5IM0A

Crystal structure of the rna recognition motif of mrna decay regulator auf1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
MEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein D0
publication title Crystal Structure of the N-Terminal RNA Recognition Motif of mRNA Decay Regulator AUF1.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5im0A00
1WHWA 1YJ9S 1FJCA 3IRWP 2I2YA 1H2TZ 2MKCA 1F9FA 2RU3A 2UP1A 3VAHA 2ADBA 1N88A 1WEYA 3EGZA 2HVZA 2OSQA 1OWXA 1X4AA 3LPYA 3SDEA 2E5HA 2MGZB 4TU9A 2LKZA 1M90T 3P5TL 3TO8A 5CXTA 1RKJA 5D78A 1IQTA 2JX2A 3FEYB 4IOCQ 1FJ7A 1KD1T 5DDPC 1U1LA 3VAFA 1DRZA 1X5TA 2M9KA 1S79A 2MXYA 2GHPA 3ULHA 1KQSR 2KG1A 3VAMA 2FC9A 1ZZNA 2QA4S 4C4WA 2FPHX 1D9AA 2JVRA 3MURP 2KH9A 1WEXA 1U1KA 3MXHP 4UY8T 4YB1P 2DH9A 4CH1A 2SXLA 3VAGA 2CQDA 1WF0A 2MQNA 3CCES 4RU2A 5DM7Q 4ZKAA 3G71S 2KN4A 2MZJA 2B0GA 3NNHA 2YKAA 1HA1A 2DHGA 3DLLQ 1FNXH 5JVHQ 2GO9A 3FEXB 2VONA 1XN9A 3MUTP 2QFJA 5IQQA 3CTRA 1VQOS 4C0OC 1KOHA 2CPYA 2HZCA 2DHSA 4F26A 3JB9k 2AYEA 1VQPS 1X4CA 2MJUA 4V19X 3B4MA 2RQCA 1A7GE 3UD3P 2OIHA 1U2FA 4WF9Q 2DGSA 2M7SA 2DHAA 2YTCA 3N9UC 1HD1A 4Y00A 3ZZZA 5DM6Q 1QM9A 2X1GA 3H2VE 2DIVA 1YIJS 1U6FA 3MUVP 3CCVS 3MI7X 5GADU 2MQMA 2N3OA 5LJ5Y 3CULA 4U67Q 3PIPQ 4WCEQ 2M8HA 3CCLS 3EGNA 2F9DA 4TU8A 2DK2A 1UP1A 2YH0A 3R27A 3CCRS 1YJWS 2WBRA 2DH7A 2RRBA 2DNPA 2RUGA 2MQPA 1HD0A 2NZ4A 2N3LA 1OPIA 4J5OA 1A9NB 2LA6A 1JJ4A 3Q2SC 3G8TA 2F3JA 1R8PA 4WFBQ 2K3KA 2AD9A 2MJNA 5BJRA 3BO2A 2KVIA 3CMES 2LCWA 4P6QA 1M5KC 2LXUA 5LXYA 5LSLA 2YWKA 1N54B 3HHNB 1HL6A 2EK6A 1X5OA 2LQ5A 3G8SA 2MSSA 1H2UX 4LIRA 4Z2XA 2CQCA 2CQBA 2XNQA 2KRRA 3VF0B 2JRSA 4Y0FA 1SJQA 3CCUS 1NO8A 2CQ0A 1UFWA 2HGMA 1D8ZA 2DNLA 3NS5A 1X4HA 2MKKA 2DNYA 2DNRA 1AUDA 1VQNS 2LMIA 3J7YU 2OTJS 4QPTA 4LMZA 5HL7Q 3UCUP 3G4SS 2VODA 4PRFA 1OIAA 1WG5A 3UE2A 1YHQS 2MMYA 2M70A 3R1HA 2Q79A 1WEZA 2ZJQQ 2DO0A 2E44A 2MHNA 1VBZA 1O0PA 1WHVA 1QVFR 1B7FA 3NS6A 1VQMS 2D9OA 2HGLA 4IUFA 2MB0B 2X1FA 1X4FA 5GAEU 2ZJRQ 5IM0A 1QVGR 3TYTA 2MQOA 1WF1A 3SDEB 3IWNC 5DDQC 3CCQS 1PO6A 2U2FA 2KRBA 3RW6A 2KM8B 2OJ3A 2CPXA 2MZ1A 3CCMS 2D9PA 4WFNQ 3BS9A 2MKIA 2DNMA 2ADCA 1U1NA 2A3JA 2KXHA 2E5GA 2J0QD 5IFMA 3S7RA 1U1OA 2E5IA 3B4DA 3J7ZT 2XSFA 1VQKS 3EX7B 4F25A 5GMKa 1PGZA 2MZQA 3VAIA 2KHCA 3NNCA 4UQTA 3G6ES 2J8AA 2CQIA 2F9JA 3LQVA 2O3DA 2N82B 4WKRA 2CQ4A 2L9WA 2EVZA 5EN1A 2LXIA 2LEAA 2DISA 4OZ1A 3UCGA 3R1LA 5GVQA 1N8RT 2MPUA 2N7CA 3CF5Q 3DXBA 2G4BA 2JVOA 4C7QA 5LSOA 3D2WA 4IOAQ 2VOOA 2DGQA 3NMRA 1OO0B 1YI2S 1UAWA 3CCJS 1BY9A 3MUMP 3SMZA 2X1AA 2KXNB 1X4GA 2LEBA 1H2VZ 4FXVA 1VQLS 3VAKA 1DBDA 2PEHA 4QU6A 3MD3A 3MD1A 2L08A 3HI9A 1K73T 3P3DA 3CC7S 1JJ2R 1M5OC 2MSTA 3U1LA 2DGVA 2DB1A 3G96A 1X0FA 2D3OR 2CQPA 2MKHA 3CC2S 5MLCV 2U1AA 4TLQA 4IO9Q 1URNA 1WI6A 2KT5A 3UWTA 1NJIT 5DDRC 2KU7A 2RS8A 3K0JA 5ITHA 2M0GB 1Q81T 3US5A 2E5JA 2KFYA 1R8HA 4LJMA 5FJ4A 1VC0A 1WF2A 3V4MA 3BEGB 2MKJA 5DDOC 1P27B 1VC6A 3S6EA 2DNOA 1WHXA 2EK1A 2ERRA 1VQ8S 4W92B 1VQ7S 1YJNS 2M8DB 3CUNA 2CPHA 2MGZA 1YTYA 2DGOA 1FT8A 1M5PC 3G9CA 1X4BA 1FHTA 2G0CA 1WHYA 3CCSS 2KI2A 2YH1A 1P1TA 3VALA 2X1BA 4W90B 3CPWR 3OW2R 2DNNA 4QQBA 4TU7A 2RT3A 3CMAS 3SXLA 3ZZYA 2CPDA 5GAHU 1YITS 2MZSA 1VQ9S 2DGWA 3BO4A 3NNAA 1YWXA 2CPEA 1X4EA 2M88A 1SJ4P 2L41A 1VBYA 2DNQA 1WG4A 3I56S 2CQ1A 2DIUA 1SJFA 1WELA 2KG0A 1VQ4S 4FXWA 1K9MT 5JVGQ 2DH8A 1VQ5S 2DGXA 4EGLA 4CIOA 4ED5A 2MZRA 1S72S 2RVJA 1Q86T 2HGNA 1ZH5A 2CQ3A 5CA5A 3S8SA 2MY8A 4M5DB 2DNHA 1K8AT 1M1KT 4PR6A 2M4MA 3RW7A 1X5PA 3MOJB 4WFAQ 1L3KA 1JJHA 2MQQA 1ZZFA 1U1RA 2LECA 4YOEA 2DGTA 4OZ0A 1H6KX 1CVJA 2QEXS 2XS2A 2XS5A 2DNZA 2RNEA 2AYMA 2I38A 1WI8A 5GAGU 2CPZA 2MKSA 1KOOA 2ZJPQ 3BO3A 4WIIA 3VAJA 1FJEB 1NU4A 4A8XA 2RS2A 2BOPA 1N52B 5IM0B 2MY7A 1SXLA 3UCZP 2CQGA 2MQLA 3I55S 4ERDA 4BS2A 3MDFA 3U1MA 1X4DA 1W2BR 5DETA 5D77A 2KM8C 5HO4A 3S01A 1SJ3P 4F02A 4CH0S 2RQ4A 2CJKA 2LA4A 1VBXA 2DNGA 2CPFA 2FHOB 2DNKA 2V94A 4PKDB 3CXCR 2DHXA 2XB2D 1FXLA 2NLWA 3Q2TC 3THTA 1U1MA 2AYGA 3PIOQ 2CQ2A 5LXRA 2PE8A 1U1QA 2RRAA 2FC8A 2G1DA 5H1SV 3UD4P 1U6BA 5CYJA 2KYXA 2XS7A 1VC5A 1WTBA 1FO1A 3CD6S 2MZTA 2CQHA 1X5SA 2JWNA 2MYFA 3TP2A 1JMTA 2KXFA 2OTLS 2CPJA 3CC4S 3THPA 1WG1A 2DITA 1UW4A 2BZ2A 2AYBA 2LYVA 2FY1A 1KC8T 2J76E 4YUDA 2HYIB 2M52A 1M5VC 1G2EA 2DGUA 2CPIA 2OSRA 1WWHA 3P6YC 2VOPA 1VQ6S 2M2BA 4CQ1A 2XNRA 3H2UB 1RK8A 5LJ3Y 4QU7A 1Q82T 1Q7YT 3L3CA 2J0SD 3P49B 1DZ5A 2DO4A 1U1PA 2K8GA 1DHMA 1SJRA
chains in the Genus database with same CATH superfamily
