3GZ7A

Crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
FQGMIQEIASILVQPGREADFEAGVAQARPLFMRARGCHGVALHRSIEAPQRYTLVVDWETVDNHMVDFRQSADFQEWRKLVGECFAEPPQVHHEQKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative antibiotic biosynthesis monooxygenase (NP_888398.1) from BORDETELLA BRONCHISEPTICA at 2.15 A resolution
rcsb
source organism Bordetella bronchiseptica
molecule tags Biosynthetic protein
molecule keywords Putative antibiotic biosynthesis monooxygenase
total genus 27
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gz7A00
4FNHA 4OJHA 2FB0A 2AJ0A 2LXFA 1OQ6A 4DN9A 1TUVA 3KG0A 2VH7A 3F44A 4A4JA 3TRGA 4A47A 2GGPB 1OQ3A 3FRYA 2VV5A 2OP5A 5B0CA 2LDIA 4EFAC 1VQSA 3DXSX 1XBWA 2PD1A 5B09A 1URRA 3DCAA 4U9RA 3UDCA 4OJ3A 1FVQA 1QUPA 1X8DA 3FMBA 3HHLA 3CJKB 1KQKA 1KVJA 2XMVA 3IWXA 1Y3KA 3HX9A 1TL5A 1YJRA 1VQYA 4Q2MA 2GCFA 2AJ1A 4Q2LA 3HHLB 3K7RA 1IUJA 1YJVA 2W4PA 3KG1A 2PGCA 2ACYA 2HIQA 1Q8BA 1JK9B 2Q3PA 2BJDA 2W4DA 4OIXA 1APSA 3MZIA 2XMWA 3HHLC 3GZ7A 2IYIA 1TL4A 3TNVA 2QYCA 2OKQA 1N5TA 2ZDOA 1Q53A 1GXTA 2XMTA 2GO8A 2AW0A 2K1RA 5F0WA 4QOTA 2HFOA 3LGMA 1Y3JA 3BGUA 4HH0A 2QLWA 1FEEA 2CRLA 3BB5A 2IYGA 3IWLA 4Y2KA 3TOQA 1SB6A 4OJGA 2RMLA 2XMJA 4ZA1A 2JDJA 2L3MA 1P6TA 2LQ9A 5B0AA 3BM7A 3BF4A 1SI9A 2BYCA 1YRXA 1YJTA 2K2PA 2KYZA 3QGPA 3E8OA 1N5SA 2IFXA 5A6PA 1KVIA 2EW9A 5B0DA 1CPZA 2ASYA 2HLTA 4Y2IA 5B0BA 2K7JA 5KAKA 1Y9OA 1N5QA 3T9NA 2RILA 3KKFA 2RU9A 4HI1A 4A46A 1CC8A 1R6YA 3BDEA 1MWYA 5F0UA 1OSDA 2N7YA 3MCSA 4HI2A 5B0EA 1FD8A 2OD6A 2OD4A 2XMMA 5T7LA 3QMQA 2OAUA 4Y2MA 4YDXA 4HL9A 2HFNA 3CJKA 2GGPA 1GXUA 2AP6A 5T7LB 4OJ1A 3HF5A 1X0PA 2BBEA 2KKHA 3HHLD 3LGNA 1FVSA 2K7KA 2OFGX 3I9ZA 5B0FA 4DPOA 1CC7A 2ROPA 1FESA 2HLUA 1WD6A 1Y0HA 1OPZA 1Q4RA 2QLXA 2ZDPA 3VTIA 2FHMA 2GA7A 2N4DA 1MWZA 3FGVA 2BUNA 5K9FA 1YJUA 1K0VA 2BJEA 2LQBA 2OMOA 2FTRA 4FNIA 5A6WA 2QIFA 3BN7A 4NPOA 4HH1A 2XMKA 4YEAA 3BR8A 1TZ0A 2FIUA 1P8GA 2GV1A 2K1RB 4DL0C 3HDSA 4NL5A 1AFIA 1JWWA 1ULRA 1X7VA 2ROEA 2ROGA 1YG0A 2HQIA 5B0GA 5B08A 1S6UA 2RSQA 3WDOA 1W2IA 2XMUA 2KT2A 2G9OA 4A48A 5IXUA 2OFHX 2W4CA 1LQ9A 1S6OA 2GFFA 1N5VA 1RJJA 2KT3A 1U7LA 4F67A 1AFJA 1AW0A 1FE0A 3KNGA 3LO3A 1V3ZA 3HFKA 1Q8LA 2N4CA 4ZOSA 1SQEA 1FE4A 1TR0A
chains in the Genus database with same CATH superfamily
2WSCC 1WORA 2WONB 2ZBCA 4QQBA 2ZM6F 1OMSA 3K89A 3BO4A 3LP0B 1LW2B 3DDKA 3R1LA 3TARA 1OSCA 3M05A 2R4FA 2GQCA 4ED5A 2R7QA 3TJ8A 4G65A 4Q44A 1JLCA 1YQHA 2E7XA 1H38A 1CULB 4JI1J 4HR2A 2DNMA 3R7BB 4DLGA 3H7HB 1GEHA 3KK2A 3MFHA 1Q1KA 1T03A 1C1CB 1VDHA 4ED8A 1R7IA 2ZFHA 5J2NA 1RKJA 4PXBA 1URRA 1DRZA 3O8WA 4M5MA 4NYZA 2W9AA 2CZ4A 2H3EB 2YX7A 2FJVA 3M6WA 3N6NA 1EARA 4HT5A 1VQOS 2XMVA 3R27A 2DGWA 1FX4A 1VQMS 1TV6A 4GO7X 1R8HA 4L74A 4L76A 2ZH6A 4J9PA 1U1QA 1U1PA 1DJ0A 2DR7A 4DR1F 1GMUA 4RX6A 3MR3A 1L3SA 4ZIWA 4GC7A 2V9WA 2PGCA 4QU7A 4CLWA 1CJUA 1MW7A 1ICEB 3PTWA 2MQOA 2X1FA 3EPIA 4OZLA 2QMXA 2Z2YB 4RBTA 4YHHJ 3HZGA 4ECRA 2ZDOA 1FA0A 1R8PA 1S0VA 3AJ2A 3SCJE 4C0HA 3IM9A 5L38A 2MY8A 3B8HA 2KM8B 1GQEA 4WPAA 2ERRA 4JV5F 2KM8C 4AD6A 2D1CA 1S9GA 4IG0B 3SV3A 4OJGA 4CO5A 3KK1B 2VUGA 2XCPA 3HHNB 1HQEA 1JLFA 3MFIA 4DCJB 2G2ZA 3QLHA 2W9CA 1QAJA 1U8WA 4J9NA 3E8OA 4MIWA 2HRTA 4NI2A 2EVZA 1R43A 3N79A 1ZM9A 3U02A 2BJ9A 3MM7B 2YKMA 5B0BA 3BBFA 3V2UC 1SJ3P 2KO1A 2C3MA 4Y65A 2RU9A 1K44A 3NGDA 1HNZJ 4AQYF 1KSPA 1EJ7L 1TL1A 2YY3A 4TU9A 1T03B 4YOEA 1VI7A 1X4AA 2H9ZA 5T7LA 4ZITA 4P2MA 2RDJA 3F41A 4OZ1A 4EO8A 2QA4S 3SYZA 3HJFA 3LH2S 5F9NA 2BMBA 2KKHA 1R8BA 1F0XA 4DI6A 1S0OA 3PRBA 2HLUA 4Y34A 5J2NB 3KHRA 2I5JA 5KG1A 3PW5A 3GSIA 4P6QA 4DS5A 4U7UD 2IVMA 4HHHA 3V4MA 4DPYA 3W9JA 3MURP 3J80Y 1IBLJ 3CXCR 1NDCA 3T5LA 2CPIA 2MQQA 2XS7A 4DQQA 3T5JA 3ZZTA 5CCLA 1Y5IB 1B0TA 3DHWC 5A0YA 4XIUA 1KHVA 1ZPWX 2DNNA 1HLWA 2J5AA 2J7WA 2B9EA 4PXCA 4QIVA 1B7FA 3ISNC 5T14A 3J80U 3GIKA 4NMLA 3NG8A 4CQ1A 3TANA 3M8RA 3M8YA 3HVAA 2XO6A 4JI3J 3F73A 5A8RB 1N5VA 3TQ1A 4B3SJ 4F4XA 2UUCF 4NA2A 4TXSA 1UPPA 4KPCA 3CIZA 3PJWA 1T9XA 3MCOA 2AF6A 4OI6A 5HMYA 1FE4A 3PJXA 1HKAA 2CNKB 4FKYA 1LWFA 4IFYA 2LXFA 4U8YA 1KRPA 4O0NA 4KHPJ 5D0GA 4TY8B 4OZNA 3IBCB 1GX5A 1OY6A 1RYSA 2K06A 3KNAA 4X4RA 5AJ3F 4C8YA 2QMWA 2V63A 5D4NA 3F44A 2UUCJ 2DHSA 1VQNS 3RBZA 1DHMA 3GYNA 2MQNA 2ZJQQ 4NA3A 1T0TV 3A3NB 4YS2A 3RB4A 4Y3CA 3H2LA 4K4YA 1Y7PA 3MD3A 3WC0A 3JXOA 4CLYA 3BDPA 1UZDA 1OS5A 3DXSX 2DH7A 3PX0A 4X4PA 2V8HA 4DL4A 2E9TA 3QFHA 4WBFA 4OYWA 3BZQA 1S0MA 1KVJA 3FZBA 1NK4A 5KTQA 2E5HA 1SKSA 4PZVA 2F40A 3VVUA 4NXNF 1YK9A 3CSKA 1LOUA 3QT8A 5MAOA 1N36F 2PA3A 3RGIA 1IUJA 2Q79A 2W4PA 2NXJA 3NOCA 5KFCA 2ACYA 4ED2A 2WW4A 1RAAB 4PYAA 2E9ZA 4MK9A 4RU9A 2LLZA 1S4FA 1N36J 2DCUB 1Q79A 3HHLC 2ZUGA 2O1PA 1BQNB 3IRXB 2R7VA 4UY8T 5LSLA 4URQU 4HTJA 5IOLA 1OO0B 1Q81T 1G1XA 2YWEA 4PG5A 2OEKA 2OEMA 3MM5B 3LAKA 4C98A 5DETA 3KMSA 2XY6A 4K2JA 1NKCA 3UR3C 6AT1B 2XYGB 1WC0A 3KDOA 3TQEA 2HAFA 4OYBA 2P2CB 4ZPTR 1RP5A 5FLXY 2YKMB 3BF4A 2HZAA 2BYCA 2KYZA 3H20A 2NXNA 5BR8F 5A6PA 4I56A 3G6YA 2E5GA 3Q0AA 4J9LA 3PW0A 3MAHA 1FJ7A 2DJWA 2GHWA 3CJ2A 1IJFB 3UN3A 1HIYA 4O3QA 1FDDA 3ZO7A 3JAMY 3OTOF 3QLHB 3CCLS 3MTKA 2IA0A 4BC7A 4F3QA 