5IM0A

Crystal structure of the rna recognition motif of mrna decay regulator auf1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
MEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the N-Terminal RNA Recognition Motif of mRNA Decay Regulator AUF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Heterogeneous nuclear ribonucleoprotein D0
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5im0A00
1VC0A 1Q86T 1KD1T 3CCES 2LEBA 2RQ4A 3CCVS 2J0SD 2MGZB 5GVQA 4V19X 2LKZA 3S01A 2MQQA 2E5GA 4EGLA 2MGZA 2ZJPQ 2MY8A 2OSRA 2JWNA 2YH1A 2MZQA 3VAHA 4C4WA 2DGQA 1M90T 2CPJA 4W92B 1VQLS 1N54B 3IWNC 2DNHA 2MPUA 3SMZA 2I38A 1VQPS 2CPEA 1SJ4P 5DDQC 1R8PA 5IQQA 2EK1A 2M9KA 2BZ2A 2ERRA 2MZSA 2LECA 1YJNS 1X4GA 1UW4A 2CPHA 3R1HA 2KT5A 3TYTA 1M5OC 1UAWA 2E5IA 3ZZZA 3BO4A 1X5TA 2M70A 2KH9A 2KU7A 3NMRA 2CPIA 1CVJA 4UQTA 2PEHA 2E5JA 1M5PC 4YB1P 5H1SV 2MJUA 2DNKA 2CQ2A 4QU7A 1KOOA 2G4BA 1KOHA 2D9PA 2JVOA 1X4EA 2RS8A 2KYXA 2JX2A 2JVRA 1X4CA 3UWTA 2VONA 3CMAS 1FXLA 2LYVA 2J76E 1U1LA 3G4SS 1JMTA 1NO8A 3J7YU 2CQCA 2E5HA 2U1AA 3UCUP 1P27B 4WFAQ 3MDFA 1SJFA 2CPZA 2FHOB 2CQ1A 2MZTA 2DNNA 2G0CA 2HGNA 2KG0A 2FY1A 3NNCA 2CQBA 4FXVA 2AYEA 1WHWA 4P6QA 5DETA 1X5PA 4J5OA 3EX7B 3CMES 1HD1A 2RNEA 4YOEA 5IM0A 2YKAA 5JVHQ 4RU2A 2B0GA 3CCSS 3Q2TC 1FJ7A 1HA1A 2MQPA 1M5VC 4PRFA 3L3CA 2QFJA 2N3LA 3CC4S 4WF9Q 2D9OA 2KVIA 1WG5A 2MSTA 4C0OC 2RU3A 2L9WA 4F25A 2M88A 3K0JA 2XSFA 3PIPQ 2MQNA 2DGTA 5LXYA 1K73T 2XS2A 4PKDB 2VOOA 5LXRA 1WEZA 3G96A 4W90B 3ULHA 2X1BA 1OPIA 1VQKS 2HGMA 2YH0A 3CC7S 2MZ1A 5LSOA 2J0QD 2LA4A 5GAEU 3CCLS 2GO9A 1P1TA 1WHXA 4IUFA 1KC8T 3MXHP 2KXFA 1Q7YT 1H6KX 2DNMA 2GHPA 2L08A 1G2EA 5LSLA 3BS9A 1SXLA 1YJ9S 1X5OA 2M0GB 3UD3P 3V4MA 3S8SA 1X0FA 1FJCA 3CCMS 2DNLA 1DZ5A 3RW6A 3FEYB 2Q79A 4TLQA 1U1PA 1URNA 4IO9Q 4OZ1A 3LQVA 2RS2A 1QVFR 5D78A 1U1KA 2OTLS 1FJEB 3Q2SC 2DGVA 1XN9A 3BO3A 5JVGQ 2CQPA 1WHYA 1WTBA 2DHAA 4ED5A 4TU7A 3MD1A 1X4HA 3G6ES 1X4BA 2LQ5A 2DGSA 3CPWR 1Q82T 2M7SA 4Y0FA 1SJQA 3FEXB 3SDEA 3PIOQ 2A3JA 2MQMA 2LMIA 2F9DA 1FT8A 1VQOS 5DDRC 3CCUS 2ADBA 1VQNS 2LXUA 4Z2XA 3CC2S 3BO2A 4BS2A 3CCQS 2X1FA 3I56S 2MYFA 2M8DB 3P49B 3EGZA 1ZZFA 1PGZA 2NZ4A 2YTCA 3CXCR 3MOJB 3G8TA 2EK6A 3TP2A 4FXWA 4CH0S 2DHXA 5CXTA 5FJ4A 1FHTA 2KM8C 1R8HA 1N52B 2N7CA 2KHCA 3US5A 4TU9A 1YTYA 2DIUA 1H2UX 1X4DA 2DNQA 2HGLA 2MY7A 3SDEB 1VQ8S 3G9CA 2DGXA 2MKHA 2DNPA 1WF2A 4CH1A 2FC9A 2QA4S 1M1KT 3RW7A 4F02A 3VF0B 4WFNQ 1L3KA 2OTJS 2E44A 1D9AA 2MMYA 4LJMA 4IOCQ 3UE2A 3CTRA 2ZJQQ 3VAKA 1YHQS 1VC6A 2MKKA 3H2VE 1U6BA 2F9JA 1WF0A 3DLLQ 2CQ4A 2CPDA 4ERDA 1DHMA 1WI6A 1WEYA 3VAIA 2NLWA 2DGUA 1K8AT 4M5DB 2MKCA 1M5KC 1AUDA 1N8RT 3R27A 3CCRS 2N82B 2LXIA 5LJ5Y 3THTA 4A8XA 2SXLA 2FC8A 1YWXA 3UCGA 2M8HA 2QEXS 4QU6A 2M2BA 3TO8A 4PR6A 1VBYA 1DRZA 2DGOA 3NNAA 3P3DA 2KM8B 2KG1A 2O3DA 1U1RA 1WWHA 2DH7A 4WCEQ 2MHNA 4WIIA 2AD9A 1JJ4A 2MB0B 2CPFA 4C7QA 1X4AA 3UCZP 3VALA 2X1AA 2MZRA 3VAGA 3SXLA 2DNYA 2XB2D 3HI9A 1WELA 1PO6A 1VQ9S 1DBDA 1VQ4S 4WKRA 2DITA 2FPHX 3U1MA 4UY8T 2KXHA 1OWXA 2KN4A 2DNGA 1NJIT 1VBZA 5HL7Q 5MLCV 1N88A 2CQHA 3CUNA 5DDOC 1BY9A 3BEGB 3MI7X 1YJWS 5GAHU 1VQMS 2MQLA 5IM0B 1WI8A 3MD3A 2XS7A 2HZCA 1VC5A 5EN1A 1WG1A 1B7FA 3VAFA 1X4FA 3EGNA 5BJRA 2DH8A 2JRSA 3IRWP 5HO4A 2RT3A 3H2UB 2D3OR 1U1OA 4ZKAA 2RRAA 2MJNA 3J7ZT 2V94A 3VAMA 3JB9k 3CF5Q 3UD4P 3S6EA 2MKIA 2VODA 1S79A 2I2YA 2K8GA 2AYBA 5D77A 5DM6Q 2MSSA 2LEAA 2RUGA 1W2BR 2K3KA 2X1GA 1D8ZA 1SJRA 2DB1A 2KI2A 5GAGU 2CPXA 3NS6A 1U1NA 1JJ2R 2DNZA 4TU8A 4U67Q 4OZ0A 5GADU 3HHNB 1H2TZ 2DHGA 3P6YC 1YITS 2DO4A 2U2FA 2OJ3A 3CD6S 2CQDA 2DK2A 4F26A 1UP1A 3THPA 1K9MT 2N3OA 1U1MA 2BOPA 2G1DA 4Y00A 1QM9A 2VOPA 3CULA 1WF1A 2PE8A 2DIVA 1FNXH 2UP1A 5GMKa 5CA5A 1KQSR 2KRBA 2DH9A 2OSQA 1OO0B 1H2VZ 1F9FA 4LMZA 3P5TL 3R1LA 2HVZA 5IFMA 2RVJA 4CIOA 3MUTP 2XS5A 1RK8A 1SJ3P 1FO1A 2DNOA 2F3JA 3VAJA 1VQ7S 2KFYA 1VQ5S 2CPYA 1IQTA 3B4DA 1YI2S 1U1QA 4IOAQ 1X5SA 2DNRA 3CCJS 3OW2R 5DDPC 2YWKA 1VQ6S 5ITHA 2DISA 3MUMP 2RRBA 2RQCA 3I55S 1U6FA 2CQ3A 3LPYA 1VBXA 3U1LA 3NNHA 2MXYA 3MUVP 2LA6A 3G71S 1JJHA 2AYGA 4CQ1A 2KXNB 1WEXA 2KRRA 1YIJS 2ADCA 1U2FA 2MKSA 1NU4A 3DXBA 1HL6A 1UFWA 1O0PA 4YUDA 2J8AA 2AYMA 1A9NB 5CYJA 2DO0A 1Q81T 3D2WA 2EVZA 3S7RA 1ZH5A 1QVGR 2LCWA 3NS5A 1WG4A 3B4MA 2CQIA 2MZJA 4WFBQ 4QPTA 3G8SA 3ZZYA 2MQOA 1A7GE 5DM7Q 2MKJA 2HYIB 1OIAA 2OIHA 2CJKA 2ZJRQ 2WBRA 2XNQA 2XNRA 2M4MA 2L41A 5LJ3Y 1ZZNA 1RKJA 2CQGA 2CQ0A 1HD0A 3N9UC 1S72S 1WHVA 2DHSA 2DGWA 2M52A 4LIRA 4QQBA 3MURP
chains in the Genus database with same CATH superfamily
