3EJMA

Crystal structure of the mimivirus ndk +kpn mutant complexed with gdp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 39
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3ejmA00
4ANDA 1XIQA 1ZS6A 1NDPA 3PJ9A 3R9LA 1K44A 3FBBA 4F4AA 3ETMA 1HHQA 3EVWA 2HURA 4ANEA 1NDLA 5IOLA 3FKBA 1NSPA 3PRVA 3DDIA 3G2XA 1NB2A 3NGRA 4DI6A 1BHNA 3ZTOA 2AZ3A 2DXDA 3EJMA 1WKLA 1F3FA 3VGUA 4F36A 3EMTA 1NPKA 1F6TA 2B8PA 1BUXA 3FCWA 3NGUA 1LWXA 1B4SA 2DXFA 3ENAA 3L7UA 3MPDA 2BX6A 3NGTA 1NUEA 5CAAA 3Q8VA 4UOFA 1NDKA 3ZTPA 4UOHA 2HVDA 3NGSA 4ENOA 4DUTA 3Q86A 3FBEA 2DYAA 1S59A 1NCLA 1XQIA 4HR2A 1JXVA 4C6AA 3VGTA 1B99A 3FC9A 1MN9A 2VU5A 4FKYA 3Q8YA 4W98A 1BE4A 3JS9A 1NSKL 3Q83A 1WKKA 4O0NA 1S5ZA 1UCNA 3EVOA 3B6BA 3ZTSA 2B8QA 5CABA 2AZ1A 4S0MA 3BH6B 1S57A 3ZTRA 1NSQA 1MN7A 3WX8A 4KPCA 3VGSA 3GP9A 4DZ6A 3BBFA 1NHKL 2NCKL 4EK2A 5BXIA 1HLWA 2ZUAA 1KDNA 1HIYA 2HVEA 1PAEX 1W7WA 1WKJA 4UOGA 3FBCA 3VVUA 1EHWA 1NLKL 3B54A 3EM1A 3ELHA 5C7PA 3Q89A 3Q8UA 3EE3A 3GPAA 3VVTA 1VYAA 3EVMA 1U8WA 2CWKA 3BBBA 2BEFA 3EICA 1LEOA 3VGVA 2DXEA 4FKXA 4WBFA 2DY9A 4CP5A 1NDCA 3ZTQA 3BH7B 3BBCA 3FBFA 1PKUA 3FCVA 3DKDA 4ANCA
chains in the Genus database with same CATH superfamily
4KB7A 1B0PA 1V3RA 2XMVA 1YSJA 5C42B 1REVA 3PHEA 3RAXA 2MPUA 4V19J 2HQ3A 3JXOA 1FFSB 2E1RA 3FCWA 2YWEA 3PYDA 4DV4J 2NLWA 3ZZ0A 1FVQA 5DM7Q 5E0OA 1FK9A 2KG0A 2QZ8A 4JI0F 4M5IA 2UXBJ 1JQGA 1FX4A 1Y4ZB 1DLOB 1BC6A 1NSKL 2VC1A 2XGPA 1FJGJ 2DNGA 1IWGA 3KMSA 4ECQA 3T9ZA 2JEIA 3TUPA 3AB4B 4K5RA 3M2RA 1JMTA 4OI2A 4ZPDA 3CJ3A 4EYHB 2AP6A 3HVRA 3FMWA 3QGIA 4DR1F 2NQPA 4EUVA 3MEDA 3ET6A 3R5AA 1LEOA 4NI2B 3GG0A 3T1YF 1XEZA 2Q3PA 5D4PA 3HZEA 4KE5A 2FY8A 4X4PA 3MR5A 3C8YA 1RYSA 3GV7B 4I4BA 3TVZA 4Y2CA 1NDLA 4G1IA 3W9HA 1O51A 5BJRA 4LRBA 4OZ5A 3S1TA 4BHQA 1CULB 4Q2MA 2W2NP 2QLJB 4CM2A 4QWDA 2DISA 1Q16B 2IY5B 4TVAB 2MB0B 2BA9A 3R5DA 2YNIA 1RT7A 4W4MA 1OS5A 4DV0F 3GU0A 2VUGA 2MKIA 3KJQB 2VJVA 1FESA 2MDAA 1SH2A 4PWDB 3MR2A 4R0EA 2ZH3A 1YK9A 3G6YA 4CLTA 1BWEA 1HNXJ 1TAUA 1K0VA 5HROA 5LMNJ 1FNMA 4NLWA 4AD6A 2DNQA 3U1MA 5F9LA 3GIIA 1WG1A 2HNZA 5KFVA 2QYGA 4NZ6A 2I6WA 1FVSA 1XNQJ 1FWPA 2YNFA 4N47A 2BW7A 1R0CB 3LP1B 4LFCF 3JQKA 3UDCA 1UEKA 3MEGB 2O3DA 3SDEA 3UDEA 2UUBJ 3E8OA 1FDDA 1YJUA 2DNNA 2B9YA 5M2PA 4LSZB 4WIQA 1L3SA 4UW2A 2IDEA 3AOBA 1AYEA 1I3OB 1RBOB 3MCSA 1NKBA 4X4NA 3RTVA 2VBZA 3EGNA 1LW0A 2MGZB 1R0AB 1SI9A 1QM9A 4RJVA 2WOMB 3X3UA 3UWTA 4KV8B 1T11A 3WC2A 4J7CA 4H4OA 4IG0B 4ED5A 3PYFA 2ZH6A 4EGLA 3P8BB 1RT3B 3RBZA 3GYNA 5IWAJ 2MZRA 4WK1A 2RDJA 3POTA 3JTPA 2D69A 1IKYB 3M6XA 5JVGQ 5EUHA 4KSEB 1TKTB 2W8LA 2QFIA 3U27A 4MT1A 3GMGA 4FF4A 2PE8A 1VCTA 5D78A 3PKMA 4WE1B 2V63A 3DGPA 1U1NA 3DRPB 4ZLPA 3KG0A 3RRHA 1UW4A 1RTDB 2BOAA 2VOPA 3SSSA 1RWXB 3EXYA 1XMQJ 3MAAA 2QLXA 3TX0A 1EARA 4FN5A 4F04B 4QCLA 1JLQA 3C66A 1SUQA 1QDUB 1RWMB 1IM6A 2AJ1A 4F4ZA 2PN6A 4DL0C 3JB9k 1VC0A 3KJVB 3CMAS 2ZZNA 4Q8FA 2ZUGA 1ZAXA 1X4HA 4UOHA 4ED0A 3ILOA 2GX8A 2OSRA 5D15A 2ROGA 3NGDA 1T9TA 1B64A 6FD1A 4WU2A 2RT3A 1JKHB 4KGZB 4Y00A 3HT0A 4RW7B 3T1HF 1S1VA 3VR1A 5DDPC 1VLYA 2QEXS 1TL7B 1KLMB 2CVEA 4ZLNA 2IRYA 2B4PA 4HHUA 4UOGA 4LF6F 3KMQA 2BRKA 3BKUA 3O44A 2PT0A 4M5HA 1LWEB 1NK0A 2MZJA 1LWFA 2BR0A 4KGKA 3VZHA 2VDHA 3J7A1 3OUYB 3PJ9A 1VRTA 2IJRA 2LXFA 2OP5A 3NMAA 1SXLA 4YMEA 1AB8A 2ACMA 2MKCA 5AJ3J 4DSEA 1FT8A 1H98A 2J8SA 5EWFA 3EJMA 4MKAA 4DCOB 2VONA 2O01C 2D9OA 1U47A 3GYGA 2AEMA 4DMZA 1NO8A 1HW8A 1ZM4A 4HHHA 5I3UB 2V68A 3LAMA 4RBUA 4W90B 4ILLA 3N4WA 3Q8YA 4FYVB 2AEJA 1IR0A 2W01A 4LFAJ 3EGVA 1JK9B 1Y5NB 3QFHA 4DSKA 3A3PB 3BREA 3NWGA 2M2BA 3PW0A 3D28A 5C42A 4FPRA 4U8VA 4J9QA 2O1PA 1TFYA 4X4VA 4I2QB 4YEAA 4URQU 1BQNB 4WFNQ 1VDHA 5KFGA 2I2YA 4OYBA 1FTRA 2E5IA 4I2PB 2V34A 3OD2A 5IOLA 1DLOA 3PRVA 4P75A 5CYJA 1HR0J 4IG3B 3DGVA 1WORA 2A6MA 1IBMF 2AWZA 1Q5YA 2UXCF 2A6OA 1LW2B 3M8PB 1N0UA 4C0HA 3VAFA 4FVMA 1Y9OA 1VRUB 2E5GA 3VQSA 2HZAA 2J9DA 1RWKB 2RU9A 3IBFB 3UPFA 5A8RB 1R6YA 4NI2A 2RQCA 4PG7A 3KK2B 2MZQA 1DBDA 1TQLA 3KNAA 2P6TA 4IKAA 2BJEA 1U1QA 3PNIA 1W7WA 1CULA 3AQOA 2M52A 4DJBA 2CNKB 4LJMA 5CQGA 5IM0B 4ZVUB 4DUZF 3W5ZA 5IZHA 4ILRA 2V9KA 1RT6B 1Q82T 4ANCA 2UVWA 3A3NB 3ISND 1PC4A 1SKSA 2KFNA 1BXNA 4DXLA 1NEEA 4PWDA 1HNIB 2A2DA 4DV6F 7FDRA 3CUNA 1FX2A 1WKLA 2QA4G 4IO9Q 3F56A 1RWUA 4NXNF 3KLGB 1EAYC 3TI0A 3OR2B 4OJHA 2J6TA 2E9RX 2ZOMA 2KTQA 2QLWA 4C2MA 3LP1A 4L3NA 4U95A 3NNCA 4MAKA 2FVRA 3MEGA 1P1TA 1Q7YT 1T03B 2YKOA 3DLHA 2WCXA 2OPSB 1FRJA 2PMWA 8ATCB 3RR7A 1LNQA 4JI2J 5CYQB 3K5OA 3FGVA 3R6GB 2QFJA 2M0GB 4O0IA 2ZE2A 3H5SA 4ECYA 2MGZA 1R0AA 5KG2A 2E9ZA 3UNGC 2V94A 5HI7A 5GAHU 2POKA 2WOMA 4LRFA 4KV8A 4ED6A 3IM9A 4IG0A 3LWMA 1RT3A 2DHSA 4BDPA 1S9FA 1F3FA 1IKYA 1L3TA 3KHGA 3ILLA 3OHAA 4CH1A 5LMUF 4DQIA 5C24B 4N7TA 1Q8KA 2AIRB 4KHPJ 4FF2A 3CIMA 1ZAVA 3MEEB 4USKA 1ZZNA 4KIAA 4B3MJ 1R31A 4WE1A 4U96A 2BKOA 2G0CA 3ITHA 3RYLA 3DRPA 2VFRA 3QMQA 3R97A 1UVNA 3M8ZA 2QMUB 4RUBA 2ZM6F 4GO5X 1NK8A 3IC1A 2R8JA 4D3GA 1IKWB 3OQ2A 1Q7LB 5B0EA 4ZA1A 4ZVFA 4PCQA 2ADCA 4P2MA 5H1SV 1TKDA 4ZP9A 5LSRA 5DRKA 4DR5J 1OY8A 3KJVA 1QTMA 2MLXA 4TQSA 5DG7A 2MQNA 1Q4RA 2PEBA 2EG2A 3EVWA 3BSNA 2RMLA 3OT9A 3C16B 1DFDA 2RDDA 1JKHA 3TRGA 4RW7A 2EFPA 3TVKA 4HT5A 2OFGX 3IM8A 4U7CA 1X7VA 1M0SA 2BX6A 1TL7A 1VK3A 2VBXA 4LQ3A 4CO5A 3WHIA 2P9GA 3AA9A 1KLMA 1QVGR 1WG5A 4OYWA 4X4RA 3JTNA 5IS2A 5J1EB 3G6VA 1U1PA 5KFCA 4FF1A 3RUBL 4RU2A 2XMUA 2UV8A 1UPMB 5H9FJ 4DFJA 1LWEA 4YHHF 2W8KA 3IGVA 4HI1A 1DY3A 5JXSA 2YTCA 4M8LA 1B7FA 2VA3A 1HD0A 2FJVA 1GH8A 2P9EA 1HFEL 2V4JB 2ZJPQ 2H3EB 1RA6A 4ZPTR 2JHEA 4CQ1A 4TN2A 1S6OA 5IT9Y 4EWTA 2A1BA 5I3UA 2E1CA 3CCVS 2IBKA 2OHDA 5T14A 5I42B 1WELA 1H2VZ 1JJCB 4Q7AA 2XEXA 3U1NA 3DXSX 1SQEA 4N76A 5E7OB 3ENQA 5EGYA 1URNA 4QWEA 1R3NA 4TU9A 4C8YA 5GMDA 3M9NB 4K2XA 2ZKUA 4IYQA 4KQZA 4O44A 2IC3B 2HQDA 2ZBQA 3Q2TC 4I2QA 1AA1B 1FF2A 3KUGA 3P49B 1BQNA 3GWCA 4RLEA 3PRBA 3LGMA 1WF1A 4YB7A 5HMXA 4D3HA 2KO1A 3PX0A 4G1QA 4OI1A 1PILA 4I6WA 4B3SJ 1H7WA 2ASJA 4IG3A 1RUSA 1EZZB 5RUBA 2ZJRQ 3GB0A 1N34J 1NB7A 5C25B 1LW2A 2PFDA 2XWYA 4NZ7A 2WSCC 4TY9A 1R8PA 3M8PA 1LFPA 4F4AA 4NYZA 1VRUA 2XM3A 3NCPA 2WBMA 2FHKA 3RR8A 1RT4B 2CPFA 4I69A 2W4CA 1UP1A 5A8RA 4R5PA 3M8WA 2R9LA 1QAYA 2LCWA 1RLDA 3MPDA 1PYTA 3VCDA 3KK2A 2CDQA 2HGMA 4USUA 3DLEB 4F0HA 4A8KA 1KS2A 4GKKF 2C2KB 3PIPQ 3H4DA 2DVIA 1S9EB 5FLXU 5DQGA 3I32A 5IM0A 1U7LA 4IRDA 4RBTA 1FO1A 2QJ3A 2V8VA 1YX2A 1RT6A 4N8OA 4CIOA 1KFDA 1X8DA 2F4VJ 4RW8B 3UDVA 2CKWA 4DG1B 4JUZA 1HNIA 2JSXA 4WWSA 4ZMMA 4GKJJ 3CSKA 1ZH5A 2JFDA 3NCQA 1UZDA 3KJNB 1N33J 3H7HB 3MCNA 4N5SA 4F4WA 3MECB 4NEZA 4NMLA 4JI6F 3NAIA 3KLGA 4F2RA 3BH7B 3OR2A 4C0BA 1DTQB 4AQYJ 3D66A 2WTFA 1UJ4A 3MI7X 1NPPA 3GIMA 1S6PB 3BSOA 2HZCA 3QPIA 4PG6A 3KDOA 4F3QA 4DS5A 4OYPA 1T03A 3N5FA 1TKZB 2OPSA 3OTBA 2JDJA 1SC1B 5KFXA 3NS6A 3FBEA 3IWNC 1XR6A 5CYQA 4JI1F 3O2IA 4OIXA 4NA2A 5B0DA 4ZJQA 1HNWF 3D0IE 2NZCA 3JSMA 5LXYA 3RB0A 4I56A 5HJXA 4JI3F 4DR7J 1WHXA 1YDLA 4CLSA 3ZTSA 1RTJB 5D4LA 2W4DA 5B0CA 2VC0A 1VQLS 3S7RA 3HX9A 2K8GA 3RG6A 3VZIA 1KTVA 2AX0A 1WTBA 2V4QA 1RT1B 3NY0A 1TL1B 3PW2A 3A8IA 2ADBA 2AV5A 2HFOA 3HF5A 4DFMA 4NL5A 2VODA 5C24A 3CDBA 2OGUA 5LSLA 3OL9A 3FEXB 2V8DA 4LRCA 3UD3P 5J2QA 3MEEA 4LF1A 3BDEA 2DIUA 4HVZA 5BR8F 3IN5A 2RDIA 3FQKA 4OZ1A 2DGUA 1IN0A 2EFQA 1IKWA 2LEPA 3MR6A 3B4MA 2K3KA 2Q1LA 2LXIA 2W2QP 3EDQB 5IQQA 5E3QA 3IR5B 4OYZA 2HFSA 5E41A 4OX9F 3OTOJ 3GZ7A 3IGNA 4XIUA 5CABA 6FDRA 1PCAA 2OMLA 1F2HA 4NZ0A 4F4XA 3C16A 1Q78A 5HLFB 2P9CA 2KI2A 1U0HB 2Z8QA 3VVTA 4FF3A 3MMJA 2OSQA 2VQFF 2B9XA 1GMWD 1RKIA 3ULHA 2YH0A 1G1XA 2E44A 2R2RA 1A6LA 4C0OC 2CPXA 3CJ8A 2ZOFA 4O3SA 3R3TA 5J1EA 3J81U 2VHGA 2HURA 3ILIA 3B82A 3QIPB 1S0MA 1VMBA 3W61A 2XSJB 3ZTOA 2AZ3A 3QIDA 3DRRB 4WKRA 5DQIA 1RWPB 3PEHA 4DHVA 3F0NA 2EPIA 4NRTA 1C1BA 3X1LB 1LWCB 1X4EA 1FKOB 1NK9A 4K4ZA 4I6YA 2C3UA 3WDOA 1L3UA 2V4JA 3MWBA 4X4OA 2MKSA 3SYZA 4DBQA 1MROB 3TUIC 2LU2A 2ZITA 3O1LA 3CJKB 1XNRF 2PGCA 4OLOA 4KJIA 4FVCA 2CZ4A 1M5HA 1GXTA 3W9JA 3MEKA 4WKYA 5I42A 1S0VA 1CC8A 2M88A 2ZC3A 1PAEX 1O6XA 3MR7A 3Q8UA 1XMBA 4MKBA 1TVRB 3LP2B 1D0EA 3D3BJ 2D3ZA 2X3DA 3PKYA 1CJVB 4OZJA 4OJ1A 5THWA 1F3VA 1QSSA 2IC3A 2BQ3A 2KRBA 3H20A 4LIWA 4FXVA 5L1KA 2UUCF 2MJUA 1FRIA 1TAQA 1VJWA 3SZ2A 3QYYA 4UY8T 3PRDA 4YDXA 4YY3F 2HBQB 1RCXB 2CPIA 1AUSL 3G9CA 3I31A 4ZP7A 5A6PA 2BABA 2GV1A 3VAIA 4CRJA 3VGTA 3N6MA 3HCXA 2AT1B 3TJAA 4Q44A 1YITS 5C25A 1M5SA 3B6BA 3TANA 5ETNA 2MLZA 2DNMA 1SKUB 2AHOB 2YKQA 2PMZD 1KQSR 3TVYA 3KKFA 3MD1A 2DH8A 2LVWA 1U1KA 3TQ1A 1RT4A 1XN9A 4O3NA 1Q95G 2YNHB 3FBCA 2P5VA 4ILMA 2BBEA 4K7QA 1VQSA 5LOQA 2HFZA 1JJ2R 3OL8A 3H5YA 2HK3A 2MQLA 1HNZF 4GRSA 3N6LA 3PO4A 4CO0A 2WHOA 4ZPBA 3QSYB 3DLEA 1SH0A 4KY3A 2DKOB 3H0PA 1SCJB 1S9EA 4E0DA 3UW1A 4LT6A 4HL9A 2CIMA 5KT5A 2JC0A 1S9GB 3THPA 4DV5J 1BQXA 4RW8A 3QRQA 3H90A 4C8LA 2P6SA 4DG1A 2N7YA 2XZWA 2ZWPA 1JNZB 1RWNB 3PG9A 1NCLA 1A0OB 3KHLA 1LFWA 4ZVTB 2R3VA 1KP6A 2NYIA 3MECA 2XMKA 2KZMA 1KNZA 2M3DA 1T02A 3EXCX 1DTQA 3CULA 2IVFB 5ITHA 5EWEA 2CVIA 1HI8A 3BBFA 4B3OB 1S6PA 3HFZB 3AXKA 4B9MA 1UA1A 2XMAA 4IQXA 2YNGB 1U6BA 1TFWA 5F8GA 5EX0A 4ICLB 2UXDF 2HHWA 1NKEA 2OEJA 1TKZA 3BKFA 1OO0B 3SCJE 1XR5A 3L95X 3LUYA 2OI2A 3J81j 2VG6B 1BMQB 3CC7S 4CLFA 2C2DA 1R6VA 3TZWA 2HBYB 4LF8F 1HD1A 1B0TA 5BYRA 4JI8F 2FJWA 4DR2F 3W66A 2QL7B 5GAGI 1RTJA 2YVSA 1LWXA 2B4OA 1RT1A 1TL3B 4C8OA 3IP0A 4C98A 3R5JB 3QZ7A 1UVIA 3QZ8A 1NU4A 1URRA 2VL1A 3NBPB 3HZGA 4J91A 2CJQA 4MIWA 4N8NA 2GQ2A 2C2EA 3CD6S 3OR1B 1Q5VA 2BVZA 4C3MA 1H0HB 1DHMA 1VIOA 5F8JA 1H72C 1U4BA 5GADI 5T41A 4OYAA 2G2ZA 1CS4B 3EICA 2OH2A 2BE7D 2HMIB 2IRXA 2C3YA 3N0VA 2D9PA 4BWJA 3GCXP 3G4SS 1VQOS 1OPIA 3GQCA 2XLIA 3G87A 2F8MA 1DAXA 1WACA 2OTLS 2QL9B 2P8IA 3SIPB 4Y3CA 2ZOGA 1VBXA 2G9OA 1T9XA 3ENAA 2J9CA 1GX6A 4CYUB 2BJDA 1ZA1B 5KT6A 4ZP8A 2DYAA 2XSFA 2WVBA 2B9EA 3OSNA 3BQ2A 3J7YU 4DV4F 1U0HA 2C2RA 3JSYA 4FNHA 3DI6B 4P6QA 2ILZA 1J5EJ 4ZIVA 1CQMA 3ZZRA 2E7XA 2UXBF 2E1MC 3GJSB 2FQQB 3M6VA 2YPYA 5B0BA 1FJGF 3QIPA 4CH7A 4XO0A 5KT4A 2XSJA 2Z2ZA 2E7VA 3DRRA 1RXOB 3V6DB 4BS2A 2YWGA 3VTIA 4B9SA 1M5OC 4NLSA 1M1HA 2RUGA 1LWCA 1HBUA 2B5JB 1FKOA 2AYBA 1CG2A 3D67A 1B3TA 3OJSA 1F60B 3EZ5A 3LF0A 2HNDB 1MROA 3GYXB 3KUHA 4ECVA 3D6TB 5F9NA 3CJKA 1FD2A 1HBMB 1R8AA 2VG5B 5DDOC 1N32F 2ZH5A 3W64A 1S77D 4KBIA 2B6AB 4L6V3 4HR2A 2OPQB 2RRBA 1C1CA 1TVRA 3LP2A 2XS2A 2UV8G 2XYHB 4A8SA 4GVBB 1VQ7S 4IOBA 2CG4A 4FYWB 2UVVA 1NHUA 1JLBB 2W1BA 4R8UB 5KFUA 3WX4A 5E3RA 1CJVA 3CE8A 3UD5A 2QN6B 1HNXF 2CJ9A 2ZH7A 4DV2J 4ZLLA 5LMNF 2DGTA 2K1RB 4JBCA 4B3RJ 3BM7A 2RQ4A 4HH0A 1XNQF 4ECZA 1HQUA 4IH7A 4HTJA 4C8ZA 