2MYFA

Solution structure of rna recognition motif of a cyclophilin33-like protein from plasmodium falciparum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
GSHMSDNNATDILFVGGIDETIDEKSLYDIFSSFGDIRNIEVPLNMTTKKNRGFAFVEYVEVDDAKHALYNMNNFELNGKRIHVNYSKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RRM containing cyclophilin
publication title Solution structure of RNA recognition motif of a cyclophilin33-like protein from Plasmodium falciparum
rcsb
source organism Plasmodium falciparum
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2myfA00
4C0OC 2M9KA 3S8SA 2AYBA 1DZ5A 3EGNA 3K0JA 4YUDA 2DHXA 2DNZA 1H6KX 3VAFA 2XS5A 1SJQA 2MQNA 1OO0B 2LXUA 1WHXA 3EX7B 1YIJS 3N9UC 3VAJA 2AYMA 2M7SA 2MZRA 1KQSR 1YHQS 1S72S 2O3DA 1K9MT 5GAEU 2JVOA 1YJ9S 3J7ZT 2DGSA 2HGLA 2XNRA 2EVZA 4WFNQ 5BJRA 4CH1A 2DGTA 5GADU 1WG1A 4J5OA 2M88A 3BO3A 2KYXA 3BO4A 1YJWS 3P5TL 2CPHA 3VAMA 1VC6A 1U1KA 1VQ8S 2ZJPQ 4WFAQ 2YH1A 3CUNA 2KT5A 2HVZA 2OTJS 1DBDA 4PKDB 5DDQC 3VAHA 2OJ3A 2LQ5A 3SDEA 2VONA 3J7YU 2MZSA 2YH0A 1Q86T 3NNCA 4TU9A 2FHOB 1PGZA 1WTBA 2HGMA 3THPA 4M5DB 3B4DA 2HYIB 3RW6A 4PRFA 1K8AT 3IRWP 2CPZA 2JX2A 2M4MA 1A9NB 1UAWA 4QU7A 1D8ZA 3G9CA 3CC4S 3TP2A 1VC0A 1WHYA 2DH7A 2F3JA 5GMKa 4W92B 2AYEA 2KG1A 2DIVA 2YKAA 3US5A 2CQPA 2CJKA 2EK6A 1X4DA 3THTA 3MUVP 3CCJS 1S79A 4F02A 2X1AA 3NNAA 3HI9A 4QQBA 3NS6A 1M1KT 1X5OA 2DHGA 3TO8A 5HL7Q 3G8TA 1RK8A 4LJMA 1U1MA 2MYFA 4PR6A 1YWXA 3EGZA 4TLQA 4FXWA 2ZJRQ 3SXLA 2E5GA 2HGNA 2MPUA 3UE2A 3CD6S 3CCUS 4TU7A 3BS9A 1FXLA 3MUMP 2M52A 2MY8A 2XB2D 1NU4A 3FEXB 3CF5Q 2DGQA 5IM0A 1FJ7A 1VQ4S 2JVRA 3CCRS 1U6FA 2QA4S 4F25A 2RVJA 3CCVS 3NNHA 2EK1A 1ZZNA 2CPFA 1VBYA 1YJNS 1WEYA 2CQ2A 1NJIT 2N3OA 2DNKA 3R27A 1VC5A 2CPEA 1X5PA 4BS2A 2D3OR 2E44A 3UWTA 5LJ3Y 1KC8T 2YTCA 3I55S 2UP1A 1W2BR 4CQ1A 3CMAS 2MKCA 4QU6A 2DIUA 3CC7S 3ZZZA 2PE8A 2CPIA 3LQVA 2GHPA 4IOAQ 2RT3A 2DH9A 3ZZYA 3IWNC 1VQKS 2AD9A 1K73T 2B0GA 2KXFA 1WG4A 1UFWA 1XN9A 1FT8A 3FEYB 2NZ4A 3PIPQ 3G6ES 2MJNA 1X5TA 4OZ0A 1DHMA 2MSSA 3PIOQ 5CA5A 4CIOA 2I38A 1X4BA 1M90T 2GO9A 4YOEA 1FNXH 2MGZA 2MZ1A 1YTYA 2E5JA 1QVGR 2MKHA 1G2EA 3R1LA 1CVJA 2E5IA 4WKRA 1Q82T 1SJRA 2YWKA 2KVIA 4YB1P 1WG5A 2FY1A 1URNA 2DO4A 2G0CA 3UCUP 1X4FA 3UD3P 2N82B 1VQPS 1U2FA 1WF2A 2DO0A 5EN1A 3TYTA 1H2UX 1P27B 3MUTP 2MXYA 2LEBA 1B7FA 2ZJQQ 5DDRC 2RRBA 3CCSS 4LMZA 1NO8A 2M8DB 2KU7A 2RRAA 3D2WA 1X4HA 1SJ4P 2KXNB 3G96A 4A8XA 3LPYA 2RQCA 1VQOS 1VQ6S 5DDOC 3Q2SC 3CXCR 3VF0B 2CQ0A 2XS2A 1SJFA 2CQIA 3CTRA 4WCEQ 2VODA 3UD4P 2MKSA 1ZH5A 2G4BA 2KXHA 3U1LA 2HZCA 3BO2A 2L41A 1HA1A 3V4MA 3I56S 2D9OA 2KRBA 1PO6A 2MJUA 2CQCA 1M5KC 5JVHQ 2LKZA 1RKJA 1WF1A 2M8HA 1M5PC 1H2VZ 2L9WA 1BY9A 4C4WA 2QEXS 2DNGA 2X1GA 3VALA 2DB1A 1O0PA 1FJEB 1KOOA 3CC2S 5HO4A 2LECA 3BEGB 3HHNB 3P6YC 2DGWA 2RNEA 2ADBA 1WHWA 4WFBQ 3MXHP 5D78A 5LJ5Y 1N54B 1QVFR 3H2UB 3CCMS 1Q81T 1KD1T 2U2FA 1IQTA 4ZKAA 1SJ3P 2OSQA 1JJ2R 4U67Q 3MI7X 1M5VC 2K3KA 2LCWA 4FXVA 2KG0A 1JMTA 2MZQA 3OW2R 2OTLS 3MDFA 2DNHA 1D9AA 5IQQA 3RW7A 1WEXA 2VOPA 1VQ5S 2MZJA 1VBXA 1ZZFA 1QM9A 2M0GB 3P3DA 2JRSA 1U1OA 4IO9Q 4W90B 3L3CA 3CCES 2X1BA 2KHCA 3ULHA 2OIHA 5LXRA 2DISA 1X4EA 2LA6A 2DGUA 1WI6A 5LSLA 4TU8A 5GVQA 1JJHA 2KFYA 2KRRA 1SXLA 3CCLS 2J0SD 2NLWA 1N8RT 2CQGA 3P49B 2CPXA 2MZTA 3S6EA 5DM6Q 1VQ9S 2DNPA 1M5OC 4WF9Q 2DITA 2M70A 3SDEB 1R8PA 2QFJA 3Q2TC 2CPYA 2MQMA 3UCGA 5GAGU 2N7CA 5DM7Q 1FHTA 5LSOA 1WI8A 1U1LA 1U1QA 1U6BA 2CQBA 2XNQA 2KI2A 1UP1A 2LYVA 3CMES 1WEZA 2J76E 2CPJA 1DRZA 1H2TZ 3R1HA 2CPDA 3MOJB 2F9DA 5FJ4A 2CQDA 2DGVA 2A3JA 2DNYA 2K8GA 4UY8T 1UW4A 4V19X 2AYGA 2E5HA 4LIRA 2DHAA 5CYJA 1U1RA 3JB9k 2I2YA 2PEHA 2D9PA 5GAHU 2FC9A 2MQPA 1HD0A 2MB0B 2LXIA 2MQOA 1X4GA 3NMRA 2RS2A 3S01A 2FPHX 2WBRA 2DNLA 1VQ7S 1N52B 2N3LA 1WHVA 5IFMA 3VAKA 1OIAA 5IM0B 1X0FA 1OWXA 3MD3A 5MLCV 2KM8C 1HD1A 4Y00A 2DNQA 5H1SV 3B4MA 2L08A 5ITHA 4ED5A 3H2VE 2XS7A 3VAGA 1U1PA 4RU2A 1YI2S 3DXBA 2LMIA 1X4AA 1L3KA 3CCQS 1P1TA 2MY7A 3DLLQ 2JWNA 2VOOA 2MSTA 3MD1A 2MHNA 4Z2XA 1JJ4A 3NS5A 3G4SS 3MURP 2X1FA 4WIIA 5LXYA 4IUFA 1VQLS 4ERDA 2MKIA 2DH8A 1WF0A 1KOHA 4Y0FA 2OSRA 2SXLA 2G1DA 2LA4A 1A7GE 1FJCA 4C7QA 1YITS 1WWHA 2RU3A 3UCZP 1OPIA 2Q79A 3CULA 2DNRA 1VQMS 2CQ4A 4F26A 1VQNS 2BZ2A 2J0QD 2MGZB 3G8SA 2MQLA 2M2BA 2DNNA 2U1AA 2KH9A 2DGOA 5DETA 2ADCA 1Q7YT 2V94A 4P6QA 3S7RA 1FO1A 3SMZA 5D77A 1R8HA 1X5SA 4QPTA 1HL6A 2RUGA 1X4CA 2DNMA 2DNOA 5DDPC 2ERRA 1WELA 2LEAA 3VAIA 2F9JA 4IOCQ 2CQ3A 4OZ1A 5JVGQ 2DHSA 1AUDA 1VBZA 4CH0S 2CQHA 2RQ4A 2KM8B 3U1MA 5CXTA 2MMYA 2RS8A 2DK2A 4EGLA 2MKJA 2MKKA 3CPWR 2XSFA 2BOPA 1F9FA 3G71S 2J8AA 1N88A 4UQTA 2FC8A 2CQ1A 2DGXA 2KN4A 1U1NA 2MQQA
chains in the Genus database with same CATH superfamily
