3DLGB

Crystal structure of hiv-1 reverse transcriptase in complex with gw564511.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
431
structure length
400
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 113
structure length 400
sequence length 431
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlgB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlgB03
3V6JA 1REVB 2XCAA 4F4ZA 3KK3A 1LW2A 4K4ZA 2D3UA 4YR3A 3PW7A 3KLGB 2QE5A 1TKTA 1TKTB 3NL0A 3JYTB 2QV6A 3CVKA 4TXSA 4YP3A 4KSEB 2IA6A 4NCGB 3KK3B 1TKXA 4ZP8A 2YNHA 2I1RA 3QIDA 3MFIA 4RW6A 4X2BA 2W9BB 1C1BA 2HNYA 1QE1A 2ZE2B 3IRXB 2FLPA 3G86A 2WTFA 1N4LA 3G6VA 4MFBA 1SUQB 3I5CA 1S1VB 1RAJA 2VA3A 4WXWA 1S9GA 2C2DA 4O4GA 4ECWA 3QZ8A 4O3SA 2FJXA 4WFZA 1RT4B 2R2RA 2BRLA 3IN5A 5I42A 3N6NA 3MR6A 1RT3B 2BQ3A 1TP7A 1R0AA 5KG0A 4EYIB 4RNHA 2R2UA 1K1SA 4ECYA 4EO8A 1S1XA 1S9FA 1JLBB 1HQEB 1IKWA 4YQWA 3NGDA 2VA2A 4IDKA 3KJVB 5C5JA 2ZD1A 2B6AA 5KFMA 4K4WA 1N56A 2J6SA 1QAJA 1LWEA 3T5KA 1RT4A 3OL9A 2FJVA 3OHAA 5D3GB 4RNMA 1S0OA 4FBTA 3E01B 4ZVFA 1JLBA 1HQEA 4RW9B 3QGIA 3GQCA 4Q8EA 3V6KA 3BSOA 4RW7A 2WRMA 4ZPAA 4F50A 1HPZB 4ECTA 2HNYB 3IRXA 4LSLB 2BRKA 1T94A 4ZP6A 4RW8A 5KFKA 3H40A 4J9QA 1I6JA 2OPPB 1JKHA 4IFVB 1BQNA 5KG7A 5CYQB 4ZP9A 4Q44A 3PR4A 5KT2A 1DLOA 1RT7B 4RZRA 3GIMA 5CYMB 1S1VA 4ECQA 5J1EB 4MFBB 5KFHA 3BQ2A 4KV8B 5J2PB 3HVTB 4ECZA 1HQUA 4Y34A 4NLXA 1XR6A 3M8QB 1EETA 1NHUA 3GIIA 3RBDA 1S1UA 2WB4A 2XGPA 3DRPA 3TAMB 2D3ZA 3IGVA 3C6TA 4RNNA 5KFYA 4DL2A 3I5AA 3I0SA 5KFBA 1NNDA 1RT1B 2YKMB 1FK9A 4ZPDA 3LP1A 2FJWA 1DLOB 2OPQA 3N6LA 1IKVB 4G3IA 2YKNA 3ISNC 4IH5A 2OPPA 4IFVA 2V4RA 3G6XA 3KLIB 4IR1A 3DMJA 3CDWA 5L1KA 3M9MB 4ICLA 3DLGA 4B3OB 2F8EX 3H2LA 2C2RA 4O3RA 3KOAA 3DLKB 3FFIB 4OL8A 2B5JA 4ZP7A 5KG2A 5EWEA 4DL3A 2IJNA 2C28A 3DRRA 1MU2B 2I5JB 1TVRA 3DM2B 1S10A 3ITHB 4GC6A 3I0RA 4KFBA 2AX0A 2YNGA 5DG7A 4URQU 3LP2A 2BQUA 4PUOB 4M94A 4IDKB 3KJVA 5KFOA 4WZQA 1IKYA 4NLTA 5DGAA 1DTTB 3QO9A 3KHRA 1RYSA 3KLFA 4Q0BB 1JLFB 2XI3A 4ZVHA 1RT5A 4PQUA 2YNIB 4TYBA 5F9LA 2GC8A 3T19A 4XPEA 5KFIA 4K4YA 4EBEA 4RW4A 3PHEA 4MK8A 4URGA 4R0EA 3NBPA 2R8IA 5KG6A 2VG6A 5KFNA 3C6UA 4I7FA 3OLBA 4LQ3A 1LWFA 3CJ4A 4LSNB 2XCPA 1S6PB 1RTDB 4I2QB 2FVPA 2BQRA 1C1BB 1S4FA 3PJXA 4IRCA 1JX4A 1C1CB 1KLMB 2JC0A 1VRTB 5J2MA 1SH0A 1WNEA 3NAIA 1S9EA 1QUVA 4J9KA 3MFHA 3RB6A 3MEGA 4QW9A 2WONB 3UPFA 4ED8A 2ASJA 1J5OB 5KFJA 2V4QA 1JLFA 3LAKA 4LQ9A 3DLEB 3DOKA 3LP0A 3CJ3A 1HNVA 4ED1A 2UVUA 2XC9A 4O44A 1YVFA 1TL3B 2XI2A 4DL5A 2RF2A 1TKZB 5C25B 5DLGA 3V4IB 1RTIA 4WZMA 4WFXA 4TLRA 1RTJB 2IM2A 2BANA 1RT2A 2I5JA 3DM2A 1K1QA 1EP4A 3KLVA 3Q8PB 5HLFB 3H5YA 3BSAA 4B3OA 4ICLB 1N5YB 2W8KA 2C22A 4O3NA 4ED0A 4TN2A 3UQSA 3KLIA 2RF2B 5C25A 2B43A 3H5UA 1JLEB 4NZ0A 1IKVA 5KFTA 4KB7A 4ED6A 1UWBA 1FK9B 3QGGA 3LP0B 5I3UB 2ZKUA 3TVKA 4ECUA 5FDLA 3D5MA 1J5OA 2WONA 5KT6A 1N6QB 4Q8FA 2IAJB 2OH2A 5HP1A 3MR3A 2W9AA 1S1UB 3CJ5A 3H4DA 5DG9A 4R5PA 3HVTA 1GX5A 1S6PA 1RTDA 2D41A 2JLEA 1JXLA 3LANA 5C42A 3MEGB 4MK9A 3OSPA 4NLRA 5HBMB 3RBEA 5KFQA 2BE2A 1SH3A 5J2MB 5HBMA 1SV5A 2VG5B 5L1LA 5KFAA 1DTQA 3KLEB 3EPGA 1HPZA 3CDEA 1N48A 4I7FB 4I2PA 2FVRA 2V0NA 5L9XA 3GIJA 3EZUA 4R8UA 5KFEA 2ATLA 2AGOA 3MECB 2AQ4A 1T05A 4RW4B 5HP1B 4TY8B 4MH8A 4YR2A 1MMLA 1LW0A 1GX6A 1C0UA 3LAMA 1NHVA 3V81B 5FDLB 4TY9A 3DRSB 5J2NA 4WYWA 4H54A 2FLNA 1DTTA 2YNFB 4H4OB 4IFYA 2CJQA 2HWHA 4EYHB 5F8JA 3QLHB 4YMEA 4KO0B 3HHKA 3V6DA 1RT3A 2WOMB 5J2QA 3MEEB 2YNGB 3ISND 2YKNB 5C24B 1HYSB 3IS9A 2WCXA 2IC3B 3DRRB 3QGHA 5HLFA 4DL7A 1SUQA 5DQGA 1RT1A 3FFIA 5KG5A 4DL4A 1RT2B 3HVAA 3H4BA 2R2TA 4NLVA 4URSA 3HKWA 3PW5A 4Y2AA 2R2SA 1S1WA 2HNZA 3TQ1A 2RDIA 5JXSA 3G6YA 3DYAA 2OPQB 4HKQA 3LP1B 4J9PA 3CO9A 1HARA 1CSJA 3SFGA 1JLQA 3KMQA 1U09A 3VQSA 4KV8A 4IG3A 4WYLA 3C6TB 4Y3CA 3GV8B 4QWBA 5KG3A 3KMSA 3D28A 4M95A 3RB4A 1BQNB 1S1WB 3M8QA 2R8GA 4ZPCA 2W9CA 1IKXB 3IG1B 2AGQA 1HQUB 5K14A 4O3QA 4RW7B 1KHVA 1FKPA 1LWFB 2HNDA 4ED7A 2AU0A 3OHBA 5F8GA 4RW9A 4JV0A 5F8IA 4WE1B 1RTHB 4QW8A 5F8HA 4J9SA 3RAQA 5D3GA 2DPJA 5KFFA 3NBPB 3BR9A 2IM0A 1S0NA 4RW8B 3MEEA 1D1UA 3PVXA 4LSLA 3KLHB 2OPRA 1RT5B 4PQUB 3GV7B 4NRTA 1JLGA 4KHRA 4U6PA 3M9OB 1BQMB 4H4MB 4DG1B 2IM3A 4NLWA 5KFGA 2YNFA 4IFYB 5KG4A 5KT5A 2EC0A 1IKYB 1JLGB 1T03B 2WK4A 4O3OA 3V81A 4RNFA 1SH2A 2OPRB 1RT6A 3T5JA 3KLHA 1LWEB 5KFRA 4KFBB 4J9OA 5KFLA 3ITHA 2IMWP 4R8UB 1TVRB 5EWGA 1T03A 1MU2A 5DLFA 1S1XB 3OLAA 3GYNA 4ZVGA 5KT7A 5DGBA 4J9NA 2RKIA 4WFYA 2O5DA 5K14B 5DQIA 4WXOA 5I42B 1SV5B 2VG5A 4G1QB 3PJWA 2YNHB 4ED2A 4KBIA 4O3PA 1RTHA 3Q8RB 3BQ0A 4ECVA 1RA7A 1S9GB 4NCGA 3ICLA 5C42B 4IOBA 4IG3B 4IR9A 3DI6B 3I0SB 2ASDA 3KLGA 2W9BA 5HROA 5DQHA 4Q43A 2W9CB 4ED3A 2DPIA 3DYAB 5KFXA 3KK1B 4MIBA 4YR0A 1TKXB 1ZETA 4KE5A 4FBUA 3T1AA 1RA6A 1N6QA 3JYTA 1QAIA 4Q45A 2J6UA 2JEFA 4JV2A 1Z4UA 3RAXA 5J2PA 5KFUA 3GV5B 4XO0A 2HAIA 5J1EA 5KT4A 5CYMA 3M9NB 1HNIB 1LW2B 3KHHA 3H5XA 4IRDA 1REVA 4MKAA 1HYSA 4EEYA 5F9NA 3EPIA 3FSIA 2AX1A 5KFSA 3QIPB 4ID5A 4F4YA 4EBDA 4K4VA 4TQSA 2E9ZA 1RDRA 2RKIB 3UR0A 2RDJA 4IG0B 2ILYA 3MEDA 3JSMB 1S48A 5J2NB 1JLAB 3I5BA 5KFWA 3IS9B 