1RWKB

Crystal structure of human caspase-1 in complex with 3-(2-mercapto-acetylamino)-4-oxo-pentanoic acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwkB00
1RWOB 1PYOB 2DKOB 3EDQB 3RJMB 2H4YB 1RHMB 2XYGB 4JB8B 1BMQB 4ZVUB 2HBRB 1F9EB 2CDRB 3KJNB 1SC1B 3R7BB 3KJFB 2Y0BB 1RE1B 4DCOB 2XYHB 3IBCB 1RWWB 2C2KB 3R6GB 2CJXB 5IC6B 2HBYB 2QL7B 1IBCB 3D6HB 1RHQB 1RWPB 2HBZB 1RWNB 3SIPB 1RHJB 3NS7B 4DCPB 2H5JB 2Y1LB 2FQQB 2H5IB 1SC3B 3QNWB 3KJQB 3R7SB 1I3OB 1GFWB 2H54B 5K20B 3GJQB 1ICEB 2CNKB 3EDRB 3IBFB 4DCJB 2CNNB 1I51B 1NMEB 1RWMB 2CJYB 2QLBB 2XZTB 1RHUB 1RWXB 2C2MB 3P45B 4LSZB 3P4UB 1QTNB 3GJTB 3R7NB 1PAUB 2QL9B 4ZVPB 2XYPB 1RHRB 4ZVRB 2CNOB 2P2CB 3GJSB 2CNLB 4ZVSB 2XZDB 4ZVOB 2C2ZB 5IC4B 2C2OB 2H51B 3R5JB 2H65B 2H48B 2C1EB 3D6FB 3GJRB 1QDUB 2QLJB 1RWKB 4ZVQB 2QLFB 1RHKB 2QL5B 3D6MB 1RWVB 2H4WB 3R6LB 1SC4B 4ZVTB 2HBQB
chains in the Genus database with same CATH superfamily
4XDDA 3P8BB 2A18A 3G96A 1UL3A 1XN9A 3HVRA 1KRPA 4RJVA 3HT3A 4LMZA 2W2NP 1Y9OA 1CJVB 2QN6B 3DC2A 1TU0B 5HAOA 3M8RA 4C0BA 4Z37A 2C2EA 5EWFA 3OVBA 1QVGR 2XYGB 3M6WA 1NK7A 4DSIA 3H59A 3CCMS 3CJKB 3TAQA 2DGSA 2VB6A 4Y2AA 1UVIA 3OTOF 3AA8A 1S49A 1OMSA 3K89A 4USJC 2OFHX 3TJAA 1WHWA 3L09A 4DL5A 4HR2A 2J9DE 2MZ1A 2V8GA 2YPYA 3B4DA 3MMBA 5DO2A 3BH6B 4DV6J 3VWSA 4DCOB 4WU2A 4IO9Q 2V9WA 4B3TF 1UWAA 4MH8A 5HLFA 5LJ3Y 1RLDA 1HR0F 3UN5A 2NQPA 3L95X 2HHXA 2YH1A 1G6BA 3M8PA 4HACB 2MQPA 1LOUA 3ILIA 5FDLA 4YR2A 1Y11A 4JI7J 1RYRA 3ZTSA 3QFWA 3CPWR 1TUWA 5IC6B 2VHGA 2NYHA 2LXIA 4F4ZA 4DR5J 5IWAJ 2QL7B 2B8QA 2IVFB 4DWIA 2J0SD 1JJCB 1RWPB 4QCLA 1RT3A 3PW5A 2HG4A 3CCSS 2BA9A 1BD6A 3LQVA 3OBIA 2KT5A 3HX9A 3SCJE 4UOCA 5H9EJ 2IDLA 3I6PA 1A6LA 3QYYA 4F02A 1U2FA 3LAMA 4LBHA 2XMKA 2AKWB 4QIFA 2HQIA 2KJWA 3MM9A 2OIHA 2KG0A 3L9ZA 4QWAA 4RNMA 1NDKA 1HQUB 3HM9A 4QPTA 4N8NA 1NPRA 4CH0S 3OL9A 5E41A 2W9AA 1WC1A 1GXTA 4OZ3A 4CQ1A 3UCGA 4I64A 5IV4A 1RAGB 1I94F 4F0HA 2W7OA 3THPA 2R7TA 5KFNA 3FVYA 3KLVA 3NNAA 2VDHA 4AQYJ 1WI6A 1ZAWA 4FYYB 3ZZRA 1BQXA 1Q7LB 3V81A 2RS2A 3KDOA 2AEJA 2NPFA 4B3RJ 4I1TA 5BYQA 1ROFA 5B0EA 5IWAF 4P2SA 1FKPA 4LRAA 3UR3C 2VG6B 2Y1RI 1NMEB 3MPYA 5GADU 4HI2A 1QAIA 3KUHA 4RNNA 1YZ6A 5I3QA 5H9FK 2ZD1B 4X4NA 2A0FB 4DFMA 1KOHA 3GJTB 5LXRA 2UUCJ 3T9NA 2ZHBA 2W2QP 2Z57B 3DHWC 5E3PA 4M5MA 1LXNA 3WX8A 3AJDA 1UVJA 3P6YC 2C2DA 1IJFB 4N5SA 4UW2A 2BRKA 1VQ5S 3PJWA 3CCLS 5B09A 4PQUA 4NPOA 1F5AA 1JXVA 2VDIA 3NGTA 4JI2F 1VQMS 3FZ2A 3US5A 2VFUA 1T9TA 2B9EA 3G6VA 2ABYA 1RBOB 4DV3J 1PBAA 4CLLA 2XZDB 2QGFB 4QYZK 2IRXA 2LQ5A 4OJ3A 2D3O1 2CPFA 3P96A 3X3UA 2WCXA 1FKPB 2WW8A 2MGZB 3OR1B 1TL1A 2M3DA 4Y2MA 3QSYB 3LGHA 3LWLA 2KU7A 3LAKA 4EZ6A 3G87A 4RW6B 4ID5A 3KHRA 3FNNA 2H65B 3T3FA 1X60A 2L48A 2OEJA 1T9XA 3NEKA 5B0GA 5K8PA 3MPDA 3LGNA 2DEIA 2MQNA 2PDAA 2YNGA 1VQ8S 3IAS9 3C14B 1E6VB 3OTCA 3CF5Q 2DXDA 1Q8BA 4UF4A 2ZH7A 2V2ZA 1LW0B 3LUYA 1QSYA 1CQMA 5CD4H 2IA0A 2KI2A 2D3UA 1RBAA 1RAIB 4RW4A 4NCAA 2LLZA 1NNDA 2HHSA 3EXYA 1FRJA 1GT8A 1JLGA 4EI2A 2CPXA 3POTA 1X31C 2JRSA 2V8DA 3D2WA 1N5YA 1SL0A 3RU0A 2CQ3A 3EVOA 3RJMB 1JMTA 2H4YB 4AFFA 4BS2A 4DFKA 2DHAA 4HH1A 4OZ0A 4QU7A 4NEZA 3I87A 2UV8G 2YWHA 4GO5X 3T6BA 3FBFA 1R89A 4ETXA 2WHOA 1S7HA 4FKYA 1KQKA 1WHXA 1S5ZA 3JSRA 3IM8A 4TLQA 1NSQA 1ZM4A 3QIPB 5HO4A 4C48A 1E6VA 3GCWP 4AXIA 1HI1A 1HNVA 5DGBA 1D1UA 1B7YB 1RTIB 2HWHA 4B3RF 2DNMA 2OPRB 2ZITA 2DNGA 4ZHRB 5GMEA 3GP9A 1YJWS 4LBPA 4RW6A 1V5IB 1WELA 2DNRA 3HT0A 2RD5C 1R8CA 4DQRA 1UVKA 4YB5A 1HPZA 2EFNA 3R5AA 3W7BA 1DTTA 1PC5A 3F56A 1NRKA 3TZYA 2CAJA 1YBUA 3DCAA 1FVSA 5GAEI 4DV0J 1NSPA 3KK3A 2JHEA 3PIOQ 1SVDA 2VL1A 2IM3A 4NLGA 3GE9A 1RHQB 1RWNB 3M8ZA 1C0UA 3FGVA 4PPDA 4ZPVR 4DZ6A 1S72S 2BRLA 1KVIA 3SIPB 4DX6A 2UUBF 2E7XA 3MTJA 2G1DA 2R2RA 1T3OA 3OD2A 1FX2A 1PG5B 2CQGA 2BE9B 3KLIB 1VHFA 1L3KA 2BR0A 1NK5A 3BDPA 1GMVA 2V63A 1NJXA 1FFGB 1VS3A 5KT5A 2CVIA 2HVIA 3BSAA 3LP1A 4OX6A 2HGNA 2YNFA 3HPOA 1MNEA 2J9DA 2ZUGA 4OI2A 4WYLA 5KG5A 3G71S 3K5LA 3MI7X 1I3OB 3ET6B 3HCXA 4M5GA 1XR6A 2EFVA 4CTAA 4LR9A 2IJFA 1DAXA 2YY3A 5C2GA 2VQEJ 4K2JA 4LF4F 1G7CB 3EGZA 4BWMA 1Q16B 5IQQA 1NZ8A 1S1UA 2ASJA 3HP6A 2AHOB 4WTYA 3W64A 3W60A 2E7VA 2MSSA 3NMAA 2FVRA 5F3ZA 3SSSA 5JMNA 2W2PP 1X4EA 3D28A 4IFYB 2EWHA 3QAEA 2F1FA 1FRHA 3IBFB 1SBRA 1UETA 3ONQA 4QOTA 1I5OB 1UWBA 4KR0B 2PA8D 4E0DA 2FLOA 4FZVA 4LUBA 3WIUA 1RWMB 3MMCA 4F7VA 5HVGA 1HNZF 2R7OA 3OVSA 3BYPA 1U09A 2RAQA 4OZ2A 4H4MA 2IMOA 4JI3J 3GG1A 5H9FJ 2Z2MA 3EWGA 3PYFA 3KOAA 1BXNA 3ZZOA 2ZEJA 4FXWA 4LFAF 2PGCA 2XSJB 3S01A 2XGPA 4LFCF 5DZ6A 2F65A 4KO0A 1AB8A 3CMQA 3KLFA 4KPCA 1PYSB 3RRKA 4FF1A 3PX6A 4DMZA 1VISA 2BJ9A 3P3DA 4OYWA 4RWXA 4ZVSB 2BJDA 1YIJS 3NWRA 4H4OB 3M4XA 1RTDA 1Q4RA 1IKWA 3GONA 2HHPA 2OSRA 1MWYA 1WOOA 4LVOP 4ZCKA 2DR8A 4ZP6A 2SXLA 2BKOA 3UWTA 1L3SA 2POKA 3A13A 3N5FA 4HDGA 4N8OA 2DBBA 2BUNA 4Z7YA 5DJBA 3SZ2A 4FYWB 3ULHA 3EZUA 4I2QB 1VBYA 4FF3A 1NJWA 5KG6A 2FYXA 1SIZA 3Q8UA 2AZ3A 4K4TA 2XGQA 1JLAA 3CEDA 2HNDA 2IJRA 4OZNA 3PKMA 1SXLA 4NLDA 1CBKA 1NM2A 1LWEA 2QYCA 2GO8A 4J9KA 4F4XA 2H4WB 4DI6A 3E3XA 3A3OB 3VAIA 3R5DA 3Q2TC 2FDNA 1GNKA 4DX8H 5KG0A 1S10A 2XO6A 3OTEA 5HL7Q 1UJ4A 1VQPS 3MHYA 3Q8RB 4HTIA 2A6OA 1RT3B 1HNXF 3VVUA 3C66A 3V6JA 5E0OA 1S57A 1JLFB 2F9DA 3D3BJ 4JBCA 3KFWX 1TTHB 4U8VA 1MLAA 5LMNJ 4CT9A 3UDEA 4C8KA 4W4MA 4ZVUB 1TFWA 4QIVA 3D54A 1G4CA 3FQLA 1K1SA 1TV6B 1XIQA 1NKEA 3KLGB 4FVCA 1AZSA 1MU2B 2HWTA 3AXKA 3G8QA 2E1AA 3IAM9 5A6PA 1Y0HA 4OJGA 2VC1A 4WF9Q 2RIJA 3PM9A 5HP1B 5F3TA 2G0JA 4PG4A 4YB1P 1D8ZA 2MZTA 4I2PA 3T19A 2QLWA 5IT0A 3SCKE 4KHMA 4A8QA 1RT1A 1CC7A 3H5SA 3IXQA 1DQ9A 5ETVA 1FVQA 5F9LA 4DL2A 1CJTA 3QT5A 5JUMA 4ELUA 3FUYA 3C3LA 2WSFC 1T7PA 2ATCB 2FC9A 2GQ2A 1GQEA 1U1RA 1U1KA 1FJCA 2LEBA 4AE5A 1YJNS 1RT5B 1KLNA 3BKTA 1DTQB 2ROEA 1D9AA 4L75A 5CYQA 4RKUC 1YG0A 1SUQA 3CCZA 3KDNA 3MZIA 1U0SA 3D9BA 4K2XA 3TJ8A 3UQSA 2MY8A 3G6YA 1ZM9A 3C15A 2X3GA 3U02A 3OXGA 1HBOA 2WOMA 3B8HA 4DBQA 1QD1A 1VJWA 2GZOA 3H90A 3I55S 2XNQA 3DKDA 4NA2A 1J5EF 2J5AA 2V2VA 5KFHA 2WVEA 2H5IB 4ID5B 1SC3B 5THWA 4CYUA 4C4WA 1AW0A 2R7XA 1IJEB 2X3DA 1B64A 2QT7A 2MMYA 1JK9B 3BSCA 3MM6A 3FMBA 2DGVA 4IH6A 3GMGA 4NASA 3CTRA 4RUAA 3IR7B 5G0RB 2LXFA 5SUHA 3TAMB 2CXEA 4X65F 2K06A 3L7PA 2V6AA 3DM2A 4GVBB 2E7WA 5B08A 3K5PA 1B7FA 4PG6A 1U25A 2RU3A 4KGVB 4U95A 3EVMA 2IRYA 1RKIA 2ROPA 1R27B 2Z8QA 4QIWD 4EGLA 3ISND 3SDEB 3B82A 1IKXB 4XK8C 2GMJA 5D0GA 5D3GB 2XZTB 1HNWJ 3IFEA 3HSDA 2CPZA 1UPPA 3OHBA 2O01C 1M5KC 1H98A 3QJPA 3LGMA 5KG1A 4RNOA 4WP8A 5CYMA 1SH0A 2GMHA 1T05A 1Q53A 4U7UD 3GZ7A 4EYIB 1WF1A 4DX5A 4ECSA 2VA2A 5LMUJ 2ZUAA 1M0SA 2ZBIA 3AA9A 3O8WA 5C24A 3KK2B 1U48A 3DXSX 1SJFA 3H8YA 1P9QC 2A1BA 2YTCA 3AAWB 2W8KA 3TUJC 4Q2MA 5LSOA 5HLFB 3OTDA 4M5NA 2YQ0A 3NP5A 4OYMA 2XI2A 2B4OA 2V0NA 1SL1A 2YWKA 4G1PA 4MKAA 1KQSR 1RABB 1FXDA 1YJTA 4DU7A 1H74A 2PIIA 3ZTOA 3E8OA 4BC9A 5F9NA 2ZH3A 4TU7A 2QE5A 1UZHA 4K4VA 4FXVA 2QLJB 1R31A 4YB6A 2ZH5A 2ZFHA 3EVWA 1FE0A 3T5LA 1SV5A 1VGYA 3H7HB 1ZPWX 4M5HA 1T9WA 2GVZB 2LA6A 4PXBA 1EKSA 3N0VA 4F2RA 2DHSA 5LJ5Y 1CULB 5D8HB 2RS8A 3AD7C 5ETTA 2ZZNA 3H2LA 4EO6A 2MLXA 1EB0A 3IS9A 2CZ4A 2ADCA 2HHWA 1RACB 1TUVA 1GK8A 2HIQA 4OX7A 2QA4S 4A8OA 2ZVIA 1Z4UA 2KL8A 1RQ0A 2P8IA 1LNQA 3ZTQA 2EK1A 3NAHA 3UDCA 2BQRA 4IR9A 4X2BA 1AYEA 1RISA 1U7LA 3ZNJ1 1JIHA 3M8SA 2BJ7A 4AQYF 2XS7A 3MR2A 1HIYA 3MUVP 2BVZA 2DGWA 2V8PA 4WFXA 4H54A 3K59A 4A8YA 2FJAB 1SC1B 3M8QA 2PT0A 3FFIA 3H42A 4WXOA 4RUHA 4K0KF 1SIWB 2HS0A 1IWAA 1KS2A 2WB1D 5F8LA 2DPJA 4N7TA 3MD1A 2OI2A 4ZVGA 3CC4S 3QT8A 4PQUB 4OHWA 4DV4J 1KD1T 1V3ZA 1WF2A 3D3CJ 1U4BA 4ZPBA 2QSFA 4C3MA 3KLEA 1A7GE 3HHLD 2AGPA 2CJXB 1QVFR 2E5JA 1C1CB 4NLTA 2J8SA 1HBMB 1KQGB 2HQCA 1HI8A 1RP5A 1FRMA 1TZ0A 2VG6A 3DRRA 2WVBA 2J8AA 2FHKA 4JV2A 2K7JA 4DUTA 1OPZA 2VG7B 1HWLA 2GAGC 2ZOFA 4O3SA 4TQSA 3DI6B 3DLHA 4PYDA 3S8SA 5DDRC 2H5JB 2QMXA 3UPFA 3C16B 2N82B 1YWXA 1ZAXA 3BO3A 2ZDPA 2Q79A 3K5OA 3TEGA 2EVZA 4ZIVA 2BJ8A 4TU8A 4ZCLA 5M2PA 3KJVB 4C8LA 2I38A 2YBVA 2KHDA 2XMJA 1D9DA 2DNQA 1C2PA 3QPIA 2E66A 5KFFA 3J81U 2C22A 1R0CB 4GRSA 5J2MB 3W2VB 3DM2B 4GVBA 5KT7A 3NCPA 1MROB 3TA2A 1FNOA 2HKEA 3U1MA 1W2BR 5KFLA 1K73T 4LQ3A 2CWKA 4KFBA 4G1QB 5B0AA 2DY1A 2NZCA 4DF8A 1BGXT 4OYOA 4J9SA 5EDWA 2B4PA 2CZVC 3TQEA 1FRLA 3GYXB 3J7Z5 4LSLA 1U47A 3VF0B 1Y4ZB 2GJFA 5KFCA 2C28A 2W25A 4DCJB 4DR5F 2G2OA 4DS4A 2XY5A 2Y1IA 2P5VA 4OV1A 1EARA 2KTQA 2RKIB 1RT2B 2FVQA 2XMUA 1RWXB 1H7XA 3ELHA 3P45B 5ITHA 4X64F 1T05B 3EYZA 1UKUA 1HBNB 3AB2B 2JL9A 3R3TA 4K5RA 3ZXWA 4ED6A 1HR0J 2V67A 4D3GA 5KFAA 3U27A 5DM7Q 4RWWA 3SDEA 5I4MA 2FLNA 4ZVRB 3TJ9A 3MTKA 1BC6A 3C6TA 5D15A 8AT1B 1EAYC 3LP2A 1CLFA 3NMRA 1GTEA 2APOA 2E5GA 2F8HA 3CNQP 2BV3A 3CT9A 4A8WA 3OFEA 4WZQA 1UZDA 3HFVA 3VAGA 3FFIB 3DHXA 3MM9B 4LF9F 3IN5A 3NG8A 2BYCA 4WE1B 2R7VA 4Y65A 4C98A 3JAMU 1TELA 2D1CA 3HULA 1T8EA 5L1KA 3RBEA 2XTJP 4QWDA 2R2TA 5HP1A 4URGA 4Q8FA 1QDUB 1TK0A 2HHTA 3BJYA 2VPXB 4R5PA 3KLGA 3N79A 3FBCA 3BQ1A 2Q1LA 4OZLA 5KT4A 3VALA 3Q2SC 3MD3A 1J5OA 2FVPA 4LF7F 2LFVA 3J7AN 3M8PB 1SC4B 3C15B 2P9EA 3MMAB 2CYYA 4HACA 2OUGA 5EGYA 5KT3A 2FVCA 4HEA9 2HBQB 5I3UB 3NXZA 2NR0A 2ZDOA 2DNOA 4B3TJ 1C0TA 4R5PB 1VBZA 1T9UA 4FP9A 1PYOB 4TY9A 3MMBB 3BGFA 3DGPB 2CPYA 4ZVHA 4MK9A 4USWA 4ZJQA 3F73A 3RYLA 2IC3B 3M05A 4ER8A 5D77A 1RYSA 1QUVA 3AH6A 3CD0A 1OQ6A 4RW8B 3L7OA 1Z1ZA 2HHUA 1RI7A 4DSLA 1VRUA 4CO4A 3MEGA 2W4PA 2CPEA 4F26A 1NB7A 4WZMA 3GYGA 2CKWA 2OJ3A 1VI7A 3LALA 4J9LA 4GC7A 4ED7A 3MPVA 4YN3B 3LP2B 1NPPA 2BM1A 2ZE2B 2E1CA 2BACA 1I6JA 1U6FA 3TW0A 2O67A 5AXMA 4EBCA 4A8KA 4DLEA 4CNYA 4ZJOA 1C0TB 2QZ8A 5KFDA 3OHAA 1TR0A 5KOXA 1TL3B 4RU9A 2R3VA 3V4IA 3RB6A 2BQUA 3NNHA 2IMWP 3V5RA 2YWWA 3NWGA 2R8KA 4IUFA 4I67A 3QT6A 3GLJA 4C8YA 1RZMA 3HJFA 4ILLA 1CPZA 4YDXA 5IOLA 4DQPA 1ZZNA 2DGOA 2O3DA 1TL3A 4IDKA 2G9OA 3DRPA 3FBBA 1ZPVA 2GIQA 2XSJA 1SQGA 4ZPWR 4NA3A 1U6BA 2HGLA 2Y8WA 2ZVSA 1UEUA 4TXSA 3S7RA 3NOCA 1TVRA 2D69A 2DEJA 2D7SA 3HLUA 3EUNA 3NS7B 3KUEA 2HRTA 3QWUA 4ZIWA 2AGQA 1YGYA 2VBXA 2U1AA 1B70B 1X4AA 1LWEB 2ILZA 3TOQA 1UTAA 4RBUA 5KFMA 1GEHA 5J2MA 1B3TA 4PZVA 1F2GA 4NCBA 1EHWA 2E44A 2CJBA 1CC8A 2B4UA 4X4PA 4XDCA 5D6GA 1R0BG 1WUUA 2DNPA 2J76E 4QW8A 3PW2A 2GW8A 3J7YU 1XK8A 3QGGA 2UXCJ 3C16A 1H2TZ 3M2RA 2P9GA 3KYLA 1U8WA 3ET6A 4R8UB 4ECTA 2AX0A 3EJMA 1ICEB 5C42B 3JTOA 1SPBP 4YMEA 1SJQA 2B7CB 2RKIA 2VG7A 2IM1A 3M1VA 3N28A 4JI8J 4O0IA 2OEKA 3HXMA 4B9LA 3IRXB 2M52A 4ZPAA 1RU2A 4Q44A 2CJYB 3HHLA 4LSZB 3BR8A 1S0MA 3P4UB 3PEJA 