2MYFA

Solution structure of rna recognition motif of a cyclophilin33-like protein from plasmodium falciparum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
GSHMSDNNATDILFVGGIDETIDEKSLYDIFSSFGDIRNIEVPLNMTTKKNRGFAFVEYVEVDDAKHALYNMNNFELNGKRIHVNYSKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RRM containing cyclophilin
publication title Solution structure of RNA recognition motif of a cyclophilin33-like protein from Plasmodium falciparum
rcsb
source organism Plasmodium falciparum
molecule tags Rna binding protein
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2myfA00
2WBRA 2KG0A 4CH0S 1HA1A 1K8AT 3NNAA 2M0GB 2L9WA 1FNXH 3RW6A 2LQ5A 2MQLA 5BJRA 2CQCA 3DXBA 2SXLA 5GADU 2JX2A 1M5KC 2M8DB 3OW2R 2CQPA 4Y00A 2YH0A 2KRRA 2KHCA 3BS9A 2HZCA 2CPHA 4PKDB 3VAIA 2DITA 2CQ2A 2DISA 1K73T 1S72S 2MHNA 3CCES 2RS2A 2KM8B 1U1MA 3IWNC 2MQMA 2MKKA 1X5SA 1ZZFA 3R1HA 1ZZNA 2GO9A 5LSOA 4WF9Q 3CCVS 1KQSR 4WKRA 3VAFA 2LXIA 1KC8T 4C0OC 2MZJA 3VALA 1S79A 2KH9A 3UE2A 2HVZA 1WG4A 2CQ1A 1R8PA 3ZZYA 2ADBA 3UCUP 1M5OC 2M2BA 1FJEB 2E5IA 2KXHA 1L3KA 5GMKa 3SXLA 2E5JA 2D3OR 5LJ3Y 2JVRA 4UY8T 5GAGU 1SJ4P 1R8HA 2CQBA 4CIOA 4UQTA 2YWKA 2LECA 2N82B 4TU9A 3G4SS 2MYFA 2J0QD 2BZ2A 2DNPA 3N9UC 3CCRS 2M70A 3R27A 2DGSA 4WFBQ 1U6BA 1WG1A 4IO9Q 1KD1T 3LQVA 4WCEQ 1WF1A 1W2BR 1CVJA 2RRAA 2MKJA 2MZRA 3S01A 3RW7A 2JWNA 1U1PA 2KFYA 1DRZA 3P3DA 2MQOA 2ERRA 1IQTA 5DDQC 2DNRA 4PR6A 2M52A 3TP2A 1K9MT 3MI7X 3Q2SC 4TU8A 2QFJA 5DM6Q 1X4CA 1SJQA 2MXYA 3CC2S 3LPYA 3CD6S 2CJKA 2RRBA 3HI9A 2LEAA 3JB9k 5IQQA 1NJIT 1X0FA 3D2WA 2KXNB 1O0PA 1U1QA 2HYIB 2CQ0A 4F26A 2KN4A 4LIRA 2LEBA 1SJRA 4QU7A 1FT8A 1X5OA 2D9PA 1VBZA 2RU3A 2VONA 4F25A 1X4EA 2CPEA 1M5PC 1UFWA 2G0CA 2M8HA 2X1AA 2EK6A 1KOOA 4ED5A 5HL7Q 3CTRA 1DZ5A 5H1SV 2UP1A 4TU7A 2CPZA 1DHMA 2DHGA 2DHXA 2J76E 3MUMP 2DGXA 2DNLA 2DGTA 1U1KA 2DNQA 1XN9A 2X1GA 2DNOA 4C7QA 2I2YA 3VAGA 1D8ZA 1VC0A 3EGZA 2K3KA 1X4DA 1HD0A 3PIOQ 2HGLA 3SDEB 1RKJA 5LJ5Y 2DK2A 1VC5A 3J7YU 1YJWS 1FXLA 3G6ES 3CF5Q 2U1AA 2OSRA 4WIIA 2OTJS 3SDEA 2DNNA 1KOHA 3G71S 1N8RT 2HGMA 1VQLS 2XNRA 3UWTA 1A9NB 1F9FA 1WF2A 2DNKA 3DLLQ 2ZJPQ 1FO1A 4W90B 1G2EA 1YI2S 3NS6A 5DETA 1NO8A 5DM7Q 1RK8A 4BS2A 3CMAS 1N54B 1UW4A 3H2VE 2M88A 4QQBA 3EX7B 1URNA 2LA6A 2DGWA 2DNZA 1FHTA 1VQ7S 1YJNS 2NZ4A 2MMYA 1U6FA 2DHAA 2L08A 1M1KT 2MZTA 2CPYA 2CQGA 1VC6A 3MUTP 1WWHA 2DO4A 4WFAQ 5LXYA 3TYTA 1P1TA 2LCWA 3SMZA 2CQ4A 2DNYA 1BY9A 1X4BA 2CQIA 2DGUA 3MUVP 1YJ9S 2AD9A 2FHOB 2JVOA 1NU4A 4C4WA 1WI8A 1WELA 2RNEA 1M5VC 1H2VZ 3UD3P 5MLCV 1X4HA 1M90T 2RS8A 5GVQA 1PO6A 1WEXA 2CQ3A 1DBDA 3V4MA 1U1OA 5DDPC 2MQQA 3J7ZT 1A7GE 1VBXA 4J5OA 1WF0A 5IM0A 2KG1A 2MPUA 3VAKA 1HL6A 2RT3A 1VQ6S 4Y0FA 2B0GA 4F02A 2LA4A 1Q82T 3VAJA 2X1FA 2F9JA 3MD1A 2PE8A 5IFMA 2RQ4A 2CPFA 2EK1A 2DB1A 5EN1A 5D77A 2YTCA 2MZ1A 2MQPA 2E5GA 2FPHX 3B4MA 3CCJS 3VAMA 1WHWA 4PRFA 4YUDA 3FEYB 3VAHA 1JMTA 2MY8A 2ZJRQ 4QPTA 2E44A 1SJFA 5JVGQ 5HO4A 2ADCA 1X5PA 2DIVA 3G9CA 3P49B 2YKAA 4FXWA 1OO0B 2CQHA 3CXCR 3CCMS 3BO2A 2AYMA 3THTA 4QU6A 2LKZA 2G4BA 4EGLA 1WI6A 2CQDA 5LSLA 3IRWP 1WG5A 1YIJS 2G1DA 1U1NA 3I55S 3US5A 3UD4P 2MJUA 2NLWA 1YITS 4LJMA 2VODA 3L3CA 2F9DA 3THPA 3P6YC 3VF0B 3I56S 2HGNA 2V94A 2BOPA 3CMES 1B7FA 2PEHA 4V19X 1N88A 2MY7A 2DHSA 2M7SA 1YHQS 1WHVA 1H2UX 1JJ4A 1UAWA 4A8XA 2N7CA 3CCQS 1VBYA 1WHXA 2YH1A 2DO0A 4FXVA 5CXTA 1VQ4S 1H6KX 2DGVA 1VQ8S 1D9AA 3P5TL 3TO8A 1VQNS 2AYEA 1QVGR 1OWXA 5GAHU 4IOCQ 3NMRA 2KXFA 1JJ2R 3CUNA 4W92B 2MZSA 3B4DA 3G8TA 2CPXA 1QVFR 2AYBA 1U2FA 2FC8A 2DGQA 4OZ1A 3UCZP 3NNHA 2GHPA 2XNQA 5D78A 4Z2XA 1VQKS 3ULHA 2XS7A 1Q81T 2M9KA 2MKSA 2DH9A 3CCSS 4WFNQ 1FJ7A 5CYJA 3FEXB 3BO3A 2RUGA 2CPDA 2CPJA 5GAEU 3S8SA 1OIAA 2MKHA 3CC7S 2I38A 1HD1A 1U1RA 2OSQA 2LYVA 2QEXS 5DDOC 1H2TZ 2MGZB 3CC4S 2RQCA 2DH7A 5IM0B 2N3OA 1WTBA 2J0SD 2KYXA 1P27B 2FC9A 1X4FA 2Q79A 4CH1A 2KM8C 3MURP 4M5DB 2XS5A 3Q2TC 2CPIA 4U67Q 3G8SA 2MGZA 1UP1A 1U1LA 2XB2D 2KU7A 4YB1P 2XSFA 2MSTA 5ITHA 3NS5A 4IOAQ 3ZZZA 3MD3A 1X4GA 1OPIA 1YTYA 2KVIA 3MDFA 1ZH5A 4TLQA 1VQMS 1N52B 1VQPS 1Q86T 4ERDA 3NNCA 1VQ9S 1JJHA 2QA4S 3UCGA 3CPWR 2OIHA 4ZKAA 2LMIA 1PGZA 4OZ0A 2MSSA 4IUFA 4LMZA 3H2UB 4YOEA 2O3DA 1AUDA 5DDRC 5JVHQ 2KT5A 2D9OA 1VQ5S 2VOOA 5CA5A 3U1MA 2M4MA 3CCLS 3CULA 3BEGB 2MQNA 4CQ1A 1YWXA 3MOJB 3U1LA 3HHNB 2OTLS 2MKCA 1X5TA 2L41A 2XS2A 2MB0B 2JRSA 3G96A 2N3LA 3PIPQ 1VQOS 2DGOA 1X4AA 1WHYA 2ZJQQ 1SJ3P 1QM9A 2A3JA 2AYGA 2RVJA 2FY1A 2MJNA 2X1BA 2F3JA 2MZQA 3K0JA 2KI2A 3EGNA 4P6QA 1WEYA 2DNHA 2KRBA 1WEZA 2VOPA 5FJ4A 2DNGA 2MKIA 2DIUA 2J8AA 2EVZA 1FJCA 3S6EA 5LXRA 2DH8A 4RU2A 2LXUA 3MXHP 2K8GA 2DNMA 2E5HA 3R1LA 3BO4A 2U2FA 2OJ3A 3CCUS 3S7RA 1SXLA 1Q7YT
chains in the Genus database with same CATH superfamily
