2MYFA

Solution structure of rna recognition motif of a cyclophilin33-like protein from plasmodium falciparum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
GSHMSDNNATDILFVGGIDETIDEKSLYDIFSSFGDIRNIEVPLNMTTKKNRGFAFVEYVEVDDAKHALYNMNNFELNGKRIHVNYSKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RNA recognition motif of a cyclophilin33-like protein from Plasmodium falciparum
rcsb
source organism Plasmodium falciparum
molecule tags Rna binding protein
molecule keywords RRM containing cyclophilin
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2myfA00
3HHNB 1R8HA 1X5SA 2PEHA 5MLCV 2N7CA 5JVGQ 2LEAA 2DIVA 2A3JA 3LQVA 3G8SA 2MQLA 2DGOA 1Q82T 1UAWA 2B0GA 1M5KC 2U1AA 1U1KA 4EGLA 2JRSA 2KXHA 4FXWA 5IM0B 3TYTA 2NZ4A 2MQMA 2OSRA 5DDQC 2DIUA 3UD3P 1YTYA 4RU2A 2RS8A 5LSLA 3R1HA 1QVFR 2D9OA 5GVQA 2XS5A 2MSTA 1PO6A 2GHPA 4Y0FA 1WWHA 2HGLA 1VQKS 4W90B 2L41A 1X0FA 2MMYA 3Q2TC 1RKJA 3L3CA 4IO9Q 4OZ1A 3CCMS 5IQQA 1N8RT 3EGZA 2DHSA 2F9DA 5D77A 2E5HA 2RUGA 3IRWP 2DB1A 2DNYA 2KRBA 1G2EA 2MJNA 4YB1P 5HO4A 2KRRA 2Q79A 5GAGU 2DNZA 2E5GA 1M5PC 1F9FA 2SXLA 1PGZA 3CC2S 2G4BA 4TLQA 2CPFA 3MDFA 3S01A 2OJ3A 1X5PA 1QVGR 1FT8A 2DHAA 1WG1A 3TO8A 4F02A 3VAJA 3US5A 2XNRA 4CQ1A 2MQQA 2LKZA 5JVHQ 5CA5A 3ULHA 3VAIA 1VBZA 3BEGB 3U1MA 4Z2XA 1WEZA 2MZ1A 5DDOC 1WI8A 1URNA 1U6BA 2HYIB 3G9CA 4C4WA 1WELA 4WFBQ 3MXHP 4J5OA 2X1AA 2DNQA 2M52A 1DHMA 2DNOA 2M70A 2CQ2A 4WIIA 2JVOA 3MOJB 2LCWA 2XB2D 2PE8A 3CMAS 2WBRA 2JX2A 2D3OR 2MSSA 1X5OA 3UE2A 3B4DA 1U1MA 3G6ES 1DBDA 2RT3A 2MHNA 5DETA 1OIAA 3CD6S 1NU4A 1UFWA 3J7YU 2MYFA 2DNGA 4W92B 1VBYA 2LXUA 3U1LA 1VQ9S 1OO0B 2N3LA 3G8TA 2LEBA 3CCSS 3VAKA 1Q86T 4UQTA 1P27B 2KN4A 1SXLA 2MQPA 3H2UB 1U1LA 1QM9A 2KG1A 2EK1A 1KQSR 2U2FA 2UP1A 1AUDA 2EVZA 1DZ5A 2KHCA 3SDEB 2KU7A 5BJRA 2OIHA 2YH1A 1FJEB 4PRFA 4U67Q 4WCEQ 3CCJS 2RRAA 1FO1A 2OTLS 1H2VZ 1N88A 1JMTA 1VBXA 1R8PA 2VOPA 2CQIA 5DDRC 4FXVA 2X1FA 2KM8B 2FPHX 3CCES 1X4GA 3CULA 4ERDA 2F3JA 2ZJRQ 1KD1T 3CC4S 2CQHA 3PIOQ 1HL6A 4IOCQ 2O3DA 4TU7A 1VC6A 2CPEA 2MQNA 5CYJA 1XN9A 3MUTP 2ADCA 3I55S 2F9JA 1N52B 4CIOA 1VQPS 3G71S 1YJWS 2CQCA 1U1QA 2RRBA 4WF9Q 3CCQS 2MGZA 1X4DA 3UD4P 2DGXA 2LXIA 2MGZB 3P5TL 1U1NA 2HVZA 5H1SV 2MY8A 1YIJS 1HA1A 3HI9A 2DNNA 4IUFA 1H2UX 2ERRA 3THPA 2DITA 1WG4A 3N9UC 3UCGA 2MKHA 1WHVA 2CQ3A 2MB0B 2E5JA 1X4FA 2FC9A 3VAHA 1YJ9S 5FJ4A 2YWKA 2CQ1A 2G0CA 2LA4A 2N3OA 2N82B 3VALA 2DGUA 3B4MA 3MUVP 1WHYA 1HD0A 1FJ7A 3EX7B 5GADU 3FEYB 2K8GA 1WG5A 2DH7A 2MZSA 1FJCA 2CQBA 2MZQA 2I38A 2OTJS 4YOEA 1L3KA 3VF0B 2DHXA 1X4EA 3SMZA 2D9PA 2EK6A 2ADBA 2DISA 2LQ5A 1WEXA 4PKDB 3BO3A 2DO4A 2G1DA 2MQOA 4BS2A 4QU6A 3MURP 3R27A 2ZJPQ 2DNMA 1P1TA 2LMIA 2DNKA 2MKJA 2FY1A 3JB9k 2DO0A 2MY7A 1WEYA 3J7ZT 2DH9A 3NNCA 2DK2A 1SJQA 2MKSA 2J0QD 2NLWA 2MXYA 2CQGA 4F25A 3CCVS 1X4HA 3I56S 3VAGA 1VQOS 4ZKAA 2MKCA 2MZRA 5LJ5Y 1Q7YT 3IWNC 2MKIA 1W2BR 3TP2A 2RQCA 1K73T 2JWNA 1JJ4A 2V94A 2M7SA 4LJMA 3Q2SC 3BO4A 1X4CA 1WF0A 4LIRA 1WHXA 1X4AA 1M5VC 2DNPA 3R1LA 1OPIA 2RS2A 4UY8T 1U1PA 4IOAQ 1KC8T 1OWXA 1K8AT 2CPDA 2DHGA 2DGQA 3SDEA 2M9KA 3UWTA 1S79A 2L9WA 1KOOA 2E5IA 1M90T 1VQ5S 2CQ4A 2MPUA 5D78A 3H2VE 4LMZA 2HGMA 2L08A 3DXBA 1ZH5A 1D8ZA 2X1GA 3MI7X 3P3DA 1VQMS 3S8SA 3BO2A 2M2BA 1RK8A 2GO9A 3EGNA 3CMES 1VQ6S 3UCUP 4CH0S 1UP1A 2M0GB 2CPZA 2RVJA 2YH0A 3NNHA 2FC8A 2KXFA 2LYVA 4F26A 3MD1A 1NJIT 2XNQA 4TU8A 3PIPQ 3NS6A 3G4SS 1U6FA 3G96A 2XS2A 5LSOA 2CPHA 3RW7A 4WKRA 2QFJA 4YUDA 2KG0A 3NMRA 2E44A 2BZ2A 1N54B 1VQ8S 2MZTA 3RW6A 3ZZZA 1U2FA 1H6KX 2CPXA 3NS5A 2DGTA 3UCZP 2KFYA 4QQBA 5DM7Q 4A8XA 2VOOA 2LECA 1HD1A 4TU9A 2MKKA 2VONA 5LXRA 4QPTA 1YJNS 2KM8C 1JJHA 1VC0A 2HZCA 1IQTA 3S6EA 2CQDA 3CTRA 2MZJA 4CH1A 4P6QA 3D2WA 2DNLA 3V4MA 1X4BA 1WI6A 1VQ7S 3CPWR 3MUMP 1UW4A 2CPJA 5LJ3Y 2KYXA 5DDPC 5DM6Q 2KI2A 5EN1A 2DGSA 2X1BA 4M5DB 2M8HA 1H2TZ 1NO8A 1O0PA 5HL7Q 2M4MA 1JJ2R 1D9AA 2CQPA 3P49B 3THTA 2AYEA 1ZZNA 2J76E 4V19X 2DH8A 3CF5Q 3LPYA 1WTBA 5IM0A 1U1OA 3OW2R 1KOHA 1FHTA 1U1RA 2M88A 2CPIA 3S7RA 2AYMA 4QU7A 2ZJQQ 1VQLS 3P6YC 1K9MT 4PR6A 2I2YA 2QEXS 1A9NB 2M8DB 3NNAA 3CCLS 2XSFA 2KXNB 4OZ0A 1WHWA 1SJFA 5ITHA 1YWXA 2RNEA 2OSQA 3BS9A 2YTCA 5GAHU 4C7QA 3CCRS 2KT5A 1SJ4P 3DLLQ 1M1KT 1B7FA 2QA4S 2JVRA 2AYBA 1BY9A 2HGNA 3CC7S 4Y00A 1FNXH 2RQ4A 2MJUA 2J0SD 1WF1A 1YITS 5GAEU 3CCUS 3SXLA 2K3KA 4ED5A 1SJ3P 2AYGA 1ZZFA 3VAMA 1M5OC 1DRZA 2KH9A 2VODA 2CPYA 1S72S 2DGWA 1CVJA 5GMKa 2J8AA 3K0JA 2CQ0A 4C0OC 1SJRA 1YI2S 2LA6A 2BOPA 3CUNA 1VQNS 3CXCR 2CJKA 5IFMA 2DNRA 1YHQS 5CXTA 1VC5A 1WF2A 1Q81T 2AD9A 2XS7A 1X5TA 2DGVA 2DNHA 2RU3A 3ZZYA 2FHOB 5LXYA 3VAFA 2KVIA 3MD3A 3FEXB 1A7GE 4WFNQ 2YKAA 1VQ4S 4WFAQ 1FXLA
chains in the Genus database with same CATH superfamily
