3KDNA

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
437
structure length
436
Chain Sequence
b'IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase
publication title Structure-based catalytic optimization of a type III Rubisco from a hyperthermophile
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Lyase
total genus 142
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3kdnA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3kdnA01
1IWAA 4MKVA 1TELA 4NASA 3QFWA 3A12A 4F0MA 5HQLA 4F0KA 4F0HA 2ZVIA 5HK4A 5C2GA 1IR2A 3FK4A 3AXMA 1RBLA 1YKWA 2D69A 1BWVA 5C2CA 1UW9A 4HHHA 1RSCA 4LF1A 2V6AA 2OELA 3RG6A 3A13A 1RXOB 9RUBA 1SVDA 2VDIA 3KDOA 2YBVA 1BXNA 3NWRA 5HAOA 2VDHA 2V63A 5HJYA 3WQPA 3KDNA 1RLDA 1EJ7L 1RBAA 1GEHA 1UZDA 1IR1A 2QYGA 2CXEA 2OEMA 1UPMB 1WDDA 1RLCL 2V68A 5HANA 2OEKA 1GK8A 3RUBL 2V67A 2OEJA 5HATA 3ZXWA 3AXKA 5HJXA 8RUCA 1RBOB 1RCXB 1RCOB 2V69A 1UPPA 2CWXA 1AA1B 2RUSA 4RUBA 4LF2A 1RUSA 1AUSL 5HQMA 5RUBA 1UZHA 1UWAA
chains in the Genus database with same CATH superfamily
1WORA 3COTA 3Q8VA 3W1RA 3UFCX 3PM9A 4RW5A 1QBAA 3C6UA 3HOJA 4DV2F 3EZ4A 1F4HA 3GZ3A 1JDFA 3RPTA 3W82A 5BRBA 4UQEA 3VPLA 4ZCKA 3T6BA 1HBMA 4JHOA 2CQ4A 4IIBA 5L6UA 5EA9A 1WG4A 3LSCA 1K73T 3V36A 2VUYA 3BV4A 3O6CA 4LEQA 4UW2A 3NOGA 4X63A 3BE7A 5H6HA 4FS1A 3GH5A 2WW4A 2Y3YA 4LUSA 1DURA 3ZOAA 4J90A 3JS9A 1K9TA 1K9EA 2MSTA 2Q6ZA 4J9MA 1KM0A 4V1YA 2WHJA 2FIQA 2AJ4A 3P0XA 1FO1A 3CCLS 1SSDA 4Y9MA 1BWLA 2AL2B 4Y28C 3DFPA 1AD1A 3MD1A 4IMGA 4DQIA 4RX6A 5E6YA 1FFQA 3G3DA 3KBVA 2F38A 3PTKA 1N6QB 1E6PA 1K47A 4AHOA 5GJMA 2VGIA 3MCMA 5BMWA 3OTEA 3D1OA 2ZJRQ 4LQ9A 3KZSA 3N12A 3LX9A 1X4AA 1ODZA 5ETVA 3SEOA 3QYSA 4AAJA 4LRFA 4FA3A 1DHKA 3BOLA 3NS6A 4B08A 3PIPQ 3T0BA 4PPZA 4W93A 2I9UA 4LFAF 2JALA 4OYWA 5L1LA 4CNOA 3ZC4A 3ZZYA 3MUCA 4HZ7A 4LBPA 4GQBA 1FWEC 1GVSA 4IIFA 3CAKA 1AW5A 1KBJA 5I3DA 4ICLA 1B64A 4IO1A 4QQUA 5CLTA 4AHPA 3C0JA 2V9DA 4H54A 1VCFA 4J9VA 3TUZC 1K9DA 2MUCA 2Z4GA 3W1UA 4JNMA 1QI3A 1PYOB 1GQKA 2YX4A 1NK7A 3UWVA 2GDVA 3FVMA 4TVUA 4UIOA 1WXZA 4G8TA 1RAJA 1OABA 1W3LA 1U5VA 3W61A 3MUMP 3CHEA 5BWAA 3VO0A 1FWPA 5E09A 1RWOB 1P5BA 1XRFA 4NZ4A 2DNMA 4DUOA 3IRDA 2OFGX 2L9DA 1EL3A 4NKCA 5JUMA 3M8WA 4S3JA 2MLXA 4KFNA 4A21A 5I2UA 2C7FA 4LS1A 1CBGA 3S1XA 1RTZA 5G2HA 3BQ0A 4JI4J 2AL2A 2YX7A 3L5AA 3JS3A 3CD7A 1M01A 3TWAA 2L9WA 5EMLA 3S2CA 3G0UA 3BLLA 4NX5A 1JDEA 2MKYA 4NX0A 1IJFB 2DNKA 3KNAA 1LQ2A 2E29A 4C8YA 2YZRA 2VZVA 3DNCA 3ILLA 4JTDA 2H90A 5HMFA 4EIVA 3OYXA 1MW7A 6REQB 1FWSA 2B7BB 4LF5F 4MWAC 4R27A 3I4PA 2RS2A 3QF0A 3WX8A 4Q22A 3PPCA 1U8SA 1K7EA 2QA4S 2E7XA 1FRIA 3M2UA 1UD6A 3KVLA 5DLFA 4MK8A 2XTKA 1REVB 3FRYA 3KHLA 7PTDA 4Y8FA 3B54A 3PJWA 1HI8A 4QPXA 2PDMA 3SCQA 5A69A 4Q7AA 3OODA 1S1RA 1ZS6A 2F9DA 3URQA 4DBSA 1BKSA 2I14A 3QV6A 1GOWA 3C2PA 2W4XA 4E5TA 4QJ4B 3BSAA 3NXZA 3BZJA 5BNKA 5G2WA 1RI7A 1OFQA 1MWYA 1PE1A 3BGGA 1XR5A 3WH6A 4E4FA 1F1BB 1FCQA 3I55S 3MURP 3H90A 1BTMA 4KBXA 2HQDA 3CS2A 1CC8A 3TTSA 4IP7A 2MZTA 3OPSA 1EXPA 4DUWA 4JHZA 2VDIA 1B7FA 5AN7A 1FRJA 4QDWA 4F40A 5A6WA 5DELA 3VFCA 4C6MA 5CSRA 4NILA 2R8HA 3TV8A 4OZJA 2DSVA 1XLMA 4I8YA 2PCEA 3H7VA 2XY7A 1NHUA 1H3DA 4WP3A 3LU2A 2ZWYA 4K4YA 4ECTA 6AT1B 4LF8F 1S4FA 2VPYB 2LEAA 1HW9A 1SFTA 2M3DA 2BJEA 2BHZA 2BJDA 2CHNA 2EK6A 3VIIA 4DF2A 1Q13A 4CCHA 1KQZA 4ALZA 3FMBA 2YCEA 4M5PA 2V68A 3WBYA 1REVA 4HKQA 1VQLS 4ZB0A 1BQMB 4W88A 1GVQA 1IEXA 4AZHA 3WG6A 1NJYA 2F8EX 4ZS6A 3L0GA 1E1CB 2ZX5A 4GKTA 1Q6GA 3R4IA 3TSBA 2WSQA 1TR0A 2DRDA 5KFNA 1TL5A 2DZPA 3NQEA 1T6MA 2OLHA 2IRXA 2BE2A 3SCPA 5J2PA 3HD1A 2QVNA 4O8RA 1W25A 3EDJA 2HQCA 3DRRA 1XBVA 5KTQA 2CZ5A 3CQ0A 2YNGB 2WPGA 3PWIA 1Y5NB 2I57A 3TARA 3NKYA 1SH0A 4P61A 4E2DA 2EPIA 3QJPA 1NPRA 4YB1P 4IOTA 4MMWA 4J91A 2Q1LA 5C9XA 2HQFA 2QUVA 3CYJA 1RTHB 3V18A 3LH2S 2ZZ2A 4JB8B 3GNXA 4R53A 5T7LB 4JBRA 4NYUA 5DN1A 1LWXA 4JV0A 2P6TA 5D38A 2GQ3A 2VVSA 2VELA 3QGPA 3HGRA 4MK7A 1IGSA 3WK0A 1S0MA 1QAIA 4MJKA 3R89A 3T2QA 1F5CA 5K20B 4JI4F 3VTIA 3HPAA 3YPIA 1UVMA 4NI3A 8AT1B 1G0CA 4M1RA 4TLRA 4I2QA 3A23A 4ONVA 3ITLA 2LQ5A 3ZSTA 5HLFB 4KJIA 4IP5A 2E5JA 1GEQA 1NMEB 5BOOA 2ZX9A 4AZ5A 1FVQA 1WDQA 5C5YA 3SRKA 2W01A 2O5DA 5AHIA 2A7PA 2IXUA 3H12A 4M6VA 3C6TA 1ZJAA 4ACZB 3ZT7A 3WLTA 3N4WA 2XUCA 4NY2A 4UQ9A 1FT8A 1PG5B 3DG7A 5KG3A 3PPFA 3IWPA 2YNGA 4HT3A 2HGNA 4Q33A 4DX7A 1ULRA 4EU0A 4HU0A 5G2IA 5KZEA 2C2OB 4LAZA 1JXKA 3LQLA 4ZO7A 2EFNA 1V93A 2Y5SA 2YW3A 5DMNA 5KFRA 2E9TA 5I03A 2CRLA 1YTEA 5LA0A 4PB5A 1GVOA 3C19A 1EX1A 1US3A 4I7UA 4S38A 1G9HA 5EWFA 1OYAA 1S5VA 3P96A 4B5WA 4EAMA 2FLIA 2OIHA 3E74A 4IPLA 4UQDA 2JL9A 1CNVA 2J6SA 4DYKA 3O2LA 3NCOA 5F3ZA 4YL2A 3TZYA 5J5RA 1E0WA 5F8GA 5I3JA 1FWBC 3GP9A 3TVKA 2P10A 3QXBA 1OB0A 3CWJA 3RO8A 5EGYA 3RO6A 1UPPA 4JV1A 3SCRA 2XWDA 5J2QB 3KVMA 2AW0A 5IOBA 1JPDX 5IBXC 1BXCA 3GNOA 1WTFA 3PEJA 1R9ZA 1SZNA 2BLEA 4ED2A 1XBZA 5CC7A 4GO9A 4HQVA 4QIEA 3PDNA 4QIGA 4GI6A 1EP4B 1UVKA 3CUNA 3KJFB 3TA1A 1CG2A 3T41A 4C7DA 3C46A 3PV8A 1H5VA 3WNPA 4DV5J 2ERRA 3MJMA 2F8QA 1B70B 3B8TA 1XMBA 3D0IE 3H4XA 4AIBA 3OLIA 4ZN1A 4V19X 3DC8A 4AFFA 3ZLGA 4EMDA 5EMYA 