3P49B 5KFEA 1HFEL 5FLXY 1U8SA 4CT8A 4NXNF 1S59A 4F36A 3AXMA 1DURA 4PQAA 1P27B 4KBIA 3R9LA 5AXNA 5A8RA 2FHMA 3TI0A 4DQQA 1ZTWA 4F3OA 3I9V9 4NMLA 3I0RB 4KKOA 2LMIA 3M9NB 3C46A 1G1XA 3QWPA 1BQMA 1WTBA 3D68A 2AT1B 3KLHB 4ELTA 3NCQA 4USKA 1OSCA 2K3IA 3OTOJ 3SV4A 2EBEA 3HSGA 4LF2A 3DU5A 3BF4A 3IR6B 1VQ6S 2CQIA 3BV8A 3P5BP 4KSEB 5ETRA 3WDOA 4IQXA 2HPUA 2HQDA 2RUSA 2C2OB 1JXLA 2ZBQA 1LFPA 3G82B 4I0WA 4NLOA 3JS9A 4CLFA 4EWTA 1IBLJ 4KJIA 1Q1KA 3QBCA 4RO0A 4F50A 4F4YA 1FE4A 2RSQA 4M63A 1N33J 2VKRA 2FY1A 2V94A 3IBWA 1X8DA 5D78A 4G65A 4J91A 1S1VB 2WVDA 3CDUA 4FF4A 3R2CJ 5L9NA 3G6ES 4WFZA 5CZVA 3DDNA 1F6TA 2ZBPA 3KLIA 2C3MA 2JWNA 1J27A 4WFBQ 3MUTP 5D4PA 4PCQA 3BR9A 3VAKA 2DO4A 5K9FA 4IRKA 1NU4A 1Y3JA 4DPXA 4MIBA 3M8YA 5A8KA 1Q7YT 3KLEB 1TKTA 2D3ZA 5HQ8A 1YZ7A 4OI4A 1SJRA 2XS2A 1IWGA 5LL6d 3W8GA 2XCAA 2JEJA 2G1HA 3TZZA 1JNRB 1YBTA 2KDOA 1KLMA 3Q22A 2KRBA 4TVAB 2VZ9A 3JSMB 1FJGF 2FZGB 1GXLA 2GIRA 2KYXA 2LQBA 1RCOB 1H6KX 1M5VC 4BDPA 4ECQA 1GXUA 4DV1J 3AOCA 2FJXA 3DGVA 3PFEA 4YR3A 2K1RA 3KMQA 4Y2KA 3I4PA 2HIYA 4CO0A 1SB6A 1LEOA 4FDFA 2YKPA 2M5YA 4K59A 2OP5A 3MM7B 4EU0A 4ZCIA 2NYIA 5C25A 2WONA 1S1WB 2XYHB 3H4BA 2X1AA 2GIFA 1PAEX 1FO1A 2EPIA 1YJRA 2W1BA 4ZP8A 2MZSA 1J2VA 2XULA 1TUGB 2HAFA 3OFGA 1FJGJ 4X4UA 2HMIA 5MLCV 1SKSA 2GVZA 4DFJA 4LFBF 4F04B 2XHCA 3PFOA 1IBCB 1S9FA 2K7KA 1TKZB 1VQNS 3QSIA 4QW9A 2F40A 3BYRA 4JI0F 2AEMA 2HVDA 4LF5J 2BJEA 2DB1A 5KFTA 3MCSA 2FGOA 4M5DA 2BE2B 2AQ4A 1LWCB 2W4CA 5CHCB 2IPOB 5HMZA 1D9FA 1RLCL 3NL0A 4HKQA 4U7CA 2Z2YB 1FJEB 1VIXA 3V81B 3MM6B 1U1PA 2MQQA 3HO1A 1N52B 1X4GA 1FD8A 4ZJLA 2N7CA 4L76A 1SH2A 1NXIA 2ZH9A 1N33F 1TMJA 1RT2A 2AX1A 2B43A 2XHWA 2IVMA 1SCJB 4HDHA 3THVA 3L4BC 1U45A 3IO1A 1OQ3A 4R25A 1QAYA 3PIPQ 1EQ0A 2QMWA 1H7WA 3TP2A 3MDFA 1QE1B 2KT2A 2QMUB 3RG6A 4ERDA 3RB3A 3BH7B 1U49A 2XWYA 1Q5YA 2PN6A 4O4GB 2AYGA 1UA0A 4C9DA 1PO6A 2W7AA 2Z2LA 1GMWD 5DRKA 2BE2A 1HD1A 4KHPJ 3EDRB 2PEBA 4U7UK 3DLGA 1QSSA 2EKYA 2DJWA 3B54A 4DV6F 3GSIA 3TANA 1VJQA 2MZQA 3HFZB 4WIQA 4WWSA 3ZZZA 2CJQA 3SQGA 1NDPA 1TKZA 1RHUB 2PMWA 4M95A 2ERRA 1WNEA 1WG1A 4MTPA 3M8QB 2J7WA 3MEKA 4PAAA 5A8RB 1PAUB 4Q0BA 1IQZA 1PSDA 5LT5A 4LVNP 2FPHX 1JXEA 4NYPA 1D0EA 3VGUA 3PY8A 4XPCA 1CS4A 1DLOB 3GR0A 2WONB 1G2EA 2KN4A 2KZMA 1ZH5A 4DPWA 3HHKA 4KGMA 2CQBA 4NLUA 1F9HA 2NSBA 4FVMA 5FDLB 3CJQA 3G4SS 2MTLA 2MY7A 3TUZC 1NK9A 1G3OA 1VR6A 2P9CA 1RTDB 2B5JB 4GO7X 2AIRB 3I5BA 2CWXA 3UVJB 1FNXH 1JLCA 3Q89A 5L1JA 2J9CA 2C1EB 1HWJA 3GJRB 1S0NA 1L3VA 1SV5B 1UJ6A 4DDFA 2WSEC 1X4CA 3D66A 4ES2A 1OSDA 3MECB 4ES3A 2D9PA 2H5EA 3AFGA 4MYUA 2WRMA 1WC4A 4OYBA 3TX8A 1YI2S 2DVIA 4DUZJ 3RW6A 1O5JA 4ZITA 3Q24A 2XZWA 5L1IA 5FJ4A 3PX0A 2KJVA 1FWLA 1RT1B 4QJVA 3IR5B 1NPKA 2P6SA 4AUKA 5LXYA 5ETNA 1OJ4A 4ICLB 1TFYA 4DJBA 4FS2A 3OVAA 2Q3PA 3LPYA 1UEVA 1O0PA 3EZ5A 5IXUA 2O1PA 4Y0FA 2BQ3A 4I2QA 3HVWA 1WG5A 2PMHA 4IFYA 2R9LA 3OW2R 3IWXA 4ZS6A 2KFYA 2YWGA 3T1AA 4I4BA 5HJYA 2OSQA 1RXOB 2B8PA 1AZSB 1MU2A 4ED8A 4L3NA 3JQMA 2CUYA 4UUWA 5D4NA 1N36J 2ZBCA 1NUEA 3A4TA 3T41A 3J81j 4LF6F 4PWDB 2QSWA 1I94J 1HI0P 1I1GA 2YNFB 5GAEU 4PUOB 1PJ5A 3HD1A 4PG8A 1JJ4A 3R97A 1RAOA 2GNKA 1VRQC 2V69A 2C42A 2VASA 1S97A 1X9MA 1KWMA 3SFUA 3ITHB 4I6YA 4F2SA 2MJNA 4H4MB 3LPEA 1HHTP 3OSPA 2MZRA 1K9MT 7FD1A 1UW4A 3IGNA 2QJ3A 2XMVA 3DYAB 2ZM6J 1CJVA 2M9KA 4OYIA 2M7SA 3MECA 3UDLA 4A8XA 4K4WA 2YKNA 4WK3A 3U1NA 4YB7A 4UY85 2G2YA 3I32A 3NCRA 3DGPA 1EZZB 2C3YA 4LF6J 3H98A 2ALZA 3O3LA 1RT6A 4B3OA 5C2CA 4URSA 2V8VA 4OIXA 3QFHA 4DSEA 2IM0A 3NRBA 1X5SA 3FCHA 4P9SA 4A8MP 4IG3B 3KLFB 5DG7A 3SSQA 4USUA 2CJKA 4MKVA 5AJ3J 4C6AA 3Q8QB 1RT5A 4Q7AA 1SL2A 3N5BA 4OHVA 4IG0A 4OFZA 4Y28C 2RNEA 3DYAA 1DQAA 1WHYA 2HLUA 1F3FA 4DR1J 3MM8A 3TQ1A 2E1MC 2CPJA 2H54B 1IXKA 2BW2A 2DIVA 1SJ4P 1CJTB 1Y00A 4NMXA 2DHGA 3O5TB 2VG5A 1S6OA 5U47A 3R8YA 1YK9A 3PYEA 2R2SA 2KZZA 4RW9A 4DF4A 3IG1A 1OYDA 3AOBA 2DY9A 3MM8B 1KTQA 1SI9A 3BO2A 1VMBA 3JSBA 3OUYB 2QLXA 3VVTA 5LM7E 4IDKB 3CGIA 4QPXA 3OJSA 3PTWA 1KONA 4NOHA 4NLYA 2UUAF 4UY8T 3KG1A 2ZKUA 3AY0A 3SI8A 1NLKL 2XYPB 2VFVA 5DQGA 1IKWB 3CCQS 4KE5A 3ZFVA 1L3TA 4B3OB 3B4MA 2CQCA 5ETPA 4QYZJ 3I5AA 4JYAF 5BR8J 4CI0B 2DITA 2A10A 5KFSA 4KO0B 3LP1B 2NUUG 3OR1A 4F0MA 4ED5A 2EFQA 2JVOA 2OPQB 1VLYA 3BGRB 1XQIA 4ZVOB 3M32B 3W8PA 3GQCA 3DRSB 4C3KA 1VC6A 3JSYA 4W98A 4ICLA 4CLYA 1ZAVA 1QTMA 4Y2IA 4U96A 4OV6A 4N47A 1MWZA 1FKOB 4TN2A 3W2WB 2H3EB 2NXNA 1FXRA 3ZNUA 4A46A 2YX4A 1S6QB 3G2XA 1RAFB 2OHDA 4RLEA 4ZVQB 1UCNA 3D6MB 5DQHA 4GKJJ 4O3NA 3GPAA 4NL5A 2ZD1A 5IT4A 1EKRA 1OIAA 2KYZA 4IG3A 2M8HA 4DFPA 4PWDA 3DU6A 1VOMA 3VAJA 4USTA 4MYTA 4DN0A 1OO0B 5LMNF 3Q8SB 1N36F 3BKFA 2XS5A 2PD1A 2CQ1A 4WTOB 2CPIA 2OAUA 2DNZA 2Q6BA 2XI3A 2HBRB 3B6BA 1F0XA 3R5CA 3TUPA 4CIOA 2FGCA 2UXBJ 4F0KA 2BABA 2Y0SD 3I9ZA 3QZ7A 2HAIA 1U02A 4HVZA 3R2DJ 3ZTPA 4GKKJ 3W65A 2ZZTA 3MR3A 2BE7D 1HW8A 2MKHA 1RTZA 2KXFA 1BLUA 2MKSA 3N9UC 4OZJA 2IBKA 1WKLA 4YEAA 2C3OA 3FRYA 1YJ7A 1FJ7A 2CRLA 4B9SA 4L74A 5J1NA 3EPIA 2ADBA 1W25A 2X1GA 3TA0A 3FEXB 4RBVA 1XNQJ 4WFNQ 2YNHA 1ZM2A 3C14A 5E3AA 2XCPA 1VQOS 5HMXA 2DK2A 1S7IA 4BBYA 3BGOP 4D3HA 8RUCA 3TARA 1DRZA 4CLUA 3MM5A 1J5EJ 1DARA 3M9OB 1NB2A 2B6AB 3QIPA 1NK8A 4OZ1A 1SKUB 2GC8A 1BQNA 4C8OA 4Y34A 1KVKA 2VPWB 5K8MA 1KSPA 4M5IA 3W2VA 1M5SA 4QBUA 5GAHU 3OL8A 3SQGB 2DO0A 4WFYA 4M5LA 4JV0A 3TVKA 3DLGB 1B0TA 1ZM3A 1XR5A 1KNZA 5H9EK 1YITS 4DZDA 5K20B 7AT1B 2HZVA 2QIFA 4CH7A 2EG2A 2CNKB 3M2UB 4OHYA 3FQKA 4FBUA 1BUXA 5CAAA 1WDTA 3EM1A 3FSXA 2VUGA 4JI1J 5KG7A 2QLBB 3ISZA 1WHVA 2BW7A 3MEEA 3QJLA 2VC0A 4K4UA 1QY7A 1QTNB 2PA3A 2ZKTA 3S6EA 2OLWA 3X1LB 1C1CA 3OR2B 4QU6A 4KGXB 2G0IA 1WC3A 1NK0A 3BPSP 1S1XB 2VH7A 4NLRA 2R8HA 2VJUA 4Q0BB 2HFOA 5KTQA 2J0WA 2JEGA 3HK2A 1SQEA 5CCLA 4C0OC 4B3SJ 4ECWA 2AGOA 5K14B 5LSLA 4OYAA 1TKTB 2CPDA 2E5IA 1RJJA 3O44A 2XB2D 2C2ZB 4CO3A 3A12A 2BZ2A 2XQCA 4CO2A 4K0KJ 1MSWD 1XJWB 1KQFB 3KK1A 4X62J 1LV5A 4XAKA 3PJ9A 1HYSA 2J6TA 4LFBJ 3PKYA 2OPSB 1F1BB 1WWHA 3BKUA 1TVRB 3OPKA 5L9XA 3I56S 4DS5A 1RWKB 1RWUA 1ZA1B 2OD6A 5B0CA 2MQOA 4WJBA 1RK8A 1V5VA 1Q8LA 1XMQF 2F4VJ 1Y5IB 1TAQA 2E1PA 2W01A 4O3PA 1R8PA 1NEEA 5HQLA 1HNVB 1IKYA 1JB0C 1E6YB 1ZOTA 3PHEA 1YJUA 4M1KA 2DNKA 3CJ2A 3CD7A 3QRQA 2AU0A 1M5HA 4DXLA 1JLBA 1MMDA 2N4DA 3N6NA 1KLMB 2GVDB 4LREA 4TYAA 4ANEA 2MYFA 5CZXA 3GWCA 3JSMA 1JKHB 4EBEA 2HVHA 4ZPTR 1KHWA 2RDDA 1HNWF 2DT9A 4IFVB 4KYZA 4C0HA 4DV2F 1EX8A 2AYMA 5DDPC 3CXCR 3UCUP 2MDAA 3EICA 3KJNB 1VQKS 4NX9A 2CG8A 2W9BB 3RAXA 4J9PA 3FSIA 3W1YC 3KG4A 4J9MA 3DLKB 3ZZUA 3MAQA 3DOKB 2W2MP 4I2PB 5C7PA 4WBFA 1WG4A 1S1VA 2ILYA 3JYTB 4OJ1A 3V4MA 1RA7A 2XLJA 4G6VB 5DZ7A 2OMLA 3OLAA 3T5HA 1XMQJ 2R7SA 1AFJA 2N4CA 4LSNB 1Q0NA 4J90A 2JLEA 3RR7A 3QT7A 2FHJA 2B3TB 3Q83A 1TV6A 4ZN3A 4IRCA 1MG7A 2MGZA 1YJVA 1S6PA 5T7LA 5D4LA 2IYIA 1XNRJ 4NZ0A 2ZH6A 2FC8A 5A8WA 3QQCD 2VBYA 4Y6IA 3QAUA 4C8NA 4IH5A 2FD2A 4DCPB 2DCUB 2HW3A 1VIOA 2LQ9A 4JI0J 2UUCF 2MEWA 2Y1LB 3W9IA 3VAHA 3EMTA 4X66F 2GO9A 4HHHA 2BXJA 3AJ1A 3SBMA 3MEGB 1K0TA 1EIYB 3OT9A 5IFMA 3CULA 5CXTA 5A0YB 2PI4A 2J7UA 1N0VC 1FKOA 3W2WA 4OX9J 3W5XA 4UT4A 5A2QU 4DLGA 3UD4P 3RB0A 4DR3J 1LWXA 4Z7CA 1NHVA 3AQOA 2FJDB 3WIVA 3H2UB 1BE4A 3MURP 4DUYF 1PJ7A 2LQ8A 4M5JA 4C7QA 4DHVA 5KFQA 2X1FA 3QRRA 3M6XA 1IUJA 2HLTA 2QO3A 3F0NA 1FRKA 3ISNC 4Z2XA 1S6UA 3K58A 4DV1F 3I96A 3EX7B 5HSPA 1TL4A 4RZRA 3T5JA 2VQFJ 4F4KA 1HA1A 4ANDA 4I6AA 1NJYA 3SYZA 1T0TV 2CA9A 4JI1F 5KFRA 2DIUA 2J7KA 4NLPA 4Q43A 1IQTA 4FBTA 1ZTTA 3I0RA 2PFFB 4ZVPB 2WVFA 1C1BB 1UMJA 1AXQA 1PILA 1R8HA 4NCGA 2CJAA 1K44A 1MROA 1RHRB 1YSJA 1RAAB 2ZBRA 3LP0A 1JNZB 3ZO7A 4OMFG 3PV8A 1TAUA 2P2CB 3GJSB 1R6YA 3CB4A 4C8MA 2MB0B 1XEZA 2W9CB 4O3OA 3B78A 2HYIB 2DXFA 1RT4A 2DD8S 2RE1A 1RCXB 1IBMJ 4Q45A 1FHTA 4QR1A 5ETLA 2IAJB 1SKRA 4JI7F 3KJVA 2AWZA 2CFXA 4YQWA 3PW0A 2UVRA 3IWLA 2VBWA 4O4GA 1R3NA 2B4VA 2GHWA 1IKVA 2MJUA 2V2KA 3CCWA 1N5QA 3H2VE 4MK7A 4RW7B 4Y00A 1AUDA 3RR8A 4AYBD 3E01B 1JLFA 5KFGA 4KY3A 1YX2A 2ASYA 1CSJA 2HWIA 2DH7A 3W61A 1RHKB 3CVKA 3THTA 1VLOA 4LF1A 5DLGA 3RRGA 1NHUA 2VFSA 3DRRB 2VONA 1TKXA 2GQQA 2E9RX 3DRYA 4JI6J 1K47A 3CJ8A 4NYOA 4XTTA 2AJFE 3UO0A 2YKOA 2CQ0A 3DLEB 1U24A 3VGTA 4J7CA 4YR0A 3C6UB 3BN4A 5E3RA 2IA6A 4C3LA 3DDIA 4M8LA 1WC6A 2DHXA 1WF0A 3CE8A 4V1Ak 5AJ3F 2X7IA 1R7IA 3DLJA 4DV7J 1J5OB 3OL7A 3QLHA 1QAXA 5F8IA 1T9VA 3T1YJ 1KR4A 4LRDA 2RQCA 1JLBB 1H38A 4B3SF 1KN6A 3DOMA 3V6DB 1HQEB 2QFIA 3KMSA 3CDEA 4PUOA 4JUZA 2BOPA 4KB7A 4N56A 4ECRA 3F41A 4FYXB 4OJHA 3H5XA 4BLGA 3SCLE 3MMAA 3L3CA 4NLVA 5KAKA 4ZVEA 2EC0A 2LKZA 1O51A 3HKZD 4UTGA 2JEFA 4USVA 1HQEA 1Q8IA 2RDIA 2JLFA 4NA1A 3CMES 1RWWB 2B0GA 3TRGA 2FHOB 1RTIA 3K7RA 2R7RA 2EC2A 3I0SB 1DZ5A 4B08A 2EG1A 1CULA 1FDDA 3NS5A 1X0PA 3V6HA 6AT1B 1IN0A 3D0HE 2KB2A 1Q82T 4F8RA 2GX8A 3D6HB 4CO5A 1DJ0A 1B99A 1P1TA 2JSXA 2ROGA 2Z30B 3NGRA 4P73A 2KO1A 3DLEA 2QX0A 4AD6A 1DFDA 3M2VB 4IYQA 2JZ5A 4O0NA 5HANA 5HQMA 4GC6A 3PW4A 4UOGA 3EGVA 5J2NB 1U1QA 1UFWA 3CJ0A 1ITPA 2NREA 3HSJA 2HZAA 2IVYA 3M6UA 2LEAA 3GILA 3NY0A 2VIHA 2L9NA 4NYZA 3Q0AA 1S4EA 2CZ9A 2FQQB 3Q8YA 2W7PA 2OH2A 1WOSA 2F8EX 4LF8J 1X4DA 1V3RA 1M1GA 4PYAA 4UOFA 2UXCF 2VPYB 4NI2A 3ZTRA 3CCVS 3HKWA 3MEEB 1FNMA 2RILA 4ZCMA 1HNIA 3IWNC 4DPUA 2B51A 2W4DA 2ZJQQ 4ZPCA 4GKJF 3FK4A 1UEKA 1GFWB 3ENWA 1IBKF 4ILMA 1F2HA 1TKDA 4LSLB 3G82A 1HBMA 3PW7A 4UZBA 4RUBA 1FX4A 3FEYB 2MQMA 3KTQA 3AD9C 4Y3CA 2R8GA 5E33A 1HWUA 2I1RA 2ZZMA 2XC9A 1JLEA 3G8TA 2E1RA 4FPIA 4RW8A 5J1EA 2C2MB 4JV5F 2KVIA 1WACA 2AJ1A 3BQ0A 3WQPA 1L3UA 3CCTA 3TVZA 3PR4A 3MWBA 1HWIA 4ZMMA 4DG1A 4H4KA 1Y5NB 2NXEA 4KHRA 1DBDA 2YKMA 1FWKA 1WJ9A 1GTHA 2B6AA 3BN7A 4PEOA 2HHHF 3PVXA 1EETB 2HMIB 5AXKA 4DR6F 5F8NA 1HBNA 5T41A 3DI6A 5J1PA 3OXLA 2KM8B 4ZP9A 3GYNA 4CYUB 4I69A 4ZLPA 5KFUA 4OX8A 2KFNA 2FUG9 4ECUA 1H72C 1U0HA 3LA0A 3MCNA 3NLCA 4LIWA 1HBOB 4LBIA 5CYMB 4O4RA 3VZIA 1X9SA 3BM7A 3RAQA 3ILOA 3SSRA 4QZVB 1X5PA 4N76A 1XNQF 1HWKA 3KK1B 2HQGA 1LKZA 3K8WA 3DN9A 1XMOJ 1C4AA 1SH3A 4LF5F 2HHHJ 4DV2J 4DG1B 1KOOA 1R6VA 2Z56B 3AQPA 3J80U 3BDEA 1K1QA 3MPUB 4NRTA 4F4AA 4YHHJ 4DSFA 1KFSA 4EFAC 4JV5J 4O23A 3W62A 1S9GB 2WBRA 4DEZA 2HQFA 1FTRA 2JJ4D 2B9XA 2NPIA 4ENOA 4FN5A 4QWBA 4NLQA 4K7QA 4FXDA 2OMOA 1VCTA 1BQNB 3ILLA 3PEHA 1EP4B 5KFYA 3TNVA 4NLXA 3K5NA 1S6PB 2FJBB 3A3NB 4USHA 5T7LB 4BWJA 3TX0A 4UOHA 1P1LA 2HRUA 5I42A 1UFLA 2MSTA 3GIKA 4DR4J 1HLWA 3OV7A 4DR2J 1BMQB 4Q5VA 1H3DA 3UI3A 1RAEB 3MM7A 1KDNA 1Q95G 2YNHB 3HF5A 4FYVB 1IBKJ 1TL1B 1NHKL 1N4LA 3DLLQ 