1RWKB

Crystal structure of human caspase-1 in complex with 3-(2-mercapto-acetylamino)-4-oxo-pentanoic acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rwkB00
1SC4B 2QLFB 2CNLB 2H65B 3NS7B 2H5JB 3P4UB 2QLBB 1I3OB 1PYOB 2CNNB 2HBQB 1RWKB 1NMEB 2H4WB 5IC4B 3R7BB 4JB8B 3EDRB 3P45B 2Y0BB 2QL5B 2C2MB 1RE1B 3RJMB 1F9EB 2XZTB 1PAUB 4DCPB 1RWNB 3D6FB 4ZVTB 3IBFB 2C1EB 4LSZB 1RHMB 1RWOB 1ICEB 1SC1B 2XYPB 2HBRB 2Y1LB 2H5IB 1RWWB 4ZVUB 4ZVQB 4ZVSB 1SC3B 2QLJB 1RWXB 3QNWB 2XYHB 1I51B 1RHKB 3R7NB 1QTNB 3KJNB 1RWPB 3R6GB 2CDRB 1GFWB 2H4YB 3GJTB 2H51B 2CJXB 2DKOB 4DCOB 1QDUB 1RHUB 2CJYB 3GJRB 2CNOB 1RWMB 1IBCB 3R6LB 4ZVRB 2P2CB 1RHJB 2C2ZB 2HBYB 2QL7B 3R5JB 3GJSB 2XYGB 2CNKB 4ZVOB 4ZVPB 2QL9B 3R7SB 4DCJB 2XZDB 3D6MB 2FQQB 1RHRB 2C2OB 3SIPB 3D6HB 2C2KB 1RHQB 3KJQB 3GJQB 3IBCB 5IC6B 3KJFB 1RWVB 5K20B 3EDQB 1BMQB 2H48B 2H54B 2HBZB
chains in the Genus database with same CATH superfamily
2V68A 4DF8A 1N0UA 1TTHB 1S9EB 2D7SA 2DNGA 4MKBA 4PKDB 4O3RA 1P1LA 1YKWA 3HHKA 2U1AA 1LK5A 1HQEB 4Y2MA 3T5JA 1Z2ZA 4IG0B 3HI9A 4LBHA 2E5HA 1T05B 4DU8A 2CQ2A 3BGOP 2NSCA 4K4ZA 1VRTB 1JWWA 5IT9Y 4WFAQ 1N0VC 4ZCLA 1RJJA 2ZDPA 3EZOA 1TL1B 3U1NA 1JX4A 4B3OA 2QO3A 4YB1P 1FRKA 1VLYA 3OL8A 2J0XA 1SJRA 3CF5Q 2YQ0A 2QEXS 2GNKA 5K8PA 3UN2A 5C25A 1YJRA 1VCTA 4EBDA 3QO9A 3TA2A 3UN3A 2EFGA 4BCAA 2HGMA 4DV3F 1RP5A 1IBKJ 3IS9A 3NRBA 3GV5B 3T41A 2HBZB 1JIHA 1OIAA 2XMKA 4Y2IA 1PO6A 4KPCA 2YKMB 3MAQA 3CDBA 4ZP7A 3HK2A 1I6JA 2X1AA 4HL9A 4ECWA 1KVKA 3PHTA 1BLUA 4WYLA 2CNNB 1RAHB 2V2VA 2YWGA 3N79A 4OYPA 3KHRA 1P27B 3I55S 4G65A 3T6BA 4L75A 3KJVB 4NLTA 4NYPA 4X2BA 1G6BA 2VONA 3JQJA 4CWBA 5CH7B 4DL5A 3K89A 2OHDA 1X5TA 2QMXA 2IM3A 4RBTA 4KSEB 1UW4A 3CXCR 2J9CA 2OAUA 5J2PB 2QJ3A 3AQPA 2CZ9A 2J8SA 3MM8B 4QWEA 1DHMA 5KG0A 4CM0A 2DEIA 4CYUA 2R7RA 2CNOB 3DDIA 2GW8A 1IKVB 4J9SA 4DSIA 1UPMB 2DY1A 1WORA 5L9NA 4O0NA 2KM8B 4Y0FA 2MY7A 4NXNF 3M8QB 5D78A 4DSJA 2ATCB 2FGCA 3RAQA 3AD8C 3GSDA 4IFVB 3I9V9 1TKDA 3PV8A 1DJ0A 3NY0A 1DARA 2N4CA 2B9XA 5HJXA 4QPTA 2FD2A 1TAUA 3PX0A 2GX8A 1FDDA 4ITSA 3CO0P 4YMEA 1U1QA 3PX6A 1IR1A 4PXDA 3L3CA 1H72C 2BEFA 2B7CB 1RT6B 5KFYA 2DYAA 3NG8A 4NA1A 2POKA 1S1WA 4ZN3A 2ROPA 1IKYA 2AJ0A 4CLYA 1S6QB 3QNWB 2ZITA 4IYQA 4B9VA 2B51A 5F0WA 2VFUA 5DDPC 1TFYA 4F3QA 4MKYA 2PE8A 3QQCD 1I5OB 1V5VA 4TU8A 4HI2A 2AF6A 4H4OB 4ZJOA 2IRUA 1GTHA 4K2XA 1L3UA 4MT1A 1RAGB 2P8IA 4LFBF 2KXNB 1ZTWA 3Q8YA 2VL1A 1X4AA 1NK6A 1VRUA 4YR2A 4ZPDA 3OQ2A 5CZXA 4OLOA 4C0OC 4DV1F 4K2JA 1HNWF 4X4NA 4M5MA 1TUGB 5T41A 1RT1B 3QGHA 3SCLE 1V5IB 3CWJA 4KV8B 3CCJS 5F8JA 5IV3A 3I87A 2CA9A 1ZAWA 4Q7AA 2E7XA 3UWTA 1S99A 3PM9A 3V4IB 3QBCA 2MMYA 2O1PA 5CA5A 1HW8A 3SSQA 4HT5A 2GS8A 2XS2A 5DG8A 4F2RA 3EVOA 4ZA1A 3N28A 1H0HB 3KJNB 4B9NA 1LV5A 1YTYA 4A8KA 3MM6B 2WB1D 1PKUA 1K73T 2KT3A 2FVQA 2ZH8A 2HHSA 1D9AA 1WWHA 2JNJA 2VG6A 1Q1KA 5D4OA 3SCJE 2VQFF 1X0PA 2HFZA 3OFHA 3CJ4A 3I0RB 3J80Y 1DBDA 3B6BA 1HNWJ 2F8EX 3W5YA 5IZHA 3X3UA 3HX9A 4UTGA 4IOAQ 3V81B 1UKUA 5B0FA 5D4PA 3TUJC 2X51A 2J7WA 1W26A 4C3KA 2WONB 1N36J 1I3OB 2HBQB 3FKBA 5E3PA 1HQUB 5A8KB 3OVBA 3S01A 4FF4A 4RW4A 5D0RA 1JLBB 1AA1B 2E5LF 1H2UX 4F4AA 3N5FA 5K8MA 2FLOA 3K8WA 1NK4A 4RBVA 1RBOB 2VQFJ 1DQAA 1J5EF 1UP1A 4OI1A 4E0DA 4GKKJ 5KT5A 2XHWA 4DR4F 3FMWA 4X4QA 2VG5B 3CJ8A 2EBGA 5L1IA 4WWSA 2ZHBA 4LIWA 5KFUA 1L3SA 1RTJB 4L6V3 2CQDA 4OZ0A 1WHWA 9ATCB 3WDOA 3W2WA 3AAWB 5GAGU 1N5SA 2NPFA 3V4MA 3OL9A 2UUTA 4JI2F 3KLHA 3H2UB 4FDFA 1VLOA 3RGIA 1RAJA 2MHEA 7FD1A 4LFCF 1NDLA 4OV6A 1KONA 3I6PA 1TV6B 2OKQA 3UVJA 2GMLA 2DRAA 5DRKA 1D9DA 3TA0A 3U27A 3HVTB 3PNIA 3W8PA 2MSTA 3QT8A 1FX4A 4RNOA 4NZ0A 3V6DA 4DR7J 3UI3A 2KVQE 1FDNA 2KG1A 4DR4J 1HQ2A 1ZA1B 4KJIA 3E01B 2ZE2A 5THWA 3QATA 5HMZA 4QWDA 1WSRA 4ZK7M 1FRJA 1XN9A 2VH7A 2OELA 2ZD1B 4JI2J 1Q5VA 2MZSA 4P75A 1KDNA 1APSA 3H4BA 3IO1A 3L7PA 2DXEA 3O5TB 5KFBA 1KHWA 3QAUA 1HW9A 3SQOP 4LFCJ 1FE0A 3MEGA 2KJVA 2B8QA 2FVPA 4LQ9A 2L3MA 3DFEA 3GE9A 3DLBA 1VS3A 4DUZF 3DI6B 3PO4A 4X4SA 1FK9A 2V94A 1UZHA 3ENVA 4FS2A 3VV2B 2O3DA 3RB3A 3OPKA 3G82B 3ITHA 5A2QY 1YJ9S 4QJVA 5HL7Q 2FC9A 3DM2B 1KTVA 3VVTA 3DN9A 5ETRA 1UCNA 4ED4A 2HLTA 1BHNA 4DCPB 3HSGA 1OMSA 4AQYF 3M8SA 5DDRC 1RT7A 1LFPA 1RACB 4O3NA 2UP1A 1KQFB 2QTWA 1FJGF 1RGVA 3OTBA 2E5GA 4X4RA 4KIAA 3HHLC 2YNHB 3FVYA 4F26A 3T3FA 2V34A 1WACA 2W9CB 4J9QA 2Z8QA 2WCXA 3A3OB 4OI6A 5GAHI 4DUZJ 1CJKA 1SUQB 3MMAB 2JLEA 3MOJB 2OFHX 4PWDB 5GADI 3MXHP 2DGTA 4AD6A 1FXLA 1VQLS 3LWMA 3OTCA 4DL6A 2J6UA 4RUAA 2CJKA 2XLKA 5ETVA 4IH7A 3GG1A 2IRXA 1H7WA 3KLIA 2WTFA 5DGBA 4Q8FA 1JKHB 1TVRA 3G8TA 4X4PA 2LKZA 3UDCA 4QCLA 1KQSR 4NLQA 3C6TB 3MCMA 1AB8A 3GIKA 1UW9A 2C2NA 3I0SB 4QIEA 4B3TF 1KLMA 1VQPS 4I2PA 3K58A 4DL2A 3GONA 3TAQA 3MZIA 4RU9A 3FJ2A 3FEYB 2KRBA 3KNAA 2V4JB 2KB2A 4QOTA 1G3OA 4WTYA 3G9CA 1KRPA 3EPIA 2M2BA 3TVYA 3HULA 6FD1A 4JP8A 3LP0A 2W01A 2BV3A 2YKNB 3EUNA 4M5IA 3MECB 5EX0A 1KQGB 3DXBA 3O8WA 1QSLA 4ILLA 3BGFA 4C4WA 1RHQB 1UVMA 3UNGC 5J1PA 4A47A 4IH6A 1MU2B 2LU2A 5I3UA 4B3TJ 4KH1B 4CRJA 4RKUC 1NZ8A 2VBYA 1R31A 3PRVA 3MM5A 4PZVA 1YDLA 1NHKL 2HVEA 2YX1A 2EK1A 3J81U 2HG4A 2F40A 1R8CA 3W7BA 3EZ5A 2LYVA 1V3SA 2D9OA 5E0OA 2VPWB 1WTFA 5DDQC 1XNQF 1OY6A 1QVFR 3ILIA 1DQ9A 2CZ4A 4KR0B 2E1PA 3H40A 3E51A 1VQKS 4UUWA 1NO8A 3C46A 3UCZP 3HXMA 4NMXA 3BSNA 4OHVA 1J27A 2UVUA 5KFFA 4RX6A 1FKOA 4LBPA 3M6VA 4M5KA 3KOAA 5IT0A 3ZTPA 1JLAA 1OWXA 2NXNA 2OSQA 4PXBA 5IC6B 2DHGA 2IA6A 3DRSB 3QAEA 1W7WA 2EC2A 3D7SB 4I0WA 3SI8A 4K4XA 1AT1B 3UCUP 4L3NA 3OFEA 2MLXA 3MPYA 1XNQJ 2CVIA 1S9FA 1NJYA 1MMNA 3HFVA 2ZH2A 2ZBPA 5EWEA 2CJQA 1UVKA 4NCBA 4B3MF 3RB4A 2K1RA 3UPFA 2JEGA 2RRNA 3TZZA 2JDJA 4OMFG 4U8YA 2ADBA 3EGNA 3M8PB 1GXUA 2IM1A 1HWIA 1IQTA 2QA4S 4EZ6A 4TNOA 3K0JA 1IUJA 2R7OA 5F8MA 3CSKA 5HQLA 3P96A 4UF4A 4ZCIA 2HQIA 2CQPA 2C42A 3TJ9A 4QYZK 1LW0B 3TAMA 2BJEA 1NJZA 3ENQA 4OZ5A 4IQXA 5HVFA 1RU2A 5LSRA 4O44B 5G4DA 3B4MA 1WHYA 2I38A 1CBKA 3KLGA 2UXBF 3BDPA 1VBKA 1S79A 4CO2A 2ZH1A 3C15B 3PFOA 2KHDA 4B3MJ 1DTTA 3GYNA 1B64A 9RUBA 2Y0BB 1MMLA 3D0IE 3MF5A 4CNZA 1T95A 4DG1B 3M9OB 5E3CA 3IM8A 2NXEA 4RPFA 1S1UB 1U2RA 3MTJA 2GQCA 2V9WA 2VPYB 2CQBA 4ZCKA 2DHAA 5KOWA 1HPZB 2DBBA 3SDEA 2ZZMA 1S0VA 2A18A 1ZPWX 3K2YA 3B54A 1RT3A 2CDRB 4LR9A 2UU9F 1SJ3P 4Z2XA 3PW2A 2HGNA 1FXDA 4LSNA 2FHKA 4ECQA 2LP4A 2BOPA 5HP1A 3FC9A 2CNKB 3IG1A 4MJKA 2R7TA 3AH6A 1MN7A 3K5NA 4Y2KA 1NSQA 2CQIA 2GHWA 1D0EA 1N88A 2O5DA 1HL6A 4NRUA 4WFNQ 2PA3A 2OEMA 3CJRA 2BXJA 3VAJA 4MK8A 3RW6A 2OMLA 4TYBA 1TFWA 1H73A 3G8SA 3UDEA 1WTBA 5DETA 3P45B 5LOQA 2B6AB 2FHOB 3MEEA 3B8HA 2XZTB 3TQ1A 1DLOA 3DYAA 3GG0A 1M1HA 2DIVA 4B3OB 4GO7X 2LEPA 2PFFB 5HROA 4H4KC 4LR8A 1T3NA 5AXLA 3MM7A 5K5MA 5EX3A 2R8HA 2NYHA 5C25B 1TKZA 3W8GA 5J2QA 1T94A 1PYSB 2IM0A 1VBYA 3QSIA 3QGIA 2G1HA 4DV6F 2YPZA 3NCPA 1B70B 1R3NA 4YOEA 2E1MC 3IS9B 3NBPA 3WX4A 4M95A 1AXQA 2LQJA 4UQTA 3ET6B 2UUAF 3BGRB 4N41A 2AD9A 2JL9A 2C3OA 4LR7A 1X9MA 3CCQS 4OYWA 2CNLB 2PIIA 3P4UB 3Q8VA 3I5AA 2XMWA 4MFBA 2V0NA 1U6BA 2VQEF 4Y65A 2VBZA 4AT1B 3PZPA 3BSAA 4OHZA 1RA6A 3ZZUA 2B9WA 3GR1A 1TKTA 2D69A 3A13A 4FVMA 3H4DA 3BZQA 4CYUB 4D3HA 4CO1A 2R2SA 2XYHB 1CJUB 1UMJA 4DV6J 3KK1A 4AL7A 2M4MA 4FPIA 2P5VA 4OL8A 4JBCA 3C16A 4IG3A 2VDHA 2JEIA 1N6QA 4Q2MA 4JI8F 2UUAJ 1S1TA 4K8RA 5HBMA 2QL7B 3FQLA 2BW2A 3FSIA 2XB2D 2MZJA 1O6XA 3MPVA 4Y28C 2BDPA 4YY3J 3DGVA 2UVWA 2YX4A 2XO6A 3EGZA 3M1VA 4NLYA 2HK3A 1F0XA 4A8WA 4KY3A 2FB0A 4LSLA 2VQEJ 1Z4UA 5ETLA 4X4UA 2DR8A 3OFFA 4RW8B 5F8NA 4HTIA 1S1WB 2FUG9 4P10A 2OSRA 2XNRA 1I94J 3VGVA 3A8KA 4ED8A 4F3OA 1N5YB 2E9RX 1SC1B 3GIIA 5IM0A 2BZ2A 2MQPA 2DNOA 2O01C 1Q4RA 4JI8J 4ZVQB 2JC0A 2HAIA 3RB0A 2PI5A 2QE5A 4UOFA 5KG3A 1PILA 4AFFA 4ED6A 2XTJP 2LXUA 1O8BA 1R43A 2VJUA 5H1SV 4ERDA 2OH2A 2C2ZB 2MTLA 2RQKA 1RYSA 1VRUB 4ZVOB 3RBXA 5B0CA 3H5SA 2D1CA 2XO7A 1QE1B 1U0HA 1X9SA 5FLXY 1FKPA 4N7TA 3O44A 4ECZA 2ABYA 1Q7LB 3UD4P 1XBWA 4I6WA 3BGLA 3G6ES 2EFNA 1SJ1A 4MIWA 4OI0A 3H25A 3LUYA 4F0KA 1JJCB 2DRDA 3ETMA 2MKSA 2PC6A 2V2KA 3VTIA 4IFYA 3QRRA 3VQSA 2GJIA 1MSWD 3FRYA 2HIQA 2VG6B 2BM0A 4QYZJ 3NOGA 2EPIA 2ZDOA 2GJ2A 1JJ4A 4QR0A 3HFKA 5IT9U 2DR9A 3O3LA 3OTOF 3G96A 2RQCA 2MHNA 2XGQA 2M88A 4W92B 1F5CA 4F0MA 2MY8A 3TNVA 1SBRA 4RBUA 2UXDF 3I82A 3OLBA 1UJ5A 4F50A 1ZA2B 1P9YA 2HVHA 3ZZTA 2CPZA 2HURA 2V67A 4RW4B 3F0NA 3LP1A 2BACA 3MCOA 2V69A 4P74A 1UZDA 4LF9F 3IXQA 2HFSA 6FDRA 4HH1A 4HLBA 2U2FA 2M9KA 1IBLF 4HTJA 4PWUA 4WP9A 1MW7A 2X3DA 3S1TA 2W8LA 3HHLD 1ZZFA 4P2SA 2DD8S 3T5KA 4OHXA 1HWJA 4BC9A 2LXFA 1LXJA 1H98A 2RHSB 4WKYA 2UXDJ 4DCOB 4J90A 4NLSA 1SI9A 2GZOA 3EICA 3HDSA 4JV5F 4DX8H 3VQTA 2CPHA 3N4WA 5B0EA 1GXLA 3UD3P 2ZBIA 1FNMA 3HFZB 4RNFA 4DN0A 5B0DA 1HBUA 5D0GA 4Z7CA 2HHQA 1XR6A 4DL7A 4FN5A 3Q2TC 1PYTA 3G6VA 1X4FA 3LAMA 2BABA 4A8MP 3V6DB 1HQEA 4C7QA 2CFXA 1IBLJ 2JEJA 2OI2A 3L4BC 4LFAF 1X4DA 4ECSA 4LF2A 3X1LB 2IDLA 3AQOA 3OVAA 3ZTRA 1Z2LA 5L46A 1VBZA 3DRXA 1RWNB 1SXLA 2GA7A 3SFUA 3TEHB 2AGOA 2LQBA 3K57A 1RT4A 1GMWA 1S1XA 1BUXA 4DQIA 5CZVA 2YWHA 5KFSA 2ZUGA 1D3WA 3O1LA 1U4BA 3QSYB 4LMZA 5D77A 3GIRA 3MEGB 1QDUB 3VAIA 4BLGA 2LEAA 2VF3A 4B3SJ 1FK9B 2ZWOA 2WVDA 1JLFA 4U96A 4QYRA 3SFGA 2XMVA 5F8IA 3DLGA 3ITHB 3BH7B 5FIIA 5JUMA 2K7JA 2KFNA 4BBYA 5E33A 3GQCA 2P9EA 1X4EA 1K1SA 5EGYA 2D9PA 2B5JA 1NSPA 2H1YA 3WX8A 4JI6F 1CVJA 3LOUA 4IOBA 1GEHA 4ZP9A 2YXLA 1RT7B 4PG8A 4DV2J 1KWMA 3C14A 4CLUA 4NOHA 2BE7D 3HCXA 3IP0A 4KFBA 5KTQA 1K8AT 3NAIA 5J2PA 1RWWB 2B7BB 1U8WA 1WHVA 2R2UA 2YNIA 4X64J 1WF0A 4DLEA 1FWLA 4RL1A 2PMHA 3QFHA 2W24A 4JYAF 3RW7A 1PG5B 4ZCMA 4KO0B 2E7WA 1TQLA 1JMTA 5B7WA 2KL8A 2ADCA 4KGXB 3DMJA 2PA8D 4N56A 3OSNA 3RAXA 1YVFA 4HKQA 4C48A 4M5NA 2HHXA 3HKZD 4FKYA 4ZVHA 3NWRA 3HSDA 4RZRA 1VQ5S 2KH9A 2RILA 2XQCA 3KLIB 1W2IA 3K5MA 2HLUA 4JI6J 1TVRB 2JHEA 5GAEU 3NGDA 2COLA 1U09A 4ECVA 2E29A 4C97A 3KLVA 3GYGA 4UOGA 4IOCQ 1UVNA 1PBAA 1KLMB 1E6VA 4YFUA 4GMKA 1U24A 3U1MA 4ZOSA 4RWWA 3UN5A 1RT6A 2QL5B 1G7CB 1OYEA 3NAHA 1YJ7A 4DV5J 4JOUA 4BWMA 4DFPA 4FBTA 4IUFA 4I69A 1OJ4A 3CMQA 2D3UA 3M4XA 3D1QA 3ILLA 2GHVC 3NGTA 2B4VA 4ZVUB 3LP0B 3MI7X 4CI0B 3HJVA 1JXLA 4V19X 2IMWP 2QN6B 2M52A 2QA4G 4OZ2A 3CJ3A 4C8MA 7AT1B 3EWGA 1FCAA 3LH2S 1SKWA 4P7VA 1TP7A 4CO4A 2RDJA 3SBMA 4RUHA 1DY3A 3TO8A 2XM3A 3KKFA 1RTIB 4DL3A 2ZC4A 2DNZA 3D6MB 2DXFA 4IKAA 5ETQA 2JVOA 2R7VA 2Z0GA 4ETZA 2F3JA 4KT0C 3MWBA 1T9VA 4L3KA 3MM5B 2FJVA 1RCXB 5FJ4A 1XMBA 1N5QA 1FT8A 1WC4A 1JXVA 2I0XA 2Q6BA 1IKWB 1JB0C 3CB4A 2J8AA 1FX2A 1YX2A 2CJBA 3M30A 4KGVB 2C2DA 