4CH0S 4N77A 1Q53A 1VRTA 4DCPB 3KMSA 1TELA 2EC0A 3BREA 3I87A 5A76A 3LP1B 2H4YB 5E3RA 3OW2R 3CIZA 5KFDA 3W2VA 1NPPA 5I3QA 1IKYB 2XI2A 3CCVS 3Q8PB 2HWIA 5J1EB 4NLYA 1EZZB 4C0OC 3W8PA 4B9VA 3O8WA 1VFJA 2ADBA 4LFCJ 4LF4J 3GB0A 4ECUA 2HHSA 4MK9A 5GMKa 2DBBA 9ATCB 4OL8A 5ETNA 4ZP6A 3PKYA 2NCKL 1JLBA 2BQRA 5GAGU 4KKOB 5F8NA 2N82B 1S6PA 2MYFA 2HK2A 2B7BB 4KGZB 2HBQB 2VFSA 1SKRA 4A8MP 1U6BA 2E5LF 4CLUA 1Y0HA 1IBKJ 1HBNA 3MR7A 4DU7A 3E01A 4JI5J 3MMAB 1SKWA 4H4OA 1S6UA 3BGRB 3A3NB 2R7OA 4B3MJ 1EARA 1NDPA 1RISA 1YZ6A 2WSFC 4DXLA 3J81U 1X0FA 1NJIT 3R6LB 1UTAA 1O0PA 4PG5A 1U1QA 4C6AA 3QPIA 4OX6A 1CJKB 1ZAXA 2ACMA 3TAMA 1VBZA 4XDCA 3AA8A 3UNGC 3G6YA 3M2VB 3J80Y 1NKCA 5KFRA 4KV8A 2HGLA 5K14B 4M5NA 3EUNA 4WIIA 2E29A 4O3RA 1R0BG 4ZCLA 1IBLF 1IUJA 2C3YA 3H20A 1OYDA 3BM7A 1LWFB 3QWPA 4RR5A 3MPDA 1U4BA 3GIKA 1RT5B 4CO5A 2UU9J 2W2MP 4G1IA 5D4NA 3QBCA 1WDDA 3MZIA 1YJNS 4WKYA 1IR2A 5HROA 2YNIA 5KG7A 4X2BA 1O51A 2GGPA 4MYUA 3SBMA 3I6PA 1GT8A 2ILZA 5D4OA 4PQUB 2GQ2A 4PPZA 4JV1A 2YQ1A 1OYEA 2Z4PA 4DPXA 2O01C 3P4UB 3ENAA 3OHAA 2PO4A 4CLZA 3HPOA 5DO2A 1Y00A 1FF2A 3J7YI 4F02A 2Q6CA 4PXCA 2RKIB 1FJGF 2YKMA 3C14A 3LP2A 4YP3A 1H38A 2WONA 4OLOA 4LF5F 1SH2A 3M32B 3W1YC 4AE5A 3F0NA 1S6OA 2GA7A 4ECVA 1B3TA 3DLBA 5ETPA 4ECSA 1RHUB 3Q8UA 5KG6A 3GIRA 2VQEF 3QT6A 1X60A 3IRWP 1UFLA 1D9DA 1V3ZA 4LQ9A 2FJEB 2CJXB 1LWEB 3CB4A 4L3KA 2Z2YB 5IXUA 4ZPAA 1XEZA 5E3CA 5E2QA 1UFKA 1Y3KA 4ID8A 1FKOA 4HH0A 3QAUA 1C0TA 1EJ7L 2VIHA 5K8PA 3FJ2A 4IOCQ 3IXQA 3UN3A 4CNZA 4B3RF 3NKYA 4HACB 2OHDA 4DMZA 2ZDOA 1VQKS 3QQCD 2WVCA 1S9GA 3U27A 2HFOA 3H5UA 4YR0A 5KG0A 4GC6A 4AFFA 2LFVA 1QDUB 1Y5LB 4HH1A 3CC7S 1GFWB 2OSQA 3BN7A 2QLJB 4N8OA 2DEJA 4E98A 1H74A 3CSKA 3PR5B 1SL0A 4ECWA 2BW2A 2MSTA 5ITHA 4IH7A 2XCPA 4YB5A 4KHRA 4ERDA 1X7VA 2H5EA 1G6BA 1U25A 4DG1A 1WTFA 3BGOP 2QT7A 3OTOJ 2D69A 1IQZA 5M2PA 4HI2A 3ILLA 4RJVA 2XS2A 4N7TA 2HFVA 4DS4A 1C0UA 1BQNA 3W3SA 3DNCA 4LR9A 5FJ4A 5T41A 4NRUA 2OP5A 4RU2A 2LDIA 5CAAA 4I6YA 5IWAF 4QW9A 2BJ1A 1B0PA 2L9WA 2CQCA 5GAGI 2JX2A 2B8PA 4RUCA 5C7PA 1T9VA 3FVYA 3HFZB 3JQMA 3OR1B 4DQRA 2V0NA 3KXDA 2Z57B 2MKKA 1ZZFA 1FD2A 3QRRA 5CZXA 1FD8A 3VAFA 4MAKA 1RJJA 1UVKA 1SV5B 1PAEX 1F0XA 2V4QA 2KXHA 4NI2B 1WOPA 3CJ2A 2HVHA 1I3OB 2XMUA 3C3LA 3IGNA 2HHWA 3JTPA 3L9ZA 4RW8A 3EZ5A 2BABA 1PJ5A 2VB6A 1ZAWA 1VISA 2LU2A 4DLEA 1FDBA 3FBFA 3R9LA 3HT0A 2V34A 2BR0A 1TKXA 1HHSA 4LFBJ 1MN7A 2PEBA 4N47A 2RE1A 1X4CA 2NS1B 4JI4J 1Q7LB 1SQGA 3C16A 2E7VA 5ETTA 4KGVB 2XYPB 4OHXA 4GKKJ 1JK9B 3ZTQA 2UXDF 1NZAA 2CPEA 1R0CB 2HHQA 1E6YA 2AX1A 3N0VA 2EK6A 2LQBA 2W25A 3CTRA 2BJ9A 1RI7A 3OTDA 2JLFA 3BB5A 1HBUB 3LF0A 1KQGB 4NCGA 1JXLA 2HRYA 1VC0A 2FY8A 1V9OA 3EGZA 4CO4A 1REGX 4I2PB 5E3AA 5H9FK 1CULB 2A18A 4HHUA 1B7YB 4K8RA 3F73A 5A6WA 2FHJA 5HMXA 3DM2B 1CS4A 4LF4F 2OPQB 2ZBPA 1RK8A 1KLMB 2CNOB 1SI9A 4QQBA 2EPIA 3M30B 2WBMA 1W7WA 2NZ4A 1HW9A 3KHHA 3PKMA 3EPIA 1MMDA 3IBCB 3TYTA 3N6MA 2ZHAA 4K5SA 1IBKF 5IQ6A 4C4WA 1WI8A 2QSWA 4JI5F 2XLIA 3D5MA 3UD3P 5MLCV 4IQMA 2UUCF 5FIIA 1V5IB 1KQFB 4NCBA 1HL6A 3A1YG 3F56A 2IM2A 4Q2MA 2IRXA 3VAJA 4JOUA 3HCXA 2JJ4D 1HWKA 3ZTPA 1JMTA 3TRGA 2VV5A 3DC2A 1TL3A 2AJ4A 1ZBTA 2B4OA 1K1SA 3CJQA 4RBTA 4UW2A 1NSQA 5EGYA 1HHTP 1YJ7A 2QMUB 2QRRA 3M1VA 1F3VA 3IFEA 5KFPA 2J7WA 4M5IA 3US5A 4AQYF 4LJMA 1IM6A 3MPYA 3PV8A 3I56S 1REVA 1RLDA 3Q8RB 5F8MA 1B7FA 1S4FA 4KH1B 2L3MA 4F4KA 4ZLNA 1YSJA 4FF3A 3NMRA 4QWAA 2BQUA 1Y3JA 1FRMA 1YZ7A 1RWVB 2AYBA 2PA3A 4C9DA 2XSJB 2ALYB 2M9KA 1EKRA 3OT9A 2CPDA 2CZ4A 2CVIA 3BSNA 4LSLB 4PABA 1NM2A 3QFWA 4ELUA 1P27B 4B02A 2HHHF 2ZVSA 2EBGA 2Q79A 2D3O1 2YKQA 1UP1A 2IIHA 2IYIA 4LUBA 5BYSA 1YTYA 4E2FB 3MDFA 4TLQA 3RB4A 4ECQA 2ZUGA 2PC6A 5J1NA 1S9FA 2VICA 2OPSA 3HD1A 1HMVA 1VQ5S 4ZITA 5H9FJ 4LR7A 1YWXA 1PJ6A 3EPGA 1Y4ZB 3DRRB 3PW5A 2MB0B 3UI3A 1BE4A 2JHEA 3KLEA 3HSJA 4QR1A 4Z7CA 2ZZTA 4I56A 2IBOA 3IR6B 4WXOA 2GQCA 1EKSA 5KFOA 3ISND 4EZ6A 3BSAA 2KG0A 1UZHA 5CCMA 1HR0J 3ZZRA 4F50A 2I9SA 5DLGA 3W2VB 5I3UA 1RHKB 1XC9A 5A8WA 2FZKB 2EW9A 2CQ2A 1HWIA 4JI0J 5KFMA 2QJ3A 3RYLA 5AE1A 3V4IB 2C3UA 2C2OB 5FD1A 2IPOB 4OX7A 4FKXA 5ETRA 3AOAA 1JLBB 1CPZA 2D7SA 2M2BA 2DRAA 3LAMA 4N56A 2D3OR 1FRLA 2E5JA 4EI2A 1S6PB 5F8IA 4OX9J 2F40A 3C6UA 3GJSB 3B82A 2V4JA 2QZ8A 2B5JA 3H5SA 1HBNB 2XYHB 1ZTWA 2JWNA 4H4OB 2G2ZA 4ZMMA 1DRZA 2XMKA 1UJ6A 4X65J 4JUZA 2MXYA 1TK5A 3S1TA 4QR0A 8AT1B 2AJ0A 3B78A 1T02A 2LEAA 2V67A 3TAMB 2J8SA 2DRDA 1KONA 2RMLA 2R7WA 1T8EA 3QGPA 3M8ZA 5KG3A 3AJDA 3QJPA 3RB3A 5H1SV 2J76E 4KV8B 1EETA 2IC3A 2X1GA 3AXMA 4J9SA 2HNDB 5KFKA 2JEJA 4O0IA 4R25A 1VC5A 3KLIA 3RAMA 4QWBA 2PDAA 1SQFA 3ILJA 1YRTA 2BE2B 1HQUA 3FEZA 4FPRA 2UV8A 3C19A 2POKA 4IOBA 3VGSA 2UUAJ 5A8RB 5J2MB 5HROB 5DM7Q 1N54B 4P75A 4ELTA 1WC0A 3O1LA 1YKWA 3K5PA 2VA2A 2GGPB 2H51B 1ELOA 3ZO7A 3AD8C 3AB2B 4Y2CA 4R5PA 5LXYA 2Q3PA 2VFVA 2OD6A 1LKZA 3EVOA 3SMZA 3PDNA 3OXLA 4NOHA 1H72C 4LFBF 4R0JA 2CKWA 3LPEA 1RYSA 2Q43A 4JI4F 1XWLA 4BCAA 2R4FA 3SFUA 1BQMB 3LALA 4I6AA 3A8EA 2FHMA 3C14B 4M5MA 4FF4A 2CPFA 2ZITA 1HYSA 1YJTA 4Q5VA 2FJXA 4URSA 2QIFA 2DR6A 2CDQA 2E44A 1FE0A 3KJVB 4DX5A 1CEZA 4MIWA 4J37A 1XMQJ 2WVDA 2FD2A 2G4BA 3LP0A 4LRBA 1IKVA 4NLSA 2W2OP 3BYPA 4UF4A 3L3CA 1ZYQA 3N6NA 1MLAA 3CD7A 5DZ7A 1N5TA 1JLQB 2NREA 9RUBA 2HK3A 1Y10A 1U0HB 3AD7C 3EICA 4LF8F 2GW8A 1S9GB 1KDNA 3DRXA 3M9NB 2BJEA 2BDPA 1HI8A 4PEOA 1KHVA 3LWMA 3KNGA 3HT3A 2C2MB 4CO0A 4CRJA 3CJKA 1KVIA 3W60A 5C25A 1VLOA 3GJTB 1TVRA 1RWNB 1WDTA 2JZ5A 2KYXA 1AROP 4GVBA 4CH1A 3OUYA 3JSMB 4U67Q 7AT1B 2YY3A 2Z8QA 1IN0A 4O44A 5CCLA 2W2PP 2E9RX 1VQMS 2ATCB 5CQGA 3O6QA 