2LCWA 3FDSA 3PDNA 4OYPA 4NI2B 1S99A 4KQZA 1IKVB 1IR1A 2E5HA 2JOQA 3KWMA 4QR0A 4TQRA 4IO1A 2R4FA 4NRUA 3OFFA 2RF2A 1X4HA 2D9OA 1WKKA 2WAQD 2J6UA 3PO5A 2Y9HA 4X66J 5MAOA 2VBZA 4RNFA 5CCMA 4YHHF 4ECXA 4EO8A 1WKJA 2XMAA 2ZC3A 2GS8A 2YKQA 2YKAA 2CADA 1VRUB 3NGDA 3GIJA 4U9RA 5G0RA 4KIAA 5DG8A 1A0OB 3F44A 3J81Y 3SV3A 1RBLA 2HNDB 2I5JA 3H20A 2GMLA 2DR5A 2OPQA 4ELVA 3FC9A 4V19J 1GMWA 4ALZA 5E3QA 3RBXA 1EQMA 1U0HB 2DISA 1WEZA 2MZJA 3HJVA 3K8VA 4MIAA 2UU9F 3CDBA 4PPZA 5AT1B 1S0VA 4IOBA 1BWEA 4ES1A 4B3MF 4OYXA 3I5CA 4YP3A 5F0UA 1Y7PA 5E7OB 3CDAA 2AV5A 3W9JA 1FEEA 1GX6A 5LSRA 2DNYA 1FKAF 2NZ4A 3HVTB 5HVFA 2OPSA 5D0RA 1S9EB 4L6V3 3R7SB 1JWWA 2GFFA 2CVEA 5EN1A 2VODA 3FRZA 1WI8A 4GKKF 2RH3A 5DLFA 1LWFA 3D6TB 3DFEA 1XTZA 3IG1B 5K8OA 4JI5J 1HD0A 1ZZFA 4OQJA 1M1HA 4QQBA 4PKDB 1KEKA 4NLSA 4JI3F 5KG3A 1WC0A 2CDQA 3CMAS 5KFVA 2M4MA 2BM0A 4ED4A 2XY6A 3BGRA 5HBMB 4WCEQ 2HHQA 3RBZA 2UZAA 2AYBA 3HHNB 1MN9A 3G6XA 5IT9Y 1RT7A 5HATA 5A8WB 3KK2A 4UZCA 6FDRA 4W92B 3R7NB 3FZBA 4XIUA 4EEYA 4C97A 5BXIA 2RMLA 3AJ2A 3JTPA 3W3SA 1D3WA 2WOMB 3E01A 3G8SA 2NXJA 2X1BA 4ID8A 4TLRA 4R8UA 4CWBA 3GU0A 4KH1B 1WC5A 1UP1A 2ZNZA 4WXWA 3M2RB 1Q79A 2JDJA 4OI0A 1AT1B 4IOCQ 2OGUA 3TVYA 2ACMA 2XNRA 3CJTA 4S0MA 5IZHA 4NXMF 2FIUA 1NZAA 4ZPDA 4LFCJ 1QJHA 4A48A 4DUYJ 2C2RA 3MOZA 3DOKA 3NGUA 4ZLJA 1RGVA 1HBUB 3MAHA 3D0GE 4NXNJ 8ATCB 1FA0A 2V4JA 2AJQA 2KXNB 3PCOB 4CP5A 4CNZA 5RUBA 2JFDA 1F60B 1RUSA 3N6MA 1VRTA 1XC9A 3H4DA 3MAAA 4TU9A 1Q5VA 1APSA 3VTIA 5M2RA 1DY3A 4EMDA 5I3UA 3TR5A 2CQ2A 3EE3A 3EGNA 4CLTA 2RQKA 5C24B 2J0QD 2B9YA 4K5SA 4RU2A 2QTWA 4PXEA 4DPTA 4MFBA 1YHQS 3BSNA 1HPZB 4DPOA 2R2UA 4EK2A 3BEGB 1XR7A 3FKBA 1VK8A 3SFGA 2GJIA 5J2QB 1HHSA 4L73A 4B9UA 4KRWA 1UVLA 2HS4A 1WSRA 3HDSA 2WVCA 2HFSA 1HNXJ 4X4OA 5EX0A 2PEHA 1IM4A 4IKAA 2C3UA 4P6QA 3R5GA 3ZZTA 5HMYA 1FCAA 2F4FA 3NAIA 3QLHB 4DR2F 1VRTB 4V19X 3CUNA 2ZHOA 3LOUA 3TYTA 4QWCA 2VOPA 1RTJB 4QIGA 2I8EA 4XO0A 4HLBA 4EBDA 4NLWA 5D0HA 4CM2A 2UUBJ 3HHLC 4DR1F 3TAMA 2GCFA 1UWBB 1S48A 3OFHA 1T03B 3ZZ0A 1M90T 2JFKA 5GMKa 2Z4PA 2JH3A 3K5MA 1NAQA 2VJVA 1NKCA 3R6GB 2DXEA 3BZQA 5EUHA 2XM3A 5CH7B 1VK3A 1HHQA 2X51A 3T1HJ 3MOJB 2KRRA 3T6JA 3R1HA 1S1XA 1OY8A 2UVVA 3CJRA 2HBYB 3H0PA 2D3OR 4WPAA 2Z58B 5ETSA 5BR8F 4P2FA 4LF4J 1QSLA 3U1LA 1VQ4S 5G4DA 2ASDA 4TNOA 4B3MJ 3QJJA 3GFHA 3L7UA 2YQ1A 4RW7A 2JLGA 3KXDA 1LXJA 2V4QA 2I0XA 3MCOA 4FPRA 5ETMA 3PO4A 1URNA 1PCAA 2WSCC 4JP8A 3TA1A 1H0HB 3RAMA 2KKHA 1IM6A 1DLOA 2DGUA 4KGZB 4RPFA 3KHGA 2ZHAA 3JYTA 1N5SA 3PR5B 1HARA 1XWLA 2R42A 2BBEA 2YWEA 2JC1A 3CIMA 2W9CA 1RA6A 2HRYA 1N34F 3DLKA 3PNIA 2LECA 2XMMA 1RU1A 3MMCB 2ACYA 2N7YA 1KBRA 1P9YA 2CQHA 2XMTA 9RUBA 5K14A 2R7WA 3BREA 4DV4F 4ECYA 2E9TA 2MKCA 2LU1A 1HMVB 3ETOA 4W90B 3AB4B 4CLWA 1BY9A 2JC0A 1FRIA 1RB0A 2GVDA 3MEDA 2DTJA 4P71A 4ZLLA 3OSNA 2B7BB 5BYSA 1SJ3P 5DQIA 5F41A 3VR1A 3GIIA 6FD1A 1QE1A 4MIWA 2Q6CA 1I51B 2OEMA 1X7VA 3ADAC 4U8YA 3W63A 2VFTA 4P2MA 4F4WA 2GV1A 3M30B 4FYDA 1UAWA 2IIHA 1KTVA 4JI8F 4PXDA 2QL9B 1CS4B 4M5KA 3QGHA 2UU9J 1T02A 2ZOMA 2HVEA 3UW1A 3HFKA 4E2FB 2OPPA 4OYZA 5ADZA 5F8GA 1Z2ZA 3SXLA 4LT6A 1R8AA 5KFJA 3MFIA 1U1OA 3LTOA 3PRDA 4JOUA 1URRA 3BSOA 4KGKA 3ENAA 3G86A 2CNLB 1FK9A 1JLQA 2E29A 2VG5B 4M5DB 4YS2A 5CABA 3DLBA 3HVAA 4WKRA 2G0CA 1IR2A 3RRHA 4EYHB 2D74B 3POTB 2F5GA 3PRBA 2YWFA 2XG8A 4DQIA 5J2PB 3M8WA 1W7WA 2YX1A 5HK4A 5GAGI 3I82A 3J7ZT 1Q78A 2F3JA 4PRFA 4K4XA 3UDVA 1FDNA 2H48B 5KFPA 9ATCB 4ECVA 4J9UE 2XO7A 1NH7A 4UQGA 1DTTB 2R7UA 1F9FA 4RNHA 2J6SA 3QIDA 4J9OA 3FCWA 2WW4A 1F3VA 1ZBTA 3CCUS 2RJZA 2OPRA 3GB0A 3OQ2A 1XMBA 3OXFA 4LSNA 5ETKA 4ZVTB 4CLKA 4CLZA 4ZHRA 1VDHA 3U7JA 1B4SA 5GADI 3QZ8A 2QG9B 4QR2A 2WTFA 2K1RB 5JVGQ 3WZ0A 4K4SA 2LQJA 1X9WA 2YKNB 3GFXA 1RWOB 2DKOB 1VQ7S 2UXDF 2J9EA 4HTJA 4X62F 4DR6J 4ED3A 1LW2B 5DDQC 3J80Y 4P52A 2UVUA 3ENVA 3CJ4A 3CO9A 3MPWA 1MW7A 2RQMA 2IFXA 2O5DA 3N6LA 1C0UB 1N5YB 2HSEB 3D1OA 2L3MA 2OTLS 4DUZF 4BHQA 1LW2A 1FT8A 1T3NA 2ZWPA 3K17A 4FS1A 1AFIA 3R7BB 1X4FA 3KJFB 3QGIA 4OI1A 2Y0BB 2FVSA 4LR8A 5A76A 1XMOF 1KHVA 2M2BA 1FDBA 2V9KA 2IYGA 2DCLA 3BBBA 1FFSB 1U2RA 4MK8A 2HFUA 5GVQA 1CQNA 3JAMY 3V6DA 2OD4A 2IM2A 2LA4A 3IS9B 5DS7A 5C5JA 4HYKA 1AA1B 2OKQA 2I6WA 1IVZA 3E51A 1K0VA 2MHEA 5KFXA 2AJ2A 4J5OA 2CG4A 1H73A 2EFGA 2L9WA 4URQU 1X5TA 1RHJB 2XEXA 3PXGa 5IS2A 3T5KA 1EJ7L 1YTYA 5DM6Q 4E98A 4NZ6A 5EHHA 4OL8A 2QRRA 2ZH1A 3CC2S 1VC0A 3TO8A 4X4RA 2DRDA 3EZOA 4KKOB 1PGZA 2M8DB 3HHDA 3CC7S 1T9YA 5DETA 2XLIA 3CWJA 1JLQB 4F25A 2V34A 1GMUA 4DU8A 1S76D 2KG1A 1V9OA 1HL6A 2LXUA 2FJWA 3BO4A 2VV5A 4J37A 3NNCA 3WC2A 3DRSA 4Y2CA 1JLAB 5D4OA 4DSKA 3CIZA 3HVTA 3OR2A 1HW9A 5SZTA 4P2XA 5HI7A 4CCHA 2BJ1A 4UQTA 1M5PC 5C25B 1NDLA 3W5YA 5LMUF 3J7YI 5A2QY 1Q8KA 3PRVA 2ZH2A 3O2IA 1VC5A 3SEOA 5L46A 3PX4A 1Q86T 3FSYA 4LJMA 3GJQB 3HI9A 2K2PA 3CCRS 4WKYA 5KOWA 5H1SV 3BGUA 1LQ9A 1VFJA 3CSKA 3N4WA 4YY3J 3FJ2A 4ED0A 2U2FA 1RTHA 3ZZYA 1WEYA 1KP6A 4LRFA 3D7SB 3MEDB 2MLZA 5J2NA 1IKXA 1DTQA 2EFPA 3RGIA 3KLHA 1PBUA 3RZAA 1R0AB 1ACMB 1VBKA 3QRPA 4OZ5A 1W26A 4AXJA 4CLPA 3H25A 2DRBA 2OTJS 2ZNYA 2DR6A 1JLEB 2E5LJ 2DH9A 1JLGB 2RU9A 1M5OC 4O3RA 3VCDA 1ELOA 2FJVA 1FRXA 1RADB 4P75A 1VQ9S 2EEYA 2A2DA 2DGTA 5KFOA 5CD4A 3M6VA 1LW0A 1BHNA 2AMCB 4WP3A 2DPIA 2XSFA 3A3PB 3CJ3A 2UV8A 4IG0B 4MAKA 3UN2A 1FEHA 2XY7A 4B9TA 1ZYQA 4C8ZA 1R8BA 3UE2A 5IC4B 1S4FA 2FTRA 4ANCA 2ZH4A 3MM5B 5EWEA 2KXHA 2M88A 1T94A 1PIEA 5A6WA 2H51B 3D1QA 3H5YA 4C11A 2N3OA 1NBEB 1OYEA 3G9CA 2OELA 2KT3A 4DQSA 3MF5A 5L39A 3ZC4A 1RAJA 4CTAB 2R7QA 3ZZPA 4MFBB 2QLFB 4N41A 3UNYA 1NKBA 3PYGA 4M94A 3P5TL 2DHHA 2ATLA 2MXYA 4JI2J 4LR7A 3DNCA 3ICLA 4FNHA 4I6WA 3AODA 4P7TA 5B0FA 4CM0A 1WORA 3CO0P 3HMJG 4DR4F 3PG9A 2F9JA 1T03A 1IBMF 1OY6A 2QFJA 1HQUA 4U67Q 3RBDA 2ALYB 2HK3A 3RW7A 3EDQB 1FTCA 3GV7B 4IR1A 2OFGX 1YLXA 5CYJA 4DV5J 3VGVA 3IM9A 3VV2B 1MN7A 1RTJA 5DGAA 2WZ1A 2NCKL 2PSZA 3ITHA 2QA1A 1AUSL 2EI5A 1LWFB 4JB8B 4X65J 2UXDJ 3K0JA 3QO9B 2KVQE 1HNZJ 3M32A 3NS6A 1TL5A 2EFOA 3FEZA 1S1WA 2HS3A 2HGMA 2NXCA 4AL7A 1V6HA 1L5UA 2DYAA 1IBLF 2AJ0A 3GIRA 4ECZA 5BYRA 5HROA 1TK8A 1YBAA 5T14A 4JV1A 4OLOA 1RE1B 2GJ2A 1WTFA 1MMLA 2C2NA 4IRDA 3IGVA 1PYTA 1CEZA 4I7FB 1RT6B 2MKYA 3C8YA 2C3PA 4RX6A 1XERA 2MHNA 1VQLS 3BS9A 1RT7B 2PFDA 1RT4B 2I9SA 3ILJA 4P74A 3JTNA 3TUIC 3R27A 3T9ZA 4HH0A 4P7VA 4DV7F 3UD5A 3UCZP 4A8FA 4HHUA 3TWZA 2V2QA 2FZCB 2H1YA 3E2EA 4LF9J 3QO9A 2IHR1 4TKTA 1S6QA 2HBZB 2R8JA 1BWVA 1FF2A 3CJSA 3JXOA 3LP0B 4TY8B 4K50A 2NSCA 2UXBF 2HVZA 2A6MA 2GAHC 4DL4A 4KT0C 3N01A 2IY5B 4E8UA 4HT7A 2VA3A 3WC0A 4DL3A 4QWEA 4KTQA 4ZN1A 1FXLA 2IBOA 1OY9A 4TYBA 2Y3YA 5IM0A 4CH1A 4J9QA 1YJ9S 1SQFA 2BX6A 5KT2A 2UUWA 4PG7A 4U6PA 4JYAJ 3M1VB 1JLCB 2KHCA 3VZHA 4DV0F 1FFWB 4DX7A 3MFHA 2CIMA 2FJEB 4G3IA 1S1UB 3EXCX 2MQ8A 2WB4A 2RT3A 2BKPA 4H4OA 1YQHA 4Q2LA 1F5CA 3IC1A 1REVA 1S1TB 2BEFA 5FIIA 4X4VA 4QYRA 4DL0C 4C11B 3TAPA 1TK5A 2G13A 3FCVA 2JX2A 1WD6A 4OHZA 3TZWA 5AE1A 3MR7A 3Q8PB 4R0JA 4ED1A 1TQLA 1D09B 2DNNA 2GQCA 2JNJA 5B0BA 1HMVA 1DHMA 2RRBA 2AEFA 5KG4A 1BQMB 3QATA 4G1QA 4N77A 2GHVC 3VHQA 1NJZA 1Q81T 4OI3A 1N6QA 4RW9B 1VQYA 4NCGB 1IR0A 1CJUB 4DOZA 2RRAA 1RAHB 1FI4A 2F7VA 4OHXA 2EKNA 3Q23A 4ZOSA 5JXSA 4ZLNA 3LWMA 3PZPA 2FLPA 2DR7A 2EXUA 4ZP7A 2Q66A 2Z0GA 2XBPA 2LU2A 3I0SA 2V5HG 4IQMA 2AYEA 4PG5A 2W2OP 2ZJRQ 2VU5A 2LEPA 3BGLA 4ILRA 3KK3B 1ZETA 5ETOA 4MKBA 5C42A 1O8BA 4LF7J 4KHPF 2AF6A 2UP1A 3UVJA 4EUVA 2QV6A 2ZC4A 4WYWA 2MLYA 2KM8C 2RUGA 3HZEA 3K2YA 4ED2A 1A9NB 1X0FA 3T1HF 2YH0A 1HQ2A 3GFZA 3DOMB 3IP0A 2YPZA 4F3MA 4A8SA 3R5JB 4B9VA 1CJKB 2HNZB 3M7VA 4CRJA 4QIEA 3KNGA 2V68A 1N54B 3D6FB 4KFBB 3W66A 3MAAB 3WHIA 3VAMA 5E3CA 2K8GA 1C4CA 4OX9F 4KV8B 4LFAJ 3WBZA 1S79A 1LWCA 3UR0A 4WIIA 1N8RT 4MJKA 4HI1A 2COLA 1S9GA 2HQ3A 1RWVB 3Q86A 2LDIA 3GCXP 4G1IA 2V4JB 3R6LB 1FERA 4B02A 2L08A 2RHSB 4DV5F 1QUPA 1TP7A 2FB0A 3DMJB 2IC3A 2QC3A 3H5UA 4PWUA 5CQGA 1U1NA 2EW9A 1UVMA 1TKXB 4JI5F 2YX7A 1U6ZA 4NWBA 3PHTA 5LOQA 2RF2B 4RW4B 5M2UA 5I3PA 1D8YA 4CO1A 3A8IA 3NOGA 2ZH8A 2PI5A 4L3KA 4RBTA 4FKXA 1NSAA 4ZVFA 1IKYB 1E6YA 4L72B 2DR9A 4MT1A 4A4JA 3JB9k 3A8KA 3C19A 1N32F 1CG2A 3KG0A 3SMZA 1F9EB 2CDRB 2QA4G 2E9ZA 2CJ9A 2YNGB 3KKFA 3IA0A 2GHPA 3V4IB 4DR7J 1PC4A 2HHVA 3C2PA 3CD5A 3LANA 1K8AT 1UW9A 4ZKAA 1KFDA 3GG0A 4DL6A 3A8JA 1KKHA 3CW2C 4A47A 4DR3F 2OO4A 5HBMA 1WOPA 2YKMB 2I2YA 2V50A 3A1YG 1TL7B 2WBMA 3GIMA 2JVRA 2DGXA 4ETZA 3IBCB 4IOAQ 4DV3F 2F4VF 2C2KB 3RB4A 3O6QA 2GGPB 2W24A 3MGJA 4NZ7A 2Y8YA 2DGQA 2AP6A 1QLNA 1FESA 1AROP 1HBUA 1GAOA 2PC6A 4P10A 2AD9A 2CQPA 5L1LA 1R0AA 1T95A 2HK2A 4I68A 2Q43A 4ZDNA 2NS1B 5KFIA 2VICA 1NJIT 5JVHQ 1YRTA 3JQKA 2HEKA 3NKYA 1Y5LB 1XBWA 3UD3P 2Z2ZA 1V3SA 3D67A 3IMQJ 1YRXA 1UJ5A 2WK4A 2B5JA 2MQLA 2M0GB 4USIA 2UUAJ 5KFBA 1Y3KA 1LFWA 2AZ1A 4J9NA 1WDDA 1RSCA 1X4BA 1HNIB 1FD2A 3SCIE 1OPIA 4DR7F 5AXLA 5L8RC 4H4KC 1S0OA 2VF3A 1ZS6A 2O66A 5DG9A 1EETA 2BDPA 2P6TA 3UN3A 1RKJA 4DN9A 3KJQB 1M1KT 3D1HA 1N48A 3KNAA 2BJ3A 2I5JB 3VAFA 2FLLA 2K3KA 4HT5A 4KAIA 5KFZA 3LO3A 2UVWA 2M70A 1PJ6A 1ZA2B 2LDYA 1FWPA 4MKYA 2E5LF 1H2VZ 4RUCA 3T1YF 2MPUA 1WSVA 2HNYB 2XWXA 3OTBA 2HZCA 2HFNA 3HZGA 3M2VA 1YKWA 4GMKA 4RL1A 4PR6A 5J1EB 1WEXA 3W5ZA 3HD2A 2CQ4A 2ZJPQ 5IV3A 2D41A 3V2UC 1UVNA 3TEHB 4OLPA 2BOAA 1TL7A 3AOAA 2QEXS 3CCES 3PACA 2ZWOA 1S9EA 3KHHA 4YDDB 2V8HA 2A3JA 4LRCA 1KC8T 2G4BA 3A8EA 1NCLA 1TMMA 4K8RA 4B9NA 2XLKA 4JI6F 2KH9A 2OPPB 5GAHI 4PXCA 1NSKL 3D4JA 4O44B 2FY8A 3S1TA 4JI4F 1HKAA 4YFUA 3MCMA 1VHIA 3M30A 3HHEA 1U2CA 2NLWA 2H9ZA 5HN0A 3J7A1 2VKZG 5FLXU 5I42B 2VFRA 1QM9A 3BB5A 2HFVA 2VOOA 4B9MA 2LP4A 1EP4A 3I31A 4ITSA 1VYAA 3ENQA 1DQ8A 3VQTA 2BANB 1P6TA 2DNHA 3V6KA 2F8MA 2VPZB 1B0PA 1W2IA 3VQSA 4F67A 2XMWA 2MKIA 4O3QA 2ZM6F 4WFAQ 2HFZA 5B0DA 3UFCX 2QYGA 4MMOA 1JKHA 2F63A 3VGSA 1N34J 2GGPA 1JJ2R 2BANA 4CDIA 4TY8A 1N6QB 5A8KB 1C1BA 4OI6A 3CJKA 3LF0A 5FD1A 4CZCA 4YY3F 4X4QA 2QL5B 2RQ4A 5F0WA 1QAJA 4HHJA 1JX4A 1FDAA 2UUTA 3HHLB 1N0UA 3QGPA 1LK5A 3DOLB 4NXMJ 2PO4A 1O6XA 2Y1JA 1N32J 4I7FA 3EPGA 4X84A 4J9VA 1Y10A 4O44A 1RHMB 2RRNA 4X4TA 2BKNA 3SQOP 4NE9C 5HROB 3AD8C 2G2ZA 2YNIB 4FF2A 2IAJA 2J0XA 1SKWA 2V4RA 2EK6A 5IM0B 2YVSA 3GFYA 3GTYX 5J2PA 4KPYA 3DMJA 2IDEA 3MR5A 1YDLA 3FBEA 5KT6A 2EBGA 3NBPA 4K4ZA 3GV8B 3R1LA 2R8IA 3BBCA 2B56A 4C2MA 4ZK7M 1FK9B 1SJ1A 1YRUA 3CDWA 5HMWA 2L9DA 3MUMP 5HJXA 5EX3A 3LH2S 3BBFA 3H40A 3AHPA 3C6UA 4XPEA 5F8JA 3NBPB 4KH0B 1LK7A 3EGWB 1YVFA 4HL9A 4PWWA 4R0EA 2AJ4A 1JJHA 1NH8A 3C6TB 4AT1B 2DH8A 3M9MB 3IRXA 4JI4J 1R43A 3CJ5A 3DDKA 4USMA 1REVB 1S1TA 3BPDA 2GA7A 4ZA1A 4LQ9A 5E5NA 1VQSA 2ZOGA 7FDRA 1JQGA 4ATNA 4RR5A 4BC7A 1GX5A 3JQJA 2PMZD 5GAGU 3D0IE 3D5MA 2W8LA 3M2UA 1ULRA 1RDRA 5CYQB 2DNLA 4UUXA 1N56A 5AE2A 3KUGA 3DOLA 5ETQA 3GR1A 4K4YA 5D3GA 4WU3A 3W9HA 4Q8EA 4B17A 4DSJA 5GMDA 4LIRA 2QA2A 2ZE2A 1N88A 3MXHP 1UFKA 3QNWB 4LRBA 5BJRA 3MMJA 4YOEA 1CJUA 2W9BA 1NO8A 1NDCA 3I4HX 5E2QA 4YUDA 5F8HA 5JJBA 4KC5A 4WP9A 3CCJS 5KFWA 2IJNA 2LVWA 2ASLA 1B0VA 3DXBA 2B9WA 4IFVA 2DRAA 1U1MA 1U26A 2NXUA 5D0EA 1XNRF 2RHQB 2VQFF 2HNZA 1CJKA 1H2UX 1OS5A 5K8NA 2AW0A 3WX4A 2MKJA 3MR6A 1U1LA 2KFZA 1RTHB 1T11A 3DRPB 4IH7A 2FHJD 4PABA 5KG2A 1Z2LA 1N5VA 1X5OA 2CNNB 5K5MA 4CLSA 2NUHA 1NK6A 4LF8F 2HURA 4BCAA 3OL6A 2RVJA 2BMBA 2L41A 1MWQA 3RUBL 1VBXA 4X64J 3OJUA 3NGSA 2A2CA 3UNGC 1UPMB 3LW5C 4P72A 1SUQB 3DRXA 2RDJA 2VQEF 1P8GA 3OUYA 3RTVA 4F3QA 3QMQA 2CNOB 2N3LA 3FMWA 5L38A 3PJXA 3NGKA 1NK4A 5IQ6A 2YXLA 2LYVA 5EWGA 4EZ9A 1HYSB 2YQ3A 5A0YA 3PYDA 3OLBA 4AL6A 1REGX 4WE1A 5KFKA 1CVJA 1N5TA 4X4SA 5IT9U 2MKKA 4KV8A 4GVLA 1KVJA 2HNYA 4FNIA 1GH8A 5F8MA 1S12A 3IRWP 4DL7A 5B7WA 3GV5B 1UA1A 3R5BA 3KHLA 2FZKB 3K57A 2IRUA 3ETMA 1MMNA 5AE3A 2CQDA 4WK1A 1S77D 3CD6S 2RB7A 2YNIA 5DDOC 5J2QA 2JEIA 2CPHA 3BQ2A 1OWXA 3O1LA 3TZXA 3Q8VA 3GSDA 4NEYA 4J9RA 4AL5A 3HSZA 1F5BA 1SC6A 1PKUA 2PE8A 4I56A 2VD3A 5CA5A 5HVHA 4DPYA 3AT1B
