3KDNA

Crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
437
structure length
436
Chain Sequence
IYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKGLRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDLLSNGADYMDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQRLEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFVLAKLYRLIGIDQLHVGTAGAGKLEGERDITIQNARILRESHYKPDENDVFHLEQKFYSIKAAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIPLDEYAKTHKELARALEKWGHVTPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based catalytic optimization of a type III Rubisco from a hyperthermophile
pubmed doi rcsb
source organism Thermococcus kodakaraensis
molecule tags Lyase
molecule keywords Ribulose bisphosphate carboxylase
total genus 142
structure length 436
sequence length 437
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00016 RuBisCO_large Ribulose bisphosphate carboxylase large chain, catalytic domain
A PF02788 RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.110 Alpha Beta Alpha-Beta Barrel TIM Barrel Ribulose bisphosphate carboxylase, large subunit, C-terminal domain 3kdnA02
3.30.70.150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits RuBisCO large subunit, N-terminal domain 3kdnA01
2D69A 1RBLA 2VDIA 2OEMA 2V68A 4F0KA 2QYGA 4LF1A 5RUBA 1IWAA 9RUBA 4HHHA 1RXOB 1AUSL 1RCOB 5HAOA 5HATA 3NWRA 1GK8A 1RBOB 5HJYA 1TELA 3FK4A 3KDNA 3ZXWA 4F0MA 5HK4A 5HQLA 2YBVA 1RUSA 5HJXA 3AXMA 1BWVA 4RUBA 3WQPA 8RUCA 1SVDA 3AXKA 4LF2A 4NASA 2OELA 1EJ7L 4MKVA 2V67A 5HQMA 1GEHA 1UZHA 1YKWA 3A13A 3A12A 3RG6A 1IR2A 1AA1B 3RUBL 4F0HA 2V63A 1UZDA 1RBAA 1WDDA 5HANA 5C2CA 1BXNA 2OEKA 2ZVIA 1RLDA 3QFWA 1IR1A 2CWXA 1RLCL 1UWAA 1RCXB 1UPPA 1UW9A 1RSCA 2CXEA 2OEJA 2VDHA 2V69A 5C2GA 2V6AA 2RUSA 3KDOA 1UPMB
chains in the Genus database with same CATH superfamily
1BWKA 3NGJA 5HMSA 3PNIA 4L75A 4WKYA 3DN5A 2NCKL 4FA3A 4XUYA 1G01A 5M2FX 4RW5A 5KFYA 3DM2B 2F63A 4GVHA 3UBPC 3ZR6A 1ICSA 1WELA 3C6UA 3T1YF 2DGOA 4J9VA 2ERRA 4KT0C 4GIAA 1NJJA 4L6HA 3AALA 2FTRA 4PWUA 1HWUA 1O1HA 2PLKA 4WFYA 3APYA 2VR5A 2W9AA 1HKWA 3MPYA 2K06A 2FFIA 3CCUS 4XDCA 4OI1A 5A2QU 5F2MA 3E2QA 4CM2A 5CQGA 2EQDA 2XY6A 1E6PA 2V8ZA 2FTWA 5EBUA 3T4WA 2R9RA 3J81Y 4NLDA 2XI3A 3KJQB 4EK7A 2YDRA 5B0DA 3ATYA 3MI6A 2E9TA 3ZJ7A 1RU1A 1I1WA 3GRIA 8XIAA 4DSFA 3ORWA 3NFUA 1E15A 1VDHA 4I0WA 5LSMA 2LDYA 3OR1A 3R5CA 1DJZA 3H0PA 3T1YJ 1U5JA 5G2HA 1NJYA 4LFCJ 1P1XA 4GXWA 5DQPA 1S1TB 2WRMA 5F3TA 3RX4A 1YXDA 5AHNA 1XBYA 1NJIT 2AW0A 1S76D 4N9EA 4HACA 2E8ZA 2QPSA 3O63A 4WIIA 4U3CA 2YGYA 5EFDA 1V3MA 2GC8A 1WSRA 2EEYA 1NOWA 3DN9A 5REQA 5A8NA 4TTGA 4GA8A 3GFYA 2M7SA 4Z2LA 4B9MA 5GMEA 4O57A 4I9MA 3DMJA 1IR1A 4URIA 4DN1A 1CEOA 1EZZB 3VVGA 2JNJA 2RGLA 3NVDA 2RU3A 3KMSA 5C42A 4Y8EA 1RTJA 1VQLS 1V5IB 3Q8PB 5DFAA 1Q7MA 1KOHA 1PE1A 1XBVA 2YZRA 1HNWF 2GVEA 1RP9A 2QDDA 3V5CA 1XLKA 3VAFA 4BDPA 1QOXA 1VFOA 1XDLA 3V5RA 5DM7Q 1RWPB 5ETOA 2V2KA 5LIKX 3DGPA 1S1XA 1GW9A 4YOEA 1F4AA 2PDQA 2NVDA 3VC5A 3L09A 3HG5A 2Z0GA 2KYXA 4OYWA 1K70A 4DR6F 1IXKA 1XX1A 4M3PA 3T4CA 4PG5A 3ONBA 2HS8A 2X7VA 3N34A 3SQLA 2DH2A 3NWGA 1RU2A 2EC2A 1KR4A 4KWVA 1I6NA 1S1RA 1PXGA 3ZT7A 4C8MA 3TOPA 3KM8A 2WC4A 2RF2B 1XLAA 1SZEA 2P10A 1PGZA 1DJGA 3KHJA 1UZDA 5TD4A 4JI1F 5K14B 3NQCA 3GS6A 4PMJA 2ZDRA 3B97A 3NXLA 3UXLA 2D1CA 2V34A 2V94A 1YJNS 1F61A 4POCA 4Y9MA 1R3TA 4NCGA 4ZS6A 1J0IA 3CL7A 4NNAA 3H4XA 1DTQA 1SC4B 1XNRJ 3OGRA 3CDAA 4F3QA 3AXKA 2C7FA 5HDRA 1EFZA 4XBSA 3DC8A 3H2AA 1WKFA 2BZNA 1OFAA 3F73A 2DSWA 4WCEQ 3WDPP 3CS2A 3N19B 5E0FA 3PBGA 1PB0A 3G82B 2VFHA 2HHPA 1ZY9A 1A0OB 3EDQB 3PJXA 4IRCA 2GVDB 1H1NA 1AQMA 5KG0A 1TE6A 4OTKA 4JI3F 1GYLA 1XERA 3TUZC 1XCXA 3P96A 4B3MJ 3LQLA 1UP2A 4F2BA 1E3ZA 3CCWA 4J27A 1UW4A 4NU7A 2E1CA 4LSNA 1QUPA 4LFBJ 3CO0P 4EZ6A 1YXYA 1EQCA 1GUVA 4ZSUA 1E0XA 3T9NA 3BZQA 3MHGA 4YU1A 1UZ4A 3M2RA 1LG1A 4NEYA 5EUHA 2GVJA 3H55A 1H38A 4PFHA 3W85A 1FBAA 2V9WA 4LV4A 3HHEA 3P5YA 1S5VA 3WJWA 2DPEA 2PMZD 2CLMA 4ZB5A 3TRGA 3LOUA 3ENVA 3RIKA 1QM9A 2CDRB 3KAOA 4ES3A 5D04C 3DYMA 2M0GB 4NAFA 1GX6A 3BDPA 5EMLA 2QCFA 3TVYA 2Z8QA 1HKMA 4AVNA 1LWEB 3M6VA 4MJ4A 1VAHA 2WCSA 2J9DE 3O6DA 2DIEA 2OU4A 2ZH6A 4IUGA 5LXXA 1IWGA 4PEKA 1OGBA 1YPXA 1GMVA 3CCMS 3UQSA 1R31A 1IQTA 4R9XA 3DLJA 2V8DA 5DF0A 4S0MA 3NPWA 1PWMA 2WBGA 3VDAA 5C7VA 1U2RA 1C1BB 3P5TL 4DQSA 4ZPTR 3BTNA 3IVUA 1K1QA 4OUEA 3HPXA 2BSLA 4AFYA 4RW4B 2JC1A 5T41A 2K7KA 3T6CA 1SBRA 1EDGA 2OT0A 5G2WA 2BE2A 2LFVA 2RF2A 5AT1B 2GO9A 4TYAA 1XINA 4AL7A 3H8AA 4YIWA 3D0GE 4IX0A 4PUNA 3LP1B 4JTCA 3R97A 3C52A 2ABYA 1RWVB 1MVYA 2PDNA 3KOWA 3WLLA 4GWEA 3OLDA 5B80A 4A8WA 2IAJB 3A3NB 1RCOB 2W62A 4D6IA 4ILLA 1KLYA 4MIAA 1SIWB 1S9GA 1NH6A 1EARA 1TUGB 3GO2A 2PEVA 2M3DA 1TZ0A 1TB3A 2OGYA 4KS0A 4ERAA 3PO5A 1WI6A 4JTHA 4JNYA 1LFPA 4LUTB 1DWGM 5CHCB 4I2QB 5CZSA 3BOXA 5I42A 3T0DA 1SKRA 5IFTA 5G1TA 1QVFR 1CYGA 2HCVA 4DUVA 2DO4A 1QFEA 1BGAA 2IM0A 2Y2WA 3BAXA 5CPQA 1P1MA 4B3TF 2RT3A 5DO2A 1VRUB 5EN1A 1T41A 4E2DA 1JAEA 4DQWA 4XKYB 2EK1A 1D3WA 4FNRA 4JGDA 1S1XB 4IMCA 3AS3A 3IWXA 5HMYA 1X5PA 1CGVA 3T09A 4WU2A 4JTEA 4RW3A 3G1SA 2F8HA 5DG8A 5A2CA 2TYSA 1WZMA 5K7JA 4Y34A 4H83A 3M7VA 4K4VA 4PMDA 