1RWKB

Crystal structure of human caspase-1 in complex with 3-(2-mercapto-acetylamino)-4-oxo-pentanoic acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwkB00
5IC4B 1QTNB 4ZVQB 1RWOB 3NS7B 1GFWB 3GJSB 2C2ZB 2CNOB 2QL9B 2H4YB 3KJNB 1RHUB 3EDRB 4JB8B 2XYGB 3P45B 1RWWB 2C2OB 1RHRB 2H48B 2CNKB 2QL7B 4ZVPB 4ZVTB 2QL5B 2HBRB 3D6MB 5K20B 3R7BB 1SC1B 2DKOB 2QLFB 3R6LB 3R7SB 3EDQB 1RHMB 2HBYB 2Y0BB 3QNWB 4ZVOB 3D6HB 2Y1LB 2QLBB 2FQQB 2H54B 3D6FB 2HBQB 4ZVRB 1RHJB 2H4WB 3SIPB 2CNNB 2C2KB 2QLJB 1F9EB 4DCJB 3IBCB 4LSZB 1ICEB 4ZVSB 1RE1B 2H51B 1QDUB 1RHKB 2P2CB 3KJQB 1RHQB 1PYOB 1RWNB 1I3OB 2XZDB 2H5JB 3IBFB 2CNLB 4ZVUB 1RWKB 2CJXB 1IBCB 3GJTB 2HBZB 2XYHB 3R5JB 1NMEB 5IC6B 1RWMB 1BMQB 3GJQB 2CJYB 2C1EB 2CDRB 2C2MB 3RJMB 1RWPB 1PAUB 2H65B 1RWVB 4DCOB 3R7NB 2H5IB 4DCPB 1SC3B 1I51B 2XYPB 3P4UB 2XZTB 1SC4B 1RWXB 3R6GB 3GJRB 3KJFB
chains in the Genus database with same CATH superfamily
4B3MF 1S1UA 4YOEA 1N36F 1RZMA 1DTTB 2HHSA 4YR2A 3JQMA 1GTHA 3WC2A 1SL0A 1WTFA 3D6TB 3TARA 2L41A 4N8NA 3B82A 4O44B 3U1LA 1X9MA 3IRXB 4NZ0A 1AA1B 3G82A 3MTKA 2FB0A 1X4AA 3VR1A 2EC0A 1H2TZ 4ECRA 1YLXA 3DYAA 4DMZA 1U26A 4JI6F 1DQ8A 1ZA1B 3M9OB 3KLIA 2CJAA 4YDXA 3OUYA 3QSYB 5K14B 1QAIA 2JSXA 4ECYA 4FXDA 2ZHOA 1T03A 1J5OA 2YKPA 4A8OA 2L48A 1RTIB 5KFWA 2GGPA 2G2YA 4CLWA 5I4MA 2E5GA 1HBUA 3VAHA 3D5MA 3SSQA 2HNYA 1HNIB 4LF9J 3PRBA 4RW4A 4ZLPA 4CO4A 4DUZF 1YGYA 4OLPA 1UL3A 4NMLA 4YN3B 5I42A 1BUXA 4JB8B 1AT1B 2MY8A 1X7VA 4OJ3A 3R27A 5KT7A 1C0UA 1A7GE 3QBCA 1GT8A 1KLNA 1GAOA 3OVAA 2AMCB 4DV7F 3KK3B 2QRRA 2FY8A 3OR2A 2IPOB 2DISA 3R97A 2V0NA 4K7QA 2F9JA 4C3LA 3ZZOA 1VBKA 3GYGA 1D0EA 1VMBA 1X4DA 3FFIB 2BDPA 1S79A 2OI2A 5GAEI 1WG5A 1EQMA 3IO1A 2GA7A 3UR3C 5B0EA 3D28A 5HQMA 5F3ZA 4HEA9 2X1AA 2BMBA 2ZBRA 1JJ4A 3HHLA 2YX1A 2DYAA 2NXEA 2AZ1A 2R2UA 1RT5B 2MHEA 1IVZA 4K5RA 3FEYB 1SJRA 3M2VA 2HFZA 5HMXA 5KOWA 4HR2A 2UUBJ 5IS2A 2GJFA 2W4DA 5JVHQ 2DEJA 1O0PA 4KHMA 1W26A 1PCAA 2MSTA 4ES3A 2MLYA 2F8HA 4FF2A 2YNGA 5CYQA 1WJ9A 2Z2ZA 1T9UA 3FGVA 1S9GA 2DHGA 4LFAJ 3BSAA 1RB0A 4ED4A 1P27B 3BKTA 3SIPB 4E98A 2C2KB 1Q95G 1JWWA 5A8KB 3AODA 4ICLA 4OYXA 3T41A 2EFOA 4ID5A 1H6KX 2CQ0A 2D7SA 3EPGA 1P1TA 3UN3A 3BBBA 1FD2A 2BRKA 4DSEA 3HX9A 2R7XA 1EP4B 2VDHA 2J6TA 1KDNA 3X1LB 1Q5YA 3HT3A 2HVIA 4A46A 2WONA 2F4FA 1VRQC 3MECA 5JJBA 5KFAA 1GEHA 2UUTA 4UY8T 1S76D 3GJRB 2G2OA 1SVDA 3V4IB 4QR2A 2GJ2A 3HT0A 1GQEA 5CYMB 3JTNA 1SC6A 5A2QU 3CMQA 2BQ3A 1GH8A 4LF9F 2XY5A 2JLGA 1RACB 5HQLA 2I5JA 1L3KA 2GIFA 2I8EA 1VDHA 4C0OC 3LPYA 4CLKA 4WFXA 1PO6A 3H5UA 2F9DA 4V19J 4F2RA 1Q79A 4N76A 2RNEA 5KFQA 5AE2A 2V2VA 1SUQA 1PBUA 1NEEA 2G4BA 1BQMB 2C2NA 2EI5A 1SIWB 2HIYA 4F4WA 7FD1A 3LOUA 4N7TA 1KC8T 4U7UD 2BE2B 2EKYA 1AFJA 2CA9A 2VD3A 4FBUA 2GAGC 1RAIB 3TJ8A 1VJWA 4H4MA 3TWZA 1SL2A 4ED5A 4OYIA 1KVIA 3AB4B 1Q16B 2QA4S 4UZCA 3CEDA 1C2PA 4MIWA 1HBNB 2V4RA 5L39A 3LAMA 3ETMA 4I1TA 4DL4A 2XZWA 3MM6A 2EFQA 1S5ZA 1T9TA 2EW9A 4IFYA 1QD1A 3B4MA 3T9NA 2ZEJA 2VPZB 2BJ8A 2IC3B 1VQPS 3BQ0A 4P2FA 2YH1A 4NI2A 2VBXA 4DF4A 1QAJA 3PDNA 2DNZA 5E3QA 3BSOA 4CLZA 2UVUA 3JXOA 3HO1A 4LQ3A 1NCLA 3F41A 3TYTA 3SCLE 3FMBA 1EZZB 2QL5B 2HBRB 2I6WA 2E1AA 1VJQA 3KK2A 3ILLA 3BGFA 4FYYB 4J9LA 4NASA 3T3FA 3R8YA 5KFNA 1OWXA 1C1BB 1N34J 3AXMA 3CJRA 3NGUA 2HBQB 4ED0A 1WG4A 3MI7X 4ZJQA 4IOAQ 2C28A 1B99A 1HBOA 4MKAA 1HWLA 4LFAF 3GPAA 3QJPA 2IRXA 3SV4A 2W7PA 1NDPA 3DLEB 1XMBA 3IN5A 1X4BA 4KGVB 1LWEA 3A3NB 2XS7A 4ZITA 1M1GA 1Q8BA 4F3QA 1J5EF 2VG6B 4J9RA 4IRCA 4KYZA 5EN1A 3VGUA 2YNIB 3UQSA 1XR6A 4IG3A 2RKIA 4B9MA 4CLPA 5LT5A 4EEYA 3KUEA 3W8GA 2N82B 2V8HA 2QA2A 1LXJA 1VC5A 5DDOC 1RYRA 3GSIA 3NCQA 4M5DA 3M9NB 4DU7A 3D54A 2IY5B 3QGGA 3KUGA 3VGSA 2W1BA 4DL0C 3Q8SB 2NCKL 5BYRA 4FN5A 2ACMA 5IQQA 2GMHA 3D6MB 5HQ8A 3LWMA 3SDEB 2B43A 2XMKA 2N7YA 3OXLA 1OIAA 4JI5F 3PYFA 2DEIA 4Q2LA 4ZVFA 2E7XA 1BY9A 4WTYA 4OL8A 2LLZA 2O1PA 3DN9A 5K8OA 1V6HA 1VQSA 2GMLA 2GCFA 2HFSA 4HT5A 3SQOP 3W60A 4QIGA 4ZPTR 3A12A 1NJWA 1DQ9A 4RPFA 2OSRA 1T05A 4K2XA 4X65J 4LFCJ 1UA0A 3MM9A 2C1EB 3CJ4A 3DGPB 4RUBA 3C2PA 1KOOA 3UDVA 1RWUA 1TFYA 3MMBA 1V5IB 3S7RA 1EX8A 4DS4A 2M3DA 2I1RA 5E41A 1QY7A 1FRMA 4M1KA 3PR4A 2DPJA 3THTA 4AFFA 1HQUA 1IKWA 1GXUA 2M5YA 1U6FA 4J9PA 1TKXA 2ZZMA 3I31A 1IR0A 3KMQA 3KLEB 1VISA 1WORA 2UXDJ 2AJQA 3DI6A 2PMWA 3EUNA 2QLBB 2XMMA 3D6FB 3PNIA 1UZDA 1OYEA 2FJAB 4CI0B 2BX6A 5CD4A 2NSCA 3M2RB 2OAUA 2M70A 1N34F 1GMWD 4JI3J 2KJVA 3MR3A 1FX4A 1C4CA 4X4PA 3ILJA 5K9FA 4G3IA 2R9LA 4J9SA 4JI1J 2DO0A 1UEVA 3H59A 4KRWA 1RWXB 2W9BA 3KHGA 3VHQA 3PX4A 1N32J 3J80Y 4O44A 2DT9A 1XC9A 2XHWA 3SI8A 1S57A 3ZNJ1 2YNHA 1S6QA 1TL5A 2OPSB 2X51A 4GVLA 2FC9A 3PEJA 1VRUB 5D78A 4RJVA 5LSOA 4A8SA 2V2QA 3RAQA 2Y1LB 3EGVA 1WF0A 3JB9k 2N3LA 2XGPA 3DRSA 4CNZA 3DM2B 1WHXA 1B0PA 4D3GA 3AY0A 4U8YA 3KLHA 1N52B 3MURP 3HVWA 2AHOB 2FVCA 1BHNA 3CCJS 3DRYA 5IFMA 1FKOA 1LWXA 5B0AA 3PFEA 5DZ6A 3CJ8A 5T41A 4K2JA 2XEXA 1NDKA 3C8YA 4X65F 4RW8B 2BJ1A 2V63A 2VC0A 2QSFA 3IGNA 2V9KA 1NSPA 1U0HB 1ZA2B 4OI1A 4PRFA 2F8EX 1FJGF 4A47A 3KK3A 1RTZA 2I9SA 3IRWP 4ZOSA 3HCXA 2HHPA 4EGLA 2QE5A 4QR1A 4MKYA 4RBVA 3CUNA 3RB0A 1NZ8A 3RR7A 3H25A 2Y9HA 1QSSA 1SH2A 3IWXA 3F73A 1HNVA 2UXDF 1NHUA 2U1AA 4WFNQ 3QFWA 2Y3YA 1REVB 4P7VA 1KD1T 3TEHB 4WF9Q 3Q8YA 5F8IA 2HHHJ 4K4UA 1IM6A 1JQGA 2WCXA 3ZXWA 2RS2A 1QE1A 2ZZTA 3O44A 4BC7A 3AA9A 3LGNA 1P9YA 4KV8B 2GFFA 1FXLA 3M1VA 2VASA 5J2PA 4OZ3A 4JI3F 2D9PA 4X4SA 1R0CB 4IRDA 2V9WA 4H4KA 2YWGA 2EFGA 2KT2A 3HVTA 1TMJA 1KQFB 2FZCB 2HG4A 2D3O1 4PWWA 1UVIA 3M8ZA 2DITA 3ISND 3M7VA 2OPQA 1YITS 2JC0A 3NOGA 3U1MA 1BQXA 2F4VJ 2W25A 3TX8A 4C3MA 1N32F 5AXKA 1ZAWA 4RNOA 2Z2LA 5J1EB 5HMYA 4PUOB 4J9VA 3KLGB 5A8KA 4O3PA 1RK8A 2CPFA 1Y9OA 1PIEA 4HHJA 4Q7AA 4DEZA 3SFUA 2F1FA 3MAHA 1YWXA 3EE3A 4X4VA 4NA2A 1IN0A 3IAS9 2F63A 2D3OR 1R43A 2ZBIA 4A8WA 4ZIVA 1RT1A 3TAPA 5EUHA 2J8SA 3QSIA 1CC8A 3G4SS 1PC5A 2FY1A 2XY6A 2A0FB 1I6JA 2RU3A 1TQLA 1SQGA 3KMSA 1Y7PA 1LW0B 1RAEB 2VZ9A 4QW9A 3A1YG 1DZ5A 4WE1B 3R5GA 2CNOB 2GC8A 4PG4A 1KHVA 3SBMA 1NXIA 4CLSA 5GAGI 3OR1B 5ETPA 4KE5A 5H9FK 1RBOB 4CYUB 3HPOA 1R27B 2JH3A 3B6BA 2MGZB 3IR7B 4DX5A 1M1HA 1DURA 1U1MA 1M1KT 2HIQA 4NRUA 2GS8A 2MKSA 4NOHA 1K0VA 1ROFA 4AL7A 1U49A 2O5DA 2RF2A 4OZ0A 2XHCA 1JNZB 3V5RA 4GO5X 4Q45A 2JOQA 1R8PA 1R31A 4F8RA 2YTCA 4EBEA 2IC3A 1IR1A 2B4VA 2HHHF 3LAKA 4LREA 2ROPA 2WRMA 4QYRA 2CPZA 5FDLB 3BPDA 5C25A 5IV4A 3BYRA 2XC9A 5DG7A 4OHXA 3R6GB 3KK1A 4OHVA 2VFSA 2BM1A 4AQYJ 1OPIA 1H3DA 1XNRJ 3GFXA 3M6UA 3LW5C 3ENWA 4TU8A 2JWNA 2X1FA 2DK2A 3HHNB 1RHRB 3OXFA 3Q8VA 2J0SD 2F4VF 4NLOA 4DL5A 3LGHA 1LFPA 3FCWA 3D6HB 2EBGA 2Z30B 3UD5A 4Z37A 1CSJA 2GO8A 1BLUA 3WHIA 1S0MA 1JLBA 2VG6A 2ZVSA 4QU6A 3GMGA 1YZ6A 1NHVA 3C15B 4MKBA 3UDEA 4J5OA 3E51A 1H98A 4OYAA 3KLVA 4J9KA 3TP2A 1HHTP 3GYNA 2BZ2A 4UQGA 1FTCA 1RADB 2JC1A 2IA6A 4KPYA 3I4HX 4C11A 2RMLA 4TKTA 3C6TB 3CPWR 3C66A 3IG1A 3VWSA 2OO4A 1Q5VA 2HEKA 4F0HA 4MAKA 1ZZNA 1IKYA 1OMSA 3CJ5A 2KXNB 4C9DA 1Q78A 4NZ6A 2DGTA 4WJBA 3SYZA 3GIIA 4K4XA 3CNQP 2I38A 3JSMB 5CCMA 4UW2A 4K4WA 1U48A 5K8MA 4I7FB 4L6V3 1C1CB 1S77D 1TUWA 3CDUA 4DF8A 4RNFA 3V6KA 2J9EA 1WOOA 4HLBA 2FC8A 2V94A 1QAYA 2I2YA 5A8WB 2AGQA 4Q8FA 2M8HA 5DJBA 2YVSA 4KO0A 1N0UA 2FQQB 3HHDA 2ILYA 2BYCA 3GIJA 1HWUA 2HVHA 2GQQA 1U1PA 3CCVS 3GCWP 1VQ7S 1RWNB 3G6ES 1WC0A 4OV6A 2XNQA 2ZH6A 3BGRB 2OLWA 3BN7A 4HTJA 3OVBA 1PYSB 4RWWA 4QWCA 2R8JA 3VCDA 5GAEU 1IJEB 2CQPA 3LP0B 2KHCA 4PEOA 4ELTA 2F65A 4NLTA 1QSLA 2HWTA 2DGWA 8AT1B 2ILZA 4DN0A 4AQYF 2MQMA 4CO1A 2XBPA 1FDAA 3RR8A 2UZAA 2CQ4A 1TAUA 4O4RA 1HL6A 4NLDA 3HI9A 4F7VA 5DG9A 1AROP 2DO4A 3ULHA 1O51A 2EVZA 1EARA 1ACMB 4ZP7A 2I0XA 4G65A 4USJC 3FBCA 4I2PB 4WBFA 1RT7B 1GK8A 1S1TA 5F8NA 4DJBA 3HSJA 1NO8A 3W2VA 2V4JA 4M5LA 4KBIA 2HNDB 4ECWA 4M5HA 3D0HE 1TV6A 3A13A 4M94A 4I2QB 2CJXB 1UP1A 1FI4A 3LH2S 1S9EA 4Y2AA 4F02A 3DRPB 2PT0A 3C3LA 2WVFA 5IQ6A 2HFVA 4HL9A 2BEFA 2OPSA 1WHYA 5D0EA 4OV1A 4MTPA 2BBEA 2IIHA 4ZDNA 1OY9A 2B56A 3NNCA 1RYSA 3PW5A 4HTIA 3HVRA 4X4UA 4IR1A 4Y2KA 4WKRA 5A8RA 1U45A 3P45B 4V19X 1CQMA 3N5BA 4DQRA 1RKJA 5GVQA 5KFVA 2JEGA 2E7VA 1UW4A 1U8SA 1MLAA 2VFUA 3I55S 4TYBA 2Y0BB 2HMIB 1FJ7A 1TKTA 1RT3A 1NAQA 5HL7Q 2VOOA 1KRPA 3GU0A 2JFDA 5B0DA 4XPEA 3AQOA 2R7VA 3U27A 3J7A1 3WBZA 4URGA 3C16A 5LMUJ 4RW8A 4DV2J 1F3FA 4TU9A 2ZVIA 1M5VC 1UEKA 3QRQA 4NCBA 5HBMB 1DLOB 1XIQA 1U0HA 2NXJA 2RE1A 4CQ1A 2ZBPA 1RWVB 1Y3KA 3C19A 4P2XA 5J2NB 2XYPB 1IQTA 1GXLA 1T8EA 3LO3A 2P5VA 1UA1A 3H20A 3GTYX 2OD6A 4C8LA 3HMJG 4IDKB 9RUBA 1RWOB 1ITPA 1CJKA 4GKJJ 2X1BA 3LP2B 3MM8A 3Q2SC 3GE9A 2ZC4A 1YIJS 1WC5A 2AGPA 4EYHB 2ZDPA 3Q2TC 1NKBA 4GMKA 2KH9A 2P8IA 4QIVA 4DUTA 1RSCA 1S12A 1E6VA 4TY9A 3E01B 4RW9B 3EYZA 1U24A 3CCWA 4KV8A 3GP9A 2CQHA 5D6GA 4USKA 1VLOA 1JXVA 4XAKA 4C97A 3Q8UA 2HRTA 4O3SA 1YBTA 1FWKA 4UQTA 1PJ6A 1P8GA 2B8PA 1D09B 4PPDA 2E5JA 1IBCB 1S6OA 4F4AA 5LXYA 1SJQA 3CJKA 2CJYB 2RDIA 2XI3A 2ZJQQ 1PJ7A 4BHQA 1RTHB 2CJ9A 3VAKA 3V4MA 4B3TF 3Q8PB 2IAJB 3FZBA 4A8MP 4PUOA 1JJ2R 3DHWC 2OMOA 4DV5J 2OFGX 3G2XA 2ZH1A 1NM2A 5IT4A 3ZFVA 1NPKA 2A2DA 2D74B 3D9BA 3JQJA 2EEYA 3WIUA 4Z2XA 3AOCA 2CPJA 4NYPA 3CJ0A 2ZH9A 1MN7A 3ZZPA 5L1JA 3CO0P 3CT9A 2Z2YB 3V81B 1PKUA 1YJUA 1Q82T 2ROGA 5F8GA 1LV5A 5A2QY 4KHPJ 4F0MA 5DGAA 3HJFA 2LQBA 4BLGA 4YEAA 4UOHA 3GCXP 2UUAJ 1LW0A 3PTWA 2FGCA 4F2SA 4WE1A 4O3QA 3M8WA 3MMCB 2HWIA 1REGX 1MWZA 2CWXA 5J2QA 4DU8A 1M5HA 5LMUF 1FDBA 4C3KA 4Z7CA 2KN4A 1M5PC 1RCXB 1NSAA 4C2MA 4LBHA 3OR1A 4RR5A 4TNOA 2VV5A 4MK9A 5RUBA 1WF2A 1R7IA 4HI1A 2MGZA 1L5UA 3AJDA 3TZZA 4OX9F 3NGSA 4J9MA 3ISZA 4MT1A 2M0GB 4KFBB 1P1LA 2HFUA 4ZCKA 1XNQJ 2QL7B 3GLJA 2QLXA 3D68A 3CCRS 4GKJF 4Y2IA 3V2UC 3O5TB 3TW0A 2GHWA 1CBKA 1U1RA 1IBLF 3POTA 5M2PA 3L7OA 4JV0A 3OTCA 1WUUA 1KQKA 2YX7A 5AJ3J 1Y3JA 2C42A 4ZCMA 1CJTB 4UUXA 4E8UA 4R0EA 1WKLA 5B0FA 5B08A 3WX4A 4EFAC 4X4QA 3RBXA 4OYMA 3Q8QB 3OPKA 2FDNA 4CLFA 1UJ4A 3MR2A 2J7UA 2FJBB 4Y34A 5DS7A 1X60A 2BE7D 4JI0F 2HAIA 3T1YJ 2HRUA 3MHYA 1EIYB 3ILOA 3QAUA 3H2UB 4A4JA 3MAAB 5I3PA 1FDDA 5IXUA 1O5JA 2NXNA 3H98A 2LP4A 4OZNA 4DV5F 1FRLA 2WZ1A 4KGZB 3C15A 2PDAA 3CIZA 4ES2A 2WSCC 1NB7A 4PWDB 1HD0A 2GIQA 2QIFA 3IM9A 2R2RA 4QPTA 3N6MA 2POKA 5AXLA 3FUYA 4M63A 3MUTP 3N0VA 1VIXA 1HARA 2CUYA 1YX2A 5J1NA 5A0YB 3CXCR 1KFDA 2B9EA 2BQRA 1U2FA 1XJWB 2EG1A 4OI4A 4KHPF 3CD7A 3SSSA 2PMZD 3JSMA 4IFVB 2UUAF 3GFHA 3WZ0A 3AQPA 1K1QA 1C1CA 5HK4A 2KHDA 4EO8A 2JEIA 3Q23A 2JZ5A 4B9NA 1RAJA 1N5VA 3FKBA 2KZZA 4NXNJ 4J9NA 2NYHA 4NLRA 2MKIA 