5GAGI

Rnc in complex with srp-sr in the closed state
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
ALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYVTEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5gagI00
4NWBA 4UY85 3J7YI 4V19J 1ZAWA 5D8HB 3A1YG 3JSYA 5GADI 1ZAXA 2QA4G 5GAGI 5GAEI 5D6GA 3J7Z5 5GAHI 1ZAVA
chains in the Genus database with same CATH superfamily
4GRSA 5L1IA 1T03A 2MKJA 3ISND 2VD3A 1R43A 1Q4RA 2HFUA 3M8PB 2Q6BA 1MWYA 2KB2A 2RUGA 2NPFA 2DNGA 4C48A 3JQMA 4YFUA 4LR8A 2W9AA 4JI6J 4PQUA 5F3TA 3HVAA 5EX3A 1Q1KA 3PY8A 3OL6A 5KFYA 4RBTA 3ET6B 4L6V3 4HDGA 2JL9A 4TQSA 2PT0A 1KLNA 3M8WA 5H9FJ 2G2YA 2VBZA 2R8GA 4ELTA 3GFYA 4F3MA 3DRSA 3IRXB 3QZ8A 1WHVA 4WIQA 4LR9A 4AYBD 4KV8B 4P10A 2C3MA 4LF9F 4GO5X 1XMQJ 5CCLA 3SZ2A 1VI7A 1DAXA 5BR8J 1PG5B 4OHZA 1TV6A 4O3QA 5DG8A 3QQCD 2HZVA 1YG0A 3FCWA 1GH8A 2KRBA 3IG1A 3BM7A 4USWA 1GNKA 2XZTB 2JC0A 4CLFA 4ILRA 5IZHA 4AQYF 4IRKA 1C1CB 4TYAA 1YQHA 4EZ6A 1U24A 2KXFA 1HLWA 4RLEA 1HNVA 1YGYA 4IFVB 1LEOA 1VC5A 1SJQA 2DEJA 2HRTA 5F3ZA 1UVMA 5E0OA 1UKUA 3KNAA 2DITA 1UWBA 4I68A 3G6ES 2KFNA 4CO2A 3KG4A 2HFVA 4JI1F 2K1RA 4KE5A 3W63A 8AT1B 3I5BA 4KBIA 3L9ZA 4K7QA 3GJRB 3R7BB 4DV3F 4DBQA 4ZJLA 4D3HA 4LF6J 2NZ4A 2J9DE 4S0MA 2J7WA 1IBLF 2H4WB 2E66A 1S6QA 4LF1A 2VC1A 4DCPB 5B7WA 3MPVA 4MAKA 1NAQA 1SQFA 2LQ5A 2W9CB 4OZLA 3I0RB 3MR5A 1OQ3A 4DL7A 1X5TA 1LWFA 3C6UB 5HROA 4Y6IA 1SKWA 2IMWP 4X4QA 1N34J 3MFIA 4KFBB 2XCPA 4IRCA 2GO9A 3CIMA 3ZZOA 1S59A 1QSYA 1RKJA 1H98A 5EX0A 4N8OA 4ED7A 4KC5A 2K7KA 2MPUA 3HFZB 3Q8PB 1H6KX 4PXCA 2HYIB 4C7QA 3ONQA 3A4TA 4B9LA 3LTOA 4C8YA 1NNDA 4N77A 1S77D 1UEKA 4YR0A 2QV6A 9ATCB 1SL2A 4DQSA 3IBFB 2NS1B 2HVZA 5HMYA 1MWZA 3M9MB 1RK8A 3N28A 4OYWA 2PI5A 3SSQA 2HVEA 1HD1A 1TL1B 1A0OB 1LW2B 4V1Ak 5DQHA 2KZZA 2AW0A 2YNHA 1K73T 4LF4F 5D15A 5C2GA 2HWTA 4ID5A 2R4FA 1A9NB 1E6YB 4XDCA 4OYAA 3HPOA 4ERDA 3UDLA 3Q8UA 3I5AA 1HNXJ 4PKDB 4QIVA 3GCXP 2WVFA 3DHXA 1SKUB 2AJ2A 3K8VA 4A8OA 3CO0P 1OS5A 3NLCA 1U1KA 3M30A 5GVQA 1RYRA 1RT6B 1S0OA 2RAQA 1H2UX 1NZ8A 3T1YF 1TL3A 1X4CA 3M2RA 3CD5A 4JI7F 4IO9Q 4M5DB 2R7TA 2VQFJ 2DIUA 3CCMS 2JNJA 4K0KF 3NS5A 2O3DA 2H54B 1K0TA 1CULB 2KXHA 4ATNA 3EYZA 4KJIA 1SH2A 3ZC4A 4DR2F 2MHNA 1CSJA 5HLFA 4RPFA 4WU2A 2V69A 4A8WA 3R5GA 5G0RA 3T5JA 1TUVA 4LQ3A 1S9EA 1VQ4S 1RT4B 2CPFA 5I3UB 4OYOA 3KLFB 3PCOB 3P5BP 5H9FK 4ZVPB 2OO4A 6AT1B 4H4MA 2O01C 3K58A 3GCWP 1S76D 3H0PA 3R7NB 1IQZA 3NNHA 4OI6A 4ZCMA 3J7YU 4IG3A 3WQPA 1NUEA 1RA7A 4B9MA 2R7RA 4MFBB 1RTDB 4M5NA 1GX6A 3V4MA 4OZ0A 4DFKA 4HACA 5D4LA 3S7RA 5J2MB 1RTIB 3M2VB 3CD6S 5IQ6A 1YRUA 2YNGB 2HSEB 1YJ7A 3J81U 2DNMA 8RUCA 1IBMJ 1RHQB 3M2UA 3TVZA 1ZBTA 1VCTA 1HHTP 1ZTWA 2BW2A 4IDKA 3M8YA 2CQHA 1PJ5A 3HZEA 5C24B 2KTQA 1NHKL 3EXYA 3IBCB 1KFDA 2J8SA 3O5TB 1FO1A 5CD4H 2RILA 3R1LA 4J9SA 3NGKA 2EW9A 1M1HA 1XR7A 2M88A 3CD0A 4RUHA 3P6YC 4M8LA 4C8NA 1X4HA 2YNFB 4X4SA 4M5JA 2B4OA 4DPUA 3ZTOA 5J2NA 4CNYA 1QY7A 4USTA 1RTHA 2Z2LA 4ICLA 3G71S 1FNXH 1N6QA 4U67Q 2WAQD 3HT0A 2H65B 3POTB 3KJVA 3PKMA 4YDDB 5DZ7A 1NH7A 1EQMA 4ILLA 2XMJA 2M8HA 2VQEF 3BO2A 4NPOA 4PG4A 2A2CA 4OFZA 5DQIA 5D0GA 2MQPA 4PWWA 3K5PA 5ITHA 2P8IA 4LSNA 2CJAA 4K4UA 3I4PA 1RT5A 1WHYA 3CDBA 3TAPA 3QJLA 1HWIA 1YIJS 4CT9A 1NJZA 3G9CA 1QD1A 5JJBA 2MXYA 1TL7A 1N52B 2UUBF 3DOLA 1KOOA 1C0TB 4A8MP 5AE2A 5HQLA 2FJVA 4L75A 4C2MA 2RT3A 4CTAA 4ETZA 1HWKA 3OBIA 4TU9A 3QT8A 1M5OC 3U1NA 2PMZD 1ICEB 5CYQB 4XTTA 4JV0A 1NH8A 3B54A 2HQCA 4EYIB 3US5A 3K2YA 4F25A 2DRBA 1J5EF 5DLFA 4ZLPA 1UWAA 2WVBA 2GW8A 3MR3A 2QGFB 2B7BB 5KG5A 2G0JA 4DQPA 1JNZB 3DGVA 4PPDA 2J0XA 2RQMA 3PEHA 3J7A1 5L1KA 4WTOB 3I9V9 4HTJA 3AQOA 3DRPA 5KFWA 1H7XA 2QLBB 1RAIB 3GJSB 4G65A 4ZN3A 2OEMA 3MPDA 5J1EA 4KTQA 4DPTA 3OUYA 5DLGA 5T41A 3VGVA 2DH8A 3IWLA 3AAWB 1B7YB 5F9NA 4MK8A 3CMES 2HS0A 2VJUA 3TZZA 2UU9J 3KLHB 2FLPA 1F1BB 2IRXA 5A8RB 3TARA 4C8ZA 1RTJA 4FPIA 4X62F 2F4VJ 4B3RJ 4MMOA 2OPSB 3RW6A 1KVIA 3FFIA 4Q0BA 1Q78A 2W4CA 2UXDJ 4NCGA 1WD6A 2L9DA 2HS4A 2E1CA 2YKPA 5C42B 3NNAA 1S1TB 3OT9A 2BA9A 2BABA 3EVOA 4ECYA 1EARA 4Z37A 1IKXB 1TQLA 4DHVA 3JS9A 3GSDA 4OQJA 4QYRA 4ZVHA 3GZ7A 4WKYA 2N82B 3VF0B 1DURA 2B5JB 3VAFA 2OSQA 2AYMA 4DFPA 3OFHA 1BXNA 2MZ1A 1WJ9A 1Y3JA 5A0YB 1KONA 5ETOA 4Q7AA 4X66F 4LFBF 3HP6A 2PDAA 1DQAA 4ZPAA 4YHHJ 2AD9A 1Y3KA 4LF9J 4F4YA 4HKQA 4P74A 5J2PB 4J9KA 2KU7A 1CJTB 2QYGA 2AMCB 1VDHA 3TNVA 2F7VA 2XS7A 3DU6A 4JI2J 1CJUB 5KFJA 1MNEA 2YXLA 1VQ8S 2QA2A 4OYMA 3SYZA 4AQYJ 3BO3A 3CDAA 3L7UA 4A46A 2CJYB 2DNLA 3KUGA 1KHVA 3Q22A 3BYPA 1LFPA 4YB6A 2YVSA 2HFSA 2V94A 1T9VA 1YKWA 2PA3A 2APOA 2V8GA 3FEXB 3HVTA 5LM7E 1O0PA 3RB0A 2DNZA 3KLVA 3TO8A 3M8RA 1LXJA 3DYAA 1HA1A 2I0XA 4IG0A 3GYXB 3VZHA 5GAHI 2BQ3A 3G4SS 4NLXA 3BH6B 3GONA 2BUNA 1IBLJ 3FGVA 4JI3F 3LP2B 1VRUA 1DHMA 1J5OB 4J9PA 3DLGB 4F0KA 1FKPA 1T9YA 4Z2XA 1N4LA 3MM8A 2V4RA 4LJMA 2G2OA 4KKOA 3IAS9 1GMVA 2GMJA 2DR6A 2PA8D 1N5TA 5AXKA 3NY0A 4MKBA 2KXNB 2MMYA 4URQU 1R6YA 2CQ1A 3MM9A 1Q8BA 1RKIA 2CYYA 2OMLA 2RDIA 2ROPA 4ELUA 3N9UC 4CO4A 2E5JA 2HHHF 1P6TA 2JEFA 2F4FA 2DB1A 2FD2A 2ZC3A 4NLTA 4N5SA 2YKNA 5E41A 3ZZUA 4ZCLA 3M32A 2OD6A 