1WHWA 1FJCA 2KJVA 5J2PB 2RU3A 2XMKA 3CVKA 5E33A 2B5JB 4R0EA 3IO1A 3DC2A 8RUCA 2FHKA 4GO7X 3G2XA 1BQNA 5ETRA 1UCNA 2I0XA 3QGHA 3EDQB 3MZIA 1NBEB 1Y4ZB 2FC9A 1FX2A 2Y8WA 3W2WB 3CT9A 4WFZA 2YQ0A 5B0AA 3K5OA 3SYZA 2YX7A 5B09A 4FF4A 2WCXA 2DHGA 4K2JA 2FVPA 3W2VB 4PYDA 1RCOB 5D4OA 2CPYA 2WOMA 5SZTA 3QPIA 1TFWA 1NPKA 3NL0A 4I67A 3FSXA 2D41A 3PKYA 2HQIA 2DHAA 2V5HG 2MEWA 5L1KA 3BDEA 4W98A 5AXKA 3NRBA 1ICEB 4LIWA 3DLEB 5FDLB 3JSMA 1RA7A 5A2QY 5AE3A 2QFIA 5KFKA 1AZSA 2NXNA 3GU0A 4CO2A 3PG9A 1TAUA 1FK9B 4WU3A 4DV4F 2ILYA 4NLYA 1YK9A 1LEOA 4NMXA 2XLKA 1LWEB 3G82A 5D4NA 1HQEA 4Y2MA 2XLIA 2H5JB 3NKYA 1P1LA 4IG3A 3HJFA 3PO5A 2MLXA 3W63A 3L9ZA 2AW0A 2JRSA 3D6FB 1AT1B 1YBTA 3MR7A 3FGVA 5ETKA 1UWBB 3DYAB 2VODA 2PN6A 4JI5F 2MHEA 4M5HA 1FKOA 4QIGA 2J7UA 3C3LA 1OQ6A 1QVGR 3QFWA 3M4XA 1RADB 2KM8B 1U02A 4ANEA 4R5PA 4WFNQ 2A3JA 1WKJA 2WRMA 4A47A 2KFZA 2KHCA 4TN2A 3OJUA 5HP1B 4UQTA 4HTJA 1UWAA 1R0AB 1P9YA 3BDPA 2XMWA 1ZETA 5E3QA 3CDWA 2C3MA 3GJTB 4DLEA 5D0HA 8AT1B 3H7HB 4DV1F 2LQBA 2DCLA 3GFXA 3K7RA 2DGQA 3GIKA 2HAIA 2CADA 3FRZA 5F41A 3QT6A 3MD3A 3MD1A 3MR2A 1BC6A 3HSJA 3QWPA 4FF1A 5K20B 2FDNA 4O3SA 1U0HB 1C2PA 3HULA 1HARA 1WI6A 3UWTA 1FEHA 4H4MA 5B0GA 1F2GA 1QUPA 1Q81T 2PC6A 3GJQB 4ZP9A 3US5A 3QRPA 3ET6A 4PYAA 3RGIA 1TAQA 2XC9A 3KNAA 1KTQA 2MKJA 4QCLA 3LAKA 3KDOA 4HLBA 2EK1A 4W92B 4K5RA 2LQ8A 2OHDA 4P2XA 3V4IA 1TKTA 4OZ3A 3HHEA 2Q43A 2E29A 3TRGA 4HHUA 4TY8B 4DUYJ 3ISND 1QAYA 4KQZA 4QQBA 4O4GA 3DU5A 3ZZYA 4F4AA 2GGPA 1KN6A 1FDDA 2OGUA 3R97A 2AZ1A 1IXKA 2NS1B 1HNWF 5LMNJ 2JJ4D 2DIUA 1O5JA 2ZNYA 4PWDA 2FLLA 4EZ6A 4ED5A 5KFCA 3BR8A 4P2MA 2HGNA 1ZH5A 1KVIA 4NCBA 2HMIB 3BV8A 3MMBB 2MQQA 1FX4A 3R7SB 1S9EA 2RS2A 1HHTP 4USHA 1SVDA 4J7CA 4I6YA 1Z2ZA 2HK2A 2BR0A 3DI6A 3D7SB 1KS2A 1B0PA 4YY3F 2CPFA 2NXEA 5E41A 3HVRA 3H4DA 4DWIA 4QIWD 4ZP7A 1U6BA 5CYJA 5L9XA 4J9MA 1VK3A 2EFGA 3Q86A 5DG9A 2ZH6A 3OL7A 1SUQB 1FERA 3THPA 3CGIA 1JLQA 2OMLA 3U7JA 1IM4A 1Q8IA 2ROGA 4DSEA 3LWMA 5HLFB 2IM1A 3FQKA 5LJ3Y 3T1YJ 3OTBA 1Q78A 5KT7A 3AB4B 3W62A 5J1EA 1R8AA 3F41A 4DV2F 1IR0A 3CWJA 3S1TA 2IA0A 3H5UA 4IRDA 4OYWA 1V5IB 5D78A 2CNNB 2XGQA 2UVVA 2KB2A 4QWAA 4K8RA 1RWMB 2R8KA 3QO9A 3MURP 2C3YA 3MXHP 1U1KA 4UY8T 4KPCA 2VA2A 3NS7B 1YRUA 2QFJA 3GSDA 1AFJA 2DHSA 1HHQA 3KDNA 1IN0A 3BKTA 5IC6B 4I68A 5CYMA 2HRUA 1YLXA 2CUYA 1XNQJ 4JUZA 5F0WA 3EVMA 1TV6A 1RT3A 2B3TB 5A8RA 1RACB 4Y00A 3HHLB 4NXNJ 3H2VE 3RB0A 5ETSA 1FNOA 4F3QA 2PSZA 2OI2A 3CEDA 1CBKA 4N7TA 2YH0A 2BYCA 2N4CA 4OI4A 2RUGA 2VPYB 2MQPA 2R4FA 2H3EB 2N3LA 2LA6A 2KHDA 1RU2A 5IXUA 2E5LF 2KO1A 5JJBA 2C2NA 4KGZB 4NX9A 2YKNA 4M5NA 2RDJA 1KBRA 1ZPVA 3WIVA 1FD8A 2KFNA 4IRKA 4CLWA 5F8IA 3ADAC 5HBMA 2GHVC 2CQ0A 4U6PA 4PWWA 4V1Ak 2CDQA 3LPEA 2ALZA 7AT1B 4DUTA 4KTQA 4PRFA 1OIAA 2MMYA 4DSJA 1RWWB 1DFDA 1JLCB 1VBZA 1LXNA 1VHFA 4OZNA 4LSLB 3KWMA 2WSCC 5AJ3J 1YDLA 2QLBB 1WF1A 1OS5A 3QQCD 1B70B 4MH8A 3OR1A 3PDNA 2YX4A 4F4KA 5K14A 2F9JA 3LQVA 4LRFA 4LFCJ 3ZTSA 1DJ0A 4DPXA 4CH7A 4ECRA 3W60A 1IKXA 2C2MB 4C7QA 3P4UB 2VOOA 2OMOA 2H9ZA 4WYWA 4C3KA 1NK5A 3GG1A 1H2VZ 3MM6B 1BXNA 3T1HF 3P3DA 1S49A 1JJ2R 1HBMB 2VQFJ 4A4JA 4DZ6A 3D0GE 1S6PA 4ID5B 4A8SA 1HWIA 2QO3A 1GMUA 1GQEA 2CNKB 2QTWA 2RS8A 4B9UA 2ACMA 1T03B 2XO6A 1RT6A 2ZH2A 1NSPA 3V4MA 2FJAB 3S6EA 2FLPA 1FTRA 1YJNS 1CLFA 3UFCX 3DLKA 1HR0F 3I4PA 2V2QA 2ZKUA 2PIIA 1UEUA 3A8IA 1FA0A 4PAAA 2RT3A 4JI2F 1HBNA 4DX8H 4MAKA 3EM1A 1UMJA 2HHHF 3BO4A 2R2RA 4DL6A 2XULA 3Q83A 4J37A 4X4RA 5HQLA 1CC8A 4BBYA 2YXLA 4NA1A 3OLBA 4N77A 1TMMA 1TU0B 3DM2B 2CYYA 3DOLA 3QIDA 3VGSA 3WIUA 2POKA 2CRLA 2OPRA 2IRXA 4YOEA 3IWXA 1HPZA 2Y8YA 2HQGA 2DNZA 5L38A 4KGXB 4GO5X 1KOOA 1FNMA 2FHJD 3ENWA 4I1TA 1HI0P 4AXIA 2UVRA 1NH7A 1S97A 1JLBB 1J27A 3UO0A 3V6DA 4ANDA 1XJWB 3RBZA 1N5QA 4F02A 4DEZA 1FI4A 1HW9A 2DNKA 5ETLA 2V94A 4PKDB 4DR4F 4IH7A 2XO7A 1SQEA 1T3OA 4IG0A 4FYXB 1WC1A 2R8HA 1SKRA 3TNVA 2BEFA 2AYBA 4NLSA 5D6GA 3K17A 4DLGA 4B3MJ 5CZXA 3VGUA 2O01C 1W2IA 4RW6B 4IFVB 2QA1A 4M94A 2J0SD 5D4LA 4O23A 1VRUB 4MKVA 5THWA 2MKCA 1X9SA 2RAQA 2NCKL 2QLWA 2XYGB 4OIXA 2NXCA 2ZZNA 1TKXA 1VRTB 1RTJA 3AH6A 4NZ7A 4IFYB 1M90T 4C2MA 1ZAVA 4FDFA 4DMZA 1FJ7A 1YJRA 1GNKA 3I87A 4B3OA 5F8JA 3QBCA 3GJSB 3DMJA 3VAMA 3EMTA 1SKSA 2H54B 1S7IA 3PRBA 5H9EJ 3M8QA 2SXLA 4ECWA 4M5GA 4ETXA 1S6QA 5ETMA 3V6HA 4IR1A 4ZKAA 3IBCB 2DT9A 2DHHA 2V8GA 1FNXH 5CD4H 1RB0A 3M7VA 5IQQA 4ZS6A 2GVDB 4URGA 4HTIA 3R2DJ 4OI2A 2AGOA 3OFGA 1TL3B 2RQCA 3A8JA 1N6QB 1ZS6A 2Z2LA 2DGSA 2Y1LB 3TWZA 3VGVA 2F65A 2Z56B 3MI7X 2DYAA 4RLEA 5KOWA 3D67A 3A3PB 3DRRA 2OPPB 2QN6B 5A76A 4DV0F 2AP6A 1K47A 3DOMA 3TQEA 4WPAA 3AD8C 3VVTA 3I5CA 1MSWD 5CHCB 2KVIA 1T8EA 2WTFA 4HDGA 5LXYA 1IWAA 3R2CJ 3IM9A 4Y65A 3MMCA 1UEVA 1VS3A 1U2RA 3Q8YA 4FYVB 2ZVSA 3G8SA 4ZLNA 2DRBA 4R25A 4DR1J 2GMHA 2HNYB 4ZP8A 1D9FA 2YPZA 2MKKA 2I8EA 4ZN3A 1L5UA 5HJXA 4C3MA 2BANB 2OEMA 4USTA 5KT6A 1KKHA 3M6WA 4X2BA 1BQMB 2CPXA 4EYHB 3K58A 5EHHA 1JB0C 4DU8A 4P52A 2AIRB 3LWLA 1YX2A 1VQKS 4F25A 4GVBB 4UTGA 4KAIA 4OJ3A 4CLSA 4FP9A 1HMVA 2LEAA 2ZM6F 2VKRA 3OVBA 3OL9A 4G1PA 3N79A 4ECVA 1HKAA 3MFIA 2EFQA 3CJSA 4JV0A 1RBAA 2L08A 3HI9A 1O8BA 2XY7A 2RIJA 1GMWA 3T3FA 2IAJB 2YBVA 3C6UA 3DXSX 4GKJJ 4F04B 3LAMA 3BEGB 3PVXA 3PX6A 1IR1A 1MLAA 1TVRB 2QMWA 4XK8C 3PW4A 4QIEA 1Y9OA 4W90B 3FFIB 4DG1A 2M5YA 4K4UA 2ZHAA 3C6UB 2GJIA 4DSIA 2XHCA 1VQ9S 2E1CA 1TQLA 4X64J 5F8NA 2QL7B 1S1XB 3KLHA 4DZDA 2KG0A 3K57A 4I56A 4V19J 1NCLA 5EUHA 2RF2B 1N5VA 1N36F 1VBKA 2A2CA 2L9DA 1OQ3A 1JJHA 1ZZFA 1H72C 3V2UC 4UUXA 1H6KX 3HHDA 1AROP 2I38A 2HVDA 2ZJPQ 3ZNJ1 2BOPA 1D8YA 3W3SA 1T9VA 4PABA 5I42B 1W26A 4XIUA 4ERDA 4QWCA 2RQKA 4YFUA 1SJ3P 2XGPA 2XYPB 1C0UA 1W25A 1JJCB 4LF8F 1FXLA 1U2CA 1JLFA 3O3LA 5KT4A 4NYOA 1U1MA 2BABA 4ID8A 1F1BB 3HHLD 9RUBA 2MLZA 2Y0BB 1C0UB 2WVBA 