5GAGI

Rnc in complex with srp-sr in the closed state
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
ALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYVTEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords SRP 4.5S RNA
publication title Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5gagI00
4V19J 5GAGI 1ZAXA 2QA4G 5D8HB 1ZAVA 3A1YG 4UY85 3J7YI 5GAHI 5D6GA 4NWBA 5GAEI 3JSYA 1ZAWA 5GADI 3J7Z5
chains in the Genus database with same CATH superfamily
3TEGA 4I7FA 2HIYA 1OY9A 1R8CA 4RW4A 4O4RA 3CC4S 2C2RA 1DQ9A 2E1PA 2R8KA 5F0UA 2ZH2A 3R5JB 1X8DA 3D6FB 4CZCA 2V2KA 3CJ8A 1JLAA 4R0JA 2J8SA 1FRLA 3HPOA 1WACA 5ETVA 2IDEA 3QIDA 3KLEA 2FDNA 3DLGA 4OI1A 4U8YA 5JMNA 1QJHA 1VYAA 4OV6A 3J81Y 1VQOS 1TL7B 2DGQA 2AEJA 2AF6A 1UCNA 5AT1B 1BUXA 4O3NA 4I56A 2HAFA 2F9JA 2ZOGA 1B3TA 3TVKA 1N32J 4TLRA 2M5YA 2ZZNA 2LQJA 5BYRA 1V9OA 2PA3A 3GV7B 2FY8A 5D0GA 2QA4S 2HHSA 2CQHA 4JV5F 4KT0C 3RB4A 2APOA 2XGQA 2DTJA 1QAIA 2L41A 2HKEA 4MK8A 5CYQA 3MFIA 2KL8A 3CIZA 3OL8A 1W2IA 4JV1A 5LMUJ 5J2QA 2ZITA 5IWAF 1NCLA 5LT5A 1XNQF 1IN0A 1VHFA 5FDLB 2YWGA 1TV6B 1FTCA 3KK2B 4J5OA 3CDAA 4PQUA 4DL7A 1S9GB 4DUYJ 4BWMA 3GMGA 3CD7A 3C46A 3UD4P 2EBEA 1XWLA 2CUYA 4EI2A 4EBDA 1T94A 1FT8A 3FRZA 4TVAB 4OJ3A 4ZVSB 4PWDB 3AOCA 2XM3A 1YDLA 3QRPA 5KFEA 3OL9A 3BR9A 3DOKA 1RBAA 3M6WA 4ES1A 2DKOB 4J90A 1IKWA 3Q89A 1RISA 4DPYA 2V5HG 4DFMA 3NCRA 3PG9A 4B3OA 5ETLA 2VBYA 1SUQB 2E5HA 2CNOB 1Y7PA 4C97A 2VBWA 5IM0B 3CT9A 5KT3A 3EMTA 1N0UA 2B5JB 5M2UA 4DV2J 3OQ2A 1RHRB 3BREA 1N34J 2CPIA 3VV2B 4JI4J 3QIPB 3ITHA 1KTQA 4EO6A 2B9EA 2E5JA 1JLFA 4DHVA 1QAXA 1RJJA 2UXBJ 3MF5A 3GFYA 1DLOA 4X4NA 3I9V9 2IC3A 4JB8B 3I55S 1F9FA 3MECA 2NPFA 2YKMB 3BSOA 4KO0B 5AJ3F 4OZ1A 7FD1A 1KLMB 2AU0A 3D6MB 1LWXA 2W2MP 4R25A 2V8DA 3TZXA 3N79A 5F8MA 1ZTTA 3D3CJ 4A46A 5B0GA 3J7AN 2UUCF 1RABB 2RJZA 3ZZPA 4DCOB 1YZ6A 2YNFA 3PYGA 4P7VA 4CO4A 2R7UA 3HSZA 1FD8A 1RA7A 1DY3A 3PTWA 1X9MA 1EETB 2ZD1B 1RWXB 5EUHA 1SV5A 3Q8VA 1JLBA 4DZ6A 1JNRB 2CVIA 2JLGA 1PSDA 3D3BJ 1N5YB 4FF3A 5LJ5Y 2DRBA 3OXFA 2ERRA 1JLCB 3PKYA 5KT2A 4ITSA 4ZVPB 3QRRA 2ZBPA 4AL5A 1VQ6S 3MM8A 2V34A 4IO1A 3LP1B 3LF0A 4ZPDA 2M52A 1ZPWX 2YWKA 4YB7A 4KGZB 4M5GA 3B4MA 2NUUG 4DXLA 2WVCA 4LIRA 1OPZA 3LP2B 3BSCA 2GJIA 4BDPA 1F9HA 3CCES 4U9RA 5HLFB 1ITPA 4GVBB 2DR8A 4AQYF 3UQSA 2LA6A 5GAHU 4Q0BA 5HJXA 5FD1A 2PI4A 4YQWA 1U4BA 5KG4A 2ACMA 2NXEA 2P5VA 4LSLA 2W4CA 3FMBA 1WKJA 1MMDA 1RP5A 5IZHA 4MFBB 4X66F 5L46A 3SCJE 1IR0A 2CQ0A 1RHUB 4X65F 4OX7A 1S6QA 4FKYA 2MZJA 2JOQA 1GX6A 3LH2S 2W4PA 4N8OA 3RR8A 3M2RA 3C6TA 3QBCA 4MK9A 4IH5A 1ZYQA 3I87A 3SSQA 2DNPA 1JLGB 3QYYA 2BQRA 2HZVA 4DJBA 5C42A 2OPSB 1UMJA 2B4UA 3AXKA 4IH6A 1TL3A 3EGWB 5M2PA 1Q7YT 2IYGA 7AT1B 3CNQP 4C7QA 3NBPA 4EYHB 3Q8UA 4F0KA 3CJ2A 2VJVA 4Z7YA 5HROB 2DGUA 2IRXA 1WTBA 1DTQA 4YS2A 1NK4A 3ZTQA 1HQEB 3IR6B 4KFBB 3DRSA 4ZVUB 3KOAA 4C3MA 2NCKL 4HTIA 3IWNC 2IPOB 3CJKA 4BS2A 1N0VC 3N9UC 2FZCB 2GMHA 4MJKA 4YR3A 4QWAA 2UUBJ 2YX4A 1F5AA 3MD3A 1MMLA 3DU5A 4ZN1A 4P2FA 4XO0A 3CCMS 1PAUB 3CDWA 2MKJA 1Z2ZA 1SIZA 2JVOA 3IS9B 4KGMA 1LW0A 4Y6IA 2COLA 3UD5A 3H40A 5A0YA 1RQ0A 2RUSA 5KT4A 2FYXA 3NCPA 4ID5B 2Q66A 2CXEA 4ZPVR 3CJ5A 1WC0A 3K89A 3M1VA 3AD9C 3C15A 4AL7A 4USUA 4WP9A 2DITA 4JI7J 2VFUA 2R8GA 4IDKB 5EX0A 3U1MA 5CAAA 4JOUA 1HPZB 2ALYB 1NKEA 2J6TA 3KNAA 3WC2A 2HPUA 5ADZA 2EKNA 2J0WA 3CCJS 1UPMB 4RPFA 3D5MA 5GAGI 1YLXA 4HT5A 2IFXA 1B0VA 2RHSB 1GXTA 2VBZA 2K3KA 2YPYA 1TK5A 1WORA 4DEZA 3EGNA 2VASA 1ICEB 2W01A 2PE8A 1CPZA 3NGSA 3D1QA 3EDQB 2DGTA 3DRXA 4EMDA 1JKHB 1IKVB 3CJTA 3AA8A 2C42A 4BLGA 3F44A 3UW1A 1JJ4A 4BCAA 1HWKA 2K06A 1G4CA 2GQQA 2OMOA 2VOOA 4DU8A 5BJRA 3UI3A 4FN5A 1U7LA 3I0RA 2HHWA 3OVBA 2NLWA 2OP5A 3VQSA 2DNOA 2EFGA 3RU0A 2AP6A 3SSRA 1EP4B 1LFWA 4IQMA 2XQCA 1S9EB 1PCAA 4Q7AA 2EPIA 4QIVA 5U47A 3HKZD 1RYRA 4RW8B 4I64A 2ZFHA 1IBKJ 3H20A 3DM2B 5DRKA 3BH7B 5KFNA 4WU3A 2CJXB 1F2HA 3FRYA 3NMRA 1JXLA 5K8MA 2K3IA 4YB1P 1ZPVA 2UVVA 1CJUB 1U6FA 1CBKA 2C2DA 1LXNA 5EWGA 4KR0B 1N88A 3CMQA 3GQCA 4PXBA 2IVMA 4AE5A 4NYOA 5KFOA 2AKWB 4OJ1A 1V6HA 2FGOA 4ED7A 1T9YA 1XBWA 1S7HA 4EYIB 2GMLA 3QLHA 3J81U 4J9OA 5DO2A 3MR2A 1FXLA 4UQGA 2CG4A 1K0TA 2FLNA 2EVZA 2QSFA 2ZH8A 2ZBRA 3TP2A 2DB1A 1P6TA 3ZZZA 1HWIA 3KLHA 2QJ3A 3BQ1A 2FHJD 4A8FA 4TKTA 1RCXB 3MEKA 1M0SA 4X4PA 2KT2A 4ZVGA 2W2OP 3MM7B 2MLYA 1PBUA 1KLNA 1MROA 1HA1A 1N36J 3V81A 4KGVB 3HHDA 2AMCB 3W9JA 4WZMA 3E01B 3K2YA 2LVWA 5JXSA 4DFJA 4RUHA 4OHVA 1HBUB 4CCHA 3A13A 2UU9J 2EBGA 3F0NA 1XJWB 2RB7A 1XMQF 2EFOA 2F5GA 2X3GA 4DFKA 4B9MA 2RILA 3I9ZA 4M63A 3FCHA 4NLYA 3GIKA 2FTRA 4MT1A 3A8JA 1F5CA 2RHQB 2R7TA 4M5NA 1VQ7S 2HNYB 3SDEA 3EGVA 1T03A 1UW4A 2YWFA 1DTTA 2HAIA 4YP3A 1NPRA 5ETQA 1UVJA 4RWXA 2YX7A 1HNWJ 3MR5A 4MMOA 2F9DA 4DR3J 1Q8LA 4Y2CA 1WD6A 1U02A 3KHRA 3A1YG 4ELUA 2VJUA 3S6EA 1RT5A 1HFEL 2F4VF 2PT0A 1UVNA 4B3RJ 1FCAA 1NB7A 2GVZB 3CXCR 3I96A 1CULB 2OSRA 3M8YA 4ZPCA 2QSWA 1T02A 2C3YA 2JC0A 2JEFA 1PYSB 4KHPF 2ZBQA 1EIYB 2AJ4A 1N6QB 1LEOA 1P27B 1FDBA 3R2DJ 3DLHA 3ISNC 3TI0A 3I56S 1O0PA 1T05B 1RGVA 2X51A 3SYZA 2VG7A 3OFGA 1TKDA 3FEXB 1PG5B 2Q6BA 3HHKA 3HM9A 1HR0J 