3KDNA

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
437
structure length
436
Chain Sequence
IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase
publication title Structure-based catalytic optimization of a type III Rubisco from a hyperthermophile
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Lyase
total genus 142
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3kdnA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3kdnA01
2CXEA 1IR2A 1RXOB 2V63A 3A12A 4F0MA 5HJXA 2V69A 2D69A 1YKWA 1RBLA 3AXMA 4MKVA 1UPMB 2OEJA 4LF2A 3FK4A 2OELA 3QFWA 9RUBA 2YBVA 5HATA 1UW9A 2VDIA 5HK4A 1SVDA 3AXKA 1AUSL 3KDOA 5HJYA 4RUBA 2ZVIA 4NASA 5HQMA 5RUBA 1EJ7L 1RBAA 4LF1A 1UPPA 1RLCL 4F0KA 1RCXB 2V68A 8RUCA 2V67A 5C2GA 3RUBL 1BXNA 1RBOB 4F0HA 3NWRA 5HQLA 1IWAA 2RUSA 4HHHA 1RLDA 1AA1B 1RCOB 1TELA 5HANA 1BWVA 1UZDA 3A13A 1UZHA 1RSCA 2V6AA 3KDNA 5HAOA 3RG6A 1RUSA 2CWXA 5C2CA 1IR1A 2OEMA 2VDHA 2OEKA 1GEHA 3WQPA 1WDDA 1GK8A 1UWAA 3ZXWA 2QYGA
chains in the Genus database with same CATH superfamily
1BYBA 1RT7A 3SCNA 1X38A 2A3JA 1FDNA 5FEXA 1BSIA 5BXTA 4UQBA 1ZETA 4UOCA 1E4LA 1EHNA 4ERGA 3HJEA 2N3LA 2CCRA 2AKMA 1KS2A 3NPUA 3M2RA 2XI2A 4GH1A 3DI0A 2F63A 1JNEA 1E6RA 2ZVSA 4JI0F 3AXIA 4YDXA 1RTDA 5B0BA 2FMOA 3PZVA 4F0RA 1RH9A 2GJ2A 4LFAF 3K7RA 4USKA 3EPNA 2JKAA 4N9BA 3TQKA 5FESA 2BE2A 1TK5A 1XSIA 2CPYA 2F3JA 3F2BA 3C3UA 1ISZA 3JSRA 4OHYA 4IGMA 4PBEA 3CCJS 3EA2A 3BMVA 2W2NP 2AYGA 4YL2A 1TWIA 4OKDA 3GC4A 3W82A 2HNZA 1F6YA 4ZBCA 1EDTA 2Z56B 2VCCA 4LPCA 3TQEA 1FRHA 2GDUA 3OP2A 3GIMA 3EZOA 4JN8A 2XTJP 2E1RA 4NLVA 1EIBA 1HI8A 4NA1A 1NY1A 1XG3A 1XK8A 4KC5A 4ZN1A 3TN4A 3IGXA 2J9ZA 1XSKA 3K8KA 3JYTB 4FX7A 3AIUA 2XB2D 3L12A 4O1EA 1MZRA 4FXSA 4B3RF 4JYFA 1HW9A 2ZOGA 3EDJA 5E3RA 2RUGA 3VIGA 1DARA 4PQUB 2HBZB 5EPDA 1FWAC 1BTMA 2J8TA 4U6PA 1KBJA 3UJEA 1M1KT 2A3HA 1VMBA 3VYLA 4AIBA 2Q3RA 5KFTA 2R94A 5CZVA 1XLEA 1JF5A 4MAZA 3IUDA 1GOMA 2ROPA 3TJAA 2XS2A 5D38A 2V4QA 1TFWA 1U8WA 2J7BA 4WY0A 3DLKA 3AZTA 1DTTA 3W61A 4DXXA 1RAGB 1S6UA 1L3SA 3MZNA 4PUEA 4DLMA 3P96A 2PC4A 5GADI 2X41A 3BXWA 3UPBA 1TV5A 4WDXA 3V5OA 3ZZTA 3AIEA 3LYEA 2WVBA 4MH8A 4DUWA 4CLLA 2G3IA 3KOFA 2QSFA 1T5AA 4DF1A 3T6BA 4M3PA 5CSYA 3PX4A 3VR1A 3LQLA 1T03B 1QSLA 5F4SA 2VPWB 3AY0A 3UDEA 4J28A 3FCVA 1W9DM 1RWMB 2EK1A 3JQKA 5G5IA 4LUSB 3RM4A 1XM3A 3E5BA 1AQ0A 4IOAQ 1JRBA 2NV9A 3BSAA 4LJ3A 1W5OA 2C2EA 2JEFA 4FPRA 2H9ZA 4EWTA 3P3BA 4IM4A 3SN1A 1SFTA 1LRNA 2CLHA 5C7HA 2OWCA 3CHFA 4H2CA 3C0QA 2KU7A 1HQUA 1FJGF 3DCPA 1MN7A 4JFWA 5DFAA 2UY2A 2WBRA 1QWGA 2ZEJA 4KB7A 2VURA 3KUGA 1OABA 3GWCA 1VAHA 2BW2A 1KR1A 1VB9A 5ECUA 3OPKA 2ZFHA 4PCFA 4KF1A 1XIBA 4NI8A 2OT1A 1JPMA 2ISDA 3G82B 3GG7A 1N0VC 2L08A 3WUEA 2WMHA 3AD9C 4IOBA 4XIAA 2ZNYA 4IZGA 1V0LA 1GQLA 4PMQA 4ZL1A 2P3EA 4PAAA 2DZSA 2YR1A 1Q8LA 3C6UA 1JDCA 4LF7F 2NT0A 2C3UA 4IQMA 2FPYA 3VGGA 1RWVB 4U7UD 1IZJA 1H2JA 3NGSA 2WW5A 1FH8A 5RUBA 1EGVA 1PL9A 3WBEA 4GABA 2D9PA 2WK2A 4XK2A 1FFWB 3H21A 1OWQA 1FWCC 4WXZA 1J2BA 3NGRA 3IWPA 3OVRA 2PFHA 3T42A 2AX1A 2M7SA 3PULA 4C1LA 1NPRA 3CLMA 4JQ3A 2A1YA 3QJJA 3L5MA 4OV4A 1IWBA 4JYEA 3NWRA 1XRVA 4LH8A 1PX3A 1U83A 3F7JA 2KVIA 3N9UC 3BGUA 5LA2A 2VC0A 3WBAA 2FZCB 4HA0A 4DB7A 5HMYA 1UVLA 3JAMY 4QG9A 3IGSA 2R7WA 2AOSA 1XQLA 2CHRA 3UI3A 3R58A 2EBGA 4DIAA 1CGYA 1L9WA 4J4KA 4FYVB 1ZFJA 3F5LA 2E3ZA 1WNEA 2I2YA 3GK0A 4A8YA 4G7EA 4OU1A 1JD9A 2EHHA 4NZCA 2FQQB 1F2GA 3NCQA 1S2VA 2P10A 2DH8A 1GK8A 4GIYA 4JDYA 3A4AA 2MJNA 1E1CA 3P60A 2I7GA 3VQSA 3S2LA 2CZEA 3QLHA 4IPLA 1DPMA 3V5FA 2OXNA 2BOAA 2VH7A 3W76A 4BZYA 1UD6A 5E9AA 5MF5A 3GR0A 5DGBA 4OOUA 4GFSA 3ZTRA 1AYEA 4ZSTA 3LGDA 4WKAA 2AEMA 4MIMA 2AMXA 1W9BM 4UW2A 1X5TA 1VFFA 2WWDA 5DDQC 2WPBA 4BJHA 2YYTA 2HNYA 5B0DA 3TDFA 1JIHA 3CMJA 4L80A 4P8WA 3PWAA 1A5SA 3N2MA 1RAAB 4OYXA 3KG1A 2J74A 3QIDA 4B4HA 1RWKB 1E73M 2WMKA 2EEYA 3H6OA 2DNHA 2VT0A 4LYKA 3QW4B 4A4AA 3NCRA 4I9AA 4GUGA 3VOCA 1FDJA 3IAM9 3WQWA 2M88A 1PKMA 1XSJA 2BBEA 2LA4A 3BC9A 3ABQA 4DJED 1E0TA 4K8EA 3PUDA 2BUNA 1R7AA 4P2VA 2DR7A 1EBHA 3VINA 2GJLA 2ASDA 3RJMB 5FOOA 3OW2R 1VJIA 2ALDA 3G71S 1X8CA 2V3DA 3DGPB 4X64J 1P0DA 3OD2A 3PACA 3S1XA 3ARRA 3BR8A 4QE5A 2A10A 1WI8A 2J4GA 3VALA 3QKEA 2ICSA 2FPTA 1VPYA 3TTEA 3VNIA 1JB0C 4I4BA 4Y0FA 2Y2WA 2VGIA 4R5PB 3TTYA 4RZRA 1FDZA 4C1NB 4H9VA 4J40A 3EVWA 3MO4A 1M1BA 2H65B 3D66A 4IDKB 1UZDA 3ICJA 5F8LA 1PBGA 3NNAA 1U22A 1S57A 3SXLA 1R9YA 3KRZA 2GJIA 3BZGA 3C6TA 3BKUA 4G6CA 4K0KJ 3KDNA 3MW7A 1KQZA 3CS2A 1REVB 2W7OA 2ZDSA 2DGAA 3NOYA 2VQUA 3KVMA 5BR8F 1SPBP 2ROEA 2YZ5A 3T81A 3HHLA 3TAMA 3DYAB 4H4OA 3AO0A 1SV5B 1WUUA 2QR6A 1SCJB 1JZ4A 5DXYA 1H3GA 4LBUA 3B9EA 1HKVA 1UL3A 3NO3A 1W1YA 3UETA 4PSPA 5T7LB 2XN1A 4MB5A 2PWVA 4Y2IA 3MS8A 3P81A 2VEKA 3W7CA 3W2UA 4EBDA 3BSMA 2J8AA 3RZAA 1KRAC 3VC6A 1GVRA 3W2JA 4D6DA 1BPLB 4DPPA 1DQAA 1W9VA 4JN6A 3EXTA 4AW7A 1FHVA 3AYSA 3NO5A 4Q0BA 5D03A 1CJVA 5H9FJ 3OJGA 4OBRA 3LF0A 1RGVA 5LNRA 3MEDB 3SUWA 1APSA 1W31A 3QGGA 1TTHB 4H6RA 4B9VA 1VCTA 2X7VA 1TP7A 3K59A 2E66A 1RAIB 3TJLA 4AWSA 2GYIA 3E12A 2EAWA 1NDCA 4FI4A 4R5EA 1TKZB 4IFYA 4R0EA 2WCAA 2D3O1 4AD4A 