1HNWF 3NAIA 3O3LA 3QRQA 2JEGA 3OLBA 2OD4A 3I56S 3TUJC 2A6OA 3R6LB 4ZK7M 2GHVC 1HD0A 4USUA 1S1WA 3VR1A 2D41A 2OP5A 2ACYA 1CQMA 5MAOA 1UVJA 2IVYA 3D1OA 3KXDA 3Q8VA 1SUQB 3ZO7A 2C2DA 3CULA 1RUSA 4FVMA 4F36A 5ETQA 5HP1B 3Q24A 4RR5A 2WVEA 3Q83A 4LF4J 2I1RA 5LL6d 1TAQA 2HS3A 1NMEB 4Q2LA 1BC6A 3QIPA 2D69A 5D3GA 4YP3A 1NSPA 4KHPJ 2JZ5A 1DJ0A 3MOZA 1Q5YA 5I42A 1Q95G 3RB4A 4DX6A 4MJKA 2CQ4A 4F26A 2XYPB 2P9EA 3M6VA 1B0TA 1KOHA 4CIOA 3T1YJ 5CA5A 1EQ0A 2DCLA 2W25A 3KFWX 4B3SF 1NK5A 3DOKA 4DL0C 2UUAF 2DNQA 1TVRA 3EPGA 3C16B 3M7VA 3IWXA 4K0KJ 1YSJA 3PFOA 3G87A 1N8RT 1IWGA 5BYRA 2H4YB 3H2LA 3IP0A 3D1QA 4KPCA 1S7HA 4BS2A 1ZOTA 4RWWA 1ZZNA 4BDPA 4ZKAA 3QT7A 3OR1B 5D6GA 4QOTA 4PG7A 1HBOA 2XY7A 2XLIA 1JXVA 2IM1A 3PYEA 1NB7A 1E6VB 1FKAF 3E8OA 1SQGA 4LMZA 3DLEB 4P75A 2ZZMA 4LIWA 2CJKA 4DOZA 2AGPA 3L95X 3JAMU 3QBCA 3O8WA 3L09A 2W9BA 4U7UD 1PKUA 1FE0A 2BE2B 1ZETA 4NL5A 2RS8A 1WKLA 5U47A 4ECQA 5CH7B 4LRDA 1C0UA 2VICA 4EUVA 1HNIB 4WZMA 5F41A 1EZZB 1F3VA 3TQ1A 1FWPA 4KIAA 1G6BA 4DF8A 3T3FA 3OR2A 5A8KB 1FRXA 2DR9A 2CDQA 4JV2A 5IXUA 4O3PA 3D6FB 3OTDA 3DGPA 2ZE2A 3AA8A 3QGHA 4WE1A 3QGPA 5DGAA 4FBUA 3MMCA 1BLUA 3LAKA 2HMIB 3E2EA 2FY1A 4EI2A 1VJQA 3IM8A 4Y00A 1Q0NA 3NGUA 5F8GA 2VIHA 4R8UA 2I5JB 3PYFA 1FKOA 1ZA2B 5AE1A 3HX9A 5JXSA 1JXLA 1RABB 4ZPTR 4JV1A 6FD1A 3B4MA 4NYOA 4PR6A 1IR0A 1VHFA 3MI7X 5EWEA 5KOWA 4JP8A 3R8YA 1FVSA 3RJMB 3VAMA 3BV8A 3R3TA 5IS2A 2E5HA 3G8QA 5K8NA 3AHPA 3MWBA 4TY9A 4I2QB 5B0AA 2XO7A 1R6VA 3VGUA 4I0WA 3OSNA 3ZZZA 3K57A 6FDRA 2GIRA 2C2OB 2XHCA 4TQRA 1T11A 3C3LA 3PJXA 3OJUA 2O1PA 2JOQA 4EBCA 4JV5F 1VQKS 2DD8S 3PJ9A 2BKNA 1F9EB 1NK9A 3PXGa 1RAGB 3NWGA 3BREA 3M8QA 1LWXA 4RW8A 2IRYA 5A2QY 4RW9B 3IFEA 2RVJA 1SC4B 1KS2A 4M63A 1TKZB 4LFCJ 2FB0A 1AA1B 2XC9A 2EFNA 2UUBJ 3Q89A 4QQBA 3UO0A 1FTCA 3BR8A 1F6TA 5LJ5Y 3VHQA 4DV7J 1HR0J 4FPRA 4O44B 1EP4B 4DV6F 3V6JA 1TFYA 2IJFA 1I51B 2QO3A 4C98A 3SDEA 2QT7A 3CDUA 4CLTA 3MR6A 2HEKA 1Y4ZB 1D8YA 3W62A 3A8EA 1M5HA 1VJWA 3J81j 2EBGA 1J5EJ 2DR8A 2D3UA 2D1CA 3W3SA 2P9CA 2FPHX 1Q79A 2J7UA 3G96A 3DCAA 4FF1A 5DO2A 3V81A 3UVJB 4ZLJA 1MU2A 2H1YA 2BOPA 3KKFA 3BSOA 1QSSA 3CCVS 1SJ4P 4IKAA 2YTCA 4ZVTB 3LP1B 2DHGA 2GQQA 1OSDA 4OV6A 4DV2F 1JJHA 5KFSA 3RBXA 1WG4A 4PRFA 3P45B 2IM3A 2Z57B 2MKKA 1WOSA 2XGPA 1BQXA 1QUVA 5KT5A 1VC6A 2Y3YA 4ZVQB 4DS5A 2CWXA 2FHJD 4YY3F 4WIIA 1UVIA 1RJJA 2B6AA 2J7KA 2F63A 2OPPA 5E3AA 3CNQP 3FK4A 4URGA 2JSXA 2YQ1A 4PUOB 3UNYA 2ROGA 1H73A 4FZVA 5KAKA 1GMWD 1DARA 2LEPA 1Q8KA 2ATCB 3BZQA 4BC9A 1URNA 4JI5F 2ASLA 3R5JB 2ZEJA 4DX5A 1YK9A 2C2NA 2VBXA 1AUDA 2N4DA 2XWYA 2GMHA 4ER8A 5F8MA 2DNPA 2EXUA 1X9MA 2QSWA 1VHIA 2DNHA 1FK9A 4QWAA 1NJYA 2JH3A 2CQIA 1SJ3P 5HO4A 4FN5A 2GJ2A 2SXLA 2MY8A 3W8GA 1HQUB 3CDWA 1D9AA 4WK3A 1U8SA 3BQ0A 4X66J 3DI6B 3RAXA 4LFBJ 3IM9A 4ILMA 1XJWB 2ZOMA 4FYXB 1RT7A 5KFAA 3AH6A 4JI0F 1XQIA 4OL8A 1GFWB 1T0TV 1T95A 3KLGB 2Y1JA 3BS9A 5F8LA 4NLSA 2V4JA 3L7OA 3C6TB 1RQ0A 1TK8A 4NMXA 1CJKA 1LWEA 3IXQA 1JB0C 2IBOA 4OYBA 2XSFA 3KG1A 3OHBA 3C15B 4AD6A 1JKHB 4LBIA 2VBYA 3PYGA 3NBPA 3NCQA 3QATA 1R3NA 1N5SA 4OI1A 4OZ2A 2C22A 4C11A 4TYBA 1Y5NB 5GAGU 1PC4A 3KK3A 3D6TB 2CPHA 3PVXA 2QA4S 3SMZA 2KFZA 2G2ZA 4FP9A 1IKYB 3NP5A 4YB1P 2IMOA 2IVFB 5KFKA 4DV5F 2O66A 2AV5A 4G3IA 3LQVA 3TZXA 1N48A 2H5EA 3MEEB 3H98A 4JI3J 2FGCA 1ZH5A 4GKJF 5D4NA 3MHYA 3RBDA 1APSA 3Q8RB 2HBYB 3D6MB 3TWZA 4FYVB 1FRMA 1S5ZA 1TMJA 5DRKA 1PILA 2ZKTA 3OSPA 5F8JA 2AZ1A 2CQCA 2K8GA 2NUUG 1ZPWX 1UVKA 3JTOA 2X51A 3S1TA 2JLGA 4DQIA 1S1UA 3O6QA 1HNZF 2N7YA 4DV0J 1S0VA 2BRLA 3QO9A 1X5SA 2KI2A 2HHHJ 1TL4A 2B7CB 4CI0B 2HVIA 2DO4A 1CS4A 1R0AA 2UZAA 2HW3A 3H40A 3MM7A 2WW4A 4K4YA 1EB0A 4DU8A 4CM2A 4GO7X 2HNDA 1HNWJ 3TA1A 3KLIA 3Q86A 4KR0B 2GFFA 4RO0A 4KT0C 3RG6A 1DTQA 1IBKJ 1SIZA 3TVKA 2RD5C 1TU0B 4NLPA 1SJRA 4IRDA 2KKHA 3LPYA 4DR3J 3OXGA 4NEZA 2CKWA 4QWBA 2WOMA 1P9QC 1SV5B 5AJ3F 3V6HA 2CDRB 2QLJB 1O51A 1V9OA 2R7OA 2DKOB 4WP3A 2WRMA 1ELOA 4NLUA 3R1HA 1OY9A 3VV2B 2B43A 3Q23A 2KT3A 4EMDA 4O3NA 4RW7B 2HBZB 2ZVIA 1I6JA 3R97A 3RRGA 4CLSA 3CCRS 1FCAA 2YNIB 1JMTA 1I94F 4Q5VA 1VQYA 5IT0A 4DLGA 4NEYA 1NJWA 1JJ4A 4GVBA 1XIQA 5T7LA 2YKMA 2F1FA 1RAJA 1N5YA 4Q43A 2AJQA 3J81Y 4LFAF 1SVDA 3JQKA 1YJRA 2FLOA 3B4DA 3MURP 2A1BA 1F0XA 4EWTA 1PYSB 4J9NA 3LGNA 1T05B 3CSKA 3MPYA 3SSSA 4I4BA 2HHWA 4H54A 4P2XA 2DGSA 4ZVUB 4OLOA 4U96A 2DNRA 1NDCA 3SFUA 3UDCA 2N4CA 4HI1A 4PWDB 2XMAA 1B4SA 4DR6J 1WHXA 5D77A 1RBOB 3UD5A 5C25A 1YJTA 3AOAA 4I69A 3MCMA 2KH9A 4MYTA 1N5VA 3CC2S 1RI7A 4ZMMA 4Y2MA 2UUCF 3P49B 2Q1LA 2DBBA 4I64A 4P2MA 1KWMA 3BGRA 3H25A 3ZTRA 3F44A 2AGOA 3A3NB 3EZ5A 3I0SA 3WX8A 1S7IA 4NLVA 2NXCA 2LXIA 2W24A 5AE3A 1RWNB 4QU7A 3HVRA 2DY1A 2K06A 2XZDB 5L9NA 2EFOA 2JX2A 4LT6A 2A10A 4JB8B 4DXLA 3FEYB 3V6KA 1ZM3A 1HFEL 3I31A 1SQEA 1JWWA 1Y5LB 4ZDNA 3BJYA 1T9WA 1Y9OA 2RU9A 4USHA 3UDEA 2WTFA 2HLTA 2MKSA 4ZP7A 3PV8A 4JYAJ 4ED1A 1JQGA 4ZPCA 4L74A 2OPQB 5CCMA 2HVHA 1OJ4A 5HVGA 1YBTA 2RDDA 5LSLA 1ZAXA 1IM4A 3J7AN 4CP5A 2L48A 5CQGA 5DDOC 1X0FA 1JNRB 4OLPA 5DJBA 3HCXA 3JSBA 2W7AA 2ZD1B 1I1GA 3DLLQ 3M9OB 3HJVA 1V6HA 4CWBA 2XQCA 4M5LA 1EKRA 1H7WA 