2MYFA

Solution structure of rna recognition motif of a cyclophilin33-like protein from plasmodium falciparum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
b'GSHMSDNNATDILFVGGIDETIDEKSLYDIFSSFGDIRNIEVPLNMTTKKNRGFAFVEYVEVDDAKHALYNMNNFELNGKRIHVNYSKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RRM containing cyclophilin
publication title Solution structure of RNA recognition motif of a cyclophilin33-like protein from Plasmodium falciparum
rcsb
source organism Plasmodium falciparum
molecule tags Rna binding protein
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2myfA00
2KU7A 1K9MT 2RT3A 1N54B 2M0GB 3V4MA 2XB2D 2U2FA 1YHQS 1QVGR 1AUDA 3B4MA 1FT8A 5EN1A 3IRWP 2MGZB 1FJEB 1JJ2R 1M1KT 1WHVA 2DHAA 3UD3P 2KXNB 5GAGU 2HZCA 4TU8A 3G8TA 2G0CA 2OTJS 1HL6A 1SJQA 2M8DB 2OIHA 1N8RT 3TO8A 3UWTA 3I55S 3RW6A 2DNZA 3P5TL 3THPA 4F26A 2N3OA 3MUMP 2U1AA 3G96A 1QVFR 1X4BA 3CC7S 2DO0A 3BEGB 5CYJA 2DH8A 2D3OR 1R8PA 2E5HA 1L3KA 2GHPA 1SJFA 2MQLA 2DNPA 3OW2R 1X4AA 5FJ4A 1N52B 2JVOA 4CH1A 1VQOS 3CMES 3G9CA 2F3JA 2MZSA 1WI6A 5D78A 3K0JA 3JB9k 1U1NA 1B7FA 2EVZA 3PIPQ 1W2BR 2HGMA 3MUVP 1YJ9S 2BOPA 3IWNC 1H2UX 5ITHA 2MSSA 3VAMA 2FPHX 2LYVA 3MI7X 4WFAQ 1OIAA 2X1AA 3CD6S 2LMIA 3TP2A 2DIVA 4C7QA 2XNQA 2E5GA 2LXUA 3EGZA 1U1MA 1DBDA 2O3DA 2GO9A 2KVIA 1X5OA 2E5JA 1VC5A 3L3CA 4FXWA 2M88A 3Q2TC 1OWXA 2CPEA 2DGUA 2HGLA 1VC6A 2CQ3A 4Y0FA 2L08A 2X1GA 1VQPS 3N9UC 3CCES 2XS7A 1IQTA 2VODA 5IFMA 4LJMA 4CIOA 1HD0A 3CC2S 5CXTA 3HHNB 2MKSA 2MY7A 2DNNA 3DLLQ 1WF2A 2CPXA 2JVRA 2QA4S 5JVGQ 1KOHA 5GMKa 2J76E 3TYTA 2KI2A 3MD3A 2KG0A 2KHCA 1G2EA 1A9NB 1U1LA 5H1SV 1FXLA 3S6EA 4TU7A 5GADU 2DGTA 1VQNS 1H2VZ 3BS9A 3B4DA 1VQKS 3EX7B 1WELA 1X0FA 4UY8T 2F9JA 2CPDA 3LQVA 4WF9Q 3CCMS 4C0OC 5DETA 1VBXA 2DHXA 1UAWA 2ZJQQ 2B0GA 1FJ7A 1HA1A 1WWHA 1VQ5S 2VOOA 3VAHA 2RS8A 1WF0A 2RQCA 5LSLA 1VQMS 3CPWR 3P49B 1S72S 3G71S 2HGNA 2CQPA 2MQPA 1R8HA 1SXLA 3R27A 3MURP 1QM9A 1FO1A 1VBYA 1DHMA 4FXVA 2E44A 2AYBA 1WHYA 3VAFA 3CCSS 2M70A 1WHWA 3UCGA 4WCEQ 1X5SA 1M5PC 2JWNA 2FC9A 1FHTA 2RRBA 1X4CA 1SJ3P 4OZ0A 1WHXA 1VQ9S 3G8SA 2YKAA 1ZZFA 3NNHA 2MQQA 2DH9A 4U67Q 4QPTA 4EGLA 4OZ1A 1DRZA 2WBRA 2MPUA 4ED5A 1RKJA 4PR6A 4WFNQ 2XS5A 2D9OA 1DZ5A 4ERDA 3U1LA 2CPFA 1XN9A 2FHOB 3SXLA 2EK6A 3CUNA 3ULHA 5MLCV 3UE2A 1VQLS 4QU6A 5D77A 3CULA 2Q79A 3CCQS 2HVZA 2AYEA 3CCJS 3S7RA 3FEYB 2CQHA 2DGSA 4Y00A 3UD4P 2K3KA 4W92B 1JJHA 1WF1A 2PEHA 1WEYA 1SJ4P 1UW4A 2ERRA 2KN4A 2OSQA 5DM7Q 4F02A 1S79A 2RUGA 2YH1A 1ZZNA 3NS5A 1WG4A 3DXBA 3S8SA 2N82B 1M90T 2ZJRQ 3CXCR 2RVJA 5IM0A 3Q2SC 5LSOA 4C4WA 1URNA 1U1PA 2KT5A 3MXHP 1U1RA 2CQ1A 1VC0A 1WEZA 2MSTA 2DHGA 1CVJA 3SMZA 3CCRS 1KOOA 4TU9A 4PRFA 2LEAA 4IO9Q 2N7CA 1WI8A 3CTRA 3VAKA 5GAHU 1JJ4A 2XSFA 2V94A 3HI9A 2DNQA 5LJ3Y 2HYIB 5DDOC 2DNYA 2DNGA 2EK1A 2MYFA 1U6BA 2OSRA 3MOJB 3UCZP 5DDQC 2NZ4A 4YOEA 2ZJPQ 1FNXH 2CJKA 1UFWA 1VQ8S 1ZH5A 2MZQA 5DDPC 4LMZA 2KXHA 3G6ES 1Q7YT 1D9AA 1M5OC 4W90B 2VONA 3SDEA 2K8GA 3PIOQ 1X4GA 2MZ1A 3ZZZA 1K73T 2MQNA 1VBZA 2ADBA 2X1FA 2YTCA 2QEXS 3P3DA 2DGWA 2CQBA 4RU2A 3NMRA 2ADCA 2L41A 3J7ZT 2D9PA 2LA4A 1X4HA 1Q86T 2DNOA 2XS2A 2CQCA 3RW7A 2DHSA 3G4SS 1UP1A 2RRAA 2AD9A 1F9FA 2CQGA 5JVHQ 1U6FA 3VALA 2M2BA 2DIUA 1U1QA 1O0PA 2DNLA 1SJRA 1X4EA 3NS6A 2YH0A 5HO4A 2RNEA 1M5KC 1U2FA 2QFJA 2DH7A 3UCUP 3R1LA 2M52A 1YTYA 1Q81T 3NNCA 2MGZA 1YITS 4P6QA 2KM8C 2KH9A 1Q82T 1FJCA 2FY1A 1A7GE 2MQOA 1P1TA 1BY9A 5HL7Q 2DGVA 2A3JA 1KQSR 2LQ5A 4QU7A 5BJRA 2KFYA 2KG1A 2MQMA 2RQ4A 2DB1A 4ZKAA 3CF5Q 2JX2A 3CCUS 2LXIA 3LPYA 2DNRA 2M4MA 1X4DA 2CPJA 2J0QD 1JMTA 2CQIA 2DNKA 2MZJA 1U1OA 3CC4S 1N88A 1NO8A 1VQ6S 2CQ2A 4V19X 2DGQA 2XNRA 2CPHA 2MKCA 3EGNA 4IOCQ 5IQQA 5LXRA 2MXYA 1WG1A 4QQBA 2BZ2A 2DNHA 2L9WA 1X5PA 4CH0S 4CQ1A 2FC8A 4A8XA 1NJIT 1OO0B 1WEXA 2CPZA 3MD1A 4YB1P 2MKKA 1RK8A 4Z2XA 2MY8A 2NLWA 2LECA 1VQ4S 2VOPA 2KRRA 5CA5A 3VAGA 3H2VE 4M5DB 1PO6A 2I2YA 2LA6A 2MHNA 2CQ4A 2E5IA 2MKJA 4WIIA 2AYGA 2DNMA 2LCWA 2CQ0A 2LKZA 2MZRA 4PKDB 5LXYA 3CCVS 2M9KA 2DGXA 2KYXA 4IUFA 4F25A 2JRSA 2CQDA 2N3LA 5IM0B 2KXFA 4UQTA 3VAJA 4LIRA 3BO2A 1WTBA 1WG5A 2KRBA 2OJ3A 5DM6Q 1OPIA 3J7YU 4IOAQ 2MJUA 3BO3A 1H6KX 3D2WA 5GAEU 1YWXA 1U1KA 2CPYA 2MKHA 2M8HA 2YWKA 3FEXB 2DK2A 2DISA 2RS2A 2I38A 3CMAS 3BO4A 5GVQA 4J5OA 2M7SA 1YIJS 4TLQA 1PGZA 3H2UB 2MMYA 3I56S 1D8ZA 3R1HA 2J0SD 1VQ7S 4WFBQ 2MKIA 2SXLA 3NNAA 3P6YC 2MZTA 2PE8A 3CCLS 1YI2S 1X5TA 2G1DA 2J8AA 2MB0B 3U1MA 5DDRC 3US5A 1M5VC 3SDEB 1KD1T 2DO4A 2G4BA 2X1BA 2RU3A 1P27B 1K8AT 2OTLS 1YJWS 3MUTP 4WKRA 2DITA 3S01A 3MDFA 3VAIA 2KM8B 3THTA 2UP1A 3VF0B 2CPIA 1H2TZ 4YUDA 1KC8T 2F9DA 1X4FA 4BS2A 2LEBA 1YJNS 1HD1A 5LJ5Y 2AYMA 2DGOA 3ZZYA 2MJNA 1NU4A
chains in the Genus database with same CATH superfamily