4N56A 1H3DA 5CABA 5F8IA 1C0UB 1Q86T 1KD1T 2V68A 3RBXA 3E3XA 1GMVA 1NSKL 2APOA 4ZLNA 3IR5B 2LLZA 2RQ4A 5IV3A 3TR5A 4X4OA 3H5YA 3EPIA 4DV6J 5KT3A 4FZVA 2G2OA 4R5PB 1WUUA 3RTVA 1FVSA 2HHSA 3EZUA 3ZO7A 2D1CA 4U7UD 5C25B 1U02A 4WP9A 2ZH9A 1CJVB 4I56A 4DPUA 2UU9F 4RO0A 2J6UA 4FF2A 2FGCA 1XK8A 4NCGB 1KLNA 4B9VA 3LP2B 2ZJPQ 4PUOA 4Q45A 2X7IA 2RILA 2OSRA 2FJVA 4DL7A 1RWPB 3K7RA 4DL2A 1S10A 5DG8A 4LFCJ 2MZQA 1KWMA 3MMBB 2IRYA 1YBUA 4YHHJ 5K8PA 1HIYA 1NCLA 3TW0A 4QWEA 4KB7A 2RF2A 1KSPA 3OJSA 1R3NA 2DNHA 2ZUGA 5L38A 3EZOA 3T1HF 4X64F 2VG6B 3RBZA 2HKEA 2V8GA 3DLEA 5K14B 3SFGA 3MGJA 3FVYA 1R8PA 3M2UA 3KK2A 5IQQA 2EK1A 1XNRF 3FQKA 2BZ2A 5E5NA 2P9EA 1RA7A 2CYYA 4DSFA 1HPZB 3PVXA 4MIWA 4DQRA 2IVFB 1KFDA 3TYTA 1T9YA 5J2MA 4QIVA 4AL6A 1UPMB 1X5TA 3I5CA 2KH9A 2KU7A 1RISA 1VGYA 2BBEA 3GSIA 5EUHA 5L9XA 3C8YA 4Y34A 4CO5A 4ZITA 2CWXA 2FLNA 3PYGA 5J2NA 3R3TA 5KG1A 2RF2B 2B4VA 4J7CA 3VHQA 3NGKA 2E7VA 5B0CA 5JMNA 3ZTQA 3SV3A 4MK8A 3C19A 1A6LA 4M94A 3M32B 1KOHA 2ZM6F 2RS8A 1Q8IA 1S59A 4JI0F 3Q8RB 3QGIA 1GTHA 1FWKA 3D6MB 2OEJA 3M8QA 1X4CA 4PXBA 4G1QA 5KG3A 2BR0A 3GWCA 2CNKB 3J7YI 3C6TA 4RNNA 3J7YU 3T19A 3UCUP 3CJ4A 2MKYA 4OHWA 1OSCA 4J91A 4LIWA 4NMLA 4ATNA 1QSSA 4JI2J 3AJDA 2UVRA 1N33J 1PJ5A 3CMQA 3LF0A 3IRXA 3MWBA 2FHOB 1UTAA 2QZ8A 5E33A 1RU2A 2MHEA 4K4UA 2VPYB 2HGNA 1WC1A 2H51B 1IM6A 1IM4A 1IKWA 4R8UA 1TKZA 2C2ZB 1FFWB 1S49A 2CQBA 4B02A 3TZYA 3NNCA 3OLBA 1NXIA 2J5AA 4WTYA 3CDWA 1NHUA 1HR0F 4P6QA 2HS4A 2PO4A 3D5MA 1RWKB 4J5OA 3EX7B 2UUCJ 4IDKA 2B7BB 3CSKA 4KJIA 4OI4A 2OFGX 4C8MA 1C0TB 3HX9A 4C8NA 3RZAA 4CLWA 1FRIA 4OX6A 2FJDB 4I69A 1PCAA 2QTWA 5DO2A 2XMAA 1VRQC 5D0RA 2B0GA 3ENAA 4P9SA 2JFKA 2VQEJ 1U0HA 4HHHA 3MOZA 1HA1A 4UOHA 2MQPA 4FDFA 3V4IB 1TL1A 3BQ2A 3RBDA 2D9OA 2V6AA 1WG5A 3VZIA 4C0OC 4KT0C 5D0EA 3M1VB 2L48A 3OR2A 3D6TB 2M88A 4OYIA 1HQUA 2QSWA 3JTOA 4BC9A 1UJ4A 1YBAA 2DEIA 2V8PA 1FNOA 3JTPA 1JK9B 1RWOB 1KTQA 1TL5A 1V9OA 2ROEA 1TUGB 1WORA 2JZ5A 4OYMA 3W2VB 1K73T 2HVHA 1C2PA 2BRLA 3MM8A 1VLOA 5J2PB 2QRRA 3M6XA 1BWVA 2R2TA 4U6PA 1IKXA 2YXLA 2G0JA 2XHWA 3RBEA 1OPIA 3ISZA 2DR8A 2BJDA 1OPZA 2W2QP 2CZVC 4ZVFA 3HCXA 3HVTB 1WJ9A 1EIYB 4BWJA 1ZM9A 4WYWA 5CYQB 1IXKA 3MHYA 1LKZA 2LA4A 1Y10A 4LUBA 4RW6B 2GO9A 3WZ0A 5JUMA 5C24B 5GAEU 3BPSP 4A8MP 2BKNA 1C4CA 3RRGA 3BH7B 1S0MA 3AB2B 4TQRA 2FVQA 1UVMA 4BLGA 1N5VA 3OJUA 1DTQB 4QYZK 3GV7B 2GHPA 2L08A 4QPXA 1ZM3A 3KLEA 1NK6A 5LSLA 1XBWA 4PABA 1V6HA 3CDBA 5HI7A 1YJ9S 3MM5A 2KO1A 4L73A 3BSCA 2C3OA 1MNEA 2OPRB 1V3RA 4NI2A 4YB6A 3VR1A 2BQRA 1HBOB 2VZ9A 1Y0HA 3SQOP 1RT4A 4MMOA 8RUCA 1N33F 1O51A 1SKWA 2W2NP 2H5IB 2AGOA 5FJ4A 1LK7A 4DWIA 3IP0A 1RBOB 1TL3B 4FVMA 4TLQA 2VG5A 4K2JA 2CRLA 1LV5A 1UJ5A 5ETKA 4K59A 2HW3A 2LP4A 3W60A 2J7WA 4DV5F 3EJMA 1FWLA 4ZPWR 4LF1A 4ZIVA 4OJ3A 4DDFA 3PXGa 4ECRA 3IFEA 1DTQA 3BREA 3TVKA 3MEKA 3Q2SC 3U7JA 1XN9A 3R5GA 5A8RB 1UZHA 4Q8EA 1WTBA 4ED5A 2E1RA 2HAIA 4MYTA 5DGBA 2B5JA 1AA1B 1D0EA 4X4VA 2IYGA 3QQCD 5EGYA 5KG7A 4QJVA 4O0IA 3KMQA 1EP4B 4DZ6A 3FK4A 2WSCC 1HNZJ 4DX8H 2VBZA 3QSIA 2QA1A 4J37A 1RTDA 4B9TA 1LXNA 3K5OA 2KT3A 2XMVA 3PIOQ 4OI1A 4DR5F 3UQSA 1JLCB 2R8GA 2RB7A 3RB6A 1XR7A 1U25A 2V2ZA 1FT8A 4O4GA 1SL1A 1X9MA 3MM6A 5DDRC 4PYAA 1KN6A 1HI8A 1B64A 4ZVSB 4DPOA 5HMZA 5L1JA 3MF5A 1DTTB 2MLYA 3M6WA 2HRTA 3RAMA 2A6OA 1RAJA 4ED8A 2HHUA 1QDUB 4ZLPA 2R7OA 1F2GA 2GCFA 3KG0A 3BKTA 1GK8A 2R3VA 5KG6A 2VG7A 2AZ3A 2ZKUA 2EFNA 4FNIA 2VG7B 3LP2A 4Y2AA 3H4DA 4DF8A 1PGZA 2EK6A 1HNVB 4J9KA 2NUHA 4FXWA 1TP7A 2IVYA 1FHTA 4ZPCA 2A1BA 4QWDA 4UY85 1SI9A 4DR3J 5D4PA 2DTJA 2N7CA 3US5A 4ZP7A 3QAEA 1YTYA 4O3QA 2FD2A 2W7PA 5F8LA 1QAJA 4V19J 1T02A 4O4GB 1IR2A 5J2MB 3V6DA 2DNQA 3HZEA 1WC5A 4GVBB 2XO6A 3G6YA 1TZ0A 2ZFHA 3M2RA 2RHQB 3DLJA 3FQLA 3IA0A 2DGXA 4Y2KA 1VQ8S 2DRAA 5J1NA 3N6MA 2FC9A 3MM7B 3MFHA 1J5EF 2QA4S 1S9GA 1SV5B 4ENOA 4XO0A 1M1KT 3RW7A 3D28A 3P8BB 1XC9A 5KFSA 4K0KJ 2E9ZA 2VPZB 3KLVA 1F0XA 3N6LA 4R8UB 3W3SA 4DV0F 1VHFA 3DRPB 2QLWA 3DRRB 2JSXA 4R0JA 4IG0B 1KHWA 1UEUA 2BJEA 2E44A 3TRGA 4ECQA 4LJMA 3CJ0A 6FDRA 2UXBJ 1W25A 4IOCQ 4C8OA 2ZJQQ 2BW2A 2PSZA 1VC6A 2YX4A 3ET6A 3H2VE 4AXJA 4TYBA 2V4QA 4EZ6A 2D74B 2EEYA 3A8IA 2DRBA 1LWEA 1ZAVA 2CQ4A 2CPDA 2DBBA 2YNFA 4HI2A 3JSMB 1WEYA 4UW2A 2IM2A 2XC9A 1FKAF 4K4SA 4GKKF 2FQQB 3GP9A 1OJ4A 2H5EA 4OJHA 2JEGA 3KK1B 1K8AT 1SL0A 4M5DB 5A8WA 2MKCA 2VA3A 4Q8FA 3H20A 1RKIA 2W2OP 1Q95G 1R7IA 2N82B 3KFWX 1RU1A 4B08A 1FA0A 3PRVA 1G3OA 3THTA 5HMXA 1JLFA 2XSJB 5E2QA 5E41A 1RTJB 4KAIA 1IBKJ 1REVA 3PW2A 3UCGA 4H4OB 2M8HA 2ZH7A 4J9RA 3BYRA 4AL5A 2YNGA 1YZ6A 4QU6A 1S1TB 3TO8A 2GJIA 4F2SA 2W1BA 3M6VA 1OMSA 5HSPA 5KT7A 7AT1B 2B51A 1H98A 3FBFA 4WCEQ 4LF2A 1JJ4A 2K3IA 5T14A 4AYBD 1AYEA 3K8WA 2C1EB 4I6YA 4F4XA 4ECXA 2MB0B 3M9NB 1Q5VA 1N32J 2Y8YA 1RLDA 4IDKB 3ZNJ1 2JHEA 3QFHA 4DQQA 2CPFA 4CT8A 1T9WA 5D3GA 1X4AA 1JLQB 1WD6A 2X3GA 2GV1A 4W98A 4YR3A 2C28A 1JLGA 4RX6A 1PO6A 4X4SA 2AJ1A 4NXMF 1RBLA 2CADA 2FPHX 1U47A 2Q6BA 1WKJA 2UUTA 2GNKA 2YQ0A 2D69A 2IVMA 4N7TA 2WCXA 3DHWC 3G87A 4JOUA 1HQUB 1U4BA 1I3OB 2DJWA 1PC5A 2ZOFA 1OWXA 4PQAA 4HYKA 1S76D 4ECVA 3UR3C 1DFDA 2WK4A 1ITPA 3V4IA 3CCTA 1AROP 1G7CB 5MLCV 4DLGA 1HW8A 1KVKA 3JAMY 4WZMA 4EK2A 2CQHA 2HBQB 4KE5A 3NG8A 5KT2A 2E7WA 3OFGA 2C3MA 2OMLA 4WZQA 4OYWA 3OTOJ 2MQ8A 5DLFA 4G3IA 2NPIA 2VFSA 3R6LB 3SSRA 5C7PA 1HNXJ 3IM9A 3LA0A 2HK2A 2PT0A 4P72A 2HLTA 1WG1A 4DN9A 3BM7A 5DQHA 4JV2A 1FKPB 2JDJA 1EQMA 3NAHA 3WBZA 1FKPA 4ZCIA 4WTOB 5CD4H 2GIRA 1IN0A 4LF5J 4OL8A 1FDAA 3ZZOA 1VJQA 1U1OA 1ULRA 1WOPA 3KK3A 2DXEA 2OD6A 4DUYF 5ETVA 3J7ZT 2V94A 2ZITA 4X4TA 2I2YA 3MCOA 3E51A 4WU3A 3RRHA 1HHTP 3CO9A 1JLAA 4OJGA 1VFJA 2FLOA 2YNIB 4F36A 2CFXA 3NLCA 2OPQB 5HMYA 2R7XA 5KFXA 2Q6CA 2LEAA 2RUGA 3L4BC 1KR4A 4USHA 4G65A 