3KDNA

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
437
structure length
436
Chain Sequence
IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
publication title Structure-based catalytic optimization of a type III Rubisco from a hyperthermophile
pubmed doi rcsb
source organism Thermococcus kodakaraensis
total genus 142
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3kdnA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3kdnA01
1IR2A 1RBOB 1AUSL 1UPMB 2V67A 1UZDA 5HJXA 5C2CA 1AA1B 1RLDA 2D69A 3ZXWA 4LF2A 2YBVA 5HK4A 3A13A 2V63A 1WDDA 2V6AA 4F0HA 3AXMA 3RG6A 1TELA 1SVDA 4HHHA 2CWXA 5HQLA 1UWAA 5C2GA 1RBAA 2V68A 1IWAA 1RLCL 1UZHA 8RUCA 3RUBL 5RUBA 3QFWA 1IR1A 1GEHA 1EJ7L 1BWVA 3WQPA 5HQMA 1BXNA 4RUBA 1RUSA 1RCOB 2VDIA 5HANA 4NASA 9RUBA 3KDNA 4F0MA 2OEJA 1RCXB 5HATA 3FK4A 2QYGA 4LF1A 2OEMA 3AXKA 1RXOB 1GK8A 1UPPA 2CXEA 4MKVA 1UW9A 3KDOA 1RBLA 3A12A 5HJYA 2OEKA 2VDHA 2RUSA 5HAOA 3NWRA 1RSCA 4F0KA 2ZVIA 2V69A 2OELA 1YKWA
chains in the Genus database with same CATH superfamily
1IV8A 3W1TA 1MUCA 1M1KT 1OF6A 5HMEA 3H26A 3EE3A 4ATWA 3CHCA 2N7YA 2R2TA 1UMJA 4CWBA 3BCFA 5C0QA 2AL2A 3R10A 5K2ZA 1OSCA 5LT5A 3L23A 4HN4A 2MKKA 1GOKA 3T9ZA 2DHGA 2MSSA 4PPDA 1U1MA 3IG1B 2E9BA 2AMGA 5KZDA 2GGIA 1M0SA 2HDJA 2EEYA 1TWZA 2PDIA 2EPIA 1HNZJ 1REGX 3DENA 2JQXA 1TU0B 3OVQA 3AXMA 1FWDC 3F0NA 3N4AA 3UJEA 4DR6F 4Q8MA 3KMQA 3BKTA 1OADA 4GIEA 5AXKA 1LFWA 3CCZA 2UZAA 4IX0A 2HHSA 1RV8A 3P80A 4N7QA 1MEWA 2I5JA 5HQLA 3HPOA 4KWWA 4U96A 3VGVA 1E6PA 1VQ8S 4M5GA 2C28A 5C70A 1XISA 4X9SA 2W4DA 1GVEA 1ZTVA 2I7GA 3CBWA 1VR6A 5ENLA 3UR8A 4HEA9 1V7YA 3MDWA 5IC6B 3FSUA 3QY8A 3G0SA 1N36F 4IFRA 3KHDA 3PNUA 3KBJA 3AS2A 2D2HA 3U1MA 4K4WA 3ITHB 3A47A 2BV3A 2OIHA 3H2CA 1MZHA 2M3DA 1B4EA 3HQPA 1HGYA 4FN5A 3N79A 4RXGA 4WQ6A 4BFAA 2C8NA 1Z69A 1S1XA 3NPVA 1ZAVA 2VGFA 1JEZA 3D7SB 4QDWA 4WXZA 4JI1J 5KFIA 1OZQA 4ED6A 3PM9A 1D7FA 2E9RX 2JZ5A 1IXOA 2QFJA 3AJ7A 1V3LA 1PS9A 1KXHA 2ZVRA 1W5OA 4YFUA 4CYUA 2DH7A 1BSIA 4M82A 3SFUA 2WAQD 3PY2A 2VHGA 1OK4A 3P5BP 4ZPCA 2IM0A 2D0FA 1FA0A 4Y96A 1G67A 2GHWA 3DHWC 3AYSA 3AIRA 2Z7GA 4JTJA 4LALA 2FUG9 3TJXA 3MV11 4AVFA 4DJBA 3GPAA 3MFIA 3C3LA 1SJFA 4BC9A 3NNAA 5I24A 2QCMA 2QL7B 3CDAA 1DIEA 3W01A 3T2PA 4Y0FA 5KFDA 2QA2A 1EP2A 1NDWA 2R4FA 2JWNA 1YVFA 4B3TJ 1BFNA 4KB7A 1NSPA 1UUMA 2P8IA 4QE1A 3BDKA 4C4WA 4B9UA 2PRHA 1A47A 5GADI 3QF0A 4NE9C 4IMCA 3M5YA 4X60A 3RBZA 7FD1A 2XI2A 1F6KA 3WEOA 3SFKA 3MKKA 4Y9MA 3G24A 3NPWA 3H4XA 5DX7A 2YWEA 1FH8A 5HBFA 4LFYA 1FCQA 1SW7A 3E2RA 4HJWA 4LRTA 3KTCA 3HD1A 4OI2A 1QI5A 3M8PA 2OPQB 1QSYA 4L64A 3WEMA 1S4EA 1UJ5A 2KDOA 4FOKA 3UQSA 3A4AA 1JDDA 3H4DA 4ICMA 3UGRA 4JV0A 1JLQA 2DR6A 1T7LA 2REQA 1LXNA 1R6WA 1UBSA 2CQGA 3U2CA 5HROB 4DUZF 1SJCA 1AJ2A 3QGPA 4MJ4A 4HNTA 1O5XA 1V3RA 5CYQB 3E0FA 3W07A 5D0EA 3W9JA 1E4MM 4E3TA 4MNKA 1SC1B 1I2QA 4LVBA 1LP6A 2GWGA 2J79A 3LQLA 4IRKA 1KGWA 4X2BA 1FWCC 1TJ2A 5IHSA 3QFEA 3GTIA 2NVDA 5H6HA 3W7EA 3TTYA 5KFQA 3TA6A 4C3KA 4JFVA 4NP7A 1IT7A 3L21A 5CXTA 2XISA 4KRTA 1N6QB 3K1DA 3KW3A 4FX7A 3NQEA 4JICA 1CULA 5AYYA 4AWSA 4ICLA 3F73A 3I10A 1M1BA 4IP4A 4HI1A 1VFLA 2F7VA 1ZTTA 1HJVA 1TV3A 1XLAA 2FH8A 1G2EA 5AJ3F 3M2VA 3SCQA 3NGJA 2UZ9A 3NAVA 4AXKA 2BQRA 2KAUC 4WCJA 2QA1A 2W25A 4JS3A 3UCGA 4F0LA 1N4LA 1AFIA 2QCDB 1W31A 4J40A 3T08A 4J3VA 4DQIA 1F5ZA 4J90A 2AHOB 4CQ8A 4US5D 3L0KA 1H3GA 5E3RA 1FCVA 4DZAA 5CSSA 4J7CA 3FCWA 2V3FA 3KG1A 3P8BB 1DFDA 2O67A 3OHMB 3UQNA 4YIWA 3DDIA 3FVYA 3SCSA 4PAAA 2W7AA 2CLKA 5L38A 1GKPA 1VBXA 5D0GA 3IVSA 1TMJA 4Y8EA 3SEOA 1V51A 3D6NA 3QGGA 3H12A 2CA9A 1YJTA 1DWJM 3LA4A 1NEYA 3N2CA 1LWFA 1UC5A 1PB0A 1GOMA 4IP5A 1NBEB 1DOSA 2R1NA 3BB5A 3N13A 3R1ZA 4ENLA 4MB5A 2RHGA 2CXGA 3U8GA 2J88A 2D0HA 1JLBB 5EDWA 4D6EA 3W2VA 3L67A 1XN9A 1FVQA 4BI6A 1AD4A 2GDVA 3BLFA 4QU6A 3UD5A 4TXEA 1XYFA 2XFYA 3UXLA 4GBDA 1A5OC 1SW0A 3B04A 1DTQB 4QG6A 1S46A 2W5FA 4E3VA 4PUEA 2DJLA 4GVGA 2ZA1A 3OJGA 4RLEA 1HGWA 1E5JA 1PWLA 1WKEA 1UWTA 5D3GB 1O12A 2E4TA 2DH8A 4P75A 3CH0A 3H2LA 3GY1A 2O1PA 2WK2A 1Y00A 2B4UA 4ZKAA 1UH2A 3U5YA 3G6LA 3W1LA 2POZA 2VQFF 3V4IA 1XBZA 1WG5A 1EH9A 2DZAA 1WTBA 2YWWA 2V8HA 3QGVA 4P7TA 4YTTA 4K4SA 2DISA 4O3RA 1IEQA 2XG9A 1M5WA 1SZFA 4H3DA 1H7NA 3A5FA 3CB3A 4ZCWA 3DLGA 1EL3A 3WQ5A 4C6OA 1UC4A 2GQ8A 2DD8S 1BYBA 4JI5F 2OP5A 5I3UB 1CJVB 2RQCA 4Z1AA 3DCAA 4OZ2A 2PDYA 1FK9A 1M7OA 4PC8A 3IV3A 3H55A 5HATA 4IYQA 3N25A 2D41A 1X6NA 4AZCB 1RT2A 3IJ7A 1P1TA 3AXKA 1WTFA 1MG7A 5H9EJ 1K0TA 2VD8A 2WW8A 3DRPA 5EX3A 4HLBA 5D30A 1S1TA 2DEPA 4QDMA 1K03A 4DO7A 2XM1A 3SQMA 2J7DA 4H83A 3PYEA 2R2RA 3IVUA 3TU9A 1HVQA 1ZM2A 5A0YA 1GQIA 4JB8B 4TVAB 3N5BA 1K8XA 3EOUA 1H3DA 3CJ0A 1OGGA 1T03B 2XH2A 4WFZA 4M8UA 4HU0A 1H0GA 3TZWA 3FUYA 1EYEA 3QYQA 2A2IA 4NLPA 1TPH1 1E73M 3L5AA 4NX0A 5AT1B 3MM6A 1PAUB 4N8OA 4ZN3A 1X97A 4ES4A 4J9OA 3ERPA 3RN6A 2V4QA 3KM8A 3PB0A 3DZ1A 1CEOA 1UFKA 5I06A 4USIA 3I6RA 1S2VA 1GVIA 1BQMB 4ILLA 3IUHA 3QO9B 4MPQA 1S1WB 1X7VA 6FDRA 1QO5A 3S9IA 1M5VC 2ZBCA 4CLSA 1TJRA 2AQ4A 1AJ0A 3H5SA 4DG1A 4DX7A 1BAGA 4GINA 3NZGA 3O5TB 1KBLA 1VB9A 2D24A 4U4MA 3E51A 1S1PA 3EZOA 