3DLGB

Crystal structure of hiv-1 reverse transcriptase in complex with gw564511.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
431
structure length
400
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 113
structure length 400
sequence length 431
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlgB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgB03
4EYHB 3HVWA 2OPRB 1IKWB 1RT7A 4JV2A 4IRKA 4NLWA 5C24A 3BR9A 4KFBB 1TL3B 4XPCA 5J2QB 1LW0A 1DLOB 3E51A 3UQSA 1S1XB 3BGRA 4RW7B 4ED8A 4JUZA 4KKOA 4O44A 5CYQB 5DQHA 2C2RA 4PUOB 3MEDB 2ATLA 4RNOA 4ID5B 3OHBA 2JLEA 1RTIB 5KFOA 2C2EA 3M8PB 1QUVA 2C28A 1TKXA 2ALZA 3JSMB 2OPQA 1TKTA 3QLHA 3KLFB 1S0NA 4WE1B 3KMSA 3T5KA 2ASJA 3H5SA 4LSLA 5CYQA 3QO9B 2BRLA 4M95A 4J9NA 1IKYA 5KFTA 2ZKUA 4ID5A 3GIMA 3BREA 3H4DA 3M8PA 2OPPA 1K1QA 2QE5A 2VG5A 5KFYA 3JSMA 5J2NA 1C0UA 2FJVA 2I1RA 3OL7A 1HPZA 4WE1A 4MIAA 2C22A 2UVUA 4ZP9A 5KG2A 4I2QB 4ZPAA 1RTJB 2HNZA 4B3OA 3CDUA 2IM0A 1RT4B 4J9RA 4MKAA 3RB0A 3LAMA 5D3GB 3DRRA 3TVKA 4ECTA 1QE1B 3H98A 4R0EA 5F9NA 4EBCA 4I2QA 2R2TA 2YNHA 1RTJA 3ITHB 4NCGA 5J2PB 4RNHA 4J9KA 1RT4A 3PHEA 3H4BA 2B6AB 3NKYA 2W8KA 1C1CB 3E01B 1RA6A 5KFMA 3EPIA 3KLGA 2WTFA 3KK2B 4YR2A 1DTTA 4H4MB 3CJ4A 4Y3CA 3IN5A 2YNIB 5J1EB 4XO0A 5J2PA 2VG6B 2AQ4A 3CVKA 4YR0A 1S1UB 4RW6B 1CSJA 4IDKA 4IG0B 2CJQA 3QZ7A 3H59A 5DGAA 3KK2A 4J9OA 2B5JB 2R8KA 1JKHB 4IFVB 5HROB 1GX5A 4LQ3A 2YNIA 5J1EA 5I42A 2QV6A 3DM2B 2BRKA 4Q44A 4J9LA 3KMQA 3T19A 5L1IA 2RKIA 4Q0BB 1REVA 2RDJA 5T14A 1BQMB 5C25A 3DRPA 4IG3B 5FDLB 2R2SA 2W7OA 1S0OA 4ED3A 4U7CA 4IFVA 1TL1A 2E9ZA 1RT3B 3DM2A 1N48A 5HBMB 3KHLA 4IFYA 2C2DA 4RW4A 3H2LA 4I7FA 4KHRA 1LWEB 3MEEB 3CDWA 4KHMA 3DMJB 3I5BA 3LP1B 1BQNB 2HWIA 3KNAA 1RT2B 1S9EB 1RT3A 1C1BB 2YNGA 3KLEB 2GC8A 3CDEA 4MKBA 4ECQA 2R8HA 4O3NA 2F8EX 2HAIA 2VA2A 5KFSA 3MR3A 3KK1A 3GV7B 1LWEA 3V6JA 2BE2B 3LALA 3DMJA 3ISNC 3LP1A 1BQNA 5HLFB 2JC0A 3MTKA 4MIBA 1RT2A 4O4GB 4ZP7A 1HYSA 4TN2A 3KLEA 4Q8EA 2RF2B 3NAIA 3FQLA 4DL3A 1HNIB 1T03A 4R8UA 1UWBB 3DLEA 3HKWA 4JV0A 2OPSB 2IM3A 4ZMMA 5F8GA 2YKMB 4Q8FA 2J6TA 4O4GA 4WFYA 3G6XA 3I0SB 5KFLA 4FBTA 4ZHRB 5KFXA 4IH6A 3EPGA 4Q43A 2UVVA 4K4SA 1SH3A 3GYNA 1S6QB 2WOMA 5KFUA 5KFDA 2JEFA 4IRCA 4KE5A 4WXWA 4XPEA 2GIQA 3M9MB 5K14A 2YKMA 3LP0A 4NLVA 2ASDA 4K4UA 5KT3A 2JC1A 5DGBA 4ZPBA 4K4TA 3MECB 4I2PA 4PWDB 3MEGB 2D41A 4TYAA 4MFBB 2HWHA 4NLGA 1EETA 1RYSA 4G1QB 4ZVEA 4ZPDA 1RAJA 4FS1A 1S6PB 5KFNA 3GIKA 1HQUB 4OL8A 4NRUA 1RTDA 3V6DB 2YKNB 4WZQA 1LWCA 1R0AB 3DDKA 3SI8A 4RNNA 5L1KA 4PWDA 3FRZA 1C0TA 4MFBA 3RAQA 1FKPB 5HP1A 4NLSA 3MR2A 4NLDA 2DPJA 4QW8A 3KHHA 1S6PA 5CYMA 1IKXA 3OHAA 2ASLA 2VA3A 3G86A 1JLBB 2YKNA 3QGHA 1RTHA 1R0AA 2ILYA 4YP3A 4IR9A 1JLAA 1HARA 3M9NB 4ED7A 2IAJB 2OPRA 3M8QB 1IKWA 4WYLA 2IMWP 1HQEB 3T1AA 2FVCA 5DQGA 4ICLB 4PQUB 3IGNA 1RT1B 1TL3A 3DOLB 4KFBA 5J2QA 1DLOA 2JEIA 1S1XA 4RW7A 3H5YA 3NL0A 5L1JA 4PUOA 3MEDA 3KLIB 4GC6A 3PZPA 5L9XA 2R8GA 1RTIA 5C42B 1LWFB 1QAJA 2AX1A 4PQUA 4K4WA 4K4VA 1RT1A 3KLFA 3DOLA 4URQU 4RW9B 4ECUA 4RZRA 3QO9A 5EDWA 2V4RA 4ZP8A 2AGQA 3HVAA 2FJWA 3OLAA 4HYKA 2V0NA 4ZVHA 5C42A 5KT7A 4URSA 4RNFA 1S1VB 1MU2B 2HNDB 4IKAA 1TP7A 5KT6A 3Q8PB 2XCAA 3PW2A 2ZE2B 2BQ3A 2IM2A 2FLNA 1TVRB 1SH2A 2YNFB 4ECSA 5JUMA 3H5UA 5KFHA 3DOKB 4TY8B 5KFZA 4EBDA 1S1VA 2XI2A 1J5OB 5D3GA 1VRTB 2E9RX 4NYZA 3IS9B 1RT5B 2FLLA 5DG8A 2XI3A 5KG1A 3M9OB 3UPFA 1QE1A 3PJXA 4QWBA 3RAXA 3IG1B 4IOBA 2R2RA 5KFBA 2D7SA 3ITHA 4TY8A 5F8NA 1MMLA 1JLCB 4TLRA 4O3QA 4ED0A 1EP4B 3ICLA 4O3PA 4Q45A 4TQSA 3RBDA 2B6AA 2V9WA 1C1CA 3E01A 4WXOA 5KFIA 2BR0A 2I5JB 4H4MA 2AGPA 4NRTA 5KFWA 1S9GB 1JXLA 3NMAA 4X2BA 4KSEB 1JLCA 2VG6A 1S1UA 2HMIB 4QWEA 4RW6A 4ED1A 1WNEA 1S1TB 4IG0A 3KLHB 4F4WA 1NHUA 2B5JA 2I5JA 3QGIA 1JKHA 5HROA 3D28A 4KO0B 4O4RA 3T5JA 3MR5A 3TAMB 1XR5A 5C5JA 3UR0A 5KFCA 4O3SA 1JLGB 1TQLA 4H4OB 4Q0BA 1VRUB 2IJNA 3GILA 3PVXA 1DTQB 3PW5A 1BQMA 3LAKA 2E9TA 4MK8A 4IG3A 5FDLA 4H54A 5DQIA 3PR5B 3TQ1A 1LW2B 1S49A 5KG7A 2XGQA 4KO0A 5EUHA 4J9SA 4EYIB 5F8JA 1IM4A 4DL4A 3GV5B 2O5DA 3PW7A 2ZD1B 3RB6A 5HBMA 2JEJA 2ILZA 3GIIA 4QPXA 1RYRA 3MEEA 3V4IB 4F4XA 4KV8B 4NLPA 5KFVA 3HHKA 1TKZB 1RT6B 5KFAA 2DPIA 3N6NA 3BSCA 1S9EA 3NBPB 2EC0A 1C1BA 3QYYA 1JLFB 2XC9A 2IJFA 5DLFA 2BE2A 1JLQB 3FQKA 1ZETA 4IRDA 3PW4A 5KFQA 5HLFA 4Y2AA 5KFFA 3FFIB 4QWCA 4K4XA 3PJWA 2RF2A 5KFEA 4NLYA 1S1WB 2FVRA 1HNIA 2AWZA 3LP2B 3GIJA 1UWBA 1Z4UA 4HKQA 2BQUA 2OPSA 3N6MA 1D0EA 4MK7A 5KG4A 2W9CB 3I0SA 4IR1A 2WONB 1S1WA 1SUQB 4ZHRA 3CJ3A 1N6QB 3LP2A 2AX0A 1S6QA 4QW9A 2J6UA 4R5PB 3DLGB 3BQ1A 2WHOA 1KHWA 4KB7A 1TV6B 1JLEB 1FK9B 4ZVFA 5EWEA 3KHGA 2W9BB 5KFPA 4DL2A 3QZ8A 4RUAA 4DG1B 1IKVB 2FLPA 4K4YA 2JEGA 3MECA 3I5CA 3MEGA 2IBKA 3OL9A 1SUQA 4ECRA 5F8LA 3DLKB 4IH7A 4G1QA 5KFGA 4K50A 5I3UB 4WFXA 3RB3A 3DLGA 2FVQA 1HQUA 2VG7B 4O3OA 5KG3A 3V6DA 1FK9A 2RDIA 3BQ2A 1RA7A 3N6LA 4ECZA 2WB4A 1S9FA 1FKPA 5JXSA 4J9MA 5C24B 4J9QA 3RB4A 5F8IA 4U6PA 3PR4A 4K4ZA 4EEYA 4ZPCA 4ECWA 1JLBA 3OLBA 3BGRB 4RW8B 4KKOB 4O44B 4DL7A 2IAJA 5DG7A 3M8QA 2B43A 1HNVB 2AGOA 1HQEA 1TKXB 4KAIA 4RUCA 4ICLA 3Q8QB 2OPQB 1TKTB 