3UDVA 1S1WB 4YUDA 2DHXA 3ET6B 1G6BA 1X9MA 4O44A 1MW7A 5DG9A 3DM2B 1N32J 5H9FK 2VQEJ 2BACA 1T02A 3IXQA 4RW7B 4UUWA 1K9MT 1PCAA 2WZ1A 4MT1A 2QE5A 2R42A 3VAMA 5BYSA 1RTIB 3G6YA 3FZ2A 3IBCB 3UNYA 4MJKA 5L8RC 2LQ5A 3H20A 4F50A 1RAIB 4NRUA 3ICLA 1MMDA 1QE1B 4PQAA 1OQ3A 2CRLA 4M5DB 2E1PA 3IRWP 1C4CA 2M3DA 2FYXA 4XAKA 1A9NB 1D8ZA 4UOHA 4RUAA 2FLOA 4R25A 5IZHA 3NMAA 4I6WA 4KC5A 3DLEA 4FYDA 3OVAA 1C0UB 3G8TA 2HKEA 1VGYA 2FY8A 2PT0A 4USTA 2E5GA 2MPUA 3AJ1A 2LXFA 3DRRB 1N6QA 3NEKA 1BE4A 1FXLA 4C8LA 3CF5Q 1Y7PA 4EZ6A 5ETPA 3TVZA 2B56A 3ZZRA 4F25A 3OTEA 2RVJA 1OS5A 1OY6A 4AYBD 1NJIT 2VHGA 4HHHA 2CPEA 1S1UB 2HBQB 3DHXA 1RT5A 2D3OR 3IR7B 2HHVA 5CAAA 5D15A 3QJPA 3ZZZA 1SIWB 2QMWA 1NSAA 2BUNA 2DH9A 3OL9A 2OMOA 1HNWF 1ZBTA 3FEYB 2KFZA 2BKOA 2ZD1B 1NSQA 3TZYA 4Y6IA 5A6PA 2R7SA 3KLHA 3F73A 2B4VA 2BM1A 4I2QA 4DV0J 3A8IA 3PJXA 3CJTA 3RRKA 2ZOFA 1SL2A 3UCUP 3W2VB 1N33J 5IWAF 2W9BB 1WDTA 3DI6B 4ZDNA 3JTNA 3G87A 4UF4A 4X2BA 4LMZA 2E1MC 4HYKA 4WPAA 2CWKA 5KFQA 3ZZTA 4WCEQ 4K4TA 2HZCA 3BO2A 2FHMA 4JI2F 4IG0B 1DTTB 1M5PC 1HNZF 1IR1A 3RZAA 1JNRB 2C2ZB 3CCWA 3EGWB 3A3NB 2ADBA 2DR8A 3AXKA 3TUPA 4XPEA 2OD4A 2K3KA 4WP9A 1FJGF 1Z2ZA 2VOPA 2QTWA 3OTCA 3BH6B 4ZCMA 4NEYA 3ULHA 1IKXA 2VC0A 3JS9A 4HHJA 4EEYA 4LRCA 3D5MA 1B4SA 1YRUA 1HBOA 1Y00A 3CJ5A 4KFBA 2FLNA 3TVKA 2W8KA 2QV6A 4EUVA 1R0AB 3CIMA 5GAGU 5DM7Q 3GV7B 1JLCA 1VLOA 1NK5A 1MU2B 1U1QA 3PO4A 3CCTA 4LT6A 2IHR1 4GMKA 3TA0A 2E1RA 4X66F 3DLKA 1BWEA 4B3MF 1H2TZ 5KFKA 3TQ1A 2F9DA 3PRBA 4YEAA 3K89A 2AQ4A 3JTOA 3LA0A 3KG0A 4X4VA 1NZAA 5CYJA 4KIAA 1T9WA 2VU5A 2PI5A 3NMRA 1MMLA 3BGLA 4ENOA 2FPHX 3QIDA 4N7TA 3VAKA 2CWXA 2R2TA 1B0VA 4TQSA 3MMBA 4ZVGA 2L08A 4RLEA 2D3ZA 3HHLC 2XULA 2YKMA 5E7OB 4LR9A 4LF2A 2MY7A 5U47A 4DR4F 2Z2YB 4J9VA 4IUFA 1HQEA 4X4QA 3FRYA 3DXSX 1NJZA 3AAWB 1JXVA 1PBUA 1VR6A 3PACA 2G1DA 4NA1A 1FFSB 1YITS 2DR7A 3UCZP 5LL6d 4J9NA 4YHHF 3BSAA 4RBVA 1VQMS 1S4FA 2JEJA 1WORA 2PIIA 2B7BB 2V8PA 5ETOA 4XIUA 4PZVA 4FYWB 4C97A 3SMZA 2HHUA 1JXLA 4YR2A 1X9SA 2R8KA 5F0WA 4DL5A 5IS2A 4IFVA 3VVUA 2LDIA 1P8GA 1N88A 2MDAA 3I9ZA 2IM3A 2YNIA 3HMJG 3PY8A 2HWHA 3IBWA 2E7XA 3EDRB 2MQNA 3W60A 4OJHA 1UA0A 8ATCB 5HI7A 1I51B 4DL3A 2JVOA 2VDIA 2DGSA 4WU3A 3KK3A 3BR9A 3K57A 1TUGB 1XMQJ 3I0RB 3MM8A 4PKDB 2F7VA 2VZ9A 2YH0A 3D9BA 1T9XA 4NMLA 5IT9Y 3PZPA 1LWEA 4FP9A 3CJKA 4ER8A 2HGMA 2DRDA 1FFGB 2XQCA 1UAWA 4BBYA 1EP4A 4UOCA 5CH7B 5DO2A 1WOSA 1S79A 3I87A 2HSEB 3ENVA 3AOAA 4IRDA 3HT3A 2CIMA 2N4DA 2PMWA 5EX3A 4JUZA 4FNIA 3GJSB 3PRDA 2VFUA 4OZNA 3CE8A 4WIQA 3T6BA 1EKSA 3IM9A 3N79A 3DGPA 1NU4A 3N28A 2ZE2A 5DZ7A 3M05A 5F9NA 4J9SA 2R2SA 4F36A 4K0KJ 2FLLA 3TX0A 3GIJA 3R27A 1IKWA 3OTBA 1R43A 3RB0A 2EFQA 4EYIB 1L3UA 2UP1A 3CC7S 1F2HA 2AMCB 3W65A 3JSMB 2A2CA 1UVKA 2WK4A 3BH7B 2QRRA 1X5TA 3ITHA 1S9EA 1ZAXA 3I6PA 3DOKB 3BREA 1WC3A 2HHPA 2MGZA 1BD6A 4FZVA 3A1YG 1WC0A 3SIPB 1QSYA 1UFLA 4PG4A 3PEJA 4NLGA 2NXCA 4F67A 5KFUA 5AXKA 2ZH4A 3PRVA 1X4FA 4N76A 5LMUJ 3TANA 2HNYA 4CYUA 4WBFA 3M4XA 1HPZA 2ZJQQ 1NO8A 2HBYB 2M8DB 1U25A 2ZVSA 1GMVA 1BQNB 2RQCA 3GIRA 5DDOC 2V2ZA 5FLXY 2UU9F 3TAMA 2EEYA 4DR6F 1HI0P 1C4AA 2IJFA 3V4MA 1U48A 1PO6A 3W63A 5F41A 4ZVRB 1SL1A 2CJXB 2ZWPA 2ASYA 3HHNB 2HS0A 1QDUB 5EWEA 1HNWJ 1I5OB 5DG8A 4YDXA 3AOBA 3CCMS 2FTRA 2BANB 2HAFA 2FHKA 3C19A 1HBMA 1VRUA 2DNHA 5IQQA 2A10A 3F41A 2VG7A 2W4CA 4LFAF 2A2DA 2NLWA 2YX7A 4OX7A 3GLJA 4FF4A 3S6EA 2JNJA 3SFUA 4NXMJ 2C28A 4FF1A 4EO6A 1RBOB 3I0SA 3MCNA 3SCKE 2EW9A 2P2CB 4HKQA 3M2RB 4ZIVA 3SI8A 4O0NA 2CQBA 2NXEA 3J81Y 3CMES 4DX5A 3VZIA 4JI2J 3MOJB 1DQ8A 4NXNF 4MMOA 3NP5A 2CQDA 2VPWB 1GXUA 1F2GA 1R8CA 5EUHA 1VRTB 1HNZJ 3BGRA 4F3MA 2VPXB 3WX4A 5GAHU 1TK8A 1WKKA 2MQOA 3BF4A 4ECZA 3GWCA 4CM0A 2Z2LA 4H4KC 1RWXB 4TY8B 3EMTA 3HVTB 1FJGJ 1RUSA 4DI6A 4ZJLA 2B5JB 4ECWA 3QT7A 2BX6A 2HHTA 3NS7B 3MD1A 4UY85 4ERDA 1RWPB 4FNHA 4X64F 3POTA 1ZAWA 3BM7A 4ECYA 4ES2A 2Q79A 3NG8A 5KOWA 1RT7B 3IMQJ 1HARA 2OPPA 4RWWA 1NK0A 1HNIB 2M2BA 2J7UA 2FZKB 4DR3F 1X5SA 2V6AA 1L3TA 3OL6A 1S0OA 2KTQA 1S99A 2RS8A 4O0IA 3L7UA 3HHLB 4PPZA 2COLA 3W9IA 3U1NA 1U1NA 4C0OC 2P6TA 2XS5A 4LVOP 3HHEA 3KHHA 3BBFA 4L76A 2BJEA 3SV4A 1WHXA 3N9UC 3K8VA 3BZQA 1OSDA 3P96A 4A4JA 4DR4J 1LW2B 1RHRB 2C3YA 3P5BP 2DGTA 3FSYA 5E3RA 2XO7A 4JV1A 4DCPB 3V4IA 2RAQA 3CUNA 3LGNA 1E6VA 3R5JB 4NI2A 4Q44A 2ZH2A 2ZNZA 1WC5A 3V81A 2R2UA 1FE0A 3I32A 4C48A 2RKIB 2AZ3A 3UN5A 5GMKa 2KG1A 4USKA 4USUA 2CJKA 4ZVOB 3FMWA 3AFGA 2FZGB 4KRWA 4KH1B 1OQ6A 2IA0A 4URQU 1SPBP 4DV7F 3DRPA 1MSWD 4F4ZA 2PFDA 4GVBA 5J2QB 4GKKJ 2XB2D 4DF8A 2ALYB 3MEGB 3T1YJ 3A13A 2A1BA 4WP3A 2NUHA 1PSDA 1UL3A 2C2MB 2N3OA 3PEHA 3VGSA 3SZ2A 4I1TA 3WZ0A 1CS4A 2E44A 3MMCA 3KK1B 2Y9HA 1TZ0A 2C2DA 4TYAA 4IFYB 2P8IA 2HMIA 5CD4A 3JAMY 3ILIA 2V4JA 1BMQB 3G6ES 5G4DA 3QIPB 1CJUB 2PSZA 3O5TB 4ILRA 5J1EA 2MZ1A 4DPUA 5CYQB 2CJBA 5LOQA 4A8QA 2VBXA 2XYPB 3AJDA 3VTIA 1P9QC 4U8VA 3R5BA 4MFBA 5KOXA 1SC6A 1JLQA 3MUTP 2EBGA 4Y2MA 1R27B 2K1RA 1JB0C 2X3DA 2V4QA 3DLJA 3CXCR 3VF0B 1RWKB 5KFDA 4FXDA 2MKSA 3J7YI 3MAHA 2ZWOA 5JVHQ 4A46A 2HRTA 1WF1A 5EWGA 4F04B 4C4WA 4J9PA 2JL9A 3VALA 3ZZOA 4NL5A 4RW9B 2JDJA 4CTAA 3MEDB 2G2ZA 1ZS6A 5C42B 3H2UB 5CCLA 3ZNJ1 2FD2A 4NLYA 3KDNA 1XJWB 4FXVA 4GO7X 1TKZA 1V3SA 4CO4A 1ZZFA 1QM9A 3HF5A 2JRSA 2ZHBA 3CCES 1U7LA 2DGUA 1S5ZA 1JJHA 3C15B 4ICLA 5FIIA 4CO5A 1QJHA 3CCLS 4ZVSB 2XLIA 4DR1F 5DM6Q 2HIYA 3KUEA 2DJWA 2IBKA 4ED2A 1K47A 1R7IA 1X0PA 3VQSA 4ZLLA 2QLXA 5K5MA 3GP9A 2FJAB 1KKHA 4RBTA 1TKXA 4KE5A 1UW4A 5J2MA 1T94A 4LIRA 3JB9k 1RP5A 3TEGA 2D9PA 5AXMA 5F3TA 3HVRA 3K59A 1OYDA 1TK0A 5IFMA 4C8ZA 1WC1A 4NCGA 4ID5B 4NA3A 2KM8C 