2Q43A 3AQPA 4ZN1A 2JRSA 1YJRA 2H5EA 3PX4A 2ZVIA 3N01A 2HBRB 4USJC 4B9UA 3MOZA 4NLVA 2DR7A 2UUBF 1U25A 3K59A 2R8IA 3IRXB 3OFFA 1FDNA 3K5PA 1U2FA 4HTIA 4EBDA 4B08A 2ZDOA 3P5BP 3A4TA 1NH8A 5KAKA 3D2WA 4EZ6A 2YNHA 1OY6A 2VH7A 2V2ZA 2IYGA 1H38A 1UCNA 1YRTA 3ZNJ1 3ENVA 1SJFA 1NSQA 4QWCA 3R7BB 3LH2S 1TUWA 2NPIA 4DUYJ 5IWAF 2ZH9A 2JNJA 2JX2A 3T5LA 1EKRA 3D5MA 3HFKA 1S9GA 3HXMA 4GC6A 2Y1IA 2LA6A 1YBTA 4A8WA 2OPPB 1VC5A 2OJ3A 2CG8A 8AT1B 1Q8BA 4NRUA 2IRUA 4ANEA 3BYPA 2BJ7A 3BV8A 2VQEJ 1YJNS 2NUUG 2UUAJ 2CPEA 4ZVQB 4N41A 1JLEB 3JQJA 1XMQF 1UZHA 4NA1A 3HHEA 5HVGA 4B3OA 3OFGA 1C0TB 1JLGB 4QR2A 1HYSB 4IH6A 1H74A 5ETPA 4ICLA 4ZVPB 3W8GA 5K20B 3L09A 7FD1A 5HO4A 4ZITA 3FJ2A 3CJSA 2CQ2A 4O0NA 5KFNA 3G71S 2V8HA 4IOAQ 3GIKA 2AZ1A 1D09B 2VG6A 5J1PA 5KG7A 1F9HA 4P2FA 3DRYA 2U2FA 3BGOP 5KG4A 3BGLA 3I82A 3IFEA 2M8HA 3ZC4A 3BO4A 2C2MB 2FPHX 2HHSA 2AW0A 4NLOA 3RW6A 2YX4A 4B3TJ 4OI0A 3PW5A 4L74A 2KXHA 5DG9A 1EQMA 2V67A 1SQFA 3GSDA 3ETOA 2F1FA 1TL3A 3IO1A 3T1YJ 1UWAA 1W2BR 2AX1A 3AFGA 3K89A 1HHTP 1GTEA 2ZD1B 3MZIA 4LBIA 5U47A 3NBPA 1UVKA 2KDOA 3UVJA 3OSPA 1JB0C 2DO4A 1U09A 4YB6A 4USIA 1TELA 3OR1A 2LQ9A 5HJYA 2CQ1A 5AJ3F 2ILYA 3RGIA 4O3PA 4CNYA 1IBLF 4KKOB 1IJEB 1M1KT 2VU5A 4PPDA 3JS9A 4TLRA 3M2VB 4OMFG 1CS4A 2HS4A 2NPFA 2Z0GA 2HMIA 3CIZA 4Y2KA 2BM1A 5L9XA 2VB6A 1JIHA 2WONA 1HI1A 2IM2A 2R4FA 2FLNA 2CQIA 4LFAF 3NMRA 3CD0A 1X5OA 2L9WA 3LW5C 1DQAA 2HVEA 4RNNA 1TK5A 4DR3J 2XI3A 4P71A 1NJIT 4CYUA 3NEKA 3VAJA 2ROEA 4DS4A 3JAMY 3HHLC 4L75A 1FE4A 3CDUA 5GAEU 4IFYB 2AU0A 3HPOA 1RISA 5F0WA 3IR7B 2NS1B 5G0RA 1S99A 4ECXA 3NGUA 1MMNA 1VS3A 2GGPB 1FKAF 1TL4A 3KLHB 4DUTA 2R2UA 2F63A 1HR0F 2W7AA 2V8PA 3LO3A 2MKJA 1WOOA 1NPRA 4HDGA 1S76D 3DDKA 1MN9A 2JOQA 3HFVA 2DR9A 1ELOA 4JV0A 2CRLA 3HSDA 2G2OA 1RBAA 4TU8A 5L38A 4KGXB 2H51B 2WW4A 2B5JA 3FQLA 2GAGC 3CCQS 3LAKA 4JI4J 5L8RC 1YHQS 1ZM9A 4LQ9A 3VAKA 2B43A 2HNDA 3AB2B 4QBUA 3NOGA 2KZZA 3HSGA 3IAM9 3UI3A 2XMMA 3LGNA 4DLGA 4BCAA 1T3NA 4H4KC 1HBMA 4ERDA 2XZDB 2VG5A 2GVZB 3BGRB 1QSYA 1ZTTA 2B6AA 2Z30B 3EDRB 4PG5A 3DOLB 5AE1A 1RAGB 1SB6A 2OPQA 2MQQA 1DTTB 1TK0A 2KJWA 1DQ8A 2R7XA 3G86A 4GVBA 1UEUA 4X4SA 3BPSP 3IBCB 1RTHB 4JYAJ 4RO0A 1JLBA 1PO6A 1Q79A 2KJVA 4R8UA 3OFHA 1RZMA 4MIBA 3W65A 1N5SA 1NZAA 2EFVA 2YNIB 4IFVB 1U6ZA 1VRQC 1D1UA 3OVAA 2DRAA 3OTEA 3IRWP 2K1RA 4LFBJ 5E5NA 1S1XB 2EBGA 1QLNA 1ICEB 1ZZFA 4OX7A 1NH7A 1S57A 2HEKA 2R7QA 4G1PA 4ZVRB 1GFWB 2E29A 2GMLA 4J9RA 2V69A 4HT7A 2C28A 4PXDA 3FSXA 2LEAA 2BJ1A 2IFXA 5AXNA 3R5BA 1RHJB 4W92B 3MMCB 4AFFA 3IRXA 3ONQA 4NXMJ 1YJ9S 4NOHA 2EFGA 2M9KA 1FJCA 2DXEA 4FKXA 2LECA 1BWVA 2FJXA 4ED1A 4LSLA 4EI2A 3SDEB 1VLOA 1M90T 2VPXB 5IT9U 2YX7A 1QVFR 2IMOA 1CJUB 4ZVSB 5DGAA 5HATA 2KRRA 1GMUA 1UWBB 5LJ5Y 1WC3A 4F67A 3Q8RB 1KEKA 1LW0B 2L3MA 4Y28C 2ASDA 5E3PA 4ZPWR 3QATA 3VWSA 1KHVA 3T41A 3GR1A 3D54A 4H4OB 4KHPF 2JJ4D 3TQEA 4F0MA 2AJ2A 2R7TA 2UU9J 1S49A 4DF8A 2DHGA 3PTWA 2LDYA 1WDTA 1ZM3A 2OPPA 4B3MF 3AD7C 1D8YA 5AXKA 3DLJA 3T19A 4B9LA 1UEVA 2X7IA 1H3DA 1GMWA 1RHUB 2IVMA 2NSCA 4C11B 1DRZA 1C4CA 2WB1D 3PX6A 3Q8QB 2FYXA 3OBIA 4RWXA 1JLEA 4E98A 4ECSA 1U1OA 4QWBA 1C0TA 1JLGA 1G6BA 3P3DA 1RCOB 1HYSA 3SCLE 2VASA 2W2MP 4XPCA 2E1PA 4DR5F 3UDLA 2CQDA 1O0PA 3M8YA 4PG4A 3M8RA 3FRYA 4XDCA 3TZZA 1IJFB 4Z7YA 2FD2A 2HRUA 1P9YA 4BLGA 1DARA 3HHLB 5AE2A 4NYOA 1GT8A 1RAFB 1SC3B 2VBYA 5E2QA 4DV7J 1RHRB 4P2XA 1WJ9A 1BQMB 3OTCA 4B02A 3JSRA 1S79A 2X51A 2W24A 1FFGB 1GXLA 4J90A 4QW8A 2KM8C 2L08A 3FDSA 4WTYA 1DURA 3HDSA 3MDFA 2VD3A 2ZD1A 2H48B 4NWBA 1VQ4S 4JV5J 3DXBA 2WAQD 2C22A 1FA0A 3FFIB 1S0NA 3H98A 1JX4A 1YJ7A 2MSTA 3FBFA 1PKUA 3GR0A 4KO0B 1CBKA 1SVDA 2CYYA 4J37A 3D6FB 4KKOA 4OI4A 4Q0BB 2CPZA 1LWFB 1MG7A 1TP7A 2FVSA 3SV3A 2M8DB 3M2VA 2E1AA 3VGUA 1OYDA 3EZOA 2L48A 4KHMA 2CNLB 4QOTA 4UTGA 2Z2YB 3CF5Q 2E5LJ 2BM0A 1F5BA 2ZBIA 3LANA 2UP1A 1KQFB 3ADAC 2MYFA 2IBOA 3R1LA 4CWBA 1PBUA 1VOMA 4P7TA 5K9FA 2GJIA 4DR6J 4LVNP 2RRAA 5A8WB 1VC6A 3NOCA 3LA0A 4IFYA 3B78A 1V6HA 4ES3A 2XNRA 1NHKL 2XZTB 1HLWA 2ZUAA 4OV6A 5JMNA 3NLCA 5KOWA 1KONA 4YS2A 2G2YA 5JVHQ 2GGPA 1VI7A 1S7HA 2HFVA 1UVLA 1UPPA 3KLHA 3THTA 1JNRB 3AD9C 5IC4B 4K2JA 5IV3A 1N34F 3RRGA 2CUYA 4NYPA 4OHVA 2ZHBA 1EP4B 1NK6A 2DXDA 1SKWA 3QRRA 1GK8A 5HANA 2VICA 2G0JA 2HPUA 5KG6A 1N5YB 3CB4A 4ALZA 2GIRA 4OZ3A 4I6AA 3BGUA 2JWNA 4W98A 2H54B 1RK8A 4UOCA 3JTOA 1VBYA 1X4FA 2Y0SD 5M2UA 1M5KC 2RNEA 3NNAA 3KYLA 2GVZA 3ZTRA 3BGRA 1IWAA 3AODA 2ZM6J 3IBWA 3DOLA 3PFEA 4PQAA 4DEZA 1AXQA 1DTTA 4RPFA 2D3OR 4CLLA 4CLZA 4OV1A 2F4VF 1SV5B 1RTHA 5L1JA 3GJTB 4U7UK 4GKJF 3HHNB 1ZS6A 2HRYA 1N33F 2GAHC 1SL2A 2ATCB 4IFVA 2R7UA 1WWHA 3QWUA 4A48A 1R43A 3G2XA 5AT1B 2UVUA 1S1XA 4AQYF 2RE1A 5GVQA 4UY85 5D8HB 4ZVGA 2HS0A 4FXWA 4FP9A 3A1YG 2KVQE 1QAJA 5KT3A 3KLIB 2AD9A 3NGSA 4DV1J 2ALZA 3DMJB 3TJ9A 4ED2A 3FC9A 3MMCA 2AJ0A 3DU5A 3T9NA 2OPRB 3QBCA 2XLJA 4PG8A 4DFPA 1PYOB 2MXYA 1MSWD 2NR0A 4QPTA 4AXJA 4F4YA 1TKXB 3K58A 4NX9A 2DK2A 3UN2A 4UZCA 1WD6A 3I87A 3TO8A 4DR7F 1CJUA 4RBVA 1WG4A 4PYAA 3GONA 1KVKA 3CPWR 2KKHA 1F1BB 1FJEB 1UWBA 1UFKA 1G4CA 2NZ4A 2D41A 1KTQA 2ZE2B 4WBFA 5DJBA 5H9EJ 3GE9A 4WFYA 3KNGA 1H6KX 3NS7B 4EZ9A 3CEDA 1WHWA 1PJ5A 3W63A 3NAHA 1HQEA 3OLAA 2KM8B 2J7WA 4CLKA 2IDLA 5CCLA 2VKZG 1HA1A 4F0KA 4U67Q 2YX1A 1CQNA 2UVRA 2QO3A 2V8GA 2XY6A 1U1LA 2HVZA 2C2ZB 1O8BA 4O3RA 2EVZA 2GQQA 2GO9A 2NXNA 2HIYA 2W4PA 4WJBA 2OELA 2Y8WA 1MWZA 5D0EA 1KWMA 4DSJA 3RAMA 4C11A 2LKZA 3L7PA 4A46A 3IMQJ 3MGJA 3D68A 3QRPA 1UVJA 1U24A 2ATLA 4PWWA 3ITHB 2HAIA 2CADA 3BF4A 5KFLA 1WC1A 3OTOF 4NLGA 4ZHRB 1I5OB 2MSSA 1SL0A 4RUHA 3M4XA 4HDHA 1S6UA 2SXLA 2BYCA 3EUNA 3AAWB 3AJ2A 3PJWA 3E51A 3HHLA 3L3CA 2VFVA 2ERRA 2QA2A 1S1TB 1HWLA 3F41A 4FYDA 1WC5A 3OJUA 3CO0P 2DNOA 2ZVSA 1BQMA 5A0YB 3W2WB 1FKPB 4E2FB 4USMA 4WU3A 3FK4A 1N36J 1NDKA 2A3JA 4FXDA 2CJXB 4M1KA 4P7VA 4Y65A 3DOMA 3FFIA 3CJ5A 1RP5A 2DD8S 4KO0A 4HACB 2HBZB 4Q0BA 2BACA 3P45B 3DOKB 5F8IA 2Q79A 2XWXA 3C6TB 1ZETA 2ZHOA 4QU7A 4ES2A 4WIIA 3FUYA 1EETB 4XDDA 2DNRA 1EHWA 3VHQA 2I9SA 3A13A 4Y0FA 5D77A 4RNOA 2MQ8A 2VOOA 3EPIA 2V2QA 2DNKA 4H4KA 2J8AA 5KT2A 3V6JA 3SSRA 3D1HA 3SFUA 2Y8YA 3MTKA 1QUVA 3UR0A 5L1LA 1ULRA 2FHJA 4NCAA 2RD5C 5A8WA 8RUCA 1YJWS 4PZVA 3HJVA 2D74B 3DRSB 2E5JA 4LF2A 1FEEA 3PYEA 3ZTPA 2V50A 3MAQA 4LBPA 2AGPA 2J7KA 4AE5A 2GNKA 3AJDA 2DNLA 4O44B 3T5HA 4I0WA 3MMAB 4C8KA 1HNWJ 3LWLA 1X4BA 5HN0A 2J5AA 4ELTA 1KOOA 4BC7A 2PI4A 1FRXA 2K7JA 3CT9A 1LXJA 3CCTA 3CCRS 3P96A 2CXEA 5BXIA 4RW4B 4ZOSA 1CEZA 5DETA 3MMBB 3CCSS 1EP4A 2FHMA 1RWVB 5I3QA 3NP5A 4G1QB 2FB0A 2K3IA 4USHA 2UUWA 5J1NA 1N5YA 4IDKB 4I68A 4DR4J 1NDPA 4JV1A 2JZ5A 2ZC4A 2VFTA 1FRMA 3MPVA 4MH8A 3M6WA 5IT4A 2DXFA 4DQQA 3K0JA 4AT1B 1IVZA 4ER8A 2UUTA 3TX8A 2FIUA 1KQGB 4R5PB 4F50A 2M70A 1RADB 2WK4A 3VALA 3GLJA 1WI6A 1JXVA 4M95A 3CDAA 3DNCA 5IQ6A 2KT3A 3AOAA 1SV5A 4JB8B 1NJXA 3FMBA 3EVOA 2L9DA 3TUJC 3NG8A 5DZ7A 3MOJB 5K8OA 2MQMA 3OL7A 2BW2A 2EI5A 1U1MA 4KGVB 4A8QA 1RTZA 4F25A 3PVXA 1X5TA 5D0HA 3HK2A 3G82B 4ZCLA 4X62J 1SPBP 1T8EA 4I7FB 3KLIA 4OHXA 2HHVA 2IAJB 3RBEA 3DMJA 1CC7A 1NK4A 2AYMA 2XI2A 2OPRA 4JOUA 2GIQA 2VV5A 5KFOA 1JJHA 1NPKA 4KT0C 1TKXA 2F8EX 5AXMA 2CNNB 1OPZA 2ZZMA 3L4BC 2NREA 5C2GA 3HSZA 1XQIA 3QO9B 2PFFB 1EX8A 4WP3A 3O3LA 2MHEA 2BRLA 3RB6A 3GG1A 2KFYA 3GV5B 3A12A 1V3SA 4WFXA 1IKVB 2BQUA 2IJNA 3JSMB 2RUSA 2HQFA 4ELVA 3GFZA 5E3CA 5CA5A 4Z2XA 4J5OA 3QAUA 2R8GA 2W2OP 1RU2A 4E8UA 4QR0A 1ZYQA 1N6QB 4RNFA 4A8XA 2GHWA 3SFGA 4KRWA 3F44A 4MJKA 1G2EA 5H9EK 4QPXA 1N5QA 2OD6A 3PFOA 4NLDA 2VPYB 1BY9A 2GJ2A 2GQCA 1MMLA 1P27B 5K8NA 5J2QB 2JEFA 2GHVC 4F8RA 3RB4A 1WSVA 2ASYA 4O4GB 1OSDA 1X31C 6AT1B 4KR0B 2CPJA 1IBKJ 4AL5A 1Q8LA 3F73A 1JLAB 4OQJA 3ZZTA 2W9CB 4KHRA 2HVDA 5EDWA 4LR9A 4DQRA 4X2BA 1N4LA 2X1FA 4ZHRA 4O3OA 4LRAA 1HBNB 4C48A 1TZ0A 1QTNB 2JLGA 3A8EA 4YDDB 3FVYA 4UT4A 4L76A 2B8QA 3C14B 1AW0A 3IA0A 5A2QU 4ETXA 1S1TA 1SJ3P 4CTAA 1J5EF 3KUEA 2R2TA 4OYIA 5A0YA 1EIYB 3W2WA 4J9VA 4FBTA 3N6NA 1FKPA 1XMOJ 2KHCA 4MTPA 4B9NA 3FEZA 1SC6A 1AUDA 4QWAA 2LYVA 3CCWA 1FI4A 2QMXA 4U8YA 5A8KB 2HLTA 3VAMA 3DLLQ 2MY7A 4U9RA 1VK8A 1KHWA 4F26A 1S12A 1HQ2A 1XK8A 4HACA 4ZDNA 1M5VC 2Q66A 3DOKA 3THVA 3Q86A 3W2VB 3C6TA 2MKYA 4YFUA 4PQUB 1C1BB 2HIQA 1EETA 2V9WA 1YBUA 3Q83A 1RKJA 2XCAA 4UQTA 3S6EA 2BZ2A 4Q8EA 4F3OA 3W5YA 4S0MA 4PXEA 1MMDA 2BANB 3KK3A 2BMBA 3M7VA 3K8VA 4H54A 4WFZA 1D8ZA 2HHHJ 1YZ6A 1Q8IA 4CO3A 4RW9B 2L41A 3CW2C 4X65J 4BWMA 4B17A 5MAOA 1TMMA 3RW7A 4YQWA 2BEFA 4WXOA 1LV5A 5F3TA 3DRSA 3WZ0A 4DV2F 3BR9A 3CDEA 4K0KJ 2J0WA 2YWFA 3DKDA 2CA9A 2QIFA 2ROPA 4ZVEA 5IXUA 4RW6B 2I0XA 4B3RF 2W2PP 2Q6BA 3GFHA 3NGRA 3MMAA 2DNYA 4EMDA 4F36A 2DHHA 5JJBA 2X1GA 1NAQA 1VQPS 3SV4A 4QJVA 5F41A 1NM2A 2XB2D 5CAAA 2R7RA 4XAKA 2DEIA 2CQ0A 1HW9A 4RW4A 3MCMA 1OIAA 1KLNA 1HI0P 3MMBA 1S1UB 2XGQA 2LQ5A 1GAOA 2KYZA 3L9ZA 1S48A 5B09A 4IDKA 4Y2AA 2HWHA 3UO0A 5KFYA 3CMES 3HLUA 1SKRA 4X66J 4DPUA 2LLZA 3MM6B 2ACYA 3SI8A 4RX6A 3ENWA 5LL6d 2F8HA 4PEOA 3R7NB 1WKJA 2ZHAA 2HWTA 2XLKA 5KFBA 4DUYF 2KXNB 2N4CA 2BKPA 4EFAC 1MWQA 5ADZA 4FDFA 5HP1B 1ZPVA 3JAMU 3N79A 4WCEQ 4OI6A 4AL7A 1P9QC 2J9EA 1NB2A 4J9NA 1BHNA 1RB0A 5FDLB 1CJKB 4M94A 3VF0B 2V5HG 1BUXA 3S8SA 1JLFB 1L5UA 1YVFA 3LTOA 2QRRA 2VQEF 3HULA 2EG1A 4NLTA 2UUAF 5KFAA 1AROP 2QMWA 1ZOTA 3EZUA 4UF4A 2EWHA 2B51A 3G82A 1XBWA 5FIIA 1DJ0A 1FDBA 1F5CA 2DGVA 1SBRA 4C8NA 2F9JA 2Y9HA 5D4NA 2C3OA 3AD8C 4I7FA 4P73A 4ZVHA 3AY0A 3T1AA 2IAJA 2YWHA 2DGWA 3H40A 4Q2LA 5M2RA 5SZTA 4CO4A 3CJ4A 3T3FA 2AQ4A 5C7PA 4JI5J 1VQKS 3K5NA 2RS8A 3KFWX 4GC7A 1Y3JA 3OXGA 4NMXA 1X9MA 2AGOA 3QT6A 1X9WA 4ZS6A 2WVFA 4C3LA 2X1BA 2ZNYA 5K5MA 4B3TF 3GV8B 2JH3A 3MM9B 2RH3A 1Y11A 1S10A 2EC0A 3QO9A 3CVKA 1UAWA 3CJ2A 3PHTA 1NSPA 1UETA 2C2OB 4X4TA 2MTLA 1KC8T 2GVDB 1IKVA 2Y3YA 2B8PA 2AYEA 1ZM2A 2WSEC 3RBXA 3OVBA 2Y0BB 2QGFB 3O6QA 1DZ5A 3UN5A 1N32J 3KK1B 1VQYA 1N6QA 4OYXA 1WKKA 4TLQA 2Z4PA 1Y0HA 5HVFA 2B4UA 1WHYA 5C5JA 1XWLA 3M8SA 4WP9A 2XMTA 3NKYA 1NSAA 1QUPA 2KB2A 4NEYA 5DM6Q 4IUFA 1KVIA 2HFUA 3SQGB 2MZTA 3ZNUA 4CH0S 2F7VA 4NLPA 3VV2B 4ZIWA 4O4GA 1GNKA 2CDRB 2FVQA 2J0SD 1JLAA 2W9CA 5F8LA 3HI9A 1HWKA 1WOSA 2RHQB 3G96A 2CQCA 4DR3F 2K2PA 2FUG9 2VJUA 4ATNA 1HBNA 3FNNA 2DGOA 4OJGA 3TAQA 3C3LA 1V9OA 4FYXB 2K06A 1RAAB 4C3KA 1GX5A 3B8HA 4WP8A 4WTOB 1IR1A 3R2CJ 3C14A 3CD5A 1APSA 5B0FA 4WF9Q 1FRLA 4P74A 2M4MA 1RAIB 4WYLA 4OI3A 1PG5B 5ETKA 3US5A 5JUMA 4M5MA 5KFPA 2V0NA 2DH7A 3TNVA 3HKZD 3PR5B 5DDRC 2VIHA 1VHIA 2FC9A 1VJQA 3PO5A 2XYPB 1A7GE 1S72S 1HMVB 1ZA2B 3R7SB 2ZH1A 1RBLA 4K5SA 2RIJA 1CSJA 2EKYA 3HVAA 3CJ0A 2R2SA 3GIRA 5A8KA 1ZTWA 1PAUB 3PW4A 3EE3A 2W9AA 3BYRA 4JI4F 3WBZA 2JFKA 5IV4A 