1FDDA

Azotobacter vinelandii ferredoxin i: aspartate 15 facilitates proton transfer to the reduced [3fe-4s] cluster
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTNCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azotobacter vinelandii ferredoxin I. Aspartate 15 facilitates proton transfer to the reduced [3Fe-4S] cluster.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport(iron-sulfur)
molecule keywords FERREDOXIN
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fddA00
4AYBD 2V4JA 1FRLA 3MM5B 2PMZD 1GT8A 1JB0C 3OR2A 1FRHA 3MMCA 2V4JB 3MM5A 1G6BA 1D3WA 3EUNA 1FRXA 1R27B 2WAQD 1G3OA 2Z8QA 4OMFG 2VPXB 1GTEA 5BYQA 1Y4ZB 1FDBA 1GAOA 2VPZB 1JNRB 1SJ1A 1FDDA 1H0HB 2C3YA 1Y5NB 1XERA 1FERA 2WSEC 4DHVA 4ID8A 3MMCB 1BWEA 3EGWB 1FXRA 4Y28C 1B0TA 2FJBB 2WB1D 1CLFA 3MM9B 1FRKA 1BQXA 3MM9A 4XK8C 5FD1A 3IR6B 1B0PA 1H7XA 3IR7B 1F5BA 5CHCB 1FTCA 1FXDA 2IVFB 2VPWB 6FD1A 2FJAB 3PNIA 1BD6A 3HKZD 5BYSA 2C3PA 1H98A 1A6LA 1ROFA 2FDNA 2VKRA 3IR5B 2GMHA 1Y5IB 1SIZA 2XSJA 3MMBB 7FD1A 1JNZB 1FEHA 3OR1B 2PDAA 2WSFC 2V2KA 3MMBA 2VPYB 5L8RC 1GTHA 1F5CA 1FRJA 1PC5A 1IQZA 1BC6A 3EXYA 4OV1A 1RGVA 4YDDB 2ZVSA 3MM6A 1WTFA 1FCAA 1AXQA 4L6V3 1K0TA 3MM6B 2O01C 1VJWA 2FJDB 3GYXB 5BYRA 1BLUA 1FDAA 2WSCC 5E7OB 2C3OA 3MMAA 4RKUC 3MM8A 6FDRA 7FDRA 2PA8D 1HFEL 3MM7B 2XSJB 1KQGB 2UZAA 3OR1A 3MM8B 5CH7B 1IR0A 2FJEB 1C4AA 3C8YA 1FDNA 1KQFB 2GMJA 2C3UA 2FD2A 4CI0B 3OR2B 3LW5C 4KT0C 1DFDA 1FF2A 1H7WA 1Y5LB 1KEKA 1DURA 1C4CA 4XDCA 1Q16B 2C42A 3MMAB 2Y0SD 1PC4A 1FRMA 3MM7A 1SIWB 1B0VA 1F2GA 2FGOA 1FD2A 1DAXA 2C3MA 4XDDA 1FRIA
chains in the Genus database with same CATH superfamily
2V2QA 4DPYA 4CH1A 1CG2A 1UVMA 3F44A 2YPZA 5H9FK 3O3LA 2GHVC 4ANEA 4K2XA 1WC3A 1FKPA 4LSNB 2AGPA 1KQKA 2LA6A 2BANA 4BLGA 2RQCA 2ZJRQ 4JI1F 2DBBA 1X5OA 3SXLA 4BHQA 4NLUA 1T95A 1J27A 2DGVA 3BGRB 1TQLA 3KLEA 1OIAA 2UUBJ 2Y9HA 4K50A 4KRWA 4USTA 3CB4A 5DQHA 4I2QB 3W2WA 2VFSA 1CBKA 3MPVA 2RDJA 3J81j 3HMJG 3N9UC 5M2RA 1VJQA 2BJ9A 4OHZA 2E1CA 1YSJA 3LO3A 1YG0A 3UO0A 2FJWA 2ZDPA 3CDEA 3TZXA 3BSNA 4CCHA 1WNEA 5EWEA 3QRQA 5D3GA 4DR1F 4ZLPA 1RXOB 3WC2A 4QIWD 4ECSA 1T11A 2CNNB 3K0JA 3LP2B 2UXDF 