1V3SA 2O1PA 4PCQA 1TVRB 3MEDA 3JSRA 4URGA 4RU9A 4I67A 2X1GA 1FJGF 3C14B 1KLMB 1GFWB 1N6QB 5GAGU 3SCIE 2W8LA 4B9UA 3ENVA 4I6WA 4NLOA 4F0MA 1UL3A 3MTJA 3PZPA 4QOTA 1S1WA 2Z2ZA 3BH6B 1T05B 4L75A 2G1HA 3CDUA 4ILRA 2OPPA 2H9ZA 1FKOB 5KFCA 2J9CA 3LW5C 3OTDA 2BMBA 3FKBA 1NKEA 2E9RX 4ZVUB 2ZHBA 2K1RB 2CQDA 2DK2A 1SIWB 2DT9A 3Q8VA 3THPA 4DJBA 1K9MT 5KG5A 2UUAJ 2QL7B 1RWWB 2PFFB 3QIDA 4AUKA 2CXEA 4OMFG 1QM9A 4Y00A 3Q22A 4OZLA 4C2MA 1C0UA 3DOLA 4MJKA 2VBWA 4ER8A 3SCJE 2HRYA 2EBEA 2K1RA 4IQMA 3WX8A 4J9NA 1KQSR 3SQGA 3VGUA 2Z57B 4DX7A 2HHXA 1Q53A 1PAEX 2VBXA 3DOKB 3ETOA 3IO1A 3PM9A 5B0GA 3TQEA 1SKRA 3ICLA 3PJXA 3T6JA 1SQFA 3TEGA 3CW2C 3P5TL 3I4HX 3NCQA 3Q24A 2V9WA 3LAMA 5A6WA 5IOLA 2W9CB 4Q0BB 3KHHA 3ZZTA 4CM0A 3IR7B 3M9MB 2ZZTA 2UU9J 5IT4A 3W9JA 1SJ3P 2DNOA 2VH7A 4I1TA 3G82A 4MAKA 3VAJA 1HNIB 4FF4A 3BSNA 2XLKA 3U27A 3R5AA 1NK9A 2R7SA 3TI0A 1BHNA 2B7CB 1CQNA 5ETRA 1IKYA 1SVDA 4ZVPB 1VQ5S 5J2QB 3PG9A 4EO8A 1X9SA 1IQTA 2ROGA 1N5TA 4ALZA 1VIXA 4ECWA 3DLGB 3G6XA 4JI1F 4IOAQ 2C2OB 4NWBA 4DXLA 3M8YA 5DS7A 4H4KA 1S7HA 2YWKA 2E1PA 1RT7A 1LW0A 3W64A 4OX7A 5ITHA 3LH2S 3BKUA 1IBCB 2N7YA 3LALA 2XYHB 3MUMP 3LANA 4EFAC 2RQMA 1IWGA 3PFEA 1SB6A 4OIXA 4IR1A 2I0XA 1DTTA 3CCZA 1C1CB 3I0RA 5HBMB 3FFIA 2CQ3A 1RTZA 3DOKA 4H4MB 2XZWA 1S9GB 1SV5A 3FCWA 3POTA 3KLGB 2EFOA 1TMJA 3L7UA 3CGIA 3N28A 2R2RA 4J9PA 4DQPA 2EC0A 4PWDB 4LFBF 4QCLA 1RADB 3PACA 4B3MF 4QIFA 1HWIA 4X62J 2AYGA 4CQ1A 1BWEA 2KXNB 1S97A 3M8RA 3JQKA 1B3TA 3T9ZA 4AE5A 1HWUA 4JI8J 1UMJA 1A0OB 2QT7A 4PAAA 5KTQA 3QZ8A 3PYFA 1TKDA 2ADCA 2ATCB 2ASJA 4RUHA 3CJKA 2YNHA 1FKOA 3GIRA 5L39A 1UFWA 3QZ7A 2V0NA 3MPUB 2FHMA 4YUDA 5L9NA 2J6TA 3MMAB 4ZHRB 5KFRA 2CNOB 3OD2A 5AXNA 2YQ1A 5G0RB 5CYJA 1RTHB 1FERA 1JLFB 1RT6B 3MFIA 3D2WA 3S7RA 2R9LA 3PW5A 2EFPA 1ZH5A 3RB4A 2WRMA 5HROA 2LCWA 2DRDA 1RHKB 3JXOA 1WG4A 2BV3A 3NS5A 3W8GA 2AJ4A 5KFIA 4DV2F 4FF3A 2J7UA 1XMOF 3OVAA 2ZH8A 3PV8A 3NGRA 1MMDA 4ECTA 7FD1A 3R5BA 3J81U 4I7FA 4WFBQ 2I5JA 2YQ3A 2HNDB 3O1LA 3EICA 2FIUA 4R25A 3Q8QB 3QRPA 2BJ7A 2V9KA 4HH0A 1S6UA 2MKJA 1R43A 2W9BB 2HWHA 4L72B 4LT6A 4ECSA 4UOCA 1WKKA 2BM0A 1RAFB 4J9QA 3BV8A 1RKJA 2BE2B 3N9UC 1WHVA 3T3FA 4XPEA 4O4RA 2ZH3A 2Y9HA 4IRKA 4DF4A 2ZE2B 3ZZPA 3PO4A 2Y8WA 4PXDA 4P71A 2A18A 3V5RA 3I82A 3HVRA 1NH7A 4DUZF 4ZVRB 7FDRA 5I3PA 5KFPA 4U8VA 1BMQB 3QT7A 1LW0B 4P52A 2J0SD 1P1LA 3CCVS 3Q8SB 3TAPA 2GQ2A 5KFAA 4UOFA 4K4YA 2KZMA 5D4LA 4X4PA 5KFOA 4FNHA 1R6VA 3S01A 1JXVA 2E5GA 1FI4A 2I9SA 2LU2A 3N4WA 3NCRA 1FE4A 4NA2A 1JB0C 2HK3A 4G6VB 4QIGA 2H65B 1KQFB 1D8YA 4HVZA 5B0AA 1IKVB 2QO3A 1NH8A 3R5DA 4LSLA 4MT1A 4CI0B 2MY8A 2WVEA 3TAQA 2JWNA 1G1XA 2OMOA 3MEGB 3OL7A 2FYXA 4F67A 2BYCA 4M5IA 4CNYA 4NXMJ 4C4WA 3OTEA 4UOGA 4YR0A 1SC1B 1Y5IB 2Q3PA 3OXGA 1RAOA 3NCPA 3QWPA 1IBMJ 4DQIA 1REGX 3R8YA 4F4KA 4XDCA 2I38A 4DG1A 3HT3A 4M8LA 4CO4A 4F8RA 3KUGA 2WVCA 1N32F 3ISND 3TAMA 3TX8A 2M9KA 2YVSA 5EWEA 4P75A 4Z7CA 3DM2A 1XWLA 2IBOA 2MZSA 3TOQA 2LECA 4DPWA 3J80Y 3OL6A 1VI7A 1PC4A 1RI7A 4ED4A 1J5OA 4GO7X 3TAMB 4AD6A 2LQJA 4NX9A 2R7QA 2M70A 3ZTRA 2B5JB 1FEEA 1FFGB 2NXEA 3KUHA 4FYXB 4PXCA 2PD1A 1HHSA 4UQTA 1TKZB 2PEHA 3G2XA 1G6BA 1TUWA 2VFVA 3A12A 1M5PC 2KZZA 5H1SV 3T1YJ 3I9V9 2IAJB 3QJJA 1SH2A 2DNKA 3KG1A 1P8GA 4ZLLA 2CQ2A 1Y3KA 3UR0A 2D3ZA 4FYYB 5MAOA 1FESA 1XTZA 3Q89A 4Q2MA 4LQ3A 1X4EA 1NEEA 3PHEA 2CJXB 4ZN3A 3KDOA 2JX2A 4GKKJ 3C14A 2YKPA 4NCGA 1YX2A 3KLHA 1P9QC 1GH8A 4DFKA 3N01A 4DV3J 2VONA 3CMAS 3JYTB 3HHLD 2J76E 4X62F 4DV1F 2R8IA 1U1LA 4FBTA 5AT1B 2YKNA 1JMTA 1HNIA 1VCTA 3P5BP 3WC2A 4C9DA 3KLHB 3RGIA 1Y9OA 2ZDPA 3MDFA 3PKMA 1F2HA 3M7VA 4LF7F 3QLHB 1SJFA 2CQ1A 1D9DA 1OY6A 1EAYC 1JLBB 1KTVA 5D0HA 3NMAA 2FY1A 3UVJA 3TUIC 4ES2A 2HIYA 3UVJB 1ZAWA 3KHRA 2ZHAA 3Q2TC 1NB7A 1X5PA 1DQ8A 2R4FA 2RNEA 2UVWA 1DARA 1S4FA 1XERA 2HLUA 2XWXA 4PWWA 4YOEA 2ZH6A 4DR4F 3LOUA 1ACMB 2Z30B 5DZ6A 5H9FK 1W7WA 3IAM9 3M8ZA 1RAAB 2XI2A 3PJ9A 2HEKA 2XMUA 3B78A 3NKYA 4AFFA 2H4WB 2VG6A 3BN7A 3JYTA 1N4LA 1UVLA 2J7KA 2UUBF 2XHCA 1EARA 1OY9A 1YLXA 3L3CA 3NOGA 2QFJA 3GR0A 3CC4S 5KFVA 3UDLA 1VRTA 1PILA 4WF9Q 5GAGI 2AP6A 2MSTA 2C22A 1XMQJ 4N5SA 2L9WA 3V6HA 3KLIB 1CS4B 1AZSB 4UTGA 3K0JA 4DFPA 1RHQB 3T5HA 4P2SA 2Y0BB 5LXYA 3FMBA 1FFSB 2GW8A 3W9IA 1PYOB 2VOOA 3ENQA 1WEZA 3HPOA 1F5BA 3D1QA 1WDTA 3BGRB 3ULHA 2IY5B 3HHEA 4KHPF 1BQXA 4F4AA 1D9FA 1LK5A 3MR3A 5IT0A 4DS4A 1C0TA 4KO0A 4DG1B 3HP6A 1RHJB 3OR1A 5LSOA 5A2QY 1RACB 2J0QD 1L3UA 4NZ0A 1LXJA 3QJPA 5F8JA 2H5JB 4RW9B 1HI1A 4ZDNA 4K4XA 1B0TA 3QO9A 1PG5B 1FTCA 3KKFA 3MAAA 2DY1A 4TKTA 5KFDA 2OKQA 1BLUA 2PI4A 3T9NA 4LSNA 3MR6A 1R0AB 1FJGJ 1G2EA 1CQMA 1REVB 5KG0A 3DU6A 1Y5LB 3OL9A 3KNAA 1SXLA 2F63A 2JLFA 3KJFB 3M1VA 3VZHA 4WJBA 3D67A 4LR7A 4OYOA 3SYZA 4PUOB 1D3WA 1UEVA 1GX5A 4U95A 1N5SA 2BXJA 4Q7AA 1BQNA 3K8VA 2ZBQA 4OV1A 3UD3P 1X0FA 3P4UB 1XQIA 2HNDA 1R8BA 3QT6A 3GILA 1TKTA 4NLQA 1Y7PA 4C3MA 5BR8F 1NMEB 3ILOA 1DZ5A 5KG2A 4A48A 2VPWB 2L9NA 1U1PA 1R31A 2CVIA 4YEAA 1WNEA 2C3YA 1GMUA 2VDIA 5D78A 2HBZB 4QWAA 2QIFA 2XMJA 2EXUA 1E6YA 2GVZA 3QAUA 4USVA 1KVIA 1RT6A 3FGVA 1XMOJ 2VKZG 5SUHA 5HLFB 2DGVA 3NGSA 4CLFA 5JVGQ 2ZE2A 1IUJA 2CQPA 3L09A 1WHYA 