3KKFA 4HI1A 4EK2A 3JSMB 3PRDA 2LFVA 2RJZA 1OSDA 4GO5X 1SKWA 1PCAA 2OD4A 3CIMA 3M7VA 4JV5J 3HSJA 4YB7A 1S6QA 4ZVEA 4ZVOB 4EYIB 4FF3A 3BN4A 4Y2MA 1HHSA 1A0OB 4DV0J 3CJRA 4ILMA 2QGFB 3CJKA 3TO8A 1J2VA 2VG5B 2V8DA 3B82A 3I32A 2CQGA 2ZVSA 4LMZA 3DKDA 3JQMA 1HW8A 2OFGX 1JLGB 1TL3B 2F65A 5DDQC 1QVFR 1PIEA 1VBYA 4W98A 5GAGU 1RK8A 1RT6A 4X2BA 3FGVA 2BJ8A 1H0HB 1KDNA 1MWZA 5K9FA 2DXFA 5I3QA 5LXRA 4DV4J 3T41A 3G9CA 4DMZA 3K2YA 2AEMA 2P6TA 1MG7A 3RJMB 1KLNA 2ZVIA 4DSIA 4ZN3A 3R5BA 1NH7A 1YDLA 4KC5A 2Z30B 3MEDA 3PRVA 4HH1A 4YEAA 4S0MA 5DM7Q 2VOPA 2GV1A 2FIUA 1X4DA 2NQPA 3QJLA 4X62F 3HDSA 3S1TA 3DDIA 3T1AA 1KLMB 2ROGA 1S9EA 2CA9A 3KHHA 3C14A 3VZHA 4ECQA 1S0NA 2MSTA 2A1BA 4KGZB 4OYOA 3WDOA 1L3VA 1WWHA 2ASDA 2XMUA 3PYGA 4NLYA 2G9OA 3A8JA 4EU0A 2JJ4D 4M63A 4DR6J 3CCQS 3Q86A 1R3NA 1TKZB 4JP8A 2CZVC 2GFFA 2PE8A 3X3UA 2B8QA 1W25A 2NLWA 3RAMA 5CA5A 1G7CB 2WK4A 1NHVA 1R89A 2WONA 2XQCA 3EZ5A 2K8GA 3MPVA 1LW2A 3J81j 4WKRA 3E51A 5HBMB 4YHHF 2KDOA 4AQYJ 1NHKL 2E66A 2EI5A 4IG3B 1JLAB 4M5DA 3H90A 1AXQA 1PYSB 3QIDA 4RBUA 4DHVA 4ELVA 5A8WB 2GVDA 3KG0A 1VC5A 3PW2A 4QYRA 3CCVS 3I0SA 4DR7F 3LP0A 1TELA 3QWUA 2ZOMA 3FC9A 1PJ7A 4A47A 3OXFA 5KT4A 2UVRA 1ZOTA 1OY9A 2BJ3A 4O4GA 2H54B 1YSJA 3H5YA 1LW0A 1MNEA 2IDEA 1BMQB 2CQ3A 3S7RA 3K5LA 3SV4A 2FD2A 3RR7A 2B0GA 3UNGC 3HHLA 3D5MA 4FYVB 2XM3A 1XNQJ 4ID8A 2R7OA 3W9IA 1B3TA 1YBUA 1TL5A 4GVBA 4ZKAA 2KZZA 4B3RJ 2HNZA 3DXBA 5J1PA 3PFEA 4ZLJA 5U47A 2MB0B 1ZA2B 2V4JA 1C0UB 1JKHB 1L3UA 1JJ4A 2XG8A 1RT5A 5ITHA 2AIRB 1RTZA 3VR1A 3QJPA 3W7BA 1KTVA 1UJ5A 5DDPC 4EGLA 3ZTOA 2M9KA 2LP4A 2ZJPQ 2NREA 4HLBA 1IM6A 5HMZA 3OSNA 1VQ6S 1Q53A 5HQMA 2GO8A 5EWFA 5HQLA 4WFBQ 2FJDB 2V67A 1TK5A 1CBKA 1UCNA 2A10A 4DBQA 4B02A 4CYUA 2H48B 1N54B 1PILA 2KH9A 3QSIA 2IYGA 1NAQA 1NJYA 3GB0A 3FCHA 4LSNB 2IVYA 2QTWA 3Q8SB 3LANA 4LRBA 5F8GA 4B3TJ 2IM0A 2RDIA 1QDUB 1AUSL 3K17A 1KVKA 1NM2A 1Z4UA 4IOBA 4DV5J 1GMVA 4PG7A 3BGRB 4FYXB 4PRFA 3IR6B 4GKKJ 1RKIA 4RO0A 2BR0A 3M6XA 2W2PP 3W8PA 3IM8A 4OYPA 4C7QA 2V8GA 3C15B 1T94A 2BM1A 3KLGA 3VAKA 1TL7B 1X4FA 5L1KA 2RILA 4ERDA 2OPQB 4EBCA 2I6WA 4PXDA 2HS4A 1WC3A 5LOQA 1MWYA 1RAFB 1HBUA 3CWJA 3D54A 5F0UA 2CKWA 5B0EA 4CI0B 4ZIVA 4ES1A 3Q8RB 4DF8A 2Y1JA 1WEZA 4G6VB 1HI8A 2ZBRA 2KFNA 3QGHA 4J37A 4ID5B 4Y6IA 3M9NB 3CF5Q 2J9CA 3EXCX 2VDIA 3FJ2A 1JLCB 1YRUA 1S1VA 4F02A 2AP6A 1UFLA 1AYEA 2CPYA 5T7LB 4DLEA 1K1SA 4E8UA 4CO1A 3CJ5A 2IM1A 3N6MA 3BKFA 1Y5NB 3UD5A 2VB6A 2ROPA 3R5AA 1WG4A 1CJVB 4KRWA 1L3KA 2QLXA 2VJVA 3HCXA 3ETOA 3OHBA 4DV1F 1KNZA 2UXCJ 3R7SB 4ZVPB 1WDDA 3I55S 2XSJA 4OZ0A 2YWFA 4A8YA 4F3OA 3DOLB 1RI7A 4K7QA 3PG9A 4WFAQ 3P49B 2Y1RI 4XPEA 3WZ0A 2X7IA 1IM4A 1XNRJ 3U7JA 1TZ0A 3R3TA 3IBWA 2XWYA 2Z2MA 1RISA 1BXNA 2B4VA 3TA0A 5BXIA 3TUZC 2XY5A 2N3OA 1NSPA 4WXWA 1UKUA 2JNJA 3V6DB 3HKZD 4B9LA 5HMWA 4FBTA 4D3HA 1H2TZ 1P1LA 1J5OB 2RH3A 4OX9J 1SXLA 1EETB 4L75A 1P9YA 3OVSA 2ZKTA 2ZD1A 3AA9A 5CYMB 1T8EA 3CCES 5F8JA 4DG1A 7AT1B 3OR2B 3PIPQ 2ADCA 2VBXA 3EZUA 3MMBA 4L3KA 4FPRA 1X60A 2CADA 1KBRA 2ZOGA 4ICLB 3GFZA 4ZVSB 4C8NA 4C6AA 3J7YI 3FDSA 4LFAF 1HL6A 5AT1B 4OI1A 2HHTA 4IUFA 2VODA 2CPFA 1PAUB 3NNAA 2ALZA 2C2RA 1SBRA 1RT1A 4M5DB 4ZPBA 3TRGA 3E01A 2Z2LA 4ZPWR 3M32A 4DSLA 3I6PA 3T1HF 3VGTA 4DR6F 3K8WA 3AFGA 1QVGR 1XNQF 1E6YA 2MKJA 2RRAA 2EWHA 4K4WA 2DEIA 3K58A 3AOAA 4WU3A 7FDRA 4IOCQ 3ZFVA 1KD1T 4CO3A 2OPRB 3RB0A 3TVZA 3CD0A 4L3NA 3UNYA 2PEHA 1FNMA 4RW7A 3TAPA 2LEPA 4F04B 1R8AA 4OX7A 3G96A 1R0AA 1RWNB 1QUPA 5D3GA 4WZQA 1QM9A 3ICLA 1U2FA 4MKAA 3AD7C 3HP6A 5IFMA 1EB0A 2WZ1A 3DLJA 5D0EA 1YJRA 2BE7D 4P71A 2JL9A 4ZJOA 1T3OA 1RA6A 4MTPA 2P5VA 2RVJA 3NGKA 3OFFA 2HZVA 5J2QA 2H5EA 1NCLA 3BSCA 1RT2A 1RHUB 4NMXA 3W61A 2VBZA 1CJKB 1WEXA 2J8AA 3W5YA 1N5YA 2YNGA 4FS1A 3SCIE 3HVTB 3NMRA 4NOHA 3Q8UA 3GWCA 1TL4A 4RW4A 3OV7A 2KN4A 3ZZOA 3RB6A 1CQNA 1RCXB 2MKIA 4B9NA 1X4EA 2CPEA 4PG4A 3BEGB 5L9NA 2DHHA 3LPYA 2H5IB 2V94A 3FEZA 4WE1A 5HMXA 2XMJA 4ZA1A 2LQ9A 4MFBB 1S79A 3BBBA 2B9XA 1ZA1B 3SFUA 2XGPA 2JFDA 3KLHB 2HQCA 2J9DE 3BGFA 4IQMA 1N5SA 1YKWA 5CAAA 4ITSA 1V9OA 3EXYA 5CYMA 1NMEB 5C42B 1VQ9S 4AL5A 3JYTA 1NK8A 7FD1A 1F3VA 3MPWA 4URSA 3S01A 2G0JA 1TKXA 2UU9F 4FZVA 1RACB 4KQZA 1IJEB 1Q7LB 4A8OA 2D3ZA 2AX0A 4O3PA 4FN5A 1TP7A 5DM6Q 1MU2A 1DQAA 1XWLA 4ZVTB 3QRQA 4XDCA 3R5JB 4B3SF 4K4VA 1HWJA 3M6UA 2IMWP 1EQ0A 3PACA 3EICA 1P9QC 3KXDA 4LVOP 2MZ1A 1UEVA 3GE9A 2Z57B 3LGNA 2K7KA 4ECWA 2OTJS 3D1QA 3OQ2A 3FBBA 2RQ4A 3MAAA 4PQUB 5KG7A 4I67A 1CS4B 2XEXA 3HVTA 3IFEA 1RWXB 3G8QA 1S4EA 3N9UC 3A8IA 1C4CA 3BN7A 4MK8A 2CWXA 3BYRA 3RUBL 3RYLA 5KFRA 2W2NP 1R0CB 4IO9Q 2XNRA 1GX6A 4KKOB 5K5MA 1XN9A 1NJIT 3J7AN 4I2QB 4LRCA 2BW2A 2QL9B 3H5UA 3KJVB 1GFWB 5IC4B 4DV6F 2AGPA 5IT9U 1ZM4A 3BO3A 2KT2A 3I5AA 5I3UA 2Z58B 1KLMA 3A8EA 4C8OA 1UVJA 3BKUA 4PR6A 5IS2A 3OW2R 3HI9A 1RA7A 3EGWB 3D28A 4DV6J 1U7LA 3CNQP 3MM9B 3QAUA 1W2BR 1UA1A 1IBMJ 1N32J 3CDBA 2BW7A 4JI7F 1OWXA 2HHQA 4U67Q 2MZJA 1RT3B 3D68A 4QJVA 4CLPA 1FXRA 1HQEB 2O66A 1GTHA 2HVEA 1UW4A 4NEZA 2JC1A 2OSRA 2ZC3A 2DHXA 5C25A 1D9DA 4JI7J 2HHWA 1MU2B 2Z2ZA 4J9UE 4DFPA 2VH7A 3I31A 4UTGA 3ETMA 2GJFA 2VFVA 1HI1A 3M8ZA 2HKEA 1N34F 1XR5A 3FQKA 3LUYA 1Q5YA 