1RWKB

Crystal structure of human caspase-1 in complex with 3-(2-mercapto-acetylamino)-4-oxo-pentanoic acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwkB00
1RWMB 3EDRB 2XZTB 2QL9B 4ZVTB 3D6HB 2H4WB 5IC4B 2H48B 1RWPB 1F9EB 3GJRB 2C2KB 1RWNB 1IBCB 2CNKB 1RWWB 2FQQB 2HBZB 3P4UB 2QLJB 3R7SB 2XYPB 1ICEB 2QL5B 1I3OB 3IBCB 2C2OB 1GFWB 1RHKB 3KJNB 2CNNB 2H4YB 3P45B 2CNLB 4ZVPB 1PYOB 3QNWB 2XYHB 2P2CB 2H54B 3RJMB 1RWOB 3KJFB 1PAUB 2Y0BB 4ZVRB 4ZVSB 1SC4B 1RHUB 3R6LB 1RWXB 2HBYB 2C1EB 2C2ZB 2CDRB 5K20B 5IC6B 2HBQB 2XZDB 1QTNB 3NS7B 2DKOB 1SC1B 2C2MB 3GJSB 3IBFB 1RHRB 2CJYB 3GJQB 4LSZB 1NMEB 2H5JB 1RHQB 1SC3B 2XYGB 3SIPB 3R7BB 4DCOB 3R5JB 4DCPB 2CNOB 2H51B 4ZVOB 1RWKB 3R6GB 4ZVQB 3D6MB 1RE1B 2H5IB 3GJTB 1RHMB 3KJQB 2QL7B 2QLFB 2H65B 3D6FB 1I51B 1QDUB 1RWVB 3R7NB 2HBRB 3EDQB 4JB8B 2QLBB 2CJXB 1RHJB 4ZVUB 2Y1LB 4DCJB 1BMQB
chains in the Genus database with same CATH superfamily
2W7PA 3SSSA 3U7JA 4OX7A 3ILOA 2I2YA 5G0RB 4K7QA 1FDBA 1UZDA 1RWWB 5J2QB 2HW3A 4EU0A 2Z2YB 4Y00A 2Q79A 3A3OB 2DHAA 3GMGA 1RT5B 5IOLA 4ZVPB 2I6WA 2RSQA 2HZCA 3IWNC 5G4DA 4K4YA 1VC5A 2NSBA 3C3LA 2MQMA 2RUSA 1CBKA 4DMZA 2VJUA 2A2DA 4G3IA 5K8NA 2VICA 3G71S 3B8HA 2FUG9 4DV7J 2CQPA 3LGMA 1U2FA 2ZJPQ 4JI0F 2B56A 3UDEA 2WAQD 4NOHA 2DISA 2YPYA 2CQ0A 1DQAA 1SV5A 4WIIA 1LFPA 4DR7F 4P2FA 1W2BR 4B17A 2O1PA 1TKTA 2XSFA 1I51B 3MR2A 4IG0B 3UQSA 2UUAJ 4FF1A 1H98A 2WSFC 3NGRA 1RWUA 1EZZB 2OIHA 2AZ3A 5CQGA 4X62F 1HHQA 2I0XA 1RUSA 2OEJA 5GAGI 1N5YA 2HHHJ 4JV5J 1S6QB 3P4UB 3KLVA 3R7SB 1XNQJ 3NGSA 2DNRA 2DNYA 1HD0A 2RE1A 2I9SA 2BMBA 2FGOA 3TJAA 5KT5A 2ILYA 2P9CA 1DLOA 2FJVA 1WDDA 3S1TA 1RWXB 3SV3A 1WI6A 1EIYB 2VBZA 1R89A 2C2NA 3H8YA 2W9CB 2V8HA 2DCUB 1JWWA 3GIJA 2EC2A 4A46A 4ECRA 4RW4A 3LPYA 1PC4A 2RS2A 1VQ8S 1F60B 2XLKA 2LA4A 4OZ1A 4WZQA 3K2YA 2OUGA 3I55S 2N3LA 2XSJB 2KRBA 1EP4B 1RAAB 4ELTA 5AXLA 2OEMA 3UCUP 1UWBA 2G13A 4DPWA 3R7NB 3FC9A 2HFVA 3G86A 4LVOP 5HROB 1FJ7A 3DNCA 5D4OA 2BJ9A 2VBXA 2Z2LA 3BR9A 5KG7A 3SZ2A 3QSIA 2QJ3A 3UCGA 4J9SA 2SXLA 4AUKA 2DRDA 2QYCA 2ZD1A 1FX2A 4CTAB 1FNXH 1HPZB 1E6VB 3ZTSA 4ES1A 2YY3A 4MKAA 1C0UB 2PA3A 1RT4B 3GPAA 5KFKA 2F7VA 4URQU 1ZM2A 3BDEA 2VDHA 1PJ6A 1U1NA 1Y3KA 5L1KA 2ACMA 5KFDA 3C19A 3PEJA 4G1QA 2YNGB 2R2UA 4DFJA 3HVWA 1S9GA 2ZOGA 2HVHA 2JL9A 3SEOA 4WU2A 3NWRA 3W2VA 2PMHA 4J9VA 3FKBA 1D8ZA 4USVA 4X4TA 1SXLA 4NXNF 1G6BA 4P7TA 1CJTB 1F3VA 1W7WA 1IBKJ 3DYAB 4ILRA 2QLXA 4MIBA 3C14B 2ZH7A 1SIZA 3LP1B 1MLAA 4C8YA 2QLBB 3M8ZA 3PRDA 1Y7PA 3H2LA 3VAKA 3CDWA 1U0HA 4YB5A 2XY5A 4Y34A 3UVJA 5A2QU 1REGX 1RT7A 2GVDB 1F2GA 2GFFA 3L4BC 4M5DA 2PE8A 1JXLA 5CABA 1P8GA 5KTQA 2IDEA 2XHCA 5THWA 2CVIA 2KM8C 1HBNA 2WW4A 5EX3A 3DOKA 4USHA 2BOAA 3GYNA 3C6TB 2FJEB 5HJXA 1U26A 4CDIA 2XMTA 3QLHB 1PYSB 5KFAA 2U2FA 4X4NA 1IVZA 1HA1A 1NB2A 4RUCA 2F9JA 2UUCF 1NMEB 4JI3J 5F8LA 2XYGB 4DCOB 1RTHA 5DM6Q 3H5XA 5D77A 1YJNS 2NQPA 4K5RA 1P9YA 3T41A 2J9DE 2G0IA 4Q45A 3KG1A 3OHBA 5IZHA 4YFUA 2O3DA 1KS2A 3W8GA 1S99A 3KTQA 1XQIA 2MQOA 4DLGA 1QM9A 4TN2A 1CJUB 4DPXA 2LQBA 2NSCA 2VB6A 3MURP 2ZH9A 4QU6A 2FB0A 2RQCA 4HT7A 1Q53A 3O8WA 5KFWA 4ED2A 2DTJA 1REVB 3VAJA 1LWFA 3LGHA 4DV3J 3QJLA 7AT1B 4I6AA 5GAEU 4WF9Q 3M1VA 3W8PA 2VKZG 3A3NB 3H2VE 4DL6A 4NLXA 4O3NA 2D7SA 4IFYB 2EKYA 5BR8J 2VFTA 3K5NA 5A8RB 1RT2B 2JZ5A 4WP9A 2DR5A 5D6GA 4I1TA 1RDRA 4J9NA 2EG2A 1X4GA 3W61A 2GIRA 3CC4S 2HHTA 3F73A 4MFBB 1C0TB 1HHSA 2MSTA 2QFIA 1JLBB 1RBAA 2GVZA 1BLUA 1JLQA 1S4FA 4O4RA 1SV5B 2MTLA 3R5AA 5EWEA 2H4WB 3MD3A 2AMCB 3DLEB 1TKTB 4OYIA 3VV2B 3QMQA 1FKOA 2G0JA 1MMNA 4NMXA 2R7OA 3WC0A 4OL8A 4B3SF 2F3JA 1IQZA 2ZUAA 1EX8A 1TUGB 2YNHB 4PKDB 2FZCB 2Z2MA 1U02A 2ZH8A 1T0TV 5BYSA 3L95X 4USTA 2A0FB 1S76D 3QFHA 3D66A 3M2VA 4J37A 4DX6A 3EGVA 4LFAJ 1NAQA 1PO6A 1GMUA 3G8SA 2HFZA 1WTBA 2CZVC 4CCHA 2W24A 1DLOB 2PEHA 1VFJA 3I0SA 3VAMA 3UD4P 1UPPA 4Y2AA 4EO8A 3HVAA 4EYHB 3TX0A 4JP8A 2YPZA 3CMES 2OKQA 4F7VA 2P9GA 5HO4A 4JBCA 1HQUA 4XDCA 4FS2A 4ES3A 1U2RA 2MZQA 2JSXA 1WOPA 3K8VA 1HW8A 2C3YA 4IOBA 4ZCLA 4DPOA 3E2EA 1R0BG 4YOEA 4CH1A 2JEFA 9ATCB 2NUHA 1HNVB 4F4WA 3LP2A 1M5HA 1D09B 2ZD1B 3H5SA 5CYMB 4ZVRB 2B3TB 3RAXA 1NK5A 3IRXA 4DZDA 1RAOA 1MROB 2WOMB 5IT0A 2FHOB 2DVIA 1T9WA 1HI0P 2ATLA 2HKEA 1UVMA 3S7RA 2XB2D 2VH7A 1SJ4P 1JLCB 3IRWP 2LQ8A 2WB1D 5HATA 3SIPB 4G1QB 1C1CA 5F8NA 2JRSA 1UTAA 4YEAA 1AUSL 4CO0A 3UDLA 3L7UA 3RRHA 1X9MA 4BWMA 3POTA 4HTIA 4UY8T 4CLLA 5F9NA 4TY8A 2QN6B 1I1GA 2EFQA 5KFTA 3CGIA 3M8QA 3KLGA 1DHMA 4FN5A 2VQEF 4LRDA 1WG4A 3T19A 3OTDA 3H42A 4I68A 2B6AA 2BDPA 2DO0A 4LVNP 4A8MP 1M1KT 1XN9A 2OPPB 5L9NA 2YKNB 1U0HB 3RW6A 1VGYA 3BSAA 2UZAA 4KY3A 4N41A 2DNHA 4AQYJ 3OL6A 2PT0A 3M8RA 1RA6A 3S6EA 2HRTA 3LTOA 5KG6A 1N33F 2ZH4A 1SC1B 1HBNB 1XMQF 3DOKB 3T3FA 2L3MA 5KAKA 2W2OP 4PG6A 3O3LA 6FD1A 3DFEA 3CT9A 4H4KC 2OPQA 1FDDA 4LSZB 3CD5A 1VQ9S 2F1FA 2C3UA 2PD1A 1BUXA 2KXFA 1W25A 2BQRA 3DHWC 2HNDA 2DPJA 2V69A 1CQNA 2E1RA 2W8KA 4U95A 3EDQB 4GRSA 1TR0A 2LQ9A 2Y1LB 1D3WA 3LO3A 4YB1P 4RW8A 2GQQA 3VTIA 1X9SA 4UF4A 4FBUA 3QATA 2HLUA 4N8NA 2IA6A 2K1RA 2ZFHA 3CE8A 3T6BA 3UN2A 2GGPA 1FT8A 4LF6F 4F4ZA 3SBMA 2AEFA 3JAMU 3CIMA 2ZKUA 4QBUA 2HIQA 3KLEA 2XWXA 3TW0A 2RHSB 2VPYB 2ZC4A 4AFFA 4HI1A 2BANA 5A6PA 2IRXA 4G1PA 1SH0A 4QWEA 2BZ2A 3W60A 3KHGA 1C4AA 3M1VB 4B9VA 1AROP 1IJEB 2GS8A 3L09A 3HZEA 3TZWA 2BXJA 3EVMA 3C15A 1Q8LA 3FBCA 1PBUA 3HFKA 2APOA 3ZC4A 3NWGA 3WX8A 2D69A 1EHWA 2ZVSA 4KE5A 4IRDA 1TV6A 4TVAB 2LECA 2VOOA 5FLXU 4AL5A 1O5JA 3L7OA 2ZWPA 5F3TA 3CVKA 4L73A 1U0SA 1Q78A 1XEZA 4J91A 5IT4A 4F67A 4M1KA 1I3OB 5HLFB 3KLFA 4TYAA 4LF7J 1HWUA 2HFOA 3HJVA 1JLEA 3VAIA 1R43A 5CA5A 3T5KA 2ASJA 1FKOB 1R8AA 5EDWA 4B3OA 5KT6A 3V6HA 2W9AA 1PAEX 1CS4A 3WX4A 1D1UA 1ZM9A 2J9EA 3GFHA 3GIKA 2RH3A 3W2WB 4N8OA 4QIWD 3ZTQA 3WIUA 3AJ1A 3I96A 4WE1B 2JVRA 3M2VB 1RKJA 3O5TB 2DK2A 1M1GA 2IAJB 5DG9A 3PHTA 5B0BA 2Y3YA 5L9XA 1O8BA 3NG8A 4OX9J 5HMYA 3MCOA 4ICLB 4DL0C 3UN3A 3IG1B 4L75A 3J81j 3VGVA 3LUYA 1WF2A 2M9KA 1DQ8A 3H59A 1U1MA 1IBLF 4FP9A 4F4XA 4F3MA 2Y1JA 1UAWA 4P6QA 1Z1ZA 4OQJA 2NREA 2EFOA 3MOJB 2OPSA 4F4YA 3TAPA 1ZAXA 1KC8T 2V9WA 1X4FA 1RI7A 4AE5A 3EXYA 3D1HA 3QZ7A 3KUEA 3M30B 3LWLA 3RZAA 3LP2B 3M2UA 4RWWA 2A10A 1XNRF 5DG7A 1LW0A 1L3VA 1FXRA 1TL7B 3DM2A 2AP6A 1N5TA 4DN9A 2EKNA 5E3QA 4ZVOB 2V2KA 5EWGA 3ZNJ1 1JJ2R 4H4MA 4G1IA 1RAHB 2QLFB 1NNDA 1C1CB 3CTRA 3LP0A 1WHWA 3RW7A 4EO6A 2HHXA 1SH3A 5BJRA 1IWGA 2ALZA 1KSPA 1KVIA 1IJFB 2MKIA 3B82A 4L3KA 4N5SA 4Y0FA 2BABA 1NLKL 3KK1B 1LWXA 2K06A 3M8QB 3KLGB 3R5GA 1RT1A 5DZ6A 2FVQA 1B99A 3KDNA 1B4SA 5LMNF 3J7Z5 2NYIA 3I0RA 2QX0A 3OTBA 3V6DA 2UVVA 3T9NA 4KV8A 4DSLA 2M88A 3V4IA 4DX5A 3G6ES 3PCOB 2NYHA 2YKQA 2XS2A 5KFBA 1FKPA 2UUTA 4KH0B 3MPYA 2KRRA 1ZZNA 4KHPF 5J2MA 4QW8A 2XCAA 5DG8A 3D1OA 5GAGU 3W1YC 5B0AA 3CXCR 1CJVA 3E51A 4C9DA 1YZ6A 4KGXB 4CP5A 3FNNA 1VQ4S 3OD2A 3P3DA 1CEZA 4LIWA 2KFZA 2AYMA 1U1OA 1LFWA 1YX2A 3HHKA 4FYYB 3BYPA 1NSPA 1WSVA 3HI9A 2MKHA 1FD8A 5HVHA 2NUUG 5CYQA 4PWDB 4P2XA 2H48B 4A8FA 1BQNA 2GA7A 2UUBJ 1IBCB 4DXLA 3D54A 3BGFA 3CCRS 1NDCA 4UUXA 1GK8A 1C1BA 1WJ9A 4LREA 2BACA 3M6XA 3Q89A 3PIOQ 4O3RA 4DV7F 3TP2A 1UEKA 2J9DA 1GEHA 1TTHB 2A6OA 1R0AA 1WC1A 3MEGB 4CLYA 3AHPA 3CB4A 2XZDB 1QE1B 4DF4A 4OYWA 3KLEB 2XMVA 3WBZA 2EK6A 3PYEA 3I9V9 2XHWA 4JYAJ 4DU7A 2BANB 1YRTA 1TKXB 3MM6B 1FE4A 3EZ5A 2CAJA 3Q8PB 4DBQA 2HWTA 5ETPA 4JV5F 1XNQF 4NLOA 3C15B 1Q8IA 2A3JA 5HQMA 4RJVA 1TL1B 3KLIA 4O4GB 3RRGA 3N5FA 2HMIB 1JIHA 3K5MA 1K73T 3OLBA 2FC8A 5I42B 3BH6B 1XMBA 1YJVA 3VZIA 4N7TA 2C2DA 2XBPA 3H4DA 1T9XA 4FF4A 4FS1A 2YWEA 4BHQA 2Y0BB 4ZVSB 1JJ4A 2FTRA 2YKMB 3CJKB 3ENAA 4GMKA 5KFCA 2X3DA 3PX6A 2LMIA 3WC2A 4CLUA 1JLEB 3UCZP 5L38A 5DLGA 3ENWA 4J7CA 2KH9A 1JJHA 3QIPB 3OUYB 4CM2A 4UOCA 1EARA 1VI7A 3M8SA 3SSRA 4IFVA 1ULRA 2G4BA 4OJHA 4EI2A 2DCLA 4X4OA 4RW9A 5L1LA 2ADBA 1NKCA 3V81A 1QAIA 3MFIA 5HMZA 4ZJQA 2HGNA 3IAS9 5JUMA 2H1YA 2FVRA 4KC5A 4W98A 2AJQA 4WFAQ 4DQPA 2MLZA 3C16A 2R2TA 2DT9A 3J7ZT 4KGMA 1VRQC 2IMWP 4HT5A 1F9HA 1UKUA 5KFOA 4J9QA 2UU9J 1YITS 4JOUA 1L3KA 4NRTA 2OPRA 2RVJA 5D3GB 2IPOB 3VF0B 4X4QA 2X51A 4HACB 3OL8A 3ILJA 3GV5B 1IR2A 4CNYA 3RBDA 3MTKA 1UCNA 2OFHX 1IBKF 1MMDA 2CZ4A 3M6WA 2GMLA 4JI6J 2DGQA 1RSCA 4C4WA 4CYUA 1CSJA 1T02A 1RTDB 3BBFA 3AT1B 1IKWB 3M8YA 1Y11A 1S1TA 4YDDB 2ZH6A 2FHJD 1S0OA 3M2UB 3Q83A 1LW0B 3QSYB 3PYDA 2RRNA 2WVDA 3DOLA 4JI2J 3G8QA 1T7PA 1WHVA 3MEDA 2JHEA 2C28A 2E44A 1FK9A 4ZLPA 2ASDA 3LP0B 5F8JA 3G82B 4I2PA 2W8LA 3DLBA 4QPXA 4ZK7M 4KBIA 4LBPA 2FDNA 4JI3F 4Q8EA 1SKWA 2WB4A 1NZAA 1YBAA 1UJ6A 2RKIA 2ZH3A 2XY6A 5C25B 4IRKA 3BQ2A 3KMSA 2KT3A 3DOMA 3HDSA 4UW2A 4ZP8A 3V6DB 4WFXA 2KFNA 4Y2KA 4HDHA 1J5EJ 3V4IB 3N79A 4JV2A 2UXCJ 2E7VA 2Q6BA 4NLVA 5J1EB 3CCTA 3MR5A 2HHPA 5C7PA 1TVRA 1DJ0A 4DR7J 1RHMB 4X65J 2HLTA 2IVFB 3BB5A 2FJDB 1NHKL 3N6MA 1MNEA 2ZHOA 5I4MA 5KFQA 5D0HA 2D41A 4N77A 2RU9A 4NLTA 2GIQA 3CJRA 2M52A 3KK3A 4DV3F 3J7YU 2AX1A 3E3XA 4AD6A 3OVBA 1Q79A 3GSIA 3FZBA 1Q95G 2I8EA 5BR8F 4UT4A 1BQNB 2IYIA 3DGPA 4RUAA 1FRIA 4PR6A 3UD5A 2MY8A 2AJ4A 2B51A 1F1BB 2R7VA 3GR1A 3ENVA 1C1BB 2JC0A 2IM2A 4ZITA 1X8DA 4OYPA 1VLYA 1BE4A 3GV7B 3WZ0A 3SCIE 3ICLA 3OXLA 1VQ6S 4PUOA 2E9ZA 4AT1B 1GQEA 3A4TA 1JXEA 3TO8A 2C3PA 1FWKA 3KHRA 2GHWA 4IUFA 3CC2S 1H0HB 2YKOA 4YUDA 4BLGA 1MN9A 5KT7A 3HVRA 8ATCB 3HD2A 3CF5Q 3FMBA 1H72C 4KKOB 4NCGA 2ASLA 3Q8UA 4HR2A 4EZ6A 1YRUA 2G1HA 1N8RT 4B3TJ 1GX5A 4LFAF 4KGZB 3DKDA 3QAEA 3PYGA 3RBZA 2XNQA 2XY7A 5LXYA 3MM7A 4QJVA 5ETNA 2MZ1A 2XM3A 1S9EA 1BY9A 3EPGA 4IOCQ 1KVKA 2HAIA 4A48A 3QT6A 3HHNB 2ZBRA 4FZVA 5FLXY 2V4JA 3K7RA 2Y8YA 2EVZA 1TELA 2IVYA 1KTQA 3IFEA 2DH7A 1RTIA 1M5KC 2B4OA 3B4MA 2WK4A 3C2PA 1RHQB 2ZHAA 3RB4A 3SDEB 4QYZK 2YKPA 2VIHA 2MZRA 3TQ1A 2ZC3A 1S0MA 4ZPAA 2HNYB 4PG4A 4ED6A 4EBEA 5IM0A 1SB6A 2NCKL 3QRPA 3UW1A 1F5BA 1ZETA 4IKAA 4IFVB 3BO4A 1RABB 2KVIA 2HS4A 4NLWA 1FEEA 1VDHA 4XTTA 5KFLA 3RB3A 2E9RX 3SCLE 2OH2A 3TVYA 3H40A 1SI9A 1FXDA 4M95A 3QFWA 2A18A 4ZLJA 2DHHA 3K17A 2CJQA 4YY3J 1YBTA 5EX0A 2M70A 4C7QA 1LKZA 1N56A 3KHLA 3PFOA 4NEYA 3TYTA 1MU2A 3GE9A 5CZXA 4Q5VA 5LSOA 1FRHA 1XK8A 3THTA 2Z57B 3PDNA 5HBMA 2LQ5A 5FDLA 4JV0A 2B7BB 1KTVA 3GTYX 2HBYB 2GQCA 1QTNB 1NDPA 4H54A 4OYOA 2OPRB 1U09A 4WFNQ 3HP6A 2VG7A 4J9OA 2FY1A 1S1UB 1SC6A 2VFSA 1J27A 1TAQA 4QWBA 5E3RA 2FZGB 2AEMA 2R8GA 1YSJA 2R2RA 4I7FB 5B0EA 2KN4A 4CYUB 4GO5X 4C3MA 2OAUA 3PO4A 1CJKA 1U1KA 5I3PA 1OQ3A 2ZJQQ 2H3EB 3Q86A 5C24A 1FJGF 4IDKB 1S1TB 2J7KA 4LF1A 1WHYA 2PMWA 1N48A 2DGTA 3CJ8A 