4DPWA 2XM3A 5FLXY 1KQSR 4B91A 3K5MA 2XIMA 4W85A 4F48A 3W23A 1RT3B 1HKJA 1FY6A 1N5VA 2CVEA 4A3UA 3A5VA 1SKRA 1XGEA 4LVGA 3WBEA 5CH7B 2G50A 3BQ0A 5D4YA 1AVAA 5AE2A 1D9DA 3EMZA 1AZSB 4JOMA 3OP2A 1EWEA 5A1AA 1EJVC 4OYAA 4B5VA 3EGNA 2JDJA 2I2YA 1JLAB 1J5OB 4V1XA 5EWGA 1OFOA 2PA6A 1OO0B 2FDSA 4GBUA 3GJTB 2DY9A 5U47A 3BZJA 4W84A 1T0OA 2KZMA 4AD0A 4NXKA 5E6ZA 3NO1A 2R7UA 2K3IA 4YB5A 4LT9A 1A5AA 4WZHA 4JV5J 1FWGC 3PC0A 2P0IA 2KJWA 1N32F 4OZJA 1RWMB 2XM2A 3QWUA 4NZ1A 3OEXA 4H00A 2YH0A 1FX2A 2J7EA 3PW0A 2W66A 2K1RB 4PSPA 2GMHA 2XNRA 3LA0A 4C6MA 4F79A 3AIUA 5DFAA 4RW3A 3TO8A 1FWAC 3GFYA 3TZFA 3B0VC 4KR0B 3CQIA 1ISXA 1ZBCA 1SGJA 3BN7A 1PGZA 3GTNA 3W9HA 4TTUA 5C6MA 3OLIA 4UZSA 2ZH7A 3QWPA 3FKBA 1LWIA 4Q7IA 4JBRA 4MH8A 1EHAA 3TTQA 1A50A 4I5RA 1RBOB 2VC6A 1REVB 4AL6A 1YZ6A 1YJ9S 1LKZA 1E15A 3A64A 3AQOA 2PS2A 1OCJA 2VFUA 3MJMA 4DPYA 3C3UA 4WY0F 4ECQA 4D72A 5HOSA 3UWEA 2CQ4A 3CXCR 4UTLA 4XISA 1QT1A 1Q8KA 1RTJA 1C1CB 4E4FA 1T9WA 3RRHA 2VODA 5CABA 1GZJA 1NM9A 1ZZNA 3AHTA 2Q6CA 5T14A 1R3QA 2PFHA 1VRQC 2FVKA 4GPNA 1EO7A 4NYOA 4E2DA 2YQ0A 1TZ0A 3DC8A 3RBEA 1MNZA 3CL8A 2ZWZA 4Z1YA 5BCAA 4O44B 2DR5A 3MD3A 3PFOA 3R2DJ 4JYAF 4KPCA 2FLOA 5IM51 2E1RA 1JLEB 5HL7Q 2RH9A 1F5AA 4NEYA 3HFVA 3F03K 3JS3A 2Q6ZA 4C6KA 2BUNA 3I0RB 3CEUA 1SJ1A 4C6DA 3HGRA 4S1FA 2JGQA 2Q79A 1LORA 2JLEA 1A3WA 5FL1A 2PWUA 3VNIA 2HFUA 1U0SA 4KKOB 1RWPB 3M6WA 3NNTA 3N11A 2YPIA 2YX4A 3H4WA 2J9CA 4UTWC 2R42A 4QFUA 3ES8A 3W82A 2VFRA 5LXXA 2YX0A 3VYLA 2I5GA 4I2PA 1SUQA 3ALGA 1TWSA 4Z2KA 4NA1A 2YX1A 3BH7B 1EXPA 3B9EA 4RL3A 3OR1B 3GR0A 1V0LA 3PHTA 2GVDB 5BRBA 3BQ1A 2ZX5A 5HJLA 3I96A 4JI0J 2CWNA 3IRSA 4EP8C 3LP0B 4WFBQ 1XW8A 3HVWA 2FJUB 3CD7A 1YSJA 4J3TA 4RW7A 5GAGU 1QMLA 2DSUA 3MMUA 3ZTSA 1XFCA 3B8IA 3KP1A 3M0XA 2V30A 3GNNA 4WF7A 3S6DA 3CZKA 3VILA 3U2EA 1FH7A 1S6QA 1XNQF 3KTQA 3AOCA 3R5BA 3MUMP 3VTIA 2YIHA 4CO0A 5TF0A 3W7RA 2RU9A 2PI5A 2FJEB 1GORA 4ES2A 1R7OA 4QS5A 4C97A 2ZFAA 4ROPA 2MJUA 2V69A 3QTPA 1QNSA 1TREA 2YWKA 5J2QB 1I5OB 4DQQA 2C71A 2W01A 2GNKA 3W7PA 3K0JA 1XMQF 3U4AA 4OHVA 2M4MA 6ALDA 5BZAA 1E43A 1PO9A 3ZLFA 1H0IA 3FSYA 1Q6CA 1VBJA 3NQCA 3GTXA 5DRCA 5HNTA 4P9SA 1M9HA 1M01A 1VHIA 3V2UC 3HHKA 2UVRA 1LCOA 3ITXA 3CNYA 4A4JA 2BB0A 4UMAA 4JL1A 4C1LA 2V2VA 2E5LJ 4FNTA 3GQCA 1YDVA 3I5BA 1RDRA 4Z2LA 4C8MA 3TA1A 3PZVA 5D9MA 3NPUA 3G82A 5KZ6A 3W9IA 3E49A 3PR4A 2XZTB 4DJFC 2NV2A 3AIWA 3LNPA 2VHLA 3BMVA 5JIWA 3VKKA 4AXNA 2EW9A 3HZGA 5HI7A 1RLCL 2HV5A 4FEZA 2V5BA 1A0EA 3MM5A 2HROA 3UPBA 4ZL1A 4QPTA 4PE8A 2FPVA 2PLKA 2C2OB 3KFWX 4B9LA 1OCQA 2VX6A 3AOFA 4RW9A 3CQJA 3B6BA 3NDOA 3V7PA 2HZGA 2Y88A 1EPVA 3I82A 4MB1A 1ZGDA 3W7JA 2BDQA 7ODCA 3IM9A 1X8FA 1J5EJ 2BXZA 4LAZA 3WNOA 2YBUA 1WCGA 4K4YA 1QVFR 3IWLA 2AV5A 1SFLA 3IGHX 2YB4A 4I2QA 2IJRA 2AKZA 4EZ9A 4IISA 3ZZPA 4ZLNA 3PFRA 3SCLE 5F8IA 5DCBA 4NI8A 3TVYA 2VGGA 4ECYA 4OV6A 1GX6A 3MR2A 2WSFC 5AYXA 2MGZB 2FTRA 1NXIA 2JFKA 3ZFHA 4X2RA 3HX9A 4O4VA 2B9WA 3O1NA 3SZ8A 4G1PA 1WEYA 1PTGA 3LPGA 5JUMA 2DR7A 4C3MA 4U7CA 1IWBA 3QPEA 3TH6A 3QW4B 4HYRA 3J7YU 3PR5B 4X64J 1MUWA 4CO3A 3Q0AA 4GACA 4WWSA 2QPXA 3RJMB 3ARSA 1I94J 5IT4A 3GRIA 4LJMA 1MXDA 5LHEA 2EPHA 3DX5A 1AUSL 1C7TA 1I2NA 3NRBA 3FBBA 2CQ2A 3PJTA 1F9EB 1NY1A 3LGHA 4ZOSA 2ZH5A 4IPNB 3A13A 5EYWA 3FV9A 1GNXA 3PBVA 1KHVA 5DG8A 5DM6Q 1JD7A 4PYDA 1JPMA 2MZRA 4HMDA 1TL1B 1KCZA 1F9HA 3UXAA 1ZAHA 3IUDA 4WIWA 3W8PA 5DLFA 3VDBA 3W1NA 3F5JA 3W5YA 4NXNJ 4OX7A 1UIOA 5I3JA 1OEPA 3TN6A 1GW1A 3H54A 1HTIA 3G18A 3TR9A 5JH1A 1ZAXA 5D77A 2RKIA 1Q86T 1F3TA 4RNOA 5ECVA 2OG9A 3UJSA 2VQTA 1HBMA 4U95A 4HYWA 1IWPA 1F07A 1LOSA 3GG8A 3GG0A 1YYAA 1MW7A 3W53A 3GDLA 3CC1A 1M3UA 4ZB0A 1GMWD 1MROB 2L41A 4ZP7A 4BQ5A 2DR8A 2XWXA 2YKOA 1YJUA 4KF1A 3EWYA 1HWUA 5D6GA 3VCCA 4HU8A 3GE7A 3AALA 2ZHOA 1GOXA 4P8WA 2BY3A 1HR0J 1PO6A 2BS9A 2C2ZB 1GHSA 5A69A 4OHZA 5C7HA 5IWAJ 1R0MA 3BREA 5HVFA 3OZMA 1UR3M 1OFDA 2WKGA 5FAGA 4MKSA 1VQTA 2VQUA 4LANA 4OZOA 4GNVA 2ZOGA 4X3ZA 1CX9A 2OCZA 5HPOA 4TU7A 3CAWA 3G22A 2D1CA 3T41A 5E93A 4UFHA 3TZZA 5DELA 5K14B 1VAHA 2BE2A 3UU0A 4RZRA 4QNEA 3UCCA 2OUGA 3WBZA 4AY8A 2BP1A 2J13A 1LJYA 1U1OA 1D8YA 3K5PA 4ILMA 3V5RA 2ILZA 2YCKX 4IQEA 4LFCF 4MNLA 1J2BA 1DJQA 4IM4A 3D54A 1P6CA 3ZZOA 2V67A 1JXLA 2GO9A 3VIJA 1H5YA 2FVPA 2WW4A 3EX4A 5CCZA 4JTEA 4HKPA 4IL0A 3HMJG 1OC7A 2FFCA 2PTWA 3NCRA 4C8NA 4EBCA 3GMGA 2WWCA 3BAIA 3W26A 1CXIA 3CQ0A 5CLWA 3LXBA 1QDSA 1EQ0A 5D8HB 9CGTA 4GUGA 4DFPA 2UY5A 1ZJHA 1TL7A 1PKLA 2YPZA 2WYSA 4AL5A 4XKYB 1XLFA 1J5TA 3JSRA 1RAOA 3MUZ1 1XV8A 1F4AA 3D3FA 3GDTA 4NZ4A 4UWMA 4ITSA 5HR6A 5F0UA 3HFKA 3GWQA 3WH5A 3TYCA 3WJZA 4Q8VA 1JNEA 1K9FA 3OGSA 4NJJA 5TNVA 5C8BB 2FZMA 2QJJA 5IS2A 1E4NA 3TIMA 1X4HA 3CUIA 4JDBA 2P6SA 2ZBTA 3CZEA 4LQ9A 4UOFA 3EYPA 5G2WA 4H6EA 1Q1KA 3BSNA 1L3SA 3T05A 4X62J 4H4OA 5AC5A 1PVNA 2WMIA 2VKZG 1SC3B 2BJDA 2WONB 2F9JA 1JDAA 3VOIA 1CC8A 3RBXA 4W4QA 4A48A 4L7ZA 3KRZA 3MM8A 1LK5A 1DBDA 4DAFA 3G1HA 3MCNA 4DHGA 5BRQA 4QW8A 2G97A 2C22A 4KO0A 3MD1A 1EWDA 3QQCD 5IFTA 1NSQA 4H7VA 2OEMA 5TAOA 1RXOB 3ZSSA 1M1HA 1JNRB 1IXQA 2J9YA 1SKWA 3L7RA 3K2GA 5J2NB 1DXEA 4ECTA 3HD2A 1OJXA 3PF3A 4R7OA 