3KDOA

Crystal structure of type iii rubisco sp6 mutant complexed with 2-cabp
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
436
structure length
435
Chain Sequence
b'YDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITLGFVDLLRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase
publication title Structure-based catalytic optimization of a type III Rubisco from a hyperthermophile
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Lyase
total genus 135
structure length 435
sequence length 436
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3kdoA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3kdoA01
3ZXWA 3A12A 4F0KA 2OEKA 5HAOA 1RBOB 2YBVA 2QYGA 3FK4A 2OEJA 5HQMA 4NASA 8RUCA 1GEHA 1UZHA 5HJXA 1IWAA 1UZDA 1BWVA 1RBAA 2V69A 1UW9A 2OEMA 1TELA 3AXMA 5C2GA 1RLCL 1RCXB 3WQPA 1UPMB 2V68A 1RUSA 3QFWA 1RBLA 2VDHA 3RUBL 3NWRA 5HK4A 3A13A 1IR2A 1EJ7L 5HQLA 3RG6A 1SVDA 1RLDA 2V63A 1RCOB 2D69A 5C2CA 1YKWA 5RUBA 4LF2A 2CWXA 2CXEA 1GK8A 4LF1A 3AXKA 1BXNA 5HANA 5HATA 3KDOA 2V6AA 2V67A 5HJYA 9RUBA 4HHHA 4RUBA 1UPPA 1AUSL 2RUSA 2ZVIA 4F0HA 1WDDA 1UWAA 3KDNA 2OELA 4MKVA 1RSCA 1AA1B 1RXOB 4F0MA 1IR1A 2VDIA
chains in the Genus database with same CATH superfamily
3E96A 3BR9A 1CWYA 1WDQA 1SUQA 3KK3B 2PCQA 4AEEA 1JCLA 1WACA 5DGBA 2K3IA 4IMGA 5BMWA 1X4GA 1XUZA 3RRXA 2ZRYA 3VCRA 1PIEA 1ZM2A 1OO0B 3DG6A 3ARXA 3PS7A 4Q8WA 4BQ3A 3W85A 3BZGA 3L23A 1VEMA 4ECTA 1VQOS 4M5NA 1K4HA 3HMCA 3CMGA 3L0NA 1KD0A 2MY8A 3TJ4A 1GOXA 4OKDA 4QDMA 2VIHA 3WELA 1UA3A 4U96A 2HFUA 3JUGA 4PODA 4IFKA 5AKQA 2HDJA 2OSQA 3MPWA 5D2YA 3ZFVA 4FBUA 2Y5SA 4O4WA 4FALA 1CJUA 4ZXLA 1XBWA 1S4FA 2Y3YA 2BACA 2NXEA 3N79A 1EYEA 4PWDA 1NEYA 3LY0A 4W8AA 3TX0A 4K8RA 1EKOA 4ZVJA 2LA6A 4U8YA 2ZWYA 3GE9A 1QDSA 1PUDA 1XD0A 3KUGA 5CC7A 1C0UB 2ROPA 1OHLA 1BXCA 4DX7A 1Q2SA 3KKFA 4M5MA 3MEGA 5GAHI 5A6SA 2OO4A 3L2MA 4HYWA 1XICA 2E3ZA 1YXCA 2G37A 2VDGA 4PWUA 2E5CA 5BRPA 2DHSA 1WYIA 5LXEA 4DUYF 2FHMA 1TAUA 2P8BA 2B0GA 2MQ8A 1Q6OA 3SCKE 1FJEB 3OZYA 4MIMA 4LRTA 1CQNA 3IAQA 4C0HA 1GX6A 4BWLC 2KFNA 3EVMA 3O15A 2V9KA 1GJUA 1H0GA 1T9VA 2DY1A 1KDNA 2RRNA 1BD0A 1EJTC 3H54A 1S99A 4NXNF 4QOTA 3O44A 3FRZA 5KFVA 3V5CA 4IG0B 4DBDA 3DM2B 2ZTJA 5CSRA 4BK9A 4J9LA 3AXHA 2G3JA 5LNVA 5KFGA 4K7VA 4O3QA 2YA2A 3OBAA 4JI0F 1D1UA 4PMQA 2AV5A 3BV4A 1E71M 2QZRA 3TU9A 3GV7B 4DL5A 2E9RX 3SDEB 2OZTA 2VC1A 4TX6A 1IXNA 4PEEA 3K89A 3R6GB 4F0MA 3L7PA 4DBEA 3HLUA 2HZVA 1XPGA 4X65F 3LI1A 5HOSA 3B3DA 4U7UK 3JSMA 3K57A 1Q6EA 2IJFA 3HURA 2P5VA 2A4AA 1EJRC 2FZ8A 2PURA 3U27A 3UR8A 3W3OA 2QMKA 3ARPA 2ZC8A 3ZFHA 4ML9A 5G0RA 5CPNA 5AYBA 4QXIA 2E5JA 3F03K 2QL9B 2J8AA 2FZBA 2IMWP 2ICSA 3BO3A 2BXVA 3VU2A 1Q53A 4JNMA 3BSNA 4GVGA 4LCQA 2VA2A 3C4UA 4J35A 3RGTA 1FWRA 1Y7PA 2D3LA 3P2VA 4AL5A 2IQTA 2W4XA 3UZYA 3JAMY 3O5TB 5EWFA 3R2CJ 3NEVA 1MUCA 1VS3A 3ITOA 5FI8A 3HHLD 3QIPA 5EUHA 1LZOA 3GAKA 1U4BA 3U7BA 2YIHA 1O12A 3AIWA 1JD9A 5XIMA 4NI2A 5AJ3F 1X7FA 4KT2A 3VZHA 5FOOA 2MKJA 2W61A 1LWIA 4L1WA 1PIIA 3F4VA 3PIPQ 3UETA 2ZE2A 2PTZA 1YRTA 2NVAA 1JCXA 3MO4A 4TQRA 4GI6A 4L9XA 4K8HA 2PP1A 3ITGA 1XGDA 2WWDA 5RUBA 3TK7A 4WOQA 3FX4A 1JYNA 1JQGA 4OGZA 4JV1A 4F50A 3SGZA 1XGZA 2GQCA 5LIYX 1ZAWA 3O63A 3K17A 2FTWA 4QU6A 1WKFA 3EX3A 3OLDA 2HXTA 4NZ5A 1F5CA 1Y11A 1V02A 2CPXA 2PF0A 1KM2A 2ZUUA 3WD1A 3OL7A 3LEPA 1G7VA 3FYYA 5A94A 2YH1A 3EGJA 4GO8A 2REQA 4JX6A 5A6LA 3TXZA 2GHWA 3T9PA 1IEQA 4H4OA 2I5JB 4BI5A 2ZVIA 3PNUA 2YVSA 3WJWA 5FDLB 4I5XA 3S5OA 3TYBA 4MSSA 5G2HA 1UB3A 4UFJA 1YIXA 1IQTA 4C6LA 1N48A 1HL9A 1W3KA 3EEGA 3R2DJ 3KM8A 3I4PA 4U28A 3WNMA 3FC9A 3LCHA 4GYJA 5KINA 5HP1A 4XAYA 2V9WA 1V6TA 3CCLS 5LYRA 4BI6A 1WC6A 4DR7J 1MN7A 1U1PA 3NSXA 3WG6A 5AHEA 3W6YA 2HK2A 3W60A 4OBRA 3UN2A 1ODUA 1U0HA 1A0DA 3M6XA 1V3SA 5EGYA 1XCXA 4ZPTR 3M07A 2YKNA 4DYKA 2ZZMA 4KEZA 3NL6A 4MJ2A 3S46A 3SV4A 3N1AA 2HRTA 2PLJA 3ZC4A 4O11A 4WCJA 1IF2A 5IM0B 5DQGA 3G6YA 1Z4UA 4IQDA 1FCBA 4NX0A 3C86A 1UW9A 4PGLA 3KOZA 4DV5F 3HKZD 1XG3A 4AYGA 5D8ZA 2FHJD 3UBPC 4F02A 4AY8A 3VDBA 4EK2A 4J27A 2QJMA 2PEVA 4DQRA 3UG4A 4UTTA 1RQBA 4GVHA 5E6ZA 1UKSA 2PSNA 1LT8A 1KBBA 2O9OA 4HHPA 2N3OA 3D5HA 1R6WA 5KFFA 2LP4A 2Q71A 4Y2MA 1R7AA 3VDGA 3H2VE 3N5BA 1EDTA 3S1WA 4J91A 3BB5A 3EBVA 4HZ7A 1XR2A 3K2YA 2DNMA 2V5BA 5GJMA 2EKGA 4MPQA 5C71A 3S9YA 3KG1A 1CT5A 1XJWB 1RQ0A 5K8OA 1M1HA 2OD4A 2CWXA 1S38A 4XBSA 3EKZA 3P62A 4AQLA 2QLXA 4CD4A 5K20B 1HW9A 3GXDA 5FSEC 4NL1A 3DFHA 4WU2A 4HBKA 3WQOA 4BFAA 1AODA 4LY8A 4NLOA 4W8LA 6REQB 3A4TA 3B05A 1XIFA 2WONB 1GQIA 4WFAQ 3DNCA 4JI8F 4XIMA 5CA5A 4B5NA 2KYXA 3PW4A 3AJ2A 4GC6A 4DFJA 1THFD 1HBOA 3EB4A 4PTWA 1NSPA 2VL4A 2GUUA 5GNXA 4OZLA 2X1FA 3WUBA 3B8TA 4F2UA 3MMAB 1P6BA 3NQ7A 2ZZ2A 1SKWA 2V8PA 3NWGA 2XISA 1H5VA 2XSFA 5AHLA 1WCGA 4USHA 4YOEA 2J6XA 1U26A 3RYSA 2EXUA 4CN4A 3ETOA 4LF4F 1RTIB 2NXUA 1Q7MA 4DM1A 3D28A 1Q16B 1EDGA 3UP8A 3DU0A 3VNIA 1TE6A 2W62A 3GG8A 3WBAA 3D3CJ 2H8ZA 3CMAS 4K59A 4C8MA 5HROB 1HVXA 5JJBA 1I6JA 5C0QA 1Q3NA 4DUYJ 2Y0SD 1DWJM 4OYIA 5JQ9A 3VC6A 2DGVA 3E74A 5E41A 1NWSA 2W7OA 3LQLA 3C8NA 1LJYA 1QVGR 3HG2A 2O3DA 2YB1A 1W3HA 2OHDA 1MWZA 3GHSA 2DNNA 3GUWA 5H8UA 