3ZTQA 2W4DA 4C98A 3R1LA 3IBFB 1EARA 5F9LA 2IM2A 4CTAA 4EMDA 3MR5A 2F4FA 4X62F 4NX9A 3DXSX 3S7RA 2MKJA 2HIYA 3EYZA 5AE2A 3GJTB 2RU3A 1UAWA 1HWLA 3GCWP 2B3TB 4F36A 4WPAA 1FKOB 5A8RA 2W7OA 5EWGA 2ROEA 3N0VA 1JLAB 3ELHA 2KJWA 5E7OB 3J7ZT 2XULA 3V81A 2MLYA 1RA7A 2RH3A 2D41A 5F8LA 3MFHA 1NB7A 1WEXA 1P6TA 2YX7A 3RB6A 3AOBA 4R0JA 1SPBP 1L3TA 2A6OA 4LRFA 4HHJA 1VQOS 3H5UA 4YHHF 1FJEB 1T9TA 4R5PA 1CLFA 3K5LA 3AY0A 2AX1A 4DX5A 1M0SA 1JLBA 4X62J 5T14A 2ZNZA 3BM7A 5I3PA 1PBUA 2Y1RI 2AJ4A 1XIQA 2Y1LB 2DTJA 5KG7A 3GSIA 4F67A 3VGTA 1B99A 1SC3B 2VG7A 2VG5A 3W60A 3QGPA 3R7NB 3D0GE 2B8PA 4FYDA 1GK8A 5J1NA 5KG4A 4PG7A 3TAMB 2MQMA 1F5BA 2K06A 2NR0A 2XZDB 3CIZA 2ZOGA 4L76A 5DZ6A 2GC8A 3LALA 5KFAA 2DNHA 3KLGB 4C6AA 4UZCA 1S4EA 3BO3A 3HVTA 1EX8A 1N32F 2W9BA 1DTTB 1LQ9A 4MH8A 3W2VB 3BB5A 4MKAA 4DDFA 3N6NA 4LRAA 2C3YA 1R89A 1WSVA 3UDLA 4DSKA 5HMXA 3THPA 3SDEB 5F8GA 1YJWS 3WHIA 2B56A 3E01A 1RT3B 3QIPA 4FXDA 4F7VA 1Q7YT 1NHVA 5AXNA 1KLNA 3CMAS 3GIMA 5KFQA 1S0MA 3C6UA 2BJ3A 2MLZA 2ZD1A 1ZZNA 5HQ8A 5D6GA 3GP9A 1QY7A 2QSWA 2Y8WA 3Q8QB 2MGZA 3EMTA 1D9FA 4P71A 3IG1B 3PCOB 2AEFA 2BQUA 3DI6A 3A3NB 1S12A 3VGUA 2P6TA 3OHAA 3SIPB 4TY8A 2IVMA 4HYKA 3CMES 1WKJA 1DQ8A 2HVIA 1NH8A 3MD1A 3CCSS 1U6FA 5KFXA 1RWVB 1HBMA 2QLFB 3DCAA 1IWAA 4OYAA 4HACA 4B9TA 1DLOB 1NK5A 1VQMS 1LKZA 1L5UA 1S49A 3WC2A 1C1BA 1VMBA 1F9HA 2VASA 4I68A 3OV7A 1PJ6A 1KTQA 4J37A 3K7RA 5KFLA 5H9FK 1N33F 1E6YA 1NPKA 1KBRA 1SQGA 2XLJA 5J2QB 3O6QA 1AROP 5DLFA 1F1BB 1J2VA 3LW5C 3OT9A 1EKSA 1OS5A 2ZM6F 4ZVEA 4JI1F 3BS9A 1LWFA 3KHGA 5B0GA 1RTDA 4A8XA 3JAMU 3KFWX 4I4BA 1K47A 2R8JA 4GKJJ 2V8HA 4QIFA 1TL7B 3P8BB 3OTDA 2QFJA 2LU1A 2V4QA 3QJLA 2V50A 3MTKA 2HNYA 4MFBB 3TZXA 3BKTA 4P9SA 2V8DA 4JI3F 2I5JA 1CEZA 3C6TA 5HMWA 3IMQJ 2J0SD 5HK4A 3OVSA 3LANA 1TKTB 1GXTA 3NMRA 3BKFA 3FZ2A 4Q0BA 2OLWA 3PW5A 1T03A 2IJRA 3KK1B 4CH7A 4JI1J 3CNQP 1GTEA 2MQQA 1YWXA 3KG4A 1T9WA 4ELTA 3RRKA 1N6QB 1S1TB 2YKNA 5HBMB 4MMOA 1KEKA 1KOOA 4A8SA 2WZ1A 3U1LA 2BQRA 2KXHA 1ULRA 3W9JA 3R9LA 1MG7A 1XEZA 5K9FA 5I4MA 3LGNA 1RWMB 3CJ0A 2R8KA 5KFMA 4UW2A 1WDTA 3L7OA 2VKRA 2W2QP 2ZVSA 4WE1A 1YITS 4JI0F 1YBTA 1IM4A 3M1VB 2Z2ZA 2IY5B 4K4TA 1Y4ZB 1Q95G 3GV7B 4LSLB 1X5SA 3KDOA 1K0TA 2RDIA 1RAIB 1Q8IA 1P9QC 1SH2A 5K20B 4I6YA 2AP6A 3M6XA 2OTLS 5BYSA 3FUYA 3DLKA 3PKYA 3JXOA 2B4UA 5KFOA 1AW0A 4AL5A 5IM0B 1ELOA 4Y2AA 4FBUA 3IR6B 3IRWP 4DR1F 3NMAA 2ERRA 4KHMA 4NXMF 3GTYX 3RTVA 4Q5VA 1T3OA 2HRYA 3C19A 1U26A 4LF8J 3P5BP 1S0OA 3BV8A 4Q8EA 3ENAA 1VJWA 5M2RA 4K4VA 3M05A 4MAKA 3BR9A 2PEBA 4R0EA 4DZDA 3I5CA 1Q82T 5J2NA 2DT9A 2XYGB 2DHXA 2OO4A 4YP3A 4DSLA 1KP6A 4DWIA 2FIUA 3BBCA 3DOMA 2RUGA 4O3SA 3OW2R 4YB6A 3Q86A 3ZNJ1 1HHQA 2DCUB 1T8EA 4M5DA 1UFKA 1Q79A 4DSFA 1ZOTA 2C2EA 5C24A 2HZCA 5F3ZA 2MKCA 4O4GB 4K5SA 3HF5A 1F60B 1IN0A 4EO8A 4HDHA 2GJFA 2Q3PA 1WG4A 4IRCA 4DR1J 1K44A 4NXMJ 1X4GA 4D3GA 1C4CA 2CQ3A 3MPDA 4ED2A 5HLFA 1HNVA 5AE3A 2K2PA 4USJC 4EI2A 2H5IB 2KKHA 3N01A 2VHGA 4CLPA 4CT8A 3UE2A 4DR2F 1IR0A 1FWPA 4ID5A 4M5HA 1Q16B 4B3RF 2B0GA 3CC7S 3AOAA 2ROGA 3Q0AA 1U47A 1S7IA 2XI2A 5JVGQ 4I64A 4I6AA 1LW0A 3JSYA 3R5JB 4WFZA 2LECA 1U25A 2HNDB 4E98A 2UUCJ 4WFYA 2ZH6A 3GIJA 2XMAA 4YR0A 3J7YI 3LP1B 3SSSA 4UUXA 1A9NB 1SC4B 1AFIA 1IKXA 1VR6A 2G4BA 3FCVA 4A8FA 2R7QA 1D09B 2DPJA 3PJ9A 1EP4A 2QT7A 1LXNA 3SZ2A 4LVNP 4WP3A 4DR2J 2YWKA 4C8KA 2DB1A 4CO5A 4F02A 1XTZA 5A6PA 4B3RJ 2ZKTA 2V5HG 1RU1A 3CUNA 2B4PA 3ZTOA 1VQYA 3D54A 4QWBA 4OYBA 2XMJA 1UL3A 5GMDA 2FVRA 1NLKL 1YK9A 4WKRA 3SCIE 5A0YA 1LW2B 4TXSA 2EKNA 2ASDA 4UOHA 3QJPA 4ZLJA 1HBUB 5EDWA 4QWAA 4EEYA 4NEYA 1HR0F 4RW9B 4AXJA 1UFLA 3D6HB 2Y1IA 3CW2C 1UPPA 1WKKA 1NM2A 1N54B 1S77D 5H9FJ 4DBQA 4EWTA 1YJTA 4N8NA 3AXKA 3W3SA 1UVJA 4J9VA 5KT7A 2B6AA 2L48A 3M9MB 1FD2A 2HFUA 2WSEC 1NBEB 2H4WB 4USKA 1NJIT 4WFXA 3R7BB 4DQQA 2PDAA 2IDEA 4LIRA 3CD7A 1RE1B 2DH9A 1M90T 3H2LA 1RT4B 1PGZA 1VOMA 6AT1B 1RBAA 1S1XB 1QTMA 3AD7C 1PJ5A 2FVCA 3D4JA 2YVSA 1NKEA 1H74A 1KN6A 1RDRA 3UDVA 1HR0J 2CQ1A 1M5VC 1JLFB 2XI3A 3CCUS 1UWBA 4XPEA 2HGLA 2MPUA 4AE5A 4NASA 5DG7A 3DLGB 1MLAA 2DNNA 1JXEA 3ULHA 2FDNA 3CVKA 3ET6A 3BGRA 1FJCA 3M8ZA 2EI5A 3IRXA 3PVXA 3DOKA 1WC3A 2B5JB 4DPWA 2FLPA 2ZJQQ 4NYOA 1S48A 4CO0A 3IR7B 1WF1A 3NL0A 4ICLA 1NEEA 3ISZA 2BJ7A 2DR7A 1NDCA 2K7KA 3C14B 3SSRA 3DRPA 3PY8A 4KFBB 5IWAF 2NZ4A 2ZJRQ 3T1HF 1SKSA 3VAFA 5FLXU 2YKPA 3ISND 2YNIB 5GVQA 1YQHA 5ADZA 2ZOMA 4ELVA 2HBRB 1CJUA 1G4CA 1EZZB 5FD1A 4DV3J 3PYFA 1HNIA 2O67A 2PMZD 2JFKA 2XHCA 1RHKB 5HANA 4M94A 1RUSA 1SKUB 1CPZA 1LWCA 3DMJB 2XZWA 4X84A 4TLQA 5KG5A 4DUTA 5CCMA 1YRUA 4C0BA 1GMUA 2YWFA 3CJQA 2FZCB 4ZVRB 4ZPAA 1BQMA 4RO0A 3IR5B 1TMMA 1RADB 2XWYA 3BH6B 2OTJS 5E3QA 3A8JA 1WELA 1XK8A 4C8OA 2RQMA 3BDEA 1E6VB 2V6AA 2FZGB 1D8YA 4PXCA 3N9UC 4NLDA 4O4RA 5IWAJ 1SV5A 1U1RA 3TJAA 3PG9A 1HD1A 3T1HJ 4RW8A 1YBAA 2Q43A 2LLZA 4HHHA 3TZWA 3TJ8A 1IJFB 3CD0A 3Q22A 2AV5A 3ETOA 3D5MA 1Y0HA 4ZHRA 1N5YA 1R6VA 2AYBA 3IGVA 2VUGA 4NLVA 2KM8C 3ZNUA 2I6WA 2JZ5A 4NXNJ 3CDAA 1S10A 2CDQA 2MSSA 4I56A 2FJAB 1A6LA 4PRFA 4EK2A 5F41A 4MYTA 1FESA 3CDUA 2BM1A 2CJ9A 1FFWB 5KFTA 5BXIA 1YI2S 3DGPA 3OLAA 1QE1A 2DXDA 3MR6A 1BQXA 1VFJA 3I56S 3FQKA 1EQMA 4FPRA 2ILZA 2R7WA 2E44A 4N5SA 3KLFB 1ITPA 1FFGB 4Y00A 5K14A 1VHFA 3LGMA 2JX2A 4JI7F 2OD6A 3M30B 2IYIA 4R8UA 4EU0A 4I7FA 2Z57B 4A46A 2RVJA 3IN5A 3AJ1A 4F4XA 1PSDA 2DNYA 4CTAB 3TEGA 1BXNA 1H2VZ 1HI1A 5GAHU 4WP8A 4LFBJ 4PQAA 2MQ8A 3U02A 2DVIA 1N34F 4OZJA 3J7AN 2HS3A 5A8RB 1I51B 4K50A 3NP5A 4DV1J 3ZZ0A 3VR1A 4C0HA 1FKAF 4XDCA 4F2SA 1RSCA 4UY8T 4Y6IA 3EM1A 1IBCB 2H5EA 4NZ7A 2BMBA 2NREA 2HQGA 1CSJA 2UUWA 2DEJA 2RT3A 4ZJQA 3H5XA 1HI8A 4JI7J 3ADAC 4YEAA 2GAGC 4R5PB 3VWSA 4DV4F 3ZTSA 3HSJA 1HKAA 5C5JA 4NPOA 3NS7B 2BW7A 3NGSA 2OPRB 3AB4B 5J2MA 4RWXA 4EUVA 3MR2A 1TL3B 2VFVA 2AGPA 4NCGA 1N34J 1U8SA 2P6SA 4DI6A 2VG7B 4CT9A 5E2QA 3BO4A 3M2VA 1FNOA 4EFAC 2KVIA 4DPOA 4MYUA 2Q66A 2GVDB 1S57A 2KO1A 1NU4A 3VAMA 5SUHA 1G2EA 1REGX 5DDOC 4YDXA 5I42A 2QGFB 3QZ7A 2D3OR 2MKYA 4RUCA 4CNYA 1S72S 1CS4A 2QA1A 4MKVA 4N77A 5B08A 1V3ZA 1L3VA 5BR8F 4DV4J 2ZH9A 2BJ1A 4IRKA 3UD5A 1OQ6A 2E5IA 1KSPA 3OD2A 3BN7A 2E5LJ 2W9BB 1TL4A 5DM6Q 1EIYB 3TX0A 2N82B 2VIHA 4ZN1A 5DZ7A 1H6KX 1J5EJ 2GMJA 1X8DA 2FY1A 3TRGA 1JK9B 1NSAA 2RUSA 1OYDA 3HJFA 3HHLA 1Q0NA 3QIPB 1CULA 2LMIA 4C11A 3VAHA 2ZEJA 3C6UB 3CIMA 2RS2A 2CXEA 2W9AA 5KFWA 1NJXA 2MGZB 1XR5A 3NLCA 5ITHA 3EVMA 1R0AA 2AJ2A 2N3LA 1GH8A 2FJEB 1RLDA 2CPJA 2V2ZA 3DC2A 2GQQA 2VC0A 2MJUA 4KGKA 4H4MA 4TY8B 2XS5A 2BE2B 3PFEA 2BX6A 3CO9A 4RW7A 4CQ1A 4Z37A 1HBMB 2DNRA 1SCJB 4DV0F 4U7UK 4TN2A 1HBNA 4H54A 4HACB 4OYXA 1U48A 1LK7A 2DGQA 4OJGA 3B4DA 3K5OA 2YKAA 1C1BB 1IVZA 2P9CA 3RR8A 3FCWA 2MKIA 4ZIWA 1R0BG 3MPWA 1E6YB 3EXCX 4TLRA 2Z58B 1KFSA 2DNQA 4RJVA 3UCGA 4CDIA 4LF1A 1C0TA 2YNFB 1PJ7A 1SC6A 2F4VF 4I67A 3MHYA 1UEKA 2XWXA 4U7CA 1LWFB 4KO0A 2HHTA 3CDWA 2ZWPA 1RTDB 4HHUA 3VGSA 1FTCA 4QQBA 5DM7Q 4WK3A 5L8RC 1VQSA 2MEWA 3PEJA 2VOOA 2CQCA 1JLGA 1M5OC 2C3MA 2HNYB 3IC1A 2V8GA 2RIJA 2I5JB 3KUHA 3R2DJ 4AQYJ 1UJ4A 3MMBA 3PX4A 1FJGJ 4DU7A 3R27A 2C2RA 2F8MA 4N8OA 1S6PB 3MUTP 2MQOA 3N6LA 4OI4A 4Q0BB 1KNZA 1U1LA 2Y0SD 4DFMA 2D74B 4ED3A 1T03B 4HEA9 2F4VJ 1IXKA 5IC4B 2HNZA 2RDDA 2HHUA 3A3PB 2ATLA 4W90B 2FLNA 3LAKA 5DS7A 1PC4A 2J7UA 2EC0A 4OV1A 2BOAA 2M8DB 4B9LA 1AUDA 4HDGA 1XNRF 3HT3A 2CRLA 2KHCA 2RRAA 2C28A 1VHIA 1T7PA 4WE1B 3D68A 1TR0A 3F73A 5LJ5Y 2BKOA 1YG0A 2OD4A 4OI2A 1TK5A 1RTIA 1ZETA 1R8HA 4PUOA 4KAIA 2W7AA 3DHWC 3KYLA 4FKXA 2MYFA 2RRBA 2MKHA 1YBUA 4FF3A 2J6SA 1MN9A 1NXIA 2QG9B 3FFIA 3DLKB 2VJVA 3W9IA 2XY7A 4BS2A 4EBCA 3AFGA 4KB7A 3TWZA 2JSXA 1IKWA 4BC7A 2BYCA 4FVCA 4ES1A 5EN1A 2QSFA 1YJVA 1KHVA 4JI4F 4ZLLA 3AOCA 3T1YF 1EHWA 4DS4A 2NCKL 3PXGa 2EFVA 2GIQA 2XMMA 2HHVA 1XNRJ 2ACMA 3VCDA 2DHSA 2RNEA 2C1EB 1ICEB 1WC5A 4O3OA 5M2UA 1TKXA 1YGYA 4E8UA 2ZC3A 3H59A 1IWGA 1WC1A 1Y10A 4U9RA 5E3RA 4XPCA 1EB0A 2HHPA 2CPFA 5J2NB 4IO9Q 3EVWA 2Z2LA 2XS7A 4OYZA 4USUA 2NSBA 2FJWA 2IMOA 4F25A 2DGXA 3GB0A 3DOMB 3FCHA 2OIHA 3R3TA 1EAYC 3OJUA 3CCES 3VF0B 2ZZNA 2N7YA 1NDKA 4UQGA 4M5DB 2FHJD 5DQHA 3KK2A 2WVEA 5C24B 5CYJA 2WSFC 4FNIA 1FFSB 2QYGA 2VDIA 2YTCA 2EEYA 1Y5NB 3RRGA 5IOLA 4QW9A 1U45A 2VPZB 1SIWB 3TVZA 4DR5F 4ECRA 3AJ2A 2EFQA 4PPDA 3P6YC 4Y34A 5HLFB 2Z4PA 1HNVB 1R8AA 5CXTA 4K5RA 1U2FA 3FSXA 1BY9A 3D6FB 2DO4A 3HKWA 1XERA 1RWOB 1CC7A 2EG1A 2MQLA 2ZJPQ 2NXUA 1RCOB 4AXIA 1EQ0A 4FXVA 4ID5B 2R2RA 5C2CA 3AT1B 4LRBA 2VPXB 3K59A 2RQ4A 4ZLPA 3NS6A 1R6YA 4PPZA 2CQ4A 4XDDA 2CJXB 3W66A 4ECUA 4LRCA 1S9GA 1HBOA 4U67Q 1NJWA 3ICLA 1DZ5A 4DR5J 3PW0A 5C2GA 1URRA 1IKXB 2HW3A 1HMVB 1T11A 1SVDA 3FGVA 1H2TZ 2RE1A 1GMWD 1JJHA 2ZOFA 3W2VA 1N8RT 2XY6A 5T7LA 2I9SA 1EP4B 4H4KA 4DR6F 2WW8A 5A76A 5KFPA 1X7VA 2XG8A 2MZRA 5KFDA 2YY3A 3R5DA 1B7FA 3V2UC 1VIXA 2FPHX 1RTHA 2AJQA 1BWVA 2X1FA 1H3DA 3I4PA 2KYZA 5AJ3F 4GVLA 2XEXA 2OPSA 1IBKF 1PAEX 2R4FA 3VZIA 4QBUA 5A0YB 2AZ1A 3KUGA 1ZAVA 1WG1A 1IBMF 4V1Ak 2KTQA 4X66F 4DPUA 3R97A 2UXBJ 5K8NA 3KUEA 1FI4A 1L3KA 2KFYA 5HQMA 1RAOA 3RBEA 1Y00A 4P2FA 4A8YA 4KKOA 1RHJB 1YZ7A 1RK8A 4WIQA 1UFWA 2GVZA 4MTPA 4U7UD 1ZAXA 3QFWA 4DR6J 3F44A 5KT6A 4PQUA 3UFCX 4ELUA 3OXGA 3R5BA 4RW6A 3SEOA 3FBBA 3GLJA 3CJKA 4N47A 3HVWA 4WXWA 2E7VA 4CLSA 2UU9J 2WK4A 4ZLNA 1KFDA 3R5AA 1SJ4P 2VFRA 5AJ3J 2IBOA 3KTQA 4U95A 5JXSA 5F3TA 3Q83A 3H90A 3H8YA 2WRMA 5D0HA 2WVCA 1F5AA 4A48A 1WC6A 2HWTA 2XY5A 1IBMJ 4WU3A 4X66J 3WIUA 4YS2A 2XMTA 1YRXA 2FY8A 1UWBB 1TK0A 4USHA 4LT6A 3CJ2A 1Q81T 3OUYA 3TUPA 3G87A 4G1QA 4KHPF 2K3IA 2CAJA 2QC3A 2IPOB 2Q1LA 2DNKA 3EGVA 3EXYA 1CJTA 5BYRA 3MCSA 2CJYB 3CCVS 3IRXB 1TL7A 3DOKB 2KZMA 2AIRB 1Q8BA 2ZFHA 1HYSB 3MM9A 4N76A 2X3GA 4RNNA 3A1YG 1N4LA 2JC1A 4ICLB 1NPPA 3IWNC 4DQPA 3VAGA 4E2FB 3DRPB 1U1MA 2VKZG 2R2TA 3DLHA 5LSOA 5IT4A 3BKUA 1B4SA 1NK8A 2JLFA 3GFXA 1P1TA 1MWZA 1RWKB 2F9DA 5DO2A 3OTEA 4NLGA 3BBFA 1O51A 3BEGB 4EO6A 2YKQA 1PAUB 2FZKB 1HNIB 3KMQA 1V3RA 2DGSA 2DR6A 2W25A 1JLQA 2AEJA 3UO0A 4DSEA 1V9OA 4KHPJ 1WD6A 2FLLA 1RKJA 1LWCB 2R8GA 5KFVA 2CZVC 4B9UA 4RR5A 1TZ0A 1VQ8S 5KFZA 1BQMB 4FF1A 4IR9A 4TU9A 4NA2A 2WSCC 4WZMA 1WHXA 5IFMA 3MAHA 3FEXB 3C8YA 3TR5A 1RQ0A 3MR7A 4J9OA 4DL0C 3OL6A 1GNKA 1BE4A 2J9DE 2W1BA 1SV5B 1T9XA 4RUBA 3DOLB 3K5PA 1UEVA 3ZO7A 4YN3B 4FYXB 2EXUA 1NSKL 2RHQB 2WVBA 2C2MB 1QJHA 1VYAA 3DRRA 4DV7F 3OL7A 4CP5A 1VK3A 2GV1A 4ZHRB 1OY9A 1B7YB 3EZUA 4KPYA 3JQKA 3JQMA 4HR2A 3I31A 3EDRB 3DLEA 4K7QA 3RJMB 4CIOA 4TY9A 2AJFE 1N52B 4ECXA 3GFYA 1URNA 3JSRA 