2DNQA 3LP2A 2XS7A 2PFFB 2Z0GA 3AD8C 4LSLB 2BRLA 3W5YA 2JWNA 2VOOA 4IRCA 4FVMA 1LNQA 2FHJD 1JJ4A 1JIHA 2X1FA 5KFPA 4GKJF 1Q1KA 4C3KA 2SXLA 3BBBA 3C14A 3LWMA 2N7YA 2RU3A 2UUCJ 5A0YA 4ZVHA 3SSRA 4P2XA 1I94F 1S0VA 4F26A 1SKRA 1VJWA 1RZMA 3Q8SB 3OLBA 2LU2A 2A18A 4PXEA 2V5HG 5KT2A 3HFVA 3HP6A 2YNHB 2W9CA 3KDOA 2CQ3A 2RMLA 1AUDA 3PW5A 3L09A 2MLZA 5L9XA 4I4BA 2BOPA 2RSQA 2J8AA 3JQJA 1I6JA 2GS8A 1EARA 4FBTA 5HQMA 2H4WB 3PKMA 2PA3A 5EGYA 2AYMA 2MZRA 2G2OA 1JXEA 1TV6A 3J7ZT 4JP8A 2ZC4A 4K2JA 3TARA 3KLIB 4IG3A 3E8OA 4X64J 2CPHA 2KFNA 2DBBA 4WFAQ 5A2QY 2HVZA 4DR2J 3TUJC 2GGPB 3VAHA 1TL4A 2BJ7A 1MMNA 4QYZK 2LQBA 2WBMA 1Q8KA 2QLJB 2AJ2A 1HI1A 3RRHA 2UVWA 1NKCA 1UZDA 1RA6A 1S9GB 5B0BA 2LEPA 3BYPA 4X4TA 2KDOA 3MPDA 3CCJS 2IVMA 4XK8C 1CULA 3TWZA 2HFVA 2DXEA 3BV8A 2DHGA 3CJRA 4ZLPA 2WSFC 4M94A 9RUBA 5KFHA 3LP0A 1AA1B 4UQGA 1JQGA 2KT2A 2HRYA 4RNFA 4ED1A 3LP1B 2QA4S 4O4GA 5K9FA 1UEKA 4DS4A 1RI7A 4QWAA 1VOMA 1F0XA 3AQPA 2WB1D 1S6UA 4LIWA 1QLNA 3ZZ0A 3OFEA 3LF0A 3W1YC 4DN0A 1IN0A 2GHPA 2OPRA 1TVRB 2J0XA 1VQKS 5T7LA 2WSEC 3DDNA 1S1VB 2ZH5A 2XTJP 4NLWA 4DCOB 1R89A 2MSSA 4RO0A 2VD3A 3IRXA 2IPOB 4DG1A 4DV4F 5B0FA 1H7XA 2ZDPA 3V2UC 1T3OA 3F0NA 4Z7CA 1EQ0A 1XR7A 2HQFA 4DV7J 2WOMB 2XGPA 1P27B 3H90A 2CUYA 2RF2B 2MXYA 2JZ5A 3PKYA 2W24A 5EWFA 4CLPA 5IT9U 3D2WA 5D4PA 3CDEA 2KXNB 1VQ6S 2XMVA 2CQ0A 1P6TA 4LSNA 3E01B 3J7Z5 3MEEB 1S1XA 4OFZA 3SBMA 1J5EF 4H4MB 2IDEA 1BGXT 4ZJOA 4RKUC 2WONB 1LWFA 2F65A 1IVZA 3OR2A 3D7SB 4MTPA 3KOAA 3UR3C 3O1LA 1FNOA 1P9YA 3IG1B 4X4NA 1CQMA 1UJ6A 1C0TB 2L3MA 3OXGA 3P3DA 3L3CA 4K4UA 2HVDA 3LOUA 2X1BA 2KHCA 4DPTA 1CG2A 4TXSA 4B3OA 3UR0A 3RR8A 3PNIA 1WI6A 5LSLA 4F4KA 3WHIA 2BJDA 4R5PA 3UDEA 2NPFA 3AD9C 4D3HA 2LQ9A 3OHAA 3UCGA 1SH2A 5A76A 3B6BA 4FN5A 4CLTA 3JYTA 2OFGX 1RT3B 1KR4A 4EYHB 1JLBA 3KXDA 4ZVTB 4ZPDA 4WU2A 3NOGA 2AJQA 4OYWA 4ZP9A 1U24A 5HP1A 3NAIA 4P72A 2I2YA 5MAOA 1G7CB 1QUVA 1FKPA 3AT1B 4ATNA 5KFNA 4PUOA 1N5YB 2UXCF 1PJ6A 1TK5A 1DAXA 3OTOJ 2VIHA 2K7JA 2CDQA 4Z7YA 5FLXU 2V4RA 2ZM6J 1HD1A 2GVDA 3D6TB 1N5TA 2YKOA 2LMIA 5I3PA 2FVPA 1QTNB 2EKNA 3G82B 1YBTA 3NS5A 4JB8B 4LRDA 2XZTB 1RACB 2GCFA 3HULA 2H5IB 4G1IA 1WSVA 3VV2B 2XMMA 1RT4A 1TR0A 1TUWA 2E1AA 3ILOA 5KT5A 1WC6A 1S6QA 1FDDA 1OY8A 3RRGA 1EQMA 2DXDA 1Q7YT 4P6QA 4F2RA 3CDBA 1KHWA 1LFWA 4HTIA 4ED3A 4C8KA 2KM8B 3EE3A 2V67A 1F9FA 4EBDA 3G71S 2HNZA 3BN4A 4U7UD 1SUQA 3MGJA 4KQZA 3RTVA 1S12A 1N34J 1TL3B 1KQSR 4LFBF 3O8WA 5GAEU 1YJ9S 1RJJA 3DLEB 1Q53A 1ZA2B 4CP5A 3J7A1 5IQ6A 4DEZA 2BR0A 1RHUB 2B6AB 1ROFA 1GXLA 1FXDA 4NE9C 1N6QB 1S49A 1ZM4A 3Q83A 3M8SA 1MWQA 4J9QA 1SQFA 1I94J 4DS5A 3GYGA 2PC6A 5KG6A 3DRSB 4QU7A 2BXJA 2ZKUA 1IWAA 5G0RB 2CQPA 1KTVA 4DX7A 4JI4F 2AJ0A 4DF4A 3HI9A 1AYEA 3PW0A 1X5OA 1MROA 4JI7F 3GFZA 2XLKA 2AJ1A 2ZH9A 2KJVA 3PW4A 1LWCA 1F3VA 3CCUS 2VPYB 4MIAA 2QGFB 3OXLA 4A8FA 4ZVQB 2QLFB 2IRUA 1D0EA 3QZ7A 2L9NA 2JVRA 2JLGA 3CCRS 3NNHA 3MM6A 1G1XA 2V2KA 4FVCA 2Z56B 3PG9A 3NY0A 2YTCA 5C25A 3G2XA 3OV7A 3CMAS 1RT2A 2GVZA 4KGKA 2PE8A 2PO4A 4XDCA 4WTYA 3H59A 4OYZA 1AT1B 2CZ9A 4K4VA 2ILYA 2BABA 2YPYA 2UXDF 4UTGA 2XCAA 4KTQA 1FWPA 3BGFA 2Q6CA 4OZLA 1F6TA 3H4DA 2VJVA 3IGVA 1KVIA 4NLVA 2KVIA 4UW2A 4ZCIA 1WG5A 4H54A 2B9EA 3GYXB 5F8GA 3NGSA 1UJ4A 1SV5B 2K7KA 1T03A 3QSIA 4X65J 1U0HA 2IM2A 3NGKA 2CADA 2YKQA 2ALZA 2HFNA 4DL0C 3GV8B 3O44A 2CNNB 3UD4P 2G4BA 1GK8A 4LBHA 3HFKA 1IKXB 2RE1A 4K7QA 4M5LA 1HA1A 1W7WA 1Y5NB 4WFXA 3I56S 4IQMA 2BOAA 4FDFA 1Y10A 4YB5A 4KFBB 5HQ8A 1S0NA 3GR1A 1KOOA 4PWWA 3BKUA 5ETNA 3GFHA 2RNEA 1WHWA 4WFBQ 1XR5A 4LRAA 1HQ2A 1QVFR 3FBCA 4LFCF 3DLKB 3V6JA 1IWGA 4ZKAA 3FZBA 4QYZJ 5I42A 2RHQB 2OEMA 3AHPA 3N6NA 4DV4J 4NWBA 4W90B 5ETMA 1X7VA 5KFSA 4LF5F 1IKYA 2V63A 2LA6A 2F4FA 1NNDA 7AT1B 3FSXA 4ETXA 1Q4RA 3JAMU 3MMBB 4YDDB 4OYOA 4XO0A 2ZUGA 2FHJA 2KI2A 2IM1A 3RR7A 1DY3A 3QRRA 4ZIWA 2E7VA 3BDEA 1HQEB 2K8GA 3QFWA 3OXFA 1RAEB 1U1RA 4OI0A 2VFRA 3MM9A 3GB0A 2BQUA 2MQPA 4NLQA 3MPUB 2O66A 4KHMA 5KFIA 3KJVA 2MLYA 2YPZA 1AFIA 3JSRA 1KVJA 2DYAA 2Y0SD 4RR5A 1CC8A 5L1KA 4MK7A 4RU2A 1B3TA 1QTMA 4N47A 1FRIA 3MURP 5IOLA 4LF6J 3TA1A 2YNIB 2LA4A 2R8HA 1FJCA 2Q6BA 2O67A 4OX9F 2QIFA 1VLYA 2GFFA 2GMJA 2HS3A 3ZO7A 4ZHRB 3M2VA 2BRKA 2R3VA 1FF2A 4HVZA 4K4YA 2V94A 4CCHA 1HL6A 2DNOA 4DUZF 1DFDA 2DHSA 3PYFA 4OV1A 2DY1A 2R2RA 4DWIA 2UXCJ 2XI3A 4NLSA 2KN4A 4JI3F 3DGVA 3M7VA 3S8SA 1CQNA 3C3LA 1OO0B 1CJTA 1KP6A 1S72S 4OYBA 5D3GA 3CNQP 4F2SA 2D7SA 1U47A 1RKIA 2XMTA 4DUYF 4WE1B 1ZETA 1C1BB 3QATA 2YH1A 3DGPB 3PV8A 4KHRA 3IS9A 3TX8A 2ZE2B 2OJ3A 4ECVA 2HNDA 1REVA 3KJNB 3ISNC 4DPWA 3NNCA 4H4OB 3TA2A 4WWSA 1WTBA 4PG7A 4DSIA 5ADZA 4I68A 4A48A 1IKWB 2DH7A 1VK8A 3T1HF 2YKAA 3SV3A 1T05B 1JLAA 1C1CA 3D6FB 3C16A 4ED6A 5E5NA 2V2VA 2L9DA 4I6YA 2AX0A 3KYLA 4QQBA 3NS6A 4NRTA 2FB0A 1ACMB 2NPIA 1S9EB 4NCBA 1KVKA 3MCMA 1U02A 4YP3A 4BWMA 2P5VA 5HANA 2Y1LB 2JEIA 2CG8A 3TAPA 8RUCA 4LFBJ 1J5OA 1S0MA 3PJ9A 5CYMA 1HPZB 4WZQA 1WC4A 1W2BR 4OV6A 3HVAA 2AZ1A 3N5BA 2RRNA 3CCZA 2EFGA 4IH6A 4KBIA 3TAMB 4P2SA 1JK9B 3LW5C 4HH0A 1LEOA 3M32B 4CRJA 3MR5A 2IJRA 2VPZB 4A47A 4RUHA 3BSNA 5CD4H 4ZK7M 5CABA 4ZN1A 3RG6A 2BA9A 2KL8A 1SI9A 5SZTA 2G0CA 4JI4J 1U49A 