1RWKB

Crystal structure of human caspase-1 in complex with 3-(2-mercapto-acetylamino)-4-oxo-pentanoic acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwkB00
1RHUB 2H65B 2Y0BB 3R7BB 1RHRB 1RWXB 2HBZB 2CNOB 1NMEB 1BMQB 3GJTB 1RWPB 3D6MB 2QL9B 2HBRB 3EDQB 2CJYB 2QLJB 2H51B 1RHJB 1RWNB 2C2OB 2CNNB 2XYHB 5K20B 3SIPB 1IBCB 1QDUB 4ZVRB 3R6GB 5IC6B 4ZVQB 2XYGB 3GJRB 3P4UB 4ZVOB 2XYPB 2XZTB 2C1EB 3R7NB 2P2CB 2CNLB 3R6LB 4ZVSB 4JB8B 1RHMB 2H48B 1RHKB 1RWMB 2C2ZB 2H5JB 2C2MB 2CJXB 1I3OB 3KJFB 1I51B 2QLBB 2H5IB 2FQQB 2HBYB 4LSZB 5IC4B 1RHQB 2HBQB 3D6FB 3QNWB 4ZVUB 1RWKB 3R7SB 1RE1B 3RJMB 3NS7B 1RWOB 4ZVPB 2XZDB 2H54B 3KJNB 3IBFB 1GFWB 3KJQB 3P45B 1ICEB 3IBCB 4DCJB 1SC4B 4DCOB 3GJQB 3EDRB 2CDRB 1RWVB 2DKOB 2H4WB 2Y1LB 2QL5B 4DCPB 2QLFB 1SC1B 2QL7B 1PAUB 1F9EB 1SC3B 1RWWB 2CNKB 1QTNB 1PYOB 2C2KB 3GJSB 3D6HB 3R5JB 2H4YB 4ZVTB
chains in the Genus database with same CATH superfamily
4ZHRA 3DLEB 1OPZA 2CQ2A 1UAWA 3PG9A 4LR8A 1S0NA 3DGVA 3M05A 3OL7A 3HSDA 2BABA 2BJDA 2LMIA 1WKKA 3UCGA 1NKEA 1FFGB 2MQQA 2HHXA 3VAFA 1FKPB 3QZ7A 2VG6A 3FJ2A 4TYAA 2J6TA 3AH6A 1RYSA 3MMJA 1W7WA 2NPIA 1RKIA 3EE3A 4DLGA 3VAHA 2H5JB 3CCZA 2RIJA 2MLZA 3CJ3A 3J7YI 2RS2A 1VQ4S 3OJUA 4GC6A 4QIWD 2BJ3A 3H42A 2R8GA 4LF6J 2R3VA 2NZ4A 2W2OP 3KJQB 5A2QU 2CRLA 2V4JA 3A1YG 4FKYA 4J9UE 3OFFA 2ZM6J 2EK6A 2EC0A 1Y9OA 1HHSA 4ZPAA 3O3LA 4HACB 1XR6A 3G96A 2DRDA 3MUMP 1UVNA 3SSRA 5KFJA 1PYOB 1CULB 5ETVA 3ZZYA 4WJBA 2WBMA 4WU2A 4RNFA 4DF8A 4P7VA 2QGFB 4ZVTB 2RAQA 1R6YA 4P75A 3PX6A 2BACA 3SSSA 4DV2J 1N36F 2DXEA 2M88A 3C15B 3N5BA 4OJGA 4PXBA 3L7OA 4OX9F 1VCTA 2ROPA 4UOGA 2FY1A 2LEPA 4KKOB 1S9GB 1S1TA 3K0JA 1H2TZ 2VFUA 1IR2A 3T1YJ 3M6WA 2LECA 4AT1B 1RHMB 4PXCA 4DV3J 4ZS6A 2FQQB 3NNCA 3QO9A 4NYPA 3MPWA 2ZDPA 1R3NA 3FUYA 3Q2TC 2CWXA 2DRBA 2XM3A 3IR7B 4YOEA 1CJTA 4RLEA 4DWIA 2Z2MA 2AQ4A 1JWWA 1R43A 3UPFA 2MEWA 4K4UA 1U09A 3GV5B 2UXCF 3GILA 5ETPA 5I3PA 5KFZA 5HVHA 2YNGB 2A6MA 1PILA 2YY3A 3EPIA 3BGLA 1CVJA 5KFEA 1YI2S 2DNHA 4LF4J 4QIVA 3NG8A 4ER8A 3MM5B 1YRUA 5DO2A 2OO4A 4LSNB 1OSDA 3KXDA 1JK9B 4RW4A 1VISA 1NJIT 5GAGI 4A47A 1BC6A 5DDQC 2CPZA 1IN0A 1HL6A 3OUYB 2XMJA 4QIGA 1FRJA 2CVEA 1QSSA 1V6HA 5KFAA 2Z30B 3OVAA 3H40A 3ZTPA 5KFHA 3EX7B 3UW1A 2P9EA 4F4XA 3I0RA 3HULA 3W60A 2M52A 4KHRA 5JVHQ 1U1NA 1TKZB 1T0TV 4YQWA 4CZCA 4N7TA 2M70A 1IKVA 1QJHA 2ZBRA 2CPFA 1S48A 4KGXB 4ZVHA 5FDLB 3DLGA 3CCMS 2HEKA 1VR6A 2RUGA 2MKSA 3D2WA 1SUQA 3IO1A 1E6YA 3RBDA 1MN9A 2XHCA 4NLDA 3VQSA 1HBUA 2YQ3A 4AQYF 3BEGB 3TARA 4KT0C 4EYHB 1BMQB 3ISND 1FK9A 3OXFA 4X66J 1TZ0A 3W5ZA 4ZPBA 3V5RA 4BLGA 3TJ9A 4X64J 1TL4A 2KM8C 2HS0A 5F8LA 3M32B 1N33F 2AP6A 1LWCB 2J7WA 2VA3A 1N34J 2OGUA 2ADBA 3R7NB 4V19J 4A48A 1X4AA 3M8YA 4WZMA 2HZAA 2WW4A 4KGKA 4LF7J 2VG5B 1RWMB 2D3UA 3POTA 4CO2A 1JLEB 1QAIA 4WK3A 1ROFA 1AXQA 3EWGA 5EWGA 2W2MP 3RAMA 5FD1A 2AJFE 3PZPA 5IQ6A 3Q89A 4NCGA 4DSFA 5THWA 2HNDB 1RWUA 2MDAA 4RW4B 4LMZA 5HQMA 2ZEJA 3BPDA 4B3MJ 4GKJJ 3C66A 3PVXA 3QRPA 4LF5F 2IVFB 1UL3A 2DGQA 4URSA 4P9SA 4IOCQ 1N8RT 3ET6A 4DV4F 3FVYA 1FRHA 3SEOA 2SXLA 5K14A 3SDEB 2IM0A 3TVZA 3KLGA 1FFSB 2OELA 2FHJA 3RRKA 3AJ1A 3DGPB 1JLBA 2QA4G 5DG7A 1WJ9A 2B51A 1FNXH 5AT1B 1M5HA 2HVIA 4F36A 2GJFA 1NK7A 1K73T 4C6AA 1PJ7A 1WHXA 3RGIA 5E3CA 4ECUA 1X5PA 1EX8A 1HHQA 2QTWA 3GIIA 2KYZA 3SI8A 3BGOP 4OMFG 2LA6A 1TUWA 1TL5A 1NK6A 5KFYA 2DR7A 1E6YB 2QZ8A 2OPPA 1U0SA 5L39A 1EB0A 2XMUA 3Q8YA 2DO0A 1ICEB 4ELVA 1TK5A 1F9FA 3SCLE 3W5XA 5L8RC 3IR6B 1WTBA 3EVMA 4C3MA 4PR6A 5FJ4A 2GIRA 2Z2YB 2ADCA 4F2RA 3I6PA 1Q5YA 2AU0A 1T95A 4QU7A 4RO0A 1RZMA 1N6QA 4CO0A 4YS2A 1SC3B 3AQPA 5KFNA 4PRFA 4IH6A 2PI4A 2GVDA 3CO0P 4OHYA 2RRAA 3H2VE 1LWFB 2XYHB 5M2RA 2QLXA 1IBCB 2NXNA 4RUHA 5U47A 1VFJA 4UOHA 2J6SA 1ZAWA 5EX3A 4UTGA 1TV6A 1U1LA 1TK8A 3F41A 2HWHA 2QSFA 4OZ3A 2ZH2A 3VGUA 4M63A 3TVKA 2XY5A 1MSWD 1WKLA 2HIQA 4A4JA 2B9WA 2V2VA 2MZSA 1R31A 4YUDA 3C16A 3QFHA 3LAMA 3CJSA 3MM7A 2OMOA 1JLAA 4I2QA 5K14B 1VIOA 5E5NA 2N3OA 4TYBA 1AUSL 2EW9A 3MMAB 5KFXA 1UWBA 4RUAA 1YJ9S 5CYQB 1V3ZA 2ZBQA 4IH7A 4ATNA 4GVBB 4M5GA 5GADI 1SBRA 1U6ZA 2HRUA 4JI3J 3OVSA 1ULRA 1RWNB 2CPHA 4I6AA 5CYJA 3O1LA 3DRXA 2OEJA 2OPQB 4W92B 4ED3A 2VQEF 4WFNQ 3BH7B 1B0VA 2IVMA 3D9BA 3EVOA 1UEKA 2JDJA 5KFCA 4PG4A 2FY8A 4DR1J 4FZVA 4B9VA 4S0MA 1S5ZA 5KFGA 4EBEA 3MEGB 1DRZA 2RQCA 3THTA 2BW2A 2IMOA 1CG2A 2B6AA 1D8YA 2J8SA 1KC8T 3LGHA 3NGSA 2CJAA 4WKYA 4K4YA 1S1XB 2HW3A 3W9IA 1RWVB 3ZZTA 2ZITA 3JAMY 2VBZA 4TVAB 4NLOA 4IRKA 1X4DA 2E1MC 1X8DA 1F9EB 4CYUA 4OYOA 4LVNP 2BV3A 2MJUA 4YHHJ 2AF6A 2Y9HA 2PMZD 1Y3JA 2R7RA 1TV6B 1D8ZA 1XIQA 1DFDA 2JEJA 3UDCA 3ITHB 2W9BA 2KJWA 5B0DA 1VBZA 4CLFA 2O1PA 3G2XA 1DJ0A 5DRKA 4DPTA 2ZH9A 4B9NA 1RA6A 5IC6B 5JVGQ 5DLGA 2V5HG 3CDUA 1WC4A 4C9DA 5D3GB 3QIPB 2QLWA 4CT8A 2VD3A 2XNQA 1PJ6A 1Q78A 4OFZA 1BUXA 2YTCA 1LFWA 4ICLA 2KT2A 1BQXA 3CMAS 3QGIA 2VONA 1FRXA 4OI3A 3D0IE 3R5AA 3AD9C 1C0UB 2IA6A 2ZH6A 3M6VA 4I4BA 2XI2A 1DURA 4R5PA 3P45B 1M1KT 1M5SA 2NR0A 3LO3A 1PCAA 2Y8WA 2F4VF 1YBTA 1N32F 2R2TA 2FHMA 1REVA 4KE5A 5DDOC 1HBOA 4NZ6A 4O0NA 3M1VB 1W2BR 4Y0FA 3VAKA 3BGRB 3H5SA 3D0HE 4Q43A 3OR2B 3NOCA 2OD6A 5C25A 2VBWA 4RW8B 1OS5A 3UDEA 3PW7A 1MW7A 4X65J 4C8MA 4AUKA 1S1UB 3LP1B 1AROP 4HVZA 2N7CA 1NKCA 3TA2A 4OYXA 2OFHX 2RKIB 4ZVFA 1QY7A 2ZD1A 3BH6B 2N3LA 2H48B 4YR0A 3VGVA 5J2NA 1R8BA 2MZ1A 4XDDA 2JSXA 1UWAA 1RT2A 3KK3A 3D6FB 1KWMA 3KJVA 1WI6A 4J91A 2JLFA 2G4BA 3AHPA 2M8DB 5LMUJ 4YFUA 2Y1RI 4RBVA 2P6SA 3TA0A 3EDRB 1FXDA 1KR4A 1U2CA 3I5AA 1XERA 1XMOJ 4B17A 2RMLA 4I0WA 1SH2A 4JI0F 4Y2MA 2PT0A 1T05A 3G6ES 1VQOS 1VGYA 3ZXWA 4QW9A 3TANA 4Q8EA 3QRQA 3GFYA 1RT3B 1DZ5A 3CCQS 3JTNA 2Z2LA 1NK8A 1JLQB 2J9DA 3AAWB 1FD2A 2F8EX 1K9MT 3IGNA 4CDIA 4WFYA 3J81U 2C2ZB 2X7IA 2ZM6F 1HFEL 3CCLS 3HT3A 1LXJA 2B9YA 3L3CA 3Q8QB 2QFIA 3IG1A 4B3RF 2WSFC 2ZZMA 3UE2A 2C2NA 1F2GA 1P9YA 4NRUA 2ZFHA 4ED6A 3IA0A 2KRRA 1PYSB 3ILJA 3PFEA 4Z7CA 4DV2F 2QMWA 1UMJA 4DUTA 5K8MA 2VG7B 1LW0A 2G2YA 1MWYA 4WFZA 3C8YA 2BKOA 3BN7A 2L41A 1KVJA 3Q22A 8AT1B 2ZKTA 1RYRA 3VZHA 1DTTA 5I4MA 3PIOQ 3T1YF 1N5VA 4X62F 4B9MA 1FDDA 3AD7C 3RBXA 4DV3F 3AFGA 4ITSA 1X5TA 4YDXA 1HNXJ 1QAXA 2J9DE 3BBCA 1AZSA 4ZVRB 4MK7A 2KXHA 2ZHBA 4IO1A 4G1QB 1HWUA 3JSYA 4P6QA 1H7WA 2V2QA 2VFSA 5B0CA 4XDCA 4JV0A 4CQ1A 2HHSA 2K06A 2EFQA 4FYYB 2VQFF 2HBQB 3ENWA 1REGX 4JYAJ 2JVOA 3T9NA 2CKWA 2V67A 2CJKA 4K0KJ 5F9NA 2JLEA 4USUA 1NSAA 2KT3A 3NGKA 3W7BA 1GXLA 1I94J 2CVIA 3GPAA 3QT7A 3UI3A 4Y28C 1H72C 2HFNA 3FEXB 3A3NB 1YVFA 1H74A 2KFYA 4FS2A 1HW8A 3Q24A 1ACMB 1VQNS 4N5SA 3GYGA 1GXUA 3N0VA 2JJ4D 1X9MA 1URNA 2V4RA 4UQTA 1JJHA 1C1CA 1RHRB 2UXBJ 1AFIA 1U1KA 2FHJD 4YB5A 4X4TA 3BO2A 3ADAC 1TL3A 1NPPA 1JJ4A 3IAS9 2PI5A 2G1HA 3LWMA 5KOXA 5KT3A 3T5HA 3RRHA 3TAMA 1HMVB 1LW0B 4A8KA 2NREA 2C2EA 2I2YA 4MKAA 2FVCA 3HK2A 1YLXA 1EETA 3CCWA 3DNCA 3NS7B 3M2RA 4PABA 3K5PA 1RKJA 4ES1A 1WKJA 2FJWA 2DNGA 4HT5A 2QL5B 1GX6A 4FXVA 4XK8C 4OLOA 1R0AA 3U7JA 4DV1J 3MDFA 2HFOA 2F4FA 2VZ9A 2JH3A 2EG1A 2ILZA 4DFPA 1IWGA 3MCSA 1IQZA 1X4CA 2HGLA 4WTOB 2B5JA 2MQNA 4Y2AA 3EMTA 4DV0F 2UVWA 4FNIA 2EG2A 4QZVB 2NPFA 2XS5A 3UN2A 5A8RB 1N48A 2W4DA 3FZ2A 1JLFA 1NK4A 3OLBA 2ZH5A 4NZ7A 1UVKA 3BSNA 3VAIA 3VALA 4EZ6A 4U9RA 3ZTOA 1OPIA 2C42A 3KNGA 2WW8A 1B64A 3FDSA 1VLOA 1NO8A 2HRTA 3MECB 1ZH5A 4GKJF 3M30A 4XTTA 4U7CA 4BCAA 4ZVPB 4HYKA 1S6QB 3PYEA 4IOAQ 2ZNYA 4OYIA 2P8IA 4J9MA 2CXEA 3M2UA 2MZRA 3MF5A 2ZVIA 1S4FA 3PW2A 1O6XA 4WU3A 3HMJG 1RTIB 4BC7A 5HBMB 3U1LA 2M2BA 3OTOF 1HBMB 2HNZB 3DXBA 2J7KA 2R8JA 5KT5A 3RAXA 4OYWA 1BQNA 3RRGA 1QE1B 3ZZ0A 4FBTA 4ECYA 4UY85 1SL0A 2ASLA 4NA1A 2QL9B 2WONB 3VVUA 1RT4A 2AEJA 2ZOMA 5DQIA 3QGPA 4FVMA 2D9OA 2IYIA 1QLNA 4NMLA 3D0GE 3LGMA 4IFVB 2ZHAA 1IKYA 4NX9A 2IYGA 6FD1A 4F02A 3OL9A 4B3OA 1HNVA 3NBPA 4ZIWA 5D4PA 5HQLA 2EC2A 3W8PA 3THPA 4JI1F 2O66A 5LL6d 3KLEB 4DPYA 2XSJB 3ELHA 4OV1A 4X84A 5FLXU 4UQGA 3CDWA 1SKUB 5H9EK 4DCPB 4B9TA 4I2PA 3T1HJ 1Q7LB 2E7XA 4JV5F 4WXWA 3KLFA 4LF8J 2C2KB 1E6VB 2JFDA 3D6HB 2R7VA 2BQ3A 2LQ9A 5ETLA 1WEXA 4DUYJ 4XAKA 3E01A 5GAHI 1WDDA 3ZC4A 5KT2A 2WRMA 1YK9A 2DGOA 4USHA 1F5AA 3VVTA 3GR1A 3TUPA 2ZWPA 2VBXA 4G3IA 2NS1B 2VF3A 3W2WB 3MOZA 2RDJA 3I87A 4Z2XA 3RBZA 2RVJA 2PD1A 1X0PA 3N6NA 3DOLB 2RRBA 1SJ1A 4LJMA 1XNRJ 2XGPA 4ZP6A 2XWXA 4B08A 2PO4A 3I9ZA 4RUCA 4I69A 4O3QA 2GVZA 2MKHA 2FJAB 2UUAJ 3O6QA 5E3RA 2XQCA 4IFYA 4RW7A 2YWGA 3K58A 2XLIA 2HGNA 2KJVA 4ZDNA 1WNEA 2ZNZA 1DQ8A 4PAAA 1UA0A 3GU0A 3SYZA 3AXMA 1WF1A 1IBKF 2BJ7A 1RTHB 4C0BA 3AY0A 4USWA 2XMAA 4EBCA 5A6WA 4PQAA 1G7CB 1H2VZ 4NLSA 1T3OA 3VF0B 2GO8A 4KHPF 5HLFA 3F73A 4C0OC 4TU9A 1O0PA 1B0PA 4WP9A 3HSGA 5K8PA 2OLWA 3D28A 4PG7A 1TFYA 1UJ6A 3CC2S 3UR3C 3J7ZT 2OIHA 3JQKA 3RZAA 1NHVA 2AWZA 3MPYA 2PFFB 2V0NA 5IT0A 4YHHF 3G82A 3F0NA 3GV8B 3BDEA 4DUZJ 4HDGA 3TAQA 4BHQA 3U1NA 1X31C 2VFTA 2GW8A 4ELTA 2AX1A 2W8KA 4W4MA 3I96A 1LK7A 4PG5A 5ITHA 2XZWA 2KI2A 3C14A 1XQIA 5EWEA 1MMLA 2MKCA 4GO7X 1TMJA 2C2DA 2G0IA 3M2VA 2M4MA 4DPWA 1RAJA 4ZLPA 3CJKB 4USTA 2CQ4A 1RT6B 2HG4A 5L1KA 5L1IA 4ED0A 1Q79A 4Y2IA 2UUBJ 5AE2A 1S1WB 4PYAA 4Q7AA 3HD1A 2N82B 2UV8A 3BKFA 3W63A 1JXEA 4KPCA 2LLZA 3MM8B 2MQMA 2GQCA 1UTAA 1S9EB 3RTVA 2WB4A 2GHWA 1HNIB 2DHHA 1CJUB 3MZIA 3DRPB 2AV5A 3FGVA 2F65A 2DGVA 1KTQA 2BYCA 4OX8A 2R8IA 3E3XA 1SJFA 1Y5IB 3FCHA 4Y3CA 4B9UA 4W90B 4C8ZA 3US5A 2BR0A 3S01A 5A76A 4IDKA 2O3DA 4CH1A 1RHUB 1FRMA 3R7BB 2QT7A 2DPJA 1B70B 4LIWA 2CADA 1VIXA 5E0OA 2HHHJ 2J0WA 1VQMS 1TFWA 1S97A 1U6FA 2QLJB 4RX6A 3HVTA 4RU9A 2C2OB 2DGUA 3GJRB 4U7UD 3NXZA 3VGTA 4ZKAA 2UVUA 2X3DA 2FC8A 1GQEA 3N9UC 3BGFA 3ZZRA 1KQGB 4TKTA 2DCLA 3RAQA 1XMOF 1WC1A 3GB0A 4LIRA 4FYWB 4CRJA 2DEJA 5D6GA 3MR3A 4RBUA 4NI2A 2DISA 1Q8KA 2J9EA 5A6PA 2IC3B 2CA9A 2I5JB 4R0JA 3R5DA 4Z7YA 4DV6F 1UJ4A 3TVYA 4B9LA 1TVRB 3H2UB 5IXUA 3I9V9 3EGWB 4WIIA 2UU9J 5HROB 4I7FB 4DSKA 4K4WA 2Q79A 5L1LA 2XLJA 4F4KA 4IUFA 5GAEU 1DHMA 1LKZA 3AJ2A 3FEYB 2HLTA 3MEDA 1UZDA 4DZDA 4N76A 2MZQA 4IQMA 4LR7A 2A10A 4USKA 2Z56B 3HFVA 2W9AA 1RHJB 3FBEA 3FZBA 1ZBTA 1RTZA 3CE8A 2DD8S 3FKBA 4PEOA 2J6UA 2DRAA 4CCHA 1VJQA 4N8NA 3JSMA 3FC9A 2XBPA 3HT0A 2QV6A 5SZTA 1RXOB 1HI0P 1UP1A 2YPYA 2V4QA 4CWBA 2CQCA 1HQUB 4ZJOA 4ERDA 4NLQA 4P2MA 4IDKB 3M8PA 4ZLLA 2GGPB 3W3SA 1RT5A 3CCES 3NY0A 1YX2A 4DCOB 5T41A 3H20A 2RU9A 1HNXF 1FKOA 3WX4A 4DR5F 1Y11A 3GSIA 3OFGA 2L08A 2F9JA 3MD1A 2NZCA 4JV1A 3MR6A 3DLKA 4U7UK 1FDBA 5H9EJ 3NAIA 3IGVA 3CJQA 4FP9A 4QPXA 3CCRS 4FDFA 2X1GA 5C2GA 4K0KF 5T14A 1NDKA 2W01A 2UUTA 4DV7J 