3I0SB 4URSA 4ES1A 4L3NA 3HHLC 4C11A 2XYGB 3EMTA 3G6ES 2LQ5A 1M1HA 1WSRA 4H4KC 1E6VB 1RXOB 4GMKA 4RW6A 5ETOA 2CJYB 2XQCA 1NPPA 4IFVB 3IRXB 2M7SA 4I2QA 1IJEB 3EUNA 1SJQA 2IFXA 3IR6B 2A2CA 2HHHF 2IRXA 3T41A 1SBRA 3W1YC 2E9TA 2LMIA 4CZCA 1DLOA 1ROFA 3ZTSA 1FXDA 1HARA 3UI3A 5EDWA 1QTMA 1VK3A 3FSIA 1B99A 5AE1A 4RW7A 4KPYA 4H4OA 4PG5A 4Y2IA 1S12A 4LBIA 4OX9F 3HT0A 4CT9A 3BO2A 1HYSA 4ITSA 3M2VA 3WDOA 1CLFA 4FYWB 3G86A 2DVIA 1BE4A 3O8WA 2CJAA 2X1FA 2EFGA 3P49B 1U8SA 2RQKA 3EGZA 2RKIA 2JC1A 3MM9B 1RT1B 2JFDA 3Q8PB 1QTNB 1TL1B 3TP2A 1WC3A 4ZK7M 4F2RA 1FD2A 2VBYA 1KNZA 4RR5A 4CH0S 4X65J 1VOMA 1GX6A 3M8PA 5E3AA 5KFLA 1NDCA 5CXTA 2HVIA 3QYYA 2W7OA 4IR9A 2KHCA 2GQQA 4OI6A 1DLOB 4DR4J 2GJ2A 2IRUA 3GV8B 4A8SA 4YY3J 1OQ6A 1YJTA 2LQBA 4BWMA 1S99A 2P8IA 5ETMA 5DGAA 3NWGA 4I2QB 3TA0A 4HH1A 4QR2A 2R7RA 3B82A 2MKHA 3RU0A 1N34J 4ILMA 2W4DA 5LMUJ 5K9FA 1TV6A 4CLTA 1FCAA 3TUZC 2DD8S 1YJRA 4F02A 3FBEA 4KFBB 5ETPA 3VF0B 4RKUC 4YDXA 5HVHA 2HQIA 2BQ3A 1NK0A 1T7PA 2OTJS 5FDLB 4QIEA 1I94F 1CEZA 5KFHA 3VGSA 1YRTA 3EVOA 4DX6A 3CWJA 3VAKA 5HP1B 1RYSA 1YHQS 2JNJA 2RDIA 3LWMA 2DR5A 2LDIA 2QL9B 2IBKA 4IG3B 2VASA 5LJ5Y 1EKSA 3CIZA 2IMOA 4MYUA 1SQGA 4ERDA 4B3SJ 1DHMA 2OPPB 2RIJA 2FVCA 2B6AA 3TUJC 3BBFA 4JI7F 2M8DB 3M6UA 3Q8YA 2WSEC 2FZKB 3V81A 3IGNA 3KUEA 4N77A 1BD6A 3VQSA 5EWGA 1N8RT 3CCRS 2LDYA 5D8HB 2QYGA 2G13A 2ZOGA 2NXCA 4L6V3 4LRFA 2OPSB 2LXIA 3K17A 3QPIA 4M5NA 4O44A 2YX1A 3D54A 4TVAB 5FDLA 2SXLA 2FC8A 4RWXA 4A8XA 5LMUF 1OYEA 3J7AN 3IMQJ 2PEBA 2ACMA 4RJVA 1NPRA 2HIQA 2M2BA 4PR6A 2OPQA 3SQGB 4DL4A 1VBYA 1DRZA 1NKCA 3AA8A 2BABA 1TL4A 1RT5A 5E7OB 2KM8B 2BACA 3DOLB 4MTPA 3E2EA 2DH7A 1ZPVA 4KRWA 4JI5F 1Y4ZB 2KFNA 3HVTA 2IIHA 3KG4A 2FHJD 2KVQE 4Q43A 2E29A 4ICLB 4C7QA 1UVNA 1T9UA 2UUWA 2VJVA 3POTB 4M5JA 2MZRA 3I6PA 2IPOB 4YDDB 3SXLA 1IBMF 2XB2D 2VQFF 1WELA 2BE9B 4TY9A 5H9EK 1TK5A 1T05A 1I51B 2YWWA 3BGLA 2G0IA 4F4ZA 3UPFA 2GMLA 3Q0AA 1VQ4S 4LFCF 1AZSA 2POKA 3W66A 1L5UA 3I31A 4UY8T 3HK2A 1YSJA 1ZM4A 3H59A 3HHDA 3IG1B 1QAIA 3K89A 1VISA 4QWBA 1VHIA 4CLPA 2KYZA 2PFDA 2DNGA 5HQLA 4B3OB 3OHAA 2R2UA 3H5UA 4ZPAA 1TVRA 3MEDB 1X31C 4IO1A 4RW4B 2H4YB 4P2XA 1HNXF 1BY9A 1BQNB 1H7XA 1U6ZA 3ZXWA 4OX8A 1OQ3A 5JXSA 5HN0A 2HWIA 2MQLA 3FEZA 3GFYA 5GAHI 1VQMS 3P96A 1N56A 4XPCA 1DQ9A 5F3TA 5FLXU 5T7LB 4DFJA 5LL6d 2HHQA 4K4VA 3LUYA 3DRPA 1GXUA 1CULB 1MW7A 2BANA 5EN1A 4MK7A 5F41A 4NA1A 4DUZJ 4FXDA 3I87A 4OLOA 2AV5A 4ZPVR 2DH8A 2G2YA 3H5XA 2JRSA 5HO4A 2ZH1A 1N5YA 3QNWB 1QE1B 2O01C 2Z4PA 3A3PB 3NBPB 3ELHA 1RSCA 5L46A 4J9SA 1DURA 2RRAA 1ZOTA 3PO5A 1NJWA 3M2RB 1U48A 3JB9k 1G4CA 2ZVIA 4C3KA 3H0PA 2E7XA 5BR8J 3CF5Q 2FHJA 2PMZD 1S6QB 1QD1A 4ZPDA 1L3TA 3HO1A 2K8GA 1QJHA 1NDPA 2EG1A 3QFWA 2DHHA 4HT7A 1V5IB 3AD8C 4PEOA 3AOBA 1GMWA 3C6TB 1UETA 5D77A 3UN2A 4E8UA 4ZJLA 2QL5B 3PYEA 5KFYA 2NPFA 1V3ZA 3X3UA 2BOAA 3EDRB 3RR8A 3VQTA 4RBTA 1RT3B 3DU5A 3CIMA 4G1PA 1W2BR 2K3KA 2WONA 2ZD1A 2ZEJA 3PFOA 5ETNA 4ECYA 1RT1A 1TK0A 2DB1A 4NASA 1N36F 1YJNS 2CPXA 2ZBCA 4DV2J 3T5JA 1IBLF 4M5DA 5A8WB 4DSLA 1FXRA 1D09B 1X60A 1YG0A 3RYLA 1JXEA 2F8HA 5DM6Q 3KMSA 3SV4A 4U67Q 4OZ0A 1AFIA 2V67A 3PCOB 2DHGA 4OI3A 1T9VA 4LVOP 2AHOB 3H90A 4HTIA 2DO4A 4I64A 4OLPA 5KG4A 3UDEA 3KHGA 1HHQA 4Y6IA 5DZ7A 3IS9A 4C0HA 2AJQA 2N4DA 2N3OA 5D3GB 3CT9A 2FTRA 4LFBJ 2BOPA 2OP5A 2GAHC 2PE8A 2X51A 1HPZA 2H54B 2XY7A 4K50A 2NXNA 3HSGA 4C8ZA 4NLDA 1S1TA 4A8WA 1OO0B 3DMJA 5J1PA 2GZOA 3D0IE 4ZN1A 1TELA 4WIQA 1RHMB 1F9FA 5DQGA 4LMZA 2N4CA 2AT1B 2P9CA 4P2MA 4RWWA 1Q8BA 2HWTA 4TXSA 1MWYA 4USIA 1GXLA 8AT1B 2B3TB 4DOZA 2OI2A 3TNVA 4C0BA 4QWCA 1NK7A 1FK9B 3D66A 1WC4A 1FO1A 4M5GA 2F3JA 2QE5A 3PX4A 2J6SA 2WVDA 1S1VA 2KFYA 2B6AB 2CPYA 3OTCA 1R8CA 2F5GA 1UFLA 4ED6A 3B4DA 3DI6B 3CB4A 4TNOA 5B0DA 2FZGB 4DL6A 1U1QA 4DR2J 1KP6A 2V5HG 3DOMB 4PPDA 3C46A 2JEFA 2QLFB 3CCJS 5EWFA 3OW2R 4A8KA 3PKYA 5B0BA 2VC1A 5DDPC 5CCMA 2HHTA 2ALYB 2B8QA 2DISA 2PMHA 3BR8A 3IWXA 1Q7LB 3M30A 2XBPA 3C2PA 4F0HA 2W4PA 2E5LJ 1K1QA 2B9XA 2PDAA 4NXNJ 5DG9A 2HS3A 3D0GE 3IM8A 3MMCB 2AJ0A 4C97A 4F0KA 3LPYA 4LF7J 9ATCB 1RTIB 4ED3A 4LF9J 3MM6B 1JLQA 1TV6B 3MCSA 2VICA 5CYQA 2LA6A 5ETQA 2JEIA 1EQ0A 4P2FA 2MTLA 1UFKA 2EFQA 1H38A 4A4JA 2RDDA 2HVEA 2YY3A 3N6NA 1WEXA 2HFSA 3NAIA 3HMJG 1B0VA 3CJRA 2B4UA 4QR0A 5HVGA 2UUAF 1VK8A 2NS1B 2E1MC 3TQ1A 1NU4A 3DXBA 1UA0A 1R89A 1TR0A 4A8YA 2XZDB 4LRAA 2UVVA 5A8RA 4O3PA 5KT5A 2CIMA 1RAIB 2J8AA 2AYMA 2HVDA 2QMUB 5K20B 2ZC4A 2BJ1A 4O44B 1NNDA 2WVBA 2DY9A 1TL7B 4EO6A 1QVGR 2Z8QA 3V81B 3KJVA 3K5PA 1HMVA 3B4MA 3PEJA 3Q86A 4DV7F 3EXYA 3RG6A 1OS5A 5HQ8A 4DU8A 1HYSB 1RCXB 2B4PA 4KHRA 4HLBA 1Z1ZA 1B70B 3G8SA 1JXLA 3D4JA 5BYQA 4ZIWA 1FE0A 2XTJP 1S4EA 2B9EA 3JSYA 3H7HB 4NLRA 1FK9A 1HW9A 2Q1LA 2CJKA 3H8YA 4F50A 2WBRA 2R7TA 2XNQA 5D4NA 4A8QA 1LFPA 2XNRA 4HTJA 4RW8A 1I6JA 4PG6A 3TUPA 4DUYJ 1HD0A 1GTEA 2F65A 2DHSA 2DGWA 4U8YA 5CHCB 3ZTOA 2M52A 2UZAA 1IWAA 3NEKA 2ZZMA 4QIWD 4AQYJ 4J9UE 3NGUA 1GQEA 2PI5A 1JLBA 4RW8B 4F3OA 3MPYA 5L1KA 3BBBA 3DC2A 3D68A 5K5MA 1VC0A 2GO8A 3GZ7A 4XDDA 2LEBA 5IC6B 3DKDA 3K5MA 5ADZA 3CJTA 2MGZB 5C42B 2VG5B 2E66A 5GVQA 1F3FA 5KFTA 3VWSA 3ILLA 3W61A 1YRXA 4CWBA 