3GZ7A

Crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
FQGMIQEIASILVQPGREADFEAGVAQARPLFMRARGCHGVALHRSIEAPQRYTLVVDWETVDNHMVDFRQSADFQEWRKLVGECFAEPPQVHHEQKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Putative antibiotic biosynthesis monooxygenase
publication title Crystal structure of Putative antibiotic biosynthesis monooxygenase (NP_888398.1) from BORDETELLA BRONCHISEPTICA at 2.15 A resolution
rcsb
source organism Bordetella bronchiseptica
total genus 27
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3gz7A00
3IWLA 1FEEA 1ULRA 4QOTA 2XMWA 2N4DA 1FE4A 2XMMA 1X7VA 4NL5A 2IYIA 4HH1A 1WD6A 1VQYA 1MWYA 1SB6A 3BF4A 2OKQA 4OJ1A 1Y3KA 3DXSX 4HI1A 4OJGA 4YEAA 1JWWA 2L3MA 1W2IA 1Y3JA 3BN7A 4HL9A 4YDXA 2CRLA 3BDEA 1FVQA 1OQ3A 2GGPB 4A47A 2GCFA 4Y2MA 5B0DA 1APSA 1KQKA 2VH7A 1URRA 2N4CA 1OSDA 2W4PA 2K2PA 2AJ0A 2G9OA 3BGUA 1Q4RA 2W4DA 2XMKA 3BR8A 3DCAA 2AP6A 3KNGA 3HFKA 2XMVA 3WDOA 3TRGA 3FMBA 2OD6A 2PD1A 2BBEA 1N5QA 4OJ3A 4Y2IA 2RILA 2GGPA 5B0AA 3MZIA 2HQIA 1U7LA 2ROEA 5T7LB 4A46A 3LO3A 4A48A 5B0FA 4DPOA 2HLUA 2XMTA 3HHLC 4Q2MA 1AW0A 4HH0A 1TL4A 1N5SA 2LQBA 3I9ZA 1TL5A 2XMJA 3T9NA 3QMQA 2FIUA 5F0UA 1N5VA 2IYGA 4DN9A 1SI9A 1FESA 1RJJA 5B0GA 2OFGX 2PGCA 3FGVA 4U9RA 1MWZA 4OIXA 1P8GA 3FRYA 2GV1A 5T7LA 3KG0A 1FD8A 2W4CA 2KKHA 2LXFA 2KT3A 4F67A 3TNVA 1GXUA 2K7KA 5A6WA 2HIQA 2KT2A 1R6YA 1OPZA 2FB0A 1YJUA 1OQ6A 5B09A 2OAUA 3CJKB 2GO8A 1Y9OA 4HI2A 1IUJA 1X0PA 1V3ZA 1Y0HA 1Q8BA 2BJEA 2GFFA 2RMLA 3GZ7A 2K7JA 2EW9A 1N5TA 1Q53A 2GA7A 3KKFA 1LQ9A 4ZOSA 2ACYA 3CJKA 2FTRA 1CC7A 1TZ0A 2OD4A 1AFJA 2ASYA 3LGNA 4Y2KA 3TOQA 1JK9B 1CC8A 2QYCA 1P6TA 2LDIA 2RSQA 2ZDOA 2LQ9A 4ZA1A 2KYZA 3HHLB 2OP5A 1KVJA 2AJ1A 3HX9A 1K0VA 5B0EA 1GXTA 2FHMA 2OMOA 2K1RB 5K9FA 4DL0C 4EFAC 1S6OA 1FVSA 2HFNA 2QIFA 4FNIA 2RU9A 1TR0A 2Q3PA 4Q2LA 2HLTA 3HDSA 1QUPA 1YRXA 1X8DA 1YJTA 3HHLA 5B08A 2OFHX 3F44A 3QGPA 3E8OA 2AW0A 1AFIA 1S6UA 2K1RA 3BB5A 3HF5A 5A6PA 1KVIA 1XBWA 2HFOA 4NPOA 2ZDPA 3HHLD 5B0BA 2BUNA 1YJRA 2QLXA 2IFXA 1SQEA 3BM7A 1FE0A 5B0CA 2N7YA 2QLWA 4FNHA 4A4JA 3LGMA 1VQSA 3IWXA 1YG0A 5IXUA 1CPZA 2VV5A 2ROPA 2XMUA 1TUVA 1YJVA 2ROGA 2BYCA 3K7RA 3VTIA 4OJHA 1Q8LA 3MCSA 2BJDA 3UDCA 5KAKA 2JDJA 3KG1A 5F0WA
chains in the Genus database with same CATH superfamily
2UUWA 1VBZA 1VRTA 1FDDA 1OJ4A 2QC3A 1NCLA 4LRDA 4YDXA 1TKTB 3DI6B 5RUBA 2YWKA 3P4UB 1KNZA 1P1LA 1VQMS 5A0YA 3KMQA 4WYLA 1RTIB 2VBYA 3BGRB 3VAMA 3DLEB 5JXSA 3KJVB 1BQNB 2HFSA 3RB0A 3QMQA 3SIPB 2YNFA 3BKFA 4QIEA 4OX9J 4F3MA 4Q0BA 3VAKA 2FLOA 4DR3F 4I4BA 1RAIB 2PI5A 1TKXB 4O3SA 2KXHA 4JI1J 5G0RB 1RTHA 1P1TA 1WELA 4KO0A 2QYCA 3CD5A 2JEIA 4B3OB 5ETOA 4X2BA 5C42B 2O3DA 1FX4A 4RBTA 3I31A 1PBUA 5F8MA 3M8PB 5DRKA 5CZVA 2QTWA 1F5AA 1N6QA 4FNHA 5A8RA 4NLGA 1REVB 4C2MA 3QIDA 2NXUA 1RAEB 1EP4B 3G6VA 4G1QB 2CJKA 1TAUA 1ELOA 2AHOB 1T95A 3OPKA 3VAHA 3V81B 1Q0NA 1VIXA 3GG1A 3E01A 1MU2B 5KFVA 1CEZA 2K2PA 4O44A 1CJTA 3CNQP 3RJMB 4O4GA 2V34A 3N79A 2D3UA 4DWIA 2ZE2A 4BLGA 4ES3A 3CCLS 3M1VB 4PQUA 2HBZB 3CUNA 5KG0A 2C3UA 5KT5A 2RF2A 1RE1B 1RQ0A 1S1UB 2PIIA 2AYBA 3DGVA 1GXUA 3LF0A 3UCGA 1VQ7S 1FJCA 1FDBA 3G71S 4UZCA 4W98A 2ZBIA 3BBFA 4AYBD 1KLMB 3EVOA 1H38A 1Q5VA 4CLLA 1EJ7L 1T02A 2RKIB 3O44A 4DFPA 5CHCB 1RHRB 4C11B 3NWRA 3W2WB 2CPHA 2GVDB 1RA7A 1JLQB 4RW4B 3GQCA 4CLPA 4OJGA 2QT7A 4C8ZA 1ZPWX 4P2XA 5D0EA 3V6KA 2MQOA 1TKZB 3BR8A 5FD1A 2QA1A 2V69A 5B7WA 2WVEA 5CD4A 3KHGA 5K5MA 5HROA 2HFVA 4RUBA 1RAGB 2IA6A 1P8GA 1HQEA 2PA3A 3MECA 4PAAA 3FEZA 4M95A 4NLPA 1ZTWA 2DGWA 4U7UK 1OSCA 4JI5F 1LWEB 5JVHQ 5T41A 3ADAC 3MMCA 2Y1IA 4K4UA 3CSKA 4OYWA 1NSAA 3M9OB 2Q3PA 3T5JA 3NBPB 3OTCA 3CCSS 4S0MA 3WIVA 2QLWA 4KHPJ 2LU2A 1TK5A 3KDNA 2R7VA 5I42A 1UA1A 2JDJA 3CDUA 2R8GA 4KH1B 2H5JB 2BJ1A 2PC6A 2MGZB 3EZUA 4PPZA 4IG3B 2RUGA 3BKUA 3MAAA 4YP3A 4D3HA 4P71A 4C0BA 1FRXA 2P9CA 2XG8A 1BGXT 1HD0A 5EWFA 3IBFB 3BDPA 5IFMA 1HBUA 3CB4A 2J5AA 3N28A 2MZ1A 1T05B 3LPEA 3PRDA 2BX6A 2J9EA 2PSZA 3A3OB 5C25B 4RPFA 4QIGA 2VDHA 4ILLA 3SXLA 4KC5A 1KKHA 1N36F 2CPJA 4DR4F 3OL9A 4B3SF 3SEOA 1M5HA 4N56A 2D3OR 2N3OA 4PR6A 3DRXA 1OY6A 3TWZA 1D9AA 2BM1A 3MM7A 3V6DA 1FE0A 2X1BA 2GQQA 4X4UA 1FKPA 2ROGA 3MM9A 1QUVA 4OZ0A 3ZC4A 3PW5A 2UXCJ 3SQOP 2VONA 1ZM2A 3HD2A 4W4MA 5EHHA 2MLZA 1RAOA 1SUQB 4IO1A 1VQ6S 5C7PA 2XMKA 1KEKA 5BYQA 1PSDA 3A1YG 2CJBA 4DV2F 3RB3A 2BJ9A 3G6XA 1GTEA 2GJIA 4U7CA 1GTHA 1N34J 1YJUA 1CSJA 2EKNA 3TX0A 1U2RA 4FPRA 2B7BB 1SC4B 4ILMA 4NLVA 1AXQA 1G2EA 2DNNA 4C6AA 1ACMB 2OP5A 1RKJA 2HHHF 1F3FA 3BKTA 2VZ9A 3KLHA 1XEZA 1U25A 3PX0A 1FNXH 5J2NB 3F44A 1Y10A 4ZMMA 1FD2A 3PRVA 2NZCA 1LKZA 5EX3A 3TJ8A 2UP1A 4M63A 2E9RX 5L38A 3KOAA 2OEKA 3D5MA 4EBDA 3VTIA 4K4ZA 4DPYA 5L1IA 3QIPB 3I0SB 1FJ7A 1JLGA 4N41A 4P6QA 2CADA 5HVFA 2W4DA 4RW9B 1N54B 3ZZOA 4OL8A 2ZHBA 4LVNP 2X1AA 1MWQA 5IT9Y 3B8HA 2HK2A 3MDFA 4LF8F 2UVVA 1S1WB 1S7IA 3T5LA 4RBUA 1EX8A 1S0VA 2YKNB 4O23A 2E1AA 4NZ6A 1LWCA 2JVRA 3ZXWA 2EXUA 1KFSA 1IUJA 4ZVQB 2M7SA 3MM8A 2AZ1A 3VF0B 4IFYB 1LQ9A 1U8SA 1K0TA 2O5DA 5GAEI 3M6VA 1IQZA 1XIQA 1U48A 2YH0A 2H48B 1S6QA 4KV8A 4K0KF 2UXDF 1S4EA 4QQBA 2M3DA 3ZO7A 1S10A 2E7VA 2OHDA 4RW8A 1NLKL 4GVBA 