4LSNB 1HWUA 2H4WB 4OZJA 3OTCA 1VI7A 1BQMA 2CZ9A 3W1YC 3DOLA 2A2CA 2J0XA 2ZM6F 1BC6A 2NSCA 3RBXA 4OX8A 1ELOA 3KMQA 2G2YA 3A8EA 4NPOA 4CTAB 1Y3JA 3MM9B 4WFNQ 4YDDB 2D7SA 3NNAA 5CHCB 4ZP7A 1WHXA 2CPFA 1T9TA 1MU2B 1JJ2R 2GS8A 2A10A 4MH8A 5KFJA 3M4XA 2PEBA 1X4GA 1TK0A 1QSYA 4URSA 4C11A 3HSGA 3A3OB 5LSOA 1FRMA 4NI2B 1X0FA 4AL6A 1JXEA 1RTJA 1HWLA 3L7UA 3KJVB 3LW5C 3DDNA 1NSQA 1WUUA 2OPQB 1G6BA 4Y0FA 3M8QA 2MYFA 2VQFJ 2VQEJ 2L3MA 4Y28C 3FMWA 4OI4A 3GSIA 1S6UA 2XLJA 1WC5A 2AYMA 3MOJB 2R4FA 5EHHA 1QSLA 1NK9A 2OLWA 3NCQA 4OZNA 1FI4A 1VQPS 5A6PA 4B3SJ 4M5DB 2PFFB 5IQ6A 1F1BB 1FFWB 4AFFA 2H5IB 3D1HA 2GX8A 2ZKTA 2OKQA 4B3MF 3M6UA 3PHTA 4K2JA 4NLSA 3SI8A 2HQGA 1KD1T 2FJVA 2VC1A 4V19X 5C2GA 2E9ZA 1VFJA 3MPUB 1N5VA 1V3SA 1ZBTA 2DXFA 2ZNYA 3DLKA 4I2PB 5KFQA 2YKPA 5C24A 3KLFB 4PKDB 4EUVA 5KT5A 1S5ZA 5D3GB 4R0EA 2RQMA 1P1LA 2ZJRQ 4L3KA 5KG5A 2YH1A 4EZ9A 3NKYA 1J27A 1C4CA 4LSZB 3GG1A 3G8QA 3TAQA 4H4OA 3AQOA 1X9WA 3HHLC 5J1EB 3FK4A 1Q5VA 1WG1A 1YQHA 3UNYA 3QAUA 4ZCMA 2OTJS 3PFOA 3QT6A 1FO1A 4F3MA 1NO8A 4CO2A 1LW2B 3CCRS 1ZA1B 2LCWA 2VG6B 2GFFA 1M5KC 2AYBA 5HMYA 3T1HF 1F5BA 1MW7A 4DV0J 2R9LA 1UJ6A 2E29A 2EKYA 3RBZA 4WYWA 2LDIA 1K1SA 4HLBA 3OTOF 2GO8A 2BYCA 3DI6B 3T5LA 1RXOB 1KONA 2PMHA 2W9BA 4CLLA 3UD3P 3CVKA 4FF4A 3BH6B 1X5PA 5B0AA 2AW0A 4GC7A 5E3RA 1I1GA 3FZ2A 3TX0A 4IUFA 4LF7F 2M8HA 4O3QA 4JI2F 3RBEA 1KOHA 1HI1A 3CCWA 3THPA 2H5JB 2GIRA 3KG4A 4PG5A 4DL4A 4I69A 5ETPA 3MMAB 4Q44A 2E7VA 3BKUA 4DV1F 2DCUB 1ZAWA 5BR8J 3TJ9A 1K0VA 4L75A 2UXDJ 4A8KA 2GZOA 5KG0A 4WFBQ 1VCTA 2JLFA 4YHHJ 3EE3A 1IBLF 1TL7A 1FKAF 3AB4B 3W2WB 1M1GA 4QWCA 2W25A 2V67A 2WOMB 2MSSA 4U96A 1CJVB 4C8LA 4RW6B 4RU2A 4DPTA 2CNLB 1ZS6A 3M30A 4IG3B 3HD1A 3M2VB 3CB4A 3OW2R 2DJWA 2AJ1A 2RRNA 3NRBA 4NYZA 3MTKA 3GR1A 5HQLA 1NJWA 4BWJA 3CMES 5ITHA 1OPIA 2P6SA 2ZH5A 1D1UA 3GJTB 2V4QA 4M5IA 1DURA 3C19A 1VRUB 5FDLA 2OH2A 2F8MA 4AUKA 1TV6A 3KK2A 3R7NB 1S9GA 2ZH4A 5KFTA 1RT6B 1TVRB 3ZXWA 3POTB 2IRUA 2QN6B 4MAKA 2BABA 3OD2A 2BKPA 1Q86T 4JI8J 4PWDA 2GA7A 1FDNA 3BKFA 2IDLA 1SI9A 3Q0AA 3CMAS 4A8OA 5HMWA 1HNZF 3H25A 4OI6A 3BQ0A 1WSVA 1S0VA 4OZ3A 3NOCA 3GIJA 1JX4A 2ALZA 3QO9B 4IQXA 3IWXA 1VC0A 1IM6A 1SQEA 4WTYA 4QYZJ 4KGXB 1SUQA 2U1AA 3QT5A 4RO0A 3V5RA 4K4VA 1UWBB 2B5JA 2PMWA 1YRXA 1CC8A 4DS4A 3NY0A 3BV8A 1ZZFA 2UVRA 3M9OB 3TZWA 3IRWP 3QIPA 1CLFA 5GADU 1TKXB 4P74A 2R7VA 3IWLA 1VK8A 3KUEA 5ETOA 1RT4B 3CCZA 3CJ0A 2HQDA 3ZZRA 2XSFA 2RU3A 3KLIB 2B51A 3LWMA 3S1TA 2QO3A 2GMJA 2YKMA 3N01A 4KO0A 3IR7B 2DYAA 2QT7A 1KLMA 3K57A 5DM7Q 3NGTA 1WOSA 1VIXA 3BBCA 4TU7A 3LPYA 4WK1A 3CO0P 3OV7A 4CNZA 3EZOA 3FNNA 3UCGA 3DC2A 2V68A 3PJ9A 1TTHB 1IUJA 4LF5F 2DEIA 1MNEA 2JZ5A 3GV5B 1EETA 2ZD1A 4A4JA 1TKZA 1KP6A 5H9EJ 2Z57B 2F8HA 4WWSA 2NZ4A 5KFYA 4C48A 2MLZA 3W7BA 2BJ1A 2F8EX 3VVUA 1VQ8S 2DXEA 3I4PA 6FD1A 1XMBA 4F8RA 5AXKA 3ZO7A 3C2PA 4HVZA 3IP0A 1JLCA 4N41A 4UT4A 2EFNA 1HQUB 2ZNZA 3AB2B 2QLWA 4QYZK 3HVAA 3KUHA 5F3ZA 5I4MA 1YG0A 2ZH6A 1H98A 5D8HB 4CO0A 4DQIA 3LP1A 5HI7A 2OPPB 2G0JA 1WKLA 3ILLA 3LP2A 1NKCA 1Y3KA 2BM0A 1U1KA 4OYIA 4EEYA 2HYIB 3HZGA 5HLFA 3BS9A 1U1NA 2UUAF 3DRYA 3R5BA 4GVBA 5E3PA 1C0UB 2DGVA 4JV5J 3BZQA 3RB6A 4IYQA 3TX8A 2KG0A 1VK3A 2E1MC 4DSJA 1Q79A 4L72B 3Q23A 1H6KX 3V4IB 2J76E 4Z37A 3O5TB 2I1RA 3AJ1A 1KQKA 3QRQA 1B0TA 3TRGA 3TJAA 5IWAJ 1X5OA 4MFBA 1XNQJ 1SCJB 3U02A 4QWBA 2LFVA 3L95X 2HS0A 1YBTA 4B9NA 1Q53A 2C2MB 2B9XA 4X84A 4ZKAA 3P5TL 4PYAA 3VAHA 1FEEA 5D77A 4QU7A 4YMEA 4WE1B 2E66A 1UZDA 2XSJB 5F41A 2FHKA 5H9EK 2E5LF 3MUVP 4DL6A 1JLGA 3R1HA 2NS1B 4NA2A 4FP9A 4EK2A 3ULHA 3AOAA 1SC1B 2OPSA 1M5VC 2CADA 3VF0B 3AHPA 4NCAA 1LWFB 4ZJLA 2WVEA 4DX5A 5L9NA 4FXVA 5HROA 3O44A 2KYXA 2L08A 1HQEA 4KFBA 5ETTA 4ZLJA 1D9AA 3GCXP 2YX1A 1RLDA 1LXJA 4QQBA 3UN5A 1VLYA 3H2LA 2KU7A 1YJRA 4ZJQA 2MKIA 2BW7A 5IS2A 1NK7A 1LK5A 4QR0A 3PZPA 2V4RA 4GVLA 5IC6B 2R7OA 4FS1A 1HKAA 1XEZA 4ID8A 3DXBA 3IS9A 4HH1A 1R89A 2YNGB 4TN2A 1FA0A 4ED6A 2HWHA 4EFAC 5AJ3J 2DBBA 5D4OA 1RUSA 4H54A 4B9LA 3B6BA 1S0NA 2HNZB 2P9EA 4ZP8A 4HHUA 2UUCJ 2M4MA 1CJKB 1NAQA 4ID5A 1RHKB 3BPSP 3QJLA 3IR5B 4MIBA 2BJ3A 1S1UB 2ROPA 4LVNP 5LL6d 5CYMB 2JHEA 2W9AA 3HSJA 2MQQA 4PXDA 4ED0A 1CG2A 4IDKA 3Q8YA 3HKWA 5IT0A 1HPZA 3QPIA 1VC5A 3AJ2A 2WBRA 2FVQA 3M7VA 3ZZ0A 2VICA 1P9QC 3MOZA 4KHMA 4QR1A 3AAWB 3MCNA 2K1RB 2Z30B 2V4JB 1S0MA 2QLXA 3BJYA 1TFWA 1M1KT 3BGOP 4M8LA 4PR6A 1JKHA 2QE5A 1IKVA 2FZGB 3RZAA 1R7IA 2KXHA 4RBTA 4WIIA 3SCLE 3MUTP 1B99A 3R6LB 4MIWA 2MZRA 1N33F 1S7IA 3BN4A 3QT7A 1N52B 4KPCA 2AEMA 1EP4A 5B0FA 3P3DA 2JRSA 5EWFA 4DF8A 2OEKA 1S9EA 4GC6A 4AQYJ 1CSJA 1VMBA 4U6PA 2QA4G 1JXVA 4Q2LA 3U1NA 2X1GA 1E6YB 1Q4RA 2VIHA 1GX5A 4RW8A 5HMZA 2HQCA 4UOFA 5BXIA 2J9DE 3DM2A 3K5OA 4X66J 3NP5A 1KTVA 4P71A 3AY0A 5L39A 3HX9A 4X65J 3RUBL 3I6PA 3MAQA 3M6XA 4UZCA 3HULA 3FCWA 4ZVOB 4DL5A 1C4AA 4PPZA 3CDBA 2W1BA 2H54B 4CT9A 1PJ7A 5KFRA 4YN3B 1CJUA 2MKSA 3FBFA 2E9TA 4CQ1A 1O8BA 2R42A 4DPOA 2ZHAA 2BM1A 3A3PB 1WC6A 2LXFA 1CEZA 2BACA 2DNKA 1GNKA 2FD2A 2ZKUA 1JLQB 1S77D 1JB0C 3B8HA 4USJC 3GV8B 1SKUB 1R0AB 3DMJB 4QJVA 5HP1B 1X5TA 1GK8A 5EN1A 4CO3A 4WJBA 1TZ0A 3V2UC 2OAUA 1FWKA 