2CJQA 3IM8A 3FKBA 4NRUA 3DN9A 1R8HA 2N7YA 3C3LA 4E98A 3KWMA 1KN6A 5MLCV 1NK6A 1RTHB 4KY3A 1R8AA 3TQ1A 1R31A 5KT6A 2E1CA 1UAWA 4JI7J 3QJLA 4NEZA 2ALZA 2B5JA 2XMWA 2JSXA 3F56A 2C3OA 1XMQJ 1NCLA 1V6HA 4DFKA 2AJ1A 3IAM9 2JRSA 3A8JA 4OI1A 1M1GA 3UN5A 2V34A 5LMNJ 2UXDJ 4C97A 5J2MB 3NY0A 2FZGB 3JQJA 3JAMY 3DYAB 1T05A 4YHHF 2FVPA 1YTYA 1WC4A 1U25A 2XYGB 4CLWA 3OUYB 2RS8A 2W8KA 3O1LA 2P6TA 1HWUA 4O44A 1RYRA 4LF8J 2J8SA 1N5YB 4F2RA 2PGCA 5GVQA 4QWEA 1FRHA 3BH7B 4WZQA 2CVIA 5H9EK 3CB4A 2J6TA 5AE3A 1FEEA 1WDDA 4OYWA 4X2BA 4M63A 3QBCA 3NG8A 3HP6A 5C25B 1O51A 1TL1B 3EJMA 4U96A 4DPYA 3B54A 3W9IA 3GV8B 3ITHB 1X0FA 3A3OB 3JTPA 2ZZNA 4OHVA 2F5GA 2IVMA 5IT9U 4IO9Q 1U4BA 2QLFB 1ZM9A 3CCMS 1TQLA 1JLBB 2OEMA 1XMOJ 3KHLA 1FE4A 1RU1A 4DR6F 2A1BA 2WRMA 4OZ5A 1EETB 4P52A 4K0KF 1HNVA 1CQNA 1N6QA 1J5EJ 2HMIB 1FEHA 2L48A 2H5EA 2ILZA 3MR3A 3L3CA 3GFXA 4JUZA 2HRYA 5IT0A 2OPPB 5KG1A 2DB1A 3PEJA 1EARA 1V3RA 1LW0A 3MR2A 1D09B 5L1LA 2FVQA 4C9DA 1K0VA 4B9LA 5D0EA 1VI7A 2HHHJ 1B7YB 5GAGU 1M5PC 2E5GA 4HT5A 4I69A 2SXLA 4YN3B 3VGVA 1RHUB 3A13A 4ECXA 2XLKA 1TKXB 2VG6B 4LF2A 4YB5A 1Z2ZA 2CPFA 5DS7A 5AT1B 4K59A 1UZHA 2GQQA 4FKYA 3ZTSA 1FVSA 5HMZA 3KTQA 5L8RC 3HFZB 4I1TA 4OYOA 2XSJB 1WG1A 2W01A 5KFGA 2VD3A 2IDLA 3C16B 3VAJA 3AJDA 4ID8A 4HHUA 5DG9A 1FDAA 2BXJA 1YKWA 4ECYA 3W2WB 5JVHQ 5CA5A 1T03B 1BD6A 3GJSB 5ETKA 4TXSA 1GT8A 2GHVC 4PG6A 5E2QA 1VBZA 2GJFA 4WP9A 2QL5B 4LVNP 3OTBA 3UW1A 4DR3J 4JI8F 2C1EB 4C4WA 3GZ7A 4NXNJ 1V5IB 4GC6A 1C1BA 1T11A 1LWEB 5D6GA 1ULRA 1Q16B 2Z2ZA 4J5OA 2YNGB 2XULA 4WWSA 1AZSA 1HHSA 1DHMA 5HVFA 3I5CA 2NPFA 2M70A 3LANA 1HQUA 2JVOA 4NOHA 1S1VA 4Y28C 4ZCMA 5LMNF 2V9KA 1FD8A 4QYZJ 1N33J 1TV6A 1LNQA 3KMQA 2PE8A 2WW8A 3FFIB 3KK1B 1HHQA 3IN5A 3CMAS 1XMQF 3RRGA 4I7FA 4NRTA 1MG7A 3AJ1A 2HK3A 1GTEA 3B4DA 2VPZB 3ILIA 3PEHA 3DDIA 6FDRA 2GIFA 2FJVA 1RT6A 2MHNA 3JYTB 3DOKA 2K7KA 2PEBA 4ETXA 4PQUB 5KFKA 2HHVA 1NRKA 1Q8LA 4AUKA 4OFZA 4Z37A 1HNWJ 4CLUA 4DSFA 2KT3A 5I4MA 3U1LA 4YY3J 2ZZMA 1ITPA 4JI2J 1JLGB 1T05B 5F9NA 1GK8A 2UXCF 1HNZJ 1B0TA 3M32A 3G82A 4CI0B 3TX8A 3VAKA 4DV5F 3DLEB 3FJ2A 3VCDA 3D1QA 3M9OB 3EDRB 4ZP8A 4LSLB 3OVBA 2UXBF 1S9EA 1QE1A 2BJ9A 1HNIA 1PC4A 2V63A 2Z57B 4X4VA 1QM9A 2H9ZA 1S0OA 2VFTA 2W7AA 4OHZA 3CD0A 3VQSA 3RJMB 2HHPA 1OJ4A 3R5CA 1AUDA 3M4XA 1E6VB 3ZZTA 3KMSA 1HI8A 3OR1B 2OIHA 2YH1A 3ILOA 5FLXU 3KJNB 2XSJA 4LSNB 3OL6A 2ZH7A 1NPPA 3OBIA 5HMWA 2OTLS 1FRXA 4RW6B 4DR6J 2FJEB 2P8IA 1K0TA 1HPZA 4PAAA 1JMTA 2IA6A 3KUHA 2B8QA 2DCUB 3SFUA 3DOMB 2PSZA 4ZJLA 3R9LA 2CQIA 4K5RA 4MKVA 4YR3A 1YVFA 2KYZA 3H7HB 4NE9C 4ZHRB 2QJ3A 1JXEA 1XR5A 3WHIA 2BJ7A 2AMCB 2CKWA 3MHYA 1G3OA 3OJSA 3MMAA 3OL7A 2FVRA 2F1FA 1HL6A 3GB0A 1VC6A 4TU7A 2PI4A 1M0SA 2QV6A 5IS2A 3KNAA 1FRIA 4RPFA 3SFGA 1XN9A 4RUBA 1BWEA 4PWWA 3MEDA 4F3MA 4CLTA 4P72A 8ATCB 3OV7A 1PILA 3FBEA 2ADCA 2FY8A 4ZPTR 3ZXWA 1FK9A 4NLSA 5DQHA 5J1NA 1S7HA 3CCQS 4FYXB 3ETOA 1NPKA 2POKA 4K7QA 3KK2A 2HHQA 1SQGA 2DT9A 4MTPA 4U8YA 1RCXB 5HROB 5E3PA 3OTOF 5D4PA 2MGZB 3TARA 2IY5B 5AJ3F 1FKPA 4M1KA 5K8PA 2Q6BA 3CJKB 1TAUA 1QAXA 4X66J 1N6QB 4DU8A 2RF2A 3CDUA 4NXNF 5H1SV 2MY8A 3UD5A 4H54A 1RT6B 4LF5F 1UEVA 1C2PA 4MK9A 3TUIC 1W26A 1N5YA 2DNNA 4ZIVA 4PWDA 4IUFA 4NLYA 2ERRA 2GZOA 3THPA 3NMAA 4NLPA 1IBMF 1S77D 2DITA 2E9RX 3WC0A 5LT5A 2HVIA 3N9UC 3MM5B 1C1BB 4B3TF 4WE1A 3UCGA 3W2VB 3D6TB 2OMOA 1WHVA 3MCMA 5CZVA 4MKAA 2ZH9A 4RWWA 3Q24A 2E5JA 2MB0B 1UJ4A 5D3GA 1VK3A 1UVMA 4C0HA 3TUJC 2W2QP 3TZYA 2J6SA 1X4FA 3K8WA 3E2EA 4MYTA 3DLEA 2FC9A 2V8HA 2VFSA 3I4PA 2P5VA 2VG5B 3LGHA 4IFVA 4YDDB 1VRUA 2WVBA 3VAHA 4EEYA 1IN0A 2FHJA 5FJ4A 4DPWA 2EFQA 4EU0A 5C24A 3D6HB 1HNXJ 3HX9A 1NK0A 2V8GA 3VALA 2Z2YB 3B4MA 1HFEL 1LW2A 1RP5A 1FERA 4C48A 5JMNA 3Q8VA 1HNWF 4G3IA 1TK8A 4JI0J 1D9FA 2IC3A 3ILLA 3A3NB 1WHYA 2XGQA 1UVIA 3CJ5A 2DY9A 4ZCLA 5C5JA 5GADU 3FEYB 2K8GA 1WC6A 2PD1A 3GFYA 3H90A 2DH7A 1T3OA 3W5ZA 4FF3A 1QD1A 3K8VA 4N76A 1JLGA 3HHLC 3KLEB 5J1EA 3VF0B 2DHXA 3M7VA 3C6UA 3GR1A 3IM9A 3LPEA 2D9PA 2ADBA 2A2CA 2VUGA 3FMBA 1BQMA 1T02A 3W66A 4F0KA 1RUSA 5C42B 4J9MA 3DOLA 1S6UA 4DJBA 4PKDB 3IWXA 4NLQA 1IJFB 1SH2A 2HLTA 4NCAA 1P1TA 4NYPA 1SI9A 2DNKA 2IRUA 1ACMB 1Y10A 4L6V3 4DN9A 1RU2A 5KFFA 4DFMA 3POTB 3JB9k 3DGPA 3K58A 1EP4B 4LQ9A 1QLNA 4X4UA 4NI2B 4E0DA 1FVQA 3DLHA 2MKSA 1HNVB 3L7PA 4F25A 3CCVS 2HMIA 1IVZA 4DUZJ 4EBDA 3AOCA 2MZRA 1LW0B 2R4FA 1RKIA 4C3KA 2DXDA 2IM3A 3WC2A 1RI7A 1U0SA 2H48B 1TVRB 2QGFB 2K06A 5CYQB 2OPRA 2WCXA 2JLGA 1X9MA 1K73T 2UU9F 2ZM6F 5G0RA 2UUAF 2DRDA 1H98A 2F8HA 1RWKB 4DFJA 3J81U 1WTFA 4Y2MA 3BBBA 4DL7A 3HHLD 1BC6A 4KHPJ 1WF0A 1WHXA 1MN9A 1J27A 4O4RA 2VJVA 1FXRA 2QA1A 1NLKL 2RS2A 4CM2A 4UY8T 4Q2LA 3HT0A 1U1PA 4LFAF 1T9TA 3TUPA 4KYZA 4OYXA 2A6OA 1KC8T 1K8AT 4TY8B 1I6JA 2UUBF 1KS2A 5KFPA 2DD8S 2AJ0A 5KG3A 3H25A 4JI1F 3G8QA 3ISND 3EYZA 3I31A 3DRRA 4DEZA 4DV3J 3DM2A 1TL7A 2UUTA 4JV5F 1H73A 2J0XA 2VPXB 4X4QA 2R7RA 5HK4A 4DR3F 4DQSA 1NEEA 1KOOA 2KL8A 2Q3PA 3NWGA 4A8SA 2DJWA 3MM9A 2G2ZA 1WKJA 3AB2B 2KTQA 3A8IA 1P6TA 1SL0A 5HP1B 5G4DA 1C0TA 4OIXA 3Q8SB 2VA3A 4ID5B 2CNKB 1UZDA 2MLZA 4OI6A 4O0NA 2GGPB 3JQMA 1UW9A 4A47A 3DHWC 1J2VA 2BE2B 3EZ5A 2IM2A 3BO2A 1UVJA 4J37A 1KRPA 2F4VF 1SUQA 5I3QA 4F36A 5KT3A 3TW0A 1H3DA 3CMES 3IAS9 2DCLA 3DLBA 3MEKA 1UP1A 1D8YA 2JEGA 4NLGA 1RXOB 1RT1B 1HARA 2YH0A 4LRAA 2XMAA 3KYLA 1S9GB 2KXFA 4DL2A 2PT0A 2LYVA 5JXSA 4NI2A 4NLVA 4NXMF 2O67A 1FDNA 2XNQA 4TU8A 2X51A 2P6SA 3D3BJ 4ALZA 1UWBB 5D4NA 3MF5A 3PZPA 3FUYA 5CAAA 1EHWA 5ETLA 4YR0A 2E44A 1N54B 4F2SA 3DXSX 2RQMA 2MZTA 4DQRA 1JK9B 1RT1A 4WTYA 3WX8A 1U48A 4I6YA 3TEGA 3ZZZA 