3OFHA 4QIFA 5L8RC 4C97A 1U45A 4Z7CA 2VONA 1S72S 4AQYF 4ITSA 3DOLB 1Q5YA 2QT7A 2GAGC 4DR4F 3I5AA 1SL1A 1BGXT 3M8WA 3DCAA 1LWEA 1UL3A 1HKAA 4EZ9A 3MMCA 3JSMB 2WCXA 3TNVA 4EEYA 4RR5A 3L7PA 2PI5A 3PKYA 3M9OB 3IC1A 3NAIA 5H9EJ 2EI5A 1KD1T 2ROGA 4LFBF 3P5BP 3EGNA 3HT0A 2HFNA 2LDYA 2EFVA 2RDIA 3BPDA 4FKYA 4USMA 1HNZF 2FGCA 4ECXA 4K4WA 5KFNA 3JQJA 1XWLA 3CDUA 5HN0A 4KGKA 2PDAA 4QR1A 3KUHA 1URNA 2JDJA 4LJMA 1N4LA 3G6XA 4M5MA 2CFXA 2PI4A 3DOMB 1N0UA 2EPIA 1YI2S 2JLFA 2AYGA 4PWUA 2VL1A 4LQ9A 4KO0B 2ZNZA 3G87A 3RUBL 3IXQA 1RU1A 3BO3A 4X4SA 3HHDA 2G1DA 4JI4F 4YDXA 3PR4A 3VQTA 1R6YA 2OTLS 1HWIA 3IP0A 2E1AA 3O6QA 4YHHJ 2DGXA 3KK3B 4F4KA 5CCLA 4CLPA 1HMVA 3JSRA 4FNHA 2XYHB 3R97A 3D2WA 4LBHA 4PAAA 4ZLNA 1VRTA 5A8WA 2VG5B 1AA1B 2DKOB 2V5HG 2DEIA 1G7CB 1ZA1B 2ZJRQ 5HQ8A 3JB9k 3T1HF 1NSKL 4Y6IA 2RDDA 4ECZA 4DHVA 1FJCA 3AOAA 3PW5A 3GU0A 3M2RB 4LR8A 2K2PA 2CNOB 4N56A 4OIXA 3MCSA 3ZZRA 1FDAA 3MMBB 1YIJS 2UXBF 4PUOB 3MR6A 3P5TL 3FQKA 4LF7F 3NP5A 3ZNUA 2LEPA 4EWTA 4MK7A 2VFVA 2Y0SD 4Y65A 4DX7A 3NCQA 3M6VA 3G6YA 4TXSA 1YRXA 4P73A 4NI2A 5KFGA 2J76E 2UVWA 2QYGA 3UR3C 4CO2A 3KFWX 3MM5A 2AT1B 3CJTA 1Y4ZB 4A8KA 2N82B 2LDIA 4RWXA 4QU7A 2PEBA 5HQLA 3KK2B 3L3CA 3A8JA 3MM7B 2OELA 3IBFB 4NA2A 1NDKA 3IA0A 4ZMMA 4R5PA 3QIDA 2HFSA 3JYTA 5HJYA 4K8RA 1S9EB 4DV2F 2V8DA 3MCNA 8AT1B 2BKNA 2QZ8A 3EE3A 3OSPA 4USIA 4TQRA 3V4MA 3EICA 2E29A 1NK9A 3KJVA 1VR6A 2ACYA 1CLFA 3OL9A 1JKHA 3BGRA 5GMEA 1NRKA 2QEXS 2XO7A 2QFJA 4B9MA 3VVUA 4RNFA 4R8UA 2W7AA 3CCLS 4ELUA 2JEGA 2R2SA 2XQCA 3MUMP 2XI3A 2CJAA 1JLFA 3D3BJ 1RCXB 2JNJA 2NXEA 1SC4B 3OTOF 1VHIA 1S48A 4NXMF 2VFUA 1LXJA 1N33J 1CPZA 1Q8KA 1XMQJ 2QA4S 1KKHA 1HBOB 2F8MA 5HBMB 2F4VJ 5G0RA 1RISA 5J2QA 4OJ3A 3FGVA 2E7XA 2KDOA 1K47A 1VQSA 3CJ0A 4CM0A 1LWCB 4I6WA 2VG7B 1GMWA 4LF9J 4WFZA 2E7WA 3R3TA 5F3ZA 5B0DA 2QA2A 2ASYA 3PX0A 3TARA 4ERDA 2B4PA 2HHSA 2EFGA 3SYZA 3UDCA 1U2CA 2IBOA 4MKBA 2DRBA 5C24B 3J81U 4XIUA 4FKXA 1VC6A 2VPZB 4QYRA 3TZXA 4O44B 3TEGA 1UFKA 1SL2A 5H1SV 2GW8A 3CCSS 2DNQA 3HO1A 4K50A 4C8MA 2DGWA 2BE7D 3QYYA 4LF6J 2GHPA 2XNRA 1S6OA 3D0HE 1VHFA 4PXCA 2WBMA 2MKSA 2D9PA 1U8SA 4DR5J 4QOTA 1HL6A 2GCFA 2GZOA 3DRYA 4NLUA 2LA6A 4USWA 5IC6B 4ED8A 3GIMA 5M2UA 4BCAA 2YWHA 4RL1A 1GXLA 1TP7A 4CT9A 1O6XA 4EUVA 3BGOP 3LANA 4DV6F 2CQBA 1LEOA 2CYYA 1SPBP 4C11B 1S6QA 3FFIB 3I5CA 4OYMA 4A8QA 4ID5A 1BWVA 3W9HA 3QQCD 1RBLA 3D6MB 2F4FA 2NR0A 2UUBF 4DR1J 1B64A 3MF5A 4P72A 3IAM9 4OZ2A 4O3QA 4OZLA 1QDUB 1RWVB 4DUTA 4DV4J 1D0EA 3KLHB 1S6PA 2W9CA 2MB0B 3BS9A 5HK4A 1KLNA 2HGLA 3GFZA 2ZH2A 2N3OA 2BJEA 3FQLA 4Q0BB 3PRBA 1JLGB 3HK2A 2OO4A 2XSJA 3QWPA 4GC6A 1EP4A 4P10A 4JYAF 1S59A 1QSYA 4NCAA 1GX6A 2PIIA 5HROA 4LRCA 2V34A 1HMVB 3KKFA 2HG4A 4C8LA 1B0PA 4RBVA 2MKJA 1VRTB 4CTAA 3VAHA 3BN7A 1HPZA 1SVDA 2KO1A 1E6VA 1W26A 5KT2A 1WEYA 2JWNA 1LQ9A 1VQKS 1RT4A 1NK8A 1RB0A 1FTCA 3WIVA 2CUYA 3CCJS 1HBMB 3OBIA 4F8RA 1JB0C 2BVZA 1P27B 3HXMA 3A3PB 1APSA 2YNGA 1R27B 2BM1A 1LW2B 2UV8G 1YK9A 4DL4A 2AQ4A 4MT1A 1JLAA 2WVFA 3JTPA 4YS2A 2VPXB 1JXVA 1CJTA 3IBWA 1VBZA 2UV8A 1P9QC 3DYAA 4DQQA 3P96A 3JS9A 4CH7A 2ZOMA 3QNWB 1LXNA 1PCAA 3MECA 4C0OC 3UPFA 2M5YA 3DI6B 1VQNS 3W5ZA 3TEHB 1Q7YT 3Q8QB 5K8MA 3MM5B 4NLRA 5EWFA 1V3RA 1P1LA 2AGQA 3MD1A 2LKZA 1M90T 1KHVA 3FRZA 5I3UA 1ZTTA 2KXNB 5HSPA 5LM7E 1OO0B 5AE2A 2FHKA 1T05B 3AODA 4UQTA 2WSEC 3LWMA 2B8PA 3C6TA 2UU9F 3AA9A 3AD8C 4QIVA 3KOAA 2LEAA 3HMJG 2LU1A 1FRMA 3MUVP 2P6SA 3BGRB 3T5HA 3PO5A 2OMLA 3X1LB 4O23A 1Q81T 1PBAA 2FQQB 4DSIA 4GVBB 4K2JA 3ISZA 2V2QA 4P75A 2AF6A 3Q2SC 5LJ5Y 2AYBA 2ADCA 5LMNJ 3KJFB 4LF2A 2QA4G 4ZOSA 4RW7B 3OR2B 1U1QA 3GIIA 1CJUA 5A0YA 2KZZA 1VCTA 2KZMA 5IQ6A 5IT9U 2Y9HA 2C42A 2VKRA 4JI2F 4HYKA 3MPDA 4DU8A 3PM9A 1UVIA 2FJBB 2JC1A 4EMDA 1AFIA 1REVA 1VJQA 4CT8A 3M32A 3G6VA 3HLUA 3D5MA 3BDPA 2J6TA 2AEJA 2V8VA 5KFMA 5BYQA 2QG9B 4ZVUB 2L08A 1NHUA 2EFNA 1UA1A 2LEBA 4IFYA 2DYAA 1RU2A 1MWYA 1S79A 1CVJA 2BJDA 2AKWB 2NZ4A 4ZCMA 1RT6B 3LH2S 5A8RA 1RT2A 1NSQA 1V9OA 3PG9A 2I5JA 3NKYA 2ZE2A 3H5YA 3DLLQ 4MFBA 1C0TA 2UP1A 4A4JA 4W4MA 2B4UA 1J5EF 2KHCA 1JLBA 3ISND 2UXCF 4B3MJ 4DV5F 5BXIA 3C8YA 2HBQB 3DRPB 3ZZ0A 2CRLA 5L1IA 2BUNA 1PYTA 4QPTA 1NK6A 5C42A 3DLEA 4X65F 4FXDA 1TFYA 2RQKA 1IBMJ 2DIVA 1J5OA 1YJ7A 1RQ0A 2LYVA 1N5QA 2GO9A 3UWTA 4ZN3A 4DUZJ 1T9YA 4ZP9A 3VR1A 4RKUC 5H9FJ 4G65A 3EJMA 1IUJA 2QTWA 2E1MC 2MZSA 2YNHA 3CJ5A 1FJEB 1UMJA 1VQ7S 4ID5B 3KJQB 4C3KA 1XR7A 4DPYA 2Q3PA 5FD1A 5D78A 4RUHA 2IYGA 1D9DA 5B0FA 4RU2A 3WHIA 4IG3B 4MMOA 4X2BA 4CZCA 4PEOA 2F63A 3N28A 4OHWA 1WC4A 3B4DA 4ZCIA 5J1NA 3JTOA 3ULHA 1S6PB 3DMJB 3V6KA 2KJVA 3LOUA 1CC8A 3FBFA 4DQRA 1N54B 3GILA 2NPFA 1YJTA 1B0VA 5KFSA 3MDFA 2MQPA 1I6JA 1AFJA 1YZ7A 3MMAA 5K20B 2C2ZB 2KVQE 1G4CA 2YWFA 4DWIA 2POKA 2QIFA 1L3SA 3AXKA 4TU8A 2LXUA 3DLKA 3H20A 3NNAA 4MIWA 2BQ3A 3W62A 2XC9A 2BW2A 4F36A 2AD9A 3TANA 3NEKA 1U25A 1HNVA 4DL3A 3SSQA 1WC6A 3GFYA 3NXZA 3BPSP 5HL7Q 5CYMA 1SKUB 2FIUA 1DZ5A 4ECTA 1S7IA 2PC6A 4B3TF 4HHJA 3HHLC 1KFDA 4KR0B 1MROA 1FI4A 2WOMA 2B5JA 2YNIB 2I1RA 4ED7A 3CDEA 4LIRA 5B7WA 2FHJA 1S1VA 1S1XB 4IYQA 3AXMA 3M05A 3KUGA 1JLCA 1BXNA 3TRGA 1OMSA 1SQFA 2YQ1A 4WP3A 4D3HA 2F40A 4R0EA 1JLAB 4DV0F 3VWSA 4NLQA 1ELOA 4I6YA 4KIAA 2DHSA 2RD5C 3OFFA 4YR0A 2V94A 1O0PA 1IWAA 1UETA 2ALYB 3PJWA 2DNNA 1Q0NA 1VIOA 4E98A 2OTJS 4E0DA 2UUWA 2RRAA 1S49A 3ENQA 3MECB 3HKZD 5K14B 1DAXA 1SJRA 3QBCA 1X31C 5M2PA 4LR9A 3TI0A 2GX8A 4L6V3 2OPPA 4ZCKA 2YKNA 4CQ1A 2Z8QA 2ZOFA 4OHZA 3G4SS 4DV1F 3UE2A 3MM9A 2RU3A 3SFUA 3ZZYA 4YY3F 4WFYA 5F8GA 5I3UB 4QIGA 2KJWA 2QMXA 5ETQA 1RWMB 2GJ2A 4DS4A 1GMVA 5GMDA 3NS5A 3HSGA 2K3IA 1NJXA 1JK9B 4PXBA 1KP6A 1Q16B 1WKLA 1VLOA 4U8YA 2AU0A 1PC5A 2J9CA 2MDAA 2YH1A 4ILLA 5KT3A 3N9UC 2JFKA 1B70B 3PXGa 4ZPWR 2HVDA 3OJSA 3QPIA 5E3PA 2QC3A 3H7HB 2KT2A 5HAOA 2D3O1 2HVEA 1IKXB 4USJC 1OS5A 3ITHB 5KFEA 1DTTB 2KB2A 3RGIA 1KEKA 2GC8A 4OHYA 2DGUA 5A0YB 2U1AA 2V4QA 4F2SA 4IOAQ 4NLPA 3ETMA 4ED4A 3P6YC 1KHWA 3W65A 4CO1A 2CVEA 2YQ0A 3D6FB 4DL2A 3RR7A 5D0EA 2MZJA 2HS3A 4DZ6A 1VOMA 1Q1KA 4DLEA 1Y00A 3R5BA 1RWPB 3M32B 1NH8A 4X4VA 1BQMB 3MXHP 1Q5VA 2AJ0A 4YMEA 3C6UB 1YTYA 2IRYA 2MKCA 4K5SA 1DY3A 1U6ZA 2XMMA 1YLXA 3FSXA 5GMKa 3J80Y 2H4YB 4MTPA 3D1QA 3RJMB 3CWJA 3OL7A 2AW0A 1PAUB 3QT5A 3GCWP 3BN4A 2B9EA 1VIXA 1T9UA 2I5JB 3MR3A 4RUBA 3QWUA 3FDSA 3D3CJ 2ZE2B 1IM6A 3J81Y 1B7FA 2XGQA 2CJKA 2R7SA 1FA0A 1X4EA 1UEUA 3R5JB 3TR5A 1Y9OA 2H51B 4IH7A 2XMAA 3R9LA 2AGOA 1S0NA 5HLFA 4DR2F 5C42B 3W64A 2YXLA 3CDBA 3IR6B 1FNOA 3OFGA 1J5OB 2IJNA 2B43A 4YHHF 2DH8A 4V19X 1FD2A 2ZNYA 2D74B 2VBWA 1JQGA 3DLGB 2MZTA 3HHEA 3B78A 3W2WA 2OLWA 3ZZUA 2CNKB 5CD4H 3UDVA 4C0HA 1FRXA 4ED1A 2CQ4A 1N0VC 1S1WA 1UVJA 4WE1A 2YNFB 2HQDA 2CPJA 2KL8A 3HULA 3KJNB 3NGTA 2IAJA 5HI7A 4YR2A 1PYOB 3J7YI 4MYUA 2Z58B 1L5UA 1GTHA 4ICLA 2BW7A 4J9UE 1N88A 4LF5J 2W7OA 3IG1A 4ZVFA 2VC0A 3N0VA 4JUZA 3QRRA 4A8SA 3H98A 5B0GA 4BC9A 3MMAB 3QGPA 2K7JA 4FPIA 3L9ZA 1T9TA 5DQGA 2W9BA 3FEXB 3AB4B 4H4OB 3DLKB 3J7AN 5FIIA 2D9OA 4OYAA 2B8QA 1KRPA 3UN5A 3OVAA 3EZOA 2A2CA 4F50A 1U6BA 3BSCA 2DHGA 2NXJA 4B3RJ 3HSJA 2BX6A 3Q22A 3M30A 4LRAA 3VVTA 3K0JA 1PJ5A 5D4LA 2M4MA 1TL7A 3X3UA 2GHVC 1NEEA 1M5SA 2B5JB 2YTCA 4U7CA 2VA3A 2J0QD 4U96A 3E01A 2ZDOA 1CC7A 4JV1A 4DPTA 4O3SA 4K4VA 4MH8A 1S1VB 1W2IA 3OLAA 1U1RA 3THVA 3PRVA 2EG1A 3U1MA 1DARA 2UVUA 4F4AA 3HVTB 2BM0A 5CD4A 1WDTA 3PEHA 3CO0P 2FVPA 2HPUA 2DD8S 4ECUA 3PW0A 2XCPA 2F8HA 3EX7B 5F0UA 3KK1A 4NMLA 1WC0A 2J8SA 2F5GA 4WCEQ 2GO8A 3BKUA 2R8HA 4C3LA 1RE1B 4BC7A 3FSIA 2CG4A 1FWLA 2FZKB 2W1BA 3MPWA 4WFBQ 4OI0A 1FE0A 3IR5B 1FJGJ 4C48A 2X1GA 3HZGA 4QYZJ 2CQCA 1VQOS 4KHMA 3H90A 4NZ7A 3W7BA 1A7GE 1NU4A 3DRRA 3WQPA 2QGFB 3GIRA 3U1NA 2JJ4D 3GG1A 4LF4J 3MM9B 4KQZA 1UW4A 1AUDA 2GJIA 4DR4J 2EW9A 4B9NA 1HIYA 1HI8A 4GKJJ 1T95A 2X1BA 2AJFE 4CIOA 1U1LA 1ITPA 1B0TA 3AJDA 1KR4A 5LSRA 2F4VF 5E0OA 4X66J 4ZVHA 4LQ3A 3EMTA 4LFBJ 1XBWA 5EUHA 4EGLA 1WG1A 3TUJC 3M6UA 5E41A 2IY5B 4LF9F 4UTGA 2F8EX 4PWDA 5DJBA 4HKQA 4NLSA 2X7IA 5DS7A 4F2RA 1HNZJ 3HX9A 1U1PA 4BWJA 1F9FA 4NX9A 1TAUA 2NLWA 4PYAA 2Z30B 4OI4A 3BF4A 3DN9A 3LQVA 4ECYA 3UI3A 3NS6A 4M8LA 2Q66A 2YWKA 1R8HA 5DGAA 2CPFA 3BBBA 3KXDA 4XPCA 2UXDJ 5LL6d 2WRMA 3Q0AA 4QCLA 2RIJA 3MEGA 3MHYA 3TAQA 1QVFR 2ZVIA 3K5LA 3OFEA 1QE1A 1KN6A 4O3PA 4JI4J 5I3QA 5IT9Y 1UVKA 2RHQB 4X4UA 3SXLA 3K59A 1WI8A 4CH0S 4DR5F 1FX4A 4PABA 2BJ3A 2NXCA 4WJBA 4ZPBA 3OVSA 1TKXA 3MM6A 1C2PA 3O2IA 4F0KA 2E5HA 3BBCA 4M5HA 1TK0A 1BHNA 2R8IA 1V6HA 1Z2LA 3DU5A 2C1EB 2AYEA 1TL1A 5IFMA 4O4GA 4DR1F 1FEHA 3D7SB 2LU2A 3T1HJ 1DQ9A 2A1BA 1H73A 3MPVA 3US5A 2OI2A 1Y5NB 5IS2A 4ANDA 2HMIA 1ZS6A 4LR7A 1TKZA 4L3NA 1V3ZA 1JX4A 3NRBA 5I42A 4DV4F 5EGYA 1NK0A 5JMNA 4HTJA 1UP1A 2LQJA 4USUA 1RTJB 3JTNA 4ED5A 4U7UK 2WTFA 2L9NA 3CCZA 5JXSA 1UFWA 2WVEA 3PYFA 4OI1A 1DTQB 1HFEL 3QRQA 2UXBJ 2YKMA 3IWLA 3CJKA 4EBDA 3B6BA 2W2NP 4OZ3A 4DSFA 3MR7A 1ZA2B 1TZ0A 4GKKJ 4OYZA 1TU0B 3CEDA 1Z2ZA 3BZQA 1RZMA 3QIPA 3OUYA 2V68A 2I38A 3NOCA 2MKKA 3OJUA 5JJBA 1EJ7L 2KG0A 4UOHA 1U24A 2L41A 4XO0A 3K5OA 2B9YA 3FRYA 4P9SA 3TVZA 1MWZA 3D0IE 5DDOC 1WELA 4DEZA 2P8IA 4DG1A 4RZRA 2JFDA 2VG6A 1S1WB 4TLQA 4F26A 4J9PA 4V19J 4UOFA 3SQOP 1RGVA 5CZVA 1RAIB 4MIAA 4DV2J 2XI2A 4RLEA 2H9ZA 1D9FA 3C66A 3MEEB 4FVCA 3W9IA 4B08A 5D3GA 4HACA 5E33A 3SCJE 2LXIA 4Y28C 3GB0A 2MHNA 1UVLA 3N5BA 2WVCA 2W9BB 4ZLLA 1FKAF 1RTDA 1YQHA 4BS2A 4YR3A 2DR9A 1IXKA 1IKWA 3MGJA 1OPIA 4OX8A 1X5PA 4M5NA 1GT8A 1ACMB 2CZ9A 1HD1A 2CDQA 3LALA 4CWBA 1GAOA 3FCVA 2E5LJ 3RTVA 4IH5A 4DR6J 3VGSA 3PY8A 5CAAA 3OTOJ 1MSWD 1KFSA 4NXMJ 3E01B 4ENOA 2ZH5A 2KM8B 3W9JA 3OW2R 3RAMA 2KFYA 4DL5A 4H4KA 2EXUA 3NLCA 4QQBA 4LRBA 4KFBA 3G82A 1DFDA 3NGKA 3FMWA 1NJYA 1U49A 4UZCA 4U9RA 2CIMA 2N4DA 3IMQJ 4XDDA 5IWAF 3BREA 4DOZA 2XTJP 4XPEA 4FYVB 1NKEA 4B9TA 1T3OA 2IJRA 5C25A 5MLCV 1BMQB 4IR9A 3D4JA 3KNAA 3PACA 5LXRA 2IJFA 2HVIA 2DEJA 1ZH5A 2DY1A 1IKYB 3CSKA 3DRRB 4WTYA 5J1EA 3MUTP 1KLMB 2W01A 3D6TB 4OJGA 5U47A 3CW2C 3SQGB 2CJ9A 1M1HA 4RX6A 4G6VB 4FF3A 1KQKA 4TQSA 3A8IA 3NBPA 2AWZA 1V5VA 1X4AA 1SKRA 4DV6J 3GONA 5E3CA 3RBEA 5KOXA 3ZZOA 3PVXA 5DDRC 3R6GB 3BJYA 3K57A 3DDIA 4IH6A 2YBVA 4KJIA 5IV3A 1SIWB 2DNZA 4OI6A 1OY6A 2FVSA 5J2PB 1RA7A 1NBEB 3PFEA 4P52A 3BSOA 2HK2A 1F9EB 2B9XA 1HBUA 4X64F 5L39A 1S10A 1ZM4A 4B3MF 1EB0A 4TYBA 5AE3A 4CLZA 2P5VA 4WK1A 2VHGA 3FUYA 5J2NB 5M2RA 1Q8BA 2JLEA 2ZBCA 3P45B 4ZA1A 4K2XA 5D8HB 1IBMF 1TMJA 4NASA 3MAHA 2DXFA 4DUZF 3OT9A 5ETOA 3T6JA 4NE9C 2PGCA 2DNGA 2C22A 