2BANB 1JLCB 1S1TA 1RTJA 2BR0A 4TY8A 4NRUA 2HMIA 2R8KA 4PWDA 3MECA 3V6DB 2B6AB 2OPSB 4EO6A 3NAHA 3LALA 4O44B 1IKWB 3QLHA 4I2PB 3CIZA 4IH7A 3OSNA 1S6QB 1KHWA 3GIKA 4DG1A 3DLEA 3DOKB 3GILA 2IBKA 3DRSA 4ZMMA 3Q8QB 2W8LA 3DOLB 4ZHRA 5KG1A 4QWCA 1R0AB 4F4XA 4ECXA 3M8PB 3OL6A 4F4WA 4J9RA 2JC1A 4J9MA 4IRKA 4TYAA 3H5SA 1ZTTA 1HMVB 1VRTA 4O4GB 4IKAA 3RB0A 3FQKA 3H98A 2W7PA 4O4RA 1TQLA 2IJFA 1XR5A 4I2QA 4K4TA 3FRZA 1QE1B 2ZE2A 1DTQB 3KLEA 3PW0A 3CWJA 4QPXA 2AGPA 4RW6B 1T3NA 4ZVEA 1W25A 1XR7A 3BGRA 4KKOA 1JIHA 3SI8A 2E9TA 4Y2CA 1C0TB 4QWEA 1S0MA 2IAJA 3M8PA 4IQXA 1LWCB 4NLOA 2XWYA 1RYRA 1JLQB 2UVVA 1UWBB 2IM1A 2OPSA 4K4UA 1JLEA 2HNZB 3OL7A 1S49A 5KFVA 3MR5A 3PZPA 2HMIB 4K4XA 5KFDA 1TL1A 2JEJA 1IM4A 4RUAA 1VRUB 3PR5B 2W7OA 1FKOA 1JLAA 2FVCA 4NLYA 2WHOA 3V6HA 1TV6A 3BJYA 2ASLA 4MK7A 1TV6B 2C2EA 3DLKA 2IC3A 2CKWA 2UUWA 3DDKA 3SFUA 2VG7A 5C24A 5EDWA 2UVRA 2ILZA 1TL1B 3UDLA 4DEZA 3V4IA 5T14A 2XGQA 1OS5A 4K50A 2WOMA 5J2QB 4EBCA 4DL6A 1TL3A 4KO0A 4JUZA 4NLSA 1HNVB 5DG8A 1S97A 4H4OA 2YKMA 3IGNA 1LWCA 1C0UB 1LW0B 2FLLA 3KK2A 4RUCA 1RTIB 1C0TA 4RU9A 1T05B 3DRPB 3TAMA 3KK1A 3E51A 1S9EB 2JEGA 3BGRB 4KKOB 5KT3A 1EETB 1C1CA 1KLMA 5HROB 2UVWA 5KFZA 4MIAA 3BSNA 3DI6A 4K4SA 4KAIA 4J9LA 4NLGA 2FVSA 2ALZA 3QZ7A 1RT7A 3KHLA 4FS2A 4NLUA 2BE2B 5CYQA 3PW2A 1JKHB 4ZPBA 4G1QA 4NLPA 2D7SA 3QYYA 3OL8A 2V9WA 3BQ1A 4GC7A 2FVQA 4ZHRB 3N6MA 4TQRA 3KLFB 3FDSA 4FS1A 3QO9B 4LSNA 4XPCA 1S6QA 4R5PB 5L1JA 2UUTA 3H59A 3C6UB 4KHMA 3CJ0A 2VG6B 3E01A 1HMVA 4QWAA 4JV1A 1ZTWA 4PUOA 3LP2B 3MTKA 3KK2B 3I0RB 4HYKA 1RT6B 2YNIA 1JLCA 1S1TB 2ZD1B 3FQLA 5EWFA 3DOLA 3PW4A 4Q0BA 3BREA 3MF5A 3JSMA 3NKYA 5I3UA 4IG0A 5JUMA 2B5JB 3CDUA 1BQMA 4H4MA 3BSCA 3Q8SB 2R8HA 2R8JA 2JEIA 3HVWA 4ECRA 3DLGB 1C2PA 4NLQA 5F8LA 4U7CA 1D0EA 3QIPA 4PWDB 2GIRA 3KHGA 4RNOA 3RB3A 5KFCA 3NMAA 2E9RX 1N5YA 4QWDA 2VG7B 2GIQA 4WE1A 2HWIA 1HNIA 3MEDB 5F8NA 5L1IA 1FKPB 2HNDB 3T5HA 1EP4B 4NLDA 5F8MA 4NYZA 1FKOB 2AWZA 5KFPA 1VRUA 4MKBA 4ID5B 5EUHA 2J6TA 1IKXA 3DMJB 3IG1A 3MR2A 3T5LA 1TKZA 3KNAA 3CJ2A 4ECSA 4IH6A
chains in the Genus database with same CATH superfamily
5AE2A 4ZIWA 4DQQA 1VQLS 4N41A 3KK3A 4K4ZA 4L3KA 1V5VA 2VF3A 2BXJA 2HQGA 3PW7A 3PRBA 4BBYA 4E2FB 2DNNA 2CQ4A 2YWKA 2VV5A 3MAAA 5K5MA 1RHUB 2MKSA 1DBDA 4USVA 1NXIA 4KSEB 1VISA 2OP5A 3PFOA 3KK3B 3KDOA 5E0OA 2D9PA 4OYPA 5AXKA 3TO8A 1FEHA 1UVNA 1CULB 3ZZRA 5L8RC 2H65B 3G6ES 5CQGA 2XMTA 3N4WA 5D4OA 2W9BB 2HNYA 2ZE2B 3IRXB 5HJXA 4CLLA 4G1PA 1N4LA 1VK3A 2ZBRA 4UOCA 4MFBA 1ULRA 2C1EB 3I5CA 4ZVSB 3P5BP 4ZN3A 4WXWA 1U47A 4V1Ak 2RHSB 2GVDB 4O4GA 3RUBL 1S7IA 2E5HA 3AJDA 2BRLA 4DR5F 2MJUA 4QR0A 3TARA 5I42A 2YWFA 3N6NA 4E0DA 1R0AA 2QJ3A 2X3DA 2N7YA 4YDXA 1FVQA 2J8AA 4JV5F 3J7ZT 4LBPA 4C8YA 1Q16B 4IQMA 1S9FA 3JSBA 3FZBA 5C5JA 2B6AA 3H90A 4PG5A 1BC6A 2J6SA 3GP9A 3T5KA 3CJKB 4HHUA 2XEXA 1RT4A 4HH0A 2GX8A 4RNMA 4YFUA 2E5JA 2AD9A 2DR5A 4FBTA 4LBHA 1S59A 4P2FA 2BJ8A 3EXCX 1RUSA 1X8DA 1ZAWA 4DCJB 4A8YA 4RW7A 4V19X 1EQMA 2ZEJA 1AFIA 1HPZB 3J80Y 3TW0A 4ECTA 3RRGA 2GQCA 1TFYA 5KFKA 1HI0P 2CYYA 3G87A 4IFVB 1HBUA 2PMWA 3HSZA 2PEBA 5CYQB 2R4FA 4KGXB 4KH0B 4OHXA 1HW9A 3M6VA 1A7GE 1EHWA 1MWYA 1RT7B 3OR1A 4OYAA 4IOCQ 4JI4F 2DXEA 2W25A 4ECQA 1SXLA 1TK0A 4HH1A 1F60B 3HVTB 2VJVA 3LGHA 4I6AA 5ETPA 1HQUA 3X3UA 1JXVA 4DUYF 1XMOJ 3PYEA 3GIIA 4HACB 1TL7A 3RBDA 2B9YA 2CFXA 1NDLA 3TOQA 5IQ6A 3IGVA 4X4NA 1BY9A 4RNNA 1NDPA 1CQMA 3K8VA 1UJ4A 3G4SS 3MAAB 1RBAA 5KFBA 3KJFB 1L5UA 3CDBA 2Z8QA 2DCLA 4ZPDA 3U7JA 4KPYA 2OPQA 5IQQA 4YS2A 1IKVB 5FLXU 4G3IA 1SJ1A 4RKUC 2YKNA 2OPPA 2V4RA 3MMAB 1JQGA 4X66F 1FRJA 3R8YA 5K8NA 4FF3A 5GAEI 4QR1A 3FFIB 1WG5A 2MKYA 5J1NA 1MU2B 5MLCV 4U9RA 5AE3A 5B7WA 4FF4A 1S10A 2NR0A 2M2BA 4CO2A 1YSJA 2ZBCA 3I0RA 2GMJA 1WUUA 2YNGA 4CCHA 4TU8A 1Y0HA 2DRAA 1JNRB 2HQDA 5CZVA 2R7TA 4WZQA 1IKYA 1FRXA 4NLTA 2PGCA 3BGLA 3K8WA 2LECA 4Q2MA 1IBKJ 3QO9A 1H2VZ 3KLFA 2DNLA 4F4AA 3TR5A 3RG6A 1IWGA 3L7UA 4C11A 4EBEA 1PKUA 2KT3A 5KFIA 1HWJA 4DV3F 3QQCD 4ED5A 3PHEA 1IJEB 3D9BA 1NHKL 4CLFA 3I87A 4JI2J 2R8IA 3THPA 1ZBTA 2MY8A 4OV1A 4I7FA 3M2VB 5JVGQ 4LQ3A 1VR6A 4F8RA 1NB2A 5JJBA 1MROB 3FEYB 3VAFA 2FVPA 1J5EF 3KNGA 3THVA 1S4FA 1YTYA 3PM9A 4ILRA 4IRCA 1C1CB 2KHCA 3MCNA 3DLHA 4YDDB 1JK9B 5J2MA 3NAIA 1GT8A 4USKA 3VALA 1U26A 1KEKA 4LVNP 4OMFG 1HWUA 1UPMB 2BA9A 2E44A 2ASJA 5KFJA 4ES2A 1JLFA 1CJKA 3OTOJ 3NGTA 3TJ8A 5RUBA 3LP0A 4ED1A 1T7PA 4OZ3A 5ETRA 3HHNB 2XC9A 2Z2ZA 5CABA 5K8OA 4ZA1A 1TL3B 2XI2A 2JSXA 2NZCA 1LWXA 1TKZB 1FWKA 1O51A 2MLZA 5FIIA 4DFJA 3W5ZA 2OH2A 1FWPA 3N5FA 5D4LA 3GCXP 2KZMA 1RT2A 3DM2A 1UTAA 4JI5J 3PIOQ 2XHCA 4C0OC 4JI0F 3BSAA 4ES3A 2JLGA 2W8KA 3VAJA 2VONA 4O3NA 3AB4B 4TN2A 3UQSA 3FBEA 3UVJA 3NMRA 2FHOB 1JLEB 2V94A 4PCQA 1QAXA 2YQ3A 4XDDA 1PAEX 3HSGA 5KFTA 4IO9Q 1T8EA 2UUAF 4OYBA 1UWBA 5SZTA 3TVKA 1ELOA 1YX2A 2PE8A 1R6VA 4GKJJ 4M5MA 1GAOA 1PYOB 3AA9A 2J7UA 3HFZB 4OZ2A 2MXYA 4PYDA 4DFPA 4Y2IA 3MR3A 4DR1F 3TANA 3LUYA 3CJ5A 4DCOB 3H4DA 3ENWA 1BWEA 3R5JB 1IBCB 2RH3A 4USIA 1H3DA 3BV8A 2F9DA 2UUAJ 2MKKA 1WSRA 1YJ7A 1GX5A 1RWOB 4OJHA 4EU0A 1ZPVA 5L38A 1C4AA 4KHPF 2GJFA 4CM0A 