chains in the Genus database with same CATH topology
1RWOB 1PYOB 2DKOB 3EDQB 3RJMB 2H4YB 1RHMB 2XYGB 4JB8B 1BMQB 4ZVUB 2HBRB 1F9EB 2CDRB 3KJNB 1SC1B 3R7BB 3KJFB 2Y0BB 1RE1B 4DCOB 2XYHB 3IBCB 1RWWB 2C2KB 3R6GB 2CJXB 5IC6B 2HBYB 2QL7B 1IBCB 3D6HB 1RHQB 1RWPB 2HBZB 1RWNB 3SIPB 1RHJB 3NS7B 4DCPB 2H5JB 2Y1LB 2FQQB 2H5IB 1SC3B 3QNWB 3KJQB 3R7SB 1I3OB 1GFWB 2H54B 5K20B 3GJQB 1ICEB 2CNKB 3EDRB 3IBFB 4DCJB 2CNNB 1I51B 1NMEB 1RWMB 2CJYB 2QLBB 2XZTB 1RHUB 1RWXB 2C2MB 3P45B 4LSZB 3P4UB 1QTNB 3GJTB 3R7NB 1PAUB 2QL9B 4ZVPB 2XYPB 1RHRB 4ZVRB 2CNOB 2P2CB 3GJSB 2CNLB 4ZVSB 2XZDB 4ZVOB 2C2ZB 5IC4B 2C2OB 2H51B 3R5JB 2H65B 2H48B 2C1EB 3D6FB 3GJRB 1QDUB 2QLJB 1RWKB 4ZVQB 2QLFB 1RHKB 2QL5B 3D6MB 1RWVB 2H4WB 3R6LB 1SC4B 4ZVTB 2HBQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWO B;  1PYO B;  2DKO B;  3EDQ B;  3RJM B;  2H4Y B;  1RHM B;  2XYG B;  4JB8 B;  1BMQ B;  4ZVU B;  2HBR B;  1F9E B;  2CDR B;  3KJN B;  1SC1 B;  3R7B B;  3KJF B;  2Y0B B;  1RE1 B;  4DCO B;  2XYH B;  3IBC B;  1RWW B;  2C2K B;  3R6G B;  2CJX B;  5IC6 B;  2HBY B;  2QL7 B;  1IBC B;  3D6H B;  1RHQ B;  1RWP B;  2HBZ B;  1RWN B;  3SIP B;  1RHJ B;  3NS7 B;  4DCP B;  2H5J B;  2Y1L B;  2FQQ B;  2H5I B;  1SC3 B;  3QNW B;  3KJQ B;  3R7S B;  1I3O B;  1GFW B;  2H54 B;  5K20 B;  3GJQ B;  1ICE B;  2CNK B;  3EDR B;  3IBF B;  4DCJ B;  2CNN B;  1I51 B;  1NME B;  1RWM B;  2CJY B;  2QLB B;  2XZT B;  1RHU B;  1RWX B;  2C2M B;  3P45 B;  4LSZ B;  3P4U B;  1QTN B;  3GJT B;  3R7N B;  1PAU B;  2QL9 B;  4ZVP B;  2XYP B;  1RHR B;  4ZVR B;  2CNO B;  2P2C B;  3GJS B;  2CNL B;  4ZVS B;  2XZD B;  4ZVO B;  2C2Z B;  5IC4 B;  2C2O B;  2H51 B;  3R5J B;  2H65 B;  2H48 B;  2C1E B;  3D6F B;  3GJR B;  1QDU B;  2QLJ B;  1RWK B;  4ZVQ B;  2QLF B;  1RHK B;  2QL5 B;  3D6M B;  1RWV B;  2H4W B;  3R6L B;  1SC4 B;  4ZVT B;  2HBQ B; 
#chains in the Genus database with same CATH topology
 4XDD A;  3P8B B;  2A18 A;  3G96 A;  1UL3 A;  1XN9 A;  3HVR A;  1KRP A;  4RJV A;  3HT3 A;  4LMZ A;  2W2N P;  1Y9O A;  1CJV B;  2QN6 B;  3DC2 A;  1TU0 B;  5HAO A;  3M8R A;  4C0B A;  4Z37 A;  2C2E A;  5EWF A;  3OVB A;  1QVG R;  2XYG B;  3M6W A;  1NK7 A;  4DSI A;  3H59 A;  3CCM S;  3CJK B;  3TAQ A;  2DGS A;  2VB6 A;  4Y2A A;  1UVI A;  3OTO F;  3AA8 A;  1S49 A;  1OMS A;  3K89 A;  4USJ C;  2OFH X;  3TJA A;  1WHW A;  3L09 A;  4DL5 A;  4HR2 A;  2J9D E;  2MZ1 A;  2V8G A;  2YPY A;  3B4D A;  3MMB A;  5DO2 A;  3BH6 B;  4DV6 J;  3VWS A;  4DCO B;  4WU2 A;  4IO9 Q;  2V9W A;  4B3T F;  1UWA A;  4MH8 A;  5HLF A;  5LJ3 Y;  1RLD A;  1HR0 F;  3UN5 A;  2NQP A;  3L95 X;  2HHX A;  2YH1 A;  1G6B A;  3M8P A;  4HAC B;  2MQP A;  1LOU A;  3ILI A;  5FDL A;  4YR2 A;  1Y11 A;  4JI7 J;  1RYR A;  3ZTS A;  3QFW A;  3CPW R;  1TUW A;  5IC6 B;  2VHG A;  2NYH A;  2LXI A;  4F4Z A;  4DR5 J;  5IWA J;  2QL7 B;  2B8Q A;  2IVF B;  4DWI A;  2J0S D;  1JJC B;  1RWP B;  4QCL A;  1RT3 A;  3PW5 A;  2HG4 A;  3CCS S;  2BA9 A;  1BD6 A;  3LQV A;  3OBI A;  2KT5 A;  3HX9 A;  3SCJ E;  4UOC A;  5H9E J;  2IDL A;  3I6P A;  1A6L A;  3QYY A;  4F02 A;  1U2F A;  3LAM A;  4LBH A;  2XMK A;  2AKW B;  4QIF A;  2HQI A;  2KJW A;  3MM9 A;  2OIH A;  2KG0 A;  3L9Z A;  4QWA A;  4RNM A;  1NDK A;  1HQU B;  3HM9 A;  4QPT A;  4N8N A;  1NPR A;  4CH0 S;  3OL9 A;  5E41 A;  2W9A A;  1WC1 A;  1GXT A;  4OZ3 A;  4CQ1 A;  3UCG A;  4I64 A;  5IV4 A;  1RAG B;  1I94 F;  4F0H A;  2W7O A;  3THP A;  2R7T A;  5KFN A;  3FVY A;  3KLV A;  3NNA A;  2VDH A;  4AQY J;  1WI6 A;  1ZAW A;  4FYY B;  3ZZR A;  1BQX A;  1Q7L B;  3V81 A;  2RS2 A;  3KDO A;  2AEJ A;  2NPF A;  4B3R J;  4I1T A;  5BYQ A;  1ROF A;  5B0E A;  5IWA F;  4P2S A;  1FKP A;  4LRA A;  3UR3 C;  2VG6 B;  2Y1R I;  1NME B;  3MPY A;  5GAD U;  4HI2 A;  1QAI A;  3KUH A;  4RNN A;  1YZ6 A;  5I3Q A;  5H9F K;  2ZD1 B;  4X4N A;  2A0F B;  4DFM A;  1KOH A;  3GJT B;  5LXR A;  2UUC J;  3T9N A;  2ZHB A;  2W2Q P;  2Z57 B;  3DHW C;  5E3P A;  4M5M A;  1LXN A;  3WX8 A;  3AJD A;  1UVJ A;  3P6Y C;  2C2D A;  1IJF B;  4N5S A;  4UW2 A;  2BRK A;  1VQ5 S;  3PJW A;  3CCL S;  5B09 A;  4PQU A;  4NPO A;  1F5A A;  1JXV A;  2VDI A;  3NGT A;  4JI2 F;  1VQM S;  3FZ2 A;  3US5 A;  2VFU A;  1T9T A;  2B9E A;  3G6V A;  2ABY A;  1RBO B;  4DV3 J;  1PBA A;  4CLL A;  2XZD B;  2QGF B;  4QYZ K;  2IRX A;  2LQ5 A;  4OJ3 A;  2D3O 1;  2CPF A;  3P96 A;  3X3U A;  2WCX A;  1FKP B;  2WW8 A;  2MGZ B;  3OR1 B;  1TL1 A;  2M3D A;  4Y2M A;  3QSY B;  3LGH A;  3LWL A;  2KU7 A;  3LAK A;  4EZ6 A;  3G87 A;  4RW6 B;  4ID5 A;  3KHR A;  3FNN A;  2H65 B;  3T3F A;  1X60 A;  2L48 A;  2OEJ A;  1T9X A;  3NEK A;  5B0G A;  5K8P A;  3MPD A;  3LGN A;  2DEI A;  2MQN A;  2PDA A;  2YNG A;  1VQ8 S;  3IAS 9;  3C14 B;  1E6V B;  3OTC A;  3CF5 Q;  2DXD A;  1Q8B A;  4UF4 A;  2ZH7 A;  2V2Z A;  1LW0 B;  3LUY A;  1QSY A;  1CQM A;  5CD4 H;  2IA0 A;  2KI2 A;  2D3U A;  1RBA A;  1RAI B;  4RW4 A;  4NCA A;  2LLZ A;  1NND A;  2HHS A;  3EXY A;  1FRJ A;  1GT8 A;  1JLG A;  4EI2 A;  2CPX A;  3POT A;  1X31 C;  2JRS A;  2V8D A;  3D2W A;  1N5Y A;  1SL0 A;  3RU0 A;  2CQ3 A;  3EVO A;  3RJM B;  1JMT A;  2H4Y B;  4AFF A;  4BS2 A;  4DFK A;  2DHA A;  4HH1 A;  4OZ0 A;  4QU7 A;  4NEZ A;  3I87 A;  2UV8 G;  2YWH A;  4GO5 X;  3T6B A;  3FBF A;  1R89 A;  4ETX A;  2WHO A;  1S7H A;  4FKY A;  1KQK A;  1WHX A;  1S5Z A;  3JSR A;  3IM8 A;  4TLQ A;  1NSQ A;  1ZM4 A;  3QIP B;  5HO4 A;  4C48 A;  1E6V A;  3GCW P;  4AXI A;  1HI1 A;  1HNV A;  5DGB A;  1D1U A;  1B7Y B;  1RTI B;  2HWH A;  4B3R F;  2DNM A;  2OPR B;  2ZIT A;  2DNG A;  4ZHR B;  5GME A;  3GP9 A;  1YJW S;  4LBP A;  4RW6 A;  1V5I B;  1WEL A;  2DNR A;  3HT0 A;  2RD5 C;  1R8C A;  4DQR A;  1UVK A;  4YB5 A;  1HPZ A;  2EFN A;  3R5A A;  3W7B A;  1DTT A;  1PC5 A;  3F56 A;  1NRK A;  3TZY A;  2CAJ A;  1YBU A;  3DCA A;  1FVS A;  5GAE I;  4DV0 J;  1NSP A;  3KK3 A;  2JHE A;  3PIO Q;  1SVD A;  2VL1 A;  2IM3 A;  4NLG A;  3GE9 A;  1RHQ B;  1RWN B;  3M8Z A;  1C0U A;  3FGV A;  4PPD A;  4ZPV R;  4DZ6 A;  1S72 S;  2BRL A;  1KVI A;  3SIP B;  4DX6 A;  2UUB F;  2E7X A;  3MTJ A;  2G1D A;  2R2R A;  1T3O A;  3OD2 A;  1FX2 A;  1PG5 B;  2CQG A;  2BE9 B;  3KLI B;  1VHF A;  1L3K A;  2BR0 A;  1NK5 A;  3BDP A;  1GMV A;  2V63 A;  1NJX A;  1FFG B;  1VS3 A;  5KT5 A;  2CVI A;  2HVI A;  3BSA A;  3LP1 A;  4OX6 A;  2HGN A;  2YNF A;  3HPO A;  1MNE A;  2J9D A;  2ZUG A;  4OI2 A;  4WYL A;  5KG5 A;  3G71 S;  3K5L A;  3MI7 X;  1I3O B;  3ET6 B;  3HCX A;  4M5G A;  1XR6 A;  2EFV A;  4CTA A;  4LR9 A;  2IJF A;  1DAX A;  2YY3 A;  5C2G A;  2VQE J;  4K2J A;  4LF4 F;  1G7C B;  3EGZ A;  4BWM A;  1Q16 B;  5IQQ A;  1NZ8 A;  1S1U A;  2ASJ A;  3HP6 A;  2AHO B;  4WTY A;  3W64 A;  3W60 A;  2E7V A;  2MSS A;  3NMA A;  2FVR A;  5F3Z A;  3SSS A;  5JMN A;  2W2P P;  1X4E A;  3D28 A;  4IFY B;  2EWH A;  3QAE A;  2F1F A;  1FRH A;  3IBF B;  1SBR A;  1UET A;  3ONQ A;  4QOT A;  1I5O B;  1UWB A;  4KR0 B;  2PA8 D;  4E0D A;  2FLO A;  4FZV A;  4LUB A;  3WIU A;  1RWM B;  3MMC A;  4F7V A;  5HVG A;  1HNZ F;  2R7O A;  3OVS A;  3BYP A;  1U09 A;  2RAQ A;  4OZ2 A;  4H4M A;  2IMO A;  4JI3 J;  3GG1 A;  5H9F J;  2Z2M A;  3EWG A;  3PYF A;  3KOA A;  1BXN A;  3ZZO A;  2ZEJ A;  4FXW A;  4LFA F;  2PGC A;  2XSJ B;  3S01 A;  2XGP A;  4LFC F;  5DZ6 A;  2F65 A;  4KO0 A;  1AB8 A;  3CMQ A;  3KLF A;  4KPC A;  1PYS B;  3RRK A;  4FF1 A;  3PX6 A;  4DMZ A;  1VIS A;  2BJ9 A;  3P3D A;  4OYW A;  4RWX A;  4ZVS B;  2BJD A;  1YIJ S;  3NWR A;  4H4O B;  3M4X A;  1RTD A;  1Q4R A;  1IKW A;  3GON A;  2HHP A;  2OSR A;  1MWY A;  1WOO A;  4LVO P;  4ZCK A;  2DR8 A;  4ZP6 A;  2SXL A;  2BKO A;  3UWT A;  1L3S A;  2POK A;  3A13 A;  3N5F A;  4HDG A;  4N8O A;  2DBB A;  2BUN A;  4Z7Y A;  5DJB A;  3SZ2 A;  4FYW B;  3ULH A;  3EZU A;  4I2Q B;  1VBY A;  4FF3 A;  1NJW A;  5KG6 A;  2FYX A;  1SIZ A;  3Q8U A;  2AZ3 A;  4K4T A;  2XGQ A;  1JLA A;  3CED A;  2HND A;  2IJR A;  4OZN A;  3PKM A;  1SXL A;  4NLD A;  1CBK A;  1NM2 A;  1LWE A;  2QYC A;  2GO8 A;  4J9K A;  4F4X A;  2H4W B;  4DI6 A;  3E3X A;  3A3O B;  3VAI A;  3R5D A;  3Q2T C;  2FDN A;  1GNK A;  4DX8 H;  5KG0 A;  1S10 A;  2XO6 A;  3OTE A;  5HL7 Q;  1UJ4 A;  1VQP S;  3MHY A;  3Q8R B;  4HTI A;  2A6O A;  1RT3 B;  1HNX F;  3VVU A;  3C66 A;  3V6J A;  5E0O A;  1S57 A;  1JLF B;  2F9D A;  3D3B J;  4JBC A;  3KFW X;  1TTH B;  4U8V A;  1MLA A;  5LMN J;  4CT9 A;  3UDE A;  4C8K A;  4W4M A;  4ZVU B;  1TFW A;  4QIV A;  3D54 A;  1G4C A;  3FQL A;  1K1S A;  1TV6 B;  1XIQ A;  1NKE A;  3KLG B;  4FVC A;  1AZS A;  1MU2 B;  2HWT A;  3AXK A;  3G8Q A;  2E1A A;  3IAM 9;  5A6P A;  1Y0H A;  4OJG A;  2VC1 A;  4WF9 Q;  2RIJ A;  3PM9 A;  5HP1 B;  5F3T A;  2G0J A;  4PG4 A;  4YB1 P;  1D8Z A;  2MZT A;  4I2P A;  3T19 A;  2QLW A;  5IT0 A;  3SCK E;  4KHM A;  4A8Q A;  1RT1 A;  1CC7 A;  3H5S A;  3IXQ A;  1DQ9 A;  5ETV A;  1FVQ A;  5F9L A;  4DL2 A;  1CJT A;  3QT5 A;  5JUM A;  4ELU A;  3FUY A;  3C3L A;  2WSF C;  1T7P A;  