4JI4F 1RHJB 3H90A 1ITPA 5KFVA 4NA3A 3FCVA 4L6V3 3I9ZA 4B9LA 2IM3A 2R8GA 1L3UA 2OTJS 4LRFA 3UWTA 3JAMU 4A8SA 2OD4A 2B4OA 2DO0A 1RAGB 4TYBA 1WSRA 1WNEA 2DNPA 3TVZA 4NZ7A 5KFNA 1APSA 3P8BB 2F3JA 3LAKA 2A6OA 3TUIC 2V4QA 3TAQA 3WHIA 3NMAA 2HGMA 3MUVP 2AJ1A 2RHSB 2XZDB 1H2UX 1BC6A 5KFMA 2QLJB 3P4UB 1K1SA 3MPUB 2YNFA 2FZCB 2ZKUA 5D4NA 2R7OA 1VC6A 2AW0A 4QIGA 4A8YA 5F8JA 4DS4A 1ZTWA 4F0HA 2MKSA 2MY7A 1VK8A 5AT1B 4WJBA 1QTNB 1UETA 5KFHA 3T5JA 5CYQB 2F40A 3SIPB 3AFGA 4C8NA 3B4DA 2F4VF 4ID5A 4JI0F 1RHKB 2ALZA 5MAOA 2XLJA 3DGVA 3DOKB 3LQVA 1GX6A 4NLGA 1UPMB 2ZE2B 3QT8A 2UUCF 3LP1B 3POTB 2RQCA 5HJYA 1FRJA 3WIUA 2R7TA 2VG6A 1MMLA 3I82A 1N6QA 4HEA9 2EFVA 1KTQA 1DHMA 1WHYA 4K4TA 2XZWA 4WIQA 3TNVA 5J2MB 1PJ6A 4GKKF 4DR2J 3OHAA 1VQ9S 2NR0A 2WOMB 1ZZFA 2W2MP 1CBKA 1RAIB 5F8HA 1S97A 4ZIVA 4F04B 3J7Z5 4USIA 2C2EA 1RUSA 4B08A 4OIXA 3KK1A 1GTEA 1MNEA 2IPOB 2DXFA 2HPUA 3GONA 3PW7A 1KBRA 4IR1A 1JB0C 4YDXA 1DTTA 2RVJA 3Q2SC 1ZTTA 3BGRB 2HRUA 1VJQA 4B3TF 1F2GA 1H72C 1QJHA 2XBPA 4MMOA 1U0HA 3QZ7A 1HWKA 4TU9A 1UTAA 2AEMA 3CT9A 4K4VA 2GQCA 1T9WA 3KK3A 3PTWA 4RUBA 1X9WA 1HWUA 4ALZA 2VPWB 4B3OB 2CWXA 2WONA 4L76A 4TXSA 3SDEA 1BQMA 2KO1A 5HLFA 1RQ0A 1VBZA 2KDOA 2KJVA 2XYPB 4R8UB 1PYSB 2D9PA 2HQIA 3RW7A 3MM6B 3M1VB 4O23A 5KFRA 4JYAJ 5IT9U 4Y2IA 1YDLA 4P2FA 1WDTA 2M52A 3GFYA 2R2UA 4RUAA 1SC6A 2KT2A 4CNYA 4BDPA 3OJSA 2BJ7A 5T41A 1FJCA 4F67A 1JLCA 5KFUA 5BJRA 2EC2A 2W9BB 2QL5B 3CCUS 3WX4A 3EGNA 4LF9J 3EXCX 2YKMA 2BZ2A 1N36J 2FC8A 2HRTA 1Y5NB 1NK9A 4F3QA 4IR9A 3Q22A 3QGHA 1WKJA 4RL1A 5FIIA 5J2NB 2B8PA 2AT1B 3QSYB 5B0CA 3H20A 3CB4A 2XY6A 4PEOA 5HVHA 4FPIA 2LQ8A 3IR5B 4Q5VA 3CCVS 3KLEA 4B3SJ 4F25A 2CQDA 1DQ8A 1KWMA 3TA2A 5EGYA 3JYTB 1LW0A 3KOAA 2KHDA 2CDRB 2V50A 2HWIA 2OPPB 4NXMJ 5HSPA 3DU5A 3G87A 4KE5A 4IQMA 2F65A 2XCAA 1PGZA 2CA9A 1CJUB 1SPBP 2J8AA 3MM9A 2V8PA 1XBWA 5JXSA 4FF3A 3AJ2A 3RZAA 5J2QA 3TAMA 1NB7A 3DN9A 3FZBA 2Q6CA 2PDAA 1FE0A 2ASJA 3OVBA 4R0JA 2MJNA 3AOAA 1GAOA 5CZVA 1EARA 4P73A 1KONA 5J1PA 1HQUB 3E01A 1QE1A 2OFGX 2YX4A 3D1HA 3I0SA 4TU8A 2ZDOA 2M8DB 1PYTA 1HHSA 3GJQB 3BEGB 4O0IA 1V3SA 2VQFF 4ZPWR 3T3FA 2AQ4A 3OD2A 3SEOA 1REGX 3A4TA 1Y9OA 1S1WB 3VZIA 4LF8J 1RAHB 1AFJA 1RWWB 1D0EA 1BLUA 4CYUA 2QL9B 3OR1A 5IQ6A 3MI7X 2DEIA 3EGWB 5E41A 2J0WA 4H4MA 2CJXB 4F3MA 2W4CA 3MM7B 1PBUA 4WPAA 3H5SA 3G2XA 5SZTA 1IBMF 3SYZA 4ETZA 2VG5A 4ID8A 2DGUA 3UR0A 4C11A 3PX0A 1XR7A 3SFGA 2DNNA 2J0XA 1KOHA 1X9MA 1QSSA 3M8SA 2FTRA 1WSVA 3ENVA 1FXLA 5GADU 5HQLA 3MM8B 4DX6A 4ZHRA 1NK8A 2YNGB 5C24B 2ZUGA 1VBKA 4V1Ak 1UAWA 4PUOA 4FYVB 3NBPA 3JSRA 1FK9B 2XCPA 2I1RA 2E1AA 3DLKA 1RWNB 2VA2A 3W64A 3UFCX 4DL0C 3R2DJ 3LWLA 2ZM6J 3IBWA 2FZKB 4N76A 2I9SA 2AYBA 3IRXA 5ETMA 2M70A 1AYEA 4DSKA 2IAJB 3AJ1A 3QAEA 4OLOA 1WHXA 3MMBB 1H98A 2PFFB 5E0OA 1VLOA 4EO8A 1DRZA 3T19A 4K0KJ 1RKJA 3D0IE 4EBEA 1RT2A 2H51B 3OHBA 2VL1A 4OYZA 2BW7A 2XLIA 2UUTA 3UE2A 1TK5A 1TKTA 4YQWA 4GVBA 5D77A 1BQNA 4ILMA 1EX8A 2UVVA 8RUCA 5CAAA 4W92B 4F4YA 1LWFB 2XWYA 2YNIB 2IFXA 2KN4A 1D3WA 4KH0B 1IXKA 1UCNA 5A8KB 1XR5A 3HD1A 4DX5A 3V6HA 2VZ9A 2R7RA 5BXIA 4FKYA 4IO9Q 2YKOA 3PFEA 2N7CA 3K5PA 3WX8A 4J9PA 2DEJA 4F2SA 3HMJG 3MM5B 2J6SA 2ASLA 4A46A 3MOJB 3PKYA 1CULA 4P10A 4LRBA 1HWLA 4LBIA 1EETA 1XQIA 1M5OC 2VONA 5E3QA 4O3SA 1HNWJ 3OTDA 1NJWA 3IC1A 2BDPA 3J7ZT 3M2VA 3OTCA 1ACMB 2QV6A 3KLIA 4C3KA 2CQCA 2Y0SD 2YPZA 2V2ZA 3QIDA 4OI0A 2ZH2A 4G65A 4ZVUB 4AYBD 1E6YA 4OQJA 1TP7A 4DWIA 2BJ9A 5EX3A 4MT1A 1SKRA 2B6AA 4FBUA 3SCIE 1YJ7A 1Z2LA 1RHQB 4DOZA 5G0RB 1HMVA 4O44B 2JOQA 1GFWB 1UZHA 2QMXA 1N34J 1AROP 3PCOB 1R0AB 1HR0J 1UEKA 3TVYA 3DOMB 4LF7F 4DI6A 3VVUA 3J7YI 2IMOA 3BKUA 4LRCA 4AXJA 1RE1B 4FF2A 1RK8A 2FGOA 2LECA 1NEEA 3CJ5A 3H2VE 1FEHA 1S0OA 1VCTA 2AV5A 3H4DA 5EDWA 2LQ9A 5F8NA 3TZZA 3DCAA 3K5LA 2QLXA 1KQKA 4O4RA 4LIRA 5BYSA 5HBMA 1ZA2B 1OPIA 4KV8B 3UR3C 1KVKA 3KFWX 2CPYA 3GR1A 2BJDA 2I38A 2CG4A 1RAFB 4PYDA 3QGPA 3OPKA 5HMYA 1VRUA 1TVRB 2Z2ZA 1CSJA 4J9NA 2VV5A 2VU5A 5IV4A 3MEGA 4RU9A 1M5VC 2H4YB 3KK2A 1NDCA 1IM4A 3CMQA 4ZCIA 3GJRB 4DV7J 2OPQB 2XB2D 3BSOA 2MGZB 2DR8A 5GAGU 1VHFA 3DRYA 2XO7A 2J7UA 3Q24A 2DD8S 1H7XA 1SJQA 5J1EB 4HDGA 1L3SA 2EW9A 5CYJA 3NRBA 1CPZA 1U45A 3KLGB 2IVFB 3RB0A 3MR5A 1OSDA 2UVWA 5G4DA 4AT1B 4B3RF 2WW8A 2MZSA 5ETQA 4QOTA 2B5JB 3QSIA 1VDHA 5E3AA 4PWDA 4M5LA 4DUYJ 4JI8F 2MSSA 2FPHX 3CD6S 2V6AA 2L48A 3PACA 4OZ5A 2GA7A 3I0RA 3ZTSA 1X5OA 1VC5A 4USHA 2A0FB 4KB7A 5D0RA 2HBYB 2F7VA 3R7BB 1Q5YA 5ETVA 3MR2A 5CHCB 1IKXA 1DJ0A 1JLGA 5C5JA 1MG7A 4FVCA 3CJ2A 1U1LA 3BM7A 4QWDA 1H7WA 2CPDA 3CCMS 1TUGB 2CJQA 3UDVA 4CWBA 4AE5A 3DHXA 3JQJA 5KFKA 2FUG9 2VA3A 1HWJA 3P49B 5KG2A 3ZZRA 1SXLA 4MIWA 1XNRJ 1UMJA 1HQEA 3MURP 4DS5A 2GZOA 1X4CA 4I68A 4HHHA 1DTQA 4KPCA 2DH9A 4OZ1A 2PO4A 3WZ0A 4DSJA 2WB4A 3NGUA 3TEGA 1NM2A 3NGDA 2ZH7A 4JI3J 1HFEL 2FVRA 4C0BA 3HVTA 5C25B 2VICA 4QU6A 3PDNA 4ANEA 2HVZA 1ZM2A 4EFAC 5RUBA 2HHXA 1WEYA 1UW4A 4FN5A 5DM7Q 1WG4A 5IT9Y 2OKQA 1RWXB 2ACMA 1B3TA 2WVCA 1RT1A 1URNA 2ACYA 3IFEA 1B0PA 2ZH9A 2VFVA 1S59A 1ICEB 2IMWP 2V2VA 3MPDA 2UXDJ 4GO7X 2YWFA 3VAKA 3HHKA 2XSFA 3K8WA 3D1QA 3DRSA 2HYIB 5LL6d 2G0JA 3TQEA 3KDNA 5A8WA 4IDKB 1ULRA 1FNXH 2V5HG 4LMZA 1NSAA 3RYLA 1X4GA 3HZGA 4ZN3A 1F2HA 4OX9F 2YTCA 3UQSA 1S9GB 2A2CA 2F8EX 3KHRA 4J9LA 3GFHA 3NLCA 1VQYA 3KHHA 2XGPA 1M1HA 2DIUA 3RGIA 4C0HA 1EKSA 2KZMA 3A8JA 3GE9A 3NS6A 5HO4A 3ET6B 2JSXA 2W8KA 1NKEA 2QFJA 1YTYA 1RLCL 1NK6A 2ZWOA 1K47A 2GIRA 2QA2A 3CJKA 3DM2B 2J0QD 1S9EA 3Q8YA 2MKCA 3IWLA 4HVZA 1LK7A 4J9VA 3HKWA 1DLOB 4NA2A 3FJ2A 4MKAA 4OYWA 5M2UA 1FKOB 2KRRA 3BGFA 2QZ8A 