1LOUA 1JXLA 2OEMA 4RWWA 3G96A 1CEZA 1RAIB 5CZXA 2ZHAA 3DOMB 3HT0A 5J2MB 1HBOA 3A8JA 2RQ4A 3H2VE 3VQTA 3M8YA 4F0HA 1HPZA 1GFWB 2OLWA 2CG4A 1FDNA 3LGNA 2KFYA 4DUZJ 1YHQS 4LF8F 1IBLJ 3ZTPA 2VQEF 1SVDA 2BJ9A 2XO6A 2FVRA 3K5LA 1SC1B 4HR2A 3GPAA 7FDRA 3EZUA 4OZNA 3BGUA 2B9EA 2VBYA 2EFPA 2AGOA 3MECB 3P6YC 2HVDA 1XEZA 3C3LA 1N54B 5HP1B 4TY8B 1AZSB 5IC6B 4USUA 1GX6A 1NHVA 3LAMA 2VU5A 2KL8A 3V81B 4CLSA 2ZBQA 4H54A 4RR5A 1DTTA 4EYHB 1R31A 4LF8J 2X1BA 3NS6A 3QLHB 1X9MA 4GO5X 1G3OA 2DKOB 1NRKA 4CH1A 4HI2A 1U1RA 3V6DA 1RT3A 2WOMB 1OYEA 2VPZB 3BKFA 3EUNA 5HAOA 3ZTOA 2ACYA 5AE1A 2DR8A 4USMA 3IWNC 1B64A 3KG1A 3ISND 1VBKA 3BKTA 1TKDA 3X1LB 2BJ7A 2A10A 2K2PA 2E5GA 5HLFA 1TL4A 2AEJA 2FIUA 2M88A 2QZ8A 5I4MA 3FFIA 5GADI 5A0YA 3CPWR 1RT2B 3BYRA 1DJ0A 1R0BG 2U2FA 3KUEA 3L4BC 4NLVA 3VGTA 2HHUA 3PW5A 4Y2AA 2R2SA 1XMQF 3AXKA 3TQ1A 2RDIA 3DYAA 2GAHC 2RAQA 4HKQA 2B3TB 4QZVB 5A76A 4J9PA 4FXVA 3SFGA 1CSJA 1RAEB 3EGNA 4B9LA 3KMQA 4IO1A 4CM2A 3VQSA 4KV8A 2C3MA 2VKRA 3HHLB 2PO4A 2HHWA 4TLQA 3CCWA 4RWXA 4D3GA 4Y3CA 3CE8A 2ZBPA 3MUTP 2DO4A 3KMSA 3D54A 1K8AT 3RB4A 1CJTB 2LXUA 2DD8S 1S1WB 3M8QA 3W5YA 2XLIA 2LA6A 1S4EA 1Y3KA 3P45B 3HVRA 3ETOA 2RQCA 1U0HA 1WEYA 5K14A 1Q8LA 3FEZA 2VBZA 2PIIA 1KHVA 1TR0A 2MSSA 5E5NA 1NB7A 5HJYA 5F8GA 4N5SA 3OR1B 2MLYA 1Q86T 2DR9A 4QW8A 1F5CA 1WOOA 5SUHA 5KFFA 2F8MA 2KXHA 4NEYA 4RBUA 1S0NA 1X5TA 3ENVA 5CAAA 2IA0A 3PVXA 4I1TA 1UAWA 1SIWB 4OFZA 1KQKA 2F4VJ 3CMES 4LF4J 3M9OB 4H4MB 3CNQP 1T9YA 2IM3A 2HRTA 5D0RA 5KFGA 5KG4A 4GVBB 2XY7A 1R8AA 5GADU 2CPEA 3V81A 4FF2A 1UMJA 2V4JA 2ZVSA 5F0UA 3T41A 3KLHA 2Z30B 1L3KA 4WFAQ 5KFRA 4KFBB 2LLZA 1RLDA 4ZOSA 4H4KA 4PYAA 2RJZA 3ZXWA 3CCJS 4BC7A 1VQ8S 4ZVGA 2HFSA 3LPEA 2WBMA 3GR1A 3MMCA 3P5TL 2B56A 4EI2A 1L3UA 4OHZA 4ILLA 3A3PB 2JDJA 2EPIA 2HEKA 2V8HA 4WXOA 4DXLA 4UT4A 5IV3A 2IBOA 2UXDF 3G9CA 4UZCA 2EK6A 4GVLA 1RBOB 4ED2A 1RTHA 3Q8RB 3BQ0A 1PBUA 2JVOA 2XB2D 3IR7B 4IOBA 2M4MA 3ICLA 2MQQA 2PFFB 4AT1B 3HMJG 2DVIA 3Q2TC 4A4JA 5CD4H 2CZ4A 3L09A 3DI6B 2RE1A 3HCXA 4OX9F 2RRNA 2ZUAA 2MHNA 1RU2A 5L39A 1JNZB 1OYDA 4C3LA 4L74A 1SCJB 4OX6A 2BZ2A 1SKUB 2LVWA 3LPYA 4DV5F 5KFXA 3KK1B 1RHRB 3BH7B 3GFXA 4PABA 1KC8T 5IT4A 1APSA 2HQFA 4WKYA 1KTVA 3JYTA 4CZCA 5J1PA 4Q45A 3CCZA 3RAXA 5J2PA 3CIMA 5KFUA 3M6UA 4A8KA 4U96A 5KT4A 5CYMA 5E3RA 2GGPB 3IM8A 1YBUA 4I56A 2ZKTA 1REVA 2HGLA 4ZLPA 1DRZA 4IRDA 1HYSA 1H6KX 2C3OA 4DJBA 4DFMA 4EEYA 2BKPA 2IVYA 1SC4B 3BM7A 3MAHA 4ANCA 4CLKA 1N33J 1HNZF 5LSLA 2HRUA 4YY3F 4TQSA 1RAAB 1RDRA 4IUFA 2DITA 2E9ZA 2PMHA 2Y0SD 1FRIA 4CH7A 2WVFA 5J2NB 1JLAB 3I5BA 2QA1A 3IS9B 3N79A 4ZVRB 2CUYA 2MY7A 2CPJA 3D6FB 4KJIA 4FPRA 4TY8A 4NRUA 1FFWB 2G1DA 2R8KA 1NPKA 4PWDA 3MECA 1U7LA 5AXNA 2OPSB 1WF0A 3MOZA 3NAHA 2D1CA 2ABYA 2YWGA 4CDIA 4UY85 3OSNA 1KHWA 5A6WA 2GHPA 3EDQB 3DOKB 4AQYF 3QSYB 3Q8QB 5ETVA 4QWCA 1AZSA 1KVKA 2W2OP 4YHHF 3D1HA 4HVZA 1KR4A 3I6PA 2RB7A 5HO4A 3W8PA 4IRKA 1NJXA 1GTHA 1ZTTA 4UZBA 1NH7A 3PRVA 2E1RA 4IKAA 4KGVB 1I51B 2FUG9 1WJ9A 2W7PA 2UXBJ 5M2PA 1IQTA 4C3MA 4I2QA 2GW8A 4RBTA 4DQSA 2DXFA 2BVZA 3KLEA 1LNQA 2DGWA 4DV7J 2KT5A 2P8IA 3NNAA 2AGPA 4QPXA 3ISZA 2V69A 3UN2A 1P9QC 4ZDNA 1W25A 2C3PA 2ZH7A 5B0CA 1JIHA 4ES1A 1CULA 3SI8A 3QT5A 2AJ2A 5HVGA 1C0TB 5DM6Q 1UEUA 4OZJA 5L9NA 3S01A 3M8PA 1J27A 1WHWA 2GIFA 2ROEA 3GLJA 3HHLA 2FGOA 2XWYA 4NLOA 4DDFA 4RJVA 1KSPA 3CCQS 1UWBB 2BX6A 3UCZP 5IC4B 3UD3P 4UQGA 3IFEA 3R7SB 3UNGC 1T11A 4C2MA 4K4XA 3DFEA 5KFDA 4DV6F 1TL1A 3M8RA 1VRUB 2YKPA 4CLTA 3V6HA 2WHOA 5A0YB 1REGX 5IM0A 4HDHA 2DO0A 2ASLA 4A8QA 2X3GA 4X65J 2ROGA 3OTEA 4RBVA 5LL6d 4P7TA 5ADZA 2KZZA 1LK5A 5C24A 1D8YA 2UZAA 2UVRA 3UDLA 4DEZA 3CD7A 1X31C 2R3VA 4DL6A 1QLNA 2EWHA 3RZAA 1SJ3P 4LFBJ 4OYZA 1FDBA 1X60A 1HNVB 1LQ9A 1FDAA 2AYMA 4JP8A 5C2GA 1ZOTA 2W24A 2XMJA 2Z4PA 2ZZTA 3KUHA 3DLBA 1S57A 1C0UB 1NSPA 1M5VC 3QFWA 4J9UE 4RUCA 3TRGA 1T05B 1YRUA 1PJ5A 4FYVB 1UVKA 1W26A 3BGRB 3T9NA 5KT3A 2JEGA 2CNLB 3GSDA 2RQMA 3R1LA 2UVWA 1HHQA 2I38A 3PXGa 1GMWD 5KFZA 3W62A 4DF8A 3RRKA 1X0FA 2UU9J 1HLWA 2PI5A 3R2CJ 5HI7A 2NLWA 4K4SA 1CLFA 4B08A 1UW9A 1FRKA 2FJEB 3FGVA 1RT7A 2HS3A 5CHCB 5A8WB 3KHLA 4WTOB 4NI2A 5CYQA 1TUWA 3PW2A 1JKHB 4ZPBA 3EJMA 5BJRA 2R7RA 2D7SA 2BOPA 1WACA 3BQ1A 4LF4F 1VQKS 4GC7A 1BGXT 4BLGA 2ZDPA 2DRBA 3N6MA 3ZNJ1 4JI3F 3VVUA 1WKKA 3OXLA 1S6QA 1UFWA 2VODA 2KXFA 3C6UB 2ZNZA 4KHMA 3E01A 1HMVA 1VK8A 3EDRB 3SSRA 4DR7F 2DHXA 1BUXA 3MM5A 1NJWA 5B0EA 3TAQA 2JHEA 1JLCA 3FQLA 2KHDA 3AD7C 2CJYB 3K2YA 2R7VA 3AT1B 4Q0BA 3MGJA 3BREA 4IG0A 1CBKA 2J9DE 3BSCA 2JEIA 3TJAA 2NPFA 3OTDA 4B17A 3DLGB 4L73A 4NASA 1SC3B 2A0FB 3HF5A 4CP5A 1SJ4P 1Q7YT 3MMAA 3O5TB 3DCAA 1UFKA 2E7WA 3DDIA 4OI6A 4RNOA 3KHGA 1XNQF 3NMAA 1N5YA 2R9LA 4A8FA 3R5DA 5T7LB 2GVDA 3A3OB 2GGPA 3R5AA 2D74B 2XTJP 4L3NA 4CO3A 5F8NA 1SC6A 1FKPB 1WC4A 3IO1A 2M52A 5IM0B 4WBFA 1NCLA 5HL7Q 2QX0A 5KFPA 1Y7PA 1NLKL 3MUMP 2J6TA 2YBVA 3T5LA 4FF1A 1Q78A 3EE3A 3O8WA 3KNAA 4QCLA 3Q24A 3B6BA 4DR4F 3V6JA 5CA5A 4F4ZA 2DNHA 2OAUA 3MEKA 3UWTA 4CNZA 9ATCB 2D3UA 4YOEA 5IT9U 4KGMA 1HNXJ 2QE5A 4AL6A 5BYQA 1TKTB 1RXOB 3NL0A 2QV6A 3JQKA 1FE4A 2AW0A 4NCGB 2V2ZA 3A1YG 