4YB7A 1G2EA 1U1MA 2LA4A 1S1VB 3PW5A 3PX4A 2JHEA 3I87A 5K8MA 1SXLA 1M90T 5I4MA 5FJ4A 3IR6B 2DHHA 4D3GA 3PFEA 3GSIA 3JSYA 3VAHA 5FLXU 3DLHA 2D3O1 2Z56B 1QAIA 1K47A 3SV4A 4PXDA 4J9VA 4ZN1A 3ITHA 2QMXA 4OJ3A 4B3OB 1ZM2A 5MLCV 1U25A 1S9GB 3M6WA 1W2BR 4JI6F 3PW7A 3RYLA 5KG7A 2X1BA 2ILZA 4JV5J 3TX0A 1CEZA 2I9SA 3KWMA 3QMQA 5D8HB 5KG6A 2OLWA 1X8DA 1NEEA 2ZBQA 4WFZA 1WEYA 2RU3A 1TL5A 3DOMA 4Z7CA 4OZNA 3MTJA 1O5JA 4JI4J 3BKFA 2VONA 5BR8F 1HL6A 3G8TA 2BACA 1WC4A 2A0FB 1NPRA 1HMVA 2JC1A 4F02A 3R27A 3TUIC 2MSTA 3TEHB 4Q45A 3HF5A 2FVPA 3NGSA 2DR5A 3D7SB 1NSKL 1B0VA 4RJVA 4EBEA 3OVBA 2KYXA 4CLPA 2PC6A 2QG9B 3QAEA 2OHDA 3JSMA 1VYAA 2D3OR 3CIZA 3X3UA 4WP8A 4FF2A 1ZS6A 1NXIA 4B9TA 2QA1A 3MECA 5E5NA 4NI2B 4QR1A 1T9XA 3ULHA 2KG1A 4F67A 2J6UA 2VJVA 4DSJA 2PMHA 2XBPA 2E1RA 7FDRA 4DV2J 3CT9A 2GGPB 2GC8A 1R8PA 1WNEA 4ELVA 1ZPVA 4K2XA 1AB8A 1HYSB 5IM0B 4LF6F 1IUJA 2FUG9 4NLOA 4G1QA 3V6DB 2M5YA 2B8PA 4X65F 1HPZB 4FNHA 2VPYB 4LSLB 1F5CA 2R8JA 2XI2A 4CLZA 3NXZA 2NXNA 5EUHA 3CJKB 2BEFA 2XMKA 4Y3CA 4CO5A 4CTAB 1TTHB 1M0SA 1N34F 4J9UE 4CYUB 4PYDA 5LOQA 2Y1IA 4BWJA 3PO4A 1DLOB 5HSPA 3TAMB 4XPCA 3M8PA 2AIRB 4FKYA 4P2FA 2AYEA 5KFZA 4HYKA 2CQDA 4ZP6A 1RISA 4K4ZA 2BDPA 2CNKB 1OY8A 2HQ3A 3IBWA 1CLFA 3KLEB 5EN1A 2CAJA 3MOJB 5HI7A 1XEZA 4ECSA 4MK7A 1KR4A 3ET6A 1O8BA 1U0HB 2R9LA 5KT4A 1XK8A 1PC5A 4CT8A 1LNQA 2FC9A 4EFAC 2BJ1A 1H2TZ 3IRXA 4USIA 4KV8A 3HD1A 2JDJA 1T9TA 1WTBA 3EUNA 4P72A 4F8RA 4MKYA 5E33A 3H5SA 1FXDA 5IT4A 2W2QP 3PG9A 3BPSP 3FRYA 3UWTA 1WC0A 3I55S 1GXLA 2LECA 1VISA 1X4GA 4NZ7A 1RBAA 2BX6A 1C1CA 2BJ8A 2RUSA 3IR5B 3LW5C 2QEXS 4WFBQ 3N6NA 4B08A 4IFVA 3HMJG 2VASA 2ACMA 1P1TA 4R25A 2R7UA 3CW2C 4QW8A 2MGZB 4J37A 3GQCA 4HT5A 2XS5A 5HBMB 2Q3PA 4DV5J 5AT1B 1KQGB 2WCXA 1YJWS 3CXCR 1BGXT 2VODA 3W61A 4QIGA 5SZTA 3AXKA 3HDSA 4C0BA 4GKJJ 1RU2A 3S8SA 2DCUB 5ADZA 4OJHA 4HHJA 1RGVA 2ZH9A 2IA6A 5B09A 2IY5B 3AJ1A 4Y2AA 2W9CA 3I0RA 1PAEX 5K14B 3S6EA 2HAIA 3V4IB 2J0QD 3H4DA 1AT1B 3C6UA 5EWFA 2KM8C 1U1PA 4KFBA 4KH0B 1XMBA 2C3OA 3VAGA 3BQ2A 1RBLA 4RX6A 4N7TA 1D0EA 2EC2A 3OVSA 3P96A 2EC0A 2KT5A 2WBMA 1B70B 1YJVA 2X3DA 1FWKA 2ZH7A 4KRWA 3GV8B 2RRNA 2HG4A 2VDIA 1MN9A 2B4PA 4IUFA 2EK1A 3PW0A 4A8SA 4QCLA 1QE1B 5HQ8A 2FGOA 3THVA 1IBMF 3L7PA 3BKTA 3BSCA 3CUNA 5IC4B 3MFHA 3ISZA 3N79A 4XIUA 1FJGJ 3JAMY 2F40A 3CMAS 3CJ4A 3UD4P 5DQGA 5GADU 1TL1A 1LW2A 2Z30B 3KHLA 1WI8A 2NREA 4PEOA 5DZ6A 1E6YA 4TVAB 3FSXA 5B08A 3JYTB 4W92B 3C14B 3RR8A 1X9SA 4EGLA 1Z1ZA 1RHUB 1SB6A 2LU1A 4DL3A 2OEKA 2XYGB 3ELHA 1HHQA 2ZOGA 2RRAA 3BDPA 1RT6A 4IQXA 1JLQB 2DEIA 1N54B 5J1PA 2POKA 3GIMA 1FRLA 3W8PA 2P6TA 4M5DA 3VAJA 1ZZFA 1F2HA 2ASYA 1UMJA 1BY9A 1CULA 2FJAB 2UUCJ 1N56A 3HHNB 3MXHP 4YQWA 3EGNA 1UP1A 1HWJA 4ED5A 2HLUA 1FRKA 1I5OB 4C3KA 3RW7A 4DR1F 1RT4A 2V8DA 3EZUA 2CPYA 4WWSA 3UCZP 3DRRB 5I3UA 2WBRA 3KLFA 2K2PA 3IGNA 3A12A 1QJHA 1MLAA 3IS9B 2YWEA 2IAJB 2CNNB 3JXOA 2F8HA 4I1TA 2ADCA 2BV3A 3P3DA 3NWRA 4FYWB 3TX8A 1VMBA 1HI1A 5ETNA 4F2RA 3G2XA 3H2VE 2F5GA 3MR2A 1FERA 2D74B 4RW4B 2DO0A 3M6XA 4RW6B 2EI5A 2FZKB 3KJFB 4MFBA 2Z4PA 1RTDA 1LWCB 1X4DA 3MMBB 1FFSB 3F0NA 1HQ2A 5I3QA 2V2ZA 2ZH8A 5J2MA 4H4OB 1RTIA 3M2VA 1HKAA 3NEKA 2YNGA 2YBVA 1XNQF 3SCKE 4EEYA 4M5GA 3E01B 1S9FA 3NL0A 2UV8G 4P2SA 3DMJB 3CMQA 2KO1A 4N56A 4OZ1A 2XMTA 5C24A 4F04B 5A8WB 4EO6A 2BVZA 1DRZA 1KQSR 2C3YA 3DM2B 1S0NA 2UU9F 2CUYA 2Q79A 2HKEA 1RB0A 4ZVSB 4RUBA 5D0RA 3FSIA 2K3IA 5EWGA 2UVVA 3EMTA 3UD3P 2PEHA 2BJ3A 2YNFA 4LBPA 1CJVB 2FVSA 2PI4A 2BR0A 3CJ0A 2FJBB 1F9FA 2M70A 3CCZA 2BZ2A 3KDNA 1IJEB 4ED8A 2PIIA 4C6AA 5HMZA 1KN6A 2QE5A 1VS3A 1JLBB 2U2FA 2GS8A 1R89A 3POTA 1KTQA 5F0WA 2C3UA 2L9WA 3MEKA 1C1BB 5DM6Q 4DPYA 1TFWA 3RBEA 2N3LA 5RUBA 4DUZJ 4BCAA 2HGMA 4J9MA 3K5NA 3BPDA 4X4VA 5M2UA 5KFLA 3SCIE 4I6AA 4DMZA 1C0TA 3MAHA 4M5HA 4YHHF 2DNOA 1WF1A 1QAJA 4L72B 3LALA 3T1HJ 2DR7A 1FJ7A 4DUYJ 4LRBA 5CYQA 3SSRA 3T6JA 3CCTA 1NU4A 2LKZA 4JI2F 2PFFB 1T9UA 1QAXA 3NKYA 3LP0B 3TW0A 5KG1A 2NXEA 5IT9U 4PPZA 5K9FA 4PG8A 1ZYQA 5E3CA 1OY6A 2AJ0A 3ZNUA 4HH1A 3W2WA 5KFMA 1VR6A 1U1QA 1P27B 3C2PA 3MGJA 3CDEA 3B78A 4ED4A 2ZUAA 1UZDA 4QWEA 4DG1B 2Y9HA 5T14A 3AB2B 2DXEA 1N33F 2L08A 4PQAA 2ZH3A 2XLKA 2NLWA 3M1VB 3W5ZA 4RU2A 3CPWR 3BGUA 1N88A 4KHMA 4OZ3A 3KHGA 4X65J 3M4XA 3NCPA 4WPAA 2HVDA 4Y65A 5AXNA 3KLHA 3U27A 4P52A 1SKRA 1SJ1A 5J2QB 4LF7J 3DDNA 4FF3A 5A8RA 1YI2S 1KQFB 3K7RA 3KJQB 1CC7A 2J76E 2YKAA 2OPSA 1OPZA 2CQ0A 1FFWB 5L1JA 3GP9A 2OGUA 1A6LA 4LRAA 3KMQA 2HHSA 3UCGA 4BWMA 3BBCA 4KY3A 3TR5A 2X1AA 4DL5A 3CF5Q 5CXTA 2QLFB 5HVHA 2DNNA 2W4DA 2Z2MA 2E9ZA 2DGUA 2W2OP 2BJ9A 4KQZA 5C42A 2HNYB 1S1TA 1MSWD 4H4KA 2QYCA 3PEJA 1IKXA 2V67A 1IKVB 1XTZA 3MEGB 2BE9B 1TR0A 2B5JA 1Q82T 2BQUA 4OX9J 4KGKA 2DJWA 3T5KA 4F4AA 2GHWA 2KJWA 4LREA 3PYDA 5A0YA 1KRPA 1KQKA 2PN6A 3ZZPA 3H42A 3PTWA 2R42A 5KFEA 3D28A 4W90B 3MCSA 5J2PA 1NKBA 2YWKA 4NYZA 4KPYA 3H8YA 1CJTA 3M05A 2V8PA 4O3OA 1ZA1B 1CJUA 1OMSA 1U48A 4UUXA 5JVHQ 1TELA 5CABA 4UQTA 4KHPF 2L9NA 2XY5A 3UPFA 1UETA 3MPUB 1CPZA 2RQKA 4ECZA 1Q7YT 3MEDB 3ZTSA 4OYIA 2R8HA 2VUGA 3PX0A 3KJNB 4A47A 2CG4A 2E1PA 2IYIA 2WZ1A 3MAAB 2Q43A 