2WVCA 1F9HA 2HQDA 1WG1A 2D3ZA 5DDPC 1TL3A 4DLGA 1T7PA 2AWZA 3FSIA 3OT9A 3EDRB 1AB8A 3DOLB 1VR6A 3V6DB 4LSNB 4LJMA 1HIYA 2YWKA 2C3UA 1XWLA 1XNQF 4ZPAA 3TUPA 5BYSA 4LMZA 1N8RT 2YNFB 2B5JB 2ZH2A 5D0GA 3BGRA 4LF1A 3A3PB 1JXLA 5M2RA 3KXDA 3THVA 4JI4J 4WFYA 2IDEA 5HANA 5L46A 3NCPA 1T9VA 5AJ3F 2AV5A 2HYIB 3BN4A 5IWAJ 4I67A 1I94J 3C46A 1Q86T 3AHPA 3R5JB 5E33A 1MU2B 5F8HA 3LP0A 4F4KA 4R5PB 3H5XA 2HNZA 2QTWA 2KRRA 3GV7B 1YK9A 3GIMA 2W4PA 4LIWA 3BS9A 4HKQA 3IWNC 2E9TA 3DLKA 3OVSA 4WCEQ 1S1UB 3BJYA 4GVBA 1UWBB 3F56A 2RAQA 2DY1A 3T1YF 1YSJA 3M8YA 3CULA 4OHZA 2ZH5A 4A8XA 2G13A 2C2OB 4ECXA 1NJYA 2IFXA 2VG5B 1YQHA 1NKCA 3CCQS 3T19A 1H74A 2QG9B 1M5KC 3BR8A 1M90T 2FTRA 9ATCB 2WW4A 1I5OB 2R8IA 4IG0A 5JXSA 2RUGA 3DRPA 4A8FA 2ZE2A 5EX0A 3KLIB 3OUYB 2LEBA 2E29A 4X62F 2EPIA 2VQFJ 1Q7YT 4LSLA 1T03B 1J5OB 5HSPA 2GGPB 1KNZA 1N5QA 5DQGA 1YJVA 8ATCB 4HHUA 4K4YA 3C14A 5L9XA 2HHUA 1H38A 3AFGA 2QLWA 2HQGA 4Q5VA 2HNYB 4M5MA 4DR2J 4QW8A 3TOQA 4RW4B 4TU7A 2WK4A 4DR1J 2HMIA 4GO7X 2CKWA 1S9FA 2LKZA 3O2IA 3EGZA 4NXNF 3LGMA 3DOKB 3IBWA 2KZMA 3HFZB 2AJ2A 4NLUA 3W9IA 3OFFA 3K8WA 4FYXB 3BKFA 4O4GA 1C0UB 3I56S 4DN9A 2XLIA 1W25A 3JAMU 1UJ6A 3OL6A 5C7PA 1RAGB 2QX0A 3OR2B 2QSWA 1DLOA 4V1Ak 3CJSA 2DXEA 2CVIA 2FZKB 1G3OA 3KJQB 4ZLLA 3DOMA 2C2EA 2B6AA 3HHLB 1ZH5A 3ZO7A 4A8YA 4IDKA 1K44A 3BZQA 4JI4F 4HACB 2HGMA 3D3CJ 4OI6A 3MM5A 3MAQA 3M2VB 1FNMA 4DCOB 2ZKUA 2A1BA 5D8HB 1IQZA 1TVRB 5ETSA 1UW9A 2O66A 3W8PA 4YB6A 1I94F 1JLQA 2F3JA 1N48A 2GVDA 3MF5A 3SXLA 2MKCA 1IR2A 4NLWA 4LRAA 4MJKA 4RW9A 1X4HA 1JLGB 3AT1B 4NE9C 4LVOP 2K7JA 5CYQB 1RWWB 3EMTA 2LEPA 4J37A 3KJVA 2AEFA 2AQ4A 1S6PA 1S9GB 4Q0BA 2H1YA 4PG7A 2DNYA 1S1XA 2B4PA 1WOSA 3FQLA 3SSRA 3GR1A 2FVSA 4NLXA 5M2UA 2QZ8A 3QAEA 2RUSA 2IRUA 3CB4A 2FVPA 1B64A 5HJYA 4ICLB 3MCOA 1B4SA 4ID5B 3Q0AA 1E6YA 4H4OA 3MFIA 4CWBA 4GKKJ 3EJMA 3U02A 5L8RC 3G8TA 4R8UA 3JSBA 1R6VA 2KM8B 3G96A 2GMJA 2Y0SD 5CH7B 4ZCIA 4DX7A 2WW8A 5IM0A 2Y8YA 1RBLA 2BJDA 2WONB 2PGCA 1YTYA 2M8DB 2W4CA 3MECB 1HYSA 3AOBA 3NGDA 1U7LA 1K9MT 4I68A 2CG8A 4DR2F 2BKPA 1MNEA 1G1XA 4R25A 2J0XA 2I5JB 1OSDA 2CNKB 4RNHA 4JV5J 4YDDB 4DR1F 2PFFB 5K20B 4LR9A 3JTOA 5F9LA 2HZCA 4MIBA 1NRKA 2DTJA 3W5YA 3JSRA 4DFKA 2FHOB 1SUQB 1HW9A 1U1KA 3TEGA 1VHFA 3VALA 1JLAB 3CCZA 3N9UC 2KVQE 5KFIA 4P2MA 1M5SA 2R8KA 4NX9A 2VHGA 4H4MB 4NPOA 2ADBA 1UETA 2DR8A 3MCMA 3K17A 3C6UA 2BKNA 4KPCA 2CQIA 2QA1A 3J81Y 4ZP6A 4QYZJ 1U2RA 4M5JA 4QWAA 3MM6B 5T7LA 1HNWF 2E9ZA 1F6TA 1WHVA 2CZVC 3PIOQ 4FYDA 1SQFA 4NI2B 5KG3A 2QEXS 4YFUA 2CPHA 3L7PA 3W64A 3K57A 2KDOA 1UFWA 4DPTA 1SXLA 1QTMA 2DH8A 4ECZA 3PCOB 4N56A 1HQEA 3UR0A 3KK2B 4YQWA 2HBYB 5ETNA 2P9GA 2K8GA 2V8PA 3DDKA 4PXCA 4PR6A 3UD4P 4DUYF 2CPDA 1VQNS 3AA8A 2AX1A 4HH1A 4EZ9A 4CP5A 1KLMA 1HBOB 1ZAVA 2CFXA 3QWUA 4LSZB 4ELVA 1YRTA 1N36J 2KL8A 1RKIA 3MZIA 4ZIWA 2YPYA 1DQAA 2VBZA 4F25A 1LWEB 2VG7A 5GMKa 1BMQB 2ZH7A 4TXSA 3J7ZT 5HI7A 3T5LA 4YUDA 5ETRA 5KFBA 3HD2A 2RRAA 3VQTA 4IG3B 2RKIB 1CG2A 4GKKF 3A3OB 3TRGA 1KEKA 1OY6A 2GV1A 4WZQA 2HGNA 1U02A 3I0RA 2FJDB 1MW7A 6FDRA 1HQ2A 3HSZA 2BW7A 3DRXA 1RU1A 2O67A 3DLGA 3OFEA 3RUBL 2QLFB 2KXFA 1ZM3A 2JRSA 3OL8A 4AXJA 4B02A 5J1PA 2YKNA 4JV5F 3I87A 3DLLQ 2MJNA 3ZZRA 1WNEA 2AF6A 4WP8A 5GMEA 1R8AA 2GHVC 2BJ9A 4O23A 4WFZA 2MKKA 4N5SA 2IJRA 4IFVA 2FHJA 4DUZJ 4YHHJ 2PE8A 1QVGR 1PYTA 5CCLA 2V2ZA 1I1GA 1Q81T 2LVWA 1IKXB 3PYDA 1XR7A 3GJTB 1T05B 4ZPVR 1LQ9A 3MM9B 2VFVA 4QWDA 3K59A 3RTVA 1WELA 2D41A 4DCPB 2HFOA 2NZ4A 3DU6A 3K8VA 1FRKA 2IM3A 4K8RA 3H2VE 3OTDA 2C22A 5DZ7A 4RKUC 5B0BA 1HQUB 2K06A 1IKWB 3GQCA 4HYKA 1FRHA 1UPMB 1DAXA 2YNFA 1TKXB 3QJLA 4KC5A 4OYOA 3G71S 1B0VA 1D9AA 3RW6A 1TUVA 1KP6A 1T9XA 5HJXA 2ZD1A 4KTQA 5IZHA 1NSKL 3US5A 4DV1J 3RBDA 1FRIA 2OPPA 1DHMA 1MU2A 4JOUA 2DNOA 1X5SA 5F8MA 4L75A 4U6PA 4LBPA 1ULRA 2XZDB 2H5JB 1MWYA 3RAXA 2DRDA 5CZXA 1FHTA 2G0CA 1UWBA 4A48A 2YWWA 1KQGB 4U95A 4U7UK 3N6LA 1LK5A 5K5MA 4KH0B 2OUGA 1GMWA 1IBMJ 2CAJA 2W9BB 2VG5A 2UVRA 2VC1A 2B3TB 3HVAA 4HI2A 3HK2A 1VQ5S 5CABA 2GHPA 5F8LA 1FVSA 2QGFB 3ELHA 3NOCA 1UEUA 2YNHB 1S6QB 2FHMA 1N5YA 3TJ9A 3BF4A 4X4OA 2HK3A 4EBCA 2L3MA 3M6XA 2P9EA 4Y65A 1U25A 2BE9B 5KFXA 2MKJA 5K8NA 1JK9B 3DRSB 4HDHA 4XTTA 3UI3A 4DWIA 2QYGA 4WIQA 2CQ3A 4RW7A 4ER8A 3I4PA 1PAEX 1FK9A 4OFZA 4LF6F 3KLHB 4DV0J 2Y1JA 2M88A 1S10A 4YS2A 5IV3A 3T6JA 2PIIA 3NNHA 3H42A 2L9DA 4FKXA 1FKOB 3L7UA 4YY3J 5LXRA 1RQ0A 4YHHF 4CM0A 4QPXA 3GFYA 3BGLA 3MMAA 2FJWA 3OLBA 3ONQA 4DL2A 4E2FB 2MEWA 3DOKA 5LJ5Y 3L95X 3PO5A 1S1WA 4XK8C 1RAHB 3T1HF 5KFTA 4IH6A 1TTHB 3VGVA 1PSDA 1AW0A 2MDAA 2ZUGA 4F4ZA 4MK7A 4G6VB 1IBKJ 2N4DA 1N33F 5KFOA 1FF2A 5U47A 2BRLA 4GRSA 2VU5A 2BM0A 2HQFA 4OYWA 2CPIA 2FUG9 1DTQA 3CJTA 5C42A 2MQOA 1V3SA 1X9WA 2LCWA 3NRBA 1T0TV 1FKAF 2RQCA 1G7CB 1HNVB 2MZSA 4HACA 2F5GA 3M6VA 3FCHA 3OBIA 2CQDA 2Q43A 4CLLA 4CM2A 2AYGA 2YQ0A 2LQJA 4K4VA 1TVRA 2VF3A 3MXHP 4ID8A 2XWYA 3OJSA 4DV1F 1FO1A 1JNRB 3PHEA 3TVZA 3K5MA 2HAFA 1QE1B 2YQ1A 2OD4A 3M1VB 2LA4A 3ET6A 5J2PB 4RU9A 2OHDA 2WTFA 1U0SA 3PHTA 3R7NB 1JLGA 4J9QA 1KN6A 3HVTB 4RNNA 2AYBA 1D9DA 4X4RA 3M4XA 3CCSS 3A8KA 4WKYA 2IJFA 1KTVA 3ZZUA 1ZPWX 4Y3CA 1H2VZ 3UVJA 4KJIA 2OPQB 2DGVA 2ZUAA 4PG5A 1FXRA 3BPSP 1IBMF 3G86A 1VYAA 1DARA 3EICA 1UFKA 4PYDA 2G0IA 1RAFB 3TA1A 3HHKA 2MZQA 2VL1A 1J5EJ 2IYIA 3D1QA 3IFEA 2IM0A 2W8KA 3W7BA 2KFZA 1SPBP 4M8LA 4LBIA 2PD1A 2AJ1A 1TL1A 3CCMS 4CT8A 1YKWA 3MGJA 2CQGA 2ADCA 3SEOA 1X4GA 1Y5IB 3FZ2A 5CHCB 1V5VA 2RH3A 1PG5B 2K2PA 1RT1B 3BEGB 4PXBA 4C98A 5HP1A 1EETA 1VBZA 4DV0F 2WVBA 1QLNA 4K4TA 2HWHA 4YY3F 5A6PA 2XNRA 4JI5J 4DR6J 2BVZA 1C0TB 1RA7A 4KKOA 4USWA 2MMYA 3GILA 3JS9A 2MXYA 5CD4H 2Q1LA 2DGOA 2DNQA 4NMXA 4EBDA 2V8DA 2KYZA 1JLAA 2DCLA 3VAMA 2ZOFA 1F5BA 4DQSA 2LEAA 2ZHBA 1IBKF 4ZVOB 2XM3A 3RG6A 1U47A 1Q1KA 1Y4ZB 5GADI 3P5BP 4I69A 5SUHA 1P6TA 4WZMA 2DNKA 1MMDA 4UT4A 2KI2A 1YJRA 2RF2B 3TANA 1FTRA 2X3GA 1L3TA 1F5CA 3K58A 5EDWA 1EKRA 1S48A 1DFDA 3CD6S 4NRTA 1FVQA 3G9CA 1SL1A 1SV5A 4B3OA 3MEGA 1CJUA 3HLUA 1X4FA 3MWBA 2HKEA 3I9V9 1RDRA 3UNGC 5C2GA 3DNCA 5IT0A 1RU2A 3PACA 5C25B 2JFKA 3GIKA 3KK1B 1Q53A 1O6XA 4NA3A 1LWFB 2HVEA 2DY9A 1ZTWA 3SCJE 1VK8A 3CD0A 3RW7A 4EUVA 2AJ4A 1GTEA 4P75A 1M0SA 1PBAA 3BBCA 1V9OA 2C3PA 2DH9A 2IDLA 2RILA 1B3TA 3VAIA 1SIZA 2OTJS 1NBEB 2OTLS 1SKWA 4H54A 2R7QA 4CZCA 2C3YA 3TI0A 3MEDA 4A8QA 2RD5C 2GQ2A 4FVCA 3MPUB 2R2SA 3TUZC 1JLBB 2BABA 2MPUA 1S0NA 3K5PA 4O3OA 2L08A 4CH7A 1KBRA 4IKAA 1BWEA 2NUUG 3CVKA 4DV6F 4ZK7M 1UCNA 4UY85 1OQ3A 1JLEA 4W4MA 2KFYA 3R1LA 1OYDA 3Q22A 4C11B 2FVQA 2AIRB 5KFSA 3IG1B 3CCTA 1KOHA 1QAXA 4DPYA 2IVFB 2XY7A 2COLA 3VZIA 4ELUA 1JJCB 1RLCL 1IKYB 3NEKA 3M8QA 1EKSA 1HPZA 2CWKA 1RTDA 3R9LA 3RBEA 4RO0A 2G2ZA 4C8YA 4DR6F 2DHAA 1P9QC 1KS2A 1LEOA 4DLEA 2GW8A 4YB5A 4DR7F 4U67Q 4NLQA 1WDTA 3R6LB 4QOTA 5MLCV 2A6OA 4KO0B 3ZTSA 2VH7A 1IKXA 2HZVA 3ZZYA 2Z8QA 3NBPB 3VZHA 4ILLA 4G1IA 5B0CA 3EWGA 2NXUA 2IYGA 1YZ7A 1H2UX 1FJGJ 4W90B 3NY0A 2MTLA 4YR0A 2FLLA 3D1HA 2KU7A 4QIFA 3EXYA 5E3RA 3AJ1A 3HHLC 1TFWA 2O3DA 1KFSA 1QVFR 2R7WA 1ZETA 3H4DA 1TELA 3CJ2A 2XO6A 1G4CA 3PJWA 2DBBA 2JEJA 1Y10A 4HDGA 3DCAA 3T5HA 3KHHA 4CO0A 4EMDA 1U1NA 5ETTA 2LFVA 3CC2S 4N41A 1KKHA 4KGMA 5FD1A 1KWMA 4ECTA 4TLRA 1FNXH 3UE2A 3GR0A 1NH7A 4BWJA 4DS5A 3K5OA 5F8JA 1S1TB 3BBFA 1SB6A 4OZJA 2EG2A 3W2VB 2V4JB 1KONA 3QYYA 3H0PA 3IP0A 1RHQB 3MOZA 2DNGA 3L4BC 1TV6B 2Z0GA 1FE4A 2CNLB 3W9HA 4MFBB 2IA0A 2QMUB 3ETOA 2HPUA 3SZ2A 1RT4B 3GJQB 1S9EB 5ETKA 1PAUB 1Y00A 3OHBA 2X3DA 2H9ZA 4UOFA 4C8ZA 3UO0A 2RQKA 2KM8C 1HLWA 5DM6Q 3D1OA 1IUJA 3KG0A 5HO4A 2YWHA 5KG2A 1TK8A 1RCOB 3ZC4A 2HHXA 2FLPA 3QRRA 5A8RB 2M52A 4NLVA 2JVRA 2Z2MA 5E2QA 2H5EA 2DJWA 5KG5A 2AW0A 5A6WA 1FA0A 1TKTB 1RT3B 1BXNA 1AFIA 4ANEA 2ZJRQ 4FNHA 1Q4RA 1UVJA 3QO9A 1MROA 1FNOA 5LSRA 4USMA 2CXEA 1XR5A 2YKQA 2B9YA 1YJNS 1FFSB 3PKYA 2UVVA 2BJ7A 2MQPA 3C16B 2VPXB 1VBXA 1QUPA 4P9SA 4K5SA 4DXLA 3QZ7A 3MTJA 3U1NA 3JAMY 3ZZ0A 1FT8A 2QN6B 4QCLA 3I5CA 2OEKA 3OD2A 1CJVA 4E0DA 4I0WA 5E3PA 3D66A 3M6WA 2K1RA 3OXGA 1LOUA 4OJ1A 3UN5A 3ADAC 3ENAA 2IVYA 2W24A 4ERDA 3WDOA 2UUCJ 3MFHA 4LF7F 4PAAA 4IO9Q 1CJKB 4P10A 1NNDA 3MM8B 1JLCA 1VQOS 2GZOA 2DR9A 3FRYA 3OSPA 4LT6A 5HATA 4DR3J 1BWVA 3H8YA 4DFPA 2B0GA 1U2CA 3HSGA 4G1QA 3UFCX 3R5DA 2EC2A 4I64A 1E6VB 4JUZA 4IQXA 1AZSA 4IOCQ 2WBMA 1HA1A 1NKEA 3V6HA 3DKDA 1W2IA 2VJUA 2J6SA 1D3WA 4DX8H 2RRNA 4L76A 3D3BJ 4YMEA 4TYAA 3GV5B 3I0SA 2VKRA 4RBTA 1AUDA 4UOCA 2XMWA 2HBZB 1V3RA 3G6YA 4ED1A 2AYEA 2B7BB 1ZM9A 3CJKB 5DO2A 4DPWA 3F0NA 2H65B 1YG0A 4NL5A 2BACA 3LA0A 1WEYA 5LOQA 4OI3A 2M9KA 1XMOJ 4OX6A 4LQ9A 2G1HA 5B0GA 2E44A 3MUVP 4YB1P 3KLFA 1T11A 2H4YB 4ZN1A 4FDFA 1NPPA 1UFLA 1F3VA 1T9YA 3BO2A 3RU0A 4PCQA 3L3CA 3EVMA 3UCZP 1HHQA 3P5TL 3E2EA 3KFWX 5B09A 1SJ3P 2ZH4A 2KRBA 2EKNA 4MYUA 2KT3A 4X64J 4IUFA 2AKWB 3PR5B 4IRKA 2H4WB 5CA5A 5D4PA 3Q83A 2NREA 2MB0B 3N79A 3NAHA 4J9OA 2CQ2A 2OH2A 3DC2A 4Y6IA 2MYFA 1C0TA 3LPEA 5AXNA 1Q7LB 5KG6A 4F3OA 2NPIA 5J2QB 5DDQC 2HQIA 4QYZK 1LW2A 3PV8A 1JKHA 5HMZA 4ILMA 3LANA 4B9VA 2IVMA 3OTBA 5HLFA 2W2MP 2V8VA 2DNLA 3NWGA 1YBUA 2YWFA 2XO7A 2BW2A 4ZCLA 2UUCF 5BR8J 3J81U 3BQ2A 5KFYA 4WK1A 2X7IA 2J7WA 3R2CJ 3QIPA 3POTB 4FYWB 4DR3F 3QT7A 1ZTTA 3SQGA 4NLPA 1V3ZA 3MPVA 5F3TA 4OIXA 5KT5A 1VQ6S 2YBVA 3BR9A 3I5BA 1WKKA 4F26A 3DXSX 1HWKA 1HD1A 3D0IE 3CW2C 2XB2D 2GVZB 2HHQA 1LWFA 1HR0J 2LA6A 4CTAA 1XERA 1O8BA 2VA3A 2RQ4A 3J7YI 6FD1A 3FEZA 3W5XA 2R7SA 2PFDA 3I96A 1SQEA 3UD3P 3WIVA 2RVJA 7FDRA 2ZJPQ 4PXEA 4OYPA 5H9EJ 5FJ4A 2OJ3A 1TMMA 1XMOF 5JVGQ 2XSJA 5JUMA 3FSYA 2K3KA 4FP9A 3RRKA 1NPRA 5DRKA 5C24B 1SC1B 5E0OA 1URRA 4BC9A 3KDNA 4PZVA 1HMVA 3TAQA 3QRPA 1NK9A 3R5AA 4B3RJ 2MLXA 2MQQA 4M95A 2H54B 3GYXB 4IQMA 4R0JA 1XEZA 4CH1A 3IS9B 5D4LA 5KFGA 2R7OA 5EX3A 3P96A 3PG9A 4X64F 5D4OA 1JB0C 1RE1B 4BWMA 3NP5A 4F50A 1I3OB 2ZBQA 4LRCA 2UXCF 3RAMA 5IC6B 3PW2A 2J7KA 3LF0A 3M32A 3SV3A 2BKOA 3AD7C 1SKRA 1FXDA 5THWA 1VOMA 2AYMA 1JLFB 2C2DA 5ETOA 2VBWA 3N4WA 4OLOA 3OSNA 1CQNA 1TL3B 3QZ8A 4P73A 4RX6A 1HHSA 2WSEC 4DR4J 3CCES 5F0WA 3TAMA 1HNXJ 2DH7A 3NBPA 1SCJB 1VQ8S 2RT3A 4IO1A 1RHMB 5DQIA 5BR8F 1U1QA 2BANA 2AEMA 3MM7B 4ZJLA 1WWHA 3BQ1A 2CPEA 2J9DA 3J81j 4FXWA 1Q8IA 1HBMA 5I3UB 3GG1A 4K0KJ 2J76E 3N6NA 3B8HA 3D4JA 1WEXA 1BC6A 1VI7A 2X1GA 2ASYA 1NMEB 3K5LA 3HM9A 4JI2J 2RRBA 2HNZB 2DGXA 2CG4A 1I51B 1NDCA 4USVA 5IT9Y 4ZHRA 5GMDA 2LXIA 3L9ZA 4ZVGA 4PQUB 5KAKA 5CXTA 1HR0F 4WYWA 2KO1A 1FDNA 3DLKB 4H4KC 4IH7A 3MCSA 4GVBB 2HS4A 2BA9A 4X4NA 4FPRA 4NYZA 