 4O53A 1KGXA 4K39A 3WNLA 1QW9A 4IG2B 1L6WA 1SFJA 3W22A 1NK4A 3JSRA 1ZLPA 2P3ZA 2QCHA 3NL2A 3AS2A 4LUBA 3MUIA 3ICJA 3IGUA 2HMCA 3KOXA 2VI0A 4IQLA 1YMYA 1F3TA 4P2XA 4O3PA 3TEVA 3RBXA 2Y1IA 3GW3A 1FK9B 4EEYA 3QPEA 1EWEA 4DV5J 1FEEA 4AVFA 4F4RA 4KRZA 2XFRA 3FXGA 2FLOA 4IFVA 4DUZJ 4QU6A 5FESA 4WK3A 3E2SA 3EWCA 4HK6A 3LDVA 3GTIA 2D0GA 2XVLA 3OBEA 4YB1P 2YDAA 1KSPA 2A79A 4P72A 3V6KA 3P82A 3OSPA 1RA7A 4AL7A 2QGYA 3THPA 4EGLA 2Z1SA 2DEIA 1OD8A 2XMKA 2PEHA 1E15A 2BWGA 3S2MA 4LOCA 4GCXA 4PMUA 1W1PA 3M6WA 4S38A 2AJFE 3JQMA 3SGGA 3LHVA 3GR4A 4LQ1A 4JI4J 2VXNA 3VUPA 2V38A 2FJEB 1H41A 2QF8A 1LP6A 4JN7A 4LS0A 3SI8A 4TMCA 3SUUA 1EL3A 3HJEA 2E5DA 1LL6A 5AC6A 5G0RA 1F6KA 1XNRF 2H6RA 2XLJA 3R0KA 3ABXA 3APYA 2FC8A 3OR2B 4HI2A 2XSJB 4NJKA 4GI4A 3P93A 2AAMA 2C2DA 3IBFB 2XVKA 2MDAA 1W9UA 5HQLA 2HQDA 3D6FB 4ZFMA 2C2NA 4NNCA 1AZSA 2CXGA 2RKXA 5B0BA 4U9RA 1K9DA 1UQYA 3NQVA 5FJPA 1KKHA 5BZAA 5DLCA 1Y9OA 1NZAA 1H1NA 3IRDA 3A3PB 3MPGA 3MFIA 1CJVA 4C7DA 2DNHA 4RLEA 5G1TA 1B4EA 3POCA 2D0HA 1J2WA 1E6ZA 3MV01 3CJSA 2X8RA 1NTHA 2C1HA 1FXRA 2ZH5A 3WDIA 3GUGA 1RT4B 3DLLQ 4O11A 1RTIB 2WW8A 1R9XA 3A22A 1OSCA 2CNNB 3RBZA 4KWOA 3L65A 1IKWB 4L1WA 1UMJA 3LGNA 1ITQA 4CTAB 5EFDA 1NMEB 2ILZA 4S3GA 5ABTA 1L3VA 1IXKA 3EB4A 3H2AA 2C3UA 2OFGX 2RQCA 1WC5A 4IOBA 5LMUF 2C15A 1ZBCA 2HEJA 3EEZA 5AVNA 5IXUA 1WSRA 4DR3J 2HS4A 2ADBA 1J18A 2FY8A 4AY7A 2VHGA 3KVKA 1BG4A 3VE7A 5DQPA 4GQGA 4QG6A 3OTCA 4LF9J 1E70M 2XH0A 5CZVA 4YDDB 3R97A 2GIRA 1BD6A 1UUMA 3GIQA 1G9HA 3L0NA 4N9EA 1KM2A 3WLHA 4C6MA 3EZUA 3H8YA 3QGHA 5D4PA 3H4GA 2OLAA 1X60A 5LSOA 2EKGA 4JBRA 4YTUA 2KI2A 3BBBA 1D9AA 3WLOA 3C8NA 3LM7A 2PC8A 3E12A 1QNRA 2G41A 1XDJA 4GUJA 3GHRA 5D0GA 4ID5A 3N34A 2JF7A 3E0IA 3XISA 4UNIA 1JZ6A 