5GAGI

Rnc in complex with srp-sr in the closed state
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
b'ALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYVTEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5gagI00
5GADI 1ZAWA 3JSYA 4UY85 5GAGI 4NWBA 5GAEI 5D6GA 4V19J 5D8HB 1ZAXA 1ZAVA 3A1YG 2QA4G 3J7YI 3J7Z5 5GAHI
chains in the Genus database with same CATH superfamily
1RAEB 4LF1A 1KR4A 5F3ZA 4PXCA 2XYHB 3IMQJ 2OMLA 3NG8A 2VC0A 4O3OA 4YDDB 3QLHA 5ETKA 2W01A 1G6BA 2XB2D 4WP8A 1TL3A 4GVBB 4KY3A 2IRXA 1PC4A 2DXDA 1D0EA 4NL5A 1XMQF 1S0VA 4LFBJ 4MT1A 3AOBA 3C6TB 3TUPA 3RW7A 1UFKA 2YQ1A 2CQIA 3I87A 2DITA 3QLHB 2CDQA 3FEXB 3VAIA 2KVIA 4TYBA 2F4FA 2SXLA 3DDKA 2UXBF 1TL3B 4RLEA 3T1HJ 4GKKJ 1Q5VA 4DOZA 1YBAA 4DV7F 1U26A 1DQ9A 2VG7A 5CD4A 2ZBRA 2XMKA 3ZZOA 4P2FA 3M2RB 1NK4A 5H9FK 1AXQA 2E1CA 2BR0A 1BMQB 1VK8A 4Y2MA 4DV1F 1VC5A 2ZH5A 2KTQA 4M1KA 4NRTA 4KC5A 3K5MA 1H7WA 4FKYA 2J0QD 1RABB 2MZQA 2WZ1A 3NS6A 1KC8T 1BY9A 1WEZA 4WF9Q 1VHFA 3TJAA 3I6PA 1Y3KA 3MR6A 4RW4A 4DPOA 4WE1A 1WG4A 3I5CA 3BN4A 3KJFB 1U1QA 4I7FA 4EBEA 3KHRA 4P2MA 5LMUF 5KFHA 4IRDA 3W64A 3CMAS 4DEZA 1K44A 3FKBA 3K89A 1VQ5S 4CO5A 1TZ0A 1B70B 4ECYA 4RW4B 2GFFA 2FGCA 1P8GA 2VG5A 4PG5A 1HHQA 4WE1B 5K8OA 1JNZB 3FBFA 5SUHA 4XPCA 2HFUA 1T05A 1XMBA 4I7FB 3IP0A 2R3VA 1R27B 3EYZA 2CQCA 2H51B 3NL0A 2BJEA 3OTDA 1OPIA 3FZBA 3GB0A 3JTNA 5CZVA 3J81U 1TV6A 4UZBA 4HACB 3CSKA 4O4GA 4CRJA 4RZRA 1A9NB 3U7JA 1M1HA 3GR1A 1U0HA 2VG5B 1WD6A 1S10A 3UCGA 3MCMA 4JI4F 2FVPA 3BR9A 4QIFA 2NUHA 2XMVA 5RUBA 1T05B 2XS7A 5G4DA 1T0TV 1LXNA 2W2QP 5A8WB 3QGIA 2HIYA 2H9ZA 2ZC4A 2HHHF 1F9HA 4DSFA 4K59A 1U0HB 3DRSA 3ICLA 1N48A 1Q5YA 5KFZA 1KEKA 4C2MA 2XO7A 1XNQJ 2D1CA 3A4TA 4ZVOB 2VBXA 4KGVB 3T9ZA 4RW6A 1YRXA 3HD1A 4CLZA 1RB0A 1P9YA 2Q1LA 3TX0A 5CHCB 3K5NA 2L3MA 4RW7A 3KJVB 3KHGA 5C2GA 4JI0J 4X64J 5IT9Y 1TMJA 3Q22A 1FJCA 5L1JA 1JJCB 1AZSB 1JLCA 3EUNA 4IOBA 3DRSB 3U27A 4K4YA 1C0UA 3PX0A 3FFIB 4B9NA 5C25B 4F4XA 3NAIA 1TKTA 1OQ6A 1K1QA 2HBZB 3M9NB 4RW6B 3FEZA 4ZPCA 3MTKA 2AD9A 4KJIA 4RW7B 4LF8F 3LP1B 2J6TA 1JWWA 5EDWA 1XEZA 1GMVA 2WVBA 1JLCB 2FZKB 2IM0A 4UOGA 5CCLA 1C0UB 3NY0A 1BD6A 1TKTB 3GFZA 3CJSA 3G6VA 5M2PA 2CJXB 5L39A 2D7SA 1X4GA 1R6VA 1SIZA 1N52B 1PJ5A 2HK3A 5E41A 4UOCA 1LOUA 3CDBA 3PYEA 2CRLA 3CWJA 1JXEA 2E9TA 1WC0A 2E7VA 2RE1A 1N0UA 3IRWP 2JSXA 2PT0A 2IM2A 2MDAA 4MKVA 1F0XA 5HI7A 4I2QA 2UP1A 3OFFA 1RQ0A 3HKWA 5I3QA 5K20B 1K0TA 2RDIA 3PJ9A 2JEIA 3PYDA 4MYTA 3I9ZA 3BO3A 4HHHA 5ETRA 2R8IA 2V50A 3MR2A 1IBMF 3FBBA 2AYBA 1KHVA 5ETVA 4H4OB 3MEDB 4LT6A 2UUAF 2R8GA 3D1HA 4QPTA 5L1KA 4R8UA 4RNOA 3D3BJ 2DY9A 1JXVA 4NZ0A 4DUYJ 1VQ7S 3D6TB 4IFVA 5D78A 3ILOA 2RSQA 5B0DA 9ATCB 3R97A 4D3HA 1S0MA 3H8YA 2B6AA 4HI1A 1IN0A 1T3OA 4LFCF 2FVRA 1ZYQA 1FXRA 4R8UB 3HSZA 3UVJB 1K47A 2XCAA 3GCXP 1KVKA 4DV6J 1XMOJ 4AL6A 4EBCA 1L3TA 4IFVB 4P73A 5F8MA 1S1UA 2B6AB 1SUQB 3UFCX 4LF7J 2A0FB 3MAQA 5GMEA 1F3FA 4MIAA 4YMEA 4OJHA 3V6KA 1CJTA 5H9EJ 4EO6A 1HBOA 3KHHA 2MZSA 4CLTA 1RHJB 4B3MF 1TFYA 3R7SB 2Z0GA 2PEBA 1FKOB 1UPMB 3MCSA 3BZQA 4KR0B 3MPYA 1S1UB 4DU8A 5MAOA 1O8BA 3SQOP 2QA4S 3EJMA 1UVMA 3M32B 2VQFJ 4ZPBA 2WAQD 1FFWB 5HP1A 1UW9A 3QNWB 2Y1IA 1NJIT 4WZMA 4ES3A 3DN9A 1S9EA 2HSEB 4KPYA 2BOPA 3KUHA 2J7WA 5KFVA 1GXLA 3G96A 4DR5F 1LEOA 3T41A 3DLEA 4NA3A 4J90A 3ZNUA 4WXWA 1VQLS 4P2SA 3QGHA 3MEGA 4K2XA 2LXUA 2HQDA 3NGTA 5D4PA 1SB6A 4LIRA 4DQSA 3V5RA 5IFMA 2MY8A 4NXNF 5GMKa 3ZZUA 2DH7A 4OX6A 4XAKA 4EFAC 3NGDA 2BE9B 3IWXA 2YWKA 3L09A 3KK2A 1S9EB 4QWBA 2QO3A 3O44A 4DR7J 3QSIA 3TUIC 2KT5A 4FVMA 2FLOA 3KYLA 3DLEB 3BKFA 1KFDA 3D66A 1FESA 1OO0B 4P7VA 3IBFB 2ZBIA 2UUBJ 2A6OA 4ECVA 1VBXA 4CLSA 3GWCA 2HHPA 1RYRA 3AXKA 3PKYA 1PBUA 5EUHA 3KK2B 5HL7Q 3EXCX 3KLGA 2V4RA 2M8HA 3AFGA 5KOXA 4MIBA 3TZZA 1U1KA 1KN6A 4UTGA 2EK1A 3C6UB 3PHTA 2WVDA 2FJWA 2J9CA 4AXJA 4DR3J 2N3LA 2WCXA 1XK8A 3D4JA 1D9AA 2XY7A 2EFGA 3VV2B 1NK6A 3A3NB 4DV3F 4ZPDA 3KLGB 2CYYA 4DSJA 1VQKS 2KT3A 1RUSA 1GXTA 4DCPB 2OPSB 1CLFA 3CCMS 2RHQB 2PO4A 1QLNA 2UVRA 1UEVA 4Z2XA 2DNHA 3IR7B 4TY9A 3F44A 2ZH3A 3G86A 3RAXA 4KGZB 4NEYA 2ZVIA 2GZOA 1R0AA 3ISND 4DR6F 1EJ7L 1T03A 5SZTA 4FBTA 2EFQA 3D5MA 1CC7A 3MPDA 1UP1A 3N4WA 4C3KA 1RKJA 1IQZA 3K2YA 2IA6A 2BXJA 1TFWA 3G9CA 1NPRA 2V8GA 2R8KA 3QT6A 2F4VJ 3HPOA 4QQBA 2KZZA 3HHNB 1FJ7A 1R0AB 2DR8A 3GIJA 3VAGA 2XWYA 4ZMMA 2W7OA 2K1RA 1HI8A 1VMBA 1X9MA 1I51B 2IPOB 2GAHC 4DZDA 4AL7A 4IDKA 3LPYA 3AJDA 2DO4A 2HNYA 1RWXB 5L1IA 1C4CA 1NH7A 4QJVA 2C2KB 1W2BR 1DFDA 3PCOB 1ZOTA 4EYHB 1Q82T 2CPJA 3DFEA 4X4UA 2XZDB 4ELTA 5DQIA 3HT3A 1L5UA 1RWUA 4TU9A 1HI1A 3GSDA 3PEHA 4DPYA 3QT7A 5KFXA 5FDLB 1IR0A 4IDKB 2RAQA 2M4MA 1K8AT 2F8MA 1Y5NB 5HQLA 4J9RA 4CNZA 2HNYB 4K4SA 1TKDA 3RB3A 2V2VA 3VWSA 2ZWOA 2G1HA 4KB7A 1ICEB 1PGZA 4QWCA 2B7CB 3V4MA 5B09A 2VFUA 4J9MA 2CIMA 1UJ5A 4F50A 1EQMA 1N32F 2DNOA 4IQMA 3R5DA 4CZCA 2BW2A 5L9NA 2RRBA 2HNDB 2OH2A 2YY3A 1OY8A 4USJC 3AOAA 1HNZF 3AQOA 4O0IA 3R5CA 4X4RA 3GJQB 2G9OA 1I5OB 1MNEA 1SKUB 1WDDA 1RWWB 2R2RA 3OD2A 4LSNB 1VQSA 3MDFA 2Z57B 4WZQA 5I4MA 1NZAA 1H2UX 5KFLA 3IBCB 3PIOQ 4C4WA 3NOCA 1NSKL 1RT3A 2FC9A 