4V19X 1RGVA 4LF8F 1D1UA 4EGLA 2XWYA 2BE7D 4RNOA 1TKTB 2AU0A 3M05A 3CDEA 4IFYA 4N47A 1CJKB 2MGZA 5A76A 1TFYA 2E1AA 4H54A 2R2SA 2VA2A 3M32A 2QA4G 4JI5J 4IH6A 1U8WA 2YH1A 2ZUAA 1UPPA 4OHXA 1LWFA 2V8VA 1TUVA 2CJBA 2GVDA 2ALZA 5A2QU 1B0PA 1VBKA 1S1UA 1HLWA 2DGQA 3O6QA 1M90T 1VQLS 1N54B 4MKYA 2MPUA 4DL5A 4FVCA 1N0VC 2CPEA 4ED0A 1HI0P 5DDQC 4ICLA 3PTWA 5F9LA 2NR0A 4JUZA 2CWKA 3ZZRA 5I42B 2GIFA 4KR0B 3PY8A 5I4MA 5B0FA 2ERRA 2QMXA 3AD7C 4YR2A 2NUUG 4DL0C 2D3O1 5KFMA 1UW4A 4Y28C 1X8DA 2CPHA 3NS7B 3KLGA 3R1HA 1UAWA 2E5IA 1M5OC 4J9VA 3RB3A 3BO4A 3KK2B 2XMKA 4M95A 4HACA 5CZVA 5F8NA 2CDQA 1YQHA 3CJQA 3NMRA 3I0RB 4I7FB 3W63A 1XEZA 1CVJA 4I2PA 3MMJA 3MTKA 4LF8J 1XJWB 1XR5A 4B9NA 2MJUA 4NZ7A 1IQZA 2WTFA 3EXCX 1UKUA 5D15A 2G4BA 2DR9A 1JKHA 4OJ1A 2CUYA 3QWUA 1K0TA 2LEPA 2KYXA 5G0RA 3G6VA 5BYRA 4KYZA 1MG7A 2Y1JA 1IKVA 4HI1A 4LSLB 4USUA 4HKQA 2FHKA 1RWVB 3TJAA 1FXLA 2RU9A 4JI7J 1U0HB 4HDHA 5F0UA 5EX3A 2IM1A 3N0VA 3G4SS 1S1VB 3BSAA 1N48A 2CQCA 3PNIA 1BGXT 1SJ1A 1P27B 2U1AA 1S6QA 1LOUA 2BM1A 4CO3A 1IR0A 2W25A 1U45A 4ZCMA 4L76A 2F4VJ 2B56A 2OELA 3A3OB 4DUTA 2DNNA 4OV6A 2RHSB 4FBUA 2G0CA 5HJYA 4DV7J 1KQKA 1RTIA 3OHBA 2BQUA 1NPKA 3EGVA 4FXVA 4NLWA 3F56A 3ZTPA 3GCXP 3W5XA 3KYLA 4JI1J 1HD1A 1U0SA 2C2MB 2CZ4A 2Z56B 5DLGA 1C1BA 2XZTB 2JC0A 5KOWA 2DXDA 3AA9A 4UUWA 2ZZNA 3C15B 5JVHQ 2HFNA 1V5VA 2QV6A 1EKRA 3DI6A 4RU2A 4X2BA 5FD1A 1Q16B 2XGPA 1SKSA 1FJ7A 2RE1A 3AHPA 4NL5A 1URRA 1UJ6A 4AQYF 5KFBA 2J0WA 2N3LA 2YX7A 1FRMA 2HQFA 3THVA 1NM2A 2ZH5A 3QATA 2KVIA 2RU3A 2V34A 1Z2ZA 5KFUA 3BGUA 3IGVA 2V2KA 3OR2B 5HROB 5B09A 2XGQA 1LEOA 1XNQJ 2VQFJ 3ADAC 4PPZA 3PIPQ 1ZYQA 2ZOMA 5HMWA 4YHHF 1LQ9A 2DGTA 3AODA 3TJ9A 5LXRA 2R8HA 2ATLA 2CNLB 1JLAB 4MIAA 3OBIA 2YNIA 3C15A 1C4AA 2GHWA 3W2WA 2M3DA 2X1BA 4CDIA 1VQKS 4O3RA 1Q79A 1KONA 2HGMA 4E2FB 3GIIA 4DR2F 4O3OA 3FRYA 1HNZF 3C6UB 4ELVA 3CE8A 3DYAA 4JYAJ 2V2QA 1VJWA 2GAGC 2PN6A 1B7YB 1NSAA 3SEOA 1IR1A 3OV7A 1CJUA 3FC9A 3V6DB 1WHXA 1ZA1B 3J81j 2GJFA 3LO3A 1KC8T 2KXFA 4IRCA 4QYZJ 4NLGA 2ZDOA 1H6KX 1SCJB 2DNMA 4NLVA 4NCBA 3W7BA 3MECA 2J9DA 5E0OA 3HKZD 5HJXA 4IH7A 1SUQA 3MEEA 3TZZA 1OY8A 1HBUB 2BJ8A 3PW7A 3GIMA 1X5OA 5HATA 2M0GB 3HDSA 3VVTA 4BC7A 5F8GA 3V4MA 5BYSA 3S8SA 5IC4B 3KHLA 3O5TB 1CBKA 5B08A 1ICEB 1FJCA 1HFEL 1URNA 2V8HA 3FZ2A 2LFVA 3ILJA 3W8PA 1NDLA 2ABYA 2HG4A 4OQJA 3DLKB 1S7IA 1WACA 2XMWA 3AD9C 1I94J 4K4TA 1AT1B 1VRUA 1U1KA 1GEHA 2EFVA 4LF5F 4EWTA 1U49A 5CAAA 4B3RJ 2YWEA 1KKHA 3E8OA 2IAJA 2Y1RI 4WK1A 1YK9A 4CTAB 2W9CA 2OTLS 4Q0BA 1ELOA 2UXDJ 5DG7A 4LSZB 4OZNA 2K7KA 4LR8A 3MAAB 3WIVA 5KFKA 3D3BJ 2DHAA 2VB6A 1CJUB 4TU7A 1WOOA 4WP8A 3EZ5A 4ED2A 2NQPA 4TY8A 3CJ8A 4GC6A 2DGSA 4DU7A 2E1CA 1FTRA 1NUEA 2X3DA 4A8OA 5KFGA 3DM2B 4PG7A 1TKXA 4Y0FA 2AEMA 4MKBA 3SDEA 2DR7A 2PA8D 1KFSA 4CYUB 2R7UA 4HDGA 1EZZB 4KV8A 4ZPTR 4NE9C 3DGPA 5HAOA 1UWAA 4M5KA 4OZJA 2YWGA 1RT5B 5G4DA 1VQOS 1R8AA 1JX4A 1BQMB 2BEFA 4DR1F 1LNQA 1EB0A 2EKYA 3LGNA 4IOBA 3T5KA 2ADBA 2XM3A 4Z2XA 3CC2S 5IT9U 2FB0A 3GB0A 2VFRA 1MMNA 1RP5A 3MCMA 1JLEA 3VV2B 3CCQS 3ZNUA 4B3OA 1Q8LA 3MMBA 4LBPA 3UDCA 2W24A 3MAHA 3D6FB 3UN5A 3WQPA 3I56S 3N79A 1ZZFA 1VRUB 2B9YA 2LVWA 1KQGB 1KLMA 1CJKA 2H3EB 5KFFA 3G8TA 1UWBA 4DR7F 4O3NA 2O66A 3GIKA 1JLEB 3MMAA 1RLCL 2YNFB 4ZHRA 1LW2A 1LWEB 1R8HA 1N52B 1UEKA 2AKWB 3GYNA 4NYOA 1ZPWX 5K8NA 2ZH4A 1B4SA 2HBYB 5IWAJ 2FVRA 2DIUA 4TN2A 1SC4B 1X4DA 2C3PA 2FVSA 4RNFA 3CJSA 5IV4A 3HLUA 1TAUA 2DCLA 4HHUA 1TAQA 3GJRB 4MH8A 5A8KA 1TTHB 1RTDB 4CYUA 4DN0A 3SDEB 1NSQA 2OAUA 4CH1A 1WF2A 1HR0J 4EBEA 2UXCF 1IBLJ 4LSNB 2K7JA 4HR2A 1RE1B 2ZBIA 3LTOA 2VIHA 1YBTA 2BDPA 4PQUA 1MROA 1MLAA 3QBCA 5HVFA 1C1CA 3AJ2A 3KOAA 1RTJA 1L3KA 2ZNYA 2C2RA 1ZETA 1LWFB 1E6YB 2MMYA 4J9LA 4JV5J 2ZBPA 1F60B 3BBCA 3CTRA 1GMWD 1FRKA 3OXFA 3K5LA 2MKKA 4RUAA 2KJVA 5KFWA 1S1XA 2YWHA 2I5JB 5GMDA 1U6BA 3HSZA 2F9JA 5RUBA 5E3PA 3GMGA 4FPRA 1RHUB 5AXLA 1WI6A 3SBMA 4DCPB 1PKUA 2ZHOA 4TLRA 4JI4F 1H7WA 1YJ7A 4JI0J 1EJ7L 2GGPA 3VAIA 2AJFE 2NLWA 3ET6B 1M5KC 1S48A 3OUYA 1H0HB 3R27A 3J7A1 4MFBB 2BW7A 5IZHA 1RTHA 2RD5C 4X4RA 1FX2A 2IDEA 4E0DA 5D0GA 1R0AA 4JI6J 5KAKA 4U9RA 1BUXA 3CJ3A 1RWNB 4ZPBA 4WYLA 1F9EB 1S5ZA 1SIZA 3AQPA 2QEXS 2YKQA 1QUVA 3T1AA 4X4UA 2NXJA 2IHR1 2W2PP 1NSPA 3ILIA 2DGOA 1SH0A 3P3DA 3LWLA 1NLKL 4XTTA 1S57A 2KG1A 1LWCB 2O3DA 1CPZA 4NRUA 1U1RA 2NSBA 2HPUA 2MHNA 2RJZA 4I4BA 4KO0B 4WIIA 3CNQP 1LWXA 5C2CA 3NGDA 3EPGA 3RAQA 1LFWA 3A8JA 1F9HA 2JL9A 2HRUA 4ZVOB 1NZAA 2EC2A 2A0FB 2EI5A 5GMEA 3L9ZA 4U96A 1U24A 2EKNA 5M2PA 2X1AA 2LQ8A 3O2IA 3VALA 3UCZP 2XY5A 1ZM2A 1NDKA 3HI9A 2IYIA 1XNQF 1DBDA 4WKRA 1J2VA 3UO0A 1MU2B 5K8OA 5SZTA 4LF9F 3M30B 3D1HA 2DITA 1O6XA 1UVKA 1VYAA 2WOMA 3A3NB 3HFKA 2KXHA 5HLFA 3JQMA 1DJ0A 4LF6F 3GG0A 2OPSA 3OUYB 4P10A 5BXIA 2A2DA 1P9YA 1T95A 4UUXA 4B9MA 1WOSA 5KFEA 4KY3A 4QW9A 4OHVA 1UCNA 2DXFA 1FRXA 3NXZA 5HL7Q 3FUYA 1TL3A 3M9OB 1N88A 5JJBA 4RW7B 5AJ3J 3CUNA 2HBRB 2B43A 1HBNB 1HBOA 3I5BA 4DV4J 1NRKA 3DRYA 4BCAA 1AXQA 2OFHX 3L95X 2P9GA 3CVKA 3D6HB 2KT2A 3LGHA 4ZP8A 4DV6F 2EBGA 1KS2A 2H48B 2HFOA 2W2MP 3AOCA 4IFVA 4ZCLA 4C3LA 2F8EX 2CVEA 2HZCA 2XG8A 2WOMB 4A47A 4X65F 5F9NA 1F6TA 2Y0SD 