5BW6A 2CDRB 4ERDA 2ZZ7A 3V5RA 4NXNJ 1N32F 1S0VA 1S1VA 2AJFE 1KP6A 1NDKA 3WIUA 1GONA 3TW9A 3W7IA 2FPHX 4L6HA 2P9GA 1U6FA 2JEPA 1DKWA 3TA6A 4G65A 1SBRA 3PYGA 1RWKB 4JI0J 4NJIA 1NDCA 3L9ZA 3MC5A 3EDDA 3KBNA 4MB4A 4RWWA 1JJHA 7FD1A 1ZB5A 2NCKL 2BM1A 1RAAB 3EWBX 2XWEA 1EDQA 3QPYA 1KRPA 1YE4A 3N73A 2YLAA 2C71A 4NUWA 3WY1A 4NLWA 2A18A 3OA5A 2HZAA 3FUYA 1HNVA 2VR4A 1VQ6S 2C2RA 4W84A 3PTMA 4KIEA 2IKIA 3R0UA 4WXOA 4EWTA 2W2OP 1EP4A 2CETA 5TD4A 1JPDX 2PWHA 3WF2A 4QS5A 1DWGM 1BXNA 4H9XA 3O3LA 3ZTSA 1KLNA 3KDOA 4WRHA 5LIUX 3EE3A 1DYSA 2E68A 1JRBA 3HTWA 3UWUA 3RB3A 3DENA 1WDPA 4HD5A 2VCAA 1YADA 4KC5A 3RLHA 4BY3A 5JH1A 4Z0JA 1G4TA 3PR2A 1K1SA 1VGAA 2CQ3A 2J0QD 3TJAA 2F8EX 1V77A 1O5QA 4ZA1A 1TKXA 3A3OB 4AIBA 5B0GA 1CJUB 3TYTA 2QVNA 5EMYA 1MW2A 2W92A 1WQ5A 3GIJA 3WLOA 1TL1A 1DJ0A 4JIQA 4HMEA 4HKQA 2J7DA 4IO9Q 3NBPA 1ZJIA 1H74A 3URAA 1V3HA 2G3FA 3NDOA 5AJ3J 2AYGA 1D3HA 1OADA 3KHGA 4KWVA 3CYJA 2QFJA 1S59A 2GGJA 1VLWA 4ECRA 3WQ8A 2YW3A 3ABQA 3DFPA 3QOKA 3KAOA 4PG6A 1T8EA 1XUUA 4FYDA 1KM0A 4XZBA 3W1PA 5FAGA 1AFSA 1NSQA 1W9BM 1XIHA 3DFSA 2DRAA 2EPIA 4K0KF 3GU2A 2C3YA 4X4OA 3SFGA 1NFBA 1FX4A 3L4ZA 4RXGA 3FLUA 3CMQA 1XD1A 2VF3A 4RNNA 3MM9A 2AKZA 2RHGA 2DR8A 1ZAJA 2IPFA 2KDOA 2EG8A 1N8FA 1PBAA 3MZNA 6ENLA 1BVZA 2HBVA 1BF6A 1NZAA 4C6IA 4GMEA 3ZSTA 4E6MA 4FNTA 2PB1A 3FN9A 2DNHA 2ZUVA 3IPWA 3OVPA 3W7EA 4ILLA 3LMYA 1O8BA 3HSGA 3FHQA 1GYNA 1Q6DA 2B43A 1SO4A 3K8LA 1FH8A 2CU0A 3AMDA 2ASJA 4ELTA 3LAMA 1OGGA 1FK9B 4O1AA 1HI0P 1CGYA 4JZ5A 2DQXA 1NK9A 5LIKX 4L64A 2YQ3A 2X2YA 3WNPA 2LCWA 2XH7A 2X3GA 3T1HF 2FVRA 2HEJA 2SXLA 4ZN3A 2IKGA 2BWGA 4DV1F 2XMMA 1S0MA 4MF4A 4ZQMA 2VG6A 5H1WA 3QR0A 1CLXA 3Q4DA 4EBDA 1FHLA 1WC1A 1V6UA 4KEUA 4ZIWA 3USZA 2DT1A 1J2VA 2V8VA 4DV5J 1SSDA 4GHRA 1R8PA 9XIAA 1UEVA 1VRUB 2HGNA 1HPZB 3O6QA 2PA6A 4WSKA 3GLJA 3NDYA 3QFEA 4PUEA 4OJYA 3G86A 2MJNA 3H23A 4NZCA 3M05A 1FFWB 2V3GA 2DNZA 2XHYA 3S1GA 4EU0A 2FGLA 2VICA 2JFDA 3N18A 1UFWA 2XGPA 4MK7A 4GIYA 4NI2B 3S2CA 4FYYB 3ARSA 4IRKA 1PYTA 1HKVA 5M03A 4L4OA 1SMDA 5J2PA 2PDFA 1QTNB 3HPAA 3E12A 2V8GA 3GB0A 2AQOA 5AYXA 2WVBA 2C91A 5CSSA 4WZQA 3IAPA 2BJDA 5ETTA 5B0AA 2RQ4A 1X39A 2VKRA 1F0XA 3Q37A 3BGFA 3APYA 1SPQA 1TO3A 4R5EA 4HSHA 1UD8A 1IUJA 2CQ0A 3TAPA 3GR7A 4I7FA 6FD1A 4KPYA 3IWLA 4YTTA 5A8QA 3RYLA 4L3KA 3O1NA 2ZICA 3LRMA 3GILA 5CYJA 2QCNA 1CJKA 3C2OA 4AHPA 4DCOB 1CCWB 3GVGA 4CNOA 3JTNA 2OZ0A 3QWUA 3D3FA 4YTSA 3CTRA 1A5LC 4JI8J 2ZBTA 2ZUWA 3TYUA 3TA0A 3UDCA 3P81A 1NWTA 2A0NA 3QT8A 3A9BA 2REQB 5G2WA 5K8NA 1VFLA 2OPRA 2D2HA 1OFRA 2V8DA 5D03A 2HGMA 5M2FX 3T8LA 3D6TB 2I1RA 5I23A 4IR9A 1JDEA 3R79A 3CEDA 3CJKB 3RF9A 1TVLA 1XRTA 4C7FA 3CGTA 3BAXA 1DLOB 1NRKA 1NUEA 3ICLA 3IRXA 4Y28C 1X96A 3H26A 3UXAA 3PUEA 5IXEA 4W9TA 3GNNA 2E40A 2WQPA 2FYXA 1QWKA 2Q43A 4H41A 4LF4J 4JL2A 6A3HA 4CLFA 3RJXA 3ZR6A 1N88A 2PDLA 3G1VA 4M63A 3NRBA 3D67A 1SMAA 4UQDA 2HRYA 4PCFA 4ZKAA 2OLHA 2ZBPA 4C8ZA 3CM4A 5HATA 2BV3A 4LCSA 1QI2A 2WBMA 4K36A 4TU1A 3N13A 1YJ7A 3D2WA 3TTEA 4ACYA 3PG8A 5EGRA 1X98A 2Q6BA 1W8SA 4EZ9A 2ZHBA 3OHIA 1AFIA 1EWEA 2OB3A 4US6A 4HVZA 2W3ZA 3OV7A 3FVDA 5KG4A 1WDDA 1YBUA 1JJ2R 2VO5A 4KGXB 4DWDA 2ZWOA 1N32J 3MMBA 5KZDA 4AY1A 2DIVA 3G8SA 4GKJF 3W72A 1P5BA 4WY0F 4ZXOA 1ZS2A 4ITSA 1UHVA 3DHDA 3ARRA 1N5SA 4R9XA 3Q2TC 1R89A 3GHRA 5HNNA 1E1EA 3FGCA 1S7HA 1JKHA 1NK0A 4DR1F 3HA1A 4WUIA 2QA4G 2W4PA 2EBGA 3BJTA 1BYDA 3RRKA 2PUZA 2X1TA 3BPWA 3WBWA 1AL8A 1H2TZ 4TVUA 4ZFCA 3BZQA 3HHEA 1H7PA 4DJDD 3MPYA 1FWNA 4J9SA 3GO2A 2YW4A 1RHKB 1NJIT 3AALA 3H70A 3TA9A 3NVTA 3RCMA 2X42A 1X97A 2VPYB 1BG4A 1QR7A 4FX7A 1N8WA 1JULA 1AQHA 4IQMA 1RT2B 3T1AA 4ECZA 2XJ7A 4I67A 3OZMA 1MNSA 1WF0A 1ZGDA 2AP6A 2DTJA 4DX5A 2YDSA 1HUVA 1WUUA 1IT7A 3LPOA 3D1OA 4ZITA 5I03A 1EC8A 4TV5A 1RWMB 4PR6A 2I6WA 3TVZA 4RW6B 3E9AA 5G4WA 3C8YA 1KQYA 3L7OA 3FQKA 1RPXA 3KMSA 2CPIA 3JRKA 3CCQS 3FW6A 2PDQA 5BNKA 1FDJA 3A22A 3W5YA 4NX9A 3GJSB 2A1YA 4XO0A 2E1MC 4DPXA 1E6VB 3IO1A 2NWRA 4FYXB 1JLQA 2LLEA 3VOHA 4DLMA 4LUBA 3MM6A 2WMIA 2Y89A 4LBHA 5KFCA 3DI0A 2XZWA 1YNQA 2PI4A 4YB1P 4NLVA 1IGSA 3NOCA 4JTAA 4B9LA 2RRAA 4H7CA 4LYKA 2ZH4A 1KQFB 5FJIA 3W73A 3NA8A 3G2GA 1RJJA 1E5NA 3P5YA 5BJRA 4LVAA 4K0KJ 2AAMA 2AJQA 2IBOA 1OQ3A 1WX0A 5CXPA 5EMKA 1HKIA 3CZEA 1Y4ZB 4AHQA 4U9RA 3I7QA 1VDHA 5T9BG 3B03A 1NHKL 3PW5A 3NG3A 4GINA 3PYFA 2NQ9A 5F8JA 1W5QA 3QFHA 4C0BA 2DK2A 3BGLA 4WTYA 1GJPA 1P27B 1VQ4S 4EACA 2CJYB 1Q6QA 4QITA 1SJ3P 3O6AA 4F40A 1OWQA 4C65A 4XZMX 4XTIA 2WCAA 1ITQA 1AW5A 5CZKA 3KUHA 3P14A 4ETXA 3U4FA 3ARWA 2V5JA 4NA2A 4MZYA 2FJVA 3KOYA 1RT7B 3FSIA 2Z2AA 1GWJA 1S2AA 1GMVA 2HVIA 4PXEA 5B0DA 2EXOA 1YJNS 2NPIA 1M3UA 1TV6A 3SQGB 5SZTA 3VTRA 1E6XM 1S5MA 3T1HJ 1YDOA 1E6YA 5DDOC 3V81B 1VPYA 2AZ1A 4FMVA 1YX2A 1TELA 3MM8B 4H4KA 1HJVA 5C2GA 4DV1J 3V6DA 1H73A 4CU8A 1Q8KA 2QLBB 1Y5XA 3KVKA 3WQPA 1Y3JA 2Q09A 1ZTWA 3G6LA 2WC7A 3MBFA 2E1PA 2DIJA 4YTQA 3PJ9A 3AMLA 1OX4B 3U48A 4F4YA 2YQ1A 4P7TA 4GIRA 1FCAA 3IN5A 4GLEA 2J24A 1SGJA 3IEBA 3P0XA 1POKA 4K7YA 1O0PA 4OYOA 1FNMA 3J7AN 2BJ9A 4ICLA 5D8HB 1E72M 1PYOB 2HNEA 4TUFA 2EI5A 3WJXA 1Z69A 1TKXB 3BC9A 3RX2A 3D0CA 5K14A 3GFXA 1CPUA 4Z1AA 4RBVA 1KWGA 