1WG5A 3MD1A 1HBNA 2FVCA 5HBMA 2V2VA 5K14B 2BJDA 2D3UA 3L4BC 4M5JA 2BQ3A 3EVMA 3DDKA 2ZBRA 1HD1A 1UZHA 1RCXB 4JI3F 3UWTA 2AEMA 2FJBB 4X62F 3M2RB 2KU7A 3NGSA 4R0EA 3EYZA 3MM9B 2XLIA 4P2XA 2PI5A 1EARA 3I82A 4O4GB 4WBFA 1HWLA 1LWEA 3MM9A 1P6TA 2BKOA 1RTHA 1S6PB 3R6LB 1SV5A 4C3LA 2XMMA 2DVIA 4F3OA 4ZN1A 2YNGB 2QLXA 2RD5C 3PTWA 4QYZK 3KUGA 3TANA 2WONB 4F0KA 2EFGA 1QSYA 1UVLA 1AZSA 3AJ2A 2PT0A 2CQ3A 4ZLLA 2DY9A 2CQPA 2RHSB 3ZZUA 1N0VC 1P27B 1Y5IB 5J1EA 5GAEI 2MKCA 3C16B 5E41A 2NZ4A 3SQOP 1FEHA 1TELA 4KO0B 2C2DA 4GO5X 4CP5A 2EEYA 4NLTA 1PBAA 1YHQS 3AT1B 3DRPA 3H4BA 2P5VA 1S72S 1S1TA 2BM0A 2ZUGA 4MYUA 8ATCB 3TVYA 4QCLA 2OO4A 3ZZPA 4B3TJ 1RP5A 3AD7C 1S12A 2VG6B 4MIWA 3W8PA 4TY8B 5KFHA 2BMBA 2WW8A 2M8HA 4LF2A 2OTJS 2O01C 3QIPB 3TW0A 3K17A 1VI7A 4CTAB 1NEEA 4K5RA 2JEJA 2OGUA 4MAKA 1NZAA 2BDPA 2ZNYA 2RS2A 4LFAF 2V94A 2JC1A 3MMAA 1RT2B 2PA8D 2DNZA 1ITPA 3K8VA 4FYYB 1T9VA 4I2PA 4RL1A 3N5BA 1NSPA 5F8JA 5K9FA 2GIRA 3MTKA 3POTB 4DU7A 2LU2A 9ATCB 3D3CJ 2MEWA 2ZH5A 2FVSA 1OYDA 2CPDA 4QQBA 4KQZA 4OYWA 1SL0A 1ZOTA 2X3DA 4QR2A 2LEAA 4CDIA 2KXFA 3MECA 2Z2YB 3UQSA 5KFKA 1VQ6S 2PE8A 1T94A 2PSZA 3MEKA 3N0VA 1FWKA 3G6ES 2GS8A 4EU0A 4ZOSA 4HDGA 3R7SB 2YNHA 4KT0C 1KWMA 1SVDA 2HSEB 4GC7A 4K8RA 3M2UB 3IAS9 4HACA 4IDKA 4W4MA 4WIIA 1S49A 1VQ9S 3SCIE 1TK5A 3OXGA 2ZNZA 3LTOA 4NZ0A 3FRYA 4DR2F 1LWFA 1H74A 3UN5A 4DDFA 1Q7YT 4HL9A 4LRDA 3Q8QB 1HLWA 1PC4A 1FRMA 2B5JA 2DD8S 2VFVA 1U47A 1JLEB 3PX6A 2HHHJ 4UQGA 4PQUA 4YUDA 5HSPA 4OHXA 4X4UA 1F2GA 4AUKA 2HWHA 3IGNA 4S0MA 1TK0A 4ANCA 4HT7A 3EX7B 3HK2A 3N01A 4IOAQ 2ROGA 3AA8A 2B4VA 3LF0A 3PX4A 1WOPA 3ZNUA 1VRUA 2AZ1A 1KFDA 2B8PA 1NK7A 1FJCA 5LMNF 4OYPA 4U96A 1V5IB 5EUHA 1Y0HA 2H9ZA 2W8LA 1J2VA 3MURP 1RJJA 3MOZA 1HKAA 2WAQD 2ZKTA 3RW6A 3H5SA 1T8EA 3U1LA 4ECYA 1NPKA 2GC8A 4YDXA 2KM8C 1ZETA 1SV5B 4OX6A 4LIWA 4ER8A 1T05B 1KNZA 2EFQA 1HNIA 1HYSA 5HMYA 4FYWB 2VB6A 1UJ6A 1XMOJ 3Q24A 2DK2A 3W7BA 1RHMB 3HX9A 2RNEA 2EK1A 3UW1A 3R8YA 4NXNJ 1LK7A 3H25A 1F60B 2VZ9A 2AU0A 1PJ5A 5CAAA 4ED6A 2G2OA 2KI2A 3C6UB 4OQJA 5L39A 3N4WA 2E1RA 2VQEF 1GNKA 2XYHB 3IBCB 5DJBA 1HNXJ 3DLEB 2CJKA 4A8MP 4NZ6A 4C98A 4UTGA 1F9FA 1RWOB 3GB0A 3HHLD 1Q1KA 2C2OB 4LR7A 