5AC7A 4GKTA 1J0YA 5M5DA 4PXEA 3NL2A 3LDVA 2VQFF 2NQ5A 2V4JB 2W9AA 1FKAF 3A3OB 3GDKA 2DIKA 3AD8C 3WQ5A 3BSGA 4YY3F 3MUMP 3VOHA 4YWSA 5HPCA 4FA3A 4GY1A 1QHZA 4UQCA 4UTMA 3NRBA 2PDIA 2NLWA 1OC6A 2PZ0A 3B0UX 2CPEA 4WJBA 2D9OA 1NQKA 3R2GA 4A8KA 1MMNA 1R2TA 2OPQA 1GMVA 2WB4A 1S79A 4BR1A 2LEPA 3KEHA 4M24A 1E9ZB 3L9CA 2UUBJ 4XZIA 3QN3A 4UY85 3VDAA 1WDSA 2A21A 2PO4A 4Q6JA 4YB1P 4NZJA 4GX9A 2MANA 1WAWA 4JCMA 5D78A 4QWBA 3K46A 3QBUA 5T91A 5L1KA 2JEIA 1I51B 2CWXA 5E1QA 1MU2B 1KXQA 4F40A 4XX6A 7FDRA 3VAMA 3PVXA 4N76A 5DZ6A 4XD6A 4K4TA 3STCA 4XZHA 2FB0A 5FEWA 2CW6A 4FXWA 2JEPA 2DO0A 4LF6J 1JNZB 3SSJA 3TQ1A 4IG2B 3L4BC 1NDWA 4J3SA 1ELOA 4RWXA 5MLCV 4PRWA 4GBUA 4B9YA 2CZ5A 3J7YU 1NFGA 3CVKA 1R89A 3LCGA 2LXUA 3I96A 3M6UA 4Q8UA 3K89A 1JQXA 3CT7A 2F38A 4GGBA 4W98A 2WHLA 3ARZA 2FHCA 3M0MA 3R13A 1NPKA 1C9DA 3II1A 3OIHA 3C2PA 3UA3A 2JQXA 2WM0A 2CITA 4WSJA 4L65A 3DLJA 1V3IA 3UZJA 2EPHA 1HNWF 1Q3NA 3S8SA 1HBOB 4HCDA 3SGZA 2VOOA 2UUCJ 1A53A 4ZMMA 4OTKA 1PCWA 4JHMA 3WDQA 1MNZA 2ATMA 1D9AA 1HNXF 4NXNF 1URRA 2K7KA 2HQGA 3L67A 1BMQB 4IO1A 4ATLA 3E49A 4ZJQA 3Q8UA 4IRDA 2WWCA 4LUTA 4X2BA 1JCMP 3SDOA 3WDOA 3ZS4A 2KXNB 2XH4A 3W1AA 4B5SA 1R87A 2EKGA 3NGUA 3BPSP 3MU7A 2VQEJ 1GOIA 4R88A 1GJUA 4IXHA 2XCAA 3PWGA 1CLFA 4NJKA 1NQ6A 2DY3A 4IIFA 3OUYB 2LMIA 1UPPA 3GPAA 3RYLA 4I3GA 1L5UA 4TY8B 1RADB 1N55A 2MTLA 4M56A 4G1PA 3CC4S 1XXXA 2JVRA 2EW9A 5JBFA 1FKPB 5ECVA 3JRKA 3A4TA 1GMUA 5D4PA 3PVFA 4P7OA 3BPWA 3DFHA 2DVIA 4A8FA 4IJCA 1X96A 3M0IA 3NPVA 5CC7A 3J7HA 3M8PA 1LUCB 2IA6A 4HNVA 1QW7A 1TL3B 1N48A 3PRBA 3ARUA 5D37A 4DR6J 3O63A 1ACMB 2E25A 1S9GB 1Q4WA 2QW5A 2FHJA 4DN1A 1X98A 1TA3B 4ICCX 1OIFA 1DJHA 3GY1A 5DCEA 3ABRA 4ES3A 4YTSA 3FN9A 1B0PA 4CO1A 3PZOA 1G1YA 3BSNA 3ARVA 3RM9A 3UVIA 2ZNZA 4MFDA 2QDGA 2ZH3A 3TUJC 5L1LA 1HUVA 5LKYA 1V5XA 3UD3P 3EEGA 4K38A 1X4AA 1CVJA 1WA3A 2NPFA 1VS1A 4EPBC 2V3GA 4OZ3A 1SO5A 2EJAA 3CMQA 3VNLA 2A3BA 3AOCA 3EWWA 1JXJA 3FFSA 1QLNA 3CIXA 4L6DA 4ZP6A 4W86A 1IBLF 1BHGA 1E6QM 2OQHA 5H91A 3UYCA 4OHZA 2W91A 5GAGU 2C3OA 2PRMA 3O44A 3VGSA 3R2CJ 1XL9A 3OTOJ 2XM1A 3RITA 1CPUA 2EPKX 2Q09A 1XMOF 4M5PA 4U10A 4NLGA 1WZAA 4U5IA 3FZBA 3S5SA 2HNDA 3PC0A 2YWGA 3RN6A 3A8EA 1XYAA 2KG0A 3OGSA 2XZDB 3NIYA 4OUIA 1PSCA 4YYCA 3LBCA 2VFVA 3R5DA 4NP7A 2CYGA 2I56A 3PPCA 4I6WA 5D9PA 5KFAA 3GDRA 4ZVQB 3CCES 1J9YA 2V2VA 3KZSA 1EQPA 5DMNA 2HBQB 3PW2A 2A6LA 4RO0A 4BEUA 5BXIA 3TVKA 4N4QA 4LVBA 3MM8A 4LR7A 3KK3B 3L9ZA 2QJNA 3TYTA 3IVSA 3PG9A 2XHCA 2FGLA 4NLDA 2X1GA 1ADSA 2IM1A 1VRTB 4JFTA 3LV5A 2KZMA 3UD6A 1XC6A 1VC6A 4Z1BA 4QP0A 2Y7DA 3GB0A 3F2CA 2RDDA 3DIPA 1PB0A 4NX5A 5CBJA 1XIGA 3CUHA 1FKXA 1RBOB 1RHKB 5F3ZA 3OSNA 3V5CA 3MCOA 3GJQB 1T99A 1VYPX 1XN9A 5DLFA 2L9DA 1LWEA 3BZJA 5LIYX 2WW4A 1RCOB 2CNKB 5CYQA 1WKDA 4YVXA 5M1TA 1PKUA 1WC3A 1KFEA 4TXEA 4HZ8A 1VLWA 2OJ3A 2R42A 5J2QA 4M94A 1XH2A 5B80A 4MSSA 4GYJA 3VZXA 1E51A 1X9MA 2CQCA 1ZAJA 4RX0A 2KXHA 3BQ6A 3BDEA 3NGKA 3OTDA 1SKWA 1YEYA 4LUBA 3W2VB 1B3VA 4NLQA 4C0OC 2GJFA 1ZS2A 5D02A 3XINA 2EG1A 1RAJA 1TQJA 1U5VA 1OYEA 5CZJA 5T41A 2C42A 3LM7A 1IIHA 1N6QA 3CIWA 5CCLA 3VCRA 3PG8A 3KOAA 3W1NA 2AKWB 4M5JA 2VZOA 1J0IA 2HZVA 3DHDA 1PC4A 1VLOA 3NZ1A 2BQ3A 4JNYA 2CJYB 1QM9A 2XN2A 1OJ4A 3V6KA 1T41A 3UERA 3GIJA 3BJTA 1Y11A 2LP4A 2FZ9A 2HROA 4DUYJ 2Z1KA 5FAGA 3RAXA 2CZDA 1UQYA 1UPMB 2UZAA 1VIZA 4FLOA 2R7TA 2HFSA 2PFDA 3SM0A 4S3AA 2DEJA 3GAYA 2ABBA 1KBLA 5KFRA 4D6IA 2GVJA 4HMEA 2V38A 3WDIA 9XIAA 3KOYA 1EKRA 4ED5A 1T95A 1URNA 1WBHA 3VD5A 4I5RA 3ES8A 5DO2A 3DUGA 2FJWA 1FTXA 5CEWA 4U2ZA 3MUXA 5C55A 3A21A 3C14B 3F0NA 2YBTA 4PC8A 2IM3A 2ZZ4A 1BKSA 1TFYA 2ACUA 4J5OA 2BDQA 2JIWA 3WQFA 1QI2A 4W84A 1TL1A 4AD6A 4GKKJ 4LWWA 1CNVA 2VG5B 3HHDA 1V3LA 2YJQA 3LG3A 1ITPA 2WSQA 3IWLA 3AJXA 5G0RB 3BLIA 4QLLA 1HLWA 1KA9F 5I0DA 3O5TB 2W8KA 1R47A 3UVAA 5GNYA 1MW1A 4RW5A 1RT4B 2RS8A 1NXIA 1EETA 3N04A 3PFMA 3M8SA 4RR4A 5KFPA 1F6PA 3D3FA 2ZADA 4LR8A 1C4AA 1ZAIA 4C0HA 5CAHA 3K5MA 3ENAA 5D4OA 1IWAA 5LJ5Y 3G24A 1WC4A 2AP6A 3CO0P 4GYPA 3UCDA 1HMVB 5REQA 3CK5A 2YNFA 2IS7A 2D7SA 3CDBA 4OI1A 3O16A 4C6PA 4ORIA 4CNSA 3QSIA 3BCDA 1LWFB 5F41A 3SI8A 4O17A 5E3QA 4M29A 3EE3A 2VYOA 1HBMA 2R14A 3VGTA 1US3A 3DHUA 1Q4RA 3Q65A 4ZQOA 1MWOA 1NM9A 1R43A 3HO1A 2P6TA 4PXDA 2YQ0A 4G6VB 1UR9A 3L5AA 1TMLA 4WSHA 1F9CA 3VDCA 2DPIA 1CS4B 3J7Z5 4Z2JA 4FBTA 5KOXA 4YFUA 1O68A 4IG0A 5HA7A 3DRRA 3AHYA 3SCVA 2D2GA 5D0HA 3HQ1A 3ZJ6A 3A4WA 1ZL1A 3S6TA 2ZTKA 2D22A 4WZQA 1N33F 4S39A 5GNZA 3R8HA 3VUPA 4LBPA 2DDXA 1TZZA 1SC1B 3CAQA 3N34A 3GNRA 2WCSA 1MUWA 2CZVA 2Z30B 1O5JA 3SV3A 1WOSA 4Z2XA 4DQRA 1I9CB 4GA8A 4ZPDA 3B78A 1JCYA 3AI0A 3D1QA 5J2PB 3KJFB 1LP6A 1WYIA 4AMAA 3MUZ1 1K0TA 1Z8AA 3MSGA 2PF0A 5KG5A 1RTJA 3TUPA 3W3OA 4DPTA 4DLEA 4F3OA 2C0AA 3RXZA 4DV1F 3GXNA 4O52A 3TK7A 5A2QY 2IQTA 3W83A 3DZ1A 3GVVA 1JZ5A 4LY4A 1TV4A 3FSXA 1BXCA 1EX5A 2ILYA 2Q3PA 3OFGA 1SQ7A 2XN0A 1VDHA 3L95X 4DX7A 4C8LA 1JKHA 3P61A 3KHGA 4LF8J 1KM0A 3WDRA 2EBEA 3BSCA 3VDHA 3W2WA 1NKEA 2P6SA 3B9NA 5E9XA 1Z69A 4FF7A 5SUHA 2KG1A 2PDMA 3ZLGA 2FDNA 3QRQA 1CXHA 4FSAA 3DOLB 3W9HA 2X0HA 1DP0A 4CNPA 2OIHA 3AMKA 4JEQA 1S6QA 