5D0HA 3THVA 1HJWA 4FVCA 1SVDA 1R3VA 3SEOA 4W4QA 2QLWA 5IOLA 3CZLA 3VKBA 3MUZ1 3A3XA 1P9QC 1PCWA 1S46A 1SW0A 3I0SA 3NBPB 1QSYA 2DW6A 1FJ7A 1YITS 1XLMA 5EHHA 1FDYA 4HNCA 1YPIA 2X1BA 1GTEA 3IFEA 5M17A 3PIOQ 3WH9A 2LU1A 4HU4A 4NSBA 1YSJA 3WJSA 3BSAA 4DU7A 2QX0A 3OHBA 2D20A 2R2TA 2MZRA 5HMSA 1E1FA 4FYWB 4I5RA 1JWWA 1IEIA 4N7TA 4DF1A 2XGIA 4RCXA 4J9RA 2V4JB 2HWGA 1HI1A 1WNEA 3G3MA 2P3ZA 3JZUA 1FFRA 3M64A 3MBDA 3HHLC 3BSGA 2VX5A 3NS5A 2AL2A 3VINA 2HNDA 5E3PA 3B8SA 5T26A 4LB4A 4JTJA 2XI2A 1QO5A 3JS3A 4V28A 4HI1A 5DLCA 1QE1A 4WXWA 3MM9B 3VGSA 3TXVA 2HVHA 3NEKA 1N54B 3WLLA 1FNOA 2PN6A 2EQDA 3HVTA 1V3RA 4OX9F 1K77A 1SR9A 2HKEA 4RZRA 1QTMA 1HF6A 2FLOA 1YX1A 4QLLA 3MP3A 2DVUA 3QV7A 1YJVA 2CAJA 1X4BA 1SQEA 4WPAA 2Z4GA 4F0KA 3HJEA 1RHUB 3WZ0A 1HO4A 4Y9MA 1CQMA 3H8AA 2CZVC 3BKUA 3W2VB 2WLYA 1N55A 5GAGU 1S6PB 4JTIA 1G5AA 2HAFA 2OZ3A 1K0TA 3WDJA 4HL9A 5DDQC 2YDRA 5DMYA 4W89A 4H01A 1LQ0A 1VFUA 3D47A 4QIGA 4B4HA 3QQ0A 2JH3A 5CAKA 4I9MA 3E5PA 2ACYA 2JOQA 2YL9A 2VG6B 3CB3A 1HNXF 1IJFB 1UA1A 2YNFA 3PX0A 4GI9A 2HVMA 5F8GA 3B4YA 3CEUA 4MYTA 1M7JA 3BARA 2F63A 3BW4A 1J5OB 1KEKA 4GKJJ 2QPXA 4RZ5A 5IRPA 2DHAA 3G2XA 3VGBA 1UP3A 3DI1A 3UCZP 4JIPA 4IM4A 2VC7A 1FD2A 2LA4A 3T8QA 2CG4A 2J79A 1XP3A 4P2MA 4U67Q 4U3CA 4Z08A 2OMAA 1R47A 3BGOP 3DG7A 2KXNB 1UWIA 1JFHA 2DH7A 4J9NA 3WEZA 3QMRA 1DTUA 3L67A 5HR7A 4DR1J 1D9FA 3HIJA 3I6PA 1YDLA 3AZTA 4ZSTA 2D9OA 1UWBB 1W3TA 4ZOCA 1GXUA 2YL8A 2M9KA 3ZQ9A 5T91A 4KHRA 5A8WA 3CCMS 2RS2A 4KFBA 2BJEA 3WBZA 1VRDA 3LA4A 2G41A 4EP8C 1XFCA 3CJSA 1CEOA 3FEMA 3I7RA 2H9AA 1LCOA 3QZ6A 4IG3A 2YA1A 1CJKB 2RIJA 2G2YA 2CVEA 4EO8A 2VWSA 5ETSA 3N3MA 4DPWA 2QA4S 2BFGA 4NOHA 2ACSA 2NYHA 3S4TA 3W82A 1C90A 2UY3A 3TSMA 3TNVA 3GYGA 2XZ9A 2DUZA 4OFCA 3TVKA 2KFZA 1EIYB 2MPUA 1OEPA 4BJHA 1HNZF 3M6DA 5FJ4A 3I96A 4IXHA 2GJ2A 1HQTA 3GR4A 1UIOA 4XUYA 4G3IA 3SBFA 5D4PA 1SJBA 4M6VA 3P7YA 3MR6A 4F4RA 4DPYA 1PEZA 3S1XA 1V6YA 4C9DA 3RITA 2VFVA 1VCGA 3V5FA 1CENA 3ITXA 1KXTA 1FXDA 3GYEA 4PBGA 5L9NA 2BY2A 3D0GE 3MGJA 2AGQA 2AOSA 5AN7A 3PANA 2PU1A 3TTSA 2XGBA 1NBEB 3VAFA 4PB3A 1V9OA 1G6BA 3WF1A 4RW7A 3EXYA 4DHVA 1WV2A 1JJCB 2J9XA 3G82A 3BYRA 3E8OA 2VC0A 3VOCA 3WMLA 3GIPA 4M56A 1FH7A 1KNZA 2D73A 3NWRA 3Q67A 1D9EA 1Y5VA 5JBEA 2EPKX 1SQFA 2DNKA 2WVDA 3T07A 3MSDA 2CWNA 4HMDA 5DO8A 4K4VA 3PBMA 5HN0A 3ZJ6A 1RT1A 1P6CA 3GNOA 3HFZB 3C15A 2PODA 1IKWA 2OPQB 3VX1A 3SSQA 3ITCA 1XYMA 3W7BA 3C2FA 4DX6A 5DF0A 4TV6A 4JQ1A 3OIXA 4Q8VA 4DV3F 3PW0A 3CU2A 3E2EA 1ZJHA 2C3ZA 1W9PA 2NREA 3CUGA 4O8AA 2ZWZA 1SIWB 2YH0A 3IJQA 4XSLA 2MXYA 1F6KA 3M7WA 3MPDA 1JKHB 1D8ZA 3ABSA 4IJRA 2TAAA 1GKQA 3PRDA 2YXLA 2XM1A 4PMRA 4C1NA 2N7CA 2CERA 4B5VA 3BSOA 4IPJA 4DR3F 3TUZC 1W5NA 3DGBA 3LGHA 1ICQA 4J9UE 4DWIA 1XIJA 4OJHA 3NNTA 2FHFA 4A48A 2YGYA 4LAZA 4EXBA 2EKCA 2WBRA 3POTB 3TMQA 4EBEA 2EG7A 2AKMA 4DDFA 5MLCV 2C13A 4QE4A 4ZVHA 4ERGA 2F6KA 1NELA 2WHOA 2GJRA 3NGTA 3CC1A 4HA1A 1OYAA 4UTJA 2I9UA 1QNPA 3AB2B 3DCAA 3DG3A 4P8VA 2Y8UA 4QJ1A 1J0JA 2J78A 4JGDA 4QE5A 2QL7B 4WE1A 3OW2R 5B80A 3FV9A 2DNGA 2DZXA 1BSLA 4L4PA 4E3VA 1JDAA 3WC2A 3W2WA 1J0YA 2GLKA 4C6NA 4HZ6A 1SQ7A 2RS8A 3T19A 4X84A 3NGDA 3URBA 2XLIA 3HV9A 4BEQA 1LLOA 2B4OA 1TA3B 2WMJA 4O52A 3PDNA 2CPEA 4KBXA 3WNKA 3KNAA 2VGGA 3MWBA 3KK1A 2FHKA 4XD5A 4OYAA 1GJWA 4R0JA 1VISA 1KHVA 3IUDA 3GVWA 2WC3A 3C52A 1IWPA 4PG7A 7TIMA 2AL1A 5K9CA 4YR0A 4CNUA 2JVRA 3MP5A 1YBQB 5HPOA 1TQJA 3PNIA 1VQNS 1R30A 3GTNA 2E9BA 4IISA 4EXAA 3IACA 1TRDA 1IYXA 1B1YA 5E0KA 3VOIA 2B7NA 1KC8T 4PPDA 1KBLA 1AFJA 2J7HA 3CLMA 3ENQA 2OVLA 3Q86A 3LNMA 2ZH1A 4GNJA 3AMCA 4UY8T 3C8FA 1EP3A 4PMOA 3TZNA 2BE7D 3QQCD 1NFPA 4LF8F 4KCVA 4PRWA 1WOAA 2UUWA 5CGTA 2VZUA 2X30A 1TKTA 3WQDA 4ZCWA 3SN1A 4OX9J 4JTGA 1V3JA 3G1SA 2GVDA 1R3QA 4W92B 4Q4RA 1LQ2A 4ZK7M 2WOMA 3TAQA 3GNDA 4PSRA 1OGBA 4KRZA 2NVDA 5AZ0A 3MUTP 1Y00A 1HQUB 1I2RA 3IK4A 1P7TB 4AZGA 2ZADA 5F4SA 5AY7A 2BASA 4W4MA 1E9ZB 2IC3A 4MY1A 4XIUA 2ASHA 1EA0A 4QWCA 4XQ6A 1DJWA 1V03A 5D15A 3M7SA 4IIEA 4S39A 4CVUA 4W7VA 3ZWSA 4G1QA 3NGUA 3R0KA 1D0EA 3J7ZT 1QAJA 4OZ0A 4N9BA 3OLBA 2BS9A 1S1UA 2P53A 2LQJA 1HNXJ 4AZCB 2PLCA 3W1RA 5KFAA 2XS7A 2R82A 4JV2A 2V2CA 2AF6A 1AH0A 3LO3A 2C1GA 2FYMA 4PUDA 3M32B 4WWSA 2E1RA 3LNPA 2ZNZA 5F7UA 3C19A 2HS3A 1KNWA 1K8YA 2P76A 3CZKA 3Q8QB 1LL6A 3PEHA 2V94A 2Z2MA 4FPRA 5K14B 2BP1A 3SN0A 1TVRA 3DLGB 1F61A 4ROPA 1FFQA 2VZ9A 3NJ3A 1GQJA 4EXQA 1TZ0A 2FJUB 1JLEB 4AMCA 1DJZA 3SCLE 4OHZA 4NF7A 2QZ8A 5B0CA 2ZUTA 2PMZD 2UY2A 4I2PA 3HGSA 3SY1A 1GFWB 5F3ZA 3A4JA 5KFJA 4LB3A 4PQAA 3P8IA 1DRZA 3AAMA 1W3JA 3QGPA 1KRAC 1GQKA 4NZ0A 5TAOA 2MLZA 1XH1A 4EWJA 5DM7Q 2HPIA 1QTWA 3NPXA 4GUGA 3C14A 3H6OA 2HNDB 4ANEA 2J7GA 4KKXA 3W7MA 1V7AA 4PMDA 3ZTOA 1NKEA 3ZZTA 2AQVA 2HRWA 3FKKA 3QLHB 1JLFB 5HQLA 1KTQA 1MYRA 3ATYA 5KFZA 4CIOA 5LNWA 1Q7ZA 1W1VA 2WVVA 5A8GA 3LYEA 4GI8A 3FJLA 2YPIA 2UXCF 2D69A 1D3CA 4ZPAA 3T6BA 1RWWB 2UXBJ 1F5ZA 4NMLA 5LL6d 4IIHA 5HBFA 1TL3B 1HNZJ 1Y5WA 3MWCA 5J8LA 3W2KA 3H2EA 5C5JA 3TQPA 1Q8JA 1X1ZA 1TIMA 4P9SA 1V6HA 2WSFC 1M53A 1BWKA 4LAUA 2BJ8A 3KUMA 4AD3A 3BV8A 3QNWB 1H60A 4H4IA 4YCOA 4KO0B 1NOUA 1DORA 5T8GA 2H9ZA 2PT0A 3DLJA 1LM1A 2DR7A 