4UQTA

Rrm-peptide structure in res complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
NEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U2 SNRNP COMPONENT IST3
publication title A Novel Protein-Protein Interaction in the Res (Retention and Splicing) Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uqtA00
2MZTA 2MQMA 1X4EA 2CQ3A 4F25A 3ZZZA 2RQCA 3LQVA 3P3DA 3Q2TC 2XNQA 1VBZA 2DNQA 3R1LA 5IM0B 1VQMS 1WHYA 4RU2A 4QU6A 5D77A 1X4DA 2O3DA 1JJ4A 3P6YC 1WEZA 2LEBA 1VC6A 1WG5A 1WF0A 3VF0B 1VQ4S 2LA4A 2MKSA 2B0GA 3MUMP 2DITA 2KYXA 4QQBA 2UP1A 2MZSA 2KH9A 2M4MA 2ERRA 5CXTA 2MKKA 3VAMA 2D9OA 2MXYA 1H2UX 2G0CA 3CCRS 4Z2XA 2E5IA 3OW2R 2YH1A 2DNPA 3SDEB 3G96A 1WG4A 2MY7A 2DO4A 2J0QD 3EGNA 2KXNB 4WKRA 3UCUP 2CPXA 2JX2A 1FNXH 3DLLQ 1SJ4P 2HGMA 4FXVA 3P49B 2DGUA 2MGZB 2KFYA 4WIIA 5LXYA 1PO6A 1VQKS 2E5JA 2ADCA 1NU4A 1X4CA 2M88A 2AYGA 1WHWA 2DGSA 2X1FA 4W92B 3S01A 2MHNA 1X5TA 2RQ4A 3HHNB 2DGWA 2DGTA 3CCMS 3MUTP 2U2FA 3U1LA 2VODA 2I2YA 1X4FA 2DNMA 1U6FA 1X5PA 2KHCA 5LJ3Y 1U1QA 2DGQA 1UP1A 2ADBA 3NS6A 1U1MA 3US5A 4CH1A 2CQBA 2D9PA 2FPHX 1OO0B 2DH7A 3SDEA 2LQ5A 2OSRA 1VQ9S 1SJRA 4IO9Q 5JVHQ 2DNLA 2CPJA 2CQ2A 4FXWA 4CQ1A 5GAGU 2ZJPQ 1VBYA 1NO8A 2CQHA 2VOPA 3CF5Q 2OSQA 3TP2A 3G4SS 2OJ3A 1VQ6S 1U1LA 2F9JA 5IQQA 2F9DA 2PE8A 2MQPA 2MGZA 1H6KX 3B4DA 1WF2A 1X5OA 2DGVA 4WCEQ 1URNA 2DNZA 3N9UC 2WBRA 1WHVA 2CPIA 3VAIA 3PIPQ 2ZJRQ 1VC5A 4YUDA 3NS5A 1UW4A 1Q86T 1U1RA 2G4BA 1F9FA 4OZ1A 1RK8A 3UD3P 2DISA 2QFJA 3MOJB 2RT3A 2DGXA 2CQGA 4IOAQ 2KG0A 2DGOA 3CC2S 2N7CA 4U67Q 1K8AT 1FO1A 4Y00A 3P5TL 1HD0A 4EGLA 2DB1A 2KG1A 3CCQS 2KRBA 1RKJA 3CD6S 1WF1A 3MD3A 3EX7B 2XNRA 3CCSS 2X1GA 1W2BR 2OIHA 1KD1T 5D78A 4C7QA 2LCWA 2CQ1A 1X4GA 3MI7X 4TU8A 3I56S 2KN4A 1OIAA 3VALA 2L08A 3RW6A 3CC7S 1U1NA 3CUNA 1SXLA 2CQCA 3FEYB 3H2VE 2KI2A 3UCZP 5LJ5Y 3MD1A 4W90B 1VBXA 2FC9A 2DH8A 4A8XA 2LYVA 1KOHA 1ZH5A 4P6QA 1NJIT 3CCJS 4PKDB 1M1KT 3BO2A 1M5KC 3PIOQ 2AYMA 1XN9A 3MDFA 1M5PC 2KRRA 3NNHA 2MZJA 4PR6A 1N52B 2XS2A 1DBDA 1ZZFA 4LJMA 3U1MA 2D3OR 4TU7A 3SMZA 5IM0A 2RU3A 2AYEA 2MYFA 2VONA 1YJ9S 2CQIA 1YI2S 2M8HA 2XSFA 1QVGR 1Q81T 2HGLA 3S7RA 2CPEA 4YB1P 4C0OC 1FT8A 2GO9A 3THPA 1WTBA 1U1PA 1VQOS 5ITHA 1UFWA 2N82B 3S6EA 2AD9A 1JJ2R 2LKZA 4C4WA 4PRFA 1QVFR 2XB2D 5DETA 2DIUA 2MY8A 2DO0A 3H2UB 1VC0A 5CA5A 2GHPA 3TYTA 3LPYA 2VOOA 2HYIB 2M52A 3S8SA 3CTRA 2MJNA 2BZ2A 1P1TA 2FHOB 2KM8B 1YITS 1U1OA 4IUFA 1WELA 5DDPC 4LIRA 3R1HA 2I38A 2YH0A 1SJ3P 1FJ7A 2CPFA 2XS5A 2EK1A 1S72S 4WFNQ 1FJCA 5JVGQ 2OTLS 2NZ4A 1S79A 4WF9Q 1N88A 1IQTA 1X0FA 3FEXB 2DH9A 1WI6A 2JRSA 3VAJA 1B7FA 3ZZYA 1L3KA 5FJ4A 2J8AA 1FHTA 3BO4A 2MKCA 1KQSR 1HA1A 4YOEA 2EVZA 1WI8A 3G6ES 2L41A 3HI9A 1YTYA 3CPWR 2CPHA 2CQDA 1WG1A 2MJUA 4QPTA 1VQPS 3K0JA 2YWKA 3BS9A 1WEYA 2DK2A 3MXHP 2L9WA 1DHMA 2E44A 4CH0S 3VAKA 2LEAA 1AUDA 5HO4A 2KXHA 2LXUA 1U6BA 3G8TA 3V4MA 3NNCA 2MKJA 2DNYA 4ED5A 2MQNA 2E5GA 2M2BA 2KT5A 2KU7A 3CCUS 2K3KA 4TU9A 5BJRA 3J7ZT 1PGZA 1DZ5A 3D2WA 3CC4S 3R27A 3MURP 2Q79A 1FJEB 5GVQA 5CYJA 2M7SA 1ZZNA 2BOPA 5GAHU 2MZRA 4J5OA 2K8GA 2EK6A 2FC8A 2U1AA 4F26A 5GADU 2CQPA 5DM6Q 4CIOA 2DNNA 2J0SD 1SJFA 5DDRC 1H2TZ 1G2EA 3J7YU 2M70A 2MQLA 2E5HA 2XS7A 2M9KA 4UQTA 5H1SV 1R8PA 1YIJS 2MZQA 3IRWP 2MSSA 5IFMA 2LMIA 1DRZA 2DHAA 2RVJA 2QEXS 5LSLA 5HL7Q 5GAEU 1YJNS 4LMZA 2CQ4A 1WEXA 2DNHA 2CQ0A 1X4AA 3I55S 1YWXA 2MMYA 2A3JA 3CXCR 1OPIA 4BS2A 4ERDA 1U1KA 2M8DB 1SJQA 3EGZA 4QU7A 4M5DB 1UAWA 2RRAA 3TO8A 1VQ8S 2DHGA 5MLCV 3NNAA 3UCGA 3UWTA 3JB9k 2N3LA 2LA6A 4Y0FA 2JVOA 3G8SA 5LXRA 1M5OC 1WHXA 4TLQA 3NMRA 3VAGA 1R8HA 2NLWA 2RNEA 2RUGA 1A7GE 1YHQS 1K73T 2RRBA 1N8RT 4OZ0A 5DDOC 2CPYA 3CCVS 2RS2A 1KC8T 2OTJS 2DNKA 2KVIA 3CCES 4WFBQ 2MKIA 3L3CA 1M5VC 4ZKAA 1FXLA 2MSTA 2DIVA 2AYBA 3BEGB 3THTA 3CULA 1Q7YT 4F02A 2LECA 3BO3A 2M0GB 2MKHA 5DM7Q 1JJHA 1KOOA 1WWHA 1M90T 1K9MT 2DNRA 4IOCQ 1VQ7S 1QM9A 3MUVP 2CPZA 1D9AA 3VAFA 1OWXA 2MB0B 2JWNA 2DHXA 5LSOA 2YTCA 3VAHA 5GMKa 2MQQA 3RW7A 1HD1A 2DHSA 1N54B 2MQOA 2KM8C 1BY9A 2CJKA 3CCLS 3B4MA 3DXBA 2LXIA 2FY1A 1VQNS 5DDQC 4WFAQ 2MZ1A 2CPDA 1D8ZA 2HGNA 5EN1A 2X1BA 3CMES 3Q2SC 2SXLA 2QA4S 2YKAA 1P27B 1Q82T 2DNOA 2G1DA 1YJWS 3CMAS 1X5SA 2F3JA 2RS8A 1H2VZ 3ULHA 2HZCA 3UE2A 2V94A 2HVZA 2KXFA 2MPUA 3G9CA 1JMTA 1U2FA 2J76E 3G71S 1VQLS 1CVJA 2DNGA 1A9NB 3SXLA 2PEHA 2X1AA 1VQ5S 2N3OA 1O0PA 4V19X 2JVRA 3UD4P 3IWNC 1X4BA 2ZJQQ 1HL6A 4UY8T 1X4HA
chains in the Genus database with same CATH superfamily