4KKOA 3TOQA 2Y1RI 2FC9A 4LSLB 1L3TA 1KQGB 1AT1B 3CPWR 2VDIA 1S7HA 1RADB 4ZVQB 4I56A 3KNGA 4P7VA 1SL0A 1NSAA 2OGUA 4X4RA 5GAHI 2WZ1A 3PIPQ 2CQIA 3EVOA 2RF2B 1TKZB 3KWMA 3GQCA 2M7SA 2BE9B 3DLJA 4C6AA 2HNZB 2PFFB 2VQFF 2J7WA 1FNMA 1IKVA 1YJRA 3ZZPA 1NUEA 1WF0A 2DNOA 4C8NA 3SDEA 5DQIA 3TAMB 4DPUA 1X4DA 4Q8FA 3BQ0A 3UO0A 1OY8A 2HNYA 1RAEB 2MKYA 1VQMS 4B9LA 3K58A 5H9EK 2MQNA 3N6NA 1KQSR 4O3OA 3PHEA 2VC1A 3TVKA 2KT5A 2CDRB 1T03B 2IRUA 5C2CA 2IC3B 4DUYJ 1FXLA 5F8HA 2DNKA 2M8HA 4ZP7A 3CCES 4DSEA 2BJ1A 4DG1B 2H5JB 2VG6B 1RK8A 3IS9B 1JMTA 1VMBA 1NPPA 2OSQA 2R7UA 4MYTA 3I82A 2IA0A 3W66A 1X4BA 3D68A 5HMWA 2EBEA 3QO9B 1HWLA 2AJ1A 1DURA 3CCUS 1P6TA 2YWWA 1VBKA 3DDKA 1WOOA 3EDRB 1QLNA 3AOCA 2FJAB 3VAFA 7FD1A 4WKYA 4L74A 1HNWJ 4DFPA 4QIEA 4ECVA 1HNIB 1S1UA 3Q2TC 1FWPA 2YX7A 4K0KJ 1VK8A 3NNCA 1RAGB 4WP8A 3T5LA 4I7FA 1WKJA 3EYZA 5T7LA 4Y2CA 4UY85 3D67A 3AH6A 4KB7A 4OV1A 3TUZC 4IDKA 4WTOB 5J1PA 2HQGA 1RKIA 2OHDA 6AT1B 2HHVA 3ONQA 3FJ2A 2FJXA 1H7WA 1IR1A 4ETZA 3I4PA 4RNOA 3H25A 1XC9A 4OX6A 1XR6A 2ILZA 1WEXA 3LAMA 2B0GA 5DO2A 1X0FA 1S77D 2HHWA 4ALZA 1UFLA 4EYIB 2O01C 5A6WA 5AXNA 3JSMA 3EWGA 3M9NB 4KFBB 3AD7C 1HQ2A 5HVFA 1MG7A 2OFGX 4ZS6A 3I9ZA 2P6TA 4L76A 5L1JA 1FVSA 5ADZA 2HIYA 5K9FA 2DH9A 2XYPB 1OYEA 2C2OB 4QWAA 2IM3A 1YJWS 4F0MA 3N4WA 1YKWA 2RDJA 2P2CB 3DRXA 3V5RA 2COLA 5KFPA 5CCMA 4JI1F 1UZHA 2ZITA 4KO0A 3R6LB 4DV5J 2LLZA 3GSDA 3I5BA 3H5UA 2Y1IA 1RHRB 2HS0A 1U7LA 4WYLA 1WWHA 4A47A 1WF1A 4OHXA 3BGLA 1N5YB 4MJKA 2DRAA 4DCPB 1RAJA 3IR7B 5DLFA 3BO2A 3NBPB 4WWSA 5ETLA 3NAHA 1EAYC 3ILIA 1QUPA 5KFXA 4BBYA 4OZ0A 2OD4A 5IXUA 3OHAA 4QW9A 1D9AA 1KWMA 3UD3P 1YVFA 4USKA 2WONA 2MXYA 3I6PA 4FDFA 1F6TA 4ZJOA 2VG5A 2BRLA 2QV6A 3NY0A 3U1LA 5HMXA 1UW9A 2QA1A 3I87A 3HD1A 2GMJA 1FO1A 5RUBA 2C2KB 2RQMA 4RW4B 3M2RA 4YB6A 1WKKA 4QR2A 1LV5A 2YH0A 1OQ6A 1H3DA 1M5OC 1HBUB 3MMBA 2H54B 5AJ3J 3JSYA 3KG0A 1UWBB 1RP5A 5GADI 3OQ2A 1S5ZA 2FPHX 2HSEB 1U4BA 3PW4A 4PPZA 3MI7X 3EVWA 1PJ7A 3TQEA 4JI5J 2UVRA 3LW5C 4P74A 2DY9A 3JQMA 3TX8A 2J8AA 5AE1A 1UJ5A 3HJFA 3F44A 4NLDA 4OV6A 4C2MA 3SFGA 3S01A 4OLPA 3HKWA 1S9GB 3KK2A 2VD3A 3T1YF 1HQEA 4P2SA 3DXBA 2ZZTA 3W2VB 4NL5A 2KTQA 3GJRB 4JI8J 1NHVA 3B54A 1Z4UA 5D0RA 4LFCF 3KYLA 4MK9A 4LF5F 1X5OA 3IBCB 5F8MA 3DU6A 1JJCB 3EPIA 1K8AT 4DV0J 1IKVB 3QGHA 1XR5A 2AJ2A 1VISA 2K7KA 2DR8A 4PXEA 3QJPA 3HHLD 2QSWA 3UVJB 1OJ4A 1V5IB 3CC7S 4UZBA 1RT7B 4N76A 1YGYA 2B9WA 4R0JA 4NEZA 1T8EA 1SJFA 4EBCA 4B3RF 2XMWA 4M5DB 4K4TA 3ZFVA 2G2OA 1NKBA 5CXTA 5A76A 2PSZA 1SJ1A 4DV1J 3VHQA 2Y8WA 2M8DB 2RJZA 3U02A 1V3SA 1OSDA 4DR3J 1MWQA 2KKHA 3RB6A 1IN0A 2D3OR 1HBOA 4ZPVR 5C5JA 1RTHB 5D0GA 4WU3A 2BR0A 2O5DA 3NMRA 3QJJA 1UWAA 2QL5B 3CMAS 2MLYA 1LWCA 3F56A 1N32F 2PN6A 3FVYA 4L72B 2KG1A 1RYSA 3PTWA 1HR0F 2ATCB 4AL6A 1BWEA 2DHXA 3FBEA 5T7LB 2E66A 2P9EA 3CCMS 4EK2A 3IGVA 1GMWD 1NH7A 2V0NA 4O44A 3EZUA 2R8JA 1QAXA 4K4SA 1LWFB 4LF4F 2V2ZA 4WYWA 2WVBA 1KQFB 3NOGA 1LOUA 4P71A 5ETKA 5HP1A 2JX2A 4GKJF 4HVZA 2LCWA 2ZKTA 4R25A 2DR7A 4J9LA 2OMOA 4RBUA 4X66F 2PA8D 5DQHA 4LF8F 1HNXJ 3M8PA 1UEVA 5KFFA 1RLCL 2DITA 4C11A 3FFIA 4J9RA 1EKRA 2HWIA 3PJXA 4CLSA 3TZZA 5FJ4A 2GJFA 1BQXA 4NLGA 3BV8A 4OLOA 1MW7A 4I67A 1B3TA 2GVZB 4KPCA 1JLQB 4RBTA 2W4DA 1ZPWX 2QE5A 2XS5A 1F2HA 2YKAA 3A12A 3KLHA 2CJYB 2O66A 3CMQA 1D8YA 3MOZA 4K4UA 2UXDF 1SC3B 3MM8A 1CULA 3GYXB 1FCAA 2RUGA 6FDRA 1M5PC 4Q0BA 3CDAA 1JLGA 1NXIA 4DR2J 3W3SA 2X1AA 4ZJLA 1PG5B 2OD6A 1SH2A 3MPUB 1AXQA 3ZZZA 4YB7A 3FBBA 1E6YA 2ZBIA 1FFWB 1N34F 5IV4A 5KFIA 3CNQP 5IC4B 2CQ2A 1HWKA 1TL5A 5C2GA 2R7WA 2D1CA 1CG2A 3O1LA 2M0GB 4LMZA 3MWBA 3AA8A 1BD6A 4W92B 4IR1A 1YBUA 2WONB 3I0SB 2ZHBA 4U67Q 3T9ZA 4MKVA 3K89A 3V6JA 3PNIA 4I2QA 5KG1A 3ADAC 5LMUJ 1Q4RA 1HBMA 2VBYA 3IM9A 1HQUB 2QO3A 3NS7B 1LW2A 1RYRA 4KAIA 3OTEA 2JLGA 1Y3JA 2EFPA 1X0PA 5IQQA 4ETXA 2CXEA 3S8SA 2LFVA 4NZ6A 2R9LA 4WK3A 4J90A 2IBKA 5KFJA 4GKKF 3ZTRA 2AIRB 3SMZA 4F04B 1WC5A 3I4HX 1KOHA 1K1SA 3DI6A 3IRXB 5ETMA 3RB0A 4DDFA 3VGUA 1KBRA 4URSA 2MMYA 1AB8A 1VJWA 1NK7A 5ETVA 1NPRA 2VF3A 1FRLA 2RB7A 5K8PA 4WPAA 1HQEB 1R8CA 2DNMA 3NGUA 4TU9A 1PKUA 3BR8A 1ZBTA 3POTB 4QWDA 1XMOJ 1T05A 4TY8B 2VOPA 1I94J 5L46A 1AZSA 1H38A 1WG5A 1KONA 2N4CA 1S6UA 2IDLA 2DNPA 2GIFA 2FD2A 2FVCA 2B6AB 4U6PA 1JNZB 2VODA 4JI7J 3KDOA 4FXWA 4PRFA 3GFXA 2GQ2A 4HL9A 4ER8A 2L48A 4GVBA 1OPZA 5H9FK 5A2QY 2ZWOA 1S57A 4CO5A 3DRSA 1WUUA 2GNKA 1U6FA 4RW7A 3OR2A 4YP3A 5EHHA 1VQPS 5HVGA 2E5LF 3D6HB 3JQKA 2HYIB 1K9MT 4PYDA 2KI2A 2RNEA 1L3UA 3ISNC 4DR6F 1VC0A 3KHHA 2OPQB 1SQEA 4ECQA 5DRKA 2QRRA 4F0HA 1OYDA 1FESA 2HNDB 4ELVA 2J6UA 2XO6A 4M5JA 5LSLA 4V1Ak 1ZOTA 1NO8A 1PSDA 5MAOA 2V6AA 3OPKA 5AXKA 2F9DA 3J80U 2HZVA 4RW8B 1HW9A 3GZ7A 3PJ9A 4KTQA 4NA1A 3R1LA 1RT6A 1KDNA 4YQWA 4XAKA 2K1RB 4CLWA 4HHUA 2MY7A 1TUWA 1RWKB 3IM8A 2DBBA 2GGPB 2L9DA 4Z7YA 2XMKA 4ED3A 1FDNA 4WXOA 2UUAF 4A8XA 3FZ2A 2LXFA 3RRKA 2YX4A 4ZIWA 2HGMA 2YX1A 3DRPA 4TY9A 1QY7A 1S9FA 2HQ3A 3VGTA 1FVQA 3HFVA 2R8KA 4IO9Q 4FYXB 4LRFA 2HHHF 5HP1B 1WD6A 2DB1A 4F3OA 4LUBA 1G3OA 4QWCA 5GAHU 2GAHC 3M8PB 2VFRA 2MYFA 1EETA 1TV6B 2J5AA 4FVMA 3M7VA 2DJWA 1H7XA 4DFKA 2R7RA 2AZ1A 2K3KA 4EFAC 4IG3A 1NCLA 4ZIVA 5T14A 4MKYA 4NYZA 3HCXA 4ZKAA 3PV8A 1EKSA 4NZ0A 4WXWA 4DS5A 5KG3A 3FEYB 3KLFB 2VJVA 2GV1A 3CCQS 1EQMA 3DMJA 4TNOA 3MM8B 3OTCA 2R4FA 1FERA 1H2UX 4B3OB 1CULB 2HBRB 4JB8B 5E2QA 3NL0A 1CS4B 3CD7A 4PQUA 3BQ1A 4OMFG 3Q8SB 1F3FA 1VRUA 4OZJA 2AX0A 4ILMA 1PILA 1QAYA 1TQLA 3HFZB 3HF5A 1E6YB 2O67A 4E8UA 3K8WA 2ERRA 2MPUA 2QMWA 4ZPCA 5CYJA 1SKSA 1FRKA 2E5JA 1B7YB 3MAQA 8RUCA 2YNIA 3TJ9A 1VYAA 5KFUA 3HPOA 1TK5A 1KOOA 1C4CA 4I2QB 1A9NB 1S1XA 3H2UB 4J9KA 3SI8A 1TFWA 4LT6A 2OEKA 5DZ7A 3TZYA 4ZDNA 5GVQA 3DC2A 2MJNA 2OPSB 1RACB 3MTJA 2ZZMA 5KFHA 3MCMA 2ZUGA 2H65B 2Z2ZA 4QZVB 1N36J 4NRUA 4O0NA 3ELHA 4DSKA 2CJXB 4AXIA 2BE2A 2BRKA 2ZBPA 4FF2A 4YN3B 4OYBA 2XWYA 3VZHA 5HANA 4B9UA 2FY8A 3DM2B 5K14A 2CWKA 5SZTA 4HHHA 3AY0A 2WHOA 5DDQC 2ZM6J 4ID8A 4ATNA 4DUYF 1RHKB 4UQGA 4H4MB 2HZAA 2MHEA 4FYWB 2HHQA 4NYOA 3LGNA 1ZTWA 3R8YA 4I69A 1YDLA 3FEZA 4MK8A 2MSSA 1WHXA 3PKMA 3OSNA 4PXDA 4ANEA 1HYSA 2W2PP 2JVOA 1VBXA 1AZSB 4FBTA 1TK8A 4HLBA 3G2XA 1RT1B 4J9MA 3RYLA 4WKRA 5IWAJ 3T1AA 2XZWA 1HNWF 1K44A 3I0RB 1HLWA 3BEGB 4DN0A 2DR6A 4K0KF 4KV8B 1O51A 1RT3A 4KH1B 4JI0J 3AFGA 2BJ8A 3AOBA 1FKPB 4OJ1A 4C0BA 2VU5A 2QL9B 4Q43A 2E5IA 2ROEA 5J2MB 4M63A 3DRSB 1IKXA 4E2FB 3VQSA 2HWHA 3ITHA 4FXVA 1CJVB 1DTTA 4HH0A 2XGPA 1U8WA 2Z4PA 1DBDA 3SV4A 3CCWA 5KG0A 1TL3A 1T3NA 2GMHA 3BYRA 4X62J 3ETOA 4ZHRA 1NPKA 4CLFA 3RU0A 4DJBA 1Y5IB 1RHUB 2FLPA 2WW8A 1N6QA 3Q8VA 5CYQB 2HURA 2XG8A 2K8GA 3D9BA 2EWHA 1BQMA 1FTRA 5ETSA 2FHMA 4CRJA 3C6UA 2NXNA 2JOQA 4C8KA 1F5CA 2H5IB 3GJTB 4OI2A 4ED0A 1YJ9S 1R0AB 1ROFA 3BSNA 1VQLS 3R1HA 4Z2XA 3EXCX 5GADU 2CPYA 2V50A 2BBEA 2PO4A 5AT1B 3JAMY 1XERA 2OJ3A 2J0XA 1QD1A 2M3DA 4FNIA 1MN7A 1RWNB 5KFVA 4X64J 2DGSA 3G96A 2FYXA 1SUQA 2CPXA 1ICEB 2CNLB 4ZVEA 1ZPVA 3QGIA 1SQGA 1VQ5S 2CQHA 3GYGA 2J7UA 1NZ8A 2E1PA 1DRZA 3KLIB 4LSNA 2C2MB 3DLGA 3GCXP 1FRJA 2HK3A 4OFZA 2HAFA 1NJZA 4HEA9 1EETB 3NGDA 4GO7X 4RNHA 3JSBA 2L9WA 3EUNA 3VAGA 2BKOA 3TA0A 2C2RA 2YNFA 2RT3A 1IQTA 1H2TZ 2W4PA 1NM2A 4NLYA 1AYEA 3LF0A 3IWXA 3G9CA 4NXNJ 3TJ8A 4DCJB 1Q7LB 3Q23A 2XZTB 2R7TA 3TUIC 3IN5A 2VQFJ 5AJ3F 2WSCC 3GP9A 1GXTA 2W4CA 4PQUB 2CPIA 4AYBD 3QT8A 4U8VA 4RW9B 4ANCA 4H4OA 3V81B 1VRUB 1FHTA 1RWOB 2PFDA 1Q82T 4JI5F 3QT7A 2HFUA 4KPYA 3CJSA 2MQQA 2ABYA 3GV8B 5DM7Q 3W5XA 4GC7A 5ITHA 3BKFA 1J2VA 5D4NA 3BKTA 3GJSB 4WBFA 3I31A 3C16B 1VQYA 2NZCA 2N7YA 3W5YA 4K4XA 3R2CJ 2VUGA 2CPHA 3WDOA 2JEJA 2BA9A 2XMJA 1WC3A 2FLNA 1TUVA 2EK1A 5K5MA 4JI8F 1RAFB 1M0SA 4BDPA 2HQFA 4IO1A 2CPEA 2UUCJ 4CO3A 3RBXA 4MAKA 3A1YG 3HVTA 3AQPA 4TU7A 4KT0C 1BC6A 2X3GA 1U47A 1T94A 2VA2A 4ZP6A 4M5IA 2NXUA 2BE2B 5KG2A 1R7IA 2QLJB 4AL7A 2CPZA 3LAKA 3N6LA 3H4BA 3LA0A 4NYPA 5K8OA 4WZMA 1N5SA 3R5CA 2JEIA 2EBGA 1K1QA 3NCPA 3MAAA 5F9LA 4A8WA 3ET6A 4DX8H 4J5OA 2HRYA 3ZZTA 4Q2MA 4K4ZA 4GVLA 3MEDB 1FK9B 3GJQB 2RS8A 2QSFA 2BKPA 1R8BA 2HQIA 1MMLA 4I2PB 5EN1A 4NWBA 2CPDA 4DR3F 3C46A 1X60A 2IM0A 9RUBA 4P2MA 3DDNA 4N47A 1HYSB 4U7UD 1R6VA 2G2ZA 3A8KA 3AD9C 1NJWA 2XS7A 2DNLA 2Q1LA 2RKIB 2MGZA 5KOWA 3CJQA 4ES2A 4ZVTB 5B0CA 1RTZA 3D28A 1X7VA 1R0CB 3TA2A 2N7CA 3IO1A 1XTZA 1RT3B 3UNGC 1UVNA 1WORA 1ZZFA 4UOGA 2IMOA 2FLLA 3MMJA 2DXDA 1TKDA 4NA3A 1GFWB 4FYDA 4I0WA 1TVRB 3M4XA 3QZ8A 3AB2B 4UUWA 3FK4A 4JI1J 4A8YA 1S4EA 1WSRA 3CULA 4RO0A 4KSEB 3PW7A 2VASA 4RNNA 5F41A 1SCJB 1TL3B 4I4BA 4B3SJ 3R27A 4OHVA 4ZHRB 1WEZA 4Q7AA 2RQ4A 4FPRA 1P1TA 2W2MP 1N6QB 2AV5A 1RXOB 4Y3CA 1OWXA 2YQ3A 2RRBA 3DGPB 2G0CA 1U48A 3AQOA 2KYXA 1UJ4A 1HNXF 5CH7B 5GAEI 5DGBA 3OXFA 2V2VA 2ZH1A 2MEWA 4F3QA 4M5KA 7FDRA 1KVJA 1NK4A 3Q8RB 3R2DJ 1T11A 2E9TA 2DGOA 4PQAA 1OIAA 2MLXA 3GWCA 4X84A 1GNKA 2V9KA 2XMUA 1GH8A 1X4HA 2R7XA 1X9WA 4DQIA 4OI3A 2EC0A 4OZNA 3QAUA 1RJJA 1RTJA 1HARA 2ROPA 3KG4A 2V63A 2CADA 1DTQA 1R8PA 4S0MA 2EEYA 4PG8A 3O44A 4C8ZA 1SUQB 2MQLA 2F65A 5D4PA 3PX4A 3OXGA 2WBRA 5D15A 3H0PA 1RBOB 1YG0A 2VPWB 1IR0A 1RLDA 2MJUA 2Q43A 3CD0A 2Z0GA 4NCGB 3TWZA 1F5AA 5E7OB 4Z37A 1AW0A 1URRA 4RW6A 4LSNB 2IHR1 4ECWA 5DETA 2MQ8A 3CIZA 3QGGA 2NS1B 4PWWA 1GTEA 3DHXA 2C3OA 4OX9F 2R42A 3E8OA 1QUVA 3HHLA 4KGVB 3EGZA 3FCWA 3N01A 3CJ4A 2BV3A 4CLTA 2V4JB 3HM9A 2RILA 3MZIA 1Y5LB 1S97A 3T1YJ 2PMZD 1RTIB 1NJIT 2H5EA 4HH1A 3NNHA 5LMUF 4KYZA 1G1XA 4IQMA 3OR1A 1QAJA 2V8GA 5KFRA 4LFCJ 2KXHA 3LPEA 3A8EA 3OV7A 5CHCB 2VQEJ 3MEEA 1OSCA 1S12A 4M5GA 4F25A 5B09A 5IM0B 3K5PA 4WIQA 1ZAWA 3W63A 3CUNA 2AGPA 2CQ1A 1SJQA 4NCBA 5A8KA 2CQDA 1UA0A 4I64A 4KRWA 2HQCA 4ZVGA 1TL4A 3P8BB 2AHOB 4ZN1A 1K0VA 3HT3A 4DQSA 2HEKA 4DI6A 2A6MA 4PPDA 2Q6CA 2BQUA 3HSDA 1UPMB 1NB7A 2LP4A 1MU2B 4DFMA 4A8OA 1S0VA 3PR5B 4W90B 4C98A 5FDLB 2J6SA 3I32A 1WTFA 4ZPDA 2KU7A 1X4CA 1X5TA 3RG6A 1YHQS 1XMOF 1RT5A 4Y2IA 2LVWA 2W2QP 3Q8YA 1QSSA 3BH7B 1I94F 4CNZA 3ZTOA 2C3MA 4HI2A 2HBZB 1LK5A 2J0WA 3AJ2A 2NPIA 2ZEJA 2D3ZA 1CJKB 2RAQA 1LNQA 1N5VA 4JI7F 4RU9A 4B9SA 3THPA 1N32J 5DDPC 1JNRB 5B08A 3BM7A 1HR0J 1R31A 4Y2MA 5LJ3Y 4IRCA 2DPIA 3IGNA 1G2EA 2CWXA 1K0TA 1VK3A 3ILLA 2BJ7A 2C2EA 3MAAB 2QLWA 3U27A 2E1CA 4HDGA 5E3AA 3ET6B 2BYCA 1VBYA 4IG0A 1LWEB 1IKYA 2DGVA 3VALA 2IIHA 3MMCB 4Q2LA 1KLMA 3BGUA 1KNZA 2V8PA 3HSZA 5SUHA 4URGA 3SQGA 2HRUA 4K59A 4X4PA 3NCRA 1QSLA 2D3UA 5KT4A 2FLOA 3ZXWA 3MEKA 2B4VA 4CI0B 1ZM3A 4LF8J 1WACA 5KG5A 4CLKA 3DGVA 4Q44A 2OSRA 2MGZB 1TMMA 3ZTPA 2IFXA 2QMUB 5E5NA 1HHTP 1H2VZ 3RR8A 1FFSB 3MFHA 5KG4A 5J2PA 2XEXA 1GXUA 2JH3A 1CQMA 5ETTA 3ZO7A 1I5OB 2OP5A 2W25A 1XIQA 4PG5A 3KMQA 2IVMA 5F8IA 4M94A 1WOSA 3R7BB 1SBRA 2CG8A 2ZZNA 2HHUA 1PIEA 5J2NA 3UFCX 1RCOB 4DF8A 5T41A 1WNEA 4RNMA 2QL7B 2RMLA 3I56S 1NDLA 3JXOA 4DSJA 3GLJA 2ZDPA 3GR0A 3SCKE 4PG7A 5A8WB 3G8TA 4KHRA 1H6KX 1C0UA 2ZBQA 1T9VA 1N34J 2G2YA 1ZYQA 2IM1A 3CD6S 2KYZA 4ZPTR 1IM4A 4LSLA 5JVGQ 2XLJA 3D0GE 2CKWA 2FJWA 3VCDA 2CJBA 4RPFA 2Z56B 5AXMA 2HVZA 5LOQA 4AXJA 1IBLJ 2KHDA 3NMAA 2RF2A 3PZPA 3CO9A 3T5JA 2HNZA 3F0NA 4B02A 1OY9A 1R3NA 4PZVA 4LBIA 2VZ9A 3A13A 4C8OA 3C14A 4OZ5A 2X1FA 3J7A1 3UR0A 1ZAVA 4NI2B 4QR0A 3LP1A 3R5DA 5KFZA 2XULA 2XLIA 1HI1A 3TAMA 4CO4A 1A0OB 3M9MB 1XNRJ 2M2BA 2DO4A 2V4RA 1HWJA 3DLHA 3PW2A 4RW6B 2DIUA 2GVDA 2V67A 1LK7A 2DXEA 1RHJB 1T03A 3P49B 5ETRA 2IC3A 3FCHA 2B7CB 1SJ3P 5BYRA 4R5PB 1VS3A 2CA9A 3FSYA 2CQ3A 3CJ3A 3JYTB 3HHLB 2VV5A 1F0XA 4PCQA 3F41A 3IS9A 1QTMA 1YWXA 3TUPA 3QLHA 3Q24A 4TKTA 2J0SD 2CNNB 1X5SA 3KJVB 4ECSA 2R3VA 2R7QA 1A6LA 2BOPA 3EGWB 3AAWB 2BEFA 3QO9A 1JKHB 1XJWB 3OR1B 1Q86T 1EQ0A 1N52B 3RAQA 3CCVS 3V2UC 3EM1A 4O0IA 5LT5A 4JI6F 1QJHA 1FF2A 1QVGR 4R8UB 4M5LA 1HNIA 1N36F 3TA1A 1FFGB 1M5VC 1YJUA 4NPOA 5F0WA 1JLFB 3CJ2A 5A8KB 4D3GA 4F02A 1H74A 2CQGA 4IQXA 2YVSA 1PGZA 2G9OA 5JVHQ 4XK8C 4OYXA 5KFYA 4KHPJ 4DL7A 2E5GA 1Y10A 3UNYA 2ZM6F 4TLRA 2YWGA 3GG0A 1Y0HA 3DXSX