4ZP9A 4KHPF 1K47A 1VR6A 1YX2A 4V1Ak 1U09A 2FZCB 4CZCA 2CNLB 2R8IA 2AU0A 2G2OA 4AFFA 5B09A 1PG5B 2BACA 2Z4PA 4MT1A 1S57A 4USJC 3CUNA 1SKRA 2JEGA 1JQGA 2DR8A 2CVEA 2R2SA 3EDRB 3LA0A 5IT9Y 3I9V9 2CG4A 4PQAA 2QV6A 4Q5VA 1ZETA 1H7WA 1VRQC 1N48A 1N5YB 4ZVUB 4WFYA 1HQUA 1JLQA 2D74B 2BJ7A 2MLZA 2Y0SD 2BV3A 1RTHA 1P27B 4USHA 3POTB 2CQHA 1SC4B 2JLGA 5KFJA 2V2KA 1OYEA 2V5HG 2MKCA 3QWPA 2JLEA 5L8RC 4DOZA 1Y10A 1AT1B 2JOQA 4HEA9 2BA9A 3BH7B 2ZE2A 5DJBA 5F0WA 4Y2CA 1ZPVA 2MQPA 4I2QA 2HHVA 4XK8C 2QLWA 5C7PA 4TN2A 4ZLPA 1FKPA 2L9NA 2W7AA 4OI2A 4PCQA 4DPXA 1W7WA 2FHJA 2RMLA 2MGZB 1HMVA 2ZH9A 4QYZK 1TKZA 3BM7A 1HYSA 2CJKA 3OLAA 2F4VF 1S49A 4KHRA 4CLLA 2KVIA 1CPZA 1RABB 3AA8A 2P9GA 2RNEA 4MYUA 3WX4A 4G1PA 3MDFA 3CJQA 2E5LF 2ZM6J 5FD1A 3MCMA 4HHJA 2R7XA 4URGA 1S7HA 3MCSA 8RUCA 2AD9A 1RBAA 1FD8A 2HFUA 3NCRA 3ZZZA 4ED1A 2FLLA 3RRKA 4MYTA 4DUYF 4ZP6A 5DLGA 1SL1A 2D7SA 2GO9A 4LT6A 1S6PB 3FZ2A 5ETOA 3ZNUA 5KFNA 4LFBJ 2DD8S 4C8MA 2FZKB 3Q8VA 4WK1A 3GIIA 2FJXA 1RTJB 3MMCA 1DARA 2ILYA 1E6VB 4QWEA 4DR5J 4KJIA 1HWKA 3HSZA 3MUTP 3HD1A 2VJUA 2GJ2A 3OLBA 3H59A 5A76A 1FESA 3SQOP 3KK3A 4KBIA 3UFCX 3G2XA 2VU5A 1QLNA 4QU6A 1WC4A 5CZXA 3PX6A 1S77D 2DT9A 2AJQA 5HK4A 1F6TA 2H5JB 2LQBA 5E0OA 1UMJA 4RR5A 1TTHB 1CJVA 4KV8B 1YJ9S 2QMUB 4FF4A 2HNDA 5KFIA 4NPOA 4V19J 5ETNA 2DNPA 2IY5B 1XTZA 1IBCB 3W2VA 1HNWJ 3DOLA 3IR5B 4ZS6A 1ULRA 4ECYA 2MSSA 2YPYA 3NWGA 3H4BA 3DLEA 1JXEA 1VLOA 3Q89A 2YWHA 1WOPA 1D1UA 2EBEA 1S6OA 3KJVA 3PIOQ 1FTRA 3HK2A 1YJ7A 1U48A 5C2CA 4RUBA 4F25A 5ETMA 1X31C 3BO2A 4DV7F 3LO3A 1V3ZA 1EZZB 1FKOA 1RSCA 1H73A 1S59A 4RW9A 4N56A 2XLIA 1U1OA 2XB2D 1U1KA 1M90T 1WHXA 2HG4A 4ELUA 1VRTA 4OJHA 1J5EJ 4IRKA 3TUJC 2B4UA 3CO0P 1SL0A 1N8RT 4LIRA 1M5HA 3CJ8A 5KG5A 3G8TA 1V3RA 5KFZA 1XERA 1M1HA 4X65F 1ZBTA 4C8KA 2MKYA 4DF4A 3PV8A 4B9UA 3FKBA 1IR1A 1WKJA 2B51A 2CQDA 2QA4G 3GIRA 3H4DA 1HARA 3JS9A 5F3ZA 5LJ5Y 2HURA 4IDKB 4FXWA 4RW7B 4BBYA 2HBQB 4RWWA 4IQXA 1HBUB 2AJFE 2CWKA 3C16A 3MGJA 4FYWB 2OJ3A 1FDBA 3GQCA 4ECUA 3MAQA 3CJ4A 1QSSA 1U6BA 1FD2A 4WJBA 1SJFA 1X9MA 5E41A 1RYRA 3W65A 2HPUA 1YZ7A 3QBCA 2LEBA 5HROA 3CJKB 1JLQB 2E1PA 3SDEA 2UU9J 2B6AB 1HNVB 2BE9B 2WVDA 1EX8A 1F2HA 2DR9A 3CO9A 3UPFA 4Q2LA 5DS7A 2XSFA 3D6TB 1JLGA 1TL3A 3JSBA 3MEGB 2QJ3A 3NAHA 3T1YF 1ITPA 2WBRA 2HGMA 2J9EA 1VJWA 3MPYA 4F36A 5KFDA 3CC7S 3NNCA 1UETA 1GK8A 4F0HA 4WZMA 4H4KC 3CD6S 3GFHA 3DLLQ 4KV8A 5GMDA 1FRXA 3C66A 4FVMA 4CLZA 1Q95G 1B4SA 2Z56B 4WP8A 2FVRA 1N52B 3SSRA 3UR0A 1VQPS 1U1RA 4RU2A 4M5LA 3QZ8A 1N32F 4XO0A 1JLFB 4J91A 2AJ2A 1Q8IA 2B5JB 1LNQA 1LWCA 2HFVA 4ANDA 2JVRA 4DV3J 3IWLA 1RZMA 2P6SA 3MEEA 4PPZA 2HAIA 2RF2A 4QIWD 4OYIA 3TEGA 4ED3A 3L7OA 1RLDA 2FLOA 2HNYA 1KOHA 1QE1A 4CLKA 3TA2A 2M4MA 3TZYA 1CVJA 4KR0B 1SV5B 4UOGA 3M8WA 2FHOB 2G0IA 2HFZA 4NA1A 1FI4A 2PI5A 3ISND 3BBCA 4USIA 1IBLF 4NLXA 4A46A 4H54A 1ZM3A 2X1GA 4RLEA 2V4QA 4FXDA 5GADI 3M1VA 4NLWA 3BQ1A 3UVJB 3FBFA 3P5TL 3AJDA 4LR9A 3SMZA 1PKUA 3MOJB 3KFWX 3UCZP 3CE8A 3CD7A 3I0SB 1FFSB 4YQWA 3GLJA 2VD3A 4TNOA 3BV8A 1DBDA 1S1UA 4WTYA 4XTTA 3M32B 5IC6B 4ZCMA 3J81U 1HA1A 1IKWA 2JEFA 1EHWA 4F4ZA 1MN7A 4DPOA 1CC7A 4TYAA 1Q4RA 1U0HA 2XLJA 1VC0A 1WSRA 2O3DA 1FRMA 4QWAA 1L3TA 4K5RA 1DTQB 4FNIA 3OBIA 2DR6A 2HEKA 3FFIA 4LF2A 3W5XA 2B7CB 2I8EA 1D9FA 2OPSB 1B70B 2CVIA 1FWPA 2X3GA 2JLFA 3LALA 3OL7A 1JKHA 5H9FJ 4NASA 4R0EA 3B4MA 4KGXB 2LEAA 4DUZF 2RSQA 3PHTA 4I7FB 3V81B 3IS9B 3TEHB 2DXDA 2RF2B 3GV8B 2DIVA 1T7PA 1FHTA 5HI7A 5KFFA 2VG7A 4I0WA 1RB0A 2LKZA 2RU3A 2HRUA 4EZ9A 2J8SA 2HQGA 1LWFB 4IFYB 1I3OB 1HNWF 4RUAA 2EC0A 2C3YA 1C4AA 3M8PA 5JXSA 4LSLA 1VBXA 3A4TA 1HWLA 2HZCA 1OQ6A 4LR8A 2XHWA 4RUHA 4EMDA 2NS1B 4C3MA 1KQSR 1NSQA 2HMIA 2EBGA 3W5ZA 4DN0A 4DR1J 4N41A 3NMAA 3O44A 4ZVHA 1LWEA 1PBAA 5AXMA 4CDIA 1RBOB 1EAYC 3FRYA 2PT0A 4W4MA 3CC4S 1IKWB 4R8UB 4NXMF 3KUHA 1Z2ZA 4YB6A 3HXMA 1B0PA 1X5OA 4YR2A 4CT9A 1XBWA 3T9ZA 2B6AA 4OHVA 1NH8A 4U9RA 3EVMA 1JMTA 4DL2A 1AROP 4KH1B 3AT1B 4RZRA 1DTQA 1Q7YT 3D7SB 4P52A 1ZZNA 3F56A 1WG5A 2HQFA 3D0GE 4ZPAA 2UUAF 2Q43A 1PJ6A 3ZTRA 3OSPA 1NSKL 1PC5A 2CQ1A 4OQJA 2PC6A 3M8SA 3IG1B 1YBAA 2RKIA 3FEYB 2FUG9 1Y00A 1RE1B 1FRKA 1UAWA 5BR8J 2Y8YA 2UUAJ 4DR2J 1HHQA 3FVYA 4CM0A 2VONA 4K0KJ 2MJNA 4K4ZA 2HBZB 4OMFG 2HWTA 4OYXA 3KK3B 4DWIA 5GMKa 1U1LA 5D77A 1BQXA 4I64A 3U1MA 2L08A 3MXHP 4KGVB 3K5NA 5DDOC 2ZD1B 1HWUA 2J9DA 2NXCA 4LRFA 2CRLA 3R97A 2A3JA 4F4AA 4U95A 2FQQB 2ABYA 3TOQA 1JB0C 1SB6A 1QE1B 1UL3A 2JHEA 3D3CJ 2ZH8A 1YJNS 1SJQA 1PGZA 4JI6J 4ICLA 4LBPA 5D4LA 3IO1A 3V6DA 1FEHA 3ISZA 1SI9A 5GMEA 1YRXA 3ZTSA 2WBMA 4EO6A 4KGMA 3MEEB 3P4UB 5KG4A 1VMBA 3OFGA 1NJXA 2C42A 3HSGA 4YR0A 3TP2A 3TZXA 5GADU 2ZBIA 3OVAA 4GKJF 4J9KA 3OR2A 6FDRA 2HNYB 3W60A 1RT7B 2YNHA 4K5SA 4M5KA 2VASA 2GQ2A 3HZEA 3V4IA 4JI3F 3OXLA 2HIYA 2VC1A 3DI6B 3QIPB 3JSRA 4B9MA 4EBDA 1FT8A 3WHIA 3I56S 3DRPA 4MKYA 1T05B 1SPBP 4O3RA 2F8HA 2ZHOA 3GR1A 1S6QB 2BQRA 4LF6J 4WWSA 4I2PA 4USVA 4Y00A 2JC0A 2XI2A 5LT5A 3SZ2A 4KYZA 1VQ7S 3DLHA 1C1CA 2MDAA 2G0CA 3ITHA 3VQSA 4UZBA 1M5OC 1SVDA 4H4MA 5M2UA 4IR1A 1ZH5A 4DDFA 1CJUB 5B08A 2V6AA 2LMIA 2Q1LA 2ZKUA 3EE3A 2G2YA 3AJ1A 1Q16B 1YJUA 1JJHA 3KLIB 4RW6A 