4UQTA

Rrm-peptide structure in res complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
b'NEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U2 SNRNP COMPONENT IST3
molecule tags Translation
source organism Saccharomyces cerevisiae
publication title A Novel Protein-Protein Interaction in the Res (Retention and Splicing) Complex.
pubmed doi rcsb
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4uqtA00
3R1LA 3G96A 2K3KA 4QPTA 5IQQA 4ERDA 2LMIA 2DK2A 2KXFA 1U1PA 3NMRA 3CC2S 2KRBA 3MXHP 4IUFA 2V94A 5HO4A 2DGUA 3J7YU 2D9OA 1KOOA 2LA6A 2DH7A 2DGTA 3CCES 1KQSR 3G8SA 2MZ1A 2CQGA 1JJHA 2CJKA 2KM8B 4LIRA 5LSLA 1YTYA 1YJWS 2OTLS 3IRWP 1UP1A 5GAEU 1JMTA 1W2BR 4YOEA 2RU3A 1A9NB 3NNAA 2LXIA 3P5TL 3S6EA 2BOPA 2J0SD 2MY8A 2M2BA 2KG0A 4BS2A 2ADCA 2F3JA 3G4SS 2DNYA 4WFAQ 2MQMA 2ADBA 2M9KA 2DISA 3UD4P 4QQBA 4RU2A 2DHAA 3S7RA 1PGZA 2CQHA 3FEYB 4M5DB 1WG5A 2HGMA 3N9UC 2OIHA 2DHSA 3J7ZT 2RUGA 1VQMS 2L08A 4C7QA 2MY7A 3DXBA 3P49B 1VQNS 2I2YA 5DDQC 2MMYA 1ZZFA 2FHOB 2Q79A 4ZKAA 1WG1A 5CA5A 2JRSA 2G0CA 2LQ5A 3R1HA 5DDOC 2CQ1A 5MLCV 2DITA 4C0OC 3UD3P 1KC8T 2M8DB 2X1FA 3V4MA 2HVZA 2G1DA 2CQPA 2M4MA 4UY8T 2F9DA 3B4DA 2KH9A 2XS2A 1D8ZA 1SJ4P 2DGQA 3EGNA 2UP1A 1VQ5S 2M8HA 2YKAA 3BO2A 2YH0A 4LJMA 2CPYA 1JJ2R 1WTBA 1XN9A 3MURP 2HZCA 3G9CA 4WKRA 2MKSA 2AYBA 3SDEB 2LKZA 4J5OA 1FO1A 1BY9A 4FXWA 1U1MA 5CXTA 2MSTA 2CPIA 3UCGA 4V19X 1N88A 3HHNB 4PRFA 1N8RT 2JVRA 2E5IA 2HYIB 5DETA 4ED5A 3VAGA 2ZJPQ 3MD3A 2DGWA 3CCUS 1FXLA 3G8TA 2CPXA 5IFMA 2KN4A 1WI8A 1F9FA 5D77A 2M52A 1U1OA 2DO4A 3TO8A 1OO0B 1DRZA 1QM9A 2RT3A 2I38A 3JB9k 3CUNA 3NNCA 1M90T 1X4DA 2LXUA 3BO4A 1M1KT 1VQ7S 2KXNB 2MZTA 3CMES 2KVIA 1WF0A 1WG4A 5LXYA 1X4FA 3CCQS 1X4AA 4LMZA 1FJ7A 1H2TZ 1H6KX 2CQ0A 5HL7Q 2XSFA 4W92B 2QEXS 3SMZA 2MQPA 3Q2TC 1YHQS 2MSSA 3L3CA 2EVZA 3EX7B 3CCJS 3IWNC 2OJ3A 3S01A 2CQIA 2NLWA 3MD1A 4EGLA 1P27B 3TP2A 1Q82T 2DNKA 1WELA 1YWXA 3UWTA 2AYGA 2RQ4A 2XB2D 3H2VE 2X1AA 5LXRA 2CQ3A 3I55S 2OSQA 2DO0A 2MKCA 2ZJQQ 3LQVA 4P6QA 1HD0A 3PIOQ 3BEGB 4YUDA 3SDEA 4Y00A 2MKHA 2QA4S 2CPHA 1KD1T 3EGZA 1K73T 4TU9A 1DBDA 2CQCA 2SXLA 1D9AA 1WHWA 3VAJA 2CPZA 3PIPQ 3MUTP 1U1RA 2RVJA 1UFWA 3HI9A 1K8AT 2DGSA 1VBZA 2DNPA 1M5VC 3BS9A 2CQDA 1FNXH 2OSRA 4W90B 4OZ0A 2FC8A 3R27A 4IOCQ 1X4BA 2JX2A 2KHCA 1VQPS 1QVGR 1YITS 4OZ1A 4FXVA 2MYFA 1G2EA 2CPDA 1OPIA 2EK6A 2ZJRQ 5DDPC 1JJ4A 3VF0B 4QU7A 1H2UX 1SXLA 1RK8A 2X1BA 1NO8A 2K8GA 2ERRA 1UW4A 2RNEA 2KM8C 5D78A 2LEAA 3CCVS 1L3KA 2DNLA 1IQTA 2DNOA 5IM0A 5GMKa 2G4BA 2AYMA 1UAWA 2M0GB 2KFYA 3NNHA 4TLQA 3G6ES 3UCUP 1AUDA 3CXCR 2BZ2A 3THPA 2MKKA 2YTCA 3CC4S 1S79A 2YWKA 1M5OC 2M70A 1P1TA 1WF1A 5JVHQ 2E5GA 2MKIA 1U6FA 2L9WA 2LECA 2CPEA 1WEXA 1Q86T 1CVJA 3CF5Q 3LPYA 3BO3A 2MXYA 5BJRA 2D3OR 2MGZB 3MUMP 2DGVA 4Z2XA 5CYJA 1U1LA 2WBRA 3UE2A 5LSOA 4TU8A 3US5A 5GVQA 3TYTA 4QU6A 1YI2S 2VOOA 1VBYA 1YIJS 3ULHA 3VAKA 4IOAQ 2B0GA 2RQCA 1FHTA 4IO9Q 2AD9A 2KXHA 3RW7A 2E5HA 2DGXA 2EK1A 1VQ9S 4A8XA 1VQ8S 1HA1A 2VOPA 3MI7X 2X1GA 1OIAA 5FJ4A 2DGOA 2KI2A 2KRRA 2MHNA 3ZZZA 1R8HA 2MQLA 3Q2SC 2U1AA 2YH1A 5JVGQ 2OTJS 1SJQA 2DHGA 3VAMA 1ZZNA 2M88A 2XNRA 2RS8A 3S8SA 4WF9Q 2J76E 5GAHU 2U2FA 2PE8A 1N54B 1N52B 2RRAA 1X4HA 1WI6A 3CD6S 2CQ2A 4CH0S 4WCEQ 2KYXA 4WFBQ 1R8PA 1X5PA 5H1SV 2DB1A 2MZJA 2RS2A 5IM0B 4PR6A 1PO6A 1WEZA 3CTRA 5LJ5Y 1SJFA 1H2VZ 2F9JA 2FY1A 2DIUA 2CQBA 2MQNA 4Y0FA 3SXLA 3CC7S 3FEXB 3D2WA 1U1NA 2N3LA 5EN1A 2L41A 3U1LA 5GAGU 4WFNQ 5DDRC 2J0QD 1X4GA 1FJCA 3VAHA 3VAFA 2DNGA 1VC0A 2DNMA 2MZQA 1DHMA 3UCZP 5DM6Q 2MJUA 4YB1P 1WEYA 2KG1A 2DH8A 2LYVA 1SJ3P 2AYEA 2CPFA 2DNZA 1RKJA 1Q81T 3DLLQ 2JWNA 1QVFR 2N82B 1X0FA 1DZ5A 4PKDB 2MPUA 1VC6A 1O0PA 3H2UB 2E44A 1U2FA 1M5PC 2KU7A 2CPJA 1X4CA 4UQTA 2D9PA 3NS5A 1S72S 1YJNS 1X5SA 1VQLS 2HGNA 1URNA 1HL6A 3MUVP 4F25A 5LJ3Y 3ZZYA 1VBXA 2A3JA 4TU7A 1Q7YT 5DM7Q 3G71S 3CMAS 4WIIA 1ZH5A 2LA4A 1OWXA 1VC5A 2MJNA 2HGLA 1KOHA 1SJRA 2DNNA 2O3DA 1WWHA 3CPWR 2XS7A 2MQQA 5GADU 3THTA 2PEHA 2LCWA 1X4EA 3I56S 2FPHX 2N3OA 1B7FA 2VONA 1WF2A 1NU4A 2MQOA 1U1QA 2CQ4A 1FJEB 2XS5A 1M5KC 3MDFA 2M7SA 1U6BA 2QFJA 2MKJA 1VQOS 3B4MA 2DHXA 3CCMS 3VAIA 3K0JA 2MB0B 2DNRA 1X5OA 1HD1A 3NS6A 3CCLS 1K9MT 3P6YC 1NJIT 1WHXA 2GHPA 4F02A 3MOJB 3P3DA 2DNQA 1A7GE 2MZRA 1U1KA 3RW6A 2JVOA 1VQ4S 1VQ6S 2DNHA 2XNQA 2E5JA 2FC9A 2VODA 4CIOA 3CCSS 2NZ4A 2MZSA 2DIVA 3CULA 1WHYA 2GO9A 4CH1A 4C4WA 2N7CA 3U1MA 1VQKS 1YJ9S 2J8AA 4CQ1A 4U67Q 2DH9A 2KT5A 3VALA 1X5TA 2LEBA 3OW2R 3CCRS 5ITHA 2MGZA 1FT8A 4F26A 2RRBA 1WHVA
chains in the Genus database with same CATH superfamily