1RQHA 4JDBA 4G2DA 1E9IA 1UH4A 3DUGA 1ONRA 1QAYA 1XKYA 3D4JA 3M1VA 4Y2KA 1J5TA 3KLKA 3VV2B 3QZ6A 4DS5A 3QY7A 4CP5A 3FS2A 3TJ4A 1B30A 4LF4J 2HISA 5L46A 4MAZA 2MSSA 1C1CB 3DFHA 2GHPA 2JFKA 1J18A 2PRHA 3KWSA 3QH2A 1S2CA 3VK5A 1Q81T 2HBVA 4KWUA 4MTVA 2AJ2A 4QITA 1DPMA 5EUHA 3UJSA 4H9VA 4WUIA 2NQLA 4TO8A 4CT8A 1RALA 5DCEA 4XIMA 1KQGB 2FKPA 1LWEB 5BYSA 1E9YB 1MMDA 3W9JA 1OY0A 1FKPB 4MYTA 2XMKA 1T7PA 1GW9A 1JQXA 1RWKB 1PX3A 3WSUA 1TV8A 4ZSTA 4NMXA 4I90A 4CO1A 2OZ0A 1GYMA 4AZ6A 3M16A 3NVTA 5HMXA 3T8QA 4UTMA 2PEVA 3M4XA 2C1EB 2FLOA 2OSQA 2Q6CA 4HK5A 3MEDB 2PA6A 2YXOA 2MQNA 1EO7A 1WWHA 5C24A 4U7UK 3NO1A 4NCGA 3UWQA 3UXLA 1AMKA 4M1KA 1R3VA 2DKOB 5BXIA 3V1PA 4LR7A 1JNDA 1MRQA 4WRHA 2NT1A 4BQ2A 1FH8A 3MHUA 3AO0A 1XYMA 4EACA 4OJGA 2E5LJ 3V5RA 3LENA 3UERA 1C1CA 3K5NA 1WA3A 1PHWA 3GD6A 1U83A 1ZALA 2XSFA 1KD1T 2GJNA 2QT3A 3BGUA 4IIHA 3K89A 4RW7A 3W2WB 3ITVA 4CLYA 4O52A 1TVPA 3H59A 3TZWA 3AFBA 4Z2IA 1Q45A 4X61A 2QVHA 3UZYA 2OKQA 3QQ1A 1MXDA 4A3RA 2KRBA 4HCLA 1I60A 2H8XA 1S12A 4S23A 3AIUA 3LPGA 1ISZA 3GTFA 4AEOA 5I0DA 2DGSA 2WB1D 3N9SA 2ZBCA 4EK2A 1X7VA 3J7YU 5CPOA 1WG1A 2PLCA 1HGYA 3DRPA 5B7YA 2ZXQA 3HSZA 4ELUA 2DT1A 2XGBA 4YWSA 3BW3A 1K4GA 1F05A 3O5TB 4ZPAA 4P75A 3FNNA 1KFKA 3G71S 3CPRA 3FSUA 3HQNA 1WZAA 1EX5A 1I2RA 3WQDA 2RHQB 4H1ZA 3WUBA 1GWJA 3TIMA 3LP2A 4P52A 1J12A 4DV5F 2CZ9A 2R8GA 5HR6A 3FA4A 3CF5Q 3GV5B 5CABA 2OYLA 3GY1A 4DJFC 4PODA 4NJKA 3M7SA 3P49B 4GI9A 4FOJA 3CYVA 4LEFA 1TKXA 4ZOBA 4Q44A 4KAIA 1D3CA 2ZVRA 2BJ1A 3UETA 5KFDA 1KXVA 3IJLA 4PG4A 1U47A 2V4RA 1FUYA 5JMUA 3E3HA 4URSA 3L5MA 2AJQA 4DM1A 3R7MA 3E0IA 3A3XA 3CZLA 1R86A 1IGWA 5FJUA 2WZ1A 5MAOA 1JR1A 3TWZA 5LSLA 2DO0A 2WC7A 2LXFA 4UMCA 2DPJA 3OA3A 4DPTA 1VD6A 2HEJA 2GJXB 2E66A 4B3TJ 2O9OA 2ISSA 4PC8A 4MADA 3M30A 4RNNA 5HMZA 3KZPA 4DBDA 2NUWA 1PZ1A 5GQBA 5GVQA 3BGAA 3WIUA 4Q4OA 2JHEA 5CHCB 3PHEA 3N2CA 1HBOB 4JR5A 4GIRA 1QE1B 4QR0A 4RUAA 2TSYA 2C1GA 3DGRA 4XBSA 3ZZOA 1VC5A 4QFUA 4ZSUA 3NG3A 1Q95G 3URNA 1B0VA 2XH0A 1JLBB 1T11A 3OZOA 1M1BA 3EZ5A 1WUFA 3PEHA 3TJAA 4IFVB 3VAMA 1NF7A 1HZYA 4ZVFA 4LF2A 3OLBA 4PCQA 3U6WA 1JXJA 1XBYA 2Z29A 5XIMA 4CYUB 1DQUA 1VFUA 2DP3A 4DCOB 2GQ9A 1QNRA 2FH8A 2VEFA 1MFUA 4WFNQ 3MKKA 5A6PA 2W7AA 3LLFA 5GMKa 1DEDA 2FHJA 3N9UC 1FX6A 2QUMA 1UJQA 3QKEA 3KG0A 3TZZA 3EOEA 5T9CE 4LWWA 4WX2A 4X2BA 2QDEA 3C2YA 2E5LF 3EZOA 4OYAA 4OZ2A 2GS8A 3TTEA 3KLHB 2A2IA 4HP5A 2VWSA 4UOHA 4U6PA 1RHKB 1I94J 3Q8SB 2VX4A 1TPH1 4N4PA 1NFGA 4RKUC 3UD5A 1WDRA 4PUNA 2YBTA 2EFOA 4DPXA 7FD1A 3CJQA 3UG4A 4NLTA 5F3TA 1U1LA 4N4QA 1UW9A 3IM8A 3VFLA 3V4IA 1VRUA 1BMQB 3ONCA 2J9DA 4C5YA 1QE1A 3CD5A 4CN6A 2BY3A 1UBPC 3W2UA 1VK3A 3ZTPA 2H8ZA 4KTQA 4ZIVA 1T40A 1XFCA 4B9NA 2PDHA 3WD3A 3PYEA 1KFLA 5D8WA 3R11A 2Q6BA 5U47A 4I6WA 3KM8A 3KHHA 4RZ4A 2P9CA 4LAOA 4C6CA 3HN3A 1S5ZA 5DQHA 1A9NB 4MWAA 4CYUA 3EVOA 3BH4A 2HGMA 1FI4A 5ETLA 4DI8A 1ZA1B 1XCFA 3H2AA 1XPYA 3CZJA 1YYAA 3TK7A 2VOPA 3FHAA 5DF0A 3HMJG 4PWUA 1GT8A 2J8GA 3KLLA 1JLFA 2OP5A 5K14B 3H2UB 3PAJA 1UCNA 4CLFA 4ZOEA 1GX6A 1HQEA 2WQDA 3ITHB 1FXPA 5I3FA 1EP1A 3BQ6A 4ZXOA 1Q3NA 1DXIA 5BCAA 2BV3A 5D32A 2QHAA 1CLVA 1GHSA 3O63A 5D6GA 2ATMA 4M5DA 2AGTA 4BWJA 4I5UA 4LSLA 3DZ1A 1RTIB 3O9NA 1H63A 3H7UA 2WVCA 2VG6B 2XCPA 3CWHA 3PZPA 1JYXA 4U10A 5D2XA 2FGCA 4GOAA 1NU5A 2NXCA 4LBUA 3VD7A 3UNGC 2M8HA 1H41A 3L4TA 4L56A 5GMEA 3EA2A 1WJ9A 2RKIA 1Y65A 2PLMA 4B3TF 1NY1A 4RE2A 3DDIA 4EGLA 4FLQA 3KWXA 1XN9A 3HD2A 5AHMA 1Q8JA 4JXCA 4OOZA 4QG6A 2NYIA 2V2VA 2I8EA 1EP2A 1VCVA 4JL2A 3R8GA 4Q0BB 3UR5A 5CCMA 1E0TA 1WKEA 3HG2A 4X66J 3KOAA 1J6OA 4LYPA 4C9DA 2VC5A 1LG2A 2C3MA 3W23A 4JYDA 3RXZA 3B8UA 1NVMA 5F0UA 4L3NA 4A4JA 1U7LA 2V5LA 2Y8KA 1H0HB 2ZDRA 3EX6A 1F6TA 3A21A 5EN1A 4C6IA 4S3EA 2NV2A 2DGQA 4KBIA 5AXNA 1YW1A 2OPRB 1N48A 2Z56B 2NVDA 2TPSA 1FCVA 4KRWA 4KO0B 1OY8A 4B9SA 1S9FA 3RDKA 2MHEA 1ZZMA 2ZIDA 3OVPA 1GKPA 1H3GA 2JFEX 1Q6RA 4AWUA 1K1SA 1X8FA 1JJHA 2BP1A 1AL8A 5D05A 1Z44A 2VG6A 3CJ8A 4N8OA 4YB5A 2JEJA 2ZRZA 1XW8A 1HQUB 3OP2A 4I3GA 3DMJA 3GIKA 4NPOA 4BS2A 1W3KA 1TPDA 1I94F 3VCRA 2JEPA 2CNKB 4ZQOA 3PG8A 4QX4A 4BEUA 3MMAA 4IX2A 4GO8A 1NDZA 3U2OA 2EJ1A 5BYRA 5E6ZA 4LBRA 3CAVA 2OLWA 3K2YA 3OTCA 2KFZA 1K8AT 2VURA 4IP4A 3TR2A 3E6EA 4MFEA 1Z69A 1IEQA 4DUYJ 1Y5IB 3DHXA 2HV5A 4OJHA 4IPJA 5M2RA 1W9BM 2JIWA 2UY4A 4I6AA 3G1VA 2IKIA 3IK2A 4JY8A 4LREA 2NXNA 5FJRA 1PGZA 2BW2A 3VNDA 4FX7A 2ZA2A 3SUVA 3RAXA 1UUOA 3ABRA 4GFIA 4ZO8A 2QYCA 4AWSA 1TFYA 3FFIB 3MUVP 3RU6A 1S7IA 2DUXA 3SRHA 3OJGA 3ISNC 4IFKA 2ZZTA 5ETSA 4M6PA 3RCNA 4WBFA 4ED1A 4JTHA 2PF8A 2BQUA 5J5DA 1EIYB 3QV7A 2FHJD 3DLHA 4RBUA 5DETA 3CPUA 3K46A 3PW4A 3OW2R 2YXLA 1UR4A 5AKQA 2ZYFA 5GPRA 4JN7A 2OGYA 1X4BA 4PBGA 1FFRA 1UMYA 1VYRA 3AS1A 3UJEA 1IWPA 3C3UA 4IQDA 3BAKA 1SPQA 3NSXA 3WLPA 4EKJA 4NLUA 2ALDA 4PCPA 4JI2J 3VOJA 1RKIA 1ITXA 4GD0A 2APOA 3JSBA 3ARUA 3DFQA 4UUWA 2A6MA 1XIBA 2FQQB 5F8LA 1TA3A 5LXRA 4RL3A 2IMOA 1XLIA 1RHQB 1S57A 3O3RA 2RDWA 3AS0A 2PRLA 3BLFA 3R94A 1HFBA 3RGIA 3CDAA 3MSGA 3F2DA 1FKXA 4MAKA 4CEXC 1TVLA 1NCLA 2C2ZB 1HGWA 4X66F 3LSBA 4X4QA 5KFBA 5KFFA 2WK4A 1ZBKA 4EPDC 3NFUA 5GVJA 1S1VB 2HSAA 3OZMA 