3KDNA

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
437
structure length
436
Chain Sequence
IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based catalytic optimization of a type III Rubisco from a hyperthermophile
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
total genus 142
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3kdnA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3kdnA01
1IR2A 3AXKA 1RLDA 4F0MA 2RUSA 1BWVA 1IR1A 1SVDA 1GEHA 2CWXA 1WDDA 2VDIA 3KDOA 4NASA 4LF1A 1UWAA 2V63A 3ZXWA 5RUBA 1AA1B 2V69A 5C2GA 1RXOB 2V67A 2ZVIA 3RUBL 1RBLA 1RLCL 3A13A 5HATA 1RUSA 4LF2A 5HAOA 9RUBA 1UPMB 2D69A 1UZHA 1UW9A 2OEKA 1RCOB 1UPPA 1GK8A 1RSCA 3A12A 3FK4A 1RCXB 2OELA 1AUSL 3KDNA 4RUBA 4F0HA 8RUCA 1TELA 1IWAA 2OEJA 1YKWA 4MKVA 2YBVA 1EJ7L 5C2CA 5HJYA 2VDHA 2V68A 4HHHA 5HJXA 2CXEA 5HK4A 3RG6A 5HQLA 1RBAA 5HQMA 2QYGA 2OEMA 3WQPA 4F0KA 3AXMA 1UZDA 3NWRA 3QFWA 1BXNA 2V6AA 1RBOB 5HANA
chains in the Genus database with same CATH superfamily
4KQNA 3W1TA 3OVSA 3MSYA 3CO0P 5C42B 4F25A 1W1A1 4PTVA 2UUBF 2TODA 3D1QA 3BSOA 3DFSA 3SURA 4N77A 3AAMA 2M52A 1TMJA 2R1LA 3JR2A 1K6WA 4MUZA 4DYEA 4HNTA 4EIVA 3KRBA 2VL4A 4EPDC 4DPTA 3S46A 3BPSP 3HIJA 4MVAA 3NGDA 3VQSA 5HNUA 3TYCA 1DLOA 2YPYA 2CQ3A 3R6LB 1DWJM 4ACZA 3KS6A 3TN4A 2QLXA 3MEDA 4AWTA 4ZN1A 2PDQA 3S1VA 1K4HA 1OWQA 4WCJA 3C2FA 1JGMA 3CHCA 2X1UA 2DT9A 1PZ2A 1Y8BA 3D5MA 3HF5A 3EOLA 1V0MA 4JI3F 3BLLA 3QQCD 4DLFA 5F2LA 3EX2A 3OQ8A 1OCQA 2N7YA 2PDYA 4A3QA 4RLEA 3KJVA 1Z7AA 3QFWA 1GKRA 1TE6A 4MB3A 3ZJ6A 1MZHA 3SAZA 3EDRB 3KTXA 4O14A 4O0KA 2R1NA 3F2CA 1O66A 2G0CA 3FEXB 5KFBA 3OLDA 1ZA1B 2Y5EA 4PODA 3WUFA 2ZOFA 4PXCA 4FF4A 4M5LA 2VPYB 1UR8A 4IFKA 2B5JA 4DDFA 4G7EB 5E9XA 3KUMA 3CDWA 3FQLA 3THTA 4DCPB 3C0SA 4HHJA 3NS7B 4AD2A 1EP2A 1LWEA 5KFAA 3VINA 3T0CA 4YS1A 4KFPA 3K8KA 4DR7J 4I4BA 2CPYA 1NUEA 5K8OA 1BLIA 5U47A 4U67Q 1QSSA 4ZQRA 4IH3A 3BJTA 2HZAA 2LCWA 3D66A 1Z3NA 2WSRA 3MMTA 4LAKA 5KITA 4JX4A 2AYGA 3GC5A 1VQ7S 3VAJA 4PYDA 3WZ0A 3CCRS 5JIPA 1TV2A 1X6NA 2F8EX 1UHVA 1G7UA 4L1XA 1GOMA 4S23A 4DJBA 3N19B 1XRTA 1E6ZA 3SCPA 4K37A 3S1WA 1AJZA 4L1WA 3NAIA 3OG2A 2GGJA 3MUCA 5HROB 4HZ8A 3O3LA 3V6HA 2VFFA 4L4OA 3A6OA 1FDZA 3VOIA 3OSPA 4GVBA 3CXCR 3AMLA 4WKRA 4JAWA 4BJHA 1S12A 1CPUA 4F0KA 3FJ4A 3PNUA 1Y5LB 4GI6A 2XG9A 3AH6A 4KGKA 4GUGA 3G1XA 5LL6d 3XISA 3I5CA 4PBEA 2C3YA 5L9NA 2BY3A 3HTWA 4FP9A 4LNYA 1VJWA 5KZMA 5I03A 1CTNA 3HHLB 5CHCB 1QW9A 4IG3A 4ZVSB 1D2KA 1H7XA 3L12A 2HISA 3JW7A 1XYMA 3J81Y 4U10A 1OYDA 1J9YA 1A5SA 4ALZA 4JV0A 4JI1J 4MF4A 1O51A 1O4UA 1XR6A 1FFSB 2HJPA 4AQYF 2DZBA 4ROPA 4YTTA 3IM8A 1V6YA 1MMLA 5FF2A 3AXXA 4E4PA 3BV7A 4G6VB 2PTZA 4ICLB 1OFOA 3BSGA 1ZBKA 3VZYA 5G0RB 2F40A 2XVLA 4ZCWA 2BBFA 4P8XA 4X4UA 2C22A 3EX1A 2DUAA 3KWMA 2EFQA 1KRMA 4QWEA 2NQLA 5IFPA 1YJVA 3RRKA 3ZT5A 2QNEA 4S1FA 2C91A 2Y1RI 3GAYA 2WK2A 4UTGA 1W3KA 1J0IA 5AOUA 2J0XA 4GNKB 3RM9A 3VPLA 2XYGB 1X5OA 1SSGA 3XIMA 1HNIA 2PE4A 1HWUA 1AH0A 3TZZA 1Y10A 2HNHA 3M32B 1PX3A 1QD1A 2YX4A 3A13A 4X4QA 4HR2A 4NJKA 2WC4A 5K3VA 2DISA 2BKPA 1ZHAA 4G1QB 2FH6A 2Z1WA 3B97A 5EMMA 4R8UA 3GFZA 3UU0A 1JLAA 1VFOA 5BZAA 1US0A 3LANA 4XV0A 3VVGA 1GZ1A 4B9ZA 2CQHA 4O1DA 5D4LA 2QA4G 4ORIA 1QM9A 6REQB 4A8IA 1BHGA 1F9FA 2ZH5A 2DR5A 4KWOA 3KVLA 4U96A 4YN5A 2RJHA 3C86A 1EH9A 3NGJA 4Q4RA 4RW7A 3EYPA 3N2MA 1C1BA 3SFUA 1GVSA 2BJ7A 3RW7A 4GY1A 3RO8A 4YMZA 3DHXA 5D0HA 3G0SA 3O8AA 1DEDA 1DOSA 3IK4A 3C2OA 3TCSA 1LOQA 1EEPA 1CGUA 2W24A 1HIZA 2R2SA 4O0QA 5IDIA 3R79A 1TKXA 2O9PA 3N5BA 5DGBA 4KC5A 2MLZA 3EGNA 3PTWA 3R11A 2ZUWA 1NEEA 1U6ZA 2WPBA 4O1FA 4QDPA 1VIOA 2OGYA 3QT6A 4Z7YA 9CGTA 2CPHA 3FDKA 3LP2B 2NXUA 1XI3A 3KLGA 1M68A 4JYAJ 4OYWA 1POJA 3UO0A 3B40A 4GQQA 1YQHA 2CIMA 2MPUA 2UBPC 4DF8A 1E72M 2ILZA 2EO7A 1ELOA 1LNQA 5HWNA 3CC4S 1X60A 3NVTA 2IS7A 4DJEC 1WACA 2HS4A 3IAPA 5I07A 2LEPA 3DYOA 3ZQ9A 3OZOA 4DV0J 3PBVA 1XC9A 2FGZA 1Q65A 1W1B1 4YHEA 3JTNA 3IPWA 1S10A 3NXZA 4DX7A 1X4BA 6CGTA 2E8YA 4M6QA 2WW4A 2NLWA 1E6QM 3QLLA 4W88A 2Z2MA 1U5HA 2E25A 1FEHA 3G82B 4DX5A 1KBKA 1T95A 4EOUA 3B0UX 2HRWA 2X16A 4DEFA 2H3BA 2E7WA 3AOBA 4WWSA 1TL1B 5C25B 4FNQA 1FX2A 1XCWA 3UDEA 1DE5A 3V3WA 4LBRA 3CULA 2J79A 3W3OA 2KDOA 2CPXA 4OX9J 3K59A 4ZJQA 2HGMA 3H25A 2OX4A 3G6ES 1PCAA 1RBOB 4TX8A 3LCIA 4B5NA 1E1CB 4YR2A 2Y61A 1MROB 4ZXLA 3LCGA 3UESA 2DCLA 2W61A 2CIPA 3EOSA 3DECA 3UVAA 3JRKA 1FWIC 2UU9F 4PC8A 3G1DA 3AO0A 2QJNA 4GH3A 4X60A 4O52A 4HK6A 1VD6A 3LX9A 2C2MB 2DDXA 3M0VA 3BPDA 1AH3A 5TQLA 1K7EA 2ZDPA 4WP3A 3MMWA 4ZVGA 1V3JA 3KBMA 3LNMA 3EWDA 3R12A 4HSNA 1QLNA 2IBOA 5G1YA 3BYPA 3Q22A 1OBAA 2DHXA 1Q63A 2Y2WA 1BG4A 4LVAA 3I0RA 4HT5A 1ISXA 7PTDA 5HMFA 4OJ3A 2FZBA 5CJ5A 1T0OA 1MMNA 3EB2A 1VBRA 1AROP 4UFLA 4HK7A 3VGUA 3AHXA 2BLEA 4HOWA 2BJ9A 1P7TB 4ECLA 3ITCA 2VIHA 1JCXA 1B64A 4QG9A 1HNVB 1T9VA 4A21A 5LIXX 2OSYA 3UN5A 4EBDA 1N34F 4ES3A 3CMES 1RABB 2AHOB 7FDRA 2J0WA 4Q44A 3GILA 1R86A 2V0TA 3FEZA 3NSNA 3ZZPA 2Q01A 4GJ1A 1IBCB 2REQA 4XAGA 1DJNA 1XRFA 5T9CE 5IC4B 2QG9B 2IA0A 3TRGA 5DJBA 1Q6LA 3GFXA 2KO1A 3K2YA 4R88A 1AUDA 3A5FA 3L4WA 4C7FA 2OUGA 2WMHA 2G37A 