5GAGI

Rnc in complex with srp-sr in the closed state
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
ALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYVTEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5gagI00
1ZAVA 5GAHI 3J7Z5 1ZAWA 5GAGI 3J7YI 5D6GA 4V19J 3A1YG 1ZAXA 5GADI 5GAEI 3JSYA 2QA4G 4UY85 4NWBA 5D8HB
chains in the Genus database with same CATH superfamily
3R5GA 1QE1A 4HHUA 1BY9A 3W66A 5CA5A 3KJFB 4CWBA 5KFDA 3K2YA 4RNOA 1KP6A 4ED1A 3ICLA 3KLIA 2JSXA 2V4JA 2I1RA 2ASDA 1P8GA 2K7KA 4CLWA 4DU8A 3DRXA 2DR5A 3SXLA 4WIQA 1SJ1A 1Q8KA 2FVSA 3NP5A 5LMNF 2E5JA 2GC8A 2HLTA 4NMLA 1U6ZA 2E5LJ 4TXSA 4QWEA 3HMJG 1WSRA 3UQSA 3IG1A 5A6PA 3TAMA 2FJBB 5KG5A 1FNOA 3SMZA 2IM0A 4O3PA 2BE2B 3FQKA 3L9ZA 2AZ3A 3GFZA 3X1LB 4B02A 4ID5A 2EEYA 1U1QA 2HKEA 1OSDA 4O4GA 3G6YA 1WEZA 3T3FA 3MM8B 3GIRA 3DXBA 2RQCA 3PFOA 3TAQA 4GKJJ 4JYAF 2M70A 2DNYA 3DDKA 2BM1A 2CNOB 4CYUA 3O3LA 4UOFA 4HL9A 5J2MB 3JXOA 3MAAA 5F3TA 2P9GA 4J90A 4PQAA 2KT2A 1CJUA 1X5OA 1T3NA 2C22A 3CT9A 1JLQB 2OPQA 2ABYA 2GNKA 5LMUF 1QSSA 1FK9B 2DGQA 1IM4A 1O51A 1A0OB 2GVDB 4EO8A 2DNHA 2P5VA 2QFIA 2HHQA 2V94A 2EKNA 3OQ2A 2Z30B 3CO9A 5A76A 3RR7A 1SKUB 2D3O1 3NWGA 1MSWD 1SQFA 1AUDA 1KEKA 5ETTA 1ZS6A 1RI7A 1XMQF 5GMDA 4C4WA 4YB1P 3BSNA 2H5IB 1YG0A 2RVJA 1I51B 2BACA 1Q5YA 1WDTA 4ATNA 3CJ3A 2QYCA 5J2NA 5DG7A 1T9WA 2FLNA 3C6UB 4IG0A 2HMIA 2MYFA 1RISA 3V6JA 3U1LA 3MR6A 1S6QA 1MW7A 2FHMA 3P45B 4WYLA 4I6YA 2J6UA 3HHKA 2CQ2A 4OZ2A 4X4TA 2CPZA 1LXJA 4F26A 2MJUA 2KTQA 3VQTA 2B7BB 1NO8A 1QAIA 3PW0A 2J5AA 4B9MA 1RAHB 1HBUA 5HMZA 4RNHA 2N7CA 2UUAF 3FKBA 5LSOA 2B4UA 1NB2A 4ZVQB 3PCOB 3PKYA 2J9DA 3JQKA 2VQEF 5SUHA 2VPZB 2HQDA 1F5CA 2MKKA 5IWAF 4DV3J 1QSYA 4HKQA 1RGVA 2G0CA 4F8RA 1YJUA 1X4BA 2CJXB 2LCWA 4DXLA 2Y1IA 2BKOA 5CD4A 4JV5F 3KWMA 2C2NA 4LBIA 1RQ0A 1N33J 1YRTA 1WHVA 3B8HA 5DQGA 4DCJB 4DR6F 4WE1B 3I0RB 4RL1A 1U26A 1HFEL 1CJKA 3NOGA 2HNYB 2AJ4A 3LALA 1QDUB 3QGIA 4CLYA 2FDNA 1F5BA 3EYZA 2F5GA 1U0SA 1GX5A 4WP8A 1N34J 2VPXB 3BJYA 3PV8A 3M30B 4DFPA 3MAQA 1PJ6A 2XS5A 1X9SA 2LP4A 4KGVB 2PFFB 1JLBB 1V3RA 4TNOA 1UJ4A 2HZAA 5KFTA 3QZ8A 2HHHF 3LP1B 2MKJA 1NK6A 2J0QD 4OYWA 2GGPA 2IC3B 3BS9A 1U7LA 4ZVPB 2FQQB 1OPIA 1JLEB 3JTOA 4EBCA 2ZDPA 2A3JA 2B56A 2PI5A 5EHHA 2K3IA 3M8WA 3I5CA 2HGNA 2HQCA 2UV8A 4M5IA 1X60A 3QRPA 2YNIB 2OPSA 3VALA 1F5AA 3ILIA 3SV3A 2R7RA 3BH7B 3D5MA 2XYPB 1S9EB 1RU1A 3B4MA 2F3JA 4KY3A 4LR7A 3I82A 5D0HA 2XNRA 1T0TV 1KLMB 4JP8A 1HI8A 1XK8A 4F2SA 3LPYA 4DUZJ 5CZVA 4F3OA 1KRPA 5KFIA 2BANA 1Q8BA 3QIPB 3DOLB 4MAKA 4EI2A 3TUIC 3JSMA 3EZ5A 3TANA 5M2RA 4WJBA 3NWRA 1WG1A 4U6PA 3D28A 4C11B 4F7VA 2Y8YA 1N0UA 3DLGB 3FCHA 2W9CB 3EVMA 1F9EB 1NK5A 2ROEA 1XNRJ 4ZK7M 1N5VA 3KNAA 3PW4A 4C8KA 1RBAA 2G13A 4NLUA 1O6XA 2QLJB 2XMWA 2DNNA 1VLOA 3MEGA 3IP0A 5KT6A 1BXNA 2HS3A 3D1HA 3MM9B 2OO4A 4M5HA 1NHUA 4OYZA 3CF5Q 4MT1A 4OZ3A 4KSEB 2WVCA 5JUMA 1FDAA 3ZTQA 4DFKA 3T1YJ 3ITHA 1X4FA 2UUCJ 2BJ8A 3VF0B 3T41A 3MM7A 4CO4A 4PWUA 4EU0A 2GW8A 4I2PA 2YXLA 1WD6A 2CNLB 3OSNA 2DJWA 2M5YA 5GAGU 5A8RB 2IRUA 2W8KA 4B3OA 3FQLA 2R7OA 4O44A 2HBRB 4X4QA 1VBXA 2MZ1A 3PO5A 4HI2A 5F0UA 1KC8T 4NCBA 1WC3A 2J0SD 1FRLA 1Y00A 1PCAA 3KJQB 4OHVA 1IBLJ 2MKIA 4LF7F 1FI4A 2ALYB 3LP2A 5DQHA 4QU6A 3CIZA 1FNXH 4Q43A 2HW3A 1UCNA 3UN3A 4E2FB 4R8UA 1JLCA 1PG5B 3CJ5A 3RG6A 4KHPF 3M4XA 1RCXB 4WK3A 1Y9OA 3ZC4A 2M7SA 1R0BG 5J2PA 1P9YA 2JVOA 4C8YA 1RAJA 2XI2A 1T94A 4J9LA 4RUCA 3UNGC 1V6HA 4KR0B 5AE3A 2BYCA 3HSGA 3TVKA 2BW7A 5AE2A 3EDQB 3DOKA 3CJ4A 4DG1A 1J2VA 2B5JB 4LREA 1SXLA 1ZAVA 1SH2A 4F0MA 2Z57B 1HBMB 1RDRA 4MKAA 1X4CA 3QO9B 1YI2S 1EHWA 4HT7A 3E51A 4OLPA 4A8SA 2HQFA 2P9EA 4A46A 4ECQA 1RE1B 3UWTA 2BOAA 1PBAA 4DEZA 1S0OA 1JNRB 3EVWA 1JLGB 1H0HB 2DHSA 2UZAA 1PJ7A 1MMLA 1RT3B 1XNQF 1G4CA 2V8HA 3AJDA 1BE4A 4M63A 4ZITA 3VTIA 1H73A 4DV0F 5F9NA 5HO4A 2MSTA 5CAAA 1PYOB 1EJ7L 2ZC3A 4Z2XA 2HLUA 4WZMA 3ISND 3MHYA 3CJSA 1I5OB 5EDWA 5KG3A 3I87A 2GVZB 4K4UA 5EWFA 4ZP7A 1J5EF 2K1RB 4MFBB 4NXNF 2BE2A 5GAEU 4K0KF 2KVQE 4DS5A 5DGBA 2HHVA 1U1LA 3VAFA 3M8RA 1YLXA 2EFPA 4X64J 1RT7B 4DU7A 3E3XA 3BBCA 4WTOB 3MM8A 1FEEA 3I5AA 2JDJA 2UXBJ 3J7ZT 4YHHJ 3TZYA 1FWPA 4M5KA 2PGCA 1RABB 2B6AB 4WU3A 2RIJA 1SPBP 9ATCB 4OJGA 1D8ZA 3LAMA 1S72S 2HFSA 1RWXB 3CCMS 1U1NA 1FE0A 4Q5VA 3ZTSA 2WONB 4EYIB 2L08A 4ZDNA 2HBYB 4UY8T 2LLZA 5KFQA 5J2MA 2KFYA 4DV4F 3CJKB 4X4SA 2DVIA 2ZOFA 1DQ8A 1H2VZ 2YNFB 2E1PA 1JLQA 4L3KA 2DEJA 1S79A 4C48A 2K8GA 2AJ2A 3GYXB 2GVDA 3DRYA 5DJBA 3TR5A 2I0XA 4NLOA 4OYMA 3J81U 2LYVA 2JWNA 4NCAA 5ADZA 1FERA 2J9DE 1RA6A 4TQSA 3KK1B 1BWEA 2GQQA 3MEEB 5IV4A 5HJXA 2K06A 1RADB 3ADAC 1MN7A 2XC9A 1G2EA 1QAXA 3ZZZA 2F4VF 1VDHA 5BR8F 1YITS 5HI7A 4KO0B 1PC4A 1F6TA 2H5EA 2BQUA 3BREA 1W2IA 2PO4A 2DBBA 3OD2A 3C6UA 1RWWB 4XAKA 4K50A 3IRXB 4PCQA 2RKIB 3E8OA 5H9FJ 1ZPWX 4BCAA 4KIAA 1LXNA 2ZE2B 2P2CB 3G86A 1DTTB 3AHPA 4TY9A 3OXFA 2V4RA 1RAIB 3RBXA 1EB0A 5CHCB 2QC3A 2MQQA 5D77A 1N56A 3O1LA 2ZHBA 1EKSA 1LKZA 4K5RA 3D2WA 2X7IA 4PZVA 4RU9A 2Z4PA 2EK6A 1TL7B 1YRXA 2F63A 3PTWA 2YNGB 3T1HJ 2AYBA 4KBIA 3MCOA 3W63A 3LO3A 5E3CA 1KS2A 1IKVB 4K2XA 1JLAA 1QLNA 3LWMA 