2BJEA 1CC7A 2HVDA 4Y0FA 1Z2ZA 4OZLA 1X5OA 4URSA 2YXLA 4EWTA 3T5JA 3NWRA 3F44A 4QIEA 1Y0HA 2P6SA 1OS5A 1U1OA 3R7SB 4ZJOA 1X0FA 3QT6A 5HVGA 4MFBA 1NJXA 4B3TJ 4CRJA 4M5NA 3UCGA 5ETQA 4IG0B 1RT4A 1TK5A 2IJNA 2YY3A 2VJVA 2WOMA 2C3OA 1F60B 3BSNA 3JSYA 2ZE2B 2WB1D 3DFEA 2FLOA 4FNIA 4B3RF 4KHRA 1KVJA 2KKHA 4LSLB 4JI8J 4FS2A 3CCUS 3AXKA 3HJVA 2HRYA 2EFPA 2FHKA 2HS0A 4OHYA 4F4XA 3C14B 2UU9J 2W2PP 3IM8A 1G6BA 1YJ7A 2VBYA 2JLEA 4HH0A 4OYBA 3HKWA 1WOPA 4RW6A 3PY8A 3HHEA 3CE8A 1VRTA 4FF1A 3PW0A 2QL9B 2B4OA 4LIRA 3OTOJ 1X31C 1VQ4S 3MEEB 2H3EB 1UVNA 3LTOA 4A8KA 3G6XA 1WI8A 3LP1A 4DR4F 2UUBF 4O4GB 3A8EA 4O0IA 2K3IA 2Z58B 4DFMA 2W01A 1HNXF 4Q43A 4CO5A 3GSDA 4DSLA 1EHWA 3M05A 3P49B 5B7WA 2BJ3A 2ZITA 4FZVA 3ILIA 1BD6A 4F0KA 2CQ1A 1U6ZA 4ZLNA 3DOMB 2DNRA 3VGTA 4OX9J 2B6AB 1HKAA 2E1RA 3CDAA 3W63A 4I6YA 5D3GA 1YDLA 4G1PA 3MM5B 4TY8A 4XIUA 2FJEB 5GADU 1YRXA 4K0KF 4K4ZA 1MMNA 1H73A 3EXCX 1R0AA 4F67A 1IBLJ 3M8SA 5FLXU 4PWUA 3GONA 1S59A 1JLQB 1H0HB 4NLYA 4JI2F 2VONA 2GVDB 2ZH3A 5KFCA 1GMVA 1S97A 2ZH8A 3D67A 4ZPWR 2HS3A 3RB3A 2A10A 2CZ9A 4F04B 1B70B 3PO4A 5G0RA 2YPZA 2NXCA 2JHEA 4DG1B 3TZXA 1S0OA 4UOGA 2GIRA 3KJVB 3DRRA 1S6PB 4Q0BB 4MYTA 3BDEA 1TL7B 1XBWA 1S1XB 2W9CB 2ASLA 4DL6A 2LQ5A 4JI0J 1CULB 3G87A 2DGQA 4ED3A 5KFUA 4AXIA 2QC3A 4UF4A 1IKVA 1S0VA 2FHJD 1TK0A 3E3XA 1OSCA 4LRBA 3FVYA 4ZVSB 3OL7A 1XN9A 2B9WA 1E6YB 4H4OB 3M2UA 3I6PA 2UV8A 1GXTA 3VQSA 3VTIA 2RSQA 3BM7A 3EZOA 1YRUA 2BQUA 2PA3A 5CYJA 5G4DA 4R8UB 3N01A 1S49A 2IMOA 1N6QB 3W2WA 4C6AA 5IM0B 2CPYA 2JL9A 2KG0A 4JI8F 1XMQJ 1HYSB 1LFWA 2PO4A 2FYXA 1NLKL 2UU9F 2HZAA 4Y28C 1MN9A 4Q2MA 4YP3A 4YB7A 3Q86A 1SKSA 2ASJA 2UP1A 1SJ1A 3LWLA 3P6YC 4M5KA 4ZP9A 2R42A 3OTOF 4ANDA 3WC0A 4OX7A 4DHVA 2UV8G 4QR0A 1Y5NB 1R0BG 1RTJB 1RT6A 2EFNA 1FESA 1J27A 3MD1A 2VOPA 3QLHA 1N56A 3N28A 5DGBA 2KT5A 4NEYA 3PKMA 2YKMA 4B9UA 2AEJA 3C6UB 4CT9A 1RWPB 3TZWA 4L3NA 2FZGB 1RXOB 1F9FA 4CLTA 3OW2R 3S1TA 5T7LB 2ZZNA 2ZOGA 1LWCB 1UMJA 2GAHC 3KJNB 1DTTA 1WKJA 4DZ6A 4KY3A 4WTOB 1JXEA 1SJFA 1AXQA 1B0TA 2B7CB 4Y2CA 2CJKA 3CDBA 2CQBA 1WC1A 4J91A 1HQEB 4JYAJ 1UTAA 3IRXA 1VHIA 4TN2A 4OI0A 3CCLS 1NUEA 2Q6BA 4WIIA 3ZTRA 3NMAA 1X5TA 4LFBJ 2GVZA 4W92B 2L9WA 1KLMB 2AZ3A 1UKUA 4AL5A 4ENOA 2DHXA 2Y1RI 1TR0A 2H51B 2CADA 5K14A 2NQPA 4HT7A 2VG7B 2RQMA 4UZBA 1VFJA 2K7KA 1RTIA 3TVYA 1J2VA 3M30B 2G9OA 2N3OA 3AD8C 3D7SB 1HNIA 5E3CA 2IBOA 4CCHA 2YH0A 1ZYQA 2ZM6J 5C24A 3P3DA 3W1YC 3KNGA 3W3SA 1RLDA 4WU3A 3I0RB 1WC6A 2OPRB 3CIMA 4Q44A 2LU2A 1XMQF 1B7YB 1NJZA 4URQU 4LFCF 5LSLA 3IS9A 2VUGA 1L3SA 4USHA 4X62J 3DLGB 5BXIA 4NXMJ 1OO0B 4CDIA 2YKNB 3HHLD 2HK2A 4RL1A 1F2HA 4XDDA 4C8KA 3JQKA 1S6UA 1LKZA 3W5ZA 3IMQJ 3FFIA 4M5GA 2MZ1A 4ECVA 1JLFA 4F4YA 1CPZA 1WTBA 1PILA 4N77A 4NCGB 4NA1A 1XQIA 1L3VA 3PVXA 1RT5A 4C0HA 1YHQS 4QU7A 2KFNA 4EI2A 3EVWA 4NCAA 4WFBQ 1RI7A 1K8AT 3ZNUA 5HROB 3PW4A 3T1AA 2CRLA 4C7QA 3R1HA 4ETXA 1UVLA 3CJ3A 1RP5A 1U6BA 2IMWP 4AYBD 2C2ZB 2KB2A 4ZPCA 5KFRA 4LF2A 3DGVA 3O6QA 4PXDA 3MM7A 1ELOA 2OKQA 2VPWB 3MR5A 1WSVA 3OJUA 2DNNA 4JI1F 1YJ9S 5I3UA 2JJ4D 4TQRA 2E1PA 5E7OB 4B3SJ 4ED7A 2ZD1B 3CSKA 2XCAA 2Y8WA 3B78A 3QMQA 2VB6A 2EXUA 2MKHA 2OPPB 4JYAF 4IOBA 2M2BA 5KG0A 4U8VA 2VFTA 4TVAB 4LFBF 1Z1ZA 3FRZA 3P8BB 4PQUA 3JYTB 4ZVUB 1SBRA 4U96A 4UUWA 1EP4A 4DPXA 1NJIT 3K0JA 5D15A 5JMNA 1RGVA 2M7SA 1D9FA 1BQNB 4BDPA 2NR0A 3G8SA 2ZDOA 1AUSL 3V4IA 5DM7Q 2EBEA 5CYMA 3K5NA 5KFZA 5I3QA 3GZ7A 2GNKA 4FXVA 5HMWA 1RAAB 2ZM6F 4LF4J 3DXBA 3U7JA 1N5YB 4PABA 3SCKE 3HDSA 4FVMA 3EZ5A 3IA0A 4USTA 3CDEA 3E8OA 2DXDA 3QNWB 1NK8A 4DSFA 1Y5LB 1VC0A 1FD8A 1NU4A 3MDFA 2MQ8A 4WWSA 1BQMA 2C2RA 4NXMF 5KG7A 2N4CA 3MD3A 1OPZA 2BE2A 4RW7B 2MQNA 1FK9B 2P2CB 1PYOB 4OJHA 1VBYA 5GAHI 3ITHB 2VDIA 3ZTQA 2ZWPA 1HBNA 2DHSA 2ALZA 2B9XA 3FNNA 5K8PA 3MMAB 2AGOA 2QFIA 2XZTB 3MEEA 2DNMA 1DBDA 1S1WB 4KSEB 2PEBA 1RT2B 4CH0S 2IM2A 1X0PA 2XMJA 2PI5A 4RNMA 1FEHA 2PEHA 3W9JA 4CIOA 1D8YA 3KOAA 5LMNJ 2V67A 4MIAA 2DRBA 3Q8RB 1CS4B 1WACA 4TLQA 4D3HA 1DTQB 5H1SV 1WSRA 5C42B 4L3KA 1C1BA 3GFZA 2R7TA 4LF5J 2KJWA 1UPPA 2CNNB 4JI7J 2Q66A 4DFJA 1HNWJ 3SMZA 4B3SF 1F2GA 3DLEA 1FJCA 4DQPA 1VIOA 4GC7A 1FERA 2HHVA 4L74A 1SH3A 4S0MA 5DDRC 2VA2A 2C3MA 2YNIA 3ET6B 3FBBA 2MSSA 1K73T 4JP8A 3DDIA 2PA8D 4DG1A 4DUYJ 1TKDA 3TQEA 2E7WA 3A8IA 1UVMA 3FBFA 4OHWA 3UVJB 3HZGA 7AT1B 1TL7A 3BB5A 2W9CA 3OV7A 2UVWA 2BUNA 1N54B 1CULA 3NS6A 2ZNYA 3AB2B 4KT0C 4ZVPB 3J7YU 2FIUA 1T3NA 3SDEA 3FCVA 4LF4F 3AJ2A 4Y00A 3TR5A 1Z2LA 3UN2A 4I6AA 1S4FA 1TL4A 1FKPB 5ADZA 3NS5A 3V6JA 2GQCA 4C8MA 1TL1B 3DU5A 1N4LA 2HLTA 1N6QA 3WX8A 1N5SA 4ILRA 1JX4A 1X5PA 4RWXA 4B9TA 2F40A 4DZDA 2V2KA 5HP1B 5CAAA 2Z56B 2P9CA 1Q8LA 1EETB 1A0OB 1IM4A 3O3LA 2EK6A 3H40A 3DGPA 2E1MC 3QT5A 3OQ2A 1VQLS 4BS2A 2DXFA 3N5FA 1Y11A 4KKOB 4FF3A 1YBAA 4KH1B 2IBKA 5J2MB 2NZCA 2ZHAA 5E3AA 4FYVB 1FFGB 2NLWA 1RJJA 1RTJA 3HF5A 2RDJA 1FCAA 3ZTPA 1YJWS 3KLEA 5A76A 1HWIA 3TUJC 5LMNF 3GB0A 1NK6A 5AT1B 3PYEA 3Q24A 1WC3A 3NG8A 5KT4A 1U8WA 5SZTA 4ES1A 3DLJA 1R8BA 2QLJB 1XNRF 3MCNA 4Q8EA 3M2RA 3SFGA 4LF5F 3EX7B 2WVEA 1D1UA 3VVUA 3H5SA 4N47A 4JI7F 2XGQA 2XLJA 4ZVHA 2RS8A 3WQPA 1HI0P 1SV5B 1NDLA 4B3OB 1LWCA 3MEGB 1CJUB 3BV8A 2MKYA 3ICLA 1VCTA 3S01A 3FDSA 5F9NA 1R8CA 4ZMMA 4L73A 5LL6d 4DL3A 4CLUA 4P74A 3DDNA 3PRDA 5EWEA 5H9EK 3QGPA 4ZVQB 4MK8A 5D0RA 2RB7A 5AXMA 2XG8A 1X4CA 2WB4A 4LRFA 1TU0B 4B9SA 2PSZA 1PC4A 4NZ7A 1YI2S 1JMTA 2B51A 1VRUA 4I56A 4ECUA 1QUVA 1R89A 4RBUA 1DJ0A 2RDDA 3MEDB 4PG6A 3I82A 4X84A 2GX8A 3HFKA 3MPYA 2QV6A 4DQQA 3DM2A 3TQ1A 1QJHA 4C8NA 3IBCB 3M30A 4O0NA 3OTEA 2KG1A 3R2DJ 4PQAA 1VK3A 3X3UA 4AE5A 2MZRA 1FE0A 1JLEB 4XPCA 4HVZA 3QATA 5AE1A 2SXLA 3B54A 2PI4A 1VQMS 2CDRB 1TAQA 3RGIA 2OPRA 4I4BA 1H7WA 2HHTA 3BKUA 3KUHA 2A18A 2OP5A 1U4BA 4K4SA 3BO3A 3M8QB 1HPZB 1RTDB 2ACYA 2PN6A 2W7OA 4OX8A 1EJ7L 5EWFA 4LF6J 4DX6A 2QYCA 2OMLA 1AYEA 1IWAA 4WU2A 4LUBA 2RU9A 2R7UA 5KT2A 1UJ5A 4LR7A 1CEZA 4MMOA 3CMAS 1GMUA 3ZZZA 2RJZA 4NCGA 2J9DE 2LYVA 4Z7YA 3H7HB 3PZPA 1TUGB 1N5TA 3GWCA 2Q3PA 3RZAA 1REVA 1WF1A 2RHSB 3T1HJ 1ZM2A 2KTQA 2BR0A 2R8HA 5HROA 1VQKS 3IBFB 5KFMA 1Z4UA 1DRZA 1N33J 4P52A 1FRJA 3BYPA 4OI2A 6AT1B 4KIAA 3R5BA 3GIRA 5L1LA 2OEMA 4W98A 2ATLA 1SC3B 1PJ5A 1IWGA 1SI9A 3BDPA 1ZOTA 3UDCA 4DSJA 3RYLA 3FC9A 3PX6A 5KT6A 3KYLA 5D4NA 4WK3A 3NAIA 5HN0A 3MPWA 1C4AA 3CWJA 4F36A 5J1EA 2J0WA 5IT9U 3KLGA 1T3OA 1WHWA 4USUA 2M4MA 4ED2A 3MEKA 3JTPA 1UZHA 2A6MA 3J7Z5 2JDJA 5BYQA 4B9LA 1D8ZA 2R4FA 4ZS6A 3JYTA 3CF5Q 2LDIA 4ALZA 2LMIA 4DI6A 1S72S 5BJRA 4X2BA 2DGUA 3NL0A 5KG1A 3VAFA 3CC4S 4CNYA 2W2QP 4QJVA 4J90A 1BQNA 4KB7A 1FRXA 4P71A 1W7WA 2V8GA 1ZPVA 3RRGA 4WP9A 1U1LA 2L9NA 3T6BA 1KQSR 2DHHA 3UWTA 5F41A 2WVDA 1VS3A 3I9ZA 3CJQA 4C0BA 3AD9C 3QQCD 1YVFA 4DR5J 3NS7B 2XS5A 3B4DA 4LRDA 3RRHA 2GJIA 4DV2F 2VQEJ 2CVEA 1RA6A 3FMWA 2ROEA 5C5JA 3AH6A 4TQSA 2YQ3A 1S4EA 3IC1A 4CYUA 4P72A 3BSCA 4K50A 2ABYA 3M9MB 2FJXA 2HQCA 3PM9A 3ITHA 1WEZA 2QO3A 3TUIC 3QO9B 1MROB 1HW8A 2XMAA 3A8JA 2ZWOA 2XS2A 1QDUB 1RHKB 2YKAA 5KT3A 3BO4A 1TKZB 5C2CA 2XYHB 1RT2A 3MR6A 3K7RA 4DPOA 3RB6A 3QWPA 1APSA 4ECQA 1CJVB 2ASDA 2B4UA 5FDLA 2K1RB 2OFHX 1FEEA 1DY3A 2UUWA 1CS4A 4PG8A 1MG7A 3CC7S 4X66J 1ZS6A 4DDFA 4RLEA 3EZUA 1R8HA 4NLSA 4BBYA 2MZTA 2F7VA 1R6YA 4JV2A 5DQHA 1JLCB 2U2FA 2QMWA 2AT1B 1S1VB 3HSDA 3MMJA 1ZZFA 4G1QB 2VIHA 3R7BB 5FLXY 2EWHA 1AZSB 2XLKA 3T5KA 3FSXA 4FPIA 2WSFC 3I32A 3H4BA 5KOXA 2FVRA 4FS1A 3M8PB 4ANCA 4RUHA 1F9EB 4EZ6A 4AL6A 2JX2A 3FQKA 3I0SB 3G6VA 2OEJA 4NLGA 3W65A 2AD9A 3C6TA 3TNVA 1CVJA 2MLZA 2OELA 5L1KA 2FJVA 2ZBCA 4RU2A 3VVTA 3P4UB 1RUSA 1RAOA 3VF0B 3DMJB 4WP3A 3HP6A 5IC4B 5EGYA 1X9SA 1K1SA 1NB2A 3KLFB 1FJEB 3FJ2A 2DVIA 3G8QA 3EGNA 4DV6J 4I7FA 2ATCB 5HVFA 2IM1A 3FEXB 2CZ4A 1FKPA 4DR5F 1OJ4A 1EB0A 4EU0A 3VV2B 4ED6A 5A8WA 2VQEF 3M8RA 3DLHA 3CD5A 2ZKTA 3DLBA 4WYLA 3UDLA 5CZVA 3IXQA 2BXJA 3IGVA 1Q0NA 4DSKA 2DNPA 2DPIA 4LF8J 2HHWA 1LXNA 2MY7A 3NNAA 2N7CA 2G1DA 3IR5B 5L1IA 3PYGA 2XSFA 3Q89A 3PJ9A 2ALYB 2JLFA 2RIJA 3HD1A 3J7AN 2VPYB 2V4QA 4DR7J 4JBCA 3AOAA 2Q79A 4C48A 2C2MB 5J2MA 2V34A 1YJTA 2KXHA 1LW2B 4ETZA 3CMES 1JKHB 3PRVA 2DIUA 3NMRA 4AT1B 1SC4B 2JNJA 4KGXB 4I6WA 3TZYA 3BH7B 5HLFB 2HFNA 3QPIA 4MH8A 1GFWB 2KVIA 2J6UA 1L3UA 1BGXT 4X66F 2XYGB 3UCUP 5KFLA 3CGIA 3FK4A 4ZPBA 4KQZA 2P6TA 4XDCA 1A9NB 3DHXA 3H2LA 3QIPB 5DETA 4WXOA 3CTRA 5ITHA 2ZOMA 1N0VC 4FBTA 3SQGB 4OZ2A 2YWEA 4I2PA 2QJ3A 3PIPQ 1RT7A 3T9ZA 1SKUB 1KSPA 3PX0A 3CDWA 3NGTA 2J8AA 3OHAA 3A4TA 3QFHA 3J80U 2HNDA 2A3JA 4PKDB 3G82B 2XULA 1ZAXA 4I2QA 2DR6A 2QFJA 2CIMA 3HULA 3NCRA 4CTAB 3DYAB 3LUYA 2KYXA 4JV1A 2LQ9A 2HQ3A 2HVZA 1IJFB 1JIHA 2AU0A 4OJGA 5EWGA 5KTQA 3UNYA 3OFHA 3S6EA 2E5HA 5L38A 1JJHA 3GG0A 4OMFG 4QWBA 3EVOA 4OYZA 1HBUB 5LJ3Y 2XSJB 4NYOA 4WFAQ 2BV3A 2H48B 1CLFA 4OZ1A 2BOAA 4N8OA 3ZZTA 2OGUA 1HMVB 2XMUA 4ZA1A 2XTJP 2XCPA 5I42B 1MWQA 4ED8A 5KFDA 4ZN3A 2UXBJ 4GC6A 4IYQA 2NSBA 4BCAA 1K47A 1H7XA 1NK5A 1ICEB 4OQJA 2FLNA 1RBAA 1XTZA 3H90A 1KVKA 4U9RA 2BOPA 1S99A 2DRAA 3EM1A 2DR7A 1EAYC 3BREA 4LF8F 3OL9A 4OZ5A 3MUMP 2D69A 5HBMA 2OSQA 3M32B 1R3NA 3PEHA 1T94A 1QSYA 5GAGU 5MAOA 1GX6A 2E66A 1NK7A 1W2BR 3VAJA 5J2NA 5HVHA 3HXMA 2W2NP 1RISA 2LDYA 1Q8KA 1HNZJ 3KG4A 2W8LA 2YX4A 1BE4A 5GAHU 2D1CA 4YR3A 2E5LJ 2CPXA 1FX2A 1RABB 2R7RA 2WAQD 3LP2A 4QQBA 5LM7E 5IWAF 2R2TA 4O3RA 3K89A 2DNHA 3TAMB 3VAGA 2W9AA 2E9RX 2V68A 3BGOP 2PMHA 5KG4A 2V5HG 4P2SA 2HW3A 3E01A 1TP7A 2CDQA 2YNGB 2BANB 4F3MA 2WBRA 1F0XA 4EK2A 3IAM9 4QWEA 2DR5A 2Y1IA 1LK7A 4LF7J 1HBMB 2CJBA 1KR4A 4LR8A 4KR0B 4LVNP 3PXGa 1GNKA 2LQ8A 4HHHA 4NEZA 3W61A 2Z57B 1T95A 2AX0A 3RB4A 3I5AA 3EPIA 2ZC3A 1ZBTA 3RJMB 1UAWA 1RTHA 2YKOA 4FF4A 1EQ0A 2IAJA 1ZM4A 2OIHA 3QGHA 2NPFA 4RUAA 1QM9A 4ZHRB 3NGRA 5DLFA 4KAIA 1VQ9S 2MHNA 2VQFF 3R3TA 1T9WA 2MZJA 3R5CA 2HLUA 4DOZA 4RZRA 2A2CA 2CQCA 2NUHA 3O1LA 2QT7A 5KFHA 3EDQB 2F8MA 1S7IA 2XI2A 1HI8A 3V81A 2DB1A 3ISNC 1IXKA 2VKZG 3MPDA 5AE3A 1MMLA 2NYIA 4P7TA 1N88A 2WOMB 2O01C 3IWLA 2LXUA 3TVKA 2UXBF 2LXFA 4K59A 4ZVEA 1HFEL 4MKVA 3D0GE 4CO3A 2Q6CA 3MR7A 3MMCA 5KFEA 1FWPA 2PC6A 3S8SA 4DPUA 2WHOA 3NGKA 8RUCA 3BGUA 3QIDA 4ZPDA 4C4WA 5F0UA 3O8WA 2R3VA 5D77A 5L9NA 3ENQA 3KNAA 3EGWB 1UWAA 5E5NA 4B08A 2VODA 3KJFB 4RW6B 4AUKA 4P6QA 5EHHA 4NWBA 1OY8A 1VRTB 4KGKA 3D2WA 1VGYA 2V6AA 2J5AA 3TJAA 2V69A 4KFBA 1HNZF 1NK4A 2DGSA 4IFYB 4USIA 2W7AA 5IOLA 2E5LF 3L09A 1PGZA 3LP1B 2DKOB 4ECSA 4DSIA 4QIWD 3PFOA 1WI6A 1KHWA 5H9FJ 4DV4J 3PW7A 1VC6A 1LNQA 3LALA 5D0HA 5FIIA 2HSEB 4DV3J 4DQIA 1TKZA 1M5OC 2FGOA 4J9UE 2QA4G 1X4EA 3IR6B 3HFVA 2AJFE 2G0JA 1CJTA 4DCJB 5T14A 5DLGA 2VICA 2EFVA 2XMVA 1X8DA 5D3GB 3TA0A 2FD2A 1NSQA 4EYIB 2D3UA 4TY8B 3NXZA 4B3MJ 4CLYA 4XO0A 5ETVA 3KWMA 2H5IB 1R0AB 4IH5A 3KHRA 1U09A 2XMTA 3GV8B 1S1VA 2V50A 4O3NA 2FPHX 3QT8A 1F5AA 2ZNZA 3KKFA 2J9CA 3UPFA 2W2OP 3MAAA 3TO8A 2XQCA 1QTNB 2DIVA 3SCIE 1FFWB 1RHUB 3HZEA 4ATNA 2CYYA 5G0RB 2DCUB 3M8PA 3H5YA 1NH8A 5KFFA 4ZVTB 3DRRB 5KFPA 4PWDA 4X4TA 4C8OA 4JI6J 1G2EA 4M5IA 2E1CA 4M5DB 3BH6B 1UVKA 1RHJB 4ZP8A 1HWJA 2JEFA 1IKVB 2HGLA 2AJ0A 2NS1B 3UW1A 4B17A 2DD8S 2RHQB 2Z4PA 3QJJA 5A0YA 5DG8A 4AD6A 4CO2A 2ZFHA 3NKYA 3M2UB 3TX0A 1RWKB 3DMJA 5KFKA 3FBEA 5HAOA 1GX5A 1RWMB 1SH0A 1FWLA 3ENVA 4WPAA 2EK1A 2AP6A 1S7HA 1WDDA 1VQYA 3W2WB 5CQGA 2XWXA 1VLYA 4ITSA 2QMXA 4EO6A 4RUCA 1T02A 2LU1A 3GJSB 4QBUA 3ZTOA 3OLAA 5KFJA 2APOA 4ZKAA 1URNA 3THPA 1TZ0A 3DOLA 3V6DA 3MOJB 4L72B 4DV7J 4LSNA 4IR9A 3MMBB 3OFGA 2MQLA 3W62A 3KHLA 1WD6A 2UXCJ 4DBQA 3CO9A 2HURA 1K0TA 4J7CA 1OQ6A 3LQVA 1NZAA 3TA2A 1SJ4P 1B7FA 1MSWD 1NK0A 1F1BB 3KTQA 1WC4A 4UTGA 2CJQA 3PJXA 4PPZA 2E5IA 1NHKL 4ZVRB 3NLCA 3KG1A 4U7CA 2B5JA 1RT6B 3RBZA 5ETLA 3K2YA 3AAWB 3W66A 4DV4F 3HKZD 1H72C 4PYAA 4DV3F 5ETMA 3QLHB 3DI6B 2J0QD 2VFRA 4FKYA 1HI1A 2JVOA 1KTQA 2IHR1 2IRYA 3KDOA 1XK8A 3QGIA 2YKMB 2MJUA 4QZVB 4R5PA 2GO9A 1A6LA 2R8GA 2ERRA 4WXWA 2D9OA 4DL7A 4ZLJA 2B8QA 2LECA 4Y2MA
