3KDOA

Crystal structure of type iii rubisco sp6 mutant complexed with 2-cabp
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
436
structure length
435
Chain Sequence
YDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITLGFVDLLRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
publication title Structure-based catalytic optimization of a type III Rubisco from a hyperthermophile
pubmed doi rcsb
source organism Thermococcus kodakaraensis
total genus 135
structure length 435
sequence length 436
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3kdoA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3kdoA01
5HAOA 5HJYA 1RBAA 5HJXA 2OEJA 2ZVIA 5RUBA 4F0HA 2VDHA 3WQPA 1SVDA 1GK8A 3AXKA 5C2CA 3RG6A 4LF1A 1TELA 1UPPA 3FK4A 1BWVA 3RUBL 1RLCL 2YBVA 4NASA 1GEHA 2V6AA 2V67A 2QYGA 1RCXB 2VDIA 3NWRA 5HQMA 3A13A 2V68A 1UPMB 5HANA 9RUBA 1UWAA 1AA1B 2D69A 4MKVA 1WDDA 1UZHA 1RCOB 1RUSA 1RBLA 2CXEA 1RBOB 1IR1A 4LF2A 3KDOA 3QFWA 1IWAA 2V63A 3AXMA 4RUBA 1RXOB 2OEKA 4HHHA 2OEMA 3A12A 2RUSA 2CWXA 1UZDA 3ZXWA 1BXNA 5C2GA 1RLDA 1RSCA 2V69A 2OELA 8RUCA 5HK4A 1YKWA 3KDNA 1EJ7L 4F0MA 5HQLA 5HATA 4F0KA 1UW9A 1AUSL 1IR2A
chains in the Genus database with same CATH superfamily
3GC4A 3SUSA 3VTRA 2VURA 2W3ZA 3G1SA 3H8AA 1MRAA 2ZE3A 4HU8A 5DGBA 5KT4A 3K8MA 2PP0A 2OXNA 1UB3A 2B7BB 4H4MB 4DSFA 4J3WA 3SGGA 3THQA 3HZGA 2ACSA 2E5LF 3I55S 1V8EA 1JDFA 2VGGA 3NQVA 4PMDA 3UXDA 3SIZA 2PA3A 4HJFA 1IN0A 1RR2A 2ROGA 3T19A 2VR2A 3R1HA 4DJEA 2BHZA 3GTNA 1EF3A 1T99A 3PZNA 1LEOA 4H9TA 4FLQA 4S3CA 4NZFA 1SZNA 4TV5A 4DWSD 1EO5A 4WE1B 4IFVB 2COLA 2ERRA 4NASA 4DV2J 4LY4A 1A5LC 2PC6A 4Q32A 4YMEA 3LXAA 5IV4A 2P3EA 2PD1A 1AG1O 2IBKA 1Q7ZA 3RR8A 2OWCA 3Q24A 2V2ZA 3D0IE 3KTSA 1W5NA 3KBJA 3C61A 4U28A 2F4FA 1K44A 4HK7A 2F7VA 3HD1A 2E5DA 2E5JA 4OZ0A 4R0EA 4HYKA 1KFWA 1JRCA 2VEFA 3CULA 4UQ9A 2ABYA 3E96A 1JZ7A 3VOHA 3BW2A 1RTHB 4NL5A 4H83A 4NNCA 2DGVA 3P80A 1GOIA 1LL4A 2X3GA 5EDWA 1KEKA 1BF2A 2MQMA 2XZWA 3ENQA 2ZBQA 5A2BA 4FDFA 3PC0A 3VKAA 2IPFA 3VD3A 1AH0A 2P9GA 3GPAA 4W4MA 1X6NA 5I0DA 4XKYB 2XSJA 1XLEA 2PEVA 3GE7A 2VCAA 5CSRA 3RMJA 3DECA 2FVQA 1WG4A 5DDQC 3KMSA 3OIXA 1CJUB 3PNIA 1HNYA 2WC3A 4L4MA 2DGWA 3UCZP 1D9FA 1GQJA 3R8HA 3DHUA 4GQGA 3W8PA 4DR5J 3LTOA 1SPBP 1Z69A 4FLOA 3SN4A 2OJPA 4TU1A 3R7NB 1ISVA 3ES8A 3CT7A 5CLWA 1S57A 5GVJA 4NAEA 3MU7A 3STGA 4URGA 5DQIA 1AD1A 3F4VA 2YVSA 4G1IA 4K2JA 4HHPA 3W27A 3B40A 2ZOFA 3V6KA 2VG6B 3H2CA 4ZZ9A 3PEJA 2Q3RA 1W1A1 4Y2AA 1HUVA 1MN9A 4JYAF 3VVGA 3LN3A 3TR9A 4IPPA 1SVDA 4U96A 3P74A 4DNHA 1OFAA 5B80A 4CVUA 4Z08A 5KFNA 1EDQA 1OFBA 1YZ6A 3OTEA 4RV3A 2Z26A 2WOMA 4YS1A 1Q8AA 4F8RA 3PIPQ 1MUCA 4PUJA 1X97A 3TYDA 5JVLA 4FF2A 1ZPVA 3SQMA 2NUWA 4UFJA 4GUIA 2INFA 4EGLA 3RX2A 3HFTA 1JNRB 4CLUA 4LTSA 4WFNQ 3R10A 1S6UA 5F8LA 2E8YA 4DJFD 5FSEC 4G6VB 2QF8A 1R87A 4F8XA 1KRMA 4MJ2A 3SUVA 1MEHA 5HN0A 5KFLA 4DV3J 2NV1A 1FCQA 1OG6A 3UG8A 4IPJA 2VF3A 4HKQA 4DI8A 2NQ5A 2W0UA 3KJVA 1EP4A 3WY1A 2MZRA 3TVAA 1PO9A 3H5XA 3D6MB 3M1VB 4G5DA 2PWHA 2CQCA 2P3ZA 3GHSA 1NELA 3CV6A 2CQPA 2ZE0A 3SN1A 4M1KA 1X5TA 3AYSA 1F3TA 3J7YI 1FI4A 1MQPA 5L1JA 3GVRA 2ABAA 2ODOA 2OGUA 4JI5F 4WYWA 4XX6A 3IRWP 3WQFA 4GACA 4P9SA 1NP0A 2NQHA 3MZ2A 3F4DA 3VCCA 2XHYA 1U24A 3RN6A 4OT7A 4USTA 3KK2A 2PODA 4DQRA 2XFFA 1SQFA 4NEYA 1RACB 3CS2A 3CUJA 3EGJA 3JAMU 3N6MA 3LV6A 1M1KT 3ZYZA 4D71A 3RAOA 4E4UA 4RW8B 3TJ4A 4EU0A 4IQDA 3EWGA 4A8NA 4AQYF 1X5SA 1M1BA 3CHCA 2VFSA 1ALDA 2X42A 2RKXA 1EETB 5D3GA 2JFEX 4JIRA 4A8QA 1KGXA 1NVMA 2CLOA 4TVUA 1LQAA 3GNNA 3PR5B 4MDPA 2DHSA 5KG0A 1JYVA 4MIAA 4G1QA 4N5SA 2ZXAA 1OIFA 3AIUA 3T42A 5HWNA 4LF8J 3NP5A 1IGSA 1CENA 4OYMA 1DQ8A 2J0SD 2CZFA 2FVRA 3KG1A 2CXGA 1UMJA 1UVIA 3HU7A 4Q45A 4ZQPA 1TUXA 4LH8A 1VZWA 3DN9A 2D3LA 1KTQA 3PJXA 1T05B 1JQVA 1JLAB 2BJEA 3HM7A 2QFIA 3AAWB 4C5ZA 4MT1A 3RG6A 3UCDA 3WLNA 4KBXA 2EC0A 3B0PA 2V3FA 2VA2A 2C2OB 3KKFA 3KHRA 2Y9HA 1ZLPA 1M9HA 3OL9A 3BBCA 4HSHA 5LMUJ 1EQCA 4LF8F 2FZCB 2DZSA 1RQBA 2WVVA 4EPBC 5IM0B 1CI1A 1T3OA 4Q4PA 4DV1J 3JSMA 3B04A 3F1QA 1FWDC 1KWKA 3ARSA 5FEZA 3VE9A 3NDYA 2K7JA 1H7RA 3W2NA 4AW7A 2D69A 2KHDA 4PWDB 3V1PA 1OC7A 4JTAA 3CZEA 1K1QA 3DBNA 3FKRA 1FX6A 2Y61A 4AYSA 4RKUC 2QUVA 2QGFB 1X4DA 2CPZA 3AFGA 4FZVA 3TU9A 2CNKB 2FGOA 2NZLA 5KZ6A 2BJ3A 2O0TA 3KVKA 5FJIA 1ZBWA 1TUFA 5AB3A 3OFHA 1WHVA 1NWTA 4F4YA 4JV2A 4AWTA 4HA0A 4DL4A 1KM5A 1H2TZ 1R6YA 4B9VA 2CVEA 2M52A 4DV1F 1RXOB 1H4PA 2VFTA 4DCPB 3K57A 4X61A 3CMJA 1VHFA 4J3SA 2XGQA 4KFOA 3LRLA 3M7SA 2O9PA 3EWBX 4Q0BA 3GWCA 1CSJA 4WR3A 4D6JA 4DQWA 3P8BB 2YDAA 3OR2B 4FNQA 1JDCA 4AD3A 5ECUA 1IT7A 3JVAA 2JRSA 3O2IA 2X7VA 1SI9A 2NT0A 2FVSA 1L2QA 1CC7A 3EZ4A 3NRBA 3GV8B 1S9GA 2YWHA 1LK7A 3THTA 2OYMA 4K7VA 1Y11A 4ZVJA 1GQIA 1Z1ZA 3HJFA 1K8ZA 1VJIA 3VAMA 2R8GA 3BSMA 3LWLA 2FPVA 3RLHA 3FJ4A 4PH6A 3ITXA 2VASA 2BY0A 1R30A 3VGFA 4XTDA 4HNTA 2V8PA 1A4LA 1K7FA 2W8KA 3OGVA 4MH8A 5HINA 1RZMA 4K0KJ 1GG0A 4O3NA 2GVLA 3V5CA 3VFCA 2G13A 4LBIA 1R47A 2RAQA 2D0FA 1YZ7A 1G9HA 1R27B 4B9YA 3DRPA 3OL8A 3SCKE 3R5DA 5E09A 3PEHA 4OJ3A 4BLGA 1US3A 4WBFA 2VPZB 1EKOA 1ZQ5A 3EDQB 2DH2A 4GIAA 2MJNA 1MVYA 3A64A 