4NLRA 1RB0A 3C66A 4G6VB 1K0VA 3ZTOA 1PGZA 3UR0A 4V1Ak 2ALZA 1AUDA 3KHLA 4DR1F 3BR8A 1C0UB 1BQNB 1U49A 1OSCA 3U1LA 3RRGA 3NMAA 1SJ3P 1RBOB 4WP9A 5KOXA 1Q8IA 2BYCA 2RH3A 4BWMA 4MYTA 3LANA 2DNGA 3JYTA 2HFNA 3TEGA 3FDSA 4Y2IA 3LGNA 2ZHBA 5FDLA 3PYDA 1D9FA 1T9UA 1Y5NB 4K5RA 4C8OA 3F41A 1Q5YA 4F0KA 3I5BA 4DR6F 2F8MA 1BMQB 3OLBA 3AAWB 4ES2A 5KFJA 2RS2A 1HWUA 3DGPA 3HMJG 3UN5A 4B08A 1N0VC 4WKRA 2XZDB 4RNHA 3G82B 2PI4A 2C2ZB 1RCOB 3MEKA 3UCUP 3J81Y 1RAHB 3D66A 2PFDA 4RW8B 4URGA 5HQMA 1KBRA 5CYQA 3HXMA 1H0HB 5KT6A 5F8GA 2JLGA 1VOMA 3R97A 2BZ2A 3TNVA 3P45B 1TKXB 3W64A 3JSYA 1CVJA 2F8HA 2AGQA 1IKXA 2KFYA 1IQTA 5J2QA 1K9MT 3C16B 4LRDA 2QMXA 1JQGA 4FF2A 1NJZA 5DGAA 2CFXA 1KNZA 1IWAA 3CDUA 1E6YB 4WTOB 3GCWP 2HBRB 1R89A 3JTOA 3SCKE 5HL7Q 4D3HA 1DHMA 2DHGA 3RBXA 4DQSA 2DNLA 2WSCC 5HN0A 3PNIA 1X4DA 4JI0F 3U02A 3Q89A 2JSXA 1L3VA 5KTQA 3BKTA 1CS4B 4FPIA 2ASYA 3AQPA 2WVBA 1PYSB 1UJ5A 4LT6A 1PBAA 2F7VA 2DNKA 1ZTTA 1QUPA 3D54A 3SV3A 1SC1B 1U6ZA 1RABB 3DOMA 3KG4A 2BKNA 4X4NA 1TL4A 3GILA 4J9UE 1F3FA 1KLNA 1NDLA 2P9EA 3EVWA 3BV8A 3R5BA 3HK2A 1HWJA 1GAOA 4PYDA 4X65F 4X4PA 2CG8A 1FX2A 4MIBA 1S57A 3FMWA 4A47A 1S97A 4PXDA 2OMLA 2MLZA 1RT1A 2HBYB 1YBTA 3D3BJ 1WKKA 3NCRA 5HMWA 1T9WA 1TUGB 4ED7A 3EYZA 6FD1A 2DB1A 3RR8A 3CO9A 1TL3B 3KDNA 2E5GA 3B4MA 3CCJS 1WHWA 2ABYA 2R8IA 3VAHA 3DU6A 1Y5IB 4X4RA 3ET6A 3UVJA 1X9WA 3V2UC 4LQ3A 3RB0A 3K58A 2DPIA 1NPKA 3M1VB 3CXCR 3THTA 4GKJF 2VBZA 1DFDA 5L8RC 3L7UA 4F4XA 4K4XA 4RUAA 2AJ2A 2HBZB 2CNKB 2RQKA 4X84A 1DTQB 2J0XA 5F8HA 4DSJA 4G1QA 4BDPA 1UW9A 3THPA 3DMJA 3BJYA 3T19A 1VQ4S 3V6KA 4B9MA 3EXYA 3P5TL 3IP0A 3L09A 4DUTA 1N33F 2VASA 1KS2A 1LWCA 3GQCA 4NZ7A 1JIHA 1XERA 2XO6A 3ITHA 2XS7A 3CCSS 1EP4B 5L1JA 4YMEA 2HZVA 3GFHA 2BJ3A 3TA1A 1FFSB 3GYXB 3QGIA 1FVSA 4QIEA 4DR7F 2F8EX 2XI3A 1S99A 1FEEA 4AL5A 2YNGA 1X4GA 2AGOA 1UEVA 3C15A 1YJRA 1XMQF 1R8AA 3CPWR 4DL7A 1RT7A 1SH3A 1I6JA 4LSNA 3T1HJ 4DHVA 5DDRC 1T7PA 1EAYC 3IAM9 3RBEA 3GP9A 4Y28C 3G96A 2N3LA 1NBEB 1VQOS 1KTVA 1QM9A 1RWKB 4P6QA 3MOZA 1WC6A 1XK8A 4RO0A 1UA0A 3BPDA 4FYWB 2EVZA 3R1LA 1NK8A 4DL4A 4DL0C 3E3XA 5DG8A 4DQQA 3Q8QB 3BBBA 4DV6J 4OJ1A 2YNHA 5I3UB 4K2XA 2V50A 3JSBA 5A8WB 3VTIA 5BJRA 2WCXA 1OS5A 1ZM2A 1YJUA 2KHCA 1K0TA 3CJ4A 3QO9B 1R8BA 4RW6A 5AJ3J 4M5GA 2OELA 4ES1A 1FKAF 4NYZA 3CCES 3B6BA 3I5CA 1ZZNA 1NXIA 1KQSR 3DLHA 5B7WA 1KC8T 2CAJA 2RIJA 2VJUA 1LW0B 1SIWB 2BUNA 2CQ1A 4F7VA 3K5NA 5B09A 1SKUB 3BGFA 1LV5A 3QJJA 2V4JB 4UY8T 2B5JB 4M1KA 2YWKA 4TU9A 2ZH5A 4RLEA 3G4SS 2DNPA 3N9UC 1WG1A 3NEKA 1HWLA 4YR2A 3DOLA 3MF5A 2VD3A 1V6HA 2K1RA 1IVZA 2IHR1 4I2QA 1M5HA 5AT1B 1LEOA 4DF8A 5IQQA 4OYBA 4HLBA 3HVTB 2O5DA 3OTCA 3GV5B 4DV7J 4MKBA 1HNXJ 1EETB 2MDAA 2IC3B 3MMJA 5LL6d 4OHZA 4PWDB 2LXFA 2XM3A 1DZ5A 4RW4A 3MUMP 2IRUA 1XN9A 4DL3A 4ED1A 3RZAA 1HD0A 2VL1A 3EGVA 3PCOB 1I51B 3HHLA 1N5YA 2KL8A 3TJAA 4ICLA 3GZ7A 2OSRA 1L3TA 4TYBA 1W25A 1FXRA 4NASA 4JV5J 2ZWOA 1VYAA 4B3OA 4UUWA 1S76D 3DRYA 3HZGA 3HZEA 3FRYA 2LA6A 4R5PB 3KHGA 2AIRB 4DV3F 4U8VA 1U6FA 2R8JA 3BYRA 2YQ0A 3UPFA 1Q8KA 2VPXB 4DR2F 5DS7A 1K1QA 4KHPJ 1HQEA 3KLGB 3TX0A 5L1IA 2HMIA 1UL3A 4OYAA 4IKAA 3KK1A 4LRCA 3EMTA 1HYSB 4NPOA 1HNZJ 4Y0FA 2YNFB 1Q82T 4ZN3A 5IFMA 3OBIA 2YTCA 5BR8J 4A8SA 4QPTA 1SJFA 3I9ZA 3P49B 4L75A 4FXWA 4KC5A 4DSEA 3X1LB 1F60B 4TNOA 5JJBA 4LVNP 3D28A 2AX0A 2EC2A 4F2RA 2HHXA 3AODA 3WQPA 4C8MA 1DTTA 3C6TA 5D0EA 4EBEA 4F8RA 1B0TA 1N56A 2BOPA 2CG4A 1N88A 2DHSA 1ZPVA 3D1OA 2YH1A 2FUG9 2AZ3A 2FIUA 4EEYA 4YS2A 3DRSA 2N4DA 2Y8YA 5GAHU 3RBDA 1RT6A 3DXSX 3CJKB 3A3PB 4NWBA 1RWWB 1HARA 1RAFB 3LP1A 3ULHA 2GZOA 4RNOA 3NY0A 3MMCA 5C25B 3ZFVA 3PFEA 4TY8A 3QIPA 4DR4F 4GVBB 2VZ9A 3CMQA 2YX7A 4PG8A 3ILOA 4ELVA 4ZPBA 4OJ3A 1HNWJ 3PEJA 3M9OB 4O44B 1S1XA 4ZVSB 1PIEA 3RG6A 4FBTA 4M5KA 2DPJA 2QL5B 2FLPA 2OIHA 2FJWA 2B8QA 4P2FA 3H42A 2LMIA 2F5GA 1FRKA 3JQJA 2FB0A 1S0NA 3MPVA 5D8HB 4IRCA 2KT5A 3T5JA 3NOGA 2Y3YA 3JS9A 3MWBA 2MKCA 2GAGC 1R7IA 1RA6A 2JRSA 4IFVA 3MMAA 4ZN1A 3MM7B 3T3FA 4QWEA 4C11A 2X1BA 3BGLA 1WEYA 1FWLA 2JC0A 1UVLA 2Y8WA 1T3OA 3CJ8A 2J8AA 1CJKA 4J9PA 4KE5A 4DS5A 1JLGA 3I31A 3CCUS 3S7RA 4C8LA 1BWEA 2CJQA 3SCIE 4X62J 4JV2A 4KPCA 2KVQE 5ETSA 3KLHA 2ROGA 2KRRA 4O3QA 3BS9A 4PKDB 3ENVA 3CJ0A 2HQIA 3VHQA 3FSIA 3R5DA 5AE2A 4M8LA 2Z58B 1JXEA 2PGCA 1UKUA 1LWFA 4HT5A 4OZLA 3VALA 1S79A 1AB8A 2VG5B 2HVZA 1WG4A 1BD6A 1RA7A 2YX1A 1ZS6A 5CYQB 4PPDA 4V19J 2FJBB 4DFKA 2IMOA 5HQLA 5LMNJ 3Q8YA 3T1HF 2Y1JA 2BANB 4PQUA 5THWA 3DHWC 2K3IA 2WAQD 4WP3A 3SSRA 5J2QB 3ZZUA 1ICEB 4CZCA 4DX8H 5L1KA 2QX0A 4ZPTR 4H54A 2HWHA 2AEJA 1HNIA 4DV6F 5KT2A 2NSBA 3TWZA 2D9PA 4WTYA 2W1BA 4PZVA 2OFGX 5DGBA 4DFPA 2EFOA 1SJ1A 1RLCL 1C1CA 5L46A 1J2VA 4ZP8A 1U1KA 3T6BA 4KH0B 2KB2A 1S9EA 1Q16B 2ILYA 1S6QA 5MAOA 4PWWA 3G6ES 1R0AA 1QAJA 2PI5A 3MCSA 3SQOP 4ID5A 2YKNA 1U8WA 4KO0A 2XNRA 3DOMB 1RYRA 2ZJPQ 2ZBCA 4W90B 4DCOB 1NRKA 1SKSA 2NYHA 1RAEB 4DU8A 1UW4A 3H2VE 4Y65A 1FHTA 2R8KA 2VPZB 4DR3J 3ETMA 3RUBL 2ZEJA 3QYYA 3CJ5A 3HSGA 3H0PA 3J7Z5 2Y1IA 3EE3A 1WELA 2ZH4A 1RT1B 1D3WA 1X4HA 3V4MA 5EX0A 2YWFA 2MQ8A 1P6TA 2G1HA 2VFRA 1RAIB 3TR5A 1HI1A 3FBCA 4DV7F 2DR7A 1HNXF 2H5JB 2PE8A 2QA2A 5K8MA 3R8YA 