3FVDA 5KZEA 4RU9A 1BF2A 3GNPA 4NVTA 1FT8A 4H1ZA 1D9DA 2YW4A 1EIBA 4JI6J 4LF6J 3ILLA 1NF7A 1S3HA 3WO8A 2ZZ3A 1NELA 2DGXA 5ITHA 3EKZA 4B3RJ 2ZBTA 3SM0A 3DGPB 2DZUA 3GJQB 3VI2A 1XR2A 2YOCA 4M94A 2V3EA 3VCCA 3SN0A 2BXJA 1GJWA 1XL9A 3WDHA 4XBKA 1FNMA 4R0EA 1XLIA 4CNUA 4YVVA 3DH7A 3W25A 1NY1A 1GOXA 2UUBJ 3ZNUA 5E0CA 4N76A 1JD9A 1PKUA 2IDEA 4DPOA 2YKQA 1KC7A 1N82A 3TZNA 2I56A 3LXAA 2ZE2A 4DR6J 3UW1A 1A5AA 4W93A 3DIPA 3W7LA 1LORA 3D5HA 5CZTA 2PGCA 4JN7A 1UKUA 2V2HA 1FTXA 1TV7A 4GLEA 3GJTB 1YXCA 1LLOA 2XFRA 3FKRA 2WVBA 2YKPA 3FSXA 2ZADA 2D3LA 4FMVA 1RTIA 1IM4A 3CWHA 3LUYA 2R8WA 1VK8A 4OJHA 2XFWA 4G7EB 1PIGA 2R8KA 3U9IA 1SJ3P 3GDMA 1TKKA 1XYAA 1FFSB 4O0IA 3AOFA 2ZOFA 3WD4A 1TZ7A 3HM7A 3W26A 4HPHA 5E33A 2Z28A 3HG2A 3I68A 5J2MB 1VC4A 1SFLA 1LCOA 1V4YA 4FXVA 4B5XA 4B9UA 1RLCL 4F2UA 4AYBD 2DSVA 3R1ZA 4ATDA 4JQ4A 3MUY1 2HRYA 2R1NA 1NDPA 3RCMA 1O94A 4S2BA 2HDJA 3IJ7A 5A6MA 2BACA 2ZXDA 4DJBA 3GE9A 2E5DA 2CPYA 1XYFA 3SCSA 1SYTA 2BHZA 1Q8AA 1I2RA 3MUCA 4JS3A 1FCAA 5HMXA 3RRGA 3MMJA 3M1VB 2PS2A 4ECTA 1EP1A 3V6HA 5KFXA 1R0BG 4J9RA 1SO4A 1RYSA 3CUFA 3PNZA 4DELA 3BKFA 2QEZA 1H5YA 1GFWB 4JN8A 3M6XA 1DIOA 4JTTA 1XYBA 1ZM3A 3NPUA 3D54A 4CTAA 4DWIA 5K3VA 2QZ8A 1XC4A 2CVEA 1JQGA 1ZBTA 2LYVA 2D3O1 2E6FA 2MANA 3QAUA 1JIHA 3GAKA 1S6PA 1K1DA 2A3CA 2QVHA 4IMFA 1OX6A 1LYXA 3GDBA 3QTGA 1XC9A 2VG6B 3NL0A 4ZOSA 1VFSA 5HMWA 2MQ8A 1JCTA 2ZWPA 4CLFA 4Q8NA 5A8OA 1BC6A 1LOLA 5DN1A 3V6DA 4P2MA 2UP1A 2DHSA 4H6QA 1HWKA 3AA8A 4MAKA 2BE7D 4N7QA 3MMBA 3HJFA 2J27A 5A94A 3B0YA 2FC9A 3WNPA 1LT7A 1RPXA 4LB4A 4C6BA 3CCQS 4M5JA 5IDIA 3VZHA 2CZEA 5E0KA 4CRJA 4H6RA 3VQSA 5HLFB 1ZENA 3WJXA 3PP7A 3R5BA 1RISA 3S1VA 4WYWA 4J9OA 4A46A 4P75A 2FJWA 2WANA 4BWLA 1BXNA 2OEKA 4ATLA 1XMBA 2AMXA 1HIYA 2ZVSA 4IG3B 2QLWA 3MM8A 1KXVA 1F3VA 1ZBVA 4XZHA 5EPDA 5TBOA 4WE1A 5CLWA 4B3KA 1RV8A 4MFBA 5AXMA 3H40A 2XSAA 3EMQA 3CWNA 2DNPA 1D3GA 4LRBA 5E3RA 1L9WA 4UR7A 5KFWA 1W2IA 5KEZA 4UTMA 3U57A 3PO4A 3W84A 3LI1A 4IP4A 1X31C 1WHWA 2OYMA 1GYNA 4XBJA 3EGWB 1R3VA 2PBGA 3LX9A 3F4DA 1R43A 5KFIA 5CYMB 3DOPA 2TSYA 3W1UA 2L08A 3DG6A 1POJA 3DRPA 3ITVA 3CUIA 4Y9NA 3FGVA 2VDIA 2ZEJA 3TXVA 4JTAA 2V8HA 4WSHA 4FXWA 3GR7A 4PUMA 2HNZB 4GABA 3AUOA 3RLGA 3H54A 3FYOA 1VQ6S 3PIPQ 2C2MB 2GDUA 5HJXA 2V3FA 3C2OA 1M90T 3DAQA 4G5DA 3BARA 3UR7A 4QIFA 3PYGA 1DJHA 1NBEB 4K0KJ 4X22A 2ZWYA 3BPWA 3R94A 2JE8A 2YL5A 3TWAA 2N3LA 1IT8A 4GUGA 2AJ1A 4WZHA 3TUUA 2A2DA 3SXLA 3DFPA 4GQ0A 2MPUA 4JKKA 4HMNA 3H20A 1HHQA 4LR7A 5KZ6A 5TIMA 2NR0A 5KT5A 2X3GA 2MJUA 1JNDA 1P27B 4NT0A 1IF2A 1WORA 4BC9A 2C42A 4FLRA 4HSNA 4O1EA 4DPTA 1KRPA 2VL4A 1PYMA 4S23A 1HJXA 1P6CA 2O7QA 3LZ5A 2XSJB 4URGA 1NK5A 3ANYA 4DYKA 1FKPA 5CH7B 4H4OB 2BOEX 2BVWA 1MZHA 1ZA2B 3MOZA 1LFWA 4YWIA 1ZM4A 4O3QA 4WXYA 4DWSA 2HZAA 1JULA 5HUOA 4A48A 3AHZA 1RK5A 1ZCCA 2YW3A 3UWYA 3O2IA 3BLIA 5HL7Q 1Q45A 1JJKA 4LF1A 1G7UA 2VFEA 2VGGA 1TL7A 2OO6A 2BJ1A 2B5JA 1EL3A 1NTHA 4ECWA 2PDFA 4H19A 5H8MA 3QR3A 1V3RA 5D32A 1WP6A 3AWOA 5KG2A 1UD6A 4PQAA 2PDMA 4I5UA 1OY8A 3M5XA 2FD2A 3MMBB 1JFHA 3K8MA 3PC0A 1M7OA 1ICEB 1SGJA 5AYBA 1VHFA 1JDEA 1RQBA 5IC6B 1JI1A 2D1ZA 4GC4A 3CJKA 1MEIA 3FV9A 2C2ZB 1X9SA 2Q1LA 2OEJA 1KHVA 4ZLNA 5K20B 3LGEA 4HK5A 4FN5A 1IT0A 1JYVA 4Q6XA 3WQGA 2V5HG 4IKAA 1X98A 2VC9A 3ARUA 1TA3A 3PUOA 5D3GB 3CTTA 1TWWA 4CTAB 3ABSA 3B9OA 2VASA 1T11A 3AO0A 1VHIA 2W01A 4UTIA 5L1KA 4REQB 1V6HA 2R2TA 4JI4F 2VX4A 4A4AA 3OA3A 3S5OA 2VM8A 4W85A 3GHTA 1O8BA 4FXRA 3EX1A 4RX0A 5DGBA 3PX4A 1OABA 4I68A 3B0VC 3OZYA 4N02A 4KHPF 4XTTA 2CYGA 3A8IA 1VFLA 2QCHA 1AL8A 1CXFA 4M5NA 1FRMA 3LWMA 2ISDA 3C2VA 3E38A 3S42A 3ILIA 1MROB 4U67Q 2F2KA 2A1BA 4NKCA 4CD7A 4P74A 3WF0A 1LW2A 3GWCA 4C1NA 3POTA 3CD7A 5HWNA 4F8XA 3V0TA 1X6LA 3AYRA 5ECUA 3VGFA 1H0GA 1F1BB 4Q8PA 2UXBF 2ANUA 2X0YA 1XLJA 4OHVA 4Q7IA 3JUGA 3QEZA 2CBJA 3UT0A 1XN9A 3U8GA 2ROPA 6FDRA 2MSSA 2HMIA 4JTGA 4LX4A 1AFSA 3CV2A 4A6GA 4FBTA 1AD1A 1APSA 2EGZA 1K02A 2A7NA 1E70M 2VEMA 3KOYA 1YWXA 1Q6RA 2RQ4A 1UR1A 2DORA 2Q01A 3STFA 3TOQA 4LCRA 1TVRB 3I7RA 4OHQA 4K4YA 5L46A 3ZLGA 4EYHB 1PO6A 5ECVA 3SQGA 2KRRA 3WUEA 2WXDM 5I42B 2OOFA 4NJGA 1JLAA 2X7IA 2J7CA 2WSCC 5JUVA 4XK8C 1UWQA 1XS2A 4O14A 3DCPA 4QS6A 4ED8A 2DFAA 2KXNB 3PAOA 2ROEA 3TA0A 3HVTB 3I7QA 3KDNA 3PPFA 2DGSA 2R8GA 3ARVA 1ZAHA 4GHRA 5IOBA 3KBJA 3WELA 1NFPA 3AD8C 3VD4A 2IKHA 3PBWA 5T91A 3OVRA 4I6WA 1U2YA 2WKGA 2XVLA 1BUXA 2E1WA 4H9ZA 4J9PA 1W3IA 4ELVA 2GGIA 5BOFA 3SMZA 1I94J 3J80U 2J6SA 3DHXA 4YS1A 4IG0A 2Z0IA 4HTIA 2QJHA 2YKNA 3LGHA 4R9OA 2CJXB 2HHXA 1UVKA 2LEBA 1WZAA 4IFVB 1TJ0A 4FLQA 4L1GA 3WEMA 2HVNA 1FCQA 2JALA 2YR1A 2PDYA 2XCPA 4NAEB 3VINA 1GAOA 4S3FA 3MCMA 4ES2A 4NA3A 3R9LA 1SJFA 1GW1A 4B15A 3WQ4A 4B9NA 5E7OB 5BW6A 1UUQA 5B0BA 3BG3A 5KFJA 2I9UA 3SJNA 2CBIA 2J47A 4NJIA 2OHDA 1XIEA 5KG7A 4NLVA 3UG3A 1EOMA 3W2WB 3ZMRA 2ZHAA 4PH6A 4MKYA 2Y0SD 4FHAA 3EMZA 3L21A 2V5KA 1YTYA 3UD5A 4M6PA 3HHDA 3W00A 3EB3A 2J6UA 4JI6F 2GSHA 3NEVA 4M0XA 3MC5A 2INEA 1QNSA 4C0BA 2J9CA 2INZA 1NB2A 2NZLA 3PBMA 1GT8A 4UMBA 3TVKA 3CV6A 2JHEA 2BGNE 4K7VA 2OP5A 1SR9A 1EOKA 5DBTA 2DHGA 3UR5A 3X3UA 1R0CB 3T5JA 3OFHA 1CGTA 2COLA 1YSJA 1TV6B 4ZCLA 2RAQA 3RBDA 3W4RA 3SADA 2Z1BA 4BCEA 2NT1A 5FJIA 3NCOA 3R11A 3GV8B 1TV8A 1QDSA 