3U1LA 2MKKA 3PHEA 3THTA 5JVHQ 3X1LB 1P1TA 2CAJA 2J0SD 3Q2SC 1H2VZ 4C3KA 2DKOB 4DSEA 5AE2A 1NDKA 1RQ0A 2WRMA 2Y0BB 2ZOFA 3QNWB 4JBCA 4L73A 2AQ4A 3F0NA 4KIAA 4XPCA 5J2QB 4ZCLA 5KFUA 1UA0A 1V3SA 2XS5A 3AOBA 2D41A 2W7PA 4O3OA 2R7RA 2CPHA 2YXLA 3GJTB 4EI2A 1S1TB 4H4KA 1WI8A 3T3FA 4IFVB 4OLOA 2W8KA 1NK6A 2XS2A 3DMJB 2F4FA 3GCXP 3PO5A 1LXJA 1XMOJ 4B3OB 2YVSA 3PX4A 4CTAA 2FY1A 1D09B 4RWXA 3EDQB 2IA6A 3MM7A 4YY3F 2AV5A 1TQLA 2Y1LB 4CLUA 4OZ2A 4GRSA 2EFVA 1XK8A 1F3FA 3OJSA 3RZAA 5FLXU 2AJ0A 2PDAA 3I96A 3NAIA 5DQHA 4G3IA 2M88A 3EGVA 2VFUA 1VQ5S 2NPFA 4WKYA 4IH6A 3J7Z5 4YY3J 1IQTA 3G86A 3W9HA 2UVWA 3MMBB 2GVZB 3I0RB 1T9WA 1I51B 4J9VA 4M1KA 2N3LA 2V34A 4R8UA 3UCGA 5KG2A 2KG0A 5DGAA 4M95A 2CG8A 2DNLA 1M5PC 4BCAA 1H98A 1RBLA 3WC2A 4CO2A 2HMIB 2ZITA 2PMHA 1ZYQA 1R0BG 3CDWA 1VGYA 3KLFA 3HVRA 1IQZA 1HNVA 1RU2A 5F8HA 3G87A 1NSAA 5I42A 2GHPA 1M5SA 4LSZB 3BKTA 3FMBA 3MEGA 2AEFA 5H9EJ 1Q86T 2QYGA 5LM7E 2IMOA 4CM2A 2UVUA 4W92B 2APOA 4K0KF 1JIHA 5A2QY 4ZCKA 2HQDA 2KL8A 3K7RA 1Z1ZA 5HROB 3BJYA 3HLUA 1N4LA 2DHGA 1SUQB 4LF5F 4DV1J 4NZ6A 3EX7B 2X51A 3C8YA 4OI4A 1T02A 3SQGA 4DXLA 4HT7A 3M8QA 2J0WA 5LMNJ 2FJWA 3MMAA 2MYFA 1G3OA 1F9HA 2VBWA 5IT0A 3IG1A 2J7KA 2V8VA 3I5CA 1WELA 4I69A 4I6AA 4NEYA 2WAQD 2RQCA 2QFJA 2FVSA 5HVFA 1A9NB 3U27A 5HL7Q 5KFXA 4B3OA 1F1BB 3DC2A 4HHUA 1ZS6A 2OO4A 4M5GA 3ENVA 1Y3JA 1RWVB 2AKWB 3UI3A 4QPXA 1FEEA 1XR6A 3Q8QB 4LUBA 3CPWR 5KFKA 5C24A 5J2PA 2X1AA 4Q45A 3CW2C 5K8MA 4KAIA 5GAHI 4I68A 2L3MA 2D3UA 5HANA 1REGX 3D4JA 3IRWP 4GC6A 1IBKF 3C15A 4RL1A 1KN6A 2EFNA 1T9UA 2RB7A 3SEOA 5EWGA 2IRYA 3G6VA 3T1YJ 4GMKA 1FTCA 5ETVA 5CXTA 2EPIA 5CD4H 3H25A 2HLTA 2PEBA 4DV5F 5KAKA 4O0IA 2ASJA 4GKKF 1KHWA 2D9PA 3ADAC 4KT0C 5HBMA 2FJEB 4PG6A 5H1SV 3HD2A 3UN5A 1F5BA 3EWGA 5ETTA 2PA8D 5SUHA 3J7YU 3KLGB 4YP3A 1S1UB 1PSDA 2W1BA 4WIQA 1RU1A 2FC8A 2OPQA 3RU0A 5KFGA 2YNIA 4DCOB 1I6JA 1VQLS 2B4PA 4LF1A 4HL9A 3E3XA 1X0FA 2XI3A 3M2RB 3T6BA 5ETKA 3UVJA 3DI6A 4WFZA 2FGCA 4X84A 1N88A 2VZ9A 2MHEA 5JVGQ 1MMLA 4DL6A 2M52A 2QSFA 1UVNA 4RW6B 5LMNF 3ENQA 4QR2A 5IV4A 1U25A 3MM8A 3MMJA 5K8PA 4N77A 3JAMU 1U2CA 3IA0A 2KG1A 5I42B 5KFMA 2GA7A 4A8SA 1WF1A 2OI2A 2H1YA 5K20B 4Z37A 2ZH2A 2W9BA 3M8QB 4MH8A 3NCQA 2FHKA 5KFLA 4ECZA 3EM1A 1NB2A 4NYOA 5FIIA 3V6HA 2DVIA 3P6YC 2YKNB 1NDLA 4DEZA 3I4HX 1MN9A 3V81A 2ALYB 3K57A 2YX4A 1UFKA 1JJCB 2EG2A 2V4JB 2BKNA 4K2XA 4WYLA 3GFXA 3MR6A 1LK7A 1WTBA 2HQIA 2DH9A 2KHCA 5HAOA 1SC6A 2CQPA 4PABA 4ZPDA 2ZWOA 1KKHA 4TQSA 5KG0A 3DOMB 3P45B 1IR0A 4I7FA 1EP4A 1WKLA 3BSNA 3DU6A 2OTLS 5D78A 1HBMA 2L9DA 2XYHB 2V4RA 4LF9J 4A8FA 2WVEA 3NBPA 2MJUA 1RHQB 2MMYA 2N4CA 4M5HA 2DITA 1CLFA 2IAJB 2F8MA 3PM9A 5A2QU 1JLEA 2C2ZB 2JSXA 2FB0A 3I0RA 4J90A 4CTAB 4QCLA 1DQ8A 2DXEA 4Y28C 1HYSB 1X5TA 4EUVA 1QJHA 4YB1P 1RTIB 2CQ4A 4NLDA 4P73A 3UE2A 4WYWA 4A8XA 1FK9A 2MZSA 3T6JA 4F4YA 2DISA 2WVBA 3KUGA 2IVFB 4B3MF 2L48A 2QT7A 5DQGA 2NZCA 4LF6F 1LFPA 2L9WA 3D1OA 3DRRB 2VC0A 3VAMA 4DV3F 5D3GB 3VV2B 1FFWB 2ZZMA 2HBRB 1VQSA 4PAAA 2BM0A 2PSZA 3M2UB 1DAXA 3MR7A 2ZNYA 1FRLA 4NE9C 3VGSA 1CSJA 3KYLA 5D15A 1R31A 2HHHJ 3W1YC 2R2RA 1ZTTA 4EZ6A 5FJ4A 2CQ0A 4LRDA 2RHSB 3O6QA 3IWXA 1Y3KA 2VG6A 1C1BA 2AX1A 1VQYA 3AQPA 4Q2MA 2IJFA 3PYEA 4O3NA 3S8SA 4J9SA 4AXIA 1MSWD 3C6TB 4F7VA 2RD5C 1IKXA 3C46A 4ZCIA 5JJBA 1DURA 3ZC4A 3HT3A 1YWXA 1K0TA 3OT9A 4LF7J 3DHXA 4NRTA 2AYGA 2RE1A 2UXDF 1ZAWA 1BC6A 1RTHB 1I1GA 3MHYA 1KQGB 4QWCA 4ZJQA 3SQGB 1U1MA 2GMJA 3CCRS 2IM2A 2V2VA 2C2EA 1EP4B 5EGYA 3UDEA 2ADBA 3W2VB 1WC6A 3D1HA 4NYPA 4J7CA 4JI8F 5KFEA 3H2VE 2XZTB 4HACB 4FF2A 3OFHA 3R7NB 2R8JA 4Y2AA 3OL8A 2BQ3A 3BR9A 1N33F 4NI2B 3TAMA 1P6TA 3KLEA 1DFDA 2VQEJ 3CDAA 1A6LA 2W25A 2B9WA 3DLGA 1RAGB 5KT3A 1S9GB 2RAQA 2B7BB 3AHPA 3NGUA 4IG0A 5B0CA 1HR0J 2GMLA 3CC2S 1XC9A 4D3GA 4FPIA 2ACMA 2XZDB 1DZ5A 2XNQA 3OTDA 2ASYA 3L09A 3T9NA 2QA2A 3DLBA 3MF5A 2IPOB 2MEWA 4IDKA 3TYTA 4CCHA 3U1NA 5M2PA 4PKDB 4KO0A 4C97A 2QX0A 2CPDA 2JVOA 3M2RA 4AXJA 1LW0B 2GVDB 4JB8B 1JNRB 2GW8A 1VISA 3M2UA 3DRYA 9RUBA 3VVTA 5L46A 4J9RA 3RAQA 1U8SA 2BKPA 2LDYA 2V69A 3M2VA 4UOFA 4X4TA 4Q8EA 3QRRA 4TVAB 4P2XA 4QIFA 5E3RA 2C2DA 4HVZA 1HWIA 3MAAB 4PQUA 1SIZA 4LF4J 4RBVA 1E6YB 2OSQA 4LIWA 2J6TA 3J7A1 2UXDJ 1TK0A 4OI0A 5HJYA 1FJEB 2GAHC 1OPZA 2XO7A 2MLYA 2YNFB 3V6KA 3ONQA 4X65J 3QT7A 2EXUA 3PEJA 4QIEA 3AD8C 3W63A 2DNHA 4KTQA 4I6WA 1KP6A 1GXLA 2CDQA 1GMWA 1TVRB 1EKSA 1U6FA 2NSBA 3NCPA 1HBOA 1X4CA 2ILZA 2MHNA 3FEXB 3KLIA 3R5CA 1CS4A 3PFOA 2W8LA 4M5JA 3GJRB 4MKBA 5J1NA 1IWAA 3AXKA 1SQGA 1JWWA 1RTDA 2HNDB 3DOMA 2HHXA 1HI0P 1S6UA 2QFIA 1LKZA 3W2WB 4O3SA 4P9SA 5AXKA 5EN1A 2E5JA 2HWHA 4DL7A 2WSFC 4JI4J 1SKUB 1LQ9A 2YBVA 3D67A 3BSOA 3DLEB 4A8MP 1AW0A 1FE0A 3GONA 5ETSA 2HYIB 4HACA 1TKDA 1LWCB 3IGNA 2JWNA 3GG1A 1Q8LA 5KFBA 1EIYB 1SQEA 2QRRA 5EX3A 3CCUS 3QQCD 1I5OB 3MUVP 4ZN1A 3DLGB 5DQIA 4HYKA 2F5GA 2DNOA 4DN9A 2QL7B 1WDTA 4DPUA 1TUVA 2HWIA 5HSPA 1VRUA 2A18A 1YIJS 5KFTA 1YZ6A 2BEFA 5K14B 2BJ1A 2IBOA 2XLKA 2JH3A 2RQMA 3DOKB 5EUHA 5C42A 3OTEA 5KT7A 2YNHB 5AXLA 3ENAA 1U6ZA 1ZAXA 3FSXA 1KEKA 2QO3A 3OFEA 1MWQA 4DSKA 1MLAA 1RUSA 3DLKB 4DUTA 4LFBF 1F9FA 4X66F 4DL3A 2KTQA 2VQFF 4FS2A 