3FZBA 2MY8A 1R43A 3T9ZA 5GMEA 1QSYA 5B0FA 5GAHI 2EFNA 4OJGA 3NCQA 1B0VA 4DV1J 3PYGA 1SIZA 3MM8A 1OJ4A 5ETMA 5E3QA 3GCXP 1HKAA 4G1QB 1AZSA 2HAFA 3DMJB 5IT0A 4OYMA 2YWHA 2L48A 2XZTB 1URRA 1NH8A 2NLWA 3C8YA 3P6YC 1IJFB 3CMES 3NGKA 1IR1A 2YKPA 1LWCB 4NA3A 2DGVA 4N8NA 4GO7X 4ATNA 1TKTB 4AT1B 3ITHB 2B4PA 4KHPF 2LVWA 1U2FA 2V8GA 2LDYA 4Z2XA 4ZVTB 4DL6A 2ZHOA 2GIQA 3LUYA 1QJHA 3ETOA 3HHKA 1RHJB 2OAUA 2V2ZA 1HNZF 2OEMA 4IH6A 3OR2B 3RJMB 3LGHA 1NPRA 2YNGB 1U1LA 4O3SA 3C15B 3CCTA 3I96A 3ZZZA 4M5DA 1RT7B 1RHQB 4ED2A 4KGMA 1FA0A 2UUBJ 4P7TA 2IVYA 3DU5A 2UVUA 1RUSA 4CWBA 1C4CA 3M05A 4K4UA 1VHFA 2J0WA 4O3NA 1GMUA 3OPKA 5D0HA 4USTA 1U2CA 4P72A 2BQ3A 4USMA 3CCLS 1YRXA 1YBAA 3HHNB 4XPEA 2OEJA 1DJ0A 1X4AA 3TEHB 2K7KA 5F3TA 2MZQA 3D6MB 4A8OA 2ASJA 4MTPA 3I9V9 2HWTA 2R7VA 4ZPWR 4DV0F 1KVKA 4DLGA 3S6EA 3I0RB 5LXRA 2YPZA 2YNHB 3MXHP 3WIVA 4P10A 3BO4A 2GJ2A 2XCAA 2OJ3A 3VVUA 5E7OB 5LMUF 1WJ9A 3MAHA 2F63A 2LU1A 1FNXH 3NGRA 1RTDA 1QD1A 3D3CJ 4I2PA 2M8DB 2E9ZA 2YH0A 3Q24A 4ZHRA 2CPHA 5AXKA 2HVDA 2KDOA 2MHNA 1HNWF 4Q45A 2EFPA 2GO9A 3DM2A 5LSOA 1FTRA 4JI1J 2OPQA 3HVRA 1RCXB 4XPCA 4BBYA 2AJQA 2RHQB 3W9IA 4RU9A 3RRKA 5KFGA 2CNLB 4A8YA 1YGYA 3LAKA 4C8ZA 4DF4A 1SJ4P 3FFIA 3T5KA 4O4GB 4NLGA 2X7IA 2J0QD 4CLYA 4HKQA 2E1CA 4IO9Q 1GXUA 2OMOA 2K1RB 5HJXA 2XC9A 2NXJA 3P3DA 2ERRA 3HLUA 2DNRA 4I2QB 4DX7A 2I0XA 3H90A 1B64A 1MMNA 2HFZA 4C8KA 4Q8EA 3GR1A 4BHQA 5D4PA 3M2RB 1R3NA 1FFWB 4AL6A 2HYIB 3H8YA 4LIRA 4WZQA 4RW4B 1FT8A 1X5OA 5J2NA 4YR3A 1W2IA 5JMNA 3ZNUA 2QC3A 2UV8G 4DR5J 1HBMA 1FX4A 3HHLB 2I2YA 1UMJA 1ZPWX 2QN6B 4ICLB 1RAGB 1IKWB 4EO6A 2VFUA 3J7YU 1RTIB 4YDXA 2B7CB 3R2DJ 3MCMA 4N76A 4J9VA 2IMWP 4B3OB 2HGMA 3BBFA 3DLLQ 4O23A 3KKFA 1YI2S 1JXVA 2LQ8A 1U09A 2V8PA 4TN2A 4JI2J 5F0WA 3GU0A 3W5YA 2DY1A 3LOUA 3RAXA 1JKHA 1NJXA 2MMYA 4QWCA 3CJRA 4KHMA 3MUTP 3RB6A 2GAHC 1MG7A 4JV0A 1N5VA 1VIOA 3MUVP 4JI7F 2AJFE 3GFZA 2IFXA 1M5VC 2QYCA 5ETQA 3DHXA 2H9ZA 5SZTA 1RTJB 2JL9A 3QZ7A 3LO3A 4MKVA 4DSIA 4NEYA 1GK8A 2P6TA 1HQ2A 2G0JA 2ZOMA 2RQ4A 4Y2AA 1SH0A 4QIVA 4B3SJ 3P96A 2FPHX 1FK9A 4C48A 4MJKA 2MHEA 5JVGQ 3AY0A 3HKZD 2W8KA 1PILA 4Y2MA 2GFFA 2AYMA 3ISNC 4DUYJ 1DTTB 4ED0A 1S59A 5IC6B 1NK7A 4K0KJ 5B0EA 2VODA 2WVEA 4PUOA 4NLQA 3DRSB 1Y11A 3DYAA 4DR3F 2R8HA 5CXTA 3OTBA 2BRKA 1RT6B 1XIQA 4OI6A 3CO0P 3TO8A 4B9UA 2CJYB 4PG6A 3D0GE 5K9FA 4OYXA 4DPUA 2B51A 4GMKA 4DV4J 3MMCB 2XNQA 3G2XA 1Q81T 4TY8B 3R5GA 3QIPB 4CH7A 2MEWA 3LH2S 1J5EJ 2PN6A 1RWPB 3PM9A 2JEGA 2OLWA 2M5YA 3JXOA 5CD4H 3D1QA 1H2TZ 3V4IA 3OSNA 1S1XB 3NXZA 2NUUG 5IM0B 4OZJA 5L39A 4F04B 2XWXA 3MURP 3Q2TC 1PC5A 1TKZA 3ONQA 3BF4A 1WSVA 1PG5B 4FXDA 4X4QA 4DV1F 3NNCA 2G9OA 3MCOA 3FZ2A 2QA4S 1KSPA 2NXNA 2OI2A 3ICLA 1FDNA 4CLKA 2QLBB 2V2QA 3HFKA 4MIAA 3BH7B 4IFVB 4RNFA 2GHVC 5JVHQ 5H9EJ 1D8YA 3KUGA 4P7VA 4C11B 3MOJB 4WYLA 2O66A 1S4EA 5KG4A 5G4DA 5FLXU 5IV4A 1P9QC 1KHWA 4XIUA 1X9MA 1JLGB 5GAEI 3KK3B 2K8GA 3ELHA 2VQFJ 1GTEA 3KUEA 3KLHB 2HNDA 1DY3A 3PX0A 2ASDA 3PXGa 2CDRB 2J5AA 1CLFA 3RAQA 3HHLC 2GVZA 2BE2A 2DISA 1K73T 2HSEB 4KB7A 3T1YJ 4H4KA 5A8RA 5J2MA 2E66A 4OIXA 4WXWA 3P8BB 1RP5A 1NJYA 2UUBF 3MM6A 1L3KA 2F4FA 2HIYA 2VDHA 4NXMJ 4QR2A 2CQBA 4ILRA 5ETOA 4Q43A 1NCLA 4WU3A 4B9LA 3BQ2A 1Z4UA 2K7JA 1EQ0A 1ZM3A 3RU0A 1VRUB 1TQLA 1HNVB 1MU2A 3DLEA 4NYOA 1T94A 2M52A 2ASLA 4I67A 1HNIB 5DM6Q 1BQMA 4OV6A 3R3TA 1FNOA 3OV7A 4WE1A 2EG1A 1C1CB 3H25A 4GRSA 2CADA 2VONA 3MPUB 5KFZA 2M8HA 1C1BA 3KJVA 1S9EB 2L9DA 2NXCA 4F4WA 1S6QB 2A6OA 3GG0A 1T05B 1R0AB 3T9NA 1QSSA 3PYEA 4ID5B 3K17A 2YKNB 1TMMA 2IM0A 4KR0B 1T03A 1N6QA 2APOA 4KO0B 5JXSA 4M95A 3RTVA 1YDLA 2NXEA 4BWJA 4HTIA 4FNIA 3G71S 4X64J 3AJ1A 1UVMA 2CJAA 2B9WA 1A9NB 3UWTA 2HG4A 3NRBA 3BQ1A 2GVDB 4DL5A 4UUXA 4WU2A 4BS2A 1JLQA 4ETXA 2FGCA 4ER8A 2DNZA 1U0HA 4QIWD 1VC6A 4NEZA 2B56A 2G2YA 4FYDA 1S49A 1S5ZA 2DNYA 2RILA 1H3DA 1T9TA 1VBKA 2H5IB 1VJWA 1QTNB 2B6AB 2RS8A 3MM9A 2KFNA 2HHUA 2AU0A 4F3QA 4TXSA 5KFEA 2V2KA 5KFFA 1H7XA 3HM9A 3JSMA 2BEFA 1FWKA 4UTGA 2XMVA 2RQMA 3GV7B 2AKWB 3KWMA 5LOQA 2MQPA 2E1RA 1VJQA 3OHBA 3KJQB 4TYAA 2ZH6A 1CC8A 3SSQA 3MM8B 2CJBA 3R7NB 4WYWA 4MK8A 2DIVA 4J9MA 2YKAA 1MNEA 1AZSB 2RDIA 3GONA 3IA0A 1CQNA 4CT8A 2HVEA 4DUZJ 4ED6A 1WG5A 2ZOGA 2ATLA 3I55S 3UD4P 3OSPA 2WHOA 4CM0A 4JI2F 2F9DA 2HGNA 4Z37A 2PEHA 4JBCA 4LR8A 1H2UX 4RW7A 3W7BA 4BC7A 5F3ZA 3G87A 3RGIA 1C2PA 3IBWA 1QVGR 1FRIA 2W8LA 4W92B 1N36J 2RF2A 2RB7A 1ZETA 2C22A 4OZ1A 3UCZP 2B4VA 3QWUA 3GIMA 3R6GB 4KBIA 3T5LA 3ZTSA 2W4PA 3ENWA 4DPOA 4J90A 2RQCA 1NZ8A 2FC9A 4HL9A 5J2PA 3KLFA 3IR5B 4M5DB 2XS5A 4WZMA 3G82A 2CVEA 2QMWA 3K59A 3N6LA 2DR9A 2UXCJ 3UQSA 3TVZA 4NRTA 1FERA 3RRHA 4G3IA 4LF9J 4IYQA 4DDFA 4IR9A 5IOLA 1F1BB 2CRLA 4ZKAA 3V81A 4OZ0A 1TAUA 5LM7E 4IUFA 4LMZA 2O3DA 4K0KF 5F9NA 5F8JA 4USVA 4ANEA 2L41A 5M2UA 2XY5A 4KFBA 1D0EA 2LP4A 3OFGA 3CWJA 2A1BA 2GIRA 1RAAB 2R2SA 1CG2A 3AD9C 4OYZA 3U7JA 2DIUA 3TZXA 2DH8A 3VGUA 4U8YA 3H4BA 5B0CA 1RTDB 1SXLA 2YPYA 2F4VJ 4GC7A 1EHWA 3NAIA 4EZ9A 5IZHA 2G2OA 3RW6A 1J5EF 3DXBA 4ZHRB 5LSRA 4DV5J 4QCLA 4AXJA 3M8QA 1VMBA 3VAIA 2WW4A 3SEOA 4LFCF 1S72S 4ZLPA 3I32A 2KM8B 4RW9B 4Z7YA 1ZOTA 5DLFA 3K5MA 1KKHA 2ZBQA 2OPPA 1LXNA 4DV2J 