1HNIB 1U2FA 3JSBA 2CZVC 3NS5A 3QYYA 3NLCA 4RKUC 5KFDA 2UXBJ 1S1WB 2DGTA 4OV1A 3UN2A 4YEAA 4XPEA 3C15B 4P2SA 4Y2KA 1N4LA 1U24A 4DG1B 1Q5YA 4QQBA 1HD1A 3K5NA 2W2PP 2AF6A 2ATCB 4TN2A 3LWLA 5KAKA 1TK0A 4DU7A 4PYAA 1F5BA 2VBYA 2B6AA 5LXRA 2GMLA 1YJNS 2UUAJ 2W2NP 1NMEB 3NGDA 2GMJA 3HHLA 3S6EA 3D66A 1T9WA 4QJVA 4ZVQB 4LRFA 4K50A 1F3FA 4NX9A 1N5SA 1S1UB 3NOGA 3HMJG 3HT3A 4C8YA 1C4AA 2XY7A 3PJ9A 5H9FJ 5KFVA 3V6DB 2CG8A 4NLRA 2ZDPA 2QZ8A 5CHCB 1HW8A 1RT3A 3QIPB 1KP6A 3BSOA 2UVRA 1R0AB 2ABYA 3VVTA 4J9VA 1YZ6A 3NBPA 3VQTA 4FKXA 2KYXA 2G1HA 4KHRA 3UPFA 4F4AA 2GS8A 5DM6Q 4QWAA 4CO5A 3KLIB 1S1TB 1H2TZ 2WB1D 4XDCA 4DV7J 3I82A 1I3OB 1JXVA 1N36J 1CULA 3V81B 3VR1A 1C0UB 1TR0A 4OZJA 5K20B 4LF4J 4U7CA 4F4WA 1XNQJ 3G2XA 1SJ1A 3K5LA 2J76E 2FLNA 4V19X 2FVCA 1CJVA 3IP0A 3WZ0A 2HS4A 3I0RB 4C3MA 3LPYA 5DGAA 1ELOA 3NRBA 1LK5A 2CZ4A 1S1TA 5CD4A 1I94J 2E66A 2YKMA 5GMEA 1MLAA 3S7RA 1RQ0A 2B5JB 2ZC4A 2IVYA 4ZPBA 3NXZA 2NQPA 1QJHA 2AYMA 3D0HE 2X3DA 2C2RA 2Y8WA 1XERA 4IH7A 4LFCJ 3K2YA 2JLEA 1PCAA 1MWYA 4HHJA 2I2YA 4Y2AA 3UNYA 2ZDOA 2C22A 2Q66A 4OX9J 2WHOA 2I6WA 2Q6CA 5GMDA 4IYQA 5T14A 4ZP9A 3DNCA 1NJZA 4OZ0A 3BGUA 1YWXA 2RNEA 4K0KJ 5EGYA 3FCVA 4DCOB 2BJ1A 2KT5A 3POTA 2ILYA 1VMBA 4C98A 2J7WA 4CLPA 5K8OA 3PYGA 3SQGA 4W4MA 1UFLA 2JVRA 4NMLA 1PSDA 1ZA2B 2B7BB 2D41A 4Y00A 2ZVIA 4LSZB 2XY5A 1NM2A 3N6NA 4DV2J 4ZVHA 2OLWA 1VQSA 3EGWB 3KLFA 2DY1A 1JQGA 5E3CA 4ECQA 4EI2A 3BF4A 2VPWB 4JYAJ 2K3KA 1RWMB 2B6AB 4B9UA 2QMXA 4RNHA 4LBIA 1G6BA 4O4GB 3C2PA 1DRZA 2HK2A 3F41A 2CDQA 4X4SA 1BMQB 3TZXA 2VZ9A 1C4CA 4RX6A 4KPCA 3GJTB 3RG6A 5M2PA 1WKKA 2CPYA 1RWXB 3DHXA 3OFFA 5EHHA 2DGWA 4IG3B 2BJDA 2OD4A 5B08A 7FD1A 1CVJA 3EZOA 1RE1B 3IMQJ 3K0JA 4DSIA 2YKPA 3EUNA 2CQ0A 3MCSA 3E01A 1BQNB 1SJRA 4ED4A 4YQWA 5IT4A 4JI4F 3LGMA 1IQZA 3J7AN 1FRLA 2NS1B 4NLOA 3UO0A 3LP1A 1IR0A 3CXCR 2CJKA 2DNRA 2J9CA 4P75A 2R8KA 4J9NA 4CLLA 2DKOB 2OHDA 1BLUA 1Z4UA 2BBEA 3OXGA 4BHQA 3OHBA 3WBZA 4ILLA 4KB7A 5EWGA 3DRPB 4P2FA 3MMAB 4DV1J 4DV7F 2HVDA 2HQIA 1TKZA 3FC9A 3R5GA 3TQEA 4EO6A 1H74A 1RWPB 4A8FA 4ILMA 1MROA 2KZMA 1XWLA 4KJIA 5ETTA 3M2VA 3W3SA 5DO2A 1RAFB 3FEXB 1NPRA 2JFKA 1XQIA 1RT3B 2J5AA 2YKAA 2UV8A 3UDLA 3D67A 2LFVA 1LWFB 2RU9A 3M9NB 4UY85 4W90B 3CCZA 4UOFA 3HJFA 2JOQA 2ZEJA 3PVXA 1N34J 5E3RA 2OPQA 2UU9J 5ETQA 1DQ8A 2IJNA 2ASJA 2X7IA 1OPZA 4QR0A 4KT0C 2B43A 1RHJB 2NREA 4WU2A 4DV0F 4DR1J 3LP2A 3LP0A 3G8SA 2BKPA 4D3GA 4KAIA 1Q82T 2BMBA 3OL8A 4LF7J 3GE9A 1UA0A 4ICLA 2R9LA 4DV4F 1T9YA 3M9MB 2VBZA 1HBOA 1RT2A 1YRUA 4PG5A 4GKJJ 1N33F 2KXHA 2HIYA 4LR8A 1TKTB 2VQEJ 5IM0B 5ADZA 3TYTA 5RUBA 3RAQA 2MQMA 1IUJA 1OYDA 4RW6A 4YB7A 5D3GB 1TAQA 4KQZA 1KTQA 3L4BC 4YY3F 1T03A 2KFZA 2YNIA 2H65B 5LSLA 3R1HA 3I0SA 3W65A 1CS4A 4DQPA 2W4CA 2MSTA 5F8HA 3SSRA 4RBVA 1PO6A 3BDEA 2CYYA 1WWHA 3MEGA 4PG8A 3KHHA 3R7NB 1YSJA 1VQKS 2RSQA 3PHEA 3D7SB 2AEFA 3FBCA 2QLJB 3OVSA 3EICA 4M5IA 3RZAA 2HURA 2JC1A 1QUVA 2Q43A 3KFWX 2BE7D 3PNIA 4C0BA 4JI6J 1SB6A 3DI6B 4CRJA 3ZNJ1 2BDPA 3O2IA 1KLMA 4KV8B 4R5PB 1OMSA 4DPOA 2K7JA 1VRQC 2J9EA 2XMJA 2OFHX 4J91A 4NZ7A 4OZ1A 1GH8A 1JLAB 1PYSB 3HCXA 5F8GA 3IBFB 4AL5A 2HRTA 5I3UA 1S4EA 5DRKA 2A18A 1JLQA 1DLOA 5D4OA 1CJTB 5L1KA 2ZBIA 2DHSA 1RWUA 4OI3A 5AXNA 2E5LJ 4ZPCA 4EUVA 1FTRA 2UUCF 1OQ6A 3QWUA 2E5HA 3FEZA 3OFEA 1UEKA 1AYEA 1VS3A 1LKZA 2YBVA 4PXCA 3IRWP 2LQBA 3ET6A 4G1QB 4CTAA 1NK9A 2KRBA 1G2EA 5HQ8A 4A8KA 1YQHA 1KQGB 1JLAA 4LREA 1FKOB 1GX6A 2ROEA 3GP9A 2CRLA 1VRTB 2KRRA 2YQ3A 4DUYJ 4ED3A 2CJ9A 4Q43A 1PGZA 2XM3A 2G4BA 4TLQA 2AZ1A 3BSCA 3GYGA 1S5ZA 2JLFA 2W24A 3PKMA 3KLHA 5J2QA 2C2NA 1H38A 1X5PA 2K3IA 3HXMA 1WSVA 1IBKJ 2DHAA 3PFEA 2Y3YA 4A46A 3Q83A 2HAFA 1RACB 2XNRA 3HSJA 4CQ1A 1SL1A 4IRCA 2LKZA 2B8PA 2XCAA 1TP7A 5KT7A 3L09A 4UTGA 3H5XA 3VAIA 1L5UA 1M5HA 5M2RA 2NUHA 5MAOA 2EI5A 1TUGB 3H5SA 1Y4ZB 4IDKA 5B7WA 1T7PA 3KXDA 3OPKA 5EX3A 3MMJA 1BXNA 1NJWA 4PUOA 4B3RF 1U47A 2E7VA 3CMQA 1UVNA 4P73A 1U8WA 2ZHAA 4OI4A 3NOCA 2XI2A 4WFBQ 1RTZA 3MXHP 5HN0A 2YNIB 3TVKA 3PRDA 4DSJA 2Y1RI 3D28A 4P9SA 3TJ8A 1XNQF 4V1Ak 2CQ2A 1OY6A 4IDKB 4LBPA 1YZ7A 1TFWA 2LCWA 4Q7AA 1FDDA 3CVKA 3ENQA 2OPSA 1EP4A 1F1BB 2V68A 1FD2A 1LOUA 3VZHA 3Q8PB 2WBRA 2GAGC 4KHMA 4Y2IA 3KK1A 2APOA 2Y8YA 3FDSA 1VR6A 4G65A 1Q5VA 1X5OA 4ANEA 2NCKL 3V4IB 1U1MA 3G6ES 3OR1A 4OHWA 4JV0A 3AOAA 2AV5A 4HHHA 4O4GA 3CD6S 2Y1LB 3J7YU 3EVOA 1U7LA 4JI0F 5EWFA 4CO1A 4GO7X 1LEOA 3M8QA 3IR6B 3UDVA 2MYFA 5IV3A 4W92B 2VASA 1VBYA 1FKPB 2LLZA 3K17A 2LEBA 4PABA 2FQQB 2NXUA 4TYBA 1LWEA 4WTOB 4USKA 3PV8A 2C3UA 3ET6B 4NA2A 4OLPA 1IWAA 2A6MA 4MIAA 3CJSA 1P27B 2XGPA 2IYIA 3GLJA 4K8RA 4ELTA 4AQYF 3QMQA 2V0NA 2MQPA 1WJ9A 3H2UB 3FQKA 2XHWA 2R2SA 2HHWA 3DU6A 1EETA 2NXCA 2KG1A 1VYAA 5L38A 1PYOB 5KG7A 1OS5A 2IPOB 2UP1A 1LWXA 5T41A 3HK2A 2VDIA 3R5AA 2XCPA 3BYPA 4LFBF 1KLMB 2YVSA 3BGRB 4KV8A 3SDEB 3PW7A 2KU7A 3RB3A 1FJEB 1UWBA 3H4BA 3HVRA 4U67Q 2XYHB 1H2VZ 3HHKA 2ZH6A 1MU2A 1XJWB 5THWA 5KG6A 2R2RA 3G6VA 2IDEA 2HG4A 2X3GA 1CJKA 1JLFA 3O8WA 1WC3A 3FBBA 3KG4A 1GMVA 2X1FA 4FXVA 3IA0A 1UMJA 3Q89A 2OGUA 4KKOA 2KM8B 3CCES 2W9AA 3RRHA 2AEMA 1CC8A 3BV8A 1JKHB 2FZKB 3N6MA 2QRRA 3TNVA 2HSEB 2ZJRQ 4F4XA 2FJXA 3PIOQ 2HQFA 