3MM9A 4QR0A 1UEKA 2KL8A 1Y5NB 3SQOP 2V8VA 4LF4F 3I4HX 4HH0A 2IY5B 1C1BA 8ATCB 2HBQB 4DN0A 1NK9A 3EZOA 4LFBJ 3QYYA 3NCPA 4K4ZA 2VF3A 1HFEL 1Q82T 1JLEA 3CDUA 2DO4A 1SJRA 4ECTA 1CQNA 2AWZA 1CQMA 4QWEA 1RKIA 2IBOA 2HVZA 2XLJA 2DXFA 3BYRA 3G6YA 2FJEB 3JTNA 3P5TL 2FZKB 4ZJLA 1CSJA 3TO8A 2BJEA 4EZ9A 2AU0A 1LWCA 1LW0B 3K5PA 3KXDA 5C42B 3IWLA 1D9AA 2JVRA 3J80U 1IQZA 4ES3A 3QLHB 3O44A 2CJQA 1S1WB 4DV4J 5G0RB 2KN4A 4M5IA 1HA1A 1VJQA 1TZ0A 3IR7B 1L3TA 3TW0A 2HZVA 3J80Y 2D3UA 4B9VA 1A7GE 1XR5A 4DV5J 5A8KA 2ATCB 2EFVA 3L95X 3ZZZA 1QM9A 1TMJA 3M6UA 3TOQA 2VASA 1EETA 2MQMA 4ZVQB 2OPSB 4B3RJ 4Q8FA 1Y3KA 4JI5J 5AXLA 2WBRA 4NWBA 5HMZA 5I3UB 1J5OA 3OUYA 1XK8A 5M2PA 2F3JA 4QOTA 3I5AA 3RR8A 4P6QA 5U47A 5J1NA 4JV5J 4K5SA 5CABA 1YSJA 2BE2A 1HIYA 1ITPA 4L3NA 2QLFB 2ZC3A 2LQ5A 3V6KA 4IDKB 5L8RC 3A8EA 3MEKA 4ED6A 3W64A 1RDRA 3HSDA 1RYSA 5CYQB 3O5TB 3BBBA 2F4FA 1JK9B 5J2QA 3K8WA 2Q79A 2HBYB 2HIQA 2F8EX 3M8RA 2BDPA 4MTPA 3HF5A 4K4WA 3AQOA 2OD6A 2U2FA 4B3SJ 2XM3A 4TLRA 2QA4G 4F3OA 2EBEA 5IFMA 4NEZA 3KJNB 5HATA 1NM2A 2XSFA 1NH8A 4DR7F 1CJKB 4QR2A 3TAMB 4K59A 2NXJA 1M5HA 2VFRA 4QZVB 4F7VA 5GVQA 3RU0A 2CJ9A 3BGRA 3SCKE 4USJC 1BMQB 5J2NB 2XY6A 4CO1A 1SH2A 3MUMP 2H51B 5LMUF 4GC6A 2I6WA 2BA9A 4CP5A 1DBDA 2V4RA 2UV8G 4URQU 2ZH7A 1NB2A 3DNCA 3ZZRA 2VH7A 1V3SA 2DB1A 3OQ2A 1DTQB 1S99A 3EDRB 3JSRA 2L48A 4UW2A 5DDRC 3UDCA 4KHRA 2XMAA 3MPUB 2NR0A 1SH3A 2VU5A 1RT1A 3A1YG 3FMBA 1VC0A 3M2RA 1FJGJ 5ETTA 1J5EF 4OJHA 2CPHA 3LP0A 4JI6F 4JI1J 2ZE2A 1Y11A 5JMNA 4CLUA 3R5JB 1TKZA 2N7YA 3CCZA 3GFYA 3M9MB 2JZ5A 4CLPA 4CM0A 4BHQA 4CZCA 2DH8A 2G2OA 2RDIA 4RW9B 3TX8A 4ICLA 1IJFB 2FVSA 1RXOB 4LFAF 2HQFA 2J6TA 1WOPA 5CCLA 2HFVA 1R6YA 1DQ9A 1S1VB 3PNIA 3O1LA 3H98A 5IT9Y 4DPUA 2BBEA 4RX6A 5DG7A 4ELVA 4NMLA 3KUEA 3MEEA 2RMLA 4DCJB 3UCZP 3RAXA 2VJUA 3MPDA 1MWZA 1F9EB 1HQ2A 2GIQA 3CXCR 2DHXA 5C25A 3JQKA 2NREA 1V3RA 5D15A 3H20A 2AYGA 2C3UA 1RTIA 2RRAA 3NGUA 2XS7A 1VC5A 1KSPA 4TKTA 4OX9F 1QLNA 2C28A 3C15B 4IRCA 2ABYA 2FVQA 2GCFA 2O1PA 1D0EA 3WX4A 3CDEA 3TVZA 4C0HA 4URSA 4CO5A 2HFZA 2W9BA 3DHWC 2BXJA 2CKWA 4OYZA 3N4WA 1CJTA 4C97A 3HFKA 2QRRA 2CJBA 1CULA 2GHWA 3GFHA 5AT1B 1H2TZ 2VPWB 4OI1A 3L7UA 4DQIA 5BYRA 4JYAF 1WC4A 3BN7A 3TUJC 1Q8BA 4ETZA 1BUXA 4OJGA 1YJVA 4IOCQ 3AOBA 1KD1T 4ED8A 4FF3A 1U1LA 1R6VA 1T05B 3QNWB 3M1VB 2P9GA 2NUHA 4X66F 3MAQA 3RRKA 3TANA 3HZGA 3CCES 4RU2A 2Y1IA 1SIZA 3UDLA 3TUPA 3BN4A 2HK3A 4FS1A 2HHVA 5LSRA 4ZHRA 3JAMU 1U24A 1Q5YA 2UXCF 3GIIA 3ZTRA 4PG8A 5DLGA 4S0MA 2GMJA 4RBVA 3FMWA 4WF9Q 5KFJA 3Q23A 1HD1A 1RT4A 1N5YB 2LP4A 4X4QA 4A8QA 2N3OA 5EX0A 1LWFB 1FEEA 2AJ4A 4P72A 4WFBQ 5T7LA 1RTDB 4HVZA 3ITHA 5KG5A 1LW2B 1SL0A 1RAFB 3WZ0A 5LSLA 5HROA 2EKNA 3HHNB 3MMAB 3J7AN 1VK8A 1NLKL 3E01A 1NJWA 1SC4B 1D1UA 3KLFB 5F9LA 1CS4A 3ZZUA 3RUBL 2EFNA 3R5AA 2DNLA 3NS5A 3MM8B 3QJJA 5C2CA 2XSJB 1T9XA 2RB7A 1REVB 2PGCA 3R1HA 1HYSA 4GC7A 4KYZA 3IC1A 2F4VF 3ZTOA 2DPIA 2VFSA 1KLMB 4OQJA 3G6VA 2X1FA 3KOAA 5IWAF 4XPEA 1JIHA 1YRTA 1CJVB 1IBKF 1U1NA 3MCMA 1KR4A 4IQXA 3DRSB 1FWLA 4M5MA 1FRXA 1JLGB 3G6ES 2BJDA 2CQIA 4BLGA 2O66A 4RW8B 2EVZA 1NDLA 2AQ4A 5KFYA 3GQCA 3ILOA 4P73A 3T6JA 3NWGA 1BY9A 2HHHJ 4O3RA 4FS2A 3ENQA 3PYFA 2BMBA 4GKKJ 2BKNA 1FRKA 2HPUA 3GSIA 3A4TA 4NA2A 4JI0F 2I1RA 5A8WA 4DCOB 2H1YA 1VFJA 2E5JA 3I31A 4TY9A 3QJLA 1MU2B 3OSNA 4NLPA 2HHWA 5HN0A 1X4BA 2MLYA 2VPZB 4KV8A 3CJ0A 4LF6F 1EX8A 1ZAWA 1K0TA 4ECZA 3MAAB 3NP5A 3KLEB 2CPEA 3FBCA 5LM7E 2C3OA 1SJFA 4F0HA 2ZDOA 1VQ4S 1SV5B 1BD6A 4FXWA 3RR7A 2G2YA 2PMZD 2DXDA 3MWBA 2CQ3A 3NXZA 4ZVTB 4PZVA 4L75A 1U8WA 3M32A 4ZCLA 4OZ0A 1IBMJ 3OTDA 2YKMA 3POTA 3HX9A 2YKQA 1SXLA 3I55S 1Q53A 1WC3A 1LWXA 1X4DA 2D74B 2RUSA 2YNIA 2RQ4A 4DL3A 1FDAA 2UUAF 2C2ZB 1AW0A 4DFJA 4LF9J 3M8YA 4L73A 1FKPB 3Q2TC 2MTLA 3J81U 2HBRB 3FUYA 2YWEA 3AXKA 2AT1B 1WTBA 2JWNA 1BWVA 2AEJA 1FCAA 1WG1A 4X4VA 2BZ2A 2FY1A 3I5BA 5GADI 2EKYA 4RBUA 4HACA 3EJMA 3J81Y 2KZMA 3SV3A 2VICA 2CDRB 1Z1ZA 3RJMB 3CJ3A 2E9RX 2Z2YB 4CCHA 1URRA 1EB0A 2X51A 4DPTA 3CJ4A 2HFSA 3VAHA 1RJJA 2ADBA 1N88A 2B9WA 1T11A 3C14A 1XBWA 4I7FA 4Q7AA 3W5XA 2QYGA 2UXBF 1RKJA 4B3TJ 3LP1B 3VAFA 1N32J 4Y2AA 4ZK7M 4UY85 4J9LA 1RYRA 2J8SA 2OFHX 2HWHA 1WEXA 4DV0J 2W2NP 2W7AA 2KJWA 1TR0A 4JBCA 1V5VA 3DDKA 3V81A 1E6VB 3KJVB 4EO8A 1IUJA 1XN9A 2FJDB 3MUTP 4ZVPB 1NPPA 2NYHA 5KG0A 4OHVA 1KDNA 4F26A 1I3OB 3FSYA 1VQPS 3WC2A 1F9HA 1G3OA 3M6VA 3KLIA 2GQQA 1Q7LB 1EP4B 3TI0A 5DM6Q 3M30B 1WSVA 2NZCA 2CVEA 5LJ5Y 3M8PA 1U6ZA 3JQMA 3D3BJ 9ATCB 5SUHA 3CCRS 3KJFB 2RRBA 4FPIA 4RUAA 3D3CJ 4X4UA 2WVCA 1OPIA 4QYRA 1A9NB 1NMEB 3BGFA 1F3FA 3KLIB 3K89A 1ACMB 2MJNA 1XNRF 3KK2A 3D68A 4ED7A 3NGKA 2YWKA 1H7XA 4DV6J 4DR2J 2QLXA 2VDIA 3MECA 2MSSA 4TXSA 2BE7D 1D8ZA 4CYUA 3BQ0A 2KT3A 5A0YB 4PQUB 3AT1B 3TQ1A 4X65J 2FUG9 2IC3B 3UCUP 1RTHB 1LFPA 2DO0A 1GX5A 2IFXA 2D9OA 5GAHI 2HFOA 4Y34A 4JP8A 3JQJA 3K2YA 4ELUA 3MFHA 3SDEB 5KFMA 4C11B 1KFDA 3CCMS 2ADCA 4DV7F 3OHAA 2H5EA 3BR9A 2NPIA 2HG4A 1HWJA 1AXQA 4XDDA 2PT0A 1D09B 1SPBP 1XMOJ 4WK1A 4F4WA 3T5JA 2CQ4A 4AFFA 1ELOA 1GTHA 1C1CA 4OZ1A 3NGDA 3U1NA 1QDUB 3DXBA 2UUBJ 1R7IA 1EQ0A 3AJ2A 3CCJS 3ZZTA 1I6JA 3T6BA 2UV8A 2YNGB 