4DSIA 1QUPA 1MU2B 3R1LA 1LWFA 5HP1A 1G3OA 4ED1A 3SQGA 1NB7A 2UZAA 1H73A 5LMUJ 4TYAA 4X64J 1U1PA 4NLQA 2R7RA 1YVFA 2VBZA 2KRBA 1S12A 1VRQC 2RF2B 5A6WA 3NNAA 4ENOA 1IKVA 3BSCA 3I6PA 3J7YU 2Y1RI 4Y2KA 2LA6A 1RWXB 1K44A 3C6UB 3DGVA 3M30A 4CYUA 4RUAA 2F65A 3KLHB 1S4EA 1TL1A 5L1JA 3TEGA 2YX1A 3I0RA 3MM8A 4EMDA 3KK3A 3PCOB 3CJ2A 3IN5A 3M1VA 3O5TB 2EC0A 2DEJA 1HWUA 2IDLA 3D9BA 3O8WA 4LIRA 4OI2A 4JUZA 2GAHC 3ZXWA 4RZRA 1YJWS 2KYZA 2ZBIA 1UP1A 3Q23A 4AL5A 3GFZA 2AIRB 1X0PA 3K8VA 1HQEA 1YRTA 2P6TA 3CCWA 2QYCA 2WZ1A 3VQTA 3RAXA 1IBKJ 3QFWA 4LF5J 2QC3A 3MECA 1RAAB 5EWFA 1OYEA 2XO6A 1TQLA 3S6EA 3T6JA 2PT0A 2J0SD 2H5EA 5B0FA 4NOHA 2MY8A 2VG5B 4UF4A 3OFEA 2KG0A 4A8KA 2F3JA 4QR1A 1FX4A 3AA8A 1B0PA 1S4FA 2V8GA 3DOKB 4I4BA 3ZTOA 1TK8A 4H4MA 4L73A 4L72B 4O44B 5T7LB 2ADBA 3M8RA 1UKUA 2UXDJ 3QJPA 4O4GA 3S7RA 1PGZA 4Z7YA 3N9UC 3HHKA 1KN6A 1CQMA 3SYZA 4ETZA 5DG7A 2G13A 2YX4A 3SFUA 1MWQA 4YR0A 4M95A 3AQOA 5LOQA 2MY7A 3DXBA 4WTYA 1F9EB 2P5VA 1NNDA 2I2YA 3IM8A 5DDQC 3H2LA 1MROA 3ZZTA 4DOZA 5HAOA 2JEGA 2RQKA 4XO0A 4OYBA 3C8YA 2FHOB 6FD1A 4DQQA 1KVIA 4OJ1A 1RXOB 4AYBD 4PAAA 4MJKA 2AQ4A 2EFQA 2FJWA 1KSPA 2ZM6F 3H42A 1NAQA 5ETPA 5CA5A 4B3TF 2AU0A 2G0CA 1L3SA 3BGRA 3FEZA 2KFZA 4LR7A 4ECRA 4JYAJ 4ZP7A 3TVKA 4PG4A 5CH7B 1JKHA 2CQPA 1V3RA 3CSKA 2KH9A 3B4DA 4KTQA 2PIIA 2XS2A 1S6PB 3BV8A 3DRYA 3I5CA 1ULRA 3J7Z5 3EGVA 4EK2A 4X62J 5HP1B 2YKAA 3M8YA 3BO2A 3W9IA 2KTQA 5KT7A 2J7WA 1I6JA 1XERA 4J9VA 3D3CJ 1XN9A 4UOCA 1R31A 2JHEA 2DRAA 3PZPA 1S1VA 1YJ7A 3QBCA 3OXLA 1H74A 4HH0A 3F44A 3R5CA 2VA3A 1FD8A 3HHEA 1P9QC 2WVBA 4XAKA 5KFAA 4N56A 2E1AA 1U1MA 4HHHA 1FCAA 4NX9A 3WC2A 2D41A 3I0RB 3RYLA 3DU6A 2MSTA 1OQ3A 4LR9A 5BYRA 4QWBA 1N88A 1S6OA 1PYTA 3LAMA 1G4CA 3MAAA 3UCGA 2WK4A 2W7PA 1NRKA 1HNIA 1RTJA 1FRKA 3DRSB 4G1IA 3VAGA 2HURA 3TX8A 3CT9A 4LFCJ 2FHMA 3CDUA 4QR0A 2ZJPQ 2YNFA 4HVZA 3R6GB 3QGGA 1GTEA 2F1FA 1Q8KA 2Y0BB 5GAEI 2DGWA 1L3VA 1H7XA 1HQEB 1R0BG 2UVWA 4DFMA 1EP4B 5IFMA 2VD3A 2C3UA 5ETSA 4R8UB 2XY7A 4I7FA 2ZOFA 1U1OA 3A3OB 1FXRA 3MWBA 4OI6A 4DSJA 4HH1A 3SFGA 1DRZA 4J9LA 5C5JA 1NHUA 4LBPA 4XTTA 3EVWA 3K5PA 1WOPA 4NZ6A 1RT3B 1N48A 2Z57B 2DR8A 5ETRA 4M94A 4JI0F 1M90T 5J2NB 1UVJA 2D7SA 2JC1A 2F7VA 1RE1B 3VVUA 2GMHA 2HVDA 1M1KT 2MZTA 3DNCA 3GZ7A 2W9CA 1DQAA 1RWOB 1WF0A 4ED4A 4X65F 4C0HA 1QDUB 1UTAA 3WQPA 2VV5A 2UU9J 5ETNA 2K1RB 3N79A 1FNOA 4L76A 4LMZA 1NDCA 1PC5A 4NLYA 4F2RA 4NCBA 4KH0B 1H2TZ 3L9ZA 4LFAJ 4DFPA 5LM7E 3QRRA 2YKNB 5HL7Q 3LP2B 2AZ3A 1GAOA 3BZQA 4JI8F 4LSLA 4OYMA 3T5JA 2QV6A 3HULA 2ZBRA 5DG8A 3KUGA 3Q2TC 4F4AA 4KHRA 5AE3A 2XMTA 4K5SA 3R97A 3BGRB 3W63A 4DR1J 5HROA 2DPJA 4ZVOB 3CCJS 2RAQA 4OZ3A 1MN9A 3KLIB 3MD1A 4ZVGA 3QRPA 1P27B 1WJ9A 1Q82T 1CLFA 4TY8A 1IR2A 2OHDA 1YWXA 4CT8A 5ADZA 3LF0A 2AYGA 3IR7B 1F2GA 2AJ1A 5HI7A 5FLXU 4D3HA 2W24A 3DHXA 3H2VE 3HT0A 4Q5VA 3KLGB 3I55S 2VL1A 2ALZA 5LMNJ 3H59A 1VJQA 4ED6A 5DZ6A 3DCAA 5DQIA 5KT6A 4OL8A 4NLOA 2AJ2A 4IH7A 1HD0A 2WCXA 2XQCA 4RBVA 3PIOQ 1YZ6A 3OVBA 4FDFA 3QFHA 2ZHBA 2AGQA 5HQ8A 3QT5A 4LUBA 5IT9U 7AT1B 2R7UA 4NRTA 3PRBA 1U0HB 2H1YA 4OJGA 5B0DA 2FDNA 3EGZA 3M4XA 1CC7A 1M5SA 1N5SA 4RWXA 1CS4B 3UDVA 2CQCA 5LT5A 3IA0A 1D3WA 1D9AA 1WHWA 1S49A 1JXLA 1CC8A 1RTJB 3N0VA 3IR5B 3FFIB 3ZZPA 4F0HA 4KH1B 2GVDB 1Y5IB 2HQFA 2Z56B 3UVJB 2ATCB 2R3VA 3N6NA 3SQOP 1VHIA 4KE5A 1R0AA 4FP9A 2QFIA 2D3ZA 1HFEL 1NHKL 1SC1B 2PD1A 1KQKA 2GMJA 2OPSA 3JTNA 2VF3A 2YVSA 2DNPA 4ALZA 4ZIWA 3SQGB 1M5VC 4JI6J 3BS9A 2Y8YA 2F5GA 4HT7A 3TQ1A 4B9LA 1S76D 1Q7LB 5EX3A 1PJ6A 3ISND 2GJFA 1W26A 1OY8A 4MFBB 4QJVA 3D1HA 4IFVB 5KG3A 4URSA 4USWA 4J9RA 1FX2A 1X4BA 4DR5J 4ECVA 3DN9A 3GFYA 4JV0A 5C2CA 4OZ1A 5LSRA 4I0WA 2EI5A 1G2EA 3KHHA 2CPDA 2Y0SD 3KLHA 1FA0A 2V8VA 1GT8A 4CM2A 3FC9A 3VF0B 3A8IA 1H2UX 3RZAA 3Q24A 2K8GA 2PFDA 4F3MA 1NMEB 4HR2A 2CG8A 2EW9A 4P2SA 3CCVS 2K1RA 2FJXA 5EHHA 2YPYA 4ZVUB 2C22A 3BH7B 4MIBA 1YDLA 2RB7A 5ETMA 1Q53A 5LSLA 1IQTA 2YKNA 4D3GA 1H72C 3TZWA 5GMKa 1P8GA 3SBMA 4U9RA 2HQ3A 3UD5A 5BXIA 3AB4B 3HDSA 3TVYA 2R7OA 3CXCR 3UCUP 1E6VA 3ILIA 5HROB 2KT2A 3DFEA 2WRMA 3LP0A 5J1EB 3OJUA 4DWIA 3T9ZA 2VICA 2VA2A 2GC8A 1LEOA 3QLHB 2FGCA 2WVCA 1I94J 4G3IA 4LFAF 1VCTA 1M5OC 2M70A 4B3MJ 2E5GA 1I1GA 1FESA 3BBFA 2L9WA 2XMJA 3LA0A 2MKIA 2LECA 4ZN3A 2ZEJA 1Q86T 5DRKA 2XLJA 1CVJA 4KQZA 4X65J 4LF8J 1WC1A 4UOGA 3GV5B 5C25B 4I1TA 3MUMP 4NLPA 2R7SA 1VQSA 4WKYA 3D0HE 1DY3A 1LWFB 1ICEB 1QAXA 2C2NA 4ZLNA 3HSJA 1U0HA 1V6HA 2EPIA 1T9YA 3ET6A 3TRGA 1YIJS 1VBYA 1VMBA 4CP5A 1EJ7L 2NXEA 3SSSA 2C2DA 2HQCA 3G8QA 4B3SJ 3AAWB 4LR8A 4IO9Q 3V6HA 3QGPA 2KXHA 1JKHB 3OHAA 1KQSR 3M30B 4CYUB 4B9SA 4LF6F 1FDNA 3OV7A 4K4VA 3UVJA 1TL1B 2YKQA 3JSBA 2ROPA 1VQ8S 4KJIA 1HA1A 2OPRA 3PVXA 2X1GA 1OIAA 4QIEA 5K14A 4CLFA 4DCJB 5HMXA 3ZZZA 5FJ4A 2KRRA 4LFCF 2PFFB 1JLGB 2LQ9A 3CJRA 2MQLA 3E3XA 5J2QB 2U1AA 4M5KA 1X8DA 4OHXA 4YHHF 2C3OA 4RNFA 3TANA 5HN0A 2DHGA 4JI3J 3DHWC 3VAMA 1N34F 3GIJA 4P73A 4KGXB 1PKUA 2RJZA 2J76E 2BJDA 1DURA 4WF9Q 4DXLA 2QMXA 1TV6B 2Y1LB 3TX0A 4PZVA 4JI6F 4E8UA 2MLZA 2POKA 3T3FA 4KHPF 1WC4A 2VG5A 3L7UA 2YNIA 2J9CA 2N4DA 5CAAA 1M1GA 1X4HA 1KFDA 1Y3JA 3DOKA 4CH0S 2KYXA 4IOBA 5A76A 4WFBQ 2XC9A 2Y8WA 2QSFA 2HG4A 5T7LA 3H25A 4TNOA 1X5PA 3G6YA 2BKPA 4USHA 4HDGA 4X66F 2B7CB 3MCOA 4X62F 5KFEA 2MZJA 5CD4A 1IM4A 4PR6A 3CTRA 1RKIA 4K5RA 5EWEA 4JYAF 4PWDA 4X2BA 1YSJA 5D4NA 1SJFA 1RWWB 2W7AA 2BE7D 3CB4A 3KXDA 4OZ2A 3A8EA 1W25A 3RR7A 1E6VB 2F9JA 2NYIA 2DY1A 1SIWB 3MM9B 1MROB 4WZMA 1S6QA 1HR0J 1VYAA 1TUGB 2B43A 3KK1A 2HVHA 1F1BB 2XG8A 1H7WA 2HFZA 5KAKA 4OI3A 1CG2A 3C16B 3D2WA 1NDLA 2VC1A 5T14A 3HP6A 3HJVA 1Q1KA 3U1LA 3EVOA 3T1HJ 5IC4B 1EX8A 3HD2A 5GAGU 5KFFA 4WFNQ 3JS9A 3MR2A 1R8AA 3PKYA 2IM2A 2GQCA 2GFFA 3E51A 1NKCA 