1HBUB 2MZQA 2RF2B 5FD1A 5T7LB 2JZ5A 1E6YA 1R3NA 2RDDA 2Z2MA 3MAQA 4A8YA 1RT3B 4DF4A 3T5JA 1EQMA 2YQ0A 4GKKF 4B17A 1KSPA 4ITSA 5D77A 2MTLA 5KG7A 2W2PP 3PYGA 1H98A 4C8MA 4J9MA 4OV6A 4DR5J 4JI4F 3M6VA 4N41A 4PPZA 1XNRJ 1AFJA 1JLCB 2DCLA 4FKYA 1NBEB 5C25B 3TQ1A 4J7CA 4N7TA 4QR0A 2CRLA 1VQ4S 1N33J 4JI7J 3A12A 3V2UC 2GW8A 3S1TA 3OFFA 4WFNQ 1U6BA 3DRSA 3IC1A 2R3VA 4OZJA 4F0HA 5KFFA 3M1VB 4CLSA 1QAJA 4KTQA 1F5CA 2GQ2A 2MZRA 4UT4A 3BQ2A 4V1Ak 1CJVA 2HAIA 3CJKB 2BYCA 4YDDB 3PYFA 2ZDOA 4ECWA 5CCMA 3EPIA 1LW0B 2B8QA 3M2UA 1QTNB 3MM6B 4I1TA 5DQGA 5CCLA 5KT3A 1F2HA 2LQBA 3ZZYA 1AROP 3CCSS 1RQ0A 3GLJA 3M8PB 3MM7B 2J7KA 4CLTA 3TZYA 4M5DB 2OPQB 1NK4A 2X1BA 1S0VA 4KO0A 1IKWA 3UVJA 2WHOA 2PFFB 3KK1B 1VHFA 3CCWA 4DX7A 2A2CA 3FEXB 3D0HE 4YHHF 1D8YA 2VQEJ 1K9MT 2K3IA 3J7YU 4A8FA 4DR6F 4X4NA 1SKSA 4ZP9A 1YZ7A 2KYXA 1UVJA 3SBMA 1SUQA 4FYXB 4CNYA 2Q79A 1DQ8A 3CD0A 1GMUA 1YI2S 4F4XA 3D1QA 5A8RB 5M2PA 4F25A 2PO4A 4Z7YA 3VHQA 2AV5A 2DNQA 3IRXB 3RG6A 3KYLA 1C0UA 2VBYA 5GADI 1PIEA 2C42A 1GMWD 4URSA 1YLXA 2HBYB 5GADU 1S1XA 4DR5F 1UFKA 1ACMB 2OI2A 2GVZA 2ZHAA 2A18A 1RAEB 3N79A 3NL0A 2PA3A 5KG6A 4IFVA 3FJ2A 3SSQA 2UUAJ 2LU1A 2V8GA 5ETNA 2UVRA 3PO4A 3TZZA 1U1KA 4E98A 5E2QA 3VAMA 3PR4A 2IJFA 3CC7S 2AHOB 2IY5B 4OI4A 2DNOA 4FXWA 1ZS6A 1X5PA 2VC0A 2X7IA 4HDHA 3VGSA 2VHGA 2UXDJ 2DB1A 1O5JA 1R27B 3P96A 1DTQB 4JI6F 2MQMA 1L3KA 1G3OA 4Y65A 5LMUF 3SZ2A 4A8QA 3DGVA 1T9XA 2C2NA 4OMFG 3MR2A 1RTHB 1S6PA 3GONA 2B6AA 3PX0A 2F7VA 4J37A 4JI5J 4N5SA 4RW8A 2M0GB 2DNLA 2QMUB 1X4FA 4G65A 3C14B 2BACA 2HFNA 2W01A 1VBKA 3NWGA 3GJQB 3VCDA 1RYSA 2YQ3A 3IP0A 1TKTA 3MUVP 4P74A 3LAMA 1WUUA 1XERA 2HNZA 1EETA 2HNYB 2J0XA 2J7UA 4JI8F 2RILA 1TP7A 2FHJD 1F9EB 3M8SA 2Y1RI 3HHEA 1KLMA 4C6AA 3VAIA 4IOCQ 2YNFB 3KUHA 2I2YA 3W5YA 4R8UB 3J81U 2W2MP 1YBTA 2UVUA 2ASJA 1SPBP 3CCLS 1RAAB 4ALZA 4I0WA 2HK3A 1XQIA 1RB0A 2DGSA 5LSRA 1Q53A 1IM6A 1F5BA 2LDYA 2VASA 3NGDA 3CTRA 1FTCA 2OPPB 2DR6A 2RQMA 1S5ZA 3KLFB 5DDRC 4B3MJ 2QFIA 3RB4A 1BD6A 5FLXU 2J6UA 1U8WA 4PWDB 1ZPVA 2DNPA 4I56A 3OHAA 3AH6A 3SI8A 2HZVA 3QJLA 2RS8A 1WEZA 1BY9A 2IYIA 5J2MB 2IJNA 3M32A 3AXKA 1N54B 1X5SA 2R2UA 1RT5A 3DOMB 2ASLA 2WCXA 3TYTA 2PDAA 