1T02A 1I94J 4RW4A 4ZVUB 4I2QB 2R42A 1GH8A 4X4TA 1HNVB 2JEGA 4CO0A 2D3OR 4IO9Q 4TLQA 2WHOA 1XIQA 1U26A 3I9V9 5I3PA 4P9SA 2D3ZA 1TKDA 3OHBA 1VC6A 2R7XA 5FLXY 2R7VA 1XR6A 2M8DB 2VG7B 2E7XA 2OLWA 2MGZA 1GAOA 3PR4A 1VHIA 3CJTA 3CCSS 2FJBB 3SSSA 4L76A 3F73A 5KTQA 4B9TA 1KP6A 4PXDA 1RWXB 3NNAA 4PXEA 3M2UB 2RH3A 3I56S 4LF7F 1HWUA 1DURA 1JKHA 1KHVA 2E7WA 3EICA 4WU2A 2YY3A 2QLJB 2J9DA 1MN9A 1MNEA 4NLUA 2AEMA 3TR5A 2MY8A 1F0XA 3JS9A 1WACA 1MW7A 4WFAQ 1L3KA 4A48A 3C66A 1U1RA 4YMEA 4KHPJ 3HVAA 4HL9A 2RNEA 3M8SA 4CNYA 2CPZA 4TNOA 2I5JA 2X7IA 1EKRA 2EPIA 4BS2A 5KG6A 2OP5A 4USUA 2LA4A 3PJ9A 4DN9A 4AQYF 1HHSA 4LRBA 2W9AA 3MOZA 2YVSA 3QT8A 4K4YA 4K0KJ 3IAS9 3A3NB 3QSIA 3R3TA 3MM5A 1QE1A 2CQHA 1X5SA 2B8QA 4BC9A 1WKLA 1JMTA 2D3O1 2KXFA 3CC4S 4J9NA 3BGUA 3ZTQA 2HHQA 2J76E 1NK0A 2OSRA 1TL5A 1DY3A 3FVYA 3MCOA 2VOPA 5HAOA 4KO0B 5DS7A 4HT5A 3H2UB 1VI7A 4J9RA 3FRYA 3VZIA 4FPRA 1VQYA 2LQ9A 4G1QA 1H3DA 4J9UE 4CDIA 3I0RB 3T9ZA 4UT4A 3MEGB 2UP1A 4X62F 1JLAA 2E5HA 1Q1KA 1WDTA 4EI2A 3JSYA 5HMYA 5L1JA 1FESA 5C24B 3SSRA 4O44A 3RTVA 4NLRA 4XAKA 3ULHA 3FKBA 3J7YI 3EE3A 1N5TA 1PYTA 2JEIA 4LR7A 4OHXA 4JI8F 4ZCIA 4RPFA 2PI5A 4OZLA 1B7YB 5GAEI 1PAEX 2O67A 3FEXB 3NBPB 4F4ZA 2FLNA 3GYGA 3AJ1A 1Z4UA 5K8NA 2MJUA 3RYLA 2PMWA 3KK3B 2DXEA 3SCLE 2P8IA 3OTOJ 3N9UC 2X1GA 2DR9A 1YIJS 4ZPDA 3MUVP 4UZBA 3CIZA 4U67Q 1TUGB 3KJQB 2FVRA 4I2PB 3OVAA 5F8HA 1F5AA 2NZ4A 3JTOA 1BHNA 4H4KA 3AQPA 3KK1A 3QIPA 4B08A 3BO2A 3DLGA 1S0NA 2FGCA 4NE9C 3BH7B 1PBUA 4B9NA 3H42A 4ZPVR 2W9CB 2ZH8A 2HS3A 1TL1A 2YWFA 4QJVA 1U47A 1XMBA 4AL6A 2VG6A 5C5JA 4UOGA 5B08A 5E3CA 2CNOB 3HKZD 2Y1JA 2R7QA 3T41A 2UUCJ 4M5KA 5LMUJ 5KFAA 1HBOB 3DOKA 1RHMB 1T0TV 1MN7A 1YVFA 6AT1B 1X7VA 3TJ8A 2ZJRQ 5IM0A 1NZ8A 3K5NA 1S1TA 3CCQS 3KMSA 3LW5C 1B99A 1RBLA 3BS9A 5KFBA 4EK2A 2UU9F 4OYIA 2DTJA 3KKFA 5GMKa 3Q24A 1TK8A 3OR2A 2J7KA 1IKWB 2J7WA 4F36A 5DQIA 4L3KA 1RT2B 5T41A 3HVTA 3OLAA 2HBZB 3MEDB 1UKUA 2WBMA 3NMRA 1VQLS 3IRXB 4MMOA 4QW8A 1KHWA 2DVIA 1ULRA 2GIRA 4Y28C 4NRUA 1URNA 3DGPB 2U1AA 4C9DA 4F0MA 2VL1A 2M0GB 4R8UA 4NCGA 1FFSB 4J9VA 1N48A 1PIEA 4YB5A 5J2PA 2P9CA 3W9HA 1WTFA 1B64A 2B5JA 4RO0A 4KKOB 4WP3A 4ZCMA 2G0CA 4QIFA 1WHYA 3VALA 4J9OA 2B9XA 3HK2A 2DNNA 2QE5A 4YR3A 3Q89A 2J0WA 5D0EA 2CIMA 3CJ5A 2QMXA 2PA3A 1Y3JA 2FHJA 2W2QP 2DNQA 3W2WA 4CWBA 2Y1RI 2MZRA 4DDFA 1RE1B 2ROEA 1Q86T 4H4OB 3W2VA 1YKWA 2AZ3A 1KVKA 3IG1B 2DNHA 3CE8A 1QTNB 1OPZA 3LTOA 4TVAB 3TEGA 5EWEA 1FRLA 4EMDA 1K1QA 1VDHA 2CQGA 2AV5A 3OFHA 3DLEA 3MDFA 5FDLA 1QAJA 3U1MA 1G4CA 3R5GA 1IBLJ 2VPXB 1Q8KA 2W7PA 3Q8VA 2EI5A 1FK9A 3O2IA 3UNYA 5C2GA 3AODA 2OEKA 1VLOA 4JYAJ 1LWEA 3I0SB 5H1SV 3HVWA 4NLDA 2R7TA 4N47A 3EPIA 4FKXA 4N8OA 5F9NA 3SI8A 4EYIB 3NGSA 1LV5A 1A6LA 1C4CA 2CJXB 2KVQE 1KC8T 2HYIB 4X66J 1YZ7A 4IR9A 1VYAA 2HSEB 2OAUA 2CPIA 3ILJA 2C2DA 4MT1A 3VTIA 5HVGA 3OPKA 4CQ1A 4KPYA 4DR6J 1UWBA 3DYAA 4K2XA 3TA2A 3HJVA 2VBWA 2V68A 3L3CA 2LDYA 1DHMA 4K4TA 3KHLA 3EGWB 3TZWA 1YJ9S 3PM9A 4RWWA 3UVJB 1TL4A 3TVYA 3GCWP 3QRRA 4DCPB 2GVZB 3LPYA 2IM3A 5DRKA 4TU9A 3N28A 2JX2A 2B4VA 5DDPC 5D8HB 2GHPA 5HP1A 1XWLA 1R0AA 1QUVA 4M8LA 3OXFA 1M5SA 1S57A 4C4WA 2ZH3A 4CO3A 3F56A 3CCTA 3VAGA 4NZ6A 4DUYF 3PKMA 2JLGA 3RBXA 4Y2IA 4J90A 2GO9A 2YNHB 2QJ3A 5KFNA 2E1RA 3HSGA 1FDBA 4C0OC 5LMNF 4I64A 2R8GA 2RJZA 1TELA 4M63A 2ZHBA 1U0HA 4LBPA 2AHOB 5IQ6A 3SZ2A 2AJ2A 2AX1A 2PFDA 2HKEA 5GADU 3FEZA 4N8NA 4OLOA 3RRHA 4RBTA 4MK9A 2HNZB 1H98A 4TY8A 2ZWPA 5L39A 1S7HA 2VFTA 5IWAJ 2AD9A 1UFKA 2LCWA 4KY3A 2LXUA 3GIJA 4OI6A 1IBKJ 1JX4A 1UETA 4J9KA 2IM0A 2Q6BA 2ZNZA 2IYGA 2KRRA 3VF0B 3OVSA 4MFBB 5HI7A 1NO8A 5KFEA 4J9SA 2XMTA 4DL2A 2JC1A 1BWEA 5E3PA 2WSEC 3LO3A 3QT5A 2OTJS 4PUOB 2HMIA 3MMBA 2FQQB 4Q2LA 1UVLA 1OY9A 1SQGA 2OKQA 2J6UA 2ZJQQ 1EARA 1RAIB 1O51A 2WAQD 1UVJA 3CJKB 4IUFA 1X60A 1VJWA 4WBFA 4HT7A 4KSEB 2GO8A 3HSZA 1K44A 1NK8A 2J9EA 1ZYQA 3IWNC 3DDNA 4K4SA 1GEHA 4C48A 2JL9A 2DEIA 4UOHA 3T1YF 1XTZA 2CZ4A 4C8OA 2J0QD 2E5IA 3EX7B 3IM8A 1Q5VA 4ZLJA 1VISA 2J8AA 3OD2A 4JOUA 1S1UB 2QSFA 2GMLA 3VWSA 5KFHA 2MPUA 1SUQA 1HWKA 2WB1D 2OPQB 4XPCA 3AOAA 2IJRA 4LF6J 3SMZA 1OYDA 5ETQA 4CLFA 3W7BA 4ZPAA 5HLFA 1UJ4A 4JI3J 3FBEA 4QR1A 3N6LA 3UD5A 1MWYA 2IVMA 1XC9A 5E3RA 4DR5J 3QSYB 4LVOP 2W1BA 3N6NA 2DNOA 3MAHA 4TQRA 1UTAA 1XNQF 2ATLA 5BXIA 3TARA 1IVZA 4NXNF 2OUGA 5GAHU 4LRCA 1MMDA 3B54A 5F8LA 4LQ9A 4N41A 4DV3J 4NXMJ 3MF5A 1HLWA 2LFVA 2IMOA 5KAKA 4Q8EA 1VGYA 4AYBD 1KNZA 3GP9A 5ETPA 4WE1B 2FJWA 1X5PA 4DL0C 4WTOB 1S59A 2DGTA 4DPWA 4Z37A 4X4NA 2V67A 3H4BA 1OSCA 2JC0A 1QSYA 3PX4A 3HHLA 4PXBA 2MY7A 4DSLA 2GQCA 2F8HA 4TYAA 4ILMA 2GAHC 5KFZA 4DUZJ 1HNIB 2PD1A 1EQMA 4Q0BB 1NJYA 4RUCA 4DX6A 1M0SA 5AJ3F 3GONA 3QZ8A 3THTA 1S4EA 4LR9A 3TJ9A 2KYXA 4LRDA 5KG1A 2QZ8A 3N5FA 3K8VA 2B43A 2G13A 2V8DA 3RB6A 3C8YA 3C6TB 4BWJA 4LFCF 3IAM9 4QU7A 2QMUB 4NLXA 2J0XA 2A1BA 1JLCA 2XI3A 4ECQA 1T7PA 4LSLA 4K4VA 2H5IB 1G1XA 3KLVA 3UN5A 5D3GB 2GFFA 2W7OA 2UVWA 1DLOB 2VQFF 3RBDA 2B4UA 3DRYA 2FZCB 1B0VA 2BE9B 3BBFA 3X1LB 3LGNA 3WBZA 1FXRA 5HQMA 1X5TA 4ATNA 2DR5A 4ZVOB 4MYUA 4XDCA 2XMUA 2FPHX 4CTAB 1WC0A 4CH1A 2C42A 2MQNA 3KUGA 4YQWA 3J7Z5 2HHSA 2FJXA 2KKHA 