1LNQA 1HD1A 1MSWD 2F63A 2D3OR 2KRRA 1U1MA 1S1VA 3GV7B 2VG6A 4DV2J 2DNLA 3BGLA 3P8BB 2ZM6J 3QRRA 1GMUA 2YBVA 2MKSA 5EWGA 4YR2A 1JQGA 4R5PA 2C2DA 3BJYA 1RT3B 1R8AA 3DRRA 2C2ZB 1YWXA 1S1VB 3OL8A 1LWCA 2VA3A 3GSIA 2X1BA 2VG6B 3G4SS 4OYBA 4UW2A 1VJQA 4O3RA 4JI5F 4ED6A 3H5YA 2E1MC 2XHWA 1JJ4A 2BM0A 1FDDA 3N28A 2IJRA 2KFZA 4USMA 2DO0A 4OHVA 4LBIA 2FLLA 4R5PB 4IG3B 3CJ8A 2RRNA 3DRRB 1OWXA 4MAKA 2W7PA 4J7CA 2EC2A 3UDLA 3VHQA 2W2MP 4GRSA 2RJZA 2FB0A 3QZ8A 2Y1JA 4LRFA 3LGHA 2PIIA 1UJ4A 1RHKB 3GYGA 3PIPQ 3Q8VA 3H5SA 4WFBQ 1S7HA 3IGNA 1NHUA 1QM9A 3BGOP 4FXVA 4I68A 2DGTA 4L3KA 3J80U 2G2ZA 2DNPA 2DCUB 1HYSA 1TAQA 2BZ2A 1WKLA 3EDRB 2ZDPA 3RRGA 4P9SA 4DPXA 2Q3PA 2DGVA 4FDFA 2WB1D 4MIWA 4BHQA 2CFXA 5D0EA 1K73T 4AFFA 2M8DB 4JI2J 4X4TA 1F9FA 4LSLA 1HYSB 5IM0A 3CD0A 3R6GB 1N5QA 1S12A 4LR9A 3OLBA 5E2QA 1P1LA 2GO9A 4M95A 2CVIA 1SC1B 2KXFA 2ALZA 1S57A 1FT8A 3D54A 4ANCA 3CCZA 1WI8A 4JI7J 4M5GA 2QEXS 1VBZA 1MG7A 2W2PP 2RQKA 3CCES 2HRYA 4P72A 3JSMA 4LSLB 4O3PA 3TEGA 2YKAA 1P1TA 5IM0B 1H7XA 3HSDA 3MMAA 5JUMA 4CWBA 5BYQA 1IBKF 2GCFA 3BREA 1IXKA 3W3SA 2ZHOA 2MKIA 2PMZD 1G4CA 4TLQA 4PEOA 1KWMA 2GVDA 2QLWA 1UVJA 4A46A 2ROPA 4NCAA 2XBPA 4OHZA 2C3YA 3I4PA 3K8VA 1FNMA 4NYPA 3MECA 4USKA 3RG6A 2R7OA 1XWLA 3GP9A 2A6MA 2FZCB 4A8XA 1I6JA 3NCPA 1RK8A 2M5YA 2OEKA 1NH8A 2B9YA 5GAHI 4TNOA 1CG2A 5L38A 5KFOA 3GG1A 4ZJLA 1JLGB 4X62F 3I96A 2VC1A 1T9WA 3ISZA 3KLIA 2COLA 2P6TA 1TL5A 4P6QA 1CJVA 1MN7A 4HKQA 4ZP9A 1JLBB 3PYGA 3DGPA 2E5LF 1NLKL 4C8MA 2ATLA 2VH7A 3Q86A 2F7VA 2YKOA 5KG4A 4RW8A 1NDKA 1LWFA 3KLIB 3JAMU 4AQYJ 1CJVB 4CH1A 3M6VA 1FEEA 4NLPA 5IQQA 4IR1A 2JEFA 1O51A 4C97A 1MROA 3DC2A 1VYAA 1GX5A 1UPPA 2D9OA 2V6AA 4M5NA 1X4CA 1GFWB 3ENAA 4I6WA 5DM6Q 1URRA 1RZMA 2E1PA 4LF5J 4MYUA 1LWFB 1FO1A 2AZ3A 2VD3A 2MKKA 1M0SA 1J5EF 4HYKA 3DXBA 5DDRC 1MROB 3R5JB 1QUPA 3EM1A 2YH1A 1HNVA 3TQ1A 2RS8A 1S49A 4U8YA 5EWEA 4RWXA 3O2IA 1UA1A 1VQ9S 2R42A 3AJ1A 1U7LA 2CPZA 3NMAA 3Q0AA 3E2EA 4QWEA 3KLHA 2HHSA 4YUDA 1BQNA 3K58A 1O5JA 3FSIA 2AGOA 2NXNA 1KDNA 1QAJA 3NP5A 5DZ6A 4USUA 2BABA 1RHMB 1N56A 5J1PA 5HMWA 1VRTA 4ECSA 4DR4F 3ILLA 1H3DA 1T9TA 3VAFA 4YB5A 3HD2A 1CPZA 1RT7B 4DPUA 3L7PA 1J5OA 4QIEA 5K8PA 5FLXY 3PX4A 1VC0A 2C1EB 4YB7A 4IOAQ 4I6AA 1N36J 4QIGA 3HF5A 1UL3A 3ZZTA 2HS4A 4JI3F 5DJBA 2D41A 1W2IA 4P52A 1PAEX 1P9QC 4F26A 1WC5A 1NSPA 1RTZA 4X66J 1S0NA 2OPRA 2V5HG 3IXQA 4FNIA 4G6VB 1J5OB 1FKPA 2CQBA 1JJ2R 4P7TA 1RAOA 1BC6A 2G1DA 4ZPAA 3I56S 3R5AA 1SCJB 1VC6A 2A18A 4OX8A 3FBCA 1SJRA 2HVZA 3D6MB 4J37A 1UETA 4WXOA 2GIQA 5CYMA 3M6WA 1X4DA 1Y11A 4WYLA 2VF3A 1LKZA 3J7YI 1FKPB 2CQPA 3QSYB 1RWMB 4LRBA 1GH8A 1JJHA 2WOMA 2XS2A 2BE7D 3DMJA 2LQJA 4GKJF 5B0AA 3M1VA 1KTQA 3CCTA 4LUBA 2J9DE 2DIVA 5ETSA 3EE3A 1WC3A 3BGRB 1Q8KA 1VQNS 2EBEA 2GJIA 2RF2A 2XHCA 3PHEA 1S99A 4C8KA 2WOMB 2Y0BB 5C24B 3GJTB 3DMJB 3NLCA 2Z58B 1S59A 1NDLA 1V3RA 4ECZA 1VRQC 2HFOA 2VQEF 4LR7A 1HNWJ 3M1VB 1F5AA 1HQEA 4NLXA 2KL8A 4UY85 4IFYA 2MZTA 3Q24A 3R1LA 1T9VA 2HMIA 5BR8F 2OAUA 2UUWA 1IKVA 3AY0A 3N0VA 3WDOA 2RF2B 4X4NA 5AJ3F 2ZH1A 1SVDA 2HAIA 1N33F 2KZMA 3A8IA 2GVZB 4CO4A 2HHTA 5ETMA 3GE9A 1HQEB 5HANA 2BJ8A 4IFYB 5HVFA 1WOPA 2HMIB 4HEA9 2FVCA 1IKVB 1S1XA 4ILLA 2YXLA 2J76E 5DG9A 1TKZA 4A8QA 2VFVA 4O4RA 5KTQA 1HD0A 4AT1B 2YWFA 2EG2A 2YX4A 3MPWA 2EK6A 3H5UA 2JLEA 3H59A 2OP5A 3L7OA 2HG4A 5LMUJ 6AT1B 2I38A 4C7QA 1VDHA 3F73A 3NBPB 3GFHA 1RU1A 1S1XB 4ED2A 2ACMA 5K14A 2R2UA 3TARA 1TKZB 2VONA 5H9EK 3OHAA 3CCLS 1Z4UA 2XM3A 4WIQA 1DTQA 5KFDA 2HWIA 4RNNA 3VGTA 2CG4A 4QYZJ 3T1YF 4K5RA 4L6V3 1M5SA 4I1TA 3D3CJ 2RU3A 2DHHA 2BW7A 5K14B 2V94A 2HZCA 1NPPA 2O5DA 1AT1B 4R0EA 1R3NA 3Q83A 5U47A 5HQ8A 1SJ4P 4DSEA 4HL9A 1Q86T 1DTQB 3R1HA 1RAIB 3BEGB 2AT1B 2YNFA 3HZGA 3PM9A 3R5GA 3MR3A 3A1YG 2M3DA 4YHHJ 3PFEA 2L41A 2RT3A 2CPEA 3TA1A 5BYRA 4TLRA 3T5LA 5J2NA 2OJ3A 1Y00A 1I3OB 4JV5F 2RDJA 4DS4A 1MMDA 2UXCJ 2L9NA 3VGVA 3W9JA 3GFXA 2YNFB 3BS9A 3D0IE 2MZJA 4RX6A 1SC4B 3BKUA 1QTMA 2YNGB 3KWMA 3WQPA 3PW2A 3W7BA 3OV7A 1FRXA 3OXLA 2EPIA 1JMTA 3W66A 2QA2A 2YNIA 2U2FA 2BQRA 1FKAF 2NPFA 1F5CA 5IC4B 4DBQA 1UJ6A 2ZD1A 2E1RA 3DYAA 2F9DA 3QQCD 1EHWA 4ZPVR 2FVQA 3IC1A 2VBWA 4LF6F 4NEZA 3DCAA 1HA1A 2OMOA 3KTQA 5KFNA 1JX4A 1WORA 2BBEA 1TP7A 2E1AA 4YY3F 3DYAB 1RKIA 2B9WA 4NYOA 3J80Y 2L9DA 3PTWA 1YJ7A 1MU2A 1WEYA 3QJPA 1NK9A 2XLKA 3ENVA 1IKWB 3DRYA 1SPBP 4IH7A 3WHIA 4K5SA 3O8WA 1RTHB 3SCIE 1XQIA 4U8VA 3ITHB 3N5FA 3N01A 3G82B 4JB8B 4FBUA 2BJ1A 3EVOA 1VI7A 3BQ0A 3IRXB 4OZ2A 3MD3A 2XMUA 3FK4A 1PYSB 3ZTQA 4OZLA 1U8SA 4F3MA 3G6XA 3PG9A 4L76A 1FRKA 1QDUB 1ZBTA 2HWHA 2V68A 1V3ZA 4C6AA 1W7WA 2JX2A 4J91A 2LU1A 2QTWA 4DSLA 1UFLA 2AJQA 4Q8FA 3AB2B 4A47A 2QA4G 2HVIA 3FVYA 1F3VA 3MWBA 3HKZD 3RB0A 3POTA 2CNKB 2MSTA 3UR0A 1U0SA 1N5SA 3QWPA 3P96A 2OTJS 2UUTA 4PG8A 2IBKA 3CF5Q 3RR8A 5KFCA 3BF4A 4ZLNA 2HFSA 1TUWA 4UT4A 3G8TA 3POTB 2CDRB 2UVVA 4ZP8A 3R2DJ 3KNGA 5HO4A 1RYSA 4Q2MA 4PAAA 1QTNB 5GAGI 3W5XA 3CD6S 2BANA 3ILIA 1B0TA 1IWAA 1SL2A 4C8OA 2VA2A 2QMWA 2D3UA 3IWNC 3KDNA 5E7OB 4DQPA 5DETA 2C2OB 4Y2CA 4J9OA 1RWVB 1D1UA 1Y7PA 3LANA 4PPZA 3C16A 4C0HA 4PG6A 3NXZA 2M0GB 2P9EA 