3QLHB 5F9LA 2UUTA 3BSNA 2BANB 4NLRA 4RW8A 3OL8A 1NHVA 2IC3B 4LSLB 1U09A 3H40A 3OSPA 3C6UB 3BSAA 1IKYB 1NNDA 3KLIA 4NLQA 2R8JA 4RU9A 2WRMA 1HNVA 1LWFA 2OPPB 4Y34A 3IRXB 2VG5B 1S0MA 5J2NB 1C0UB 4ECVA 5EWGA 1HPZB 4RW9A 2BQRA 2BANA 3QIDA 2IC3A 2XCPA 1YVFA 5L1LA 3C6UA 4ZP6A 5KFRA 4URGA 2HNZB 4B3OB 2HNDA 1MU2A 2FVSA 3IRXA 2ZE2A 3DRRB 1TVRA 1I6JA 2YNFA 3KLVA 4RNMA 4TYBA 3DOKA 2YNHB 4NCGB 3MR6A 3GQCA 4ED2A 1ZTTA 3NGDA 1ZTWA 4F50A 1J5OA 3SFUA 4Y2CA 3DYAB 1VRTA 3BSOA 1SV5B 4O3RA 3IS9A 1RT5A 4KBIA 3T5HA 3KLGB 4MH8A 1T94A 4QWDA 1DTTB 5DLGA 3MFIA 3IG1A 3SFGA 3HVTB 4WYWA 3CJ2A 5KG5A 5F8HA 1EP4A 1N56A 5KG0A 3DYAA 4IDKB 3RBEA 1SV5A 4ED6A 3MFHA 1S4FA 1SH0A 3NAHA 4IH5A 4LQ9A 4NLXA 3QIPB 2D3UA 1D1UA 3G6VA 1S9GA 3HVTA 3H5XA 5I42B 4ZVGA 2HMIA 4TXSA 2RKIB 1S1TA 4EO8A 1REVB 4F4ZA 3D5MA 3DI6B 3KLHA 1K1SA 5C25B 3DRPB 3MF5A 3CJ5A 1RDRA 4F4YA 4QWAA 5KG6A 2WCXA 1GX6A 1TL1B 3QIPA 4TQRA 4YQWA 3TAMA 4FS2A 5DG9A 2WK4A 3OL6A 1JLGA 3DRSB 1QAIA 1FKOB 4H4OA 3PW0A 1VRUA 4IFYB 4RW4B 1DTQA 5KT4A 3DI6A 4I7FB 2R8IA 4ECXA 2D3ZA 4NLTA 3CO9A 2XWYA 3Q8SB 3VQSA 5KT2A 1LW2A 1T05B 3CJ0A 3CWJA 5EWFA 2OH2A 3ISND 3Q8RB 3V81B 3KHRA 2YNGB 2ZD1A 3EZUA 3QGGA 3DRSA 3OSNA 1FKOA 1HMVB 1JIHA 3KK1B 3JYTB 5KFJA 1KHVA 2UUWA 3V4IA 4KV8A 4NLOA 2FVPA 2HNYB 3G6YA 1TKZA 1T05A 4NLUA 4WZMA 1RT6A 4EBEA 3NBPA 3V81A 1HYSB 3UDLA 1JLFA 3FSIA 1S10A 1HMVA 2W7PA 2UVWA 4DL5A 1T03B 3T5LA 3JYTA 1JLQA 4R8UB 3DLEB 3V6HA 4IQXA 3BQ0A 2HNYA 3KOAA 1C2PA 1N5YB 3FFIA 4LSNB 4M94A 2IA6A 4MK9A 2J6SA 5KT5A 5F8MA 4DL6A 4JV1A 4NZ0A 2W9AA 3LANA 4J9PA 2WOMB 2W8LA 4G3IA 2R2UA 3I5AA 1KLMB 2CKWA 4YMEA 2V4QA 3GV8B 1N5YA 4LSNA 2FJXA 5K14B 3LP0B 3KJVB 2W9CA 2AU0A 4TY9A 4FBUA 4I2PB 2WONA 1XR7A 1S97A 2GIRA 3V6KA 1EETB 1N6QA 2IM1A 3CIZA 1T3NA 4R5PA 3I0RB 2XGPA 1XR6A 1KLMA 5J2MB 1TV6A 1JLEA 1RTDB 3FDSA 1LWCB 3C6TB 4YR3A 3KJVA 1W25A 2W9BA 4DG1A 1IKVA 4GC7A 1JX4A 3KK3B 4ECYA 1OS5A 1C0TB 4WFZA 1RT7B 3BJYA 5HP1B 3DLKA 5I3UA 3IGVA 3I0RA 1IKXB 5CYMB 1N4LA 5KFKA 2UVRA 1LW0B 2VG7A 5J2MA 4DEZA 3C6TA 1RTHB 4EO6A 1S48A 1JLAB 3KK3A
chains in the Genus database with same CATH superfamily
1RHKB 3UN3A 2Y8YA 1NSKL 4IRKA 1BUXA 1TL3B 4XPCA 1DLOB 5DQHA 3Q8UA 5D6GA 2KRRA 4J37A 1RZMA 4DR4J 1U26A 4M5GA 2XY7A 2KKHA 5LMUJ 4ZA1A 4YY3F 4A8YA 4ZCKA 3JSRA 4J9RA 4KR0B 4ES1A 4EBCA 2DISA 3MM9B 2UUAJ 4H4MB 2CPDA 3W63A 3D1QA 2GJIA 2BEFA 2O1PA 4LJMA 4HI2A 1X4HA 1UPMB 2R7OA 2VJVA 1YWXA 3S01A 2QV6A 3ZZ0A 1NPRA 4Q0BB 4NYPA 3J7A1 2J9EA 3W8GA 2ZBPA 4X66J 5HMWA 3SMZA 2L41A 4I7FA 2C2ZB 4OX8A 1V3SA 3KNAA 2XMWA 3CTRA 2QL7B 1G7CB 3KK1A 3V6JA 3G87A 3LP1A 1KC8T 1XK8A 3EICA 4B3RF 3MPYA 2RF2B 2DNZA 3FQLA 3DLEA 2V4JA 3OR1B 1GXTA 2YKMB 4PWWA 1R8HA 4CLSA 2OTLS 5K14A 4WKYA 3FBBA 2XZTB 5GMDA 1K8AT 2DRDA 5IXUA 2HGLA 1XQIA 2AT1B 2ASLA 1IKXA 1HWKA 5GADI 4HH1A 1WSRA 4LR9A 2IVYA 1MWYA 1NZAA 1U1OA 3TANA 1SL1A 2C42A 1PC5A 4LBHA 3NGRA 1PBAA 4NI2A 2L9DA 2V4RA 4F3QA 3PCOB 3SQGA 2LP4A 4RNFA 1ROFA 2FLNA 3B4MA 1HQ2A 4LVOP 4TY8B 1MN9A 4X4VA 1RT5B 3ET6B 1FD2A 2D7SA 3QT7A 2VHGA 3RBDA 4ER8A 3E01A 5KFIA 5LJ5Y 2V8DA 2UV8G 4CLPA 3UFCX 4CH7A 3C14A 2IDLA 3RUBL 1WNEA 1RWNB 4PYAA 1LFPA 4O0IA 2A10A 3GILA 2ZWPA 1HI8A 1FFGB 3CMAS 5EUHA 1U8WA 3PW7A 1RYRA 4MYUA 3HHKA 5KFVA 3OXLA 2JNJA 1RHJB 2I0XA 1W7WA 2IJFA 2VBXA 2QL9B 3WX8A 3GIJA 4UOHA 2BQUA 4WF9Q 1S4EA 3MPUB 3CJQA 2CPYA 3L09A 2POKA 2QA4S 3CJ3A 3PY8A 2LQ9A 3MUMP 2J6UA 3EX7B 5KFPA 1GK8A 2AMCB 2FLPA 3DGPB 2QFIA 3DU5A 5KG3A 1IBMJ 1N0VC 1K9MT 2IYGA 2OMLA 3KDNA 2WVDA 2IAJA 3MM7A 5H9EJ 5A8WA 2JHEA 1UA0A 2KYXA 4RU9A 1DQAA 2J7UA 1GEHA 5D0EA 1WG5A 5KFRA 1LEOA 1VHFA 1IBKF 2Y1IA 3HP6A 4I1TA 1F5AA 2RRAA 4IO9Q 4MH8A 2ZM6F 3QWPA 1FKAF 3FUYA 2CJYB 4OJ3A 1JJHA 4IH5A 2UUBJ 3O8WA 2HMIA 3DI6B 1LXJA 2M8DB 2HS0A 1WI8A 3TAMA 2QT7A 5ETRA 1FERA 2DGOA 3AD7C 3OFGA 3QGGA 3RU0A 5GAHU 4QYZK 3THTA 2BW7A 1KHVA 1FDAA 2BYCA 4FVMA 1ZM3A 2MQQA 3V81A 1PAEX 3TARA 1S99A 1T03B 2DBBA 5FLXY 4AL7A 2BOAA 2MQ8A 2R42A 3EWGA 2A6MA 2JFDA 4YDDB 4J9VA 2OSQA 1Y5IB 3HFKA 4JI5J 4LUBA 4LSZB 1GMWD 2LFVA 4X4NA 2YH1A 3M2RA 1FE0A 1F5CA 4DSLA 1FO1A 4JI3F 1VHIA 2HBYB 2MGZA 2DGXA 4BCAA 1WHXA 1Y0HA 3D0HE 4O44A 1B64A 4DFMA 2WAQD 3R2DJ 3M8PB 2EWHA 1H2VZ 3QO9B 4J9NA 1HWJA 3PJ9A 2IM0A 4IYQA 4CLYA 5A0YA 4BWJA 2NZ4A 1LQ9A 2FZGB 5D0HA 2KFZA 3AY0A 1N5TA 2KRBA 4A4JA 3NKYA 4KHPJ 2HWTA 4JI1F 2VFVA 2Y0SD 1VLYA 1QVFR 4ILMA 4LQ3A 2OEKA 1YJ7A 2YVSA 1TK5A 1RWOB 4ZN1A 1WHVA 1ZM4A 2BKNA 3IAM9 3VAKA 4IFYA 4WFNQ 2CPIA 3W1YC 1IJEB 4CM0A 3Q24A 2ZDPA 1RT2B 4OYBA 3PIOQ 3UR3C 3DXSX 1LWEA 3LALA 2XLJA 3LW5C 3NAIA 4C4WA 4DQRA 2LLZA 1WC6A 2FHOB 5DZ6A 3FEZA 4WFYA 3F73A 1Y3JA 5KFXA 1BE4A 2XZDB 2W2QP 2FJAB 4DV1F 3GR1A 2PMHA 2D41A 3MM8B 4LF2A 2G4BA 2J7KA 1OPZA 4LT6A 4NRUA 4OZLA 1AA1B 3JTNA 4EGLA 3SI8A 3FRZA 5CCLA 2WSEC 1AFJA 4QQBA 5CXTA 5IT9U 3KHHA 4LF6F 1FJGJ 1RTHA 1UEUA 3CC7S 3T1AA 5HJYA 1RT1B 1TL3A 5A6WA 1J5EJ 1DLOA 4DR5F 2ZWOA 3GE9A 4K4VA 2PC6A 1YSJA 3D2WA 3M30B 1M5VC 2MEWA 3FVYA 2AGQA 3BPDA 2X1AA 4S0MA 1XMOJ 1R31A 2IM2A 1EKRA 3TWZA 2FC9A 3M8YA 3ENWA 5HMXA 3R7SB 1YKWA 4NYZA 1FRLA 3M6UA 5HSPA 4QWBA 1NB2A 2QMUB 2WZ1A 4H4MA 