2FZKB 5CA5A 1G1XA 1H73A 4W92B 4DBQA 3H4BA 2V9KA 3VHQA 1TK8A 2MKHA 3PO4A 3GCWP 4P2SA 1RHMB 3JSRA 3HO1A 1WC1A 1U2RA 4HH0A 2N7YA 2QL7B 2RS8A 2UV8A 1MWQA 2RDDA 4CDIA 1U1LA 4L3NA 1HHQA 3G96A 3NNHA 4DX6A 4J9PA 4G3IA 4OZ5A 4B9SA 2OD6A 3E01A 2AIRB 3GWCA 4J9QA 4TQSA 1U0SA 2RT3A 7FDRA 4LR8A 3JSBA 1HBUA 1YRUA 3WDOA 2K7JA 3NGRA 3MMCA 2F40A 4DPWA 1J5OB 3UPFA 4QWDA 2NUHA 1X60A 2XS7A 3KWMA 2W7AA 3FC9A 1WSRA 4LF4J 1SH2A 3PYFA 2DR7A 2CQDA 1WWHA 4NXNJ 2DK2A 2BJEA 3L4BC 1UAWA 1KOOA 5KFIA 2HNYA 3BGRA 2XMWA 3LGHA 1TL1B 2R2RA 5E2QA 1BHNA 4BC7A 4J91A 1NH7A 4K4ZA 3SV3A 2E44A 4URQU 3CCTA 1U24A 4R5PB 1OSDA 1SQFA 1QE1B 1UEVA 1C0TB 1SJ4P 1FD2A 2PI5A 2V8VA 3MXHP 3LAMA 1S6OA 3WIUA 4TY8B 3IMQJ 4Q8EA 4DSKA 2DH8A 2GVZA 3BKTA 1CULA 2DHAA 1HBMA 3T1YF 1RU2A 2L9WA 4FYWB 2KHCA 3SMZA 1RWWB 3HP6A 1RWMB 1XK8A 1N6QA 3PW0A 1FKPB 2WW8A 4ZHRB 1Q78A 2N3LA 1W7WA 1T05A 2ZJPQ 3K59A 2W2QP 1FJGF 2IJRA 3SFUA 1DRZA 2KG1A 3MEEB 1KHVA 5KFVA 3EX7B 4U95A 4X4UA 2MKYA 2WZ1A 3T1AA 2VBXA 1UJ5A 5IFMA 2J8AA 2OFGX 4KTQA 1S0OA 3A12A 3G82B 3ETOA 1WTFA 3FUYA 3I0SB 2CG8A 4FZVA 4CTAA 3MM9A 5A76A 4KB7A 1NK8A 5KFBA 4RUAA 2GO9A 4ZLPA 2UP1A 4YB5A 5F3TA 4ZPWR 3Q24A 4B3TJ 2H51B 1DBDA 1MU2A 3ILIA 1X4EA 1K73T 5L1JA 5K20B 2NZCA 1UWAA 4NI2A 1M1HA 4W4MA 3J7YI 3G8SA 3KJVA 3CW2C 3I4HX 2BRKA 1WEZA 4BHQA 3EUNA 3T6BA 2OPQA 3DFEA 5AXNA 3G6ES 3N28A 2ATCB 1T9XA 4ANDA 3VVTA 2LEPA 4PUOB 3H2UB 3HF5A 1YGYA 5K9FA 2ZVIA 1NJYA 5E5NA 4IR9A 2QMUB 1XN9A 2WVBA 5H1SV 5DG8A 5F8NA 4OHXA 3HHLB 2L48A 3Q2TC 4RNNA 1U2FA 5LXRA 3K8VA 2H48B 4PXEA 4M5DA 2W2NP 1TELA 4K7QA 2A6MA 3JXOA 3KDNA 3PW2A 1AZSB 3GFXA 3UDCA 4RUBA 4ECYA 3C14B 2PC6A 2MTLA 1N48A 2BANA 3KHHA 3F73A 2BKNA 4OQJA 1FK9B 3R27A 3EPGA 3P6YC 4DPUA 1Q95G 2Y3YA 3QZ7A 3BO2A 1FJEB 4DV2F 3HT3A 3J7YU 4NLUA 1RTIB 4OHYA 4F4WA 4I2PA 4JI1F 3IRXB 2BQUA 1HBNB 1X31C 3KLFA 3JTNA 1ZM2A 3BEGB 3SQGB 5D3GA 3CD6S 2DPIA 2W7PA 1XMQJ 5EX3A 3QSYB 3WIVA 4PXCA 3W8GA 2V8HA 2WSEC 3TZYA 2XY7A 3CJSA 3N6NA 5KFUA 3C6UB 3A8KA 5J1EA 1H38A 2CPDA 2Y1IA 1PILA 4P10A 5HMXA 4ANCA 5KOXA 2WRMA 3D7SB 3UDLA 4NWBA 4J9UE 4DZDA 1HLWA 5KG6A 1LW2A 4DS5A 4PPDA 2FUG9 2P8IA 2VG6A 3RRGA 1SJ1A 1XMOF 3CEDA 4EBEA 2GVDA 4ED3A 4JUZA 2QL5B 3PKMA 5RUBA 4LRDA 2QFJA 4K50A 2ZOFA 2HFUA 4UOHA 1VJQA 4N5SA 1U1MA 1NPKA 3Q22A 2F4VJ 3G9CA 4LFAF 4L76A 2GAHC 3DI6A 2J7KA 2XTJP 3BSAA 2BX6A 2XS2A 1TL5A 2BJ9A 2GHPA 3DYAB 4O44B 1CQNA 4N7TA 2Y1JA 1UVIA 2Y1LB 4UZBA 1HHTP 3EGZA 4HR2A 4C8ZA 5L9XA 3Q2SC 3M05A 2OI2A 3E51A 4ZK7M 3UNGC 4F4XA 2DGXA 1N54B 3ETMA 3RB3A 3MMAA 3GYGA 2AX0A 3LWLA 2C2OB 2HQIA 2WCXA 4DV7J 3WX8A 1KVJA 2MKCA 1OQ3A 5J2NB 1JLEA 1GMVA 2MHEA 4LMZA 1IR2A 3FSIA 3IBCB 2HRTA 2XZWA 4V1Ak 3W2WA 2VA2A 4UUWA 2H3EB 4P52A 1A6LA 2WOMA 3BBFA 3PACA 1CVJA 1EKRA 1HWJA 2P2CB 3LGMA 3OJUA 1YITS 2MQMA 3OPKA 1CJVA 4ENOA 3FCVA 2DRDA 3T3FA 4IG3A 4RNMA 3M2VA 3LA0A 3BSNA 3GB0A 3H5SA 4WP3A 3PV8A 2LP4A 2BOPA 2QZ8A 2VOPA 1R27B 2LMIA 2D3O1 3ILOA 1VRUA 1IBMJ 5GAEI 4ES2A 5GMDA 1EQMA 4OZLA 1ZM3A 3KTQA 1X4DA 2NR0A 2MY8A 4OYPA 5FLXY 2R2TA 1TU0B 1TVRA 3MI7X 3POTA 5B09A 2ASDA 4B3MJ 2QLBB 3B54A 4NLOA 4FF1A 5IQQA 5JVHQ 1TL4A 1VQNS 2KZZA 3T5JA 3KK3A 3J81j 1RWKB 4EGLA 1VQ4S 3MPDA 1Y00A 5J2PB 6FDRA 2M8DB 3ZC4A 5B08A 4LF8F 2FQQB 2YQ1A 3QO9A 2EEYA 4WCEQ 2Z8QA 2CQGA 2DHXA 4X2BA 4ZVFA 3PW4A 1QUVA 2GGPB 1KDNA 2HRUA 4TYBA 3EXYA 2EG2A 2CJBA 1KFSA 4KAIA 1VQMS 5IOLA 1PJ5A 2EC2A 3P45B 3SFGA 3GYNA 1UWBA 5GAEU 3ISZA 2I5JB 3Q8PB 1B7YB 3TANA 1XC9A 4GO5X 3R9LA 1WG5A 2E7WA 3BYPA 4DLGA 2QEXS 4N56A 3EVMA 3QAEA 4FDFA 3AFGA 1TKXA 2IM2A 2A6OA 4CM2A 2YKAA 2DH9A 2DO4A 1REVB 1AA1B 1RT4A 1OS5A 1DHMA 3KDOA 3T41A 2BJ7A 2NXCA 3KLIA 3T1HJ 2OPRB 1NSAA 4X4SA 3EZ5A 4XTTA 5B0BA 2RE1A 4J9MA 1RBOB 4JV0A 3SSSA 4Q45A 2XMAA 1YK9A 2DEJA 4WXWA 4PQAA 3DLEB 3TUPA 1TUVA 1I94J 4OI0A 2CQPA 1NK0A 4YB6A 2K8GA 2XNQA 3CCUS 3KLGB 1SC4B 2VUGA 4K0KF 4LFBF 4OZ0A 4LF7J 2V9WA 1FNXH 4JI2J 2ZVSA 4WU2A 3FQLA 1N8RT 4JP8A 2AJ0A 5L38A 1CJTB 1C1CB 3DN9A 4OHZA 5F0WA 2JL9A 1HARA 2MDAA 3DU6A 4DV1J 3THVA 3M8WA 2DH7A 1HQUA 3IC1A 2HFNA 1W25A 4PABA 4UOCA 2HWIA 1IBLJ 2DD8S 1RTDB 4AXJA 2B43A 2CJYB 1S49A 2RDIA 3K58A 3Q86A 4LF9J 3AJDA 4ELVA 4X4VA 2OPPA 3MPYA 4UQTA 1IBKF 2LQ9A 2Y1RI 3LOUA 2JH3A 2DR9A 1VRTB 3DCAA 1S6PB 1S6QB 1WJ9A 4OX6A 5D6GA 1U26A 2GIQA 2V2QA 3SCIE 4KBIA 3ONQA 2MEWA 1J5EF 1C0UA 2HFZA 3C6TB 3HZEA 4ECSA 1N5SA 2BXJA 4CLFA 4RL1A 2RF2B 2B56A 3NLCA 4ZVQB 3V4IA 4LRBA 2MQ8A 3K5PA 4FKXA 4F4ZA 2G2ZA 3ZTOA 4PG8A 2YPZA 3SV4A 1YSJA 5A2QY 4ELTA 2CPZA 1WHYA 1TMJA 1WF1A 2AV5A 3K5NA 2FJXA 3UR0A 1PBAA 3OSPA 2BVZA 4JBCA 2LKZA 1BQNB 2J7UA 3VGVA 1TFYA 2C2KB 1UFLA 4K5SA 2DVIA 1DZ5A 4WE1A 3R5CA 4N47A 2XSJA 5C5JA 1YVFA 2HURA 4L6V3 2VFSA 4YR0A 1F0XA 4YY3F 2KB2A 1QSSA 3D2WA 2BJDA 4QOTA 2VPXB 1RYSA 1AFIA 3I5CA 1SIWB 1HNZJ 5GAHI 2XY5A 3DRRA 3FJ2A 1WC4A 1LWFA 2X1FA 3M9NB 2VZ9A 3PY8A 2WB1D 3BO3A 4DLEA 2QLFB 3SXLA 5HQMA 3KJFB 5K8NA 2Z0GA 1RAHB 3A8IA 3NL0A 3PYEA 5HK4A 4E0DA 2JDJA 1LW0B 2CJ9A 4I2QB 1NJXA 4OL8A 1S59A 2IY5B 2VPZB 3G8TA 1LOUA 5ETSA 2XHCA 5K14A 3M9MB 4O3OA 1G3OA 4X4RA 3FGVA 4X4QA 3D6HB 1UETA 3SIPB 5A8RB 1H0HB 2VG5B 5B0EA 5DLFA 4P2XA 4JI5F 