2MZTA 2CQ3A 3BKTA 2E9TA 2OAUA 4F25A 2AP6A 5BR8F 3R1LA 2MDAA 3I4PA 3L4BC 2LDIA 3VV2B 1XNRJ 3MR7A 3L7OA 2B0GA 2DITA 1XBWA 2M4MA 2GVZB 2YPYA 1Q95G 3PX0A 3MEEA 4OZJA 4RW9B 3CCRS 2Z56B 1N4LA 1TKZB 4OYOA 2OD6A 2H51B 3G96A 2AGOA 5HANA 1FFWB 3KK2A 1PO6A 1W2IA 2YNFB 2VU5A 4C6AA 2NQPA 2HQIA 4DR1F 3D68A 1TKTB 1S6OA 1WACA 4DL2A 1NK9A 2A6MA 2CZ9A 5ETPA 4DV5J 2AX1A 4MKVA 2HHVA 5A8RB 1JLGA 3QPIA 4NA1A 1U1LA 2MQPA 2F9DA 2GJFA 4NXMJ 1X5OA 5M2UA 2CPIA 3TEGA 2OFHX 1H38A 4ZA1A 2YNIA 4X64F 1RT2A 3M8PB 3LPEA 4KFBB 4LSZB 1S0VA 4FXDA 3BYPA 3CJ2A 1P1LA 2KTQA 1HQEA 2IAJA 4KHPF 1WDTA 1IJEB 2DB1A 2KG1A 5ETRA 3EX7B 4NRUA 1CC7A 4TLRA 2BM0A 1RTJB 1UJ6A 4TN2A 3DLKB 5J2PA 2HLTA 2AIRB 2FVSA 2L08A 4EZ9A 4RLEA 3CC7S 2J6SA 1Y9OA 1FJGJ 3UCZP 3TAMA 4O3OA 4X62F 3SIPB 3CT9A 3MF5A 3MR3A 3BO2A 1M5PC 2CXEA 1FK9A 2Y3YA 5HMWA 3RUBL 5KFRA 2WB4A 4NMLA 4DS5A 3I87A 6FDRA 5KFXA 4YB1P 1VQSA 1MROB 1ZETA 2GJ2A 2NZCA 3R9LA 3QJJA 1X0PA 2GIFA 5GMEA 1N5YB 3CDWA 4DL3A 2WOMB 2O01C 2XQCA 4NLWA 1RBOB 2LQJA 3GFXA 3Q8RB 1P1TA 1S7HA 2DBBA 1U02A 5B0GA 4N56A 2XS5A 1XQIA 3W7BA 3FEXB 4Y2KA 3R5AA 1TAQA 1WI8A 2Q6CA 1RLDA 3Q0AA 2G0JA 5A6WA 1TMMA 2ZHAA 3PRVA 2B9YA 1SC1B 3TNVA 3B54A 2KU7A 3CCUS 3JTPA 2QRRA 2PO4A 4Z37A 2FLNA 2YWHA 5J2MA 2FIUA 1WKJA 4USTA 2C2MB 2FJXA 1D09B 2XS7A 2MZQA 2BV3A 4EBDA 2CAJA 1Q8BA 4QYRA 2K1RB 1L5UA 1U4BA 2ATCB 2W8KA 4DUYF 4BS2A 2M8DB 1SJQA 4M5DB 1HQUA 4PWWA 4F2SA 4MKAA 5MLCV 2VG5B 3UWTA 1KEKA 4IRDA 4UOHA 4FS1A 5HATA 5F0UA 3I0SB 1N8RT 3TRGA 1SBRA 1HWKA 1PJ5A 1M5VC 2MKIA 1HBMB 4MK9A 4KRWA 2NSBA 2C2EA 1G6BA 5I3QA 2RQKA 5K20B 4JI0J 5DM7Q 3K17A 4B9TA 2DNRA 1VQ7S 2YX7A 4WTOB 3ENWA 3ZTRA 2CJ9A 1N36F 3POTA 3VAHA 5HVFA 2B43A 3QYYA 2MQQA 3CD5A 4YS2A 4IDKB 1ZTWA 3V6DA 3IG1B 2IJFA 1R27B 1NHVA 1RT1B 1PAEX 1WUUA 4XDDA 3RBZA 4BBYA 5EWFA 1A9NB 3FSIA 4KKOB 5I42A 2V0NA 2B7BB 3MPDA 1KHVA 3VGSA 4MIWA 1X4HA 5A0YA 4IRKA 1FRJA 3DI6B 4YB5A 1UZHA 2XNQA 1LK7A 1IKXB 3H42A 1QE1B 2NUUG 3OT9A 2VQEJ 3NGKA 4FYXB 1PIEA 3MHYA 4Q0BB 2WRMA 3VAMA 1E6YB 4MIBA 3IBCB 1SC6A 4MMOA 1WD6A 2KL8A 1AW0A 3TEHB 2E66A 2MKYA 3HF5A 3HHEA 2J0QD 2ALYB 1J5EJ 3KLIB 4EZ6A 2VUGA 4QWBA 1EP4B 4WTYA 3LWLA 2M88A 1WSRA 1B64A 4JI8F 2WW4A 1CEZA 2B4PA 1VLOA 3IC1A 4D3HA 3LGMA 4EWTA 4EI2A 5KG3A 4ECXA 4CH1A 2DXDA 2D9PA 5IXUA 4QWAA 2E7WA 2PSZA 5G0RA 1RWNB 1RADB 2F9JA 4WCEQ 1NK0A 1RKIA 1CJVB 4RX6A 4EYIB 3SFUA 2CJXB 1RAAB 1PG5B 3IGNA 5ETNA 2HQ3A 3MOJB 2OP5A 3BGRA 1YK9A 2UUBF 5K14B 2KDOA 4U67Q 3HVWA 3D9BA 3HULA 5M2RA 1ULRA 4AL7A 3VQTA 3TA0A 3SCKE 4C8MA 2GQCA 2F4VJ 3BR8A 4ZOSA 1CULA 2Z0GA 1MG7A 1HMVB 2GAHC 1AFJA 4FYYB 1BQMA 4DQRA 3ET6B 3H2VE 3C19A 2XSJB 2XY7A 4CLUA 1VBXA 2ZM6J 2DH8A 2NPIA 3OL6A 2AZ1A 1M1KT 1AB8A 2AYMA 3FVYA 1XN9A 3BH6B 5LMUF 5DO2A 2CVEA 5KFKA 1NK4A 3R3TA 4DN0A 2GQ2A 4CO1A 1YJ9S 1YI2S 3D6HB 3MZIA 1S97A 1WTBA 3GIRA 2QX0A 3NEKA 4F2RA 5ITHA 3EDRB 5HP1A 1DAXA 1QVFR 2WVBA 4PXBA 4CT9A 2HYIB 1I94J 3VHQA 4ILMA 4JI5J 1WELA 2DRAA 1SC3B 1FJ7A 3KNAA 2L48A 1F2GA 1FJCA 1IBMF 2HFNA 3DOKA 4M5GA 4HACB 4ZLLA 3OTCA 3SCLE 1TELA 1KQSR 1UFLA 1J5OA 4DWIA 1VLYA 4DPWA 4DG1A 3JS9A 3IS9A 3MXHP 2L9WA 2E44A 4ITSA 2FVPA 4CH0S 2LEAA 3SSRA 1BHNA 1UEKA 2HWTA 2J5AA 1LWXA 3QRPA 2KZMA 2OO4A 2ZHBA 4V1Ak 3CC4S 5G4DA 2FYXA 2MZRA 4FNIA 2IMWP 4N41A 2XM3A 1EETA 3WDOA 4RBTA 4DR3J 1LW2A 4FP9A 2M70A 1TK8A 5DG8A 1B70B 3DLEA 1YIJS 5KFEA 4LMZA 4PUOA 4NXNF 2NREA 3CXCR 3H5UA 2DEJA 4K4TA 2ZH5A 3TO8A 3PY8A 4RNHA 1ZAXA 3NNAA 3CJRA 3CIMA 4RNFA 3TARA 5JMNA 1M1GA 2QG9B 4K7QA 3ZO7A 4XDCA 1YHQS 3C8YA 3I5BA 1YSJA 4HTIA 2CNLB 3SCIE 5DDOC 3LALA 2CPYA 2VA2A 1R0CB 1JLGB 2PDAA 4M5NA 4ZKAA 4UZBA 4A8FA 2XYHB 1QAIA 3QGPA 4DSLA 4YY3J 4IFVB 3ZZOA 2YNIB 4IOCQ 3PZPA 2UXBJ 1T8EA 1FXDA 3MMBA 1HQEB 2W2PP 4BC7A 1FRKA 3W60A 3GU0A 1D8YA 4A4JA 1K44A 3MTKA 5EN1A 2ASJA 3HKZD 5E7OB 5ETKA 4ZCKA 1DLOA 1LFWA 1FDBA 1VDHA 3VQSA 2DYAA 1Y3JA 2DTJA 3ULHA 1GXUA 3OR1B 1T02A 4HVZA 3JQKA 1NB2A 4LFCF 1TU0B 2QSWA 2WSCC 1JNRB 1UVMA 1OS5A 4ZP8A 1LWEA 2RSQA 4YHHF 1VQMS 4QU6A 2AGQA 2VBZA 4I6WA 2VPZB 3C6UA 1WEZA 1VC6A 1YQHA 2OPSA 4ECUA 4LVNP 1RAFB 2AGPA 2G0IA 4DR2J 3IBWA 2ZBQA 5E41A 3EGNA 4ZS6A 1TR0A 3RTVA 2DY9A 4PEOA 2KT3A 4KPYA 2R7XA 4ES1A 2VDIA 4NZ6A 4WIQA 2EBGA 4A8QA 2DRDA 1VBKA 1S0OA 1MMDA 4LIWA 3DU5A 2G9OA 3FMWA 2HNZB 4LFBF 2ZITA 4ILRA 4C48A 1VJWA 2PD1A 1UVLA 2DH7A 4H54A 2CQ2A 4P2FA 2VOPA 3CJ8A 1VQ6S 1BLUA 2OJ3A 1P8GA 2BXJA 1KQKA 1CSJA 5J2MB 3HZEA 5B0FA 3OFEA 2OMLA 1HNWJ 1F9HA 1T7PA 4GKJJ 1Q86T 2LLZA 1RK8A 4DMZA 2EG1A 1OMSA 1OQ6A 4DV6J 3DC2A 3OR2A 2KG0A 4KGMA 3A8JA 5IWAJ 3CCQS 2KRBA 1W2BR 3SBMA 3NAIA 4J37A 1WKKA 5EUHA 4XK8C 3T5HA 1TTHB 4HI1A 5LL6d 4ZHRB 1QY7A 2KI2A 4IH6A 5C2CA 3MM9A 1MWYA 2W2NP 4A8XA 1V3RA 1G1XA 2A6OA 1LWCA 4KGKA 4NX9A 1RHUB 3SZ2A 4LJMA 1RYRA 2DCLA 4P7VA 2MYFA 2Q43A 3HVTB 4L72B 2VPYB 1QVGR 3D0IE 3J81j 3KMSA 1IR0A 1CQNA 1TKXA 1FFSB 1X7VA 4UOGA 1RZMA 4C8YA 4NOHA 4IG0A 3SSSA 1NBEB 2LKZA 2ZOGA 4P72A 4ZLJA 1HNIA 3IAS9 4KYZA 1S76D 2MJNA 1S9GB 3F56A 4IO1A 2YH0A 2BKOA 3PDNA 2IYGA 1IWAA 4H4OB 1T9WA 3OV7A 1RTHA 2XZTB 3G6ES 5I42B 2LFVA 1U6ZA 1Q5YA 1D1UA 1ZA1B 5HO4A 4ZVUB 2MQNA 2AWZA 4I6YA 4QPXA 3MURP 4ECVA 4I4BA 3PX4A 1TUWA 5L38A 4CDIA 2Y0BB 1T05B 4L3NA 5HL7Q 1YJNS 2H54B 4DR4F 3VVTA 4K4WA 4NCBA 3L7UA 1YRTA 4AL5A 3O2IA 3T41A 3BPDA 5I4MA 5T7LB 4Y0FA 3RBEA 2ZH8A 3GR1A 2FJBB 5CYMA 4M8LA 1WC1A 1OSDA 4U7CA 1JXEA 4NLQA 4ZP9A 2MHEA 6AT1B 3JSMA 2IJNA 2HEKA 2B5JB 2CPZA 2QFIA 2YX1A 4QW9A 1HNZJ 5HQMA 3BKUA 1C0TB 4DR7J 2H65B 3DXBA 4J9VA 4WFAQ 2BABA 4W98A 3KK3B 3JAMU 4ZJQA 1UZDA 3W2WA 2RB7A 5B09A 2DR5A 2XMTA 3DYAB 1H2VZ 5J2NA 5HVGA 2XZDB 4K0KF 1NJYA 2CIMA 2VBWA 3ZZRA 2EW9A 1NJZA 4LSNA 2XMMA 4H4MA 5F9LA 4F7VA 4ANCA 1S1XA 1DURA 2GIQA 2XHCA 4UW2A 2W01A 4CRJA 1VBZA 2RF2B 5KFYA 4RU2A 5K8NA 2NYIA 5HROB 5D77A 3QLHA 4IFYA 3C2PA 