5EDWA 3MGJA 3I55S 4DN9A 2L9WA 3GSIA 2IPOB 3NCQA 4C8KA 1VQ7S 1FRJA 1WC1A 2PEBA 3GFZA 3R7BB 2QO3A 2IHR1 4NA2A 4LFBF 1W2IA 1UKUA 2U1AA 1X60A 3E01B 3TVKA 1RGVA 2IAJA 3BN7A 3G82A 4ZA1A 1HWUA 5SZTA 3KK2B 4TY9A 3HZGA 3W61A 5KAKA 2DH9A 1PBUA 3GYXB 4FXVA 3K5MA 3TQEA 3H2LA 3NAIA 4X4RA 2OSRA 2AWZA 1VLOA 2C3OA 4ZCKA 1PKUA 1WKLA 2FHMA 3IFEA 2RVJA 4Y3CA 5CXTA 2JFKA 2EG2A 3W2VB 2JOQA 4DR7F 5CH7B 2DR9A 3M9NB 4YQWA 1JIHA 1Q8IA 2CJBA 2ZHBA 2F9JA 1I6JA 2EFOA 2VJVA 1FX2A 2ZH2A 4LVNP 4NLYA 3BGFA 2FQQB 3CSKA 1B99A 1MU2A 2GFFA 2PGCA 4PYAA 3HM9A 3KHLA 2OH2A 2KFNA 3B54A 5DLFA 4BC9A 4OX9J 2CJYB 4H4OB 2DNHA 3MZIA 2KZZA 4MIAA 4ED3A 4ZPTR 5A2QY 1H7WA 4M5MA 5AE2A 4JB8B 3RRHA 2UXBJ 3CNQP 1DTQA 5MAOA 4N76A 4BC7A 2JWNA 1OQ6A 2C2EA 3AFGA 2DR7A 2XCAA 1DLOA 2OPQA 1OY9A 1NM2A 3H2UB 2H5IB 1MWYA 4C0HA 3L9ZA 1M5HA 1RBAA 3F73A 2WK4A 5LOQA 3M9OB 2J76E 4ZK7M 2D3ZA 2XZDB 4NCGB 3VAKA 2V8DA 3PHTA 4R5PB 4G6VB 3GCXP 2HNZB 1R7IA 4PPDA 3F56A 3JAMY 1GT8A 5CYQB 1U1LA 1RKJA 1N56A 2MHEA 3PW5A 3M30B 2DT9A 2ABYA 3R6GB 1PG5B 4DL3A 4OZ0A 2CFXA 5F41A 1B70B 3DCAA 5KFOA 4RUCA 4C11B 2Z8QA 4RW6B 5LXRA 2HZAA 2JEGA 2ZUAA 4WXWA 1GTEA 1M1GA 4GVLA 3BSCA 2B3TB 4GKJF 4WZQA 1TFWA 3TEGA 2ROEA 1FDBA 1GX5A 1M90T 1REVB 1RT6A 4NMLA 4YEAA 4B9VA 1SJ1A 3KDOA 1K1SA 1BQNB 2QX0A 2AD9A 3EVOA 2FVQA 1CULB 2FZGB 1IR1A 4OI0A 2HVHA 3UDEA 3Q2TC 3I4PA 2IIHA 1A9NB 1RWMB 2XI2A 4O3OA 4N47A 4EK2A 4K4XA 3CJ5A 3MHYA 4ZCIA 3MAAA 3A8KA 1JLQA 3RYLA 2NYIA 2H65B 4EO8A 4M5KA 4MMOA 5IV3A 1NDLA 2XLJA 4ILMA 2J9DE 1G2EA 2IRUA 4L73A 2FZKB 2KJVA 1T03A 1FFSB 3DM2B 2EVZA 2AKWB 3CJ8A 3KWMA 4LRCA 4OZ2A 3MFIA 2LXUA 2HBZB 5D4LA 1U02A 2IBOA 2UXBF 3WDOA 3HVTA 4L3KA 5F9LA 4MH8A 4R5PA 1J5OB 3KTQA 5IQ6A 2DJWA 4U8YA 3QJJA 4NLSA 4LF8F 2HWIA 2XZTB 3QT5A 1HL6A 3EXCX 3M6UA 1OJ4A 2BKNA 4ELTA 4F4WA 2E5JA 2FYXA 4ID5B 4L76A 4WF9Q 4PXBA 1HPZA 2QT7A 5I42A 2AX0A 3I9V9 2KRBA 3DOLB 1PC5A 3FCHA 1V3SA 2DHSA 4NLVA 5I42B 2XO6A 1RWXB 4DV6J 2KZMA 3TZWA 4ES3A 1NU4A 3BPSP 1S99A 4QIVA 2HHUA 2XNRA 2QRRA 2E66A 3DN9A 2GV1A 1TKZB 2NXEA 3CD5A 4RBVA 5EHHA 2IAJB 4ELUA 3HP6A 2KVIA 4A8OA 3D7SB 4C48A 3C66A 3MEGB 2F63A 2UXCJ 4GKJJ 2LMIA 3FFIA 2QFJA 1DTTA 4ECXA 3PCOB 2Q66A 4YR3A 