4DUTA 5EHHA 4P74A 2CAJA 2Z57B 4ZP8A 1FO1A 3LTOA 2H9ZA 1UFLA 3MFIA 2VUGA 3GZ7A 3MMBB 3NCQA 1HWLA 1UA1A 3M8WA 1OY9A 4PQAA 4X2BA 1BD6A 1QE1A 3IXQA 4PWWA 4ZCLA 3G86A 3GONA 2WTFA 2IVMA 1D9AA 1FD8A 3UN5A 1UA0A 3J7AN 5HMZA 1NH8A 1WTFA 1VLYA 2K06A 3F56A 2G0CA 1GH8A 4NXMJ 4WFZA 4UUWA 3BYPA 2KTQA 2V63A 4OZLA 4P52A 5D77A 1N32F 1ACMB 1RT3B 4G6VB 4MKYA 3TUPA 5KG0A 3SDEA 2R2UA 4ECYA 4FYXB 1HKAA 1F9EB 4NOHA 1DAXA 1JLBB 2OFGX 1IKWA 4RL1A 3NGDA 3KJVB 2ZD1A 4MT1A 3W5XA 1LWEA 1U1NA 3SCKE 4CRJA 4HL9A 4ZVFA 1HQEA 4RW9B 2PD1A 4FKYA 2JLFA 3HXMA 4P6QA 1FVSA 4FZVA 1X5PA 2OD6A 2WRMA 4ZPAA 4ZLLA 4AD6A 2ZHOA 3FC9A 4LSLB 2BRKA 3F41A 3RJMB 4RW8A 2WSCC 3GFZA 1I6JA 4WJBA 1CJTA 2HFVA 2QLFB 3Q22A 1CVJA 4D3HA 1NK5A 5CYMB 8ATCB 5J1EB 4ZCKA 4MFBB 3O6QA 5HMYA 4TU9A 3BQ2A 4KV8B 4GMKA 1U2RA 2XM3A 3SSSA 3BR8A 4ECZA 2V9KA 2EFGA 2V8GA 4RLEA 3AQPA 4NLXA 4BCAA 5HVHA 1EETA 1NHUA 4M5NA 1VMBA 2L9DA 2D3ZA 3OQ2A 3C6TA 1X5SA 1Y5LB 4W4MA 2DIVA 4ZCMA 2W4PA 2D3O1 2B9WA 4DU7A 4QOTA 5A8RB 2YKMB 3LW5C 3KDNA 4A47A 3WC2A 1FK9A 4DV1F 1CG2A 2FJWA 1DLOB 2HBZB 2K8GA 1V9OA 3FZ2A 3M32A 3N6LA 3OR2A 4DV7F 4P2XA 4C8NA 1L3SA 1UVMA 4IFVA 3W9HA 3W8GA 1SJQA 2P5VA 4Y0FA 5L1KA 1PYTA 1XNRF 2R7SA 4RU2A 4ICLA 1Y11A 4B3OB 2F8EX 3H2LA 5E3QA 3DLKB 2H5EA 3E8OA 2B5JA 3TJ9A 4DL3A 2C28A 1NMEB 2IJNA 3DRRA 5E2QA 1HHTP 2XS7A 2ZH3A 3CD5A 2FYXA 4LRFA 1CJUA 1FE0A 3CJQA 4KFBA 2BW2A 2PN6A 3SCJE 8RUCA 4AL7A 4DZ6A 2DR7A 2FHMA 5T41A 3PYDA 1JJ2R 4IDKB 3M30A 3BO3A 4J9VA 4DQRA 3BPDA 2XBPA 3KHRA 1FHTA 1JLFB 1CJKB 3ZZTA 3R5CA 2WVEA 2Z0GA 1RT5A 4K4YA 2YNIB 4TNOA 4TYBA 3TA2A 3T19A 4C8KA 2HQ3A 3ENAA 3LO3A 3ILOA 4LRBA 1ICEB 1MLAA 1N52B 2VG6A 2D9OA 3M6XA 3PNIA 3C6UA 4LIRA 5KFNA 4QR2A 3G8SA 1LWFA 3A4TA 4W98A 2V6AA 3POTA 1WWHA 3DDNA 2VDIA 4ELTA 3A3NB 2DHHA 3K5OA 2Q6CA 2LCWA 3R9LA 3TAPA 1C1BB 3PJXA 3PV8A 2BQRA 2VFRA 1KNZA 3RBXA 4BC9A 5B0BA 4HHHA 2JC0A 4F67A 1VRTB 3FMWA 3TZWA 3TZZA 3I55S 1RCOB 3NGRA 2LEBA 1WNEA 2DNQA 3MFHA 1RI7A 4QW9A 3K59A 4ED8A 5HQ8A 3WC0A 1J5OB 1TAUA 5H9FJ 3M7VA 4LR9A 4N47A 2HURA 2ZH4A 2DB1A 1BE4A 4JI5F 4JB8B 4DPXA 2K3KA 1YVFA 5M2UA 1G4CA 3VF0B 2EFQA 1F9HA 1RTIA 1UP1A 3UDEA 3BO2A 4X4TA 4I67A 4TLRA 2IM2A 1F3VA 2WSFC 1FT8A 2KYXA 2MZQA 2I5JA 1K1QA 4OYOA 3VCDA 1CC8A 4NXNJ 2Y8WA 2AP6A 4B3MF 3VVTA 1YZ6A 5JMNA 4YB1P 3H5YA 4B3OA 4WKRA 1VQ7S 4F0MA 2XULA 4JI2F 4P73A 3PHTA 2R7OA 2LQ5A 4ED0A 2VFSA 1UVIA 2RF2B 5C25A 2IIHA 4N8NA 4F04B 3TZYA 2JZ5A 3D6TB 3IMQJ 2LXFA 4NZ0A 5B09A 5DS7A 1B0PA 2G0IA 4UQTA 2N4CA 4KB7A 4K2XA 4Z7CA 4ED6A 1FJ7A 1PSDA 2DT9A 2EFOA 2MQPA 2JRSA 3QBCA 4ECUA 1N0VC 1OWXA 3D5MA 3FEXB 2WONA 2CRLA 1N6QB 3P96A 2IAJB 5KT6A 2HLUA 1TMJA 2C2MB 3FSXA 3TA1A 5GVQA 1Q5YA 3W1YC 1X4BA 2XZTB 2M8HA 3GG0A 1S1UB 4LF6J 2CIMA 4WTYA 5DG9A 2MZTA 4FP9A 4QIVA 2FC8A 2OSQA 2IYIA 5D15A 1AT1B 5HQMA 3LANA 2HHXA 1FTCA 3MEGB 2LU1A 4F2RA 3SZ2A 4CNYA 2BV3A 3IR5B 1FJCA 2KI2A 2VG5B 3NWRA 3PEJA 3D6MB 3V5RA 5L1LA 1HR0F 4RUBA 2C42A 2GFFA 1T3OA 3IA0A 2YPYA 2YX4A 1N48A 5C2CA 2FZCB 4I2PA 1JJCB 2I8EA 5KFEA 3B8HA 2QFJA 2ATLA 3H20A 1ZYQA 1SI9A 4JI7J 4FNIA 2LXIA 1B3TA 4ER8A 4J90A 3GYGA 4YR2A 1MMLA 4LRDA 3M05A 3A13A 5FDLB 3I32A 4U95A 5J2NA 4QIFA 3MXHP 1Q82T 4IFYA 4DBQA 2CJQA 1U6BA 1KKHA 4ZJOA 1BLUA 2KB2A 3CC2S 2HHHF 2J7KA 2XLKA 4WF9Q 3D3CJ 3MHYA 2BJEA 4C8MA 3SEOA 4WP8A 1DZ5A 5J2QA 4KPCA 1VC6A 4B3TJ 2HHQA 4A8WA 5B0AA 2AJQA 2HGMA 4HT5A 4LRAA 4NA1A 3E2EA 3KYLA 4DV4F 2IC3B 1VRQC 3QGHA 2EI5A 2BE9B 3AB2B 1SUQA 1TAQA 5DQGA 3I82A 3NXZA 3H4BA 4RUHA 3OFEA 2AIRB 1U48A 2R2TA 4WU2A 5C7PA 3HKWA 1TZ0A 1KFSA 4DLGA 3TUZC 2HNZA 1WHYA 4NPOA 1WDTA 1MMDA 4I68A 1N88A 1HARA 1K73T 4FXWA 5E33A 5A8RA 3QRRA 1JB0C 2CPFA 2NXNA 4YEAA 2GZOA 2HW3A 2E66A 4N77A 2W2MP 3QMQA 5KG3A 3D28A 3T9ZA 4M95A 4OHYA 2HVIA 1LK7A 2ATCB 3H25A 4ELUA 2A18A 4LF2A 1LXNA 2AGQA 2A6MA 3IWXA 3D0HE 1VQ5S 3A12A 5E3CA 1X4CA 2WSEC 4OI0A 3KG4A 4X66J 3LWMA 3POTB 1RAHB 1U02A 4P71A 4ANDA 4X64F 5LMNJ 4ED7A 4JV5J 4RW9A 3FMBA 1I1GA 2BYCA 2DK2A 4JI8F 4JV0A 5F8IA 4WE1B 3MM7B 4FN5A 3QNWB 5DZ7A 5F8HA 5D3GA 4ZVOB 3RAQA 4B3SJ 3EMTA 4OV6A 3CCTA 1OQ6A 4WP9A 4LSLA 2CQ1A 3UO0A 2OPRA 1RT5B 2JFKA 2M3DA 2XLJA 4NRTA 4X4SA 2UUBF 1JLGA 4KHRA 3W2WA 2J0XA 2XMMA 1XIQA 4NLWA 1FA0A 2YH0A 3TVZA 5IZHA 4IFYB 1OQ3A 1IKYB 1JLGB 1S99A 3W2WB 3ZNUA 4DHVA 3S7RA 3T1HF 2OPRB 3UFCX 1RT6A 1Z1ZA 1WC1A 4A46A 4ZPWR 4J9OA 1R6YA 3MPUB 1E6YA 1ZM4A 5BR8F 2IMWP 4MAKA 4R8UB 5EWGA 2QLBB 5DLFA 1NK6A 1TMMA 2J0SD 3CD6S 1JJHA 1VOMA 1P1TA 2JJ4D 3GYNA 2MSTA 4CQ1A 5KT7A 2KT2A 5DGBA 4DR5J 4WFYA 1FRHA 4DPUA 4OHVA 1NUEA 2FTRA 2DCUB 3IRWP 2BOAA 2BJ3A 2Z2LA 4G1QB 2B0GA 4Y65A 2WZ1A 3I96A 3NEKA 4ATNA 3CMAS 1X4AA 2OIHA 4DX7A 1U24A 2QLJB 2V2QA 4LJMA 3RW7A 2B8PA 1S9GB 4F7VA 4IG3B 2B7CB 4LF1A 4IR9A 4U8YA 2BUNA 3NNCA 2KVIA 2HFNA 3CJSA 3OV7A 2A2DA 5HROA 2CZVC 2C2ZB 3AFGA 4ETXA 2F7VA 1RWKB 4CLUA 2DHAA 2DBBA 2UXCJ 4MIBA 5HSPA 2MGZB 4S0MA 2IDEA 1QAIA 2IRXA 5DZ6A 2JEFA 3D1OA 5G0RA 3MM8B 3J7YU 1XK8A 1T9WA 4PXBA 3JAMY 3BBCA 3UDVA 4XO0A 1RP5A 1WI8A 2HAIA 1Q8IA 2QLXA 2AJFE 4A8MP 1VBXA 1VC5A 3UE2A 2DNZA 2GVZA 3D1QA 1A9NB 1OO0B 4OQJA 3NOCA 5THWA 1KVIA 3EPIA 2AX1A 1CJVB 