4FKXA 2FHBA 2VQEF 1QWKA 2X1SA 5BXRA 4L72B 3MP3A 1XHGA 5D9OA 6XIAA 1ZP4A 1TG7A 2XGZA 1WXJA 4LF8F 3IS9A 3G6VA 1R9YA 2KZHA 3BO3A 3IRXB 1J0IA 3C86A 3BPDA 5M2FX 4MAZA 2CLEA 1EOMA 2JVRA 3GVRA 1WXZA 3G0XA 4WGXA 3MM9B 3TR5A 4IQXA 1JLGA 5DDPC 2OWCA 4MKBA 5LMNF 1NK4A 1JJ2R 3ITLA 4LF9F 3WF1A 1HYSA 3W27A 4KT0C 1PX8A 1J0KA 3PYGA 3WH9A 2HTMA 3SADA 4FYYB 3LHWA 4ZVJA 4CNOA 3OHBA 2J7KA 4CI0B 1JYXA 3N12A 3GIYA 2CVIA 3L0GA 1H09A 4PR4A 5HMDA 5J1EB 4OZ3A 1MW3A 2OZ0A 4E2VA 2Q8LA 5H2ZA 4IX2A 1H62A 1CGXA 3EOEA 3R3TA 1EETA 4OBRA 3LSCA 1E0UA 2Q3RA 4GZJA 3VGHA 3NYDA 2DRDA 3W60A 4S38A 4IXHA 3W1UA 3WBXA 1IM4A 3MPVA 3LLXA 3RO6A 4GC6A 1SMDA 3E3HA 4AY7A 1Q45A 2HS4A 1VPQA 2GVZA 3HBLA 2O01C 3K57A 5AC4A 2V82A 2CBUA 3TUZC 2F4FA 1HPZA 1DQAA 5FD0A 4F4KA 2DR9A 3SW6A 4HNUA 2WZHA 2VEPA 1TUGB 2QCLA 4P8XA 2PGCA 4ECZA 1Y7PA 3OGVA 1CJKB 4Z2GA 3LCWA 3C6CA 1XLBA 2CETA 1TE1A 2WJEA 4LSZB 3K5LA 4QLKA 3OXFA 1R9ZA 1OF8A 2ISFA 1R31A 3UVAA 2CQIA 3B0UX 2AAMA 2XJ7A 4DV5F 3CUXA 1YJ7A 4H8NA 4AB4A 5E0KA 2DP3A 3AIVA 1SZEA 1DXFA 1Z7AA 4JQ3A 4YYCA 2HWIA 1G0CA 3S8SA 3VOGA 1IIHA 1OYDA 3TR2A 2D2OA 2VPYB 2FD2A 4FZIA 3NCOA 4TV5A 3VAVA 1KXTA 3HDSA 1IKVA 2J8TA 1ECEA 1FBAA 5ETVA 1IXKA 3PX6A 4EFAC 5A6JA 3HZEA 4B3MJ 5HJYA 4B92A 3DYAB 1DJHA 5A6WA 3WD4A 4LB3A 1KFDA 3ET6B 4I3GA 3NXZA 4AZ7A 3LV5A 2XWYA 3S5SA 3GJRB 4IIEA 4JTFA 5F3ZA 1SJAA 3KL3A 2ZH3A 4G3IA 1FT8A 3GW0A 3VDAA 1CJTA 4Y2IA 3CUGA 3F4NA 4FF3A 5C24B 2JEQA 4GIAA 1TPWA 3WLQA 2I16A 1FX4A 2DXFA 2PSZA 3EX3A 3VR1A 2HK2A 3LZ3A 4QIUA 1UFWA 4QQUA 1RHKB 1DTUA 3IAQA 2DNHA 4P10A 3MZ2A 3CJTA 4WU3A 2J7CA 3SN0A 2EG7A 3TFXA 2QLYA 4TR9A 2GK1A 3DKLA 4AEFA 3GV8B 4DPQA 5ETQA 4MAVA 3LMZA 1X96A 4LUYA 2F6UA 4LRFA 4NU7A 3PZPA 2OO4A 4JIRA 4ATDA 3V18A 1RT7B 3WENA 1FVPA 2F5GA 1R85A 2YCLB 2QULA 3W2JA 3NNCA 3O7UA 3LI0A 3DHUA 5DXYA 1N8WA 1YJVA 3C61A 1NP0A 2XWEA 4Y9AA 1MMLA 2YKNB 3AUOA 4YHEA 4Y6GA 3DC0A 3SRDA 1SB6A 3A22A 1L6GA 5K8NA 2AZ1A 4UNIA 3PANA 3TYAA 1Z2ZA 1E6YA 1XQKA 1IIGA 3L4VA 3VF0B 1G9HA 3STPA 3HI9A 3UR7A 3PWAA 1XIQA 1Q6FA 1LUCA 2OQLA 4H9XA 2NV9A 3W63A 2HWGA 1WC4A 4TQSA 4RUBA 1A9NB 3ZTQA 4ILSA 5HUOA 1FHUA 4DZIA 2H9AB 5DMMA 3ILOA 4M1RA 4XZIA 1PIIA 1YGYA 3HULA 2VKRA 3G86A 1ZBKA 1O6IA 2WBGA 3JRKA 1JZ7A 4J9PA 2ON3A 1WI8A 4XTDA 2DSVA 2HHPA 3ID7A 2DIEA 1Y11A 3EEGA 1KBJA 1XDMA 1D8ZA 3UESA 2HE8A 3P5YA 3ZZYA 2V5DA 2Q1LA 1FEHA 1ONRA 3BGJA 1KC7A 1XLHA 1PYSB 2WZIA 3LNMA 5IQQA 1VFOA 3EGWB 4P71A 3C8NA 3OD2A 1O1HA 2H4WB 1W3IA 3PW2A 3C6TA 3VNZA 3IGUA 1K4GA 3K5XA 1NARA 5M03A 2DZPA 4DM1A 4GVBA 3LCIA 4PRRA 2M2BA 4NCAA 3U57A 3N4EA 4NCGB 2ASYA 2RD5C 3V16A 5ABTA 3Q2SC 1ISVA 3MI2A 3GSDA 1N5YB 2RDTA 4O1AA 2VFVA 1F6PA 4O4GB 2YYUA 1GVYA 3UE2A 1S48A 3PZNA 2C14A 4ZVQB 3ITGA 2E7XA 3GB0A 1GXLA 1BSLA 3MANA 3QH2A 2WNZA 3CV6A 3DFOA 4H41A 3GFHA 3UWYA 6XIMA 1H5VA 4F2SA 2HMIB 4DI9A 1JJCB 4BCAA 4UFJA 4B17A 3O0KA 3GNOA 5D04C 1NHUA 2RE1A 1SMAA 4AYSA 3WQOA 4DSIA 4JTKA 3EB2A 2PCEA 5B0CA 1XFBA 4DL0C 4B9NA 2A79A 4Q8UA 2VURA 3U3HA 4MGGA 4FF2A 4MJ2A 2B0GA 5LA0A 1WOSA 4NLQA 4IIBA 3PBMA 2XHYA 3N17A 2UUCJ 3QHMA 1VJWA 4IH5A 3HHDA 2F4VJ 3LG3A 2BJ3A 1G4SA 4OQJA 3BO4A 2CFXA 2WZ1A 3CWNA 1OIMA 5AE1A 3M2UB 3SSQA 3Q23A 2IPJA 3ICJA 3C0SA 1W3HA 5M2PA 1KLNA 2BVYA 5GAGI 4QJ5B 1S1XB 3VGUA 2C6QA 1PBAA 4V1Ak 2DU2A 4NSBA 4RCXA 2IM2A 3ZC4A 1TP7A 4YCPA 2EEXA 3B03A 4XZ9A 2FTWA 1GQEA 4DUZJ 3C14A 1OIFA 3ZTRA 2BANA 4X65F 4US6A 4UTHA 5C71A 1WE5A 8ATCB 1RYSA 2QJ3A 4PB5A 1NMEB 3PEJA 4CYUB 3MC5A 4DS5A 2YWGA 1WKDA 2IVFB 3KLFB 4B5XA 4CLLA 1UHVA 4Z1DA 2WQPA 1YRRA 4WBFA 2K3KA 4WHBA 4YY3F 4JI3J 5A6AA 3QT8A 2C3OA 4E0CA 3OVSA 1G01A 4L9YA 4R25A 5KFHA 4XSLA 2E8ZA 2Q71A 1OINA 3AA9A 5FOOA 3BCDA 1W26A 2YNGB 4K59A 1UJ6A 1C2PA 3E12A 2QZ8A 4C6FA 2I1RA 2OR2A 1CQMA 2LECA 2NUXA 2ANUA 2ZUUA 4HNOA 5CHCB 4LY8A 2DEIA 1U1RA 1Y5VA 3MEEB 2K8GA 1HKIA 2PEVA 1I2RA 4I5UA 4I90A 1WWHA 5FESA 2HRYA 4D3HA 4NZ0A 3E0WA 3MEGB 1MW0A 4P2VA 3M9NB 3WK3A 2DNPA 4FB7A 1S2TA 2NSCA 3A3XA 3E74A 1VYAA 3R97A 1FJGF 3KMSA 4V28A 1GEQA 3CIWA 3S2NA 3UR5A 4NI3A 1SV5B 3TX9A 1V6TA 1SVDA 4HHHA 3Q2TC 3QPIA 1K9MT 1DHKA 5SWUA 4W7WA 2CLPA 3R0UA 4I7VA 5HWNA 1US2A 1R0AA 3VVUA 2REQB 4FLQA 4L76A 4ZB5A 4PG6A 4K4UA 1H2JA 1Q6GA 4HHPA 4G5DA 3REQB 3W2NA 5E0FA 1WI6A 1A3HA 4JIHA 4USWA 1GW9A 4OYMA 1U2FA 1KTBA 2PP1A 3AICA 3GXFA 4MPKA 2AEMA 4Q0BA 3CB8A 3O8WA 1XD1A 1UUOA 4DR2J 2RILA 2NZLA 4UOZA 1AH4A 4QCLA 1V08A 1CULB 3XINA 3R2GA 3VAGA 1T05A 1W9UA 3WUGA 2A18A 3D1QA 1SIZA 3MTKA 2I5IA 5I09A 3BLOA 1RU1A 3QZEA 4E4PA 5ETRA 1QAPA 4V1YA 4OU1A 2QPSA 5CSRA 3C6UA 1NDKA 2RHSB 3TYEA 1VS3A 3MEDA 5CC5A 1K9EA 2QVHA 3AQPA 2FC8A 1O51A 2GJNA 5AB3A 1F3FA 2BJ7A 3J7YI 1RT5A 4A3YA 4IFKB 4KRZA 2XU2A 2GFTA 2VENA 3DAQA 4O3QA 2WKJA 7A3HA 2NSBA 3NGDA 3F44A 4NRSA 4KGZB 4CM2A 3CJSA 1UD2A 3JVAA 2VC1A 3KJVB 2IKHA 2DNZA 4PMQA 4H6QA 3UW6A 3A8EA 4NYYA 3C16A 2Z1SA 2QLBB 4JI5J 3PUOA 5ABFB 2QA4S 3T1YF 5KFLA 1ZALA 3T19A 5LIUX 3W70A 3VKBA 3T6CA 5AC6A 2B4PA 4PEOA 4XD4A 4UTTC 4PKDB 3DM2B 2FJBB 3LPFA 3R5EA 3GDBA 3FN9A 4DZ5A 1DPMA 3C46A 3POTB 5IZHA 4MY9A 3RLVA 5EBAA 2CDQA 1X0PA 3OZPA 2PD5A 5HP1A 1C0TA 3R1LA 5ETMA 3HM7A 4QBXA 3TAMB 3KK2A 