1XNRJ 5M2RA 2HS0A 2V2VA 3K59A 2GA7A 4ZJQA 2ASLA 4RNHA 1ZM9A 3ZO7A 3MM6A 2FD2A 3HD1A 4U9RA 4ZVSB 4N76A 3VCDA 1HI8A 1HBMA 1RP5A 1Q4RA 2QL5B 2XZTB 1PC4A 4NEYA 4ID5A 1F3VA 1N33J 2RKIB 1Q16B 2COLA 2BACA 3U02A 4WP9A 4M5JA 1U6FA 4DS4A 2EG1A 1T03A 1KEKA 3D6MB 3IS9B 1ZM3A 4WCEQ 2DK2A 2DH7A 4RL1A 3PRDA 4NA3A 3V5RA 3MMJA 3G8TA 3MPWA 2K3KA 2HIYA 2H48B 3JYTB 1X31C 4DV7J 2Z4PA 5IS2A 2W8LA 2EK6A 2V8PA 3HM9A 1H2UX 1GXUA 2CA9A 2B7BB 2CQCA 4MKBA 1X8DA 5D0GA 3JTPA 1SJQA 3DM2A 1AUDA 3J7YU 4LMZA 5HL7Q 1R0BG 1WG5A 3GCXP 3GV7B 3TZZA 2AF6A 1CJUB 1JXVA 1VQMS 4I4BA 2ZD1B 1Y7PA 3AOCA 1NHKL 4J9PA 5GAEU 5J1PA 2V0NA 2MQOA 4PG5A 1JLBA 1RUSA 2BJ1A 2ZC4A 2KXHA 2LU2A 3S7RA 2UXDJ 2ILZA 1JXLA 3B4DA 1TL7B 4LF5F 2IVFB 2MZQA 1HQUB 1S9FA 2ZKTA 1JNZB 3M2VB 3HDSA 3GIMA 3OL8A 2AJFE 1VQSA 2FZGB 2YNFB 4M5LA 5KFPA 3CF5Q 1HW8A 3VQSA 2B6AB 3MM7B 2GQ2A 3IXQA 4WTYA 2PEHA 4KGMA 4ZJOA 1LFWA 2K1RB 3GV5B 3BJYA 3QGGA 2VHGA 1B0TA 3G96A 4RW6A 3CC2S 3H5YA 4IFVA 5HMXA 3R5DA 1VRUA 1R8HA 1U25A 4QYZK 4TQSA 3DU6A 3BPDA 3IBWA 2R7SA 1VRTA 5KFWA 2DGOA 2HNDB 3PR5B 1FHTA 1RLDA 4IFYA 3OW2R 5KFQA 4TU7A 4KIAA 3QRQA 4DL5A 2V4QA 2F40A 1ZPWX 3NAHA 2QC3A 1X4EA 2KYZA 2XYHB 2XHWA 2B56A 4NL5A 1WELA 2H4YB 5KFLA 1AA1B 2PDAA 4EO6A 2A0FB 4WYLA 1PYSB 3EGVA 2GVDA 4M5DB 3SFUA 4XTTA 4MJKA 2WW8A 2VZ9A 2QV6A 3GMGA 1LXJA 1TL3A 3OT9A 2XS2A 3HO1A 4DR1F 1N6QA 1WI8A 5KOXA 3BO3A 4QWDA 1RZMA 1JNRB 1R43A 3BKFA 3JSBA 2OPPA 3LP2B 4CH0S 2B4PA 3PW2A 3SIPB 2JDJA 2OELA 4RW7B 2KT2A 3SQGB 4U96A 4C98A 2NLWA 4X62J 2WW4A 2BM0A 3CD6S 2BQRA 2XI2A 2RD5C 2UVUA 1HBUB 4M95A 1FE0A 3RRGA 2HNYA 1NK7A 1NDPA 2QGFB 1M5VC 5H9FK 3P6YC 3N0VA 2E7VA 1UZHA 1QTMA 2BANA 3BQ2A 1RI7A 5GMDA 1DZ5A 4JI7J 2ZUAA 3AFGA 1YJUA 2FVCA 1E6YB 2IBKA 1HNXJ 1BQMA 1KQGB 3EUNA 2R7RA 1RHUB 4NI2B 2IHR1 1KRPA 3GR1A 1DRZA 1DTTB 4GVBA 1S79A 1NNDA 4AXJA 2KG1A 4ZVGA 1T94A 3UPFA 1ZZNA 4ZP6A 4YB1P 1WF0A 4CI0B 1FWKA 3IFEA 5BYQA 2K2PA 5AE2A 1WOOA 4NLVA 4LSNB 2DEJA 2DJWA 1VQOS 4X64F 3JB9k 4JB8B 1N56A 2VD3A 4V19X 5HANA 1U2FA 3W61A 5AXNA 4OX7A 2IAJA 3UN3A 2DIVA 2XBPA 5E5NA 2WB4A 1UPMB 1IKVB 1S48A 2ZBRA 2C2RA 1H0HB 1G7CB 1S5ZA 2F9DA 1TVRA 4Z7CA 2NSCA 4A8KA 2LQJA 4J5OA 3EWGA 3FFIA 1XEZA 4PPZA 5KFOA 1Y5IB 1RWVB 4KFBB 1X9WA 2ASDA 1TP7A 1S1XA 3LGHA 3NCQA 1S6UA 2ZBQA 1FWPA 1H38A 1IKYB 2E1AA 3Q8UA 4DR3J 3SCIE 2RF2A 2HGMA 2HVEA 1MROB 1DARA 2LMIA 3G4SS 2VFUA 3I82A 1YHQS 2VBXA 3KLGB 1QAIA 3ENAA 1C0TB 1QVFR 1O0PA 4AL5A 4ES2A 1SBRA 1SKUB 1LNQA 2IYIA 3SEOA 5I42A 2GW8A 1PO6A 5DZ7A 4LFBF 3LA0A 2DRDA 2WVEA 2B9YA 1EHWA 2GNKA 2MKIA 3KUHA 1BQNB 2DY1A 2OFGX 3CD5A 4ZN1A 2KZZA 2P6TA 4KGKA 2DKOB 1CEZA 2GIFA 3SBMA 1AB8A 5A2QU 2P6SA 2HAFA 3FCHA 4IYQA 2HLUA 2DISA 1HI1A 2BRLA 3KYLA 4PWUA 1YI2S 1N34F 4FNHA 2LEBA 3O6QA 4FXVA 2GZOA 2WOMB 1F6TA 4A8OA 1M5OC 2MSTA 4OFZA 2DBBA 2MKHA 2Q6CA 5MLCV 2XMMA 2KT5A 2KU7A 2KFYA 5K5MA 2HQ3A 1DQ8A 3IP0A 2IDLA 3JSMB 4ITSA 3R5CA 2ERRA 3G6XA 5HQ8A 4LREA 1AZSB 4DV5F 4YB7A 1NSQA 2HVHA 1WKKA 2KI2A 1P1TA 3QWUA 3TX0A 4DF4A 1LW0A 2ZVIA 4BDPA 4LF2A 2XEXA 5C42A 4U8YA 4OV6A 4B3RF 3G82B 1HQEB 2M88A 4I69A 4IG3B 4DS5A 1D3WA 3QLHA 4RUBA 4C8YA 4KB7A 1S1WA 5G0RA 5HMWA 2DGXA 5ETVA 4O0IA 1R3NA 4DQSA 3CMQA 1K8AT 1H73A 1M1KT 4Q5VA 2VA3A 4JV5F 5EDWA 3MOJB 1W7WA 5CCMA 3E3XA 2V34A 2RRNA 2LECA 1Q0NA 1YRXA 2QEXS 2JNJA 2XS5A 3N01A 3HP6A 1FKOB 3SFGA 4MKAA 3H25A 2OPSA 2KM8C 4R5PB 2AX0A 3S01A 5HO4A 4MIBA 4EUVA 3KG1A 4WFXA 4F4YA 1VBXA 5I3UA 4RNMA 1NK6A 3CDAA 2XCPA 1ZA1B 2R7OA 3PHEA 5K9FA 4B3SF 2BX6A 2MZTA 4JI4F 2MYFA 2OH2A 3BSAA 5KT3A 1RAOA 1IBCB 2DITA 4IDKA 4DQQA 3M8ZA 4RNNA 4UZCA 5ETNA 4OZJA 4ILRA 5CYQA 3K5MA 2M2BA 3EXYA 3FDSA 2VC1A 1RK8A 4NRTA 4OZ5A 3FC9A 2IJNA 2BJ9A 3BM7A 5F3TA 4H4MB 3KG4A 4DFPA 1U1PA 3W8GA 3N5BA 1T9TA 3GR0A 3ET6B 2I2YA 4ZA1A 1K1SA 3EGZA 3H90A 4AUKA 3V4IB 1TKTB 2CFXA 1VRQC 4DV1J 1FFWB 1IQTA 4C8KA 2V63A 3FEYB 4O4GB 4E98A 1IJEB 2GGPB 1RLCL 2B8PA 4LR8A 4ZDNA 1CJKA 1FJGF 3TAMA 2QA4S 4ES1A 2D7SA 1VIOA 3CD7A 4DL7A 3AA9A 4PWDB 4CLLA 4K4XA 3IA0A 5DM7Q 1GXTA 3VVUA 5J2NA 4ZMMA 4JI1F 3LF0A 2E9ZA 4EWTA 2LVWA 3MPVA 2CNLB 4IH6A 4L74A 1DTQA 2V4JA 1S9EB 3FSIA 3GB0A 4RZRA 1HNWJ 3DI6B 3R27A 2RQMA 1EKSA 3MTKA 1SIWB 2HRYA 1KWMA 2V4JB 1NDKA 4WXWA 1U4BA 5BJRA 3BQ1A 2GJFA 5HVHA 2NPFA 1FXDA 2D1CA 4O3QA 2F1FA 1ZOTA 4ECXA 4E8UA 2Q66A 1CPZA 4PG7A 2VDHA 4U7UD 1WORA 3KFWX 3PTWA 2C22A 3OFEA 2J9DE 1JLQB 4Y0FA 1SCJB 4RW9A 5M2UA 4O4RA 5B0CA 1S12A 6FD1A 2DNRA 4UOCA 1S1VA 4F2SA 1N5SA 2ZH9A 1PJ5A 4C8ZA 2MHNA 4YY3J 2K3IA 4P7VA 5J1EB 2JSXA 1TUWA 4P74A 3R5BA 2OJ3A 2E1MC 2E5GA 3MPYA 1GX6A 3KHRA 4RR5A 2G0IA 5LT5A 3QGPA 1OSDA 3QO9B 3UCGA 1AUSL 3KHHA 3AHPA 1N8RT 3C15A 3D2WA 1OO0B 4DQRA 1EIYB 1TK5A 1NHVA 4IH5A 1RABB 1KVJA 4DV2J 3EPGA 2V69A 4FNIA 4H54A 5CYMB 4ZIWA 4P7TA 1CC7A 4ED2A 4I6WA 1TV6B 1RT3B 5A8RB 4MK7A 5DLFA 4YEAA 2G2ZA 5IT4A 2DR8A 5CH7B 3HHLC 1RWNB 5E0OA 2K7JA 1P27B 1VQ8S 3CUNA 1YTYA 2DPJA 1YGYA 5KT2A 3OBIA 4F3MA 1U0SA 1Y0HA 5K8MA 1T05A 3M1VA 2CWXA 5C7PA 1YJTA 2YKNB 3VQTA 2RILA 3UI3A 2L9NA 1XERA 1CG2A 2V9KA 5E2QA 1FFGB 3HCXA 4A8FA 3FBBA 2J5AA 5HBMB 2RHQB 3EVOA 4OYXA 5KG4A 2G1HA 3DN9A 3RW7A 4ECYA 3G8QA 1PC5A 4ECSA 1KLNA 4UF4A 