4D3GA 1VIOA 1R43A 2YNGA 2FJWA 1VISA 1YIJS 4F04B 2ZHBA 5SZTA 4F7VA 1EHWA 1IVZA 4FXDA 1J2VA 2HNZA 1TKTB 1S1VB 4NCGB 1CJKA 5KFSA 4OYAA 1FX2A 3SQOP 1XR6A 3FSXA 3TNVA 1A7GE 3DGVA 2GC8A 1RI7A 1S1UA 2AWZA 2XMJA 5CYMA 3PJXA 1NDCA 2WAQD 4ALZA 3DDKA 2MQNA 4N76A 2MZTA 4I67A 4U7CA 1QDUB 3TUIC 1BXNA 2MXYA 2YNHB 4JYAJ 3PW5A 3L7PA 2G4BA 1S1XB 2FPHX 5D0HA 4NZ7A 1EKSA 2MZSA 2XGPA 4FNIA 2K1RA 1YWXA 1OO0B 5IV3A 2V4JA 1VDHA 2VFVA 3BQ2A 1SKWA 2HZCA 4MYTA 3ET6B 3EM1A 1ZAVA 2YBVA 1UP1A 1I51B 1Q8IA 2DY1A 3H5UA 3NXZA 2M2BA 1NPPA 1YX2A 4NEYA 3B4DA 4IOAQ 5IC4B 2BE7D 5KOWA 2BE9B 1RU1A 3MPVA 2JFDA 4DG1B 2CJAA 2OELA 4OI2A 4FYYB 3H0PA 1Y9OA 2C2EA 3RR7A 3UCUP 3C66A 4F3QA 2ZBIA 3MTJA 5HANA 4Q2MA 2RKIB 2ZBCA 2NSBA 3BDEA 3H4DA 2HQ3A 1E6YA 4KRWA 1BLUA 2R8IA 2R8HA 4NX9A 3ELHA 1RT7A 1VQYA 1YI2S 2BEFA 1RAOA 2A2DA 3HVRA 4NA3A 4K4TA 2C2NA 2ZUAA 5J2MB 2R2UA 2AGQA 2LDYA 3W8PA 4RUCA 5M2RA 4FXWA 4FPRA 4DR2F 3CC7S 2BV3A 3HXMA 2EG1A 3LUYA 2G13A 3V6JA 4C8YA 4QIWD 1IQZA 2HVDA 2R7XA 2E5LJ 4I4BA 1TUGB 5AE3A 4B3SF 1GMWA 3CO9A 1HD0A 1SJRA 5DQIA 1K47A 4DR5J 1JLQA 1ROFA 4ECWA 4GKJJ 1RWOB 3TARA 4TXSA 1R0AA 1HNVB 3BGLA 2D74B 4PAAA 1MROB 5HP1A 1U49A 3VALA 3THTA 3OTEA 3RG6A 2QMWA 3O8WA 2D9OA 3ENWA 3M8SA 3M8ZA 1UJ4A 2HLTA 4MTPA 4EZ6A 3MFHA 3QSIA 4CWBA 2CFXA 4W90B 1RCOB 1HYSB 4J9SA 1L3UA 3PW7A 5HN0A 3G4SS 1NXIA 1MMNA 2DY9A 1K44A 5F8JA 4RNFA 3HJVA 2BW2A 2VHGA 2V8PA 4PEOA 3OR1B 5HL7Q 3M8RA 3C3LA 2ASLA 1GMWD 1T9VA 4I1TA 1WI8A 3VWSA 3SDEB 4KC5A 1T03B 1DTTB 2CRLA 2D9PA 2LLZA 3K5LA 3WZ0A 2VKRA 4GKKF 3FFIB 2XS5A 2YNIB 2QFIA 4K4YA 3KLVA 1VOMA 4J9RA 4ATNA 4TQRA 1X4HA 1J5OA 2HVHA 5FLXU 1RHJB 5DJBA 4IFYB 5CCMA 4H4MB 5T41A 2PMZD 4OIXA 2HMIB 1EX8A 3W5ZA 1MN9A 4UY85 1KWMA 3PFEA 2V94A 4QPXA 4DDFA 1NRKA 4LFCF 2G1DA 2E5GA 4CM0A 1M5HA 3DHXA 1U1OA 1GQEA 1TL1A 5F8IA 1S76D 3W3SA 4GRSA 4M95A 5KFZA 4DQRA 4X4TA 4PCQA 5DS7A 2ZH7A 2MQLA 2WK4A 1VBZA 4R5PA 4WXOA 3D0GE 4OYZA 1QE1A 4QIEA 1C0TA 3P4UB 4QW8A 5HVFA 3HK2A 1O51A 2VG7B 1H72C 5D4LA 5LJ3Y 1OWXA 4LR7A 4TY8A 1BQMB 1AB8A 2IM1A 1VQ5S 4YR2A 1S99A 4I6AA 3ISND 3UDEA 4X62F 4I6WA 2G1HA 1N33J 2E9RX 5HSPA 2MY7A 1AFJA 3RB0A 1FKPA 2VA3A 5I3UB 4ZHRA 5CD4A 3OVSA 2FB0A 3VAKA 3MEEA 4DR6F 4DU7A 2E1RA 4PG7A 4S0MA 4G1IA 2AJ2A 3RGIA 3M2UB 4MKVA 1RHQB 5KG3A 1RTJB 2FIUA 1ULRA 2VC0A 4M5HA 3G82A 4DUZJ 2XLKA 1IM4A 2UVUA 3I0SA 3GJSB 1W26A 4USVA 4HTJA 4DV3J 1PYTA 5KFWA 2ZDPA 2KTQA 2UXCF 1G2EA 4DSFA 2CAJA 2ZE2A 2B7BB 1B4SA 1WOOA 1RT1B 2BJ8A 2B9YA 2PIIA 2JSXA 4QU6A 2KVIA 2JFKA 2C2ZB 2J9EA 1KQFB 1XIQA 2M88A 3JSYA 2YTCA 3W60A 1T7PA 2ZHOA 1GEHA 3W66A 3L09A 5A8KB 4ZLNA 4PUOA 3O3LA 3I5BA 2OD4A 3FBBA 1S1WB 3V4MA 3KKFA 1L5UA 4WIQA 1MWZA 3W5YA 3IGVA 3HHLA 4TY9A 4M94A 2BMBA 1KRPA 2GHWA 4C2MA 2HGNA 2LECA 4YEAA 2CQ2A 1RSCA 4TNOA 3D9BA 4NASA 3OUYB 5L8RC 5DDPC 4MKAA 2ADBA 2Y8YA 1KN6A 5KTQA 3WX4A 1OYEA 1BMQB 1FK9A 2WONA 1RTHB 4H4OB 3QGIA 1XR7A 3QT8A 1I5OB 2XMMA 1RTIA 5A2QU 5F9NA 5B0DA 3MPWA 1FXRA 5E33A 3IRXA 1HBNA 4HYKA 3NGKA 4DV4F 3SQGA 5KFXA 4ETXA 4FBUA 3RTVA 4J9LA 1A9NB 3HHLD 2ZWPA 3J7ZT 3CULA 4LF2A 3G86A 2CQCA 3QWPA 4P2MA 2XYPB 1NHVA 3C6UA 1AYEA 1DJ0A 4ZJOA 4QIFA 2YQ3A 4JI0F 3JB9k 2BA9A 1T95A 2MZ1A 2FVRA 2BE2B 3MCMA 1PC5A 4DMZA 3H98A 3TVZA 1KQGB 2YXLA 1U09A 4ZOSA 4JI6F 2AQ4A 1Z2LA 2V0NA 5E0OA 4F4KA 2F65A 2KHDA 1U6BA 4PWWA 2HHHJ 4DN0A 4A8YA 3T19A 4C3LA 4IR1A 2Y0BB 1RTZA 4KIAA 1CS4B 2VKZG 1F3FA 1NZ8A 3C16B 3GFHA 4ZVHA 3BO4A 4DX8H 2N82B 1TP7A 3BN7A 2CA9A 3W64A 3T1YJ 2KXNB 3NAHA 1IJEB 2IYIA 1ZH5A 4WFAQ 3DYAA 3HHEA 4O44A 3CWJA 1R3NA 3P5BP 4PZVA 1PKUA 4DI6A 4O0IA 2RMLA 4RZRA 3OHAA 1FJGJ 2RS2A 4DV5F 4CIOA 1VQ9S 1WF2A 1NK5A 2XYHB 1QVFR 4LREA 2HGLA 3GLJA 2U2FA 3M30B 4LRAA 2B6AB 2IIHA 5ETMA 2DNYA 1HQ2A 3MWBA 2CQ4A 3AH6A 5T7LB 5J2NA 4Y2MA 3EVWA 3IM8A 2ZWOA 3OL7A 3M6VA 4CLTA 3VGUA 1RLCL 1IQTA 2PA8D 1ACMB 4ECXA 5CXTA 2X1AA 1X0PA 3L9ZA 5EWEA 1S97A 4DR7F 2BUNA 2FHMA 3HDSA 2BR0A 3PX6A 1FRJA 4UF4A 1HD1A 3PEHA 3D54A 4B9UA 2QX0A 3CF5Q 4QIGA 1YBAA 3GYXB 1H2UX 4ILRA 4IOCQ 2GJFA 4M5JA 4O23A 1BE4A 4QCLA 1VRQC 4RX6A 1Q0NA 1SB6A 4RU9A 1I3OB 4FNHA 5G4DA 2XZTB 2CWXA 3HHNB 4DSEA 4B9TA 3GTYX 5DLGA 2O5DA 2CPXA 3LALA 3K0JA 4KH0B 3PVXA 2JVRA 1H3DA 3D0IE 2QGFB 2RIJA 4P9SA 4CI0B 3GU0A 1NHKL 2HBRB 4A8QA 3OJSA 1K1QA 2IRYA 1LV5A 1OQ6A 2HBQB 4P7TA 1YJ7A 4USIA 5D78A 3ZTPA 5KG1A 1X4AA 3HVTB 2O01C 3KMSA 3QZ8A 3NG8A 5LMNF 4X64F 1PIEA 5J2PA 4JI1J 3BDPA 3V6DB 1FKOB 4C8MA 4A8WA 1IBCB 3RAXA 1HMVB 3MURP 1FRKA 3H8YA 4OJHA 3BGUA 3M8PB 2GGPA 4C6AA 3VAFA 2H4YB 5ETRA 2VV5A 4RNHA 4C8KA 4URGA 2MJUA 2HHPA 2I5JA 2CDQA 4ECTA 1VQKS 1SXLA 4ZCLA 2X7IA 3U27A 4XK8C 1FDAA 4QWEA 3HFZB 2NXJA 5D4NA 3IAS9 5HVGA 3PIOQ 3DOMB 3J80U 1XMOJ 3GPAA 2QMXA 2YQ0A 3MDFA 1REVA 4A8SA 3KYLA 3ZTRA 2AHOB 3UO0A 4CLZA 4NRUA 1BQXA 2JNJA 2MZQA 2OO4A 2OPRA 2ZC4A 4M1KA 5F9LA 4B9VA 1UA1A 4TYAA 1TKZB 5AXLA 1S4EA 1GMUA 4I68A 1Z1ZA 5HATA 2GHVC 3QATA 3DLEA 4LFAJ 1FESA 3OHBA 4DR1F 1IXKA 2DNMA 5GMKa 1UW9A 5DG7A 3MZIA 4Z7CA 1KVIA 2B3TB 2W4DA 3W63A 4FPIA 3KLGA 3RW7A 4C98A 2Y0SD 4ETZA 4F3OA 4ZP6A 5KFGA 3TAPA 4J9VA 5GADI 1KR4A 2DR5A 5LOQA 3EPIA 1VBYA 1HI8A 1VBXA 2VPWB 4EWTA 2PDAA 