2H8ZA 4C60A 1SMAA 3DFSA 4ELVA 3MKKA 4RNJA 4EANA 4AG0A 3ZTSA 3V3WA 3K30A 3FKBA 3QR0A 4G7EB 3IJ9A 3UFYA 4HK5A 2X7VA 1HP4A 4RR5A 1RWXB 3NQGA 2GQQA 1ZM9A 3H90A 3OBAA 3BQ5A 1QI2A 4WIWA 2OZ8A 5F2GA 4L74A 4NLYA 4QW9A 3VV2B 4L6OA 2MQ8A 2JFKA 1PDZA 5KT4A 1TQXA 4KT2A 2ZUAA 1MO0A 5CYQB 1V6UA 1JYNA 4BA0A 4RDVA 1TWZA 1UZ4A 2DHXA 1UUOA 1K4GA 2J13A 3MP3A 3U8GA 5KFPA 2UVRA 2OUGA 1I1WA 4U31A 4DG1A 4HNUA 2F6XA 3TA9A 5GAEU 1LXNA 1N5TA 2J7FA 2A3LA 5AHLA 2DGOA 2DCLA 1SL1A 3C2FA 2AD9A 1CJTB 1F5ZA 3DECA 4Y8EA 2MLXA 3VNDA 3R7NB 2J9YA 3LQLA 1F7BA 3PTDA 2FJAB 5DZ6A 4ZITA 3WJWA 3FEXB 2ZVRA 4I9MA 3RM9A 3CNQP 2WVFA 3GG8A 3QRQA 2OSRA 2ZA1A 4ZKAA 4QR0A 2KTQA 1CXFA 3DRSB 3DLHA 2C2MB 4X4QA 5K9CA 1V3MA 2ZDRA 1NDYA 1FWBC 1LWIA 1PTGA 1UWQA 5HJLA 2C3PA 3EDRB 5CQGA 4K37A 2RDUA 3HM7A 1MN9A 4LRBA 3HKZD 3JTOA 3UCZP 4LXFA 3AIUA 3OQ8A 4YNGA 4AZ5A 3MP4A 5BR8J 1XCFA 1KM4A 2W91A 1P43A 3GJTB 4ZPVR 3VNZA 4TVCA 3CMQA 4I1TA 5PTDA 3HPOA 2W25A 4O4RA 4PUWA 2GQAA 3QIPB 1XERA 1HBUB 2GFFA 4F3QA 1OYEA 2HIYA 2LXIA 4RWWA 4ZCLA 3NBPB 4E0DA 1K6AA 1V6YA 2DGVA 1G7UA 2ZH6A 3V6DA 1WEXA 1FNMA 1LKZA 3Q89A 4PAAA 2D0FA 2V4QA 1RAIB 3GHSA 4LAMA 2J4GA 2APOA 1FKOA 5HMZA 1HQUB 1UW4A 1IKYB 1KRBC 5TAOA 3QATA 1HT6A 2FMOA 2YWGA 3M2VB 2BM1A 1EWDA 5CGMA 2ZTKA 5HNNA 5L46A 1KXHA 2PD9A 2FHMA 8AT1B 2I6WA 5AYBA 1VDHA 3M9YA 3GIIA 3QSIA 4FNHA 4JI3F 2GQCA 4DS5A 3GG1A 1ZA2B 1HW6A 5HNTA 4MK8A 4OYBA 4JI0F 1EBHA 4S3CA 2HVZA 3H40A 3W7EA 3NO5A 4HMDA 2WKJA 4FX8A 4OHYA 4HVZA 5I3QA 3IRXA 3TSMA 3PZNA 3QRHA 5FJTA 3WJXA 3UD3P 1RY0A 4XAPA 5JIPA 4PWDA 2GZXA 1A9NB 4GXMA 3CW2C 2NXGA 1RTDB 5I3UA 4RW8B 3W1XA 3CZLA 4AWTA 3QYYA 4LF5F 3OJSA 4AD3A 3SN1A 4QIVA 2W9AA 4UOCA 5FEPA 5AC5A 4H4OB 1TKTA 5KFXA 2QLWA 2FB0A 3T2OA 4UZUA 2X1FA 