3VVTA 2DTJA 1OIAA 1QAYA 2OI2A 4TY8B 1R8AA 3DLKB 2HNZB 1Y00A 3FMBA 2MEWA 4KYZA 2CIMA 3GWCA 3MD1A 4CH1A 3PW2A 5E3PA 1RLDA 2ADBA 3PR5B 2GQCA 3LANA 4NLYA 3LP2A 4DL4A 5HAOA 1J5OA 1SH3A 3EGWB 1S49A 3DLGA 3HSDA 1UJ6A 1FNMA 2AGQA 3MM5B 4BBYA 3HT3A 3MUTP 2E1MC 1VRTA 4OX8A 1T94A 2DPJA 2JFDA 3RTVA 1DFDA 3T5HA 3DDIA 4GMKA 2UV8A 3G8SA 3KOAA 2RS2A 2CPZA 1IVZA 3NNCA 4LF8F 1F5BA 1Y7PA 1HBUB 4QBUA 1WF0A 1HBMB 1VIOA 3EDQB 1UAWA 4YMEA 2FHKA 1ZAVA 4XO0A 2AEMA 3M6UA 4ZJOA 1AZSB 4RNMA 1RCXB 2GVDB 1FJEB 2Z8QA 5KT7A 2LVWA 1KNZA 2LQJA 1MROB 3TUPA 4F0HA 3OHAA 3CCSS 1WOPA 2GAHC 5HMWA 1U1LA 3OFGA 3GU0A 4XDDA 4ED6A 1UPPA 3W65A 1PBUA 3FJ2A 4W98A 2XZWA 1WG1A 2JWNA 4LVNP 1NK6A 3RRHA 2W4PA 4KHRA 1QDUB 4N8NA 1HARA 2C2RA 4DN0A 2GAGC 1SUQA 4DN9A 2DGXA 4ED2A 3HSZA 4M94A 3GR1A 2CPJA 2HBRB 1RTZA 4F4XA 2VOOA 3MMJA 2MKYA 3CJRA 2XI3A 5HP1A 2QL5B 3DXSX 2XY6A 4HLBA 2CZ9A 4I7FB 5K8PA 1RWUA 4WZQA 2I38A 3HD2A 3DFEA 1WC6A 2IC3B 4HDHA 4F3OA 5DGBA 1YJ9S 5D0HA 3EPIA 4WYLA 1R8CA 2UUWA 2YWHA 4ECRA 2F8MA 4Q2MA 1FRIA 3GYNA 3BBFA 4R0EA 4PG6A 1U0SA 4Y0FA 4QWDA 2KN4A 1OO0B 3TZWA 4ZHRB 1SKSA 4NZ0A 3AQPA 1UFWA 2DHAA 4TU7A 3T9ZA 2O67A 4DZ6A 4ECVA 5CHCB 2FC8A 1JJCB 3C16A 4ECUA 2VDHA 5FLXY 3KLIB 4LFCF 5BYQA 4C9DA 2NSBA 3GG1A 1X4BA 1RAHB 3B82A 4TNOA 4DV7F 4NZ6A 1HR0F 4RZRA 2XCAA 1DZ5A 1FVQA 5GAEU 3PACA 2DYAA 3OR1A 2Q66A 4NWBA 4WTYA 4DR1J 3SXLA 2RQ4A 3TI0A 5AXLA 1E6VA 3AB4B 3TAQA 3HFKA 3H4BA 1WUUA 1NK4A 1MG7A 3DLEA 3N6MA 3Q8QB 5C5JA 1FRJA 3ENQA 3FEZA 3G6YA 2HQFA 3PRDA 5T7LB 4K4TA 1GT8A 4NXNJ 2BJDA 2BE2A 2NXJA 3TVYA 3OL9A 1SCJB 2AHOB 2ZFHA 2J0SD 4PYAA 2ZKUA 1HNIA 2CZ4A 4AL5A 2GZOA 2GVZB 3ILJA 4ECXA 2RKIB 2NPIA 1Z4UA 1XNQJ 2E44A 1RT3B 4NRTA 2C2EA 2QLWA 2G0IA 5DDQC 3FBBA 2R7QA 4A48A 2MHEA 5LSRA 4MIWA 2HMIA 4GC7A 3ZFVA 4I6YA 1S6PA 3QFWA 3K8WA 4OIXA 4UUWA 4MYUA 3D67A 3CJQA 2VPWB 1EIYB 2YKQA 2M4MA 2I5JA 1X4AA 2ZVSA 2X7IA 3PR4A 2BJ7A 1S1XB 1WHWA 2Y1LB 3EDRB 2OPRB 5KFRA 4DSKA 2RF2B 3QSIA 1TKDA 2V2KA 4DR5F 2NR0A 1WC5A 3J80U 2DISA 2ZM6J 1H38A 1YZ7A 2QN6B 1PSDA 3RRKA 1PYTA 2RJZA 3NOGA 4I2QA 3PNIA 5D4OA 5L9XA 3A8IA 4O4GB 3IAM9 2EK6A 3GB0A 1RWMB 2LYVA 1RYSA 3K59A 3BYRA 3HSJA 1TAUA 2QRRA 1BQMB 4V19X 4YOEA 3VGTA 3VAKA 5J1NA 3PJWA 2CVEA 1R31A 4CH0S 4ECTA 1YX2A 1V3ZA 3J7ZT 4RW9A 1UEVA 1AFIA 3TJAA 1TKZA 1RWKB 1REVB 5FDLB 2BANB 2EEYA 1RP5A 2V8VA 1DQ9A 1TP7A 1FDBA 2WB1D 4WXWA 4EO8A 4O44A 4IFYB 1RAAB 2MTLA 1EP4A 2I8EA 4DR4J 4AT1B 4K59A 4TN2A 2FLNA 2HWIA 1FRHA 1KDNA 3HSGA 2N3OA 2WB4A 1M5KC 1K1QA 1YTYA 1JLGA 4ZCKA 1X31C 4F4WA 2E7VA 1UW4A 1XR5A 2CQGA 3FZBA 2XGQA 2JJ4D 4Y28C 4NA3A 1YITS 2MZJA 3UVJA 3G6XA 2E29A 2RE1A 3HHEA 3IRWP 2DH9A 2EFGA 3HKWA 4CRJA 3ADAC 1OQ6A 1U6FA 1UVLA 2CZVC 3AA9A 2E7WA 3LP1A 3TUZC 5DG7A 1PAUB 4KGZB 1N33J 2Y1RI 4QR0A 4C3MA 1VFJA 3LAMA 3RZAA 4ZVGA 4ANEA 2F9DA 4ANDA 5KFIA 2R2TA 1RHJB 4J7CA 1IXKA 3WZ0A 4FXWA 3M8ZA 4KO0B 5EDWA 1G4CA 2QX0A 3GIKA 1NJIT 1QM9A 2BOAA 3K5OA 4X4RA 4UW2A 4QW9A 3BKUA 2R8IA 2DK2A 3NGRA 1AW0A 3OLAA 3W66A 4PUOA 4ZVFA 1RT2B 2MQ8A 2IHR1 4F4KA 4KH1B 1NCLA 2FHJA 5GMEA 3J7Z5 1VOMA 3MCOA 2Y8YA 3GFHA 4DV0F 2AYGA 4OZJA 4B3MF 1SL0A 5KOXA 1YJNS 4OI3A 1B7FA 4DPWA 3GTYX 1JLCB 1PBAA 5I3PA 1WELA 3TRGA 2MKIA 4KAIA 3W9IA 1SH0A 4OYZA 4U6PA 2HFOA 3JSMB 2DH7A 2CADA 3BGLA 1FA0A 3W64A 3BR9A 1IBKF 1UEUA 4UQGA 1N0UA 2CQPA 4ZIVA 2VKZG 1TMMA 1JLAA 3UQSA 4IH7A 4DR3F 1SJFA 3SCLE 1IKWB 1HQUA 2AP6A 4K4XA 2XSJB 3KK1B 4C0OC 4DR7F 4CLWA 3DI6A 1S0MA 3W9HA 2PEBA 1LW0B 1NK7A 4IR1A 2CWKA 3OW2R 3KLGA 1U4BA 4QIEA 3R5DA 4G1QB 2M52A 4RKUC 2E1AA 1YDLA 1DTTB 1PO6A 3C6TA 2FJDB 3FQKA 5HL7Q 5JMNA 2M0GB 1REGX 2G13A 3MMAB 2QIFA 1RAFB 3G6VA 4IOCQ 3KYLA 4IR9A 4L3KA 3UFCX 4UTGA 4RUCA 1ZM9A 3C15A 4X4OA 4DFMA 1JKHA 5LMNF 3SBMA 1U6BA 3OPKA 3FDSA 5F0UA 2EFVA 5BXIA 2XHWA 1H74A 1UFLA 3FKBA 4CO1A 3VTIA 5IV3A 4PXBA 2J6TA 2FZCB 2P6SA 1LOUA 3HO1A 2MDAA 2F65A 1IKYA 2ZH6A 1OYEA 3VVUA 2C2MB 4HTIA 4IH5A 4RWXA 4DR6F 4URSA 1YLXA 1X0PA 1AXQA 4AL7A 2FDNA 4OMFG 2OELA 3MUVP 3MEEA 3QZ7A 4UOCA 3N0VA 5HANA 3ETMA 2XEXA 3ILIA 4RNHA 1VBXA 1T3OA 2F3JA 3UN3A 1NKEA 2CQ2A 4OHVA 5KG3A 2MQNA 4LF8J 1UFKA 1RT1B 3R5BA 1EETB 2MQQA 2MZQA 2GNKA 1VQ6S 2KJVA 4QPTA 1YHQS 1HQEB 2IVMA 4DWIA 3UCUP 1P1LA 1S10A 3UR3C 4DSLA 3SI8A 2DGOA 3RR7A 1SIWB 1NKCA 2HQGA 3NRBA 2RHSB 2IA0A 3SQGB 4JYAF 4N47A 2HFNA 2BM0A 3BB5A 4CZCA 4UT4A 1K0VA 3HK2A 3QT6A 2UXBF 2CJQA 5E3RA 3FSYA 1YVFA 2VH7A 2QTWA 1FEEA 4GVLA 3V2UC 2EPIA 2K7JA 1SV5A 4K2JA 5KFHA 3VGSA 3BN7A 2DRAA 3SEOA 3CJ2A 2MKHA 3FMWA 3K89A 4I2PB 1U1RA 4YN3B 1P9YA 4RW7A 4ZVRB 1K44A 4WJBA 5KFGA 4DFJA 2YNIA 1Z2ZA 3IWNC 2HHPA 5KFPA 3TANA 3G82B 3TQEA 4K8RA 1RCOB 2EG2A 2HHVA 3CCQS 2IJRA 3SV3A 2A18A 4TLQA 3TOQA 3HVWA 1TK0A 2VG6B 1L3TA 2LFVA 4K5RA 1M5SA 2MLXA 2Y0BB 5L1LA 3EVWA 2CRLA 4HI2A 3B8HA 2BKOA 1T05A 3GG0A 2DVIA 4YR3A 2LXFA 1U02A 5IC6B 4FS1A 5CYMB 4LSZB 2B51A 2IYGA 1A7GE 2VG7B 2GQ2A 2B0GA 2JRSA 2RMLA 1JLEB 1LV5A 1TK5A 4PWDA 1L3VA 2EG1A 4ZA1A 3C8YA 2ASJA 4JI8J 2CNOB 1WKJA 1SC1B 2VG5B 1WEZA 4QIFA 1VLOA 1HBNB 3U02A 2RH3A 2V0NA 5GAGI 4JI4F 5M2RA 4QJVA 4PZVA 4EBDA 1WC1A 4LR7A 4Y34A 3KHRA 1K9MT 3PRVA 2LA6A 3SQOP 