3KDNA

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
437
structure length
436
Chain Sequence
IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based catalytic optimization of a type III Rubisco from a hyperthermophile
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
total genus 142
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3kdnA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3kdnA01
1IR2A 1UW9A 4NASA 3RUBL 3ZXWA 9RUBA 2CWXA 3KDNA 1RCXB 1UWAA 2D69A 1BXNA 1WDDA 2V69A 5HQLA 5C2GA 8RUCA 4MKVA 2QYGA 1GK8A 5HJXA 1AA1B 1UPMB 2OEJA 3FK4A 3KDOA 1EJ7L 1RBAA 4LF1A 1RLDA 2V63A 1RBOB 2VDIA 4F0KA 5HAOA 1RLCL 5HANA 2V6AA 2V67A 2V68A 4F0HA 4F0MA 4HHHA 3WQPA 2RUSA 2ZVIA 1SVDA 1BWVA 1RCOB 1RSCA 1RXOB 3NWRA 5C2CA 5HQMA 4LF2A 1YKWA 3A12A 1GEHA 1AUSL 1UPPA 1UZHA 2OEKA 2VDHA 3A13A 3QFWA 1RBLA 5HATA 3RG6A 5RUBA 2OEMA 2OELA 2CXEA 1RUSA 2YBVA 1IWAA 4RUBA 5HJYA 1TELA 1UZDA 3AXMA 1IR1A 5HK4A 3AXKA
chains in the Genus database with same CATH superfamily
3KHRA 2PEHA 3MR6A 4UQEA 2EG6A 2ZXBA 3TUUA 1S79A 1W1ZA 3ATYA 1C9DA 2DGTA 1R8AA 1Z4UA 2XSJA 5IFMA 5KTQA 2IRYA 1G0CA 3DLKB 4OJ1A 1U83A 4GVHA 3OHAA 1L3TA 1CW2A 1D3WA 2DZVA 1NB2A 3LCGA 3H8AA 3PB0A 5AXLA 1HKVA 2PEVA 3MP3A 4OFZA 1KQFB 4AFFA 4O4GA 1K03A 2BP1A 2WHKA 4M5MA 3W60A 3A6OA 2BM1A 4REQA 2SFPA 2RDDA 2Y9HA 1XCXA 3A4TA 4AIEA 2ZVRA 1VDHA 3L2MA 1MU2B 1SW3A 3TEGA 2W25A 4IR1A 2BOAA 4I2PB 3N6LA 4RK8A 1RJJA 1LW0A 3LW5C 3IARA 1JJCB 3PZ9A 2KRBA 1SJ1A 2ZUMA 1QVGR 3N15A 2FKPA 1Z42A 4AWEA 1D1UA 3NEHA 1PCAA 2A3BA 3MTWA 4MY1A 4MSSA 3PUGA 4KSEB 5IHRA 3O6YX 2VGBA 4JTKA 2DUZA 4Z2LA 5CZVA 4LF5J 3P60A 3THTA 3KBJA 2BASA 3A23A 2MZRA 2V5LA 4RDWA 4USWA 5B0AA 5M2PA 1ZJAA 4YY3J 1J93A 3DGPB 3AHTA 1WXYA 1WE5A 2PWHA 1G6CA 1O4UA 1L6WA 3HSZA 3JQKA 1GQJA 2ZTJA 2J25A 3DI6B 3MJYA 3TYEA 4CLMA 3SGGA 3LXAA 5D2VA 5BYRA 5F3TA 2F3JA 3TQKA 3GE7A 2C1GA 2YLAA 1I94F 3D28A 1DQ8A 1MO0A 3D1QA 2XWYA 3DFQA 5G1MA 3TJIA 2GQAA 4UQGA 2YKPA 1V6VA 3MCMA 3GW0A 1N88A 1VRTB 2IKHA 2YDQA 2HHPA 1RD6A 4IQLA 1SKWA 3KBSA 4NE9C 3HX9A 5TQLA 3R5CA 4D8AA 1O6IA 3L4YA 4WR3A 3BUVA 1NBEB 1XQKA 3E9AA 4ACZB 4X66F 2GCFA 4DUWA 3OIHA 1P1LA 4PR4A 3SCPA 1CEZA 3DN5A 5CBIA 4QNEA 3UPBA 1WI8A 2CCRA 2EO7A 1JI1A 4C60A 1Z48A 4J9JA 5D2YA 1JLEB 3T4CA 2ZVSA 3UN3A 3GUGA 2ATLA 2HWHA 2C15A 2W27A 3TW9A 4IF2A 5AE1A 1JQXA 3SW6A 1U2RA 2G1DA 4Y28C 3GIKA 1FOBA 4F2SA 4FXJA 3BGUA 3ABSA 4MIBA 4A3RA 4R0JA 1EFZA 2HYIB 1VQOS 2CADA 1KRCC 1W9DM 4S39A 1W91A 2Z1XA 5B0GA 3ZTPA 4HYWA 3MM9B 2KX9A 3H4XA 4V33A 3Q8QB 3FNNA 3CHFA 4O50A 4D6IA 1BXBA 1L2UA 3V4IA 3PYEA 2XYLA 1NMEB 3HZGA 7TAAA 1DIEA 2G3IA 3RO6A 4LQ1A 1E6SM 1JLGB 1UFWA 2Y88A 3PNZA 4NYPA 1I6NA 3GHRA 2DQWA 2YNIB 3FRZA 4FN5A 4A8YA 3NVDA 2PDNA 5DF0A 3LZ3A 3SCSA 3N4FA 2I5QA 1I2RA 4N8OA 4QEEA 1EQPA 2GVZB 2KHDA 3F4VA 2ROGA 3M4HA 3E51A 2J7GA 4LYPA 2PDCA 5CG7A 2I17A 6FD1A 2UXDJ 4IISA 5E09A 4ZKAA 5A5WA 2QYGA 1JL8A 3AQOA 1R8HA 5FF4A 4AXNA 2Y8VA 2JFEX 3U2OA 1EXBA 3FY1A 3KFTA 3TQ1A 1N32J 4AYBD 3SUSA 5M5DA 5A8RA 3PHEA 2IKGA 2VDHA 3W73A 4KO0A 2DORA 4NL5A 4F4RA 1WOOA 5I00A 5KT7A 4B3SJ 3LU2A 1XYFA 1AROP 1RK8A 4QWDA 3HJFA 1BQCA 4UTFA 1LT8A 4WYLA 4I9MA 3B04A 4C3LA 2NCKL 2EHHA 3PRDA 2QT3A 3W7IA 1DTTA 2E5LF 3PZUA 3VOIA 3REQB 3H2AA 5FF2A 2YNGA 3BN4A 2AW0A 3WK1A 4YXGA 5G5IA 4H4KC 4AUBA 3GIYA 1X39A 2Y8KA 2Q43A 4Z1AA 1DOSA 2DGVA 4EI2A 3CV7A 1YI2S 3NQBA 2CQGA 3DKLA 1S1TA 1RAGB 3SSJA 2EFQA 4ZVTB 4XZ9A 2DY9A 4AG0A 4AZ7A 4BI7A 1B7YB 1YJUA 1NJIT 4Z17A 1QNPA 4IIGA 5KG4A 3ZR4A 1X0PA 4YB6A 3T8LA 1TPB1 2ZNYA 3K5LA 3TTSA 4AWUA 3VGHA 3G1HA 2BE2A 4ZDNA 2YYUA 1RTJB 3SFUA 2VNCA 4Q7AA 3EYZA 1H09A 4U5IA 3N5BA 3BCJA 4JCLA 1M5SA 1QPOA 4U2ZA 3TSBA 1JNEA 3LGNA 2BFGA 4JBCA 3IVUA 3MSYA 1C0UA 4OHWA 4WLCA 5DCDA 4O4VA 4LF4J 4DLGA 3OGRA 3DFYA 2GVGA 3EWDA 4WDTA 2QUNA 2RDXA 3BKUA 2W4XA 3I65A 1OC5A 4FF1A 5DG7A 1VQTA 2OHDA 2ZZ1A 4QG9A 2QA4S 1ZLPA 3QFEA 3A8JA 2BACA 2OLSA 3DI0A 2DH7A 3GYGA 2C19A 3NNAA 3ABXA 4ZTYA 3WH9A 1F0XA 1CXFA 3R8HA 2MQLA 4QPXA 3F5KA 3G82B 3G96A 2CPUA 4XO6A 5C70A 3MUAA 3H2EA 3VV2B 3JTOA 2KKHA 1JULA 2ISDA 2XGQA 2FVRA 1UWIA 2REQB 3IGHX 4F3MA 5E7OB 4BS2A 2DHSA 2R14A 3HMCA 5DMYA 1S7HA 4CCHA 3WLLA 2E9BA 1GTEA 3J80U 1C8QA 3DI6A 4IQMA 3KOAA 3QWUA 1ONEA 3PBYA 4XQ6A 5JJBA 2GGEA 5BU9A 3M2UB 1S0OA 1CJUA 3OXGA 4XVEA 4ED8A 2ZUAA 1ICQA 2X16A 4ATWA 1JYWA 1I1GA 5DM7Q 4KFOA 2FJVA 1EUAA 1IKWA 4B5NA 5A95A 4H8UA 4NXMF 2QLFB 3DHFA 3QR3A 3RR7A 4IH3A 3OJUA 9XIAA 5K14B 4RNOA 1CQNA 3CEPA 1XIIA 3QHNA 3QGVA 4WZHA 4OLOA 5AECA 1HR0F 1Z6KA 3PFEA 8CGTA 3G5EA 1ZTVA 1NIUA 5HOSA 2AJQA 3A4JA 2HGNA 4NZ4A 1NJWA 1JLCA 1RISA 3L5MA 3NGUA 3DLJA 1MNSA 2VYOA 3I4HX 3JU2A 3W1UA 3THUA 1QTMA 1BKSA 4MJ4A 4LH8A 4OV1A 1ELSA 5AT1B 1Q8IA 2MPUA 1JIHA 3THPA 4WKRA 3P14A 5AC7A 2QCNA 2BB0A 4ZP6A 3N25A 2OLWA 1PDZA 2VX4A 3M6DA 4JNMA 1LWEA 4L61A 3OBEA 1Z32X 3C16A 2HVIA 3R11A 3ZSTA 1EF3A 4TVUA 2QV4A 4G7FA 3WD4A 4GINA 4LS1A 2OO6A 4J9VA 3APTA 2XO7A 4GWEA 3LHZA 5JMUA 4HHUA 4S2CA 4DV6J 3CGIA 1RT7B 1MSSA 5T41A 4WF9Q 1J0KA 2JVRA 2JIEA 1KR1A 1FRLA 1KFCA 4Z42C 2DNRA 1OX5A 3IUDA 4EGLA 2R7XA 4YHHF 3W63A 4BS0A 