2WVVA 3CNYA 4NUWA 2IM0A 4ZA0A 3DOLB 1FWBC 3LG3A 4D1JA 1LL6A 2ACQA 2ZX5A 4QQ3A 4MG4A 1EETA 3GO2A 4BWLA 2AGQA 3H26A 3RX3A 3L4UA 1WKFA 4NX9A 1N6QA 3FN9A 1MW3A 5IFTA 2D1ZA 5IXUA 3KLHA 5BYQA 5J2PA 1NARA 2Z4GA 4HOZA 2HNZB 3CEPA 1EGVA 3L68A 4M51A 2GMHA 2ZJQQ 1QHPA 1LROA 3LV6A 3WDPP 4WX2A 4DS5A 3BSHA 2ZE2B 2PT0A 2HHUA 3CQIA 1VQ4S 1RAKA 2VFHA 1NK0A 5FEWA 5DDOC 3DI6B 2YKMA 2ACSA 2YCIX 4GUFA 3NA8A 2R2RA 2PURA 3SFKA 3U5UA 3SSZA 4UUWA 3S2JA 1N0UA 2ZDOA 3LPFA 2PB1A 3B8SA 1J96A 2ZZ6A 1AMKA 5LMNF 3TONA 4N8NA 2WKLA 5H1SV 3MO7A 3TAPA 3DH7A 1YTKA 2A3LA 2YFOA 2KFYA 1GJUA 1P0EA 2GJ2A 2Q66A 1HKMA 3CYVA 4L4MA 4IFOA 1ZAVA 4G1QA 4C60A 1XMOF 3PYDA 1Y4ZB 4B9LA 2GVEA 2CADA 4UTJA 4P2XA 4U95A 2OI2A 3KLGB 2DHGA 2EW9A 3MM5B 3MUXA 5BWAA 3RRHA 3KMSA 4C1NA 2PU0A 4WF7A 2QDDA 3O63A 1IR0A 4C5YA 3DLEA 1BTCA 4ZK7M 4ERDA 2BVYA 1IM6A 3S5NA 1TL3B 5KFIA 3H7VA 3J7AN 3HZGA 2X51A 3IAS9 4OZ2A 3UW1A 1FUYA 1TR0A 5F8GA 3VGTA 1A3XA 3FJNA 4QYZK 2GJXA 3R27A 4IKAA 1KCKA 2FY8A 2HVEA 2FJVA 4ED1A 3LN3A 4IG2B 2CPFA 1TA3A 2I38A 1R43A 1O5JA 4OYOA 4S3JA 4M29A 4E38A 2JE8A 1XL9A 2WJDA 3DKLA 2WZHA 3W87A 1Q2SA 1U2CA 1KCLA 4CD7A 4LR8A 4WPAA 2DEIA 2WWDA 3W2MA 4A8FA 1DVJA 3D1HA 2CNNB 3I9V9 4DAFA 4L9XA 3U48A 1UP1A 4M80A 3IUHA 4IH5A 4TX6A 1P9QC 2V6AA 3CV6A 3PW7A 1H38A 3FHQA 2ZUSA 1QHZA 2ZC8A 4LW7A 3T81A 3N4EA 1TE1A 4G65A 1ZTVA 5XINA 5DM7Q 1XLAA 1FCBA 1L8NA 1YPFA 4KEUA 2E5LJ 2FY1A 3M7SA 1RQEA 4L5ZA 1JF5A 4JI4F 3WQGA 3LXAA 3LPYA 2XO7A 2VFGA 4WJXA 2C2OB 4IISA 3KVJA 2NQPA 3GE9A 1R38A 4LY8A 2FZ9A 4NXNJ 2RDTA 4K2SA 1GVIA 1YDYA 4P2SA 2ZZ1A 3CL6A 3R13A 2J8GA 1GW1A 1WDDA 2V3EA 2N82B 4QLLA 4TXEA 4YCOA 1VRQC 1FK9B 1KLYA 3PX0A 1FHLA 2RAGA 3FW6A 2HAFA 2ZVRA 1O6IA 4KEVA 2U1AA 3SI9A 3Q8UA 2ZADA 1V3MA 2Y5JA 3CMJA 3M6XA 1QUVA 3MZ2A 2PDKA 1HL6A 3CJ0A 2HHHF 2ZC1A 3VO0A 3I5BA 3VWSA 1FRIA 2LA6A 1XH0A 3BCFA 3WSUA 4OHYA 1IGWA 3KHHA 1F3WA 1PB0A 4CH0S 4YN3B 1S5WA 4AHOA 2E9BA 4Q45A 1D8CA 3LA0A 1KRCC 4ZCKA 4P74A 3TOYA 1UBPC 2F6KA 3GDLA 2HS3A 1AL8A 5LJ3Y 2C3ZA 5FSDC 1F5AA 5JXSA 3EB3A 1FRMA 5AE3A 3NL2A 3NFUA 1XRVA 3KG1A 2EXOA 3UWTA 1RTJA 3R5GA 1L3SA 2R7TA 1F6PA 3L7RA 3IS9A 4S3CA 1T5AA 3CC2S 1BQMB 3R7MA 2ILYA 2PDBA 5HJLA 4MJ4A 4JHOA 1AQ0A 3EWCA 4RNIA 1VRTB 3RCNA 3W0KA 2ZBQA 4J5OA 1NQ6A 2ZOGA 5J1EB 3FYYA 1C0TB 2V8ZA 4M0XA 4X2BA 3FIGA 4P71A 4M6UA 5CGMA 4ED0A 5CBIA 3W6YA 3FS2A 4Q8MA 4YTQA 3MHFA 1K44A 3HT0A 2LLZA 1RTIB 3H54A 4JKLA 4Y8EA 3DG6A 4O3PA 2PI5A 3OQ2A 1B9ZA 4J3ZA 4N42A 2FDSA 1BQXA 1NWTA 1VK3A 4XK8C 3TNBA 3CH9A 3STCA 3W22A 1D9DA 2PRHA 2Y0SD 3GBEA 3AJDA 4USVA 3E74A 2XFRA 3GIKA 4CLUA 4HKPA 4GVGA 4FB7A 1B7FA 3PBYA 3LHYA 1HNZJ 3P0XA 3DM2A 3Q8VA 3CWNA 1NK6A 2E6AA 4FXWA 3RU0A 1T9UA 3AOAA 2W7AA 4J9KA 4Q0BB 4OYIA 5HVFA 2BOEX 4LNCA 1HNYA 4AQLA 4IRKA 2GO8A 4QQUA 4PFMA 4C6AA 3R5EA 2OOGA 4IP7A 1OFPA 2P0IA 4BWLC 3EKLA 3MD1A 3UETA 1E6RA 1CSJA 5IWAJ 4RW4B 4DQRA 3LTSA 3P6YC 4K4UA 1KA9F 1UVJA 2DGXA 1MVYA 4DO6A 4DN1A 5CJMA 1Q8KA 3MFIA 3GSMA 3MPWA 1TWWA 1NJZA 5A6MA 3ANVA 1M7XA 2QJJA 1IKXB 6AT1B 3CPUA 1VCTA 4LOCA 4O4VA 5CZSA 4D8AA 3D6MB 3Q67A 2VDHA 2XHCA 1JK9B 3BOXA 3FY1A 4Q0BA 4WEVX 2VFEA 4IGNA 1I1XA 2LQBA 3BAJA 1TMQA 1HF6A 1HKWA 1NIUA 3UYCA 2YCJA 2DCUB 3CO9A 1T11A 3VIKA 2Z1KA 1HKJA 2L9NA 1SKWA 1C8YA 1ZJAA 3URNA 3H7HB 4ERAA 4KEZA 3CGTA 4H54A 4ATWA 1A5KC 3FHAA 3GJRB 1JLCB 2HQIA 3KRSA 1MEIA 1VC6A 2BXJA 2ATMA 1S49A 3P84A 3C6TB 4LREA 4BKNA 2J7WA 2CHRA 4XD5A 3POCA 2QUMA 1QI0A 5KMYA 2DXFA 3QSIA 3L67A 3SUWA 3MUTP 1A53A 2Z29A 1X9WA 2XGBA 4J28A 3WDRA 4I68A 3W8GA 1JDAA 1L3KA 3WF4A 3EOOA 1YSJA 1HBUB 4I9JA 4LUJA 2V82A 3ARQA 4TIMA 1DXIA 3D0CA 3LHVA 2XSAA 4DL6A 2Q79A 1P1MA 4OHVA 3CCJS 5IM0B 4HBKA 4K59A 1PIIA 1I3OB 1CIUA 1KM1A 1DARA 3PF3A 3T4CA 1RAFB 2DT3A 2HMIB 3PJ9A 2QUVA 3BG9A 3P6LA 3VCNA 4DI9A 5J5RA 1HNVA 4D8ZA 3G1HA 3GVRA 1O1ZA 2FQQB 2DH3A 4L73A 3GXFA 4Q3MA 4Q8FA 3OEXA 4LBHA 3APGA 2ZIDA 2G0WA 1W2PA 4QHRA 1K03A 3NCOA 4FI4A 4JIEA 3U1MA 2V67A 1T03B 5BNKA 1M5WA 6XIAA 3MSDA 3L4VA 4WGXA 5DFAA 3MDUA 4DBWA 5CC3A 2OPQB 1QPKA 3AZTA 2JFDA 1HKIA 1KKOA 4H04A 1ZS6A 1V5IB 1Q8BA 1U0HB 5C2XA 2I1RA 2Z2BA 4P7VA 3C19A 3RBZA 2JKAA 1PSCA 2M7SA 1PV8A 1TTJA 3DFEA 1S5VA 4LS1A 3H6OA 4LPCA 3HHKA 4LMZA 4FA3A 4YVPA 1JYXA 3C56A 3DLGB 1VF8A 4NQ1A 2FPYA 2HHSA 2FJAB 4MIAA 2VX5A 4DR4F 4CCHA 4XAYA 1DWAM 2C28A 3TX8A 2NV9A 1ZLPA 2DNQA 3P5TL 2EC0A 5GAHU 1W37A 4UMCA 2OH2A 4NYOA 4QCFA 5HNNA 3D3BJ 3MPYA 1HBOA 1RWWB 1R8PA 3FGCB 5BCAA 3L7OA 1NOFA 1E70M 2V2HA 3IP0A 1V6VA 1RT3B 2DKOB 4JHZA 2HZVA 3APTA 4BR1A 2M3DA 2W1BA 5CAKA 4FOKA 2YL5A 2YCEA 2Y5SA 4ES4A 4FPIA 4MY9A 1Y0EA 1MXDA 3UWEA 4DWSC 3UPMA 2VQTA 2EG8A 3UVJB 1XPYA 3R8GA 3K4WA 5C7HA 4GPNA 3H90A 3W5YA 5A76A 2OEJA 1XGDA 4GH1A 4GXPA 3NWGA 5E41A 1VIXA 5CAAA 5J2MA 1BYCA 4G7FA 3J80Y 1RQ0A 3WFZA 1KM0A 1UBSA 2XFFA 5DXXA 3I0SB 4NWBA 5GAGI 2BP1A 3T1HJ 3H5UA 1RD5A 3LY0A 4RXGA 1JIBA 1W0MA 3ZVHA 4DPOA 4O57A 4Q6JA 2EFPA 1NF7A 2VC7A 5FAJA 1ESWA 2GVYA 2D3O1 5HMZA 3AHVA 2EJAA 4IR1A 2NZCA 1A5OC 3A3OB 4RPFA 3S47A 3NQ8A 1QI5A 3VCCA 4J2MA 1FWFC 2KHCA 1YBAA 2YKQA 3GE7A 1A5BA 2WSEC 4XTDA 2RHSB 3JAMU 5HWMA 4MNMA 2YTCA 1FWAC 2YWWA 2VOOA 1QUMA 