2ATC B;  2FC9 A;  2GQ2 A;  1GQE A;  1U1R A;  1U1K A;  1FJC A;  2LEB A;  4AE5 A;  1YJN S;  1RT5 B;  1KLN A;  3BKT A;  1DTQ B;  2ROE A;  1D9A A;  4L75 A;  5CYQ A;  4RKU C;  1YG0 A;  1SUQ A;  3CCZ A;  3KDN A;  3MZI A;  1U0S A;  3D9B A;  4K2X A;  3TJ8 A;  3UQS A;  2MY8 A;  3G6Y A;  1ZM9 A;  3C15 A;  2X3G A;  3U02 A;  3OXG A;  1HBO A;  2WOM A;  3B8H A;  4DBQ A;  1QD1 A;  1VJW A;  2GZO A;  3H90 A;  3I55 S;  2XNQ A;  3DKD A;  4NA2 A;  1J5E F;  2J5A A;  2V2V A;  5KFH A;  2WVE A;  2H5I B;  4ID5 B;  1SC3 B;  5THW A;  4CYU A;  4C4W A;  1AW0 A;  2R7X A;  1IJE B;  2X3D A;  1B64 A;  2QT7 A;  2MMY A;  1JK9 B;  3BSC A;  3MM6 A;  3FMB A;  2DGV A;  4IH6 A;  3GMG A;  4NAS A;  3CTR A;  4RUA A;  3IR7 B;  5G0R B;  2LXF A;  5SUH A;  3TAM B;  2CXE A;  4X65 F;  2K06 A;  3L7P A;  2V6A A;  3DM2 A;  4GVB B;  2E7W A;  5B08 A;  3K5P A;  1B7F A;  4PG6 A;  1U25 A;  2RU3 A;  4KGV B;  4U95 A;  3EVM A;  2IRY A;  1RKI A;  2ROP A;  1R27 B;  2Z8Q A;  4QIW D;  4EGL A;  3ISN D;  3SDE B;  3B82 A;  1IKX B;  4XK8 C;  2GMJ A;  5D0G A;  5D3G B;  2XZT B;  1HNW J;  3IFE A;  3HSD A;  2CPZ A;  1UPP A;  3OHB A;  2O01 C;  1M5K C;  1H98 A;  3QJP A;  3LGM A;  5KG1 A;  4RNO A;  4WP8 A;  5CYM A;  1SH0 A;  2GMH A;  1T05 A;  1Q53 A;  4U7U D;  3GZ7 A;  4EYI B;  1WF1 A;  4DX5 A;  4ECS A;  2VA2 A;  5LMU J;  2ZUA A;  1M0S A;  2ZBI A;  3AA9 A;  3O8W A;  5C24 A;  3KK2 B;  1U48 A;  3DXS X;  1SJF A;  3H8Y A;  1P9Q C;  2A1B A;  2YTC A;  3AAW B;  2W8K A;  3TUJ C;  4Q2M A;  5LSO A;  5HLF B;  3OTD A;  4M5N A;  2YQ0 A;  3NP5 A;  4OYM A;  2XI2 A;  2B4O A;  2V0N A;  1SL1 A;  2YWK A;  4G1P A;  4MKA A;  1KQS R;  1RAB B;  1FXD A;  1YJT A;  4DU7 A;  1H74 A;  2PII A;  3ZTO A;  3E8O A;  4BC9 A;  5F9N A;  2ZH3 A;  4TU7 A;  2QE5 A;  1UZH A;  4K4V A;  4FXV A;  2QLJ B;  1R31 A;  4YB6 A;  2ZH5 A;  2ZFH A;  3EVW A;  1FE0 A;  3T5L A;  1SV5 A;  1VGY A;  3H7H B;  1ZPW X;  4M5H A;  1T9W A;  2GVZ B;  2LA6 A;  4PXB A;  1EKS A;  3N0V A;  4F2R A;  2DHS A;  5LJ5 Y;  1CUL B;  5D8H B;  2RS8 A;  3AD7 C;  5ETT A;  2ZZN A;  3H2L A;  4EO6 A;  2MLX A;  1EB0 A;  3IS9 A;  2CZ4 A;  2ADC A;  2HHW A;  1RAC B;  1TUV A;  1GK8 A;  2HIQ A;  4OX7 A;  2QA4 S;  4A8O A;  2ZVI A;  1Z4U A;  2KL8 A;  1RQ0 A;  2P8I A;  1LNQ A;  3ZTQ A;  2EK1 A;  3NAH A;  3UDC A;  2BQR A;  4IR9 A;  4X2B A;  1AYE A;  1RIS A;  1U7L A;  3ZNJ 1;  1JIH A;  3M8S A;  2BJ7 A;  4AQY F;  2XS7 A;  3MR2 A;  1HIY A;  3MUV P;  2BVZ A;  2DGW A;  2V8P A;  4WFX A;  4H54 A;  3K59 A;  4A8Y A;  2FJA B;  1SC1 B;  3M8Q A;  2PT0 A;  3FFI A;  3H42 A;  4WXO A;  4RUH A;  4K0K F;  1SIW B;  2HS0 A;  1IWA A;  1KS2 A;  2WB1 D;  5F8L A;  2DPJ A;  4N7T A;  3MD1 A;  2OI2 A;  4ZVG A;  3CC4 S;  3QT8 A;  4PQU B;  4OHW A;  4DV4 J;  1KD1 T;  1V3Z A;  1WF2 A;  3D3C J;  1U4B A;  4ZPB A;  2QSF A;  4C3M A;  3KLE A;  1A7G E;  3HHL D;  2AGP A;  2CJX B;  1QVF R;  2E5J A;  1C1C B;  4NLT A;  2J8S A;  1HBM B;  1KQG B;  2HQC A;  1HI8 A;  1RP5 A;  1FRM A;  1TZ0 A;  2VG6 A;  3DRR A;  2WVB A;  2J8A A;  2FHK A;  4JV2 A;  2K7J A;  4DUT A;  1OPZ A;  2VG7 B;  1HWL A;  2GAG C;  2ZOF A;  4O3S A;  4TQS A;  3DI6 B;  3DLH A;  4PYD A;  3S8S A;  5DDR C;  2H5J B;  2QMX A;  3UPF A;  3C16 B;  2N82 B;  1YWX A;  1ZAX A;  3BO3 A;  2ZDP A;  2Q79 A;  3K5O A;  3TEG A;  2EVZ A;  4ZIV A;  2BJ8 A;  4TU8 A;  4ZCL A;  5M2P A;  3KJV B;  4C8L A;  2I38 A;  2YBV A;  2KHD A;  2XMJ A;  1D9D A;  2DNQ A;  1C2P A;  3QPI A;  2E66 A;  5KFF A;  3J81 U;  2C22 A;  1R0C B;  4GRS A;  5J2M B;  3W2V B;  3DM2 B;  4GVB A;  5KT7 A;  3NCP A;  1MRO B;  3TA2 A;  1FNO A;  2HKE A;  3U1M A;  1W2B R;  5KFL A;  1K73 T;  4LQ3 A;  2CWK A;  4KFB A;  4G1Q B;  5B0A A;  2DY1 A;  2NZC A;  4DF8 A;  1BGX T;  4OYO A;  4J9S A;  5EDW A;  2B4P A;  2CZV C;  3TQE A;  1FRL A;  3GYX B;  3J7Z 5;  4LSL A;  1U47 A;  3VF0 B;  1Y4Z B;  2GJF A;  5KFC A;  2C28 A;  2W25 A;  4DCJ B;  4DR5 F;  2G2O A;  4DS4 A;  2XY5 A;  2Y1I A;  2P5V A;  4OV1 A;  1EAR A;  2KTQ A;  2RKI B;  1RT2 B;  2FVQ A;  2XMU A;  1RWX B;  1H7X A;  3ELH A;  3P45 B;  5ITH A;  4X64 F;  1T05 B;  3EYZ A;  1UKU A;  1HBN B;  3AB2 B;  2JL9 A;  3R3T A;  4K5R A;  3ZXW A;  4ED6 A;  1HR0 J;  2V67 A;  4D3G A;  5KFA A;  3U27 A;  5DM7 Q;  4RWW A;  3SDE A;  5I4M A;  2FLN A;  4ZVR B;  3TJ9 A;  3MTK A;  1BC6 A;  3C6T A;  5D15 A;  8AT1 B;  1EAY C;  3LP2 A;  1CLF A;  3NMR A;  1GTE A;  2APO A;  2E5G A;  2F8H A;  3CNQ P;  2BV3 A;  3CT9 A;  4A8W A;  3OFE A;  4WZQ A;  1UZD A;  3HFV A;  3VAG A;  3FFI B;  3DHX A;  3MM9 B;  4LF9 F;  3IN5 A;  3NG8 A;  2BYC A;  4WE1 B;  2R7V A;  4Y65 A;  4C98 A;  3JAM U;  1TEL A;  2D1C A;  3HUL A;  1T8E A;  5L1K A;  3RBE A;  2XTJ P;  4QWD A;  2R2T A;  5HP1 A;  4URG A;  4Q8F A;  1QDU B;  1TK0 A;  2HHT A;  3BJY A;  2VPX B;  4R5P A;  3KLG A;  3N79 A;  3FBC A;  3BQ1 A;  2Q1L A;  4OZL A;  5KT4 A;  3VAL A;  3Q2S C;  3MD3 A;  1J5O A;  2FVP A;  4LF7 F;  2LFV A;  3J7A N;  3M8P B;  1SC4 B;  3C15 B;  2P9E A;  3MMA B;  2CYY A;  4HAC A;  2OUG A;  5EGY A;  5KT3 A;  2FVC A;  4HEA 9;  2HBQ B;  5I3U B;  3NXZ A;  2NR0 A;  2ZDO A;  2DNO A;  4B3T J;  1C0T A;  4R5P B;  1VBZ A;  1T9U A;  4FP9 A;  1PYO B;  4TY9 A;  3MMB B;  3BGF A;  3DGP B;  2CPY A;  4ZVH A;  4MK9 A;  4USW A;  4ZJQ A;  3F73 A;  3RYL A;  2IC3 B;  3M05 A;  4ER8 A;  5D77 A;  1RYS A;  1QUV A;  3AH6 A;  3CD0 A;  1OQ6 A;  4RW8 B;  3L7O A;  1Z1Z A;  2HHU A;  1RI7 A;  4DSL A;  1VRU A;  4CO4 A;  3MEG A;  2W4P A;  2CPE A;  4F26 A;  1NB7 A;  4WZM A;  3GYG A;  2CKW A;  2OJ3 A;  1VI7 A;  3LAL A;  4J9L A;  4GC7 A;  4ED7 A;  3MPV A;  4YN3 B;  3LP2 B;  1NPP A;  2BM1 A;  2ZE2 B;  2E1C A;  2BAC A;  1I6J A;  1U6F A;  3TW0 A;  2O67 A;  5AXM A;  4EBC A;  4A8K A;  4DLE A;  4CNY A;  4ZJO A;  1C0T B;  2QZ8 A;  5KFD A;  3OHA A;  1TR0 A;  5KOX A;  1TL3 B;  4RU9 A;  2R3V A;  3V4I A;  3RB6 A;  2BQU A;  3NNH A;  2IMW P;  3V5R A;  2YWW A;  3NWG A;  2R8K A;  4IUF A;  4I67 A;  3QT6 A;  3GLJ A;  4C8Y A;  1RZM A;  3HJF A;  4ILL A;  1CPZ A;  4YDX A;  5IOL A;  4DQP A;  1ZZN A;  2DGO A;  2O3D A;  1TL3 A;  4IDK A;  2G9O A;  3DRP A;  3FBB A;  1ZPV A;  2GIQ A;  2XSJ A;  1SQG A;  4ZPW R;  4NA3 A;  1U6B A;  2HGL A;  2Y8W A;  2ZVS A;  1UEU A;  4TXS A;  3S7R A;  3NOC A;  1TVR A;  2D69 A;  2DEJ A;  2D7S A;  3HLU A;  3EUN A;  3NS7 B;  3KUE A;  2HRT A;  3QWU A;  4ZIW A;  2AGQ A;  1YGY A;  2VBX A;  2U1A A;  1B70 B;  1X4A A;  1LWE B;  2ILZ A;  3TOQ A;  1UTA A;  4RBU A;  5KFM A;  1GEH A;  5J2M A;  1B3T A;  4PZV A;  1F2G A;  4NCB A;  1EHW A;  2E44 A;  2CJB A;  1CC8 A;  2B4U A;  4X4P A;  4XDC A;  5D6G A;  1R0B G;  1WUU A;  2DNP A;  2J76 E;  4QW8 A;  3PW2 A;  2GW8 A;  3J7Y U;  1XK8 A;  3QGG A;  2UXC J;  3C16 A;  1H2T Z;  3M2R A;  2P9G A;  3KYL A;  1U8W A;  3ET6 A;  4R8U B;  4ECT A;  2AX0 A;  3EJM A;  1ICE B;  5C42 B;  3JTO A;  1SPB P;  4YME A;  1SJQ A;  2B7C B;  2RKI A;  2VG7 A;  2IM1 A;  3M1V A;  3N28 A;  4JI8 J;  4O0I A;  2OEK A;  3HXM A;  4B9L A;  3IRX B;  2M52 A;  4ZPA A;  1RU2 A;  4Q44 A;  2CJY B;  3HHL A;  4LSZ B;  3BR8 A;  1S0M A;  3P4U B;  3PEJ A;  3P49 B;  5KFE A;  1HFE L;  5FLX Y;  1U8S A;  4CT8 A;  4NXN F;  1S59 A;  4F36 A;  3AXM A;  1DUR A;  4PQA A;  1P27 B;  4KBI A;  3R9L A;  5AXN A;  5A8R A;  2FHM A;  3TI0 A;  4DQQ A;  1ZTW A;  4F3O A;  3I9V 9;  4NML A;  3I0R B;  4KKO A;  2LMI A;  3M9N B;  3C46 A;  1G1X A;  3QWP A;  1BQM A;  1WTB A;  3D68 A;  2AT1 B;  3KLH B;  4ELT A;  3NCQ A;  4USK A;  1OSC A;  2K3I A;  3OTO J;  3SV4 A;  2EBE A;  3HSG A;  4LF2 A;  3DU5 A;  3BF4 A;  3IR6 B;  1VQ6 S;  2CQI A;  3BV8 A;  3P5B P;  4KSE B;  5ETR A;  3WDO A;  4IQX A;  2HPU A;  2HQD A;  2RUS A;  2C2O B;  1JXL A;  2ZBQ A;  1LFP A;  3G82 B;  4I0W A;  4NLO A;  3JS9 A;  4CLF A;  4EWT A;  1IBL J;  4KJI A;  1Q1K A;  3QBC A;  4RO0 A;  4F50 A;  4F4Y A;  1FE4 A;  2RSQ A;  4M63 A;  1N33 J;  2VKR A;  2FY1 A;  2V94 A;  3IBW A;  1X8D A;  5D78 A;  4G65 A;  4J91 A;  1S1V B;  2WVD A;  3CDU A;  4FF4 A;  3R2C J;  5L9N A;  3G6E S;  4WFZ A;  5CZV A;  3DDN A;  1F6T A;  2ZBP A;  3KLI A;  2C3M A;  2JWN A;  1J27 A;  4WFB Q;  3MUT P;  5D4P A;  4PCQ A;  3BR9 A;  3VAK A;  2DO4 A;  5K9F A;  4IRK A;  1NU4 A;  1Y3J A;  4DPX A;  4MIB A;  3M8Y A;  5A8K A;  1Q7Y T;  3KLE B;  1TKT A;  2D3Z A;  5HQ8 A;  1YZ7 A;  4OI4 A;  1SJR A;  2XS2 A;  1IWG A;  5LL6 d;  3W8G A;  2XCA A;  2JEJ A;  2G1H A;  3TZZ A;  1JNR B;  1YBT A;  2KDO A;  1KLM A;  3Q22 A;  2KRB A;  4TVA B;  2VZ9 A;  3JSM B;  1FJG F;  2FZG B;  1GXL A;  2GIR A;  2KYX A;  2LQB A;  1RCO B;  1H6K X;  1M5V C;  4BDP A;  4ECQ A;  1GXU A;  4DV1 J;  3AOC A;  2FJX A;  3DGV A;  3PFE A;  4YR3 A;  2K1R A;  3KMQ A;  4Y2K A;  3I4P A;  2HIY A;  4CO0 A;  1SB6 A;  1LEO A;  4FDF A;  2YKP A;  2M5Y A;  4K59 A;  2OP5 A;  3MM7 B;  4EU0 A;  4ZCI A;  2NYI A;  5C25 A;  2WON A;  1S1W B;  2XYH B;  3H4B A;  2X1A A;  2GIF A;  1PAE X;  1FO1 A;  2EPI A;  1YJR A;  2W1B A;  4ZP8 A;  2MZS A;  1J2V A;  2XUL A;  1TUG B;  2HAF A;  3OFG A;  1FJG J;  4X4U A;  2HMI A;  5MLC V;  1SKS A;  2GVZ A;  4DFJ A;  4LFB F;  4F04 B;  2XHC A;  3PFO A;  1IBC B;  1S9F A;  2K7K A;  1TKZ B;  1VQN S;  3QSI A;  4QW9 A;  2F40 A;  3BYR A;  4JI0 F;  2AEM A;  2HVD A;  4LF5 J;  2BJE A;  2DB1 A;  5KFT A;  3MCS A;  2FGO A;  4M5D A;  2BE2 B;  2AQ4 A;  1LWC B;  2W4C A;  5CHC B;  2IPO B;  5HMZ A;  1D9F A;  1RLC L;  3NL0 A;  4HKQ A;  4U7C A;  2Z2Y B;  1FJE B;  1VIX A;  3V81 B;  3MM6 B;  1U1P A;  2MQQ A;  3HO1 A;  1N52 B;  1X4G A;  1FD8 A;  4ZJL A;  2N7C A;  4L76 A;  1SH2 A;  1NXI A;  2ZH9 A;  1N33 F;  1TMJ A;  1RT2 A;  2AX1 A;  2B43 A;  2XHW A;  2IVM A;  1SCJ B;  4HDH A;  3THV A;  3L4B C;  1U45 A;  3IO1 A;  1OQ3 A;  4R25 A;  1QAY A;  3PIP Q;  1EQ0 A;  2QMW A;  1H7W A;  3TP2 A;  3MDF A;  1QE1 B;  2KT2 A;  2QMU B;  3RG6 A;  4ERD A;  3RB3 A;  3BH7 B;  1U49 A;  2XWY A;  1Q5Y A;  2PN6 A;  4O4G B;  2AYG A;  1UA0 A;  4C9D A;  1PO6 A;  2W7A A;  2Z2L A;  1GMW D;  5DRK A;  2BE2 A;  1HD1 A;  4KHP J;  3EDR B;  2PEB A;  4U7U K;  3DLG A;  1QSS A;  2EKY A;  2DJW A;  3B54 A;  4DV6 F;  3GSI A;  3TAN A;  1VJQ A;  2MZQ A;  3HFZ B;  4WIQ A;  4WWS A;  3ZZZ A;  2CJQ A;  3SQG A;  1NDP A;  1TKZ A;  1RHU B;  2PMW A;  4M95 A;  2ERR A;  1WNE A;  1WG1 A;  4MTP A;  3M8Q B;  2J7W A;  3MEK A;  4PAA A;  5A8R B;  1PAU B;  4Q0B A;  1IQZ A;  1PSD A;  5LT5 A;  