5IRPA 3H40A 4Z17A 1OIMA 3PX0A 1HKMA 3CCVS 1JIBA 3ONQA 1E6VB 3GWQA 4HYRA 4EU0A 3K17A 4OZJA 1X4DA 2QLYA 3G6MA 4F2TA 3IWXA 1W3HA 3EZ5A 1XPYA 2C0HA 4ED4A 2G4FA 2Y5SA 1WHYA 3QY7A 3OIXA 4C8KA 2PDQA 4ZOCA 1A5AA 2RDJA 3L4VA 4UCFA 1YYAA 1IVZA 3MURP 1WBJA 3DAQA 3DBNA 1OQFA 1Q66A 5A0YA 4CO4A 5CD4H 3KTXA 1KKOA 3VK5A 1WV2A 3IFEA 4XBSA 2DNRA 3BO2A 6TAAA 3BQ1A 1V79A 5F9LA 4YR2A 3IRWP 2VKRA 4FXFA 3HPAA 3OR1B 1HF6A 2E1MC 2E7XA 1IJEB 3V36A 4LQ1A 1JDEA 4MNMA 2E1WA 2XS7A 2DNZA 4D8ZA 2XVGA 3GKAA 1MMLA 2ZJPQ 3RB3A 3Q89A 1S5NA 4H9YA 4DI8A 2J7DA 2WJFA 3D6MB 3W02A 1HD0A 4TU7A 3EGZA 2N82B 1N4LA 3OTCA 2BOGX 2C3PA 3KBWA 2LYVA 2Z0GA 1OF6A 4W89A 2V5HG 3SCSA 3R4IA 2PP1A 4TIMA 3R7BB 3GTXA 1LK7A 2XIBA 1L6SA 4Q43A 2M2BA 2R3VA 5ABFB 1KXVA 4ZDNA 4HN4A 3K4WA 4QJ3B 5ABEA 4IPJA 3ISND 3C19A 3PK7A 1MDLA 1JLQA 4MNJA 3EX7B 2IPWA 4PWWA 3ZTPA 2WC7A 1B4SA 1R3WA 4ED0A 3WDHA 1KFKA 5I3QA 4E2DA 1FXRA 4CNYA 4GWEA 4JTAA 1BF6A 1XLDA 5ETKA 1VJWA 1QUVA 1UBSA 2RDTA 5KSWA 1W2BR 5D0EA 3BBCA 5M2RA 4P75A 3WD2A 3WUFA 2Y3YA 4URGA 4RPPA 1HQTA 4JBCA 2HK1A 3IC1A 2YDAA 4PSRA 2GJRA 1YDOA 1PCKA 2PBOA 3AMDA 4F8RA 4Y8FA 1T9VA 4N8NA 1DURA 6CGTA 2JWNA 5KFIA 2YDQA 3RRXA 3SRFA 1CXEA 2C3MA 3F1QA 1WPCA 3G5EA 3UY8A 4I5UA 3AZSA 4DBQA 4DPWA 2BV9A 3MPGA 1QSSA 2O3DA 3B8UA 3HM9A 5DCBA 5A8MA 3UZWA 3NBPA 2BE9B 2REQA 3M7VA 3DRPA 3RB4A 1I2QA 3CV7A 3CTTA 4J5NA 4WDWA 1R5YA 3V4IA 4USIA 4ZOSA 2ZICA 1YBQA 2VKZG 4AY7A 2W92A 1PAMA 4L1GA 1GW1A 1XINA 1KWMA 3T05A 4JI8J 1IXPA 2YLLA 4WTYA 3HF3A 1DJWA 1OQ3A 3ILJA 3LSCA 1JYWA 1FO1A 2QCNA 4HMCA 1UC4A 1TK8A 4UOHA 3HPZA 2FVCA 2CXEA 4JQ2A 3M16A 4U33A 3QYYA 2C14A 4WYLA 1XTZA 4WPAA 1EYWA 2YNHA 5IT9Y 2A3AA 5F0UA 3E0IA 1BGAA 2QA4S 4JI7J 4Q22A 3D46A 1WC0A 4H7CA 4A21A 4QWDA 2IXVA 2R24A 3MD1A 5I23A 1D3WA 3QVQA 1J5EF 1CXKA 1S99A 4X4RA 3VV2B 5IV3A 3HQOA 3KNGA 1TG7A 4QXIA 3WK3A 2W9CB 4GVLA 2FJBB 4PR4A 5FJUA 4FNQA 1EC8A 3PFRA 4CQDA 4YXGA 1OBAA 4A35A 1F9EB 4RNIA 3TN5A 3L0NA 1OYDA 1TJ2A 3I9ZA 1B99A 4NXKA 2PD5A 3NZRA 3VNDA 3WF4A 4ZVTB 4ZO6A 2BTMA 2AF6A 4F0SA 4QR0A 2JX2A 3RF9A 3KLFB 4HBKA 2V8PA 1VQNS 4J91A 3C0LA 2Z1XA 5HO4A 3WQ8A 3K1GA 4O14A 3SZ2A 5FF7A 4NJJA 1SC6A 4HEA9 1QTWA 4UZUA 1Q2RA 1KWKA 2F8EX 5CPLA 4H9ZA 1FNXH 4KPCA 3GZ3A 2X1RA 4WDTA 4GZIA 1NB7A 4BKNA 2QGYA 2NZCA 3R89A 2YQ3A 2EG8A 4EGLA 1E6YB 4M81A 1H38A 5L1IA 2W66A 4HB7A 3GIPA 3UXAA 1BXNA 3GYEA 2E7WA 4AYSA 4FBUA 1FY6A 1AFSA 1NWUA 3R5AA 4KH1B 1YPXA 2QYCA 4DR4J 3KS6A 1XX1A 1OFEA 4JKMA 4NAFB 1UB3A 1RU2A 3FAWA 4M63A 1AJ2A 3QZEA 4XDDA 1G1XA 3S2MA 2OLHA 3DLHA 3LAMA 2BQUA 2NQPA 1S2CA 4D6HA 4US5A 1L6WA 3T4WA 1VQ6S 1WZKA 3VDBA 4FF5A 1SQGA 2W4DA 1W54A 2YDRA 1K9EA 2XMVA 2B6AB 4OZOA 4PN2A 4RW9A 4LY8A 4MGGA 2GHWA 2OEMA 3BWWA 2O7QA 3D54A 3W7QA 1UVJA 5KG0A 3KFTA 1TPC1 1VCFA 2HW3A 1QATA 3CZJA 3R5CA 1SQEA 1JCJA 3BJYA 5B09A 2YA1A 2DGXA 4TLRA 4WXYA 5A2QU 1RAKA 3LI0A 3MKVA 2MHEA 1VQOS 2NQJA 3CHEA 4C7GA 2RKIB 3BN7A 4LANA 5LGZA 3CM4A 3GYGA 4OJ1A 4KQNA 3H4WA 2DT3A 1R7IA 1VQMS 4TNOA 3EAUA 3CJTA 3JB9k 3OO2A 1ITQA 3U2OA 2P88A 2QHAA 4DZ6A 3EA3A 1CTNA 3G1YA 4F2UA 3D28A 3QY6A 4XAYA 3CPUA 1Q6EA 2INZA 4GO8A 2FD2A 3WG6A 5C9ZA 3LTOA 3UR3C 4WF9Q 3VGBA 2OZ8A 3SCPA 5L39A 2YPIA 1XQIA 2ZZ2A 3BLOA 2E5BA 1CQMA 3NDZA 2FJXA 1I60A 2W63A 4O53A 4CCDA 2VCBA 3TSDA 5A8GA 5A6KA 1ZAVA 4HHPA 1KW1A 5CZTA 3WX8A 5KFHA 4I7VA 4XZBA 3EDRB 4FHAA 4DBSA 2FGBA 4I1TA 1WI6A 4JI3J 5KFNA 3UR5A 1B1YA 1GW9A 1VOMA 4GRSA 1P1MA 2FVSA 1NK8A 3DMJB 1I5OB 2PE8A 4AXKA 1Z89A 2RIJA 3TLLA 4HR2A 2G4JA 3L65A 3STFA 4N41A 4NEYA 2QV6A 3VO0A 4DL3A 3V0TA 2XZTB 1ZGDA 1GOXA 5FEZA 2AQVA 3OTBA 4LRCA 4C6QA 4DXLA 1MQRA 1VHNA 1HJWA 4CH1A 4DPQA 4K2JA 3W1RA 4WKRA 3UWYA 3ZT7A 2CBJA 4ACZA 3U4AA 2D1ZA 1W2IA 2XMKA 1NJIT 4XKYA 3TA6A 4IH5A 1ELSA 4NZ1A 4DZIA 4GE8A 2CLMA 5CJ5A 1RP9A 2GDVA 1OIAA 1DVJA 3BQ0A 4CLTA 1RTHA 2YNGA 4WP9A 1EJVC 3QXBA 3N5FA 1B3YA 2QJJA 5HROB 3L09A 5K4ZA 2A0FB 3KHDA 3IAS9 3NZGA 4LEQA 2XLIA 1VHCA 3HGRA 4X4UA 1XBXA 4WE1B 1QE1B 2ACQA 2E5LJ 1M7PA 1U1UA 5ENLA 4W7UA 2CQHA 1D8CA 2YKOA 3GU0A 3MWCA 4XTIA 2XUCA 1KCKA 3UQNA 3CTLA 4I2PA 3POHA 2CJKA 2WKLA 2Y6ZA 3IPWA 4B3MJ 3KYLA 4N5SA 2W5FA 4DYJA 2RHQB 4AG0A 1L6YA 4GUFA 4PL1A 1KFDA 5F8IA 1TV7A 4WXWA 2OX4A 4MNLA 1FXDA 1PPIA 3PSVA 2Y1JA 2OPPB 3GR1A 3NNCA 2FC8A 2KHDA 3O1LA 1BKHA 3TNVA 4FNTA 1RTIA 3QC3A 4WXOA 4FLQA 1RA5A 4V1XA 3LTPA 1VISA 1BLIA 4JYDA 1HIZA 4WCJA 3NG3A 3AYRA 3CNYA 1CI1A 5KFWA 1IV8A 1QVBA 3BQ2A 1DYSA 1F8IA 3R9LA 4A05A 3GNPA 1YNPA 3I68A 1HL8A 1A3XA 2CQIA 4YB5A 3BKFA 1RT6A 2LECA 4HSHA 3R25A 3WBYA 3PY8A 3RAQA 4QOTA 3KWMA 3EDFA 1W2PA 1KEKA 2C8NA 1WC1A 3PJ9A 4F3MA 2RE1A 4E5TA 2ZZTA 4K4YA 2HFZA 3QJAA 3WELA 1R0CB 1FT8A 1R8HA 5AC8A 4ICNA 2DT9A 1OX4B 3RMJA 3B4MA 4L74A 3IIZA 4RJVA 5IT9U 1T6MA 2A6MA 3PFEA 3MGJA 1KO0A 2HKEA 2AGTA 3IM9A 2JL9A 4DBDA 5KTQA 2YCIX 3SY8A 3TV8A 1LWHA 2XTKA 1WXYA 1HZYA 4GNJA 3T41A 2FJVA 4ZE5A 1X4CA 2AU0A 3ECQA 5L9XA 1YDNA 5IT4A 4OQJA 1JDAA 1JCNA 5DXXA 3QRRA 1U7LA 4Y2MA 2QULA 2QGFB 1X1ZA 3S9YA 2PB1A 3R1HA 3R6GB 1E6XM 2WSKA 1S5MA 4LALA 4V1Ak 5KT7A 2PODA 4NQ1A 3MHYA 3Q8PB 2IC3A 4HK6A 1X0FA 3LY0A 1PCAA 1SJ1A 4O4RA 4WFAQ 3RGTA 2HE5A 3CMAS 