3MUTP 2W8LA 3VQSA 1SIZA 2J9CA 4PWWA 2VJUA 1S99A 1RK8A 3CJRA 4QWDA 3WX4A 3M6UA 5IT0A 4F50A 9RUBA 3RYLA 4UQTA 5L1LA 1D9FA 3GFXA 3QRQA 1L3UA 1QTMA 4WE1A 2KG1A 3GLJA 1GAOA 3I0RA 2CKWA 1SC1B 3L09A 1W2BR 1Y3KA 2FZCB 2UVVA 3T6BA 1FRMA 1R7IA 4ZCKA 2HNYA 2HRUA 2FVQA 2DNMA 5DETA 4LF5J 2XULA 3PACA 4IOBA 4AE5A 4CLKA 4J91A 3IO1A 2ZWPA 4F4YA 1H98A 5KAKA 4Q45A 1F3FA 3HSZA 1FVSA 3M30A 5D4NA 4WBFA 2KB2A 3GSIA 3VCDA 4ID8A 4ECYA 2CAJA 4QIVA 2HQGA 4GKKF 2UUWA 1UJ5A 4NLGA 2RHSB 5KFEA 3O2IA 3MI7X 1JLBA 3MMAB 3BKUA 3VVTA 3LP1A 3DN9A 4LIWA 4DV5J 1S1WB 3PVXA 4N8NA 3NCQA 2KXHA 2IC3A 3CJTA 3UDLA 3SQGB 1UW4A 1VGYA 2DNPA 3LA0A 1JLEA 1O5JA 3I0SB 3P8BB 5LSRA 3W64A 4LVNP 4WU2A 1A7GE 1TKZB 2H9ZA 3FBBA 3TNVA 4Q2LA 2YNIA 3ZXWA 1G7CB 4BC9A 4LBPA 4QPXA 1X4GA 2DPJA 4I6WA 3L7PA 1GEHA 2JNJA 5KFWA 1S9EA 2CJYB 4EBEA 2ZJRQ 3T5JA 4LFBJ 2B4PA 2KRRA 4P71A 2Z2YB 1Y5NB 1KLMA 3GILA 3I31A 1HNWJ 4RLEA 4ZLNA 3LUYA 5T14A 4RUHA 3H0PA 1NJZA 4XTTA 3GIIA 3PFEA 3IGNA 4DR3J 3QIPA 3DOLA 4QYZJ 1JK9B 4AYBD 3CD7A 5KOXA 3S8SA 4O3SA 2CPHA 1LQ9A 2DPIA 4C11A 1YJWS 1N32J 3KK2B 1OO0B 4XDDA 3DLGA 2W9CA 1WC5A 4KAIA 3T5LA 4YB6A 2IJFA 1KWMA 1SKSA 2VBXA 4DPTA 2C2DA 4ZPBA 5H9FK 2KM8B 2BR0A 3ZFVA 3SFUA 1T7PA 3HD2A 3H40A 2JEIA 3UE2A 3I9ZA 3R5BA 1VQ5S 3D6MB 1SL1A 4ANEA 3VAIA 2XM3A 3EVOA 3MM9A 3HKZD 1FJ7A 2OD4A 1MN9A 3BSOA 3FMWA 2CPDA 4OIXA 4LF4F 4MK9A 1BD6A 3PDNA 3G71S 3ONQA 2Z2LA 1J5OA 1X5TA 2CDRB 5KFLA 1RTHB 3DM2B 4AUKA 4NRUA 1IXKA 1TUWA 8AT1B 1NRKA 2V8GA 2W2PP 4I67A 5BYRA 5A8RA 5F8LA 5A2QU 4LSNB 3EZOA 2FVCA 3GSDA 2Q1LA 3PJXA 3GE9A 4CH1A 2ZKUA 3LP0B 3HI9A 4LR9A 2GO8A 1H38A 4MTPA 1U1KA 4NLVA 1NPRA 3KTQA 3TQ1A 1IR0A 1YBTA 2DITA 1AT1B 1QM9A 2HK3A 3DI6B 1YKWA 4HEA9 2R7SA 2O3DA 2VQFF 2F8HA 3Q83A 5JVHQ 2JHEA 1FO1A 4PG7A 2FTRA 4WTYA 2IBOA 2GHVC 4ZVHA 3FEXB 4ED3A 4ZLLA 2UVWA 3PJ9A 4J9SA 3R5DA 4GVLA 1U02A 5HQMA 4YY3F 4FF4A 4IFYB 3FVYA 1B64A 3S7RA 3AT1B 2B5JA 2PMZD 4NEZA 1S1UB 1RB0A 4X65F 3I5BA 4Y34A 1K47A 1HBMA 2UXCF 3QO9A 4NYPA 2DCUB 4KQZA 2N4DA 1YBAA 4IRCA 4EZ6A 4I0WA 1JB0C 2HGMA 3V81B 2XHWA 1KQFB 2ZOMA 3G8SA 2E9TA 1KOOA 1JLGA 3E01B 2VOOA 4UOCA 3W61A 1RT3A 4DL4A 1HA1A 3K8WA 3AXKA 4IH6A 3CO0P 1UTAA 4J9QA 1S12A 2CPEA 3TI0A 5LSLA 3BN7A 4A8XA 2DGSA 2VU5A 4RZRA 2QLBB 1RJJA 2RQ4A 3GB0A 1ITPA 4YR2A 1CG2A 4OX9J 4B9NA 5G4DA 5IV3A 4K4XA 2ATLA 2GVZA 1TMJA 4FPIA 4QYZK 1VYAA 1M1KT 4JI5F 2KZZA 4JI1J 2K1RA 4MFBA 1KFDA 4JB8B 4KYZA 2XO7A 4JYAJ 3TW0A 1RT7A 4OI0A 4OZLA 2DXFA 1Q8IA 1AFJA 2YKAA 2ADBA 2WVFA 3M8ZA 5MAOA 2DNGA 2B6AA 1YJRA 2LXIA 4ZIWA 5FDLB 2M4MA 1JKHB 1GT8A 3CPWR 5ETSA 3FSXA 3AAWB 2RE1A 2MZQA 1NSPA 4RWWA 4DI6A 2WONA 5LMUJ 3TRGA 1JWWA 2VG7B 2MZTA 1IKYB 4A8FA 3U1NA 3CJKA 4ILRA 4OJ1A 3CCZA 4CM0A 1DHMA 2YNFA 1S0MA 1UFKA 3W9HA 2AW0A 2E7VA 2W2OP 3TUZC 1FTRA 1KLNA 3SCJE 5C2GA 5HROB 2VPWB 3G2XA 1SKWA 3IC1A 5DLFA 3EXCX 3BV8A 6AT1B 1EETB 3SSSA 5E3PA 1XMQJ 3D0IE 2BQ3A 2KXNB 4OI1A 3KJNB 5SZTA 3KK1A 3MEEA 5DDOC 1ZOTA 1WHWA 1IWGA 1FXDA 1YZ6A 1NMEB 2CFXA 2NXNA 3BQ2A 3RBEA 3WHIA 1F9HA 2A10A 1Y5LB 4KO0A 1RTIB 2K2PA 3N0VA 3CMES 4LRDA 5M2PA 2JC1A 3N6MA 3IS9B 1NB7A 1W7WA 1N4LA 4NLDA 3MFIA 2V9KA 3IRXA 3CNQP 2RKIA 2KYXA 3QFWA 2YY3A 2ZE2A 3RGIA 3RRKA 1DTTA 5A8KB 2FLLA 4C3MA 4WPAA 1MROB 2VPYB 1FJGF 2QMWA 4G6VB 4WFBQ 1IUJA 1RCOB 3DGPB 1WF0A 4PXEA 2V6AA 3D67A 3MR2A 5ETNA 2AGPA 2EC0A 2V2KA 3U1MA 4YR3A 1TL7A 3I4HX 1JIHA 5D78A 2YH1A 3FNNA 2VQEJ 4LRFA 1TKTB 3W1YC 3OTEA 2YNGA 5IWAJ 1HWKA 1L3SA 3OFGA 1WORA 4LIRA 3SBMA 1FVQA 2KJVA 1TKXB 4USHA 2FVRA 1IKVA 1VJWA 1AROP 1GXUA 4TU8A 4AL7A 2OIHA 2CZ9A 2DY9A 1AW0A 4JV5J 3MOZA 3CUNA 4DR6J 1VC5A 5KT3A 2APOA 2BX6A 1GNKA 2ZH3A 4WCEQ 4LFAF 1XMBA 1UETA 4URSA 1KFSA 2D7SA 1LWEB 2NYHA 2DNLA 1WOPA 1NCLA 4DL5A 3I9V9 4YMEA 3QATA 3PX6A 1VQYA 5HQ8A 2JH3A 1IBMF 1N6QB 3W2VB 1F2GA 3BM7A 3GIMA 4DL7A 2JOQA 4FYXB 1RHUB 3RUBL 4NWBA 4WXWA 3CB4A 5CXTA 3PW2A 4PWDB 1AA1B 3MR5A 2CVIA 2IPOB 1N36F 5JJBA 5LXYA 1JNZB 4XK8C 2ZHOA 2HHHJ 3QGHA 4WFYA 4USVA 2COLA 2A2CA 4QR0A 5G0RB 2V50A 4LF1A 1ULRA 2CPYA 3OLAA 3QT8A 4H4KC 1NH7A 1VMBA 4DJBA 4QCLA 1D9AA 2VC0A 3MMAA 2B8PA 3QRRA 1S1WA 3DNCA 2V69A 1VR6A 1RWKB 3AY0A 5EWGA 4RX6A 4ILMA 4NPOA 1EZZB 2HAFA 1KTQA 2M88A 2UV8G 3SQGA 3THPA 4B9UA 3DHWC 4USUA 3VAMA 3I0SA 4DL3A 2R7UA 3PG9A 2HHUA 2ZITA 3PYGA 1TKZA 3PJWA 2R4FA 1FRXA 1S59A 4A8KA 3W62A 2CPJA 2DHXA 1W25A 5L39A 3R9LA 1LEOA 1SJ3P 3U02A 4P6QA 3NS7B 2BXJA 2XLIA 1NDLA 2C2EA 5J1NA 2CDQA 1KD1T 3DLLQ 2DYAA 3MF5A 4A8MP 3GWCA 4AXIA 4ZVSB 1F60B 4CT9A 4Y65A 3FMBA 3PYFA 1MLAA 1NJIT 4BC7A 4DUZF 3G6ES 5DO2A 4ZN1A 3KK2A 4YEAA 3GCWP 4KJIA 5CCMA 1HI0P 2A6MA 4DF8A 1TTHB 1M1GA 3GJTB 2LU2A 4FVCA 1TUVA 1YSJA 5F41A 5IT4A 4WFZA 3AB2B 4C8MA 2IVFB 2MEWA 2Y1RI 3F56A 4JI6F 2C28A 3JSYA 3TX8A 2E29A 2ZZMA 7AT1B 1WC4A 1U8SA 3KMSA 3CCSS 4HH1A 4NRTA 1RTHA 3DM2A 2RUGA 4RW8B 3GJSB 4FF1A 1CQMA 3RRHA 3P6YC 4J9UE 2UUCF 3RBDA 4LSNA 2GHWA 2RU9A 3MEKA 2DY1A 4H4MB 3LP0A 4DX5A 2XGPA 4B9SA 4PG8A 2GO9A 2AX0A 3FCVA 1UEKA 3OXGA 1S48A 3AD7C 4WYWA 2FIUA 5HVFA 3HCXA 4MMOA 3J7Z5 3DOMB 4Y28C 3ELHA 4KHPJ 1DQ9A 2B43A 5GAGI 1HKAA 4QBUA 1OWXA 1Q86T 2H4WB 4UUXA 4QQBA 