3MHGA 3CIWA 5E70A 1FF2A 4NYZA 1K8AT 4WIQA 3N29A 3KJNB 3UF9A 5DN1A 1QAXA 3N2BA 1JLAA 4IT1A 2W2QP 2PI5A 3KDNA 5ETNA 4GK8A 2VB6A 3CCWA 4WBFA 2ILYA 3RLUA 2E5LF 4Q7IA 5CD4H 2AGOA 4WDUA 4BQ2A 3BAKA 1SJQA 1H3DA 4EUVA 3EB2A 2OXNA 4Q7BA 1GVFA 1WDTA 2W9BB 1XDMA 2MKCA 3R1LA 1S1XB 3L4TA 1TPH1 3I68A 5BWFA 3VMNA 4K2XA 5I6SA 3OT9A 1XF0A 3W1MA 4OZ1A 2MKKA 3BANA 4UOGA 3G96A 4DV3J 2OEJA 1FX6A 3M9OB 3E0IA 4DLEA 1IBCB 5F8IA 2QF7A 5KOXA 2Z26A 3AIBA 3W81A 3VMPA 3LTYA 4TTGA 4U7CA 1LP6A 3OJUA 4KAIA 2ZH8A 2HHSA 1KCKA 4EANA 1NY1A 1VFFA 4RWXA 3AXMA 4RZ6A 2VZSA 2E4TA 4MKNA 4PSPA 3SMZA 3RBEA 3K5LA 2XVKA 3LSCA 5KG2A 4DR3J 3ILOA 3MSGA 2UUCJ 1WI6A 5KFUA 1JPIA 2CLFA 4USUA 5A8WB 4R85A 1D7KA 1VCFA 3LHYA 4KFBB 3AWOA 4LSLB 3PWGA 4MY9A 1NMEB 4O4GB 4KH1B 1JDFA 5HK4A 2H9AB 3O0KA 4AUBA 5C9UA 1RWPB 2WQDA 4YMEA 4CRJA 1S39A 1M41A 2P6TA 5L46A 2W9MA 4Z2JA 1RLDA 1JGIA 2ZRZA 2AKWB 2Z2BA 4O18A 3UZWA 4DJDC 4CCHA 2HS6A 4CN6A 4WP8A 4KH0B 5JIPA 2OX1A 1Z3NA 2JNJA 4L3NA 5JH2A 1HQEB 1IZJA 1VYPX 1X9WA 4HCDA 5IC4B 4HI2A 3DMJA 2VTFA 5I3HA 4M8UA 5FF4A 5D6GA 3BVJA 2FZ9A 3UD6A 3DI6B 3TO8A 3IV8A 2DT0A 5H1SV 2Z7KA 3G1RA 3UFYA 1EZ2A 2DSUA 2H4YB 5M2RA 2O56A 3MANA 2FMNA 4LUSA 1R8CA 3XIMA 4D8LA 4OHYA 1WB0A 2XO7A 4LFBF 2CZ5A 4YQWA 3KG0A 3T3FA 4HJFA 4S3AA 4Q8PA 5H8PA 4MT1A 2ZDPA 3ZJ8A 2FPYA 5DFAA 3WD4A 3A8KA 5KAKA 1HYSA 4O10A 1XWLA 3LP0B 1TQXA 4LEQA 5F4XA 3VAKA 4LCRA 4RNOA 2EKNA 2P3EA 3BICA 2W8KA 1ZCOA 4KV8B 2QDGA 3D7SB 4ZSUA 4QDPA 4WP3A 4UNIA 3K8MA 4LF8J 1F7BA 4GQBA 1LXJA 3Q8PB 4YIWA 3AXXA 4P5UA 2HSAA 3IM9A 2XCPA 3ZZOA 4EBCA 1TU0B 4HSOA 3H2FA 3GC4A 2GC8A 4O44A 1RT1B 4P2XA 5CCZA 2KH9A 3FK4A 2O7SA 3KTXA 1IKWB 5LNSA 1YRRA 3GJQB 1QWGA 3WFLA 2VI0A 3E2VA 4GIAA 4N77A 3BAYA 3BW2A 1XLAA 3JTPA 1GGOA 1LDCA 4X63A 4Y2CA 3G18A 3OFGA 4BLGA 4NZ4A 4MVAA 1KGWA 4FEZA 1EETB 3WDOA 4IYQA 2BZNA 4I68A 1YBTA 4M5DB 5KG6A 5H91A 4F0LA 2NYIA 3CUFA 5FIPA 1KCLA 1TV7A 2XN2A 2L48A 4PUMA 2IUZA 2WYSA 5A5WA 3UW6A 1QD1A 1JUBA 3GXPA 4P7VA 1E43A 2FHBA 4OHWA 5D4OA 3P67A 4LR8A 1JLCA 4NG3A 1SO5A 3F5KA 1HARA 4DPPA 1CULB 4JYDA 4IDKB 2VV5A 2PAJA 3C6UB 2CLIA 4JTHA 3SN4A 5JVLA 1DP0A 3EAUA 4ZBCA 2IYGA 5LXXA 1QSLA 1RZMA 4PN2A 3SFWA 2QE5A 4FS1A 1TFYA 1FWJC 2TPSA 5DY2A 4D6GA 1RHCA 3LENA 2F7VA 2OWXA 3G1HA 1DHPA 5CPOA 1KKOA 2QCHA 1VJWA 2YSWA 2CZFA 4E8GA 5BZAA 4MTPA 3KFTA 1ITXA 2HS0A 4QDWA 3W2WB 3QATA 1KONA 3M5YA 1RISA 1APSA 3A8IA 4WXYA 3W71A 3CASA 5HJYA 3HD1A 2ZRXA 2W25A 1NAQA 1TL4A 4RJVA 2J88A 1KTNA 3N11A 3TAMB 3KK1B 3BSHA 3LW5C 1B3XA 4D1JA 2XWDA 2KAUC 1MZHA 3VCCA 4H9UA 2J9DA 3N2CA 3UWVA 4Y2WA 3WDRA 1KFWA 2HS4A 4DIAA 1XH0A 2X1SA 4ZTYA 1MVYA 3CWOX 3FKRA 5L1LA 3ZLGA 4C6AA 3DRSA 4TR9A 4E38A 1SZEA 3H2MA 3STGA 5LT5A 3AQPA 1F8MA 3RW7A 1DL3A 1TKTB 1HT6A 2PA3A 1F2GA 1ELSA 1OCNA 2UXCJ 3KOAA 2PP3A 2GVDB 5I2UA 3DHPA 2JZ5A 3QJPA 4GNKB 3VZXA 1UZHA 1EAYC 1WAUA 3WLIA 1TV2A 1ZPTA 2Z28A 1UD6A 2ZH6A 1U45A 3NR0A 2WOMB 3LOTA 4GXPA 2V2HA 5K8PA 3LSBA 3SUTA 2V69A 1QI3A 1K44A 4Z1BA 1SZNA 2VD3A 2GMHA 2XHWA 2YNGB 3SJNA 3H21A 1WZMA 4B90A 4NA1A 1OBAA 4ICCX 4QCLA 5J5DA 4DJEA 1S2CA 1HD0A 1Y5IB 5ETKA 3K1GA 1R3TA 4JFTA 4E2OA 3M2RB 3QR3A 3EX6A 1U25A 2XUCA 1I0BA 2PMQA 3F44A 1IZKA 3NVDA 4WGXA 2D2GA 3C16A 2DR6A 4JTRA 2XVPA 4G1QB 1BRLA 3SIZA 4GC3A 1W3NA 2NSBA 3FA5A 1SCJB 3PZVA 4IL2A 2DITA 1S1UB 1JQXA 3URQA 1G69A 2E5LJ 1BGAA 3HQPA 3OHAA 1ME8A 1WDRA 4XAFA 5CPMA 2VUYA 4J9VA 3D6MB 3IJIA 4AC7C 1PKLA 4UTFA 4W5ZA 3QQ1A 1PKYA 4UCFA 4TX8A 1EX8A 5G4DA 1IQ8A 1XERA 4L75A 2NZLA 4PRRA 2GZOA 1QNOA 1XDLA 1Z32X 4LYPA 3W1UA 3LBMA 4DBQA 3K13A 4LGXA 4K4TA 1E9LA 4GVLA 3FYOA 3QOMA 4RUHA 1WF2A 3HHKA 1HL2A 3AYVA 3TP2A 2GJXA 4LF6F 4JEJA 5A1AA 5EMLA 1ZY9A 2YNHA 3TCSA 1DVJA 2PSZA 3ZVIA 4MWAA 1Z9AA 4P8WA 2J27A 4GVIA 4FBTA 3W7HA 1QI0A 4UTLA 1M5PC 4MB5A 5C42A 2P50A 1XIMA 3AI0A 1RSCA 3CL8A 4A46A 4FXFA 4B2DD 1I51B 3O07A 1T9YA 3CQJA 2FDNA 1BMQB 3J81U 3G22A 3C14B 1FA2A 4HA3A 3M8QB 3KEHA 3DERA 2R7QA 3CCES 1YXYA 3WLKX 1L6GA 2NUWA 1XLIA 4TYAA 2VOMA 1SJFA 3N15A 1D7FA 3EMQA 3GXTA 4NU7A 4D6EA 1TR1A 5EX0A 2Z8QA 2BGNE 3HU7A 2O5DA 1FWTA 3NM3A 3V7PA 2G1DA 2NUXA 4P7QA 4Q0BA 1JRCA 3W3SA 3SECA 4P7NA 1GAOA 2AGKA 2B9EA 5KT4A 3WFAA 3SAZA 1CGWA 3AYSA 1KFDA 3W4RA 1KXHA 1OB0A 1UR9A 4B9ZA 3X3UA 4H2CA 4DPTA 2PEBA 5AYZA 4F2SA 1HFBA 1W1PA 2JVOA 3TQVA 2VURA 5KFNA 1E70M 4P74A 3W6LA 4ZVUB 2OLAA 2XM2A 4U3AA 2M70A 5A8PA 3GP9A 1TR0A 4JFSA 1R86A 5DT5A 3RAQA 5T7LB 2C2OB 2K06A 1SKRA 4LFBJ 5K9XA 1QMLA 5G1MA 1JCNA 4LS2A 4L6V3 3BQ0A 4QCEA 1GG0A 4NP7A 5GAEI 3T6CA 5MAOA 1XQLA 2XIIA 4FLSA 2GVZA 1UIPA 4CU6A 3DH7A 5A6KA 3P3DA 3RG6A 3C6CA 1JLGA 2Y7EA 1JZ6A 4FKYA 3A8JA 2Y63A 4F0SA 3OYXA 1HD1A 2BBEA 1SH0A 3S5ZA 1N5QA 7XIMA 1C4AA 2CDQA 3IM8A 2RKIB 5AHMA 3R5JB 1OCJA 4LF1A 3EXTA 1RI7A 2EFPA 3TP4A 3EICA 4CQ9A 3QKZA 2DGAA 4KWSA 2ZVRA 1OFOA 4IQXA 4Z2IA 2V6AA 4ZQOA 3V6JA 3BBCA 1S9EB 3U1MA 4CLWA 3RBXA 2KM8C 5DBTA 1PBGA 3R9LA 5FLXU 3BLLA 4G7EA 1S1TA 1ZPWX 3CCUS 2ZRUA 1RVGA 3WDQA 4WU3A 2R7UA 4KS0A 3GG7A 2EPLX 5IM51 1DTTA 3TQ0A 1RTJA 4UOJA 1KVKA 3S6EA 3BPDA 2WNNA 4UTMA 2NLYA 3RB6A 1GVEA 3SADA 1TPB1 3HQ1A 1RXOB 1M7XA 4DXKA 1PIGA 1GXLA 3VZZA 4I90A 2Y0BB 3BUVA 4DPQA 3UJEA 