3QRPA 4KO0B 5D0RA 1FF2A 3A8EA 4N7TA 2FB0A 1KLNA 3MMBA 4PG4A 2D3UA 3BBFA 1FXDA 3I55S 1TL5A 1VQPS 3E01B 1H7XA 1NB2A 1S99A 2B9EA 1JLBA 2CQCA 2RRBA 2YQ1A 4TKTA 3UFCX 2MGZA 1X4DA 4ECUA 1SL2A 1KTVA 1SKRA 3AQOA 4JI4J 4ZVRB 3V2UC 3KK2B 2DR7A 1FFSB 4P74A 5HMYA 2DHHA 3DGVA 5F9LA 5EDWA 1FRMA 4X4RA 5F8JA 2P9GA 1AUSL 2HVZA 4OLOA 3WX4A 2QIFA 1EKSA 1ZOTA 1O6XA 3M1VB 3GIKA 1WC1A 4O0IA 3BPSP 5T7LA 1RHMB 1XR6A 1YJVA 1WORA 3H42A 2QLXA 4LFAJ 4TY8A 2RE1A 4O3OA 1JLCA 5AE2A 2V2VA 4YHHJ 2MKHA 1FRKA 1V3ZA 2V2KA 1F0XA 2W9BB 3EPGA 3PKYA 3HDSA 1I1GA 2CJXB 3HZGA 3PO4A 2R7TA 2I0XA 4XIUA 1B99A 1IBMJ 3VVUA 4JV5J 3MPVA 3M6WA 4IQMA 2OPRB 5GAHI 4CO0A 4TVAB 1UJ6A 3ZTQA 5G0RB 1IKYA 3LP1B 4B08A 3Q8RB 2QA2A 2XY6A 4LF5J 3K5PA 2N3OA 4LF8F 1L3UA 4I67A 3B82A 2DGUA 3MWBA 1S59A 4CM0A 4FF2A 1B0VA 3BQ1A 1RAIB 2D69A 2JZ5A 1BQNA 1HD0A 3R8YA 1NH8A 3TVZA 4ZPDA 2ZBRA 1MW7A 2Z30B 4RU9A 4CCHA 4DR2F 2D7SA 4LIWA 4MK7A 4XDDA 3NCRA 4BC7A 4C11A 4YOEA 2YPYA 1NHVA 4DXLA 2O01C 4EK2A 2XC9A 1CS4B 4TNOA 3GG0A 3MAHA 3SMZA 4K4SA 2R7VA 2JJ4D 2NPIA 1FFGB 2FIUA 1CJVB 3HKWA 2DISA 3BREA 1BQMB 1WEXA 4LFBJ 2EC2A 3BN4A 2MQOA 3L9ZA 3J81Y 4A8YA 1S9FA 3GPAA 3DC2A 3MURP 3MM8A 4OYMA 2DNMA 2ZD1A 5D4LA 4U6PA 3IR5B 3FRZA 2ZZTA 3S1TA 2FY1A 4QBUA 2DO0A 2MY7A 2I9SA 5A0YA 3T6JA 3PX6A 1WEYA 4N41A 1NXIA 1R27B 3R97A 1YBAA 4GKKF 2DK2A 1SJQA 4L76A 9ATCB 2NLWA 4HI1A 1TL3B 3ITHA 3VAGA 3BR9A 2JL9A 3W7BA 5I42B 8AT1B 2VPYB 4HTIA 4ZCIA 2UUCJ 1FNOA 4QOTA 4LF4F 2MKIA 3KDOA 2BANA 2YKNB 1REGX 5DZ7A 2JWNA 1IBKF 5AXLA 2PA3A 2OH2A 2GC8A 2Z0GA 3GJRB 3HVWA 1S48A 1Q53A 4B9VA 1KEKA 1X60A 3RUBL 2G2OA 3O6QA 2ZH2A 1X4CA 1WD6A 4LIRA 1I94F 4FNIA 5HJXA 1UPPA 3GSIA 3MPUB 4USVA 4XPCA 2ZM6J 1RBLA 2YKNA 3JTOA 3SZ2A 2F4FA 2WVCA 1Q79A 3PXGa 4DQQA 5CYMB 1OWXA 2M5YA 3RB0A 1D9DA 3N4WA 1KDNA 1Y3JA 4GVBB 2JDJA 4A8OA 3OL9A 1VJQA 2DGQA 4DR7J 1E6YA 3QJJA 1S9GA 1KSPA 4L3NA 1JJCB 3UWTA 2R8JA 5FLXY 2L9WA 3MPWA 1IBLF 4LFCF 2HW3A 2R7WA 1D1UA 2E5IA 2MDAA 1SBRA 4M8LA 1Q78A 2G13A 2ZKUA 5A8KA 3BQ0A 3FBFA 3K57A 1M90T 1V5VA 2MPUA 1T94A 1WOSA 4Z7CA 2UXCJ 4MK8A 1OQ3A 2HGMA 3LGNA 1RWNB 5FDLB 3W5XA 2K2PA 4WU3A 1U49A 3CJTA 1GQEA 1UETA 3HVTA 3MI7X 4RNNA 1VQMS 4IH6A 4K2XA 2C2KB 3LH2S 5E5NA 4HKQA 5A6PA 4ID5A 4QIVA 5SUHA 4B3OA 2GIQA 4PPZA 4OX8A 3M30B 1IM6A 4USJC 3AAWB 3EM1A 2M2BA 4NL5A 2N4CA 4DG1A 4J9OA 1A0OB 4Y34A 2YKQA 1PJ7A 1S0MA 2HNDB 4F8RA 5B0EA 1B70B 2QO3A 3R5BA 4HL9A 2W4PA 3GR0A 4DR2J 3UCUP 4PXEA 2RVJA 2MQ8A 2W8LA 4UUWA 3KUEA 3MD1A 3MM7A 3DM2B 2BVZA 2V8VA 2ZH4A 4WFZA 3PIPQ 3GV7B 3N01A 1PBUA 4ES1A 3QZ7A 3G4SS 1F2GA 2XS2A 2QL7B 3RW7A 3CJ3A 4RW9A 2CJYB 5KFTA 3AA9A 2QFJA 1AXQA 2KG0A 2D3O1 3SSQA 3U27A 2V8DA 2LQ8A 2GVZB 4RW4B 3K59A 2B9XA 3BJYA 3AD8C 2H54B 3DMJB 2QX0A 2XMVA 5EX0A 3I32A 4B9SA 1VRUB 3DDNA 4RNMA 2VHGA 1RHKB 4ZPVR 1PAUB 3M8PA 4IQXA 1RWOB 2OPSB 3RBZA 1KBRA 3UCZP 1TKTA 4FBTA 4Q8FA 3MR7A 5DM7Q 2VOOA 4A8XA 2VICA 4RW7A 4JV1A 4UZCA 3QZ8A 2BACA 2KM8C 3KHGA 2ACMA 1VC0A 2VG7A 3IRXB 1ZTTA 1UA1A 4NLWA 3Q22A 1Y5IB 4ZVEA 2LQJA 2B9YA 1VJWA 3ISZA 4H4KC 1F9HA 2MZJA 1N34F 1TL3A 3M8QB 4OYPA 1LFWA 3O44A 2IIHA 3OFHA 1CJKB 1JLFB 4NPOA 1IKXB 5HQLA 5J2QB 3PRVA 5FD1A 3DLGA 2HWTA 3V4MA 3W9JA 1T0TV 1RZMA 2W9CB 3M8WA 4FYVB 2H5IB 3E51A 3MUMP 3CPWR 2AGOA 3VGTA 5LJ3Y 1RTDB 2ZHBA 5EN1A 2DGSA 4ZVGA 2OELA 1NNDA 2M8HA 4A4JA 4NZ6A 1O0PA 5HL7Q 5HLFB 3BKTA 3I5AA 4TQRA 5D8HB 2ZH3A 4DF8A 4CNZA 5DJBA 1JJ2R 2CQPA 3QRRA 1NZ8A 4WE1B 3P49B 3THTA 2RDDA 2H51B 2AYEA 2ALYB 3PJXA 3AOBA 3PCOB 5SZTA 4ED0A 1HYSB 5C42A 1KVJA 4EZ6A 4DL0C 5F3TA 3QT5A 4K4YA 2XEXA 2ZFHA 3QGHA 1WTBA 3FNNA 5I3UB 4UQGA 1NDLA 1U1OA 1CJTA 4ED7A 5A2QY 1GX5A 1NK5A 4PXDA 1FHTA 2M88A 5EUHA 1MU2B 3HZEA 1ZYQA 2WVEA 4BWMA 3BB5A 5HANA 3QFWA 3HD2A 2ZJQQ 1VQLS 3P6YC 1LW2B 5CYQA 4DSEA 5HROA 1HR0F 2Y0SD 3B6BA 2WTFA 1N0UA 2QC3A 3SYZA 3MOZA 3NNAA 3JQKA 4EFAC 4FXDA 2BE9B 1X7VA 3JTNA 1SVDA 3I6PA 2B4UA 1Y5LB 3C46A 1WNEA 3V4IA 1MMDA 3V6HA 3QNWB 5ITHA 3AY0A 2YTCA 5GAHU 3QLHB 4C7QA 4K4VA 3MAQA 1RAHB 3SIPB 1EX8A 2DVIA 5EWEA 4FYWB 1B7FA 1FWPA 3R5DA 4OYIA 3EVWA 2HHHF 1BQXA 2LDIA 2RJZA 3OTCA 4ZS6A 4BDPA 1CQMA 1F9EB 1NUEA 3PW2A 1KR4A 2QN6B 2YNHB 1FNXH 2I1RA 2EXUA 1Q95G 1VHIA 4D3HA 3HSGA 1RT5A 2E1RA 2J7KA 4I4BA 3D1HA 4NLDA 3LP2B 3KOAA 1R0CB 3SXLA 3W8GA 4ED5A 1SJ3P 1MMLA 4PQUA 1N56A 4G6VB 5IWAJ 1M5OC 1DLOB 1LFPA 2CXEA 2ZBPA 3D5MA 1U45A 2KH9A 5F0UA 4KRWA 1NHKL 5LMUJ 3TOQA 5C24B 1TMJA 3OR2B 4X65F 1R6YA 2KKHA 3R2CJ 5GMKa 4B3SF 4DR4F 3UN3A 4C3LA 1TL7B 3IC1A 3O3LA 4F67A 1QUPA 2E7XA 2GIRA 3BKFA 2W7PA 2BQ3A 2UVUA 4ZA1A 4DSKA 2R7UA 2AEJA 5KFRA 4H4OA 3J81j 4J9RA 2CUYA 3TVYA 1VQNS 2W25A 3M8PB 2CA9A 5CD4H 4A8WA 1WF2A 1Q81T 1IXKA 4USMA 4RUHA 3PX4A 2AD9A 2W1BA 2HNYB 4CLFA 4DCJB 4YFUA 3PR5B 3U1NA 3CJ8A 4BWJA 4LRBA 4IRKA 1R7IA 3OTEA 1TFYA 1YJ7A 3TJ9A 1CG2A 1X5TA 4HACA 2DGVA 5HAOA 4X4TA 2FVSA 3FSXA 4GKKJ 2AX0A 2NXNA 2ZITA 1UVLA 2FHOB 5LXYA 5KTQA 2OKQA 2Z56B 4IR1A 4Q0BA 3MM5A 1JB0C 4MMOA 4WFAQ 2R7QA 1VQ4S 2RD5C 4IG3A 3IGVA 4MIBA 4LRCA 2FLLA 1KVIA 3GFHA 3HHNB 4ECWA 3H4DA 1Y0HA 1F3VA 1UWAA 3C16A 3TRGA 3MAAA 2PEHA 5A8RA 2OPQB 1HBMA 2N7CA 5KG2A 3M30A 2LEAA 2DIVA 2CG4A 4ZDNA 1Y3KA 3PY8A 4QYZK 1Q0NA 