2BASA 2H4YB 4GMEA 4JQAA 4MM1A 1AODA 3OG3A 3J7AN 4OL8A 2RQKA 3LP2B 2GL5A 1WNOA 1YWXA 1BFNA 2IDLA 3RR7A 4WUIA 3L66A 3GBDA 3K8VA 2OO0A 4JX4A 4DR5J 5A8WB 1YTEA 3M8RA 5HMDA 3Q4DA 5CCMA 5FA5A 1SIWB 1R6VA 1VC0A 5KFYA 4H41A 2YBVA 4CVUA 3BO9A 1NWSA 4DZDA 1TKTA 1FNMA 5M2UA 3SECA 4JI1J 2KZHA 1Q6QA 1DJ0A 5B7ZA 2LU1A 4LAOA 1HIYA 2JSXA 3N73A 4U2YA 1WHXA 2B9WA 3VGFA 2NX1A 2WKJA 2YOCA 4E2VA 1KM6A 1KTCA 2WAGA 2JGYA 1TQLA 2UY5A 2JZ5A 4G9PA 4L9YA 4GVBB 1FH9A 2DGWA 1T40A 4Y6IA 1OC5A 3UCGA 1SZRA 2BJ1A 4ZPWR 3KBNA 2R4FA 3P6LA 4ERAA 1WP6A 3E02A 4JIHA 3I6RA 2J79A 2AW0A 1DHKA 3B8VA 2VMFA 3M41A 4DV6F 4JV0A 4K50A 3K4DA 2ZKMX 2VQTA 1WG5A 2PU1A 4NX0A 3NL0A 2TMDA 1UIPA 2ZWOA 3NQCA 1M5KC 4IPPA 2LQJA 1KXHA 2C19A 1SFLA 1M5OC 1L2UA 2ON3A 3NO1A 4AZGA 3TZYA 3IBWA 4DR1J 2CBUA 2I14A 3EMQA 4MAVA 4W7WA 2OT0A 5D30A 2V34A 2PGEA 3A4XA 1L6GA 4PTNA 1DIEA 2HRUA 4NA3A 3CSKA 2EC0A 4XPEA 1XJBA 3RILA 3WH8A 3HG2A 4P9SA 3HVAA 2K3KA 2CPDA 5IFMA 5JUMA 1YG0A 2ROGA 3TONA 2VUYA 1J01A 2OGJA 5J5RA 4F9DA 4HDGA 1W7WA 1VQ8S 5KG4A 4B3KA 2LQ9A 4ED2A 3BV4A 4MWAD 4CVWA 2DR5A 1A4MA 1B0TA 5LIXX 4JTLA 4DWSB 2ZH7A 5I3HA 4LYRA 5GADU 2WCXA 4P73A 2Q8LA 1X7IA 3RU6A 2BE7D 4X64F 1REQB 3GNXA 1J10A 1QPRA 3CWOX 3BAJA 3TVAA 2QZ8A 1IJFB 3A9BA 3EDKA 2QA1A 1IIGA 4Y9MA 4C65A 3CGIA 4G8TA 3HFVA 1I2PA 1NCLA 4OFCA 1UOKA 1RD6A 4XIUA 3G3DA 1KV8A 3ADAC 3VX1A 3S42A 4QYRA 4TVDA 3O6CA 4R7WA 4Q4RA 4OX9F 4BWLC 3OVAA 1XH0A 4K0KF 2QMJA 3IJ6A 4DV2F 1X9SA 3PPGA 3QRPA 3RBDA 3UG3A 1PO9A 4E2FB 5FF4A 3OR2A 4PMUA 1XYLA 1HVXA 4IMCA 2EK6A 3XIMA 2ADBA 3B03A 1F05A 4GO9A 3M9YA 3DI1A 3SYZA 1DXEA 1TMJA 1TTJA 3KE0A 3M7WA 1VGAA 4NCAA 3VOIA 2XSJA 1QRQA 4S2BA 3FY1A 3PAJA 1FTCA 4OFZA 2E9MA 1XP3A 4K8HA 2H5IB 3NTYA 5DELA 3G1AA 3LOTA 4IQJA 2CIPA 1Q5YA 4WEVX 1UWBB 5E70A 4JBRA 4V1YA 1YXCA 2PDWA 4ZR8A 2O92A 5JH1A 4P2SA 2PTWA 2ACSA 2XMWA 4AL7A 4FXDA 5HINA 3OYXA 1H0GA 4KEVA 4HHMA 1I4NA 3NGDA 3VI2A 1EB3A 1SJBA 3Q8RB 2VFSA 4M95A 1OM0A 1OGGA 5D09A 2H5JB 1ME7A 4NVTA 2HS0A 3M8ZA 3RR4A 4IMGA 3U3HA 4F4AA 1YQ2A 3M0YA 5E6YA 2D24A 3VIFA 2WSEC 1CDGA 3PW5A 5D32A 4HHUA 1CLXA 2WVVB 5I3JA 3LX9A 2C7FA 1IT8A 5AC6A 3E3HA 1XBWA 4G65A 4PYAA 5A5WA 3VD7A 1G6CA 1OY9A 2HVMA 4CGTA 5JU6A 5LSMA 1UBPC 1IM6A 1FJ7A 1JI1A 2RQ4A 3E74A 2DNYA 4NF7A 4B2DA 3AIVA 3PPHA 1P9YA 1Y7VA 2ZZMA 3H2CA 2MZTA 4USUA 1SL1A 3LXCA 1ZM4A 3N11A 1IR0A 1T9TA 4DL0C 2C1GA 1LKZA 4ZHRA 4C3KA 3QZ8A 3WF3A 2CETA 3VE9A 4JICA 3TW9A 1OT2A 3NPWA 2WHKA 4FLSA 3WYZA 4Z1AA 1LRQA 3A3NB 1X6NA 2W4XA 4ONVA 1H98A 1NF7A 2B0MA 2UUBF 4FOKA 4HNOA 4OI0A 1PJ9A 1CLVA 1TE1A 5J8LA 1QD1A 1QNVA 2KO1A 1R31A 3OL7A 3N17A 4ALZA 1ZALA 3SQOP 4CCCA 1NSAA 3PYDA 3MMAB 3G0UA 1EFZA 3PIOQ 3FYPA 3BSOA 3U1LA 1Y5IB 1R3SA 3UW6A 1T0OA 4WIQA 5BMWA 4TR9A 1TV6B 4DF8A 1YE4A 5DMYA 2QC3A 5H9EK 2A3CA 2JF6A 1MXGA 3H23A 2J8SA 4XTTA 4DV3J 2ZITA 3EGVA 4LF6F 2VFTA 3JS9A 1VRUB 3BREA 3O2LA 1H5YA 4XD5A 3IS9B 5F8GA 3MXHP 5HNRA 4US6A 4NNCA 1UD5A 2Q1LA 1U6ZA 1TIWA 2JE8A 1QAIA 1M7XA 1XR2A 4AEFA 4OIFA 1HJVA 3NQAA 1CW2A 2VFDA 3N19B 3TUZC 2OI2A 4P7TA 3QQ0A 2WOMB 6FDRA 1BQCA 3UWWA 2B7QA 5EB8A 1V6TA 2H3DA 4DU8A 4DSLA 2ALRA 1HL2A 3BZQA 1A5OC 4RV8A 2UUCF 2GUUA 4NLRA 2V6AA 2D2OA 1JFXA 3POTA 2HRWA 4MLRA 3HPOA 2VPXB 2Q6ZA 2XSFA 2EO7A 4F2BA 1X0PA 4DUVA 3VKKA 4JD4A 1B57A 4YQWA 2DW7A 5EGYA 2VQEF 1GQJA 3WK0A 2QCDB 4MKYA 1UH4A 3DENA 1ME8A 2V5CA 2J62A 1S10A 1FX2A 3WX4A 1NDYA 2OX1A 4F0MA 3SQGA 4NYYA 3EOUA 3A9IA 4AXNA 2C1IA 5CH7B 1UTAA 3KK1B 1UR4A 3PYEA 2UY3A 2OEJA 1Z42A 3ZFVA 1W0MA 1S1TB 3NVDA 5A6BD 5E09A 2A3EA 3L5LA 3E0FA 3WBWA 2GVZB 4JYAJ 4DR6F 3PW4A 2BY1A 3KRBA 3B8WA 3OHIA 4DQSA 2ZRUA 1W8SA 1NHUA 3UN5A 1SBRA 3KXDA 1ZP3A 1FBAA 4JTQA 1UKOA 1JLEA 1N5SA 2NVAA 2OWWA 1A5CA 1F3EA 1H1ZA 3TJIA 4OYAA 3K4AA 3H2UB 4HSOA 4DX5A 4FNSA 3BDKA 2ABYA 2XQCA 4XO0A 4DL5A 2QT7A 3T5JA 1X60A 2FTWA 4RNMA 4I6AA 4Y6GA 5EMJA 5J1EB 4Y8EA 4BDPA 4DR2J 4GYFA 2ACYA 4ZIWA 2W2PP 3IMQJ 1WZLA 3OTOF 1EIXA 5ABHA 1EF2A 3H2VE 4OV9A 2GWGA 5B0GA 1PHWA 3DN5A 2WMIB 4Q4MA 3M1VA 4WTOB 3PSWA 4O3RA 5I3DA 3DYOA 4ETXA 3EDEA 3N6NA 1DTQA 4CLSA 2PLKA 3UCUP 4NZ3A 1FK9A 2OODA 3OVGA 1X7VA 2FJAB 4KEZA 1YK9A 1I6JA 3ULHA 1U1PA 2PTYA 2HWGA 3NNTA 1V51A 1KB3A 4CNNA 4CEXC 2ZX5A 1V6UA 4G1KA 3VM5A 3BCFA 3GX9A 4QIWD 3A23A 1JLAA 3IG1B 3LBMA 4DZHA 3BANA 4DQWA 4EVZA 5BW6A 1Y4ZB 3KK2A 2X1TA 2JEGA 1IWGA 4NRUA 2VOMA 4K7VA 3U5UA 4CU8A 1UVMA 3OTEA 5HUOA 4UT4A 2X3GA 2VFGA 1TVNA 1FDAA 3P7YA 1TKXA 2P9EA 4L72B 3L7OA 4H01A 3O06A 1JPKA 5A6WA 3UVJA 4ZPTR 1NJXA 3FEZA 1RAHB 4CDIA 1FWDC 4DAIA 2I6WA 1S9EB 5H8MA 4GLEA 1CC8A 1MLAA 3QFWA 3QQ1A 1LW0A 4XK8C 4D9PA 3E0VA 1VBUA 1RP5A 1QPNA 3FIGA 2J7CA 3N4AA 4O1FA 5EL1A 5KFEA 4MWAB 2ZX8A 5BOFA 1TQXA 1SVDA 1V8EA 4JI0J 1ZAHA 4JI2F 4B17A 2J25A 2XVLA 4FN5A 4LFBJ 2FH8A 1TR0A 3VA8A 2BSLA 1KBBA 1I45A 4ZA1A 3L2LA 3M46A 3VGHA 1P6WA 1A4LA 1Q63A 2M9KA 3CZGA 4NYUA 2V5KA 2CPZA 4I7FA 1UP0A 3BO3A 1FJEB 5EBAA 4YPJA 1RBAA 4GJIA 4Q44A 3C8NA 2A85A 2DYAA 1RQEA 3MP5A 4AIEA 4QRNA 4PCTA 2FGOA 3TP2A 2Y89A 1UWIA 4AD0A 3QLLA 2A7RA 2V0NA 3MHUA 4MUZA 1BQNA 1EA9C 2YKMA 3MR5A 4DCOB 3QIPA 5A8OA 1HO4A 4QROA 4XUYA 4TVCA 2GHVC 3HP6A 5HJLA 1K02A 