3M1VB 4YB5A 2V5HG 2ZFHA 3CDUA 3DCAA 2E44A 3QBCA 1NXIA 2QE5A 4CLZA 1IQTA 3ENVA 3PYEA 5ETPA 5J1EB 4F4AA 1S1VB 2UP1A 2HVDA 3UD3P 5C5JA 5A8WB 4X62F 4DSIA 2DR8A 3G87A 1FKAF 5KFHA 3PEHA 3IWLA 2P8IA 3OXLA 4IFYA 2CA9A 1ZA2B 3HHLB 3RAMA 4X84A 4IH7A 3KJVB 1KN6A 4USTA 1S1UA 4DR1F 4L74A 1CEZA 1UJ6A 1YX2A 2YTCA 5IM0B 1R6YA 3GMGA 2FJVA 3PHTA 3Q8UA 4DV0J 4ZVTB 5BYQA 3V81A 3Q8RB 1U2RA 1ZA1B 4K4SA 2Q79A 3E01A 1URNA 3THVA 3BO2A 1X7VA 1S4EA 3CMAS 3QWUA 1ICEB 3LF0A 1Q82T 1WC1A 2YKMB 5E2QA 2L48A 3M2UB 5FLXU 4IYQA 1RWNB 4RUBA 1EKRA 4WP3A 4ZVEA 4IOAQ 3FJ2A 4ED6A 1EX8A 3OTCA 1QVFR 2CJ9A 4NXNJ 2MTLA 1JMTA 2AQ4A 2EKYA 5CYQB 1FHTA 1SI9A 2CQ0A 4RBVA 4OZ0A 3M8PA 3OJUA 2XS7A 1DLOB 3F44A 4FYWB 2MQLA 4M1KA 4DV1F 3UD4P 3FRYA 2VA2A 4X66J 4ZLJA 3WC2A 3IFEA 1H72C 1GMUA 1M5PC 3B54A 4EO6A 3MPUB 3HF5A 2N82B 1RT6B 3QAUA 3NL0A 1C0TB 3KG0A 1VISA 2OJ3A 4Y0FA 3NMRA 3N5BA 3A3NB 5L1IA 1SJFA 5ETOA 3SV4A 1MWYA 3HT0A 2VV5A 3HLUA 4X64F 1UW9A 1YJVA 4C98A 2D3UA 4DZ6A 3H5YA 2DHAA 5FDLA 1JKHA 1TK8A 4ECRA 1Z1ZA 3MAHA 1GK8A 5GAEI 2QA1A 4C8LA 2UXBF 3GV8B 4F4KA 2E66A 4YQWA 4OL8A 1I6JA 2VBZA 4WF9Q 3CMQA 1OMSA 2VG7A 3HZEA 3QLHB 4HR2A 5IC6B 1IKYA 2VFRA 3BO4A 1U25A 2AIRB 2NYIA 3IMQJ 4J7CA 1FTCA 1SH0A 3ZZRA 4HI1A 2WSFC 5DLGA 5HROA 4ETZA 4F36A 3W3SA 2IDLA 3OL6A 1SUQB 1S10A 3R97A 1AZSB 3GQCA 4DOZA 1NK9A 1EETA 1HQUB 2Z2MA 3L7OA 4EUVA 5AXNA 2WW4A 4R0EA 2AU0A 3NOCA 3W2WB 2F4VJ 5BR8J 3PX0A 1NKBA 3J80Y 2V63A 1HWLA 2FJAB 2F65A 3QJPA 3QJLA 4QZVB 2H48B 2R9LA 1B0VA 4RW7B 4PUOB 2GIFA 4KPYA 3I56S 2E5GA 3EGWB 3KKFA 1X5SA 3IS9A 4ZP8A 4TYBA 4I6AA 3US5A 2OPPB 3C66A 2EVZA 4GMKA 1REGX 1X4DA 3HHLC 1NNDA 1APSA 1RT5B 3V5RA 1SQEA 2W7PA 1DBDA 2FHOB 4F0HA 5A8KA 3IM8A 1MROA 4ZP9A 1OYEA 3KNGA 3BH6B 1KSPA 1BC6A 1IJEB 1FRJA 3DGPA 1XN9A 1R8BA 4P9SA 2YKQA 1R6VA 2O5DA 5KFOA 1XJWB 3BZQA 1LWFB 1TKTA 2YKPA 2Y0SD 3KOAA 3P49B 2ZD1B 2W2MP 1RKIA 1RWOB 3NGSA 1NHVA 3RB0A 3J7A1 1TKXA 2WOMB 3TZXA 2WBRA 3TJ8A 1BUXA 4NI2B 3NBPB 3Q8PB 4ZVUB 2P9CA 3JYTB 5IQ6A 2J0WA 2YNHB 1F1BB 3FCWA 3MDFA 1VC6A 4MJKA 1WC6A 1NSAA 1RTZA 4DN9A 1FRHA 1LWEA 3OBIA 5DZ6A 2JJ4D 3IAS9 2FB0A 1N6QA 2HWTA 3W2VA 3LOUA 1NK4A 3W9IA 1RT2B 4I1TA 2DGTA 1BHNA 4OHXA 4PWDA 4ZVRB 1RAEB 1I1GA 4RJVA 4GKKJ 2JEGA 4JBCA 2DRBA 3EGZA 3UFCX 1MU2B 3MCMA 1K8AT 1CSJA 3DRSB 5G0RA 2YQ0A 2M2BA 2ZOGA 2MKYA 2MQOA 3LW5C 2ZKTA 3IRWP 1SC6A 3OHAA 3SYZA 2OSQA 3BBFA 4E0DA 1FDDA 1LWCB 2MJNA 1OPZA 5C42B 4P2FA 3F41A 1N48A 2B4OA 3I32A 3H2LA 3V2UC 4ZMMA 1UPPA 2VG6B 1XR6A 3ZNJ1 1FRIA 1IM6A 2KL8A 2N4CA 1U49A 1ZPVA 2XGQA 1JJCB 3HVWA 1WNEA 4KGMA 4ELUA 1N8RT 2FPHX 4NASA 1PO6A 3V6DB 4X4VA 5DQIA 1FA0A 2YWWA 4A4JA 1VOMA 1RUSA 4KH0B 3A3PB 4O3QA 1OS5A 1WKLA 1XR7A 3S1TA 4I69A 4QIEA 2CZVC 5F8IA 4LFBF 5A2QY 4O3OA 4M5MA 1YHQS 5JVGQ 1D1UA 1TAQA 1NBEB 3D54A 2QIFA 4DQSA 4PXBA 3VZIA 1HW8A 1NKEA 4Q8EA 5KFRA 1EAYC 1D09B 3G4SS 5KFNA 2UXDJ 4LF4J 4CO1A 4B3TF 2BVZA 1N32F 1XBWA 3CVKA 4P7TA 2V2ZA 2JFDA 4A8OA 4GRSA 4FVMA 5IT9Y 1ZAXA 4PQUB 1NSKL 3VR1A 3OVAA 4C97A 1WUUA 2H5JB 5J1PA 3DFEA 1HLWA 4RW8A 4CQ1A 4DCPB 4CLPA 2V34A 3ET6B 4DL0C 1YQHA 3KUGA 5HSPA 2DGUA 4H4MA 5BJRA 3MMJA 4NLRA 4H54A 1U09A 2I9SA 4CP5A 2EWHA 2QSFA 2VQFJ 3DOMA 2V8PA 3HP6A 4NZ0A 2OFHX 2NZCA 1RWVB 4OI3A 4KGXB 3M1VA 3CGIA 2AWZA 1VBYA 1SQGA 1Q81T 3CIMA 4NOHA 4DSKA 3AD8C 1R27B 3SQOP 1HQEB 3V6HA 2Z56B 2ZHAA 1XIQA 2A6OA 1S1VA 3T5KA 5F8JA 4TU9A 5KT5A 1LW0B 2J0XA 5HAOA 1VQLS 4KH1B 2WK4A 1HWJA 4DX6A 4B3RF 3HKWA 1B7YB 1JQGA 4I64A 1XWLA 1RYRA 4X65J 2QA4G 2J8AA 2ZZTA 4DPOA 2R7WA 4P74A 2V67A 2XB2D 3HHLA 2HG4A 4LF2A 3AH6A 4HLBA 3GR0A 3KJVA 3ETMA 2KU7A 1C1BB 3NGDA 1U4BA 3NGUA 4J37A 3BR8A 3PW5A 3P4UB 5FJ4A 3D1OA 1S0VA 3GJRB 1XMOF 3DMJB 2Y1JA 3B6BA 4FS1A 4W98A 2VBWA 3JAMY 3PX4A 2QG9B 3MPWA 4Q44A 4RR5A 1GTEA 3GFHA 2BV3A 1H3DA 2N3OA 2YKMA 3M2UA 4XO0A 1WF1A 4PEOA 4CLLA 1KONA 3SZ2A 2XI3A 1OJ4A 4Y2IA 3LGHA 4PG5A 2AJFE 3KLFB 4JI5J 2Z58B 1R8HA 3BGFA 1B70B 2HHSA 4QYRA 3AQPA 1VK8A 1NJXA 5CYQA 5I3PA 2PMHA 2VICA 2VFUA 2C2RA 1DLOA 3QT5A 4OV1A 2EFGA 4OX9F 2MZJA 2QEXS 3UN2A 2BM0A 1RTDB 4JI4F 3K57A 1P9QC 1VBZA 2BE7D 1RT6A 1X5PA 4B9VA 4GO7X 3TA1A 4JI1F 4O23A 3UNYA 1C0TA 3FDSA 1KQGB 2RILA 2BZ2A 1ZYQA 1V5VA 2BJ1A 3MPYA 4F2RA 2W4PA 1ZETA 2FJEB 1QJHA 3AODA 2AYMA 4Y2AA 2FJWA 3QLHA 4J9PA 2NSBA 4ZP6A 1Y10A 2M3DA 2BUNA 3U27A 3HSDA 3PRDA 3M8SA 5D4PA 2LQ8A 1QVGR 1WEYA 1SUQA 2DHHA 1AZSA 3BBBA 1TL4A 4B08A 2BJEA 2WHOA 4OI4A 1U1PA 2HZCA 3FC9A 1VQMS 2OTLS 1HQUA 1FD8A 2Z2ZA 4I4BA 4K59A 2IM1A 2DTJA 3R7SB 1Z2LA 4DPYA 3W2WA 2CJBA 2PIIA 2CPFA 3MWBA 3H42A 3EDRB 3TVZA 4JI2F 4RW7A 1T05B 4PUOA 1QAJA 5B0GA 5D3GA 3NS6A 3QT7A 3EICA 4USMA 2ZBCA 3R1LA 2LVWA 1OY9A 1FJGJ 1ZM3A 4RPFA 4Q0BB 4RNFA 2MKHA 3CCES 2LEBA 3CEDA 1RT5A 1NEEA 2BJ3A 1X4HA 4P2MA 4DZDA 4Y6IA 4PG4A 4ED7A 3W5ZA 1WWHA 2FHJA 4XIUA 4P2SA 3S01A 2NUHA 3N4WA 2R8KA 3LQVA 1HQ2A 4FP9A 3Q89A 2CQ1A 4U95A 2I2YA 3JQMA 2BJDA 1C4AA 5E7OB 2OEMA 3D7SB 1LWFA 3M8QB 2O1PA 3EJMA 1OIAA 2NXJA 2ZD1A 2KI2A 4F3QA 2WOMA 1NUEA 1K0TA 4LFAJ 2UVUA 2AF6A 2DGWA 4NI2A 2QTWA 5F3ZA 3NBPA 1E6VB 4ECWA 1M90T 3JYTA 1S1TB 1RKJA 2YNHA 2ILZA 1S9GB 4HDHA 1VIOA 1SH3A 1IBMJ 