3CDBA 4YHHF 3PEJA 2YPYA 5HK4A 1JQGA 2E5LJ 1T9WA 4J91A 3RB3A 1N5YA 3BBCA 2WK4A 4QIVA 5BR8F 5D77A 1Q79A 3OR1B 1NDCA 3BF4A 2KDOA 1WUUA 3CCWA 3ILLA 3OXLA 7FDRA 1LWFA 3L09A 4P10A 4USIA 1P6TA 5K14B 3N6MA 4B9MA 2HQDA 1RTDA 2ZH4A 1NB7A 2FC8A 4N5SA 4Q44A 1LW2A 2XMJA 3PRVA 2O5DA 1QJHA 3JAMY 3MMAA 5HSPA 1IKXB 1RISA 3DGVA 3KLFA 3AJDA 1KTVA 2IIHA 2Z57B 2LU1A 3MM8A 4LUBA 3QAUA 1FRMA 1YJ7A 2XSJA 3BYPA 1S6PB 3CJRA 1REVA 3ELHA 1T9UA 2MQ8A 3DRPA 5IT0A 3Q8SB 3P49B 4KH1B 1PYOB 1KLMA 1OY6A 2UUWA 1RT6B 3D6TB 1S77D 3NOCA 4ZPTR 4GKKF 2IJFA 3EZ5A 2ZZMA 4ZVRB 3ENVA 2QA2A 2LKZA 3TZYA 1ZAXA 1CJVA 1FE4A 3GV8B 3DLKB 3R7NB 2N4DA 3NY0A 2IRUA 3MTJA 3DRSA 1HBNB 2ACYA 4OYOA 3DRPB 1UJ5A 2M9KA 1JLGA 1ZM4A 4RW8A 3R7BB 4HR2A 2KH9A 1JXEA 2Z0GA 3T1HJ 4X84A 2B0GA 3DLLQ 1UJ6A 5JVHQ 3DOLB 4B17A 4EU0A 3T5LA 4C3LA 2OPRB 3V6JA 1X4CA 2ASJA 1HPZB 1V9OA 1P8GA 1SQFA 3P45B 2R7WA 4YDDB 4D3HA 1HR0J 2ZWOA 2YTCA 4Z7YA 1PSDA 4JI2J 1NKBA 4KC5A 1MU2A 3EXCX 2IA6A 3V6DB 2M8HA 1BGXT 1IBMF 1GT8A 1RAAB 4MK8A 3P8BB 1R8PA 2BV3A 4A8WA 3QZ7A 4ED0A 4IG0B 3CMES 2WVDA 1WNEA 3MAAA 1AFIA 3H5SA 2CG8A 3KLEA 1RHJB 3DFEA 2PO4A 4LF5J 3B8HA 1UA1A 1SV5A 2QIFA 4LF9F 5KFVA 2YKOA 4UUWA 4WIQA 4OI3A 2BJ7A 1VQNS 4QPTA 4F50A 1ZTTA 2AJ1A 2HURA 2E66A 3DLJA 3UQSA 2RU9A 2XZWA 4F8RA 1BE4A 2JFKA 3D0HE 1SKWA 4DJBA 5D4PA 4DR4J 1I5OB 2BOAA 5H9EK 1TKXB 3GYNA 4DBQA 1RTJB 4DFKA 2KRBA 3MR3A 3UN2A 1HNZF 3R9LA 4DHVA 3GFZA 4TYBA 4CLKA 4B3OB 3Q8PB 2PFFB 3TEHB 1Q8LA 2BM1A 4C0BA 1L3VA 1FKPA 3DMJB 1VLYA 4WKRA 5E3AA 3M8QB 3H59A 3PFOA 1S6QB 1DQAA 2B4OA 4OZ2A 4B3TF 4C8NA 4JV1A 5LSOA 3M9NB 3PJWA 3F44A 3GILA 1N32F 1GK8A 2X1AA 2P2CB 1ZA2B 4KRWA 1X0FA 1FRJA 2CQPA 3U27A 3ZC4A 5B0FA 2ZBCA 5ITHA 3HFVA 1PJ6A 2BRKA 1NKCA 4USWA 3NLCA 4OHYA 2ZITA 3DRRB 2EXUA 5IC4B 2IM2A 7FD1A 3VGTA 2G9OA 3DOMB 1RWUA 3SSQA 4N56A 5DO2A 3LP1A 1YITS 4G65A 3R8YA 2MZSA 2ZOMA 3MMCB 2ZZTA 4WP8A 2DCUB 3OL6A 3LOUA 3L4BC 1PAUB 3TUIC 1E6VA 4EBEA 4DSFA 3KJVA 4G3IA 1APSA 3GIRA 1XQIA 4EEYA 2R2TA 1F60B 3H40A 3TA0A 4DSKA 2M4MA 4DV6F 4DR2F 2DR6A 3Q8RB 1CVJA 1KFSA 5KFFA 2Q1LA 3QMQA 2V8HA 2CXEA 1EP4A 4WIIA 1NU4A 1ZTWA 1UA0A 2Y9HA 1LK5A 3M30A 2CAJA 4X65F 1FD2A 3T9NA 3UW1A 4ZIVA 2CJKA 4C8LA 2VIHA 3ZZPA 4OLPA 3L7OA 4YN3B 2E1PA 4HI2A 3LGMA 4RNOA 3WDOA 2M3DA 2G1DA 1HMVB 5JUMA 2GAGC 4FBTA 1IM6A 2C3PA 4PG4A 2YWWA 2RE1A 1UW4A 1YZ6A 1RHKB 1WC6A 2LYVA 4YUDA 1G2EA 1XMOF 1NJXA 4YB6A 5A0YA 3IR6B 4PQUA 4RNFA 2IC3A 3BB5A 4EBDA 2FIUA 1RTHA 3EVWA 4DF8A 2HWIA 2F7VA 2UUBF 2PMHA 2VUGA 3KHGA 2CVIA 2APOA 2BVZA 5FD1A 1WC5A 1QD1A 1F9FA 3QJPA 1OWXA 4AE5A 1I94F 3SDEA 3PZPA 4C11A 2ZEJA 2ZM6J 2XY5A 3M05A 1PILA 5IOLA 4DG1B 1PCAA 1FKAF 4NLGA 3T5KA 3A12A 2H4WB 3ZFVA 2FLOA 3KLHB 3H8YA 2P9EA 2YKPA 3PW0A 3NNHA 2EC0A 4MYTA 2VONA 4USVA 2JFDA 3CTRA 1KOHA 2YNGA 2A6MA 4NOHA 3BREA 4I2QA 1HNVA 1MMLA 1X0PA 1IR2A 1Y00A 4OHZA 4DI6A 2CJAA 4RU9A 1UVNA 4NPOA 3M8WA 4OL8A 2QX0A 5F8MA 3H2LA 1A0OB 1PKUA 4X4PA 3W5YA 4F2RA 3MGJA 4KHPF 3WC0A 1GXLA 2VG7A 4Q43A 1LQ9A 4X4SA 4ZVHA 3ILIA 1R89A 5E7OB 1JLFB 5CZVA 1N36J 3PY8A 3PFEA 1M5KC 3PYEA 2V9WA 3M2UA 3IGNA 1OYEA 1PJ7A 1T3NA 3UDVA 1X5OA 4LQ3A 2WSFC 3I6PA 3LALA 2CQBA 2XNQA 3NGTA 4CM2A 3TZXA 3MM9B 1WDDA 3UR0A 3VV2B 5KFRA 1QAXA 4ZPBA 4K0KF 3BKUA 1C1BB 2BQUA 2LXFA 1RGVA 1L3UA 1JLEB 1WEZA 2E44A 1RAGB 1N34J 3KMQA 3I96A 2VKZG 5K8OA 2Z2MA 4MKYA 3J7A1 2HGLA 3I32A 3M6XA 4LF8J 3A3OB 4FVMA 3RAQA 5B7WA 3RW6A 4AL7A 1RT5A 3D6HB 5L1LA 1J2VA 5KFGA 1DAXA 4WXOA 1LWCB 4HEA9 4Y6IA 3W9IA 3LUYA 4PG6A 2L9WA 4LF4J 4OX8A 3LH2S 2HFUA 1NKEA 2N7CA 5KFUA 4LT6A 2JVOA 1MWQA 3MCNA 2DR7A 1RT5B 4WK3A 2UUTA 1S0MA 2W4CA 1XR7A 2A18A 3NMAA 2YQ1A 4U7CA 4KO0A 1K73T 3Q0AA 2VFVA 4FXDA 3BSCA 4LVNP 4ANCA 5A8KB 2K7KA 2VQEF 2AEFA 4MIWA 4ZITA 3ETMA 1SJ1A 1EETB 5L9NA 3I0RA 1RA6A 3BPSP 1RTZA 4LJMA 3AA8A 3MEGA 1SC1B 4J9QA 1UFLA 1FT8A 3G9CA 2ZH1A 1G6BA 3OTOF 1UL3A 1J5OB 3OUYB 5C24A 1SL2A 1H7WA 4P2FA 5KFTA 2R8JA 4FKYA 3THVA 4ILLA 5EGYA 1UZDA 2BE2B 4EGLA 2ALYB 1U7LA 2R3VA 2AJQA 1U09A 5IV3A 1TK0A 5J2QB 4JI4J 3AXMA 2A6OA 3NBPA 2AKWB 5F8GA 2IDEA 2VC0A 1I1GA 2AYMA 3P96A 3KK3A 2XWXA 3HHKA 3VAJA 3TVKA 1N52B 2FTRA 2JH3A 3F0NA 2GJ2A 1EZZB 3OSPA 1YBUA 2UUCF 4I2PA 3CB4A 4U7UK 4A8MP 4OHWA 4Y2CA 4QPXA 1L3SA 2W24A 2Y0SD 3FCWA 2EG2A 3UD4P 3TP2A 3BGRB 2W9CA 1BQXA 2OTLS 4PQAA 2V2ZA 1WOSA 2JLEA 5F3ZA 1RAHB 2DGUA 3HT0A 3ZZ0A 1XMQF 1VQ6S 4OMFG 2ZDPA 3OFFA 4ZLPA 2CJYB 6FDRA 1Q7YT 1FRIA 3SCJE 4K50A 2W01A 1HBOA 1RT1B 4DR7J 3Q22A 3AD7C 3GPAA 2F8MA 3C46A 3M2RB 2BW2A 1WEYA 1LK7A 2IRYA 3DLBA 5IT9U 2QSWA 2XWYA 3LP0B 5MAOA 3NOGA 4HYKA 1V3ZA 2ZE2B 3H5XA 3VHQA 3DDIA 1IKWA 4NLWA 1TKZB 1RT2A 2DH9A 1IWGA 4G1IA 4KH0B 1FDNA 3MEDA 3PCOB 3I9ZA 4O3PA 4ICLB 2E9TA 3IRXA 1PBAA 1J5EJ 2AYEA 3D0IE 1RSCA 2JLFA 3UD3P 3D66A 2OIHA 3DGPA 5KFXA 2W4DA 3CSKA 2M7SA 3MEEB 4JI6J 1NSKL 3W1YC 1R31A 3PW7A 3BGLA 2P5VA 1KONA 4ER8A 3RG6A 2YX1A 4RWXA 1F2HA 1UP1A 2ROPA 1YJWS 4KKOA 3C2PA 3D1QA 4C8MA 2HVIA 4EFAC 5JXSA 4X4OA 5C25B 4LFAJ 1RTIB 3NCRA 5ADZA 3BZQA 1N54B 3GTYX 1IBLF 1Y10A 3DRXA 2W2PP 3AY0A 4KHMA 4WWSA 4K7QA 2JOQA 2W9BB 1RHQB 4H4OA 2DNYA 3A13A 4YR2A 3IG1A 4HHHA 3TA1A 3TAQA 2M70A 1CJTB 2AMCB 