3VUSA 4MY9A 4HI1A 5GAEU 3LLDA 2R9RA 1EXPA 2E6FA 3PZGA 1NBEB 3LI1A 3KLHA 1AFJA 4GY7A 2FLOA 3GDBA 3IR5B 4I1TA 1VQ7S 4LC6A 4AISA 1V5IB 5IRPA 4L56A 5AY7A 2W5FA 4PSRA 3S6OA 4ED2A 2O56A 1KWMA 4K0KF 3DOLA 4YJ5A 5FJRA 4KQNA 4JV0A 3RYLA 2QSWA 4WKFA 4OHWA 3E3XA 3ENVA 1IWGA 4RW9A 4UTKA 3ZSTA 2MANA 5ABFB 4NLSA 4B9SA 1S1XA 4CM0A 3B8SA 3JYTB 2D3OR 1OADA 4NMLA 2ZWYA 3W23A 1QU4A 3OXFA 2VEKA 3HFZB 4RJVA 1WZMA 5AC8A 2KI2A 2D2GA 4IG2A 2BY3A 4N6FA 3U48A 1P1TA 5KEZA 5MKGB 2BGSA 1DHMA 3D6HB 4I6AA 4RPFA 1TK5A 1US2A 2MNRA 2VHLA 1OCBA 5KFTA 2HPIA 3IGVA 1GPFA 2WW8A 2INEA 3PWIA 4JKKA 5GJNA 4LUSA 3V81A 2JL9A 4Z7CA 3UJEA 3LTPA 4GE8A 3EJMA 1KBRA 5GAHU 3NSMA 2F8EX 2FVPA 3B4DA 1RA0A 2Y1LB 1AH4A 3D0HE 3TX9A 3QJLA 2DCLA 3LANA 1IJEB 1HQ2A 3UDVA 1W1IE 3KE0A 2E1CA 3G18A 5BOOA 3QAEA 3WX8A 4B9LA 3EPNA 5A8WA 3TZNA 4KRWA 2IC3A 3H7HB 4RX6A 3BG3A 3NLCA 2Z57B 4US5A 3NZPA 1V6TA 3TEHB 2W2NP 1BKHA 2J8GA 1EQPA 6AT1B 3QGKC 5E3PA 3UJFA 4J9VA 1WELA 3UO0A 1NF0A 1XG3A 1NPPA 1CT5A 4CCZA 5D4YA 4DEFA 3M6UA 3E0FA 2VQTA 3AD9C 2XWXA 4QCLA 4MKSA 3PVXA 1NJIT 1J9YA 1TVPA 4G7EB 3VVUA 4EKJA 3LP1B 2ZH3A 2V0TA 2R1MA 3EXCX 2FVLA 3CCUS 4I6YA 3CEPA 4QIVA 1FWEC 1JLEB 3QTGA 3DGPB 1NK9A 3DOMA 5KG6A 2HBRB 5B0EA 3MR6A 5LZLA 5HWJA 4QG6A 1B3WA 2DR9A 3JSYA 3AISA 3B0VC 1MFVA 4LFYA 4GYJA 4TX9A 3I6PA 2HNZA 3LZ5A 1RBLA 4ZCWA 1MWOA 4S2CA 3CBWA 1RTZA 1XCXA 4OU1A 4PTDA 1HBUB 3RJMB 2VT0A 1SFLA 3AOCA 3PM6A 2EPHA 1QR7A 4I8YA 2ZICA 3HSJA 4IRDA 4AU0A 1IKXB 2BLEA 4H9ZA 5AECA 4Q8OA 3GH5A 3NQBA 3VC6A 1V3JA 2ZE2B 3UW1A 3PW4A 3AO0A 3S7RA 5I42B 2QSFA 4DUYJ 5LL6d 1Z41A 3CLWA 4FEZA 3S9ZA 4TNOA 4PUOA 5I7GA 1UCWA 2CQ2A 1YJRA 3TUUA 1A7GE 1FDNA 4MB3A 2XYHB 4F0RA 4EPEC 5J1PA 2JEFA 4PPZA 2L41A 1NKEA 3KZPA 3IAS9 1A3HA 2WLZA 1Q4NX 1DWAM 4MOZA 4YYCA 3VF0B 4JOMA 4M5DA 1VRUB 2MKSA 3L68A 1ZAIA 4FK9A 3OVBA 1S6QA 4M5KA 2B9YA 3D3BJ 4FXDA 2QL7B 1UBSA 3PIOQ 1Q7MA 4HKPA 3OYXA 4GOAA 2VEGA 1YYAA 4EF9A 4H8VA 5CC7A 5DRIA 4KV8B 1TL5A 3LF0A 3F2CA 4EBCA 1K8YA 2ZXQA 1FDAA 5BR8F 1YBAA 2DW7A 5KFYA 4E2BA 4YYFA 3QMRA 3AXIA 4V2XA 3EWXA 4QP0A 4PKDB 1SFSA 1A5MC 3C2YA 1FXDA 3W88A 1DBDA 4LIRA 1JEZA 2YBVA 1KFBA 4QS6A 4ZCKA 2WMGA 1LZOA 1M1GA 2WBMA 2Y7FA 1ONXA 4YIWA 1Y3JA 2ZC8A 3PTQA 3R27A 2C3PA 2BQUA 2V38A 1A50A 2XHWA 1OJXA 4JIQA 4GO9A 5A8KB 3M8YA 1M5OC 1O8BA 3A23A 1SQ7A 1VBGA 4G1NA 1GOWA 1NM9A 3P81A 3SFGA 3M2VB 4C4WA 3THUA 1W5MA 5DS7A 3E0IA 1V77A 3VKCA 5IHRA 4DLEA 4K38A 2HE8A 1DQAA 1GW1A 4BF5A 2KVQE 2V0NA 1UMYA 2HHQA 1QE1A 2QTWA 4AYBD 5H9FK 4C3MA 2R8HA 2R8IA 3K30A 1EPXA 1ZETA 1QAJA 3B8HA 2BVZA 3CDBA 1O5RA 4FXRA 4GPNA 4LYRA 3G2GA 1IF2A 1GXTA 3LGEA 4LF4J 3GG1A 1QBBA 5E7OB 3NO3A 2YJQA 3F4CA 2FTPA 3PYEA 1GZ1A 3EX6A 1UKUA 4NYZA 2FJWA 4FN5A 3VGEA 1S97A 2ZVRA 3CJSA 2CQDA 2EG8A 2ZHAA 2PTXA 4W87A 3U7VA 2XVKA 3M6YA 1PIEA 2RB7A 4DL6A 3FDGA 3TNBA 5FEXA 3TJLA 3TK7A 4Y90A 1F9EB 3PANA 3T0CA 4RW5A 5C7HA 1WE5A 5U7SA 4DV7J 2PDLA 3VOFA 1WP6A 3GNRA 2AYBA 2OSRA 3U2EA 4YR3A 3H2OA 2QL9B 2MPUA 3RBEA 1L2UA 2QR6A 5CC6A 3AFBA 3BV8A 1DIEA 2D73A 3S2MA 3SDEA 2K06A 1X96A 3WFLA 1I45A 3SRFA 4WKYA 4JY9A 3AJ7A 2J7EA 1S0MA 2DIUA 3R8YA 1FXQA 5JMNA 1N8RT 3R2CJ 1ZJAA 2CYGA 1XR6A 3AS1A 1L3TA 2MB0B 4ECVA 4JV1A 2NQPA 4S3GA 2R6OA 3DLKA 2LQ8A 3URQA 3WD4A 3RJYA 1V08A 2CNNB 4B4FA 2A3BA 5DY2A 2R7RA 2R8JA 4DV7F 5HUOA 3L95X 2XSXA 3I68A 2VG7A 3MA8A 4JHMA 2WSQA 4ML4A 2XH4A 3N2XA 3UZYA 2JWNA 1SYTA 1WKYA 1PEZA 3P0WA 1XR7A 4MJZA 2F9DA 2XS2A 4INFA 2IVMA 3NMAA 1E6YA 1JR1A 3VILA 4QJ4B 4DPWA 1F5BA 3E2RA 3PPCA 2W1BA 5FD0A 1WBJA 1NY1A 3AH6A 2CIPA 2Y1HA 5D38A 2CPFA 3MMCB 1NZ8A 2EFOA 5T26A 5LOQA 2YL6A 4S0MA 4C97A 3RBXA 4YXGA 3O6YX 1FK9B 4ED6A 4NZ1A 1XLFA 4GGHA 4HHLA 3IIVA 1M04A 5CJ5A 2KG1A 2FZGB 3CCES 4QROA 2IDEA 3FGVA 2M88A 3G82A 1E51A 1W3IA 3KTQA 3CL7A 4IH3A 1JK9B 2HZVA 5A6SA 3H5SA 3TWAA 3GONA 5KG4A 3S1XA 3U0HA 2NXUA 4B3TJ 3DFEA 1R7IA 3LYEA 3I32A 5D2WA 1JI2A 5L9FA 2D7SA 2OZ8A 1CQNA 3AOFA 2XN2A 3S2JA 4BHQA 3MWBA 2PWVA 3BW3A 4LSLA 1OFRA 4OZ5A 1U1KA 5D0EA 4JTDA 3R5BA 4M6VA 3BN4A 3ZS4A 6XIAA 2DNLA 4MKAA 2ZJQQ 3VM7A 5D3GB 4LBPA 5EYWA 3ZTRA 1N54B 2KXFA 5TQLA 4H2HA 3EGNA 3MM9A 4PBFA 4JL1A 1CGXA 4CNPA 1I2PA 1E6NA 3KOWA 3AHTA 3FA4A 4LRFA 3W5XA 3LHTA 3BOFA 5M1TA 5JQ9A 3H2LA 1TV6A 4P7NA 1JB0C 4OECA 3MI3A 3M32B 3RHGA 4UQAA 4IFRA 2PE4A 5G1YA 1T95A 1J0KA 2HIYA 1FWRA 1PZ1A 2VFHA 3GG0A 3SDOA 3BBFA 5IS2A 1U0HA 2ISSA 1OY6A 3PJ9A 3PJWA 3FFIA 3HQPA 2MZ1A 1J01A 4AT1B 1Y7VA 3TMLA 1LWIA 3EB2A 3PZUA 3CW2C 2GYIA 1KC7A 4ZJQA 1U30A 3I87A 1RD5A 1ZNNA 5KFQA 2BDQA 4FXJA 2X1FA 2C79A 4C6JA 4UXDA 1UAWA 2OWXA 3ALFA 1F05A 3WQOA 2I14A 4V27A 2NLYA 2I16A 4A8FA 3TWBA 3ITOA 1RT5A 4BEUA 3NO5A 1UP0A 2WCXA 3EVMA 2QUTA 4W89A 3MD3A 4DZDA 4MKVA 3HV8A 5G2IA 2QHAA 3AUOA 2FHMA 3MDUA 1LFWA 3RPDA 2WPGA 4YTRA 4MWAD 2CLKA 1HJWA 1UR8A 2HVOA 2VZUA 4MYAA 4BKNA 4Z42C 2B5JB 2FZ8A 2VYOA 4CNSA 3GNXA 3MS8A 5I77A 3P67A 1MNZA 1P27B 3GZ7A 3M8RA 4AVOA 3ETOA 3CCMS 1OM0A 2LLEA 3I0SA 1JNDA 3GFZA 5I02A 3GB0A 5C9UA 3GV7B 3LENA 1OZQA 4WZMA 1YBTA 2GUBA 4ZP8A 4OYWA 4Z1YA 5E6YA 1HNVA 5L8RC 3ZTSA 4DAIA 4ICLA 3R43A 4L6DA 1ENUA 2P9CA 4Q8TA 4DXKA 1VCFA 3VDBA 3T1AA 4XK2A 2V3DA 1U02A 3KLLA 3IJLA 2FYMA 