4FBTA 3PX4A 5BYSA 2QA1A 1T02A 2DNMA 3CJSA 4OI4A 2NSBA 4ZS6A 2PGCA 1HBNB 1D09B 2ZWPA 2YXLA 4CLPA 4OYWA 1IKYA 1DHMA 2R2SA 5DM6Q 3Q8SB 2MJUA 2RDDA 3KYLA 3X3UA 3R7SB 1N5VA 2EG2A 4TN2A 3MCNA 2ASYA 1GXTA 3DLLQ 2X7IA 4BWMA 1JLBA 1F2HA 4YQWA 5KFSA 4UOHA 4LF5F 2AP6A 4CLUA 3J7AN 1SVDA 1DFDA 4M5MA 1KHWA 1BGXT 1SKUB 3K17A 1LW0B 1X31C 3D54A 4MT1A 2E44A 5KFVA 2HIQA 4ZLJA 1VS3A 2CPJA 4DV7F 2X51A 1IBKF 2XHWA 2EFGA 5A8KA 2LXFA 3TVZA 4NEYA 5K14B 4UOFA 3DRSA 4ZP9A 3UFCX 1RWMB 1U49A 3MPDA 4G1QB 1SV5A 2XMWA 4EO6A 4IG3A 4WU3A 4F25A 4DV2F 1K0VA 2FJDB 4TU7A 3EMTA 5F3TA 3Q0AA 4Q45A 4F8RA 3AXMA 1RT2B 4A4JA 3W9JA 2IRYA 1PYSB 4LQ9A 5GAHI 2QA2A 3G71S 3PX0A 1VC5A 1IBLF 1IKXA 2J7KA 3ZZ0A 2W2PP 2HSEB 3KLEA 1SC3B 4MTPA 4W4MA 4J9PA 2W1BA 3PR5B 1FWPA 2MQ8A 2V5HG 3HKWA 1DQ8A 4J9OA 4WFXA 3O6QA 5L39A 4DL7A 4MKYA 2GIRA 3QZ8A 2LCWA 3M8ZA 1RT3A 4DL5A 2ATLA 1UMJA 1HNXF 1X4EA 3O2IA 2J6UA 5E41A 3I56S 1RSCA 4Y28C 1RISA 2QIFA 3FNNA 4F3QA 4JBCA 4KBIA 2JLFA 1WF2A 3EXCX 1XJWB 4UQGA 4NYPA 2BKOA 2HHHJ 4B3SF 2B7BB 3DLGA 1U1QA 2H51B 1IR0A 3PRVA 3LUYA 1WSRA 2DEIA 1S9FA 4MFBA 3W5YA 4IFVA 2GVZA 4LF6J 3FDSA 4MAKA 3ZNJ1 1TP7A 8ATCB 1Y00A 3GCXP 2UUBJ 4EEYA 5IOLA 2VPYB 3D28A 4Y34A 3LP2A 5KG2A 3PJ9A 2J9EA 3R7BB 2CADA 2LEPA 2BM0A 5HMZA 3D6MB 1I51B 3CCMS 4ED0A 2WTFA 1NKEA 3K0JA 3OUYB 4B3RJ 3H98A 4X4SA 1X5OA 2WBMA 3DLKB 4ILRA 4OFZA 1U47A 3KLIA 3NS6A 1XR5A 3Q8VA 5F0WA 4XIUA 3I32A 4QIVA 1X7VA 4FPRA 4USTA 3BYRA 2OEKA 3W2WB 4DR6J 1EQ0A 2GHPA 4DMZA 2CNNB 3QSYB 4ECSA 1RJJA 5IV3A 4M5DA 3H5YA 2FUG9 3KLGA 2E1PA 2YNGA 3PR4A 5IWAJ 2V63A 2MZRA 3RW6A 5ETVA 2YQ3A 4AE5A 2WVEA 1UVNA 3ETOA 2FVCA 1RGVA 5JJBA 4BC7A 2ZH2A 1SL2A 5CQGA 5L9XA 4EBCA 2UXBJ 1EB0A 4X4PA 1YQHA 4MMOA 2DIVA 3C19A 1CQNA 2XY5A 5KG4A 2JEFA 4K0KF 2N7CA 2WOMB 2FJAB 4A8QA 3U1MA 4J9MA 2OP5A 2A6MA 1RAGB 1OJ4A 2ZD1A 3CJKB 4DX7A 5B09A 4YY3J 3QYYA 3GLJA 3D0IE 3RAMA 3UDLA 2Z58B 2WONA 3M2VB 3GB0A 1T3NA 4C97A 1SH0A 2VDIA 3FFIA 2QZ8A 4M8LA 3EDRB 4M63A 4RKUC 3SCJE 5KFPA 2VQEJ 3A13A 3CW2C 4G1QA 4ID8A 3SZ2A 4H4OA 4OZLA 4Q2MA 4F26A 4ED2A 4IG3B 1WOOA 2PC6A 5E33A 4A8MP 4O3RA 4HLBA 2OPSB 5B0EA 1PJ5A 2AGOA 1B7YB 2QGFB 1XNQF 4QPTA 4ZLLA 2VG6A 1T11A 1WKKA 2HBRB 5IQQA 2V2VA 1IKXB 3O3LA 2LMIA 2DK2A 4P74A 9RUBA 3OR2A 3RBDA 2V9WA 3NMRA 3CC2S 3VGVA 1FEEA 5HO4A 1B3TA 1YJTA 2D9OA 4KPCA 2DH7A 2HEKA 3GU0A 1J27A 3MMCA 3CJTA 4PYAA 1LV5A 1JLAB 3HVAA 2HS4A 2UVVA 3AQPA 2YNHB 5HMYA 2W9AA 2J8SA 2C2OB 4HL9A 1VRTB 1FVSA 1PAUB 4P10A 3GJQB 4DV2J 1JJHA 2XWYA 1EKSA 2JH3A 2KM8B 4IR9A 2IHR1 3DRXA 1SIZA 1JLGA 1SI9A 1UPMB 4LBHA 5J2QA 4DL6A 2QRRA 3DLGB 3IRWP 4JP8A 2OTLS 3WBZA 2BDPA 3AOAA 3H40A 1YRUA 2EEYA 2FB0A 4OYOA 3C6TA 1NK5A 1NDPA 2AEMA 2DCLA 5GAEU 5AE1A 2QX0A 1D0EA 2VFSA 4NZ0A 1W2BR 1QTMA 4B3OA 4L3NA 3SCLE 2V2ZA 1RT7B 4YOEA 1A9NB 2B5JA 4PWWA 1FF2A 2LXIA 5I3QA 5D0EA 3EDQB 4ZCLA 3UQSA 2HHSA 2NXNA 2GCFA 4OZ5A 1U25A 2M2BA 2HNYB 1JJCB 4USKA 3IBFB 3O1LA 2ADCA 3J80Y 4B02A 1HWKA 4XPCA 4LREA 4WFAQ 2OELA 2PMWA 4K2JA 2GGPB 2W01A 4ZVTB 3HJFA 5CZVA 4QQBA 3H5SA 3R3TA 3FEYB 3QAUA 4M5DB 3PW2A 3UW1A 5AXNA 1UA1A 2E7XA 2L08A 2VB6A 2P9EA 2NSCA 4PWDB 1ZAWA 4YEAA 1QSYA 1RYRA 3IRXA 4IRCA 4GKJJ 1U26A 1R3NA 4CLWA 2B6AA 1Q16B 1Q5VA 3HFVA 3TZYA 1S6QB 3UNYA 4CLKA 4Q8EA 2ZC4A 2Q79A 2A2DA 4FYXB 2HK2A 4KV8A 4U8YA 2I6WA 2BQUA 1CBKA 2HHWA 3C16A 4Y65A 3IC1A 3TWZA 3LGHA 2JRSA 3W3SA 1Q8BA 4QW8A 3R1HA 3ZTPA 5DDOC 3GFHA 2O67A 3MPYA 3R5GA 3MPWA 4WYLA 3UD3P 1KC8T 2ZBQA 4LF4J 1QTNB 4IG0A 4UZCA 2M4MA 2ZE2A 4ZP6A 3GR0A 5KFNA 1PIEA 1RU2A 5DGAA 1AB8A 2KT3A 2ZDOA 4H4OB 4N5SA 4U7CA 4X4UA 1TU0B 3ILOA 5M2RA 2OPRB 2HK3A 2IC3A 2M8HA 2XMAA 1QAIA 1OMSA 2GIFA 3MF5A 1R6YA 1UPPA 3VZIA 2YH0A 3NXZA 4MYTA 4ZIVA 5SZTA 3JYTA 1NJYA 3G9CA 2HZCA 5DO2A 5DLGA 3UNGC 2MKSA 1VDHA 2AW0A 2YX7A 1CJVA 1HPZA 3B8HA 3SV3A 4WIQA 4PXBA 1JLCA 4K4UA 4B9TA 2R9LA 4DV3F 2R7TA 2HRTA 1YJRA 2ALYB 3CD5A 1GXLA 3F0NA 1TV6A 2VIHA 8RUCA 2CPIA 4ECUA 4V19X 2Q6CA 5KT3A 5GAGI 3HHNB 4NEZA 3OFGA 2XMMA 3P4UB 2E5IA 4ANCA 3MPUB 4K4YA 1T03A 3OLBA 4DR2F 2RQMA 2W8LA 4U96A 2L9DA 1GXUA 1GFWB 1H38A 1ZAVA 2BJ7A 2XHCA 3T5KA 1A6LA 2UUTA 2HQDA 1UWAA 1Y7PA 4J9KA 1C0UA 3EUNA 4FYYB 2XLIA 3BM7A 4IDKA 2RIJA 1JB0C 2VG7A 2VZ9A 4O3PA 4AXJA 1CJKB 2F63A 3MAHA 3G8TA 4O3NA 2H9ZA 2O01C 1WI8A 1Q95G 3MEGB 3IM9A 4UTGA 5F9NA 4ZMMA 1JLFB 2UUAJ 3MM9A 1RCXB 2P2CB 4DI6A 4WFYA 4USJC 2V34A 2V4QA 4P75A 1EKRA 2I38A 5F3ZA 2Z8QA 4PEOA 3R9LA 4LF9J 4H4MB 4TKTA 4KO0B 4O44A 3M32B 4XDDA 4OLPA 1X4DA 3P45B 1N4LA 4CLTA 4F3OA 2UXCJ 1S1XB 3PEHA 4LRFA 4B08A 5HVHA 3BO4A 3I82A 1VQ7S 3BPSP 4F04B 5KFZA 5SUHA 3H7HB 1WG4A 2VASA 3CCQS 4R0EA 1HBNA 2AEJA 1TKZB 4DUYJ 4DUTA 2W25A 4GVLA 2GO8A 3VGSA 1NK7A 2XI2A 1O51A 2AZ1A 3BQ0A 4DV0F 2CQ0A 1ZM3A 4URQU 5KOXA 2QEXS 1BHNA 3EGWB 1GH8A 3SMZA 4RWWA 2MQPA 4ECXA 2MSSA 3OUYA 1UVIA 1SCJB 3R2DJ 5E3QA 2DCUB 4P9SA 4C48A 2HFUA 3DLKA 2IVFB 4DR7J 3MCMA 4EGLA 4JI0J 1EQMA 1HBOA 2CWKA 2JFDA 2A2CA 3TP2A 2V8HA 1S97A 1WELA 1XBWA 1U45A 1ZM9A 1ROFA 4CNYA 2RQ4A 5JMNA 4FYVB 1NBEB 4P2FA 4IYQA 1WSVA 5KFYA 3LWLA 3K58A 4MKAA 2CQ3A 2LDIA 3OFFA 4LRCA 2HKEA 1R8CA 2DO0A 3NRBA 5HMWA 2R8HA 2VHGA 4O3SA 1YBAA 4JI2F 