1DTTA 3G0UA 3E8OA 3IIPA 4NL1A 3A24A 1ZSXA 2OSXA 1X39A 1OPIA 1T02A 3BF4A 2MQ8A 1B30A 1M03A 2WXDM 3VKDA 4DEZA 3QJJA 1R2TA 4JI6J 3HXMA 4GVHA 3A4TA 1BF2A 3G5EA 1K9DA 2WNQA 4FP1A 4DPXA 4LVDA 4GYJA 1IBCB 1TKXB 4XQ6A 3PO5A 5THWA 1P0DA 1X4AA 3LF0A 1PAMA 3V4IB 5KFCA 4Z1CA 2XH7A 2ZZ4A 2WVUA 4F0SA 5IM0A 2ZE0A 3ABQA 2E7VA 4I64A 3M43A 4OL8A 1QNQA 1JQVA 2Y70A 2VXNA 5EKYA 1CBGA 1S5NA 1P0KA 5HANA 4DEFA 3SFWA 1VRUB 4RDZA 5F8NA 3T0TA 1W8SA 3ARTA 1ML1A 4MFEA 5EGRA 4P52A 3GTYX 3M8QA 2G96A 2PZNA 2CPEA 2JFEX 3TOPA 2RF2B 4J9MA 4NLXA 3GR8A 5SZTA 1V3HA 1JCJA 2OLAA 4RUHA 4C8OA 1BMQB 2HVHA 2WMHA 4ZEPA 2XC9A 1HBNA 2NSXA 1VCFA 4HK7A 1Q5YA 1PSDA 1TX2A 4GQ0A 3PZUA 7REQA 3ZSTA 4IOBA 3RM8A 4N77A 4F0KA 3AJDA 4AL7A 3WNKA 1RKJA 2Y4SA 4ZGYA 1RHUB 1U30A 3CUZA 2JFDA 3VD9A 3GHRA 1NOWA 5HULA 4NIRA 3DRYA 3B54A 4XSMA 2J8GA 2ZQ0A 4XB3A 3TNOA 4ILRA 4LF7F 1ZJBA 1FRMA 1JL8A 3WD0A 2YKAA 3R0KA 4MK9A 1C91A 1JAKA 2Z1VA 3KLHA 3JTOA 5E2QA 1VFSA 5CSUA 1N32J 2HNDB 2IQTA 4D6FA 3OBIA 2YOCA 3PSVA 1A49A 3H24A 2WMJA 1MEIA 1UKQA 4IG2B 4GA8A 1MNEA 2O7SA 3MSRA 4XZNX 2ZRZA 4CTAA 1XYAA 3CWOX 2KO1A 2UVUA 4BWJA 4Q2LA 4QISA 2C1EB 2M7SA 2D3NA 1IKXA 1MO0A 4FLRA 1KM0A 2XVNA 1X0FA 4C1KA 3POHA 4HACA 3CJKA 3MKCA 3B4YA 1C0UB 4I56A 4I0WA 4JX4A 1PKNA 1FOBA 3RB6A 2YWHA 2G0CA 1KNWA 4LUTA 3UPFA 4FXVA 1V6VA 1OX4A 4QSFA 3WG6A 2WSPA 3OLBA 2FZ9A 3HB9A 3LRMA 3WNLA 4DX6A 2B43A 2G4BA 1OY6A 3SQGA 5F4WA 1KRCC 1T9XA 1BWVA 4U33A 1B7FA 1J5SA 2G4FA 3HJEA 1NJZA 2DHAA 4DF8A 2BY2A 1DEDA 3BOFA 4ZCLA 1VBYA 4CU7A 1DE5A 4GKLA 1UD8A 4MTPA 3U1LA 1FKOA 4UQGA 2H4YB 2VGIA 1U1JA 4TLQA 2B9XA 2XCAA 2Z2YB 2IRYA 1FDAA 3KWSA 3SSRA 4WOQA 3AIBA 2E6FA 4NWBA 1RCXB 1GX5A 2VC0A 1QDUB 1Q63A 3NOGA 3GK0A 4GISA 1N88A 1KR0A 4UQBA 2O0TA 2E9TA 4PG8A 1CENA 1BWKA 1Y5LB 3KDOA 4ZVHA 1WV2A 2VVSA 3H2FA 2Y62A 4MDPA 3ARQA 3W72A 4O13A 2FGBA 4H8HA 4W7VA 1IEXA 2YKKA 1DLOA 5IXEA 5JXSA 3R43A 3KLEA 2AEFA 1L0PA 1TK0A 4IIFA 4AISA 4KPYA 1SUXA 3W2KA 3W61A 3W64A 3M8YA 4KGJA 2P8CA 2UY3A 3OQEA 5BXTA 3KUHA 2XSFA 2G37A 3L68A 3VIHA 3CJ2A 4JR5A 2BA9A 3CTTA 4QOTA 2V8GA 2FGOA 1NK5A 4WYLA 4ZP9A 3LP2A 4PCQA 3SCKE 1TPVA 2G3FA 3R8HA 3G3MA 4ERDA 3VFLA 4X4OA 1Q6QA 4IGMA 5FSEC 4K8HA 1FWPA 3EVMA 2YFNA 2EFGA 1QPOA 1WKJA 1QUVA 4L6V3 2ZDSA 3QMTA 1V3SA 3ABZA 3ABRA 4LAUA 1LWXA 3VZZA 3VNYA 1OVDA 3R13A 2Z2AA 3ZVIA 4TLRA 1UR9A 2E09A 3M6DA 3V4MA 2CPFA 4K0KF 2ZX6A 4UQ9A 1S9EA 2R7XA 2HNZB 3DI6A 1K44A 4DL4A 3GD6A 3N6NA 5D2VA 5FJUA 5G4HC 1R27B 2ISWA 1LV5A 2WPGA 1CWYA 1XMQJ 4QROA 4NVTA 4NILA 1EJTC 3SY1A 3Q8RB 1XLCA 1V3IA 3RUBL 1S7IA 4X4UA 2RDJA 2AGOA 3HTWA 4JN7A 5I77A 2EFNA 1W0MA 4A8WA 5HR7A 2IPFA 2P1FA 1CDGA 2FC9A 5D2YA 2VFFA 4MFBA 3DLEA 2KXHA 2HHVA 2GJXA 3ZFVA 4OFCA 4NG3A 4WR3A 3LDVA 2CJKA 4P5UA 5BOEA 1IBLF 1SFSA 3VM5A 3M32A 4O10A 3BOLA 4XX6A 3L7OA 3CD5A 3MMCB 4LT6A 2NZ4A 4M5MA 3CF5Q 1EF2A 2E1WA 3ZZ1A 4WDTA 4LR7A 4NZ5A 1YMYA 1AK5A 3V0TA 3LLFA 4NL5A 4M81A 4MOZA 2PMZD 3AMLA 3RAMA 2CQBA 1F2HA 2VR2A 2Q09A 3BV4A 2ZDPA 2LA6A 4EK7A 1S5TA 2E6DA 2GGPB 3E2VA 2ZHBA 1MN7A 1DJIA 1MDLA 3KS5A 4F9DA 2F9RA 1ODUA 4JIPA 3TQKA 2XMVA 3SQSA 5KFAA 1BKHA 1SI9A 1IM6A 4ANDA 5CD4A 4NHVA 1GVSA 4FS2A 4FAMA 3H4BA 5M3WA 2PI6A 3MR5A 3FAWA 2YXLA 4Q4PA 1WC6A 2R6OA 1U26A 1EOKA 5CZVA 3FJ6A 1E9IA 3KBVA 2YXGA 4ECSA 2Q6BA 2E5HA 3K8WA 4PUUA 3FCPA 1SR0A 4EX4A 4Y2MA 5F8JA 5EBUA 4INFA 4QQ3A 2IRXA 4FYVB 3SSSA 2BVZA 5IOBA 1R8CA 3H7RA 3I4KA 3NQBA 4H9YA 1FESA 3N18A 4POCA 2GDUA 2PDGA 3QR1A 1C29A 2E5GA 3G2GA 3A6OA 1FNMA 4RX6A 2CYGA 2YSWA 1X8DA 1VENA 1UVNA 3MWBA 4QLLA 3I9V9 3JU2A 3C66A 2Z2BA 3B8UA 2CLLA 3I5AA 1UZ4A 1B3ZA 2WC4A 2HQFA 1PX3A 3M7WA 1LRTA 3C2VA 3MO7A 2CHRA 4QR0A 4ZPBA 2UXDF 4O3SA 4C60A 2JEIA 4PXBA 3CPGA 2Y5JA 4A3RA 3TEVA 3FSTA 4DWDA 3WHIA 4AD6A 4ECXA 2C1HA 3GG7A 4BF9A 3I3DA 2YDAA 3EWCA 3AS1A 4ECLA 4PZVA 2PE4A 4HHMA 4CNNA 1AFSA 4GHRA 4N8NA 3CIXA 2E66A 2NX3A 2ZYFA 2LU2A 1A5NC 2Y1RI 2HBRB 4RW9B 4QRNA 1VYRA 3JSYA 2Z56B 2EFPA 4HT5A 3HPAA 3QXBA 2DUAA 3BW4A 3WKZA 2WZTA 4DQWA 3HG4A 3GVWA 4F67A 3KE0A 1RWKB 3FHQA 1CZ1A 2JIWA 4AD3A 3QV9A 2G3IA 2BGNE 1IKYB 3SCWA 4A8IA 2FZGB 3PBUA 2NW0A 3WCZA 1KQKA 1JNDA 2ZJRQ 4ZPWR 4CGTA 1XP3A 3BBCA 1JCTA 1RWUA 5CPSA 3IAM9 1DXIA 2CERA 9ATCB 4C6JA 2W91A 4MB4A 3QOKA 3RRXA 4ML4A 5AECA 2H9ZA 4ZQMA 4PR6A 3II1A 4EPDC 1L3VA 1SXLA 1XERA 3HVTB 3EOLA 2AX1A 4E8CA 4IFVB 3SO7A 5L39A 1P4CA 5BU9A 3CZLA 1RAFB 3WLHA 1U09A 3LBCA 2W9BB 3QPYA 4MB3A 1HX0A 9XIMA 3GS6A 3THQA 3TOYA 4DO6A 3ONBA 3AD9C 3H70A 5A6MA 2J8FA 1BLUA 2ZUAA 1IZCA 3MS8A 5AXLA 4GI9A 1F8MA 3JZUA 1C8VA 2O7QA 2PEHA 4QYRA 3LQVA 1F7BA 4JQ1A 5LIXX 3DHXA 1QLNA 3CPWR 4S3EA 4O0QA 3OT9A 1XNRF 4ZVEA 1KD1T 3B4MA 3EXTA 2W63A 5HBMA 1RAKA 2KHCA 1DTNA 4LEFA 4FF7A 4FVCA 1R3NA 4JIQA 4G7EA 4WFXA 4G1QB 2HISA 3IXQA 5KFJA 1WUUA 2X05A 4L6OA 4D6IA 2DGQA 3CJ3A 3MI7X 2RKIB 2F38A 1F9FA 2PSNA 3TW6A 4IKAA 5E3QA 1Y7VA 4D9PA 3DN9A 2XYPB 4OIXA 2HPIA 2KFNA 4K2XA 1ELSA 1R2RA 1XG3A 5L1KA 2FKPA 4U5IA 2J66A 3BH4A 2YZRA 4J5OA 8A3HA 1UKPA 4YTRA 4I6YA 3OXGA 3V6DA 3UNGC 2KVIA 2HBQB 2QNEA 3CMQA 3VGBA 4RBUA 5HVGA 4HN8A 3K2YA 1PCWA 1SJRA 4J9QA 1OFBA 3EVOA 1JCLA 2V9DA 2BQ3A 4N47A 1HKMA 