2KTQA 3GG0A 4J37A 2RDIA 1J5EF 4HTIA 3AT1B 4JI8F 3MD3A 2MZJA 4ZIVA 4O3NA 2QLBB 1U6BA 1TKDA 2Q66A 3K5OA 4OX6A 2IRXA 3IRXA 4EMDA 2I9SA 3QYYA 2GJ2A 1H73A 4J7CA 3LP2A 5KFFA 1DQ9A 2WVCA 4O3RA 2HSEB 1VI7A 3JSBA 5HAOA 4OV6A 1R7IA 1RABB 1SC1B 1L3UA 3CDEA 2BE9B 1VRTA 3UD3P 1BWVA 1OMSA 1SXLA 4NXMJ 5J1PA 4J9SA 2QYGA 2DCUB 1I6JA 1QD1A 5KFPA 3L7UA 4JI6J 1EAYC 1IM6A 4J9RA 1A6LA 2HPUA 2VPXB 3H25A 3PXGa 4JI7J 1X7VA 1N5TA 1U47A 4OL8A 2YWWA 3FSXA 4B02A 1WG4A 3DRSA 3QBCA 1B4SA 1EP4B 1RHKB 2B4OA 3HSZA 3MEEB 2YKQA 4F67A 1FEEA 1P1TA 1NNDA 3NEKA 5KT4A 3ETOA 1Y0HA 4I64A 3O2IA 2DNQA 1FF2A 2OTJS 5H9FK 3KOAA 3EZUA 3UVJB 5AXLA 2HHWA 2ZBPA 2E66A 3K7RA 4DQRA 1Y5LB 5BYSA 5CABA 1C4CA 3PW4A 3AODA 4IG0B 3VHQA 2QMXA 4L3KA 3AXKA 4WE1B 5DM7Q 3SXLA 1S1VA 3CF5Q 3PYDA 4GKKJ 4M5NA 2HNYA 1TUVA 1PSDA 2PMWA 2GA7A 1Q53A 3DMJB 1DTQB 5JXSA 1X0FA 2YKMA 2MMYA 3OHBA 4RL1A 3V81A 1H3DA 3VAJA 3UCUP 2JNJA 4KH1B 4PWDB 1UW9A 1VC6A 3CT9A 2YNFA 1TAUA 6FDRA 2BX6A 2VKZG 4DF4A 4V19X 1G3OA 4KV8A 3AQOA 1SVDA 3RW6A 1YZ7A 2HMIA 1IM4A 1RTJA 4OYBA 3ISZA 3KHGA 3HHLA 2PMHA 2BM1A 2Y0SD 4JI5J 2HHUA 4OHVA 3PV8A 4IG3B 3KMQA 4X2BA 2CDQA 2EBGA 3KLVA 4IO9Q 3T3FA 4F3MA 2GNKA 1OY9A 1RTDA 2DR9A 1G4CA 2RHQB 3IS9A 4LFAJ 2AW0A 1TL7A 3CULA 1FE0A 2DO4A 3QPIA 4CO3A 5KFLA 1NKBA 5KAKA 2MHNA 1AB8A 3KLIA 5M2UA 2C2RA 2PEHA 2K3IA 3KUHA 2WK4A 3MM9B 3UQSA 3NL0A 3HI9A 3LTOA 4PZVA 4O4GA 2Z2ZA 3OFHA 3V4IA 4OZNA 4QW8A 3T1HF 1VS3A 4M8LA 2ZOFA 2CFXA 3KK1A 1JMTA 1MG7A 1RAGB 4LF9J 2GJIA 2OEKA 4K59A 1CJKB 1QAYA 1HPZB 4RW9A 2EFPA 3RB6A 4KB7A 2VH7A 1T3NA 4F26A 5LM7E 3ISNC 5IT4A 2RE1A 4FPRA 5I42B 1T03A 4D3GA 2CPYA 4J90A 2UVRA 2NCKL 5C24A 1S6PB 2F7VA 4CH0S 4F0KA 1A7GE 1U8WA 2DXDA 2BJ8A 2YNFB 3WHIA 4MYUA 1OJ4A 1T7PA 3S6EA 3G6XA 4DR6F 4LUBA 3Q86A 2MKJA 3OTEA 2VKRA 1BXNA 4MJKA 2YXLA 1YTYA 2HFSA 3CD0A 2D9PA 2YPZA 2E5LF 5CCLA 2P9GA 2J8AA 3OBIA 3MMCA 4JB8B 3KHRA 2PE8A 1JLCB 4ZPTR 3W1YC 5IQQA 2E29A 3C6TA 4JOUA 3G8QA 4LRCA 2LQ5A 1MU2B 1GMVA 3L9ZA 2BE2A 3QLHB 4WTYA 4WP8A 3DM2A 3DOMB 2WAQD 2ILYA 2AT1B 2FLOA 3L95X 1XR5A 3M8RA 2IDLA 3SQGB 4ED5A 1Y10A 4NRTA 4XPCA 5KG6A 1T9YA 4N8OA 3NLCA 3O5TB 3KLIB 2HFUA 3CUNA 2X3GA 1WHVA 3PO5A 5HO4A 4E0DA 2DGSA 3PDNA 3R97A 4LFCF 1NB2A 4O23A 2YX7A 4TY8B 4ZA1A 4M5MA 3P4UB 2HKEA 1U26A 2BMBA 1FCAA 1VQ6S 4MK9A 2DGWA 3ZZZA 1X60A 2J76E 5A0YB 4PQUA 1NUEA 1QVFR 1Q8LA 1VDHA 2YBVA 2FLLA 5KG0A 2GX8A 4A8QA 2EWHA 4LF2A 2YNIA 1YJWS 2MQ8A 2UUCJ 2J9CA 2VIHA 1U1PA 3KMSA 3MCNA 1T9VA 1UFWA 5GMDA 1GT8A 2W9CA 5MAOA 4P73A 2JVRA 3MPVA 1IKXA 1BQMA 3MPUB 4DL4A 5IM0A 1U45A 3HKZD 4ZPDA 3K2YA 3TOQA 1IR0A 1SIZA 1FWPA 1XNQJ 4EK2A 5F9LA 3M8QB 2POKA 4I6YA 2ZWOA 4FXDA 1H0HB 2UUWA 2ZH7A 1RAHB 3AD8C 2H65B 2WVDA 1SV5A 1P6TA 1WOSA 1Q95G 3MTJA 4DDFA 2XY6A 3DLEA 3RG6A 1J2VA 4KFBB 4OLPA 1LV5A 1UCNA 3BYPA 1NDLA 1K47A 1HA1A 2HHPA 2JX2A 3CVKA 3TW0A 1U1OA 2W4PA 4LQ9A 5HN0A 2DGTA 4BWMA 2EKYA 3S8SA 2HQDA 5LSRA 1FD8A 5IOLA 2EVZA 1TL1B 2IPOB 1JJCB 4DS5A 1GXTA 3JYTB 5F41A 3GIKA 1IBLF 1UFLA 3L4BC 5D78A 1OWXA 2WB1D 3PR5B 2AGOA 4OHXA 5JUMA 4ELUA 3MAAB 2HQGA 1RAOA 2L48A 4CLTA 4I68A 1S76D 1HR0F 2HHHF 1SJ3P 2LA4A 3CJRA 3MWBA 2RQMA 3K5MA 4DR2F 2ACMA 3WIVA 3FEZA 5J2MB 1MLAA 1Q7YT 5H9FJ 1FRIA 4HACA 3SBMA 4OJ3A 2KYXA 1CULA 1V5VA 4NWBA 3NCQA 3LPEA 2CJYB 2YX4A 3LWLA 3C15A 1TK0A 3PEJA 3EVWA 4E98A 3C2PA 1YIJS 2R7UA 3DOKB 2J0SD 3H4DA 1S7IA 3FFIB 1XK8A 3NWGA 4NYOA 4KKOA 1S9GA 3CB4A 4WK1A 3ZTQA 1VYAA 1VBXA 2CJXB 4XO0A 3KJFB 4CLPA 3CIMA 2GMLA 3TAPA 3IAM9 2F63A 2CQ0A 5LMNJ 3A8EA 2XS2A 1VK8A 4F4ZA 3A3PB 3OXLA 2J0QD 1NZ8A 1ZPWX 1IKWB 1KONA 1NJYA 2AYGA 3CMES 1Z2ZA 2V8PA 2UP1A 4UF4A 5KFWA 2E1RA 1UVLA 2FJVA 4CT9A 1KN6A 4ECSA 2KT5A 4F4AA 4TU8A 3AB4B 2YNGA 1VLYA 4C0HA 1OQ3A 4M5LA 3QT8A 4ZK7M 3J7A1 5L38A 3BDPA 3NOGA 3D6MB 3PW0A 3KK2B 3MM5A 4QYRA 1JQGA 4DMZA 2ATLA 4LSNA 5K20B 2VC1A 3TZYA 4K4ZA 3HVRA 2BQRA 4DR4J 3L09A 5DLFA 4KO0B 1FRKA 4FKXA 2A2DA 3OUYA 4C8KA 2NQPA 1FVSA 2LP4A 2DNNA 1VQ8S 1WWHA 1N5YB 3FBCA 4K4TA 4FF1A 3FRYA 3G9CA 3BPSP 2UXDJ 2DNLA 1LWEB 4KJIA 1L3VA 4IH5A 4J9PA 1DLOB 1TKZA 5E2QA 1T8EA 1OO0B 4Q0BB 5FDLA 1GTEA 1ELOA 4J9QA 2MSTA 2QSWA 1F9HA 4P2FA 4ZJQA 3QT6A 3EYZA 5KTQA 2MJNA 1J5OB 2GMJA 2CNOB 2D3ZA 2AYBA 4MIWA 4HR2A 3Q8RB 2ROEA 4CTAB 2RD5C 2LU2A 3FSIA 1D09B 2G9OA 2B9EA 1Q16B 4OZ0A 3MMBB 2XYPB 3KFWX 3M32A 5JJBA 3DLHA 1LWCA 4DI6A 3MM6B 4KHMA 1NB7A 4X4VA 3VAMA 3V6JA 3TWZA 1RT1B 1RCOB 1IBMF 2OPRB 5F8MA 2A1BA 2VG5A 3ILOA 4DV5J 4QWAA 4ECZA 1JLEA 3V2UC 2ZH4A 3I4PA 4NXMF 2H54B 3SV4A 5KFVA 4DS4A 5DDPC 1FX2A 4QWDA 4WPAA 1YG0A 4A8OA 5KG3A 3CMQA 3OT9A 2HNDA 2FJEB 2YKNB 3AOAA 1D0EA 4B3TF 2DIVA 3LGNA 2V2ZA 3RU0A 5KG4A 4DR7F 3MR7A 2OKQA 1F5CA 2YWKA 2LVWA 3THVA 2XHWA 3DRRB 1S49A 3HKWA 2QRRA 2YH1A 2VPYB 2KVIA 3SDEA 5J2PB 3DI6B 5L9XA 3DGPA 4FF2A 1C1BB 3PTWA 4C8LA 3V6DB 3G86A 2HYIB 5KFIA 3HFKA 1VC5A 2GHVC 1XTZA 2ZDOA 2K7KA 3B54A 1ZAXA 4F0HA 3UNGC 2ASJA 1BWEA 2CQDA 2B4VA 2LYVA 5KFBA 1ZM4A 5DGBA 5LOQA 3T6BA 2JLGA 2I6WA 2ZKUA 4OX9J 2LQ8A 4DCJB 2OSRA 3FMBA 5AE1A 3K17A 5H1SV 4YB1P 1N52B 4R8UB 5EDWA 2Q43A 4GVLA 2NYHA 4OIXA 3GG1A 2I8EA 1FXLA 2GMHA 2DT9A 4DFKA 1RLDA 2U2FA 2Y0BB 2B3TB 5LXYA 2OI2A 5AXMA 4ZCMA 3KUGA 3TNVA 4N41A 3CC7S 3DLJA 5DZ6A 3Q2SC 1PO6A 1LWFA 1ZM2A 1M1GA 3WIUA 3QGGA 1GMWD 5D0HA 5KFKA 2XMVA 2MGZB 2XMKA 4DU8A 1U0HB 3K8WA 2CQ3A 1FFWB 2IAJB 1JB0C 5DGAA 2JEFA 3NRBA 3Q23A 2C3OA 4YDDB 2DH8A 2L9WA 3QAEA 2YKPA 5C42B 2XMWA 1GFWB 4Q44A 1UETA 3MTKA 3MUTP 3EGVA 3CO9A 1BGXT 3FRZA 1NM2A 4J9VA 2ZJRQ 3MGJA 3BN4A 1LWXA 1EHWA 3IWXA 3BO3A 1HD0A 5KFMA 2E7VA 3MMAA 3OHAA 5T7LB 2YWEA 5CYQA 3MI7X 3KLHB 4DFJA 4ID5B 3I5BA 1WEYA 4A46A 2YQ1A 5CHCB 4GVBA 1S79A 2FJXA 5ETRA 1BE4A 2CNNB 1QDUB 4EU0A 3PR4A 3R6GB 4ILLA 2ASYA 3J80Y 1FEHA 8ATCB 2YNHB 1RA7A 5BYQA 2OPQA 1T9WA 1HYSB 4ED7A 1NPKA 2AZ3A 3KKFA 2JHEA 4KC5A 2KG1A 4ZVUB 1AW0A 2RF2B 3LP0B 4UT4A 1SH0A 4MYTA 2A0FB 4ANCA 2W4CA 4A8SA 1ZAVA 5B0FA 2AJ2A 5IZHA 4F25A 3D1QA 4AQYJ 3MEGA 3R1LA 2BJEA 1FJGJ 2DNZA 2BOPA 3UO0A 1LW2B 2ZJQQ 1Q1KA 2EBEA 2YH0A 4LBIA 1SIWB 5IS2A 3VQTA 1B0TA 1N33J 1HI8A 1S1XA 1KHVA 5EHHA 2BANB 4CNZA 3KNAA 2NXUA 4RNOA 5B09A 2R7TA 2FIUA 3GFXA 4OJHA 3J7AN 3ENVA 1CC7A 2VJUA 3AOBA 4JUZA 1WI8A 4HL9A 3ITHA 2DIUA 1F6TA 1PC4A 4AL5A 1W26A 2NSBA 2WOMB 2G2ZA 5I3UB 4PUOB 1VQYA 4QPTA 2KKHA 2AJ0A 4ES3A 1ZS6A 3FK4A 4NASA 5D3GA 2LDIA 3QIPA 3DU5A 5CA5A 2D3O1 2W1BA 4JI2J 2MLXA 3C6UB 3DXSX 4E8UA 3ZNUA 3W65A 1NRKA 4LF5J 2GS8A 1KKHA 1C0UA 4ZLNA 3RW7A 4IOBA 1EIYB 3N4WA 1VRUB 4DV4J 2BE7D 3JSRA 4YY3F 1NCLA 3NGRA 4DR3F 1JKHB 1N88A 3IBCB 4RJVA 2V94A 2F5GA 2Y8YA 3DYAB 1KSPA 2XEXA 1P9QC 3VAGA 3TEGA 2ZH1A 1EQ0A 1T11A 3UWTA 4M1KA 2JC1A 3M1VA 1QTNB 3GONA 3Q8UA 4ZN3A 4OQJA 4DQIA 3U1MA 3BGRA 4RBTA 4NE9C 3ZZPA 2F8HA 4EFAC 3HM9A 3OR2A 3UDLA 2R9LA 2B4UA 1S99A 5DS7A 4RW8A 3TEHB 2UUCF 3I56S 3OQ2A 3OR1B 3W5YA 2QJ3A 1S1UA 3LP1A 4BC9A 5HMXA 4HHHA 5HI7A 5GVQA 1NDCA 2IRUA 2HFVA 2RKIA 1I3OB 4ECXA 3GCXP 1HNWF 4DG1B 2G2OA 1MNEA 1JLGB 2WSEC 1YBUA 2WBRA 3R7SB 2J0XA 1FDAA 1WDTA 1Q8IA 3SCIE 2RJZA 5F3ZA 3RUBL 4U6PA 2W7PA 4JI4F 2B8PA 4MAKA 3B78A 2MQLA 4QCLA 2MY7A 2DPIA 4OYAA 4W98A 2EKNA 3P96A 4DU7A 9ATCB 1XR7A 3I0SB 1MMNA 1VK3A 2JL9A 1VJWA 5ETQA 4H4KA 2V68A 4AD6A 5DETA 2N4CA 3W2VB 2CAJA 1S57A 2QO3A 3RYLA 3IM9A 2FVPA 4H4OB 4MKVA 1RB0A 4B3SJ 2RNEA 3BQ2A 1RAFB 4DX7A 3R5GA 4LFBJ 5J2QB 3TI0A 2XI3A 5KFDA 3HHEA 3KDNA 3B8HA 1NDPA 1PG5B 3QWUA 4ED1A 1RT3A 3T9ZA 5E3PA 1SKRA 3ZZUA 2MLYA 1JLQA 2IVYA 2PA3A 1S72S 1W25A 1EKSA 4MFBB 3BBFA 1VHIA 3SQOP 1I51B 4KRWA 4EWTA 4N56A 4YEAA 5E3AA 4PG8A 2OEMA 3MEKA 5IV4A 4C11B 2RUSA 2MQPA 2W2PP 2UVVA 1O5JA 5KFUA 4USMA 2VC0A 4NLXA 3JXOA 1S6OA 2QA1A 2E5GA 4UY8T 2OPSB 2VG7A 3M9MB 3K5NA 1HI1A 3GSDA 4KAIA 2XNRA 4GO5X 5IWAF 2VQEJ 4RNNA 1WOOA 4DOZA 1M1HA 3GP9A 2X1BA 4L76A 1CS4B 2DHGA 4QIFA 1OSCA 2YKOA 1NU4A 1HARA 1XMQF 1X5OA 4MK8A 3D67A 1WHYA 4CNYA 4UOCA 3QSIA 3BQ1A 3H98A 4G1QA 3SFGA 1NHKL 3UFCX 2KHDA 2E5HA 5EX0A 2NUUG 2NYIA 2MYFA 1LOUA 3DHWC 4O44B 3BYRA 3U02A 4CLYA 1CEZA 5F8HA 2Q1LA 3EZOA 1MROB 1RT7B 2XZDB 2DK2A 2FUG9 2F8MA 2LCWA 4LREA 4HH0A 1U8SA 4WF9Q 3LAKA 2CDRB 4P52A 3PEHA 2FTRA 4ECRA 3M8WA 3LF0A 2HGMA 4U96A 3IN5A 3CJ2A 1LQ9A 1KRPA 2VODA 1UPMB 3ICLA 4NYZA 4LF6F 4DPUA 2HQIA 4QJVA 2Y3YA 2ZE2B 3MXHP 1RK8A 1SI9A 2CPDA 2XG8A 4FBUA 3GV7B 2IJRA 2R7OA 4PWWA 2FDNA 5D0GA 2I1RA 2F4VJ 3UN5A 3Q8PB 3ETMA 3GZ7A 2K1RB 3NGDA 1Q81T 1Z1ZA 2IM2A 3CD5A 1VQ5S 2O01C 4KGMA 4J9OA 1HMVA 3X1LB 1MMDA 1T94A 3TJ8A 1HQEB 1OY8A 1EJ7L 5IFMA 2RILA 3JQMA 5D4LA 5HL7Q 2AX0A 2ZUGA 3DFEA 2AEFA 3PRVA 2FPHX 4H4MB 2DVIA 2QA2A 1X4HA 3IBWA 3GIRA 1Q0NA 4RKUC 3LPYA 2W7AA 4LRFA 1R8CA 4QOTA 2AYEA 2H4WB 3EJMA 1N0UA 1TKXB 1XJWB 3MAHA 5B0AA 5DG9A 2E1CA 4WBFA 9RUBA 4KTQA 1CQMA 1NPRA 2HS4A 4BWJA 2C22A 2OH2A 1YRXA 2HHQA 2L3MA 1TQLA 2BRLA 2CUYA 4HI2A 4PXEA 4M5DB 2ZBIA 1P8GA 2BRKA 5A8RA 4C98A 2PN6A 4PPDA 2E5IA 4WWSA 4ETXA 2OMLA 3HJFA 4LF4F 2XCAA 2HK2A 1KS2A 4MKBA 1HBNB 2ZUAA 1U1RA 4GC7A 4JI0J 3T6JA 1OQ6A 5G0RB 3OVBA 3TX8A 3MECA 2MZTA 4NOHA 3O8WA 4OZ1A 3V4MA 2ROGA 4FNHA 2X1AA 3UCZP 4LRAA 1S6QA 5J1EB 1J27A 4C3LA 2FHOB 1SC4B 3W64A 4ANEA 3EGNA 3SMZA 5BR8J 3EUNA 3HD2A 1VBYA 2KVQE 2W2QP 1TKTB 1RTIA 5HBMA 3CPWR 1HNZJ 3HHLC 1HBMA 3WC0A 2HNZA 3J81Y 2LU1A 3Q8VA 4PXDA 3VTIA 2YWHA 1VBKA 4K2XA 1SL2A 4A8FA 2CJBA 4A8XA 1QE1A 4B9SA 4B3RJ 4ZCLA 2WONA 2ZH8A 5D0EA 4LSLB 3OV7A 1ZTTA 3M8ZA 4DN0A 2YVSA 3IRWP 5K8OA 1RISA 4ID8A 4WZQA 1DBDA 1WC5A 2V9KA 3NNHA 2Z8QA 4IKAA 5AXKA 2KRBA 1HD1A 4ALZA 2GFFA 5HJYA 1A9NB 1SCJB 4U8VA 4HI1A 4IFVA 4X66F 3CD6S 4AL6A 4X64F 1KLMB 1K1SA 3GIJA 4LF1A 3ENQA 4DSEA 4X62J 4CLWA 1N34F 4KPYA 1YJ7A 1CJVB 2B4PA 1C0TB 5HJXA 1LEOA 3KLEA 1FXRA 2XSJA 4ZPCA 4X4OA 4GMKA 2PEBA 4LF7F 3HF5A 2QX0A 2BXJA 4WYLA 2LXUA 3OJSA 2EK1A 4ZHRB 1D1UA 4YR2A 3C46A 2BOAA 1M0SA 1E6VA 1B3TA 2ZH3A 4G65A 1F3FA 2VQFJ 1L3TA 2OTLS 2FVSA 1VQKS 2EFVA 1TP7A 2XYGB 2VG6B 1FI4A 4B3MF 1N5SA 1S7HA 2IDEA 4RU2A 3NMRA 4L75A 5EN1A 3UN3A 5K9FA 2VDHA 4QWEA 5B0EA 3W2WA 5IC4B 5IT9Y 3MOJB 4HHUA 4RR5A 2CPJA 1GTHA 2M5YA 1R27B 1HWIA 4URQU 3DOLA 4F4YA 3QQCD 5ADZA 2C28A 4OHWA 5HVFA 1IQTA 1Y4ZB 2V4JB 1VMBA 4PWUA 3OL8A 1I1GA 2YX1A 3PCOB 4ZOSA 3AA8A 3QJJA 4BDPA 4IRDA 1DY3A 1AYEA 1PGZA 3DDIA 4P72A 2BW7A 4WYWA 3HO1A 3S1TA 4PPZA 5F3TA 2R2SA 3J80U 4RNHA 2VUGA 1PC5A 1RAEB 2W8LA 3NCPA 1H7XA 3EXYA 2N7YA 1FERA 3SZ2A 1RTHA 1G1XA 3CJ8A 1RU2A 2A2CA 3H8YA 1R0CB 3R5CA 3BF4A 2VJVA 2E1PA 4AXJA 5CYMA 1SJ4P 4I1TA 1S1TB 4Y6IA 3R8YA 1KP6A 4LVOP 3D1OA 4QIEA 