1VJQA 3LTOA 4MMOA 4OJ3A 4QW9A 4QYZJ 1ACMB 3C6TA 1HNZF 2CJYB 3DM2A 3L7UA 1H6KX 4HDGA 3FFIB 3OTBA 1KTQA 5KFAA 3TVKA 1FNOA 5K8OA 2R2UA 4C0OC 4X4OA 2OPSA 2Y1IA 5HJXA 2G1DA 5E3AA 3SDEB 3THVA 2P9EA 1JK9B 1S72S 1U0HB 1QSLA 1C1BB 4OIXA 1APSA 2YWWA 4P72A 3GPAA 3H5XA 1MMNA 3D6FB 4C8ZA 1PAEX 3VF0B 3O1LA 5D4OA 4LJMA 3FNNA 1N5TA 2FC9A 4USWA 1FCAA 1FDAA 5KFOA 4ED7A 2AHOB 2YKOA 2W2QP 2UVVA 1FRHA 4DPWA 1Y4ZB 1T11A 1VQ8S 1HMVB 2QLFB 4NLOA 2OGUA 1HHTP 4DG1B 4BHQA 1NK5A 1KC8T 4EWTA 2AEJA 2KRRA 4DQRA 2WW8A 3FUYA 3JSYA 2MZQA 2QE5A 4JI2F 2AT1B 3HULA 1QTNB 1UJ6A 3DYAA 3NS5A 1M5KC 3TAMB 3KLEB 1EETA 3OL9A 2HHUA 3CDUA 3GJQB 4USUA 1RAJA 3MTJA 2M0GB 1NK7A 2J7UA 3AODA 2R8KA 1LWEB 2CQCA 4EYHB 2R2TA 1CC8A 1UEUA 4DR3F 1N33J 1IXKA 1WHWA 1TKTB 2HVIA 1NRKA 4OX6A 4LF9F 1QAIA 2OH2A 2UXBF 3JSMA 5KFHA 3SSQA 1K8AT 2NZ4A 2DGXA 2LU1A 2IBKA 4YDXA 2M5YA 1G6BA 3RRGA 2KFYA 2PI4A 2KJVA 4F2SA 3MM8B 3H42A 4ETZA 2ATCB 3GV7B 3T1HJ 2KHDA 3US5A 4JV0A 2CPZA 2R7UA 3PEHA 4LREA 3D9BA 3LW5C 1CJTB 4QW8A 1RAOA 3VTIA 2DGUA 1CJKA 1E6VA 2BUNA 2BKOA 2B9YA 2V68A 1M5VC 4L6V3 2EEYA 2BOAA 4F26A 4WFNQ 3IN5A 2E1AA 3OPKA 3WX8A 5HLFB 1FWKA 2OUGA 4WXOA 5F8NA 2CXEA 3L7PA 3JB9k 2ROEA 5J2MA 2RKIB 4OFZA 5KOXA 2HBYB 2FJBB 1T9TA 2BABA 3BS9A 1IBKJ 1VHIA 4JOUA 3PZPA 5IQQA 1NU4A 1D3WA 2MKSA 4OZ5A 4PYDA 3MM6B 2KI2A 1N34J 2YQ0A 3PYFA 5LMUJ 2KT3A 2BANB 1TAUA 3M4XA 1IWGA 1RCOB 1JLEB 2EKNA 5L39A 4NRUA 4CO4A 2BQUA 3TX8A 2XWXA 3UQSA 2QSWA 2N82B 4RNMA 5E2QA 2MGZA 1PO6A 3JQKA 3KHGA 3ZZPA 2DO4A 2FGOA 4DR2F 4Z2XA 4ZLLA 4ATNA 1RWKB 4R5PA 1S48A 4FDFA 2MLXA 5C5JA 5IM0B 2VFSA 5L1JA 2DNQA 3HVWA 3ZXWA 1REVA 1S1WA 2CJQA 2NYHA 2O5DA 3AD9C 4A4JA 5LSOA 2DPIA 3KTQA 2P8IA 4ECTA 2RRNA 2VQEF 4LF4F 2J0QD 2OLWA 2A6OA 1WNEA 1TKXB 1RWMB 2A2DA 1U1NA 3ZZYA 1OPIA 3QT5A 3DOKA 3V4IB 2DNGA 2LDIA 4EFAC 1I94F 3C2PA 3TUPA 4H4MB 4DU8A 3EVWA 1N6QA 3R5GA 2FPHX 2EG1A 3D6HB 1XR7A 1T05A 2XYPB 2H4YB 3D3BJ 3KDNA 1KQKA 1YTYA 4DPTA 1QY7A 3VCDA 4C11A 3SCKE 1NK0A 3HX9A 1H2UX 1RTJA 3MMCB 3QT6A 4L72B 1FXLA 3HHLB 2MZRA 5F8IA 4X64F 1SL2A 3HHKA 4AL6A 2BZ2A 2HIQA 3EGNA 3IAS9 4OV1A 2M8DB 2OELA 3KWMA 4DQSA 2BOPA 5DDRC 3AAWB 3LPEA 3QJJA 3GZ7A 4FBUA 3H98A 1C0UA 2QYCA 2C3UA 3IAM9 3O3LA 2OKQA 4QZVB 3OL6A 1WACA 1U4BA 1VC6A 3ILLA 4DX8H 1IN0A 1GXTA 2KZMA 2K1RA 3MM9A 5T41A 2D3OR 5A0YB 3C19A 4ED6A 1M0SA 1WUUA 3BGUA 4HH0A 1XMQF 3GILA 2NCKL 2JEIA 2VFTA 3I5BA 4ZPVR 4O4RA 3ZTQA 5AE3A 4ES3A 3C6UA 5I3UB 1GAOA 4RNHA 4K4UA 2BRLA 3MOZA 3VGVA 4ANCA 3UCUP 2ZEJA 2UV8A 3LP2A 5A8RA 2D3O1 3MD1A 3P8BB 3QGPA 4OHZA 5C2GA 3HO1A 1KQFB 3TX0A 2FJAB 4M5IA 4X62J 1HPZA 5DG8A 2KYXA 2ZBPA 4WK3A 1FRJA 4IRCA 1FKOB 2M3DA 3ZZRA 4R25A 1NNDA 3M1VB 4UOCA 1TMJA 1VK8A 2HHPA 2DPJA 2EFPA 2B3TB 2CDRB 1SV5A 2MY7A 3WIVA 4ID5A 5KOWA 4O44A 5H9FK 4R5PB 1TAQA 2KT5A 2KU7A 4QR0A 1O0PA 1S1VB 2LVWA 2YWGA 1UPMB 4ILLA 1FERA 4C0BA 2B56A 4UUXA 3VAIA 4B17A 1GMWD 3FCWA 4OJ1A 3CJ0A 2JRSA 3K5PA 5HVHA 3RBEA 1QSYA 2VA2A 1BD6A 1FJGF 1HBNB 2RUSA 4YMEA 5ETLA 2FYXA 2G13A 4DUYJ 5AJ3J 2DTJA 3POTA 3IP0A 4BC9A 3OTCA 3B4DA 4LF5J 4NLGA 3GU0A 1S97A 1AB8A 5CYQA 3E2EA 1OJ4A 5F3TA 3ILJA 3ZTPA 1LEOA 3PNIA 1CJTA 1N56A 1B0VA 1HNXJ 4OHWA 2XHCA 2GZOA 3LOUA 2QEXS 1HQUB 2ZWPA 1S1XB 3N0VA 2K1RB 4FKXA 2VQFJ 2F4VJ 4ANEA 2QN6B 2F9DA 2E7WA 1MMDA 2GNKA 1TUGB 1VOMA 2VG7B 3A3PB 1UVMA 2LA6A 3OHAA 1HNIA 5ETRA 2VA3A 4A48A 2KJWA 4WFXA 1KR4A 4LBHA 2OIHA 2CJ9A 3M8PB 1CQMA 1BHNA 4YFUA 1RJJA 1D0EA 4LF8J 1BQMB 3N5BA 1S76D 5KT6A 2GMHA 4WCEQ 3FCVA 4ER8A 2CJXB 4IKAA 4BWMA 2MQLA 2XCAA 5KG6A 1NXIA 1VRUB 3MZIA 4P7VA 4FNHA 2FHJD 3ZZUA 4KGKA 1SJ1A 1OYDA 3QGGA 2MTLA 9ATCB 4P75A 1URNA 1HQ2A 4WF9Q 2VPYB 1ZAVA 3GV5B 2A0FB 1FXDA 4LF8F 4DCPB 1H3DA 1WEYA 1RHRB 2OPRA 5IM0A 1AUDA 1XQIA 4K4TA 3R9LA 2E1CA 3TI0A 1REVB 1S1WB 1R0AB 2R8GA 3CCTA 1QAXA 2CFXA 5CCMA 4USKA 4KPYA 1UVLA 3VWSA 4WU2A 3B78A 3GIMA 3Q83A 4ZDNA 4N5SA 4R0JA 2PIIA 1U24A 4UOHA 3P5BP 2AJ1A 1PJ5A 2CYYA 5KFQA 2XC9A 5I4MA 1NZAA 3HPOA 1FFGB 2R8HA 4LFCJ 4YUDA 2Q3PA 4PUOB 3A3OB 3TUIC 1VHFA 5D4PA 3NL0A 4OYMA 1RAIB 4DS4A 1U2RA 2EFOA 5L9XA 3G82A 5L1LA 1KFSA 5HP1B 3VAGA 4LR7A 5D8HB 1K1QA 1UFWA 4ZVGA 1O8BA 1YRTA 3GJSB 3DGPA 2SXLA 3H0PA 3LP1B 4P74A 3AQOA 4YN3B 5BJRA 1X9SA 1UW9A 2AW0A 2DYAA 1HBMB 4MIBA 4OLPA 3LGMA 4AE5A 3KLHA 4K4SA 3NS7B 3C14B 3EMTA 2KXNB 3CMQA 5DG9A 2Q66A 1XMQJ 1F5AA 2AGOA 3IS9A 1HNIB 2OPPA 2JDJA 3MR2A 3IC1A 1L5UA 2CNOB 5H9EK 5ADZA 5CHCB 3JYTB 8ATCB 1DLOB 3KK1A 1KOOA 1BQMA 4A8KA 2MQMA 3GR0A 2DY1A 3RAXA 4NLTA 4PXEA 5HATA 3RRHA 4Y2IA 1UTAA 4ALZA 1FDNA 1V5IB 4LSLB 2V2QA 3OUYA 3DYAB 4X4UA 3K8VA 2GX8A 3A12A 1J5EF 1SJ4P 1NKBA 4KE5A 1FF2A 4ZP7A 2J6UA 1VS3A 4CNYA 3MUMP 2IIHA 3IXQA 4N76A 2E9RX 5IZHA 5BYQA 4OYAA 2ZZNA 1NEEA 4PWUA 2VF3A 2RUGA 1IKYA 2VKRA 3BGOP 2HFNA 4USMA 2GGPA 2QL5B 4CLTA 5DZ6A 3WIUA 4ECXA 3NKYA 2I5JB 4PWWA 1GNKA 4QR1A 4TU7A 1NDPA 3KG4A 3NNHA 3C16B 4O4GB 2C3PA 3JQJA 1XJWB 5B0FA 3GCWP 2K3IA 4RNFA 3N28A 2ZDPA 3CJ3A 2DB1A 1G4CA 2HQ3A 5KT2A 2L41A 5E3QA 2RDDA 1QAYA 5G4DA 2BJEA 1J27A 2DGTA 1TMMA 2K3KA 2G1HA 1HFEL 2QLJB 3B54A 2M70A 2QIFA 4XAKA 2LCWA 5CZVA 5A6WA 2ZH7A 5DGBA 2X1BA 3NP5A 2V9KA 4P7TA 2ZH5A 1X7VA 1KS2A 4IFVA 5B0GA 5KG3A 