2H3DA 1U7LA 3AI0A 5C9RA 2BB0A 3K1DA 1VRQC 4FYVB 4MVAA 2BRKA 3RCNA 4ZJOA 1NWUA 2WBRA 4CN1A 3TW7A 1AXQA 1ZYQA 3TKFA 4C48A 1KOOA 3QV8A 4O52A 1EUNA 3IJ7A 2GHPA 4OFCA 2ADCA 1E4LA 3URBA 4HLBA 2E5GA 4PG8A 4B15A 3DDMA 1REQA 2JVOA 1SJQA 5IM51 4ZO9A 4O1BA 3TW6A 2ZDRA 3W29A 3IO1A 2WCAA 1SO3A 5J04A 2HZGA 1KQYA 1J79A 1E6SM 3BSCA 2QPXA 3BZGA 1Z6KA 3UZWA 4JI0F 1D3HA 1BQNB 5LNSA 4ZPWR 1V3MA 3LP0A 3F5LA 1LOLA 3FNNA 3WBYA 3TUJC 4H9UA 4L1WA 4RU9A 3MUMP 4C6OA 1UD2A 3LM7A 1WCGA 1GXUA 4UMCA 1QWKA 1KR1A 2CJAA 4F0SA 4A3YA 3WDQA 1NFGA 2DJWA 2I9EA 3COTA 5A8GA 3MUZ1 3SB0A 4DAFA 3W1LA 1U22A 1B3ZA 3FIGA 1I3OB 3PG9A 3TN5A 3W70A 4DHGA 3HHLC 3PDNA 4GG9A 4I7UA 3D0GE 2XMWA 2NV2A 1VDHA 3NXLA 2E9ZA 4WYLA 2JLFA 2EEYA 5JH2A 3O15A 1GAOA 3PAJA 2H48B 3R97A 2ZXDA 1YXYA 4PCPA 3U2ZA 2DNPA 4X66J 1M65A 3SCUA 4BA0A 3D6TB 4A8MP 1VHNA 3L4TA 5IFMA 1WJ9A 1W1B1 4HU4A 3W1AA 4WIQA 5AE3A 4L5ZA 1N4LA 5B09A 2XGPA 4CNNA 3WEZA 1PGZA 3EWUA 3RNDA 4NRUA 4RR5A 2G96A 3QEZA 2ZH5A 5CBBA 3DM2A 4W5ZA 2HMIB 4HSOA 1G67A 4LVOP 1UROA 1VQLS 1SSGA 3TA0A 1ONEA 3VZYA 3EZOA 4OZ2A 4KPYA 4KJIA 3P14A 2BUNA 3WLIA 1RPXA 2KZZA 3AROA 1DJYA 5LMNJ 2JNJA 3A8KA 2WHLA 5I24A 3STFA 1TREA 4F0KA 3LX9A 3D2WA 2IAJA 1KR4A 4X66F 4LALA 3PRVA 2ZUSA 3I4EA 1PDZA 1GVIA 4JEJA 5LNUA 2MQNA 3IVTA 1PUDA 3PFOA 3UJ2A 3LHVA 2D3UA 1CDGA 5I00A 4N0RA 3EGVA 2GVJA 2VFFA 3ZZRA 3CAKA 4RUAA 4ZLJA 3CO9A 5D77A 3OZOA 4FXSA 1A47A 4I7VA 3LA4A 3GM8A 2HNYA 2XS7A 1B4SA 3UXKA 1NPKA 1D7KA 4CQ1A 3CO8A 3VKKA 3TN3A 3K5MA 3HGRA 5I3HA 4HDGA 2A4AA 1W54A 3MP5A 3UCQA 5KG2A 3DHFA 4ZBCA 4IG3A 3EDFA 1ME7A 2ZRZA 4BI6A 1JCYA 4IOAQ 2WQDA 3LM3A 2YNHB 4ER8A 4X22A 3JTPA 3O0FA 3MAQA 4DUVA 3I9V9 4O13A 3TC3A 4DR1J 3M0ZA 1EIXA 3DC8A 3IAM9 4IJBA 4ETZA 3ILOA 1TKXA 4X64F 3CF5Q 1IXPA 2VR4A 3DOMB 2WOQA 1YK9A 3MV01 2Y1RI 3Q89A 3OJSA 2A7NA 1XJBA 4A2RA 3SCWA 1YDYA 4IL0A 4A3HA 1C0TA 2RDTA 3VD9A 4IQMA 2HQFA 2Z6IA 2CZVC 4MWAE 3YPIA 4RXFA 1NIUA 3BLPX 4HHJA 2DSZA 3IGSA 2MLXA 2EC2A 3N11A 3EMTA 5EWFA 2QXWA 3EA2A 2FPTA 3M9NB 4F0LA 1V3HA 2HNZB 4W88A 4H8NA 2MY7A 4LSNA 3ECQA 3BO3A 3ZTPA 1RDRA 3KS5A 3ENWA 1VBHA 4UWMA 4DR1F 2J5AA 2HVHA 2C16A 1CJVB 3UVIA 1GQKA 3B8VA 1WF0A 1EZWA 4NRTA 2YQ0A 3ZNUA 4HTBA 1KA9F 3GBEA 4NMXA 4ZVTB 1JXLA 2GQAA 2QS8A 3KTCA 4FO4A 4NI2B 2EXOA 4KMQA 2FLPA 4K37A 4TTUA 4GZJA 3STEA 2E25A 4IZGA 4E2VA 5CG0A 1HKJA 2J9DE 4L3NA 2VEPA 1E9YB 6ALDA 3OFGA 3ME3A 3G0UA 1IR0A 2CWNA 1JZ6A 4Y6GA 3SUTA 5L1KA 1OX5A 2GDUA 1X7FA 3NR0A 3OJGA 4RKAA 1JVNA 4BS0A 3PFMA 5J5RA 1T9XA 1F6TA 1QI4A 3IXQA 2XSBA 2GFTA 2AT1B 2FLLA 4JTHA 4M5DB 5BYRA 2DT2A 2ZX8A 4ONVA 5CPQA 3I0RB 1YXCA 1M7OA 1AW2A 4JDBA 1SPQA 4PFMA 4F0HA 2KXNB 1S6QB 2C71A 4AF0A 1L0PA 4I7FB 3GAKA 5TIMA 2DORA 1RU2A 3SGUA 5C2CA 5MLCV 4MF4A 4AWSA 3TZXA 2ZM6F 4O4WA 4WTYA 4PQUA 4J9UE 1IQZA 2CBUA 4ACZA 2HWGA 4H9VA 3J7Z5 1NEEA 2BVDA 4JHOA 1XM3A 4P7VA 2VOPA 3L67A 2WMKA 3ARTA 4HNOA 2DGXA 4DSLA 3FNDA 1Z4UA 3WQVA 2JIEA 5ITHA 3WC2A 3NDZA 3BAIA 2DH7A 3KHGA 4X4VA 7XIMA 4JIEA 4DF1A 4BQ2A 3UCGA 4NF7A 3GP9A 1QATA 2R7TA 3LCLA 2NQ9A 1K8CA 4IO1A 1J2VA 4DG1B 1Q81T 3UR3C 3IWNC 3B4YA 1KM4A 4A8SA 1CS4A 2VGFA 1WDDA 4C8OA 5E3CA 3Q8PB 3OTOJ 3HO8A 3JS3A 3N18A 3NVDA 4DJED 2TODA 4UTHA 5HULA 3AT1B 4WU3A 4LU0A 2MKJA 1SJFA 3VUPA 4D8LA 3S1TA 3UZXA 4FXVA 5G4HC 2JH3A 4Z2IA 1M3UA 5E93A 3P3DA 1RU1A 3FJNA 4WOZA 1U5HA 4C6PA 2M70A 3F5KA 1S5MA 4E98A 2HNHA 2KDOA 3TSBA 2C2EA 4AXKA 1W3KA 4HHHA 4ZOSA 2WK2A 1SZFA 2W9BA 1KCXA 3LHUA 1AFSA 5K4XA 1LWHA 2J7DA 5F8GA 3ERPA 5DBUA 3EOSA 3G86A 3OTOF 3IR7B 1JLFB 1OYDA 1RT3B 3D6NA 2CEQA 1CIUA 3ARRA 5D2XA 3CL6A 2RIJA 3WH7A 4DL5A 2UVUA 3RLGA 1A5KC 3WK0A 2MYFA 2QULA 4IT1A 4JGDA 3BO2A 4PMRA 2G4FA 4QWBA 5KZEA 1RA6A 2DSWA 2H5IB 2PMZD 3AJXA 4HH0A 4YP3A 1AW0A 2WZEA 1V6HA 5FJUA 3UD3P 4IUOA 1QI3A 4ZPVR 4TY8A 4YL2A 2DZWA 4R53A 5AYXA 3T08A 2AL2A 3SDEB 3EX7B 3QC0A 1U47A 3BAJA 3PY8A 1XMQJ 1IEXA 3W7KA 2F8HA 3MCMA 3FEQA 3ID7A 3EKGA 1YNQA 3DU0A 3PO5A 4Q8EA 1TL1A 1M0SA 1DJIA 4NYUA 2R7VA 2ZZNA 1VYAA 2SXLA 2O7QA 4YNGA 3M46A 4KF1A 4GKJJ 3NXFA 3BSNA 1YBQB 1RT6B 5C42B 2OOFA 4G6CA 4J3UA 3ISZA 2C2ZB 2VVNA 3PPFA 2YCLA 4J90A 2QCLA 2VODA 4CQBA 5FAGA 4ITSA 1DY3A 1E72M 1QVBA 3UXLA 3WUBA 5HQMA 1WC5A 4C8KA 2PDBA 2E9BA 3OGSA 1ELOA 1UJQA 2N7YA 5AXKA 4ZLLA 1C29A 3W38A 5DMNA 4ZLNA 2GWGA 1FDZA 4I4BA 3SCLE 4YTQA 3O05A 1Z44A 5EMLA 1S3TC 2VKRA 4J9PA 5ETVA 3LBCA 3N12A 9XIMA 1RTDA 2PDHA 4LBRA 4PL1A 3AJ2A 3MPYA 1IHIA 1XD0A 3TROA 4GKJF 3TVKA 5M3WA 4LF2A 1SSDA 2GVZB 1KD1T 1WQ5A 2W25A 4MYXA 8TIMA 5DXXA 2ZZTA 1S59A 4PULA 3GYXB 5AZ1A 4ZPDA 3W22A 4C98A 3PULA 4TX6A 3FJ6A 3LALA 1XH2A 4W98A 3PXGa 3LPPA 1U2RA 2KFZA 1X6UA 1HR0J 3ENAA 4O3QA 3MO4A 4LAUA 4ZN1A 3WF4A 5A2QU 2A5HA 3WENA 5DEZA 2A0NA 1UA7A 3GXIA 2EVZA 3KCJA 2VFDA 2V5KA 1T9YA 3O6QA 3MUVP 3DI0A 4BJHA 5KG5A 3TC7A 3HGOA 5J1EB 1U2CA 1Q78A 2Z1VA 4YHEA 2OO0A 3W85A 1YPFA 1W1PA 4O14A 3VOCA 1FT8A 1WSRA 2B4OA 3BSAA 5DMYA 3FY1A 1UOZA 5KFSA 3J7AN 4NAFA 4JFSA 3S2CA 2IKIA 5FSDC 1TPUA 3K58A 3N2MA 3C0JA 5D37A 1Z2LA 4JZ5A 1DORA 3TZZA 4J9KA 1HR0F 2RJGA 3TLLA 3A4AA 4DZ5A 2WB1D 4N9BA 5DQHA 4C6IA 1CPZA 1REVA 1QPKA 3TA9A 4WRHA 3K1GA 4J7RA 2YX4A 3OP2A 2R2RA 3NQMA 4DBQA 