4O4RA 2YPYA 1DJ0A 4JI3J 1TP7A 2BRKA 1VQ6S 3NS5A 1O8BA 1UZDA 3KHGA 4ERDA 4ZHRB 2DRAA 3C46A 1N36J 2ZH2A 1F3VA 1TV6B 4JOUA 1RT2A 3NAIA 3QNWB 5HATA 3G9CA 4OYAA 4F67A 1HIYA 2IM3A 5IC4B 5KG4A 1RHMB 4QWAA 1MU2A 3DDNA 3OTDA 3DRSA 3OT9A 4DX7A 5KFFA 2OEJA 1BQMB 4ED0A 2DGXA 3J7YU 2YWFA 1C0UB 3DRPB 1X31C 4DL2A 3TUJC 4IDKB 3AOCA 1LWCA 1JJ4A 4KTQA 2GA7A 4W90B 1FEHA 5C42A 4IH5A 2K3KA 2E5IA 5L38A 3F0NA 4WFXA 4AL5A 4I68A 1KHWA 5E0OA 2VG6A 1TL1B 4ZPDA 4NZ7A 3K0JA 1ZAWA 2Q66A 2UU9F 1EARA 2BEFA 1M1HA 1H6KX 1E6YA 1S9FA 4X2BA 1GX6A 3V6DA 3ENAA 2GJ2A 4IG3B 4DN0A 1YIJS 2DH9A 2R2TA 3H59A 2RRNA 5AE1A 1TL3B 4DQQA 4CLSA 5IFMA 4ELTA 3C3LA 3NCRA 2VONA 2POKA 4FXDA 3G8TA 1YVFA 2KHCA 2VBYA 1Q7YT 3IGVA 4AT1B 2WB1D 4Q2MA 3BYRA 4NYZA 4NLSA 1FDNA 2NS1B 1SKRA 1FRKA 3H25A 2GMJA 4PAAA 4F02A 2CPXA 1UA1A 3KFWX 4JI6J 2H51B 5KFMA 1YWXA 3LH2S 1UVJA 3FBFA 4JUZA 2ZH4A 3NGTA 4ES1A 3MFHA 1UP1A 3BGOP 4PQUA 4FPRA 3ZZOA 3ZO7A 4GO5X 1V3SA 4R0JA 4JV2A 5LXRA 5F8GA 3ET6A 3H4BA 2BJ9A 2V0NA 4DSEA 2FZKB 2EW9A 3TA0A 2XYGB 2X1BA 2BRLA 3ZTRA 2W25A 3DRRB 1C1CB 3CJ0A 2ZJPQ 3M8YA 3NAHA 3MURP 4BLGA 2AGQA 1S77D 4PG6A 4FNIA 1RLCL 1HWIA 4ZPWR 4NE9C 1KNZA 3BQ1A 2DIVA 2O67A 2NR0A 4ILLA 4M5LA 5EWEA 4F0KA 2VKZG 2KXFA 1BQNB 1V5IB 3D6FB 2ILYA 3ILJA 3NLCA 5DRKA 2CG4A 1KTVA 3AD9C 2F8MA 3QWPA 1MWQA 4C2MA 4GC6A 2EFNA 1UL3A 4X62J 2R8HA 5M2UA 2J8SA 1HQEA 4CNZA 4LSLA 4DS4A 1SIWB 4ZA1A 2WBMA 1LW0A 4ZJOA 5AJ3F 4P10A 5KTQA 3MPDA 4NMXA 4DR1J 4ZVGA 1S1XB 1VCTA 1PBUA 4AL6A 4TU7A 3WBZA 3UDCA 2NLWA 2Y0BB 2XBPA 3TWZA 3UN5A 3JB9k 2ZBRA 4KV8B 2MHEA 1ZBTA 2ATCB 3D6HB 5LJ3Y 1C1BA 2ZVSA 3R7NB 1AFIA 3MUMP 3K5NA 1BWVA 3SCKE 3OVSA 3DMJA 3LAKA 2L41A 2QMUB 2EFVA 1ELOA 4N76A 4W4MA 1XR5A 4ZPAA 1GMVA 4LFCF 2HAIA 4WFNQ 2OP5A 1U1OA 3VV2B 2E1CA 3M6WA 4EYHB 2DH7A 3JTNA 4K8RA 2WVDA 3KLFA 4DQIA 2HBQB 2WZ1A 4DV1J 4NLYA 5DS7A 4YOEA 4IUFA 4QWCA 2OH2A 1R89A 2P6SA 2PSZA 3H2VE 4EBDA 3GFYA 1KR4A 4G1QB 4OV6A 5K5MA 2ZWOA 1R0AB 3CD6S 3OL7A 1RTDA 5HANA 2AKWB 4J9VA 3CCUS 2WTFA 3HHEA 2XO6A 3DLJA 3MR7A 5D0RA 4HACB 2DO4A 1NK0A 4X66F 1WDDA 2OLWA 1KVKA 4CO5A 3BKFA 2G1HA 1SC3B 5D4OA 4A48A 4NYOA 2EC2A 2AMCB 2PEBA 3AFGA 2Z8QA 1RWMB 4M95A 4IKAA 2AD9A 2ASLA 1G3OA 4KKOB 4DR4F 5KFVA 1Q5VA 3HPOA 4K4TA 1N5YB 3RU0A 4ALZA 4TKTA 1FK9A 2XTJP 4ED2A 1LK5A 2D74B 3FFIB 3BR9A 1DTQB 3G82B 3KLGB 3H2UB 4J9KA 3W8PA 3HM9A 3GCXP 4NZ6A 2BKNA 2XZDB 3IBWA 3MUVP 3EXYA 2LKZA 1RAFB 4Y3CA 2R2UA 2B3TB 2IMWP 2CIMA 1WOSA 3G6VA 3BQ0A 1UFWA 4NL5A 4M5NA 3M9OB 1JLFB 1X8DA 1X9MA 4ZIVA 4HDGA 2WRMA 4NA1A 4HTIA 1T05A 1Y7PA 1Q4RA 5KFCA 3KYLA 3CCQS 4Q0BA 1K1QA 3CJ8A 2W9BB 3FRZA 2VOPA 2XLKA 5F8HA 3QFHA 1HNXF 4ITSA 2IHR1 3T9ZA 2BA9A 4FN5A 1IN0A 4WK1A 1UWBB 2NCKL 3ITHB 5GAHU 4FDFA 2ZH5A 1DZ5A 4C0BA 2PD1A 2E7XA 1SCJB 5LJ5Y 5AT1B 5D0GA 2DK2A 2L9NA 1C4CA 3M8QA 4DPWA 3K5MA 3OFEA 2QZ8A 4FBUA 3CD5A 2VD3A 2HS4A 3RW7A 4S0MA 2B7CB 1Q1KA 2HSEB 2EG2A 3KHRA 1KOHA 1E6VA 3WX8A 5KFBA 1Y11A 1U48A 1S1TA 3JQJA 1S9GA 1S6PB 2RS8A 2B4VA 4UT4A 3HX9A 2GQCA 5D8HB 4X4OA 1TKDA 3RBZA 5B09A 1Y4ZB 1N5TA 4CO3A 1T03B 2IM2A 2PN6A 4O3RA 1S7HA 1WG5A 4ZHRA 3D4JA 2ADCA 4DUYJ 1WHYA 2MLZA 5A6WA 1TV6A 3I55S 2ALZA 4KT0C 2BJ7A 2X51A 4EGLA 1CVJA 3LANA 4H4OB 2AJQA 5KG6A 2HFVA 3M05A 3BPSP 2D41A 4ECUA 2CNNB 3C15B 2DO0A 5I3UB 1ZZNA 4FXVA 3Q23A 4CTAB 3BSAA 2OUGA 4OHYA 1BQMA 2RRBA 1REVB 1C0UA 3DRPA 3H8YA 4IDKA 2IIHA 2CJQA 3H5UA 1O0PA 4M5DB 4UZCA 3D3CJ 1R8CA 4QWBA 1KHVA 4JI8F 1MNEA 5EN1A 2CZ4A 2CVEA 3U7JA 2OKQA 3Q8YA 5HK4A 3UD5A 1FXLA 1M5VC 3MCNA 1TL1A 3C19A 1WG4A 2VG5B 2MQNA 4RW9B 4DQPA 3NKYA 4FBTA 1XTZA 2DIUA 1YJ9S 3VAJA 3O44A 2LA4A 2E1AA 4IG3A 3DLHA 1SBRA 1DARA 2YX7A 1TL3A 4QR2A 4RNNA 3CCWA 4LSZB 2AX1A 2YKNB 4J9OA 4OZ1A 4LF9J 1B3TA 2O01C 4ED5A 3TQEA 3TZWA 4ANDA 4LQ3A 2VA3A 4OLOA 3SDEB 2CJAA 3BKTA 3ULHA 5CYMB 2ZM6J 3HO1A 4B3TJ 4EMDA 2M8DB 2PDAA 3TEGA 1RTJB 2DT9A 1ZM4A 5LM7E 4N77A 3N28A 3H7HB 2FLPA 1OSCA 2FD2A 2HQ3A 4ECSA 3RB4A 4ZKAA 2YX4A 2RT3A 4ED8A 1YTYA 4TYAA 3R2CJ 3ZZUA 5I4MA 5DG8A 2D9PA 2WB4A 3KHLA 2CADA 2GFFA 2VDIA 2CRLA 5GVQA 2UXDF 1LV5A 2AGOA 5F8NA 5K20B 2IJRA 1KBRA 2C2MB 1NM2A 5LT5A 4B9TA 3BDPA 2ZUAA 3OSPA 5CZXA 1UKUA 3IR6B 4OX6A 5KFJA 3NY0A 3CDAA 1I3OB 4RW6B 2C2KB 4RBTA 3DRRA 1C1CA 1XQIA 4PYDA 3C2PA 1BGXT 3A4TA 2HVEA 2ZH1A 1WKJA 2DNRA 4U7UD 1YZ7A 5K9FA 2OD6A 2FY1A 1JJ2R 2M0GB 5E3QA 1GXLA 1PIEA 2VB6A 2IVMA 1BQNA 4KHMA 3PW7A 5KFSA 1JXLA 1RU2A 5JXSA 2DNKA 2WVEA 1PSDA 3MTKA 5DDRC 1FD2A 1HNZJ 3R6GB 4FNHA 3W8GA 3D1QA 2MXYA 2PC6A 2ZBIA 4CLFA 5DZ7A 1VQOS 3TA2A 1OY8A 3EX7B 3F73A 4B3RJ 3HHNB 3CWJA 1N5SA 1UAWA 1NK8A 1T9YA 2RSQA 2C3PA 3R3TA 5IS2A 4G3IA 3FEYB 4YFUA 5L1KA 1N0VC 2RH3A 4F04B 4RKUC 2WW8A 1S1XA 3A3OB 3NNCA 1T9TA 3IR7B 2HWHA 1FFSB 1XMOJ 2ZH8A 4DSLA 1U24A 2W7AA 1T11A 4KV8A 1JLAB 2EK1A 2CQIA 1OQ3A 2AYGA 2GS8A 1NSQA 3PEJA 2XCAA 2G2ZA 1OY6A 3TX0A 3SI8A 2D3ZA 3HDSA 1GMWA 4Y2CA 2J7WA 1VQSA 2ACYA 3Q8VA 1CULB 4YP3A 2LDYA 2V8VA 2NREA 2RMLA 4DBQA 3DLBA 2XHCA 2K7JA 1HNVB 1FCAA 1VRQC 4DUTA 2GAGC 4DHVA 2E1RA 4JI4J 4IO9Q 2E1MC 2KM8C 2HVZA 3Q2SC 2IYIA 4NXMF 5GADU 1HMVB 2RAQA 4OZ5A 1WELA 4G1QA 1R0AA 3M2VB 1S97A 2BABA 5JMNA 