2I2YA 4EI2A 2H65B 2AU0A 3OL9A 1RKIA 4PKDB 2N3LA 2KXFA 3BO2A 1D1UA 2OUGA 1JLEA 4I7FA 3J7A1 4ECQA 2YWWA 2ZH5A 3H5YA 3HHEA 4G3IA 1T95A 1K1QA 2MZTA 1U47A 5I42A 1S6QA 2I5JA 4RW4B 2L9DA 3LP0B 1FRMA 4NEYA 1K8AT 4AQYF 3O2IA 2JC1A 3PJWA 3G6XA 3HVRA 2RQKA 3MEDA 1H2TZ 4OLPA 2F9DA 2IM2A 5KTQA 2DGOA 3D0HE 3CD5A 1SL1A 1N54B 7FDRA 3BGOP 3V4MA 3GMGA 2X7IA 3H7HB 4ZN1A 3NOGA 4K50A 3QJPA 2GGPA 1JJ2R 3RJMB 1MMDA 3GSIA 4DSEA 3EZOA 1BUXA 4BCAA 2XMAA 1VMBA 3QT6A 2PMZD 3G96A 3A8IA 3VV2B 2QL7B 4K0KF 2B9XA 4R5PB 1GXTA 2IJNA 3D28A 4DL2A 5EWGA 1EP4A 4OI2A 4DSLA 4K4SA 4PG8A 2RF2B 2IYGA 3Q8VA 3NS7B 1PCAA 2IYIA 2VDHA 5GADI 1MMNA 3HKZD 1HPZB 4FF1A 3NY0A 6AT1B 4ZS6A 2AIRB 5HMZA 5B09A 3M32A 1DY3A 5KFCA 4OMFG 1LXNA 4CIOA 1HD0A 3HHNB 5DGAA 5JVGQ 4Q2MA 2J76E 2VPYB 3CDBA 1SKUB 4DBQA 3EX7B 1TFWA 2QA4G 1UWBA 2VFTA 4LF6J 4JI1F 3R6LB 1HBUA 4YY3J 9RUBA 3PYEA 4ZPTR 5DETA 2RKIB 1E6VB 4DG1A 4EUVA 2R7UA 1HW9A 4TLRA 2HVHA 1AB8A 1HA1A 3HHDA 3M8RA 4PQUA 2OPSA 5F3ZA 2MQPA 1XNQJ 4RZRA 1VLYA 3PJ9A 1U2RA 2LXFA 1VR6A 1R43A 4ZP7A 1Y5LB 2IA6A 4WCEQ 1FWKA 3W2WB 4XAKA 2YWEA 3R6GB 2NZCA 3CJ3A 1S0MA 2H5EA 5IT0A 3JTOA 5I4MA 3C6TB 2IBKA 1HIYA 2D9OA 4IFVB 3AB4B 4HHJA 3SXLA 4NE9C 4DDFA 2EKNA 1P9YA 1CJVA 1S7IA 1TELA 4J9RA 1V3ZA 2ZBQA 4Q44A 2Y1JA 2E1RA 5LMUJ 4KHPF 2B7CB 2LEPA 1MN7A 4NLVA 3W66A 4UZBA 2E1PA 1FEEA 2Y3YA 2HFSA 3IXQA 1Y3JA 4CLLA 5AE1A 2HHWA 2WBMA 1WI8A 3M8PB 3QIPA 4CH7A 1S99A 3RTVA 2DNYA 2W4DA 4RO0A 1CS4A 5DS7A 3QATA 3DLEA 4IOBA 3UNYA 4K7QA 1UFWA 4RKUC 4BHQA 2K8GA 4ZVOB 3CD0A 3QGGA 4NASA 3CWJA 3MPYA 4ZVTB 3W2VA 3R7NB 3CVKA 5FDLA 4N8OA 1T9UA 4Y28C 5U47A 2YX7A 5KFZA 1Q86T 4UW2A 3RR8A 1HI8A 2ZH6A 4Q8FA 2HS0A 2DNLA 2Z0GA 4I2PA 3W5ZA 1RBOB 3R1LA 2IRYA 3UN5A 3QNWB 1VS3A 3BKTA 2UXBJ 1JLBB 3RBZA 2H48B 2RQ4A 1WOSA 3HT3A 5BYQA 5IXUA 3D3CJ 5LXRA 1R0BG 1WG1A 4B9UA 2C3OA 4CH0S 1IWAA 1NJIT 2HQCA 1HBNA 3JS9A 2GFFA 2CPZA 4TN2A 1TL3B 5K8NA 2NLWA 1Q5VA 1KTVA 4ANCA 4FYDA 3MAAA 2LA6A 1VQSA 3RAQA 1FWPA 4TVAB 3CDAA 1PBAA 1GMUA 3JSBA 1NNDA 5KFXA 3PRDA 1WTBA 4LSLA 2AWZA 3K17A 2JLFA 4O3RA 2W24A 2VF3A 2VBZA 1SC3B 2QSFA 3FVYA 7FD1A 1NB2A 3R5JB 1IBLJ 3NEKA 3GFXA 4NLYA 3D3BJ 2J7WA 1LEOA 3HULA 5CQGA 4ED8A 5GAGI 1KD1T 1S1XB 1AZSA 5ETKA 1RT7B 2VHGA 5CYMA 2CVIA 1SQGA 4DPTA 3KUGA 2C1EB 1KLMA 2EEYA 2AP6A 1JLQB 4KFBA 4LSNA 4IG3A 1K9MT 4A4JA 3M9OB 4DCOB 5IWAJ 1YHQS 4CLSA 3LUYA 3HLUA 2EPIA 5J2PA 1NDPA 4X4OA 4CLWA 3C15B 2CWKA 4F3OA 1HNIB 5D4PA 2VQEF 5M2RA 1N8RT 5B0AA 4F4WA 4F26A 4N77A 1F60B 3QLHB 2KJWA 4ES1A 5L1KA 1X4BA 2VASA 3FMWA 4CO3A 4UZCA 2GHPA 2HQGA 3H59A 1RWVB 4FNIA 3MECB 2CZ4A 2F8MA 3N0VA 4A8FA 4NI2B 4NLTA 1RT6B 2OH2A 1NPKA 4DV6J 3W60A 2FJWA 3Q8UA 2CNLB 5ITHA 3OR2B 4HLBA 2FIUA 4CLTA 4IYQA 2AX1A 1F5BA 2O3DA 4DR1J 4CLFA 1FVSA 3KNAA 3D6TB 3MCNA 1JX4A 2UUWA 2YNHB 2P8IA 1UJ4A 1RSCA 1V5IB 2CQ3A 3ENAA 3IGNA 3DLJA 3IAM9 2B8QA 4ECVA 1FKPA 5DQIA 3NCPA 2LP4A 4NRUA 3ILJA 4YR0A 1G2EA 5H1SV 1RWMB 4FP9A 1NK4A 4JI6F 2DYAA 3BQ2A 4NLSA 3KNGA 3LF0A 2VOOA 1S12A 2HNDB 1FF2A 4E98A 2NSCA 1EZZB 5HQMA 2EBGA 2HGNA 4DEZA 3J80Y 1LWCA 3UW1A 4O0NA 2D7SA 1OQ6A 3TANA 1M5PC 4Y2AA 4KBIA 2BM1A 4NMLA 1FA0A 4F8RA 2AGQA 1H73A 2QE5A 4U67Q 2DR7A 1TKZA 4ED5A 4O3PA 4WK1A 2XY5A 2IJRA 2ZEJA 4DR5J 3HFVA 4HI2A 4ERDA 1NHKL 5ETLA 2CPFA 4KO0A 1XN9A 1NKCA 1UPPA 1PKUA 4J91A 4DV3F 2FJXA 1OY9A 3DFEA 2OO4A 2ZZMA 4DL5A 2A2DA 1P8GA 1T03A 2CQHA 2K3KA 1HNVA 1TL4A 2NUHA 2HHHF 4Q0BA 4B9NA 4F02A 2N82B 2CNOB 4QYZJ 3CEDA 1CQMA 2IJFA 5LSOA 3PYFA 5KG0A 1RBLA 3N5FA 1VC0A 3M2UA 5D4LA 4DMZA 2YNFB 3EVMA 2HFOA 1F5CA 3AA8A 1VRTA 4DV1F 2H9ZA 3IO1A 4AFFA 4X64J 3JXOA 4P72A 5IC6B 3JTPA 2HHUA 1U25A 1I6JA 2HKEA 3CO9A 2DY1A 4RWXA 1YQHA 4ID5B 4DJBA 1UEUA 1U8SA 1J5EF 1TAQA 1L3VA 5HI7A 3LALA 3FSXA 4CT9A 4TKTA 4CCHA 3MAQA 1HKAA 4ZP9A 4KHMA 2E29A 2E7VA 1BMQB 2VG6B 1N6QB 1ZETA 4U6PA 2P9CA 3T1HJ 4LT6A 4QWCA 3LP2A 2KG1A 2DB1A 4ZKAA 2JX2A 3VCDA 4URGA 1FJGJ 2CPHA 3T1YJ 4FKXA 1NLKL 4QQBA 3KK1B 4A8XA 5THWA 4ED0A 2BE2A 1OO0B 1SL2A 2MKKA 4ZCLA 3EZ5A 1N5YA 2G2YA 2NYIA 4OJ1A 1SQFA 5C2GA 2CQ0A 4X4RA 3BJYA 1KRPA 5AJ3J 3B8HA 2DGXA 1FCAA 1D8YA 1DTTB 3TW0A 1SV5A 3IAS9 4J9QA 1KQFB 1HW8A 2WAQD 1PC5A 4TY8A 2MJUA 2HIYA 5GAEU 1U0HB 3CO0P 1H74A 1KS2A 2HHTA 2HZAA 4ZP8A 4OJ3A 4ECSA 3PW5A 2B51A 2JFKA 4E0DA 4ELUA 4WFBQ 2PIIA 3NNAA 2PE8A 4K5RA 5K9FA 4ECYA 1CC8A 2HNYA 2GIQA 2WONB 3N01A 3SDEB 1BQMB 5HLFB 1CLFA 3ZZPA 4ZLLA 3MUTP 2G2OA 5FD1A 2K1RA 7AT1B 4K4WA 3C19A 3KJFB 2FHKA 3KHGA 1YJNS 1J27A 4PXCA 2MQ8A 2D1CA 4EK2A 1FT8A 1XNQF 2GO8A 4NCAA 4QBUA 2G0CA 1JLCB 3TWZA 1QUVA 4FVMA 3MUMP 3F73A 2B9YA 3ISND 2YKQA 3S1TA 1O5JA 4WK3A 4OYOA 4LRDA 4X4UA 3T5LA 2YKMB 1K0VA 2OPRA 2DXDA 1IUJA 1CJTB 4LF4F 2UV8A 4DV2F 2ZOGA 3TARA 3BGUA 4I69A 4CLYA 3FDSA 3C8YA 3RG6A 1FFWB 1Q16B 3LGHA 4IQXA 2WVEA 1FNOA 3FCWA 1XMOF 3CW2C 2M88A 3M8ZA 1LW0B 1IJFB 4I6YA 4B9SA 3GLJA 5A6PA 2ZWPA 4JI5F 1J5OA 2J6TA 4URSA 4RWWA 4DFKA 1G1XA 4JP8A 3DDNA 3DOKA 5KG6A 3UDEA 2DGTA 3A1YG 2GVZA 3MM9B 4G6VB 3QO9A 4WF9Q 3KJNB 1YJRA 3DRPA 3MWBA 5J2QB 1VBXA 5HN0A 2H4WB 4Q8EA 2B0GA 1EQMA 3RU0A 4DV5J 1UWAA 3TAMB 2I8EA 3U02A 2LDIA 4QIEA 4CO1A 1K0TA 2R9LA 1NBEB 2JEGA 1MSWD 4W4MA 3G71S 3ETMA 4YFUA 4C8LA 