1TTQA 2PFHA 1R0AB 1NHKL 2VD3A 3MANA 3C15A 5B7ZA 5IBXA 1VRUA 2R7QA 1MMFA 1H50A 3I0SA 4L74A 1KWGA 1NK9A 4UCGA 4UMBA 2VBXA 2EPOA 3D1HA 4DUYF 4DJDD 2DXDA 1I8JA 4S3FA 3CCWA 3RIKA 2GSJA 1Y5VA 4O13A 5F8MA 3LPFA 5CC6A 4B16A 5IBXC 3G1VA 4L6HA 3H2LA 4W9TA 2XYGB 3CYVA 5DJBA 3C6TA 3VAVA 3GG0A 3CDWA 1LQ0A 5AYBA 4CD7A 1RWPB 2VL1A 1TV6A 5HP1A 5L6UA 3EB3A 2Z1SA 5J2PB 3PBVA 2JH3A 1VF8A 1ZSXA 5CXPA 5BXSA 1K8XA 2Y24A 3TQVA 1ZS6A 4Y2KA 1EQ0A 5IM0B 4O8RA 1B3OA 5D4YA 3HULA 1U2CA 3G9CA 1EQMA 2O56A 1HIYA 3UCUP 1OCJA 2P3EA 2JF6A 2YFOA 4C1NA 2LFVA 3ARZA 5HMWA 4CO3A 2ZM6J 4HHMA 2DNZA 3DNCA 2OQHA 4JFVA 3IFEA 4O44A 3UN5A 3L2IA 4RX6A 5AE3A 1K02A 2A7RA 1Q6GA 4N9DA 2ZICA 2HHSA 3O44A 2VRJA 1P5BA 4MG4A 1FWDC 3WBAA 1XRSA 3TXZA 2R7UA 1ZOTA 5KG6A 2PDKA 3OJGA 2HS3A 2YNIA 4F4ZA 2MY7A 1ACMB 3VYLA 1SZNA 4B9NA 3A4WA 3GR8A 3OFGA 2D69A 1T03B 4YIWA 1S6UA 3NA8A 1H73A 4RW7B 4R3UA 3WLRA 1C92A 3HURA 1HJUA 1J11A 1OFBA 3MYOA 1AQHA 1SJQA 1V0NA 2D1CA 3GSIA 1DQWA 4PQAA 4J3SA 1GZ1A 1GHSA 3RPMA 4NEZA 1RU2A 2VODA 1LWCB 5T91A 3WD0A 4NZ6A 2XVPA 3SURA 4EWTA 2HRWA 3AI0A 3WLIA 2NX1A 1ZM9A 2E1RA 2ZQ0A 4X64F 1MSWD 2GGJA 4J1OA 2E7WA 3CZLA 1DWJM 4MKYA 1UZ1A 3WELA 1XERA 1PZ3A 4N9BA 2AJ0A 4O3RA 1CXLA 1WB0A 4JBRA 1C0TB 4HCHA 2DEJA 3D68A 1A4LA 2V5DA 3PVXA 3QT8A 3STGA 3BBCA 2H8XA 4G9PA 1B2YA 3F5LA 3Q67A 1QI2A 1IQZA 1E55A 1JLQB 2OPRA 4ES1A 3U27A 1IR2A 4FNHA 4ZHRB 3FGVA 2OT1A 3EEZA 1GQIA 3QRQA 5GVQA 1JRCA 3SDOA 5GAHI 3N9UC 4UF4A 3MJMA 5L46A 4QR6A 1R0BG 1US3A 1KGWA 3LP2A 4DPYA 1UCNA 3LOUA 5LM7E 3CAWA 1WORA 4DVOA 3VFLA 3BSHA 2VELA 6ALDA 2WSFC 2PP0A 1RT6B 3KFWX 3NS5A 4W84A 3QBUA 2YQ1A 1GX6A 4S3DA 3TNVA 4M80A 5I7GA 1WDDA 4JI1J 5GNXA 2OEJA 2A3JA 3MCSA 4I2QA 1UUMA 1N55A 1KTQA 4F0KA 1NPKA 3W29A 3CCSS 1KRMA 2C3ZA 5KFLA 1OT1A 1V3KA 1WDRA 1HPZB 3GU9A 3T2PA 4B02A 3PF3A 1S10A 5HXMA 3OV7A 3IIOA 4IZGA 1G3OA 2XH2A 4IL0A 2DJWA 1HKAA 3S6TA 3TFCA 1ZUAX 2C3YA 3SSQA 1EBHA 2GK1A 4TU1A 3GWQA 2HWTA 3K4WA 3TP4A 4TMCA 1SPQA 3M5VA 3BLEA 3NS6A 3T3FA 2QL9B 2V5JA 2C71A 4KCUA 3P6YC 4KQNA 3M0MA 3VOHA 3O6QA 1KC7A 3VGBA 3I9V9 4TY8A 2JEJA 3I6PA 4I1TA 2E7XA 3RPTA 4KPLA 3MWBA 5U7SA 4LEFA 4ZOCA 3VMOA 3AS0A 3BQ6A 1WHVA 4NI2B 1PWLA 3XIMA 3JTNA 2HXUA 4UBPC 3B0PA 1XF0A 5DLCA 3O5TB 4PBFA 1NH8A 1TWIA 1S2AA 2W63A 3WH6A 3VD3A 4XD5A 2E6FA 4RLIA 2G9OA 1EB3A 1FWNA 3DG7A 2ALZA 3QYSA 3D1OA 3LI0A 4LRFA 4MYAA 5F9LA 1W56A 5FLXU 4RWWA 5KFVA 4FLQA 2JC1A 4GK8A 4LGXA 1IXKA 3VAHA 1OT2A 1SO4A 4LYQA 3MM5B 2QCDB 1FCQA 1IN0A 4LVDA 2GZXA 2KXFA 5C8BB 1JR1A 1NTHA 2G97A 4KRZA 3G22A 1Q4WA 2F4VJ 4K50A 3LSCA 1R3SA 1IF2A 1RBAA 2B9EA 4FF5A 1S46A 1ISVA 2OZ3A 5M2FX 1WYIA 2PDYA 2UUAJ 4JNZA 1BTCA 1XYBA 3GC5A 2R7WA 1TV6B 5HP1B 3W85A 1AFSA 5MKGB 1RK6A 4I9TA 2GS8A 4WTOB 3RCMA 1DLOA 3DC2A 1KGXA 3WQEA 3IGUA 4AX6A 4M1KA 4M7TA 2CXEA 5ETRA 1WBHA 3FCVA 1QHPA 4DFPA 3TYBA 4RR4A 4C91A 1QDSA 3UG4A 3MMAA 1Q6RA 1OM0A 2JFDA 3AB4B 1VEMA 5HNRA 4GQ0A 4ZLPA 1TE6A 4EBEA 3HSGA 4V27A 3G82A 1KM2A 2QHAA 2QCMA 3VZZA 3MAAA 3D3CJ 1OY9A 1U33A 4O54A 1RLCL 2OG9A 1W25A 2NUHA 4JB8B 3TH6A 1PO9A 2G1HA 3ZM8A 4NJIA 4WXZA 2DNLA 1JUBA 1U22A 2J7EA 3MUZ1 1YBTA 4CLUA 3VK5A 3TONA 1W1IE 4DXKA 3GVQA 3RMEA 3AMGA 2F7FA 4GXPA 4NF7A 1TIMA 3C0QA 2QUUA 1OJXA 2E1AA 3DXBA 4OZLA 5H8PA 1DJQA 1FTCA 3IJ9A 4M5GA 4O4GB 4W85A 5KT5A 1KVIA 1MN9A 5F8NA 4UFIA 4NRRA 4U10A 5AZ1A 1GUVA 2P8CA 4O3NA 3WG6A 1HWJA 2Y5JA 3CO4A 1N82A 4QFUA 1P7TB 4AL6A 2C1HA 1TE1A 3UXDA 1DURA 2QC3A 4QOTA 2VI0A 2VFSA 2ZDOA 4U7UK 3NNCA 1T9TA 3C19A 1E0VA 2YB4A 1QNOA 2VXNA 1JQGA 3UNDA 4H83A 4IFVA 2RH3A 3RBDA 4IKAA 1N5TA 1D7KA 2A2IA 4HYVA 4C5ZA 4LT6A 1LFPA 1AW5A 1A0CA 3H90A 4JS3A 1WWHA 3V0UA 1LT7A 3D3BJ 3BL3A 4RW3A 4GG9A 3NAHA 1S1TB 2GUUA 4TR9A 2ZRYA 1VFTA 4ZPVR 1UWBB 4DR1J 2VC9A 3CV6A 3F1QA 1DARA 3IS9A 1W2VA 1CLKA 4AEOA 1HNXJ 2VEFA 4X4QA 3N01A 1N5YB 3IIXA 2L3MA 2YIHA 5KINA 1T0TV 4GO5X 1PJ6A 1W3IA 1B4KA 3DAQA 3HM7A 3RX3A 1XEZA 1Q2RA 5L9NA 4ZE5A 1HNXF 1SFSA 5D8HB 3NZ1A 3C6UA 1VFUA 3UR8A 3DOKA 3S1WA 4YTRA 2N3LA 3M2UA 4OYWA 4N5SA 1XR2A 4XD3A 3FV9A 2PI4A 2CWXA 2J7HA 3GNOA 4O12A 1S9EB 1BWKA 3DFTA 2EG1A 4FP1A 3GK0A 2QMXA 3G6VA 1UPMB 4D8ZA 2P6TA 3V4MA 4ZB0A 1N34F 2W7OA 4NVTA 3C2EA 3H23A 2WBGA 4ANEA 3SIMA 3TZNA 1XIGA 3R5BA 3W65A 4O57A 5LNVA 1Q6LA 2FGOA 3ZYZA 1XR5A 2N3OA 1VS1A 3UXAA 1E71M 3S5ZA 1UOKA 2OTDA 4AL7A 2YWHA 3NQAA 4GZEA 3RTVA 3U2CA 3BAWA 3AAWB 1XBXA 1S0MA 2YGYA 2Z58B 1FP8A 3DRRB 3T08A 3DH7A 4LRAA 1XTZA 1UD5A 5B0BA 2BVDA 2PDQA 1EDGA 1RJQA 5F2MA 4UOGA 4PB5A 1QHOA 4OBSA 2R7OA 4USVA 1NHVA 4OLPA 1SL2A 4FNIA 1MFVA 5I3DA 3THDA 4ZGYA 4AD5A 4JFSA 4J4KA 3AS2A 3LLXA 2AJ4A 2OPSA 1HNZJ 3T40A 1J5TA 2WSKA 4K6AA 1P1XA 2DIEA 2ONEA 1S3HA 3CLWA 3UR0A 1AFIA 2QNEA 1ELOA 4JQ4A 2GQ9A 4B3OA 4A8KA 5T7LB 3VOFA 1V77A 3W1TA 2ZVIA 4YQWA 3QQWA 3WK3A 2VJVA 3EJMA 1FKPA 1HNZF 1HIZA 4DBEA 3ZMRA 3DRRA 4HHJA 1IGSA 4ZMMA 4X0VA 2PEBA 1K1SA 2RE1A 3DYPA 4LF6J 4KY3A 1C8YA 2A7PA 2UVVA 4ZP7A 5HQLA 4J9KA 3PBGA 4CD8A 4IR9A 4K5SA 4C11B 3FJ2A 4KKOA 5HPOA 3BSOA 5HQ8A 1G2EA 3DRPA 3TANA 4Y8FA 1N54B 2BKOA 3MOZA 1UD4A 3RW7A 3UCZP 3CZJA 2HBRB 4LQ3A 3T41A 1BD0A 3BOLA 2PP1A 2XNQA 3SSRA 3IM8A 5BYQA 