2ZJQQ 3W5XA 1SV5B 3Q89A 3N28A 4DV0J 3OXFA 3BEGB 1VQYA 1ZM4A 3CIMA 4I6WA 3UR0A 1S1VB 1F0XA 3RU0A 4QWDA 4F4YA 3ZFVA 2BEFA 1VK8A 3VVTA 3JSMB 1KD1T 4P2MA 3ZO7A 3BBCA 1RTIA 2M8DB 4F2SA 3RB0A 4JV1A 4KIAA 1UFKA 2W8KA 2C3PA 3M2VA 5KTQA 2ZVSA 1S6UA 3RBXA 4QOTA 1UEKA 3HFKA 4KGVB 3HF5A 4DV5F 3CNQP 3TI0A 4FF1A 2CJ9A 4WK3A 4BCAA 3PY8A 3FBCA 4KHPJ 3NMAA 1RHRB 2DGSA 2VG7B 4ZVEA 3B6BA 2FVQA 1Y0HA 2VG6B 2NPFA 1EP4A 1IXKA 4KGKA 1FNXH 1WACA 3NY0A 4R8UA 2QLBB 1NSKL 4I7FB 2GJ2A 4CM0A 2KFNA 2FC8A 2J0WA 3EVMA 1Q79A 5E3PA 4QPXA 5I4MA 3TAPA 2JX2A 1F6TA 1VQPS 3MTJA 3TAQA 4C3MA 1JQGA 2HVIA 4NLXA 2MYFA 3VQSA 2XCAA 1JLAA 1V3SA 4NLVA 1F3FA 3HVTA 1OPIA 4FNHA 1VRTA 1XC9A 3IBCB 1JJ4A 4B9MA 1S1XA 4G1PA 4LRAA 4QU7A 2A10A 3W62A 1DLOA 3CDWA 4TQRA 2W9CB 1ZPVA 1RABB 1MNEA 4I2QB 3CO0P 3RJMB 3J81Y 2ERRA 4F7VA 3KOAA 2LVWA 5LMNF 5F8IA 2LEAA 1RB0A 1TKZA 2V2QA 3PM9A 3C6TB 2KJVA 4PQAA 4C3LA 1XMOJ 2G2ZA 3ENQA 4C11A 3MTKA 1ZYQA 2DNLA 1NK8A 2WSEC 3SEOA 4ID5B 1QUVA 5C24A 2YNGB 5IM0A 4LVOP 1JXVA 1N36F 2VH7A 2B5JB 2AYMA 2G0IA 2VFTA 3JAMU 1KWMA 3OL7A 3G86A 3KTQA 1J5OB 2K06A 5K9FA 1RWPB 1T94A 1L5UA 2VJUA 2MKKA 2HNYA 5I42A 2YQ0A 2ZZNA 1HNZF 3MMBA 2E9ZA 1U24A 2E1MC 5E2QA 2ASJA 4TY8B 2GW8A 4CO0A 1B70B 2ZD1B 2VFUA 3CJKA 2GGPA 2QLXA 4ECQA 1AW0A 3OSNA 1O5JA 1BWVA 1DARA 1P1TA 1PAEX 4GRSA 2HWHA 3Q86A 4WE1B 5F8HA 5FDLB 5JVHQ 1KFSA 2QSWA 5HQLA 2BJ9A 2FVSA 2BA9A 2UUWA 3PYFA 3LPYA 1S10A 4K4SA 3C14A 4QWEA 4B9NA 1SKRA 2DGVA 2NUHA 2QLWA 4ICLB 4CO4A 5KG6A 2W2NP 3NAHA 4ZITA 3IGNA 3OR1A 5A8RA 4QYZK 4C6AA 3M6VA 2FHJD 4QU6A 6AT1B 1R43A 1E6YA 3I96A 5U47A 2ZH3A 2HBQB 1RYSA 2VOOA 2ILZA 1XNRF 2ZH9A 3CWJA 2RDJA 3QATA 1RBAA 1K1QA 5D0RA 2RQCA 5K8NA 2HW3A 1Q5YA 1SQEA 1FHTA 4QYRA 2BANB 1QSSA 2YWEA 3RW7A 4UUWA 1GMUA 4ZVSB 2ZE2B 2GVDA 4AQYF 3FRYA 2BE9B 1Y9OA 1KVJA 1DTQA 2ZKTA 2J9DA 4A8XA 1N56A 2AJ4A 4RW9B 5D4LA 2HS3A 1BWEA 5KFQA 3MI7X 2J9DE 3PHEA 3V6JA 2EG1A 2HVEA 3HPOA 1VOMA 2DGOA 2MHNA 4DV5J 3GTYX 2G0JA 3JYTB 1IUJA 2D3UA 5JVGQ 1SJQA 3BN7A 5C42B 4ZVHA 2OTJS 2FVPA 1JLQA 3ADAC 1HPZB 2AX0A 4B3OB 1ZZNA 3CCTA 3QGHA 2IMOA 2M88A 4OX9J 2VDHA 2RS8A 2QO3A 5GAHU 5FIIA 2W4PA 4QIFA 2JSXA 1LXJA 3TUPA 5KOWA 4UZBA 4ZJOA 3EZUA 1VLYA 2A18A 1HBMB 2PE8A 4ZJLA 2HAIA 1LNQA 3LP1B 1T03B 1Y5NB 3K2YA 4EYHB 1HWIA 1NCLA 1WDDA 1WI6A 2RRAA 2CQ2A 4WCEQ 3MR6A 3D67A 1OY6A 1X60A 4DF4A 1BD6A 3TA0A 2JJ4D 1RDRA 3GP9A 1C1CA 3TOQA 2OPQA 4OYAA 1U7LA 2LQBA 1NSQA 1BQNB 4JI3F 1UVMA 1WEZA 4DZ6A 1RHMB 5J1NA 3MEGA 4YDDB 4C8MA 1EAYC 2B6AB 1NM2A 5IXUA 2ZZMA 4H4KC 1JLFA 2P8IA 3W9HA 2M5YA 2FY1A 2DIUA 1U8WA 4DFJA 1LOUA 3LP0B 4DU7A 4N47A 1JX4A 4LSZB 3NWGA 4ZPWR 3KJVB 3R5AA 2EFOA 1WC3A 4A8FA 2HBYB 1FK9A 2JDJA 4GVBB 2C1EB 3MM7B 2Q1LA 4DN0A 1AFJA 4ED7A 2ZKUA 1U1NA 1EHWA 2OLWA 3FZBA 3QPIA 4WE1A 4QIWD 2RRNA 4R0JA 5DDRC 3GQCA 4PG7A 1X4GA 3VAHA 4IG0B 1AZSB 3CO9A 3I0SB 3IP0A 2R8JA 4WFZA 3UN3A 1HNVB 1ZTTA 4IKAA 2W4DA 5HJYA 4DR3F 1DJ0A 1EZZB 1N33F 4ZVQB 3KK2B 3UCZP 2IM0A 2E7WA 3A3NB 4HYKA 1JIHA 1UFLA 4NXNJ 1AYEA 4YB1P 3D1QA 2VJVA 2WVDA 1R6VA 2KG1A 2XMKA 1AROP 1NPRA 2FHKA 3LW5C 4ZVPB 4U8VA 2AYEA 4EUVA 1N5YA 4I67A 4PPDA 3M9MB 2F4VF 4ITSA 2N82B 1DZ5A 2XLKA 2COLA 3NGUA 1S1TB 2ZOMA 2FZCB 4EFAC 1HNWF 3DOMA 2RILA 1HBOB 2MHEA 2MPUA 3AD9C 1VC6A 2UVUA 4IQXA 1SB6A 2XBPA 5BR8F 2JEJA 3PHTA 1I94F 1DTQB 2FGOA 4GO5X 3BSNA 4ED8A 3NLCA 1QLNA 2E5LJ 1X4CA 3AOBA 3NS5A 4UQTA 4JI1F 3IG1B 2D74B 5A2QY 4IFYB 4K8RA 4P72A 4BDPA 1PC4A 3NCRA 3K57A 5D0GA 3W8GA 1RT5A 3MOZA 4K4WA 2IA6A 3PRDA 2J6SA 4OX8A 1JLQB 1MLAA 1T0TV 3ZZYA 1C0UB 1R7IA 8AT1B 1Y4ZB 4IDKB 2QMWA 3HZGA 2BYCA 1CJKA 4LSNA 3JSMA 4KGZB 2HGLA 4NI2A 3TJ8A 1KOHA 2MDAA 1HBMA 1KBRA 3C15A 3FKBA 3CPWR 4ZJQA 3T1YJ 4LF8F 2YNIB 3GFXA 4OHWA 4ES3A 1MWZA 1N5QA 2FTRA 4WP3A 2PA3A 3RBEA 4O23A 3M32A 4M1KA 2N3OA 4B9VA 3D6TB 3E8OA 2D3O1 3AT1B 4RW6B 3ZTSA 2R2TA 5J2MB 4B3TJ 3BREA 3MPVA 3MR7A 2ILYA 1T9UA 1QJHA 4M5IA 1SL0A 1H3DA 2XS5A 1RBOB 2AHOB 3NCPA 3PG9A 5HJXA 2XM3A 1HQ2A 4USUA 5D4PA 4ECTA 3DDIA 2IJNA 3AJ1A 2MKJA 2QFJA 4QWCA 4KAIA 4TYBA 3B4MA 3KNAA 5DLFA 2DHXA 5CHCB 3BJYA 2KZMA 3VAIA 4K4ZA 3IXQA 3PNIA 4WU2A 4ZLPA 2X1FA 2DNRA 4Y3CA 2L3MA 1LK5A 3CJQA 3IWXA 1DLOB 1OPZA 4F0MA 3T1HF 2HFNA 3K5OA 1HD1A 5E3AA 4YY3F 3A12A 3I0SA 3RB3A 1K9MT 3TA2A 2ACMA 3A8KA 4TXSA 1NJIT 1TUVA 4URGA 1WHXA 5G0RB 4F02A 1IVZA 3TEHB 2Y1IA 1IN0A 1YLXA 2HLUA 1RT1B 4F4ZA 1TK0A 1RZMA 4JI2J 3MEKA 2VU5A 3PDNA 1ZS6A 3GCWP 3QWUA 2DNQA 5E7OB 4ZPBA 1U1KA 3JXOA 5K8PA 4JV5F 3GIRA 1VQ6S 1EIYB 1J5OA 3BSOA 2V69A 3KJNB 2F8HA 2XNQA 2CYYA 4NXNF 2Z0GA 2Z4PA 2VODA 4X66J 3CCSS 3EPIA 3V2UC 2PEBA 3MMBB 1WHYA 2GO9A 2OI2A 1LW0A 2AV5A 3AA9A 2UV8A 3DKDA 3GPAA 4KR0B 4Q0BB 3V81A 3KUEA 1UA0A 1T05A 3EPGA 2DKOB 2HRUA 2J8AA 2EFPA 4MK8A 3QJJA 1AFIA 3HK2A 4YR2A 5KT4A 3VALA 1RAHB 1J5EF 4ZPTR 3NGDA 3W5ZA 1PCAA 1T9TA 3ILJA 2XEXA 2NS1B 1SH2A 3NGRA 1VISA 4KHMA 4K4TA 1D8YA 4NXMF 4RJVA 3E2EA 1TKDA 3BN4A 4KC5A 5EX0A 4F36A 2BQRA 1NKBA 1RT2A 5L9NA 3V6DA 1RADB 3R7NB 3CJ8A 1E6YB 4F0KA 1GNKA 3M2UA 4Y6IA 4ERDA 2BOAA 3BGUA 2KXFA 1F9HA 2QE5A 4DSFA 5DM7Q 4J90A 3LWMA 3MXHP 2VQEF 3J80U 4IUFA 2V94A 1EARA 4M5JA 2XGPA 1LWCA 4PWUA 1FXDA 5B7WA 