chains in the Genus database with same CATH topology
5IC4B 1QTNB 4ZVQB 1RWOB 3NS7B 1GFWB 3GJSB 2C2ZB 2CNOB 2QL9B 2H4YB 3KJNB 1RHUB 3EDRB 4JB8B 2XYGB 3P45B 1RWWB 2C2OB 1RHRB 2H48B 2CNKB 2QL7B 4ZVPB 4ZVTB 2QL5B 2HBRB 3D6MB 5K20B 3R7BB 1SC1B 2DKOB 2QLFB 3R6LB 3R7SB 3EDQB 1RHMB 2HBYB 2Y0BB 3QNWB 4ZVOB 3D6HB 2Y1LB 2QLBB 2FQQB 2H54B 3D6FB 2HBQB 4ZVRB 1RHJB 2H4WB 3SIPB 2CNNB 2C2KB 2QLJB 1F9EB 4DCJB 3IBCB 4LSZB 1ICEB 4ZVSB 1RE1B 2H51B 1QDUB 1RHKB 2P2CB 3KJQB 1RHQB 1PYOB 1RWNB 1I3OB 2XZDB 2H5JB 3IBFB 2CNLB 4ZVUB 1RWKB 2CJXB 1IBCB 3GJTB 2HBZB 2XYHB 3R5JB 1NMEB 5IC6B 1RWMB 1BMQB 3GJQB 2CJYB 2C1EB 2CDRB 2C2MB 3RJMB 1RWPB 1PAUB 2H65B 1RWVB 4DCOB 3R7NB 2H5IB 4DCPB 1SC3B 1I51B 2XYPB 3P4UB 2XZTB 1SC4B 1RWXB 3R6GB 3GJRB 3KJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IC4 B;  1QTN B;  4ZVQ B;  1RWO B;  3NS7 B;  1GFW B;  3GJS B;  2C2Z B;  2CNO B;  2QL9 B;  2H4Y B;  3KJN B;  1RHU B;  3EDR B;  4JB8 B;  2XYG B;  3P45 B;  1RWW B;  2C2O B;  1RHR B;  2H48 B;  2CNK B;  2QL7 B;  4ZVP B;  4ZVT B;  2QL5 B;  2HBR B;  3D6M B;  5K20 B;  3R7B B;  1SC1 B;  2DKO B;  2QLF B;  3R6L B;  3R7S B;  3EDQ B;  1RHM B;  2HBY B;  2Y0B B;  3QNW B;  4ZVO B;  3D6H B;  2Y1L B;  2QLB B;  2FQQ B;  2H54 B;  3D6F B;  2HBQ B;  4ZVR B;  1RHJ B;  2H4W B;  3SIP B;  2CNN B;  2C2K B;  2QLJ B;  1F9E B;  4DCJ B;  3IBC B;  4LSZ B;  1ICE B;  4ZVS B;  1RE1 B;  2H51 B;  1QDU B;  1RHK B;  2P2C B;  3KJQ B;  1RHQ B;  1PYO B;  1RWN B;  1I3O B;  2XZD B;  2H5J B;  3IBF B;  2CNL B;  4ZVU B;  1RWK B;  2CJX B;  1IBC B;  3GJT B;  2HBZ B;  2XYH B;  3R5J B;  1NME B;  5IC6 B;  1RWM B;  1BMQ B;  3GJQ B;  2CJY B;  2C1E B;  2CDR B;  2C2M B;  3RJM B;  1RWP B;  1PAU B;  2H65 B;  1RWV B;  4DCO B;  3R7N B;  2H5I B;  4DCP B;  1SC3 B;  1I51 B;  2XYP B;  3P4U B;  2XZT B;  1SC4 B;  1RWX B;  3R6G B;  3GJR B;  3KJF B; 
#chains in the Genus database with same CATH topology
 4B3M F;  1S1U A;  4YOE A;  1N36 F;  1RZM A;  1DTT B;  2HHS A;  4YR2 A;  3JQM A;  1GTH A;  3WC2 A;  1SL0 A;  1WTF A;  3D6T B;  3TAR A;  2L41 A;  4N8N A;  3B82 A;  4O44 B;  3U1L A;  1X9M A;  3IRX B;  4NZ0 A;  1AA1 B;  3G82 A;  3MTK A;  2FB0 A;  1X4A A;  3VR1 A;  2EC0 A;  1H2T Z;  4ECR A;  1YLX A;  3DYA A;  4DMZ A;  1U26 A;  4JI6 F;  1DQ8 A;  1ZA1 B;  3M9O B;  3KLI A;  2CJA A;  4YDX A;  3OUY A;  3QSY B;  5K14 B;  1QAI A;  2JSX A;  4ECY A;  4FXD A;  2ZHO A;  1T03 A;  1J5O A;  2YKP A;  4A8O A;  2L48 A;  1RTI B;  5KFW A;  2GGP A;  2G2Y A;  4CLW A;  5I4M A;  2E5G A;  1HBU A;  3VAH A;  3D5M A;  3SSQ A;  2HNY A;  1HNI B;  4LF9 J;  3PRB A;  4RW4 A;  4ZLP A;  4CO4 A;  4DUZ F;  1YGY A;  4OLP A;  1UL3 A;  4NML A;  4YN3 B;  5I42 A;  1BUX A;  4JB8 B;  1AT1 B;  2MY8 A;  1X7V A;  4OJ3 A;  3R27 A;  5KT7 A;  1C0U A;  1A7G E;  3QBC A;  1GT8 A;  1KLN A;  1GAO A;  3OVA A;  2AMC B;  4DV7 F;  3KK3 B;  2QRR A;  2FY8 A;  3OR2 A;  2IPO B;  2DIS A;  3R97 A;  2V0N A;  4K7Q A;  2F9J A;  4C3L A;  3ZZO A;  1VBK A;  3GYG A;  1D0E A;  1VMB A;  1X4D A;  3FFI B;  2BDP A;  1S79 A;  2OI2 A;  5GAE I;  1WG5 A;  1EQM A;  3IO1 A;  2GA7 A;  3UR3 C;  5B0E A;  3D28 A;  5HQM A;  5F3Z A;  4HEA 9;  2X1A A;  2BMB A;  2ZBR A;  1JJ4 A;  3HHL A;  2YX1 A;  2DYA A;  2NXE A;  2AZ1 A;  2R2U A;  1RT5 B;  2MHE A;  1IVZ A;  4K5R A;  3FEY B;  1SJR A;  3M2V A;  2HFZ A;  5HMX A;  5KOW A;  4HR2 A;  2UUB J;  5IS2 A;  2GJF A;  2W4D A;  5JVH Q;  2DEJ A;  1O0P A;  4KHM A;  1W26 A;  1PCA A;  2MST A;  4ES3 A;  2MLY A;  2F8H A;  4FF2 A;  2YNG A;  5CYQ A;  1WJ9 A;  2Z2Z A;  1T9U A;  3FGV A;  1S9G A;  2DHG A;  4LFA J;  3BSA A;  1RB0 A;  4ED4 A;  1P27 B;  3BKT A;  3SIP B;  4E98 A;  2C2K B;  1Q95 G;  1JWW A;  5A8K B;  3AOD A;  4ICL A;  4OYX A;  3T41 A;  2EFO A;  4ID5 A;  1H6K X;  2CQ0 A;  2D7S A;  3EPG A;  1P1T A;  3UN3 A;  3BBB A;  1FD2 A;  2BRK A;  4DSE A;  3HX9 A;  2R7X A;  1EP4 B;  2VDH A;  2J6T A;  1KDN A;  3X1L B;  1Q5Y A;  3HT3 A;  2HVI A;  4A46 A;  2WON A;  2F4F A;  1VRQ C;  3MEC A;  5JJB A;  5KFA A;  1GEH A;  2UUT A;  4UY8 T;  1S76 D;  3GJR B;  2G2O A;  1SVD A;  3V4I B;  4QR2 A;  2GJ2 A;  3HT0 A;  1GQE A;  5CYM B;  3JTN A;  1SC6 A;  5A2Q U;  3CMQ A;  2BQ3 A;  1GH8 A;  4LF9 F;  2XY5 A;  2JLG A;  1RAC B;  5HQL A;  2I5J A;  1L3K A;  2GIF A;  2I8E A;  1VDH A;  4C0O C;  3LPY A;  4CLK A;  4WFX A;  1PO6 A;  3H5U A;  2F9D A;  4V19 J;  4F2R A;  1Q79 A;  4N76 A;  2RNE A;  5KFQ A;  5AE2 A;  2V2V A;  1SUQ A;  1PBU A;  1NEE A;  2G4B A;  1BQM B;  2C2N A;  2EI5 A;  1SIW B;  2HIY A;  4F4W A;  7FD1 A;  3LOU A;  4N7T A;  1KC8 T;  4U7U D;  2BE2 B;  2EKY A;  1AFJ A;  2CA9 A;  2VD3 A;  4FBU A;  2GAG C;  1RAI B;  3TJ8 A;  1VJW A;  4H4M A;  3TWZ A;  1SL2 A;  4ED5 A;  4OYI A;  1KVI A;  3AB4 B;  1Q16 B;  2QA4 S;  4UZC A;  3CED A;  1C2P A;  4MIW A;  1HBN B;  2V4R A;  5L39 A;  3LAM A;  3ETM A;  4I1T A;  4DL4 A;  2XZW A;  3MM6 A;  2EFQ A;  1S5Z A;  1T9T A;  2EW9 A;  4IFY A;  1QD1 A;  3B4M A;  3T9N A;  2ZEJ A;  2VPZ B;  2BJ8 A;  2IC3 B;  1VQP S;  3BQ0 A;  4P2F A;  2YH1 A;  4NI2 A;  2VBX A;  4DF4 A;  1QAJ A;  3PDN A;  2DNZ A;  5E3Q A;  3BSO A;  4CLZ A;  2UVU A;  3JXO A;  3HO1 A;  4LQ3 A;  1NCL A;  3F41 A;  3TYT A;  3SCL E;  3FMB A;  1EZZ B;  2QL5 B;  2HBR B;  2I6W A;  2E1A A;  1VJQ A;  3KK2 A;  3ILL A;  3BGF A;  4FYY B;  4J9L A;  4NAS A;  3T3F A;  3R8Y A;  5KFN A;  1OWX A;  1C1B B;  1N34 J;  3AXM A;  3CJR A;  3NGU A;  2HBQ B;  4ED0 A;  1WG4 A;  3MI7 X;  4ZJQ A;  4IOA Q;  2C28 A;  1B99 A;  1HBO A;  4MKA A;  1HWL A;  4LFA F;  3GPA A;  3QJP A;  2IRX A;  3SV4 A;  2W7P A;  1NDP A;  3DLE B;  1XMB A;  3IN5 A;  1X4B A;  4KGV B;  1LWE A;  3A3N B;  2XS7 A;  4ZIT A;  1M1G A;  1Q8B A;  4F3Q A;  1J5E F;  2VG6 B;  4J9R A;  4IRC A;  4KYZ A;  5EN1 A;  3VGU A;  2YNI B;  3UQS A;  1XR6 A;  4IG3 A;  2RKI A;  4B9M A;  4CLP A;  5LT5 A;  4EEY A;  3KUE A;  3W8G A;  2N82 B;  2V8H A;  2QA2 A;  1LXJ A;  1VC5 A;  5DDO C;  1RYR A;  3GSI A;  3NCQ A;  4M5D A;  3M9N B;  4DU7 A;  3D54 A;  2IY5 B;  3QGG A;  3KUG A;  3VGS A;  2W1B A;  4DL0 C;  3Q8S B;  2NCK L;  5BYR A;  4FN5 A;  2ACM A;  5IQQ A;  2GMH A;  3D6M B;  5HQ8 A;  3LWM A;  3SDE B;  2B43 A;  2XMK A;  2N7Y A;  3OXL A;  1OIA A;  4JI5 F;  3PYF A;  2DEI A;  4Q2L A;  4ZVF A;  2E7X A;  1BY9 A;  4WTY A;  4OL8 A;  2LLZ A;  2O1P A;  3DN9 A;  5K8O A;  1V6H A;  1VQS A;  2GML A;  2GCF A;  2HFS A;  4HT5 A;  3SQO P;  3W60 A;  4QIG A;  4ZPT R;  3A12 A;  1NJW A;  1DQ9 A;  4RPF A;  2OSR A;  1T05 A;  4K2X A;  4X65 J;  4LFC J;  1UA0 A;  3MM9 A;  2C1E B;  3CJ4 A;  3DGP B;  4RUB A;  3C2P A;  1KOO A;  3UDV A;  1RWU A;  1TFY A;  3MMB A;  1V5I B;  3S7R A;  1EX8 A;  4DS4 A;  2M3D A;  2I1R A;  5E41 A;  1QY7 A;  1FRM A;  4M1K A;  3PR4 A;  2DPJ A;  3THT A;  4AFF A;  1HQU A;  1IKW A;  1GXU A;  2M5Y A;  1U6F A;  4J9P A;  1TKX A;  2ZZM A;  3I31 A;  1IR0 A;  3KMQ A;  3KLE B;  1VIS A;  1WOR A;  2UXD J;  2AJQ A;  3DI6 A;  2PMW A;  3EUN A;  2QLB B;  2XMM A;  3D6F B;  3PNI A;  1UZD A;  1OYE A;  2FJA B;  4CI0 B;  2BX6 A;  5CD4 A;  2NSC A;  3M2R B;  2OAU A;  2M70 A;  1N34 F;  1GMW D;  4JI3 J;  2KJV A;  3MR3 A;  1FX4 A;  1C4C A;  4X4P A;  3ILJ A;  5K9F A;  4G3I A;  2R9L A;  4J9S A;  4JI1 J;  2DO0 A;  1UEV A;  3H59 A;  4KRW A;  1RWX B;  2W9B A;  3KHG A;  3VHQ A;  3PX4 A;  1N32 J;  3J80 Y;  4O44 A;  2DT9 A;  1XC9 A;  2XHW A;  3SI8 A;  1S57 A;  3ZNJ 1;  2YNH A;  1S6Q A;  1TL5 A;  2OPS B;  2X51 A;  4GVL A;  2FC9 A;  3PEJ A;  1VRU B;  5D78 A;  4RJV A;  5LSO A;  4A8S A;  2V2Q A;  3RAQ A;  2Y1L B;  3EGV A;  1WF0 A;  3JB9 k;  2N3L A;  2XGP A;  3DRS A;  4CNZ A;  3DM2 B;  1WHX A;  1B0P A;  4D3G A;  3AY0 A;  4U8Y A;  3KLH A;  1N52 B;  3MUR P;  3HVW A;  2AHO B;  2FVC A;  1BHN A;  3CCJ S;  3DRY A;  5IFM A;  1FKO A;  1LWX A;  5B0A A;  3PFE A;  5DZ6 A;  3CJ8 A;  5T41 A;  4K2J A;  2XEX A;  1NDK A;  3C8Y A;  4X65 F;  4RW8 B;  2BJ1 A;  2V63 A;  2VC0 A;  2QSF A;  3IGN A;  2V9K A;  1NSP A;  1U0H B;  1ZA2 B;  4OI1 A;  4PRF A;  2F8E X;  1FJG F;  4A47 A;  3KK3 A;  1RTZ A;  2I9S A;  3IRW P;  4ZOS A;  3HCX A;  2HHP A;  4EGL A;  2QE5 A;  4QR1 A;  4MKY A;  4RBV A;  3CUN A;  3RB0 A;  1NZ8 A;  3RR7 A;  3H25 A;  2Y9H A;  1QSS A;  1SH2 A;  3IWX A;  3F73 A;  1HNV A;  2UXD F;  1NHU A;  2U1A A;  4WFN Q;  3QFW A;  2Y3Y A;  1REV B;  4P7V A;  1KD1 T;  3TEH B;  4WF9 Q;  3Q8Y A;  5F8I A;  2HHH J;  4K4U A;  1IM6 A;  1JQG A;  2WCX A;  3ZXW A;  2RS2 A;  1QE1 A;  2ZZT A;  3O44 A;  4BC7 A;  3AA9 A;  3LGN A;  1P9Y A;  4KV8 B;  2GFF A;  1FXL A;  3M1V A;  2VAS A;  5J2P A;  4OZ3 A;  4JI3 F;  2D9P A;  4X4S A;  1R0C B;  4IRD A;  2V9W A;  4H4K A;  2YWG A;  2EFG A;  2KT2 A;  3HVT A;  1TMJ A;  1KQF B;  2FZC B;  2HG4 A;  2D3O 1;  4PWW A;  1UVI A;  3M8Z A;  2DIT A;  3ISN D;  3M7V A;  2OPQ A;  1YIT S;  2JC0 A;  3NOG A;  3U1M A;  1BQX A;  2F4V J;  2W25 A;  3TX8 A;  4C3M A;  1N32 F;  5AXK A;  1ZAW A;  4RNO A;  2Z2L A;  5J1E B;  5HMY A;  4PUO B;  4J9V A;  3KLG B;  