4I56A 2HURA 2AJ1A 1FJGF 2CPEA 3FCWA 3HXMA 4TU7A 2PC6A 3QO9B 5HP1A 1RP5A 2FLNA 3AJDA 2O67A 5GAEI 3F56A 3ZZOA 1CJTB 4ETZA 3N79A 2E44A 4DPOA 4EBDA 5CD4H 4FVCA 5CAAA 2C3PA 3PRDA 3MHYA 2CPXA 3A8IA 4Y00A 2HIYA 4DV0J 2XGQA 1V9OA 1FNOA 1N54B 3TX0A 3ONQA 2APOA 5EWFA 1KD1T 3G8SA 1ZETA 1WG5A 1UKUA 3ZTRA 3TQ1A 3GR0A 1KFDA 3OD2A 5K5MA 3PRBA 5MLCV 4JI2F 3EPGA 2L9DA 2ALZA 4AFFA 3TYTA 2OFGX 1FWKA 3D54A 1A0OB 4C7QA 3CXCR 3CJKA 2Z4PA 3E8OA 4ZVOB 1RT6A 3TJAA 2VL1A 2B8QA 4UW2A 1NEEA 2UV8G 4XPEA 1S1WA 3I0RB 4JI3F 3U27A 3OTOJ 1KLNA 4CLLA 4WFBQ 1AT1B 2HVEA 1DAXA 3PHEA 1PBUA 1R89A 2VA2A 2AJQA 3UNYA 2G13A 2BJ9A 1RJJA 1SJQA 1IKVB 3MM8A 2K7JA 1S9EA 2X1FA 1UFKA 2H9ZA 2CQHA 2R8HA 3DLGB 2D74B 1HNIA 1CJUA 3HX9A 3DRPA 3BM7A 3OLAA 2DH7A 4LRDA 2DKOB 2HQCA 1SUQB 1Y00A 1NLKL 4K8RA 5CYMB 4DR1F 4N77A 3H5UA 2ZC4A 3NGTA 3PJWA 3J7YU 1HBUB 1KHWA 2VOPA 1FK9B 5AXNA 2DR6A 3CIZA 2RDDA 2JZ5A 2LQBA 5HP1B 5F8GA 3D68A 3GWCA 2DR5A 3JAMU 4JI1J 2MY8A 1L3SA 3DC2A 1WHWA 4DJBA 1K0VA 2WVBA 2C3MA 5FLXY 1URRA 3POTB 3BO4A 4WFAQ 2V69A 4X4RA 4HEA9 5EUHA 1FJ7A 4G1IA 4HTJA 4JV5J 2G0JA 3FMWA 4NXNJ 2ASDA 4M95A 1F60B 1F1BB 2V2KA 3M7VA 1UVJA 2BKPA 2CQBA 1S0VA 4NCGB 1JX4A 2V8GA 2Z58B 4B3SF 2IC3A 4FS1A 2I5JA 2FB0A 4LFBF 3H0PA 3MFIA 2ZVSA 1TTHB 1UEVA 3Q0AA 3OSPA 2LEBA 1TVRA 1X4BA 2XCPA 3I82A 5HROA 2KH9A 4I7FA 3ET6B 2LDYA 3CDBA 3P49B 1NH8A 4M5JA 5HMYA 3R5JB 4U95A 1MN7A 1GNKA 1FX4A 4K2JA 1KVKA 1WC6A 3KLGB 4DEZA 1WG1A 1LFPA 1JLBB 2DNPA 3BSAA 2AD9A 1NBEB 2WTFA 1ZA2B 3RBEA 5AE3A 3LW5C 2DNRA 4I67A 1PJ5A 2C1EB 2GC8A 3D3BJ 8RUCA 3TR5A 4V1Ak 2B9XA 3BSOA 4ZJLA 4OJ1A 1HWJA 3N6LA 3UR0A 4K5SA 4O4RA 4X65F 1IBKJ 1D9DA 3PYFA 2OPPB 2W7OA 3QZ8A 1RE1B 3KHHA 3BQ0A 2F9DA 5GAGU 2DNMA 4K5RA 3H59A 1HQUA 2A6OA 3T5KA 4ZVGA 4PG6A 4HT7A 3CDAA 2GGPA 5HMZA 3R27A 4KHPJ 5D15A 4ZP8A 1N6QB 2IHR1 2C3YA 1PAUB 2WVEA 2ZC3A 2RT3A 2GVDB 3CEDA 1M90T 2G0CA 1VHFA 1RWXB 5LMUF 4ZCIA 4CLKA 2DEIA 3WZ0A 4P71A 2FZGB 3C19A 5M2PA 5RUBA 1IXKA 3HFZB 2IM3A 5I3QA 1AUDA 1U4BA 4UOFA 3T5LA 4ZVEA 1SH3A 2E9ZA 1VQ7S 1VRQC 2ZJPQ 2D7SA 3WC2A 3C16B 4UZCA 4L6V3 4QQBA 4KBIA 2GQQA 5DDRC 3MM7B 4NEYA 2DJWA 1JLAB 2CJ9A 4I2QB 3PNIA 1QAJA 4QU6A 2DHXA 4OYPA 2RRNA 1AFJA 1SL1A 3IC1A 1UWBB 3D5MA 4MIAA 4LBHA 4JP8A 1EZZB 2PA8D 2VU5A 3CJ0A 1JXLA 1GMUA 2R7WA 1KQSR 3EGZA 2RU3A 4ECWA 1CSJA 5HQ8A 3EZ5A 4Q8FA 5D8HB 2OUGA 4DXLA 2E9RX 2RS8A 3KHLA 1F0XA 4TNOA 2QYCA 4TLQA 4F04B 2P2CB 2D1CA 2KDOA 2PGCA 5C5JA 2YWFA 4C2MA 1FHTA 4USIA 4TLRA 1EP4A 3QNWB 4TQRA 2DNYA 3Q8SB 3MEEA 4DL5A 2B6AB 4P2XA 1NJXA 3DCAA 3FBFA 3P3DA 3T1AA 1N4LA 3UVJA 1KQFB 3AB2B 1K44A 7FDRA 2IBOA 4CYUB 1T02A 5AJ3J 3IM8A 2CPIA 1P1LA 4IG0A 5F8JA 2NLWA 1FTRA 2CNKB 1FVQA 2EPIA 5HMWA 5DQHA 4JYAF 4L74A 1QTMA 4WE1A 3T5JA 4KGVB 3PHTA 2W9BB 2COLA 3A13A 2DGXA 3PY8A 2EI5A 3OTCA 2MSSA 2DR8A 2DY9A 3QSYB 1I94F 3QAUA 1UW4A 1BY9A 3DMJA 1DTQA 1ZM9A 2HFZA 2QEXS 3SCJE 4ICLB 4FYDA 1YBAA 4DV6J 1ZTWA 2GZOA 2XMTA 1NK5A 4WXOA 4QWBA 2Q6CA 4QR2A 4PWDA 2KG0A 4DHVA 4C8YA 2HQFA 4YR3A 2UXBF 4FF3A 5BR8F 2KN4A 3FSYA 1CBKA 1ZZNA 1HNZF 4R5PB 4OZJA 3RJMB 1Q82T 2KZZA 1ZA1B 4TXSA 3DDKA 3KJNB 4NL5A 4NLGA 4FXWA 1REVB 2GAGC 5CZXA 1S59A 1HBOB 2JC0A 1FKAF 1OYEA 4DN9A 3IP0A 3K59A 2RH3A 2CQPA 4IG3A 2BM0A 2BZ2A 5C25B 3I5CA 4R25A 2R2RA 1ZPVA 3OL6A 3H2LA 5B0BA 4O3OA 2VV5A 3HVAA 4NA2A 1Z2LA 3EDQB 3RB4A 4ES2A 1S6UA 3RR7A 2BQUA 1EKRA 3SFUA 3HPOA 3NP5A 2HVHA 3EICA 4DV1F 5CCMA 2ZD1B 1NH7A 2KL8A 3IXQA 1XC9A 2JOQA 5J2NB 3CCVS 3FQKA 4F4WA 3W8GA 1HHTP 1ZZFA 1RT2B 2NSCA 3N5FA 3KK3B 3KJVB 4EGLA 4RPFA 5GADU 4DR5J 2VHGA 3MM9A 3N01A 4CLSA 4OZLA 2NXCA 3HLUA 1RAAB 3W62A 2FZKB 1TUGB 6AT1B 4PCQA 4A8YA 5ETNA 2XO7A 4I6WA 4G1PA 2FD2A 1NJWA 1WSRA 1RAIB 2EFGA 2V9WA 4DFMA 1CJKA 1HPZA 1SQFA 1RQ0A 1PKUA 1T05B 3JS9A 4IR1A 3BSCA 3MCMA 1O8BA 5I42A 5CD4A 2IRYA 1WOPA 1J5EJ 2HAFA 1S6PA 4JI8J 3OTDA 4C3KA 2IJFA 1U2FA 2HBRB 4CO4A 4RWWA 3Q83A 4CLUA 4OYZA 5ETTA 5DM6Q 3UDVA 4Y65A 5IT9U 1R8HA 4LBPA 2V63A 3DLBA 4ZP9A 5KFRA 3T19A 2EFNA 2UZAA 5KFTA 4F50A 2V8DA 5KG1A 4IYQA 2C2MB 1H2UX 3IG1B 4KSEB 3KUEA 5E3QA 1S9FA 1JLCA 4DSLA 4KGZB 4NLRA 1BHNA 3PO4A 4FPIA 1U1MA 1XBWA 2R8KA 1MU2A 1YJUA 3I31A 2JWNA 3TO8A 1XMBA 1B7FA 2V34A 3QLHA 3LH2S 1D9AA 3G6VA 1HLWA 3DOMA 3GMGA 3H4BA 2QLFB 2VFVA 2QL7B 1DTTB 3LQVA 2OHDA 2XC9A 3SQGA 4AYBD 2H4YB 4CM0A 7FD1A 5D4NA 2LFVA 1FWLA 2DNOA 4P2SA 3V6KA 1AZSB 1C4AA 2JRSA 3PACA 3K57A 4F3OA 1Z4UA 1B99A 2XMMA 5D4OA 1K0TA 4TY8A 2IFXA 3I4HX 4LF8F 4DX5A 3HHNB 3KG0A 5A0YA 3G8TA 5CQGA 2ABYA 2XSFA 2VDIA 3FCVA 5L46A 2XTJP 4DUYF 4LSZB 4X4NA 2CQ1A 4QYZK 4WP3A 1WORA 2MHEA 1G2EA 3S7RA 3LALA 2RB7A 3B4DA 1VC0A 3O44A 1WSVA 1L5UA 4YB6A 3WX8A 2CZ4A 2E5JA 5E7OB 2J5AA 2KU7A 3K8VA 2HVDA 3NAHA 1C1CB 2ZZTA 1XNRF 1YJNS 1QM9A 3M8QA 4H4KC 1IJEB 2FHKA 4WIQA 1S0MA 4NZ0A 3TP2A 1TR0A 2M0GB 2UUAF 1RCXB 1TL3B 1Y3KA 1R8PA 1GEHA 1U2RA 2ATCB 1ZYQA 3QFWA 3GYXB 4KFBA 5HANA 3D66A 2EEYA 3M9NB 3TAMB 4IR9A 4RUBA 1H38A 2G1DA 1UPPA 3RR8A 3FBBA 2ACYA 4MMOA 4EUVA 5HVGA 1EETB 2GV1A 5E41A 2DY1A 1TL1A 4KIAA 3M2RB 3R5BA 5D77A 3CTRA 4ANDA 3JYTA 4MH8A 3CJ5A 1WEZA 3W9JA 2IY5B 1RBLA 4JV2A 3MAAA 1SKWA 3RB3A 3A3OB 1QSYA 7AT1B 1R0AB 1SJRA 3LOUA 3HP6A 5DJBA 1M5VC 1R8AA 4OI1A 3SV3A 1KDNA 4HHJA 1YKWA 5J2MA 1WUUA 4X4SA 2B5JB 1C2PA 2HZCA 3R9LA 2R7SA 4UZBA 2LQJA 4DUZF 1WC0A 1JLFB 2LKZA 4NXNF 2HVZA 4EO8A 5LSOA 4C4WA 3WQPA 4TY9A 1TAQA 4K4SA 1WACA 4WKRA 4U67Q 1S77D 3GFHA 3DOKA 4YMEA 3ZNJ1 1RACB 2RSQA 3FFIA 3G71S 4MKYA 3KTQA 3R3TA 4P74A 4CO1A 3M30B 2DBBA 1PYTA 5LSLA 2AEMA 1L3KA 3PJ9A 3M2UB 2XS7A 4F3QA 3E2EA 2UUBF 2CG8A 1GK8A 2B56A 4DR6J 1JNRB 3TZXA 4OX7A 4JBCA 2HS3A 1IKWA 3R1HA 4DLEA 3HHKA 4TN2A 4K4VA 1BQNB 2PSZA 3QATA 2E5LJ 3BKTA 3W66A 3VR1A 3H5YA 1H6KX 2J7UA 1RT4B 2BKNA 2LXIA 3VCDA 4G6VB 3BS9A 3KK2A 1OYDA 2OSQA 3KG1A 1TU0B 2I38A 3ILIA 4J9KA 4A8WA 1HWLA 3P6YC 1F5BA 5LJ5Y 5LXRA 3OSNA 1IKYB 4KO0A 1RBAA 1NAQA 2Z0GA 3M6UA 3PKMA 1G6BA 2HQ3A 2FVRA 1N5YA 4B3OB 1HNVB 3NBPB 1Y7PA 2NXJA 2M8HA 3ENAA 1RWOB 1N0VC 4KQZA 3HSJA 1LWEA 2Y1JA 1RADB 3HCXA 2KM8B 2VFRA 1DLOA 4FF4A 4LFCJ 3D1HA 3IR5B 4I2PB 3H7HB 1RI7A 1UVIA 5F8NA 2LXFA 1U02A 4Q0BA 3KLFB 2BUNA 4IRCA 4DQQA 2DXFA 3DU6A 4NMXA 1OY6A 1RU1A 2B7BB 2AGPA 5B08A 3UD4P 4BBYA 4A8MP 3E01B 4L72B 2XB2D 3WDOA 2ZHOA 4F2SA 2HHVA 4C48A 1J5OA 4ZPVR 4PKDB 1NHUA 2UU9F 1U1QA 4ZVQB 4EEYA 4CTAA 2NXEA 3R2CJ 4CH7A 4X4UA 3TZZA 3BR8A 2WSCC 3MMBA 3G6YA 3CCTA 3NKYA 3A12A 1WELA 3V6HA 2BVZA 2ERRA 2CYYA 2U1AA 3MM6A 4RW6A 1RT1A 4P10A 2GVZB 2OPRA 1RWKB 4MTPA 4AXIA 2E1AA 4KR0B 2K8GA 4IFYB 4RW7B 2CZ9A 4MT1A 4NLTA 1U7LA 5ETKA 1S10A 5E33A 4IQXA 1NSQA 5F8IA 2FLPA 1IUJA 4ENOA 3IMQJ 3TUJC 1O51A 4KYZA 1F2HA 2P5VA 3LUYA 2MKIA 1F3VA 2YKNA 5KT7A 3GJSB 4ZP7A 4OI6A 2MXYA 2GIFA 5DQGA 2FVQA 3NNAA 2JEGA 3QJPA 1FJEB 3HVWA 1IJFB 1IBLJ 4O3SA 5HLFB 4O0IA 2H3EB 1U48A 2H51B 2FJBB 1K1QA 1M5PC 4CIOA 1FDNA 2AYMA 2M9KA 3DRRA 4OHZA 1YZ6A 2HRYA 5L9NA 3T41A 1YITS 5J2PA 1HR0J 3DI6A 1C1BA 3DHXA 5BYRA 2ALYB 3V6DA 3CJ4A 4DR2J 1V3RA 2XY7A 4KY3A 1SKSA 2CQGA 4C8NA 1CLFA 2IM1A 5AJ3F 4DL6A 2AJ4A 3G82B 4DPXA 2QIFA 2RHSB 1VQPS 3L7PA 2CIMA 2XULA 2FGCA 5CXTA 4YB7A 4K7QA 3D6TB 4DV7F 3KWMA 2DYAA 1X4GA 2HZVA 2F1FA 4QYZJ 3OPKA 3C14B 1I5OB 5ETOA 4WCEQ 4R8UA 3PM9A 2GIQA 3M2VB 1XWLA 4DQSA 2VOOA 3BZQA 1X5SA 1JNZB 3DDNA 2R42A 4DQPA 4L73A 4RW6B 1T9XA 1Q4RA 1FJCA 4M5KA 3BJYA 1HWKA 3OXGA 3IWNC 5ETSA 1XEZA 5KG7A 4Z37A 2F40A 1H98A 1FA0A 1DARA 4OZ5A 3PIPQ 2DHAA 2R7XA 3I55S 2FYXA 3HHLD 2MGZA 1EARA 1S4EA 1U0HA 4JI6F 1TMMA 1ZM3A 1QUVA 3CWJA 3DN9A 4JI7F 2IAJA 2Q3PA 5GAHU 1U49A 4NPOA 4N47A 1WF0A 5C42A 5A8KA 3GFZA 1M5OC 1KQKA 4RWXA 4J5OA 2R4FA 4WFXA 2K3KA 1KVIA 3NMAA 2AIRB 4HLBA 2HHTA 5BXIA 5A2QY 3CNQP 5T7LA 4X4PA 2BBEA 3I32A 3KLHA 3RB0A 2HWIA 3HVTB 4ID5A 3OW2R 1RWPB 1UZHA 4ECQA 3TQEA 3ZTSA 3UD5A 3SCKE 2IIHA 4RNMA 2CZVC 1WD6A 1PIEA 4HDHA 3BV8A 2VPZB 2QN6B 2B7CB 2E9TA 5HK4A 3K5LA 3BB5A 5C2CA 4GKKF 2MB0B 2QFJA 2C3UA 3M4XA 1VQLS 1YWXA 1N36J 2YNHA 2OJ3A 1FE4A 1JXVA 3VV2B 2VASA 1NSPA 4NI2B 3MCOA 2DH9A 1HYSA 3VGSA 2DITA 4FYVB 2RF2A 4NLVA 3LP0A 4OZ2A 2IA0A 3A4TA 4M5HA 3HZGA 1LW2A 5DZ7A 4OI4A 2A3JA 3LANA 3MEDB 4NA3A 5KOWA 2YQ0A 1EQMA 1FRLA 2BANA 3QIDA 3QJLA 2AHOB 1SQEA 3NS6A 1UVMA 2KB2A 1IBMJ 3IWLA 3QMQA 3BR9A 3PYGA 2UXCJ 4C97A 1K8AT 2GCFA 1U25A 4JI5F 1KBRA 1UEUA 2HWTA 1RLCL 3JSMB 1HKAA 2XZTB 1YGYA 3ILLA 1T9TA 4UUWA 3AA9A 2WOMA 4ZVSB 5I3UA 5A8KB 4PUOA 4LFAF 4AE5A 2WZ1A 2H5IB 1UA1A 3NCRA 3W9HA 4B3TJ 2V6AA 4F7VA 3C6UA 3WBZA 3VWSA 1YRTA 3M8PB 3M8SA 2V50A 3IFEA 1RT5B 4M5IA 3H5XA 2A18A 2R7QA 4DR7J 4QBUA 3G87A 1KFSA 3CC4S 2DHSA 3NGUA 2EFOA 2CWKA 3J7Z5 1FKOB 1VRUA 2JEIA 3D4JA 4CLZA 1JKHA 3MUVP 1Q8BA 4OI0A 2K2PA 3VZIA 2IJNA 2OP5A 1IR1A 4CI0B 3DYAA 2QC3A 1GH8A 5EGYA 4X4QA 3NS5A 4ED4A 3CJTA 3W61A 3DLKB 3BBBA 3N28A 4GRSA 4LQ3A 1BLUA 1D3WA 2XWYA 2YKAA 3BKUA 4LF9F 5G4DA 4OYMA 1KEKA 1NMEB 2ZBCA 5CH7B 3QT5A 4NLPA 3SIPB 3PJXA 1JIHA 1NK0A 3PKYA 2QG9B 2CJQA 3OR1A 1CQNA 4CP5A 4LR9A 1VOMA 3IRXB 4Y2CA 1RHQB 3D7SB 5KG2A 3N6MA 3LP2B 1APSA 3TUIC 3OFEA 4DG1A 1JLGA 1HW9A 1UJ5A 4CM2A 1NJZA 2KO1A 1DQAA 1GAOA 3IBFB 4M94A 1FO1A 1FT8A 4RZRA 2QE5A 1JJ2R 1QSLA 1VRTB 4E2FB 1XN9A 2AGQA 3I0SA 1VQ9S 2L9NA 3ZFVA 4R0EA 5JMNA 4F8RA 5GMKa 1YHQS 3W2VA 2EXUA 4LRBA 1Y5NB 1R0BG 2OAUA 4XIUA 2O5DA 3PX4A 3E51A 4H4OA 5F0WA 3DKDA 3J81j 2E7WA 3GYNA 1LK5A 3GJTB 2B0GA 4Y2KA 1NK9A 2IBKA 2CQIA 4ECTA 5J2QA 1KOHA 1X9SA 2KFNA 3GLJA 1S12A 2W24A 2XLKA 2H1YA 3DRSB 1YJRA 3AOCA 1SPBP 3A8JA 5A8WA 3MR5A 3A8KA 2RQKA 1Q86T 4NLUA 1IWAA 3ZO7A 2V8VA 1Q5VA 2XO6A 2HBYB 4MFBA 2KFZA 1PBAA 2AMCB 4EI2A 5CZVA 5L1JA 5KFQA 2VBYA 2QA4S 3QWPA 2WCXA 4CO5A 1YQHA 4FYXB 3CCUS 3TUZC 4MIBA 4C11A 3GJQB 5HSPA 1HIYA 2WVFA 3EM1A 4DL3A 5FIIA 2Y1IA 1S1VB 2KXFA 2OPSA 2HNYB 4K50A 3GTYX 1YJTA 3P8BB 1NXIA 4O3PA 1LNQA 2N4DA 3TRGA 3OTBA 3LA0A 3FNNA 3GE9A 2IMWP 4C8OA 2YKMB 2GO9A 4H54A 3X3UA 2DB1A 1CS4A 3V81B 2NUHA 3B82A 4NEZA 1XNQF 4DL2A 3BGUA 2D3OR 4DL0C 1GX5A 3G4SS 4DSIA 5D0RA 2CNLB 5KT6A 1ITPA 1BD6A 1WC3A 2KZMA 4NLWA 3P5TL 4KV8B 2LEAA 4U8YA 4FN5A 2DTJA 2HMIB 3QGHA 4ZCKA 1NSKL 4O44A 5SUHA 1NZAA 1RTJB 5LJ3Y 2HAIA 4BS2A 2BDPA 1S0OA 1GMWA 3GIMA 3HHLB 1MROA 1RT7A 3HDSA 4UUXA 4NCAA 5BJRA 2MKKA 3CCSS 1U24A 2P9CA 2BJ1A 3NWRA 3K89A 1RTDB 4J9NA 1N5QA 4Q2LA 4DSJA 3IS9B 3M9OB 1MWZA 1TL7B 4TQSA 5A8WB 4P7TA 1RBOB 3MAQA 1FTCA 2GHPA 5KFOA 3HZEA 2GQ2A 2F3JA 1D9FA 1T9UA 1LXNA 3PFOA 1MWQA 2V8HA 3B6BA 3KG4A 5C7PA 4Q2MA 4ED8A 2MKYA 2ZE2A 4DX6A 4YY3J 5F0UA 2HLUA 1AA1B 4DR3J 4HH1A 4NLYA 4OI2A 1RUSA 2P6TA 4ED2A 1P27B 2ZZNA 3FQLA 3R6LB 1FNMA 2R2UA 4URGA 1YDLA 4O4GB 5K8NA 3V4IB 2Q6BA 4PYDA 1X4FA 2KXNB 2K1RA 2KHCA 3KK1B 3CD7A 2W25A 1B7YB 4YN3B 3BREA 2HK3A 3MFHA 3DLLQ 1HQEA 2QMUB 2Z57B 4RW9B 5DG8A 4ZLJA 4H4MA 4ECVA 2MPUA 2BA9A 1SB6A 4ZMMA 1T03B 2MQOA 5C24B 2PDAA 4ILRA 3P5BP 1TKXA 4AL7A 2FJDB 3SSQA 4F0MA 5LMNF 2FC9A 1N56A 1KTVA 1V3SA 4L3NA 4USJC 2HBZB 3GQCA 4KH0B 5LT5A 4NCBA 1HNWJ 2M3DA 2AKWB 1RSCA 4ILMA 2OD4A 3MPDA 3R2DJ 1CC8A 1TELA 1PAEX 5B7WA 3EXCX 4JI4J 2D69A 2H5EA 2W2NP 3MMCB 1X9WA 4M5DA 2WHOA 4DL7A 4Y34A 3PW5A 1SQGA 2VICA 3DRYA 1KNZA 3CGIA 5IV3A 3ULHA 3C6TB 3M6XA 2X51A 4LT6A 2VB6A 1CPZA 2I0XA 2AZ1A 3D3CJ 4ZPWR 1YJVA 1HBNA 3CCJS 3JTOA 3JTPA 2BE2B 5G0RA 1FKPA 3C3LA 4DR4F 4D3HA 3HHDA 3GCWP 2FZCB 3DM2B 2BEFA 1FESA 1RDRA 4DBQA 2PFDA 1QVGR 2RQ4A 5J1EA 2Y1LB 1QUPA 2UXDF 3F44A 1RWWB 1TKTA 1OIAA 4EYIB 3PX0A 5ETMA 2GAHC 5J1NA 2DNKA 4QWCA 2M7SA 3KYLA 4Q5VA 1N32J 3QRRA 1W2IA 2FGOA 3KDOA 1X4EA 2JFKA 3B4MA 4EZ9A 4Q45A 3MURP 3JB9k 1HQ2A 1V5IB 1WF2A 4PQUB 3TA1A 5KG5A 4LSLA 1ZOTA 3H90A 2PIIA 2YNIB 3CSKA 4USVA 2CG4A 2ZOGA 5KFSA 1SC6A 1IVZA 4DZ6A 4QR0A 5HATA 4ZITA 1RGVA 1VQSA 5IWAJ 2W9CB 1IKXB 1BQMB 4YP3A 4EO6A 5IM0B 4J9LA 1WTFA 1KLMA 1R6VA 3HJVA 4QR1A 2D41A 1CJVA 1M5KC 3MR2A 1C0TA 5B0GA 4HKQA 3CW2C 2MTLA 3TZWA 1XMQJ 4DX8H 2B43A 4DV5F 4ZN1A 3JQJA 4K4XA 1SV5B 1YSJA 2VPWB 1KOOA 5GMEA