1S1VB 1M41A 1FXQA 5K9FA 1WF2A 4M95A 4A2SA 2EXOA 4ID8A 4R3UA 1UD4A 4LAKA 4FK9A 4OV9A 3ZO7A 1FJCA 2ZXDA 2ALYB 1KONA 3BR8A 2PDLA 3TZYA 2VEIA 2Q8ZA 2E6YA 1XR2A 3SECA 4DXXA 4M6QA 3VI2A 2VUNA 3FGCB 1JUBA 5A2AA 4YLWA 4P74A 2Y3YA 5FIIA 1VQ7S 1ZA1B 3LGDA 1E0WA 3BGFA 3CIVA 2ZZ2A 4ZIVA 3FIGA 4ER8A 2Z28A 2DVUA 5E3AA 4N41A 2E6AA 3I6EA 2JALA 4M1KA 3V6HA 2V94A 4N2YA 1EX1A 4F4YA 1KSPA 3WK0A 1PIGA 3O2IA 1E6SM 4S3GA 2X0HA 4AD5A 1XLEA 3H40A 2CJBA 1OSEA 1IHIA 2DZTA 2GGEA 4D71A 4XZHA 3RM4A 3V35A 3M30A 3M4HA 1VQ6S 4QR1A 4LRAA 4AD1A 1JD9A 2V5HG 4BQ2A 2W9AA 4Q8WA 3MPYA 4GH3A 4YB1P 3H23A 3P96A 4U67Q 4AIUA 1U6ZA 4I7FA 1I2PA 3KCJA 5ETLA 1NDZA 2RJZA 1HI0P 2B7OA 4M80A 1O5JA 3GUWA 4Q33A 3TXZA 4PUKA 1YJNS 3KZSA 2J7UA 3LCXA 2D0GA 3RILA 3TJLA 1VD6A 1PG5B 4HL9A 3SXLA 3JYTB 4LF9J 3FGVA 3GJSB 3C5QA 1MXSA 1MWQA 3OXLA 4GUIA 3MZIA 3CCRS 2GSJA 4CD6A 2A0FB 1W9BM 2F65A 2RAQA 3EDFA 3W71A 5HLFA 3NS5A 1W1IE 4AWEA 3G6XA 3NO3A 2CG4A 4MMOA 4JNYA 4NI2A 3F56A 1A5BA 3VE9A 4MWAB 4H4OB 1KD0A 3TANA 1VGAA 1KWMA 4Y34A 4YPJA 3MI6A 5G0RB 1EZ2A 3GZ3A 3A8KA 4Z0JA 2KXNB 3JAMY 3MUVP 1UR4A 4GXMA 2HS0A 2R7TA 2GQAA 1SPBP 1SR9A 4ANEA 5HPCA 4DPPA 1P9YA 3MECA 2PB1A 4J9LA 3P8IA 4B5WA 4N4QA 1F9CA 4D6HA 2XVPA 1GK8A 2BM0A 5AC8A 2ACYA 3AT1B 4HT3A 3BPSP 2EFVA 2PTXA 1S2UA 1RBLA 1TWIA 3DOMA 1OC6A 1I3OB 8XIAA 3T0AA 1UIPA 3LCHA 5HNUA 4J9VA 1O68A 3QHOA 1RISA 2QE5A 5AZ0A 1UKUA 2ROPA 3AB4B 3HFZB 1D8WA 2FB3A 2PWEA 4ERAA 3OUYA 1EQCA 3NBPA 3PDNA 4GNJA 3DOKB 3D4JA 3IS9B 3CL6A 1JAEA 1FE0A 1J4EA 4DV5J 2FVQA 1T41A 1I75A 2PTZA 2OFGX 2CPHA 1JLGB 2OMLA 1FRJA 2WNWA 5JVLA 3UN3A 4YDDB 3Q58A 1K8CA 2PODA 2H48B 4DZDA 1AQFA 4R85A 3M0HA 3S1GA 3CYVA 4FBTA 1H6KX 2X1IA 4P7QA 1S39A 5DRKA 2NVCA 5DDQC 1ZM9A 1HWKA 2XN2A 4IR1A 3MMWA 6TAAA 4DJDC 1M6JA 4N0RA 4UOJA 2XMTA 2OHDA 2VJUA 3AIQA 1S6OA 1HNWJ 2EVZA 2XH4A 3MP4A 1W1PA 1BGXT 1HW9A 1GJWA 4W86A 2QL9B 3K46A 1GMVA 4ZXLA 5C7PA 5KFTA 2DNQA 3GXTA 1X4DA 3GXDA 3OOQA 3UZZA 3BV8A 1NK8A 3P67A 1IEIA 4ICCX 5CC7A 3TQ1A 1BYDA 1V3JA 1EQPA 5FCZA 2YDRA 1A80A 3AIEA 1X7IA 1E6VB 1EEPA 2C3PA 4ID5A 1VQ9S 1IR1A 2XY7A 3URQA 3S5NA 1KFLA 5DLGA 4ZFCA 3FBEA 1KP6A 5BYQA 2DT0A 2E5IA 4HIBA 2ZNZA 3JTPA 3O16A 3VOJA 3GU9A 5GMKa 9RUBA 1TL3A 2HXTA 3RIKA 2R1PA 6REQB 3K5NA 4U10A 2YNFB 1ZPWX 4J37A 3IIXA 3FEZA 3FNNA 1TVPA 1LOQA 3T5LA 1IT8A 4AQLA 1EQMA 4EEYA 5C2XA 5LNSA 4NXNF 2GJRA 4PMZA 4W88A 5LMUF 2GSHA 2VBWA 1GKRA 1S5VA 3CK5A 2H54B 2F2HA 4ZTYA 4K8RA 5EPDA 1HQ2A 1JPHA 3UVJA 2PGWA 2U1AA 5EMKA 2MZTA 4P7LA 2PC8A 2CPIA 1LQAA 1IWGA 1HLWA 2E77A 4XZMX 1W3KA 1L9WA 1W7WA 3D1HA 2PDMA 1TMQA 4U5KA 2MZQA 2XB2D 3VGSA 2GOKA 1VC6A 2G41A 4L5ZA 5J2PB 2VFIA 5J1PA 1SJDA 2XSBA 3GAYA 2M8HA 1V5XA 4GCAA 2DGTA 3VAFA 1TWWA 3GX9A 4IIHA 5H1WA 2KXFA 2G5WA 3PZMA 2W8LA 1TV4A 1TA3A 4KJIA 2WCAA 1K02A 1GVFA 3C19A 4QX4A 2P10A 4DYEA 4PGLA 1KLMA 4QJ4B 2C3MA 3WDRA 3ARYA 2YXXA 2DGWA 4ICNA 3DDKA 1S0MA 1M90T 5CH9A 5BR8F 4ORMA 1TTHB 4U31A 2WHLA 2Z58B 5H91A 4EWND 3HLUA 2HXUA 4FX8A 1PZ2A 2EG1A 4IR9A 1VFFA 4E8DA 1U6BA 1X1OA 2XTKA 5L9FA 4P7OA 3TNBA 4ZLPA 2PGFA 2OPSB 4E5TA 1PZ0A 4BWLA 2XH0A 1BRLA 3ARWA 3SY5A 3E02A 2W67A 1EZWA 5GVJA 1HNIA 3TA0A 4KIEA 1PBGA 3HQ1A 3RYSA 5E0OA 4RKUC 2OZTA 1A4LA 2W0UA 3F2DA 3PPFA 4Z1BA 4D8LA 4CH7A 1JDFA 3E2EA 2OSRA 1L6SA 2E7FA 1Z1ZA 2XSJA 4M5DB 3O05A 4HPNA 4OWGA 1UP2A 4O16A 1DWIM 1W6TA 1U0HA 3EMTA 3PBWA 3Q8SB 3BKUA 4GO7X 4E6MA 2EGZA 3BM7A 1GHRA 1GTEA 3LRKA 3R9LA 1WKKA 1OQFA 4G1NA 1PBUA 4WXOA 3GTFA 4A8OA 2AGKA 4QTGA 3P45B 1K8ZA 3C15A 4QWCA 3N73A 2B4GA 1RR2A 4AC7C 5LJ3Y 3UEQA 1WEZA 1F6YA 2ZUSA 3TAOA 1UKSA 4O0IA 2GIQA 5CZ0A 4J7RA 5EWEA 1CIUA 4Z7CA 2JGYA 2NQHA 4O28A 3ZLGA 2V3DA 2YBTA 4Q2MA 2OQYA 4WZQA 3MURP 3MSYA 3OTRA 1JRBA 3V1PA 2HVZA 2OT0A 3M1ZA 2OGYA 4C6BA 2V34A 1BHGA 2B4OA 4OI0A 1XLLA 2P50A 4XTTA 1PAEX 3WLSA 4QCFA 2CHNA 4ZTXA 1NDVA 1PPIA 4RZ6A 2HGMA 1EXBA 4X84A 3JUGA 4GVBB 4OYOA 3LYEA 1P1XA 4IHCA 5GNYA 2HEKA 4MM1A 3APGA 3T09A 2CJ9A 2ZADA 4R0EA 4K6AA 4KWVA 3BAWA 4N6EA 4JV2A 1NFBA 2VBYA 1IF2A 2MLXA 1MU2A 3G4SS 2VA3A 3QLHA 4PEKA 3W7BA 1CI1A 1QPNA 3KL5A 4XDDA 3O0FA 1B4KA 4Q4SA 2IFXA 4UUXA 2ONEA 2D20A 4KEMA 2QL5B 3ZNUA 4UCGA 2DH2A 3GW3A 4A8SA 3ARXA 1ZZFA 3GXMA 4OYXA 1N0UA 5DG9A 1OHLA 3OA3A 5JBFA 3BSCA 4YY3J 4MK7A 3GBEA 1XEZA 3CNQP 3EOSA 3ZTPA 2WK4A 2Y5SA 2L5HA 2FMOA 2G4JA 1NDYA 4MAKA 3DLHA 1GWJA 1E70M 4OT7A 3BWWA 4YMEA 2QMKA 5IT9Y 3ZR6A 1HP4A 4EU0A 4MNJA 5CC6A 1E9ZB 3OL7A 1OABA 3W00A 1CSJA 3ECQA 2OPPA 3D67A 1MLAA 3U2OA 1FNXH 2VG5B 4E98A 1PX4A 4DXVA 2GC8A 4QGCA 4LF4F 1EJ7L 4AYGA 2CUYA 4IG3B 1XBVA 1XH1A 1SIWB 2QTWA 5REQA 4DUTA 3M64A 2QF7A 2WHOA 2P0OA 3M5XA 3HF5A 1JZ4A 3QFHA 2A1BA 1NJWA 1PC5A 3EMCA 4UY85 4PTXA 2XG8A 2ACQA 3IWXA 1IXNA 1S0NA 1FXRA 1NWUA 1H2VZ 2KRBA 3GJQB 4ACYA 3DI0A 1EB0A 4BCEA 3C14B 3CXOA 4FLSA 3AHVA 2WBKA 3F41A 3MVIA 3MUTP 5I3GA 4LYPA 4PYSA 2ERRA 3NOYA 1B70B 1EHWA 3VAKA 4JHZA 2BRLA 2ZCGA 2MHEA 3NMRA 1OX6A 4XAGA 2YNHB 1WB0A 2FPYA 3BPWA 4ZJQA 5C25B 2Q8XA 5IRPA 2JLGA 3R7BB 4MMWA 1B3XA 2FLPA 1G4TA 2NLIA 3PUEA 4KH2A 1KBRA 1S4FA 3NXFA 2XMWA 5B0BA 2OELA 3EGJA 3PZIA 1W17A 1GJUA 1KNZA 1VLIA 3OFFA 3M16A 4TU1A 1KDNA 4X4RA 