4EUVA 4IR1A 2Z30B 3FFIB 4K4YA 2W7OA 5A6PA 1DQ9A 1NUEA 4KY3A 2J9DE 2ZE2A 1KR4A 2GIFA 1S10A 1HHQA 4QPXA 1L3UA 4DPYA 2M70A 4B3MF 4OV1A 2JEFA 1AW0A 3UDLA 2IM1A 4ILLA 3EGWB 3VQTA 3MI7X 2DR8A 1TL5A 2EBEA 3HI9A 4ZP7A 4I7FB 5J2NB 3HHDA 5KFNA 2VQFF 2LEBA 1XMOJ 1SJRA 1KRPA 1HBMB 4LRFA 1XNQJ 3PFOA 1RAOA 4BLGA 1M5PC 2G0CA 3KMQA 3EDRB 1WKJA 2IJNA 1U24A 2DGTA 3QAEA 3AT1B 3OLAA 4A48A 1D8ZA 5KT5A 2W9BA 2M3DA 3PIOQ 1F9EB 2V2VA 1SB6A 5EWFA 2R3VA 3M6UA 4F2SA 4UZCA 1RTHA 2R7QA 1I1GA 4ECZA 4CO2A 3T1YF 2GMHA 2UU9F 1DTQA 3AHPA 2ZNZA 2R2RA 3KHRA 1U02A 3K5OA 4EYHB 1F9FA 1WF2A 4FP9A 1JKHB 3T41A 3GG1A 3JSRA 3A12A 2LQ9A 2H3EB 4NXMF 3FBBA 2J6UA 1H7WA 5HVGA 2CWXA 4OI4A 3VZIA 2RHSB 4B9NA 2X3DA 2CQGA 3VGTA 2NSCA 4K4SA 4HTJA 4RNMA 1CJUA 1RT4A 1X4BA 3NG8A 4MFBA 1F2HA 4CLFA 2AD9A 1YJ9S 4JI3J 1NU4A 1EP4A 3QFHA 2AW0A 1H2VZ 2IDLA 3NWRA 4PG4A 1RSCA 5EX3A 1S77D 1KVJA 1A7GE 3L7PA 1VBXA 4O3PA 2Y1LB 4OQJA 3AB4B 1VQ6S 2PA8D 1YK9A 4PYAA 1JLFA 4Q8FA 1FK9B 2V68A 2N4CA 2EKNA 2BBEA 4Q7AA 4OHYA 1RWUA 4ED4A 4CO3A 4FZVA 1RADB 4PRFA 2UXBJ 2ZJRQ 4HYKA 3UN2A 3Q83A 1KQKA 5HO4A 2ADCA 5KFUA 2P5VA 4DBQA 4GVLA 4KQZA 1Z1ZA 3BO2A 1FJGJ 2A10A 4X64F 3FC9A 3T1AA 5F8LA 2HNYB 2ZKUA 4PUOB 2MJUA 5KFIA 4FNHA 4HI1A 4TKTA 4M63A 3DYAB 1QSLA 1FI4A 3M8SA 1V3RA 1O5JA 5EWEA 2JH3A 4RKUC 1VQ8S 4WPAA 3CT9A 1CJVB 2KZZA 3VGVA 3NNHA 2UVVA 3G6VA 2IBKA 3FEXB 3NS7B 3QO9A 3C2PA 3QLHA 3J7A1 4B3RJ 1SUQB 1S7HA 4FS2A 4F3OA 1TKZB 4NZ0A 2QO3A 2J0SD 3FSXA 2KM8C 1LW0A 4JYAJ 3WIUA 2MGZA 3G8SA 1RAJA 3PJWA 2YX4A 2KU7A 4IDKA 2E1PA 3OTOF 2XHCA 1N0UA 4DZ6A 3MTJA 2GMJA 1UEKA 1DAXA 1ZH5A 1IWGA 5A2QU 4EK2A 3DLJA 2VBWA 4FBUA 3QSIA 4RWWA 2DJWA 5CA5A 2FYXA 2HHPA 1A0OB 2M4MA 3KLVA 5HK4A 5DQIA 1Q8LA 1T3NA 1WSRA 2MJNA 5KFYA 2BX6A 5CABA 4IFYA 2VC0A 2B43A 3W62A 1BUXA 2JLEA 3HVTA 3GSIA 2HS0A 5HJYA 3TVKA 2HHTA 3GPAA 4NCAA 4PWDA 5RUBA 3NNAA 4ALZA 3PEHA 4E0DA 1MWQA 2GVZB 4OYIA 2ZM6J 3ZZ0A 3TJ9A 3WHIA 5HBMA 2HIQA 2DITA 4CO1A 3FCWA 3I0SA 5T14A 1BWVA 2VC1A 4RZRA 3CJSA 3GIIA 2UXCF 4WF9Q 2VJVA 2RD5C 3MM6B 2JEIA 2D1CA 5KFLA 4LF9F 3IGVA 4D3GA 5IS2A 1FJEB 2JVRA 3IAS9 2K2PA 1KTQA 4ZDNA 2W01A 4DJBA 2DY9A 1MU2B 2CA9A 3DLEB 2HHVA 2DGSA 2C28A 1W2BR 1AFJA 4ZVHA 3A13A 3GFXA 3KLGA 4GKKF 1GQEA 1RQ0A 3D0HE 4DSFA 4L72B 4WE1B 3MECB 2K06A 3O2IA 2DXFA 2CJKA 3I82A 3WC0A 2YNFA 2PSZA 1UJ4A 2FGOA 2KXNB 4OYOA 4QYZJ 1C1BB 1S1TA 4CLSA 3VV2B 1N34J 2Q6BA 4XAKA 1LNQA 2WB4A 3CDAA 2IA6A 2DGXA 4OX8A 4EFAC 5ETKA 2FVCA 1T03B 5B0BA 1N6QB 2PD1A 4ITSA 4KPYA 2UXDJ 4RPFA 4DFJA 2VHGA 2DCUB 1YJWS 5HI7A 4KIAA 2YBVA 2HPUA 4K2JA 1VS3A 4DV2F 1GXTA 1J5OB 1TU0B 3NP5A 3HJFA 3I4PA 3M4XA 3EX7B 2V8DA 4C3KA 2ZD1A 2OGUA 4E8UA 3DCAA 1UZDA 4L74A 2CIMA 4HDGA 2FJVA 1NLKL 4FYYB 2FHOB 2VF3A 3MM9B 4TVAB 2BA9A 3QT8A 1VRQC 1KEKA 4NXNJ 2I6WA 1QE1A 2G0IA 4B9TA 2WZ1A 2PFFB 4FVCA 3JQKA 4S0MA 4ZA1A 4A8WA 1XMOF 1ACMB 1XNQF 1KFSA 1X0PA 3MR6A 3FUYA 2IAJA 2UUCJ 2CYYA 5D77A 4C2MA 3W66A 1U8SA 2ZC4A 4CP5A 3TANA 1UETA 4A8KA 3DDIA 4I1TA 2C3PA 1RZMA 4EYIB 2CQDA 2FLOA 2ZBRA 1WC1A 2G1DA 1U1NA 3K57A 2C42A 1PKUA 2HAIA 3MGJA 3MM7A 4RW7B 1PSDA 1FVQA 4X66J 1IXKA 2MTLA 2F1FA 3U1NA 2IRYA 2YWWA 5EWGA 3MMBA 4UOCA 1D09B 4I68A 4ENOA 2VFTA 4AQYJ 2RF2B 3SQGA 2QV6A 1VQNS 2ZH3A 4BC9A 1K47A 4JI3F 4O0NA 2WW8A 4WBFA 1TL7B 4RNNA 1DARA 2DGQA 5D78A 2ROPA 2GX8A 4DFMA 4PAAA 1N32J 2FDNA 1FJ7A 2XYGB 4CTAA 1GH8A 2HRUA 1SC6A 2IY5B 1HD1A 4J91A 1FDDA 2X3GA 5J2PB 3KLFB 1S0MA 4K7QA 4OMFG 1O6XA 4F0MA 4H4KC 2VDIA 4U7UK 2VG5A 5FLXY 3W2WA 2OUGA 2UXBF 3QIDA 3R7SB 2DD8S 4IOAQ 4K4VA 4F4AA 2ZZMA 3V81B 2BACA 4QWDA 4WIQA 4OLPA 2HHHJ 2BANA 5B0GA 1TMJA 2RSQA 1NK4A 3QSYB 3M6VA 1G1XA 1YRUA 3PR4A 4X4VA 2VOOA 4J7CA 3IG1A 4KFBB 2VKZG 3MR3A 3DI6A 4K4WA 4CLTA 1IBCB 1WC4A 3IBFB 2FY1A 2KI2A 3TQEA 1TTHB 2KRBA 4ED3A 1HR0F 4DPWA 1MWZA 1IR0A 2LXUA 2BJ7A 2Q1LA 1QAIA 4UOGA 3DDKA 1PCAA 1UVJA 3W9JA 2QFIA 3OD2A 3M8QB 2WRMA 2CQPA 3OXFA 4Y00A 4TQSA 5KFVA 2EFGA 4FVMA 5E41A 1TUVA 4YHHJ 2OPPB 2MQMA 1AT1B 4JYAF 4OX9F 3GWCA 4KJIA 5CHCB 3FMBA 5AXMA 2ZH1A 2LXIA 3TUJC 1N4LA 3KJNB 2DVIA 3M2UA 4ZPVR 2ZE2B 5KFQA 3ENQA 4ZCKA 3ZTRA 5LJ3Y 1Q79A 3IN5A 5F0UA 3H40A 1UEUA 1WUUA 3WX8A 3LQVA 3T5HA 2RRAA 3S01A 1U1PA 1UWAA 5F41A 3D0IE 4U6PA 3QT7A 4OHVA 2Z2ZA 4K4TA 2HQDA 3CD6S 3LA0A 4H4MA 5DJBA 3D2WA 2ZNYA 1N5SA 2CQ0A 3W63A 4DSLA 4USKA 5D3GA 1KOOA 1OQ6A 3HSDA 2EKYA 4MT1A 2W9BB 1WORA 2CPZA 4LREA 2ZM6F 3CJ3A 2DNOA 3POTB 2FTRA 3BKUA 1RTHB 3V6HA 2UUAF 3H4DA 3CCWA 3PHTA 5KG1A 3TAQA 5D4LA 1KOHA 2B4UA 1RTZA 3TZYA 2XMWA 3WC2A 1NHUA 2R7TA 1V5VA 5K8NA 1NO8A 5DG9A 5HAOA 4FS1A 4C0BA 3IS9B 3FRZA 1CJUB 2YVSA 1BXNA 1TKTA 1RT4B 3CNQP 4MFBB 2NYIA 1JLCA 3ADAC 3BPSP 2DO4A 2FLNA 3GLJA 4NLWA 4DN0A 3OVBA 1OQ3A 2I8EA 3CD5A 5KFTA 4MK7A 2Z2LA 5G0RA 3UO0A 2W24A 4LFAJ 1FXDA 2MQQA 2WB1D 3OR2A 1SL1A 3TOQA 1JLFB 2KYZA 3BQ0A 4ED8A 1LW2A 3MHYA 4A4JA 4OJHA 1N34F 5I42B 2H1YA 3K2YA 3OTEA 2IM3A 4KYZA 3ZXWA 3JAMU 1GEHA 2HFSA 4C98A 3HJVA 4NLUA 4J9OA 3BN4A 1TFYA 3FBEA 3N01A 2RU9A 1FTCA 4QU6A 1RWMB 2LKZA 1U48A 4EGLA 1JJCB 4WFZA 1YIJS 1MN9A 4DSKA 2XO7A 4ZJLA 4V19X 2E9TA 1E6VB 4A8XA 4FKYA 2VG7A 3MAAA 3RBZA 1VBYA 4RWXA 3I0RA 8ATCB 1S7IA 2DO0A 1RGVA 2KT2A 3D9BA 2KFZA 