4Y28C 3GWCA 3CJKA 3CO4A 1IBKJ 4N41A 3S1GA 4NASA 4H8UA 1MN9A 5JXQA 3FCWA 1UA0A 2M8HA 3PANA 3UG4A 1KBLA 2IPOB 3U02A 3QPEA 1C91A 2AOSA 2XMAA 3GLJA 4C6QA 1EOMA 1M53A 1U26A 4ZOBA 3ELHA 3MMBB 3QQ1A 4UOGA 2ISVA 2MQPA 3RB0A 1FJCA 2C3UA 1P7TA 2W4CA 4AZ7A 2VPZB 1W2VA 2NX1A 4BI5A 5CG0A 1RWPB 2RQKA 3CD5A 4TO8A 3BS9A 1R2RA 4EXAA 1N0VC 2HVDA 2HZCA 3NGSA 5G4DA 1B0PA 1T8EA 3L95X 3F56A 4NHVA 3UXDA 2BQ3A 5LMNJ 4E3TA 3LGMA 4BA0A 4H4KC 3GHTA 5LXRA 1TJRA 1X5PA 5LHFA 3KTQA 1S1RA 1XLGA 4LVBA 2DXDA 2E44A 1ZH5A 4IWWA 1C8VA 3KUHA 1SSDA 4M82A 1VBUA 1TA3B 1UFLA 3VFCA 2H3DA 4C6PA 3GZ7A 3D2WA 4BY3A 3POTB 1W9XA 2BSLA 2Y85A 5E0KA 2YQ3A 1FFGB 1FWPA 4UC5A 3DXSX 4RW8B 4NXMF 2OPRA 5IM51 1TU0B 2B51A 2KXFA 4TU7A 1XIDA 1E4IA 1FBAA 4E8DA 2DSUA 2O3DA 4N9BA 1HJWA 1RCXB 1TV5A 5F3ZA 1VGYA 5KFYA 3NZGA 3HX9A 2BKOA 3OVBA 1JKHB 5HQMA 5D6GA 3UDCA 1RHRB 1HD1A 3GXNA 3QGKC 4JI7J 1U0HA 3UN3A 4LUBA 1ZAXA 3DRRB 2W0UA 5ETLA 3MBDA 5LNSA 4LXFA 4PMQA 1VGAA 1XMQJ 3GNXA 4FYXB 2CNKB 3V75A 2F7FA 4H3DA 5CPOA 3KKFA 1WO2A 2JC0A 3UA4A 3AQUA 4WY0A 2W79A 3Q8RB 3UD4P 3RLGA 2IYGA 2NSBA 2GFTA 1SIZA 5DX7A 1UEVA 1U8WA 1TTIA 2HHTA 2PIIA 3TW0A 1WHXA 1QTWA 4L9ZA 2QDGA 1AW2A 5EY5A 4R5EA 3DOPA 5I3PA 1A5CA 5J2PB 4MDPA 2VG5A 3QC0A 3UJEA 1C2PA 1FQ0A 3ZNJ1 5T7LB 4HB7A 3RJYA 2F5GA 3HZEA 3OVRA 1DXEA 3P62A 1EOKA 2ZA3A 3RCMA 5HPCA 2P6SA 2FZ8A 4F2TA 1KFJA 4MKAA 2I2YA 3WMCA 2ZE2A 1TTQA 1IEWA 2QLWA 3GDMA 1YI2S 1W3LA 4S3GA 5XIMA 3NTYA 4AZGA 3BANA 4HK5A 1BQNB 1XERA 3CHFA 4O12A 4LB4A 4NA1A 4DL0C 4DR2J 1ZPTA 5G2WA 3F5JA 3FXGA 4DV1F 1EC8A 3MUZ1 3DZ1A 1HQUB 1FX6A 2I5JB 1B31A 2P5NA 3UZZA 1Q8AA 1WB0A 4A8NA 2ZFAA 3PZIA 2LYVA 4MTVA 2BR0A 5FJRA 3MC5A 1QT1A 2HGNA 2DB1A 2NX3A 3PKYA 1FI4A 5DF0A 1WBHA 4F4RA 1RI7A 3WFAA 1UVLA 1ZU8A 1E5NA 4XWUA 3QWPA 4GO7X 4ZP9A 3ARSA 4NZFA 4FPSA 4DWIA 4LF9J 1UWTA 1HI8A 4O0IA 4OVXA 1POKA 1S2WA 4KEMA 3PTDA 4P75A 1IKXA 1DJQA 3SUVA 3BURA 3WLSA 3TP2A 5DMMA 4OHWA 1BYBA 3CB8A 4IOBA 3BB5A 1IKWB 1EP3A 3VGEA 1WNEA 1RU2A 3IVTA 1MEWA 1JF6A 2WNQA 4XUGA 4R27A 3LUYA 2IQDA 4UIOA 1U2YA 2R8WA 3CL7A 3RBXA 1HX0A 3R94A 3W2LA 1KQGB 3HG2A 1W9DM 3O7UA 4A35A 2YNHA 4W98A 3D28A 4WU2A 4Q8EA 4W4QA 3NY0A 1XIFA 4ZN3A 4UOZA 4K3ZA 2CLHA 4ACYA 1TV7A 1KXTA 1EUNA 2IIHA 1KFLA 1WHYA 1FKXA 1GNXA 3A4JA 1PJ6A 2UXBJ 4A2SA 1G9HA 1J11A 3GR4A 4RR4A 1GPFA 2O7SA 4Q8NA 2NCKL 2JWNA 3UR8A 3C5QA 2QX0A 1QDSA 1UZ1A 2Z2YB 3BCJA 3LLDA 2V68A 1NZ8A 5C5YA 4EK7A 3OIHA 3CTTA 3WBYA 2JIEA 1FCAA 1S5ZA 2HS0A 3USBA 3GU0A 4EF8A 2UZAA 4WP8A 1J0JA 1XQLA 3B4MA 2HHPA 1WKLA 3TEVA 1KFSA 2V2DA 5L46A 5XIAA 1K70A 2K8GA 1HGYA 2OELA 1XLCA 3NNHA 2J7DA 3RPTA 4GIAA 1SZEA 4X22A 4TMBA 1UMJA 5REQB 5E2QA 3CUZA 4IP4A 3PHEA 1V51A 4ZTYA 1R30A 3EKZA 3WLLA 2MKSA 4BBYA 2CPUA 2CLMA 2TPSA 3AHZA 5L1KA 4WKFA 1Q16B 2ZOXA 4YLWA 5A69A 1KD0A 1EARA 4Y65A 3KVMA 5DG8A 4MHBA 1FP8A 1R85A 2DZAA 1RCQA 3FGCA 4IX0A 2R82A 2DRDA 3RJXA 4LF5J 5ECVA 3V1HA 5K20B 1F2JA 4RPPA 2DNZA 2QCDA 1OFQA 3QY7A 1J2VA 1XC4A 2Z2AA 1VPXA 3ELFA 4U2YA 5LIWX 2A7NA 5EFFA 4QEEA 4D6DA 3BKTA 1R31A 4CO2A 3I65A 2ZH9A 1T9XA 2AGOA 1JXVA 3JSRA 3E5PA 1GVQA 2ZH4A 4LALA 4NZ6A 3I87A 2XH7A 2IRYA 4HTYA 3BARA 1SYTA 2DNHA 2C0AA 2DYAA 3GVQA 2MKJA 5E3QA 1BAGA 2UV8G 1UL3A 3NEHA 3LS9A 2YL9A 2VKRA 5FJOA 1VHNA 1UKTA 5FD0A 2HNDB 2BQUA 5K2ZA 3RILA 2ERRA 3ZC4A 2V30A 5CEWA 3U1NA 2OFGX 2U2FA 1V6UA 1W1VA 4DU8A 2F4VF 4NLOA 2NUXA 5CPLA 5SZTA 4QJ4B 1NJJA 4I7WA 4WD0A 4D6HA 3QYYA 5LXXA 3SZ2A 3UPBA 4I6WA 4HDGA 1I45A 4C65A 2VG6A 5CYQB 4KCUA 4BQ5A 4W8BA 5JUMA 3U2ZA 4UTMA 4MFBA 4P52A 4CLMA 5GJMA 3LCXA 4FF5A 1QNOA 3UVIA 3M4HA 1HR0F 2BOPA 3LHUA 5KFMA 2DW6A 1TQLA 2VNCA 1JXJA 2C3OA 2P8IA 2A79A 3E01A 2AIRB 4H00A 2YWFA 3PR4A 4TY8A 4C91A 3WJSA 2WRMA 3WC0A 4EYHB 2PA3A 4INFA 5BXPA 2PGRA 1U47A 4MWAC 3I3BA 3BO3A 4NLUA 1TQXA 1L5UA 2OXNA 1OY9A 3O6QA 4WFYA 1IBKF 4IT1A 2AAAA 2CPDA 4LBIA 4E5TA 1TFYA 1Q6RA 1FY6A 5MF5A 2JLGA 3FSXA 1EQ0A 1D3HA 1OCNA 1OSEA 1BPLB 1V6XA 2YNHB 2QUTA 1UZHA 3RRAA 3WDQA 5GAEU 3UZJA 2DJWA 3DRXA 2BVDA 5FJTA 3CHVA 3GYEA 3GD6A 1GVFA 2NQHA 4D8LA 3PRVA 2WKJA 3GS6A 1VRTA 4DPQA 1P0NA 2FVLA 1DQAA 3H7UA 2ZE3A 1RLDA 4GKTA 3HFYA 4HT3A 2IPGA 1NKCA 2IFXA 1RE1B 1RTHB 2EFVA 1W3NA 2I17A 4LF8J 2R42A 2ASDA 3IM9A 2QPUA 4U8VA 4PEOA 1XBVA 3GXIA 1XP3A 1VEPA 4OUIA 5J5DA 2X0YA 2J9YA 3T44A 2BMBA 1TL7B 1KWMA 3ABOA 4PAAA 4OFCA 1NPPA 2ZH1A 1WDQA 5KFSA 4L65A 1V9OA 3OGSA 2MANA 2B6AB 2D3NA 2HBYB 3KLHB 4DV3F 4K0KJ 2E29A 2DR6A 5I3UA 1SVDA 5K5MA 2AZ3A 4J90A 3GNNA 4HP5A 3R5JB 3TX0A 4BDPA 1ZENA 1I94J 1LP6A 1NRKA 3LQLA 3JQKA 3QC3A 1EHNA 2PEHA 1VFSA 3MMCB 4WKAA 3OJGA 4KRWA 3EYZA 2BANB 3PYFA 3GQYA 4HHHA 5GAGU 4H9TA 4J9NA 2FB2A 2OD6A 3BKFA 5FD1A 4I6VA 1IEQA 2VENA 2BHUA 4HI2A 4JR5A 3NQ7A 2WQDA 2Y7DA 3PP7A 1S5MA 1YRTA 4E8GA 2V63A 2FB3A 4A2RA 2IVYA 2FPHX 1NFPA 4HOXA 3WX8A 4HTBA 5JU6A 1IXQA 2EJ1A 4ZQMA 1TVRA 4OI1A 3W25A 2D2JA 1QATA 4MK7A 1AD1A 1FE0A 4AHPA 4OZ0A 3DLBA 2YGYA 3QV8A 5HJYA 2Q3RA 4XBSA 1F4HA 3CK5A 4EXBA 4DUTA 2DIEA 3TJ4A 3RU8X 1EKSA 3VVTA 1QK2A 5D15A 3UGVA 5DO2A 1U25A 3V81B 2OKOA 3TAMB 1LKZA 3VZHA 5CD4H 2DGVA 1OEPA 4LAMA 1J6OA 1FH9A 2X8RA 4D6CA 2CLIA 1WJ9A 4QIGA 2D69A 