1RSCA 1RAJA 4USMA 4ECUA 2E7WA 2V34A 3OVBA 4RUCA 5A2QU 2C1EB 4WXOA 1XQIA 4LQ9A 1UVNA 3DKDA 5K14A 2XLJA 3W66A 3IR5B 3L7OA 5DGAA 4LQ3A 3MTJA 1HBMB 1VRUB 3LPYA 1T0TV 3ET6A 4HLBA 2DCUB 3H5XA 2IVFB 3DM2A 2VODA 3CSKA 2VL1A 1RT6B 4RW7A 2JOQA 3NGRA 2VG7B 4ES1A 2KRBA 4C0BA 2CJAA 2NCKL 5DGBA 2CNKB 2AWZA 2DEJA 3SYZA 4JYAF 2V8HA 1WUUA 3RYLA 2DGWA 1RTIA 2UUAF 2MLXA 2ZITA 4RWXA 2L48A 2JEFA 2EPIA 4IOBA 3MMJA 1Q81T 4PXBA 1QE1A 5D0GA 4M8LA 4M5DA 4S0MA 2KG0A 2OTLS 2J6TA 2G2YA 3EGVA 2F40A 4KY3A 3EDQB 2YKNB 1Z1ZA 5L1LA 1IKVA 4MAKA 4DU7A 2OEKA 3TJAA 1M1HA 1U2RA 2UUBF 2YKPA 4K5RA 2B9XA 4LF9F 4IRKA 4RBUA 2I8EA 1SC4B 3HO1A 5F8MA 1IR2A 3IGNA 4DV2J 2XNQA 2FVCA 3QRQA 2GQ2A 4Y2KA 4LBPA 3EXYA 4NMXA 4RZRA 1D9DA 4G3IA 1Y9OA 1HR0J 1X8DA 1HMVA 3POTB 3R6GB 5HVHA 1KEKA 1S1UA 1KLNA 1EHWA 1DLOB 1HD0A 1X4GA 2B9YA 3EICA 2OPPB 3DU6A 3NOCA 1OWXA 4OZJA 5KFMA 4HACB 1TUVA 4ED5A 3H2VE 1U1PA 1XEZA 1TQLA 2HFSA 2ZBPA 1VMBA 3HKWA 2HHHJ 6AT1B 4EO8A 4ZLNA 3BBCA 1RHJB 1FFWB 3W2VA 2HIQA 4WIIA 1DURA 3GYNA 2C2NA 5KFJA 3M8RA 3HSDA 4MKAA 4OI1A 4P74A 4DCJB 2YQ1A 4TY9A 3FFIA 4MKVA 4KPYA 2X51A 4M63A 4CLKA 2OMLA 4U9RA 3CJQA 5A8RA 2KHDA 1R8HA 1V5IB 1ZOTA 4USJC 1K1SA 1DTTA 1WELA 3V4IB 3L9ZA 1E6VB 1IJFB 3WC2A 1UTAA 3T1AA 2DK2A 1REGX 3SFGA 3IBFB 2D1CA 3CJ4A 2BKNA 2Q3PA 4M5JA 3CT9A 4KO0B 5F8HA 4QBUA 2RUSA 2Z4PA 3V81B 5IV4A 3LAMA 1FNMA 1HBNA 5J2NB 2WVEA 1HWJA 1T9YA 2BKPA 3PTWA 2HVEA 5HLFB 3M6WA 3M6VA 1JWWA 2FJXA 3HKZD 4C8OA 5J2PB 2OGUA 2KYXA 3P5TL 1EETA 3B78A 2HVIA 1ZM9A 1YG0A 5KFFA 1E6YB 1H98A 3ENQA 2R9LA 1DBDA 2EI5A 2WW4A 3ELHA 1GQEA 2Z2ZA 1ZYQA 1XNRF 3O3LA 3MEKA 2DXFA 1RCXB 3CJ2A 1CS4B 3MMCB 2DR5A 2QO3A 2C42A 3JQMA 4AXIA 4DUZJ 3GU0A 1Y5IB 4ITSA 1JLFB 3J80Y 2HMIB 4ZPCA 2HAIA 3EVOA 3W9HA 4B9SA 4M5IA 2KJWA 1RTZA 2I1RA 4M95A 1Y3JA 1T7PA 3CCVS 1EB0A 2Y8YA 2PN6A 2DNKA 2AU0A 3NWRA 4BC7A 4DUYJ 1K44A 2BQ3A 3ZNUA 5C5JA 4OHYA 2ROPA 4A8KA 3QLHA 4RJVA 4QU6A 1N5SA 1GTHA 2HQIA 2DEIA 1QUPA 4PQUA 3T9NA 2H1YA 1Q5YA 4RW6B 3I4PA 4KAIA 3KMSA 2NSBA 3M8PB 2MKHA 4J9LA 3T1HJ 3MM7A 2YWKA 4ZPWR 4NYOA 3QYYA 3R2CJ 2VC1A 4CTAB 2C3MA 3R5AA 1PG5B 2VBYA 2H4YB 2DTJA 1TKZB 3G96A 4N5SA 4PWDA 4F8RA 1YQHA 2IMOA 2ZEJA 2XMJA 1H74A 5KFEA 4P71A 5HVGA 4DL2A 2L41A 1TKTA 1UFKA 4ICLB 3R9LA 4DV6J 3GG0A 3UNGC 5HMYA 3MAQA 4D3GA 4B3TF 3GTYX 1EIYB 2K2PA 3ZTQA 2FVQA 3GIIA 1UVLA 3H0PA 3MXHP 3W62A 3I0RA 4DSJA 1HWLA 4OYPA 5KFGA 4F0MA 1SQGA 3LAKA 1KQFB 4MKYA 4OHZA 4PPDA 1IBMF 3KTQA 4L75A 1TKXB 4DR7F 3MDFA 2FVSA 5AE1A 2MZJA 1VBXA 3BSOA 3FMBA 5HJYA 5BYRA 1X4EA 1FVSA 2BE7D 1KLMA 2J0SD 1HI8A 1IBKF 1O5JA 1Z4UA 1UKUA 1XMBA 2DNPA 1XNQF 1NPKA 4NCGB 3LP2B 2E5LF 4DDFA 1H7WA 4IKAA 4HT7A 2ZUAA 1RT1A 4LF8J 4HTJA 2X7IA 1VYAA 4JYAJ 5A0YB 2UUAJ 2F8HA 3EVWA 2DNLA 4OI6A 2HHWA 3ZTSA 2W25A 4NA2A 4RL1A 5MLCV 1SQEA 3DOKA 2UXBF 3W2WB 4DU8A 2AX1A 2ZBQA 5ITHA 4RW8B 3DXBA 4TVAB 2W9CB 3OR1A 3VGVA 2CYYA 2YWWA 3LPEA 3DOLB 2OEJA 4DOZA 1HQUB 2B4PA 2UUBJ 3MM5A 1VQLS 4KGXB 4Y0FA 4LF9J 1ITPA 1TMJA 2QFIA 3MFHA 2W4DA 4LRFA 1U6ZA 2GW8A 5ETVA 3CULA 1BQMA 3LGMA 2OPSA 4JI8J 4QW9A 1BQNA 2BZ2A 1TV6B 1KQGB 4K2XA 3RBXA 3D54A 3HSZA 3K5NA 1KS2A 1QD1A 5E2QA 3CGIA 2RUGA 2NUUG 2RB7A 1YJRA 3U1MA 4NASA 2MKKA 5C2CA 3D0IE 4N56A 1ICEB 2YWGA 3M6XA 4XTTA 4OI3A 1DZ5A 3EGNA 5B09A 3C2PA 4DFJA 2AT1B 1SJQA 2GIRA 4NLOA 2UV8G 1YHQS 3V6DA 2LDYA 3O6QA 1IBLF 4DJBA 1CULB 4F3QA 3TQEA 4F4XA 5BJRA 3H25A 3I5CA 4L6V3 1F5CA 2XSJA 1RYRA 1ELOA 1U1KA 1SKUB 3LP0B 1XWLA 1HWUA 3T3FA 1WTFA 5DJBA 2BM0A 1DTQA 1EKRA 1S7HA 2VONA 1O8BA 4TU9A 1PGZA 1Z2LA 3WBZA 3THVA 2JX2A 3M2RA 3G9CA 2ZZMA 3CB4A 1S1TA 5ETTA 5KT7A 2OPRB 4N8OA 2X1AA 1F1BB 4QW8A 5T7LB 4DHVA 3QBCA 4DLGA 1GH8A 3PXGa 1U1MA 4TLQA 2ROGA 4FXWA 2RDJA 1MN7A 3SXLA 4G6VB 3NWGA 3QGGA 3SSQA 4DG1B 2QMXA 1FD2A 4AT1B 4O3QA 3X1LB 2Z8QA 3V6KA 3HVTA 2CPFA 4JI6J 2ZH7A 2YX4A 2HQ3A 4BS2A 3FGVA 1S7IA 2QZ8A 1VIXA 3LTOA 3F44A 4DQRA 5HATA 3LQVA 4QZVB 4FYVB 3OHBA 4ANEA 2KXFA 4ZPBA 3W61A 4J37A 1S6OA 1XNRJ 5I3UA 5A8KA 1RT7A 3HSJA 1RHQB 3IFEA 1FNXH 2G9OA 1S4EA 4CDIA 4PXCA 5BR8J 2DD8S 1URNA 1Q8IA 3JTPA 3Q8YA 3CEDA 3I5AA 4P2MA 3M9NB 1HW8A 1V5VA 1M5HA 1L3SA 2KU7A 5HROA 5LSRA 1RDRA 2XMUA 2DR6A 2WTFA 2CQIA 4WJBA 4M5GA 4B3OB 4CLLA 1FKOA 4FBUA 4WFZA 2BYCA 4GC6A 3D66A 3MZIA 1N5QA 2HK2A 1O0PA 1Q78A 2QA1A 1UVIA 1NSPA 2VQFF 5DRKA 3QNWB 3JYTB 3O2IA 2NS1B 3L95X 4DZDA 1JLBB 3OVSA 3DCAA 2LCWA 1D9FA 1WDDA 4DL7A 1WEXA 3DDKA 2RKIA 2RQKA 3IWLA 4JI5F 4IO9Q 5HQLA 1FKPB 5LXRA 2H3EB 3EZUA 4PUOB 4ZOSA 4TU8A 2XG8A 5JJBA 1N8RT 1OYEA 4JI0J 5L39A 2MZTA 4M5KA 3M8ZA 3OTDA 1R8PA 2I0XA 4BHQA 2GVDB 2JHEA 4G1QA 1BHNA 2XY7A 1JLEA 4B3RF 4YY3F 2HQDA 2K06A 3AB2B 4N8NA 3MEGA 2VFTA 3DLBA 2YXLA 3ONQA 5FJ4A 1CEZA 1LK5A 4DQPA 4Y2AA 1AFJA 4MH8A 4DPXA 1NK9A 1RT4B 4AQYF 3D4JA 2V9WA 2N4CA 2OFHX 4O4RA 2IFXA 5IM0B 3Q89A 2E9RX 1IBMJ 3DYAB 1CJUA 4DFMA 4ELVA 1G3OA 1NBEB 2V50A 2XHWA 3CJ8A 3QJLA 5CYQA 1RQ0A 4DV3F 2EG1A 4EI2A 2VFSA 1RWNB 2MSTA 2XMAA 1DJ0A 1VHIA 2HPUA 3G4SS 1NKEA 2HNZB 2W9AA 2MKIA 4KKOA 4FF3A 5KG4A 1VK3A 2H54B 1XNQJ 3BQ0A 2JC0A 1YJVA 2V68A 1OPIA 2DNRA 1B7YB 2ZH1A 1D1UA 1EAYC 2CZ4A 2ADCA 4ECQA 5DS7A 4X4OA 1Q8BA 1UETA 2YWHA 5KT4A 1UMJA 1KSPA 5JVGQ 