2GGPA 1XWLA 4OX7A 1SQFA 2LCWA 2QYCA 1Y7PA 2ASYA 1NDPA 2FJBB 4DPYA 2DHHA 3DGPB 3THTA 3PR5B 2Q79A 3BSOA 1N36F 1LWXA 1CG2A 5HO4A 2NYIA 2YKOA 2DH8A 2W4CA 2VV5A 3POTA 2QV6A 2K3KA 4ED7A 2I2YA 5F9NA 4DV7J 2MQNA 3BJYA 5K14B 3FRZA 4G6VB 3V6KA 1IR2A 3O2IA 1VBXA 1A0OB 4QWCA 4FF2A 2HQFA 3TW0A 1J5OA 1UWAA 1AUSL 1DTQA 2PO4A 1HWKA 4O4GA 4R8UB 4LBIA 4I7FB 3V5RA 4DQRA 4GKKF 5KFEA 2OPPA 5HAOA 3OR1A 2KT5A 3LPEA 1XQIA 4NLRA 2Y8YA 4DXLA 1HD0A 3R2CJ 3CT9A 1X4BA 2V63A 1R8BA 2HVDA 4Z7YA 1WUUA 5CD4H 2APOA 4ANDA 5EWFA 2HK2A 2DITA 5A8WA 3QJJA 3LTOA 1S1VA 1WOPA 3M8RA 2W2OP 1NK9A 4ZPBA 3BN4A 3I32A 3M32A 3NGKA 1REVB 2W2MP 2ZHAA 4AUKA 1BQNB 1SL0A 2QLJB 2UVVA 4J91A 4J5OA 3W65A 2HKEA 1S0NA 4QIGA 1U2CA 5IS2A 3NEKA 2N3OA 3PYGA 3LWLA 3HVAA 2CPYA 2E1CA 2WVFA 1RHUB 4A8QA 4ZKAA 2HNDA 4DR7F 3D1OA 2CPXA 3LGHA 1BWEA 3B82A 1PCAA 5B09A 2UXCF 3GZ7A 2AT1B 1MROA 1EETA 4DEZA 5J2MB 1FRHA 2W8KA 2AYEA 5JJBA 1RWUA 3L7UA 5KFCA 4QIVA 4NCGB 2QX0A 2YBVA 2L9WA 4FYVB 3MUVP 3OTOJ 3M2VB 1Q8KA 2IRYA 2BVZA 2VFSA 4WXOA 2BKPA 3D3BJ 4K4UA 2IC3B 1RAEB 5I42B 4URSA 3US5A 1CS4B 3MOZA 3CGIA 3FBEA 2C22A 2R8IA 1WF2A 2Z56B 1JLEA 2G0JA 5KG1A 1LW2A 3GPAA 2AGQA 4C9DA 3M8YA 2GO8A 1C1CA 3RG6A 2DY9A 3AA9A 4F4KA 2UXCJ 2HRUA 4OLPA 2MJNA 3QRPA 4RW9A 4LF9J 1JQGA 2V9KA 3Q23A 1M5KC 3DU5A 5CAAA 1UVLA 5HATA 2MB0B 4F0HA 1SIZA 2RMLA 4P7TA 4U8VA 1RKIA 1U0SA 3LA0A 2HFVA 3TUIC 3Q8UA 3HHLB 4FS1A 4B9SA 1RT2A 2EW9A 4ZIVA 3PR4A 1VQ7S 1CULB 3SYZA 4C11B 2PN6A 5AE1A 4FYWB 2R3VA 2BE9B 1ZTTA 2CWKA 2M7SA 2VB6A 2NLWA 4QPXA 3ILJA 4JV5J 4W4MA 2IYGA 1HLWA 2DGUA 4F4ZA 2MZ1A 2HAFA 2RF2A 2L9NA 5ETTA 2JRSA 2G2ZA 1R0AB 1RISA 1PIEA 2PI4A 4U6PA 5CYQA 1S4FA 4H4MB 4V19J 1QAYA 2LEBA 1O5JA 4PCQA 1WC0A 1YRTA 4CLKA 4RW7B 3KLEA 4X4TA 3MMJA 5KFNA 4HVZA 1WI8A 4LFAJ 3BPDA 2VC1A 1HBNB 5H9EK 2CG4A 8AT1B 3W64A 1RHRB 2H3EB 2QRRA 2SXLA 2XSJB 4RNMA 3DKDA 1RT5A 1BC6A 8ATCB 1M1KT 2HZVA 2YQ1A 1YJUA 1VC5A 1NK7A 1WNEA 5M2PA 3JSMA 5KT3A 4P2MA 1C0TB 2W2NP 2R7SA 3KDNA 1X0FA 4DJBA 4IR1A 2HPUA 2BJ8A 5KFGA 4USTA 3M2UA 1YHQS 4ES3A 2VU5A 3BYPA 3DDKA 2XYPB 3NCQA 4GC6A 4TQSA 2L41A 4WU2A 5DG9A 1RWXB 1KC8T 1P8GA 3FMBA 4ALZA 4Q44A 3IAS9 1JLGB 2E1RA 4CH0S 5C42A 2IBKA 3LP2B 2CPDA 3M2RA 1NK0A 2GO9A 2JOQA 4OYMA 2A2CA 4YQWA 4XK8C 2ZBCA 3MMBB 4F4YA 4ILRA 4NZ6A 4GVBA 4LRDA 3J80U 2IAJA 1AFJA 3CTRA 4M63A 2YH0A 5KAKA 3B78A 2MZQA 4OJ3A 1DAXA 4KBIA 5JVHQ 1QUPA 2HNZB 4G3IA 2K8GA 4A8OA 5GAGI 4JYAJ 3J7Z5 4C8YA 3OSPA 4IDKB 2GFFA 3MD3A 2OPQA 3HSZA 2LQ8A 3A8IA 3CD5A 1S97A 1FERA 4LSZB 2ACYA 2Q6CA 3E3XA 1XJWB 2LA4A 5L39A 4IO1A 1NAQA 1T02A 2E5JA 3TI0A 4PUOB 1FNXH 3M9NB 3JB9k 3RAMA 2CPEA 3JAMY 5HVGA 1LEOA 1Y11A 5DQGA 2CVEA 1FEHA 1F2GA 2DH7A 3FFIB 2VZ9A 3NOCA 3KLFA 4C8LA 4KGZB 4JV2A 3E8OA 4USMA 3MGJA 3Q2SC 3PJWA 1RAAB 5IQQA 2EWHA 2GIFA 3SCKE 3EDQB 1BMQB 2CYYA 2UV8G 2WAQD 2QMUB 5LXRA 4LJMA 4CCHA 4I2QA 3ISNC 4WZQA 4KGMA 2KFZA 2KZZA 1M5HA 3BQ2A 4J9KA 4I1TA 1VIOA 1VC6A 1QAJA 4EYIB 2G2YA 4ED1A 4WYWA 2CPIA 1TKXB 4CO3A 3JSBA 4DS5A 2J0WA 4OJ1A 5KT4A 2XCPA 3D28A 4Q2LA 2WB4A 3KK3A 1TELA 1HHTP 2D3ZA 2DGVA 1S6UA 3D6TB 2W7PA 2DPIA 2RB7A 2G0IA 1VC0A 3HZEA 3QIDA 3KK2B 5MLCV 3SMZA 3D67A 2UUBF 4PWWA 2ASLA 3GJSB 3CC4S 3NNHA 3P49B 3PACA 4ZJLA 3KNGA 3HZGA 4OIXA 3AD9C 3PW7A 4KHRA 3IFEA 1HWUA 1UTAA 3G8QA 2OPRA 5FDLB 5A2QU 2MXYA 4ANCA 3QWPA 3ZXWA 1TL3A 4KTQA 3C3LA 3NNAA 2RJZA 3UNYA 3Q89A 1Q86T 4KYZA 1I1GA 4L72B 1B0TA 3H98A 2XC9A 3R5CA 4DR3F 2CG8A 4ANEA 2GVDA 1F3FA 3MPUB 2AQ4A 2WW4A 3QRQA 3D0HE 5J1EA 3H42A 2UUBJ 3BSCA 4NI2B 4OYIA 2MZTA 4YHHJ 1S9GB 4OZ3A 2DJWA 5LMUF 3L09A 4ZMMA 1HBOB 4GO5X 1T9YA 2DRBA 3HD1A 5L1KA 1JLCA 3P5TL 3PEHA 2EG2A 3OBIA 1H38A 2VD3A 2WOMB 2EFPA 1QVGR 2QL9B 1CJVA 2FQQB 4AYBD 5AT1B 3HD2A 5T7LB 3NKYA 1AZSA 1NNDA 3NGRA 1F3VA 3AB2B 1YIJS 5G0RA 1Y5LB 2BRLA 4DN9A 3QZ8A 4LF4F 4URQU 4DR3J 2QIFA 4QW8A 2MKKA 1RTHB 5HN0A 1C0UA 5A6WA 4QIWD 2CQ0A 2IJFA 4K0KF 4HT7A 2XMUA 3TARA 1RB0A 2OPSB 3NCRA 4WBFA 3IA0A 1T9UA 1K0VA 1RHMB 5LMUJ 4CH1A 2OUGA 3FSYA 5H9EJ 2DGWA 5CYMA 1B0VA 2OEJA 3MMCA 2ZH4A 2IJNA 4KKOB 1N32J 2LXIA 1GFWB 2HMIA 2BE2A 2GVZB 5ETNA 3QWUA 2AYGA 3V6JA 4PQUB 4BDPA 2HBYB 5KFIA 2J76E 2UZAA 4RW6B 2B43A 2J6TA 3CJKB 1NZAA 3CC2S 4OFZA 2R7XA 4URGA 4LF4J 1SQEA 3QO9B 3EE3A 1KS2A 5D3GA 3AJDA 1GAOA 2I8EA 2JLGA 2YPYA 4K0KJ 4QR1A 4USVA 4XAKA 1NCLA 3WBZA 3K17A 3A12A 3PJXA 2A10A 4NLPA 4J9UE 4DZ6A 1VQNS 4ED5A 1MMDA 1R7IA 1ZM4A 5LXYA 3CPWR 3IAM9 3KWMA 1UJ6A 1U1OA 4NEZA 2UVRA 2QFIA 2YNFA 3CCRS 4YY3F 3S6EA 3OUYB 4G1QB 4F3MA 3HHEA 3CDEA 3D9BA 2BBEA 2EK6A 4NA3A 3DLLQ 1CJTB 3MM9B 1X4HA 3MAAA 5ETMA 5RUBA 4LREA 3J7YU 3D1HA 3TANA 3L9ZA 8RUCA 2FJDB 4TYAA 2F1FA 3MCNA 2A0FB 1GX6A 4JV0A 1I94F 1M5SA 2G9OA 3H7HB 1DFDA 1ACMB 1LOUA 3ONQA 3OFGA 1N33J 3NNCA 1RBLA 2RSQA 1S6PA 4OX9F 1KOHA 3AA8A 2EKYA 2HVZA 4WFBQ 2NQPA 5IV4A 3IWXA 4PABA 3NXZA 2YH1A 2VODA 2ZM6J 2PSZA 2QLBB 3I4HX 3W63A 1JLQB 2RKIA 1Q53A 3PHEA 1JNRB 2GMHA 3HHNB 5MAOA 1FA0A 1OPZA 2KU7A 4ZP6A 5CD4A 3H20A 3D2WA 2IVYA 3LQVA 4Q43A 2XBPA 2ZH7A 1WEZA 3I5BA 4BWJA 3TX8A 2R7UA 2IFXA 3BO2A 1Y3KA 1XMQF 1FHTA 2AW0A 5DLGA 1IKYB 4JI3J 4JI5F 2LDIA 4DX7A 3Q8RB 2QLXA 3PW4A 2ZBQA 2QLWA 5L1JA 3BBBA 4DX6A 3SQGA 1Y9OA 4MIAA 2V4RA 4OX9J 2G0CA 5F8HA 5KOXA 1C4AA 3ZZYA 7FDRA 4J9PA 1N5TA 3DRRB 5SZTA 1M1GA 3W61A 2CJAA 3R1HA 1FEEA 3DLJA 1KR4A 3WQPA 1LWEA 1XC9A 2X7IA 3DLEB 4ER8A 3GILA 1ZYQA 1SKRA 2GGPB 2EVZA 4JI0J 4C8NA 1H7XA 4C2MA 4G1IA 5B0BA 1XMQJ 2AJ1A 1QSYA 1WOSA 1K1QA 4NWBA 4DFJA 4JI5J 2BRKA 3ZFVA 2HWIA 3M6UA 2Z2YB 3MEDA 2HQ3A 2XSFA 5CCLA 4KH0B 1S6OA 5AXMA 1N5VA 1D8ZA 1YJNS 3JYTA 1RWPB 4NL5A 3R6GB 3POTB 1NKBA 3FK4A 4W98A 1IJEB 3PDNA 3UR3C 1FF2A 2G13A 4CLTA 2ZBRA 4NCAA 3HLUA 1U49A 1J5OB 3G71S 4OZNA 3VALA 1DTQB 3NGUA 2E9TA 4NLUA 4Y3CA 1X31C 4Q45A 2KYXA 2M70A 2OPPB 3OR1B 4ID8A 3MDFA 3H5YA 2J7KA 4OI3A 4EBEA 1AYEA 3W5ZA 3N5BA 3E2EA 4K4YA 2WBRA 4ECTA 4LF5F 3GCXP 3PKMA 3QLHA 2AYMA 5A8WB 4F04B 1S1VB 4OHYA 1EKRA 3UW1A 3QPIA 2WHOA 2PEHA 1DRZA 3M32B 5ETSA 5ETPA 1SL2A 4XIUA 4DUYF 2F8HA 2VFTA 2CIMA 2M3DA 3CCMS 1JJ2R 2FHJA 3ILOA 4Y2CA 4TU7A 5HJYA 4ECYA 4YR3A 1W2BR 3OR2A 5E5NA 5F0UA 2BANA 2WBMA 3AXMA 1FO1A 3JTNA 4EGLA 3T5HA 5LM7E 2PT0A 4NRTA 4OZ1A 4YDDB 4ZVPB 1MROB 1R27B 2HS4A 1EETB 5LMNF 2YNGA 5LSLA 1HMVA 1QD1A 3IM9A 2LQ5A 3TP2A 3W2WB 2C2KB 4LF5J 4M5LA 4K4WA 4OHWA 3OXLA 1JNZB 3BYRA 2E1AA 3KLHB 2H54B 2G2OA 5DQIA 3BQ0A 1FDBA 2DO0A 4DUYJ 4G1PA 4J9NA 3UVJB 4B3SF 5D4NA 3RBDA 4O0IA 4JB8B 2FC8A 1S9EA 1KQKA 4FZVA 2VA2A 4DOZA 2M0GB 1Y5IB 1JLEB 4DF4A 4ZDNA 4IG0A 3CJTA 4IH5A 1K9MT 1NRKA 1ZM3A 1T05A 1C1CB 3PTWA 1U7LA 4ZVSB 4KE5A 1VRTA 2M5YA 3TZYA 2GCFA 4ZS6A 2CQGA 4XO0A 2F5GA 3CCLS 4ZPVR 4PG4A 1A7GE 2ZE2B 2F65A 5LMNJ 1TL1A 1YZ6A 5D0EA 5CHCB 2DKOB 4TQRA 1RZMA 2CADA 3JTOA 4QU7A 2PGCA 4DV2F 4CLLA 3HMJG 1FVQA 1F9FA 2DK2A 1S59A 2ALYB 3WC0A 1Y3JA 5KT2A 5HI7A 1RT2B 3AHPA 1LFWA 2HQCA 2V8PA 3SV4A 4X64F 1UA1A 2BQ3A 3UQSA 3TQEA 4B17A 1MWQA 4PG5A 4O3QA 1NPRA 3PIOQ 2RF2B 4GRSA 2YKMA 3T1AA 1MNEA 4M8LA 4X4VA 1UVIA 3V6HA 3PIPQ 2YWEA 1VGYA 4DL4A 3GFHA 1Q8LA 1IQZA 3GR0A 4ZVTB 1R8PA 4K4SA 5CYQB 1RABB 2KDOA 2OEKA 2W2PP 1OY8A 1BGXT 4ZVFA 3SXLA 4CLWA 3KLEB 2C3PA 2AMCB 3KJVA 3HM9A 4O23A 3MURP 4LF7F 1QTNB 1BD6A 4LQ3A 2NZCA 1R0CB 1B3TA 3J7A1 1HYSA 5EUHA 4TKTA 2P2CB 2Z30B 3CCTA 3PRBA 3MM8A 2BR0A 5GMKa 1CJKB 3CULA 1WJ9A 4DV5F 1RT5B 1U1NA 3IWLA 4J9RA 5E3AA 4FXWA 1IKVA 1TMJA 1U6ZA 2PMWA 3M6WA 2ILYA 4IRDA 2QZ8A 1ZM2A 3JSMB 5EHHA 2DNMA 3M8QA 3HHDA 2NUHA 2HFOA 4ZITA 4NE9C 3DHXA 4IFVA 4P2XA 1ZPVA 3BR8A 3M2UB 3BQ1A 3PRDA 3BF4A 3U7JA 4ZVGA 4P73A 2GHPA 1WEYA 3WIVA 4ES2A 4KC5A 4UT4A 2OGUA 4LF7J 4I2PB 1NH7A 1WDDA 1QSSA 1F6TA 1TK8A 5LT5A 1XR7A 4WF9Q 1M5PC 5C42B 2ZH5A 1LNQA 3M2RB 1X5OA 2B9EA 4C3LA 3R5GA 2E66A 1S6QA 4ILMA 4GVBB 3GJRB 1YLXA 2IAJB 1T0TV 2GIRA 1B0PA 2OJ3A 2DISA 3H0PA 2LVWA 3DOLA 2AWZA 4KRWA 1RYRA 4XTTA 3R7SB 2V2QA 2AEMA 1CQMA 4CM2A 2AHOB 3DU6A 1FRMA 4QR2A 3MUMP 2H9ZA 3GV8B 3IBCB 2FTRA 4H4OA 2HWHA 3HO1A 1S5ZA 4UY85 2J5AA 4LF6F 4R25A 3WZ0A 2F9JA 2X1GA 2OPQB 2JWNA 3OJSA 1KD1T 5I3UB 2B9YA 4MK7A 3D3CJ 4WK1A 4L74A 4PYAA 3R8YA 1X60A 3UR0A 1RT1A 3T9ZA 4J9MA 4KV8A 3I96A 1U1PA 3RUBL 2F63A 3A4TA 3T19A 3V4IA 4MK9A 3VHQA 4RU2A 4M5GA 3NS5A 5ETOA 4B08A 4WCEQ 1KKHA 3EPGA 1RXOB 3CE8A 2DGOA 2B4OA 3Q8PB 3A8EA 2XGPA 1YSJA 1QAXA 2A2DA 2R42A 3R6LB 1RTZA 2OP5A 4B02A 3MM6A 4UZBA 1U02A 4PR6A 3TYTA 1HFEL 3NWGA 4LF6J 2ZZTA 2CWXA 1NB2A 2C2OB 1V6HA 4QZVB 4I2QB 3GJQB 3I0RA 5KFJA 3G4SS 4A4JA 3TOQA 1WOOA 2ZH3A 2BUNA 2NS1B 2N7CA 3T9NA 3TAPA 4CLZA 1HARA 2E9ZA 4YB7A 1TAQA 1GT8A 4OZLA 3EGWB 4PG6A 2YQ3A 5GADU 3KK3B 5AXKA 3GMGA 2RAQA 2WONA 3LF0A 5BJRA 2QA2A 2VBXA 5JMNA 3D66A 3N6MA 4NYZA 1G1XA 1REVA 1BQNA 5LL6d 3M8WA 3RR7A 1HQUA 5A8KA 2RD5C 1VQ4S 2CQHA 2HHWA 3HT0A 4UOCA 1DURA 4B9MA 2K1RB 1NKCA 2QMWA 4GC7A 4USIA 1OPIA 1X9WA 2KXFA 1F2HA 2ZNYA 5I3QA 1O0PA 3F56A 2CUYA 2KRRA 3CEDA 4QU6A 5CQGA 1Z1ZA 5KG2A 3QMQA 2GQ2A 2J0QD 1RTJA 3J81Y 3KHLA 3AODA 3S8SA 1UEUA 1VQ9S 4OQJA 2HEKA 3RRHA 3ENWA 1FJ7A 3BGUA 4IQMA 1X5PA 4FP9A 2FVSA 1X4CA 3EX7B 1PYOB 1RAFB 2HYIB 1VI7A 1TUVA 1TV6A 3ZZZA 2IC3A 2J9EA 4O3PA 3FNNA 4LUBA 5GAEI 2JVRA 3KG1A 2HZAA 1PC5A 2HS0A 2FHMA 1GQEA 3QYYA 5J1EB 4S0MA 1TU0B 3VZHA 2FYXA 4AL6A 3CD6S 3TVKA 1OSCA 4DLGA 3C66A 1RI7A 3TUZC 3RBZA 1JLCB 5B0AA 2H4YB 1FD8A 1SJQA 2BJDA 5GMEA 2H51B 1FDAA 4ZPWR 1QLNA 1CJVB 3OHBA 5IQ6A 1AZSB 4K59A 1D1UA 4EYHB 5C7PA 2FJXA 4ZPCA 4LSNB 3K8VA 5G0RB 2LQ9A 1HNZF 2Z2MA 5CABA 5HP1B 1KVJA 2JH3A 1C0UB 3MFIA 3CJ5A 2IIHA 4LVOP 3ZZPA 2V8VA 2H65B 2XLIA 2CKWA 4NLOA 1WI6A 2HQDA 2L08A 3G82A 5E41A 2ZVIA 1RLCL 1WKLA 4GKJF 5BR8J 3DM2A 1VQ6S 2ZKUA 2AU0A 2Y9HA 2Y3YA 5CYMB 3MMCB 3ZZRA 2YWWA 3PO5A 2JFDA 2EBEA 3MEEB 3IGNA 4PYDA 4C8ZA 1C2PA 3DYAB 2HMIB 4EZ9A 5KG6A 3G2XA 2W4PA 3DDNA 5HROB 1WG5A 3F41A 4P52A 2ALZA 2NUUG 2RU9A 3GWCA 3MM7B 3HPOA 3HVRA 3I9ZA 4NLWA 4BHQA 1TKZB 2XCAA 1HNZJ 4WTOB 2YNHA 4OJHA 3QGGA 3GU0A 5K8OA 2W9CA 2XSJA 4DMZA 5D3GB 3P3DA 1Q78A 1TL5A 5LJ3Y 1SUQA 3BREA 3MMAA 4X65F 1FRIA 4PWDA 2JEFA 3NBPB 1W25A 5HVHA 1S76D 2A6MA 3G6YA 1ZBTA 3FEZA 3KJFB 2H48B 2DIUA 3G6XA 1ZM9A 2RS8A 1NHUA 1SJFA 4DQSA 2VICA 2DCLA 4J7CA 1QM9A 4M5JA 3RZAA 1NMEB 2C3UA 3VAKA 4WIIA 1JKHA 1FRXA 3PYDA 2VOPA 3DRYA 1U1KA 3W62A 1FRLA 3EJMA 3FDSA 4YUDA 3QT5A 4DV0J 3I0SA 3FBCA 3MAAB 2FGOA 3W1YC 2KN4A 2F7VA 4RLEA 4F4WA 1VK8A 3QT6A 2V4JA 3LP2A 3JS9A 4F8RA 2DR5A 4X65J 2HHHF 1MWYA 1FE4A 3SV3A 3C16B 4IG3B 4P72A 4CLFA 4KQZA 3KG0A 1VJQA 3JTPA 4OX6A 4MIBA 1ZH5A 4USWA 3L95X 3CJSA 2NXJA 3MECA 1HA1A 2L9DA 1FTRA 4DCJB 5HSPA 4LF8F 1SH3A 2RKIB 1HIYA 4PXEA 2OFGX 1HNXF 4IDKA 1MU2A 5BYQA 2IVFB 3HP6A 1CQNA 4PEOA 3MR3A 2AZ3A 1F9EB 2G1DA 3KMSA 3Q8SB 2VA3A 1HI0P 2JJ4D 1VDHA 1ZS6A 1NUEA 4PAAA 3J81j 5L9XA 2LA6A 2AKWB 3THVA 2HHHJ 3T6JA 3SQGB 4J9LA 4JUZA 3C2PA 4WJBA 4FNHA 2KG0A 4HI1A 4YB5A 4DHVA 4ENOA 1TUWA 4ZP8A 4ATNA 2NXCA 1GX5A 2KT2A 1S7HA 2BA9A 1LWEB 1HNXJ 2D3O1 3KJQB 3Q24A 2ASJA 2VBWA 1FWKA 3RU0A 2OMOA 1U0HB 1OO0B 3PYEA 1GMVA 2Y1JA 3IBWA 2HSEB 2H5JB 1FKPB 1QUVA 3KHHA 3DRSA 4RNHA 4DFKA 1SL1A 3LPYA 3TA1A 4L73A 5D15A 3MEDB 4OYOA 5ETKA 2IHR1 3FZBA 2M8HA 3CCWA 2P9GA 1CC8A 2GAHC 3QT7A 1EJ7L 2DNLA 2UUCF 2A1BA 3FBFA 3JYTB 2AX0A 2N4DA 2XNQA 4C3MA 2BJ9A 2HRTA 5KFRA 4IFYB 3GYXB 3DNCA 3VVUA 3G86A 2X1BA 5HMYA 2IA0A 3H2VE 5DGAA 1IM6A 4JI4J 3GFZA 1XMOF 4CZCA 3M7VA 2PD1A 5L1LA 3RYLA 1N48A 2PFDA 3T1YJ 3M8PA 4P6QA 5D8HB 4HH0A 5L38A 1N56A 3MEKA 1KVIA 3CCZA 5KFHA 5FDLA 4ED0A 3W9HA 3QLHB 1Q5YA 2EFOA 2J9DA 2LFVA 4NMLA 4O44A 4X4OA 3ZC4A 3LO3A 2ZHOA 1HHSA 4ETXA 1VISA 1OSDA 3C15A 2DNPA 4OX8A 3T5LA 4TVAB 4DG1A 3OR2B 3KXDA 4NLXA 1UA0A 2MDAA 4NI2A 1XMOJ 2BANB 4DPTA 1SB6A 1S1UA 1OQ3A 4JV1A 2LDYA 2UV8A 2A3JA 2NPIA 5DJBA 2ZUAA 1HPZA 3BPSP 2WOMA 2YNGB 1FXRA 2KI2A 5IXUA 4M1KA 1SH0A 2I1RA 1VRQC 2O66A 4FYYB 1UETA 4DPXA 5KFKA 1ROFA 2BKNA 2HFNA 4ZPTR 3OXFA 1FVSA 1QAIA 3W5XA 3ZZOA 5D4LA 2R9LA 5U47A