5AVNA 4CLWA 4AD0A 4ROQA 2C13A 1BC6A 3SFWA 3ITHA 1AUSL 4XAZA 2PDUA 1GNKA 5A8NA 4PQUB 3E0WA 3LQGA 1DBDA 2OT0A 3AXIA 3OR1A 4FF7A 3R6IA 4U3AA 5IBXA 3NQCA 3T9PA 3HMJG 5CJNA 4BS2A 5DG9A 3DUGA 4AX7A 4ATLA 4LRAA 5FL0A 4CNSA 1I6JA 2QAFA 1WF1A 1XSIA 1XSJA 4JI6F 2PEBA 3KLFA 2UXDF 1OT2A 3D3AA 3DHDA 4H9UA 1UWUA 4GXWA 3KOWA 4CO0A 2C18A 2IXUA 4UR9A 3GDTA 5KFQA 1XD0A 3MW7A 2G1HA 1N8IA 1KLZA 3HA1A 3QGIA 3PWAA 3LBCA 4C98A 3OXFA 1ZOTA 4DG1B 2QIIA 3NQMA 3T6CA 3OTEA 5CPTA 1DQWA 2DEJA 1B2YA 5A3HA 1J0KA 1RY0A 1CT5A 1SC6A 4KH1B 1PO9A 4X61A 4MKYA 3G6XA 1YE6A 4JI2J 4MNJA 1X4HA 5M2UA 2B0GA 3TSMA 1TPVA 3NO1A 3Q0AA 3VALA 4CI0B 3TUPA 5DT7A 4LSZB 4IMEA 1KC8T 4HD5A 3SIZA 1TSIA 1MI3A 2C8NA 2PODA 4CD6A 3IJDA 1Z32X 3WQPA 4AUBA 5AFDA 1UVMA 4NI3A 8ATCB 1LBFA 2CFFA 3PZUA 4IF2A 4B3MJ 3FRYA 2YFNA 3M8QA 1TVPA 3DYAB 2IMWP 1ZJBA 2G96A 1ZY9A 3O15A 5D2WA 4CCZA 2G3JA 4UQAA 1H5VA 2RD5C 1G69A 2PUZA 3W7DA 4RUBA 1UP2A 4J9LA 3KOYA 1WYIA 3UBPC 4H9YA 2ISWA 1QPQA 3BQ6A 4HU4A 3IMQJ 2WPGA 3MV11 3BDEA 1WC4A 1JAKA 2VC1A 4AD3A 2HE5A 4ZO6A 3PULA 1N2VA 2W6RA 2K3KA 3IR7B 2IAJB 1H7NA 1XYFA 5HMXA 2ESCA 3T0BA 4FOUA 1XIQA 4AYGA 3M0IA 4ZOSA 2DSZA 2FB0A 2E6YA 3N4FA 2XFYA 1HPZA 5J2MB 5FDLB 4Y2IA 3WX7A 3SCWA 1R3SA 3VNJA 2MQQA 5H9FK 4PXBA 3W02A 1E73M 4H4MA 1GHSA 1W32A 4D6JA 1LG2A 4UCGA 3UW6A 1JEZA 5KG4A 1D0EA 3GHRA 2Y7FA 4TU8A 2V3GA 4AYSA 4AE5A 4TQSA 3L0GA 4FEZA 5BRQA 1G5AA 3G3DA 5HATA 4W86A 1RA7A 4IIHA 1AFJA 4AWSA 3WIVA 3HN3A 5LNVA 2XNRA 8CGTA 2BOGX 3QPYA 2ZX6A 2VQFF 1E4NA 2F7VA 3PZQA 4FOJA 5A8KA 1T41A 1U5VA 3RG6A 1HVQA 2YW4A 1RB0A 1LG1A 2CPEA 1BXNA 2ZX8A 4O53A 2L48A 4RBUA 1LCOA 3RLUA 4X64J 5FEZA 2HYIB 3OYZA 1I75A 1XYLA 3N6JA 1CEOA 5B0GA 3U7JA 3OW1A 5J2QB 1SKSA 5A8MA 2MNRA 3E2VA 4B9YA 1KFWA 5F4XA 4PWDB 1GORA 4RUHA 1J8VA 1GXUA 3P81A 3B06A 3WG6A 5BRBA 4XZHA 4OUEA 4LRDA 2C1EB 2J24A 4B4FA 3ILOA 4ADSA 3HG3A 2W2NP 3QZAA 4HPGA 1OIFA 4KB7A 2HNEA 3UG8A 3N6HA 5A8RB 2Z0IA 2V2CA 4MLJA 3HVAA 4TY9A 1L6WA 3M6UA 1VP5A 4PBGA 4TV5A 2QMXA 3WD2A 4DUYF 4ZLNA 2ZA2A 2ATSA 1DJ0A 2GUUA 3TZWA 4PQAA 2C2ZB 4O3QA 4K4ZA 1MYRA 1JJCB 2VFSA 3VE9A 1K0VA 3GNOA 4A48A 3MFHA 3PZGA 3A3HA 4KQZA 3G1YA 4X65J 2JEPA 3KYLA 2XWYA 3R8RA 1UUQA 1LQ9A 2Y8UA 2YXGA 1OVDA 5CBJA 5CQ1A 3CNQP 4L72B 2RDIA 3UFYA 1NBEB 1NTHA 2FTWA 2NUWA 1VIWA 3W63A 3HSJA 4E4UA 5CZTA 1KLMB 1B9BA 3MUY1 2M5YA 4LQ9A 4F3QA 4ECUA 4DR6F 3NZRA 3QXBA 3IRXB 1X9SA 1A3HA 2OTJS 2IHR1 1RXOB 4B3SJ 4RBTA 4L3KA 5K4XA 4J3VA 3IXQA 1D3CA 4NLPA 3SCNA 3OA5A 5HL7Q 1UC5A 4ER8A 3PUDA 3UY7A 1YHTA 2DGWA 1ZM3A 3DLEB 3SUTA 1HWIA 1D7FA 4DV5J 5AC6A 1CB2A 4UW2A 1ZM4A 1PAEX 2QJGA 3ENVA 3SQMA 2OYMA 1WA3A 5F8IA 1V7AA 3BW3A 3PAOA 3GIIA 2VH7A 3D67A 3NO5A 3WMBA 1QRQA 3II1A 3WCZA 2NW0A 2ZUVA 4H6QA 2AL1A 3BBBA 2V3FA 3EXCX 1W5OA 4ONVA 4W87A 4G3IA 1O12A 4YPJA 5IFMA 3MYPA 1TAUA 4M5JA 1GZJA 3OIXA 4H7CA 3U6WA 1JJHA 1E9LA 1SM9A 2PC8A 3HJEA 1YIJS 5JMUA 3LDVA 5CCLA 2NWSA 2BY1A 4DXKA 4AMAA 4PXEA 4QROA 4DO7A 2AX1A 2XULA 4WE1A 3WLKX 2QGFB 3NL5A 1WPCA 3P61A 1J6PA 3S42A 1WKJA 5CGQA 4BF5A 2NXCA 3PEJA 4YDXA 4YWIA 4OFZA 1HQTA 1VBZA 4DZAA 2M70A 2QL9B 2YXLA 1D3GA 3DHPA 5KINA 1KDNA 4RZBA 1PYSB 1CXHA 2Z26A 4ZO7A 3WY1A 4LEQA 2RRBA 3LTPA 1JLFB 1A5UA 1KCXA 3NBPA 1BF2A 5B7ZA 1FWSA 2HVIA 1JJ2R 3T08A 1K8AT 1WG4A 3NVDA 2GIQA 2L9DA 2CG8A 4JFUA 1SC1B 3T6JA 1RAJA 3WO8A 1E55A 1ZZFA 1DJHA 1DPMA 3VU2A 5IOBA 2BXVA 2EPIA 5DCDA 3CZ8A 4F0HA 3UN2A 3S0CA 2HSAA 3WH8A 1UKPA 2WBRA 3N29A 1ONRA 1KR1A 4TQRA 5C0QA 4OI4A 5K14B 4LSNA 4N6FA 1CEZA 3PO4A 5AXLA 3S5SA 5H8MA 2P6TA 2X1SA 3MUAA 1JD9A 3ZZOA 4LUTB 1L3VA 3WDIA 1H63A 4NRSA 4X4TA 3BKUA 2NUYA 2E9LA 4CM0A 5F9LA 2MQMA 1DWHM 1KB3A 1RTDB 2B9XA 2OJ3A 3ZTOA 4KPCA 1RT7A 2WKGA 1CGXA 1Q13A 3TH6A 4NA2A 1R27B 5JMNA 3R43A 5G5IA 1IBLJ 2ZM6J 2HQDA 5I06A 4XX6A 2OWCA 2ICSA 2GVZA 5K8MA 4IIEA 4ZQPA 2ZBCA 3RAXA 1ACMB 1HBOB 3VMPA 1ICSA 3L66A 4M5NA 4MKSA 3SFGA 2ADBA 4F48A 3SBFA 1U1NA 1HPZB 2BM0A 1HBNB 2QJIA 3S6TA 4S3EA 2Q6BA 2P3EA 4O8RA 2IRUA 4DPPA 3IVSA 2VCBA 3M5YA 3EDFA 3PRDA 3IJ9A 3PNIA 3TIMA 1JDDA 3F1QA 5BMWA 4F67A 3W29A 1XNRF 3IV3A 3H2CA 3KHDA 1LJYA 1XF0A 3KL3A 4QISA 4TVAB 3CLMA 1IGSA 3JYTA 4HYRA 4CT9A 2J62A 1JDCA 1JZ3A 5BOEA 2MZJA 4N6EA 5BW6A 4W85A 3B0PA 4HH1A 3DRSB 3NCRA 3K5LA 3UD6A 4JTKA 1VQ6S 1K9FA 3DYMA 4LX4A 4MY8A 1XH1A 2WMGA 4PTDA 1EBHA 2PP1A 1EZ2A 4CVWA 2ZH3A 1RBAA 1DJIA 4GUJA 3I82A 3KBVA 1XUUA 4CQ9A 3LD5A 4DNHA 3M8PB 3W7HA 1P48A 1QU4A 3NAVA 1TB3A 1U1LA 1IJFB 2OP5A 4LFBF 4ERGA 2I6WA 4FXSA 4UTLA 3G8EA 3PTQA 4FNSA 2P50A 3IFEA 2FFIA 4NZ5A 1A0DA 4YS2A 3RB6A 2DJLA 4I69A 3AA8A 3CM4A 3VDCA 4WDWA 1JXLA 3TE9A 5I3DA 3KFWX 4RV3A 1G1XA 3BBFA 3BSNA 4I9TA 2H6RA 2E5DA 1XLIA 3MMBA 3ZTRA 1O5QA 3M05A 2C1GA 3NYZA 3LW5C 2JFEX 1YXDA 2YYTA 1VH7A 4DY1A 2GA7A 4REQB 3SDEB 3ZZTA 4I2PB 3J81U 4IHCA 2AGTA 3TYBA 1AJ2A 3G3MA 3W26A 2C1HA 5SUHA 1VJSA 2DGQA 2WCAA 4S3FA 1F60B 3C6TA 1NP0A 3HD1A 3DRPA 3HURA 5LMUF 2JOQA 4P72A 4C97A 4WK3A 3BSAA 3QMQA 4MAZA 3HPZA 4ZEPA 4C3LA 3RB3A 4KKOA 3CCSS 5AYZA 1SH0A 5F8NA 4ZPDA 3P49B 1R7AA 1UR1A 3WJYA 1DXFA 3U57A 1PYFA 1RISA 3ABZA 2QFIA 4AUKA 2QUNA 3M1ZA 3BTNA 2H1YA 1E3XA 1LLOA 4O16A 1KM4A 