5GMEA 1HW9A 5K20B 1HNXF 3DOMB 4KV8B 5KT3A 3PX0A 2FLPA 1NHKL 2CAJA 4GVLA 3F56A 1GFWB 2FC8A 2H5JB 2AYBA 3MEDA 5C42A 4TN2A 5D0RA 2EFOA 4IH5A 4YN3B 1IR0A 2UXBJ 1RWVB 3PFOA 3L4BC 4IR9A 2Z57B 1T3NA 4EZ9A 4O23A 1HHQA 5GAGI 4BWJA 2XNRA 2ASJA 5KG3A 1MROB 3UI3A 2AHOB 3LGHA 2C3OA 3R6LB 1Y4ZB 2IA6A 3UPFA 3C15A 3NLCA 4CI0B 3TOQA 3FNNA 5DDQC 4CO0A 2PEBA 3MM6B 1N32F 1N36F 2ASDA 2F63A 4DSFA 2F3JA 2FUG9 2V69A 1QAIA 4OJGA 3VCDA 2BMBA 1RT2B 3GPAA 1DARA 5H9FJ 4F7VA 3KMQA 2GHWA 1HWIA 4PR6A 1RGVA 4WP8A 3KLGA 1B70B 3SCJE 1FRHA 3ENWA 2P6SA 2HHQA 2J7KA 2EFPA 1QAXA 3H5UA 1TKDA 2BJ9A 2CDRB 3IC1A 5HBMB 1YJNS 4ANCA 4RW4B 5DZ6A 3PYEA 1OPZA 1GMWA 2AJ4A 1VC5A 4L3KA 5IWAJ 2VJUA 4CQ1A 2MKCA 2RT3A 1TP7A 2AD9A 2YNFA 3OSNA 2B0GA 1XN9A 2GHVC 4I0WA 4CNYA 3ADAC 2MJNA 4ZN3A 1I1GA 3D1OA 3WDOA 2GA7A 1HFEL 3CDUA 1X4BA 4YOEA 4R8UB 7FD1A 3PR5B 3D67A 1G2EA 5F3ZA 4ZPAA 3M8YA 3R5CA 2FY1A 1FRMA 2ZFHA 3K2YA 4NZ0A 3UD3P 1VQPS 3TNVA 4ZVEA 8AT1B 5HN0A 2NXJA 4HDGA 1NAQA 1Y0HA 2XGQA 1X4HA 2Q66A 1FRKA 5E0OA 4A8XA 2PI4A 6FDRA 2E66A 4DV0F 3FCHA 5IXUA 3U1LA 1WJ9A 5L46A 3OUYB 3FEZA 1RAFB 3M8QA 1N33F 1WOOA 3HM9A 3JQKA 3J80U 2M8HA 4G1PA 1BY9A 2VG5B 1T95A 1PYSB 4BLGA 2LECA 2HFOA 1LWXA 1Y5LB 3T5KA 2GGPA 2JLFA 1RLCL 1KD1T 1G4CA 3R7SB 5KFLA 4U67Q 2MEWA 3N01A 2I6WA 2MZQA 3OW2R 4X66J 4B3MJ 4OJ3A 1H38A 1CC7A 2BE2A 2XO6A 2Q1LA 1IXKA 3C6UB 2I5JB 4IQXA 1X9WA 5GVQA 2HBZB 2QSFA 4HL9A 3R97A 1SXLA 1KONA 3K5MA 2R8IA 3EPGA 1RAOA 4G65A 4YR0A 4WF9Q 3SDEB 2M70A 3MR7A 5HVFA 3D6MB 1AW0A 3D3CJ 1EJ7L 1FWLA 2J6UA 3LP1A 1Q95G 1WEZA 4ZP6A 2CXEA 1DRZA 4Q43A 2IRXA 4CT9A 2HFZA 2DR9A 3TI0A 2A3JA 4R0JA 4V1Ak 4NZ7A 1T11A 5C24B 3UVJB 4HI1A 4NYZA 3DN9A 5EDWA 3N6MA 1CBKA 4C11B 3GSDA 2IC3A 3Q8RB 1D8YA 1JLGB 2C3UA 3GZ7A 1S1VA 4YHHJ 4ZVFA 2KVQE 1BWVA 2EWHA 2ZOMA 4X4PA 1RBLA 3R3TA 4JI5J 1P1TA 1XERA 3ISZA 4J9RA 4ELTA 4I64A 3DLLQ 4QIVA 2A6OA 3K7RA 4DX6A 3OJUA 5E3PA 1RADB 4DR5F 1UA1A 2WOMA 2HVHA 3GJTB 3AD7C 2RF2A 3M1VA 4RNHA 3K58A 2EC0A 1CJTB 5D4OA 3I9V9 4F4AA 4YY3J 4X62F 3D0HE 4ILMA 4RNOA 2LU1A 4RPFA 2ZDOA 1CJVB 3GFXA 3MEEA 4ED0A 3PVXA 4CLUA 2ATLA 1FA0A 3EJMA 5CZXA 3VZHA 4H4MA 2VKZG 3VAIA 4NPOA 3IS9B 2RQ4A 4AQYJ 1IM4A 4ED4A 2OHDA 2HNDB 4CM2A 1REVB 2WONA 4LR8A 2KZZA 2M9KA 3CO9A 2EFVA 2UV8A 2XMWA 1KFDA 1CJKA 2RDIA 2ZNYA 4ES3A 2W7AA 4E0DA 1WSRA 1JLAB 1C1CB 3C16B 2O3DA 4PG5A 5F8IA 3FSIA 1RLDA 3RBDA 1WG1A 4NX9A 1YJWS 1CSJA 2WVDA 2NQPA 2OO4A 1H72C 3QO9A 2ZZNA 1KDNA 4OMFG 4MYTA 1SCJB 4M1KA 5F0UA 2MZSA 1J5OB 4PRFA 5GAHI 2QMUB 3VGUA 4Q8EA 1VC0A 1UPPA 3LH2S 5CYMB 1VS3A 4W92B 2AYEA 3WIUA 4J9OA 5F8LA 1R8BA 4Q2MA 2GQQA 1B0TA 5C2GA 3NNAA 4OYXA 1XMQF 3MAAA 1RWMB 1F3FA 4C8NA 4USWA 2C22A 3AJ2A 2M52A 5AE2A 4KR0B 1F9EB 1R3NA 1U6FA 1GX6A 2NXNA 2QC3A 5KT6A 2ZOGA 1TU0B 5HAOA 4KYZA 1X5PA 5BYQA 1RA7A 2RIJA 5LJ3Y 3CMQA 3UN2A 5K14B 2QSWA 2CPIA 1A0OB 4DQIA 3NGUA 4DPOA 2FJEB 4QR0A 3ZZYA 3MOZA 1FT8A 3VVTA 4W98A 1N36J 1DHMA 3OT9A 4QWDA 4K0KF 1QVGR 1PAUB 4WKRA 2V8VA 2UU9J 4IH7A 4YB1P 4DPYA 4DR6J 4KGZB 3GCWP 1HNVA 4HH1A 2PMZD 1HKAA 1IQZA 1RTJB 2QA4G 2LEBA 3DMJA 1H0HB 1PC4A 2RRBA 4KH0B 2XZDB 2OI2A 3Q2SC 3FCWA 1GTEA 2XS2A 3GILA 4NLUA 2KXHA 2IAJA 1TL3A 4CLYA 3R8YA 1IKVB 7FDRA 4EK2A 1SH0A 2HWIA 4KT0C 5LMUF 1M5KC 4B3SF 2LKZA 3TVYA 2L9WA 2MKYA 5D4LA 2DB1A 1U8SA 3Q8PB 3CC2S 2B6AA 1SKSA 4LFAJ 1RU1A 2XYGB 1J27A 3U7JA 3KK2B 4RNMA 2P9GA 5L1IA 3UQSA 1SJ3P 1JJ2R 4OZ5A 3HVWA 3DRSA 1HMVB 3TUZC 3KLEB 5G0RA 1TL7A 1U1OA 1PBAA 3SEOA 1SIZA 2FGCA 2OIHA 1W25A 4NXNJ 1GMUA 2FJDB 1FRJA 3GE9A 2ZH6A 2CQGA 3AQOA 5F8JA 3KLFB 1VQ9S 2O01C 3HZGA 3Q8VA 1UWBA 2VICA 1AUSL 2WVCA 2V8GA 1FHTA 4F4WA 4RUBA 1WI8A 4YMEA 5B0EA 1HHTP 1NKBA 3QJJA 4P9SA 5I4MA 1JKHB 2WSCC 3IM8A 2W1BA 3FCVA 1RHMB 3MR2A 4FYYB 2C3PA 2YBVA 5E3AA 2MB0B 3FFIB 4NXMF 3NGDA 2WBRA 2LVWA 1GX5A 4LR7A 2N3LA 1OIAA 3R7BB 5A8RB 2GAGC 1YK9A 4CLFA 1LQ9A 2H65B 2YNGB 3M2UA 1URRA 3PCOB 2J5AA 5CCMA 4DR3J 4Z2XA 5KFYA 4PAAA 2JLEA 3M8WA 1SV5A 2AJFE 3FJ2A 3HHKA 1HBNB 4LBIA 3HJFA 4ECSA 3ISND 1IM6A 3I5BA 4IYQA 3KG1A 4QYRA 2KH9A 1IUJA 2ZZTA 3BJYA 1N0UA 4UOFA 1S59A 1EETB 2JH3A 1X4CA 4AL7A 3H42A 2JEGA 2ZBIA 2XSFA 2R7XA 3L7PA 2OPQB 3OL8A 3KNAA 2RH3A 1FDNA 3CJ3A 1ZAVA 4Y2IA 1H6KX 3JSBA 1FCAA 3ENAA 4HDHA 5EHHA 4CLWA 4WK3A 2LXUA 2LFVA 4LREA 1ZA1B 2W2PP 4OYMA 3KNGA 4NZ6A 4ZJQA 1HLWA 1ZM2A 2VASA 5KFWA 1VQSA 1WNEA 3BO4A 1VC6A 2WHOA 4DR5J 2E9TA 1YSJA 3MPYA 3WC0A 1FRXA 1EX8A 3P4UB 4X62J 2QYCA 3GR0A 1S6PA 4URSA 2DIVA 2EK6A 3QLHB 2AEFA 4ZVPB 4F02A 1RHKB 3CD0A 2KYZA 3C6TA 4USVA 1SVDA 2NYIA 1ZPWX 2J7WA 4PQUB 1BUXA 1RK8A 1WACA 1YWXA 3KJQB 2WRMA 2E9ZA 4A8MP 4TU7A 3MECB 4PEOA 3FEXB 4NLPA 3MM7B 1VQ4S 2IJNA 1AB8A 2FJWA 2VF3A 4USIA 2JJ4D 1U45A 3DLGA 1WKLA 3OLAA 3TZWA 2DIUA 3CDWA 5BXIA 4GKKF 4CLZA 1YRXA 2J9CA 4I7FB 4ZLJA 4PWDB 2GC8A 2W2OP 4DUTA 1PC5A 3T1YF 2QA2A 1C2PA 4ZHRA 1B0PA 2GO9A 3FBEA 1TKTB 5JUMA 3OJSA 1NH8A 1RTHA 1SJRA 2IY5B 5AXNA 4NLDA 2BDPA 2EFNA 4EBCA 2N82B 3W5ZA 2J9DE 2Y0BB 5EN1A 2PDAA 3ZC4A 3K5LA 3BDPA 5DDRC 5T14A 2RRAA 3X3UA 3AXMA 2DVIA 1SJ4P 1FTCA 2HHXA 4DLEA 3MWBA 2XY5A 4NLXA 4NLTA 5L1JA 2RU9A 4DL4A 2FZCB 3BQ2A 2MJUA 1KLMB 3ILJA 3NBPA 1VFJA 3G6VA 4L74A 4WE1A 1FJEB 1VBKA 