2DHGA 1CJTA 3Q8RB 1EQ0A 1C1CA 3D0HE 4WTOB 3KNGA 4UTGA 4OLPA 1Q5YA 1HHSA 4C0BA 4XIUA 5IT9U 5CYJA 3TWZA 3MAAB 5K8OA 3T6JA 1FVSA 4ZIVA 4DQSA 1UFKA 1AUSL 3T9ZA 1RTDA 4DR4F 2MB0B 2HHQA 4Q43A 3KJQB 3G6VA 4DV6F 3AD7C 3EXCX 2YY3A 1XNRJ 5IM0A 3RRKA 2E1CA 1VRTA 1JNZB 3QJJA 1ZM4A 1S6PA 1YJ9S 2QYGA 4DPXA 2GIFA 1HBOB 1NZAA 3FEYB 5IXUA 3ILJA 2UUWA 4HT7A 3JSMB 3T9NA 3VQTA 2KI2A 3EWGA 4A8MP 1LWEB 3PYDA 2BQ3A 3N4WA 2AYGA 2D3OR 4DN9A 2HBZB 4DL0C 2ZZMA 5HBMB 2RF2A 1UZHA 2JEIA 2GJ2A 2XO7A 1UVLA 3NAIA 3D66A 2EFQA 1PYOB 4LF6F 2ZH3A 3CDEA 1VQSA 2FLLA 1DFDA 3UVJB 3T5KA 4H4KA 2M7SA 3PDNA 2MQOA 1BQNA 1EAYC 4AXIA 2QYCA 4QW9A 4R8UB 1ZOTA 4CO5A 1FFGB 4WBFA 2VODA 3DDIA 1SBRA 1QTMA 3TW0A 2FHOB 1ZETA 1U1QA 1I6JA 3PIPQ 3MEDB 2HSEB 2XMVA 1JMTA 4ED5A 2MSTA 3HJFA 4NEZA 3C8YA 3F41A 3R7SB 1UVMA 1TQLA 2C3PA 1AROP 1W2BR 1HNIB 4DSLA 4NXMF 4ZLLA 4J7CA 3BGFA 1XQIA 4O0NA 4OV1A 1VQLS 4LF8J 4OYXA 1KNZA 1KBRA 2G9OA 3PX4A 5DM6Q 1N5YA 3NS6A 5GMEA 1QLNA 3I31A 1NNDA 2OJ3A 4KYZA 1Y5IB 2FJAB 1FE0A 2KFZA 4IRKA 3GE9A 3AQPA 2HRYA 4TU8A 2EK1A 4USTA 3W9IA 2KH9A 4I2QA 4DQPA 2EXUA 2DNLA 3D6TB 1D8ZA 2WTFA 4A8XA 1VS3A 3SEOA 2Y8WA 5CABA 3IAM9 1WDDA 3ENAA 3RW6A 4WPAA 5DQGA 3MM6B 2YVSA 2YWHA 3KJNB 2ACYA 3NGDA 2CDRB 4Z2XA 4NLWA 1QM9A 4LF4F 3BPDA 2CQIA 1BD6A 5I3PA 4NXNF 2OGUA 5A8RA 1U8WA 2VG5A 1T11A 5F8LA 2IJNA 4CO1A 4NYPA 3I32A 4OYMA 3CJ3A 1OSCA 2W9CB 3UE2A 2Z2YB 3ADAC 4NMXA 3JYTB 5FJ4A 2ZUGA 1RAGB 1F6TA 1Y0HA 2E7XA 4AT1B 2MQPA 2CKWA 1TKTA 1S1VA 4NCGA 2AGOA 3CPWR 4LRCA 3VTIA 1VGYA 4CYUB 2F4FA 4IH7A 2H1YA 2IAJB 3PRDA 4G6VB 4LR9A 3KFWX 4K0KJ 4F4AA 5KFDA 1P1TA 4LFBJ 3P8BB 4I0WA 2HHXA 3AT1B 1QUPA 4WK3A 4CP5A 4HACB 2B4PA 4CLSA 2YNHA 3H90A 4IRDA 1S1XA 4QPTA 2HEKA 5IV4A 2CPHA 4NLVA 1V3ZA 1ZZNA 2VF3A 3OVAA 1JQGA 2VFRA 2J6UA 1OY8A 2OIHA 4ZPTR 3TAMB 4HI2A 3ET6A 2CPYA 3Q8SB 1UTAA 3IBWA 2F7VA 5GAGU 4OYWA 3MEGB 1QTNB 5MAOA 2EI5A 5KFFA 4IKAA 4OX9F 1FF2A 4ED1A 2PD1A 3QFWA 1OY6A 2HNDB 3KK1B 1GFWB 3GFZA 4L73A 4UY8T 4B3TF 3BF4A 4DG1A 1RBLA 4DQQA 2FHJA 2JWNA 1J5EJ 4H4KC 4PWUA 1WDTA 2ZH1A 2NREA 1NSPA 4A48A 2RKIA 1X5SA 4O4GB 2W2PP 2VDHA 2EC0A 5LSLA 4ILLA 2CPEA 3G6YA 3CC2S 3M32B 4DL3A 1UA0A 2MJNA 2MPUA 2DISA 2XY6A 3IG1B 3H5XA 5J2MA 1NDLA 2I0XA 3OL6A 3LGNA 3S01A 4ES3A 1Y4ZB 1LFPA 1T3NA 2XULA 3FZBA 1NJIT 4FF2A 2B0GA 1SKRA 3QGHA 2D69A 4CLUA 2KM8C 4K4SA 4YY3J 3TA0A 5EDWA 4RBVA 5BYSA 1S10A 3MMJA 4JV2A 1F2GA 4KQZA 1KSPA 2XC9A 1F9EB 1RKJA 5DETA 5DDQC 2XO6A 1KFDA 2DXDA 5KG2A 2IM3A 1HNVA 3PJWA 5C25B 2MMYA 3KXDA 3X3UA 1B0PA 2M0GB 4RR5A 3TVYA 1RT2B 4NLRA 2PO4A 5L1KA 1V3RA 3ZTSA 4PRFA 5LM7E 1IKXB 1YKWA 1RAEB 3MMCB 3D28A 3GIRA 1U25A 1HYSA 1KVKA 4N77A 2ZEJA 5B0CA 4LBPA 3K17A 2Q3PA 3JAMY 2W24A 3OR1A 5A8WB 1SC6A 4JI5J 3PX0A 5KFLA 3BGRB 3OT9A 4KKOB 4CH7A 4J9KA 1RAIB 3FFIA 4MKBA 1M5SA 2YNIA 4K4UA 4ZVEA 3TUZC 2OEJA 3AOBA 2R7SA 4IFYA 1FNMA 2XNRA 4H4MA 3MMBB 3UDVA 2HMIA 1S12A 1S57A 4HKQA 2V63A 1R0BG 1Q1KA 2Z2MA 3W9HA 1EJ7L 2KRBA 1WI6A 4MK7A 1E6VB 4G1QB 4XDDA 1HBMB 2JC1A 1RACB 3S8SA 3NWRA 2B4OA 1R8BA 2UZAA 4U7UK 1R31A 4KY3A 2HHUA 2WW4A 1FRXA 4JI3F 1MLAA 3Q83A 3DGPB 3G6XA 1NLKL 4NA1A 5E3AA 3HMJG 5L1LA 1HNXF 3VR1A 2N7CA 3GILA 1C2PA 5MLCV 3W5XA 2OTLS 4WFYA 2XMUA 3QGPA 2KYZA 2M3DA 2M9KA 2QC3A 4DF4A 5I42B 4WYLA 4LBIA 2D3ZA 4DV7F 3OFFA 3K8WA 4F2SA 3TA2A 4OYOA 2FC8A 3B82A 4ERDA 1HW8A 5I3UA 1UEUA 1BWVA 4OYBA 4FYXB 1IKYB 4Y2KA 2VL1A 3FDSA 4C0OC 2XZDB 2A1BA 3MM7A 4IG0B 4LT6A 3OBIA 2YKNB 1D9DA 3M2UA 2JEGA 1FE4A 2AYEA 1X4CA 1T9WA 3D68A 3UCZP 2R7QA 4KE5A 2C3MA 4OJGA 1IWGA 5ETKA 2UV8G 3IXQA 4K2XA 1X4FA 2DNGA 3FVYA 5AE2A 3ICLA 4ZIWA 4DR2J 1N56A 5DZ6A 2EW9A 1RT1A 1Q16B 2HK3A 2RQ4A 8ATCB 1Q8BA 2HG4A 1NHUA 1MN7A 4QBUA 4M5KA 1IBMF 1SVDA 5E3CA 3R5AA 3CCLS 2HIQA 2R7RA 3VZIA 4NMLA 1KEKA 4OMFG 4C8NA 4UOGA 1AUDA 2OMLA 9RUBA 3TZZA 1RWPB 1NSKL 3PXGa 3BB5A 5H9FJ 2BANB 5A8KA 3GZ7A 2MGZB 1NDPA 5CQGA 2ZJQQ 5DDRC 1S1WA 2RH3A 4ZN3A 2ZDOA 5AE1A 4NLPA 1RB0A 4WFXA 2X3DA 2KJWA 2Z56B 1RWVB 3SZ2A 3OUYA 4IRCA 3G2XA 5CD4H 1GXLA 4DCJB 3J7A1 2OFHX 3TR5A 4ED8A 6AT1B 1H74A 1M5PC 4LQ3A 2LXUA 4ZVRB 4F4YA 2HVIA 1VC6A 3PO5A 2IBKA 2ZZTA 4LBHA 3CJRA 1RTHA 1U2CA 2UUTA 4RW9B 3MGJA 3FBCA 4NL5A 1REGX 2P6TA 4LSNA 1U0HB 4GKKJ 1HW9A 1N32F 1WOPA 4Y2IA 4U67Q 3QMQA 4USMA 3QJPA 2IBOA 1NJZA 2XWXA 4J37A 4ECQA 2GVDB 4EBCA 3DHWC 3MM5B 1P8GA 5JUMA 3IM9A 4P72A 2DGSA 4ICLB 1O6XA 1SJ3P 2IJFA 5G0RB 2LQ5A 3E3XA 4LFCJ 3ZNJ1 2HK2A 1I94F 3U7JA 4Y2AA 5LMUF 1R8HA 2BE2A 3W65A 2RUGA 4I6YA 3G87A 3PHEA 2LU2A 5H9FK 1Q7LB 2FLOA 3CCSS 3R97A 5HAOA 2HZAA 3QFHA 4DUYF 4HDHA 1YJTA 4TU9A 2J0SD 2YWEA 4RW7B 2V2VA 1A0OB 1C1BB 2R8JA 1SJFA 1V5VA 4ECUA 5C7PA 2QRRA 1CS4A 3C16A 1NKBA 3DLBA 2HLUA 5CCLA 2EFVA 1SL2A 2IVFB 4X62J 3GIMA 2XHWA 4WKRA 2HVEA 5HJYA 2VDIA 1LWCB 5F8HA 2GQCA 2DO0A 1JLEB 4NLXA 5KFPA 1SQGA 2BOAA 4LVOP 2BBEA 2F63A 2QV6A 3W2VB 4ZPBA 4DCPB 2V2ZA 3N5BA 4LF9F 3S7RA 3CJ4A 2QIFA 4DR6J 2HHTA 3LP0B 1RK8A 2W7OA 2Q6CA 1TR0A 3VAIA 2GV1A 1RT3B 2B6AA 1N34F 2XLIA 4JI4F 1WKKA 5CZVA 2Y9HA 3ZZYA 3TEHB 3US5A 4F50A 4MYUA 2JJ4D 5T7LA 2FGCA 4KV8B 2UXCJ 1SPBP 1TAUA 2VONA 1DQ8A 2H65B 2UXBF 4UW2A 4RKUC 3NS5A 1S1TB 