5A8K A;  4O3P A;  1RK8 A;  2CPF A;  1Y9O A;  1PIE A;  4HHJ A;  4Q7A A;  4DEZ A;  3SFU A;  2F1F A;  3MAH A;  1YWX A;  3EE3 A;  4X4V A;  4NA2 A;  1IN0 A;  3IAS 9;  2F63 A;  2D3O R;  1R43 A;  2ZBI A;  4A8W A;  4ZIV A;  1RT1 A;  3TAP A;  5EUH A;  2J8S A;  3QSI A;  1CC8 A;  3G4S S;  1PC5 A;  2FY1 A;  2XY6 A;  2A0F B;  1I6J A;  2RU3 A;  1TQL A;  1SQG A;  3KMS A;  1Y7P A;  1LW0 B;  1RAE B;  2VZ9 A;  4QW9 A;  3A1Y G;  1DZ5 A;  4WE1 B;  3R5G A;  2CNO B;  2GC8 A;  4PG4 A;  1KHV A;  3SBM A;  1NXI A;  4CLS A;  5GAG I;  3OR1 B;  5ETP A;  4KE5 A;  5H9F K;  1RBO B;  4CYU B;  3HPO A;  1R27 B;  2JH3 A;  3B6B A;  2MGZ B;  3IR7 B;  4DX5 A;  1M1H A;  1DUR A;  1U1M A;  1M1K T;  2HIQ A;  4NRU A;  2GS8 A;  2MKS A;  4NOH A;  1K0V A;  1ROF A;  4AL7 A;  1U49 A;  2O5D A;  2RF2 A;  4OZ0 A;  2XHC A;  1JNZ B;  3V5R A;  4GO5 X;  4Q45 A;  2JOQ A;  1R8P A;  1R31 A;  4F8R A;  2YTC A;  4EBE A;  2IC3 A;  1IR1 A;  2B4V A;  2HHH F;  3LAK A;  4LRE A;  2ROP A;  2WRM A;  4QYR A;  2CPZ A;  5FDL B;  3BPD A;  5C25 A;  5IV4 A;  3BYR A;  2XC9 A;  5DG7 A;  4OHX A;  3R6G B;  3KK1 A;  4OHV A;  2VFS A;  2BM1 A;  4AQY J;  1OPI A;  1H3D A;  1XNR J;  3GFX A;  3M6U A;  3LW5 C;  3ENW A;  4TU8 A;  2JWN A;  2X1F A;  2DK2 A;  3HHN B;  1RHR B;  3OXF A;  3Q8V A;  2J0S D;  2F4V F;  4NLO A;  4DL5 A;  3LGH A;  1LFP A;  3FCW A;  3D6H B;  2EBG A;  2Z30 B;  3UD5 A;  4Z37 A;  1CSJ A;  2GO8 A;  1BLU A;  3WHI A;  1S0M A;  1JLB A;  2VG6 A;  2ZVS A;  4QU6 A;  3GMG A;  1YZ6 A;  1NHV A;  3C15 B;  4MKB A;  3UDE A;  4J5O A;  3E51 A;  1H98 A;  4OYA A;  3KLV A;  4J9K A;  3TP2 A;  1HHT P;  3GYN A;  2BZ2 A;  4UQG A;  1FTC A;  1RAD B;  2JC1 A;  2IA6 A;  4KPY A;  3I4H X;  4C11 A;  2RML A;  4TKT A;  3C6T B;  3CPW R;  3C66 A;  3IG1 A;  3VWS A;  2OO4 A;  1Q5V A;  2HEK A;  4F0H A;  4MAK A;  1ZZN A;  1IKY A;  1OMS A;  3CJ5 A;  2KXN B;  4C9D A;  1Q78 A;  4NZ6 A;  2DGT A;  4WJB A;  3SYZ A;  3GII A;  4K4X A;  3CNQ P;  2I38 A;  3JSM B;  5CCM A;  4UW2 A;  4K4W A;  1U48 A;  5K8M A;  4I7F B;  4L6V 3;  1C1C B;  1S77 D;  1TUW A;  3CDU A;  4DF8 A;  4RNF A;  3V6K A;  2J9E A;  1WOO A;  4HLB A;  2FC8 A;  2V94 A;  1QAY A;  2I2Y A;  5A8W B;  2AGQ A;  4Q8F A;  2M8H A;  5DJB A;  2YVS A;  4KO0 A;  1N0U A;  2FQQ B;  3HHD A;  2ILY A;  2BYC A;  3GIJ A;  1HWU A;  2HVH A;  2GQQ A;  1U1P A;  3CCV S;  3GCW P;  1VQ7 S;  1RWN B;  3G6E S;  1WC0 A;  4OV6 A;  2XNQ A;  2ZH6 A;  3BGR B;  2OLW A;  3BN7 A;  4HTJ A;  3OVB A;  1PYS B;  4RWW A;  4QWC A;  2R8J A;  3VCD A;  5GAE U;  1IJE B;  2CQP A;  3LP0 B;  2KHC A;  4PEO A;  4ELT A;  2F65 A;  4NLT A;  1QSL A;  2HWT A;  2DGW A;  8AT1 B;  2ILZ A;  4DN0 A;  4AQY F;  2MQM A;  4CO1 A;  2XBP A;  1FDA A;  3RR8 A;  2UZA A;  2CQ4 A;  1TAU A;  4O4R A;  1HL6 A;  4NLD A;  3HI9 A;  4F7V A;  5DG9 A;  1ARO P;  2DO4 A;  3ULH A;  1O51 A;  2EVZ A;  1EAR A;  1ACM B;  4ZP7 A;  2I0X A;  4G65 A;  4USJ C;  3FBC A;  4I2P B;  4WBF A;  1RT7 B;  1GK8 A;  1S1T A;  5F8N A;  4DJB A;  3HSJ A;  1NO8 A;  3W2V A;  2V4J A;  4M5L A;  4KBI A;  2HND B;  4ECW A;  4M5H A;  3D0H E;  1TV6 A;  3A13 A;  4M94 A;  4I2Q B;  2CJX B;  1UP1 A;  1FI4 A;  3LH2 S;  1S9E A;  4Y2A A;  4F02 A;  3DRP B;  2PT0 A;  3C3L A;  2WVF A;  5IQ6 A;  2HFV A;  4HL9 A;  2BEF A;  2OPS A;  1WHY A;  5D0E A;  4OV1 A;  4MTP A;  2BBE A;  2IIH A;  4ZDN A;  1OY9 A;  2B56 A;  3NNC A;  1RYS A;  3PW5 A;  4HTI A;  3HVR A;  4X4U A;  4IR1 A;  4Y2K A;  4WKR A;  5A8R A;  1U45 A;  3P45 B;  4V19 X;  1CQM A;  3N5B A;  4DQR A;  1RKJ A;  5GVQ A;  5KFV A;  2JEG A;  2E7V A;  1UW4 A;  1U8S A;  1MLA A;  2VFU A;  3I55 S;  4TYB A;  2Y0B B;  2HMI B;  1FJ7 A;  1TKT A;  1RT3 A;  1NAQ A;  5HL7 Q;  2VOO A;  1KRP A;  3GU0 A;  2JFD A;  5B0D A;  4XPE A;  3AQO A;  2R7V A;  3U27 A;  3J7A 1;  3WBZ A;  4URG A;  3C16 A;  5LMU J;  4RW8 A;  4DV2 J;  1F3F A;  4TU9 A;  2ZVI A;  1M5V C;  1UEK A;  3QRQ A;  4NCB A;  5HBM B;  1DLO B;  1XIQ A;  1U0H A;  2NXJ A;  2RE1 A;  4CQ1 A;  2ZBP A;  1RWV B;  1Y3K A;  3C19 A;  4P2X A;  5J2N B;  2XYP B;  1IQT A;  1GXL A;  1T8E A;  3LO3 A;  2P5V A;  1UA1 A;  3H20 A;  3GTY X;  2OD6 A;  4C8L A;  3HMJ G;  4IDK B;  9RUB A;  1RWO B;  1ITP A;  1CJK A;  4GKJ J;  2X1B A;  3LP2 B;  3MM8 A;  3Q2S C;  3GE9 A;  2ZC4 A;  1YIJ S;  1WC5 A;  2AGP A;  4EYH B;  2ZDP A;  3Q2T C;  1NKB A;  4GMK A;  2KH9 A;  2P8I A;  4QIV A;  4DUT A;  1RSC A;  1S12 A;  1E6V A;  4TY9 A;  3E01 B;  4RW9 B;  3EYZ A;  1U24 A;  3CCW A;  4KV8 A;  3GP9 A;  2CQH A;  5D6G A;  4USK A;  1VLO A;  1JXV A;  4XAK A;  4C97 A;  3Q8U A;  2HRT A;  4O3S A;  1YBT A;  1FWK A;  4UQT A;  1PJ6 A;  1P8G A;  2B8P A;  1D09 B;  4PPD A;  2E5J A;  1IBC B;  1S6O A;  4F4A A;  5LXY A;  1SJQ A;  3CJK A;  2CJY B;  2RDI A;  2XI3 A;  2ZJQ Q;  1PJ7 A;  4BHQ A;  1RTH B;  2CJ9 A;  3VAK A;  3V4M A;  4B3T F;  3Q8P B;  2IAJ B;  3FZB A;  4A8M P;  4PUO A;  1JJ2 R;  3DHW C;  2OMO A;  4DV5 J;  2OFG X;  3G2X A;  2ZH1 A;  1NM2 A;  5IT4 A;  3ZFV A;  1NPK A;  2A2D A;  2D74 B;  3D9B A;  3JQJ A;  2EEY A;  3WIU A;  4Z2X A;  3AOC A;  2CPJ A;  4NYP A;  3CJ0 A;  2ZH9 A;  1MN7 A;  3ZZP A;  5L1J A;  3CO0 P;  3CT9 A;  2Z2Y B;  3V81 B;  1PKU A;  1YJU A;  1Q82 T;  2ROG A;  5F8G A;  1LV5 A;  5A2Q Y;  4KHP J;  4F0M A;  5DGA A;  3HJF A;  2LQB A;  4BLG A;  4YEA A;  4UOH A;  3GCX P;  2UUA J;  1LW0 A;  3PTW A;  2FGC A;  4F2S A;  4WE1 A;  4O3Q A;  3M8W A;  3MMC B;  2HWI A;  1REG X;  1MWZ A;  2CWX A;  5J2Q A;  4DU8 A;  1M5H A;  5LMU F;  1FDB A;  4C3K A;  4Z7C A;  2KN4 A;  1M5P C;  1RCX B;  1NSA A;  4C2M A;  4LBH A;  3OR1 A;  4RR5 A;  4TNO A;  2VV5 A;  4MK9 A;  5RUB A;  1WF2 A;  1R7I A;  4HI1 A;  2MGZ A;  1L5U A;  3AJD A;  3TZZ A;  4OX9 F;  3NGS A;  4J9M A;  3ISZ A;  4MT1 A;  2M0G B;  4KFB B;  1P1L A;  2HFU A;  4ZCK A;  1XNQ J;  2QL7 B;  3GLJ A;  2QLX A;  3D68 A;  3CCR S;  4GKJ F;  4Y2I A;  3V2U C;  3O5T B;  3TW0 A;  2GHW A;  1CBK A;  1U1R A;  1IBL F;  3POT A;  5M2P A;  3L7O A;  4JV0 A;  3OTC A;  1WUU A;  1KQK A;  2YX7 A;  5AJ3 J;  1Y3J A;  2C42 A;  4ZCM A;  1CJT B;  4UUX A;  4E8U A;  4R0E A;  1WKL A;  5B0F A;  5B08 A;  3WX4 A;  4EFA C;  4X4Q A;  3RBX A;  4OYM A;  3Q8Q B;  3OPK A;  2FDN A;  4CLF A;  1UJ4 A;  3MR2 A;  2J7U A;  2FJB B;  4Y34 A;  5DS7 A;  1X60 A;  2BE7 D;  4JI0 F;  2HAI A;  3T1Y J;  2HRU A;  3MHY A;  1EIY B;  3ILO A;  3QAU A;  3H2U B;  4A4J A;  3MAA B;  5I3P A;  1FDD A;  5IXU A;  1O5J A;  2NXN A;  3H98 A;  2LP4 A;  4OZN A;  4DV5 F;  1FRL A;  2WZ1 A;  4KGZ B;  3C15 A;  2PDA A;  3CIZ A;  4ES2 A;  2WSC C;  1NB7 A;  4PWD B;  1HD0 A;  2GIQ A;  2QIF A;  3IM9 A;  2R2R A;  4QPT A;  3N6M A;  2POK A;  5AXL A;  3FUY A;  4M63 A;  3MUT P;  3N0V A;  1VIX A;  1HAR A;  2CUY A;  1YX2 A;  5J1N A;  5A0Y B;  3CXC R;  1KFD A;  2B9E A;  2BQR A;  1U2F A;  1XJW B;  2EG1 A;  4OI4 A;  4KHP F;  3CD7 A;  3SSS A;  2PMZ D;  3JSM A;  4IFV B;  2UUA F;  3GFH A;  3WZ0 A;  3AQP A;  1K1Q A;  1C1C A;  5HK4 A;  2KHD A;  4EO8 A;  2JEI A;  3Q23 A;  2JZ5 A;  4B9N A;  1RAJ A;  1N5V A;  3FKB A;  2KZZ A;  4NXN J;  4J9N A;  2NYH A;  4NLR A;  2MKI A;  2WVC A;  1F9H A;  2HQD A;  1WG1 A;  2D3Z A;  5DDP C;  1TL3 A;  4DLG A;  1T7P A;  2AWZ A;  3FSI A;  3OT9 A;  3EDR B;  1AB8 A;  3DOL B;  1VR6 A;  3V6D B;  4LSN B;  4LJM A;  1HIY A;  2YWK A;  2C3U A;  1XWL A;  1XNQ F;  4ZPA A;  3TUP A;  5BYS A;  4LMZ A;  1N8R T;  2YNF B;  2B5J B;  2ZH2 A;  5D0G A;  3BGR A;  4LF1 A;  3A3P B;  1JXL A;  5M2R A;  3KXD A;  3THV A;  4JI4 J;  4WFY A;  2IDE A;  5HAN A;  5L46 A;  3NCP A;  1T9V A;  5AJ3 F;  2AV5 A;  2HYI B;  3BN4 A;  5IWA J;  4I67 A;  1I94 J;  3C46 A;  1Q86 T;  3AHP A;  3R5J B;  5E33 A;  1MU2 B;  5F8H A;  3LP0 A;  4F4K A;  4R5P B;  3H5X A;  2HNZ A;  2QTW A;  2KRR A;  3GV7 B;  1YK9 A;  3GIM A;  2W4P A;  4LIW A;  3BS9 A;  4HKQ A;  3IWN C;  2E9T A;  3DLK A;  3OVS A;  4WCE Q;  1S1U B;  3BJY A;  4GVB A;  1UWB B;  3F56 A;  2RAQ A;  2DY1 A;  3T1Y F;  1YSJ A;  3M8Y A;  3CUL A;  4OHZ A;  2ZH5 A;  4A8X A;  2G13 A;  2C2O B;  4ECX A;  1NJY A;  2IFX A;  2VG5 B;  1YQH A;  1NKC A;  3CCQ S;  3T19 A;  1H74 A;  2QG9 B;  1M5K C;  3BR8 A;  1M90 T;  2FTR A;  9ATC B;  2WW4 A;  1I5O B;  2R8I A;  4IG0 A;  5JXS A;  2RUG A;  3DRP A;  4A8F A;  2ZE2 A;  5EX0 A;  3KLI B;  3OUY B;  2LEB A;  2E29 A;  4X62 F;  2EPI A;  2VQF J;  1Q7Y T;  4LSL A;  1T03 B;  1J5O B;  5HSP A;  2GGP B;  1KNZ A;  1N5Q A;  5DQG A;  1YJV A;  8ATC B;  4HHU A;  4K4Y A;  3C14 A;  5L9X A;  2HHU A;  1H38 A;  3AFG A;  2QLW A;  2HQG A;  4Q5V A;  2HNY B;  4M5M A;  4DR2 J;  4QW8 A;  3TOQ A;  4RW4 B;  4TU7 A;  2WK4 A;  4DR1 J;  2HMI A;  4GO7 X;  2CKW A;  1S9F A;  2LKZ A;  3O2I A;  3EGZ A;  4NXN F;  3LGM A;  3DOK B;  3IBW A;  2KZM A;  3HFZ B;  2AJ2 A;  4NLU A;  3W9I A;  3OFF A;  3K8W A;  4FYX B;  3BKF A;  4O4G A;  1C0U B;  3I56 S;  4DN9 A;  2XLI A;  1W25 A;  3JAM U;  1UJ6 A;  3OL6 A;  5C7P A;  1RAG B;  2QX0 A;  3OR2 B;  2QSW A;  1DLO A;  4V1A k;  3CJS A;  2DXE A;  2CVI A;  2FZK B;  1G3O A;  3KJQ B;  4ZLL A;  3DOM A;  2C2E A;  2B6A A;  3HHL B;  1ZH5 A;  3ZO7 A;  4A8Y A;  4IDK A;  1K44 A;  3BZQ A;  4JI4 F;  4HAC B;  2HGM A;  3D3C J;  4OI6 A;  3MM5 A;  3MAQ A;  3M2V B;  1FNM A;  4DCO B;  2ZKU A;  2A1B A;  5D8H B;  1IQZ A;  1TVR B;  5ETS A;  1UW9 A;  2O66 A;  3W8P A;  4YB6 A;  1I94 F;  1JLQ A;  2F3J A;  1N48 A;  2GVD A;  3MF5 A;  3SXL A;  2MKC A;  1IR2 A;  4NLW A;  4LRA A;  4MJK A;  4RW9 A;  1X4H A;  1JLG B;  3AT1 B;  4NE9 C;  4LVO P;  2K7J A;  5CYQ B;  1RWW B;  3EMT A;  2LEP A;  4J37 A;  3KJV A;  2AEF A;  2AQ4 A;  1S6P A;  1S9G B;  4Q0B A;  2H1Y A;  4PG7 A;  2DNY A;  1S1X A;  2B4P A;  1WOS A;  3FQL A;  3SSR A;  3GR1 A;  2FVS A;  4NLX A;  5M2U A;  2QZ8 A;  3QAE A;  2RUS A;  2IRU A;  3CB4 A;  2FVP A;  1B64 A;  5HJY A;  4ICL B;  3MCO A;  1B4S A;  4ID5 B;  3Q0A A;  1E6Y A;  4H4O A;  3MFI A;  4CWB A;  4GKK J;  3EJM A;  3U02 A;  5L8R C;  3G8T A;  4R8U A;  3JSB A;  1R6V A;  2KM8 B;  3G96 A;  2GMJ A;  2Y0S D;  5CH7 B;  4ZCI A;  4DX7 A;  2WW8 A;  5IM0 A;  2Y8Y A;  1RBL A;  2BJD A;  2WON B;  2PGC A;  1YTY A;  2M8D B;  2W4C A;  3MEC B;  1HYS A;  3AOB A;  3NGD A;  1U7L A;  1K9M T;  4I68 A;  2CG8 A;  4DR2 F;  2BKP A;  1MNE A;  1G1X A;  4R25 A;  2J0X A;  2I5J B;  1OSD A;  2CNK B;  4RNH A;  4JV5 J;  4YDD B;  4DR1 F;  2PFF B;  5K20 B;  4LR9 A;  3JTO A;  5F9L A;  