chains in the Genus database with same CATH topology
1RWMB 3EDRB 2XZTB 2QL9B 4ZVTB 3D6HB 2H4WB 5IC4B 2H48B 1RWPB 1F9EB 3GJRB 2C2KB 1RWNB 1IBCB 2CNKB 1RWWB 2FQQB 2HBZB 3P4UB 2QLJB 3R7SB 2XYPB 1ICEB 2QL5B 1I3OB 3IBCB 2C2OB 1GFWB 1RHKB 3KJNB 2CNNB 2H4YB 3P45B 2CNLB 4ZVPB 1PYOB 3QNWB 2XYHB 2P2CB 2H54B 3RJMB 1RWOB 3KJFB 1PAUB 2Y0BB 4ZVRB 4ZVSB 1SC4B 1RHUB 3R6LB 1RWXB 2HBYB 2C1EB 2C2ZB 2CDRB 5K20B 5IC6B 2HBQB 2XZDB 1QTNB 3NS7B 2DKOB 1SC1B 2C2MB 3GJSB 3IBFB 1RHRB 2CJYB 3GJQB 4LSZB 1NMEB 2H5JB 1RHQB 1SC3B 2XYGB 3SIPB 3R7BB 4DCOB 3R5JB 4DCPB 2CNOB 2H51B 4ZVOB 1RWKB 3R6GB 4ZVQB 3D6MB 1RE1B 2H5IB 3GJTB 1RHMB 3KJQB 2QL7B 2QLFB 2H65B 3D6FB 1I51B 1QDUB 1RWVB 3R7NB 2HBRB 3EDQB 4JB8B 2QLBB 2CJXB 1RHJB 4ZVUB 2Y1LB 4DCJB 1BMQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWM B;  3EDR B;  2XZT B;  2QL9 B;  4ZVT B;  3D6H B;  2H4W B;  5IC4 B;  2H48 B;  1RWP B;  1F9E B;  3GJR B;  2C2K B;  1RWN B;  1IBC B;  2CNK B;  1RWW B;  2FQQ B;  2HBZ B;  3P4U B;  2QLJ B;  3R7S B;  2XYP B;  1ICE B;  2QL5 B;  1I3O B;  3IBC B;  2C2O B;  1GFW B;  1RHK B;  3KJN B;  2CNN B;  2H4Y B;  3P45 B;  2CNL B;  4ZVP B;  1PYO B;  3QNW B;  2XYH B;  2P2C B;  2H54 B;  3RJM B;  1RWO B;  3KJF B;  1PAU B;  2Y0B B;  4ZVR B;  4ZVS B;  1SC4 B;  1RHU B;  3R6L B;  1RWX B;  2HBY B;  2C1E B;  2C2Z B;  2CDR B;  5K20 B;  5IC6 B;  2HBQ B;  2XZD B;  1QTN B;  3NS7 B;  2DKO B;  1SC1 B;  2C2M B;  3GJS B;  3IBF B;  1RHR B;  2CJY B;  3GJQ B;  4LSZ B;  1NME B;  2H5J B;  1RHQ B;  1SC3 B;  2XYG B;  3SIP B;  3R7B B;  4DCO B;  3R5J B;  4DCP B;  2CNO B;  2H51 B;  4ZVO B;  1RWK B;  3R6G B;  4ZVQ B;  3D6M B;  1RE1 B;  2H5I B;  3GJT B;  1RHM B;  3KJQ B;  2QL7 B;  2QLF B;  2H65 B;  3D6F B;  1I51 B;  1QDU B;  1RWV B;  3R7N B;  2HBR B;  3EDQ B;  4JB8 B;  2QLB B;  2CJX B;  1RHJ B;  4ZVU B;  2Y1L B;  4DCJ B;  1BMQ B; 
#chains in the Genus database with same CATH topology
 2W7P A;  3SSS A;  3U7J A;  4OX7 A;  3ILO A;  2I2Y A;  5G0R B;  4K7Q A;  1FDB A;  1UZD A;  1RWW B;  5J2Q B;  2HW3 A;  4EU0 A;  2Z2Y B;  4Y00 A;  2Q79 A;  3A3O B;  2DHA A;  3GMG A;  1RT5 B;  5IOL A;  4ZVP B;  2I6W A;  2RSQ A;  2HZC A;  3IWN C;  5G4D A;  4K4Y A;  1VC5 A;  2NSB A;  3C3L A;  2MQM A;  2RUS A;  1CBK A;  4DMZ A;  2VJU A;  2A2D A;  4G3I A;  5K8N A;  2VIC A;  3G71 S;  3B8H A;  2FUG 9;  4DV7 J;  2CQP A;  3LGM A;  1U2F A;  2ZJP Q;  4JI0 F;  2B56 A;  3UDE A;  2WAQ D;  4NOH A;  2DIS A;  2YPY A;  2CQ0 A;  1DQA A;  1SV5 A;  4WII A;  1LFP A;  4DR7 F;  4P2F A;  1W2B R;  4B17 A;  2O1P A;  1TKT A;  2XSF A;  1I51 B;  3MR2 A;  4IG0 B;  3UQS A;  2UUA J;  4FF1 A;  1H98 A;  2WSF C;  3NGR A;  1RWU A;  1EZZ B;  2OIH A;  2AZ3 A;  5CQG A;  4X62 F;  1HHQ A;  2I0X A;  1RUS A;  2OEJ A;  5GAG I;  1N5Y A;  2HHH J;  4JV5 J;  1S6Q B;  3P4U B;  3KLV A;  3R7S B;  1XNQ J;  3NGS A;  2DNR A;  2DNY A;  1HD0 A;  2RE1 A;  2I9S A;  2BMB A;  2FGO A;  3TJA A;  5KT5 A;  2ILY A;  2P9C A;  1DLO A;  2FJV A;  1WDD A;  3S1T A;  1RWX B;  3SV3 A;  1WI6 A;  1EIY B;  2VBZ A;  1R89 A;  2C2N A;  3H8Y A;  2W9C B;  2V8H A;  2DCU B;  1JWW A;  3GIJ A;  2EC2 A;  4A46 A;  4ECR A;  4RW4 A;  3LPY A;  1PC4 A;  2RS2 A;  1VQ8 S;  1F60 B;  2XLK A;  2LA4 A;  4OZ1 A;  4WZQ A;  3K2Y A;  2OUG A;  3I55 S;  2N3L A;  2XSJ B;  2KRB A;  1EP4 B;  1RAA B;  4ELT A;  5AXL A;  2OEM A;  3UCU P;  1UWB A;  2G13 A;  4DPW A;  3R7N B;  3FC9 A;  2HFV A;  3G86 A;  4LVO P;  5HRO B;  1FJ7 A;  3DNC A;  5D4O A;  2BJ9 A;  2VBX A;  2Z2L A;  3BR9 A;  5KG7 A;  3SZ2 A;  3QSI A;  2QJ3 A;  3UCG A;  4J9S A;  2SXL A;  4AUK A;  2DRD A;  2QYC A;  2ZD1 A;  1FX2 A;  4CTA B;  1FNX H;  1HPZ B;  1E6V B;  3ZTS A;  4ES1 A;  2YY3 A;  4MKA A;  1C0U B;  2PA3 A;  1RT4 B;  3GPA A;  5KFK A;  2F7V A;  4URQ U;  1ZM2 A;  3BDE A;  2VDH A;  1PJ6 A;  1U1N A;  1Y3K A;  5L1K A;  2ACM A;  5KFD A;  3C19 A;  3PEJ A;  4G1Q A;  2YNG B;  2R2U A;  4DFJ A;  3HVW A;  1S9G A;  2ZOG A;  2HVH A;  2JL9 A;  3SEO A;  4WU2 A;  3NWR A;  3W2V A;  2PMH A;  4J9V A;  3FKB A;  1D8Z A;  4USV A;  4X4T A;  1SXL A;  4NXN F;  1G6B A;  4P7T A;  1CJT B;  1F3V A;  1W7W A;  1IBK J;  3DYA B;  4ILR A;  2QLX A;  4MIB A;  3C14 B;  2ZH7 A;  1SIZ A;  3LP1 B;  1MLA A;  4C8Y A;  2QLB B;  3M8Z A;  3PRD A;  1Y7P A;  3H2L A;  3VAK A;  3CDW A;  1U0H A;  4YB5 A;  2XY5 A;  4Y34 A;  3UVJ A;  5A2Q U;  1REG X;  1RT7 A;  2GVD B;  1F2G A;  2GFF A;  3L4B C;  4M5D A;  2PE8 A;  1JXL A;  5CAB A;  1P8G A;  5KTQ A;  2IDE A;  2XHC A;  5THW A;  2CVI A;  2KM8 C;  1HBN A;  2WW4 A;  5EX3 A;  3DOK A;  4USH A;  2BOA A;  3GYN A;  3C6T B;  2FJE B;  5HJX A;  1U26 A;  4CDI A;  2XMT A;  3QLH B;  1PYS B;  5KFA A;  2U2F A;  4X4N A;  1IVZ A;  1HA1 A;  1NB2 A;  4RUC A;  2F9J A;  2UUC F;  1NME B;  4JI3 J;  5F8L A;  2XYG B;  4DCO B;  1RTH A;  5DM6 Q;  3H5X A;  5D77 A;  1YJN S;  2NQP A;  4K5R A;  1P9Y A;  3T41 A;  2J9D E;  2G0I A;  4Q45 A;  3KG1 A;  3OHB A;  5IZH A;  4YFU A;  2O3D A;  1KS2 A;  3W8G A;  1S99 A;  3KTQ A;  1XQI A;  2MQO A;  4DLG A;  1QM9 A;  4TN2 A;  1CJU B;  4DPX A;  2LQB A;  2NSC A;  2VB6 A;  3MUR P;  2ZH9 A;  4QU6 A;  2FB0 A;  2RQC A;  4HT7 A;  1Q53 A;  3O8W A;  5KFW A;  4ED2 A;  2DTJ A;  1REV B;  3VAJ A;  1LWF A;  3LGH A;  4DV3 J;  3QJL A;  7AT1 B;  4I6A A;  5GAE U;  4WF9 Q;  3M1V A;  3W8P A;  2VKZ G;  3A3N B;  3H2V E;  4DL6 A;  4NLX A;  4O3N A;  2D7S A;  4IFY B;  2EKY A;  5BR8 J;  2VFT A;  3K5N A;  5A8R B;  1RT2 B;  2JZ5 A;  4WP9 A;  2DR5 A;  5D6G A;  4I1T A;  1RDR A;  4J9N A;  2EG2 A;  1X4G A;  3W61 A;  2GIR A;  3CC4 S;  2HHT A;  3F73 A;  4MFB B;  1C0T B;  1HHS A;  2MST A;  2QFI A;  1JLB B;  1RBA A;  2GVZ A;  1BLU A;  1JLQ A;  1S4F A;  4O4R A;  1SV5 B;  2MTL A;  3R5A A;  5EWE A;  2H4W B;  3MD3 A;  2AMC B;  3DLE B;  1TKT B;  4OYI A;  3VV2 B;  3QMQ A;  1FKO A;  2G0J A;  1MMN A;  4NMX A;  2R7O A;  3WC0 A;  4OL8 A;  4B3S F;  2F3J A;  1IQZ A;  2ZUA A;  1EX8 A;  1TUG B;  2YNH B;  4PKD B;  2FZC B;  2Z2M A;  1U02 A;  2ZH8 A;  1T0T V;  5BYS A;  3L95 X;  4UST A;  2A0F B;  1S76 D;  3QFH A;  3D66 A;  3M2V A;  4J37 A;  4DX6 A;  3EGV A;  4LFA J;  1NAQ A;  1PO6 A;  1GMU A;  3G8S A;  2HFZ A;  1WTB A;  2CZV C;  4CCH A;  2W24 A;  1DLO B;  2PEH A;  1VFJ A;  3I0S A;  3VAM A;  3UD4 P;  1UPP A;  4Y2A A;  4EO8 A;  3HVA A;  4EYH B;  3TX0 A;  4JP8 A;  2YPZ A;  3CME S;  2OKQ A;  4F7V A;  2P9G A;  5HO4 A;  4JBC A;  1HQU A;  4XDC A;  4FS2 A;  4ES3 A;  1U2R A;  2MZQ A;  2JSX A;  1WOP A;  3K8V A;  1HW8 A;  2C3Y A;  4IOB A;  4ZCL A;  4DPO A;  3E2E A;  1R0B G;  4YOE A;  4CH1 A;  2JEF A;  9ATC B;  2NUH A;  1HNV B;  4F4W A;  3LP2 A;  1M5H A;  1D09 B;  2ZD1 B;  3H5S A;  5CYM B;  4ZVR B;  2B3T B;  3RAX A;  1NK5 A;  3IRX A;  4DZD A;  1RAO A;  1MRO B;  2WOM B;  5IT0 A;  2FHO B;  2DVI A;  1T9W A;  1HI0 P;  2ATL A;  2HKE A;  1UVM A;  3S7R A;  2XB2 D;  2VH7 A;  1SJ4 P;  1JLC B;  3IRW P;  2LQ8 A;  2WB1 D;  5HAT A;  3SIP B;  4G1Q B;  1C1C A;  5F8N A;  2JRS A;  1UTA A;  4YEA A;  1AUS L;  4CO0 A;  3UDL A;  3L7U A;  3RRH A;  1X9M A;  4BWM A;  3POT A;  4HTI A;  4UY8 T;  4CLL A;  5F9N A;  4TY8 A;  2QN6 B;  1I1G A;  2EFQ A;  5KFT A;  3CGI A;  3M8Q A;  3KLG A;  1DHM A;  4FN5 A;  2VQE F;  4LRD A;  1WG4 A;  3T19 A;  3OTD A;  3H42 A;  4I68 A;  2B6A A;  2BDP A;  2DO0 A;  4LVN P;  4A8M P;  1M1K T;  1XN9 A;  2OPP B;  5L9N A;  2YKN B;  1U0H B;  3RW6 A;  1VGY A;  3BSA A;  2UZA A;  4KY3 A;  4N41 A;  2DNH A;  4AQY J;  3OL6 A;  2PT0 A;  3M8R A;  1RA6 A;  3S6E A;  2HRT A;  3LTO A;  5KG6 A;  1N33 F;  2ZH4 A;  1SC1 B;  1HBN B;  1XMQ F;  3DOK B;  3T3F A;  2L3M A;  5KAK A;  2W2O P;  4PG6 A;  3O3L A;  6FD1 A;  3DFE A;  3CT9 A;  4H4K C;  2OPQ A;  1FDD A;  4LSZ B;  3CD5 A;  1VQ9 S;  2F1F A;  2C3U A;  2PD1 A;  1BUX A;  2KXF A;  1W25 A;  2BQR A;  3DHW C;  2HND A;  2DPJ A;  2V69 A;  1CQN A;  2E1R A;  2W8K A;  4U95 A;  3EDQ B;  4GRS A;  1TR0 A;  2LQ9 A;  2Y1L B;  1D3W A;  3LO3 A;  4YB1 P;  4RW8 A;  2GQQ A;  3VTI A;  1X9S A;  4UF4 A;  4FBU A;  3QAT A;  2HLU A;  4N8N A;  2IA6 A;  2K1R A;  2ZFH A;  3CE8 A;  3T6B A;  3UN2 A;  2GGP A;  1FT8 A;  4LF6 F;  4F4Z A;  3SBM A;  2AEF A;  3JAM U;  3CIM A;  2ZKU A;  4QBU A;  2HIQ A;  3KLE A;  2XWX A;  3TW0 A;  2RHS B;  2VPY B;  2ZC4 A;  4AFF A;  4HI1 A;  2BAN A;  5A6P A;  2IRX A;  4G1P A;  1SH0 A;  4QWE A;  2BZ2 A;  3W60 A;  3KHG A;  1C4A A;  3M1V B;  4B9V A;  1ARO P;  1IJE B;  2GS8 A;  3L09 A;  3HZE A;  3TZW A;  2BXJ A;  3EVM A;  3C15 A;  1Q8L A;  3FBC A;  1PBU A;  3HFK A;  2APO A;  3ZC4 A;  3NWG A;  3WX8 A;  2D69 A;  1EHW A;  2ZVS A;  4KE5 A;  4IRD A;  1TV6 A;  4TVA B;  2LEC A;  2VOO A;  5FLX U;  4AL5 A;  1O5J A;  3L7O A;  2ZWP A;  5F3T A;  3CVK A;  4L73 A;  1U0S A;  1Q78 A;  1XEZ A;  4J91 A;  5IT4 A;  4F67 A;  4M1K A;  1I3O B;  5HLF B;  3KLF A;  4TYA A;  4LF7 J;  1HWU A;  2HFO A;  3HJV A;  1JLE A;  3VAI A;  1R43 A;  5CA5 A;  3T5K A;  2ASJ A;  1FKO B;  1R8A A;  5EDW A;  4B3O A;  5KT6 A;  3V6H A;  