2PO4A 1S6PA 1UZDA 5C24B 1H73A 1SJRA 3PTWA 4A8SA 2DEIA 3IRWP 3K2YA 4P2MA 3DOMB 2GIFA 3BV8A 4B9NA 2RAQA 3ET6A 2H1YA 3HFZB 1Q1KA 2FD2A 2CQHA 1UVLA 3NGSA 1C1BA 2V4RA 5L46A 5A8KB 4PWDA 4DPOA 3Q8RB 2MKYA 3CJ2A 1RKIA 3Q22A 2R9LA 3LALA 3DMJA 2MY7A 3TUIC 1RBOB 5B09A 4OYZA 3N0VA 4K4SA 2EBEA 3X3UA 1FNOA 5CYQA 2UUBJ 5A2QU 3HVTA 4F0HA 2OPSA 3Q2SC 4OX7A 3QT7A 4QWEA 1NK6A 2DR5A 4B9SA 5L9XA 1FCAA 1GFWB 3RBDA 3NXZA 4DLGA 3SFGA 1R27B 2M88A 2QE5A 2ZFHA 1RAJA 4BC7A 2DNGA 4KKOB 4LR8A 3JSBA 4WFNQ 1NMEB 5ETVA 1FDAA 1EHWA 4JI7F 3BREA 2J76E 3K7RA 2DR8A 4I1TA 1PBAA 4LF4F 1FWPA 4RLEA 5GMEA 4DUZJ 4ED8A 1FWKA 2DGSA 4WP3A 3SV3A 3MR2A 3UCZP 2JHEA 1VIOA 3J81U 2PD1A 3OFHA 1HNXJ 4DPWA 4M5JA 3D3BJ 2AD9A 2UU9F 2DBBA 3VZIA 1VC0A 1FX2A 1LXNA 3CIMA 3UD4P 2DNQA 4JYAF 3CCJS 4F3QA 1U0HB 2CNLB 2WONA 2MKHA 3NGTA 1OQ6A 3NLCA 3M8WA 1V3ZA 1X4EA 2KN4A 4QJVA 5FLXU 4OX8A 4F7VA 4RW7B 5H9FJ 4IH6A 5LSRA 4L3NA 3HKWA 1ZM4A 2LDIA 1G7CB 3KUHA 5DGBA 2QJ3A 5K9FA 2CPZA 1FI4A 2ZD1B 4ZVEA 2NUHA 5KT4A 4K2JA 3BSOA 4DR2J 2YX1A 5D3GA 4I69A 3IO1A 2F7VA 2XZTB 4R25A 1TMMA 3QT8A 1M0SA 1N52B 3SCLE 2AEJA 4DR6J 3T6JA 4ANEA 3BDEA 2RDJA 1XMQJ 1WI6A 4ZCMA 3KTQA 4V1Ak 2DKOB 3I55S 2C3MA 3KK1A 2VPYB 2U2FA 3ETOA 3JQMA 2GAGC 4OLPA 3QFHA 4BWJA 1H2VZ 2DITA 4ED2A 2MSTA 4NLRA 1I6JA 2UUAF 2V4QA 5HQ8A 1JLBB 1F9HA 1NSPA 5BYRA 4X4SA 2V67A 3B82A 1DLOB 4NEZA 1OY8A 5E3PA 3HVAA 3KDOA 2V2ZA 3H40A 1BWVA 4PZVA 3HJVA 3V6HA 5IT0A 3JAMY 1FWLA 4YUDA 5DQGA 3E3XA 2CJ9A 3H25A 1YG0A 2EFVA 1B64A 3ENVA 2QYGA 2EVZA 2BJ8A 4WK3A 2PE8A 1NJZA 3OLAA 1CS4A 3CMES 1MMDA 4B9UA 3Q8QB 4O3NA 4NA3A 1URRA 2XULA 2J7UA 4NOHA 2HHWA 3OTDA 1ITPA 3W8PA 4B3TJ 3KK2B 1Q81T 2CXEA 4IR1A 4TN2A 5BR8J 4WZMA 2FIUA 2X3DA 5T7LA 1RT7B 2JLGA 3TYTA 3VWSA 1RT6B 1HBMB 5KFUA 3OR1B 1DTTA 4WKYA 3OUYA 1QVGR 2RJZA 5HAOA 4PKDB 1IBKF 3Q8PB 3IS9A 2C2NA 1DZ5A 4DR3J 4G1IA 3C15B 1EAYC 1KQFB 1XERA 1GX5A 1VOMA 1JLCB 2VUGA 2EKYA 1NAQA 3D6TB 2N7YA 5DDQC 2MJNA 2AT1B 1TL7A 2LKZA 3HLUA 5KFIA 1VQ4S 4KIAA 4N77A 4PXCA 3U1MA 3M2RB 4C8NA 3HT3A 3EPIA 4OI2A 1IBLF 4USWA 2XQCA 1BLUA 4ZJQA 1PJ7A 3DLGA 4OI1A 5I3UA 3GWCA 5KG3A 1NU4A 1OMSA 4CWBA 3Q2TC 1FRMA 1S59A 3FCHA 3R7SB 3RTVA 2A2DA 2OPQA 3LUYA 1XR5A 4UQGA 1ZPVA 3ILJA 1S48A 3NMRA 3ZZRA 4R8UA 3IG1B 3QBCA 2DD8S 2FJVA 4ES1A 2ZBRA 2IM0A 2VOOA 2YNGA 4DCJB 1H3DA 3TUZC 3MUVP 1IN0A 2K3IA 2MXYA 3PIOQ 1LK5A 5KFEA 4ZVPB 1ZAWA 1NNDA 1LV5A 1RAHB 4ID8A 2ILYA 4RWWA 3UW1A 5IXUA 1WC5A 4EWTA 3CJRA 1XN9A 1Q8LA 2G1DA 2NSBA 3NMAA 4ANCA 2XS5A 2FHKA 3KG4A 3GSIA 4EI2A 3M30A 1J5EJ 2GQCA 1RP5A 3A12A 1WHYA 1X4BA 3UDLA 2OTJS 1RHQB 1M1KT 4ECTA 3QRQA 1HYSB 2HKEA 1L3UA 3HZEA 4MMOA 4WFAQ 4ID5A 2FHOB 1B0TA 4NLTA 1I3OB 4USKA 1YQHA 3FGVA 2VQEJ 3DLKB 4DV0F 2GO9A 5AJ3J 2IM2A 5THWA 1S0NA 3Q8VA 2XLKA 3MEGB 2D9PA 2GNKA 1F9FA 3W5XA 3TJ9A 1K47A 3MPDA 5KFTA 2BZ2A 2ZZNA 1VLOA 5E3RA 2VBWA 4JV1A 2ADBA 5J2MA 3M2UB 2HNDB 2FGOA 3DM2A 3GTYX 3CO9A 1UAWA 5KFXA 2QA2A 1U6FA 2HHUA 4K4TA 3ZZUA 1N0UA 1IJEB 4FDFA 1Y00A 1PCAA 3R9LA 2KM8B 2CDRB 3O2IA 1JXLA 1D8YA 2I9SA 3L7OA 4LUBA 1SJQA 2H5IB 2L48A 4P10A 2AZ3A 3R5GA 1WG4A 1X5TA 2EPIA 2JH3A 4IFVB 3QGGA 2P8IA 2HAFA 1RT4B 2ASDA 2MYFA 4WIIA 1TKTA 4ZCLA 2HQIA 3RAQA 3DI6A 4IRKA 1RTIA 1XWLA 4HHJA 1FKOB 4U9RA 1BWEA 3BGRA 3DLEA 3KJVA 3GV7B 1BQNA 3UN3A 1CJVB 1X5PA 2YTCA 4WXOA 3EUNA 2ZNZA 1SJ1A 4X62F 5LMNF 3PKYA 4LIRA 3G96A 2UXBJ 1E6VB 3O6QA 3KHLA 4BDPA 4MFBB 3HKZD 4DV6J 1TKXA 2BVZA 1RHMB 5G0RA 3KNAA 4B3OA 4A8YA 2J0SD 5C42A 4IO9Q 3IRXB 3R5DA 1K1SA 3I56S 3MTJA 3M8PA 1UCNA 2H3EB 2V8HA 5GAGU 5CXTA 1REVA 2YWGA 4NL5A 4NLWA 4FYXB 4LF1A 2ZBPA 1EP4A 4QIFA 4G1QA 2W8LA 5D78A 4KHRA 4OZLA 1F9EB 3V81A 2J7WA 2IJNA 4WCEQ 4GKJF 1UPMB 4WF9Q 3I4PA 1MU2A 5B0FA 1NPKA 4USMA 4JI4F 2V6AA 4A8QA 4JB8B 1X4FA 1FDNA 1F2HA 4DZDA 3N5BA 1GMWA 3M1VA 4MYUA 4CLWA 1GMWD 1S1UA 5JUMA 4DV2J 3FMWA 2HQDA 4TY9A 3MCOA 2EW9A 3OHBA 4CDIA 1KQGB 4ES2A 3PKMA 1QY7A 1HBOB 4EBCA 4J9VA 4KH0B 3WC0A 2GZOA 3RR7A 4HTIA 1KLMA 4O0NA 2R7OA 3GV5B 2Q66A 2DXEA 1X60A 3GR1A 2HHHJ 2RKIA 1LNQA 3VGVA 4OJHA 1IKYB 3EGZA 4C11A 2O1PA 4IG0B 4I64A 3W2WA 3W9JA 2Y0BB 1S12A 1O51A 4HI1A 2GVDA 3QWPA 1UTAA 4A8MP 3MCMA 1WEYA 3K5LA 2KRRA 1JLQA 1OYEA 4RW4A 4QYZK 3VQSA 5HL7Q 4J9QA 2D41A 4IQMA 1S5ZA 3EYZA 2BBEA 1RYSA 4AQYF 3MZIA 2CJQA 2B9WA 2W25A 2MHNA 3FRZA 1TKZA 4X4PA 5U47A 4ERDA 1CBKA 1WHVA 3TARA 2R2TA 5D6GA 2XM3A 2VOPA 1FRJA 4LF8J 3CCQS 3KLFB 1X9WA 1RWMB 5HBMA 4B02A 4LF7F 4LBIA 3HP6A 3R2DJ 2GC8A 5IWAF 4DPTA 1LWEA 3GIIA 1PJ5A 4MIAA 3LGHA 1S6UA 3TI0A 1KWMA 3BGOP 4M5HA 1BUXA 1J5OB 3NBPA 1UETA 2CAJA 1DRZA 1PAEX 4EK2A 1H98A 1ZYQA 4X66F 4M8LA 2KL8A 5HLFB 2POKA 3MHYA 2MGZA 5EGYA 1RCOB 4BCAA 5J2QB 1U02A 2H65B 3W62A 4IG3A 2IRUA 3TRGA 1VQ8S 4O3QA 1N0VC 5HVHA 1Z2ZA 2C2OB 3D4JA 1T05A 1W26A 4L75A 2X1FA 3UNGC 2CQDA 2KZZA 2BM0A 4DR5J 1FKAF 2DRBA 5C25A 2ZWOA 2GFFA 3LH2S 3QGHA 4P2SA 5KG4A 1EQMA 3HO1A 3FCVA 5H9FK 2VC0A 3OVBA 2OPRB 4RWXA 1V5IB 3UNYA 2ATCB 4PYAA 2ZH9A 2EFOA 3S8SA 1X9MA 1NHKL 4X65J 3HM9A 4HLBA 2PT0A 5HVGA 1S79A 3PDNA 1VQ5S 1VFJA 1Y5LB 3M8QB 3UD3P 4R0JA 5F0WA 2ZWPA 3GILA 3US5A 1H74A 1RT3B 1Q86T 1YBTA 4AT1B 1JJ4A 3TA2A 1WC3A 4UY8T 4FKXA 1SUQA 4HEA9 2MB0B 