3WF4A 2WSKA 4DN1A 3VF0B 2GX8A 4PUOA 2Y88A 4GFIA 1U1RA 3ZWTA 4JTUA 2APOA 3N6QA 4CWBA 3W5XA 5LSOA 2MKIA 3MM5B 4LBPA 4AD6A 3R2GA 3UERA 2N7YA 5D2TA 2XVLA 3UR3C 1PTGA 2PDHA 3GAYA 2V5KA 2B8PA 1CXFA 3BM7A 2PDYA 3MVIA 5E9AA 2X16A 1RAHB 4A8RA 4HPHA 4XX6A 5I3JA 4B3RF 2IKJA 1EIXA 2PD5A 2XSXA 3RPDA 4RPFA 2WJFA 3L95X 1WE5A 3HO8A 2QXWA 4AT1B 5B7WA 3RNDA 4DV2F 3DLBA 4IH3A 3W88A 1VBXA 1P4CA 5EPDA 4Q3MA 4UTWC 4K5SA 4F3OA 1QCWA 3RW6A 4ZOBA 1FHTA 1NHVA 4NPOA 2MQNA 1UR0A 2VFRA 2F9JA 3DRRA 2P9EA 2D0FA 1UVIA 4B3MF 1HMVB 1G1XA 3I3EA 3N6HA 2DZBA 2WZEA 1XYBA 5ITHA 2J9YA 4KFPA 1BYAA 3V16A 3WH7A 4UOHA 3R7MA 1EBHA 4YVVA 3BDEA 2BOPA 3B0YA 4O3SA 5CPSA 2QMXA 2QHAA 4ROQA 3GB6A 4NRUA 3KK2A 4CNPA 1Y7VA 4MAZA 3BBFA 4Y9OA 4AX7A 3X1LB 1GG1A 1SC3B 3RLGA 3GIYA 4FZIA 1PC4A 2CLKA 3TN4A 3TNOA 1R3YA 3DOMB 3WLRA 5GNYA 2HBRB 5HSPA 1YW1A 4KCWA 5D30A 1AMYA 3UCDA 3WBXA 1HKAA 3UZZA 3PCOB 3W7DA 3STPA 3GXIA 3GONA 4GG9A 2C1IA 5A8MA 3HFTA 3LGEA 5FJTA 2G96A 2KU7A 3IBCB 4AU0A 5C9WA 4PG5A 4S3FA 2BGQA 1XIEA 4ZFMA 3M0MA 3W84A 4KE5A 3TJLA 3N9SA 3BO4A 5CBJA 1RAEB 3CQIA 4I2QB 2CPDA 4AZ6A 4RW9B 2HFSA 2B4GA 1IXKA 3MUVP 4PKDB 4FLOA 1UFLA 1H63A 4CTAB 4XD6A 1LW2A 3T2PA 2QPSA 4A05A 1AROP 1RY8A 2X7VA 5J2QA 2ZKMX 3HOJA 2IRUA 3MEDB 1N5YB 3IXQA 3WDPP 3E6EA 2QN6B 4CT8A 1P0EA 3M1VB 4REQA 2PGEA 2RQCA 2DJXA 1C0TA 3ITVA 4NYPA 3TI0A 3BDPA 3AUJA 2PZNA 1J96A 1MU2A 2PRLA 4LF6J 3N0VA 2XH4A 4DV7F 4CNYA 3OTDA 3QFWA 1VOMA 2HBYB 3SIMA 2P0IA 2H90A 2HE8A 4IPIA 2W0UA 3SSJA 1ONWA 2WLZA 2FUG9 5BOOA 3MTKA 1A3HA 1AJZA 2ZYFA 1EB0A 5FCZA 4PABA 3W62A 4UR8A 2FJBB 4WP9A 2FJKA 4JIIX 4LR9A 3C0LA 1T03A 1HNIB 2AYBA 4B9TA 2WWCA 4JAWA 4QQUA 3ZZYA 3HZGA 3LCIA 1GQLA 1FA0A 3VFCA 3A6OA 5E09A 1OZMA 4DG1B 5HDRA 1B0PA 5HI7A 1DY3A 3QGAC 3M2VA 5DY3A 4ZQRA 1NFGA 3R13A 4OMFG 5C6MA 4YDXA 1EC9A 1NO8A 2CJQA 2FZDA 1S5TA 2QJIA 3PZQA 2QKFA 1S4EA 2JF6A 1KLYA 2QCFA 3MOZA 1O6XA 3Q94A 2H51B 3LALA 2YYUA 5FEPA 1URRA 5H9FJ 3V6HA 1C8VA 2EVZA 1B0IA 1FP9A 3W27A 1NM2A 1H2JA 3Q22A 4C6BA 2IPOB 4X2BA 1MWOA 2QR6A 3O9NA 4XDDA 6PTDA 3M16A 4HNUA 2OUGA 3KJFB 3CUNA 3SCPA 1XEZA 3QGKC 4RK8A 4DR6F 4DYJA 4LREA 1ADOA 1REVA 3TJXA 4OYMA 5BRQA 3C16B 5KETA 2K3KA 2H1YA 1EHWA 1OGSA 1AQMA 1BRLB 3AIEA 3MSYA 3K5MA 1PJ9A 4FOKA 5A6TC 3CCJS 3AAWB 2XN1A 4RW5A 4PH6A 3N4FA 3CIZA 1VB9A 2VCBA 4ALDA 4ZDNA 3T5LA 2UVVA 4JEQA 2YKKA 5IQQA 4H8UA 1E9IA 2E5DA 3QY8A 3W66A 1CXHA 4NYOA 1L3VA 1XS2A 1IEVA 3E01A 3GVVA 4ADTA 5HVHA 1I2QA 4GZJA 4H1ZA 2FTPA 2B51A 2HLTA 3HPZA 2NZCA 1AK5A 3APGA 1SQGA 1J0ZA 3TEGA 1YIJS 1FXLA 1ME9A 1A6LA 2MKSA 4OYZA 2HBXA 4KW2A 1IWGA 3R1ZA 4OYBA 3DHUA 1D2KA 4LUYA 2W1BA 2XM3A 3B06A 1NPRA 3EX4A 4M1RA 2XNQA 4ZVPB 2GJXB 4HQVA 4QGCA 3GQYA 4KERA 5LXRA 3OGVA 3OUYA 1FJGF 1SZGA 1IR2A 3H2LA 1VJZA 2J62A 3NLCA 3QT6A 4S0MA 2BOGX 5C42B 2YKMB 3S9IA 3BGRB 3R7SB 4IXXA 1C29A 2DT3A 3G9CA 2BZ2A 1K1QA 3LQGA 1NSJA 4O8RA 5F0WA 3YPIA 3VIGA 1OQFA 1HWJA 2BQRA 5F0UA 4XAKA 1TZ7A 2R8KA 1W8GA 1OVDA 1S0OA 4N4PA 2Y70A 4BA0A 2E5IA 2DISA 4M0XA 1G7CB 4JKMA 1NDZA 2AU0A 1FTCA 8A3HA 4F4KA 1JI2A 1FD8A 2D23A 2POTA 3FSXA 3DUGA 4Q0BB 4I6AA 2INFA 3CJ5A 1U7LA 4O15A 4LU0A 2J8FA 2VBZA 2BXYA 4B3RJ 2HMCA 5DZ6A 5K2ZA 3NG8A 4C6QA 1VC5A 3HZEA 4DV2J 2CYYA 2J7FA 1VQKS 1LWJA 2QCCA 3GHUA 4H6RA 4Z7YA 4NX5A 1U6BA 4I6VA 2PS2A 5DXYA 4CD5A 2VEMA 3AROA 3NQGA 3W6MA 1U5JA 3TJIA 2QL5B 2QCDA 2C16A 3C0JA 3NQAA 4IH6A 4RW4A 5DO2A 4B3MJ 2I5QA 3GCWP 2GOUA 1AH3A 1CC7A 2GVZB 2K2PA 1Q85A 4O0KA 3W38A 2D3O1 4KIRA 1FEEA 2HNYA 2EJ1A 3ME3A 4CLZA 1MMFA 4F4AA 4OUIA 3DLKB 3KLIB 3T55A 3QWPA 1L3TA 1U6ZA 3BPSP 1Y10A 3RAMA 5BU6A 5FESA 4P8XA 2VBWA 1B31A 2WJDA 4X9YA 2GDUA 5C7HA 1XLLA 2LDIA 4WVXA 2PTYA 4MOZA 1T5AA 1FWLA 3ENAA 5JVGQ 5C55A 5IHRA 4GNVA 1KRCC 3W1YC 3S2LA 4G7EB 3CUIA 2HWHA 3C5QA 4JIHA 2BKOA 3S2JA 3PR5B 1QVFR 3I3BA 4E8CA 5EU9A 4KQZA 1DTTB 3VNKA 3IBWA 1KFLA 3UR7A 3PPFA 4L65A 2BOFX 5EB8A 1L8NA 1QAYA 2MQMA 4WFZA 1YTYA 1Z6KA 4LSNB 4E98A 1DJYA 2K8GA 4F8XA 1W5OA 1A5CA 4GY0A 1GW9A 1KR0A 4MKSA 5KG0A 3A5VA 3H2CA 3OQ2A 2OG9A 4MKAA 4I8YA 3JW7A 4HOXA 2JWNA 5AZ1A 2AMXA 5CAAA 4PUOB 2ADAA 3OGSA 3HB9A 4HU3A 4WF7A 4NJJA 1F5BA 4NCAA 2J7BA 4MUZA 1MQPA 2BTMA 3GHTA 2R8WA 5FF7A 3IS9B 2A6LA 4XZ9A 3LAKA 1ZJAA 3I7SA 1EX1A 1XRVA 3EWYA 5KFBA 1YDNA 1CDGA 3VABA 2HPMA 3W7QA 7TAAA 5EY5A 2NV9A 1HX0A 3KS6A 4UOFA 4J9OA 5DCBA 1XYFA 4ED2A 2HISA 1RCQA 1TTJA 3GDTA 3L4WA 4DV7J 3UWWA 3FEXB 1QK2A 2HQCA 2ZUSA 2O01C 5AC6A 4V1XA 2HQDA 2CQ1A 3BTNA 3N34A 1L5UA 5LZLA 1PZ1A 3D68A 3I56S 1M1KT 3R5GA 1JNEA 3IVUA 5C8BB 3DRRB 4MZ1A 2F8MA 2QIIA 3IGVA 1G7UA 4HCLA 4IFVB 1UP2A 3XINA 1J27A 3P80A 4UQBA 2C1HA 3BG3A 2Z29A 4NAEA 4J5NA 3EWCA 4WXZA 8RUCA 1LW0B 5HUOA 3H98A 5J1NA 3CJ8A 2KRRA 2P10A 1NKBA 1XMOF 5BCAA 4F3HA 1J93A 1DARA 1AD1A 1VBGA 4PRFA 2X41A 1NU5A 3FXYA 4DXXA 4US5A 4B91A 4IPLA 2HG4A 1NJWA 2ZBIA 1VYAA 7AT1B 4BHQA 1X5SA 2N4CA 4QW9A 4B02A 4A8OA 1ZZMA 2FB3A 3OFHA 1B4EA 2A0FB 2VC6A 1GYLA 3BJSA 1KWMA 1R0CB 2B0MA 1YTKA 5H6HA 1T7PA 1AXQA 3DGPB 4ZP9A 5SUHA 1XLEA 5DT7A 1EKRA 2O1PA 3N6MA 4NCGB 5B0EA 2ATLA 4IGNA 1REQB 3UJ2A 4UTKA 3KLGA 4DWSA 2KRBA 1T7LA 4DR6J 1IV8A 2HIQA 1FWEC 4W85A 3OL8A 1CS4A 2AWZA 4TU9A 3I0RA 2XG8A 