3T6BA 3ENAA 2GAGC 5CH7B 1ZA2B 7FDRA 1ZZFA 4O3SA 1F9FA 3T9ZA 4Q0BA 1VRUB 3PYEA 1SI9A 1CBKA 4J9SA 1FJCA 2HKEA 2E5HA 3DCAA 1WC0A 3MMAB 1JLFB 2Q3PA 4Y2AA 3MMBB 1GMUA 3G8SA 1NH7A 2RF2A 3HFVA 3BO3A 2E7WA 4J91A 2NUHA 2DHXA 2XNRA 1ZPWX 2BBEA 1QJHA 3WQPA 2VBZA 2HQ3A 4K4YA 2V34A 3DLGA 3N79A 4G65A 3IR5B 2AP6A 3U7JA 1K73T 4ECWA 2CJXB 3FRYA 2O01C 2MY8A 2B43A 1YJ9S 4OMFG 1XMBA 2A2DA 4NXNJ 1BWVA 4DQSA 3I32A 1N5QA 1U1LA 3A3PB 4NMXA 3C6UA 3NGSA 1H3DA 3TUZC 5E3CA 1VC0A 2YY3A 4CLKA 2XLIA 4IOAQ 3NOGA 1ZTTA 4Y2CA 1WELA 1RT5A 3ET6A 1RUSA 1I5OB 2CNNB 3SFGA 3DLLQ 3PO5A 3MUTP 1QTMA 5CABA 2GJ2A 4R0JA 2K8GA 2HHXA 3RAMA 1RDRA 4FS2A 2V2KA 2CJAA 1HMVB 4DV0J 5KFJA 3KUEA 4WZMA 2ACYA 3PYGA 3HHLC 2QMWA 2XWXA 3IM9A 4DV3F 2HNYA 1VK3A 2C1EB 4MK9A 4DX5A 4NCBA 5A2QY 2V4QA 1WSVA 4TY9A 1B0TA 4P7VA 3AJDA 4KTQA 3M7VA 1VMBA 5J2MA 2ZBQA 4HACA 2AZ1A 4PZVA 2C2KB 2DNMA 1U48A 2GHPA 5I4MA 3ZZPA 4RW7B 1AB8A 2HBQB 2HFZA 1RAEB 2MKJA 3TJ8A 2A2CA 3HZGA 3T5KA 4HI1A 1UL3A 3BBFA 1BD6A 2K3IA 1S79A 4CH1A 2V8VA 3CCJS 3FZ2A 1NRKA 4QZVB 3TVKA 1RCXB 4LF8F 2R3VA 3L7UA 4J9KA 3MAQA 4WU2A 4U96A 1GFWB 3OXFA 5LMNF 1YIJS 3RR8A 1VQ7S 2BMBA 4YR0A 1X8DA 4RW6B 1CSJA 2JLFA 3QWUA 5DGAA 1O51A 3UDVA 1U8SA 4Q44A 4J9LA 4GVLA 1G4CA 1RBOB 5FDLB 1C4CA 4QCLA 3DM2A 3DNCA 2E5JA 4KHMA 3GB0A 4W92B 1B99A 4U7UD 2BJDA 4LF1A 3OTEA 1NJXA 3CMQA 2I2YA 3A8KA 4O4GB 2CQBA 2B8QA 5HL7Q 4PXDA 1T03A 3HKWA 3LGMA 3AA8A 2E44A 4K4SA 2NR0A 4C7QA 3L3CA 1BLUA 2VQFF 2B0GA 1R27B 1VC5A 1S6PB 3VAIA 1PC4A 3V6DB 2KU7A 1R0AB 2E5LJ 1OMSA 3A8EA 4DUTA 3TI0A 1RXOB 4QW8A 2CJKA 4ED7A 4Q2MA 3GG1A 2UXDF 3T1YF 2BJ7A 3FSYA 2MSSA 2PA8D 2DXFA 2R7QA 3DOLA 1EIYB 3S6EA 3QO9A 3CUNA 2OEMA 1XNQF 2XCAA 5MAOA 3HHDA 4OX9J 4HVZA 1PYSB 1TU0B 1BHNA 4O3QA 1XTZA 4M63A 3HFZB 1GT8A 5HQMA 3U1NA 4OHXA 4NRTA 4RR5A 5KFWA 4FF4A 1S1TB 4LFAJ 3UCZP 1CJKB 1NHUA 3CCWA 4O4RA 2DR7A 3EUNA 2RHQB 1DTQB 1T9XA 1HBOB 3ZFVA 3GSDA 4DL4A 3GV5B 3CT9A 3RTVA 1KWMA 4QPXA 4NYOA 4NLPA 3AODA 1UW9A 3HJFA 1O8BA 4IRDA 1NK5A 3QAUA 4QR1A 5HQ8A 1N88A 4RKUC 4OI0A 1S7HA 4M5IA 1Q82T 1VBYA 1WF0A 2UZAA 2IBOA 4M5NA 1H7WA 4DV7F 1KR4A 4IH7A 5GAEU 3W61A 1RA7A 2DHSA 2GVDB 4TNOA 2DHAA 4MMOA 3U1MA 3PV8A 2GQ2A 2HW3A 1FVSA 4QIEA 2XZWA 5DG7A 1ZBTA 3Q8QB 2YX7A 3TP2A 2O67A 5D15A 3E8OA 1IKYB 2JSXA 2X7IA 2VG5B 5J2NB 5EWGA 3M30A 3VZIA 4CIOA 1TMJA 2VKRA 2MKYA 2BJEA 2IMOA 4OZNA 3GFZA 4O3RA 1ICEB 1JK9B 1V3RA 1HWLA 3PHTA 3RBEA 1SH0A 1RLCL 2NXEA 5AE3A 1GNKA 2HVZA 5H9FK 3A8IA 2ZHAA 3THPA 1VRUA 2CUYA 4ECXA 1UP1A 3W9IA 4AYBD 4LF7J 3M1VA 5KTQA 3Q8SB 3MCNA 4DV6J 3CWJA 1HR0J 2HQGA 3DRSA 5JVGQ 3NGKA 1X4AA 2B4OA 3F44A 4DLEA 1T02A 4ZN3A 4X4TA 3UDLA 1JLFA 2ZVSA 1S10A 3KUGA 3NNAA 4DL5A 1NPKA 2GQQA 3RRGA 1N5YB 6AT1B 5KT5A 3OTBA 2DNGA 4N77A 2W9AA 3P49B 2WOMB 1MMDA 1BXNA 5ADZA 2Z30B 3KJVB 1ZZNA 2AU0A 1NB7A 2GGPA 4J9UE 2N3LA 3SDEA 3K5PA 1YRUA 4K0KF 1RTDB 3C6TB 1AZSB 4RBTA 3MM6B 4OHZA 3I0RA 1T9WA 1LW0B 4DEZA 4JI6F 4PXBA 2G1HA 1KD1T 1Y5LB 3E51A 4QPTA 5LOQA 3Q8YA 1FDBA 5K8PA 3ZTPA 1P1LA 2CQHA 1S0NA 1URNA 3HLUA 4QU6A 3H5SA 1RLDA 3Q0AA 2DR5A 3CCES 2FLOA 1AW0A 5F3ZA 5D3GB 3QSIA 2JOQA 5F9NA 2V6AA 3X1LB 2C3MA 4KGZB 2MQPA 4U8VA 1NSAA 1B4SA 2BE7D 4Y3CA 1UETA 4OI1A 3H59A 9ATCB 4LF9J 3TR5A 4V1Ak 3M6WA 4ZPVR 2IYIA 4IFVA 1FT8A 1VQOS 3KHLA 2C2DA 2W7AA 3KG1A 3DMJB 4WP9A 2E1MC 5B0FA 3ZTQA 1ITPA 1RT3A 3KUHA 4ECQA 1DARA 2EK1A 5EX0A 2M88A 1OY8A 2ZJPQ 4WK1A 3ISNC 2V2QA 2DVIA 3D1HA 4USWA 5IT9Y 3JQMA 1HNIB 4JP8A 5C7PA 1IWGA 4DQPA 4WP8A 1ZAXA 1AFIA 4DSKA 2FZKB 5KFDA 4WTYA 5RUBA 3B6BA 2IRXA 2B7BB 4B9VA 4BDPA 2XY5A 2LU1A 4PWDA 2MTLA 3MR2A 5LJ3Y 2BJ3A 1M90T 1VBKA 3FMBA 4DF8A 5T41A 1X60A 7AT1B 4DX6A 3J80Y 2BVZA 4RW7A 2CVIA 2MJUA 1QAJA 1QAXA 4DPTA 1SL0A 2FJWA 8AT1B 1XMQF 3RW6A 2V5HG 4DDFA 2MZTA 2YNFB 2RQKA 1URRA 3DOKB 2LEAA 2PE8A 3JAMU 3I56S 4PG4A 1RB0A 2Z0GA 4TLRA 4KH1B 3CW2C 1Y10A 3PYFA 2AGPA 2VFSA 1VBXA 2JVRA 4ZPTR 4RW6A 4JYAJ 3T9NA 2QA1A 1WOPA 3QGIA 3MWBA 3CJRA 2OO4A 1XR5A 1WG4A 4E2FB 3PW5A 3LAKA 2IVMA 5FDLA 4H54A 5DQIA 1SJFA 2OAUA 2XSJB 1ULRA 3NBPB 2XBPA 4UQGA 1KEKA 2F65A 2CQPA 3LTOA 2Z2ZA 3C15B 4NLYA 1QY7A 3P5BP 2MSTA 2NZCA 4ED4A 2ZITA 2DEIA 1VK8A 3VAFA 1N6QB 3LP2A 5H1SV 4YB7A 4YN3B 3D3BJ 2ZH7A 5KFGA 3RB3A 3SZ2A 4DZ6A 1QM9A 1X4EA 3V6DA 4O3OA 3SCIE 2HPUA 4KYZA 4RW8B 3L9ZA 4EWTA 3ZO7A 1HNZJ 2QIFA 2XTJP 2AGOA 2ZHOA 4RUCA 3KJNB 3BSNA 2JJ4D 4AQYJ 1HNVA 5AT1B 2HFNA 3DHWC 4ECVA 2HHQA 3N01A 2EI5A 5L1LA 1K44A 1DRZA 2FVSA 2GHVC 2ZOFA 2OEJA 3KLVA 3AXKA 2SXLA 3TEGA 1ZTWA 5DM7Q 3CD6S 3DYAB 4V19X 2V8GA 1T94A 4QWDA 1P8GA 2KXHA 3MFIA 2YBVA 1UJ4A 4EZ6A 2KZZA 1SJ4P 1JB0C 1RKJA 4EMDA 2XMAA 1WKLA 2X1GA 4WFAQ 1S1TA 4LF5J 1YRXA 4I6AA 2VC0A 2YWWA 4TQRA 1FKOB 3BGFA 5D78A 1DTQA 2FUG9 1DFDA 4DPUA 2OH2A 3Q8RB 1YJWS 3KHRA 2YNGB 3P96A 5DS7A 2E29A 3C16A 2W7PA 1NK6A 4M94A 1TMMA 4DUZF 2DY1A 2W8LA 5AXNA 2UUCF 4OZ5A 1IBLJ 3Q83A 2OD6A 1HW9A 1S97A 1XR6A 1KLMA 3EVOA 2V9KA 3I9ZA 4X4OA 2DB1A 1RT7B 1U2CA 5I3QA 2HAFA 5J2QB 3MD3A 1M1GA 1PJ5A 2ATLA 4YHHJ 2GW8A 2YWKA 5CYQA 2B4VA 2KG0A 3HD2A 1IKYA 5KFTA 3PIPQ 3P6YC 2MMYA 2VG5A 5KFYA 5J2NA 2FHJD 4I0WA 2OGUA 3UD3P 1FEHA 4ECTA 2NPIA 1UZDA 