2HZC A;  4MIB A;  1NRK A;  2DTJ A;  3W5Y A;  3JSR A;  4DFK A;  2FHO B;  1SUQ B;  1HW9 A;  1U1K A;  3TEG A;  1VHF A;  3VAL A;  1JLA B;  3CCZ A;  3N9U C;  2KVQ E;  5KFI A;  4P2M A;  1M5S A;  2R8K A;  4NX9 A;  2VHG A;  4H4M B;  4NPO A;  2ADB A;  1UET A;  2DR8 A;  3MCM A;  3K17 A;  3C6U A;  2BKN A;  4KPC A;  2CQI A;  2QA1 A;  3J81 Y;  4ZP6 A;  4QYZ J;  1U2R A;  4M5J A;  4QWA A;  3MM6 B;  5T7L A;  1HNW F;  2E9Z A;  1F6T A;  1WHV A;  2CZV C;  3PIO Q;  4FYD A;  1SQF A;  4NI2 B;  5KG3 A;  2QEX S;  4YFU A;  2CPH A;  3L7P A;  3W64 A;  3K57 A;  2KDO A;  1UFW A;  4DPT A;  1SXL A;  1QTM A;  2DH8 A;  4ECZ A;  3PCO B;  4N56 A;  1HQE A;  3UR0 A;  3KK2 B;  4YQW A;  2HBY B;  5ETN A;  2P9G A;  2K8G A;  2V8P A;  3DDK A;  4PXC A;  4PR6 A;  3UD4 P;  4DUY F;  2CPD A;  1VQN S;  3AA8 A;  2AX1 A;  4HH1 A;  4EZ9 A;  4CP5 A;  1KLM A;  1HBO B;  1ZAV A;  2CFX A;  3QWU A;  4LSZ B;  4ELV A;  1YRT A;  1N36 J;  2KL8 A;  1RKI A;  3MZI A;  4ZIW A;  2YPY A;  1DQA A;  2VBZ A;  4F25 A;  1LWE B;  2VG7 A;  5GMK a;  1BMQ B;  2ZH7 A;  4TXS A;  3J7Z T;  5HI7 A;  3T5L A;  4YUD A;  5ETR A;  5KFB A;  3HD2 A;  2RRA A;  3VQT A;  4IG3 B;  2RKI B;  1CG2 A;  4GKK F;  3A3O B;  3TRG A;  1KEK A;  1OY6 A;  2GV1 A;  4WZQ A;  2HGN A;  1U02 A;  3I0R A;  2FJD B;  1MW7 A;  6FDR A;  1HQ2 A;  3HSZ A;  2BW7 A;  3DRX A;  1RU1 A;  2O67 A;  3DLG A;  3OFE A;  3RUB L;  2QLF B;  2KXF A;  1ZM3 A;  2JRS A;  3OL8 A;  4AXJ A;  4B02 A;  5J1P A;  2YKN A;  4JV5 F;  3I87 A;  3DLL Q;  2MJN A;  3ZZR A;  1WNE A;  2AF6 A;  4WP8 A;  5GME A;  1R8A A;  2GHV C;  2BJ9 A;  4O23 A;  4WFZ A;  2MKK A;  4N5S A;  2IJR A;  4IFV A;  2FHJ A;  4DUZ J;  4YHH J;  2PE8 A;  1QVG R;  1PYT A;  5CCL A;  2V2Z A;  1I1G A;  1Q81 T;  2LVW A;  1IKX B;  3PYD A;  1XR7 A;  3GJT B;  1T05 B;  4ZPV R;  1LQ9 A;  3MM9 B;  2VFV A;  4QWD A;  3K59 A;  3RTV A;  1WEL A;  2D41 A;  4DCP B;  2HFO A;  2NZ4 A;  3DU6 A;  3K8V A;  1FRK A;  2IM3 A;  4K8R A;  3H2V E;  3OTD A;  2C22 A;  5DZ7 A;  4RKU C;  5B0B A;  1HQU B;  2K06 A;  1IKW B;  3GQC A;  4HYK A;  1FRH A;  1UPM B;  1DAX A;  2YNF A;  1TKX B;  3QJL A;  4KC5 A;  4OYO A;  3G71 S;  1B0V A;  1D9A A;  3RW6 A;  1TUV A;  1KP6 A;  1T9X A;  5HJX A;  2ZD1 A;  4KTQ A;  5IZH A;  1NSK L;  3US5 A;  4DV1 J;  3RBD A;  1FRI A;  2OPP A;  1DHM A;  1MU2 A;  4JOU A;  2DNO A;  1X5S A;  5F8M A;  4L75 A;  4U6P A;  4LBP A;  1ULR A;  2XZD B;  2H5J B;  1MWY A;  3RAX A;  2DRD A;  5CZX A;  1FHT A;  2G0C A;  1UWB A;  4A48 A;  2YWW A;  1KQG B;  4U95 A;  4U7U K;  3N6L A;  1LK5 A;  5K5M A;  4KH0 B;  2OUG A;  1GMW A;  1IBM J;  2CAJ A;  2W9B B;  2VG5 A;  2UVR A;  2VC1 A;  2B3T B;  3HVA A;  4HI2 A;  3HK2 A;  1VQ5 S;  5CAB A;  2GHP A;  5F8L A;  1FVS A;  2QGF B;  3ELH A;  3NOC A;  1UEU A;  2YNH B;  1S6Q B;  2FHM A;  1N5Y A;  3TJ9 A;  3BF4 A;  4X4O A;  2HK3 A;  4EBC A;  2L3M A;  3M6X A;  2P9E A;  4Y65 A;  1U25 A;  2BE9 B;  5KFX A;  2MKJ A;  5K8N A;  1JK9 B;  3DRS B;  4HDH A;  4XTT A;  3UI3 A;  4DWI A;  2QYG A;  4WIQ A;  2CQ3 A;  4RW7 A;  4ER8 A;  3I4P A;  1PAE X;  1FK9 A;  4OFZ A;  4LF6 F;  3KLH B;  4DV0 J;  2Y1J A;  2M88 A;  1S10 A;  4YS2 A;  5IV3 A;  3T6J A;  2PII A;  3NNH A;  3H42 A;  2L9D A;  4FKX A;  1FKO B;  3L7U A;  4YY3 J;  5LXR A;  1RQ0 A;  4YHH F;  4CM0 A;  4QPX A;  3GFY A;  3BGL A;  3MMA A;  2FJW A;  3OLB A;  3ONQ A;  4DL2 A;  4E2F B;  2MEW A;  3DOK A;  5LJ5 Y;  3L95 X;  3PO5 A;  1S1W A;  4XK8 C;  1RAH B;  3T1H F;  5KFT A;  4IH6 A;  1TTH B;  3VGV A;  1PSD A;  1AW0 A;  2MDA A;  2ZUG A;  4F4Z A;  4MK7 A;  4G6V B;  1IBK J;  2N4D A;  1N33 F;  5KFO A;  1FF2 A;  5U47 A;  2BRL A;  4GRS A;  2VU5 A;  2BM0 A;  2HQF A;  4OYW A;  2CPI A;  2FUG 9;  1DTQ A;  3CJT A;  5C42 A;  2MQO A;  1V3S A;  1X9W A;  2LCW A;  3NRB A;  1T0T V;  1FKA F;  2RQC A;  1G7C B;  1HNV B;  2MZS A;  4HAC A;  2F5G A;  3M6V A;  3FCH A;  3OBI A;  2CQD A;  2Q43 A;  4CLL A;  4CM2 A;  2AYG A;  2YQ0 A;  2LQJ A;  4K4V A;  1TVR A;  2VF3 A;  3MXH P;  4ID8 A;  2XWY A;  3OJS A;  4DV1 F;  1FO1 A;  1JNR B;  3PHE A;  3TVZ A;  3K5M A;  2HAF A;  1QE1 B;  2YQ1 A;  2OD4 A;  3M1V B;  2LA4 A;  3ET6 A;  5J2P B;  4RU9 A;  2OHD A;  2WTF A;  1U0S A;  3PHT A;  3R7N B;  1JLG A;  4J9Q A;  1KN6 A;  3HVT B;  4RNN A;  2AYB A;  1D9D A;  4X4R A;  3M4X A;  3CCS S;  3A8K A;  4WKY A;  2IJF A;  1KTV A;  3ZZU A;  1ZPW X;  4Y3C A;  1H2V Z;  3UVJ A;  4KJI A;  2OPQ B;  2DGV A;  2ZUA A;  4PG5 A;  1FXR A;  3BPS P;  1IBM F;  3G86 A;  1VYA A;  1DAR A;  3EIC A;  1UFK A;  4PYD A;  2G0I A;  1RAF B;  3TA1 A;  3HHK A;  2MZQ A;  2VL1 A;  1J5E J;  2IYI A;  3D1Q A;  3IFE A;  2IM0 A;  2W8K A;  3W7B A;  2KFZ A;  1SPB P;  4M8L A;  4LBI A;  2PD1 A;  2AJ1 A;  1TL1 A;  3CCM S;  4CT8 A;  1YKW A;  3MGJ A;  2CQG A;  2ADC A;  3SEO A;  1X4G A;  1Y5I B;  3FZ2 A;  5CHC B;  1V5V A;  2RH3 A;  1PG5 B;  2K2P A;  1RT1 B;  3BEG B;  4PXB A;  4C98 A;  5HP1 A;  1EET A;  1VBZ A;  4DV0 F;  2WVB A;  1QLN A;  4K4T A;  2HWH A;  4YY3 F;  5A6P A;  2XNR A;  4JI5 J;  4DR6 J;  2BVZ A;  1C0T B;  1RA7 A;  4KKO A;  4USW A;  2MMY A;  3GIL A;  3JS9 A;  2MXY A;  5CD4 H;  2Q1L A;  2DGO A;  2DNQ A;  4NMX A;  4EBD A;  2V8D A;  2KYZ A;  1JLA A;  2DCL A;  3VAM A;  2ZOF A;  1F5B A;  4DQS A;  2LEA A;  2ZHB A;  1IBK F;  4ZVO B;  2XM3 A;  3RG6 A;  1U47 A;  1Q1K A;  1Y4Z B;  5GAD I;  3P5B P;  4I69 A;  5SUH A;  1P6T A;  4WZM A;  2DNK A;  1MMD A;  4UT4 A;  2KI2 A;  1YJR A;  2RF2 B;  3TAN A;  1FTR A;  2X3G A;  1L3T A;  1F5C A;  3K58 A;  5EDW A;  1EKR A;  1S48 A;  1DFD A;  3CD6 S;  4NRT A;  1FVQ A;  3G9C A;  1SL1 A;  1SV5 A;  4B3O A;  3MEG A;  1CJU A;  3HLU A;  1X4F A;  3MWB A;  2HKE A;  3I9V 9;  1RDR A;  3UNG C;  5C2G A;  3DNC A;  5IT0 A;  1RU2 A;  3PAC A;  5C25 B;  2JFK A;  3GIK A;  3KK1 B;  1Q53 A;  1O6X A;  4NA3 A;  1LWF B;  2HVE A;  2DY9 A;  1ZTW A;  3SCJ E;  1VK8 A;  3CD0 A;  3RW7 A;  4EUV A;  2AJ4 A;  1GTE A;  4P75 A;  1M0S A;  1PBA A;  3BBC A;  1V9O A;  2C3P A;  2DH9 A;  2IDL A;  2RIL A;  1B3T A;  3VAI A;  1SIZ A;  2OTJ S;  1NBE B;  2OTL S;  1SKW A;  4H54 A;  2R7Q A;  4CZC A;  2C3Y A;  3TI0 A;  3MED A;  4A8Q A;  2RD5 C;  2GQ2 A;  4FVC A;  3MPU B;  2R2S A;  3TUZ C;  1JLB B;  2BAB A;  2MPU A;  1S0N A;  3K5P A;  4O3O A;  2L08 A;  4CH7 A;  1KBR A;  4IKA A;  1BWE A;  2NUU G;  3CVK A;  4DV6 F;  4ZK7 M;  1UCN A;  4UY8 5;  1OQ3 A;  1JLE A;  4W4M A;  2KFY A;  3R1L A;  1OYD A;  3Q22 A;  4C11 B;  2FVQ A;  2AIR B;  5KFS A;  3IG1 B;  3CCT A;  1KOH A;  1QAX A;  4DPY A;  2IVF B;  2XY7 A;  2COL A;  3VZI A;  4ELU A;  1JJC B;  1RLC L;  1IKY B;  3NEK A;  3M8Q A;  1EKS A;  1HPZ A;  2CWK A;  1RTD A;  3R9L A;  3RBE A;  4RO0 A;  2G2Z A;  4C8Y A;  4DR6 F;  2DHA A;  1P9Q C;  1KS2 A;  1LEO A;  4DLE A;  2GW8 A;  4YB5 A;  4DR7 F;  4U67 Q;  4NLQ A;  1WDT A;  3R6L B;  4QOT A;  5MLC V;  2A6O A;  4KO0 B;  3ZTS A;  2VH7 A;  1IKX A;  2HZV A;  3ZZY A;  2Z8Q A;  3NBP B;  3VZH A;  4ILL A;  4G1I A;  5B0C A;  3EWG A;  2NXU A;  2IYG A;  1YZ7 A;  1H2U X;  1FJG J;  4W90 B;  3NY0 A;  2MTL A;  4YR0 A;  2FLL A;  3D1H A;  2KU7 A;  4QIF A;  3EXY A;  5E3R A;  3AJ1 A;  3HHL C;  1TFW A;  2O3D A;  1KFS A;  1QVF R;  2R7W A;  1ZET A;  3H4D A;  1TEL A;  3CJ2 A;  2XO6 A;  1G4C A;  3PJW A;  2DBB A;  2JEJ A;  1Y10 A;  4HDG A;  3DCA A;  3T5H A;  3KHH A;  4CO0 A;  4EMD A;  1U1N A;  5ETT A;  2LFV A;  3CC2 S;  4N41 A;  1KKH A;  4KGM A;  5FD1 A;  1KWM A;  4ECT A;  4TLR A;  1FNX H;  3UE2 A;  3GR0 A;  1NH7 A;  4BWJ A;  4DS5 A;  3K5O A;  5F8J A;  1S1T B;  3BBF A;  1SB6 A;  4OZJ A;  2EG2 A;  3W2V B;  2V4J B;  1KON A;  3QYY A;  3H0P A;  3IP0 A;  1RHQ B;  3MOZ A;  2DNG A;  3L4B C;  1TV6 B;  2Z0G A;  1FE4 A;  2CNL B;  3W9H A;  4MFB B;  2IA0 A;  2QMU B;  3ETO A;  2HPU A;  3SZ2 A;  1RT4 B;  3GJQ B;  1S9E B;  5ETK A;  1PAU B;  1Y00 A;  3OHB A;  2X3D A;  2H9Z A;  4UOF A;  4C8Z A;  3UO0 A;  2RQK A;  2KM8 C;  1HLW A;  5DM6 Q;  3D1O A;  1IUJ A;  3KG0 A;  5HO4 A;  2YWH A;  5KG2 A;  1TK8 A;  1RCO B;  3ZC4 A;  2HHX A;  2FLP A;  3QRR A;  5A8R B;  2M52 A;  4NLV A;  2JVR A;  2Z2M A;  5E2Q A;  2H5E A;  2DJW A;  5KG5 A;  2AW0 A;  5A6W A;  1FA0 A;  1TKT B;  1RT3 B;  1BXN A;  1AFI A;  4ANE A;  2ZJR Q;  4FNH A;  1Q4R A;  1UVJ A;  3QO9 A;  1MRO A;  1FNO A;  5LSR A;  4USM A;  2CXE A;  1XR5 A;  2YKQ A;  2B9Y A;  1YJN S;  1FFS B;  3PKY A;  2UVV A;  2BJ7 A;  2MQP A;  3C16 B;  2VPX B;  1VBX A;  1QUP A;  4P9S A;  4K5S A;  4DXL A;  3QZ7 A;  3MTJ A;  3U1N A;  3JAM Y;  3ZZ0 A;  1FT8 A;  2QN6 B;  4QCL A;  3I5C A;  2OEK A;  3OD2 A;  1CJV A;  4E0D A;  4I0W A;  5E3P A;  3D66 A;  3M6W A;  2K1R A;  3OXG A;  1LOU A;  4OJ1 A;  3UN5 A;  3ADA C;  3ENA A;  2IVY A;  2W24 A;  4ERD A;  3WDO A;  2UUC J;  3MFH A;  4LF7 F;  4PAA A;  4IO9 Q;  1CJK B;  4P10 A;  1NND A;  3MM8 B;  1JLC A;  1VQO S;  2GZO A;  2DR9 A;  3FRY A;  3OSP A;  4LT6 A;  5HAT A;  4DR3 J;  1BWV A;  3H8Y A;  4DFP A;  2B0G A;  1U2C A;  3HSG A;  4G1Q A;  3UFC X;  3R5D A;  2EC2 A;  4I64 A;  1E6V B;  4JUZ A;  4IQX A;  1AZS A;  4IOC Q;  2WBM A;  1HA1 A;  1NKE A;  3V6H A;  3DKD A;  1W2I A;  2VJU A;  2J6S A;  1D3W A;  4DX8 H;  2RRN A;  4L76 A;  3D3B J;  4YME A;  4TYA A;  3GV5 B;  3I0S A;  2VKR A;  4RBT A;  1AUD A;  4UOC A;  2XMW A;  2HBZ B;  1V3R A;  3G6Y A;  4ED1 A;  2AYE A;  2B7B B;  1ZM9 A;  3CJK B;  5DO2 A;  4DPW A;  3F0N A;  2H65 B;  1YG0 A;  4NL5 A;  2BAC A;  3LA0 A;  1WEY A;  5LOQ A;  4OI3 A;  2M9K A;  1XMO J;  4OX6 A;  4LQ9 A;  2G1H A;  5B0G A;  2E44 A;  3MUV P;  4YB1 P;  3KLF A;  1T11 A;  2H4Y B;  4ZN1 A;  4FDF A;  1NPP A;  1UFL A;  1F3V A;  1T9Y A;  3BO2 A;  3RU0 A;  4PCQ A;  3L3C A;  3EVM A;  3UCZ P;  1HHQ A;  3P5T L;  3E2E A;  3KFW X;  5B09 A;  1SJ3 P;  2ZH4 A;  2KRB A;  2EKN A;  4MYU A;  2KT3 A;  4X64 J;  4IUF A;  2AKW B;  3PR5 B;  4IRK A;  2H4W B;  5CA5 A;  5D4P A;  3Q83 A;  2NRE A;  2MB0 B;  3N79 A;  3NAH A;  4J9O A;  2CQ2 A;  2OH2 A;  3DC2 A;  4Y6I A;  2MYF A;  1C0T A;  3LPE A;  5AXN A;  1Q7L B;  5KG6 A;  4F3O A;  2NPI A;  5J2Q B;  5DDQ C;  2HQI A;  4QYZ K;  1LW2 A;  3PV8 A;  1JKH A;  5HMZ A;  4ILM A;  3LAN A;  4B9V A;  2IVM A;  3OTB A;  5HLF A;  2W2M P;  2V8V A;  2DNL A;  3NWG A;  1YBU A;  2YWF A;  2XO7 A;  2BW2 A;  4ZCL A;  2UUC F;  5BR8 J;  3J81 U;  3BQ2 A;  5KFY A;  4WK1 A;  2X7I A;  2J7W A;  3R2C J;  3QIP A;  3POT B;  4FYW B;  4DR3 F;  