3HT0A 3PHTA 1V5IB 1VBKA 1ZM3A 4TNOA 4V2XA 3S6TA 3OVAA 1V0LA 2B7QA 2GJLA 2VD8A 4LSZB 2NQZA 4M94A 4HPGA 1S57A 4LRDA 2E77A 2YXGA 1C8QA 1FHVA 1TMQA 4QPTA 1SL1A 1JR1A 2JE8A 4ZLNA 5KFXA 1CBKA 1QVBA 5J2QB 1SU5A 1RAKA 2CQBA 2P1FA 3R5BA 5J1EB 3INPA 3WDIA 3W8PA 5DLFA 3HGJA 4REQB 3TVAA 1TPVA 2LFVA 3VCDA 1JZ2A 3PFOA 3FRYA 4NJHA 1UOKA 2ZRWA 4QIFA 3V1PA 3ZM8A 1MU2B 4AZIA 3EEZA 1GZ1A 5I3UB 4JIRA 5E7OB 2XBPA 3OU8A 4KRTA 2DH3A 3GTXA 4ATNA 5LSRA 5B09A 3FA4A 2V8HA 2H48B 1XKYA 2KXFA 1V3MA 1ZENA 1FJGJ 2QG9B 1SC1B 5J2NB 1NZ8A 2NX9A 1FI4A 1W17A 3P3BA 4ZHRB 4JTFA 4H83A 2AHOB 2D1CA 3OB8A 1UTAA 2VGBA 2GWNA 4Y9NA 3EZUA 3NS7B 1HW6A 3VIKA 5KZ6A 1ZA1B 2JFEX 3E2QA 3TCEA 3MUIA 2A79A 2O9TA 4ZODA 2P8CA 3PTQA 3U5YA 3GV5B 4DL3A 3KLVA 4UTUA 3QTGA 1TPDA 4LV4A 4B9UA 3BLKA 3MM7A 1OSEA 5A8KB 2OPJA 4D71A 2J7CA 1DHMA 1JF5A 1Y8BA 3MI6A 1CECA 4P61A 3UY7A 5AHIA 5AXMA 1TSIA 3IC1A 3IIOA 2X40A 3UR5A 1KQKA 2VWTA 1N6QB 5GADU 3HSDA 1QPNA 2ZD1A 2OCZA 2XTKA 1XV8A 4HMCA 4XTDA 3SUVA 3W24A 1S79A 4P7RA 4DAIA 3U0HA 3VKDA 1EHNA 4NLRA 6TIMA 3AHXA 3PVFA 4H9MA 4RZ4A 3GV8B 5CEWA 2OLSA 4PCNA 3WEMA 1HR0F 2D1ZA 4PTNA 4Z37A 4YB5A 1Q7QA 2Q02A 2OX4A 3UNGC 3IA0A 5GJNA 4GZIA 3CAKA 3TANA 3RJMB 1UVJA 3ARQA 3T9NA 2J9CA 4YU1A 4DV6F 3SQMA 2RHSB 5IOBA 2KFYA 3IRWP 2IBKA 1ZALA 5HNTA 6AT1B 3BKTA 3WL0A 4OX6A 3RO6A 5AE1A 5I77A 2RSQA 4BI7A 4TLRA 3PR4A 5HVFA 4XVDA 4K5RA 4B9MA 1UR1A 2HZGA 1DJHA 1V8EA 2QMJA 3F41A 5AHNA 3WNOA 3GIIA 4ED0A 4QR0A 3GG1A 3S83A 1J0KA 3LP1B 2O0TA 2X1IA 1M04A 3A23A 4ZB5A 2FLNA 4V19J 1I75A 4IOTA 1VQ5S 1UWAA 1BQNA 4QM1A 1KC7A 3BN7A 1BE4A 4NZ1A 3WHIA 3P6LA 2ISFA 2COLA 4ZGYA 1FESA 3W1XA 4ZB0A 5LMUF 2HVZA 5AOUA 5GAHU 5AFDA 1ML1A 3G0UA 1NU4A 3GRIA 1WO2A 4J3XA 1RE1B 1CBGA 1CI1A 3QRQA 3OFEA 4DRSA 3FFSA 4ICMA 3GMGA 1W6TA 4PMZA 5IDIA 2EPOA 1QNSA 4QG9A 5F9NA 4X0VA 3N6LA 2PF8A 1V3LA 3C66A 2PC4A 4A8KA 2DEPA 2ZTKA 3CV6A 2CHOA 1RKIA 2HHVA 2XZTB 3R8HA 4PCQA 4QJ4B 1Q63A 4IG2B 1GUVA 3VA8A 2CZVA 2BDPA 1JXEA 5D2WA 3TROA 4PTMA 3PG9A 3M2UA 1IWAA 2Z1VA 4X22A 2J0WA 1PJ6A 3UWTA 2QF8A 3TN6A 1KR4A 2V30A 3J81Y 3NAHA 4M7SA 4D3HA 4ECSA 1OG6A 2QYCA 1AYEA 3D6NA 3RAXA 2OPSB 2H54B 1TJ1A 2ZHOA 3S6OA 4U4MA 5GPRA 1S5ZA 4JNYA 5C9ZA 3MR7A 1ZHAA 5EBAA 2J77A 1TUGB 3OPKA 3HFKA 4E2FB 4OX8A 3QKEA 2RDUA 3D1QA 3QM3A 5B7YA 1IIGA 1B4SA 1W9DM 1KQZA 1LWFA 4C3MA 1GVRA 2GUYA 4D2JA 4LUTB 2BKPA 2X51A 4L1GA 4Q8UA 1QI5A 2WKJA 1K7XA 3L5MA 2H5IB 3PUOA 4MGGA 3WH5A 3UD3P 2G4BA 1EB3A 2M8HA 1KFEA 2CPHA 4DCJB 3L2IA 1T41A 1BXBA 3A3HA 3OP2A 2XWXA 2GHPA 2ZNYA 1XMOJ 3TVYA 1PX4A 2XZ7A 3O05A 2E5HA 3FMWA 3M0VA 1J2BA 1T9TA 3U1LA 1AUSL 2YXOA 5EWEA 4C6PA 2JLEA 1R0BG 2BJ1A 5T41A 3R12A 1EQPA 1HKWA 4R7JA 4LVBA 3SCWA 3IGUA 3EPMA 1NHUA 2KZHA 2WPGA 1SC6A 1RAOA 4EPBC 2A5HA 2JALA 1YJ9S 2GOKA 1HHTP 2RJGA 4FIQA 1AVAA 2WHKA 1FKPA 1QK0A 3QW4B 3US5A 1L3KA 4Y7EA 1D3WA 3QIDA 5KSWA 5FLXY 1K9TA 4GD0A 4QNEA 2NWSA 4S3KA 5TIMA 5A2QU 3J80U 3QJJA 2ATMA 1IM4A 2BVYA 1FWBC 2L9WA 4DS5A 1VFOA 3KK3A 3ZS4A 2FJWA 3NNAA 1SJ1A 1VQYA 4LF5F 3AFBA 5H9EK 3SM0A 3KHDA 4LBIA 2PCEA 3WQGA 2VFHA 3T78A 1RJPA 4YXGA 4XDCA 3KCJA 1T9XA 1XCWA 2YCKX 1KOHA 4WGHA 1G9HA 3ATZA 1F3FA 3GCXP 4DUZF 4L5ZA 3UZ5A 2PDAA 1MO0A 3UG8A 1CGUA 3PO5A 2J25A 2QQ6A 1Q4WA 1JQVA 2PDGA 3CV1A 3PAOA 4MLJA 2XZDB 5C24B 1UR2A 4ECYA 3C61A 3VCNA 5LIWX 2RD5C 2XLJA 2WANA 4Q33A 4MKBA 1FRXA 1V02E 3ZVHB 3C0QA 1MUMA 1O60A 1X6LA 2Z57B 1NDYA 3M0HA 3WCZA 2F9RA 2CXEA 2FVPA 1I4NA 4C8KA 2DO4A 2ISVA 2B7BB 4QRNA 3KG4A 2CITA 3GVRA 5FKYA 1AQ0A 2DBBA 2QTWA 2R3VA 3LV6A 4OL8A 1O51A 4YB7A 2PU0A 4HK5A 1XMQF 4C90A 3GYCA 3N4WA 1FDBA 2E6DA 1NARA 1IBKF 2ZQ0A 3G1DA 2KZZA 1U1UA 3GW3A 2MB0B 4H9YA 4S3EA 3PWAA 2ALZA 1I9CB 3KLFB 1YJWS 1JYXA 4USWA 1TPFA 5DMNA 4LF7F 1Q6RA 4B08A 4LMZA 2QUTA 2X3DA 4GO9A 2QMUB 3DM2A 3VUSA 2DR5A 1S48A 2RJHA 2GGPA 3CGIA 3BCJA 2DGXA 5GAGI 5BMXA 1YG0A 4NEZA 3EGNA 3ZXWA 3WNNA 5D4YA 1FBAA 3I3DA 2G4FA 3BREA 3I31A 3SDEA 1FUYA 5BR8F 4JXCA 1HR0J 1OFAA 4RKUC 4NRSA 4C91A 2Z2ZA 4HH0A 2JKPA 4MDPA 4BCAA 1QOPA 1V0NA 4WKHA 4EPDC 1DBTA 3SRFA 1OT1A 4IH7A 3WH8A 1AH4A 1FT8A 3ONCA 4JFWA 5CBIA 5AT1B 4FOUA 4DV6J 1K03A 3AOCA 1BQGA 3BGAA 4L80A 1T05B 3P8JA 1BKHA 1PPIA 3PO4A 4PA8A 5DCDA 5E0FA 1R0MA 2I56A 4WZMA 3G87A 1EA9C 4RR5A 3IK2A 2V82A 4ADSA 1LOLA 3MDFA 3CMES 3VVTA 5D9NA 3AJ7A 2IJRA 3PACA 4OOUA 1RADB 2WSYA 1KM5A 4JTCA 2PDKA 4H8VA 1VYSX 5AC4A 1JCYA 1KFKA 3WLHA 1ZA2B 3B4DA 1TKDA 3B0PA 4WDWA 2Y4SA 5LMUJ 2DW7A 1DTQB 2ZKTA 4I56A 1M5KC 5LA2A 1A49A 5AXKA 2J76E 1PXGA 1I1GA 4N76A 3CYVA 4O19A 3CHVA 2VFSA 4JQ4A 4JTQA 2J13A 1P9YA 2D0HA 5KG5A 4BF9A 2HK3A 2ZA1A 1XIIA 3IBFB 4O14A 2YWGA 2KYZA 1QATA 2A3EA 2FVKA 2IY5B 4PYAA 1ECQA 1R9XA 4ZJOA 4P71A 2CYGA 3VK5A 4HT5A 4AVFA 3HVWA 4X60A 2JEIA 1XYZA 2UUAF 1LUCB 3GE7A 2BBFA 4DUOA 1X38A 1DJXA 3NXFA 4L73A 1PILA 4HHHA 4DO4A 4A22A 4JCLA 2A2DA 4O0QA 4Q7AA 3VAIA 3LP2A 3VOJA 3MM7B 3R4IA 1GKRA 3HPSA 4DM2A 4LSBA 2CFXA 3BJYA 4LRBA 4JI4F 4ECXA 3I5BA 3FHAA 1HBUB 3M8RA 3LERA 2I5JA 3NQEA 3S1TA 4GKTA 3TAKA 4DSIA 4GIEA 2WKGA 3GNPA 1DWFM 3AO0A 1X4AA 5FDLA 4R7OA 4A4JA 1SZFA 1A50A 4QHRA 2BW7A 2OTJS 3RR1A 1DXEA 1VENA 3UJRA 4A3RA 1EJUC 2H5EA 2X1GA 3GUGA 2HMIB 2FB2A 