2AP6A 4QOTA 3BEGB 3GZ7A 3FK4A 1UPMB 4HACA 3PIPQ 2X3GA 3V6KA 1X4AA 1L5UA 2NZ4A 5AXKA 4EWTA 1M0SA 4ANCA 3EGVA 4ZLPA 4K5SA 5HQLA 4MKYA 3W65A 3H98A 4OYBA 4OZJA 3T5HA 2G1DA 5DM7Q 1VQ8S 3EPGA 2R2SA 2GQ2A 1NK7A 1AXQA 1CC8A 3VGSA 4BWMA 4KKOA 4CI0B 2XQCA 1KQSR 2G2YA 3MOJB 1N5YA 1DURA 4OHZA 3KLEB 2QX0A 3FFIA 1S6OA 1DTQA 3G82A 2CWXA 2GMLA 3KLGA 3E2EA 2O66A 4JI7F 4KRWA 4NLQA 5B08A 1RBLA 3RR8A 4JI2J 5DM6Q 3HD1A 4RNMA 3Q22A 1NAQA 4R25A 5J2QB 3B4DA 1PKUA 2DRDA 1JLFA 2QL5B 4C9DA 2MB0B 1NZ8A 4FYYB 4DDFA 4C8OA 1HL6A 1PILA 4L73A 1VBKA 4GC7A 1EQ0A 4DL6A 2W4CA 3DU6A 3KXDA 1TK5A 1I94F 5E33A 2PA8D 4BWJA 4DR2F 3OR1B 2RQKA 2W9BA 1UMJA 2C42A 3PXGa 2H54B 3HVAA 2NPFA 5EX3A 2E9ZA 5C25B 2XEXA 1UWBA 5ETRA 1CPZA 4L72B 2KVIA 4LF8F 4UOHA 2JEJA 2NSCA 3KHHA 3K5LA 5B0EA 4E98A 1J5OB 3AXMA 2VASA 3IWXA 1U6BA 2ASJA 3T19A 3DXSX 2BDPA 2GX8A 2DH8A 2GAHC 4DV2J 4I7FB 3M6VA 4MH8A 3VGTA 5K8MA 2QMXA 2LU1A 4BDPA 4IQMA 4C8NA 2CQGA 3OL8A 3JTPA 5B0CA 3Q8QB 3HHLD 1M5SA 4NLTA 2UUBF 2HGLA 1HR0F 1VFJA 4XDCA 1S6PA 4DQRA 1SJRA 3R8YA 3ZZYA 1R3NA 4PKDB 1F0XA 2RJZA 1VS3A 4ICLB 5H9EJ 4IRDA 5BXIA 1T03A 1IR2A 3A1YG 2IJNA 2PEHA 4V19X 5KOWA 3L7UA 2ZH6A 1LK7A 2NUUG 2OGUA 4KB7A 4MK7A 2XS2A 4PXCA 4JI3F 2M52A 1VQ7S 1VK3A 3R2DJ 3PRBA 3R7BB 4CLTA 1Q0NA 4USWA 2B9YA 3S6EA 1QUPA 4H4OA 3BPDA 3QPIA 5I3QA 7FD1A 2RDDA 4OZNA 2QT7A 3B78A 2OFGX 3C15A 4F25A 2YWGA 1IBKF 5I3UA 3CC7S 4CTAA 3PY8A 1P1TA 3EWGA 5DDPC 1REVA 2HZVA 3R5CA 4YDDB 5HVGA 4Y00A 1CS4B 2LFVA 3QYYA 4J5OA 4Q8FA 8ATCB 4M5DA 2J6TA 3UR0A 1URRA 4QIGA 2RHQB 2XZWA 2UU9J 1Z2ZA 2HWIA 4IR9A 3IR5B 3N9UC 1T02A 4LRBA 3B82A 3TZZA 2IAJB 2RB7A 4HHHA 3ISZA 1QUVA 1WKKA 5MLCV 3J7YI 3FBEA 5FD1A 2RUSA 2J6SA 1DQAA 2VG5A 3N6LA 4RW9A 4RU2A 5ETVA 1M5HA 4ZPCA 1XERA 3QJJA 1NJWA 3CDWA 2MQ8A 1S49A 3N79A 1U6FA 2YKNA 4PABA 4RUAA 5K14B 4E8UA 1VQNS 4YUDA 1Q79A 2C3MA 2LA6A 3M32B 2QFJA 2V9WA 4N8OA 5CYJA 4DV6F 4IFVB 1R0CB 4N7TA 2YWHA 4ELVA 2IMOA 4G1IA 3SDEA 2NXUA 4JI0F 5CYMA 4HH0A 5KT4A 5KFXA 2VL1A 4DPUA 1RTJA 4ES3A 4G1PA 2BKPA 4LRAA 3UO0A 5E3AA 1R8PA 3VAGA 3O8WA 4BHQA 2NQPA 4OJHA 1F9FA 4B3MF 4EEYA 4LF6F 1CJTB 1X0PA 2HQIA 1TL5A 3VHQA 2QA4S 2OMLA 2A0FB 1YDLA 4W92B 1KQKA 2ERRA 3CJQA 5KFAA 1D3WA 4USKA 3W5YA 2R8JA 1BQXA 3J7AN 5IQQA 3H5SA 1R43A 1T8EA 5KFKA 2D3OR 2H3EB 4L3NA 4L75A 2OELA 4AXJA 5KG0A 4MK8A 2FHJD 5IXUA 2JLFA 4MKBA 1RZMA 4RW6A 2GMHA 3MEDB 1S5ZA 3W5XA 1TMMA 4X4RA 3AQOA 1RP5A 3HFKA 3ZZTA 4CLUA 4C6AA 1NDCA 2FZGB 2ZC4A 3IAM9 5EUHA 2J76E 3EUNA 3OFFA 2UUTA 2VFVA 2EFQA 5H9EK 1N5QA 4HT5A 3DI6A 4DV7F 4AFFA 2QSWA 1UVMA 4NEYA 4DR5F 3K8VA 2QLXA 1BMQB 3MMCB 4WFAQ 2VHGA 2V2QA 5AJ3J 3SSQA 2G2OA 3JSBA 3RW6A 1S57A 2HS0A 2LXUA 3WZ0A 3K58A 2HEKA 5KT7A 2VUGA 3DKDA 4UTGA 3PKMA 1S76D 3M9MB 1YJTA 2IVYA 4B3SJ 4QPTA 3P3DA 3MM5B 2G0IA 1H7WA 1UZHA 1HBNB 3M9NB 1WJ9A 3J80U 1YJ7A 4B9LA 2GIQA 1HNIB 3QZ7A 2F40A 3QMQA 1AYEA 3CC2S 3SSRA 3RJMB 2VFTA 4LFCJ 1SV5B 2M8HA 2JEFA 4LVOP 3Q8SB 4FS2A 2KFNA 3OR2B 1Q8LA 1VQPS 4KC5A 5GMEA 1LWXA 2XMKA 3FSIA 2XG8A 2MZRA 1CULA 3H5XA 3CW2C 3I6PA 3CD0A 2DEIA 5D0EA 1LW2B 3L4BC 3GPAA 5F0WA 1VIXA 5T7LB 3R5AA 1N52B 2I8EA 1HNVA 2LMIA 2XWYA 2XY7A 2CQPA 2YWEA 2DB1A 2W4DA 1UFLA 2C2ZB 3MGJA 1HW9A 2KN4A 6FDRA 2XYHB 1K1SA 3TJAA 4WZQA 1HI1A 1P1LA 1IKWB 1HMVA 1ZM9A 2XSJB 3UCZP 4P2XA 3M2VA 3D0GE 3AA8A 3CE8A 2VC1A 3PRVA 3J81Y 2GCFA 3UPFA 4DR7J 2MGZB 2IRYA 4LJMA 5HVHA 3TUPA 4WWSA 2R3VA 1MMDA 1IKXB 4DR4J 1PC5A 3RB6A 2KFZA 3DHXA 2HHTA 2JLEA 3NEKA 4AQYF 2KG0A 5AXMA 3AJ1A 4PYAA 1K73T 3HJFA 4K4WA 3FSYA 4ZPTR 1X9WA 3TJ9A 1Q78A 1V9OA 4PR6A 4UF4A 2WVBA 4LRCA 2UVRA 1CLFA 4U96A 1T9UA 2YPZA 1MMNA 3ZZ0A 4MIWA 4OX7A 2RU3A 4UUWA 1ACMB 4BBYA 3KLEA 3AA9A 3TARA 2HK2A 4PRFA 2IDEA 1U47A 3SEOA 5KFYA 1CQNA 5LL6d 4IR1A 4C0HA 3UDVA 1RT4B 3DLEB 3A8KA 2AYEA 5L9XA 5J2QA 3QGGA 3MD1A 2KRBA 4Q7AA 2OAUA 1WOOA 3W7BA 1R31A 4O0IA 1HNXJ 4ED4A 2I5JB 2CQDA 2Y9HA 1RTIA 1RT1B 1U45A 2LQ5A 3OR1A 1FWLA 5BYSA 1XC9A 3C8YA 4RW4B 2YQ1A 3TOQA 3HHDA 3GG1A 4U8YA 2R42A 3OUYB 3KK3B 1DAXA 2XMTA 1G6BA 5C25A 3POTB 3EMTA 4FKXA 1WTBA 1GH8A 2KJWA 3HVRA 2OTJS 5K8OA 3CCVS 3KLHB 3PO4A 5L8RC 4R5PB 1MG7A 1VHFA 4LUBA 3THTA 1Q7LB 5HLFB 3CDBA 3TO8A 1VQ4S 4C3LA 2X1AA 1V3ZA 2U1AA 4QIFA 4I7FA 4Y2KA 3QT6A 3W60A 3OTOF 1FNMA 5GAHI 5DGAA 4L6V3 2FJXA 3FZ2A 1JJHA 1HWUA 1L3KA 3QSYB 2V2VA 1S6UA 2XWXA 4CT8A 3V4IB 2WSCC 3HSJA 5IT9U 5H1SV 4K4ZA 4N56A 1NPKA 3Q0AA 5K8NA 5CQGA 3BGUA 4ICLA 5U47A 3RAQA 1NH8A 2QL7B 2EI5A 3K59A 1L3VA 1VQKS 1GTHA 5HP1B 4MKVA 2RS2A 2LQBA 4WXOA 1X0FA 1LFWA 4FYVB 1N54B 4DUYF 3M2RB 3R27A 5DG9A 2R7QA 2QGFB 1NDKA 2AHOB 1SVDA 1UVIA 3SCIE 5D15A 4G65A 4URGA 5CABA 4NLXA 2HURA 2CQBA 3ISNC 2PMWA 2MQPA 1IQZA 4JI8J 3BB5A 2MMYA 2MSSA 2X3DA 1KKHA 3KMQA 4DFJA 2C2OB 1CS4A 3HK2A 3OTBA 3UDEA 5I42B 1TVRB 4CRJA 5LMNJ 3C14B 4J9NA 1VJQA 2MPUA 2IAJA 3FUYA 4USJC 2ROPA 2XLJA 2FC9A 2DHGA 3RRGA 4LQ9A 1RAGB 1CJVB 2HFZA 1U8WA 4KPCA 5LOQA 2ZH9A 1RBOB 1F2HA 1LNQA 3KG1A 4B17A 5B0DA 5EGYA 1Q16B 1FKOB 2DGVA 2HBZB 3M8PB 3CCJS 3R1HA 1B99A 1VRUB 3D66A 4O0NA 2FC8A 2E5LF 4ZVOB 1WTFA 2JC0A 5K14A 3HZGA 1SL2A 5F8MA 1FE4A 2ZBPA 2IYGA 1S4FA 1SC4B 3M32A 2R7VA 