2C2MB 2ZD1A 5A0YA 3E01B 1QE1B 4LF1A 1UFKA 2OD6A 2JWNA 1FHTA 5DLGA 4LFAJ 2K2PA 3I0SB 3TUZC 1QUPA 1WD6A 3SSQA 2ZC3A 4ZVFA 4LR9A 1GK8A 4OI4A 2QYGA 3U1LA 2LQBA 4DR3F 2XI3A 3MPWA 3CULA 4Y2KA 3MZIA 5D15A 1XR6A 2HS3A 4UOHA 4UUWA 4IRDA 1IQZA 4U7CA 3I5CA 3R5CA 4CYUB 3BGRA 4MK9A 3OR1B 2A18A 1TL1A 4RNFA 3ZC4A 2GQ2A 2IY5B 5IM0A 3GPAA 1C1CA 4H4MB 2DKOB 2G1HA 1R8BA 3MXHP 1DQ9A 1SH2A 2HIQA 2DHGA 5FLXY 1CVJA 4UOFA 3PX6A 3CCRS 2VG5B 4C11B 3ZZUA 1BD6A 4DX8H 5GAHU 1IKVA 2C2ZB 3QYYA 3ZZTA 5LJ3Y 4I67A 2RIJA 4OX8A 3BBFA 3SSRA 1A6LA 3M30A 5KFPA 5C7PA 1VQ8S 3G6ES 2J8SA 4LFCF 3ZZZA 3HT0A 4ZHRB 3MM6A 2BJ1A 3Q83A 2OELA 3LGMA 5HVGA 3P3DA 2V2QA 2O5DA 4RU2A 2GHWA 1X4HA 1S6OA 2HWHA 3NBPB 4CP5A 1XMQF 3AJDA 3C16A 2W1BA 4IO1A 3DLKB 2NYHA 1Q81T 1JK9B 2DRDA 4C48A 1C0TA 2QRRA 2Z57B 3IRXB 3V4IB 3UO0A 4DR7J 2Y1IA 2DGVA 1GX5A 2KFYA 2DNRA 4LVOP 2HBQB 4KSEB 1UVIA 2MXYA 3TJAA 3T5KA 3X3UA 4LVNP 4NA1A 4ZVHA 3FUYA 4ZCMA 1VI7A 1TKTB 3Q89A 2AJQA 4GVBB 3IWXA 2EBEA 1RYRA 1S6UA 5A76A 1BQNB 1JLFA 2FJVA 1HNXF 2CQ4A 2MKYA 3ZZOA 3ZTOA 3WC2A 2BX6A 2CUYA 3RB3A 2FLPA 3BN7A 2M9KA 4RPFA 4DV6F 1KLNA 2ZNZA 3DRRA 2AJ4A 4DZDA 4DR1F 2MKHA 5T7LA 1WC5A 3H2UB 3DLGA 2ZNYA 1CC7A 1C1BA 3MTKA 4B3MJ 3FKBA 1CULB 4HR2A 1EETB 1N32J 2OTLS 2BQRA 3THTA 4XDDA 3M2VB 4LBHA 1GH8A 3VF0B 4P7TA 4CZCA 3KLIB 2LEBA 4ZJQA 2AYMA 4DR4J 2ROEA 1E6YB 3AD9C 4KPYA 5A2QU 1VGYA 2HS4A 2VKRA 3PRBA 2ZBPA 4KGMA 3PO4A 3UD3P 2B6AB 3TA1A 2I0XA 4C2MA 2ZHAA 2J9DA 3WC0A 3I55S 3RW6A 2NS1B 1RTHA 2E7WA 1HMVB 1R8PA 2E5LJ 2OFHX 4ZVRB 3MHYA 1RT3B 4QIWD 5HAOA 1B0VA 2MQLA 1A0OB 1RTDA 1N52B 3ZTQA 4NEZA 2OAUA 2GVDB 1LV5A 2BQUA 4GVLA 1W2BR 2HVEA 3O1LA 1C0UA 3C14B 4L73A 3TJ9A 1M5SA 4OV1A 4DR6F 3IN5A 3M7VA 2R4FA 2XNQA 4DV0J 2XHWA 1AFIA 1U1MA 3D0GE 5GMEA 2BKNA 8ATCB 3NGKA 1RU1A 1ZM3A 4FXWA 3FRZA 3HFKA 2OEMA 3Q2TC 5HBMB 2BBEA 4Y0FA 4MKBA 3T1AA 3FQLA 4NXNJ 1YBAA 3D1OA 3HSGA 1PSDA 1SUQB 2QMWA 1VRUB 2BM0A 3FSYA 2OGUA 4TU7A 2EKYA 1VQNS 3MEGB 4F4KA 1IBCB 4Y3CA 4ZPAA 2F9JA 1FK9A 2BKOA 4YB6A 1T9VA 1C4CA 3BYRA 1LQ9A 4HHUA 2ZJQQ 1RWOB 1UVKA 2UUBF 1PYOB 1M0SA 1S72S 2BV3A 3TVKA 5KT6A 1ZOTA 3RB6A 1Y7PA 4USTA 1QM9A 1ROFA 3HHLB 2GAHC 1HBOB 2E44A 5ADZA 2ZC4A 2E1CA 4KQZA 4MKYA 3AY0A 2FLOA 4JV5F 1FRIA 1RWKB 3H5UA 2FHOB 2B4VA 1NHVA 3ULHA 1K44A 2RRNA 1VQLS 4C8YA 2XGQA 4ED3A 3AXMA 4B02A 2MHEA 1RT5A 1D09B 1WF1A 2R7SA 2Z2YB 4DUZF 1RAJA 5F3TA 2RUGA 3M2RA 1NDLA 3DI6B 3HFZB 1YVFA 1M1GA 3I0RB 2XZTB 1VISA 1U1RA 1WEZA 1U49A 3O3LA 2RSQA 3JQMA 3T6JA 4B17A 3GIRA 1Y11A 3GSDA 2CJAA 4F50A 2KVQE 3NAHA 3VGTA 3BSAA 4I64A 1U48A 4ZJLA 1IKXB 4N56A 1GNKA 1LNQA 5L38A 1Q7YT 3QFWA 1D9AA 1G7CB 2CYYA 3G82A 2MZ1A 2FJBB 3QT5A 1TKDA 3D4JA 2LFVA 3MF5A 2HNZA 2QEXS 2CQBA 1RABB 3GWCA 2L41A 4C97A 3BQ1A 3NGSA 1SKSA 3CJSA 1O0PA 1SJRA 4UOGA 3VVTA 5KFSA 1B99A 2X3GA 3QJJA 1HQEB 1Z2ZA 4IFYA 5F8MA 2DCLA 4QW8A 1S1VA 2Z4PA 1HHQA 4K4XA 3W65A 2XY7A 2AJFE 1R0AA 2CIMA 2J7KA 1DTQB 2B3TB 2HEKA 2C42A 2HQFA 2XNRA 1Q7LB 4KHRA 1S1TA 2AJ2A 1S77D 3DKDA 2CVEA 1ZPVA 1R6YA 5GAEI 3EVWA 4ZCKA 1WEXA 3HVTB 1U8WA 4WTYA 4Z2XA 3NG8A 4N5SA 1VQ4S 2FB0A 4JI7F 1UA0A 1PO6A 3PM9A 1IJEB 3FZ2A 1VJWA 2V8GA 5L1LA 1MN9A 4LQ9A 2H5JB 1LW2A 4DL7A 1XIQA 4KV8A 3MAHA 2E7XA 3EGVA 1S76D 3SQGA 2EFQA 2OJ3A 2GJIA 2C3MA 5DM6Q 2WHOA 4IOAQ 4USJC 3O5TB 3FEXB 3EUNA 2QC3A 2RS2A 3LO3A 4LFBF 5K8MA 3W1YC 4EZ9A 4X65F 3RAMA 1NPRA 1RT4A 3BH6B 3DRSB 1MLAA 4USVA 4CDIA 1KSPA 1DURA 3BKFA 3P6YC 3EVOA 2J9EA 4PWUA 5CCMA 2LVWA 5A8WB 2EFNA 2YQ3A 2MB0B 3CJ8A 1TK8A 3S01A 2XYHB 4X62F 2PA3A 1NU4A 3IG1A 5DGBA 3TZYA 3O6QA 1TK0A 4XO0A 4NLXA 2J5AA 3IRWP 1SJ1A 1M1KT 2DHAA 4OZ3A 1JKHA 2KXNB 1BE4A 5EWFA 1MROA 4R25A 1SB6A 1TL7A 3CJKB 3KJQB 2FDNA 2IIHA 2BQ3A 3LA0A 1S9EB 3HX9A 2C28A 3CC7S 1XMBA 4ZIWA 2HHPA 3OW2R 3D54A 3PEHA 4U7UD 5DRKA 5D78A 4ZLJA 3Q23A 1ZM4A 2V0NA 4J9KA 1NHUA 3LPEA 4WYWA 1YJ9S 1BWVA 2E5GA 3EE3A 4KH1B 3IBFB 3OBIA 3W3SA 3W63A 1JLEB 2V2KA 4I7FB 2BEFA 2YY3A 4ED7A 4U7UK 3DRXA 1X0PA 1VQPS 2LDYA 3DGPA 4U8VA 4K4ZA 2XMVA 2HFNA 2IVMA 2OMLA 3ZTRA 2V9KA 1S6QB 1N33F 2I5JB 2ZKTA 3DU6A 3M6XA 4RNNA 4Z37A 4ZVQB 4K8RA 1HNZJ 3SFUA 1RAEB 3MEDB 2UXCJ 3DYAB 3AB2B 4J90A 4X4VA 2QN6B 4JBCA 4QJVA 5EWEA 1VYAA 2BABA 5F0UA 5AE3A 2ZVSA 2W2PP 4M1KA 2GGPB 3GFZA 4NLQA 2BE7D 1TU0B 2KL8A 5BYRA 3LGNA 1UKUA 2PMHA 1I94F 2MPUA 1VFJA 3OVAA 4DR7F 5F9LA 4PR6A 2C2RA 1DZ5A 3CCZA 3BGLA 4PG4A 2D3ZA 4ZVSB 3H4BA 3O8WA 5GAHI 3I4PA 4M63A 4M5DA 2AZ3A 2AYEA 4ATNA 1EP4B 3GTYX 1UL3A 3H0PA 2PEHA 2B7BB 4DPUA 2H1YA 2EC0A 1PC4A 1QY7A 1RXOB 3CXCR 1IWGA 2UV8G 1RI7A 3QRRA 3W62A 2VUGA 3D9BA 1LXJA 3MR6A 1O6XA 4F36A 3M32B 1KOOA 2ILYA 3KTQA 1ZA1B 1TUVA 1QD1A 2KZZA 2RAQA 3C46A 3RBDA 5I3QA 5F41A 4WU2A 2NZ4A 4OJGA 1QTMA 2VC1A 2W7AA 4QW9A 2FJDB 2MQNA 4I56A 2ADBA 3GG1A 2X1FA 3GP9A 4JI4J 2C22A 1IKWA 2XEXA 4HI1A 3CDEA 4DG1B 3G4SS 4CM2A 2PEBA 3U27A 4KGKA 4PQUB 2OPSB 3PYGA 5CD4A 1XK8A 1UZDA 3UCUP 5E3RA 1BWEA 4DR4F 3OLBA 2MQOA 1KFDA 1YJVA 2A3JA 1EB0A 4E2FB 4H54A 3MMCA 3CF5Q 3LPYA 1NO8A 3LW5C 2BUNA 1T9TA 5IQQA 3QWPA 4Y34A 2CJBA 1T94A 3MPVA 2L9WA 1X5PA 3OL7A 1RCOB 3WBZA 2DR6A 3ITHA 4YB1P 3BYPA 3ZO7A 3V81A 2MY8A 4OFZA 2DVIA 4YR3A 1Z1ZA 4OV6A 4GKJF 4CRJA 5KFYA 1U2CA 