2W9A A;  1PAE X;  1CS4 A;  3WX4 A;  1D1U A;  1ZM9 A;  2J9E A;  3GFH A;  3GIK A;  2RH3 A;  3W2W B;  4N8O A;  4QIW D;  3ZTQ A;  3WIU A;  3AJ1 A;  3I96 A;  4WE1 B;  2JVR A;  3M2V B;  1RKJ A;  3O5T B;  2DK2 A;  1M1G A;  2IAJ B;  5DG9 A;  3PHT A;  5B0B A;  2Y3Y A;  5L9X A;  1O8B A;  3NG8 A;  4OX9 J;  5HMY A;  3MCO A;  4ICL B;  4DL0 C;  3UN3 A;  3IG1 B;  4L75 A;  3J81 j;  3VGV A;  3LUY A;  1WF2 A;  2M9K A;  1DQ8 A;  3H59 A;  1U1M A;  1IBL F;  4FP9 A;  4F4X A;  4F3M A;  2Y1J A;  1UAW A;  4P6Q A;  1Z1Z A;  4OQJ A;  2NRE A;  2EFO A;  3MOJ B;  2OPS A;  4F4Y A;  3TAP A;  1ZAX A;  1KC8 T;  2V9W A;  1X4F A;  1RI7 A;  4AE5 A;  3EXY A;  3D1H A;  3QZ7 A;  3KUE A;  3M30 B;  3LWL A;  3RZA A;  3LP2 B;  3M2U A;  4RWW A;  2A10 A;  1XNR F;  5DG7 A;  1LW0 A;  1L3V A;  1FXR A;  1TL7 B;  3DM2 A;  2AP6 A;  1N5T A;  4DN9 A;  2EKN A;  5E3Q A;  4ZVO B;  2V2K A;  5EWG A;  3ZNJ 1;  1JJ2 R;  4H4M A;  4G1I A;  1RAH B;  2QLF B;  1NND A;  1C1C B;  3CTR A;  3LP0 A;  1WHW A;  3RW7 A;  4EO6 A;  2HHX A;  1SH3 A;  5BJR A;  1IWG A;  2ALZ A;  1KSP A;  1KVI A;  1IJF B;  2MKI A;  3B82 A;  4L3K A;  4N5S A;  4Y0F A;  2BAB A;  1NLK L;  3KK1 B;  1LWX A;  2K06 A;  3M8Q B;  3KLG B;  3R5G A;  1RT1 A;  5DZ6 A;  2FVQ A;  1B99 A;  3KDN A;  1B4S A;  5LMN F;  3J7Z 5;  2NYI A;  3I0R A;  2QX0 A;  3OTB A;  3V6D A;  2UVV A;  3T9N A;  4KV8 A;  4DSL A;  2M88 A;  3V4I A;  4DX5 A;  3G6E S;  3PCO B;  2NYH A;  2YKQ A;  2XS2 A;  5KFB A;  1FKP A;  2UUT A;  4KH0 B;  3MPY A;  2KRR A;  1ZZN A;  4KHP F;  5J2M A;  4QW8 A;  2XCA A;  5DG8 A;  3D1O A;  5GAG U;  3W1Y C;  5B0A A;  3CXC R;  1CJV A;  3E51 A;  4C9D A;  1YZ6 A;  4KGX B;  4CP5 A;  3FNN A;  1VQ4 S;  3OD2 A;  3P3D A;  1CEZ A;  4LIW A;  2KFZ A;  2AYM A;  1U1O A;  1LFW A;  1YX2 A;  3HHK A;  4FYY B;  3BYP A;  1NSP A;  1WSV A;  3HI9 A;  2MKH A;  1FD8 A;  5HVH A;  2NUU G;  5CYQ A;  4PWD B;  4P2X A;  2H48 B;  4A8F A;  1BQN A;  2GA7 A;  2UUB J;  1IBC B;  4DXL A;  3D54 A;  3BGF A;  3CCR S;  1NDC A;  4UUX A;  1GK8 A;  1C1B A;  1WJ9 A;  4LRE A;  2BAC A;  3M6X A;  3Q89 A;  3PIO Q;  4O3R A;  4DV7 F;  3TP2 A;  1UEK A;  2J9D A;  1GEH A;  1TTH B;  2A6O A;  1R0A A;  1WC1 A;  3MEG B;  4CLY A;  3AHP A;  3CB4 A;  2XZD B;  1QE1 B;  4DF4 A;  4OYW A;  3KLE B;  2XMV A;  3WBZ A;  2EK6 A;  3PYE A;  3I9V 9;  2XHW A;  4JYA J;  4DU7 A;  2BAN B;  1YRT A;  1TKX B;  3MM6 B;  1FE4 A;  3EZ5 A;  2CAJ A;  3Q8P B;  4DBQ A;  2HWT A;  5ETP A;  4JV5 F;  1XNQ F;  4NLO A;  3C15 B;  1Q8I A;  2A3J A;  5HQM A;  4RJV A;  1TL1 B;  3KLI A;  4O4G B;  3RRG A;  3N5F A;  2HMI B;  1JIH A;  3K5M A;  1K73 T;  3OLB A;  2FC8 A;  5I42 B;  3BH6 B;  1XMB A;  1YJV A;  3VZI A;  4N7T A;  2C2D A;  2XBP A;  3H4D A;  1T9X A;  4FF4 A;  4FS1 A;  2YWE A;  4BHQ A;  2Y0B B;  4ZVS B;  1JJ4 A;  2FTR A;  2YKM B;  3CJK B;  3ENA A;  4GMK A;  5KFC A;  2X3D A;  3PX6 A;  2LMI A;  3WC2 A;  4CLU A;  1JLE B;  3UCZ P;  5L38 A;  5DLG A;  3ENW A;  4J7C A;  2KH9 A;  1JJH A;  3QIP B;  3OUY B;  4CM2 A;  4UOC A;  1EAR A;  1VI7 A;  3M8S A;  3SSR A;  4IFV A;  1ULR A;  2G4B A;  4OJH A;  4EI2 A;  2DCL A;  4X4O A;  4RW9 A;  5L1L A;  2ADB A;  1NKC A;  3V81 A;  1QAI A;  3MFI A;  5HMZ A;  4ZJQ A;  2HGN A;  3IAS 9;  5JUM A;  2H1Y A;  2FVR A;  4KC5 A;  4W98 A;  2AJQ A;  4WFA Q;  4DQP A;  2MLZ A;  3C16 A;  2R2T A;  2DT9 A;  3J7Z T;  4KGM A;  1VRQ C;  2IMW P;  4HT5 A;  1F9H A;  1UKU A;  5KFO A;  4J9Q A;  2UU9 J;  1YIT S;  4JOU A;  1L3K A;  4NRT A;  2OPR A;  2RVJ A;  5D3G B;  2IPO B;  3VF0 B;  4X4Q A;  2X51 A;  4HAC B;  3OL8 A;  3ILJ A;  3GV5 B;  1IR2 A;  4CNY A;  3RBD A;  3MTK A;  1UCN A;  2OFH X;  1IBK F;  1MMD A;  2CZ4 A;  3M6W A;  2GML A;  4JI6 J;  2DGQ A;  1RSC A;  4C4W A;  4CYU A;  1CSJ A;  1T02 A;  1RTD B;  3BBF A;  3AT1 B;  1IKW B;  3M8Y A;  1Y11 A;  1S1T A;  4YDD B;  2ZH6 A;  2FHJ D;  1S0O A;  3M2U B;  3Q83 A;  1LW0 B;  3QSY B;  3PYD A;  2RRN A;  2WVD A;  3DOL A;  4JI2 J;  3G8Q A;  1T7P A;  1WHV A;  3MED A;  2JHE A;  2C28 A;  2E44 A;  1FK9 A;  4ZLP A;  2ASD A;  3LP0 B;  5F8J A;  3G82 B;  4I2P A;  2W8L A;  3DLB A;  4QPX A;  4ZK7 M;  4KBI A;  4LBP A;  2FDN A;  4JI3 F;  4Q8E A;  1SKW A;  2WB4 A;  1NZA A;  1YBA A;  1UJ6 A;  2RKI A;  2ZH3 A;  2XY6 A;  5C25 B;  4IRK A;  3BQ2 A;  3KMS A;  2KT3 A;  3DOM A;  3HDS A;  4UW2 A;  4ZP8 A;  3V6D B;  4WFX A;  2KFN A;  4Y2K A;  4HDH A;  1J5E J;  3V4I B;  3N79 A;  4JV2 A;  2UXC J;  2E7V A;  2Q6B A;  4NLV A;  5J1E B;  3CCT A;  3MR5 A;  2HHP A;  5C7P A;  1TVR A;  1DJ0 A;  4DR7 J;  1RHM B;  4X65 J;  2HLT A;  2IVF B;  3BB5 A;  2FJD B;  1NHK L;  3N6M A;  1MNE A;  2ZHO A;  5I4M A;  5KFQ A;  5D0H A;  2D41 A;  4N77 A;  2RU9 A;  4NLT A;  2GIQ A;  3CJR A;  2M52 A;  3KK3 A;  4DV3 F;  3J7Y U;  2AX1 A;  3E3X A;  4AD6 A;  3OVB A;  1Q79 A;  3GSI A;  3FZB A;  1Q95 G;  2I8E A;  5BR8 F;  4UT4 A;  1BQN B;  2IYI A;  3DGP A;  4RUA A;  1FRI A;  4PR6 A;  3UD5 A;  2MY8 A;  2AJ4 A;  2B51 A;  1F1B B;  2R7V A;  3GR1 A;  3ENV A;  1C1B B;  2JC0 A;  2IM2 A;  4ZIT A;  1X8D A;  4OYP A;  1VLY A;  1BE4 A;  3GV7 B;  3WZ0 A;  3SCI E;  3ICL A;  3OXL A;  1VQ6 S;  4PUO A;  2E9Z A;  4AT1 B;  1GQE A;  3A4T A;  1JXE A;  3TO8 A;  2C3P A;  1FWK A;  3KHR A;  2GHW A;  4IUF A;  3CC2 S;  1H0H B;  2YKO A;  4YUD A;  4BLG A;  1MN9 A;  5KT7 A;  3HVR A;  8ATC B;  3HD2 A;  3CF5 Q;  3FMB A;  1H72 C;  4KKO B;  4NCG A;  2ASL A;  3Q8U A;  4HR2 A;  4EZ6 A;  1YRU A;  2G1H A;  1N8R T;  4B3T J;  1GX5 A;  4LFA F;  4KGZ B;  3DKD A;  3QAE A;  3PYG A;  3RBZ A;  2XNQ A;  2XY7 A;  5LXY A;  3MM7 A;  4QJV A;  5ETN A;  2MZ1 A;  2XM3 A;  1S9E A;  1BY9 A;  3EPG A;  4IOC Q;  1KVK A;  2HAI A;  4A48 A;  3QT6 A;  3HHN B;  2ZBR A;  4FZV A;  5FLX Y;  2V4J A;  3K7R A;  2Y8Y A;  2EVZ A;  1TEL A;  2IVY A;  1KTQ A;  3IFE A;  2DH7 A;  1RTI A;  1M5K C;  2B4O A;  3B4M A;  2WK4 A;  3C2P A;  1RHQ B;  2ZHA A;  3RB4 A;  3SDE B;  4QYZ K;  2YKP A;  2VIH A;  2MZR A;  3TQ1 A;  2ZC3 A;  1S0M A;  4ZPA A;  2HNY B;  4PG4 A;  4ED6 A;  4EBE A;  5IM0 A;  1SB6 A;  2NCK L;  3QRP A;  3UW1 A;  1F5B A;  1ZET A;  4IKA A;  4IFV B;  3BO4 A;  1RAB B;  2KVI A;  2HS4 A;  4NLW A;  1FEE A;  1VDH A;  4XTT A;  5KFL A;  3RB3 A;  2E9R X;  3SCL E;  2OH2 A;  3TVY A;  3H40 A;  1SI9 A;  1FXD A;  4M95 A;  3QFW A;  2A18 A;  4ZLJ A;  2DHH A;  3K17 A;  2CJQ A;  4YY3 J;  1YBT A;  5EX0 A;  2M70 A;  4C7Q A;  1LKZ A;  1N56 A;  3KHL A;  3PFO A;  4NEY A;  3TYT A;  1MU2 A;  3GE9 A;  5CZX A;  4Q5V A;  5LSO A;  1FRH A;  1XK8 A;  3THT A;  2Z57 B;  3PDN A;  5HBM A;  2LQ5 A;  5FDL A;  4JV0 A;  2B7B B;  1KTV A;  3GTY X;  2HBY B;  2GQC A;  1QTN B;  1NDP A;  4H54 A;  4OYO A;  2OPR B;  1U09 A;  4WFN Q;  3HP6 A;  2VG7 A;  4J9O A;  2FY1 A;  1S1U B;  1SC6 A;  2VFS A;  1J27 A;  1TAQ A;  4QWB A;  5E3R A;  2FZG B;  2AEM A;  2R8G A;  1YSJ A;  2R2R A;  4I7F B;  5B0E A;  2KN4 A;  4CYU B;  4GO5 X;  4C3M A;  2OAU A;  3PO4 A;  1CJK A;  1U1K A;  5I3P A;  1OQ3 A;  2ZJQ Q;  2H3E B;  3Q86 A;  5C24 A;  1FJG F;  4IDK B;  1S1T B;  2J7K A;  4LF1 A;  1WHY A;  2PMW A;  1N48 A;  2DGT A;  3CJ8 A;  3OFH A;  4QIF A;  5L8R C;  4C97 A;  1U45 A;  4Z7C A;  2VON A;  1S72 S;  4AQY F;  4ITS A;  3DOL B;  1Q5Y A;  2QT7 A;  2GAG C;  4DR4 F;  3I5A A;  1SL1 A;  1BGX T;  3M8W A;  3DCA A;  1LWE A;  1UL3 A;  1HKA A;  4EZ9 A;  3MMC A;  3JSM B;  2WCX A;  3TNV A;  4EEY A;  4RR5 A;  3L7P A;  2PI5 A;  3PKY A;  3M9O B;  3IC1 A;  3NAI A;  5H9E J;  2EI5 A;  1KD1 T;  2ROG A;  4LFB F;  3P5B P;  3EGN A;  3HT0 A;  2HFN A;  2LDY A;  2EFV A;  2RDI A;  3BPD A;  4FKY A;  4USM A;  1HNZ F;  2FGC A;  4ECX A;  4K4W A;  5KFN A;  3JQJ A;  1XWL A;  3CDU A;  5HN0 A;  4KGK A;  2PDA A;  4QR1 A;  3KUH A;  1URN A;  2JDJ A;  4LJM A;  1N4L A;  3G6X A;  4M5M A;  2CFX A;  2PI4 A;  3DOM B;  1N0U A;  2EPI A;  1YI2 S;  2JLF A;  2AYG A;  4PWU A;  2VL1 A;  4LQ9 A;  4KO0 B;  2ZNZ A;  3G87 A;  3RUB L;  3IXQ A;  1RU1 A;  3BO3 A;  4X4S A;  3HHD A;  2G1D A;  4JI4 F;  4YDX A;  3PR4 A;  3VQT A;  1R6Y A;  2OTL S;  1HWI A;  3IP0 A;  2E1A A;  3O6Q A;  4YHH J;  2DGX A;  3KK3 B;  4F4K A;  5CCL A;  4CLP A;  1HMV A;  3JSR A;  4FNH A;  2XYH B;  3R97 A;  3D2W A;  4LBH A;  4PAA A;  4ZLN A;  1VRT A;  5A8W A;  2VG5 B;  1AA1 B;  2DKO B;  2V5H G;  2DEI A;  1G7C B;  1ZA1 B;  2ZJR Q;  5HQ8 A;  3JB9 k;  3T1H F;  1NSK L;  4Y6I A;  2RDD A;  4ECZ A;  4DHV A;  1FJC A;  3AOA A;  3PW5 A;  3GU0 A;  3M2R B;  4LR8 A;  2K2P A;  2CNO B;  4N56 A;  4OIX A;  3MCS A;  3ZZR A;  1FDA A;  3MMB B;  1YIJ S;  2UXB F;  4PUO B;  3MR6 A;  3P5T L;  3FQK A;  4LF7 F;  3NP5 A;  3ZNU A;  2LEP A;  4EWT A;  4MK7 A;  2VFV A;  2Y0S D;  4Y65 A;  4DX7 A;  3NCQ A;  3M6V A;  3G6Y A;  4TXS A;  1YRX A;  4P73 A;  4NI2 A;  5KFG A;  2J76 E;  2UVW A;  2QYG A;  3UR3 C;  4CO2 A;  3KFW X;  3MM5 A;  2AT1 B;  3CJT A;  1Y4Z B;  4A8K A;  2N82 B;  2LDI A;  4RWX A;  4QU7 A;  2PEB A;  5HQL A;  3KK2 B;  3L3C A;  3A8J A;  3MM7 B;  2OEL A;  3IBF B;  4NA2 A;  1NDK A;  3IA0 A;  4ZMM A;  4R5P A;  3QID A;  2HFS A;  3JYT A;  5HJY A;  4K8R A;  1S9E B;  4DV2 F;  2V8D A;  3MCN A;  8AT1 B;  2BKN A;  2QZ8 A;  3EE3 A;  3OSP A;  4USI A;  4TQR A;  3V4M A;  3EIC A;  2E29 A;  1NK9 A;  3KJV A;  1VR6 A;  2ACY A;  1CLF A;  3OL9 A;  1JKH A;  3BGR A;  5GME A;  1NRK A;  2QEX S;  2XO7 A;  2QFJ A;  4B9M A;  3VVU A;  4RNF A;  4R8U A;  2W7A A;  3CCL S;  4ELU A;  2JEG A;  2R2S A;  2XQC A;  3MUM P;  2XI3 A;  2CJA A;  1JLF A;  3D3B J;  1RCX B;  2JNJ A;  2NXE A;  1SC4 B;  3OTO F;  1VHI A;  1S48 A;  4NXM F;  2VFU A;  1LXJ A;  1N33 J;  1CPZ A;  1Q8K A;  1XMQ J;  2QA4 S;  1KKH A;  1HBO B;  2F8M A;  5HBM B;  2F4V J;  5G0R A;  1RIS A;  5J2Q A;  4OJ3 A;  3FGV A;  2E7X A;  2KDO A;  1K47 A;  1VQS A;  3CJ0 A;  4CM0 A;  1LWC B;  4I6W A;  2VG7 B;  1GMW A;  4LF9 J;  4WFZ A;  2E7W A;  3R3T A;  5F3Z A;  5B0D A;  2QA2 A;  2ASY A;  3PX0 A;  3TAR A;  4ERD A;  2B4P A;  2HHS A;  2EFG A;  3SYZ A;  3UDC A;  1U2C A;  2IBO A;  4MKB A;  2DRB A;  5C24 B;  3J81 U;  4XIU A;  4FKX A;  1VC6 A;  2VPZ B;  4QYR A;  3TZX A;  4O44 B;  3TEG A;  1UFK A;  1SL2 A;  5H1S V;  2GW8 A;  3CCS S;  2DNQ A;  3HO1 A;  4K50 A;  4C8M A;  2DGW A;  2BE7 D;  3QYY A;  4LF6 J;  2GHP A;  2XNR A;  1S6O A;  3D0H E;  1VHF A;  4PXC A;  2WBM A;  2MKS A;  2D9P A;  1U8S A;  4DR5 J;  4QOT A;  1HL6 A;  2GCF A;  2GZO A;  3DRY A;  