3D3CJ 2UV8G 2MKSA 5HP1B 4K5RA 1XC9A 2E1RA 1NSAA 2E5IA 2VPXB 1UVJA 3CSKA 2YH1A 1RT6B 2OFGX 5IOLA 3OD2A 1KNZA 5KFZA 1RJJA 5ETQA 1WSVA 3DOKB 5BYQA 3ADAC 5LXYA 3MPVA 4PWDB 1SL2A 3HHNB 2U2FA 5KFQA 4DG1B 3IS9B 1WTFA 4H4KA 1S6QA 5T14A 3NGRA 1H72C 1B0TA 2VC0A 1RAIB 3QGGA 3UFCX 5J1PA 3GJQB 1VS3A 2VG7B 4ED8A 3EPIA 2ZJPQ 3GJRB 1BC6A 3MCOA 3PW0A 2NXJA 1NDLA 3F41A 2QMXA 2V4JA 3LA0A 4ECQA 2PE8A 3ZFVA 2DNZA 3N9UC 1EETB 3PYGA 1DQAA 1LW2B 4KR0B 4DF8A 2QFJA 2H1YA 2GJIA 3DLEB 2DGXA 3HX9A 3DOLB 2V9WA 3R5BA 3RU0A 2GA7A 3DOMA 4B3RF 4HI2A 3NGSA 4R8UA 1HWIA 2BKPA 3RGIA 3QRQA 1H7XA 2JLEA 3TVZA 2ASDA 2HFOA 4HHJA 4X66J 4J9OA 1VOMA 4JV1A 1NHUA 3MM8B 2ZOFA 3FKBA 3OFGA 4WJBA 1KN6A 2QYCA 2IRXA 2R2SA 1IKVA 2V63A 4LBIA 3QAEA 4WP8A 2IPOB 1GMVA 4L6V3 1T3OA 3G86A 5A8KA 3BYRA 2FHMA 2VFTA 1DBDA 5K8PA 2XS2A 3KWMA 2IRYA 3MPUB 3U1MA 1KR4A 3EDQB 2OPQA 3TAPA 2CPEA 2F8MA 4FBTA 4Q5VA 3MMBB 5C24A 3KKFA 1FWPA 3UNGC 3FC9A 1JJ2R 4E98A 2D3ZA 4Y2MA 3EMTA 2CFXA 4BDPA 1KONA 4OJ3A 2DCUB 2YNHA 4X65J 3QFHA 1ZA2B 1OYDA 2FHOB 3IWLA 2QV6A 3W9IA 1TL3A 4FVCA 1N5TA 2V8HA 3TUIC 4NLXA 4NZ7A 4MK7A 3I96A 2HSEB 2CQDA 4CYUA 4RU9A 2D3O1 1RAJA 2PFDA 1EX8A 2IBOA 3GONA 1TFWA 1U0HA 4R5PA 1LWEB 3ZC4A 3SCJE 2BMBA 4ED3A 2KT5A 3R97A 3C6UB 2X3DA 3K8WA 3R27A 1RA7A 2Q79A 2M7SA 4ZJOA 1ZZNA 4J5OA 1NK7A 4UZCA 3PTWA 3HD2A 3M8WA 3OPKA 2NSCA 1NK8A 3HFKA 1F3FA 4DN9A 3JSBA 5H1SV 2VQFJ 4ID5B 2RDIA 3EWGA 2DNHA 1FWLA 3NG8A 1YWXA 2QLXA 1DARA 1ROFA 1W25A 2WONA 4LRBA 2ILYA 1S49A 4ZCLA 4N8NA 4QWCA 4OZ2A 1I3OB 1HLWA 1E6VA 3WX8A 3HSDA 4DPYA 5L1KA 5CCMA 1S4EA 2I1RA 2KVIA 5A2QY 1APSA 3BBCA 2PFFB 4GRSA 3OXFA 4DS4A 2M0GB 3KXDA 3SSQA 3TJAA 4FF1A 1K9MT 1U47A 5KG6A 2FJWA 2ZDOA 1GXLA 4UT4A 2PI5A 3OR2B 3NRBA 3NCPA 5KFPA 3GIMA 4RZRA 2DHSA 4I1TA 3H59A 2DKOB 4LR7A 1KS2A 3CMAS 1X5SA 3IRXA 3GV7B 2GCFA 2DHHA 1IBCB 1CS4A 2LU1A 4GKKJ 1GX6A 2BJDA 3NL0A 3A3PB 2HQGA 3DCAA 3DMJA 5E33A 3CCWA 2X1AA 2PEHA 4LF7F 1LWCB 4QWDA 2GV1A 2ILZA 2E9ZA 4XO0A 4UY8T 1O5JA 4B9SA 2HHHJ 1RTDA 2IA0A 2W7PA 5EX3A 3Q2TC 1JLQA 1VHFA 4PWUA 5L1JA 1X4DA 4QYZJ 4BWMA 5F8GA 4GC7A 2DY1A 1X9WA 1WG5A 1SKUB 2KYXA 3D5MA 2MZSA 2KH9A 2NXNA 1WOOA 3G8QA 1IKYB 2OPRA 2IMOA 3TX0A 2PMWA 4JB8B 2P9EA 3P4UB 2CJQA 3DLLQ 1SJ4P 1LV5A 2CYYA 1U8SA 3M4XA 1URRA 2AJQA 3AD9C 2CZVC 4XPEA 3SQOP 1AXQA 1OJ4A 4K4XA 1XIQA 1U6FA 1X5PA 3QJPA 3US5A 1HHSA 4OYAA 1PYTA 3ZTSA 5JVHQ 2DNLA 3T6BA 3TZZA 3EUNA 3BN4A 4DSEA 3G82A 3TP2A 3RB6A 4FF2A 3EJMA 3SYZA 3BV8A 4FN5A 3PYFA 5FDLB 2WVDA 3PR4A 1UW4A 3IN5A 3UD3P 4AQYJ 2CWKA 4WPAA 1F1BB 4OHZA 2CQGA 1GTEA 2MTLA 3CC2S 4OHVA 4DR5J 3AODA 1FO1A 1RKJA 5KFBA 4PQUA 2IM2A 3EYZA 2W9BA 2HVEA 4MK8A 2WB1D 1I5OB 3RW6A 4OYWA 1U1NA 2QE5A 4M5KA 1NM2A 5KT3A 2QT7A 2FC9A 5CYMB 4NXMF 4B9MA 3CCJS 2AT1B 4HKQA 4KHRA 1ACMB 2ROEA 4IRCA 3GG1A 1ZPVA 3VZHA 1FTRA 4KJIA 2CJBA 1GNKA 2QZ8A 3KJVB 4JI6J 5KFFA 1UTAA 1DY3A 2RKIB 2R7TA 1U1PA 2AU0A 3N6MA 1QUVA 2MQ8A 5KG2A 3AFGA 3S6EA 5IZHA 4CLKA 5DLFA 2AJ1A 3WBZA 3EM1A 3SFGA 3D6TB 3PKYA 3OL8A 4USHA 4QYZK 4IKAA 5BYRA 1U1OA 2HURA 4CCHA 3CJ4A 5KFDA 4RL1A 2CPFA 4ZLPA 2EK1A 5JVGQ 1JLEA 4ALZA 4K59A 4OX6A 1RWVB 1EJ7L 4H4MB 2ZZTA 4HTJA 1R0AA 1S1XB 4ZPWR 3C15B 3BS9A 3HKWA 2Q6BA 1SKRA 3LAMA 3AOCA 2QMWA 1RHJB 4DV0J 3D6MB 3J7ZT 4RBVA 4LQ9A 1IKWA 4DV3J 4PG6A 3O5TB 2QIFA 2VG6A 2BOPA 2BANA 2E7VA 4NA3A 5DM6Q 4CIOA 4J9KA 2DNNA 3BBFA 3AA9A 3Q8YA 4OMFG 1RDRA 4KV8A 1YJVA 1FD2A 3BKFA 1PAUB 3T3FA 1JIHA 2CQ4A 4YR3A 3BQ2A 3PW7A 1QTNB 1LWFB 2H5EA 1UAWA 3ICLA 4YMEA 4K4SA 2PIIA 3Q89A 3JB9k 3CJTA 1S6QB 3BR9A 2JVOA 4MYUA 3G8SA 2E1AA 2KT2A 1F6TA 1JLBA 2P9GA 3W66A 1LQ9A 4F4AA 2D7SA 1SH2A 2WCXA 4I68A 3M2UB 4F4ZA 2DNKA 4GVBA 4WFBQ 2ZBPA 2XMWA 4ZPTR 4URGA 2YQ0A 4K8RA 2B6AA 1S1UA 1C4CA 1NPRA 2H5JB 2HKEA 3VAFA 4DSIA 1WKLA 1TL5A 3DOMB 2ZH4A 4P2MA 3QBCA 5DDQC 2GW8A 1HBOB 1C0UA 3NGDA 4A47A 1KLMB 1JJCB 3KJQB 2J8SA 1JLFA 3TUPA 2RDDA 3DHXA 3MM6B 3L95X 4DQIA 1QSYA 3IAM9 2DXEA 1IKVB 4DXLA 3THVA 3T9ZA 4JI0F 2N3OA 1O0PA 1JQGA 2P6TA 4U6PA 3UD4P 3FEZA 5A8KB 5AE3A 3R6GB 3ZZZA 4OYZA 1EZZB 3LQVA 3UN2A 2NS1B 3R2CJ 3B82A 2K06A 3Q22A 1FKPB 2O3DA 1V3SA 1JJ4A 5F3TA 4JI7J 2LEBA 3VF0B 3T1HJ 3T1YJ 2UP1A 1HNVA 5A8WB 1IBKF 1SKSA 2ERRA 5CXTA 4XIUA 2MKKA 2B4OA 4DSKA 5KFHA 5KT6A 4OX9J 1FE4A 1SUQA 3RRKA 5HMYA 2AZ3A 1JB0C 1RWPB 2Z4PA 2Z2MA 1REVB 5IC6B 1IBLJ 5AT1B 1RT5B 2RHSB 3QSYB 2ASYA 1TL3B 9ATCB 3UVJA 3M8YA 3M8ZA 1NB7A 1Q53A 2MGZB 3DKDA 3RYLA 1N48A 4OYIA 4BHQA 3IWXA 4DZDA 2DGWA 2GVZA 4G65A 1HPZB 4CYUB 1RI7A 4RW9A 3AHPA 5BR8J 1FNMA 5CABA 1TKZA 2FD2A 3TA1A 1U1MA 2WVFA 2HZVA 3N6LA 3DM2A 3FCWA 5GAGU 1VBYA 3MEDA 4P73A 4G1QB 2O5DA 4L74A 4NPOA 2R2UA 1Q7LB 1I6JA 1RU2A 4MT1A 2XYPB 4FKXA 2YNFA 3EXYA 2WBRA 2Z58B 3VAIA 4C8KA 3BBBA 3PIPQ 1VC5A 1XK8A 1UPPA 4YUDA 2UZAA 1TKTA 2G4BA 2GAGC 4NLOA 5DZ7A 1UVNA 2RU9A 3PV8A 1YG0A 5A8RA 1CG2A 4JI2F 4DQPA 3KLFB 2BJ1A 2X1GA 2HMIA 3DRRA 3IMQJ 1KD1T 2VFUA 2QC3A 1D3WA 2WONB 4DR1J 3IR7B 3UPFA 4J9LA 3MI7X 3MMCA 2KN4A 5EX0A 3BQ0A 4MJKA 3WIVA 5L46A 1D9DA 1OY8A 2J9CA 3M8PA 3R5GA 3NLCA 4KFBA 1EQ0A 4L76A 5DG7A 4W90B 2V8VA 3P45B 1T9UA 4ED2A 4DX7A 2R7RA 4PKDB 2NXUA 2G2ZA 4DV7F 1N52B 