1UWAA 2Q43A 1GMUA 4F4YA 1YJVA 3EVMA 4EBDA 4C6AA 4ID8A 2RKIB 2XYHB 5HATA 4RPFA 6FD1A 1DQ8A 4B9MA 4IG0B 1RADB 1S48A 3JSMB 1PGZA 1N5VA 4XK8C 3QATA 5KFWA 3FK4A 1JLCB 3OXFA 1RTJA 1X5OA 4C7QA 1VJQA 2Y9HA 3Q8UA 3CJRA 2VFVA 4J91A 3D2WA 1TUVA 4DV3J 2NSBA 4UTGA 2CPHA 2D69A 4EO6A 3Q0AA 4DUYJ 3V4MA 3QLHA 4I2PB 3CIZA 3W9IA 4OX9J 1S6QB 2ZC3A 2MQLA 2DY1A 3DLEA 3SMZA 2MKIA 1U45A 3DRSA 2DGOA 1J2VA 1AW0A 3DOLB 4ZHRA 1UETA 5F41A 1B0TA 3M8PB 2MDAA 4F4WA 4J9RA 2JC1A 3MM5B 4F36A 2QO3A 1OJ4A 4DMZA 1E6VA 2VD3A 4WIQA 1ZS6A 2GV1A 1VRTA 3KJNB 4O4GB 1V3RA 1Z2LA 2BACA 2FPHX 3IP0A 1TK8A 1VCTA 5CCMA 2CPZA 4O4RA 1FI4A 1YBTA 2LKZA 4MYUA 4F3QA 4B9VA 2CQHA 3PW0A 5LMUJ 3IM9A 2KH9A 2W01A 2QG9B 1H38A 1S77D 1IBMF 1T3NA 4ZVEA 1IBLF 1Q5VA 4KKOA 1HNZJ 1S12A 4Y2CA 2DNGA 3RYLA 4QWEA 2IRUA 2CXEA 2IAJA 2APOA 2QMXA 5D4PA 1FERA 3PRDA 1U2FA 1LWCB 5IT0A 2ZOMA 2VDHA 2HG4A 2MKJA 3NS5A 1YJ9S 1RYRA 1JLQB 4K0KJ 2KU7A 3VAHA 2UVVA 1Q8KA 2H51B 3K5PA 2OUGA 4ITSA 4K4UA 2AJ1A 4R25A 3MM9A 1K47A 2HNZB 3OL7A 1S49A 5KFVA 4J37A 4C48A 4X65F 3DGPB 3PZPA 3UDCA 1HI8A 2DIUA 2LEPA 3PYGA 2WW4A 2A1BA 2W7OA 1PJ7A 5DRKA 4NLYA 2LQJA 1AXQA 4RO0A 4N76A 3BJYA 3VAKA 2B4UA 3IWLA 2HHVA 1FTRA 1TV6B 2C2EA 3DLKA 4C0HA 3ZZOA 3KWMA 4HT7A 3GJQB 3R27A 2IMOA 4GKJF 1U4BA 2XMUA 3EWGA 2ZZNA 1W2IA 3D68A 3UVJB 1HW8A 2WOMA 4EBCA 4K50A 2R42A 1AROP 2YWHA 4X4UA 2R7WA 4OYXA 5DO2A 2HQIA 2J7WA 2KN4A 4CYUB 1WHXA 4H4OA 3G2XA 1Y5NB 3IGNA 3O3LA 4JI4J 3HHLC 1SKSA 1MW7A 4Y00A 3C19A 4KHPJ 2I2YA 2JWNA 2FLLA 2ALYB 3Q8VA 3KK2A 1N34J 2C2OB 2G9OA 3TAMA 2Q66A 3KK1A 3E51A 1QVFR 3GMGA 1EKRA 1X9SA 3FCVA 1KLMA 2CNNB 4NZ6A 4DV2F 4N56A 3SV4A 2HHTA 3BSNA 3S1TA 3A8IA 3M8SA 4OZ0A 4DUZF 1LV5A 1JXEA 2ALZA 3FJ2A 2DTJA 2CQCA 1N32J 2KG0A 4FS2A 4NLUA 3JSRA 2BE2B 3DOMA 2DGSA 4CTAA 2FLOA 2HIQA 3MI7X 1KQGB 3OL8A 4NMLA 2ZWPA 2V9WA 1L3VA 4DR3J 5IV4A 3KLFB 1JWWA 2B4PA 3ETMA 3ET6A 2UUTA 1YLXA 2V50A 3CJ0A 3D67A 2AJ0A 3EYZA 3P3DA 3M8ZA 4G65A 4LFAF 3MTKA 5B0GA 2YPZA 4C11B 4Z37A 1HD0A 4IYQA 1IM6A 1FRMA 3EZ5A 1NK7A 2NQPA 2BQ3A 3TA0A 5JUMA 2B5JB 2VL1A 4E8UA 7FD1A 1M0SA 3C14A 2AZ3A 2FY1A 2HPUA 2O3DA 1OPZA 1D0EA 4PWDB 4RX6A 4IOAQ 2K1RB 2VFTA 5KFCA 5BXIA 2E9RX 1A0OB 2FZKB 3HD1A 1H7WA 3OFGA 3PO4A 2GIQA 3FBBA 1YGYA 5FJ4A 1M1HA 4WFNQ 4WK3A 3LF0A 1DARA 4AFFA 3N9UC 2HNDB 2KKHA 3HJVA 3EICA 5H9EJ 4CO1A 5F8MA 3PY8A 5D0EA 3MOJB 2AWZA 3WZ0A 4ILMA 4DN0A 2B8QA 3J81Y 4EK2A 3CCUS 1T9VA 3MR2A 1TKZA 1QY7A 2JL9A 3CT9A 2XNQA 3L95X 3AD9C 2E1AA 4ECSA 3S6EA 2XNRA 5GMDA 1N8RT 4M5GA 1S6UA 2XCAA 2K7KA 2EKYA 2AEFA 1W2BR 1F0XA 1FXDA 3MMJA 3GR0A 3KLGB 2FDNA 1R8BA 5HANA 1U6FA 4PG4A 3P4UB 1T0TV 1PC4A 3JYTB 3CVKA 2E5LF 5GAGU 1BWVA 5A2QU 1TFWA 2NREA 4E98A 1NDCA 2COLA 3EVOA 3QRPA 4DR7J 1Q0NA 2G2OA 2EW9A 3HKZD 1HL6A 2C3UA 1C1BA 2ZJQQ 3FBFA 2FGCA 4ZN1A 1AA1B 5BYSA 4B3MJ 2KXNB 3WQPA 4YY3J 2NSCA 2CPXA 2HKEA 3HDSA 2PC6A 1R8CA 3D4JA 3G6VA 1RAJA 2HZVA 2VA3A 3C2PA 1S9GA 1GXLA 2QSWA 4WPAA 4EFAC 2C2DA 1YQHA 3CC4S 2NUUG 4O3SA 1SBRA 2MYFA 1RT4B 2JH3A 2VQFJ 2RU9A 2UUCF 2EFNA 3B4MA 4FXDA 2CA9A 2B7BB 1RCXB 2VC1A 2YVSA 3W2VB 2VOPA 1S79A 1QDUB 3EM1A 2L3MA 5GMEA 1OPIA 3T6JA 3BH6B 3RGIA 4YQWA 2DNYA 1ZAVA 4LT6A 1U8WA 3EGWB 2Y1RI 1VS3A 1UZDA 1X4FA 2J76E 3BGOP 3HHDA 1N56A 1M5OC 2OTJS 3W60A 3GIRA 1FNMA 2FJVA 1RAGB 4V19J 1S0OA 1S7HA 2R7QA 1YJNS 4DR4J 2B51A 3J80U 4Q8EA 1FNXH 4C4WA 3EGVA 1H2TZ 3C66A 3R97A 4UOGA 5HMWA 5CD4A 3BSOA 1XC9A 1FWLA 1P6TA 2YXLA 2OO4A 3US5A 2DYAA 2XQCA 1FJEB 1V3ZA 6AT1B 3NG8A 4ZP6A 4OX8A 1DQ9A 3GB0A 3VHQA 3OUYB 4J9QA 4OLPA 3EGZA 5DDRC 2IPOB 1JKHA 4B02A 5KG7A 2ZM6J 2GVZB 5KT2A 1DLOA 2DGVA 4RZRA 3GIMA 1S1VA 2AV5A 3M4XA 3I9V9 1NZAA 5G0RB 1KN6A 1UJ5A 3UW1A 2FJDB 5E7OB 3HJFA 1QSLA 2EK1A 4U8VA 1S1UA 2WB4A 3U02A 2H4YB 3TAMB 4NXMF 3MCOA 1VLOA 4DL2A 2HBQB 1BXNA 3JQJA 4UOFA 2UP1A 3I0SA 2RHQB 2KYZA 3CEDA 2MZJA 1RT1B 1CS4B 2DH9A 4WWSA 2OHDA 2CQ2A 1R27B 2NCKL 4I64A 4OJGA 1U1KA 3LP1A 3K17A 1NK8A 3C8YA 4PXDA 3ZZYA 1NKBA 2PI4A 3QRQA 3IBCB 3ISNC 3JSYA 3G6XA 3R6GB 2BE7D 2V68A 2GO8A 3CDWA 4R0JA 4KQZA 4WCEQ 4IR1A 1NPPA 1YBAA 2HBRB 5A2QY 3DLGA 2HQCA 1WHVA 2XSJA 5IWAF 4O3RA 2RS8A 4OL8A 3PEHA 2OJ3A 3A8KA 3DM2B 1TVRA 1X7VA 4F0KA 1NEEA 4PXCA 2CJBA 3ITHB 1QUPA 3GE9A 4IQXA 5DG7A 2CPDA 2LMIA 4PUOB 1TELA 3GWCA 2R7UA 2CG8A 5KFOA 2XO7A 3T3FA 1Y3JA 2EBEA 4J7CA 2RUGA 4DPWA 2F8HA 2LU2A 1RYSA 2O01C 2C2NA 4M5DB 2H5IB 3DGVA 4ZVHA 4PQUA 1ZZNA 3MPVA 5F9LA 2ASDA 2BKNA 2GC8A 4GRSA 5E3PA 2W1BA 3JTOA 4RW4A 2RDDA 1N36F 4NCBA 1EZZB 2XS2A 1O6XA 1K0TA 3RAMA 2J9EA 2DHGA 1AFJA 5A8WA 1KDNA 2AHOB 1KLNA 1VDHA 1MSWD 4DCPB 1WKLA 4X64J 1S6PB 1RTDB 4P2SA 4I2QB 4ZCIA 1NK4A 3K7RA 2DRDA 2LQBA 2Z2MA 4KGZB 4NA3A 5L46A 3FNNA 4ERDA 1JX4A 2AKWB 1H7XA 3NNHA 1S9EA 1QUVA 4AUKA 1TUGB 1X4GA 4NYOA 3W9JA 2RUSA 2OKQA 3MEGA 2KO1A 3VGVA 4DV6J 5EGYA 3CGIA 2WONB 1I3OB 3K89A 3HO1A 2V4QA 4NZ7A 2ASYA 5LSRA 4C8LA 2UUBJ 3C16B 3DOKA 2O66A 3CJ3A 4LQ9A 4AXIA 2KFZA 1FRLA 2DNKA 3AJ1A 1VIOA 2QLWA 4G1IA 4OHWA 5LSOA 4CIOA 2ADBA 2F4VF 3R6LB 1NK0A 4DL5A 5DLGA 1F5AA 3DHXA 3V4IB 2GJ2A 4WZMA 2F9JA 1RTJB 2QGFB 2BANA 3Q23A 3CJ8A 4X62F 2MZSA 2QC3A 5HN0A 4GKKJ 1P27B 4LR8A 