4C4WA 4DV3F 1OFRA 2VA2A 1K73T 1H51A 2FGCA 5FEPA 3UCDA 3HHLC 3UR2A 3LQLA 5GVJA 3T9ZA 1ME7A 3FFIA 3B8SA 3NEVA 2A0NA 5J1EA 3C3NA 3WNPA 1UR8A 4WUIA 4XZIA 4I9JA 2CNKB 3O2LA 5K9DA 2HNZB 5DO2A 5L1LA 1L2QA 5BWAA 2QULA 5BXIA 2KZHA 5BCAA 4BA0A 4WFZA 2DH9A 3H21A 1TKZB 4I6WA 3HV9A 2WXDM 3ARYA 2OU4A 3LNMA 1P0NA 5H6HA 1GG1A 3FMBA 3P62A 1AUSL 3NMRA 3KRUA 3MA8A 4DQWA 3B8UA 4QJVA 4MZ1A 3RMJA 3ZQ9A 4NSBA 4FO4A 2YVSA 2E8ZA 4GVLA 4O1CA 4DRSA 3UWTA 3VGSA 4ID8A 4RKAA 1LW0B 1SJDA 1XIJA 3C86A 3WBXA 1K9TA 4ZO6A 1B7FA 2YPIA 2YXXA 2EAWA 1JPMA 2VT0A 3S6DA 4JTSA 3W7DA 5ABHA 4N9CA 3HFZB 4FNTA 3MHGA 3TN6A 4F0LA 4LRTA 3PUOA 4XISA 4TX9A 3VFCA 4E4PA 1T96A 3HJEA 4ERGA 4R88A 1RTDB 2FY8A 3HIJA 4DZ5A 3Q37A 4UR8A 1YRXA 4L75A 3DLKA 3NXFA 3BZJA 4PXEA 4K4WA 1HUVA 1WKLA 3EA3A 2N82B 5A2CA 1VQMS 4KKXA 3TZWA 1U1QA 1VC0A 3MEKA 3NSXA 3C6CA 4A22A 3VIOA 3Q89A 2KTQA 3UVJB 3BSGA 3CBWA 1IE7C 2F8EX 3F4WA 3N79A 4D1IA 5FL0A 1H49A 2Y63A 2OEMA 1VRTA 2CRLA 1AZSA 1E73M 3CB8A 4L1XA 1ZBKA 4X62F 2HHTA 3GKFA 5HBFA 4W92B 1MZHA 3Q22A 2IS7A 2X42A 4UFKA 1ZBTA 4O11A 4NX9A 2P8BA 4UZSA 1OFEA 3MC5A 4KIRA 4ZSUA 3TNBA 1U26A 2DNHA 3FVMA 4AD3A 3P5BP 3QAEA 3GS6A 3L68A 2QV6A 4E2BA 4ZA0A 4PCPA 4ZB2A 4AHQA 2GO8A 1Z2LA 1S72S 1L6SA 4POCA 1E1EA 3POTA 2DPJA 3S2NA 4K4TA 4H9XA 2MSSA 3I32A 4EAMA 3N2BA 5DS7A 3M16A 1HA1A 2AQVA 1TK8A 3S01A 4QP0A 3S5NA 1LDCA 2RHGA 4MKSA 2DT0A 2B4GA 3W7RA 2YKNB 3TTQA 4UUWA 2WPGA 3GM8A 3A12A 2CU0A 3JXOA 4GKJJ 5IT9Y 1DQ9A 2VBWA 2BWGA 1M7JA 1LOQA 1RT3B 1KNWA 3D47A 2BOEX 4XV0A 3MPDA 5J2QA 3F2CA 4EVZA 1YRTA 3MU7A 4KFPA 2C79A 3FAWA 4ZVOB 4ZBCA 3VO0A 5HJLA 3CQIA 4UFLA 1RT7A 3AHZA 1IZKA 4EANA 3CHEA 2CBVA 4PMZA 2OWWA 2OYLA 3GMGA 1PX3A 1JLFB 3SSSA 1QK0A 4E38A 1L5UA 3T1YF 1Q3NA 4ENOA 5T9BG 3BGRA 4DO7A 1Z41A 3EXRA 4O1AA 3DM2B 4FSAA 3TEHB 3R94A 2QPUA 1ZBCA 4WP9A 2NQLA 2HWGA 4L72B 4Y2IA 3T44A 2JC0A 3ZZ0A 2AF6A 3BICA 2Y0SD 2IM2A 3DLHA 5TBOA 1A5LC 1UVIA 5I07A 1G4EA 3E8OA 1JG9A 4Y2MA 1NHUA 4Q44A 3KLFA 1T8EA 3ZFHA 3R89A 4GJ1A 2R24A 3ZIZA 2V8DA 1LWHA 1N8IA 1RPXA 4W7WA 3K2YA 3BYRA 1GOXA 3WMLA 3HVRA 3DOMA 5IV3A 4LAMA 3SSZA 4YTTA 5EMLA 4DX7A 1E9LA 2X1FA 3AU6A 5E0CA 1DHMA 4NLPA 3OHMB 2LU1A 3PTQA 4OI1A 4H8HA 3I6EA 5GMDA 1Y4ZB 3AH6A 4K8RA 3I4PA 3UWQA 5AZ0A 1U1MA 3HBLA 5I06A 1MUCA 1QBAA 1W9PA 1EJ7L 2VASA 4PG7A 4MYTA 5J2NB 1TWZA 1PAMA 3T2QA 2RQCA 1DHPA 3M46A 2WVEA 1R27B 5AKQA 4E0DA 5DEZA 4DXXA 2DZSA 5DGAA 1FDNA 3CEDA 1PX4A 4HYKA 2AU0A 1IBLJ 4W8LA 1NF7A 3N04A 1XR6A 2QSFA 3EXTA 4EXQA 3GXNA 1AZSB 3B8HA 2ZH3A 1VC4A 1QTNB 3OA3A 1WZKA 1XHGA 3EDDA 4J3XA 1DTNA 2CJXB 6A3HA 1YWXA 4JTHA 1DJWA 4EXAA 1R7OA 4RPFA 3GNDA 3W1NA 1K8AT 4TX8A 3BDPA 4DWDA 1DWIM 4H8VA 1K1DA 4C65A 1U24A 2YY3A 1IJFB 2NXNA 5FJIA 3KUHA 2EGZA 1T0OA 3WQVA 1YZ7A 2FVCA 1EHNA 1TV8A 1EO7A 2EPHA 2NSXA 2VG7A 2CXGA 2H51B 2OYKA 2F4VF 5IFPA 2N7YA 3TC6A 4H6EA 3ARQA 2BVZA 2PDMA 4UTUA 4E0CA 2YQ0A 1EZ2A 3CUJA 4ROQA 3VF0B 2CYYA 4BWMA 1YDOA 2RF2B 1U1HA 3EZ4A 4O1DA 3FYOA 1KEKA 1FWGC 2NUWA 3OYXA 2OD4A 5ETVA 4US5A 4IIBA 1WA3A 3AFGA 2R1LA 2AKWB 4U6PA 4HOXA 1R47A 2G0JA 2VOPA 1ROFA 1Q66A 4WDUA 2YKAA 4IFYB 2MKJA 5DMMA 4QR0A 3EDKA 2WMIA 1DIDA 2QKFA 1XWLA 1FY6A 4KV8A 1GKPA 3V6KA 9RUBA 3OOQA 2FHJA 2GJIA 4LBIA 1J8VA 3GNXA 2VG5B 1NZAA 3NFUA 5ABGA 5DDQC 5C71A 1U1RA 2NLIA 2DNNA 5K9FA 2XMTA 3UNYA 2H5JB 4TV5A 1R38A 4UR9A 3SN4A 4Z7CA 1JPHA 4GCXA 2DZXA 3DYMA 1GVSA 2YCLB 2GZOA 3A22A 2BM0A 1XDLA 3Q2SC 2UXBJ 3AD9C 4PAAA 3CH0A 3OP2A 2V2HA 1RD5A 2LKZA 2QIIA 3WLMA 4DR6J 3HD1A 1DEDA 4XIAA 3TWBA 5H8UA 3MOJB 2ALDA 1OY6A 2UUTA 1UAWA 5G4DA 3W7MA 1F6PA 2FB3A 2V0NA 1KM4A 3AUJA 4Q8WA 3DHPA 3BS9A 3O0KA 3RLHA 2XLKA 3ZVHB 3NSNA 3VZYA 5B0CA 3L12A 4MB1A 1XLMA 4PMNA 2OKOA 3AQPA 1FBAA 2Z2MA 3MTJA 3W25A 1ZZNA 2CQ0A 3TXVA 1ZA1B 1H72C 3G6YA 3N6HA 4DCPB 4DV7F 1N5YA 2DVIA 4UQAA 2ZUUA 3SDEA 1M90T 1LFWA 4YMZA 3LHUA 3GHUA 2QT7A 1M04A 2W61A 1GJUA 3NYDA 4KBXA 2F8HA 3CMFA 3QRRA 1FK9A 1WDSA 4YTUA 3I0RA 1RWWB 1EP1A 3AJXA 4ER8A 3MV01 1KBLA 1SSGA 1ZTWA 5KFOA 2X1BA 1TR1A 1B0TA 3BCDA 1X4AA 3CSKA 4KT2A 1CJTA 4QW8A 1SQFA 3MEGB 1A53A 1ZB5A 4FXDA 3MM8B 1NDVA 2MB0B 4PG4A 2FH6A 5BWFA 3IIZA 3W7JA 1TV2A 2GHWA 3QOKA 3ZLFA 1DKWA 4LUYA 5A1AA 2ZRUA 4B4HA 4CEUC 3R2CJ 2B56A 4HA1A 1EDTA 1E3ZA 5I4MA 3L4WA 3R0UA 3S5YA 4BF7A 1VCTA 1X6UA 2X09A 3VI2A 1S76D 2V82A 2XZ7A 1DQUA 6AT1B 4NZJA 3N14A 3BKFA 3WQ5A 1HBMA 3DOLB 1NH6A 3LDVA 5AYXA 3BMXA 5F4WA 4A48A 4XK2A 2LCWA 4AMAA 3G1FA 3QW3A 2CG8A 4BWLA 4QE4A 1VIZA 2UZAA 1ZPWX 4OZ1A 1J0JA 1S6OA 4GIYA 4B90A 2E9ZA 1P6WA 2AL2A 5GADI 3W62A 2FB2A 3LAKA 1LKZA 4LPCA 4HKPA 4OUIA 4K1GA 3UJFA 1TPUA 4MWAE 3UD5A 3LK6A 3R6GB 3MT1A 4PWWA 1KTNA 5AFDA 3WJZA 3IPWA 4PEOA 2AGOA 2NREA 3TW7A 3JQJA 1DWHM 5HNNA 4ED5A 3E12A 4HHHA 4JHOA 5L1JA 2B4VA 2FZGB 1QE1B 3JRKA 2KZZA 3PRBA 5HATA 4DR3J 4FXSA 2X1AA 2YBVA 1X9SA 2PTDA 3B40A 3B06A 4G5DA 2HFOA 1KQZA 1XSKA 4P2MA 1TKZA 3NNHA 1W54A 2YZRA 5H1WA 4AZCA 2QQ6A 1CXHA 2LQ5A 2NZ4A 3MEEB 2M8DB 2EFVA 1XLAA 1L3KA 3KBVA 3LV5A 2DGUA 3LUTA 1JNZB 1KBIA 5U4NA 2OQYA 4GVIA 4KFBB 5F8HA 5IFTA 1S57A 1PZ0A 2VFGA 2PUZA 2CKWA 5KFWA 1SW0A 3FZ2A 2ZUSA 4DV2F 4D3HA 4HU0A 1RHRB 2W7PA 2EPNA 