4NLU A;  2LA6 A;  4USW A;  5IC6 B;  4ED8 A;  3GIM A;  5M2U A;  4BCA A;  2YWH A;  4RL1 A;  1GXL A;  1TP7 A;  4CT9 A;  1O6X A;  4EUV A;  3BGO P;  3LAN A;  4DV6 F;  2CQB A;  1LEO A;  2CYY A;  1SPB P;  4C11 B;  1S6Q A;  3FFI B;  3I5C A;  4OYM A;  4A8Q A;  4ID5 A;  1BWV A;  3W9H A;  3QQC D;  1RBL A;  3D6M B;  2F4F A;  2NR0 A;  2UUB F;  4DR1 J;  1B64 A;  3MF5 A;  4P72 A;  3IAM 9;  4OZ2 A;  4O3Q A;  4OZL A;  1QDU B;  1RWV B;  4DUT A;  4DV4 J;  1D0E A;  3KLH B;  1S6P A;  2W9C A;  2MB0 B;  3BS9 A;  5HK4 A;  1KLN A;  2HGL A;  3GFZ A;  2ZH2 A;  2N3O A;  2BJE A;  3FQL A;  4Q0B B;  3PRB A;  1JLG B;  3HK2 A;  2OO4 A;  2XSJ A;  3QWP A;  4GC6 A;  1EP4 A;  4P10 A;  4JYA F;  1S59 A;  1QSY A;  4NCA A;  1GX6 A;  2PII A;  5HRO A;  4LRC A;  2V34 A;  1HMV B;  3KKF A;  2HG4 A;  4C8L A;  1B0P A;  4RBV A;  2MKJ A;  1VRT B;  4CTA A;  3VAH A;  3BN7 A;  1HPZ A;  1SVD A;  2KO1 A;  1E6V A;  1W26 A;  5KT2 A;  1WEY A;  2JWN A;  1LQ9 A;  1VQK S;  1RT4 A;  1NK8 A;  1RB0 A;  1FTC A;  3WIV A;  2CUY A;  3CCJ S;  1HBM B;  3OBI A;  4F8R A;  1JB0 C;  2BVZ A;  1P27 B;  3HXM A;  3A3P B;  1APS A;  2YNG A;  1R27 B;  2BM1 A;  1LW2 B;  2UV8 G;  1YK9 A;  4DL4 A;  2AQ4 A;  4MT1 A;  1JLA A;  2WVF A;  3JTP A;  4YS2 A;  2VPX B;  1JXV A;  1CJT A;  3IBW A;  1VBZ A;  2UV8 A;  1P9Q C;  3DYA A;  4DQQ A;  3P96 A;  3JS9 A;  4CH7 A;  2ZOM A;  3QNW B;  1LXN A;  1PCA A;  3MEC A;  4C0O C;  3UPF A;  2M5Y A;  3DI6 B;  1VQN S;  3W5Z A;  3TEH B;  1Q7Y T;  3Q8Q B;  5K8M A;  3MM5 B;  4NLR A;  5EWF A;  1V3R A;  1P1L A;  2AGQ A;  3MD1 A;  2LKZ A;  1M90 T;  1KHV A;  3FRZ A;  5I3U A;  1ZTT A;  2KXN B;  5HSP A;  5LM7 E;  1OO0 B;  5AE2 A;  2FHK A;  1T05 B;  3AOD A;  4UQT A;  2WSE C;  3LWM A;  2B8P A;  3C6T A;  2UU9 F;  3AA9 A;  3AD8 C;  4QIV A;  3KOA A;  2LEA A;  3HMJ G;  2LU1 A;  1FRM A;  3MUV P;  2P6S A;  3BGR B;  3T5H A;  3PO5 A;  2OML A;  3X1L B;  4O23 A;  1Q81 T;  1PBA A;  2FQQ B;  4DSI A;  4GVB B;  4K2J A;  3ISZ A;  2V2Q A;  4P75 A;  2AF6 A;  3Q2S C;  5LJ5 Y;  2AYB A;  2ADC A;  5LMN J;  3KJF B;  4LF2 A;  2QA4 G;  4ZOS A;  4RW7 B;  3OR2 B;  1U1Q A;  3GII A;  1CJU A;  5A0Y A;  2KZZ A;  1VCT A;  2KZM A;  5IQ6 A;  5IT9 U;  2Y9H A;  2C42 A;  2VKR A;  4JI2 F;  4HYK A;  3MPD A;  4DU8 A;  3PM9 A;  1UVI A;  2FJB B;  2JC1 A;  4EMD A;  1AFI A;  1REV A;  1VJQ A;  4CT8 A;  3M32 A;  3G6V A;  3HLU A;  3D5M A;  3BDP A;  2J6T A;  2AEJ A;  2V8V A;  5KFM A;  5BYQ A;  2QG9 B;  4ZVU B;  2L08 A;  1NHU A;  2EFN A;  1UA1 A;  2LEB A;  4IFY A;  2DYA A;  1RU2 A;  1MWY A;  1S79 A;  1CVJ A;  2BJD A;  2AKW B;  2NZ4 A;  4ZCM A;  1RT6 B;  3LH2 S;  5A8R A;  1RT2 A;  1NSQ A;  1V9O A;  3PG9 A;  2I5J A;  3NKY A;  2ZE2 A;  3H5Y A;  3DLL Q;  4MFB A;  1C0T A;  2UP1 A;  4A4J A;  4W4M A;  2B4U A;  1J5E F;  2KHC A;  1JLB A;  3ISN D;  2UXC F;  4B3M J;  4DV5 F;  5BXI A;  3C8Y A;  2HBQ B;  3DRP B;  3ZZ0 A;  2CRL A;  5L1I A;  2BUN A;  1PYT A;  4QPT A;  1NK6 A;  5C42 A;  3DLE A;  4X65 F;  4FXD A;  1TFY A;  2RQK A;  1IBM J;  2DIV A;  1J5O A;  1YJ7 A;  1RQ0 A;  2LYV A;  1N5Q A;  2GO9 A;  3UWT A;  4ZN3 A;  4DUZ J;  1T9Y A;  4ZP9 A;  3VR1 A;  4RKU C;  5H9F J;  4G65 A;  3EJM A;  1IUJ A;  2QTW A;  2E1M C;  2MZS A;  2YNH A;  3CJ5 A;  1FJE B;  1UMJ A;  1VQ7 S;  4ID5 B;  3KJQ B;  4C3K A;  1XR7 A;  4DPY A;  2Q3P A;  5FD1 A;  5D78 A;  4RUH A;  2IYG A;  1D9D A;  5B0F A;  4RU2 A;  3WHI A;  4IG3 B;  4MMO A;  4X2B A;  4CZC A;  4PEO A;  2F63 A;  3N28 A;  4OHW A;  1WC4 A;  3B4D A;  4ZCI A;  5J1N A;  3JTO A;  3ULH A;  1S6P B;  3DMJ B;  3V6K A;  2KJV A;  3LOU A;  1CC8 A;  3FBF A;  4DQR A;  1N54 B;  3GIL A;  2NPF A;  1YJT A;  1B0V A;  5KFS A;  3MDF A;  2MQP A;  1I6J A;  1AFJ A;  1YZ7 A;  3MMA A;  5K20 B;  2C2Z B;  2KVQ E;  1G4C A;  2YWF A;  4DWI A;  2POK A;  2QIF A;  1L3S A;  3AXK A;  4TU8 A;  2LXU A;  3DLK A;  3H20 A;  3NNA A;  4MIW A;  2BQ3 A;  3W62 A;  2XC9 A;  2BW2 A;  4F36 A;  2AD9 A;  3TAN A;  3NEK A;  1U25 A;  1HNV A;  4DL3 A;  3SSQ A;  1WC6 A;  3GFY A;  3NXZ A;  3BPS P;  5HL7 Q;  5CYM A;  1SKU B;  2FIU A;  1DZ5 A;  4ECT A;  1S7I A;  2PC6 A;  4B3T F;  4HHJ A;  3HHL C;  1KFD A;  4KR0 B;  1MRO A;  1FI4 A;  2WOM A;  2B5J A;  2YNI B;  2I1R A;  4ED7 A;  3CDE A;  4LIR A;  5B7W A;  2FHJ A;  1S1V A;  1S1X B;  4IYQ A;  3AXM A;  3M05 A;  3KUG A;  1JLC A;  1BXN A;  3TRG A;  1OMS A;  1SQF A;  2YQ1 A;  4WP3 A;  4D3H A;  2F40 A;  4R0E A;  1JLA B;  4DV0 F;  3VWS A;  4NLQ A;  1ELO A;  4I6Y A;  4KIA A;  2DHS A;  2RD5 C;  3OFF A;  4YR0 A;  2V94 A;  1O0P A;  1IWA A;  1UET A;  2ALY B;  3PJW A;  2DNN A;  1Q0N A;  1VIO A;  4E98 A;  2OTJ S;  4E0D A;  2UUW A;  2RRA A;  1S49 A;  3ENQ A;  3MEC B;  3HKZ D;  5K14 B;  1DAX A;  1SJR A;  3QBC A;  1X31 C;  5M2P A;  4LR9 A;  3TI0 A;  2GX8 A;  4L6V 3;  2OPP A;  4ZCK A;  2YKN A;  4CQ1 A;  2Z8Q A;  2ZOF A;  4OHZ A;  3G4S S;  4DV1 F;  3UE2 A;  3MM9 A;  2RU3 A;  3SFU A;  3ZZY A;  4YY3 F;  4WFY A;  5F8G A;  5I3U B;  4QIG A;  2KJW A;  2QMX A;  5ETQ A;  1RWM B;  2GJ2 A;  4DS4 A;  1GMV A;  5GMD A;  3NS5 A;  3HSG A;  2K3I A;  1NJX A;  1JK9 B;  4PXB A;  1KP6 A;  1Q16 B;  1WKL A;  1VLO A;  4U8Y A;  2AU0 A;  1PC5 A;  2J9C A;  2MDA A;  2YH1 A;  4ILL A;  5KT3 A;  3N9U C;  2JFK A;  1B70 B;  3PXG a;  4ZPW R;  2HVD A;  3OJS A;  3QPI A;  5E3P A;  2QC3 A;  3H7H B;  2KT2 A;  5HAO A;  2D3O 1;  2HVE A;  1IKX B;  4USJ C;  1OS5 A;  3ITH B;  5KFE A;  1DTT B;  2KB2 A;  3RGI A;  1KEK A;  2GC8 A;  4OHY A;  2DGU A;  5A0Y B;  2U1A A;  2V4Q A;  4F2S A;  4IOA Q;  4NLP A;  3ETM A;  4ED4 A;  3P6Y C;  1KHW A;  3W65 A;  4CO1 A;  2CVE A;  2YQ0 A;  3D6F B;  4DL2 A;  3RR7 A;  5D0E A;  2MZJ A;  2HS3 A;  4DZ6 A;  1VOM A;  1Q1K A;  4DLE A;  1Y00 A;  3R5B A;  1RWP B;  3M32 B;  1NH8 A;  4X4V A;  1BQM B;  3MXH P;  1Q5V A;  2AJ0 A;  4YME A;  3C6U B;  1YTY A;  2IRY A;  2MKC A;  4K5S A;  1DY3 A;  1U6Z A;  2XMM A;  1YLX A;  3FSX A;  5GMK a;  3J80 Y;  2H4Y B;  4MTP A;  3D1Q A;  3RJM B;  3CWJ A;  3OL7 A;  2AW0 A;  1PAU B;  3QT5 A;  3GCW P;  3BN4 A;  2B9E A;  1VIX A;  1T9U A;  2I5J B;  3MR3 A;  4RUB A;  3QWU A;  3FDS A;  3D3C J;  2ZE2 B;  1IM6 A;  3J81 Y;  1B7F A;  2XGQ A;  2CJK A;  2R7S A;  1FA0 A;  1X4E A;  1UEU A;  3R5J B;  3TR5 A;  1Y9O A;  2H51 B;  4IH7 A;  2XMA A;  3R9L A;  2AGO A;  1S0N A;  5HLF A;  4DR2 F;  5C42 B;  3W64 A;  2YXL A;  3CDB A;  3IR6 B;  1FNO A;  3OFG A;  1J5O B;  2IJN A;  2B43 A;  4YHH F;  2DH8 A;  4V19 X;  1FD2 A;  2ZNY A;  2D74 B;  2VBW A;  1JQG A;  3DLG B;  2MZT A;  3HHE A;  3B78 A;  3W2W A;  2OLW A;  3ZZU A;  2CNK B;  5CD4 H;  3UDV A;  4C0H A;  1FRX A;  4ED1 A;  2CQ4 A;  1N0V C;  1S1W A;  1UVJ A;  4WE1 A;  2YNF B;  2HQD A;  2CPJ A;  2KL8 A;  3HUL A;  3KJN B;  3NGT A;  2IAJ A;  5HI7 A;  4YR2 A;  1PYO B;  3J7Y I;  4MYU A;  2Z58 B;  1L5U A;  1GTH A;  4ICL A;  2BW7 A;  4J9U E;  1N88 A;  4LF5 J;  2W7O A;  3IG1 A;  4ZVF A;  2VC0 A;  3N0V A;  4JUZ A;  3QRR A;  4A8S A;  3H98 A;  5B0G A;  4BC9 A;  3MMA B;  3QGP A;  2K7J A;  4FPI A;  3L9Z A;  1T9T A;  5DQG A;  2W9B A;  3FEX B;  3AB4 B;  4H4O B;  3DLK B;  3J7A N;  5FII A;  2D9O A;  4OYA A;  2B8Q A;  1KRP A;  3UN5 A;  3OVA A;  3EZO A;  2A2C A;  4F50 A;  1U6B A;  3BSC A;  2DHG A;  2NXJ A;  4B3R J;  3HSJ A;  2BX6 A;  3Q22 A;  3M30 A;  4LRA A;  3VVT A;  3K0J A;  1PJ5 A;  5D4L A;  2M4M A;  1TL7 A;  3X3U A;  2GHV C;  1NEE A;  1M5S A;  2B5J B;  2YTC A;  4U7C A;  2VA3 A;  2J0Q D;  4U96 A;  3E01 A;  2ZDO A;  1CC7 A;  4JV1 A;  4DPT A;  4O3S A;  4K4V A;  4MH8 A;  1S1V B;  1W2I A;  3OLA A;  1U1R A;  3THV A;  3PRV A;  2EG1 A;  3U1M A;  1DAR A;  2UVU A;  4F4A A;  3HVT B;  2BM0 A;  5CD4 A;  1WDT A;  3PEH A;  3CO0 P;  2FVP A;  2HPU A;  2DD8 S;  4ECU A;  3PW0 A;  2XCP A;  2F8H A;  3EX7 B;  5F0U A;  3KK1 A;  4NML A;  1WC0 A;  2J8S A;  2F5G A;  4WCE Q;  2GO8 A;  3BKU A;  2R8H A;  4C3L A;  1RE1 B;  4BC7 A;  3FSI A;  2CG4 A;  1FWL A;  2FZK B;  2W1B A;  3MPW A;  4WFB Q;  4OI0 A;  1FE0 A;  3IR5 B;  1FJG J;  4C48 A;  2X1G A;  3HZG A;  4QYZ J;  2CQC A;  1VQO S;  4KHM A;  3H90 A;  4NZ7 A;  3W7B A;  1A7G E;  1NU4 A;  3DRR A;  3WQP A;  2QGF B;  3GIR A;  3U1N A;  2JJ4 D;  3GG1 A;  4LF4 J;  3MM9 B;  4KQZ A;  1UW4 A;  1AUD A;  2GJI A;  4DR4 J;  2EW9 A;  4B9N A;  1HIY A;  1HI8 A;  4GKJ J;  1T95 A;  2X1B A;  2AJF E;  4CIO A;  1U1L A;  1ITP A;  1B0T A;  3AJD A;  1KR4 A;  5LSR A;  2F4V F;  5E0O A;  4X66 J;  4ZVH A;  4LQ3 A;  3EMT A;  4LFB J;  1XBW A;  5EUH A;  4EGL A;  1WG1 A;  3TUJ C;  3M6U A;  5E41 A;  2IY5 B;  4LF9 F;  4UTG A;  2F8E X;  4PWD A;  5DJB A;  4HKQ A;  4NLS A;  2X7I A;  5DS7 A;  4F2R A;  1HNZ J;  3HX9 A;  1U1P A;  4BWJ A;  1F9F A;  4NX9 A;  1TAU A;  2NLW A;  4PYA A;  2Z30 B;  4OI4 A;  3BF4 A;  3DN9 A;  3LQV A;  4ECY A;  3UI3 A;  3NS6 A;  4M8L A;  2Q66 A;  2YWK A;  1R8H A;  5DGA A;  2CPF A;  3BBB A;  3KXD A;  4XPC A;  2UXD J;  5LL6 d;  2WRM A;  3Q0A A;  4QCL A;  2RIJ A;  3MEG A;  3MHY A;  3TAQ A;  1QVF R;  2ZVI A;  3K5L A;  3OFE A;  1QE1 A;  1KN6 A;  4O3P A;  4JI4 J;  5I3Q A;  5IT9 Y;  1UVK A;  2RHQ B;  4X4U A;  3SXL A;  3K59 A;  1WI8 A;  4CH0 S;  4DR5 F;  1FX4 A;  4PAB A;  2BJ3 A;  2NXC A;  4WJB A;  4ZPB A;  3OVS A;  1TKX A;  3MM6 A;  1C2P A;  3O2I A;  4F0K A;  2E5H A;  3BBC A;  4M5H A;  1TK0 A;  1BHN A;  2R8I A;  1V6H A;  1Z2L A;  3DU5 A;  2C1E B;  2AYE A;  1TL1 A;  5IFM A;  4O4G A;  4DR1 F;  1FEH A;  3D7S B;  2LU2 A;  3T1H J;  1DQ9 A;  2A1B A;  1H73 A;  3MPV A;  3US5 A;  2OI2 A;  1Y5N B;  5IS2 A;  4AND A;  2HMI A;  1ZS6 A;  4LR7 A;  1TKZ A;  4L3N A;  1V3Z A;  1JX4 A;  3NRB A;  5I42 A;  4DV4 F;  5EGY A;  1NK0 A;  5JMN A;  4HTJ A;  1UP1 A;  2LQJ A;  4USU A;  1RTJ B;  3JTN A;  4ED5 A;  4U7U K;  2WTF A;  2L9N A;  3CCZ A;  5JXS A;  1UFW A;  2WVE A;  3PYF A;  4OI1 A;  1DTQ B;  1HFE L;  3QRQ A;  2UXB J;  2YKM A;  3IWL A;  3CJK A;  4EBD A;  3B6B A;  2W2N P;  4OZ3 A;  4DSF A;  3MR7 A;  1ZA2 B;  1TZ0 A;  4GKK J;  4OYZ A;  1TU0 B;  3CED A;  1Z2Z A;  3BZQ A;  1RZM A;  3QIP A;  3OUY A;  2V68 A;  2I38 A;  3NOC A;  2MKK A;  3OJU A;  5JJB A;  1EJ7 L;  2KG0 A;  4UOH A;  1U24 A;  2L41 A;  4XO0 A;  3K5O A;  2B9Y A;  3FRY A;  4P9S A;  3TVZ A;  1MWZ A;  3D0I E;  5DDO C;  1WEL A;  4DEZ A;  2P8I A;  4DG1 A;  4RZR A;  2JFD A;  2VG6 A;  1S1W B;  4TLQ A;  4F26 A;  4J9P A;  4V19 J;  4UOF A;  3SQO P;  1RGV A;  5CZV