1U0SA 4I2QA 2R2TA 2MZ1A 4UUXA 2G0JA 5KFMA 2WTFA 3CJ4A 3IN5A 2UXCJ 2E1AA 2ZBIA 3HX9A 3KK2A 2F3JA 3K5LA 1WDTA 2CQIA 2G2YA 4Y2MA 2BM0A 3SV4A 5A8KB 3J7YI 1FJEB 2E9ZA 5ETKA 2QJ3A 4KHRA 2DGSA 2R9LA 4KGVB 1DURA 3GZ7A 3POTB 1V6HA 5HLFB 4QYZJ 2ZNZA 4MTPA 4B9LA 2H5IB 4DL3A 1CJVB 3GMGA 1WHWA 3GP9A 4KJIA 1SH3A 2WOMA 5KFUA 4DV2J 1UVLA 1X5PA 4MFBB 1VC6A 2IRYA 3F41A 2QYCA 1RTDA 4ZOSA 2YKNB 1KOOA 3B4DA 1AZSA 4Z37A 3DDKA 1CULB 2CFXA 3RAQA 2RQ4A 2CQ1A 2OFHX 2F9JA 2HS4A 4CLUA 2GA7A 2B8PA 1KQGB 1FESA 4KT0C 3NL0A 5D77A 2DK2A 1FVQA 1VIXA 3IO1A 2ROEA 3OPKA 3BH6B 5C42A 5KT7A 1YLXA 1KONA 2R8KA 5B0GA 2ZE2B 4PKDB 1KQFB 3KJFB 4ZVUB 1F9HA 2YPZA 5D3GA 2X1BA 2MY7A 2EFOA 2RU3A 1CC7A 2CNKB 1EP4B 3OTOF 4WU3A 4WXOA 1WKKA 2HVEA 1OPIA 4KSEB 4QWEA 2QLWA 1T0TV 2ZJQQ 1VBZA 2D3O1 4KO0B 3T5JA 5C5JA 5KFCA 3QQCD 4WBFA 3SSRA 4LR7A 1IWAA 4OYZA 4Y6IA 2QN6B 5KFAA 2W2PP 2XLKA 2XC9A 1JLQB 5B09A 5KFFA 2W2OP 3R7BB 3R5GA 4QWCA 1U1NA 3HCXA 4CNZA 2KT2A 1HNIA 1RE1B 4MAKA 2IA0A 5IQ6A 1QSSA 2N4CA 4DU8A 2MLYA 1S1WA 2A6OA 5AJ3F 1J27A 1KHWA 3KYLA 4LBIA 5D4NA 3JTOA 4LF4J 2RUSA 1X4CA 3T1HJ 3VHQA 3GSIA 1NK8A 1VQNS 2ZZTA 2BDPA 3MMCB 2DNLA 1KOHA 1N36J 2IFXA 4G6VB 1P27B 3CDAA 1QUPA 3D1OA 5ETSA 2W4CA 3IRXB 4USVA 1HPZB 1R0CB 2YH0A 3CC4S 3AXMA 2BZ2A 2YNFA 4X62F 3HHNB 4ZLPA 4RNMA 3DOKA 4CP5A 4F50A 4NMLA 1TUWA 3T5HA 3HO1A 2P5VA 3P8BB 4BS2A 4NCAA 3A12A 3ETOA 4QU7A 4DR4F 4NLXA 2D3UA 2NCKL 2XY6A 2RKIB 1REVB 1GXUA 4NZ7A 1PCAA 5DG9A 3LWMA 2EXUA 3Q22A 4FKYA 2QA4G 2DCUB 3EZUA 2UUAF 3VAMA 5IOLA 4ELVA 2FVPA 3D68A 3G6YA 4H4KC 3NBPA 4DZDA 1PYTA 2EG2A 2HZVA 1YGYA 2OTJS 3NWRA 2R2UA 4X66F 2AHOB 2X51A 2F9DA 1XR7A 2GIRA 3V6KA 1N6QA 2WB1D 3I96A 3TRGA 4ES3A 2KXNB 2P6TA 1R0BG 3WC2A 1H98A 1OS5A 3CCTA 2BOPA 2MYFA 4BC7A 1NPPA 2DNPA 3BGOP 3EGZA 3DDNA 1SIWB 2ZC4A 4WE1B 2E1PA 4A46A 3I55S 2ZKUA 3K59A 3TZZA 2X3GA 1NJWA 4ZP9A 4ZPAA 2F7VA 3RB0A 1QE1B 4R0EA 3LF0A 1NDPA 4OJGA 5J2PB 3KKFA 3TZYA 2WVEA 1B3TA 5J1EB 2AQ4A 3CVKA 3HHLB 1SXLA 5BR8J 2CWKA 1JKHB 3M32B 1E6YB 3OVSA 3FMWA 4UUWA 2FHKA 3AA9A 3CPWR 1PBUA 3CDWA 1CQMA 1T11A 4TU9A 2YNGA 4MKBA 5DDOC 4P2SA 3R8YA 3PKMA 3KLEA 4M5HA 5SUHA 4DWIA 2GMLA 2VQEJ 3SXLA 1QVGR 1VS3A 4IRCA 4NZ6A 2DRBA 1YBUA 2DH9A 2ROPA 2ASDA 4NLVA 5DGBA 4P6QA 3MEGB 4OYOA 2E7XA 1WUUA 4C11B 3U02A 1YX2A 9RUBA 3IWLA 3H25A 2L3MA 3BDEA 2HLUA 1QAYA 4NLDA 1X9WA 3WDOA 3VAJA 4M5MA 5E3PA 3HSZA 2GX8A 4N8OA 2RQMA 1FNMA 2XMUA 5J2QA 2LKZA 3KLIB 3PZPA 2AX1A 1RAFB 4PQUA 1HKAA 3TJAA 4RZRA 4DR1J 1CPZA 1M5HA 3CIMA 4IKAA 1XC9A 4FNHA 1IBMF 2RT3A 1RHQB 4K5RA 3TUIC 1FXRA 1S1VA 1J5OB 3N4WA 5KG1A 3PJXA 2XS5A 3PX4A 2DR6A 4N47A 3K57A 2KZMA 3I6PA 5HK4A 1M5OC 2ZH8A 2ASYA 4ED1A 1EHWA 2ZJRQ 3W8PA 3UR0A 5A8KA 2EFGA 3PR5B 4WPAA 3PRDA 2O5DA 1VQ8S 4RUHA 2XS7A 3PKYA 3POTA 3W64A 2EG1A 2HHHJ 3IFEA 4DR3F 2UUBF 3VGUA 5KFQA 5HLFA 3KG4A 4QIFA 1Q5VA 1FRIA 3ETMA 1CJVA 1UKUA 1Z4UA 3N6MA 1FWKA 1RAIB 1KSPA 2WHOA 3H42A 2J7WA 4C8LA 1FK9B 5HJXA 4PR6A 4ECRA 3DLJA 3DLKB 1CC8A 2FVQA 1HA1A 2PGCA 2VG7B 4DPOA 3BQ2A 1CULA 4U6PA 1SC1B 4WCEQ 4DL7A 2VDIA 1MSWD 2VKZG 2IC3B 1X4DA 5CQGA 1KDNA 5ETLA 1N32J 2BQRA 2FPHX 3G2XA 1X0PA 4B3OB 1RKIA 4G1IA 2DIVA 1TAUA 2A3JA 2ZE2A 5DJBA 2KTQA 4NCGB 5D0RA 2I9SA 4YDXA 2HIQA 1SV5B 1BY9A 2MKSA 2EEYA 2QMXA 4CM2A 1NLKL 5F8HA 1EP4A 1TL7A 3AT1B 4IDKB 3PDNA 3N9UC 1T9UA 4LQ9A 3QIPB 2CQDA 3R27A 2J0QD 3Q86A 1BC6A 3D5MA 4C0BA 1OY6A 4B08A 1TL1B 5IV4A 2AKWB 5L9NA 1NDKA 2IDEA 2H4YB 3CO0P 2HIYA 2QO3A 3EZ5A 1MG7A 1T05B 1YHQS 4ANCA 5A8RB 3ISND 2KM8B 4USJC 5IWAF 2HRUA 3DGVA 3GYGA 4KHPF 3ONQA 4EBEA 1S0VA 3J7AN 1FRHA 3QNWB 1JLQA 1TFYA 2E1RA 2J6SA 2V8PA 2QRRA 4UF4A 1N33J 3DDIA 2J9DA 3D67A 4WJBA 1QTNB 2JL9A 1JX4A 1U49A 2J0SD 4ZVOB 4EI2A 2E5IA 1JLAB 2FHJA 2MKHA 3MAAB 1Y7PA 3MMCA 2O66A 2HQDA 1RTIB 3QT5A 3MGJA 4F2RA 2BRLA 2Q43A 4M95A 3AJ1A 1R8CA 3X3UA 4MKVA 1K0VA 1HPZA 4DHVA 1XWLA 4DL0C 2ERRA 1IR0A 1RT4B 4MKAA 5G0RB 1FJGF 2OJ3A 2GMJA 2F8HA 3H98A 1RTJA 3ITHB 3M2VB 1J5EF 1S6OA 4KPYA 3EPIA 4CT9A 2DR8A 4KC5A 4NWBA 4ZVPB 3VGSA 1HI0P 2FGCA 4X4RA 4GKKJ 4X4PA 4J9OA 1W26A 2YNIA 3B78A 1XMOF 2RKIA 1REVA 1HNWF 2V67A 1IR1A 2I8EA 3W2WB 3MEEB 3QBCA 5H9FJ 3W66A 4DV4J 1TK8A 4M5DB 2NLWA 4HTIA 4LRCA 1NH8A 4OHYA 4FZVA 1FWLA 3CD0A 4ZP7A 1SPBP 1YTYA 3N0VA 2E66A 3AOBA 5LT5A 1YBTA 4FYWB 1S6QB 1BWEA 2XHWA 3HXMA 4NLGA 3C66A 4FS1A 1UAWA 4A8OA 4KY3A 3M05A 2FJDB 2HVIA 4ZK7M 4JI2J 4AL5A 3MM5B 5GMKa 3OHAA 3E3XA 4IR9A 1HARA 1Z2LA 5HVGA 2QG9B 4ZCIA 4A8MP 3K5NA 5L1JA 4C0OC 2H1YA 2DNQA 4K4WA 4QOTA 4P72A 4ZVHA 3EVWA 1Q86T 1TP7A 3PW2A 2BQ3A 3CCQS 1SH2A 2CWXA 2KT5A 2PMWA 3Q2SC 2XI3A 3CXCR 3UPFA 1QE1A 1NSPA 4JI7F 2NSCA 1ZM9A 3CD7A 2QFJA 4DV3J 4NXNF 4X2BA 1JLCA 4HR2A 4M5JA 3HHLA 4GVBB 1JKHA 3M32A 3LA0A 1SKRA 2RB7A 1JLGB 1ACMB 4OI4A 3PVXA 2FTRA 1IN0A 2GV1A 4MT1A 2Z58B 1JMTA 5T7LA 1NHKL 2PD1A 5BJRA 1RT6B 3BSCA 4KIAA 2Z57B 3RRHA 3JTPA 1HIYA 3PJWA 5KFEA 4CYUB 1B0VA 2OKQA 3IC1A 3G6ES 1SUQB 1H0HB 1Y5NB 3HJVA 1PO6A 3KHGA 2B3TB 4DV0F 2DNYA 3MEGA 5B0BA 4QYRA 4K50A 4C11A 4ELUA 2LA4A 4LF8J 4C8YA 1R6VA 3MZIA 4A8XA 4ZPCA 4HDGA 3TYTA 1SC3B 2Q6BA 3S7RA 1PSDA 2U1AA 1QDUB 4B3SJ 4LSLB 3OSPA 