2FVCA 1LNQA 2XLKA 1RCXB 1HKAA 2K3IA 1RTJA 2GVDB 4X64J 3DLKA 3LH2S 4KB7A 1IVZA 1S99A 3P8BB 4MKYA 1FCAA 2N82B 4Q8EA 4A48A 1ZTTA 4C4WA 2CVIA 3NOGA 2XB2D 4Y34A 2H4WB 2E1PA 2H3EB 2M52A 4KQZA 3S8SA 4NL5A 4LIRA 3DLBA 2ZM6F 4J90A 4DL7A 7AT1B 1U24A 1S72S 1FD8A 4NLRA 1MROA 2GGPB 4ECSA 2JRSA 3TZYA 4X62J 5C25B 4OI3A 5JUMA 3LP0B 3KUHA 4OV1A 4ZLNA 2MKCA 3DMJB 1UCNA 4JV5F 2HHWA 4YOEA 4EMDA 2L41A 4KGZB 2EEYA 1N5YA 2WOMA 2KJVA 1IUJA 2P8IA 1C2PA 1RTDB 3WC0A 2IFXA 4FPIA 2HHTA 1JLQB 1P9QC 1B0VA 3W9HA 3K2YA 3FZBA 1FTCA 2V2ZA 1RACB 2CQPA 3RR7A 1Z1ZA 3U1NA 3U7JA 4ZPVR 1PYSB 2LMIA 4LF8F 5GAEU 1HHTP 4OV6A 3PHEA 2KZZA 4Z7YA 1AFIA 2UXCF 4CZCA 3OXGA 3GCXP 4R0EA 3GZ7A 2A18A 1UEVA 1ZOTA 4PXEA 1RWWB 1REGX 5EHHA 1GAOA 2DEIA 2W25A 3JSRA 3DGVA 4KAIA 3CCES 3G82B 2HBRB 4WWSA 3MEGB 3HP6A 5DQHA 1KVIA 4M5DA 1T3NA 2EFOA 3DXSX 4OYXA 2IRUA 2VG5A 4DOZA 1GH8A 3PJXA 3D6FB 1CJTB 2AEJA 3PR5B 2MB0B 4URQU 2AQ4A 4ZVGA 3TVYA 3H40A 1M5HA 1RT4A 3RW7A 3GIKA 4CLTA 3CB4A 1N54B 4DUYJ 2HS4A 3CCLS 2HHXA 4C3MA 2FY1A 1HBMA 3PCOB 1P27B 3LW5C 2A2DA 2F3JA 1FX4A 4P74A 4DI6A 3HJVA 1GX5A 2DR7A 2ZKUA 2KXFA 5B0DA 3WC2A 5L9XA 1IM4A 4ED6A 2ACYA 1SH3A 3CJ3A 3SXLA 1C4AA 3HHLA 2YKQA 4IDKA 2B8QA 3QQCD 4LBPA 2D1CA 2Q1LA 3P3DA 2POKA 3M32B 3R5CA 1T9YA 3OSNA 3IG1A 2ASLA 2R2RA 3J7A1 3ENAA 3LF0A 1N36J 4I2PB 1NZAA 4YQWA 3HSZA 1BWVA 2LA4A 3CD7A 1Q79A 1RT1A 1ZPWX 4OZNA 4WK3A 2WAQD 4KKOA 3WIUA 5L1LA 1VCTA 1TV6B 3UCUP 1QE1A 2N4CA 3DLGA 3MEKA 4HH1A 3AA8A 1PBUA 2YWWA 2X1FA 3HLUA 2HHQA 3K59A 3CCMS 1PKUA 2GC8A 3LP1B 2MLZA 2PN6A 1E6YA 1HI1A 5F3ZA 2E1CA 1NK5A 1N0VC 1JWWA 5SZTA 3PHTA 3M8SA 2LQ5A 2ZUGA 1SJRA 4DX6A 5KG0A 1EP4A 3OVBA 4ZPBA 3D1QA 2UXDF 4DPOA 1DTQB 4M1KA 4RPFA 4NLPA 1KVKA 1NKEA 3AQOA 3GG0A 3EVWA 4DDFA 3P5TL 4WYWA 3OJUA 2QLJB 1TZ0A 3MD3A 4LT6A 1PSDA 2OIHA 5KFAA 1LEOA 2JLFA 1UWAA 4XTTA 2OELA 1BE4A 1S6PA 5C2GA 1Y7PA 3MFHA 1CJVA 3VZIA 3KLHA 3CUNA 2BOAA 4CI0B 3UQSA 4DPXA 3PFOA 1JLBB 1ELOA 4DV4F 3BZQA 4P7TA 4P6QA 3ZZPA 8RUCA 1TUVA 1HARA 4TQRA 3I0RB 2KRRA 1AT1B 2V8PA 4PG5A 3HVRA 3GQCA 1YBAA 3AD8C 1FVSA 2J0WA 3SV4A 4YB7A 4Q43A 2UUBJ 2PEBA 2XSJA 3OTEA 4O4RA 2W2QP 2IC3A 1ZM4A 2HBZB 4M5MA 3TYTA 3HT3A 2V68A 4TY9A 2W2OP 5D8HB 2E7XA 3R1HA 5L9NA 2FDNA 2NZ4A 5CH7B 1N88A 3R7SB 4A8SA 3Q8VA 1LOUA 1Y0HA 1NDPA 1EIYB 5LMUJ 1K47A 2ZH2A 2VPWB 2XC9A 3VAKA 2W4CA 2E5GA 3ETOA 1VK8A 4KTQA 3FK4A 1DZ5A 3NKYA 3RRHA 1HNVB 2EI5A 1VR6A 5GVQA 2XMJA 4TKTA 3AJDA 2GFFA 2K8GA 4GC6A 2GIRA 1RB0A 5HVHA 3BSNA 1LXJA 4IR1A 1FWKA 3CVKA 3IRWP 3IO1A 3FRYA 5SUHA 3UVJB 1IBMJ 5HAOA 4AT1B 5JXSA 3UR0A 2OEMA 2EC2A 2RRAA 4WU3A 3HT0A 2DHGA 1YJ7A 1KQGB 2CUYA 4QZVB 2UU9F 4X4SA 1H3DA 5I3PA 3C14B 2RUGA 3DM2B 4OZ0A 5KFVA 3MEDB 3L3CA 3QRRA 3K5MA 1Q7YT 3IM8A 5I3UB 4IQXA 2NYHA 4NI2B 4ZDNA 2MKHA 3J81Y 4ES3A 3TANA 2AEFA 3H7HB 4O3RA 1U48A 3D4JA 3G2XA 2KFNA 4M95A 3E01A 3BGFA 3KNGA 3EICA 4K4ZA 1BY9A 5KFMA 2HMIB 3DRRB 3QNWB 1XTZA 3FCVA 1TL1B 2SXLA 2YKAA 3Q2SC 2QA4S 2JC1A 1X9MA 3MMCB 2ZD1A 2VFVA 3W65A 1IWGA 4IFVA 4JV2A 2L9NA 1K1QA 4I2QB 1A0OB 5K8OA 1JMTA 3AXMA 3DRSB 3GPAA 3OTBA 2NPFA 3W5ZA 4CWBA 1RBAA 2ZJQQ 4USVA 2BUNA 3OUYA 3Q8SB 2XLJA 4ECWA 1U25A 2PGCA 2I5JB 1Q8IA 4B3SF 1Q0NA 3OR1A 4Y3CA 4EBEA 4KSEB 1OSCA 4B3TF 3ZTOA 3UDEA 1H2UX 1A6LA 2HRTA 3KK1B 4MTPA 3OJSA 2C1EB 2B9EA 2IDLA 2EC0A 4ZJLA 4LFCJ 4ED7A 1RAOA 5KOWA 2RQ4A 2RE1A 3T6JA 4EUVA 4YHHJ 3NAHA 2Z8QA 1H98A 1KTQA 4UOFA 1RHQB 4HL9A 4F3MA 4YFUA 4CQ1A 3QSIA 2OSQA 3GCWP 4C2MA 1GTHA 4EK2A 5HBMB 1IJFB 1WHVA 4K5SA 1GQEA 3W8GA 1RWXB 2GMHA 1F9FA 1XNQF 4WU2A 2HNZA 2Y1IA 1NAQA 2CZ4A 5K8MA 4RR5A 3G87A 1HD0A 1WF1A 2XNRA 1RXOB 1N5QA 4DPTA 2W24A 4C7QA 2LQ8A 3DNCA 1TKDA 5EWEA 2HBYB 2FJEB 4TU8A 4I6AA 4G3IA 2FVRA 5AXKA 3OTOF 1R89A 1NMEB 3AJ1A 2BJ9A 1JLCA 4G6VB 4OFZA 4USJC 4DCJB 1NJIT 4DEZA 1R8CA 1NJWA 2J9DA 2P6SA 5ETMA 4NA2A 4NLVA 1ZZFA 2UVVA 3EZ5A 3OL7A 4JUZA 3DDNA 4OZLA 2FGCA 1RAEB 4PYAA 4ZHRA 4DR6F 4QR1A 4F50A 1RT4B 3CDBA 1TAUA 3LGNA 4N8OA 2KVQE 9RUBA 3V6KA 3H2UB 2GHPA 2HK2A 4Y2CA 1V5VA 2J7KA 5L8RC 4N76A 1TFYA 4TNOA 1YITS 1HIYA 4JOUA 1Q8LA 1EAYC 3HVTA 2QA1A 1S1TB 2BEFA 1DQ8A 4LF6J 3VAJA 5CCLA 5E3PA 3OXLA 3H25A 4GVLA 1YKWA 4QBUA 5T41A 2CPHA 4ZVHA 5M2PA 3HHLB 1WEYA 2C2OB 4O3PA 1LKZA 1RT3B 3KUEA 1XEZA 2LXUA 1S9GA 1PILA 4ED5A 1FKOA 4A8OA 1CJUA 2B3TB 4X4OA 1F3VA 1R7IA 4H4OA 2O66A 4OYPA 2EPIA 2X3GA 4X65F 7FD1A 4EEYA 4FKYA 5KFCA 3SI8A 5GADU 1SL0A 3QWPA 4RKUC 1RE1B 1UVKA 5F8HA 1XERA 2Q66A 5AE2A 3PYEA 2V69A 1RHKB 3ENVA 4JI4J 2CQ0A 1V9OA 4ZCMA 3DLGB 4OHXA 2D69A 1GMUA 2A3JA 3A3NB 2YVSA 3PVXA 2UUWA 4FYDA 2LA6A 1KDNA 3VAGA 4I67A 1T05A 2NXEA 2RNEA 1A7GE 1S9EB 3GJTB 4AYBD 3TWZA 2HFZA 1IN0A 3NP5A 3W63A 4X4QA 2V4RA 1FDDA 1RT7B 3QGHA 2YKPA 2NCKL 3H5XA 5T7LA 3KLGA 2F8HA 2HHUA 5LSOA 1KLNA 4DR4J 3JYTB 4I7FB 1MNEA 1SPBP 3P5BP 1D8ZA 2YKMB 2BJ8A 3D7SB 3FBBA 1S6PB 2VBYA 1S77D 2F7VA 3KLHB 4DV2F 1HI8A 3H4DA 5KT2A 4LFAF 2DPIA 2B5JA 4OJHA 4DUZF 2CADA 3AD7C 1P9YA 3ILLA 5K9FA 1C0TA 4O3QA 1R6YA 1U2FA 3V6HA 5A2QU 4J7CA 3W9JA 1H7WA 4DU7A 2BQUA 1X4EA 3CJSA 3KK3A 2V9KA 1W26A 1LK5A 3LOUA 2B8PA 3DYAA 3P6YC 1HW8A 1GFWB 1FI4A 2J7UA 4USUA 2QSFA 1YRUA 4U9RA 4Y6IA 