3A3PB 3KXDA 4C9DA 3B82A 1QSYA 3Q8QB 1PJ6A 1G7CB 3SCKE 4DFJA 3H2UB 3MOZA 5FIIA 1RTJB 2V63A 3WBZA 2WHOA 3EGVA 1C0TA 3C16B 1T9UA 4KHMA 5F9NA 2QL9B 1AROP 1TL1A 2DNQA 5J1EA 4C8LA 3MUTP 3TZWA 3FCHA 4DR2F 4QW8A 3IA0A 2BDPA 1FNXH 1SH2A 2H5JB 3CB4A 1C0TB 1UMJA 4Q0BA 3U1LA 2WSEC 1TL1B 5J1EB 4DV0J 2XI3A 1IR1A 1HWKA 3KK3A 3KG4A 5KT2A 2E9ZA 2FJEB 1DQ8A 2Z2ZA 2Q6BA 4FPIA 4HH1A 5LMNF 6FD1A 4LREA 3FBEA 1NK5A 4LF2A 1RT6B 4FF4A 1Y5IB 2CJBA 2B4PA 1IKYB 1PBAA 3NCQA 5CABA 4N8OA 4NLOA 4WCEQ 2HFZA 2RILA 4F3OA 3KK3B 3M6XA 1YRTA 4AXIA 2UXDJ 3DOLA 1OS5A 2DGWA 4IH5A 4DUTA 4QZVB 3HFZB 5J1NA 1Q81T 4DPTA 1H6KX 1NB7A 1NUEA 4M5MA 3MURP 3DRXA 1ROFA 5A0YA 4DUZJ 2ZE2A 3BO4A 3RBXA 3CGIA 4Y3CA 5E3QA 4DR6J 1BE4A 1LFPA 3DLKA 2XZWA 3DOLB 3UN5A 5AE2A 1Q7YT 1WTFA 5K8MA 1RAGB 4OLPA 3TP2A 2IMWP 2MQNA 1AFJA 4OHXA 1SV5A 1JNRB 1RE1B 3HVTA 2HEKA 2OPPB 2YKQA 1VJWA 5D4NA 2IC3B 5KT3A 2ZE2B 3MD1A 1LK5A 3KMQA 3GZ7A 3DLKB 2D69A 4DV5F 1XNRJ 4HHJA 2HHXA 2I9SA 2HLUA 3SMZA 2R7UA 5KFTA 1X0PA 5KG2A 1SV5B 4V19X 4TU8A 3HVTB 4HLBA 2MQLA 2LU2A 2VDIA 2WSCC 5HLFB 4HR2A 5F9LA 4KKOA 2ZUGA 2Z4PA 4I69A 1NAQA 2BMBA 3DU6A 1HKAA 1OJ4A 3CD5A 2HVHA 4NA2A 4OI2A 3UNGC 2VHGA 2VZ9A 4ECUA 3OTEA 4IG0A 3LP2A 5F0UA 2DPJA 4DG1A 2VUGA 3R27A 1RTIB 3CD7A 1WI6A 5KFBA 3MAHA 5KT7A 2AX0A 2KB2A 3ZTPA 4QWAA 3CT9A 3TUJC 4E98A 3PW4A 1RHUB 5E0OA 3W65A 3CDEA 3H20A 4JV1A 3LP2B 4O3NA 2J9DA 1VHIA 4DG1B 1LWEB 1OYDA 2J7UA 3CW2C 1X9WA 1JXLA 3IM8A 1S1WB 4DF4A 1IM4A 4PXEA 2CJAA 3HHKA 1NNDA 1OYEA 2EFNA 2QMXA 2ZJPQ 5D3GA 2ZBCA 3MR5A 4E0DA 4KSEB 5HMZA 2VFSA 3HSJA 2AEFA 3CMES 2HRUA 3FSXA 3SXLA 3LWLA 1WDTA 2J6UA 1JLEA 2NXEA 2MLYA 3S8SA 2J8SA 3ADAC 1RT4A 3JYTA 3B4MA 2E5HA 4LFBF 1H73A 5IZHA 2FQQB 3FGVA 3MM9A 4UUWA 3IFEA 2LXIA 2APOA 1EQ0A 3ZZZA 2IY5B 2J0SD 4YOEA 4TVAB 3TZXA 3AHPA 3M6UA 1HPZA 1JLEB 3MI7X 4GKKF 2HVEA 1RT4B 3LAKA 3JYTB 5MLCV 4URGA 4DFPA 3G6YA 5D77A 2KU7A 4CCHA 2PI4A 3K5OA 5AXMA 3MM9B 3TJ8A 3AB4B 5F0WA 4MJKA 2YPYA 1JB0C 2M52A 2FYXA 1X8DA 1RWNB 2V8VA 1PJ7A 3GJRB 1ITPA 2GNKA 2OGUA 2NPIA 2MQQA 1VQ8S 2ERRA 2JEGA 2GA7A 2PMHA 1U09A 2YWHA 3NEKA 2DHAA 1E6YA 2DCLA 2CPFA 4DL4A 2DHGA 2FPHX 4MMOA 1SKRA 2WK4A 2CQ1A 3FC9A 3RBDA 1IQTA 3MM8B 5D6GA 1B64A 3QJJA 4XDDA 4ICLA 3TYTA 1SH3A 4RWWA 4FN5A 1FTRA 1MWZA 1JLFB 4ELUA 3AODA 1E6YB 1AYEA 3PNIA 2X3DA 3MF5A 1UEUA 2GGPA 4ZJQA 3PKMA 3W2WA 4PWDB 3LW5C 4ICLB 4NLDA 1TK8A 2A2CA 3X3UA 2J0WA 4CIOA 1YG0A 4HH0A 2QYGA 2AGQA 3WIUA 1CS4A 3KG1A 1FWLA 1EX8A 4F4WA 1HARA 5DQGA 2GGPB 1GAOA 3GIKA 2XC9A 3E8OA 4URSA 4B3TJ 1XJWB 4A8SA 3VQTA 3CPWR 3H2LA 1IKXA 5CYQA 1N54B 2OSQA 2DNRA 5GADU 1XNQF 2GMJA 1CS4B 3FQLA 4X2BA 2KI2A 2JDJA 1EAYC 3I5BA 5E3AA 2RU9A 1WJ9A 4ZP7A 3CJ4A 1HBUA 1WELA 3FEYB 5F8JA 2B56A 1RHQB 2BJDA 1IKXB 5CYQB 2ATCB 3ZFVA 4X64F 5D4LA 5IT0A 3PEJA 4O0NA 2DGQA 3EZUA 1VRUA 4EMDA 1EKSA 2R7RA 3GYNA 2W4DA 4J9QA 2ILZA 2ASYA 2WONB 2CXEA 2L9WA 2O67A 3ZNJ1 1YI2S 2IYIA 5A76A 3IN5A 2LVWA 4XK8C 3S6EA 2D3ZA 1VRUB 2W7AA 1GEHA 3K57A 3CJKA 2RD5C 3V6DA 4AD6A 3QIDA 1TL4A 4YDXA 3M7VA 4QCLA 2IMOA 1PIEA 2ADBA 3EPIA 2DNGA 5KAKA 1V3SA 2QYCA 2XMWA 1HBMA 1UZDA 2V4JA 3CUNA 3LTOA 1U49A 1NMEB 3CJKB 1QAIA 2RQCA 3A3OB 5D0GA 3NWGA 4LRAA 4JI1J 3TR5A 1SL1A 2DB1A 1Q16B 4EU0A 3I55S 1X7VA 5K5MA 2A1BA 3SFUA 4ECQA 1RT2A 3MFHA 1HBMB 2V4JB 2ASJA 5K8NA 2FDNA 8RUCA 2OHDA 1WHWA 4DQQA 1DURA 4MKYA 5F41A 1YJRA 4U7UD 1Q1KA 2LQBA 2E5LJ 5T14A 2JFKA 4M94A 4DUYF 2HZVA 3TA2A 1T8EA 1RT2B 1WSVA 4BCAA 5H9FJ 3B78A 2DEIA 3C6TA 5HJXA 2J0XA 1FA0A 4A8YA 1BQMA 1FF2A 1IVZA 2CQ3A 2QLJB 1F9EB 2IVFB 2Y1LB 1FE0A 4DV6F 1XMOF 2Z56B 2MQMA 2KHDA 5DM7Q 1BXNA 1YKWA 4F4YA 4DSKA 4B3SJ 3M2RA 5IV4A 3TUZC 5AXNA 1M5KC 1TAUA 2A2DA 4LF7F 1DARA 2F40A 2ZOFA 4WWSA 2C2MB 1BQMB 1PAUB 3C19A 5C42B 3GFYA 1NK0A 2BV3A 3OJUA 4U95A 2N82B 2QLXA 3RUBL 1UWBA 2LP4A 5J2MA 4ANEA 4CT9A 1DTTA 1HWIA 4ILMA 5DLGA 1YJWS 5JJBA 2CADA 4NLUA 3CO9A 4CLLA 4MKAA 3ZTOA 4KT0C 4OYOA 3DKDA 2DTJA 3OL9A 3CNQP 3PXGa 1U1LA 5AE3A 5BYSA 1FRMA 1S9GA 1ZZNA 4ZCMA 1UWBB 2AJ1A 5J2MB 1VISA 3N6MA 4DQRA 4K50A 1DTTB 1U47A 1T9XA 2HNZA 2RB7A 3OR2A 3W2VB 3OJSA 1RAJA 3UR3C 2A10A 2KYXA 2C3OA 5CYJA 1G2EA 3RB4A 4HACA 3RU0A 1KBRA 1BLUA 3EMTA 2DPIA 5ADZA 3VALA 1S9GB 4IUFA 5LM7E 2N7YA 4IH6A 4ZLJA 3BYRA 3HJFA 3UCUP 3W8GA 3MAAB 5DDQC 5KFSA 2HNZB 3OR2B 5A8WA 1FNOA 5C5JA 1R0BG 5B0BA 2UUBF 4UZCA 1X31C 5A2QU 3CDAA 3NGRA 4DS5A 1K1SA 2DJWA 1RBLA 2DGXA 2FIUA 2CNOB 3VAJA 3HDSA 5T7LA 5DGAA 3HSGA 2VL1A 3OHBA 3H4DA 1FJEB 1NHVA 3IBWA 3SSQA 3CIZA 1JKHA 2ZH4A 4ES2A 4Q2LA 3O5TB 4FZVA 2V9KA 3KJVA 2Y1RI 5EX3A 4DR3F 2F5GA 2GX8A 1H74A 1NU4A 3RR7A 2KXHA 3HVAA 1AZSA 3KNAA 3B6BA 5KFUA 2JEJA 5T7LB 3W9IA 2W4CA 3FFIA 2VDHA 1NKCA 5C25A 2NS1B 4ECXA 4WKYA 2DHXA 4WK3A 2EFVA 1JKHB 1QJHA 3VAHA 1PYTA 1ELOA 2CA9A 4FYWB 2WVCA 4F02A 3BSOA 1KRPA 3PRBA 2XY5A 3LP1A 4K0KJ 1NRKA 2XNRA 4A48A 1Q0NA 1D3WA 3AJ2A 2R7VA 4ZVQB 2NXCA 3AAWB 2W8LA 1HNXJ 5HVHA 4ZHRA 3TAQA 4WP3A 3OVAA 2L08A 2OSRA 2GQCA 1YGYA 3I82A 5BR8J 2AYEA 2F4VF 2EI5A 3A12A 4RR5A 2YTCA 3ZZYA 4ZVEA 1ZPWX 5B7WA 4OZJA 3OTOJ 4R0JA 1IJEB 4RUCA 4ZHRB 2WRMA 2JH3A 3ETOA 3R5BA 1N88A 1TELA 4RUHA 2XMAA 2K3IA 