3QT7 A;  1ZTT A;  3SQG A;  4NLP A;  1V3Z A;  3MPV A;  5F3T A;  4OIX A;  5KT5 A;  1VQ6 S;  2YBV A;  3BR9 A;  3I5B A;  1WKK A;  4F26 A;  3DXS X;  1HWK A;  1HD1 A;  3D0I E;  3CW2 C;  2XB2 D;  2GVZ B;  2HHQ A;  1LWF A;  1HR0 J;  2LA6 A;  4CTA A;  1XER A;  1O8B A;  2VA3 A;  2RQ4 A;  3J7Y I;  6FD1 A;  3FEZ A;  3W5X A;  2R7S A;  2PFD A;  3I96 A;  1SQE A;  3UD3 P;  3WIV A;  2RVJ A;  7FDR A;  2ZJP Q;  4PXE A;  4OYP A;  5H9E J;  5FJ4 A;  2OJ3 A;  1TMM A;  1XMO F;  5JVG Q;  2XSJ A;  5JUM A;  3FSY A;  2K3K A;  4FP9 A;  3RRK A;  1NPR A;  5DRK A;  5C24 B;  1SC1 B;  5E0O A;  1URR A;  4BC9 A;  3KDN A;  4PZV A;  1HMV A;  3TAQ A;  3QRP A;  1NK9 A;  3R5A A;  4B3R J;  2MLX A;  2MQQ A;  4M95 A;  2H54 B;  3GYX B;  4IQM A;  4R0J A;  1XEZ A;  4CH1 A;  3IS9 B;  5D4L A;  5KFG A;  2R7O A;  5EX3 A;  3P96 A;  3PG9 A;  4X64 F;  5D4O A;  1JB0 C;  1RE1 B;  4BWM A;  3NP5 A;  4F50 A;  1I3O B;  2ZBQ A;  4LRC A;  2UXC F;  3RAM A;  5IC6 B;  3PW2 A;  2J7K A;  3LF0 A;  3M32 A;  3SV3 A;  2BKO A;  3AD7 C;  1SKR A;  1FXD A;  5THW A;  1VOM A;  2AYM A;  1JLF B;  2C2D A;  5ETO A;  2VBW A;  3N4W A;  4OLO A;  3OSN A;  1CQN A;  1TL3 B;  3QZ8 A;  4P73 A;  4RX6 A;  1HHS A;  2WSE C;  4DR4 J;  3CCE S;  5F0W A;  3TAM A;  1HNX J;  2DH7 A;  3NBP A;  1SCJ B;  1VQ8 S;  2RT3 A;  4IO1 A;  1RHM B;  5DQI A;  5BR8 F;  1U1Q A;  2BAN A;  2AEM A;  3MM7 B;  4ZJL A;  1WWH A;  3BQ1 A;  2CPE A;  2J9D A;  3J81 j;  4FXW A;  1Q8I A;  1HBM A;  5I3U B;  3GG1 A;  4K0K J;  2J76 E;  3N6N A;  3B8H A;  3D4J A;  1WEX A;  1BC6 A;  1VI7 A;  2X1G A;  2ASY A;  1NME B;  3K5L A;  3HM9 A;  4JI2 J;  2RRB A;  2HNZ B;  2DGX A;  2CG4 A;  1I51 B;  1NDC A;  4USV A;  5IT9 Y;  4ZHR A;  5GMD A;  2LXI A;  3L9Z A;  4ZVG A;  4PQU B;  5KAK A;  5CXT A;  1HR0 F;  4WYW A;  2KO1 A;  1FDN A;  3DLK B;  4H4K C;  4IH7 A;  3MCS A;  4GVB B;  2HS4 A;  2BA9 A;  4X4N A;  4FPR A;  4NYZ A;  2BJE A;  1CC7 A;  2HVD A;  4Y0F A;  1Z2Z A;  4OZL A;  1X5O A;  4URS A;  2YXL A;  4EWT A;  3T5J A;  3NWR A;  3F44 A;  4QIE A;  1Y0H A;  2P6S A;  1OS5 A;  1U1O A;  3R7S B;  4ZJO A;  1X0F A;  3QT6 A;  5HVG A;  4MFB A;  1NJX A;  4B3T J;  4CRJ A;  4M5N A;  3UCG A;  5ETQ A;  4IG0 B;  1RT4 A;  1TK5 A;  2IJN A;  2YY3 A;  2VJV A;  2WOM A;  2C3O A;  1F60 B;  3BSN A;  3JSY A;  2ZE2 B;  2WB1 D;  3DFE A;  2FLO A;  4FNI A;  4B3R F;  4KHR A;  1KVJ A;  2KKH A;  4LSL B;  4JI8 J;  4FS2 A;  3CCU S;  3AXK A;  3HJV A;  2HRY A;  2EFP A;  2FHK A;  2HS0 A;  4OHY A;  4F4X A;  3C14 B;  2UU9 J;  2W2P P;  3IM8 A;  1G6B A;  1YJ7 A;  2VBY A;  2JLE A;  4HH0 A;  4OYB A;  3HKW A;  1WOP A;  4RW6 A;  3PY8 A;  3HHE A;  3CE8 A;  1VRT A;  4FF1 A;  3PW0 A;  2QL9 B;  2B4O A;  4LIR A;  3OTO J;  1X31 C;  1VQ4 S;  3MEE B;  2H3E B;  1UVN A;  3LTO A;  4A8K A;  3G6X A;  1WI8 A;  3LP1 A;  4DR4 F;  2UUB F;  4O4G B;  3A8E A;  4O0I A;  2K3I A;  2Z58 B;  4DFM A;  2W01 A;  1HNX F;  4Q43 A;  4CO5 A;  3GSD A;  4DSL A;  1EHW A;  3M05 A;  3P49 B;  5B7W A;  2BJ3 A;  2ZIT A;  4FZV A;  3ILI A;  1BD6 A;  4F0K A;  2CQ1 A;  1U6Z A;  4ZLN A;  3DOM B;  2DNR A;  3VGT A;  4OX9 J;  2B6A B;  1HKA A;  2E1R A;  3CDA A;  3W63 A;  4I6Y A;  5D3G A;  1YDL A;  4G1P A;  3MM5 B;  4TY8 A;  4XIU A;  2FJE B;  5GAD U;  1YRX A;  4K0K F;  4K4Z A;  1MMN A;  1H73 A;  3EXC X;  1R0A A;  4F67 A;  1IBL J;  3M8S A;  5FLX U;  4PWU A;  3GON A;  1S59 A;  1JLQ B;  1H0H B;  4NLY A;  4JI2 F;  2VON A;  2GVD B;  2ZH3 A;  5KFC A;  1GMV A;  1S97 A;  2ZH8 A;  3D67 A;  4ZPW R;  2HS3 A;  3RB3 A;  2A10 A;  2CZ9 A;  4F04 B;  1B70 B;  3PO4 A;  5G0R A;  2YPZ A;  2NXC A;  2JHE A;  4DG1 B;  3TZX A;  1S0O A;  4UOG A;  2GIR A;  3KJV B;  3DRR A;  1S6P B;  4Q0B B;  4MYT A;  3BDE A;  1TL7 B;  1XBW A;  1S1X B;  2W9C B;  2ASL A;  4DL6 A;  2LQ5 A;  4JI0 J;  1CUL B;  3G87 A;  2DGQ A;  4ED3 A;  5KFU A;  4AXI A;  2QC3 A;  4UF4 A;  1IKV A;  1S0V A;  2FHJ D;  1TK0 A;  3E3X A;  1OSC A;  4LRB A;  3FVY A;  4ZVS B;  3OL7 A;  1XN9 A;  2B9W A;  1E6Y B;  4H4O B;  3M2U A;  3I6P A;  2UV8 A;  1GXT A;  3VQS A;  3VTI A;  2RSQ A;  3BM7 A;  3EZO A;  1YRU A;  2BQU A;  2PA3 A;  5CYJ A;  5G4D A;  4R8U B;  3N01 A;  1S49 A;  2IMO A;  1N6Q B;  3W2W A;  4C6A A;  5IM0 B;  2CPY A;  2JL9 A;  2KG0 A;  4JI8 F;  1XMQ J;  1HYS B;  1LFW A;  2PO4 A;  2FYX A;  1NLK L;  2UU9 F;  2HZA A;  4Y28 C;  1MN9 A;  4Q2M A;  4YP3 A;  4YB7 A;  3Q86 A;  1SKS A;  2ASJ A;  2UP1 A;  1SJ1 A;  3LWL A;  3P6Y C;  4M5K A;  4ZP9 A;  2R42 A;  3OTO F;  4AND A;  3WC0 A;  4OX7 A;  4DHV A;  2UV8 G;  4QR0 A;  1Y5N B;  1R0B G;  1RTJ B;  1RT6 A;  2EFN A;  1FES A;  1J27 A;  3MD1 A;  2VOP A;  3QLH A;  1N56 A;  3N28 A;  5DGB A;  2KT5 A;  4NEY A;  3PKM A;  2YKM A;  4B9U A;  2AEJ A;  3C6U B;  4CT9 A;  1RWP B;  3TZW A;  4L3N A;  2FZG B;  1RXO B;  1F9F A;  4CLT A;  3OW2 R;  3S1T A;  5T7L B;  2ZZN A;  2ZOG A;  1LWC B;  1UMJ A;  2GAH C;  3KJN B;  1DTT A;  1WKJ A;  4DZ6 A;  4KY3 A;  4WTO B;  1JXE A;  1SJF A;  1AXQ A;  1B0T A;  2B7C B;  4Y2C A;  2CJK A;  3CDB A;  2CQB A;  1WC1 A;  4J91 A;  1HQE B;  4JYA J;  1UTA A;  3IRX A;  1VHI A;  4TN2 A;  4OI0 A;  3CCL S;  1NUE A;  2Q6B A;  4WII A;  3ZTR A;  3NMA A;  1X5T A;  4LFB J;  2GVZ A;  4W92 B;  2L9W A;  1KLM B;  2AZ3 A;  1UKU A;  4AL5 A;  4ENO A;  2DHX A;  2Y1R I;  1TR0 A;  2H51 B;  2CAD A;  5K14 A;  2NQP A;  4HT7 A;  2VG7 B;  2RQM A;  4UZB A;  1VFJ A;  2K7K A;  1RTI A;  3TVY A;  1J2V A;  3M30 B;  2G9O A;  2N3O A;  3AD8 C;  3D7S B;  1HNI A;  5E3C A;  2IBO A;  4CCH A;  2YH0 A;  1ZYQ A;  2ZM6 J;  5C24 A;  3P3D A;  3W1Y C;  3KNG A;  3W3S A;  1RLD A;  4WU3 A;  3I0R B;  1WC6 A;  2OPR B;  3CIM A;  4Q44 A;  2LU2 A;  1XMQ F;  1B7Y B;  1NJZ A;  4URQ U;  4LFC F;  5LSL A;  3IS9 A;  2VUG A;  1L3S A;  4USH A;  4X62 J;  3DLG B;  5BXI A;  4NXM J;  1OO0 B;  4CDI A;  2YKN B;  3HHL D;  2HK2 A;  4RL1 A;  1F2H A;  4XDD A;  4C8K A;  3JQK A;  1S6U A;  1LKZ A;  3W5Z A;  3IMQ J;  3FFI A;  4M5G A;  2MZ1 A;  4ECV A;  1JLF A;  4F4Y A;  1CPZ A;  1WTB A;  1PIL A;  4N77 A;  4NCG B;  4NA1 A;  1XQI A;  1L3V A;  3PVX A;  1RT5 A;  4C0H A;  1YHQ S;  4QU7 A;  2KFN A;  4EI2 A;  3EVW A;  4NCA A;  4WFB Q;  1RI7 A;  1K8A T;  3ZNU A;  5HRO B;  3PW4 A;  3T1A A;  2CRL A;  4C7Q A;  3R1H A;  4ETX A;  1UVL A;  3CJ3 A;  1RP5 A;  1U6B A;  2IMW P;  4AYB D;  2C2Z B;  2KB2 A;  4ZPC A;  5KFR A;  4LF2 A;  3DGV A;  3O6Q A;  4PXD A;  3MM7 A;  1ELO A;  2OKQ A;  2VPW B;  3MR5 A;  1WSV A;  3OJU A;  2DNN A;  4JI1 F;  1YJ9 S;  5I3U A;  2JJ4 D;  4TQR A;  2E1P A;  5E7O B;  4B3S J;  4ED7 A;  2ZD1 B;  3CSK A;  2XCA A;  2Y8W A;  3B78 A;  3QMQ A;  2VB6 A;  2EXU A;  2MKH A;  2OPP B;  4JYA F;  4IOB A;  2M2B A;  5KG0 A;  4U8V A;  2VFT A;  4TVA B;  4LFB F;  1Z1Z A;  3FRZ A;  3P8B B;  4PQU A;  3JYT B;  4ZVU B;  1SBR A;  4U96 A;  4UUW A;  1EP4 A;  4DPX A;  1NJI T;  3K0J A;  5D15 A;  5JMN A;  1RGV A;  2M7S A;  1D9F A;  1BQN B;  4BDP A;  2NR0 A;  3G8S A;  2ZDO A;  1AUS L;  3V4I A;  5DM7 Q;  2EBE A;  5CYM A;  3K5N A;  5KFZ A;  5I3Q A;  3GZ7 A;  2GNK A;  4FXV A;  5HMW A;  1RAA B;  2ZM6 F;  4LF4 J;  3DXB A;  3U7J A;  1N5Y B;  4PAB A;  3SCK E;  3HDS A;  4FVM A;  3EZ5 A;  3IA0 A;  4UST A;  3CDE A;  3E8O A;  2DXD A;  3QNW B;  1NK8 A;  4DSF A;  1Y5L B;  1VC0 A;  1FD8 A;  1NU4 A;  3MDF A;  2MQ8 A;  4WWS A;  1BQM A;  2C2R A;  4NXM F;  5KG7 A;  2N4C A;  3MD3 A;  1OPZ A;  2BE2 A;  4RW7 B;  2MQN A;  1FK9 B;  2P2C B;  1PYO B;  4OJH A;  1VBY A;  5GAH I;  3ITH B;  2VDI A;  3ZTQ A;  2ZWP A;  1HBN A;  2DHS A;  2ALZ A;  2B9X A;  3FNN A;  5K8P A;  3MMA B;  2AGO A;  2QFI A;  2XZT B;  3MEE A;  2DNM A;  1DBD A;  1S1W B;  4KSE B;  2PEB A;  1RT2 B;  4CH0 S;  2IM2 A;  1X0P A;  2XMJ A;  2PI5 A;  4RNM A;  1FEH A;  2PEH A;  3W9J A;  4CIO A;  1D8Y A;  3KOA A;  5LMN J;  2V67 A;  4MIA A;  2DRB A;  3Q8R B;  1CS4 B;  1WAC A;  4TLQ A;  4D3H A;  1DTQ B;  5H1S V;  1WSR A;  5C42 B;  4L3K A;  1C1B A;  3GFZ A;  2R7T A;  4LF5 J;  2KJW A;  1UPP A;  2CNN B;  4JI7 J;  2Q66 A;  4DFJ A;  1HNW J;  3SMZ A;  4B3S F;  1F2G A;  3DLE A;  1FJC A;  4DQP A;  1VIO A;  4GC7 A;  1FER A;  2HHV A;  4L74 A;  1SH3 A;  4S0M A;  5DDR C;  2VA2 A;  2C3M A;  2YNI A;  3ET6 B;  3FBB A;  2MSS A;  1K73 T;  4JP8 A;  3DDI A;  2PA8 D;  4DG1 A;  4DUY J;  1TKD A;  3TQE A;  2E7W A;  3A8I A;  1UVM A;  3FBF A;  4OHW A;  3UVJ B;  3HZG A;  7AT1 B;  1TL7 A;  3BB5 A;  2W9C A;  3OV7 A;  2UVW A;  2BUN A;  1N54 B;  1CUL A;  3NS6 A;  2ZNY A;  3AB2 B;  4KT0 C;  4ZVP B;  3J7Y U;  2FIU A;  1T3N A;  3SDE A;  3FCV A;  4LF4 F;  3AJ2 A;  4Y00 A;  3TR5 A;  1Z2L A;  3UN2 A;  4I6A A;  1S4F A;  1TL4 A;  1FKP B;  5ADZ A;  3NS5 A;  3V6J A;  2GQC A;  4C8M A;  1TL1 B;  3DU5 A;  1N4L A;  2HLT A;  1N6Q A;  3WX8 A;  1N5S A;  4ILR A;  1JX4 A;  1X5P A;  4RWX A;  4B9T A;  2F40 A;  4DZD A;  2V2K A;  5HP1 B;  5CAA A;  2Z56 B;  2P9C A;  1Q8L A;  1EET B;  1A0O B;  1IM4 A;  3O3L A;  2EK6 A;  3H40 A;  3DGP A;  2E1M C;  3QT5 A;  3OQ2 A;  1VQL S;  4BS2 A;  2DXF A;  3N5F A;  1Y11 A;  4KKO B;  4FF3 A;  1YBA A;  4KH1 B;  2IBK A;  5J2M B;  2NZC A;  2ZHA A;  5E3A A;  4FYV B;  1FFG B;  2NLW A;  1RJJ A;  1RTJ A;  3HF5 A;  2RDJ A;  1FCA A;  3ZTP A;  1YJW S;  3KLE A;  5A76 A;  1HWI A;  3TUJ C;  5LMN F;  3GB0 A;  1NK6 A;  5AT1 B;  3PYE A;  3Q24 A;  1WC3 A;  3NG8 A;  5KT4 A;  1U8W A;  5SZT A;  4ES1 A;  3DLJ A;  1R8B A;  2QLJ B;  1XNR F;  3MCN A;  4Q8E A;  3M2R A;  3SFG A;  4LF5 F;  3EX7 B;  2WVE A;  1D1U A;  3VVU A;  3H5S A;  4N47 A;  4JI7 F;  2XGQ A;  2XLJ A;  4ZVH A;  2RS8 A;  3WQP A;  1HI0 P;  1SV5 B;  1NDL A;  4B3O B;  1LWC A;  3MEG B;  1CJU B;  3BV8 A;  2MKY A;  3ICL A;  1VCT A;  3S01 A;  3FDS A;  5F9N A;  1R8C A;  4ZMM A;  4L73 A;  5LL6 d;  4DL3 A;  4CLU A;  4P74 A;  3DDN A;  3PRD A;  5EWE A;  5H9E K;  3QGP A;  4ZVQ B;  4MK8 A;  5D0R A;  2RB7 A;  5AXM A;  2XG8 A;  1X4C A;  2WB4 A;  4LRF A;  1TU0 B;  4B9S A;  2PSZ A;  1PC4 A;  4NZ7 A;  1YI2 S;  1JMT A;  2B51 A;  1VRU A;  4I56 A;  4ECU A;  1QUV A;  1R89 A;  4RBU A;  1DJ0 A;  2RDD A;  3MED B;  4PG6 A;  3I82 A;  4X84 A;  2GX8 A;  3HFK A;  3MPY A;  2QV6 A;  4DQQ A;  3DM2 A;  3TQ1 A;  1QJH A;  4C8N A;  3IBC B;  3M30 A;  4O0N A;  3OTE A;  2KG1 A;  3R2D J;  4PQA A;  1VK3 A;  3X3U A;  4AE5 A;  2MZR A;  1FE0 A;  1JLE B;  4XPC A;  4HVZ A;  3QAT A;  5AE1 A;  2SXL A;  3B54 A;  2PI4 A;  1VQM S;  2CDR