4CO0A 1HQEB 1B7FA 3DHXA 3VAFA 1X4FA 3EGNA 1NJYA 3UDVA 4Q2LA 5BJRA 1R6YA 3EVMA 5T41A 4IH5A 4ETZA 1RT2A 3NOCA 1CC8A 2MLZA 3M8SA 2D3OR 3BQ1A 2NZCA 1NHVA 3IN5A 1J5OB 4B3SF 4LRCA 3VAMA 4O0NA 3PW0A 3UD4P 2BRKA 3S6EA 2VODA 4RNHA 1S79A 4ZS6A 4C48A 4USJC 1RCOB 1S6OA 3HZGA 4O23A 3EYZA 1CJTB 3EWGA 4X84A 4Y2MA 4DCJB 3FZBA 3GJQB 4OYZA 4DV3F 2XI3A 3H25A 3BN4A 1IKXB 3AY0A 2FJBB 2BKOA 3TANA 4BHQA 3PX0A 1RT4B 2WW8A 2ZH2A 4OZ2A 3DXSX 1Q78A 3EE3A 1T9XA 3GR1A 2CNNB 1TQLA 3H2LA 3KJVB 3SI8A 1N6QA 2AQ4A 1ZBTA 3MM9A 2ASDA 3GFXA 3QRRA 3CDAA 5CQGA 2IJFA 1XMBA 4LF4J 2B8PA 1JJ2R 1M5HA 4NLXA 1IBKF 2DNZA 1HBMB 4TU8A 3CC7S 4M5LA 4WBFA 1N36J 2K2PA 5GADU 3HJVA 3HHNB 3QRQA 3P6YC 1RWMB 1JLGB 2VF3A 3CD0A 2PGCA 3K2YA 4RW9A 5GADI 1YITS 3HJFA 3UD5A 4WFYA 2OJ3A 3GJSB 1UP1A 3D0HE 4KV8B 3L7PA 2WHOA 5F3ZA 1GAOA 3KLFB 1JLCA 4Y3CA 3W5YA 3J81Y 2G1DA 1U1MA 1JQGA 3CULA 5KOXA 5ETSA 5GMKa 1PYTA 1QE1A 2QSFA 5D4OA 3WIUA 1RYRA 1KRPA 4YMEA 2HNYB 5E3CA 2HAFA 5F8HA 3FFIB 2DH9A 4CO1A 1EHWA 3MMCA 4FS2A 1MMLA 4YFUA 5CYMB 1HBMA 4ID5B 4JV5F 3EVWA 3GYGA 4DV0J 4CLSA 3R1LA 3QGPA 4RBUA 4KTQA 2YPYA 5T7LA 4CIOA 3KLIA 4USTA 2DYAA 4X66J 5A6PA 1RK8A 3EDQB 3TARA 1GNKA 3JTNA 2JEJA 4RPFA 2AGQA 2RAQA 1J5EJ 3K58A 1RT3A 4PXEA 4B9SA 1NHKL 3E01A 1ZAXA 4P74A 1NK5A 3IBFB 1Q4RA 2AIRB 2KHDA 4QR1A 5J2QA 1IKYB 4KPCA 3M8QB 4EMDA 4JYAF 1NJZA 1YI2S 4OHYA 3PHTA 1Z2LA 4Q5VA 2UUCF 1FRJA 1X5SA 1JJCB 1HBUA 5C42A 2DNRA 2ZWPA 2XMMA 3KJQB 5AE2A 4ED1A 3L7OA 4TYAA 4ZMMA 4DR6J 4QQBA 1RWUA 2V2VA 4IYQA 2RDJA 1VQ6S 3A8EA 5KFQA 3NBPA 3HSDA 3PR4A 3CO0P 3DN9A 4LR9A 5M2RA 3QJLA 1MROB 3DMJB 1U6FA 3GJTB 2G9OA 2GQCA 3W65A 3WX4A 1VBXA 3U1LA 2VJUA 3NNHA 1PJ6A 2MXYA 3GFZA 3ZZUA 3VVUA 1OSDA 3BB5A 4HHJA 3IAS9 4NCAA 2Z2LA 4ZLJA 3GQCA 3R2CJ 2YBVA 3M2UB 4URQU 1LWCA 2ZM6J 3TA2A 3TVYA 4DS5A 5F0WA 4M5MA 1U2FA 2Y3YA 2QYCA 1RWXB 1HL6A 1MN7A 3GE9A 3LPEA 3CJ5A 4G1QB 4P7TA 4RW4A 3TVZA 3FBBA 3TZXA 4J90A 3J7Z5 2HZVA 2R8KA 4DSEA 4LF4F 3MR2A 1PIEA 1A9NB 2NREA 3JS9A 4Q44A 1RT7B 3SZ2A 4MIBA 2VPXB 4N8OA 1FWPA 2C2KB 4WU2A 1X7VA 2FVPA 2BX6A 2ZD1B 4RL1A 9RUBA 3OPKA 3BKFA 2IMWP 2ASYA 1S9EA 3MPWA 3OFFA 3R7SB 2KL8A 1SQEA 4DV5J 1RQ0A 1RJJA 4K2XA 4QPTA 1JNZB 3M4XA 5AXMA 2VFTA 1S0NA 1NJXA 4JI3F 4KHPJ 3DLBA 4OI0A 3U1NA 1T03B 2HYIB 1NKBA 1OIAA 4CLKA 2OIHA 4M5HA 4RNMA 6AT1B 4KHMA 5DRKA 4DV1J 2OD4A 3H42A 2M4MA 2L41A 3OXLA 4UF4A 4DEZA 2QGFB 5LJ3Y 3WHIA 4W4MA 2P6SA 4WPAA 2W8KA 2CKWA 2CQ0A 2PIIA 3Q23A 1RT2B 2WW4A 1FDNA 1YVFA 1N5YB 3N5FA 4DZDA 5LT5A 3ZC4A 2YWFA 1HQEA 3TEHB 2AMCB 4F7VA 3A4TA 3OTBA 3UNGC 2DPJA 4ANDA 4WKYA 3CCES 4YP3A 1AFJA 4NLSA 1Q1KA 2EWHA 1VQSA 4DV4F 4CM2A 2J0XA 3BJYA 2VUGA 1FF2A 4AL7A 4B3TF 4OI2A 3Q8UA 2LKZA 4R0EA 3PRBA 2C42A 4PG4A 4WXOA 1HBNA 2MQQA 2V4JB 3KNGA 1W26A 3PYDA 4OZ5A 2ROPA 2W01A 4YY3F 3H40A 2L3MA 3BYPA 2XLIA 3HULA 1OYDA 2HQGA 2OPRA 4KH1B 4ZJOA 4NEZA 1K0VA 3KXDA 4DR7J 4AT1B 5DQIA 2I1RA 3RRKA 2CPJA 4W92B 4E98A 1MU2A 3OSNA 1MN9A 4LBHA 3IWNC 1VQPS 3SMZA 2HFVA 1DAXA 2YNHB 3LP0A 1HNWF 1NK4A 4DPYA 1SJ4P 5EX0A 1YDLA 3HXMA 4KIAA 2ZC3A 4WE1A 3JQJA 1QAXA 2IM0A 4DR1J 2VQEF 1U26A 3MZIA 1Q8KA 1X4GA 1HWJA 2V63A 5THWA 2QX0A 3X1LB 2IC3B 1T9TA 2KT5A 4UT4A 3HHLA 3W2WB 1FD8A 3ZZZA 3KLFA 3DNCA 2JOQA 2NYHA 2Q43A 3CJ2A 5GAEI 3VTIA 4TY8B 2CPIA 2GFFA 2ILZA 4FF1A 1FDDA 1YRUA 2E5JA 4IKAA 4HL9A 4YB7A 4LFAJ 4JI6F 4OYXA 2RUSA 1DQAA 5J1EB 2ZKTA 3CEDA 4FPIA 3T1YF 4MK9A 3OT9A 4DBQA 2AGPA 1AW0A 4QU7A 2ZVSA 4USKA 2HQDA 1KOOA 3F44A 4ZVQB 2FGOA 4BBYA 4GO5X 2D9PA 2JVOA 2HURA 1S0VA 3KJNB 4K5SA 4ZVGA 2MLXA 4IFYB 3TA1A 4WFNQ 4K4WA 2FLPA 2JVRA 1UVJA 4M1KA 1WC6A 4YB1P 1F5CA 3MPDA 1EETA 2PC6A 3UWTA 1ZTTA 4JI2F 2LYVA 2F1FA 1HQ2A 1SC3B 2KKHA 4C98A 4EUVA 1SPBP 3BQ0A 1NO8A 1PJ7A 2O5DA 2VDHA 2E5HA 4NI2B 1CSJA 2FJWA 4ZVHA 4ZCKA 4ZA1A 4WFAQ 3FSYA 3OVBA 5FIIA 1TKXB 3LAKA 1SUQB 2Z2MA 3MEEB 2CPZA 2PA3A 2MZTA 3P45B 1KHVA 1RABB 1RAGB 5CYMA 1IJFB 1Q5YA 4KFBA 2KG0A 3IBCB 4I2PB 2AX0A 1L3VA 3T6BA 1PYSB 1DY3A 4DSIA 4PQUB 2HNYA 1VMBA 3VGTA 2AYEA 1WHWA 4CO2A 4DX5A 2BA9A 5D6GA 5KFNA 5DETA 2K06A 2PMWA 4GKJF 3U02A 3CMES 3OQ2A 3NL0A 1M0SA 3C6UA 2J9EA 2YKAA 5IM0A 4F3MA 2CJ9A 4N8NA 2VU5A 3IWLA 3BR9A 4NLTA 5IWAF 3CCWA 3BGRA 3LP1B 2RH3A 2D7SA 2GS8A 1MSWD 2AX1A 5E3QA 2OUGA 1RBAA 2QA2A 3SFUA 1N5QA 3LP0B 4LRDA 3RJMB 3CCSS 1TK8A 3NGTA 1M1GA 4B3MJ 1LW2B 5HANA 3GCWP 1M5VC 4PRFA 2HHVA 2CG8A 1XNRJ 1NBEB 3PJWA 3OLAA 4U7UK 1UWBB 1TL7A 4X64J 3SSQA 3VGVA 1HNWJ 3HKWA 4DPXA 5LOQA 1F3VA 2RRNA 3MCNA 4F25A 1S9FA 2HMIA 2XSFA 3C3LA 3KWMA 2MQNA 1ZTWA 3EM1A 4UZCA 2VV5A 3CD5A 2XS2A 3AJ1A 4PKDB 4K8RA 5J2NB 3AQOA 3GTYX 3G96A 4W90B 1RZMA 4HACB 2QLXA 4FN5A 3OVSA 4CNZA 3LP1A 1SH3A 4WP3A 2VHGA 4DMZA 2E5LF 2YH0A 2WB1D 3R5JB 3DDIA 1I5OB 1SC6A 2P2CB 2FJAB 4KQZA 4OYBA 4LREA 2MZ1A 5I42A 4B9LA 1GXTA 3CCLS 1I1GA 1P1TA 3ITHA 4DSJA 2ILYA 5KFZA 4A46A 1R0BG 3I0SA 4IUFA 4C11B 3MXHP 1SL2A 2DCUB 3W62A 1Q7YT 1S1UB 2XSJA 3OL8A 3PDNA 2NSCA 1Q0NA 3MM7A 1WC0A 5LMNF 3BS9A 2CZ9A 2F8MA 1HKAA 2EW9A 1ZA2B 2HSEB 3H4BA 4GVBA 4MFBA 2P5VA 1MWQA 2HNZA 3I4PA 2GHVC 4FYVB 3QIPB 4D3HA 2JJ4D 2HHWA 1Y3JA 3UN3A 3CCMS 2DNLA 2XYPB 1CJVA 3RW6A 3FEYB 1T8EA 4A8FA 1UVIA 2Q79A 3AXKA 