A;  1RAI B;  4MIA A;  4DV2 J;  2XI2 A;  4RLE A;  2H9Z A;  1D9F A;  3C66 A;  3MEE B;  4FVC A;  3W9I A;  4B08 A;  5D3G A;  4HAC A;  5E33 A;  3SCJ E;  2LXI A;  4Y28 C;  3GB0 A;  2MHN A;  1UVL A;  3N5B A;  2WVC A;  2W9B B;  4ZLL A;  1FKA F;  1RTD A;  1YQH A;  4BS2 A;  4YR3 A;  2DR9 A;  1IXK A;  1IKW A;  3MGJ A;  1OPI A;  4OX8 A;  1X5P A;  4M5N A;  1GT8 A;  1ACM B;  2CZ9 A;  1HD1 A;  2CDQ A;  3LAL A;  4CWB A;  1GAO A;  3FCV A;  2E5L J;  3RTV A;  4IH5 A;  4DR6 J;  3VGS A;  3PY8 A;  5CAA A;  3OTO J;  1MSW D;  1KFS A;  4NXM J;  3E01 B;  4ENO A;  2ZH5 A;  2KM8 B;  3W9J A;  3OW2 R;  3RAM A;  2KFY A;  4DL5 A;  4H4K A;  2EXU A;  3NLC A;  4QQB A;  4LRB A;  4KFB A;  3G82 A;  1DFD A;  3NGK A;  3FMW A;  1NJY A;  1U49 A;  4UZC A;  4U9R A;  2CIM A;  2N4D A;  3IMQ J;  4XDD A;  5IWA F;  3BRE A;  4DOZ A;  2XTJ P;  4XPE A;  4FYV B;  1NKE A;  4B9T A;  1T3O A;  2IJR A;  5C25 A;  5MLC V;  1BMQ B;  4IR9 A;  3D4J A;  3KNA A;  3PAC A;  5LXR A;  2IJF A;  2HVI A;  2DEJ A;  1ZH5 A;  2DY1 A;  1IKY B;  3CSK A;  3DRR B;  4WTY A;  5J1E A;  3MUT P;  1KLM B;  2W01 A;  3D6T B;  4OJG A;  5U47 A;  3CW2 C;  3SQG B;  2CJ9 A;  1M1H A;  4RX6 A;  4G6V B;  4FF3 A;  1KQK A;  4TQS A;  3A8I A;  3NBP A;  2AWZ A;  1V5V A;  1X4A A;  1SKR A;  4DV6 J;  3GON A;  5E3C A;  3RBE A;  5KOX A;  3ZZO A;  3PVX A;  5DDR C;  3R6G B;  3BJY A;  3K57 A;  3DDI A;  4IH6 A;  2YBV A;  4KJI A;  5IV3 A;  1SIW B;  2DNZ A;  4OI6 A;  1OY6 A;  2FVS A;  5J2P B;  1RA7 A;  1NBE B;  3PFE A;  4P52 A;  3BSO A;  2HK2 A;  1F9E B;  2B9X A;  1HBU A;  4X64 F;  5L39 A;  1S10 A;  1ZM4 A;  4B3M F;  1EB0 A;  4TYB A;  5AE3 A;  4CLZ A;  2P5V A;  4WK1 A;  2VHG A;  3FUY A;  5J2N B;  5M2R A;  1Q8B A;  2JLE A;  2ZBC A;  3P45 B;  4ZA1 A;  4K2X A;  5D8H B;  1IBM F;  1TMJ A;  4NAS A;  3MAH A;  2DXF A;  4DUZ F;  3OT9 A;  5ETO A;  3T6J A;  4NE9 C;  2PGC A;  2DNG A;  2C22 A;  4KKO A;  3TOQ A;  2Y1R I;  2FC9 A;  4LSL B;  1L3T A;  1KQG B;  1AT1 B;  3CPW R;  2VDI A;  1S7H A;  1RAD B;  4ZVQ B;  4I56 A;  3KNG A;  4P7V A;  1SL0 A;  1NSA A;  2OGU A;  4X4R A;  5GAH I;  2WZ1 A;  3PIP Q;  2CQI A;  3EVO A;  2RF2 B;  1TKZ B;  3KWM A;  3GQC A;  2M7S A;  2BE9 B;  3DLJ A;  4C6A A;  2HNZ B;  2PFF B;  2VQF F;  2J7W A;  1FNM A;  1IKV A;  1YJR A;  3ZZP A;  1NUE A;  1WF0 A;  2DNO A;  4C8N A;  3SDE A;  5DQI A;  3TAM B;  4DPU A;  1X4D A;  4Q8F A;  3BQ0 A;  3UO0 A;  1OY8 A;  2HNY A;  1RAE B;  2MKY A;  1VQM S;  4B9L A;  3K58 A;  5H9E K;  2MQN A;  3N6N A;  1KQS R;  4O3O A;  3PHE A;  2VC1 A;  3TVK A;  2KT5 A;  2CDR B;  1T03 B;  2IRU A;  5C2C A;  2IC3 B;  4DUY J;  1FXL A;  5F8H A;  2DNK A;  2M8H A;  4ZP7 A;  3CCE S;  4DSE A;  2BJ1 A;  4DG1 B;  2H5J B;  2VG6 B;  1RK8 A;  3IS9 B;  1JMT A;  1VMB A;  1NPP A;  2OSQ A;  2R7U A;  4MYT A;  3I82 A;  2IA0 A;  3W66 A;  1X4B A;  3D68 A;  5HMW A;  2EBE A;  3QO9 B;  1HWL A;  2AJ1 A;  1DUR A;  3CCU S;  1P6T A;  2YWW A;  1VBK A;  3DDK A;  1WOO A;  3EDR B;  1QLN A;  3AOC A;  2FJA B;  3VAF A;  7FD1 A;  4WKY A;  4L74 A;  1HNW J;  4DFP A;  4QIE A;  4ECV A;  1HNI B;  1S1U A;  3Q2T C;  1FWP A;  2YX7 A;  4K0K J;  1VK8 A;  3NNC A;  1RAG B;  4WP8 A;  3T5L A;  4I7F A;  1WKJ A;  3EYZ A;  5T7L A;  4Y2C A;  4UY8 5;  3D67 A;  3AH6 A;  4KB7 A;  4OV1 A;  3TUZ C;  4IDK A;  4WTO B;  5J1P A;  2HQG A;  1RKI A;  2OHD A;  6AT1 B;  2HHV A;  3ONQ A;  3FJ2 A;  2FJX A;  1H7W A;  1IR1 A;  4ETZ A;  3I4P A;  4RNO A;  3H25 A;  1XC9 A;  4OX6 A;  1XR6 A;  2ILZ A;  1WEX A;  3LAM A;  2B0G A;  5DO2 A;  1X0F A;  1S77 D;  2HHW A;  4ALZ A;  1UFL A;  4EYI B;  2O01 C;  5A6W A;  5AXN A;  3JSM A;  3EWG A;  3M9N B;  4KFB B;  3AD7 C;  1HQ2 A;  5HVF A;  1MG7 A;  2OFG X;  4ZS6 A;  3I9Z A;  2P6T A;  4L76 A;  5L1J A;  1FVS A;  5ADZ A;  2HIY A;  5K9F A;  2DH9 A;  2XYP B;  1OYE A;  2C2O B;  4QWA A;  2IM3 A;  1YJW S;  4F0M A;  3N4W A;  1YKW A;  2RDJ A;  2P2C B;  3DRX A;  3V5R A;  2COL A;  5KFP A;  5CCM A;  4JI1 F;  1UZH A;  2ZIT A;  4KO0 A;  3R6L B;  4DV5 J;  2LLZ A;  3GSD A;  3I5B A;  3H5U A;  2Y1I A;  1RHR B;  2HS0 A;  1U7L A;  4WYL A;  1WWH A;  4A47 A;  1WF1 A;  4OHX A;  3BGL A;  1N5Y B;  4MJK A;  2DRA A;  4DCP B;  1RAJ A;  3IR7 B;  5DLF A;  3BO2 A;  3NBP B;  4WWS A;  5ETL A;  3NAH A;  1EAY C;  3ILI A;  1QUP A;  5KFX A;  4BBY A;  4OZ0 A;  2OD4 A;  5IXU A;  3OHA A;  4QW9 A;  1D9A A;  1KWM A;  3UD3 P;  1YVF A;  4USK A;  2WON A;  2MXY A;  3I6P A;  4FDF A;  1F6T A;  4ZJO A;  2VG5 A;  2BRL A;  2QV6 A;  3NY0 A;  3U1L A;  5HMX A;  1UW9 A;  2QA1 A;  3I87 A;  3HD1 A;  2GMJ A;  1FO1 A;  5RUB A;  2C2K B;  2RQM A;  4RW4 B;  3M2R A;  4YB6 A;  1WKK A;  4QR2 A;  1LV5 A;  2YH0 A;  1OQ6 A;  1H3D A;  1M5O C;  1HBU B;  3MMB A;  2H54 B;  5AJ3 J;  3JSY A;  3KG0 A;  1UWB B;  1RP5 A;  5GAD I;  3OQ2 A;  1S5Z A;  2FPH X;  2HSE B;  1U4B A;  3PW4 A;  4PPZ A;  3MI7 X;  3EVW A;  1PJ7 A;  3TQE A;  4JI5 J;  2UVR A;  3LW5 C;  4P74 A;  2DY9 A;  3JQM A;  3TX8 A;  2J8A A;  5AE1 A;  1UJ5 A;  3HJF A;  3F44 A;  4NLD A;  4OV6 A;  4C2M A;  3SFG A;  3S01 A;  4OLP A;  3HKW A;  1S9G B;  3KK2 A;  2VD3 A;  3T1Y F;  1HQE A;  4P2S A;  3DXB A;  2ZZT A;  3W2V B;  4NL5 A;  2KTQ A;  3GJR B;  4JI8 J;  1NHV A;  3B54 A;  1Z4U A;  5D0R A;  4LFC F;  3KYL A;  4MK9 A;  4LF5 F;  1X5O A;  3IBC B;  5F8M A;  3DU6 A;  1JJC B;  3EPI A;  1K8A T;  4DV0 J;  1IKV B;  3QGH A;  1XR5 A;  2AJ2 A;  1VIS A;  2K7K A;  2DR8 A;  4PXE A;  3QJP A;  3HHL D;  2QSW A;  3UVJ B;  1OJ4 A;  1V5I B;  3CC7 S;  4UZB A;  1RT7 B;  4N76 A;  1YGY A;  2B9W A;  4R0J A;  4NEZ A;  1T8E A;  1SJF A;  4EBC A;  4B3R F;  2XMW A;  4M5D B;  4K4T A;  3ZFV A;  2G2O A;  1NKB A;  5CXT A;  5A76 A;  2PSZ A;  1SJ1 A;  4DV1 J;  3VHQ A;  2Y8W A;  2M8D B;  2RJZ A;  3U02 A;  1V3S A;  1OSD A;  4DR3 J;  1MWQ A;  2KKH A;  3RB6 A;  1IN0 A;  2D3O R;  1HBO A;  4ZPV R;  5C5J A;  1RTH B;  5D0G A;  4WU3 A;  2BR0 A;  2O5D A;  3NMR A;  3QJJ A;  1UWA A;  2QL5 B;  3CMA S;  2MLY A;  1LWC A;  3F56 A;  1N32 F;  2PN6 A;  3FVY A;  4L72 B;  2KG1 A;  1RYS A;  3PTW A;  1HR0 F;  2ATC B;  4AL6 A;  1BWE A;  2DHX A;  3FBE A;  5T7L B;  2E66 A;  2P9E A;  3CCM S;  4EK2 A;  3IGV A;  1GMW D;  1NH7 A;  2V0N A;  4O44 A;  3EZU A;  2R8J A;  1QAX A;  4K4S A;  1LWF B;  4LF4 F;  2V2Z A;  4WYW A;  2WVB A;  1KQF B;  3NOG A;  1LOU A;  4P71 A;  5ETK A;  5HP1 A;  2JX2 A;  4GKJ F;  4HVZ A;  2LCW A;  2ZKT A;  4R25 A;  2DR7 A;  4J9L A;  2OMO A;  4RBU A;  4X66 F;  2PA8 D;  5DQH A;  4LF8 F;  1HNX J;  3M8P A;  1UEV A;  5KFF A;  1RLC L;  2DIT A;  4C11 A;  3FFI A;  4J9R A;  1EKR A;  2HWI A;  3PJX A;  4CLS A;  3TZZ A;  5FJ4 A;  2GJF A;  1BQX A;  4NLG A;  3BV8 A;  4OLO A;  1MW7 A;  4I67 A;  1B3T A;  2GVZ B;  4KPC A;  1JLQ B;  4RBT A;  2W4D A;  1ZPW X;  2QE5 A;  2XS5 A;  1F2H A;  2YKA A;  3A12 A;  3KLH A;  2CJY B;  2O66 A;  3CMQ A;  1D8Y A;  3MOZ A;  4K4U A;  2UXD F;  1SC3 B;  3MM8 A;  1CUL A;  3GYX B;  1FCA A;  2RUG A;  6FDR A;  1M5P C;  4Q0B A;  3CDA A;  1JLG A;  1NXI A;  4DR2 J;  3W3S A;  2X1A A;  4ZJL A;  1PG5 B;  2OD6 A;  1SH2 A;  3MPU B;  1AXQ A;  3ZZZ A;  4YB7 A;  3FBB A;  1E6Y A;  2ZBI A;  1FFW B;  1N34 F;  5IV4 A;  5KFI A;  3CNQ P;  5IC4 B;  2CQ2 A;  1HWK A;  1TL5 A;  5C2G A;  2R7W A;  2D1C A;  1CG2 A;  3O1L A;  2M0G B;  4LMZ A;  3MWB A;  3AA8 A;  1BD6 A;  4W92 B;  4IR1 A;  1YBU A;  2WON B;  3I0S B;  2ZHB A;  4U67 Q;  3T9Z A;  4MKV A;  3K89 A;  3V6J A;  3PNI A;  4I2Q A;  5KG1 A;  3ADA C;  5LMU J;  1Q4R A;  1HBM A;  2VBY A;  3IM9 A;  1HQU B;  2QO3 A;  3NS7 B;  1LW2 A;  1RYR A;  4KAI A;  3OTE A;  2JLG A;  1Y3J A;  2EFP A;  1X0P A;  5IQQ A;  4ETX A;  2CXE A;  3S8S A;  2LFV A;  4NZ6 A;  2R9L A;  4WK3 A;  4J90 A;  2IBK A;  5KFJ A;  4GKK F;  3ZTR A;  2AIR B;  3SMZ A;  4F04 B;  1WC5 A;  3I4H X;  1KOH A;  1K1S A;  3DI6 A;  3IRX B;  5ETM A;  3RB0 A;  4DDF A;  3VGU A;  1KBR A;  4URS A;  2MMY A;  1AB8 A;  1VJW A;  1NK7 A;  5ETV A;  1NPR A;  2VF3 A;  1FRL A;  2RB7 A;  5K8P A;  4WPA A;  1HQE B;  1R8C A;  2DNM A;  3NGU A;  4TU9 A;  1PKU A;  3BR8 A;  1ZBT A;  3POT B;  4QWD A;  1XMO J;  1T05 A;  4TY8 B;  2VOP A;  1I94 J;  5L46 A;  1AZS A;  1H38 A;  1WG5 A;  1KON A;  2N4C A;  1S6U A;  2IDL A;  2DNP A;  2GIF A;  2FD2 A;  2FVC A;  2B6A B;  4U6P A;  1JNZ B;  2VOD A;  4JI7 J;  3KDO A;  4FXW A;  4PRF A;  3GFX A;  2GQ2 A;  4HL9 A;  4ER8 A;  2L48 A;  4GVB A;  1OPZ A;  5H9F K;  5A2Q Y;  2ZWO A;  1S57 A;  4CO5 A;  3DRS A;  1WUU A;  2GNK A;  1U6F A;  4RW7 A;  3OR2 A;  4YP3 A;  5EHH A;  1VQP S;  5HVG A;  2E5L F;  3D6H B;  3JQK A;  2HYI B;  1K9M T;  4PYD A;  2KI2 A;  2RNE A;  1L3U A;  3ISN C;  4DR6 F;  1VC0 A;  3KHH A;  2OPQ B;  1SQE A;  4ECQ A;  5DRK A;  2QRR A;  4F0H A;  1OYD A;  1FES A;  2HND B;  4ELV A;  2J6U A;  2XO6 A;  4M5J A;  5LSL A;  4V1A k;  1ZOT A;  1NO8 A;  1PSD A;  5MAO A;  2V6A A;  3OPK A;  5AXK A;  2F9D A;  3J80 U;  2HZV A;  4RW8 B;  1HW9 A;  3GZ7 A;  3PJ9 A;  4KTQ A;  4NA1 A;  3R1L A;  1RT6 A;  1KDN A;  4YQW A;  4XAK A;  2K1R B;  4CLW A;  4HHU A;  2MY7 A;  1TUW A;  1RWK B;  3IM8 A;  2DBB A;  2GGP B;  2L9D A;  4Z7Y A;  2XMK A;  4ED3 A;  1FDN A;  4WXO A;  2UUA F;  4A8X A;  3FZ2 A;  2LXF A;  3RRK A;  2YX4 A;  4ZIW A;  2HGM A;  2YX1 A;  3DRP A;  4TY9 A;  1QY7 A;  1S9F A;  2HQ3 A;  3VGT A;  1FVQ A;  3HFV A;  2R8K A;  4IO9 Q;  4FYX B;  4LRF A;  2HHH F;  5HP1 B;  1WD6 A;  2DB1 A;  4F3O A;  4LUB A;  1G3O A;  4QWC A;  5GAH U;  2GAH C;  3M8P B;  2VFR A;  2MYF A;  1EET A;  1TV6 B;  2J5A A;  4FVM A;  3M7V A;  2DJW A;  1H7X A;  4DFK A;  2R7R A;  2AZ1 A;  2K3K A;  4EFA C;  4IG3 A;  1NCL A;  4ZIV A;  5T14 A;  4MKY A;  4NYZ A;  3HCX A;  4ZKA A;  3PV8 A;  1EKS A;  4NZ0 A;  4WXW A;  4DS5 A;  5KG3 A;  3FEY B;  3KLF B;  2VJV A;  2GV1 A;  3CCQ S;  1EQM A;  3DMJ A;  4TNO A;  3MM8 B;  3OTC A;  2R4F A;  1FER A;  1H2U X;  4B3O B;  1CUL B;  2HBR B;  4JB8 B;  5E2Q A;  3NL0 A;  1CS4 B;  3CD7 A;  4PQU A;  3BQ1 A;  4OMF G;  3Q8S B;  1F3F A;  1VRU A;  4OZJ A;  2AX0 A;  4ILM A;  1PIL A;  1QAY A;  1TQL A;  3HFZ B;  3HF5 A;  1E6Y B;  2O67 A;  4E8U A;  3K8W A;  2ERR A;  2MPU A;  2QMW A;  4ZPC A;  5CYJ A;  1SKS A;  1FRK A;  2E5J A;  1B7Y B;  3MAQ A;  8RUC A;  2YNI A;  3TJ9 A;  1VYA A;  5KFU A;  3HPO A;  1TK5 A;  1KOO A;  1C4C A;  4I2Q B;  1A9N B;  1S1X A;  3H2U B;  4J9K A;  3SI8 A;  1TFW A;  4LT6 A;  2OEK A;  5DZ7 