1ONXA 1X7VA 2X8RA 4EWND 4ICLB 4X0NA 3WDRA 2CPIA 1X31C 1OF8A 1SL1A 1HNWF 2EEYA 1TB3A 4IWWA 3LGHA 4USHA 1GW9A 1GYLA 2CQ1A 1RLDA 2ZH6A 4FNRA 1MNEA 6REQA 4OV9A 4MUZA 4NL1A 2W0UA 3N13A 3W87A 5F1VA 3KNAA 3DFHA 5B80A 1OSCA 1EJUC 1F3VA 4URQU 2QLJB 3I3EA 3PZIA 4Q8MA 2KDOA 3NOCA 2ZEJA 1TKXB 5CQ1A 3NLCA 2HIQA 2Z2ZA 3ENWA 4WCEQ 2QG9B 1DFDA 2KYZA 4PKDB 1HNWJ 1YMYA 1LBMA 2FVQA 1FRIA 1GVQA 2N4CA 4IFRA 4AQLA 1B0VA 3VC5A 5C5YA 1EP4A 1TL4A 3OVBA 1B0PA 3L4TA 4GQQA 1MG7A 4TU8A 5IM51 3MKVA 1KN6A 4CU7A 2X2GA 1TZ7A 1DJ0A 2DHXA 3MM8A 1M5KC 2F9JA 1VGAA 4AX7A 3GBEA 3W61A 3SADA 2VQFF 4P74A 4DV3J 5BOEA 3EWGA 1VRXA 3MUIA 2BW7A 5CH7B 1LBLA 1CXEA 4A8IA 2QJMA 2Z1VA 1A3XA 1N5SA 4OYBA 1V6UA 1UD6A 2OGJA 3DLEA 2CQ4A 4M95A 1KO0A 2G37A 5HA7A 3WLJA 2AJFE 5AVNA 4CO2A 3D0GE 3OTRA 2KJVA 1B3VA 2JEGA 1G01A 5LNSA 5CZTA 3EWZA 2O4MA 1OFOA 4H6RA 5K8MA 1LL4A 3NUKA 2VB6A 2DKOB 1NK4A 5LA2A 4PPDA 5D8ZA 4GA8A 3KOYA 1CULB 2IBOA 3DRPB 1K8ZA 2A85A 4IXXA 3M05A 3A3HA 2WHMA 3B82A 2NQPA 1U02A 4XSLA 2JX2A 1CJVA 3I7SA 2BODX 4BC7A 1JDAA 1S9EA 5K8PA 3G3MA 5CSYA 1JZ2A 3CDAA 2V8VA 4QR2A 4RL3A 5C9WA 2L48A 4ZFMA 1IBCB 4OYMA 3OPSA 3H40A 2WB4A 1Q7MA 2MNRA 2CBUA 3DOPA 4HU4A 2TMDA 2CVEA 1W3NA 2YXLA 2XHWA 1PVNA 3FDGA 3RUBL 2HISA 3DMJB 1KFWA 1DQXA 2HNYA 3OR1B 3H2FA 2OLHA 5KT2A 1KLYA 2P5NA 3W83A 1SUXA 1Q7ZA 2Z2YB 3D3AA 4LUTB 4DL3A 2IPFA 2LU2A 4RR5A 2HQFA 8AT1B 2MZSA 4TVCA 1AJ0A 2TODA 1YSJA 4EIVA 3L4UA 2GK1B 3K5OA 4NCGA 2XIIA 2JSXA 3OTOF 3NQ6A 4JV0A 4DL5A 4NZFA 1X9WA 2G8ZA 3GZ3A 2W2MP 4I0WA 3P74A 2D41A 1UP3A 2XULA 1Q8JA 3GC4A 5L39A 3SY8A 3M2RB 3VNIA 4U9RA 2V38A 1F07A 2J7DA 4LRSA 3WJXA 1GJWA 1Q53A 1CGVA 1XKJA 3UXKA 5LXYA 1IVZA 4E8GA 3D46A 1KQGB 1H1NA 1AXQA 1HW9A 1X4CA 4JI8J 2VFEA 2PTZA 4QNWA 1CDGA 2HBZB 4C7DA 1C4CA 2XVLA 1SM9A 5CPQA 3KS5A 4S3CA 3LP0A 4PTWA 2MYFA 2MQOA 1NQ6A 3SQGA 3HXMA 2AEJA 1BF2A 3HT0A 4MWAD 1TPVA 3M32B 2CA9A 1ADOA 4J28A 1MMNA 2NZCA 4BI6A 3ZZUA 4DQRA 2NW0A 3H6OA 2FZNA 4L4MA 2PWGA 2Y89A 4GIRA 3OBKA 4ECZA 2A2DA 4M94A 3A64A 4NNBA 4JTTA 4DX3A 2G2ZA 4KGXB 3N2OA 1SJ4P 2B0MA 3LTYA 1G7VA 1RT1B 1ZHAA 3OL6A 5CZSA 4KFBA 4J9QA 4IH6A 2IVFB 4ZIWA 1HMVA 3F44A 4JX6A 5DRCA 5LOQA 3DERA 3FYYA 3AY0A 3US5A 1NQKA 1I45A 4AVOA 3T6JA 3SI9A 4U7CA 4FNUA 4Y8EA 2YTCA 4DWIA 2E1MC 3NGDA 4KO0B 1LUCA 1Y7VA 2HVOA 4ALZA 3SI8A 1TPEA 3L09A 3M8YA 5AC4A 1M6JA 4I7WA 4LUIA 4B5UA 3ZO7A 2WZ1A 4YCOA 5I3UA 5XIAA 2TAAA 1WZAA 2CC0A 4KMQA 5D4LA 1KOHA 3HZ3A 3AALA 5A6BD 3B78A 3N9KA 5F9NA 1GQKA 2FDMA 1HO1A 3LPOA 3NTYA 2HNDB 3EM1A 1U47A 5A6JA 2KL8A 1J27A 3PN8A 4KC5A 3B05A 1QATA 3T78A 4PFMA 1QFEA 3WNOA 2Q66A 1JKHA 3PPFA 3TU9A 1FFQA 1WNOA 4E8CA 2R9LA 1V0KA 3QN3A 1XYZA 3B9DA 1U0SA 3RAOA 4DU7A 5E3QA 1LWXA 3IGNA 5FDLA 2AJ1A 1VZWA 1N8RT 1H7WA 2R1NA 2QF7A 4QGCA 1TAUA 1SJBA 2GMHA 2F5GA 4WK1A 2C0HA 4Z0SA 4MNLA 1JF5A 1UEVA 3WDQA 4TVAB 1YTDA 3PTKA 2GPTA 3BGRB 1QPNA 4Q5VA 5FJUA 1M65A 1TZZA 1TFWA 3ET6A 2NSCA 4PWDA 4G7EB 4EAYA 3JTPA 4WWSA 2KB2A 2WWCA 4L3NA 3H0PA 2MGZB 2HK3A 2ROPA 3DFSA 3WDIA 1E40A 3VCNA 3T0DA 3ZZRA 3GJTB 2K3KA 3CEUA 2KG1A 2AMGA 3VDHA 2ZOFA 2LECA 2JALA 1VBHA 4Z2XA 3BGLA 3JB9k 3BLKA 1QI5A 5I3HA 2NYIA 3AD7C 3HVAA 1TUXA 3RF9A 5CPOA 4RXFA 3AWOA 2ZX9A 4BK9A 1RWUA 3KTQA 1O66A 2O01C 2CZVA 2CNOB 2HVDA 4CN1A 2VFTA 4K8GA 3QHOA 1EJVC 3IBCB 3L7PA 1M1BA 4W7UA 4ZPDA 1KTBA 3N6NA 2QR6A 3J7A1 1LZOA 5JVGQ 3NQDA 3RW6A 4I5UA 4JTDA 3BLFA 3U48A 2HGMA 1E6XM 4UFMA 2J9DA 5MKGA 3C2PA 1B3XA 1TCMA 3W8GA 5HN0A 5F7UA 4V19J 4DELA 2REQA 4D72A 4GC6A 5LZLA 5BXTA 1RT1A 2CPFA 4LRDA 3E5PA 3W6MA 1Y5NB 2HMCA 3LPEA 3WLKX 4B9YA 3BO2A 2ZBRA 3AJ1A 3M0KA 1TMLA 5DXXA 3VNDA 2Y1JA 1FHTA 4E8DA 3H2NA 1OADA 3BB5A 4ILSA 3OB8A 1RT2A 3B4YA 2FZBA 4NLOA 2Y85A 1JJHA 3KOWA 2HRUA 2NUXA 2F40A 1E1FA 2J62A 1Q65A 4PWUA 3FSXA 1C9WA 4X63A 2V2VA 3UW1A 1S5NA 5K4XA 2FPTA 5BRQA 4E2VA 4HR2A 3A3XA 3WF0A 1CS4B 2MQMA 1F76A 3ETMA 3HB9A 1HXJA 3W0KA 3N73A 2WNNA 4MB3A 1U1OA 3CV1A 1IZJA 1E4IA 2BANB 4G1QA 3IJDA 4OZOA 1W9UA 4AWSA 3V2UC 4YS2A 3T2OA 3UCQA 4DX5A 4HGXA 5LNRA 3MZIA 3MI3A 3KUGA 4RV8A 5M3WA 2XH0A 5DFAA 3BDEA 2HQAA 3MSDA 1JLAB 2O92A 1GGOA 3TAMA 1VPXA 4JI2F 1G67A 2F38A 2FZDA 3BQ0A 3BREA 1ZJIA 3M1VB 5B08A 1UD8A 2D23A 2XMMA 3UWEA 2W66A 1TQLA 5G0RB 3BAKA 1S77D 5IT9U 3VIJA 4X4RA 2BHUA 3H2OA 2QUMA 4B5XA 3VAIA 1M7OA 4GMEA 2FZ8A 4N6EA 2ZDRA 3OGVA 5A6WA 4H4MA 2HNZA 3SCOA 2B6AA 1CLVA 1KLNA 3OODA 3W1XA 4NLSA 4CLFA 2R8IA 2D74B 4FVMA 4H6KA 4FLOA 1J12A 4PXBA 3AU2A 4ZPTR 2PDAA 4WGHA 3HKZD 3C8FA 1K4HA 2X0YA 3S8HA 3T07A 4D6JA 1RY0A 3TQEA 1H74A 1XLHA 1ZALA 4FZIA 2P8IA 4FX7A 1Q79A 1B4SA 3CUHA 1Q5YA 3R7NB 4OZ5A 2HS8A 2JDJA 1VLOA 3M6XA 4UOFA 2ZH5A 1UA1A 2RAGA 4IM4A 4M6UA 3KL3A 2DW7A 5DANA 2CZ5A 2OMAA 3GIMA 2EK6A 3DLEB 3KJFB 4JY8A 3TYZA 3CNQP 1WPCA 3DG3A 1UWUA 1YNYA 2NPIA 4FPIA 4UY85 3MY9A 3NAVA 5XIMA 5HO4A 4CNOA 4K4YA 1E5NA 1AG1O 1EOKA 1XW8A 2NR0A 3IR5B 4IPLA 3KG0A 1N8WA 1Q6FA 3WJWA 3RRAA 3EGNA 4EZ9A 2WJFA 1XNQJ 3FBBA 2J7CA 4R7WA 1WHXA 3S0CA 1U1PA 4GFSA 4Y9MA 1EA9C 1T11A 3GIIA 3IVTA 1YDNA 4PEEA 4I6YA 2NXIA 4FS2A 1R9XA 5FI8A 2RDTA 3QT5A 3BJTA 1HARA 3JZEA 4KERA 2OP5A 1JDDA 4LRCA 4MNMA 5EWGA 4L65A 2EKCA 