1FKPB 2AYEA 1WOOA 1OWXA 1TZ0A 2FJAB 4O3OA 5BYQA 3G8TA 2CPXA 2HW3A 4CDIA 3IMQJ 1FRXA 2B9YA 3QLHB 2DT9A 2GHPA 3CDEA 4NXNF 4QW8A 5HP1B 2MKSA 3N5FA 1V3SA 3OVAA 1M0SA 4LF8J 4USUA 3UD5A 3MEDB 3NGTA 4HDHA 2QEXS 1T9YA 2MGZB 3KUHA 3KK2A 1FWPA 4IDKB 5EHHA 2HNZA 3VQSA 3QRPA 4R0EA 2P6SA 1ZA2B 3MD3A 4OZ2A 1VI7A 3TZZA 3AH6A 2JNJA 2V9KA 1Q86T 1JJHA 5IT9U 4O4GA 2XY7A 4O4RA 3L7OA 1W26A 1RWXB 1PBUA 3OFFA 2Q66A 4TQRA 1NEEA 4ETZA 4YOEA 2J7UA 1MROA 4GO5X 1JLEB 1LQ9A 2E1MC 2D9OA 3ZNJ1 4B17A 4NZ6A 3MR2A 1QTMA 1U7LA 4P52A 2OTLS 4USHA 4X66F 1KFDA 3D68A 4IFYB 2HFUA 1NK0A 1RT3A 1LFPA 2BV3A 3QGGA 3M2RA 1NDCA 1WEZA 2ZFHA 4DR1J 5L1LA 1AA1B 1FJCA 4Y2KA 2NPIA 1QAXA 1DLOB 1LK5A 3OQ2A 3TUZC 3HSZA 1FNMA 3PTWA 3B8HA 1N32F 1Y7PA 2M0GB 4AUKA 2SXLA 5HBMB 4ZS6A 4DN9A 3I0SB 1IKWA 2VKRA 4QYRA 2V4RA 1RTIA 2HZCA 2QA1A 4OYWA 4ZVRB 4NLTA 4ZVFA 3GMGA 1X5SA 1S12A 2BJDA 1UWBA 2NXUA 4DR6J 4ZP9A 4DEZA 2IYGA 1OMSA 1QAYA 4UZBA 3A8IA 4KT0C 1EX8A 4UQTA 4OZ3A 1U0SA 4X4TA 1KD1T 3N5BA 4ZVPB 4N5SA 2MZRA 1K44A 2VA3A 2P8IA 4YDDB 5C5JA 2KZMA 1DQ8A 3TP2A 1RTJA 2V9WA 2QFJA 1HPZB 1J27A 4Y3CA 4M5JA 4XK8C 1S1TB 2PMZD 4ECYA 2EXUA 2G13A 1GX5A 1XTZA 2CWKA 2J6SA 4FN5A 2RDDA 3N4WA 4YFUA 4CI0B 1VRTB 5C42A 2HLTA 1NHKL 1VCTA 3BBCA 4YHHF 2YWGA 2IJFA 3P5BP 2U1AA 4CYUA 3SDEA 5IV3A 4ZVOB 2W2NP 3ZC4A 5T7LA 2BVZA 4PQAA 4ZVUB 2NR0A 1FO1A 1EQMA 2P9GA 2ZD1B 3NS6A 4DI6A 3W61A 3CMAS 5ETVA 2QG9B 3UDVA 2L08A 1RKIA 4OI2A 3VZHA 4IRDA 4Y6IA 5ADZA 2CNNB 1S1UA 1QE1B 2H54B 1VIXA 1NAQA 2OFHX 2W7PA 1L3SA 1S1WA 4USJC 4ZJOA 4L73A 1PO6A 1UCNA 1U1OA 3PJXA 3E01B 2HQFA 1LFWA 1VK3A 5IM0A 4RBVA 2IAJB 3R5CA 3IM9A 1FCAA 2B0GA 2F9JA 3MD1A 3IO1A 1NHVA 1AYEA 4RUHA 3PW0A 3LGMA 3VAMA 3M6WA 3GJRB 5CYMA 1NSKL 3KDOA 2CQHA 1M1HA 5K20B 1RU1A 2BE7D 4OFZA 3W5ZA 4P73A 3Q23A 4ILMA 2KT3A 2COLA 3MFIA 1RBLA 2KJWA 3MMBB 2Z56B 3CD0A 1TL1A 4GKJJ 1WHVA 3SQGB 2FQQB 4I4BA 1B70B 3KK3A 4DX6A 2EEYA 4EU0A 3X3UA 1U45A 2YNIB 3CUNA 2FJDB 2VUGA 1P1LA 4YB6A 4CTAB 3HHLD 5A2QY 1RU2A 1SPBP 4LFAF 4F4ZA 5KFCA 4J9RA 1NKEA 3BDPA 3CW2C 3AOBA 2V5HG 1N33J 1WD6A 2HQCA 2PMHA 2CZVC 5KT3A 3GR0A 2ROEA 2LYVA 3KNAA 3W2WB 1WTBA 2N3OA 3PG9A 4NMXA 3GIJA 1UVIA 3OL6A 4WJBA 1RXOB 2VPWB 2C3OA 3WX4A 1VHIA 3TJ8A 2ZC3A 1Y9OA 4FYVB 3LTOA 2YKMB 3LP2B 2WONB 1YQHA 2KVIA 3DOKA 2BW7A 3G86A 3FNNA 1LK7A 3TUPA 2V8VA 3CDWA 2RJZA 3NOCA 4I0WA 4ZVEA 3OL9A 2R8GA 1JB0C 3IG1B 2MSSA 4DR7J 2HQGA 3D7SB 1VLYA 4HHJA 3DI6B 4CNYA 4HVZA 1VRUA 2W9CA 2BRLA 1HNVA 3U1MA 4YY3J 1RHMB 4P2XA 3WDOA 5DZ6A 5HSPA 3PW2A 3M8PA 2ZJQQ 1Z2LA 3PO5A 2C2NA 2VOPA 2MKIA 4XO0A 1FE4A 4NLOA 4U7UD 2RAQA 1FKOB 2U2FA 1C0TB 3NLCA 4B9SA 2WBRA 5AJ3F 1G4CA 1K8AT 5CZVA 4Q2LA 1T05A 3QATA 2Z0GA 1MSWD 2EG2A 3DFEA 4KRWA 1S48A 2W4CA 3H7HB 3C46A 4P2MA 5DQGA 2X51A 3EJMA 3GE9A 3PZPA 3T6JA 3M2UB 4B3TJ 1N5QA 2GVDA 4UY85 4ZJQA 4G65A 5LT5A 5C24A 4U95A 4J9LA 5KT7A 3ZZTA 4ZIWA 4EBCA 4KAIA 2DTJA 1DQAA 5I3PA 5BYRA 2BE9B 3IRXA 5KG2A 1I94J 3OFHA 2EWHA 4ECXA 4CLWA 4DG1B 2OEKA 3IWLA 4CM2A 4PWUA 2NQPA 1X8DA 4QJVA 4WCEQ 2N7YA 3HX9A 4P74A 3RW7A 3N28A 3KJFB 3GYNA 2B6AA 3ZZPA 1D1UA 1R27B 3OVSA 4H4MB 3KFWX 1VK8A 1FESA 4NE9C 2RRBA 2WOMA 3A4TA 1TK8A 4PXBA 4NA1A 1KP6A 5D3GB 2KN4A 2OH2A 4QU7A 3SV4A 3MEEA 2JDJA 2RU3A 3AJ2A 2XEXA 4C3MA 4F25A 1APSA 3SSSA 1U26A 4TU7A 4AL7A 3DLGA 3NGDA 2DNQA 2ZH9A 3PO4A 2XWYA 3VAGA 2WSEC 4JV5F 2K3KA 1JNRB 5LJ5Y 4QOTA 2V8HA 2Y0SD 3CF5Q 3SCJE 3A3OB 4ZVGA 2OTJS 2DNNA 2IVFB 1DURA 3BR9A 4ZPCA 1VQLS 1C4AA 2R2UA 3H59A 2I1RA 1G2EA 3NWGA 4LSZB 1JLCB 5AXNA 1PYTA 1TUWA 1M1KT 2J9CA 1Q4RA 1U47A 2BKOA 3CCZA 4PCQA 2CZ9A 4NMLA 3NBPA 2ACYA 3FQLA 4C97A 2XULA 2R7SA 5G0RB 5IC4B 4OI0A 4DV3J 1UPPA 2V63A 1LW2B 4EWTA 1WEXA 3E8OA 2VG6A 5DDPC 1RHRB 4DR2J 1VGYA 1S1VA 5JUMA 5BR8F 4J5OA 2OPRA 3BSOA 1UA1A 2GCFA 2FVQA 4CLLA 2X1FA 2JFDA 5EN1A 1UVNA 2R7RA 2MKYA 3SZ2A 5EDWA 2GC8A 2BOAA 3FEYB 5HANA 3PRDA 5KG5A 5HLFA 2W2QP 3G9CA 2DEIA 3ILIA 2AEFA 4NCGB 2BMBA 4ZOSA 1WI6A 2QL7B 4OHWA 6AT1B 5C2CA 1YITS 2DHHA 2VG7B 3MAAB 3R5AA 3VF0B 4ECRA 2JFKA 5B0DA 2I5JA 2MY7A 2HS4A 2XG8A 2M7SA 1YHQS 1NNDA 1JJ4A 2N7CA 1WHXA 1S0VA 3CEDA 4KSEB 5HMZA 3MPWA 4NYPA 3FK4A 2KXFA 2D41A 2MZSA 2VU5A 4LF6J 4Q0BA 2DXEA 7FDRA 2ZH8A 3CE8A 4LVOP 5HVHA 4ZCMA 4P2SA 4F0HA 3PJ9A 4WFNQ 1CC7A 2ZBIA 2CPJA 3M8RA 5GAEU 2MKHA 3KK2B 4RW9A 3TAPA 1U1RA 2MLYA 2HNZB 3WZ0A 1X4FA 2XY6A 4XDDA 2GJIA 5KFBA 2KJVA 4DR4J 4ZLLA 4Q44A 1VQ9S 2DRBA 1MROB 2O67A 2AF6A 3QMQA 4CCHA 1WACA 2BXJA 3DRPA 4F67A 3H2UB 2J7KA 4KGKA 3NGUA 1HI0P 1RT3B 1F6TA 3H98A 4LBPA 1LXJA 1X5TA 2HS3A 4WP8A 4OZ5A 4OI1A 1TV6A 2AT1B 2RVJA 3K0JA 3IR7B 1REVB 3EGNA 4I7FA 3EDQB 2VBYA 2OD4A 5L9NA 4X62F 2C1EB 1CQMA 3DGVA 1SC4B 2DNMA 3H2LA 4IG0A 2FZGB 3E51A 1ITPA 1HA1A 5H9EK 1RWOB 2QYGA 4PG7A 3GV8B 3E2EA 3O44A 3OL7A 1BHNA 3DLKA 3EM1A 1HW8A 2H48B 4DPTA 1TR0A 1UWBB 3Q8VA 1JLAA 1Q0NA 3EWGA 2FHKA 3FCVA 3R1HA 4ZLJA 2AWZA 4M94A 5LMNF 2C2RA 2F65A 2MZJA 3UE2A 3OJUA 3V6DA 2IJRA 1G7CB 4YB7A 2E5IA 2ZDPA 4X4OA 3QGHA 2HQ3A 3AFGA 4KGXB 1R8HA 2LECA 4YY3F 1EB0A 2YWEA 4RX6A 1H98A 4JI6J 2OPSB 1GNKA 3FKBA 1HMVB 4DZDA 1HBOA 4QIGA 4MMOA 1GMWD 5KAKA 5I4MA 5DDQC 4F4YA 3Q2SC 2ZKTA 3KLEB 5K5MA 1M5SA 2OO4A 2HKEA 2IA0A 