4OLOA 5JMNA 4ZIVA 3PDNA 2AF6A 4ATNA 1S6PA 1FJGJ 2X7IA 1YIJS 4H4OA 3MEDA 3IM9A 4I67A 1S4EA 5KFRA 2ZH8A 2AJFE 4ZA1A 2AYGA 2R7TA 3B8HA 3CMQA 3IG1B 2NZCA 3HJVA 4WFAQ 3PR4A 3MCNA 2GMHA 3F41A 2DR9A 1BGXT 4ZS6A 3EVWA 3MXHP 1CJUA 4S0MA 3W62A 2MKHA 3BN7A 1SKSA 1S6PB 2IM3A 2ZDOA 1XIQA 5DQHA 5BXIA 4C0OC 2RKIA 4N5SA 4ELVA 1BWVA 2XY6A 3UVJA 2Z8QA 2CPIA 3RGIA 4KTQA 1NJZA 1YQHA 1KQKA 3UPFA 2LEBA 2DH9A 4RUBA 1LWXA 4WTYA 4BS2A 4NLGA 5IWAF 1VOMA 1CJUB 4NRUA 1SUQA 2WB4A 2B5JA 4KGMA 4EGLA 3TVYA 2QA1A 3GONA 1R31A 2G4BA 3SCJE 2RKIB 4WP9A 1Q78A 2BE2A 1RHRB 2M70A 4OI4A 1FXDA 2HHVA 2G2YA 1FHTA 1IM6A 4CDIA 4PUOA 1FKOA 3NS5A 4RNFA 2QT7A 5D0RA 2YKNB 4G1IA 2ILYA 3DDIA 2ZITA 1FRIA 2B5JB 3BSNA 4ZCLA 3JSRA 3M32A 2BE2B 3GIMA 2GMLA 4I2PA 2W9BA 4ED4A 1N0VC 1HR0J 3BDEA 2J6SA 1OSDA 2DT9A 1CULB 1RDRA 4PUOB 3ENQA 2AJ0A 2X1FA 4N56A 3RRHA 2AEJA 4OX9F 3BH7B 1SBRA 1PO6A 1N34J 2X1GA 1Y4ZB 2FY8A 1RT1A 1YK9A 4DV2F 3NAHA 3VR1A 3OLAA 3W8PA 3SBMA 1ZAXA 3TX8A 4TYAA 3PFOA 4I2PB 2W9BB 2UV8G 2ZM6F 3J7ZT 4FP9A 2X1AA 3AQPA 1IR2A 4OHWA 3W9HA 1A6LA 1NK8A 5B0CA 3Q8RB 4LFAF 4LF6J 4LF9J 1RT1B 2PA8D 4DX7A 4QIVA 4YS2A 1WKJA 1QSLA 3D67A 4Y2KA 4TY8A 3W61A 4YY3J 2KRBA 2JLGA 5D8HB 1NK7A 2DGUA 5F3TA 2DGSA 3PO5A 3CDUA 3EWGA 3C6UA 1MWQA 4U7CA 1HHTP 4QWDA 4IO9Q 1BHNA 1ZPVA 1FCAA 3ZZ0A 3JTPA 3ZZPA 1O0PA 4MFBB 4TY8B 1OSCA 4PABA 4TKTA 5LJ3Y 2IDLA 4USWA 1U6FA 1IUJA 2K3KA 2R7QA 4OZ5A 4ZKAA 2OPSA 4DL2A 2IYGA 4B3OB 1SJQA 4B17A 3RAMA 1X0FA 2M2BA 1DAXA 4ALZA 4HT7A 5L9XA 1M5PC 4ZVFA 3SFGA 1MN9A 2CJKA 2KFNA 4ZN3A 3TOQA 5D0HA 4QR0A 2W8KA 1T11A 3BH6B 3CC7S 1HLWA 4DL7A 2AWZA 5FD1A 3VGUA 2Y0SD 3NMRA 3D6FB 1XR5A 3O1LA 4JI2F 2PDAA 3OXFA 2UUCJ 1HI0P 2EEYA 4X4SA 2ZZNA 4FXWA 2ASDA 4NZ6A 1XTZA 3OFGA 3ELHA 2PC6A 2IDEA 1F1BB 2H4WB 4QYRA 1NSQA 4FXDA 1DZ5A 4JI7F 3I0RA 2EKYA 3TVZA 2N7CA 5C7PA 1AW0A 4LF4J 3I0SA 3O3LA 2HS3A 4DL3A 1R7IA 4NX9A 1Q79A 2D9PA 2DXFA 4NCGA 2BQ3A 1RJJA 4K2JA 4BBYA 3M8SA 2K2PA 3TA0A 1S1TB 4FVCA 2PE8A 1YSJA 3LALA 5E5NA 1I94J 4U96A 1M1GA 3I0RB 3E3XA 5FDLA 3QYYA 2RHSB 4KHPJ 3I9V9 2AU0A 3FJ2A 3I0SB 2VJUA 2HWTA 1EETB 3GIIA 3VF0B 3I32A 1KQGB 2MZ1A 5KT6A 3CCJS 1UAWA 4NCGB 2FD2A 1S5ZA 5HBMA 5KFMA 3PR5B 3M2UA 3PW5A 1YVFA 4F4AA 1FERA 1IWGA 1KVJA 1WC4A 2OKQA 2UU9J 2CJQA 2DR7A 5I3PA 3BQ2A 4OX7A 4HDHA 5F8NA 2Z2MA 4NOHA 2MEWA 4AL5A 5HBMB 4PRFA 4KE5A 3R8YA 1O6XA 2HNDA 3PX6A 4HTIA 2XMTA 3M2UB 4UY8T 4CQ1A 4GO7X 2F8HA 4WU2A 2C3PA 3SDEB 5IV3A 5C2CA 1GTEA 3DHWC 4DN9A 4B08A 1PCAA 1NKBA 1S79A 4AQYF 4FYYB 5DG7A 2MMYA 4LSNA 4RBUA 5KFKA 3RRKA 4NCBA 1MLAA 2FJDB 1Q4RA 3S01A 1CSJA 3TO8A 1Q7LB 4O23A 2F3JA 1M90T 2PEHA 4JI6J 1NB2A 1FRJA 1RTDA 3T19A 4B9LA 2PFFB 1QE1A 3GQCA 4OL8A 3QATA 4LF5F 1KSPA 2CG8A 3H7HB 1X5SA 3THTA 4LBPA 1DHMA 3WX8A 1RXOB 5DG8A 3BGFA 4OI0A 1MMLA 2OUGA 3R9LA 1HQUA 1WACA 2R2SA 2ZUAA 2M88A 3UD5A 4QU7A 4K4XA 1RTDB 4W90B 1QE1B 2OPQA 1LW2A 3EGNA 5GMDA 4E8UA 3OT9A 3TANA 5CH7B 1RBOB 3PRVA 5DGBA 4NLYA 3M8PA 2WW4A 1HQUB 4IG3A 3DOMA 2IA0A 2DEJA 1GTHA 1JLAB 3KFWX 2XI2A 3J81Y 4CO1A 3QIPA 3CCVS 3OBIA 2OPQB 1ZM4A 4M8LA 1LW2B 1YZ6A 9RUBA 3UD4P 5J2PA 4DFKA 3DI6B 3SZ2A 3U1NA 1HNIA 3M8PB 5DS7A 3D1OA 1SIWB 2B7BB 4OI6A 5A8KB 3DOMB 5ETPA 4QBUA 1EZZB 1NXIA 1N36F 2W4PA 1FTCA 3MUMP 3QIPB 3H5XA 4NXMJ 4M5KA 4DI6A 2C42A 2NSCA 3BQ1A 3UDCA 2K7KA 4NLVA 3EICA 2Y8WA 3K59A 2CPXA 1W26A 2HQGA 4QR2A 3V4IA 4X66F 4V1Ak 5J2PB 3EZOA 1HNIB 1RISA 3DOKA 2QL5B 3CC4S 5ETOA 2R9LA 1F60B 2W2OP 2V4QA 1GMWD 1LW0A 3M8WA 1RWOB 1R43A 1IBLJ 3CVKA 3V4IB 2CUYA 4XO0A 5CXTA 1FRHA 4L73A 3P5TL 2DNNA 2XTJP 2ZBPA 1UZHA 4J5OA 5CZXA 3DOKB 3CCSS 3D68A 2KXNB 3W1YC 4ER8A 2CQHA 3T5HA 1HQ2A 4U6PA 2X51A 1M5OC 3L7UA 2HIQA 1SC3B 4JV0A 1LW0B 2KHCA 3UE2A 2MQOA 4P10A 4J9VA 4C3MA 1WC1A 4JYAJ 4PYAA 3THVA 1X5TA 5ITHA 1WG5A 1NM2A 3TAPA 4KBIA 4A8FA 1VLOA 3HK2A 1UVIA 2WVFA 3M05A 5CQGA 2BQUA 1BQXA 1ZM9A 1HNWF 4N7TA 2KN4A 3T9NA 3OL6A 2JJ4D 4X65J 4MK8A 3KKFA 1VBYA 1FFGB 2DH8A 2MPUA 2CNLB 2ADCA 3VGSA 1V5IB 2Q6CA 3GLJA 1KTVA 2DD8S 1VLYA 1U2RA 2GV1A 3ZO7A 5KFFA 3NNHA 3HHLD 3IO1A 3HCXA 5KG7A 1JLGA 4CLKA 1FE4A 4FF1A 2KH9A 1U1RA 3ZXWA 2CQGA 4C8ZA 5J2QA 1JLBA 2HZAA 3RTVA 4B3RJ 1ZZFA 2FHKA 2XQCA 2RQMA 1M5VC 3CCUS 4F0KA 2VG7B 4XPEA 1DLOA 5CAAA 2I5JA 3VZHA 1T02A 2YX1A 2LKZA 2HFNA 2VB6A 3N79A 3H0PA 4B9SA 5J2QB 1DBDA 2BKOA 3L3CA 3BGUA 2B51A 4DX6A 4WFXA 1FFSB 4CLPA 2ZJQQ 3CJ0A 1DLOB 1AUDA 1U1PA 1KNZA 2IVMA 4D3GA 2I5JB 3CEDA 1QVGR 3HHEA 2GC8A 2MHEA 4HHUA 3MM6A 3K5PA 3VAKA 3MPUB 2Y8YA 1S76D 4JBCA 1KQFB 4K7QA 2HRTA 5EHHA 1APSA 4YHHF 2RUGA 4JUZA 3H42A 4DHVA 3EZ5A 2R7SA 4Z37A 1MW7A 2H65B 4KGXB 1KOOA 2ZC3A 3MM6B 1TV6B 4ZPTR 2AYMA 4O4GB 3RBEA 2CQ0A 3BSCA 4EZ9A 1PSDA 1B0PA 2UXCF 4A8WA 2P2CB 1B7FA 3H25A 1WWHA 4JI8J 3DRPA 4QIWD 3PJWA 3CJRA 3HVRA 2G0IA 5KFYA 4RU9A 1G3OA 1WUUA 5HN0A 1NDPA 4C11A 1XBWA 1RT7A 4TQRA 1Y9OA 2C3UA 1KONA 2C3MA 3DRPB 3FCWA 4DZ6A 3MHYA 2ZZTA 3DLBA 1C2PA 3Q8UA 2NQPA 2PMWA 4C11B 4OJ1A 1XERA 3N5BA 4DV4J 4GC7A 4EO8A 2CZ4A 2AMCB 1VCTA 5M2RA 2LYVA 4N76A 1FX2A 4NMXA 1YITS 5D15A 4J9NA 4X4VA 1VQPS 3VVUA 2ZH9A 4A8KA 2VIHA 2H5IB 4H54A 4HT5A 1YHQS 1ZH5A 3BKTA 1KP6A 2FZGB 2YNHA 