1NNDA 3KLIA 2CRLA 3HMJG 4D3HA 4F02A 1B7YB 1S0MA 1CJTB 3FCWA 3PG9A 3R6LB 3NGUA 3V4MA 4TYBA 1JNZB 2GMHA 3HD1A 4E98A 2OIHA 3AFGA 2BV3A 1J5OA 3CNQP 2EBGA 2HEKA 3TAQA 2AD9A 3HSDA 3SEOA 4RUBA 3BGUA 2VPZB 3BYPA 4OHVA 4B3MJ 5HVHA 4F4YA 3VZHA 1AYEA 5IT0A 1U2FA 2ZOMA 1X4GA 4KGMA 1QAIA 1N5VA 3JQKA 2KVQE 3MHYA 2D3ZA 4RBVA 2VQFJ 2PIIA 2XWYA 5JJBA 2BM1A 3IMQJ 3J7YU 1FWPA 3ELHA 4NLOA 1Q1KA 1O5JA 1HYSB 4OV6A 4RPFA 5HO4A 2N7CA 2UXDJ 4JOUA 4DL6A 1KTVA 1NUEA 1SCJB 4YMEA 4LSNA 2FJXA 1M5SA 4DUYF 1NJZA 2XG8A 1V5IB 4F3OA 3FSXA 1LWCB 1H7XA 1GAOA 2RQCA 5HP1B 3DLKA 2VG7A 2ALYB 4CH0S 3BR8A 2BX6A 3PFOA 4JV2A 3WX4A 3BR9A 2K2PA 3UQSA 3H5XA 2F40A 4ID5B 4A48A 1OYDA 3H8YA 4F67A 3JSMB 2VPWB 3QMQA 3HT3A 4O0NA 3OL7A 2FZCB 1EKSA 1YQHA 4B3OA 3QSYB 4GMKA 3N5BA 1VR6A 3HI9A 5AXMA 4NCGA 1TKDA 1MMNA 2GHWA 4OI2A 1U1KA 4IDKA 2CJQA 3UD4P 2Q6CA 5ETPA 1DHMA 2BJ1A 1GX5A 2E1CA 3D54A 5L1IA 4U7UK 4PXEA 4Y00A 4FYDA 2YWFA 4OX9F 1UVIA 4OJ1A 1TL1A 3R6GB 2QLXA 1FRKA 4BC9A 4LIRA 3KDOA 6FDRA 4DFJA 1S9EB 2GC8A 2ZBRA 2HAIA 1BQNA 4ES2A 2M9KA 4TN2A 4DJBA 4LFAF 3AJ2A 3KNGA 4Q8FA 2R4FA 3RJMB 2ZKTA 4FBTA 2Z56B 4B9SA 2JFKA 4M5LA 4ZPBA 2KI2A 2G13A 2HSEB 4DR2J 4WP3A 1GH8A 1R8PA 1FKPB 3GR0A 2DPJA 4NE9C 2VA3A 3IR7B 4CO2A 1XNRF 4OX6A 4E0DA 1JLAA 3I87A 3VQTA 2LXIA 2K1RA 2B56A 3TOQA 2XS2A 1RTIA 5GVQA 2H5JB 4RW9B 5CHCB 4ECUA 4HYKA 2CPZA 2HNDB 3Q8PB 2YKPA 4P2XA 2CYYA 4ECSA 1IXKA 1UWAA 2IVFB 2KG1A 2MJNA 3ZZYA 4EBDA 3TEHB 5G0RA 4HH0A 2WVFA 3RAXA 3IG1B 2CIMA 4IOBA 1NK0A 3ITHA 3ICLA 4O3PA 1RAGB 3M2VA 2LDYA 2I5JB 1D9DA 1N5SA 1FRMA 2EFNA 1WF1A 3P5TL 2DGVA 2VASA 3SSSA 4MJKA 3NY0A 5GAHI 5E41A 5DZ7A 3MAHA 1VQ6S 5HVFA 5D4PA 2DRAA 1RHRB 3M4XA 4B3TJ 1LW2B 2RHSB 4EYIB 2ZD1B 2Y1LB 1SQFA 1RAAB 3MEEA 1VYAA 2CDRB 4M5DA 2FJBB 4IOCQ 3O2IA 4DXLA 1OWXA 3FCHA 2RDDA 3D66A 5DETA 3FBCA 3NLCA 2WBMA 2W9CB 1HBNB 2DCLA 3JQJA 3MI7X 5IS2A 2WONB 4LF7F 1R8BA 1AROP 1S6QA 1WACA 4R5PB 1HR0F 1FHTA 4KB7A 4USIA 3QZ8A 1VQ9S 4PXCA 2IBKA 5F8LA 4E8UA 4K2XA 1X5SA 3MM5A 4LFBJ 4CTAB 4WTOB 3CC2S 1PG5B 2J9CA 2OPQB 2VPYB 2VL1A 5AE2A 3D0GE 2PEHA 2BANB 2VFTA 3OJSA 5ETNA 1X9SA 3TVZA 1B0PA 4Y2IA 2OPPB 2DKOB 1U02A 1RSCA 4G1PA 3ADAC 1KNZA 2Y9HA 4HHUA 1L3UA 2YWHA 2C3UA 2CZ4A 2BW2A 3HSGA 3VALA 1DTTB 2GJFA 1KVJA 1ZAWA 3KWMA 4ZJOA 1S4FA 2V94A 3NAHA 4B9MA 4P52A 3OFEA 3HVTA 2PN6A 4DSFA 1P1TA 3EGWB 1RP5A 3VR1A 1JLGA 2PI5A 5IFMA 3G8QA 3HZEA 5KT2A 3LWLA 3GJTB 3CF5Q 3PO4A 5BYQA 4OX7A 1KFSA 1RT6A 2BKOA 1R3NA 2RD5C 3JYTA 3UNYA 4LF9F 3V6HA 2EW9A 2YKQA 1QLNA 4C8MA 5F8MA 1TFWA 5HQLA 4CYUA 3O5TB 1LKZA 4NOHA 4UOCA 2U2FA 2JZ5A 2LYVA 4DLGA 3EYZA 2ZZNA 5HI7A 3FDSA 3TZXA 3DU6A 2CJ9A 3M8SA 5LXRA 2KL8A 4EO6A 3KK3A 2VPXB 2KXFA 2B51A 2RSQA 1KVIA 1KBRA 3LO3A 2XULA 2DYAA 3P4UB 4JUZA 3QFWA 5ETTA 3A3NB 3OHBA 2C2EA 2VB6A 3R1LA 1QUVA 2RMLA 4JI0J 4LSLA 1NJIT 2J76E 5AXLA 2BABA 4MIAA 1NDCA 4NA2A 1YG0A 4PYDA 1X7VA 2VFUA 2RVJA 1C1CB 1RA6A 3MPDA 1YRTA 2HHPA 4FDFA 3MM9A 4FYXB 2ADCA 3QRRA 1U6FA 3T19A 3QFHA 2F4VJ 2RDJA 1B70B 3TUJC 2LXFA 2XO7A 5HBMB 1YZ6A 2C2OB 3LP1B 4Y0FA 2KYZA 4O3NA 2VA2A 2AEJA 3GV7B 3HULA 2DJWA 2JC0A 5GAGI 3MTKA 1XBWA 4JYAF 1HYSA 4Q8EA 3W60A 1UWBB 4JV0A 2DO4A 4I64A 2C3OA 3I0SB 4L72B 4MYTA 4ZHRB 3UO0A 2EKNA 1CG2A 3H20A 5LSLA 3OR1A 2YKMA 3UVJB 1HQUB 1LWCA 5G4DA 5M2UA 3RBXA 2GQCA 4RNNA 3ZZOA 2Q1LA 5FLXU 5HP1A 1M1HA 4QBUA 3DLHA 2AYGA 3OTDA 1DY3A 3K2YA 3J81Y 4NI2B 2MDAA 4QIVA 2ZH5A 4JV5J 3NCPA 4DCOB 5LM7E 1FX4A 2ZHBA 4LRDA 5KT6A 4HDHA 1Q81T 3T3FA 1VRQC 5I3PA 4QIGA 1AT1B 3FJ2A 2UXBF 1HNZF 4TY8A 2NXNA 4TQSA 3GONA 2BR0A 4AQYF 3D7SB 4OYMA 4CZCA 1JJ4A 2F63A 2UUCJ 4J90A 4FPRA 5E5NA 2K06A 4LREA 4RBUA 1UCNA 4Y2KA 3DKDA 4YB5A 2WW4A 4F4XA 4W98A 2D9PA 1U45A 1S9EA 3ZTOA 3SSQA 2RNEA 4U67Q 3LOUA 4K4XA 4NXMJ 3GG0A 4LRAA 2EPIA 3RRKA 3IR6B 2PMZD 1KFDA 1LOUA 4ZDNA 3B8HA 1UJ6A 3AB2B 3I5CA 3OL9A 4F2SA 1LXNA 3DFEA 2M8HA 4PPDA 3DGPA 3G4SS 2KB2A 2WB4A 3MM7B 1S9FA 1FKPA 4J9MA 4DPWA 3PR4A 3FKBA 4F4KA 3NG8A 4DQQA 3W9JA 2MQNA 2RRBA 1CS4B 1PILA 3DN9A 1TELA 2WBRA 3BYRA 3BSAA 4HL9A 3TW0A 3HM9A 3WC0A 2WRMA 3SV3A 3CJTA 3MD1A 4RW9A 3LGNA 5CZVA 4URGA 1AUSL 2OELA 2HNDA 4OYAA 1VDHA 1VGYA 3Q2TC 3SFUA 3DRYA 4B9NA 1X4FA 4GKJJ 4NASA 3IG1A 5IV3A 4YHHF 4CT8A 3K7RA 5KG5A 3EMTA 1N56A 3DHXA 1R43A 3G6VA 2CDQA 5I42B 3JXOA 2M70A 4CO4A 1HL6A 4TXSA 4L6V3 2IJRA 3GYXB 4U8YA 4DS4A 3OL6A 3MR7A 4RJVA 3DI6A 4W4MA 1L5UA 2JWNA 3CO9A 5CYJA 1LW2A 3V81B 2ZD1A 3OSNA 1NO8A 1RBAA 2UXCF 4L3KA 3FSIA 2F8MA 1X4BA 3GJRB 4ZS6A 4IQXA 2LEPA 2DR9A 2CG4A 3OFFA 2W9CA 4YB6A 1RISA 3VAHA 4I2PB 2WONA 2QEXS 4R5PA 1D9FA 1H2TZ 4JI4J 1W25A 2K3KA 2W2NP 4IQMA 4HT7A 3OW2R 4LR8A 1S57A 4NLWA 3W5XA 4KFBB 1X9MA 4RNOA 2JLEA 1RCOB 2OPQA 2B4UA 3FBFA 5K8OA 4X65J 3BREA 2CZVC 3M8PA 4PABA 2OPPA 5A0YB 2BUNA 2R7XA 4Z7CA 3T6JA 3D4JA 3PHEA 2W4DA 1G2EA 1DTTA 3MURP 3OD2A 1S1UB 4MIWA 1U47A 3GTYX 3QZ7A 3JSYA 2B5JB 3HT0A 2HYIB 2BRKA 1CLFA 3BO4A 3KMQA 4C2MA 2EK6A 1S0OA 4U7CA 2D3OR 2HQCA 1N48A 1LWEB 3WHIA 5KFSA 1VQ4S 5A6PA 2JRSA 4RWXA 1RT2A 2MHEA 4OV1A 4FYYB 4CLLA 5GAEI 3G96A 2FIUA 4IH6A 3KFWX 1NMEB 3M9MB 3R7NB 2KJVA 2CQ2A 3MECB 4PAAA 4TYAA 1Q95G 4G1QB 1RAJA 