1NDCA 1P8GA 2BJ8A 2XG8A 2QX0A 4A8FA 1W25A 1EQ0A 5IT0A 4LF4J 3W2VA 3LQVA 3R9LA 4PQUA 3ZZPA 4I67A 2YKMB 2WVDA 5LSOA 1S4FA 2D1CA 1HBUB 2EBEA 1D9AA 2FVPA 3MM7B 1FD8A 2DNHA 3RRKA 5H9FK 3BZQA 5LJ3Y 1UKUA 1R8CA 3NGTA 2BANA 2IYIA 2QTWA 3D3CJ 4OJ3A 4YN3B 3Q8VA 4M5GA 2VZ9A 3FRZA 3KLVA 4YB1P 3J80Y 4YOEA 4RW9A 4JYAF 3QWPA 5E3AA 2OEKA 3D4JA 2QC3A 4DL3A 3SXLA 1C1CB 2PIIA 2GIFA 1YJVA 3UCGA 4NCGB 2HKEA 1MU2B 4RW6A 4DX6A 3BR8A 3EPGA 4LFBF 2DTJA 1KFSA 3M2UB 3MAHA 1U02A 3Q89A 2W25A 2HHQA 5IC6B 2YPZA 4HHJA 4DPTA 4K4YA 5CYMB 4A47A 2VFSA 1HNVA 4DDFA 1AT1B 4J9MA 4LF9J 3MPUB 1T95A 2P2CB 1HWJA 4NXMF 4DQSA 1HQUB 2Z57B 1D9DA 1S1UA 2V2KA 4DPYA 1X5PA 5D3GB 2ZH8A 4NLQA 3U7JA 3MURP 1YGYA 3EGZA 1N0VC 1XERA 2DO0A 1UW9A 2Q6CA 3TA1A 4UQGA 3MM6A 4ENOA 2YWKA 1NBEB 3TZYA 2BJ9A 1IBLJ 4C6AA 4I1TA 5C2CA 1X9SA 3K5LA 4YB5A 4TKTA 3I0RB 5B08A 2DR5A 1VQ5S 3JYTA 2FLPA 1FNXH 1HBOB 3I55S 4RUCA 5HP1A 2CNOB 2PSZA 3MF5A 5KFDA 3RJMB 3M9OB 2UU9F 3E3XA 3SCKE 4RUAA 5D0GA 5FDLA 3GSIA 1CJKA 3ELHA 1YI2S 2EFOA 3EVMA 3TOQA 1JLFA 1RQ0A 3OTDA 4OZ0A 1PYSB 1YTYA 2A18A 2B3TB 2HSEB 5DQHA 4A8YA 1I94J 2XBPA 3BKTA 4G65A 3MUTP 1PGZA 2AYGA 1U1RA 2HK2A 4M5LA 3O8WA 3QNWB 1VQ8S 2FGCA 1VFJA 4NLXA 4HEA9 4X4QA 3MUMP 1J2VA 1NUEA 2R7VA 5EN1A 1X0FA 1VGYA 3ILJA 5DO2A 4LIRA 1S59A 1L3KA 3IAS9 5HBMB 1K47A 1EB0A 2QLBB 4BBYA 4JI7J 1QJHA 3MD3A 3MFHA 4OHZA 4FBUA 5DGBA 1R8BA 5J2NB 5KG0A 2MQPA 3BH6B 1ZBTA 5GAGU 4DV7F 2R8KA 2DHXA 2PMHA 2XHCA 3MM9A 3Q8PB 2FHOB 4IRCA 3TA0A 4OLPA 2E5HA 2YKNB 3SBMA 2H5IB 1KBRA 3VVUA 4RNMA 2RQKA 2GVDA 4LRDA 5DLGA 3W5XA 3BDPA 3BBCA 1CJTB 1X60A 2E66A 4NLUA 4JV5F 1N54B 3I6PA 1N48A 5KFEA 2J76E 3MTJA 4FS1A 3KK1A 3GFYA 1Z4UA 4Y34A 2N3LA 2BJ3A 1T05B 2KHDA 5GADU 3K2YA 1SJRA 4F4KA 1L3VA 1KRPA 9RUBA 4H4MB 1MLAA 2UZAA 5ETVA 3UVJB 4HI2A 4IQMA 3M6UA 5L9NA 2GMHA 1BD6A 3SQGA 2QG9B 2WW8A 2DB1A 3OLBA 2DRDA 2RQMA 2E5LF 3VQTA 2V6AA 2WSFC 5HL7Q 2WRMA 5IFMA 2F40A 2IM3A 3NCRA 3K8WA 5F8NA 4DR6F 2C3MA 2WONB 5ETTA 1R89A 3CCES 2OFHX 4URSA 2NYHA 2VG7B 1PBAA 3K7RA 2HS3A 1B0VA 3PZPA 4CI0B 4CM0A 5CD4A 2RB7A 4A8OA 3R6LB 3KHRA 3Q23A 1EKSA 5ETSA 4DLEA 5G0RB 5I3PA 1HMVA 3CWJA 4PR6A 1WHVA 1F2GA 2DH9A 1JXEA 3LALA 4ZJOA 3CCJS 5HMZA 1SH3A 2B0GA 3QGPA 4KGMA 3RB3A 1IBCB 2QE5A 2K7KA 3QSIA 1TKTA 2JEJA 4CT8A 2J6SA 1NRKA 5F8MA 5GAHI 1XC9A 3R5CA 2M5YA 3D6MB 4YR3A 3MHYA 2R7OA 1JLCB 3P6YC 3DHWC 4OL8A 5DS7A 5ETOA 2YKMA 3A3OB 2XULA 3H5UA 3MM7A 2N7CA 3KDNA 4ED4A 2F5GA 5D0RA 3HHLD 1RTDA 4IRKA 4ECWA 3DCAA 2LEBA 1Y5IB 3CMQA 4ZK7M 4J9KA 4YR2A 1FFWB 4QIEA 4XTTA 4HYKA 1T9YA 3V6HA 2OAUA 2J6UA 1ROFA 2Y1JA 1HKAA 4FS2A 2YH1A 3DDIA 2CZVC 3KTQA 3MR3A 1X4DA 3L7UA 1UVMA 3D1QA 3H59A 4NCGA 4V19X 1MU2A 3D1OA 1Y7PA 3IWLA 2R8HA 3M2UA 2RS2A 1TV6B 1IQTA 2XNQA 2DITA 1B99A 4ZLJA 1Y3KA 2KT5A 3MCOA 1S5ZA 3NRBA 4DV1F 1BLUA 3KJFB 3KG1A 4TXSA 5CYMA 3NS5A 1TR0A 2HLUA 3HVWA 1SIZA 3HMJG 3V81B 4ID5B 4PABA 2DT9A 5EWGA 4KPCA 4X64J 2KU7A 1HWUA 5B0GA 1PJ6A 3Q0AA 4DV3J 5D3GA 1FXLA 3I4PA 4CLYA 2RKIB 4K4SA 1FHTA 3OUYA 1E6YB 3OPKA 4LMZA 2J7UA 3W7BA 2FHJD 3VAGA 1QY7A 3UE2A 4R25A 4BC9A 1FE0A 2LQ8A 2PI5A 2G0IA 4LSLB 2I8EA 1RTIB 3I0RA 1N5TA 1OQ3A 2EXUA 2I1RA 2WB4A 2ZBCA 2Z2MA 3OXFA 4IH5A 1VR6A 1FRKA 1HBOA 2LQBA 4UUXA 2WVEA 4Y2IA 4LF7J 3CDWA 1S1WB 3PEJA 3PXGa 5A2QY 4UOFA 2QT7A 1K1SA 4LF5J 1FXRA 4PAAA 2QLFB 3PW7A 3D7SB 3CO9A 3IG1B 4USTA 4CLWA 4C9DA 1KR4A 1I6JA 1F9FA 1MWYA 1YZ7A 3QFWA 4EBCA 3DN9A 1N56A 3KG4A 1IXKA 2DGQA 4ZCMA 4DN0A 4U6PA 1NK5A 3CC2S 3TAMB 2HGNA 1YIJS 5CH7B 2CQHA 3OW2R 2XYGB 5KFFA 3BN7A 1JJ4A 2LU1A 1C2PA 4I2PA 4DL4A 3E01B 3C46A 3UD4P 3G8QA 3HT3A 1WF0A 5HBMA 1PC5A 2IA0A 3ISNC 1N5VA 5L1IA 5DZ6A 2RU3A 4K4TA 2JEGA 2FJAB 1Q86T 3C15B 2COLA 2GA7A 3KWMA 5J2NA 3EMTA 4JI0J 3GJQB 4QIWD 2R7WA 2BDPA 2HQGA 5ETQA 1UFWA 2OD4A 2BUNA 3QJJA 2VPWB 3VAHA 1X4GA 2YKNA 4KAIA 3UFCX 2BE2B 2KXFA 3M1VB 1RA7A 1GXUA 3I9ZA 4HLBA 5D4OA 1N36F 1ITPA 3WIVA 3TYTA 1RLCL 1CJTA 2HQIA 4XPEA 3OHBA 2H5JB 1FWKA 4DR1J 3OFEA 3WX8A 3PJXA 3WIUA 2IMWP 3WQPA 1LK7A 5B7WA 1T05A 3HP6A 2DHAA 4MKVA 4H4MA 1R8HA 3PCOB 4MK9A 3I4HX 5CZXA 4NASA 2ZJQQ 5CD4H 5KFQA 3AJ1A 2BOPA 4DI6A 2D7SA 4DV0J 1U6FA 2F65A 3QT5A 2BV3A 2RF2B 3LP0B 1U2CA 4PXCA 2GJFA 2A10A 4KFBB 1J5OB 3R1HA 2NXJA 2ALYB 3SQOP 2HYIB 4DL2A 3R27A 2OO4A 3Q2SC 1HARA 1I51B 2OIHA 3CGIA 2AEFA 3A8KA 3J7ZT 2HAFA 4AYBD 2VG7A 1WC4A 1FTCA 2XO7A 1RAOA 4LFCJ 5KFSA 2HG4A 2AGQA 1H73A 2I5JB 2KG1A 5BYQA 1VBKA 2CAJA 1GMVA 2XY5A 3J7AN 4EYIB 4X4UA 4OZNA 3TJ8A 1U2RA 2XCPA 2H4YB 1T9WA 4KH1B 2NUHA 2FZCB 5CCMA 4LUBA 5DDQC 1Y5LB 2FTRA 3TAPA 3PDNA 3QJPA 1AFJA 4K4WA 4DR4F 2GC8A 3Q24A 2AJ4A 2MMYA 1K1QA 1B4SA 1JLCA 4PUOB 3SSQA 1X4AA 4HKQA 4DL7A 2B7CB 4MK7A 1VQMS 3BQ0A 3G6XA 4DSFA 2EK6A 2HZVA 2FZKB 4MMOA 3PACA 2HNYB 4ZCIA 1WTFA 1KD1T 3P4UB 1UTAA 3OV7A 3AH6A 3HSJA 4TY8B 1RE1B 1K9MT 3DHXA 2JC1A 4M5JA 2NCKL 5HMYA 1GQEA 1K8AT 1YG0A 2IVYA 4P52A 4ZP6A 5KG5A 5HAOA 3UCZP 2DCUB 4Z7CA 1LQ9A 3QAEA 3NGKA 1LXNA 2IM0A 1REGX 2BXJA 1WOPA 3LOUA 4L73A 3EGWB 2XQCA 4AUKA 4WZMA 3CJTA 4CNZA 1TV6A 1I1GA 5F0UA 3U02A 4X62F 1AZSB 2YQ3A 3QT7A 3DDNA 2JVOA 4MKYA 1RDRA 4O4RA 2LDIA 1Q81T 4ZKAA 4QW9A 3UNYA 1N8RT 5J2MB 3V81A 4ID5A 1A9NB 1YBAA 5HQMA 3DRXA 3W9IA 4IR1A 2Z2LA 4MFBB 3T1HJ 1VQ9S 4OYMA 4LREA 2HVHA 2ZBRA 4FKYA 3SCIE 1NMEB 5ETRA 2RKIA 2MKKA 1E6YA 4OZ2A 4LF6J 1RABB 4B9TA 4DX7A 4P9SA 3V4IB 3PM9A 1G7CB 4JI2F 4DPWA 3AHPA 4ZCKA 5KFTA 1RTIA 2H65B 4OX6A 1U26A 3W1YC 3I5BA 2QYCA 2MLYA 1TMJA 4Y2MA 1U8WA 3VGVA 5D6GA 3N28A 4CP5A 2DR8A 4K59A 4DSIA 1S1WA 1E6VB 3ICLA 1Y00A 1VISA 3QLHB 5B0AA 1YQHA 1C4AA 3DFEA 4XK8C 4NE9C 4MIAA 3IG1A 4ETZA 1HQEB 2XMWA 4LSNB 2X1AA 4TQRA 2YBVA 2PC6A 1XJWB 4L72B 5KTQA 1Y10A 2V4RA 3MM5B 1Q0NA 4WK3A 1RWOB 3CD7A 4DCPB 2ZNZA 2PD1A 4CO1A 2OUGA 1IBKF 4ZPCA 4LR7A 3TAMA 1GTHA 3DYAB 1KQKA 4FZVA 3E01A 3PR4A 2XY7A 1QAXA 3HVTB 3LGHA 4J9SA 1FDAA 2DR6A 4QYZJ 4KH0B 3KLFB 2F4FA 1P1LA 1IM4A 1R7IA 2OTJS 3C15A 3DLKB 1RAEB 3RU0A 4YR0A 2VDIA 4OX8A 3FCHA 4RL1A 1F9EB 3TW0A 2XS5A 1F5AA 4V1Ak 3ZTQA 3DLBA 5EX3A 3TEHB 3K17A 1HPZB 3FZBA 3ISZA 2DPIA 3HKWA 2XHWA 1S4EA 1XMOF 2WZ1A 1IBMJ 2BE2A 1HHQA 2D3O1 2UXCJ 2QA4S 1YRUA 3D9BA 3M1VA 3FKBA 4DFKA 2AJFE 3NNHA 1PSDA 1TK8A 2N3OA 2DBBA 1WUUA 1KKHA 1RSCA 4M5NA 5CHCB 2ASLA 3NXZA 1RJJA 3KXDA 3TZXA 2ABYA 2AKWB 3PV8A 3DOMB 1OJ4A 3MM8B 2OLWA 5J2PB 3V4MA 2J9DE 4DUZJ 3CCMS 3VGSA 4K4UA 2AMCB 5G4DA 4HH1A 4DPXA 5KFKA 3AA8A 1SJ1A 2CQGA 2O66A 5T7LB 4EBEA 1VYAA 2RF2A 3LP0A 3T5JA 3MPYA 4DV6J 2HHHF 4KFBA 1J5OA 4DSLA 4CO2A 4KYZA 4X65F 3M8QB 4NXNJ 2WBRA 4RU9A 3H5XA 3KLEB 2KYXA 3UN3A 4DU7A 4K0KF 2YKPA 4NLYA 4DX8H 1YRXA 4Y6IA 1F6TA 1QAIA 3BGFA 2IIHA 4QIFA 4F3MA 2QV6A 2I5JA 4LVOP 2EKNA 4AL6A 1CPZA 5KT7A 2CJYB 2YQ1A 2QL5B 3Q8SB 2KFZA 5LT5A 3IR6B 3BSCA 1RT2B 2IM1A 1LKZA 2FVCA 4ZPVR 1TL1A 1TU0B 4B3SF 3BQ1A 1U48A 2HRTA 1HIYA 3DLGB 4AXIA 2CPYA 1YKWA 1T9VA 4X66F 2LXUA 3DM2B 4RZRA 4PUOA 2ZKTA 3GIJA 4PKDB 2XC9A 2H4WB 3BB5A 5LMUJ 2ZFHA 5CZVA 3RZAA 3N9UC 1UA0A 2W9BB 2QSFA 2BKNA 1IUJA 2HNYA 2PA3A 2LA4A 4M5KA 3G6ES 2X3GA 1MW7A 2R42A 1JXLA 2YKAA 1T9UA 2VPZB 3LPEA 4TY8A 2CPHA 3H2LA 3ZXWA 3BSAA 4UZBA 4PPZA 3BJYA 3V6KA 1RYRA 3V5RA 5A76A 4CZCA 3W62A 2W7OA 3P5TL 2C42A 1GEHA 2KT2A 2HWIA 2EFNA 4UUWA 1MNEA 5HLFA 1S0OA 1AZSA 2FC8A 3M32B 2HGLA 4USVA 1YLXA 2RHSB 3M05A 4DQPA 3G8SA 3BBBA 2YQ0A 1VHFA 2FZGB 5J2MA 2YXLA 4N56A 3G8TA 4JI5F 1QE1B 4MFBA 4M5DB 2YY3A 4RWWA 4CDIA 3J7YI 2J0QD 4DX5A 4GO7X 3GFXA 1J27A 3NWRA 4RNHA 1M1GA 3CNQP 4F7VA 3TWZA 3V4IA 2O67A 1NJZA 2YWWA 4YHHJ 3PY8A 1OQ6A 1FJ7A 2EC2A 1YJTA 4IR9A 3J80U 2HW3A 2A2CA 2ZH4A 3SEOA 5MLCV 3C6UB 3LPYA 3CCZA 2FLOA 1RHMB 1W2IA 2DPJA 1E6VA 2PEHA 3GILA 2FJEB 5DG8A 3CJQA 1WC6A 3FZ2A 3QLHA 1NJWA 4CLUA 2W7PA 2MZ1A 1RACB 2NXUA 1RGVA 1CLFA 4PWUA 4ZPAA 3U1LA 5I4MA 4LSNA 4C7QA 4DZDA 2JLEA 2Y1RI 2HQCA 3MPWA 3MM5A 4J9LA 2GCFA 2CFXA 1K44A 1UMJA 3RAQA 2LMIA 3ETMA 1H2TZ 2DJWA 3IXQA 3K5MA 2FJBB 3DYAA 2FLLA 2G1HA 3PIOQ 3L7OA 4EO8A 3HVTA 1WDDA 4ECTA 4X84A 1R27B 1ZAWA 2C2NA 1S6QB 4RKUC 3KLFA 2IA6A 2GMJA 2CJKA 2E9TA 5F8HA 1VQ6S 2CPDA 3CXCR 3DU6A 3DLKA 3KOAA 1WC0A 5GMEA 1ZPWX 1N88A 4ELUA 2EW9A 1FXDA 1TL5A 2DNPA 5ETMA 1T0TV 4GMKA 3ZZYA 4C8MA 1HPZA 4QYZK 3IS9B 1MN7A 4MYTA 4J9UE 3HM9A 2J0XA 4DZ6A 2LQJA 4F2SA 3S01A 2MKHA 4C4WA 1FRHA 4CTAB 1NLKL 3EM1A 1RHKB 3HO1A 2M7SA 2CZ9A 4KTQA 4MYUA 1FEHA 2RRNA 5L39A 4LBHA 3FBBA 3FSYA 3I0SB 4LR8A 2MHNA 1HL6A 2XTJP 3PYGA 4LF4F 4GKKJ 2OKQA 4ED7A 3MM8A 1NNDA 5FD1A 5J2PA 3V2UC 1U45A 4ECRA 5KFMA 3CCUS 2DEJA 4WFBQ 2F9DA 3ZZUA 5K14B 1T3OA 3H2VE 5T7LA 3HJFA 4CCHA 1H7XA 1SQGA 2IPOB 5HSPA 3BO2A 4ITSA 4WPAA 1IKXB 4L3KA 2DIVA 1HWIA 3BS9A 5KFZA 3M8QA 2GHPA 1KVJA 2YNGA 4JI6J 5K8PA 3JQMA 1H2UX 5F3ZA 1B70B 1WSRA 1U8SA 1KDNA 3KLEA 4FNIA 1Z2LA 3KK3B 2PDAA 3T6JA 2BE9B 4GVLA 3TA2A 4QIVA 1SJ4P 5AXLA 4QR1A 2N82B 2Z58B 1FNOA 2H9ZA 2F3JA 2VBWA 2R7SA 4DPOA 4OHWA 5KG1A 5KG3A 1T94A 2XO6A 1X0PA 4DL6A 4LF9F 3CCLS 4JI1J 3AT1B 4DF4A 2PO4A 2CQPA 1RWWB 1RT2A 1RU1A 2OMOA 3FSIA 3K57A 2IHR1 3BEGB 2HHTA 4JI3J 2ZZTA 4ZVOB 4NCBA 4ES1A 3DC2A 3DLGA 2IJFA 4A8MP 5FJ4A 2BQRA 4WFAQ 1SC4B 5KFHA 4TYAA 2AF6A 3MUVP 4FYYB 1BGXT 3DM2A 1OY9A 4IOCQ 2JLFA 2MJNA 1OMSA 4P72A 2I38A 5KOXA 1O5JA 3TARA 5BYSA 4DOZA 3EYZA 2W9BA 4PRFA 2ZDPA 5HQLA 4ED3A 2G13A 4WYWA 2DCLA 3GCWP 2CWKA 3H25A 2ZEJA 1KOHA 3FCVA 3ZFVA 5KFIA 1Q1KA 5BR8J 4K4VA 1C0UB 1RT5B 4Q43A 2KL8A 1F0XA 5AE3A 2RSQA 3KHHA 3CC4S 2GZOA 1V5VA 4DL5A 1KN6A 3ZO7A 4Q5VA 4DV5F 4ED8A 3M30B 3HHDA 4QYRA 1I94F 2WVCA 3HD2A 3TR5A 4N77A 2DGSA 2CQBA 2HHUA 3UR3C 4QZVB 1UL3A 4OX9J 2HFNA 4DCJB 1WNEA 5FLXY 3M32A 2MQOA 3SMZA 3H2UB 2HVIA 4M63A 3DI6A 3UQSA 4R0JA 4QIGA 4Q45A 2N4DA 1DQ9A 1REVB 1NK7A 3JSBA 1XTZA 5GAEI 4ECUA 3D0HE 1QE1A 4JI7F 4M5DA 2VQFJ 1NXIA 1FK9B 3GP9A 2DRBA 4EK2A 3W3SA 3V6DA 4IO1A 4OZLA 5K8MA 3IWXA 4OFZA 4DWIA 4RR5A 1XR7A 3QT8A 2RVJA 2AJQA 2FGOA 1D3WA 5A6WA 4QU6A 4Z37A 2B4VA 3M2RB 2FJDB 3BPDA 3B4DA 4EEYA 5SUHA 4EU0A 4A4JA 5HVHA 3R2DJ 3HHKA 2DNZA 2ZBPA 1OSCA 1IQZA 4J9OA 4K50A 3C6UA 1UFLA 3MEDB 3ET6B 1OYEA 3GJRB 2G4BA 2KN4A 1EJ7L 1SL1A 2ZWOA 2LP4A 1AFIA 1XNRJ 1QSLA 4P10A 2FY1A 2O5DA 2GW8A 2MZSA 3D0GE 1NHVA 1WEXA 2CJAA 1TUVA 3EWGA 2GFFA 3E2EA 2LFVA 3MXHP 3CJRA 4JP8A 1Z1ZA 1JWWA 3T6BA 1X4CA 1RAHB 1RHQB 1RT7B 3M9MB 1W26A 4U7UD 3H8YA 3BO3A 1V3ZA 1N52B 3D6HB 3FEYB 3GPAA 4NA3A 3ZZZA 4G6VB 1SJQA 4URGA 5HROB 1FCAA 2DY9A 2VA2A 1NKCA 2QSWA 4OYOA 4C97A 2UUCJ 3N5BA 1S6QA 1Q53A 4ZN3A 2HNZB 4YY3J 1OWXA 3I5CA 3WC0A 2YNFB 1PIEA 4G3IA 3MFIA 5DLFA 1QD1A 3I5AA 2OEMA 3QGHA 1UJ6A 3OVSA 2QA1A 3GTYX 4KC5A 2CJBA 1RAJA 2RJZA 1WEZA 3IS9A 4K4XA 4EO6A 4TYBA 4I64A 2CWXA 5ETLA 4ID8A 2A0FB 1U0SA 5GMKa 1IR2A 7AT1B 4O3QA 4KPYA 2MY8A 3ZZOA 1TUGB 3I9V9 5HMWA 4DU8A 1G3OA 3I0SA 1K73T 2JVRA 1HNZJ 2Y1LB 1V5IB 5E33A 4YP3A 1VBZA 1ACMB 1TTHB 2C1EB 3O5TB 3B54A 3BN4A 4DN9A 1VIXA 3POTB 1NZ8A 1UJ5A 1HHSA 3J81Y 4NPOA 1CVJA 2EEYA 2L9NA 5CXTA 5K14A 2XS7A 3CTRA 2JL9A 3TP2A 1X5SA 2APOA 3A8JA 3HD1A 1SIWB 2CQ3A 2GO8A 4OHYA 3H4BA 4MK8A 1IKXA 3C2PA 3DGPB 1YWXA 2H1YA 2V2VA 2NXCA 1WF2A 3AXMA 5HQ8A 4USWA 2KVIA 2ZH2A 3TEGA 5HK4A 4CT9A 5KFWA 1FWLA 1LOUA 1K0TA 2VFUA 3MAAB 1BE4A 2G1DA 2Z56B 1P6TA 2B7BB 4CLPA 3J7Z5 4K8RA 1S7IA 2KH9A 1JLQB 1LK5A 1SUQB 1WEYA 2RAQA 1FERA 2UXDJ 3RBDA 2HHXA 2FDNA 5LM7E 3I96A 2DGXA 4NLRA 4PXBA 1U49A 3W60A 3NL0A 2VKRA 3AOCA 2MEWA 4P2SA 5EHHA 3UCUP 4X64F 2U1AA 2HHPA 1S1VB 2B9WA 4LF8J 4PYDA 4QQBA 3OL6A 4DV3F 4JI8J 4DR2J 4ANDA 1XIQA 2C3PA 4FPIA 1HNVB 5KFJA 1M5PC 1RI7A 3W8PA 2B56A 5LXRA 2EK1A 4WXWA 5L46A 4TU7A 1B7YB 3QJLA 4WZQA 3C19A 2NXEA 1PJ7A 2E7WA 3I56S 2RILA 1VRTB 1VQNS 2DY1A 4O23A 3R8YA 1NJYA 4LF7F 2XMJA 1T7PA 4B9VA 1KSPA 3T5KA 4LF5F 3OXLA 2CQ4A 1Z2ZA 3EX7B 1WI8A 3JYTB 4JV2A 2GS8A 1C0UA 1D9FA 1RT5A 3Q22A 2D3UA 3QGGA 9ATCB 4ZJLA 5KFRA 3H42A 4TNOA 4YUDA 2PA8D 3M30A 2NSBA 3TUZC 4F02A 3QQCD 2VF3A 3R5GA 1R0BG 4J9PA 1S97A