3Q8RB 3CCES 3K89A 1PYOB 4Y2CA 4BHQA 4QCLA 2B9WA 3OL8A 2MZ1A 2CQGA 2V0NA 3AHPA 2CJKA 4RW6A 3AJDA 5J2MA 1RAFB 4I2QA 4U6PA 1TL4A 3EYZA 3R5DA 1R27B 1XQIA 4I2PA 3RAQA 1LWEB 2XI3A 1HBUB 2WB1D 3GV7B 3MMAB 2GVZB 4QYZJ 5BR8J 3G6VA 3IS9A 3L7PA 3TZZA 4KFBB 5KG1A 4N8OA 1NJWA 4ANEA 4NCGA 3GSDA 1PILA 4ZHRA 1HARA 1ZAXA 4KKOA 4DZDA 5F9LA 4JI4F 2DY9A 3VTIA 1B99A 3OD2A 4P7TA 3KHGA 2BOPA 2FLPA 4J7CA 4GKKF 1UJ4A 4OHVA 3RB6A 3G4SS 1HHQA 2F40A 4HI2A 2MQMA 2RH3A 3W2WA 2M9KA 3UD4P 5G0RA 3I5AA 4DL4A 2ZNYA 4RU2A 1LK7A 2K7JA 2ZBPA 3W1YC 5F8NA 1T9XA 1IBCB 5FDLA 1WG5A 1XNRJ 2HGMA 2OAUA 3J7ZT 1VQMS 2RUGA 1BQNA 1QY7A 2I0XA 5C2GA 3H4BA 3A8JA 4TLRA 3PO5A 2V68A 1K47A 1C1BB 2NYHA 4EU0A 2LLZA 3GYXB 1VQNS 1KVKA 1H0HB 2KB2A 4CT9A 4XPEA 2DXDA 2MMYA 1BXNA 2W4CA 2BRKA 5IZHA 3QSIA 1HW8A 1URRA 2ZNZA 1UJ6A 4F4KA 4ZKAA 3MEEA 4DFKA 2WOMA 3OTOJ 4Q0BA 1KQGB 4C8LA 1WG1A 4W98A 1U6ZA 4DX6A 4X4OA 5IT4A 2PI5A 4AD6A 4N7TA 1T05B 2LQ5A 2OFHX 4Q43A 2WONB 1VK3A 3NGKA 1Z4UA 2VKZG 2R8IA 1AXQA 3QMQA 1AZSA 5FD1A 1CJUB 2B51A 5HVFA 1MMLA 2F9DA 4P71A 4F4WA 4JB8B 3KHRA 1IQZA 1XK8A 5ETTA 3GR1A 4OIXA 4RW9A 1KHVA 3LOUA 2DGQA 3EGNA 3IGVA 3KK2A 2UP1A 5HANA 1BC6A 3LGMA 1TAUA 2VFVA 2RE1A 2ZVIA 3BYPA 4OX6A 1RI7A 2IDEA 1VIOA 2CPYA 4I6YA 5HVGA 3WIVA 3CJ5A 3HD1A 1W2IA 3MR3A 1TL5A 1IJEB 1NH7A 4DSEA 4WKRA 3SDEB 2JLGA 2LKZA 4J5OA 1I3OB 4ZCKA 3KG4A 1BY9A 1UJ5A 2EBGA 5AXLA 2HHPA 3CDBA 1JXEA 2CZ9A 5CXTA 5KFIA 4L6V3 2PA8D 4CLZA 5J2PA 2QN6B 3LGNA 4F50A 4PRFA 1YKWA 1RACB 2JVRA 2R42A 2Y3YA 3KDNA 3TQEA 3THVA 1S57A 2HYIB 4IFYA 3RR8A 2VPZB 4KSEB 4IR1A 4DPWA 3H8YA 4I2PB 4MK9A 4YP3A 2ZZTA 1HBUA 3KG1A 1C1CB 2C3YA 1L3TA 2OPQB 2Q6BA 3CCUS 2GV1A 2H5IB 1BE4A 2NXUA 4J9NA 2XY6A 3RB4A 4JI7F 5K20B 3ZTRA 4DUZF 4NCGB 2BXJA 1F9FA 5D77A 5EDWA 4HHJA 1RLDA 3NBPA 2DO4A 3BPDA 3MM6B 4LVNP 4K2XA 3M9OB 1OO0B 4ZCIA 3KLVA 2UVRA 4HI1A 3ETMA 2UUAF 4DSLA 3KJVA 4MIAA 2OPPA 2PO4A 1FK9B 3MCSA 3HHLA 4GVBA 3W2VA 3MM7A 4UUXA 5L1IA 1NJZA 3ZZOA 3NNCA 5H9FK 3FCHA 3EZ5A 4LF7J 4QW9A 2E5LF 2LXUA 5F0UA 1YJVA 5JUMA 3HMJG 4DR1F 3DI6A 1HWLA 5I3UB 3CMES 2HHXA 2VPWB 3ICLA 1KP6A 4DV4F 2KVIA 1QAYA 2HHTA 5B0GA 3MAQA 3IRXB 1HNVA 2VQFF 2UUCJ 2V8DA 4Y2MA 1K1SA 4PPZA 1X4AA 1V5VA 3CDEA 3CD7A 3CEDA 1H6KX 4OYZA 1RTHB 3C2PA 4KV8B 2XSFA 5D0HA 1S1UB 1LW2A 3DXSX 3LALA 2NCKL 3MEEB 4O0IA 1D9FA 3NL0A 3QNWB 2FLLA 1JLEB 1YBUA 4YR3A 1NZAA 2NREA 1YHQS 3Q22A 3V4IB 2EVZA 4DR4J 2QL9B 1HI1A 5ETOA 5HATA 4ECWA 3IWNC 1S1TA 2NLWA 3DOMB 2XGQA 5F8JA 4FVMA 2CWXA 2ABYA 4KRWA 1RHKB 3NG8A 5A6PA 4GC7A 3I9ZA 4ATNA 2NQPA 5KG5A 2XB2D 1RUSA 2IC3B 1KR4A 1RT1A 1RBLA 2XZDB 3IG1A 2X1AA 1PJ7A 4S0MA 2V2KA 4MIWA 2ZHOA 2L9NA 3TR5A 1IWGA 3HLUA 3LQVA 1RT5B 4P6QA 3PW0A 4WP8A 2VC0A 4YUDA 3GIMA 3R5BA 1CJVB 3AOCA 1FVQA 4ZPVR 2MKHA 2QA4S 1NEEA 2ZUGA 1JLCB 1UL3A 3PYDA 5HBMA 2CUYA 4DCPB 4A8YA 2CPHA 4LSNB 3PX6A 1K73T 1A0OB 1U4BA 4TU9A 2WSFC 3V81B 1DBDA 3JQKA 2SXLA 3LANA 1DTTA 2OUGA 3HVWA 3T5HA 3KDOA 2F4FA 1NK6A 2JEIA 2WHOA 4J91A 3HM9A 2V50A 2HHUA 2F8EX 1WTFA 3I5BA 3NCQA 3D0GE 4RW8A 3PIPQ 2B8PA 3KLFB 3MUTP 1Z2ZA 1U1RA 1IWAA 3GYNA 2RVJA 3LO3A 4PXDA 1UFWA 3W66A 4FYDA 2V8PA 3HI9A 1RLCL 4A47A 1VBZA 1FKOB 3N6LA 2CQDA 1MN7A 3HX9A 4WWSA 4NLDA 3FVYA 5B0BA 2IVYA 3CDAA 1XIQA 4LT6A 2OSRA 2ZH8A 1XMQJ 5RUBA 1FJGJ 1T95A 3HZEA 4MKBA 3NAIA 3POTA 1HHTP 2DHHA 3H5UA 4WK1A 1HI8A 1Y10A 1LWCB 1ZA1B 4FXVA 3KG0A 3FSXA 4R5PB 9ATCB 1YITS 2WW4A 1X9WA 3N6MA 4U7UK 4DPTA 2W2OP 4X4NA 3HHLB 4KO0A 4RX6A 2EXUA 3IMQJ 5I3PA 2EK6A 1HNWJ 2ZJRQ 1V5IB 1XNQJ 1B64A 4FN5A 5AXMA 2FHJA 3VZHA 1SXLA 1RK8A 5HK4A 1NO8A 1YRXA 3V6KA 4WXWA 4DV3J 4MYUA 5D78A 1V9OA 2HZAA 1LWEA 1GX5A 3OFHA 1L3KA 3MMAA 4OYPA 1MWYA 3IAS9 3VV2B 1HWJA 4V1Ak 4IRKA 3IS9B 1G6BA 1GMWA 2CNLB 2IFXA 2YKOA 3I4PA 4KFBA 5KFGA 2DNOA 4OQJA 4N41A 1LW2B 2I5JA 1NB2A 5H9EK 1ZETA 3NNHA 2QMUB 4TLQA 3G6ES 4RBTA 2V4RA 3LH2S 3PFOA 2BZ2A 3H20A 3G82B 5CCMA 4RNNA 3ITHB 3THPA 1ELOA 2O1PA 1V3ZA 4K4XA 1K0TA 3VWSA 4NLRA 3F41A 2QT7A 5M2UA 4OZJA 4L75A 3DDKA 4DPYA 1S79A 3CC4S 1UEUA 2YWKA 2QLFB 2Z2YB 3NWRA 4OYXA 4WXOA 5K5MA 1WF1A 5AXKA 2H4YB 2H48B 4I64A 1U6FA 3WHIA 2MLXA 3HVRA 1FTRA 4BWJA 1WEXA 4DQSA 2MKYA 1CJTB 3T6BA 5K8OA 3DLHA 4KT0C 5CYMB 3BO3A 2HMIB 4OJ3A 5BJRA 1FDDA 2VFRA 2MGZB 4EBEA 3AD7C 2D3OR 1IKWA 3FK4A 4ZPDA 2WVFA 2IAJB 2WBRA 5LSOA 2HNZA 4TU8A 3US5A 3ISNC 1FKPA 3FBEA 3TJ9A 2ZHAA 4C0BA 2W9BA 4FF3A 3V6DB 4DDFA 3TYTA 2R7WA 2LQJA 1ZM2A 1YI2S 4LF7F 5CYQB 3ULHA 3R2CJ 1RTIB 2IM3A 3W7BA 2GIQA 4PG8A 2H4WB 3C46A 3G87A 4JOUA 5THWA 2P9CA 1YK9A 1T7PA 4HTIA 1W7WA 1Q78A 2W2MP 4NASA 1CJUA 2VBYA 3SSQA 5KG0A 2A6OA 4DEZA 4KPYA 1GQEA 2AX1A 5AE2A 3KLFA 3PXGa 2DGXA 4AL7A 1S0MA 3L95X 1VQ9S 3W8PA 4LFBJ 4JI8J 4DJBA 2DD8S 2XMUA 4CI0B 3UO0A 3OHBA 3OL6A 2Q66A 5A8WB 3DRRA 3MM5B 2B9YA 3JB9k 3TNVA 3HO1A 3M7VA 1R8HA 3Q2SC 4MK7A 3ZC4A 4CO1A 2DBBA 2YH1A 3AODA 2DR9A 2QLJB 5KFLA 1P6TA 1BUXA 4CWBA 3DRPB 4TY9A 3GV8B 2IYGA 1S0NA 1LWXA 1MSWD 3CE8A 2FJBB 3MEDA 2KHDA 4MKVA 4DL2A 1SKWA 2CJXB 2JLEA 4KYZA 3GJRB 3M8PB 3HVTB 1WDTA 3K5MA 3D7SB 2U2FA 1B7FA 2MLYA 3T19A 5J2PB 4DPXA 2IJFA 1N54B 1UWBA 1AT1B 2EKNA 1YZ7A 3IAM9 1TK5A 2IIHA 2X3GA 2KL8A 3SIPB 3T9NA 