1RJJA 4GVBB 1FWGC 4ZJQA 1PYTA 1XRFA 1DQ9A 3JTOA 3U1NA 3ZYZA 3F2DA 3WLSA 4GKTA 3E0WA 4NSBA 4I6KA 2Z24A 1FCBA 3A5VA 4IFVA 1FXRA 3K59A 3MZNA 1KFKA 1SCJB 1XK8A 4C98A 4KBXA 2A3EA 5I3UA 4E0CA 3EOEA 1RWXB 5BOOA 4IMAA 3KHGA 4R7OA 4OI2A 4F4KA 4P2VA 5HR6A 2E1MC 2OJPA 5H2ZA 4NNCA 1UMYA 2FTPA 2RHGA 4GK8A 1XMOJ 4EXBA 1KFDA 1U8SA 1PSDA 4XIUA 3SUUA 3D0IE 3JTPA 1GHSA 3W72A 3GSIA 4JDBA 1KXHA 1L8NA 2I16A 4KWOA 1AJZA 3WBWA 2XYHB 3MEDB 2HQIA 4QE5A 1SL0A 1M53A 4MB3A 3L4ZA 3II1A 3AYVA 2A3LA 1M1KT 1Z89A 1IXOA 3Q22A 3F4VA 4AT1B 3PY8A 2VC1A 3G4SS 4PMUA 4X61A 4UY8T 5T7LA 1FUYA 3FSIA 5F7UA 5E5NA 2P9EA 4KB7A 1WE5A 2A6OA 4CO2A 3WDIA 3D67A 3TN3A 2LVWA 1S1VB 3TP2A 5HSPA 3SEPA 1SKWA 2EKNA 5I3HA 2NXGA 3UR3C 1KQGB 4LXFA 3W24A 4I7VA 1TWZA 3LAKA 3BSMA 5DM6Q 3UG5A 4KFOA 2R1LA 2IPOB 4UFHA 2AEFA 3H25A 5K4XA 2VG7A 1RWOB 4GVBA 5FJTA 4C7FA 4PA8A 1LF1A 1Q7LB 2DCUB 5C42B 3DXIA 1DIKA 1Q5YA 1VGYA 1FJGF 4MTPA 3HVTA 1KWMA 3B8UA 4YDXA 3GYNA 3H5YA 4PABA 1DHMA 3CJ8A 1IEWA 3PS7A 3CMQA 3OVQA 4QM1A 5BXPA 3N5FA 3ZTOA 4OBTA 2X09A 3W1YC 2PD9A 1ZJIA 1NF0A 1ZZFA 3E01A 3NDYA 1F5CA 1SKSA 4JYFA 4Q2MA 2OOGA 1Y5XA 2J9DA 1UD5A 2RKIA 3R27A 1RY0A 2DSKA 2FPHX 5LJ5Y 2QJGA 2WZEA 3NAHA 2QL5B 3AMKA 1RQEA 2BODX 2AQOA 1SJAA 4NJKA 1ITXA 2L41A 2MQNA 3R8YA 4PUUA 4B9ZA 3OL9A 1JI2A 4EX4A 3IGNA 1WC3A 4M56A 2VC6A 4DLFA 1ICQA 1Z3NA 1N8RT 4BK9A 4DZAA 1SZGA 4NLQA 4C1NB 3TW7A 2HK0A 1UYQA 3THPA 1E4NA 4NCAA 4UZUA 1QNQA 1PJ7A 2HHTA 3QV6A 4GC3A 2XM1A 4ANCA 3C2YA 4D1JA 5JVGQ 1BGGA 3H4GA 1PKLA 1KR0A 3OR2A 7AT1B 1OIAA 1WDQA 3DLEA 4ACYA 3HG4A 2ZRVA 3OR1B 2PU1A 1LWCA 2G37A 3R6GB 3NL2A 2YL6A 2QSWA 5D77A 2FFCA 3D7SB 2MKKA 2UXDF 7TIMA 2UZAA 4UOQA 4TQSA 3HHNB 2A7PA 5EA9A 1P0EA 4REQA 5LL6d 3I4PA 1DBDA 1B1YA 3JSYA 4MIBA 3R8HA 1I2QA 2DGAA 1V5VA 2CZFA 5ABFA 2E25A 3R4IA 5DMNA 1F6TA 2O7SA 1PZ3A 3G6MA 4UUXA 3G71S 2DZXA 5K5MA 1OQFA 3NOEA 1NK7A 3EZ4A 3NQMA 2ZH1A 1NDYA 4G1KA 4LUBA 4ZVHA 1QSLA 3W5XA 2F9RA 3PVFA 2R24A 2NSXA 1W2BR 5SWUA 3SGGA 3EMTA 3AQOA 3IWLA 1KLMA 3DLGB 4GJJA 4R8UB 4YEAA 2HBXA 2XH2A 3HM9A 2WWCA 4PUOB 4B92A 1RTHB 2GJ2A 4S3GA 7ODCA 2ZH5A 1J2WA 3L4YA 3WKZA 3FVMA 2VVSA 2ZITA 3O6QA 2GQ2A 5EMMA 1M7PA 2L48A 2I5JB 3RR8A 2D23A 3S8HA 2FLPA 1F2JA 2M52A 4HDGA 1K7FA 1U6BA 2P9CA 3BV7A 4HMDA 2WSEC 4AC7C 3UESA 1EKSA 2CYYA 2RS8A 5A8PA 3CASA 4B9YA 4D71A 2EK6A 2HBVA 3BURA 3S4TA 4PG7A 2BOFX 2PSZA 1U6FA 2PGWA 5A95A 3R79A 1WOSA 2OH2A 3ITXA 1ISVA 3NQ2A 4CU7A 2GLKA 3JQJA 3IUHA 3F0NA 3GIMA 4FS1A 1PBAA 3H5UA 3S5ZA 3SQGB 1QXLA 2OXNA 3NZGA 4EF8A 3ZLFA 1SQGA 5JVHQ 3BXWA 4DPYA 2WPBA 3G18A 4BJHA 4RL1A 2WV8A 2LQBA 1DV7A 1H7PA 3FSUA 3G22A 4CCZA 3BO2A 2BASA 1FWTA 1JDCA 5A6WA 1VQ7S 1DJYA 4RDYA 1JZ2A 2ZD1B 3DXBA 5AFDA 3V1PA 2DNOA 5EWGA 5EMKA 1LUCB 2I5IA 5IQQA 4R34A 2YSWA 1MW1A 1GPFA 4QAIA 2WZHA 1DIDA 5A6KA 4A35A 4CO0A 2HXTA 3TSBA 4CKQA 1XR7A 3AXIA 3FBCA 3QIPB 3EBVA 4HA3A 2NXIA 1FE0A 2OGJA 3US5A 1LQ2A 3NWRA 2UY2A 4P9SA 1ONWA 3FQLA 3OSPA 2E9ZA 3CPRA 3ZTPA 4DI8A 2LQ9A 2DY1A 5FACA 1BHNA 3W8GA 4H4IA 4J35A 2GQ3A 1W1VA 5F0UA 1U1LA 5LA1A 3N17A 1YHTA 2AX1A 3AIWA 5HA7A 2J7HA 1DOSA 3RAMA 5G2IA 4ZKAA 4HH1A 1JZ6A 1JXKA 3VGSA 2KFZA 1J18A 2Y8VA 1XJWB 1O51A 1FWHC 4HMEA 2NYHA 3GYCA 3MEGA 5D0GA 1P4CA 2OVLA 3W76A 1KFSA 1QPKA 1CB2A 3CULA 3M0JA 4XG1A 2OG9A 1KCLA 1ZPVA 2C3YA 1HI0P 2B8PA 4HT3A 4N8NA 2WQDA 3WDJA 5CBIA 3T41A 3WBZA 3B8DA 4GMKA 1YTEA 5JIPA 3JS3A 2Z1WA 2J6TA 4UT4A 4M24A 2BXZA 3EZUA 4PSRA 4YN5A 5CG7A 2PTDA 4EI2A 1XIJA 1OQ6A 1SO5A 3J7ZT 2VG6A 2XI2A 3KHHA 5B0CA 3IRXB 2OR2A 1XUUA 4GO5X 4BC7A 2VRJA 5GQBA 3KJNB 2J5AA 3AOBA 3B0PA 4CP5A 4OX9J 1F8IA 1WNEA 3LTYA 3L0NA 3Q8VA 2IBOA 4DX3A 5CCLA 3M2VB 3TUIC 3C66A 4JYAF 1LL6A 4H4KC 3DRYA 1SUQB 4HNNA 2EG8A 3I9ZA 4PCQA 2OQHA 2IXVA 4MHBA 1N6QB 4O15A 2O9TA 3ZS4A 4DJED 1V3IA 2PRMA 2X1IA 5AE2A 1X0FA 1J5OB 4OYIA 1PIFA 3W88A 3Q2TC 4JAWA 5E09A 4ZR8A 3NAIA 3FXYA 2AX0A 5DMLA 3V81A 1KCZA 4CVUA 3BSNA 2XHCA 2WW4A 2CIMA 1YJTA 2WSKA 4LSBA 3L7RA 1FTRA 4B2DD 3IP0A 3EKGA 3MAAA 4DQIA 1ZPTA 4V1XA 4MF4A 3PF3A 4ATWA 3MUZ1 4ZCIA 3D68A 4N7TA 4E38A 4JI1J 3RMJA 2VJXA 4Y2AA 1BMQB 5BU6A 2HFUA 3GVVA 3L65A 3KRUA 3W1MA 5CYQB 1VQPS 4M6VA 1YRXA 4WKFA 3MYOA 3NM3A 1NDZA 4L61A 1QPRA 1R8AA 5A8RB 1VJIA 1QY7A 3H98A 5CKSA 4QHRA 3EX2A 3TQVA 2J62A 1F76A 2DPIA 3Q8YA 4E3VA 1N33F 4I6AA 5KMYA 3WZ0A 3ZO9A 3OHBA 1RTHA 2DJLA 4GO7X 1ZBKA 3ZSSA 1NPRA 3GMGA 3QY6A 4QYZJ 4U28A 2CNKB 3GZ7A 2D0HA 1OFQA 5LSRA 2XB2D 1EC7A 1BGXT 1NO8A 3B8WA 4F02A 2ZZ6A 1GEQA 5FJJA 4IYQA 2N7CA 4XKYA 2AYEA 2M8DB 3G6XA 3M7WA 4TTUA 5FJ4A 4FXDA 4BKNA 3CMGA 2YKAA 2UUCJ 1WV2A 1YJUA 2EJ1A 2VBZA 4C6PA 1EO7A 5LXEA 1UWAA 5LMNF 5FKYA 3BN7A 4NJJA 3UVIA 1DE5A 1BQNA 4MSSA 3W62A 4J3SA 3AIUA 3R1HA 1HJWA 1ME7A 3BAKA 3Q8SB 2WZMA 1N34J 1QVBA 5IHSA 2I6WA 1H74A 3ITCA 4CQAA 4KPYA 3QGHA 2NSOA 4JTJA 3BMWA 2GX8A 2E28A 1U1RA 2ZUGA 4HHLA 4DJDA 4OZNA 2CNOB 5FEXA 3UG8A 5I3IA 5LNUA 3PZIA 4MUZA 4JIEA 5AVNA 3PJWA 5EY5A 5JH1A 5K9XA 4ZOCA 1H1ZA 1PYSB 4RDVA 2Z6JA 2JJ4D 3IR7B 4EYIB 4RWWA 2VZUA 1DFDA 2YX0A 1US3A 1KWKA 2JK2A 4GC7A 1MUWA 2QAPA 4PTDA 1B2YA 1EKOA 4N8OA 4ENOA 1FA0A 1H11A 3QW3A 2VC7A 2ZZ2A 4QLJA 3S1WA 1TPVA 4R7WA 2NXUA 2W2MP 3Q89A 3VM7A 1S79A 3QLDA 4CQ9A 3OL7A 3VNMA 2E4TA 3LW5C 4AG0A 3GYGA 1TUVA 3GPAA 2W7PA 