3G8QA 3HVAA 1GX6A 2ZOFA 3IM8A 5HMYA 3K89A 4HHHA 5KFSA 2MLXA 1UFWA 5C42B 3TVYA 2WK4A 2QLWA 2W9AA 1NSAA 2QLFB 1RDRA 2D74B 4NLPA 2Y9HA 2V69A 2BM0A 4R8UA 4NX9A 2YKOA 2DR5A 4CYUB 3SDEB 4M5LA 2J9DA 4B3TF 5T7LB 1A6LA 2HNYA 3J7AN 5A0YA 2C2KB 4C8NA 1BQXA 1Z2ZA 1RT2A 3FQKA 2R7UA 3PYFA 2AMCB 1NB7A 1I94F 1CJVA 4FF1A 3H5XA 2FVRA 3J80U 1JX4A 3JAMY 2CPYA 1S1UB 4UOHA 1T0TV 3C6UB 4I64A 4A8FA 1P1TA 2WTFA 2GV1A 1BC6A 1S1WB 3AXKA 1BY9A 2CUYA 2JVOA 3LW5C 2PIIA 3MEGA 5A8KA 3HFVA 1BLUA 1M90T 2PT0A 4ECTA 1SUQA 1GTHA 3J7ZT 4WWSA 1ULRA 3BZQA 4MKAA 3VAKA 4WK3A 1XR5A 2AZ1A 2GMLA 2P9CA 5CYMB 4DCJB 1TKDA 2MZ1A 4Y34A 3M7VA 3JTNA 1WKLA 4L76A 4YUDA 3D4JA 2W4DA 1WC3A 1X5PA 1U2RA 4HEA9 3O3LA 4OYPA 2RUSA 2XLKA 5LSLA 5GMDA 3KLIB 3KYLA 4K59A 4JP8A 1TL1B 1S0OA 3SIPB 1IBMJ 2WVFA 1HQUB 3F44A 4UQGA 1OY8A 3PX4A 1UAWA 1RE1B 4FXVA 2DCLA 1H6KX 3Q0AA 4L6V3 1FRJA 1D9AA 3Q86A 5AE3A 1VQYA 4IH5A 2XQCA 5E33A 5CD4A 3DDNA 4TLRA 3GSDA 3OFEA 4I69A 1VQSA 2D3UA 5IT9Y 3PW4A 1TP7A 1P8GA 2VH7A 3BO3A 3FSYA 4ANCA 1ZAVA 3MM5A 4F36A 3S8SA 1OIAA 5CH7B 3KOAA 4XTTA 4M5HA 4JI8J 2FZCB 3HULA 1AFIA 2YXLA 2XB2D 2R7XA 2H4WB 1WOSA 3DOKB 4YB1P 1FFGB 2QE5A 2Y0BB 3QT5A 1N52B 3GJQB 3K8WA 1F5BA 1KN6A 2XZWA 1CJTA 2W9CB 5EUHA 1F5CA 3UW1A 4A46A 4NL5A 3K5LA 3BDEA 1Q5VA 3M8PB 2E1AA 3LP0B 5HQ8A 1IKVB 3RR7A 2J9EA 3MECA 1VR6A 3PRBA 1WHYA 4YEAA 1NDKA 1ROFA 4J9KA 2F3JA 1LWXA 3AA9A 1OPZA 3HDSA 4LF6F 5F9LA 4C0HA 4A8QA 1Q7YT 5DQHA 4RBUA 2FLLA 4LF7J 3L4BC 4IG3A 5KOWA 2LQ5A 4W98A 4DV0J 4AYBD 4JI1F 2QTWA 4WK1A 5LMUJ 4LBIA 3IWNC 1U1MA 3G6XA 1SL2A 2XTJP 2ZZNA 2KTQA 5C24B 1TVRB 1J5OA 3NAHA 4X4UA 3BKFA 3OUYB 2KH9A 4DL2A 1IKYA 1R8PA 3ZZYA 1M5OC 4IQXA 3UDEA 5J1EA 3IRXB 4ANDA 4F3MA 3SXLA 3Q8SB 3TX8A 1NB2A 1ZM9A 1F5AA 4ZVQB 1MW7A 2B9EA 4KKOA 1IM4A 3BH6B 4J9NA 2AJ1A 1NMEB 2MKJA 5E3PA 1HFEL 2MQOA 2WOMB 2BM1A 1NH7A 2R42A 1SJQA 3LPYA 3HP6A 2V6AA 2AQ4A 5C2GA 4DR5F 2O1PA 3JB9k 3MEEB 4DOZA 5IT4A 2HURA 1NKBA 3JYTB 3BGRA 3WBZA 2EI5A 4G1PA 3DLGB 3W5XA 4MKYA 4UOFA 1WC5A 2X1AA 1JWWA 4C8YA 1XNRJ 5FDLB 4C7QA 2HLUA 3M2VA 2IDEA 1RKJA 1NJWA 3UDCA 3HF5A 2DK2A 2H65B 4J9QA 3VR1A 3OJSA 2DYAA 3TA0A 5K14A 2XHWA 3V6JA 5HATA 3DGPB 3SCLE 4KTQA 1OY6A 2UUWA 3PX6A 2KHDA 1VQ7S 2DHAA 4LRAA 2CJ9A 3NBPB 1RT5A 2MZTA 3DN9A 1PAUB 1WWHA 4JI6F 4WFAQ 1TL7A 5D15A 1SCJB 3FGVA 2LCWA 5SUHA 3HKWA 2RRNA 2VG6B 2AP6A 3R7BB 1S1VB 1IKXB 3M8YA 4QIFA 3W8GA 2OPRB 1OSDA 4ZCIA 3PW7A 4B3SF 5GVQA 1G3OA 4JI7J 3TZWA 4TY9A 2R2TA 1CBKA 3QNWB 3PVXA 2EK1A 4EMDA 3TI0A 4DUYF 5HLFB 4NLDA 1B4SA 3MCNA 3I5AA 3W9HA 2RKIA 1EIYB 1T11A 4HR2A 3M32A 3THVA 1NK9A 1TAQA 3TW0A 1FEHA 3M9MB 4K50A 2J6TA 3SYZA 2QLXA 5KT4A 1PJ7A 1OY9A 4DQIA 2I5JB 4ZPDA 1ZM4A 2XMJA 5E5NA 3CJTA 2V94A 2DKOB 4DV4F 5B08A 5BXIA 3O5TB 3CCQS 1LWEA 3D6HB 4EO8A 3R2CJ 4AXIA 3IC1A 2R9LA 4Q0BB 4LF1A 1JJ2R 5KFWA 3B4DA 2OKQA 3DKDA 1QVFR 2BJ8A 2Y1RI 1Q95G 1Q8BA 4WFYA 1YVFA 2A6MA 1QLNA 4HACA 3ZZOA 4N41A 5CYJA 1YLXA 1P9YA 3CDBA 2ZVIA 1R31A 4ZK7M 2I38A 3D1HA 3FCHA 3CIMA 3KG0A 3BGUA 3EZUA 1PC4A 3AQOA 2DH7A 3EZOA 3AOCA 2LQJA 5D0GA 2QL9B 2GQQA 4DQPA 2QSFA 2XSFA 3NS5A 3ISZA 1OPIA 3D6FB 1N48A 1VQPS 3DRPB 2DXDA 1Q78A 1BGXT 3ET6B 3UVJB 5KFHA 1QY7A 1X31C 1Q1KA 1YX2A 3TUIC 1SBRA 1IBMF 3OL8A 3HO1A 4RUBA 1TV6B 3EVMA 4AD6A 4CQ1A 4X4SA 5D0RA 2E5LJ 4WFXA 3PIPQ 1TFWA 2A3JA 2AYGA 3M6XA 4HT7A 3GFYA 4ES3A 1XR6A 4IG0B 3UNYA 2XMAA 2GHWA 4PXEA 2GS8A 2E5HA 1YJVA 3UR3C 3DLKB 4K4ZA 3PRVA 3POTA 2E7WA 3HVWA 6FDRA 2MQLA 5GADU 2Z2MA 1M5KC 4U96A 3CVKA 5DG7A 1JLAB 5L38A 1RBAA 4LIWA 4MH8A 3GYGA 5M2RA 4U9RA 1AUSL 8RUCA 3MR5A 1L5UA 2NPFA 2PMWA 4JI8F 1KWMA 2A2DA 2KKHA 3OR1A 3V6DB 1NSPA 3QZ8A 2UVRA 2UZAA 1GMWA 3I4HX 2A0FB 1IBLJ 2L9NA 3GTYX 3IS9A 2C2EA 4USWA 2ZH2A 4L3NA 4JB8B 1SC3B 1SV5A 4NA2A 3MTKA 4NI2A 3V5RA 4RL1A 3W65A 4CIOA 4DWIA 2AHOB 1HBOB 3CCRS 1F2GA 3R27A 4WFBQ 1WF1A 4LSNB 4NLVA 5HVFA 3PHEA 1HLWA 1WNEA 2BKPA 3NGSA 2QGFB 1TK0A 4PR6A 1LOUA 4P71A 2YQ3A 1VDHA 4TU8A 1AXQA 1HIYA 1YBUA 4OI3A 4ZIVA 3CC2S 5K8OA 3A8JA 3CGIA 2FVPA 1H73A 2NUHA 1SQEA 5I42A 3SFGA 1R8CA 4F26A 3VCDA 3PACA 4LF7F 3L95X 3J81j 2RDJA 1X4EA 2JC1A 3SI8A 4ED5A 4R8UB 2HEKA 2UP1A 2CXEA 3VVTA 2DHXA 3KTQA 2QA4G 3KG1A 4LF5J 1GMVA 5KFXA 4URQU 2B9XA 5A0YB 1HBUA 2XMMA 1FXLA 5AXLA 4YQWA 4RW6B 2HZAA 3NCPA 2AEMA 4QYZK 4NLXA 1RT2B 1CULA 1T9XA 1N8RT 3TA2A 4OZNA 2VQEJ 1PYOB 2W7AA 1E6VA 5KFAA 1CSJA 2B3TB 3R5JB 5DETA 3NL0A 2M88A 1FKPA 1URNA 1R6VA 2DGWA 7FD1A 1XMBA 5E0OA 1B99A 1KLMA 1UPMB 4YN3B 2GJFA 2XBPA 3M30A 1MMLA 3MEGB 5A8KB 2CQ4A 2CQIA 2DGUA 5HP1A 2FHJD 3B54A 2A2CA 2RNEA 4USIA 2D3ZA 3DOLB 3MEDA 2AV5A 1DBDA 2CQ3A 2EFVA 1M1GA 1WF0A 2KG1A 2AGPA 2MPUA 2RT3A 2XMTA 1RACB 1XQIA 2LA4A 3MFHA 2HVIA 2EFQA 1IJEB 4IRKA 3IWXA 3LWLA 4DUZF 3K7RA 1XNRF 2E7XA 5L9XA 1ZA1B 3D6TB 2ZH7A 1O8BA 4EBDA 1OO0B 4FDFA 3CCMS 1JLEA 1R6YA 4C3LA 3K8VA 1FRHA 5U47A 1N5YB 4FYXB 3TQ1A 4QBUA 4P9SA 1MWYA 2JOQA 1N36F 3QRQA 3N79A 1F9HA 2VBXA 1DLOA 2P2CB 2GO8A 2FVSA 3UFCX 3VWSA 5J1PA 4LBHA 2ZWPA 3PY8A 4IO1A 2C3MA 2XLJA 2FC8A 4CT9A 5B0AA 2LEPA 3MM5B 5IWAJ 5ETLA 2DH9A 2RUGA 2GNKA 2UUTA 1HQEB 2XSJA 2UVWA 3HD2A 4CLPA 1SVDA 5DDOC 1YG0A 3CC4S 1XJWB 2NZCA 2HMIB 4LSLA 3H5YA 4I6WA 3EXCX 3KK1B 1T95A 3MAQA 2VPYB 2CPIA 1GXLA 1NK5A 2XGPA 3TARA 3HHEA 1CJTB 1NK6A 2XGQA 2IVMA 1JNZB 3OXGA 3A8KA 1I5OB 1XR7A 3UCGA 1QUVA 3QJLA 5D6GA 2LLZA 1XBWA 4U7CA 2C2DA 4UT4A 5GADI 1FDAA 3CULA 3BEGB 2MQNA 3C6TB 4LF2A 2DGOA 4QZVB 1HPZA 2F4VF 1X9SA 2ZUAA 2DNHA 3DRRA 3Q22A 3BSCA 4W4MA 3M8WA 3D67A 4DV5F 4IG3B 2KO1A 2HRTA 5DRKA