1VCTA 2F1FA 1C1BA 1OJ4A 4HHUA 4DR1J 3TR5A 1VIOA 4O44B 1TL1A 4H4OA 5GMDA 3FK4A 3FBBA 1RT1B 4QOTA 3ZXWA 5DQIA 4PWUA 2BQRA 1H3DA 1T05A 2LQ8A 1YJTA 4OHVA 4Q7AA 3VQTA 4P7VA 2CPXA 4ECRA 2RILA 2JC1A 5KG5A 2AEJA 4Q2LA 2Y1RI 1U2CA 2HBRB 3OR1B 1U6BA 5LM7E 2LYVA 3TZZA 1NK7A 2DGVA 3MM5B 3OBIA 4B3SJ 4IO1A 4UY8T 2CJQA 2AYGA 3HX9A 2PEHA 3QSYB 4J9UE 4B9VA 4GKJJ 4YB6A 2PMHA 1BQMB 3S01A 2OPSB 3BPDA 3B82A 2R7OA 1N52B 4J9KA 1M1GA 5HSPA 2CNOB 4CWBA 2VG6A 2W2QP 3MD3A 5SUHA 3M32A 5H1SV 4J90A 2HHSA 4MYUA 1FEEA 1RT5B 3UFCX 2MHNA 1MN9A 5AT1B 4Q0BA 5LXYA 4URGA 5L38A 2MHEA 2V0NA 4NOHA 5HK4A 3AY0A 1RXOB 2GZOA 1HWKA 4AUKA 5M2RA 1NCLA 3KLHB 2CQ4A 3V6DB 1NB7A 5H9EK 5THWA 4I2QB 5DETA 5D0HA 1MWYA 1RT6A 4ZVUB 1LK7A 2XI2A 1SKWA 2XSJB 1O51A 1M5SA 2DNMA 4NLRA 5KFCA 4IOCQ 3EWGA 3TJ8A 3GCXP 1DTQB 3QGPA 2UUCF 2R8JA 1GXTA 1K1QA 3D1QA 1LW0A 1S1TB 1NJXA 3BGUA 1YIJS 3EX7B 2QN6B 2M7SA 4ANDA 4Y34A 4OL8A 4IDKA 5AE3A 2YKNA 5KTQA 5KFOA 3SQGA 4N41A 1VHFA 2H9ZA 3D0GE 2GMLA 3VR1A 3J7YU 4I2PA 2AW0A 1Q86T 3T5JA 2FHOB 2FDNA 4UOGA 4QIGA 2CPZA 2X3GA 3WIVA 1FE4A 2DY9A 2NSCA 4P7TA 4J91A 2AIRB 3THTA 3MUVP 1HYSA 2F4VF 2AEMA 3HCXA 3M30A 1HBOB 2VFVA 3UN3A 4DR2F 1DLOA 5I3UB 5A8KB 3IN5A 3E2EA 1JLCB 2FJVA 1O6XA 3W9JA 1PIEA 4HACA 3GJRB 3AH6A 1ZZNA 3PR4A 1WEYA 1D09B 5K8MA 3TW0A 1PKUA 3OPKA 1KFSA 1KHVA 2BE9B 4K4SA 3KJFB 3SCIE 1DQ9A 4J7CA 4V19J 1FDBA 4HEA9 2ROEA 4QWBA 1S77D 5HROB 2BBEA 3IWNC 1I3OB 3G86A 4X84A 3MMAA 1K73T 1F60B 1N0VC 1AZSA 4OZ0A 3KKFA 3A12A 2BW2A 1FKOB 4B9UA 5CA5A 1YX2A 2I38A 1M90T 1RAAB 1S9FA 2IYIA 2XMKA 2YKMB 1JJCB 3FQLA 3SQOP 1FVQA 1J5EJ 4B9MA 5JXSA 4YFUA 1U2FA 2LQJA 3KFWX 2DO0A 2FIUA 5GAEI 4KO0A 4YR3A 2OKQA 5F9LA 3PYDA 5J2NA 1KBRA 4QR1A 5HMWA 2A0FB 5HLFA 3QFHA 5J1NA 4Q45A 2W4PA 3RAMA 2CNLB 4JI1F 3EPIA 1UZHA 5IC4B 5J2PA 2BVZA 2I9SA 4IFVB 2X1GA 2OELA 1BQXA 4HR2A 1E6YA 4KHPF 4G1QB 2AKWB 3G6XA 1JLEB 5A8WA 3D1HA 2B4OA 3TRGA 1HBUA 2ABYA 2H51B 1R6YA 4C3LA 1BXNA 4F0HA 3NCRA 1VQ5S 3KK3B 4RX6A 4QIFA 4UT4A 1S48A 2ZH8A 1JLFA 1S76D 1R6VA 2KFYA 4ZP8A 4Y28C 4U7UK 4DFPA 2VH7A 4K59A 1APSA 3MM8B 3NAHA 2MTLA 1LWEB 3CJKB 2UUWA 5LSOA 1Y11A 1UP1A 1NM2A 4B17A 1NPRA 4KGVB 1EP4B 1FKAF 1MG7A 4PXDA 5D0EA 4KKOB 4V19X 1F5BA 3GFYA 1VQYA 4HT5A 3UDCA 3BQ1A 1MWZA 2RS2A 1VQ7S 2Y1JA 2WVFA 3R5DA 1FD8A 1WHVA 4Q8FA 4Y3CA 5K8NA 1SBRA 4B9TA 4RW6A 3B4MA 4JOUA 3Q24A 2HFUA 3EVMA 1FK9A 1L3KA 3M8PA 1ZPVA 1PJ7A 3QWUA 4WKYA 3PX6A 1WF0A 3E3XA 4MKBA 3OTOF 3M9MB 4DSKA 3ITHB 1RTDA 4FYXB 2XYHB 2ZM6F 4UZBA 2GO8A 2J0QD 2MGZB 2KZMA 3RGIA 1YLXA 5K8OA 3S7RA 3QMQA 1KNZA 4ZCLA 2D3UA 2HNYB 2LEAA 4CYUB 4OZ1A 3IWXA 5ETKA 4Z37A 3PHEA 5KFVA 4UQTA 3NCPA 2DNZA 3GIMA 3CWJA 4ILLA 4FKXA 2GIFA 1YGYA 2PA8D 2FGOA 1DQAA 3P45B 1HIYA 1D3WA 1R0BG 2AGOA 3ETMA 1UVMA 4C6AA 3HJVA 2HQGA 4CZCA 2HGLA 2EVZA 4QIEA 1Q79A 3QT6A 3BO3A 4P10A 5A6WA 3KLGB 2ZJPQ 4DBQA 2OTJS 3I96A 1UJ5A 4JI7J 3HFZB 4K4XA 1GNKA 3QRPA 3FC9A 1KN6A 5IV3A 2WB4A 1N34F 4ZITA 3THPA 5FDLA 1K8AT 5E41A 1S1WA 3UD5A 5B08A 3CC4S 3TP2A 2H48B 2E29A 3LANA 4L73A 4OIXA 2PD1A 3H8YA 4ALZA 2KKHA 4E98A 2YNFB 1YRTA 3TO8A 4BC9A 4LJMA 3MCSA 3P8BB 4DX8H 3M6UA 3OFHA 2ZJRQ 2XZWA 3CD6S 3I0SB 3BS9A 2GMHA 4EBEA 4OYIA 3H2LA 2UXDJ 4J9MA 2PGCA 2HQCA 1XMOF 2HRUA 3W2WA 3V6HA 4RW8A 3GV5B 2CQ2A 3HHLD 4U7CA 3BGRB 3DOLA 1HQUA 3W7BA 5I3QA 2RQMA 4ECTA 1LKZA 1C0UA 3EUNA 4JV0A 2XHCA 3QZ8A 5T41A 3M8QB 3DRRA 4DQSA 1FEHA 1YTYA 1V3ZA 1F9HA 2E5IA 1Q82T 5H9EJ 3BYRA 3RJMB 3HK2A 3LWLA 2DO4A 2F4VJ 4U6PA 4OX8A 1M0SA 1YKWA 1H2UX 1FWKA 4I6AA 1B7FA 2AV5A 3HZEA 3MPVA 4C0HA 2HLUA 1R0CB 3RB3A 4LFCJ 2ZD1A 1NHUA 2IYGA 3CTRA 5RUBA 1ZH5A 2BE2B 3T5LA 3HPOA 2H5EA 2CQCA 3W64A 3J81j 4N77A 1PILA 4LF5J 4WYWA 2ASLA 2WAQD 4K4ZA 4X65F 2W9BA 3DI6A 2EBEA 5HMXA 1TMMA 1B99A 5LJ5Y 2DRAA 4JBCA 2B7CB 3MR6A 1M5VC 3EYZA 2QX0A 1JMTA 3RW7A 1D9AA 2Z2MA 2M0GB 1MNEA 4YS2A 2DISA 4ZPTR 3DFEA 4FPRA 4CO2A 2IC3B 2HLTA 4IG0A 5D8HB 3N0VA 2CFXA 2OAUA 2CA9A 4XPCA 3H7HB 3KHLA 3ZFVA 2ZVIA 1YJUA 4NI2B 5LT5A 4FF2A 3OQ2A 3PHTA 1VI7A 2N7CA 1NJWA 4GO5X 2AGQA 1U1LA 1U09A 2QLWA 3S1TA 1V6HA 2GV1A 2CPJA 4TKTA 4JI1J 4F4YA 3A8JA 4L3NA 2ZBCA 4DXLA 3D28A 2CJ9A 4DV5F 2DHAA 3ZTPA 3M1VB 2XWXA 1TAUA 3C46A 3DRPB 4K4WA 3QPIA 4OI4A 5ETQA 4KHPJ 3C66A 4GVBB 2ZKTA 1ULRA 3TEHB 1SH3A 2XBPA 3Q86A 1XC9A 4C3MA 4LVNP 3AB4B 2KO1A 4OX9J 4W4MA 2Z30B 1LXJA 3JXOA 1R0AA 4LUBA 1X4AA 1FXRA 1MU2A 4XDDA 2ZHOA 3GSIA 3FDSA 4C2MA 2DH8A 3HD1A 2J9DA 2DT9A 2VUGA 2YVSA 3T5HA 2NZCA 2V4JB 1CJKB 2W7OA 4JI3J 4ED7A 4WFYA 2F8EX 2MQ8A 3ZZPA 5J1EB 1W2IA 3G8SA 2DNNA 1GT8A 1RABB 1QSLA 5D77A 5ETLA 4KGMA 4I69A 2DPIA 4MIWA 3BPSP 5LMNF 4MFBB 4LF6F 3QO9B 2F9JA 1YZ6A 3KHGA 5M2PA 1JLQB 5CXTA 4A8YA 5DQGA 2K1RB 2MQQA 3HDSA 2J9EA 1TAQA 4ZA1A 3VAFA 2W7PA 3FBFA 1QAYA 4WTOB 2IMWP 3JSYA 2O1PA 1YVFA 1N48A 3HSGA 4OX6A 2J6SA 2B8QA 4U96A 4LRBA 4EWTA 5D4NA 3MAAB 2DKOB 4J5OA 2Q43A 3ILLA 4UZCA 2DRBA 2KT5A 3Q23A 2BJ3A 2R4FA 1IBCB 2HWTA 2V2QA 2HYIB 1QSSA 2G0JA 4I67A 4GRSA 1MLAA 1WHYA 1X60A 2KT3A 3H98A 1V3RA 1X4DA 2NREA 2VA2A 4B9NA 3KWMA 5CZVA 4NYPA 4WZMA 5C7PA 2WW8A 4LF7F 3MPWA 3IAS9 2MY8A 3KLVA 5IM0A 1WKJA 4CT8A 4DSLA 1NH7A 3DYAA 3QT8A 5DG7A 1HNVB 2GIQA 2ZC3A 3DDIA 4OHXA 