3MM7A 1ZTTA 4GI4A 2O66A 3MMBA 1TO3A 2AJ0A 4RX6A 4OBTA 2WJDA 2DPJA 4AF0B 4B3RJ 1V3JA 2GSJA 4KFBA 4NRSA 2I9SA 3BGFA 2WM1A 3E8OA 4HH1A 1ICSA 3GV8B 2MUCA 4AIUA 1FKOB 1V7YA 4JEJA 2RF2B 4C0BA 4DOZA 1HWLA 3I3BA 5FJPA 5KG3A 3PR4A 1F73A 5AYYA 2VFRA 3WQPA 2K1RB 3ZNUA 3I4HX 3CJRA 3MZIA 4QIVA 2VG6A 4JNMA 4GKKF 2IPJA 1POJA 4K39A 3LCIA 3INPA 2AGOA 1RXOB 8A3HA 1HBNA 4HI1A 1VFUA 1GCYA 3THUA 4HD5A 5A69A 2V69A 2X3DA 5F0WA 1H74A 3RLHA 1PIIA 2DQWA 3ATZA 2XMMA 2KXFA 3CAWA 1CCWB 4I9MA 1GVIA 3ZJ7A 4F04B 1YI2S 1G01A 3C2FA 3M6DA 4CO2A 4FP9A 4O3NA 3W1MA 3TYEA 2H9AA 5I02A 3MMDA 1MNSA 4GY0A 4LU0A 3ZSSA 3FEXB 1HKKA 2PWHA 1WCGA 4WY0F 3BYRA 3I5BA 3GO2A 4UFJA 3CTRA 2F4VJ 2A2DA 4NIRA 1E5NA 1DJQA 1W1TA 3LENA 3LP1B 4IJBA 4CO5A 3WK2A 2GAGC 4DO7A 3KHRA 1FJGJ 3LRKA 5HLFB 4X3ZA 3EICA 1NJJA 2DHHA 4HACA 3US5A 1RABB 1P27B 4LRBA 1FERA 4KAIA 3FZ2A 1ZBKA 5BYRA 1UFKA 4NLYA 2RDWA 1D2KA 1XMQF 3RPMA 4C48A 2BS9A 4O4GB 3SY5A 3HHEA 3TA2A 3WIJA 1BGXT 3EXRA 2XFYA 4Q7BA 4HZMA 5AY7A 4K7QA 1GQNA 3JTOA 4B9UA 1H41A 1CPZA 5IC4B 2PA3A 3D0HE 3C6CA 4KKOB 5L9NA 4C6FA 5LHEA 3WLSA 1RA6A 3R0UA 4C60A 3WQ4A 2FMNA 3DLBA 2QPUA 1KD1T 2R8HA 2GK1B 1ZSXA 1WKFA 2AD9A 5JXQA 2F5GA 2V94A 3S2NA 3M9NB 3EPOA 4UNKA 2V50A 2XHWA 3BV7A 4U67Q 3D67A 3HI9A 1Q7QA 3T6CA 4PEOA 4DV5J 1S1PA 3KWSA 4GK8A 2WHJA 1ITUA 1AMKA 2VZVA 3BBFA 4KGKA 2QCGA 3R0KA 1HP4A 5ETQA 4C5ZA 2P3ZA 4PYDA 3PKYA 1P43A 1FHDA 1UEKA 3P80A 1RHCA 4GX8A 2QUVA 5AE2A 4PMXA 3ENVA 2PDXA 4LF8F 8TIMA 4A48A 2A7PA 4OT7A 3QT6A 5DRIA 3LK6A 4C6CA 3DI6A 4LX4A 3ES7A 3W22A 2IQDA 3GH5A 4ZQRA 3MAAB 1T8EA 3C16B 3LGNA 4KGXB 1VBGA 2JGQA 1DE5A 3CUNA 5EFFA 4F4WA 3MM9B 1WORA 2HMIB 2DUZA 2HK2A 1YJTA 2DR8A 3E2SA 3ZR4A 5G2HA 2GPTA 3VTIA 3DG7A 2WBMA 3NPXA 3I6TA 2H8ZA 1LOQA 3MEEA 2UVVA 1DQ8A 3VDGA 5FD0A 2E68A 2OB3A 4ES1A 3CO9A 3RBXA 1J12A 4PGLA 1IXNA 1Q0NA 2JALA 3UE2A 5IV4A 4GJJA 1I2RA 2POZA 2OFHX 2YXGA 4G56A 3R2DJ 4ZP9A 3I0SA 3BSHA 2QCCA 3K5OA 2UU9J 5I7GA 4TUFA 1Y0HA 2NV2A 4LV9A 2JH3A 3F41A 1T3OA 5KITA 1WO2A 1G7CB 3TAQA 1NSJA 1KNWA 2DEIA 1MSWD 4K3ZA 2WVFA 1P1XA 3QQWA 1CXLA 3FXGA 3V7PA 3W25A 3FJ2A 1JLCA 4ELVA 3W2KA 1S3TC 5FLXY 5SWUA 2AZ1A 5J2MA 1P0EA 1VH7A 3EWYA 3GFYA 4M7SA 2BKPA 3HG4A 1HNIB 4K8GA 2YKQA 5L38A 1RT5A 3WZ0A 4ENLA 3EMTA 2CRLA 1S0MA 3BL3A 4LAMA 4A8QA 2DQXA 3C2OA 3T40A 2YCKX 2XY6A 1M1GA 1SO3A 2W79A 2I5JA 3LGGA 3LN3A 3OV7A 2W4CA 1R9XA 1WOBA 3ZOAA 4ICLA 4NMLA 3AALA 4C6JA 1M1HA 1TUVA 4XSMA 4ECLA 1CQNA 4Q4OA 2EC2A 4S3KA 1U1JA 2BANB 2ZWZA 3SSZA 2RJZA 4O4VA 3L0GA 3W81A 1LW2B 1NSPA 1ADDA 4RE0A 1CBGA 3RYSA 5BXSA 1BTCA 1GMWD 1O12A 3AOAA 4UXDA 4QDMA 3Q22A 1G7UA 1H4PA 3QPEA 2TAAA 4UQTA 2KRBA 4F4YA 3QPIA 2O67A 2IA0A 3TWAA 4AZ6A 2BX7A 1GQIA 1QCWA 2FJKA 4ZXOA 3EWGA 4OMFG 3UD4P 4I5XA 1Z9AA 4DY1A 2ZXAA 4MKVA 1KCXA 4OI4A 1Q8KA 5EFDA 3VX0A 2Z0IA 2Z1WA 3CL6A 3FAXA 4U7UK 2HVNA 3FFIA 4RW7B 3KOZA 4H3DA 1P1TA 3L4XA 5CC3A 3REQB 3Q2SC 2R7UA 4ER8A 3S9IA 3PTQA 1Q6LA 3CCWA 5HWNA 3MOZA 4PUKA 4I67A 3QT5A 2C2MB 3G1XA 4CU6A 1RYSA 5A6MA 3MBDA 1ZBVA 4YTUA 3LSBA 4ZOEA 3CJKA 1XLLA 1YX2A 4JI8F 2OZ0A 3LHZA 1XBYA 4X65J 4OIXA 5DRCA 4GKLA 5HUPA 4H6KA 3C56A 4NAEA 4L64A 2Z6IA 4LREA 3GV5B 2F8MA 2WHMA 4X4PA 4C2MA 4KCWA 2MSTA 4JHZA 5KT5A 1ESWA 2HHPA 4HNLA 5HPOA 2XIIA 4O15A 3H55A 4JI7F 1W26A 2DZUA 4RDYA 4OX8A 2HVHA 3RUBL 3N9KA 3OL9A 4W8BA 4Z2KA 3MM5A 4MMOA 4LRDA 2G3MA 2V8HA 5BRQA 4LCSA 1CIUA 5ABTA 4K5RA 1HYSA 3ZMRA 1HBUB 2KL8A 2CNOB 2CQ2A 4JUZA 3VPLA 1UUQA 1UJPA 2KN4A 4KRZA 2V81A 4P71A 4PUNA 3M43A 1SFJA 4RL3A 2Z25A 3AAMA 1O51A 1FHTA 1D3GA 1YITS 3LU2A 3ARSA 3W7EA 3W7JA 4NZ5A 5FD1A 3CIZA 4E8DA 1R30A 3H2LA 2GZOA 4LVOP 2RMLA 4A8NA 1RR2A 2CFFA 3W37A 4ZPBA 2VICA 3CL8A 1JFHA 3OFEA 2YKAA 4KIAA 1VLIA 2ZRZA 2ERRA 1IQ8A 1UYQA 3H2FA 2FHOB 1Y00A 4CQ9A 4XAZA 1DQWA 2VZTA 4GNKB 3TN6A 4CO0A 2WSRA 4GC3A 1SJCA 4K68A 4DV4J 3MUVP 4QIGA 2FZMA 1Q45A 3KLGB 3MT1A 3S83A 3N2BA 2FJDB 3UWTA 3HG5A 4HT5A 3B4DA 4MJMA 2EG6A 3RLVA 5HNTA 4AEOA 1TVLA 3MP3A 5CBIA 4HT7A 4DR4F 2WV8A 1W2VA 2DBBA 5DG8A 4HIBA 2GNKA 1GKRA 2PS2A 2UXCJ 1UCWA 3SCRA 6REQB 2QRRA 3IXQA 1U45A 3FXYA 2DIJA 4LAKA 2NREA 3UNDA 2E29A 3GFHA 3RK8A 3C3NA 4GQGA 3WQDA 3SCJE 4AWTA 2R91A 1ZS6A 1AJ0A 4A29A 2BXJA 1E9YB 1K77A 4GUIA 2OPRB 3GSMA 4HJFA 3NSXA 3VAFA 2ZIDA 4DL7A 3D1OA 4OYOA 4GISA 4L61A 1E40A 3J81j 3OLBA 1KVIA 4B5VA 1MW0A 1SYTA 3B4UA 3G18A 3DLEB 3AUOA 2OH2A 4S0MA 5DN1A 5LA1A 4HU3A 2CADA 5B08A 5MKGB 3WNPA 3EYZA 2YL5A 1Q6GA 3VAVA 4BF7A 1RHUB 1HGWA 2VJXA 3NEVA 4MNKA 5C2GA 4CLKA 1P0KA 2ZYFA 1DQXA 1N88A 2VC5A 4QIUA 2XU2A 3B8IA 3G1VA 4GZEA 3JYTA 3W53A 5CYMB 2F6KA 4BWLA 1JLBB 4MJZA 3KMSA 2J75A 3HN3A 1SW0A 1KKHA 2HWHA 4N9EA 4PQUA 3SRDA 2MEWA 4Z0SA 5HNNA 2LFVA 3FCHA 4B9SA 4G3IA 1HG3A 4XPCA 3RLUA 3MDWA 2RH3A 2VU5A 4G1QB 2RJHA 1DEDA 4AZCB 1NB2A 2MB0B 3BVJA 4FIRA 1RHRB 1UJ4A 1G9HA 1FWHC 3G96A 2ZA3A 1W5PA 1P4CA 2UBPC 3CAKA 3DFYA 2VFUA 1FD8A 1K03A 1XLBA 1XLHA 3BG9A 1S76D 5KT4A 4JI3F 2PAJA 1GVYA 2Z00A 2BZ2A 4JKLA 2VENA 3WMLA 1UWUA 2XLKA 3FNNA 4QEHA 4ECUA 1NKCA 1XBZA 1I8JA 3MWBA 2J8FA 1T03A 3K5PA 4M5NA 1OGSA 3PNIA 4C8OA 1H3DA 5J1PA 3OSPA 2OSWA 1HQEB 1C8YA 1CEOA 1ICQA 3OQEA 4I9TA 2FHMA 