4M63A 2C8NA 1E0WA 3N1AA 4WSHA 5AC4A 3P8IA 4ILRA 2ZC4A 1JXVA 2XVGA 1GKPA 1UG6A 1CXLA 5CLTA 1D2KA 3E6EA 2ZDSA 1UWTA 4XZLX 1UKOA 3M0IA 4UMAA 2Y1JA 3GDMA 1SKUB 3V4IB 1WO2A 1EX8A 1S5TA 3S9IA 3W73A 3RR7A 1D1UA 3NGKA 3EWYA 4MIWA 3J81U 1JMTA 3EDKA 4B2DD 3WF0A 1TMJA 2YKNA 3X3UA 5HMFA 2WKJA 1RT2B 2P5NA 1VQ9S 4NLRA 2R8KA 1K4HA 4OQVA 4M6QA 4I2PA 3WUEA 2VH7A 4Q6XA 2BDPA 1RQ0A 4DM2A 2G37A 5T14A 1CX9A 1VK3A 4CNZA 2A3LA 2VC7A 3GFHA 1H3DA 8A3HA 1OD0A 5KAKA 2XMJA 3SCQA 1HQUB 5G0RB 4B90A 1JPHA 1UKSA 3LG3A 3UVJA 3NGUA 2DO0A 2DGQA 3QN3A 3P45B 1CULB 4K7QA 1YQ2A 2RQCA 2QE5A 4DV5J 3BOLA 3MJMA 2WBGA 3M5XA 1VC6A 1FHLA 2DSKA 5FF7A 2XM3A 4CD7A 4XWUA 3CQHA 3WQDA 4M82A 3PHEA 3WLJA 3PW7A 2XI2A 2VD9A 4FVMA 1HF6A 2OELA 4OLOA 3HG4A 1EEXA 3MFIA 1ITQA 4LF6J 5BJRA 3GK0A 7ODCA 1VEOA 2O1PA 1XFBA 3G6ES 1ZM9A 4OJYA 4QCFA 1LW2B 3JB9k 3CZJA 4WXYA 5FL0A 5C25B 2J8SA 2FJUB 4UZCA 2FLIA 1JZ2A 3OLIA 1MWQA 5CQGA 1UR1A 4C0OC 3CASA 4HR2A 1RTIB 5A8OA 2MQLA 4BWLC 2VBYA 1M5WA 5AYZA 3IVUA 2LQJA 3LHYA 2QLXA 5FIIA 1RALA 3SV3A 4DV5F 3FOKA 3QF0A 1BHGA 4UQCA 4IP5A 3MECA 4GCAA 4C90A 2C7FA 1V4YA 2ZTKA 4E2DA 1NAQA 4OFZA 4X60A 3WQPA 2Q1LA 2DNNA 3QLHA 4FXWA 5CXTA 2E6AA 3B4UA 3UWTA 3F73A 3OBEA 3VIFA 2CPEA 4LF6F 3EX4A 4RDYA 1NH7A 5LA0A 2VV5A 4BHYA 1HD0A 1DL3A 3CD7A 3CM4A 5F1UA 3IFEA 3J7ZT 1XX1A 3HJEA 1O5JA 5I3JA 2I1RA 1W8SA 2TRSA 1IKVA 3C6UA 4RNNA 5CYMB 1A5SA 4DX3A 2FQIA 5A6AA 4KFBB 2AMXA 1BSLA 2I2YA 3VHQA 1VQ5S 3NO1A 2X1UA 5HP1A 4AEFA 1C1CA 5I3UB 4A6GA 2ZOMA 4I9JA 4F4XA 2RS2A 5A94A 4MFEA 2FGZA 5D8ZA 4WKHA 4FOUA 1Q1KA 2IQTA 1SJCA 4V1Ak 3CCRS 1R8BA 2GOUA 3T0BA 2RF2B 3SSJA 2DY3A 3M2RB 2WONA 5CAAA 1DIOA 1OGBA 3N25A 1DWFM 4X4RA 1U1QA 3S5SA 3C56A 3ABRA 3AHZA 3QH2A 3RTVA 3VKJA 4ERIA 3EWDA 4IIEA 2I5GA 3CC2S 5J2MB 4ZOCA 3W74A 2ZCGA 4YQWA 5IQQA 1CYGA 4NZ0A 3UF9A 2HGLA 3R6LB 3BL3A 3I10A 3S0CA 2A2CA 5C24A 4JCLA 1F76A 1VBRA 2ASYA 1PBGA 1SW7A 3IK2A 3P5ZA 4ROPA 4OHYA 2BE2A 1DQXA 3A47A 4WJXA 1TKKA 3J7YU 3C15B 3KBWA 3UBPC 4NLXA 2FDMA 4K39A 4PG7A 2NUYA 4KHPF 4DUWA 3FKBA 1WORA 2RDUA 4XBSA 3HIJA 1XUZA 3VKBA 2FPHX 1W0MA 2I5JB 4FVCA 4NPOA 1X6LA 4UR9A 2BZNA 3SN0A 4HNVA 4MTPA 4K4WA 2V2CA 1EYWA 2DV0A 3SFUA 4GFSA 1ZA1B 3T1HJ 3KOZA 1GVFA 1XIFA 4O10A 1AT1B 3VTIA 3VNIA 4IH5A 4C0HA 5CSUA 5CGMA 3KOYA 1FX2A 4P7QA 1R8LA 2G0IA 3MTWA 1VQOS 2YBUA 3QOKA 4AZ6A 5KMYA 5L39A 1MMDA 2JVRA 4DCOB 4HT3A 4R25A 1WDQA 1IEVA 3C16A 1SL1A 2G0JA 4NVTA 4AZIA 4DUXA 1RAFB 4P5UA 1XGEA 1HKWA 2AP6A 7PTDA 4MM1A 2IRUA 4QW8A 4RDZA 3EE3A 4KO0A 3OW1A 2G2ZA 3U4FA 4UNKA 2IBOA 3DCAA 4UQEA 1X4GA 2HXTA 3P60A 4Q8MA 5CAKA 3KLEA 3TTEA 3PZVA 4QR6A 4REQB 3VIJA 4TVAB 3NEVA 4GABA 4OWGA 3HG5A 1RHMB 4FYYB 4I0WA 3B78A 3MUXA 1KFDA 1YDVA 4L1GA 1W5OA 3NWRA 1E9LA 3LZ3A 4US5D 3MEDB 4ZB0A 2BY2A 1GVYA 1RAGB 5IQ6A 1DWHM 1HX0A 5CXPA 2VJXA 2HBZB 1XR2A 5F0WA 3R5EA 5HANA 5FF0A 1OHLA 2YWWA 1NJZA 4C1LA 5AYYA 2GGPB 1IYXA 4BBYA 1M5HA 3UN2A 4JV5J 4ZQRA 1BKSA 3W63A 1CJKB 4M5IA 1SV5B 1XMOJ 2GWNA 4MNLA 3MAAA 3NSXA 4HMNA 4U67Q 3KXQA 4EK2A 1VEPA 2OQLA 1EC7A 1UVJA 2NSXA 3IJ6A 2ESCA 1XICA 1DJGA 3HMJG 3WSUA 3PPGA 2DZPA 3LQGA 2D0GA 3UWWA 4PZVA 4DWSC 4DZIA 1RT1A 5IOBA 1KB3A 1SFJA 4DFPA 3K46A 2BV3A 5THWA 1EP2A 2D3O1 3MVIA 3BPSP 3D9BA 1K47A 4DSKA 3FAXA 1CB7B 5D05A 3TJIA 3C66A 1WX0A 3NNTA 5JVHQ 2L9WA 3SCTA 2OG9A 1PHQA 5I23A 2MGZB 2GGIA 3ANYA 1Q16B 3LGMA 3RO6A 3QMTA 3AIBA 1QTNB 5JBEA 3NL2A 4D8ZA 3RU0A 3DRRA 3BC9A 3VCNA 5GPRA 4ZPAA 3PJUA 3NL6A 2PDQA 4IPIA 3WFAA 1TK0A 3NS7B 4KESA 1Z9AA 2DQWA 5AHFA 4DV4J 1R0CB 4AX7A 4L9ZA 4QDWA 2FZMA 4ECYA 1E6VA 2OGYA 3CZ8A 2BHYA 3ZZZA 1S12A 3NOEA 1U83A 3HQ1A 3PUEA 2PGWA 2G3IA 4NWBA 1BXBA 3OA3A 4NZJA 1MLAA 3G6MA 3WLRA 4YFUA 1VR6A 4PQUB 3TTSA 1S0VA 2V6AA 1OO0B 2PLJA 2BP1A 4B3SJ 2IKHA 1MZHA 1F0XA 1EP3A 3C14B 1XLJA 4H7ZA 1O5KA 4QLKA 2W67A 4YLWA 1DEDA 1FTCA 2PFDA 3WC0A 3F2BA 3ZWSA 3K4DA 4L73A 1XH0A 4RL1A 3V5FA 2PRHA 1PCKA 3K2YA 4F25A 4WFZA 5LNRA 2RJZA 2KO1A 1MZRA 1Z2ZA 3HHDA 4WDUA 1PBAA 2F9RA 1S1VB 1ZY9A 3EOOA 2OPSA 4BCEA 3P5TL 3NL5A 2W7PA 1HKKA 3KLGA 2QPSA 3HHNB 3MOJB 3JSBA 2ZFHA 1A0EA 4B91A 4Z1CA 1O4UA 4UOQA 1F1BB 2Z2BA 2X1AA 4C6LA 4B3SF 3EDDA 3KMQA 1N8WA 2HRYA 2ACRA 4FP1A 2LEPA 2RKIA 2PDPA 3GXDA 4EWND 3AA8A 3H5UA 2DT0A 2LVWA 1SR0A 4K5SA 3U1NA 4TV6A 4JQ2A 2VFEA 2AQ4A 4N8NA 5LIXX 1HARA 5BZAA 3H26A 2GS8A 5FLXY 1G0CA 1QLNA 1PZ0A 2HV5A 3PZTA 2CQ3A 1RSCA 3LCFA 2JOQA 4YN5A 3TJ8A 2C2NA 2D24A 2DXEA 3QM3A 3DLBA 1SC1B 2WCGA 4PCTA 4KPCA 4CYUA 2DY9A 1GGOA 3M5YA 4HH1A 1R6VA 3H55A 4AIBA 1JAEA 2ALRA 3T09A 1Z7AA 2A2IA 3WK2A 1BAGA 1QJWA 4MDOA 1EL3A 5KFKA 5FJJA 2AYMA 4CLTA 1L3VA 3OLEA 2W9CB 5REQB 1X0FA 2OEJA 2AIRB 1IBKJ 4PMNA 3BLDA 4WF9Q 4FF4A 4ZP6A 2Y8WA 5KFFA 4DL7A 4JOUA 2KM8B 1HTIA 3S46A 1Q3NA 1LWFB 1LLOA 2J25A 4MFDA 1FKPB 1TPEA 1R3RA 3OLGA 4C6AA 4ZMGA 3G9CA 2XH7A 1Q6DA 3BLEA 2D74B 1O1HA 3U02A 3DYAA 4DM1A 2VUYA 1OY9A 3CNYA 4XQ6A 4JTSA 2RSQA 2WMIA 4Q4MA 5KFXA 5DXYA 4FNPA 4PRWA 1SUQB 1WZKA 1DJ0A 3LQLA 1F5AA 5HVHA 1IBKF 1PIFA 1N88A 1GQLA 3MEEA 1E0XA 2QMJA 3LCIA 3TEVA 4AD1A 2E7XA 5AKQA 3AMGA 4NZCA 2XMTA 4P8XA 3NBPB 5AXMA 1HNWJ 1OS5A 3QAUA 4X0VA 1KLYA 1RAAB 1KOHA 1VCTA 3ICLA 1NCLA 1H5YA 4UC5A 1FDDA 