2W1BA 2CQ3A 4IFVA 2I38A 5HMXA 5T41A 2DISA 3ZTOA 4XPEA 4DLEA 4LF9F 4KGZB 4C7QA 2JVRA 1OYDA 2ZBQA 4N47A 2HIYA 3ILLA 1GFWB 3C6TB 3GONA 3JAMU 3A13A 4ES2A 1K9MT 4CNYA 3AJ2A 2P6TA 3QIDA 3T6JA 2HNZB 2ZM6F 2MKCA 5IZHA 2OSRA 2FUG9 3CC4S 2JLGA 3GJQB 3ILOA 1SJQA 1YBUA 1IWAA 1CJTA 2D9OA 3HVTB 5B0BA 1VI7A 2MLXA 3L3CA 4GKJF 2J7KA 2MLYA 1WI8A 3KDNA 2BMBA 2EPIA 2W2NP 3PR5B 4FF3A 2A2DA 5KFZA 1FJEB 3FEZA 1WHXA 1PJ5A 4V1Ak 1TK0A 2L9DA 2IY5B 2VIHA 2XMUA 2CXEA 2BOPA 1VLYA 2XY6A 3RAXA 2RNEA 3GTYX 3MEDA 4ZCLA 2HPUA 2YX1A 2FHKA 4ER8A 5C2CA 2VKRA 2RF2B 3MECB 4ENOA 1RAOA 4OYIA 4OFZA 2QLWA 1JX4A 3EGNA 2EBEA 1EIYB 1TFWA 1G1XA 2V68A 1VQ9S 1NDPA 1YK9A 2QJ3A 1Y0HA 2Z0GA 3O5TB 1PGZA 3LPEA 2CQ4A 4UOGA 4WP9A 3AOAA 3GYGA 3Q86A 4PPDA 4EZ9A 3FZBA 2B51A 3MMCA 2BE9B 4NLPA 3BO3A 1Y5IB 1UVKA 2OPRB 1B0PA 1UEVA 4ZPVR 3RB3A 5ETKA 1NJYA 1YGYA 3OW2R 5J1EA 4TQRA 5C24B 3Q24A 1HNZF 1IJFB 1FESA 2X1GA 5A8WA 4I2QB 2UUAJ 4X4PA 2W7OA 4GVBB 3KLVA 1TR0A 3GIJA 3UCGA 2AEFA 3MM5A 2R8GA 3JS9A 3K5OA 4QJVA 1HBNA 2HNDB 1WSVA 1HNIA 1MWZA 4N41A 1UVLA 2OHDA 5A0YB 2J7UA 3FGVA 1PYSB 2HHPA 1SV5A 1U0HB 3A8JA 5IM0A 3IWNC 2LQ9A 5AXLA 1HBOB 2YWKA 3MM6B 3OR2A 4TY8B 2IA6A 3CTRA 3NGKA 1TAUA 2YBVA 3VAHA 2VDHA 3C16B 4DV3F 3MR3A 3OFHA 5HMYA 1OQ6A 3PZPA 1LW2A 1HYSB 1EP4B 4P73A 5T7LA 2IA0A 2ACMA 3G8QA 4XPCA 3OJSA 2HFUA 4MYTA 2LDIA 8RUCA 2GZOA 1TFYA 4YR0A 3AB4B 4ZCMA 2DR6A 4NXMJ 1N33F 1X4EA 1YRUA 2B9WA 1PYTA 5F9LA 2GV1A 1RXOB 4IOCQ 4A8QA 2B9EA 4CDIA 1UEUA 4ZVFA 2LEAA 2KT3A 2PFDA 3D0HE 2MQMA 1RHKB 4NCGB 1IKWA 1WI6A 4PXDA 1Q53A 2G0JA 1CBKA 2XSJA 4LBHA 2E9RX 4DPXA 3IBFB 3WC0A 2L9WA 1RLDA 1HARA 2YKOA 1N34F 4IO1A 3ENWA 2MGZA 2W9AA 2PI4A 4MIBA 4NLWA 2QA2A 3MTJA 4UZBA 3QGPA 2RQMA 2BQRA 4URQU 3T1AA 3WDOA 2NXEA 3BSCA 1N88A 4F4ZA 3P96A 4F4XA 4RBUA 2WCXA 5DDQC 5KFUA 1IKXA 2N3LA 5GADI 1D9DA 2C3OA 3VVUA 1FT8A 5KG1A 5E5NA 2C1EB 3KUHA 1FDBA 4L76A 1AB8A 1VHIA 4KE5A 3CCLS 5HBMB 5HMWA 4IQXA 2KH9A 1KVIA 1RHRB 3G96A 5KG7A 1ZM2A 3GYNA 3ZTPA 1FX2A 4JI7J 4ZJLA 1EQMA 1HPZB 1RWPB 3DYAB 1YJNS 5ETMA 2MKSA 2KDOA 3HFZB 4Y2MA 1HHQA 2QLFB 5HL7Q 3PIOQ 1Y3JA 2HRYA 1H74A 2DNOA 3HFVA 3EZUA 4OJ3A 1T95A 1RT4A 1FKPB 5CCLA 3MMBB 3DLEA 2XMJA 2VFSA 3WIVA 5KFPA 4Z7CA 2XCPA 2QO3A 1I94J 2ZDOA 1NKCA 3W9JA 2R8IA 4C3KA 4DR2J 4CIOA 2FJDB 2YQ3A 1RHQB 3OPKA 1A6LA 5HN0A 2E5HA 2J9EA 2RDIA 3D9BA 4KGKA 2I5JA 5EX0A 1RT1A 3TYTA 4LF8J 4OMFG 2OPPA 4RW4A 3I4PA 1KVJA 4DF4A 1XNRF 3BGRB 1ROFA 2EXUA 3OUYA 3KK3A 2W24A 4C8ZA 1VRTB 2HFNA 3HJVA 3POTA 1B7FA 2QV6A 1NPPA 4OYPA 2QL9B 3KUEA 2IFXA 5D4LA 2N7YA 1UWAA 3KLHA 3MD3A 4R5PA 2C3YA 2NPIA 3UCUP 2I6WA 1QY7A 3T1YF 4ZOSA 2JL9A 5HLFA 4DMZA 1SB6A 3NNAA 3GR1A 1TZ0A 2W2QP 3ETOA 2UUBJ 2D69A 1HR0J 4FZVA 4ECVA 2AEMA 1UVNA 4LF7J 1IVZA 5C7PA 2B8QA 1KDNA 3MZIA 2ZVIA 4DV2F 1H2UX 5ITHA 3N6NA 2GJIA 4D3GA 1ZTWA 3MXHP 7FDRA 2BBEA 3OVBA 2KYZA 2OEKA 4N5SA 4O3NA 4LT6A 1U2CA 3V4IA 3OL9A 1GXTA 2QRRA 2KZMA 5CD4H 4KFBB 2WAQD 4OHWA 2Q3PA 4J9RA 3TP2A 2JFKA 1BLUA 1IBLF 4QW8A 4UY85 1H7XA 1GMWD 2EBGA 4FYDA 4LR8A 2B0GA 2DCLA 3GV7B 5HP1A 4MIAA 4M5GA 2VODA 1P6TA 1IBKJ 3LGMA 4U9RA 1Z4UA 2G9OA 1GQEA 1QTNB 3UVJB 5THWA 1T9XA 4UW2A 2ZZNA 3M2RA 3UR3C 2HHWA 2LQJA 1Q95G 4X4NA 1U2FA 3HULA 2CQCA 3SIPB 4DX8H 3DLKB 1D0EA 3T9NA 3IBCB 2A18A 1QE1B 4MYUA 1FJCA 2CWKA 2F4FA 2Y3YA 4U67Q 1RWUA 1XNQJ 3TAPA 2OI2A 3GIKA 5E3RA 2IBKA 2H1YA 5I42A 3HT3A 3R5JB 1TVRA 1PAEX 3DGVA 1NZAA 1S0NA 3KLIB 3C14A 2HIQA 2V4JB 1FXRA 2HVHA 4U7CA 4CH7A 2MDAA 3A8EA 3P5BP 1WACA 5B0AA 1HD0A 1CJVA 1RSCA 2E7WA 2F1FA 4M5JA 2HHXA 1J5EJ 2PE8A 1WEXA 3LTOA 3FBCA 3WQPA 2Y1LB 1NLKL 4K0KJ 2MHNA 4PPZA 3CULA 1FKOA 4DV6J 1WF2A 4QIWD 2RD5C 3IG1B 3TAMB 3A8IA 4C0OC 1NU4A 1VRUA 1H2TZ 3Q2TC 1A9NB 4JI0J 4V19J 4K4VA 2CJKA 1IR1A 5GMKa 3PR4A 3UW1A 1B4SA 1RA7A 4K4YA 4ID5B 1VC0A 1DFDA 4RWXA 3RZAA 4O4GB 3IA0A 2CQHA 4OQJA 1P27B 3EPIA 2XMAA 1U1RA 4EFAC 4B3MJ 3C6TA 3IM9A 4LF6J 4YB7A 1PAUB 2H4YB 3D3BJ 2W01A 4DV4J 4BS2A 2HNZA 1ZH5A 2RRAA 1CC7A 2LXFA 2ZUGA 3CSKA 4CYUB 4YHHF 2Q6BA 3HVTA 4H4KA 3MAAB 3LWLA 4QU7A 2AJ0A 4U7UK 1CJUB 2XSFA 3WIUA 3O6QA 3K5PA 1J27A 2OPQB 2HRTA 3BDEA 2ZEJA 3G6XA 2FGCA 1R8AA 4KHRA 3H90A 4P7VA 2GIRA 3CXCR 3V4MA 3L95X 2AZ1A 6FD1A 2RF2A 3MECA 4D3HA 4DV7J 4I56A 2AJ1A 3TVYA 1QD1A 4DR5J 3H20A 2KHDA 4CCHA 4HVZA 2L3MA 3EE3A 4LMZA 5D3GB 2FVPA 1ZTTA 5J2NB 3N01A 2CUYA 2PA3A 3MCSA 2X1FA 4IG0B 2HMIB 2VH7A 3NXZA 3QAEA 2KKHA 5HJYA 3SCLE 3NNHA 2FY8A 2OPRA 2MY8A 2XNQA 1S6QB 4TLRA 2WSEC 3I96A 4DSFA 3NRBA 5C24A 3GG0A 2R7XA 3NCPA 3P5TL 2KT5A 5FLXY 4I2QA 4TN2A 4GVBA 3D68A 4DLGA 3BF4A 1T9VA 2DR7A 2IRXA 3PHEA 3VZHA 4CH0S 1FX4A 4JV0A 1FWKA 1HBUB 2XMVA 2HNDA 2C3UA 2DKOB 2SXLA 5ETLA 4J9MA 2ROGA 4B3SF 1WC0A 3KG4A 1DY3A 5A0YA 4QR1A 4USIA 3ZZPA 2KO1A 3KDOA 1U0HA 2DNZA 2DXDA 1C2PA 3T1HF 2A1BA 4IRKA 1HBOA 4WKRA 4HTJA 3MM6A 4TY8A 3BGLA 4DWIA 4DFMA 3ENQA 3HXMA 4F4WA 3RTVA 4NA2A 2EG1A 2F7VA 3DDIA 1L3TA 3C16A 2D1CA 4FF2A 1JXEA 2F8EX 2GJFA 3D6TB 1K44A 2RDJA 3LGNA 2CPIA 4DCOB 3GV5B 2AEJA 1HYSA 1EP4A 2ASYA 2CG8A 4YN3B 1TELA 3K17A 5L46A 2HYIB 1CJKB 1FFWB 2ZJQQ 4TVAB 4ZN3A 2VF3A 5L9NA 2XY5A 4ECXA 1HHTP 2FYXA 4K2JA 5L1JA 