2KDOA 3H2VE 1Q82T 3HI9A 1CQMA 5IT4A 2Z2ZA 3DRPB 1KKHA 4KSEB 3KG0A 2IA6A 1FVQA 3L3CA 4IFVB 1FTRA 3OR2B 2B4VA 2KKHA 3OTBA 2XCPA 2NYIA 1DQAA 3PRVA 4I7FB 5I3QA 4RW4B 4LQ9A 1B64A 2CIMA 4MIAA 3KK3B 2KFNA 1WF0A 3N6LA 1Y11A 4NZ6A 2IA0A 2CQ1A 4LIWA 1Q81T 4OI3A 1EZZB 3JS9A 3MCOA 2ROGA 3KHGA 3IA0A 3GONA 4A47A 1JLAB 2W8KA 2AT1B 3K5MA 1GTEA 2DIVA 4KH1B 3AODA 1YJWS 1AW0A 2CJKA 3PEJA 3KLEB 4RNOA 4KHPJ 3DLGB 4Y00A 2QA1A 2N3OA 5ETNA 1OYDA 4C9DA 5CH7B 2OUGA 3TO8A 2PN6A 1PGZA 4DWIA 2CPJA 3HVTA 1X9SA 3IO1A 3VAMA 2WBMA 1WEXA 2DNZA 4F67A 2KRRA 4HL9A 3V6DA 1FKOA 3NMAA 3VGTA 1L3KA 3LTOA 1WHVA 2ZM6J 2AZ1A 5C2CA 4DV4J 4CT8A 1HMVA 1TAQA 1OMSA 1KHWA 2CZ4A 3M8PA 4XPEA 1K8AT 4OZ2A 1H2VZ 2PGCA 2X1BA 4XDCA 3EDRB 2IHR1 1T8EA 2M70A 2N4DA 5CYQB 3R5GA 1JJCB 4JI0J 5J2QB 5E7OB 3NOGA 4GO7X 4RW6A 3DOMA 4KPYA 4LJMA 4B02A 2P9CA 1SH3A 4PQUB 3V6KA 4JI6J 4CH1A 4WKYA 2G2OA 4Y65A 4NOHA 2AD9A 4FYVB 2FJDB 2DNRA 2HS4A 3NGUA 5DGBA 4C0HA 4P73A 3ZZUA 3WHIA 1KQSR 3N0VA 4WFZA 4JYAF 3NNCA 3HFKA 2F3JA 4NE9C 5DDOC 5DG9A 4DL2A 3J7Z5 1F3VA 2HQFA 1BGXT 1VBKA 3DOKB 2H9ZA 2I2YA 3IGNA 3R6GB 1IKWB 2A3JA 4CLYA 8AT1B 3SCKE 3UR3C 4FS2A 3R5DA 1RT6A 4YFUA 3JAMU 4FVCA 4B3OB 4DV5J 5K8PA 1UKUA 1T0TV 4HHHA 4KJIA 2HBYB 3W61A 3CSKA 2CVEA 2RNEA 2LA4A 1Z4UA 2UUBF 3HSDA 1QD1A 2RRAA 3ITHB 4BBYA 3WBZA 2XYGB 3MAAA 1JLFB 2XI3A 3VCDA 2VFTA 1LNQA 1MWYA 2DNQA 1S4FA 3HT0A 4ED4A 4IOBA 2B9WA 2CYYA 2HHVA 1DLOB 4F36A 2A0FB 1URRA 3Q8QB 3X1LB 1U1RA 4NLQA 2IC3B 3AXMA 1GT8A 3MECB 4ZS6A 3N5FA 1LKZA 1SKSA 4DR7J 2RDJA 2Q1LA 4HDGA 4ECZA 2XG8A 3TOQA 3CUNA 2QTWA 3FBEA 3O6QA 5D0RA 2J9DA 2RSQA 1HBOA 4GMKA 1CC7A 2Z4PA 3JSMA 1JK9B 2O66A 1LWEA 2XBPA 2UVWA 1L3TA 2EWHA 2DPJA 4B08A 4EO8A 4MKYA 2IVYA 2YNFB 2RD5C 5HBMA 4JI7F 3T5HA 2C3OA 1AXQA 3LAKA 1M5OC 4PG4A 2CNNB 2FVPA 4LRFA 3D67A 1RKIA 5J1NA 3BR8A 3FKBA 1SV5B 4K4XA 1B70B 4DR5F 1JLBB 2QG9B 3DRRB 4ZCKA 3OTOJ 4UUXA 4GKJF 3GR0A 3RAQA 3UVJA 5JVGQ 3GJRB 5DZ7A 2AGPA 1P9YA 3RBDA 1PO6A 3CE8A 3N6MA 2VPYB 1NBEB 4R8UA 4EU0A 4L74A 1HI0P 1EARA 4ECRA 3GIIA 4Y34A 1R6YA 2GW8A 3MEDA 5HQ8A 1OIAA 3MM8B 1PAEX 1YHQS 1N4LA 5LMNJ 5K14B 4X64J 5KFAA 1HNIA 3EJMA 3U1LA 2GAGC 5LXYA 4O3SA 1UEKA 4ZCIA 2EK6A 2LEBA 4XPCA 1NM2A 2PSZA 2NYHA 4HEA9 3CCQS 2YWWA 3D1OA 3CTRA 3R1LA 4F25A 3NWGA 1V5IB 1IWAA 3JQMA 2IM0A 2PEHA 2E5IA 4C4WA 2FC9A 1X4BA 4Q0BB 4O3PA 2LXIA 2Z58B 5B7WA 3L7OA 1URNA 2DIUA 4LSLB 2B7CB 1QVGR 1OJ4A 2O1PA 3MM6A 4BC9A 4CLPA 4YUDA 2C28A 1R8PA 2JEJA 8RUCA 3EYZA 2WB4A 3MR7A 1U8SA 2J7WA 3FSYA 3P96A 3P49B 3DKDA 3M2RB 3ZNUA 2XEXA 3MR3A 4ILMA 4FVMA 2ZOMA 2W9CA 2QL9B 4K8RA 1DARA 3JYTA 4LUBA 1R0CB 5EGYA 4CH0S 4DR1J 5C42B 1NB2A 1TL3B 3TUJC 2LYVA 3OLBA 4CYUA 1RAFB 3HD2A 5D4PA 3NBPB 2IAJA 2DR6A 3IFEA 1YJNS 2RQCA 1D3WA 4P75A 3E8OA 1DTQB 4CRJA 2KZMA 1TMMA 4RJVA 4K59A 3DRSB 1FJ7A 3DLLQ 4HACA 4HHJA 2MLXA 5E41A 2NQPA 3CJKB 2C1EB 3EVOA 3I82A 5KG7A 3TA1A 2KJVA 3LQVA 3BYRA 2O3DA 3TJ8A 3MCSA 3QWUA 3TAMA 1N36F 1LQ9A 2P9GA 3CDUA 4DR4J 1HL6A 3RYLA 3W62A 2KM8B 3MEGA 4DV6J 5KFKA 3IN5A 2ILYA 4DUZF 1YBUA 3G71S 1RT7B 2DT9A 3V6HA 2DGOA 3OXLA 5A0YB 4DV3F 2JLEA 2HNDA 3QGGA 4PG6A 2UU9F 1NH8A 3KK1A 5BYQA 5LSRA 1ZA2B 4OFZA 3TQEA 1WHWA 1GAOA 3PRBA 2DRAA 2G0IA 4K5RA 3M1VB 3C15B 4O4GA 4M5MA 2WSFC 4G1PA 2K7KA 3TQ1A 1IJFB 4C8OA 2NPIA 4LF6J 3OTDA 3M32A 2FY1A 1WC3A 3IG1A 1HNWF 3R3TA 2KT5A 2DHHA 5SUHA 4DR3F 2G0CA 3HCXA 1S9FA 5D15A 5KAKA 2D41A 4DUTA 1YZ7A 4ZITA 4FBTA 2ASJA 2ABYA 2I6WA 1FJCA 2XWYA 2VH7A 3JTPA 4LF5J 4HI1A 2QLJB 5DQHA 1K9MT 2Z2LA 4B3RF 4XAKA 2ROEA 2A18A 2J5AA 4NXMJ 4RLEA 2I38A 1FWLA 1WELA 3UFCX 5HVHA 3BBBA 2WSCC 4ZMMA 4F0MA 3IBFB 3I0RB 2R2SA 1FNOA 1APSA 5C25A 2HFOA 2E1AA 1FFSB 4RBUA 4X4OA 1U45A 3CIMA 3UN2A 2O67A 2KT3A 1YJVA 1RT2A 1TUWA 2IMWP 1HR0F 2BKOA 1VJWA 2C3UA 3SBMA 3AA9A 1XERA 1IKXA 9ATCB 1UVKA 4OLOA 1M90T 3QQCD 2R3VA 3LANA 3GP9A 1NUEA 3MHYA 3LPEA 4DOZA 3PR4A 1DAXA 4USWA 3ZZOA 3FQKA 3LO3A 4TLQA 1S48A 2RRBA 4AD6A 3OLAA 3PNIA 2R7WA 2UUAJ 2QA2A 2FLPA 1VHIA 4YDXA 5A8WA 1L3SA 1WG4A 1Y5NB 1Y5LB 2BZ2A 4KKOA 3GG0A 2J0QD 3KHLA 4Y3CA 1U48A 2V50A 3R2CJ 4U7UD 1S79A 4N8NA 4ED2A 3A3NB 4KHRA 5FIIA 5KT6A 5J1PA 1RDRA 3VAGA 3MMBA 2VQFF 2AJFE 1H7WA 3QLHB 4W98A 1RWUA 2VQEF 2HHHF 2SXLA 4V19J 1XR5A 3ZFVA 4ZPAA 3I5AA 1UL3A 4NLTA 1ZTWA 4F26A 3HFVA 2B8QA 2Q43A 1E6VA 1X7VA 4G1QA 2KVQE 2FJEB 1S72S 3CD5A 1T9UA 3KLHB 3VZHA 2CNKB 1FRHA 1QAYA 2ASYA 2XB2D 2C22A 2EFPA 5KFHA 2LU1A 3GSDA 3DXSX 2J9CA 4WP8A 3DGPA 2AEFA 2CWKA 3J80Y 3OXGA 3O2IA 1YTYA 1VLOA 4E2FB 3DMJA 1VR6A 2ILZA 1G7CB 3K7RA 3V81B 4QR2A 2IMOA 2DNHA 4E8UA 2PFDA 3UWTA 1D9FA 1B7FA 5I42A 4Q5VA 1FRIA 2J6SA 5HO4A 1SH0A 2XCAA 4OX9J 4U8VA 2I8EA 4NZ0A 2VU5A 2FVSA 1NDKA 2OHDA 2F1FA 1WNEA 2ZE2B 1IKYA 1H7XA 2LQBA 1MG7A 4NLGA 3O1LA 2RAQA 4IG0A 2DCLA 1D0EA 3MD1A 4NCBA 2YKNA 1EB0A 1U6ZA 2HW3A 2D1CA 2OEMA 5F8GA 4C3KA 3H59A 4RWWA 1O5JA 2HS3A 1QAJA 1NU4A 4NLDA 2DGWA 2L9NA 1RZMA 4ZA1A 1FWPA 1L3VA 1FDDA 2HWTA 2KXFA 2ATLA 2POKA 1FEHA 2NXUA 3R8YA 2WVDA 5IT9Y 4OHWA 3JTOA 4DV0F 2V69A 3ENVA 1N5TA 1RADB 3A4TA 1R8AA 1RT5B 5THWA 3OSNA 2B8PA 1MSWD 3HVWA 1GTHA 3RJMB 2AZ3A 3CCVS 4J9NA 3HLUA 2Q79A 3MUMP 2GCFA 2HFVA 