4DSFA 4FSAA 1KTBA 4Z08A 3E01B 2PT0A 2ZE3A 4P7RA 2GGPA 3VGSA 4FX8A 1NOFA 2B4PA 4C65A 1HYSA 1RT5B 1B3VA 4KGVB 1WOSA 3DKLA 2CUYA 5H1SV 1S4EA 5DRIA 1PKUA 3DOKB 2CJXB 1B57A 2XY5A 1AJZA 1XL9A 3SRDA 2E1RA 4BLGA 3RF9A 4OZ5A 2OQLA 2D1ZA 3SCKE 1JF6A 4L76A 3LCHA 1NOWA 1JYWA 3E3XA 2QA4G 4AUKA 2VPWB 2TODA 4ZL1A 1ZYQA 3M2RB 2EC0A 4LR9A 5DDOC 5HJXA 4KWSA 3B9DA 4WQ6A 2VU5A 4P7LA 1MG7A 2YH1A 2YL9A 4WP8A 4AY7A 3KK2B 1NKCA 3AAWB 5A8QA 1FKWA 3IGSA 3IC1A 1NKEA 3EPNA 3RCYA 5HNNA 2FZ9A 2ZQ0A 4RCXA 5K8NA 1IIGA 3CHCA 4AIOA 1S1VA 2R3VA 4DUYF 2R7OA 1U45A 3L7RA 2X2GA 3RPDA 4ZB2A 1X8CA 4GZEA 5LT5A 4RL1A 2X2YA 4N02A 3HM7A 3MI7X 1QI5A 1MWOA 3CMAS 4A8YA 2PDGA 9XIAA 2EPHA 5HQLA 3M5YA 3DG3A 3CCQS 1FCUA 2RAGA 2J62A 2Y5EA 1OJ4A 1XLJA 2FHCA 2PDXA 1PZ0A 1ESWA 1UEKA 4C6JA 3QO9B 4EBDA 3C0QA 3H2VE 3OR2A 2QCDA 3UWZA 1K9MT 3M6UA 3PB2A 3OPKA 4HR2A 3WDRA 4GQ0A 4BQ5A 4R88A 5FL0A 3RJMB 3NMAA 3HCXA 3AYSA 4IG2A 5A2BA 3GTXA 4AEFA 1CULA 1YDVA 2V34A 1GCYA 2BFGA 3DXIA 3BG9A 2P50A 3JSMB 1KGUA 1NB7A 5REQA 4ZOSA 2ZUGA 2TYSA 1SB6A 5CQGA 4OJ3A 2H5JB 4CQCA 3PNIA 4DQWA 3KDOA 1X1ZA 4UFJA 1F9FA 3O06A 4PTVA 2CZ4A 3G4SS 4OZOA 1HKAA 3MV01 3WQCA 2GC8A 9XIMA 1HNYA 1VLOA 1EO5A 1O5XA 2UUCJ 3VKDA 1W37A 4H9XA 4HYVA 1OQ6A 5AFDA 4AMAA 3QFHA 4ZP9A 2DH9A 2KDOA 4LRCA 1SW3A 2Y5JA 4K4VA 2CLOA 3QC3A 4RR4A 4EZ6A 1U1HA 3IR7B 2XFFA 2BBFA 3I5AA 1QUVA 4U4MA 1YBUA 1UZ1A 2QIFA 1LEOA 1MI3A 4QAIA 3PY2A 4NRUA 4YR0A 3UY7A 2GUBA 5KFGA 4A4AA 3I9ZA 1RLCL 1TPWA 1KV8A 4XD6A 3NGTA 2L41A 4AEEA 4PGLA 5E5CA 4RXFA 1IKXB 4TV5A 3KK3A 4GY0A 1A5KC 2IAJA 1UH3A 4TKTA 2M8DB 2XSJA 3DHFA 1VYSX 2HHSA 2AQ4A 1IWGA 3MTWA 2KTQA 2P3ZA 3C2OA 2B43A 3GW0A 4F48A 3ZIZA 2ZOXA 5B80A 3DH7A 4QLJA 4IDKA 4UMBA 3IGNA 4LUTB 5IRPA 5A8KB 1T3OA 3BV7A 5D2VA 1F5AA 1U0SA 2HAIA 2GGEA 4OQVA 2D41A 1IKVB 3HSDA 3PX0A 4RW6B 4ED3A 5AYIA 4JIPA 1UD8A 1VQ7S 5CZVA 3WFAA 4HPXA 5A95A 5LSOA 2DNYA 2YNFB 4MY1A 3GDTA 1DTTA 1F3VA 3KXDA 2VZUA 4GNKB 1GMVA 2KVIA 2YNIB 2H9AB 2HSEB 2BA9A 1GOKA 2I1OA 3Q2TC 3ILIA 1WDTA 3A9BA 1RV8A 4FYXB 5C71A 1A4MA 2NSOA 4PRFA 1TL1B 1MVYA 4X4NA 2LMIA 4FF4A 3PY8A 4EBEA 1YQHA 3FIGA 4S3DA 3GC4A 3UNTA 3IA0A 2WBKA 3GDLA 4AX6A 1CJUA 3EWCA 5MKGB 1VRXA 3DFNA 3E9AA 1JLQA 1R47A 3ZFHA 1WKLA 4HNTA 1CXHA 2C3ZA 2QUTA 4HKPA 4DFJA 4B02A 3M47A 1OM0A 4DAIA 4TU1A 1JLEB 3A8KA 5ETRA 3CCSS 2Z2UA 1KLMA 4KKXA 4WZHA 4K2SA 2OQHA 3F4WA 1DORA 4DZ6A 3G6XA 1EIBA 4KMQA 6A3HA 4ZIWA 3SAZA 4PTXA 1U1PA 3A3PB 5G4HC 4DL3A 1OCJA 1OG0A 3C15B 3S6TA 5BXRA 2EXUA 2Z8QA 1YZ7A 1BUXA 2YKMB 3HJZA 3LXAA 3U0HA 2W9AA 1FWRA 3VZHA 3H20A 7ODCA 5A76A 2CPZA 1EDTA 2OKTA 1WNOA 2JDJA 2O92A 2UUCF 3SV4A 4M19A 2RHSB 4ORMA 1TL1A 2ZBQA 1KBBA 4IGMA 3P5YA 4D8AA 3SDEA 1T8EA 1X96A 5I24A 3C2VA 4DSIA 5AZ0A 4DZ5A 1QD1A 2I6WA 4DX8H 4AD5A 1UQYA 1PYMA 4EEYA 3WCZA 5MKGA 4Y2AA 5E9XA 1X38A 5GAHU 4LVGA 2I56A 3S8HA 2XTJP 1R27B 1XC9A 1Y8BA 2A2CA 1I1XA 4ZQPA 3P93A 4XSMA 2ZJPQ 3MCOA 3DEQA 1TKZA 1L8NA 3ABSA 3FN9A 4F0HA 3GLJA 4BA0A 2R4FA 4AF0B 2W91A 4OIXA 3C66A 2VYOA 1GYLA 4HA0A 1SL2A 1V3ZA 4QROA 2DVXA 4G9PA 4Q8OA 1J5EJ 4NAFB 4UFIA 5A0YB 1Y5LB 1XV8A 2A2DA 4ADTA 4H4OA 2YTCA 1UZ4A 4GHRA 5HWMA 2DGUA 4A46A 1WF2A 3AIEA 3QGKC 3WLIA 2V6AA 3WD4A 2VT0A 3FQLA 2OQYA 5EMUA 1RT3A 3GNNA 2A3BA 1CX9A 3H2EA 1OYCA 4F4YA 1SR0A 4RDYA 1P6CA 4C7FA 2A1YA 2E5BA 3IGUA 2M5YA 1SKRA 4ES2A 2IPGA 2DZWA 4G6CA 4O57A 5F7UA 3W1LA 2X41A 5JH2A 2JVOA 4A29A 5CJNA 2ALRA 3CLWA 3DYAB 3E12A 2PI4A 1BWKA 4PXDA 3WIVA 1EHNA 3UQSA 2VQTA 3V5OA 5KSWA 1LOLA 4S3FA 3UA4A 3IFEA 3NQFA 1M3UA 2QCCA 4ZVGA 1G67A 1U0HA 4LUIA 4HA4A 2ZH2A 2D2JA 1LW0A 1C8QA 4AF0A 2FD2A 5FESA 1O51A 4O18A 4DJFD 1Z48A 2ZTKA 2BACA 3F5JA 3F73A 4Z2XA 1A7GE 4H9UA 2XWYA 2U1AA 5A0YA 4FF1A 2PGRA 4L4PA 3GVWA 2EXOA 3G0XA 3VDBA 2QC3A 2XZDB 3FUYA 4ANDA 2KZHA 4FIQA 1N34J 3KOZA 4GZIA 1R8CA 2WCAA 2MHNA 3SI8A 1HO4A 3P8JA 5I06A 3T6JA 1ZHAA 5FIIA 3FSYA 3W07A 1O5JA 3W64A 1C8YA 1YXDA 3OV7A 2E1MC 4AMCA 1CB2A 1P9QC 1SUQB 3TNBA 1KR1A 1H2UX 1E43A 3G82A 1Q6CA 2Z1SA 3CZKA 2RDJA 3CCES 5J1NA 3W9IA 9ATCB 3AMKA 4PCFA 1I9CB 1TJPA 1UJPA 1EQMA 2Y8WA 3DYAA 3HKZD 4L64A 3TAOA 3A4XA 2V9WA 3IACA 3PRBA 4NZ3A 4USHA 3GNDA 4W4QA 3DOMB 1FDNA 3QRHA 3MDUA 4NI2B 2C3PA 4W8LA 4A8IA 4J7RA 4CWBA 3W2LA 5ETKA 3MKVA 4JPGA 1SQGA 4MMOA 1J2WA 1KA9F 1R0AB 1FXDA 1R7OA 3MR5A 1UH2A 1TP7A 3L5LA 1TRIA 2F40A 2DY9A 1H09A 2ALZA 2NQHA 3RLGA 4ID8A 5G0RB 3S3GA 1TZ0A 4D72A 4DQSA 2OSYA 2NZCA 4ECQA 3G8QA 3AZTA 1MU2A 1QTNB 1V5XA 2QR6A 1RWMB 1JPKA 3I82A 2DEPA 5D9NA 2EG1A 2HAFA 2E5GA 4USWA 3GIMA 4C8OA 5JXSA 1OK4A 2ZBTA 3MCNA 3LRMA 4Z0SA 5MHBA 1H2TZ 4I7FB 3I3BA 2P3EA 2MZ1A 3UJFA 2YQ1A 3V6DB 2ZD1A 3M0MA 4GCAA 2FVSA 3TA6A 4F3OA 3UD6A 5DG7A 1XLBA 2Z7GA 4HHLA 4F79A 2KL8A 2CPUA 3LGGA 4NEYA 2ACSA 4UQCA 4MYAA 3GXPA 4EK7A 3N11A 1R30A 4GI4A 4K7QA 2GSEA 2KJVA 2RS8A 4O15A 4OOUA 1W7WA 2HIYA 3W63A 2XS7A 3VIJA 2W79A 4LJ3A 2CXEA 2BY2A 3VM5A 3WL1A 5LOQA 5DQGA 3UW1A 5F2LA 4X0VA 5BXSA 4MY9A 3C2FA 4LIRA 3K5XA 5E7OB 1EC9A 4XUYA 3RUBL 3S47A 3O1NA 1U2FA 2VIHA 1RK6A 4CDIA 1ITCA 1KR4A 3LGEA 4LAKA 2QPXA 1W2VA 2DHHA 1IV8A 1S1WA 1EGVA 3F1QA 1LBLA 2FPHX 2XU2A 1E9ZB 4J3XA 3TZXA 1R0AA 2IKGA 1RCOB 