2GCFA 1EZZB 2X3DA 1VOMA 2KM8C 2P6SA 3DOMB 2OLWA 1LV5A 3MM8A 1N34J 3G86A 3IAS9 5A2QU 1JLBB 5B08A 4ELTA 2IMWP 1HQEB 1DBDA 3PFEA 1HHSA 2XYGB 2R8GA 3D9BA 5L9XA 4CLZA 4HHJA 1RT1A 3CJSA 1VQKS 4B9TA 1MN7A 4ID8A 4LF4F 2UU9J 2AJ4A 4URSA 3T1HF 4XK8C 2BA9A 2MLXA 2NREA 2W1BA 1Z2ZA 3IA0A 2EBEA 4A8WA 5D4OA 3S8SA 4TU7A 2D74B 3A4TA 1N36F 1WC4A 2XMTA 3P3DA 1YJTA 1C1CA 2V69A 3IWNC 4ANEA 1S9GB 4H4KA 1VQLS 1F2GA 4RLEA 2B9XA 1P9YA 1UFKA 3I9V9 1FFWB 1TQLA 4H4OB 3ILJA 5DRKA 1D3WA 1S49A 3N5FA 2H3EB 5HBMA 5BYRA 4DR6J 5JVHQ 1S77D 2B4PA 2GAHC 4DU7A 4UTGA 2HHSA 4I6YA 3C46A 3MMAA 2AWZA 4C3MA 1UWBA 4HKQA 3MMBA 3I0SA 1GMVA 2CVEA 4ZHRA 3BEGB 3DLGB 1JQGA 2EKYA 4ZVFA 4DG1B 2JEGA 2HFOA 4F0HA 3SYZA 3UVJA 5I3UB 3ZC4A 2F5GA 4ZLNA 1Y00A 1HQUA 3LQVA 4FXVA 2NPFA 2L9WA 4X4UA 3WZ0A 4CDIA 2C3YA 4NL5A 4KAIA 1NKBA 5F9LA 2UUTA 7FD1A 1G1XA 3C6UB 2AEMA 4OZ3A 4FKXA 3R5CA 5GADU 5DO2A 2M7SA 3CGIA 2HNZB 4M1KA 3UCGA 2H48B 4WIIA 3BKTA 3L7PA 4HT5A 2GVZB 5F0WA 4ZPWR 2EVZA 3KLGB 4ATNA 2AW0A 2O3DA 3VTIA 3MFHA 4ZVSB 3MCSA 3L7OA 2P9CA 4C3LA 2X1FA 2WSFC 5KG6A 3QJJA 1IUJA 3A1YG 4HTJA 3PW0A 4DS5A 3FNNA 3PRVA 5F3TA 3VQSA 5EWFA 1VCTA 1UA1A 5IM0B 3L4BC 4ZLJA 2HNYB 1F5BA 1HMVA 2UVWA 4QR2A 5BR8F 3T5LA 2LEBA 5B0AA 3AQOA 4F04B 1ZAVA 2EFVA 1I1GA 4JV1A 3LANA 3SCJE 3S1TA 1NAQA 2HS3A 4NA3A 3LP0B 4OHWA 1MWQA 3U1LA 3QRPA 1EETB 5HANA 1V5VA 4IO1A 5J2MB 3AB4B 4HACB 4UOGA 2HZAA 1N0UA 2DITA 4N41A 4OQJA 2XMJA 3VVUA 4K7QA 4PQAA 4EYHB 2RAQA 4OYXA 2VQEF 3UE2A 5E33A 1JXVA 5KFOA 1CS4A 3KMSA 2ASJA 3E2EA 2BJ9A 1A6LA 3H4DA 1RABB 5DDRC 1FJ7A 4K5SA 3OV7A 3R5AA 1RHUB 1S72S 3MEKA 1UW4A 2ZZMA 1GTHA 1RWXB 5K20B 3D6FB 3A8JA 4RU2A 4DR3J 1ZH5A 1TAQA 3LPEA 1T8EA 2G1DA 3UCUP 3EXYA 4DR1F 3BN7A 2D9OA 5I42A 3DM2B 2AYEA 2JX2A 2N3OA 1BQMB 2XO6A 2R2SA 4JI8J 4X64J 3VGTA 1F1BB 3HF5A 1FNXH 3H2LA 4YFUA 3BZQA 4P71A 5ITHA 4DFKA 2Y3YA 3KJQB 2DNKA 3GU0A 1YBAA 1S59A 4O4GA 3SQOP 1KQKA 2JEFA 2HRTA 2GIQA 1GXLA 2OFGX 2VF3A 4I2PA 1RU1A 5M2RA 1WI6A 4U9RA 2NS1B 4UZCA 1NCLA 2HHHF 3JS9A 1OIAA 2AF6A 1XEZA 1S6PA 1R8AA 1SVDA 2HLTA 1R0AA 4YP3A 3M9NB 3FEXB 1TTHB 3CULA 3IGNA 4KFBA 3DOLB 3F0NA 3TVYA 2B9EA 2ZUAA 4N76A 1D8YA 5EDWA 3OLAA 1CEZA 3BH7B 4DSEA 4F4ZA 3MUVP 1CVJA 4PRFA 2DNNA 5AXKA 1X31C 4YUDA 1F0XA 5BXIA 2R7UA 1FTRA 5IWAJ 2PFDA 4DN9A 5KFBA 3M8ZA 1MMLA 5AE1A 4USMA 3G8TA 2HGNA 1S1UA 1Q0NA 1VI7A 3OXGA 1N32F 4GO5X 3DRXA 2B5JA 1X5OA 3W5ZA 1HHTP 4ZIVA 1CJKA 4OIXA 3HPOA 2JEJA 5L39A 4K2JA 3ISZA 1HBOA 2D1CA 3QJPA 4QR0A 3N6NA 2PFFB 2R7TA 5DLFA 1ZETA 1PIEA 1D9AA 1NEEA 3NRBA 3FFIB 2ZH4A 1HNXF 2QSWA 5KG4A 1YZ7A 2FGOA 2HQFA 4CLTA 2PEBA 4XAKA 2W9BB 2FY1A 2FB0A 4UY85 3MECA 5MLCV 4G1QA 5GMEA 4KQZA 5IC4B 3DOMA 1WC3A 2ZH2A 4EEYA 1JLBA 4FF3A 4HLBA 1YJVA 2GVDA 3US5A 2MKKA 1HQEA 2HVDA 1N33F 4UT4A 1N52B 1XERA 1NKEA 1HNWJ 3ILLA 2CAJA 1WOSA 1I6JA 1H74A 3J80U 1U1QA 4F7VA 3UN2A 2YNHB 3OVAA 4LFCF 2D69A 4BBYA 1MROB 1Z1ZA 1FI4A 4KBIA 5DLGA 1TUVA 4CWBA 1HWUA 3CB4A 3R97A 2QSFA 5KAKA 1S9GA 2CQ4A 1KRPA 2ABYA 3M1VB 1JJCB 1Y4ZB 3THVA 4ZCLA 3OUYB 2IIHA 2MB0B 3DRSB 4H4OA 2I38A 4PCQA 1NZ8A 2IPOB 3R5BA 1UZHA 1F9EB 4XDDA 4USUA 4DV5F 1GTEA 1V9OA 4GKKF 5CAAA 5B7WA 4R8UB 2BE9B 3MCMA 3ZTSA 5GAGU 2GGPB 3SDEB 1I94F 1YI2S 2PO4A 4LRBA 1N5YA 4DPXA 4QJVA 4FBUA 4DR7J 2OP5A 4DV4F 2IM1A 1HI1A 3I0RB 3IBCB 1L3TA 3KJVA 3F56A 3FK4A 4DG1A 4CO1A 2YTCA 4IUFA 2KN4A 4WFZA 2XNQA 1Q7YT 1MLAA 3BJYA 1FX2A 1R7IA 5I3UA 5CYMB 1N4LA 1M1KT 3C6TA 4JI7J 2ZC3A 1H73A 3MM6A 3KG0A 1LW0A 2B9YA 3MEDB 1O6XA 2ALZA 3C19A 3KLFB 2GS8A 4OYIA 3C8YA 2I1RA 2C22A 1FCAA 3KXDA 2HFSA 1Y9OA 4JI2F 2HNZA 3MDFA 2M52A 4KGKA 4CCHA 2DIUA 4DBQA 2GVZA 2WVCA 2DXDA 2VONA 4ZLLA 3KLGA 3CSKA 2NYIA 3BO2A 2J8AA 3CDBA 5ETVA 5D8HB 1BMQB 2DGWA 5JMNA 4IFVB 4AD6A 2R7WA 4IG3B 5IC6B 4JB8B 1RJJA 1RT3B 3AQPA 3SIPB 1RQ0A 2F1FA 5HAOA 3W7BA 5CCMA 5IM0A 2R8HA 1K0TA 3NXZA 3DMJA 3K17A 3HHLD 4MIBA 2VICA 1WD6A 4F0KA 5F8GA 2UP1A 1FRJA 3CCVS 2Y0BB 1FNOA 2LQBA 4ITSA 3LP0A 2JC1A 4K4TA 4PWDB 3TJ9A 4N8NA 1EETA 4A8QA 2MZRA 3GIKA 4YY3J 1VQYA 1Q8IA 2NUUG 5L1KA 5IQQA 2WVBA 4NLSA 1RADB 4OZ2A 4FXWA 1FXDA 3M8QB 4B02A 4ICLB 3IRWP 1FEEA 3H5YA 3M8WA 4OI6A 3ZNUA 5CD4H 3HVAA 1ZPVA 1MU2B 1TVRB 2DGUA 1YJNS 3FGVA 1VRTB 2CPHA 3LPYA 1UTAA 5DG8A 2QZ8A 2J9DE 4CRJA 4Q45A 2V9WA 1EARA 1IQTA 4B3SF 5L46A 2UV8A 5J1PA 3D0IE 1Y11A 3MTJA 3ZTRA 4B3RJ 1U1PA 1X5TA 1TL4A 5LMUF 3MR5A 4DUYJ 4EFAC 2IJNA 4ILLA 1BQMA 2VJUA 2DD8S 1MW7A 3HK2A 3GWCA 1XIQA 5HMYA 2EC0A 2XSJA 1J2VA 2ZBCA 3NCQA 1N8RT 5E7OB 5LSRA 2FVRA 3LP2B 4B3MF 1D0EA 1RWUA 2XSFA 4OYPA 1SBRA 3C15A 4TU8A 1WC1A 2FC8A 3PYDA 4QW9A 1TV6B 3BBBA 1YJRA 4DL2A 4RUAA 1IKVB 4P75A 1E6VB 2CQCA 3N6LA 1L3SA 2A18A 5F8IA 4F36A 3BGRB 4ZVQB 3EJMA 4Q2LA 5A76A 1HNVB 1S7IA 4RW8A 2N7YA 1UVJA 4Y34A 2AJ0A 5K9FA 2DEJA 1C0UB 4UY8T 3QATA 1DQ8A 1LK5A 1YVFA 4X4SA 1RWPB 4A8KA 3UW1A 3DRRB 2Z2MA 1BGXT 1KTQA 5ETQA 3BSOA 1FF2A 2DTJA 3CJ2A 3AD8C 4Z7YA 2J0XA 4GRSA 5KG0A 3DYAA 3JB9k 1VISA 1LNQA 2M2BA 1KS2A 4ED6A 1LK7A 2L9NA 2VU5A 2HQIA 1ZS6A 1NXIA 2OHDA 1UFLA 2VH7A 4C9DA 2W4PA 2C2NA 4DOZA 1TL5A 3CCMS 1FFSB 2Z2LA 2R8IA 3LGHA 4J5OA 3NCRA 3UWTA 4K8RA 2AJ1A 3C16B 1FKOA 4ETZA 