5A6WA 3DLJA 1GXUA 3QNWB 1RAAB 2MGZA 4ECVA 1H2TZ 4ER8A 1F60B 4QZVB 2WONB 3MR6A 2YKOA 4CLWA 4DFPA 1U47A 2AJQA 4PYDA 1UFWA 2KO1A 3DOLB 3PR5B 1PC4A 2AX1A 5L1IA 1T3OA 3D4JA 2CZVC 5BR8F 3R7BB 1RWNB 2ZH9A 2UXDF 1YJUA 1UPPA 3WQPA 4USHA 4YHHF 1RA6A 4RW9A 3H42A 2V8GA 1NEEA 1JJHA 2BDPA 1WEYA 1U0HA 4C11B 3OFEA 4D3HA 1BWEA 1R6VA 1KC8T 2XMKA 5KT7A 3B78A 2CQ3A 4ZVTB 4O3RA 4Q8FA 3CD0A 4ANEA 1AT1B 1YRTA 3MM5A 4KGKA 5GVQA 2K2PA 2D3UA 4ICLA 4F02A 3M8QB 3CGIA 2JX2A 5K5MA 1SL1A 1SL0A 2DHSA 5G0RA 3GJQB 1QY7A 2MHNA 1FXDA 4QYRA 1N5QA 4F0HA 1Y10A 1NK6A 1FHTA 3NEKA 1D8YA 3ZZTA 3H5YA 2CQBA 4DX7A 2RVJA 3RRHA 1SJQA 3JQJA 2BRLA 4JI3J 2ZC3A 2CJQA 2YKQA 1BY9A 4RW7A 4CNYA 1HNXJ 4YOEA 1D09B 5D0EA 1C1BA 5KFCA 3TYTA 4JI8F 2HVZA 1RAJA 3JQKA 2V6AA 2L9DA 1XTZA 3H7HB 5T14A 2LEAA 2W8LA 1GH8A 3FEZA 3DLKB 5C24B 3BM7A 1LWCA 4IO9Q 4K4WA 2FJBB 3MAHA 3E2EA 2N4CA 3W2VA 1AZSA 1RE1B 3C14A 3EZUA 1ZAXA 1SC3B 1NMEB 3VGSA 2WVFA 3LP0A 5CZXA 4WZQA 1XNRF 4WF9Q 1Q8KA 3ENQA 3PCOB 1RT3A 1JWWA 3PM9A 4F2RA 2XMTA 4AYBD 3DNCA 2I9SA 2MKKA 1KS2A 1LK7A 1FERA 4KV8A 3WC0A 5KFMA 2HGMA 1HIYA 2RU9A 4NRTA 1ZM9A 2H5EA 3OFHA 2VB6A 2FVCA 4G65A 4LF1A 4ZP9A 1S1TA 3F56A 2XI2A 4USKA 4B17A 4ZDNA 1PJ6A 3UN3A 5DGAA 1JIHA 5E3QA 2HFSA 1U1PA 3DRPA 1FX4A 3EICA 2VD3A 4M5LA 2GQ2A 2ADCA 4DSIA 2GNKA 2OSQA 3KG1A 3KUGA 4IFVA 3NS7B 5JJBA 4CLKA 2W9BB 3OR2A 1IR1A 3RAMA 2DNNA 2YH0A 3AD8C 2KFYA 4E98A 4FYDA 2WHOA 5AXMA 2RQKA 4P6QA 2KN4A 2LQ8A 2NXNA 3CJQA 3VAJA
chains in the Genus database with same CATH topology
3C66A 3HVAA 4I7FA 1R8CA 1RT1A 4O4RA 4RW4A 4F3QA 2C2RA 3CC4S 2ZBIA 1DQ9A 1Q16B 3MTJA 5F3ZA 5I4MA 4Q2MA 2RKIB 2R8KA 2RQ4A 2ZBCA 1YG0A 2ZH6A 1Q8BA 1H98A 2NSBA 2HG4A 5D8HB 1NHUA 3BDEA 5F0UA 3H4DA 2HQ3A 2ZH2A 1E6YA 4CO0A 4KRWA 1X8DA 1BLUA 4DQIA 4QBUA 2R8IA 3LP1A 4CZCA 2R8HA 5HI7A 1IBMF 2OPPB 4NX9A 2V2KA 5E3CA 3R5AA 1JLAA 3CCLS 2HIQA 2R7RA 3VZIA 4NMLA 1KEKA 4OMFG 4R0JA 4C8NA 1FRLA 1RT7A 3HPOA 1AUDA 2OMLA 1VQYA 3LP2A 1YI2S 1NKCA 1Y3KA 1WACA 2BM0A 2A2DA 3QIDA 3HVRA 1U1KA 4NA3A 4K4TA 4EEYA 3KLEA 3PXGa 3BB5A 3HZGA 2HYIB 2FDNA 5HLFA 5J2MB 3BS9A 2R2UA 5H9FJ 1U1NA 2UUAF 3DLGA 2LDYA 2BANB 4OI1A 2AGQA 3DRYA 5A8KA 3R5BA 4RUCA 3GZ7A 5M2RA 4FXWA 1QJHA 4FPRA 1C0UB 2DGVA 5E3PA 2MGZB 5CQGA 4DR2F 3BZQA 3RB6A 4IYQA 3J81Y 3CC7S 2ZJQQ 3TX8A 1VQOS 2KG0A 2BV3A 5DDRC 3HXMA 1S1WA 1VK3A 2EG1A 3LUYA 2RH3A 2E1MC 2G13A 2DGQA 3V6JA 4C8YA 2AF6A 4DSJA 2ZDOA 4QIWD 1IQZA 5AE1A 2R7XA 1Q79A 4L72B 4NLPA 3Q23A 1H6KX 3V4IB 4I4BA 4O3NA 2J76E 4I56A 4WFXA 4Z37A 3O5TB 5AE3A 2I1RA 3AJ1A 2F9JA 2ZOGA 4B3SF 1KQKA 1B0TA 3TVKA 3TRGA 2KJWA 1X5OA 4MFBA 4TLRA 2M5YA 2ZZNA 3SZ2A 3U02A 3CO9A 1HD0A 2LQJA 5BYRA 3OUYA 1SJRA 4QWBA 4IRCA 5DQIA 1V9OA 3L95X 2HS0A 5CD4H 2PA3A 1GXLA 3GV7B 3J7A1 1JLQA 1ROFA 4ECWA 2OFHX 3TR5A 4ED8A 4B9NA 2QA4S 1Q53A 2HHSA 3TARA 4TXSA 1R0AA 1HNVB 3BGLA 2CQHA 2D74B 1MROB 5HP1A 1U49A 3VALA 2B9XA 4X84A 4KT0C 4ZKAA 1M5PC 3P5TL 2LXUA 3RB4A 3VAHA 4LQ3A 2APOA 2XGQA 2DTJA 1FEEA 5D77A 4F4YA 2HVIA 1VC6A 3PO5A 3THTA 3OTEA 2IBKA 1RTHA 4QU7A 4YMEA 2QMWA 2UUTA 2E66A 4RW9B 3MGJA 4WE1B 1QAIA 2XSJB 5F41A 4NL5A 3O8WA 2FHKA 2L41A 2E5LF 4MK8A 3MUVP 4DL6A 5CYQA 3MFIA 2P6TA 2D9OA 3ENWA 1JLGA 3M8SA 3CIZA 3OL8A 3R1HA 4LSNA 2NS1B 1UJ4A 4NA2A 4FP9A 1W2IA 4JV1A 5J2QA 2ZITA 1HW9A 2HLTA 4MTPA 3ULHA 5IWAF 4EZ6A 1N32F 5LT5A 2OPSA 3MFHA 1XNQF 4Y2IA 1M5VC 4U67Q 1IN0A 1VHFA 3QMQA 5FDLB 3VF0B 2CFXA 3AHPA 4NCAA 2YWGA 3QJPA 1TV6B 1FTCA 4W90B 2IBOA 3KK2B 1NJZA 4J5OA 3CDAA 2XWXA 1HYSB 4J9SA 4J37A 4ECQA 4PQUA 4EBCA 3DHWC 3MM5B 1P8GA 1LWFB 5JUMA 4DL7A 3PW7A 1L3UA 1S9GB 5HN0A 3G4SS 4BWMA 5L9NA 4FXVA 1MMNA 3GMGA 2DGSA 3CD7A 4ICLB 3C46A 3UD4P 5F8JA 4RNFA 5HROA 3O44A 2BW2A 2EBEA 1XWLA 1SJ3P 2IJFA 4EBDA 2KYXA 2L08A 1T94A 3OR1B 5HL7Q 3M8RA 3C3LA 2ASLA 1FT8A 1HQEA 3FRZA 5G0RB 2LQ5A 4I1TA 1WI8A 4OJ3A 3VWSA 4KFBA 3SDEB 3E3XA 4KC5A 4PWDB 1T03B 1D9AA 1DTTB 2CRLA 2D9PA 1I94F 2LLZA 3K5LA 3U7JA 4Y2AA 2VKRA 3WZ0A 5LMUF 4GKKF 1R8HA 2BE2A 3FFIB 5KFEA 3OL9A 3BR9A 2XS5A 2YNIB 2YX1A 2RUGA 3DOKA 4I6YA 4K4YA 3KLVA 1VOMA 3M6WA 1LXJA 4ES1A 4QQBA 3PHEA 4J9RA 1VLYA 1IKWA 4ATNA 2LU2A 3H2LA 4TQRA 2KU7A 1Q7LB 1RISA 1X4HA 2FLOA 3CCSS 1J5OA 2HVHA 4DUYF 1YJRA 5DJBA 2V5HG 4HDHA 4DFMA 1YJTA 4TU9A 3NCRA 2MKIA 2J0SD 4IFYB 5IS2A 5CCMA 1NK7A 2YWEA 4H4MB 1LK5A 5T41A 4QR0A 3PZPA 2PMZD 2V4RA 4RW7B 4OIXA 2HMIB 2R7OA 4B3OA 4FS1A 1C1BB 2R8JA 1SJFA 1XEZA 4ID8A 4ECUA 3DXBA 3IS9A 2QRRA 4HH1A 4UY85 1R89A 3PFEA 2V94A 2VBYA 4QPXA 1SUQB 2E5HA 2YNGB 4TN2A 4DDFA 1FA0A 1Y7PA 1NRKA 4C97A 4ED6A 1NKBA 4LFCF 2G1DA 2E5GA 2HWHA 2VBWA 5IM0B 3CT9A 5KT3A 3DLBA 1M5HA 3DHXA 1N0UA 4EFAC 1U1OA 2B5JB 2DBBA 1GQEA 1TL1A 5D4OA 5F8IA 4M95A 5M2UA 2HLUA 5CCLA 4H54A 5KFZA 1S76D 3W3SA 2EFVA 3OQ2A 4DQRA 4B9LA 1SL2A 2IVFB 3BREA 3GIMA 2CPIA 2XHWA 4X4TA 4WKRA 1S0NA 4PCQA 2HNZB 2P9EA 4ZP8A 5DS7A 2ZH7A 1LWCB 2MQLA 2M4MA 5F8HA 1NAQA 4ID5A 2WK4A 3QIPB 1VBZA 3ITHA 4R5PA 4WXOA 3QJLA 1KTQA 2DO0A 2GQCA 3D0GE 3IR5B 4EO6A 1JLEB 1QE1A 4NLXA 2E5JA 1JLFA 5KFPA 4LVOP 1C0TA 4QIEA 4DHVA 4MIBA 2BBEA 4QW8A 1S1UB 2ROPA 2QV6A 3W2VB 4LVNP 4ZPBA 5LL6d 3HK2A 1O51A 2VG7B 2JHEA 