A;  3TZY A;  4ZDN A;  5GVQ A;  3DC2 A;  2MJN A;  2OPS B;  1RAC B;  3MTJ A;  2ZZM A;  5KFH A;  3MCM A;  2ZUG A;  2H65 B;  2Z2Z A;  4QZV B;  1N36 J;  4NRU A;  4O0N A;  3ELH A;  4DSK A;  2CJX B;  4AXI A;  2BE2 A;  2BRK A;  2ZBP A;  4FF2 A;  4YN3 B;  4OYB A;  2XWY A;  3VZH A;  5HAN A;  4B9U A;  2FY8 A;  3DM2 B;  5K14 A;  2CWK A;  5SZT A;  4HHH A;  3AY0 A;  2WHO A;  5DDQ C;  2ZM6 J;  4ID8 A;  4ATN A;  4DUY F;  1RHK B;  4UQG A;  4H4M B;  2HZA A;  2MHE A;  4FYW B;  2HHQ A;  4NYO A;  3LGN A;  1ZTW A;  3R8Y A;  4I69 A;  1YDL A;  3FEZ A;  4MK8 A;  2MSS A;  1WHX A;  3PKM A;  3OSN A;  4PXD A;  4ANE A;  1HYS A;  2W2P P;  2JVO A;  1VBX A;  1AZS B;  4FBT A;  1TK8 A;  4HLB A;  3G2X A;  1RT1 B;  4J9M A;  3RYL A;  4WKR A;  5IWA J;  3T1A A;  2XZW A;  1HNW F;  1K44 A;  3I0R B;  1HLW A;  3BEG B;  4DN0 A;  2DR6 A;  4K0K F;  4KV8 B;  1O51 A;  1RT3 A;  4KH1 B;  4JI0 J;  3AFG A;  2BJ8 A;  3AOB A;  1FKP B;  4OJ1 A;  4C0B A;  2VU5 A;  2QL9 B;  4Q43 A;  2E5I A;  2ROE A;  5J2M B;  4M63 A;  3DRS B;  1IKX A;  4E2F B;  3VQS A;  2HWH A;  3ITH A;  4FXV A;  1CJV B;  1DTT A;  4HH0 A;  2XGP A;  1U8W A;  2Z4P A;  1DBD A;  3SV4 A;  3CCW A;  5KG0 A;  1TL3 A;  1T3N A;  2GMH A;  3BYR A;  4X62 J;  3ETO A;  4ZHR A;  1NPK A;  4CLF A;  3RU0 A;  4DJB A;  1Y5I B;  1RHU B;  2FLP A;  2WW8 A;  1N6Q A;  3Q8V A;  5CYQ B;  2HUR A;  2XG8 A;  2K8G A;  3D9B A;  2EWH A;  1BQM A;  1FTR A;  5ETS A;  2FHM A;  4CRJ A;  3C6U A;  2NXN A;  2JOQ A;  4C8K A;  1F5C A;  2H5I B;  3GJT B;  4OI2 A;  4ED0 A;  1YJ9 S;  1R0A B;  1ROF A;  3BSN A;  1VQL S;  3R1H A;  4Z2X A;  3EXC X;  5GAD U;  2CPY A;  2V50 A;  2BBE A;  2PO4 A;  5AT1 B;  3JAM Y;  1XER A;  2OJ3 A;  2J0X A;  1QD1 A;  2M3D A;  4FNI A;  1MN7 A;  1RWN B;  5KFV A;  4X64 J;  2DGS A;  3G96 A;  2FYX A;  1SUQ A;  2CPX A;  1ICE B;  2CNL B;  4ZVE A;  1ZPV A;  3QGI A;  1SQG A;  1VQ5 S;  2CQH A;  3GYG A;  2J7U A;  1NZ8 A;  2E1P A;  1DRZ A;  3KLI B;  4LSN A;  2C2M B;  3DLG A;  3GCX P;  1FRJ A;  2HK3 A;  4OFZ A;  2HAF A;  1NJZ A;  4HEA 9;  1EET B;  3NGD A;  4GO7 X;  4RNH A;  3JSB A;  2L9W A;  3EUN A;  3VAG A;  2BKO A;  3TA0 A;  2C2R A;  2YNF A;  2RT3 A;  1IQT A;  1H2T Z;  2W4P A;  1NM2 A;  4NLY A;  1AYE A;  3LF0 A;  3IWX A;  3G9C A;  4NXN J;  3TJ8 A;  4DCJ B;  1Q7L B;  3Q23 A;  2XZT B;  2R7T A;  3TUI C;  3IN5 A;  2VQF J;  5AJ3 F;  2WSC C;  3GP9 A;  1GXT A;  2W4C A;  4PQU B;  2CPI A;  4AYB D;  3QT8 A;  4U8V A;  4RW9 B;  4ANC A;  4H4O A;  3V81 B;  1VRU B;  1FHT A;  1RWO B;  2PFD A;  1Q82 T;  4JI5 F;  3QT7 A;  2HFU A;  4KPY A;  3CJS A;  2MQQ A;  2ABY A;  3GV8 B;  5DM7 Q;  3W5X A;  4GC7 A;  5ITH A;  3BKF A;  1J2V A;  5D4N A;  3BKT A;  3GJS B;  4WBF A;  3I31 A;  3C16 B;  1VQY A;  2NZC A;  2N7Y A;  3W5Y A;  4K4X A;  3R2C J;  2VUG A;  2CPH A;  3WDO A;  2JEJ A;  2BA9 A;  2XMJ A;  1WC3 A;  2FLN A;  1TUV A;  2EK1 A;  5K5M A;  4JI8 F;  1RAF B;  1M0S A;  4BDP A;  2HQF A;  4IO1 A;  2CPE A;  2UUC J;  4CO3 A;  3RBX A;  4MAK A;  3A1Y G;  3HVT A;  3AQP A;  4TU7 A;  4KT0 C;  1BC6 A;  2X3G A;  1U47 A;  1T94 A;  2VA2 A;  4ZP6 A;  4M5I A;  2NXU A;  2BE2 B;  5KG2 A;  1R7I A;  2QLJ B;  4AL7 A;  2CPZ A;  3LAK A;  3N6L A;  3H4B A;  3LA0 A;  4NYP A;  5K8O A;  4WZM A;  1N5S A;  3R5C A;  2JEI A;  2EBG A;  1K1Q A;  3NCP A;  3MAA A;  5F9L A;  4A8W A;  3ET6 A;  4DX8 H;  4J5O A;  2HRY A;  3ZZT A;  4Q2M A;  4K4Z A;  4GVL A;  3MED B;  1FK9 B;  3GJQ B;  2RS8 A;  2QSF A;  2BKP A;  1R8B A;  2HQI A;  1MML A;  4I2P B;  5EN1 A;  4NWB A;  2CPD A;  4DR3 F;  3C46 A;  1X60 A;  2IM0 A;  9RUB A;  4P2M A;  3DDN A;  4N47 A;  1HYS B;  4U7U D;  1R6V A;  2G2Z A;  3A8K A;  3AD9 C;  1NJW A;  2XS7 A;  2DNL A;  2Q1L A;  2RKI B;  2MGZ A;  5KOW A;  3CJQ A;  4ES2 A;  4ZVT B;  5B0C A;  1RTZ A;  3D28 A;  1X7V A;  1R0C B;  3TA2 A;  2N7C A;  3IO1 A;  1XTZ A;  1RT3 B;  3UNG C;  1UVN A;  1WOR A;  1ZZF A;  4UOG A;  2IMO A;  2FLL A;  3MMJ A;  2DXD A;  1TKD A;  4NA3 A;  1GFW B;  4FYD A;  4I0W A;  1TVR B;  3M4X A;  3QZ8 A;  3AB2 B;  4UUW A;  3FK4 A;  4JI1 J;  4A8Y A;  1S4E A;  1WSR A;  3CUL A;  4RO0 A;  4KSE B;  3PW7 A;  2VAS A;  4RNN A;  5F41 A;  1SCJ B;  1TL3 B;  4I4B A;  4B3S J;  3R27 A;  4OHV A;  4ZHR B;  1WEZ A;  4Q7A A;  2RQ4 A;  4FPR A;  1P1T A;  2W2M P;  1N6Q B;  2AV5 A;  1RXO B;  4Y3C A;  1OWX A;  2YQ3 A;  2RRB A;  3DGP B;  2G0C A;  1U48 A;  3AQO A;  2KYX A;  1UJ4 A;  1HNX F;  5CH7 B;  5GAE I;  5DGB A;  3OXF A;  2V2V A;  2ZH1 A;  2MEW A;  4F3Q A;  4M5K A;  7FDR A;  1KVJ A;  1NK4 A;  3Q8R B;  3R2D J;  1T11 A;  2E9T A;  2DGO A;  4PQA A;  1OIA A;  2MLX A;  3GWC A;  4X84 A;  1GNK A;  2V9K A;  2XMU A;  1GH8 A;  1X4H A;  2R7X A;  1X9W A;  4DQI A;  4OI3 A;  2EC0 A;  4OZN A;  3QAU A;  1RJJ A;  1RTJ A;  1HAR A;  2ROP A;  3KG4 A;  2V63 A;  2CAD A;  1DTQ A;  1R8P A;  4S0M A;  2EEY A;  4PG8 A;  3O44 A;  4C8Z A;  1SUQ B;  2MQL A;  2F65 A;  5D4P A;  3PX4 A;  3OXG A;  2WBR A;  5D15 A;  3H0P A;  1RBO B;  1YG0 A;  2VPW B;  1IR0 A;  1RLD A;  2MJU A;  2Q43 A;  3CD0 A;  2Z0G A;  4NCG B;  3TWZ A;  1F5A A;  5E7O B;  4Z37 A;  1AW0 A;  1URR A;  4RW6 A;  4LSN B;  2IHR 1;  4ECW A;  5DET A;  2MQ8 A;  3CIZ A;  3QGG A;  2NS1 B;  4PWW A;  1GTE A;  3DHX A;  2C3O A;  4OX9 F;  2R42 A;  3E8O A;  1QUV A;  3HHL A;  4KGV B;  3EGZ A;  3FCW A;  3N01 A;  3CJ4 A;  2BV3 A;  4CLT A;  2V4J B;  3HM9 A;  2RIL A;  3MZI A;  1Y5L B;  1S97 A;  3T1Y J;  2PMZ D;  1RTI B;  1NJI T;  2H5E A;  4HH1 A;  3NNH A;  5LMU F;  4KYZ A;  1G1X A;  4IQM A;  3OR1 A;  1QAJ A;  2V8G A;  5KFR A;  4LFC J;  2KXH A;  3LPE A;  3A8E A;  3OV7 A;  5CHC B;  2VQE J;  3MEE A;  1OSC A;  1S12 A;  4M5G A;  4F25 A;  5B09 A;  5IM0 B;  3K5P A;  4WIQ A;  1ZAW A;  3W63 A;  3CUN A;  2AGP A;  2CQ1 A;  1SJQ A;  4NCB A;  5A8K A;  2CQD A;  1UA0 A;  4I64 A;  4KRW A;  2HQC A;  4ZVG A;  1TL4 A;  3P8B B;  2AHO B;  4ZN1 A;  1K0V A;  3HT3 A;  4DQS A;  2HEK A;  4DI6 A;  2A6M A;  4PPD A;  2Q6C A;  2BQU A;  3HSD A;  1UPM B;  1NB7 A;  2LP4 A;  1MU2 B;  4DFM A;  4A8O A;  1S0V A;  3PR5 B;  4W90 B;  4C98 A;  5FDL B;  2J6S A;  3I32 A;  1WTF A;  4ZPD A;  2KU7 A;  1X4C A;  1X5T A;  3RG6 A;  1YHQ S;  1XMO F;  1RT5 A;  4Y2I A;  2LVW A;  2W2Q P;  3Q8Y A;  1QSS A;  3BH7 B;  1I94 F;  4CNZ A;  3ZTO A;  2C3M A;  4HI2 A;  2HBZ B;  1LK5 A;  2J0W A;  3AJ2 A;  2NPI A;  2ZEJ A;  2D3Z A;  1CJK B;  2RAQ A;  1LNQ A;  1N5V A;  4JI7 F;  4RU9 A;  4B9S A;  3THP A;  1N32 J;  5DDP C;  1JNR B;  5B08 A;  3BM7 A;  1HR0 J;  1R31 A;  4Y2M A;  5LJ3 Y;  4IRC A;  2DPI A;  3IGN A;  1G2E A;  2CWX A;  1K0T A;  1VK3 A;  3ILL A;  2BJ7 A;  2C2E A;  3MAA B;  2QLW A;  3U27 A;  2E1C A;  4HDG A;  5E3A A;  3ET6 B;  2BYC A;  1VBY A;  4IG0 A;  1LWE B;  1IKY A;  2DGV A;  3VAL A;  2IIH A;  3MMC B;  4Q2L A;  1KLM A;  3BGU A;  1KNZ A;  2V8P A;  3HSZ A;  5SUH A;  4URG A;  3SQG A;  2HRU A;  4K59 A;  4X4P A;  3NCR A;  1QSL A;  2D3U A;  5KT4 A;  2FLO A;  3ZXW A;  3MEK A;  2B4V A;  4CI0 B;  1ZM3 A;  4LF8 J;  1WAC A;  5KG5 A;  4CLK A;  3DGV A;  4Q44 A;  2OSR A;  2MGZ B;  1TMM A;  3ZTP A;  2IFX A;  2QMU B;  5E5N A;  1HHT P;  1H2V Z;  3RR8 A;  1FFS B;  3MFH A;  5KG4 A;  5J2P A;  2XEX A;  1GXU A;  2JH3 A;  1CQM A;  5ETT A;  3ZO7 A;  1I5O B;  2OP5 A;  2W25 A;  1XIQ A;  4PG5 A;  3KMQ A;  2IVM A;  5F8I A;  4M94 A;  1WOS A;  3R7B B;  1SBR A;  2CG8 A;  2ZZN A;  2HHU A;  1PIE A;  5J2N A;  3UFC X;  1RCO B;  4DF8 A;  5T41 A;  1WNE A;  4RNM A;  2QL7 B;  2RML A;  3I56 S;  1NDL A;  3JXO A;  4DSJ A;  3GLJ A;  2ZDP A;  3GR0 A;  3SCK E;  4PG7 A;  5A8W B;  3G8T A;  4KHR A;  1H6K X;  1C0U A;  2ZBQ A;  1T9V A;  1N34 J;  2G2Y A;  1ZYQ A;  2IM1 A;  3CD6 S;  2KYZ A;  4ZPT R;  1IM4 A;  4LSL A;  5JVG Q;  2XLJ A;  3D0G E;  2CKW A;  2FJW A;  3VCD A;  2CJB A;  4RPF A;  2Z56 B;  5AXM A;  2HVZ A;  5LOQ A;  4AXJ A;  1IBL J;  2KHD A;  3NMA A;  2RF2 A;  3PZP A;  3CO9 A;  3T5J A;  2HNZ A;  3F0N A;  4B02 A;  1OY9 A;  1R3N A;  4PZV A;  4LBI A;  2VZ9 A;  3A13 A;  4C8O A;  3C14 A;  4OZ5 A;  2X1F A;  3J7A 1;  3UR0 A;  1ZAV A;  4NI2 B;  4QR0 A;  3LP1 A;  3R5D A;  5KFZ A;  2XUL A;  2XLI A;  1HI1 A;  3TAM A;  4CO4 A;  1A0O B;  3M9M B;  1XNR J;  2M2B A;  2DO4 A;  2V4R A;  1HWJ A;  3DLH A;  3PW2 A;  4RW6 B;  2DIU A;  2GVD A;  2V67 A;  1LK7 A;  2DXE A;  1RHJ B;  1T03 A;  3P49 B;  5ETR A;  2IC3 A;  3FCH A;  2B7C B;  1SJ3 P;  5BYR A;  4R5P B;  1VS3 A;  2CA9 A;  3FSY A;  2CQ3 A;  3CJ3 A;  3JYT B;  3HHL B;  2VV5 A;  1F0X A;  4PCQ A;  3F41 A;  3IS9 A;  1QTM A;  1YWX A;  3TUP A;  3QLH A;  3Q24 A;  4TKT A;  2J0S D;  2CNN B;  1X5S A;  3KJV B;  4ECS A;  2R3V A;  2R7Q A;  1A6L A;  2BOP A;  3EGW B;  3AAW B;  2BEF A;  3QO9 A;  1JKH B;  1XJW B;  3OR1 B;  1Q86 T;  1EQ0 A;  1N52 B;  3RAQ A;  3CCV S;  3V2U C;  3EM1 A;  4O0I A;  5LT5 A;  4JI6 F;  1QJH A;  1FF2 A;  1QVG R;  4R8U B;  4M5L A;  1HNI A;  1N36 F;  3TA1 A;  1FFG B;  1M5V C;  1YJU A;  4NPO A;  5F0W A;  1JLF B;  3CJ2 A;  5A8K B;  4D3G A;  4F02 A;  1H74 A;  2CQG A;  4IQX A;  2YVS A;  1PGZ A;  2G9O A;  5JVH Q;  4XK8 C;  4OYX A;  5KFY A;  4KHP J;  4DL7 A;  2E5G A;  1Y10 A;  3UNY A;  2ZM6 F;  4TLR A;  2YWG A;  3GG0 A;  1Y0H A;  3DXS X; 
#chains in the Genus database with same CATH homology
 1RWM B;  3EDR B;  2XZT B;  2QL9 B;  4ZVT B;  3D6H B;  2H4W B;  5IC4 B;  2H48 B;  1RWP B;  1F9E B;  3GJR B;  2C2K B;  1RWN B;  1IBC B;  2CNK B;  1RWW B;  2FQQ B;  2HBZ B;  3P4U B;  2QLJ B;  3R7S B;  2XYP B;  1ICE B;  2QL5 B;  1I3O B;  3IBC B;  2C2O B;  1GFW B;  1RHK B;  3KJN B;  2CNN B;  2H4Y B;  3P45 B;  2CNL B;  4ZVP B;  1PYO B;  3QNW B;  2XYH B;  2P2C B;  2H54 B;  3RJM B;  1RWO B;  3KJF B;  1PAU B;  2Y0B B;  4ZVR B;  4ZVS B;  1SC4 B;  1RHU B;  3R6L B;  1RWX B;  2HBY B;  2C1E B;  2C2Z B;  2CDR B;  5K20 B;  5IC6 B;  2HBQ B;  2XZD B;  1QTN B;  3NS7 B;  2DKO B;  1SC1 B;  2C2M B;  3GJS B;  3IBF B;  1RHR B;  2CJY B;  3GJQ B;  4LSZ B;  1NME B;  2H5J B;  1RHQ B;  1SC3 B;  2XYG B;  3SIP B;  3R7B B;  4DCO B;  3R5J B;  4DCP B;  2CNO B;  2H51 B;  4ZVO B;  1RWK B;  3R6G B;  4ZVQ B;  3D6M B;  1RE1 B;  2H5I B;  3GJT B;  1RHM B;  3KJQ B;  2QL7 B;  2QLF B;  2H65 B;  3D6F B;  1I51 B;  1QDU B;  1RWV B;  3R7N B;  2HBR B;  3EDQ B;  4JB8 B;  2QLB B;  2CJX B;  1RHJ B;  4ZVU B;  2Y1L B;  4DCJ B;  1BMQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...