4NE9C 4Q8QA 4TMCA 3ENLA 1TTIA 3CO4A 1F0XA 4YLWA 1JJCB 5G0RA 3GFZA 4X2PA 4I0WA 4AXJA 4A8MP 3CUFA 2TMDA 2OD6A 5M2UA 1MEIA 3QHOA 4R5EA 2IDLA 3TRGA 1XNRF 2GDUA 3L65A 2H1YA 3KBMA 2G0WA 2YPZA 3W2VA 2G8ZA 2KG1A 5DMMA 1W1B1 3AS2A 1PIEA 4LVBA 3IO1A 1E6VA 1TWIA 4PMOA 4RLEA 4Z17A 3JZUA 1ZTWA 1YSJA 1S97A 2EKYA 2Z2BA 3S0CA 1XSIA 1AQHA 3A3HA 4Q8UA 2GOKA 3NSMA 1MRAA 3I7QA 3DU5A 2BY0A 2JRSA 1N34F 5AYXA 3L4ZA 2FHFA 3QGHA 4CM0A 2KKHA 1H1YA 4BHQA 2IXVA 2XFWA 3N34A 3CJKB 2WSFC 1TKKA 3WF2A 3REQB 3UN3A 3S5NA 5I7GA 1TTHB 4JL1A 5DG8A 4CCEA 8XIMA 3G6MA 4HNUA 1XNQJ 1SR9A 2OFJA 2R14A 1R2RA 2RSQA 3EGZA 5D77A 1SPBP 4AVNA 4N47A 1XLFA 2HJPA 3GE9A 1IKYB 4KR0B 4F7VA 5D0EA 1T05B 4EPEC 1EKSA 4ID5B 3LP1B 4A8LA 2B7PA 3Q8QB 5A2CA 3D3FA 5C9UA 2MKHA 3A5FA 3IJ6A 3G22A 4XPEA 3NQ6A 3ZZ1A 1ZBCA 3T5LA 3OG3A 4QCLA 2VC6A 3OHAA 1WZMA 3MUIA 2XINA 3SQGA 3LI0A 2VFGA 4CO2A 4FNRA 1D3HA 1I45A 1C0UA 3THQA 1C1BB 3CZ8A 1OF6A 3AHXA 4PH6A 2WJDA 3FYYA 2WZMA 1B1YA 4IT1A 1WOOA 2WVFA 3VA8A 1GXUA 2AJFE 2X51A 4QYRA 4CNZA 1YDOA 3RITA 4P10A 1TFVA 5KFIA 3QBCA 1VIXA 5BW6A 5EWGA 3UVAA 3EGVA 1NJWA 3VDHA 4PEKA 1YITS 2KI2A 1FWGC 3VX0A 5CSSA 2C2DA 5HMYA 8XIAA 5D2YA 3IJDA 3CJ0A 1AQFA 3PULA 4UF4A 1UR0A 4F0RA 2WBGA 1IKYA 1VQOS 1T05A 4NLQA 2GUUA 4C7QA 2CBVA 1TB3A 2V8PA 1KXQA 3DN9A 3VIFA 3KCOA 4EZ9A 4RUCA 1TVNA 3P2VA 4W8BA 2V3DA 3A12A 3BKFA 2G3IA 2CWNA 3AU2A 3DRXA 2GQ8A 3KL3A 4DI6A 3BDKA 3L7OA 4ZQMA 1VHIA 3ISND 3AYTA 1S1PA 2Z2LA 3TN3A 1YBQB 5I3QA 7REQB 4DL5A 5D8HB 3ARXA 3QATA 3H98A 5PTDA 1TMHA 3SJ3A 4EBCA 3CV7A 5CJ5A 5L9XA 1SO5A 3GXIA 1O6XA 3SUWA 2WLZA 1EJUC 2YL8A 3RLHA 2OELA 5EX0A 1SFSA 4DR5F 1OZMA 5AJ3J 3VIHA 3TAQA 3WF3A 5HINA 3SY1A 3AD8C 2CBJA 5FAJA 1XCXA 1QSSA 5A8MA 3E0LA 2DV0A 1TJRA 4JTTA 3RR4A 1RPXA 2BKPA 1IF2A 1PXGA 3LRKA 4UCGA 3WLMA 1V9OA 2Y0BB 1KDNA 3MANA 1XQKA 3URAA 1P9YA 1K9FA 4C6QA 1DTNA 4ILLA 2V63A 1IXOA 2W1BA 3GB0A 3MAAA 5D3GA 3HVTA 4TY8B 2A21A 4JEJA 1HBNB 2MGZA 1XNQF 4A8RA 3K8KA 4PRTA 5T26A 2Q8ZA 1CQNA 1NK4A 1MUWA 3AHZA 1DJQA 5EKYA 3ME3A 3PJTA 4UOZA 1TWDA 3K5OA 1JCMP 4RR5A 3CDEA 2YCLA 1YBQA 2R8JA 1LL4A 1XLLA 1VFHA 1ZPWX 4J9KA 4C3KA 3BW4A 7REQA 2A4AA 2R7QA 2KXHA 5IHSA 4XQ6A 3SEPA 1HQ2A 3MMBA 2GVZA 2EO7A 1MSWD 3PUEA 4IF2A 3TYDA 1OZQA 4FBUA 1OK6A 1K1QA 3KNGA 2WM1A 4RNMA 3ETMA 2PE8A 2RHGA 3KE0A 4KGKA 4DEFA 2V0NA 1LV5A 1FNMA 2X16A 2FGBA 3GDRA 4H4IA 2B8QA 3VKCA 3OB8A 5GNZA 1G94A 4Z1CA 4O28A 3PSWA 2JKAA 4JFUA 2R2TA 2HQ3A 2V5KA 1IIHA 3WFZA 3SJNA 1T94A 1TFWA 4E8UA 4DNHA 4F4AA 2O7QA 2OU4A 4IXHA 1BYCA 1VJZA 3W88A 4CLMA 4QWBA 3LWLA 1JI1A 2CJBA 3OHIA 3EYPA 3LPEA 1Q7QA 3BGJA 1V6VA 4E98A 2BHYA 3B82A 1KR0A 2ADAA 4AZGA 3KLEB 1UQZA 4KT2A 3EWGA 3ELHA 3VAFA 3U7BA 1YLVA 2I38A 1UKTA 2A3AA 4KRTA 2DPEA 3SCNA 3ZVHB 3BPWA 1CSJA 2VZ9A 2OH2A 3MEGB 1UVJA 4FKYA 4YEAA 4PB3A 1AB8A 2ISFA 2EEYA 2FPTA 3GCWP 1ME8A 1ZZNA 1NZ8A 4CCDA 1RJQA 3G1XA 3GNRA 3U2EA 2BTMA 5HPOA 3W27A 1K03A 5FJPA 4IFYB 1C9WA 3BANA 4ZODA 5J2MB 4P71A 1HWIA 2XLKA 4USVA 3VCNA 3H7RA 3F4CA 1FP8A 1PZ3A 3KTCA 3T05A 3NPUA 4UFMA 3PRVA 4M5GA 2AKMA 2X0HA 1NWSA 3TN6A 2OPQB 3PFEA 4WVXA 4RKAA 4XAYA 3A24A 2G50A 3BN7A 2FTWA 3C16B 5AJ3F 2L9NA 3RYSA 4Z42C 2BVDA 1SJBA 3WQWA 5AC6A 1OS5A 1TUFA 3F7JA 3VKBA 3OR1A 3DGPB 4DR4J 1W5NA 7FDRA 2Z1XA 1PTGA 4YMEA 5F41A 3H2MA 1HNVA 4D1JA 1V7YA 3EX7B 4UTUA 2PBOA 3BGFA 2FLNA 2WXDM 2D24A 1X4CA 2Y70A 2QLFB 3CV6A 4Y0FA 3QKZA 1TK5A 3GU9A 1DIOA 3MPUB 2R1NA 1QBBA 4JTIA 1VFFA 1JQVA 3FBCA 1YBTA 3AAMA 2N3LA 5C5JA 4BC9A 3QTPA 1R7AA 5J2MA 1IT8A 4ZLNA 4B16A 3GKAA 1KO0A 4X65J 3CNQP 1Q8IA 2CIPA 3UNDA 3AC0A 3KW3A 2WB5A 3P45B 2HVNA 5DCDA 3T2PA 4FBTA 4HYRA 3T8LA 4FF5A 3OVGA 2QLWA 3E5BA 2QGFB 1HPZB 2CC0A 4UBPC 5I78A 4AG0A 1WUUA 5IC4B 2ONEA 6TAAA 4LW7A 2C3UA 3HGOA 4XKYA 1NTHA 3QPEA 3ETOA 1CJVB 5FD0A 2D69A 2QUNA 1OEPA 1B4EA 4CRJA 3MMJA 5CG7A 4L9ZA 1G6BA 1UFLA 3LPPA 2GVYA 1JZ5A 1SKWA 5KTLA 3CL8A 1E6XM 3KLIB 2UU9J 2B6AA 2VRJA 1B54A 1OC6A 4R3UA 3GH7A 4USMA 1AH3A 1BXNA 2DITA 1YX1A 3MR7A 6PTDA 4Q43A 1YQ2A 3GCXP 1O4UA 5JMNA 2B9WA 2ZOGA 3DI0A 1WACA 2BSLA 2OODA 2MANA 1UYQA 4XZMX 5ABEA 2X7VA 1JG9A 1V0MA 1EGMA 3B0VC 1W8GA 1B0TA 4C60A 3K17A 3KBNA 2NXHA 3NYZA 4LUYA 4ZE5A 3T0TA 1Q5YA 1Q78A 3GIRA 1Q6LA 4JTCA 1YJNS 3MPGA 1BXBA 3L66A 3LM7A 1DY3A 3MMCB 3WH9A 3HHLB 7TAAA 2RUGA 3J7YI 3DLGB 4DZHA 2KM8B 5LXXA 3OVSA 3PKMA 5FF4A 3SCVA 1B2YA 1KLNA 2ISDA 4Q8VA 3NAHA 1VJQA 4ZJOA 4UOGA 1NRKA 5FDLB 1UVIA 4N42A 4R0EA 1H2JA 1EWEA 3EGNA 4DSJA 1PHQA 2ZHOA 1JPHA 1A80A 2FVQA 3MM7A 1K8CA 2A3LA 3KLIA 5CPQA 1OADA 2GK1B 4CNNA 1BQCA 4E8CA 4PAAA 1SL1A 3VQTA 3UWEA 4OZ1A 3QV9A 1EARA 4KIAA 1W2BR 3WDIA 3BAIA 4L7ZA 4O4GB 4DR4F 3DYPA 5C55A 1U02A 1ALDA 5FACA 3EVWA 1IXQA 2IHR1 2VODA 4G1PA 1OVDA 2ZH4A 1KLYA 2PFFB 4EXBA 1FCAA 5LMUJ 4US6A 2V30A 3GB6A 1EBGA 3HFTA 4LU0A 3GM8A 3M32B 2QS8A 2WVVB 3QSTA 1OCQA 3HO8A 1ZM9A 2CAJA 3KOXA 2XFYA 3CT7A 1C8VA 3B9AA 1TMLA 1U33A 4ZCIA 3GUWA 1OD8A 2D9PA 2CZEA 4WTYA 2ZX8A 1V6HA 1JF5A 2PB1A 3QRPA 4GKKJ 3D46A 1T9UA 4D6JA 3NYDA 3WJZA 3EWBX 5C7PA 3I5BA 1O12A 1UHVA 1GORA 1R8BA 3TUIC 3DLGA 4X65F 1L8PA 3UGRA 4L9XA 3BH6B 5CH7B 5F8IA 3FBEA 4DR1J 5B0BA 4DR3J 3JTOA 1BTCA 