5GAEU 3VHQA 4Q0BA 3K5MA 3NLCA 4KKOA 2CPJA 2LU2A 2PMZD 4B3TF 5J2MB 3CJTA 2J0XA 1FJCA 2WCXA 3TJAA 3QATA 4N8OA 4JI5F 2YKPA 1TU0B 4F67A 4DX7A 1WTFA 3QAEA 4J5OA 4U96A 5DZ7A 4ZK7M 1A7GE 4CYUB 3PY8A 2MPUA 4IRDA 5MLCV 4FVCA 3SXLA 4DR3J 3BGLA 3D0HE 3T19A 4AL7A 3O5TB 3TZZA 4CWBA 3GIJA 3PW4A 2OMLA 4Y0FA 4TLQA 4HKQA 4J9QA 4G1IA 3CTRA 4UQTA 4DV7J 2COLA 4TKTA 1IKYB 2XULA 4ED0A 3CD5A 1FX2A 3B6BA 4MIAA 4JUZA 3R1HA 3CMES 1FJGJ 4PWDB 2XY7A 4OYZA 2F3JA 4CIOA 2LXUA 3TR5A 2OP5A 2DR5A 1TKTA 4DX5A 1G2EA 3KHLA 2DRBA 5GAEI 3NS6A 5CD4A 1TV6B 2PD1A 2VPWB 4BDPA 2YH1A 2JEJA 3QO9B 3RBXA 4CH0S 3D66A 2IM3A 4CT8A 3UWTA 4PUOA 3IR7B 4ECVA 3ET6A 1IVZA 2PO4A 2QA1A 2ZNZA 5D6GA 1Q78A 1FKAF 1VQKS 4I4BA 1Q8BA 2WB1D 3IRXA 2BJDA 5GAGI 2PMWA 8AT1B 2XZWA 3OD2A 4ES2A 2WB4A 3A13A 4O23A 3EYZA 4B9VA 4JV1A 3HMJG 2IYIA 4USTA 2J6SA 1IKXB 3MM5A 3H2UB 3PO4A 3UD3P 1HBOB 5SZTA 4ZMMA 4JYAF 2RQKA 2LECA 3TW0A 1RAHB 2XMTA 4I1TA 4BLGA 5HP1A 4QOTA 2HFOA 4OX9F 4JI8J 2VPXB 1BQNA 3FBCA 1KFDA 3BSAA 5HO4A 4OHYA 1M1GA 2MKHA 2YQ1A 2C1EB 4DR4F 2M2BA 1C0TA 2GIFA 4JYAJ 3SFGA 3DNCA 2ZJRQ 1HPZB 2HGNA 4UUWA 2VDHA 3L3CA 2FZGB 3MM6A 4CO0A 5I3PA 2AYBA 3DMJA 1YJTA 1LXNA 2CQ2A 2UV8G 1KVIA 3L9ZA 3NEKA 2ZBQA 1U47A 2HFSA 1NUEA 2YWKA 1TL1B 3SCLE 4F50A 4NLRA 1RXOB 5L1IA 3R2DJ 3BPDA 2GQQA 2C3OA 2KVQE 1RT4B 2OD6A 1D8ZA 2EK6A 2PFDA 1ZM2A 2VG5A 2CIMA 3CJSA 4G1QA 4CH1A 2W01A 4Q8FA 3QO9A 1I94J 4Z7CA 5G0RA 2C2NA 2R9LA 5LJ3Y 2W24A 3FQLA 1VBZA 1UP1A 2RIJA 2NUHA 4GVBB 1YLXA 2MQ8A 4JI0F 5JMNA 3VALA 1BGXT 2D69A 3AB4B 5E3PA 3TA1A 5BYSA 1FVSA 4LQ9A 2W9BB 3I9ZA 4DSFA 4LQ3A 1C2PA 1WD6A 2CQIA 2GS8A 2YKNA 1N6QB 1EKRA 2FHMA 4NLVA 2HRYA 5IT4A 3HM9A 3UD4P 1JLBB 1WC5A 4DL5A 2UXBJ 1W26A 1GTEA 1T95A 3SIPB 5IQ6A 4DFKA 1X5PA 1YBTA 2ZHAA 4J9MA 4UY85 3DFEA 4GKJJ 2XMKA 4N8NA 4YR3A 3BR8A 1U49A 4HTIA 2WSEC 4DL0C 3LQVA 4K4XA 2Q6CA 1IBMF 1TVRA 1RT2B 4JI5J 3KUEA 5KFYA 1W2IA 1NO8A 2D9OA 2EKYA 1NKEA 3HFVA 4UQGA 4NZ0A 3RB3A 1RTDB 4K50A 4CNZA 5DO2A 2A6MA 4B3MJ 2BE2A 3OR1A 5IWAJ 3LWLA 3FMWA 1N0VC 1SH2A 2DNZA 3KNGA 4NCGB 1JLAA 3I87A 2XTJP 5D0RA 3WQPA 3CMAS 1HD1A 1RDRA 1YVFA 3FK4A 4ZOSA 5C24B 5J2PB 3LWMA 1C0TB 3OVBA 1SJRA 5KFSA 2DO0A 5A8KA 3VAHA 2VOOA 4F8RA 4IO1A 3H8YA 1FK9B 1V5VA 2DEJA 2B8PA 3UDVA 2HGLA 5BYRA 5EHHA 4IOAQ 2YKAA 2YPZA 3GFYA 4KFBA 4WP9A 5E5NA 4QIGA 1VRTB 5ETPA 4DJBA 4NX9A 2HK3A 4IG3A 5LXYA 4UW2A 2FVPA 3DRRA 3THPA 1WG1A 1WF2A 4C4WA 2DCLA 4YDDB 1RGVA 1OQ3A 1RTIA 1UVKA 4YB5A 2DIUA 1Q82T 2V2ZA 4I2PB 3NXZA 2I38A 4ZPCA 1ZTWA 4X4VA 2GIQA 3MEKA 4X66J 3TJ9A 2R7WA 4PG8A 1D8YA 4FXVA 1X8DA 3BYPA 5FDLB 4CP5A 5RUBA 4QPTA 5CYJA 3OJUA 5EX0A 2VIHA 3DLKA 4DV0F 1RWPB 2LA4A 3AY0A 3UO0A 3V5RA 2NXEA 3N5FA 1LFWA 4LVNP 1UWBA 2GCFA 4WIIA 2P9CA 5HQ8A 4NLPA 4PPDA 4E0DA 1YJVA 2CUYA 4DR7J 2O01C 1Y11A 3ITHB 1KONA 2AZ1A 2MZTA 2LQJA 4IYQA 3BQ0A 1SIWB 2VHGA 3VQTA 2BVZA 3SI8A 5LL6d 2Y8WA 2HHSA 1NBEB 5CYQB 3G4SS 1S9FA 2B5JA 2CZ9A 3CCWA 1LWXA 1R27B 1RT5B 1X4GA 2KXHA 3ZNJ1 5J1EA 2OEJA 4FYYB 4NWBA 4I6YA 1J5OA 2HVZA 2Y3YA 4OV6A 5LMUF 2JZ5A 4MAKA 4X4QA 1ZZFA 3G71S 2DNYA 3LP1A 1IKVA 2ZZTA 4J9OA 1RHKB 4AUKA 4EBEA 2I0XA 2HSEB 2PN6A 3NGTA 4P10A 4N7TA 3GTYX 3TVYA 4DUZJ 5DG7A 1VIOA 5C25B 2IFXA 2OPPB 1WHYA 2EW9A 2GVZA 1U0SA 1XIQA 2I9SA 2WVFA 3PYDA 1RT4A 1HR0F 1D9AA 2YX1A 1Y9OA 3HKWA 2C22A 2G4BA 4KSEB 5E33A 3M30A 2IJNA 3EVOA 1YGYA 4G1QB 4K8RA 3Q22A 1RWWB 2M8HA 4RKUC 1R6YA 2X3DA 4ZJLA 3H40A 3BQ2A 2HVHA 2N7YA 3FSYA 2LQ5A 3J7ZT 4CLSA 3HSDA 4ZHRA 2XMMA 4DX6A 1VIXA 2F63A 4C48A 3NGRA 1T3NA 3NOGA 5DLFA 3W66A 2F1FA 2CQBA 1LK5A 1PYTA 1S7IA 3QFWA 3LF0A 1GXUA 2DHAA 4FYDA 1DTTB 2JX2A 1TK8A 2ASLA 2DRAA 2BBEA 3HJVA 2CJAA 3M2VB 5CH7B 1AA1B 3I4PA 4IH5A 5E3CA 2YKQA 2H51B 3MWBA 3PJ9A 4N47A 4BWJA 1N0UA 2VBYA 1ELOA 2DRDA 4Z7YA 1BLUA 4KHMA 3Q24A 1YJWS 4X64J 1SC3B 3AB2B 1S5ZA 3MEDB 1XNRF 1K0VA 2ZC4A 2NXUA 1SC1B 3BREA 4IH7A 2NUUG 2FTRA 2OMOA 3MMAB 4ZVFA 5M2RA 1VBKA 3G8SA 4DSJA 2E5IA 4QWDA 1QUVA 3AH6A 5F41A 1BE4A 4TLRA 2EK1A 1WOOA 1JLBA 2Z0GA 1SUQA 3O2IA 2B4OA 4RPFA 5HLFA 2UUBJ 1AFIA 1MROB 5F8LA 2RS2A 4WP3A 5IWAF 1RAEB 1R8CA 1K73T 4WE1B 4JI4F 2Z8QA 2C28A 3GYGA 4CLFA 3TZWA 2OFHX 3W62A 5KT5A 2ZH4A 1VLYA 1SQFA 1O6XA 3R6GB 1FWLA 3RBDA 3LAMA 1HD0A 1VK3A 4LBIA 2XMAA 3I82A 2HHHF 1GH8A 2IC3B 3CT9A 3IGVA 2LYVA 2DK2A 3KJFB 4C3LA 5KFWA 2WOMA 3SSSA 5AXNA 2UUBF 3P3DA 5K14A 3HHDA 3MECA 1T9YA 4H4OA 1X5SA 3L4BC 1DLOA 2F9JA 4PWDA 1UVIA 4BS2A 2YNIB 5GVQA 1S6PA 5KFVA 4IR9A 4NCBA 1B99A 1NPPA 2IHR1 3W3SA 4NLSA 4A8QA 2AYMA 4V19X 3PKYA 4JI0J 4OZ3A 4OHXA 3PR4A 3WBZA 5THWA 3PVXA 1HBNA 2CNNB 4QWBA 1S12A 2XGQA 1QTMA 2C2KB 2AGQA 4RNNA 3CCZA 1WI6A 2HW3A 3UDCA 3KK2B 5CQGA 2QC3A 5JUMA 1NJZA 2I2YA 3ZZ0A 4X4NA 5EDWA 3CDEA 1RLCL 2IRUA 5LSRA 4DFJA 2ZH3A 4UF4A 4GVLA 2DH8A 4ILRA 3G6ES 2E1MC 4WTOB 1X9WA 2R7TA 2BRKA 4F0KA 4DV4F 4C2MA 3KG1A 3DM2B 2N7CA 3GMGA 1RWOB 3RW7A 2YNFA 1S9EB 3HFZB 4LRAA 2ZH1A 1SH3A 1PYOB 4ZVRB 2W7OA 2XMWA 3KJQB 2FLPA 3SBMA 2V8PA 2VKZG 3TNVA 1NJWA 2HK2A 3FRZA 2DNKA 2VFRA 5GAHU 1NHUA 1O51A 3IBFB 1TFWA 4LSNA 2DGOA 4RW8B 2J76E 3DRXA 3NBPB 2Y9HA 3W8GA 2A2CA 4RW9B 4ETXA 3KMQA 1FNXH 1UJ4A 2IDLA 4Y2KA 5AE1A 1B7YB 4TQRA 2IAJA 2W9CB 1YI2S 