2KM8C 3KWMA 1R43A 1N5VA 3T3FA 4DV7J 3FRYA 2XYPB 2EFGA 5LSLA 3I32A 2KT2A 3TVZA 3TZXA 4DZ6A 2XSJB 1RT2B 2UU9J 3P8BB 2RU3A 4ELUA 3KKFA 1S57A 4KGVB 3R6GB 1Q7LB 4DL7A 2CVIA 2UVWA 1WEZA 3NNCA 4FP9A 4EGLA 2AWZA 1FRLA 4W92B 3GV8B 2HIYA 3ZZYA 3C3LA 3BB5A 3HF5A 5IT9U 1X0FA 4UQTA 1RDRA 1SIZA 2RUSA 1L3KA 5J2NA 1R31A 3M6XA 1G3OA 2DR9A 5F8NA 2KJVA 4CO5A 1XJWB 4USTA 1VK8A 1I94J 3MR6A 3DGPB 1Y3KA 3NOCA 3QIPA 3I0SA 1QE1B 4L3KA 2E29A 4JI2J 3NNAA 1PC4A 3D67A 1H0HB 3B4DA 1NPPA 2BA9A 4Q44A 4P72A 3KLIB 1RI7A 4TU9A 3NS6A 4DN9A 4F4YA 2WW8A 1CQMA 3JXOA 2OSQA 3H2UB 3BR9A 2VPXB 2DH7A 2AV5A 2XHWA 4B3RJ 1S1WA 4L76A 3RAMA 2VC1A 3PVXA 3SV4A 2M8DB 2YKNA 5JMNA 1T9YA 3PACA 3JQJA 3ILIA 4F26A 1K0VA 4IFYA 3AHPA 2QIFA 2HFNA 2FVCA 2EK1A 3EXYA 1H2TZ 3L09A 4IRDA 5KFRA 2NQPA 1TU0B 2OPPB 2F4FA 3G8SA 5C24A 2DHAA 2VFRA 3MCSA 3BH6B 4DCOB 2CNNB 3EDQB 2I8EA 1KC8T 3ZZZA 4NLSA 1ZBTA 4YR3A 4ZS6A 3DOMA 2V2KA 2XCPA 4JI1F 2CPDA 3M4XA 1Q4RA 1YHQS 4O0IA 2KB2A 2MJUA 1OWXA 2HLUA 2C2ZB 5F0UA 3NCPA 3CCUS 5A8KA 1DFDA 4HACB 1EZZB 1R89A 2Z58B 5CYJA 2B9YA 3KHRA 3ZZTA 2PEHA 5DG8A 1H2UX 2FJBB 3UR3C 2Q43A 1V3SA 4CIOA 2FY8A 4WXWA 2B4UA 3MEKA 1KP6A 2L9NA 2VU5A 3MPVA 4F02A 2XWYA 2W7AA 4TLQA 4DL3A 1KDNA 3D6FB 2Y1RI 1T3NA 4X4OA 4FNIA 2CG8A 2B4PA 3PYFA 3N6MA 3NAIA 3ZZ0A 3RBXA 2FJEB 5LMUJ 5KTQA 2DCUB 4HT7A 2IFXA 4QCLA 3THPA 3NNHA 2QEXS 1QLNA 4KKOA 1FK9B 5KAKA 2IMWP 1NKEA 1FRIA 4EUVA 2QMXA 1CVJA 3GYXB 1JWWA 4U6PA 3R5CA 4H4OB 3D2WA 2XNRA 4ZP8A 2CWKA 3EXCX 3UI3A 3MF5A 5KFSA 4QWAA 1CULB 3PHEA 1HWLA 1QTMA 3LO3A 2AKWB 4DV4J 1VRUB 4DQSA 3RR8A 4PWWA 3H0PA 4ZP6A 2A2CA 4RNHA 1TL5A 1VBXA 4AUKA 3TQEA 4RR5A 3UE2A 1RLCL 1YZ6A 5F9LA 3GIKA 3U27A 3L95X 3V5RA 3VAFA 1VQOS 3OLBA 4NRUA 2DNHA 5EDWA 4DSIA 5DS7A 1RYRA 1U0HA 2NCKL 3CGIA 3VGUA 3BEGB 2W9BB 1HPZB 2DY9A 2J0XA 4RW7A 3JSMB 2VASA 3SCIE 3JTNA 3U7JA 5CABA 1H7XA 3DRRB 5E3QA 4KFBB 1RA6A 1YJTA 5KOWA 4QBUA 4P9SA 3ZTSA 1NSQA 3K57A 3Q8SB 4ZVTB 2ZD1A 2EC2A 5IZHA 4KQZA 4O3RA 3HVWA 5AXLA 5KG6A 2Z8QA 4AE5A 3CW2C 1B7FA 4PABA 1RWUA 2AEFA 1U7LA 2ROEA 3JAMU 4XDCA 3EM1A 2OFGX 2LFVA 2X3GA 4WZQA 1UFWA 1GMVA 2WK4A 4KHPF 2XO7A 4TU8A 5A76A 2VKZG 1HI1A 3JQKA 1JLBA 4LR7A 3R7NB 4C98A 3GFXA 1DLOA 1QAJA 3KLVA 3OL6A 4J9RA 3J7ZT 5D15A 1PYTA 2COLA 1BC6A 2YWWA 4JV5F 4KSEB 5HMZA 2M8HA 4ZPVR 1CPZA 1SBRA 2HSEB 5G4DA 2NLWA 2ROPA 2G1HA 1SJ3P 4EO8A 3RW6A 5KFMA 1VISA 2FJAB 3KG1A 1TVRB 1FFGB 3BGFA 3N6LA 4DOZA 1FTRA 3R97A 1FVQA 2W4PA 1BQXA 1RTJB 1SKWA 1EIYB 2XNQA 2RILA 1Q8IA 4ECUA 2HNYB 3FJ2A 3MMAA 2YKOA 1HMVB 2EEYA 3T9ZA 3KK2A 1LOUA 1AZSB 2ZH3A 2KG0A 3N9UC 1B7YB 1DAXA 4TYBA 2GVZB 1QVFR 4DHVA 1HD1A 3ENQA 1RT7A 1K44A 1YKWA 3EZOA 2ZH7A 1HBMA 2ACYA 2FTRA 1BD6A 3OR1A 4OX6A 2FHJA 3TW0A 4KR0B 5M2PA 4DG1B 1S49A 2AYMA 2FHJD 5GAHU 4RUHA 4X62J 3AA9A 1RUSA 5LMNJ 1VR6A 3RBEA 4MKVA 1VQ9S 1G6BA 3C15A 4OZJA 3IR7B 1JLCA 4LRAA 4C97A 2CNOB 4IYQA 2O66A 3KHHA 1N34F 2YKAA 2DGVA 4C7QA 4HHHA 4ZVRB 2HHXA 4P52A 1Q7YT 3GJSB 3M2RA 2ZJQQ 3P3DA 2UUTA 1IWGA 1DQ9A 3I9V9 4P73A 2LP4A 1HWUA 2XMTA 3MPUB 2YWFA 4NMLA 1N4LA 2MDAA 1S9GB 1RWOB 1FD8A 4DL2A 5KFNA 3MMBB 2VL1A 4ZDNA 5GVQA 1U1KA 2CQ1A 3OW2R 2DVIA 1ZH5A 2RVJA 3UCUP 2P9GA 2CIMA 1WTFA 2BOPA 1CC7A 3C46A 3CCZA 3C6UB 2HRYA 3CMQA 1T9TA 1IKVB 5FLXY 3IG1A 2LEAA 3QO9B 3FZBA 1HHTP 1RABB 2RHSB 1T9XA 2HFOA 4QWCA 2AGQA 4XAKA 1AYEA 4PG6A 2GHPA 3VAGA 3D28A 3H4BA 1JNRB 3VVUA 1X5SA 2HQ3A 5KFPA 5BYSA 1ZTTA 5ETPA 4NLUA 4OJ3A 3DLHA 4QPTA 2DHGA 2WZ1A 1HYSA 1QM9A 4LF9J 3T9NA 4WU3A 1PYOB 1UW9A 4TYAA 2HZCA 3PG9A 3CWJA 2V9WA 1VBKA 4ENOA 1U2CA 1C2PA 3DLKA 3EVMA 4N47A 5F3ZA 1U26A 2HZAA 1SKSA 2BE2B 2EFNA 2M70A 2DH9A 3EE3A 2JLEA 3MEGA 3FNNA 1NK4A 2H4WB 3LW5C 5IC6B 1X4DA 4LQ9A 2YKMB 4URGA 4M5MA 1U1RA 3OJSA 3QGPA 2V8GA 2FDNA 3M2UA 1R0AB 2HNDA 3MR3A 3KJNB 3MEDB 2GAHC 2MTLA 2YNIB 3PO4A 2NZ4A 2MEWA 3KK3B 4FKYA 1N48A 2ASLA 2YKPA 1FEEA 3SYZA 2UUBF 2RQCA 1KTVA 3AJ1A 1PAUB 4LSNB 2A6MA 4ELTA 1XNRJ 1NDLA 1JLEB 3K59A 3IP0A 1LXJA 3D66A 2R7SA 4IFVA 1SL1A 3H2LA 2ZH2A 1WKJA 1RT4A 2E7WA 4DX6A 4P2FA 2ZHAA 3I9ZA 2EC0A 2ALZA 5B0GA 1QSYA 2OGUA 1M5SA 2KTQA 2MKKA 4DU7A 5D0HA 4RNMA 1YWXA 1FKOA 1VJWA 2MQNA 4LQ3A 1TELA 1CJVA 2R42A 4ZVOB 2RB7A 1I51B 2ZOGA 2ZOMA 4DUZF 2X7IA 1YRUA 2QX0A 3NGUA 4ZN3A 4XIUA 2W2OP 1E6VA 1KD1T 4MFBA 3T5HA 1HNXF 3QAUA 2AEMA 4IQXA 3ZNJ1 3MEEB 2L08A 4YY3J 4NLOA 2DHSA 2VV5A 3EGVA 4ELVA 1KVKA 1TL3B 1RTDB 3IRXA 3PYGA 1Y7PA 2R7TA 2IYIA 2HGMA 3EICA 1YJWS 2D69A 3M2VB 4ZVSB 3D54A 1I5OB 1OQ3A 4Y2MA 3MD3A 1UWBB 3BPSP 2PMHA 2BEFA 2J6TA 2RIJA 2VBZA 2NR0A 2G4BA 2C2MB 3HHLC 1MMNA 4U8VA 1WC0A 3FEYB 4FF4A 1X4HA 2LA6A 3W65A 4NA2A 5HJXA 4QZVB 4A8XA 3VAIA 4DR2F 2KO1A 4FXWA 1Q53A 4Q0BB 4DR6F 2KRBA 5L8RC 3O8WA 2AJ1A 2JOQA 3UVJB 4CLYA 3TEHB 1NO8A 1HBOA 4OV6A 4E98A 2IMOA 1U09A 1TUVA 2DIUA 2YNHB 4TY8B 3I0RB 7AT1B 3OL8A 4FVMA 2RNEA 5HMYA 1IKYA 4IG0A 2HBQB 4USVA 1HNIB 1DTQB 5HI7A 3W66A 1N5YB 2DNZA 2WVFA 3TZWA 3W8GA 5EWEA 3EGNA 1YZ7A 2XO6A 4WKRA 3CJ0A 5HSPA 2HHQA 2KVIA 1R8BA 2LECA 4GC7A 1T11A 1P9YA 1OYDA 3T1HJ 3P96A 3CJTA 4CLSA 4I6AA 1Y9OA 2R8HA 3MM6A 2DR7A 3P6YC 2VFSA 2V8VA 4Z7CA 1S6OA 3KLFA 4B3TF 3PW0A 2OEMA 3HSDA 3EZ5A 2HURA 5BR8F 1YI2S 1PKUA 