5H2ZA 2OVLA 1TUVA 4ELUA 4DV2F 2MSTA 4LR9A 1P5BA 1N5TA 4NPOA 3HB9A 2GMJA 5KT3A 1PTDA 1EC7A 4IG0B 4A8MP 4F02A 1KBBA 2NVDA 4B91A 2ZH7A 3HJVA 4LSNB 3M64A 1JI2A 2PLCA 3DC2A 1MUMA 4NZJA 5IV4A 2Z8QA 3I6PA 3CUJA 4MJMA 5DMLA 4UQCA 4CQBA 3OTRA 1YBQA 1R7IA 5LYRA 4PRWA 3PUOA 4FIRA 3THDA 3R9LA 3UXLA 4R7OA 4GYKA 4A4JA 3CU2A 4F26A 3TZNA 1UD2A 4QW9A 1W56A 5HMSA 3H4XA 1YX2A 1CLKA 4NXSA 1NU4A 4B3KA 1GJPA 2XMJA 3STPA 3UPWA 4YOEA 1FWTA 3BE7A 2YNFA 1HNXJ 1VEOA 1V79A 1TV6B 3QBCA 2CFXA 4XBKA 2EBNA 4F2UA 1OYCA 1YJWS 2VURA 3RUBL 2VWSA 1RUSA 3L5MA 1N88A 1B3WA 4CN6A 3ZVHB 2G41A 3GWQA 1CQNA 4ZA1A 4IRCA 3TWBA 1H2UX 4J7CA 2VEIA 1ODZA 2OU4A 1MNSA 1VLWA 5D38A 2BX7A 1H6KX 1HVXA 3E5BA 4LH8A 2G2ZA 1ZGDA 5EMKA 3PW4A 1BTMA 1CXLA 3IGHX 1X5TA 2MDAA 3K17A 3VV2B 2A2IA 3SEPA 2DR8A 3POHA 2GFFA 1YWXA 1T03A 2W67A 2BZNA 1DIKA 4LVDA 4QLKA 3VI2A 4O1BA 4BEQA 4KGJA 3QEZA 3R5AA 2LLEA 4O44A 3F2DA 1JAEA 3EX7B 1QAJA 4ZIVA 2GDVA 5J8LA 3VNKA 3WBAA 2ONEA 2J7KA 1VQ8S 4Y00A 1OHLA 2EPHA 2FLNA 3NQEA 3B4DA 3UJRA 5CLTA 4H9ZA 2PD5A 1SKRA 5CYMA 9XIAA 2YQ1A 1OF6A 2B7PA 5L6UA 3TN5A 4DR1J 3M8ZA 2I9SA 1SW0A 3UR5A 2W25A 3UR0A 2HFUA 2W2PP 3VKDA 4NYUA 1BWEA 3MEGA 1HNXF 3MU7A 1V0KA 5LIUX 1KHWA 1R2SA 7TIMA 4ZKAA 1NK4A 2I56A 5I3QA 2WC3A 2VMFA 1JUKA 3GTHA 4P2VA 4JYEA 4R3UA 3URQA 4ZO9A 9XIMA 3VAKA 2RS2A 2ZTKA 2QF7A 1CENA 4TN2A 2Y7GA 2I8EA 2AL2B 1HJVA 1NHUA 3PZTA 3QATA 3O6AA 2Y0BB 4EWND 3ME3A 3N2CA 4UMBA 3H7RA 3M16A 4ASTA 2WXDM 2JK2A 2EHHA 1SH3A 4Y90A 1QASA 4JTCA 2GVZB 5I6SA 5IRPA 2X1GA 1HFEL 2Z56B 4GZ7A 3HHNB 4R9OA 4PZVA 1X97A 3ZYZA 2TYSA 3ZJKA 3TQEA 3JSMA 4W90B 2HWGA 4OHZA 2WZTA 1B54A 3MP5A 4HIBA 2E1RA 1RT1B 1WQ5A 6REQA 3VD5A 4JPGA 4C6OA 2PDLA 4GYPC 4LVFA 2E28A 2JLEA 3P93A 1PZ1A 1JLEB 1JPMA 3D0GE 1S1WA 5ETRA 4FPRA 1RJRA 1SZRA 1ZSXA 4LEFA 4AD6A 3UWUA 1QO5A 1JKHA 4LT6A 3EPNA 2MMYA 2CUYA 4F40A 4B5VA 4E3VA 1KV5A 1XLDA 3D3CJ 1N5YB 4ZJLA 1RPKA 4WY0B 1HJXA 4CCEA 3QGVA 1NSKL 1BQGA 2IXVA 1WBJA 3VDBA 1EB3A 3MTWA 2G0IA 2WOQA 1H2TZ 3MEEB 3KRZA 3PKMA 4QR6A 3BJYA 3BAKA 3IANA 3PY8A 1IE7C 2NV1A 3BGRB 1LFPA 2I14A 5C7VA 1TKXB 2IJFA 2X05A 4FK9A 1F0XA 3PC0A 4LB3A 1UP3A 4B5SA 4FP1A 4QRNA 2PI4A 5LT5A 1UA3A 2YYUA 1N5SA 2VTFA 3TCEA 2A3HA 1ZZMA 1OM0A 5F4WA 4S2BA 4QSHA 4AC1X 1IQ8A 4MJZA 1YBUA 3QGAC 1R3NA 2FVCA 4I5XA 3WLTA 4WHBA 3RX2A 3B0YA 3LPGA 5GVJA 4H01A 3SY1A 3V1PA 4CT8A 2PCEA 3ZMRA 4ADUA 3BC9A 1L2QA 4R0EA 3OFFA 3EEZA 3T9ZA 1I9CB 5C9RA 4UY85 3C3LA 5DQIA 1XLEA 3TZYA 2YBTA 4UUXA 1DWGM 3ZZ1A 3T1GA 5C7PA 3P7YA 1EGZA 2W2MP 5F8LA 1C8QA 3THQA 4I8YA 3TUZC 2XJ7A 2QJ3A 1ZP4A 4G1NA 3HOJA 1RZMA 4KERA 4OHQA 3K5NA 3IGVA 2YJQA 1I1GA 1F76A 1GKQA 2VJXA 2YA2A 1XFCA 5ITHA 2PU1A 3AJ1A 1VC4A 4C7DA 4CLTA 4C90A 1US2A 5TIMA 3L7UA 4X4NA 1KW1A 1R87A 4WXZA 5C2GA 3QLHA 1IIGA 1UAWA 4HI1A 1PKMA 3GYGA 4RE4A 4O1AA 4WY0F 4JY9A 1F3EA 4NLWA 2E7XA 1E1CA 3UCGA 4DN9A 2A7RA 2WM0A 2W2QP 1E6NA 2ZYFA 2ZBIA 1A0OB 2CQ2A 2KTQA 4HPHA 3L4YA 2OSRA 2XQCA 3P0WA 1FK9A 3AOCA 1IKYA 2DO0A 4J4KA 4JI8F 4C7QA 4OYBA 1A49A 2YL8A 1CJUB 4H2HA 4HHUA 2MHNA 3UA3A 4DF4A 4Z1YA 4IMGA 1HI1A 1TK8A 2IM3A 4DSIA 3TUJC 4K8HA 3CMGA 4QYZJ 1K8YA 4U5IA 6ENLA 2FVKA 4KHPF 4OZOA 2CNLB 4JHMA 1J2WA 1KXHA 3LUTA 3W64A 2XINA 1R2TA 5FCZA 2E77A 1TPFA 4Y6GA 1PYTA 3UE2A 2F4VJ 3VIPA 4AZIA 1Z8AA 4I7UA 2N4CA 5D09A 3K1GA 4URQU 3MCOA 4R5PA 1AG1O 2CBVA 3VDHA 1KXVA 5A2BA 2ZVIA 4O17A 1KVJA 1XFBA 2Z57B 4PABA 3OBIA 3TOQA 4JQ3A 1CX9A 3OJUA 1GVEA 1FX4A 3LXCA 4P8WA 1UKQA 2A3AA 1R0CB 3GCWP 1FWEC 4ECZA 3M7WA 2VEGA 4GJJA 4I2QA 3GG8A 1E6YA 5EL1A 1JMTA 2X1IA 1IXPA 3HJFA 1C9WA 3P2VA 1OIAA 1WDTA 5A0YB 4ELVA 3ZR5A 4KFOA 3GFYA 1Q8LA 5AC4A 1FH7A 2YOCA 3H98A 2UXCF 1I2RA 1RDRA 1XD1A 4AZCB 4TTGA 4ZQCA 3CPRA 2HPIA 1IZCA 4DV1J 3CZKA 3MP3A 3T42A 2QMUB 3CMQA 3KK1B 4I56A 3BM7A 2VZTA 3LLXA 4GKJJ 3KOAA 1HTIA 3BV4A 2JBMA 1VQMS 2OLWA 2YH1A 2QYGA 3C8FA 2GQQA 1CJKA 4QIWD 2IRXA 4V1XA 1RWOB 2N7CA 1CXIA 1KQFB 3OGVA 5C54A 2P9CA 1MFVA 1Z2LA 1SC4B 4A8LA 1GW9A 2AJ1A 5LNRA 3OR2B 3ZTSA 4ID5B 3NOYA 1VIZA 2VBXA 4NLSA 1MWQA 4CLSA 1N4LA 5CSRA 2AEMA 2DXEA 4BWMA 3SQGB 1UJPA 4FVCA 3AXHA 3THCA 1ZA2B 1LT7A 1FNMA 4TVUA 3S7RA 3NDZA 3CC1A 5AZ1A 3W2KA 1LQ2A 3JQJA 4NYYA 4OZLA 1O5XA 3R7NB 1V3LA 1RT5A 1CXFA 5DQHA 2E8ZA 4K4XA 2A2CA 4N02A 1FO1A 3WH9A 3ZM8A 4CIOA 1RAGB 3KEHA 3VZZA 2K06A 5A6BA 1B99A 3MM7B 2Q09A 1J18A 4Y9MA 1TQJA 5TNVA 2PDFA 3U0HA 2RDJA 3B6BA 2GQAA 2HVZA 4KO0B 4OV9A 1LUCA 1YNYA 2R1KA 1DFDA 2POTA 5FOOA 3VDGA 2GS8A 2VZ9A 1EETB 1AL7A 4WIWA 4I7FB 2UZ9A 3CCTA 5JUVA 1FE4A 5JVHQ 3SRHA 2E5HA 4ILSA 4MB1A 1TMMA 4EPEC 1R7OA 3TNVA 3A21A 2E0PA 1GPWA 3CHEA 2NYHA 4ZP7A 3DC0A 1UR4A 1HL8A 2CETA 1DL3A 1KNWA 1BG9A 1ZNNA 1U09A 2LEAA 1ITCA 4LU0A 5BMXA 2KXHA 3BDPA 3I6RA 5HBMB 1F07A 2G4BA 2B9WA 4J9RA 4RKUC 3NR0A 5J1NA 5KG3A 3NCPA 4NRTA 4ETXA 5AYIA 2CJQA 1UKUA 5FF0A 1XJBA 3L7PA 3ZT6A 2D74B 3ETOA 4XD3A 3JZEA 2POKA 3GIMA 4IFRA 3HI9A 3GCXP 2JQXA 3W1AA 3C2RA 1KV8A 3D0HE 1WTFA 2R4FA 1UFWA 3CQHA 3IR5B 1DHPA 2WV8A 4ZPBA 4DR5J 4DFPA 2HV5A 2J9DA 5FDLA 1J79A 3VNLA 3V4BA 2Z24A 4C3KA 1Q7ZA 3QZ6A 4M94A 4AXKA 4MYAA 1E6VA 3KLLA 1FWLA 1XM3A 4QBXA 3QRRA 1ITPA 1OT1A 4QNEA 4ZOCA 