1F9EB 5IV3A 2R7SA 2LXIA 2RRBA 3MCNA 5B0AA 3FBEA 3KLVA 4TY8A 2ATLA 3ILIA 4NL5A 4H4OB 2AWZA 4ELTA 1VFJA 3CGIA 4F4KA 1RT7A 2EFQA 4JV2A 3C6UB 2YH0A 1RHJB 2QLBB 3QSYB 4M5NA 3ENWA 1U26A 1WOSA 1WSVA 2AJ4A 2GHVC 2QZ8A 3Q23A 4OX8A 2K7JA 2WOMB 3GP9A 4UZCA 1M1KT 2KB2A 3BH6B 4U8VA 1BY9A 4RJVA 4B3RF 4TYBA 3N4WA 3BDEA 4NLUA 3DRPB 4E2FB 1CEZA 5F9LA 1OY8A 4HI2A 5G0RB 2U2FA 5KFPA 1O5JA 2E29A 4NLQA 3ULHA 3AXMA 2V0NA 2POKA 3ILOA 2OAUA 4OZJA 3H5SA 2R3VA 4RUCA 3QIPA 2KRBA 3HT0A 2E1RA 2HS0A 2VG6B 2HNZB 3KOAA 1WJ9A 2XSJB 2VICA 3D6MB 1AZSB 4RNOA 1RWUA 1Y0HA 1DTTA 3IMQJ 4B9SA 6FD1A 4PEOA 2N4DA 1UWAA 4LFCF 1UEKA 2M7SA 4Q43A 3G6XA 4K59A 3EGZA 2EC2A 1NPKA 1JNZB 4MKVA 3UW1A 2WVCA 3QRPA 3DGPB 2AYEA 4ECSA 3OTOJ 2QG9B 2UZAA 2LQ8A 3MI7X 5EWEA 3FSIA 2KXFA 2FDNA 1SCJB 3L95X 1S1TA 1IR2A 3DN9A 1K9MT 2NPIA 1FKPB 4DR5F 3R2CJ 5CABA 3P96A 4CRJA 4ZLNA 2KFZA 2HVDA 4F0MA 3PXGa 4DFMA 4JI1F 2W4CA 2VL1A 2GJIA 1JXLA 1TFYA 2OHDA 1IKVB 2H4WB 1VYAA 1NPRA 3JTNA 5D0HA 5A8KB 4NCAA 1AFJA 1Q5VA 3NRBA 1V6HA 2DBBA 4X4SA 1XMBA 1PC4A 1XEZA 3HFKA 3NGSA 1NB7A 2BXJA 1TL7A 4KFBB 2BE2B 1TR0A 2YTCA 3OR1B 1X4BA 4EEYA 4W90B 1BWVA 3RTVA 4P2FA 1ROFA 3CEDA 2RT3A 3BGRA 2UXCF 1R6VA 1DQ9A 3UN2A 3N6LA 2NR0A 3MECB 3UDLA 4ED4A 3DU5A 4DZ6A 1Q8KA 4FP9A 3PKMA 2GGPB 3W64A 3OUYB 1Y5LB 4F2RA 3EZOA 1JJ2R 3PDNA 5F8MA 2VV5A 4E98A 2CPXA 2WHOA 2GC8A 4B9TA 4KO0B 3BPSP 3QPIA 4M8LA 4TY9A 4OI3A 4MK7A 3MR5A 1H74A 1F60B 3MPDA 3A1YG 3VAJA 4KH0B 2W2MP 1EQMA 2UUWA 2B43A 3DCAA 2AMCB 3VAFA 4XDDA 1FVQA 4P2SA 3M9OB 2DGVA 3S6EA 3KLFB 4AT1B 3LGHA 3DRSA 2AZ3A 5FDLA 3Q8YA 2F8EX 1LV5A 3T5KA 3M6VA 2W4DA 4F4WA 1U45A 2RS8A 4JI2J 3CCMS 3HHEA 4U7CA 2YQ3A 3K0JA 3EUNA 4RW8A 4JI6F 1U02A 2VPZB 4B08A 2E7VA 3D2WA 1BWEA 3D0IE 5DRKA 2Q6BA 3G82B 4U7UK 2DGSA 2NSCA 3DGVA 3T5HA 3PW7A 1YITS 4NZ7A 3PCOB 3BB5A 3VGUA 3M9MB 4Q0BB 3NY0A 3W2WA 1KWMA 2I1RA 2ZE2B 3JTOA 3N01A 3PR5B 1GT8A 2C2OB 4TU8A 3NWRA 1RHMB 4U6PA 2K2PA 3RG6A 5A8WA 2BANA 4KB7A 1NZ8A 3M30B 2XBPA 3CCSS 1NLKL 3R6LB 2V50A 4NCGA 4AYBD 5B0DA 1RT1B 5K8NA 2EFGA 1Z2LA 4O44B 1WC1A 3LP2B 2UUTA 4F3MA 2FVCA 1N5QA 3JTPA 3E01B 4LFAJ 4ZHRB 2WTFA 1CULA 3DDNA 1JX4A 1HNXF 4DQIA 4HDHA 1B64A 3R5DA 2BDPA 3R8YA 4QBUA 1F5CA 1OIAA 3QYYA 3J81Y 4FF1A 2F7VA 4DV2F 2IJRA 1S99A 3RR8A 2NYIA 2W2OP 1WHVA 4ZVQB 1XMOF 4ENOA 4C8LA 2MXYA 3C3LA 3QMQA 1VQ4S 4DQPA 2GIRA 1WKKA 2FVQA 4M94A 2PFFB 5E7OB 1SH0A 2H65B 3RW6A 1AZSA 1NK9A 1VCTA 2DY9A 1BUXA 3QZ7A 3HF5A 3TWZA 3QGIA 3CULA 1X0PA 1YHQS 3HHLD 3TAQA 4LF7F 2ZHBA 2FLNA 3MPUB 5ETQA 1RADB 2FY8A 3VZIA 1Q0NA 1H72C 2E44A 2UP1A 3GYXB 1PBUA 3CVKA 1CG2A 4MJKA 4C11B 2HS3A 4DU7A 4A8WA 3DRSB 1TUWA 1RT6B 2E5LJ 3ET6B 4NXNJ 1UWBB 4CH7A 3IWNC 4C9DA 1UZHA 2IRXA 1P8GA 4KY3A 3KJNB 3V6JA 5HN0A 1YG0A 2O67A 2ZUAA 1H7XA 3GSDA 3CB4A 2YNGB 4DZDA 1FRIA 1JXVA 4NXMJ 1FO1A 1S1XA 2U1AA 3ELHA 3OXGA 4ZP8A 1QD1A 4MFBA 4RW4B 2IC3A 1MROA 2JFKA 3GG0A 5IXUA 3Q8PB 2CJBA 4UT4A 1DY3A 2C2MB 5J1EB 4DR4J 2RHQB 4Q7AA 1T9VA 1RT3A 1X4HA 2GAGC 3A8KA 3EJMA 5HVGA 2BX6A 3CCJS 1S10A 5B7WA 3AOCA 3K5OA 2DNRA 3EPGA 4DV2J 3K59A 1HW9A 1WF0A 3Q2TC 4OL8A 2DGQA 1F2GA 2R42A
chains in the Genus database with same CATH topology
2WSCC 2ZBCA 2WONB 4QQBA 2ZM6F 3BO4A 3LP0B 1LW2B 3DDKA 3R1LA 3TARA 1OSCA 3M05A 2R4FA 2GQCA 4ED5A 2R7QA 4Q44A 1JLCA 1YQHA 2E7XA 1H38A 2DNMA 4DLGA 3KK2A 3MFHA 1Q1KA 1T03A 1C1CB 4ED8A 1R7IA 2ZFHA 5J2NA 1RKJA 4PXBA 1URRA 1DRZA 3O8WA 4NYZA 2W9AA 2FJVA 2CZ4A 2YX7A 3M6WA 3N6NA 4HT5A 1VQOS 2XMVA 3R27A 2DGWA 1VQMS 1TV6A 4GO7X 1R8HA 4J9PA 2ZH6A 1U1QA 1U1PA 1DJ0A 2DR7A 4DR1F 4RX6A 3MR3A 1L3SA 4GC7A 2V9WA 2PGCA 4QU7A 1MW7A 2MQOA 2X1FA 3EPIA 4OZLA 2QMXA 4RBTA 3HZGA 4ECRA 2ZDOA 1FA0A 1R8PA 1S0VA 3AJ2A 3SCJE 4C0HA 5L38A 2KM8B 2MY8A 3B8HA 2ERRA 1GQEA 4JV5F 2KM8C 2D1CA 1S9GA 4IG0B 3SV3A 4OJGA 4CO5A 3KK1B 2VUGA 2XCPA 3HHNB 1HQEA 1JLFA 3MFIA 3QLHA 2W9CA 1QAJA 4J9NA 3E8OA 4MIWA 2EVZA 1R43A 3N79A 1ZM9A 3U02A 3MM7B 5B0BA 2YKMA 3V2UC 1SJ3P 2KO1A 2C3MA 4Y65A 2RU9A 3NGDA 1KSPA 4AQYF 1TL1A 2YY3A 4TU9A 1T03B 4YOEA 1VI7A 1X4AA 2H9ZA 5T7LA 2RDJA 3F41A 4OZ1A 4EO8A 2QA4S 3SYZA 3HJFA 3LH2S 5F9NA 2KKHA 1R8BA 1F0XA 1S0OA 3PRBA 2HLUA 4Y34A 5J2NB 3KHRA 2I5JA 5KG1A 4P6QA 4DS5A 2IVMA 3V4MA 3MURP 3J80Y 3CXCR 3T5LA 2CPIA 2MQQA 2XS7A 4DQQA 3T5JA 3ZZTA 5CCLA 1Y5IB 1B0TA 3DHWC 5A0YA 4XIUA 1KHVA 1ZPWX 2DNNA 2J7WA 2J5AA 4QIVA 4PXCA 1B7FA 3ISNC 5T14A 3GIKA 3TANA 4NMLA 3NG8A 4CQ1A 3M8RA 3HVAA 3F73A 5A8RB 1N5VA 3TQ1A 4F4XA 2UUCF 4NA2A 4TXSA 3CIZA 3PJWA 2AF6A 4OI6A 5HMYA 1FE4A 3PJXA 1LWFA 4IFYA 2LXFA 1KRPA 4TY8B 4OZNA 1RYSA 1GX5A 3KNAA 4X4RA 5AJ3F 4C8YA 2QMWA 5D4NA 3F44A 2DHSA 1VQNS 1DHMA 3GYNA 2MQNA 2ZJQQ 4NA3A 3RB4A 4Y3CA 3H2LA 4K4YA 1Y7PA 3MD3A 3WC0A 3BDPA 1OS5A 3DXSX 2DH7A 3PX0A 4X4PA 2V8HA 4DL4A 2E9TA 3BZQA 1KVJA 3FZBA 1NK4A 5KTQA 2E5HA 1SKSA 2F40A 4NXNF 5MAOA 3CSKA 1LOUA 1N36F 2PA3A 1IUJA 2Q79A 2W4PA 5KFCA 2ACYA 4ED2A 2E9ZA 4MK9A 4RU9A 2LLZA 1S4FA 2DCUB 1Q79A 3HHLC 2ZUGA 2O1PA 1BQNB 3IRXB 2R7VA 4UY8T 5LSLA 4URQU 4HTJA 1OO0B 1Q81T 1G1XA 2YWEA 4PG5A 3MM5B 4C98A 5DETA 3LAKA 3KMSA 2XY6A 1NKCA 1NJXA 3UR3C 4ZPTR 1RP5A 5FLXY 2YKMB 3BF4A 2KYZA 2BYCA 3H20A 5BR8F 3G6YA 2ZJRQ 5A6PA 