chains in the Genus database with same CATH topology
1SC4B 2QLFB 2CNLB 2H65B 3NS7B 2H5JB 3P4UB 2QLBB 1I3OB 1PYOB 2CNNB 2HBQB 1RWKB 1NMEB 2H4WB 5IC4B 3R7BB 4JB8B 3EDRB 3P45B 2Y0BB 2QL5B 2C2MB 1RE1B 3RJMB 1F9EB 2XZTB 1PAUB 4DCPB 1RWNB 3D6FB 4ZVTB 3IBFB 2C1EB 4LSZB 1RHMB 1RWOB 1ICEB 1SC1B 2XYPB 2HBRB 2Y1LB 2H5IB 1RWWB 4ZVUB 4ZVQB 4ZVSB 1SC3B 2QLJB 1RWXB 3QNWB 2XYHB 1I51B 1RHKB 3R7NB 1QTNB 3KJNB 1RWPB 3R6GB 2CDRB 1GFWB 2H4YB 3GJTB 2H51B 2CJXB 2DKOB 4DCOB 1QDUB 1RHUB 2CJYB 3GJRB 2CNOB 1RWMB 1IBCB 3R6LB 4ZVRB 2P2CB 1RHJB 2C2ZB 2HBYB 2QL7B 3R5JB 3GJSB 2XYGB 2CNKB 4ZVOB 4ZVPB 2QL9B 3R7SB 4DCJB 2XZDB 3D6MB 2FQQB 1RHRB 2C2OB 3SIPB 3D6HB 2C2KB 1RHQB 3KJQB 3GJQB 3IBCB 5IC6B 3KJFB 1RWVB 5K20B 3EDQB 1BMQB 2H48B 2H54B 2HBZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SC4 B;  2QLF B;  2CNL B;  2H65 B;  3NS7 B;  2H5J B;  3P4U B;  2QLB B;  1I3O B;  1PYO B;  2CNN B;  2HBQ B;  1RWK B;  1NME B;  2H4W B;  5IC4 B;  3R7B B;  4JB8 B;  3EDR B;  3P45 B;  2Y0B B;  2QL5 B;  2C2M B;  1RE1 B;  3RJM B;  1F9E B;  2XZT B;  1PAU B;  4DCP B;  1RWN B;  3D6F B;  4ZVT B;  3IBF B;  2C1E B;  4LSZ B;  1RHM B;  1RWO B;  1ICE B;  1SC1 B;  2XYP B;  2HBR B;  2Y1L B;  2H5I B;  1RWW B;  4ZVU B;  4ZVQ B;  4ZVS B;  1SC3 B;  2QLJ B;  1RWX B;  3QNW B;  2XYH B;  1I51 B;  1RHK B;  3R7N B;  1QTN B;  3KJN B;  1RWP B;  3R6G B;  2CDR B;  1GFW B;  2H4Y B;  3GJT B;  2H51 B;  2CJX B;  2DKO B;  4DCO B;  1QDU B;  1RHU B;  2CJY B;  3GJR B;  2CNO B;  1RWM B;  1IBC B;  3R6L B;  4ZVR B;  2P2C B;  1RHJ B;  2C2Z B;  2HBY B;  2QL7 B;  3R5J B;  3GJS B;  2XYG B;  2CNK B;  4ZVO B;  4ZVP B;  2QL9 B;  3R7S B;  4DCJ B;  2XZD B;  3D6M B;  2FQQ B;  1RHR B;  2C2O B;  3SIP B;  3D6H B;  2C2K B;  1RHQ B;  3KJQ B;  3GJQ B;  3IBC B;  5IC6 B;  3KJF B;  1RWV B;  5K20 B;  3EDQ B;  1BMQ B;  2H48 B;  2H54 B;  2HBZ B; 
#chains in the Genus database with same CATH topology
 2V68 A;  4DF8 A;  1N0U A;  1TTH B;  1S9E B;  2D7S A;  2DNG A;  4MKB A;  4PKD B;  4O3R A;  1P1L A;  1YKW A;  3HHK A;  2U1A A;  1LK5 A;  1HQE B;  4Y2M A;  3T5J A;  1Z2Z A;  4IG0 B;  3HI9 A;  4LBH A;  2E5H A;  1T05 B;  4DU8 A;  2CQ2 A;  3BGO P;  2NSC A;  4K4Z A;  1VRT B;  1JWW A;  5IT9 Y;  4WFA Q;  1N0V C;  4ZCL A;  1RJJ A;  2ZDP A;  3EZO A;  1TL1 B;  3U1N A;  1JX4 A;  4B3O A;  2QO3 A;  4YB1 P;  1FRK A;  1VLY A;  3OL8 A;  2J0X A;  1SJR A;  3CF5 Q;  2YQ0 A;  2QEX S;  2GNK A;  5K8P A;  3UN2 A;  5C25 A;  1YJR A;  1VCT A;  4EBD A;  3QO9 A;  3TA2 A;  3UN3 A;  2EFG A;  4BCA A;  2HGM A;  4DV3 F;  1RP5 A;  1IBK J;  3IS9 A;  3NRB A;  3GV5 B;  3T41 A;  2HBZ B;  1JIH A;  1OIA A;  2XMK A;  4Y2I A;  1PO6 A;  4KPC A;  2YKM B;  3MAQ A;  3CDB A;  4ZP7 A;  3HK2 A;  1I6J A;  2X1A A;  4HL9 A;  4ECW A;  1KVK A;  3PHT A;  1BLU A;  4WYL A;  2CNN B;  1RAH B;  2V2V A;  2YWG A;  3N79 A;  4OYP A;  3KHR A;  1P27 B;  3I55 S;  4G65 A;  3T6B A;  4L75 A;  3KJV B;  4NLT A;  4NYP A;  4X2B A;  1G6B A;  2VON A;  3JQJ A;  4CWB A;  5CH7 B;  4DL5 A;  3K89 A;  2OHD A;  1X5T A;  2QMX A;  2IM3 A;  4RBT A;  4KSE B;  1UW4 A;  3CXC R;  2J9C A;  2OAU A;  5J2P B;  2QJ3 A;  3AQP A;  2CZ9 A;  2J8S A;  3MM8 B;  4QWE A;  1DHM A;  5KG0 A;  4CM0 A;  2DEI A;  4CYU A;  2R7R A;  2CNO B;  3DDI A;  2GW8 A;  1IKV B;  4J9S A;  4DSI A;  1UPM B;  2DY1 A;  1WOR A;  5L9N A;  4O0N A;  2KM8 B;  4Y0F A;  2MY7 A;  4NXN F;  3M8Q B;  5D78 A;  4DSJ A;  2ATC B;  2FGC A;  3RAQ A;  3AD8 C;  3GSD A;  4IFV B;  3I9V 9;  1TKD A;  3PV8 A;  1DJ0 A;  3NY0 A;  1DAR A;  2N4C A;  2B9X A;  5HJX A;  4QPT A;  2FD2 A;  1TAU A;  3PX0 A;  2GX8 A;  1FDD A;  4ITS A;  3CO0 P;  4YME A;  1U1Q A;  3PX6 A;  1IR1 A;  4PXD A;  3L3C A;  1H72 C;  2BEF A;  2B7C B;  1RT6 B;  5KFY A;  2DYA A;  3NG8 A;  4NA1 A;  2POK A;  1S1W A;  4ZN3 A;  2ROP A;  1IKY A;  2AJ0 A;  4CLY A;  1S6Q B;  3QNW B;  2ZIT A;  4IYQ A;  4B9V A;  2B51 A;  5F0W A;  2VFU A;  5DDP C;  1TFY A;  4F3Q A;  4MKY A;  2PE8 A;  3QQC D;  1I5O B;  1V5V A;  4TU8 A;  4HI2 A;  2AF6 A;  4H4O B;  4ZJO A;  2IRU A;  1GTH A;  4K2X A;  1L3U A;  4MT1 A;  1RAG B;  2P8I A;  4LFB F;  2KXN B;  1ZTW A;  3Q8Y A;  2VL1 A;  1X4A A;  1NK6 A;  1VRU A;  4YR2 A;  4ZPD A;  3OQ2 A;  5CZX A;  4OLO A;  4C0O C;  4DV1 F;  4K2J A;  1HNW F;  4X4N A;  4M5M A;  1TUG B;  5T41 A;  1RT1 B;  3QGH A;  3SCL E;  1V5I B;  3CWJ A;  4KV8 B;  3CCJ S;  5F8J A;  5IV3 A;  3I87 A;  2CA9 A;  1ZAW A;  4Q7A A;  2E7X A;  3UWT A;  1S99 A;  3PM9 A;  3V4I B;  3QBC A;  2MMY A;  2O1P A;  5CA5 A;  1HW8 A;  3SSQ A;  4HT5 A;  2GS8 A;  2XS2 A;  5DG8 A;  4F2R A;  3EVO A;  4ZA1 A;  3N28 A;  1H0H B;  3KJN B;  4B9N A;  1LV5 A;  1YTY A;  4A8K A;  3MM6 B;  2WB1 D;  1PKU A;  1K73 T;  2KT3 A;  2FVQ A;  2ZH8 A;  2HHS A;  1D9A A;  1WWH A;  2JNJ A;  2VG6 A;  1Q1K A;  5D4O A;  3SCJ E;  2VQF F;  1X0P A;  2HFZ A;  3OFH A;  3CJ4 A;  3I0R B;  3J80 Y;  1DBD A;  3B6B A;  1HNW J;  2F8E X;  3W5Y A;  5IZH A;  3X3U A;  3HX9 A;  4UTG A;  4IOA Q;  3V81 B;  1UKU A;  5B0F A;  5D4P A;  3TUJ C;  2X51 A;  2J7W A;  1W26 A;  4C3K A;  2WON B;  1N36 J;  1I3O B;  2HBQ B;  3FKB A;  5E3P A;  1HQU B;  5A8K B;  3OVB A;  3S01 A;  4FF4 A;  4RW4 A;  5D0R A;  1JLB B;  1AA1 B;  2E5L F;  1H2U X;  4F4A A;  3N5F A;  5K8M A;  2FLO A;  3K8W A;  1NK4 A;  4RBV A;  1RBO B;  2VQF J;  1DQA A;  1J5E F;  1UP1 A;  4OI1 A;  4E0D A;  4GKK J;  5KT5 A;  2XHW A;  4DR4 F;  3FMW A;  4X4Q A;  2VG5 B;  3CJ8 A;  2EBG A;  5L1I A;  4WWS A;  2ZHB A;  4LIW A;  5KFU A;  1L3S A;  1RTJ B;  4L6V 3;  2CQD A;  4OZ0 A;  1WHW A;  9ATC B;  3WDO A;  3W2W A;  3AAW B;  5GAG U;  1N5S A;  2NPF A;  3V4M A;  3OL9 A;  2UUT A;  4JI2 F;  3KLH A;  3H2U B;  4FDF A;  1VLO A;  3RGI A;  1RAJ A;  2MHE A;  7FD1 A;  4LFC F;  1NDL A;  4OV6 A;  1KON A;  3I6P A;  1TV6 B;  2OKQ A;  3UVJ A;  2GML A;  2DRA A;  5DRK A;  1D9D A;  3TA0 A;  3U27 A;  3HVT B;  3PNI A;  3W8P A;  2MST A;  3QT8 A;  1FX4 A;  4RNO A;  4NZ0 A;  3V6D A;  4DR7 J;  3UI3 A;  2KVQ E;  1FDN A;  2KG1 A;  4DR4 J;  1HQ2 A;  1ZA1 B;  4KJI A;  3E01 B;  2ZE2 A;  5THW A;  3QAT A;  5HMZ A;  4QWD A;  1WSR A;  4ZK7 M;  1FRJ A;  1XN9 A;  2VH7 A;  2OEL A;  2ZD1 B;  4JI2 J;  1Q5V A;  2MZS A;  4P75 A;  1KDN A;  1APS A;  3H4B A;  3IO1 A;  3L7P A;  2DXE A;  3O5T B;  5KFB A;  1KHW A;  3QAU A;  1HW9 A;  3SQO P;  4LFC J;  1FE0 A;  3MEG A;  2KJV A;  2B8Q A;  2FVP A;  4LQ9 A;  2L3M A;  3DFE A;  3GE9 A;  3DLB A;  1VS3 A;  4DUZ F;  3DI6 B;  3PO4 A;  4X4S A;  1FK9 A;  2V94 A;  1UZH A;  3ENV A;  4FS2 A;  3VV2 B;  2O3D A;  3RB3 A;  3OPK A;  3G82 B;  3ITH A;  5A2Q Y;  1YJ9 S;  4QJV A;  5HL7 Q;  2FC9 A;  3DM2 B;  1KTV A;  3VVT A;  3DN9 A;  5ETR A;  1UCN A;  4ED4 A;  2HLT A;  1BHN A;  4DCP B;  3HSG A;  1OMS A;  4AQY F;  3M8S A;  5DDR C;  1RT7 A;  1LFP A;  1RAC B;  4O3N A;  2UP1 A;  1KQF B;  2QTW A;  1FJG F;  1RGV A;  3OTB A;  2E5G A;  4X4R A;  4KIA A;  3HHL C;  2YNH B;  3FVY A;  4F26 A;  3T3F A;  2V34 A;  1WAC A;  2W9C B;  4J9Q A;  2Z8Q A;  2WCX A;  3A3O B;  4OI6 A;  5GAH I;  4DUZ J;  1CJK A;  1SUQ B;  3MMA B;  2JLE A;  3MOJ B;  2OFH X;  4PWD B;  5GAD I;  3MXH P;  2DGT A;  4AD6 A;  1FXL A;  1VQL S;  3LWM A;  3OTC A;  4DL6 A;  2J6U A;  4RUA A;  2CJK A;  2XLK A;  5ETV A;  4IH7 A;  3GG1 A;  2IRX A;  1H7W A;  3KLI A;  2WTF A;  5DGB A;  4Q8F A;  1JKH B;  1TVR A;  3G8T A;  4X4P A;  2LKZ A;  3UDC A;  4QCL A;  1KQS R;  4NLQ A;  3C6T B;  3MCM A;  1AB8 A;  3GIK A;  1UW9 A;  2C2N A;  3I0S B;  4QIE A;  4B3T F;  1KLM A;  1VQP S;  4I2P A;  3K58 A;  4DL2 A;  3GON A;  3TAQ A;  3MZI A;  4RU9 A;  3FJ2 A;  3FEY B;  2KRB A;  3KNA A;  2V4J B;  2KB2 A;  4QOT A;  1G3O A;  4WTY A;  3G9C A;  1KRP A;  3EPI A;  2M2B A;  3TVY A;  3HUL A;  6FD1 A;  4JP8 A;  3LP0 A;  2W01 A;  2BV3 A;  2YKN B;  3EUN A;  4M5I A;  3MEC B;  5EX0 A;  1KQG B;  3DXB A;  3O8W A;  1QSL A;  4ILL A;  3BGF A;  4C4W A;  1RHQ B;  1UVM A;  3UNG C;  5J1P A;  4A47 A;  4IH6 A;  1MU2 B;  2LU2 A;  5I3U A;  4B3T J;  4KH1 B;  4CRJ A;  4RKU C;  1NZ8 A;  2VBY A;  1R31 A;  3PRV A;  3MM5 A;  4PZV A;  1YDL A;  1NHK L;  2HVE A;  2YX1 A;  2EK1 A;  3J81 U;  2HG4 A;  2F40 A;  1R8C A;  3W7B A;  3EZ5 A;  2LYV A;  1V3S A;  2D9O A;  5E0O A;  2VPW B;  1WTF A;  5DDQ C;  1XNQ F;  1OY6 A;  1QVF R;  3ILI A;  1DQ9 A;  2CZ4 A;  4KR0 B;  2E1P A;  3H40 A;  3E51 A;  1VQK S;  4UUW A;  1NO8 A;  3C46 A;  3UCZ P;  3HXM A;  4NMX A;  3BSN A;  4OHV A;  1J27 A;  2UVU A;  5KFF A;  4RX6 A;  1FKO A;  4LBP A;  3M6V A;  4M5K A;  3KOA A;  5IT0 A;  3ZTP A;  1JLA A;  1OWX A;  2NXN A;  2OSQ A;  4PXB A;  5IC6 B;  2DHG A;  2IA6 A;  3DRS B;  3QAE A;  1W7W A;  2EC2 A;  3D7S B;  4I0W A;  3SI8 A;  4K4X A;  1AT1 B;  3UCU P;  4L3N A;  3OFE A;  2MLX A;  3MPY A;  1XNQ J;  2CVI A;  1S9F A;  1NJY A;  1MMN A;  3HFV A;  2ZH2 A;  2ZBP A;  5EWE A;  2CJQ A;  1UVK A;  4NCB A;  4B3M F;  3RB4 A;  2K1R A;  3UPF A;  2JEG A;  2RRN A;  3TZZ A;  2JDJ A;  4OMF G;  4U8Y A;  2ADB A;  3EGN A;  3M8P B;  