chains in the Genus database with same CATH topology
1RHUB 2H65B 2Y0BB 3R7BB 1RHRB 1RWXB 2HBZB 2CNOB 1NMEB 1BMQB 3GJTB 1RWPB 3D6MB 2QL9B 2HBRB 3EDQB 2CJYB 2QLJB 2H51B 1RHJB 1RWNB 2C2OB 2CNNB 2XYHB 5K20B 3SIPB 1IBCB 1QDUB 4ZVRB 3R6GB 5IC6B 4ZVQB 2XYGB 3GJRB 3P4UB 4ZVOB 2XYPB 2XZTB 2C1EB 3R7NB 2P2CB 2CNLB 3R6LB 4ZVSB 4JB8B 1RHMB 2H48B 1RHKB 1RWMB 2C2ZB 2H5JB 2C2MB 2CJXB 1I3OB 3KJFB 1I51B 2QLBB 2H5IB 2FQQB 2HBYB 4LSZB 5IC4B 1RHQB 2HBQB 3D6FB 3QNWB 4ZVUB 1RWKB 3R7SB 1RE1B 3RJMB 3NS7B 1RWOB 4ZVPB 2XZDB 2H54B 3KJNB 3IBFB 1GFWB 3KJQB 3P45B 1ICEB 3IBCB 4DCJB 1SC4B 4DCOB 3GJQB 3EDRB 2CDRB 1RWVB 2DKOB 2H4WB 2Y1LB 2QL5B 4DCPB 2QLFB 1SC1B 2QL7B 1PAUB 1F9EB 1SC3B 1RWWB 2CNKB 1QTNB 1PYOB 2C2KB 3GJSB 3D6HB 3R5JB 2H4YB 4ZVTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHU B;  2H65 B;  2Y0B B;  3R7B B;  1RHR B;  1RWX B;  2HBZ B;  2CNO B;  1NME B;  1BMQ B;  3GJT B;  1RWP B;  3D6M B;  2QL9 B;  2HBR B;  3EDQ B;  2CJY B;  2QLJ B;  2H51 B;  1RHJ B;  1RWN B;  2C2O B;  2CNN B;  2XYH B;  5K20 B;  3SIP B;  1IBC B;  1QDU B;  4ZVR B;  3R6G B;  5IC6 B;  4ZVQ B;  2XYG B;  3GJR B;  3P4U B;  4ZVO B;  2XYP B;  2XZT B;  2C1E B;  3R7N B;  2P2C B;  2CNL B;  3R6L B;  4ZVS B;  4JB8 B;  1RHM B;  2H48 B;  1RHK B;  1RWM B;  2C2Z B;  2H5J B;  2C2M B;  2CJX B;  1I3O B;  3KJF B;  1I51 B;  2QLB B;  2H5I B;  2FQQ B;  2HBY B;  4LSZ B;  5IC4 B;  1RHQ B;  2HBQ B;  3D6F B;  3QNW B;  4ZVU B;  1RWK B;  3R7S B;  1RE1 B;  3RJM B;  3NS7 B;  1RWO B;  4ZVP B;  2XZD B;  2H54 B;  3KJN B;  3IBF B;  1GFW B;  3KJQ B;  3P45 B;  1ICE B;  3IBC B;  4DCJ B;  1SC4 B;  4DCO B;  3GJQ B;  3EDR B;  2CDR B;  1RWV B;  2DKO B;  2H4W B;  2Y1L B;  2QL5 B;  4DCP B;  2QLF B;  1SC1 B;  2QL7 B;  1PAU B;  1F9E B;  1SC3 B;  1RWW B;  2CNK B;  1QTN B;  1PYO B;  2C2K B;  3GJS B;  3D6H B;  3R5J B;  2H4Y B;  4ZVT B; 
#chains in the Genus database with same CATH topology
 4ZHR A;  3DLE B;  1OPZ A;  2CQ2 A;  1UAW A;  3PG9 A;  4LR8 A;  1S0N A;  3DGV A;  3M05 A;  3OL7 A;  3HSD A;  2BAB A;  2BJD A;  2LMI A;  1WKK A;  3UCG A;  1NKE A;  1FFG B;  2MQQ A;  2HHX A;  3VAF A;  1FKP B;  3QZ7 A;  2VG6 A;  3FJ2 A;  4TYA A;  2J6T A;  3AH6 A;  1RYS A;  3MMJ A;  1W7W A;  2NPI A;  1RKI A;  3EE3 A;  4DLG A;  3VAH A;  2H5J B;  3CCZ A;  2RIJ A;  2MLZ A;  3CJ3 A;  3J7Y I;  2RS2 A;  1VQ4 S;  3OJU A;  4GC6 A;  4QIW D;  2BJ3 A;  3H42 A;  2R8G A;  4LF6 J;  2R3V A;  2NZ4 A;  2W2O P;  3KJQ B;  5A2Q U;  2CRL A;  2V4J A;  3A1Y G;  4FKY A;  4J9U E;  3OFF A;  2ZM6 J;  2EK6 A;  2EC0 A;  1Y9O A;  1HHS A;  4ZPA A;  3O3L A;  4HAC B;  1XR6 A;  3G96 A;  2DRD A;  3MUM P;  1UVN A;  3SSR A;  5KFJ A;  1PYO B;  1CUL B;  5ETV A;  3ZZY A;  4WJB A;  2WBM A;  4WU2 A;  4RNF A;  4DF8 A;  4P7V A;  2QGF B;  4ZVT B;  2RAQ A;  1R6Y A;  4P75 A;  3PX6 A;  2BAC A;  3SSS A;  4DV2 J;  1N36 F;  2DXE A;  2M88 A;  3C15 B;  3N5B A;  4OJG A;  4PXB A;  3L7O A;  4OX9 F;  1VCT A;  2ROP A;  4UOG A;  2FY1 A;  2LEP A;  4KKO B;  1S9G B;  1S1T A;  3K0J A;  1H2T Z;  2VFU A;  1IR2 A;  3T1Y J;  3M6W A;  2LEC A;  4AT1 B;  1RHM B;  4PXC A;  4DV3 J;  4ZS6 A;  2FQQ B;  3NNC A;  3QO9 A;  4NYP A;  3MPW A;  2ZDP A;  1R3N A;  3FUY A;  3Q2T C;  2CWX A;  2DRB A;  2XM3 A;  3IR7 B;  4YOE A;  1CJT A;  4RLE A;  4DWI A;  2Z2M A;  2AQ4 A;  1JWW A;  1R43 A;  3UPF A;  2MEW A;  4K4U A;  1U09 A;  3GV5 B;  2UXC F;  3GIL A;  5ETP A;  5I3P A;  5KFZ A;  5HVH A;  2YNG B;  2A6M A;  1PIL A;  2YY3 A;  3EPI A;  3BGL A;  1CVJ A;  5KFE A;  1YI2 S;  2DNH A;  4LF4 J;  4QIV A;  3NG8 A;  4ER8 A;  3MM5 B;  1YRU A;  5DO2 A;  2OO4 A;  4LSN B;  1OSD A;  3KXD A;  1JK9 B;  4RW4 A;  1VIS A;  1NJI T;  5GAG I;  4A47 A;  1BC6 A;  5DDQ C;  2CPZ A;  1IN0 A;  1HL6 A;  3OUY B;  2XMJ A;  4QIG A;  1FRJ A;  2CVE A;  1QSS A;  1V6H A;  5KFA A;  2Z30 B;  3OVA A;  3H40 A;  3ZTP A;  5KFH A;  3EX7 B;  3UW1 A;  2P9E A;  4F4X A;  3I0R A;  3HUL A;  3W60 A;  2M52 A;  4KHR A;  5JVH Q;  1U1N A;  1TKZ B;  1T0T V;  4YQW A;  4CZC A;  4N7T A;  2M70 A;  1IKV A;  1QJH A;  2ZBR A;  2CPF A;  1S48 A;  4KGX B;  4ZVH A;  5FDL B;  3DLG A;  3CCM S;  2HEK A;  1VR6 A;  2RUG A;  2MKS A;  3D2W A;  1SUQ A;  3IO1 A;  1E6Y A;  3RBD A;  1MN9 A;  2XHC A;  4NLD A;  3VQS A;  1HBU A;  2YQ3 A;  4AQY F;  3BEG B;  3TAR A;  4KT0 C;  4EYH B;  1BMQ B;  3ISN D;  1FK9 A;  3OXF A;  4X66 J;  1TZ0 A;  3W5Z A;  4ZPB A;  3V5R A;  4BLG A;  3TJ9 A;  4X64 J;  1TL4 A;  2KM8 C;  2HS0 A;  5F8L A;  3M32 B;  1N33 F;  2AP6 A;  1LWC B;  2J7W A;  2VA3 A;  1N34 J;  2OGU A;  2ADB A;  3R7N B;  4V19 J;  4A48 A;  1X4A A;  3M8Y A;  4WZM A;  2HZA A;  2WW4 A;  4KGK A;  4LF7 J;  2VG5 B;  1RWM B;  2D3U A;  3POT A;  4CO2 A;  1JLE B;  1QAI A;  4WK3 A;  1ROF A;  1AXQ A;  3EWG A;  5EWG A;  2W2M P;  3RAM A;  5FD1 A;  2AJF E;  3PZP A;  5IQ6 A;  3Q89 A;  4NCG A;  4DSF A;  5THW A;  2HND B;  1RWU A;  2MDA A;  4RW4 B;  4LMZ A;  5HQM A;  2ZEJ A;  3BPD A;  4B3M J;  4GKJ J;  3C66 A;  3PVX A;  3QRP A;  4LF5 F;  2IVF B;  1UL3 A;  2DGQ A;  4URS A;  4P9S A;  4IOC Q;  1N8R T;  3ET6 A;  4DV4 F;  3FVY A;  1FRH A;  3SEO A;  2SXL A;  5K14 A;  3SDE B;  2IM0 A;  3TVZ A;  3KLG A;  1FFS B;  2OEL A;  2FHJ A;  3RRK A;  3AJ1 A;  3DGP B;  1JLB A;  2QA4 G;  5DG7 A;  1WJ9 A;  2B51 A;  1FNX H;  5AT1 B;  1M5H A;  2HVI A;  4F36 A;  2GJF A;  1NK7 A;  1K73 T;  4C6A A;  1PJ7 A;  1WHX A;  3RGI A;  5E3C A;  4ECU A;  1X5P A;  1EX8 A;  1HHQ A;  2QTW A;  3GII A;  2KYZ A;  3SI8 A;  3BGO P;  4OMF G;  2LA6 A;  1TUW A;  1TL5 A;  1NK6 A;  5KFY A;  2DR7 A;  1E6Y B;  2QZ8 A;  2OPP A;  1U0S A;  5L39 A;  1EB0 A;  2XMU A;  3Q8Y A;  2DO0 A;  1ICE B;  4ELV A;  1TK5 A;  1F9F A;  3SCL E;  3W5X A;  5L8R C;  3IR6 B;  1WTB A;  3EVM A;  4C3M A;  4PR6 A;  5FJ4 A;  2GIR A;  2Z2Y B;  2ADC A;  4F2R A;  3I6P A;  1Q5Y A;  2AU0 A;  1T95 A;  4QU7 A;  4RO0 A;  1RZM A;  1N6Q A;  4CO0 A;  4YS2 A;  1SC3 B;  3AQP A;  5KFN A;  4PRF A;  4IH6 A;  2PI4 A;  2GVD A;  3CO0 P;  4OHY A;  2RRA A;  3H2V E;  1LWF B;  2XYH B;  5M2R A;  2QLX A;  1IBC B;  2NXN A;  4RUH A;  5U47 A;  1VFJ A;  4UOH A;  2J6S A;  1ZAW A;  5EX3 A;  4UTG A;  1TV6 A;  1U1L A;  1TK8 A;  3F41 A;  2HWH A;  2QSF A;  4OZ3 A;  2ZH2 A;  3VGU A;  4M63 A;  3TVK A;  2XY5 A;  1MSW D;  1WKL A;  2HIQ A;  4A4J A;  2B9W A;  2V2V A;  2MZS A;  1R31 A;  4YUD A;  3C16 A;  3QFH A;  3LAM A;  3CJS A;  3MM7 A;  2OMO A;  1JLA A;  4I2Q A;  5K14 B;  1VIO A;  5E5N A;  2N3O A;  4TYB A;  1AUS L;  2EW9 A;  3MMA B;  5KFX A;  1UWB A;  4RUA A;  1YJ9 S;  5CYQ B;  1V3Z A;  2ZBQ A;  4IH7 A;  4ATN A;  4GVB B;  4M5G A;  5GAD I;  1SBR A;  1U6Z A;  2HRU A;  4JI3 J;  3OVS A;  1ULR A;  1RWN B;  2CPH A;  4I6A A;  5CYJ A;  3O1L A;  3DRX A;  2OEJ A;  2OPQ B;  4W92 B;  4ED3 A;  2VQE F;  4WFN Q;  3BH7 B;  1B0V A;  2IVM A;  3D9B A;  3EVO A;  1UEK A;  2JDJ A;  5KFC A;  4PG4 A;  2FY8 A;  4DR1 J;  4FZV A;  4B9V A;  4S0M A;  1S5Z A;  5KFG A;  4EBE A;  3MEG B;  1DRZ A;  2RQC A;  3THT A;  2BW2 A;  2IMO A;  1CG2 A;  2B6A A;  1D8Y A;  2J8S A;  1KC8 T;  3LGH A;  3NGS A;  2CJA A;  4WKY A;  4K4Y A;  1S1X B;  2HW3 A;  3W9I A;  1RWV B;  3ZZT A;  2ZIT A;  3JAM Y;  2VBZ A;  4TVA B;  4NLO A;  4IRK A;  1X4D A;  2E1M C;  1X8D A;  1F9E B;  4CYU A;  4OYO A;  4LVN P;  2BV3 A;  2MJU A;  4YHH J;  2AF6 A;  2Y9H A;  2PMZ D;  1Y3J A;  2R7R A;  1TV6 B;  1D8Z A;  1XIQ A;  1DFD A;  2JEJ A;  3UDC A;  3ITH B;  2W9B A;  2KJW A;  5B0D A;  1VBZ A;  4CLF A;  2O1P A;  3G2X A;  1DJ0 A;  5DRK A;  4DPT A;  2ZH9 A;  4B9N A;  1RA6 A;  5IC6 B;  5JVG Q;  5DLG A;  2V5H G;  3CDU A;  1WC4 A;  4C9D A;  5D3G B;  3QIP B;  2QLW A;  4CT8 A;  2VD3 A;  2XNQ A;  1PJ6 A;  1Q78 A;  4OFZ A;  1BUX A;  2YTC A;  1LFW A;  4ICL A;  2KT2 A;  1BQX A;  3CMA S;  3QGI A;  2VON A;  1FRX A;  4OI3 A;  3D0I E;  3R5A A;  3AD9 C;  1C0U B;  2IA6 A;  2ZH6 A;  3M6V A;  4I4B A;  2XI2 A;  1DUR A;  4R5P A;  3P45 B;  1M1K T;  1M5S A;  2NR0 A;  3LO3 A;  1PCA A;  2Y8W A;  2F4V F;  1YBT A;  1N32 F;  2R2T A;  2FHM A;  1REV A;  4KE5 A;  5DDO C;  1HBO A;  4NZ6 A;  4O0N A;  3M1V B;  1W2B R;  4Y0F A;  3VAK A;  3BGR B;  3H5S A;  3D0H E;  4Q43 A;  3OR2 B;  3NOC A;  2OD6 A;  5C25 A;  2VBW A;  4RW8 B;  1OS5 A;  3UDE A;  3PW7 A;  1MW7 A;  4X65 J;  4C8M A;  4AUK A;  1S1U B;  3LP1 B;  1ARO P;  4HVZ A;  2N7C A;  1NKC A;  3TA2 A;  4OYX A;  2OFH X;  2RKI B;  4ZVF A;  1QY7 A;  2ZD1 A;  3BH6 B;  2N3L A;  2H48 B;  4YR0 A;  3VGV A;  5J2N A;  1R8B A;  2MZ1 A;  4XDD A;  2JSX A;  1UWA A;  1RT2 A;  3KK3 A;  3D6F B;  1KWM A;  3KJV A;  1WI6 A;  4J91 A;  2JLF A;  2G4B A;  3AHP A;  2M8D B;  5LMU J;  4YFU A;  2Y1R I;  4RBV A;  2P6S A;  3TA0 A;  3EDR B;  1FXD A;  1KR4 A;  1U2C A;  3I5A A;  1XER A;  1XMO J;  4B17 A;  2RML A;  4I0W A;  1SH2 A;  4JI0 F;  4Y2M A;  2PT0 A;  1T05 A;  3G6E S;  1VQO S;  1VGY A;  3ZXW A;  4QW9 A;  3TAN A;  4Q8E A;  3QRQ A;  3GFY A;  1RT3 B;  1DZ5 A;  3CCQ S;  3JTN A;  2Z2L A;  1NK8 A;  1JLQ B;  2J9D A;  