4RWXA 2IC3B 2DVIA 1RWMB 1EKSA 2XY6A 4Z2XA 3LGHA 4X2BA 3ZZ0A 5KG1A 1MU2B 2UUCF 3SDEB 4MYTA 2RF2A 4UUXA 3RR8A 2ZKTA 3FMBA 1NJXA 3BB5A 5HROA 1MMNA 4XPCA 2JFKA 4IH7A 3Q24A 2E5JA 1NU4A 4Q2LA 4WXWA 3M9NB 3I82A 1RUSA 1WC6A 2FTRA 3MM5A 2KYZA 4U96A 2VODA 2BR0A 3KLEA 2QTWA 4FNHA 4DHVA 2C2RA 1O51A 4Y2IA 3PW4A 1RT6A 2CQBA 1FESA 2R7WA 3D54A 3GV5B 1NO8A 3CF5Q 3PO4A 3NWGA 3FCHA 1YLXA 4PWDA 1UETA 2DGVA 3E8OA 1URNA 3BF4A 3QT6A 3D0HE 3M7VA 2BRLA 3PM9A 2XCPA 3E3XA 3AOBA 4IOBA 4NMXA 4EO8A 2VJUA 4LF4F 2N7CA 3V4IB 1JLAB 2IM1A 3DRYA 2VG7A 3AT1B 3Q23A 3CD6S 1NZ8A 4WBFA 3TOQA 4IYQA 1MWQA 3C6TA 2CQ1A 3OLBA 2LDYA 3MAAA 1BQNA 3L9ZA 2M5YA 2Y8YA 5LJ5Y 1Y3KA 3DOLA 1HYSA 1RGVA 4RUCA 2F63A 4J9MA 2QLFB 2R8JA 1AUSL 1YDLA 3GB0A 3R2DJ 3RB3A 4F8RA 1RQ0A 2K7JA 3C16A 3W62A 1U26A 4KGXB 5E3CA 3E01B 3MM8A 3T1AA 1UKUA 4DBQA 3H20A 1HBNB 4B3RJ 3T5JA 4ETXA 3BGUA 1ICEB 1X8DA 1F9EB 2QJ3A 3TR5A 1QDUB 1R43A 3KYLA 4ATNA 3H98A 2XO6A 2ZD1B 2KM8B 1T11A 5KFUA 1SJ3P 1AROP 2OTLS 2FUG9 1MWZA 4QW8A 3HK2A 5FJ4A 3QO9B 5J1EB 2J7WA 4B9UA 4JI3F 2HWHA 4DLGA 3OUYB 4AXIA 2C3UA 2BE7D 4B3MF 1YX2A 4GO5X 3V4MA 4RUAA 1GMWA 5KFNA 4PCQA 4PAAA 3QWUA 1KRPA 4WKYA 1XMOF 1FJEB 1KP6A 5THWA 4DCOB 2IVMA 2EK6A 4JI1F 3GP9A 1YBUA 2VL1A 1ZM3A 1H2TZ 3O6QA 1CBKA 1R8PA 1QSLA 5J2QA 2X7IA 2RVJA 4DJBA 3ZNUA 3KHHA 5F0WA 2HNDB 1AYEA 3I55S 3CJKB 4ID8A 1FVQA 1VRQC 5ETSA 1VQ8S 3IR5B 1Z4UA 3GMGA 4TLQA 5E3RA 2GS8A 3AB4B 4QR0A 1R8HA 2NLWA 2HRUA 5F8IA 1FRIA 4FPRA 3GYNA 4ID5A 5DG9A 3AH6A 5HQ8A 1KC8T 1KFSA 4HHUA 3FDSA 1TL7B 4PYDA 1HW9A 5C5JA 4CTAB 4F02A 2LECA 2QA4G 1KQFB 1UPMB 2XWYA 1N34F 5HLFA 4PG4A 2XHWA 3F73A 4ZN3A 1N6QB 4R0JA 2HAFA 1R6VA 3RG6A 1GXTA 2G1DA 2Q3PA 3QGIA 3W2VB 4PPZA 3PACA 3NY0A 3BGLA 5ETVA 4NLTA 3IR6B 2HZCA 1WJ9A 2Z2YB 3DU6A 5CD4H 1JLCB 3UW1A 1JK9B 2ZH3A 2QL7B 4C11A 4FBUA 1IR2A 2ZWOA 4V19X 2Z30B 1HHQA 1VRTB 4YR0A 1T94A 2BRKA 3BH7B 5E2QA 1VMBA 2A1BA 4J9SA 1QAXA 1RBLA 1VQ4S 2AMCB 3HDSA 1UA1A 2G13A 2EFGA 1FRXA 3TQ1A 3RB0A 2G0CA 4RW8B 5RUBA 1G3OA 1RSCA 2DT9A 2IY5B 2BW2A 4FF4A 1RYSA 2CPXA 1WC0A 3Q8PB 3BDPA 4FXVA 1N32F 1AZSA 3CMQA 4QIGA 3K5PA 4H4KC 2B51A 1BQXA 3R8YA 2KHDA 2HK3A 1X4CA 2ZE2B 5DS7A 4ZPAA 3JTNA 3U1LA 1KTVA 1IKYA 1T0TV 1RHMB 1UL3A 1RP5A 3PW2A 2WSEC 3RAQA 1EQMA 1B7YB 2AF6A 1FKOB 3ILIA 1CJUB 2DR6A 3G4SS 5LMNF 3LANA 3CW2C 3OHAA 1KWMA 3CCZA 4NCAA 1IBLF 3F44A 4CH7A 1FRLA 5HMZA 2O67A 3NS5A 1U1RA 4J9UE 2DGOA 5D4OA 3UDVA 1ZAVA 1PYOB 3EXCX 4KT0C 3CCSS 2Y1JA 4NYOA 5D0RA 2ZC3A 4ES2A 3GJSB 2QA2A 5DLGA 4ANDA 2WW8A 2YQ3A 5FDLA 3H8YA 3D0GE 4B9VA 1SXLA 4OJGA 3TVKA 3D1HA 3MD1A 3A12A 1NLKL 5KG7A 3PIOQ 1S7IA 3QZ7A 3NNHA 2VJVA 2KO1A 3HD1A 1WORA 1VYAA 2HW3A 4KE5A 4HYKA 1Q81T 3S7RA 1NXIA 3KLGB 2JHEA 2GO9A 3MPWA 1O8BA 3D67A 2XULA 1S1WB 1UFWA 5AJ3F 1RISA 1N5VA 2B56A 4X4VA 1O6XA 3V81B 1S57A 3MGJA 3IM9A 2VOOA 1BXNA 2VHGA 3KJVA 3W8PA 2FB0A 2RKIA 1B7FA 3MCMA 2J8AA 5F8MA 1AA1B 3AQPA 1IXKA 2EVZA 3OTDA 2GNKA 1VQPS 3K0JA 4N47A 2CDRB 1DHMA 3PX6A 3TUZC 3N0VA 1U6BA 2JEGA 2R8HA 1VIXA 3K57A 4USKA 2E5LF 2QYGA 2WSFC 3D2WA 4YDXA 2XO7A 4RWWA 4OZ3A 1FX2A 5GAHU 3GFZA 2H48B 5AXLA 3K7RA 4RJVA 3M2VB 5CYQB 3H0PA 3C15A 2HIQA 1G2EA 3J7YU 2MQLA 3FUYA 1S1VB 4UQTA 2MSSA 5H9EJ 2LU2A 3F0NA 3KG0A 2DHAA 1U49A 3NGUA 2W8LA 3CO9A 2MMYA 2APOA 3EPGA 4ERDA 4AXJA 4ZVQB 5KFIA 2IVFB 1S59A 3MM5B 1L3UA 3FBEA 1ITPA 4ZCIA 1HNXJ 3W1YC 3KLEB 3MTJA 4IH5A 2A0FB 1M5OC 4O44B 1UW9A 3I5CA 1HWLA 2XMAA 3D66A 4ICLB 4NYZA 3QT5A 2RS2A 3MR5A 4OHYA 1FXLA 2PMHA 3W5YA 4KH0B 4C9DA 4LF5F 1LWFA 1UFKA 1L3VA 4U7UK 1RA6A 1T9XA 2ATLA 4IG3A 1R0BG 1QM9A 5LSRA 1QD1A 4I69A 2BACA 2B7CB 2XY5A 3L09A 2ZEJA 2GHVC 3HSJA 4OLPA 2E29A 2YTCA 1ZM2A 2HVDA 5GMKa 1VFJA 1XMQF 2P5VA 2VFRA 1T9TA 3KHGA 1FRHA 2QO3A 1VQNS 3M2UA 3W61A 3CMES 4WK1A 1F60B 3RJMB 3C6TB 3KUGA 5B0EA 4DU8A 2RS8A 1HR0J 1N33F 3MAAB 1BQNB 4USWA 1EB0A 2HVIA 1HYSB 3A8KA 4TYBA 2ZBRA 3I31A 2VH7A 3IWNC 2OH2A 3JQMA 4F3QA 1EKRA 1HBOA 1KLMA 2L9DA 2CA9A 3C16B 1B4SA 2OMOA 4AUKA 1N56A 5F8LA 3DGPA 2CG4A 5KFOA 3MM6A 5B0AA 4RO0A 2A2CA 3QIDA 2EBEA 1SQEA 2WTFA 4QIEA 3I5AA 2MXYA 3M8QB 4M5JA 1VRUA 2AHOB 1TQLA 4LR9A 3TA2A 3MOZA 4X84A 2DNPA 2FZKB 2R42A 2KXNB 4WKRA 5LM7E 3N28A 3P49B 4OI6A 1J2VA 1FKPA 1QTMA 3HXMA 1SQGA 4UQGA 4KY3A 1C1BB 5A8WA 2WZ1A 2AJ2A 5H9EK 4KBIA 4C0HA 3FFIA 1R8BA 2HQDA 3ZZUA 2DGQA 1REVA 3QJLA 4ECTA 5L39A 4X4UA 2ABYA 1RT5A 4MH8A 2XGPA 4F0HA 2N7YA 3PW5A 1BMQB 2HFVA 4OI2A 2CQHA 2CRLA 4JYAJ 2XZWA 5B08A 4NLSA 1YGYA 2MGZA 2VB6A 3BM7A 1IBKJ 4DLEA 2OKQA 2HHPA 1OQ3A 2KKHA 3UN3A 1HPZA 2ZFHA 3H2LA 4C3LA 4KO0B 4NLUA 3E51A 4B9LA 5J2QB 2WBMA 2HZAA 1QUPA 3GFYA 4DZ6A 2YKNB 5IT9Y 4NLYA 4G1QA 1OPZA 4B3OB 3B6BA 4TQSA 3ETMA 5CAAA 1V3ZA 5HI7A 4F04B 4RW6B 4MFBB 3N4WA 1LXNA 1C1CA 1OIAA 2OPPB 2WVEA 2JSXA 3CCTA 3BJYA 4F3OA 4GO7X 3NWRA 2R3VA 2LYVA 3EVOA 3FQKA 2CNOB 4F36A 1ZH5A 4C98A 3KG4A 3KLFA 2MZJA 1BGXT 1GK8A 5IM0A 1HBUA 2MEWA 5HLFB 4NRTA 5EDWA 3EZOA 2MLXA 4DV1J 3RRGA 2H5IB 1SV5A 4LR8A 4CLLA 4JI2J 3IP0A 3RAMA 4NE9C 3OVSA 5D3GB 1T9VA 4A8MP 2ZH9A 1Y00A 2RQMA 4L75A 3GR0A 5DDPC 2RIJA 2UVWA 1SCJB 2I38A 1RABB 4S0MA 1U2RA 2GVDA 1CJKB 3KMQA 4WFNQ 1S79A 2RRNA 3LO3A 