1JNRB 2NSBA 3PXGa 1XNRJ 3RR7A 5E3QA 3MCOA 3TO8A 2VOPA 5EN1A 3FFIA 3GCXP 3W5YA 4FP9A 4C8NA 3I5AA 1WG1A 1KLMB 3EGNA 3J7Z5 2YXLA 3NNHA 2Q66A 1T3NA 2XGPA 4FNIA 2W9BA 2YPYA 4GC7A 2LXUA 3PACA 1C0TB 3IGVA 1H38A 1IBKJ 3OBIA 3OQ2A 1S48A 1RACB 1RT7A 1S1XB 4WKRA 5CYQB 1QSYA 4K59A 2ZM6J 1S6UA 3JAMY 1U1MA 4ALZA 3CCLS 3RG6A 2JH3A 4USTA 2CADA 4DR2F 5F0UA 1FD8A 4I2QB 2HVHA 3UDEA 4TLQA 3LAMA 1G3OA 5J1NA 2GFFA 2YNHA 4AL6A 2J8SA 1MROA 2MKIA 3KK2B 1OSDA 4XO0A 2VG6B 3C3LA 4IG0B 4PEOA 1NM2A 1RHMB 4L73A 3I4HX 1JXEA 1WJ9A 4OYWA 2HHUA 3VAGA 2J5AA 3OUYA 2MXYA 3DXBA 3K8VA 3NNCA 3BKUA 2GNKA 2DH7A 3I5BA 2HWIA 4LMZA 3QT6A 4B9UA 1C1BB 4F4AA 4RX6A 2VC1A 4J7CA 1H2UX 1GMWA 1U4BA 4JI3J 4DCJB 2NYHA 1OQ6A 1OQ3A 1SKUB 1PYOB 2XYPB 4R8UA 3VWSA 2DGTA 3A3OB 4DSJA 3R1HA 3BBCA 3G6XA 5KFLA 4B3TF 2AV5A 1SQEA 3GIRA 1PJ6A 4ZVEA 4ZPDA 5KFNA 1UPPA 4F0MA 3QAEA 4MFBA 5HN0A 1F3FA 5DDQC 5CYMA 2YKNA 2LCWA 2ILYA 3W9HA 3QGPA 1F2HA 4LIWA 2DHHA 2JEIA 4F3MA 3D6HB 2KHDA 2MPUA 1HBMB 1YITS 3MEDA 5C42B 4JI1J 3KLFA 1VJWA 2AZ3A 1Q7LB 4JI5F 2DGQA 2OI2A 2HGMA 4LFBF 5KFZA 2VV5A 2XI2A 3RYLA 2XHCA 2ZNYA 4DMZA 3M9OB 1F6TA 2RS8A 2R2RA 3LH2S 5ETOA 4UZBA 2A0FB 3BV8A 3BKFA 3ZZTA 2C2MB 1WHYA 3KLHB 4F4WA 3VCDA 2DY9A 4GO7X 2E9TA 1RWVB 4IG3A 1HLWA 4F25A 4XIUA 4KO0A 2M0GB 3RB6A 4DV1J 3OTCA 2Q79A 3GIIA 1Q8KA 2PSZA 3GFHA 1Q78A 1XJWB 1UMJA 3R3TA 3FQKA 3PW4A 1D8ZA 4LF6J 1VQMS 3L95X 1S1WB 2CPXA 1T9TA 2H9ZA 2A1BA 2XYHB 4DR5J 2ZH6A 1W2BR 1IBCB 4RWWA 1U6ZA 1PGZA 1SKSA 2AX0A 2CNLB 2FYXA 4I67A 1VQPS 2APOA 3ENQA 4OJHA 3R9LA 3K58A 3U27A 2XM3A 3ZZUA 1T95A 4EK2A 2MQLA 3NEKA 1NK7A 3NGTA 2CPEA 4C8OA 4K4ZA 1F3VA 4KKOB 5E2QA 3GJQB 3M8QA 4PG5A 1TKXB 4ICLA 3QLHB 2G9OA 3HHEA 1CJUB 2DNRA 1SJQA 3QIDA 4ZP6A 1D09B 2CPJA 4U95A 3H90A 1MU2A 3IRXA 1TVRA 2AJFE 2Z4PA 1LWXA 3K5MA 1S12A 4I6WA 3GQCA 3MR6A 4ED2A 3NGDA 3PEJA 1VRTA 3MXHP 4I69A 4C97A 4JI0F 1U6BA 3Q23A 2GO8A 1Q8LA 4ZVGA 1MNEA 1TUGB 3M6VA 3K0JA 3HDSA 4CLFA 2MZJA 2W24A 2WK4A 2FY8A 4RW4B 1K47A 5KT4A 4FN5A 4YS2A 4CO5A 3W2VB 3H2VE 2UUWA 4P74A 3BM7A 4I4BA 4PG7A 2MQMA 2F4VF 3A13A 4J9PA 1I3OB 1W2IA 1KP6A 5FIIA 2QYGA 2MZSA 1HHQA 1Y3KA 3WIVA 1TV6A 3OVBA 1IKVA 1WTFA 3IBFB 3W65A 4FXDA 3C2PA 1R6YA 2EFPA 1S76D 2XMKA 2HK3A 2P9GA 1E6VA 4P9SA 2FHMA 2HHWA 2UXBJ 2OPRB 1IKWB 4P10A 3TA2A 2RS2A 3BGRA 2RH3A 1IVZA 3K89A 1CQNA 3J7ZT 4YOEA 6FD1A 1Q79A 3PNIA 1FA0A 2FJVA 1C0UA 3M8RA 4WE1A 4CNYA 2L08A 2AJQA 3DRRA 5E3AA 2XMMA 4USHA 4M5KA 1QSLA 3TNVA 4RNHA 4UW2A 1GQEA 4NX9A 3ILIA 4WFBQ 2QA2A 4YR2A 4JV5F 3JSBA 4BLGA 5J2PA 4A8SA 1Q53A 4C8KA 4DPYA 1SL2A 2KHCA 2N82B 4ED5A 2ZUGA 5J1EA 1H72C 2VDHA 5T14A 1MWZA 1E6YA 1HFEL 2QGFB 2AYMA 3HSJA 1U25A 3KLEB 2F8EX 2BXJA 3DLBA 2H4WB 1HD0A 3QRQA 5CA5A 2NXUA 2ZH9A 1HBUB 4CLWA 1VQSA 3IWXA 3EDRB 2J6TA 4KRWA 2K7JA 4JBCA 3EPGA 1T3OA 4ZJLA 4OZ0A 5E3RA 4A47A 2LQ5A 2QLJB 2Z2YB 1RWMB 3BDPA 2YX4A 4M8LA 1DAXA 5F41A 1C0TA 2P2CB 1WORA 2XEXA 2W25A 4NXMF 3QGHA 5H9EK 4WYLA 2P8IA 2FVCA 5DQGA 4PQUB 3ZNJ1 2HG4A 3PEHA 1S1XA 5EGYA 2M5YA 4ZITA 2HZCA 4N7TA 5LMNJ 5DDPC 4OZ1A 5B0EA 1V3ZA 4PG8A 2FJEB 1S1VB 2CQ3A 3IM8A 5JUMA 4X84A 1EAYC 3W62A 1WC5A 2FLLA 4ETXA 1H6KX 4ED0A 2FQQB 3UI3A 5K5MA 1AUDA 2CXEA 2VG6A 4IG0A 3BF4A 2AEFA 3D28A 3SBMA 5K8NA 4DF4A 3QJLA 5IT4A 5HATA 3BGLA 1U0HB 3RZAA 5KG7A 2XGQA 5THWA 3FEYB 2V2VA 4RL1A 2CZ9A 1G6BA 4GKJF 3R2CJ 3NS7B 4KV8B 4AT1B 1TKZB 1C1BA 4F26A 3PX6A 2KVIA 2G2OA 3SCLE 1U7LA 2H54B 3TAPA 1UVNA 3BB5A 2JLGA 3T1YJ 2ZOGA 3BQ1A 1I51B 1NBEB 1P9QC 2FDNA 4AE5A 1XNQJ 3V5RA 1UVKA 2RDIA 1FK9A 2LU2A 1RBLA 5EHHA 5C24B 3RB4A 3NMRA 4N56A 2RJZA 4FVCA 1TKTB 1ELOA 4NLRA 3OL8A 1U09A 1HBMA 2R8JA 4CO3A 3ULHA 4JI4F 8RUCA 1PKUA 2IC3A 5SZTA 2E7VA 1KN6A 3AHPA 2H5EA 2E5LF 4XTTA 4CI0B 1TL7B 1A0OB 2LQ8A 3CD5A 2ZVIA 2YKOA 4B17A 5C2GA 2Y8WA 1SV5A 4RO0A 2OSRA 4X65F 3TUPA 3M2UB 2GO9A 4EO8A 3KLHA 5C25B 3DRPB 3MF5A 3CJ5A 4QWAA 3G9CA 3QIPA 4YQWA 4Q7AA 5D4LA 3VF0B 2ZDOA 4NLTA 4ERDA 3GJSB 4KH0B 3UN5A 3MOZA 3TX8A 4DV7J 1T05A 3B54A 5B0CA 5A8RA 2LECA 2DHGA 2I6WA 3T41A 3GLJA 1P6TA 2IA6A 2Y1RI 4UOFA 1JJ2R 2V63A 3IXQA 4N5SA 4ENOA 1IM6A 2QTWA 3CIZA 2VOOA 2ZH3A 4ZVTB 2PI4A 4ECYA 2V8HA 4C48A 3RGIA 5KFKA 2UVRA 1S5ZA 4BWMA 1RWWB 4ZIWA 3HVWA 1BQXA 3NP5A 4C6AA 1NDLA 4X4QA 1A9NB 4F8RA 4PPZA 2C2RA 3ILOA 4KKOA 2WW8A 3G82B 4PUOB 2GZOA 1L3KA 4YEAA 1TKXA 2C28A 3QLHA 2YX1A 3MAAA 3BS9A 1WEZA 1CJUA 2QE5A 3CCRS 2ATCB 2FD2A 1RTJB 3W3SA 2HBZB 1N34F 4EZ9A 4OFZA 5BYSA 1RT4A 2B6AB 2W8KA 3K5OA 2BKPA 2YNIB 3NS6A 2NQPA 3CEDA 1EQMA 1LFWA 4Q5VA 1SQGA 5HROB 2RE1A 2UU9F 1UVMA 1EB0A 3D3CJ 1M5PC 2Y1JA 2K7KA 2RRNA 4FF2A 1FTCA 1RU2A 1WOOA 3ZZRA 4RW4A 1YK9A 1RWKB 3QPIA 4USKA 4K0KJ 2OD4A 3EDQB 3W2WA 3CDEA 2G0IA 3RW7A 3MR3A 3W2VA 2BE2B 4NPOA 2CG8A 3H0PA 2ACMA 4JI6J 5E0OA 2AIRB 3RBZA 1ZYQA 2OPSB 4UQTA 5FJ4A 4HHHA 4DCPB 2YQ3A 4NEZA 4AXIA 4AFFA 2UVVA 3GYNA 1T7PA 1RTZA 4WXWA 2H65B 4XPEA 1VFJA 5KT3A 1C4AA 4I56A 4DQIA 4DR6F 5L38A 2J0WA 4DV6F 4KPCA 1F60B 4OL8A 1YDLA 4WZQA 3TA1A 2CA9A 2N4DA 1U24A 2CPFA 4P73A 2HURA 3J81j 2LMIA 1EQ0A 2OPRA 1IKWA 2C3PA 1VJQA 4WWSA 2ZEJA 2AYBA 1WEYA 1M5KC 2HHTA 3OJUA 1LWFB 3VGVA 2DH8A 3OR2B 2PDAA 