chains in the Genus database with same CATH topology
4ANDA 1XIQA 1ZS6A 1NDPA 3PJ9A 3R9LA 1K44A 3FBBA 4F4AA 3ETMA 1HHQA 3EVWA 2HURA 4ANEA 1NDLA 5IOLA 3FKBA 1NSPA 3PRVA 3DDIA 3G2XA 1NB2A 3NGRA 4DI6A 1BHNA 3ZTOA 2AZ3A 2DXDA 3EJMA 1WKLA 1F3FA 3VGUA 4F36A 3EMTA 1NPKA 1F6TA 2B8PA 1BUXA 3FCWA 3NGUA 1LWXA 1B4SA 2DXFA 3ENAA 3L7UA 3MPDA 2BX6A 3NGTA 1NUEA 5CAAA 3Q8VA 4UOFA 1NDKA 3ZTPA 4UOHA 2HVDA 3NGSA 4ENOA 4DUTA 3Q86A 3FBEA 2DYAA 1S59A 1NCLA 1XQIA 4HR2A 1JXVA 4C6AA 3VGTA 1B99A 3FC9A 1MN9A 2VU5A 4FKYA 3Q8YA 4W98A 1BE4A 3JS9A 1NSKL 3Q83A 1WKKA 4O0NA 1S5ZA 1UCNA 3EVOA 3B6BA 3ZTSA 2B8QA 5CABA 2AZ1A 4S0MA 3BH6B 1S57A 3ZTRA 1NSQA 1MN7A 3WX8A 4KPCA 3VGSA 3GP9A 4DZ6A 3BBFA 1NHKL 2NCKL 4EK2A 5BXIA 1HLWA 2ZUAA 1KDNA 1HIYA 2HVEA 1PAEX 1W7WA 1WKJA 4UOGA 3FBCA 3VVUA 1EHWA 1NLKL 3B54A 3EM1A 3ELHA 5C7PA 3Q89A 3Q8UA 3EE3A 3GPAA 3VVTA 1VYAA 3EVMA 1U8WA 2CWKA 3BBBA 2BEFA 3EICA 1LEOA 3VGVA 2DXEA 4FKXA 4WBFA 2DY9A 4CP5A 1NDCA 3ZTQA 3BH7B 3BBCA 3FBFA 1PKUA 3FCVA 3DKDA 4ANCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AND A;  1XIQ A;  1ZS6 A;  1NDP A;  3PJ9 A;  3R9L A;  1K44 A;  3FBB A;  4F4A A;  3ETM A;  1HHQ A;  3EVW A;  2HUR A;  4ANE A;  1NDL A;  5IOL A;  3FKB A;  1NSP A;  3PRV A;  3DDI A;  3G2X A;  1NB2 A;  3NGR A;  4DI6 A;  1BHN A;  3ZTO A;  2AZ3 A;  2DXD A;  3EJM A;  1WKL A;  1F3F A;  3VGU A;  4F36 A;  3EMT A;  1NPK A;  1F6T A;  2B8P A;  1BUX A;  3FCW A;  3NGU A;  1LWX A;  1B4S A;  2DXF A;  3ENA A;  3L7U A;  3MPD A;  2BX6 A;  3NGT A;  1NUE A;  5CAA A;  3Q8V A;  4UOF A;  1NDK A;  3ZTP A;  4UOH A;  2HVD A;  3NGS A;  4ENO A;  4DUT A;  3Q86 A;  3FBE A;  2DYA A;  1S59 A;  1NCL A;  1XQI A;  4HR2 A;  1JXV A;  4C6A A;  3VGT A;  1B99 A;  3FC9 A;  1MN9 A;  2VU5 A;  4FKY A;  3Q8Y A;  4W98 A;  1BE4 A;  3JS9 A;  1NSK L;  3Q83 A;  1WKK A;  4O0N A;  1S5Z A;  1UCN A;  3EVO A;  3B6B A;  3ZTS A;  2B8Q A;  5CAB A;  2AZ1 A;  4S0M A;  3BH6 B;  1S57 A;  3ZTR A;  1NSQ A;  1MN7 A;  3WX8 A;  4KPC A;  3VGS A;  3GP9 A;  4DZ6 A;  3BBF A;  1NHK L;  2NCK L;  4EK2 A;  5BXI A;  1HLW A;  2ZUA A;  1KDN A;  1HIY A;  2HVE A;  1PAE X;  1W7W A;  1WKJ A;  4UOG A;  3FBC A;  3VVU A;  1EHW A;  1NLK L;  3B54 A;  3EM1 A;  3ELH A;  5C7P A;  3Q89 A;  3Q8U A;  3EE3 A;  3GPA A;  3VVT A;  1VYA A;  3EVM A;  1U8W A;  2CWK A;  3BBB A;  2BEF A;  3EIC A;  1LEO A;  3VGV A;  2DXE A;  4FKX A;  4WBF A;  2DY9 A;  4CP5 A;  1NDC A;  3ZTQ A;  3BH7 B;  3BBC A;  3FBF A;  1PKU A;  3FCV A;  3DKD A;  4ANC A; 
#chains in the Genus database with same CATH topology
 4KB7 A;  1B0P A;  1V3R A;  2XMV A;  1YSJ A;  5C42 B;  1REV A;  3PHE A;  3RAX A;  2MPU A;  4V19 J;  2HQ3 A;  3JXO A;  1FFS B;  2E1R A;  3FCW A;  2YWE A;  3PYD A;  4DV4 J;  2NLW A;  3ZZ0 A;  1FVQ A;  5DM7 Q;  5E0O A;  1FK9 A;  2KG0 A;  2QZ8 A;  4JI0 F;  4M5I A;  2UXB J;  1JQG A;  1FX4 A;  1Y4Z B;  1DLO B;  1BC6 A;  1NSK L;  2VC1 A;  2XGP A;  1FJG J;  2DNG A;  1IWG A;  3KMS A;  4ECQ A;  3T9Z A;  2JEI A;  3TUP A;  3AB4 B;  4K5R A;  3M2R A;  1JMT A;  4OI2 A;  4ZPD A;  3CJ3 A;  4EYH B;  2AP6 A;  3HVR A;  3FMW A;  3QGI A;  4DR1 F;  2NQP A;  4EUV A;  3MED A;  3ET6 A;  3R5A A;  1LEO A;  4NI2 B;  3GG0 A;  3T1Y F;  1XEZ A;  2Q3P A;  5D4P A;  3HZE A;  4KE5 A;  2FY8 A;  4X4P A;  3MR5 A;  3C8Y A;  1RYS A;  3GV7 B;  4I4B A;  3TVZ A;  4Y2C A;  1NDL A;  4G1I A;  3W9H A;  1O51 A;  5BJR A;  4LRB A;  4OZ5 A;  3S1T A;  4BHQ A;  1CUL B;  4Q2M A;  2W2N P;  2QLJ B;  4CM2 A;  4QWD A;  2DIS A;  1Q16 B;  2IY5 B;  4TVA B;  2MB0 B;  2BA9 A;  3R5D A;  2YNI A;  1RT7 A;  4W4M A;  1OS5 A;  4DV0 F;  3GU0 A;  2VUG A;  2MKI A;  3KJQ B;  2VJV A;  1FES A;  2MDA A;  1SH2 A;  4PWD B;  3MR2 A;  4R0E A;  2ZH3 A;  1YK9 A;  3G6Y A;  4CLT A;  1BWE A;  1HNX J;  1TAU A;  1K0V A;  5HRO A;  5LMN J;  1FNM A;  4NLW A;  4AD6 A;  2DNQ A;  3U1M A;  5F9L A;  3GII A;  1WG1 A;  2HNZ A;  5KFV A;  2QYG A;  4NZ6 A;  2I6W A;  1FVS A;  1XNQ J;  1FWP A;  2YNF A;  4N47 A;  2BW7 A;  1R0C B;  3LP1 B;  4LFC F;  3JQK A;  3UDC A;  1UEK A;  3MEG B;  2O3D A;  3SDE A;  3UDE A;  2UUB J;  3E8O A;  1FDD A;  1YJU A;  2DNN A;  2B9Y A;  5M2P A;  4LSZ B;  4WIQ A;  1L3S A;  4UW2 A;  2IDE A;  3AOB A;  1AYE A;  1I3O B;  1RBO B;  3MCS A;  1NKB A;  4X4N A;  3RTV A;  2VBZ A;  3EGN A;  1LW0 A;  2MGZ B;  1R0A B;  1SI9 A;  1QM9 A;  4RJV A;  2WOM B;  3X3U A;  3UWT A;  4KV8 B;  1T11 A;  3WC2 A;  4J7C A;  4H4O A;  4IG0 B;  4ED5 A;  3PYF A;  2ZH6 A;  4EGL A;  3P8B B;  1RT3 B;  3RBZ A;  3GYN A;  5IWA J;  2MZR A;  4WK1 A;  2RDJ A;  3POT A;  3JTP A;  2D69 A;  1IKY B;  3M6X A;  5JVG Q;  5EUH A;  4KSE B;  1TKT B;  2W8L A;  2QFI A;  3U27 A;  4MT1 A;  3GMG A;  4FF4 A;  2PE8 A;  1VCT A;  5D78 A;  3PKM A;  4WE1 B;  2V63 A;  3DGP A;  1U1N A;  3DRP B;  4ZLP A;  3KG0 A;  3RRH A;  1UW4 A;  1RTD B;  2BOA A;  2VOP A;  3SSS A;  1RWX B;  3EXY A;  1XMQ J;  3MAA A;  2QLX A;  3TX0 A;  1EAR A;  4FN5 A;  4F04 B;  4QCL A;  1JLQ A;  3C66 A;  1SUQ A;  1QDU B;  1RWM B;  1IM6 A;  2AJ1 A;  4F4Z A;  2PN6 A;  4DL0 C;  3JB9 k;  1VC0 A;  3KJV B;  3CMA S;  2ZZN A;  4Q8F A;  2ZUG A;  1ZAX A;  1X4H A;  4UOH A;  4ED0 A;  3ILO A;  2GX8 A;  2OSR A;  5D15 A;  2ROG A;  3NGD A;  1T9T A;  1B64 A;  6FD1 A;  4WU2 A;  2RT3 A;  1JKH B;  4KGZ B;  4Y00 A;  3HT0 A;  4RW7 B;  3T1H F;  1S1V A;  3VR1 A;  5DDP C;  1VLY A;  2QEX S;  1TL7 B;  1KLM B;  2CVE A;  4ZLN A;  2IRY A;  2B4P A;  4HHU A;  4UOG A;  4LF6 F;  3KMQ A;  2BRK A;  3BKU A;  3O44 A;  2PT0 A;  4M5H A;  1LWE B;  1NK0 A;  2MZJ A;  1LWF A;  2BR0 A;  4KGK A;  3VZH A;  2VDH A;  3J7A 1;  3OUY B;  3PJ9 A;  1VRT A;  2IJR A;  2LXF A;  2OP5 A;  3NMA A;  1SXL A;  4YME A;  1AB8 A;  2ACM A;  2MKC A;  5AJ3 J;  4DSE A;  1FT8 A;  1H98 A;  2J8S A;  5EWF A;  3EJM A;  4MKA A;  4DCO B;  2VON A;  2O01 C;  2D9O A;  1U47 A;  3GYG A;  2AEM A;  4DMZ A;  1NO8 A;  1HW8 A;  1ZM4 A;  4HHH A;  5I3U B;  2V68 A;  3LAM A;  4RBU A;  4W90 B;  4ILL A;  3N4W A;  3Q8Y A;  4FYV B;  2AEJ A;  1IR0 A;  2W01 A;  4LFA J;  3EGV A;  1JK9 B;  1Y5N B;  3QFH A;  4DSK A;  3A3P B;  3BRE A;  3NWG A;  2M2B A;  3PW0 A;  3D28 A;  5C42 A;  4FPR A;  4U8V A;  4J9Q A;  2O1P A;  1TFY A;  4X4V A;  4I2Q B;  4YEA A;  4URQ U;  1BQN B;  4WFN Q;  1VDH A;  5KFG A;  2I2Y A;  4OYB A;  1FTR A;  2E5I A;  4I2P B;  2V34 A;  3OD2 A;  5IOL A;  1DLO A;  3PRV A;  4P75 A;  5CYJ A;  1HR0 J;  4IG3 B;  3DGV A;  1WOR A;  2A6M A;  1IBM F;  2AWZ A;  1Q5Y A;  2UXC F;  2A6O A;  1LW2 B;  3M8P B;  1N0U A;  4C0H A;  3VAF A;  4FVM A;  1Y9O A;  1VRU B;  2E5G A;  3VQS A;  2HZA A;  2J9D A;  1RWK B;  2RU9 A;  3IBF B;  3UPF A;  5A8R B;  1R6Y A;  4NI2 A;  2RQC A;  4PG7 A;  3KK2 B;  2MZQ A;  1DBD A;  1TQL A;  3KNA A;  2P6T A;  4IKA A;  2BJE A;  1U1Q A;  3PNI A;  1W7W A;  1CUL A;  3AQO A;  2M52 A;  4DJB A;  2CNK B;  4LJM A;  5CQG A;  5IM0 B;  4ZVU B;  4DUZ F;  3W5Z A;  5IZH A;  4ILR A;  2V9K A;  1RT6 B;  1Q82 T;  4ANC A;  2UVW A;  3A3N B;  3ISN D;  1PC4 A;  1SKS A;  2KFN A;  1BXN A;  4DXL A;  1NEE A;  4PWD A;  1HNI B;  2A2D A;  4DV6 F;  7FDR A;  3CUN A;  1FX2 A;  1WKL A;  2QA4 G;  4IO9 Q;  3F56 A;  1RWU A;  4NXN F;  3KLG B;  1EAY C;  3TI0 A;  3OR2 B;  4OJH A;  2J6T A;  2E9R X;  2ZOM A;  2KTQ A;  2QLW A;  4C2M A;  3LP1 A;  4L3N A;  4U95 A;  3NNC A;  4MAK A;  2FVR A;  3MEG A;  1P1T A;  1Q7Y T;  1T03 B;  2YKO A;  3DLH A;  2WCX A;  2OPS B;  1FRJ A;  2PMW A;  8ATC B;  3RR7 A;  1LNQ A;  4JI2 J;  5CYQ B;  3K5O A;  3FGV A;  3R6G B;  2QFJ A;  2M0G B;  4O0I A;  2ZE2 A;  3H5S A;  4ECY A;  2MGZ A;  1R0A A;  5KG2 A;  2E9Z A;  3UNG C;  2V94 A;  5HI7 A;  5GAH U;  2POK A;  2WOM A;  4LRF A;  4KV8 A;  4ED6 A;  3IM9 A;  4IG0 A;  3LWM A;  1RT3 A;  2DHS A;  4BDP A;  1S9F A;  1F3F A;  1IKY A;  1L3T A;  3KHG A;  3ILL A;  3OHA A;  4CH1 A;  5LMU F;  4DQI A;  5C24 B;  4N7T A;  1Q8K A;  2AIR B;  4KHP J;  4FF2 A;  3CIM A;  1ZAV A;  3MEE B;  4USK A;  1ZZN A;  4KIA A;  4B3M J;  1R31 A;  4WE1 A;  4U96 A;  2BKO A;  2G0C A;  3ITH A;  3RYL A;  3DRP A;  2VFR A;  3QMQ A;  3R97 A;  1UVN A;  3M8Z A;  2QMU B;  4RUB A;  2ZM6 F;  4GO5 X;  1NK8 A;  3IC1 A;  2R8J A;  4D3G A;  1IKW B;  3OQ2 A;  1Q7L B;  5B0E A;  4ZA1 A;  4ZVF A;  4PCQ A;  2ADC A;  4P2M A;  5H1S V;  1TKD A;  4ZP9 A;  5LSR A;  5DRK A;  4DR5 J;  1OY8 A;  3KJV A;  1QTM A;  2MLX A;  4TQS A;  5DG7 A;  2MQN A;  1Q4R A;  2PEB A;  2EG2 A;  3EVW A;  3BSN A;  2RML A;  3OT9 A;  3C16 B;  1DFD A;  2RDD A;  1JKH A;  3TRG A;  4RW7 A;  2EFP A;  3TVK A;  4HT5 A;  2OFG X;  3IM8 A;  4U7C A;  1X7V A;  1M0S A;  2BX6 A;  1TL7 A;  1VK3 A;  2VBX A;  4LQ3 A;  4CO5 A;  3WHI A;  2P9G A;  3AA9 A;  1KLM A;  1QVG R;  1WG5 A;  4OYW A;  4X4R A;  3JTN A;  5IS2 A;  5J1E B;  3G6V A;  1U1P A;  5KFC A;  4FF1 A;  3RUB L;  4RU2 A;  2XMU A;  2UV8 A;  1UPM B;  5H9F J;  4DFJ A;  1LWE A;  4YHH F;  2W8K A;  3IGV A;  4HI1 A;  1DY3 A;  5JXS A;  2YTC A;  4M8L A;  1B7F A;  2VA3 A;  1HD0 A;  2FJV A;  1GH8 A;  2P9E A;  1HFE L;  2V4J B;  2ZJP Q;  2H3E B;  1RA6 A;  4ZPT R;  2JHE A;  4CQ1 A;  4TN2 A;  1S6O A;  5IT9 Y;  4EWT A;  2A1B A;  5I3U A;  2E1C A;  3CCV S;  2IBK A;  2OHD A;  5T14 A;  5I42 B;  1WEL A;  1H2V Z;  1JJC B;  4Q7A A;  2XEX A;  3U1N A;  3DXS X;  1SQE A;  4N76 A;  5E7O B;  3ENQ A;  5EGY A;  1URN A;  4QWE A;  1R3N A;  4TU9 A;  4C8Y A;  5GMD