4LUSA 1KFCA 3M0JA 3A8KA 3DOPA 2LXFA 2FZDA 2XCPA 3WH9A 1OPZA 5FLXU 3PHAA 3TCEA 4LUJA 3NL5A 3LA4A 1LBMA 4J9RA 1IBLJ 4ZFCA 2GQAA 4J3ZA 3S47A 1W9XA 1NFBA 2OZ3A 5CGTA 1OFOA 4DX6A 3PHTA 1D9DA 3LZ5A 4USVA 1WXZA 1RCQA 3AXXA 4CNUA 5HMXA 3FYYA 1MW3A 5AFDA 3TC7A 4PE8A 3H12A 3G1SA 1C9WA 2ZVIA 2WNZA 5E93A 1U0HB 4RDZA 1IXQA 2JFKA 3DHXA 4GC6A 4PWDB 2JLEA 1VFLA 4OZNA 3G82A 4M5GA 3VIPA 1FJCA 4IQLA 1XIMA 4WYWA 3STPA 3UP8A 5HDRA 1MNEA 2D74B 3IGUA 1RI7A 1TX0A 2XWDA 2Y8KA 2J7KA 5GVJA 2CJBA 1KHVA 4CRJA 4P8UA 3LTYA 1CJKB 5LSOA 3OLAA 2E5LF 3O7UA 3CC1A 5JMUA 2IHR1 2OJPA 2C16A 3QZ6A 1NIUA 3GH4A 1GJWA 1WDTA 2GQ2A 1V5IB 4B3MF 4BHQA 3NSNA 4R53A 3RPTA 3DU5A 3SGUA 3DFSA 3A13A 4DXKA 4HL9A 4Z37A 4J3WA 1UEVA 3MD3A 1C1BB 2WKGA 2BM0A 4U3AA 2QAFA 4TTUA 4CD6A 4DPYA 2BEFA 2ZHBA 2JVOA 2W62A 3RG6A 1W3JA 1AFIA 3ZZRA 1NOWA 3GDBA 3TQ0A 2WSFC 2MQ8A 2XFWA 1PTGA 1V93A 3WN6A 4FPIA 3SCLE 2QFJA 4IISA 4F9JA 1FWFC 1BEUA 2JHEA 4IH3A 2ACRA 4N42A 1J4EA 3EWCA 3RX3A 5DRKA 3SFGA 5G2WA 1EIYB 3WJWA 3UZ5A 3OL8A 2YW4A 4L7ZA 1I3OB 1Y3KA 3AXMA 1ZM2A 1AJZA 4PG5A 3T0BA 1GEQA 1WXJA 2Z8QA 2YNIB 4WDUA 5CSUA 1FDYA 2I1OA 5C5JA 1OYBA 3IEBA 4DCJB 3LUYA 2HHTA 4S3JA 2HGLA 1S4EA 4M80A 2B31A 3DU6A 3T55A 1WJ9A 5FF2A 3DRSB 2DVXA 4MKAA 1GVQA 3NEKA 1B4KA 3VGEA 4Q4KA 1EKSA 3C66A 3TR2A 4DI6A 4KERA 3M30B 3OA5A 5E3AA 3RRGA 5DGAA 3ITYA 3GCWP 4JTIA 3BB5A 1ZAXA 4PWUA 1ZA2B 1B3ZA 3WHIA 2Q71A 3M32B 3E3XA 3TZNA 2IAJA 4HMNA 4K8RA 3MANA 4LV4A 2OHDA 3L21A 4R8UB 3ZYZA 2HFNA 1KQSR 2G3NA 2P2CB 3KL0A 1HL9A 4OE7A 2IRUA 4LIRA 4HT3A 4IOTA 2CNCA 3GVQA 2LQ5A 4WJEA 4OJYA 4S3DA 3HOJA 2FKPA 2GVYA 3VVGA 3NXZA 1R8AA 1VENA 3ENLA 2FZNA 2E5IA 3A5FA 3V0SA 1WF0A 2X0SA 1HXJA 3DGPA 2QMXA 1PS9A 4OWGA 2MZJA 2HCVA 4LT6A 1J0JA 2AV5A 3CB3A 3CNQP 1JK9B 3GVRA 3V81B 1GQKA 2BKOA 2JEJA 2DNKA 3EPGA 3B3DA 3NQBA 4RV3A 3NM1A 4JI1F 3GBEA 5A8KA 4R5PA 1ICPA 4W5UA 5G4HC 4C1NA 1TVPA 4IDKA 5T14A 2RHSB 2Y1IA 1J11A 3P84A 3U1NA 1HPZB 2ZH2A 1OY6A 4AIOA 3VNJA 3DEQA 1W3IA 4WSKA 2JLGA 3O0KA 3D6NA 1REVA 2WBKA 4UNIA 2DCUB 4U3CA 4Q32A 2V8GA 3FBEA 4ZO7A 4Z1YA 1RWNB 2IPOB 4DPXA 1XHGA 5CC6A 3FKRA 4YMEA 3ID7A 4UMAA 2Y5EA 1X4BA 1JMTA 3DYAA 4JV1A 1Z41A 2D73A 3ONCA 1SV5A 2QFIA 4K4WA 1H60A 4R34A 3WNKA 4I6YA 4GFIA 4NG3A 1P0NA 2IKGA 3FS2A 3TX9A 2YWFA 3FMBA 3DDNA 2PC6A 1BRLB 4OI2A 1HL6A 4IMEA 1GKPA 3K8MA 4GXPA 2XISA 3FKBA 5T7LA 4HU0A 5DY2A 4CTAB 5GAEI 2YH1A 4XG1A 2IYIA 3K8WA 1DIKA 3GTIA 1X6UA 5EMUA 4DR1F 2OU4A 1S2TA 4KTQA 1ZZFA 2AL2B 3H90A 4TN2A 4KBIA 5FJTA 1AUSL 2G2YA 2J88A 5EN1A 3DDKA 1U1HA 1T9WA 4HA1A 1XIDA 1C3FA 1MO0A 1HJXA 1ZJIA 4M6VA 3MEDA 5IWAJ 1VFHA 1K7XA 2A79A 3IK2A 1RU1A 4R7JA 2Z1SA 3BOLA 4ML4A 3AHPA 4UTGA 4ZJLA 4EYHB 3PANA 2Z24A 1OFQA 3AU2A 1NRKA 2FJEB 3ANVA 3CJ0A 1P7TB 1IEWA 5H8PA 3NS5A 2V9WA 3QF0A 1TPEA 2PDCA 3LA0A 1PJ6A 2J6VA 4ADTA 1TL1B 2DK2A 5M03A 2JC1A 1S5TA 4QBXA 5J2NB 3VMNA 4AZIA 1TKZA 3WCZA 4IG3B 1K6WA 4YB6A 3WQVA 3N1AA 1FP9A 2E09A 4DJBA 4Y9PA 4KV8B 3GR4A 1XG4A 3W8GA 4QX4A 4GO7X 1X1NA 2RNEA 4W87A 2EKNA 1HVQA 4CCZA 3SR7A 5T9BG 4UQEA 3HGOA 3GC2A 3SBFA 1AL7A 1W5QA 3VE7A 4PCQA 4BI6A 2DZBA 2KYZA 3AJ2A 1XEZA 2QPXA 5CABA 1N56A 2DVUA 1EJXC 3CGTA 3JQMA 4DPOA 4EFAC 5HWMA 3NG8A 2IW0A 1CLKA 3QR3A 1XIHA 4J90A 1CGWA 1DXIA 3DYMA 3GXIA 5T8GA 1P6CA 1IR1A 3BJFA 3W01A 1XD0A 1EOMA 3TYZA 3T0AA 1Q1KA 3CBWA 2B4GA 4EAYA 1WEZA 4WFBQ 5HQLA 3V4BA 1Q5MA 2FY1A 4A47A 1NU5A 1VEMA 1SUQB 2ISSA 3QGAC 1F7BA 5LIWX 3JZEA 1MU2A 2YX4A 3SSRA 1ZQ5A 4J9LA 3EYPA 4DWIA 1RT3A 1FD2A 1OY8A 4ATWA 4BBYA 3GG1A 4IRKA 2HWIA 3R8YA 4M5DB 3EZUA 5FAJA 3RBEA 1C8XA 2EPNA 4IG2A 4IIEA 4NCGB 1TREA 2VGGA 1RWWB 2B56A 3I87A 2V4RA 4Y9AA 1M04A 2EKCA 1V0MA 3U1MA 2OTJS 2X09A 1OD8A 1FE4A 2BVYA 4N7TA 1BVWA 5HATA 1T8XA 1KTBA 5H2ZA 1OMSA 2FVMA 4DELA 3E6EA 5AKQA 3P5ZA 3IA0A 3UR8A 3FX4A 5ETNA 3P5BP 4JIEA 2QCFA 3NQEA 3ISNC 1XERA 1HBOA 3FSTA 4F3QA 5KFZA 1RJQA 2XHYA 4ATNA 1E6ZA 4PBFA 5G4WA 3UR0A 5BRPA 4PFHA 4ZENA 3CQJA 4MFEA 3ME3A 4F36A 2P50A 4UTFA 3R6LB 2VJUA 2F9DA 2HEJA 3E01B 3A24A 2VPYB 2ZH6A 3IARA 1KWGA 1RWUA 5JVLA 3RJXA 4TX6A 2HK3A 1RALA 4NZ4A 3OUYA 1TKDA 1S4FA 3T0CA 5HMEA 1KV5A 3QJLA 1ENUA 3MMWA 4RJEA 4TY8A 3HM7A 1CJUB 4G5DA 2ZXQA 4YHGA 3A3PB 3GQCA 1FKPA 2WRMA 3BLKA 2YWHA 4A2SA 1XC4A 4ZA0A 3XISA 1H2TZ 4EWND 4E0DA 1V3ZA 1I0DA 2JEQA 2BLEA 1LUCA 2PDYA 4J37A 3SCTA 3UPMA 3CIMA 3R1ZA 1ZJAA 2DSWA 4KGLA 4GC7A 1RUSA 1S9GA 2R7QA 3QBCA 1Z2LA 3OOQA 1TA3A 4KH0B 2CG4A 2HGMA 1YDLA 5LNUA 2FDMA 1PKNA 4Z08A 1QOPA 1DQUA 2QF8A 2NLYA 4CKQA 2OR2A 3BW3A 4U4MA 2W3ZA 3WMSA 1X8DA 1DE6A 4DV3F 3QAUA 1Z3NA 2HIQA 3CHDA 3SSSA 4MZ8A 1H7PA 3ZSTA 1EJUC 5TNVA 1YKWA 1BYDA 2VL1A 1JR1A 2FLPA 2MGZB 4UMCA 3LB0A 4DL6A 4HTYA 2OO4A 3VUSA 4LF2A 1SJQA 4XZMX 4ECZA 4BHYA 4F79A 1XGEA 4O1CA 3VKCA 2EFQA 1AZSB 1RAOA 4L73A 3V18A 3A22A 4QCFA 2AMCB 3RHGA 1QDSA 2ZZ5A 4OECA 4CU7A 5HBMB 5IXUA 4F8XA 2GGPB 1K8CA 2MZQA 4F25A 3NL3A 5CGMA 3EZ4A 4DYKA 1QNQA 4IIGA 4B3OB 1UW9A 1W17A 3C0SA 1VIXA 3CULA 5F7UA 1GPFA 4H4MB 5DQGA 2DXFA 4WQ6A 3T0DA 3GTHA 2YB1A 4CD8A 1JI2A 4C8ZA 2YY3A 4DVOA 1CB2A 3A8JA 1W6TA 1GT8A 3UZYA 2PRHA 2DJWA 3TXZA 3PF3A 4P7QA 2E40A 4WFXA 4TLQA 2DGQA 1B0IA 5IM51 