4LVN P;  2FPH X;  1JXE A;  4NYP A;  1D0E A;  3VGU A;  3PY8 A;  4XPC A;  1CS4 A;  1DLO B;  3GR0 A;  2WON B;  1G2E A;  2KN4 A;  2KZM A;  1ZH5 A;  4DPW A;  3HHK A;  4KGM A;  2CQB A;  4NLU A;  1F9H A;  2NSB A;  4FVM A;  5FDL B;  3CJQ A;  3G4S S;  2MTL A;  2MY7 A;  3TUZ C;  1NK9 A;  1G3O A;  1VR6 A;  2P9C A;  1RTD B;  2B5J B;  4GO7 X;  2AIR B;  3I5B A;  2CWX A;  3UVJ B;  1FNX H;  1JLC A;  3Q89 A;  5L1J A;  2J9C A;  2C1E B;  1HWJ A;  3GJR B;  1S0N A;  1L3V A;  1SV5 B;  1UJ6 A;  4DDF A;  2WSE C;  1X4C A;  3D66 A;  4ES2 A;  1OSD A;  3MEC B;  4ES3 A;  2D9P A;  2H5E A;  3AFG A;  4MYU A;  2WRM A;  1WC4 A;  4OYB A;  3TX8 A;  1YI2 S;  2DVI A;  4DUZ J;  3RW6 A;  1O5J A;  4ZIT A;  3Q24 A;  2XZW A;  5L1I A;  5FJ4 A;  3PX0 A;  2KJV A;  1FWL A;  1RT1 B;  4QJV A;  3IR5 B;  1NPK A;  2P6S A;  4AUK A;  5LXY A;  5ETN A;  1OJ4 A;  4ICL B;  1TFY A;  4DJB A;  4FS2 A;  3OVA A;  2Q3P A;  3LPY A;  1UEV A;  1O0P A;  3EZ5 A;  5IXU A;  2O1P A;  4Y0F A;  2BQ3 A;  4I2Q A;  3HVW A;  1WG5 A;  2PMH A;  4IFY A;  2R9L A;  3OW2 R;  3IWX A;  4ZS6 A;  2KFY A;  2YWG A;  3T1A A;  4I4B A;  5HJY A;  2OSQ A;  1RXO B;  2B8P A;  1AZS B;  1MU2 A;  4ED8 A;  4L3N A;  3JQM A;  2CUY A;  4UUW A;  5D4N A;  1N36 J;  2ZBC A;  1NUE A;  3A4T A;  3T41 A;  3J81 j;  4LF6 F;  4PWD B;  2QSW A;  1I94 J;  1HI0 P;  1I1G A;  2YNF B;  5GAE U;  4PUO B;  1PJ5 A;  3HD1 A;  4PG8 A;  1JJ4 A;  3R97 A;  1RAO A;  2GNK A;  1VRQ C;  2V69 A;  2C42 A;  2VAS A;  1S97 A;  1X9M A;  1KWM A;  3SFU A;  3ITH B;  4I6Y A;  4F2S A;  2MJN A;  4H4M B;  3LPE A;  1HHT P;  3OSP A;  2MZR A;  1K9M T;  7FD1 A;  1UW4 A;  3IGN A;  2QJ3 A;  2XMV A;  3DYA B;  2ZM6 J;  1CJV A;  2M9K A;  4OYI A;  2M7S A;  3MEC A;  3UDL A;  4A8X A;  4K4W A;  2YKN A;  4WK3 A;  3U1N A;  4YB7 A;  4UY8 5;  2G2Y A;  3I32 A;  3NCR A;  3DGP A;  1EZZ B;  2C3Y A;  4LF6 J;  3H98 A;  2ALZ A;  3O3L A;  1RT6 A;  4B3O A;  5C2C A;  4URS A;  2V8V A;  4OIX A;  3QFH A;  4DSE A;  2IM0 A;  3NRB A;  1X5S A;  3FCH A;  4P9S A;  4A8M P;  4IG3 B;  3KLF B;  5DG7 A;  3SSQ A;  4USU A;  2CJK A;  4MKV A;  5AJ3 J;  4C6A A;  3Q8Q B;  1RT5 A;  4Q7A A;  1SL2 A;  3N5B A;  4OHV A;  4IG0 A;  4OFZ A;  4Y28 C;  2RNE A;  3DYA A;  1DQA A;  1WHY A;  2HLU A;  1F3F A;  4DR1 J;  3MM8 A;  3TQ1 A;  2E1M C;  2CPJ A;  2H54 B;  1IXK A;  2BW2 A;  2DIV A;  1SJ4 P;  1CJT B;  1Y00 A;  4NMX A;  2DHG A;  3O5T B;  2VG5 A;  1S6O A;  5U47 A;  3R8Y A;  1YK9 A;  3PYE A;  2R2S A;  2KZZ A;  4RW9 A;  4DF4 A;  3IG1 A;  1OYD A;  3AOB A;  2DY9 A;  3MM8 B;  1KTQ A;  1SI9 A;  3BO2 A;  1VMB A;  3JSB A;  3OUY B;  2QLX A;  3VVT A;  5LM7 E;  4IDK B;  3CGI A;  4QPX A;  3OJS A;  3PTW A;  1KON A;  4NOH A;  4NLY A;  2UUA F;  4UY8 T;  3KG1 A;  2ZKU A;  3AY0 A;  3SI8 A;  1NLK L;  2XYP B;  2VFV A;  5DQG A;  1IKW B;  3CCQ S;  4KE5 A;  3ZFV A;  1L3T A;  4B3O B;  3B4M A;  2CQC A;  5ETP A;  4QYZ J;  3I5A A;  4JYA F;  5BR8 J;  4CI0 B;  2DIT A;  2A10 A;  5KFS A;  4KO0 B;  3LP1 B;  2NUU G;  3OR1 A;  4F0M A;  4ED5 A;  2EFQ A;  2JVO A;  2OPQ B;  1VLY A;  3BGR B;  1XQI A;  4ZVO B;  3M32 B;  3W8P A;  3GQC A;  3DRS B;  4C3K A;  1VC6 A;  3JSY A;  4W98 A;  4ICL A;  4CLY A;  1ZAV A;  1QTM A;  4Y2I A;  4U96 A;  4OV6 A;  4N47 A;  1MWZ A;  1FKO B;  4TN2 A;  3W2W B;  2H3E B;  2NXN A;  1FXR A;  3ZNU A;  4A46 A;  2YX4 A;  1S6Q B;  3G2X A;  1RAF B;  2OHD A;  4RLE A;  4ZVQ B;  1UCN A;  3D6M B;  5DQH A;  4GKJ J;  4O3N A;  3GPA A;  4NL5 A;  2ZD1 A;  5IT4 A;  1EKR A;  1OIA A;  2KYZ A;  4IG3 A;  2M8H A;  4DFP A;  4PWD A;  3DU6 A;  1VOM A;  3VAJ A;  4UST A;  4MYT A;  4DN0 A;  1OO0 B;  5LMN F;  3Q8S B;  1N36 F;  3BKF A;  2XS5 A;  2PD1 A;  2CQ1 A;  4WTO B;  2CPI A;  2OAU A;  2DNZ A;  2Q6B A;  2XI3 A;  2HBR B;  3B6B A;  1F0X A;  3R5C A;  3TUP A;  4CIO A;  2FGC A;  2UXB J;  4F0K A;  2BAB A;  2Y0S D;  3I9Z A;  3QZ7 A;  2HAI A;  1U02 A;  4HVZ A;  3R2D J;  3ZTP A;  4GKK J;  3W65 A;  2ZZT A;  3MR3 A;  2BE7 D;  1HW8 A;  2MKH A;  1RTZ A;  2KXF A;  1BLU A;  2MKS A;  3N9U C;  4OZJ A;  2IBK A;  1WKL A;  4YEA A;  2C3O A;  3FRY A;  1YJ7 A;  1FJ7 A;  2CRL A;  4B9S A;  4L74 A;  5J1N A;  3EPI A;  2ADB A;  1W25 A;  2X1G A;  3TA0 A;  3FEX B;  4RBV A;  1XNQ J;  4WFN Q;  2YNH A;  1ZM2 A;  3C14 A;  5E3A A;  2XCP A;  1VQO S;  5HMX A;  2DK2 A;  1S7I A;  4BBY A;  3BGO P;  4D3H A;  8RUC A;  3TAR A;  1DRZ A;  4CLU A;  3MM5 A;  1J5E J;  1DAR A;  3M9O B;  1NB2 A;  2B6A B;  3QIP A;  1NK8 A;  4OZ1 A;  1SKU B;  2GC8 A;  1BQN A;  4C8O A;  4Y34 A;  1KVK A;  2VPW B;  5K8M A;  1KSP A;  4M5I A;  3W2V A;  1M5S A;  4QBU A;  5GAH U;  3OL8 A;  3SQG B;  2DO0 A;  4WFY A;  4M5L A;  4JV0 A;  3TVK A;  3DLG B;  1B0T A;  1ZM3 A;  1XR5 A;  1KNZ A;  5H9E K;  1YIT S;  4DZD A;  5K20 B;  7AT1 B;  2HZV A;  2QIF A;  4CH7 A;  2EG2 A;  2CNK B;  3M2U B;  4OHY A;  3FQK A;  4FBU A;  1BUX A;  5CAA A;  1WDT A;  3EM1 A;  3FSX A;  2VUG A;  4JI1 J;  5KG7 A;  2QLB B;  3ISZ A;  1WHV A;  2BW7 A;  3MEE A;  3QJL A;  2VC0 A;  4K4U A;  1QY7 A;  1QTN B;  2PA3 A;  2ZKT A;  3S6E A;  2OLW A;  3X1L B;  1C1C A;  3OR2 B;  4QU6 A;  4KGX B;  2G0I A;  1WC3 A;  1NK0 A;  3BPS P;  1S1X B;  2VH7 A;  4NLR A;  2R8H A;  2VJU A;  4Q0B B;  2HFO A;  5KTQ A;  2J0W A;  2JEG A;  3HK2 A;  1SQE A;  5CCL A;  4C0O C;  4B3S J;  4ECW A;  2AGO A;  5K14 B;  5LSL A;  4OYA A;  1TKT B;  2CPD A;  2E5I A;  1RJJ A;  3O44 A;  2XB2 D;  2C2Z B;  4CO3 A;  3A12 A;  2BZ2 A;  2XQC A;  4CO2 A;  4K0K J;  1MSW D;  1XJW B;  1KQF B;  3KK1 A;  4X62 J;  1LV5 A;  4XAK A;  3PJ9 A;  1HYS A;  2J6T A;  4LFB J;  3PKY A;  2OPS B;  1F1B B;  1WWH A;  3BKU A;  1TVR B;  3OPK A;  5L9X A;  3I56 S;  4DS5 A;  1RWK B;  1RWU A;  1ZA1 B;  2OD6 A;  5B0C A;  2MQO A;  4WJB A;  1RK8 A;  1V5V A;  1Q8L A;  1XMQ F;  2F4V J;  1Y5I B;  1TAQ A;  2E1P A;  2W01 A;  4O3P A;  1R8P A;  1NEE A;  5HQL A;  1HNV B;  1IKY A;  1JB0 C;  1E6Y B;  1ZOT A;  3PHE A;  1YJU A;  4M1K A;  2DNK A;  3CJ2 A;  3CD7 A;  3QRQ A;  2AU0 A;  1M5H A;  4DXL A;  1JLB A;  1MMD A;  2N4D A;  3N6N A;  1KLM B;  2GVD B;  4LRE A;  4TYA A;  4ANE A;  2MYF A;  5CZX A;  3GWC A;  3JSM A;  1JKH B;  4EBE A;  2HVH A;  4ZPT R;  1KHW A;  2RDD A;  1HNW F;  2DT9 A;  4IFV B;  4KYZ A;  4C0H A;  4DV2 F;  1EX8 A;  2AYM A;  5DDP C;  3CXC R;  3UCU P;  2MDA A;  3EIC A;  3KJN B;  1VQK S;  4NX9 A;  2CG8 A;  2W9B B;  3RAX A;  4J9P A;  3FSI A;  3W1Y C;  3KG4 A;  4J9M A;  3DLK B;  3ZZU A;  3MAQ A;  3DOK B;  2W2M P;  4I2P B;  5C7P A;  4WBF A;  1WG4 A;  1S1V A;  2ILY A;  3JYT B;  4OJ1 A;  3V4M A;  1RA7 A;  2XLJ A;  4G6V B;  5DZ7 A;  2OML A;  3OLA A;  3T5H A;  1XMQ J;  2R7S A;  1AFJ A;  2N4C A;  4LSN B;  1Q0N A;  4J90 A;  2JLE A;  3RR7 A;  3QT7 A;  2FHJ A;  2B3T B;  3Q83 A;  1TV6 A;  4ZN3 A;  4IRC A;  1MG7 A;  2MGZ A;  1YJV A;  1S6P A;  5T7L A;  5D4L A;  2IYI A;  1XNR J;  4NZ0 A;  2ZH6 A;  2FC8 A;  5A8W A;  3QQC D;  2VBY A;  4Y6I A;  3QAU A;  4C8N A;  4IH5 A;  2FD2 A;  4DCP B;  2DCU B;  2HW3 A;  1VIO A;  2LQ9 A;  4JI0 J;  2UUC F;  2MEW A;  2Y1L B;  3W9I A;  3VAH A;  3EMT A;  4X66 F;  2GO9 A;  4HHH A;  2BXJ A;  3AJ1 A;  3SBM A;  3MEG B;  1K0T A;  1EIY B;  3OT9 A;  5IFM A;  3CUL A;  5CXT A;  5A0Y B;  2PI4 A;  2J7U A;  1N0V C;  1FKO A;  3W2W A;  4OX9 J;  3W5X A;  4UT4 A;  5A2Q U;  4DLG A;  3UD4 P;  3RB0 A;  4DR3 J;  1LWX A;  4Z7C A;  1NHV A;  3AQO A;  2FJD B;  3WIV A;  3H2U B;  1BE4 A;  3MUR P;  4DUY F;  1PJ7 A;  2LQ8 A;  4M5J A;  4C7Q A;  4DHV A;  5KFQ A;  2X1F A;  3QRR A;  3M6X A;  1IUJ A;  2HLT A;  2QO3 A;  3F0N A;  1FRK A;  3ISN C;  4Z2X A;  1S6U A;  3K58 A;  4DV1 F;  3I96 A;  3EX7 B;  5HSP A;  1TL4 A;  4RZR A;  3T5J A;  2VQF J;  4F4K A;  1HA1 A;  4AND A;  4I6A A;  1NJY A;  3SYZ A;  1T0T V;  2CA9 A;  4JI1 F;  5KFR A;  2DIU A;  2J7K A;  4NLP A;  4Q43 A;  1IQT A;  4FBT A;  1ZTT A;  3I0R A;  2PFF B;  4ZVP B;  2WVF A;  1C1B B;  1UMJ A;  1AXQ A;  1PIL A;  1R8H A;  4NCG A;  2CJA A;  1K44 A;  1MRO A;  1RHR B;  1YSJ A;  1RAA B;  2ZBR A;  3LP0 A;  1JNZ B;  3ZO7 A;  4OMF G;  3PV8 A;  1TAU A;  2P2C B;  3GJS B;  1R6Y A;  3CB4 A;  4C8M A;  2MB0 B;  1XEZ A;  2W9C B;  4O3O A;  3B78 A;  2HYI B;  2DXF A;  1RT4 A;  2DD8 S;  2RE1 A;  1RCX B;  1IBM J;  4Q45 A;  1FHT A;  4QR1 A;  5ETL A;  2IAJ B;  1SKR A;  4JI7 F;  3KJV A;  2AWZ A;  2CFX A;  4YQW A;  3PW0 A;  2UVR A;  3IWL A;  2VBW A;  4O4G A;  1R3N A;  2B4V A;  2GHW A;  1IKV A;  2MJU A;  2V2K A;  3CCW A;  1N5Q A;  3H2V E;  4MK7 A;  4RW7 B;  4Y00 A;  1AUD A;  3RR8 A;  4AYB D;  3E01 B;  1JLF A;  5KFG A;  4KY3 A;  1YX2 A;  2ASY A;  1CSJ A;  2HWI A;  2DH7 A;  3W61 A;  1RHK B;  3CVK A;  3THT A;  1VLO A;  4LF1 A;  5DLG A;  3RRG A;  1NHU A;  2VFS A;  3DRR B;  2VON A;  1TKX A;  2GQQ A;  2E9R X;  3DRY A;  4JI6 J;  1K47 A;  3CJ8 A;  4NYO A;  4XTT A;  2AJF E;  3UO0 A;  2YKO A;  2CQ0 A;  3DLE B;  1U24 A;  3VGT A;  4J7C A;  4YR0 A;  3C6U B;  3BN4 A;  5E3R A;  2IA6 A;  4C3L A;  3DDI A;  4M8L A;  1WC6 A;  2DHX A;  1WF0 A;  3CE8 A;  4V1A k;  5AJ3 F;  2X7I A;  1R7I A;  3DLJ A;  4DV7 J;  1J5O B;  3OL7 A;  3QLH A;  1QAX A;  5F8I A;  1T9V A;  3T1Y J;  1KR4 A;  4LRD A;  2RQC A;  1JLB B;  1H38 A;  4B3S F;  1KN6 A;  3DOM A;  3V6D B;  1HQE B;  2QFI A;  3KMS A;  3CDE A;  4PUO A;  4JUZ A;  2BOP A;  4KB7 A;  4N56 A;  4ECR A;  3F41 A;  4FYX B;  4OJH A;  3H5X A;  4BLG A;  3SCL E;  3MMA A;  3L3C A;  4NLV A;  5KAK A;  4ZVE A;  2EC0 A;  2LKZ A;  1O51 A;  3HKZ D;  4UTG A;  2JEF A;  4USV A;  1HQE A;  1Q8I A;  2RDI A;  2JLF A;  4NA1 A;  3CME S;  1RWW B;  2B0G A;  3TRG A;  2FHO B;  1RTI A;  3K7R A;  2R7R A;  2EC2 A;  3I0S B;  1DZ5 A;  4B08 A;  2EG1 A;  1CUL A;  1FDD A;  3NS5 A;  1X0P A;  3V6H A;  6AT1 B;  1IN0 A;  3D0H E;  2KB2 A;  1Q82 T;  4F8R A;  2GX8 A;  3D6H B;  4CO5 A;  1DJ0 A;  1B99 A;  1P1T A;  2JSX A;  2ROG A;  2Z30 B;  3NGR A;  4P73 A;  2KO1 A;  3DLE A;  2QX0 A;  4AD6 A;  1DFD A;  3M2V B;  4IYQ A;  2JZ5 A;  4O0N A;  5HAN A;  5HQM A;  4GC6 A;  3PW4 A;  4UOG A;  3EGV A;  5J2N B;  1U1Q A;  1UFW A;  3CJ0 A;  1ITP A;  2NRE A;  3HSJ A;  2HZA A;  2IVY A;  3M6U A;  2LEA A;  3GIL A;  3NY0 A;  2VIH A;  2L9N A;  4NYZ A;  3Q0A A;  1S4E A;  2CZ9 A;  2FQQ B;  3Q8Y A;  2W7P A;  2OH2 A;  1WOS A;  2F8E X;  4LF8 J;  1X4D A;  1V3R A;  1M1G A;  4PYA A;  4UOF A;  2UXC F;  2VPY B;  4NI2 A;  3ZTR A;  3CCV S;  3HKW A;  3MEE B;  1FNM