A;  3M9N B;  4K2X A;  2ZKU A;  4IYQ A;  4KQZ A;  4O44 A;  2IC3 B;  2HQD A;  2ZBQ A;  3Q2T C;  4I2Q A;  1AA1 B;  1FF2 A;  3KUG A;  3P49 B;  1BQN A;  3GWC A;  4RLE A;  3PRB A;  3LGM A;  1WF1 A;  4YB7 A;  5HMX A;  4D3H A;  2KO1 A;  3PX0 A;  4G1Q A;  4OI1 A;  1PIL A;  4I6W A;  4B3S J;  1H7W A;  2ASJ A;  4IG3 A;  1RUS A;  1EZZ B;  5RUB A;  2ZJR Q;  3GB0 A;  1N34 J;  1NB7 A;  5C25 B;  1LW2 A;  2PFD A;  2XWY A;  4NZ7 A;  2WSC C;  4TY9 A;  1R8P A;  3M8P A;  1LFP A;  4F4A A;  4NYZ A;  1VRU A;  2XM3 A;  3NCP A;  2WBM A;  2FHK A;  3RR8 A;  1RT4 B;  2CPF A;  4I69 A;  2W4C A;  1UP1 A;  5A8R A;  4R5P A;  3M8W A;  2R9L A;  1QAY A;  2LCW A;  1RLD A;  3MPD A;  1PYT A;  3VCD A;  3KK2 A;  2CDQ A;  2HGM A;  4USU A;  3DLE B;  4F0H A;  4A8K A;  1KS2 A;  4GKK F;  2C2K B;  3PIP Q;  3H4D A;  2DVI A;  1S9E B;  5FLX U;  5DQG A;  3I32 A;  5IM0 A;  1U7L A;  4IRD A;  4RBT A;  1FO1 A;  2QJ3 A;  2V8V A;  1YX2 A;  1RT6 A;  4N8O A;  4CIO A;  1KFD A;  1X8D A;  2F4V J;  4RW8 B;  3UDV A;  2CKW A;  4DG1 B;  4JUZ A;  1HNI A;  2JSX A;  4WWS A;  4ZMM A;  4GKJ J;  3CSK A;  1ZH5 A;  2JFD A;  3NCQ A;  1UZD A;  3KJN B;  1N33 J;  3H7H B;  3MCN A;  4N5S A;  4F4W A;  3MEC B;  4NEZ A;  4NML A;  4JI6 F;  3NAI A;  3KLG A;  4F2R A;  3BH7 B;  3OR2 A;  4C0B A;  1DTQ B;  4AQY J;  3D66 A;  2WTF A;  1UJ4 A;  3MI7 X;  1NPP A;  3GIM A;  1S6P B;  3BSO A;  2HZC A;  3QPI A;  4PG6 A;  3KDO A;  4F3Q A;  4DS5 A;  4OYP A;  1T03 A;  3N5F A;  1TKZ B;  2OPS A;  3OTB A;  2JDJ A;  1SC1 B;  5KFX A;  3NS6 A;  3FBE A;  3IWN C;  1XR6 A;  5CYQ A;  4JI1 F;  3O2I A;  4OIX A;  4NA2 A;  5B0D A;  4ZJQ A;  1HNW F;  3D0I E;  2NZC A;  3JSM A;  5LXY A;  3RB0 A;  4I56 A;  5HJX A;  4JI3 F;  4DR7 J;  1WHX A;  1YDL A;  4CLS A;  3ZTS A;  1RTJ B;  5D4L A;  2W4D A;  5B0C A;  2VC0 A;  1VQL S;  3S7R A;  3HX9 A;  2K8G A;  3RG6 A;  3VZI A;  1KTV A;  2AX0 A;  1WTB A;  2V4Q A;  1RT1 B;  3NY0 A;  1TL1 B;  3PW2 A;  3A8I A;  2ADB A;  2AV5 A;  2HFO A;  3HF5 A;  4DFM A;  4NL5 A;  2VOD A;  5C24 A;  3CDB A;  2OGU A;  5LSL A;  3OL9 A;  3FEX B;  2V8D A;  4LRC A;  3UD3 P;  5J2Q A;  3MEE A;  4LF1 A;  3BDE A;  2DIU A;  4HVZ A;  5BR8 F;  3IN5 A;  2RDI A;  3FQK A;  4OZ1 A;  2DGU A;  1IN0 A;  2EFQ A;  1IKW A;  2LEP A;  3MR6 A;  3B4M A;  2K3K A;  2Q1L A;  2LXI A;  2W2Q P;  3EDQ B;  5IQQ A;  5E3Q A;  3IR5 B;  4OYZ A;  2HFS A;  5E41 A;  4OX9 F;  3OTO J;  3GZ7 A;  3IGN A;  4XIU A;  5CAB A;  6FDR A;  1PCA A;  2OML A;  1F2H A;  4NZ0 A;  4F4X A;  3C16 A;  1Q78 A;  5HLF B;  2P9C A;  2KI2 A;  1U0H B;  2Z8Q A;  3VVT A;  4FF3 A;  3MMJ A;  2OSQ A;  2VQF F;  2B9X A;  1GMW D;  1RKI A;  3ULH A;  2YH0 A;  1G1X A;  2E44 A;  2R2R A;  1A6L A;  4C0O C;  2CPX A;  3CJ8 A;  2ZOF A;  4O3S A;  3R3T A;  5J1E A;  3J81 U;  2VHG A;  2HUR A;  3ILI A;  3B82 A;  3QIP B;  1S0M A;  1VMB A;  3W61 A;  2XSJ B;  3ZTO A;  2AZ3 A;  3QID A;  3DRR B;  4WKR A;  5DQI A;  1RWP B;  3PEH A;  4DHV A;  3F0N A;  2EPI A;  4NRT A;  1C1B A;  3X1L B;  1LWC B;  1X4E A;  1FKO B;  1NK9 A;  4K4Z A;  4I6Y A;  2C3U A;  3WDO A;  1L3U A;  2V4J A;  3MWB A;  4X4O A;  2MKS A;  3SYZ A;  4DBQ A;  1MRO B;  3TUI C;  2LU2 A;  2ZIT A;  3O1L A;  3CJK B;  1XNR F;  2PGC A;  4OLO A;  4KJI A;  4FVC A;  2CZ4 A;  1M5H A;  1GXT A;  3W9J A;  3MEK A;  4WKY A;  5I42 A;  1S0V A;  1CC8 A;  2M88 A;  2ZC3 A;  1PAE X;  1O6X A;  3MR7 A;  3Q8U A;  1XMB A;  4MKB A;  1TVR B;  3LP2 B;  1D0E A;  3D3B J;  2D3Z A;  2X3D A;  3PKY A;  1CJV B;  4OZJ A;  4OJ1 A;  5THW A;  1F3V A;  1QSS A;  2IC3 A;  2BQ3 A;  2KRB A;  3H20 A;  4LIW A;  4FXV A;  5L1K A;  2UUC F;  2MJU A;  1FRI A;  1TAQ A;  1VJW A;  3SZ2 A;  3QYY A;  4UY8 T;  3PRD A;  4YDX A;  4YY3 F;  2HBQ B;  1RCX B;  2CPI A;  1AUS L;  3G9C A;  3I31 A;  4ZP7 A;  5A6P A;  2BAB A;  2GV1 A;  3VAI A;  4CRJ A;  3VGT A;  3N6M A;  3HCX A;  2AT1 B;  3TJA A;  4Q44 A;  1YIT S;  5C25 A;  1M5S A;  3B6B A;  3TAN A;  5ETN A;  2MLZ A;  2DNM A;  1SKU B;  2AHO B;  2YKQ A;  2PMZ D;  1KQS R;  3TVY A;  3KKF A;  3MD1 A;  2DH8 A;  2LVW A;  1U1K A;  3TQ1 A;  1RT4 A;  1XN9 A;  4O3N A;  1Q95 G;  2YNH B;  3FBC A;  2P5V A;  4ILM A;  2BBE A;  4K7Q A;  1VQS A;  5LOQ A;  2HFZ A;  1JJ2 R;  3OL8 A;  3H5Y A;  2HK3 A;  2MQL A;  1HNZ F;  4GRS A;  3N6L A;  3PO4 A;  4CO0 A;  2WHO A;  4ZPB A;  3QSY B;  3DLE A;  1SH0 A;  4KY3 A;  2DKO B;  3H0P A;  1SCJ B;  1S9E A;  4E0D A;  3UW1 A;  4LT6 A;  4HL9 A;  2CIM A;  5KT5 A;  2JC0 A;  1S9G B;  3THP A;  4DV5 J;  1BQX A;  4RW8 A;  3QRQ A;  3H90 A;  4C8L A;  2P6S A;  4DG1 A;  2N7Y A;  2XZW A;  2ZWP A;  1JNZ B;  1RWN B;  3PG9 A;  1NCL A;  1A0O B;  3KHL A;  1LFW A;  4ZVT B;  2R3V A;  1KP6 A;  2NYI A;  3MEC A;  2XMK A;  2KZM A;  1KNZ A;  2M3D A;  1T02 A;  3EXC X;  1DTQ A;  3CUL A;  2IVF B;  5ITH A;  5EWE A;  2CVI A;  1HI8 A;  3BBF A;  4B3O B;  1S6P A;  3HFZ B;  3AXK A;  4B9M A;  1UA1 A;  2XMA A;  4IQX A;  2YNG B;  1U6B A;  1TFW A;  5F8G A;  5EX0 A;  4ICL B;  2UXD F;  2HHW A;  1NKE A;  2OEJ A;  1TKZ A;  3BKF A;  1OO0 B;  3SCJ E;  1XR5 A;  3L95 X;  3LUY A;  2OI2 A;  3J81 j;  2VG6 B;  1BMQ B;  3CC7 S;  4CLF A;  2C2D A;  1R6V A;  3TZW A;  2HBY B;  4LF8 F;  1HD1 A;  1B0T A;  5BYR A;  4JI8 F;  2FJW A;  4DR2 F;  3W66 A;  2QL7 B;  5GAG I;  1RTJ A;  2YVS A;  1LWX A;  2B4O A;  1RT1 A;  1TL3 B;  4C8O A;  3IP0 A;  4C98 A;  3R5J B;  3QZ7 A;  1UVI A;  3QZ8 A;  1NU4 A;  1URR A;  2VL1 A;  3NBP B;  3HZG A;  4J91 A;  2CJQ A;  4MIW A;  4N8N A;  2GQ2 A;  2C2E A;  3CD6 S;  3OR1 B;  1Q5V A;  2BVZ A;  4C3M A;  1H0H B;  1DHM A;  1VIO A;  5F8J A;  1H72 C;  1U4B A;  5GAD I;  5T41 A;  4OYA A;  2G2Z A;  1CS4 B;  3EIC A;  2OH2 A;  2BE7 D;  2HMI B;  2IRX A;  2C3Y A;  3N0V A;  2D9P A;  4BWJ A;  3GCX P;  3G4S S;  1VQO S;  1OPI A;  3GQC A;  2XLI A;  3G87 A;  2F8M A;  1DAX A;  1WAC A;  2OTL S;  2QL9 B;  2P8I A;  3SIP B;  4Y3C A;  2ZOG A;  1VBX A;  2G9O A;  1T9X A;  3ENA A;  2J9C A;  1GX6 A;  4CYU B;  2BJD A;  1ZA1 B;  5KT6 A;  4ZP8 A;  2DYA A;  2XSF A;  2WVB A;  2B9E A;  3OSN A;  3BQ2 A;  3J7Y U;  4DV4 F;  1U0H A;  2C2R A;  3JSY A;  4FNH A;  3DI6 B;  4P6Q A;  2ILZ A;  1J5E J;  4ZIV A;  1CQM A;  3ZZR A;  2E7X A;  2UXB F;  2E1M C;  3GJS B;  2FQQ B;  3M6V A;  2YPY A;  5B0B A;  1FJG F;  3QIP A;  4CH7 A;  4XO0 A;  5KT4 A;  2XSJ A;  2Z2Z A;  2E7V A;  3DRR A;  1RXO B;  3V6D B;  4BS2 A;  2YWG A;  3VTI A;  4B9S A;  1M5O C;  4NLS A;  1M1H A;  2RUG A;  1LWC A;  1HBU A;  2B5J B;  1FKO A;  2AYB A;  1CG2 A;  3D67 A;  1B3T A;  3OJS A;  1F60 B;  3EZ5 A;  3LF0 A;  2HND B;  1MRO A;  3GYX B;  3KUH A;  4ECV A;  3D6T B;  5F9N A;  3CJK A;  1FD2 A;  1HBM B;  1R8A A;  2VG5 B;  5DDO C;  1N32 F;  2ZH5 A;  3W64 A;  1S77 D;  4KBI A;  2B6A B;  4L6V 3;  4HR2 A;  2OPQ B;  2RRB A;  1C1C A;  1TVR A;  3LP2 A;  2XS2 A;  2UV8 G;  2XYH B;  4A8S A;  4GVB B;  1VQ7 S;  4IOB A;  2CG4 A;  4FYW B;  2UVV A;  1NHU A;  1JLB B;  2W1B A;  4R8U B;  5KFU A;  3WX4 A;  5E3R A;  1CJV A;  3CE8 A;  3UD5 A;  2QN6 B;  1HNX F;  2CJ9 A;  2ZH7 A;  4DV2 J;  4ZLL A;  5LMN F;  2DGT A;  2K1R B;  4JBC A;  4B3R J;  3BM7 A;  2RQ4 A;  4HH0 A;  1XNQ F;  4ECZ A;  1HQU A;  4IH7 A;  4HTJ A;  4C8Z A;  2Q43 A;  3AQP A;  4ZN1 A;  2JRS A;  1YJR A;  2H5E A;  3PX4 A;  2ZVI A;  3N01 A;  2HBR B;  4USJ C;  4B9U A;  3MOZ A;  4NLV A;  2DR7 A;  2UUB F;  1U25 A;  3K59 A;  2R8I A;  3IRX B;  3OFF A;  1FDN A;  3K5P A;  1U2F A;  4HTI A;  4EBD A;  4B08 A;  2ZDO A;  3P5B P;  3A4T A;  1NH8 A;  5KAK A;  3D2W A;  4EZ6 A;  2YNH A;  1OY6 A;  2VH7 A;  2V2Z A;  2IYG A;  1H38 A;  1UCN A;  1YRT A;  3ZNJ 1;  3ENV A;  1SJF A;  1NSQ A;  4QWC A;  3R7B B;  3LH2 S;  1TUW A;  2NPI A;  4DUY J;  5IWA F;  2ZH9 A;  2JNJ A;  2JX2 A;  3T5L A;  1EKR A;  3D5M A;  3HFK A;  1S9G A;  3HXM A;  4GC6 A;  2Y1I A;  2LA6 A;  1YBT A;  4A8W A;  2OPP B;  1VC5 A;  2OJ3 A;  2CG8 A;  8AT1 B;  1Q8B A;  4NRU A;  2IRU A;  4ANE A;  3BYP A;  2BJ7 A;  3BV8 A;  2VQE J;  1YJN S;  2NUU G;  2UUA J;  2CPE A;  4ZVQ B;  4N41 A;  1JLE B;  3JQJ A;  1XMQ F;  1UZH A;  4NA1 A;  3HHE A;  5HVG A;  4B3O A;  3OFG A;  1C0T B;  1JLG B;  4QR2 A;  1HYS B;  4IH6 A;  1H74 A;  5ETP A;  4ICL A;  4ZVP B;  3W8G A;  5K20 B;  3L09 A;  7FD1 A;  5HO4 A;  4ZIT A;  3FJ2 A;  3CJS A;  2CQ2 A;  4O0N A;  5KFN A;  3G71 S;  2V8H A;  4IOA Q;  3GIK A;  2AZ1 A;  1D09 B;  2VG6 A;  5J1P A;  5KG7 A;  1F9H A;  4P2F A;  3DRY A;  2U2F A;  3BGO P;  5KG4 A;  3BGL A;  3I82 A;  3IFE A;  2M8H A;  3ZC4 A;  3BO4 A;  2C2M B;  2FPH X;  2HHS A;  2AW0 A;  4NLO A;  3RW6 A;  2YX4 A;  4B3T J;  4OI0 A;  3PW5 A;  4L74 A;  2KXH A;  5DG9 A;  1EQM A;  2V67 A;  1SQF A;  3GSD A;  3ETO A;  2F1F A;  1TL3 A;  3IO1 A;  3T1Y J;  1UWA A;  1W2B R;  2AX1 A;  3AFG A;  3K89 A;  1HHT P;  1GTE A;  2ZD1 B;  3MZI A;  4LBI A;  5U47 A;  3NBP A;  1UVK A;  2KDO A;  3UVJ A;  3OSP A;  1JB0 C;  2DO4 A;  1U09 A;  4YB6 A;  4USI A;  1TEL A;  3OR1 A;  2LQ9 A;  5HJY A;  2CQ1 A;  5AJ3 F;  2ILY A;  3RGI A;  4O3P A;  4CNY A;  1IBL F;  4KKO B;  1IJE B;  1M1K T;  2VU5 A;  4PPD A;  3JS9 A;  4TLR A;  3M2V B;  4OMF G;  1CS4 A;  2HS4 A;  2NPF A;  2Z0G A;  2HMI A;  3CIZ A;  4Y2K A;  2BM1 A;  5L9X A;  2VB6 A;  1JIH A;  2WON A;  1HI1 A;  2IM2 A;  2R4F A;  2FLN A;  2CQI A;  4LFA F;  3NMR A;  3CD0 A;  1X5O A;  2L9W A;  3LW5 C;  1DQA A;  2HVE A;  4RNN A;  1TK5 A;  4DR3 J;  2XI3 A;  4P71 A;  1NJI T;  4CYU A;  3NEK A;  3VAJ A;  2ROE A;  4DS4 A;  3JAM Y;  3HHL C;  4L75 A;  1FE4 A;  3CDU A;  5GAE U;  4IFY B;  2AU0 A;  3HPO A;  1RIS A;  5F0W A;  3IR7 B;  2NS1 B;  5G0R A;  1S99 A;  4ECX A;  3NGU A;  1MMN A;  1VS3 A;  2GGP B;  1FKA F;  1TL4 A;  3KLH B;  4DUT A;  2R2U A;  2F63 A;  1HR0 F;  2W7A A;  2V8P A;  3LO3 A;  2MKJ A;  1WOO A;  1NPR A;  4HDG A;  1S76 D;  3DDK A;  1MN9 A;  2JOQ A;  3HFV A;  2DR9 A;  1ELO A;  4JV0 A;  2CRL A;  3HSD A;  2G2O A;  1RBA A;  4TU8 A;  5L38 A;  4KGX B;  2H51 B;  2WW4 A;  2B5J A;  3FQL A;  2GAG C;  3CCQ S;  3LAK A;  4JI4 J;  5L8R C;  1YHQ S;  1ZM9 A;  4LQ9 A;  3VAK A;  2B43 A;  2HND A;  3AB2 B;  4QBU A;  3NOG A;  2KZZ A;  3HSG A;  3IAM 9;  3UI3 A;  2XMM A;  3LGN A;  4DLG A;  4BCA A;  1T3N A;  4H4K C;  1HBM A;  4ERD A;  2XZD B;  2VG5 A;  2GVZ B;  3BGR B;  1QSY A;  1ZTT A;  2B6A A;  2Z30 B;  3EDR B;  4PG5 A;  3DOL B;  5AE1 A;  1RAG B;  1SB6 A;  2OPQ A;  2MQQ A;  1DTT B;  1TK0 A;  2KJW A;  1DQ8 A;  2R7X A;  3G86 A;  4GVB A;  1UEU A;  4X4S A;  3BPS P;  3IBC B;  1RTH B;  4JYA J;  4RO0 A;  1JLB A;  1PO6 A;  1Q79 A;  2KJV A;  4R8U A;  3OFH A;  