1PJ6A 3M1VA 2GNKA 4FYWB 5ETMA 5HLFB 4QIGA 2I6WA 4X4QA 4LF7J 3WDOA 3OW2R 3MM6A 5KOXA 1N5YB 9RUBA 3T1YJ 3PX0A 1S0VA 4XAKA 1XBWA 3F0NA 4OZ1A 4TU7A 2B43A 1WC5A 1IR0A 3QAUA 1IKVA 2DGTA 2UXDJ 2X1FA 1RWPB 2EVZA 4K5RA 3QGGA 2GHWA 2OEJA 4QPTA 5FDLA 3GU0A 1HBNA 1J5OA 1Q4RA 3K58A 1F2GA 2EC2A 2P6TA 5GAEU 3SIPB 1HNXF 2OI2A 4F25A 1K44A 4ELVA 2FHJA 4Y6IA 4M8LA 5LMUF 1W7WA 1XTZA 4DX5A 1JMTA 2W9AA 1T9UA 2GA7A 2GO9A 4QU6A 3ET6B 1QTMA 2FB0A 1R89A 3B54A 3QPIA 1X4HA 1XERA 1DQAA 3PX4A 2C2KB 1S6PA 1RTDA 2D41A 4OJ3A 2N7CA 1YWXA 1XNRJ 5C42A 4OYIA 1Q1KA 5HBMB 4NLRA 4ZPVR 3TI0A 1HBOB 4NYPA 3TEGA 5KFQA 1WDDA 5HVFA 4NI2B 3RBEA 1O0PA 1F1BB 3OVSA 3OJUA 2QMWA 2W2NP 5HBMA 3C15B 2MZ1A 4DR2J 1SV5A 1FFSB 4NXNF 2L48A 5KFAA 1DTQA 1GTEA 2AF6A 2V67A 4PG7A 3EPGA 3DXSX 2NXEA 1VC0A 3BS9A 1N33F 3CDEA 1FEEA 2MTLA 4M5KA 2XS5A 4M63A 2XG8A 1U1QA 4I7FB 3M2VA 5H9EK 2V0NA 3GIJA 4NE9C 3V2UC 2CQ3A 2IFXA 1MN9A 1X4EA 2YH1A 1UEKA 2AQ4A 1T05A 4KY3A 4RW4B 4TVAB 3CCSS 1H98A 5LOQA 1PIEA 3DU5A 4N7TA 4JI1J 1LW0A 1MG7A 3NOGA 3PDNA 2FLNA 4TY9A 5ETQA 1Z2ZA 2FJBB 1EARA 1RTZA 4H4OB 3B78A 4NL5A 2HYIB 3SCLE 3PG9A 2Z56B 4EMDA 4KO0B 1Q79A 3HHKA 5D0HA 3D66A 2EFVA 3MEEB 4KT0C 5E41A 4DOZA 3RW6A 2YKNB 3UI3A 2MPUA 4YHHJ 5ETSA 4ZIVA 2WCXA 2MQOA 3DRRB 3GJSB 1GMWA 3OVAA 3LQVA 3M1VB 4BHQA 1RT1A 1CS4A 5KG5A 1UVLA 3QJLA 2CPYA 3HVAA 3ZTSA 3JAMU 4DV2J 7AT1B 2UXCF 3R7BB 2HZAA 1B99A 1CJVA 4OI1A 4WP3A 2NZ4A 1SKWA 1VQ9S 1RHQB 2RT3A 5JXSA 2J0WA 1KS2A 2OPQB 3LP1B 1Q8BA 2XZDB 3AY0A 2FHKA 3CO9A 1D8ZA 4LUBA 1NKEA 1VQYA 2P9CA 1U09A 2VPYB 4WFBQ 1RABB 4C3KA 3AH6A 1EX8A 2VQFF 4J5OA 4IG3A 3P49B 1FCAA 4X4OA 3L9ZA 3C6TB 3OBIA 4CT9A 3GV8B 4PPZA 4WK1A 4QBUA 1BQNB 2AEMA 4QQBA 4ZPCA 2RVJA 2JVRA 1R0CB 2DR6A 4M5JA 1ZM3A 1GXTA 4CLZA 4L72B 2V34A 4RW7B 5F0WA 1SKRA 1FKPA 5ETTA 1UJ6A 2AU0A 2V8DA 1SJRA 1HBMB 3PYFA 3G82A 2GMLA 2DHSA 2K3IA 3Q86A 2DPJA 5ETOA 2K1RA 4MJKA 1NDKA 1D1UA 3PJ9A 1U49A 3PKYA 3J81j 3KLHB 4CO0A 1FX4A 2VFUA 3KFWX 4PQUB 1IR2A 4EGLA 3GV7B 4LSZB 3VWSA 2XZWA 3AOAA 3HHLD 4U6PA 4GVBA 3MMCB 4HLBA 4DG1B 1AB8A 2EC0A 2MMYA 3NCPA 1T03B 4RNFA 4LF6F 2MB0B 3DU6A 2RILA 3KUGA 4KIAA 2HFUA 1VQPS 3CJKA 1LWEB 2RNEA 1IR1A 3OFFA 5B0DA 2G13A 3RR8A 3UR3C 1D09B 1T03A 1XMBA 1U8SA 2E7VA 3AXMA 2NXUA 1S1XB 5D78A 3OLAA 2EXUA 4HTIA 2UXBF 3SQGA 3ILJA 3LOUA 4ZVPB 2RKIA 2Q79A 2QTWA 5I3PA 3MD3A 1RB0A 4U67Q 4BDPA 2LFVA 2VG5A 3Q2SC 2B9XA 4Q8FA 8AT1B 3OTBA 4USWA 2N82B 4KBIA 4O3PA 1Q53A 4ECVA 2Y1LB 1RAOA 3O1LA 3VV2B 2H54B 3GJRB 4TKTA 4FVCA 2QSFA 2A3JA 5FD1A 3BBBA 2LQ9A 4I69A 3I0SB 4DPYA 5GAGI 3KLGA 2ZH2A 3VAMA 3DN9A 2E29A 3MCSA 1HWKA 1VYAA 3JS9A 2W9BA 2W9CB 5LMNF 2RRAA 1VQ6S 3D6HB 4ED3A 2DPIA 3DYAB 1VIXA 2W2QP 1SPBP 2BMBA 1H73A 3NWGA 4KGKA 5LJ5Y 1EIYB 5D4NA 4FBUA 3PX6A 2CQ0A 2J6UA 1RAFB 1TU0B 3FCWA 5F3ZA 4DSKA 4JV2A 3GV5B 1A6LA 1V5IB 3A8EA 3BN7A 4LR7A 3RRHA 2HBYB 3VAGA 5J1EA 3BZQA 1RHKB 1ZH5A 4WU3A 3M9NB 1AUDA 1LW2B 3KHHA 5T7LA 3K57A 4MKAA 2LDIA 3JTPA 5IXUA 1NJYA 4DWIA 2KFNA 5D6GA 1MNEA 1VI7A 4C9DA 1WTBA 5F9NA 1YI2S 5KFSA 1XJWB 1LKZA 2CWXA 3SQOP 3UR0A 2BW7A 4ETZA 4LFCF 5ETKA 2ILYA 2V5HG 3SV3A 3BF4A 2VZ9A 2OGUA 2XWXA 3EX7B 5DJBA 2F4FA 4LF5F 3EZOA 2G4BA 2HMIA 3LGMA 3RTVA 2QEXS 3ILLA 2ZC4A 2NUHA 2B6AB 2BDPA 4QJVA 1N5TA 4DQPA 4USTA 3KJQB 3GIKA 4IH7A 4I0WA 4DG1A 1PG5B 4B9NA 3CC7S 2V2VA 4OI3A 1T9XA 1IXKA 1FFGB 2J9DA 2OMOA 3OPKA 5KG1A 2UU9F 3Q89A 4Z7YA 4KH1B 4PG8A 4ECXA 4W92B 1KVJA 3C15A 4MYTA 4JI0J 3LA0A 1HMVB 2HFOA 3RB0A 3MPWA 1IBKF 2Y1IA 2CJAA 2FZGB 3FQKA 1VBZA 1YITS 2M70A 1TQLA 2IJFA 1BHNA 5LJ3Y 2ZH5A 4XTTA 5H1SV 2M8DB 5AT1B 2R7XA 3FRZA 3RBZA 2ZE2A 3W61A 3HSJA 4DSEA 3BDEA 3CWJA 1EJ7L 4O0NA 2OFHX 2N3OA 1XR7A 3IAM9 3ZZ0A 1YJTA 2QIFA 3ULHA 2ZOGA 1NJZA 1KOOA 3OXGA 2DNPA 4A8XA 4EUVA 1R8PA 1S0MA 5AXLA 1FX2A 2YY3A 3HPOA 2HAFA 1QJHA 3CCRS 2KJWA 4PZVA 3HD2A 4NCAA 3SYZA 4I6WA 3HT3A 1VQMS 1NU4A 4B9UA 3TZXA 1WI6A 1JLEA 2QA4G 4QYZK 3MR5A 1K9MT 1VQSA 2KG1A 4W90B 3BGFA 1ZM2A 1IM4A 2NS1B 3GG1A 2GCFA 1HBNB 1FKOA 1JLAA 2H4WB 2HGNA 5DDPC 1LFPA 3FCHA 2AYBA 1O8BA 4MK7A 4LF5J 2IC3A 1Y00A 2CKWA 2UUWA 3DDKA 1R3NA 3UCGA 5LXRA 2AMCB 3MAQA 4NMXA 1QSSA 2H48B 2ILZA 1TL1B 2FQQB 2WVDA 3OD2A 5T14A 2H5JB 3G71S 3VZIA 2XGQA 3JTNA 4L75A 5J2QB 3CCES 3TVYA 2HVHA 3UN3A 5H9FK 1O5JA 4X84A 5E3AA 1S5ZA 5LXYA 1YRXA 4PRFA 3I31A 2YKMA 2MHEA 3AOBA 1UVJA 1LWCA 1KD1T 2HK2A 1LW0B 1ROFA 2ZUGA 4DQIA 1RWVB 1RTIB 1FNOA 4K5SA 1FJGF 3DRPB 4QYRA 2CQGA 3N5BA 1S9EB 2MGZA 2YTCA 4KKOB 1ZZFA 3KXDA 3B4DA 1C1CA 3BB5A 5HROB 4DN9A 3HX9A 5FLXY 4DR3F 4HEA9 1HNWJ 1F9FA 2PEHA 1RJJA 3OFHA 4J9LA 1HWIA 4NLGA 2FVSA 2DEJA 1H72C 3ELHA 4K0KF 1HA1A 1TK5A 1SIZA 2AYGA 1NPRA 3R2DJ 1HBUB 2CDQA 2IDLA 5HQLA 5D0GA 1QAYA 4NLPA 2X7IA 3M2RA 4ZJLA 3S8SA 2FVQA 1XQIA 1YZ7A 2GJIA 3DXBA 3FDSA 4OI2A 1OIAA 3ZTRA 3UNYA 4LSNA 4AE5A 4TQRA 4CWBA 4FS1A 3PKMA 4R5PB 1I94J 2W7AA 2IHR1 2VG6B 3M30B 1MWQA 4JV1A 1P9YA 4QWAA 1ZTWA 4ZPTR 4AXJA 1KRPA 3LP2B 1Q81T 2IJRA 4C8ZA 3KK2B 4OZ5A 4HYKA 2LP4A 1RT6B 2YNIA 1S1TB 1WC6A 2ZD1B 2RSQA 2QA2A 3DOLA 2YX1A 3W65A 5EWFA 3PW4A 1NSAA 1FXRA 2GMHA 2Z2YB 3JSMA 2YQ0A 2HS4A 3TP2A 2MJNA 2RRBA 1BQMA 2R8HA 2R8JA 