1HHSA 3W5ZA 2F65A 3AQPA 1J5OA 3FKBA 3OFGA 2R4FA 2XI2A 3A8JA 1CQNA 4LFCJ 5HQMA 2CRLA 4A47A 2CPEA 3K5NA 1NB2A 4ZLNA 2XEXA 4J9LA 4YB1P 3H59A 3AT1B 5HLFA 4R5PB 1SKUB 2IRXA 4DCPB 5J2QA 4LRFA 3GB0A 1GQEA 2GV1A 4QIWD 1S9EB 3O3LA 3QLHB 3CJKB 1ZZFA 1UW4A 3OHAA 3K5PA 5KFKA 1LEOA 1NK8A 3UN5A 4OFZA 1L5UA 2RT3A 3HPOA 3BSCA 3IN5A 4RZRA 2BRKA 3G8TA 4I2PB 2WTFA 2CQCA 2CQ4A 2OPRA 4RJVA 4TNOA 3P5TL 3CO0P 1HBNB 1S1XB 4C9DA 3AAWB 3CD6S 1JJHA 2IVFB 4N76A 4DL4A 1H72C 3G82B 2R7UA 3HHNB 3MM5B 2Y1JA 2MZQA 3R27A 3OTOJ 2N4DA 1Z1ZA 4MJKA 2B5JB 4J37A 2CJYB 1XC9A 1K9MT 5HMWA 4F2RA 3M8QA 4DUTA 2VG5B 4NCAA 2CPFA 3W5YA 1PYSB 1RT3A 4G3IA 4RUAA 3DOLB 1RWNB 4UTGA 1HQ2A 3FBFA 1M1HA 4DSFA 3TX8A 3N01A 5DM7Q 5DQHA 1U6ZA 4KGKA 1C0UB 2R7QA 3PJ9A 4UW2A 2JEFA 2Z2ZA 1NEEA 2OTLS 3R5AA 3PW2A 1J5EF 3FZ2A 2XSJA 3DRSB 4GO7X 4ECZA 2JC0A 6FD1A 2H51B 3CIZA 5B0EA 1GXTA 3PJXA 3W61A 4RL1A 3PY8A 3J81j 2Z2LA 5L39A 2ZJPQ 2W1BA 1QUPA 4OZ2A 2C3YA 1WKLA 4H4MB 3LTOA 1B3TA 2QMWA 1FJGJ 4WFXA 3AXKA 3IWXA 2PMWA 2Z4PA 3C6TB 2VQEF 4ILRA 1GXLA 5AJ3F 1WC1A 3BO2A 4J5OA 3AB4B 4RU2A 3QRPA 2IY5B 4MIBA 1FTCA 2DHXA 2MZRA 3V6DB 1X7VA 2V8DA 1FJEB 3MURP 1U1MA 1MROB 4PRFA 3CD0A 1RWPB 3IBCB 4CLUA 4DF4A 4IKAA 4N5SA 3DGPA 1QE1A 5B0AA 3BBCA 2AX1A 2A18A 5KT6A 2XY7A 2X1GA 5IC4B 3I4HX 2VODA 4XO0A 4QR2A 4X4RA 4MT1A 4F67A 3KLIA 1AUDA 4OHYA 4I68A 2MZSA 3OTEA 4RW6B 3SCJE 4L6V3 2G0IA 2CQ2A 4JI6F 2BKPA 2BE9B 4K5RA 4XDDA 3TZZA 1RHKB 3AY0A 1NK0A 4KJIA 4ZVHA 1YRTA 1OY9A 1RT1B 3DLJA 3NRBA 3EX7B 5K8PA 1SKRA 1NXIA 4QR1A 2EWHA 3WHIA 1CJKB 3SDEB 5JJBA 1SVDA 2OPPA 2QO3A 4JV5J 1KR4A 1FA0A 2XC9A 2ASJA 2FLPA 3OFEA 9RUBA 3PEJA 3C14B 1KN6A 2UXBF 1TV6B 3K5MA 2FLLA 3H20A 3ZTPA 3DLBA 1IBCB 1U1QA 3DXBA 4DV6F 2IJFA 2N7CA 1IXKA 2NXNA 3JTPA 3ZTRA 3SCKE 2GJFA 3FSXA 4DI6A 2QFIA 2R7RA 4DV1J 2LYVA 1R6VA 4CP5A 2M9KA 2KT3A 3WIUA 3K0JA 2EG1A 2QZ8A 1HHQA 4HACA 5LT5A 5HMXA 3TR5A 4ZIVA 2XY5A 1WI8A 4ZJLA 2VFTA 4ZOSA 1X31C 2AYGA 1EETB 3M6UA 1E6YB 1IQTA 3O5TB 2C3PA 4F50A 3F73A 2CUYA 5L1LA 1NK7A 3GCXP 1UEKA 3BGLA 4QPXA 1IR0A 4NCGB 4Y28C 3NCRA 4RW8B 4OI6A 1LFWA 5FIIA 3PFEA 1ULRA 4B9LA 2OH2A 1FK9A 3DXSX 1L3TA 3BYRA 2CPIA 2Z2YB 4F4WA 1WUUA 3IR5B 3M9NB 4H4OA 1T9WA 2D1CA 4M5GA 4CM2A 1CULA 3Q8YA 5EX0A 2BABA 1AA1B 2WSEC 5HATA 2C28A 2C2RA 3KUEA 3RB4A 1U1LA 2I6WA 2RS8A 3G4SS 2FQQB 1OPIA 2D3ZA 3ISND 2B0GA 2D74B 3DMJB 2L41A 1VDHA 5ETSA 4OHVA 3OD2A 5FDLB 5AXMA 1NJXA 2B8QA 2W9BA 3HVTB 1HPZA 2KHDA 1KOOA 4J91A 4FXDA 3MXHP 4GVLA 3NS7B 2LLZA 2WB4A 2WCXA 5AXNA 4UOFA 3JSMA 2DHHA 1LW0A 1YJ7A 3DRRA 3OFFA 4KFBA 1GT8A 4P7TA 2W7PA 2XMUA 3LAMA 3GFHA 3NKYA 1PG5B 1M5PC 1NKCA 1HW9A 3GP9A 4KGZB 2E5GA 2CQ0A 4K2XA 3PJWA 2ILZA 3IM8A 3KUGA 2XCAA 1S76D 1RBAA 3D1OA 4Z2XA 4J9SA 2YY3A 4FYYB 4G6VB 4LT6A 2K3KA 3UN2A 4QU7A 1RJJA 2UVUA 1HNZJ 3GJRB 1YVFA 4NWBA 1F6TA 3OSNA 1D3WA 3JSRA 4I7FB 2BRLA 2V9KA 2FZGB 4IDKB 1O0PA 4ECSA 1Q8BA 2BJEA 4P75A 2F8EX 3MFIA 1RB0A 2GMLA 4DPXA 1T7PA 2GJ2A 1KS2A 3KLGB 3MFHA 2K1RB 3SSSA 2NYIA 2QG9B 2CG4A 4QYZJ 5E3AA 1KOHA 5D77A 4PPDA 3VAJA 3H5XA 2G2OA 4CTAA 4LBPA 3A13A 1NZAA 5AXKA 2F8HA 1AROP 5CYMA 5SUHA 3LOUA 3DYAB 5CCLA 1SB6A 4DR5F 3G6ES 1NHUA 2F63A 3IR6B 2C2KB 4Y00A 1TVRA 1RHJB 2GHVC 4CT8A 1IJFB 3AOCA 1RTJA 2F4VJ 4L73A 2CZ4A 5M2UA 2W01A 2ZH4A 5DZ6A 1G4CA 2V8PA 3AB2B 3QJPA 4CNYA 4HR2A 2HNYA 2KKHA 1S1TB 5DDRC 4X65F 4IOCQ 1HMVA 3CEDA 2BJ3A 3D68A 1AZSA 2A0FB 2HGLA 1F1BB 3A8EA 2VJVA 1SXLA 4LF5F 5AE3A 2W8KA 2D7SA 2FJXA 3GZ7A 2HS4A 2GVZA 3M8ZA 3OT9A 1S1VB 2GMHA 2VG6B 1RADB 4KTQA 2ZC3A 5L9NA 1B99A 2FHMA 4NI2B 1NK5A 1P9QC 2DNLA 2LMIA 2IBKA 1HWJA 4DG1A 3EDRB 4C8OA 4ALZA 3E8OA 3TANA 2XGPA 2FVRA 3GJTB 4ICLB 4DV7F 4IR9A 5D0RA 3CULA 3DDIA 1VQPS 1JLFB 4DJBA 3DN9A 1ZZNA 3M8YA 4YB6A 2B7CB 4ZN1A 4F4ZA 3H4DA 1APSA 2CKWA 1C4CA 5I4MA 3N4WA 1UMJA 2DIVA 1N5QA 2ZUAA 3C16A 2BQ3A 3A8IA 3PR5B 3PW7A 1N33J 4D3GA 4KY3A 2NXCA 2DGOA 1XMBA 1X4CA 2QL9B 5K14A 4ZHRB 1F5BA 2R8KA 1RBLA 1JJCB 1S9GA 3FFIB 4FS1A 3PZPA 2MZJA 2JJ4D 3ZZPA 3MMBA 1GX6A 2R8IA 2DK2A 1T8EA 2VG7B 4AL6A 2DH8A 1I94F 1TZ0A 1T0TV 3R3TA 2LQ8A 2HK3A 4JI2F 2J6UA 1T9VA 3C6UA 2E7XA 2RQKA 3GYNA 3WQPA 1IKVA 1WACA 2DR6A 3QO9A 4A8WA 1VS3A 3CD7A 2W2PP 1SJFA 2HBRB 5AE1A 4JOUA 3GU0A 1NH8A 4OYOA 2WAQD 2R2SA 4B3RF 1HNWJ 3NL0A 2CDQA 4ECRA 4CO0A 5J1EB 4WPAA 2GQ2A 4FBTA 4JI8J 3VGTA 2AP6A 2E1CA 2LVWA 5F8IA 2V0NA 2R8JA 5ETRA 3KMSA 2YWHA 4Q45A 4NEYA 5H9EJ 5IT4A 3I96A 3PFOA 4UUWA 1GAOA 1MWZA 2ZJRQ 1VGYA 3W60A 1RT5B 2BXJA 2JSXA 4DFJA 3H5YA 2J6SA 3I5BA 2QN6B 2E9ZA 4DR7J 4J9MA 1UVKA 4X4NA 2OPQB 2VJUA 2Y8YA 2DNOA 2BE2A 4B3MF 3TEGA 4J90A 5KFWA 3RYLA 3LP2B 4K5SA 1UEVA 1D1UA 4KAIA 3DU5A 1YRXA 5J1PA 2V50A 2DPJA 1TUGB 4JI0J 2YKMA 4HDGA 5B0CA 1V9OA 4WK1A 2W9AA 3SBMA 2XI3A 1R0AA 2J0WA 3UDCA 2E1MC 3GONA 3MEDA 1VC6A 4V19X 4WFBQ 2ZVIA 1EQ0A 8AT1B 4DS5A 3KK3A 1T94A 3GCWP 2VFUA 1VHFA 3M32B 2DCLA 2RH3A 2CQGA 3TAMB 4OHWA 4PYDA 1JMTA 4ED0A 4LSNA 5LOQA 3M7VA 2ZUGA 2AYEA 1JLEA 3QZ7A 3D3CJ 1J2VA 4IH5A 5LMUF 1OO0B 2QSFA 4K4YA 4MKYA 2KH9A 2LA4A 4ED3A 2B51A 1T03B 3LPYA 3RGIA 2AGPA 1X0PA 3AOBA 3BQ0A 2NREA 4KE5A 4NXMJ 3J7YI 4G1PA 2KU7A 2XLIA 2B43A 2OLWA 2FUG9 4RNOA 5EN1A 2AGOA 3FBEA 3DHWC 