1NSPA 3PRDA 2D41A 3OSPA 4WZQA 4C11B 3GLJA 1SIWB 3DHWC 3LAKA 4UF4A 4DV7J 4IQMA 4MKBA 2DK2A 3UD5A 1BD6A 3D1OA 3OVAA 3M6VA 2MKJA 4FS2A 4L73A 4YN3B 2GGPA 4A8YA 5C25A 1MLAA 2UUAF 5DQIA 4DSFA 3LP0A 2XWXA 2V5HG 2AEMA 3PO5A 5KTQA 3MM7A 5IFMA 4A8WA 2P9CA 4OX8A 3SQGB 4U7UD 2ZZMA 1GMWD 5E5NA 3K58A 3A8EA 1AZSB 4ZP6A 4LF9F 4JV5J 1RTIB 3LP2B 3TW0A 3RAXA 1S0MA 3B8HA 2IM3A 2IVYA 3UCGA 1RU1A 3MCSA 2F4FA 1YRXA 1FNOA 4QIWD 3M6UA 2JOQA 5DZ6A 4ECZA 2HVHA 1FE0A 2FZCB 4OYBA 1HWJA 1WWHA 1T03B 2JC0A 1XNRF 3EGVA 3VGUA 4LF8J 3O3LA 3X1LB 3KHRA 3V6JA 1LW0A 2BJ7A 4P71A 1XR5A 1FEHA 2G1HA 2CPDA 5F8NA 4K4YA 3MEGA 2UXCJ 3R6LB 4USIA 2GMLA 3ZTPA 4J91A 4RW7A 4YB6A 1LFPA 3RB4A 1CJTA 4NLDA 3GSIA 3VTIA 3MEEB 2BYCA 3GIJA 2B9XA 3QZ8A 3CIZA 2YPZA 1OY9A 1X4BA 4FVMA 3FQLA 3J81U 4OLOA 3GYGA 5D0HA 2XG8A 4URSA 5HMXA 3KK2B 4DV5F 2YY3A 3M2RA 4QOTA 4UOCA 2M3DA 4TXSA 4Y2AA 4X4RA 2D9OA 2XEXA 2COLA 4JP8A 3OW2R 1PC5A 3CO0P 2ZHOA 2DO4A 3M32A 4DF4A 2V2VA 4UY85 2HGMA 4ZMMA 1B0PA 4LRCA 4I2PA 4WFYA 1X5TA 4CM2A 4O3NA 4CM0A 3Q8UA 1RT2B 1KSPA 3QIPA 1CC8A 2KHCA 3DDKA 2IJRA 5HN0A 1WC5A 1TV6A 3CJ0A 4WYLA 2IAJB 1FJGF 2FPHX 1OO0B 3VGTA 4EYHB 2C2DA 1QAYA 1RLCL 3ISND 2XBPA 4DL6A 3CDAA 3JTOA 2JEIA 1H6KX 5LOQA 1WF2A 5GAGI 4L3KA 5J2PB 4BCAA 2JL9A 3AJ2A 4KPCA 2IDEA 3A1YG 4B08A 4PZVA 3LP1A 3WZ0A 2XGQA 1VIOA 4OZ1A 2YBVA 3TAMB 4AE5A 1RWKB 1H73A 4M5LA 3CJQA 2Z57B 1FK9B 1R8AA 4CO4A 3R5JB 3MECA 1DTQA 1FEEA 4ZPDA 3VVUA 1HI0P 3WHIA 4WZMA 1D9FA 3J80Y 2HIYA 1KOHA 1Y4ZB 2EFPA 1M5KC 3W3SA 2CNKB 3MDFA 2UXDJ 2R2TA 5HSPA 5FLXY 2D3OR 1U09A 4A8KA 2AYEA 2BJ3A 4IG3B 2HGLA 4M94A 1FT8A 2K7KA 2PMZD 2ACMA 1Q5VA 1NKCA 4Q2MA 4RUBA 3TZXA 1SI9A 3O8WA 1U2CA 5DETA 3O1LA 2DIUA 2MY8A 1VC0A 5CA5A 3DN9A 3I0RA 1Q78A 2BZ2A 1WOPA 1YJRA 1M1HA 4ZVSB 2ZNZA 2R7OA 1F5BA 1U45A 4CO5A 1J27A 2DH9A 3MR6A 4DV4J 1WI6A 1ZBTA 2ZWPA 2DR8A 3M05A 2CJAA 3GTYX 1FHTA 3BO4A 5DJBA 5FD1A 4RNOA 3M1VA 2AJ0A 2GX8A 2YWKA 3UO0A 2VD3A 2XMUA 1ZS6A 5DGBA 2HWIA 4OI1A 5D4PA 4K2JA 2HS3A 1AUDA 3PRBA 4DX5A 2DNYA 2M2BA 3LUYA 3DGPB 4RNNA 5BJRA 1HQUB 2P2CB 5CYJA 1XJWB 4CLPA 2FC8A 2BDPA 4N7TA 4ZVRB 2J9EA 1VRUB 2JDJA 2BQ3A 4QJVA 1FFGB 1U7LA 2AKWB 3TZWA 4LF6F 4E0DA 2CJYB 4DL5A 2YNGA 3HVAA 1U0SA 5D15A 1WEXA 4WXOA 4F4WA 5GAEI 4M63A 1VISA 1TUGB 3J7Z5 3NS7B 2ZZNA 3FFIB 3HHKA 5LXRA 2JLGA 1NH7A 3POTB 1JXLA 2R7SA 1MN7A 4B17A 4J9NA 2QLBB 2MSTA 1Z2LA 2DD8S 3ITHA 4C97A 3V6DB 4F4KA 1EARA 3BN7A 4ZK7M 4NEZA 4OIXA 2YWGA 3TX8A 4EBCA 1M90T 2UUTA 4YDDB 2HLUA 4JI4F 2VQEF 2QLWA 1RWOB 4ZVOB 1OWXA 2VZ9A 3VGVA 2DHXA 2VF3A 4ELUA 2V4QA 2FVQA 1K1SA 3C14A 4PG8A 5A0YB 1TVRA 2HGNA 4GMKA 3H90A 3MAHA 1Q4RA 2JJ4D 1Q82T 2DNOA 1QLNA 5I3UA 4NI2A 1MN9A 5IV4A 3I6PA 1YZ6A 1C1CB 2UU9J 2R7QA 3JSYA 1J5EF 3TQEA 2FHKA 1NSQA 3UE2A 3HHLC 1Y5LB 4DUTA 2HBQB 3PEHA 4JBCA 2IHR1 2V50A 5F8JA 2J76E 5U47A 2DNGA 1NCLA 2VKRA 3IGVA 3PJWA 3X3UA 3JXOA 4P2SA 4ILLA 5B0BA 2LEPA 3DDIA 1TL1A 1HFEL 5IM0B 1VJQA 1HBUB 4HT5A 2ZBIA 5BXIA 4I2QA 1SV5B 2V8DA 5F9NA 2YWEA 3DRSA 5D0EA 1HQ2A 3C46A 1NPKA 3O44A 4U8YA 1WG4A 2MY7A 2W7OA 3HPOA 2JX2A 3PG9A 5G0RB 5D6GA 3BDEA 2I5JA 4LBHA 1YJTA 2Y8WA 4WIIA 3R7NB 1P6TA 3WQPA 4C8NA 2AYGA 1WHWA 2DGSA 2HNYA 4W92B 2F4VF 4KHPJ 4KC5A 1S4FA 3I9ZA 4MAKA 3W5XA 1X4FA 3KK1A 3BGRB 2VICA 5MAOA 1FKAF 1D0EA 1CPZA 3D28A 2PI4A 4IO9Q 1RAGB 4B3SJ 4Q7AA 2C3YA 3MMJA 3KTQA 1CULB 3M6XA 2JZ5A 4B3TJ 3QT7A 4ECYA 1PJ7A 1BQMB 4BC9A 3MM7B 2QL9B 2DISA 2RT3A 2OHDA 4DL4A 5B0CA 8ATCB 3N6NA 4C0BA 3ILJA 3AAWB 4LRFA 4TY8A 3MWBA 5JJBA 5D4NA 4OHWA 2LCWA 5HBMA 1I94F 4JI5F 4HH0A 2LP4A 1X31C 2OUGA 4U95A 4ELTA 1NK6A 4DL0C 1S9FA 1WNEA 2BE9B 2I8EA 1Q16B 1XNQJ 2XSFA 2AJ4A 2BJEA 3NMAA 3T9NA 2FJAB 2FJDB 1J5OB 3K5OA 1FERA 1LW0B 2RUSA 2ZNYA 4PRFA 3CGIA 3FSYA 2F8EX 5KT7A 5HJXA 1I51B 1XMBA 4NEYA 4OJ1A 3B78A 2W1BA 2HPUA 3CTRA 4DR3F 5B7WA 3TAQA 3OTOJ 4RW7B 4CNYA 1NNDA 1V5IB 4CLZA 3N01A 5BYSA 4CP5A 1VGYA 4K4VA 2LQ9A 2F65A 3MAQA 2GO8A 3N5BA 1YTYA 1DQ9A 1WG1A 4FZVA 3ZTQA 2C3OA 5KFJA 1Y11A 4U8VA 3E2EA 1SJ1A 3I32A 1PBAA 4PUOB 4ED0A 3ISZA 4NYPA 4OZ5A 3M2RB 4TU9A 2FLLA 4DR6J 1S1TA 4F0KA 3EGWB 3RBDA 2VA3A 2OD4A 5KT4A 4YY3F 4X4PA 1KBRA 2UXBF 2E5HA 1GEHA 4N5SA 2FZGB 1RT3A 1DRZA 3M8RA 3M30A 2OEJA 3DRPA 3K5LA 2RMLA 1EHWA 2NR0A 3T19A 3EGZA 2KFZA 2YXLA 2R8KA 3MMAA 3QIPB 3T5KA 5KG4A 2V8GA 4OQJA 3UI3A 4Y65A 2LVWA 2W4PA 4K4UA 3TJ8A 1JNZB 2XMVA 2J6UA 2DIVA 3BEGB 3THTA 2F1FA 2V6AA 1F0XA 4ZIWA 1DLOB 1RWUA 1Y5IB 5D0GA 2VFSA 3OQ2A 2GZOA 2AJFE 2CWXA 4OL8A 4F67A 3MPYA 1S9EA 2V2KA 3I9V9 2RD5C 2KM8C 3GWCA 3CE8A 5CQGA 3ZZTA 5IT0A 1RT7A 5HJYA 4DR2F 3MECB 1YJWS 2YWFA 4B02A 2D3UA 5IS2A 5ETTA 4CLFA 1R31A 2OPSB 5KAKA 2ZH7A 2ZH1A 4LF2A 4D3GA 4UUWA 3G71S 1VQLS 1CVJA 4WP9A 1B3TA 1VQ5S 3JYTA 2PA8D 4I7FA 2HQCA 2FGOA 4F0MA 4P10A 3DLJA 2W9CA 4JI8J 2YKMA 4O4GA 5CHCB 2C28A 1M5SA 4I56A 2DNQA 1WHYA 4PQAA 2EWHA 1VHIA 3GIIA 2EKYA 3GYXB 1Y5NB 3TUJC 1JXVA 2BKNA 4J9RA 1UWBA 3DLHA 1JKHA 3J7AN 1HNWF 8AT1B 4GKJF 4R25A 4CLWA 4HDGA 2GHWA 4DV2J 4DV6F 3CD0A 4LFAJ 3IXQA 1UVIA 4ZVTB 4DUZJ 2DGUA 2RHQB 5IWAF 3HHDA 2KFYA 2ADCA 4P52A 5C42A 4FF3A 1QSSA 2Z2LA 3S01A 3Q8QB 3MUTP 3M1VB 4ZVEA 5CZXA 1ZAWA 3UNYA 