1RZM A;  4MIB A;  3W65 A;  1N5S A;  1NZA A;  2EFV A;  2YNI B;  4IFV B;  1U6Z A;  1VRQ C;  1D1U A;  3OVA A;  2DRA A;  3OTE A;  3IRW P;  2K1R A;  4LFB J;  5E5N A;  1S1X B;  2EBG A;  1QLN A;  1ICE B;  1ZZF A;  4OX7 A;  1NH7 A;  1S57 A;  2HEK A;  2R7Q A;  4G1P A;  4ZVR B;  1GFW B;  2E29 A;  2GML A;  4J9R A;  2V69 A;  4HT7 A;  2C28 A;  4PXD A;  3FSX A;  2LEA A;  2BJ1 A;  2IFX A;  5AXN A;  3R5B A;  1RHJ B;  4W92 B;  3MMC B;  4AFF A;  3IRX A;  3ONQ A;  4NXM J;  1YJ9 S;  4NOH A;  2EFG A;  2M9K A;  1FJC A;  2DXE A;  4FKX A;  2LEC A;  1BWV A;  2FJX A;  4ED1 A;  4LSL A;  4EI2 A;  3SDE B;  1VLO A;  1M90 T;  2VPX B;  5IT9 U;  2YX7 A;  1QVF R;  2IMO A;  1CJU B;  4ZVS B;  5DGA A;  5HAT A;  2KRR A;  1GMU A;  1UWB B;  5LJ5 Y;  1WC3 A;  4F67 A;  3Q8R B;  1KEK A;  1LW0 B;  2L3M A;  4Y28 C;  2ASD A;  5E3P A;  4ZPW R;  3QAT A;  3VWS A;  1KHV A;  3T41 A;  3GR1 A;  3D54 A;  4H4O B;  4KHP F;  2JJ4 D;  3TQE A;  4F0M A;  2AJ2 A;  2R7T A;  2UU9 J;  1S49 A;  4DF8 A;  2DHG A;  3PTW A;  2LDY A;  1WDT A;  1ZM3 A;  2OPP A;  4B3M F;  3AD7 C;  1D8Y A;  5AXK A;  3DLJ A;  3T19 A;  4B9L A;  1UEV A;  2X7I A;  1H3D A;  1GMW A;  1RHU B;  2IVM A;  2NSC A;  4C11 B;  1DRZ A;  1C4C A;  2WB1 D;  3PX6 A;  3Q8Q B;  2FYX A;  3OBI A;  4RWX A;  1JLE A;  4E98 A;  4ECS A;  1U1O A;  4QWB A;  1C0T A;  1JLG A;  1G6B A;  3P3D A;  1RCO B;  1HYS A;  3SCL E;  2VAS A;  2W2M P;  4XPC A;  2E1P A;  4DR5 F;  3UDL A;  2CQD A;  1O0P A;  3M8Y A;  4PG4 A;  3M8R A;  3FRY A;  4XDC A;  3TZZ A;  1IJF B;  4Z7Y A;  2FD2 A;  2HRU A;  1P9Y A;  4BLG A;  1DAR A;  3HHL B;  5AE2 A;  4NYO A;  1GT8 A;  1RAF B;  1SC3 B;  2VBY A;  5E2Q A;  4DV7 J;  1RHR B;  4P2X A;  1WJ9 A;  1BQM B;  3OTC A;  4B02 A;  3JSR A;  1S79 A;  2X51 A;  2W24 A;  1FFG B;  1GXL A;  4J90 A;  4QW8 A;  2KM8 C;  2L08 A;  3FDS A;  4WTY A;  1DUR A;  3HDS A;  3MDF A;  2VD3 A;  2ZD1 A;  2H48 B;  4NWB A;  1VQ4 S;  4JV5 J;  3DXB A;  2WAQ D;  2C22 A;  1FA0 A;  3FFI B;  1S0N A;  3H98 A;  1JX4 A;  1YJ7 A;  2MST A;  3FBF A;  1PKU A;  3GR0 A;  4KO0 B;  1CBK A;  1SVD A;  2CYY A;  4J37 A;  3D6F B;  4KKO A;  4OI4 A;  4Q0B B;  2CPZ A;  1LWF B;  1MG7 A;  1TP7 A;  2FVS A;  3SV3 A;  2M8D B;  3M2V A;  2E1A A;  3VGU A;  1OYD A;  3EZO A;  2L48 A;  4KHM A;  2CNL B;  4QOT A;  4UTG A;  2Z2Y B;  3CF5 Q;  2E5L J;  2BM0 A;  1F5B A;  2ZBI A;  3LAN A;  2UP1 A;  1KQF B;  3ADA C;  2MYF A;  2IBO A;  3R1L A;  4CWB A;  1PBU A;  1VOM A;  4P7T A;  5K9F A;  2GJI A;  4DR6 J;  4LVN P;  2RRA A;  5A8W B;  1VC6 A;  3NOC A;  3LA0 A;  4IFY A;  3B78 A;  1V6H A;  4ES3 A;  2XNR A;  1NHK L;  2XZT B;  1HLW A;  2ZUA A;  4OV6 A;  5JMN A;  3NLC A;  5KOW A;  1KON A;  4YS2 A;  2G2Y A;  5JVH Q;  2GGP A;  1VI7 A;  1S7H A;  2HFV A;  1UVL A;  1UPP A;  3KLH A;  3THT A;  1JNR B;  3AD9 C;  5IC4 B;  4K2J A;  5IV3 A;  1N34 F;  3RRG A;  2CUY A;  4NYP A;  4OHV A;  2ZHB A;  1EP4 B;  1NK6 A;  2DXD A;  1SKW A;  3QRR A;  1GK8 A;  5HAN A;  2VIC A;  2G0J A;  2HPU A;  5KG6 A;  1N5Y B;  3CB4 A;  4ALZ A;  2GIR A;  4OZ3 A;  4I6A A;  3BGU A;  2JWN A;  4W98 A;  2H54 B;  1RK8 A;  4UOC A;  3JTO A;  1VBY A;  1X4F A;  2Y0S D;  5M2U A;  1M5K C;  2RNE A;  3NNA A;  3KYL A;  2GVZ A;  3ZTR A;  3BGR A;  1IWA A;  3AOD A;  2ZM6 J;  3IBW A;  3DOL A;  3PFE A;  4PQA A;  4DEZ A;  1AXQ A;  1DTT A;  4RPF A;  2D3O R;  4CLL A;  4CLZ A;  4OV1 A;  2F4V F;  1SV5 B;  1RTH A;  5L1J A;  3GJT B;  4U7U K;  4GKJ F;  3HHN B;  1ZS6 A;  2HRY A;  1N33 F;  2GAH C;  1SL2 A;  2ATC B;  4IFV A;  2R7U A;  1WWH A;  3QWU A;  4A48 A;  1R43 A;  3G2X A;  5AT1 B;  2UVU A;  1S1X A;  4AQY F;  2RE1 A;  5GVQ A;  4UY8 5;  5D8H B;  4ZVG A;  2HS0 A;  4FXW A;  4FP9 A;  3A1Y G;  2KVQ E;  1QAJ A;  5KT3 A;  3KLI B;  2AD9 A;  3NGS A;  4DV1 J;  2ALZ A;  3DMJ B;  3TJ9 A;  4ED2 A;  3FC9 A;  3MMC A;  2AJ0 A;  3DU5 A;  3T9N A;  2OPR B;  3QBC A;  2XLJ A;  4PG8 A;  4DFP A;  1PYO B;  2MXY A;  1MSW D;  2NR0 A;  4QPT A;  4AXJ A;  4F4Y A;  1TKX B;  3K58 A;  4NX9 A;  2DK2 A;  3UN2 A;  4UZC A;  1WD6 A;  3I87 A;  3TO8 A;  4DR7 F;  1CJU A;  4RBV A;  1WG4 A;  4PYA A;  3GON A;  1KVK A;  3CPW R;  2KKH A;  1F1B B;  1FJE B;  1UWB A;  1UFK A;  1G4C A;  2NZ4 A;  2D41 A;  1KTQ A;  2ZE2 B;  4WBF A;  5DJB A;  5H9E J;  3GE9 A;  4WFY A;  3KNG A;  1H6K X;  3NS7 B;  4EZ9 A;  3CED A;  1WHW A;  1PJ5 A;  3W63 A;  3NAH A;  1HQE A;  3OLA A;  2KM8 B;  2J7W A;  4CLK A;  2IDL A;  5CCL A;  2VKZ G;  1HA1 A;  4F0K A;  4U67 Q;  2YX1 A;  1CQN A;  2UVR A;  2QO3 A;  2V8G A;  2XY6 A;  1U1L A;  2HVZ A;  2C2Z B;  1O8B A;  4O3R A;  2EVZ A;  2GQQ A;  2GO9 A;  2NXN A;  2HIY A;  2W4P A;  4WJB A;  2OEL A;  2Y8W A;  1MWZ A;  5D0E A;  1KWM A;  4DSJ A;  3RAM A;  4C11 A;  2LKZ A;  3L7P A;  4A46 A;  3IMQ J;  3MGJ A;  3D68 A;  3QRP A;  1UVJ A;  1U24 A;  2ATL A;  4PWW A;  3ITH B;  2HAI A;  2CAD A;  3BF4 A;  5KFL A;  1WC1 A;  3OTO F;  4NLG A;  4ZHR B;  1I5O B;  2MSS A;  1SL0 A;  4RUH A;  3M4X A;  4HDH A;  1S6U A;  2SXL A;  2BYC A;  3EUN A;  3AAW B;  3AJ2 A;  3PJW A;  3E51 A;  3HHL A;  3L3C A;  2VFV A;  2ERR A;  2QA2 A;  1S1T B;  1HWL A;  3F41 A;  4FYD A;  1WC5 A;  3OJU A;  3CO0 P;  2DNO A;  2ZVS A;  1BQM A;  5A0Y B;  3W2W B;  1FKP B;  4E2F B;  4USM A;  4WU3 A;  3FK4 A;  1N36 J;  1NDK A;  2A3J A;  4FXD A;  2CJX B;  4M1K A;  4P7V A;  4Y65 A;  3DOM A;  3FFI A;  3CJ5 A;  1RP5 A;  2DD8 S;  4KO0 A;  4HAC B;  2HBZ B;  4Q0B A;  2BAC A;  3P45 B;  3DOK B;  5F8I A;  2Q79 A;  2XWX A;  3C6T B;  1ZET A;  2ZHO A;  4QU7 A;  4ES2 A;  4WII A;  3FUY A;  1EET B;  4XDD A;  2DNR A;  1EHW A;  3VHQ A;  2I9S A;  3A13 A;  4Y0F A;  5D77 A;  4RNO A;  2MQ8 A;  2VOO A;  3EPI A;  2V2Q A;  2DNK A;  4H4K A;  2J8A A;  5KT2 A;  3V6J A;  3SSR A;  3D1H A;  3SFU A;  2Y8Y A;  3MTK A;  1QUV A;  3UR0 A;  5L1L A;  1ULR A;  2FHJ A;  4NCA A;  2RD5 C;  5A8W A;  8RUC A;  1YJW S;  4PZV A;  3HJV A;  2D74 B;  3DRS B;  2E5J A;  4LF2 A;  1FEE A;  3PYE A;  3ZTP A;  2V50 A;  3MAQ A;  4LBP A;  2AGP A;  2J7K A;  4AE5 A;  2GNK A;  3AJD A;  2DNL A;  4O44 B;  3T5H A;  4I0W A;  3MMA B;  4C8K A;  1HNW J;  3LWL A;  1X4B A;  5HN0 A;  2J5A A;  4ELT A;  1KOO A;  4BC7 A;  2PI4 A;  1FRX A;  2K7J A;  3CT9 A;  1LXJ A;  3CCT A;  3CCR S;  3P96 A;  2CXE A;  5BXI A;  4RW4 B;  4ZOS A;  1CEZ A;  5DET A;  3MMB B;  3CCS S;  1EP4 A;  2FHM A;  1RWV B;  5I3Q A;  3NP5 A;  4G1Q B;  2FB0 A;  2K3I A;  4USH A;  2UUW A;  5J1N A;  1N5Y A;  4IDK B;  4I68 A;  4DR4 J;  1NDP A;  4JV1 A;  2JZ5 A;  2ZC4 A;  2VFT A;  1FRM A;  3MPV A;  4MH8 A;  3M6W A;  5IT4 A;  2DXF A;  4DQQ A;  3K0J A;  4AT1 B;  1IVZ A;  4ER8 A;  2UUT A;  3TX8 A;  2FIU A;  1KQG B;  4R5P B;  4F50 A;  2M70 A;  1RAD B;  2WK4 A;  3VAL A;  3GLJ A;  1WI6 A;  1JXV A;  4M95 A;  3CDA A;  3DNC A;  5IQ6 A;  2KT3 A;  3AOA A;  1SV5 A;  4JB8 B;  1NJX A;  3FMB A;  3EVO A;  2L9D A;  3TUJ C;  3NG8 A;  5DZ7 A;  3MOJ B;  5K8O A;  2MQM A;  3OL7 A;  2BW2 A;  2EI5 A;  1U1M A;  4KGV B;  4A8Q A;  1RTZ A;  4F25 A;  3PVX A;  1X5T A;  5D0H A;  3HK2 A;  3G82 B;  4ZCL A;  4X62 J;  1SPB P;  1T8E A;  4I7F B;  3KLI A;  4OHX A;  2HHV A;  2IAJ B;  3RBE A;  3DMJ A;  1CC7 A;  1NK4 A;  2AYM A;  2XI2 A;  2OPR A;  4JOU A;  2GIQ A;  2VV5 A;  5KFO A;  1JJH A;  1NPK A;  4KT0 C;  1TKX A;  2F8E X;  5AXM A;  2CNN B;  1OPZ A;  2ZZM A;  3L4B C;  2NRE A;  5C2G A;  3HSZ A;  1XQI A;  3QO9 B;  2PFF B;  1EX8 A;  4WP3 A;  3O3L A;  2MHE A;  2BRL A;  3RB6 A;  3GG1 A;  2KFY A;  3GV5 B;  3A12 A;  1V3S A;  4WFX A;  1IKV B;  2BQU A;  2IJN A;  3JSM B;  2RUS A;  2HQF A;  4ELV A;  3GFZ A;  5E3C A;  5CA5 A;  4Z2X A;  4J5O A;  3QAU A;  2R8G A;  2W2O P;  1RU2 A;  4E8U A;  4QR0 A;  1ZYQ A;  1N6Q B;  4RNF A;  4A8X A;  2GHW A;  3SFG A;  4KRW A;  3F44 A;  4MJK A;  1G2E A;  5H9E K;  4QPX A;  1N5Q A;  2OD6 A;  3PFO A;  4NLD A;  2VPY B;  1BY9 A;  2GJ2 A;  2GQC A;  1MML A;  1P27 B;  5K8N A;  5J2Q B;  2JEF A;  2GHV C;  4F8R A;  3RB4 A;  1WSV A;  2ASY A;  4O4G B;  1OSD A;  1X31 C;  6AT1 B;  4KR0 B;  2CPJ A;  1IBK J;  4AL5 A;  1Q8L A;  3F73 A;  1JLA B;  4OQJ A;  3ZZT A;  2W9C B;  4KHR A;  2HVD A;  5EDW A;  4LR9 A;  4DQR A;  4X2B A;  1N4L A;  2X1F A;  4ZHR A;  4O3O A;  4LRA A;  1HBN B;  4C48 A;  1TZ0 A;  1QTN B;  2JLG A;  3A8E A;  4YDD B;  3FVY A;  4UT4 A;  4L76 A;  2B8Q A;  3C14 B;  1AW0 A;  3IA0 A;  5A2Q U;  4ETX A;  1S1T A;  1SJ3 P;  4CTA A;  1J5E F;  3KUE A;  2R2T A;  4OYI A;  5A0Y A;  1EIY B;  3W2W A;  4J9V A;  4FBT A;  3N6N A;  1FKP A;  1XMO J;  2KHC A;  4MTP A;  4B9N A;  3FEZ A;  1SC6 A;  1AUD A;  4QWA A;  2LYV A;  3CCW A;  1FI4 A;  2QMX A;  4U8Y A;  5A8K B;  2HLT A;  3VAM A;  3DLL Q;  2MY7 A;  4U9R A;  1VK8 A;  1KHW A;  4F26 A;  1S12 A;  1HQ2 A;  1XK8 A;  4HAC A;  4ZDN A;  1M5V C;  2Q66 A;  3DOK A;  3THV A;  3Q86 A;  3W2V B;  3C6T A;  2MKY A;  4YFU A;  4PQU B;  1C1B B;  2HIQ A;  1EET A;  2V9W A;  1YBU A;  3Q83 A;  1RKJ A;  2XCA A;  4UQT A;  3S6E A;  2BZ2 A;  4Q8E A;  4F3O A;  3W5Y A;  4S0M A;  4PXE A;  1MMD A;  2BAN B;  3KK3 A;  2BMB A;  3M7V A;  3K8V A;  4H54 A;  4WFZ A;  1D8Z A;  2HHH J;  1YZ6 A;  1Q8I A;  4CO3 A;  4RW9 B;  2L41 A;  3CW2 C;  4X65 J;  4BWM A;  4B17 A;  5MAO A;  1TMM A;  3RW7 A;  4YQW A;  2BEF A;  4WXO A;  1LV5 A;  5F3T A;  3DRS A;  3WZ0 A;  4DV2 F;  3BR9 A;  3CDE A;  4K0K J;  2J0W A;  2YWF A;  3DKD A;  2CA9 A;  2QIF A;  2ROP A;  4ZVE A;  5IXU A;  4RW6 B;  2I0X A;  4B3R F;  2W2P P;  2Q6B A;  3GFH A;  3NGR A;  3MMA A;  2DNY A;  4EMD A;  4F36 A;  2DHH A;  5JJB A;  2X1G A;  1NAQ A;  1VQP S;  3SV4 A;  4QJV A;  5F41 A;  1NM2 A;  2XB2 D;  5CAA A;  2R7R A;  4XAK A;  2DEI A;  2CQ0 A;  1HW9 A;  4RW4 A;  3MCM A;  1OIA A;  1KLN A;  1HI0 P;  3MMB A;  1S1U B;  2XGQ A;  2LQ5 A;  1GAO A;  2KYZ A;  3L9Z A;  1S48 A;  5B09 A;  4IDK A;  4Y2A A;  2HWH A;  3UO0 A;  5KFY A;  3CME S;  3HLU A;  1SKR A;  4X66 J;  4DPU A;  2LLZ A;  3MM6 B;  2ACY A;  3SI8 A;  4RX6 A;  3ENW A;  5LL6 d;  2F8H A;  4PEO A;  3R7N B;  1WKJ A;  2ZHA A;  2HWT A;  2XLK A;  5KFB A;  4DUY F;  2KXN B;  2N4C A;  2BKP A;  4EFA C;  1MWQ A;  5ADZ A;  4FDF A;  5HP1 B;  1ZPV A;  3JAM U;  3N79 A;  4WCE Q;  4OI6 A;  4AL7 A;  1P9Q C;  2J9E A;  1NB2 A;  4J9N A;  1BHN A;  1RB0 A;  5FDL B;  1CJK B;  4M94 A;  3VF0 B;  2V5H G;  1BUX A;  3S8S A;  1JLF B;  1L5U A;  1YVF A;  3LTO A;  2QRR A;  2VQE F;  3HUL A;  2EG1 A;  4NLT A;  2UUA F;  5KFA A;  1ARO P;  2QMW A;  1ZOT A;  3EZU A;  4UF4 A;  2EWH A;  2B51 A;  3G82 A;  1XBW A;  5FII A;  1DJ0 A;  1FDB A;  1F5C A;  2DGV A;  