A;  2RIL A;  4ZCM A;  1HNI A;  3IWN C;  4DPU A;  2B51 A;  2W4D A;  2ZJQ Q;  4ZPC A;  4GKJ F;  3FK4 A;  1UEK A;  1GFW B;  3ENW A;  1IBK F;  4ILM A;  1F2H A;  1TKD A;  4LSL B;  3G82 A;  1HBM A;  3PW7 A;  4UZB A;  4RUB A;  1FX4 A;  3FEY B;  2MQM A;  3KTQ A;  3AD9 C;  4Y3C A;  2R8G A;  5E33 A;  1HWU A;  2I1R A;  2ZZM A;  2XC9 A;  1JLE A;  3G8T A;  2E1R A;  4FPI A;  4RW8 A;  5J1E A;  2C2M B;  4JV5 F;  2KVI A;  1WAC A;  2AJ1 A;  3BQ0 A;  3WQP A;  1L3U A;  3CCT A;  3TVZ A;  3PR4 A;  3MWB A;  1HWI A;  4ZMM A;  4DG1 A;  4H4K A;  1Y5N B;  2NXE A;  4KHR A;  1DBD A;  2YKM A;  1FWK A;  1WJ9 A;  1GTH A;  2B6A A;  3BN7 A;  4PEO A;  2HHH F;  3PVX A;  1EET B;  2HMI B;  5AXK A;  4DR6 F;  5F8N A;  1HBN A;  5T41 A;  3DI6 A;  5J1P A;  3OXL A;  2KM8 B;  4ZP9 A;  3GYN A;  4CYU B;  4I69 A;  4ZLP A;  5KFU A;  4OX8 A;  2KFN A;  2FUG 9;  4ECU A;  1H72 C;  1U0H A;  3LA0 A;  3MCN A;  3NLC A;  4LIW A;  1HBO B;  4LBI A;  5CYM B;  4O4R A;  3VZI A;  1X9S A;  3BM7 A;  3RAQ A;  3ILO A;  3SSR A;  4QZV B;  1X5P A;  4N76 A;  1XNQ F;  1HWK A;  3KK1 B;  2HQG A;  1LKZ A;  3K8W A;  3DN9 A;  1XMO J;  1C4A A;  1SH3 A;  4LF5 F;  2HHH J;  4DV2 J;  4DG1 B;  1KOO A;  1R6V A;  2Z56 B;  3AQP A;  3J80 U;  3BDE A;  1K1Q A;  3MPU B;  4NRT A;  4F4A A;  4YHH J;  4DSF A;  1KFS A;  4EFA C;  4JV5 J;  4O23 A;  3W62 A;  1S9G B;  2WBR A;  4DEZ A;  2HQF A;  1FTR A;  2JJ4 D;  2B9X A;  2NPI A;  4ENO A;  4FN5 A;  4QWB A;  4NLQ A;  4K7Q A;  4FXD A;  2OMO A;  1VCT A;  1BQN B;  3ILL A;  3PEH A;  1EP4 B;  5KFY A;  3TNV A;  4NLX A;  3K5N A;  1S6P B;  2FJB B;  3A3N B;  4USH A;  5T7L B;  4BWJ A;  3TX0 A;  4UOH A;  1P1L A;  2HRU A;  5I42 A;  1UFL A;  2MST A;  3GIK A;  4DR4 J;  1HLW A;  3OV7 A;  4DR2 J;  1BMQ B;  4Q5V A;  1H3D A;  3UI3 A;  1RAE B;  3MM7 A;  1KDN A;  1Q95 G;  2YNH B;  3HF5 A;  4FYV B;  1IBK J;  1TL1 B;  1NHK L;  1N4L A;  3DLL Q;  2LCW A;  3FDS A;  3PDN A;  4OYP A;  4NI2 B;  1S99 A;  4KQZ A;  1IKV B;  1IR1 A;  2E5H A;  2JOQ A;  3KWM A;  4QR0 A;  4TQR A;  4IO1 A;  2R4F A;  4NRU A;  3OFF A;  2RF2 A;  1X4H A;  2D9O A;  1WKK A;  2WAQ D;  2J6U A;  3PO5 A;  2Y9H A;  4X66 J;  5MAO A;  2VBZ A;  4RNF A;  5CCM A;  4YHH F;  4ECX A;  4EO8 A;  1WKJ A;  2XMA A;  2ZC3 A;  2GS8 A;  2YKQ A;  2YKA A;  2CAD A;  1VRU B;  3NGD A;  3GIJ A;  4U9R A;  5G0R A;  4KIA A;  5DG8 A;  1A0O B;  3F44 A;  3J81 Y;  3SV3 A;  1RBL A;  2HND B;  2I5J A;  3H20 A;  2GML A;  2DR5 A;  2OPQ A;  4ELV A;  3FC9 A;  4V19 J;  1GMW A;  4ALZ A;  5E3Q A;  3RBX A;  1EQM A;  1U0H B;  2DIS A;  1WEZ A;  2MZJ A;  3HJV A;  3K8V A;  4MIA A;  2UU9 F;  3CDB A;  4PPZ A;  5AT1 B;  1S0V A;  4IOB A;  1BWE A;  4ES1 A;  4B3M F;  4OYX A;  3I5C A;  4YP3 A;  5F0U A;  1Y7P A;  5E7O B;  3CDA A;  2AV5 A;  3W9J A;  1FEE A;  1GX6 A;  5LSR A;  2DNY A;  1FKA F;  2NZ4 A;  3HVT B;  5HVF A;  2OPS A;  5D0R A;  1S9E B;  4L6V 3;  3R7S B;  1JWW A;  2GFF A;  2CVE A;  5EN1 A;  2VOD A;  3FRZ A;  1WI8 A;  4GKK F;  2RH3 A;  5DLF A;  1LWF A;  3D6T B;  3DFE A;  1XTZ A;  3IG1 B;  5K8O A;  4JI5 J;  1HD0 A;  1ZZF A;  4OQJ A;  1M1H A;  4QQB A;  4PKD B;  1KEK A;  4NLS A;  4JI3 F;  5KG3 A;  1WC0 A;  2CDQ A;  3CMA S;  5KFV A;  2M4M A;  2BM0 A;  4ED4 A;  2XY6 A;  3BGR A;  5HBM B;  4WCE Q;  2HHQ A;  3RBZ A;  2UZA A;  2AYB A;  3HHN B;  1MN9 A;  3G6X A;  5IT9 Y;  1RT7 A;  5HAT A;  5A8W B;  3KK2 A;  4UZC A;  6FDR A;  4W92 B;  3R7N B;  3FZB A;  4XIU A;  4EEY A;  4C97 A;  5BXI A;  2RML A;  3AJ2 A;  3JTP A;  3W3S A;  1D3W A;  2WOM B;  3E01 A;  3G8S A;  2NXJ A;  2X1B A;  4ID8 A;  4TLR A;  4R8U A;  4CWB A;  3GU0 A;  4KH1 B;  1WC5 A;  1UP1 A;  2ZNZ A;  4WXW A;  3M2R B;  1Q79 A;  2JDJ A;  4OI0 A;  1AT1 B;  4IOC Q;  2OGU A;  3TVY A;  2ACM A;  2XNR A;  3CJT A;  4S0M A;  5IZH A;  4NXM F;  2FIU A;  1NZA A;  4ZPD A;  4LFC J;  1QJH A;  4A48 A;  4DUY J;  2C2R A;  3MOZ A;  3DOK A;  3NGU A;  4ZLJ A;  1RGV A;  1HBU B;  3MAH A;  3D0G E;  4NXN J;  8ATC B;  1FA0 A;  2V4J A;  2AJQ A;  2KXN B;  3PCO B;  4CP5 A;  4CNZ A;  5RUB A;  2JFD A;  1F60 B;  1RUS A;  3N6M A;  1VRT A;  1XC9 A;  3H4D A;  3MAA A;  4TU9 A;  1Q5V A;  1APS A;  3VTI A;  5M2R A;  1DY3 A;  4EMD A;  5I3U A;  3TR5 A;  2CQ2 A;  3EE3 A;  3EGN A;  4CLT A;  2RQK A;  5C24 B;  2J0Q D;  2B9Y A;  4K5S A;  4RU2 A;  2QTW A;  4PXE A;  4DPT A;  4MFB A;  1YHQ S;  3BSN A;  1HPZ B;  4DPO A;  2R2U A;  4EK2 A;  3BEG B;  1XR7 A;  3FKB A;  1VK8 A;  3SFG A;  2GJI A;  5J2Q B;  1HHS A;  4L73 A;  4B9U A;  4KRW A;  1UVL A;  2HS4 A;  1WSR A;  3HDS A;  2WVC A;  2HFS A;  1HNX J;  4X4O A;  5EX0 A;  2PEH A;  1IM4 A;  4IKA A;  2C3U A;  4P6Q A;  3R5G A;  3ZZT A;  5HMY A;  1FCA A;  2F4F A;  3NAI A;  3QLH B;  4DR2 F;  1VRT B;  4V19 X;  3CUN A;  2ZHO A;  3LOU A;  3TYT A;  4QWC A;  2VOP A;  1RTJ B;  4QIG A;  2I8E A;  4XO0 A;  4HLB A;  4EBD A;  4NLW A;  5D0H A;  4CM2 A;  2UUB J;  3HHL C;  4DR1 F;  3TAM A;  2GCF A;  1UWB B;  1S48 A;  3OFH A;  1T03 B;  3ZZ0 A;  1M90 T;  2JFK A;  5GMK a;  2Z4P A;  2JH3 A;  3K5M A;  1NAQ A;  2VJV A;  1NKC A;  3R6G B;  2DXE A;  3BZQ A;  5EUH A;  2XM3 A;  5CH7 B;  1VK3 A;  1HHQ A;  2X51 A;  3T1H J;  3MOJ B;  2KRR A;  3T6J A;  3R1H A;  1S1X A;  1OY8 A;  2UVV A;  3CJR A;  2HBY B;  3H0P A;  2D3O R;  4WPA A;  2Z58 B;  5ETS A;  5BR8 F;  4P2F A;  4LF4 J;  1QSL A;  3U1L A;  1VQ4 S;  5G4D A;  2ASD A;  4TNO A;  4B3M J;  3QJJ A;  3GFH A;  3L7U A;  2YQ1 A;  4RW7 A;  2JLG A;  3KXD A;  1LXJ A;  2V4Q A;  2I0X A;  3MCO A;  4FPR A;  5ETM A;  3PO4 A;  1URN A;  1PCA A;  2WSC C;  4JP8 A;  3TA1 A;  1H0H B;  3RAM A;  2KKH A;  1IM6 A;  1DLO A;  2DGU A;  4KGZ B;  4RPF A;  3KHG A;  2ZHA A;  3JYT A;  1N5S A;  3PR5 B;  1HAR A;  1XWL A;  2R42 A;  2BBE A;  2YWE A;  2JC1 A;  3CIM A;  2W9C A;  1RA6 A;  2HRY A;  1N34 F;  3DLK A;  3PNI A;  2LEC A;  2XMM A;  1RU1 A;  3MMC B;  2ACY A;  2N7Y A;  1KBR A;  1P9Y A;  2CQH A;  2XMT A;  9RUB A;  5K14 A;  2R7W A;  3BRE A;  4DV4 F;  4ECY A;  2E9T A;  2MKC A;  2LU1 A;  1HMV B;  3ETO A;  4W90 B;  3AB4 B;  4CLW A;  1BY9 A;  2JC0 A;  1FRI A;  1RB0 A;  2GVD A;  3MED A;  2DTJ A;  4P71 A;  4ZLL A;  3OSN A;  2B7B B;  5BYS A;  1SJ3 P;  5DQI A;  5F41 A;  3VR1 A;  3GII A;  6FD1 A;  1QE1 A;  4MIW A;  2Q6C A;  1I51 B;  2OEM A;  1X7V A;  3ADA C;  4U8Y A;  3W63 A;  2VFT A;  4P2M A;  4F4W A;  2GV1 A;  3M30 B;  4FYD A;  1UAW A;  2IIH A;  1KTV A;  4JI8 F;  4PXD A;  2QL9 B;  1CS4 B;  4M5K A;  3QGH A;  2UU9 J;  1T02 A;  2ZOM A;  2HVE A;  3UW1 A;  3HFK A;  4E2F B;  2OPP A;  4OYZ A;  5ADZ A;  5F8G A;  1Z2Z A;  3SXL A;  4LT6 A;  1R8A A;  5KFJ A;  3MFI A;  1U1O A;  3LTO A;  3PRD A;  4JOU A;  1URR A;  3BSO A;  4KGK A;  3ENA A;  3G86 A;  2CNL B;  1FK9 A;  1JLQ A;  2E29 A;  2VG5 B;  4M5D B;  4YS2 A;  5CAB A;  3DLB A;  3HVA A;  4WKR A;  2G0C A;  1IR2 A;  3RRH A;  4EYH B;  2D74 B;  3POT B;  2F5G A;  3PRB A;  2YWF A;  2XG8 A;  4DQI A;  5J2P B;  3M8W A;  1W7W A;  2YX1 A;  5HK4 A;  5GAG I;  3I82 A;  3J7Z T;  1Q78 A;  2F3J A;  4PRF A;  4K4X A;  3UDV A;  1FDN A;  2H48 B;  5KFP A;  9ATC B;  4ECV A;  4J9U E;  2XO7 A;  1NH7 A;  4UQG A;  1DTT B;  2R7U A;  1F9F A;  4RNH A;  2J6S A;  3QID A;  4J9O A;  3FCW A;  2WW4 A;  1F3V A;  1ZBT A;  3CCU S;  2RJZ A;  2OPR A;  3GB0 A;  3OQ2 A;  1XMB A;  3OXF A;  4LSN A;  5ETK A;  4ZVT B;  4CLK A;  4CLZ A;  4ZHR A;  1VDH A;  3U7J A;  1B4S A;  5GAD I;  3QZ8 A;  2QG9 B;  4QR2 A;  2WTF A;  2K1R B;  5JVG Q;  3WZ0 A;  4K4S A;  2LQJ A;  1X9W A;  2YKN B;  3GFX A;  1RWO B;  2DKO B;  1VQ7 S;  2UXD F;  2J9E A;  4HTJ A;  4X62 F;  4DR6 J;  4ED3 A;  1LW2 B;  5DDQ C;  3J80 Y;  4P52 A;  2UVU A;  3ENV A;  3CJ4 A;  3CO9 A;  3MPW A;  1MW7 A;  2RQM A;  2IFX A;  2O5D A;  3N6L A;  1C0U B;  1N5Y B;  2HSE B;  3D1O A;  2L3M A;  2OTL S;  4DUZ F;  4BHQ A;  1LW2 A;  1FT8 A;  1T3N A;  2ZWP A;  3K17 A;  4FS1 A;  1AFI A;  3R7B B;  1X4F A;  3KJF B;  3QGI A;  4OI1 A;  2Y0B B;  2FVS A;  4LR8 A;  5A76 A;  1XMO F;  1KHV A;  2M2B A;  1FDB A;  2V9K A;  2IYG A;  2DCL A;  3BBB A;  1FFS B;  1U2R A;  4MK8 A;  2HFU A;  5GVQ A;  1CQN A;  3JAM Y;  3V6D A;  2OD4 A;  2IM2 A;  2LA4 A;  3IS9 B;  5DS7 A;  5C5J A;  4HYK A;  1AA1 B;  2OKQ A;  2I6W A;  1IVZ A;  3E51 A;  1K0V A;  2MHE A;  5KFX A;  2AJ2 A;  4J5O A;  2CG4 A;  1H73 A;  2EFG A;  2L9W A;  4URQ U;  1X5T A;  1RHJ B;  2XEX A;  3PXG a;  5IS2 A;  3T5K A;  1EJ7 L;  1YTY A;  5DM6 Q;  4E98 A;  4NZ6 A;  5EHH A;  4OL8 A;  2QRR A;  2ZH1 A;  3CC2 S;  1VC0 A;  3TO8 A;  4X4R A;  2DRD A;  3EZO A;  4KKO B;  1PGZ A;  2M8D B;  3HHD A;  3CC7 S;  1T9Y A;  5DET A;  2XLI A;  3CWJ A;  1JLQ B;  4F25 A;  2V34 A;  1GMU A;  4DU8 A;  1S76 D;  2KG1 A;  1V9O A;  1HL6 A;  2LXU A;  2FJW A;  3BO4 A;  2VV5 A;  4J37 A;  3NNC A;  3WC2 A;  3DRS A;  4Y2C A;  1JLA B;  5D4O A;  4DSK A;  3CIZ A;  3HVT A;  3OR2 A;  1HW9 A;  5SZT A;  4P2X A;  5HI7 A;  4CCH A;  2BJ1 A;  4UQT A;  1M5P C;  5C25 B;  1NDL A;  3W5Y A;  5LMU F;  3J7Y I;  5A2Q Y;  1Q8K A;  3PRV A;  2ZH2 A;  3O2I A;  1VC5 A;  3SEO A;  5L46 A;  3PX4 A;  1Q86 T;  3FSY A;  4LJM A;  3GJQ B;  3HI9 A;  2K2P A;  3CCR S;  4WKY A;  5KOW A;  5H1S V;  3BGU A;  1LQ9 A;  1VFJ A;  3CSK A;  3N4W A;  4YY3 J;  3FJ2 A;  4ED0 A;  2U2F A;  1RTH A;  3ZZY A;  1WEY A;  1KP6 A;  4LRF A;  3D7S B;  3MED B;  2MLZ A;  5J2N A;  1IKX A;  1DTQ A;  2EFP A;  3RGI A;  3KLH A;  1PBU A;  3RZA A;  1R0A B;  1ACM B;  1VBK A;  3QRP A;  4OZ5 A;  1W26 A;  4AXJ A;  4CLP A;  3H25 A;  2DRB A;  2OTJ S;  2ZNY A;  2DR6 A;  1JLE B;  2E5L J;  2DH9 A;  1JLG B;  2RU9 A;  1M5O C;  4O3R A;  3VCD A;  1ELO A;  2FJV A;  1FRX A;  1RAD B;  4P75 A;  1VQ9 S;  2EEY A;  2A2D A;  2DGT A;  5KFO A;  5CD4 A;  3M6V A;  1LW0 A;  1BHN A;  2AMC B;  4WP3 A;  2DPI A;  2XSF A;  3A3P B;  3CJ3 A;  2UV8 A;  4IG0 B;  4MAK A;  3UN2 A;  1FEH A;  2XY7 A;  4B9T A;  1ZYQ A;  4C8Z A;  1R8B A;  3UE2 A;  5IC4 B;  1S4F A;  2FTR A;  4ANC A;  2ZH4 A;  3MM5 B;  5EWE A;  2KXH A;  2M88 A;  1T94 A;  1PIE A;  5A6W A;  2H51 B;  3D1Q A;  3H5Y A;  4C11 A;  2N3O A;  1NBE B;  1OYE A;  3G9C A;  2OEL A;  2KT3 A;  4DQS A;  3MF5 A;  5L39 A;  3ZC4 A;  1RAJ A;  4CTA B;  2R7Q A;  3ZZP A;  4MFB B;  2QLF B;  4N41 A;  3UNY A;  1NKB A;  3PYG A;  4M94 A;  3P5T L;  2DHH A;  2ATL A;  2MXY A;  4JI2 J;  4LR7 A;  3DNC A;  3ICL A;  4FNH A;  4I6W A;  3AOD A;  4P7T A;  5B0F A;  4CM0 