2HFOA 2ZNZA 5FIIA 4ECTA 2FGOA 4NCGA 2QYGA 4LF5F 2DNQA 1M5OC 5KT2A 4OX8A 2QN6B 3K89A 2JZ5A 2FLOA 2VZ9A 2M9KA 4CM2A 3M6XA 1XEZA 4AQYJ 3GU0A 5K8PA 1JXVA 3DC2A 3TEHB 3CCRS 3NMAA 3CCTA 2YVSA 2GGPB 1QAYA 4TLQA 3R6LB 2XZTB 3BN4A 2AT1B 4HHJA 4DR7F 2DR9A 2AV5A 2EFOA 2DGOA 4FKYA 4DV5F 3JSRA 5KG2A 3A12A 1QSLA 4DSJA 3QSIA 5HBMA 2JX2A 5D6GA 2OPSB 2R7TA 4EK2A 5CH7B 3PNIA 1E6YB 4K7QA 1HPZA 2V4QA 3DYAA 2H65B 2F9JA 3AOBA 3J81j 2GHPA 4U8VA 4Z7YA 3X3UA 2V8DA 3VGUA 2MZSA 4ETXA 3QQCD 1SL0A 2BANB 1HD1A 3BYPA 1FKPA 4HYKA 3MMBA 1W26A 3PM9A 2Q43A 3MPVA 3JSMB 4ZCIA 2BW2A 4M94A 1TU0B 2G4BA 1TUGB 5ETQA 1HNWF 4F3MA 3NGRA 4NA3A 1AUSL 5RUBA 2F9DA 3N5FA 4DR3F 1DRZA 4JV1A 2YH0A 4A8WA 3GP9A 3PYDA 4FXWA 3SFGA 3M7VA 1FF2A 3OLBA 1K0VA 3MEGB 3CDEA 1FFGB 4WIIA 1NHKL 2DXEA 3BGRA 2VJVA 1LOUA 4ECZA 4YDXA 4A8YA 5KFGA 4ZS6A 1RACB 1VRTA 1SJ4P 3DU5A 5IOLA 2LECA 4QW9A 3VAKA 3MM7B 1HHSA 4A47A 4I2PB 3OV7A 2DD8S 3OTOJ 2NXCA 2HVIA 4RO0A 1UA0A 2U2FA 1TQLA 4CZCA 1IBCB 4B3OB 4P72A 4OYXA 1M5KC 4O44B 4UQGA 2Q6CA 4P52A 2LEPA 2ZH7A 4OI2A 2CNKB 4OYOA 4OI6A 1RHJB 3IN5A 2ZNYA 3OHBA 2PT0A 3ZNUA 4P75A 1B0TA 4CO2A 1ZZFA 3LP2B 1S7IA 2OMOA 4KFBA 4NX9A 4R8UB 1JLCB 1LFPA 1RAAB 3NG8A 4WKYA 5J2PB 3UI3A 1D8YA 4AD6A 3VGVA 4YY3J 4LSLB 3K7RA 4X4UA 3VWSA 4CO0A 2MY7A 5B0FA 3IXQA 2B9XA 3UVJA 3CJ2A 1RYSA 2CYYA 4M8LA 2XMMA 4YS2A 4ZJQA 2R2RA 3H4DA 2UXCJ 3DOKB 2JRSA 2Y8WA 5E41A 1T3OA 4Z37A 3EM1A 1U1MA 3DLKA 5B7WA 4DG1B
chains in the Genus database with same CATH topology
2V2KA 3U1MA 4ES1A 3MFHA 1QE1A 4YR3A 1UP1A 1PC5A 3I4HX 3RB6A 2KFZA 1JIHA 3DHXA 5D78A 2YH1A 1BY9A 2JLEA 3FNNA 2HHTA 4PQUA 4AQYF 4FPRA 3ZZOA 1TKTB 5CA5A 2KG0A 3OTEA 5AXMA 2YNGA 3AJ1A 1HWKA 1L3SA 4GO5X 3OFGA 1V3SA 1K73T 4R0JA 4K4WA 3HJFA 5KFDA 3FSYA 4ZPTR 1X9WA 1Q78A 4LIRA 3K2YA 4JV2A 1V9OA 1FVQA 4PR6A 2KJVA 4RNOA 1TKXB 4USHA 5LXRA 2FVRA 1IKVA 1VJWA 5F8GA 1AROP 1GXUA 2UVRA 4TU8A 3H4BA 4ED1A 1CLFA 4AL7A 2OIHA 3ICLA 3KLIA 2V0NA 2JSXA 4DSEA 2V4JA 1AW0A 1MMNA 2I1RA 3ZZ0A 3MOZA 4MIWA 4OX7A 1P8GA 2K7KA 2RU3A 3CUNA 2ASDA 2EW9A 3TA0A 3DRXA 2DR5A 4UUWA 2X1BA 3SXLA 5KT3A 1VC5A 2BRLA 2APOA 2W25A 1SJ1A 1C1CB 3CJ0A 3DRRB 4BBYA 2ZJPQ 3KLEA 3AA9A 3TARA 1GNKA 2ZH3A 3NAHA 4PRFA 3MURP 2FVSA 2AGQA 1S77D 4WCEQ 3NP5A 1XMBA 4PG6A 5LMNF 1UETA 4URSA 3SEOA 2E5JA 2GC8A 4FNIA 1KFSA 5KFYA 1CQNA 2HLTA 1HWIA 4ZPWR 4NMLA 2D7SA 1U6ZA 5LL6d 4IR1A 1LWEB 4C0HA 1KNZA 4TXSA 4QWEA 1RT4B 3BQ1A 2DIVA 2O67A 2NR0A 2DNLA 3DLEB 4ILLA 2AYEA 3HMJG 5EWEA 4DL5A 3I9V9 2VKZG 5L9XA 4YMEA 2KXFA 1BQNB 5J2QA 3PX6A 1VQYA 3UQSA 5HQ8A 2JH3A 3IG1A 2ILYA 3QGGA 3TAMA 5A6PA 1N6QB 2FJBB 3W2VB 1IBMF 1F2GA 3NLCA 5DRKA 5KG5A 1FNOA 3BM7A 3MD1A 3GIMA 2CG4A 2IM0A 2KRBA 1KTVA 4O3PA 3SMZA 4DL7A 2F8MA 4Q7AA 2JOQA 3QWPA 2OAUA 4C2MA 3W7BA 4GC6A 1R31A 2BE2B 3FQKA 2EFNA 4NWBA 4O0IA 4WXWA 3GFZA 3CB4A 1UL3A 2R8HA 3PW2A 5M2UA 5CXTA 4PWDB 3MR5A 2I5JB 2CQDA 3X1LB 4B02A 1HQEA 2CVIA 4CNZA 1RTIA 4ID5A 1U1QA 1RT1B 1N36F 1U45A 1OSDA 5JJBA 4O4GA 2LQ5A 4LSLA 5LXYA 1JNZB 3OR1A 3G6YA 4XK8C 5BYSA 2ZHOA 4DS4A 1SIWB 1XC9A 1WEZA 4ZA1A 3QGHA 4WFYA 3T3FA 2COLA 2WBMA 3C8YA 3MM8B 4RW4B 3TOQA 1LW0A 3HHDA 2A2CA 4QR0A 5G0RB 3GG1A 3DXBA 5AJ3F 5KTQA 2RQCA 3PFOA 1ULRA 3OUYB 3TAQA 3KK3B 2CPYA 3OLAA 4JYAF 1DAXA 2XMTA 2M70A 1G6BA 5C25A 3POTB 4H4KC 1NH7A 1VMBA 4ZVGA 4DJBA 1S1XB 4QCLA 1D9AA 2VC0A 3MMAA 2DNYA 3DDKA 4AL6A 2BM1A 4TU7A 1WTBA 5D3GA 1GH8A 2KJWA 3WBZA 3HVRA 2OTJS 3UDCA 2NLWA 5K8OA 2XBPA 1S1WA 3O3LA 3KLHB 3CCVS 3PO4A 3DNCA 3JB9k 3AY0A 4HL9A 5EWGA 4RX6A 4ILMA 4NPOA 5J2MB 5L8RC 4R5PB 5F3TA 1VHFA 2P9GA 1KTQA 2M88A 2UV8G 4KV8B 2MHEA 4PQAA 3SQGA 2KT2A 1ZBTA 4LUBA 3THPA 3THTA 5LJ3Y 4B9UA 3DHWC 1C1BA 1Q7LB 2ZVSA 1X5OA 5HLFB 3CDBA 3TO8A 3VAMA 1T3NA 1VQ4S 1AFIA 3I0SA 4DL3A 4C3LA 3CT9A 2C22A 2X1AA 1JLQB 1V3ZA 3MUMP 2OPQA 2U1AA 4QIFA 2ABYA 2GNKA 3SCKE 4I7FA 3K5NA 2HHUA 5LMUF 2ZITA 4Y2KA 1QSSA 1FK9B 1TKZA 3OVSA 2DGQA 1IM4A 3DMJA 1O51A 2R4FA 3PJWA 3LAKA 2L41A 4EO8A 3OTOF 1FNMA 2DNHA 2EFVA 1FRXA 2P5VA 2HHQA 1ELOA 2V94A 4N76A 3OQ2A 1XR5A 4ZPAA 5GAHI 4A8KA 3CO9A 4LFCF 5DGAA 2HAIA 4WFNQ 4L6V3 2OP5A 3RR7A 2CPJA 2FJXA 2DHXA 3FZ2A 1W25A 3NWGA 1U1OA 5L39A 1JJHA 1HWUA 1MSWD 1L3KA 1SJ3P 3U02A 4P6QA 2E1CA 3M6WA 4EYHB 1AUDA 1KEKA 1S6UA 2DH7A 2BXJA 2XWXA 2XLIA 4CT8A 3V4IB 2WSCC 1RI7A 3JTNA 2C2EA 1XMQF 5H1SV 5J1NA 4K4ZA 4N56A 3KLFA 4DQIA 3Q0AA 2CDQA 4C4WA 1KD1T 5K8NA 3DLLQ 4YB1P 3BSNA 5CQGA 3BGUA 1YG0A 4ICLA 2RVJA 5U47A 3MF5A 4NLYA 3RAQA 4A8MP 5DS7A 3GWCA 1NH8A 4AXIA 4IUFA 4YOEA 2BACA 4QWCA 2OH2A 4ATNA 1F60B 3CJ3A 4CT9A 1R89A 2QYCA 2EI5A 3K59A 4Y65A 3FMBA 1L3VA 1VQKS 5J2NA 5DG7A 2P6SA 1NJIT 2FLNA 4BC7A 1GTHA 2PSZA 3H2VE 3C6UB 3G6ES 5DO2A 4DUZF 4EBDA 5HP1B 3GFYA 4IG0A 2HMIA 2RS2A 2LQBA 3KK2A 4YEAA 4WXOA 1X0FA 1KR4A 2MYFA 4G1QB 5K5MA 4KJIA 5CCMA 1R0AB 1LFWA 1RISA 1HI0P 3CD6S 3OL7A 3V6JA 1RTDA 3U1LA 4DF8A 3MR6A 2LU2A 3CCUS 1S6QA 2WTFA 1N54B 3HHEA 4DUYF 1MW7A 3M2RB 2FHMA 1TUVA 3DLJA 3R27A 4FVCA 5DG9A 2R7QA 1YSJA 4WYLA 4I6YA 2J6UA 3HHKA 2CQ2A 2DO4A 1NK0A 5F41A 4X66F 2OLWA 4X4TA 5IT4A 2CPZA 4WFZA 4CO5A 1UVIA 3SCIE 3AB2B 4C8MA 2IVFB 4URGA 2Y1RI 