3EOSA 3ZZUA 4F4WA 3SUUA 1BWEA 2IFXA 1TVPA 1S0NA 4UZBA 4BKNA 3S2MA 2FLPA 1DHKA 3CCTA 1XLGA 1ZUAX 2HROA 2VYOA 1EQMA 1BWVA 2E6FA 1I3OB 3L4BC 5BOFA 1LLWA 2VJXA 2Y5EA 3QZAA 3LRKA 5DMLA 1NQ6A 2GQ8A 5JMUA 1XNRF 3FA3A 4C11B 2WZHA 5MKGB 4U33A 4GUIA 4GZEA 4QU7A 1FQ0A 3QY6A 1TWWA 4P8UA 5CPQA 2OAUA 1FVPA 4NLYA 3EZOA 3QTPA 4HU0A 4P73A 4OI4A 4NXKA 2QSWA 3LBOA 3HHLB 3PFEA 4CLLA 1G1YA 3T1GA 4WKAA 1NTHA 3DLEB 1XDJA 5BXTA 4OYXA 1DAXA 2EG2A 1KHWA 5JVHQ 2ZDRA 2J8TA 4ETZA 3EDFA 1WC5A 1HQ2A 5AYYA 1TX2A 4UTTC 1F4AA 2B7CB 3KL0A 7ODCA 2VENA 1D3GA 4QBUA 1J10A 1RHRB 5E3QA 2CJKA 1JXJA 1QT1A 4WJ8A 4IRCA 3OJGA 3QXBA 3TYEA 3KWSA 3E02A 1IT8A 2O4MA 2PD1A 4OX7A 9RUBA 3Q24A 2OMOA 1LWHA 4LF5J 3PZMA 3BZJA 2XO6A 5AE3A 1FDZA 3ANUA 2CKSA 3GDRA 1OYCA 2WB4A 4KIAA 4K37A 3NCQA 3R10A 3W7GA 1F2HA 4IH5A 4DJFA 2OWCA 3J7HA 5LA1A 2DB1A 5U7SA 4F25A 4DUZJ 2VBYA 3QBUA 3UXIA 3CTLA 4HNNA 3RU8X 1HL6A 1OSDA 2GQ9A 1ITCA 5J5RA 4JOMA 2FZKB 2VASA 3LTOA 4FZVA 5L39A 2FQIA 2G4JA 1MW1A 4YJ5A 4RLIA 3C0SA 4YFUA 5LIXX 4V15A 2HTMA 4PAAA 3FKBA 2D74B 3MP4A 4C1KA 2JC0A 1PGZA 1YNPA 1SJCA 1CXEA 1WP6A 5HQMA 2RVJA 1XIQA 3W23A 2B5JA 3PZIA 3GNRA 1PZ2A 6XIAA 1HKJA 5HL7Q 1NJZA 2FGOA 1E0UA 3W37A 3ISZA 4CM2A 5HVGA 1PHQA 3LV5A 5HROA 4ZVQB 2FTYA 5C9RA 2CHRA 1WOBA 1XMQJ 3A1YG 2DXDA 2IMOA 3VDCA 1IBKJ 3WC0A 4R53A 3G8EA 1JZ5A 5KFIA 1IR0A 3TOYA 1W37A 1NDWA 3V35A 1PO6A 4ZCKA 3GD6A 3RCNA 4HEA9 1E1CA 1M5SA 5KFYA 1SIZA 1SC4B 3NQ8A 2EO7A 3LXCA 4LF7J 1QPOA 2NLWA 3B8VA 3HBLA 3IMQJ 2A85A 3CJRA 1IE7C 1GVQA 2WVTA 5CC5A 1RY0A 3PWIA 2V8ZA 1J0HA 3RLVA 3GWQA 3CLWA 2YA0A 3HGOA 3S7RA 2DZTA 3BV7A 2GGHA 3QV9A 4DI6A 2VX7A 1PC5A 3AHTA 4ECLA 1ZP3A 5BR8J 3FS2A 3QSYB 4U8VA 3MUXA 1EF2A 1GOMA 2ZH9A 3MJYA 3PJTA 3DIPA 4HZMA 4HACB 1RK5A 4U2YA 4B9SA 4C8LA 2PMWA 4GBDA 4NLUA 3EWGA 4D3GA 5EWGA 2BHYA 3GZ3A 1E6NA 1XYAA 1X8FA 4XSMA 2CQIA 4L56A 4AWUA 2MZ1A 4QP0A 2Z1BA 3UN5A 5CKSA 2B6AA 4USJC 2ZM6F 3OTCA 1E40A 4MAKA 2AEMA 4I9TA 4KR0B 1JPMA 3D4JA 4Q6XA 4YDDB 5IFPA 4IHCA 2L5HA 2GJFA 4C60A 3D6HB 1OCBA 3LCGA 4A8QA 1NB2A 4M5PA 3A12A 3E0VA 3N2TA 5EBUA 1D9DA 3PNZA 4TXEA 4FNRA 2DVIA 4TTUA 4X4NA 2YBVA 4FKXA 2BLEA 1GVIA 2V5LA 5D77A 3QHNA 5A6BA 3Q65A 4O3RA 4S38A 2VPXB 4UFMA 2R7SA 2PE4A 5KFTA 4W87A 1K7EA 1CG2A 5HNRA 1GOQA 4ZR8A 1N33F 1BYCA 5GQBA 4ED7A 3K59A 1VC4A 2RF2A 3VTIA 1TQLA 1ZAXA 3L7UA 1JK9B 3DRPB 1VEPA 2UUAJ 3V1HA 4EPEC 2F1FA 2Q3OA 1PX8A 5A3HA 2NUHA 4MMWA 2HWTA 1IBMF 1JZ4A 1YRXA 2V5HG 1VBJA 3HI9A 4CH1A 4NKCA 3ZLHA 1U1HA 2VFIA 1PKMA 3VKAA 4PMJA 2UUBJ 1W3IA 1JVNA 3RUBL 4ID5B 4V1Ak 3CJ4A 4JI4J 4ES4A 1KV8A 3WQ6A 1IGWA 1NSAA 1KGUA 1E4LA 4QWDA 2A3LA 4Y8EA 4V19X 5U4NA 3LWMA 1TV4A 2XMAA 1R8BA 1ZTTA 4RBUA 2BE2B 2LXFA 1OK4A 1Q6GA 2QGFB 2V3EA 1RD5A 2HHXA 1KBJA 4F4XA 3GIQA 4P52A 2R7TA 2L41A 3OPSA 3O8AA 3ZO7A 2GGIA 1T8QA 1J9YA 1QHPA 1HP5A 5K3VA 1FK9A 3E49A 4DBWA 2RH3A 2Y1RI 1C8YA 2OO6A 2RU9A 3NOGA 5JBDA 2P9CA 2CPFA 3V36A 2Z24A 4ACZB 2DY9A 3A3NB 1MSSA 2XIJA 1XNRJ 4UQCA 5DANA 3PKMA 1ROFA 1YZ6A 1LEOA 1R9ZA 1VHFA 2E1AA 4C8NA 4N5SA 4FDFA 4S1FA 4E8UA 3TX9A 2E6YA 5A6WA 4O4VA 5ETPA 4R7WA 1NKCA 3C2PA 1AZ1A 3S47A 3WL1A 3B8DA 4DX8H 3KTCA 4MM1A 1PG5B 3RRAA 2WM1A 1VRUA 4N0RA 1HPZA 2UWFA 3V4MA 3E0WA 2AZ3A 2QV6A 4AL6A 3FCVA 2MTLA 1LLZA 5HAOA 3L4YA 1YZ7A 1K8ZA 1QPKA 2ZX8A 4IF2A 3KJVB 4ZTXA 1NM9A 1L2UA 3NNCA 4LFAF 4WIIA 3DFYA 1F6TA 4AD2A 3IG1A 2ZZNA 2YDQA 2U2FA 3B8WA 1W1IE 1YEYA 4X4SA 3UWZA 5C5YA 4K2SA 3CC7S 2LDYA 1MRAA 1RTDB 2PFFB 2ZC1A 3EOUA 4B9YA 4M6PA 3QC0A 1UQYA 4BS2A 3UXLA 4CO2A 2OT0A 1OSCA 1FJCA 2OO0A 1XBXA 3TUJC 2CQGA 1KBKA 1E56A 4V27A 2HBZB 1UPMB 5LHEA 3NNHA 3BGJA 3B0XA 2IRYA 1QO2A 2VFUA 1RBLA 1GH8A 4IIDA 2XYGB 2VQUA 2NW0A 3LP2B 2VVSA 1VEOA 3W7RA 2W2MP 1KTVA 5FEZA 3VIIA 4WR3A 4DO5A 2O7QA 2HQIA 2V5DA 2OR2A 2BDQA 4OBSA 1FXQA 2XS5A 3KZSA 3NSMA 3CDEA 3TOQA 3M9MB 1JJKA 1J5SA 1X1OA 1WKDA 1YE6A 2EEXA 3FNDA 5ENLA 5C70A 2I1OA 1DJQA 3CJKA 1G94A 2IIHA 3H0PA 1GMUA 3WK2A 1DLOA 1BQCA 5DG9A 3OJSA 4H2HA 4PWWA 2A6OA 4QISA 2Q01A 2E66A 4KWOA 3W61A 4NZJA 2XFFA 1BKSA 3CIVA 3R11A 2PDMA 4AVOA 2G3MA 3UGRA 1R0AB 3CZJA 3HXMA 5ABTA 5GVJA 3SSZA 3VQSA 3NSNA 3TA1A 3QSRA 5DEZA 2HFZA 2MEWA 2X7WA 1SKUB 3OR2B 3DYMA 3VD9A 2V5CA 4ED6A 2VFEA 4OLOA 4M1KA 3LPYA 4D6CA 4EYHB 1JIBA 1EXBA 4HU8A 4DSLA 3H7RA 1XIDA 4KH2A 4PYSA 3IWNC 5IDZA 1RV8A 3SQOP 1WOPA 2IPJA 3POHA 4DZAA 2NQPA 1M9HA 4HMNA 1VRXA 3VD3A 2YBTA 3OL6A 2HVNA 2E7VA 5TBOA 3UCCA 2B8QA 3ANVA 3W64A 3VGTA 2XFYA 1JFXA 2RDWA 4JHZA 3KVJA 1BHNA 4TY8B 1G3OA 2YWKA 1GPWA 3I5AA 1OYEA 1VJQA 2D41A 2OI2A 4DVOA 3MEKA 2NPFA 1QHZA 2X0HA 3PZNA 2R1MA 5KMYA 1TMMA 1OINA 3VR1A 2FZCB 2ATCB 4OZ3A 3FVMA 2D0GA 4AWSA 2Y0FA 1RTHA 1QM9A 5CC3A 1ZBKA 2A7NA 4M5GA 4Y0FA 2V2DA 3O7UA 1M68A 1VQPS 4POCA 1DJGA 1VFHA 3MMUA 1TZ9A 4JYEA 8XIAA 3F73A 3H7VA 3QF0A 1UR3M 1VAHA 4CQAA 2CPJA 1RT2A 5GMDA 2R8IA 4XZHA 3PJWA 3VWSA 2ZM6J 1PKNA 3MZIA 2BVTA 3K8VA 4LXFA 5I00A 5CBBA 2E7FA 1WHVA 4HHJA 2IVFB 4CP5A 2IDLA 1WEYA 1FNXH 2VFDA 4NAFB 2VA3A 5EX3A 1XQIA 4RW6A 4J3WA 1A5SA 3HSZA 4WJXA 1BHGA 3SGUA 1Q45A 5IV4A 3PTDA 1YMYA 4QX4A 1WD6A 3DC2A 3SIPB 4ES1A 4J2MA 2B4PA 3VYLA 3PBWA 1Q95G 5A8OA 1E6VA 1GQNA 3PFMA 3CVKA 5HANA 