2LCWA 1SQFA 4YFUA 2FJXA 4DL5A 1ZTWA 4RJVA 4KAIA 3TVKA 2RIJA 2YKPA 3LGNA 2OO4A 5IS2A 1KHWA 2IRUA 3KG0A 1Q95G 1WG1A 4O3SA 4Y2AA 3CC2S 3KLFA 4I56A 4A4JA 3DDNA 3PW0A 2Z30B 2YNHB 3BGRA 2P5VA 2Z2LA 2JVOA 2UVWA 4M5JA 1R0CB 2K7JA 4I2QB 4ETXA 3MR7A 4WYWA 5C24A 4KQZA 4WU3A 2KG0A 1URNA 3BM7A 4ZVSB 1RAFB 4ZN1A 1Y0HA 1TVRA 2IJFA 5JVHQ 3KLFB 1D9DA 2FLNA 3OVBA 2E7WA 3H2VE 4NMLA 3GJSB 2ZKTA 1HFEL 3CTRA 1PG5B 1T9YA 4CLFA 1ZTTA 1HBNA 1AA1B 4CLYA 5KG3A 1OY6A 3FDSA 3TQEA 2GVZA 3KLVA 3MUVP 5EN1A 4P74A 3W60A 3Q23A 1XMQJ 1QSSA 3GV5B 2VFRA 1R8PA 5EWFA 1TVRB 1RLDA 2R7XA 4OZ1A 3CULA 5HAOA 4P71A 2MTLA 1GT8A 3Q2SC 4QU6A 4I64A 4X4QA 1HBNB 5HSPA 4M5DA 1ACMB 2F65A 1WF0A 3EGWB 2VPWB 2GO8A 2UXBJ 1S48A 1CVJA 4DV7J 3HMJG 4W4MA 2VU5A 1FXLA 4J9KA 2YX7A 3NKYA 1X5OA 3JQJA 4DV1J 4IRKA 2YQ0A 3NBPA 4KH0B 2PD1A 3VTIA 3P49B 1RA6A 1CJTB 1QAXA 4M5DB 4B9VA 4W92B 2AIRB 1HBOB 2K06A 2D74B 1KKHA 4ZVTB 4F36A 3AD9C 2V2KA 3UQSA 4K4TA 2RVJA 4KRWA 1NJYA 2JHEA 4TXSA 2YWEA 4F3QA 2DKOB 6FDRA 4MKBA 1I1GA 4Q5VA 4PWUA 3BDPA 2JRSA 4OYAA 2H48B 4NI2A 5HP1B 4F7VA 2IAJA 4MK7A 2EC0A 1HW9A 4XTTA 4LVNP 1TUGB 4N8NA 3GG0A 2ZOMA 4GMKA 1IBCB 1GQEA 4USTA 2XLIA 1UA0A 4ECWA 2FHJA 4Q43A 3MEGB 1MMNA 2O66A 3QGPA 2RMLA 3NS7B 4NI2B 4DR1F 2IAJB 2BJ9A 4DV0F 1CC8A 2W24A 1UFWA 1YJUA 2O3DA 3BBCA 3MCOA 4JI4J 1H2TZ 2DGOA 2QX0A 2XCPA 4CLUA 1U2FA 4QW9A 4PQUA 2DY1A 5FLXU 2YNGA 2NYIA 2DRDA 1XR7A 3SIPB 3HX9A 5IC6B 3QGGA 3ILJA 4X84A 2BJ7A 1Z1ZA 3U1MA 2HHHJ 2UXDF 2RDDA 1NZ8A 5L1LA 3L4BC 4ZVGA 1FD8A 3SQGA 3SI8A 4NLQA 4PQUB 4L75A 1AB8A 3UNYA 2CKWA 3CCQS 4DUZF 3DLHA 2H4YB 2HGLA 2YWWA 8ATCB 2AHOB 4Q45A 1HMVA 4DF8A 4OFZA 2Q66A 1QAYA 3QFHA 3V81A 4PPDA 1C1CA 3LOUA 2IFXA 2V2QA 3SQGB 5KOWA 3HHDA 2JWNA 2HK2A 1D8YA 4K4WA 4PZVA 3D9BA 1Y3JA 3MMJA 3ULHA 4WJBA 4CI0B 3WC2A 2B0GA 1X5PA 4LF8J 2K8GA 3AA8A 1IKWA 2E44A 1HMVB 1T03B 1FD2A 2OTLS 2WBMA 1L3VA 2CVEA 4ZVUB 1RTHA 2MKYA 1XNRF 4OIXA 3ITHA 3G82A 3V81B 1C1CB 2Z2YB 4IKAA 4ERDA 3Q2TC 3A8KA 1U1OA 1YJVA 4DL6A 3IRXA 1VK3A 1EB0A 2CZ9A 3BYPA 1G1XA 1OPZA 3K7RA 5FJ4A 4F8RA 1LQ9A 1WKKA 3QRQA 2DIUA 4HVZA 1UEKA 2K1RB 1FWPA 4O3QA 1FEHA 1HL6A 1SJ1A 1T94A 2NUUG 4FYXB 1PC5A 2FY1A 4EUVA 4DSIA 5E3RA 2ACYA 5DDOC 5LJ5Y 4DLEA 1IBMJ 2EG1A 1H0HB 2HYIB 2UVUA 3LUYA 2ZNZA 3GPAA 4Y6IA 1FWKA 2UUAJ 4WK1A 4UQGA 2YH0A 1XN9A 4OI3A 1X4HA 1SJFA 1XR6A 1VQMS 2HQCA 3HM9A 4GO5X 3OR1A 3R6LB 5IWAJ 3DXSX 2B8PA 3DU5A 2ZFHA 4ZCIA 5E3PA 4LFCJ 4OJGA 2EWHA 3FZ2A 1ZA2B 4KO0A 4GC6A 3PZPA 1REVA 2FC8A 2HGMA 4J9UE 3OR1B 1A7GE 2HHWA 1MWYA 2VV5A 3SYZA 4ED0A 1X4AA 1HWUA 2FJAB 3V6HA 2OFHX 1Z2ZA 5HROA 2DR6A 5BJRA 1Q8IA 4KO0B 5DLFA 1RAHB 5E33A 3MMBA 1REVB 1E6VA 4B3MJ 2MJNA 1NJXA 2JFDA 2QRRA 3DM2A 5HMYA 3OFEA 4RPFA 3S7RA 2ZOGA 5LSLA 4JP8A 2AGPA 3G6ES 3QO9A 4OZ3A 4OX9J 4FYDA 1RI7A 1RTJA 2DVIA 4I6YA 3F0NA 3TNVA 4KV8A 5HROB 5AE1A 2AJ4A 2IHR1 1NEEA 2QN6B 3MMBB 1E6VB 5HJYA 3DM2B 1WHYA 2CNNB 2G0JA 3HXMA 4DCOB 4C3LA 4RNHA 3M8RA 4DR5J 3JAMY 3QO9B 2F9JA 4LFAJ 2XMMA 1RA7A 3TJ9A 1TKXA 4KV8B 4C48A 2HVDA 2MHNA 4NXNJ 2FUG9 2ABYA 3RW6A 1JK9B 4F4KA 4ES1A 5GVQA 2LEAA 3HULA 3K17A 2BA9A 3IR6B 5B0FA 1LWCB 4OYZA 2OD4A 3GTYX 1RT6A 3Q8PB 1TKXB 4L72B 1IKYA 3CJ5A 2VPZB 2C2RA 4OJ3A 3CJ2A 4NYZA 2DNZA 2EW9A 1TL7A 3IAS9 4UQTA 2ZH7A 1EKRA 1Q8BA 5B0EA 3MZIA 3UN3A 2JC1A 3LQVA 5I42A 1B7YB 4ITSA 4B02A 2RH3A 3M8YA 2KYZA 1RBAA 2KM8C 4WFNQ 3THPA 4B3TF 3JSBA 2BM1A 3CO0P 2DRBA 3VVTA 1V9OA 1TL7B 2B9XA 3QRPA 3LP0A 4ILRA 4DV3J 4LMZA 1U1NA 2B9EA 2LQ9A 4EEYA 3HP6A 2GJ2A 1SL0A 5I42B 4L74A 4H4MA 2OLWA 3Q89A 3JSYA 4MH8A 5A8RA 1U48A 2OPPA 3D0HE 2NXUA 2IC3A 4N77A 3CE8A 3CJQA 4F0HA 4LR8A 2HHQA 3G8SA 3LP0B 2MJUA 4QR1A 4RKUC 4BDPA 4ECTA 2CJYB 4H4MB 2YKMA 2BX6A 2E29A 2Q43A 1N4LA 3QT5A 3Q8SB 5A8RB 2H3EB 5KFAA 1DJ0A 2R7WA 1YZ7A 5HMXA 3FMWA 4NE9C 4E2FB 2E9RX 5HLFA 1M5HA 1RCXB 4W98A 1VQ6S 3NOGA 2GIRA 3E51A 1ZA1B 3PW7A 2VKRA 2MXYA 2C28A 3KK1A 4F67A 2QJ3A 2YKMB 5L8RC 2O1PA 3IR5B 3V6JA 1BUXA 1NCLA 2LECA 5T41A 2M7SA 4QPXA 2BKPA 1RTIA 3JSMB 3D1QA 3K0JA 5KG0A 3DLLQ 4WKRA 1S97A 1PYOB 5CCMA 4FS1A 3MMAB 4JOUA 1C4AA 1EARA 2QG9B 4DX5A 1V6HA 3NGSA 4JI1F 1Y10A 3KK1B 3NGUA 2ZZMA 4AYBD 1RWPB 1UTAA 5GADI 3L9ZA 3RBZA 1IJFB 1KD1T 4U67Q 3OW2R 2I6WA 4U7UK 1Y5LB 1LWEA 2GVDB 4HDGA 3GMGA 1S1WA 3B4DA 5F8IA 4IRCA 1T3NA 3M9MB 2V8PA 1KFSA 1VIOA 3D0GE 4ID8A 3MECB 2LQ5A 1SQGA 5KG5A 2RRAA 1NPKA 2AW0A 3J7Z5 3A8JA 1OQ3A 1U45A 3OUYA 1TTHB 4CNYA 2W1BA 2O01C 5JVGQ 2W25A 4PR6A 2GHPA 4EZ6A 3R2CJ 4ANDA 1GK8A 1N32J 1X9SA 4YB1P 3NWRA 2GQQA 3DGPB 3N6NA 1SJ3P 5KFQA 5HVGA 3K8WA 1ULRA 1WEXA 3OUYB 2BJ3A 5AXLA 1LK7A 3E01A 2POKA 1HNZJ 4LSZB 2V67A 1AFIA 2HURA 3JTOA 1BWEA 4B3SF 5A6PA 3BSAA 4OYXA 2I1RA 4RW8B 2ZEJA 1X60A 1H72C 3TAMA 4LRDA 4CM2A 4CH7A 2MQ8A 2H5EA 3F56A 3QPIA 4OZNA 1VIXA 1RCOB 2P8IA 2FTRA 4OZ0A 3T1HF 3ZZRA 4J9LA 2B3TB 1TK5A 3E01B 2I2YA 2DISA 4USHA 2LLZA 3FRYA 3M9OB 1DY3A 2LFVA 4FF2A 1NBEB 3TAMB 1N5TA 2V8DA 3MM8A 2MLXA 2WVEA 1H2VZ 4F0MA 3NGKA 4RBVA 4RUAA 3MGJA 3NNCA 1HNVB 1JLFA 4I0WA 4I4BA 2QL7B 2AX1A 2VICA 4ZCKA 3LH2S 4H4KC 2NZ4A 1EP4A 1WF2A 4Y34A 2IRYA 2PFDA 2KO1A 3ZTSA 4NASA 4JI5J 3PACA 4PWDA 3PRDA 1YJ9S 