5FLXY 1S9EB 3ZZ0A 3M8WA 4IO9Q 1HNVA 4OZ1A 4CLYA 3CD7A 3LQVA 4CP5A 2RS2A 1QVFR 2F40A 5DJBA 2F4FA 1C1BB 2QLBB 5A0YB 4DLEA 2G2ZA 5C5JA 5HP1A 3RB0A 1VR6A 1XR6A 2V4RA 3V6JA 3M2VB 4DL3A 2Y1IA 3NY0A 3BGFA 1T3NA 1FJEB 3BO3A 5LMNJ 6FD1A 2XO7A 3D9BA 1N34F 3QGGA 4ZP6A 4J9OA 3QO9B 4RZRA 3MD1A 2R42A 1X4HA 1X9WA 4EEYA 1X4BA 1ZS6A 8ATCB 1JWWA 1Y5NB 2W4CA 5B7WA 4PWUA 4KGKA 3CPWR 1Q82T 3C16A 5I3QA 2QN6B 3FEXB 4QBUA 4ETXA 2IJNA 3B8HA 2OGUA 2YKMA 2A3JA 2IM3A 4I0WA 2AEFA 1FRHA 3GFHA 2MQMA 4OYPA 3R2DJ 2F9DA 1H73A 2QMWA 3J80U 3PR5B 2OEMA 3MM8B 4RLEA 3H5SA 5J2PA 2WZ1A 1JNRB 3CCUS 3IXQA 4F4WA 1VQNS 4ANCA 1T0TV 2AEJA 2LXUA 2YNGB 4S0MA 4Y65A 4YN3B 2JLEA 4P73A 1RAEB 1FX4A 2OEKA 4PYDA 4BS2A 4DQSA 2XY6A 4LRBA 2IA6A 5CH7B 4WWSA 4V1Ak 3R7NB 1JKHB 2MYFA 4P7VA 4OX9J 4CRJA 2MDAA 2WONB 2YTCA 3BF4A 3HFZB 3CXCR 3PW4A 3MOJB 2NZ4A 1VS3A 2GGPB 3KK1A 3ENWA 2QLJB 3ISNC 4F4YA 2DHXA 1VIOA 4IRDA 3GONA 1X0PA 2HZAA 3HVWA 4KGZB 2LQ9A 3FMWA 4XK8C 5L8RC 4CLZA 3ZFVA 2KM8C 5CCLA 4DR5J 3JSMA 1L3SA 4TU9A 3KDNA 3FNNA 5AE3A 1CJTA 3FBCA 1H2UX 1WDDA 4F3QA 3OTOF 1Y11A 2FDNA 1APSA 3BGOP 3HD1A 1U2CA 2WB4A 5B0EA 5EHHA 3MM5B 2FJXA 2HGLA 1S77D 3C16B 1R0CB 2KFZA 2MY7A 1PAUB 2HQ3A 3QSYB 4LF6J 2BUNA 2DNPA 3V2UC 3G9CA 3D1OA 1WTFA 1VQYA 2NXUA 1K44A 2JH3A 1F1BB 3MAQA 2UV8A 2F4VF 1CC7A 4X4QA 3OFHA 3AXMA 5H9EJ 3T1HJ 3HVAA 3BDEA 1D9AA 3HM9A 4CTAA 2FY8A 2GMJA 3B54A 5A0YA 4DPTA 4JI4J 4N41A 2GVZB 4AXIA 3F41A 3UE2A 5LSRA 3VAHA 4N76A 1QSLA 1U09A 3SCKE 3GV5B 2WAQD 2YKNB 3DLKA 4KKOA 4YB5A 1QY7A 1WF0A 3DLLQ 4USWA 4NYZA 2FJEB 2J9DE 4PG8A 1Z4UA 3R97A 2BVZA 2ZNZA 3QT5A 5KT4A 3DGVA 3G8QA 4I6AA 1TMMA 2DGUA 1R27B 2QG9B 4JP8A 5L1IA 4KSEB 1HMVB 2C2NA 1CS4A 1AUDA 2BJ3A 4NYPA 4U7CA 3IG1A 1NZ8A 1FDBA 3HFVA 1HWKA 2AF6A 2GC8A 1HWLA 1QAYA 3KLEB 1P6TA 4CLUA 1YWXA 4ID5A 2CDRB 4ZOSA 3DDKA 4EZ9A 4ANEA 3DRXA 4OZ3A 4YS2A 1M5SA 2OH2A 4KC5A 3DCAA 3I32A 2QFIA 3HSJA 4OFZA 2DPIA 5C24A 4B17A 4WFXA 3VCDA 4NZ6A 1Y00A 4MKVA 3NNAA 3DGPB 1PBUA 1FEHA 1U7LA 1YJVA 3EGWB 2XMTA 1WWHA 2C3UA 3OR1B 1CG2A 2AD9A 1W2IA 4C8LA 3DYAB 4I68A 4GRSA 4EU0A 3MPVA 5HQMA 1EP4A 3K59A 3DLEB 3HD2A 4H4MA 5K14A 3FJ2A 5CD4A 2R8JA 3WC0A 3FDSA 4ECZA 2L9DA 3VAGA 3FSXA 2DNYA 4LQ9A 5IS2A 3V6KA 2H1YA 3JSBA 2P6TA 4EYHB 1VQ9S 1NAQA 5F8MA 1PBAA 4ELTA 3A13A 2VKRA 5U47A 1CULA 2BANB 3NRBA 1RHRB 1N0UA 4JV0A 3U1MA 4FS1A 1UA1A 2HMIB 3LGMA 3O44A 2GVDB 3QLHA 3TZWA 5M2UA 2DR6A 4KGXB 2YPZA 1WKLA 4UZBA 2UUBJ 4K0KF 2KN4A 3AH6A 2WVFA 1NJIT 1KEKA 3QMQA 3SIPB 1VBZA 1GT8A 1VRTB 1F5AA 4NEYA 2OO4A 1H74A 4ZVEA 2J8SA 3BSOA 2V69A 1U2RA 5DDOC 1J27A 3K57A 2ACYA 4R5PA 2HNZB 3BEGB 3G82B 3MI7X 4NLPA 2BKPA 3SCLE 5GAHU 3E01B 3TX0A 1YJWS 1O5JA 1KDNA 2A6MA 2D41A 1WI8A 2YKOA 4FKYA 5IM0B 1FVQA 4RUCA 4B3TJ 5AJ3F 3BZQA 3MD3A 1TFWA 2XS7A 4DR3F 4ED7A 2O67A 4XIUA 3PRDA 2Q66A 1VC5A 1IVZA 3DRRA 3GYXB 2GMHA 4FYDA 2DKOB 2VC0A 4EYIB 2UVUA 4K7QA 2W7AA 4F04B 2VD3A 2IJRA 3W2VA 4B3RF 4JBCA 2BE2A 3R6GB 1S6PA 2UV8G 3R9LA 4DCOB 3IRWP 4KH0B 2RT3A 2HHPA 3H2UB 3ITHB 5LM7E 5IT9Y 1KBRA 1K47A 2MEWA 2QJ3A 3W9HA 2MJNA 3H98A 2WSFC 4ZKAA 5A8KB 3RAXA 3FCHA 1UW9A 2MKIA 3R7BB 4GC7A 3C66A 1PSDA 4JI3J 4EBCA 2AZ1A 4O3SA 2EPIA 2HFUA 3IS9B 3Q83A 4M63A 2AYBA 2C2DA 5ETTA 4OHZA 1SKUB 2HHHJ 2IA0A 3KTQA 1MWZA 2UXBF 2R7VA 3DLHA 1YKWA 2MSSA 4IQXA 3QIPA 2GA7A 4ID8A 2LXFA 2LU1A 3FCVA 2BJ9A 2RKIB 4EI2A 4NRTA 1D8ZA 1SJRA 2VL1A 4ZVTB 2KI2A 3NWRA 3UNYA 5I3UB 5I3UA 4KGVB 4ZP9A 2QC3A 4Y2CA 2XCPA 2KTQA 4BDPA 2CAJA 2Y1LB 3NS6A 4DFMA 1U1NA 4K4ZA 2GX8A 2AW0A 2CG4A 3FRZA 3F73A 4NLYA 2C2EA 1H2TZ 3F0NA 2ZBRA 3CJKB 4G1IA 2OHDA 3D3CJ 1T94A 2U2FA 2WBMA 3DFEA 4PZVA 1S1XB 4F26A 2XCAA 3CD6S 2UXCJ 3ETMA 4DHVA 4KBIA 2ZWOA 2KJWA 2YKMB 1O8BA 1QUPA 4XAKA 2VOPA 1WF1A 1FNXH 2DIVA 2UP1A 3GSDA 4FP9A 3GLJA 1T11A 1E6VA 3PEHA 3R5CA 3GIJA 1T3OA 4NA3A 3T5LA 3ONQA 5CA5A 4C8KA 3QT8A 2KRBA 2KDOA 3GU0A 2AJ2A 5IQ6A 2OSQA 4NXNF 4WFZA 3BDPA 4C8YA 5KFJA 5HBMA 1K1SA 1IKWB 1H2VZ 2DEJA 3MR5A 2Z2YB 2HFZA 2HVZA 5IFMA 3NP5A 2RVJA 3MUTP 2XS5A 1YGYA 1QLNA 4JV1A 1FRLA 3TJ8A 2W9BA 3MEGA 3BPDA 4YQWA 5CZXA 3AAWB 3JAMU 3A8KA 3RUBL 2EG2A 1VQ7S 3DOMA 1BXNA 4DR6F 2NCKL 3GG1A 4KGMA 2FZCB 1EETB 3K5NA 1UZDA 4UQGA 4MKAA 3IBWA 1EX8A 1RDRA 3M8PB 4IG3A 2KB2A 2OLWA 4KKOB 4WK3A 4GKJJ 1RAHB 1QSYA 2CJQA 3MECB 3O3LA 4JB8B 3KK3B 5J1EA 4QZVB 2W9AA 2JLGA 2HS0A 4HT5A 2RRBA 1TU0B 4X66F 2RQCA 4ZJQA 3I55S 2V8DA 2GIQA 2XEXA 2B9WA 1AUSL 2FLLA 1XMQF 4X4NA 3DDNA 3OSPA 1KVJA 4C6AA 2I8EA 3MUVP 2XLJA 2IC3A 5K8MA 3G71S 2Z58B 3I5AA 3HHLB 4ES3A 2RSQA 3DRSB 3W5ZA 2R7WA 2V50A 4GVLA 1JJHA 3GPAA 2CA9A 1T03A 4QYRA 5E3RA 4D3GA 4RUBA 1YZ7A 4Z37A 3TWZA 5H9FJ 1S0OA 3SSSA 1H72C 1WSVA 2B4OA 4K5RA 2KRRA 1YIJS 2XULA 1RB0A 4NOHA 2MKSA 3UFCX 1O0PA 4USMA 1YJUA 1S1WB 4EBDA 3QGHA 2DO0A 4CH7A 1Q81T 2EVZA 3RR7A 3OFEA 2A10A 2NYIA 4LVNP 4LFAF 4ELUA 4FKXA 4TQSA 1RA6A 2D3UA 1RUSA 3PX6A 2M5YA 4ILLA 2VFUA 3AOAA 1VDHA 4DI6A 5L1LA 1FNMA 3AT1B 3DLGA 3HF5A 4QW8A 2UXDF 4L3KA 2CQIA 3D7SB 3I96A 4JI8F 1NK8A 1VLYA 4RBVA 4J9MA 1BC6A 5AXKA 2COLA 2MZJA 2RMLA 1BQMA 5C25A 2V4JA 5IXUA 1JIHA 3HHKA 1NB2A 4NMXA 3A1YG 2F7VA 3AB4B 2I6WA 1A7GE 3UW1A 3ZZYA 2MQOA 4NLUA 5DM7Q 2Z0GA 3I9ZA 3IC1A 4Z7YA 4HEA9 3AFGA 4DSKA 1AB8A 2FUG9 2AWZA 3DRSA 5ETLA 2ZJRQ 4IG0A 5KT6A 2HQCA 3N5BA 4OYAA 4WE1B 5C2GA 1ZZNA 4PWDA 1XIQA 3B6BA 1S6PB 2CQGA 3MR7A 4CCHA 4CLLA 1S72S 5HK4A 4ECUA 4NPOA 4LIRA 3S1TA 2ASLA 4WXWA 2IDLA 3MURP 4L74A