1L3SA 2UUCJ 3B82A 5SWUA 1JGIA 2PFFB 2FJKA 3E49A 3VGDA 1GVOA 2QAFA 4ZP7A 2AEFA 2ACMA 2PD5A 2YWGA 3SCOA 3BVJA 1IEIA 2GW8A 2O66A 1F2JA 2NSCA 1PYMA 3FRZA 5LJ3Y 4IH6A 3QJJA 4DPYA 4E0CA 2C22A 2ZA1A 4MIBA 1TAQA 2VTFA 4OYBA 5CD4H 1OZMA 3BH4A 4PBGA 2I8EA 3BPDA 1PO6A 3WJSA 4CLMA 3SCIE 3L3CA 2E7FA 3V4BA 1IEQA 1H0HB 2ATCB 3IR6B 1LG1A 3TYTA 1FUYA 2UUCF 4LFCJ 4Z2KA 4YTSA 4KRZA 2I9UA 2XCPA 1KXVA 2R7XA 1TR9A 3G1FA 4NEZA 2E1MC 3APTA 4IDKB 4FYWB 1BVWA 2GVYA 1XGDA 3OZMA 2V4JA 3I9ZA 1U1PA 3MBDA 4UQBA 3GIIA 4I7WA 4IR1A 4GXPA 4NKCA 3DEQA 3AWOA 2VPXB 3WQ8A 3QIPB 1RABB 5KT2A 2CPXA 2F2HA 1SB6A 4F36A 4QU6A 2BJ7A 1OX4B 2ZHOA 4RW7A 5HA7A 5DCEA 3LEPA 2BXZA 3GJSB 4CT9A 5ADZA 1CTNA 1PYOB 4K4XA 1HJSA 1S1WB 4ZOBA 4GJ1A 1VISA 5I3PA 3AICA 2XISA 4LFCF 3QV6A 4LMZA 4I9AA 3KXDA 2WM0A 3IWLA 2HURA 2K1RB 2M8DB 1C8YA 4NRRA 2KFNA 1EYEA 5CKSA 2DNHA 4HK6A 1XSJA 2DRAA 1SH2A 4XIMA 3DI6A 3UR2A 3OTRA 4JTKA 1N0UA 2ZWOA 5HDRA 3G22A 4HMCA 1O60A 3BS9A 1JCNA 1G6CA 4OZOA 2E28A 1MSSA 1OYCA 1JZ5A 4Q3MA 3WH9A 5CZTA 3EMZA 3BCDA 1R38A 4UNIA 4NILA 1OFDA 3WEOA 5I3FA 2M0GB 3C2OA 2ZX6A 3BGRA 4BC7A 1JDAA 4EANA 1YPXA 4Y7EA 2AJQA 3AYTA 3O44A 2CCRA 3G8SA 3DENA 3TMQA 2F3JA 1RVGA 1LWEA 3FCVA 1FWWA 3TQ1A 1YX1A 2WSYA 4MUPA 1FWIC 4KR0B 3ABXA 2G8ZA 1XV8A 2MZQA 4EYHB 3GDLA 4J40A 5LXRA 4JKLA 2ZH6A 1TV2A 1BXNA 2B43A 3EZUA 1WDWA 4EMDA 1HBNB 3NNCA 1AL8A 4E6MA 1FWJC 4W8BA 1FXRA 2BW7A 2BASA 4IX2A 1A5BA 2J7UA 1U8SA 3S42A 4F4AA 3TDFA 1XLDA 4E5TA 1HO4A 2RDJA 1N33J 3U4AA 3M2UB 3H2EA 5DGAA 5HJYA 5T7LA 4EZ6A 1VFFA 3TV8A 5A95A 2VL1A 4QLLA 3LP2A 2YXLA 1BYCA 1ZM3A 3ZSSA 3V0SA 3L7RA 3MFHA 2FD2A 1XS2A 2I7GA 3N79A 1XW8A 2BBFA 4GX8A 1JLBB 5I3QA 1TCMA 2VDHA 3UQNA 3G1AA 1KM2A 3ETMA 4IJRA 3TUPA 1PSCA 3GE9A 3QLHB 4JTFA 5HROA 3NNAA 1JFHA 4AD4A 2F65A 4DI9A 1U25A 3VAKA 2J9YA 1L6SA 3B0YA 5LA2A 2R3VA 2J6XA 2Y5SA 2MKHA 4PABA 4TYBA 5BXPA 3VGSA 2Y70A 3CPGA 2JEPA 3UNYA 4Y2WA 3ITYA 2CUYA 3UN5A 1A0DA 1U1OA 1RWKB 3SEOA 2ZUUA 1EUAA 2H6RA 2A79A 2VDIA 4D6FA 1ZAWA 3APYA 1UFLA 1VI7A 2ZUGA 4KGZB 2XGZA 3M5ZA 1EGVA 2GHWA 2X1IA 4ES2A 1TL3B 3OUYB 2QCDB 2O9TA 1G4SA 4ZO8A 3BEGB 2J9CA 4DSIA 1PAMA 5FIPA 4NXNJ 3ZTOA 3W76A 2UUAJ 2ZA3A 3DFQA 4GQRA 1R8AA 4WZHA 3VNJA 1TQLA 4O44B 1TVRB 2QEXS 1B3YA 4IIDA 1XIIA 1B90A 4HU0A 5T9CE 4FKXA 2WV8A 1EOMA 3RB3A 2FB3A 2WONB 1TJ0A 2NUHA 3DFTA 3N9SA 2DH9A 1NDYA 2J9XA 2XZ9A 2ZOGA 4UOFA 3HULA 4B3LA 1X9WA 3FS2A 3MI2A 4QS5A 3ZIZA 2HZCA 2IMOA 1TMQA 5T8GA 1XQKA 5D33A 3LGDA 4ATLA 2WZ1A 2J4GA 2RHQB 1FVPA 3OW2R 1XLIA 3UPFA 2QLBB 3W2WA 2VG5B 5C55A 1UA1A 1V79A 2XYGB 3DU5A 1T8XA 3DOKB 3GYNA 2OPPA 1O7AA 1WC4A 3IWPA 4NXNF 1UP3A 5BYQA 3UXIA 2UUAF 5DO2A 2E7WA 3E38A 1W9XA 3MAHA 2P10A 4S39A 3W2JA 1CPUA 1T0OA 2Q09A 3K7RA 1HG3A 3UD5A 2HHXA 3PBYA 4ZVGA 1BG4A 2G4JA 2IVFB 5HLFB 2W79A 2Z27A 5HR6A 1SQEA 1DJWA 3RRKA 2DGSA 2AHOB 1KBLA 2F7FA 1FJ7A 1T96A 3KRBA 3LSBA 3HPFA 3KBVA 4ICNA 5LGXA 3EZ5A 3R2GA 2MSTA 3A4XA 4W5UA 1LOQA 1IUJA 3CE8A 4CU6A 3W1NA 3KCOA 1XSIA 3SYZA 1W32A 3P84A 3L7PA 4CZCA 1NK7A 5MHBA 2H4WB 3QWUA 2OPJA 1HP5A 3R0KA 1S2WA 4FX6M 1PB0A 1XP3A 4NL1A 5H91A 3CWNA 1KLMB 2PEHA 4NX5A 5IC6B 3C2FA 5BNKA 1F7BA 1T9WA 4YHGA 4HB7A 2HK2A 2YYTA 2GJXA 1U5JA 1XDMA 5EMYA 3QY6A 3EOEA 2VXNA 1QDSA 1W9VA 3CH0A 3FHQA 4KIEA 4MAZA 4GWEA 5M03A 3PBGA 3Q22A 4XVEA 2YIHA 3VKDA 4ED3A 3CD6S 1KGWA 3B6BA 4PMXA 2ZRVA 2F2KA 4UOHA 1GH8A 5DQPA 2GC8A 4TY9A 2QT7A 2HBXA 4UFMA 9RUBA 2I17A 3KVJA 4R3UA 1WOSA 2XTKA 5HXMA 2LEAA 4JX6A 3WD1A 5K9DA 1PJ5A 3PBMA 3UJSA 1RWMB 4RNFA 1E6ZA 1H7PA 1DIDA 3CUZA 2OPQA 3VGVA 2HNEA 1XISA 2KXHA 1J6PA 4EYIB 3T4WA 1WXYA 4PTNA 3VIPA 3W2MA 2XIQA 1WKDA 3REQB 5CZKA 5E0CA 3T5KA 3TR5A 4PXBA 4L65A 1ISZA 3E1F1 1H73A 2OLWA 4UTJA 3OPSA 5EL1A 4FLSA 5B0GA 4ZJLA 3GTFA 4H01A 2BEFA 1E40A 1FWNA 4E8CA 1YMYA 1V7YA 4IXXA 4PAAA 5B0CA 2XO7A 2RDIA 3UJRA 1Y9OA 2GV1A 4DV6J 2GDQA 2V8HA 3ZZYA 1GMUA 2CLLA 2OODA 1I75A 4FNHA 1XPYA 4O54A 4DMZA 2ZOXA 3M8PB 4AMCA 2QCGA 1OYEA 2IW0A 2DCUB 3OVAA 1F4HA 1TJPA 3AS2A 1KRAC 1WHXA 3G87A 2W6RA 3GR4A 3RYSA 1ZZNA 4H04A 4Q8PA 3A9IA 5H8MA 2G2YA 3C52A 3S6DA 1BG9A 3MYOA 1ZSXA 4L6V3 2YTCA 2WNWA 4L4OA 5G1TA 4CTAB 1YJVA 5J2QA 4B9UA 4HTJA 3MT1A 7REQA 3FCWA 3MZNA 4F4ZA 4NZ3A 3ISNC 1B0VA 1IBMF 4KETA 2TPSA 5LKYA 4EF8A 2FGCA 3WG6A 5CZVA 3HTWA 3L23A 1F07A 3KBSA 1E6VB 2L9DA 5HOSA 4GX9A 4URSA 4MIMA 1ZZFA 4OJGA 4LCSA 3N19B 1NQ6A 1H11A 1LYXA 4HK5A 3GIKA 3ZT5A 4DBWA 1XKYA 3MPDA 3H4XA 3KCLA 1RK6A 2X2YA 1RHKB 1XN9A 2Q66A 3FQKA 3GXPA 4WKRA 3STCA 4JFTA 3KLFA 3L0KA 4WK9A 2OLSA 4CEXC 4O19A 3GH7A 4JXCA 4ZITA 1LRNA 1P7TA 1GNXA 1P5BA 1OF8A 1QW8A 1SO5A 2JKPA 3PP7A 4CH0S 3PTKA 2M2BA 1TV7A 3WDPP 2A6MA 1MFUA 5DRCA 1NDKA 4XIAA 5CJMA 1OWQA 5JIPA 4YWSA 4RCXA 2JEIA 4KPLA 5JUVA 4DU8A 1RP9A 1O68A 3PX6A 4U10A 2GGHA 5F8NA 1JZ4A 4DF4A 1ZUAX 4AL7A 1Q8KA 4TIMA 4LF7J 4I5XA 4Z17A 4DXXA 2FC8A 2RFGA 1U1JA 1S72S 5K9CA 1X8DA 1VLIA 1P0BA 4B5UA 1WAWA 3XINA 4QISA 2VC9A 4ZE4A 1RHQB 2RUSA 2UXCJ 3S5ZA 3O1NA 2OO4A 4OJ1A 2LXIA 3OTBA 5CPNA 2QVNA 4O3PA 2PC8A 4MPKA 1ACMB 4UZUA 3R2DJ 2CNLB 2BJ1A 4LUYA 2CRLA 1JKHA 1NRKA 3ABZA 3G6VA 1JG9A 4WCEQ 2BMBA 4GMEA 3GR8A 4JN7A 2PBGA 2AJ1A 3HHLA 1OSEA 1UASA 3ZFVA 