2VOPA 1U25A 2YWGA 3KLHB 3H90A 2DK2A 2XWXA 2P6SA 2BRLA 2FLPA 1WOSA 3QFWA 1BQNB 1YBUA 4F25A 3BBFA 2V9WA 2BKNA 1EP4B 3FNNA 3UCZP 2BYCA 3OFHA 2AEMA 3JQMA 2P9GA 3RB6A 1VRTB 1U6BA 3AXMA 3FSYA 5F8GA 2JZ5A 2XMJA 2CWKA 3R7NB 3D6HB 2ASLA 4NA1A 1SQEA 1KLMA 2JL9A 3MTJA 4YR0A 2OEJA 4A8OA 2QE5A 1OIAA 2BOAA 3M8QA 2OI2A 3G8QA 4ED7A 2V2ZA 4FYVB 4OV1A 2XGPA 2FHOB 4M5HA 2WTFA 3EGZA 4WTOB 3HLUA 2XNQA 3A8EA 3O6QA 2OPRB 2YQ3A 4P2XA 2XULA 4X4OA 1KLNA 4YQWA 3MM5A 3AT1B 1KLMB 3LPEA 4Q7AA 4V19J 1AUSL 5KFGA 3RZAA 3QJLA 5GAHU 1FDNA 1QD1A 4PCQA 3M8QB 3PVXA 2WONA 4DL0C 3SEOA 5CYMB 4CT8A 2B4UA 3UDEA 4JI0F 3B54A 4K0KF 5LT5A 3MM5B 3R7BB 1YJTA 1PKUA 4A8MP 1NDCA 4IO1A 5AXKA 2KM8B 2MSSA 2J9EA 3P4UB 2Y3YA 5E3CA 3C66A 2W9AA 1HNXF 2XO6A 2CQDA 3VZIA 2CAJA 2LXFA 2HBQB 1R8BA 2KT2A 4DJBA 5IT4A 2XZTB 3UW1A 2UZAA 4KGKA 2QFIA 2XG8A 4ED8A 3BPDA 4BC7A 1FVSA 2VASA 3MPVA 2M9KA 1IBKJ 4Z7CA 2QMUB 1P6TA 3OTOF 4FF3A 2GHVC 2GJFA 2EFPA 3N6LA 3CCWA 3C3LA 2ZHBA 3OVSA 3WX4A 3AD8C 3SSSA 2N3OA 4TN2A 3D28A 3HT0A 2DBBA 5THWA 4Y65A 2ROEA 1FJGF 4DX8H 5H1SV 2CWXA 3WIVA 1QUVA 4Q44A 1ZETA 3C46A 2B43A 2GIFA 2DXEA 2Y9HA 4PG4A 4YR3A 1WHXA 1N6QA 2BEFA 3GILA 5IOLA 4PKDB 5HQMA 4ZVPB 3ETMA 3ISNC 4X62J 2GHWA 4B9TA 3C2PA 1D09B 3M30A 1VQYA 1UVLA 1GXUA 1YDLA 2MKCA 4PG7A 3G71S 3KUEA 4NLTA 3BR8A 2KVQE 4F4ZA 1RAAB 4FPRA 1T7PA 2DNMA 2QV6A 1N6QB 1YBTA 4PYDA 4G65A 4DCJB 1FDBA 3U02A 2EFOA 8AT1B 2ZWPA 4HTJA 4K8RA 4MK9A 4BLGA 1WOOA 4N41A 3QBCA 3M30B 1UKUA 2PI5A 2KJVA 3J7A1 1YX2A 1S6QA 2MZRA 2QLFB 5C42A 1SI9A 1R6YA 2OD6A 4M5LA 4Y00A 2YVSA 1F2GA 5D4OA 5DDPC 3LWMA 1B99A 3MEEA 5LOQA 3P6YC 1B3TA 4NWBA 4UUXA 4ZIWA 1P27B 3HI9A 3PYFA 1HW8A 2FJBB 2XYGB 3KDOA 1Q53A 4XDCA 4RU2A 1S6QB 3EPGA 1J5EJ 1HR0F 4CO2A 3RYLA 1PILA 4QYZK 2ZVSA 3GR0A 3MEEB 2CQ4A 2DRAA 3AA9A 5A6WA 4DFMA 2L48A 2VKZG 4ZPWR 4ED5A 3W2VA 1N34F 5J2NB 3T1AA 4EK2A 3J7YU 5KG1A 2VQFF 3P3DA 3DHXA 4USIA 5ETTA 2G0CA 3T6JA 2MYFA 3W5YA 1DRZA 2KDOA 4ZDNA 3MAAA 4CO3A 1LXJA 3TRGA 4LF9F 5ETLA 1U6ZA 3FRZA 4DR4J 3DLGA 4H4KA 4ZJOA 3OPKA 1RT5A 5IQ6A 2KG1A 3DLJA 2YNIB 3HFVA 3HZEA 2G13A 4ZVRB 2ZD1B 3TWZA 2E5IA 4DR7F 3BB5A 2GAGC 2DR5A 3DGVA 1X4EA 4M5IA 2R2TA 4JI3J 2MKJA 4NPOA 2NSBA 3DLGB 3SSRA 1RT5B 3M4XA 4CLWA 4LRCA 4K4UA 3MEKA 2F1FA 4ZP6A 3IS9A 4M63A 2C2NA 3FQKA 2CZVC 2G2OA 3VCDA 4LIWA 2KKHA 4OYIA 2U1AA 1MU2B 2QIFA 2LMIA 3I31A 4NLRA 4Z7YA 2OELA 4ZOSA 4J9PA 2XLJA 3IS9B 5KFEA 1UVKA 4WBFA 1NKEA 2EVZA 2AKWB 2LA4A 2N4CA 4GKJJ 1W25A 3HO1A 2JC0A 2VPXB 2J7KA 3OSPA 3MM7A 3T5JA 4ID5A 2GS8A 2UUCF 2KFYA 2WBRA 4OMFG 3TZYA 2HPUA 1CQNA 3G2XA 3BV8A 2I0XA 3MFIA 2QSFA 1H98A 4DWIA 2VQEJ 1CBKA 2PGCA 4IQXA 4OQJA 4DXLA 4ETZA 3K5LA 5DO2A 1LV5A 2V34A 3UO0A 1K9MT 4YN3B 3MM7B 2FHJD 4BWJA 3GYXB 3QWUA 4ID5B 4LJMA 4LF4F 1F2HA 3Q8YA 2R8HA 3R3TA 3EDQB 2WW8A 5AJ3J 1S9FA 3OTBA 1RADB 1N33J 3M8ZA 4YB6A 1QVFR 2IM1A 3KHLA 3V2UC 3I5AA 1REGX 5KT4A 1WF1A 3IG1A 1I94F 2BVZA 3EVMA 3IAM9 4U9RA 5EGYA 2QSWA 4KHPF 1FK9A 1NJWA 5KFIA 3LAMA 2NYHA 1K0VA 4ZLLA 2BUNA 2EXUA 2NLWA 1S0OA 1UWAA 4EWTA 1F6TA 3H40A 2XS5A 3PY8A 3QMQA 1KS2A 1NO8A 2F8EX 2BANB 3QZ7A 4RL1A 3S1TA 1YRUA 4UOHA 2UU9F 4DPWA 1FK9B 4Y28C 1VQOS 4NZ7A 1GX6A 1ZAVA 2CPHA 2MGZA 5LXYA 3UDVA 3BO2A 2N4DA 3RAQA 4OV6A 2PSZA 1Z2LA 3FMBA 2LDYA 2HQIA 4NLWA 1N5VA 3BBBA 3T1YJ 4X4PA 2CQ2A 3CIMA 2LQ8A 2YKNA 1YTYA 1LFWA 2RQ4A 3GU0A 2LDIA 3PV8A 5KFPA 5LL6d 3VQSA 4B9MA 2MGZB 1TUVA 2HQ3A 1KQSR 2EKNA 4DR1J 2GW8A 4RW9A 1L3SA 3KLEA 2B4VA 1KOHA 1CULA 2D3O1 3HHLC 1V5VA 2PA3A 3KJNB 4C0BA 1YLXA 3OSNA 4JI6F 4IR9A 4XIUA 5JXSA 3VAMA 5L46A 1JLQA 2AP6A 3M2VA 2XSJA 5KG6A 4F2RA 2VBZA 4Q0BB 4HI2A 4URQU 1ZM2A 3NNAA 4JV5J 1M1KT 2VFTA 4RW9B 3KLEB 1TMMA 4N47A 2FVSA 1UVNA 2ZKUA 7AT1B 2HFVA 4UF4A 3H98A 4Q8EA 5CD4H 3JS9A 3KMSA 1S7IA 5ETNA 1RWKB 1JLQB 3M2VB 2IBOA 1Q8LA 2XSJB 2IJNA 3GIRA 4TQSA 1R8HA 1ZAWA 2MY7A 1WHVA 2J5AA 1HWJA 3T6BA 4ZVHA 1S4FA 2LA6A 5B08A 1D9FA 4C98A 4MTPA 2HS0A 1HWLA 2V69A 4QOTA 1VQ4S 3ZC4A 5DZ7A 1D8ZA 4C8NA 1B0VA 2NREA 4WFYA 3P5BP 2QZ8A 5A0YB 1ZM3A 5B0GA 4TU7A 2CJ9A 5HATA 2QFJA 5I3UA 4RBTA 4CM0A 1FX4A 2XYPB 4KYZA 4F2SA 1L3UA 4MFBA 1TQLA 3LGMA 4K4VA 3LO3A 2E7XA 3NCRA 4USVA 5IT9U 2VJVA 5LSRA 4DU7A 3ET6A 1HHSA 4C8YA 4EYIB 3CCRS 2A3JA 2I8EA 4AUKA 3MMCA 4NXMF 4B3OA 2P9CA 1SXLA 2DNYA 3FUYA 5K9FA 2MQPA 3SV3A 4OHYA 5I3UB 1VGYA 1ZS6A 2H1YA 2V8HA 3UD3P 4G1QA 4OYWA 2R8JA 3DNCA 5GAGU 1UCNA 3J81j 3UN2A 2W2NP 1FRLA 3ET6B 3G87A 7FD1A 3SCLE 2RNEA 1SH0A 4KFBA 3MMCB 5LXRA 2E66A 3X1LB 1J2VA 3C8YA 3WC0A 1WTBA 1IBLF 1L3KA 4KKOB 3CDWA 3QAEA 3H4BA 2NCKL 2XSFA 4G1QB 2HKEA 2J8AA 1GNKA 4WPAA 4IG0B 4LBHA 2AV5A 2DHSA 4KFBB 3L95X 4RNMA 1UW4A 1FDAA 3UWTA 4CP5A 3JXOA 1N8RT 1A0OB 3US5A 3EXYA 2LEPA 4ZITA 1RACB 3IGVA 4JYAF 5GAEI 5DRKA 3T3FA 2ZJRQ 1KVIA 2C22A 3KOAA 2BACA 1J27A 1NSAA 3AOCA 3I4HX 4LQ9A 1S1TA 2HHUA 3OL7A 5G0RA 2HGNA 2GQ2A 4PXBA 2E5JA 4YP3A 4ZLPA 1TU0B 5ETQA 4X65F 3P45B 3CJTA 3NRBA 3LF0A 1EETA 3PJXA 3T5KA 2UV8A 1DQAA 2OIHA 5D3GB 1WC6A 2HBRB 4DLGA 2MLZA 2RUSA 2NR0A 2VBYA 1VBKA 2FJVA 2QLBB 3OXGA 2ROGA 2ZBQA 2WSFC 5G0RB 4FS2A 4ENOA 7FDRA 4UOFA 2B4OA 4J9SA 1GMWA 3QT8A 2DNKA 3CXCR 1HIYA 