3AAW B;  1FD2 A;  2F8E X;  1K9M T;  3IGN A;  4CDI A;  4WFY A;  3J81 U;  2C2Z B;  2X7I A;  2ZM6 F;  1HFE L;  3CCL S;  3HT3 A;  1LXJ A;  2B9Y A;  3L3C A;  3Q8Q B;  2QFI A;  3IG1 A;  4B3R F;  2WSF C;  2ZZM A;  3UE2 A;  2C2N A;  1F2G A;  1P9Y A;  4NRU A;  2ZFH A;  4ED6 A;  3IA0 A;  2KRR A;  1PYS B;  3ILJ A;  3PFE A;  4Z7C A;  4DV2 F;  2QMW A;  1UMJ A;  4DUT A;  5K8M A;  2VG7 B;  1LW0 A;  2G2Y A;  1MWY A;  4WFZ A;  3C8Y A;  2BKO A;  3BN7 A;  2L41 A;  1KVJ A;  3Q22 A;  8AT1 B;  2ZKT A;  1RYR A;  3VZH A;  1DTT A;  5I4M A;  3PIO Q;  3T1Y F;  1N5V A;  4X62 F;  4B9M A;  1FDD A;  3AD7 C;  3RBX A;  4DV3 F;  3AFG A;  4ITS A;  1X5T A;  4YDX A;  1HNX J;  1QAX A;  2J9D E;  3BBC A;  1AZS A;  4ZVR B;  4MK7 A;  2KXH A;  2ZHB A;  4IO1 A;  4G1Q B;  1HWU A;  3JSY A;  4P6Q A;  1H7W A;  2V2Q A;  2VFS A;  5B0C A;  4XDC A;  4JV0 A;  4CQ1 A;  2HHS A;  2K06 A;  2EFQ A;  4FYY B;  2VQF F;  2HBQ B;  3ENW A;  1REG X;  4JYA J;  2JVO A;  3T9N A;  2CKW A;  2V67 A;  2CJK A;  4K0K J;  5F9N A;  2JLE A;  4USU A;  1NSA A;  2KT3 A;  3NGK A;  3W7B A;  1GXL A;  1I94 J;  2CVI A;  3GPA A;  3QT7 A;  3UI3 A;  4Y28 C;  1H72 C;  2HFN A;  3FEX B;  3A3N B;  1YVF A;  1H74 A;  2KFY A;  4FS2 A;  1HW8 A;  3Q24 A;  1ACM B;  1VQN S;  4N5S A;  3GYG A;  1GXU A;  3N0V A;  2JJ4 D;  1X9M A;  1URN A;  2V4R A;  4UQT A;  1JJH A;  1C1C A;  1RHR B;  2UXB J;  1AFI A;  1U1K A;  2FHJ D;  4YB5 A;  4X4T A;  3BO2 A;  3ADA C;  1TL3 A;  1NPP A;  1JJ4 A;  3IAS 9;  2PI5 A;  2G1H A;  3LWM A;  5KOX A;  5KT3 A;  3T5H A;  3RRH A;  3TAM A;  1HMV B;  1LW0 B;  4A8K A;  2NRE A;  2C2E A;  2I2Y A;  4MKA A;  2FVC A;  3HK2 A;  1YLX A;  1EET A;  3CCW A;  3DNC A;  3NS7 B;  3M2R A;  4PAB A;  3K5P A;  1RKJ A;  4ES1 A;  1WKJ A;  2FJW A;  2DNG A;  4HT5 A;  2QL5 B;  1GX6 A;  4FXV A;  4XK8 C;  4OLO A;  1R0A A;  3U7J A;  4DV1 J;  3MDF A;  2HFO A;  2F4F A;  2VZ9 A;  2JH3 A;  2EG1 A;  2ILZ A;  4DFP A;  1IWG A;  3MCS A;  1IQZ A;  1X4C A;  2HGL A;  4WTO B;  2B5J A;  2MQN A;  4Y2A A;  3EMT A;  4DV0 F;  2UVW A;  4FNI A;  2EG2 A;  4QZV B;  2NPF A;  2XS5 A;  3UN2 A;  5A8R B;  1N48 A;  2W4D A;  3FZ2 A;  1JLF A;  1NK4 A;  3OLB A;  2ZH5 A;  4NZ7 A;  1UVK A;  3BSN A;  3VAI A;  3VAL A;  4EZ6 A;  4U9R A;  3ZTO A;  1OPI A;  2C42 A;  3KNG A;  2WW8 A;  1B64 A;  3FDS A;  1VLO A;  1NO8 A;  2HRT A;  3MEC B;  1ZH5 A;  4GKJ F;  3M30 A;  4XTT A;  4U7C A;  4BCA A;  4ZVP B;  4HYK A;  1S6Q B;  3PYE A;  4IOA Q;  2ZNY A;  4OYI A;  2P8I A;  4J9M A;  2CXE A;  3M2U A;  2MZR A;  3MF5 A;  2ZVI A;  1S4F A;  3PW2 A;  1O6X A;  4WU3 A;  3HMJ G;  1RTI B;  4BC7 A;  5HBM B;  3U1L A;  2M2B A;  3OTO F;  1HBM B;  2HNZ B;  3DXB A;  2J7K A;  2R8J A;  5KT5 A;  3RAX A;  4OYW A;  1BQN A;  3RRG A;  1QE1 B;  3ZZ0 A;  4FBT A;  4ECY A;  4UY8 5;  1SL0 A;  2ASL A;  4NA1 A;  2QL9 B;  2WON B;  3VVU A;  1RT4 A;  2AEJ A;  2ZOM A;  5DQI A;  3QGP A;  4FVM A;  2D9O A;  2IYI A;  1QLN A;  4NML A;  3D0G E;  3LGM A;  4IFV B;  2ZHA A;  1IKY A;  4NX9 A;  2IYG A;  6FD1 A;  4F02 A;  3OL9 A;  4B3O A;  1HNV A;  3NBP A;  4ZIW A;  5D4P A;  5HQL A;  2EC2 A;  3W8P A;  3THP A;  4JI1 F;  2O66 A;  5LL6 d;  3KLE B;  4DPY A;  2XSJ B;  3ELH A;  4OV1 A;  4X84 A;  5FLX U;  4UQG A;  3CDW A;  1SKU B;  5H9E K;  4DCP B;  4B9T A;  4I2P A;  3T1H J;  1Q7L B;  2E7X A;  4JV5 F;  4WXW A;  3KLF A;  4LF8 J;  2C2K B;  1E6V B;  2JFD A;  3D6H B;  2R7V A;  2BQ3 A;  2LQ9 A;  5ETL A;  1WEX A;  4DUY J;  4XAK A;  3E01 A;  5GAH I;  1WDD A;  3ZC4 A;  5KT2 A;  2WRM A;  1YK9 A;  2DGO A;  4USH A;  1F5A A;  3VVT A;  3GR1 A;  3TUP A;  2ZWP A;  2VBX A;  4G3I A;  2NS1 B;  2VF3 A;  3W2W B;  3MOZ A;  2RDJ A;  3I87 A;  4Z2X A;  3RBZ A;  2RVJ A;  2PD1 A;  1X0P A;  3N6N A;  3DOL B;  2RRB A;  1SJ1 A;  4LJM A;  1XNR J;  2XGP A;  4ZP6 A;  2XWX A;  4B08 A;  2PO4 A;  3I9Z A;  4RUC A;  4I69 A;  4O3Q A;  2GVZ A;  2MKH A;  2FJA B;  2UUA J;  3O6Q A;  5E3R A;  2XQC A;  4IFY A;  4RW7 A;  2YWG A;  3K58 A;  2XLI A;  2HGN A;  2KJV A;  4ZDN A;  1WNE A;  2ZNZ A;  1DQ8 A;  4PAA A;  1UA0 A;  3GU0 A;  3SYZ A;  3AXM A;  1WF1 A;  1IBK F;  2BJ7 A;  1RTH B;  4C0B A;  3AY0 A;  4USW A;  2XMA A;  4EBC A;  5A6W A;  4PQA A;  1G7C B;  1H2V Z;  4NLS A;  1T3O A;  3VF0 B;  2GO8 A;  4KHP F;  5HLF A;  3F73 A;  4C0O C;  4TU9 A;  1O0P A;  1B0P A;  4WP9 A;  3HSG A;  5K8P A;  2OLW A;  3D28 A;  4PG7 A;  1TFY A;  1UJ6 A;  3CC2 S;  3UR3 C;  3J7Z T;  2OIH A;  3JQK A;  3RZA A;  1NHV A;  2AWZ A;  3MPY A;  2PFF B;  2V0N A;  5IT0 A;  4YHH F;  3G82 A;  3F0N A;  3GV8 B;  3BDE A;  4DUZ J;  4HDG A;  3TAQ A;  4BHQ A;  3U1N A;  1X31 C;  2VFT A;  2GW8 A;  4ELT A;  2AX1 A;  2W8K A;  4W4M A;  3I96 A;  1LK7 A;  4PG5 A;  5ITH A;  2XZW A;  2KI2 A;  3C14 A;  1XQI A;  5EWE A;  1MML A;  2MKC A;  4GO7 X;  1TMJ A;  2C2D A;  2G0I A;  3M2V A;  2M4M A;  4DPW A;  1RAJ A;  4ZLP A;  3CJK B;  4UST A;  2CQ4 A;  1RT6 B;  2HG4 A;  5L1K A;  5L1I A;  4ED0 A;  1Q79 A;  4Y2I A;  2UUB J;  5AE2 A;  1S1W B;  4PYA A;  4Q7A A;  3HD1 A;  2N82 B;  2UV8 A;  3BKF A;  3W63 A;  1JXE A;  4KPC A;  2LLZ A;  3MM8 B;  2MQM A;  2GQC A;  1UTA A;  1S9E B;  3RTV A;  2WB4 A;  2GHW A;  1HNI B;  2DHH A;  1CJU B;  3MZI A;  3DRP B;  2AV5 A;  3FGV A;  2F65 A;  2DGV A;  1KTQ A;  2BYC A;  4OX8 A;  2R8I A;  3E3X A;  1SJF A;  1Y5I B;  3FCH A;  4Y3C A;  4B9U A;  4W90 B;  4C8Z A;  3US5 A;  2BR0 A;  3S01 A;  5A76 A;  4IDK A;  2O3D A;  4CH1 A;  1RHU B;  1FRM A;  3R7B B;  2QT7 A;  2DPJ A;  1B70 B;  4LIW A;  2CAD A;  1VIX A;  5E0O A;  2HHH J;  2J0W A;  1VQM S;  1TFW A;  1S97 A;  1U6F A;  2QLJ B;  4RX6 A;  3HVT A;  4RU9 A;  2C2O B;  2DGU A;  3GJR B;  4U7U D;  3NXZ A;  3VGT A;  4ZKA A;  2UVU A;  2X3D A;  2FC8 A;  1GQE A;  3N9U C;  3BGF A;  3ZZR A;  1KQG B;  4TKT A;  2DCL A;  3RAQ A;  1XMO F;  1WC1 A;  3GB0 A;  4LIR A;  4FYW B;  4CRJ A;  2DEJ A;  5D6G A;  3MR3 A;  4RBU A;  4NI2 A;  2DIS A;  1Q8K A;  2J9E A;  5A6P A;  2IC3 B;  2CA9 A;  2I5J B;  4R0J A;  3R5D A;  4Z7Y A;  4DV6 F;  1UJ4 A;  3TVY A;  4B9L A;  1TVR B;  3H2U B;  5IXU A;  3I9V 9;  3EGW B;  4WII A;  2UU9 J;  5HRO B;  4I7F B;  4DSK A;  4K4W A;  2Q79 A;  5L1L A;  2XLJ A;  4F4K A;  4IUF A;  5GAE U;  1DHM A;  1LKZ A;  3AJ2 A;  3FEY B;  2HLT A;  3MED A;  1UZD A;  4DZD A;  4N76 A;  2MZQ A;  4IQM A;  4LR7 A;  2A10 A;  4USK A;  2Z56 B;  3HFV A;  2W9A A;  1RHJ B;  3FBE A;  3FZB A;  1ZBT A;  1RTZ A;  3CE8 A;  2DD8 S;  3FKB A;  4PEO A;  2J6U A;  2DRA A;  4CCH A;  1VJQ A;  4N8N A;  3JSM A;  3FC9 A;  2XBP A;  3HT0 A;  2QV6 A;  5SZT A;  1RXO B;  1HI0 P;  1UP1 A;  2YPY A;  2V4Q A;  4CWB A;  2CQC A;  1HQU B;  4ZJO A;  4ERD A;  4NLQ A;  4P2M A;  4IDK B;  3M8P A;  4ZLL A;  2GGP B;  3W3S A;  1RT5 A;  3CCE S;  3NY0 A;  1YX2 A;  4DCO B;  5T41 A;  3H20 A;  2RU9 A;  1HNX F;  1FKO A;  3WX4 A;  4DR5 F;  1Y11 A;  3GSI A;  3OFG A;  2L08 A;  2F9J A;  3MD1 A;  2NZC A;  4JV1 A;  3MR6 A;  3DLK A;  4U7U K;  1FDB A;  5H9E J;  3NAI A;  3IGV A;  3CJQ A;  4FP9 A;  4QPX A;  3CCR S;  4FDF A;  2X1G A;  5C2G A;  4K0K F;  5T14 A;  1NDK A;  2W01 A;  2UUT A;  4DV7 J;  2KTQ A;  3GG0 A;  4J37 A;  2RDI A;  1J5E F;  4HTI A;  3AT1 B;  4JI8 F;  3MD3 A;  2MZJ A;  4ZIV A;  4O3N A;  2QLB B;  1U6B A;  1TKD A;  2Q66 A;  3K5O A;  4OX6 A;  2IRX A;  3IRX A;  4EMD A;  2I9S A;  3QYY A;  2GJ2 A;  1H73 A;  4J7C A;  3LP2 A;  5KFF A;  1DQ9 A;  2WVC A;  4O3R A;  2HSE B;  1VI7 A;  3JSB A;  5HAO A;  4OV6 A;  1R7I A;  1RAB B;  1SC1 B;  1L3U A;  3CDE A;  2BE9 B;  1VRT A;  3UD3 P;  1BWV A;  1OMS A;  1SXL A;  4NXM J;  5J1P A;  4J9S A;  2QYG A;  2DCU B;  1I6J A;  1QD1 A;  5KFP A;  3L7U A;  4JI6 J;  1EAY C;  1IM6 A;  4J9R A;  1A6L A;  2HPU A;  2VPX B;  3H25 A;  3PXG a;  4JI7 J;  1X7V A;  1N5T A;  1U47 A;  4OL8 A;  2YWW A;  3FSX A;  4B02 A;  1WG4 A;  3DRS A;  3QBC A;  1B4S A;  1EP4 B;  1RHK B;  2B4O A;  3HSZ A;  3MEE B;  2YKQ A;  4F67 A;  1FEE A;  1P1T A;  1NND A;  3NEK A;  5KT4 A;  3ETO A;  1Y0H A;  4I64 A;  3O2I A;  2DNQ A;  1FF2 A;  2OTJ S;  5H9F K;  3KOA A;  3EZU A;  3UVJ B;  5AXL A;  2HHW A;  2ZBP A;  2E66 A;  3K7R A;  4DQR A;  1Y5L B;  5BYS A;  5CAB A;  1C4C A;  3PW4 A;  3AOD A;  4IG0 B;  3VHQ A;  2QMX A;  4L3K A;  3AXK A;  4WE1 B;  5DM7 Q;  3SXL A;  1S1V A;  3CF5 Q;  3PYD A;  4GKK J;  4M5N A;  2HNY A;  1TUV A;  1PSD A;  2PMW A;  2GA7 A;  1Q53 A;  3DMJ B;  1DTQ B;  5JXS A;  1X0F A;  2YKM A;  2MMY A;  3OHB A;  4RL1 A;  3V81 A;  1H3D A;  3VAJ A;  3UCU P;  2JNJ A;  4KH1 B;  4PWD B;  1UW9 A;  1VC6 A;  3CT9 A;  2YNF A;  1TAU A;  6FDR A;  2BX6 A;  2VKZ G;  4DF4 A;  4V19 X;  1G3O A;  4KV8 A;  3AQO A;  1SVD A;  3RW6 A;  1YZ7 A;  2HMI A;  1IM4 A;  1RTJ A;  4OYB A;  3ISZ A;  3KHG A;  3HHL A;  2PMH A;  2BM1 A;  2Y0S D;  4JI5 J;  2HHU A;  4OHV A;  3PV8 A;  4IG3 B;  3KMQ A;  4X2B A;  2CDQ A;  2EBG A;  3KLV A;  4IO9 Q;  3T3F A;  4F3M A;  2GNK A;  1OY9 A;  1RTD A;  2DR9 A;  1G4C A;  2RHQ B;  3IS9 A;  4LFA J;  2AW0 A;  1TL7 A;  3CUL A;  1FE0 A;  2DO4 A;  3QPI A;  4CO3 A;  5KFL A;  1NKB A;  5KAK A;  2MHN A;  1AB8 A;  3KLI A;  5M2U A;  2C2R A;  2PEH A;  2K3I A;  3KUH A;  2WK4 A;  3MM9 B;  3UQS A;  3NL0 A;  3HI9 A;  3LTO A;  4PZV A;  4O4G A;  2Z2Z A;  3OFH A;  3V4I A;  4OZN A;  4QW8 A;  3T1H F;  1VS3 A;  4M8L A;  2ZOF A;  2CFX A;  3KK1 A;  1JMT A;  1MG7 A;  1RAG B;  4LF9 J;  2GJI A;  2OEK A;  4K59 A;  1CJK B;  1QAY A;  1HPZ B;  4RW9 A;  2EFP A;  3RB6 A;  4KB7 A;  2VH7 A;  1T3N A;  4F26 A;  5LM7 E;  3ISN C;  5IT4 A;  2RE1 A;  4FPR A;  5I42 B;  1T03 A;  4D3G A;  2CPY A;  4J90 A;  2UVR A;  2NCK L;  5C24 A;  1S6P B;  2F7V A;  4CH0 S;  4F0K A;  1A7G E;  1U8W A;  2DXD A;  2BJ8 A;  2YNF B;  3WHI A;  4MYU A;  1OJ4 A;  1T7P A;  3S6E A;  3G6X A;  4DR6 F;  4LUB A;  3Q86 A;  2MKJ A;  3OTE A;  2VKR A;  1BXN A;  4MJK A;  2YXL A;  1YTY A;  2HFS A;  3CD0 A;  2D9P A;  2YPZ A;  2E5L F;  5CCL A;  2P9G A;  2J8A A;  3OBI A;  3MMC A;  4JB8 B;  3KHR A;  2PE8 A;  1JLC B;  4ZPT R;  3W1Y C;  5IQQ A;  2E29 A;  3C6T A;  4JOU A;  3G8Q A;  4LRC A;  2LQ5 A;  1MU2 B;  1GMV A;  3L9Z A;  2BE2 A;  3QLH B;  4WTY A;  4WP8 A;  3DM2 A;  3DOM B;  2WAQ D;  2ILY A;  2AT1 B;  2FLO A;  3L95 X;  1XR5 A;  3M8R A;  2IDL A;  3SQG B;  4ED5 A;  1Y10 A;  4NRT A;  4XPC A;  5KG6 A;  1T9Y A;  4N8O A;  3NLC A;  3O5T B;  3KLI B;  2HFU A;  3CUN A;  2X3G A;  1WHV A;  3PO5 A;  