1S59A 3M9MB 4FX8A 2BJDA 3T5KA 1S97A 4K1WA 1HMVB 1ZCCA 3DNCA 2UV8A 3PBMA 3SSSA 3FAWA 2V8GA 1FRKA 3FJ6A 2HDJA 4K4TA 2QLYA 2ZJRQ 3OZYA 3E0FA 4GHRA 2IC3B 1A4LA 4HYKA 2DZVA 2O92A 1JJ4A 1QVBA 1VHFA 2EI5A 3LRMA 4XKYA 2XEXA 4M5DB 2R8GA 2VONA 2JLFA 1K77A 2OJPA 2ZXBA 3VNIA 2VHGA 1PJ7A 3T8LA 4H1ZA 3M8QB 4PMYA 3DMJA 1HARA 1H7PA 1K8CA 1ZUAX 2GJRA 3NAHA 3VD9A 3L2MA 1WEZA 2QCHA 3O0FA 4RUCA 1Z9AA 1ME7A 2HFNA 1S6OA 1WHWA 2CZDA 3W86A 4E8CA 1RT6B 4X3ZA 3KMQA 3M2VB 2GK1A 2X1RA 2Q43A 4PMOA 2VR4A 1FJEB 1QJWA 2ZC4A 1D9EA 3ZR6A 3RLHA 3I3EA 1P4CA 2E1AA 1F61A 4FR6A 4OBTA 4MYUA 2OZ8A 4QNWA 3QR3A 1P8GA 4GQGA 3AQPA 3W8PA 4QX4A 4LAOA 2ZH6A 2UUAJ 1D7KA 4B16A 3C15A 3AUOA 1UR3M 4HNLA 3RRXA 5EX3A 1J0YA 1WOOA 3WK3A 1U1QA 2J9EA 4IL0A 3A4XA 1Y7PA 3MAHA 4YHHJ 4RW9B 2WVVB 4NX5A 1YW1A 4IQDA 1HWLA 5HUPA 1BVNP 2Y7EA 4KFNA 1B1YA 4UZCA 1W3JA 3VILA 2EFGA 4QE1A 2B0MA 4IPLA 2UXDJ 1BQCA 1PILA 1S6UA 2H3EB 1Y5NB 2XWDA 2ISDA 3MPGA 3P8IA 3FVYA 4QOTA 1XBXA 1LF1A 2PP0A 4GCXA 3OT9A 5LZLA 3FK4A 1VS1A 1CXEA 4NAFB 4K8GA 3H4GA 4F0RA 4XO6A 2V4JB 5GMDA 1H0GA 3CMFA 3Q65A 5AB3A 2WVFA 4IDKB 4OYXA 3TTSA 3B78A 2OYKA 2ROPA 3HPOA 5CSSA 1S1WB 3EZ5A 4M24A 4JB8B 2G1DA 3GK0A 2PN6A 2J76E 4X62F 3G87A 2Z6IA 1NPKA 2YKMB 4L74A 2ZKTA 3QJPA 3TYUA 2W4XA 2BBEA 1FEEA 4RPQA 3T8QA 2R1PA 1F6TA 2GPTA 5JJBA 3OL6A 1Y3KA 1D9FA 3SUUA 3PSVA 1X4GA 2ZITA 4IQMA 3CMAS 2IDLA 2OMLA 5C70A 4DLGA 1IYXA 3EAUA 2ZH2A 4J91A 4ES2A 3SO7A 1IWPA 4AZ6A 3DGVA 3BG3A 3NL0A 5L1IA 5LA0A 1CS4A 4Q5VA 4US6A 4XIMA 4RW4A 2VG7A 2WCSA 2D22A 4OQVA 3BLIA 3EX4A 1EJUC 1EBGA 5DMNA 1SQGA 4F4YA 5PTDA 2HKEA 1W1YA 2AD9A 3N14A 1J5SA 2AKWB 1C29A 1SPQA 4ZXOA 2GHVC 3GW3A 4H6KA 1W9UA 3RMJA 3ZS4A 4BQ3A 1JLBB 3OR1B 4G1PA 2FLPA 5IT9Y 1W6TA 1W7WA 5FJ4A 3S8SA 4K8RA 2HBVA 2H8XA 4IIGA 1OQ6A 2WOMB 3MM9B 2Z27A 3DEQA 3QHNA 1E6VB 1RBLA 2HVNA 4XZ9A 2RSQA 1PJ5A 1EYWA 4KFBA 1U8SA 2BV9A 3KG4A 4LFCJ 3QIPA 1YKWA 5TBOA 5IQQA 2KVQE 4IM4A 2ZRXA 2KZHA 4QIFA 2KT3A 4GACA 4PUJA 3OLIA 1M6JA 3K5PA 2FJBB 5K9DA 1SJQA 4LRFA 2J7HA 1R3QA 3L09A 3R7BB 2APOA 2P3ZA 2PDJA 1XGEA 4IO1A 3CBWA 4O3SA 2VGBA 2CNCA 2CNOB 4JBCA 4JY8A 1YPXA 3P5YA 4M5KA 3DI0A 2LXUA 4KRUA 2VT0A 3T1YJ 1RWMB 2VRJA 1QTMA 4NZ4A 5HJXA 4E0CA 2B7QA 2G5WA 3R6GB 4F9JA 3U1LA 1ZPWX 1RWUA 1NOWA 3FVDA 4DHGA 3VDAA 2MB0B 4YEAA 3Q58A 2W27A 3M8WA 2F61A 4FS9A 5E33A 5I3GA 3M1VB 2AQVA 4UTUA 3VKCA 3EVMA 1YRRA 3OD2A 3VNMA 2KAUC 2J13A 4USJC 3KK2A 3E1F1 1FWNA 2D7SA 5M2PA 5T91A 2B5JB 2OO4A 3CF5Q 3LLFA 4Z08A 3UEQA 4O15A 2HGLA 3FLUA 4HU8A 2J9CA 4HU0A 4ED3A 1IQZA 3QOMA 3HO1A 3M41A 1EX5A 3FA4A 3CWJA 4JI0F 1U1UA 3S2LA 1IHIA 2O4QA 3JB9k 3VGHA 4USWA 1VQ9S 4RWXA 3D3FA 1QXLA 3T5JA 2QN6B 1C9DA 4QQBA 1V4YA 4GIYA 1GOXA 2PP3A 3W7CA 3C8NA 4F8XA 3BLKA 4RU2A 1R46A 1F73A 4NVTA 2PWGA 4B90A 5IHRA 2CDQA 2D41A 1HQEB 1LM1A 2GQCA 4MMOA 4W89A 1TL5A 3QO9B 4IXXA 3SY8A 3A24A 3FEMA 1RK5A 4OE7A 4CD8A 5EYWA 3U7BA 5I09A 1JLGB 3H2VE 4QWBA 1TCMA 3FFIA 3M8SA 2V8PA 3KLKA 4NYPA 4HNUA 3NQGA 3IV8A 2XLIA 3UWQA 4C8ZA 2FUG9 5FAGA 3SBMA 2HWHA 3HG4A 3W6LA 2J7EA 3P82A 5G1TA 2HNYA 2CESA 2GL5A 3BLEA 5KG1A 1GCYA 4ZLJA 3K13A 3LSBA 5EKYA 4YR3A 2D73A 1VJQA 3MAAB 2UP1A 3V7PA 5T14A 5ETTA 2QEXS 4K7QA 4X84A 1GEHA 1IIHA 2RIJA 4JYFA 3THAA 1J27A 4C8NA 4PG8A 2O1PA 4JCLA 3VAIA 4D6EA 5EN1A 5D8ZA 1W25A 5KFUA 3VGSA 3EICA 3QPZA 5E1QA 4UTFA 2WMIA 3M9YA 1HKKA 5E09A 2BQRA 4UOJA 3R4IA 2DGTA 1ECEA 2IQTA 3G2GA 4CH1A 3AYRA 3PS7A 3QH2A 1V3ZA 1TCDA 5IV3A 4UQTA 2BVTA 2D3ZA 3TAMA 5HNTA 2EKNA 3FZBA 2Q1LA 2V2ZA 1J10A 4DUZJ 1RP5A 3UT0A 1VRUB 3Q8YA 3V4MA 2W7PA 3A9IA 2HFOA 4DBSA 2GIRA 4Q2MA 2IMOA 1BWKA 3CUXA 3W60A 1HXJA 4RDZA 5F4SA 4AFYA 2MTLA 3QBUA 4UBPC 2UUCF 2WHJA 2CVEA 1ZQ5A 3B8IA 4AY8A 5I42B 3PFOA 2JNJA 2VICA 2IJRA 4OQJA 2ZZNA 4RNMA 2MY7A 3GQCA 1S99A 5KFHA 1ENUA 3S83A 2YKNB 3V35A 1MLAA 4CNUA 3QMSA 3KFTA 3VOHA 3KK1A 2AEJA 4XAPA 1XCXA 1FA2A 4J27A 5C42A 1ELSA 1VFLA 2ZUAA 5M17A 3NZPA 5GAEI 2WBMA 1JRBA 1WOAA 3QSTA 3M32A 2OKQA 3O8WA 3NXLA 3QMTA 1BFNA 2D2HA 2CLFA 1VLOA 1UIPA 3OW2R 4RNFA 3R8HA 3BW4A 2ZUTA 5ABTA 4LIWA 5KOWA 3DGPA 4QEHA 5D2VA 4KO0A 1M7OA 3AYVA 4MK9A 1QR7A 2H48B 1Q6FA 2OQHA 3O06A 2NYIA 3LTOA 2A0NA 2GO9A 2OR2A 3ZJ8A 4E2FB 2CPIA 4Z1DA 4Z2GA 1H5YA 2R8JA 2OPPA 3ICJA 4AH7A 2GMLA 1DIDA 2XZ7A 3DX5A 4MTPA 3BQ1A 4XB3A 4PKDB 1Q3NA 5F1VA 2XN2A 1E0UA 3PZMA 2CPZA 1PE1A 1OC6A 2ZDRA 3G6MA 3AI0A 1EF2A 3NNAA 5D4PA 1YTDA 1FFWB 3PUEA 5D0RA 4HHMA 4J7RA 1Z4UA 2OKTA 4D72A 1EP1A 3U4FA 2MKYA 1CBKA 2TMDA 1S7IA 4M56A 1GXLA 3WUGA 1YRUA 3H21A 1NDZA 1H60A 4JUZA 1RSCA 4I6KA 2K1RA 4M3PA 3P5BP 4WK1A 3WNKA 1ZJIA 5A8RA 4C6KA 3J7Z5 5EGRA 3MSGA 1NF0A 3KBNA 3S3GA 3SCRA 3CAKA 5A8QA 3TNOA 4B15A 1CJTB 3C3UA 4CU6A 1H74A 4L6DA 3F4DA 4Q7NA 4AW7A 4EEYA 2E1DA 4XG1A 3R5BA 2XM1A 5C8BB 1VFTA 1Y5IB 3NG8A 4B3TJ 1NDKA 4DR6J 2ZZ4A 3WK0A 4MFEA 4O3RA 1RCOB 1FWWA 4BFAA 2HURA 4JTAA 3LM3A 2WVBA 4IH7A 5KT2A 3O9NA 4G2DA 1JQVA 1E9YB 3IRDA 4XVEA 1BE4A 1RVGA 1NK7A 4N4PA 5D33A 2EWHA 3TMQA 2RVJA 2FZGB 4AL5A 1FCVA 3VZIA 3E2QA 4S3KA 3DRYA 1KM2A 2NPIA 1ML1A 4X62J 4H9VA 2VWTA 5D37A 1UD4A 2GGPB 3N6QA 3QY6A 2OPRB 3MWAA 4CNYA 3I7RA 1O0PA 3QHMA 4LF7J 1XMQF 1XRSA 2V9WA 