4OYPA 2QC3A 2AQ4A 4Y2IA 4KH1B 1CJKA 1U8WA 3ENWA 1F5BA 4B3RF 1U2CA 3TW0A 1HPZB 4Y0FA 2JOQA 3D7SB 1OY9A 5EX0A 4NLSA 5F8LA 2ALYB 2W9CA 1S6OA 3UI3A 4CH0S 1VR6A 3SDEA 4AE5A 3HVWA 4P75A 5KFWA 3LA0A 4B9UA 3N9UC 4WIIA 4IOCQ 4G1PA 2VODA 1CJKB 2QGFB 4ECRA 1U02A 2ZH2A 4DMZA 4DR2J 3QAUA 1FI4A 2DYAA 2W9CB 4WFZA 5F8HA 4PXDA 2H54B 4KHRA 1TR0A 2B8QA 3A13A 3IWLA 4R25A 1WSRA 2EBGA 1EIYB 2X3GA 4O44A 2PN6A 3ZTRA 2OEMA 2V0NA 5LMNJ 3ONQA 1RGVA 2IIHA 2XEXA 1QY7A 4CTAA 3W63A 2FHMA 3HHLA 3W2WB 1H38A 2IVYA 4ZK7M 4DQIA 3D2WA 4ED3A 2Q79A 4K4ZA 1RP5A 4O44B 1SKWA 1S72S 4JI8F 3AH6A 1JLAA 2JLFA 2OFGX 4KIAA 2KJWA 4CTAB 4CYUA 1N5YA 3HHLB 2RS2A 4CO0A 2XGQA 1JIHA 5AT1B 4JV2A 1U4BA 3C15A 3OQ2A 2FGOA 2ZHAA 1S6UA 3WZ0A 5KFJA 1WNEA 1RU2A 2BRKA 3DI6A 3CJ3A 1C1BA 5A8KA 4BWMA 1FVQA 1VFJA 4LQ3A 2VOOA 5A2QY 1B4SA 4PQAA 4OI1A 1SC6A 4CYUB 1OMSA 1N5YB 1HBUB 2ZH6A 4EI2A 3TEHB 3TI0A 4ED1A 4GVLA 4LVOP 1CQMA 2YPZA 5GAEU 2VPYB 4IYQA 3C15B 4YEAA 3KUGA 1VS3A 3FCVA 4DV4F 3W5ZA 4DV5J 3PO4A 2AJ2A 4FNHA 1C1BB 3JQKA 4KPCA 4PWWA 2HQFA 1XC9A 1CEZA 1NHKL 5KT5A 2JVRA 4DN0A 1X4BA 2CPYA 1TK0A 3C14A 4OYMA 5LSOA 1T95A 1X4FA 2HLTA 3HFKA 1RLCL 3KJQB 5CA5A 4L3NA 3RJMB 3JB9k 3MOJB 5IXUA 3V6DB 2MB0B 1S77D 3OTCA 1RSCA 4RO0A 2CPDA 2AZ1A 3EX7B 2HAFA 3BPSP 3SV4A 4F04B 3C14B 2R4FA 4BC9A 1R89A 3AD7C 1YJNS 4DDFA 3GCWP 2HW3A 4G3IA 2HBYB 5M2UA 1R8CA 4EBDA 2ZNYA 3J7AN 2E5GA 4GVBA 2C2EA 5HK4A 2JNJA 3GV8B 2NXJA 4FKXA 1U24A
chains in the Genus database with same CATH topology
4ECTA 5B0CA 3OHAA 3CCLS 3Q8RB 4LFAF 1KR4A 5F3ZA 4PXCA 1Z4UA 1RT1B 1DTQA 5KFDA 2HWIA 2OMLA 4RNNA 2PA8D 3NG8A 4H4MB 2YKMA 2VC0A 4O3OA 2E29A 2CG4A 2Q43A 4YDDB 3QLHA 1N4LA 4QYZJ 3Q8SB 5A8RB 4QIVA 3T1YF 4K5RA 4L6V3 5KFAA 1DJ0A 1QSLA 2R7WA 4Y2KA 1G6BA 5HMXA 3FMWA 4TY8A 2XB2D 1M5SA 2E9RX 5HLFA 1M5HA 4I1TA 2RU3A 2KRBA 2JLGA 1TL3A 5D8HB 2IRXA 1NK7A 1PC4A 2DGUA 5K14B 1D0EA 2V94A 2HZCA 1VQ6S 5F3TA 4NL5A 1XMQF 2DGSA 2O5DA 1S0VA 4R0EA 1R3NA 3PO5A 5U47A 5HQ8A 2GIRA 1SJ4P 3CDUA 4DSEA 4HL9A 3E51A 3C6UA 3C6TB 3PW7A 3RW7A 2VKRA 1Q86T 1DTQB 4U7CA 3R1HA 2MXYA 2CQIA 3BEGB 2C28A 1HHTP 2YNFA 3I87A 4F67A 3HZGA 3PM9A 4QWDA 3KK1A 3MR3A 2YKMB 4IO9Q 5L8RC 2DITA 2O1PA 3IR5B 3QLHB 3V6JA 3A1YG 2M3DA 1ZPVA 2CDQA 2L41A 3PFEA 2RT3A 3FEXB 2LECA 1FCAA 3ZZ0A 3VAIA 5T41A 2CPEA 2M7SA 3JTPA 1O0PA 4MFBB 4TY8B 2KVIA 4TLRA 1OSCA 4TYBA 5BYRA 3ZZPA 4QPXA 3T5LA 2SXLA 3DDKA 1RTIA 4TKTA 5LJ3Y 2UXBF 1TL3B 3JSMB 4RLEA 3D1QA 3K0JA 5KG0A 3DLLQ 4WKRA 1S97A 4DOZA 5J2NA 5CCMA 1YBAA 4DV7F 4FS1A 1U6FA 1U26A 2OJ3A 1Y00A 1DQ9A 2VG7A 1IUJA 2K3KA 2XMKA 2R7QA 4JV5F 4OZ5A 3ZZOA 3MMAB 2RDJA 4ZKAA 2OPSA 4JOUA 2IYGA 4DS4A 1C4AA 4DL2A 4B3OB 1MMDA 3M2RB 1NK4A 1SJQA 1AXQA 4B17A 1V6HA 3RAMA 1X0FA 4JI1F 2L9NA 1DAXA 2M2BA 2BR0A 2E1CA 3GFXA 1VK8A 4ALZA 4Y2MA 2YNFB 3KK1B 3BS9A 4HT7A 5L9XA 2ZZMA 3D0IE 4AYBD 4DV1F 1VC5A 1M5PC 2MZJA 2ZH5A 2KTQA 4M1KA 4NRTA 5GADI 4KC5A 1IJFB 1H7WA 4RX6A 4U67Q 3K5MA 3OW2R 1KD1T 4ZVFA 2J0QD 4U7UK 3SFGA 2MZQA 1QTMA 2CJKA 3NS6A 1Y5LB 1KC8T 1BY9A 1WEZA 1LWEA 4WF9Q 2YNGB 1VHFA 3KWMA 4HDGA 3GMGA 1Y3KA 3I6PA 1S1WA 2KFNA 3B4DA 5F8IA 3TOQA 4IRCA 4QR0A 3MR6A 1T3NA 2W8KA 4RW4A 3M9MB 4DPOA 3PW2A 1KFSA 3W7BA 3CC7S 1VIOA 4WE1A 1WG4A 3I5CA 4DL7A 3BN4A 3OV7A 1FRXA 2AWZA 2EPIA 3OXLA 1JMTA 5FD1A 2Y0SD 3NMRA 3D0GE 2QA2A 4ID8A 2YNIA 1XR5A 3MECB 2LQ5A 2U2FA 1U1QA 2BQRA 4I7FA 4EBEA 3O1LA 4JI2F 2NPFA 3KHRA 1F5CA 2PDAA 5KG5A 5LMUF 2RRAA 1FKAF 3OXFA 5KFHA 4DBQA 4IRDA 1UJ6A 2ZD1A 1HI0P 2AW0A 3CMAS 2E1RA 3DYAA 4DEZA 4X4SA 3J7Z5 2F9DA 1OQ3A 1U45A 2ZZNA 3OUYA 4FXWA 4CNYA 4ZPVR 1VQ5S 2ASDA 4NZ6A 1XTZA 2FVQA 4CO5A 1TZ0A 3OFGA 3IC1A 2VBWA 2O01C 2PC6A 4ECYA 4LF6F 5JVGQ 4RW4B 2GFFA 2W25A 3DCAA 2FGCA 1P8GA 2GHPA 2VG5A 4PG5A 4PR6A 4WE1B 5K8OA 4EZ6A 1JNZB 1HA1A 2OMOA 3KTQA 5SUHA 4QYRA 4FXDA 1DZ5A 5KFNA 4XPCA 1JX4A 1X9SA 4YB1P 1T05A 1XMBA 3I0RA 4I7FB 4JI7F 2BBEA 2EKYA 3TVZA 1TP7A 2N7CA 1R27B 2E1AA 2GQQA 1AW0A 3N6NA 3EYZA 1SJ3P 5KFQA 2CQCA 4YY3F 3NL0A 2BJEA 3K8WA 3DYAB 3OTDA 3I0SA 1ULRA 3O3LA 1OPIA 1RKIA 1WEXA 2HS3A 2B9WA 3OUYB 3FZBA 4DL3A 3GB0A 4NYOA 1R7IA 5AXLA 1LK7A 3E01A 3JTNA 1Q79A 1TV6A 2POKA 4NX9A 2L9DA 5CZVA 3J80Y 2D9PA 1AFIA 3CSKA 3JTOA 4O4GA 4RZRA 4NCGA 2BQ3A 1A9NB 1BWEA 1RJJA 4B3SF 5A6PA 3BSAA 3U7JA 3GR1A 1MU2A 2I1RA 4RW8B 4BBYA 2VG5B 1WEYA 1WD6A 3M8SA 2K2PA 3TA0A 1S10A 3QJPA 1S1TB 3TAMA 4FVCA 3UCGA 1NK9A 2PE8A 2XLKA 1YSJA 3LALA 3ENVA 5E5NA 4CH7A 4JI4F 1IKWB 3DRYA 3BR9A 2FVPA 4QIFA 2NUHA 4IH7A 2XMVA 2H5EA 3F56A 1T05B 2XS7A 3QPIA 5G4DA 3I0RB 4K5SA 4OZNA 1VIXA 3E3XA 3O8WA 1LXNA 1RTHB 5FDLA 3SCIE 5A8WB 2FTRA 3QGIA 3QYYA 3ITHB 3I9V9 2AU0A 3FJ2A 3N5FA 3N01A 3I0SB 4OZ0A 3T1HF 3ZZRA 4J9LA 2HWTA 4FBUA 1EETB 2B3TB 3GIIA 1TK5A 3E01B 3VF0B 2I2YA 1VI7A 3I32A 1KQGB 2MZ1A 2H9ZA 5KT6A 3CCJS 1UAWA 4NCGB 2DISA 3BQ0A 2FD2A 4IR1A 3IRXB 2ZC4A 5HBMA 4USHA 2LLZA 2HHHF 4DSFA 4K59A 3FRYA 3M9OB 3MD3A 3DRSA 3ICLA 1N48A 5KFZA 1KEKA 5KFMA 3PR5B 4FF2A 3TAMB 2XMUA 4C2MA 2XO7A 4OZLA 2D1CA 1U8SA 1N5TA 4F3MA 3G6XA 2VBXA 3M2UA 3PW5A 1YVFA 2V8DA 3MM8A 1FERA 1H2VZ 1KVJA 2OKQA 2CJQA 3NGKA 3T9ZA 4RBVA 4RW6A 1YRXA 1FRKA 