5HO4 A;  4E0D A;  2DGS A;  3PDN A;  3R97 A;  4LFC F;  1NB2 A;  4O23 A;  2YX7 A;  4TY8 B;  4ZA1 A;  4M5M A;  3P4U B;  2HKE A;  1U26 A;  2BMB A;  1FCA A;  1VQ6 S;  4MK9 A;  2DGW A;  3ZZZ A;  1X60 A;  2J76 E;  5A0Y B;  4PQU A;  1NUE A;  1QVF R;  1Q8L A;  1VDH A;  2YBV A;  2FLL A;  5KG0 A;  2GX8 A;  4A8Q A;  2EWH A;  4LF2 A;  2YNI A;  1YJW S;  2MQ8 A;  2UUC J;  2J9C A;  2VIH A;  1U1P A;  3KMS A;  3MCN A;  1T9V A;  1UFW A;  5GMD A;  1GT8 A;  2W9C A;  5MAO A;  4P73 A;  2JVR A;  3MPV A;  1IKX A;  1BQM A;  3MPU B;  4DL4 A;  5IM0 A;  1U45 A;  3HKZ D;  4ZPD A;  3K2Y A;  3TOQ A;  1IR0 A;  1SIZ A;  1FWP A;  1XNQ J;  4EK2 A;  5F9L A;  3M8Q B;  2POK A;  4I6Y A;  2ZWO A;  4FXD A;  1H0H B;  2UUW A;  2ZH7 A;  1RAH B;  3AD8 C;  2H65 B;  2WVD A;  1SV5 A;  1P6T A;  1WOS A;  1Q95 G;  3MTJ A;  4DDF A;  2XY6 A;  3DLE A;  3RG6 A;  1J2V A;  4KFB B;  4OLP A;  1LV5 A;  1UCN A;  3BYP A;  1NDL A;  1K47 A;  1HA1 A;  2HHP A;  2JX2 A;  3CVK A;  3TW0 A;  1U1O A;  2W4P A;  4LQ9 A;  5HN0 A;  2DGT A;  4BWM A;  2EKY A;  3S8S A;  2HQD A;  5LSR A;  1FD8 A;  5IOL A;  2EVZ A;  1TL1 B;  2IPO B;  1JJC B;  4DS5 A;  1GXT A;  3JYT B;  5F41 A;  3GIK A;  1IBL F;  1UFL A;  3L4B C;  5D78 A;  1OWX A;  2WB1 D;  3PR5 B;  2AGO A;  4OHX A;  5JUM A;  4ELU A;  3MAA B;  2HQG A;  1RAO A;  2L48 A;  4CLT A;  4I68 A;  1S76 D;  1HR0 F;  2HHH F;  1SJ3 P;  2LA4 A;  3CJR A;  3MWB A;  2RQM A;  3K5M A;  4DR2 F;  2ACM A;  3WIV A;  3FEZ A;  5J2M B;  1MLA A;  1Q7Y T;  5H9F J;  1FRI A;  4HAC A;  3SBM A;  4OJ3 A;  2KYX A;  1CUL A;  1V5V A;  4NWB A;  3NCQ A;  3LPE A;  2CJY B;  2YX4 A;  3LWL A;  3C15 A;  1TK0 A;  3PEJ A;  3EVW A;  4E98 A;  3C2P A;  1YIJ S;  2R7U A;  3DOK B;  2J0S D;  3H4D A;  1S7I A;  3FFI B;  1XK8 A;  3NWG A;  4NYO A;  4KKO A;  1S9G A;  3CB4 A;  4WK1 A;  3ZTQ A;  1VYA A;  1VBX A;  2CJX B;  4XO0 A;  3KJF B;  4CLP A;  3CIM A;  2GML A;  3TAP A;  3IAM 9;  2F63 A;  2CQ0 A;  5LMN J;  3A8E A;  2XS2 A;  1VK8 A;  4F4Z A;  3A3P B;  3OXL A;  2J0Q D;  1NZ8 A;  1ZPW X;  1IKW B;  1KON A;  1NJY A;  2AYG A;  3CME S;  1Z2Z A;  2V8P A;  2UP1 A;  4UF4 A;  5KFW A;  2E1R A;  1UVL A;  2FJV A;  4CT9 A;  1KN6 A;  4ECS A;  2KT5 A;  4F4A A;  4TU8 A;  3AB4 B;  2YNG A;  1VLY A;  4C0H A;  1OQ3 A;  4M5L A;  3QT8 A;  4ZK7 M;  3J7A 1;  5L38 A;  3BDP A;  3NOG A;  3D6M B;  3PW0 A;  3KK2 B;  3MM5 A;  4QYR A;  1JQG A;  4DMZ A;  2ATL A;  4LSN A;  5K20 B;  2VC1 A;  3TZY A;  4K4Z A;  3HVR A;  2BQR A;  4DR4 J;  3L09 A;  5DLF A;  4KO0 B;  1FRK A;  4FKX A;  2A2D A;  3OUY A;  4C8K A;  2NQP A;  1FVS A;  2LP4 A;  2DNN A;  1VQ8 S;  1WWH A;  1N5Y B;  3FBC A;  4K4T A;  4FF1 A;  3FRY A;  3G9C A;  3BPS P;  2UXD J;  2DNL A;  1LWE B;  4KJI A;  1L3V A;  4IH5 A;  4J9P A;  1DLO B;  1TKZ A;  5E2Q A;  1T8E A;  1OO0 B;  4Q0B B;  5FDL A;  1GTE A;  1ELO A;  4J9Q A;  2MST A;  2QSW A;  1F9H A;  4P2F A;  4ZJQ A;  3QT6 A;  3EYZ A;  5KTQ A;  2MJN A;  1J5O B;  2GMJ A;  2CNO B;  2D3Z A;  2AYB A;  4MIW A;  4HR2 A;  3Q8R B;  2ROE A;  4CTA B;  2RD5 C;  2LU2 A;  3FSI A;  1D09 B;  2G9O A;  2B9E A;  1Q16 B;  4OZ0 A;  3MMB B;  2XYP B;  3KFW X;  3M32 A;  5JJB A;  3DLH A;  1LWC A;  4DI6 A;  3MM6 B;  4KHM A;  1NB7 A;  4X4V A;  3VAM A;  3V6J A;  3TWZ A;  1RT1 B;  1RCO B;  1IBM F;  2OPR B;  5F8M A;  2A1B A;  2VG5 A;  3ILO A;  4DV5 J;  4QWA A;  4ECZ A;  1JLE A;  3V2U C;  2ZH4 A;  3I4P A;  4NXM F;  2H54 B;  3SV4 A;  5KFV A;  4DS4 A;  5DDP C;  1FX2 A;  4QWD A;  4WPA A;  1YG0 A;  4A8O A;  5KG3 A;  3CMQ A;  3OT9 A;  2HND A;  2FJE B;  2YKN B;  3AOA A;  1D0E A;  4B3T F;  2DIV A;  3LGN A;  2V2Z A;  3RU0 A;  5KG4 A;  4DR7 F;  3MR7 A;  2OKQ A;  1F5C A;  2YWK A;  2LVW A;  3THV A;  2XHW A;  3DRR B;  1S49 A;  3HKW A;  2QRR A;  2YH1 A;  2VPY B;  2KVI A;  3SDE A;  5J2P B;  3DI6 B;  5L9X A;  3DGP A;  4FF2 A;  1C1B B;  3PTW A;  4C8L A;  3V6D B;  3G86 A;  2HYI B;  5KFI A;  3HFK A;  1VC5 A;  2GHV C;  1XTZ A;  2ZDO A;  2K7K A;  3B54 A;  1ZAX A;  4F0H A;  3UNG C;  2ASJ A;  1BWE A;  2CQD A;  2B4V A;  2LYV A;  5KFB A;  1ZM4 A;  5DGB A;  5LOQ A;  3T6B A;  2JLG A;  2I6W A;  2ZKU A;  4OX9 J;  2LQ8 A;  4DCJ B;  2OSR A;  3FMB A;  5AE1 A;  3K17 A;  5H1S V;  4YB1 P;  1N52 B;  4R8U B;  5EDW A;  2Q43 A;  4GVL A;  2NYH A;  4OIX A;  3GG1 A;  2I8E A;  1FXL A;  2GMH A;  2DT9 A;  4DFK A;  1RLD A;  2U2F A;  2Y0B B;  2B3T B;  5LXY A;  2OI2 A;  5AXM A;  4ZCM A;  3KUG A;  3TNV A;  4N41 A;  3CC7 S;  3DLJ A;  5DZ6 A;  3Q2S C;  1PO6 A;  1LWF A;  1ZM2 A;  1M1G A;  3WIU A;  3QGG A;  1GMW D;  5D0H A;  5KFK A;  2XMV A;  2MGZ B;  2XMK A;  4DU8 A;  1U0H B;  3K8W A;  2CQ3 A;  1FFW B;  2IAJ B;  1JB0 C;  5DGA A;  2JEF A;  3NRB A;  3Q23 A;  2C3O A;  4YDD B;  2DH8 A;  2L9W A;  3QAE A;  2YKP A;  5C42 B;  2XMW A;  1GFW B;  4Q44 A;  1UET A;  3MTK A;  3MUT P;  3EGV A;  3CO9 A;  1BGX T;  3FRZ A;  1NM2 A;  4J9V A;  2ZJR Q;  3MGJ A;  3BN4 A;  1LWX A;  1EHW A;  3IWX A;  3BO3 A;  1HD0 A;  5KFM A;  2E7V A;  3MMA A;  3OHA A;  5T7L B;  2YWE A;  5CYQ A;  3MI7 X;  3KLH B;  4DFJ A;  4ID5 B;  3I5B A;  1WEY A;  4A46 A;  2YQ1 A;  5CHC B;  4GVB A;  1S79 A;  2FJX A;  5ETR A;  1BE4 A;  2CNN B;  1QDU B;  4EU0 A;  3PR4 A;  3R6G B;  4ILL A;  2ASY A;  3J80 Y;  1FEH A;  8ATC B;  2YNH B;  1RA7 A;  5BYQ A;  2OPQ A;  1T9W A;  1HYS B;  4ED7 A;  1NPK A;  2AZ3 A;  3KKF A;  2JHE A;  4KC5 A;  2KG1 A;  4ZVU B;  1AW0 A;  2RF2 B;  3LP0 B;  4UT4 A;  1SH0 A;  4MYT A;  2A0F B;  4ANC A;  2W4C A;  4A8S A;  1ZAV A;  5B0F A;  2AJ2 A;  5IZH A;  4F25 A;  3D1Q A;  4AQY J;  3MEG A;  3R1L A;  2BJE A;  1FJG J;  2DNZ A;  2BOP A;  3UO0 A;  1LW2 B;  2ZJQ Q;  1Q1K A;  2EBE A;  2YH0 A;  4LBI A;  1SIW B;  5IS2 A;  3VQT A;  1B0T A;  1N33 J;  1HI8 A;  1S1X A;  1KHV A;  5EHH A;  2BAN B;  4CNZ A;  3KNA A;  2NXU A;  4RNO A;  5B09 A;  2R7T A;  2FIU A;  3GFX A;  4OJH A;  3J7A N;  3ENV A;  1CC7 A;  2VJU A;  3AOB A;  4JUZ A;  1WI8 A;  4HL9 A;  3ITH A;  2DIU A;  1F6T A;  1PC4 A;  4AL5 A;  1W26 A;  2NSB A;  2WOM B;  2G2Z A;  5I3U B;  4PUO B;  1VQY A;  4QPT A;  2KKH A;  2AJ0 A;  4ES3 A;  1ZS6 A;  3FK4 A;  4NAS A;  5D3G A;  2LDI A;  3QIP A;  3DU5 A;  5CA5 A;  2D3O 1;  2W1B A;  4JI2 J;  2MLX A;  3C6U B;  3DXS X;  4E8U A;  3ZNU A;  3W65 A;  1NRK A;  4LF5 J;  2GS8 A;  1KKH A;  1C0U A;  4ZLN A;  3RW7 A;  4IOB A;  1EIY B;  3N4W A;  1VRU B;  4DV4 J;  2BE7 D;  3JSR A;  4YY3 F;  1NCL A;  3NGR A;  4DR3 F;  1JKH B;  1N88 A;  3IBC B;  4RJV A;  2V94 A;  2F5G A;  2Y8Y A;  3DYA B;  1KSP A;  2XEX A;  1P9Q C;  3VAG A;  3TEG A;  2ZH1 A;  1EQ0 A;  1T11 A;  3UWT A;  4M1K A;  2JC1 A;  3M1V A;  1QTN B;  3GON A;  3Q8U A;  4ZN3 A;  4OQJ A;  4DQI A;  3U1M A;  3BGR A;  4RBT A;  4NE9 C;  3ZZP A;  2F8H A;  4EFA C;  3HM9 A;  3OR2 A;  3UDL A;  2R9L A;  2B4U A;  1S99 A;  5DS7 A;  4RW8 A;  3TEH B;  2UUC F;  3I56 S;  3OQ2 A;  3OR1 B;  3W5Y A;  2QJ3 A;  1S1U A;  3LP1 A;  4BC9 A;  5HMX A;  4HHH A;  5HI7 A;  5GVQ A;  1NDC A;  2IRU A;  2HFV A;  2RKI A;  1I3O B;  4ECX A;  3GCX P;  1HNW F;  4DG1 B;  2G2O A;  1MNE A;  1JLG B;  2WSE C;  1YBU A;  2WBR A;  3R7S B;  2J0X A;  1FDA A;  1WDT A;  1Q8I A;  3SCI E;  2RJZ A;  5F3Z A;  3RUB L;  4U6P A;  2W7P A;  4JI4 F;  2B8P A;  4MAK A;  3B78 A;  2MQL A;  4QCL A;  2MY7 A;  2DPI A;  4OYA A;  4W98 A;  2EKN A;  3P96 A;  4DU7 A;  9ATC B;  1XR7 A;  3I0S B;  1MMN A;  1VK3 A;  2JL9 A;  1VJW A;  5ETQ A;  4H4K A;  2V68 A;  4AD6 A;  5DET A;  2N4C A;  3W2V B;  2CAJ A;  1S57 A;  2QO3 A;  3RYL A;  3IM9 A;  2FVP A;  4H4O B;  4MKV A;  1RB0 A;  4B3S J;  2RNE A;  3BQ2 A;  1RAF B;  4DX7 A;  3R5G A;  4LFB J;  5J2Q B;  3TI0 A;  2XI3 A;  5KFD A;  3HHE A;  3KDN A;  3B8H A;  1NDP A;  1PG5 B;  3QWU A;  4ED1 A;  1RT3 A;  3T9Z A;  5E3P A;  1SKR A;  3ZZU A;  2MLY A;  1JLQ A;  2IVY A;  2PA3 A;  1S72 S;  1W25 A;  1EKS A;  4MFB B;  3BBF A;  1VHI A;  3SQO P;  1I51 B;  4KRW A;  4EWT A;  4N56 A;  4YEA A;  5E3A A;  4PG8 A;  2OEM A;  3MEK A;  5IV4 A;  4C11 B;  2RUS A;  2MQP A;  2W2P P;  2UVV A;  1O5J A;  5KFU A;  4USM A;  2VC0 A;  4NLX A;  3JXO A;  1S6O A;  2QA1 A;  2E5G A;  4UY8 T;  2OPS B;  2VG7 A;  3M9M B;  3K5N A;  1HI1 A;  3GSD A;  4KAI A;  2XNR A;  4GO5 X;  5IWA F;  2VQE J;  4RNN A;  1WOO A;  4DOZ A;  1M1H A;  3GP9 A;  2X1B A;  4L76 A;  1CS4 B;  2DHG A;  4QIF A;  1OSC A;  2YKO A;  1NU4 A;  1HAR A;  1XMQ F;  1X5O A;  4MK8 A;  3D67 A;  1WHY A;  4CNY A;  4UOC A;  3QSI A;  3BQ1 A;  3H98 A;  4G1Q A;  3SFG A;  1NHK L;  3UFC X;  2KHD A;  2E5H A;  5EX0 A;  2NUU G;  2NYI A;  2MYF A;  1LOU A;  3DHW C;  4O44 B;  3BYR A;  3U02 A;  4CLY A;  1CEZ A;  5F8H A;  2Q1L A;  3EZO A;  1MRO B;  1RT7 B;  2XZD B;  2DK2 A;  2FUG 9;  2F8M A;  2LCW A;  4LRE A;  4HH0 A;  1U8S A;  4WF9 Q;  3LAK A;  2CDR B;  4P52 A;  3PEH A;  2FTR A;  4ECR A;  3M8W A;  3LF0 A;  2HGM A;  4U96 A;  3IN5 A;  3CJ2 A;  1LQ9 A;  1KRP A;  2VOD A;  1UPM B;  3ICL A;  4NYZ A;  4LF6 F;  4DPU A;  2HQI A;  4QJV A;  2Y3Y A;  2ZE2 B;  3MXH P;  1RK8 A;  1SI9 A;  2CPD A;  2XG8 A;  4FBU A;  3GV7 B;  2IJR A;  2R7O A;  4PWW A;  2FDN A;  5D0G A;  2I1R A;  2F4V J;  3UN5 A;  3Q8P B;  3ETM A;  3GZ7 A;  2K1R B;  3NGD A;  1Q81 T;  1Z1Z A;  2IM2 A;  3CD5 A;  1VQ5 S;  2O01 C;  4KGM A;  4J9O A;  1HMV A;  3X1L B;  1MMD A;  1T94 A;  3TJ8 A;  1HQE B;  1OY8 A;  1EJ7 L;  5IFM A;  2RIL A;  3JQM A;  5D4L A;  5HL7 Q;  2AX0 A;  2ZUG A;  3DFE A;  2AEF A;  3PRV A;  2FPH X;  4H4M B;  2DVI A;  2QA2 A;  1X4H A;  3IBW A;  3GIR A;  1Q0N A;  4RKU C;  3LPY A;  2W7A A;  4LRF A;  1R8C A;  4QOT A;  2AYE A;  2H4W B;  3EJM A;  1N0U A;  1TKX B;  1XJW B;  3MAH A;  5B0A A;  5DG9 A;  2E1C A;  4WBF A;  9RUB A;  4KTQ A;  1CQM A;  1NPR A;  2HS4 A;  4BWJ A;  2C22 A;  2OH2 A;  1YRX A;  2HHQ A;  2L3M A;  1TQL A;  2BRL A;  2CUY A;  4HI2 A;  4PXE A;  4M5D B;  2ZBI A;  1P8G A;  2BRK A;  5A8R A;  4C98 A;  2PN6 A;  4PPD A;  2E5I A;  4WWS A;  4ETX A;  2OML A;  3HJF A;  4LF4 F;  2XCA A;  2HK2 A;  1KS2 A;  4MKB A;  1HBN B;  2ZUA A;  1U1R A;  4GC7 A;  4JI0 J;  3T6J A;  1OQ6 A;  5G0R B;  3OVB A;  3TX8 A;  3MEC A;  2MZT A;  4NOH A;  3O8W A;  4OZ1 A;  3V4M A;  2ROG A;  4FNH A;  2X1A A;  3UCZ P;  4LRA A;  1S6Q A;  5J1E B;  1J27 A;  4C3L A;  2FHO B;  1SC4 B;  3W64 A;  4ANE A;  3EGN A;  3SMZ A;  5BR8 J;  3EUN A;  3HD2 A;  1VBY A;  2KVQ E;  2W2Q P;  1TKT B;  1RTI A;  5HBM A;  3CPW