2PGFA 1JGIA 2NSXA 3O07A 3DHWC 3ZZ0A 2QJHA 2W2PP 1NWTA 1RY8A 4L73A 1WNEA 3EX4A 1AMYA 2VD9A 5K4XA 2V8GA 3PW2A 4HJFA 4YN5A 3NQ7A 1Z1ZA 1HMVA 3A9IA 2RT3A 2WVDA 4HNLA 5LGXA 4RPFA 4DBUA 3E2RA 3UG3A 2P8BA 3DFTA 5A8RB 5CXPA 4X9YA 3PG9A 1Q1KA 4NL5A 3VC5A 1B4KA 2FVKA 2UU9F 1RJPA 5DY3A 2OEKA 3VGDA 3CO9A 1Y5WA 2OEJA 2IVFB 5HATA 4LUBA 4NLOA 2DR5A 3M32A 2WVVA 4TVAB 1PO9A 4RW3A 5AECA 5E3AA 4DQPA 1BG4A 1RH9A 1UOKA 2LXIA 5M2PA 2DT3A 4O50A 1VBJA 4AW7A 4IJCA 2KU7A 3D1HA 2FVCA 3GAKA 3GC2A 3EDQB 1XWYA 1VZWA 3GR1A 1RA5A 1EQCA 2ISWA 4IM4A 2VEGA 5KFOA 4ECWA 3IBFB 1E4IA 1W1A1 1W1PA 2MKJA 1QVGR 4Y9PA 4BI6A 1CWYA 4MLRA 3UZZA 4OHXA 1E6YB 2NQJA 3AOCA 5DDPC 4IG3B 3GTYX 4V1XA 3FEYB 1EPVA 2G1DA 1KQSR 3ET6B 3OYZA 2A7RA 3GFXA 5L8RC 4J40A 4B17A 4UOQA 3VU2A 3CWOX 2WHMA 3WQFA 4IL0A 1S72S 4LYRA 1A5SA 1BVZA 3R2GA 3WHIA 1EJWC 2EW9A 4IGHA 2AF6A 1KQYA 2WC3A 2WANA 1HBUB 3KP1A 3HVRA 4HU8A 2G3JA 5HULA 3AS3A 3O8WA 2R2RA 3SB0A 2QMUB 4ILRA 1MLAA 3IIZA 4NEZA 4CO3A 3TFCA 4C0BA 1VJWA 4I9TA 2E68A 4B4HA 4DR6J 4CQ8A 1R3WA 5A2QY 1DE6A 3PO5A 1KM1A 3DYMA 3PKYA 1UA1A 1X7FA 2CLFA 3G3MA 3CBWA 2B5JA 4V15A 3F4NA 1U1JA 3NL3A 2ZUUA 5J8LA 2E9BA 2Y1HA 4V2XA 3VI2A 3THAA 4E8DA 1UJ4A 5LMUF 1YIXA 2VFFA 4RW4B 2I5QA 2GWGA 4CCCA 4C4WA 1S9EB 4UQBA 2NV1A 2AMCB 3Q58A 4D1IA 1HA1A 4GVBA 3PHAA 3O3LA 1TREA 2C42A 4XX6A 3VGGA 4D6DA 1FTRA 3ET6A 1HNXJ 4GKKF 1DFDA 1NPPA 2PDPA 4OT7A 3V3WA 3SCIE 3P80A 5AYYA 1M68A 1HHQA 1NO8A 5HXMA 1UKUA 1NOUA 2V38A 1URNA 1P1MA 3POHA 4DR1F 4ED8A 4C7GA 3FDGA 2P1FA 4DR3F 4LRTA 4KRZA 5L38A 3H26A 1FK9A 1SH2A 5DGBA 2HMIA 2B4GA 3KK1A 1HL6A 5D37A 1WC0A 3T09A 2PWUA 3AMDA 4GVIA 2Z4PA 3OG2A 3R6LB 3NAVA 2WZEA 4DO6A 2MTLA 3SR7A 1QPKA 1H38A 2I17A 1JXVA 3NEVA 2F7VA 2DZVA 4RDVA 4RPQA 2DBBA 2QAPA 1K0TA 5IXEA 4RW8A 2QFJA 3CT2A 4PUOA 2KFYA 2OGUA 4Q4QA 2V4JA 2JKEA 2NX9A 5CZJA 3VIGA 2G9OA 4A8WA 1BF6A 1YXCA 3PHTA 1VS3A 1TQJA 2CPDA 4XPCA 2AAMA 2VGBA 2P5NA 4WIQA 2IY5B 1VS1A 2QCFA 1AZSA 2RDUA 1S6QB 1S9EA 2YX1A 1RTDB 3CHDA 1J5OA 2XIJA 5KFTA 4L6V3 4R5PA 4O0QA 4W7WA 3WF1A 2INFA 4HHJA 3VD5A 3LBOA 3IJQA 2ZCGA 2BOPA 1UD5A 2POZA 3LPFA 4DXLA 1R6VA 2Q8XA 1ZCOA 1SFLA 3EKGA 5HMSA 3HHLD 2WKGA 5FEZA 2AD9A 2BXVA 3ARPA 4OHQA 4MT1A 4PL1A 3ITGA 3WNOA 1S99A 4YR3A 4XB3A 1QAJA 2EJAA 4AISA 3NM3A 4WU2A 1FRBA 1JKHB 1M0SA 4HHHA 2XVKA 1DWJM 2PDUA 4C3MA 3CJ3A 1EHAA 1E72M 2PP0A 2K1RA 3EDRB 4XIUA 3D3AA 5KG7A 4LYKA 2R1LA 1N56A 3QT6A 1WZLA 5CZXA 3OJSA 1R3TA 2AOSA 4R34A 2WMIB 3KLVA 4HTJA 4WKAA 1HARA 4J9OA 2IYIA 1K3UA 2LYVA 2ACMA 4XZNX 3IG1A 1F60B 4DR6F 5LM7E 1FD8A 1EEPA 4WHBA 3IAQA 2JEFA 3UDLA 3UG8A 1ELSA 1FXQA 2N4DA 3QMTA 2NLYA 3D47A 4JTEA 5FAGA 3V81B 1RWVB 3OFGA 2V4QA 4O0IA 1YJRA 5C54A 3CD0A 1NDKA 3M7WA 4IMDA 3QQ0A 1PSCA 4LRSA 1FE4A 1MQRA 4OHWA 3E0FA 5D09A 1ZB5A 1OIFA 3W1AA 2FTRA 1LXJA 3OGRA 3NS7B 2MZRA 4IJRA 5BYWA 3BGRB 1E3ZA 1GGOA 2H3EB 1N5YB 2XGZA 3FOKA 1WUEA 3GZAA 1JIBA 1DLOB 1HNXF 2GMJA 4KV8B 3M4HA 4DV7J 4AY8A 2B8PA 1H7PA 4EVZA 1RADB 4GK8A 3V35A 4WWSA 4X60A 2E5CA 4PSRA 3AIBA 3OQ2A 3VXGA 1FKOA 3MP3A 3OW1A 1N8IA 5A2AA 2O9TA 3EDEA 3MPYA 3R1HA 4KT0C 4HYKA 4GYFA 2YOCA 3THVA 3EYZA 3RX2A 4GZ7A 4KFOA 3AMLA 3MM8B 3WC0A 2HQIA 4DV1J 4XDCA 5HROB 4U5KA 3MWBA 3P6YC 1FDZA 3GIYA 5FD1A 4MB4A 3RM9A 2W9BA 3BGOP 1KKOA 1F76A 1D3WA 1CJTB 4R9XA 1S2VA 3GJQB 4P7TA 1LOSA 1WF0A 5I23A 2Z58B 2R8WA 3RB3A 1PUDA 4NZJA 3VILA 1WDPA 2VFEA 2PU1A 2XH2A 1OSDA 3DOLB 2SXLA 1CXLA 3NQBA 3L68A 1TRDA 2J74A 2CQIA 5T91A 1XUUA 1DVJA 4BCEA 1K1DA 1TYGA 4X64J 5ETMA 1ZNNA 1E55A 1DAXA 3OLDA 5A6MA 1KKRA 3GG7A 1UB3A 4KETA 3MSRA 3VOIA 3DRYA 3FEQA 1MUCA 1IWBA 3LTSA 1HT6A 4YR2A 1URRA 2PZ0A 3BDEA 4A3QA 4GC3A 4MUPA 1V8EA 2VG7B 3EMTA 3PFRA 5LL6d 4IH3A 1YLXA 1IHIA 1RAHB 1UWSA 1X1OA 3GHSA 3A4TA 3PW0A 3J7A1 3W28A 3WQ4A 4JAWA 3IS9B 4TV6A 3HJVA 3Q22A 1F5BA 3G6LA 1R89A 2IJFA 2YWFA 1GHRA 5HROA 4GXMA 3L23A 4NL1A 3VIOA 3NEKA 2UXBJ 4B3RJ 1CEOA 2M7SA 4A3YA 3V6KA 3E96A 1KTQA 1ADDA 4W98A 1VGYA 2NZLA 4JNYA 3EJMA 1RT6A 4FXRA 3UBPC 3LI1A 4I69A 1WXYA 3JB9k 3KLGA 1G69A 3CB8A 3I0SB 1XK8A 2WYSA 2HURA 4O16A 4DX3A 1Q6OA 1I3OB 3AIRA 1NDWA 4N41A 4J3VA 2W92A 3BZGA 1RQEA 3E0WA 4C6KA 1UC5A 5IQ6A 2KH9A 1JXLA 1HR0J 3DDNA 3VZXA 4HACA 2NLWA 3H25A 1WQ5A 3V0SA 3W2NA 2PN6A 3EWDA 2Y6ZA 4X84A 4GWEA 1D9EA 5ABFA 3NQVA 1HNIA 3FA5A 4BBYA 1EUAA 3NGSA 3W81A 3W7MA 2IMRA 3KKFA 2C8NA 1OGSA 3P14A 4ZLJA 1SV5B 3MSDA 3Q86A 2VG7A 4LBSA 1VRTB 1GYNA 1KNWA 2HG4A 2CCRA 1BRLA 3MMTA 2DNRA 3M8SA 4I68A 2B9EA 4DV7F 1R3RA 2XIQA 4H6QA 1GQIA 1VLWA 3W2KA 3ZTOA 1NQKA 3IP0A 1JZ3A 4QEHA 1V7AA 3G8EA 2CHRA 4CI0B 4OKDA 2J76E 4LS2A 2AEJA 3CC1A 4I2PB 3CNYA 2XZWA 4W5UA 3P0WA 4CNSA 2ASJA 1RBLA 4YWIA 4F50A 3K57A 5L9FA 1XLKA 1FJ7A 2K7JA 3KTQA 1RT2B 4JYEA 2D1CA 1QU4A 5LIXX 3QPIA 3D54A 5D15A 4WFAQ 1OX6A 4DV1F 4D6EA 3JYTB 3G87A 2KN4A 4ECVA 1GOXA 3AQPA 3BR9A 2W8LA 2YA1A 3AXXA 4I6KA 1SBRA 2AP6A 4RNIA 5I3PA 4OV4A 3Q89A 1QLNA 2HPIA 1LWFA 4WE1A 2OTLS 3UCQA 4CNYA 1V02E 2F3JA 2E77A 3OLAA 2JFDA 1RT4B 1TMMA 3TJ8A 2CJQA 1IT7A 3XISA 1VBYA 3NGKA 3QWUA 3CLMA 2WSPA 1QI4A 5G4EA 3CHVA 1PZ2A 2MMYA 1NARA 1A0OB 3GW3A 4FP9A 4F3HA 4O3RA 3TSMA 1NHVA 2X8RA 3NXLA 2K3IA 