4I56A 3Q0AA 2E5GA 4J9LA 3PW0A 3MAHA 1FJ7A 2DJWA 2GHWA 3CJ2A 1IJFB 4ECTA 4O3QA 1FDDA 3JAMY 3OTOF 3QLHB 3CCLS 3MTKA 2IA0A 4BC7A 4F3QA 3KKFA 4HI1A 3JSMB 3PRDA 2RJZA 1OSDA 4GO5X 1SKWA 2OD4A 3CIMA 4YB7A 1S6QA 4ZVEA 4FF3A 4EYIB 3BN4A 4Y2MA 1HHSA 4ILMA 3CJKA 3TO8A 1J2VA 2VG5B 2V8DA 3B82A 3I32A 2CQGA 2ZVSA 4LMZA 1HW8A 2OFGX 1JLGB 1TL3B 5DDQC 1QVFR 1VBYA 5GAGU 1RK8A 1RT6A 4X2BA 3FGVA 1H0HB 1MWZA 5K9FA 5LXRA 3G9CA 4DMZA 3K2YA 2P6TA 1KLNA 4DSIA 3R5BA 1NH7A 4KC5A 5DM7Q 3MEDA 2VOPA 4HH1A 4YEAA 2GV1A 2FIUA 1X4DA 2NQPA 3QJLA 4X62F 3HDSA 3S1TA 3T1AA 1KLMB 2ROGA 1S9EA 3KHHA 4ECQA 3VZHA 1S0NA 1L3VA 2MSTA 2A1BA 3WDOA 1WWHA 2ASDA 2XMUA 4NLYA 2G9OA 4EU0A 2JJ4D 4M63A 3CCQS 3X3UA 1R3NA 1TKZB 2CZVC 2GFFA 2PE8A 1W25A 2NLWA 3RAMA 5CA5A 1G7CB 2WK4A 1NHVA 1R89A 2WONA 3EZ5A 2K8GA 3MPVA 1LW2A 4WKRA 3E51A 5HBMB 4YHHF 2KDOA 2E66A 2EI5A 4IG3B 1JLAB 4M5DA 1AXQA 3QIDA 4DHVA 4RBUA 4ELVA 5A8WB 3KG0A 1VC5A 3PW2A 4QYRA 3CCVS 3I0SA 4DR7F 3LP0A 3QWUA 2ZOMA 4A47A 3OXFA 5KT4A 2UVRA 1ZOTA 4O4GA 1YSJA 3H5YA 1LW0A 1MNEA 3S7RA 3SV4A 2CQ3A 3K5LA 2FD2A 3RR7A 2B0GA 3UNGC 3HHLA 3D5MA 4ID8A 2R7OA 1TL5A 4ZKAA 2KZZA 2HNZA 3DXBA 5J1PA 3PFEA 5U47A 2V4JA 1C0UB 1JKHB 1L3UA 1JJ4A 2XG8A 1RT5A 5ITHA 3VR1A 3QJPA 3W7BA 1KTVA 1UJ5A 5DDPC 4EGLA 2M9KA 2NREA 2ZJPQ 4HLBA 5HMZA 3OSNA 1VQ6S 1Q53A 2GO8A 5EWFA 4WFBQ 2FJDB 1TK5A 2A10A 4DBQA 4B02A 1N54B 1PILA 2KH9A 1NJYA 1NAQA 2IYGA 3GB0A 3FCHA 4LSNB 2IVYA 3Q8SB 3LANA 5F8GA 2IM0A 2RDIA 1Z4UA 4IOBA 4PG7A 3BGRB 4PRFA 3IR6B 1RKIA 2BR0A 3M6XA 4C7QA 2V8GA 3KLGA 1T94A 2BM1A 3VAKA 4ECVA 5L1KA 1X4FA 4ERDA 2RILA 2OPQB 4EBCA 4PXDA 2HS4A 1MWYA 3CWJA 1HBUA 3D54A 5F0UA 4CI0B 2CKWA 5B0EA 3Q8RB 4DF8A 4ES1A 2Y1JA 1WEZA 4G6VB 1HI8A 2KFNA 3QGHA 4J37A 4ID5B 4Y6IA 3M9NB 3CF5Q 2J9CA 3EXCX 3FJ2A 1JLCB 1YRUA 1S1VA 4F02A 2AP6A 1UFLA 2CPYA 5T7LB 1K1SA 4E8UA 4CO1A 3CJ5A 2IM1A 3N6MA 1Y5NB 2VB6A 2ROPA 3R5AA 1WG4A 4KRWA 1L3KA 2QLXA 3ETOA 3OHBA 4DV1F 1KNZA 3I55S 2XSJA 4OZ0A 2YWFA 4A8YA 4F3OA 3DOLB 1RI7A 3P49B 4WFAQ 2Y1RI 4XPEA 3WZ0A 1IM4A 3U7JA 1TZ0A 3R3TA 3IBWA 2XWYA 2Z2MA 1RISA 2B4VA 3TA0A 3TUZC 2XY5A 2N3OA 4WXWA 1UKUA 3V6DB 3HKZD 4B9LA 5HMWA 4FBTA 4D3HA 1H2TZ 1P1LA 1J5OB 2RH3A 1SXLA 1EETB 3OVSA 2ZKTA 2ZD1A 3AA9A 5CYMB 1T8EA 3CCES 5F8JA 4DG1A 3OR2B 3PIPQ 2ADCA 2VBXA 3EZUA 3MMBA 4FPRA 2ZOGA 1KD1T 4B9TA 4ICLB 3GFZA 4LFAF 4C8NA 3J7YI 3FDSA 1HL6A 2HHTA 4OI1A 4IUFA 2VODA 2CPFA 3NNAA 2ALZA 2C2RA 1SBRA 1RT1A 4M5DB 4ZPBA 3TRGA 3E01A 2Z2LA 4ZPWR 3M32A 4DSLA 3I6PA 3T1HF 4DR6F 2HW3A 3K8WA 1XNQF 1QVGR 1E6YA 2MKJA 2RRAA 2EWHA 4K4WA 3K58A 4WU3A 7FDRA 4IOCQ 3ZFVA 4CO3A 2OPRB 3RB0A 3TVZA 3CD0A 4L3NA 4ELTA 2PEHA 1FNMA 4RW7A 3TAPA 2LEPA 3G96A 1R8AA 4OX7A 1R0AA 4WZQA 1QUPA 5D3GA 1QM9A 3ICLA 1U2FA 4MKAA 3HP6A 5IFMA 3DLJA 5JJBA 1YJRA 3EGZA 2JL9A 1T3OA 1RA6A 4MTPA 2P5VA 2RVJA 3NGKA 3OFFA 5J2QA 2H5EA 3BSCA 1RT2A 2VBZA 1WEXA 2J8AA 1N5YA 3NMRA 2YNGA 4FS1A 3SCIE 3HVTB 4NOHA 3GWCA 1TL4A 4RW4A 3OV7A 2KN4A 3ZZOA 3RB6A 1CQNA 2MKIA 4B9NA 1X4EA 2CPEA 4PG4A 3BEGB 5L9NA 3LPYA 3FEZA 2V94A 4WE1A 5HMXA 2XMJA 4ZA1A 2LQ9A 4MFBB 1S79A 3SFUA 2B9XA 2XGPA 3KLHB 2JFDA 2J9DE 3BGFA 4IQMA 1N5SA 4ITSA 1V9OA 3EXYA 5CYMA 1VQ9S 5C42B 4AL5A 3JYTA 1NK8A 7FD1A 4URSA 3MPWA 3S01A 1TKXA 2UU9F 4FZVA 4KQZA 1IJEB 1Q7LB 4A8OA 2D3ZA 2AX0A 4O3PA 4FN5A 1TP7A 5DM6Q 1MU2A 1DQAA 1XWLA 4XDCA 4B3SF 4K4VA 1HWJA 3M6UA 2IMWP 3PACA 1P9QC 4LVOP 2MZ1A 1UEVA 3GE9A 3LGNA 2K7KA 4ECWA 2OTJS 3D1QA 3OQ2A 2RQ4A 4PQUB 5KG7A 4I67A 2XEXA 3HVTA 3IFEA 3G8QA 3N9UC 4MK8A 3BN7A 1C4CA 5KFRA 3RYLA 4IO9Q 2XNRA 1GX6A 4KKOB 5K5MA 1XN9A 4I2QB 2BW2A 3H5UA 4DV6F 3KJVB 2AGPA 1ZM4A 3BO3A 2KT2A 3I5AA 5I3UA 1KLMA 3A8EA 4C8OA 1UVJA 5IS2A 4PR6A 3OW2R 3HI9A 1RA7A 3EGWB 3D28A 1U7LA 3MM9B 3QAUA 1W2BR 1UA1A 3CDBA 4JI7F 1OWXA 2HHQA 4U67Q 2MZJA 1RT3B 4QJVA 1FXRA 1HQEB 2O66A 1GTHA 1UW4A 2JC1A 2OSRA 2ZC3A 2DHXA 5C25A 1D9DA 2HHWA 1MU2B 4DFPA 2VH7A 3I31A 2VFVA 1HI1A 1N34F 1XR5A 3FQKA 3LUYA 4ZP9A 4KHPF 1U09A 4CZCA 2R8IA 2AU0A 4AFFA 5B09A 1SKRA 2BACA 2Z4PA 4USJC 3CUNA 2JEGA 2DR8A 2CVEA 2R2SA 5IT9Y 3I9V9 2CG4A 4PQAA 2QV6A 4Q5VA 1ZETA 1H7WA 1N5YB 4WFYA 1HQUA 1JLQA 2D74B 2Y0SD 2BV3A 1RTHA 1P27B 4USHA 3POTB 2CQHA 2JLGA 5KFJA 2V2KA 2V5HG 2MKCA 3QWPA 2JLEA 5L8RC 4DOZA 2JOQA 4HEA9 2BA9A 5F0WA 2ZE2A 5DJBA 4Y2CA 1ZPVA 2MQPA 4I2QA 2HHVA 4XK8C 2QLWA 4TN2A 4ZLPA 1FKPA 2L9NA 2W7AA 4OI2A 4PCQA 2RMLA 2FHJA 2MGZB 1HMVA 2ZH9A 1TKZA 3BM7A 1HYSA 2CJKA 3OLAA 2F4VF 1S49A 4KHRA 2KVIA 1CPZA 3WX4A 3AA8A 2P9GA 2RNEA 4MYUA 4G1PA 3MDFA 2E5LF 2R7XA 5FD1A 4HHJA 4URGA 1S7HA 3MCSA 2AD9A 1FD8A 3NCRA 3ZZZA 4ED1A 2FLLA 3RRKA 4MYTA 4DUYF 4ZP6A 5DLGA 1SL1A 2D7SA 2GO9A 4LT6A 1S6PB 3FZ2A 5KFNA 2DD8S 4C8MA 4WK1A 3GIIA 2FJXA 1RTJB 3MMCA 1DARA 2ILYA 1E6VB 4QWEA 4KJIA 1HWKA 3MUTP 4DL2A 2GJ2A 3OLBA 3H59A 1FESA 4KBIA 3UFCX 1QLNA 4QU6A 5CZXA 3PX6A 1S77D 2DT9A 2AJQA 5E0OA 1NB7A 2LQBA 1UMJA 4KV8B 1YJ9S 4FF4A 2HNDA 5KFIA 4NPOA 4V19J 2DNPA 1XTZA 3W2VA 3DOLA 3IR5B 4ZS6A 1ULRA 4ECYA 2MSSA 3NWGA 3H4BA 3DLEA 1JXEA 2YWHA 1D1UA 2EBEA 1S6OA 3KJVA 3PIOQ 1FTRA 3HK2A 1U48A 3BO2A 4F25A 4DV7F 3LO3A 1V3ZA 1FKOA 4N56A 2XLIA 4RW9A 2XB2D 1U1OA 1U1KA 1M90T 1WHXA<