1IR0A 2Z00A 3MCOA 2PWUA 2C2DA 1TPH1 5LA1A 2ZRZA 3EDQB 4DYJA 2Q3RA 3BGAA 3A8KA 3AYSA 5A6MA 2MQQA 1WCGA 5IWAJ 1VBRA 7ENLA 4GI9A 3LGEA 2GHVC 1F74A 4GGHA 1J6OA 1GONA 3WEZA 4S1FA 3P61A 5KMYA 1EX5A 1QPRA 3UZXA 2A3HA 4BFAA 1UZ4A 1LEOA 2ABYA 2POTA 4INFA 1U48A 4QQUA 2HE5A 1OPZA 4C9DA 3DRSA 4CWBA 5I6SA 4H19A 3QJLA 1K9DA 3W24A 1RQBA 4GBUA 2BRLA 1U1KA 1KQSR 4AZCB 2D2GA 1C90A 5C42A 1S9GB 4KEUA 5D03A 5G4WA 4CH0S 4GVBA 1SC4B 1Y10A 3QT6A 4WJBA 3NQ2A 3ANVA 1AODA 2PDWA 4Q22A 2CWNA 3T6BA 2YWEA 1XNQF 4ECUA 1LK5A 3FEYB 2VEIA 3WQ8A 1V8EA 5CC7A 4P2SA 2Q6CA 3UE2A 1XDJA 3PW4A 1BHNA 2UP1A 4O1EA 4OX9J 4RE0A 2HVHA 4UTKA 3L95X 2FZ9A 4HMCA 4NNAA 4YHGA 2CPEA 2J8FA 1NFBA 2J0XA 4UTGA 1ZP4A 3CMQA 1HD0A 2E1CA 2M9KA 4R53A 3B3DA 3ARVA 2E9RX 1IKXB 1KC8T 4OX9F 3CAKA 1R3VA 4B5WA 4ZFCA 4OT7A 2WZMA 2XZWA 3G6XA 4DJBA 4FALA 1M01A 1LRTA 1FQ0A 4BQ2A 4LAUA 3I4KA 3UWWA 1LTDA 3VGGA 4YR3A 2Z7KA 2XMUA 4DO6A 4EYHB 3AIWA 4ERDA 3DENA 4QSHA 1ISWA 1VQNS 3A5VA 3WX8A 2W9BB 3E0IA 1XGDA 2H9AA 2YWWA 3V35A 4DBSA 3PSVA 3LQGA 3U7VA 1LLWA 4F66A 5KFYA 1VI7A 1QJWA 4AAJA 1R8BA 3CJ4A 3I5CA 2YX0A 3VNZA 3RJMB 1EEPA 4ZVSB 5I79A 3ZZ1A 1PAUB 2VEMA 3B9OA 2LLZA 2VCBA 2XS2A 3CIVA 1SUQA 3PZPA 3K57A 1MZRA 3AMKA 4D71A 4CNTA 1GMWA 2ZE2B 3AFBA 2YR1A 3WX7A 1HL6A 1WACA 4KWSA 2Y3YA 1AH0A 2NQ5A 3FHQA 5JBDA 2GOKA 1TELA 4HL9A 2JKEA 2G0WA 2V3DA 3M7SA 3UXIA 4LUSA 3M8PB 4K37A 1IKXA 3NDYA 1XH1A 3CD0A 4DBQA 1VHFA 3PBWA 2VHLA 1ICSA 2DZTA 1AZ1A 4U7UD 4NXSA 2AP6A 4HH1A 4K7YA 2YPZA 1RTIA 4YHHJ 2CIMA 1PTGA 3CXOA 5CYQB 5J1EB 1DHKA 2E1WA 2HVNA 3NWRA 3SBFA 3WD1A 4RW4A 4JAWA 4NU7A 3FNDA 2WB5A 5A6BA 3I0RB 3QPIA 2FFIA 5I2UA 5C25B 2VX7A 1GKRA 2D3NA 2ZWYA 3WO8A 4LC8A 3R5AA 3RB4A 3QQCD 2BW2A 4RW6B 2RQMA 3FEZA 3BMVA 3PACA 3I6RA 3VA8A 5D3GA 3UCCA 4WXYA 1TPC1 2ACMA 5BR8F 2QA2A 1BKHA 5JXQA 3LH2S 1UR4A 5LMNJ 3ID7A 2WAQD 3NO3A 3MPUB 2FPYA 5EN1A 3ZNJ1 3VILA 5K4ZA 1C1CB 4I56A 2JOQA 2WZEA 2FVPA 4F3OA 3EOUA 4PRTA 2G96A 4G1KA 1U5JA 2FGBA 1E56A 4NKCA 1NDYA 1EIBA 4DN1A 1RAKA 4UIOA 1VIXA 3NGRA 2YWFA 5BJRA 3NPVA 1VHCA 4DLEA 1YHTA 5K9XA 3ZSSA 7PTDA 5BOOA 2I5GA 3TUZC 3KHDA 1NSPA 3SJ3A 2FTYA 3PW0A 3PAJA 2RRBA 3FQLA 3RU6A 2GVZA 2P2CB 4ZCLA 1A5SA 1IBMJ 1FNMA 1QUPA 1S48A 4JN8A 2B9XA 2M2BA 2NSOA 2ZE3A 3OL7A 1FWSA 4DWSC 1JXJA 3UY8A 1IUJA 1DL3A 1SH0A 4JI5J 3H24A 4L1WA 2Q8ZA 1FXLA 2BDPA 4NZ5A 2I6WA 2QE5A 1FESA 4IO9Q 4LAZA 5LJ3Y 1J96A 4FMVA 1WG1A 5I3QA 5K7JA 1BQGA 1Q0NA 4O0KA 3M0HA 3PK7A 3HSDA 4FZVA 1IXPA 3IO1A 4B17A 2ISFA 3DGVA 2ZC3A 4DR7J 2DHAA 3EB4A 4C97A 3N6QA 1J5SA 5RUBA 4ZVJA 3ITXA 2FJBB 1NWSA 3VXGA 3FGCB 4IIDA 4PUDA 2IA0A 4LY4A 4HD5A 2MZ1A 2BGSA 4AVFA 1KFSA 4A8FA 1EQCA 2YKOA 1PSCA 2ZX6A 2XB2D 2CLIA 4O0IA 1H2UX 3GTFA 1WKEA 1ME9A 1Z2ZA 3ECQA 2PP3A 2UU9J 4EPBC 2PPGA 5GJPA 2C2RA 1RVGA 2QN6B 3L4XA 2V2DA 1B1YA 3DLBA 4OHQA 1O0PA 1UKUA 2XN2A 1HL8A 1VGYA 1CXKA 1QDUB 1QY7A 4NZCA 2XVGA 3QY6A 4NRSA 4XTIA 4P7QA 2C3UA 1UC4A 4CI0B 4DX6A 2DBBA 1QOXA 3WBEA 3K58A 1V93A 1BE4A 4DSKA 1LV5A 3TK7A 3THCA 2L9WA 2LP4A 4Q7IA 1ZZFA 3UDLA 1ZYQA 2CJ9A 4Q4RA 4CQBA 2E0PA 4IGMA 1BSLA 2CPXA 2QDHA 3U1NA 3I9ZA 4HN4A 1SFLA 2B7OA 1AH3A 3FJLA 4CNUA 4JUZA 2EBNA 4HNNA 3GTIA 2OJ3A 4E5TA 3LCHA 2XH7A 2VPYB 5EL1A 4QDPA 5DY3A 2YL5A 4Z7YA 5M17A 4FVCA 3AXHA 1UW9A 3FSIA 1S5ZA 1BXNA 2R94A 3M5XA 2PLKA 3CDEA 2GJRA 3OXFA 1MMDA 1JYVA 1UFKA 5D37A 3TR2A 2POKA 3VAMA 3VCCA 2XZ9A 3SY5A 3F2BA 4CN4A 1VJZA 2HKEA 1X4DA 3QO9B 5K20B 4DFMA 5DT5A 2X1GA 3CM4A 2W62A 1TV3A 1FVQA 4ZLNA 2DT9A 4LV4A 2A1YA 4NAFB 1MW7A 4OYXA 2VPXB 5BW6A 4UUXA 4DM1A 2E6DA 4AY8A 2WSRA 1PIFA 2FGLA 1SJFA 1NAL1 4JNYA 2AKZA 3R0DA 2OWXA 3KJNB 1BWEA 2B7CB 4X4NA 4F25A 2DRBA 2AX0A 3BAIA 4OZNA 3JYTA 2R7RA 3FHAA 4I6KA 2PD9A 3C61A 2M88A 1TA3A 4R0EA 4GUFA 2IDEA 1T03A 2J9YA 3PM6A 1NPRA 1E70M 1XIHA 3MUXA 2BR0A 2V5HG 3CCES 5CAKA 1SSDA 1B31A 2PD1A 4P6QA 1AFJA 3MFIA 3C14B 4JXCA 2IJFA 4C6CA 2JBMA 4G1PA 2ZJPQ 4JI4J 4J9PA 2V63A 3QLHB 1GTHA 2SXLA 2TRSA 4DV7J 3HTWA 4ZVHA 1U2YA 4UC5A 3ZLHA 5ECVA 3TA0A 2VPZB 4XG1A 4ACYA 5H2ZA 1PKMA 3K8MA 1DJZA 1HHTP 4EO6A 2INZA 4DAIA 3SIZA 4HHPA 4HYRA 2ACYA 2CLMA 4PMQA 4TU7A 3N9RA 4ZJQA 2GX8A 2Z0GA 1OIMA 3CCQS 3Q58A 4UTJA 2VONA 2IQDA 1OK4A 5J2NA 1RGVA 1HNVA 5E3CA 3TARA 3PB2A 4M51A 5F1UA 4DB7A 1B90A 3DHUA 2JGQA 2NZLA 1VK3A 1Y9OA 3HM9A 2QYCA 3VVTA 1LBFA 3L9ZA 1R6WA 2FB0A 4Z2JA 4IIEA 1JB0C 1GNKA 1YJVA 3VTRA 3C66A 1PIIA 1DAXA 3LBCA 3R97A 4L3KA 3M44A 3HF3A 2CZVC 3BG3A 4ELUA 1YDLA 4H2HA 1M3UA 1P0KA 4WZQA 5TF0A 1K6WA 2Y8YA 3QAUA 2XFYA 5HSPA 2UY4A 4GPNA 4ATNA 1PTDA 4IPNB 1HX0A 1X97A 4LFAJ 3I0SB 2WANA 3OHIA 3WMBA 2UBPC 3VD4A 1AYEA 4IGHA 1NU5A 4W87A 1I2OA 1O12A 4PMVA 2NT1A 2F8MA 4H41A 3G1SA 4CLTA 5KFFA 4X3ZA 5AC6A 4KCTA 5EMMA 4H9UA 3W75A 2J47A 4JD4A 2FHFA 1V6TA 3KTCA 1JLFA 3NAIA 1EAYC 1LQ2A 1BRLB 1K0TA 5H91A 3OTBA 5DGBA 1WKKA 4I6VA 4DI9A 4DX8H 1CTNA 4JTUA 3GVGA 3SFWA 1ECEA 4I7FA 1IYXA 1F2HA 4GVGA 2WMFA 4DR3F 3PPHA 4QX4A 1U25A 1R86A 4FF3A 1ALDA 2WBRA 1ZNNA 4N7QA 3MMDA 2WVSA 3HJZA 3DIPA 3KP1A 1FA2A 3NZQA 2XUCA 3GQYA 3KLHA 2ZX5A 3UWUA 2WPBA 4GKTA 1F9EB 3EMTA 4MJZA 1FCBA 2E4TA 4JI2J 3B8TA 2PRLA 2C3OA 4RJEA 5B0FA 1LQ9A 2DVTA 