chains in the Genus database with same CATH topology
4N56A 1H3DA 5F8IA 1C0UB 1Q86T 1KD1T 3E3XA 4C8ZA 2APOA 3V6DB 4X4OA 3IR5B 2LLZA 2RQ4A 4KTQA 3TR5A 3H5YA 3EPIA 5KT3A 4FZVA 4R5PB 3RTVA 1FVSA 2HHSA 3EZUA 2D1CA 5C25B 2ZH9A 4I56A 2UU9F 4FF2A 2J6UA 2FGCA 1XK8A 4NCGB 1KLNA 4B9VA 3LP2B 2ZJPQ 4PUOA 4Q45A 2RILA 2OSRA 2FJVA 4DL7A 3K7RA 4DL2A 1S10A 5DG8A 2MZQA 3MMBB 3VAHA 2IRYA 5K8PA 3TW0A 4QWEA 4KB7A 2RF2A 1KSPA 3OJSA 1R3NA 2DNHA 2ZUGA 5L38A 3T1HF 4X64F 2VG6B 2V8GA 3DLEA 5K14B 3SFGA 3MGJA 3FVYA 1R8PA 3M2UA 3KK2A 5IQQA 2EK1A 1XNRF 3FQKA 2BZ2A 5E5NA 2P9EA 1RA7A 2CYYA 4DSFA 1HPZB 3PVXA 4MIWA 4DQRA 2IVFB 1KFDA 3TYTA 5J2MA 4QIVA 4AL6A 1X5TA 3I5CA 2KH9A 2KU7A 1RISA 1VGYA 2BBEA 5EUHA 5L9XA 3C8YA 4Y34A 4CO5A 2FLNA 5J2NA 3R3TA 5KG1A 2RF2B 2B4VA 3NGKA 5B0CA 3SV3A 4MK8A 4M94A 1A6LA 3M32B 1KOHA 2ZM6F 2RS8A 1Q8IA 4JI0F 3Q8RB 3QGIA 1GTHA 3M8QA 1X4CA 4PXBA 4G1QA 5KG3A 2BR0A 3GWCA 3J7YI 3C6TA 4RNNA 3J7YU 3T19A 3UCUP 3CJ4A 4OHWA 1OSCA 4LIWA 4NMLA 4ATNA 1QSSA 2UVRA 3LF0A 3IRXA 3MWBA 2FHOB 2QZ8A 5E33A 2MHEA 4K4UA 2VPYB 2HGNA 1IM4A 4R8UA 5I3QA 1IKWA 1TKZA 1S49A 2CQBA 4B02A 3NNCA 3OLBA 4WTYA 2J5AA 3CDWA 1NHUA 1HR0F 4P6QA 2HS4A 2PO4A 3D5MA 4J5OA 3EX7B 4IDKA 2B7BB 3CSKA 4KJIA 4OI4A 2OFGX 4C8MA 1C0TB 3HX9A 4C8NA 3RZAA 1FRIA 4OX6A 2FJDB 4I69A 5DO2A 2B0GA 2JFKA 3MOZA 1HA1A 2MQPA 3V4IB 1TL1A 3BQ2A 3RBDA 2D9OA 3VZIA 1WG5A 4C0OC 4KT0C 3M1VB 2L48A 3OR2A 2M88A 1HQUA 2QSWA 3JTOA 4BC9A 1UJ4A 1YBAA 3JTPA 1FNOA 1JK9B 2ROEA 1KTQA 1TL5A 1V9OA 1K73T 2HVHA 2JZ5A 3W2VB 1C2PA 2BRLA 3MM8A 5J2PB 2QRRA 3M6XA 2R2TA 4U6PA 1IKXA 2XHWA 3RBEA 1OPIA 3ISZA 2DR8A 2BJDA 1OPZA 2CZVC 4ZVFA 3HVTB 4BWJA 1ZM9A 4WYWA 5CYQB 1IXKA 3MHYA 1LKZA 2LA4A 4LUBA 4RW6B 3WZ0A 2GO9A 5JUMA 5GAEU 5C24B 4A8MP 1C4CA 3RRGA 1S0MA 3AB2B 4TQRA 2FVQA 1UVMA 1N5VA 3OJUA 1DTQB 3GV7B 2GHPA 2L08A 4QPXA 1ZM3A 3KLEA 5LSLA 1XBWA 1V6HA 3CDBA 5HI7A 1YJ9S 3MM5A 2KO1A 3BSCA 2C3OA 1MNEA 2OPRB 1V3RA 4YB6A 3VR1A 2BQRA 1HBOB 2VZ9A 1Y0HA 1RT4A 4MMOA 1N33F 1O51A 1SKWA 5FJ4A 2AGOA 1LK7A 4DWIA 4FVMA 1TL3B 4TLQA 2VG5A 2CRLA 1LV5A 1UJ5A 4K59A 2HW3A 2J7WA 4DV5F 4ZPWR 4OJ3A 4DDFA 3PXGa 4ECRA 3IFEA 1DTQA 3BREA 3TVKA 3MEKA 3Q2SC 3U7JA 1XN9A 5A8RB 4Q8EA 1WTBA 4ED5A 2E1RA 2HAIA 4MYTA 5DGBA 2B5JA 1D0EA 4X4VA 2IYGA 5EGYA 5KG7A 4QJVA 4O0IA 3KMQA 1EP4B 2WSCC 4DX8H 2VBZA 4J37A 2QA1A 1RTDA 4B9TA 1LXNA 3K5OA 2KT3A 2XMVA 3PIOQ 4OI1A 4DR5F 3UQSA 1JLCB 2R8GA 2RB7A 3RB6A 1XR7A 1U25A 4O4GA 1FT8A 1SL1A 1X9MA 3MM6A 5DDRC 1KN6A 1HI8A 1B64A 4DPOA 5HMZA 5L1JA 3MF5A 1DTTB 3M6WA 3RAMA 1RAJA 4ED8A 2HHUA 4ZLPA 2R7OA 1F2GA 2GCFA 3KG0A 2M8DB 5KG6A 2VG7A 2ZKUA 4Y2AA 2EFNA 4FNIA 2VG7B 3LP2A 3H4DA 1PGZA 2EK6A 1HNVB 4J9KA 2NUHA 4FXWA 1TP7A 2IVYA 1FHTA 4ZPCA 2A1BA 4QWDA 4UY85 1SI9A 5D4PA 2DTJA 2N7CA 3US5A 4ZP7A 3QAEA 1YTYA 4O3QA 2FD2A 2W7PA 5F8LA 1QAJA 4V19J 1T02A 4O4GB 5J2MB 3V6DA 2DNQA 3HZEA 3G6YA 1TZ0A 2ZFHA 3M2RA 3DLJA 3FQLA 3IA0A 4Y2KA 2DGXA 1VQ8S 2DRAA 5J1NA 3N6MA 2FC9A 3MM7B 3MFHA 1J5EF 2QA4S 1S9GA 1SV5B 4XO0A 1M1KT 3RW7A 3D28A 1XC9A 5KFSA 2E9ZA 2VPZB 3KLVA 1F0XA 3N6LA 4R8UB 3W3SA 4DV0F 1VHFA 3DRPB 2QLWA 3DRRB 2JSXA 4R0JA 4IG0B 1KHWA 1UEUA 2BJEA 2E44A 3TRGA 4ECQA 4LJMA 3CJ0A 6FDRA 1W25A 4IOCQ 4C8OA 2ZJQQ 2BW2A 2PSZA 1VC6A 2YX4A 3H2VE 4AXJA 2V4QA 4TYBA 4EZ6A 2D74B 2DRBA 1LWEA 1ZAVA 2CQ4A 2CPDA 2DBBA 2YNFA 4HI2A 3JSMB 1WEYA 4UW2A 2IM2A 2XC9A 1FKAF 4K4SA 4GKKF 4OJHA 2H5EA 2JEGA 3KK1B 1K8AT 1SL0A 4M5DB 5A8WA 2MKCA 2VA3A 4Q8FA 3H20A 1RKIA 1R7IA 2N82B 3KFWX 4B08A 1FA0A 5HMXA 1G3OA 3THTA 5E41A 1JLFA 2XSJB 5E2QA 5LJ5Y 1RTJB 4KAIA 4LF8F 1REVA 3PW2A 3UCGA 4H4OB 2M8HA 2ZH7A 4J9RA 4AL5A 2YNGA 4QU6A 1S1TB 3TO8A 2GJIA 4F2SA 3M6VA 5KT7A 2B51A 1H98A 4WCEQ 1JJ4A 2K3IA 5T14A 4AYBD 3K8WA 4F4XA 4I6YA 2MB0B 4ECXA 3M9NB 4IDKB 2JHEA 4DQQA 2CPFA 4CT8A 5D3GA 1X4AA 1JLQB 1WD6A 2X3GA 2GV1A 4YR3A 2C28A 1JLGA 4RX6A 1PO6A 4X4SA 2AJ1A 4NXMF 2FPHX 1U47A 2Q6BA 2UUTA 2GNKA 2IVMA 2WCXA 3DHWC 4JOUA 1U4BA 1HQUB 2DJWA 1PC5A 2ZOFA 1OWXA 4PQAA 4HYKA 1DFDA 4ECVA 3UR3C 2WK4A 3V4IA 3CCTA 1AROP 1G7CB 5MLCV 4DLGA 1HW8A 3JAMY 4WZMA 2CQHA 4KE5A 3NG8A 5KT2A 2E7WA 3OFGA 2C3MA 2OMLA 4WZQA 5DLFA 4G3IA 2NPIA 2VFSA 3SSRA 2PT0A 2HLTA 1WG1A 4DN9A 3BM7A 5DQHA 4JV2A 1FKPB 2JDJA 3NAHA 3WBZA 4ZCIA 1FKPA 5CD4H 2GIRA 1IN0A 4OL8A 1FDAA 3ZZOA 1U1OA 1ULRA 3KK3A 2OD6A 4DUYF 3J7ZT 2V94A 2ZITA 4X4TA 2I2YA 3E51A 4WU3A 3RRHA 1HHTP 3CO9A 1JLAA 4OJGA 1VFJA 2FLOA 2YNIB 2CFXA 3NLCA 2OPQB 5HMYA 2R7XA 5KFXA 2Q6CA 2LEAA 2RUGA 4USHA 1KR4A 1V3SA 2O1PA 4PCQA 1TVRB 3MEDA 3JSRA 4URGA 4RU9A 4I67A 2X1GA 1FJGF 1KLMB 1N6QB 5GAGU 3SCIE 2W8LA 4B9UA 3ENVA 4I6WA 4NLOA 3PZPA 1UL3A 3MTJA 4QOTA 1S1WA 1T05B 3CDUA 4ILRA 2OPPA 2H9ZA 1FKOB 5KFCA 2J9CA 3LW5C 3OTDA 1NKEA 2E9RX 2ZHBA 2K1RB 2CQDA 2DK2A 1SIWB 2DT9A 3THPA 4DJBA 1K9MT 2PFFB 5KG5A 3QIDA 4AUKA 4OMFG 4Y00A 1QM9A 3Q22A 4OZLA 4C2MA 1C0UA 3DOLA 4MJKA 2VBWA 3SCJE 2HRYA 2EBEA 2K1RA