1N34J 3OLAA 4C8OA 2OGUA 2LQ8A 4DPOA 3UDCA 2G9OA 4C11B 1F5CA 1S9EA 3H4DA 2GHWA 4DR4F 4ID5A 5C24B 1D1UA 5IM0B 2BM1A 4WBFA 4CTAB 2ROEA 4ELVA 5B0CA 3PW7A 3NBPB 4J37A 2RD5C 1H2VZ 3FMWA 2ZDPA 4DU8A 2AJ0A 4FS2A 1N32J 3A3PB 3SV4A 2CQBA 1SC6A 2HFSA 2CZ4A 5I42B 2F4VJ 4ETXA 2CKWA 4ELUA 3FEXB 4LRBA 2H5JB 1JWWA 1HNZJ 4DCOB 5L1KA 2KJWA 3DYAB 3SSRA 2APOA 3TUIC 2DPIA 5EN1A 2FD2A 3D66A 2BJ8A 1FNMA 3WZ0A 1OSDA 3HKZD 3QO9A 1FEHA 3L4BC 5IT9Y 1WUUA 3VAFA 2DNGA 2IMWP 1VFJA 3C14B 3MMJA 1AUSL 2MZQA 3DU5A 4ICLA 5KFJA 1R89A 4GKJF 2OMOA 3QIPA 2HPUA 4OHYA 1FRIA 2V6AA 1ZOTA 4YFUA 3OR1B 5A8RB 2W9BB 3ISZA 3EWGA 1WEYA 3M2RB 3D6FB 1XWLA 2E1CA 2DH8A 5MAOA 5FLXY 1SJ3P 1TL7A 4ZDNA 1N32F 1TKTA 1RKJA 1Q81T 2JWNA 1C2PA 1P9YA 4XDCA 3K5NA 4B3MF 4IH6A 1BLUA 2BANA 3DLJA 2V4JA 3M9NB 4GKKJ 4OYIA 1VI7A 3H2UB 2GQQA 3U27A 3AJ2A 2VBXA 1P1LA 2DT9A 1RWNB 2P6SA 2D9PA 2UXCF 2QTWA 4QZVB 1S72S 5A8WA 1YJNS 1X5SA 3CIZA 1VQLS 2NR0A 4AT1B 1U0SA 1RWVB 1KLMB 2WW8A 2F8MA 2AGPA 5C42A 4RR5A 1HL6A 4M5NA 2DTJA 3CJ0A 3ELHA 2OO4A 4Y2IA 5LJ3Y 3MUVP 1RTDA 2A3JA 4C98A 1Q7YT 3KMQA 5D3GB 3MEDB 2GHVC 3IO1A 5HBMB 3OBIA 4FS1A 4WIIA 3D1OA 3H0PA 1G1XA 1FD2A 1Y3KA 3M8PA 1NPKA 3KWMA 2YWHA 4N77A 4ES2A 2DNNA 4NA2A 4FVCA 3LTOA 2O3DA 1S9GB 1TL3A 1WWHA 3OVAA 3K59A 3WX8A 3BSAA 2BR0A 1SL1A 4B17A 2XS7A 3KNGA 2G1HA 2Q43A 3LP1A 5JXSA 4DX8H 5GADU 2QA4G 2LP4A 4F67A 1T9VA 3GILA 1SQGA 1RHQB 2OPPB 3W2VB 2E66A 3CGIA 2LFVA 2CG4A 2R7QA 2W7OA 2C42A 2ZM6J 1XTZA 4CO3A 3FZ2A 5L46A 2AMCB 2QJ3A 4PYDA 4NXMJ 3DGPB 4EO8A 3DI6B 1NH8A 2XSJB 3L09A 2MQOA 3G2XA 1PBAA 3FJ2A 1ZPWX 5DS7A 4DS5A 3GSIA 1C4CA 1OQ6A 3T41A 4WP9A 2M7SA 2ASDA 2A0FB 3POTB 3HT3A 4YN3B 3IWLA 1RTHA 3JQJA 3N01A 3R8YA 1VQOS 1S1UA 2K7KA 1SBRA 1CSJA 2CFXA 1G7CB 3LPEA 2JOQA 3KHLA 1QD1A 5HSPA 3OT9A 4DV1J 1VRUA 4CLYA 1EETA 5L8RC 5AJ3F 3NOGA 2MTLA 5IWAF 1WNEA 3CCLS 4E2FB 2FZKB 4LRDA 2HIYA 1FRHA 2IA0A 2V67A 1FWLA 3ENAA 4WPAA 4O4GB 4QBUA 2R2UA 1Q4RA 1RA6A 3N4WA 2RU9A 3MOJB 1N0VC 3ENWA 1OSCA 1VIXA 3CJ4A 3P3DA 2M3DA 2ZOGA 2I5JB 1N5YB 2K3IA 3PJWA 4IO1A 4RNMA 1TKTB 1NXIA 2B4UA 2DNHA 2HFOA 4WYWA 2E5JA 2FC9A 2Z2ZA 3ITHA 4OX7A 3RRGA 4LIWA 1SH3A 2MZSA 2JFKA 3TA1A 1TMMA 1RWKB 2YY3A 5E3RA 3GWCA 1JNRB 5ETKA 4NL5A 4J9UE 1S1WA 4CLSA 4M5GA 1YJ9S 2C3MA 1S48A 3TZXA 2O66A 1RT6B 4U67Q 3M05A 4DV6F 3J81j 1RAOA 1RQ0A 1CJTA 1SJ1A 2DH9A 4EWTA 2YWWA 5CYMA 1S99A 4ZP8A 7FDRA 5HQMA 1KLMA 3CCRS 3OW2R 2MGZA 4A8WA 1FT8A 1REGX 4ZN1A 1IKWB 1FTCA 1L3UA 4NCAA 2AJQA 2RRBA 1J2VA 4CZCA 4NE9C 2ZUAA 1VGYA 2HNZB 5F41A 1KTVA 2XULA 3G96A 4HHUA 1NUEA 1UCNA 2K3KA 1D9DA 2IBKA 4C8YA 3PKMA 4KB7A 1OS5A 5CYQA 1FWKA 3VCDA 4NI2B 4Q44A 1U02A 2MEWA 2UUCF 5EUHA 2ZFHA 4P7VA 3C15B 2BJ3A 2D69A 3AB2B 2DGUA 2IYIA 2A1BA 2KVQE 1KOOA 2C2RA 4R5PA 1SUQA 3HXMA 4FNIA 1BMQB 2DGTA 3EICA 1TVRA 5BYQA 3W65A 3PV8A 3QIDA 3FUYA 3G8SA 1HQUA 3EE3A 2DRDA 4X4RA 4DV6J 1IBLJ 4NLWA 3MAAB 3DGPA 2RHQB 3DRRB 1HNIB 2C2MB 2CAJA 3MM5A 4YB7A 4ZVRB 1YTYA 4NYZA 2R7XA 3C66A 4AFFA 4RU9A 2YNFB 3DC2A 1DQ9A 1KRPA 3MFHA 1Q8LA 3M8QB 4RW4A 1NSAA 1RT4B 2IRXA 3DRPA 3FCWA 2GJIA 4NMXA 2G2OA 3RUBL 3DOLA 3OTBA 1JMTA 4KY3A 4JI1J 1C4AA 5KFRA 2QL7B 4RUHA 2RU3A 3ONQA 4EZ9A 3P5TL 4O3OA 1UVKA 2JZ5A 4CO5A 1RHUB 3DDNA 4FYWB 2BJ1A 3UPFA 4HEA9 1VRUB 4G65A 3PW5A 3HSDA 1NJXA 4PXEA 3PO4A 3HFZB 4FZVA 2BQ3A 4BS2A 2E7VA 4X4QA 3QZ7A 2DNYA 2ZH4A 1GMWD 2C2ZB 4OMFG 4DV1F 1KLNA 2DISA 4HDHA 4OHZA 5J2NA 2AJFE 2DHAA 4ANDA 1M1HA 3TARA 1S9EB 2CQHA 1HLWA 3UDEA 3OTEA 3W64A 2ZH7A 2OIHA 3BKFA 2DHSA 3R6LB 1RWUA 3QAEA 5G4DA 3TW0A 3UR3C 4C7QA 3CD0A 4LQ3A 4DR7F 3GG1A 2HMIA 1BQXA 2CIMA 5D8HB 2GMLA 3P49B 1WKJA 3I4HX 3DM2B 4GMKA 3D4JA 2VUGA 2N4CA 3V5RA 5KFDA 3TUJC 1FERA 4FF2A 1FKPB 1ZZFA 4FXDA 3HSZA 5KFCA 4JI5J 2HHQA 1NDKA 2DR6A 2Q3PA 4LF1A 1S1WB 2DYAA 2GX8A 2I8EA 1LXNA 3PEJA 4H54A 3DLBA 4C2MA 4ZVFA 2CQ1A 2J0XA 2DITA 4C0OC 2YQ1A 4USMA 5MLCV 3SI8A 3PYGA 3V4MA 1C0TA 2HVZA 2YWFA 2G1DA 5KFUA 3VGUA 3K7RA 4RL1A 2X3DA 3WX4A 4UY8T 1U2RA 4OV1A 3X1LB 2KZZA 4O4RA 3SCIE 1U09A 1FE4A 3GIKA 4TQSA 2ZH6A 2FLNA 2EKYA 1D8ZA 2VQFJ 2IY5B 4NPOA 1SJ4P 3FBBA 1TAQA 3QIPB 2QG9B 4DN9A 1VQ5S 5EGYA 2NUUG 2YKMB 3M2RA 1RAIB 2EFVA 1WD6A 4LJMA 1GX6A 1XMBA 3M2UB 3Q83A 3E01B 3H90A 1WTBA 1REVA 1TKXB 2HNDA 3MURP 1JJ2R 3ENVA 3FGVA 2PDAA 2AKWB 4YMEA 4DUZJ 2AYBA 2OFGX 2W2QP 3JSRA 1FO1A 1SPBP 2CDRB 1SUQB 4FXWA 2FIUA 4OV6A 1ZA2B 1TVRB 4C8NA 3WC0A 5KT2A 3I87A 2HHHF 4C8KA 3BGOP 3M8WA 2R4FA 1WOSA 3GONA 4OI1A 1QE1B 3FCVA 2J0QD 1N8RT 1HIYA 2HWTA 2XTJP 1HR0F 1CEZA 1GK8A 5DETA 4ED5A 2H3EB 1Q8IA 1S5ZA 4Z7CA 1UEVA 2B9XA 2V9KA 4DPUA 3NS7B 2B56A 4YB5A 2AWZA 3BB5A 3M8QA 4RW4B 1R0AB 1BQMB 3MD3A 3D68A 4NA1A 4P2XA 4C3KA 3D3BJ 5KFMA 2B4OA 4J9SA 1FXLA 5D3GA 2VKRA 2IBOA 3KJFB 4PG5A 3OTDA 1NK9A 1R0CB 2CPXA 2RUSA 3BGFA 3FSYA 3OVSA 1J5EJ 2KN4A 3D6HB 4ZHRB 1U48A 2M52A 4KKOB 1RP5A 2HZVA 1RAEB 2R2RA 1B4SA 5HLFB 4Z37A 3TO8A 1WC0A 2D1CA 1S77D 2WSCC 3GMGA 4NWBA 4RBUA 1QM9A 2RT3A 2XYHB 3M6UA 2BW2A 3BKUA 4RO0A 1LKZA 1F5BA 3K5LA 4DLGA 3IBWA 3TAMB 3QRQA 4P52A 3CUNA 1X9MA 1RU1A 1QSLA 5IT0A 4USIA 4GO7X 2FYXA 4FKYA 4QR2A 4UT4A 3Q8PB 2KXNB 2WB4A 2FZGB 2RSQA 4NYOA 2O5DA 2XSJA 2R7VA 4Y2AA 