4OZLA 1EKRA 5C42B 4UQTA 2ZBIA 1HLWA 5BR8F 2OHDA 1H6KX 3VHQA 1YWXA 3QBCA 3V6KA 1XJWB 2WVBA 1DAXA 4JI0J 2AMCB 4RBTA 4TLQA 1YIJS 3I56S 3NCRA 3QIPB 1VQ7S 1UJ6A 4YB5A 1CS4B 3DLEB 2COLA 1NSQA 2R42A 2NPIA 2G1DA 3M8QA 2UUCJ 4OZNA 1FE4A 1RYSA 3W2VB 2ATLA 5FDLB 3M8YA 3N79A 2F63A 2CPIA 2OP5A 2FGCA 5I3PA 2UUAF 2QSWA 2DJWA 1MWZA 4G1PA 1HARA 2KU7A 4MYUA 4HH0A 3K89A 5T14A 4L3NA 4Q43A 1XC9A 3FFIA 5EN1A 5ETPA 3IA0A 4PWWA 4MFBA 2AKWB 3QZ8A 1X8DA 4CM0A 1Q78A 4YHHF 1HL6A 2OIHA 4YB7A 3IGVA 4ILRA 2A6MA 2GMHA 3D6HB 1T9XA 3M4XA 4R5PA 2NCKL 4DPWA 1VK3A 4G1QA 2ASDA 1IBKJ 1HBNB 2PMWA 1WI6A 1YX2A 3GIKA 1KHWA 4W98A 3A8EA 5ETSA 4B3TJ 4LF5F 3MAAB 3H98A 2MTLA 4DSIA 1NH7A 4XK8C 3GV7B 1T05A 5KG3A 1TKXA 1FDAA 3L3CA 4HL9A 3DHWC 1S0VA 4LSLB 1WKLA 5CXTA 3QRPA 4FZVA 2CPXA 2KG0A 2KHCA 1T02A 3CCWA 1H2VZ 2RKIA 1E6VA 4PG5A 1OY6A 1N5TA 1NK0A 1AZSB 2QT7A 3BSCA 2DHXA 3P96A 5ETTA 4YN3B 2BA9A 1HQ2A 4DPXA 2DR9A 2HVIA 3MCMA 1XTZA 4EEYA 1M5HA 1BGXT 2FZGB 4O3OA 4D3GA 1N0UA 1R8HA 4KFBB 4LSNB 2V67A 4IG3B 2G2ZA 3FSIA 4F0MA 4XPCA 4FXVA 3KMSA 2XMTA 3UCGA 5B0DA 2RDJA 1F9EB 5J2PB 2RRBA 4OYIA 1R0CB 5HMWA 4ZA1A 3R3TA 3GJSB 3NNHA 2JDJA 4RNHA 4LIWA 3OTBA 4R0EA 1F9HA 2W9CA 3HSDA 1N5SA 4DFJA 2IHR1 5MLCV 3GIJA 5E7OB 3AA9A 3AD8C 2XHCA 2GJFA 2Q79A 1LWEA 3R5AA 2QFIA 4DSFA 4RW7A 3S8SA 4NPOA 3TOQA 2HHVA 1D9DA 5HK4A 4RW6A 3WQPA 2PA8D 2CQ1A 3V2UC 2AJ0A 2O66A 3M8PA 4PRFA 3EPIA 3B82A 5JUMA 2V94A 2W01A 2DNGA 2MYFA 4EYHB 4N41A 3JAMY 2QG9B 3PEJA 4OHVA 4W90B 3CGIA 2BKPA 4CI0B 1XERA 4NCGA 3LH2S 2Y1LB 3NMRA 1URRA 2XS2A 1QAIA 1W7WA 4ZP6A 3K5NA 2W4PA 5GMDA 4B9MA 2YH0A 3OTEA 3F56A 4I0WA 3CE8A 4DPYA 2ATCB 3NNCA 4ZPVR 1LWCB 3N5BA 3THVA 3H25A 1Q8KA 3L4BC 2FY1A 2VQFJ 3EDQB 2NREA 3GYNA 2M4MA 1W26A 1FFSB 2KTQA 3IBCB 1TKZB 2V8VA 5L39A 1TL5A 1S49A 5KFOA 4DR2F 3Q8RB 3HDSA 2XTJP 2PGCA 3CCTA 4KO0B 4DQQA 4X4QA 5DLFA 3V6JA 1QLNA 2C2KB 1B0TA 3AQOA 4FF4A 1T03B 1IBMJ 1JLAA 2AHOB 1HNVB 4DCJB 4Q0BB 3ISNC 4LR8A 2IA0A 1ZM9A 2ZDPA 2RE1A 1G6BA 1PG5B 1V6HA 2IVYA 2Y1RI 5KG1A 1FESA 2OEKA 2CADA 3OFHA 1Q4RA 2KRBA 9ATCB 3M2UB 2WW4A 4N7TA 3DOLA 3KUEA 3BQ0A 5KT7A 1FDNA 5JMNA 3D6FB 2XMKA 3TUJC 4Q2LA 5K14A 2VG7A 1NH8A 4O3NA 3AD7C 5CZXA 3GB0A 4WP9A 1WUUA 5L1IA 5F8GA 4QPXA 2BMBA 3C3LA 4USKA 1N5QA 1SCJB 2UP1A 3OSPA 4YUDA 5L1JA 3FBEA 1TZ0A 3AOCA 4ELVA 3I4HX 3IR7B 3HSJA 3TX8A 4ECWA 1WORA 1S4EA 1H3DA 1CQNA 1S9FA 5LMNJ 4JYAF 2UVUA 2KB2A 5KFWA 4DQSA 3MCOA 2DNZA 3THPA 1IVZA 2N3OA 2CG8A 4DN9A 4X4NA 2J6UA 1QVFR 2XLKA 1BQXA 2E5HA 2B43A 5B0EA 2QLBB 3GV5B 4PXDA 2JLGA 5FJ4A 1RT6A 1L5UA 2JVOA 4H4OA 2GNKA 2HFZA 2BE2B 2BXJA 3TJ8A 1FWLA 3PYDA 3DNCA 1U1NA 4NX9A 2ZOMA 4LF9F 2E9ZA 2BOAA 1NZAA 2QTWA 3DXSX 2BOPA 1N36F 2HQ3A 3WDOA 1OIAA 1SC1B 8AT1B 2ZH1A 2DIVA 3D7SB 4L74A 4C7QA 3L7OA 1DBDA 3NL0A 2IC3B 1SV5B 2E5JA 4TYAA 1PJ5A 4C8KA 1Y10A 1TV6B 1MWQA 4TY8B 4B3SF 5DZ7A 3QRQA 4LJMA 4GO5X 2DHHA 1RTIB 3DC2A 4OHZA 3DLLQ 1WF2A 2QA4S 5D3GA 4NXMF 2KFZA 4JUZA 1F3FA 3CJTA 2HNYB 1Q0NA 4Q45A 3PXGa 1V5VA 1FJ7A 2K1RB 1WWHA 1U7LA 1WC6A 2RS8A 1WF0A 2E9TA 2WSFC 1XEZA 3O44A 3HZEA 3VAFA 4JOUA 4UT4A 5HROA 2Y8WA 3IR6B 1X5SA 4LF7J 4DFPA 4QYZK 1OS5A 2VKZG 1F3VA 4KGVB 4WE1A 3SCKE 2R3VA 3KMQA 3CIMA 3KG1A 2O1PA 3FMBA 6FDRA 2F4FA 1RWPB 3MMAB 3OTOJ 3IMQJ 2OPRB 3W5YA 1NZ8A 3TZXA 3CCQS 2IM1A 3CCJS 1MU2A 2HQDA 4Y00A 1Y3KA 1JJHA 2ABYA 3H2LA 1S79A 2YH1A 1M90T 1YRUA 4ICLA 4LF8F 1U4BA 2WK4A 1R3NA 4H4KA 1ELOA 4D3HA 3HCXA 1SI9A 3FNNA 3A13A 3GCWP 1U6BA 1ZAXA 2FJAB 1J5OB 1FD8A 1WTFA 2Q66A 2P9EA 4DLEA 1RTJA 4KTQA 2GVZB 1I51B 2DGWA 3QO9B 3DRPB 4NZ0A 2OEJA 1C4AA 4ZVPB 3DMJA 1AT1B 4EU0A 3OJUA 4IG0B 1DFDA 2M2BA 2FD2A 3MEKA 3W9IA 4CLKA 3MGJA 2X51A 1M5KC 1LOUA 4CTAA 5D6GA 4FS1A 2DH7A 5E3CA 2ZD1B 4WBFA 2KM8C 3PX4A 2C3PA 1WACA 5A0YB 2FVCA 4MKVA 3U7JA 5HL7Q 4E8UA 1KQSR 3QMQA 4N47A 1QSLA 2ZM6F 3KLFA 3FBFA 2LXIA 2XM3A 1X4DA 2CPJA 3ENQA 3FEZA 1EAYC 4B3RJ 4V19X 2F5GA 1R6VA 4ES3A 2NXUA 1GXLA 2JEFA 2FQQB 1NRKA 2DNHA 4CQ1A 3H40A 4JI8J 4X4TA 2N7YA 3RR7A 2HK2A 1R27B 2VDIA 4ECZA 4QR1A 2VOPA 3T5HA 2E5IA 1IBKF 1V9OA 1FERA 1IM6A 3NAIA 3ILIA 3J7AN 2W7OA 2KYXA 1TL1B 4NLWA 5IM0B 2ZHBA 5A8RA 3UVJA 1C1CB 1GXUA 2BANA 4RW8A 2Q6BA 4OYXA 3RRHA 3GCXP 2DISA 2GC8A 2V4JA 1IKVB 4ZITA 4ES2A 3CCLS 4JI2J 1X5TA 3OQ2A 2QMUB 5DQHA 3M30B 5I3UA 2I6WA 2HZVA 2JLEA 5KFJA 2G4BA 2P5VA 2R8HA 3OVSA 1SQEA 5DQGA 2KM8B 1S1UA 4LQ3A 1KC8T 2GMJA 1HNWF 1HD1A 2GIFA 5ETNA 4PXBA 2EXUA 3SI8A 3C16B 1OQ3A 2E1MC 3B4MA 1UW9A 3KLHA 2RHQB 1P1LA 1MWYA 1C0TB 1WHVA 1RAAB 3GU0A 2HWTA 3EXYA 3G8TA 4UY85 3TO8A 4BC7A 3I31A 1R31A 3UI3A 2BRKA 3W8PA 3OL8A 2W7PA 3AOBA 1IKYA 5F8IA 2X3DA 2D74B 1CJTA 1LKZA 3F44A 2V8HA 3KJVA 2GW8A 4UF4A 3VQSA 4TQRA 1N34F 3N4WA 1HR0F 1PIEA 2EVZA 4Y2MA 1JLFB 3QWUA 1Q79A 2FLNA 3EZUA 3VAMA 3WIVA 2LMIA 4DXLA 2GO9A 1YBUA 2BRLA 2KVIA 1HYSA 2H3EB 2BW2A 5KT5A 4DU7A 4WP3A 4PCQA 2WCXA 1FTRA 3DRRB 4QIVA 2VBXA 1Z4UA 4AL5A 1IQTA 2R2TA 5IFMA 3D6MB 4WFYA 5T7LB 1ZBTA 4OX9J 3NWRA 2ZH8A 3QAUA 5GMKa 3DLGB 4O4GA 2KI2A 3D67A 3MD3A 1B64A 1C1BB 3OSNA 1FFGB 1IN0A 1X0FA 1HBMA 3PW0A 1SBRA 3MEEA 2V68A 2XMMA 3J81U 1T11A 3L7UA 4JB8B 5KOWA 2FHMA 2DR5A 5LSLA 3CPWR 1S6PB 2WZ1A 1ZS6A 3OFGA 2HMIB 4K2XA 3HP6A 