4KWWA 4TKTA 3VIFA 2BOFX 3PRBA 2W62A 3BK0A 3QMRA 2D0GA 3SRDA 2XZDB 4M7SA 4JV1A 1LRQA 3P8JA 1OJXA 1SZFA 4TYBA 3GYNA 2E67A 3W1RA 3GVWA 3PX6A 3NGKA 2R6OA 3URBA 1L9WA 4G56A 2R94A 3F03K 3M47A 4JI1F 3W88A 1BY9A 1SCJB 1ME8A 1UQYA 4GOAA 1WXJA 1DIOA 2QCEA 4PCPA 3WQ8A 1MW7A 3W53A 2RKIB 3PIPQ 2DJXA 3LZ3A 1CULB 3A3XA 2RQCA 5C9UA 1DWFM 2NSXA 5HOSA 3GIPA 4ZCIA 4C8LA 1JPDX 4BF9A 3BF4A 2HIQA 4Y96A 2GVLA 4A8OA 5T8GA 4A05A 2CQIA 3I6TA 3TW7A 4US5A 1R6VA 5I3JA 3BCDA 3PZPA 1TTHB 2E4TA 2V94A 1F3VA 4D2JA 1AZ1A 3GNRA 5HQEA 3ZOAA 3CEUA 4PFHA 3NP5A 1F9HA 3UZYA 2OODA 3Q8PB 5KZ6A 4AXIA 1FWKA 4WFBQ 1VQTA 4J9PA 4J2PA 3A47A 3TJXA 4E2OA 1JD7A 4NLTA 2WCXA 4KBXA 3VOJA 2IPFA 5GMEA 4HJFA 4K50A 1H62A 4JV2A 4JNZA 1OGBA 5BXTA 1U24A 3M8YA 2ADAA 4DCOB 1P43A 4LSLB 2QSWA 1I1WA 4PMNA 3O6YX 4B5WA 3A22A 2GAGC 1UVNA 2VQFJ 5A6WA 3WQFA 4DX8H 3ENQA 1H7OA 1I6NA 1MUWA 2VVNA 2PSNA 3PWIA 3CLWA 4CQ8A 4XZIA 2A21A 2BDQA 1X5SA 3G82A 1S2CA 4K6AA 1GT8A 4DF1A 1W9BM 4HJWA 1L3UA 1R0AB 4IQJA 4UCFA 2GCFA 2AL2A 4LS2A 4NMXA 4I5RA 1ZPVA 3J7A1 3AOFA 2Z7GA 1TO3A 4J9VA 3BOLA 3KK3A 4U8YA 1ZJHA 5DO8A 5KT4A 2UY5A 2HROA 3E9AA 4ZPTR 3MEEA 3A8IA 3D1OA 1UYQA 3IACA 3KOFA 1JXKA 3T78A 1X1ZA 3S9ZA 3CJ5A 1JR1A 3AD7C 5AHIA 2X40A 3MJMA 3VF0B 2HSEB 3BMVA 3WFLA 3EWXA 1KC7A 4RZ6A 2VFTA 2D24A 3HK2A 1UC4A 1EJWC 2MUCA 2QDEA 4WYLA 4FBTA 3AD8C 3BMXA 3HGOA 5F8MA 4GA8A 1LWFB 1OWXA 1UVKA 2HBRB 2FC8A 3SQSA 3GBDA 4PG4A 4TY8B 1N48A 4JL2A 4A8YA 3HLUA 2GJLA 5E7OB 3V5RA 3QR0A 3I0RB 1A47A 1NH6A 4L1GA 2OLSA 3T0DA 5CC5A 3SGZA 3ZFHA 3DLKA 1W54A 3MEDB 4XDCA 2PFDA 3WYZA 3F44A 1CC7A 5DDPC 4F50A 4NI2B 4EX4A 5DQGA 1EDGA 4OJ1A 1BYAA 3SRFA 2GVDB 3PPCA 2ZZ3A 4LTSA 3BXWA 5E5NA 2R7RA 3O6DA 5H9FJ 4FLQA 4PRRA 5AECA 1DHKA 1M5HA 1U2RA 2YDAA 1EP4A 1S1VB 3N2BA 1TKZA 3ITXA 1HWJA 1IVZA 3MUIA 3WNPA 4CLLA 4B3SF 1OYEA 4CN1A 5K8PA 4Z2JA 1VRXA 4A8SA 3CE8A 2Y62A 3PV8A 2WHLA 1LOLA 3T1AA 1JNRB 1YE4A 4NL1A 4N9DA 3TVYA 2F6XA 3CPWR 4YHHF 2HNDA 3CQKA 3R89A 1UUMA 4XQ6A 4TLQA 2XN0A 4JI6J 1W9PA 3H2FA 3K46A 2Q8LA 2QL7B 3W7QA 1KVKA 2A6OA 4QE4A 3H20A 4OTKA 4U33A 2DU2A 1CNVA 1TWDA 3W9IA 3EMTA 4QITA 2RDDA 4A8XA 4XTTA 3UJFA 3G18A 3ZZRA 4LQ1A 4EI2A 1I0BA 3TSBA 3FDGA 4GY7A 1FD2A 1K3UA 3B3DA 1S9EA 3EZUA 5HQLA 4KWUA 3ATYA 1TMHA 3SN4A 1EHAA 1M03A 3NM1A 4X0NA 3A4WA 3I32A 4NU7A 2BE7D 4GJIA 4C2MA 2PMQA 1K1SA 5HLFA 3PTKA 4GVIA 4XPEA 3M9NB 5H6HA 1Q82T 5KG6A 3ZZYA 1NJXA 4E0DA 3KTCA 4AMCA 3M0MA 1M7JA 2HWIA 3CJRA 1YPIA 4J1OA 3KLIA 4ZVTB 3J7YI 2X3DA 2VXNA 1J5OB 4A3RA 3DM2B 1IZKA 2BX6A 2H5IB 5J2NB 3U2CA 4QWDA 4DR4J 2XIJA 3S5ZA 1QK0A 2A10A 3Q2SC 4GNJA 2NZ4A 3EDEA 3PPGA 2DW7A 2AQOA 5I5RA 3M8RA 3W76A 2YIHA 3UZ5A 2QW5A 3RDKA 1ITUA 3N17A 3OLBA 5D05A 5F8HA 2A6MA 3N28A 3QAEA 1CJVB 3H2OA 2ZRVA 4CYUB 3FNNA 1B7YB 3FCHA 4E98A 2FYXA 2PRMA 3ZWTA 3DFOA 4LUSB 4H7ZA 4DZHA 3WD1A 4RDYA 3A1YG 5IWAF 6FD1A 1QMLA 2E9RX 3SZ8A 4F79A 3LM7A 4QAWA 4ZENA 5I3KA 3UG5A 3LAMA 2J8FA 3MHYA 2RILA 4LBPA 4ZCLA 3OVAA 4YNGA 1G4EA 1ZTTA 4HQVA 3Q94A 4AD5A 2HNYB 3ENWA 3WQWA 5IM0A 1X98A 3TA6A 3TSDA 3F41A 4QXIA 2OPSA 3QN3A 5ADZA 1QVGR 2HMCA 3M2UB 4MWAA 4LF8F 1VYAA 3PXGa 4KKXA 1R0MA 4WQ6A 3EPIA 2ZHAA 3TJ9A 2RH3A 1HHQA 2BOAA 2JHEA 1PTAA 1M1GA 2DSKA 3KL5A 2QVHA 1Q4RA 2PMWA 3BO4A 1TUFA 1PGZA 2J6SA 4XO7A 2WHOA 4RE2A 3KXDA 4OI2A 1FFRA 4AY1A 4CKQA 3TYEA 2FIQA 4OI0A 4KESA 1RHCA 4EPBC 3ARZA 4KFBB 3WUBA 1A6LA 4LCRA 4KCTA 3OV7A 4GO5X 4RKAA 4DM2A 3TQKA 4HMEA 4JN7A 2VOMA 2ZXAA 5KFRA 1GOKA 4JKKA 1YTYA 3H70A 4N7QA 4GO9A 3TYDA 5CC6A 3N0VA 2V5KA 5H1WA 3BGRA 3AY0A 4PMXA 3NQAA 1EIBA 1GOOA 1X1OA 4MPKA 3VYLA 4N7TA 1SO5A 1MG7A 4PYSA 3AS3A 2QIFA 5KFGA 1UWSA 4K4SA 1GYMA 1P9YA 1TR1A 5I42A 4EBEA 2XCPA 1HJUA 2VR2A 3PBGA 1HW9A 5F2IA 1TKTA 2OTLS 4RW7B 2X3GA 1QE1B 3G8RA 1PDZA 1OD8A 5ETSA 3G8TA 3TEGA 3MCNA 3C6CA 5I3HA 4DSJA 2J0SD 4Q4PA 4DF2A 4WXYA 4LF4F 1TWSA 4FF1A 2WYSA 3HULA 4C6BA 4KIRA 4DNMA 1SJDA 4HYWA 2YH0A 4FXFA 3ERPA 1REGX 1S6PB 4ERIA 2R7XA 2FGLA 2HW3A 2DGSA 3WLJA 1GMUA 1VMBA 1XC6A 4CD4A 1RAOA 3WJZA 1QW8A 3HGRA 4H4KA 1TRDA 2DY1A 1G2EA 1OINA 2EPLX 5FJUA 3S2CA 2XG8A 2J75A 4QU7A 2XFWA 4KRZA 5A6PA 3MI2A 3WQEA 5B0AA 4PCFA 2YWKA 2GAHC 2K2PA 2ANUA 4Y7EA 4IGMA 1OG6A 3WQ6A 1N36F 1OX4A 3R5CA 2XY5A 3SCLE 3TFCA 1W17A 1XSKA 3T5LA 4C6EA 2E6FA 2JRSA 4A8RA 2Z6JA 2CRLA 4WP9A 1RV8A 2NUUG 1OGGA 5DELA 3M07A 3UCQA 2DD8S 1U1JA 4I8DA 4DO4A 3S6DA 2L3MA 3ZFVA 2CVIA 1VCVA 2H51B 2RRAA 2BGQA 1J5OA 2OSQA 4DBEA 4ZVRB 5LA2A 2FZCB 3TW9A 1KNZA 2VRKA 3PEHA 4CLFA 3QZ8A 4HN8A 3FYOA 4LF1A 4DV2J 2G13A 3ABXA 4B2DA 1XTZA 3W01A 2VQEF 4JI2F 5HA7A 3A5VA 1CGTA 4OZ3A 3W5ZA 1CXKA 2QPXA 1WF0A 1FVQA 5FEPA 2AJQA 1XGZA 1N33J 3QT5A 4PWUA 1D1UA 2HQAA 1TG7A 4P73A 1WUEA 4I9AA 1J0ZA 2H9AB 2QJMA 3TJIA 4M81A 3S8HA 2XIBA 2HFZA 4HPNA 3P3DA 4PA8A 2QCMA 3W7GA 5E70A 4FHAA 1TV4A 1H0IA 2ZXQA 5CD4A 1HUVA 2UVRA 1Y11A 3C46A 2VI0A 3MKKA 4YB1P 3W1MA 5BOFA 1J2BA 4O28A 1W26A 1HIYA 1KTBA 2M2BA 1U1HA 1IM4A 1U6BA 4GKJF 3KRUA 3CJQA 1PEZA 3TXZA 2CU0A 5C6MA 4OKDA 1E4MM 1ONWA 2EPMX 2IAJA 4MKNA 1VC0A 4IPPA 8A3HA 5DQPA 5BU6A 3M0JA 4WFAQ 3VAGA 4ADTA 2E9MA 3S1UA 1AH4A 2YB1A 4YQWA 2KI2A 4IOTA 4ZVEA 2WVEA 4RNOA 