1GXU A;  2IM1 A;  1HWI A;  1IQT A;  2QA4 S;  4EZ6 A;  4TNO A;  3K0J A;  1IUJ A;  2R7O A;  5F8M A;  3CSK A;  5HQL A;  3P96 A;  4UF4 A;  4ZCI A;  2HQI A;  2CQP A;  2C42 A;  3TJ9 A;  4QYZ K;  1LW0 B;  3TAM A;  2BJE A;  1NJZ A;  3ENQ A;  4OZ5 A;  4IQX A;  5HVF A;  1RU2 A;  5LSR A;  4O44 B;  5G4D A;  3B4M A;  1WHY A;  2I38 A;  1CBK A;  3KLG A;  2UXB F;  3BDP A;  1VBK A;  1S79 A;  4CO2 A;  2ZH1 A;  3C15 B;  3PFO A;  2KHD A;  4B3M J;  1DTT A;  3GYN A;  1B64 A;  9RUB A;  2Y0B B;  1MML A;  3D0I E;  3MF5 A;  4CNZ A;  1T95 A;  4DG1 B;  3M9O B;  5E3C A;  3IM8 A;  2NXE A;  4RPF A;  1S1U B;  1U2R A;  3MTJ A;  2GQC A;  2V9W A;  2VPY B;  2CQB A;  4ZCK A;  2DHA A;  5KOW A;  1HPZ B;  2DBB A;  3SDE A;  2ZZM A;  1S0V A;  2A18 A;  1ZPW X;  3K2Y A;  3B54 A;  1RT3 A;  2CDR B;  4LR9 A;  2UU9 F;  1SJ3 P;  4Z2X A;  3PW2 A;  2HGN A;  1FXD A;  4LSN A;  2FHK A;  4ECQ A;  2LP4 A;  2BOP A;  5HP1 A;  3FC9 A;  2CNK B;  3IG1 A;  4MJK A;  2R7T A;  3AH6 A;  1MN7 A;  3K5N A;  4Y2K A;  1NSQ A;  2CQI A;  2GHW A;  1D0E A;  1N88 A;  2O5D A;  1HL6 A;  4NRU A;  4WFN Q;  2PA3 A;  2OEM A;  3CJR A;  2BXJ A;  3VAJ A;  4MK8 A;  3RW6 A;  2OML A;  4TYB A;  1TFW A;  1H73 A;  3G8S A;  3UDE A;  1WTB A;  5DET A;  3P45 B;  5LOQ A;  2B6A B;  2FHO B;  3MEE A;  3B8H A;  2XZT B;  3TQ1 A;  1DLO A;  3DYA A;  3GG0 A;  1M1H A;  2DIV A;  4B3O B;  4GO7 X;  2LEP A;  2PFF B;  5HRO A;  4H4K C;  4LR8 A;  1T3N A;  5AXL A;  3MM7 A;  5K5M A;  5EX3 A;  2R8H A;  2NYH A;  5C25 B;  1TKZ A;  3W8G A;  5J2Q A;  1T94 A;  1PYS B;  2IM0 A;  1VBY A;  3QSI A;  3QGI A;  2G1H A;  4DV6 F;  2YPZ A;  3NCP A;  1B70 B;  1R3N A;  4YOE A;  2E1M C;  3IS9 B;  3NBP A;  3WX4 A;  4M95 A;  1AXQ A;  2LQJ A;  4UQT A;  3ET6 B;  2UUA F;  3BGR B;  4N41 A;  2AD9 A;  2JL9 A;  2C3O A;  4LR7 A;  1X9M A;  3CCQ S;  4OYW A;  2CNL B;  2PII A;  3P4U B;  3Q8V A;  3I5A A;  2XMW A;  4MFB A;  2V0N A;  1U6B A;  2VQE F;  4Y65 A;  2VBZ A;  4AT1 B;  3PZP A;  3BSA A;  4OHZ A;  1RA6 A;  3ZZU A;  2B9W A;  3GR1 A;  1TKT A;  2D69 A;  3A13 A;  4FVM A;  3H4D A;  3BZQ A;  4CYU B;  4D3H A;  4CO1 A;  2R2S A;  2XYH B;  1CJU B;  1UMJ A;  4DV6 J;  3KK1 A;  4AL7 A;  2M4M A;  4FPI A;  2P5V A;  4OL8 A;  4JBC A;  3C16 A;  4IG3 A;  2VDH A;  2JEI A;  1N6Q A;  4Q2M A;  4JI8 F;  2UUA J;  1S1T A;  4K8R A;  5HBM A;  2QL7 B;  3FQL A;  2BW2 A;  3FSI A;  2XB2 D;  2MZJ A;  1O6X A;  3MPV A;  4Y28 C;  2BDP A;  4YY3 J;  3DGV A;  2UVW A;  2YX4 A;  2XO6 A;  3EGZ A;  3M1V A;  4NLY A;  2HK3 A;  1F0X A;  4A8W A;  4KY3 A;  2FB0 A;  4LSL A;  2VQE J;  1Z4U A;  5ETL A;  4X4U A;  2DR8 A;  3OFF A;  4RW8 B;  5F8N A;  4HTI A;  1S1W B;  2FUG 9;  4P10 A;  2OSR A;  2XNR A;  1I94 J;  3VGV A;  3A8K A;  4ED8 A;  4F3O A;  1N5Y B;  2E9R X;  1SC1 B;  3GII A;  5IM0 A;  2BZ2 A;  2MQP A;  2DNO A;  2O01 C;  1Q4R A;  4JI8 J;  4ZVQ B;  2JC0 A;  2HAI A;  3RB0 A;  2PI5 A;  2QE5 A;  4UOF A;  5KG3 A;  1PIL A;  4AFF A;  4ED6 A;  2XTJ P;  2LXU A;  1O8B A;  1R43 A;  2VJU A;  5H1S V;  4ERD A;  2OH2 A;  2C2Z B;  2MTL A;  2RQK A;  1RYS A;  1VRU B;  4ZVO B;  3RBX A;  5B0C A;  3H5S A;  2D1C A;  2XO7 A;  1QE1 B;  1U0H A;  1X9S A;  5FLX Y;  1FKP A;  4N7T A;  3O44 A;  4ECZ A;  2ABY A;  1Q7L B;  3UD4 P;  1XBW A;  4I6W A;  3BGL A;  3G6E S;  2EFN A;  1SJ1 A;  4MIW A;  4OI0 A;  3H25 A;  3LUY A;  4F0K A;  1JJC B;  2DRD A;  3ETM A;  2MKS A;  2PC6 A;  2V2K A;  3VTI A;  4IFY A;  3QRR A;  3VQS A;  2GJI A;  1MSW D;  3FRY A;  2HIQ A;  2VG6 B;  2BM0 A;  4QYZ J;  3NOG A;  2EPI A;  2ZDO A;  2GJ2 A;  1JJ4 A;  4QR0 A;  3HFK A;  5IT9 U;  2DR9 A;  3O3L A;  3OTO F;  3G96 A;  2RQC A;  2MHN A;  2XGQ A;  2M88 A;  4W92 B;  1F5C A;  4F0M A;  2MY8 A;  3TNV A;  1SBR A;  4RBU A;  2UXD F;  3I82 A;  3OLB A;  1UJ5 A;  4F50 A;  1ZA2 B;  1P9Y A;  2HVH A;  3ZZT A;  2CPZ A;  2HUR A;  2V67 A;  4RW4 B;  3F0N A;  3LP1 A;  2BAC A;  3MCO A;  2V69 A;  4P74 A;  1UZD A;  4LF9 F;  3IXQ A;  2HFS A;  6FDR A;  4HH1 A;  4HLB A;  2U2F A;  2M9K A;  1IBL F;  4HTJ A;  4PWU A;  4WP9 A;  1MW7 A;  2X3D A;  3S1T A;  2W8L A;  3HHL D;  1ZZF A;  4P2S A;  2DD8 S;  3T5K A;  4OHX A;  1HWJ A;  4BC9 A;  2LXF A;  1LXJ A;  1H98 A;  2RHS B;  4WKY A;  2UXD J;  4DCO B;  4J90 A;  4NLS A;  1SI9 A;  2GZO A;  3EIC A;  3HDS A;  4JV5 F;  4DX8 H;  3VQT A;  2CPH A;  3N4W A;  5B0E A;  1GXL A;  3UD3 P;  2ZBI A;  1FNM A;  3HFZ B;  4RNF A;  4DN0 A;  5B0D A;  1HBU A;  5D0G A;  4Z7C A;  2HHQ A;  1XR6 A;  4DL7 A;  4FN5 A;  3Q2T C;  1PYT A;  3G6V A;  1X4F A;  3LAM A;  2BAB A;  4A8M P;  3V6D B;  1HQE A;  4C7Q A;  2CFX A;  1IBL J;  2JEJ A;  2OI2 A;  3L4B C;  4LFA F;  1X4D A;  4ECS A;  4LF2 A;  3X1L B;  2IDL A;  3AQO A;  3OVA A;  3ZTR A;  1Z2L A;  5L46 A;  1VBZ A;  3DRX A;  1RWN B;  1SXL A;  2GA7 A;  3SFU A;  3TEH B;  2AGO A;  2LQB A;  3K57 A;  1RT4 A;  1GMW A;  1S1X A;  1BUX A;  4DQI A;  5CZV A;  2YWH A;  5KFS A;  2ZUG A;  1D3W A;  3O1L A;  1U4B A;  3QSY B;  4LMZ A;  5D77 A;  3GIR A;  3MEG B;  1QDU B;  3VAI A;  4BLG A;  2LEA A;  2VF3 A;  4B3S J;  1FK9 B;  2ZWO A;  2WVD A;  1JLF A;  4U96 A;  4QYR A;  3SFG A;  2XMV A;  5F8I A;  3DLG A;  3ITH B;  3BH7 B;  5FII A;  5JUM A;  2K7J A;  2KFN A;  4BBY A;  5E33 A;  3GQC A;  2P9E A;  1X4E A;  1K1S A;  5EGY A;  2D9P A;  2B5J A;  1NSP A;  2H1Y A;  3WX8 A;  4JI6 F;  1CVJ A;  3LOU A;  4IOB A;  1GEH A;  4ZP9 A;  2YXL A;  1RT7 B;  4PG8 A;  4DV2 J;  1KWM A;  3C14 A;  4CLU A;  4NOH A;  2BE7 D;  3HCX A;  3IP0 A;  4KFB A;  5KTQ A;  1K8A T;  3NAI A;  5J2P A;  1RWW B;  2B7B B;  1U8W A;  1WHV A;  2R2U A;  2YNI A;  4X64 J;  1WF0 A;  4DLE A;  1FWL A;  4RL1 A;  2PMH A;  3QFH A;  2W24 A;  4JYA F;  3RW7 A;  1PG5 B;  4ZCM A;  4KO0 B;  2E7W A;  1TQL A;  1JMT A;  5B7W A;  2KL8 A;  2ADC A;  4KGX B;  3DMJ A;  2PA8 D;  4N56 A;  3OSN A;  3RAX A;  1YVF A;  4HKQ A;  4C48 A;  4M5N A;  2HHX A;  3HKZ D;  4FKY A;  4ZVH A;  3NWR A;  3HSD A;  4RZR A;  1VQ5 S;  2KH9 A;  2RIL A;  2XQC A;  3KLI B;  1W2I A;  3K5M A;  2HLU A;  4JI6 J;  1TVR B;  2JHE A;  5GAE U;  3NGD A;  2COL A;  1U09 A;  4ECV A;  2E29 A;  4C97 A;  3KLV A;  3GYG A;  4UOG A;  4IOC Q;  1UVN A;  1PBA A;  1KLM B;  1E6V A;  4YFU A;  4GMK A;  1U24 A;  3U1M A;  4ZOS A;  4RWW A;  3UN5 A;  1RT6 A;  2QL5 B;  1G7C B;  1OYE A;  3NAH A;  1YJ7 A;  4DV5 J;  4JOU A;  4BWM A;  4DFP A;  4FBT A;  4IUF A;  4I69 A;  1OJ4 A;  3CMQ A;  2D3U A;  3M4X A;  3D1Q A;  3ILL A;  2GHV C;  3NGT A;  2B4V A;  4ZVU B;  3LP0 B;  3MI7 X;  4CI0 B;  3HJV A;  1JXL A;  4V19 X;  2IMW P;  2QN6 B;  2M52 A;  2QA4 G;  4OZ2 A;  3CJ3 A;  4C8M A;  7AT1 B;  3EWG A;  1FCA A;  3LH2 S;  1SKW A;  4P7V A;  1TP7 A;  4CO4 A;  2RDJ A;  3SBM A;  4RUH A;  1DY3 A;  3TO8 A;  2XM3 A;  3KKF A;  1RTI B;  4DL3 A;  2ZC4 A;  2DNZ A;  3D6M B;  2DXF A;  4IKA A;  5ETQ A;  2JVO A;  2R7V A;  2Z0G A;  4ETZ A;  2F3J A;  4KT0 C;  3MWB A;  1T9V A;  4L3K A;  3MM5 B;  2FJV A;  1RCX B;  5FJ4 A;  1XMB A;  1N5Q A;  1FT8 A;  1WC4 A;  1JXV A;  2I0X A;  2Q6B A;  1IKW B;  1JB0 C;  3CB4 A;  2J8A A;  1FX2 A;  1YX2 A;  2CJB A;  3M30 A;  4KGV B;  2C2D A;  3ZTQ A;  2W4D A;  4C98 A;  3R1L A;  3IBF B;  1EAR A;  5F9L A;  2IM2 A;  4CTA A;  4EMD A;  3MR5 A;  2F4F A;  4X62 F;  4NX9 A;  3DXS X;  3S7R A;  2MKJ A;  2HIY A;  3EYZ A;  5AE2 A;  3GJT B;  2RU3 A;  1UAW A;  1HWL A;  3GCW P;  2B3T B;  4F36 A;  4WPA A;  1FKO B;  5A8R A;  2W7O A;  5EWG A;  2ROE A;  3N0V A;  1JLA B;  3ELH A;  2KJW A;  5E7O B;  3J7Z T;  2XUL A;  3V81 A;  2MLY A;  1RA7 A;  2RH3 A;  2D41 A;  5F8L A;  3MFH A;  1NB7 A;  1WEX A;  1P6T A;  2YX7 A;  3RB6 A;  3AOB A;  4R0J A;  1SPB P;  1L3T A;  2A6O A;  4LRF A;  4HHJ A;  1VQO S;  3H5U A;  4YHH F;  1FJE B;  1T9T A;  4R5P A;  1CLF A;  3K5L A;  3AY0 A;  2AX1 A;  4DX5 A;  1M0S A;  1JLB A;  4X62 J;  5T14 A;  2ZNZ A;  3BM7 A;  5I3P A;  1PBU A;  2Y1R I;  2AJ4 A;  1XIQ A;  2Y1L B;  2DTJ A;  5KG7 A;  3GSI A;  4F67 A;  3VGT A;  1B99 A;  1SC3 B;  2VG7 A;  2VG5 A;  3W60 A;  3QGP A;  3R7N B;  3D0G E;  2B8P A;  4FYD A;  1GK8 A;  5J1N A;  5KG4 A;  4PG7 A;  3TAM B;  2MQM A;  1F5B A;  2K06 A;  2NR0 A;  2XZD B;  3CIZ A;  2ZOG A;  4L76 A;  5DZ6 A;  2GC8 A;  3LAL A;  5KFA A;  2DNH A;  3KLG B;  4C6A A;  4UZC A;  1S4E A;  3BO3 A;  3HVT A;  1EX8 A;  1N32 F;  2W9B A;  1DTT B;  1LQ9 A;  4MH8 A;  3W2V B;  3BB5 A;  4MKA A;  4DDF A;  3N6N A;  4LRA A;  2C3Y A;  1R89 A;  1WSV A;  3UDL A;  4DSK A;  5HMX A;  3THP A;  3SDE B;  5F8G A;  1YJW S;  3WHI A;  2B56 A;  3E01 A;  1RT3 B;  3QIP A;  4FXD A;  4F7V A;  1Q7Y T;  1NHV A;  5AXN A;  1KLN A;  3CMA S;  3GIM A;  5KFQ A;  1S0M A;  3C6U A;  2BJ3 A;  2MLZ A;  2ZD1 A;  1ZZN A;  5HQ8 A;  5D6G A;  3GP9 A;  1QY7 A;  2QSW A;  2Y8W A;  3Q8Q B;  2MGZ A;  3EMT A;  1D9F A;  4P71 A;  3IG1 B;  3PCO B;  2AEF A;  2BQU A;  3DI6 A;  3A3N B;  1S12 A;  3VGU A;  2P6T A;  3OHA A;  3SIP B;  4TY8 A;  2IVM A;  4HYK A;  3CME S;  1WKJ A;  1DQ8 A;  2HVI A;  1NH8 A;  3MD1 A;  3CCS S;  1U6F A;  5KFX A;  1RWV B;  1HBM A;  2QLF B;  3DCA A;  1IWA A;  4OYA A;  4HAC A;  4B9T A;  1DLO B;  1NK5 A;  1VQM S;  1LKZ A;  1L5U A;  1S49 A;  3WC2 A;  1C1B A;  1VMB A;  1F9H A;  2VAS A;  4I68 A;  3OV7 A;  1PJ6 A;  1KTQ A;  4J37 A;  3K7R A;  5KFL A;  5H9F K;  1N33 F;  1E6Y A;  1NPK A;  1KBR A;  1SQG A;  2XLJ A;  5J2Q B;  3O6Q A;  1ARO P;  5DLF A;  1F1B B;  1J2V A;  3LW5 C;  3OT9 A;  1EKS A;  1OS5 A;  2ZM6 F;  4ZVE A;  4JI1 F;  3BS9 A;  1LWF A;  3KHG A;  5B0G A;  1RTD A;  4A8X A;  3JAM U;  3KFW X;  4I4B A;  1K47 A;  2R8J A;  4GKJ J;  2V8H A;  4QIF A;  1TL7 B;  3P8B B;  3OTD A;  2QFJ A;  2LU1 A;  2V4Q A;  3QJL A;  2V50 A;  3MTK A;  2HNY A;  4MFB B;  3TZX A;  3BKT A;  4P9S A;  2V8D A;  4JI3 F;  2I5J A;  1CEZ A;  3C6T A;  5HMW A;  3IMQ J;  2J0S D;  5HK4 A;  3OVS A;  3LAN A;  1TKT B;  1GXT A;  3NMR A;  3BKF A;  3FZ2 A;  4Q0B A;  2OLW A;  3PW5 A;  1T03 A;  2IJR A;  3KK1 B;  4CH7 A;  4JI1 J;  3CNQ P;  1GTE A;  2MQQ A;  1YWX A;  3KG4 A;  1T9W A;  4ELT A;  3RRK A;  1N6Q B;  1S1T B;  2YKN A;  5HBM B;  4MMO A;  1KEK A;  1KOO A;  4A8S A;  2WZ1 A;  3U1L A;  2BQR A;  2KXH A;  1ULR A;  3W9J A;  3R9L A;  1MG7 A;  1XEZ A;  5K9F A;  5I4M A;  3LGN A;  1RWM B;  3CJ0 A;  2R8K A;  5KFM A;  4UW2 A;  1WDT A;  3L7O A;  2VKR A;  2W2Q P;  2ZVS A;  4WE1 A;  1YIT S;  4JI0 F;  1YBT A;  1IM4 A;  3M1V B;  2Z2Z A;  2IY5 B;  