2V69A 3ILLA 5KFTA 4L75A 5EUHA 3KG0A 1EIYB 4DV7F 2YKAA 4KRWA 1YLXA 4Z7YA 1VOMA 1QAXA 4M5KA 3OXFA 1RTHB 1QSYA 2XS5A 2YKNA 2DY9A 4EBCA 4QWAA 3CIZA 2CDQA 4ZPBA 3GIIA 4ECTA 2EK6A 4ECRA 1RTDB 1Q95G 2BR0A 3T9NA 3HM9A 3S7RA 2DGSA 4RW9B 2R2RA 1TUWA 1C0UB 4PYAA 2RJZA 4CT8A 4AL7A 2W9AA 4DUYF 5H9FK 4WWSA 3BSNA 2WB1D 3SMZA 5A6WA 4HDHA 3CTRA 3GYXB 1WOOA 1EHWA 4K5SA 4AQYJ 2R2SA 5HP1A 2VFSA 1OPZA 3NXZA 2P6TA 5F8LA 1W2IA 3EICA 1FTCA 4BWJA 1NDKA 2ADCA 3PZPA 1X7VA 1RU2A 2LA4A 2Q1LA 2RRAA 1U6FA 3VALA 4MJKA 1U2FA 1NMEB 3GJTB 5D0GA 4FYYB 3V4IA 3OUYA 3HO1A 4TY9A 4DV4J 2AF6A 3AHPA 3I5BA 1GMVA 1P1TA 1BY9A 2LQ5A 1XNRF 3R5BA 5CD4H 5LMNF 4G1IA 1X60A 4AD6A 3BREA 1REVB 1N88A 2CQ2A 2DGQA 3BBBA 1WOPA 1NKBA 2N4CA 2HAFA 4NYOA 2JEJA 4KAIA 2HSEB 1TMMA 1ZAVA 3I9V9 3TR5A 4HACA 2W2QP 2HVDA 2PT0A 4RX6A 4EBDA 2HHQA 4P75A 1RT5B 4JI3F 4F2RA 4QR2A 3QFHA 4OZ2A 4DFMA 3V6DA 4JV2A 2MZRA 4XTTA 1LFWA 3M2RB 4FS2A 1NK7A 2JRSA 3C6UA 4RBVA 4ECUA 4QIFA 3HSZA 5HMXA 3D2WA 3ICLA 4J9UE 1U1KA 3I96A 4CLUA 2C2OB 2AX0A 1U0SA 2QA1A 4J5OA 2GAGC 4JI1J 2J9CA 4FPRA 2VFUA 2UXDF 2Z56B 1VHIA 5KT3A 2XSJA 4F4ZA 3G82B 5KFAA 2DO4A 3KYLA 2VBWA 2HNZB 1GT8A 3OV7A 4BS2A 4RNMA 3VGSA 2ZH4A 4FBTA 2CAJA 1T3NA 1RP5A 1AUDA 2AGOA 1SIZA 4IFYB 2Q43A 1S1VB 2YKPA 3JSMA 1RT3A 4MK7A 2UU9J 2AEJA 3OFEA 4K59A 5CH7B 4DUTA 1S1TB 2GVDA 4Y2CA 4MTPA 4DL3A 1SJFA 1X4AA 2PFDA 4CH1A 4KHPJ 3R7SB 3K0JA 3C14A 3JB9k 3P5BP 4P9SA 1B7FA 1WDDA 3CNQP 3OTOF 1FXDA 3AH6A 3IWNC 2X1AA 2G0IA 1LW2B 3BV8A 3IM9A 1RACB 2NPFA 5KFIA 3SQGB 3K5MA 2CRLA 1DQAA 2HBRB 4P52A 1SUQA 3NGTA 2VODA 3D5MA 1KEKA 1KDNA 2P2CB 2PI5A 1YK9A 2DT9A 1RT4B 4U8YA 5HATA 4WU3A 4RR5A 3BS9A 4EYIB 2ZH3A 2YBVA 1CJKA 5DG7A 4UY8T 4KKOA 6FD1A 4LBPA 3QQCD 4TQSA 5IZHA 3T9ZA 1VQ5S 2ZZTA 3BDEA 4P71A 5B0FA 2HRYA 3HHLA 1HBOA 2H54B 1N4LA 3GV8B 3SQOP 2YWGA 3IG1B 3R27A 1ZYQA 1N48A 1FRHA 1R89A 4JV1A 1WHWA 4CLZA 1JKHB 1MROB 2FLLA 1TL7B 4LREA 2WBRA 3TUPA 4KYZA 3E3XA 4I2QA 2Z8QA 3DDKA 2APOA 2XMWA 1OYDA 5IS2A 3IS9A 2DPIA 2W2OP 3CJ4A 3ZNUA 2WRMA 3UD4P 1IR0A 3DI6A 2E66A 4UQGA 2DCUB 1G4CA 4CNZA 2RQMA 3BBCA 2FY8A 3GG0A 2KT5A 4Q7AA 2W2NP 1JQGA 2EG2A 2MSTA 1YSJA 2LQJA 2ZBCA 4EMDA 4A8MP 3MMJA 3DGPB 1FRKA 3A8KA 1FD2A 5B0GA 2EK1A 1WC1A 4YOEA 2CJKA 2DXEA 3KK3B 1MW7A 3PHTA 3RB4A 1N56A 1FVQA 3QGIA 3ZTPA 4DPOA 1OMSA 4JI2F 1GTHA 3ZFVA 3BN4A 4F4AA 3HHLD 2DHSA 2AD9A 5E33A 2XI2A 3EWGA 3EYZA 1QDUB 4LF6F 1X4EA 3SV3A 4YY3F 4USMA 4P2XA 2VQEJ 4FNHA 3HXMA 4B9VA 3M05A 4P6QA 4PPZA 1KVJA 1A7GE 4ZVGA 4Y65A 4FYXB 4WZMA 5M2PA 2DBBA 3SSSA 4DL6A 2MZJA 2HK3A 3ENWA 3FCHA 5H9EK 3B78A 4FDFA 3KHLA 1HHTP 2GJ2A 1I1GA 2NXJA 3FBCA 4I6AA 2RH3A 1RJJA 4OL8A 1FRXA 3VAGA 4M5DB 2NUUG 3HK2A 4HTIA 2AYGA 4IH5A 3J80U 1S10A 1B70B 2KFNA 3VGUA 2GQQA 4Z7CA 4WP8A 3TI0A 2N4DA 1H38A 2XC9A 2R7XA 2EI5A 3KLEB 4ELTA 2V63A 2GV1A 5LMUF 1T8EA 2M8HA 3CDWA 1AA1B 2FHJA 4ZJOA 4JI6J 3PW2A 4L3KA 3Q0AA 5CYQA 3QPIA 4J9SA 4LUBA 3IM8A 2HBZB 3US5A 2RMLA 4IRKA 3MR3A 2ZE2A 4C6AA 1YJWS 3KXDA 1IR2A 1IKWB 2R8IA 3LP1A 1YKWA 3POTA 2XO6A 1X4FA 5DO2A 3T6BA 3MFHA 3F0NA 1SIWB 2GS8A 2RUSA 1VRQC 1QVGR 3IP0A 3N28A 5J2MA 5KAKA 2WOMA 2VPZB 1RWUA 5E3PA 2MEWA 4DV3J 3MMCB 2XULA 5KFFA 4K4YA 4X2BA 2UXBF 3W7BA 1HI1A 4DHVA 2HHHJ 2KKHA 2B9EA 1KVIA 4NRTA 1DARA 3ITHB 3V81B 1PAEX 3J81Y 2CJ9A 4OI3A 4ED4A 4OYMA 4ZDNA 2Z58B 3M8WA 3NKYA 2WSCC 2XQCA 1HWIA 4UOCA 2FYXA 4ZOSA 1J2VA 4DV1J 2FHJD 4ILLA 2X1GA 3N9UC 2XS7A 1ZAWA 3GZ7A 1VIOA 1Y4ZB 3TAPA 4B3OA 4P7VA 3TYTA 4WKYA 1J5EJ 1RADB 4N8NA 3W9JA 4RUHA 3M8QB 1VQKS 5KT2A 3M9NB 4R8UA 1IBLF 3QJLA 3DYAA 4ANDA 1RBAA 3M1VA 4F0KA 4QWEA 5HQ8A 3U1NA 2C3UA 4V19J 1TMJA 4PUOB 2K3IA 5H9FJ 4AL6A 3DLHA 5KG5A 3EM1A 3FFIB 3CCSS 2CZ9A 4RBUA 3PVXA 2FC9A 4MFBB 5KOXA 2NSBA 4A48A 2Q3PA 2W9BA 3CSKA 4DV4F 5IWAF 4QPTA 4EGLA 3LAMA 1FX4A 1JXVA 5AXLA 1OJ4A 3UNGC 5KFBA 5F9NA 4MIAA 4I6WA 3CUNA 1KR4A 2JHEA 1RT2B 4J37A 4G1QB 2OI2A 4MH8A 5J2NA 2ILZA 3FEYB 2V34A 2OLWA 4GC6A 3M6VA 1PAUB 1S0NA 1RLDA 2RU9A 5AXMA 3NS5A 3DXBA 2RDDA 3JYTA 3BPSP 1T05B 2L3MA 1FI4A 1TKXB 2OPPA 3I6PA 4GMKA 3KLVA 3LTOA 4A8QA 5D8HB 2K06A 5DDOC 1CJUA 5D0EA 5DG8A 2CNNB 3NP5A 2VB6A 3UCZP 2ZJPQ 3GILA 1LWXA 3PR4A 1W25A 1K73T 3H5XA 4USWA 4ECXA 5L9XA 1UA1A 1RTZA 1G3OA 4EO6A 5KG4A 2ROPA 1P9QC 3L7PA 5KG7A 2AEFA 2LLZA 3M6WA 1HQUA 2UZAA 1KQGB 2EFOA 2CKWA 1O51A 1P6TA 4PG6A 1HI0P 1YJTA 3CC4S 2DNKA 1U1OA 4PPDA 4XPEA 2JL9A 1S48A 4DL4A 5AE2A 4LF4J 4OYBA 4NLRA 5AXKA 4DV2J 2W9CB 4DF8A 2CFXA 2UU9F 4ED6A 1S1WA 3VQTA 4ZPCA 4DR5F 1XMOJ 1LWEB 2RB7A 4LF2A 4WIIA 2Y8YA 1RCXB 3W61A 4DX7A 5C42A 2BVZA 2LKZA 5LXYA 1KN6A 2D3UA 4RW7B 1Y00A 2XMJA 3MM7A 2V9WA 2IDEA 2WVFA 3GYGA 4TNOA 4RW6B 4JI5J 4WTOB 1WG5A 3G6VA 3SCLE 3PY8A 2H5IB 3BZQA 3W5XA 1NSKL 3LWMA 2YWKA 4M94A 1YGYA 1EJ7L 4M95A 2IDLA 1D8ZA 3R1HA 2J0SD 2MKIA 2SXLA 1FXRA 1YI2S 3MM8A 1PILA 1RDRA 2YNGA 5C24A 4BWMA 2RU3A 1P27B 1U02A 3PHEA 4NCGB 4X64F 2DITA 1SVDA 1Y5IB 3VAIA 4DZ6A 4MIBA 2R8JA 2GX8A 3K59A 3KK2B 2IBOA 1JNRB 4ZVEA 2ZBRA 5FLXU 4FXDA 1GMWA 1X9SA 3K8VA 4AXIA 2R7VA 1NJXA 1FDBA 2IAJA 2YXLA 2JNJA 4DN0A 5B0BA 3MMBA 2V8DA 5D4OA 4DR3J 3D68A 4ITSA 4JV0A 2JEIA 4X4SA 5DZ6A 2CXEA 4CLPA 4KC5A 2D3OR 3T1HF 1L3KA 4YP3A 