3NVDA 4M6QA 4KCWA 4J7CA 3GYEA 3IXQA 1E51A 3TQEA 3I6EA 3JU2A 3LCLA 1X31C 2BQ3A 3CPGA 3A4AA 3MM5B 4NLVA 1GJPA 2CQ3A 2HNZB 1RVGA 2ZX7A 2CG8A 4I2PA 1CECA 3UPFA 4D6CA 4DL7A 1UR2A 2QMXA 4O44A 2FJWA 2ANUA 3DYOA 1R46A 1OYEA 2VC1A 2VZSA 4UUIA 4LSNB 1OFEA 5HNRA 1RHUB 1DJIA 4DRSA 1WOPA 4JTSA 4YFUA 3PRDA 4ZZ9A 3BJTA 2XHWA 3QNWB 4OI1A 2UXBF 4B3RF 2HFNA 4OE7A 2WONA 1HWJA 1EF2A 4JP8A 5EGRA 1TK8A 4DWSB 4PMYA 4L9YA 4M7SA 1SJ3P 3G0SA 4JI5J 4ED0A 5CYQA 3UVJB 1Q6DA 4DNMA 4POCA 4L74A 3GK0A 4O12A 4QG9A 1RT4A 2WMFA 3L67A 2Z27A 1A5CA 4O0NA 2WBRA 4NT0A 4RE3A 2I9EA 3CQJA 2ZBPA 1S2WA 2QCGA 1HR0F 1IBCB 3BLOA 3CAWA 3NBPB 2YJQA 3TUJC 3PK7A 1SH3A 1W3HA 3CTLA 4O8AA 5D33A 3NPWA 4N7QA 3S5SA 1L6WA 1SL0A 4W9TA 2IVMA 5KZ6A 4F2SA 4U7UD 3AHTA 1RAAB 1YRXA 3W7GA 3K8MA 2I5GA 3EPGA 2B81A 1ITPA 2DQWA 2PEBA 1T8XA 3S6DA 1QJHA 3B4UA 2JKPA 4MFBA 1HF6A 1L3TA 4TLQA 4C11B 2W24A 4ERIA 1HD0A 3K59A 1NDYA 2XMTA 4O11A 5KMYA 2YBVA 2R1KA 1JDDA 3W7PA 4ZXLA 3E02A 4CQBA 3UR3C 1JCJA 1CENA 4DYJA 1QY7A 3QJAA 3R0KA 5AYZA 5M1TA 1HJSA 3S9IA 1KB3A 1ZBVA 5DGAA 5GAHI 3BJFA 1RHCA 2AKZA 1SJ4P 1KKHA 3UVJA 1EZ2A 3I3DA 5K4ZA 1O94A 4OI3A 3NRBA 1ZQ5A 3KJQB 2W4DA 4P2XA 5DQIA 2QAFA 1M5SA 3MR3A 3G5EA 1EZWA 4PABA 2PDLA 3CB4A 3GO2A 4MKYA 1LWHA 3HPFA 5BZAA 1XLGA 2P0IA 4LV4A 3NBPA 3BARA 3FJNA 4G1QA 1V08A 1C0TB 2HFVA 1P48A 2L3MA 1IQ8A 3NZGA 3W7EA 4DELA 1V4YA 2DSKA 3H53A 4GX8A 1S79A 2RRAA 1TPUA 3GVRA 4BS0A 3CDUA 1ZOTA 4U3CA 4KFBB 1T3NA 2G5WA 2NPFA 3HV9A 3LD5A 4XVEA 2XVLA 1LYXA 3SSSA 4GUHA 4ZHRB 1V6UA 3SM0A 2DSUA 5DQPA 4QLLA 3R0UA 2HLTA 3NLCA 2REQB 2PWFA 2HWIA 1F5ZA 3V6HA 3TC7A 1ZAHA 4DI9A 4AXIA 3L4XA 3ISIX 1EOKA 1DP0A 1MW0A 1PSDA 3LUYA 4IQLA 3PWGA 3QSIA 4KQZA 4UTHA 1FP9A 1CXIA 2ILYA 2GNKA 4MNKA 5KT2A 4OL8A 3FHQA 5LSMA 2VX6A 2XWXA 5AY7A 3MEKA 2VL4A 3H23A 3KL0A 3OU8A 5ENLA 2QN6B 4K8EA 3VVUA 1NHKL 5FJTA 2WOMB 3M2VA 2OJPA 1JNEA 3UVIA 4HDHA 3TN5A 2Y8UA 1S9GB 4S3GA 1P7TB 2J0SD 1M41A 1IBLJ 3FX4A 4JI5F 3U7JA 1W9DM 5B0DA 2VHGA 2NUYA 4DG1B 3CU2A 1E0UA 4Y00A 2DVIA 4KEZA 5CXTA 2R7XA 1ME7A 3OEXA 4CH1A 1DWIM 2DJWA 5LA2A 4O13A 4HNCA 2X05A 4DPQA 4PXCA 1DWFM 2NX3A 2ZRWA 4IICA 1C29A 2ZH8A 1OSEA 2GIQA 2DNOA 3CEUA 3T08A 1U1UA 1UG6A 4DL6A 2RQCA 1W9XA 4PMXA 2HNDB 5K8MA 5HA7A 3HGJA 2BXJA 3B0XA 3UCCA 1WC5A 3LF0A 3WMSA 1KTVA 1Q2RA 1EGZA 3TQVA 4QLKA 1J01A 3M6XA 2X3DA 1E5JA 1TMQA 1CGVA 1L5UA 1TTPA 4OI0A 2OI2A 1R2SA 4GQQA 4ES3A 2A6LA 1NM9A 1PX8A 1XGZA 1RA6A 1TL3B 3H6OA 4TIMA 4BHYA 2ZZ6A 3ZR5A 1S9GA 1B0IA 3WEMA 2PDQA 3W60A 1SZRA 2MNRA 3C86A 4AIEA 3MFHA 4XZHA 5IS2A 2ZXDA 4V28A 1F2GA 2Y0FA 1V3KA 2BG5A 3LA4A 4QNEA 1Z41A 4AT1B 1RTJB 4QAWA 3IRSA 3L12A 2UV8A 3TVAA 1MO0A 2IBOA 1XYBA 3CC4S 1CXEA 3M6DA 2W6RA 3CASA 3MAQA 1BPLB 1O0PA 2VP8A 3QZEA 1VFOA 3KHDA 3ZWTA 3I87A 4H4MB 3L0NA 1V5VA 3PZIA 3W29A 5FEWA 3RRHA 5C42A 2PMWA 2ZUVA 3ZNUA 1QK0A 1DTQA 3HIJA 3DCPA 5I07A 1LL6A 1E4MM 4WFXA 1U2YA 4B2DA 3T0AA 4DQQA 2DR8A 3S01A 1N0VC 2C71A 5CCLA 2ATSA 1XR7A 1V0KA 2WHLA 5AE3A 4HU3A 5FA5A 5HP1B 4L1WA 1BWVA 1KRMA 5DFAA 4WIIA 1NSPA 5D04C 5KOXA 3IIXA 2VEIA 1TL3A 4Q2LA 5BROA 1KCKA 2A7NA 1WKJA 5IC6B 2ZJQQ 4IRKA 2HNYB 3K0JA 1UA7A 1A5AA 2HS6A 3AHPA 4WXOA 5C25A 2J5AA 4CLPA 3OD2A 5EY5A 4U28A 2JWNA 4YHGA 1JRBA 1F8IA 4DWSD 1Z8AA 3AWOA 3FJ6A 2J9XA 2PWEA 1QASA 4JFSA 5A6TC 3SMZA 2ATCB 1AH0A 4CU6A 4QZVB 2XISA 3KVKA 5AVHA 2AEFA 2R91A 3PZ9A 2V0TA 1LWJA 2WQPA 3GQCA 1IBLF 4RV8A 3IM9A 3GIIA 2XJ7A 2VRKA 2ILZA 2XO7A 5K9XA 5F8JA 1UR3M 2CU0A 3UJ2A 1CIUA 2QPSA 5EL1A 4U3AA 4H4MA 2HVOA 3W73A 1TUVA 1W3JA 2PLJA 1N32J 1S1TB 1EYEA 3PS7A 4HIBA 7A3HA 4QU6A 3VC6A 1X5TA 1U1OA 1YJ7A 3QMSA 5A5WA 4O1BA 3EEGA 3F56A 3IARA 2M9KA 3EWUA 3MHGA 1RCXB 4CD4A 1W2PA 1TJ0A 3KHRA 3M0ZA 2OO6A 2CLIA 3PYDA 1SW7A 4JYAJ 1I8JA 3G6YA 1JWWA 2QLXA 4CVUA 2QMJA 4KEVA 4ZE4A 4F2TA 3FKBA 4P9SA 4OX7A 3U5YA 3TYZA 2ABBA 1HTIA 1MW3A 2J6TA 1PDYA 1TVRB 2KT5A 4FMVA 1VQSA 3MM9B 2CPHA 2KYXA 4H7CA 1YE6A 6CGTA 2YKNB 1WDWA 3D0GE 3R7BB 3M0JA 4Q6JA 3STPA 3OUYA 2MZSA 1W5QA 1IZJA 2X40A 3BO4A 1LUCB 4KHMA 2A1BA 4YVPA 2A6OA 2P9EA 1H0IA 1M03A 1QFEA 2JZ5A 2FVRA 3PTMA 1VB9A 3DX5A 1V6XA 3SY5A 4GVGA 2QZRA 2V2CA 4JCMA 3VF0B 1V5IB 2IPFA 1YTYA 5CPLA 1ZAJA 1CLFA 1FWDC 3ULHA 1Z2LA 3IRXA 3T1HJ 4OV9A 1Q8KA 2FLLA 4REQA 2ZZMA 3LB0A 2J7BA 3QIPB 3VGFA 1XM3A 4URIA 5K9FA 4XAFA 3T9PA 1ZAWA 1Q63A 5L1IA 5HJLA 3THTA 4JDYA 3HJFA 1U1RA 3KX6A 4ZEPA 5CBJA 4UQGA 1S2TA 2J0QD 3MW7A 2E9RX 5H8PA 4M63A 4GKLA 1OCBA 2GAGC 1RISA 1XSKA 3U4AA 1JAEA 3QW4B 3R8RA 2O56A 4WU3A 4CNTA 2YKNA 1OFRA 3NNHA 1LZOA 4GJ1A 3NP5A 5C0QA 5JVHQ 4ED4A 1QVBA 5DCBA 4F3QA 3BCDA 2J66A 1QI2A 5HNTA 4PBEA 1DIKA 3SN0A 1EWDA 1ZENA 4ILMA 4PUMA 2MQPA 4Q5VA 1H7RA 4MK9A 4CD7A 3RRGA 2GX8A 2A5HA 3TMLA 4PG7A 2ZDSA 4QPTA 4GH1A 3II1A 1T8QA 3LK6A 2OG9A 1NLKL 1AA1B 4UTKA 4K5RA 2PWHA 3M0IA 4RNHA 3THCA 3HLUA 3IUIA 4LQ1A 2V81A 3APGA 3TSDA 4ACYA 4E3VA 1WG5A 3R7NB 1FRXA 4QWAA 1N32F 1S3HA 1PKMA 2FTPA 1EXBA 1VBHA 4H9YA 2ICSA 3TA2A 2VCAA 2PO4A 1V6WA 1Z7AA 4F0SA 4YB6A 1JI2A 4F0MA 3PN8A 3T4WA 2WWCA 4F0KA 4Q8TA 4HSNA 3W6MA 2OYKA 3W8GA 2VQEF 1JQGA 3TTOA 3RJYA 4U67Q 2ZC1A 3W2MA 1ZM4A 3GXDA 4JYAF 2GV1A 3T1AA 4LB3A 2VBXA 