4URQU 2KO1A 4ZP8A 2V0NA 3QT8A 2G0CA 3CJKB 2M3DA 3H7HB 1R89A 5CZXA 5KFHA 3WIUA 4XDCA 1DQ9A 2E9RX 3IS9B 1IR2A 4I68A 5F8NA 1JLCB 2ZFHA 2E5GA 1Q8BA 1UFWA 2KH9A 2COLA 2VIHA 3NMAA 1SKWA 3IBWA 3IP0A 1EX8A 2QLFB 2CJBA 5T7LB 3AOAA 3TX0A 2WSCC 2RILA 4GVBA 3TQ1A 1ZOTA 2ILZA 3V4IB 1UEKA 2VZ9A 2XMVA 2DPIA 4TKTA 5U47A 3QYYA 2VBWA 1M0SA 2KFYA 2W2MP 3ZZZA 2MKCA 2OUGA 1SJRA 1RGVA 3NS5A 2P9EA 2VODA 3CMES 1HBUA 4P2MA 4NEYA 1T9YA 2QL5B 4DSIA 1JLEB 1APSA 5EWEA 3WBZA 1PJ7A 1SUQA 1XMQJ 4WFXA 2MQOA 3UD5A 4J9QA 2BACA 2HFUA 4CO0A 4AXJA 1B7FA 2IY5B 1SB6A 2BJ8A 1NK9A 1ZA1B 3MPWA 1NHVA 4ZJQA 3MOJB 3M6XA 2R7SA 3HKZD 1FRXA 3O44A 3EVMA 2XCPA 1NJYA 3KTQA 3MPVA 1CJTA 3O1LA 4LRFA 2IRUA 4PG6A 4BHQA 1Q5YA 2V68A 5L8RC 4ZCMA 1VQ5S 2PT0A 1DJ0A 2YQ1A 4WYWA 4L75A 2QX0A 4CQ1A 1U2RA 2EC2A 1D1UA 2YKAA 1AXQA 1OSCA 4DX7A 2XB2D 3FCVA 3N28A 3K8WA 1KLNA 2KT3A 3B82A 2WCXA 3EE3A 1OO0B 1VLOA 4DFPA 5ETMA 4I7FB 1U0HA 2HHVA 3CJ0A 1RAOA 4FPIA 3DC2A 2CQ0A 4OLPA 1JIHA 4HEA9 3KK1B 4KV8A 1TKZA 4Y65A 3PM9A 1WWHA 4YB1P 3DLEB 2V4JB 3KOAA 4LSNB 3MMJA 3SCKE 2ROGA 1SC4B 1Q4RA 3I4PA 3V2UC 2JDJA 1QD1A 4JI8F 2VUGA 4X64F 1FDNA 5K14B 2NXJA 3ZXWA 4FYVB 1KVKA 1WF2A 2MLZA 2B7CB 1IKXB 1OYEA 3FZBA 3TZWA 2MHNA 3AAWB 5C24A 3D6MB 3R5JB 4ANDA 1OJ4A 4ED8A 1TKTA 4ZKAA 3BPSP 4ID5A 3SQGB 3GIMA 3GPAA 1K1QA 3CJ8A 3JSMA 2UVUA 1WTBA 1RK8A 2GIFA 5KG2A 3CDUA 4OLOA 3VVTA 1JWWA 1EJ7L 3H4BA 3E01B 5CD4A 2V50A 3C14B 1HNXJ 1FDDA 5LXYA 3AOCA 5D0GA 3M2UA 2M4MA 3Q89A 4DUZJ 1TK0A 2HK2A 5C25A 3DRPA 2W7OA 4ED3A 1ZM2A 4W90B 3GFYA 2LQJA 3NOCA 1BQNB 4MKYA 4FF1A 4DN0A 3AD9C 1XN9A 4KGXB 2ADBA 1SC6A 1T9VA 2IM3A 4ZMMA 5FD1A 3EZOA 4LF5F 4LBPA 2CNOB 4Q43A 2LA6A 4KE5A 5C2CA 2OMOA 4K4UA 2MZQA 4O23A 2HWHA 1RYSA 1NK4A 1UJ5A 4R25A 2RUGA 1WDDA 4LFCJ 2K1RB 1KQSR 2F4FA 3CCUS 3O6QA 2IAJB 2H51B 4Z2XA 5A8WB 3R5DA 5IZHA 3G82A 4PUOA 3TA0A 4GC6A 1NKCA 1IBLF 2EFQA 3O3LA 1WEXA 3EGVA 1U1RA 3H5UA 2RU9A 4V19J 3I82A 4DI6A 2HRYA 5DM6Q 3PTWA 4DV5J 3I31A 2B6AA 1UEVA 2KFNA 1JXLA 4P7TA 2LDIA 2HMIB 1WKJA 4DX8H 1I94J 2I5JA 2KDOA 2G2ZA 5HROA 3TAMB 1REGX 1IJFB 1O0PA 3D6TB 4MK8A 5F8JA 1IM4A 1TZ0A 1YJUA 2PA3A 4A8FA 2DO0A 1FXLA 2DNOA 4EU0A 2B9WA 2R7RA 3GCWP 2JVOA 3UDCA 2AJ2A 2KJWA 4EUVA 2BE2A 1Q16B 3FC9A 3HVRA 5KOWA 4WIQA 3OFHA 2VFRA 4L76A 2OPSA 4MK7A 2L48A 4ILRA 4IR1A 1X0FA 2XQCA 3BN4A 4C0HA 1HBNA 4PWUA 3GFXA 3OT9A 3M2RB 1N54B 2IHR1 3FBEA 1KKHA 2MGZB 2YWEA 4C98A 2HFVA 4WK3A 1SJ1A 4ECZA 2DXEA 8ATCB 1A7GE 5JXSA 4L3NA 3CE8A 4Y28C 3OLBA 1RAHB 4O44B 1NU4A 3OTOJ 4CTAA 3H40A 4DR7F 2V2ZA 4L74A 4NLQA 1LWFA 4DV2F 3VV2B 3OR2A 2BANA 2YQ0A 5K8MA 2Z8QA 3CJKA 3PRBA 3J81U 1HW8A 1IQZA 2ZH1A 1RI7A 4C3KA 5LSOA 3UNGC 3IS9A 1OY9A 3HVTB 2R7VA 2CQGA 4ZVRB 1HD1A 1PAUB 3NWGA 2DNHA 2W01A 1K1SA 2QLBB 4LVNP 5HMZA 4C8ZA 1GX6A 4NA1A 5B0DA 3EXCX 3TQEA 4IFYB 4D3GA 4OI3A 1NSQA 1VIOA 5AJ3J 5EX3A 3Q8VA 2YWGA 3AH6A 3CCSS 3JYTB 3V4IA 4NLUA 4QIWD 1DZ5A 2RIJA 5M2PA 4AUKA 2HBRB 3BQ0A 2LVWA 1C2PA 1HWIA 3P45B 1SIZA 3EM1A 3ENVA 4P2FA 3LUYA 4NZ0A 4G3IA 2CKWA 3GV8B 3PX0A 2VD3A 4OZJA 2NXCA 2DT9A 2VBYA 5LL6d 3CCZA 1JLEA 4YR3A 3H2UB 2QC3A 3KK3B 1SJ3P 5KOXA 4TVAB 1L3VA 1TR0A 3G71S 1RTHB 4X62J 1FE4A
chains in the Genus database with same CATH topology
2VPXB 2KXFA 2B51A 1RT7A 4IRKA 2RSQA 1KVIA 1TL3B 4XPCA 5J2QB 3LO3A 1DLOB 2XULA 3MD3A 1S1XB 4JUZA 5CYQB 5DQHA 1QSYA 4WKRA 5D6GA 2KRRA 4K59A 1S6UA 3JAMY 2ATLA 3OHBA 2C2EA 2VB6A 3R1LA 1QUVA 1U1MA 4J37A 4ALZA 2GW8A 2RMLA 2YWKA 4LSLA 5CYQA 2B4VA 2KG0A 3CCLS 1NJIT 1U26A 2XY7A 2KKHA 1IKYA 5KFTA 2JH3A 3PIPQ 4ZA1A 4YY3F 3P6YC 2MMYA 4A8YA 2VG5A 5KFYA 5J2NA 2J76E 4DR2F 5F0UA 1FD8A 5AXLA 2BABA 4MIAA 4ZCKA 2FHJD 3JSRA 4I0WA 4I2QB 2HVHA 4NA2A 4TLQA 1YG0A 4J9RA 4KR0B 3UD3P 3LAMA 1G3OA 1FEHA 5J1NA 2GFFA 4ECTA 2NPIA 4ES1A 1X7VA 4EBCA 4I2QA 2R2TA 2YNHA 2DISA 2VFUA 2MZ1A 4UUXA 2RVJA 4AL6A 3MM9B 1C1CB 5KFMA 1RA6A 1MROA 2MKIA 2WTFA 3KK2B 4H4MB 2CPDA 3CJ4A 1OSDA 1YRTA 3D1QA 2GJIA 2HHPA 3IN5A 4XO0A 2E1AA 2VG6B 3C3LA 2O1PA 4LJMA 4IG0B 3MM9A 2ZBIA 3HX9A 4HI2A 3KK2A 1X4HA 2R7OA 1YWXA 2ADCA 2F3JA 3K5LA 3S01A 2QV6A 1U6FA 2CQIA 3I4HX 3ZZ0A 4Y2MA 3T19A 4Q0BB 1JXEA 2BM0A 4NYPA 2RDJA 3SV4A 3TUJC 3J7A1 2J9EA 5A8KB 2HHUA 3VAGA 2LXFA 2J5AA 3J7YI 1FJEB 3OUYA 2XO7A 2E9ZA 2MXYA 3DXBA 5HBMB 3K8VA 5HMWA 3SMZA 2L41A 3NNCA 4I7FA 4KHRA 2GNKA 2DH7A 3LP1B 3I5BA 1V3SA 4OX8A 2HWIA 2KYZA 2XMWA 2DGSA 4Y0FA 3KNAA 2R9LA 4LMZA 3CTRA 1DURA 3GZ7A 4B9UA 3POTB 1C1BB 4O3NA 1G7CB 4RX6A 2VA2A 2VC1A 3GV7B 3KK1A 3V6JA 1H2UX 1V6HA 3LP1A 1KC8T 1XK8A 2DJWA 5HLFB 2JC0A 5GAGI 1U4BA 3MTKA 1XBWA 2ZNZA 4QYZJ 4B3RF 4JYAF 1HYSA 4MTPA 3MPYA 4Q8EA 4B9LA 2RF2B 1OQ6A 2DNZA 1OQ3A 3FQLA 4DL3A 4R8UA 1UWBB 3DLEA 2DGTA 4JV0A 3VWSA 2V4JA 3OR1B 2DO4A 4DSJA 1GXTA 4I64A 3R1HA 2YKMB 2C3OA 3GMGA 3I0SB 5KFLA 3G6XA 4L72B 1WHWA 4ZHRB 4MYTA 1R8HA 4KJIA 1SH3A 2WOMA 1CG2A 5KFUA 4B3TF 3H20A 5LSLA 2AV5A 3OR1A 1SQEA 2OTLS 1UVLA 5K14A 2YKMA 4WKYA 1X5PA 4MFBB 1VC6A 4ZVEA 4ZPDA 2IRYA 3F41A 5KFNA 1HQUB 2QYCA 1RTDA 4ZOSA 2YKNB 1LWCA 1KOOA 3B4DA 5G4DA 4Z37A 3DDKA 5M2UA 1K8AT 2GQCA 5IXUA 2CFXA 4RNNA 3ZZOA 3QAEA 2HGLA 2Q1LA 4MFBA 3RAQA 5HN0A 5HP1A