4RUAA 3MGJA 3NNCA 1HNVB 5I3PA 1JLFA 2Q1LA 4I0WA 5CHCB 4I4BA 2L3MA 4OX7A 2AX1A 4RW7A 3K5NA 3BQ2A 3KJVB 4HDHA 1ZBTA 2HWHA 5F8NA 3KHGA 4ZCKA 3LH2S 4H4KC 2Z2MA 4NOHA 1V3ZA 5IT9Y 2NZ4A 1EP4A 3Q22A 1FJCA 4AL5A 1WF2A 5L1JA 4Y34A 5HBMB 4PRFA 2IRYA 2JX2A 1JLCA 3EUNA 2LU1A 4IOBA 4KE5A 3DRSB 3U27A 4K4YA 4DSLA 1C0UA 1UFLA 3FFIB 3PX0A 2AJQA 2KO1A 4Q8FA 2HNDA 3AB2B 4A47A 3PX6A 5C25B 4B9NA 4F4XA 3NAIA 4HTIA 2XMTA 3M2UB 2QA4G 3PACA 4PWDA 2HVIA 1TKTA 1OQ6A 3PRDA 4UY8T 3FVYA 1YJ9S 4CQ1A 2VOPA 1K1QA 3M9NB 1U25A 3MWBA 2YWGA 4GO7X 3HKZD 3KLHB 2F8HA 3RB0A 3POTA 2DK2A 2XWXA 2P6SA 4RW6B 2MSTA 4WU2A 3FEZA 2BRLA 2FLPA 2C3PA 4ZPCA 3SDEB 1BQNB 3MTKA 3UR0A 2AD9A 4F25A 4KJIA 4RW7B 1GTEA 3DHWC 4DN9A 1N5SA 3QWPA 4LF8F 4B08A 2V9WA 3LP1B 3P96A 2J6TA 1EP4B 1JWWA 5EDWA 3FNNA 1XEZA 2OTJS 1NKBA 1S79A 2UUTA 4AQYF 3UCZP 5DG7A 4PG8A 1JLCB 2BYCA 2MMYA 3OFHA 4LSNA 4RBUA 2IBKA 3CF5Q 5KFKA 2P9GA 3RRKA 3RR8A 2IM0A 5CCLA 3RB6A 5KFCA 3BF4A 1C0UB 4NCBA 1VRTB 1U6BA 2FJDB 1BD6A 1Q4RA 1TKTB 1CSJA 3S01A 3TO8A 3GFZA 3FSYA 5F8GA 3G6VA 1Q7LB 5M2PA 4O23A 5L39A 2JZ5A 2XMJA 3G8TA 2D7SA 1X4GA 1SIZA 2F3JA 3POTB 2PEHA 1M90T 2ASLA 1FRJA 1N52B 2UVVA 4NA1A 1RTDA 5E41A 4UOCA 1SQEA 4ZP8A 1KLMA 2JL9A 3T19A 3KNGA 4B9LA 2PFFB 1LOUA 5HO4A 1QE1A 3MTJA 3CDBA 3GQCA 1RYSA 4OL8A 2CRLA 4Q2MA 3CWJA 4YR0A 4A8OA 1JXEA 4LF5F 5GAGI 2E9TA 2QE5A 1KSPA 2RE1A 3CD6S 1N0UA 1OIAA 3IRWP 2BANA 1B0TA 3M8QA 1SL2A 1X5SA 4C8OA 2JSXA 2VA2A 2PT0A 2QMWA 3G8QA 3THTA 4ED7A 1DHMA 2D3UA 4OV1A 2IM2A 3IWNC 2XGPA 2FHOB 5E7OB 4DQPA 2MDAA 5DG8A 3BGFA 2WTFA 1F0XA 4OI0A 5HI7A 3EGZA 4I2QA 1MMLA 5DETA 3HLUA 4Y2CA 2XNQA 3A8EA 3O6QA 2UP1A 1HQUA 1WACA 4J9OA 2R2SA 2OPRB 3OFFA 1RQ0A 2YQ3A 1D1UA 2M88A 1Y7PA 3HKWA 5I3QA 3LANA 1K0TA 2RDIA 4QU7A 2XULA 4PPZA 4X4OA 4K4XA 2JEIA 1KLNA 4C0HA 4YQWA 1RTDB 3MM5A 4PG6A 4MYTA 1KLMB 3I9ZA 4Q7AA 4W90B 4V19J 1QE1B 3BO3A 2R8IA 3MR2A 1IBMF 2M0GB 2OPQA 5KFGA 3RZAA 2P9EA 1LW2A 3QJLA 2AYBA 3EGNA 5GAHU 1FDNA 4C9DA 3B82A 1KHVA 1QSYA 4E8UA 3Q8QB 4H4OB 4PCQA 3M8QB 3MEDB 1G7CB 4LT6A 3PVXA 3SCKE 4DFJA 3TANA 2UUAF 2R8GA 3D1HA 3H2UB 3MOZA 5CH7B 5FIIA 2WONA 4QPTA 4DL0C 5DGBA 5L1KA 1RTJB 3SEOA 4NLYA 4R8UA 4RNOA 5CYMB 3M8PA 1HQUB 4IG3A 3DOMA 2IA0A 4NZ0A 4CT8A 2B4UA 3WBZA 2WHOA 4JI0F 1C0TA 1GTHA 1VQ7S 1JLAB 4K0KF 3KFWX 5LT5A 3MM5B 1YJTA 4KHMA 5F9NA 2XI2A 4A8MP 3J81Y 4CO1A 4IFVA 1AROP 5D78A 3QIPA 4IO1A 1TL1A 2DNQA 5J1EA 4C8LA 5AXKA 2KM8B 3CCVS 2MSSA 2RSQA 5B0DA 2J9EA 3MUTP 3OBIA 2OPQB 3FCHA 1ZM4A 4D3HA 3H8YA 4M8LA 1S0MA 1LW2B 2B6AA 4DR2F 4HI1A 4QW8A 1IN0A 3IA0A 1T3OA 5E3CA 3C66A 2BDPA 1FNXH 1SH2A 2W9AA 1HNXF 3UD4P 4LFCF 2FVRA 5J2PA 4DFKA 1ZYQA 1FXRA 2CQDA 3DI6B 3VZIA 4R8UB 3SZ2A 3U1NA 1HNIA 3M8PB 5DS7A 3D1OA 1SIWB 2B7BB 2LXFA 2XCAA 4OI6A 5A8KB 3CB4A 1R8BA 2KT2A 4DJBA 5IT4A 4QBUA 1N36F 3UW1A 1C0TB 2UZAA 2W4PA 1UMJA 4Q0BA 4KGKA 4AL6A 2XG8A 3U1LA 4EBCA 2WSEC 1L3TA 1FTCA 4IFVB 3MUMP 3QIPB 1TL1B 4ED8A 5J1EB 5F8MA 3H5XA 2C42A 2NSCA 4BC7A 3BQ1A 1FVSA 3UDCA 2VASA 1S1UA 2K7KA 2XI3A 3KK3A 1HWKA 2M9KA 2B6AB 3MPVA 3KG4A 4NLVA 1SUQB 3UFCX 3K59A 2CPXA 3MAQA 4QR2A 5KT2A 3V4IA 2E9ZA 2FJEB 1DQ8A 4X66F 1P6TA 3OTOF 4MIAA 2Q6BA 5J2PB 4FF3A 4HH1A 4YMEA 2GHVC 4OJHA 5LMNF 6FD1A 3V6KA 5H9EJ 4EO6A 1NK5A 2EFPA 3N6LA 3CCWA 1HBOA 1HNIB 3C3LA 1RT6B 3KHHA 1RISA 4FF4A 1Y5IB 2ZHBA 3OVSA 2CJBA 2B4PA 2MZSA 3DOKA 3WX4A 1IKYB 3SSSA 4B3MF 1TFYA 3NCQA 2N3OA 2Z0GA 4TN2A 3D28A 3CC4S 2DBBA 5THWA 4Y65A 4N8OA 1FKOB 2ROEA 4NLOA 4WCEQ 1FJGF 2HFZA 2R9LA 1F60B 3BZQA 3MCSA 4DX8H 2RILA 5H1SV 2V4QA 4KR0B 3MPYA 1LW0A 1QUVA 4Q44A 1S1UB 5MAOA 4F3OA 3KK3B 1R43A 1YRTA 3M6XA 4AXIA 1ZETA 3C46A 1O8BA 3DOLA 1OS5A 2B43A 3CVKA 3V4IB 2DGWA 4PG4A 4XO0A 5CXTA 1FRHA 2QA4S 4YR3A 4IH5A 3P5TL 2DNNA 4QZVB 1WHXA 5J1NA 1UVMA 3M32B 1N6QA 1Q81T 3GILA 1H6KX 4ZPBA 1NB7A 2WAQD 4PKDB 3MURP 5HP1A 4J5OA 3DRXA 5CZXA 3DOKB 3CCSS 2KXNB 2Y1IA 1NJIT 4WZMA 3ISNC 2GHWA 4ES3A 1ROFA 5A0YA 3DN9A 1S9EA 4B9TA 3C2PA 4KPYA 2ZE2A 2CQHA 3T5HA 2BOPA 3BO4A 3M30A 4U6PA 1VQYA 2J7WA 1UVLA 3CGIA 2X51A 4Y3CA 1M5OC 1GXUA 1GXLA 5E3QA 5KFVA 3G96A 4DR5F 2HIQA 4JV0A 2MKCA 1LW0B 2KHCA 4PG7A 3UE2A 3DLEA 3G71S 4NA3A 1LFPA 3DLKA 2XZWA 2MQOA 4NLTA 4WXWA 3DOLB 3BR8A 5AE2A 1VQLS 4P2SA 4F4ZA 3QGHA 1Q7YT 1WTFA 3MEGA 4FPRA 4C3MA 4K2XA 2LXUA 5K8MA 4OLPA 3TP2A 2IMWP 1T7PA 2DNMA 5D4PA 1SB6A 2QV6A 4LIRA 2MQNA 4DQSA 1AFJA 3THVA 3V5RA 1N6QB 4OHXA 1SV5A 5IFMA 1JNRB 2MY8A 1X5TA 4NXNF 5ITHA 3ZZUA 5GMKa 2DH7A 1WG5A 3HVTA 2OPPB 4OX6A 4XAKA 4EFAC 3NGDA 1FDBA 2YKQA 3TAPA 3IWXA 1VJWA 4KBIA 2YWKA 5D4NA 3U02A 2EFOA 3L09A 2IC3B 3KK2A 4A8FA 4HTJA 4MK9A 3HK2A 1S9EB 4QWBA 5KT3A 2QO3A 2ZE2B 3MD1A 3O44A 1UVIA 4N41A 3M30B 1UKUA 1LK5A 3M05A 5CQGA 3TUIC 1BQXA 2BQUA 3KMQA 2KT5A 2PI5A 2KJVA 1ZM9A 4FVMA 2FLOA 1HNWF 3J7A1 3KYLA 1S6QA 3DLEB 2KN4A 3GZ7A 3T9NA 3DLKB 3OL6A 2MZRA 4DV5F 1KFDA 4HHJA 2JJ4D 2HHXA 2I9SA 5C42A 4MK8A 2HLUA 1FESA 1OO0B 4P7VA 3SMZA 2ZBIA 2R7UA 3KKFA 5KFTA 1SI9A 1VBYA 1R6YA 2OD6A 4Y00A 4ECVA 1VBXA 1X0PA 2YVSA 1F2GA 5D4OA 5KG2A 1SV5B 4V19X 2DH8A 4TU8A 3GWCA 2HHPA 5DDPC 3HVTB 3LWMA 1RYRA 3MEEA 4HLBA 2MQLA 2MPUA 3PKYA 2LU2