4U7UK 2ROPA 2JFDA 2KDOA 2WAQD 3SDEB 2ZM6F 4B9SA 1C2PA 3THTA 2W4DA 4NLQA 4P75A 3G8TA 4JYAJ 4U7CA 4YB6A 2P2CB 3CUNA 1RE1B 3RB3A 5DM7Q 2DXDA 1N36J 3CO0P 1HI1A 2P9EA 4MIWA 4WE1A 3MM7A 1HBMA 3SXLA 2Y8YA 2IY5B 2ZFHA 3QT7A 4LREA 2DNRA 5B0FA 4DPOA 3T5HA 1LFWA 1EP4B 3VGSA 1D9DA 2FD2A 1FKOB 2YWEA 3AA8A 1LEOA 1VRUA 2UV8G 5BYRA 4P10A 5K8PA 1WF2A 2VOOA 3CJ2A 2X1AA 4IH6A 2CJXB 3EXYA 3J81U 5LM7E 1HFEL 3PTWA 1REVB 1LW2A 2NXJA 4NEZA 3H2UB 4YR3A 1YJRA 3H42A 1GNKA 1TKTA 5JVHQ 2A6OA 2F40A 1KFDA 4DX8H 4DSLA 2VICA 4TXSA 4YP3A 2LA4A 5HK4A 2IA6A 1MMNA 1NKCA 1TKXA 5IFMA 3UD5A 3HM9A 3DKDA 2YNHA 2I1RA 3QIDA 4RW6A 1OSDA 3OUYA 2Q6BA 2HHHJ 4C8OA 2HWTA 2KJVA 3B82A 4OIXA 4DSJA 2FLPA 1LXJA 2CDRB 3DRYA 1MROA 2G2YA 3NGKA 4JI1F 3AODA 1SUQB 4GKKF 1S1VB 2V2KA 5ETLA 3AAWB 2V8PA 3AQOA 2HK3A 1RLCL 3IAS9 4ECWA 3ILIA 3QZ8A 1QVGR 4B3RJ 2FJXA 3AD8C 2R2RA 3QSIA 1G7CB 3IN5A 3MR6A 1TP7A 2I0XA 3CCLS 4EYIB 4RNHA 1G1XA 1U6ZA 1K1SA 2E1PA 4EO8A 1SQGA 4CT8A 1S1XA 4Y28C 1HQEB 5KAKA 2ZH9A 2VA2A 4IDKA 2QMUB 4M5IA 2CVEA 2E7XA 2PA8D 5KFMA 2RS2A 4K4WA 4GO7X 1VBYA 2G0JA 1QAJA 3NRBA 1KQSR 2F1FA 2VC0A 3VGUA 3OL9A 3OHAA 5D3GB 3L7OA 5G4DA 3CF5Q 2G1HA 3E01B 3QAEA 2ZJRQ 2Y1JA 3DLJA 1JLBA 2CQDA 1DHMA 1Q95G 3M6WA 3QGIA 3N0VA 4EWTA 3GQCA 1R43A 2ZJPQ 3V6KA 1QM9A 3D0IE 1UL3A 3CJTA 3GYXB 4CI0B 2XSJB 3MD1A 2KM8C 4F50A 4B9TA 4PEOA 4F02A 2HNYB 3IRXA 3Q8YA 3W64A 4QIEA 2VIHA 4DLEA 1T94A 1T95A 1V6HA 3SBMA 3H40A 3RR7A 3HFVA 3C46A 3MPDA 2OPPB 4OLOA 4CTAB 1BQNA 2IVFB 1PBAA 2XY5A 2MQMA 1S72S 1KONA 5KFHA 4B3SF 5J2PB 1EKSA 1RBLA 2OEKA 5K9FA 5EX3A 4UUXA 1XMQJ 2M9KA 2SXLA 2CQPA 1KTQA 3NCRA 4C0BA 4Y34A 1EAYC 3UD4P 3MMBA 1XR6A 3M8QB 2UUCJ 3QJJA 2XGPA 3DRPA 1EB0A 4FDFA 5KFYA 4LF7F 3R7NB 2NPIA 3ZTQA 2CQIA 3I5AA 4Z2XA 2RU3A 4JI7F 3K0JA 3O2IA 4UY8T 1OY6A 1NNDA 4YUDA 3ADAC 3MCMA 3FUYA 3WX8A 1NAQA 1M5SA 3HZGA 1QD1A 3LH2S 3TEHB 3OTCA 1RKJA 1NJIT 3HK2A 1CQNA 2BABA 2MZRA 4IH5A 4DV0J 4C97A 3KLIB 3DMJA 1Y9OA 2HSEB 3FBCA 1WEXA 4PPDA 4ZITA 3I4PA 5K20B 3M9MB 2WVCA 3C14B 2C2RA 3KOAA 4YB5A 4PWUA 2XHWA 4ZP7A 3T6BA 2E5IA 5KG2A 5EWEA 3H0PA 1SJFA 2BEFA 2B4OA 2I5JB 1KQFB 4YB7A 4A48A 4ENOA 1YG0A 4HHJA 1FJGJ 1ZPWX 2E1MC 3H8YA 1UCNA 3P8BB 4GC6A 3DLLQ 2AX0A 4P2MA 4URQU 3LP2A 2BQUA 3QFHA 2V4JB 3WHIA 4M94A 3KJVA 2NYIA 2DH7A 1ZM9A 2A2CA 2DY9A 3CB4A 5A8KB 5DGAA 1N34F 1DTTB 3BDPA 4NWBA 4Q0BB 3H7HB 1PILA 2XI3A 4ZLNA 3M2RB 4XPEA 2VKZG 4DS4A 5CH7B 4MK8A 4URGA 1UEVA 2HFZA 3NBPA 4R0EA 3FVYA 4ZVUB 3F73A 5KG6A 3U1NA 4ALZA 1WORA 1M5PC 3OLBA 3CJ4A 2XCPA 4LSNB 1U1OA 1IJFB 4F3OA 3GSIA 3CXCR 1X9WA 2DH8A 3NS7B 4LVOP 5AJ3J 2PFDA 1KLMB 1SH0A 1RU1A 4J9KA 3BBFA 3RB6A 2CJ9A 2MEWA 3UPFA 2N3LA 1C4CA 3LAKA 2ACMA 3U1MA 4HDGA 2XYPB 3DLEB 4ZS6A 1FDDA 1HNVA 2X51A 4X62J 2UVUA 1NZ8A 3J7A1 4O44A 1M5HA 5M2RA 3O44A 2W2PP 2E1CA 2RF2A 5C25B 4JI6J 1B4SA 3HI9A 1XMOF 4WFXA 2OD4A 1ZAXA 2LYVA 1UW4A 1EP4A 3KLVA 4K7QA 5AXMA 2AJ4A 3Q8PB 4KTQA 1VHIA 3VTIA 3PCOB 1SL1A 2PSZA 5ETNA 4ICLB 3DHWC 2C22A 2ZBIA 2CVIA 3CCMS 2BM0A 5IT9Y 1IVZA 1N5SA 3DGPA 3KLIA 1IWAA 3HSDA 5GAHU 3R1HA 3CDAA 3H5UA 4Y2KA 3D3BJ 3M32B 1VHFA 4DI6A 1WG1A 2ZH8A 5KOWA 1FK9B 2QN6B 2AZ1A 4DL0C 3LP0B 5I3UB 2ZKUA 4CO5A 3HHEA 4OX7A 3CD0A 1KBRA 6FDRA 4FVMA 1VJWA 2ZDOA 4KYZA 3GCWP 4CLYA 1OMSA 5HP1A 2FJAB 3DNCA 3IBFB 3PACA 1U2CA 4PAAA 2NYHA 3MUVP 1U1MA 3MM9B 2ZH1A 4ZJQA 1WD6A 1JJ4A 4R5PA 1I94F 1N0UA 3C16A 3TYTA 2PT0A 2CADA 1NBEB 4OI4A 3HVTA 3Q83A 3E3XA 4MTPA 3LWLA 2JLEA 4NA2A 2BKOA 3AOCA 4ZVTB 1U1LA 4MK9A 3OSPA 2BJDA 1WOPA 2AYEA 2KVQE 5DDOC 2BE2A 1SH3A 4BWJA 1RQ0A 3HULA 4LFAJ 4XIUA 3KLEB 3NGSA 2Z58B 3R5BA 4JYAF 4YN3B 2EG1A 3CTRA 3J7Z5 5A8KA 4ANEA 5I3QA 4FYDA 2HRYA 1DFDA 2I9SA 1FXLA 5L9XA 3BN4A 4QIWD 4R8UA 3U27A 2VPXB 2XMAA 2VB6A 2HLTA 1M1KT 4MH8A 1MWZA 4WYWA 1C0UA 4DV1J 2F63A 3DRSB 1B7YB 2GS8A 2PA3A 4DV5J 2YNFB 4FPIA 2PDAA 5GMKa 2HWHA 5F8JA 4HI1A 4O23A 2H3EB 4YMEA 2XYGB 5B08A 4F2SA 2ZOFA 4CLPA 2QYGA 4F4KA 4DSIA 1F3FA 1HIYA 2X1GA 2YNGB 2F5GA 5A6PA 1AUSL 5C24B 1HYSB 3IS9A 3ENQA 1H0HB 4P9SA 1RACB 3K5NA 4OJ1A 2RMLA 4DL7A 3M2UB 2B4VA 2IRYA 4DL4A 1YIJS 1PCAA 2Q3PA 3MM8A 4DPTA 2YKQA 4URSA 5KTQA 1SL2A 1XNQJ 4LFBF 1S1WA 2XY6A 3TX0A 2VH7A 3G6YA 2ZITA 3AHPA 3W66A 2CQBA 4QU7A 3RU0A 4DZDA 1JLQA 1GEHA 4I4BA 2CJKA 2L9NA 4O0IA 3PIPQ 1OSCA 5K8MA 4UW2A 2C3YA 1CC7A 1RHJB 3CW2C 3GTYX 2HZCA 4WYLA 2VBXA 2ZVIA 4QWBA 1TL7B 2R8GA 1WOSA 1IKXB 3IG1B 2W9CA 2HVZA 1T02A 1HQUB 2MQ8A 1PC5A 1XWLA 1ZA1B 1J5EJ 3WIVA 4LBIA 4O3QA 1U25A 1OY8A 3FRYA 3WIUA 4KC5A 2HNDA 1LWFB 4DX6A 3PO5A 1WC0A 2N4DA 3OHBA 5D8HB 1EQ0A 4I6YA 1TTHB 2VPWB 1RTHB 2XSFA 3MWBA 4J9SA 5CXTA 2DEIA 3NBPB 3BR9A 2IM0A 3GJTB 1T9TA 4Q5VA 4RW8B 3MEEA 1VFJA 4K2JA 2L9WA 2V8VA 4USHA 3MTJA 2RD5C 1IN0A 4F4XA 1BQMB 1GQEA 2YNFA 4JOUA 5KT5A 2FC9A 3OTOF 2WK4A 4O3OA 2DISA 4OYWA 5U47A 1SH2A 1FESA 2UV8A 5F3TA 3ZC4A 3T5JA 5IS2A 2DGQA 3DRXA 3TUJC 2J8SA 5KFLA 3ITHA 1RKIA 2GQQA 3WBZA 4HTJA 1GK8A 5IOLA 2DGXA 1TVRB 3BKUA 4L76A 1D3WA 1MU2A 4AYBD 4C98A 2HIYA 4F3MA 2E5LJ 1HNWF 4Y2MA 2YQ1A 3R5GA 4MKVA 3KKFA 3W2VA 4J9NA 3QWPA 2J5AA 2O5DA 2RIJA 3BEGB 5K14B 2U1AA 2HS0A 5ITHA 5DQIA 5I42B 2L41A 1PYSB 