3B8DA 1P9QC 2VASA 2D1CA 3H4XA 1L3KA 4OYZA 3KK3A 1CG2A 4IGNA 5I3FA 1ML1A 1VQLS 2PLJA 3IVTA 1ZBTA 1S7HA 2DD8S 4INFA 3U02A 3KM8A 4CUCA 2VHGA 3EKZA 3GXDA 1VRTA 4RLEA 1EXPA 4YHHJ 5CPQA 1KC8T 3JZUA 4IFRA 2DY1A 5IQQA 3L4ZA 4JYAF 1WTFA 2V5DA 1FE0A 4Z7YA 3R8GA 1ITCA 1U09A 1WOOA 3QWUA 4EOUA 2VFEA 3UEQA 2DB1A 3AS0A 4IUFA 2Q6BA 1TKKA 4LRFA 2EFOA 4D8AA 3QM3A 4C91A 4HQVA 2D0FA 1XBVA 1UUMA 1J6PA 1TMMA 4N9DA 3GNNA 3PZMA 2VGBA 5AN7A 3W2VA 3AH6A 1E3ZA 3TARA 1VCVA 3M1ZA 3UT0A 1KONA 5TD4A 3W72A 4F50A 2JFEX 4L76A 2X40A 5KFGA 4HU8A 5H9EJ 4DR2F 1KLMB 3VMOA 3QNWB 1E0WA 4USWA 1Y8BA 3OVPA 2XH7A 4CYUB 3GIRA 2WVSA 5KFVA 1GNKA 2WCGA 4PPZA 2QA4G 1QBBA 4NLSA 3A47A 4CN1A 5ETVA 4OZ0A 3RDKA 1VKFA 1DXFA 5IHRA 3S7RA 1BAGA 5DEZA 3DLGB 4IX2A 5FI8A 3OBEA 2GVDB 1RA0A 2J77A 4V19J 1OCJA 3APYA 1Q16B 4DHVA 3CZ8A 4Q2MA 1KP6A 1RACB 5AYBA 1KD0A 4QG8A 2X1FA 1IKVB 2DH3A 4NASA 2ALZA 4ES4A 4QLKA 2OZTA 2D3NA 5K8OA 1FVSA 2NSXA 3APTA 1QAXA 3QWPA 2FVQA 3DFPA 3UPWA 2EEXA 3E2QA 4A8LA 5G1TA 5HN0A 3ARTA 1UA0A 4ID5B 3C14A 1DWJM 1O60A 1XYBA 2CLFA 3OLIA 4ZQMA 1QU4A 1DJNA 5IM0B 5F2IA 2RSQA 5AB3A 2NX3A 1JPHA 2NX9A 2VG5A 3G1HA 3W7OA 3KJVB 4UWMA 3SZ8A 3NNHA 1YRTA 5G0RA 3JQJA 1U1OA 5FIPA 3UU0A 4WHBA 3QC0A 4QBUA 2AYMA 3BH7B 1S2AA 1RT4A 4E4PA 4DUZJ 1UA7A 5MHBA 3SY1A 4WZMA 1R0AB 4JX6A 5IDZA 4DR7J 3IRXB 4J35A 8ATCB 3OGRA 1S46A 4LVGA 4UNLA 3WF0A 1DLOB 4QR2A 2VFHA 4UR7A 5FACA 3WIVA 2BV3A 1HMVA 1KN6A 2DGTA 5EMYA 4WR3A 5GMEA 1SXLA 4I2QA 1FX6A 4LFBF 2F65A 5G4DA 2XYGB 1LWFA 4S3BA 4UCGA 4DX3A 3TW6A 1QAPA 3FDKA 3UJRA 1BQMB 1RT2B 4LBSA 3MB9A 4B3LA 2RT3A 2WSCC 2IY5B 1LROA 1TPUA 1MG7A 1QHOA 1W9UA 2XGBA 3H70A 3QTPA 4O13A 1KQFB 3DFEA 1OYCA 1NK6A 4QFUA 3QR1A 1G7VA 1CS4A 3EPIA 3IIPA 1UASA 3LHYA 4RZ4A 4I6VA 3KCLA 3VM7A 3A8IA 4URSA 2GDQA 1HT6A 5CA5A 3GUWA 1CWYA 2ZOXA 3MJMA 1US2A 3GIQA 3LCWA 7AT1B 2AT1B 1JDDA 2DITA 1G3OA 1T9YA 3NQ7A 1XYZA 4LAUA 4ZK7M 4RKUC 4Q4SA 5HMFA 1MFUA 2OWXA 3LQGA 4RE4A 4OX7A 1QJHA 2BVWA 3HQPA 5JMNA 2KZZA 3UG8A 2CNNB 3CCRS 1N5QA 2AQWA 2DSZA 3LRLA 2ABAA 4ENOA 2OYLA 4RUBA 1KRMA 3N9SA 2ZHOA 1WF2A 3ENWA 5J2PA 1C0TB 3V3WA 4FKXA 1R0MA 1P6BA 2V2KA 1TCDA 2ZWPA 3DC8A 1R3VA 2A7NA 4LAZA 3WZ0E 1S6PB 1UJ6A 2RRAA 4QHRA 3SFWA 1SU5A 5ABGA 4X9YA 3NSMA 4PQAA 4PEEA 3MPYA 2DRDA 3C8YA 1NVMA 1VBHA 4L6OA 3BGRB 1NPPA 2OUGA 1XPGA 1F4HA 2VRJA 1A0DA 1KQKA 3ZTSA 3EA1A 4C11B 1IKXB 1EZZB 2VXNA 5U4NA 4UY8T 1MSSA 1GHRA 3BICA 3RIKA 2A4AA 3UFCX 3GDTA 3ETMA 2GIQA 3MM6B 1OG6A 5KFQA 3X1LB 2DNOA 1WEXA 3DOLA 1M0SA 2QLFB 4HN8A 5M17A 1TPFA 2X7WA 3LALA 4DSFA 1PDYA 4M6PA 5FJJA 3T1HJ 5A2BA 3M8QB 2I17A 3MPUB 4NHVA 3M6YA 4ZN3A 3BV8A 5GNXA 3EVOA 1UMLA 2F4VF 1E6VA 3WENA 2Y0SD 4X0NA 1S1VB 4G2DA 4EPEC 2H3BA 3W6YA 3Q45A 1J96A 4X9SA 1AQMA 3U6WA 3D9BA 4E98A 2H51B 2YXLA 3E2VA 2VDHA 3TYCA 3H5UA 2EQDA 1YHTA 1J0KA 1VGYA 1N8RT 2NW0A 4B9MA 5CZKA 3W62A 3MYPA 1N34J 2YWWA 3G8TA 3UGVA 1HKJA 3P0WA 3DNCA 3GDLA 1ZTVA 2FQIA 3HJZA 1EDQA 1BGGA 1VQTA 2V5LA 4UFMA 1E15A 1QK0A 2L41A 1K4HA 4FVCA 5F8HA 5CH9A 2VZUA 2RQMA 5J5DA 3NAIA 3TAOA 3OR1A 2I16A 3NYDA 1VBRA 4ZLJA 3N3MA 1H2UX 1M5VC 1H0HB 4ML9A 2CLKA 5AT1B 2I57A 2ZJRQ 4X4NA 5GQBA 2AAAA 1C4CA 2J13A 2Z2UA 5XINA 4J9QA 4LF4J 5J04A 3I7SA 2YVSA 1QNSA 2XIOA 4DV5F 4GGHA 4ERIA 4AXIA 3W9JA 1PBAA 3B0XA 2DNGA 1NTHA 5AXKA 3IM8A 5ETSA 1EGZA 3HV8A 1SL2A 2HSEB 1VQ7S 3M0VA 3EGJA 5KFXA 3TAPA 5ABFA 2Y1LB 1DQ9A 3H5XA 3G8RA 1SR9A 3VFCA 3ELHA 3WLNA 3UD5A 1QXLA 8XIAA 2UVWA 2HIYA 3W7PA 2YPZA 4YU1A 3PZPA 1YHQS 4ZVOB 3DKDA 3KP1A 3NA8A 1EJWC 2F9RA 4ECWA 2XEXA 1I94J 3DERA 2OLSA 3BYPA 4UTTC 3M07A 2L3MA 4NLPA 4OI3A 1F5BA 4Q2LA 4Q45A 1FFQA 2RGLA 4QW8A 2Z2AA 1GOKA 4Z1CA 3E2RA 1SO6A 3HFKA 5K20B 3RW6A 3U0HA 1TPDA 3DDIA 4PRTA 1GXUA 3U5YA 1M3UA 2B4PA 2OYKA 4UR8A 2JIEA 3VNKA 1YRUA 4QJ1A 3BURA 2QLBB 2ATCB 2Z58B 1UA3A 2ZC8A 2XGQA 2WSYA 4DV6J 1W3KA 3RU8X 2XNQA 3E2EA 5I3GA 1YLVA 2UU9F 2W4PA 1M5SA 4HHJA 5DM6Q 4JTSA 1T0TV 3IP0A 4QU7A 1BD0A 1EB0A 4YTRA 1O5RA 1Q8BA 3CEUA 3IJDA 3CAVA 1ONXA 1Q86T 1YW1A 2AJQA 1TPWA 2IUZA 4PUJA 3H5SA 4KJIA 4IR9A 2EXOA 5LXRA 5CG0A 3ZNJ1 3VZYA 3N01A 1ODZA 2ZC1A 3GILA 3PW0A 3PTWA 1AZ2A 3EX6A 4MWAC 1CJTB 1JAEA 1WC6A 1PC5A 2ZZNA 3MWAA 4WP3A 4A46A 4OHQA 1EF3A 2PGCA 1XLAA 3KVJA 4B9ZA 3S2JA 1BE4A 3HT0A 3R5GA 1NK7A 2WW8A 5DG7A 2ZRVA 3FDGA 3LNPA 3WBZA 3FK4A 3UNYA 3LLDA 1H09A 1PGZA 4XBJA 3WNLA 4L4MA 4NYZA 3NOCA 1LYXA 5C42B 2QLXA 1QW8A 2PDNA 3S01A 4M51A 2WTFA 1M68A 4POCA 1SZEA 5CSRA 2W9CA 3VIKA 4OYPA 3W7DA 2ZUVA 5DT7A 3D1HA 3HFZB 1VZWA 4FYXB 2VONA 2Y8YA 5ETMA 1X6LA 3W3SA 1UWQA 4JTDA 5F2MA 2J7WA 2W61A 3ZO7A 3IANA 2PDHA 4NUWA 2WQPA 2LEAA 3TWZA 2N7CA 3V16A 2D20A 3KLFA 3GU2A 4EAMA 4ATDA 3SCUA 2GW8A 1S6OA 4YVVA 4OX9J 3OHMB 4W5ZA 4O44B 2P1FA 4KWUA 4DV2J 3HVWA 8RUCA 1YXDA 3VIMA 3OVSA 3ARQA 4QSFA 3WD0A 2DIVA 1NELA 2B5JB 4KGJA 3SBMA 2MKIA 1SJFA 2HHWA 4ECTA 5LNWA 1HWJA 3PTKA 1YDVA 3JSBA 3N14A 3W5ZA 4DM1A 4K4XA 4HLBA 3BLFA 2IJRA 2Y4SA 1E6YA 4O0QA 1XRFA 4QGCA 5LA0A 1FTRA 2PDKA 4E2OA 4RNJA 2HRTA 2YXOA 1UZHA 4H9MA 3STGA 4K59A 4MDOA 1LF1A 4RNNA 1ITXA 2Z1BA 1S12A 1ZOTA 5LOQA 1B4EA 4ADUA 3NDYA 3GRIA 4TV5A 1I6NA 1M41A 4NAFA 2AJ1A 1OSCA 3RAOA 