5LIKX 2IUZA 3V7PA 3EEGA 2ZD1A 1YJNS 2BOGX 3MM7B 4ECZA 4ZQOA 2FZDA 1L6FA 2OP5A 5B0BA 2Y63A 4RNHA 3MVTA 4LAKA 3OT9A 3J7HA 1FHVA 4JN8A 2FHOB 2RDXA 3WH5A 2UXCF 4GYFA 5IBXC 3NOGA 5TBOA 2HFSA 5ENLA 2V2DA 2DTJA 4JD4A 1VQ8S 4LR7A 3C5QA 3TQKA 5KTLA 2HVZA 3POTA 2P88A 3FJ2A 1XWLA 3ZZ1A 4KW2A 5LXXA 1XWYA 1JLGA 1YRRA 2PWEA 3VD7A 1DTNA 2Y3YA 2HQAA 3H7VA 4QIUA 1S1UA 4J9RA 2MJUA 1DXIA 3WLOA 2QKFA 1LOSA 4AD0A 3OHAA 1SJ4P 2Y8YA 1YXDA 5EMKA 3PB2A 4OZJA 2JFDA 3M30B 5HQEA 4F66A 4ZR8A 5D6GA 1Q6QA 4EAMA 2AMGA 2QA4S 2BSLA 1UYQA 2Z2UA 3BOXA 2HQGA 2DT9A 5CYQA 4NCGA 2CJBA 1ZJHA 4R8UB 4R9OA 1QRQA 1EJXC 2VEIA 5BXRA 1MG7A 3PUOA 4Q2LA 4LANA 1H41A 4Z2LA 5CAHA 2YXOA 2YX7A 3ELHA 3R5GA 2UV8A 2P8CA 3L4UA 1ZAVA 1MO0A 1E6QM 3GTXA 3CZKA 5D04C 4I9TA 3EX2A 2QYCA 3G8QA 1E6PA 1P6BA 3LV5A 3G1HA 3ELFA 3LDVA 3B9DA 4HOWA 5D0HA 2HNDA 1PCWA 2DGAA 3SQLA 1C91A 2FMNA 2PGCA 3GCXP 5CZ0A 4L7ZA 2O9RA 3QPIA 3LUTA 5LHFA 3HPXA 1RHJB 3S2NA 2N4DA 1U2FA 3FC9A 3OYZA 1QNQA 1UD8A 3RPTA 3APGA 2A3EA 4KT2A 1R3VA 3K8KA 2W2PP 1Y0HA 4NLVA 3PV8A 2E9MA 3M8QB 3KWSA 2VBWA 4IUFA 4F9JA 2CZVA 1H0IA 2DP3A 4UMBA 4LJ3A 1E4IA 3FUYA 3K5PA 2Y8UA 2QJHA 1H63A 5D09A 3CQKA 4GIYA 3UU0A 1K9EA 4CO2A 1U1UA 3QHNA 4AG0A 2PDAA 1M5VC 2GVDA 2DXFA 1H2JA 4PRRA 2NXEA 4ELVA 2XI3A 3PUGA 3O3RA 1KONA 3C6TB 3KVMA 3WQCA 4DR2F 2WTFA 4JYEA 2YNGA 2ZRUA 3MKCA 1RA7A 4JPGA 4TO8A 4P7TA 1U0SA 2GJNA 1X0PA 3M0MA 5JUMA 1JLQB 3B9EA 4MMWA 1VK8A 1UL3A 1EC8A 1FJCA 1UH3A 1WKFA 2E5BA 3LGNA 3AHVA 4EP8C 3A13A 1TKZB 4RW4A 3GVVA 5F0UA 3VMPA 1VRDA 3H90A 3NGSA 2QCCA 1SJBA 1W6TA 5A8QA 4OYXA 1G7VA 4IMAA 2H90A 4S3JA 5JU6A 3GNPA 4OYAA 7TAAA 1FXLA 2FTYA 2Z1SA 2KJWA 4PMZA 4OGZA 1G4TA 4DS4A 4XSMA 3QBUA 2MQOA 3A3OB 2HS0A 4KEMA 2PDGA 2XZDB 3N9KA 1RAJA 4MPQA 4K2XA 2ICSA 4I2QB 2OD6A 4AE5A 5FDLA 3UA4A 3U5UA 4ZPTR 3S5NA 3QXBA 3KAOA 2OEMA 5K3VA 2DH3A 2DJLA 5A6PA 3WQGA 4P73A 1M68A 2HHVA 2NPFA 4WP9A 1TTPA 1XRSA 1AQMA 3W65A 2CQGA 5D15A 3N15A 1VC5A 4L4PA 1QUPA 4QSFA 3TO8A 2ZH1A 3WDJA 4DCJB 3W7HA 1Q0NA 1A80A 4WK3A 4A48A 4UOCA 2XC9A 2XZTB 1SH0A 1WD6A 1K9MT 4GZEA 5K14B 2ZZ6A 4MFBB 4NLOA 4XDCA 5KFAA 2F6XA 4I90A 3N5FA 2Z25A 4WIIA 3B8DA 3BQ5A 1W1TA 3CUGA 4IJCA 5JMUA 4ECWA 2FDNA 4M7TA 1FNMA 1HKMA 3ZZOA 2AGKA 1C92A 3BGJA 2QMXA 4QZVB 3DNCA 4NA1A 2DB1A 4NLUA 5BXIA 4ZOAA 1PKYA 4NYPA 2ZBCA 3UG5A 1AB8A 4DPTA 1V5XA 4AVNA 1FA0A 1TUGB 4NZ7A 2F8MA 1U33A 3CGIA 1E1CB 1UZ1A 4PG5A 3U1LA 2B7NA 5TNVA 3M44A 4C6EA 2UXDF 1KBBA 2PFHA 3FGCA 2C13A 4DVOA 4K4SA 2OAUA 3UDLA 1TJ2A 3VR1A 2VCBA 4XKMA 1GX6A 3QZAA 1NB2A 2WHKA 5KFDA 1N7KA 2H9AA 4XAZA 4MJ4A 4J91A 2EPKX 2X0YA 1XLKA 1HJUA 3WELA 2C3ZA 1ITUA 1RYSA 3NPWA 1NO8A 4N7QA 2QJ3A 1QPRA 1TWIA 1X31C 2CW6A 4UT4A 1HNIA 4QQUA 4G2DA 3KDOA 4X4TA 1UKPA 3IPWA 2ZNYA 1IWAA 4HDHA 3IWXA 3A6OA 2POKA 4GFIA 3QSTA 1XLBA 3RM9A 2PDXA 1I94J 3QO9A 2VQFJ 3S1VA 2BANB 2V8VA 4EWTA 4M29A 4B9ZA 4UUWA 1IE7C 4ROQA 3CJKA 3ILJA 3HP6A 1NLKL 3W1QA 3K89A 3ITHA 2C0AA 3IG1A 3G6XA 1YITS 2ZVSA 3RB6A 1TV8A 2QJIA 4O8AA 3PS7A 3IGUA 1TFWA 1FDBA 2UY5A 2PMHA 4HVXA 1EJVC 1GVSA 1A9NB 4ZSTA 1FKOA 1YNPA 3PWGA 3R6IA 5M2FX 5KFHA 1I94F 3IANA 3ZO9A 3GMGA 4ANEA 2K3KA 4DO6A 3E8OA 1G94A 4YB5A 8ATCB 4Y9AA 4C8ZA 1C0UA 4A46A 3R0DA 4W8AA 2WW5A 1IQTA 3G2XA 5LNWA 3V5OA 5D0RA 2EFQA 2QC3A 4JL2A 5FI8A 2PCEA 1C1BB 1S5WA 3UERA 2R14A 2EPNA 4PFHA 3VM5A 4JTCA 1NTHA 1X8CA 2OUGA 2RH9A 4OYOA 1WKKA 2E1RA 4ZDNA 2WYSA 1FP9A 3A22A 4IGNA 5D30A 3GR0A 3BCFA 4TUFA 1B9ZA 4LUTA 1N5SA 3OTCA 4DUTA 2VJUA 2IJFA 2HHHJ 1XJWB 2YFNA 4EVZA 3CTLA 4DV0J 2OQHA 1NDLA 3CAWA 3OOQA 5B7WA 3H21A 1WB0A 1REGX 2H5JB 4ANCA 4H4OB 3SSRA 1RD6A 2NXHA 3PR2A 4KCTA 2CERA 3WL1A 4WY0A 3HG2A 4XTTA 4U9RA 4GNKB 2PEBA 3PYFA 5ETNA 3BZJA 1IKYA 4C65A 2BVWA 1KRBC 2DUXA 1VRTB 3H2UB 4DL0C 3ZVHA 2NXIA 4GVGA 4HACB 4JTIA 3F5JA 4DYKA 1QNVA 4X62J 2XY6A 4TMCA 2HFVA 1SL2A 4NI8A 3D68A 2AMCB 4DLFA 2GIFA 2HHHF 4HA4A 1S2UA 2A0FB 4LRTA 1Q2RA 1FOBA 4DV0F 3LBOA 4TLRA 1D8YA 1E4MM 3M0XA 1Q53A 1P0NA 1XYCA 1VIOA 1I60A 1FRKA 3O2LA 1ZBTA 1XCWA 5A6KA 5E2QA 2UY4A 3GVWA 4M81A 5MAOA 3QT5A 3GKAA 3TA6A 3W02A 2N4CA 2X05A 4RW6A 2J78A 3OGRA 4LUJA 5HQLA 1OQ3A 3C0SA 2E6YA 3MM8A 2B7CB 1MU2A 5IT0A 1CCWB 4X62F 4JI6J 3G4SS 1M5PC 4G8TA 2NW0A 1TO3A 1G3OA 3B05A 3TVYA 2B8QA 1YJ7A 3SR7A 6REQB 1NFPA 1R3SA 3C6CA 3WUGA 4NLWA 1OYAA 4Y2IA 4C91A 2OFJA 4FNTA 2QDEA 3L4WA 4DSEA 2EG7A 3HO1A 4RWXA 1DRZA 4J2MA 2XYLA 3CQJA 1CB2A 4HMDA 2WJDA 1QI5A 3CV1A 4Y00A 1CGVA 1TUWA 3ANVA 1MXDA 2J6UA 3AXXA 2QUMA 1TZ7A 2QZRA 1EGMA 2NXJA 4OI6A 2CESA 5CPSA 4AX6A 4MYTA 4XG1A 3TAQA 4N9EA 4GZ7A 3VX0A 4Y28C 4GRSA 4FPRA 2G2OA 4DN1A 1LXNA 4OJHA 4FAMA 1O6XA 3WLQA 1OK6A 3BGFA 4ED1A 1BRLA 1J2BA 2BV9A 1JXJA 3FQLA 1I5OB 3FSYA 2F1FA 2OFHX 1L6WA 1B30A 1PV8A 2QCNA 3UDEA 2JK2A 4GUFA 5LHEA 3LPOA 2EK1A 3SCSA 2A3CA 4NXKA 4BWLA 1RY8A 4KIAA 1AROP 4KWVA 4Q8WA 4OE7A 2WJZA 4J5NA 2C3YA 1BXCA 1H3GA 4EACA 4UTMA 4ES1A 3BJSA 1VFTA 2VFGA 1IZJA 2DEPA 1NK5A 2J7GA 1PS9A 5GMKa 1TE6A 2IVYA 3IIXA 3VNDA 2GK1B 3EX1A 5H9EJ 2E1PA 1QNPA 3C3UA 2HHSA 2DZTA 4QR2A 3BDEA 2HBVA 1DXFA 3RW6A 5CG7A 2W7OA 4Z2XA 5D9PA 4X3ZA 3HF5A 3G8RA 2RGLA 1N32F 1GYMA 3MO7A 4MJKA 1KQZA 1HA1A 2W4CA 4RE0A 1EGZA 4ZVRB 