5DG9A 4M5HA 2BW2A 2EPIA 1DTTB 3H40A 3VVUA 4FKXA 4O3NA 3W2VA 4ZMMA 2G0JA 2OD4A 3C8YA 5SUHA 3KK3A 3TI0A 4WFYA 5FDLB 4J9LA 3QLHB 4CWBA 3RBEA 4USVA 4J9NA 2G0CA 3SIPB 4F4ZA 1WHVA 2HW3A 3EGNA 4J5OA 1YJTA 1L5UA 4K4WA 2MSSA 4Y6IA 3LW5C 5A8KB 1IM4A 3D1HA 3QGHA 3TAMB 2QA1A 4WU2A 2VQFF 2D3OR 4EUVA 1KEKA 3R5CA 1FJGJ 4A8KA 3G6YA 3CJ0A 2JSXA 3BQ1A 3TUPA 2DGOA 4XDCA 2E9ZA 3THVA 1F3FA 4QWBA 3IS9B 1URRA 4ZVSB 2DRBA 4FBUA 4NA3A 2HIQA 3I5CA 2G1DA 4P2MA 3ZTPA 4PYDA 1RAHB 3EZUA 3O2IA 2R7OA 2MQPA 3V4IB 1RU2A 2VG7B 3PW2A 1KRPA 4BDPA 3MTJA 4ANDA 3T1YF 3QIDA 1U09A 2PFDA 2W24A 2W4DA 1U45A 1VGYA 2R7XA 4YB7A 1N5VA 1VISA 2PMZD 1JB0C 4A8SA 3T1HJ 1HBNB 5HBMB 2YKNB 1RCOB 1VFJA 1QM9A 2YX7A 3GV8B 1CJUA 1U1MA 1IKXB 3M30A 3W63A 1J5EF 2FZCB 1JJHA 1NDPA 1S1VB 2IJRA 1LFPA 2ZOGA 5B0GA 3WIVA 3DYAB 1NKEA 4HHJA 3KMQA 2BJ7A 3OLBA 2HLTA 1I5OB 3QFWA 2YWKA 5L38A 5AXNA 2R7RA 1ULRA 1I94J 1X8DA 3H59A 4N77A 4JI5F 4JYAJ 2YXLA 2P6TA 4OHVA 4Q8FA 3Q86A 3RR7A 5J1PA 1PJ6A 2AW0A 4ES2A 3F0NA 4PG5A 3CXCR 4OJ3A 4ZPWR 1BWVA 4JI8J 2OKQA 3SMZA 3PW7A 1X4HA 4JI0F 3ICLA 3H98A 3T41A 5IXUA 4IRCA 2KO1A 2YH1A 2VBWA 2EFVA 4LF6J 3VGTA 3AD9C 4M8LA 1HNVB 3EE3A 5F8IA 3CPWR 4AQYJ 4YFUA 4RW4B 1B0TA 5L1KA 4DUZJ 4CLFA 4Q44A 4C8LA 3GYNA 3BQ0A 1NZ8A 2I5JA 2QSFA 3PJXA 1GMVA 1M5SA 2CYYA 3E51A 1QSSA 2HYIB 3KJQB 1KBRA 1LKZA 1RTIA 3HHLC 2V69A 2ZH6A 4KR0B 1P1TA 1M5PC 1B3TA 4C2MA 4LR8A 2F8MA 2DH8A 2XMJA 5J2NB 1FO1A 1KDNA 1HHQA 2CXEA 3HKZD 1HBOB 2K1RA 3FZBA 1X4AA 3NRBA 2NXUA 3Q8PB 2H54B 2MB0B 4B3RF 2DR5A 4OYBA 4P7TA 3VVTA 4B9NA 3E2EA 2N4CA 1KLNA 4KGXB 3IM8A 2H1YA 4W98A 1UEUA 4B02A 3G6VA 4LF9J 2E9TA 3PKMA 1HNWF 1NO8A 4Q2LA 2AJ4A 1F9HA 4PRFA 1Q86T 4URGA 3HSGA 4F3QA 4FF3A 1FK9A 5CD4H 1JLBB 3HPOA 3OTOF 1AFIA 1BC6A 5K8PA 1TL7B 2VV5A 3IWXA 2JC0A 1X4BA 3OL7A 3T5KA 4EEYA 1FXLA 5B08A 1RT4B 3LQVA 1QSLA 2J8SA 2FPHX 3OJUA 1R0AA 3ILOA 4I67A 2WOMB 2Z58B 2I0XA 1Q0NA 2OPSA 1Q81T 4EWTA 4V19J 3UCGA 4XO0A 1ELOA 4XPEA 3R1LA 1X7VA 3H90A 3QT7A 2VOPA 2HHVA 1RT1A 3IS9A 4NYZA 3FFIB 1UEKA 3JSYA 1W7WA 4DXLA 2CADA 4UQTA 3BGUA 3HDSA 4FF4A 3CT9A 1PAEX 1TL4A 4O4RA 1TMMA 5GMKa 4KGVB 1RU1A 1IKVA 2QG9B 3QLHA 1YTYA 2DNYA 4DS5A 4JI7F 1WEYA 2HHSA 4QIFA 4K4SA 