5CYMB 1QAXA 1RJJA 5D4LA 2W9AA 5LJ3Y 3MF5A 3N5BA 4LF9F 1OWXA 2MQQA 3S7RA 3CJ4A 3GFYA 1DLOA 2QIFA 2HHTA 4PXDA 4ED0A 4TY8A 1CG2A 4X4NA 3I9V9 1BQMB 2IC3A 3LP0B 4IDKA 3I55S 1F9FA 1RK8A 2W7OA 3MECA 2IM1A 2NPFA 2YKMB 1VQ5S 3HKWA 2Q6CA 3BSOA 4YR2A 4KO0B 1TR0A 5IT0A 4OZ1A 7FD1A 5AJ3F 1S99A 4I6AA 1KLMB 3VAIA 2AU0A 1HPZA 2GV1A 3ISND 1RT3B 4R25A 4X62F 2B6AA 2V8DA 4I6WA 2XLIA 1N34F 3QPIA 4JI4F 3N79A 5F8MA 1VC5A 1ZTTA 3AJ2A 5CZVA 4A46A 2E9RX 2WBRA 5B0GA 2UUCF 3ZZYA 3US5A 4F50A 2MY7A 2FVQA 2RJZA 4MYUA 3ZZ0A 1AFJA 3RB0A 1P9QC 2JJ4D 3MOZA 5T7LA 4KHMA 1FKPA 4LF4F 4QR1A 2FGCA 3ZZPA 2VA3A 4KV8B 3AAWB 5I3UB 4ZHRA 1TAUA 2YNFA 2K1RB 4P7VA 3OVSA 2VONA 2V4JB 1S0MA 2FB0A 2QLXA 1DQ8A 3BJYA 1TFWA 2UXBF 4CO4A 4UW2A 1M1KT 2R7UA 4RKUC 4M8LA 1FD8A 4PR6A 1RA7A 1JKHA 3VAKA 3MEEA 2QE5A 4DR6F 1IKVA 3NS5A 1S1TB 2KDOA 3RZAA 2E1RA 3H2VE 1X9MA 1Q82T 4PG7A 1R7IA 3HI9A 2KXHA 1EETB 2ZD1B 4RBTA 1CQMA 4G1IA 5EUHA 3M2UB 5IT4A 4WIIA 3SCLE 1RTJB 5KG3A 3MUTP 1SV5A 1ULRA 2FIUA 2VC0A 3DRPB 4MIWA 2MZRA 4KSEB 3KG0A 2IA6A 1JLBA 1N33F 2XLKA 1IM4A 1JNRB 2CVIA 2UVUA 3I0SA 2JLGA 1FVQA 3L3CA 4IFVB 3BN4A 1PSDA 1FTRA 3OR2B 4HTJA 5LJ5Y 1N5YB 2DRBA 4FF3A 5KFWA 3OXFA 2ERRA 2ZDPA 1N52B 1JLCB 2B4VA 3PKYA 2KTQA 2UXCF 5KT2A 2KKHA 1G2EA 3OTBA 4ITSA 4DSFA 2XCPA 2ZE2A 2B7BB 1EP4A 5B0FA 3P3DA 2JRSA 2NYIA 5EWFA 4DF8A 1DQAA 1S9EA 4GC6A 4I7FB 5I3QA 4RW4B 1RT1B 1CSJA 2B9YA 1VMBA 2PIIA 4LQ9A 4AL5A 2JSXA 4U6PA 2QA4G 1B64A 2CIMA 4MIAA 4Q2LA 3KK3B 1VQ6S 2KFNA 1WF0A 3N6LA 4QU6A 4NZ6A 2IA0A 3U1NA 3MM8A 2CQ1A 2X1GA 1E6YB 4LIWA 1Q4RA 2KVIA 1Q81T 4OI3A 4IO1A 3LP1B 3LF0A 1GX5A 2JFKA 4ZPDA 2M52A 1ZPWX 2ROGA 2YWKA 4RW8A 4YB7A 3KHGA 3IA0A 4A47A 3B4MA 2J9EA 1JLAB 2NUUG 5HMZA 2W8KA 2J9DE 3DM2A 3K5MA 1GTEA 3K5OA 2DIVA 4LIRA 3NP5A 1YJWS 1KTVA 1AW0A 1OPZA 1KQFB 3AY0A 5L39A 3HX9A 3LP2B 3BSCA 2M88A 2GJIA 3I6PA 3MAQA 2CJKA 3PEJA 4BDPA 3M6XA 3JSYA 3CCES 3KLEB 4RNOA 2YTCA 1T7PA 4U9RA 2ZHOA 5HLFB 4DL5A 1C4AA 3DLGB 4Y00A 3L09A 5A8KB 2DR8A 4PPZA 2QA1A 2N3OA 4PUOA 3O3LA 3I5BA 4C9DA 2OD4A 3CDBA 5CH7B 4AQYF 1S1WB 3TO8A 2PN6A 3UQSA 3V4MA 1PGZA 3KKFA 1L5UA 4DWIA 4CT9A 1MWZA 2CPJA 3IGVA 3HHLA 5KFRA 4TY9A 3HVTA 4M94A 2LA6A 1X9SA 1KRPA 2MKSA 2GHWA 4C2MA 5GAHU 4Q0BA 2HGNA 3IO1A 2E9TA 4CQ1A 1O8BA 5FD1A 2PI4A 4YQWA 1U4BA 2LECA 5KG4A 4DPOA 3VAMA 2WBMA 2ZHAA 1WEXA 2BM1A 2DNZA 4YEAA 2P5VA 4LSLA 2LXFA 2KRRA 2W4CA 4F67A 3FMBA 4HL9A 1CEZA 2CQ2A 2BACA 1MMDA 2DNKA 1RP5A 5IZHA 3V6DA 1FKOA 4MFBB 3NMAA 4X66F 1GNKA 1L3KA 4TNOA 2FD2A 3SCJE 1WHVA 2ZKUA 1IR0A 2CQ0A 4X65F 3OUYB 4OX7A 5L8RC 1S6QA 5DDPC 4MKAA 4CT8A 1HMVA 1TAQA 2ADBA 1JLQB 1S77D 1JB0C 3B8HA 2MZJA 4USJC 1KN6A 3GV8B 2JOQA 1KHWA 1R0AB 5KTQA 1GX6A 2CZ4A 3M8PA 3WX4A 3DMJB 3LH2S 4QJVA 4XPEA 5HP1B 1K8AT 2W4PA 1X5TA 4N8OA 1H2VZ 3RR8A 5EN1A 2PGCA 3M2RA 4CO3A 1FK9A 2X1BA 3C6TA 4WJBA 4XDCA 1TZ0A 4MK9A 3V2UC 2OAUA 2WONA 1RTHB 4H4OB 4IH5A 1ZYQA 3QGIA 5CA5A 2IHR1 3I87A 1T8EA 3SSQA 1G1XA 2DNPA 2M70A 1XR7A 4W92B 2N4DA 5CYQB 4DBQA 1JLGB 3QYYA 2XMMA 3H4BA 2BQRA 1RTIA 2V9KA 1TK8A 5F9NA 2MKHA 3PO4A 5B0DA 5J2QB 3MPWA 5E7OB 1FXRA 4P2SA 5E33A 4DJBA 3IRXA 5C42A 1HBNA 2OPSB 1UMJA 2B4UA 4HYKA 4IH6A 1TL3A 4GO7X 3JSRA 3NGKA 4RW6A 3DOMA 3EGWB 5M2PA 3HO1A 4DV4F 3SQGA 1Q7YT 1U2RA 4KPYA 2IYGA 5KFXA 4ETXA 4FBUA 3RTVA 4HH0A 4LJMA 4B02A 2N7YA 4J9LA 2RS8A 1A9NB 2P9CA 1SH3A 2UV8A 3HHLD 4C7QA 3NBPA 4EYHB 4PQUB 3V6KA 1U1LA 4L3NA 3J7ZT 4CH1A 3CULA 4WKYA 3CJ2A 4Y65A 4NOHA 3G96A 2AD9A 3G86A 3NNHA 2FJDB 2DNRA 2HS4A 2CQCA 5HROB 2DGUA 3QWPA 2IRXA 4C0HA 5DGBA 1WTBA 1DTQA 4J9PA 3ZZUA 1NK4A 1HQEB 3IR6B 4G3IA 1NHVA 3C6UA 4KFBB 1DJ0A 3DRSA 4QIFA 4OZ5A 1KQSR 4B9SA 2YQ3A 2OD6A 3E01A 3KOAA 3N0VA 4WFZA 4C3MA 3GWCA 4JI0F 4J9QA 4JYAF 3JB9k 4TQSA 3NNCA 3HFKA 2F3JA 2RT3A 5DDOC 5DG9A 4DL2A 2BA9A 7FDRA 1T95A 2MZ1A 3J7Z5 4HTIA 2BE2B 2FVRA 3IWNC 3CJKA 4BS2A 3JSBA 1HBUA 1YRUA 3WDOA 1PC5A 1BGXT 1N0VC 3N9UC 2K7JA 3DOKB 2GMHA 4DMZA 2H9ZA 3MMCA 4MJKA 3H98A 2F40A 4YR3A 4QWAA 2I2YA 3TVZA 3IGNA 1KQGB 2YX4A 1IKWB 2A3JA 1U09A 1F5AA 1J5OB 3UPFA 3MD3A 4ZOSA 4JI6F 1MMLA 4QWDA 3SCKE 2AQ4A 1Z2LA 3DU5A 2V0NA 2NUHA 3UR3C 2XS7A 4XO0A 3KWMA 3CCMS 4FS2A 2W7AA 3R5DA 5E0OA 1RT6A 4F4KA 4YFUA 2KHDA 4FVCA 1U6BA 1SH2A 2DR7A 2CQDA 4DN0A 1WWHA 4A8YA 4B3OB 3CDWA 2MKJA 1Z2ZA 3T19A 4C3LA 5K8PA 1UKUA 2DK2A 4IR1A 1SIZA 2JVOA 3IS9B 4KIAA 4KJIA 4KGMA 2BJEA 1UAWA 1LW0A 2VKZG 1KOOA 5KFIA 2HNYA 3BGRA 3GFHA 4Y6IA 4ZVHA 2COLA 2XMWA 3CSKA 3BO4A 4DX8H 1TL1B 2R2RA 2CVEA 5E2QA 2N82B 1TP7A 3BN7A 2RNEA 2LA4A 5A0YA 3H40A 1Z4UA 4BC7A 2KXNB 3NAHA 1IJEB 1NH7A 4K4ZA 2UUBF 2IYIA 1RQ0A 3SV3A 5KT4A 1ZH5A 2E44A 4WFAQ 3NCPA 4URQU 3CCTA 3DYAA 3HHEA 4O44A 4ID5B 2Q66A 2RRAA 3CWJA 1U24A 3ITHB 1R3NA 4R5PB 1OSDA 4BBYA 3WBZA 1QE1B 1UEVA 1JLFB 1C0TB 1SJ4P 2XI3A 4ZPVR 1FD2A 3VCDA 2VFTA 3CJ5A 2PI5A 1MWYA 2V8VA 2DNQA 1S4FA 3M1VA 4O0IA 3MXHP 2RMLA 4RZRA 4IOBA 3OHAA 4AL7A 2RS2A 2B9WA 4DV5F 2DITA 2CYYA 3LAMA 2HHVA 1DLOB 1S6OA 2VFUA 1URRA 2R8GA 3Q8QB 4TY8B 3X1LB 4CIOA 1U1RA 4NLQA 2IC3B 1VQ9S 1GT8A 1WF2A 4IDKB 4Q8EA 3MECB 4ZS6A 3N5FA 1NK5A 5EX0A 4DSKA 1LKZA 1SKSA 2DH8A 1QVFR 2RDJA 2HGLA 2Q1LA 3U1MA 4HD