1F5BA 3QAEA 1WHVA 1B7FA 3NS6A 1S9GA 3CD0A 2EWHA 1NJZA 1CULB 2G0JA 3WHIA 4QBUA 1X4FA 2W4PA 4E2FB 2VG5A 1QY7A 4A8YA 4DR6F 3W9JA 4E0DA 3C19A 2MZ1A 2D9PA 4OX9J 5KT5A 4AD6A 4ZVEA 2ZOGA 3J7ZT 1NK4A 1Q95G 1S9GB 2AGPA 4XO0A 4HHJA 3DCAA 1GTEA 3M9OB 5EN1A 3I0SA 2VG5B 2BKOA 3A8KA 1T9YA 5GAGI 2X3DA 5KFIA 1NSAA 4KGVB 1UAWA 2BJ3A 3PV8A 2KXNB 1X4GA 4DFMA 3OJSA 4BCAA 4ZHRB 5EWGA 5I4MA 5KFSA 1H74A 3HD2A 4YS2A 3D4JA 3ETOA 5GMEA 1RT4B 5KFDA 1NHUA 1RCXB 2RSQA 1MG7A 1RWPB 2Z30B 3AAWB 3UVJA 4W4MA 5DDOC 3FNNA 1WHXA 2GVZA 1VQ7S 3CO9A 5RUBA 4YHHJ 3BH6B 1GMVA 4DX5A 4P75A 5T7LB 1AYEA 2NUUG 3ITHB 2XG8A 4M1KA 5BR8J 1GMWD 4B9LA 5HROB 3E51A 4KR0B 2L41A 4OYAA 4L6V3 2UXCJ 2CQ1A 2PA8D 3E01B 2HHXA 2HEKA 5JVGQ 3FBFA 4IKAA 4PEOA 4CIOA 1CS4B 2RVJA 2YNHA 3IR5B 2BJ8A 2Q3PA 4PR6A 2C2OB 2HS4A 1ROFA 1HYSB 3PACA 2V2KA 2MKSA 2HFNA 4LBHA 3RAMA 4A8XA 3FZ2A 4ELTA 2KTQA 1KQKA 4O3OA 4IOBA 5DETA 3CIMA 3O8WA 4HDHA 2HNZA 2FYXA 2F5GA 3PEHA 5KG2A 1RAEB 3L7PA 3ZXWA 4FYYB 3EZUA 1U1QA 2JEJA 4WFYA 3VR1A 1RQ0A 1NUEA 2HW3A 4RUHA 2WVFA 2CG4A 5HJYA 2CPJA 2F4VJ 3HLUA 4MFBA 2M52A 4WZMA 2K06A 4FVCA 2LDIA 1RT7A 3P5BP 2XNRA 1YBAA 4PUOA 2YWGA 4BC7A 4PXCA 3ICLA 5A8WB 3Q8QB 4OJ1A 3J81j 4QWBA 4DX7A 3CJKA 3ZTPA 3IRWP 3SV4A 4HKQA 4O0NA 1EJ7L 3W65A 1X4AA 2UZAA 3OTEA 1RT7B 1NXIA 3QFHA 4JI3F 1SC6A 2NSBA 4OV1A 4KV8B 1I51B 1SB6A 4DR5F 2W25A 1KQSR 3BSNA 4F4XA 1NRKA 2EEYA 4RKUC 3HT3A 5DQGA 1S1UA 5DJBA 3D9BA 2RDDA 4LSZB 3KTQA 5EWFA 1OMSA 3D54A 3G71S 4JI0J 2MZJA 2C1EB 2BKPA 2OPQA 1VCTA 5A6WA 4FF2A 2FJVA 2QG9B 3C16A 2EW9A 1SC3B 2NXUA 3NG8A 3W66A 4ED1A 4ZVFA 3ISZA 4DV3F 4QW9A 4NXMF 3M32B 1U45A 4WKYA 2B9EA 3TUZC 5I3QA 3B4MA 3PYGA 2VB6A 1R8CA 2YKMB 3POTB 3RB4A 2EBGA 3LANA 3TAPA 2EC2A 3IBFB 4UQGA 3PJXA 3CCVS 3PHTA 4KJIA 1K0VA 1SH0A 2Y3YA 1U49A 3C16B 1U8SA 3W5ZA 3B78A 2YNIB 3X3UA 3CCLS 4TU8A 2DNPA 1HD0A 4I0WA 3AB2B 3T19A 3Q2SC 4ED4A 5L46A 1WJ9A 1RHRB 3GE9A 4I6AA 3MHYA 4DUZF 1HNZJ 2JHEA 5CQGA 1HL6A 2PEBA 2YQ3A 4LIRA 4Z2XA 2OD4A 3HMJG 3UNGC 4CT8A 4HACB 1YQHA 3KG0A 1UFWA 2OO4A 1RU1A 3D1OA 4WE1A 4EBCA 1S0OA 3UE2A 3DLHA 3R6LB 3GYXB 2UUAJ 2WONA 1UVKA 3D5MA 2MB0B 1ZBTA 4NASA 3TYTA 1C4AA 3C14B 5DDQC 2FHMA 4I7FB 4GVLA 5FIIA 4JV2A 1TUVA 2EFOA 3MR5A 2R2SA 1HNIA 4IQMA 4Q0BA 4ALZA 2CZ9A 1Y5LB 2WONB 4NLOA 2O3DA 2N82B 2GV1A 3GJRB 2HRTA 5A6PA 4KE5A 4D3GA 2W2OP 3R1LA 4USMA 3RBEA 4ECUA 3V81B 2LEPA 4PCQA 1T95A 1RBOB 2B51A 3C6TA 1OY8A 1FVSA 3CC7S 1O6XA 2UXBJ 3ONQA 1NJIT 1S0VA 3WX8A 1RWOB 3HPOA 2IPOB 1Z2LA 5FJ4A 1YG0A 1WF2A 3M8PB 4LRAA 4ZPWR 4AT1B 5D3GA 2BUNA 1DLOA 1M5PC 5DG8A 5B0DA 1S6OA 2YH1A 2X1BA 2HHTA 5HVFA 4F67A 1N33F 2YWHA 2ZBPA 3CMAS 3SXLA 3PW5A 4DL4A 1NEEA 2CPDA 3D28A 3KK2B 4WJBA 3NGRA 5CD4A 4CTAA 1VBYA 5AE1A 2VV5A 1M1HA 3MECB 4FZVA 4CLTA 4KBIA 2H65B 2MKYA 1VQ5S 1GFWB 5AXMA 4PPDA 2BQ3A 1S72S 5B0EA 5LL6d 4CYUB 5F0UA 3FQLA 2VBZA 3DHXA 4FN5A 1R8BA 1VIXA 2R9LA 1BLUA 3UDEA 1LKZA 4WZQA 1N0VC 1WSRA 1FJEB 4NZ0A 2RKIA 5L1IA 4FBUA 4CLZA 4CO4A 2MQLA 3IS9A 3GLJA 1D9DA 1TFYA 5FLXU 2CQ2A 3JYTA 2PE8A 1C1CB 1WD6A 1JWWA 3MR6A 4GMKA 3PO4A 2UXDF 2W2MP 2IVYA 4Y2KA 3H0PA 3VZHA 2ZOFA 4R0JA 4B02A 4RW4B 5BYSA 2J9CA 2ZUGA 4OI0A 1QSSA 4ZOSA 2XZDB 1MMNA 5DZ6A 2K8GA 1CJUA 5D0RA 2ZD1A 4DOZA 4HI1A 1TTHB 5B0BA 2OSQA 3OXGA 2MGZB 2Z8QA 2GC8A 3ISNC 2I9SA 3IMQJ 2ZBIA 3T1AA 5CXTA 4YR0A 4A46A 3CJ8A 2ZHOA 4FYDA 1PG5B 1TL7A 2R8IA 2MXYA 1X9MA 1HQUA 4ED3A 1RWKB 4LBIA 3QGIA 3M2VA 4B3MF 1ZM2A 4U8VA 2RHSB 2DY9A 2WZ1A 4DPYA 2CQDA 2YNFA 2GS8A 4F0KA 2NYIA 1JKHB 2F63A 3CW2C 5KG7A 1FTCA 2FGOA 2YKAA 2B6AA 4ENOA 4CLYA 1R27B 4CT9A 4FYWB 3MM7A 2L3MA 3MCSA 5CAAA 2R2UA 1VMBA 5ETOA 4DU7A 4OYMA 2HZCA 4USKA 2K1RA 2NQPA 3FZBA 5IV4A 1UVIA 1M1GA 1VR6A 2I5JB 5LOQA 1U48A 1KQFB 3CULA 2ZFHA 1OJ4A 2HZAA 3PIPQ 1SI9A 3EGNA 5IZHA 1S10A 1REGX 2HNDA 4LF7J 2HHUA 3CJQA 3QATA 1JJ4A 5T14A 5J2MA 4DQPA 2C2KB 4QYZJ 4Q45A 3MM5B 1QE1B 2XQCA 3BSOA 2XTJP 2IMWP 4ZPCA 2W8KA 2X3GA 3AD9C 3CCUS 2JEFA 2DRAA 2QYCA 2B7CB 1X4HA 5J2MB 4M5DA 3WQPA 3HZEA 3PX0A 2C2EA 2FB0A 2VBYA 4G1QB 1FRHA 1F5CA 1UPPA 4OYBA 1FF2A 4AQYJ 4MIAA 2BW7A 3JXOA 1VOMA 3NEKA 3GWCA 1JLAB 3ZZOA 4DPOA 3GZ7A 4CNZA 2VQEJ 3LP2A 3HFZB 2DNMA 3CJ2A 2XMVA 1HWLA 4O44B 3ZNUA 4JI7F 1U1OA 4RW7A 3PYDA 3SQGA 1PGZA 3VAIA 4ZCKA 3NNCA 3NWRA 2EFPA 3HXMA 3PXGa 1HNXF 1NZAA 2OEJA 2CZVC 3RZAA 4C6AA 2V6AA 2LXIA 4NYPA 5DGBA 1B3TA 4G6VB 2G4BA 1HBUA 3CNQP 2XCAA 1N0UA 4IOAQ 3OTCA 3KNGA 2LLZA 3VAKA 2J6SA 4QU6A 3B6BA 2HQCA 2MDAA 2Z58B 3IN5A 3U1LA 2DGVA 5KG3A 2HLTA 4NYZA 3K0JA 3NAIA 4YDXA 3GG0A 3B82A 1E6YA 4IO1A 4UOFA 2CWKA 1UW9A 5H9FJ 2A10A 4JI8J 5K8PA 4NLQA 3D1HA 4NI2A 3DKDA 1R0CB 3CPWR 4P71A 1FVQA 3TJAA 2DD8S 3KK1B 3QIPB 5DQHA 1DTTA 1NPRA 3DLGB 2DGWA 4CRJA 1YWXA 3HKWA 1SJ4P 1UVMA 4Y3CA 1QSLA 1WG4A 2PI4A 3UR3C 4U95A 2HWTA 3FJ2A 1K9MT 5EX3A 1TL1B 3FCVA 4NLTA 3G86A 4H4KC 4LSNA 2VG6B 4GRSA 3G87A 4GKJF 5CA5A 3S8SA 1S4FA 2AJ0A 4OYPA 3W8PA 2AGQA 2A2DA 3R6GB 1N4LA 4DR3F 5GAGU 1SL1A 2GX8A 3DOKB 3OV7A 2R7UA 4B9SA 2HHPA 5IM0B 1XMQJ 2QL9B 1P9QC 4LF1A 1IKVA 1S1TB 1EAYC 1W2BR 2ASYA 3E8OA 5DGAA 4ZLLA 3BGOP 2DNGA 1LOUA 5G4DA 2FHOB 2D69A 4L72B 4YP3A 3FK4A 2FY8A 2XB2D 3QT7A 3OR2B 4KFBA 3PIOQ 1S76D 5LXRA 4P2SA 2V50A 1B4SA 1FO1A 3HVTB 4O3NA 4RJVA 4OX6A 4Q2MA 1V6HA 1RAJA 1IKYA 2QT7A 2ZH5A 4HH1A 1NAQA 1WWHA 3IGVA 3CO0P 2Z2ZA 3K5LA 1MROA 4DXLA 4NCAA 3T5HA 3EYZA 4BWMA 3KLGA 2VJVA 3E2EA 2UU9J 1C0TA 4R8UB 4KT0C 4NCGB