4K4T A;  1Y4Z B;  1Q95 G;  3GV7 B;  4LSL B;  1X5S A;  3KDO A;  1K0T A;  2RDI A;  1RAI B;  1Q8I A;  1P9Q C;  1SH2 A;  5K20 B;  4I6Y A;  2AP6 A;  3M6X A;  2OTL S;  5BYS A;  3FUY A;  3DLK A;  3PKY A;  3JXO A;  2B4U A;  5KFO A;  1AW0 A;  4AL5 A;  5IM0 B;  1ELO A;  4Y2A A;  4FBU A;  3IR6 B;  3IRW P;  4DR1 F;  3NMA A;  2ERR A;  4KHM A;  4NXM F;  3GTY X;  3RTV A;  4Q5V A;  1T3O A;  2HRY A;  3C19 A;  1U26 A;  4LF8 J;  3P5B P;  1S0O A;  3BV8 A;  4Q8E A;  3ENA A;  1VJW A;  5M2R A;  4K4V A;  3M05 A;  4MAK A;  3BR9 A;  2PEB A;  4R0E A;  4DZD A;  3I5C A;  1Q82 T;  5J2N A;  2DT9 A;  2XYG B;  2DHX A;  2OO4 A;  4YP3 A;  4DSL A;  1KP6 A;  4DWI A;  2FIU A;  3BBC A;  3DOM A;  2RUG A;  4O3S A;  3OW2 R;  4YB6 A;  3Q86 A;  3ZNJ 1;  1HHQ A;  2DCU B;  1T8E A;  4M5D A;  1UFK A;  1Q79 A;  4DSF A;  1ZOT A;  2C2E A;  5C24 A;  2HZC A;  5F3Z A;  2MKC A;  4O4G B;  4K5S A;  3HF5 A;  1F60 B;  1IN0 A;  4EO8 A;  4HDH A;  2GJF A;  2Q3P A;  1WG4 A;  4IRC A;  4DR1 J;  1K44 A;  4NXM J;  1X4G A;  4D3G A;  1C4C A;  2CQ3 A;  3MPD A;  4ED2 A;  5HLF A;  1HNV A;  5AE3 A;  2K2P A;  4USJ C;  4EI2 A;  2H5I B;  2KKH A;  3N01 A;  2VHG A;  4CLP A;  4CT8 A;  3UE2 A;  4DR2 F;  1IR0 A;  1FWP A;  4ID5 A;  4M5H A;  1Q16 B;  4B3R F;  2B0G A;  3CC7 S;  3AOA A;  2ROG A;  3Q0A A;  1U47 A;  1S7I A;  2XI2 A;  5JVG Q;  4I64 A;  4I6A A;  1LW0 A;  3JSY A;  3R5J B;  4WFZ A;  2LEC A;  1U25 A;  2HND B;  4E98 A;  2UUC J;  4WFY A;  2ZH6 A;  3GIJ A;  2XMA A;  4YR0 A;  3J7Y I;  3LP1 B;  3SSS A;  4UUX A;  1A9N B;  1SC4 B;  1AFI A;  1IKX A;  1VR6 A;  2G4B A;  3FCV A;  4A8F A;  2R7Q A;  1D09 B;  2DPJ A;  3PJ9 A;  1EP4 A;  2QT7 A;  1LXN A;  3SZ2 A;  4LVN P;  4WP3 A;  4DR2 J;  2YWK A;  4C8K A;  2DB1 A;  4CO5 A;  4F02 A;  1XTZ A;  5A6P A;  4B3R J;  2ZKT A;  2V5H G;  1RU1 A;  3CUN A;  2B4P A;  3ZTO A;  1VQY A;  3D54 A;  4QWB A;  4OYB A;  2XMJ A;  1UL3 A;  5GMD A;  2FVR A;  1NLK L;  1YK9 A;  4WKR A;  3SCI E;  5A0Y A;  1LW2 B;  4TXS A;  2EKN A;  2ASD A;  4UOH A;  3QJP A;  4ZLJ A;  1HBU B;  5EDW A;  4QWA A;  4EEY A;  4NEY A;  1HR0 F;  4RW9 B;  4AXJ A;  1UFL A;  3D6H B;  2Y1I A;  3CW2 C;  1UPP A;  1WKK A;  1NM2 A;  1N54 B;  1S77 D;  5H9F J;  4DBQ A;  4EWT A;  1YJT A;  4N8N A;  3AXK A;  3W3S A;  1UVJ A;  4J9V A;  5KT7 A;  2B6A A;  2L48 A;  3M9M B;  1FD2 A;  2HFU A;  2WSE C;  1NBE B;  2H4W B;  4USK A;  1NJI T;  4WFX A;  3R7B B;  4DQQ A;  2PDA A;  2IDE A;  4LIR A;  3CD7 A;  1RE1 B;  2DH9 A;  1M90 T;  3H2L A;  1RT4 B;  1PGZ A;  1VOM A;  6AT1 B;  1RBA A;  1S1X B;  1QTM A;  3AD7 C;  1PJ5 A;  2FVC A;  3D4J A;  2YVS A;  1NKE A;  1H74 A;  1KN6 A;  1RDR A;  3UDV A;  1HR0 J;  2CQ1 A;  1M5V C;  1JLF B;  2XI3 A;  3CCU S;  1UWB A;  4XPE A;  2HGL A;  2MPU A;  4AE5 A;  4NAS A;  5DG7 A;  3DLG B;  1MLA A;  2DNN A;  1JXE A;  3ULH A;  2FDN A;  3CVK A;  3ET6 A;  3BGR A;  1FJC A;  3M8Z A;  2EI5 A;  3IRX A;  3PVX A;  3DOK A;  1WC3 A;  2B5J B;  4DPW A;  2FLP A;  2ZJQ Q;  4NYO A;  1S48 A;  4CO0 A;  3IR7 B;  1WF1 A;  3NL0 A;  4ICL A;  1NEE A;  3ISZ A;  2BJ7 A;  2DR7 A;  1NDC A;  2K7K A;  3C14 B;  3SSR A;  3DRP A;  3PY8 A;  4KFB B;  5IWA F;  2NZ4 A;  2ZJR Q;  3T1H F;  1SKS A;  3VAF A;  5FLX U;  2YKP A;  3ISN D;  2YNI B;  5GVQ A;  1YQH A;  5ADZ A;  2ZOM A;  4ELV A;  2HBR B;  1CJU A;  1G4C A;  1EZZ B;  5FD1 A;  4DV3 J;  3PYF A;  1HNI A;  2O67 A;  2PMZ D;  2JFK A;  2XHC A;  1RHK B;  5HAN A;  4M94 A;  1RUS A;  1SKU B;  1CPZ A;  1LWC A;  3DMJ B;  2XZW A;  4X84 A;  4TLQ A;  5KG5 A;  4DUT A;  5CCM A;  1YRU A;  4C0B A;  1GMU A;  2YWF A;  3CJQ A;  2FZC B;  4ZVR B;  4ZPA A;  1BQM A;  4RO0 A;  3IR5 B;  1TMM A;  1RAD B;  2XWY A;  3BH6 B;  2OTJ S;  5E3Q A;  3A8J A;  1WEL A;  1XK8 A;  4C8O A;  2RQM A;  3BDE A;  1E6V B;  2V6A A;  2FZG B;  1D8Y A;  4PXC A;  3N9U C;  4NLD A;  4O4R A;  5IWA J;  1SV5 A;  1U1R A;  3TJA A;  3PG9 A;  1HD1 A;  3T1H J;  4RW8 A;  1YBA A;  2Q43 A;  2LLZ A;  4HHH A;  3TZW A;  3TJ8 A;  1IJF B;  3CD0 A;  3Q22 A;  2AV5 A;  3ETO A;  3D5M A;  1Y0H A;  4ZHR A;  1N5Y A;  1R6V A;  2AYB A;  3IGV A;  2VUG A;  4NLV A;  2KM8 C;  3ZNU A;  2I6W A;  2JZ5 A;  4NXN J;  3CDA A;  1S10 A;  2CDQ A;  2MSS A;  4I56 A;  2FJA B;  1A6L A;  4PRF A;  4EK2 A;  5F41 A;  4MYT A;  1FES A;  3CDU A;  2BM1 A;  2CJ9 A;  1FFW B;  5KFT A;  5BXI A;  1YI2 S;  3DGP A;  3OLA A;  1QE1 A;  2DXD A;  3MR6 A;  1BQX A;  1VFJ A;  3I56 S;  3FQK A;  1EQM A;  4FPR A;  2ILZ A;  2R7W A;  2E44 A;  4N5S A;  3KLF B;  1ITP A;  1FFG B;  4Y00 A;  5K14 A;  1VHF A;  3LGM A;  2JX2 A;  4JI7 F;  2OD6 A;  3M30 B;  2IYI A;  4R8U A;  4EU0 A;  4I7F A;  2Z57 B;  4A46 A;  2RVJ A;  3IN5 A;  3AJ1 A;  4F4X A;  1PSD A;  2DNY A;  4CTA B;  3TEG A;  1BXN A;  1H2V Z;  1HI1 A;  5GAH U;  4WP8 A;  4LFB J;  4PQA A;  2MQ8 A;  3U02 A;  2DVI A;  1N34 F;  4OZJ A;  3J7A N;  2HS3 A;  5A8R B;  1I51 B;  4K50 A;  3NP5 A;  4DV1 J;  3ZZ0 A;  3VR1 A;  4C0H A;  1FKA F;  4XDC A;  4F2S A;  1RSC A;  4UY8 T;  4Y6I A;  3EM1 A;  1IBC B;  2H5E A;  4NZ7 A;  2BMB A;  2NRE A;  2HQG A;  1CSJ A;  2UUW A;  2DEJ A;  2RT3 A;  4ZJQ A;  3H5X A;  1HI8 A;  4JI7 J;  3ADA C;  4YEA A;  2GAG C;  4R5P B;  3VWS A;  4DV4 F;  3ZTS A;  3HSJ A;  1HKA A;  5C5J A;  4NPO A;  3NS7 B;  2BW7 A;  3NGS A;  2OPR B;  3AB4 B;  5J2M A;  4RWX A;  4EUV A;  3MR2 A;  1TL3 B;  2VFV A;  2AGP A;  4NCG A;  1N34 J;  1U8S A;  2P6S A;  4DI6 A;  2VG7 B;  4CT9 A;  5E2Q A;  3BO4 A;  3M2V A;  1FNO A;  4EFA C;  2KVI A;  4DPO A;  4MYU A;  2Q66 A;  2GVD B;  1S57 A;  2KO1 A;  1NU4 A;  3VAM A;  5SUH A;  1G2E A;  1REG X;  5DDO C;  4YDX A;  5I42 A;  2QGF B;  3QZ7 A;  2D3O R;  2MKY A;  4RUC A;  4CNY A;  1S72 S;  1CS4 A;  2QA1 A;  4MKV A;  4N77 A;  5B08 A;  1V3Z A;  1L3V A;  5BR8 F;  4DV4 J;  2ZH9 A;  2BJ1 A;  4IRK A;  3UD5 A;  1OQ6 A;  2E5I A;  1KSP A;  3OD2 A;  3BN7 A;  2E5L J;  2W9B B;  1TL4 A;  5DM6 Q;  1EIY B;  3TX0 A;  2N82 B;  2VIH A;  4ZN1 A;  5DZ7 A;  1H6K X;  1J5E J;  2GMJ A;  1X8D A;  2FY1 A;  3TRG A;  1JK9 B;  1NSA A;  2RUS A;  1OYD A;  3HJF A;  3HHL A;  1Q0N A;  3QIP B;  1CUL A;  2LMI A;  4C11 A;  3VAH A;  2ZEJ A;  3C6U B;  3CIM A;  2RS2 A;  2CXE A;  2W9A A;  5KFW A;  1NJX A;  2MGZ B;  1XR5 A;  3NLC A;  5ITH A;  3EVM A;  1R0A A;  2AJ2 A;  2N3L A;  1GH8 A;  2FJE B;  1RLD A;  2CPJ A;  2V2Z A;  3DC2 A;  2GQQ A;  2VC0 A;  2MJU A;  4KGK A;  4H4M A;  4TY8 B;  2XS5 A;  2BE2 B;  3PFE A;  2BX6 A;  3CO9 A;  4RW7 A;  4CQ1 A;  4Z37 A;  1HBM B;  2DNR A;  1SCJ B;  4DV0 F;  4U7U K;  4TN2 A;  1HBN A;  4H54 A;  4HAC B;  4OYX A;  1U48 A;  1LK7 A;  2DGQ A;  4OJG A;  3B4D A;  3K5O A;  2YKA A;  1C1B B;  1IVZ A;  2P9C A;  3RR8 A;  3FCW A;  2MKI A;  4ZIW A;  1R0B G;  3MPW A;  1E6Y B;  3EXC X;  4TLR A;  2Z58 B;  1KFS A;  2DNQ A;  4RJV A;  3UCG A;  4CDI A;  4LF1 A;  1C0T A;  2YNF B;  1PJ7 A;  1SC6 A;  2F4V F;  4I67 A;  3MHY A;  1UEK A;  2XWX A;  4U7C A;  1LWF B;  4KO0 A;  2HHT A;  3CDW A;  2ZWP A;  1RTD B;  4HHU A;  3VGS A;  1FTC A;  4QQB A;  5DM7 Q;  4WK3 A;  5L8R C;  1VQS A;  2MEW A;  3PEJ A;  2VOO A;  2CQC A;  1JLG A;  1M5O C;  2C3M A;  2HNY B;  3IC1 A;  2V8G A;  2RIJ A;  2I5J B;  3KUH A;  3R2D J;  4AQY J;  1UJ4 A;  3MMB A;  3PX4 A;  1FJG J;  4DU7 A;  3R27 A;  2C2R A;  2F8M A;  4N8O A;  1S6P B;  3MUT P;  2MQO A;  3N6L A;  4OI4 A;  4Q0B B;  1KNZ A;  1U1L A;  2Y0S D;  4DFM A;  2D74 B;  4ED3 A;  1T03 B;  4HEA 9;  2F4V J;  1IXK A;  5IC4 B;  2HNZ A;  2RDD A;  2HHU A;  3A3P B;  2ATL A;  4W90 B;  2FLN A;  3LAK A;  5DS7 A;  1PC4 A;  2J7U A;  2EC0 A;  4OV1 A;  2BOA A;  2M8D B;  4B9L A;  1AUD A;  4HDG A;  1XNR F;  3HT3 A;  2CRL A;  2KHC A;  2RRA A;  2C28 A;  1VHI A;  1T7P A;  4WE1 B;  3D68 A;  1TR0 A;  3F73 A;  5LJ5 Y;  2BKO A;  1YG0 A;  2OD4 A;  4OI2 A;  1TK5 A;  1RTI A;  1ZET A;  1R8H A;  4PUO A;  4KAI A;  2W7A A;  3DHW C;  3KYL A;  4FKX A;  2MYF A;  2RRB A;  2MKH A;  1YBU A;  4FF3 A;  2J6S A;  1MN9 A;  1NXI A;  2QG9 B;  3FFI A;  3DLK B;  2VJV A;  3W9I A;  2XY7 A;  4BS2 A;  4EBC A;  3AFG A;  4KB7 A;  3TWZ A;  2JSX A;  1IKW A;  4BC7 A;  2BYC A;  4FVC A;  4ES1 A;  5EN1 A;  2QSF A;  1YJV A;  1KHV A;  4JI4 F;  4ZLL A;  3AOC A;  3T1Y F;  1EHW A;  4DS4 A;  2NCK L;  3PXG a;  2EFV A;  2GIQ A;  2XMM A;  2HHV A;  1XNR J;  2ACM A;  3VCD A;  2DHS A;  2RNE A;  2C1E B;  1ICE B;  1WC5 A;  4O3O A;  5M2U A;  1TKX A;  1YGY A;  4E8U A;  2ZC3 A;  3H59 A;  1IWG A;  1WC1 A;  1Y10 A;  4U9R A;  5E3R A;  4XPC A;  1EB0 A;  2HHP A;  2CPF A;  5J2N B;  4IO9 Q;  3EVW A;  2Z2L A;  2XS7 A;  4OYZ A;  4USU A;  2NSB A;  2FJW A;  2IMO A;  4F25 A;  2DGX A;  3GB0 A;  3DOM B;  3FCH A;  2OIH A;  3R3T A;  1EAY C;  3OJU A;  3CCE S;  3VF0 B;  2ZZN A;  2N7Y A;  1NDK A;  4UQG A;  4M5D B;  2FHJ D;  5DQH A;  3KK2 A;  2WVE A;  5C24 B;  5CYJ A;  2WSF C;  4FNI A;  1FFS B;  2QYG A;  2VDI A;  2YTC A;  2EEY A;  1Y5N B;  3RRG A;  5IOL A;  4QW9 A;  1U45 A;  2VPZ B;  1SIW B;  3TVZ A;  4DR5 F;  4ECR A;  3AJ2 A;  2EFQ A;  4PPD A;  3P6Y C;  4Y34 A;  5HLF B;  2Z4P A;  1HNV B;  1R8A A;  5CXT A;  4K5R A;  1U2F A;  3FSX A;  1BY9 A;  3D6F B;  2DO4 A;  3HKW A;  1XER A;  1RWO B;  1CC7 A;  2EG1 A;  2MQL A;  2ZJP Q;  2NXU A;  1RCO B;  4AXI A;  1EQ0 A;  4FXV A;  4ID5 B;  2R2R A;  5C2C A;  3AT1 B;  4LRB A;  2VPX B;  3K59 A;  2RQ4 A;  4ZLP A;  3NS6 A;  1R6Y A;  4PPZ A;  2CQ4 A;  4XDD A;  2CJX B;  3W66 A;  4ECU A;  4LRC A;  1S9G A;  1HBO A;  4U67 Q;  1NJW A;  3ICL A;  1DZ5 A;  4DR5 J;  3PW0 A;  5C2G A;  1URR A;  1IKX B;  2HW3 A;  1HMV B;  1T11 A;  1SVD A;  3FGV A;  1H2T Z;  2RE1 A;  1GMW D;  1JJH A;  2ZOF A;  3W2V A;  1N8R T;  2XY6 A;  5T7L A;  2I9S A;  1EP4 B;  4H4K A;  4DR6 F;  2WW8 A;  5A76 A;  5KFP A;  1X7V A;  2XG8 A;  2MZR A;  5KFD A;  2YY3 A;  3R5D A;  1B7F A;  3V2U C;  1VIX A;  2FPH X;  1RTH A;  2AJQ A;  1BWV A;  2X1F A;  1H3D A;  3I4P A;  2KYZ A;  5AJ3 F;  4GVL A;  2XEX A;  2OPS A;  1IBK F;  1PAE X;  2R4F A;  3VZI A;  4QBU A;  5A0Y B;  2AZ1 A;  3KUG A;  1ZAV A;  1WG1 A;  1IBM F;  4V1A k;  2KTQ A;  4X66 F;  4DPU A;  3R97 A;  2UXB J;  5K8N A;  3KUE A;  1FI4 A;  1L3K A;  2KFY A;  5HQM A;  1RAO A;  3RBE A;  1Y00 A;  4P2F A;  4A8Y A;  4KKO A;  1RHJ B;  1YZ7 A;  1RK8 A;  4WIQ A;  1UFW A;  2GVZ A;  4MTP A;  4U7U D;  1ZAX A;  3QFW A;  4DR6 J;  3F44 A;  5KT6 A;  4PQU A;  3UFC X;  4ELU A;  3OXG A;  3R5B A;  4RW6 A;  3SEO