3TYAA 3LTPA 1RT7A 2HYIB 4HMDA 3TN4A 3UY8A 1TZZA 2ZE2B 3L4VA 3D6FB 3SZ2A 1V3LA 2LEBA 4I5XA 4FOUA 5A8PA 1WX0A 3GNPA 2NV9A 1K70A 2F4FA 1XR6A 3AISA 1XQIA 2F5GA 4P5UA 3US5A 2NT0A 1KXHA 4C6LA 4QG8A 4TOQA 3HSGA 3V0TA 3GSDA 3USBA 4MY8A 3AB2B 3NWGA 3MR2A 5DRKA 1S7HA 3SFKA 3MR6A 1AZ2A 1VC6A 4TU9A 5KFUA 3ARWA 3ZLFA 1VPYA 3ZM8A 4HPGA 1RWUA 5BU6A 4QHRA 3IIPA 1VFLA 3IWLA 1Q82T 2RFGA 1RVKA 3T1HF 4IMAA 3KHGA 2OR2A 2WHOA 2Z1BA 3PVFA 3RYLA 4RZRA 1QWGA 4AZ7A 1K77A 2CYGA 3GWCA 4KH2A 2KAUC 1VMBA 1SW0A 1N0UA 4B5VA 1AW2A 1AODA 3L3CA 4R0JA 3VINA 5AXLA 1HG3A 3A8IA 2ZE2A 4GYKA 4I1TA 1JFXA 3G8TA 1BD6A 1PIIA 2CWXA 1P8GA 2VKZG 1LFPA 1O66A 4FNTA 3MUAA 1E6SM 5M2FX 2RQMA 2Q01A 1Q79A 3GFHA 2G3MA 2P5VA 2RRBA 2DJXA 2B4UA 1I75A 4DV0J 5A8NA 1OYBA 4DPUA 2YL6A 1CT5A 2F1FA 2ZZ4A 2HHPA 3W5XA 4BF9A 1F3FA 1OHLA 8A3HA 1BE4A 1PYFA 2PDIA 4DF4A 4FYVB 3GH4A 3J81U 3MM6B 3SN1A 1B3WA 3T0CA 2E44A 4JV5J 4ZVPB 1S2AA 1XMQJ 5FJIA 2B7QA 3EWYA 4NHVA 2B4VA 3GR0A 1QHPA 3LCGA 1HW8A 1KS2A 1X60A 3AD9C 3F44A 2ZVIA 3WLHA 4Z2GA 3JZEA 3ABZA 4M6UA 5CAKA 1VF8A 3MWAA 2C13A 3UXKA 3SIPB 2R7VA 1PAMA 3U1LA 1SJRA 1SM9A 2PWGA 4DLFA 5A94A 4U95A 1FRKA 1YX2A 1FRHA 3H42A 3ERPA 1OIMA 1X5SA 4INFA 3D68A 4FX6M 1P6BA 3FNDA 1XPGA 1H6KX 2IM0A 2YKKA 1P0NA 1H2VZ 4NJIA 3N2OA 1QM9A 3U2CA 2DW7A 4EF9A 3SSZA 1LW2B 1NAL1 1Z4UA 4KGLA 2YDQA 4KQNA 1AW0A 1RA7A 1RAKA 5BYQA 1W26A 4K4SA 4EE9A 1XSJA 1LK7A 2CPIA 2J7KA 4UCFA 4YP3A 1I6JA 2RILA 1F6PA 2BGNE 2VC7A 3PUOA 3CMQA 3VAJA 1OD0A 5L39A 3FLUA 4S3AA 3D5MA 4K37A 2V3FA 1EOMA 5IFMA 2ASYA 3IUHA 2DISA 3A8EA 1XYFA 4W89A 3R1ZA 5KG4A 3W65A 1ZP3A 5CYMB 3CJ4A 3SYZA 1FHDA 4QR2A 1UWBA 2A0NA 5A3HA 4YOEA 4M80A 3WF4A 3GRIA 1KHWA 5U4NA 1E71M 1HQTA 2ZITA 2W62A 4JS3A 1FRMA 2HZCA 3M8RA 1TV6A 3I4HX 2IBKA 4XV0A 2YQ3A 3M0XA 1S6PB 1ZM2A 4USIA 1AJ0A 2D3LA 4JIHA 1L2UA 4YMZA 3VNKA 4HU4A 5FEXA 1G3OA 3N5FA 1B5TA 1B7YB 4UY85 5A8GA 1ZAXA 1VLIA 4AD0A 1FWJC 5D4PA 4B9YA 1VBRA 1RE1B 2QRRA 4JOMA 4MIAA 1KQFB 2RU3A 1C92A 1OG6A 1NK5A 1VFJA 4U7CA 5AE1A 3DDKA 1IR0A 2D2OA 2FJXA 3BSHA 4NAEA 4LF8J 3CUIA 2O9RA 3A3WA 1JLAB 4KCTA 3NXFA 1ECEA 5CC6A 4AC1X 1GMWA 1OC7A 2F84A 2O67A 2FPYA 2DNHA 1UETA 5ITHA 4MLJA 4C8NA 4QBUA 1FJEB 1SJCA 4BEQA 3LYEA 4MWAE 3CGTA 3HQ1A 3O6DA 1RY0A 3RN6A 4JEQA 4DUVA 1BGXT 4DV0F 4LCRA 1HW6A 2PU0A 4PKDB 3WBZA 3WZ0A 2WCXA 4ATDA 3C52A 2DT2A 1DJYA 3AMGA 4MKSA 1YKWA 3G1AA 1N8RT 3EDDA 4O1CA 1RSCA 5IDIA 2F9JA 2MJUA 2YCJA 4V27A 3VOGA 4JV5F 4B3OB 3LP0B 4J4KA 1XMQF 5KAKA 3P62A 4I9MA 3RG6A 2BJ9A 2W0UA 4KSEB 3OTRA 4GC7A 1Y5VA 4OECA 5KG1A 2VDGA 2LU1A 2BS9A 5HO4A 5CD4A 2PSNA 2EQDA 4A8XA 3BAXA 3CXOA 3CZEA 3NQMA 1JNRB 2Y1RI 4FLRA 3U57A 2BVYA 5TF0A 3OFEA 2QV5A 4MF4A 4CNPA 3TP4A 1WKKA 2JGYA 3NQDA 2MEWA 2H65B 2X09A 3HG3A 3QQWA 4ZN3A 4DR7J 3Q23A 3WQPA 3DLEB 2NR0A 1HIYA 2O4MA 1JLAA 1QTMA 4RJVA 5ETPA 3GJTB 1LQAA 3OIXA 3GIJA 3VGVA 5HBFA 3PJ9A 4DUTA 2LKZA 4W86A 1WD6A 2PSZA 1N6QA 4OBSA 1MUMA 3CMFA 5HANA 1QNPA 3BCFA 1RB0A 3T0DA 2CYYA 4DO4A 4PR4A 4O3QA 2RB7A 3IS4A 3TCEA 4LFBJ 2CPXA 1V3RA 3WJSA 2IM2A 4EOUA 3RBXA 4U2ZA 3C61A 3ZS4A 3H7HB 3UEQA 1BQGA 2VQFJ 3D2WA 5ECVA 2C91A 2VH7A 3B8DA 2BM1A 2HFZA 1YGYA 2WMGA 2VX7A 4F2BA 1ZBTA 2CLMA 1ZPVA 2ZH1A 3JXOA 1YJTA 5B08A 2UY2A 5DMLA 2GAHC 3J81j 4B3OA 1B9ZA 4JKKA 3BW2A 2OFHX 3BUVA 2GVDB 1S0NA 4V33A 1RJJA 4NF7A 1QW9A 3MZIA 1UP2A 4HA1A 1LRQA 2XVNA 1RHRB 2FC8A 1R5YA 4H9TA 4IMFA 5EHHA 2HS4A 3DI6B 1E4NA 4EXAA 2BV9A 2HROA 4H8NA 1ZSXA 3UZ5A 3TVZA 1J0HA 4B5XA 1K4HA 1B3YA 7ENLA 1QAPA 1YDNA 3IJ8A 5HPCA 5D9OA 1XH2A 5ABHA 3HFYA 1YHQS 4JTAA 1JYNA 2DZXA 3VIMA 5C6MA 1Q2SA 4WKFA 5ETQA 2FJBB 3D3BJ 3UN5A 2PD5A 2VFVA 2OWWA 2PDJA 1LTDA 4F4RA 5I3GA 5JJBA 3UPMA 3TTQA 5DZ7A 4QYZK 3POCA 2RF2B 4YB7A 1ICSA 2QCMA 3TQPA 5GAEU 2IPWA 4M7TA 5H9FJ 4USUA 1P6WA 6REQA 1CC7A 2AT1B 3UCGA 3N73A 2C2MB 2YFNA 1HWUA 1KOHA 4O54A 5IXUA 5KFZA 2C3YA 3KRSA 1OPZA 3R7SB 1QUPA 4N5SA 4H41A 2CERA 1Q53A 4QXIA 4R7OA 2HGLA 1QPOA 4AXKA 2IM1A 4MDPA 1HX0A 2HS3A 5FF3A 2UUTA 2ZDOA 5DBTA 3RB6A 2ZRXA 1XLCA 5A2QU 2GYIA 5IHRA 2NUHA 1RWXB 3B04A 2ASHA 1ZH5A 2ZWOA 1OQFA 2FYXA 4DN9A 2PPGA 3BL3A 3HFVA 1B3XA 4X4OA 1NDLA 4YVXA 1OINA 1O5QA 4X4RA 4B4FA 3VX1A 5U7SA 1UW4A 3GJSB 4X0NA 2DORA 2XO6A 3PR5B 2W25A 1UVNA 1Y11A 3HPOA 1WSVA 4D9PA 4GFSA 4C2MA 1DXFA 1BD0A 1QT1A 2R7TA 3IEBA 3W75A 1RBOB 2J7DA 1YRRA 3O2IA 3VGUA 4JFTA 2FZ8A 2ROPA 1TL7B 5KG2A 4P2SA 4HPJA 1WBHA 2CNOB 3PCOB 4ZP6A 1A47A 3CXCR 4GGBA 4TQSA 4DR7F 4KH0B 1IKWB 3VMNA 1UA3A 1E70M 3AHYA 4DJEC 4HMCA 3OTBA 2LU2A 2F8MA 1J8VA 3G8SA 4C8LA 1PCAA 5J1EB 1KM6A 2FJKA 3OL7A 2ACRA 2CHOA 4URGA 4TX8A 4OV6A 1R8HA 1GMWD 4X4SA 1IWAA 3LZ5A 3URBA 3KL5A 3HHEA 3DOPA 2WLYA 2EG8A 3LZ3A 1BQMA 1TMJA 4DZDA 2EBEA 4IRCA 3Q24A 4LFBF 3FDSA 2BOEX 1TELA 5BRPA 3MYOA 4PB4A 2CDRB 1E1CA 1H7OA 5DMYA 5GNXA 1N5SA 2VQFF 2BXYA 3S1WA 4L4OA 2PAJA 2G4FA 4IJBA 4UTWC 3P5BP 4LSZB 1LLZA 2D23A 1BSIA 4XD5A 5D4LA 3EGWB 1ONEA 1QATA 1BGGA 2FZMA 3TNVA 1RT1B 4ZKAA 4P8WA 2E1CA 3SSQA 1GKQA 1Q66A 3ITOA 2BDQA 3O6AA 1T9WA 1X7IA 4ZVQB 1WHVA 3DHUA 4AYBD 4KERA 2ZUNA 4N6FA 2OXNA 1U4BA 2F4VJ 1RTHA 1CBKA 3FGCB 3P3BA 2Y9HA 8TIMA 1M9HA 5H9EJ 1ZU8A 3AOBA 5T7LA 