3PRVA 4ELVA 3NVDA 1BVNP 1ZS2A 1NWTA 4ACZB 5EB8A 2DNYA 3RX4A 4XPEA 3WLMA 2JEGA 1N33J 4RW6A 2Y24A 3NSXA 5KETA 4HK6A 3JQJA 5HMYA 4DSKA 1NAQA 2MY7A 5DBUA 4B2DA 4YOEA 1UD5A 1OCNA 3WJSA 4CO2A 3S6TA 5XINA 4DQRA 2FGLA 4LBPA 3RLHA 3NDZA 1QUMA 2QF8A 4GGHA 3GNRA 4M29A 4NF7A 4GYFA 1LOUA 1LDCA 3LSBA 5CEWA 5E41A 4NXMF 1DKWA 1E0XA 4ZZ9A 3TK7A 3FXYA 3BK0A 4V2XA 5LZLA 2B51A 2BE7D 3BGRA 4DSJA 1VDHA 1RQHA 1IWAA 3BLPX 4YHGA 1GXTA 2J9EA 1QSLA 3WELA 1KW1A 4DXKA 2A3BA 1WD6A 2J0WA 5DDOC 1DVJA 3CV2A 2ISSA 1RP9A 4GX8A 1BF6A 3RU8X 2HE5A 1EGVA 1LEOA 3BH6B 1WHYA 5FEWA 3QHNA 1G7CB 2WJZA 2DH3A 2IQ0A 1VQLS 5EMUA 5XIAA 1QPQA 4HYKA 2YKMB 3DNCA 2E25A 3L9ZA 2G0WA 4RXFA 1JRCA 4P7VA 1T05B 2ZWPA 3MHUA 3FEMA 4DL7A 4QU7A 5KFOA 2E5CA 3GFXA 3KK1B 2DEJA 3B82A 3NAHA 3MUXA 2CESA 3NQ7A 5JVGQ 3FBFA 2BZNA 4EIVA 4F3HA 4LBIA 5ETKA 2XO7A 1V77A 3MEDB 4XK8C 3K59A 1D09B 1OM0A 3M1VA 3CAKA 4QXIA 2B7CB 2WOQA 3GQYA 1AB8A 1EIYB 4CD7A 2LXUA 1ICQA 3QMSA 2ASLA 4UFKA 1SO5A 3PZTA 5FL0A 2Z27A 4N6FA 2XLKA 1VK8A 5BMXA 3THVA 2XINA 3CB4A 1B54A 3SDEA 2NT1A 2D3O1 2CJXB 2DNMA 1XG4A 3WLLA 2C2RA 2PPGA 1U1HA 1JPIA 4LTSA 1C1BB 2YCJA 4M7SA 3J7HA 1XWLA 2XBPA 3M7SA 4PXDA 5GMDA 4XKMA 1RACB 1GYMA 1XD0A 4PTMA 2E9ZA 1FWTA 2APOA 1R7AA 2QGHA 3JXOA 3DLJA 2MXYA 3T55A 3B8WA 2WVFA 1P1MA 3NOCA 4X0NA 3F4VA 4YUDA 1GH8A 3M0IA 3U6WA 4LS0A 4K3ZA 4ECVA 2ISVA 1KBKA 4KFPA 4HTYA 3KK2B 4WJEA 1KTNA 1T6MA 2A6NA 2V2CA 4LOCA 3GXPA 5ABGA 1OFEA 3UR0A 3ZZZA 3VIMA 4WE1B 1P6BA 4B3OA 1E55A 1I0DA 3D0CA 3KK3B 2VELA 1RB0A 1KXVA 4RW8A 2AYBA 2AU0A 4CLYA 2NT0A 4NCBA 1SO3A 2GL5A 1QVGR 4LF7J 4FXWA 3DG3A 4GKKF 5CGMA 4ED2A 3W02A 4HPXA 2NQZA 3WH8A 3ES7A 4V19X 2XPKA 4H19A 1PKUA 4WDUA 3PJUA 4K5SA 4UMCA 1PWMA 3CM4A 2GQ2A 1TJPA 2Y5EA 3EGZA 4XAZA 2P2CB 3GIQA 3WL1A 5D4NA 1XSJA 3W1XA 2Z1XA 1X38A 3IARA 1U83A 1REQB 4EVZA 1K7XA 2VG6A 2ATLA 2HPMA 3OTBA 2AEJA 3MMAB 5A8KA 3KBMA 1XC4A 2W7OA 3M8QB 1OD0A 2JSXA 1ZTWA 4ZHRA 4NA2A 3QQWA 1JLFA 3UWTA 3QVQA 4ONVA 4C8LA 4CQBA 3O06A 1HI1A 1LL7A 1L2UA 4A21A 4L75A 3KLIA 5L6UA 3MR7A 4JTIA 2YCEA 2O9RA 4CO1A 1XC9A 4LY4A 2DDXA 2XULA 2UUWA 5FJ4A 1A5KC 1UCWA 2DZWA 4XDCA 1XMOF 4WU2A 1I6JA 3H7UA 4O1BA 4YXGA 3IM8A 3GILA 3MM7B 3GNDA 3IJ9A 2J8SA 4RU9A 1QAIA 4RJVA 4RPQA 5A5WA 2ESCA 2ZVIA 4WTYA 1TKTA 4ZPDA 3TCEA 4N9EA 3S9ZA 1MI3A 3DFEA 1Z4UA 3WK1A 3T9NA 1RZMA 4E2FB 3Q89A 2YXOA 1BHNA 1EKRA 4RE3A 2RDWA 3CHEA 3P6YC 4IIGA 4H7CA 1X9WA 1X5PA 3OG3A 1JXEA 4ZVUB 3KLHB 3VIOA 1VRTA 2VL4A 2KG1A 1N5TA 3MT1A 5MHBA 4OYWA 3MTJA 2A10A 3EBVA 1GVRA 1WF0A 3T1GA 4BDPA 1M68A 3SI9A 3VAMA 3F4CA 5DG7A 4UTGA 3RF9A 3HKWA 3UDVA 4ZITA 1IKXB 1YRTA 4GG9A 4Y9NA 1D3GA 5M2UA 3S9YA 5BXPA 4DJEA 1V3ZA 1JF6A 2PDQA 3B06A 3LM7A 3MW7A 3TAPA 3CJKB 2H3EB 4RW4B 5HXMA 2FMNA 4W5ZA 4GYKA 2ZM6F 2WHKA 1V03A 3S4TA 2WSQA 3NGTA 2JKAA 1HBUA 4DV2F 1E6NA 3IIZA 2VPWB 5IV4A 2FY8A 2VC7A 1W56A 3ZQ9A 3DEQA 4USKA 1YDOA 1IBKJ 3FJ2A 4HMEA 4F04B 3SQGB 4KY3A 4CH0S 3DESA 3EX7B 2QV4A 4WVXA 2ABAA 4O11A 4YR3A 4GKJJ 3Q4DA 4IOCQ 1R89A 4M94A 4WXYA 2PWFA 4PMOA 3QJPA 2YLAA 3I9ZA 4HVXA 1SU5A 3RU6A 2ZC3A 3PRBA 3MY9A 3L4WA 4A47A 4TY8A 1U1LA 3C8YA 2I9UA 3WBWA 4K0KJ 3ZM8A 2OFJA 2R8KA 3LBMA 2EPNA 2NXGA 1HQUB 2L08A 5B7WA 1S9GA 3RFAA 4CZCA 3MMBB 3TC7A 1ECQA 4H9MA 1WKYA 1RK5A 2A7NA 4NJKA 4B4HA 4O52A 1OY9A 2CPXA 5F2IA 1WKFA 2EBNA 2KT5A 1J12A 2DVTA 2E9LA 3CH9A 3I87A 1M7XA 4P7NA 2CU0A 3SY8A 1WSVA 1XPYA 1E6ZA 2W24A 4I1TA 2PDWA 1E9LA 4G2DA 1HJUA 4DSLA 3VC6A 2CAJA 4GD0A 2WWDA 4CT9A 1UASA 3L4TA 5LGZA 2G9OA 1LQ2A 1PKMA 3OGRA 4LPCA 4H9VA 4DR3J 1IBLJ 4I9MA 1IR2A 4DR5F 5HSPA 5I42A 5K9XA 2FLNA 2JH3A 3KLVA 4USVA 1E40A 4UR9A 2J27A 2H51B 1HUVA 2KFZA 5E5CA 3QIDA 2BTMA 1YPIA 2CJQA 3THTA 3T6JA 1I8JA 4JD4A 4MF4A 3KL0A 3T5HA 1Q7ZA 3VOFA 1QO2A 2ZC8A 3E2QA 4LBRA 3I7QA 1SPQA 4MY1A 1XF0A 2Y85A 4FIRA 2D3OR 3DLLQ 4JNZA 1BQNB 3QQ1A 3T3FA 4FOJA 4C3LA 4DYKA 1VYPX 1RAIB 1ZM4A 5H9FK 1UBPC 2WSYA 4O3NA 4FXJA 3W84A 1V6UA 1FP9A 1CJUB 1S9EB 3D2WA 4DV1F 2QMJA 4DV3F 1B0IA 4DLEA 4UF4A 1JKHA 2JF7A 2OKQA 3OYZA 1FXDA 2HQCA 3QW3A 1EKOA 2VASA 2EFOA 3UXDA 5H8PA 5JXQA 3LHVA 1FFWB 1YDYA 4UFMA 4MHBA 5FF3A 2CPUA 1KRMA 2HS8A 3SUVA 1Q95G 1JYNA 2VC9A 3Q8QB 2J7HA 5HO4A 2HQ3A 5GAHU 1KO0A 1ZQ5A 3DOLB 5C9WA 1C9WA 3EDQB 1F4HA 1BPLB 4OYBA 2IXVA 2FIUA 1Z48A 5JJBA 2V2HA 3EDEA 3THDA 4LU0A 1A5LC 1S0OA 2XGBA 1ME7A 1ZBWA 1YIXA 2GVLA 4FXSA 1E3XA 4FZVA 1DBTA 3HPXA 4NLRA 5A3HA 4X61A 3K58A 3DERA 2D3ZA 1QOPA 4GRSA 4UTWA 1NUEA 2AZ3A 4XBKA 1N34F 2UU9F 4S3AA 2V50A 2VO5A 2NR0A 3NS6A 5L1IA 1GONA 5KOXA 2VI0A 4DZHA 1RAGB 2IKJA 3J80Y 1TO3A 2PDAA 3RBDA 4NKCA 2KTQA 3CT7A 4AT1B 3A4XA 2TMDA 4AMCA 3SCUA 2OMOA 3KOXA 4OFZA 2GQQA 2JF6A 1HW8A 3NQGA 4L56A 4B9YA 2ROEA 4QM1A 1TZ9A 2RAGA 2PDNA 4RPFA 3H98A 1AW5A 1SL0A 3UNTA 3HHNB 1WYIA 1AQMA 4HNVA 2VFEA 3L4ZA 1OYAA 1VC0A 4KHRA 1N56A 1FFGB 4NNAA 4O1EA 2XI3A 3VD7A 4HVZA 2WB5A 3LS9A 4YB6A 1H1NA 2ZX7A 4O50A 3T5KA 1GQLA 1OYCA 1CXHA 1O5KA 2NX9A 3DFNA 5F1UA 3VM7A 4NLOA 3AS0A 1HKKA 3BAYA 1AQHA 4CLKA 3P81A 4IMFA 1BD6A 2X2YA 1WHWA 3VWSA 3WF0A 4AD2A 1Q79A 3RPMA 4Q4KA 4JEJA 3T81A 4DWSA 1R3YA 3J7A1 2V5JA 3OFGA 4A4AA 4KBIA 2PLCA 1VLWA 3V81A 3LEPA 3GBDA 