2ZUUA 4QW9A 4KO0A 3CQJA 2BFGA 3AXHA 2PWUA 1BLIA 2X2GA 1BG4A 3CZGA 1Q82T 4UNIA 1J6OA 4USJC 3D3BJ 4V27A 4O0QA 3PUEA 3HHLC 2NLYA 2AIRB 1M5KC 1EC8A 4RV3A 4DUWA 1KVKA 5H9FK 1U4BA 3CPWR 4D3HA 3MZIA 5A76A 1CI1A 5I77A 3E1F1 1URNA 1S48A 2G0WA 2PURA 1POKA 2HQGA 3PW0A 3A3PB 4DF8A 1UB3A 4P8WA 4FYXB 1F3FA 4GJIA 4EXQA 1RAEB 2MTLA 4CWBA 2ZZTA 1A5KC 4GINA 1JXJA 1V3LA 4B02A 2ALZA 3WBEA 2C19A 3B4YA 1JZ8A 5C6MA 1DBTA 1XCFA 2WJFA 1DTUA 2R8IA 3W73A 4AH7A 1P7TA 1E6ZA 2WVTA 1S1VA 1QNRA 3U1MA 4JB8B 2XWDA 3GU9A 2IY5B 3RUBL 2QUNA 4LS2A 4NMLA 2WMHA 4Q4OA 2QVNA 1D2KA 4GKKF 3BS9A 3MANA 4M5GA 3MTWA 3BBCA 4KESA 3M9OB 2ZX9A 3AYTA 1VIXA 2NQJA 3HX9A 2ZUTA 3WMLA 4P6QA 1WKYA 4Q8EA 2YCLA 4WSJA 3GVGA 1U30A 2BUNA 4F2RA 4HEA9 2W25A 2BY0A 4UOZA 2V5LA 5EGYA 2Z1XA 3OD2A 3D1QA 3D3AA 1XLBA 4IP5A 3VNYA 4OJGA 2FIQA 4Z2XA 2BKNA 4O13A 4N6FA 1LK7A 3OFEA 1T03A 3CC4S 1FRHA 1DLOB 4XKMA 3S01A 1LW0A 3LTOA 1TG7A 4CD4A 1B31A 1B3XA 3O15A 1TZZA 2TODA 1T5AA 2DBBA 2VCCA 1F5BA 3VTRA 3M2UB 2K8GA 3T08A 1TUXA 4TX6A 4RWXA 2FHCA 4WTYA 2XY5A 4IIDA 1AH3A 5AYYA 2OI2A 4S3EA 1FJCA 5HJYA 3QMRA 3M8QB 1NDLA 1U5HA 3T1AA 4QDPA 4GYPA 1BE4A 2XU2A 3MKCA 4GY0A 3F5KA 3H8YA 2YH1A 3P3BA 2Z26A 3RB4A 4Z1DA 1V9OA 5D2YA 4LSNB 2EVZA 2QAFA 3VNJA 1TTQA 3GK0A 2KHCA 3EWXA 4TU9A 3N2TA 1OC6A 1J96A 3T19A 2XFYA 3TK7A 2EPOA 4L76A 3BW4A 4M5MA 3GLCA 1WDRA 1VZWA 3TMQA 3LMYA 4IFKA 3ARYA 3DDNA 2GJNA 3MM7A 4DG1B 4M7TA 2JKPA 2OGUA 3IIVA 2VUNA 3VIOA 3V4MA 1DJ0A 2NUYA 4OI4A 1EGZA 3S9YA 2RDXA 3U5UA 2Y5SA 3ZZRA 3OSNA 1MWZA 3IA0A 1H4PA 2C8NA 3NYDA 5H8UA 3IPWA 4R27A 4P71A 2A1YA 2CADA 2E1DA 1AG1O 1RHQB 4DUXA 4GI9A 3WQWA 1QPQA 2LLZA 2D3NA 1RTJB 1Y3JA 5KT4A 5J2NB 4BQ3A 1RT5B 2WVVA 1WQ5A 3O07A 2G13A 1EP2A 5KFAA 5JMNA 3IK4A 4LANA 3TVZA 3MO7A 3N6MA 3NP5A 1UL3A 2RS2A 1CBGA 2ZRYA 3KUHA 1BYBA 1UFWA 4ZP9A 2DVUA 2ACYA 4ECQA 3PKYA 2GQCA 2GIFA 3ITGA 2GGJA 4YN3B 5HBFA 2YQ0A 1U45A 3N9UC 4WIWA 1KGWA 2QCCA 3NNHA 1K77A 2OPQA 1S0NA 2YX7A 4KKOA 4WTOB 1M1BA 2DIKA 4PMVA 2R1MA 4NMXA 4IH5A 2C6QA 3WFAA 1Q13A 4Q4KA 3BSHA 4IOCQ 3OTBA 1XPGA 4FKXA 4FLSA 1HL9A 2ZX5A 3W2JA 1JLEB 1U02A 5C54A 1XCWA 3IRDA 2IVMA 4Q2LA 4M5IA 4I7FA 4NZCA 3BB5A 2WNZA 4DQPA 3MW7A 2W79A 4YL2A 1KFJA 4DJFC 5ETNA 2FMOA 3FJ4A 4Z42C 3VGVA 4MY1A 2WVSA 3U7BA 4GYFA 3FZBA 4MT1A 5C24B 2ABBA 2IYIA 4CCEA 1EJWC 5DCEA 1WEXA 3CJ5A 3GQYA 1EJ7L 2GVZB 4IDKB 4NZ7A 4CCHA 4H9VA 3VVTA 4YHHJ 3HJEA 1K9EA 2DT3A 1GORA 4IIGA 3NY0A 3DLLQ 2ZM6F 3TV8A 1TK8A 1S4EA 2CUYA 1MW3A 2VOPA 1MQQA 4UC5A 3OV7A 3GR8A 1W2VA 3HFKA 3T2PA 2HURA 1OY6A 1ZPWX 3B4DA 3NQBA 5D3GA 3QPYA 3IV3A 3W1RA 6XIAA 2R7OA 5CSRA 2BOAA 1VC6A 2XMKA 4DV2J 1MMLA 1EX1A 1UVMA 1ADSA 4O1BA 4FSAA 2G3FA 1BKHA 5BU9A 2WQPA 4IQDA 3DFTA 5DDPC 4C6DA 2UY4A 2I17A 5F2GA 4C8ZA 2Y24A 3NGSA 4Q8VA 2J8GA 4Q43A 1VLYA 1VFTA 1T9UA 3OQ2A 1HIZA 2PB1A 3QLHA 4ZVOB 2LECA 5XINA 1GKRA 1UP0A 1OCJA 4C3KA 4KYZA 4NXNJ 3ZOAA 2YA0A 1P0NA 2FVPA 3LP2B 4E0DA 3LHTA 2G3JA 1NXIA 4DM2A 5BRBA 4QRNA 4L74A 4MTVA 4U5IA 3T1HJ 5G5IA 4NZ3A 3BG5A 3AQPA 3M6YA 1ELOA 2XIOA 1AUDA 4KKXA 4LF6F 4ZP6A 1DWFM 1MEWA 2M8HA 2BM1A 1B0PA 4ED5A 3N5BA 1IXQA 4LU0A 4PG4A 3LU2A 4Z2KA 3QBCA 5KT6A 2OPSA 4W9TA 1Q6EA 2ZHOA 5G4HC 3P6YC 4F0RA 4URQU 1HNXF 4ECLA 4I1TA 4GY1A 1MQRA 3AU6A 3N6NA 3P84A 3TQEA 1TVRA 1FRBA 4E2BA 1O5JA 3VKDA 4DEZA 5GAEU 2CEQA 2MB0B 2DJWA 1XMOF 1LDCA 5FCZA 3HO1A 4YTSA 5AC7A 3UY8A 1RBLA 1ZB5A 5B0EA 1EIYB 2FLIA 2HPIA 1XD1A 1W5QA 4C5ZA 1D9EA 1P6WA 5A8WB 5E9XA 2J66A 4BS0A 1KBBA 2JVOA 4QG8A 4M19A 3CZLA 2CPUA 1R8LA 1PZ1A 1UKSA 3VNLA 1HR0J 3PZGA 4IMEA 2LMIA 1T9VA 3EPIA 1VCFA 1SFSA 2QUVA 3EAUA 3AMDA 3H2LA 4O0NA 1N48A 2BJ8A 3ARTA 1X4DA 4ZVGA 4KQZA 8XIMA 5G1YA 4YCOA 2DQXA 2POZA 5T8GA 2E5GA 2J8FA 1CENA 4H9YA 3S9ZA 3VO0A 5DETA 4ED7A 3G96A 1EJTC 1G4TA 3BYRA 1DHPA 3IN5A 2YWWA 1SL1A 1DZ5A 4XZNX 4ZMGA 2XZWA 4ZVJA 3W7CA 3QPIA 3BLDA 3DHPA 3EWZA 3MBFA 4KIEA 1BAGA 2QO3A 1CECA 3GIKA 1UUOA 4XIAA 4BR1A 1W26A 4FZIA 2F7FA 3UO0A 4CD6A 2EI5A 3WD2A 2H9AB 3SY1A 5LZLA 4JR5A 3CWJA 1G0CA 1Z9AA 1JZ5A 1ZA1B 2PN6A 4CQ1A 4YR0A 4ZCKA 2Y62A 3L3CA 4IO9Q 1XI3A 1I6JA 2UUCF 3Q0AA 1A5BA 1G5AA 4ERDA 1JLFB 3VC6A 1X4CA 4LRFA 2DJXA 1XNRF 3SCVA 3RM4A 2XSFA 3DLEB 4FP1A 3C4UA 1KS2A 4I9AA 1PBGA 4PSPA 5J5RA 2ZC4A 3UDVA 3BAWA 3WK3A 4B3SJ 1X6NA 2DNRA 3T2OA 9RUBA 1E9YB 3M64A 2CG4A 3KUGA 1W5NA 2R1KA 1U2CA 4UTKA 1XLFA 1Q4RA 2J9EA 3W7DA 2J13A 4GOAA 2ZH8A 3FJ2A 3EVOA 2C3PA 2KTQA 2BA9A 1MRQA 2YQ1A 4LF2A 3S83A 1NDCA 1KD1T 2E29A 3QT5A 4UQBA 4LF5J 4HQVA 4UTTC 4LALA 5B0FA 4U9RA 2H51B 3Q45A 2QJIA 1Y65A 3KL3A 1VYPX 3GM8A 3CMJA 4NRSA 3WQEA 4TXEA 2WZIA 5CSUA 3M8QA 4M5KA 4P7QA 2DUAA 1LWXA 2CA9A 1NEYA 3H24A 4FEZA 2HQ3A 2GHVC 2P6TA 3CD5A 1DXIA 5J2PA 5BXIA 1D8ZA 2FY8A 4HI2A 4A2RA 3NRBA 4LUYA 2WHJA 1Q78A 3MR7A 1D09B 1LWCB 3MSGA 2PIIA 3CT2A 2KKHA 3STPA 3M9MB 1TV5A 1MUMA 3BGRA 3G0UA 3LRKA 1JIBA 1NDKA 2RILA 2HNHA 3PY2A 3CAVA 3IJIA 3RHGA 1WKLA 4C5YA 4PC8A 1S6UA 3CZEA 3W6LA 2P8BA 4PBGA 3R5JB 3MUTP 5J1EB 4ELTA 1OX5A 1AQHA 3W64A 1H60A 2QPUA 2Z7GA 3K4WA 4EO8A 3M9YA 4ZPAA 3PHTA 2H3DA 3IR6B 4Z2GA 1CXLA 2PTWA 4KHMA 3VV2B 1UTAA 4KEUA 1U0SA 4F9DA 2JEGA 4MLRA 2DEIA 1W9UA 4AZ5A 2E40A 3Q83A 4NXMJ 2PZ0A 2DGVA 4IXXA 2W4XA 1EJVC 4D6JA 5DDQC 2VEPA 1I75A 4XAKA 4F7VA 2U2FA 2CLPA 1SMAA 