4DV5J 1U49A 3M7VA 3IRWP 3GYGA 3VR1A 4DFMA 4AT1B 4NLDA 1CPZA 4JV0A 3K5PA 1S1VA 3J7ZT 3MMAB 2ERRA 2VA3A 3UN2A 1SQEA 3US5A 3T5HA 3D0GE 2UUWA 3R2DJ 5KFEA 4LQ3A 4DMZA 4IRDA 1R89A 2AEJA 1HNIB 1PJ7A 3BKUA 1VC5A 1MMDA 3AQOA 4ZVHA 1H2UX 3V4IA 4FVMA 3H8YA 1HNXF 5IT4A 5HMZA 5D4NA 3RW7A 2RSQA 4AL5A 2EKYA 4NLQA 4KC5A 2P6SA 5KT2A 1C0TA 2HVDA 4USUA 4U95A 2P9EA 2QL7B 2X1FA 4MT1A 1YVFA 5HATA 3JB9k 2DNKA 4MKBA 4C8NA 3TO8A 5JUMA 1EIYB 2OEMA 4USIA 3PV8A 2G4BA 2BJ8A 3B4DA 1NDCA 4KH0B 4EO6A 2DHAA 4I64A 3I31A 3KHHA 1JJCB 2FHOB 2MZJA 4FDFA 1EKSA 4USKA 4FF2A 1PGZA 4C0BA 4E0DA 1R8HA 1T3OA 2YBVA 2LLZA 3BO2A 2B9WA 3ETMA 2HGLA 3OFGA 2G9OA 2K3KA 5J2NA 3OT9A 3O1LA 1JNRB 1VC0A 3M6WA 3OUYA 3BDPA 1XNQF 1CS4B 1FDDA 5DDQC 5HQ8A 1Y5NB 2BR0A 4IQMA 2N4DA 4LF4J 1TKTB 3I87A 3JTOA 1CS4A 1CJTA 3L7PA 4RW7B 3CC2S 2Y1JA 2VJUA 1NKCA 2XY5A 3UCUP 3EGWB 1FXRA 4Y28C 2E5HA 2B51A 2E5LJ 1MLAA 3GTYX 3W5ZA 2W9BB 2POKA 1TV6B 3DRSB 2M52A 1YBUA 2B56A 2BABA 4NEZA 3TJ8A 5J2PB 2EXUA 4DL4A 3V6DA 1TKXB 3IG1A 4DWIA 4GO7X 1NRKA 1KTVA 2XS5A 3UE2A 3VGUA 3M8RA 1M5OC 4NE9C 1TKXA 2HIYA 1FWLA 1F0XA 4DU8A 4HT5A 2BEFA 4ZIWA 1H73A 2FJAB 5EX0A 1WHXA 3HXMA 2CPXA 3HJVA 2L41A 1YJRA 3UI3A 4X84A 1H3DA 1O6XA 2RH3A 4CM0A 3RR8A 2HHXA 3C16A 5DRKA 4OX8A 1NJIT 5JVGQ 4DR3F 4JI0J 1IVZA 1Q79A 3GZ7A 3M05A 4DQPA 2OELA 4K0KF 4CRJA 2W8KA 4K4VA 4USWA 1QY7A 3H5UA 4CLKA 3PZPA 2HZCA 4DS4A 2V6AA 1GXTA 1PO6A 2IRXA 3WZ0A 5C5JA 1YRXA 1LWCA 1D09B 5DQIA 4CLYA 4HHHA 5CA5A 4RNMA 2XO7A 3K7RA 2IVMA 3PEJA 2XMTA 4DG1B 1HNZF 3AHPA 4ILRA 2LEBA 1I1GA 2Q3PA 2KKHA 5HROA 1YJWS 3P49B 1NHKL 4ECRA 1U48A 1UA0A 1AB8A 1RA7A 4KV8A 4PZVA 2AP6A 4NLPA 4DZ6A 1S1UA 4RKUC 1TVRA 1VK3A 4NCBA 3BDEA 2VA2A 1CQNA 1Y7PA 2A0FB 2XYGB 3TX8A 5IC6B 1NK9A 1D1UA 5IT9U 3CCTA 3P3DA 2YTCA 4IFVB 4QYRA 2PEHA 2XMWA 3E8OA 1FDNA 1I3OB 4WIQA 1VS3A 2QC3A 1JX4A 3P8BB 3PHEA 1XR7A 2AJ1A 4YB6A 3GU0A 3NGTA 4L75A 1C0TB 4KHRA 1APSA 2ATCB 3BR9A 2UVVA 4GRSA 4WTOB 3GIMA 2NCKL 5A0YA 4KGMA 2CQBA 4BWMA 3WIUA 1UPPA 1UWBA 2VQFJ 1YRTA 3ONQA 4EBCA 1QVGR 2ZZNA 3JSBA 1WSVA 3MOJB 4URQU 2HVEA 2B5JB 1UWBB 1XK8A 2W25A 3D67A 1D0EA 4W92B 2CQ2A 2K2PA 3MEDA 4NYPA 4N8NA 2CJXB 4KSEB 2EC2A 2KHDA 3OQ2A 2CPFA 