R;  1HNZ J;  3HHL C;  1HBM A;  3WC0 A;  2HNZ A;  3J81 Y;  2LU1 A;  3Q8V A;  4PXD A;  3VTI A;  2YWH A;  1VBK A;  4K2X A;  1SL2 A;  4A8F A;  2CJB A;  4A8X A;  1QE1 A;  4B9S A;  4B3R J;  4ZCL A;  2WON A;  2ZH8 A;  5D0E A;  4LSL B;  3OV7 A;  1ZTT A;  3M8Z A;  4DN0 A;  2YVS A;  3IRW P;  5K8O A;  1RIS A;  4ID8 A;  4WZQ A;  1DBD A;  1WC5 A;  2V9K A;  3NNH A;  2Z8Q A;  4IKA A;  5AXK A;  2KRB A;  1HD1 A;  4ALZ A;  2GFF A;  5HJY A;  1A9N B;  1SCJ B;  4U8V A;  4HI1 A;  4IFV A;  4X66 F;  3CD6 S;  4AL6 A;  4X64 F;  1KLM B;  1K1S A;  3GIJ A;  4LF1 A;  3ENQ A;  4DSE A;  4X62 J;  4CLW A;  1N34 F;  4KPY A;  1YJ7 A;  1CJV B;  2B4P A;  1C0T B;  5HJX A;  1LEO A;  3KLE A;  1FXR A;  2XSJ A;  4ZPC A;  4X4O A;  4GMK A;  2PEB A;  4LF7 F;  3HF5 A;  2QX0 A;  2BXJ A;  4WYL A;  2LXU A;  3OJS A;  2EK1 A;  4ZHR B;  1D1U A;  4YR2 A;  3C46 A;  2BOA A;  1M0S A;  1E6V A;  1B3T A;  2ZH3 A;  4G65 A;  1F3F A;  2VQF J;  1L3T A;  2OTL S;  2FVS A;  1VQK S;  2EFV A;  1TP7 A;  2XYG B;  2VG6 B;  1FI4 A;  4B3M F;  1N5S A;  1S7H A;  2IDE A;  4RU2 A;  3NMR A;  4L75 A;  5EN1 A;  3UN3 A;  5K9F A;  2VDH A;  4QWE A;  5B0E A;  3W2W A;  5IC4 B;  5IT9 Y;  3MOJ B;  4HHU A;  4RR5 A;  2CPJ A;  1GTH A;  2M5Y A;  1R27 B;  1HWI A;  4URQ U;  3DOL A;  4F4Y A;  3QQC D;  5ADZ A;  2C28 A;  4OHW A;  5HVF A;  1IQT A;  1Y4Z B;  2V4J B;  1VMB A;  4PWU A;  3OL8 A;  1I1G A;  2YX1 A;  3PCO B;  4ZOS A;  3AA8 A;  3QJJ A;  4BDP A;  4IRD A;  1DY3 A;  1AYE A;  1PGZ A;  3DDI A;  4P72 A;  2BW7 A;  4WYW A;  3HO1 A;  3S1T A;  4PPZ A;  5F3T A;  2R2S A;  3J80 U;  4RNH A;  2VUG A;  1PC5 A;  1RAE B;  2W8L A;  3NCP A;  1H7X A;  3EXY A;  2N7Y A;  1FER A;  3SZ2 A;  1RTH A;  1G1X A;  3CJ8 A;  1RU2 A;  2A2C A;  3H8Y A;  1R0C B;  3R5C A;  3BF4 A;  2VJV A;  2E1P A;  4AXJ A;  5CYM A;  1SJ4 P;  4I1T A;  1S1T B;  4Y6I A;  3R8Y A;  1KP6 A;  4LVO P;  3D1O A;  4QIE A;  4I56 A;  2HUR A;  2AJ1 A;  1FJG F;  2CPE A;  3FCW A;  3HXM A;  4TU7 A;  2PC6 A;  3QO9 B;  5HP1 A;  1RP5 A;  2FLN A;  3AJD A;  2O67 A;  5GAE I;  3F56 A;  3ZZO A;  1CJT B;  4ETZ A;  3N79 A;  2E44 A;  4DPO A;  4EBD A;  5CD4 H;  4FVC A;  5CAA A;  2C3P A;  3PRD A;  3MHY A;  2CPX A;  3A8I A;  4Y00 A;  2HIY A;  4DV0 J;  2XGQ A;  1V9O A;  1FNO A;  1N54 B;  3TX0 A;  3ONQ A;  2APO A;  5EWF A;  1KD1 T;  3G8S A;  1ZET A;  1WG5 A;  1UKU A;  3ZTR A;  3TQ1 A;  3GR0 A;  1KFD A;  3OD2 A;  5K5M A;  3PRB A;  5MLC V;  4JI2 F;  3EPG A;  2L9D A;  2ALZ A;  4AFF A;  3TYT A;  2OFG X;  1FWK A;  3D54 A;  1A0O B;  4C7Q A;  3CXC R;  3CJK A;  2Z4P A;  3E8O A;  4ZVO B;  1RT6 A;  3TJA A;  2VL1 A;  2B8Q A;  4UW2 A;  1NEE A;  2UV8 G;  4XPE A;  1S1W A;  3I0R B;  4JI3 F;  3U27 A;  3OTO J;  1KLN A;  4CLL A;  4WFB Q;  1AT1 B;  2HVE A;  1DAX A;  3PHE A;  1PBU A;  1R89 A;  2VA2 A;  2AJQ A;  3UNY A;  2G13 A;  2BJ9 A;  1RJJ A;  1SJQ A;  1IKV B;  3MM8 A;  2K7J A;  1S9E A;  2X1F A;  1UFK A;  2H9Z A;  2CQH A;  2R8H A;  3DLG B;  2D74 B;  1HNI A;  1CJU A;  3HX9 A;  3DRP A;  3BM7 A;  3OLA A;  2DH7 A;  4LRD A;  2DKO B;  2HQC A;  1SUQ B;  1Y00 A;  1NLK L;  4K8R A;  5CYM B;  4DR1 F;  4N77 A;  3H5U A;  2ZC4 A;  3NGT A;  3PJW A;  3J7Y U;  1HBU B;  1KHW A;  2VOP A;  1FK9 B;  5AXN A;  2DR6 A;  3CIZ A;  2RDD A;  2JZ5 A;  2LQB A;  5HP1 B;  5F8G A;  3D68 A;  3GWC A;  2DR5 A;  3JAM U;  4JI1 J;  2MY8 A;  1L3S A;  3DC2 A;  1WHW A;  4DJB A;  1K0V A;  2WVB A;  2C3M A;  5FLX Y;  1URR A;  3POT B;  3BO4 A;  4WFA Q;  2V69 A;  4X4R A;  4HEA 9;  5EUH A;  1FJ7 A;  4G1I A;  4HTJ A;  4JV5 J;  2G0J A;  3FMW A;  4NXN J;  2ASD A;  4M95 A;  1F60 B;  1F1B B;  2V2K A;  3M7V A;  1UVJ A;  2BKP A;  2CQB A;  1S0V A;  4NCG B;  1JX4 A;  2V8G A;  2Z58 B;  4B3S F;  2IC3 A;  4FS1 A;  2I5J A;  2FB0 A;  4LFB F;  3H0P A;  3MFI A;  2ZVS A;  1TTH B;  1UEV A;  3Q0A A;  3OSP A;  2LEB A;  1TVR A;  1X4B A;  2XCP A;  3I82 A;  5HRO A;  2KH9 A;  4I7F A;  3ET6 B;  2LDY A;  3CDB A;  3P49 B;  1NH8 A;  4M5J A;  5HMY A;  3R5J B;  4U95 A;  1MN7 A;  1GNK A;  1FX4 A;  4K2J A;  1KVK A;  1WC6 A;  3KLG B;  4DEZ A;  1WG1 A;  1LFP A;  1JLB B;  2DNP A;  3BSA A;  2AD9 A;  1NBE B;  2WTF A;  1ZA2 B;  3RBE A;  5AE3 A;  3LW5 C;  2DNR A;  4I67 A;  1PJ5 A;  2C1E B;  2GC8 A;  3D3B J;  8RUC A;  3TR5 A;  4V1A k;  2B9X A;  3BSO A;  4ZJL A;  4OJ1 A;  1HWJ A;  3N6L A;  3UR0 A;  4K5S A;  4O4R A;  4X65 F;  1IBK J;  1D9D A;  3PYF A;  2OPP B;  2W7O A;  3QZ8 A;  1RE1 B;  3KHH A;  3BQ0 A;  2F9D A;  5GAG U;  2DNM A;  4K5R A;  3H59 A;  1HQU A;  2A6O A;  3T5K A;  4ZVG A;  4PG6 A;  4HT7 A;  3CDA A;  2GGP A;  5HMZ A;  3R27 A;  4KHP J;  5D15 A;  4ZP8 A;  1N6Q B;  2IHR 1;  2C3Y A;  1PAU B;  2WVE A;  2ZC3 A;  2RT3 A;  2GVD B;  3CED A;  1M90 T;  2G0C A;  1VHF A;  1RWX B;  5LMU F;  4ZCI A;  4CLK A;  2DEI A;  3WZ0 A;  4P71 A;  2FZG B;  3C19 A;  5M2P A;  5RUB A;  1IXK A;  3HFZ B;  2IM3 A;  5I3Q A;  1AUD A;  1U4B A;  4UOF A;  3T5L A;  4ZVE A;  1SH3 A;  2E9Z A;  1VQ7 S;  1VRQ C;  2ZJP Q;  2D7S A;  3WC2 A;  3C16 B;  4UZC A;  4L6V 3;  4QQB A;  4KBI A;  2GQQ A;  5DDR C;  3MM7 B;  4NEY A;  2DJW A;  1JLA B;  2CJ9 A;  4I2Q B;  3PNI A;  1QAJ A;  4QU6 A;  2DHX A;  4OYP A;  2RRN A;  1AFJ A;  1SL1 A;  3IC1 A;  1UWB B;  3D5M A;  4MIA A;  4LBH A;  4JP8 A;  1EZZ B;  2PA8 D;  2VU5 A;  3CJ0 A;  1JXL A;  1GMU A;  2R7W A;  1KQS R;  3EGZ A;  2RU3 A;  4ECW A;  1CSJ A;  5HQ8 A;  3EZ5 A;  4Q8F A;  5D8H B;  2OUG A;  4DXL A;  2E9R X;  2RS8 A;  3KHL A;  1F0X A;  4TNO A;  2QYC A;  4TLQ A;  4F04 B;  2P2C B;  2D1C A;  2KDO A;  2PGC A;  5C5J A;  2YWF A;  4C2M A;  1FHT A;  4USI A;  4TLR A;  1EP4 A;  3QNW B;  4TQR A;  2DNY A;  3Q8S B;  3MEE A;  4DL5 A;  2B6A B;  4P2X A;  1NJX A;  3DCA A;  3FBF A;  3P3D A;  3T1A A;  1N4L A;  3UVJ A;  1KQF B;  3AB2 B;  1K44 A;  7FDR A;  2IBO A;  4CYU B;  1T02 A;  5AJ3 J;  3IM8 A;  2CPI A;  1P1L A;  4IG0 A;  5F8J A;  2NLW A;  1FTR A;  2CNK B;  1FVQ A;  2EPI A;  5HMW A;  5DQH A;  4JYA F;  4L74 A;  1QTM A;  4WE1 A;  3T5J A;  4KGV B;  3PHT A;  2W9B B;  2COL A;  3A13 A;  2DGX A;  3PY8 A;  2EI5 A;  3OTC A;  2MSS A;  2DR8 A;  2DY9 A;  3QSY B;  1I94 F;  3QAU A;  1UW4 A;  1BY9 A;  3DMJ A;  1DTQ A;  1ZM9 A;  2HFZ A;  2QEX S;  3SCJ E;  4ICL B;  4FYD A;  1YBA A;  4DV6 J;  1ZTW A;  2GZO A;  2XMT A;  1NK5 A;  4WXO A;  4QWB A;  2Q6C A;  4QR2 A;  4PWD A;  2KG0 A;  4DHV A;  4C8Y A;  2HQF A;  4YR3 A;  2UXB F;  4FF3 A;  5BR8 F;  2KN4 A;  3FSY A;  1CBK A;  1ZZN A;  1HNZ F;  4R5P B;  4OZJ A;  3RJM B;  1Q82 T;  2KZZ A;  1ZA1 B;  4TXS A;  3DDK A;  3KJN B;  4NL5 A;  4NLG A;  4FXW A;  1REV B;  2GAG C;  5CZX A;  1S59 A;  1HBO B;  2JC0 A;  1FKA F;  1OYE A;  4DN9 A;  3IP0 A;  3K59 A;  2RH3 A;  2CQP A;  4IG3 A;  2BM0 A;  2BZ2 A;  5C25 B;  3I5C A;  4R25 A;  2R2R A;  1ZPV A;  3OL6 A;  3H2L A;  5B0B A;  4O3O A;  2VV5 A;  3HVA A;  4NA2 A;  1Z2L A;  3EDQ B;  3RB4 A;  4ES2 A;  1S6U A;  3RR7 A;  2BQU A;  1EKR A;  3SFU A;  3HPO A;  3NP5 A;  2HVH A;  3EIC A;  4DV1 F;  5CCM A;  2ZD1 B;  1NH7 A;  2KL8 A;  3IXQ A;  1XC9 A;  2JOQ A;  5J2N B;  3CCV S;  3FQK A;  4F4W A;  3W8G A;  1HHT P;  1ZZF A;  1RT2 B;  2NSC A;  3N5F A;  3KK3 B;  3KJV B;  4EGL A;  4RPF A;  5GAD U;  4DR5 J;  2VHG A;  3MM9 A;  3N01 A;  4CLS A;  4OZL A;  2NXC A;  3HLU A;  1RAA B;  3W62 A;  2FZK B;  1TUG B;  6AT1 B;  4PCQ A;  4A8Y A;  5ETN A;  2XO7 A;  4I6W A;  4G1P A;  2FD2 A;  1NJW A;  1WSR A;  1RAI B;  2EFG A;  2V9W A;  4DFM A;  1CJK A;  1HPZ A;  1SQF A;  1RQ0 A;  1PKU A;  1T05 B;  3JS9 A;  4IR1 A;  3BSC A;  3MCM A;  1O8B A;  5I42 A;  5CD4 A;  2IRY A;  1WOP A;  1J5E J;  2HAF A;  1S6P A;  4JI8 J;  3OTD A;  4C3K A;  2IJF A;  1U2F A;  2HBR B;  4CO4 A;  4RWW A;  3Q83 A;  4CLU A;  4OYZ A;  5ETT A;  5DM6 Q;  3UDV A;  4Y65 A;  5IT9 U;  1R8H A;  4LBP A;  2V63 A;  3DLB A;  4ZP9 A;  5KFR A;  3T19 A;  2EFN A;  2UZA A;  5KFT A;  4F50 A;  2V8D A;  5KG1 A;  4IYQ A;  2C2M B;  1H2U X;  3IG1 B;  4KSE B;  3KUE A;  5E3Q A;  1S9F A;  1JLC A;  4DSL A;  4KGZ B;  4NLR A;  1BHN A;  3PO4 A;  4FPI A;  1U1M A;  1XBW A;  2R8K A;  1MU2 A;  1YJU A;  3I31 A;  2JWN A;  3TO8 A;  1XMB A;  1B7F A;  2V34 A;  3QLH A;  3LH2 S;  1D9A A;  3G6V A;  1HLW A;  3DOM A;  3GMG A;  3H4B A;  2QLF B;  2VFV A;  2QL7 B;  1DTT B;  3LQV A;  2OHD A;  2XC9 A;  3SQG A;  4AYB D;  2H4Y B;  4CM0 A;  7FD1 A;  5D4N A;  2LFV A;  1FWL A;  2DNO A;  4P2S A;  3V6K A;  1AZS B;  1C4A A;  2JRS A;  3PAC A;  3K57 A;  4F3O A;  1Z4U A;  1B99 A;  2XMM A;  5D4O A;  1K0T A;  4TY8 A;  2IFX A;  3I4H X;  4LF8 F;  4DX5 A;  3HHN B;  3KG0 A;  5A0Y A;  3G8T A;  5CQG A;  2ABY A;  2XSF A;  2VDI A;  3FCV A;  5L46 A;  2XTJ P;  4DUY F;  4LSZ B;  4X4N A;  2CQ1 A;  4QYZ K;  4WP3 A;  1WOR A;  2MHE A;  1G2E A;  3S7R A;  3LAL A;  2RB7 A;  3B4D A;  1VC0 A;  3O44 A;  1WSV A;  1L5U A;  4YB6 A;  3WX8 A;  2CZ4 A;  2E5J A;  5E7O B;  2J5A A;  2KU7 A;  3K8V A;  2HVD A;  3NAH A;  1C1C B;  2ZZT A;  1XNR F;  1YJN S;  1QM9 A;  3M8Q A;  4H4K C;  1IJE B;  2FHK A;  4WIQ A;  1S0M A;  4NZ0 A;  3TP2 A;  1TR0 A;  2M0G B;  2UUA F;  1RCX B;  1TL3 B;  1Y3K A;  1R8P A;  1GEH A;  1U2R A;  2ATC B;  1ZYQ A;  3QFW A;  3GYX B;  4KFB A;  5HAN A;  3D66 A;  2EEY A;  3M9N B;  3TAM B;  4IR9 A;  4RUB A;  1H38 A;  2G1D A;  1UPP A;  3RR8 A;  3FBB A;  2ACY A;  4MMO A;  4EUV A;  5HVG A;  1EET B;  2GV1 A;  5E41 A;  2DY1 A;  1TL1 A;  4KIA A;  3M2R B;  3R5B A;  5D77 A;  3CTR A;  4AND A;  3JYT A;  4MH8 A;  3CJ5 A;  1WEZ A;  3W9J A;  2IY5 B;  1RBL A;  4JV2 A;  3MAA A;  1SKW A;  3RB3 A;  3A3O B;  1QSY A;  7AT1 B;  1R0A B;  1SJR A;  3LOU A;  3HP6 A;  5DJB A;  1M5V C;  1R8A A;  4OI1 A;  3SV3 A;  1KDN A;  4HHJ A;  1YKW A;  5J2M A;  1WUU A;  4X4S A;  2B5J B;  1C2P A;  2HZC A;  3R9L A;  2R7S A;  4UZB A;  2LQJ A;  4DUZ F;  1WC0 A;  1JLF B;  2LKZ A;  4NXN F;  2HVZ A;  4EO8 A;  5LSO A;  4C4W A;  3WQP A;  4TY9 A;  1TAQ A;  4K4S A;  1WAC A;  4WKR A;  4U67 Q;  1S77 D;  3GFH A;  3DOK A;  4YME A;  3ZNJ 1;  1RAC B;  2RSQ A;  3FFI A;  3G71 S;  4MKY A;  3KTQ A;  3R3T A;  4P74 A;  4CO1 A;  3M30 B;  2DBB A;  1PYT A;  5LSL A;  2AEM A;  1L3K A;  3PJ9 A;  3M2U B;  2XS7 A;  4F3Q A;  3E2E A;  2UUB F;  2CG8 A;  1GK8 A;  2B56 A;  4DR6 J;  1JNR B;  3TZX A;  4OX7 A;  4JBC A;  2HS3 A;  1IKW A;  3R1H A;  4DLE A;  3HHK A;  4TN2 A;  4K4V A;  1BQN B;  2PSZ A;  3QAT A;  2E5L J;  3BKT