4OI6A 3CJ0A 2JFDA 4XIUA 1WC3A 2JH3A 5ETOA 1FJGF 3T1YF 3KWMA 3KUHA 3UN3A 2P6SA 3PIPQ 1LWFA 2YNIA 1O8BA 2LYVA 1JLAB 5A8KA 3N6MA 4PWDB 3UN2A 1NUEA 2LXUA 5IT4A 1S7HA 1F1BB 3PNIA 5E2QA 3E8OA 3JQKA 1OWXA 3G86A 2HGLA 1RZMA 2L08A 3OL6A 1AUSL 5AJ3F 3DOLB 4LFCJ 3MM5A 1GQEA 3N6LA 5K14B 4OX6A 2VG7B 1A9NB 4WXOA 1JLGB 1YG0A 1AW0A 3FRYA 1Q53A 1XMQJ 2YWHA 3OXLA 4C0OC 4HT5A 1N0VC 2HG4A 3HJFA 3R2CJ 4NLPA 3ILOA 1VQMS 4NLDA 1RGVA 1V3RA 1GMWD 5EX0A 2VJUA 4X4PA 3BR9A 2B4UA 2NQPA 4I1TA 2GMLA 4MK8A 2F1FA 5K5MA 3PG9A 1NPPA 2BJ3A 3TZWA 1TR0A 2Z2MA 5KFDA 3KG4A 4NLUA 5G0RA 4OX7A 3G8SA 3F41A 4P2SA 1WC4A 4O44A 5K8OA 3SCJE 4A8OA 3K5OA 3DOMA 4F7VA 4WFNQ 1R8AA 3SZ2A 4GRSA 1HNXJ 4ETXA 4ED2A 4OYAA 2LU1A 3E2EA 5EHHA 1Q1KA 1RAOA 4ZMMA 2JJ4D 4H4OB 1Y0HA 3C66A 4C8OA 2XMUA 2R8KA 2L9NA 2ERRA 2OSQA 3NWGA 4P2MA 1SL0A 2ZJRQ 2DPJA 1U1PA 4ZLPA 4X66J 4RUCA 1RT1B 4OJHA 4CO2A 1D9FA 4J9MA 2GHVC 3I87A 2W8LA 3Q8SB 5H9EJ 1JJ4A 1TVRA 4NOHA 4L72B 4HT7A 4C9DA 2K7JA 5DDQC 4H4KC 4M5IA 5D3GB 3ONQA 1FDDA 3FK4A 3RRGA 3OT9A 1H0HB 5LOQA 4GC7A 2DNOA 5CABA 1F9FA 5IOLA 2RDIA 2OPQA 2BJ8A 4PXEA 3P45B 4DV5F 2MGZA 1X31C 1JXEA 3MR7A 3SBMA 3ZNJ1 3BDPA 5HROB 2P9GA 3M6UA 5J1EA 2WTFA 2CQIA 1VQ6S 4WE1B 3A12A 3HJVA 3CJRA 5KFEA 3KLGA 2MLYA 2NXCA 4LFAF 2R7WA 1VIXA 2ROGA 3CDUA 5KFGA 3RUBL 2B5JA 1KP6A 3MD1A 4DR6J 3L95X 4NMXA 5CA5A 1YZ6A 2VIHA 2KYZA 4ER8A 1I3OB 2MKJA 1MU2B 4A8WA 2LCWA 3MFIA 2NXNA 5IV3A 3TA0A 4ICLB 2Y0BB 3FBBA 4NYPA 1LK5A 3UDCA 1RA7A 4DCPB 2Z30B 3BO3A 3N6NA 3EPGA 4OHWA 2D41A 1YJUA 3CMAS 5L9NA 3I5AA 4B9TA 2FVPA 2YQ0A 4LR7A 4CO0A 4YEAA 4QYRA 2UUBJ 4PABA 5I42B 2X1BA 1RTJB 2JC0A 3GIMA 3A3OB 3LANA 3JSYA 2FJEB 3UPFA 1OSCA 2HFUA 1S57A 3DMJB 3J81j 2YPYA 4ZPDA 5LJ5Y 3FGVA 3HPOA 2QGFB 2RT3A 3L09A 1UVJA 3D66A 1T7PA 4CTAB 2QYCA 2U2FA 1QAJA 4HH1A 3MCSA 3C2PA 4JV5J 3BF4A 1FJEB 4LRAA 2JZ5A 1RB0A 3M9MB 2HZCA 1JIHA 1B4SA 1T3OA 2W25A 1FKAF 3P5TL 3KLFB 2ZZNA 2DH8A 4YS2A 5KFQA 3RAXA 5C25A 1TFYA 4DUZJ 3SV4A 1VQOS 3OXGA 3NGRA 4NZ6A 1KFSA 2QLWA 2B9WA 3ZZ0A 2G13A 2IC3A 4NLOA 3EGZA 4C8ZA 1SH3A 4OI1A 1TV6A 5SUHA 5LT5A 5A8RB 3UVJB 2YX1A 4O3QA 1FNMA 2BACA 1I5OB 2B56A 2CPEA 1RTIA 2BANB 4NCBA 1RHUB 4RW8B 3CCES 2A1BA 3RBXA 1CEZA 3CC2S 4U95A 3A3NB 4A47A 2ZHOA 1UVLA 2JVRA 2V4JB 4IDKA 2XWXA 3KDOA 3S6EA 4M5MA 3PV8A 2RD5C 2EWHA 5I3UB 1WELA 1S9GA 3RRKA 2CZVC 4IH6A 2HLTA 4B3MF 1UWBB 4DQRA 1HBUB 5IC4B 2QLFB 3BPDA 1S1UB 2M3DA 1R7IA 3OLAA 3ET6A 1N32F 2R7QA 4RNOA 1YZ7A 3AQPA 5L8RC 4USUA 1KNZA 5DG9A 2CNKB 4QZVB 1VBYA 4J9OA 4C3LA 1RHMB 4U96A 4P74A 3KLHB 4XDCA 1RISA 4KGXB 1SKWA 2PN6A 3DM2A 1U24A 3G6YA 1T9YA 3K57A 4YDDB 1UEVA 3MMAA 4JI7J 1RA6A 4ZLNA 5AXNA 2PC6A 1DLOA 1IKYB 2B4PA 4RLEA 1NAQA 1FKOA 3KJVB 4URQU 4X84A 4F4XA 2E5LF 4BC9A 1CJVB 4UTGA 2XG8A 1SJ4P 3BB5A 1KHVA 1OY8A 1ZZNA 3R5DA 3CJQA 4YMEA 1UVMA 4ENOA 4LFBJ 4X65J 1JNZB 3ADAC 1HYSB 4K2JA 3R9LA 5A2QY 4MAKA 2HW3A 1B7YB 4KT0C 2D3O1 2WVDA 4DV0F 3HI9A 5B7WA 2OSRA 2F4VJ 5K8PA 3L9ZA 4OYPA 1KKHA 4O4GB 3PO5A 4RW4A 3LP0A 5HJXA 2VPXB 4X62J 4NXNF 3ISZA 1HBMB 3MEEB 2ASYA 4IG0A 2O01C 1UP1A 5JVHQ 3CD7A 2POKA 4UUXA 5J1NA 2C3YA 3W9HA 3VR1A 2C2DA 4GKKJ 2PD1A 3PJXA 2VC0A 3PFOA 1WJ9A 3E51A 4DU8A 3G8QA 2BJEA 2KH9A 1Q82T 4I2PB 3K58A 1YRXA 4QWBA 2PI4A 2ZOFA 2ZUAA 1JMTA 4K4UA 3TQ1A 2DTJA 1WC0A 3HD2A 4QR0A 2YKNB 4Y6IA 3VWSA 3VGVA 1OYEA 4YR2A 4M8LA 3K7RA 1XWLA 2RF2A 2MHNA 2DNMA 2ALYB 3NCQA 1HPZA 2BYCA 2IRUA 3AAWB 3UDLA 3HVWA 1UVNA 3V5RA 2QO3A 1S4FA 1BXNA 3K2YA 2IM0A 5K20B 4WXWA 4PAAA 4IH7A 4IRCA 1N33J 5GVQA 4OHXA 4HTJA 1F0XA 4M5HA 5HP1B 4KY3A 2VFRA 3U1MA 5DDRC 2EFGA 3VZHA 1FX2A 4DQPA 2HFVA 4M5NA 4C3MA 2MLXA 4FYWB 2NXEA 3ETOA 5DJBA 3GR0A 1U26A 1EQ0A 1R8CA 1Q8LA 5CYMB 2HURA 4KGZB 1SH0A 2KT3A 1KLMB 1N5VA 2M0GB 3Q8QB 2XYGB 1I94J 3OUYB 3W2WA 3UD5A 2HAIA 1S5ZA 2V4RA 3C6TA 4OZJA 2U1AA 3R5GA 2K7KA 4I4BA 2FVQA 2WSEC 4IFVA 3MOZA 2LU2A 2AZ1A 3VTIA 5B08A 3CMES 4EZ6A 3G9CA 2EFPA 4HACB 3FQKA 1PJ7A 1IR1A 1JWWA 2M5YA 4M5GA 4WFAQ 1NJYA 3V6DB 3TP2A 3W8GA 4A8KA 3DLBA 2OMOA 2IRXA 3ELHA 3C6UB 5KT4A 1UFLA 2O67A 3EJMA 4X66F 3PKMA 3A3PB 2VD3A 4PZVA 4HYKA 3DDIA 3AXKA 5D0HA 2BE9B 2QJ3A 4WFXA 2EG1A 1FKPB 1TAUA 2XSJB 3B6BA 4NWBA 2MLZA 1C2PA 1T0TV 5LSRA 4M5JA 1L3TA 2YQ1A 3R8YA 2RILA 1S6PA 3VAHA 5CCLA 2VH7A 2HMIA 2ZVIA 1NXIA 2CQPA 2PSZA 2DRBA 3Q86A 4CO5A 1FO1A 3AT1B 3RBEA 1RHRB 1JLBA 3FC9A 1SC4B 4DQIA 1SJ3P 4OZ0A 4WZQA 2CJYB 1TQLA 2MQQA 3HHLC 3Q8PB 2A10A 3JSMB 3H42A 1WKKA 2FVSA 4KIAA 1NCLA 4KJIA 4GKJJ 1TL3A 4RW9A 2G9OA 2F8HA 1QAYA 4C98A 1NK5A 4KR0B 5LM7E 5BR8J 5JJBA 2J9DE 2QIFA 1LFPA 4MYTA 1Q8BA 3LOUA 4ZK7M 1YRTA 3HVAA 4C4WA 2C2NA 1BHNA 2LEAA 2ZITA 1YBTA 4WFZA 2HLUA 1NSPA 2DNQA 4AUKA 4U9RA 1VRTB 1ZH5A 2MZQA 5DDPC 2KXHA 5C2CA 2ZFHA 3JTNA 3PIOQ 2UUAJ 1S1XA 3B54A 1CJKB 1RT7A 4KKOB 2YVSA 2CQGA 1TTHB 2D69A 2MDAA 3T41A 1JLQA 2AGPA 4HKQA 5ETRA 1U6ZA 1U1QA 5L46A 2RNEA 4YHHJ 4PQAA 3X1LB 1FRLA 1HNZF 1YITS 4IKAA 1CG2A 3C15A 4NYZA 2UXCF 3TEHB 5HANA 3I32A 3PR5B 1HNIA 4QCLA 1REVA 4LSZB 4QU7A 4CO4A 3QLHA 2MQMA 4S0MA 1U09A 3LP2B 4RJVA 1NJZA 4BBYA 4IOCQ 4I2QB 3MECA 3BH7B 4BLGA 2VBYA 4LF5J 1F5AA 3QT7A 5KFLA 3GQCA 3R97A 4NI2A 1Q8IA 3PW4A 3IS9B 3HF5A 4ED1A 1AXQA 3OR2A 4DLGA 2Z2LA 4C8MA 1N5YB 4PG7A 5F0WA 4IUFA 3VAJA 4OHYA 2GCFA 2YNHA 4DF4A 3J7YU 3ZXWA 3MTJA 2HHSA 3PRVA 2DK2A 3BO4A 2M7SA 1GEHA 2MMYA 1JXLA 3EMTA 3KKFA 3H8YA 3OFFA 1ZPWX 4NL5A 4EWTA 1F6TA 2DRAA 3EDRB 5E5NA 3AODA 2UVRA 3BR8A 3TX0A 1UJ5A 4J7CA 3TRGA 4WKRA 3MDFA 2HNDA 1JJCB 2QX0A 4WYLA 2VJVA 3NOCA 2Y9HA 3ZZYA 2E9RX 5HVFA