3VM5A 3QYQA 3ZZZA 3BQ1A 4EAYA 1U48A 2HAIA 4YPJA 3IGNA 4S2BA 4JI2F 2Z7GA 4AL7A 1BTCA 3RXZA 1YPXA 1N33J 1WKKA 3VIMA 2QIWA 4X61A 2B5JB 3VQTA 1UMLA 2HCVA 3ZZPA 3WLNA 4K3ZA 4R33A 4UUIA 2CBIA 3P5TL 5E3RA 3WZ0E 4P6QA 4NZ7A 2FIQA 1IBMJ 3CDUA 1DQAA 1R7IA 1DJIA 1RJRA 3TFXA 2C2MB 3JSBA 1E1CB 3ZTRA 4EE9A 3G24A 1FHUA 3FY1A 3WQFA 1XH2A 1LYXA 4FF3A 2V2KA 1TREA 3B9DA 3U8GA 2VVNA 1LKZA 4M81A 2I7GA 4GPNA 4IMEA 4BZYA 1S1WB 4J3UA 2ISWA 4X4QA 5IT4A 3TWZA 4MFDA 3ZT7A 1ZS6A 1JDDA 1MUWA 4JPGA 1FWGC 2QJ3A 3KP0A 2CKRA 2OU4A 1ICEB 3UI3A 3PZUA 2JFKA 3AIUA 2C14A 4QR2A 5CZVA 3B8UA 1RT7A 4OV6A 1VYRA 1BAGA 2Y8KA 5C7PA 4AW7A 3V0UA 4B92A 3NXLA 3QH2A 1TB3A 3SQGA 2I5GA 2PC6A 2CQDA 4HYRA 4AZHA 1FWFC 5I3IA 3ET6A 2ZOGA 5A2QY 3J80Y 3V81A 1XSKA 5KT3A 1UKTA 1F3EA 3MM8A 3L2LA 4EPKA 1C1CB 4ZVGA 3AYRA 3L12A 2NSXA 1VQ8S 1QW9A 3K1DA 1EPXA 4EK7A 1WKLA 3NO1A 1I0DA 4HYVA 1OX4A 2Q8ZA 2B6AB 1TPUA 2ESCA 3P5ZA 4H4KC 1SJRA 2VKZG 4CEXC 3MS8A 3RHGA 5C25B 4BWJA 1E9YB 3K58A 1F76A 5D9OA 3M5ZA 3R5DA 4QPXA 1QLNA 3N4AA 1XIGA 2MHNA 1PTDA 2V3FA 2WZMA 4LYRA 1GOOA 4XISA 2B9YA 3KBWA 4AF0B 2EPMX 3TLLA 4ID8A 2BXJA 3SBMA 1OFEA 4KQNA 4LFAJ 4BQ4A 1T40A 3F4DA 4GACA 3GPAA 4OHXA 1PV8A 3MV11 1RWXB 1YDVA 3OBIA 2ZCGA 4K4SA 2KT5A 2NSOA 3JR2A 1P0NA 1T6MA 1H11A 3ARTA 4GJ1A 5B0FA 4WQ6A 2GFFA 3D6FB 1ZH5A 3UNDA 2D3NA 3CXOA 2RF2B 4N42A 4G1PA 2V4JA 4B5XA 2R7WA 3W75A 2DNRA 3EWXA 4IFYB 3R89A 1RT5B 5DG7A 3AHVA 4IR1A 1CVJA 2CNCA 1EHAA 3RX3A 2BE9B 3Q23A 3K5OA 4DZDA 4GUHA 1LWCB 3VD5A 3GX9A 2WVSA 4QIEA 1XNQF 3D9BA 3MV01 1H51A 1F6YA 1OT2A 4N56A 3AIRA 2G0JA 2PBGA 3R8GA 4B3ZA 3UD5A 4RDZA 3W29A 3EYZA 1E6QM 1PB0A 3EWWA 3MKVA 1U1LA 1LBMA 4Q8TA 4DJED 4HDHA 4CI0B 2QUMA 5CYMB 2WSPA 2VHLA 2VQFF 4EF8A 3VD4A 4F3QA 2YBUA 2PFDA 3B82A 1TV3A 3AS2A 5I78A 3QZEA 3AC0A 1GX5A 5LOQA 2C2EA 3WN6A 3W2VA 1MLAA 1WXYA 4EAMA 1SFTA 4MJ4A 2YNIB 1R87A 2VM8A 2VJUA 1S6PA 1WXJA 1I94F 5REQA 3C46A 1L6YA 4E8DA 3B0UX 3SB0A 4UNKA 1X9MA 4RR4A 1UOZA 3DAQA 1N56A 2FY1A 6ALDA 1DIOA 4AXNA 2J6VA 1F3TA 4OZNA 3CPWR 2RDXA 1WZLA 4B3OA 4J90A 3HO1A 1P0BA 1MMLA 2RGLA 3HVRA 3QN3A 4UTGA 1S1RA 2QAPA 3VGGA 1CC8A 1KW1A 3KHJA 1TL7A 2XMWA 4RV8A 4F9JA 3L3CA 2C2KB 2CJ9A 2YJQA 4IOBA 3K30A 2BKNA 1F9HA 4C7GA 3WLQA 4N6EA 4BCEA 2VG5B 3WX7A 2C1EB 4DZHA 3GY1A 3W2MA 2OYMA 5L6UA 3CF5Q 1J5OA 4IMAA 1S3HA 4WY0A 4JY9A 1Q81T 3USBA 1Z2LA 3MT1A 5HMEA 7CGTA 4MWAD 1HA1A 1S9GB 3DYPA 3FOKA 1Y65A 1XWYA 2OFJA 2OQLA 1H49A 3FIGA 1DIDA 1PDZA 4JUZA 2Q3RA 3IG1B 4FXDA 1HFEL 3S3GA 4AZ7A 4IIFA 4KWWA 3D0IE 2XY6A 1OC6A 3EWDA 4F0HA 3SW6A 4C6EA 4GX9A 1X4DA 5I3DA 1UWBA 1DE5A 2DO0A 1TWDA 3BF4A 3M0KA 1Y5LB 4DPUA 5D8WA 5IZHA 1K02A 1VMBA 3MUMP 4XB3A 1QXLA 4FXVA 2LXUA 4YYCA 1H1ZA 4LC8A 2Y62A 1TTPA 2H4WB 2WJEA 3F5LA 2BOEX 2PC8A 5IBXA 3RR4A 2KVQE 4DV0F 4RXFA 4K50A 1IN0A 4LEFA 1W54A 1CJTA 2HGLA 2R8HA 1DQ8A 3T05A 1SFLA 1Q6FA 1BSIA 2C3OA 3VALA 3DRYA 1OY8A 1VKFA 5JMNA 3KMQA 3SCSA 4JN7A 4YR2A 2DUAA 1YJTA 3PW7A 3UT0A 3NZQA 1L6WA 1W1ZA 4OLPA 4X2RA 1J8VA 2MLXA 2V3DA 3QO9B 2EHHA 4GQGA 1BUXA 2NXCA 3HFVA 4YTUA 2ZH7A 3LD5A 1B99A 3RZAA 4JI2J 3HHDA 2QA2A 4HH1A 2WMKA 1S12A 1TMLA 3CMJA 1UG6A 3QPZA 2PGCA 2FIUA 4ZCMA 2A1BA 3P49B 3SFKA 1FRBA 1UH4A 3O06A 3U5UA 4K68A 1CJVB 1L0PA 1RUSA 2QEZA 1Q0NA 3OVGA 4E3TA 3G1YA 2L9NA 4QLKA 4CD6A 3TWBA 1K9DA 1XCFA 1XRSA 4WKFA 3D5MA 3TTOA 1XGEA 5HNUA 1NP0A 1A4LA 5F2GA 4XO6A 1B3TA 2R2UA 1P1LA 2J7KA 4HLBA 1JXLA 4O17A 4AMAA 1YDYA 3J7YU 2RNEA 1UWQA 2GPTA 3EB3A 1HBNB 3F2DA 1NOFA 1HN1A 3ARUA 4A21A 2VZOA 1DZ5A 2BYCA 3R7BB 3B78A 1J0IA 3AXKA 4TQSA 2I2YA 4OQVA 2OPQA 3I6EA 1KXQA 1ZM4A 1VFMA 3EDKA 3LDVA 3CV7A 4JQ2A 2Z0IA 3UN3A 2G0IA 3A3WA 1UQZA 4PEOA 1UVMA 1PYMA 1LNQA 2DGSA 1HP4A 5CSUA 2GNKA 2PP0A 5IXUA 1CX9A 1AG1O 4QTGA 2V50A 4MNMA 1TFVA 4YB6A 3LH2S 2AMCB 3I10A 1VBYA 1NVMA 5KFOA 5DQPA 5XIAA 3MPVA 5I42B 3CPUA 3CIMA 3K5NA 1RTHB 4WK9A 1C8XA 3VV2B 3UFCX 2M8DB 2CESA 3UZJA 2Q8XA 3UXDA 3OW1A 1Y0EA 2QJGA 3POTA 3L21A 1K0VA 1NIUA 4HNVA 3C3NA 5CCMA 2I14A 1R8LA 3BLPX 4MZ8A 4FYVB 5I3QA 1PSCA 3EPNA 2WHMA 4LRFA 2HNHA 1MSWD 4AEFA 3HULA 1S2VA 3QHOA 2X05A 4A8XA 1U30A 2FVCA 2DIEA 3CV2A 1JB0C 3U2OA 1RKJA 4A8NA 2FY8A 1RBAA 2KHDA 5F3TA 1U1NA 3MKKA 4HNTA 2CQ4A 3W9HA 4ZVFA 4LR7A 1TA3A 4QEHA 4C3LA 1UKQA 3GR1A 2F4FA 2GIQA 3EA2A 3CUXA 3W5ZA 4HHMA 4GI4A 3MCMA 3T0BA 3VILA 1EJVC 3DLHA 1DWIM 3ARYA 4YN3B 5BU9A 1U1OA 2WSCC 2I57A 1KTBA 1YBQA 4X0NA 3S2NA 4XAGA 2QNEA 4C6KA 2KM8B 3A4AA 3GIMA 4Y2KA 3M0LA 3GSIA 5CZ0A 4S2CA 5F4WA 2RFGA 1XC4A 1V6VA 4Y90A 1G4PA 2UXDF 3LCFA 2FGCA 1JUKA 2H3BA 4W7WA 4TX9A 2Z30B 3G71S 2IDEA 5HMYA 3AQUA 3MSRA 1JAKA 1GNKA 1XNQJ 1GNXA 4R88A 3CNYA 3KZPA 4DUTA 5J1PA 2ACRA 1M5OC 1Z41A 1V51A 2EFVA 4RLEA 4DQSA 1PS9A 1V7YA 4J3ZA 2KZMA 3GNXA 4RE4A 1DQUA 2ZZTA 2VQFJ 1EC7A 1AJ2A 4LC6A 1TMHA 2JLGA 1F74A 2GIRA 3AOAA 1HJSA 1HQUA 2ZKUA 3OSNA 1P7TA 4O1EA 5CQ1A 1UPPA 1ITPA 2E9MA 4KGVB 3KOXA 3PKYA 3PVXA 3HM9A 4UY85 3PPCA 3FSTA 2NX3A 1XIBA 2XSJB 1H38A 2ILZA 1I94J 2ZWPA 3SUWA 5HMFA 3CO9A 2GK1B 3U2CA 4OFZA 3THTA 2BANA 3JYTB 2D22A 1TTHB 1LRTA 3OVBA 1IKYA 5AC7A 4K4XA 3ET6B 2DYAA 3MXHP 2DSWA 1H7RA 1N82A 1W91A 5SWUA 4AZCA 2QV5A 4R0EA 1VLIA 1JZ3A 4KGKA 3HJFA 3TAOA