A;  3FBB A;  3GLJ A;  3CJK A;  4N47 A;  3HVW A;  4WXW A;  2E7V A;  4CLS A;  2UU9 J;  2WK4 A;  4ZLN A;  1KFD A;  3R5A A;  1SJ4 P;  2VFR A;  5AJ3 J;  2IBO A;  3KTQ A;  4U95 A;  5JXS A;  5F3T A;  3Q83 A;  3H90 A;  3H8Y A;  2WRM A;  5D0H A;  2WVC A;  1F5A A;  4A48 A;  1WC6 A;  2HWT A;  2XY5 A;  1IBM J;  4WU3 A;  4X66 J;  3WIU A;  4YS2 A;  2XMT A;  1YRX A;  2FY8 A;  1UWB B;  1TK0 A;  4USH A;  4LT6 A;  3CJ2 A;  1Q81 T;  3OUY A;  3TUP A;  3G87 A;  4G1Q A;  4KHP F;  2K3I A;  2CAJ A;  2QC3 A;  2IPO B;  2Q1L A;  2DNK A;  3EGV A;  3EXY A;  1CJT A;  5BYR A;  3MCS A;  2CJY B;  3CCV S;  3IRX B;  1TL7 A;  3DOK B;  2KZM A;  2AIR B;  1Q8B A;  2ZFH A;  1HYS B;  3MM9 A;  4N76 A;  2X3G A;  4RNN A;  3A1Y G;  1N4L A;  2JC1 A;  4ICL B;  1NPP A;  3IWN C;  4DQP A;  3VAG A;  4E2F B;  3DRP B;  1U1M A;  2VKZ G;  2R2T A;  3DLH A;  5LSO A;  5IT4 A;  3BKU A;  1B4S A;  1NK8 A;  2JLF A;  3GFX A;  1P1T A;  1MWZ A;  1RWK B;  2F9D A;  5DO2 A;  3OTE A;  4NLG A;  3BBF A;  1O51 A;  3BEG B;  4EO6 A;  2YKQ A;  1PAU B;  2FZK B;  1HNI B;  3KMQ A;  1V3R A;  2DGS A;  2DR6 A;  2W25 A;  1JLQ A;  2AEJ A;  3UO0 A;  4DSE A;  1V9O A;  4KHP J;  1WD6 A;  2FLL A;  1RKJ A;  1LWC B;  2R8G A;  5KFV A;  2CZV C;  4B9U A;  4RR5 A;  1TZ0 A;  1VQ8 S;  5KFZ A;  1BQM B;  4FF1 A;  4IR9 A;  4TU9 A;  4NA2 A;  2WSC C;  4WZM A;  1WHX A;  5IFM A;  3MAH A;  3FEX B;  3C8Y A;  3TR5 A;  1RQ0 A;  3MR7 A;  4J9O A;  4DL0 C;  3OL6 A;  1GNK A;  1BE4 A;  2J9D E;  2W1B A;  1SV5 B;  1T9X A;  4RUB A;  3DOL B;  3K5P A;  1UEV A;  3ZO7 A;  4YN3 B;  4FYX B;  2EXU A;  1NSK L;  2RHQ B;  2WVB A;  2C2M B;  1QJH A;  1VYA A;  3DRR A;  4DV7 F;  3OL7 A;  4CP5 A;  1VK3 A;  2GV1 A;  4ZHR B;  1OY9 A;  1B7Y B;  3EZU A;  4KPY A;  3JQK A;  3JQM A;  4HR2 A;  3I31 A;  3EDR B;  3DLE A;  4K7Q A;  3RJM B;  4CIO A;  4TY9 A;  2AJF E;  1N52 B;  4ECX A;  3GFY A;  1URN A;  3JSR A;  2GGP A;  1XWL A;  4OX7 A;  1SQF A;  2LCW A;  2QYC A;  1Y7P A;  2ASY A;  1NDP A;  2FJB B;  4DPY A;  2DHH A;  3DGP B;  3THT A;  3PR5 B;  2Q79 A;  3BSO A;  1N36 F;  1LWX A;  1CG2 A;  5HO4 A;  2NYI A;  2YKO A;  2DH8 A;  2W4C A;  2VV5 A;  3POT A;  2QV6 A;  2K3K A;  4ED7 A;  2I2Y A;  5F9N A;  4DV7 J;  2MQN A;  3BJY A;  5K14 B;  3FRZ A;  4G6V B;  3V6K A;  1IR2 A;  3O2I A;  1VBX A;  1A0O B;  4QWC A;  4FF2 A;  2HQF A;  3TW0 A;  1J5O A;  1UWA A;  1AUS L;  1DTQ A;  2PO4 A;  1HWK A;  4O4G A;  4R8U B;  4LBI A;  4I7F B;  3V5R A;  4DQR A;  4GKK F;  5KFE A;  2OPP A;  5HAO A;  3OR1 A;  2KT5 A;  3LPE A;  1XQI A;  4NLR A;  2Y8Y A;  4DXL A;  1HD0 A;  3R2C J;  3CT9 A;  1X4B A;  2V63 A;  1R8B A;  2HVD A;  4Z7Y A;  1WUU A;  5CD4 H;  2APO A;  4AND A;  5EWF A;  2HK2 A;  2DIT A;  5A8W A;  3QJJ A;  3LTO A;  1S1V A;  1WOP A;  3M8R A;  2W2O P;  1NK9 A;  4ZPB A;  3BN4 A;  3I32 A;  3M32 A;  3NGK A;  1REV B;  2W2M P;  2ZHA A;  4AUK A;  1BQN B;  1SL0 A;  2QLJ B;  2UVV A;  4J91 A;  4J5O A;  3W65 A;  2HKE A;  1S0N A;  4QIG A;  1U2C A;  5IS2 A;  3NEK A;  2N3O A;  3PYG A;  3LWL A;  3HVA A;  2CPY A;  2E1C A;  2WVF A;  1RHU B;  4A8Q A;  4ZKA A;  2HND A;  4DR7 F;  3D1O A;  2CPX A;  3LGH A;  1BWE A;  3B82 A;  1PCA A;  5B09 A;  2UXC F;  3GZ7 A;  2AT1 B;  1MRO A;  1EET A;  4DEZ A;  5J2M B;  1FRH A;  2W8K A;  2AYE A;  5JJB A;  1RWU A;  3L7U A;  5KFC A;  4QIV A;  4NCG B;  2QX0 A;  2YBV A;  2L9W A;  4FYV B;  3MUV P;  3OTO J;  3M2V B;  1Q8K A;  2IRY A;  2BVZ A;  2VFS A;  4WXO A;  2BKP A;  3D3B J;  4K4U A;  2IC3 B;  1RAE B;  5I42 B;  4URS A;  3US5 A;  1CS4 B;  3MOZ A;  3CGI A;  3FBE A;  2C22 A;  2R8I A;  1WF2 A;  2Z56 B;  1JLE A;  2G0J A;  5KG1 A;  1LW2 A;  3GPA A;  2AGQ A;  4C9D A;  3M8Y A;  2GO8 A;  1C1C A;  3RG6 A;  2DY9 A;  3AA9 A;  4F4K A;  2UXC J;  2HRU A;  4OLP A;  2MJN A;  3QRP A;  4RW9 A;  4LF9 J;  1JQG A;  2V9K A;  3Q23 A;  1M5K C;  3DU5 A;  5CAA A;  1UVL A;  5HAT A;  2MB0 B;  4F0H A;  1SIZ A;  2RML A;  4P7T A;  4U8V A;  1RKI A;  1U0S A;  3LA0 A;  2HFV A;  3TUI C;  3Q8U A;  3HHL B;  4FS1 A;  4B9S A;  1RT2 A;  2EW9 A;  4ZIV A;  3PR4 A;  1VQ7 S;  1CUL B;  3SYZ A;  4C11 B;  2PN6 A;  5AE1 A;  4FYW B;  2R3V A;  2BE9 B;  1ZTT A;  2CWK A;  2M7S A;  2VB6 A;  2NLW A;  4QPX A;  3ILJ A;  4JV5 J;  4W4M A;  2IYG A;  1HLW A;  2DGU A;  4F4Z A;  2MZ1 A;  2HAF A;  2RF2 A;  2L9N A;  5ETT A;  2JRS A;  2G2Z A;  1R0A B;  1RIS A;  1PIE A;  2PI4 A;  4U6P A;  5CYQ A;  1S4F A;  4H4M B;  4V19 J;  1QAY A;  2LEB A;  1O5J A;  4PCQ A;  1WC0 A;  1YRT A;  4CLK A;  4RW7 B;  3KLE A;  4X4T A;  3MMJ A;  5KFN A;  4HVZ A;  1WI8 A;  4LFA J;  3BPD A;  2VC1 A;  1HBN B;  5H9E K;  2CG4 A;  8AT1 B;  3W64 A;  1RHR B;  2H3E B;  2QRR A;  2SXL A;  2XSJ B;  4RNM A;  3DKD A;  1RT5 A;  1BC6 A;  8ATC B;  1M1K T;  2HZV A;  2YQ1 A;  1YJU A;  1VC5 A;  1NK7 A;  1WNE A;  5M2P A;  3JSM A;  5KT3 A;  4P2M A;  1C0T B;  2W2N P;  2R7S A;  3KDN A;  1X0F A;  4DJB A;  4IR1 A;  2HPU A;  2BJ8 A;  5KFG A;  4UST A;  3M2U A;  1YHQ S;  4ES3 A;  2VU5 A;  3BYP A;  3DDK A;  2XYP B;  3NCQ A;  4GC6 A;  4TQS A;  2L41 A;  4WU2 A;  5DG9 A;  1RWX B;  1KC8 T;  1P8G A;  3FMB A;  4ALZ A;  4Q44 A;  3IAS 9;  1JLG B;  2E1R A;  4CH0 S;  5C42 A;  2IBK A;  3LP2 B;  2CPD A;  3M2R A;  1NK0 A;  2GO9 A;  2JOQ A;  4OYM A;  2A2C A;  4YQW A;  4XK8 C;  2ZBC A;  3MMB B;  4F4Y A;  4ILR A;  4NZ6 A;  4GVB A;  4LRD A;  3J80 U;  2IAJ A;  1AFJ A;  3CTR A;  4M63 A;  2YH0 A;  5KAK A;  3B78 A;  2MZQ A;  4OJ3 A;  1DAX A;  4KBI A;  5JVH Q;  1QUP A;  2HNZ B;  4G3I A;  2K8G A;  4A8O A;  5GAG I;  4JYA J;  3J7Z 5;  4C8Y A;  3OSP A;  4IDK B;  2GFF A;  3MD3 A;  2OPQ A;  3HSZ A;  2LQ8 A;  3A8I A;  3CD5 A;  1S97 A;  1FER A;  4LSZ B;  2ACY A;  2Q6C A;  3E3X A;  1XJW B;  2LA4 A;  5L39 A;  4IO1 A;  1NAQ A;  1T02 A;  2E5J A;  3TI0 A;  4PUO B;  1FNX H;  3M9N B;  3JB9 k;  3RAM A;  2CPE A;  3JAM Y;  5HVG A;  1LEO A;  1Y11 A;  5DQG A;  2CVE A;  1FEH A;  1F2G A;  2DH7 A;  3FFI B;  2VZ9 A;  3NOC A;  3KLF A;  4C8L A;  4KGZ B;  4JV2 A;  3E8O A;  4USM A;  3MGJ A;  3Q2S C;  3PJW A;  1RAA B;  5IQQ A;  2EWH A;  2GIF A;  3SCK E;  3EDQ B;  1BMQ B;  2CYY A;  2UV8 G;  2WAQ D;  2QMU B;  5LXR A;  4LJM A;  4CCH A;  4I2Q A;  3ISN C;  4WZQ A;  4KGM A;  2KFZ A;  2KZZ A;  1M5H A;  3BQ2 A;  4J9K A;  4I1T A;  1VIO A;  1VC6 A;  1QAJ A;  4EYI B;  2G2Y A;  4ED1 A;  4WYW A;  2CPI A;  1TKX B;  4CO3 A;  3JSB A;  4DS5 A;  2J0W A;  4OJ1 A;  5KT4 A;  2XCP A;  3D28 A;  4Q2L A;  2WB4 A;  3KK3 A;  1TEL A;  1HHT P;  2D3Z A;  2DGV A;  1S6U A;  3D6T B;  2W7P A;  2DPI A;  2RB7 A;  2G0I A;  1VC0 A;  3HZE A;  3QID A;  3KK2 B;  5MLC V;  3SMZ A;  3D67 A;  2UUB F;  4PWW A;  2ASL A;  3GJS B;  3CC4 S;  3NNH A;  3P49 B;  3PAC A;  4ZJL A;  3KNG A;  3HZG A;  4OIX A;  3AD9 C;  3PW7 A;  4KHR A;  3IFE A;  1HWU A;  1UTA A;  3G8Q A;  2OPR A;  5FDL B;  5A2Q U;  2MXY A;  4ANC A;  3QWP A;  3ZXW A;  1TL3 A;  4KTQ A;  3C3L A;  3NNA A;  2RJZ A;  3UNY A;  3Q89 A;  1Q86 T;  4KYZ A;  1I1G A;  4L72 B;  1B0T A;  3H98 A;  2XC9 A;  3R5C A;  4DR3 F;  2CG8 A;  4ANE A;  2GVD A;  1F3F A;  3MPU B;  2AQ4 A;  2WW4 A;  3QRQ A;  3D0H E;  5J1E A;  3H42 A;  2UUB J;  3BSC A;  4NI2 B;  4OYI A;  2MZT A;  4YHH J;  1S9G B;  4OZ3 A;  2DJW A;  5LMU F;  3L09 A;  4ZMM A;  1HBO B;  4GO5 X;  1T9Y A;  2DRB A;  3HD1 A;  5L1K A;  1JLC A;  3P5T L;  3PEH A;  2EG2 A;  3OBI A;  1H38 A;  2VD3 A;  2WOM B;  2EFP A;  1QVG R;  2QL9 B;  1CJV A;  2FQQ B;  4AYB D;  5AT1 B;  3HD2 A;  5T7L B;  3NKY A;  1AZS A;  1NND A;  3NGR A;  1F3V A;  3AB2 B;  1YIJ S;  5G0R A;  1Y5L B;  2BRL A;  4DN9 A;  3QZ8 A;  4LF4 F;  4URQ U;  4DR3 J;  2QIF A;  4QW8 A;  2MKK A;  1RTH B;  5HN0 A;  1C0U A;  5A6W A;  4QIW D;  2CQ0 A;  2IJF A;  4K0K F;  4HT7 A;  2XMU A;  3TAR A;  1RB0 A;  2OPS B;  3NCR A;  4WBF A;  3IA0 A;  1T9U A;  1K0V A;  1RHM B;  5LMU J;  4CH1 A;  2OUG A;  3FSY A;  5H9E J;  2DGW A;  5CYM A;  1B0V A;  2OEJ A;  3MMC A;  2ZH4 A;  2IJN A;  4KKO B;  1N32 J;  2LXI A;  1GFW B;  2HMI A;  2BE2 A;  2GVZ B;  5ETN A;  3QWU A;  2AYG A;  3V6J A;  4PQU B;  4BDP A;  2HBY B;  5KFI A;  2J76 E;  2UZA A;  4RW6 B;  2B43 A;  2J6T A;  3CJK B;  1NZA A;  3CC2 S;  4OFZ A;  2R7X A;  4URG A;  4LF4 J;  1SQE A;  3QO9 B;  3EE3 A;  1KS2 A;  5D3G A;  3AJD A;  1GAO A;  2I8E A;  2JLG A;  2YPY A;  4K0K J;  4QR1 A;  4USV A;  4XAK A;  1NCL A;  3WBZ A;  3K17 A;  3A12 A;  3PJX A;  2A10 A;  4NLP A;  4J9U E;  4DZ6 A;  1VQN S;  4ED5 A;  1MMD A;  1R7I A;  1ZM4 A;  5LXY A;  3CPW R;  3IAM 9;  3KWM A;  1UJ6 A;  1U1O A;  4NEZ A;  2UVR A;  2QFI A;  2YNF A;  3CCR S;  4YY3 F;  3S6E A;  3OUY B;  4G1Q B;  4F3M A;  3HHE A;  3CDE A;  3D9B A;  2BBE A;  2EK6 A;  4NA3 A;  3DLL Q;  1CJT B;  3MM9 B;  1X4H A;  3MAA A;  5ETM A;  5RUB A;  4LRE A;  3J7Y U;  3D1H A;  3TAN A;  3L9Z A;  8RUC A;  2FJD B;  4TYA A;  2F1F A;  3MCN A;  2A0F B;  1GX6 A;  4JV0 A;  1I94 F;  1M5S A;  2G9O A;  3H7H B;  1DFD A;  1ACM B;  1LOU A;  3ONQ A;  3OFG A;  1N33 J;  3NNC A;  1RBL A;  2RSQ A;  1S6P A;  4OX9 F;  1KOH A;  3AA8 A;  2EKY A;  2HVZ A;  4WFB Q;  2NQP A;  5IV4 A;  3IWX A;  4PAB A;  3NXZ A;  2YH1 A;  2VOD A;  2ZM6 J;  2PSZ A;  2QLB B;  3I4H X;  3W63 A;  1JLQ B;  2RKI A;  1Q53 A;  3PHE A;  1JNR B;  2GMH A;  3HHN B;  5MAO A;  1FA0 A;  1OPZ A;  2KU7 A;  4ZP6 A;  5CD4 A;  3H20 A;  3D2W A;  2IVY A;  3LQV A;  4Q43 A;  2XBP A;  2ZH7 A;  1WEZ A;  3I5B A;  4BWJ A;  3TX8 A;  2R7U A;  2IFX A;  3BO2 A;  1Y3K A;  1XMQ F;  1FHT A;  2AW0 A;  5DLG A;  1IKY B;  4JI3 J;  4JI5 F;  2LDI A;  4DX7 A;  3Q8R B;  2QLX A;  3PW4 A;  2ZBQ A;  2QLW A;  5L1J A;  3BBB A;  4DX6 A;  3SQG A;  1Y9O A;  4MIA A;  2V4R A;  4OX9 J;  2G0C A;  5F8H A;  5KOX A;  1C4A A;  3ZZY A;  7FDR A;  4J9P A;  1N5T A;  3DRR B;  5SZT A;  1M1G A;  3W61 A;  2CJA A;  3R1H A;  1FEE A;  3DLJ A;  1KR4 A;  3WQP A;  1LWE A;  1XC9 A;  2X7I A;  3DLE B;  4ER8 A;  3GIL A;  1ZYQ A;  1SKR A;  2GGP B;  2EVZ A;  4JI0 J;  4C8N A;  1H7X A;  4C2M A;  4G1I A;  5B0B A;  1XMQ J;  2AJ1 A;  1QSY A;  1WOS A;  1K1Q A;  4NWB A;  4DFJ A;  4JI5 J;  2BRK A;  3ZFV A;  2HWI A;  3M6U A;  2Z2Y B;  3MED A;  2HQ3 A;  2XSF A;  5CCL A;  4KH0 B;  1S6O A;  5AXM A;  1N5V A;  1D8Z A;  1YJN S;  3JYT A;  1RWP B;  4NL5 A;  3R6G B;  3POT B;  1NKB A;  3FK4 A;  4W98 A;  1IJE B;  3PDN A;  3UR3 C;  1FF2 A;  2G13 A;  4CLT A;  2ZBR A;  4NCA A;  3HLU A;  1U49 