4CO0A 5KFXA 3KUHA 1G3OA 2Y0SD 1RWOB 2MY7A 2VB6A 1JLFB 4ZIWA 2X1FA 3W7BA 1SPBP 3KK2B 3VZIA 2I6WA 2FVRA 2WONB 2ZHOA 3VALA 3QLHB 4FDFA 4R5PB 4RNOA 2R2SA 2PGCA 3CVKA 3CD7A 2OPQA 4PABA 4MH8A 2F8EX 4I67A 3UDVA 4QYZJ 3JQJA 3W2VB 2ZBRA 3KG0A 3L3CA 1TKTB 2ZZTA 4USKA 1S57A 9RUBA 4WXOA 4J90A 3MM6B 4I6WA 2ZD1A 1RZMA 5IT9Y 2X1GA 1PIEA 2ZH4A 4JUZA 1S1VA 1Q8IA 4HHHA 1BMQB 5JUMA 2C42A 2IJNA 4RUAA 3MPWA 3RBZA 1VK8A 2Z58B 1QTMA 2QA4G 3CC4S 2ZITA 4RBVA 2DT9A 4DX7A 1U26A 3ZZYA 4DR5J 3VQTA 1NSQA 3AY0A 3MUMP 3HI9A 2VU5A 1XNRF 3QRRA 1KLMB 4ZITA 1LFWA 2VF3A 1UJ4A 4HH0A 4B3OA 1HIYA 4NLGA 3ETOA 3OFEA 1S9GA 4QWCA 1HHSA 5M2PA 4LVOP 4J91A 5F8IA 1IR1A 1P8GA 1LK7A 3GJTB 4WCEQ 1BWEA 2A3JA 4NX9A 2VBWA 1L3KA 3W9JA 1BUXA 3O2IA 2WK4A 5DETA 4O3RA 2A6MA 4X64F 1VLYA 2IM2A 1FJCA 1N0VC 4RL1A 5HATA 3GIRA 3TZYA 1M5PC 2W8KA 3LA0A 2ZBIA 3KNGA 1W2IA 3HHLA 1KHWA 4XAKA 2AKWB 2KYZA 5B0FA 3FVYA 3ENVA 3RB3A 2HIYA 4O23A 1KEKA 4O3SA 1GK8A 1YJUA 2RDJA 2E5LJ 5IWAJ 1TKXB 4NYPA 1NO8A 2L41A 3CO9A 3EX7B 5E3QA 2P5VA 2VFUA 5KFNA 1WSVA 1BQNB 1GXUA 4P6QA 3IA0A 3QT5A 1RLCL 1WORA 1T03B 4NI2A 4KSEB 2J8AA 3ZTPA 3T19A 2LQBA 3BEGB 2CPDA 3THTA 4DV1F 5DM7Q 2XYHB 4PQUB 1N5QA 2GGPA 2KT2A 3PHTA 3ZZRA 2KG0A 3LPEA 3TEGA 1HYSA 2HFZA 5IM0A 3CJSA 4DDFA 3ISNC 4K5SA 4EZ9A 3V6DA 2B56A 3EGZA 1OPIA 5JVGQ 4EYHB 2H9ZA 2MLYA 4UZCA 4RBUA 3PRBA 1HPZA 3F73A 4LSLA 2OKQA 3DRSB 3QRPA 3CJKA 2WSEC 4MK9A 1VBZA 1S12A 2M2BA 1TV6B 2PD1A 4CYUA 2C2KB 2ZH5A 1FTRA 3IG1B 2NXUA 2QMWA 4DEZA 4B3MJ 1DLOA 2AJ4A 1VQLS 4IO1A 3BQ1A 2COLA 3TAMA 5EHHA 1VBYA 1IR2A 4PXEA 3QJPA 3D3BJ 1RHMB 2DGTA 4ALZA 5D78A 3N01A 5L39A 3GILA 3KLEA 1HNVB 1WC3A 3HLUA 1KSPA 4EU0A 4B3TF 3EM1A 2RHQB 1RWXB 2VA2A 4X4TA 3MD3A 3W2WB 2PSZA 4CLYA 5C2CA 4UOGA 1DY3A 1U0HA 4NLRA 1UWBB 1CG2A 3R5CA 5B0DA 1FJGF 5F8NA 4DR7J 3K17A 4DCOB 1NRKA 1YZ6A 2K1RB 5B0GA 2XMUA 4U7CA 2XO6A 4LUBA 3IGVA 2ZOFA 2MQLA 4Q8EA 3H2UB 2GHPA 2M8DB 2B9XA 4Q8FA 5KFVA 3UN5A 4X4PA 1S6QB 4CCHA 1X4EA 2KHDA 4R0JA 1SL1A 2VKRA 2HHUA 1I3OB 4QYZK 3HM9A 2KVIA 2HQIA 4ZVOB 2AWZA 2ZWOA 1U2RA 1BWVA 2OSRA 3RAMA 5LMNJ 1LWFB 3N5FA 5HROB 3PX6A 2QC3A 2J6SA 4P73A 2V68A 4F3QA 3IC1A 2FIUA 2AJ1A 5HMXA 2MGZA 3H5UA 5GMKa 2HAFA 1R8HA 2AT1B 2V4QA 4F50A 5HBMA 1XR6A 1SI9A 1R27B 3CJTA 4GKKF 3H7HB 2DXFA 2LP4A 4YS2A 2V8HA 2W2PP 1KC8T 3EWGA 4DUTA 3AD9C 3T6BA 2FTRA 3R9LA 3GIIA 3BF4A 1HI0P 1TUWA 3U1MA 1B3TA 4WFYA 3N6LA 3CCJS 3BH7B 5LMUF 1J2VA 5ETSA 3DC2A 5DG9A 4PG5A 3ILLA 5K14A 1YBUA 4ITSA 3V4IA 3ZZTA 4DSEA 2R2UA 4NMLA 2PE8A 2GO8A 4AXIA 2YNHB 4Y2IA 1GAOA 2KM8B 4DU7A 5EGYA 4ID5B 2YWWA 1D1UA 3FBFA 4Y2KA 2BYCA 3F41A 1U2CA 2LEAA 4NA2A 4C8KA 1B0PA 5A6PA 2ZNZA 4OHWA 2HRUA 4NLDA 1MMLA 1FD8A 5KFTA 4CQ1A 4XPEA 1NK8A 2W8LA 4Q44A 2UXBJ 1QE1A 1HI8A 4YUDA 1Q53A 3M30B 3TJ9A 4WFNQ 4ZPBA 2YX7A 3EVMA 2VC0A 3I6PA 2YPYA 1TL3B 2W01A 3M2RB 4B9SA 2H48B 2CPEA 4JI1J 1RWVB 3BN4A 1NSAA 3CTRA 2WSCC 3I4HX 4DV3J 2OTLS 1WF2A 2DXDA 3D0GE 5LXRA 1BE4A 3TP2A 4KGVB 3CWJA 4C8LA 1SC6A 5B0EA 1NZAA 5HLFB 3DKDA 5G0RB 3QGIA 1VRTB 3JYTA 3M8SA 3C14A 3NOCA 1S9EB 3O44A 3VCDA 4KB7A 2M3DA 4A8XA 2LDIA 2C2ZB 1QLNA 4LF5F 1L3SA 4USMA 3CJ5A 4DV4F 4H4MB 5A6WA 1D8ZA 5LXYA 2OFGX 2YH0A 1H2VZ 1JLQA 4DZDA 1T7PA 4DUZF 4IG3B 3DLBA 2ZWPA 2V2QA 2F9JA 4CLLA 4NLWA 1RHKB 3ILOA 1T02A 3DHWC 3OV7A 1MWQA 4HACB 3J80Y 2LDYA 1FDDA 4WBFA 4NE9C 2VA3A 4DX8H 3M2UB 2OEJA 1OSCA 2QFIA 4IDKB 3T1HF 3ICLA 3FQLA 1XN9A 1VQ9S 3CEDA 3D68A 4DUYF 2EFQA 1RSCA 4RNFA 1CVJA 1KVKA 5B0CA 2R7SA 2PO4A 2VL1A 1ROFA 3DRRA 3ZXWA 1VQSA 1Q5VA 2ROEA 3BDEA 4C4WA 3IS9A 2IAJA 3I32A 2HGLA 2CPIA 1U2FA 2XMWA 2BE7D 2R3VA 4TU8A 2QSFA 2OAUA 3I82A 2UXCF 5J2NB 1AYEA 4RW4A 1RTHB 4RW6A 4B02A 2VPXB 2KFYA 4ICLB 1LWCA 5DDPC 1N6QB 4FXDA 3MMBA 4ECWA 3K5MA 4H4OA 2GCFA 3A3OB 3KJVB 5CYJA 2ZC4A 3E01A 3A8JA 3OVAA 5IFMA 3AXMA 2BW7A 2MZRA 3DMJA 4JI7J 1G1XA 4LSNB 2KL8A 1RT5B 3NG8A 3DN9A 4ES1A 5A8WA 3OL8A 2CQBA 3DM2A 4K50A 1QTNB 3AOCA 1TL7B 3HHKA 3DOLB 4LF7F 5HVFA 2EFPA 1FFGB 1NDPA 2NQPA 2KDOA 4DR2J 2P9GA 4ES3A 4DL6A 1CJVA 3I9ZA 3DRYA 2EWHA 2DNYA 3FBEA 4BC7A 3THPA 3PM9A 1XNRJ 4J9RA 4ES2A 4L76A 5GAHU 1LKZA 4OX7A 1JLBA 5GADI 2RRBA 2HBQB 3HULA 4NLQA 2LXUA 3CJ3A 3GE9A 2KHCA 3CB4A 1Q81T 1C1BA 1RU1A 4OI0A 3NS6A 1D3WA 3SCJE 3FCHA 2L3MA 3D3CJ 4CLUA 4MKAA 4OX9F 2C3PA 5KFCA 4ID8A 2OH2A 1XERA 3HHDA 3DRPB 2H3EB 4IOBA 1MN7A 3IR7B 4ZLLA 4LRFA 2FVQA 1GTEA 4X64J 2E5GA 5ETRA 3UR0A 3DLJA 2IM0A 1VK3A 4IOAQ 4M1KA 5J1EB 3CGIA 3OUYB 2QJ3A 2MYFA 3E3XA 1V3RA 1FNOA 2LCWA 2WVDA 1S6PB 4I56A 2DGQA 3H5YA 1V5IB 1W7WA 4QIWD 2DRDA 1RTJB 2VV5A 1FT8A 3LP0A 5KFOA 1ITPA 3AODA 2QZ8A 1C2PA 3OTOF 3FFIB 4CNZA 1VC0A 1QSLA 4Q0BB 3Q0AA 2ZBPA 3UE2A 4NCGB 3OJSA 3IMQJ 4CLKA 5ETTA 1O6XA 1EX8A 1D9DA 2XM3A 4H4KC 4WKRA 3PO5A 2ALYB 4GC6A 1QVGR 4ANCA 4DV1J 2X3GA 4DG1A 2W2NP 3AT1B 5G4DA 3U1LA 1X9WA 2J9CA 1WOOA 3KUEA 1U1OA 3D54A 2VQEJ 2UVUA 2N7CA 3M1VA 4P7VA 2WSFC 4K4SA 1EKSA 2AEFA 3O1LA 1S99A 1C4AA 3AD8C 4B9VA 1VQOS 1IWAA 4RU9A 4ZPDA 3QFHA 4USJC 1G7CB 3D6HB 4B9UA 5J2QA 2XNQA 3LGHA 3GV5B 2CJXB 7AT1B 2Z2YB 3IO1A 2IBKA 2B3TB 5IQQA 8ATCB 2CNLB 1XC9A 2GJFA 2IRUA 5KFQA 1JXEA 4FKXA 2IDEA 3WIVA 