1MU2A 3SDEA 4NLGA 5K5MA 3KDNA 2OSRA 1VQ9S 3CEDA 4FXWA 4C3KA 4ZN1A 3M6WA 1WOSA 2LQBA 2ALZA 2ZJRQ 3VCDA 5CD4A 2UUCJ 3QT8A 3MM9B 3ELHA 4IOAQ 3AB2B 4NCGA 2YNGB 4LRDA 5CZVA 2R7VA 4Y00A 1SC4B 3FNNA 3KOAA 4FYWB 1H74A 1F5AA 2NXCA 2Y9HA 3I56S 2XLIA 3A8IA 1TKXB 3MCNA 3FEYB 1CQMA 4IG0B 2OEKA 4EO6A 1V6HA 4NWBA 3V4IA 1JLAA 1HNIB 2J6TA 2BE2A 3ITHB 3IFEA 1NRKA 4DX8H 4PR6A 4P75A 4LSLA 1S5ZA 2JNJA 4DQQA 1TK5A 3JQJA 3A3OB 2CQIA 2J0XA 2ZH6A 2VDHA 3THPA 2HRYA 2DJWA 4LF4J 1VK3A 1RTHB 3UN5A 4USMA 1F5CA 1VI7A 4PPDA 4LREA 3AXKA 1TVRB 2BQRA 2XMKA 5DQGA 2FHJA 4ED4A 1TMJA 2NUHA 1HWUA 5E3AA 2VBXA 1IQTA 1YVFA 1X0FA 3FSXA 2GMJA 5IQ6A 3ZZYA 2RJZA 4F4XA 4ECRA 4BLGA 3BSOA 1HA1A 4NXNJ 1HBNA 3HI9A 2MJUA 3VWSA 3KJNB 5GMDA 1S48A 2BX6A 4KIAA 4M5IA 3BPSP 1DTTA 4PABA 2A10A 2KB2A 5EWGA 2YQ1A 2VC1A 5HK4A 4ELVA 2B4VA 1UMJA 2FY8A 2ZUAA 1UEUA 1PGZA 4DPUA 4YP3A 4ENOA 1UA0A 1IQZA 3QO9A 5J1EA 5KFSA 2I9SA 4CO0A 4QR2A 1QAJA 1ZM9A 2O1PA 1SIZA 2AV5A 2QL5B 5GADI 5A76A 1HNZF 2R7UA 3PXGa 5LSLA 4O23A 4DR7F 1X4AA 3D3BJ 3FZ2A 4CLYA 1IR1A 2MLYA 4ANEA 2HNYB 5A6PA 3JSMB 4RNMA 2UVRA 4JI3J 3V5RA 2N3LA 3C3LA 5HQLA 4MIAA 4B3MJ 4C8ZA 4CNZA 2ZVSA 3R7BB 3PJ9A 1XMOJ 1N5SA 3EVMA 5KT5A 1X9SA 2HNDA 3HSGA 2XI2A 2H9ZA 4KGVB 1OYEA 3W2WB 3NBPA 4OI4A 2CKWA 2AYBA 3CULA 3CJKA 4JI1J 2C3PA 2DPJA 3EZUA 3OL9A 4OYMA 1KOOA 4RW4A 5J2NB 2FLPA 4F4YA 3MUVP 4AD6A 3OFHA 1RCOB 4LSNB 4I64A 3FJ2A 2VIHA 1G7CB 4QIVA 4TY8B 4ZIVA 2MQOA 4QWEA 3B4MA 2LXIA 1HNXF 2N4DA 3MFIA 1TL7A 2W9AA 4CTAA 4G1PA 2CDQA 2QMUB 4LQ3A 3QLHB 4IFYB 3PYDA 2BM1A 4WFXA 3KG1A 2V94A 1F2HA 2AX0A 2MPUA 4ZVPB 3ENQA 1N6QA 3QFWA 2RILA 1KKHA 1HL6A 2BW7A 2MQMA 3LWMA 4A46A 2HHSA 3W2VA 3ILOA 1N34J 4LFBJ 1SL1A 4HEA9 2C2NA 2ROPA 4QQBA 3BGOP 1MMLA 2DR9A 3R5DA 3OHBA 5H9FJ 5E0OA 1HR0F 1VRTA 4DFMA 2V67A 4TVAB 5IV3A 2W2MP 2V4JB 1K0VA 2XI3A 1Y10A 4CO2A 2HFUA 5IT4A 2BBEA 3K8VA 2DGTA 2EFQA 3CJ5A 4X66F 2HFSA 2UV8A 4RW8A 3NS6A 4OX7A 4WFZA 2I6WA 3UDLA 1S10A 1RAHB 2CPJA 4O3SA 3LTOA 1I1GA 4R8UB 3DRXA 1B99A 2IIHA 5IQQA 3B4DA 1N0UA 2ZE2A 1W7WA 4WE1A 5KFWA 4CT8A 3H4BA 2IBKA 3BSAA 1NDKA 4M5HA 2QN6B 4CLSA 1BWEA 2C2KB 2WVCA 1NSKL 3M30B 1N32J 3DRPB 4HLBA 2IA6A 2E9RX 2F40A 3Q83A 2JFDA 5D78A 4V19J 5DGAA 2EKNA 1FDNA 2KJWA 2C3MA 3MMAB 4HT7A 2OPQB 3PKMA 4KH1B 4E8UA 3VALA 3CWJA 5C24B 3RZAA 2CNNB 4JYAF 2B4UA 4QIFA 3S1TA 1L3TA 1NEEA 3NOCA 2R8GA 2C22A 5LMNJ 2Y1RI 5KFLA 2YNHB 3QAUA 3Q86A 4NZ0A 4LF1A 4IR9A 3KHLA 5KOXA 2RU3A 4ZP7A 7FDRA 4J9PA 3HFZB 3KDOA 4RUHA 4W4MA 2VKZG 2JH3A 2HG4A 4O0IA 5IT9U 2F5GA 2DO0A 3OLAA 1U0HB 4R5PB 1TL4A 3GSDA 4E2FB 4NASA 1L3SA 1NH8A 3UR3C 2IYIA 2VQFF 4IUFA 2J9DE 4X4NA 3HMJG 4WF9Q 2CG8A 2XCAA 1L3KA 5H9FK 3N79A 1S1WA 2X51A 3EE3A 3CPWR 5AE1A 4QPTA 2W9CB 1UJ5A 3V81A 5DRKA 4O4GB 2RH3A 4PXDA 2ZVIA 3G8TA 4DV1F 1FRMA 3NNCA 4EU0A 2ZOMA 2C2ZB 1XWLA 3AY0A 5AJ3J 2YKOA 2DRBA 4Q45A 1YBTA 3HJFA 4LVOP 1R3NA 1UWBB 4HR2A 4EFAC 3FGVA 1FF2A 4LUBA 2J0SD 1JKHB 1SJFA 5DDRC 3M9MB 3PNIA 4DCPB 1E6VB 2M9KA 3ZNJ1 5ETLA 2QEXS 3I4HX 1SB6A 4Y28C 1U1KA 1PJ6A 4QU7A 5C42B 3JAMY 5C7PA 5AXMA 3SEOA 4QCLA 2FLOA 3HHLD 3M2VA 5CYQA 4GKKF 4UTGA 2XTJP 1S1VA 1K73T 2RRBA 2E5LJ 1SQFA 3CCVS 3QATA 1H0HB 1YJUA 4K0KJ 1NPPA 2JEJA 3G6XA 3IRXB 3U02A 5F41A 2HHHF 1CS4B 2IM0A 2UVUA 3QMQA 3HCXA 1D9AA 4O44A 4ZITA 2VASA 2JWNA 4N77A 4NCGB 4C8OA 1WC3A 4Z7CA 3AOAA 5LT5A 4ICLA 2CJKA 2MZ1A 1S12A 1S0NA 3KLVA 3HZGA 2I0XA 2X1BA 4YEAA 4ER8A 1VQYA 3V2UC 3H5SA 4PXCA 3BQ1A 2Y1LB 4K50A 3FBFA 2HVZA 1FDAA 1PC4A 1OY6A 4AFFA 2OPRB 2BE2B 2JVRA 4LF5J 2XYGB 4HDHA 2K2PA 3W64A 2RQCA 3GILA 1FXRA 2G2YA 4LSLB 2BA9A 3IBFB 3CNQP 1XR7A 3TJ9A 1X60A 3P96A 2OI2A 1WF0A 3OBIA 4XAKA 3KJFB 4DFKA 1KVJA 5E3QA 3MUMP 5ETOA 1XMQJ 3K5NA 1NKBA 4ZVFA 4KHMA 3NGTA 3G6YA 3ISNC 3A4TA 4AQYF 4O0NA 1XR6A 1N33J 1FNXH 4DR5F 4AL6A 4K2XA 3RBXA 4DQSA 2K1RA 2EFVA 3A13A 1VQKS 2WHOA 2G2OA 2OLWA 2MHNA 2R8IA 2I2YA 3M8QA 2DNMA 3FRZA 5LJ3Y 1U1QA 2ZC4A 1UP1A 2ADBA 1DTTB 1WDDA 4OI0A 3I0SA 2VV5A 1K0TA 1FA0A 3NCRA 4PQUB 1TP7A 1GT8A 2W9BB 2RAQA 3M9OB 1S6UA 2ROGA 2C42A 2FQQB 2D74B 1C1BA 3HFVA 4PG7A 3BREA 3FBCA 4JI6F 4G1IA 4X4TA 4LRAA 1K8AT 2W4DA 4FDFA 4EGLA 1G4CA 2R4FA 4P9SA 1JX4A 1X4GA 2E1MC 4J9QA 1TK0A 3U27A 2Y0SD 3GFHA 2CQCA 2ZDPA 4KO0A 2GQQA 2DXFA 4Q44A 3SV3A 3NBPB 1NUEA 2YKNA 5FIIA 2BVZA 4B3OA 3DI6A 3CDUA 4RW6A 4TU7A 3SMZA 3ONQA 1IKXA 1U8WA 4RW4B 4MFBA 2VONA 4P2XA 2M8HA 2FJVA 3NXZA 3IA0A 4C0OC 1KHWA 2OPPA 1JLEB 1VQOS 4DV0F 4DV3F 5D4LA 4CO3A 1R0AB 2AD9A 4Q0BA 5AXNA 2V2QA 1CLFA 3LPYA 1M0SA 1NDCA 1YZ7A 4I0WA 1PCAA 3KLIA 3K89A 4JV0A 4C8LA 1Z2ZA 1IKWB 3J80U 2VG6B 3DFEA 2BANB 3PEJA 1BUXA 2ZBCA 3G6VA 5FLXU 1SH0A 1RHRB 4KV8B 2FHJD 4Q8FA 5D3GA 2B9WA 3VR1A 3TI0A 3CDEA 6FD1A 2KXHA 4ETZA 1DFDA 2PT0A 2K3KA 4DFJA 1CJKA 2QGFB 2LXFA 1SVDA 3GV8B 4RBUA 1DJ0A 5L1IA 2U1AA 4F26A 1Q1KA 5GAHI 2HAIA 2YX4A 1SKWA 2EFNA 1NHKL 4ZPCA 3HM9A 5K14A 1RTZA 2PA3A 1WC4A 3J7YI 3HO1A 4GVBB 3L7PA 2V34A 1OPIA 1QJHA 2B6AB 3BSCA 1S1UB 1HMVA 3H5YA 2AW0A 2OGUA 2EXUA 1WHXA 2W7AA 3NMRA 2H4YB 3ET6A 5KFTA 3ZXWA 3UDCA 2Z2ZA 3SQGA 4YR2A 2OTJS 4BWJA 3NCQA 2UUAJ 1C0UB 1RTIA 3LP2A 3BO3A 4DFPA 4LF7J 1JLFB 4FYVB 4WE1B 4DSJA 1JJHA 1Q8KA 2WK4A 3KFWX 4HHHA 1MSWD 2PC6A 5IC4B 1ZYQA 4B9NA 5ADZA 4JI7F 1UJ4A 3MR2A 3T1HF 3T1YF 2HS0A 3C66A 3PFEA 1HD1A 2HQFA 4LF9J 1MW7A 1IM6A 4OX9F 3WX4A 5J1NA 2L3MA 1T95A 2R9LA 3N5FA 4TYAA 3T5LA 5KFGA 2RDJA 1KFDA 1T03A 5KG5A 2JEFA 2EG2A 3OFFA 3GE9A 4HACA 3G9CA 4ED1A 1SUQB 4WP3A 5EGYA