2IKJA 3NVTA 1CJTB 3KJQB 2G2OA 5IWAF 2XIMA 3KLLA 3H26A 4NCAA 1I2NA 1XMOF 3ALFA 1IEIA 5G4HC 2MJNA 3SN0A 2BGNE 2IAJB 3LLFA 5I3PA 4CKQA 4LFCJ 4JEJA 1BQNA 4GJJA 1HBUA 2LQBA 4CRJA 2CDRB 4F0MA 1DWFM 4OKDA 1UR9A 3NWGA 4M5PA 2WSYA 5KFJA 2R82A 4ZB5A 3HPXA 4Q32A 1VCGA 2ZDPA 3M9NB 3OQ8A 1IWPA 1NP0A 1TP7A 3CF5Q 1MWOA 2ALRA 4IX2A 1KFEA 1RT5B 5AHFA 4Q8VA 2QCDA 4F4KA 3O63A 1N0UA 3QMQA 3FSTA 3Q8RB 3TX9A 2Y5EA 4Q2MA 1IM6A 3O8WA 3FVDA 8RUCA 4Z1BA 3E2RA 1C0TA 5DETA 2NVCA 2GIFA 3EZ5A 2O0TA 1IGWA 1HR0J 4NNCA 4DEFA 1P0DA 2IIHA 5E5NA 3TW6A 3TV8A 3COTA 4YYFA 1VBZA 1SV5A 4ICCX 3IM9A 2WVBA 3GTXA 3KRSA 1RYRA 5EX0A 1PYFA 5EWFA 2Q71A 1D8ZA 3G2XA 2XYPB 2QFJA 1GCYA 2VVSA 3CJRA 1T95A 4Y90A 2LLEA 1VFFA 5ETNA 3BQ1A 4OVXA 3SIPB 3IV8A 1UIOA 1PE1A 1AQFA 4USUA 3KWSA 3GZ7A 3CL8A 3WIVA 2PC6A 4XDDA 4DWSD 2EWHA 4WDWA 4DPTA 4N2YA 4QHRA 1K77A 2HSAA 3GY1A 1DXFA 1W5QA 3E0LA 2WC7A 2BY2A 2WW8A 1PKLA 3ZFVA 3GH7A 1UOZA 1IV8A 4TOQA 3BPWA 3S7RA 1NWRA 5DY2A 1F3XA 1OFQA 1GKQA 1XMOJ 1HQ2A 5HR7A 3A3WA 3LCXA 1H11A 1XLBA 2DGQA 2CHOA 2YXOA 3K8WA 5F41A 1EIXA 4KQZA 1RV8A 2HQDA 5HVGA 3D5HA 3ITTA 4QLJA 3S9IA 3DLGB 3M5ZA 2YNHB 4NT0A 2BBFA 1IQTA 1JXLA 3CWNA 2WCAA 4P8UA 2BJ1A 1XFCA 1TMHA 1MW0A 2XFFA 4C1KA 5DLGA 2FD2A 5A6PA 1X5OA 2PI6A 3TZYA 3VZXA 3W2VA 2PA3A 1KWKA 5FJJA 3NQMA 4FX8A 1Q45A 1FVSA 2H3DA 1R8CA 3CS2A 2WM0A 2CQ3A 3M0ZA 2B43A 1EZWA 3R8RA 1UWBA 2FTPA 2IYGA 3IR7B 4CM0A 3WH5A 2HG4A 2O66A 5CBBA 2OFJA 3ARPA 1ZPTA 3LGMA 4LCRA 2CIPA 3TQ0A 5D78A 1TMJA 1ZENA 2NVDA 3Q8UA 3LGDA 1AW2A 3MVIA 2D3ZA 2WMJA 4ZN3A 4F3QA 2UY5A 3TAMB 4RW8B 3R12A 3IBWA 3MMCA 4NRUA 3KK1B 4K2XA 5CAHA 2BV3A 1Y0HA 2D9OA 3OW2R 3PR4A 5FLXY 2WQPA 3W2WB 2Y5SA 3TSDA 2VZOA 2ZWPA 1RWNB 4O1BA 4LW7A 2GUBA 2VQFJ 2AGKA 3PJXA 4Q8NA 4I7FB 2V2ZA 2IY5B 4UZUA 1BGAA 1OYCA 4AHPA 3ZTOA 4PTXA 3QRPA 3N2XA 4XUYA 2XQCA 1O95A 3E3HA 3TZFA 1UP1A 4MT1A 4DJFD 4DUYJ 1YXCA 2CLPA 4HTBA 4LYRA 4ZE4A 4F48A 4BHQA 2QRRA 4ITSA 5D0HA 2R6OA 5CLWA 5GNYA 4FOJA 4IJBA 1OIAA 3ZJ7A 1TX2A 3W53A 4HMNA 3L5LA 4H00A 2FJDB 5FF0A 3GJSB 3CC7S 1JD9A 5EKYA 4IFKB 4YB5A 4W8BA 5CGQA 3BJFA 4U28A 1B3WA 3CJKA 2FPVA 1FDDA 2VU5A 5AOUA 3P3DA 5CLTA 5SUHA 2ZRVA 1OYAA 1WHWA 2CPDA 3BAYA 1CC7A 4NA3A 4CH1A 2FDSA 3VIGA 3H2UB 1VCFA 2V0TA 3EWBX 4PODA 3WLNA 3BBFA 3OVRA 2WO5A 1FH9A 5LXEA 4MWAA 2PMQA 1U6BA 2B9WA 1G7UA 2BOFX 3QSTA 5KFIA 4CT9A 2RGMA 3M30A 4F4XA 2NXUA 3UVAA 2VL4A 2C8NA 1FWKA 1K9MT 3GW3A 2BTMA 4W7VA 3S5SA 3O6CA 3AYVA 3RO8A 5IC4B 1Q78A 3IAPA 2DP3A 4C0BA 3P8IA 3GKAA 2R7SA 1W6TA 2A4AA 4XB3A 1R9YA 3VAFA 3BOFA 4CLYA 3THAA 2AL1A 2LA4A 3D9BA 1W0MA 3QGHA 2HBXA 2QFIA 3CJQA 2ILZA 2OTJS 1KNZA 5I3UB 1XUUA 1XYMA 2GFTA 1JVNA 2ACUA 3M6UA 3A21A 4DUZJ 2OLAA 3C4UA 4F67A 1G69A 4OBTA 1T9VA 3OHBA 3DI1A 1HWKA 2VR2A 3EGWB 2FIUA 4HZ6A 5DCEA 3L5AA 1TTJA 2AQOA 1X4EA 3VKJA 2ZUWA 3PAOA 4AYGA 1P4CA 2VCCA 2WBKA 2GMJA 3M8ZA 4RPPA 4RWXA 2QIWA 4U3CA 4QS5A 4BEQA 5E3PA 5F0UA 1EGMA 2X7WA 3MSRA 1YJ9S 3QJAA 3BV4A 3TDFA 5JH2A 4HPXA 1E6PA 2X1TA 4REQB 8XIAA 1HWLA 4HA4A 1Q8LA 2HMIA 4MIAA 4HSOA 3WD2A 3V5OA 2VD8A 1T8QA 4AQYF 2D22A 4AXKA 2QLXA 4S38A 3KK3B 1WKDA 3N3MA 4I5RA 1KCLA 1VC5A 4DLFA 3RX2A 4EBDA 3OFFA 2KXHA 1M03A 2Y1LB 1C2PA 5LNWA 4J90A 2YCEA 1V3LA 1RTZA 2J27A 2MANA 4IGSA 2DEIA 4KCVA 3CZ8A 4GXWA 4HZ7A 1UIPA 1LOUA 5IT4A 1Q6CA 1X1OA 3VGTA 1IBMF 2DSKA 4GC3A 2VFUA 2LDYA 5EMUA 4NJJA 4U33A 4JQ3A 1A0OB 2ADAA 1YJ7A 5C9UA 1YIXA 4D2JA 5H9FJ 2QVHA 4M82A 2ADCA 1RKJA 3BLPX 3CCRS 4A3QA 2EQDA 3WF4A 4WKHA 2QSWA 2BHZA 4AY1A 3GH5A 5HINA 1KBJA 1JLCB 1GVEA 1J0IA 4C8KA 4FA3A 2RS2A 3VOCA 3EPIA 3CV2A 3TZZA 1XINA 3EOEA 2YCJA 2ZC4A 1LUCB 4QIUA 2Z1KA 4AW7A 5E1QA 1P43A 2Z2LA 1E9YB 3PW2A 4BF5A 1R3NA 1SVDA 5A8MA 3QZEA 4Y00A 4K36A 5C42B 2YBUA 2J9EA 3NO5A 3KKFA 2Y1HA 1Q5MA 1L8PA 5AHNA 4ZCMA 2BA9A 2G0CA 1BUXA 2E09A 3VGDA 2Z27A 3UJ2A 3M30B 1V3RA 2ABAA 4RZBA 4F2TA 4MK9A 4AEEA 3IGSA 1WEYA 2HBQB 1IBLF 1N5VA 2W67A 4DFKA 4H4KA 3CT7A 3V81B 4P8VA 1CVJA 1NK7A 2BX7A 5LGXA 3A8IA 4PL2A 4QXIA 5CKSA 2DR7A 1Z89A 2B7BB 1O5XA 4J37A 3WBZA 3GP9A 4DN9A 2RS8A 2WJDA 3D6HB 2FPHX 4KGZB 2ISSA 5GQBA 3UT0A 2YLLA 5T7LA 4A21A 2J9ZA 3L0GA 4TY8B 3Q23A 1RA5A 2E6AA 3QGKC 4URIA 3MPVA 3ZTRA 4IMCA 2FLIA 3HFTA 1E15A 3RRKA 2C14A 1G9HA 3EICA 3FGCA 1JLAA 1PKNA 1S7IA 5DBTA 3MPYA 2XSXA 3BN7A 2VPWB 3DDNA 3U5YA 2WNQA 5LT5A 4LF8F 1FHVA 4PUMA 5A8OA 1QMLA 3A24A 2EFOA 3BGFA 3WQWA 1EX1A 2BE2B 2C1EB 3QMTA 5KG7A 3KCJA 4M6VA 4NJGA 4P71A 3K46A 2E5LJ 2QPSA 4JY9A 2HLUA 2VDGA 1KBKA 1YEYA 3OTCA 3ZZZA 1GMVA 5HI7A 2Q09A 2YOCA 3WF3A 1UD3A 3I10A 3MYPA 3W7QA 5BYWA 7XIMA 3AUOA 1Q7LB 3URQA 4IOAQ 3H59A 2PMWA 1X7IA 4ACZA 3OG3A 1OINA 2JZ5A 4CTAB 1NJXA 2EG7A 2J24A 2RDUA 4WFXA 3VM7A 3UNTA 2J5AA 1VPYA 1M5HA 3GLJA 4ETZA 2CHNA 2AJ2A 4KGVB 3ARWA 3WHIA 1LOLA 4FNPA 3A9BA 4PRRA 1XK8A 2CETA 5KSWA 3QF0A 1DE6A 2CBJA 3A1YG 4F2UA 4PUWA 1MEWA 1S1UA 3ETOA 1N32F 4A3YA 2BSLA 2E1DA 1BY9A 4PQUB 1QOQA 1CULA 4K39A 3UETA 3S2JA 2BNJA 1UP0A 2I5IA 4HJWA 4QBUA 4B3SF 3WEOA 4PXDA 2I0XA 1NOWA 4OV4A 2FJAB 4UMCA 4YVXA 2IA6A 5D3GB 3DLGA 3IMQJ 5ABEA 1WC3A 2EFNA 4C6KA 5EUHA 3VIKA 3ZR5A 2PE4A 3MUY1 2VEPA 1U09A 1W1PA 2PBOA 3P5ZA 4B9ZA 4N77A 