2W7PA 1ZM4A 2HNYA 1JLGB 1Q7LB 2B4UA 4DQRA 2NCKL 3H5XA 1SC3B 3ZTQA 2PFDA 3WIUA 1IKVA 2YPZA 4F4ZA 3MEGA 3UN2A 1FESA 3A8KA 4WP9A 4B3TJ 1CC8A 1Y0HA 2V50A 3BO4A 3C66A 3HVTB 2D9OA 3DYAB 4QR2A 2H5IB 4IG0B 1M1KT 1K1SA 1ULRA 4UOHA 3VQSA 4UOFA 5KT3A 2V5HG 2HZAA 2XS2A 1VRUB 5GMDA 3TA0A 2JFKA 4OHXA 3C46A 1FKPB 4ZPVR 3JTPA 4NRUA 3S01A 3LUYA 3MM8B 3TJ8A 4ETXA 4X4NA 4HEA9 5FD1A 4KKOB 4X62J 1KP6A 4YDXA 3CCLS 3FUYA 1DBDA 1RHRB 4FXVA 2ASDA 4DCJB 1LQ9A 1S4FA 4USVA 3MEDA 3MM9B 3EXCX 3D0HE 3W1YC 3JSRA 1H3DA 3DNCA 3MAAA 4DJBA 1NDKA 4G1PA 4TY8A 4B17A 2YKNB 4LBHA 3DLKA 2HNZA 1JK9B 3F56A 3R6GB 3M32B 4HHUA 2RSQA 3T1AA 4GKKJ 4X4UA 1UJ5A 1KTVA 2BM1A 2CQ3A 1R0BG 2BKPA 1PJ6A 2FHMA 2FHOB 3W5YA 2ZJQQ 1JLAB 2VFVA 3PIPQ 5L46A 4O4RA 1S1WB 3AJ2A 3WHIA 1U45A 1RADB 3MM5A 5LMUJ 1WWHA 3D66A 1IQTA 2KZMA 1WEXA 1HWLA 2G0CA 1V5VA 2B9YA 3A13A 2YQ0A 1HBUA 4DQQA 3Q8SB 1HBMA 2YY3A 1NJXA 2WHOA 4DI6A 4NXNF 2VPZB 3QIPB 1AZSA 2V6AA 2KVQE 5KG2A 2GVDA 5D3GB 1B99A 1U6ZA 2DIVA 2HHQA 1MROA 4UF4A 2R7WA 1HW8A 5HN0A 4AE5A 4O0IA 5I42B 2VZ9A 5DDRC 4RNNA 2ZNYA 2FY8A 2BQRA 2OTJS 3N5BA 2OFHX 1PYOB 3JTNA 3WBZA 2Z0GA 2E9TA 2B4VA 4F0MA 2QL9B 2ZBCA 3DOKB 2GV1A 4QPXA 1U09A 3WC2A 1TVRB 2XTJP 2D7SA 2BRKA 2IFXA 2VOPA 4AL6A 3Q2SC 4LRCA 5K20B 1FDNA 1PJ7A 4OJ1A 1S97A 4J9QA 4I7FA 1VRQC 5LJ3Y 1JJ2R 2NYIA 2IC3A 1U49A 2MQOA 3NMRA 1HBOB 4QZVB 1EAYC 2CPXA 1N36F 2ZM6F 4C0HA 1NPPA 1RAEB 1LK5A 4LF5J 5HJYA 2GIFA 2B8QA 4DV4J 1C4CA 2RQCA 3LH2S 2UUTA 3CE8A 2W9BB 4ZHRA 1FX4A 1L5UA 2E9RX 3FZ2A 5ETPA 4KGMA 4L3NA 5H9EJ 3OXLA 4OHYA 1C0UB 5FIIA 2XG8A 2R7VA 4NASA 1QUPA 5F8HA 2HHXA 3ENAA 3OR2B 3GJQB 4WU3A 2R7XA 4O0NA 3H20A 1VBKA 2AJFE 2PMWA 2NSCA 2GA7A 2M7SA 4BLGA 2RIJA 3DGPB 2ZJRQ 2ZE2B 4DR4F 1H0HB 2GX8A 4WE1B 3MMCB 4C8MA 2ZH2A 1S6OA 5A76A 1Q8LA 1IBCB 1OWXA 2M9KA 4J5OA 3K0JA 4R8UB 1XMOF 4G1IA 1FKOB 2BMBA 1S4EA 2G1DA 1TZ0A 3HFVA 3NGTA 1R7IA 2UXCJ 4U8VA 3VWSA 2CJBA 3DRXA 4HL9A 4M5IA 1FE4A 3EICA 2GVZA 1T3NA 1FI4A 1JIHA 2RKIA 2JEIA 4ZOSA 1RT3A 3RGIA 3MZIA 4FBTA 2HK3A 3EZOA 1WSRA 2JLFA 4B3SJ 1UPMB 5AXMA 3GYGA 3RUBL 2HPUA 5H1SV 2UUAJ 1V3SA 1X4FA 2YKOA 3M8QB 4RW8B 1L3UA 4UY8T 4DPOA 3J7YI 4YEAA 5C7PA 4DPXA 1VQNS 3JB9k 4HVZA 2W1BA 3OQ2A 3MR7A 1UW9A 4K4WA 1S1XA 1FXLA 2OPRA 1F5AA 2MZTA 2RF2A 1PCAA 2B9WA 3PHEA 2YH1A 4U7UK 3SDEB 2Q6CA 2ABYA 3DU5A 2FJEB 2ZJPQ 2DY9A 2AX1A 3I5CA 1WDTA 1NHUA 4OI4A 2ALZA 2HWHA 3KDOA 1WI6A 4O4GA 1KD1T 4OZ5A 1DQ8A 2D9PA 3MF5A 5KFUA 1NM2A 4ED3A 2DNKA 1ZTTA 1BQMA 3W60A 3V81B 3AOBA 1MU2B 2K3KA 2V63A 2ZZNA 2BBEA 1IN0A 4TXSA 3R2CJ 3MCNA 1REVA 2HQDA 5FDLA 2BANA 2CA9A 4MT1A 2CJ9A 1FWLA 4L73A 4ZPWR 1PGZA 2CVIA 4NXMF 4IFYA 4KGXB 3LF0A 2ERRA 2R2RA 2FLLA 4A8FA 4Y2CA 2MSSA 1W26A 1U7LA 2E7XA 4IQMA 4FNIA 2WW8A 3H90A 1T8EA 1YRXA 1VIXA 2B6AB 1H72C 4YB5A 4A4JA 2QMUB 2OPPB 4DSIA 1URRA 1EJ7L 2JVRA 4WFXA 2VFSA 1VGYA 3DDKA 2AYBA 2ZDPA 3OTOJ 4DS4A 2V9WA 1N32F 4DL2A 2YX1A 4UY85 2MLZA 5GAEI 4C8OA 1HWUA 1XWLA 2UVWA 3L4BC 3FBCA 5HK4A 3I96A 1S6UA 4U95A 1WDDA 3ZNJ1 1GEHA 3VAIA 3PIOQ 1Q86T 2FJXA 1VQ5S 4MIBA 5CAAA 3SIPB 1GQEA 1FK9B 3RB6A 1CBKA 2MKCA 2MZSA 5DS7A 1U8WA 1BHNA 1RA6A 2DPIA 5ETLA 2HZCA 4KO0A 1MMDA 3HHLD 4TLRA 4ZS6A 2MJUA 1NHVA 4N41A 5KFFA 4OV1A 3BGOP 1GXTA 3KMSA 4J9LA 5H9EK 1RT7B 2RB7A 3UW1A 1KVJA 1YBAA 1RT2A 1XMQF 4DV6J 4PCQA 5K8OA 2G9OA 3LWLA 3QGGA 3HHLB 2V4JB 2FQQB 2XLJA 4P9SA 3LO3A 1CJKB 1GTHA 1LWEB 5E2QA 1Q16B 1JLCA 3HKZD 3G86A 1S72S 5THWA 3NBPB 2XWXA 3QIDA 4PAAA 4P7TA 3SFGA 2QLXA 4C11B 4U9RA 5KT2A 3P5TL 3KK3B 3NAHA 4OYXA 4EK2A 7FD1A 4X2BA 3K5LA 1IKWA 1LXNA 3NCRA 3AJDA 4WF9Q 4NCAA 1D9FA 2AQ4A 2XSJA 2LMIA 4BHQA 3KK1A 1NB2A 4F7VA 3B6BA 3QPIA 4Z7YA 2UVRA 1LW0A 4ZCIA 4FYYB 4HR2A 3TYTA 2HK2A 4FVCA 2D3ZA 3CC7S 2DGWA 4YY3J 3GR0A 1R8BA 3WDOA 1DTTA 2EKYA 5CZXA 2ILYA 4CO3A 2JEJA 1RXOB 3MMAA 4CDIA 1X60A 2Z2ZA 4V19J 2OIHA 3CJ8A 5B0BA 2OMOA 3OFFA 2HIQA 3PKYA 1FXRA 5BJRA 2JLEA 1FHTA 5KG0A 5LSOA 3EJMA 4IYQA 2G4BA 1S1UB 3FCVA 2V34A 1X5PA 4G6VB 5L8RC 4WK1A 4E2FB 2W7OA 4AUKA 3QO9B 4JI5J 2FYXA 1IM6A 2CG8A 3FRZA 1U1NA 4ZJQA 1NLKL 5KTQA 4FS2A 1CS4B 2ZHBA 1R0AB 3MM7B 3MAQA 4N76A 2HNDB 2GIQA 1OYDA 3NMAA 3OTCA 5LT5A 4JI8F 3RAQA 1DTQB 1F3FA 4DLEA 2P2CB 3T5LA 3U7JA 1FEHA 4A8KA 4CM0A 4MKVA 2CFXA 3KHHA 2ZH1A 1KKHA 2WOMB 1GX5A 1WACA 4QU6A 2ZDOA 2XULA 4TKTA 2MB0B 1M1GA 1KFSA 1S79A 1VQPS 3D9BA 1RAOA 3D5MA 2QFJA 4ZP9A 3QJJA 4A8QA 4JI0J 1K8AT 2BXJA 2R8KA 2ATLA 1RT1A 3GMGA 4C3LA 2FVCA 4K4VA 1EETA 2E5IA 1X7VA 4JBCA 2MQMA 5BYSA 4GVBB 1HQEA 2DGVA 2YKMB 3T9NA 2O5DA 4E98A 4IH6A 1N5YB 1NPKA 4U8YA 5KFBA 4B9NA 3QNWB 3DXBA 2OUGA 4ED0A 2NZCA 3AD7C 1WTFA 5E7OB 3LGMA 3SQGA 3GLJA 4AXJA 3CCWA 1HNXF 2YX4A 2AEJA 4FYDA 5A8KA 3V5RA 3E51A 1AROP 1WKKA 4E0DA 2Y8WA 1RACB 2WVCA 2RNEA 2HRYA 1UZHA 3QWUA 1FF2A 4J9OA 1NK0A 3ZZ0A 2G1HA 1WG5A 5IV4A 5ETVA 3D2WA 3NGDA 2HURA 5D4PA 2BJEA 2VQFF 3HZGA 4I2PA 3R7SB 5K5MA 4NA1A 3PDNA 3GFXA 2B9EA 1FX2A 3P8BB 5C25B 5CD4A 2EBEA 3A1YG 3D0IE 3A3PB 1ACMB 3T41A 4ENOA 1R0CB 3G82A 1RWPB 3UNGC 1QVFR 3BGRB 4X84A 5KFDA 2LQ9A 3WX4A 3I0SB 2XB2D 2VFTA 2VG6A 1N36J 3OXFA 4UZBA 4M95A 1AFJA 2CXEA 4NOHA 4DSFA 3H59A 5CYMA 1HNZJ 4P71A 