1JPDX 3SFUA 3HFZB 4WY0F 1FOBA 2XPKA 1JCXA 5D09A 2XGQA 1T6MA 4XIMA 3ZJ8A 4JV2A 2B9XA 3UERA 2EPKX 4GIYA 2QHAA 3MR5A 3TAKA 3MU7A 4D6HA 4DQRA 4L6V3 4QU6A 3E5BA 3RU6A 2CETA 3CZJA 1B0VA 1RWWB 4TLQA 1R6YA 2HZCA 4DX5A 2V63A 1VS1A 1MN7A 2C1IA 4ZFMA 3GG1A 1DWHM 1TPEA 3RN6A 1IYXA 2YH0A 4M8LA 1UPMB 1OT2A 3TA1A 3PW2A 4JQAA 2WWDA 4ONVA 3W8PA 4ZHRB 5IV3A 1IKWA 1K9DA 4RCXA 2ZWZA 3WH7A 3WDOA 1TV2A 3W86A 3SY8A 2DIVA 4AU0A 1B64A 1CNVA 2C3OA 3MR3A 2ZXBA 1B70B 1C93A 2CQHA 1K9FA 4ID5B 1O5RA 1O0PA 1WG4A 4J3VA 7REQA 2WSPA 4C6KA 4CH7A 1S4FA 4GPNA 5EWFA 2Y7FA 2Q6BA 3LBMA 1JF6A 3NCQA 1SVDA 1JQVA 3UNGC 2R82A 2M88A 4AISA 1UD3A 1VCGA 4XD3A 4ZB0A 3JQMA 2W2NP 3WEZA 1CSJA 4GUHA 2EPHA 1RQHA 4I6YA 2O66A 4QQ3A 4RBTA 1ZZMA 1EB3A 2CKSA 6ENLA 1IQ8A 1M1HA 2LP4A 3R7NB 2FZGB 1A0EA 3CJ2A 4MNJA 4AAJA 1MMDA 2YFOA 1ZCOA 3FUYA 2ZA1A 5I4MA 1A0CA 1VBYA 2DHAA 5H9EJ 1RGVA 1U0HB 2OIHA 4TU7A 4RUBA 2BV9A 3UZWA 3IVSA 4NASA 1HBUA 4WUIA 4P7RA 2OZ0A 1Q7ZA 4JI2F 2WB1D 3PW5A 4RXGA 4HZ7A 2EFQA 1K1SA 1GVOA 2PP0A 3MCSA 4WXWA 3W75A 4GYKA 1S0VA 1WEZA 4N4QA 1HX0A 4JDYA 4ZXLA 3L5MA 3K0JA 2VFUA 2JEQA 2MHNA 2C0AA 4JQ2A 3IC1A 3UVJB 5AOUA 3FYYA 3RZAA 1HNWJ 1H7OA 4IIFA 1VMBA 4WJ8A 3K4DA 4PAAA 2QG9B 1C8VA 1RH9A 2WNQA 1E6VA 3STCA 3K8WA 2KX9A 4CZCA 4ERIA 3UPWA 3W1AA 2QSFA 4C8NA 4PGLA 4MKSA 3M8RA 2QIIA 3AB4B 3RBZA 1A47A 4K68A 3GWQA 2YCEA 1BXCA 4JI0F 3TWBA 2OMAA 3DXSX 4P2XA 3QY7A 2PF0A 1Q4WA 2PA8D 4DX8H 2E66A 5KFUA 2YA2A 4PMNA 3V5FA 3T07A 2RAGA 5I09A 3LHVA 4QJVA 2NT0A 4QJ5B 3H22A 1TJ1A 3R13A 4G65A 4ZBCA 3NQAA 1YTDA 2F2HA 3KNGA 2HGNA 1QAXA 4NNBA 3MQTA 5LT5A 1AYEA 2ZBQA 1FJGJ 4FB7A 1CWYA 2DGTA 3VIKA 3KLFA 4QIEA 4HGXA 1QHOA 1DKWA 5DCBA 1C2PA 3MDFA 5DQHA 2YB4A 4A3RA 3N15A 1YI2S 1ECEA 2FZ9A 4LBPA 1FX6A 2VOMA 4J40A 1ZJHA 1K47A 2NXJA 2GO8A 1JCNA 3TE9A 4J7RA 1PZ0A 3S2MA 4LCSA 3TFCA 4ED6A 5E3PA 1K0VA 4K8RA 3NCPA 3IJ8A 4E8DA 1QD1A 1HGYA 3EOSA 3TTOA 1IBKJ 2UXDJ 3IUDA 3POCA 2W4CA 1O4UA 5GADI 1UEUA 3QPZA 4C97A 3EWWA 3DEQA 4ALZA 1O66A 1V3HA 2C16A 2VQFF 1FWIC 3QO9B 3U2CA 2HHWA 2BLEA 3CCJS 3KCJA 3CZKA 5B7ZA 4FX7A 3A3OB 3E9AA 3CQ0A 1OM0A 8A3HA 3N04A 2DZTA 3GB6A 2FGBA 5BYRA 4DL0C 1S5MA 3BG9A 3SB0A 3OVPA 1RAIB 4QSHA 2QCLA 4ZTYA 3DBPA 4FOJA 4IGHA 1R8BA 3G6LA 3CE8A 3CEUA 4LVGA 4L64A 1HQEA 3D5MA 5EX3A 5C5YA 5KOWA 3ZVHB 1YEYA 3NZ1A 4CCDA 2V5BA 1B3TA 3WNLA 3F44A 2HNYB 3F41A 4LBRA 2CNCA 3NGKA 1RD5A 3NR0A 2PBOA 4KCUA 2CZ9A 2PI6A 2FDSA 4M1BA 4QG6A 1G94A 2WZ1A 4G1QA 3RK8A 4OV6A 3TMLA 4FDFA 4A3HA 2NX1A 3GTHA 2DYAA 4M95A 1JK9B 2A10A 3VF0B 1IGSA 4DR3F 4E6MA 2WSFC 4BWLC 3ISZA 4I3GA 1AT1B 2RJGA 4HTBA 2B51A 2PA6A 3JU2A 4CNNA 4C1KA 3IACA 1S0OA 2XMTA 3NO3A 3KK1B 2QMWA 4CYUB 2HHSA 3HA1A 5DZ6A 3G9CA 5C9XA 5D02A 2DHXA 2YVSA 3IG1A 4IRKA 4F66A 1CJKA 1BWEA 3C6TA 3DOMB 4QP0A 4YDDB 4FO4A 1WUUA 1B7FA 3DM2A 3NQEA 4M5DB 3KOFA 2AL2A 3WYZA 2QL9B 8TIMA 2OYLA 2QT3A 2ZA2A 4NYOA 3WBYA 4GKJJ 4DI9A 1EHNA 3AZSA 3PTDA 7FDRA 3SCRA 4FNIA 4OYZA 3RW7A 2ZOMA 1Q6GA 3O0FA 3UWWA 1ZFJA 4HCDA 2CJAA 1U6ZA 1ALDA 3A4WA 2W6RA 1MUCA 3LAMA 4FYDA 3WCZA 5GMDA 1DJNA 3PFMA 4AY1A 2PD1A 2GFFA 2REQA 4OX8A 3CBWA 4L4OA 2QA4S 4JYAJ 3R43A 2XIIA 2JRSA 3L23A 4KH2A 1KFLA 1TJ2A 2DR8A 2IKIA 1WZLA 3R5DA 3WDRA 1PIIA 1IJFB 3I6PA 4JOMA 3AB2B 3B03A 1W54A 4IWWA 3UCGA 2FY1A 3CV1A 2YKKA 2DDXA 3TYDA 1AROP 3IUIA 2HQFA 1VD6A 2EXUA 3ZZUA 3VNIA 5KG5A 1A0DA 3TR9A 2B7OA 3G82A 5KFFA 5C5JA 1KQSR 4CQ8A 1UMJA 1PVNA 1IR2A 2ZKMX 3CVKA 4QIWD 4C6FA 1VIWA 1S72S 5AXKA 2CJBA 1WDWA 2D2HA 3CL8A 3OBKA 3B54A 2MGZA 4JI2J 1T40A 3BSCA 2Y7DA 5C9UA 3ZZYA 4AUKA 5AKQA 3N73A 3PWAA 3PW7A 3GHRA 1MDLA 1LWHA 2JBMA 4ALDA 1HPZB 1LWIA 1YDVA 4DJDC 1SUQA 4QX4A 3PZNA 4DXKA 5ABGA 3VZXA 4YCPA 5DLFA 1ZGDA 4Q8UA 2BGQA 1Q6DA 2QN6B 1ACMB 1CZ1A 1WXZA 1FXLA 1PHWA 1R86A 4DV6J 3CPUA 1C0TB 1SSGA 1SW3A 3BJTA 3M6WA 2EWHA 4IFYA 4Q4RA 4GNJA 3H21A 3ICLA 2HG4A 1VF8A 4DFJA 1B9ZA 4NY2A 4Z2JA 4P7OA 1HNIA 2FLOA 2R7RA 4O17A 2LEAA 2B4OA 1XICA 3LY0A 2DZAA 3W1NA 4RNFA 1TIMA 3E3HA 1HQ2A 2GVLA 3IS9A 2OJ3A 4WF9Q 1I94F 1KQFB 2DO0A 2A5HA 3IBWA 4RUAA 3AJ1A 2IJNA 4KSEB 5FEWA 4F3OA 3NCRA 2HZVA 5BYSA 1GQIA 3AMCA 5HOSA 3J7AN 3FJ6A 3BQ2A 2L9WA 2RUSA 4P10A 1EGMA 5DLGA 2NV1A 1KM0A 3ABZA 4DV6F 1U1NA 2QYGA 1SJCA 2A4AA 4LGXA 2QPXA 4DSLA 4KF1A 1LK5A 3T9PA 2N7YA 1GQEA 2XCAA 4Q6JA 1KN6A 4IHCA 3RO6A 3WNOA 3IK2A 3I0SA 1E72M 2F9JA 2C79A 2G1DA 5KFRA 4HCLA 4B5SA 1OF8A 3QSYB 1BTCA 2CLEA 2VH7A 3J7HA 5LXRA 1FVSA 1NSPA 2C2EA 4MK9A 1M5WA 1C0UA 2O5DA 2JIWA 4WEVX 1H0HB 3L4VA 3H2FA 2AGOA 3UDLA 4ZCWA 3RX2A 1OQ3A 4RR4A 3W7IA 4RW6B 3R2DJ 1TR9A 3G2GA 3QGIA 3DG3A 4NXSA 5EMUA 3TQ1A 1TR1A 1J2BA 1JL8A 1C1CB 3MD1A 3A1YG 4US5D 4EP8C 3N2MA 4FF2A 1TYGA 3FAXA 4QNWA 2B56A 3R2GA 1EP4A 2MGZB 4KT2A 4RZBA 3EDDA 2W1BA 1XIHA 2VTFA 1RT1A 1NP0A 4LS0A 4ZITA 3OVGA 1HL6A 3NQ8A 3PJ9A 1NFBA 2DKOB 5C9RA 2XG9A 1LJYA 2CPJA 3CU2A 1V0LA 2ZZ4A 2B4PA 3DI0A 2XWEA 1VEPA 3QXBA 4BWMA 3BVJA 3GG8A 4ACZB 2V9KA 1DWAM 1XISA 4XSMA 2XN2A 1VK3A 3TWZA 3M8WA 3OOQA 3EXTA 1S99A 1QI3A 4PRRA 2R2UA 1US2A 4BI7A 3KWXA 3ITOA 3QJAA 1SFJA 5HMDA 3OZOA 4GX8A 4O4RA 4ML9A 4OU1A 5CZ0A 3AIBA 5T14A 1WHYA 4UQ9A 3WNKA 3W7NA 2AGPA 2QV6A 2BX6A 3ENLA 5FJPA 2PF8A 2R1PA 3ARXA 2YLLA 3RCNA 3EDEA 1IIHA 3AHPA 1JCYA 2CCRA 2PA3A 5D0HA 1W5OA 4KWWA 2L3MA 