chains in the Genus database with same CATH topology
1WHWA 4LSLA 2BVZA 5FD1A 1FJCA 4K4VA 3GFHA 2KJVA 1G1XA 1H2TZ 3KLVA 5J2PB 2VPWB 1F9FA 4OI1A 2RU3A 2XMKA 4DQIA 3CVKA 5D3GB 2GFFA 3QJPA 5E33A 5BYRA 2B5JB 2W7OA 1OWXA 4R0EA 4AE5A 1DLOB 3SDEA 3PZPA 1I94F 2UVWA 2VQFF 3RBDA 3BN7A 4C11A 2B4UA 3DRYA 3IO1A 3DC2A 3TUJC 2FHKA 4GO7X 2XY5A 1Q8BA 4ETZA 1B0VA 4OJGA 1YJVA 3M05A 1BQNA 1PILA 4DG1B 4IOCQ 3X1LB 1KD1T 3LGNA 4ED8A 4FF3A 1FKAF 3WBZA 1FXRA 2I0XA 1U1LA 3QGHA 1X5TA 1T05B 3MZIA 4ATNA 3M1VB 2DR5A 1Y4ZB 4NLGA 3T5KA 2P9GA 2NUHA 4X66F 4MYUA 3MAQA 2FC9A 4XDCA 2XMUA 2FPHX 3RRKA 4CTAB 3ZFVA 3TANA 3HZGA 2FLOA 3KLHB 3W2WB 3CT9A 4CH1A 4WFZA 3H8YA 2C42A 5B0AA 2P9EA 2MQNA 3CCES 4RU2A 2YKPA 3PW0A 3K5OA 4YQWA 2Y1IA 3SYZA 1SIZA 2YX7A 3UDLA 5B09A 3J7Z5 2HHSA 3NNHA 4FF4A 2WCXA 2DHGA 2KKHA 2FJXA 3BN4A 2EC0A 2FVPA 4MYTA 5M2RA 2HS0A 3W2VB 3K59A 2VONA 2GA7A 4FS1A 2HHVA 2JFDA 3CTRA 5LSRA 2ASLA 4RNHA 5D4OA 1KOHA 2CPYA 1ZM9A 2YNGA 2WOMA 3MM6A 4ZHRA 2FD2A 4U9RA 5SZTA 1U24A 3QPIA 1TFWA 2UXCF 3GIIA 4N76A 4NOHA 3BREA 3NL0A 4I67A 4PG8A 3VCDA 1HI8A 1HBMA 1RP5A 3FSXA 1Q4RA 4I2QA 1PC4A 5DLGA 1HNVA 1MMLA 4ID5A 2GMJA 1X0PA 4RBVA 2D41A 1Y00A 4OHZA 3FMWA 2CJAA 4WF9Q 5KFJA 3PKYA 3Q23A 2HQIA 4RU9A 2DHAA 1HD1A 1RT4A 2RKIB 2V5HG 1Q16B 2COLA 1UVNA 4NPOA 2BACA 3U02A 5L1KA 1N5YB 4OL8A 1U6FA 4DS4A 3BDEA 4X4QA 2EG1A 1T03A 1KEKA 4A8QA 5AXKA 2N3OA 3NRBA 5F8MA 3H2LA 4LIWA 3DLEB 4X4PA 3IS9B 5FDLB 4F2RA 3JSMA 5EX0A 1RA7A 1ZM3A 3MGJA 4WCEQ 4KHPF 3WC0A 5A2QY 5AE3A 1GXLA 2DK2A 2VG7A 4Q43A 2DH7A 5KFKA 1LQ9A 3PRDA 4NA3A 4X4SA 1LWFB 4ZVHA 4CO2A 3V5RA 1TAUA 1FEEA 1FK9B 4WU3A 4DV4F 1R89A 5E7OB 1JLFB 3MMJA 2AJ4A 2ILYA 3G8TA 3MPWA 4WFBQ 4NLYA 2K3KA 5T7LA 5CZVA 1RTDB 4HVZA 3JYTB 2XLKA 1LWEB 3PY8A 3PFEA 3ITHA 5KG5A 1M5KC 1LW2B 1SL0A 3WZ0A 5LSLA 2V9WA 5D4NA 5HROA 1HQEA 3M2UA 3IGNA 4Y2MA 3HHNB 2Z4PA 2XLIA 5IS2A 3NKYA 1P1LA 3MMAB 4IG3A 1VK8A 2EK6A 2W8LA 1T3NA 3HJFA 3PO5A 1X5OA 4LQ3A 3HM9A 2WSFC 3I6PA 1H2UX 1NJWA 1GXUA 3E01A 3LALA 2AW0A 2B7BB 2CQCA 2CQBA 2XNQA 1D1UA 4MKBA 1X8DA 2JRSA 3KLFB 5F9LA 3JTPA 1SJQA 3MM9B 3ZZUA 3UR0A 5KFRA 3DM2A 2EFNA 1QAXA 4ZPBA 3R5AA 2DNLA 3NS5A 4K0KF 3MM8B 3QJJA 1C1BB 2BQUA 2XSJB 1AUDA 3J7YU 2LXFA 3FGVA 4LMZA 5HL7Q 1UWBB 3DYAB 2VODA 2RB7A 1WG5A 3GV7B 1REVB 2PGCA 2PN6A 1RGVA 3R1HA 1L3UA 1HYSA 4GC7A 4JI5F 1JLEB 1WEZA 2AF6A 2E44A 3IC1A 2F4VF 3KMQA 2DPIA 2VFSA 3I96A 2VKZG 2MHEA 5K8OA 1KLMB 2Z2MA 4MKYA 1VQMS 3J7A1 4I4BA 1FKOA 2HGLA 4QIGA 2J7UA 2ZD1B 1Y7PA 4OQJA 3C3LA 1OQ6A 3I32A 3M6XA 3G6VA 4J9PA 2X1FA 5GAEU 5J1PA 3KOAA 2V0NA 4FVMA 1QVGR 5IWAF 2MQOA 4PG5A 3RAQA 3M4XA 5B7WA 4XPEA 1JLBA 1JIHA 3RW6A 2KM8B 1YRTA 4AL7A 4R5PA 4WFNQ 1IBKF 1U1NA 1RT5A 2ZC4A 2A3JA 2KXHA 2LU2A 3S7RA 5L1LA 1J2VA 1KR4A 4IQXA 2ILZA 3DRSB 5KFGA 2WRMA 3B4DA 4A47A 1JXLA 2KFZA 1DAXA 4WXOA 4LF5F 1LWCB 2IVFB 2MZQA 4HEA9 2KHCA 4TN2A 4Y6IA 3OJUA 5HP1B 1HQUB 4UQTA 4HTJA 1FRXA 3LUYA 1JLGB 3G6ES 1R0AB 2BJDA 2CQIA 3BDPA 1S9FA 2O66A 2ZKTA 4RW8B 1JNZB 2XMWA 1ZETA 3M2VB 5E3QA 4PG6A 3HDSA 2L9WA 2EVZA 3CDWA 2C2DA 2C3MA 3GIMA 2AQ4A 3OL8A 4OX8A 2AJFE 4DLEA 1VQSA 5KFYA 2YNFB 3LH2S 4DV1F 2LQBA 5KFPA 1NKEA 2N7CA 2DCLA 5KFUA 3GQCA 1HW8A 4LT6A 3CF5Q 3GFXA 2JVOA 3VQSA 2B6AB 2DR7A 1RT5B 3K7RA 2DGQA 4WK3A 3T6JA 2UUTA 1S0MA 3NWGA 3GIKA 2W4CA 1BY9A 3MM7B 2GQ2A 2HAIA 1XR7A 3ENQA 4FS2A 4O3RA 3FRZA 2A18A 3NMAA 3IXQA 4WTYA 5F41A 2PEHA 4KGMA 1LFWA 3MD3A 1FRKA 3MD1A 3MR2A 1BC6A 4U7CA 4FF1A 2K1RB 3QWPA 4KO0A 3GV5B 1K73T 3BJYA 3Q0AA 2FDNA 2HPUA 3QGGA 1B0TA 2VFVA 4NA2A 4O3SA 4FXDA 1C2PA 3BSCA 4RW6A 3G96A 4LVNP 4JI0F 5A8KB 3CC2S 3H5YA 2K7KA 2I1RA 2VQEF 1HARA 1WI6A 4IFVA 4MIWA 5A8WA 3UWTA 1FEHA 4H4MA 5HMXA 3R5DA 5B0GA 1F2GA 1QUPA 1Q81T 1VRUA 2PC6A 4ZP9A 3US5A 1VFJA 2E5JA 3I31A 1SJ1A 4TY9A 1EETB 5L9NA 1R8HA 3I0RA 1U25A 3QJLA 4TQSA 1RA6A 1MU2B 3DU6A 3IBWA 4LJMA 1TAQA 2XC9A 3KNAA 3AA8A 3MEGA 3OSNA 1KTQA 2MKJA 4NLPA 4QCLA 3LAKA 2R7SA 2HHWA 4HLBA 2EK1A 4J9QA 1UFLA 4K5RA 1VRTA 4W92B 5HN0A 5KFWA 3V4IA 2DGOA 1FT8A 1TKTA 2HNDB 3PR5B 1X4BA 3HHEA 2Q43A 2E29A 3TRGA 3G9CA 2ZH1A 2VPZB 1G6BA 4IFYA 4TY8B 3OTOF 1UL3A 3ISND 3OW2R 5KFQA 3OUYB 1QAYA 4KQZA 1J5OB 5C24A 4QQBA 4TU7A 4KIAA 4O4GA 1SL2A 4DL5A 1H7WA 4KV8A 5KFTA 3CJ0A 3DU5A 2R8JA 3ZZYA 2V4QA 2GGPA 2F40A 1KN6A 1FDDA 4LF6F 1ZAWA 1K0TA 1ZPWX 1IXKA 4ECZA 3THVA 2NS1B 3NP5A 3NAHA 1HNWF 4ILLA 5EGYA 3KLEB 2CPEA 1X4EA 2BE2B 2JJ4D 2KYZA 2XHWA 2C3OA 2B56A 4NL5A 2DIUA 1O5JA 2ZNYA 1SJFA 1WELA 2ZDOA 1VQ4S 4PWDA 1SV5B 1BD6A 4FXWA 5KFLA 3RR7A 2FLLA 2PDAA 4EO6A 4EZ6A 4EGLA 4ED5A 2PMZD 4WYLA 1U7LA 5KFCA 3BR8A 2HGNA 1ZH5A 3MWBA 2CQ3A 2AJQA 1KVIA 1U09A 4M5DB 1TK0A 5J2QB 4NCBA 2HMIB 3SFUA 3MMBB 3NBPA 4MJKA 2WW8A 5F8GA 2MQQA 2VZ9A 3M32A 2VC0A 4ZCLA 2QV6A 3GMGA 4OZ0A 1LXJA 1TL3A 2XS2A 3HO1A 1I1GA 2AYMA 4DR1F 1N6QA 1WI8A 3OTDA 3P96A 3KK3A 2YKMA 3POTA 2XWXA 3HHKA 5KOXA 3BO3A 3HX9A 3VAJA 2YKQA 3TVKA 1S9EA 2RS2A