1TUGB 4OI2A 4ZLNA 1UTAA 5HQMA 4C97A 2XMVA 3M9NB 2IPOB 2GJIA 5IOLA 1UA1A 2VG7A 4E8UA 3LOUA 4MTPA 1JLEA 2NYHA 3R5AA 3Q2TC 3OD2A 3Q8YA 3EE3A 2J5AA 3KTQA 3FC9A 3GV7B 3GIJA 2LQ8A 1YWXA 3ENWA 4NCBA 2VG5A 2YWFA 3MDFA 1HBNA 4DF4A 3IN5A 5AJ3J 2J9DA 2I2YA 2YQ3A 5HJXA 2J9EA 5KG4A 3N4WA 1W25A 3QAUA 2FJWA 1FDAA 4XK8C 3HXMA 2QL7B 1AUSL 3QSYB 4OJGA 3WC0A 1S48A 1SBRA 4FF4A 1F60B 3HJFA 3AFGA 1I94J 2LLZA 4LF2A 1Y5IB 1U47A 2AZ3A 1RDRA 2E5LF 1VQ7S 1BD6A 2JVOA 5IWAF 4LQ9A 1XMOJ 2UP1A 1JLFA 2ZUGA 3D4JA 3BSAA 3NS7B 3EGVA 3KK2A 3P4UB 3QYYA 4WFAQ 2KRRA 4LFAJ 2VHGA 2WONA 3QLHA 2A2DA 3ITHB 5SUHA 4M5MA 5KT6A 4R5PA 1IJFB 4YR2A 2FZGB 2J0WA 3CCES 2XNRA 2EVZA 3W2VA 1Y10A 1TKTA 1ZAWA 1GMUA 3GFZA 1Z2LA 5D0EA 2H51B 3MM6A 4A8YA 2ZHAA 1NDLA 1UL3A 4OX6A 3FNNA 2U1AA 3RU0A 4JOUA 1F2GA 3QWPA 1F9HA 4WYWA 2DHSA 3PZPA 3DOMB 4MIAA 2V2VA 3UI3A 5F9LA 3HHLC 3OTBA 3LWMA 1HMVB 4F2SA 1EHWA 3X1LB 2VFRA 4W4MA 1KLMA 2DHXA 5CZVA 1RWWB 2NUHA 1YRTA 3MTKA 1GMWA 1NBEB 4ZVEA 4M5KA 2C28A 2YWGA 3CCUS 3R2DJ 3PW4A 1UA0A 1D09B 3MECB 1X5OA 2H5JB 4ZP8A 4OYPA 2OJ3A 2GMLA 4AFFA 5ETMA 1Y11A 5ETKA 4CH7A 3GPAA 1B64A 4NXMJ 1VQMS 1HW9A 3BBBA 3BSNA 2IDLA 1UVNA 2C1EB 2W2MP 2AF6A 2MJNA 1RE1B 1KBRA 2HGNA 1M5VC 3TA2A 2LEBA 2LU2A 3D1HA 2HHTA 4HT7A 2XMMA 2V9KA 1CQNA 3OTEA 4LIRA 2EKNA 4PWUA 1FD2A 1TKXA 3C19A 5L38A 1MMNA 2F4VF 1N32J 4B3RF 1XBWA 5A2QU 2AX0A 3W5XA 1UCNA 2IIHA 2AU0A 1BQNA 1J27A 2UXDF 1JX4A 3OL7A 1MW7A 3BGFA
chains in the Genus database with same CATH topology
4R0EA 4GKJF 4PG6A 5D4NA 3MHYA 4Y0FA 5L1IA 1T03A 3RBDA 1APSA 3Q8RB 2MKJA 4QWDA 3HHKA 3ISND 2VD3A 2KN4A 1R43A 1Q4RA 3DOLB 4LF7F 3M8PB 2Q6BA 1FRMA 1MWYA 1OO0B 2KB2A 2EFPA 5DRKA 4ZHRB 2RUGA 2NPFA 2DNGA 1SKSA 4NZ0A 2NQPA 2KDOA 1PILA 2ZKTA 2P9GA 1UFWA 3AQPA 2DHAA 4YFUA 4TU7A 3OSPA 5F8JA 2W9AA 4PQUA 5F3TA 3HVAA 4ES3A 5EX3A 4DL6A 3T9ZA 2O67A 2CQCA 1Q1KA 3I9ZA 4ECVA 2K8GA 3DRYA 5CHCB 2NUUG 2EWHA 1ZPWX 1UVKA 3PY8A 3OL6A 2DNYA 2FC8A 4ECUA 3JTOA 2X51A 3S1TA 5FLXY 4BC7A 2JLGA 3KLIB 5KFYA 4RBTA 4DQIA 3THPA 4LFCF 4L6V3 3PM9A 1S1UA 3O6QA 4HDGA 2JL9A 5BYQA 4TQSA 4C9DA 1HNZF 4J9RA 2N7YA 4ES2A 2NSBA 3GG1A 2PT0A 1KLNA 1S0VA 1X4BA 2BRLA 3QO9A 5GAHU 1LKZA 3B82A 5H9FJ 4TNOA 1X5SA 4OX7A 2KI2A 2VBZA 4DV7F 4NZ6A 1HR0F 2R8GA 1JLBA 5GADI 4RZRA 2RRBA 2XCAA 1TL4A 1DZ5A 4ELTA 2B7CB 3GFYA 4F3MA 1FVQA 3DRSA 4CI0B 4NLQA 5GAEU 3IRXB 2HVIA 2LXUA 3CJ3A 1WHVA 2DO4A 3QZ8A 1R0AA 3GE9A 2KHCA 2UZAA 3CB4A 2HW3A 3PACA 4AYBD 3MM7A 1C1BA 3H40A 4KV8B 1Q81T 4K4YA 3OR1A 2C3MA 4OI0A 2Q66A 4LF9F 4GO5X 4GO7X 3NS6A 1D3WA 2HNDA 5CCLA 1VI7A 3SZ2A 1DAXA 3TA1A 3KLIA 4NWBA 4WTYA 3SCJE 4OHZA 3SXLA 4KR0B 3FCHA 1TV6A 2L3MA 2RQ4A 3TI0A 5AXLA 4O3QA 5DG8A 4MKAA 1YG0A 2GFFA 1E6VA 3AB4B 4KT0C 3HFKA 4OX9F 3TAQA 2C3PA 1DTQA 5KFCA 3H4BA 4ID8A 1GH8A 1SIZA 3TVKA 1NK4A 2KRBA 2RD5C 3IG1A 3BM7A 2OH2A 3DLEA 1XERA 1GNKA 4NLPA 3N6MA 1SJRA 4IRDA 3Q8QB 2JC0A 2KKHA 3HHDA 5C5JA 1FRJA 3DRPB 3ENQA 3FEZA 3LPYA 3OXGA 4IOBA 3IR7B 2CKWA 4QWBA 2WOMA 1P9QC 1SV5B 5AJ3F 1GTEA 4ILRA 3V6HA 2FVQA 3G6YA 5IZHA 3PRDA 1O51A 1V9OA 2R7OA 5T7LB 2E5GA 4K4TA 1GT8A 3UR0A 3DLJA 2WRMA 1ELOA 4NLUA 2BJDA 2IM0A 1VK3A 4AQYF 3R1HA 2B43A 4IRKA 4M1KA 2BE2A 1C1CB 3CGIA 4TYAA 5J1EB 4IOAQ 1YQHA 3OUYB 3Q23A 2KT3A 3TVYA 1U24A 4EZ6A 3OL9A 2KXFA 4O3NA 4RW7B 1I6JA 4RLEA 1HNVA 3RRGA 1YGYA 3CCRS 1FCAA 2ZFHA 2YNIB 2MYFA 4IFVB 1JMTA 2J0SD 3E3XA 1I94F 2ZKUA 4Q5VA 1HNIA 1V3RA 1FNOA 1VC5A 1VQYA 2CZ4A 2LCWA 1SJQA 4AL5A 1S6PB 5F3ZA 4ECXA 4I56A 2RKIB 2NPIA 5IT0A 4DLGA 1UVMA 5E0OA 1NJWA 1JJ4A 1UKUA 1Z4UA 3KNAA 2DITA 2DGQA 3H5YA 1UWBA 2E44A 4I68A 4QIWD 1RTJB 3G6ES 2VV5A 1RT3B 5T7LA 1FT8A 2YKMA 2KFNA 2F1FA 4NRTA 2C2EA 1RAJA 3LP0A 3KG4A 4CO2A 4JI1F 5KFOA 2K1RA 4KE5A 1N5YA 4Q43A 2AJQA 3I5BA 4KBIA 2QZ8A 3J81Y 2QLWA 5DDQC 4LFAF 1C2PA 3OTOF 1YJRA 2R7QA 2FLOA 3B4DA 4A48A 3MURP 2MHEA 3FFIB 5LSRA 4DV3F 4CNZA 1VC0A 1QSLA 4Q0BB 4DBQA 2A1BA 4MIWA 1F0XA 2HMIA 3Q0AA 4GC7A 3ZFVA 4D3HA 4EWTA 4I6YA 4J9NA 3LGNA 1T05B 3CSKA 1S6PA 3MPYA 3SSSA 4I4BA 3UE2A 4NCGB 3OJSA 3K8WA 2NZ4A 2J9DE 2J7WA 1IBLF 4OIXA 2E66A 1S6QA 4UUWA 2HHWA 1D9DA 4H54A 2VC1A 4MYUA 4H4KC 5B7WA 4WKRA 3MPVA 4MAKA 1NAQA 3PO5A 2DGSA 4GC6A 1QVGR 2VPWB 4OLOA 2YKQA 2M4MA 2I5JA 1X4AA 2DNRA 2LQ5A 2ZVSA 2X3GA 4DG1A 2W9CB 4OZLA 3PR4A 3SFUA 1S1XB 3I0RB 3UDCA 1WHWA 5G4DA 3U1LA 2OPRB 1OQ3A 3MR5A 1X9WA 2J9CA 5KFRA 2N4CA 4HI1A 1U1OA 4DSKA 2RF2B 4PWDB 3D54A 4DL7A 2UVUA 1X5TA 2N7CA 3M1VA 2V2KA 1LWFA 2WSFC 4P7VA 1TKDA 4K4SA 4DR5F 1WHXA 3C6UB 5D77A 4Y6IA 5HROA 1SKWA 2NR0A 2IMWP 3O1LA 2DISA 5C25A 1S99A 1YJTA 4X4QA 1H38A 1C4AA 4I69A 2KH9A 4B9VA 4MYTA 1N5VA 1PSDA 3RRKA 3CC2S 3MFIA 1VQOS 4KFBB 2XCPA 1RI7A 4IRCA 2GO9A 3CIMA 4Y2MA 4ZMMA 4RU9A 4ZPDA 3ZZOA 2UUCF 3P49B 2RJZA 1QSYA 4I2QA 4USJC 3PNIA 5D4OA 5L9XA 2Q1LA 2DBBA 4I64A 1G7CB 4O4GB 3BGRA 4B9UA 5J2QA 1RKJA 3H25A 3IAM9 2EK6A 3F44A 2AGOA 3GB0A 1H98A 2XNQA 5EX0A 4N8OA 4ED7A 4KC5A 3I0SA 3EZ5A 2LYVA 1RYSA 3K59A 2K7KA 1TAUA 4NLVA 3GV5B 2MPUA 3Q8PB 2QRRA 1BQMB 4V19X 4YOEA 2LXIA 2W24A 1H6KX 3VAKA 3IO1A 5J1NA 5AE3A 2IBKA 2B3TB 3PJWA 4PXCA 5IQQA 2HYIB 2CVEA 1R31A 4CH0S 4C7QA 