5BYSA 3FSTA 3O6CA 1AMKA 4N42A 2GFFA 3AZTA 4WJEA 1IZKA 1E0UA 1NWRA 2KX9A 3BREA 4EAYA 5J2PB 1MROB 3KL5A 3GR7A 1RH9A 3D3FA 1KCLA 4QWDA 3V6DB 1H60A 3D28A 1F6YA 4Q8VA 1KHVA 2A6NA 1SMDA 3MM6B 4H6RA 1QOXA 2GJIA 3LPEA 4X9YA 2HSAA 3R79A 1AVAA 3VIHA 1EO7A 2VA3A 1R8PA 5DDPC 3Q23A 4X65J 3MEKA 1BQCA 3GC2A 2LMIA 3KEHA 2AU0A 1RT4A 1BF6A 2CPUA 3GU1A 2U2FA 4CD5A 1DQ9A 1ZP3A 1S1TA 4ZIVA 5XINA 2W9MA 1FRIA 1NK6A 3BLOA 2BXVA 3MHYA 2V9WA 2MKKA 3CAVA 3OVRA 1FY6A 3S83A 1FQ0A 1QASA 3QYSA 1GWJA 4JX5A 2Y7EA 1E55A 1SJ3P 4JTQA 2G3MA 2PA8D 1EIBA 3VDCA 2V5DA 1MYRA 2Q8XA 3IRXB 3K59A 4E38A 5EMUA 3N73A 4PXEA 1I8JA 4CCCA 3TANA 4X65F 4NXSA 4KH0B 2R8WA 3CD5A 4RU2A 3MPGA 4Q5VA 2RRBA 3CEUA 4GMKA 2Z7KA 3WH8A 5HJLA 3E9AA 1PSDA 1HBOB 1S6PB 1J5SA 2XBPA 3LNMA 4MK7A 2CJKA 1D9DA 3N13A 1FEHA 3H25A 4M5LA 1I2RA 1JRBA 4QAWA 4B3ZA 1BQXA 2H4YB 1C8VA 3QR0A 1LFPA 2JC1A 1SUXA 3M8WA 1IKWB 4O3RA 5FACA 3MMBA 1FWGC 1A6LA 5K8PA 2WANA 1PE1A 1HKVA 1FFQA 3GS6A 3RDKA 3BO4A 5SUHA 3DLGB 1X1OA 2IDLA 1G5AA 1RP8A 1FP8A 1R3TA 4OL8A 1E6XM 1AQHA 1BVZA 4O28A 4V28A 2XO6A 2HLUA 8XIMA 3GO2A 3OG2A 3WK3A 4OI0A 2XNRA 2Q3PA 2MEWA 2WZTA 2HZAA 1VRXA 4O18A 2YXGA 4HA3A 3WJWA 4UUIA 2GQQA 3ABOA 4NLQA 1ZBCA 2JEQA 3JTNA 2VUNA 2YNIB 1BGXT 1E6RA 1GKRA 1I2QA 1UIOA 3TOPA 3J80Y 3OQ2A 3FEXB 4JI8J 3RAXA 4TU8A 2VP8A 1F4AA 1XYLA 5E70A 3D47A 3HKZD 1EHNA 4ANDA 1XINA 3W7JA 4A22A 3KJQB 2XLKA 1CW2A 1QTWA 2HMCA 1TFYA 1ZTWA 1W1ZA 3VYLA 3KG4A 2O7SA 3AODA 1SMAA 4DXVA 5FF3A 5G4EA 1DLOA 4M1BA 3BV4A 1N6QB 1DP0A 2AJ0A 1W3HA 4USJC 2YCEA 4CD4A 1LRQA 2CNOB 1Z32X 4HNLA 1P6TA 4BS2A 3CTRA 3Q94A 3WFZA 1VQKS 2XSFA 1S1PA 1O0PA 4ORMA 2VB6A 3NZGA 2HQIA 1J4EA 3O0KA 2ZUWA 3VI2A 5HI7A 4JI8F 5A8RA 1FTXA 1J0JA 2UZAA 4QJ3B 4DV2F 1XUUA 1GEQA 1YTEA 1W3JA 1K8XA 2JE8A 3CWOX 2V5LA 3QGVA 1X5PA 4PSPA 4O11A 1E56A 4MG4A 3KJFB 4IPNB 1TVNA 4TU7A 2Q71A 3G6LA 2VZ9A 1R8CA 3IGXA 1EAYC 1HNXJ 2MHEA 1RK8A 1H5VA 3I7SA 2G0CA 4P72A 3M47A 3EGZA 3CPRA 1RWVB 1VGYA 5D0GA 3IBCB 5HMYA 1BWLA 2QZ8A 1UVNA 3NQAA 4K50A 4DF0A 1RV8A 3N17A 3UZJA 1B0IA 1JCXA 2BBEA 2ZDOA 2WWDA 1TWWA 1ME8A 2R94A 1XK8A 2R1NA 2DNMA 4K8EA 4WTOB 4JNZA 1RT7B 3N6NA 2DUZA 1KFLA 3LGHA 4AUBA 3N6LA 2PTWA 2PWGA 2YZ5A 5CPTA 1TKDA 1TX2A 5K8MA 1Q7YT 2PMQA 3PBVA 1X1ZA 3DXBA 4USIA 2EG6A 1FERA 4G1KA 3ET6A 1HNXF 3MMAB 5C7VA 3IARA 4WJBA 2ZJPQ 1KSPA 1O5XA 4Q43A 4Q8UA 5GNXA 1N5YA 3W7NA 3MW7A 4ID5B 4DR5F 3I7QA 5J1NA 4JS3A 2GQ3A 2NWSA 2FJXA 3II1A 3OVGA 3MEGB 5KITA 2QIFA 1V3IA 4D9PA 1X4FA 5KFIA 4RR4A 1MW3A 1XIBA 2Z29A 5T91A 2EEXA 3PJTA 4UTLA 1IM6A 4IG0B 1TTHB 4GYPC 1K0TA 3B4MA 1K6WA 2Y8KA 3PR4A 1KWGA 1M01A 2WMJA 1UKTA 3FX4A 1Y7PA 2D2HA 4CLSA 4MZ8A 4J3TA 3W3SA 1TTIA 3THDA 5ETQA 1KXHA 1XIGA 5EMMA 1EB0A 3NWGA 4J9NA 4PRFA 3UXAA 4CCEA 3LH2S 1BWVA 3IS9B 3OXLA 3OO2A 4PE8A 2R24A 4D6IA 2Y85A 3RAQA 2A18A 1RQHA 1DIKA 2QV5A 4GVBB 4KSEB 4F4RA 2EBEA 4GH3A 5DM7Q 4JP8A 1WUEA 1KGUA 3ITTA 3BKTA 4YWIA 1ADOA 1GKQA 2ZTJA 4UTWC 3WIUA 4B9NA 2B7PA 4C8LA 2YB4A 1IZCA 1AZSA 3VDHA 1RTJB 2GIRA 5KFVA 3K4AA 2YSWA 4HPNA 2UU9J 3TH6A 4LSZB 4DV3F 5A6JA 3DAQA 2UUWA 3EKZA 4IQLA 3MSRA 3QLLA 1HVQA 3KL3A 1E71M 3QSRA 1J5OA 2ZH4A 2CQHA 2CZEA 2FB2A 4QCEA 4ETXA 4BZYA 3SO7A 2DHGA 4C8NA 3HJZA 3M9YA 6XIMA 2YNFB 2PDYA 5D9OA 4QAIA 3QFWA 2Z2AA 3SI9A 4CWBA 5J2NA 4M8LA 2MXYA 5GMDA 1QK0A 1CGWA 1NAL1 1R85A 2AYEA 1ZPWX 3OVSA 4HTIA 1HBMA 3S01A 2LQ5A 5IFTA 4OHVA 3Q86A 3T0TA 4GZIA 2GPTA 2UU9F 3H6OA 3V0TA 3WLSA 1TPC1 4F2TA 4CLZA 4LNCA 2MY8A 1NJJA 2EXUA 1S77D 3FA5A 3AY0A 5EHHA 3WKZA 3TAMB 4ORIA 3TOYA 1NSQA 3CHEA 3C8FA 3LS9A 3BARA 3K0JA 4IFKB 1RE1B 2CWKA 1YTYA 4U33A 1SBRA 1F5ZA 3PFRA 4M1RA 2FVKA 4JTTA 5AN7A 1S6OA 3GR1A 4O4GA 5HVGA 4MWAB 4C7FA 4DDFA 4AD5A 1XLCA 3PM9A 4DPXA 4B02A 1H09A 1XIQA 3CJPA 4ZFMA 1BUXA 2ZZMA 3TR2A 1GUVA 4O1FA 1YG0A 4S2BA 4UW2A 4CO5A 3W28A 1FF2A 4DXLA 4ENOA 3FZBA 5FEPA 1UH2A 1AD4A 4B5VA 4HA1A 1LW0B 1TL7A 1N36J 2ISDA 4HOZA 2VFIA 1SC6A 5AC7A 5LXYA 2CU0A 4MK8A 1TJRA 5BXTA 1TELA 1WA3A 3R94A 1CJTB 1GQEA 4LX4A 2UXBJ 1BD0A 4LAZA 5KETA 1HQEA 4R0JA 1XCFA 1KLZA 2WK4A 4QWEA 1P0KA 4B3OB 1A0OB 3M16A 1FE0A 4AD2A 5I09A 2FZBA 2ZZ5A 3PZQA 3PG8A 2QPUA 5B08A 2J88A 4OQJA 2LQBA 2GOKA 4Q4KA 2BXJA 2FIQA 1LM1A 3ANUA 5GJMA 3RFAA 3T44A 3WMLA 1G4CA 4LUTB 4KHRA 4NYOA 5LMUF 2FUG9 3S1GA 1HJVA 2WVFA 2XMUA 4Q8NA 3BV7A 1ROFA 4JI3J 4CNYA 3AZSA 1SC3B 1ECQA 1QI2A 3LPFA 2FJAB 5LIYX 3JAMY 1YTDA 3L7OA 4QGCA 3GYGA 2VOMA 2W2MP 1U49A 1OCQA 4H1ZA 1VMBA 1LP6A 3QYYA 2CFFA 2BOEX 3PHTA 1W17A 2CDQA 4LNYA 1LG2A 2A3HA 3RMEA 2WO5A 2WHMA 3CGTA 4WWSA 1VFMA 1ELSA 3TYUA 3WBEA 2MQPA 2VICA 4EXAA 4WFYA 1S76D 2YXXA 3K4WA 4J9JA 3A3XA 4E3TA 3LRMA 3S4TA 4A8KA 3W9HA 2Z00A 2ZFAA 1VFOA 2PT0A 1TPB1 3CDEA 3PW0A 4IQJA 2X1TA 1HW6A 1KVJA 4JNMA 3AWNA 3LCXA 4GC7A 1MW2A 4CH7A 4P2SA 1TE1A 1Q86T 5D4PA 4Y0FA 2A21A 4LEQA 1EX1A 2YKMB 3MJYA 2VWSA 4LT6A 5L46A 3UR0A 3UYIA 3D5HA 4G7FA 1MXSA 2DJXA 3CMAS 3DRSA 3RGIA 1T03A 1BGGA 3EOLA 3NKYA 1GTEA 1JCTA 4FYDA 1Z3NA 2ON3A 3MBFA 2B6AB 2XH2A 3MKVA 4D8AA 3CUIA 3I5BA 3IVSA 3AIWA 2PZ0A 1TZ9A 5ABEA 1V0LA 2A6LA 1AL7A 3W81A 4IX0A 3RO8A 1PJ7A 3E01B 1PZ3A 1NKBA 2NS1B 4GCXA 4KEVA 2VD8A 3SSQA 2TYSA 3DUGA 1TU0B 5E5CA 