B;  1TAQ A;  3RGI A;  2OPR A;  4I4B A;  1H7W A;  2HHT A;  3BKU A;  3KUH A;  2A18 A;  2OP5 A;  1U4B A;  4K4S A;  3BO3 A;  3M8Q B;  1HPZ B;  1RTD B;  2ACY A;  2PN6 A;  2W7O A;  4OX8 A;  1EJ7 L;  5EWF A;  4LF6 J;  4DX6 A;  2QYC A;  2OML A;  1AYE A;  1IWA A;  4WU2 A;  4LUB A;  2RU9 A;  2R7U A;  5KT2 A;  1UJ5 A;  4LR7 A;  1CEZ A;  4MMO A;  3CMA S;  1GMU A;  3ZZZ A;  2RJZ A;  4NCG A;  2J9D E;  2LYV A;  4Z7Y A;  3H7H B;  3PZP A;  1TUG B;  1N5T A;  3GWC A;  2Q3P A;  3RZA A;  1REV A;  1WF1 A;  2RHS B;  3T1H J;  1ZM2 A;  2KTQ A;  2BR0 A;  2R8H A;  5HRO A;  1VQK S;  3IBF B;  5KFM A;  1Z4U A;  1DRZ A;  1N33 J;  4P52 A;  1FRJ A;  3BYP A;  4OI2 A;  6AT1 B;  4KIA A;  3R5B A;  3GIR A;  5L1L A;  2OEM A;  4W98 A;  2ATL A;  1SC3 B;  1PJ5 A;  1IWG A;  1SI9 A;  3BDP A;  1ZOT A;  3UDC A;  4DSJ A;  3RYL A;  3FC9 A;  3PX6 A;  5KT6 A;  3KYL A;  5D4N A;  4WK3 A;  3NAI A;  5HN0 A;  3MPW A;  1C4A A;  3CWJ A;  4F36 A;  5J1E A;  2J0W A;  5IT9 U;  3KLG A;  1T3O A;  1WHW A;  4USU A;  2M4M A;  4ED2 A;  3MEK A;  3JTP A;  1UZH A;  2A6M A;  3J7Z 5;  2JDJ A;  5BYQ A;  4B9L A;  1D8Z A;  2R4F A;  4ZS6 A;  3JYT A;  3CF5 Q;  2LDI A;  4ALZ A;  2LMI A;  4DI6 A;  1S72 S;  5BJR A;  4X2B A;  2DGU A;  3NL0 A;  5KG1 A;  3VAF A;  3CC4 S;  4CNY A;  2W2Q P;  4QJV A;  4J90 A;  1BQN A;  4KB7 A;  1FRX A;  4P71 A;  1W7W A;  2V8G A;  1ZPV A;  3RRG A;  4WP9 A;  1U1L A;  2L9N A;  3T6B A;  1KQS R;  2DHH A;  3UWT A;  5F41 A;  2WVD A;  1VS3 A;  3I9Z A;  3CJQ A;  4C0B A;  3AD9 C;  3QQC D;  1YVF A;  4DR5 J;  3NS7 B;  2XS5 A;  3B4D A;  4LRD A;  3RRH A;  2GJI A;  4DV2 F;  2VQE J;  2CVE A;  1RA6 A;  3FMW A;  2ROE A;  5C5J A;  3AH6 A;  4TQS A;  2YQ3 A;  1S4E A;  3IC1 A;  4CYU A;  4P72 A;  3BSC A;  4K50 A;  2ABY A;  3M9M B;  2FJX A;  2HQC A;  3PM9 A;  3ITH A;  1WEZ A;  2QO3 A;  3TUI C;  3QO9 B;  1MRO B;  1HW8 A;  2XMA A;  3A8J A;  2ZWO A;  2XS2 A;  1QDU B;  1RHK B;  2YKA A;  5KT3 A;  3BO4 A;  1TKZ B;  5C2C A;  2XYH B;  1RT2 A;  3MR6 A;  3K7R A;  4DPO A;  3RB6 A;  3QWP A;  1APS A;  4ECQ A;  1CJV B;  2ASD A;  2B4U A;  5FDL A;  2K1R B;  2OFH X;  1FEE A;  1DY3 A;  2UUW A;  1CS4 A;  4PG8 A;  1MG7 A;  3CC7 S;  4X66 J;  1ZS6 A;  4DDF A;  4RLE A;  3EZU A;  1R8H A;  4NLS A;  4BBY A;  2MZT A;  2F7V A;  1R6Y A;  4JV2 A;  5DQH A;  1JLC B;  2U2F A;  2QMW A;  2AT1 B;  1S1V B;  3HSD A;  3MMJ A;  1ZZF A;  4G1Q B;  2VIH A;  3R7B B;  5FLX Y;  2EWH A;  1AZS B;  2XLK A;  3T5K A;  3FSX A;  4FPI A;  2WSF C;  3I32 A;  3H4B A;  5KOX A;  2FVR A;  4FS1 A;  3M8P B;  4ANC A;  4RUH A;  1F9E B;  4EZ6 A;  4AL6 A;  2JX2 A;  3FQK A;  3I0S B;  3G6V A;  2OEJ A;  4NLG A;  3W65 A;  2AD9 A;  3C6T A;  3TNV A;  1CVJ A;  2MLZ A;  2OEL A;  5L1K A;  2FJV A;  2ZBC A;  4RU2 A;  3VVT A;  3P4U B;  1RUS A;  1RAO A;  3VF0 B;  3DMJ B;  4WP3 A;  3HP6 A;  5IC4 B;  5EGY A;  1X9S A;  1K1S A;  1NB2 A;  3KLF B;  1FJE B;  3FJ2 A;  2DVI A;  3G8Q A;  3EGN A;  4DV6 J;  4I7F A;  2ATC B;  5HVF A;  2IM1 A;  3FEX B;  2CZ4 A;  1FKP A;  4DR5 F;  1OJ4 A;  1EB0 A;  4EU0 A;  3VV2 B;  4ED6 A;  5A8W A;  2VQE F;  3M8R A;  3DLH A;  3CD5 A;  2ZKT A;  3DLB A;  4WYL A;  3UDL A;  5CZV A;  3IXQ A;  2BXJ A;  3IGV A;  1Q0N A;  4DSK A;  2DNP A;  2DPI A;  4LF8 J;  2HHW A;  1LXN A;  2MY7 A;  3NNA A;  2N7C A;  2G1D A;  3IR5 B;  5L1I A;  3PYG A;  2XSF A;  3Q89 A;  3PJ9 A;  2ALY B;  2JLF A;  2RIJ A;  3HD1 A;  3J7A N;  2VPY B;  2V4Q A;  4DR7 J;  4JBC A;  3AOA A;  2Q79 A;  4C48 A;  2C2M B;  5J2M A;  2V34 A;  1YJT A;  2KXH A;  1LW2 B;  4ETZ A;  3CME S;  1JKH B;  3PRV A;  2DIU A;  3NMR A;  4AT1 B;  1SC4 B;  2JNJ A;  4KGX B;  4I6W A;  3TZY A;  3BH7 B;  5HLF B;  2HFN A;  3QPI A;  4MH8 A;  1GFW B;  2KVI A;  2J6U A;  1L3U A;  1BGX T;  4X66 F;  2XYG B;  3UCU P;  5KFL A;  3CGI A;  3FK4 A;  4ZPB A;  4KQZ A;  2P6T A;  4XDC A;  1A9N B;  3DHX A;  3H2L A;  3QIP B;  5DET A;  4WXO A;  3CTR A;  5ITH A;  2ZOM A;  1N0V C;  4FBT A;  3SQG B;  4OZ2 A;  2YWE A;  4I2P A;  2QJ3 A;  3PIP Q;  1RT7 A;  3T9Z A;  1SKU B;  1KSP A;  3PX0 A;  3CDW A;  3NGT A;  2J8A A;  3OHA A;  3A4T A;  3QFH A;  3J80 U;  2HND A;  2A3J A;  4PKD B;  3G82 B;  2XUL A;  1ZAX A;  4I2Q A;  2DR6 A;  2QFJ A;  2CIM A;  3HUL A;  3NCR A;  4CTA B;  3DYA B;  3LUY A;  2KYX A;  4JV1 A;  2LQ9 A;  2HQ3 A;  2HVZ A;  1IJF B;  1JIH A;  2AU0 A;  4OJG A;  5EWG A;  5KTQ A;  3UNY A;  3OFH A;  3S6E A;  2E5H A;  5L38 A;  1JJH A;  3GG0 A;  4OMF G;  4QWB A;  3EVO A;  4OYZ A;  1HBU B;  5LJ3 Y;  2XSJ B;  4NYO A;  4WFA Q;  2BV3 A;  2H48 B;  1CLF A;  4OZ1 A;  2BOA A;  4N8O A;  3ZZT A;  2OGU A;  1HMV B;  2XMU A;  4ZA1 A;  2XTJ P;  2XCP A;  5I42 B;  1MWQ A;  4ED8 A;  5KFD A;  4ZN3 A;  2UXB J;  4GC6 A;  4IYQ A;  2NSB A;  4BCA A;  1K47 A;  1H7X A;  1NK5 A;  1ICE B;  4OQJ A;  2FLN A;  1RBA A;  1XTZ A;  3H90 A;  1KVK A;  4U9R A;  2BOP A;  1S99 A;  2DRA A;  3EM1 A;  2DR7 A;  1EAY C;  3BRE A;  4LF8 F;  3OL9 A;  4OZ5 A;  3MUM P;  2D69 A;  5HBM A;  2OSQ A;  3M32 B;  1R3N A;  3PEH A;  1T94 A;  1QSY A;  5GAG U;  5MAO A;  1GX6 A;  2E66 A;  1NK7 A;  1W2B R;  3VAJ A;  5J2N A;  5HVH A;  3HXM A;  2W2N P;  1RIS A;  2LDY A;  1Q8K A;  1HNZ J;  3KG4 A;  2W8L A;  2YX4 A;  1BE4 A;  5GAH U;  2D1C A;  4YR3 A;  2E5L J;  2CPX A;  1FX2 A;  1RAB B;  2R7R A;  2WAQ D;  3LP2 A;  4QQB A;  5LM7 E;  5IWA F;  2R2T A;  4O3R A;  3K89 A;  2DNH A;  3TAM B;  3VAG A;  2W9A A;  2E9R X;  2V68 A;  3BGO P;  2PMH A;  5KG4 A;  2V5H G;  4P2S A;  2HW3 A;  3E01 A;  1TP7 A;  2CDQ A;  2YNG B;  2BAN B;  4F3M A;  2WBR A;  1F0X A;  4EK2 A;  3IAM 9;  4QWE A;  2DR5 A;  2Y1I A;  1LK7 A;  4LF7 J;  1HBM B;  2CJB A;  1KR4 A;  4LR8 A;  4KR0 B;  4LVN P;  3PXG a;  1GNK A;  2LQ8 A;  4HHH A;  4NEZ A;  3W61 A;  2Z57 B;  1T95 A;  2AX0 A;  3RB4 A;  3I5A A;  3EPI A;  2ZC3 A;  1ZBT A;  3RJM B;  1UAW A;  1RTH A;  2YKO A;  4FF4 A;  1EQ0 A;  2IAJ A;  1ZM4 A;  2OIH A;  3QGH A;  2NPF A;  4RUA A;  1QM9 A;  4ZHR B;  3NGR A;  5DLF A;  4KAI A;  1VQ9 S;  2MHN A;  2VQF F;  3R3T A;  1T9W A;  2MZJ A;  3R5C A;  2HLU A;  4DOZ A;  4RZR A;  2A2C A;  2CQC A;  2NUH A;  3O1L A;  2QT7 A;  5KFH A;  3EDQ B;  2F8M A;  1S7I A;  2XI2 A;  1HI8 A;  3V81 A;  2DB1 A;  3ISN C;  1IXK A;  2VKZ G;  3MPD A;  5AE3 A;  1MML A;  2NYI A;  4P7T A;  1N88 A;  2WOM B;  2O01 C;  3IWL A;  2LXU A;  3TVK A;  2UXB F;  2LXF A;  4K59 A;  4ZVE A;  1HFE L;  4MKV A;  3D0G E;  4CO3 A;  2Q6C A;  3MR7 A;  3MMC A;  5KFE A;  1FWP A;  2PC6 A;  3S8S A;  4DPU A;  2WHO A;  3NGK A;  8RUC A;  3BGU A;  3QID A;  4ZPD A;  4C4W A;  5F0U A;  3O8W A;  2R3V A;  5D77 A;  5L9N A;  3ENQ A;  3KNA A;  3EGW B;  1UWA A;  5E5N A;  4B08 A;  2VOD A;  3KJF B;  4RW6 B;  4AUK A;  4P6Q A;  5EHH A;  4NWB A;  1OY8 A;  1VRT B;  4KGK A;  3D2W A;  1VGY A;  2V6A A;  2J5A A;  3TJA A;  2V69 A;  4KFB A;  1HNZ F;  1NK4 A;  2DGS A;  4IFY B;  4USI A;  2W7A A;  5IOL A;  2E5L F;  3L09 A;  1PGZ A;  3LP1 B;  2DKO B;  4ECS A;  4DSI A;  4QIW D;  3PFO A;  1WI6 A;  1KHW A;  5H9F J;  4DV4 J;  3PW7 A;  1VC6 A;  1LNQ A;  3LAL A;  5D0H A;  5FII A;  2HSE B;  4DV3 J;  4DQI A;  1TKZ A;  1M5O C;  2FGO A;  4J9U E;  2QA4 G;  1X4E A;  3IR6 B;  3HFV A;  2AJF E;  2G0J A;  1CJT A;  4DCJ B;  5T14 A;  5DLG A;  2VIC A;  2EFV A;  2XMV A;  1X8D A;  5D3G B;  3TA0 A;  2FD2 A;  1NSQ A;  4EYI B;  2D3U A;  4TY8 B;  3NXZ A;  4B3M J;  4CLY A;  4XO0 A;  5ETV A;  3KWM A;  2H5I B;  1R0A B;  4IH5 A;  3KHR A;  1U09 A;  2XMT A;  3GV8 B;  1S1V A;  2V50 A;  4O3N A;  2FPH X;  3QT8 A;  1F5A A;  2ZNZ A;  3KKF A;  2J9C A;  3UPF A;  2W2O P;  3MAA A;  3TO8 A;  2XQC A;  1QTN B;  2DIV A;  3SCI E;  1FFW B;  1RHU B;  3HZE A;  4ATN A;  2CYY A;  5G0R B;  2DCU B;  3M8P A;  3H5Y A;  1NH8 A;  5KFF A;  4ZVT B;  3DRR B;  5KFP A;  4PWD A;  4X4T A;  4C8O A;  4JI6 J;  1G2E A;  4M5I A;  2E1C A;  4M5D B;  3BH6 B;  1UVK A;  1RHJ B;  4ZP8 A;  1HWJ A;  2JEF A;  1IKV B;  2HGL A;  2AJ0 A;  2NS1 B;  3UW1 A;  4B17 A;  2DD8 S;  2RHQ B;  2Z4P A;  3QJJ A;  5A0Y A;  5DG8 A;  4AD6 A;  4CO2 A;  2ZFH A;  3NKY A;  3M2U B;  3TX0 A;  1RWK B;  3DMJ A;  5KFK A;  3FBE A;  5HAO A;  1GX5 A;  1RWM B;  1SH0 A;  1FWL A;  3ENV A;  4WPA A;  2EK1 A;  2AP6 A;  1S7H A;  1WDD A;  1VQY A;  3W2W B;  5CQG A;  2XWX A;  1VLY A;  4ITS A;  2QMX A;  4EO6 A;  4RUC A;  1T02 A;  2LU1 A;  3GJS B;  4QBU A;  3ZTO A;  3OLA A;  5KFJ A;  2APO A;  4ZKA A;  1URN A;  3THP A;  1TZ0 A;  3DOL A;  3V6D A;  3MOJ B;  4L72 B;  4DV7 J;  4LSN A;  4IR9 A;  3MMB B;  3OFG A;  2MQL A;  3W62 A;  3KHL A;  1WD6 A;  2UXC J;  4DBQ A;  3CO9 A;  2HUR A;  1K0T A;  4J7C A;  1OQ6 A;  3LQV A;  1NZA A;  3TA2 A;  1SJ4 P;  1B7F A;  1MSW D;  1NK0 A;  1F1B B;  3KTQ A;  1WC4 A;  4UTG A;  2CJQ A;  3PJX A;  4PPZ A;  2E5I A;  1NHK L;  4ZVR B;  3NLC A;  3KG1 A;  4U7C A;  2B5J A;  1RT6 B;  3RBZ A;  5ETL A;  3K2Y A;  3AAW B;  3W66 A;  4DV4 F;  3HKZ D;  1H72 C;  4PYA A;  4DV3 F;  5ETM A;  3QLH B;  3DI6 B;  2J0Q D;  2VFR A;  4FKY A;  1HI1 A;  2JVO A;  1KTQ A;  2IHR 1;  2IRY A;  3KDO A;  1XK8 A;  3QGI A;  2YKM B;  2MJU A;  4QZV B;  4R5P A;  2GO9 A;  1A6L A;  2R8G A;  2ERR A;  4WXW A;  2D9O A;  4DL7 A;  4ZLJ A;  2B8Q A;  2LEC A;  4Y2M A; 
#chains in the Genus database with same CATH homology
 5IC4 B;  1QTN B;  4ZVQ B;  1RWO B;  3NS7 B;  1GFW B;  3GJS B;  2C2Z B;  2CNO B;  2QL9 B;  2H4Y B;  3KJN B;  1RHU B;  3EDR B;  4JB8 B;  2XYG B;  3P45 B;  1RWW B;  2C2O B;  1RHR B;  2H48 B;  2CNK B;  2QL7 B;  4ZVP B;  4ZVT B;  2QL5 B;  2HBR B;  3D6M B;  5K20 B;  3R7B B;  1SC1 B;  2DKO B;  2QLF B;  3R6L B;  3R7S B;  3EDQ B;  1RHM B;  2HBY B;  2Y0B B;  3QNW B;  4ZVO B;  3D6H B;  2Y1L B;  2QLB B;  2FQQ B;  2H54 B;  3D6F B;  2HBQ B;  4ZVR B;  1RHJ B;  2H4W B;  3SIP B;  2CNN B;  2C2K B;  2QLJ B;  1F9E B;  4DCJ B;  3IBC B;  4LSZ B;  1ICE B;  4ZVS B;  1RE1 B;  2H51 B;  1QDU B;  1RHK B;  2P2C B;  3KJQ B;  1RHQ B;  1PYO B;  1RWN B;  1I3O B;  2XZD B;  2H5J B;  3IBF B;  2CNL B;  4ZVU B;  1RWK B;  2CJX B;  1IBC B;  3GJT B;  2HBZ B;  2XYH B;  3R5J B;  1NME B;  5IC6 B;  1RWM B;  1BMQ B;  3GJQ B;  2CJY B;  2C1E B;  2CDR B;  2C2M B;  3RJM B;  1RWP B;  1PAU B;  2H65 B;  1RWV B;  4DCO B;  3R7N B;  2H5I B;  4DCP B;  1SC3 B;  1I51 B;  2XYP B;  3P4U B;  2XZT B;  1SC4 B;  1RWX B;  3R6G B;  3GJR B;  3KJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...