4QU7A 4ECTA 3HVRA 3ONQA 1V3ZA 3J7ZT 4RW9A 4B9LA 1UEVA 1XC9A 5L9NA 2EFOA 2JX2A 4LT6A 2A10A 2IRUA 1AFIA 5KFQA 1JXEA 1TKZA 4C8YA 1REVB 5FDLB 3FEYB 3V6KA 1NNDA 2BANB 1ZM3A 1HFEL 3I31A 4N77A 1RP5A 1SQEA 2W7PA 1S77D 1JWWA 1Y5LB 1ZM4A 4YR0A 2QV6A 2V8VA 2HNYA 1JLGB 1DQ9A 1Q7LB 1SL2A 4DQSA 1TP7A 2B4UA 1FDBA 4ZDNA 4DQRA 2NS1B 2WB1D 2HVZA 5HMYA 3H5XA 4WXWA 3BJYA 1MWZA 4EO8A 4O44A 1Y9OA 4IFYB 3M9MB 2RU9A 4USHA 1EP4A 1RK8A 2I8EA 1IKVA 4F4ZA 3N28A 3MEGA 4K59A 4TN2A 2WTFA 2PI5A 3SSQA 2FLNA 2HLTA 1FESA 2MKSA 4ZP7A 3PV8A 1HD1A 1TL1B 1LW2B 1CC8A 2HWIA 1Y0HA 4ED1A 1FRHA 5DQHA 3BO4A 4ZPCA 2KZZA 2AW0A 2YNHA 2N3OA 1K73T 3C66A 2WB4A 1M5KC 4LF4F 3HVTB 1K1QA 2OPQB 5CCMA 2HVHA 1YTYA 2HWTA 1JLGA 4ZCKA 4ID5A 5LSLA 1ZAXA 2R4FA 2D9OA 1A9NB 1E6YB 1IM4A 4F4WA 4XDCA 1UW4A 3DYAB 2L48A 4QR2A 4IG0B 1XR5A 5CQGA 2CQGA 5DDOC 3HPOA 4ERDA 1X0FA 3FZBA 3UDLA 1JNRB 4OLPA 5DJBA 2JJ4D 4Y28C 4NA3A 2XGQA 1YITS 1K1SA 3I5AA 2MZJA 3JSBA 2W7AA 2ZD1B 1I1GA 1ULRA 3VQSA 3DLLQ 3M9OB 5KT3A 1V6HA 2V5HG 2XS2A 3G6XA 1H7WA 2E29A 2RE1A 4YB7A 4PKDB 1G2EA 3HHEA 3IRWP 2DH9A 4QIVA 1U1MA 2LA4A 1VRUB 3DHXA 1S1VB 3K8VA 4A8OA 2EFGA 3HKWA 1OS5A 3PW5A 1OQ6A 3PX4A 3NLCA 1U1KA 2JHEA 3TA0A 3M30A 2JFKA 4OHXA 5GVQA 3C46A 1U6FA 1RT6B 2CZVC 3AA9A 2E7WA 1FKPB 3I87A 1RYRA 5K8MA 1S0OA 3LP1A 1SXLA 4ZPVR 1M90T 5I4MA 1H2UX 5FJ4A 3JTPA 3IR6B 4NRUA 3S01A 3T1YF 3TUZC 5DG7A 1TL3A 3LUYA 3MM8B 4D3GA 4ETXA 1X4CA 3PFEA 3M2RA 4X4NA 3CD5A 4HEA9 3JSYA 4KKOB 5FD1A 2Y1RI 3VAHA 4QR0A 4C3MA 4JI7F 4IO9Q 1VFJA 3LAMA 4M5DB 4YDXA 3CCLS 3RZAA 3DLHA 2R7TA 4ZVGA 2DIUA 2F9DA 5KFIA 1DBDA 2R2TA 3CCMS 1QAIA 4K0KF 4FXVA 2ASDA 3SV4A 1LQ9A 1IXKA 1S4FA 3NS5A 4PXDA 1UVLA 2O3DA 3ITHA 3MEDA 3WZ0A 3MM9B 1K0TA 4FXWA 4KO0B 3EXCX 5EDWA 2QMXA 2KXHA 4OJ3A 3D0HE 4ATNA 3GIKA 1NJIT 3EYZA 1QM9A 3K5OA 4X4RA 4B3OB 4KJIA 1SH2A 1ZM2A 4UW2A 5MLCV 3JSRA 4QW9A 1H3DA 3ZC4A 3DNCA 4DR2F 1U25A 1S9GB 4DJBA 2MHNA 2DK2A 3M6WA 2R8IA 4G1PA 4TY8A 4B17A 4JI6F 1W2BR 1CSJA 1AW0A 3OLAA 2YKNB 3DLKA 2HNZA 5HLFA 1JK9B 3F56A 3M32B 3PW7A 4WU2A 3RYLA 5KG7A 4PUOA 2X1BA 2ILZA 4ZVFA 4A8WA 1RT2B 2RSQA 5G0RA 3T5JA 2IHR1 4F4KA 3T1AA 4X4UA 1TUVA 1UJ5A 4LQ3A 1CEZA 2I9SA 1KTVA 1S9EA 2BM1A 2FHJA 3KWMA 1VQ4S 1RT4B 3QMQA 3J7Z5 2CQ3A 1VOMA 5D8HB 2CPFA 2FHMA 2FHOB 3GFHA 5KG6A 5I3UB 2OLWA 3KLFB 4DV0F 1X8DA 1NEEA 2AYGA 4OZJA 4B3MF 2ZJQQ 1SL0A 2OO4A 5KOXA 1JLAB 1YJNS 4OI3A 1B7FA 2VFVA 3PIPQ 4H4MA 4O4RA 4WFZA 1S1WB 1WEYA 2O01C 3AJ2A 3K58A 2RU3A 1JLCB 1TL5A 1S76D 3DOMA 1U45A 5I3PA 4OZNA 3MM5A 3MTJA 1WELA 1O5JA 3TRGA 2MKIA 1WWHA 4KAIA 1IQZA 1SH0A 3NNHA 4OI6A 2VONA 5BR8F 4U6PA 1HL6A 4ZCMA 3G8TA 2HFOA 3J7YU 2BACA 3JSMB 4IG3A 1IQTA 2KZMA 1WEXA 2DH7A 1RA7A 1HWLA 3BGLA 4B9MA 1FA0A 2G0CA 2R7RA 3BR9A 1HMVA 1IBKF 1UEUA 2JC1A 4MFBB 1RTDB 4F02A 4UQGA 2B9YA 1N0UA 3R27A 3TUIC 1GX6A 1HBUA 2CQPA 2VKZG 4DQQA 2MSTA 1JLAA 4OZ0A 3UQSA 3V4MA 3Q8SB 4IH7A 4DR3F 4DFKA 4Q45A 1SJFA 3HF5A 3SCLE 5D4LA 2FVPA 1IKWB 3S7RA 1HBMA 5J2MB 1RTIB 2YY3A 3M2VB 1NJXA 3CD6S 1HQUA 2AP6A 2WHOA 5IQ6A 1YRUA 2YNGB 4K4XA 2DR5A 2DNMA 2XSJB 3KK1B 3M2UA 3TVZA 1B0VA 1ZBTA 4C0OC 4DR7F 4NXNF 2VPZB 3DI6A 4EBEA 3QIPB 1ZTWA 1S0MA 2KYXA 1HHTP 3OVBA 2BW2A 5KG2A 2PC6A 3QAEA 4IDKA 3JSMA 1LW0B 5D3GB 3CIZA 2CQHA 2D3OR 3X3UA 1U6ZA 3HZEA 2DIVA 4FF2A 1NK7A 5C24B 2HHQA 1MROA 4IR1A 2R7WA 2KTQA 3OW2R 1HW8A 5HN0A 3KLGA 3EXYA 1U4BA 4B9TA 2QA1A 4QIEA 3R5DA 1KFDA 4G1QB 4AE5A 4O0IA 5I42B 3MECA 2VZ9A 3O5TB 2M52A 1FO1A 5DDRC 5CD4H 4RNNA 2RILA 2ZNYA 3R1LA 4RKUC 2E1AA 5E5NA 2BQRA 2OTJS 4QR1A 4J9SA 3ULHA 3NGKA 2EW9A 2KG1A 1DTTB 3N5BA 3C6TA 4F67A 1PO6A 2OFHX 2FJDB 3FQKA 5HL7Q 2J6UA 4DSJA 1XR7A 2PMHA 2M0GB 2M88A 3JTNA 3WBZA 2G13A 2Z0GA 2E9TA 2XBPA 2E1RA 3CD0A 3MMAB 7FDRA 2B4VA 4RUHA 2QIFA 3P6YC 2ZBCA 3G6VA 4IOCQ 3KYLA 4IR9A 3DOKB 4M8LA 2GV1A 3CT9A 4C8NA 3UFCX 1X4HA 2YNFB 2GGPB 2GC8A 4QPXA 4RUCA 1R8PA 1U09A 1WNEA 4X4SA 1ZPVA 3WC2A 4ELVA 1ZM9A 4K2XA 4X4OA 4DFMA 1HYSB 1TVRB 1JKHA 2D7SA 5IM0B 4LF6F 1IUJA 2FUG9 2B4OA 2BRKA 5LMNF 4NLOA 5J2NA 1U6BA 3OPKA 4CNYA 3FDSA 4G1QA 2IFXA 5F0UA 3V6DB 2EFVA 2VOPA 2M5YA 4AL6A 1QY7A 2XHWA 3Q2SC 1RTHA 4X65F 1UFLA 5D4PA 4CO1A 2Z2LA 3VTIA 4ICLA 3G71S 4PXBA 1FNXH 1HPZB 2J6TA 1N6QA 4FNHA 1FDNA 2P6SA 4U67Q 1S97A 2WAQD 4OJ1A 4J9QA 4I7FA 1LOUA 3HO1A 2VPYB 2MDAA 4LSLB 1F5CA 2R8JA 1IKYA 2XI2A 3POTB 3KJVA 2ZH6A 3PKMA 5LJ3Y 4YDDB 1NH7A 1JJ2R 4ILLA 2NYIA 2IC3A 2XMJA 2M8HA 5EUHA 3CJKB 2VQEF 4HTIA 4IH5A 3BO2A 4NPOA 4RWXA 1U49A 2MQOA 4DR6F 3NMRA 4URSA 4PG4A 2A2CA 4OFZA 1HBOB 4QZVB 2XMKA 5DQIA 2CPXA 1X0PA 1N36F 2MQPA 2ZM6F 4Y3CA 4C0HA 4CO5A 4CTAB 1M0SA 1AXQA 3K5PA 5ITHA 4LSNA 1N34F 2CJAA 4K4UA 3I4PA 1RT5A 1WHYA 2FDNA 3CDBA 4AL7A 3TAPA 3QJLA 1HWIA 4OMFG 2Y1IA 1LK5A 4BWJA 3MUVP 3MEEA 1YIJS 3PO4A 1DLOB 3QZ7A 4CT9A 4UOCA 3N0VA 1NJZA 3G9CA 5JJBA 2XEXA 2MXYA 1C4CA 2RQCA 1N52B 2UUBF 3LH2S 2UUTA 3DOLA 3TAMB 3CE8A 4XPCA 3M8PA 1KOOA 1C0TB 2W9BB 4ZHRA 2AYEA 4RNHA 5KFZA 4HYKA 1L5UA 2CQDA 3FZ2A 1VBXA 2E9RX 1T3OA 4ZP6A 4A8MP 5AE2A 1RISA 4KGMA 4K4ZA 2FJVA 2F3JA 2BDPA 4C2MA 2HQ3A 3IBWA 1NKEA 2RT3A 2CQ2A 1CLFA 3KLEB 4L3NA 4OHVA 3OXLA 4CTAA 5H9EJ 4OHYA<