3W8PA 5J2MB 2QG9B 1NMEB 5J1PA 3I55S 3DMJB 1NK6A 2AP6A 3CW2C 3RB6A 4FKYA 3AA8A 2KB2A 4PG6A 1R8AA 2CKWA 1ZTWA 4FS2A 1VJQA 3J81U 2P9EA 4CLSA 1NDLA 4PYAA 3OD2A 2IAJB 4CIOA 1L5UA 1UPMB 5B0GA 4X4SA 1RWOB 3AODA 1U26A 4KSEB 4EMDA 1P1LA 2NYHA 1SL0A 3Q0AA 2W2MP 1RU2A 3VGTA 1WF2A 2EKYA 3C14B 3N5FA 3TYTA 1NK8A 3DOMA 4KV8A 3OFFA 5IT0A 3Q22A 3QT5A 3AOCA 1XIQA 1Q0NA 3JSMA 3U02A 2GX8A 2GJIA 4A8SA 1XMOJ 4ID8A 1TL7B 4L72B 3D68A 4ZMMA 4DL6A 5AJ3F 2G1HA 4U8YA 1HHSA 1UWBB 3T6JA 3BEGB 4F0KA 3GMGA 3QGHA 4NEZA 5KFAA 1YDLA 3I31A 2OSQA 1FTRA 2CJYB 3QQCD 4O3RA 2D41A 1L3VA 2B9WA 2OP5A 4B9LA 4PCQA 4IG3B 1TTHB 3EM1A 4ZCKA 3RBEA 2J8SA 1TELA 5M2UA 5DLGA 3SCLE 1NDKA 4KPCA 2MQMA 3QGIA 4F3OA 3M2UB 2VB6A 5KFXA 1RWWB 2BANA 3BN7A 2UVRA 1NUEA 5HBMA 3TUIC 3FVYA 2ZHAA 5CQGA 4RW4A 2DNYA 4JV5F 2GJ2A 3FUYA 4LF1A 4OLOA 2ZH3A 4FPIA 5HMZA 2LXIA 3GG1A 1VDHA 2OUGA 3I4HX 3GJQB 1RBAA 1X0FA 4DV2F 4O4GB 3CD7A 3WQPA 3VAGA 4R8UA 1NHVA 3R5GA 1HR0F 2AF6A 3N6LA 1QAJA 1UCNA 3ZTRA 5E3QA 1UVJA 1WD6A 4P73A 3QAUA 1VRTA 3HD2A 1KOHA 2OSRA 5DLFA 1A7GE 4WK1A 3NGTA 3BSCA 3ZZUA 4MIBA 2EG2A 2HG4A 3DNCA 3SSSA 3IRXB 2HHHF 1U0SA 2U1AA 1SC3B 3QWPA 2EC2A 1FO1A 3OUYA 4TY8A 4B08A 2YY3A 3K17A 3R2DJ 2B5JA 5DDPC 4QWCA 4DV5J 6FD1A 3N4WA 3RB4A 1PYTA 1VBZA 4OYAA 2VG5A 2CQHA 3RAXA 1NB2A 2MKJA 2IBOA 3V5RA 3ZTOA 3T19A 1Q7LB 1LOUA 2C2EA 1AXQA 3K0JA 3E51A 3G8QA 5L9NA 3M9OB 2OLWA 3AA9A 1VISA 1S6PB 4E8UA 4LSNB 2WVBA 5KFZA 3VAJA 5AXLA 1S1XB 1NJYA 1JX4A 3C6TB 1HNIA 4LF4F 4KB7A 4CNZA 4I56A 2QLBB 2M88A 2R7VA 3C6UA 2I5JA 2QYGA 1LWFB 2ZBRA 3A3OB 4RU9A 2XM3A 1TFYA 3OR2B 2ACMA 2JFKA 3SDEA 3A3PB 3HHLA 1KRPA 1IJEB 3DLGB 3RW6A 3PO5A 2AGPA 4TNOA 3HT0A 1T8EA 3A8KA 4MK9A 3US5A 4OLPA 5LMNJ 3BB5A 4C9DA 5C24A 1M1KT 3DRXA 2J0WA 1LW2A 5F8NA 5HL7Q 3UVJA 5K8PA 4R5PB 2YQ0A 2IIHA 4B02A 3EGZA 2HW3A 1LXNA 4C11A 4AD6A 2HGNA 1NSKL 3UE2A 3IP0A 4NCAA 3MUMP 1JLGA 2VKRA 1RTHB 2YX1A 3Q8QB 4UUXA 2E1CA 3CJ0A 2QT7A 4ZS6A 2G13A 3HLUA 1VBYA 4PYDA 2JFDA 2EXUA 1NRKA 2V9KA 5HP1B 1F5AA 2F8MA 2C2KB 2CVEA 5EX0A 3T41A 3UWTA 3PYGA 4Y2CA 2IDLA 3EZ5A 4MK8A 4DFKA 1RE1B 1UFWA 2NZ4A 2D74B 3PIOQ 5J2QA 1U4BA 2R8GA 2UVVA 4C8MA 2XCPA 4K8RA 2CG4A 3NBPB 3R1LA 1S97A 1CJVA 2RD5C 2JSXA 3WX8A 3RAQA 3MR3A 1N56A 3CJSA 5E3CA 4AE5A 2XEXA 3IAM9 1W26A 3U27A 2W2NP 4B3TJ 3W3SA 1Q5VA 2BW7A 4LF7J 1TL1B 3KK1A 1NDPA 1XBWA 1RCOB 3CD5A 4IFYA 4OQJA 1S6QB 1X31C 3IO1A 2XWYA 2K3IA 1Q16B 4DV1F 3GIKA 3B54A 3QIPA 4DR7J 3HXMA 2FQQB 3R7NB 2D9OA 2UUTA 5KG1A 1A6LA 1H2VZ 2QEXS 2DNGA 5E33A 4QPXA 9ATCB 1B64A 5HO4A 1BLUA 3P6YC 3MF5A 4CH7A 1IBKJ 2RJZA 1CLFA 3BKFA 1SUQB 4C8YA 2RHSB 3FRZA 2U2FA 3NXZA 3PX4A 2DPJA 3MI7X 2E5LJ 2IVYA 2O5DA 4O3OA 2VBZA 2WCXA 4WXWA 5ETRA 4DV6F 1LV5A 5KAKA 3QAEA 2OH2A 3RBZA 4FS1A 4BDPA 5B0AA 3NKYA 4YQWA 2KRRA 4USHA 4AL6A 2D3O1 3P49B 1OSCA 4OI2A 2VG6B 2BJ8A 1M5OC 4RW9A 1R31A 4IR1A 3Q2TC 5CHCB 2CPYA 1RISA 3DHWC 3LUYA 1T9TA 3FKBA 2J76E 3R1HA 1NZ8A 5AJ3J 4Q0BB 2V8DA 4DQQA 2XY6A 2E5HA 2NR0A 2FC9A 3ETOA 1LWCB 2FVRA 2Z58B 4O3SA 4DMZA 1T9VA 1TL5A 2VQEF 1YI2S 2GNKA 4LF8F 1KTQA 4ELUA 5C25B 3A8EA 1K0TA 2GVZB 3K5PA 4QJVA 5B0CA 4M5MA 1GAOA 1VRQC 1NXIA 1RTJA 2W8LA 1NEEA 4EU0A 4C7QA 1WWHA 1OMSA 1LW0B 1NLKL 1FX2A 3OFGA 5KG2A 3MTKA 3KUHA 3T9ZA 4IDKB 2MQLA 3H40A 4A8WA 2DGOA 1NK4A 4ID5A 3A4TA 5IT4A 4M5HA 4O3PA 3SQGB 4JV5J 1IBLJ 4K5SA 4AFFA 4AXJA 5KG7A 4LSLA 2YWEA 3FQKA 2B3TB 4TLRA 3PFEA 4CH0S 3IR6B 1NPPA 4EGLA 3BKTA 4I2PB 1T03B 2BJ1A 1K0VA 1U0HB 3MHYA 2HURA 4Q5VA 3KK2A 2CQ1A 4JI8F 3KUGA 3I82A 5KFBA 2R7WA 2R7UA 2Y1IA 1HYSB 1PYOB 1JNZB 3KLEA 3C8YA 3M30B 4ZP7A 4WFNQ 5JMNA 1N5VA 4CH1A 4HI2A 2QL7B 5GADU 4OZ3A 2B8PA 1XK8A 1UW9A 1S10A 3BR8A 1VQ8S 2YNHA 2M5YA 2B4UA 3KLFA 4H4KA 3UW1A 1RAHB 1FERA 4LSZB 4EFAC 4P75A 3KG4A 5DQHA 3NRBA 3B4DA 4PG8A 5I42B 4X4RA 2M4MA 1XR6A 2C2OB 3CIZA 5KG0A 3LO3A 1JKHA 2G0IA 3D3BJ 1UEUA 4PABA 1IKYB 3DU5A 3TJ9A 1FESA 3UDLA 3MMAB 4QCLA 3KLIA 3H5SA 4DSEA 2MYFA 1AZSB 2QL5B 1ZM3A 1YBAA 1S57A 1PJ5A 4C98A 3DC2A 2DGQA 4OZ2A 1FJ7A 2HZVA 1RB0A 2EK1A 4DN9A 2YNGA 4TQRA 1S9GA 4LF4J 1WOPA 2CZVC 1CPZA 2R7TA 3GQCA 1FI4A 1KC8T 2UZAA 4P2FA 3MM9B 4CO3A 3PDNA 3CVKA 4IOAQ 1U8WA 3KJVB 3OSPA 1WG4A 3J7AN 3W8GA 3NL0A 3PIPQ 3K8WA 4OHWA 2VDHA 3EZOA 3H5YA 2VA3A 4JI6F 2QJ3A 1RWUA 2E5JA 1CVJA 4ZPVR 3KHRA 3TAQA 2IRYA 4P52A 2HZAA 3W5XA 4K50A 5A8WB 1HBUB 2CVIA 3CCSS 3D6HB 2OPQA 3VWSA 2VQFJ 4AL5A 1TVRA 3M2VB 1VQOS 1SJ1A 1XTZA 3PM9A 1SJFA 3OL7A 3H4BA 5BR8F 4DZ6A 4KJIA 4X4UA 5D6GA 2DCLA 1RKJA 5B7WA 1T9UA 1Y3KA 1QY7A 5KFRA 1J2VA 4GC7A 2APOA 2BEFA 3RUBL 3RU0A 1EZZB 5D78A 1N54B 3HHDA 3BGOP 1FX4A 2R7RA 3PW2A 1IQTA 1GEHA 2ACYA 4B3RJ 2POKA 3NCQA 4OJ1A 2B51A 5D3GB 5ETSA 1N4LA 1FRLA 4TYBA 1PAEX 3VHQA 3E01A 2IM0A 3GONA 1RYSA 2NXUA 3CO0P 2FJBB 4QIWD 1H73A 4RNNA 2A6MA 1YBUA 5B0DA 2DITA 1V9OA 2QFJA 2F5GA 3UO0A 4QWEA 2RDDA 2GQCA 2QL9B 4M5NA 3MECA 5FD1A 1FK9B 4ED8A 4ECXA 1RAGB 4DV1J 1LFPA 2CPDA 3IG1A 2DHHA 2UVUA 1ZTTA 1TFWA 4DV3J 1C0TA 3PJWA 1AROP 4JI0F 2R7QA 1GMWD 5HJXA 3Q8UA 4CO1A 3PW7A 1RTDB 5GADI 4I7FA 4R0EA 2W01A 1YJ7A 3K5OA 4U95A 4WYLA 1UWAA 4Y00A 4A8OA 2D69A 4YB7A 3DRYA 4Y65A 1KQKA 1OY9A 1SB6A 4ETZA 3DLHA 3CCQS 3CDAA 1RT3A 2B43A 1UEVA 4QR2A 3MFIA 2XC9A 2ATCB 2GJFA 4E2FB 1FDAA 3TZXA 2OD6A 2YQ3A 1HNXJ 3B8HA 5KFTA 3IA0A 1SC1B 1NDCA 2ILZA 1Q8LA 1KWMA 2Y8WA 1N5YA 2YWFA 1VQNS 1BC6A 2P9CA 2HK3A 2LP4A 2HS4A 2VV5A 4QPTA 2VBWA 4BCAA 1YZ7A 2LLZA 3MCOA 4JV2A 2Y3YA 3EXCX 2ERRA 2GAHC 2BV3A 2HEKA 2MMYA 3LALA 3G82A 3CPWR 5IC6B 4O3NA 2C2RA 2DGXA 5FDLB