chains in the Genus database with same CATH topology
2WBRA 5AJ3F 4CH0S 4GC7A 4OJ1A 2YNHA 3NAIA 4EZ9A 4N77A 1K8AT 5I3UB 5CZVA 1Q53A 1VRTA 4K2XA 4Q2LA 5IZHA 3JSBA 3KMSA 2EC0A 3RW6A 3BREA 3I87A 5A8WB 1T05A 2Z0GA 3VTIA 1J5EF 1MSWD 5BJRA 3DXBA 4ZHRB 2EG2A 5LSRA 2WCXA 1OS5A 3DFEA 4KRWA 3LP1B 1S48A 2W4CA 5E3RA 3OW2R 1ZM2A 3C46A 4QCLA 4AXJA 3CIZA 1YJUA 2KHCA 1K0TA 3CJ4A 5KFDA 5DQGA 3M8QA 3QO9B 1VMBA 2X51A 1R8BA 4RW6A 3VAIA 3SEOA 3GE9A 4LFCF 3W2VA 4ES1A 3PZPA 1FKAF 4NYZA 1S72S 4ZLPA 3I32A 3CCES 2KM8B 4RW9B 1ZOTA 3T6JA 3M2UB 3I5CA 1ZZNA 5I3QA 5DLFA 1IKYB 1N5QA 2XI2A 3CCVS 1KQSR 3K5MA 3DLHA 5B7WA 3Q8PB 2HWIA 5J1EB 1KC8T 4UY85 4NLYA 2OPPA 2RIJA 4C0OC 1LXNA 4B9VA 5LT5A 3O8WA 1LW0B 1SIWB 2BUNA 5C24A 4EUVA 2CQ1A 1VFJA 4IR1A 2ADBA 3K5NA 4J9LA 3GB0A 5B09A 4ECUA 3BGFA 5KT7A 2HHSA 4MK9A 3ZZTA 3FFIB 4K4YA 5GMKa 2W7OA 2DBBA 5A6PA 4EBCA 4KAIA 1LV5A 2DTJA 1DQ9A 4OL8A 1DQAA 3QJJA 2J9DE 2ZE2A 2V4JB 4ZP6A 5I3PA 3PKYA 1KR4A 5BYRA 2B5JB 4UY8T 1JLBA 1S10A 2BQRA 3IRXA 4M1KA 5GAGU 5KG2A 4KKOB 3OFHA 5F8NA 2YWKA 2N82B 4TU9A 2EWHA 1S6PA 2MYFA 4RLEA 4QPXA 3G4SS 2DNPA 4DG1B 2ZH5A 2B7BB 3N9UC 4ECXA 1L3UA 2M70A 3IWLA 2VFSA 1SKRA 4B3MF 4A8MP 1U6BA 1WG1A 4PWUA 2NQPA 1X8DA 4QJVA 4OV1A 4WCEQ 2JEFA 2E5LF 2N7YA 1AW0A 3HX9A 1HWLA 3UDLA 2IM1A 3RW7A 3N28A 4ILLA 1Y0HA 3EGWB 3GYNA 4YR2A 3DOLA 2B6AA 3ZZPA 1D1UA 1R27B 3OVSA 4H4MB 1HBNA 3MF5A 3VQTA 2VD3A 3E01A 3KFWX 1V6HA 3MMAB 1VK8A 2K1RA 3MI7X 2DR8A 1FESA 1SKWA 4H4OA 1S6UA 2IHR1 3BGRB 1TL5A 2EBEA 2RRBA 2R7OA 3HI9A 1M5HA 2WOMA 4I2QA 4ZP7A 1TK8A 1RISA 4I7FB 4NA1A 4PXBA 5IQQA 5J2NB 4DF8A 2WSFC 1NJIT 1X0FA 3HHDA 5KFNA 4HLBA 1O0PA 4PG5A 5D3GB 3HVTB 2VQFF 1U1QA 3QPIA 2O5DA 3OTCA 2KN4A 4OX6A 3GV5B 1ZAXA 2OH2A 2LEBA 1SJRA 4QU7A 3TAMA 4MKBA 3SV4A 3MEEA 1VBZA 1HBMB 2JDJA 2RU3A 1EETB 1KRPA 2MDAA 2IC3B 2XEXA 3AJ2A 3MMJA 4XDCA 3AA8A 3PFOA 4C3MA 4F25A 1M5PC 1APSA 5LL6d 2G0CA 4OHZA 3UNGC 3KMQA 2LXFA 3M2VB 3G6YA 4PWDB 3SSSA 1DZ5A 1U26A 4TU7A 4RW4A 2IJNA 3J80Y 4AL7A 3MUMP 3DLGA 1U24A 2IRUA 2DGTA 3NGDA 2DNQA 2ZH9A 1XN9A 3QAEA 3PO4A 2XWYA 3OLAA 4A48A 3VAGA 1D8ZA 4DL3A 2WSEC 4JV5F 4ED1A 5KT5A 1NKCA 2W9BA 2K3KA 3RZAA 5KFRA 1HD0A 1JNRB 2M3DA 2HGLA 2VL1A 4KV8A 3PIOQ 5K14B 5LJ5Y 1SB6A 4QOTA 5EWFA 3HHLA 2V8HA 3M6UA 2Y0SD 1N5YA 4F2SA 1RTHA 2R7QA 1I1GA 3CF5Q 3EUNA 4CO2A 4ICLA 4ECZA 3SCJE 3GZ7A 3T1YF 2OSRA 4WIIA 4ZVGA 1L3TA 2OTJS 2GMHA 4TYBA 1W25A 2DNNA 2UU9F 1DTQA 1FXRA 3AHPA 2IVFB 1DURA 2E29A 4O3RA 2ZNZA 3BR9A 4ZPCA 2R2RA 1VQLS 1C4AA 3KHRA 2R2UA 4ZCLA 3H59A 3K5OA 4EYHB 1IBLF 1IUJA 1F9FA 1WF2A 4FP9A 2C3YA 2I1RA 3H20A 1JKHB 1G2EA 3BM7A 1LWFB 3GG1A 3QWPA 3JSRA 4B3OA 4UUWA 1S76D 3NWGA 3DRYA 3HZGA 3HZEA 2LQ9A 3GIKA 1RT5B 1U4BA 3FRYA 4NXMF 4CO5A 2J6UA 1JLCB 1H7WA 2LA6A 5AXNA 4R5PB 4G1IA 4OI4A 5D4NA 3KHGA 3VZIA 3MZIA 1YJNS 4WKYA 4DV3F 5HROA 1U6FA 2R8JA 2YNIA 4B9NA 1M1KT 2J9CA 1Q4RA 1U47A 2CQGA 3UPFA 2VPXB 5KG7A 2NSCA 4K4SA 4X2BA 1O51A 4HTJA 2GGPA 4MYUA 4RNMA 3CCZA 4DR2F 4PCQA 5DS7A 3I6PA 1K1QA 1GT8A 2ILZA 4NMLA 3NBPA 2ACYA 5D4OA 1RT4A 1X4BA 3FQLA 4PQUB 3NG8A 4MFBA 1YJ9S 2GQ2A 4PPZA 4C97A 2AD9A 2XULA 4JV1A 2R7SA 5G0RB 1NU4A 1EP4A 4OI0A 2AW0A 1IBMF 1HQEA 1H2VZ 2Z4PA 4PG4A 3KLGB 2O01C 1LW2B 4EWTA 1WEXA 3E8OA 2VG6A 5L1IA 5DDPC 5EX3A 1S77D 1KVJA 1A7GE 3OHAA 1VGYA 3L7PA 1S1VA 5JUMA 2PO4A 2HMIA 1UL3A 1VBXA 5BR8F 4O3PA 4J5OA 2OPRA 3HPOA 5DO2A 3BSOA 4IKAA 3KK1A 1Y00A 1UA1A 1HYSB 4OQJA 1FF2A 4NPOA 3AB4B 2GCFA 3J7YI 2FVQA 1VQ6S 4Y0FA 2YNFB 4F02A 1Q82T 2PA8D 2X1FA 2Q6CA 1JLFA 2JFDA 4PXCA 1FK9B 5IFMA 4Q8FA 2N4CA 2BBEA 3OBIA 4Q7AA 5EN1A 2RKIB 2YTCA 1UVNA 2YKMA 2R7RA 4OHYA 1FJGF 1RWUA 3LP2A 3SZ2A 4YP3A 1H38A 2WONA 5EDWA 2GC8A 4CO3A 4FZVA 4OLOA 4LF5F 4PRFA 3FEYB 2ZJRQ 3PRDA 1SH2A 3M32B 4HYKA 4A8SA 4QPTA 1KQKA 1SJFA 5KG5A 4AE5A 5HLFA 5HO4A 1S6OA 3I9ZA 2GA7A 2ADCA 5KFUA 3G9CA 3P49B 2P5VA 4ECVA 4DBQA 3DLBA 4FXWA 4KC5A 4KQZA 4NCGB 4DSEA 1Z1ZA 4ECSA 3BO2A 4ZOSA 3X1LB 2A10A 1F60B 4TNOA 1WI6A 5KG6A 5JJBA 4X64F 4LVNP 3D28A 2AX0A 2VQEF 3IRWP 1UFLA 4F2RA 1D9DA 2HHXA 1V3ZA 3T1AA 5F8LA 4LQ9A 4OHWA 2HNYB 4C8MA 1DTTA 2ZKUA 3C6TA 4PUOB 2MJUA 2FJEB 1YITS 5KFIA 4EBEA 4FNHA 4HI1A 1B0TA 4F8RA 2VG7B 4M63A 4TKTA 3DYAB 3R5AA 1LWEB 3VF0B 3CB4A 4ECRA 2JFKA 1QSLA 5B0DA 1N56A 2BOPA 2CG4A 2I5JA 1N88A 2MY7A 2DHSA 2HS4A 3M8SA 2XG8A 2M7SA 5IXUA 4ZPAA 1YHQS 1V3RA 1XEZA 1NNDA 1ZPVA 2N7CA 1JJ4A 1O5JA 5EWEA 3D1OA 1WHXA 2YH1A 5E3CA 1S0VA 2FUG9 5E2QA 1Y3KA 2FIUA 2JH3A 3CEDA 4ID8A 4KSEB 5HMZA 1FKOA 3MPWA 4RKUC 4HH0A 3QAUA 1VQ8S 4EEYA 1C0TA 3CT9A 4NYPA 3DRSA 2N4DA 5K8PA 5GAHU 3FJ2A 4IOCQ 3IXQA 4CNZA 3RBDA 2KXFA 2D41A 1RT6A 3NKYA 4B3RF 2KZZA 2MZSA 3DXSX 4Q0BA 7FDRA 2ZH8A 3CE8A 4LVOP 4DMZA 3CJKB 4ZCMA 3NNHA 4P2SA 2ZDOA 1VQKS 4NWBA 1HARA 3LP1A 3ULHA 1S9GA 4WFNQ 1CC7A 3U27A 2HFOA 2UVVA 3G6VA 2IBKA 3FEXB 3H5UA 3QO9A 4RNOA 4YR0A