2ASDA 2A3JA 3LQVA 1P9QC 4HT7A 2DR5A 3DGPB 3BGFA 2P9EA 4OYZA 4B02A 4ENOA 1CLFA 4I0WA 1FK9B 1WSRA 4CO2A 2HFUA 2YWHA 3OFGA 2B56A 2GW8A 4C8MA 3KK3B 4K4WA 2HFSA 4FXWA 4L74A 1XNRJ 1AROP 4O3QA 3KDNA 2OSRA 2DPIA 2PMZD 5DDQC 2MLXA 3I9ZA 2YNGA 4RU2A 3M8ZA 2AQ4A 3RR7A 3CWJA 1UEUA 1XBWA 2GVDA 2R42A 1QVFR 3AXKA 3LO3A 4DMZA 3BYRA 3H5UA 3KG1A 5BXIA 2XS5A 1T3NA 3G86A 2YWFA 1FE0A 1S12A 2HNZB 4M5DA 1N5VA 4HR2A 4DL5A 1NK7A 1APSA 4JP8A 3BH6B 2L41A 2HBQB 3FFIA 4FVCA 5KFIA 5KFMA 3JSMB 4GVLA 2ZH1A 2F8MA 4I56A 2XLJA 2C2MB 3CEDA 4ZLPA 3QLHA 1E6VA 4GO5X 4QIEA 2EKNA 3MMCA 2CVEA 2EBGA 4OJ3A 1N8RT 1IR2A 1S6PA 3J80Y 3QSYB 4ED6A 3GV5B 3CCWA 4HDHA 4CLKA 2F9DA 2F8EX 4W98A 3OSNA 3R7BB 4OI0A 1EIYB 5CYMA 5D77A 5DLGA 3OVAA 2RUGA 3BBCA 2BKNA 3QGPA 2ZNZA 2GFFA 1S1XA 3T5LA 4PUOB 1GXLA 1KWMA 1LWCA 4XK8C 4HACB 2MJNA 1SCJB 2BJ3A 2GA7A 2Q79A 3OQ2A 2DNZA 2ZHOA 4KFBA 3IG1B 1F9FA 3K89A 5KOWA 5HLFA 1RBAA 3LP0B 1NSPA 4YS2A 3CC2S 1O5JA 2ZVSA 2B4OA 3QIPA 4WK1A 2HLUA 3PYDA 1QVGR 4BCAA 4M5LA 3CCTA 3ZFVA 5IZHA 3TO8A 2QA4G 3NCQA 3MM6B 4NCGA 4PWUA 1TK5A 1OY9A 3ELHA 3I9V9 5I42A 4A8QA 2CJAA 2BKOA 2RRNA 3ULHA 3T1YJ 4USIA 4HDGA 2DEJA 3M2VB 4WP3A 1LXJA 3U1MA 1ZAVA 1YRXA 2ZUGA 1PYTA 3I87A 1WEZA 2HPUA 4Z2XA 1N32F 1WC5A 2MZ1A 5DDOC 1WI8A 4PG7A 1URNA 1U6BA 1S1WA 2Z58B 2YWGA 2HIQA 2DEIA 2C3YA 3C15A 2WW4A 4M5NA 4K4XA 1CC7A 2I5JA 3AD7C 5B0FA 4O3NA 2WOMA 2C2DA 3RRKA 2FDNA 1REVB 4B3MJ 2D3ZA 3C14A 2AHOB 2DNQA 3OUYA 1BHNA 2DNOA 3NP5A 4CWBA 5KT5A 4X64F 1RWWB 4NEYA 2KZZA 4YR2A 4B3RJ 1R8CA 3IR7B 5AXKA 3PM9A 3QSIA 2XB2D 3SCJE 3DRYA 3IGNA 1TZ0A 2J0WA 5C25A 5HVGA 1S4FA 2JX2A 2D3OR 1RGVA 1Z2LA 2VB6A 1IKVB 2YKOA 3ADAC 4JB8B 3UE2A 4AXJA 4B9TA 1T95A 1DBDA 4USUA 5KFXA 2RT3A 2DXFA 4OX7A 3F73A 1QY7A 1HMVB 3HULA 1S1UA 2FHMA 3GMGA 2XQCA 2PO4A 2CWKA 2YX7A 1ZBTA 3V6DA 1HR0J 1HWIA 4B9MA 2WSFC 2G9OA 1MNEA 2DNGA 1AFIA 3CULA 2L3MA 1C0UA 2KB2A 4EBCA 4FF1A 3AD9C 3CCSS 3V5RA 2HVHA 3C6UB 2KDOA 4FS2A 4ZPWR 2YNFA 2KN4A 1SXLA 4F0MA 2JC0A 1DQ9A 3T1HF 3NL0A 3KUGA 2RU3A 3UVJA 2N4DA 4DV6F 4Q44A 2OMLA 1ZA1B 2QT7A 1NSAA 3MECA 3RBEA 4Y65A 4FBUA 4I2PA 4KGKA 2RMLA 2ZNYA 5B0GA 3UDCA 2GV1A 5HBMA 2IRYA 3ZC4A 2V9WA 4WZMA 1C0TB 2CNNB 1RAOA 1CSJA 2EVZA 2IVFB 1DZ5A 4KIAA 5F8MA 4L73A 1E6YB 2DR6A 4L75A 5B09A 1SC6A 1VQYA 1NKCA 3TZWA 2RRAA 1CEZA 1FO1A 3PJWA 4ZJQA 2ZC3A 2M3DA 4DPTA 3AXMA 3LUYA 1N88A 2NXEA 3GONA 1QSLA 4NLTA 1IKWA 1ZPVA 3Q86A 3QO9A 3FK4A 4RBTA 4X65J 1VBXA 3KLGA 2HS0A 4FS1A 3CDAA 1YG0A 5CQGA 3H2LA 4O3PA 5DDRC 3RTVA 1X4GA 1HI0P 1S1XB 2IAJB 1HBNB 2EPIA 4DS5A 3Q0AA 2AP6A 2CQHA 1UJ5A 5KFSA 2O3DA 2LXFA 3MMBB 4WYLA 5CYJA 2EFPA 4A8MP 4DWIA 1G1XA 3NAHA 2BJEA 1F5CA 3M6VA 4KO0A 4MKBA 1X8DA 4FPIA 3LAMA 5A6WA 1J5EF 2UUBJ 2ZH5A 4FP9A 2F9JA 4CIOA 3CD7A 5IV4A 3OJUA 4WF9Q 2PI5A 3RB6A 4H4OB 4URGA 3DU5A 4MH8A 4C2MA 1U26A 2VL1A 3BR8A 2LXIA 4C8KA 1N5QA 3P5TL 3K5MA 2FGCA 2B7CB 2L9DA 1U1NA 4X64J 1S0VA 1PIEA 1AW0A 2O5DA 2OI2A 1WACA 4F0HA 3MM8B 3RBXA 3DRRB 3TA2A 1HA1A 1YIJS 2F63A 3KLVA 1Q7LB 2HNZA 1I51B 1H2UX 2FJDB 4USHA 3MM7B 1NBEB 2DTJA 1W25A 3CO9A 4MIWA 1WG4A 4OJ1A 4K2JA 4BLGA 2I5JB 1Y9OA 2RKIB 3ZZRA 3TUZC 4ZITA 1EB0A 1K47A 1O8BA 1RT5B 2CQ3A 4PEOA 1FCAA 4OX6A 5L1JA 2OFGX 4WFYA 2MLYA 2VC1A 4ZJOA 1PAEX 1RJJA 3IBWA 3W1YC 4EBEA 2GGPA 3QT7A 5HSPA 3TR5A 4DPXA 3W61A 4N56A 4WXOA 3TAMA 3GJQB 2QYCA 5KOXA 3JAMU 2CQ1A 2LA4A 4YMEA 5HBMB 2N82B 1H0HB 3PR4A 3M2UB 4LQ3A 3MUVP 1DQAA 4R25A 2Y1JA 1NH7A 4MFBB 2F7VA 3TANA 3FRYA 2JH3A 1EQMA 1VIOA 2FYXA 2VBXA 4EYHB 1RHRB 5DZ6A 1FJ7A 2VBWA 4IFVB 4KFBB 2PFFB 1N0VC 1NZAA 3TX0A 2FZCB 1BGXT 4DR5J 1JIHA 1WG5A 2MZSA 4JI6F 2CQBA 4ECZA 4J9SA 1S6QB 4J9QA 2C2ZB 2OTJS 4Q0BB 2VJUA 1SV5A 3MZIA 4X84A 1X4EA 4AE5A 2W9BA 3G82B 1AT1B 1I5OB 2ZBCA 3AHPA 1XIQA 2BR0A 1S0NA 4MYUA 3HHEA 2C3PA 3EWGA 2R7SA 1GMUA 2PFDA 2QLWA 3BO3A 1AB8A 2G1DA 2KFNA 1DAXA 1TUVA 1U8SA 4BS2A 4QU6A 4DX5A 4KGVB 1QAJA 2ZJPQ 3TZZA 4OYBA 1FJGJ 3EZUA 3D9BA 2W4DA 1LK7A 1U09A 2GJIA 2LMIA 2MKJA 3M6XA 4KC5A 5L46A 4KPYA 1IR1A 3KLHB 1U6ZA 2XG8A 2FGOA 2KVQE 3ISNC 3QFHA 1S57A 4M5MA 3RGIA 4DUYF 2ZOMA 1YX2A 3NNCA 3KK3A 2J0QD 1SH3A 4MAKA 2MXYA 1X4HA 3I56S 1PC5A 2AX1A 4ZKAA 2K1RB 5LJ5Y 3GFZA 3IWNC 4Q8EA 3SCKE 4DFPA 1DJ0A 1YBUA 2R8HA 1OYEA 2C42A 2AJ4A 3R6GB 4RJVA 2RQCA 4JI5F 3D6MB 5A8WB 3QAEA 3UQSA 3IS9B 4I6AA 1JJ4A 1B0PA 2H5JB 2V94A 4J9UE 2DXEA 3D4JA 4LJMA 4B17A 3CDWA 4CLZA 4Q5VA 4G1PA 1DTTA 3B78A 4FN5A 4ITSA 2HHSA 2MHEA 1X9WA 2EFOA 3PFOA 1X4AA 2DNPA 2GVDB 3X3UA 3R1LA 2BQUA 1B64A 2ZE2A 4C8ZA 4KGZB 2BRLA 2AGPA 4HEA9 5T7LB 3W2WA 4L3KA 4IOAQ 1MWQA 2RDJA 2CPDA 2NSCA 2OP5A 3SCIE 2DHGA 5ETVA 1KQKA 3ILJA 2OO4A 2BW7A 4GMKA 2RF2B 3BGRA 2D1CA 3LTOA 3SDEA 1GEHA 2BW2A 4ZVFA 5HMXA 1HI1A 2XBPA 1L3VA 3IXQA 1S79A 2B9WA 2WVDA 2RB7A 4AL7A 4DS4A 1KHVA 3MPDA 1LWCB 1S9EB 3CDEA 2CFXA 1ZM4A 3M2RA 5CH7B 3SI8A 1JWWA 1GTHA 3MEGB 3GILA 1NDPA 1MMNA 4X4OA 2CQ4A 1KVKA 5D78A 4JBCA 2L08A 4ELUA 1ZH5A 4F04B 3T3FA 1D8ZA 2X1GA 3ZTOA 1WUUA 4QR2A 1B4SA 2VG5A 3JXOA 2WK4A 3EGVA 4I2QB 5KFCA 1XMOF 5GAEI 3MM9B 1JLQB 4LRDA 4PCQA 1BWVA 2HQCA 1HQ2A 1N48A 3EGNA 1IKWB 3QO9B 5CABA 3J7A1 3T9ZA 4J90A 2EG2A 3FQLA 4CH0S 3PO5A 4FVMA 2M0GB 3JYTA 2HFOA 1VQ6S 