3VNYA 3B4DA 1WZLA 1VFOA 4FLRA 4NMXA 2OTLS 2W2PP 4ZVRB 1GPFA 8TIMA 3THQA 1RQHA 3D6FB 2Z4PA 3KDOA 3PFRA 1VIOA 1JCXA 2FTWA 3TYAA 1YJRA 2V6AA 1VPQA 4K38A 4DOZA 1YXDA 4ML9A 3LN3A 4J9RA 2CPJA 4D1JA 5AYIA 2KH9A 1S5MA 4C6IA 3MDUA 3ARSA 4J7RA 3NQEA 3W9HA 1GHRA 3FN9A 3OYZA 4XZMX 1BYAA 5AB3A 1TL3B 3AOAA 3NBPA 1TL1B 2A3LA 3N11A 4I9AA 3RPDA 1FFGB 1XSJA 1QAXA 1WOPA 4H54A 3GXIA 4C7FA 3WJYA 3EWWA 1GAOA 1LWEB 3F2DA 1SGJA 2I9EA 4YPJA 4C6BA 2YH0A 2QDGA 4DYEA 1D8WA 3AZSA 2ZD1B 1LLZA 2W01A 2JF7A 5G1TA 1XKYA 2WLZA 3SAZA 2CJBA 3NEKA 4DV2J 3E0FA 3CK5A 4ECVA 1TR0A 5E2QA 1JLEA 2QL7B 4Z08A 4L56A 4RNJA 5ABFA 3HZEA 1YADA 4LF1A 4MB5A 3N6JA 4P7LA 4ICMA 1HI0P 5IQQA 1MQRA 4B3MF 3ZZTA 2ZWZA 1H41A 3KW3A 4PPZA 2TYSA 2FHJD 1LORA 1XH0A 3G8TA 4YLWA 2Z2UA 2ZBPA 3TTEA 4H2CA 4O16A 4UOQA 1QPKA 1QE1A 4HH0A 1RAOA 1OD8A 3RAMA 4LVFA 1XD1A 1LW2B 3WY1A 4DPUA 4EFAC 1X1ZA 1ZM3A 3VR1A 2VG6A 5D2XA 4TLRA 4ID5A 4FF2A 3NPXA 1XFBA 1GVFA 4C6OA 3D0CA 1SKRA 4UB9A 2OFHX 3ONCA 1EO5A 1V79A 1BAGA 1BVWA 3UQNA 2QA4G 5LMUF 3PTMA 4CZCA 1QD1A 1VFLA 1S2CA 3IAQA 1EGZA 4DNMA 4K8EA 3WLTA 4OI6A 4ELVA 1JCYA 4K1WA 4UOJA 3E38A 3AZRA 4FEZA 3FX4A 2XJ7A 3GV5B 3NGFA 2PCEA 3D2WA 2EPIA 1SJ3P 1RCOB 5HQMA 2OMLA 2RHQB 2YDAA 3OQEA 1W8GA 2RFGA 4V1XA 5E0FA 2E7VA 2ZHAA 1G94A 1W2PA 4WPAA 2E3ZA 4LBPA 1H2JA 1WC4A 3FC9A 2RHSB 5CYMA 4TLQA 1JQVA 3M41A 2LQ8A 4JTGA 1XSIA 2VFHA 3W64A 3WN6A 1NM2A 3FOKA 5AXNA 2MGZA 4EWJA 2DFAA 3RDKA 4J7CA 5EMJA 3N29A 1HW6A 1C29A 3GHSA 2VZ9A 3HG2A 3WK2A 4XZHA 2HS4A 2VV5A 3MR2A 4XKMA 3A4XA 1N36J 4J5OA 3LTPA 2DT2A 2ASHA 3LXCA 5LXRA 2BDQA 3W7PA 2H90A 3VQSA 3MBDA 2ZOXA 2E7FA 2VQEJ 4DL0C 4V1Ak 3QGPA 1V0MA 2YPYA 4HVZA 3D6MB 4HZ8A 3PO4A 2DU2A 3K4AA 4YYCA 1EC8A 2UY3A 3VPLA 1VFHA 3B8WA 1LL6A 5KG0A 4O53A 5CSUA 2H5IB 2H65B 1TFVA 3TYUA 4AXJA 5LMNF 3LWMA 1H1YA 1XRFA 1RP8A 1ITXA 1W3TA 3UERA 2WONB 3ISZA 5GPRA 4OIXA 1ZBVA 4DM2A 1S6PA 3LUYA 1AJ2A 1BHGA 3TA9A 3GH4A 3UD4P 3PV8A 2O67A 4IQDA 1XLKA 3NGKA 1TKDA 1RA0A 3ILOA 3LALA 3HHLA 2AAAA 1O68A 2QXWA 5A8GA 4QIGA 3GSDA 2KFZA 3NZGA 2DSWA 4ES2A 4B2DA 3GNNA 1H2TZ 2FTRA 2E5CA 4MKBA 4MZ8A 3UPWA 4K7QA 1VMBA 3UF9A 2KI2A 3KHLA 4NXNJ 1U1LA 3QY7A 3LHWA 1O51A 3E2QA 4TV6A 5KEZA 2VP8A 1H62A 3V1PA 5THWA 3EDFA 2B9YA 2GHPA 3B0XA 3CJ5A 3R7MA 5HK4A 2Q01A 1NK5A 4GC4A 1M1GA 4AU0A 4OQVA 1G5AA 2GQ3A 4JTAA 4RBTA 3LO3A 2ZITA 4GKJF 4DZHA 2ZH4A 1UH2A 3QV9A 4LSNB 4YTQA 4FHAA 2ZIDA 2QO3A 3Q86A 2ZZMA 3MB9A 4MM1A 2Z26A 1FA0A 1FRBA 1HFBA 5G2IA 4OYIA 4U8YA 2VGGA 1JJ4A 4HK5A 2PA6A 3K17A 4KYZA 5IXUA 1L3UA 2W9AA 2E5IA 1N36F 2J6UA 4OZ0A 3SCUA 1FT8A 3TC3A 4N7TA 5DG8A 4X62J 3SQGB 1H7RA 3T9NA 3JUGA 3K1DA 2V5KA 1PIEA 3V3WA 2V8HA 4F4WA 4CM2A 1OFAA 1HHQA 2RDWA 4FIRA 3QYQA 2L5HA 1W3KA 2IXUA 1NJJA 7REQB 2DNOA 4NLTA 2X51A 2A3CA 2J76E 4CQCA 2KM8B 1GW1A 1IKYB 4P7NA 3PCOB 5DDPC 4X60A 1R43A 4GNJA 3X1LB 4MF4A 1LWFA 2CQBA 1JYXA 1NK6A 5CD4A 2V4JB 1GOQA 3ITCA 3SN1A 4LSNA 4B9UA 3KNGA 3NL2A 1C3FA 4JTRA 5K8OA 1HD1A 1SR9A 3GYCA 5FEXA 4MFBB 3IK4A 1EJXC 4J5NA 1NLKL 3PIOQ 6REQB 3PIPQ 1OF6A 2VG7B 3SM0A 4ZVPB 1IEVA 4OZ3A 4DR7F 1P9QC 4KEVA 1L8NA 3WBWA 1GVIA 1RHKB 1VD6A 2LEPA 5D8WA 1CGUA 2P88A 3CH9A 4LAOA 3IAM9 3K7RA 1O5RA 3CL7A 3W00A 3ARRA 1S5TA 4W8AA 3KLEB 4OJYA 3HHLD 4NXNF 2VH7A 4M5NA 4CLSA 1PYSB 3VKCA 4UQTA 1S0VA 2PGRA 1WZMA 1PL9A 3ZOAA 1ISZA 3HHNB 4WD0A 4N4PA 1SPBP 4X65F 2JEPA 3QZAA 1OJ4A 1QSLA 5HMEA 3W38A 3W1QA 1BD6A 3IANA 4FKYA 1B3ZA 1I6JA 3P45B 1DJGA 1A5CA 3UFCX 1TUFA 4PMOA 1KP6A 3NGTA 2CQPA 2QTWA 5FACA 3URBA 3NXLA 3S8SA 2AOSA 4JIHA 1H2VZ 3PX6A 2IM3A 3TZXA 2E44A 2BOPA 3H4BA 3AO0A 2A21A 3DXSX 5CGTA 4PUEA 4BI5A 2O3DA 2ATCB 4WK3A 3C15B 1CPZA 1FERA 4RW4B 4PN2A 2IVYA 4G1IA 5A2QU 3IIPA 1TWDA 2VKRA 3HGJA 4Q8EA 1QI0A 3JSMB 3SRHA 1IT8A 4RZ6A 5E0KA 2LEAA 1NH7A 4Y2WA 3HQOA 7A3HA 4CD4A 4Y96A 4YN5A 4YP3A 4NASA 5LIYX 2NPFA 2YCIX 4RDYA 3AWNA 1TREA 3OA5A 4GI6A 1FJCA 1VFSA 3POCA 3RFAA 1HHSA 4C7QA 2UU9F 4YU1A 2NWSA 4ZPAA 4N41A 2HHWA 4ZJOA 4X4TA 3R8YA 1TK0A 4ZVQB 3GWCA 2XWEA 2CJYB 4LYKA 3T1GA 4QWCA 1CJKB 1KDNA 1PSDA 4Q45A 1QM9A 2DISA 5DZ7A 1GOWA 1RHJB 5AJ3J 1AUDA 4QJ5B 3DESA 4ATLA 4XTTA 4I7VA 4XO7A 4P7TA 1AW0A 3N18A 3LMYA 2QMWA 3CZGA 1WUFA 4X65J 1PO6A 2HK2A 1IT7A 2HJPA 5AHEA 5EGRA 1VBYA 1GWJA 4JZ5A 3HFYA 4Y6GA 4QS6A 5JIPA 4IP4A 4LF7F 1MEHA 4DV1J 3VKAA 1UMJA 4KHPJ 3PZVA 2DDXA 4ZPCA 1CGXA 5CC3A 5TD4A 2WKJA 2BZNA 3R5GA 1OEPA 4ICLA 2H3EB 1BLUA 2ZKUA 1XX1A 1EX8A 5HLFB 1V5XA 2BLEA 3Q94A 3MECA 2DHHA 3IN5A 3BDKA 1H4PA 5C2XA 5FOOA 2HFNA 1W3HA 3H54A 2YKMA 3MEDA 4AXIA 4AZHA 4P2VA 2ADBA 5T9CE 1KRBC 5HANA 2CNLB 4Q3MA 4BQ3A 3S6EA 3KLIB 1GT8A 2D73A 1HMVB 3UPFA 4FDFA 3CDBA 3MZNA 1WX0A 2PFDA 4A4JA 4HT5A 1N6QA 4ADSA 4ZTXA 2PDUA 4EE9A 3FMWA 2CKRA 2DB1A 3E6EA 1FHLA 2CYGA 1RK5A 3UG8A 1HI8A 3PBMA 3MSGA 4CO0A 4C2MA 3PPCA 4QCEA 3R1HA 3HHKA 3MWAA 3RM8A 2NLYA 3QJPA 5HMZA 1J01A 1YLVA 1OABA 4A8XA 3HV8A 4B5TA 3VIFA 1H7PA 5ABFB 3TIMA 4IICA 2HEKA 3ZTSA 5KAKA 1YQ2A 5HJYA 4USMA 4DNHA 4R27A 3NZPA 3DECA 2BXZA 4FOUA 5G4EA 4J9UE 4NI3A 1LG2A 3H7RA 1V9OA 1S6QB 1A5UA 1KFBA 3M2RA 3FSYA 3P2VA 3KVLA 4HTJA 4J40A 5KZ6A 4XAGA 4EPEC 4KF1A 3UYCA 1H0HB 4QITA 3LBOA 