4ED8A 1I94F 3LP1A 4P71A 2RMLA 3JQKA 4OJ1A 3O6QA 2NSCA 1S1WA 2AIRB 1ZAWA 2CPZA 1FRIA 3HSJA 4DV0J 3LWMA 2R7VA 1B7FA 5F8LA 2KTQA 4PQAA 1D9DA 3MM5B 3FUYA 2ASDA 2CJQA 3KLIA 1CSJA 4B9LA 4B3OB 2CZ9A 2OMOA 5GAEU 4LT6A 3W9JA 2IBKA 2BW7A 3BBBA 3MM5A 3MCNA 2HFVA 4J9QA 3KHRA 2GMLA 1F6TA 3BH7B 2QL5B 4KKOB 3Q8RB 1N36F 4JI2J 1NPRA 1RABB 1YWXA 2LXFA 2YPYA 5ETQA 4QPXA 1NPPA 3I5BA 4EYIB 3AJ1A 1URNA 3H0PA 3I0SA 3BF4A 3IAM9 2UU9J 4DPTA 4OL8A 2AJ0A 5A76A 3FGVA 1S1XB 3BSAA 5ETVA 1YRUA 2GVZB 4LSLB 4C11A 1XMOF 4X65F 4C8ZA 5EWGA 4WFAQ 1SJFA 2YWFA 2BUNA 2KG0A 4LSLA 3RRKA 1H0HB 4WXOA 4USMA 4X66F 1OYEA 1TZ0A 2FB0A 2P9CA 2V2ZA 1HHSA 1N5YB 3OUYB 4ED2A 5A8WB 3D54A 2PC6A 1IUJA 5HI7A 2AYMA 4RW4A 5C2CA 5K8NA 4ECQA 1BQMB 4KGZB 4M5NA 1TL3A 1JXVA 1M1KT 2DGUA 1C1CB 2C2KB 2HQIA 3VV2B 1DBDA 3BSOA 4DUZF 1SC6A 3NAHA 2GJFA 2I6WA 1XJWB 4A46A 2MPUA 1FRKA 3HLUA 5T7LA 4LF5J 3HCXA 3ZZZA 5F8GA 2A10A 4PKDB 2FGCA 4O3SA 4X64J 4R25A 2C1EB 4DPUA 3H5XA 4LFAJ 2DRAA 3ZFVA 5FLXY 2H51B 3DI6A 4TU7A 3V6HA 3PNIA 1L3VA 1ZH5A 3IBFB 2EFPA 2WONA 4FZVA 5BYSA 4Y2IA 5T41A 1EETB 5D0RA 1ROFA 5DETA 3IR5B 4JV1A 2E5GA 5CYMA 2XSJA 3FBBA 3MMBB 4H4KA 1DRZA 3JSRA 3GWCA 2MKIA 3MMBA 2BRKA 2F40A 2NXNA 3OSPA 5L8RC 1RDRA 4GMKA 1SKRA 1TL7A 2QLBB 1ZM9A 3M2VB 3DLGA 3H7HB 4PUOB 4XTTA 1SH3A 2ZE2B 5HK4A 1GQEA 5F0WA 3T1HF 1XWLA 3WX8A 3D5MA 2G2ZA 4Q0BA 2YWEA 1IJFB 4LREA 2FHJA 3MWBA 2M4MA 3RU0A 1QAXA 4CH7A 1J5EJ 4HTJA 1S0MA 5D0HA 2IRYA 1OSCA 1RBOB 1T9TA 2B7BB 3C15A 5BYRA 3QZ7A 2F4VF 3OLAA 3PYEA 2L08A 3TR5A 1PAUB 4OJHA 2OEKA 1XBWA 2HRTA 4IG3B 3TA1A 5C42A 3ENAA 4ZPAA 4ETZA 1N88A 1NK6A 3ELHA 2XZWA 2ZVIA 3UD5A 2MXYA 2CG4A 3M8YA 3OR1A 1S6QB 3R97A 5IWAF 1VQ8S 3AA9A 2CNKB 2MGZB 1JJ4A 5E0OA 3HKWA 3TJAA 4CT8A 5DG8A 3FSIA 4DLEA 2IM0A 3EDQB 4RPFA 1DQ9A 4TVAB 5GAHI 2E29A 4CI0B 2QA4G 1U1RA 2A3JA 5D8HB 1LXNA 1YJ7A 2XWYA 3B6BA 4FNHA 4I6YA 4OZLA 4CLLA 3MFHA 3OTBA 3TVZA 3J7YI 1FJEB 2QLJB 3SFUA 3QIPA 4CM2A 1KC8T 1Y5LB 4HH1A 5A2QU 1HA1A 1YJUA 2HAFA 3OSNA 4WZMA 4ZVRB 3I32A 2VU5A 2Y0SD 1RHJB 2BE2B 1QUPA 5D15A 2FLNA 2A2DA 2HFUA 4ZPVR 1AA1B 3W65A 3ZO7A 4ENOA 4RZRA 3NNCA 4G3IA 3GG0A 4UF4A 4ZITA 3A8IA 3V81A 2E7VA 3EGZA 5ETOA 4OLPA 4NCAA 1R0BG 