2E1MC 2CPZA 3QT6A 2F4VJ 4CDIA 2NYHA 3NNHA 1F2HA 2IC3B 1G4CA 1Q8IA 2GHWA 2YQ0A 1ZETA 2FJWA 1U6FA 4YDXA 4KGMA 3OXFA 2H3EB 2LDYA 2CPHA 3O5TB 2HBRB 5A8RB 5B0BA 1RA7A 2B3TB 2HS3A 1WDTA 3A1YG 1Y7PA 3NGRA 1P1LA 5A2QU 2W9CA 3NMRA 2BZ2A 2O1PA 4U9RA 3QATA 4USTA 2FLOA 4I64A 1XR7A 2Z8QA 2GCFA 3RW6A 4OL8A 4QIWD 1SKWA 1XK8A 2CPXA 3T1HJ 3X1LB 4TYAA 3UR0A 1QTNB 4DLEA 3HVAA 4LF9J 4UUXA 1DTTB 5LM7E 5F8NA 4WXWA 2GAHC 2XWYA 2B4PA 4JOUA 1S76D 5K14B 5HQMA 3DRPA 4RUCA 4LSNA 2VA2A 1DY3A 1YLXA 2HZCA 4OZ3A 5KFLA 4QIGA 2CQDA 2IFXA 1GNKA 3CTRA 2VDHA 1EJ7L 3UR3C 2J9DA 2UUWA 3ONQA 1NKBA 3SCLE 4HLBA 5D0HA 1W7WA 3DOMA 4WJBA 4CT9A 2OD6A 4DZ6A 2DNLA 1X4BA 3IO1A 4DL4A 5KFNA 4NZ0A 2KO1A 2CPJA 4GKJF 2VIHA 2DR8A 4JI3F 4F4KA 3FZBA 2X1BA 4M5DB 3LALA 2QFIA 5J2PA 4RBUA 4DL6A 1G7CB 2HWIA 4HTJA 1RWVB 1DTQA 1RT4B 3MEDB 5LOQA 4WK3A 4S0MA 4J9PA 1D9AA 1YJ9S 1EQ0A 4WIQA 4FYDA 3CJRA 3PACA 3GU0A 2ASLA 4DX7A 5IC4B 3PX0A 4DQIA 4WP8A 2IA0A 3R2DJ 2DH8A 2YPZA 3FZ2A 3N6LA 4LSLA 2PDAA 4O23A 5AE1A 4MJKA 5IM0A 4JI8J 4DI6A 3PG9A 2FHJD 4G1IA 3OW2R 3T6BA 4F50A 1KOHA 3CDBA 3GCXP 2HWHA 2VFUA 5KFBA 3EDQB 2CPIA 3H0PA 1FNMA 1RT7A 3CJ0A 2C3MA 3T5HA 1BE4A 4QU7A 2BA9A 1U0HB 3RAMA 3T41A 3B8HA 3NS7B 4J7CA 1K9MT 2QEXS 1YDLA 2AT1B 4P7VA 2ATLA 2M8DB 3CCLS 4N47A 2KXNB 4OJGA 4ZVTB 3W9HA 1WHWA 1SJFA 4IFYA 4O44B 1Z1ZA 4HH1A 2GNKA 4U8VA 4HVZA 5E7OB 3MGJA 3CCRS 1VIXA 2VG7B 1HWJA 2R7OA 3IRXA 4AD6A 3DLLQ 2UZAA 2YX4A 3M05A 3PYEA 4CH7A 5L9XA 5BR8F 1M1KT 3NWRA 4DHVA 1HIYA 4MT1A 2AYBA 2V6AA 1TL1A 2HAIA 4B9NA 2IBOA 1ZPWX 3GIJA 3PYFA 3LOUA 4JI7F 2NZCA 5AXMA 2EFGA 3M32B 2H4YB 3ENVA 4IFYB 2J0SD 2HNYA 2QMWA 3CCUS 1V3SA 1FKAF 3AT1B 4WYWA 5K9FA 3EMTA 1WOPA 5K14A 1ZZFA 3VAMA 1RTJB 2QL9B 2ROGA 2HQDA 2QE5A 3IS9A 3QIDA 4TLRA 5IC6B 3TWZA 4DX8H 1LV5A 1J5OB 2HEKA 2LEPA 4JYAF 4C6AA 2P2CB 1VBKA 2Y9HA 3R7SB 1S72S 3TAQA 1DFDA 4C8OA 4I7FB 3OR2A 1RAJA 1VDHA 2J8AA 2QLBB 4FZVA 4DBQA 3LWMA 3T1YF 4CNYA 4C0OC 5B0CA 3RU0A 3HM9A 1YI2S 3SBMA 1IM4A 1MROB 1RBOB 2WZ1A 1UPMB 3Q8YA 1TV6B 2FHKA 2LA6A 2MEWA 3CJ2A 3CUNA 2BOPA 2WB4A 3DKDA 3VHQA 3W5YA 3OXLA 1ZAWA 1R8BA 2H4WB 3D3CJ 3TAMB 5BYSA 3OHAA 2Q1LA 5KG0A 1U02A 3I4HX 2OEJA 2HBYB 2MKYA 4H4MA 2E7WA 1FKOA 2XZDB 3LF0A 1HMVA 1R3NA 2AZ3A 2V4JB 1RTDA 2YXLA 3M2RB 4N77A 5DGBA 3L7UA 3R3TA 3H20A 3QJPA 2CAJA 2KVIA 3MD3A 4ZVUB 2YWWA 1A7GE 2VV5A 4WFNQ 2V5HG 2C28A 2LQ9A 3GSDA 2GVZA 5K5MA 4NYZA 1VGYA 1FXLA 3C66A 3D68A 3DMJA 5IXUA 4MFBA 1X5SA 3UNGC 3TA1A 1FDBA 2R8GA 1RTHA 1CBKA 3H8YA 4RW9B 5JVGQ 5DLFA 2F40A 1RYSA 2CADA 4RW7B 4I2PB 1HBUB 1Q4RA 2MQLA 3NGKA 2DGOA 4V19J 4ANDA 2B0GA 2HQ3A 2NUUG 1M5KC 2ZE2B 2U1AA 4YB6A 7AT1B 2VQEF 1U1KA 4LF6J 2WVFA 4I68A 5E3AA 3PDNA 4EGLA 3J80U 4QWCA 1UKUA 3DDKA 3QGIA 3DRSA 3EVMA 4LF7F 3E8OA 2G2YA 2R8IA 1YGYA 2RKIA 5D0GA 3CD5A 3F0NA 3RYLA 3T5KA 1QAIA 4DR7F 2NYIA 1YBTA 2NZ4A 2DIUA 2OPPA 4OV6A 4KE5A 6FD1A 1FI4A 1LXNA 5IQ6A 3DYAA 3EPIA 3UD3P 4YP3A 1WC0A 3DOKB 5J1PA 2HFVA 2K1RA 2D9OA 4A48A 2HHUA 3M1VA 5C2GA 1F60B 2IAJA 2J6UA 2ZUAA 2L9NA 2GHPA 4Y0FA 1HBOB 1RT2B 2HGLA 4URSA 2MTLA 2XWXA 4K5SA 4AL6A 2W7OA 2UV8G 4X62F 2COLA 3MEEA 1FTCA 3PW0A 4JV2A 5E33A 1RSCA 1YK9A 2GX8A 2MMYA 4USWA 5E41A 3RBDA 1RKJA 3Q2TC 3G96A 4ED2A 1TUWA 2AW0A 2JFDA 4ES3A 2DYAA 2QTWA 4QR1A 4NA1A 5IQQA 3GIIA 4ED8A 3EGZA 3NKYA 4NA3A 4ZLJA 1MN7A 3MECB 4IO1A 4GVBA 1JLEA 2Z2LA 3KNGA 3P8BB 4ATNA 3RR8A 3CW2C 5J2MA 1KKHA 1AA1B 3N79A 4U7UK 4UOGA 4X62J 3MR5A 4R0EA 4DUZF 3QAUA 4M5KA 4ELVA 2DNYA 4KH1B 2WSCC 2XMKA 4RL1A 3ZZPA 2VQFJ 3THVA 1X31C 4ZPAA 3ZNUA 3KLIA 1TKZB 5HO4A 4YB1P 4F4ZA 4ECSA 2IYGA 1VK8A 2GQCA 4M95A 1TELA 4RZRA 2R2TA 3OTDA 4DV5J 1VLYA 3P45B 5F41A 1UFKA 4BC9A 2G0IA 3MDFA 4P2MA 3S01A 2OJ3A 3QGGA 4RNOA 3KJVA 4HYKA 1X9SA 5IT9Y 3N28A 3ZTRA 1JXLA 1FT8A 3MM6A 4NCGB 4RLEA 4F02A 4OJHA 3NAIA 2VU5A 3US5A 4IG0B 4QW9A 2MQQA 2VKRA 1IKVA 3M8RA 2FJBB 3P5BP 4CP5A 2PA8D 1RTIB 1VCTA 1M5SA 1RT7B 2FUG9 4DDFA 2BX6A 4DUTA 3VWSA 3BEGB 4K4UA 1U0HA 1XC9A 1HKAA 4DL3A 2PIIA 5A0YB 4WFXA 3ZZ0A 2IBKA 2HYIB 1UCNA 3G9CA 2WBMA 4DV3F 2WOMB 4CYUB 4ANCA 5H9EJ 1REVA 1WELA 4ZN1A 3MFIA 4ILRA 1IJEB 1SIZA 2AKWB 3BQ2A 5F0WA 1R43A 2X1AA 1UL3A 2M52A 4QIFA 2BQRA 5J1EB 5KFHA 4XTTA 4LUBA 4WIIA 3MOJB 1RLCL 3KLGB 3JS9A 1Y11A 4AFFA 1TTHB 5J2PB 3HJVA 3DLKB 3SQGB 4ZIWA 2CNOB 2HVEA 3IFEA 4ZCKA 2ZWPA 3QRQA 2FJAB 1ROFA 3QPIA 4PQAA 3MEEB 3A4TA 2MSSA 3DLGB 3M6UA 3VTIA 1FX2A 5KT4A 1HBUA 1GXUA 1RAEB 5J2NA 2QMUB 4E8UA 2A2DA 5DETA 1BUXA 1OIAA 5HVHA 1J5OA 4LF1A 4ZVPB 1NU4A 1RTJA 1UFWA 3MTKA 3H5YA 3HO1A 2GMHA 2P9CA 1JLCB 1QSYA 1SC4B 3GTYX 2LXUA 1VQ9S 1OO0B 2N3LA 3G8TA 5HP1A 4KR0B 3DLJA 4FDFA 2JEIA 4DCPB 4RNFA 3OD2A 2YNFB 4LR7A 2E1PA 4CO3A 1HBNA 2ACYA 3CT9A 4UQTA 1ICEB 1Q86T 2IJFA 1B3TA 2FTRA 3C19A 1F6TA 2RQKA 4ZVOB 2RILA 2CNLB 1YJTA 4IRDA 2PC6A 2E1AA 5KFAA 1U1LA 4M94A 4QZVB 4ZVSB 2EWHA 4Q2MA 1PJ5A 4M5JA 3QQCD 4U95A 3ENWA 2EKYA 3JSRA 2EK1A 5E3QA 1KQSR 2U2FA 2R3VA 4WBFA 3V81A 3MCNA 4ES2A 5F8LA 3M8SA 3CIMA 3RB4A 2UVWA 2KHCA 4KTQA 4EYIB 3SV4A 3MAAB 4UOCA 5BJRA 4PRFA 2IM0A 3E3XA 3JSYA 3KKFA 4WKYA 2V2ZA 2VF3A 4WCEQ 4XAKA 3CCJS 3CNQP 3DRXA 2EC0A 5LSRA 1ZTWA 2RHSB 2ZOGA 1RAAB 3QT8A 3ETMA 3IG1A 3R6LB 1UTAA 