1C1BA 2EC2A 1X4FA 5LXYA 3DM2A 4MH8A 5D15A 3BGLA 4CCHA 3NP5A 4DQPA 1FFSB 3CCZA 5KFKA 3DLEA 5IC6B 4K50A 1FJ7A 3I31A 3AY0A 5F8LA 1S7IA 4W92B 4DHVA 3ZZRA 2BV3A 3N5FA 3T1AA 2N7YA 4U7UD 1F60B 3BQ1A 1F5AA 2PMHA 2XZWA 3QT6A 4UW2A 2FJEB 3S1TA 2QL5B 3OTOF 4OJHA 4O0NA 1H98A 3L3CA 4GC6A 2FQQB 1APSA 3Q8QB 3EX7B 1EETB 2OJ3A 2FJVA 2V4JB 3S01A 2CQIA 4ZK7M 4K0KJ 3P5BP 1FI4A 3O44A 4HACB 2DNKA 3QLHA 3U7JA 2LU2A 1LQ9A 3UWTA 1NSPA 4LF2A 2DRBA 1KONA 4XK8C 4WJBA 4PQUB 1TR0A 4ILLA 1PBUA 5LXRA 3CVKA 2YKMA 2OSQA 5T41A 4IRDA 1S7HA 1TFWA 4CH7A 2MKCA 5C25A 5KFXA 1REVB 1TKXA 1FRJA 3Q8YA 5D4OA 3IR6B 4X4VA 2Z2MA 1RTDB 4I68A 3SDEA 4Y00A 1WKLA 4I56A 1HNXJ 2GQ2A 3KFWX 4RUBA 2KO1A 2B9EA 4IH5A 3ET6B 1OYDA 2CJQA 2CVIA 1CPZA 4AXIA 3F73A 1T8EA 4DV4J 1QE1A 2HQIA 3PJXA 1S9GA 1TL3B 1RT6A 4IQMA 5H9FJ 4A46A 4BBYA 2XYPB 1HW9A 2UV8G 1TELA 4LFBF 3VAJA 2CPZA 2BMBA 4DR5F 2HWIA 2JC0A 2RKIA 3HSGA 3DMJA 4CNZA 2ASLA 2UUBF 3C3LA 3KKFA 1BQMA 2R8KA 1K8AT 3H5XA 1MU2A 2JNJA 4HKQA 3BF4A 4NLTA 1WC5A 2YKPA 1KTQA 1UZDA 3OJSA 4DBQA 3GJSB 4CRJA 1FKAF 3AH6A 3PACA 2HHVA 3UN2A 2XCPA 2Y9HA 4W90B 4OZ0A 5E0OA 5A0YB 3R27A 3MM6A 5ETLA 5KT5A 4PCQA 4IOCQ 1X9SA 4UY85 2KHCA 1IKVB 1IR1A 2BW7A 2EBEA 3D5MA 1NHVA 4DS4A 1QVGR 1T9WA 2Z30B 4X64F 5L1LA 4J9QA 3BH6B 3TAMA 3NGTA 5CD4H 3MR5A 2RDIA 1FFWB 1HQUB 5DDPC 4A8OA 4ZCMA 2C2EA 3M1VB 4RUCA 2X1BA 2HS0A 1UW9A 4NLUA 3GE9A 3G6XA 5I3UA 1UW4A 2PMZD 4FF4A 1QAJA 2RNEA 3QQCD 3FQLA 2KM8C 1TFYA 4ILMA 5IS2A 3BDEA 3WDOA 4K7QA 1RT4A 5A8KB 1RA7A 2BJEA 3DLEB 4M5HA 5KFBA 1N33J 4RNHA 1XR7A 3W60A 1TUWA 1ZBTA 4YB6A 5A2QU 2G4BA 1HKAA 1UAWA 2M0GB 2KFYA 2UXBF 1JLEA 4DL3A 4V19J 3OL9A 1AUDA 3AFGA 3V4IA 5DGBA 1NZ8A 3Q8UA 5ETQA 4X4TA 1URNA 1GMVA 1HMVA 2B4VA 3J7YI 3KK1B 4PUOA 2YTCA 3EXYA 4G6VB 1Z1ZA 2IRUA 2G2YA 4DUYF 4JV5J 3KUHA 2IPOB 3BKTA 2DXEA 2ZWOA 4EI2A 5M2PA 3OPKA 1IBMJ 4JV2A 2E9RX 4PQUA 2CPEA 4ES1A 5F8GA 1N6QB 4JI4J 3CF5Q 1JK9B 4JI5F 2P9GA 3TUZC 2MXYA 3T1YF 4DQRA 2UU9F 3QWPA 4Z2XA 5CYJA 4C9DA 1FJGF 1PSDA 3HCXA 3GG0A 1IKYB 2EWHA 3P96A 4RLEA 3UE2A 4DG1A 4NLSA 3JTOA 1U1LA 4YS2A 4DSKA 2NZCA 1RAJA 2H54B 2J7UA 5KFTA 5GVQA 2BX6A 1Z2LA 2H65B 1VLOA 3MHYA 3TJAA 4NMLA 5CCLA 1XMQF 3HHLD 1HHSA 2VPXB 3VAKA 4IOAQ 2B0GA 1JLBB 1VHFA 1DTTB 2RF2A 3HHDA 3KJQB 3RG6A 2ZH5A 3QT7A 1XMOF 1F3VA 4CO2A 2KDOA 3VR1A 5CABA 2AD9A 3C6UA 4NA3A 3NKYA 2VBWA 4L3KA 4RW8B 2I1RA 4A48A 4E0DA 2CXEA 4OX9F 2OD4A 2RKIB 2E5HA 2EK1A 4ZOSA 2CNOB 1MMNA 4ER8A 1SKSA 4RNOA 3B54A 4RW7A 3MM8B 4NZ7A 3M6XA 1RHJB 1UETA 3KK3B 2VOPA 3FQKA 1B0VA 1FKOA 1S59A 2J5AA 4H4KA 2KI2A 5E3CA 1TZ0A 4PABA 5KFHA 2PN6A 5IQ6A 3OSPA 5KFWA 3T5LA 3E01A 3P8BB 4DL0C 3RRHA 5H9EJ 2HNDB 1Y5LB 1TTHB 2OMLA 1NPPA 1B0TA 1YBTA 4PXCA 4R25A 3RTVA 2QYGA 3DOLB 4DR2J 1YX2A 4L74A 2OKQA 1I5OB 2XNRA 4NRUA 3JSYA 3S8SA 3RBZA 4E98A 2IVMA 2ZBCA 1T3OA 2AEFA 2HAFA 3KLEB 3ZZUA 3JTPA 1IJFB 1VBKA 2Z2LA 1N52B 4Q2LA 5DQGA 5GADI 3CD6S 4OZNA 4C8ZA 1MW7A 1KDNA 2LU1A 1SC4B 4DV7J 4ED3A 2Y1JA 3BDPA 3OXGA 1R8PA 3NOCA 3U02A 1FFGB 3WIUA 5B0AA 5H1SV 2I9SA 2DB1A 3PTWA 2ZH1A 2RS2A 5D6GA 1PO6A 2YWGA 2XWXA 5LJ5Y 4DF8A 1JNZB 1PG5B 1KS2A 1S0OA 3GYGA 3W61A 4LF4F 1M5HA 3G82A 3PYEA 5E5NA 2ROGA 2NXCA 2YBVA 3IFEA 3RGIA 1HYSA 2GA7A 2DR5A 4Y0FA 2B8QA 2MQNA 4EYIB 3EJMA 3SXLA 3CC7S 5K8MA 1DAXA 4U95A 4WTOB 3F56A 4DR3J 4QWAA 2N3LA 2L41A 2L48A 5AJ3J 4HTJA 1XEZA 4CLLA 1IM6A 1C0TB 4I6AA 1FJCA 1MG7A 4RPFA 2FY8A 2HRYA 2OEMA 1VC0A 3NEKA 2UXDF 1S6PA 3RRKA 5L38A 3OTCA 2IAJA 2IM1A 4DG1B 1ACMB 1TMJA 1VR6A 2DJWA 4K59A 2GNKA 1ZH5A 3SCKE 3FRZA 4JI7J 1M0SA 1NLKL 1WC6A 2BBEA 2CNKB 3M6WA 4ZA1A 4OI0A 4LSLB 2LYVA 3LAKA 2XMVA 3FMBA 4OLOA 2CPFA 2DNZA 1IBMF 2PI4A 1QVFR 2NPIA 1AA1B 3A1YG 2JL9A 1X0FA 2BUNA 3A4TA 2B3TB 4PKDB 4FBUA 2ZITA 5HLFA 1RTZA 3EM1A 1O0PA 4HACA 4ZPCA 1FDAA 1U2FA 2CJAA 1KNZA 1M5PC 1FRXA 1KQFB 1FDBA 2BRLA 2HLTA 2KU7A 4RW7B 3UN5A 3MZIA 3ZTQA 3JAMY 4YHHJ 4ECZA 2BE2B 1Q0NA 1CULB 1O6XA 4LF9F 2RHSB 1FRMA 2HGNA 2OD6A 4NLGA 3BR8A 4EBDA 2C28A 1GTHA 3N5BA 1FE0A 4O3QA 3BBBA 4FKXA 4BLGA 1VBXA 4HT5A 2NXJA 1YJUA 1XR6A 3CMQA 6FDRA 3J81U 4EZ6A 3BQ2A 2CA9A 3B78A 5CZXA 2KKHA 3CMAS 2BABA 1OWXA 2LA4A 2MJNA 3FBFA 1OY9A 2AT1B 4BC9A 4ZPAA 1SJRA 3OR2B 4LBIA 4AUKA 1HI0P 5B08A 1RCOB 1UWBB 2EFNA 3K8WA 4CDIA 1KEKA 2MQQA 2BKNA 5EWGA 3MGJA 3CJ3A 3UI3A 1R8BA 5DQHA 1NK4A 2AF6A 3MMCB 2CRLA 2PEHA 3THTA 5DJBA 4PG6A 3U1NA 5DG9A 4TVAB 3PW4A 1ZTWA 1NK0A 3DMJB 2YNHA 4DQIA 4YDXA 2FPHX 5IV4A 3GJTB 2DR7A 2VONA 3EZOA 5AT1B 1MMDA 2RMLA 4AL6A 4CTAA 1NU4A 4ELTA 3M8SA 2CQ4A 3AXKA 1FJEB 1ITPA 3PFEA 5LL6d 5GMEA 1YG0A 4I69A 5A0YA 1M5KC 4AQYJ 3MDFA 1HYSB 2K2PA 1U6BA 1U8SA 2OH2A 3KMSA 3L7OA 1N36J 1RT7A 2DVIA 7FD1A 2ACYA 3I9V9 2DXFA 3J7A1 3MECB 2BACA 2XZTB 3DYAA 1UZHA 2MB0B 2CJBA 1VJWA 2IJRA 2ZC3A 4KGMA 3HHLC 1YGYA 2CVEA 3QO9B 1FRLA 3BR9A 4Q8FA 1LFWA 3GIIA 2GS8A 3R5JB 2CZVC 4A8SA 1UVLA 1S0VA 1Y11A 2GAGC 2HFVA 3MFIA 1O8BA 1N0UA 1WORA 5LMUF 4B9UA 3P6YC 2GZOA 4DR6F 2HBZB 2C2KB 5GMDA 3JQMA 1SQFA 3QT8A 1GEHA 4F4XA 4N8NA 4USVA 2E29A 1A7GE 1TL7B 2JVOA 1VQ4S 2FVRA 2B4PA 3FSIA 4DX5A 1U2CA 3ZNUA 2R8GA 2LDYA 4DLEA 2E9TA 3NGSA 2HQGA 2CJYB 2CDQA 4CIOA 1HMVB 2PSZA 4B3RF 2NZ4A 2WAQD 3B82A 1LFPA 3QGIA 5J1EA 5KFOA 2E1RA 4M5LA 3CULA 4PUOB 3QJLA 2OEJA 4CH1A 4C4WA 5KG7A 1VQKS 3VHQA 1CS4A 3ILLA 5J1PA 3AD8C 3VGTA 2XO7A 2J6TA 4WZQA 4N76A 2BVZA 4CQ1A 2XYGB 1KKHA 2KT5A 4ECYA 2BE2A 2FLOA 1X5TA 4FPIA 4X84A 2LEBA 4Q7AA 1N6QA 1CULA 2YPZA 4QIGA 5DZ7A 5C7PA 5ITHA 5F8MA 1N5TA 3OQ2A 1WHVA