1SV5B 4A8OA 4DR2F 1U1PA 4UOHA 1R8HA 1RGVA 3L3CA 3PJWA 4X4VA 2YNHB 1FD2A 2LDYA 4FYYB 1RA7A 3CMQA 4NCGA 5C42B 1B70B 4KR0B 2MKCA 4PXEA 4ZP9A 1R7IA 3WX4A 5LT5A 1Y10A 4EZ6A 2ZH6A 1V3SA 1NSQA 4M5LA 1H74A 4AQYJ 4LRCA 1FKAF 2QRRA 4CLWA 4NX9A 5DQHA 4Q43A 2QL5B 3MDFA 2W4CA 2YKAA 4JI6F 1KP6A 2DNMA 3UCUP 3JQMA 3NY0A 1L3TA 2PMZD 4YR0A 2MKHA 1ZETA 3KG0A 1TKXB 1VQNS 4KE5A 4B3RF 3SSQA 3KTQA 3T1AA 1RA6A 4P7VA 1N6QA 4U7UD 2EKNA 1Z4UA 1RHMB 2O67A 1P8GA 4PG6A 4DSFA 2XMKA 4UF4A 5IWAJ 3M2UA 2KRBA 2QA4S 4CYUA 4ZK7M 1HNIB 3QWUA 4BWMA 2ADCA 3G8QA 3H5XA 1URRA 1RZMA 1WC3A 3IBWA 1GXUA 3L7PA 2BM1A 3FSIA 2H1YA 3QIPB 4ID5A 2EBGA 3N01A 4K4VA 1RISA 2CPIA 4JI3J 2DGUA 2K7JA 3MM6B 3SQGB 1PO6A 2VQEJ 1B7FA 2DNOA 2WVBA 2RDJA 1FF2A 4JI8J 3MEDA 1D9FA 1KOHA 1VQOS 3IC1A 3BO4A 5EN1A 2BANB 1E6YB 1S1TA 4CO4A 1VQ4S 2BR0A 3D7SB 1M5KC 1RWWB 1HQ2A 1U0SA 4DS5A 2QL7B 4N8OA 3V6DB 1BMQB 3LALA 4O44B 1IKWB 3JXOA 4Q7AA 4ED4A 2BBEA 3GILA 1PAUB 1RSCA 2XMVA 3CCVS 2QYCA 4ZMMA 1SB6A 2W8LA 2IBKA 2WBRA 3NGUA 1RK8A 2YX7A 1R0AB 1NO8A 3TWZA 3W63A 2P9GA 3OL6A 3PFEA 4J9MA 1NK9A 2Y3YA 2GQ2A 3I9ZA 2CNOB 4TYAA 3H5SA 4FNHA 2Q1LA 2Y0BB 2GAGC 1NSKL 3VR1A 1CPZA 3H98A 4PKDB 4EZ9A 1YDLA 1XR5A 4K4TA 1AYEA 1QE1B 4ZLJA 1DTQB 2KM8B 1U0HB 2FY8A 2O1PA 1ZA2B 4DR1J 3QJPA 2P6SA 4AL5A 4DR6F 4RW6B 1SQFA 2F65A 4K59A 2OTLS 3BGRA 1QTNB 2E9TA 1E6VB 3ZZZA 3CSKA 2L08A 4BS2A 3W3SA 1F2HA 4LFCJ 2LQ8A 3VAIA 3TX8A 3HP6A 2ZNYA 2M5YA 3MURP 4ZVQB 3FKBA 2DJWA 2OELA 3TQEA 2IM1A 1YK9A 3HZEA 2OPSA 4FKXA 4Q2LA 4DR6J 1NM2A 4X4RA 3JB9k 2HMIB 1S6OA 4L6V3 4QYZJ 4WIIA 5HMXA 5GAHI 2JEJA 4RUAA 3PR5B 2YKOA 2FVCA 4USJC 1TV6A 3FSYA 3IR6B 1X0PA 1X4DA 2M7SA 3HLUA 3QT6A 3ZZUA 2M0GB 2J0QD 1G2EA 3SFUA 2VG7A 5EDWA 1SQEA 4K8RA 3BPSP 4F26A 3AJ2A 2FHJD 2XMWA 1DURA 3NP5A 3V4IA 1Y5IB 1OS5A 1WG4A 2EG2A 3OT9A 4KRWA 3U1LA 5DDQC 1TL3A 1WEZA 5CYJA 4KO0A 4JUZA 1Y4ZB 1IUJA 3I4HX 1TL5A 4NLSA 5DG8A 1S97A 1Q7LB 1WKJA 4CH0S 2G2ZA 2QT7A 5BR8J 2VJUA 2BJ1A 1C0TA 4RU9A 2WW8A 2WB1D 5AJ3F 3J7YI 2IYGA 1S76D 2ZWOA 4Q44A 4HACA 4A8SA 1EETB 3F44A 3W7BA 5CCLA 1IQZA 2AT1B 3ONQA 3ZO7A 1RWNB 1QSYA 4B3TF 1B0VA 2OSRA 1F6TA 4LF9F 2VASA 4MIAA 3ZFVA 5DETA 3DI6A 1WF1A 4KAIA 2VHGA 1UKUA 4DV4J 2GHVC 2OMLA 3QZ7A 3R3TA 4DV0F 3GFHA 3NLCA 2JX2A 4H4KC 1UPPA 1BQXA 4DFKA 3MZIA 4DU8A 1GMVA 4G1QA 2KRRA 2VBWA 4M1KA 3QYYA 4LMZA 1F5BA 2JNJA 2YWWA 1M90T 4ZHRB 2ERRA 5EX0A 4DF4A 1RWMB 3T1YF 1DY3A 4M5DA 2CNKB 1SL0A 3QO9B 4XPCA 2LEAA 4LF9J 4X4PA 1UZHA 4M5HA 5L1JA 3I56S 1IBMJ 2EEYA 3H59A 3D0GE 2ZZMA 3N28A 2NXCA 3DC2A 1YJWS 4PUOA 3QGPA 1G6BA 4JBCA 4ZKAA 1URNA 1HR0J 3ZZPA 3I0RB 2CZ9A 1CJUB 3QT8A 2J9CA 1I5OB 1H2UX 2MQNA 3MR7A 1HD1A 3MF5A 3NKYA 4P72A 5I3UA 3CDUA 1RWXB 4H4MA 4OYMA 3TNVA 3Q8SB 2ZHBA 3CULA 3HVWA 4ECRA 3EVWA 2HHPA 1VGYA 1WELA 4PR6A 1RWUA 5F8LA 2RQKA 3QIPA 3MPYA 2GIRA 3OJSA 3GFYA 2D3OR 2QL9B 2HHSA 1N5QA 1YRTA 3HFKA 3TUIC 3VZHA 4QWDA 2VG7B 3OR2B 1ITPA 3G82B 1K0VA 2HWIA 1MN7A 1HNIA 3MEDB 4XDCA 5MAOA 3K5MA 5L1IA 1HHSA 2POKA 2F3JA 2MLXA 1YKWA 4NLDA 2JOQA 4NYZA 2CWKA 1M1GA 3SCIE 4MMOA 4LIWA 2HVEA 1YJUA 3OVBA 4MKBA 4ID5B 5EUHA 1KWMA 1IKXA 3DMJB 3IG1A 1P1LA 1XN9A 3PR4A 2QFIA 1WSVA 3T1HJ
chains in the Genus database with same CATH topology
5AE2A 4DQQA 1VQLS 4N41A 3KK3A 4K4ZA 2BXJA 3PW7A 3PRBA 4BBYA 2DNNA 2CQ4A 2YWKA 2VV5A 5K5MA 2MKSA 1DBDA 4KSEB 5E0OA 2OP5A 3PFOA 3KK3B 5AXKA 3TO8A 2D9PA 1UVNA 1FEHA 3ZZRA 5L8RC 3G6ES 3N4WA 2XMTA 5CQGA 5D4OA 2W9BB 2HNYA 2ZE2B 3IRXB 4G1PA 1N4LA 1VK3A 4UOCA 1SJ3P 4MFBA 1ULRA 3I5CA 1U47A 4WXWA 4O4GA 2E5HA 2BRLA 4DR5F 2MJUA 4QR0A 3TARA 5I42A 2YWFA 3N6NA 1R0AA 2N7YA 4YDXA 1FVQA 2J8AA 4JV5F 3J7ZT 4C8YA 1Q16B 4IQMA 1S9FA 3JSBA 3FZBA 5C5JA 2B6AA 4PG5A 1BC6A 2J6SA 3T5KA 3CJKB 2XEXA 1RT4A 4HH0A 2GX8A 4RNMA 4YFUA 2E5JA 2AD9A 2DR5A 4FBTA 3EXCX 1X8DA 4A8YA 1ZAWA 4RW7A 4V19X 1AFIA 1HPZB 3J80Y 3TW0A 4ECTA 3RRGA 2GQCA 1TFYA 5KFKA 1HI0P 2CYYA 4IFVB 1HBUA 3PR4A 4Q44A 2X1AA 5CYQB 2R4FA 4OHXA 4ZP9A 3PXGa 1HW9A 3M6VA 1A7GE 4IOCQ 1MWYA 1RT7B 3OR1A 4JI4F 2W25A 4ECQA 1TK0A 1SXLA 4HH1A 1F60B 3HVTB 4I6AA 3X3UA 4DUYF 1HQUA 3GIIA 3RBDA 2B9YA 2CFXA 3TOQA 5IQ6A 3IGVA 4X4NA 1BY9A 4RNNA 1CQMA 3K8VA 1UJ4A 3G4SS 5KFBA 1L5UA 3CDBA 2Z8QA 2DCLA 4ZPDA 3U7JA 4KPYA 2OPQA 5IQQA 1IKVB 4G3IA 1SJ1A 4RKUC 2YKNA 2OPPA 2V4RA 3MMAB 4X66F 1FRJA 5K8NA 4FF3A 5GAEI 4QR1A 3FFIB 1WG5A 5J1NA 1MU2B 5MLCV 4U9RA 5AE3A 5B7WA 4FF4A 1S10A 2NR0A 2M2BA 4CO2A 1YSJA 2ZBCA 3I0RA 2GMJA 2YNGA 4CCHA 4TU8A 1Y0HA 2DRAA 1JNRB 5CZVA 4WZQA 1IKYA 1FRXA 4NLTA 2PGCA 3BGLA 3K8WA 2LECA 4Q2MA 3QO9A 1H2VZ 3KLFA 2DNLA 3TR5A 4C11A 4EBEA 4KJIA 5KFIA 2KT3A 1HWJA 4DV3F 4ED5A 3PHEA 1IJEB 3I87A 2R8IA 3THPA 1ZBTA 2MY8A 4OV1A 4I7FA 3M2VB 5JVGQ 4LQ3A 4F8RA 5JJBA 1MROB 3FEYB 3VAFA 2FVPA 1J5EF 3KNGA 3THVA 1S4FA 1YTYA 3PM9A 4ILRA 4IRCA 1C1CB 2KHCA 3DLHA 4YDDB 1JK9B 5J2MA 3NAIA 1GT8A 3VALA 1U26A 1KEKA 4LVNP 4OMFG 1HWUA 2BA9A 2ASJA 2E44A 5KFJA 4ES2A 1JLFA 3LP0A 4ED1A 1T7PA 3HHNB 2XC9A 5K8OA 4ZA1A 1TL3B 2XI2A 2JSXA 1TKZB 1O51A 5FIIA 4DFJA 5D4LA 3N5FA 2KZMA 1RT2A 3DM2A 3PIOQ 4C0OC 4JI0F 3BSAA 4ES3A 2JLGA 2W8KA 2VONA 4O3NA 3AB4B 4TN2A 3UQSA 3NMRA