4QW9A 1TP7A 2J8SA 3C8YA 4CH0S 2NPFA 2IC3B 2OFHX 4QW8A 3D1HA 4DV4F 3V6JA 4B17A 4LF6J 1RU1A 4P7VA 2I38A 1L3SA 3MEEA 1ROFA 4DV5J 4F04B 4MKBA 4ZLPA 3MMJA 1TL3A 1RU2A 4U96A 1H7WA 3ITHB 1RTDA 2JWNA 3BO4A 1D0EA 1ZAXA 2CPYA 1NH7A 3TUJC 5HP1A 1EB0A 3M2VA 2RHQB 4JI3J 5CAAA 4DFMA 2DNRA 1UWBA 1SC3B 1Q78A 2IM3A 1DQ8A 3ETMA 3IGVA 1SJ4P 2E1RA 5GAHI 4EEYA 4Y3CA 2NS1B 2HWTA 1SH2A 4Q43A 2YWEA 4MTPA 2B4OA 2OMOA 2CZ9A 1KSPA 5E5NA 5J2PB 2R7WA 3CJSA 3ISZA 3UVJA 1BMQB 2CQPA 2GW8A 4PUOB 3G8QA 1QTNB 5MLCV 2FPHX 5F41A 1U47A 5AE2A 4GKKJ 3GMGA 2UUCJ 1FE4A 2DT9A 3AOAA 2YNHA 3T5KA 4TY8A 2Z0GA 3I0RA 1T9UA 2GCFA 5C2GA 1F2GA 2FVQA 2XMVA 4BBYA 2VQFJ 4DQPA 1HQUB 2HVHA 4CRJA 1HNIA 1DTQA 1N5YA 3BN4A 2OJ3A 4USJC 2A3JA 5K20B 1DHMA 3RRGA 3P49B 2YQ0A 4NYOA 3KG0A 4DUYJ 2ACMA 3VV2B 4K4VA 2BQRA 3G87A 4WE1B 2G2ZA 3WX4A 4NZ7A 4UOGA 1WEXA 1KTQA 1FXDA 2BANB 5GMKa 3OV7A 3PEHA 2OEJA 4WFZA 4JI6J 1UKUA 4DX8H 1WDDA 2BOAA 3ZTQA 3TUPA 2AU0A 1FT8A 3KYLA 1QSSA 4HYKA 4H54A 2DPIA 2VF3A 3LP0B 2ZH1A 4LR9A 1Z4UA 4YEAA 5CA5A 5KFFA 2Z2MA 4N7TA 1UJ4A 3IXQA 4M94A 2OD6A 4YHHJ 1VMBA 4B9VA 4ZK7M 5GADI 3IWNC 3V2UC 4R5PA 3CCWA 4DMZA 2BR0A 4PXEA 3MGJA 3EWGA 2XYHB 3PHTA 4I2QB 2MKSA 1F60B 4GC6A 1S9EA 3QLHA 2W2MP 1KQSR 1K1QA 3CJKA 3C66A 2Y8WA 3MUTP 4ZA1A 3QSYB 3R7BB 3MAHA 3F41A 1Y11A 5HBMB 1FF2A 3FQLA 4ZJOA 4X4TA 4ANDA 2QLXA 2ZITA 3FUYA 3FEXB 1JLAB 1NZ8A 4I2PA 1XK8A 4HHUA 1DJ0A 2OIHA 4ZVGA 2RRNA 2M0GB 3L4BC 3S1TA 1HBNA 1S1XA 3HK2A 5KFZA 4DR1J 4CO1A 4CQ1A 3G82A 1WF0A 3NP5A 3MM5A 1FO1A 4Z37A 5F8LA 1XNQJ 4LFBJ 1W2IA 3OTBA 1VK3A 3THVA 2B5JA 2G9OA 2J9CA 1RZMA 1B0VA 2QLFB 2VG5A 5DO2A 2NPIA 3LP1B 1M5OC 1SI9A 3DOLA 1JNZB 1MN9A 3GFZA 1Q82T 3MOJB 2AJ4A 4AL5A 2R2RA 4DLEA 4O3OA 1JXEA 4ECWA 1C0UA 2HHVA 3B78A 4ZLLA 2DO0A 4Q7AA 4AL7A 1FRHA 3CC2S 3VALA 2ZM6J 3PW4A 3SI8A 2GIQA 4A8FA 4PG4A 3POTB 2HAIA 3HSGA 3DRSA 5ETKA 1IKWB 4ECQA 2ADCA 3A3PB 2ZKUA 2DNPA 1XBWA 1M90T 4LF9F 3PO5A 2ZZMA 2RQ4A 5HO4A 5KG7A 3UR0A 2WB1D 3QAEA 4H4MA 3OR2B 2JNJA 4NLQA 3CCRS 2IDLA 2GMJA 3CJQA 3C6TA 3WX8A 1UFKA 2L3MA 2VA3A 2X51A 4Y2CA 4OYMA 2Y0SD 1FHTA 2C22A 1G1XA 1MROA 3ENAA 1IM4A 1D9DA 5EUHA 3MPWA 1FERA 2F5GA 1TL1B 2L9WA 2Q6BA 4OIXA 4OZNA 2W4CA 2IIHA 4X4QA 1V6HA 1NDKA 1IR2A 1Q8KA 4IRCA 2QFJA 2ZVSA 1S7HA 3NCQA 5KFHA 3LWMA 2LU1A 3R1LA 4WYWA 1I1GA 1UL3A 3NWGA 4CLFA 2DGXA 1FFWB 2DISA 4OHXA 3OXFA 3GJQB 4RW6A 1XNRF 1O8BA 3HVRA 1PC5A 3AXMA 3M8SA 4BWMA 3MI7X 1WSRA 1O5JA 1RLDA 1IKXB 2Y1LB 1RT1A 3W1YC 3A8KA 5IS2A 4Y6IA 5IV4A 4C3LA 2XMWA 5HK4A 4X64J 5ETTA 4HH1A 3QZ8A 1FRKA 2MKIA 2APOA 1WHXA 4OJ1A 5D0GA 3MR5A 4FS2A 2MQPA 5B0DA 1CJKA 3SDEA 3AD7C 4USIA 2M4MA 4C4WA 4ZP9A 1B0PA 3C14A 4LSZB 1TV6A 4LMZA 1W7WA 4C3KA 2P9EA 1HL6A 4MAKA 3AQOA 2LXFA 1A7GE 3VVTA 4YY3F 1GH8A 1R8CA 2OAUA 3SZ2A 5A8WB 4ZPDA 2AIRB 4ECVA 4H4KC 5KFDA 2CZVC 4DQIA 2HYIB 2HNZB 3CXCR 3CJ8A 1LW2B 5T14A 4YFUA 2UZAA 2RS2A 4NXNJ 3D0GE 4LF5J 1FVSA 4MKAA 1EETA 5IOLA 1E6YA 4CYUB 3KLEB 4K4WA 1KVIA 3BS9A 4PG5A 2BKOA 3D1QA 3GIMA 2IBOA 2MSSA 1YSJA 4ED6A 3CJ4A 4MK8A 4NYPA 4DF8A 1R0BG 3TJAA 4DV3F 4NCGA 1C0TB 2KHCA 1XMOF 1TUWA 2QRRA 2VDIA 2J9DE 1TMJA 2IAJB 1Y5NB 4UT4A 5DGAA 3HT0A 3CT9A 4NCBA 2HQFA 5E2QA 3CMAS 3CDAA 4OZ3A 2ZBQA 1CJUB 1FESA 4ETXA 2WVBA 2G0JA 3TNVA 5H9EK 3PM9A 1RSCA 2JC1A 4M5DB 2V5HG 3PIPQ 1Y4ZB 3SSRA 4TQRA 1VI7A 2F40A 3HHKA 2ASYA 1P6TA 4HT5A 1HI8A 2D9OA 4DL0C 5AT1B 5KFGA 5FDLA 3G2XA 3IM9A 2HHTA 2ZDPA 5FJ4A 3TQ1A 9ATCB 3E2EA 4FF3A 1GNKA 2MPUA 3W2VB 1ZETA 3T1HF 4LF2A 1UP1A 2CJAA 4RW9A 4J9PA 2OMLA 2JLFA 3OJUA 1NUEA 3D0IE 3DDKA 3CF5Q 2LEBA 2AX0A 2GGPB 2Q1LA 5CQGA 4WTOB 1MSWD 3HMJG 1F5CA 4X4VA 1Q95G 4OMFG 3D0HE 4CNZA 2FVPA 1UVMA 2F9JA 2VBXA 2C42A 4EYHB 3TAQA 4FPIA 4CCHA 2XZDB 2B6AB 3W9IA 3HI9A 2HMIB 4LJMA 1NSKL 1LFPA 3PR4A 2LXUA 4YN3B 4I7FA 2XYGB 5DZ7A 3CTRA 3SSQA 3G86A 2AJ2A 4IDKA 4LFCF 2IHR1 1M5KC 4YR2A 1WTBA 1RGVA 4EO6A 4DSEA 1GMUA 3HULA 1VBYA 3BO3A 2R3VA 1X8DA 4DDFA 3KLGA 2K1RA 1UPPA 4NLYA 2CYYA 4B3MJ 2K8GA 1U1PA 3LGMA 3K58A 2P6SA 3CCES 5F8GA 1IM6A 2J8AA 3DHXA 3PV8A 4LREA 3G9CA 1MG7A 4YB7A 1WOOA 3JYTB 1IBMJ 4NYZA 1MWYA 4C3MA 2V4JB 4ZLJA 3IAS9 1NM2A 4UZBA 4OZ1A 1U49A 1OSDA 4DN0A 3DYAA 4DX7A 4ED4A 3ENWA 4F4KA 1SQGA 3NAHA 4LFAJ 2ATLA 2ZH5A 4G65A 3UD5A 2KFNA 1NRKA 4NLDA 2BDPA 2E5JA 3T1YF 2FB0A 4LSLB 1S1TA 5E33A 3OTOF 2FGCA 1K8AT 1N5TA 1D9FA 1ZA1B 1WC6A 3U02A 1JXVA 1TAQA 1KVJA 3CCVS 4DXLA 4U67Q 1S1VA 4DPUA 3SMZA 2VG6A 3TA1A 1MMLA 3D6MB 1U1NA 3UPFA 3J80Y 2E5LF 2FC8A 3FSYA 2RQMA 5DQIA 4NI2A 3QATA 3UDVA 2DO4A 4ZPAA 3RRHA 1SQEA 1WNEA 4MYTA 3K8VA 2HBYB 2BJ7A 3LA0A 3TP2A 3DRPB 2XS2A 2VPZB 2VA2A 5IQ6A 4ICLA 2PFFB 2CNKB 1JLFA 2FVSA 3ULHA 2ZEJA 2AMCB 3THTA 2MQQA 4B08A 2GIRA 3KNGA 3R6LB 1HIYA 3IC1A 1DURA 2B56A 5E41A 1AUSL 2MLXA 4MK7A 4A46A 2LQ5A 4FZVA 5HJYA 4HH0A 1SL2A 4CT9A 4Q8FA 2XMAA 4XPCA 1WOSA 2K06A 2C1EB 4ZKAA 2W9CB 2K7KA 1FJGF 3MMAB 3MWBA 8RUCA 4ZHRA 5H1SV 4F36A 4AXJA 4V19J 3FFIA 3KXDA 1RCXB 3LGNA 2VKRA 3JTOA 4URSA 2VG7A 5LJ5Y 3OBIA 3HDSA 3J7AN 4Q8EA 3S6EA 2AW0A 1AFIA 2WBMA 1W2BR 5B0BA 1C1CB 3MCNA 4I0WA 3OVSA 4N8OA 3HFVA 2JEGA 4YMEA 3UO0A 3H8YA 2Y3YA 2HHPA 4ZVFA 1WD6A 1VQYA 1X5OA 1U4BA 3P45B 3K8WA 4CO3A 1S9FA 