chains in the Genus database with same CATH topology
1S1WB 2AYBA 3BN4A 2DHXA 3MEDA 2DNZA 4YUDA 5C42A 3GIMA 1G6BA 1SUQA 1X9MA 3MGJA 4KQZA 3CWJA 4O44A 3RTVA 4TN2A 4ILLA 1MW7A 2EFOA 2PA8D 1YGYA 4IH5A 2FGOA 5DG9A 3DM2B 1IR0A 1DQAA 2BACA 1T02A 1D3WA 3PFOA 1TL3B 3IXQA 4RW7B 2AGOA 1KQSR 4IR9A 4LFBF 1UVMA 4UUWA 1K9MT 1T3NA 3O8WA 5GAEU 4EZ9A 1YJ9S 1RJJA 3DLEB 4O23A 1Q53A 4CZCA 2HGLA 4BWJA 5GAGI 2XNRA 2EVZA 2ASJA 4QIEA 5KG3A 1MROB 3J7A1 3UI3A 1Q79A 2C3OA 4DEZA 5IQ6A 2BR0A 2QE5A 3BO3A 5A6WA 1Y4ZB 3KLGB 2B6AB 2IA6A 1ROFA 3UPFA 5BYSA 3VAMA 1GXLA 2ZJPQ 3NLCA 4CI0B 1RTIB 1FXDA 3G6YA 1N6QB 4DBQA 3FZ2A 3TOQA 1S49A 1ZM4A 2OTJS 3I96A 1UJ5A 3M8SA 4K4XA 4MJKA 3FNNA 5DDQC 1GNKA 5L8RC 2LQ5A 3H20A 4CO0A 4J9QA 4F50A 4NRUA 1KN6A 3ICLA 3MM6B 4DS5A 2WB4A 1MMDA 1QE1B 1N32F 1N34F 4PQAA 1OQ3A 1N36F 3THPA 2CRLA 4M5DB 2PC6A 5KG6A 5FDLA 1K8AT 5E41A 1C4CA 2M3DA 3IRWP 1S1WA 3DRSB 4XAKA 2ASDA 1A9NB 4QU7A 1D8ZA 5B08A 3CC4S 3TP2A 4DSFA 2BXJA 4RUAA 2F3JA 2ZKUA 2FUG9 5G0RB 2E29A 2FLOA 3LANA 4R25A 2CQPA 4OIXA 1QAIA 4OJGA 3VCDA 5IZHA 1RT2B 2PD1A 1KTVA 3NMAA 4I6WA 1DARA 4JI4F 5H9FJ 2AJ0A 4KC5A 3H8YA 4ALZA 2KKHA 4E98A 3DLEA 3HI9A 4DF4A 4FYDA 3PW0A 2YNFB 3OVAA 3KMQA 1X5OA 1YRTA 2GHWA 1MROA 1C0UB 3TO8A 1HWIA 3G8TA 4BC9A 4JI7F 1VGYA 4LJMA 3MCSA 3GFZA 2XLKA 4PR6A 2AJ1A 4DX8H 2PT0A 1RGVA 2ZH9A 2KJVA 3M6UA 3OFHA 3KLGA 2ZJRQ 3PW4A 1LWCA 2E5GA 2MPUA 3AJ1A 2LXFA 3SCJE 2XZWA 3DRRB 3CD6S 3CCUS 1FRHA 3ENWA 2VPYB 3I0SB 4MIAA 2P6SA 3BS9A 1N6QA 2GMHA 3OXLA 4EBEA 4A8FA 1FXLA 4C8LA 2HHQA 2J7KA 2EFPA 3CF5Q 3H2LA 2IRUA 1D0EA 3QZ7A 4J9MA 1Y7PA 2L9NA 1QAXA 4EZ6A 2JVRA 2JLGA 3CCRS 3TVZA 2B56A 2PGCA 3H5UA 3ZZRA 4F25A 3OTEA 1TKDA 2RVJA 3MM6A 1XMOF 2HRUA 1OS5A 3NNHA 4AYBD 3IC1A 3W2WA 5HBMB 3V6HA 1G1XA 4RW8A 1YJNS 3GV5B 2CQ2A 1NJIT 4RW4B 3HHLD 2V2KA 4FVCA 1OPZA 4U7CA 2AJ4A 1VC5A 3BGRB 2CPEA 3DOLA 1S1UB 3DHXA 1RT5A 2D3OR 3IR7B 2HHVA 2YTCA 1HQUA 5C25A 4CQ1A 3OV7A 3W7BA 3CMAS 1RT2A 5I3QA 2MKCA 2RQMA 4KGKA 4ECTA 3QJPA 3ZZZA 1SIWB 2PE8A 2PO4A 2RT3A 2QMWA 2BUNA 2DH9A 4WTYA 4XDCA 3H59A 1LKZA 1TP7A 2AD9A 2OMOA 3OL9A 2YNFA 3OSNA 2B0GA 1HNWF 1ZBTA 1XN9A 2ILYA 1C0UA 2GHVC 3FEYB 2BABA 3EUNA 4I0WA 4K4VA 2ZD1B 2KFZA 4CNYA 2UXDF 4JV0A 2MJNA 2XCAA 4Y6IA 5A6PA 1I1GA 2R7SA 3D1OA 3QZ8A 3KLHA 4KTQA 3WDOA 2GA7A 5T41A 1HFEL 3CDUA 3M8QB 3F73A 2B4VA 2BM1A 3BGFA 1X4BA 3DRRA 4YOEA 2Q6CA 4DQSA 4R8UB 7FD1A 1FEHA 3PR5B 4OZLA 4I2QA 1V3ZA 3H4DA 1YTYA 1G2EA 5F3ZA 2E5IA 3PJXA 1Q82T 3IGVA 1KVIA 4NLVA 3RRKA 4ZPAA 5H9EJ 2KVIA 2ZOFA 4UW2A 4ZCIA 1WG5A 3R5CA 4H54A 2FY1A 3HK2A 3LWLA 1SL2A 2DO4A 3UCUP 3W2VB 5IWAF 1FRMA 2ZFHA 3GYXB 3K2YA 5F8GA 2W9BB 4NZ0A 3UD3P 3DI6B 4U6PA 1UJ4A 4OX8A 1M0SA 1VQPS 3TNVA 4ZDNA 1SV5B 4ZVEA 3JTNA 1H2UX 2K7KA 1T03A 4I6AA 5HN0A 4HDGA 1B7FA 2IM2A 1NAQA 3NGKA 4X2BA 4LMZA 2AV5A 2E1MC 3HZEA 4HYKA 3MPVA 1Y0HA 2XGQA 2YKQA 1X4HA 2ALZA 2Q66A 4C0HA 1FRKA 5E0OA 4A8XA 2HFNA 2HLUA 4DL0C 3RB3A 6FDRA 5KFQA 2E66A 2PI4A 4DV0F 3FCHA 5IXUA 2ZD1A 1NHUA 3GV8B 3ZZTA 2IYGA 3CTRA 4WCEQ 3O44A 3UD4P 1ZH5A 2G4BA 3U1LA 4K4TA 2BE2B 3HFKA 1IKXB 3OUYB 2RE1A 3FEZA 2HZCA 3M8QA 3BO2A 2FHMA 4JI2F 1HA1A 3T5LA 3HPOA 1Y5NB 1N33F 4WFXA 3I56S 3HM9A 2H5EA 4IG0B 4IQMA 1DTTB 2CQCA 1M5PC 2M8HA 4G1PA 4N77A 4YB5A 1HNZF 1BY9A 4KFBB 2VG5B 1PILA 1T95A 5HQ8A 1S0NA 4WYWA 2ASLA 2WAQD 3RZAA 3GR1A 1KOOA 4X65F 4K4ZA 2LECA 2W9BA 1JNRB 3GFHA 3CCWA 2HFOA 3DI6A 3EGWB 1Y5LB 2EBEA 2RNEA 3T5KA 1WHWA 4WFBQ 2ADBA 1XR5A 5HMXA 2DR8A 5LJ5Y 2GGPA 2JLFA 2DRAA 1QVFR 1KD1T 3DLKB 4LFCF 4JBCA 4XPEA 3V6JA 2OD4A 4ZKAA 2B7CB 3MR6A 5KFLA 3FZBA 4U67Q 1M5VC 2K3KA 4QYZJ 5I42A 3N01A 3EYZA 3AHPA 1JMTA 2MZQA 3N6NA 3OW2R 3RW7A 1D9AA 1FJGF 1Z2ZA 2VOPA 3OTCA 2Z2MA 2M0GB 4NWBA 4ZCMA 1MNEA 4W90B 1X7VA 4OJ3A 5KFSA 1H38A 3ULHA 4LF5F 1CC7A 2BE2A 1IKXA 2VC0A 1IKYA 2Q1LA 1IXKA 2DISA 3C6UB 4HHJA 2I5JB 4ZPTR 2LA6A 4EEYA 3D5MA 3DFEA 4FPRA 1X9WA 5GVQA 1NNDA 2IC3B 2HLTA 4IG0A 2QSFA 4CO2A 5D8HB 4HL9A 1YRUA 3FSXA 3N0VA 2CFXA 1HBOA 1SXLA 1Y00A 2OAUA 4XPCA 4ETXA 3CJ5A 3KHLA 4KFBA 1KONA 3K5MA 2R8IA 3EPGA 2FLNA 3ZFVA 4YR0A 1Q4RA 1YJUA 4WF9Q 3SDEB 2M70A 5LT5A 4FF2A 3TVKA 3OQ2A 2W8KA 2QV6A 1AW0A 4EUVA 1R0AB 3MMBB 4YDDB 3CIMA 1VI7A 4XO0A 5GAGU 2N7CA 5DM7Q 1NJWA 3GV7B 4GO5X 2ZUGA 1JLCA 2AGQA 1U09A 1U1LA 1NK5A 1MU2B 1U1QA 3PO4A 2FHJA 2QLWA 3CCTA 4LT6A 2IHR1 4GMKA 2KI2A 3S1TA 1V6HA 2J6UA 2GV1A 3LP1A 3TA0A 1WEZA 2E1RA 2IM1A 4ZP6A 4X66F 3DLKA 3RR7A 1BWEA 2CPJA 4B3MF 1DRZA 4TKTA 4Q43A 1H2TZ 5KFKA 2IRXA 3TQ1A 4CT9A 2F9DA 2HFZA 2DR9A 3TI0A 3PRBA 3BDEA 4YEAA 2A3JA 4R0JA 4F4YA 1HQEB 4L3NA 2K8GA 2AQ4A 2ZBCA 4NZ7A 3OXFA 3D28A 2CJ9A 3JTOA 4DV5F 5C24B 3KG0A 4X4VA 1NZAA 2DHAA 5CYJA 4KIAA 1U1RA 4OI0A 2VFRA 3MM9A 3M1VB 3GB0A 2XWXA 1TAUA 4HI1A 3DRPB 4K4WA 2PI5A 3C46A 2BQUA 4NYZA 3DN9A 2MQPA 5EDWA 3QPIA 4OI4A 3C66A 3N6MA 4C11B 3NMRA 1MMLA 2ZKTA