chains in the Genus database with same CATH topology
1O5JA 2MZTA 1X4EA 3KK3A 4ILLA 2V9KA 2CQ3A 5B0BA 2E9TA 2OAUA 4B9SA 4F25A 2LEPA 2AP6A 1RTDA 2IA0A 5BR8F 5EX3A 2W7PA 3Q2TC 1TL1A 1LK5A 1HFEL 3R1LA 2MDAA 3LOUA 5IM0B 3I4PA 1JLQA 2LDIA 1VHFA 1HBUB 3DYAA 4PWUA 5L1JA 1X4DA 4HT5A 4QYZJ 3P6YC 1HW8A 4BWMA 2ZBIA 5F8GA 4GC7A 1X9WA 1WG5A 3L7OA 2B0GA 2J7UA 2DITA 2KYXA 4I2QA 2QSFA 1YRUA 1XBWA 3D5MA 1SV5B 2MZSA 4U9RA 2V8DA 2KH9A 2M4MA 4Y6IA 4RWXA 2IC3B 5F9NA 3PX0A 2DVIA 3G8QA 2YWEA 3DRSA 3MEEA 4OZJA 1IKYB 4RW9B 2OPRA 2XY6A 3CCRS 4Z2XA 2IMOA 3C46A 1N4LA 1TKZB 4X2BA 3ZZ0A 3O44A 2OD6A 5KG1A 1MU2B 2UUCF 3SDEB 3G96A 4MYTA 1WG4A 2MY7A 2W7OA 2RF2A 4UUXA 2AGOA 3HPOA 2P9EA 3RR8A 2CJQA 2ZKTA 2JX2A 3FMBA 3DLLQ 5G0RB 1SJ4P 5D6GA 3BDEA 1NJXA 2I5JA 3BB5A 1YJTA 3KK2A 5HROA 1MMNA 2CYYA 2JFKA 4XPCA 4WIIA 1PO6A 1LV5A 1P6TA 1U8SA 1W2IA 2E5JA 4IH7A 3Q24A 1NU4A 3M4XA 2YNFB 1URRA 4Q2LA 4WXWA 4C8NA 3M9NB 2AYGA 1WHWA 2DGSA 3I82A 2HNYA 4W92B 2AJQA 2F4VF 4KC5A 1S4FA 2NQPA 2FTRA 2HQIA 4DR1F 3MM5A 2KYZA 3I9ZA 4MAKA 1TKTB 2CZVC 1S6OA 4XPEA 2VODA 2BR0A 3KLEA 1AXQA 1WACA 1X4FA 4K4XA 4FNHA 1U6FA 4DHVA 1X5PA 3KK1A 2C2RA 1O51A 4Y2IA 4DL2A 3BGRB 1NK9A 3PW4A 5MAOA 3QJPA 3US5A 1RT6A 2CQBA 1HHSA 1FESA 2R7WA 1D0EA 1FKAF 1CPZA 3D28A 3D54A 3GV5B 2PI4A 2AX1A 2HHVA 4IO9Q 5JVHQ 2DNLA 5A8RB 1NO8A 4Q7AA 3T6BA 3CF5Q 3EUNA 1JLGA 3BN4A 3QPIA 3PO4A 2C3YA 3NWGA 4DSEA 3MMJA 3TP2A 3FCHA 3RB6A 4NA1A 1U1LA 3KTQA 2MQPA 2F9DA 4FF2A 1X5OA 4PWDA 1UETA 2DGVA 3E8OA 2JZ5A 3M6XA 3SYZA 1URNA 4FN5A 3BF4A 5M2UA 4ECYA 2CPIA 3D0HE 5FDLB 1BQMB 2OFHX 3PR4A 1H38A 2BRLA 4ZA1A 2YNIA 3PM9A 4BC9A 1UW4A 4X64F 1RT2A 3M8PB 4KFBB 2XCPA 3IN5A 1S0VA 3MM7B 3UD3P 3E3XA 2DISA 4FXDA 4IOBA 4EO8A 2RT3A 3CJ2A 4DL4A 1P1LA 4OHZA 5B0CA 2KTQA 2CQGA 1GTEA 4LF4F 1HQEA 3N6NA 3CC2S 4OHVA 4C0BA 2N7CA 3V4IB 1JLAB 1FO1A 2IAJA 2IM1A 3DRYA 4KHPF 1IJEB 3AAWB 2DB1A 2VG7A 2KG1A 4TY8A 3Q23A 1RKJA 3CD6S 3EX7B 3MWBA 4NRUA 5JJBA 5D4NA 5KFBA 4PQUA 2IM2A 1CC7A 3TOQA 2W9BA 3EYZA 4IYQA 4TLRA 4OHWA 2BM0A 1RTJB 1UJ6A 4TN2A 4MK8A 2LCWA 5HBMA 3C6TA 1I94F 2CQ1A 2WB1D 3DLKB 3OLBA 2LDYA 5J2PA 2HLTA 4X4UA 2FVSA 4JI5F 2L08A 3RW6A 4EZ9A 4RLEA 3CC7S 1U1NA 2QE5A 4HH0A 1BQNA 2M5YA 2J6SA 5KT3A 1Y9OA 2QT7A 3UCZP 5LJ5Y 3TAMA 1Y3KA 3DOLA 1HYSA 2FC9A 4O3OA 4X62F 5CYMB 4NXMF 1RGVA 3CT9A 4B9MA 3CCJS 3MF5A 3MR3A 3BO2A 4RUCA 4HKQA 4J9MA 4KHRA 1M5PC 4ELTA 2ROEA 4IRCA 1NK6A 2R8JA 3GG1A 1FK9A 1ZPVA 3VZHA 4DL0C 5HMWA 1S9FA 1WNEA 3GB0A 1FTRA 5KFRA 4KJIA 2CJBA 1GNKA 3RB3A 2WB4A 4F8RA 4NMLA 4DS5A 2I8EA 3I87A 6FDRA 1Q16B 2QZ8A 1RQ0A 2K7JA 3KJVB 2XSFA 5KFXA 4YB1P 2AJ4A 2BJEA 1MROB 1U26A 1VQSA 5KFFA 3NMAA 3T9NA 2RKIB 1ZETA 2R7TA 2FJAB 2GJ2A 5E3CA 2FJDB 1U1PA 3E01B 2AU0A 3MM8A 3QJJA 3N6MA 3T1AA 1QUVA 1X0PA 1UKUA 4DBQA 3H20A 5KG2A 1HBNB 3S6EA 1J5OB 3K5OA 1FERA 5IZHA 3T5JA 4ETXA 3BGUA 5DLFA 1N5YB 1LW0B 3CDWA 2AJ1A 2ZNYA 3WBZA 4DL3A 4PRFA 2WOMB 3SFGA 2O01C 3CGIA 3FSYA 3PKYA 1X8DA 3OL8A 2F8EX 5KT7A 4NLWA 2LQJA 3GFXA 1XMBA 3Q8RB 3TR5A 4OJ1A 3B78A 2HPUA 1R43A 3KYLA 4USHA 3CTRA 4DR3F 4IKAA 5B7WA 3TAQA 1P1TA 4ATNA 3H98A 5BYRA 2ZD1B 2KM8B 1S7HA 1U1OA 2DBBA 4RW7B 4CNYA 5B0GA 4CCHA 4N56A 1NNDA 5KFUA 3CJ4A 1SJ3P 5KFDA 2CPFA 3N01A 4ZLPA 5BYSA 2XS5A 1AROP 1VGYA 2EK1A 4K4VA 5JVGQ 2LQ9A 2OTLS 2FUG9 1MWZA 4QW8A 3W7BA 3FEXB 3HK2A 1JLEA 4ALZA 3MAQA 4Y2KA 3R5AA 4K59A 4OX6A 2GO8A 3N5BA 5FJ4A 3QO9B 5J1EB 1TAQA 4H4MB 1WI8A 4HTJA 2Q6CA 1R0AA 1YTYA 2J7WA 1DQ9A 3Q0AA 1S1XB 4ZPWR 5A6WA 4B9UA 1WG1A 4JI3F 2HWHA 2ZHAA 4FZVA 3BS9A 4DLGA 3OUYB 3HKWA 4AXIA 2C3OA 2C3UA 2B9YA 5KFJA 3E2EA 1SJ1A 3I32A 4B3MF 2Q6BA 1SKRA 3TNVA 3LAMA 4GO5X 4PUOB 4ED0A 3V4MA 4RUAA 5KFNA 4PCQA 2KU7A 3CCUS 3ISZA 3QWUA 4NYPA 2QMWA 4OZ5A 1KRPA 3M2RB 3JTPA 4WKYA 4TU9A 1XMOF 2FLLA 3J7ZT 4RBVA 1S1TA 4LQ9A 1IKWA 4PG6A 2QRRA 3O5TB 1FJEB 5THWA 2QIFA 2VG6A 2PO4A 4Z37A 2BANA 4NA3A 2BOPA 3EGWB 3RBDA 2FLNA 2IVMA 2EK6A 4JI1F 2YWHA 2VA3A 2OD4A 5J2MA 2VL1A 5KT4A 5DM6Q 4YY3F 4X4PA 2FIUA 4CIOA 4J9KA 2DNNA 1ZM3A 2FJXA 1H2TZ 3AA9A 2UXBF 4OMFG 2E5HA 2XS7A 4N5SA 3O6QA 1RDRA 1R8PA 4KV8A 2MZQA 5J2QA 1YJVA 1QSLA 1FD2A 1RT3A 2BV3A 1DRZA 2RVJA 4EBDA 4DJBA 3M8RA 3KHHA 5F0WA 1Q8BA 4QYRA 1JIHA 2CQ4A 2HNDB 3M30A 3T3FA 3DRPA 3K5LA 3I55S 2K1RB 1L5UA 2RMLA 1U4BA 2W8KA 3CJKB 4DUYF 4BS2A 4ID8A 4YR3A 3BQ2A 3PW7A 2NR0A 3T19A 2M8DB 1FVQA 1SJQA 1LWFB 4M5DB 1HQUA 2H5EA 1UAWA 3EGZA 2KFZA 3ICLA 2R8KA 4YMEA 3MMAA 1VQ8S 4F2SA 4K4SA 4MKAA 2PIIA 3IR5B 5MLCV 1Z4UA 2VG5B 3UWTA 3QIPB 3JB9k 3T5KA 1KEKA 1S6QB 3BR9A 4IRDA 3GMGA 5KG4A 2V8GA 2JVOA 4MYUA 3G8SA 4TLQA 4FS1A 2E1AA 2KT2A 5E3RA 5F0UA 3AB4B 4OQJA 4QR0A 1R8HA 3UI3A 2NLWA 4Y65A 2HRUA 2LVWA 5F8IA 3I0SB 1JLBA 2P9GA 1FRIA 1LQ9A 4FPRA 2D7SA 2W4PA 3GYNA 1N8RT 1SH2A 4K4UA 3TRGA 4ID5A 1SBRA 2WCXA 5DG9A 4I68A 3AH6A 5HQ8A 1HWKA 1JNZB 3M2UB 1KC8T