1FKXA 2NXCA 4R5PB 4FNIA 3SXLA 3DLEB 2DSUA 2H54B 1D7FA 2BHUA 2F9JA 4KKOB 5IDIA 4DF2A 5LT5A 1ODUA 3ORWA 4JFVA 4QNEA 1YJUA 3I5AA 3SCJE 4JAWA 1VLWA 1Y10A 4OLPA 3INPA 3T1YJ 1LLWA 2XJ7A 4GXMA 3GLCA 2ASLA 2V68A 3U7BA 3Q65A 4JTEA 3VU2A 1TB3A 4U95A 1VCGA 1K73T 3Q67A 2QLJB 2HFUA 5BWAA 1LORA 3H54A 4PWUA 2E8ZA 1X39A 3R12A 1Q63A 3L4BC 3H8YA 1LUCA 1GYNA 4OHZA 1FRBA 4QSHA 2DVIA 4M94A 3HDSA 5DM6Q 2XDFA 1VC0A 4OHQA 2KKHA 3VOGA 1UWBA 1OB0A 1XL9A 3GQCA 4HNCA 5CSSA 1L6GA 2VMFA 3VDGA 4W4QA 3A3NB 4JIHA 1UA0A 2CPHA 4GINA 5DFAA 1HWLA 2UZ9A 2AJ4A 2EPMX 2DITA 1VIZA 1Q85A 1NJXA 5HBMB 2E1WA 1M1HA 2HBQB 3NS6A 4NNAA 2CZDA 3THAA 2IMRA 5JH1A 2WWCA 1GJPA 4K6AA 1ZENA 2GO9A 2R2UA 4GC4A 4HNUA 1GMVA 1CBKA 4IFYB 5ETPA 1SL0A 4BR1A 1KV8A 4B3MJ 1QY7A 1QNOA 3QC3A 4GYKA 3FSIA 3W2VB 4S3EA 2BABA 1XIMA 3OVPA 3ZLGA 4C6CA 2REQA 1LDCA 1HGYA 2RVJA 3C3LA 4H4IA 4AZCB 3CB8A 2D41A 1EJWC 2EFGA 4F2UA 2ZRXA 4PTWA 1C7SA 2WB4A 4CP5A 1HMVB 1WTBA 1VBXA 1TKTB 1HYSB 4PQAA 2XTJP 3N4AA 5EBUA 4AZ5A 1LCOA 2E5IA 1FRXA 4GC3A 4OOZA 2LDYA 3DMJB 1TX0A 1AZ1A 4C1NB 4PWWA 2VC5A 3W64A 4N41A 5A6BA 1SJRA 1RY0A 1SCJB 1FWPA 1EQMA 1PILA 2Z4PA 3R5CA 1JD7A 4B3MF 3PACA 1A3XA 1W31A 1ZHAA 3GG8A 1Q6LA 5A0YB 5DO8A 2P53A 4RBUA 4NLTA 1AUDA 3H12A 3QR1A 1U1LA 4XTIA 4HBKA 4S1FA 1M7XA 1OCNA 3TNOA 3HHLD 3CYVA 1DTTB 5J8LA 1SU5A 1PYSB 1DYSA 3GJTB 1IBLJ 1O6IA 3KK1B 3NGTA 4WFAQ 1VQPS 4IO9Q 3WEMA 4EO8A 3W1UA 4AAJA 4BQ5A 4OIFA 3W7BA 3LLFA 1NH6A 1S9EB 5B7ZA 2ANUA 2V94A 1AH3A 3ITLA 3A5FA 2QJMA 2HWHA 2HQDA 1GVEA 3CYJA 3CJTA 2Q6CA 5G1MA 1NP2A 3M0KA 2RS8A 2AX0A 1LWCB 2R7QA 4CNUA 3PCOB 1X7IA 4AC7C 3QQ1A 1R43A 3BDPA 4JY8A 4NSBA 1PKNA 1QFEA 2PGEA 3QHOA 5HMDA 3UWVA 4CM2A 4DO4A 4DX7A 5E33A 3AIQA 3KLIA 3W00A 1IBLF 2PP3A 1HI1A 2WB5A 2VJVA 4CUCA 1OFOA 3BSGA 2IRYA 4FOJA 3SSZA 1WOBA 3UPWA 1SJAA 1ZA2B 3BH6B 2JDJA 3QZ8A 3SGZA 2R7WA 4ZPCA 2GJPA 3W1PA 1MDLA 3V2UC 3OEXA 1IXNA 4DUYF 1YEYA 2EKYA 1ITCA 3NAVA 4M24A 1Z8AA 1AFIA 5AXNA 4QJ1A 2VX5A 2D3ZA 4RV8A 2KB2A 1B3OA 1LTDA 1TWSA 2X09A 2SFPA 4QXIA 5DG9A 1Q8BA 1JIBA 3BMXA 3W53A 3JZEA 2FJDB 2DT3A 3CVKA 4AXNA 2K2PA 4JQ4A 4Y2CA 1NMEB 3OR1A 1QUMA 2NPIA 1EIYB 1QTMA 5E6ZA 2C19A 5AVHA 3W60A 1U4BA 1QSLA 2Y8VA 2JSXA 3V36A 2L08A 1C3FA 1IT0A 4UQDA 3MPUB 4CO4A 4NZ4A 1C8XA 3T0DA 3EDRB 1H7WA 5EGYA 2BR0A 3H40A 3QPZA 3S5OA 2YW3A 3L21A 4GLEA 3IA0A 5LJ5Y 4KWWA 1NH8A 2X7WA 2N82B 1XERA 3TZWA 3QFEA 4UQGA 2J79A 3KP1A 3UPBA 1EA0A 3EEZA 4HCDA 4N9CA 2Y89A 5I3IA 2Z2LA 4H4MA 1FH7A 5ECVA 2CHOA 1O94A 2HK3A 4PRTA 4L9XA 4FF5A 3QFHA 3UR8A 3P5YA 1DE5A 1YQHA 3VZZA 3F2DA 3TIMA 1A3WA 3FA3A 1B4KA 1YDOA 2YBTA 4C1KA 3CLMA 2F5GA 1CXHA 3T05A 2B56A 3LTYA 1G1XA 4O0KA 4R27A 2DK2A 2XSJB 3W6MA 3E0LA 3RX3A 4WE1A 3W84A 4IFVA 2ZWZA 3VVTA 2J7WA 2BG5A 2VNCA 3MZIA 2XIJA 4KCWA 3F0NA 3RB4A 1DWJM 4HQVA 2D2OA 1TZZA 4N77A 5ETOA 1NK4A 1FVSA 1TUVA 4ZQNA 2G3NA 1LK5A 2FHKA 4NAEB 3PYGA 1Y5IB 1RTHA 1ZALA 3ZO7A 4LF4F 1NOUA 3UI3A 1WI8A 4RBVA 2YLLA 3QTPA 4S3DA 2DDXA 4IFOA 1C93A 4EK7A 4DN0A 3OIHA 3K2GA 4C0BA 4NP7A 3NJ3A 4ILLA 1M7PA 1QAPA 3IJ9A 3BLFA 1K6AA 4JBRA 2RQKA 1T7LA 2DT1A 3ARWA 4OX7A 5EA9A 3MR7A 1FDYA 3AMDA 4XKYA 1LL7A 2FHBA 4FSAA 4UCGA 2NVAA 4K59A 2EPLX 3T7VA 3CH9A 2HPUA 3UD4P 3MP3A 2MQQA 5E3QA 2YH0A 2C1GA 4NJKA 3XISA 2WOMB 1R6WA 1CJUA 4DU7A 3KK3A 5DLCA 1AW1A 3QT6A 1K4GA 3DYPA 1JJHA 1MNEA 4C8MA 3DN5A 1CXKA 4M5JA 1OD8A 2FC9A 3E2SA 1S39A 3GG7A 3DC2A 2UP1A 2NUXA 4XUGA 4HN8A 5T41A 2Q79A 2ADBA 4R33A 1Y3KA 2OT0A 2UUBJ 4M56A 3MB9A 1EJUC 2MUCA 3BLKA 1VEMA 3GFXA 5CZXA 3RRHA 2G5WA 1I0DA 3B03A 2CADA 3JSRA 3FXYA 3KJVB 2CPJA 2VG6A 1EP4B 1QT1A 3GNOA 3VO0A 4AXJA 1VQSA 4Z7YA 3MR2A 1GEHA 2F38A 3AD8C 1KVIA 4O53A 4UOJA 5D9MA 2B9WA 3L9ZA 3F4NA 5KFJA 4JKMA 3W9IA 1JJ2R 3L0GA 1UEKA 2FPYA 3H22A 3RW7A 1VPXA 3P7YA 1P1MA 5GVQA 1O12A 2DIEA 1W7WA 1XC4A 3C2VA 2YDQA 1AJZA 6FDRA 2VZSA 3A24A 2V5HG 4I3GA 2IQ0A 1PBUA 3KK2B 3DFYA 1OC6A 4WK1A 2CXEA 1F60B 3HD2A 5IBXA 3O06A 2H9ZA 5F8JA 1SXLA 1RBOB 4LRCA 2DKOB 3EB3A 3KBNA 3TA1A 2GIQA 4B4HA 1LNQA 1XBYA 4PGLA 5M5DA 3ZJ8A 1NQKA 3GIYA 1FJEB 1F9CA 1I51B 3BKFA 2ATSA 4QJVA 4AY8A 2OX1A 3RR1A 2ZZ4A 4MUZA 3BMVA 5HL7Q 3QGAC 5L38A 3UDCA 2GNKA 4Z2JA 3H59A 4G1QB 1Q66A 3VGHA 3H2MA 2QCHA 3ABSA 3CV2A 1UW4A 2LKZA 4B3TF 5J5DA 5FOOA 3NGDA 5L1IA 3M64A 1LV5A 4C6DA 5DANA 2IJRA 2WSRA 5DDRC 5AHMA 3NM1A 3PYDA 3V6HA 4DL3A 1QPQA 2Y5JA 1U1RA 1OJ4A 3R58A 3G6YA 2BOAA 1L8NA 3T6BA 2OSYA 3P82A 4J5OA 1IXQA 3DDNA 4IXHA 1VQ4S 4RW8A 4OVXA 4NI3A 4ZOEA 3I5CA 2CQ1A 3VX1A 5HSPA 4X0NA 4WFXA 3EUNA 4YHHJ 3TC6A 3HX9A 1WYIA 4G56A 4N6EA 1J8VA 5HUPA 1OSCA 3T2OA 1JI1A 5KFWA 2WVVB 3P49B 3LTSA 2FHCA 3JSMB 2OQYA 4TQRA 4MADA 2O5DA 2WLYA 1ZZMA 4JQ3A 5IXEA 1UETA 5EBAA 3H70A 5MF5A 1YVFA 2YY3A 2E9TA 3H42A 3VAFA 3ARXA 1Q8IA 5F2MA 2IYGA 7CGTA 4MB4A 1D3WA 3SZ8A 4N47A 1JJ4A 2PRMA 1JXKA 5H8UA 3HBLA 3RCMA 4DQQA 3AAMA 2XUCA 1TQJA 2IJNA 3ARVA 1T05A 4OBTA 1JLAA 2YKQA 4M95A 4E2FB 4H8UA 5AYIA 1H72C 4ZLPA 4FPSA 1BVNP 1D0EA 1A4MA 2CLEA 1KQGB 1XNQJ 4E4PA 3MYPA 1RCQA 3GIQA 3I6EA 3U2OA 3QLDA 4L61A 4ES3A 2DPJA 5DG7A 5A6LA 2JC0A 5C9XA 3KFWX 4Q0BB 5DELA 1DJNA 2FTRA 2PDFA 3M7WA 4PWDA 1XQLA 2ZUVA 2PBOA 1S5ZA 1OYBA 3BGOP 3MPWA 4DELA