2OI2A 1ZM3A 1UVNA 1RWWB 1X9SA 5J1EA 1WKKA 3V4IB 4OI0A 4GMKA 1WG1A 2ZH8A 3QT5A 1WF1A 5IM0B 2KT5A 4CO4A 1LWFB 2XWXA 4L72B 3GSDA 2HIQA 5LSOA 4ED5A 2A1BA 3HHEA 4LIWA 3GIJA 1NKBA 3VHQA 1RT5A 3HHDA 6FDRA 3B6BA 2WOMB 2Z30B 1YITS 3CC4S 3HHLB 3CCTA 4OYIA 2A10A 4ZCIA 4IOBA 4ZPTR 3SQGB 3X1LB 2MY8A 5KFOA 1Q5YA 4M5KA 2CJXB 4OLOA 5A6PA 3LP2A 4OZ5A 3S7RA 4ZP7A 4FBUA 4DV1F 2IDEA 2BV3A 3MUMP 2YX7A 4F4XA 3A4TA 3RB6A 3IBWA 3AD8C 3Q86A 1DARA 2VICA 2OKQA 1NPRA 2XSFA 1Y3JA 2PMZD 4PXBA 3TAPA 5GMDA 2QV6A 2ALYB 2QL5B 2MQLA 2ZNYA 3UQSA 4ED7A 3FMBA 3D9BA 3IGNA 3M32A 4PG7A 4ER8A 1HNVB 3TAMA 4Q5VA 1RT6A 1JKHB 1NJYA 2U1AA 1O6XA 2VFVA 1VYAA 1OIAA 3AD9C 4RNNA 4F25A 3QQCD 2WSCC 1R3NA 3BQ2A 1N88A 5F3TA 4YB5A 3R1HA 2EFPA 1S0OA 1T03A 2I5JB 5KG5A 2FZKB 1JK9B 2NYHA 3GG0A 2ZDOA 4YQWA 2LDYA 5KOXA 3D6HB 4NZ0A 2UV8A 1RHUB 3QWUA 5DDPC 4DSJA 1ZM9A 5DDOC 2IC3A 1BE4A 3T1AA 3H98A 3DU6A 4JI5J 1NJIT 2DEJA 2IVYA 2A6OA 2WVDA 1UA0A 3ITHA 4BC9A 5CH7B 2IJRA 2OSRA 3A3NB 4QWDA 4NLXA 2DYAA 1WWHA 5E7OB 3LAKA 5M2RA 3BSAA 4W90B 1JJ2R 3T6BA 3QJJA 3BYPA 5F9NA 5DLGA 4F0KA 2EG2A 2QA4S 3FDSA 4CH1A 3H90A 1L3VA 4KYZA 1XTZA 3U1NA 3RU0A 2DNKA 4F8RA 4C0OC 4FVCA 3C19A 3LQVA 4K50A 3AJDA 4Y0FA 4M5NA 3AFGA 3L9ZA 5J2PA 1HNZF 2VHGA 2I1RA 5BXIA 4LRBA 3RRKA 4PUOA 2YQ3A 1HWKA 2DXDA 4U95A 4F2SA 1N36J 2KVQE 4UOCA 3FBBA 1ZAVA 4J7CA 4DR4J 4B3SJ 1YLXA 3DFEA 4YS2A 1J27A 3HD1A 4TLRA 2KXFA 4QYRA 1VJQA 4X84A 2L9DA 2VPWB 4RO0A 2YQ1A 4YOEA 4BS2A 4F3OA 2Y9HA 1N5SA 3H42A 1WG5A 4H4KA 1HQUA 1UVIA 3DDNA 2P2CB 5E3CA 4RNFA 3OVAA 4F0MA 4KGXB 2YH1A 2HGNA 3BJYA 1B70B 4GO5X 5MAOA 2PI4A 5ITHA 3UFCX 3EPGA 2HW3A 2J0QD 3CDWA 1S97A 3Q89A 4CZCA 2AQ4A 2PEBA 5ETLA 4WE1A 2KI2A 1NBEB 3E51A 1YX2A 2BANA 3VCDA 2EK6A 4Y65A 2M5YA 2I0XA 3VZHA 1Q16B 2F4VF 2MLYA 1D8ZA 3RAXA 2GX8A 4KB7A 3R2CJ 2V68A 4XPEA 2QLJB 2AF6A 3R5BA 1RAAB 2RDIA 4WP8A 2NXEA 2BYCA 1RXOB 3QT6A 1PO6A 1FXRA 4QOTA 4CH7A 4NASA 4LBHA 3ILOA 2HHSA 4AFFA 2F1FA 3P5BP 4MH8A 4ZVUB 3LP0A 1DQAA 3OSPA 4OV1A 4URQU 1BQMB 2F3JA 4FYDA 3JB9k 2HVDA 3AA8A 2HFZA 1CG2A 1NDPA 4WP9A 3DOKB 2E5IA 1KONA 2SXLA 5KT7A 5BJRA 3ZTOA 3B54A 2RMLA 4J9UE 4I2QA 1SV5B 1N8RT 4K8RA 1JIHA 2N3LA 4AD6A 4Y2KA 2JX2A 1UVJA 1S77D 1MNEA 3MM6B 4PQAA 2KYZA 1RK8A 1RWKB 2XGQA 4DSKA 3MPYA 4NE9C 4OI4A 1YK9A 4PEOA 2G2YA 2LXIA 1IR1A 4EMDA 3M9MB 1N33F 3IA0A 4AXIA 4MIWA 4DQRA 3BM7A 1MW7A 3U1LA 2ERRA 1SH3A 1VRTB 1FFSB 2BJDA 1ZOTA 2Z57B 1JLAA 3S01A 4U8YA 5DJBA 4LRCA 3BF4A 3GFYA 4I6YA 5A0YB 5KT3A 1W25A 4K0KJ 2UXDJ 2Q6CA 4DV3J 1XMOJ 3WBZA 3HFKA 1UEUA 1HWIA 2HG4A 3IFEA 2YNFB 3H5SA 1EKSA 2CPXA 3NGDA 2PGCA 1A9NB 1Y5IB 4OI3A 1HR0F 3LP1A 1R6YA 2ZOFA 1R0CB 4KBIA 4HDHA 3FCWA 4C8MA 1RTHB 2GO8A 1VC5A 4A8KA 2XHCA 4KO0B 3BBBA 2HZVA 2ZZTA 1HNWF 2HWHA 5HQLA 1JQGA 3DKDA 1AFJA 2AJQA 3NY0A 3HX9A 1A0OB 4JI8F 2WSFC 3KFWX 1N6QB 2J7KA 5A8RB 2PDAA 4UY85 3RZAA 1OS5A 1S0MA 8ATCB 3POTA 4CLTA 1IKWA 5LXRA 5I3QA 4Y2AA 2IRYA 1VQLS 2E66A 1VCTA 1ZA2B 3DLLQ 3DC2A 4FN5A 4QU6A 5KFBA 2W24A 3E01B 4O44B 1CLFA 3RUBL 1CJTB 4P74A 4DR7F 3OR2A 5LL6d 4O4GB 2R2UA 3CVKA 1PIEA 3QJLA 2ZE2B 2AJ0A 2O67A 4PQUB 2P5VA 4NA1A 3DCAA 4ED1A 4XK8C 2RF2B 3HXMA 2RRBA 3GPAA 3K5OA 4RX6A 2IYGA 4JI7J 5CD4H 4JI0F 1SPBP 3PXGa 1QAYA 2ZH6A 4QIVA 3W7BA 1TL1A 1F3VA 4LF4J 1HKAA 5KFQA 3K17A 5EWGA 4KT0C 3CC7S 3TZYA 1KHWA 2PFDA 2OO4A 3V4MA 1RISA 1U45A 1MN7A 2V63A 3CDEA 2RU9A 5GAEU 3HJFA 3PX6A 4JYAJ 5SZTA 1WORA 2EI5A 4EZ9A 1VQSA 1FEHA 1URNA 2JEJA 2MQMA 3UDEA 1IKXA 2WHOA 1HW8A 4CLKA 4Z7YA 5F8JA 2ZBCA 4NXMF 5C5JA 1KFDA 1NHVA 2OUGA 3GYGA 5HROB 4RU9A 4O3PA 3M8RA 2RDDA 2QL7B 2HFUA 3CJ5A 3W9HA 2WRMA 4ZCKA 1HQEB 3FBCA 3PX4A 3MECB 3LANA 2BACA 4HTJA 4J9OA 4UF4A 3G6YA 1U0SA 4LF6F 3CE8A 1SC1B 1Y0HA 4KPYA 3ILLA 3MMCB 4DV5F 4E0DA 2DGQA 1VQKS 4EYIB 3IMQJ 3LWLA 2LCWA 5A8WA 2ZKTA 1KBRA 3T1YJ 1CC8A 2XZWA 1WDTA 1UJ5A 5DG7A 4UUXA 1N32F 3TVYA 5KFJA 1YDLA 2HNZA 1LW2A 2I2YA 1A6LA 4Q2LA 1AB8A 2FJDB 4JI3F 4FF2A 1VRQC 5KG2A 3OXGA 1K73T 5I42B 1HLWA 2UUAJ 4A4JA 1R8HA 4CYUA 3KLEA 5ADZA 3OXLA 3QSIA 2E5LJ 2HQGA 1BY9A 1S72S 3MAAB 1BHNA 1KRPA 1C0TA 3RG6A 2GHWA 3HSJA 2RE1A 2O01C 1HBUB 2KZMA 5L1JA 2IAJA 3WDOA 4DBQA 4DQQA 4Y2IA 3KJFB 4OX9F 3C2PA 5DM6Q 5JVGQ 4NMXA 1HI0P 1YIJS 1RT2A 1IWAA 1TKDA 4YDDB 1YJNS 1CJUA 5A6WA 3F0NA 3T41A 2PN6A 4GKKF 4HI2A 2HWIA 2UUCF 5GAGI 2YKQA 4RBVA 3QPIA 4GRSA 4M5DA 5KFAA 2YPYA 2JFDA 3JS9A 3QGIA 2IVMA 3PYEA 2J9DA 3MM7B 1KLNA 1X4AA 1U2FA 2CA9A 2VQFF 1FKPB 3MM9B 3M05A 1GEHA 4CLZA 3DRYA 4DUYF 4JP8A 2F8MA 4ZPWR 4QR0A 4J9KA 3WZ0A 3IWLA 2B4VA 2BMBA 1C4AA 3OQ2A 1IBKJ 3NEKA 3GE9A 3O1LA 2KFYA 3W2VA 2B9XA 1R8PA 2OELA 5LXYA 2GGPA 7FD1A 2DNMA 3FVYA 4ZITA 5L1KA 4K7QA 2YVSA 5D4NA 3RW7A 2ZC4A 2PA8D 3FSIA 1NJWA 5KFCA 2B6AA 4WIQA 2HMIA 1IBLJ 3JSYA 4IH7A 2JRSA 2CWXA 3ZFVA 3KLHB 2KG1A 3BSNA 3MD1A 1QDUB 2DXFA 1VQNS 2D3O1 4YHHF 2WVCA 5B08A 1N56A 3FK4A 5HN0A 4B9MA 4M5LA 4USUA 1JLGB 2W2QP 4FF1A 1LW0B 3NGKA 4OYXA 3MR7A 4C0HA 2C2DA 3HZGA 4BHQA 2DGUA 3EMTA 5K8OA 2H54B 3Q8UA 1KQKA 1QSLA 2E5HA 3JYTA 1LK7A 2MKJA 5DETA 4ECYA 2V4JA 3BZQA 1YGYA 2R7XA 3NS5A 3F56A 4A48A 4Q2MA 2FZCB 3J80U 1TL4A 2Q79A 2Z56B 3J7Z5 1LWCB 7FDRA 3CDBA 1REGX 1WF2A 3W63A 4TVAB 2DNYA 