3F56A 1LXJA 4NLXA 4F26A 2MJUA 2KTQA 4JI6F 2C28A 5D4OA 3VQTA 2B7BB 3JSYA 2CQBA 3ISNC 1NO8A 2MQPA 1QAIA 1IQZA 3PW0A 3BB5A 2MMYA 2MSSA 2J5AA 3TX8A 4B9MA 2E29A 2ZZMA 3KMQA 4A48A 4DFJA 1HBUA 5HMZA 4NYOA 1U8SA 4RNHA 2N7CA 2UUAF 3KMSA 3CCSS 5LSOA 3HK2A 2Z8QA 3OTBA 2B4UA 4HH1A 4M95A 4IKAA 4NRTA 2AD9A 1RTHA 3DM2A 5I42B 2RUGA 2ASLA 1G3OA 4RW8B 1TVRB 2J9DA 3PKYA 4KKOB 4DR4F 5KFVA 4FF1A 1CQMA 3RRHA 3P6YC 2VQEF 5SUHA 2VPZB 2UUCF 1F5CA 3RBDA 4LSNA 3HPOA 4K4TA 2GHWA 2MKKA 1N5YB 5IWAF 4J9NA 2MPUA 2RU9A 3RU0A 1QSYA 4HKQA 1RGVA 2IAJA 4ALZA 4TKTA 1FK9A 3MEKA 2G0CA 4F8RA 4ED2A 1YJUA 1LK5A 4H4MB 1X4BA 3LP0A 2XGPA 2D74B 3FFIB 3BR9A 2ROPA 4USJC 4B9SA 2XLJA 2FC9A 2DHGA 1DTQB 3RRGA 4PG8A 2GO9A 2LCWA 4LQ9A 3KLGB 2AX0A 3H2UB 2HFZA 4J9KA 2Y1IA 3HM9A 2ZH9A 3OXGA 4NZ6A 4JV5F 3KWMA 3IBWA 1S48A 1RQ0A 3MUVP 1YRTA 3EXYA 3KG1A 4B17A 1WHVA 5B0DA 3B8HA 5DQGA 2LKZA 4WYWA 4DR6F 2FIUA 4WE1B 4MMOA 4Y3CA 5EGYA 3J7Z5 2R2UA 1Q16B 2B3TB 4Y28C 3I0RB 2IMWP 2CIMA 1U26A 1FKOB 1DQ9A 1HFEL 3G6VA 2B43A 3BQ0A 1UFWA 5GAGI 2DGVA 4NL5A 4QBUA 3M8PB 1OWXA 1Q86T 3CCJS 3R1HA 1VRUB 3M9OB 1JLFB 1X8DA 2FC8A 4UUXA 2E5LF 1X9MA 2HNYB 4QQBA 3M1VB 4YB5A 2AJ4A 3LALA 2V5HG 3QGIA 1WTFA 2JC0A 2ZFHA 5K14A 3HZGA 3CDUA 1SL2A 2FDNA 4HDGA 5F8MA 1F5BA 1FE4A 3DCAA 3EYZA 2WRMA 4NA1A 2IYGA 2E44A 1S4FA 4HTIA 3M32A 2QE5A 1T05A 2R7VA 1IQTA 2CQ3A 4IFVA 3ENVA 2I38A 1Y7PA 5T41A 5HMXA 1GX5A 2DISA 1Q4RA 5KFCA 3KYLA 4XPEA 5J1EB 4DLEA 2VPXB 4LF9F 3BJYA 4C7QA 1S1VB 2JVRA 2UP1A 3CCQS 3PV8A 4Q0BA 1K1QA 4N47A 3M30B 2W9BB 3FRZA 4DFPA 2VOPA 2XLKA 3MAQA 3UD3P 5C5JA 5A8WB 5F8HA 1HNXF 4X62F 4DSIA 2DR8A 4ITSA 3C6TB 2XS5A 2IHR1 3T9ZA 1K9MT 2BA9A 4ES2A 4FN5A 1FKAF 4CNYA 5KFHA 3PEHA 1X9SA 1IN0A 4WK1A 3AJ2A 2P6TA 3QIDA 3T6JA 2HNZB 3IWLA 1UWBB 2PFFB 1JLBB 1V3RA 4TNOA 3OXLA 4IFYA 2ZM6F 1UJ4A 2MKCA 5KFTA 5IZHA 3ITHB 3QZ8A 5GAHU 2OSRA 2HHHF 2FUG9 3LP1B 3CC4S 3HHLB 3RAMA 2MKJA 1NK6A 2JLGA 2J0QD 4X84A 4IH7A 1SJQA 2ZH5A 1DZ5A 4C0BA 2D9OA 3HVTB 2GGPA 3KJVB 5B0BA 1VI7A 2PD1A 2E7XA 1KN6A 5LJ5Y 2IC3B 1S1UA 3BS9A 3L3CA 2J7KA 4GKJF 1U7LA 1WI8A 4DR1F 1CEZA 1UJ6A 2EPIA 1OPIA 2YTCA 2DK2A 2L9NA 1JLEB 3JTOA 1C4CA 3M8QA 5IM0B 3PR5B 4EBCA 2ZDPA 4FF3A 1R6YA 2A3JA 2B56A 3K5MA 2PI5A 3GMGA 2A2DA 2FJVA 5EHHA 2K3IA 5KFZA 3OFEA 1FJEB 2QZ8A 3FEZA 4FBUA 1WHXA 5BYQA 3CD5A 3I5CA 1TK0A 2HGNA 3Q8RB 3V81A 1U2RA 2UV8A 2L9DA 2VD3A 4K4SA 2HS4A 2YNIB 2OPSA 3RW7A 3VALA 2Q79A 3E01A 1URNA 2B7CB 1Q1KA 1F5AA 2EG2A 2XMUA 3BO2A 3THVA 2BOPA 1VLYA 1X7VA 3CMAS 2XY6A 3RAXA 3KHRA 1KOHA 3SV3A 2RNEA 2R7RA 1E6VA 3QWUA 3D5MA 5KFBA 3LF0A 1U48A 1Q82T 1S9EB 3MEDA 4ZCLA 3B4MA 1S1TA 2HPUA 2F3JA 1S9GA 2YX1A 2YKMB 1S6PB 2RS8A 5E2QA 2L48A 2FHKA 3M2UB 3I82A 2B4VA 2XNRA 2VKRA 2RF2B 3MECB 3HX9A 1KLMB 4IYQA 1HI8A 4OFZA 2QLWA 1XK8A 4F2SA 4ZVEA 4IOAQ 2GQCA 3LPYA 3FJ2A 4ED6A 1JX4A 5D8HB 5CZVA 3EGNA 2EBEA 4F3OA 4X4OA 1TKDA 1TFWA 3OTCA 1KRPA 1G1XA 5KFIA 2BANA 5B09A 1QVFR 1Y4ZB 1VQ9S 1N5TA 2CJ9A 4CO3A 1T03B 1Q8BA 1JMTA 2AQ4A 2IM2A 2EKYA 3QIPB 1Y0HA 5CYQB 3DOLB 2Z0GA 2PN6A 1FHTA 3O5TB 4O3RA 1SI9A 2CQ0A 4MAKA 4OZ0A 4RBVA 3TUIC 1PGZA 1S7HA 3M8PA 3JSMA 3EZ5A 1WG5A 3TANA 4ZHRA 2CQ4A 5M2RA 2ADCA 4WJBA 1WHYA 3OJUA 2XS7A 1DLOB 1WG1A 3F44A 4PPDA 5A6WA 3D28A 4U6PA 1TV6A 2MQLA 4M1KA 4C11B 3I55S 4EZ9A 4DV1F 3UD4P 3FRYA 3FZBA 1N0UA 3DLGB 2B51A 3FCHA 3MMCA 2W9CB 2ALZA 2VA2A 4KT0C 1NK5A 4NLPA 3WC2A 3IFEA 2ROEA 3BO3A 1Y5IB 1UVKA 1M5PC 2OPRB 4ZK7M 4EO6A 1B0PA 1UEVA 4ZPVR 1N5VA 3RB3A 2X51A 4EGLA 3KNAA 1NJYA 1YGYA 3PW4A 4C8KA 3HF5A 3LANA 3OW2R 1CVJA 4H4OB 5J1EA 2N82B 4TQRA 1RT6B 3QAUA 2G13A 5C24B 3Q24A 4NLUA 2AJQA 5KG6A 2XMWA 3M05A 2DNNA 1HNZF 3NL0A 3MEGA 1C0TB 3KG0A 1IJFB 2D41A 4ECUA 5KT6A 2OJ3A 2HS3A 1FESA 2X1GA 3D1HA 5A8WA 4I2QB 4X4PA 2W7OA 4Y0FA 2DO0A 3NMRA 5I3UB 3N5BA 3KLVA 5L1IA 1ZZNA 3MM9B 1TR0A 2OO4A 4FXVA 3GIJA 1SJFA 3UCGA 3Q23A 3MM5A 4CTAB 2R8GA 1NHUA 3SV4A 3BSAA 1MWYA 3CF5Q 4OHYA 1BQMA 2VV5A 3HLUA 4KSEB 3K5OA 4QJVA 5JUMA 1FDAA 1YJVA 2RRBA 4C98A 2D3UA 4X64F 1HBNA 3H5YA 2DHAA 4DFKA 5FDLA 1JKHA 1REVB 3ITHA 1TK8A 1X4FA 4ECRA 1Z1ZA 1C0UA 3MAHA 2HNDB 3DRPA 3VF0B 5GAEI 2QA1A 3H8YA 4C8LA 3MM7A 4CO4A 4IDKA 4PWUA 2E66A 4EU0A 4YQWA 3GV8B 4F4KA 2UXBF 1HNIA 2GW8A 4OL8A 4I2PA 2CJQA 3H5UA 1O0PA 1I6JA 2VBZA 1MWZA 4WF9Q 4N41A 1UVLA 4M5DB 2VG7A 3HZEA 3QLHB 1WD6A 1IKYA 2VFRA 3BO4A 1U25A 5A0YB 3OSNA 1R8CA 2NYIA 4QWBA 2J7UA 3FGVA 1KHVA 4JI8F 2DJWA 1MNEA 2HHPA 2M5YA 5GAGU 5EN1A 2CZ4A 2CVEA 1FTCA 3U7JA 2OKQA 1SH0A 1SV5A 5A8RB 5IM0A 2IRUA 3ZZRA 2W8KA 4B3OA 3IWNC 4HI1A 2LQ9A 2WSFC 5AXLA 1FXLA 1M5VC 3FQLA 1HBOB 2R7OA 5DLGA 4O44A 2YWKA 4X4QA 1TL1A 3MM6B 3OR2A 5HROA 1VBXA 2MZ1A 4TY8B 4ETZA 3PO5A 2IA6A 3W3SA 3OL6A 3CTRA 3NGKA 4HI2A 1SUQB 1TAUA 1S10A 5F0UA 1KC8T 3GQCA 4DOZA 3VAHA 4NCBA 1WG4A 1NK9A 1EETA 2VG5B 2MQNA 4RW9B 2J0SD 4DQPA 1FRLA 3NKYA 1Y00A 4DV3F 1XTZA 4FBTA 2DIUA 3MR3A 1YJ9S 3OFHA 1HQUB 5HMYA 2Z2MA 3VAJA 1OQ6A 3L7OA 3O44A 3PZPA 2LA4A 2E1AA 4IG3A 1LW2A 4EUVA 5AXNA 3DLHA 1SBRA 4R0EA 4OHVA 1DARA 2AU0A 2YX7A 1TL3A 4QR2A 3W2WB 1HYSB 1EP4B 3PX0A 5T7LA 4RNNA 2IA0A 3J80Y 1NKBA 1HWLA 3G8QA 4XPCA 3OJSA 2FJAB<