1SBR A;  4C8N A;  2F9J A;  2Y9H A;  5D4N A;  2C3O A;  3AD8 C;  4I7F A;  4P73 A;  4ZVH A;  3AY0 A;  3T1A A;  2IAJ A;  2YWH A;  2DGW A;  3H40 A;  4Q2L A;  5M2R A;  5SZT A;  4CO4 A;  3CJ4 A;  3T3F A;  2AQ4 A;  5C7P A;  4JI5 J;  1VQK S;  3K5N A;  2RS8 A;  3KFW X;  4GC7 A;  1Y3J A;  3OXG A;  4NMX A;  1X9M A;  2AGO A;  3QT6 A;  1X9W A;  4ZS6 A;  2WVF A;  4C3L A;  2X1B A;  2ZNY A;  5K5M A;  4B3T F;  3GV8 B;  2JH3 A;  3MM9 B;  2RH3 A;  1Y11 A;  1S10 A;  2EC0 A;  3QO9 A;  3CVK A;  1UAW A;  3CJ2 A;  3PHT A;  1NSP A;  1UET A;  2C2O B;  4X4T A;  2MTL A;  1KC8 T;  2GVD B;  1IKV A;  2Y3Y A;  2B8P A;  2AYE A;  1ZM2 A;  2WSE C;  3RBX A;  3OVB A;  2Y0B B;  2QGF B;  3O6Q A;  1DZ5 A;  3UN5 A;  1N32 J;  3KK1 B;  1VQY A;  1N6Q A;  4OYX A;  1WKK A;  4TLQ A;  2Z4P A;  1Y0H A;  5HVF A;  2B4U A;  1WHY A;  5C5J A;  1XWL A;  3M8S A;  4WP9 A;  2XMT A;  3NKY A;  1NSA A;  1QUP A;  2KB2 A;  4NEY A;  5DM6 Q;  4IUF A;  1KVI A;  2HFU A;  3SQG B;  2MZT A;  3ZNU A;  4CH0 S;  2F7V A;  4NLP A;  3VV2 B;  4ZIW A;  4O4G A;  1GNK A;  2CDR B;  2FVQ A;  2J0S D;  1JLA A;  2W9C A;  5F8L A;  3HI9 A;  1HWK A;  1WOS A;  2RHQ B;  3G96 A;  2CQC A;  4DR3 F;  2K2P A;  2FUG 9;  2VJU A;  4ATN A;  1HBN A;  3FNN A;  2DGO A;  4OJG A;  3TAQ A;  3C3L A;  1V9O A;  4FYX B;  2K06 A;  1RAA B;  4C3K A;  1GX5 A;  3B8H A;  4WP8 A;  4WTO B;  1IR1 A;  3R2C J;  3C14 A;  3CD5 A;  1APS A;  5B0F A;  4WF9 Q;  1FRL A;  4P74 A;  2M4M A;  1RAI B;  4WYL A;  4OI3 A;  1PG5 B;  5ETK A;  3US5 A;  5JUM A;  4M5M A;  5KFP A;  2V0N A;  2DH7 A;  3TNV A;  3HKZ D;  3PR5 B;  5DDR C;  2VIH A;  1VHI A;  2FC9 A;  1VJQ A;  3PO5 A;  2XYP B;  1A7G E;  1S72 S;  1HMV B;  1ZA2 B;  3R7S B;  2ZH1 A;  1RBL A;  4K5S A;  2RIJ A;  1CSJ A;  2EKY A;  3HVA A;  3CJ0 A;  2R2S A;  3GIR A;  5A8K A;  1ZTW A;  1PAU B;  3PW4 A;  3EE3 A;  2W9A A;  3BYR A;  4JI4 F;  3WBZ A;  2JFK A;  5IV4 A;  1NDC A;  1P8G A;  2BJ8 A;  2XG8 A;  2QX0 A;  4A8F A;  1W25 A;  1EQ0 A;  5IT0 A;  4LF4 J;  3W2V A;  3LQV A;  3R9L A;  4PQU A;  3ZZP A;  4I67 A;  2YKM B;  2WVD A;  5LSO A;  1S4F A;  2D1C A;  1HBU B;  2EBE A;  1D9A A;  2FVP A;  3MM7 B;  1FD8 A;  2DNH A;  3RRK A;  5H9F K;  3BZQ A;  5LJ3 Y;  1UKU A;  1R8C A;  3NGT A;  2BAN A;  2IYI A;  2QTW A;  3D3C J;  4OJ3 A;  4YN3 B;  3Q8V A;  4M5G A;  2VZ9 A;  3FRZ A;  3KLV A;  4YB1 P;  3J80 Y;  4YOE A;  4RW9 A;  4JYA F;  3QWP A;  5E3A A;  2OEK A;  3D4J A;  2QC3 A;  4DL3 A;  3SXL A;  1C1C B;  2PII A;  2GIF A;  1YJV A;  3UCG A;  4NCG B;  2HKE A;  1MU2 B;  4RW6 A;  4DX6 A;  3BR8 A;  3EPG A;  4LFB F;  2DTJ A;  1KFS A;  3M2U B;  3MAH A;  1U02 A;  3Q89 A;  2W25 A;  2HHQ A;  5IC6 B;  2YPZ A;  4HHJ A;  4DPT A;  4K4Y A;  5CYM B;  4A47 A;  2VFS A;  1HNV A;  4DDF A;  1AT1 B;  4J9M A;  4LF9 J;  3MPU B;  1T95 A;  2P2C B;  1HWJ A;  4NXM F;  4DQS A;  1HQU B;  2Z57 B;  1D9D A;  1S1U A;  2V2K A;  4DPY A;  1X5P A;  5D3G B;  2ZH8 A;  4NLQ A;  3U7J A;  3MUR P;  1YGY A;  3EGZ A;  1N0V C;  1XER A;  2DO0 A;  1UW9 A;  2Q6C A;  3TA1 A;  4UQG A;  3MM6 A;  4ENO A;  2YWK A;  1NBE B;  3TZY A;  2BJ9 A;  1IBL J;  4C6A A;  4I1T A;  5C2C A;  1X9S A;  3K5L A;  4YB5 A;  4TKT A;  3I0R B;  5B08 A;  2DR5 A;  1VQ5 S;  3JYT A;  2FLP A;  1FNX H;  1HBO B;  3I55 S;  4RUC A;  5HP1 A;  2CNO B;  2PSZ A;  3MF5 A;  5KFD A;  3RJM B;  3M9O B;  2UU9 F;  3E3X A;  3SCK E;  4RUA A;  5D0G A;  5FDL A;  3GSI A;  1CJK A;  3ELH A;  1YI2 S;  2EFO A;  3EVM A;  3TOQ A;  1JLF A;  1RQ0 A;  3OTD A;  4OZ0 A;  1PYS B;  1YTY A;  2A18 A;  2B3T B;  2HSE B;  5DQH A;  4A8Y A;  1I94 J;  2XBP A;  3BKT A;  4G65 A;  3MUT P;  1PGZ A;  2AYG A;  1U1R A;  2HK2 A;  4M5L A;  3O8W A;  3QNW B;  1VQ8 S;  2FGC A;  1VFJ A;  4NLX A;  4HEA 9;  4X4Q A;  3MUM P;  1J2V A;  1NUE A;  2R7V A;  5EN1 A;  1X0F A;  1VGY A;  3ILJ A;  5DO2 A;  4LIR A;  1S59 A;  1L3K A;  3IAS 9;  5HBM B;  1K47 A;  1EB0 A;  2QLB B;  4BBY A;  4JI7 J;  1QJH A;  3MD3 A;  3MFH A;  4OHZ A;  4FBU A;  5DGB A;  1R8B A;  5J2N B;  5KG0 A;  2MQP A;  3BH6 B;  1ZBT A;  5GAG U;  4DV7 F;  2R8K A;  2DHX A;  2PMH A;  2XHC A;  3MM9 A;  3Q8P B;  2FHO B;  4IRC A;  3TA0 A;  4OLP A;  2E5H A;  2YKN B;  3SBM A;  2H5I B;  1KBR A;  3VVU A;  4RNM A;  2RQK A;  2GVD A;  4LRD A;  5DLG A;  3W5X A;  3BDP A;  3BBC A;  1CJT B;  1X60 A;  2E66 A;  4NLU A;  4JV5 F;  1N54 B;  3I6P A;  1N48 A;  5KFE A;  2J76 E;  3MTJ A;  4FS1 A;  3KK1 A;  3GFY A;  1Z4U A;  4Y34 A;  2N3L A;  2BJ3 A;  1T05 B;  2KHD A;  5GAD U;  3K2Y A;  1SJR A;  4F4K A;  1L3V A;  1KRP A;  9RUB A;  4H4M B;  1MLA A;  2UZA A;  5ETV A;  3UVJ B;  4HI2 A;  4IQM A;  3M6U A;  5L9N A;  2GMH A;  1BD6 A;  3SQG A;  2QG9 B;  2WW8 A;  2DB1 A;  3OLB A;  2DRD A;  2RQM A;  2E5L F;  3VQT A;  2V6A A;  2WSF C;  5HL7 Q;  2WRM A;  5IFM A;  2F40 A;  2IM3 A;  3NCR A;  3K8W A;  5F8N A;  4DR6 F;  2C3M A;  2WON B;  5ETT A;  1R89 A;  3CCE S;  2OFH X;  4URS A;  2NYH A;  2VG7 B;  1PBA A;  3K7R A;  2HS3 A;  1B0V A;  3PZP A;  4CI0 B;  4CM0 A;  5CD4 A;  2RB7 A;  4A8O A;  3R6L B;  3KHR A;  3Q23 A;  1EKS A;  5ETS A;  4DLE A;  5G0R B;  5I3P A;  1HMV A;  3CWJ A;  4PR6 A;  1WHV A;  1F2G A;  2DH9 A;  1JXE A;  3LAL A;  4ZJO A;  3CCJ S;  5HMZ A;  1SH3 A;  2B0G A;  3QGP A;  4KGM A;  3RB3 A;  1IBC B;  2QE5 A;  2K7K A;  3QSI A;  1TKT A;  2JEJ A;  4CT8 A;  2J6S A;  1NRK A;  5F8M A;  5GAH I;  1XC9 A;  3R5C A;  2M5Y A;  3D6M B;  4YR3 A;  3MHY A;  2R7O A;  1JLC B;  3P6Y C;  3DHW C;  4OL8 A;  5DS7 A;  5ETO A;  2YKM A;  3A3O B;  2XUL A;  3H5U A;  3MM7 A;  2N7C A;  3KDN A;  4ED4 A;  2F5G A;  5D0R A;  3HHL D;  1RTD A;  4IRK A;  4ECW A;  3DCA A;  2LEB A;  1Y5I B;  3CMQ A;  4ZK7 M;  4J9K A;  4YR2 A;  1FFW B;  4QIE A;  4XTT A;  4HYK A;  1T9Y A;  3V6H A;  2OAU A;  2J6U A;  1ROF A;  2Y1J A;  1HKA A;  4FS2 A;  2YH1 A;  3DDI A;  2CZV C;  3KTQ A;  3MR3 A;  1X4D A;  3L7U A;  1UVM A;  3D1Q A;  3H59 A;  4NCG A;  4V19 X;  1MU2 A;  3D1O A;  1Y7P A;  3IWL A;  2R8H A;  3M2U A;  2RS2 A;  1TV6 B;  1IQT A;  2XNQ A;  2DIT A;  1B99 A;  4ZLJ A;  1Y3K A;  2KT5 A;  3MCO A;  1S5Z A;  3NRB A;  4DV1 F;  1BLU A;  3KJF B;  3KG1 A;  4TXS A;  5CYM A;  3NS5 A;  1TR0 A;  2HLU A;  3HVW A;  1SIZ A;  3HMJ G;  3V81 B;  4ID5 B;  4PAB A;  2DT9 A;  5EWG A;  4KPC A;  4X64 J;  2KU7 A;  1HWU A;  5B0G A;  1PJ6 A;  3Q0A A;  4DV3 J;  5D3G A;  1FXL A;  3I4P A;  4CLY A;  2RKI B;  4K4S A;  1FHT A;  3OUY A;  1E6Y B;  3OPK A;  4LMZ A;  2J7U A;  3W7B A;  2FHJ D;  3VAG A;  1QY7 A;  3UE2 A;  4R25 A;  4BC9 A;  1FE0 A;  2LQ8 A;  2PI5 A;  2G0I A;  4LSL B;  2I8E A;  1RTI B;  3I0R A;  1N5T A;  1OQ3 A;  2EXU A;  2I1R A;  2WB4 A;  2ZBC A;  2Z2M A;  3OXF A;  4IH5 A;  1VR6 A;  1FRK A;  1HBO A;  2LQB A;  4UUX A;  2WVE A;  4Y2I A;  4LF7 J;  3CDW A;  1S1W B;  3PEJ A;  3PXG a;  5A2Q Y;  4UOF A;  2QT7 A;  1K1S A;  4LF5 J;  1FXR A;  4PAA A;  2QLF B;  3PW7 A;  3D7S B;  3CO9 A;  3IG1 B;  4UST A;  4CLW A;  4C9D A;  1KR4 A;  1I6J A;  1F9F A;  1MWY A;  1YZ7 A;  3QFW A;  4EBC A;  3DN9 A;  1N56 A;  3KG4 A;  1IXK A;  2DGQ A;  4ZCM A;  4DN0 A;  4U6P A;  1NK5 A;  3CC2 S;  3TAM B;  2HGN A;  1YIJ S;  5CH7 B;  2CQH A;  3OW2 R;  2XYG B;  5KFF A;  3BN7 A;  1JJ4 A;  2LU1 A;  1C2P A;  4I2P A;  4DL4 A;  3E01 B;  3C46 A;  3UD4 P;  3G8Q A;  3HT3 A;  1WF0 A;  5HBM A;  1PC5 A;  2IA0 A;  3ISN C;  1N5V A;  5L1I A;  5DZ6 A;  2RU3 A;  4K4T A;  2JEG A;  2FJA B;  1Q86 T;  3C15 B;  2COL A;  2GA7 A;  3KWM A;  5J2N A;  3EMT A;  4JI0 J;  3GJQ B;  4QIW D;  2R7W A;  2BDP A;  2HQG A;  5ETQ A;  1UFW A;  2OD4 A;  2BUN A;  3QJJ A;  2VPW B;  3VAH A;  1X4G A;  2YKN A;  4KAI A;  3UFC X;  2BE2 B;  2KXF A;  3M1V B;  1RA7 A;  1GXU A;  3I9Z A;  4HLB A;  5D4O A;  1N36 F;  1ITP A;  3WIV A;  3TYT A;  1RLC L;  1CJT A;  2HQI A;  4XPE A;  3OHB A;  2H5J B;  1FWK A;  4DR1 J;  3OFE A;  3WX8 A;  3PJX A;  3WIU A;  2IMW P;  3WQP A;  1LK7 A;  5B7W A;  1T05 A;  3HP6 A;  2DHA A;  4MKV A;  4H4M A;  1R8H A;  3PCO B;  4MK9 A;  3I4H X;  5CZX A;  4NAS A;  2ZJQ Q;  5CD4 H;  5KFQ A;  3AJ1 A;  2BOP A;  4DI6 A;  2D7S A;  4DV0 J;  1U6F A;  2F65 A;  3QT5 A;  2BV3 A;  2RF2 B;  3LP0 B;  1U2C A;  4PXC A;  2GJF A;  2A10 A;  4KFB B;  1J5O B;  3R1H A;  2NXJ A;  2ALY B;  3SQO P;  2HYI B;  4DL2 A;  3R27 A;  2OO4 A;  3Q2S C;  1HAR A;  1I51 B;  2OIH A;  3CGI A;  2AEF A;  3A8K A;  3J7Z T;  2HAF A;  4AYB D;  2VG7 A;  1WC4 A;  1FTC A;  2XO7 A;  1RAO A;  4LFC J;  5KFS A;  2HG4 A;  2AGQ A;  1H73 A;  2I5J B;  2KG1 A;  5BYQ A;  1VBK A;  2CAJ A;  1GMV A;  2XY5 A;  3J7A N;  4EYI B;  4X4U A;  4OZN A;  3TJ8 A;  1U2R A;  2XCP A;  2H4Y B;  1T9W A;  4KH1 B;  2NUH A;  2FZC B;  5CCM A;  4LUB A;  5DDQ C;  1Y5L B;  2FTR A;  3TAP A;  3PDN A;  3QJP A;  1AFJ A;  4K4W A;  4DR4 F;  2GC8 A;  3Q24 A;  2AJ4 A;  2MMY A;  1K1Q A;  1B4S A;  1JLC A;  4PUO B;  3SSQ A;  1X4A A;  4HKQ A;  4DL7 A;  2B7C B;  4MK7 A;  1VQM S;  3BQ0 A;  3G6X A;  4DSF A;  2EK6 A;  2HZV A;  2FZK B;  4MMO A;  3PAC A;  2HNY B;  4ZCI A;  1WTF A;  1KD1 T;  3P4U B;  1UTA A;  3OV7 A;  3AH6 A;  3HSJ A;  4TY8 B;  1RE1 B;  1K9M T;  3DHX A;  2JC1 A;  4M5J A;  2NCK L;  5HMY A;  1GQE A;  1K8A T;  1YG0 A;  2IVY A;  4P52 A;  4ZP6 A;  5KG5 A;  5HAO A;  3UCZ P;  2DCU B;  4Z7C A;  1LQ9 A;  3QAE A;  3NGK A;  1LXN A;  2IM0 A;  1REG X;  2BXJ A;  1WOP A;  3LOU A;  4L73 A;  3EGW B;  2XQC A;  4AUK A;  4WZM A;  3CJT A;  4CNZ A;  1TV6 A;  1I1G A;  5F0U A;  3U02 A;  4X62 F;  1AZS B;  2YQ3 A;  3QT7 A;  3DDN A;  2JVO A;  4MKY A;  1RDR A;  4O4R A;  2LDI A;  1Q81 T;  4ZKA A;  4QW9 A;  3UNY A;  1N8R T;  5J2M B;  3V81 A;  4ID5 A;  1A9N B;  1YBA A;  5HQM A;  3DRX A;  3W9I A;  4IR1 A;  2Z2L A;  4MFB B;  3T1H J;  1VQ9 S;  4OYM A;  4LRE A;  2HVH A;  2ZBR A;  4FKY A;  3SCI E;  1NME B;  5ETR A;  2RKI A;  2MKK A;  1E6Y A;  4OZ2 A;  4LF6 J;  1RAB B;  4B9T A;  4DX7 A;  4P9S A;  3V4I B;  3PM9 A;  1G7C B;  4JI2 F;  4DPW A;  3AHP A;  4ZCK A;  5KFT A;  1RTI A;  2H65 B;  4OX6 A;  1U26 A;  3W1Y C;  3I5B A;  2QYC A;  2MLY A;  1TMJ A;  4Y2M A;  1U8W A;  3VGV A;  5D6G A;  3N28 A;  4CP5 A;  2DR8 A;  4K59 A;  4DSI A;  1S1W A;  1E6V B;  3ICL A;  1Y00 A;  1VIS A;  3QLH B;  5B0A A;  1YQH A;  1C4A A;  3DFE A;  4XK8 C;  4NE9 C;  4MIA A;  3IG1 A;  4ETZ A;  1HQE B;  2XMW A;  4LSN B;  2X1A A;  4TQR A;  2YBV A;  2PC6 A;  1XJW B;  4L72 B;  5KTQ A;  1Y10 A;  2V4R A;  3MM5 B;  1Q0N A;  4WK3 A;  1RWO B;  3CD7 A;  4DCP B;  2ZNZ A;  2PD1 A;  4CO1 A;  2OUG A;  1IBK F;  4ZPC A;  4LR7 A;  3TAM A;  1GTH A;  3DYA B;  1KQK A;  4FZV