chains in the Genus database with same CATH topology
4DSIA 1QUPA 1MU2B 3R1LA 1LWFA 5HP1A 1G3OA 4ED1A 3SQGA 1NB7A 2UZAA 4TYAA 1U1PA 4NLQA 2R7RA 1YVFA 2VBZA 2KRBA 2RF2B 5A6WA 3BSCA 1IKVA 3I6PA 3J7YU 2Y1RI 4Y2KA 2LA6A 3C6UB 3M30A 4RUAA 3KLHB 1TL1A 5L1JA 2YX1A 3I0RA 3MM8A 3KK3A 3CJ2A 3IN5A 3M1VA 3O5TB 2EC0A 3O8WA 1HWUA 4LIRA 5LSLA 4OI2A 4JUZA 4RZRA 4YHHF 1YJWS 2KYZA 2ZBIA 1UP1A 3Q23A 4AL5A 3GFZA 1X0PA 3K8VA 1HQEA 1YRTA 2P6TA 3CCWA 2QYCA 3VQTA 3NNAA 3RAXA 3MECA 5EWFA 1TQLA 3S6EA 3T6JA 2PT0A 2J0SD 2H5EA 5B0FA 4NOHA 2MY8A 2VG5B 3OFEA 2KG0A 4A8KA 2F3JA 4QR1A 3AA8A 3DOKB 1B0PA 1S4FA 2V8GA 4I4BA 1TK8A 4H4MA 2ADBA 4L72B 4O44B 5T7LB 3M8RA 1UKUA 3QJPA 4O4GA 3S7RA 1PGZA 3N9UC 3HHKA 1KN6A 1CQMA 3SYZA 4ETZA 5DG7A 2G13A 2YX4A 3SFUA 4YR0A 4M95A 3AQOA 2MY7A 3DXBA 4WTYA 2P5VA 1NNDA 2I2YA 5DDQC 3H2LA 1MROA 3ZZTA 4DOZA 2JEGA 2RQKA 4XO0A 4DQQA 3C8YA 2FHOB 6FD1A 1KVIA 4OJ1A 4AYBD 4MJKA 2AQ4A 2EFQA 2FJWA 1KSPA 2ZM6F 1NAQA 5CA5A 4B3TF 2AU0A 2G0CA 1L3SA 3BGRA 3FEZA 2KFZA 4ECRA 4ZP7A 3TVKA 4PG4A 5CH7B 1JKHA 2CQPA 1V3RA 3CSKA 2KH9A 3B4DA 4KTQA 2PIIA 2XS2A 1S6PB 3DRYA 3J7Z5 3I5CA 1ULRA 5HP1B 2YKAA 3BO2A 2KTQA 5KT7A 2J7WA 1I6JA 1XERA 1XN9A 4UOCA 1R31A 2JHEA 2DRAA 3PZPA 1S1VA 3OXLA 4HH0A 3F44A 3R5CA 2VA3A 1FD8A 3HHEA 1P9QC 4XAKA 5KFAA 4N56A 2E1AA 1U1MA 3WC2A 1FCAA 4NX9A 2D41A 3I0RB 3RYLA 3DU6A 2MSTA 1OQ3A 4QWBA 5BYRA 3UCGA 1N88A 1S6OA 3LAMA 2W7PA 2WK4A 1NRKA 1HNIA 1RTJA 1FRKA 3DRSB 4G1IA 3VAGA 3TX8A 3CT9A 2FHMA 3CDUA 4QR0A 2ZJPQ 2YNFA 4HVZA 3QGGA 1GTEA 2F1FA 5GAEI 2DGWA 1L3VA 1H7XA 1HQEB 2UVWA 4DFMA 1EP4B 5IFMA 2VD3A 2C3UA 4R8UB 2XY7A 4I7FA 2ZOFA 1U1OA 1FXRA 3MWBA 4OI6A 4DSJA 4HH1A 3SFGA 1DRZA 4J9LA 5C5JA 1NHUA 3K5PA 4NZ6A 1RT3B 1N48A 2DR8A 4M94A 4JI0F 1M90T 5J2NB 1UVJA 2D7SA 2JC1A 2F7VA 1M1KT 2GMHA 2MZTA 3DNCA 3GZ7A 2W9CA 1DQAA 1WF0A 4X65F 4C0HA 2VV5A 2K1RB 3N79A 1FNOA 4LMZA 1PC5A 4NLYA 4F2RA 4NCBA 1H2TZ 4DFPA 2YKNB 5HL7Q 3LP2B 1GAOA 3BZQA 4JI8F 4LSLA 3T5JA 2QV6A 5DG8A 3Q2TC 4KHRA 5AE3A 2XMTA 4K5SA 3BGRB 5HROA 2DPJA 3CCJS 3KLIB 3MD1A 4ZVGA 1P27B 1Q82T 1CLFA 4TY8A 4CT8A 1YWXA 5ADZA 2AYGA 3LF0A 3IR7B 1F2GA 2AJ1A 5HI7A 4D3HA 2W24A 3DHXA 3H2VE 4Q5VA 3KLGB 3I55S 2VL1A 4ED6A 3H59A 3DCAA 5DQIA 5KT6A 4OL8A 4NLOA 4IH7A 1HD0A 2WCXA 4RBVA 3PIOQ 3OVBA 2ZHBA 2AGQA 5HQ8A 4LUBA 2R7UA 4NRTA 3PRBA 4OJGA 5B0DA 2FDNA 3EGZA 3M4XA 1CC7A 1M5SA 1N5SA 4RWXA 5LT5A 2CQCA 3IA0A 1D3WA 1D9AA 1WHWA 1S49A 1JXLA 1CC8A 1RTJB 3N0VA 3IR5B 3FFIB 3ZZPA 1Y5IB 3N6NA 4KE5A 1R0AA 4FP9A 2D3ZA 1HFEL 2PD1A 1KQKA 4ALZA 4YY3F 2GMJA 2OPSA 3JTNA 2YVSA 2DNPA 3SQGB 1M5VC 3BS9A 4HT7A 3TQ1A 4B9LA 1S76D 1Q7LB 5EX3A 3ISND 5KG3A 4MFBB 4QJVA 3D1HA 4IFVB 4URSA 4J9RA 4ECVA 1X4BA 3DN9A 3GFYA 4JV0A 4OZ1A 5LSRA 4I0WA 2EI5A 1G2EA 3KHHA 2CPDA 2Y0SD 3KLHA 1FA0A 2V8VA 1GT8A 3VF0B 3RZAA 1H2UX 3Q24A 2K8GA 4F3MA 2EW9A 4P2SA 3CCVS 2K1RA 2FJXA 5EHHA 2C22A 4MIBA 2RB7A 1IQTA 1Q53A 2YKNA 4D3GA 5GMKa 1P8GA 4U9RA 2HQ3A 3AB4B 3HDSA 3TVYA 2R7OA 3CXCR 3UCUP 1E6VA 5HROB 2KT2A 3DFEA 2WRMA 3LP0A 5J1EB 3OJUA 4DWIA 3T9ZA 2VA2A 2GC8A 3QLHB 2FGCA 4G3IA 4LFAF 1M5OC 2M70A 2E5GA 1I1GA 1FESA 2MKIA 2L9WA 2XMJA 2LECA 1Q86T 5DRKA 2XLJA 1CVJA 4KQZA 3GV5B 5C25B 4I1TA 3MUMP 4NLPA 2R7SA 1VQSA 4WKYA 3D0HE 1LWFB 1QAXA 1V6HA 2EPIA 3TRGA 1YIJS 1VBYA 1VMBA 3SSSA 2C2DA 3G8QA 3AAWB 4IO9Q 3V6HA 3QGPA 2KXHA 1JKHB 3OHAA 4B9SA 3M30B 4LF6F 1FDNA 3OV7A 4K4VA 1TL1B 2YKQA 3JSBA 2ROPA 1VQ8S 4KJIA 1HA1A 2OPRA 3PVXA 2X1GA 1OIAA 4QIEA 5K14A 5HMXA 5FJ4A 3ZZZA 2KRRA 4LFCF 2PFFB 1JLGB 2LQ9A 2MQLA 3E3XA 5J2QB 2U1AA 1X8DA 4OHXA 2C3OA 4RNFA 3TANA 5HN0A 2DHGA 3DHWC 3VAMA 1N34F 3GIJA 2RJZA 4WF9Q 2J76E 2BJDA 1DURA 2QMXA 1TV6B 4JI6F 4E8UA 2POKA 3T3FA 4KHPF 2VG5A 2YNIA 2J9CA 2N4DA 1U45A 1X4HA 1Y3JA 1KFDA 3DOKA 4CH0S 2XC9A 2KYXA 4IOBA 4WFBQ 2QSFA 2HG4A 5T7LA 3H25A 4TNOA 1X5PA 3G6YA 4USHA 4HDGA 4X66F 2B7CB 4X62F 5KFEA 2MZJA 1IM4A 4PR6A 3CTRA 1RKIA 4K5RA 5EWEA 4JYAF 4PWDA 4X2BA 1YSJA 5D4NA 1SJFA 2W7AA 3CB4A 3RR7A 3A8EA 1W25A 1E6VB 2F9JA 2NYIA 1SIWB 3MM9B 1MROB 4WZMA 1S6QA 2HVHA 2B43A 3KK1A 2XG8A 1H7WA 2HFZA 5KAKA 4OI3A 1CG2A 3D2WA 2VC1A 5T14A 3HP6A 1Q1KA 3U1LA 5GAGU 5KFFA 4WFNQ 3MR2A 1R8AA 3PKYA 2GQCA 2IM2A 2GFFA 3E51A 1NKCA 4FBTA 3PX4A 5BYSA 2QA1A 1T02A 2DNMA 4OI4A 4ZS6A 2NSBA 2PGCA 1HBNB 1IKYA 1DHMA 2R2SA 5DM6Q 3Q8SB 2MJUA 3KYLA 3X3UA 1N5VA 2EG2A 4TN2A 2ASYA 1GXTA 3DLLQ 4BWMA 1JLBA 4YQWA 5KFSA 4LF5F 2AP6A 1KHWA 1BGXT 1LW0B 3D54A 2E44A 5KFVA 2HIQA 1VS3A 2CPJA 4DV7F 2X51A 1IBKF 2XHWA 2EFGA 2LXFA 3TVZA 5K14B 3DRSA 4ZP9A 3UFCX 1U49A 4G1QB 1SV5A 2XMWA 4EO6A 4IG3A 4WU3A 4F25A 4DV2F 1K0VA 2FJDB 4TU7A 5F3TA 3Q0AA 4Q45A 4F8RA 4A4JA 1RT2B 5DM7Q 3G71S 2IRYA 4LQ9A 5GAHI 2QA2A 3PX0A 1VC5A 1IBLF 1IKXA 2J7KA 3ZZ0A 3KLEA 4MTPA 4J9PA 3PR5B 4J9OA 2V5HG 3HKWA 1DQ8A 4MKYA 4WFXA 3O6QA 5L39A 2GIRA 3QZ8A