1KW1A 3VE7A 4AY7A 2F8MA 2QMJA 1GOQA 3VIGA 4YHGA 3FW6A 1ZAVA 4H4MA 4C6QA 3B9NA 3MMWA 2IKJA 4DJFA 4X66F 3EA1A 3MF5A 1SQ7A 3S2LA 1NH7A 1ITCA 3BW2A 4WWSA 2W8KA 1DURA 2UY3A 1UR9A 5GAHU 2WVDA 3OFGA 1CJKB 3WLMA 4GGHA 3G8SA 2QJMA 1SSDA 3T55A 4KTQA 3MSYA 4F67A 3RAQA 4MUPA 2MQPA 4IH7A 4DV3F 4W8LA 2X1SA 4N47A 3E2EA 3AICA 3HU7A 3LCGA 1IWAA 4OYXA 1JR1A 1HD0A 4UTWC 3SN4A 4A3YA 1XG3A 1RY8A 2OT1A 5C24A 4JKLA 4LREA 3PULA 3BDKA 5I06A 4HYWA 1PILA 1WJ9A 1IIGA 4TYBA 4USHA 4HT7A 4OL8A 4W84A 2BRKA 3M0XA 1RP8A 4G6VB 3WFLA 1CIUA 1KGUA 5KFSA 3TCSA 3MMUA 3DU5A 1YX2A 3THUA 5HP1B 2JGQA 2Q8LA 5E41A 4U7UD 4GYPC 3ZVHA 4J91A 4CN4A 3E6EA 1UA0A 4DXVA 4HNVA 3GSMA 1EETA 1RBOB 1XKYA 1XSKA 5KT3A 5HQLA 4U10A 3WG6A 1E9IA 2OKOA 1L3KA 4O10A 4LSLB 2J8SA 1AQFA 2VA2A 3SSSA 3ES8A 3OIXA 3WD1A 2WMIB 1X9MA 1SH0A 1WXJA 3IM9A 1S1UA 4LY8A 2W3ZA 2FGCA 3G1YA 3GIRA 4E98A 4YY3F 1JXVA 2CBVA 1GQLA 3GR4A 1F0XA 1YJ9S 1L8PA 4Q8WA 3EOOA 1VI7A 4HVZA 1KLNA 4M8UA 2NLIA 4L6DA 3UZYA 3IGSA 3O3LA 4J2MA 3QSIA 1TKZB 4GE8A 2VOTA 2WVVB 1AFIA 3BH6B 1UJQA 1T9TA 2VR2A 4H2CA 4A8RA 3TAMA 4UQEA 3AFGA 2IXUA 3WQ8A 1TAUA 1KBJA 3ANUA 1IEQA 3FCWA 1A4MA 2ATMA 3OW1A 2OYKA 3RYLA 2DVTA 2ZKUA 3C0JA 4GKKJ 3ITYA 4ZPDA 2HWGA 4JP8A 3DKLA 3LD5A 1Y4ZB 2BRLA 3PXGa 1A9NB 2OFJA 1B90A 2X1UA 3PEHA 2PD5A 2V2QA 2HFNA 3HSDA 1M03A 2J0SD 4OX7A 2Z30B 3GYEA 3UP8A 4KC5A 2D0FA 4S3BA 4RU2A 4QR1A 3O6YX 1YBQA 3BQ1A 3P61A 3CB3A 1HNVA 2D7SA 4JI5F 3LLFA 2ACUA 3N28A 5HINA 2MSTA 2MY7A 5F9NA 4NZ4A 3T8LA 2WVFA 2BVTA 3MB9A 4OVXA 2JQXA 4CLKA 3MDWA 1EA9C 3FOKA 4WZMA 4UNLA 4J9UE 3H2UB 3SN1A 3CDEA 2J4GA 5CPTA 1QPOA 1PTGA 3TNBA 4BF9A 2VJUA 3V6KA 4JL1A 4UZCA 1WOBA 1EZWA 3HDSA 3E74A 3RPMA 1XLMA 4HNTA 1VENA 3GNDA 3C0LA 4KCVA 3TYUA 3WUFA 4S2CA 3LP0B 5BNKA 4XTIA 2FJAB 2O9RA 2ZHBA 3D2WA 4K2SA 1QRQA 2KB2A 3R5GA 1OEPA 3FNNA 2BTMA 2Y8KA 3QHNA 4JD4A 1TUWA 3BJSA 3FGCA 3HZGA 5CPOA 3UWUA 4NLYA 1LXJA 1KRBC 2KU7A 2WJEA 1OY0A 2EFGA 2GA7A 1GVFA 4EMDA 1S57A 2C2NA 3WQDA 1PAUB 3TQPA 4A8IA 2JOQA 3I5AA 2CJKA 2WM0A 3FC9A 4USIA 1CQNA 1ISZA 3QW4B 3M2VA 3V16A 5SUHA 3CJRA 3I6RA 3IEBA 2VRQA 3O8AA 4C1LA 4J37A 1EJXC 4MFEA 3FN9A 5A2AA 2K7JA 5IWAJ 2I7GA 4O0ZA 1F60B 3TIMA 3W7GA 1M41A 3AC0A 4NILA 3S1GA 3CH9A 3RF9A 3BR9A 2ATCB 2H3BA 2BGSA 1TRDA 3FEZA 4X9YA 3M0ZA 1L6WA 5LJ3Y 4KFPA 4FXSA 1TJRA 1IT7A 2Y0BB 1TREA 1V02A 1CLXA 5BYWA 5KFKA 3TOYA 3AXXA 1OIMA 1U1QA 5ADZA 1ELSA 2XY7A 2VZ9A 2DZSA 2A7RA 3F1QA 2VF3A 2POTA 1IBLF 1HARA 2Z2MA 3GBDA 2F6KA 2RDJA 3GNOA 2KT5A 1UQZA 3E2VA 3KG1A 1FH7A 2VD3A 3S6EA 3D4JA 1T3OA 4WSKA 3NJ3A 1W2PA 5CPSA 1Q86T 1UP3A 1IZCA 4ZLLA 2NQ5A 3SV3A 3G8TA 3HHKA 1ZTVA 2D3ZA 3ITTA 2QUMA 4MAZA 2DY9A 4LAUA 3STGA 1W56A 2CG8A 1H41A 2WZTA 2YWGA 1VYRA 1S2TA 4Y8FA 4TY9A 2RKXA 4A05A 5AZ1A 4JFVA 1G4SA 4ZQMA 4EK2A 4ID5A 4EAYA 3SECA 3L4UA 4YXGA 2N4DA 4YLWA 2E77A 2VG5B 3EDKA 3PBVA 4ECVA 2C2DA 4OLOA 4JV5F 5LIXX 2CXGA 4GX9A 2WW5A 1JRCA 2ZTKA 3HG3A 1WHXA 4TY8B 2QGFB 3GU0A 1UCNA 1W5PA 4QAWA 5DRIA 1Y5NB 2B9EA 1OX4A 1ZOTA 2XVNA 3I10A 1HVXA 3SCUA 2KJVA 2BQRA 3PDNA 4F0HA 3FXGA 2GS8A 3F4CA 1FK9A 1T95A 2XLIA 3NS6A 2B7PA 1NH8A 3MPVA 3CNYA 1VLIA 1BY9A 2I1RA 3C3UA 2HVOA 2VDGA 3S1XA 3ZZZA 4B5TA 4CLSA 1D7FA 1VBXA 3RRHA 3MP4A 5AN7A 3M0YA 3ZO7A 1FE4A 2QA1A 1OYBA 1DVJA 2R14A 2XUCA 1TPDA 4EGLA 5B7WA 3EGVA 2VODA 2ZIDA 3TZWA 1DTNA 2DW7A 4KE5A 3DMJB 4ZPWR 1SW0A 4H9UA 2ZNYA 4K7YA 4NI2B 4NIRA 4AC1X 1KC8T 5KZDA 3VMPA 4UBPC 1LT8A 2BXVA 2WOMB 2BABA 1LQ0A 3NXZA 1XXXA 3G1XA 1WA3A 4K39A 3I32A 3A64A 3NSMA 3PJUA 3C8NA 2EF9A 4OZJA 3C0SA 4S39A 1FEEA 2CIPA 3ZR4A 4MB5A 3CCLS 4ZJLA 2HTMA 1QNOA 4FNUA 2C2KB 3PX6A 3BUVA 5MKGA 3FIGA 2PWEA 4DYEA 3CHDA 4YTRA 2W7AA 3BQ0A 1QW9A 1ZAJA 3WF2A 2YBUA 1FERA 2DRAA 2XQCA 4BCAA 3SFGA 3BBFA 4UFJA 1FO1A 1WUEA 2YKMB 1XDJA 1XQLA 3BJFA 2F4VJ 1R0AB 5KG3A 4XVDA 5THWA 1PHQA 4IG2A 4AWUA 1TELA 5LMUJ 3MWBA 1NOUA 2YBVA 1E4MM 5IFMA 1NMEB 1WF2A 3TU9A 2NS1B 1J5EF 1P5BA 5F8JA 4DQQA 2QJNA 1S5WA 2Z7KA 5IM0A 1K9TA 4PYSA 2HNEA 1C4CA 3DERA 3KP1A 5LXYA 3BO3A 4PRWA 4Q33A 2RFGA 1VHCA 2VMFA 5GAHI 2HHHF 4NCGB 1KFWA 5M1TA 2ALRA 1EF3A 1TE1A 2XGIA 4JBRA 3VDCA 4ZOAA 1KFCA 4LVAA 4PTWA 4XV0A 2CW6A 1WOPA 4TX8A 4BFAA 3GJSB 2OELA 3A9BA 3NEHA 3BANA 1IM6A 2AJ4A 4I2PA 5HLFA 5ABEA 1X38A 3WF3A 5D9PA 1VLWA 1V8EA 4DSEA 3QHOA 4XAPA 5FDLA 1C9DA 3NG3A 3M1VA 3OEXA 1ZTWA 2NQHA 3QATA 3FKKA 1T9YA 2XN1A 1H2JA 1JUKA 2ZCGA 3SAZA 1S39A 1NDWA 3HGSA 3N18A 4F40A 3TYTA 4NYYA 5I23A 4AIUA 1GG0A 2QL7B 1WI8A 5IQ6A 1XJBA 4KPCA 3MPUB 1FA2A 1KGXA 4CQDA 3R89A 4TR9A 2G3IA 3KHLA 1XPYA 4ZZ9A 3RMEA 1ENUA 3ATZA 1AVAA 1HN1A 4I7FB 2VGBA 4EPDC 5FSDC 2G96A 1T05B 3PSVA 1UVNA 5LNVA 3LHZA 4YS2A 2O9OA 3EWBX 3RR4A 5CZJA 1JMTA 3R7BB 2PGFA 3TSMA 4QCEA 3T5HA 4J9NA 2DR6A 3KTQA 1MG7A 4M7SA 3WL1A 1MMNA 3P3DA 2YQ3A 3KP0A 1TMJA 4F4RA 2FVQA 4ED1A 4NLGA 2Q43A 4DV4F 2WK4A 3FMBA 2WJZA 4JFUA 2GSEA 1FDZA 4B3MF 2A3HA 4M5DA 1BVNP 5DY2A 3GILA 2G4BA 2R6OA 4FOUA 3QHMA 2XGPA 1W1PA 2HQCA 2ISFA 1HBNA 1V3ZA 1YJ7A 1LWJA 5DO8A 3LLXA 3MSDA 2NWRA 4D6FA 2KI2A 1RD6A 5LGZA 2IDLA 1VBKA 1BF6A 1SMDA 4W86A 3SDOA 1TL1B 4EEYA 2FGOA 1RKJA 3KMQA 2W4PA 1Q1KA 3IMQJ 3SCKE 2UXCJ 2IRYA 1YRRA 1GX5A 3QLLA 5KG6A 3CJQA 4OYMA 4ZN1A 3REQB 4IGSA 4O3PA 3UDCA 3IAPA 2MZJA 4G1QB 1OG0A 3WBXA 1FEHA 