A;  1WOR A;  3CO0 P;  3HMJ G;  4DR4 F;  3PG9 A;  2F9J A;  1T03 A;  1IBM F;  1OY6 A;  2QFJ A;  1HQU A;  4U67 Q;  3RBD A;  2ALY B;  2HK3 A;  3RW7 A;  3EDQ B;  1FTC A;  3GV7 B;  4IR1 A;  2OFG X;  1YLX A;  5CYJ A;  4DV5 J;  3VGV A;  3IM9 A;  3VV2 B;  1MN7 A;  1RTJ A;  5DGA A;  2WZ1 A;  2NCK L;  2PSZ A;  3ITH A;  2QA1 A;  1AUS L;  2EI5 A;  1LWF B;  4JB8 B;  4X65 J;  2UXD J;  3K0J A;  3QO9 B;  2KVQ E;  1HNZ J;  3M32 A;  3NS6 A;  1TL5 A;  2EFO A;  3FEZ A;  1S1W A;  2HS3 A;  2HGM A;  2NXC A;  4AL7 A;  1V6H A;  1L5U A;  2DYA A;  1IBL F;  2AJ0 A;  3GIR A;  4ECZ A;  5BYR A;  5HRO A;  1TK8 A;  1YBA A;  5T14 A;  4JV1 A;  4OLO A;  1RE1 B;  2GJ2 A;  1WTF A;  1MML A;  2C2N A;  4IRD A;  3IGV A;  1PYT A;  1CEZ A;  4I7F B;  1RT6 B;  2MKY A;  3C8Y A;  2C3P A;  4RX6 A;  1XER A;  2MHN A;  1VQL S;  3BS9 A;  1RT7 B;  2PFD A;  1RT4 B;  2I9S A;  3ILJ A;  4P74 A;  3JTN A;  3TUI C;  3R27 A;  3T9Z A;  4HH0 A;  4P7V A;  4DV7 F;  3UD5 A;  3UCZ P;  4A8F A;  4HHU A;  3TWZ A;  2V2Q A;  2FZC B;  2H1Y A;  3E2E A;  4LF9 J;  3QO9 A;  2IHR 1;  4TKT A;  1S6Q A;  2HBZ B;  2R8J A;  1BWV A;  1FF2 A;  3CJS A;  3JXO A;  3LP0 B;  4TY8 B;  4K50 A;  2NSC A;  2UXB F;  2HVZ A;  2A6M A;  2GAH C;  4DL4 A;  4KT0 C;  3N01 A;  2IY5 B;  4E8U A;  4HT7 A;  2VA3 A;  3WC0 A;  4DL3 A;  4QWE A;  4KTQ A;  4ZN1 A;  1FXL A;  2IBO A;  1OY9 A;  4TYB A;  2Y3Y A;  5IM0 A;  4CH1 A;  4J9Q A;  1YJ9 S;  1SQF A;  2BX6 A;  5KT2 A;  2UUW A;  4PG7 A;  4U6P A;  4JYA J;  3M1V B;  1JLC B;  2KHC A;  3VZH A;  4DV0 F;  1FFW B;  4DX7 A;  3MFH A;  2CIM A;  2FJE B;  4G3I A;  1S1U B;  3EXC X;  2MQ8 A;  2WB4 A;  2RT3 A;  2BKP A;  4H4O A;  1YQH A;  4Q2L A;  1F5C A;  3IC1 A;  1REV A;  1S1T B;  2BEF A;  5FII A;  4X4V A;  4QYR A;  4DL0 C;  4C11 B;  3TAP A;  1TK5 A;  2G13 A;  3FCV A;  2JX2 A;  1WD6 A;  4OHZ A;  3TZW A;  5AE1 A;  3MR7 A;  3Q8P B;  4R0J A;  4ED1 A;  1TQL A;  1D09 B;  2DNN A;  2GQC A;  2JNJ A;  5B0B A;  1HMV A;  1DHM A;  2RRB A;  2AEF A;  5KG4 A;  1BQM B;  3QAT A;  4G1Q A;  4N77 A;  2GHV C;  3VHQ A;  1NJZ A;  1Q81 T;  4OI3 A;  1N6Q A;  4RW9 B;  1VQY A;  4NCG B;  1IR0 A;  1CJU B;  4DOZ A;  2RRA A;  1RAH B;  1FI4 A;  2F7V A;  4OHX A;  2EKN A;  3Q23 A;  4ZOS A;  5JXS A;  4ZLN A;  3LWM A;  3PZP A;  2FLP A;  2DR7 A;  2EXU A;  4ZP7 A;  2Q66 A;  2Z0G A;  2XBP A;  2LU2 A;  3I0S A;  2V5H G;  4IQM A;  2AYE A;  4PG5 A;  2W2O P;  2ZJR Q;  2VU5 A;  2LEP A;  3BGL A;  4ILR A;  3KK3 B;  1ZET A;  5ETO A;  4MKB A;  5C42 A;  1O8B A;  4LF7 J;  4KHP F;  2AF6 A;  2UP1 A;  3UVJ A;  4EUV A;  2QV6 A;  2ZC4 A;  4WYW A;  2MLY A;  2KM8 C;  2RUG A;  3HZE A;  3K2Y A;  4ED2 A;  1A9N B;  1X0F A;  3T1H F;  2YH0 A;  1HQ2 A;  3GFZ A;  3DOM B;  3IP0 A;  2YPZ A;  4F3M A;  4A8S A;  3R5J B;  4B9V A;  1CJK B;  2HNZ B;  3M7V A;  4CRJ A;  4QIE A;  3KNG A;  2V68 A;  1N54 B;  3D6F B;  4KFB B;  3W66 A;  3MAA B;  3WHI A;  3VAM A;  5E3C A;  2K8G A;  1C4C A;  4OX9 F;  4KV8 B;  4LFA J;  3WBZ A;  1S79 A;  1LWC A;  3UR0 A;  4WII A;  1N8R T;  4MJK A;  4HI1 A;  2COL A;  1S9G A;  2HQ3 A;  1RWV B;  3Q86 A;  2LDI A;  3GCX P;  4G1I A;  2V4J B;  3R6L B;  1FER A;  4B02 A;  2L08 A;  2RHS B;  4DV5 F;  1QUP A;  1TP7 A;  2FB0 A;  3DMJ B;  2IC3 A;  2QC3 A;  3H5U A;  4PWU A;  5CQG A;  1U1N A;  2EW9 A;  1UVM A;  1TKX B;  4JI5 F;  2YX7 A;  1U6Z A;  4NWB A;  3PHT A;  5LOQ A;  2RF2 B;  4RW4 B;  5M2U A;  5I3P A;  1D8Y A;  4CO1 A;  3A8I A;  3NOG A;  2ZH8 A;  2PI5 A;  4L3K A;  4RBT A;  4FKX A;  1NSA A;  4ZVF A;  1IKY B;  1E6Y A;  4L72 B;  2DR9 A;  4MT1 A;  4A4J A;  3JB9 k;  3A8K A;  3C19 A;  1N32 F;  1CG2 A;  3KG0 A;  3SMZ A;  1F9E B;  2CDR B;  2QA4 G;  2E9Z A;  2CJ9 A;  2YNG B;  3KKF A;  3IA0 A;  2GHP A;  3V4I B;  4DR7 J;  1PC4 A;  2HHV A;  3C2P A;  3CD5 A;  3LAN A;  1K8A T;  1UW9 A;  4ZKA A;  1KFD A;  3GG0 A;  4DL6 A;  3A8J A;  1KKH A;  3CW2 C;  4A47 A;  4DR3 F;  2OO4 A;  5HBM A;  1WOP A;  2YKM B;  2I2Y A;  2V50 A;  3A1Y G;  1TL7 B;  2WBM A;  3GIM A;  2JVR A;  2DGX A;  4ETZ A;  3IBC B;  4IOA Q;  4DV3 F;  2F4V F;  2C2K B;  3RB4 A;  3O6Q A;  2GGP B;  2W24 A;  3MGJ A;  4NZ7 A;  2Y8Y A;  2DGQ A;  2AP6 A;  1QLN A;  1FES A;  1ARO P;  1HBU A;  1GAO A;  2PC6 A;  4P10 A;  2AD9 A;  2CQP A;  5L1L A;  1R0A A;  1T95 A;  2HK2 A;  4I68 A;  2Q43 A;  4ZDN A;  2NS1 B;  5KFI A;  2VIC A;  1NJI T;  5JVH Q;  1YRT A;  3JQK A;  2HEK A;  3NKY A;  1Y5L B;  1XBW A;  3UD3 P;  2Z2Z A;  1V3S A;  3D67 A;  3IMQ J;  1YRX A;  1UJ5 A;  2WK4 A;  2B5J A;  2MQL A;  2M0G B;  4USI A;  2UUA J;  5KFB A;  1Y3K A;  1LFW A;  2AZ1 A;  4J9N A;  1WDD A;  1RSC A;  1X4B A;  1HNI B;  1FD2 A;  3SCI E;  1OPI A;  4DR7 F;  5AXL A;  5L8R C;  4H4K C;  1S0O A;  2VF3 A;  1ZS6 A;  2O66 A;  5DG9 A;  1EET A;  2BDP A;  2P6T A;  3UN3 A;  1RKJ A;  4DN9 A;  3KJQ B;  1M1K T;  3D1H A;  1N48 A;  3KNA A;  2BJ3 A;  2I5J B;  3VAF A;  2FLL A;  2K3K A;  4HT5 A;  4KAI A;  5KFZ A;  3LO3 A;  2UVW A;  2M70 A;  1PJ6 A;  1ZA2 B;  2LDY A;  1FWP A;  4MKY A;  2E5L F;  1H2V Z;  4RUC A;  3T1Y F;  2MPU A;  1WSV A;  2HNY B;  2XWX A;  3OTB A;  2HZC A;  2HFN A;  3HZG A;  3M2V A;  1YKW A;  4GMK A;  4RL1 A;  4PR6 A;  5J1E B;  1WEX A;  3W5Z A;  3HD2 A;  2CQ4 A;  2ZJP Q;  5IV3 A;  2D41 A;  3V2U C;  1UVN A;  3TEH B;  4OLP A;  2BOA A;  1TL7 A;  3AOA A;  2QEX S;  3CCE S;  3PAC A;  2ZWO A;  1S9E A;  3KHH A;  4YDD B;  2V8H A;  2A3J A;  4LRC A;  1KC8 T;  2G4B A;  3A8E A;  1NCL A;  1TMM A;  4K8R A;  4B9N A;  2XLK A;  4JI6 F;  2KH9 A;  2OPP B;  5GAH I;  4PXC A;  1NSK L;  3D4J A;  4O44 B;  2FY8 A;  3S1T A;  4JI4 F;  1HKA A;  4YFU A;  3MCM A;  1VHI A;  3M30 A;  3HHE A;  1U2C A;  2NLW A;  2H9Z A;  5HN0 A;  3J7A 1;  2VKZ G;  5FLX U;  5I42 B;  2VFR A;  1QM9 A;  3BB5 A;  2HFV A;  2VOO A;  4B9M A;  2LP4 A;  1EP4 A;  3I31 A;  4ITS A;  1VYA A;  3ENQ A;  1DQ8 A;  3VQT A;  2BAN B;  1P6T A;  2DNH A;  3V6K A;  2F8M A;  2VPZ B;  1B0P A;  1W2I A;  3VQS A;  4F67 A;  2XMW A;  2MKI A;  4O3Q A;  2ZM6 F;  4WFA Q;  2HFZ A;  5B0D A;  3UFC X;  2QYG A;  4MMO A;  1JKH A;  2F63 A;  3VGS A;  1N34 J;  2GGP A;  1JJ2 R;  2BAN A;  4CDI A;  4TY8 A;  1N6Q B;  5A8K B;  1C1B A;  4OI6 A;  3CJK A;  3LF0 A;  5FD1 A;  4CZC A;  4YY3 F;  4X4Q A;  2QL5 B;  2RQ4 A;  5F0W A;  1QAJ A;  4HHJ A;  1JX4 A;  1FDA A;  2UUT A;  3HHL B;  1N0U A;  3QGP A;  1LK5 A;  3DOL B;  4NXM J;  2PO4 A;  1O6X A;  2Y1J A;  1N32 J;  4I7F A;  3EPG A;  4X84 A;  4J9V A;  1Y10 A;  4O44 A;  1RHM B;  2RRN A;  4X4T A;  2BKN A;  3SQO P;  4NE9 C;  5HRO B;  3AD8 C;  2G2Z A;  2YNI B;  4FF2 A;  2IAJ A;  2J0X A;  1SKW A;  2V4R A;  2EK6 A;  5IM0 B;  2YVS A;  3GFY A;  3GTY X;  5J2P A;  4KPY A;  3DMJ A;  2IDE A;  3MR5 A;  1YDL A;  3FBE A;  5KT6 A;  2EBG A;  3NBP A;  4K4Z A;  3GV8 B;  3R1L A;  2R8I A;  3BBC A;  2B56 A;  4C2M A;  4ZK7 M;  1FK9 B;  1SJ1 A;  1YRU A;  3CDW A;  5HMW A;  2L9D A;  3MUM P;  5HJX A;  5EX3 A;  3LH2 S;  3BBF A;  3H40 A;  3AHP A;  3C6U A;  4XPE A;  5F8J A;  3NBP B;  4KH0 B;  1LK7 A;  3EGW B;  1YVF A;  4HL9 A;  4PWW A;  4R0E A;  2AJ4 A;  1JJH A;  1NH8 A;  3C6T B;  4AT1 B;  2DH8 A;  3M9M B;  3IRX A;  4JI4 J;  1R43 A;  3CJ5 A;  3DDK A;  4USM A;  1REV B;  1S1T A;  3BPD A;  2GA7 A;  4ZA1 A;  4LQ9 A;  5E5N A;  1VQS A;  2ZOG A;  7FDR A;  1JQG A;  4ATN A;  4RR5 A;  4BC7 A;  1GX5 A;  3JQJ A;  2PMZ D;  5GAG U;  3D0I E;  3D5M A;  2W8L A;  3M2U A;  1ULR A;  1RDR A;  5CYQ B;  2DNL A;  4UUX A;  1N56 A;  5AE2 A;  3KUG A;  3DOL A;  5ETQ A;  3GR1 A;  4K4Y A;  5D3G A;  4WU3 A;  3W9H A;  4Q8E A;  4B17 A;  4DSJ A;  5GMD A;  4LIR A;  2QA2 A;  2ZE2 A;  1N88 A;  3MXH P;  1UFK A;  3QNW B;  4LRB A;  5BJR A;  3MMJ A;  4YOE A;  1CJU A;  2W9B A;  1NO8 A;  1NDC A;  3I4H X;  5E2Q A;  4YUD A;  5F8H A;  5JJB A;  4KC5 A;  4WP9 A;  3CCJ S;  5KFW A;  2IJN A;  2LVW A;  2ASL A;  1B0V A;  3DXB A;  2B9W A;  4IFV A;  2DRA A;  1U1M A;  1U26 A;  2NXU A;  5D0E A;  1XNR F;  2RHQ B;  2VQF F;  2HNZ A;  1CJK A;  1H2U X;  1OS5 A;  5K8N A;  2AW0 A;  3WX4 A;  2MKJ A;  3MR6 A;  1U1L A;  2KFZ A;  1RTH B;  1T11 A;  3DRP B;  4IH7 A;  2FHJ D;  4PAB A;  5KG2 A;  1Z2L A;  1N5V A;  1X5O A;  2CNN B;  5K5M A;  4CLS A;  2NUH A;  1NK6 A;  4LF8 F;  2HUR A;  4BCA A;  3OL6 A;  2RVJ A;  2BMB A;  2L41 A;  1MWQ A;  3RUB L;  1VBX A;  4X64 J;  3OJU A;  3NGS A;  2A2C A;  3UNG C;  1UPM B;  3LW5 C;  4P72 A;  1SUQ B;  3DRX A;  2RDJ A;  2VQE F;  1P8G A;  3OUY A;  3RTV A;  4F3Q A;  3QMQ A;  2CNO B;  2N3L A;  3FMW A;  5L38 A;  3PJX A;  3NGK A;  1NK4 A;  5IQ6 A;  2YXL A;  2LYV A;  5EWG A;  4EZ9 A;  1HYS B;  2YQ3 A;  5A0Y A;  3PYD A;  3OLB A;  4AL6 A;  1REG X;  4WE1 A;  5KFK A;  1CVJ A;  1N5T A;  4X4S A;  5IT9 U;  2MKK A;  4KV8 A;  4GVL A;  1KVJ A;  2HNY A;  4FNI A;  1GH8 A;  5F8M A;  1S12 A;  3IRW P;  4DL7 A;  5B7W A;  3GV5 B;  1UA1 A;  3R5B A;  3KHL A;  2FZK B;  3K57 A;  2IRU A;  3ETM A;  1MMN A;  5AE3 A;  2CQD A;  4WK1 A;  1S77 D;  3CD6 S;  2RB7 A;  2YNI A;  5DDO C;  5J2Q A;  2JEI A;  2CPH A;  3BQ2 A;  1OWX A;  3O1L A;  3TZX A;  3Q8V A;  3GSD A;  4NEY A;  4J9R A;  4AL5 A;  3HSZ A;  1F5B A;  1SC6 A;  1PKU A;  2PE8 A;  4I56 A;  2VD3 A;  5CA5 A;  5HVH A;  4DPY A;  3AT1 B; 
#chains in the Genus database with same CATH homology
 1RWO B;  1PYO B;  2DKO B;  3EDQ B;  3RJM B;  2H4Y B;  1RHM B;  2XYG B;  4JB8 B;  1BMQ B;  4ZVU B;  2HBR B;  1F9E B;  2CDR B;  3KJN B;  1SC1 B;  3R7B B;  3KJF B;  2Y0B B;  1RE1 B;  4DCO B;  2XYH B;  3IBC B;  1RWW B;  2C2K B;  3R6G B;  2CJX B;  5IC6 B;  2HBY B;  2QL7 B;  1IBC B;  3D6H B;  1RHQ B;  1RWP B;  2HBZ B;  1RWN B;  3SIP B;  1RHJ B;  3NS7 B;  4DCP B;  2H5J B;  2Y1L B;  2FQQ B;  2H5I B;  1SC3 B;  3QNW B;  3KJQ B;  3R7S B;  1I3O B;  1GFW B;  2H54 B;  5K20 B;  3GJQ B;  1ICE B;  2CNK B;  3EDR B;  3IBF B;  4DCJ B;  2CNN B;  1I51 B;  1NME B;  1RWM B;  2CJY B;  2QLB B;  2XZT B;  1RHU B;  1RWX B;  2C2M B;  3P45 B;  4LSZ B;  3P4U B;  1QTN B;  3GJT B;  3R7N B;  1PAU B;  2QL9 B;  4ZVP B;  2XYP B;  1RHR B;  4ZVR B;  2CNO B;  2P2C B;  3GJS B;  2CNL B;  4ZVS B;  2XZD B;  4ZVO B;  2C2Z B;  5IC4 B;  2C2O B;  2H51 B;  3R5J B;  2H65 B;  2H48 B;  2C1E B;  3D6F B;  3GJR B;  1QDU B;  2QLJ B;  1RWK B;  4ZVQ B;  2QLF B;  1RHK B;  2QL5 B;  3D6M B;  1RWV B;  2H4W B;  3R6L B;  1SC4 B;  4ZVT B;  2HBQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...