chains in the Genus database with same CATH topology
2KU7A 4JI4F 1K9MT 4MYUA 4HH0A 3MFHA 4A4JA 1SIWB 3M9OB 1YHQS 1QVGR 5T14A 3N28A 4L3NA 4Q43A 1XC9A 3LUYA 5KFVA 3FFIA 3HLUA 5J2MA 2EPIA 4NA3A 5EN1A 3IA0A 4L6V3 5J2PA 4X4OA 4MFBA 3QZ8A 3I9ZA 5KAKA 4B9LA 2IM3A 1X8DA 4F3OA 2WOMA 2R8GA 2VPZB 1Q78A 1L3UA 1RWUA 1HNIB 5E3PA 5D4PA 2VQEF 2OTJS 4YHHF 1HL6A 2OIHA 4YB7A 3IGVA 5M2RA 5B0AA 4F4WA 3UWTA 1N8RT 4F26A 4N77A 1F60B 3MMCB 3QLHB 4ILRA 2KJWA 2XULA 5KFFA 4ES1A 4A8SA 2OD4A 5L1KA 1X4BA 2VASA 3FMWA 4K4YA 2B4OA 2DO0A 4CO3A 2GMHA 4X2BA 3M4XA 2UXBF 4R5PA 4TYBA 2GHPA 3H59A 3W7BA 4FNIA 3MECB 1WNEA 2DNPA 3TVZA 1HI1A 2CZ4A 1VK3A 2KKHA 4NZ7A 4G1QA 4DHVA 5KFNA 1KVIA 2F8MA 1APSA 2ASDA 2F3JA 3LAKA 3N0VA 1HBNB 4A8FA 1WI6A 4NRTA 3TUIC 1DARA 2V4QA 3TAQA 3ITHB 3GIKA 4NLTA 3V81B 1RT6B 2OH2A 3J81Y 1KHWA 3NMAA 2CJ9A 2HGMA 3A8EA 3MUVP 4OI3A 2FJWA 2AJ1A 4LF5F 3H98A 1H2UX 5ITHA 4DSIA 3OR2B 1NH7A 4ZDNA 4HLBA 4XK8C 1BC6A 2FIUA 3NKYA 2WSCC 5KFMA 3GV7B 4IYQA 2AX1A 1F5BA 1HWIA 4UOCA 1T05A 5KG3A 2O3DA 1TKXA 1FDAA 1K1SA 1FVSA 4ZOSA 3L3CA 3KNAA 4HL9A 2YNFA 1J2VA 1JX4A 2ZKUA 5D4NA 2UUWA 2YNHB 2FHJD 2R7OA 1UJ4A 4ILLA 3DHWC 1VC6A 2CQ3A 1S0VA 4LSLB 2AW0A 2X1GA 3IGNA 3DLJA 3N9UC 4QIGA 4A8YA 3IAM9 2XS7A 5F8JA 4DS4A 1ZAWA 3GZ7A 1ZTWA 1VIOA 1Y4ZB 4ECVA 3TAPA 5CXTA 1FKPA 4FZVA 2MKSA 2MY7A 3NCPA 5DQIA 1VK8A 2CPXA 4B3OA 4WJBA 4P7VA 4NRUA 5KFHA 1UETA 3TYTA 3T5JA 4YR0A 4WKYA 2KG0A 2KHCA 1G2EA 5CYQB 2F40A 1T02A 5H1SV 4C8NA 4N8NA 4RUHA 4FP9A 3CCWA 1H2VZ 2RKIA 1E6VA 4PG5A 1NK4A 3M8QB 3B4DA 1VQKS 2F4VF 4ID5A 4JI0F 2ALZA 5MAOA 5KT2A 2XLJA 3M9NB 4JI6F 3DOKB 3LQVA 1N5TA 4R8UA 1IBLF 3BQ2A 1NK0A 1GX6A 3QJLA 3DYAA 3BSCA 2QT7A 4NLSA 4NLGA 2DHXA 3P96A 3KNGA 2ZE2B 3M1VA 4QWEA 2BA9A 5HQ8A 3LF0A 2VOOA 2UUCF 2DR9A 2HNDB 2HVIA 3LP1B 3U1NA 1XTZA 4EEYA 1FF2A 3POTB 2RQCA 2C3UA 4E98A 4V19J 1M5HA 1BGXT 4PUOB 4O3OA 2NSCA 1FRJA 2K3IA 2EBGA 2HGNA 4D3GA 4DEZA 5H9FJ 1N0UA 1R8HA 4KFBB 4AL6A 4LSNB 3DLHA 4IG3B 3J80Y 5KG5A 2R7TA 3FSIA 1LWCA 2VG6A 1MMLA 4XPCA 3I82A 3UW1A 1N6QA 4HEA9 2EFVA 1KTQA 1DHMA 4FXVA 2D7SA 1WHYA 3KMSA 4K4TA 3FFIB 1OQ6A 2XMTA 2XZWA 4RBUA 3TNVA 3UCGA 5B0DA 5J2MB 2RDJA 4GKKF 5J2PB 3PVXA 3TANA 2FC9A 1M5PC 2RRBA 4MFBB 4Y2AA 3OHAA 5KOXA 2NSBA 4A48A 4KBIA 1VQ9S 2BM1A 2Q3PA 1FA0A 4NMLA 5HMWA 4ZA1A 2WOMB 1ZZFA 3CSKA 3R3TA 2W9BA 4DV4F 2AGQA 4F8RA 3NNHA 5IWAF 2JDJA 2QE5A 5F8HA 4U67Q 4QPTA 2DR7A 4EGLA 3LAMA 4RNHA 1S97A 4LIWA 1TKZA 1X9WA 3J7Z5 4ED5A 4USIA 4O3PA 4WK1A 3OTBA 4R0EA 2XY5A 5AXLA 2W9CA 2C2EA 4B08A 4HI2A 4OIXA 1N5SA 4ERDA 3KK1A 4DFJA 1GTEA 3UNGC 2CPFA 2IHR1 4KO0A 1XN9A 5KFBA 1NKCA 5F9NA 4MIAA 4I6WA 3CUNA 5MLCV 1KR4A 3GIJA 4DV3F 2FJXA 5E7OB 2JHEA 1RT2B 3AA9A 4J37A 1MNEA 4G1QB 3DFEA 2OO4A 4MH8A 2Q79A 2ZZMA 5J2NA 2HPUA 4DL5A 3PW7A 2A2DA 2ILZA 1LWEA 4IR1A 1P8GA 3FEYB 1T03A 2CQHA 2OLWA 4GC6A 3M6VA 3R5AA 2K3KA 1S0NA 1JB0C 4YDXA 1HNVA 1TL4A 2NUHA 2HHHF 4Q0BA 4B9NA 4F02A 2RU9A 4DSFA 5AXMA 3NS5A 3DXBA 4RW7A 4NPOA 3TOQA 3S8SA 2N82B 2HHVA 1DTTA 4QYZJ 3CEDA 2RVJA 1CQMA 2IJFA 3Q2SC 3JYTA 5LSOA 1ZTTA 3BGRB 4RW6A 1D9DA 2HRUA 5KG0A 1T05B 2PA8D 2L3MA 4B3TF 1TKXB 2CQ1A 3N5FA 1VC0A 3M2UA 1F2GA 5D4LA 1QJHA 2OPPA 2XBPA 2AJ0A 2O66A 3V2UC 4MMOA 4DMZA 3I6PA 2YNFB 4GMKA 3KLVA 3M8PA 3QZ7A 4A8QA 1HWKA 4TU9A 4PRFA 2HFOA 3EPIA 5D8HB 1F5CA 3AA8A 3B82A 5JUMA 3CT9A 1VRTA 4K4VA 2V94A 2GQCA 5DDOC 3KK3A 2DNGA 2MYFA 5DG8A 4EYHB 4DV1F 2H9ZA 3IO1A 3NP5A 1HWUA 2VB6A 4ALZA 3UCZP 2VPWB 4AFFA 4N41A 4B3OB 3JAMY 2ZJPQ 3GILA 3PEJA 3JTPA 2WONA 4OHVA 3PR4A 1U25A 2HHUA 4W90B 4TXSA 3SDEA 1BQMA 3CGIA 1W25A 1K73T 2KO1A 5HLFA 1I6JA 1RQ0A 4CI0B 3CO9A 1XERA 4NCGA 1VBZA 2KDOA 3LH2S 4RWXA 1YQHA 4ID5B 2KJVA 4DJBA 3H5XA 1UEUA 3NMRA 4R8UB 4ECXA 2D9PA 1URRA 1U8SA 5L9XA 2HQIA 2XS2A 3RW7A 1UA1A 1QAIA 1G3OA 4EO6A 3MM6B 1J5EF 3M1VB 4ZP6A 4O23A 1TAQA 3K5NA 2W4PA 1L3VA 5HI7A 3LALA 5KFRA 5KG4A 3FSXA 4CT9A 2ROPA 4B9MA 1P9QC 3L7PA 4TKTA 5KG7A 4Y2IA 4CCHA 2YH0A 3OTEA 3MAQA 3F56A 2LLZA 4I0WA 3M6WA 1HQUA 3CE8A 4ZP9A 2UZAA 2M52A 2E29A 4KHMA 4ZPVR 3NNCA 3GFYA 1KQGB 2R2UA 1LWCB 3N5BA 1SC6A 2KT2A 2VG6B 4CNYA 4RUAA 4BDPA 3THVA 1N6QB 3OJSA 2EFOA 5T41A 1FJCA 3H25A 2FY1A 1ZETA 4U6PA 2CKWA 2P9CA 4F67A 1JLCA 1O51A 1P6TA 4LT6A 4PG6A 4QWCA 3LP2A 5KFUA 5BJRA 1HI0P 2KG1A 1YJTA 2DB1A 4ZKAA 2JX2A 2W9BB 3CCUS 3GYNA 2NREA 2M4MA 3CC4S 2KTQA 3VCDA 2DNKA 4URGA 1U1OA 4PPDA 4XPEA 3WX4A 2JL9A 1S48A 1TKZB 4DL4A 2V8VA 2CPHA 3EGNA 5AE2A 5L39A 1TL5A 1S49A 5KFOA 4NLRA 5AXKA 4DR2F 3Q8RB 3HDSA 2W9CB 3EXCX 2YKMA 4QQBA 2BZ2A 4DF8A 2CFXA 2PGCA 3KK1B 3CCTA 4KO0B 4DQQA 2UU9F 2FC8A 4ED6A 4A8XA 5THWA 1S1WA 4ED0A 2BE2A 1Y5NB 4X4QA 1OO0B 3VQTA 4F3QA 4ZPCA 3V6JA 5DLFA 1NK9A 1SL2A 3Q22A 3QGHA 4IR9A 1QLNA 2MKKA 1B0TA 4ZCLA 4DR5F 3EZ5A 5FIIA 1N5YA 5J2NB 3AQOA 1LWEB 4FF4A 2NYIA 2RB7A 3H20A 4OJ1A 3CB4A 4WIIA 5B0CA 2XY6A