A;  3W66 A;  3VR1 A;  3H5Y A;  1H6K X;  2J7U A;  1RT4 B;  2BKN A;  2LXI A;  3VCD A;  4G6V B;  3BS9 A;  3KK2 A;  1OYD A;  2OSQ A;  3KG1 A;  1TU0 B;  2I38 A;  3ILI A;  4J9K A;  4A8W A;  1HWL A;  3P6Y C;  1F5B A;  5LJ5 Y;  5LXR A;  3OSN A;  1IKY B;  4KO0 A;  1RBA A;  1NAQ A;  2Z0G A;  3M6U A;  3PKM A;  1G6B A;  2HQ3 A;  2FVR A;  1N5Y A;  4B3O B;  1HNV B;  3NBP B;  1Y7P A;  2NXJ A;  2M8H A;  3ENA A;  1RWO B;  1N0V C;  4KQZ A;  3HSJ A;  1LWE A;  2Y1J A;  1RAD B;  3HCX A;  2KM8 B;  2VFR A;  1DLO A;  4FF4 A;  4LFC J;  3D1H A;  3IR5 B;  4I2P B;  3H7H B;  1RI7 A;  1UVI A;  5F8N A;  2LXF A;  1U02 A;  4Q0B A;  3KLF B;  2BUN A;  4IRC A;  4DQQ A;  2DXF A;  3DU6 A;  4NMX A;  1OY6 A;  1RU1 A;  2B7B B;  2AGP A;  5B08 A;  3UD4 P;  4BBY A;  4A8M P;  3E01 B;  4L72 B;  2XB2 D;  3WDO A;  2ZHO A;  4F2S A;  2HHV A;  4C48 A;  1J5O A;  4ZPV R;  4PKD B;  1NHU A;  2UU9 F;  1U1Q A;  4ZVQ B;  4EEY A;  4CTA A;  2NXE A;  3R2C J;  4CH7 A;  4X4U A;  3TZZ A;  3BR8 A;  2WSC C;  3MMB A;  3G6Y A;  3CCT A;  3NKY A;  3A12 A;  1WEL A;  3V6H A;  2BVZ A;  2ERR A;  2CYY A;  2U1A A;  3MM6 A;  4RW6 A;  1RT1 A;  4P10 A;  2GVZ B;  2OPR A;  1RWK B;  4MTP A;  4AXI A;  2E1A A;  4KR0 B;  2K8G A;  4IFY B;  4RW7 B;  2CZ9 A;  4MT1 A;  4NLT A;  1U7L A;  5ETK A;  1S10 A;  5E33 A;  4IQX A;  1NSQ A;  5F8I A;  2FLP A;  1IUJ A;  4ENO A;  3IMQ J;  3TUJ C;  1O51 A;  4KYZ A;  1F2H A;  2P5V A;  3LUY A;  2MKI A;  1F3V A;  2YKN A;  5KT7 A;  3GJS B;  4ZP7 A;  4OI6 A;  2MXY A;  2GIF A;  5DQG A;  2FVQ A;  3NNA A;  2JEG A;  3QJP A;  1FJE B;  3HVW A;  1IJF B;  1IBL J;  4O3S A;  5HLF B;  4O0I A;  2H3E B;  1U48 A;  2H51 B;  2FJB B;  1K1Q A;  1M5P C;  4CIO A;  1FDN A;  2AYM A;  2M9K A;  3DRR A;  4OHZ A;  1YZ6 A;  2HRY A;  5L9N A;  3T41 A;  1YIT S;  5J2P A;  1HR0 J;  3DI6 A;  1C1B A;  3DHX A;  5BYR A;  2ALY B;  3V6D A;  3CJ4 A;  4DR2 J;  1V3R A;  2XY7 A;  4KY3 A;  1SKS A;  2CQG A;  4C8N A;  1CLF A;  2IM1 A;  5AJ3 F;  4DL6 A;  2AJ4 A;  3G82 B;  4DPX A;  2QIF A;  2RHS B;  1VQP S;  3L7P A;  2CIM A;  2XUL A;  2FGC A;  5CXT A;  4YB7 A;  4K7Q A;  3D6T B;  4DV7 F;  3KWM A;  2DYA A;  1X4G A;  2HZV A;  2F1F A;  4QYZ J;  3OPK A;  3C14 B;  1I5O B;  5ETO A;  4WCE Q;  4R8U A;  3PM9 A;  2GIQ A;  3M2V B;  1XWL A;  4DQS A;  2VOO A;  3BZQ A;  1X5S A;  1JNZ B;  3DDN A;  2R42 A;  4DQP A;  4L73 A;  4RW6 B;  1T9X A;  1Q4R A;  1FJC A;  4M5K A;  3BJY A;  1HWK A;  3OXG A;  3IWN C;  5ETS A;  1XEZ A;  5KG7 A;  4Z37 A;  2F40 A;  1H98 A;  1FA0 A;  1DAR A;  4OZ5 A;  3PIP Q;  2DHA A;  2R7X A;  3I55 S;  2FYX A;  3HHL D;  2MGZ A;  1EAR A;  1S4E A;  1U0H A;  4JI6 F;  1TMM A;  1ZM3 A;  1QUV A;  3CWJ A;  3DN9 A;  4JI7 F;  2IAJ A;  2Q3P A;  5GAH U;  1U49 A;  4NPO A;  4N47 A;  1WF0 A;  5C42 A;  5A8K A;  3GFZ A;  1M5O C;  1KQK A;  4RWX A;  4J5O A;  2R4F A;  4WFX A;  2K3K A;  1KVI A;  3NMA A;  2AIR B;  4HLB A;  2HHT A;  5BXI A;  5A2Q Y;  3CNQ P;  5T7L A;  4X4P A;  2BBE A;  3I32 A;  3KLH A;  3RB0 A;  2HWI A;  3HVT B;  4ID5 A;  3OW2 R;  1RWP B;  1UZH A;  4ECQ A;  3TQE A;  3ZTS A;  3UD5 A;  3SCK E;  2IIH A;  4RNM A;  2CZV C;  1WD6 A;  1PIE A;  4HDH A;  3BV8 A;  2VPZ B;  2QN6 B;  2B7C B;  2E9T A;  5HK4 A;  3K5L A;  3BB5 A;  5C2C A;  4GKK F;  2MB0 B;  2QFJ A;  2C3U A;  3M4X A;  1VQL S;  1YWX A;  1N36 J;  2YNH A;  2OJ3 A;  1FE4 A;  1JXV A;  3VV2 B;  2VAS A;  1NSP A;  4NI2 B;  3MCO A;  2DH9 A;  1HYS A;  3VGS A;  2DIT A;  4FYV B;  2RF2 A;  4NLV A;  3LP0 A;  4OZ2 A;  2IA0 A;  3A4T A;  4M5H A;  3HZG A;  1LW2 A;  5DZ7 A;  4OI4 A;  2A3J A;  3LAN A;  3MED B;  4NA3 A;  5KOW A;  2YQ0 A;  1EQM A;  1FRL A;  2BAN A;  3QID A;  3QJL A;  2AHO B;  1SQE A;  3NS6 A;  1UVM A;  2KB2 A;  1IBM J;  3IWL A;  3QMQ A;  3BR9 A;  3PYG A;  2UXC J;  4C97 A;  1K8A T;  2GCF A;  1U25 A;  4JI5 F;  1KBR A;  1UEU A;  2HWT A;  1RLC L;  3JSM B;  1HKA A;  2XZT B;  1YGY A;  3ILL A;  1T9T A;  4UUW A;  3AA9 A;  2WOM A;  4ZVS B;  5I3U A;  5A8K B;  4PUO A;  4LFA F;  4AE5 A;  2WZ1 A;  2H5I B;  1UA1 A;  3NCR A;  3W9H A;  4B3T J;  2V6A A;  4F7V A;  3C6U A;  3WBZ A;  3VWS A;  1YRT A;  3M8P B;  3M8S A;  2V50 A;  3IFE A;  1RT5 B;  4M5I A;  3H5X A;  2A18 A;  2R7Q A;  4DR7 J;  4QBU A;  3G87 A;  1KFS A;  3CC4 S;  2DHS A;  3NGU A;  2EFO A;  2CWK A;  3J7Z 5;  1FKO B;  1VRU A;  2JEI A;  3D4J A;  4CLZ A;  1JKH A;  3MUV P;  1Q8B A;  4OI0 A;  2K2P A;  3VZI A;  2IJN A;  2OP5 A;  1IR1 A;  4CI0 B;  3DYA A;  2QC3 A;  1GH8 A;  5EGY A;  4X4Q A;  3NS5 A;  4ED4 A;  3CJT A;  3W61 A;  3DLK B;  3BBB A;  3N28 A;  4GRS A;  4LQ3 A;  1BLU A;  1D3W A;  2XWY A;  2YKA A;  3BKU A;  4LF9 F;  5G4D A;  4OYM A;  1KEK A;  1NME B;  2ZBC A;  5CH7 B;  3QT5 A;  4NLP A;  3SIP B;  3PJX A;  1JIH A;  1NK0 A;  3PKY A;  2QG9 B;  2CJQ A;  3OR1 A;  1CQN A;  4CP5 A;  4LR9 A;  1VOM A;  3IRX B;  4Y2C A;  1RHQ B;  3D7S B;  5KG2 A;  3N6M A;  3LP2 B;  1APS A;  3TUI C;  3OFE A;  4DG1 A;  1JLG A;  1HW9 A;  1UJ5 A;  4CM2 A;  1NJZ A;  2KO1 A;  1DQA A;  1GAO A;  3IBF B;  4M94 A;  1FO1 A;  1FT8 A;  4RZR A;  2QE5 A;  1JJ2 R;  1QSL A;  1VRT B;  4E2F B;  1XN9 A;  2AGQ A;  3I0S A;  1VQ9 S;  2L9N A;  3ZFV A;  4R0E A;  5JMN A;  4F8R A;  5GMK a;  1YHQ S;  3W2V A;  2EXU A;  4LRB A;  1Y5N B;  1R0B G;  2OAU A;  4XIU A;  2O5D A;  3PX4 A;  3E51 A;  4H4O A;  5F0W A;  3DKD A;  3J81 j;  2E7W A;  3GYN A;  1LK5 A;  3GJT B;  2B0G A;  4Y2K A;  1NK9 A;  2IBK A;  2CQI A;  4ECT A;  5J2Q A;  1KOH A;  1X9S A;  2KFN A;  3GLJ A;  1S12 A;  2W24 A;  2XLK A;  2H1Y A;  3DRS B;  1YJR A;  3AOC A;  1SPB P;  3A8J A;  5A8W A;  3MR5 A;  3A8K A;  2RQK A;  1Q86 T;  4NLU A;  1IWA A;  3ZO7 A;  2V8V A;  1Q5V A;  2XO6 A;  2HBY B;  4MFB A;  2KFZ A;  1PBA A;  2AMC B;  4EI2 A;  5CZV A;  5L1J A;  5KFQ A;  2VBY A;  2QA4 S;  3QWP A;  2WCX A;  4CO5 A;  1YQH A;  4FYX B;  3CCU S;  3TUZ C;  4MIB A;  4C11 A;  3GJQ B;  5HSP A;  1HIY A;  2WVF A;  3EM1 A;  4DL3 A;  5FII A;  2Y1I A;  1S1V B;  2KXF A;  2OPS A;  2HNY B;  4K50 A;  3GTY X;  1YJT A;  3P8B B;  1NXI A;  4O3P A;  1LNQ A;  2N4D A;  3TRG A;  3OTB A;  3LA0 A;  3FNN A;  3GE9 A;  2IMW P;  4C8O A;  2YKM B;  2GO9 A;  4H54 A;  3X3U A;  2DB1 A;  1CS4 A;  3V81 B;  2NUH A;  3B82 A;  4NEZ A;  1XNQ F;  4DL2 A;  3BGU A;  2D3O R;  4DL0 C;  1GX5 A;  3G4S S;  4DSI A;  5D0R A;  2CNL B;  5KT6 A;  1ITP A;  1BD6 A;  1WC3 A;  2KZM A;  4NLW A;  3P5T L;  4KV8 B;  2LEA A;  4U8Y A;  4FN5 A;  2DTJ A;  2HMI B;  3QGH A;  4ZCK A;  1NSK L;  4O44 A;  5SUH A;  1NZA A;  1RTJ B;  5LJ3 Y;  2HAI A;  4BS2 A;  2BDP A;  1S0O A;  1GMW A;  3GIM A;  3HHL B;  1MRO A;  1RT7 A;  3HDS A;  4UUX A;  4NCA A;  5BJR A;  2MKK A;  3CCS S;  1U24 A;  2P9C A;  2BJ1 A;  3NWR A;  3K89 A;  1RTD B;  4J9N A;  1N5Q A;  4Q2L A;  4DSJ A;  3IS9 B;  3M9O B;  1MWZ A;  1TL7 B;  4TQS A;  5A8W B;  4P7T A;  1RBO B;  3MAQ A;  1FTC A;  2GHP A;  5KFO A;  3HZE A;  2GQ2 A;  2F3J A;  1D9F A;  1T9U A;  1LXN A;  3PFO A;  1MWQ A;  2V8H A;  3B6B A;  3KG4 A;  5C7P A;  4Q2M A;  4ED8 A;  2MKY A;  2ZE2 A;  4DX6 A;  4YY3 J;  5F0U A;  2HLU A;  1AA1 B;  4DR3 J;  4HH1 A;  4NLY A;  4OI2 A;  1RUS A;  2P6T A;  4ED2 A;  1P27 B;  2ZZN A;  3FQL A;  3R6L B;  1FNM A;  2R2U A;  4URG A;  1YDL A;  4O4G B;  5K8N A;  3V4I B;  2Q6B A;  4PYD A;  1X4F A;  2KXN B;  2K1R A;  2KHC A;  3KK1 B;  3CD7 A;  2W25 A;  1B7Y B;  4YN3 B;  3BRE A;  2HK3 A;  3MFH A;  3DLL Q;  1HQE A;  2QMU B;  2Z57 B;  4RW9 B;  5DG8 A;  4ZLJ A;  4H4M A;  4ECV A;  2MPU A;  2BA9 A;  1SB6 A;  4ZMM A;  1T03 B;  2MQO A;  5C24 B;  2PDA A;  4ILR A;  3P5B P;  1TKX A;  4AL7 A;  2FJD B;  3SSQ A;  4F0M A;  5LMN F;  2FC9 A;  1N56 A;  1KTV A;  1V3S A;  4L3N A;  4USJ C;  2HBZ B;  3GQC A;  4KH0 B;  5LT5 A;  4NCB A;  1HNW J;  2M3D A;  2AKW B;  1RSC A;  4ILM A;  2OD4 A;  3MPD A;  3R2D J;  1CC8 A;  1TEL A;  1PAE X;  5B7W A;  3EXC X;  4JI4 J;  2D69 A;  2H5E A;  2W2N P;  3MMC B;  1X9W A;  4M5D A;  2WHO A;  4DL7 A;  4Y34 A;  3PW5 A;  1SQG A;  2VIC A;  3DRY A;  1KNZ A;  3CGI A;  5IV3 A;  3ULH A;  3C6T B;  3M6X A;  2X51 A;  4LT6 A;  2VB6 A;  1CPZ A;  2I0X A;  2AZ1 A;  3D3C J;  4ZPW R;  1YJV A;  1HBN A;  3CCJ S;  3JTO A;  3JTP A;  2BE2 B;  5G0R A;  1FKP A;  3C3L A;  4DR4 F;  4D3H A;  3HHD A;  3GCW P;  2FZC B;  3DM2 B;  2BEF A;  1FES A;  1RDR A;  4DBQ A;  2PFD A;  1QVG R;  2RQ4 A;  5J1E A;  2Y1L B;  1QUP A;  2UXD F;  3F44 A;  1RWW B;  1TKT A;  1OIA A;  4EYI B;  3PX0 A;  5ETM A;  2GAH C;  5J1N A;  2DNK A;  4QWC A;  2M7S A;  3KYL A;  4Q5V A;  1N32 J;  3QRR A;  1W2I A;  2FGO A;  3KDO A;  1X4E A;  2JFK A;  3B4M A;  4EZ9 A;  4Q45 A;  3MUR P;  3JB9 k;  1HQ2 A;  1V5I B;  1WF2 A;  4PQU B;  3TA1 A;  5KG5 A;  4LSL A;  1ZOT A;  3H90 A;  2PII A;  2YNI B;  3CSK A;  4USV A;  2CG4 A;  2ZOG A;  5KFS A;  1SC6 A;  1IVZ A;  4DZ6 A;  4QR0 A;  5HAT A;  4ZIT A;  1RGV A;  1VQS A;  5IWA J;  2W9C B;  1IKX B;  1BQM B;  4YP3 A;  4EO6 A;  5IM0 B;  4J9L A;  1WTF A;  1KLM A;  1R6V A;  3HJV A;  4QR1 A;  2D41 A;  1CJV A;  1M5K C;  3MR2 A;  1C0T A;  5B0G A;  4HKQ A;  3CW2 C;  2MTL A;  3TZW A;  1XMQ J;  4DX8 H;  2B43 A;  4DV5 F;  4ZN1 A;  3JQJ A;  4K4X A;  1SV5 B;  1YSJ A;  2VPW B;  1KOO A;  5GME A; 
#chains in the Genus database with same CATH homology
 1RHU B;  2H65 B;  2Y0B B;  3R7B B;  1RHR B;  1RWX B;  2HBZ B;  2CNO B;  1NME B;  1BMQ B;  3GJT B;  1RWP B;  3D6M B;  2QL9 B;  2HBR B;  3EDQ B;  2CJY B;  2QLJ B;  2H51 B;  1RHJ B;  1RWN B;  2C2O B;  2CNN B;  2XYH B;  5K20 B;  3SIP B;  1IBC B;  1QDU B;  4ZVR B;  3R6G B;  5IC6 B;  4ZVQ B;  2XYG B;  3GJR B;  3P4U B;  4ZVO B;  2XYP B;  2XZT B;  2C1E B;  3R7N B;  2P2C B;  2CNL B;  3R6L B;  4ZVS B;  4JB8 B;  1RHM B;  2H48 B;  1RHK B;  1RWM B;  2C2Z B;  2H5J B;  2C2M B;  2CJX B;  1I3O B;  3KJF B;  1I51 B;  2QLB B;  2H5I B;  2FQQ B;  2HBY B;  4LSZ B;  5IC4 B;  1RHQ B;  2HBQ B;  3D6F B;  3QNW B;  4ZVU B;  1RWK B;  3R7S B;  1RE1 B;  3RJM B;  3NS7 B;  1RWO B;  4ZVP B;  2XZD B;  2H54 B;  3KJN B;  3IBF B;  1GFW B;  3KJQ B;  3P45 B;  1ICE B;  3IBC B;  4DCJ B;  1SC4 B;  4DCO B;  3GJQ B;  3EDR B;  2CDR B;  1RWV B;  2DKO B;  2H4W B;  2Y1L B;  2QL5 B;  4DCP B;  2QLF B;  1SC1 B;  2QL7 B;  1PAU B;  1F9E B;  1SC3 B;  1RWW B;  2CNK B;  1QTN B;  1PYO B;  2C2K B;  3GJS B;  3D6H B;  3R5J B;  2H4Y B;  4ZVT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...