3GJQB 3DHWC 3AHTA 4DUWA 2FJDB 3G6YA 2IMRA 3ICLA 1Q8IA 2VRQA 1YDVA 1P6WA 1TP7A 3QSYB 2RU9A 3W00A 1FHUA 3DGRA 3HV8A 3Q8SB 3BAYA 4DSFA 4P2FA 3MI7X 5LHEA 2O4MA 4DJFA 1HKAA 2ISFA 3POTA 2VELA 1VQSA 3W7IA 1SB6A 1GOIA 3PFMA 5LOQA 3ENLA 6A3HA 1XLBA 3ITHB 2ABYA 3OHMB 2P9GA 2ZRZA 3CS2A 4IMCA 5FKYA 3OFEA 3ITLA 4KGZB 3IJ7A 1TJ1A 2A3BA 2VFUA 4ML9A 4K0KF 4AT1B 4D1IA 3FBBA 4IIFA 2V9KA 1FDDA 3TR9A 2GJFA 2KYZA 2DIJA 3K8VA 3ZLFA 2IJNA 4Q22A 1F5CA 5ETMA 4ZFMA 3WZ0E 3QRPA 1ZYQA 3I3DA 4GK8A 4YB5A 2IW0A 1MQRA 2JKEA 1GMWA 1RAIB 5GNYA 4ED5A 5DRIA 3MM6B 1XQIA 4ZPCA 5CPMA 3B04A 1F3FA 1XN9A 2R8IA 3PR2A 3FJLA 3HM7A 5CAHA 1JZ2A 1EZZB 1KRPA 1KXQA 2ZQ0A 4RK8A 3T0AA 2AMCB 3FCPA 4PEKA 1F5ZA 1YYAA 1W1TA 5AY7A 1IWBA 4AZ5A 1TPEA 4FXJA 4IL2A 3G77A 2W9BA 1TKDA 3PUGA 3KWSA 5ABHA 3MI6A 4Z0SA 3ZVIA 3UDVA 3W2VA 3QV6A 3K5MA 2L9WA 3ZTQA 1XNQJ 4NLVA 1YLXA 2V8HA 3W82A 3UI3A 3V18A 1EIXA 3RTVA 3ZLGA 1WC5A 5B09A 1PPIA 3GX9A 2A6LA 1GEQA 1U6FA 1QPNA 3G2XA 1ADDA 1Z41A 4A47A 5HSPA 4WOZA 2FKPA 3GDRA 1FWHC 4YCPA 1ISVA 4PMJA 3Q2TC 3UVJA 1YVFA 2PWFA 1O5RA 2IY5B 1MMFA 1G94A 3CJ8A 1JCJA 2PGEA 4UR8A 1H3GA 2QRRA 1T96A 5KTQA 2ZZ5A 1WUUA 3SCQA 2KJWA 1OQFA 5EMYA 5EWEA 5L1LA 5I77A 3DRSA 4OU1A 4KE5A 3QGPA 5ENLA 2QFJA 3GG0A 3LHWA 4M5DA 1HKVA 3IIOA 2BNJA 3ONCA 1F9CA 3TC7A 2PSZA 1QBBA 3W71A 3B8UA 2YKKA 4IFYB 3KOZA 4ED7A 4D9PA 1B0TA 4CWBA 3PR5B 1UCWA 2G9OA 1BQNA 3DYAA 1XDLA 4HGXA 3PYGA 2B43A 3CCQS 4DRSA 1GG0A 3C15B 1QW7A 2GGHA 4TXSA 3S9YA 2NLIA 5I7GA 3N4WA 5IT0A 1OO0B 3WX4A 2KH9A 4UQGA 2CBUA 2POZA 4AX6A 3SCVA 4C6FA 1WAUA 2QCCA 3B4UA 2VPXB 3C4UA 2PCQA 2W63A 4LF2A 4DBQA 4OX7A 3CHDA 4I6YA 1RVKA 3NDYA 4KGLA 4ZP6A 3M6VA 4JTQA 4G9PA 1P0BA 4YL2A 1SGJA 3MDWA 1N5QA 4H4IA 3DG7A 2K3IA 5AXMA 3FFIB 4B9UA 5EMLA 3QIPB 1IQTA 4LUYA 4HVXA 1E1FA 3H4DA 2BG5A 3W81A 2WSQA 1BRLB 4B3OA 3BEGB 3H8YA 4ZFCA 3KVKA 1TX2A 3DYPA 3EWWA 1SC3B 3SCKE 1KOHA 1UR0A 2GUYA 5ABFB 3QNWB 2A5HA 5GNXA 2YR1A 5B0EA 3F2BA 3HHDA 3MKVA 4OLPA 3MUVP 1Y5WA 1WCGA 4W93A 4MK8A 4LQ3A 5BYRA 2WBKA 4DYJA 3HHLA 4GXMA 1C8XA 1ITQA 3OTDA 4REQA 2BWGA 2PEVA 2HS6A 3CCWA 4N0RA 2OSXA 5AKQA 1B3TA 2PPGA 2DNLA 5CGTA 1WNOA 8XIAA 3WH6A 3RHGA 3I68A 5A6TC 1S1VA 3N9RA 3DDIA 3C61A 2XCAA 2HHHJ 1GJWA 3ANYA 6ALDA 5H8PA 4ZMMA 3PO5A 1TL1A 4DR7F 2X30A 2W92A 4NZ1A 4QBUA 3PK7A 3EXYA 5GNZA 2H9AA 4JTEA 3LTYA 1YEYA 3N18A 1C1BB 3T0TA 3ILIA 3R0DA 3F7JA 2OOFA 2BS9A 1I4NA 5KG0A 4GABA 4OOUA 2OAUA 3GB6A 3H55A 2FHMA 3PN8A 2VG7B 4DUYJ 3OA3A 2ZWZA 4GFIA 2RQ4A 3PZOA 2CW6A 4ED2A 2MJNA 3W7RA 4MPQA 3FEQA 4CGTA 3UXKA 5JH1A 3H53A 3JYTB 1S6QB 5KFDA 2IYIA 3DDKA 1EL3A 2GSEA 3L9ZA 2FTRA 3OR2A 5E0CA 1I94F 3RR1A 2B7BB 3LPEA 2W9CA 2OFHX 1LWHA 3EOUA 2R24A 3LOUA 4UOHA 3EWYA 5A95A 3GH4A 3CCLS 3WNNA 4KIAA 1UD5A 2RGLA 4NXNF 2F3JA 7AT1B 1CI1A 3HPSA 4I67A 1XIBA 3MM6A 1GTEA 3HVTB 5BR8F 2V2QA 4ZB2A 1S1UB 4RDWA 4OYAA 3DGPB 3F4WA 3NEKA 4PXDA 2VODA 4R0JA 4M95A 3GHSA 3K8WA 4F3MA 2HXTA 4CCDA 5A8GA 1L6SA 1L8PA 2Q3OA 5A6KA 1RYRA 5AHFA 5HWJA 1UR9A 1ZFJA 4K7YA 1ITXA 1F3XA 1R9ZA 3GM8A 4DXVA 1RHKB 3IJ6A 1TVNA 1H73A 1FJ7A 3TI0A 3W1LA 3FEYB 1V7YA 1R6WA 5KG5A 3MANA 3WHIA 3R0UA 3VGGA 3BOFA 4W4MA 4AQYJ 4O4WA 2CKSA 4UTTA 5AC8A 1EGMA 1N5VA 3AUJA 3SUSA 1UA7A 3DKDA 4GBDA 1IWAA 1K0TA 4GLEA 2DZUA 3CJPA 2FGCA 4RU9A 2VA2A 1X6UA 3GKFA 2V81A 1BGXT 3RXZA 4GIEA 4CTAA 4LWWA 4PQUA 4QWAA 5D2YA 1Q1KA 2GZOA 4FF2A 1ISYA 4IO9Q 4ACZB 3MF5A 1SH2A 1FVSA 2YNGB 4DR3J 1GVOA 4D6GA 3SCJE 4LFYA 3H2AA 1VRUA 1I51B 3LF0A 1W3TA 3S6OA 4GYPA 3P3BA 5ETQA 3BAXA 3NEVA 3VKKA 5LIYX 4N2YA 3ALGA 1AYEA 2ZH8A 1C93A 4LCQA 2ODOA 2R91A 3HF3A 2XI2A 4M1KA 3V5CA 1N56A 1OFAA 4QJ1A 2B7OA 1W3IA 4IUOA 1QNRA 1YBQB 2FMOA 3BQ5A 2Y1JA 3S4TA 5CPSA 2BJ3A 3E01B 4AXNA 5M1TA 2PD9A 4DPUA 2HIYA 5I4MA 2NREA 2BABA 1FA0A 2CITA 2DBBA 4ICMA 2MGZB 2CKRA 3KHRA 1BLUA 7A3HA 1OADA 3A23A 2A3EA 3O07A 4R7WA 1FRBA 5FF3A 5EWGA 1ZTWA 4H7VA 5JBEA 1WI8A 2CPJA 3DXBA 4LF7F 1YJRA 3VC6A 2BV3A 2KG0A 3VNZA 4PMRA 4GWEA 4C0BA 1AFSA 3WQOA 1MNEA 1V5VA 2E68A 4M63A 3RR8A 1T7LA 1NDYA 3IWNC 1B3VA 1UROA 1MEHA 5FIPA 4Q8TA 3HSGA 3L23A 4K4YA 5KETA 3S9IA 3O2LA 1CW2A 3KHJA 5AC7A 4K4VA 2CQ0A 1UPMB 3SQOP 2VEKA 2HEJA 4EE9A 2J66A 4Y9AA 4NZ0A 1HP5A 3PFRA 3NL3A 2WHKA 2YNFB 4ZO8A 3AB2B 5D8WA 3A3PB 2UXBF 1A0CA 2XN1A 1HGWA 3APYA 4X66J 5HQ8A 2DUZA 3MTKA 3RGTA 3LQVA 5KFNA 3MZIA 1TRIA 1WZLA 1B3ZA 1OYAA 1NLKL 3QW3A 2B7CB 1TWZA 1Q6DA 2DORA 4JNMA 2AQ4A 1PCWA 2CZ5A 2GQ9A 3LPPA 1M9HA 2DH8A 4HNCA 1SJCA 3LH2S 4PG7A 4OL8A 3HG5A 1ZAJA 3NSMA 4JQ2A 5JQ9A 2DNGA 1OCBA 4JI7F 4M5IA 4XAKA 3ABQA 4OHXA 2CQPA 1W1IE 5EUHA 1LYXA 1SJRA 3F4VA 5CPQA 4MOZA 1FHTA 2BGNE 2CWXA 4X9SA 1N7KA 3D46A 4Y34A 1AD4A 3A4AA 1OY8A 4Q33A 1ULRA 4ZLPA 3M5XA 1YADA 2YNIB 3T1HF 2WJFA 3MMUA 2RJZA 1S0NA 1G4PA 2PDGA 4IQXA 3OBAA 4GGBA 2PTXA 3QT7A 3IS4A 1I60A 1WAWA 3QY8A 2ATCB 1G4CA 5D4NA 2VD3A 2ZBRA 2L08A 1TTPA 1XS2A 1A5NC 2CKWA 2CZ9A 1WKEA 4FXDA 1EF3A 2BE2A 3ECQA 2O7QA 3HQPA 3CUNA 4S2CA 2QL5B 1Q53A 3NRBA 4B3TF 3GYCA 3G1RA 3OSNA 4X63A 3W7OA 3PZNA 1O60A 4XSMA 2XMWA 3HGJA 4ETZA 2ZRWA 3UPFA 2M0GB 4FO4A 1LWCB 1RAHB 4ZOAA 3CD6S 1NQKA 2XYHB 3WK1A 5GQBA 4KPLA 1IT7A 3UD3P 3N3TA