3KWSA 1PX8A 1Z2LA 4NI3A 2GCFA 1AUSL 4JTLA 4N6EA 2GVYA 1L0PA 2PTYA 2Z2YB 3ZJKA 3B9EA 3HHLA 4WU3A 5CC6A 3KBSA 3MV01 4MVAA 4NZ0A 3I65A 4I2PB 3ALGA 4PXDA 5HO4A 1A5NC 1VPYA 3SSRA 4MH8A 4RLIA 5M2PA 3M8PB 1TU0B 2Y1HA 1KFBA 4QZVB 2VUYA 3OO2A 3W1XA 5MKGB 4AMAA 1GNKA 1AK5A 3BKUA 4HNCA 4ZVRB 4JFWA 2FHMA 2Z00A 1FFQA 3WMCA 3CO4A 4ATNA 4CLUA 1S0MA 3BSAA 4K1GA 2AHOB 1G4PA 1EBHA 4RZ5A 1E0WA 3VAVA 2YNHB 4ZGYA 3D0HE 3SCQA 1LNQA 2FJDB 5CAAA 2YWFA 2PWGA 5C9WA 4WFZA 3UD3P 1DLOA 4JX4A 1E73M 2R91A 3R0UA 1XC6A 2GOKA 4DRSA 1GOIA 1ZAIA 3JR2A 4DXXA 3ECQA 2E5IA 4TMCA 1EHWA 1ITUA 5BR8F 5KG4A 4BWJA 1EJSC 4LQ1A 1RJQA 4HPXA 2NQZA 2VEIA 1AH4A 3UJEA 2CQGA 3V0SA 4QISA 4FALA 3LHYA 1LQ9A 1FHLA 4OLPA 3NKYA 1UJ5A 2UU9J 2NVCA 1GMUA 1B4KA 2Y88A 2O56A 4Y65A 6PTDA 2ZDPA 2ISWA 3A6OA 3KOXA 3K5NA 3EOLA 5F4SA 3R12A 4JHZA 2DNGA 1F3XA 4ZVPB 3NPXA 3QMSA 3M8YA 4YFUA 1YBQB 3VOIA 2IIHA 1H6KX 4OECA 1VRUA 3RCYA 3F03K 3S8SA 1QR7A 4F3HA 3DLGA 4IDKA 2X1AA 2XMMA 4JHOA 3PZOA 1TFVA 4Y6GA 1YQHA 1T03B 1BYAA 5D6GA 1E51A 1GZGA 5DBUA 1YDYA 1W9VA 2X2YA 2P2CB 4QW8A 1CGWA 1I8JA 5CCMA 3ARQA 2DW6A 1I0BA 1UD8A 1I3OB 4GRSA 4IIHA 3LPEA 3VDGA 1VOMA 3P5BP 4Z2HA 3DOMA 4UB9A 4LAMA 2FKPA 2H3EB 4RKAA 3KJFB 1NWSA 2OSYA 3QGVA 5FD1A 4UR8A 4QWBA 3IRSA 3UPBA 1AW0A 4DV0J 1OWQA 4TVCA 5CGMA 4LJMA 2JFEX 1J8VA 3V7PA 1VFUA 2ZH2A 3MUXA 1RTIB 2MKHA 3M4XA 3AHTA 1V51A 3H4WA 4I9JA 3HQ1A 3CDUA 1FDYA 1X1NA 2YJQA 5AHFA 4XO7A 2DISA 2N3OA 4C6MA 1QBBA 3UYIA 3KBNA 2MUCA 5A3HA 4M63A 3O1NA 3UDEA 2HBQB 2XEXA 3GIIA 3BH4A 4GNVA 2XYPB 3W2MA 3W7OA 1KV5A 7TAAA 3FHAA 4EU0A 1QOQA 4Z1AA 2ZUWA 1SQFA 5IRPA 4AXNA 4OT7A 2B0GA 1SXLA 1X39A 2VO5A 5FF4A 2QFJA 5GPRA 4XZBA 4HU8A 1CJTB 4J28A 1SO3A 1XKJA 4NZJA 2LQJA 2B6AB 1V77A 4EPBC 2BV3A 1NZ8A 1G1XA 4HMCA 4R85A 4LB3A 4I5XA 4H8HA 4OE7A 2VC0A 4PG6A 5HBMB 4HU3A 2JEFA 3ANVA 4ADSA 2P0OA 5H1SV 3DFHA 3L0KA 1N36F 2JLFA 3BYPA 1REVB 1I1GA 1TVPA 2WKJA 4K38A 2ZJRQ 2V4JA 3VR1A 4LVNP 1M04A 3UCZP 2WMIA 1KO0A 5DANA 5H8PA 2DCLA 3D6TB 2CHRA 3UCUP 4FOKA 1U48A 3WLNA 2MYFA 3KWMA 1YNPA 3KTXA 1JCJA 2R7VA 2J75A 2OSRA 4OZ3A 3W7RA 4DFMA 3I56S 3R2CJ 3ICJA 4LF9F 1XGDA 1NWUA 5TNVA 3NBPB 2ZZMA 4W88A 1QUMA 4TVAB 4XK2A 1CC8A 2Q6ZA 4OKDA 2QCNA 2FLLA 4QWEA 1XHGA 5KFCA 4AIEA 1EQ0A 2X1GA 3RGIA 5A6LA 2D73A 3C86A 4B5NA 4FX6M 3TDFA 3VABA 5IZHA 1O12A 2WAQD 5CEWA 4IIBA 2PMQA 4GJ1A 3SRDA 3MI2A 1MYRA 3PCOB 3OTOF 1S2CA 5F8NA 3N14A 2PDHA 1VQSA 2HROA 3MM5A 3TI0A 5MHBA 2FHJD 2NYIA 2EFVA 3W9IA 3TC6A 1R3NA 2DGUA 4ZL1A 4ZVEA 3PBUA 4FF5A 3W60A 1Z42A 5TQLA 5AHIA 3E5PA 3IJQA 2KT3A 1SC1B 5J04A 1DJQA 4WK3A 2QX0A 3K5LA 2QLYA 2ASYA 5CLTA 2F61A 3QGKC 3UEQA 2CJQA 2NSCA 3OPSA 1DEDA 1QE1B 3XIMA 3BBBA 3POHA 2E1PA 1I1XA 4MMWA 2V0NA 5KTQA 5BCAA 2VGIA 3GTNA 1FWAC 3M6UA 2W67A 3TN6A 5MLCV 1H50A 3D3CJ 2XIJA 3AS2A 2G0JA 4RX6A 4YY3J 4DV1F 3Q24A 2GVGA 1V7YA 3EGZA 4DCJB 3TEVA 2TMDA 4JCMA 2GK1A 1ITPA 1JZ7A 5KFQA 3PR5B 2HS4A 4DUYJ 1WZKA 1TTIA 4BY3A 3V18A 2K2PA 3ZWTA 3FFIA 1NK0A 1N6QA 4LRAA 3UZJA 1J0JA 2GUBA 4LFCF 2P8CA 5GAGI 5E93A 4K2XA 3NZRA 3UD6A 5I3KA 3PRBA 1KBLA 3QNWB 4WPAA 4DR3J 1YDOA 1OFRA 1FWEC 3QQ0A 3ZFVA 1H2VZ 5E70A 3PANA 2F4FA 4HA1A 3FBEA 3UNTA 2RDIA 2R7WA 2QT7A 3MUVP 3RXZA 2FVRA 4V33A 3OGSA 2Y61A 3NGUA 1UH2A 1QAIA 1S12A 4JNMA 2QS8A 1UA1A 3T1GA 1DY3A 2VPWB 1HNZF 2ZXQA 2V3GA 3WJZA 4I7WA 3KL0A 1U1OA 2Z27A 4HU4A 1KQYA 3HB9A 2CHOA 1OYDA 3LHWA 4B3SF 3I0SB 2F40A 3CAWA 2LKZA 2QA4G 5ETQA 4PQUA 4E8UA 1XRVA 2B9YA 4WFBQ 3TLQA 3HSGA 3B0UX 3O7UA 1NHVA 3WK2A 4Q8TA 3AA9A 3MAQA 1KXQA 4KWUA 2Z6IA 3B8SA 1RVKA 4P52A 4O18A 5BROA 1NSAA 1GMWD 1RT6B 4YR3A 3HKZD 4Q44A 1RBAA 3QV9A 2Z2AA 3ONCA 2D74B 3GX9A 1MQPA 3QY8A 2DSZA 4MWAB 3LYEA 4DF1A 3OBIA 4OHYA 3CV7A 1UKTA 4DZIA 4G1NA 4G2DA 1OYCA 2Q71A 2YNGB 4DJEA 4O8AA 3FVYA 4F3MA 4NX0A 2WK2A 2NX9A 3EPGA 3HV9A 2JWNA 1YITS 2XWXA 4PWDB 5FI8A 1Y7VA 4R25A 3OTRA 4WF7A 3HLUA 3RRAA 3RR7A 3DGRA 1IV8A 2YXOA 2V6AA 4N9DA 2P1FA 3DX5A 1W3HA 1TX0A 1TIWA 4Q3MA 2E5HA 4G1IA 4HN4A 1HKKA 3FQKA 2RSQA 3R58A 3FKBA 5L39A 3B8TA 3AS0A 4DJFD 1DTQB 2G41A 3VXGA 4LJ3A 1YLXA 4ZP8A 3U4FA 1RPKA 1EAYC 1FFGB 3TAPA 3AD9C 3HKWA 4L3KA 1WWHA 3TN5A 3URAA 4RE4A 1F9CA 1UA3A 3JRKA 4MKAA 1BTMA 3S5YA 3A4AA 1DQXA 2J25A 3BCDA 1EF2A 1N7KA 3CQHA 2ZUVA 4E8CA 2RMLA 3IFEA 4NCBA 4KEMA 3CEPA 1HNIB 4WYLA 4GACA 5KFHA 3QGAC 1IKVA 4GXPA 3FJLA 2J8AA 5HXMA 4S3AA 1UIOA 2XGBA 2XSBA 3C2EA 3PUDA 2Z1SA 5M2RA 2H65B 1YK9A 4HLBA 3TROA 4QWDA 1UVLA 2HPUA 2I5GA 1GH8A 3WUGA 3B3DA 2JFDA 1CXIA 3MI3A 2F4VF 2DV0A 4LUJA 2PLCA 1CXKA 1NARA 1VS3A 2WVUA 5HP1A 2R8JA 5I78A 2P88A 1PYFA 3P45B 2U1AA 5I5RA 2V2ZA 5BWFA 3B05A 1RT3B 3GNNA 3ZC4A 5M03A 4P5UA 1D8WA 1E56A 2P3EA 4R7JA 4MJKA 4PUKA 3BPDA 1FRXA 1YW1A 4O3RA 1B3WA 3GG7A 5D38A 4MK8A 2OFHX 4FS9A 3NEKA 1RI7A 2XLKA 3HMCA 4XAGA 4M80A 2VX7A 3GFZA 4DUZF 2O0TA 2YIHA 1W37A 3DDMA 4CH1A 2UV8G 3WLPA 2BYCA 2V3DA 3VGGA 3BF4A 3O9NA 1HYSB 2BG5A 1EYEA 1TA3B 3MKVA 4RW7A 2YCIX 3IWPA 1AZSA 1FKXA 3R7MA 2EG2A 3LHUA 1REGX 4LT6A 1KA9F 3MEGB 3EE3A 3L66A 4M1RA 3UU0A 4A8FA 4HPNA 4CYUA 3P8JA 1RAJA 3CJKB 3MSRA 3ISND 3IRXA 4CT8A 2ZZ1A 2REQB 4PZVA 5KFTA 4UOHA 5G4DA 2MQMA 4QDWA 5BYQA 3IWNC 3NA8A 2Y7EA 4PKDB 3QLHB 8AT1B 4P2FA 3F56A 3G6VA 3TR5A 3BLFA 4FAMA 3SRHA 4IQEA 4ECSA 2EEXA 4EWND 