4AIOA 1I60A 4QEHA 4BS0A 2FHOB 3IA0A 2UUBF 1NHVA 3SUWA 4YTSA 4TTGA 4EPKA 2EBEA 2Z2MA 4LEQA 1C9DA 3CEPA 4G1IA 3SCRA 3VKCA 2DW7A 5F8GA 3G8EA 1M7JA 5A8NA 1Y5WA 6TIMA 1FWIC 5KZMA 3HG3A 3TTEA 4DV7F 1AROP 1GKQA 3O63A 4C0HA 2XSAA 2VTFA 1W2BR 3EAUA 3QRRA 4MYUA 2ABBA 2XVKA 3VABA 1G69A 2DVIA 2BVTA 2OZ8A 3Q83A 4DX5A 2UVVA 2RVJA 3UDCA 3R8RA 2PWGA 5LNVA 5D2WA 3MPWA 1P48A 1VQNS 2BJ1A 3ZT7A 1ZAJA 3BV7A 4QJ1A 1TFVA 1WC0A 3DGPA 4KHMA 3CC7S 3CZ8A 2X7IA 4IRCA 2QIWA 4FNPA 2VH7A 2R8JA 3TARA 1U2CA 2RHQB 5A2QU 2Q43A 4OLOA 1E51A 3PTWA 1HQTA 3NWRA 4MZYA 3T42A 2QAFA 3QKZA 1TRIA 4DFMA 2XMJA 3ZNJ1 1NKBA 1PJ6A 4F9JA 2VBZA 2AGPA 1YTYA 2YCIX 4OUEA 1BG4A 3TYZA 4EWTA 2AGTA 1PE1A 3Q24A 1SQEA 4QCEA 4LRBA 3NA8A 4URGA 3VZYA 4FF4A 2A3HA 2YKPA 2X1BA 4DV4F 4UOHA 4MYXA 4JQ2A 3SCOA 2B9YA 1DYSA 3SDOA 3T4CA 1DAXA 5E33A 4I6KA 4QR6A 5T91A 1KN6A 1S5WA 1W9PA 4RBVA 3DC2A 1POJA 2LXFA 4YJ5A 1XCFA 4O1CA 4L4OA 3TI0A 2QIFA 5C42B 4P8UA 2VEKA 3N14A 2P9EA 4IG0B 5G2HA 2W2PP 2HFOA 2ZUMA 1TV6A 4QBUA 4J9RA 3NAIA 4ES1A 2X16A 2I9SA 3NEKA 2E9MA 3PBYA 2LXIA 1WNOA 4DUYF 3D6FB 2YGYA 5CSYA 3NQMA 3ILIA 2AD9A 3TAKA 4KKXA 1HL9A 1HNVB 3JSMB 4WK9A 1JJKA 4IMAA 1HWJA 1W2PA 1LLOA 4OVXA 4ZSUA 5G5IA 2HQIA 2GVYA 3WQCA 1BXNA 1KBBA 2BWGA 4F4RA 1LBMA 3IBCB 5IDIA 3UZWA 4ETZA 2MKIA 2QXWA 4HK5A 3AFBA 1X1NA 2DH9A 3G1FA 4DR7F 2MSTA 4KGLA 4AQYJ 3OBEA 4ZA1A 2CC0A 3UDEA 3CMGA 2VGBA 4FR1A 3DFQA 3QBCA 1O94A 1H7PA 1RJRA 3RK8A 3WY1A 3TA9A 1ITXA 1XIIA 1W5QA 3EX2A 7ENLA 2I9EA 2HAIA 3D3CJ 2ZRYA 3LM3A 2W9CA 3M8SA 2P3EA 5AFDA 3B0PA 1UJPA 1PUDA 3CJQA 3FSIA 4WY0B 2HHHJ 1S97A 3I7RA 3DKJA 2F8EX 3AD8C 1BQGA 3P5ZA 2BEFA 2CKSA 3S3GA 1ELOA 2CLIA 1HJQA 1LW2A 1ITUA 4FVMA 3UCQA 3JR2A 4Q8OA 2RT3A 4PWDA 4MIMA 1TTIA 3VU2A 1KQZA 1SCJB 4R5PB 5LSLA 3AROA 1W5PA 3HHLD 4YR2A 2PDJA 4QAIA 4DV6F 1VBRA 3SSJA 4K8EA 3G96A 4MT1A 1NJXA 4AZ6A 1BC6A 3DGVA 4Y65A 1IJEB 2WLZA 1Q4NX 1AA1B 4GJJA 4QIVA 2E67A 1XX1A 1TKZA 3D47A 4A3QA 3UXIA 3M30B 4FNIA 3TW0A 1KCKA 4QYZJ 1S3HA 4GMEA 4S3BA 3KG4A 3NMAA 2WVVB 3IIVA 1N8FA 1S77D 1R87A 1XCXA 1K8AT 4LWWA 2FLLA 4F0HA 3J81j 1CB2A 3Q94A 5KFMA 3B8TA 3OSNA 3OW2R 1I6NA 2DVXA 5I02A 3VQSA 4IGSA 1HJSA 5D02A 1VLOA 4J9JA 1G1YA 2VFSA 1QOXA 1L3UA 2F2KA 3GH7A 5D8WA 4I7UA 2AYGA 1TK5A 3JB9k 4B5SA 4U8VA 1PIFA 4XAYA 4Z2XA 1U1PA 4OKDA 2DIJA 2FVLA 3N3TA 3NXLA 3GIMA 3O6AA 4OHYA 3KWMA 1GOWA 4L9ZA 1NRKA 5F4SA 3PK7A 2AJQA 2PO4A 1V4YA 4I8DA 4ED1A 3CEDA 1WACA 1EHNA 1GYLA 3QR3A 2UXBF 2HGLA 1VPXA 4RE0A 3MV01 4AZBA 4JYDA 2ZKUA 3HVAA 4RDVA 3SMZA 3ABXA 3UDLA 5KFVA 2GAHC 4OBTA 1O6XA 3TLQA 3P8JA 3QC0A 3S2MA 3RAOA 3FXGA 4Q8FA 1U25A 3ZJ8A 1U8WA 1QNOA 1OFAA 3A3WA 5J8LA 1TUXA 2VZVA 4GZ7A 5MLCV 4OOUA 1HARA 5B0EA 1KFJA 4K2SA 1IEWA 3A9IA 4WX2A 3SRFA 3HMCA 5KFZA 4AFFA 5LJ5Y 3MECB 1ZRQA 2PZ0A 4L3NA 3PKYA 1CGVA 3S83A 3ITHA 3CC4S 5AXMA 3CO0P 4ZR8A 3AU2A 3URNA 2V2KA 2PI4A 4K39A 3PACA 3GP9A 3MR6A 3C2FA 2VOPA 4LJ3A 3MSGA 1SFTA 2RUSA 3NR0A 2PF0A 3H2VE 2OWWA 4JZ5A 3WMSA 2IIHA 1VBZA 4EBDA 3BG3A 5BOOA 1QAYA 1NK6A 2MNRA 4LYKA 1K73T 1U1QA 4LCSA 4GKTA 2CZEA 2NUYA 4F4XA 4AF0B 4NYZA 5AZ1A 1EAYC 3VIKA 3RGTA 4A8YA 2EI5A 2F3JA 3W7GA 1RWNB 2G2OA 1U2YA 5LMUJ 3AXHA 2CADA 4M6VA 5A2BA 2IYIA 1Q65A 1HNZF 1RD5A 3LHTA 2NXUA 2VOTA 1UEKA 2UY4A 3A8JA 2Z2LA 2ADBA 1RHCA 1VBUA 2C3ZA 4C6PA 2IDEA 3IIOA 4NLYA 3H2OA 3HQOA 4FF1A 5MKGB 1F0XA 3VV2B 4WEVX 1ICEB 1TPB1 5HVHA 3N15A 3I4HX 1YPXA 1GG1A 1NZAA 2R91A 4A3HA 2QG9B 3AU6A 4UZUA 2J74A 5EMMA 3BJSA 5D32A 2MLZA 1LRNA 3CV1A 3PM6A 4FLOA 5ITHA 3KLGB 4AEOA 1HMVA 2OPQA 1KM1A 3JW7A 4M6UA 3T1HF 4R53A 3FMBA 1SC4B 2QGFB 1TPC1 1B2YA 1MWZA 5B0AA 1GJPA 1ITPA 3NGUA 1UJ4A 5BR8J 3SZ2A 4PRFA 6AT1B 5G4DA 5HROA 1GNKA 3AJ1A 3VALA 2XFWA 2CQ1A 3QQ0A 4FNRA 5CYQA 2DSWA 3W85A 4LUSB 2DGVA 4DU7A 3E01B 3W76A 1Q0NA 3HFTA 1RWXB 4PUDA 1S1UA 4IRDA 4OUIA 1LTDA 3E0VA 5IFMA 3FFIB 4H6RA 3I3EA 1PDZA 4USMA 1N6QA 3VD5A 3NGRA 1IKWB 2A21A 3UVJB 2RDIA 3H2MA 4ELUA 1KB3A 4GNKB 4Q5VA 3KRSA 3P82A 1I2OA 4B3TF 3E3XA 4LBSA 3SV3A 2YH1A 2NXCA 1YXCA 2EHHA 5EMJA 4PH6A 3UPMA 5HMWA 2QCDA 1DIOA 1Q8IA 4FR6A 4W7UA 3O2LA 1UZDA 4OV1A 3PRDA 1JGMA 3P4UB 2CZVA 3NGFA 5IT0A 3CGTA 1ZFJA 4HH1A 1V0NA 3TYTA 2CIPA 4UZBA 1G7UA 3R12A 4ED7A 1HD1A 4EXBA 1UKTA 3PZQA 4CIOA 3TYDA 4C91A 5K20B 1I45A 3UFCX 3SIPB 1ZU8A 1LWCB 5SUHA 1U47A 1G4EA 2DT3A 3SQLA 3PPGA 1ADSA 2HFZA 2NPIA 2ZBRA 1RH9A 2B6AB 2VIHA 2ZUNA 2VEFA 3OZOA 4WTOB 4ML9A 3KKFA 4WKRA 1JLBA 3KNAA 1D8CA 4J1OA 3GU1A 3TVZA 1BRLB 4G56A 4HNCA 3CO4A 2OAUA 5HWJA 2XYGB 2JRSA 4ZP8A 4IOTA 4L9XA 5FJIA 3BQ6A 1XRVA 4J3SA 4Q7NA 1CC7A 3VCNA 3LN3A 4RZBA 3ARRA 1TJ1A 1GPFA 4NAFA 3FBCA 1EA9C 2YFOA 5KFGA 5D3GA 4ZN1A 1DY3A 2OX4A 2DJXA 4PFHA 4E4UA 3VPLA 4ECUA 4CEXC 1E3ZA 2QJNA 2UUAJ 4HZ6A 5LNRA 1JR1A 4JI8F 3UWVA 1IYXA 3AQUA 3S5OA 2LFVA 4PXEA 5CZJA 3MUCA 5KSWA 2MDAA 3X1LB 4MKVA 4ZE5A 5KTLA 4JTAA 5JMUA 2OKOA 2BZ2A 4EWJA 3AZTA 3P60A 2OTLS 3L5MA 1KXQA 4LF4J 4HJFA 3N2MA 2X2GA 2AX0A 2ZD1A 2R8IA 3K4DA 2D23A 5I3UA 4K50A 4KV8B 2E5DA 2WOMB 1FUYA 2BOPA 2A3JA 4CQAA 4B9MA 2FJDB 4AZCA 3ZR4A 2BBEA 2DNLA 4MADA 1RHQB 3R94A 3NCPA 5E3PA 3WFLA 3VGTA 2E40A 5FSDC 1MU2B 2IMRA 1TPDA 5CGQA 3UY8A 2RH3A 