5AXNA 3MUTP 1FWSA 5BJRA 4X65F 3VKJA 3TLQA 2XH0A 1Q7YT 4P2FA 5JVGQ 4F26A 4I8YA 3MMCB 3TW0A 5F4XA 1V0KA 2XI3A 2B6AA 2Z29A 4KGVB 1KNZA 2B4VA 1FFRA 3V6DB 1WQ5A 4PRRA 3W38A 3WIUA 3WNNA 1T7LA 4X4TA 1DL3A 5HJXA 3CCZA 4RE2A 2CFXA 3TC3A 3TEGA 5AHNA 4FEZA 2MZSA 3QO9B 4CNTA 3IBCB 4J2PA 2HLTA 4YTQA 1FF2A 3IUHA 2ZD1B 5D05A 2QIFA 4W90B 1IYXA 2RKIA 2VGFA 1M90T 2PMWA 2XSBA 2LQ8A 4DBUA 2GJXB 3QEZA 2V0TA 3LHWA 1Z32X 3T8QA 4EO6A 3G22A 4E6MA 3MTKA 1XYCA 3AUJA 2VR5A 5HR7A 4P5UA 2WNQA 4QQ3A 1KRCC 4H9XA 1B9BA 1HWUA 2RVJA 2WO5A 4Y65A 2GSEA 2YCLB 3H26A 1Z7AA 4NI2A 4C3MA 2F2HA 1FCQA 2DXDA 1BYCA 1A0OB 1WD6A 3QY8A 1S38A 2G3JA 1SZNA 1PAUB 4K37A 3LRMA 1U26A 3GIYA 2DR6A 1TPB1 5EHHA 5LSLA 4ANCA 4HOXA 1JX4A 2J0QD 1Q7LB 3G2XA 4ZCIA 1JF6A 4HNUA 1RAEB 1M53A 1BSLA 1LK5A 1PE1A 4GQRA 4DV4F 4JTHA 2F84A 4UOZA 4PUOB 2AZ3A 3LGHA 4Q8TA 4LC6A 2OD6A 1R9ZA 2VC9A 5L8RC 1X5PA 1K9TA 4U96A 4UMBA 2C2RA 4TX9A 1VC5A 4KPLA 1BQXA 1RWOB 1K0VA 4D6CA 2QSWA 3DMJA 3W73A 4XZ9A 2ACMA 4CN4A 4JKKA 5C0QA 3U7BA 3J7ZT 1KTNA 3T1YJ 2UXCF 1RSCA 3A1YG 3KLKA 2PF8A 5DLCA 5H6HA 3QOMA 1S1XB 3EEZA 4J9OA 2HTMA 2CDQA 1QPQA 4QITA 1EP4B 3G6VA 1YGYA 1LG1A 1J8VA 3MCMA 2W2OP 4KBXA 3HVTB 5HP1B 1F8MA 5I6SA 4F4KA 5KT2A 3KX6A 3NOGA 1A5KC 3D6HB 3GTYX 1DIOA 3W65A 1VPQA 1V02A 5A8RB 4AUBA 3M0HA 1LBFA 4C98A 3BARA 3U2EA 2CDRB 4UF4A 3D4JA 2EI5A 4WK3A 1VD6A 3UDVA 2EBNA 1UZ1A 2RQCA 1LT8A 4WKFA 4EIVA 3ITVA 4I6KA 3W70A 2R7OA 3HCXA 3J7YI 3CD0A 5HROA 3JAMU 2E9ZA 3QMQA 1D8WA 4PCPA 4HTJA 2CLLA 1UWTA 4WK9A 1JZ8A 2N7YA 3TZZA 4WE1A 1KDNA 4AQLA 1QE1A 4I9JA 1DBTA 1DWAM 3UJSA 2RU9A 1THFD 4LTSA 3CUXA 4ZQNA 2UUTA 5DJBA 2OPJA 1NHKL 5CXPA 1U1NA 5HQEA 1GVEA 3EVMA 4XD3A 2LLEA 1JCXA 4MIWA 2ZBRA 3CHCA 4M5LA 1OC7A 5BRBA 1FCVA 2YW3A 2WONB 4V33A 2NQHA 3ITXA 4MK8A 1F9HA 5J1NA 1JLGB 2DGUA 5CPOA 2OPPA 2MKKA 3PNZA 2XIMA 4YN5A 5EMLA 1J6OA 1A3WA 1PG5B 2KJVA 3ZFHA 5IOLA 3V35A 1R8BA 3CH9A 3MFHA 3QOKA 4OOZA 4QLJA 3IR7B 3LOUA 1HI1A 2DZTA 1UZ4A 2V67A 3KBSA 4ZVRB 2F1FA 2H4WB 1KVJA 3P2VA 2ASLA 3W29A 2FTPA 3PYFA 1MN9A 1TE6A 2FZBA 3HSDA 3IAQA 3CCLS 2DZPA 3T08A 3UZZA 2LKZA 2EF9A 4JTJA 1BWVA 1ZPTA 2QEZA 2KHCA 3H4BA 4PTMA 2HZAA 3VNYA 4RXFA 4GCAA 3NQGA 1OX4A 3I5CA 4O4WA 1S5WA 1UFWA 1E4NA 2MQNA 3GFZA 2HQCA 3B8SA 3LCXA 4O0ZA 4J9KA 2Y70A 2XM3A 2ZH5A 1UP3A 3W7KA 3W6LA 3ZZOA 3FC9A 3M7SA 1XFCA 3LH2S 4KO0B 4ZVPB 4IIDA 3KLVA 3F5JA 2V3EA 1HHQA 4E8GA 3GC5A 4A3QA 4HK5A 3AIWA 4U9RA 2VWSA 3WQCA 2W2QP 1C8QA 1YIXA 3R3TA 4TVAB 1ZZNA 2E1CA 2I0XA 1TPH1 2GA7A 2KFZA 2W6RA 2JLFA 3URAA 4KMQA 2DRAA 1VJQA 5AE1A 3RR1A 2OKOA 1O5QA 1SJ3P 3GUGA 1PYSB 1FWGC 1C1CB 3PJXA 4S3GA 3FUYA 3NCOA 2VX7A 2R2RA 4Q6XA 3HA1A 1H11A 3TJ9A 3MUCA 4PMRA 4KIRA 3LP2A 4OZ2A 4DZ5A 2EPOA 4XZNX 4EACA 4L4LA 3DOKB 1F74A 3KVKA 5A8WA 1B3XA 4MF4A 4S23A 3WLHA 3VVTA 3TMLA 4C6MA 1EBGA 2DW6A 3WJYA 3AQOA 2D3LA 1LT7A 3MR7A 1OSDA 2KKHA 3SFUA 3RBZA 3PM6A 1WELA 4M82A 4F2SA 2CERA 3HV9A 4I7UA 4ZMGA 3S4TA 3SIZA 1E55A 3E38A 1RLCL 2W01A 3STEA 2YX1A 4JI2J 2YZRA 5DM7Q 2C2KB 5AOUA 1SR0A 4ZCWA 2GUYA 3N6QA 2F8HA 3BM7A 3VCDA 2PSNA 3QHMA 1Q7MA 1B70B 3ZVHB 1NK0A 3KNAA 3EPMA 2J7HA 4GVBA 5D4NA 4QYZK 2V5BA 3KS5A 4YR0A 3DKLA 1QAJA 3NJ3A 3WLJA 1QPKA 5A6JA 4C8YA 2CHOA 4NL1A 4F2RA 3FGCB 5EA9A 2W27A 1GHSA 1T9UA 1OZMA 2ATLA 1OFRA 3KRUA 3GYNA 1QTNB 2B9XA 2BOEX 3U7VA 2PDAA 3NUKA 3ARPA 2I9EA 4KS0A 4HP5A 1LLOA 4W7VA 4L4OA 1IZKA 4ERDA 3USZA 3M2VB 4DSEA 4U28A 3M5VA 4KCVA 2WZIA 2ZKTA 2VEGA 3CEPA 4XAKA 2R1KA 4LYQA 2IKJA 4NPOA 2RRBA 4UQDA 4GXWA 4ID8A 1KQYA 4H2HA 3TZWA 2QUMA 5TBOA 3N2XA 1HW6A 4X63A 3MR3A 1XS2A 3LPPA 2G37A 5HMSA 1IKYB 2P5NA 4DWSA 3FYOA 1A7GE 1BF2A 2VFFA 3AOFA 1RJPA 2ODOA 4M1RA 3G8EA 4M1BA 2J76E 1REQA 4B5XA 3LMYA 4DAFA 3AYVA 2CPFA 3SDEB 5L6UA 3NL6A 5I3UB 4IQEA 2Q01A 3CQKA 4HDHA 2B7PA 2TSYA 3OJUA 4FYDA 3P4UB 2VOTA 1VI7A 1MXSA 5I5RA 2C1HA 4OZ5A 2L9WA 3GSDA 2POKA 3TTOA 3UZXA 4YB7A 4K5SA 5KFOA 1VYSX 5BYWA 3M6VA 1SKSA 3IWNC 3KP0A 4QZVB 4O19A 5DY3A 2VZSA 3P8IA 1EO5A 3DHFA 4EZ9A 3AS3A 4W85A 2EG2A 4LBHA 2GSHA 3BG3A 5HBFA 2P8CA 5EWFA 2AGKA 1O6IA 3I7QA 1XDJA 2HVOA 4QNWA 2BOPA 2PZNA 1XMQJ 3W74A 4Q8QA 1S1UB 4GZ7A 1P1LA 2B9YA 3EDQB 2ZE3A 1UD4A 4NLUA 4H9UA 1UWBA 1ONRA 3Q67A 3SUUA 4FALA 3ZZYA 3QIPB 1N2VA 2YL8A 3KLLA 4URQU 3CW2C 1R3TA 4RBUA 1S5ZA 3ISIX 5CGQA 4AWEA 4ASTA 1IM4A 1CGUA 2EFNA 1F5ZA 3O6AA 2CJAA 3G8SA 2J7EA 4KQZA 9ATCB 1NOFA 1W3TA 1KM4A 3PBYA 2E9TA 1UFLA 4A4JA 4ECSA 4ILLA 3S3GA 2AYBA 2DCLA 1V3MA 3BW4A 1H7RA 5IWAF 1LXJA 4RPFA 1TYGA 5CPSA 3TNBA 4PUMA 1U8SA 2HMCA 4J9PA 3HJFA 2V3FA 2GVEA 4F48A 2WJEA 1F60B 1YJVA 4NJGA 4MADA 2HS6A 2WVVA 3AB2B 4EEYA 3SJ3A 3MEKA 5D33A 2W24A 3PRDA 4X60A 4OGZA 1IKWB 4IFOA 3EX4A 1P5BA 3TA9A 2ZUNA 4JXCA 4LXFA 1NDZA 1WOPA 2J47A 2CHNA 2IM2A 2N4DA 3G1DA 2ZH4A 1HNZJ 2P9CA 2EWHA 2ZBQA 4JTFA 4Z2GA 1PBUA 5KFSA 4QPXA 1SKRA 3R0DA 1I1WA 3W1UA 1FX4A 3PR5B 4GVFA 1H7WA 4OHVA 3A5VA 4PZVA 5DDOC 4XQ6A 1H5VA 3L3CA 3DXIA 5BCAA 1GOOA 1TUGB 4O3PA 2RAGA 4YHEA 3SQSA 3AZRA 4UBPC 4I69A 1E70M 1KFLA 3T5LA 1QVFR 4IIHA 3ZJ8A 3W1QA 2QT3A 1WB0A 4AYGA 1X5OA 4N4PA 4S3CA 1GG0A 1BWEA 1IBCB 1G4TA 3B40A 5AYZA 3MMAA 4PPDA 2WVEA 4OX6A 3N29A 2FVRA 2ASYA