A;  3E01 A;  3PR4 A;  2XY7 A;  1QAX A;  3HVT B;  3LGH A;  4J9S A;  1FDA A;  2DR6 A;  4QYZ J;  4KH0 B;  3KLF B;  2F4F A;  1P1L A;  1IM4 A;  1R7I A;  2OTJ S;  3C15 A;  3DLK B;  1RAE B;  3RU0 A;  4YR0 A;  2VDI A;  4OX8 A;  3FCH A;  4RL1 A;  1F9E B;  3TW0 A;  2XS5 A;  1F5A A;  4V1A k;  3ZTQ A;  3DLB A;  5EX3 A;  3TEH B;  3K17 A;  1HPZ B;  3FZB A;  3ISZ A;  2DPI A;  3HKW A;  2XHW A;  1S4E A;  1XMO F;  2WZ1 A;  1IBM J;  2BE2 A;  1HHQ A;  2D3O 1;  2UXC J;  2QA4 S;  1YRU A;  3D9B A;  3M1V A;  3FKB A;  4DFK A;  2AJF E;  3NNH A;  1PSD A;  1TK8 A;  2N3O A;  2DBB A;  1WUU A;  1KKH A;  1RSC A;  4M5N A;  5CHC B;  2ASL A;  3NXZ A;  1RJJ A;  3KXD A;  3TZX A;  2ABY A;  2AKW B;  3PV8 A;  3DOM B;  1OJ4 A;  3MM8 B;  2OLW A;  5J2P B;  3V4M A;  2J9D E;  4DUZ J;  3CCM S;  3VGS A;  4K4U A;  2AMC B;  5G4D A;  4HH1 A;  4DPX A;  5KFK A;  3AA8 A;  1SJ1 A;  2CQG A;  2O66 A;  5T7L B;  4EBE A;  1VYA A;  2RF2 A;  3LP0 A;  3T5J A;  3MPY A;  4DV6 J;  2HHH F;  4KFB A;  1J5O A;  4DSL A;  4CO2 A;  4KYZ A;  4X65 F;  3M8Q B;  4NXN J;  2WBR A;  4RU9 A;  3H5X A;  3KLE B;  2KYX A;  3UN3 A;  4DU7 A;  4K0K F;  2YKP A;  4NLY A;  4DX8 H;  1YRX A;  4Y6I A;  1F6T A;  1QAI A;  3BGF A;  2IIH A;  4QIF A;  4F3M A;  2QV6 A;  2I5J A;  4LVO P;  2EKN A;  4AL6 A;  1CPZ A;  5KT7 A;  2CJY B;  2YQ1 A;  2QL5 B;  3Q8S B;  2KFZ A;  5LT5 A;  3IR6 B;  3BSC A;  1RT2 B;  2IM1 A;  1LKZ A;  2FVC A;  4ZPV R;  1TL1 A;  1TU0 B;  4B3S F;  3BQ1 A;  1U48 A;  2HRT A;  1HIY A;  3DLG B;  4AXI A;  2CPY A;  1YKW A;  1T9V A;  4X66 F;  2LXU A;  3DM2 B;  4RZR A;  4PUO A;  2ZKT A;  3GIJ A;  4PKD B;  2XC9 A;  2H4W B;  3BB5 A;  5LMU J;  2ZFH A;  5CZV A;  3RZA A;  3N9U C;  1UA0 A;  2W9B B;  2QSF A;  2BKN A;  1IUJ A;  2HNY A;  2PA3 A;  2LA4 A;  4M5K A;  3G6E S;  2X3G A;  1MW7 A;  2R42 A;  1JXL A;  2YKA A;  1T9U A;  2VPZ B;  3LPE A;  4TY8 A;  2CPH A;  3H2L A;  3ZXW A;  3BSA A;  4UZB A;  4PPZ A;  3BJY A;  3V6K A;  1RYR A;  3V5R A;  5A76 A;  4CZC A;  3W62 A;  2W7O A;  3P5T L;  2C42 A;  1GEH A;  2KT2 A;  2HWI A;  2EFN A;  4UUW A;  1MNE A;  5HLF A;  1S0O A;  1AZS A;  2FC8 A;  3M32 B;  2HGL A;  4USV A;  1YLX A;  2RHS B;  3M05 A;  4DQP A;  3G8S A;  3BBB A;  2YQ0 A;  1VHF A;  2FZG B;  5J2M A;  2YXL A;  4N56 A;  3G8T A;  4JI5 F;  1QE1 B;  4MFB A;  4M5D B;  2YY3 A;  4RWW A;  4CDI A;  3J7Y I;  2J0Q D;  4DX5 A;  4GO7 X;  3GFX A;  1J27 A;  3NWR A;  4RNH A;  1M1G A;  3CNQ P;  4F7V A;  3TWZ A;  3V4I A;  2O67 A;  1NJZ A;  2YWW A;  4YHH J;  3PY8 A;  1OQ6 A;  1FJ7 A;  2EC2 A;  1YJT A;  4IR9 A;  3J80 U;  2HW3 A;  2A2C A;  2ZH4 A;  3SEO A;  5MLC V;  3C6U B;  3LPY A;  3CCZ A;  2FLO A;  1RHM B;  1W2I A;  2DPJ A;  1E6V A;  2PEH A;  3GIL A;  2FJE B;  5DG8 A;  3CJQ A;  1WC6 A;  3FZ2 A;  3QLH A;  1NJW A;  4CLU A;  2W7P A;  2MZ1 A;  1RAC B;  2NXU A;  1RGV A;  1CLF A;  4PWU A;  4ZPA A;  3U1L A;  5I4M A;  4LSN A;  4C7Q A;  4DZD A;  2JLE A;  2Y1R I;  2HQC A;  3MPW A;  3MM5 A;  4J9L A;  2GCF A;  2CFX A;  1K44 A;  1UMJ A;  3RAQ A;  2LMI A;  3ETM A;  1H2T Z;  2DJW A;  3IXQ A;  3K5M A;  2FJB B;  3DYA A;  2FLL A;  2G1H A;  3PIO Q;  3L7O A;  4EO8 A;  3HVT A;  1WDD A;  4ECT A;  4X84 A;  1R27 B;  1ZAW A;  2C2N A;  1S6Q B;  4RKU C;  3KLF A;  2IA6 A;  2GMJ A;  2CJK A;  2E9T A;  5F8H A;  1VQ6 S;  2CPD A;  3CXC R;  3DU6 A;  3DLK A;  3KOA A;  1WC0 A;  5GME A;  1ZPW X;  1N88 A;  4ELU A;  2EW9 A;  1FXD A;  1TL5 A;  2DNP A;  5ETM A;  1T0T V;  4GMK A;  3ZZY A;  4C8M A;  1HPZ A;  4QYZ K;  3IS9 B;  1MN7 A;  4MYT A;  4J9U E;  3HM9 A;  2J0X A;  4DZ6 A;  2LQJ A;  4F2S A;  3S01 A;  2MKH A;  4C4W A;  1FRH A;  4CTA B;  1NLK L;  3EM1 A;  1RHK B;  3HO1 A;  2M7S A;  2CZ9 A;  4KTQ A;  4MYU A;  1FEH A;  2RRN A;  5L39 A;  4LBH A;  3FBB A;  3FSY A;  3I0S B;  4LR8 A;  2MHN A;  1HL6 A;  2XTJ P;  3PYG A;  4LF4 F;  4GKK J;  2OKQ A;  4ED7 A;  3MM8 A;  1NND A;  5FD1 A;  5J2P A;  3V2U C;  1U45 A;  4ECR A;  5KFM A;  3CCU S;  2DEJ A;  4WFB Q;  2F9D A;  3ZZU A;  5K14 B;  1T3O A;  3H2V E;  5T7L A;  3HJF A;  4CCH A;  1H7X A;  1SQG A;  2IPO B;  5HSP A;  3BO2 A;  4ITS A;  4WPA A;  1IKX B;  4L3K A;  2DIV A;  1HWI A;  3BS9 A;  5KFZ A;  3M8Q A;  2GHP A;  1KVJ A;  2YNG A;  4JI6 J;  5K8P A;  3JQM A;  1H2U X;  5F3Z A;  1B70 B;  1WSR A;  1U8S A;  1KDN A;  3KLE A;  4FNI A;  1Z2L A;  3KK3 B;  2PDA A;  3T6J A;  2BE9 B;  4GVL A;  3TA2 A;  4QIV A;  1SJ4 P;  5AXL A;  4QR1 A;  2N82 B;  2Z58 B;  1FNO A;  2H9Z A;  2F3J A;  2VBW A;  2R7S A;  4DPO A;  4OHW A;  5KG1 A;  5KG3 A;  1T94 A;  2XO6 A;  1X0P A;  4DL6 A;  4LF9 F;  3CCL S;  4JI1 J;  3AT1 B;  4DF4 A;  2PO4 A;  2CQP A;  1RWW B;  1RT2 A;  1RU1 A;  2OMO A;  3FSI A;  3K57 A;  2IHR 1;  3BEG B;  2HHT A;  4JI3 J;  2ZZT A;  4ZVO B;  4NCB A;  4ES1 A;  3DC2 A;  3DLG A;  2IJF A;  4A8M P;  5FJ4 A;  2BQR A;  4WFA Q;  1SC4 B;  5KFH A;  4TYA A;  2AF6 A;  3MUV P;  4FYY B;  1BGX T;  3DM2 A;  1OY9 A;  4IOC Q;  2JLF A;  2MJN A;  1OMS A;  4P72 A;  2I38 A;  5KOX A;  1O5J A;  3TAR A;  5BYS A;  4DOZ A;  3EYZ A;  2W9B A;  4PRF A;  2ZDP A;  5HQL A;  4ED3 A;  2G13 A;  4WYW A;  2DCL A;  3GCW P;  2CWK A;  3H25 A;  2ZEJ A;  1KOH A;  3FCV A;  3ZFV A;  5KFI A;  1Q1K A;  5BR8 J;  4K4V A;  1C0U B;  1RT5 B;  4Q43 A;  2KL8 A;  1F0X A;  5AE3 A;  2RSQ A;  3KHH A;  3CC4 S;  2GZO A;  1V5V A;  4DL5 A;  1KN6 A;  3ZO7 A;  4Q5V A;  4DV5 F;  4ED8 A;  3M30 B;  3HHD A;  4QYR A;  1I94 F;  2WVC A;  3HD2 A;  3TR5 A;  4N77 A;  2DGS A;  2CQB A;  2HHU A;  3UR3 C;  4QZV B;  1UL3 A;  4OX9 J;  2HFN A;  4DCJ B;  1WNE A;  5FLX Y;  3M32 A;  2MQO A;  3SMZ A;  3H2U B;  2HVI A;  4M63 A;  3DI6 A;  3UQS A;  4R0J A;  4QIG A;  4Q45 A;  2N4D A;  1DQ9 A;  1REV B;  1NK7 A;  3JSB A;  1XTZ A;  5GAE I;  4ECU A;  3D0H E;  1QE1 A;  4JI7 F;  4M5D A;  2VQF J;  1NXI A;  1FK9 B;  3GP9 A;  2DRB A;  4EK2 A;  3W3S A;  3V6D A;  4IO1 A;  4OZL A;  5K8M A;  3IWX A;  4OFZ A;  4DWI A;  4RR5 A;  1XR7 A;  3QT8 A;  2RVJ A;  2AJQ A;  2FGO A;  1D3W A;  5A6W A;  4QU6 A;  4Z37 A;  2B4V A;  3M2R B;  2FJD B;  3BPD A;  3B4D A;  4EEY A;  5SUH A;  4EU0 A;  4A4J A;  5HVH A;  3R2D J;  3HHK A;  2DNZ A;  2ZBP A;  1OSC A;  1IQZ A;  4J9O A;  4K50 A;  3C6U A;  1UFL A;  3MED B;  3ET6 B;  1OYE A;  3GJR B;  2G4B A;  2KN4 A;  1EJ7 L;  1SL1 A;  2ZWO A;  2LP4 A;  1AFI A;  1XNR J;  1QSL A;  4P10 A;  2FY1 A;  2O5D A;  2GW8 A;  2MZS A;  3D0G E;  1NHV A;  1WEX A;  2CJA A;  1TUV A;  3EWG A;  2GFF A;  3E2E A;  2LFV A;  3MXH P;  3CJR A;  4JP8 A;  1Z1Z A;  1JWW A;  3T6B A;  1X4C A;  1RAH B;  1RHQ B;  1RT7 B;  3M9M B;  1W26 A;  4U7U D;  3H8Y A;  3BO3 A;  1V3Z A;  1N52 B;  3D6H B;  3FEY B;  3GPA A;  4NA3 A;  3ZZZ A;  4G6V B;  1SJQ A;  4URG A;  5HRO B;  1FCA A;  2DY9 A;  2VA2 A;  1NKC A;  2QSW A;  4OYO A;  4C97 A;  2UUC J;  3N5B A;  1S6Q A;  1Q53 A;  4ZN3 A;  2HNZ B;  4YY3 J;  1OWX A;  3I5C A;  3WC0 A;  2YNF B;  1PIE A;  4G3I A;  3MFI A;  5DLF A;  1QD1 A;  3I5A A;  2OEM A;  3QGH A;  1UJ6 A;  3OVS A;  2QA1 A;  3GTY X;  4KC5 A;  2CJB A;  1RAJ A;  2RJZ A;  1WEZ A;  3IS9 A;  4K4X A;  4EO6 A;  4TYB A;  4I64 A;  2CWX A;  5ETL A;  4ID8 A;  2A0F B;  1U0S A;  5GMK a;  1IR2 A;  7AT1 B;  4O3Q A;  4KPY A;  2MY8 A;  3ZZO A;  1TUG B;  3I9V 9;  5HMW A;  4DU8 A;  1G3O A;  3I0S A;  1K73 T;  2JVR A;  1HNZ J;  2Y1L B;  1V5I B;  5E33 A;  4YP3 A;  1VBZ A;  1ACM B;  1TTH B;  2C1E B;  3O5T B;  3B54 A;  3BN4 A;  4DN9 A;  1VIX A;  3POT B;  1NZ8 A;  1UJ5 A;  1HHS A;  3J81 Y;  4NPO A;  1CVJ A;  2EEY A;  2L9N A;  5CXT A;  5K14 A;  2XS7 A;  3CTR A;  2JL9 A;  3TP2 A;  1X5S A;  2APO A;  3A8J A;  3HD1 A;  1SIW B;  2CQ3 A;  2GO8 A;  4OHY A;  3H4B A;  4MK8 A;  1IKX A;  3C2P A;  3DGP B;  1YWX A;  2H1Y A;  2V2V A;  2NXC A;  1WF2 A;  3AXM A;  5HQ8 A;  4USW A;  2KVI A;  2ZH2 A;  3TEG A;  5HK4 A;  4CT9 A;  5KFW A;  1FWL A;  1LOU A;  1K0T A;  2VFU A;  3MAA B;  1BE4 A;  2G1D A;  2Z56 B;  1P6T A;  2B7B B;  4CLP A;  3J7Z 5;  4K8R A;  1S7I A;  2KH9 A;  1JLQ B;  1LK5 A;  1SUQ B;  1WEY A;  2RAQ A;  1FER A;  2UXD J;  3RBD A;  2HHX A;  2FDN A;  5LM7 E;  3I96 A;  2DGX A;  4NLR A;  4PXB A;  1U49 A;  3W60 A;  3NL0 A;  2VKR A;  3AOC A;  2MEW A;  4P2S A;  5EHH A;  3UCU P;  4X64 F;  2U1A A;  2HHP A;  1S1V B;  2B9W A;  4LF8 J;  4PYD A;  4QQB A;  3OL6 A;  4DV3 F;  4JI8 J;  4DR2 J;  4AND A;  1XIQ A;  2C3P A;  4FPI A;  1HNV B;  5KFJ A;  1M5P C;  1RI7 A;  3W8P A;  2B56 A;  5LXR A;  2EK1 A;  4WXW A;  5L46 A;  4TU7 A;  1B7Y B;  3QJL A;  4WZQ A;  3C19 A;  2NXE A;  1PJ7 A;  2E7W A;  3I56 S;  2RIL A;  1VRT B;  1VQN S;  2DY1 A;  4O23 A;  3R8Y A;  1NJY A;  4LF7 F;  2XMJ A;  1T7P A;  4B9V A;  1KSP A;  3T5K A;  4LF5 F;  3OXL A;  2CQ4 A;  1Z2Z A;  3EX7 B;  1WI8 A;  3JYT B;  4JV2 A;  2GS8 A;  1C0U A;  1D9F A;  1RT5 A;  3Q22 A;  2D3U A;  3QGG A;  9ATC B;  4ZJL A;  5KFR A;  3H42 A;  4TNO A;  4YUD A;  2PA8 D;  3M30 A;  2NSB A;  3TUZ C;  4F02 A;  3QQC D;  2VF3 A;  3R5G A;  1R0B G;  4J9P A;  1S97 A; 
#chains in the Genus database with same CATH homology
 4AND A;  1XIQ A;  1ZS6 A;  1NDP A;  3PJ9 A;  3R9L A;  1K44 A;  3FBB A;  4F4A A;  3ETM A;  1HHQ A;  3EVW A;  2HUR A;  4ANE A;  1NDL A;  5IOL A;  3FKB A;  1NSP A;  3PRV A;  3DDI A;  3G2X A;  1NB2 A;  3NGR A;  4DI6 A;  1BHN A;  3ZTO A;  2AZ3 A;  2DXD A;  3EJM A;  1WKL A;  1F3F A;  3VGU A;  4F36 A;  3EMT A;  1NPK A;  1F6T A;  2B8P A;  1BUX A;  3FCW A;  3NGU A;  1LWX A;  1B4S A;  2DXF A;  3ENA A;  3L7U A;  3MPD A;  2BX6 A;  3NGT A;  1NUE A;  5CAA A;  3Q8V A;  4UOF A;  1NDK A;  3ZTP A;  4UOH A;  2HVD A;  3NGS A;  4ENO A;  4DUT A;  3Q86 A;  3FBE A;  2DYA A;  1S59 A;  1NCL A;  1XQI A;  4HR2 A;  1JXV A;  4C6A A;  3VGT A;  1B99 A;  3FC9 A;  1MN9 A;  2VU5 A;  4FKY A;  3Q8Y A;  4W98 A;  1BE4 A;  3JS9 A;  1NSK L;  3Q83 A;  1WKK A;  4O0N A;  1S5Z A;  1UCN A;  3EVO A;  3B6B A;  3ZTS A;  2B8Q A;  5CAB A;  2AZ1 A;  4S0M A;  3BH6 B;  1S57 A;  3ZTR A;  1NSQ A;  1MN7 A;  3WX8 A;  4KPC A;  3VGS A;  3GP9 A;  4DZ6 A;  3BBF A;  1NHK L;  2NCK L;  4EK2 A;  5BXI A;  1HLW A;  2ZUA A;  1KDN A;  1HIY A;  2HVE A;  1PAE X;  1W7W A;  1WKJ A;  4UOG A;  3FBC A;  3VVU A;  1EHW A;  1NLK L;  3B54 A;  3EM1 A;  3ELH A;  5C7P A;  3Q89 A;  3Q8U A;  3EE3 A;  3GPA A;  3VVT A;  1VYA A;  3EVM A;  1U8W A;  2CWK A;  3BBB A;  2BEF A;  3EIC A;  1LEO A;  3VGV A;  2DXE A;  4FKX A;  4WBF A;  2DY9 A;  4CP5 A;  1NDC A;  3ZTQ A;  3BH7 B;  3BBC A;  3FBF A;  1PKU A;  3FCV A;  3DKD A;  4ANC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...