4M63A 4ES3A 2X0YA 4WRHA 1AG1O 2UXCJ 4CLWA 4JCMA 4AWTA 1APSA 3NL2A 5I5RA 3DUGA 2MKSA 5FJTA 3SUSA 3WDPP 2V81A 3MU7A 3LTYA 4ZP6A 3TJAA 1SSGA 1VOMA 4JI7J 4ATLA 3G8RA 3WLRA 1T03A 4OZNA 4FYDA 3H53A 5C9ZA 3PAJA 4Z08A 2WVCA 1EBHA 1P6WA 2WVEA 2E1PA 5GAEU 1JI2A 5AHLA 2XVLA 2OJ3A 5GAHI 1NU5A 5C2GA 3GIIA 2XS2A 3J81U 4ZVGA 4FS9A 3IR7B 4W98A 5LYRA 1XINA 4PB4A 4QW9A 3QRQA 3QLDA 1KWGA 3I6PA 4LYRA 1BQMA 4PUOB 3QO9A 6PTDA 1BXBA 1S1WA 2G2YA 4O53A 1HO4A 4KPLA 3KOAA 4HR2A 3DRRA 4PA8A 3TC3A 7TIMA 2XHCA 3DCPA 3LGNA 3QYYA 3M4XA 4IH3A 3QZ7A 3MYPA 4IJBA 1WUFA 5DT5A 4NAEB 2V5LA 1FRHA 2PDFA 3WF4A 2EO7A 1DJNA 3KHRA 3KDNA 1S3TC 4UC5A 3WLOA 1DV7A 2GUUA 1RTDB 2V2DA 1RTIB 3NURA 4CP5A 4KRUA 1RT3A 3R7NB 1AW1A 2AGQA 3SCIE 4MTVA 2KYZA 1O5QA 2CJYB 3LY0A 4AD4A 1Q8BA 5FLXU 1TPEA 2ZZ5A 3WQEA 5DQIA 3E96A 3MMTA 1NDLA 3S1UA 5CPOA 4QQBA 1R47A 1UQYA 1AZSA 1OMSA 4UIOA 2Z1BA 2W4CA 3WYZA 2BY0A 2VONA 1VLYA 1JLAA 1J5OA 1H7OA 4BLGA 2H5JB 2H8XA 4U7UD 5BOFA 4S3CA 1OWQA 2AL1A 3E6EA 4J3ZA 2OGJA 4MJKA 2W27A 3H5YA 4R5EA 1N7KA 3GVGA 4BA0A 1P1LA 3EZ5A 4LB4A 3WD3A 1V5VA 1A6LA 3AYTA 2I57A 4DUWA 2VOMA 2K1RA 3LTSA 2F1FA 2NREA 2R8GA 4UT4A 3CJ5A 1XIGA 1G3OA 2QCNA 3WLTA 2R7WA 1CB7B 3DFPA 4PUJA 3TVKA 3RB0A 4UY8T 4RNFA 1QASA 1KVIA 5A8MA 4E2OA 2WMKA 5I00A 2AAAA 1NFPA 3W2WB 4F4AA 3KVMA 2YNIB 3R5JB 4PQUB 2Z6JA 4HA0A 4DPUA 3TMLA 1REVA 1QTWA 2PAJA 4HSOA 1GMUA 2AKWB 1QW7A 2MYFA 3P3DA 4QWEA 1XQLA 1IGSA 3VOCA 4Y90A 2LEPA 2YQ3A 4J3XA 3HSJA 4RL1A 1C1CA 3TJ9A 4DXLA 1FJ7A 3TJ4A 5H8MA 4KGXB 1RKIA 2ZH9A 4Z17A 1FCAA 3UN5A 3AD7C 2OPRB 2ZJQQ 4EO6A 1LZOA 1QFEA 2DHSA 4UOGA 2J0XA 3RRGA 1R0CB 4O44A 3BG5A 3G1DA 1TFYA 2IYGA 2QHAA 3RNDA 1JLEA 1MRAA 4WDWA 3W1RA 4S3FA 4A2RA 2PEBA 4H4MB 1H1YA 1LWEA 3I0RA 3CLMA 4F0MA 1CG2A 4JV5F 4Y2WA 3PG9A 5D05A 4CM0A 3UG4A 5H9EK 2HAFA 3B9NA 4REQB 2QZRA 1K8YA 3MCSA 4KKOA 1RABB 3W1MA 2CQ3A 3PWIA 3CE8A 4XPCA 1LRQA 2V2ZA 3S6OA 3VE7A 1UW9A 2WVSA 3GH4A 4GO9A 5FF7A 1A53A 2BGQA 1VP5A 1V02E 4RW5A 3UJFA 1LXJA 4NRTA 2GOUA 1LFPA 1FI4A 4EGLA 4MKAA 5A6SA 4YHHF 2ATCB 3QBUA 3OR1A 4PG7A 3V1HA 1JULA 1EIXA 2PP3A 3BLKA 5J1NA 3ZS4A 1NQKA 3NZRA 4ZBCA 3WQWA 3V0SA 3CTRA 1RVKA 3QGIA 1Q81T 3M47A 5KAKA 4JTDA 1EDGA 3NVTA 1IVZA 3GSMA 2C7FA 2LMIA 4DL2A 2EPLX 1YADA 2FZBA 4ZB2A 3G8QA 2P53A 4HHJA 1K9TA 3NL0A 2SFPA 5EL1A 3PFMA 3DMJB 3N6JA 1R3TA 1SJ3P 4P6QA 1EX8A 2Z1KA 4F2BA 1W25A 4HCHA 2CQHA 3OLGA 4CH1A 2V3GA 2QJGA 3LTOA 2J9DE 4PXCA 1WXYA 1VQSA 4XIMA 5DO8A 1Z89A 3BSGA 3QIPA 1B3YA 5BW6A 2FZDA 3A3OB 5J2QA 5B0DA 2MQNA 1NO8A 1UWIA 1VFUA 1EJRC 2OJPA 2XUCA 2OLWA 3EICA 2GAGC 1P0BA 1FF2A 4KBXA 1K1QA 2W6RA 4GC3A 4GY7A 1JUKA 2A0NA 1J18A 4S2BA 4JY8A 4XZLX 4QHRA 5L9NA 4MYAA 3GUGA 8RUCA 1AD1A 4FALA 2BHUA 5DBTA 4DSFA 2Q02A 4Q8QA 2V8ZA 4KETA 2RUGA 3QRPA 4TVCA 5HMFA 4DL5A 5AE3A 2P8BA 2Y1IA 4NLWA 3WUFA 3RR7A 1WX0A 1UEUA 4AZGA 5KT4A 2JKPA 1B31A 2WMGA 4M5PA 4QWBA 3W7CA 5GJPA 3OW1A 2I38A 2G3MA 1JYVA 4IGHA 4KQNA 4PMXA 3NG8A 2GJPA 1HQEB 3MAAB 1B3VA 4LF6J 1KC8T 1YTEA 2Z7KA 2HZAA 3IRWP 2NYIA 5A8KB 2PGEA 4RZ5A 3I65A 3O15A 4KRWA 1S9FA 4ZHRB 3QOMA 3OTOF 2RFGA 2ZM6J 3BDPA 3VQTA 2IBOA 1CPUA 3ENAA 1NSJA 4LV9A 3FOKA 2HVEA 2RSQA 2O66A 5EFDA 1PCAA 4NNCA 3CCQS 2VPZB 4J9NA 1Q2SA 2VDHA 3JQKA 3J7ZT 5HAOA 2R2UA 2G1HA 4TXSA 1JUEA 2R8HA 3AO0A 4W4MA 3G71S 4YL2A 1D0EA 1TKTB 2VDGA 4L3KA 3AOAA 4GQGA 1LW0B 4GY0A 1IT0A 1VGYA 2Y7FA 4GUFA 2M0GB 4M5LA 4DFKA 4JV1A 3RB3A 2FHJA 4AXJA 1IZKA 1KFEA 3BUVA 2B5JB 4GIYA 1XSKA 1KOHA 4U8YA 3DI1A 2LQ9A 3W6MA 2MGZA 4AZHA 5B7ZA 2PBOA 2OWXA 1QD1A 1S6PB 1W9DM 3NOEA 1OT1A 2WKLA 4PBFA 3US5A 2UVWA 4K7YA 4FHAA 3UG5A 1R0BG 3GO2A 2E5LF 2C19A 3GKFA 3OZYA 1VIXA 2FTYA 2KH9A 1XGDA 3KNGA 4IUGA 2OTJS 3KUGA 5D4PA 1SZRA 3ITVA 3USBA 3WQDA 3SBMA 2VZUA 1OJ4A 4O3OA 3RXZA 2CNCA 1DARA 3Q37A 2KM8C 5K5MA 3C0JA 4D3GA 2YX7A 3LI1A 3WJYA 3CDEA 3AAWB 1TMLA 3E9AA 4R34A 5GPRA 2FVCA 1FWJC 4YYFA 5KT2A 3IANA 3VINA 3HM9A 3M2RB 1UR2A 1GT8A 2D22A 3Q67A 5HDRA 1B4SA 5TQLA 3FHAA 3MUY1 1SJBA 2Y6ZA 1CNVA 1NOUA 1TL1A 3B0XA 5AHEA 2B3TB 2GHVC 5A8RA 4DHVA 2A6LA 5HA7A 3RZAA 4BS2A 1UYQA 2A7PA 4F8XA 4K1GA 2EG6A 3KOWA 4IPPA 3EDDA 1T11A 2VVNA 3PPHA 1JDCA 4FNQA 3PKMA 2EJAA 2X1TA 2KZZA 1MQPA 3NQ2A 1AYEA 1UMYA 4R8UB 1A7GE 4LFBJ 1POKA 2HBVA 2HIYA 4OHWA 4RR4A 2WBRA 4M5NA 2ZZMA 1P7TB 4DV1J 2J75A 2HFVA 2RGMA 1Z9AA 3ANVA 1E1CB 4LQ1A 1S59A 1UA7A 1AH0A 1QE1B 5CYMA 1MROA 4XVEA 1NAL1 4NUWA 4QJ3B 1KOOA 3GLJA 1JXVA 3K30A 3FEXB 1QTNB 1Q6LA 4O0KA 3KLLA 3SGUA 2GFFA 3ULHA 4X64F 2O3DA 3CIMA 3HPZA 4C7DA 3WQ8A 1Q16B 3P84A 2P88A 5EWFA 2Z25A 2J6SA 4F2RA 1RWOB 5KT3A 5EHHA 4OYPA 1HP5A 5IBXA 4BKNA 1F8IA 1RTZA 2B9EA 1TE6A 3IR6B 3TNVA 2UU9J 5KFUA 2R7SA 5FACA 3M8RA 4BI5A 1PL9A 2CPJA 3CMFA 2KJVA 1KLZA 3C2YA 4AHPA 4LF2A 5KFEA 3U1NA 5K14A 3M0ZA 5D09A 4WSKA 1V5IB 4CQ9A 3KJFB 1N8IA 2GVEA 5A6PA 3H4GA 1VF8A 3CDBA 1ME9A 2ZITA 3CJ8A 3CW2C 3M0KA 4MWAE 1T8EA 1E1FA 3QLLA 1YWXA 4B15A 4Q7BA 1UWBA 3O6YX 1FE4A 1NDPA 1DQWA 4IO1A 3PW5A 3SGZA 4NT0A 1VEOA 5DMYA 1RTHB 3CDUA 2NX1A 2CIMA 2MQMA 3LBOA 4J5NA 3OQ2A 4NZ7A 1YNYA 1PJ7A 4JL2A 3DFSA 4G9PA 1HBOB 2XNQA 1GOIA 4GQBA 4Q6XA 5IFPA 1WOOA 3NEVA 1BYCA 5F8LA 4RE4A 3PO4A