A;  1J5O B;  3G71 S;  4OZN A;  3VAL A;  1DTQ B;  3NGU A;  2E9T A;  4NLU A;  4Y3C A;  1X31 C;  4Q45 A;  2KYX A;  2M70 A;  2OPP B;  3OR1 B;  4ID8 A;  3MDF A;  3H5Y A;  2J7K A;  4OI3 A;  4EBE A;  1AYE A;  3W5Z A;  3N5B A;  3E2E A;  4K4Y A;  2WBR A;  4ECT A;  4LF5 F;  3GCX P;  3PKM A;  3QLH A;  2AYM A;  5A8W B;  4F04 B;  1S1V B;  4OHY A;  1EKR A;  3UW1 A;  3QPI A;  2WHO A;  2PEH A;  1DRZ A;  3M32 B;  5ETS A;  5ETP A;  1SL2 A;  4XIU A;  4DUY F;  2F8H A;  2VFT A;  2CIM A;  2M3D A;  3CCM S;  1JJ2 R;  2FHJ A;  3ILO A;  4Y2C A;  4TU7 A;  5HJY A;  4ECY A;  4YR3 A;  1W2B R;  3OR2 A;  5E5N A;  5F0U A;  2BAN A;  2WBM A;  3AXM A;  1FO1 A;  3JTN A;  4EGL A;  3T5H A;  5LM7 E;  2PT0 A;  4NRT A;  4OZ1 A;  4YDD B;  4ZVP B;  1MRO B;  1R27 B;  2HS4 A;  1EET B;  5LMN F;  2YNG A;  5LSL A;  1HMV A;  1QD1 A;  3IM9 A;  2LQ5 A;  3TP2 A;  3W2W B;  2C2K B;  4LF5 J;  4M5L A;  4K4W A;  4OHW A;  3OXL A;  1JNZ B;  3BYR A;  2E1A A;  3KLH B;  2H54 B;  2G2O A;  5DQI A;  3BQ0 A;  1FDB A;  2DO0 A;  4DUY J;  4G1P A;  4J9N A;  3UVJ B;  4B3S F;  5D4N A;  3RBD A;  4O0I A;  4JB8 B;  2FC8 A;  1S9E A;  1KQK A;  4FZV A;  2VA2 A;  4DOZ A;  2M0G B;  1Y5I B;  1JLE B;  4DF4 A;  4ZDN A;  4IG0 A;  3CJT A;  4IH5 A;  1K9M T;  1NRK A;  1ZM3 A;  1T05 A;  1C1C B;  3PTW A;  1U7L A;  4ZVS B;  4KE5 A;  1VRT A;  2M5Y A;  3TZY A;  2GCF A;  4ZS6 A;  2CQG A;  4XO0 A;  2F5G A;  3CCL S;  4ZPV R;  4PG4 A;  1A7G E;  2ZE2 B;  2F65 A;  5LMN J;  1TL1 A;  1YZ6 A;  5D0E A;  5CHC B;  2DKO B;  4TQR A;  1RZM A;  2CAD A;  3JTO A;  4QU7 A;  2PGC A;  4DV2 F;  4CLL A;  3HMJ G;  1FVQ A;  1F9F A;  2DK2 A;  1S59 A;  2ALY B;  3WC0 A;  1Y3J A;  5KT2 A;  5HI7 A;  1RT2 B;  3AHP A;  1LFW A;  2HQC A;  2V8P A;  3SV4 A;  4X64 F;  1UA1 A;  2BQ3 A;  3UQS A;  3TQE A;  4B17 A;  1MWQ A;  4PG5 A;  4O3Q A;  1NPR A;  3PIO Q;  2RF2 B;  4GRS A;  2YKM A;  3T1A A;  1MNE A;  4M8L A;  4X4V A;  1UVI A;  3V6H A;  3PIP Q;  2YWE A;  1VGY A;  4DL4 A;  3GFH A;  1Q8L A;  1IQZ A;  3GR0 A;  4ZVT B;  1R8P A;  4K4S A;  5CYQ B;  1RAB B;  2KDO A;  2OEK A;  2W2P P;  1OY8 A;  1BGX T;  4ZVF A;  3SXL A;  4CLW A;  3KLE B;  2C3P A;  2AMC B;  3KJV A;  3HM9 A;  4O23 A;  3MUR P;  4LF7 F;  1QTN B;  1BD6 A;  4LQ3 A;  2NZC A;  1R0C B;  1B3T A;  3J7A 1;  1HYS A;  5EUH A;  4TKT A;  2P2C B;  2Z30 B;  3CCT A;  3PRB A;  3MM8 A;  2BR0 A;  5GMK a;  1CJK B;  3CUL A;  1WJ9 A;  4DV5 F;  1RT5 B;  1U1N A;  3IWL A;  4J9R A;  5E3A A;  4FXW A;  1IKV A;  1TMJ A;  1U6Z A;  2PMW A;  3M6W A;  2ILY A;  4IRD A;  2QZ8 A;  1ZM2 A;  3JSM B;  5EHH A;  2DNM A;  3M8Q A;  3HHD A;  2NUH A;  2HFO A;  4ZIT A;  4NE9 C;  3DHX A;  4IFV A;  4P2X A;  1ZPV A;  3BR8 A;  3M2U B;  3BQ1 A;  3PRD A;  3BF4 A;  3U7J A;  4ZVG A;  4P73 A;  2GHP A;  1WEY A;  3WIV A;  4ES2 A;  4KC5 A;  4UT4 A;  2OGU A;  4LF7 J;  4I2P B;  1NH7 A;  1WDD A;  1QSS A;  1F6T A;  1TK8 A;  5LT5 A;  1XR7 A;  4WF9 Q;  1M5P C;  5C42 B;  2ZH5 A;  1LNQ A;  3M2R B;  1X5O A;  2B9E A;  4C3L A;  3R5G A;  2E66 A;  1S6Q A;  4ILM A;  4GVB B;  3GJR B;  1YLX A;  2IAJ B;  1T0T V;  2GIR A;  1B0P A;  2OJ3 A;  2DIS A;  3H0P A;  2LVW A;  3DOL A;  2AWZ A;  4KRW A;  1RYR A;  4XTT A;  3R7S B;  2V2Q A;  2AEM A;  1CQM A;  4CM2 A;  2AHO B;  3DU6 A;  1FRM A;  4QR2 A;  3MUM P;  2H9Z A;  3GV8 B;  3IBC B;  2FTR A;  4H4O A;  2HWH A;  3HO1 A;  1S5Z A;  4UY8 5;  2J5A A;  4LF6 F;  4R25 A;  3WZ0 A;  2F9J A;  2X1G A;  2OPQ B;  2JWN A;  3OJS A;  1KD1 T;  5I3U B;  2B9Y A;  4MK7 A;  3D3C J;  4WK1 A;  4L74 A;  4PYA A;  3R8Y A;  1X60 A;  3UR0 A;  1RT1 A;  3T9Z A;  4J9M A;  4KV8 A;  3I96 A;  1U1P A;  3RUB L;  2F63 A;  3A4T A;  3T19 A;  3V4I A;  4MK9 A;  3VHQ A;  4RU2 A;  4M5G A;  3NS5 A;  5ETO A;  4B08 A;  4WCE Q;  1KKH A;  3EPG A;  1RXO B;  3CE8 A;  2DGO A;  2B4O A;  3Q8P B;  3A8E A;  2XGP A;  1YSJ A;  1QAX A;  2A2D A;  2R42 A;  3R6L B;  1RTZ A;  2OP5 A;  4B02 A;  3MM6 A;  4UZB A;  1U02 A;  4PR6 A;  3TYT A;  1HFE L;  3NWG A;  4LF6 J;  2ZZT A;  2CWX A;  1NB2 A;  2C2O B;  1V6H A;  4QZV B;  4I2Q B;  3GJQ B;  3I0R A;  5KFJ A;  3G4S S;  4A4J A;  3TOQ A;  1WOO A;  2ZH3 A;  2BUN A;  2NS1 B;  2N7C A;  3T9N A;  3TAP A;  4CLZ A;  1HAR A;  2E9Z A;  4YB7 A;  1TAQ A;  1GT8 A;  4OZL A;  3EGW B;  4PG6 A;  2YQ3 A;  5GAD U;  3KK3 B;  5AXK A;  3GMG A;  2RAQ A;  2WON A;  3LF0 A;  5BJR A;  2QA2 A;  2VBX A;  5JMN A;  3D66 A;  3N6M A;  4NYZ A;  1G1X A;  1REV A;  1BQN A;  5LL6 d;  3M8W A;  3RR7 A;  1HQU A;  5A8K A;  2RD5 C;  1VQ4 S;  2CQH A;  2HHW A;  3HT0 A;  4UOC A;  1DUR A;  4B9M A;  2K1R B;  1NKC A;  2QMW A;  4GC7 A;  4USI A;  1OPI A;  1X9W A;  2KXF A;  1F2H A;  2ZNY A;  5I3Q A;  1O0P A;  3F56 A;  2CUY A;  2KRR A;  3CED A;  4QU6 A;  5CQG A;  1Z1Z A;  5KG2 A;  3QMQ A;  2GQ2 A;  2J0Q D;  1RTJ A;  3J81 Y;  3KHL A;  3AOD A;  3S8S A;  1UEU A;  1VQ9 S;  4OQJ A;  2HEK A;  3RRH A;  3ENW A;  1FJ7 A;  3BGU A;  4IQM A;  1X5P A;  4FP9 A;  2FVS A;  1X4C A;  3EX7 B;  1PYO B;  1RAF B;  2HYI B;  1VI7 A;  1TUV A;  1TV6 A;  3ZZZ A;  2IC3 A;  2J9E A;  4O3P A;  3FNN A;  4LUB A;  5GAE I;  2JVR A;  3KG1 A;  2HZA A;  1PC5 A;  2HS0 A;  2FHM A;  1GQE A;  3QYY A;  5J1E B;  4S0M A;  1TU0 B;  3VZH A;  2FYX A;  4AL6 A;  3CD6 S;  3TVK A;  1OSC A;  4DLG A;  3C66 A;  1RI7 A;  3TUZ C;  3RBZ A;  1JLC B;  5B0A A;  2H4Y B;  1FD8 A;  1SJQ A;  2BJD A;  5GME A;  2H51 B;  1FDA A;  4ZPW R;  1QLN A;  1CJV B;  3OHB A;  5IQ6 A;  1AZS B;  4K59 A;  1D1U A;  4EYH B;  5C7P A;  2FJX A;  4ZPC A;  4LSN B;  3K8V A;  5G0R B;  2LQ9 A;  1HNZ F;  2Z2M A;  5CAB A;  5HP1 B;  1KVJ A;  2JH3 A;  1C0U B;  3MFI A;  3CJ5 A;  2IIH A;  4LVO P;  3ZZP A;  2V8V A;  2H65 B;  2XLI A;  2CKW A;  4NLO A;  1WI6 A;  2HQD A;  2L08 A;  3G82 A;  5E41 A;  2ZVI A;  1RLC L;  1WKL A;  4GKJ F;  5BR8 J;  3DM2 A;  1VQ6 S;  2ZKU A;  2AU0 A;  2Y9H A;  2Y3Y A;  5CYM B;  3MMC B;  3ZZR A;  2YWW A;  3PO5 A;  2JFD A;  2EBE A;  3MEE B;  3IGN A;  4PYD A;  4C8Z A;  1C2P A;  3DYA B;  2HMI B;  4EZ9 A;  5KG6 A;  3G2X A;  2W4P A;  3DDN A;  5HRO B;  1WG5 A;  3F41 A;  4P52 A;  2ALZ A;  2NUU G;  2RU9 A;  3GWC A;  3MM7 B;  3HPO A;  3HVR A;  3I9Z A;  4NLW A;  4BHQ A;  1TKZ B;  2XCA A;  1HNZ J;  4WTO B;  2YNH A;  4OJH A;  3QGG A;  3GU0 A;  5K8O A;  2W9C A;  2XSJ A;  4DMZ A;  5D3G B;  3P3D A;  1Q78 A;  1TL5 A;  5LJ3 Y;  1SUQ A;  3BRE A;  3MMA A;  4X65 F;  1FRI A;  4PWD A;  2JEF A;  3NBP B;  1W25 A;  5HVH A;  1S76 D;  2A6M A;  3G6Y A;  1ZBT A;  3FEZ A;  3KJF B;  2H48 B;  2DIU A;  3G6X A;  1ZM9 A;  2RS8 A;  1NHU A;  1SJF A;  4DQS A;  2VIC A;  2DCL A;  4J7C A;  1QM9 A;  4M5J A;  3RZA A;  1NME B;  2C3U A;  3VAK A;  4WII A;  1JKH A;  1FRX A;  3PYD A;  2VOP A;  3DRY A;  1U1K A;  3W62 A;  1FRL A;  3EJM A;  3FDS A;  4YUD A;  3QT5 A;  4DV0 J;  3I0S A;  3FBC A;  3MAA B;  2FGO A;  3W1Y C;  2KN4 A;  2F7V A;  4RLE A;  4F4W A;  1VK8 A;  3QT6 A;  2V4J A;  3LP2 A;  3JS9 A;  4F8R A;  2DR5 A;  4X65 J;  2HHH F;  1MWY A;  1FE4 A;  3SV3 A;  3C16 B;  4IG3 B;  4P72 A;  4CLF A;  4KQZ A;  3KG0 A;  1VJQ A;  3JTP A;  4OX6 A;  4MIB A;  1ZH5 A;  4USW A;  3L95 X;  3CJS A;  2NXJ A;  3MEC A;  1HA1 A;  2L9D A;  1FTR A;  4DCJ B;  5HSP A;  4LF8 F;  1SH3 A;  2RKI B;  1HIY A;  4PXE A;  2OFG X;  1HNX F;  4IDK A;  1MU2 A;  5BYQ A;  2IVF B;  3HP6 A;  1CQN A;  4PEO A;  3MR3 A;  2AZ3 A;  1F9E B;  2G1D A;  3KMS A;  3Q8S B;  2VA3 A;  1HI0 P;  2JJ4 D;  1VDH A;  1ZS6 A;  1NUE A;  4PAA A;  3J81 j;  5L9X A;  2LA6 A;  2AKW B;  3THV A;  2HHH J;  3T6J A;  3SQG B;  4J9L A;  4JUZ A;  3C2P A;  4WJB A;  4FNH A;  2KG0 A;  4HI1 A;  4YB5 A;  4DHV A;  4ENO A;  1TUW A;  4ZP8 A;  4ATN A;  2NXC A;  1GX5 A;  2KT2 A;  1S7H A;  2BA9 A;  1LWE B;  1HNX J;  2D3O 1;  3KJQ B;  3Q24 A;  2ASJ A;  2VBW A;  1FWK A;  3RU0 A;  2OMO A;  1U0H B;  1OO0 B;  3PYE A;  1GMV A;  2Y1J A;  3IBW A;  2HSE B;  2H5J B;  1FKP B;  1QUV A;  3KHH A;  3DRS A;  4RNH A;  4DFK A;  1SL1 A;  3LPY A;  3TA1 A;  4L73 A;  5D15 A;  3MED B;  4OYO A;  5ETK A;  2IHR 1;  3FZB A;  2M8H A;  3CCW A;  2P9G A;  1CC8 A;  2GAH C;  3QT7 A;  1EJ7 L;  2DNL A;  2UUC F;  2A1B A;  3FBF A;  3JYT B;  2AX0 A;  2N4D A;  2XNQ A;  4C3M A;  2BJ9 A;  2HRT A;  5KFR A;  4IFY B;  3GYX B;  3DNC A;  3VVU A;  3G86 A;  2X1B A;  5HMY A;  2IA0 A;  3H2V E;  5DGA A;  1IM6 A;  4JI4 J;  3GFZ A;  1XMO F;  4CZC A;  3M7V A;  2PD1 A;  5L1L A;  3RYL A;  1N48 A;  2PFD A;  3T1Y J;  3M8P A;  4P6Q A;  5D8H B;  4HH0 A;  5L38 A;  1N56 A;  3MEK A;  1KVI A;  3CCZ A;  5KFH A;  5FDL A;  4ED0 A;  3W9H A;  3QLH B;  1Q5Y A;  2EFO A;  2J9D A;  2LFV A;  4NML A;  4O44 A;  4X4O A;  3ZC4 A;  3LO3 A;  2ZHO A;  1HHS A;  4ETX A;  1VIS A;  1OSD A;  3C15 A;  2DNP A;  4OX8 A;  3T5L A;  4TVA B;  4DG1 A;  3OR2 B;  3KXD A;  4NLX A;  1UA0 A;  2MDA A;  4NI2 A;  1XMO J;  2BAN B;  4DPT A;  1SB6 A;  1S1U A;  1OQ3 A;  4JV1 A;  2LDY A;  2UV8 A;  2A3J A;  2NPI A;  5DJB A;  2ZUA A;  1HPZ A;  3BPS P;  2WOM A;  2YNG B;  1FXR A;  2KI2 A;  5IXU A;  4M1K A;  1SH0 A;  2I1R A;  1VRQ C;  2O66 A;  4FYY B;  1UET A;  4DPX A;  5KFK A;  1ROF A;  2BKN A;  2HFN A;  4ZPT R;  3OXF A;  1FVS A;  1QAI A;  3W5X A;  3ZZO A;  5D4L A;  2R9L A;  5U47 A; 
#chains in the Genus database with same CATH homology
 1SC4 B;  2QLF B;  2CNL B;  2H65 B;  3NS7 B;  2H5J B;  3P4U B;  2QLB B;  1I3O B;  1PYO B;  2CNN B;  2HBQ B;  1RWK B;  1NME B;  2H4W B;  5IC4 B;  3R7B B;  4JB8 B;  3EDR B;  3P45 B;  2Y0B B;  2QL5 B;  2C2M B;  1RE1 B;  3RJM B;  1F9E B;  2XZT B;  1PAU B;  4DCP B;  1RWN B;  3D6F B;  4ZVT B;  3IBF B;  2C1E B;  4LSZ B;  1RHM B;  1RWO B;  1ICE B;  1SC1 B;  2XYP B;  2HBR B;  2Y1L B;  2H5I B;  1RWW B;  4ZVU B;  4ZVQ B;  4ZVS B;  1SC3 B;  2QLJ B;  1RWX B;  3QNW B;  2XYH B;  1I51 B;  1RHK B;  3R7N B;  1QTN B;  3KJN B;  1RWP B;  3R6G B;  2CDR B;  1GFW B;  2H4Y B;  3GJT B;  2H51 B;  2CJX B;  2DKO B;  4DCO B;  1QDU B;  1RHU B;  2CJY B;  3GJR B;  2CNO B;  1RWM B;  1IBC B;  3R6L B;  4ZVR B;  2P2C B;  1RHJ B;  2C2Z B;  2HBY B;  2QL7 B;  3R5J B;  3GJS B;  2XYG B;  2CNK B;  4ZVO B;  4ZVP B;  2QL9 B;  3R7S B;  4DCJ B;  2XZD B;  3D6M B;  2FQQ B;  1RHR B;  2C2O B;  3SIP B;  3D6H B;  2C2K B;  1RHQ B;  3KJQ B;  3GJQ B;  3IBC B;  5IC6 B;  3KJF B;  1RWV B;  5K20 B;  3EDQ B;  1BMQ B;  2H48 B;  2H54 B;  2HBZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...