2DBBA 4DR4J 1QAYA 1ZS6A 1FX4A 3HF5A 2WAQD 1R8PA 2VOPA 4RW8B 1NDKA 3HFKA 2FPHX 3OLAA 4G1QA 3VV2B 2F3JA 4LT6A 4CTAB 4Q45A 1KD1T 2V67A 4UW2A 3CC4S 5B0AA 1RHQB 2Y0BB 1RA6A 4IOCQ 4OHXA 2CPEA 2MQNA 2AIRB 2NXJA 1NAQA 4I2QA 3ZZUA 3UVJB 2EFVA 4CYUA 3FGVA 3DFEA 4U7UD 5D15A 3MUTP 3FSYA 2E5LF 4O3RA 1KQFB 1N52B 1YJWS 3AQPA 3D0IE 1RB0A 3OLBA 3G71S 1U1QA 2DRBA 4DSLA 5CCLA 4KKOB 1NJYA 2AYGA 1S6PB 3UD4P 2QSWA 3ENAA 1S7IA 2DGXA 3T19A 4K4ZA 3CJKA 3TA0A 4PZVA 3HLUA 4FNHA 4H4KA 4IG0A 1HBMB 1HQEB 3NEKA 1SUQB 2BV3A 4UOHA 3WDOA 2WONB 4R8UB 4B3TJ 4X4NA 3L7OA 1HNXF 4DF4A 3C14B 2H1YA 2VKZG 4PYDA 3VGUA 3HI9A 5ETNA 3ZZOA 5ETRA 2OUGA 4RO0A 2AWZA 4P71A 5HATA 1TU0B 2YY3A 3A3PB 2ZH8A 2OEKA 2IM1A 3SEOA 3PHTA 5M2UA 2DRAA 4OZLA 3CO0P 3SV3A 1N36F 4NASA 2BJ8A 3V6KA 3W2VA 1RCOB 2EG1A 3KG0A 1V9OA 3GIMA 2E29A 5KFOA 2RAQA 4C8LA 1TVRA 3BDPA 5L39A 3Q8UA 4TQSA 2HHXA 4F4YA 4ECTA 2YWKA 4IR9A 1CJUB 4JI2F 2G0CA 4IH5A 2NSBA 3MFHA 5BYRA 5DQIA 5ETPA 3TEHB 1YJRA 2XO6A 1N32J 3GIRA 4GRSA 2XLIA 1P8GA 5ETMA 1SIWB 5CZXA 3EX7B 3GWCA 4M5HA 4C8NA 1H7WA 1VRTA 1R89A 5ETSA 1HW9A 1GXTA 2G0JA 3HHDA 1FJCA 1U2CA 1ZAXA 2I38A 2MZQA 5A76A 2XI3A 1HNZF 1PJ6A 4EWTA 2PMWA 1QDUB 1L3KA 2PMHA 4Y6IA 2XZWA 3AODA 1S1VB 1S97A 1N5TA 2EK6A 3KJFB 2AJFE 2J9DE 3DOLB 1NK8A 2XMTA 1SH0A 1RABB 2IHR1 2W2MP 3CJ4A 5KFJA 4P7TA 2BYCA 2LQ5A 4F3OA 3M8YA 5HJYA 2DO4A 1JNZB 1MWZA 4ZP7A 2HBZB 4OZNA 3R27A 1EZZB 4QYRA 4K4TA 4L72B 3T1AA 4R5PA 1HPZB 4QWDA 2KJVA 3HFVA 2OAUA 1YRTA 3J7ZT 2KHDA 2DH9A 4R0JA 4DR5F 3BKUA 4QW8A 2D74B 1SPBP 2V2QA 4AQYJ 1WKLA 5HI7A 1T8EA 3CSKA 2CQGA 4J9LA 4UZBA 3TAPA 1SQFA 2RHQB 3JSMA 1VQOS 2HHTA 2JHEA 2R7XA 2MKCA 3LW5C 4RWXA 1Q8BA 3GCWP 5LMUF 3T5JA 3EXCX 1Q7YT 1YJUA 2DPJA 1DARA 2RH3A 3TP2A 1W2BR 2HFNA 1NDCA 3WIVA 3G6YA 1QE1B 3ICLA 1SC3B 1ZM2A 3EXYA 3NGTA 2XYPB 3MR6A 4ER8A 3KJQB 1HWKA 2M7SA 3UI3A 1C1CB 1QTMA 3BN7A 4JI3J 3FCHA 2BUNA 3Q2SC 1KHWA 4X66F 1S49A 3BO4A 3MTJA 4EO8A 2VFVA 5C2CA 4DV0J 1M5VC 1S10A 3I0SB 4BBYA 4DZDA 4Y2CA 5JUMA 2IMWP 1OPIA 4UF4A 4ZP6A 2JEFA 3V6JA 4EZ9A 1FESA 4NCBA 3CJQA 2LVWA 1PG5B 4PWDB 4QWBA 2AU0A 4OMFG 1DTQB 1RT4A 3N0VA 5KFUA 4CZCA 4B3MF 3IBCB 4RUAA 3A8KA 1CJUA 3FMWA 3LA0A 2O66A 3KLEA 5FDLA 3FSIA 1LWFA 2AJ2A 2WONA 3PTWA 4R8UA 3W63A 2XO7A 4ECRA 3DI6A 2M9KA 2CIMA 1CPZA 2AJQA 2VH7A 4DX6A 3HD1A 3D1OA 3HKZD 2YX1A 2HKEA 1T9VA 2HRUA 2ZWOA 1XTZA 2YKMB 5BR8J 1VLOA 1NKEA 3QWPA 1FFWB 4E2FB 5FIIA 2HNDA 3L95X 3D6FB 4OZ2A 1VQ5S 3H2VE 2ASYA 2F65A 4LMZA 2DR9A 4ICLB 4IKAA 3DXBA 1D0EA 1VHFA 3TJAA 3P3DA 3C8YA 3PW5A 5IWAF 4DLGA 4FF4A 3BPDA 3NGUA 4NWBA 3WIUA 4QCLA 5KT2A 3S8SA 4NXMJ 2HZAA 2YNHA 3PW4A 1RISA 5C7PA 4KGXB 2RIJA 2NR0A 1RK8A 2CJBA 2GO9A 2XMMA 2Z2MA 1L3SA 3AJ2A 5J2NB 6AT1B 1TL4A 5BYQA 4B3SJ 1XNRF 1S6QA 1SKUB 3CE8A 4RW8A 2A0FB 3AH6A 3T9NA 3VGSA 4ZN3A 2FC8A 4ZLLA 2BM1A 4F26A 4WPAA 1NJIT 2GJ2A 3EE3A 3GYNA 3NS6A 1EKRA 1KFDA 1SQEA 2Y1IA 4JI5J 3KHRA 2I8EA 5LSOA 4HI2A 1HLWA 1R0AA 1H72C 1GAOA 1AZSB 4YUDA 3FCWA 1HHTP 4WKRA 5E0OA 1TKXA 2VG6A 1HQUB 2LU2A 4CLYA 3U02A 1VQ8S 4OX9F 4MKYA 2V69A 4ED1A 2B4VA 1H6KX 2YWEA 4TY9A 4ZHRA 1VOMA 3WQPA 1OSCA 3CGIA 1C1CA 3AB4B 3DRSB 1W2IA 2QSFA 4OI2A 1T9UA 2J7UA 4AYBD 2KFYA 4NMXA 5K8MA 2LECA 4TU9A 5F3ZA 2ZD1B 3C6TB 2MKKA 1NSQA 3BGLA 2RDIA 4M5GA 4QPTA 1JNRB 3VZIA 4J9KA 4N8OA 2VONA 1JJHA 4X4PA 2UVVA 2LU1A 2EW9A 1X0PA 3FVYA 3LAKA 4P10A 1DURA 4CO4A 4QPXA 1NJXA 1IQTA 1D3WA 3J7YI 2BEFA 1HWLA 4ZOSA 3H98A 4NYOA 4CH1A 4P6QA 3KJVB 4DN0A 3D2WA 1SV5B 5L1IA 4KHPF 2W2OP 1U2RA 2R2UA 3MPYA 1WI6A 2E9TA 1VQ7S 3SSSA 3U7JA 4CLSA 5KG5A 4DPUA 1UW4A 2EEYA 4HH0A 5DDPC 3R5JB 2KI2A 5GADI 1RAGB 3W62A 4KBIA 1Y00A 4ZMMA 4LF6F 4ECVA 2XTJP 2GQ2A 1NO8A 1VFJA 2ZOFA 2LP4A 2V4QA 1FWKA 2M4MA 3F44A 3W60A 1S6OA 2XZTB 4EMDA 5KFQA 3MCOA 2AGQA 4URQU 2V50A 3D54A 1KONA 2VFRA 3HSZA 3I0RA 4AT1B 4F3QA 2QYGA 5K8NA 1ZZNA 2HQGA 3UDEA 4B3OB 2QG9B 5B0DA 4ZLNA 1RDRA 3HHLB 5F8IA 3NGSA 4KH0B 5GAGI 3H40A 3CF5Q 2BM0A 2HFZA 2EFNA 2FLPA 1AFJA 1VISA 1A6LA 1QSSA 1KNZA 4OHYA 1GFWB 3BSNA 5I3PA 1U1RA 2JEJA 1EAYC 3BZQA 4FYYB 2GO8A 3OSPA 3I96A 3ZO7A 3HSDA 3DCAA 3PRBA 4XO0A 3Q23A 1HYSA 2ZBQA 3M2UA 5A8WA 8RUCA 3BGOP 3NBPB 2PN6A 2V4RA 2C2EA 4PR6A 4IOBA 4LBHA 1PBAA 3N5FA 1A9NB 4PPDA 4PXBA 3GYXB 2XSFA 3W64A 4JI1J 1URRA 2FD2A 5DG8A 1NHUA 2IJRA 4OQJA 5LL6d 2OSQA 3BS9A 2IMOA 4RR5A 1RADB 4DV2F 2UXDF 2RUSA 4ETZA 1SJ4P 1GMWD 1JX4A 4LF9F 3SQOP 1R0BG 3BSAA 3AA8A 2QA4S 1JKHA 2CZ9A 3GQCA 1BY9A 2HGNA 1NK4A 1IBLJ 3CC7S 1UVKA 2VC0A 5ETOA 1IBCB 2VQFF 3N5BA 1TKDA 2RQ4A 1RLDA 4ERDA 1FJGF 1LQ9A 2XMUA 2MJUA 1OSDA 1WF1A 2B51A 3CIZA 1YITS 2BOAA 4NLUA 5GAEU 1K1QA 2A10A 1FRJA 5KFWA 3HPOA 2BANB 5IOLA 1P9YA 1SKSA 4CT8A 4O3SA 1Y5NB 3I5BA 2CDRB 5KFZA 2ROPA 2ZKTA 1FA0A 1FWLA 3RAXA 2V8PA 2IRXA 1JLEB 3K7RA 1NSKL 1NB7A 3K5OA 1PKUA 1CULB 3G87A 4LVOP 5U47A 2VODA 1Q1KA 4C11B 5L9NA 2CWXA 1HQEA 3G6XA 4UT4A 3Q8QB 3P96A 4FPRA 3BM7A 3J7Z5 4N8NA 4OYAA 3ZTPA 3MMCB 4ZK7M 4DV6J 2BRKA 9RUBA 1IWGA 4RW4A 5KFYA 4NLXA 1GMWA 3OTOJ 2Z4PA 1SC1B 1ZM3A 3TI0A 4DV1F 1TMMA 5DG7A 3DLKA 2BE2A 5KG4A 1XMBA 2C2OB 3IWLA 2JNJA 2XHCA 3OT9A 4GC7A 5IFMA 1T9XA 1YHQS 5H9FK 1M1HA 5CXTA 2KT2A 1VC5A 1WOOA 2E9ZA 1IKYB 1MSWD 4AXIA 4I6WA 4H4MB 1F5AA 3C6TA 3H59A 3P4UB 3KLFB 2XS7A 1KFSA 3AFGA 5AJ3J 4DOZA 1Q8KA 4F7VA 3A12A 2DNHA 1L3TA 4N5SA 4DV4J 2HZVA 1OY8A 1XEZA 3NCPA 1K44A 2V4JA 4LR9A 4Y3CA 3W8PA 1RTIA 3ZZYA 3GG1A 1K1SA 4P2XA 2KJWA 3D0GE 4Z7YA 5A8KB 5CCMA 5JJBA 3VAFA 5KFEA 1IKXA 2WSEC 2BABA 5DQGA 4DR1F 2EBEA 1R6VA 3HVTB 7FDRA 4KSEB