2H54B 3CULA 1Y3KA 3GC2A 1Q63A 1J5OA 3R7SB 1C91A 3QIDA 1T05B 4TX6A 1SO3A 3G1XA 2GJFA 4IOCQ 1HT6A 4ZCWA 2FYXA 1W1A1 4RE3A 2VWTA 1W26A 3RITA 3EGVA 1ISYA 3CT9A 1Z44A 1M5VC 1O1ZA 4DL2A 2H4WB 3JSRA 1IHIA 3WQOA 4P52A 4IMGA 5L9FA 4UNKA 3CB3A 5GAEU 3ABZA 3ZZPA 4MPKA 3VGFA 2EC0A 3KK1A 5LIKX 4A8NA 1YE6A 4PCFA 4TQSA 4HI2A 2PDXA 5BZAA 2Y70A 2NX3A 2YL9A 4Y9PA 3EVOA 4CVWA 4IMFA 4YWIA 3TN3A 4UTTC 3LRMA 1OYBA 3GO2A 3LA0A 2JJ4D 1TVRA 3AXKA 4LUTA 4HOWA 1ZAWA 1K6AA 4U96A 2ASLA 2WSPA 4H7CA 1AQ0A 3F0NA 3GG7A 1W5OA 3L7UA 4HP5A 4GVBB 2EJ1A 5MAOA 4F02A 4B9MA 3NSMA 3E3XA 2H6RA 3QWPA 1KR0A 1SH2A 2QLWA 1B4EA 3A3NB 2A6MA 4LAKA 3V0TA 3VCRA 2HK1A 1OWXA 3CAVA 5HNUA 4X2PA 2E5JA 3IJLA 3SJNA 1RY8A 1P6BA 1B99A 1SMDA 1RAJA 3TWZA 3PVFA 1F2GA 3M0JA 4CYUA 1FE4A 4YFUA 1E0TA 1KM5A 3FDKA 2ZXAA 1TVRB 4RU9A 4S3AA 5A0YA 4JV5F 4PEKA 4CCEA 3SEPA 2BY1A 3RAQA 2G41A 4LF9J 1X6LA 4JN6A 2VG5A 1PDYA 3OJSA 1LWJA 4WK9A 4OHXA 3CHVA 1E6YB 4NY2A 4EK2A 3JAMY 3KK2A 2F1FA 1Q13A 2XIOA 4H7ZA 3BH4A 3G8EA 2F6XA 3U9IA 3KLHB 4QSFA 2GNKA 3QVQA 1R3WA 2MZQA 2OPPA 1YHQS 1E3XA 1QK2A 4I90A 1Y5XA 2O4QA 4V28A 5FESA 4WBFA 4AZIA 3NRBA 3C2VA 4NRTA 1TKXA 1K47A 2AYBA 1WF1A 2XEXA 1EPXA 2KT3A 4A8WA 3P5TL 1HVQA 3EX4A 3IWNC 3UWVA 3KWXA 2P0OA 1CYGA 2R8JA 3EYPA 4AHOA 4ED4A 2FJWA 3HU7A 1YE4A 1NXIA 2R7TA 4P73A 4FPRA 3EX7B 5A8KB 1BC6A 5A8WA 5D2WA 3DOKB 2IVMA 2CZDA 1CS4A 4O3QA 1KM1A 3APGA 1UZHA 3T09A 5C54A 4PUJA 3JS9A 2J0WA 2WM1A 2BANA 2RH9A 4YHEA 1G7CB 1Z8AA 3F5JA 1YJNS 1K7FA 3DN9A 3M1ZA 4GY1A 3FEXB 1WF0A 5L1KA 1ESWA 3N9SA 5G2HA 3C56A 5KG1A 2IM0A 4UOZA 3DHWC 5FAJA 1UJQA 1QBBA 2FVLA 3CQ0A 4KTQA 1YBQA 3WNLA 2X3GA 5KFSA 1RCQA 4DJED 1A50A 2OXNA 5A76A 4CVUA 4AFYA 2Y1IA 3D5MA 2JLGA 1S2VA 2EG2A 2VQEF 1XPYA 3BOXA 3K30A 4E6MA 3VIMA 5FIIA 3QJJA 2PWDA 5FD0A 1I51B 2ZUVA 4C7GA 1RB0A 3LQVA 5DMNA 3U8GA 1W7WA 2BABA 3DC8A 3UG3A 4HNTA 5CAAA 2F63A 1FWHC 4K7VA 2P9CA 1YLXA 2U2FA 3NOEA 2ZZTA 3YPIA 2VZSA 3O15A 3BBBA 2Q8LA 4WP8A 4X66J 4BF9A 1HNYA 4NLWA 4RUHA 3NQ7A 4L76A 3QR0A 4B3LA 2XZTB 4W89A 4OFCA 4OU1A 2ZBTA 2PTXA 1NSKL 3LANA 4PBEA 2RRAA 2FC9A 1A5MC 1FWWA 1RP5A 1TUWA 4GLEA 1T02A 3QIPA 3CUFA 3SV4A 4YUDA 1TPWA 2QDEA 4L5ZA 1GK8A 2QPXA 5M03A 4B3RF 3LA4A 2O9TA 4LS2A 4U67Q 1QSSA 2FHCA 2PGFA 4OYOA 1IKVA 3WMSA 1MI3A 4QQBA 4N56A 2ZZ2A 3KZPA 2PTYA 3BLDA 5EFDA 4K4VA 3DXIA 1XJBA 1K7XA 1HKJA 2WCGA 1UB3A 2NWRA 5EMYA 3H7UA 3T5KA 2WVVA 2YKQA 4H9ZA 1SIZA 4ED3A 2QJHA 4C3MA 2FLPA 4E2OA 2XSBA 3RB0A 2IW0A 4DXLA 2DH8A 3N28A 3KOFA 3C3LA 3AIBA 3PKYA 1X8CA 4JI7F 3AJDA 1XBWA 3O07A 1RAHB 3S42A 3UXLA 3PUEA 2OSQA 5F2LA 1N52B 4A8OA 1SC6A 1S1XB 1QOPA 3KMSA 2Z24A 2YW3A 3LF0A 1I3OB 1W1B1 1S4FA 4GC7A 2YFNA 4XPEA 2W2NP 3VALA 1OK6A 1FFRA 4A29A 4I2QB 3DHDA 3BWWA 3G1AA 4AD0A 3GXPA 5KG5A 2DJLA 5A6LA 3K59A 1E0XA 3B03A 3KTSA 4M1BA 3O3LA 2AYEA 2VG6B 2YNFB 3AQUA 3U57A 3IBFB 4LSLB 5KT4A 2HLTA 2P1FA 4AC1X 3BARA 4L4LA 1X4HA 3L4VA 4GUJA 4LIRA 1DQAA 5F2IA 4KT0C 4WDXA 2C0AA 5DMLA 2G3NA 3PHAA 1W5PA 2HCVA 2ZDSA 1HYSA 5AHIA 5IHSA 4B3RJ 3SB0A 3M0XA 4NIRA 5ECUA 3WX4A 1IT0A 4ORMA 5BR8J 3TO8A 2C7FA 2GDVA 4YB7A 3KUMA 3GSMA 1DTQA 2EPMX 3K5XA 4A35A 1EC7A 3ZVHA 3W7CA 3TR5A 1VHIA 3NZRA 3WNMA 1YGYA 1J10A 4OYAA 1REGX 1IEWA 2G3MA 3TAKA 5J5RA 5JU6A 2ZD1A 4IFKA 2Q8XA 1JDCA 4G56A 5AXKA 4F8RA 3MUTP 1MROA 4JICA 4PTMA 3P8BB 4LBHA 2QCHA 2UV8A 5LSRA 1WNEA 3KWMA 4MMWA 3GAKA 2V30A 5DBUA 4KR0B 1R9ZA 3E2SA 2E67A 2XC9A 3NR0A 3T5HA 5C6MA 2H3BA 4WSJA 4NYZA 3EOLA 3B8VA 4JX5A 2VQUA 1ZAXA 1FRMA 3AA8A 3USBA 3AJ7A 2CZFA 3JR2A 2GLKA 4QYZJ 5FDLB 3O6DA 1S4EA 1GG0A 2VGIA 3BVJA 4E4UA 1MLAA 1X4GA 2QUTA 4PMXA 4JI5F 1KR4A 1WUEA 4AH7A 1TJPA 3EGJA 3AISA 4PB4A 5LHFA 1HQEA 3AXXA 2KT5A 1MW1A 3N6MA 4MGGA 5JUVA 2BJEA 2XZDB 1WTFA 4O4RA 1PGZA 4DV5F 4V2XA 3B0VC 4UUIA 4DUZF 1U4BA 2MQNA 4J27A 3D0IE 4GH1A 4CD6A 1NJYA 5D05A 3KYLA 3B54A 5D15A 1V3SA 2IDLA 1N4LA 3S4TA 3DZ1A 4F40A 3G87A 4GFIA 1GYMA 4MTVA 5EA9A 1VQ9S 2I5JA 5KZDA 3AZTA 4ILLA 4G3IA 3P5YA 2E25A 1VFJA 1VRDA 2LEBA 1FWFC 3SRKA 3ABQA 5D09A 1S1VB 1ZH5A 4H1ZA 1VENA 6XIMA 2IHR1 2GIQA 2R1MA 4XAKA 4B2DD 3TX0A 3JS3A 2G4FA 2X0HA 3VKBA 1IEQA 4EEYA 3BG5A 4ZVGA 3OGSA 3QZ7A 2YL6A 3DC0A 2V68A 4ES3A 4JYAJ 2BZ2A 3OTDA 2QCEA 1LNQA 5GJNA 2ZH8A 4C6LA 4FK9A 5C25A 1UCWA 2CPHA 4OQJA 2I38A 1P6TA 1KV8A 1F9HA 4LOCA 2K8GA 3ICLA 2V5BA 3GXDA 1J2WA 1QUMA 1LJYA 3DOMB 3CJTA 3S2MA 1XRTA 2WVDA 1RJRA 4KIAA 3F4NA 2P5VA 3WLHA 4AF0B 1QAYA 1C7TA 1I2QA 1PHWA 5GAGI 3R58A 1JIBA 2XG9A 5EHHA 2DQXA 5KOWA 5D6GA 1WG4A 1SO5A 2XU2A 1JMTA 2IKIA 1DVJA 2VICA 1ITCA 3W1LA 1VJWA 2VFIA 3OLAA 1F4HA 2BV9A 1HJXA 5KFQA 3E74A 1CIUA 3FJ4A 4L4PA 5HWJA 3K2GA 2QAPA 2C2NA 2QW5A 3G2GA 2Q3PA 5EMKA 3NXZA 5KFDA 4WGXA 4DF2A 4D6CA 2HAIA 4QROA 1CGYA 4D6GA 3TJ4A 4IJCA 3PY8A 1RZMA 4EYIB 3IRXA 4LIWA 4XK8C 2WSQA 3NL5A 3WIJA 3WL1A 1AZ2A 3O6AA 2AGQA 3SUWA 2JKAA 4XZNX 5DQIA 4GH3A 1EYWA 3BAXA 1GFWB 3BR9A 3CPWR 3H25A 1MDRA 1O8BA 2FGZA 5M1TA 1TKTB 2HNYB 2XMAA 2BG5A 2CLEA 3EMCA 3CO0P 1J0YA 5KETA 1KKHA 5K3VA 4EP8C 4Y34A 3OZYA 4NJKA 1TL7B 4AY7A 3ZJKA 3B8DA 1FH7A 2XWXA 1NKBA 1YNPA 3M07A 1PYTA 5AJ3F 3QV6A 1A80A 2WSCC 3VE7A 2YJQA 2O1PA 1XBYA 1IQ8A