4LV9A 1F6YA 2F6UA 3MURP 3G1HA 3KVKA 3T0CA 1PAEX 3DHDA 1EZ2A 5C7HA 1WKKA 4FYVB 1RWNB 4NHVA 2XZ7A 5HVFA 2VQFJ 2HV5A 2ZZ7A 4OMFG 4AL5A 1NVMA 3LCHA 4P8UA 2XSJA 2V0TA 4DL6A 3KLGB 4DLEA 5DZ7A 3C2PA 1JAKA 3C6TB 2GDQA 1RA7A 1XBXA 3W2VB 4DR7J 1TPWA 1VBJA 3SUSA 2JKEA 3F2BA 1TL5A 3MAAB 4WY0B 3RU8X 3ZT5A 3I5CA 3AIEA 2HKEA 3GR0A 1PSCA 2DXFA 5C0QA 2Y1JA 2RQCA 1W7WA 1WDDA 1U22A 1I45A 1LP6A 4LEQA 2G95A 1FKOB 1UWRA 3L7PA 4ZA1A 1E40A 1VQNS 4DL4A 5D8WA 4JL2A 1XP3A 1LBLA 5D0EA 4F36A 4XAZA 2GW8A 4KV8A 4DOZA 1GK8A 1KTVA 3QV7A 1RT3A 1JNZB 5KFBA 1EX8A 1CGUA 3I3BA 2I38A 2ZDOA 4R88A 1XRTA 4JTDA 4MZ8A 3UZ5A 3BREA 1V0NA 1VFHA 1UW9A 1GQNA 3BW3A 1E5NA 2RDUA 1NFGA 1TL3A 3FFIB 2W2OP 1RT6A 2DHHA 4HZ6A 3OBEA 3VIJA 5CXTA 2JC0A 3PKMA 4U3AA 3D3FA 1XDMA 1FH9A 1OD0A 4AQLA 3IBCB 4P7VA 4ROPA 2KFYA 3GDRA 4A8NA 5JXQA 3HD1A 3OTEA 2XHWA 3W83A 1FRKA 3PZUA 2QQ6A 6CGTA 3N0VA 2KJWA 2UUAJ 4INFA 3K17A 1PX4A 1SU5A 1U1UA 4C6CA 4XX6A 2P0IA 3J81U 2OB3A 3TTQA 2CITA 1TZ9A 2G2OA 2VZTA 1IXNA 4RDZA 3C6UB 4K0KF 1R3QA 1DAXA 3KG0A 1GXTA 2A85A 1ZS2A 3WQPA 1VRXA 3TW0A 1K8AT 2AF6A 3KVJA 1QATA 5AC6A 1OYEA 5KTLA 2HK3A 2IA6A 2LXFA 2AJQA 1WYIA 3TYZA 4X66J 3FRYA 1TTPA 1G3OA 1LZOA 5HVHA 3M43A 5GNZA 1WKEA 4CNPA 4UQCA 2VDHA 4DUOA 3MS8A 2R8HA 3LP2A 3BK0A 3KK2A 4JTRA 4AWEA 3SJ3A 3WF4A 3Q2SC 2KM8C 4G6CA 1N56A 1RQ0A 2XNRA 5KINA 3QQCD 3JXOA 2GHWA 1Y5WA 3KS5A 1U09A 2RD5C 1W9DM 3H90A 4XD6A 2HFSA 3ONQA 3UVJA 3P2VA 4ZVSB 4FNSA 1RT5A 4JY8A 4BLGA 1VHNA 4DM1A 2WVEA 6A3HA 4C6AA 2GPTA 5C2XA 1NCLA 3AAMA 3VX1A 3SCNA 3LN3A 3WX7A 1CBKA 3VZZA 2W92A 2R7SA 3W7KA 1ESWA 4HCHA 3BLOA 3V75A 3AXMA 5A1AA 1XWYA 1IJEB 2PUZA 4JTKA 4DV7F 4GVLA 3EA2A 4OIXA 2X51A 4PEOA 2UWFA 2PFDA 1HD1A 3ABQA 4H8VA 4B91A 3SGZA 4CQBA 2DT0A 3I87A 3A22A 2APOA 4NI2A 3QMQA 3SCJE 1W25A 3MGJA 5I3UB 4R5PB 2C1GA 2JZ5A 4IF2A 2INFA 3AHXA 3TH6A 1GQKA 2F7VA 3CC1A 1IR0A 1XYLA 5H91A 3BLLA 2H8ZA 2YKOA 3PYEA 1BLUA 3N3MA 1HZYA 1SZRA 4ZN3A 3A5FA 5CJMA 2HNYA 2YPZA 1PX3A 2ON3A 2FHOB 1BYDA 5D37A 5HN0A 4JI4J 3JAMU 3Q86A 2NQLA 1EWDA 3KUMA 1S6QB 3P6LA 4RE3A 4IH6A 1ADDA 1X1OA 1UWTA 3N79A 1P6TA 3LSBA 1XIBA 1PEZA 4FNQA 3H5XA 2XMUA 3DRSA 2ZOXA 3R6IA 4OI6A 4N56A 2CPEA 1HBUB 4FIQA 3BAYA 2Q66A 4F0KA 2Z2ZA 1QW7A 4OJYA 1W1YA 2RKIB 3UNYA 3BPSP 4GUFA 1LG2A 1SJQA 4GNKB 4ORIA 4DN9A 4RE0A 3UA4A 2OWCA 3DDIA 4K8EA 1W9XA 1VEMA 2I14A 1X60A 1GKQA 4JNZA 2EPIA 5AJ3F 4USUA 3AMLA 4BI5A 2CQPA 3MVTA 3MEDA 2E5LJ 3AIVA 1GQJA 3GTIA 2ZH9A 5KT2A 4JI5J 1WG5A 2VEKA 2GAHC 4IQJA 2W9MA 2VEGA 4W92B 3AQUA 1D9AA 7REQB 4X4RA 4DHVA 4OZ0A 2A2IA 1CEZA 1DQAA 1JJHA 4UQDA 4Z1BA 4Z37A 4C6NA 7CGTA 1FRIA 2NWSA 1O5XA 4RW9A 3R8RA 3CCZA 1X4BA 1WAWA 4AD0A 2RUGA 1A49A 1WOAA 3UI3A 1K6AA 3OLEA 5A6AA 2HHVA 3W7HA 2HLUA 2C28A 2YBTA 3XISA 2PDAA 1I2OA 5F2LA 2IPJA 3CZ8A 3T44A 3AHYA 1Y0HA 4LRCA 2F9DA 2PC4A 1WF1A 1WPCA 2GJPA 1A5MC 3R7SB 5KOXA 5FJRA 2QGHA 4D72A 4Q32A 3MECA 6FD1A 4NRTA 5EB8A 1TPUA 2YX1A 4PWWA 5HQEA 4YPJA 2VFGA 4EBDA 1ODZA 3EDJA 3WLHA 3NMAA 4Z2IA 3J7YU 1S46A 2C71A 3DYAB 5I3QA 4DLGA 3CCES 2P53A 3LZ3A 1UOKA 4O16A 2L9NA 3QH2A 3FEXB 4DZ5A 3E0IA 3CH0A 4O1CA 5LIWX 3Q37A 1JLGB 1T8EA 1KTCA 3M2UA 4H4KA 1HJUA 4CLPA 3AISA 3RFAA 3HZ3A 1QI0A 3H7HB 2QV5A 3VGTA 3OQ8A 1T02A 1KM1A 4IGNA 3GG0A 4IR1A 1HNYA 3QFWA 3C14B 3T0BA 1J2VA 2JFKA 3KZSA 1JYXA 3GU2A 5CQ1A 2VC5A 1JPMA 4NA1A 2PP1A 5ETTA 2V4QA 4I69A 1R5YA 4ED3A 1XH2A 4MIMA 4XD4A 3W07A 1J79A 1VBHA 3UJSA 3Q23A 2FDMA 1R89A 5CSSA 2FHBA 2E67A 1SC3B 2GZXA 3CIVA 4LRDA 1QWGA 2Z56B 4JFSA 1R9XA 3DYPA 3VYLA 1OWXA 2Q09A 1XLEA 3KVLA 3W1LA 2FZ8A 4FPIA 3PJTA 3T6JA 2WNNA 3ELFA 1HI1A 1JUBA 3UXIA 2WTFA 1ADOA 3THTA 3EJMA 4MIWA 3F5JA 3BO9A 4Z7YA 3DFOA 3H4DA 2M9KA 3ZNJ1 4Y0FA 4LCQA 4WLCA 1TPFA 5GJPA 2WW8A 5C25B 2WVCA 4DO6A 1F2HA 4FVCA 2HGMA 4X65J 2RGMA 4F4WA 1R9ZA 4DU8A 5FL1A 3H2MA 3C16A 1TL1A 3I0RB 3TAMB 4ZA0A 1HQTA 2AQVA 3M0IA 3UZZA 2DU2A 2OTDA 2FVSA 3M41A 1EA0A 1HFBA 2DT1A 2NZCA 2D20A 4M5PA 3A24A 2Y1LB 1CJVB 3CB4A 1P0KA 1W1A1 3XINA 3DC2A 3N1AA 4JTQA 3ZZ1A 1H98A 5JUMA 1U1PA 4B3OB 3VMOA 1H7NA 3I3EA 1L6SA 4Y2WA 3M8ZA 1OO0B 3OVBA 2HNDA 3WK1A 2ZE3A 5T9BG 4AXJA 4GY7A 4X63A 1YVFA 1V6VA 3VNDA 3MAHA 1YYAA 1RDRA 5I3PA 1N32J 2DNHA 3QJJA 1PCWA 4V1YA 5KFDA 3KLIB 1VQKS 4OQVA 5ETKA 4Q22A 1EIXA 1IN0A 5DT7A 2VD8A 4B9TA 1JJCB 4D9PA 4UTJA 5E1QA 1WUFA 4RW6A 1VR6A 2NW0A 3WUBA 1RAGB 1OJXA 2VV5A 3QT8A 4F79A 1RK6A 4H2HA 1HKVA 4B5VA 3W02A 4WK1A 3LPPA 1YDLA 1QK2A 3DLKB 3N4WA 3RILA 2RB7A 1RHMB 3BGAA 2PDJA 4FX8A 2CQDA 3OJGA 2EG1A 3DRPB 1WBJA 4CGTA 1TP7A 1PO9A 3BZGA 3C15B 2POKA 1EBGA 3MV11 1ZALA 4TN2A 1KHWA 1UVJA 2OX1A 1SJRA 1NSKL 1F74A 3N9SA 2NLWA 4PYAA 5HWMA 5ETSA 3MUIA 3D28A 3QWPA 1X97A 4UQAA 2B81A 1DE6A 3HPAA 1N5QA 1RB0A 1E55A 4RUHA 3UFCX 4PRTA 5HBMA 2VICA 3QZ8A 4HNLA 1P6BA 3E49A 4EFAC 4H9MA 3CK5A 2C3UA 4B3TJ 3ITHA 2O3DA 5DXYA 3OP2A 1PV8A 2DXEA 1AJ0A 1R8HA 1FDAA 4NA2A 2XMVA 3LPFA 4DR1F 3TW9A 1FXQA 1YIXA 3NL3A 3NQ7A 2ZNZA 3KLEA 1XFBA 4NL1A 1WTBA 2CZVA 5LIUX 1Q16B 5FAGA 2PDGA 1NHKL 2E5BA 3ULHA 3DECA 3HQOA 4LIWA 4UFMA 5HULA 3TFXA 2IHR1 1F05A 3AI0A 1SR0A 1NPPA 3NDZA 5CYMA 4O3NA 3LA4A 3UN2A 4WOZA 3NNCA 3FJNA 4KR0B 3IJLA 2ZC1A 3S47A 1NU4A 2HFZA 4ZDNA 4DR1J 2WMGA 2Y1IA 3W2NA 3TYCA 2WSRA 1GVQA 3QAEA 4LR9A 1W32A 2I1OA