3GE7A 2ZBRA 3G2GA 4DF0A 2LQ9A 1S5NA 5B0FA 4ES4A 2OPPB 2CQ0A 3GTNA 1IKWA 3B40A 3WYZA 2ZICA 1UAWA 2XULA 4B3KA 2FC9A 1TPB1 1LOQA 1XFBA 1NIUA 3UYCA 3WNMA 5A6SA 2MPUA 4Q45A 1N36J 4Q4PA 3QGGA 1QNQA 1TIWA 1ECQA 1EJVC 1R9XA 2UY3A 3R79A 2DO4A 3HVAA 2DNZA 4PCSA 4YJ5A 2LVWA 3UDCA 3K8VA 4OZ0A 4HSOA 4YHHJ 1JEZA 5F4XA 5HLFA 3J7AN 1UFKA 1FWWA 5J2NB 1HJUA 4HN8A 1YJUA 3WENA 1EJ7L 3ARVA 2DGAA 3B3DA 3NA8A 3WQGA 3W24A 4XO0A 1RYRA 5KITA 2RRNA 2YZ5A 3I0RB 3QR0A 4MSSA 4ACZA 4NLGA 2KJWA 2PFHA 2Z2MA 4M5IA 1KRPA 3L4YA 3GG8A 2A85A 2IA0A 1XBXA 3C0SA 2JOQA 4IFRA 3GJRB 3GVQA 3AXKA 4ZTXA 2XN0A 4O0KA 5BR8J 4PQUB 4DR2J 3NG8A 3RJXA 5CC3A 1R3QA 3FAXA 4JX5A 5GJPA 1EX8A 1LF1A 3VCCA 3C4UA 2EAWA 4WK9A 1C2PA 3MECB 2CKSA 2RU9A 4ECXA 3ONQA 4Y2CA 2YL5A 3FGCA 4HCDA 4GPNA 3W6YA 3E2QA 4L75A 4URQU 2BWGA 1TQXA 3DLKB 3OHBA 2C79A 5HWJA 4H6RA 2IM3A 4QBXA 3BWWA 2I1RA 3NCRA 3TAMB 3O6YX 4QWEA 3EBVA 3O15A 1VBGA 4I9JA 1HJXA 4XZWA 1IXKA 3JQMA 4H00A 4I7WA 5CZTA 3T1YJ 4PUKA 4RNFA 3QFWA 2FB2A 2FGZA 1FX4A 4WZQA 2IW0A 2LA4A 1IBMF 4IUOA 4XUGA 3V2UC 5DY2A 3THPA 3EOSA 3SN4A 2YDAA 2DQXA 3FJLA 5J2QA 3QEZA 3BURA 5B0CA 2J7CA 3EA1A 1TU0B 4OYOA 3PUDA 4WIWA 1MW2A 1AFJA 3DERA 3A5VA 3QVQA 1LM1A 2J9YA 4TX6A 4NI8A 2J88A 1G4SA 2XI2A 3D28A 5D0GA 1JGMA 3A4WA 1CJKB 4X62J 3WQ5A 3WNLA 3GHRA 3ITCA 2XM2A 1EP4A 3OJUA 4WCJA 4J37A 1W5MA 4DXVA 1Q85A 3G77A 2RD5C 1NUEA 4LGXA 1TWWA 4ICCX 4D6HA 4HOZA 1OWXA 2R9RA 2QCHA 6XIMA 2E5HA 5GADU 3TJ9A 4ZDNA 3W4RA 5M3WA 4PCTA 3F03K 2QXWA 2I9SA 4WCEQ 4CLUA 3LV5A 5I00A 2H3BA 1X8DA 2CPFA 2WVUA 5KT5A 4HPHA 4QJ5B 1H7WA 1XICA 3NQGA 2G95A 2F4VF 2DGTA 3KBSA 3A4JA 2GSHA 1XLEA 2DSWA 3DRSB 4DUZJ 1YIJS 2F2HA 3WDOA 3R5CA 4D6IA 3BSGA 3SFGA 3PP7A 3LQVA 1HI0P 3QMQA 1M7PA 1XUZA 2J6UA 3S46A 2EEXA 2HE5A 4WFBQ 1N36F 4FOKA 3VD4A 1LWEA 2FHBA 3QAUA 2Y8VA 2BANB 5CGMA 2PA3A 4D8LA 1FKPA 4WSKA 4YHHF 1CJKA 4S2BA 3UZXA 3STCA 1GKRA 2BY1A 1AUSL 4IGSA 1N33J 4ZOAA 1RKJA 2RNEA 3RFAA 1OF8A 1UZHA 3OLGA 2DK2A 2HBXA 3AB4B 3MEDA 2YQ0A 2Z0GA 3VKJA 4D6FA 1DARA 4RPPA 3U1MA 2QCNA 4ZO6A 5KT3A 4XIAA 4WGHA 4AXNA 2Z25A 3HF3A 3DXSX 3BLKA 1KCXA 3C5QA 4LSBA 5BR8F 3C2RA 4C6BA 4DR2F 4D3GA 3STEA 1WC6A 4G7EB 2J0WA 1S3TC 2OPSB 4BR1A 1NH8A 1L0PA 4PYDA 7AT1B 2BZNA 4C6PA 3PZQA 1S1XB 2CQPA 3SUUA 1XLAA 4S39A 5C7VA 3OOQA 3VDGA 3VWSA 2V8HA 4DHVA 2DNLA 4YTUA 3EKLA 3JAMU 1VQ9S 3UYIA 2OTJS 2JLGA 1SZFA 3L7PA 3MMUA 2Q3RA 1P27B 2NPIA 3VMOA 1AW1A 3W2WA 2VFRA 4E2VA 2X0SA 2DGOA 2FH6A 4KEUA 4MHBA 1I2PA 2YSWA 3CZGA 4UMAA 3LO3A 1E1EA 2D0HA 3T1YF 2OKOA 2CDQA 5JBDA 1ML1A 3TH6A 1OYDA 1XLDA 3LWMA 1GPFA 4RXGA 3WMCA 4BI7A 1XINA 2QG9B 4GISA 4G3IA 3OFFA 2E7VA 3NJ3A 1QUMA 2YCIX 4K38A 1M04A 2CG4A 2XIOA 1KM4A 2DUAA 1YK9A 1CDGA 1FCBA 5E5NA 1NB2A 3L4WA 2CPJA 3FEZA 4AZBA 3N04A 4X62F 3MU7A 3MY9A 1QNOA 3QW3A 3EA3A 3OBIA 2DUZA 3P81A 3RU0A 3E2VA 3BC9A 2QYGA 4KHPJ 2WAGA 3A8JA 3G96A 3N0VA 4B3SJ 4CD5A 1S6UA 3WK1A 1EB0A 1WHXA 4Z1AA 2ZVSA 2QTWA 3H2FA 3WF0A 4I67A 3QLDA 4L4LA 1BYAA 8RUCA 5LNVA 1ITQA 4AQYJ 4UZSA 2PTXA 2POTA 4ZITA 2G0JA 3APYA 4DY1A 3N19B 1KFDA 3GC5A 2DYAA 2VM8A 2VC0A 4EP8C 1U6BA 3NEHA 1TV3A 3G1FA 4DUZF 3C6CA 3PTWA 2DR9A 4AZIA 4AWEA 2B3TB 2GJXA 4MUZA 1TR1A 4G1KA 4N76A 5FEPA 3EZUA 4KCUA 3KTSA 3A3OB 3LHYA 4ZJLA 3TQ1A 1HBOA 5LJ5Y 4ATNA 2DSZA 2G37A 5H1WA 3FEXB 2AGQA 3RLVA 4R33A 4N0RA 1JULA 1JLBA 2Y7DA 1T99A 1V3IA 4Y3CA 3TAKA 4IFVA 1QW8A 1KVKA 5HVFA 1N33F 3PTQA 3S1TA 2ZZNA 3PZVA 3FK4A 1LQ9A 4OFCA 4KKOB 4PWDB 3U1NA 2WVTA 1EA9C 4PG8A 4QQ3A 4ALDA 1KRAC 3EX3A 4I9AA 4LV9A 4LCSA 4CU8A 3DKJA 3C8YA 3QT5A 2DR6A 4PFHA 2UWFA 3BS9A 3V4BA 1UIPA 2FIUA 2YYUA 3E1F1 1UP3A 2AX1A 3A13A 2DY3A 3B8WA 1XH1A 5EMJA 4C6DA 2Y7EA 4RJEA 1B4SA 3TX9A 3QY8A 4C1NB 1JCYA 2WB4A 2OCZA 2D7SA 1GFWB 3KLHA 3WLOA 3LCFA 2CZFA 3LLXA 1J2BA 1WF1A 3RGTA 3DU6A 1K7XA 3FVDA 2OZ3A 4NJGA 2FJEB 2DRAA 2GJRA 3Q2SC 2VCBA 1JCTA 5LSRA 4MKBA 3TYTA 2Y1LB 3M5ZA 1EETB 2FY1A 4GI8A 3N25A 4NLYA 3BMXA 1EPXA 2OEMA 4GCXA 2BUNA 5KT6A 2WMHA 1T03B 4FR6A 4RU2A 4DV6J 1Q7MA 4LF6J 1DZ5A 4DU7A 1K8ZA 2VG5B 4O17A 2WK2A 4L5ZA 4GA8A 1ITUA 3ITTA 2LA6A 3ABQA 1EQ0A 1VLYA 5EPDA 3TYUA 4AZCB 2OT0A 2AQOA 3WBXA 4Y9OA 1S48A 1NWUA 5SUHA 3CSKA 4H2HA 1BAGA 1R3YA 4M5JA 4CIOA 4PSPA 3PBMA 4FHAA 5E1QA 5K14A 4AL6A 3FV9A 1FWAC 4KHPF 1ISXA 1GOMA 2I2YA 4B3SF 3ITHA 1VBUA 2OOFA 3MPDA 2JEIA 4EUVA 4EI2A 2EBNA 2EBGA 4C1NA 1GX5A 5E41A 3UJRA 1REQB 3NZRA 1M1HA 2JC1A 2KXNB 5CKSA 2DJLA 4TX9A 3WX4A 2QPUA 1D8WA 4MNJA 5IFTA 1AFIA 3X3UA 2RJZA 1FWTA 2M52A 5EMMA 4LNYA 2CNCA 2HFOA 2BGSA 1VBKA 4AQYF 3HFKA 2XIBA 3BPDA 3W62A 3NPVA 2QL9B 4CZCA 4J2PA 1RTIA 3UQNA 2ZHAA 1C91A 5IFPA 4GVHA 3N5BA 3LUTA 3WJXA 3GX9A 4J35A 5CPMA 1XIDA 1G4TA 2XIIA 3D0HE 4E3TA 7TIMA 4H4KC 2C18A 3H4GA 5C2GA 2YKQA 3O1LA 1DBDA 2EKGA 3LCWA 3U9IA 4XTTA 4EX4A 3EICA 4NZ7A 4Z2JA 4CCZA 4RDWA 4WJBA 1UCWA 1I6NA 1A50A 2QGHA 3L0KA 3LY0A 2EVZA 4QR1A 4DJEA 5J04A 4Q0BA 2QSFA 3ARSA 2XSBA 4JQ2A 2XMMA 2W66A 4QISA 3QZ8A 3N6LA 1GZGA 4Y90A 3P84A 3VIPA 4AZCA 3T3FA 2EF9A 1MZHA 2SFPA 1IE7C 4A3UA 1SVDA 2RDTA 3NIYA 3TE9A 2J6VA 4WZMA 1OBAA 4CO4A 4IH7A 4JGDA 5KFEA 3NWRA 1XCWA 5JUVA 2Z24A 3W38A 2BJ8A 3S6EA 4E4PA 4C1LA 1BVNP