4P8UA 4DJED 3OJGA 2CDRB 2D23A 5M17A 4HNCA 3NO1A 2VZTA 1S10A 3QLDA 1R0CB 3GR0A 4IO9Q 3JVAA 4ED6A 5EBAA 2WAGA 4IG3B 2PDJA 1U0HB 4ZPBA 1E0WA 1J9YA 2ZZ3A 3CNYA 1W3IA 3GQYA 1ZAJA 1O5JA 4X65F 1FBAA 4X2BA 4FNUA 4X4TA 1VJSA 1BWEA 1Q6LA 1HYSB 2VWTA 2VOTA 2CLLA 1MSWD 4B5TA 3G96A 5IWAJ 1SIZA 1OFQA 4J3TA 4WOZA 4B15A 5K14A 4HPNA 3TNOA 1FDBA 4HMEA 1EAYC 3IXQA 2Q6BA 2OZ3A 2OPPA 5F8NA 5J2NA 3LHYA 3BAYA 3P0WA 2XH4A 3DRYA 5DMYA 1LWHA 1MQQA 3LU2A 2BM0A 2WJEA 1T3OA 4Y65A 4A6GA 2VQFF 4E8GA 3M8QB 3VGGA 1P6TA 4B3OB 3ENVA 4FA3A 2DQWA 3F44A 4JIRA 4X64F 3LA4A 3T5HA 2DRAA 2IVYA 4I69A 3NOYA 3B05A 4KH0B 3OQ2A 1LUCB 4B5XA 2GQ9A 3LCXA 2DNOA 5CD4A 1Z1ZA 5FOOA 1XCXA 2PDBA 3MM7B 1ISWA 2AW0A 3PHTA 3S5OA 4J7RA 4UTWC 4NJHA 1DTQA 2WCSA 3ISZA 3VIOA 4X4VA 3M46A 3P3DA 2C0HA 4ES2A 4CCCA 1C0TB 3N4AA 4UFKA 5DGBA 2FZ8A 1UH4A 5FJRA 1CGYA 1RK8A 5BWFA 2DGTA 1MMFA 1ECEA 4ZSUA 1HKWA 3ETOA 3ZZ1A 1FWCC 1VRUA 1KHVA 1LRQA 1XRVA 4R5EA 5BXPA 3PR5B 4M6VA 1S7HA 1DWHM 3BGRB 3HKWA 1OFEA 2HQCA 3J80Y 2Y8VA 3QC0A 4JTSA 3V5OA 3PDNA 1J10A 2V4JA 1D0EA 3PB0A 2B4VA 5B0CA 4Q4OA 3IAM9 3O6CA 3LUYA 2WSKA 2IPGA 3NY0A 2FD2A 1ICPA 1US3A 2DR8A 3QR1A 1Q1KA 3CYVA 2CPDA 2VURA 3PN8A 3PZPA 5KFAA 1S72S 4E98A 2IMRA 1TWIA 8A3HA 1YWXA 2FKPA 2C2KB 2RMLA 1MNZA 4YU1A 2B9YA 4UOGA 3Q2DA 1S1XB 3WQ8A 5ABHA 1JAKA 4Q5VA 2IY5B 2QS8A 2OX4A 2GVDB 1TFWA 2ZBQA 5IV3A 2CPXA 4FF5A 3Q8YA 5EMMA 5AECA 4GXWA 4OZ0A 3FCPA 4Q4PA 3SIMA 2TYSA 4Q8OA 5D0RA 2ZRUA 2TSYA 3DGPB 3M1VA 4K6AA 5HROA 3OTEA 3LWLA 1CEOA 1EHAA 5XINA 2OWXA 3VIJA 1XN9A 1TELA 2WSPA 3AA8A 1NK9A 5BXSA 3EA1A 3ARQA 1XMQF 4L5ZA 4DL3A 2MQMA 5D15A 2NT0A 4F3OA 1XNRJ 3L5LA 2Z1XA 1G01A 3ZJKA 4Z2KA 2YW4A 4GX8A 4LCRA 2W0UA 2YW3A 3T1AA 2ZE3A 1KBLA 1G5AA 7REQA 4U95A 1FDAA 4NEYA