4DL5A 4A8OA 2FLNA 1Z2LA 5HANA 3QYYA 4M5IA 3MM8B 1BXNA 1H6KX 2QGFB 4MK9A 3BH7B 2HPUA 1S4FA 1S6QB 4KV8B 1QAXA 4DR1F 5CCMA 2EFQA 3EVWA 2OD4A 1XNQF 4LSLA 1UFLA 4LFBF 4GVBB 2RSQA 2ZHOA 5DLFA 1S6PB 2HS0A 2KYXA 4DV0J 5CZXA 5K8MA 4NPOA 4USHA 1LWXA 2B8PA 1VLYA 4WTYA 3ET6B 3GIRA 1ICEB 3J7YU 4CTAB 2V2VA 3DRPA 1C1BB 1SH0A 1XR6A 1WJ9A 5CYMB 2KXNB 1VRUA 4PWDB 2V2QA 4CI0B 5E0OA 2ZM6F 1UZHA 4DX5A 3WC2A 5K8NA 3MOZA 4DSLA 2DY1A 5ETQA 4FYVB 3MAQA 2IA0A 1MLAA 5CYQB 1S99A 2HEKA 2C2EA 2OPSB 3PYDA 4OQJA 4K4XA 4WFYA 3QFWA 3PRBA 2MKCA 1YJ9S 2W9CA 1U8WA 4PCQA 3AH6A 4J9NA 2QMUB 1M5VC 1AT1B 4WJBA 2UV8G 4EZ6A 3W3SA 2F9DA 2HLTA 2CQIA 4JV0A 1WSVA 2UXCF 2YXLA 4DFKA 4KHMA 1WC4A 3W64A 4I67A 3H2VE 3Q23A 1WOPA 4ZPBA 4O4RA 1KHVA 1C1CA 5A2QY 2BW2A 4KPCA 2XS7A 4M1KA 3HSZA 1HA1A 4XTTA 3R5JB 3BGUA 1PJ6A 1QJHA 4ZIWA 4EBEA 1Q79A 2WBRA 5D4LA 3GLJA 1TK0A 2QSWA 2YPZA 1ZS6A 3AJ2A 2WONB 2AJFE 1JX4A 3N5FA 4PG8A 3V4IA 3PCOB 2M2BA 3C16B 5IM0A 2M52A 2FYXA 3I87A 1LWFA 5D8HB 2FY1A 2JFKA 5K14B 2K7JA 4X64F 1UJ6A 1YBUA 2HS3A 3TOQA 2LEPA 1WHWA 4Y34A 3J81Y 2LQ9A 3J7A1 4GKJJ 1R7IA 4EFAC 2MMYA 3KJQB 2WOMA 4JI4J 2MZTA 4KGMA 4IUFA 1T3OA 3HHLA 2XBPA 3M6WA 3ONQA 3L7UA 5D4PA 3SQGA 5D3GB 3HHLD 2CQ3A 4IOAQ 4TKTA 3RBZA 3SFUA 4EU0A 2HRTA 1U6BA 2BE7D 3K89A 2RRAA 2XMMA 3TVKA 2E9TA 4ECXA 1M1GA 3FC9A 2HRUA 1RACB 4HL9A 2VD3A 3KK1B 2QLBB 4LVOP 2UVRA 1TFYA 4JV2A 1PGZA 2VB6A 4RUCA 4NXNF 3ZNUA 3VQTA 2IM1A 4B9TA 4DS4A 1P27B 4DU8A 4HVZA 1XQIA 3T19A 1B4SA 1RAFB 2C3OA 2GS8A 1HNVA 1JKHA 1F0XA 2JZ5A 2CFXA 3BPDA 1FNMA 5F8HA 4FYWB 5I3PA 2GA7A 4TQSA 3CJ3A 4UOHA 5D4OA 1V5VA 3VGSA 2WW4A 1U24A 3QRRA 2JL9A 4AQYJ 2I5JA 2G13A 3EGWB 1D09B 4HKQA 4QWBA 3Q83A 2QA4G 5GADU 2MHEA 1GK8A 2XY6A 1YJRA 4FXVA 1CS4B 2CVEA 2LQJA 1V3RA 3ISNC 2ABYA 1JB0C 1UWAA 5J1NA 1NK9A 4LF7J 1RWXB 4E2FB 5IWAJ 5KG1A 3NG8A 4NX9A 3IAM9 2G0CA 5T7LB 4N8NA 4WU2A 1HARA 4WBFA 2HVIA 4ITSA 1DTTB 2W2NP 4OYPA 4U7UD 3OUYB 2E44A 2DJWA 5KFLA 5ETMA 1EKRA 2CQBA 4X66J 1U1OA 2HQCA 4OYAA 3IS9B 4R0EA 4F4AA 4ZPCA 3AODA 3L7PA 1HR0J 4JUZA 2FC9A 2JVOA 3EJMA 4C8YA 4WWSA 2NSCA 1TR0A 1VHIA 2HVZA 2YBVA 1TL7B 5C2CA 3FQKA 4C8LA 2BUNA 5KFYA 1SCJB 3UWTA 2B3TB 1HFEL 1RTZA 3I6PA 1PILA 2NXJA 3QNWB 4OHZA 5LJ3Y 2DGTA 3I5AA 3I5CA 2YX4A 4DEZA 3HCXA 3DLGB 3BN7A 5I3UB 2IPOB 2VH7A 2N4CA 3ICLA 1X4GA 4I6WA 3CPWR 2LQBA 2H9ZA 3L3CA 2BQUA 4JBCA 5HP1B 2KFZA 4ETZA 1OPZA 6AT1B 4ATNA 4K59A 4R8UB 2B9EA 1YBAA 3TA0A 1QD1A 5IQQA 2YNGB 2KDOA 1IBMF 3H7HB 1DY3A 1SC6A 2BKNA 4KRWA 1NB7A 4CO2A 2BW7A 2W7OA 3B4MA 3OL7A 2YNIA 1NDCA 4LFAF 1RWVB 1SL0A 1SIWB 4PXDA 1TK8A 4L74A 1EARA 4RKUC 4TXSA 3M30B 2EBGA 1YJVA 3ELHA 2DRAA 2DRDA 1XMQF 5IV3A 1YTYA 3N6NA 3CCMS 1SQFA 2N82B 2DTJA 2V94A 4I56A 3PNIA 2NUUG 4TU7A 2VIHA 4ID5B 4OYBA 4C8KA 2KJWA 3MTKA 4CM0A 3GR0A 3BQ1A 1IVZA 1R8AA 2MQ8A 3I82A 1AW0A 1BQMA 2H4YB 4YR0A 2XMJA 2DB1A 1QAIA 3DNCA 5KT2A 1TTHB 3Q0AA 4DL6A 3DOKA 4PWUA 3Q24A 4C48A 5ETNA 3D7SB 5J2MB 1DBDA 1XR7A 3DM2B 1TFWA 2XB2D 1SV5A 2XLJA 4E8UA 2P6TA 5LM7E 3H5UA 3NGRA 3NOGA 2FJWA 2H5EA 3VR1A 3TO8A 2RD5C 3R8YA 1N32J 4NRTA 5DG9A 2HVEA 1FXLA 2XTJP 2E1PA 1TQLA
chains in the Genus database with same CATH topology
2UUWA 3RB6A 1M5PC 3IBWA 1NKCA 3GILA 1HW9A 3US5A 1DARA 2E5GA 1VRTA 1FDDA 1VBZA 2OKQA 1RT3B 2CQ0A 4K2XA 2XSFA 2ILZA 3PJWA 4YDXA 1Y3JA 2PMZD 1Q86T 4PXBA 1TKTB 2XCAA 3TAPA 1JJ4A 3DI6B 2QV6A 1S76D 2YWKA 3D1OA 2MQLA 3TA2A 4Z2XA 1KNZA 2ZNYA 1P1LA 3UQSA 4ED7A 1VQMS 5A0YA 4UY8T 3KMQA 4WYLA 1RTIB 3FMBA 4J9SA 3M32A 3IGNA 1SUQA 2VBYA 2YY3A 3BGRB 4HEA9 2MB0B 4PG7A 2KM8C 3VAMA 1HNVB 4G6VB 3DLEB 3KWMA 3TAMA 5JXSA 3KJVB 4Q5VA 1BQNB 4LT6A 1RT6A 1JKHB 3RB0A 2K3KA 1R43A 3QMQA 1NJYA 1N5VA 2U1AA 3T3FA 4QU7A 1RJJA 2YNFA 2UVUA 2VFVA 4QIEA 3FRYA 2EFGA 1OIAA 1YVFA 4NWBA 3OSNA 5LSLA 1D3WA 3JSRA 3I32A 4I7FB 2KT2A 4F3MA 4Q0BA 4RNNA 3VAKA 2FLOA 2BRLA 4F25A 3TVZA 2V9KA 4DR3F 4I4BA 2WSCC 2XSJB 1O0PA 4IDKB 1R3NA 1RT2B 4ECSA 3BQ2A 1N88A 1Q8BA 2BJEA 5F3TA 2RU3A 4YB5A 2F8EX 2PI5A 3R1HA 1TKXB 3MFIA 4O3SA 2EFPA 1S0OA 4ELUA 1T03A 3KKFA 2I5JB 2GMLA 5KG5A 2KXHA 5G0RB 1RTHA 1P1TA 1WELA 1T7PA 1JK9B 4KO0A 2GJ2A 2QYCA 1KS2A 1Q7LB 3GG0A 3CD5A 2ZDOA 4B3OB 2JEIA 4YQWA 4DL7A 2LDYA 5KOXA 3KLGB 2CVIA 5C42B 3MFHA 4X2BA 2K1RB 2O3DA 2UVWA 1WEZA 3NNCA 4FP9A 4NZ0A 3SSSA 2NYIA 4EGLA 2AWZA 4RBTA 1FRLA 4W92B 2CG4A 2UV8A 3GV8B 4QYZJ 3I31A 5E3AA 1KOHA 3QWUA 5D77A 3ZZYA 5F8MA 5DDPC 4DSJA 3M8PB 3BB5A 3HF5A 3C3LA 4PPDA 5DRKA 1X0FA 4UQTA 1RDRA 1ZM9A 5CZVA 3VAJA 5DDOC 1F5AA 1N6QA 3H5XA 4CTAA 4FNHA 1SIZA 5A8RA 4NLGA 1REVB 1L3KA 1NZAA 1R31A 2IC3A 4C2MA 5J2NA 3QIDA 3T1AA 3M6XA 2NXUA 5AXKA 1G3OA 3H98A 3DU6A 2DR9A 2F8HA 1EP4B 1AROP 5CYMA 3G6VA 4G1QB 2CJKA 5SUHA 5F8NA 2KJVA 3LOUA 4CO5A 1TAUA 3DYAB 1ELOA 5CCLA 1SB6A 1VK8A 4DR5F 1NJIT 3MR6A 1T95A 1Y3KA 1NHUA 3IR6B 3OPKA 3G6ES 2IVYA 3VAHA 3V81B 1VIXA 3QIPA 3I0SA 1QE1B 4Y00A 1TVRA 3GG1A 2E29A 3E01A 1MU2B 5KFVA 1CEZA 2K2PA 4O44A 1UA0A 3ITHA 4O4GA 4BC9A 5CH7B 2GHVC 1PC4A 3N79A 4CT8A 3NNAA 2D3UA 1H0HB 4DWIA 1IJFB 2ZE2A 3B4DA 4ES3A 2BA9A 1RTJA 3CCLS 4Q44A 2OSRA 3M1VB 4QWDA 4PQUA 2CZ4A 5M2UA 3CUNA 4NLXA 3KLIB 5KG0A 1RI7A 2C3UA 5KT5A 4TU9A 2ZH4A 3NS6A 