chains in the Genus database with same CATH topology
2CJQA 4NRUA 3DN9A 1R8HA 2N7YA 3C3LA 4E98A 3KWMA 1KN6A 5MLCV 1NK6A 1RTHB 1R8AA 3TQ1A 1R31A 5KT6A 2E1CA 1UAWA 3QJLA 2ALZA 2B5JA 2XMWA 2JSXA 3F56A 2C3OA 4DFKA 1V6HA 2AJ1A 3IAM9 2JRSA 4OI1A 4C97A 5J2MB 3JAMY 2FVPA 3DYAB 1T05A 4YHHF 1YTYA 1U25A 3OUYB 2RS8A 2W8KA 3O1LA 2P6TA 1HWUA 4O44A 1RYRA 1N5YB 4F2RA 2PGCA 5GVQA 4QWEA 1FRHA 4WZQA 2CVIA 3CB4A 2J6TA 5AE3A 1FEEA 4X2BA 4M63A 3HP6A 3NG8A 4W90B 5C25B 1O51A 1TL1B 1X0FA 3GV8B 3ITHB 3JTPA 2ZZNA 4OHVA 2IVMA 4IO9Q 1U4BA 1ZM9A 3CCMS 1TQLA 1JLBB 3KHLA 1FE4A 2A1BA 2WRMA 4OZ5A 1EETB 4K0KF 1HNVA 1CQNA 2HMIB 1FEHA 2L48A 2H5EA 2ILZA 3MR3A 3L3CA 3GFXA 4JUZA 2HRYA 5IT0A 2OPPB 5KG1A 2DB1A 3PEJA 1V3RA 1LW0A 3MR2A 5L1LA 2FVQA 4C9DA 1K0VA 4B9LA 1VI7A 5GAGU 1M5PC 2E5GA 4HT5A 4I69A 2SXLA 4ECXA 2XLKA 1TKXB 2VG6B 4YB5A 1Z2ZA 2CPFA 5DS7A 4K59A 2GQQA 5HMZA 1FVSA 3KTQA 5L8RC 4I1TA 2XSJB 1WG1A 5KFGA 2VD3A 3VAJA 4ID8A 5DG9A 1FDAA 2BXJA 4ECYA 3W2WB 5JVHQ 5CA5A 1T03B 1BD6A 4TXSA 1GT8A 2GHVC 4PG6A 5E2QA 1VBZA 4LVNP 3OTBA 3UW1A 4JI8F 4C4WA 3GZ7A 4GC6A 1C1BA 1LWEB 5D6GA 1ULRA 1Q16B 4J5OA 3GIMA 2YNGB 2XULA 1HHSA 1DHMA 3I5CA 2NPFA 2M70A 3LANA 1HQUA 2JVOA 4NOHA 1S1VA 4Y28C 4ZCMA 5LMNF 2V9KA 1FD8A 4QYZJ 1TV6A 3KMQA 2PE8A 2WW8A 3FFIB 3KK1B 1XMQF 3IN5A 3CMAS 3RRGA 4I7FA 4NRTA 3AJ1A 1GTEA 3B4DA 2VPZB 3PEHA 6FDRA 2FJVA 1RT6A 2MHNA 3JYTB 3DOKA 2K7KA 4ETXA 4PQUB 5KFKA 2HHVA 1NRKA 1Q8LA 4AUKA 4OFZA 4Z37A 4DSFA 2KT3A 5I4MA 3U1LA 2ZZMA 1JLGB 1T05B 5F9NA 2UXCF 1B0TA 3M32A 3VAKA 4CI0B 3TX8A 4DV5F 3DLEB 3FJ2A 3VCDA 3D1QA 3M9OB 4ZP8A 4LSLB 3OVBA 2UXBF 1S9EA 1QE1A 1HNIA 1PC4A 4X4VA 1QM9A 2H9ZA 1S0OA 2VFTA 2W7AA 4OHZA 3CD0A 3VQSA 2HHPA 3R5CA 1AUDA 3M4XA 1E6VB 3ZZTA 3KMSA 1HI8A 3OR1B 2OIHA 2YH1A 3OL6A 4LSNB 2XSJA 2ZH7A 3OBIA 5HMWA 2OTLS 1FRXA 4RW6B 2FJEB 1K0TA 1HPZA 1JMTA 2IA6A 2DCUB 3SFUA 2PSZA 2CQIA 4K5RA 4YR3A 1YVFA 2KYZA 4ZHRB 1JXEA 1XR5A 2CKWA 3MHYA 1G3OA 3OJSA 3MMAA 3OL7A 2FVRA 2F1FA 1HL6A 3GB0A 1VC6A 4TU7A 2PI4A 1M0SA 2QV6A 5IS2A 3KNAA 1FRIA 3SFGA 1XN9A 1BWEA 4F3MA 3MEDA 3OV7A 2ADCA 1PILA 4ZPTR 1FK9A 4NLSA 5DQHA 5J1NA 1S7HA 3CCQS 3ETOA 2HHQA 2POKA 3KK2A 2DT9A 4MTPA 3OTOF 5HROB 3TARA 5E3PA 5D4PA 2MGZB 5AJ3F 1FKPA 4M1KA 5K8PA 2Q6BA 3CJKB 1QAXA 1N6QB 2RF2A 3CDUA 4NXNF 5H1SV 2MY8A 4H54A 1RT6B 4LF5F 1UEVA 1C2PA 4MK9A 3TUIC 1N5YA 2DNNA 4PWDA 4IUFA 4NLYA 2ERRA 3THPA 3NMAA 4NLPA 1IBMF 1S77D 2DITA 2E9RX 3WC0A 5LT5A 2HVIA 3N9UC 3MM5B 1C1BB 4B3TF 4WE1A 3UCGA 3W2VB 5CZVA 2OMOA 1WHVA 2ZH9A 2MB0B 4MKAA 3Q24A 4RWWA 5D3GA 2E5JA 1UJ4A 1VK3A 1UVMA 4C0HA 3TUJC 2J6SA 1X4FA 3K8WA 3E2EA 4MYTA 3DLEA 2FC9A 2V8HA 2VFSA 3I4PA 2P5VA 2VG5B 4IFVA 4YDDB 1VRUA 3VAHA 4EEYA 1IN0A 2FHJA 5FJ4A 2EFQA 4EU0A 5C24A 3HX9A 1NK0A 2V8GA 3VALA 3B4MA 1HFEL 1LW2A 1RP5A 1FERA 1HNWF 4G3IA 1TK8A 1D9FA 2IC3A 2XGQA 1UVIA 1WHYA 3CJ5A 4ZCLA 5C5JA 5GADU 3FEYB 2K8GA 2PD1A 3GFYA 2DH7A 1T3OA 4FF3A 3K8VA 4N76A 1JLGA 3HHLC 3KLEB 5J1EA 3VF0B 2DHXA 3C6UA 3GR1A 2D9PA 2ADBA 2A2CA 2VUGA 3FMBA 1BQMA 1T02A 5C42B 4J9MA 3DOLA 1S6UA 4DJBA 4PKDB 3IWXA 4NLQA 1IJFB 1SH2A 2HLTA 4NCAA 1P1TA 4NYPA 1SI9A 2DNKA 2IRUA 4L6V3 4DFMA 3JB9k 4DN9A 5KFFA 3POTB 3DGPA 3K58A 1EP4B 4LQ9A 1QLNA 4X4UA 4E0DA 1FVQA 3DLHA 2MKSA 1HNVB 3L7PA 4F25A 3CCVS 2HMIA 4EBDA 2MZRA 1LW0B 2R4FA 1RKIA 4C3KA 2IM3A 3WC2A 1RI7A 1B64A 1TVRB 1X9MA 5CYQB 2JLGA 2OPRA 2WCXA 1K73T 2UU9F 2ZM6F 5G0RA 2UUAF 1H98A 2F8HA 4DFJA 1WTFA 4Y2MA 4DL7A 3HHLD 1BC6A 1WF0A 1WHXA 4O4RA 1FXRA 2QA1A 2RS2A 4UY8T 4Q2LA 1U1PA 4LFAF 1KC8T 1K8AT 4TY8B 1I6JA 2UUBF 1KS2A 5KFPA 2DD8S 2AJ0A 5KG3A 3H25A 4JI1F 3G8QA 3ISND 3EYZA 3I31A 3DRRA 4DEZA 3DM2A 2UUTA 4JV5F 2J0XA 2VPXB 4X4QA 2R7RA 4DR3F 4A8SA 4DQSA 2Q3PA 1NEEA 1KOOA 3NWGA 2DJWA 3MM9A 2KTQA 3AB2B 1P6TA 1SL0A 5HP1B 5G4DA 1C0TA 4OIXA 3Q8SB 2VA3A 4ID5B 4OI6A 2GGPB 4A47A 3DHWC 1J2VA 2BE2B 3EZ5A 2IM2A 3BO2A 1UVJA 4J37A 1KRPA 2F4VF 1SUQA 5I3QA 5KT3A 3TW0A 1H3DA 3CMES 3IAS9 2DCLA 3DLBA 3MEKA 1UP1A 1D8YA 2JEGA 4NLGA 1RT1B 1HARA 2YH0A 3KYLA 1S9GB 2KXFA 4DL2A 2PT0A 2LYVA 5JXSA 4NLVA 4NXMF 2O67A 1FDNA 2XNQA 4TU8A 2X51A 2P6SA 4ALZA 1UWBB 5D4NA 3MF5A 3PZPA 4YR0A 2E44A 1N54B 4F2SA 3DXSX 2RQMA 2MZTA 4DQRA 1JK9B 1RT1A 4WTYA 1U48A 4I6YA 3ZZZA 1HNIB 1U2FA 3JSBA 2CZVC 3NS5A 3QYYA 3NLCA 4RKUC 5KFDA 1S1WB 2DGTA 4OV1A 4XPEA 4YEAA 4P2SA 4Y2KA 1N4LA 1U24A 4DG1B 4QQBA 1HD1A 3K5NA 4TN2A 2AF6A 3LWLA 1TK0A 5KAKA 1F5BA 2VBYA 2B6AA 5LXRA 2GMLA 1YJNS 3NGDA 2GMJA 3HHLA 3S6EA 4QJVA 4K50A 4NX9A 1N5SA 1S1UB 3HMJG 3HT3A 4C8YA 1C4AA 2XY7A 5H9FJ 3V6DB 5KFVA 4NLRA 2ZDPA 2QZ8A 5CHCB 1HW8A 1RT3A 3QIPB 3BSOA 1R0AB 2ABYA 3NBPA 3VQTA 2KYXA 3UPFA 4KHRA 5DM6Q 4QWAA 4CO5A 3KLIB 1S1TB 1H2TZ 2WB1D 4XDCA 3I82A 3V81B 3VR1A 1C0UB 1TR0A 4OZJA 4U7CA 4F4WA 1SJ1A 3K5LA 2J76E 2FLNA 4V19X 2FVCA 3WZ0A 2HS4A 3I0RB 4C3MA 3LPYA 5DGAA 1ELOA