4DN9A 2RF2A 4F4YA 2WW8A 1CQMA 3AB2B 1WWHA 1RQ0A 1S1UB 2OSQA 3H2UB 5E7OB 3QJPA 3LAKA 3BR9A 2PIIA 4CNYA 5M2RA 2AYBA 2HNYA 2KKHA 2VPXB 1S1TB 5DDRC 4X65F 4IOCQ 1GXUA 3BSAA 3LF0A 4W90B 1HMVA 2DH7A 2AV5A 1JJ2R 2XHWA 3CEDA 3T6BA 1S1WA 3QJJA 3UCGA 3RAMA 2VC1A 3PVXA 2HGLA 5F9NA 3SV4A 1VQ7S 3A8EA 1SXLA 5DLGA 2M8DB 4LF5F 5AE3A 2YKNA 2W8KA 1FDBA 2D7SA 3G71S 3GZ7A 2FJXA 2HS4A 1FJCA 2EG2A 1S1VB 2GMHA 2VG6B 2QA4S 2ZBIA 3PACA 3FDSA 4KTQA 4CH1A 2ZC3A 1L3VA 4AYBD 1XTZA 3U1NA 1KLMB 4F26A 3RU0A 1H38A 1K0VA 4IFYA 5L9NA 3AHPA 2DNKA 2FHMA 4C0OC 4F8RA 4FVCA 1NK5A 2QIFA 1P9QC 2DNLA 2HFNA 2LMIA 3LQVA 2IBKA 4K50A 2FVCA 1T02A 1HWJA 4DG1A 2RKIB 4C8OA 4ALZA 4Y0FA 3O44A 2EK1A 3EXYA 1H2TZ 3E8OA 3L09A 4DFPA 3TANA 4IRDA 5CHCB 5KFRA 2XGPA 4C11B 2FVRA 2NQPA 4ICLB 4DV7F 2OPPB 4IR9A 3CULA 5J2PA 1HNZF 3W2WB 1VQPS 3G8SA 1JLFB 5C24A 2DHAA 2I1RA 4DJBA 2CPHA 2VFRA 3MCSA 3DN9A 1ZZNA 3RRKA 4PUOA 1RA7A 2YQ3A 1HWKA 2I8EA 1JLQB 1KC8T 4F2SA 4YB6A 3ZZZA 4RW4B 4NLSA 3GQCA 1ZBTA 4UOCA 4OJGA 1ZAVA 2QT7A 4YR3A 4C8ZA 2B7CB 3DFEA 4ZS6A 3DOMA 4F4ZA 3H4DA 1APSA 2CKWA 2V2KA 1C4CA 2XCPA 5I4MA 1ZPWX 4JI1F 4TLRA 2CPDA 2KXFA 3M4XA 1Q4RA 3N4WA 3V6KA 2MQOA 1TKZB 3BR8A 5FD1A 2QA1A 4QYRA 4X84A 1YHQS 1UMJA 2DIVA 4O0IA 2L9DA 2VPWB 5B7WA 2KB2A 1N5QA 4YOEA 2BQ3A 4BS2A 3KHGA 5K5MA 3PR5B 5HROA 4F3OA 2MJUA 1OWXA 2HLUA 3PW7A 4D3GA 1N5SA 1WG5A 4H4KA 5F0UA 2IA6A 3NCPA 2DGOA 1XMBA 3CCUS 1HQUA 1X4CA 5A8KA 1P8GA 1HQEA 1DFDA 3OVAA 3DDNA 5E3CA 4RNFA 1UVIA 2PA3A 5K14A 4ZHRB 1R89A 1F5BA 5CYJA 2B9YA 3MECA 3KHRA 2YH1A 3ZZTA 2PEHA 5DG8A 1H2UX 2HGNA 2R8KA 3BJYA 2FJBB 3UR3C 4GO5X 3FEZA 5MAOA 1S9GA 2PI4A 2Q43A 5ITHA 4M95A 1V3SA 3FFIB 4FS1A 3UFCX 4NLPA 4CIOA 3PZPA 2MZJA 2JJ4D 1ZTWA 3ZZPA 3EPGA 4WXWA 2B4UA 2HW3A 3MEKA 2J0QD 2DGWA 3MMBA 1GX6A 2R8IA 4U7UK 2DK2A 3CDWA 1T8EA 1OSCA 1S97A 4CZCA 2AQ4A 4JI5F 2L9NA 2VG7B 1LWEB 4AL6A 2DH8A 3MPVA 1I94F 4F02A 1TZ0A 2XWYA 5T41A 5JVHQ 2W7AA 4TLQA 4DL3A 4WE1A 3MMCA 2Y1IA 4K4UA 2Y1RI 1T3NA 3CSKA 3R3TA 2KI2A 3E51A 4X4OA 4FNIA 3M9OB 4JI2F 2BANA 2Q3PA 2EK6A 3VCDA 2B4PA 3T5JA 2J6UA 3N6MA 4Y65A 3NAIA 3C6UA 2M5YA 2I0XA 3NBPB 3ZZ0A 2FJEB 2E7XA 3VZHA 1Q16B 3OTCA 2RQKA 3GYNA 5KTQA 1IKVA 2DCUB 1WACA 4HT7A 3CCSS 2F4VF 1D8ZA 3QO9A 3RAXA 2GX8A 4KB7A 2IFXA 4A8WA 4XPEA 2QLWA 3THPA 4QCLA 2AF6A 1VS3A 3CD7A 1SJFA 2LU2A 3R5BA 2QEXS 2RDIA 1TK5A 3NNHA 2R7VA 1QLNA 5I42A 2BYCA 4KKOA 1FK9B 4JOUA 5AE1A 1UA1A 5KAKA 2JDJA 3CDUA 2R8GA 1PO6A 1NH8A 1FXRA 2WAQD 2PC6A 4QOTA 2MGZB 4CH7A 2R2SA 2IMWP 4B3RF 3NL0A 2CDQA 1NKEA 3EZUA 1FRIA 2HHSA 4ECRA 4CO0A 4PPZA 4EUVA 2QMXA 4AFFA 2F1FA 4IG3B 1CVJA 2RUGA 3GYXB 4MH8A 1JWWA 4YP3A 5J1EB 4D3HA 3R5CA 4U6PA 4H4OB 2GQ2A 3LP0A 4C0BA 1DQAA 4FBTA 3D2WA 1FRXA 2P9CA 2XG8A 3OSPA 1BGXT 2XNRA 4ZP8A 3EXCX 4OV1A 2AP6A 1BQMB 1HD0A 2F3JA 2LVWA 3MF5A 4URQU 3UI3A 2E1CA 4FYDA 5KFSA 5F8IA 2V0NA 2R8JA 4QWAA 3KMSA 5EWFA 3BDPA 3PHEA 2YWHA 3JB9k 5IFMA 1HWLA 1QTMA 3AA8A 1HBUA 3LO3A 3CB4A 2J5AA 2HFZA 4Q45A 3N28A 1VRUB 2MZ1A 1T05B 4DQSA 3RR8A 1CG2A 4ZP6A 5H9EJ 2A2CA 4RNHA 5IT4A 1TL5A 1VBXA 3I96A 4AUKA 3PRDA 3PFOA 4UUWA 2J9EA 1GAOA 1MWZA 2PSZA 3DOKB 3UE2A 2ZJRQ 1VGYA 5C25B 2E5IA 1KONA 5F9LA 1RT5B 3GIKA 3U27A 2BXJA 2JSXA 3L95X 3V5RA 3VAFA 4DFJA 3H5YA 2SXLA 5KT7A 3OLBA 5BJRA 2J6SA 4QIGA 3I5BA 4NRUA 2DNHA 2E9ZA 4J9MA 4ILLA 5EDWA 4DSIA 5DS7A 2RMLA 3SXLA 1RYRA 1UVKA 3CGIA 4KC5A 3BEGB 2W9BB 1HPZB 4X4NA 2OPQB 4I2QA 1N36F 1SV5B 1N8RT 2CPJA 2DNOA 1JIHA 2N3LA 4DR4F 4Y2KA 3OL9A 2JX2A 4B3SF 2BE2A 1UVJA 1S77D 3SEOA 1MNEA 4B3MF 2J0XA 3MM6B 1M5HA 4N56A 4PQAA 4RW7A 2KYZA 2D3OR 2N3OA 1RK8A 4PR6A 5KFWA 3JSMB 2XGQA 2VASA 3RYLA 3SCIE 3LP2B 4K5SA 1UEVA 3JTNA 4DSKA 3MPYA 1D1UA 3U7JA 4KAIA 4OI4A 1H7XA 3DRRB 5E3QA 3DRXA 4KFBB 3DU5A 1YRXA 5J1PA 1RA6A 1YJTA 2DPJA 5KOWA 1D9AA 2BM1A 2LXIA 3M9MB 1N33F 2YKMA 3IA0A 3MM7A 4AXIA 4QBUA 4HDGA 3V6DA 3K57A 4MIWA 4DQRA 3BM7A 1FE0A 5B0CA 1V9OA 2X1BA 4WK1A 2GQQA 3Q8SB 1MW7A 1VQOS 3U1LA 2W9AA 1SH3A 2ERRA 4X4UA 2XI3A 2ZD1A 1VRTB 1FKPA 2ROGA 3MM9A 1R0AA 1QUVA 2J0WA 2BJDA 3UDCA 4OZ0A 3ZC4A 3PW5A 2E1MC 3MEDA 1ZOTA 5IZHA 2VONA 1VC6A 1JLAA 1ZM2A 3S01A 4V19X 4KQZA 4WFBQ 5DJBA 4O3RA 3HVWA 3BF4A 4DS5A 3KK3A 3GFYA 1T94A 4I6YA 5AXLA 5A0YB 5KG6A 2VFUA 1VHFA 3M32B 1W25A 5EHHA 5KT3A 2Z8QA 2Q6CA 1SUQB 2DCLA 2RH3A 2CQGA 4IO1A 3TAMB 1VQ6S 4OHWA 1JMTA 2XMKA 3WBZA 4AE5A 1KEKA 3HFKA 1UEUA 1B7FA 1HWIA 2HG4A 3IFEA 4ED0A 4LSNA 5BYQA 1RWUA 1PSDA 2YNFB 3A1YG 1U7LA 2ROEA 3H5SA 2ZUGA 2CJBA 4DV2F 2AYEA 1JLEA 3QZ7A 2CPXA 3RB3A 1J2VA 3NGDA 3G6XA 4IH5A 4XDCA 5LMUF 1GTEA 2OFGX 2PGCA 1OO0B 2QSFA 2GJIA 1A9NB 4U7CA 4K4YA 2X3GA 4MKYA 2KH9A 1UFWA 4WZQA 2LA4A 1Y5IB 2WK4A 4OI3A 4ED3A 1HR0F 2B51A 3LP1A 4KHPF 1GTHA 1R6YA 2ZOFA 1T03B 4KBIA 1YJUA 4HDHA 2XO7A 1CSJA 3LPYA 2AGPA 4TU8A 4C8MA 1RTHB 2GO8A 1VC5A 4A8KA 1X0PA 2VKZG 1U2RA 4KO0B 3BQ0A 2NREA 4KE5A 1HI1A 3J7YI 4G1PA 2KU7A 4FPRA 1HNWF 2B7BB 2XLIA 1JLBA 2B43A 2OLWA 4ILMA 2HWHA 4NLVA 2FUG9 1AXQA 1G2EA 4RNOA 2DNNA 4C98A 1AFJA 5EN1A 3GFXA 1DLOA 2AGOA 2AJQA 1QAJA 2OP5A 3DHWC 3HX9A 3KLVA 4QW9A 1RKJA 2HHHF 3OL6A 1TP7A 3C8YA 2VZ9A 4JI8F 3KLHA 2WSFC 1XEZA 1U25A 3KFWX 4CH0S 1N6QB 4J9RA 2NPFA 3J7ZT