1Q5VA 1FE0A 3DLLQ 3NP5A 2V5HG 3PVXA 3PXGa 2L9NA 3L7UA 4NLWA 4ZN3A 1GX6A 1JMTA 4OYOA 3UDCA 3QNWB 5BJRA 4RU2A 2YKNA 1X0PA 1D3WA 2CUYA 4CYUB 4PAAA 1TV6A 2O3DA 1AUSL 3AAWB 5C24A 1AUDA 2MLXA 3ILJA 4F0MA 3RUBL 4O4GA 4F36A 1T03B 2JVOA 3EZ5A 2DRDA 5ADZA 4IG0A 4NZ7A 3R2CJ 2HBRB 4B3RJ 3CDAA 3R3TA 3BO3A 1FVQA 2DXEA 3LOUA 3BYRA 1H2VZ 2F8HA 2IFXA 3W1YC 3DI6B 4GC6A 4LFCJ 3V6KA 3G6XA 3C46A 3SCKE 3GFYA 4IH6A 5K14A 3CJSA 3J80U 2OEJA 3I96A 1NUEA 1U6ZA 1CJKB 3RGIA 1QTMA 3BGOP 4L74A 3BN4A 3FEYB 5J1EB 2IC3B 1BWEA 3N6LA 1Y00A 3OXLA 1V9OA 5A8WA 3PIPQ 2VFTA 1FKAF 2GQQA 1N6QB 2Q6CA 5F8HA 4TN2A 3FEZA 4IO1A 4JI1J 2RQKA 4DCOB 3GG1A 5HJYA 4WKRA 5DGBA 1TL3B 3HSZA 1OMSA 4NA1A 4U8VA 1KHVA 2LQ8A 3IG1B 1O8BA 5RUBA 3KLEB 1U2FA 4MYTA 4E8UA 3FBEA 2EI5A 5KFBA 4XK8C 2YNGA 4LF1A 3IR6B 4AL7A 4EZ6A 3IWNC 3OVSA 2D7SA 3U1MA 4LFBJ 1HQEB 4P73A 1U1PA 2G2YA 3IGVA 4V19X 1F1BB 2VBXA 3PYDA 5L1JA 1RTDA 3KDNA 5J2MA 4LF7J 3GR1A 3MEGA 3AODA 1RT5B 3DOMA 3MD3A 1LV5A 1RLCL 1T02A 2O5DA 2RDIA 3O44A 1HD0A 2IA6A 1SC1B 3CJRA 5LJ3Y 3OR1B 1TAQA 4RUBA 1B64A 1PILA 1C1CA 4I7FB 3GIJA 1SC4B 4YS2A 2M8DB 4O3QA 1YKWA 3GIKA 3CCQS 4I7FA 2C2MB 1O51A 2ROPA 3CO9A 1IQZA 3P4UB 4P6QA 3UNGC 1FK9B 5KFNA 1IBLJ 2B7CB 3DGPB 4OYZA 4WK1A 4P52A 1IJEB 4B08A 2CNLB 1GEHA 2V8VA 3MI7X 4P2SA 5CZXA 1FCAA 4OHWA 1CJVB 2GJ2A 4TXSA 4YR0A 2VFRA 4J91A 1AZSB 1RTJA 1Z2LA 3QRRA 1LW0A 2WSCC 3NOCA 3HD1A 4TLQA 1WELA 1U7LA 2DNNA 2NSBA 2ZEJA 3BR8A 3VF0B 2QEXS 4M94A 2XS2A 3MM8A 2D3O1 7FDRA 3ENQA 3ITHA 1HFEL 1RTZA 4Q8EA 2XSJB 3CDBA 3DMJA 2R8HA 1ZZFA 2N3OA 3BKFA 1Q8BA 2BBEA 5T14A 1VMBA 2RUGA 2RUSA 3QGPA 3TEHB 1FWPA 1C4AA 2AT1B 1F3VA 2OJ3A 3SQGB 3T3FA 2CPHA 1KQFB 2MGZA 3K5NA 1TL5A 2J0WA 3D66A 2F9DA 2R8JA 2DXFA 2I1RA 3OR2B 2W9CB 2EG1A 1Q95G 1WSRA 1EB0A 2HQFA 2MSTA 5HQMA 2PI4A 3ISZA 4ICLB 5HLFB 3M8WA 2YWWA 3ETOA 2NPIA 2OTLS 5HLFA 4G1QB 4LMZA 3CCVS 2ZM6J 4DV0F 4YOEA 4Y00A 1RAJA 1WC4A 3VQSA 1K47A 1T9UA 3ADAC 4DPXA 1HIYA 3T19A 4ZHRA 4C97A 1KVIA 2LEPA 3CJ3A 2V8PA 4ED1A 1WF2A 1OY8A 2YH0A 1DAXA 4DL6A 4UY85 3KK3B 2MDAA 4EI2A 3PIOQ 3I0RB 3QAUA 4EGLA 2ZJPQ 1EQ0A 5DZ7A 2Z4PA 5GAGI 2MKHA 2GNKA 1FHTA 3UDLA 2YKMB 2JEFA 5B09A 1DHMA 2GAHC 2GHPA 1LWFB 4HKQA 1FJGF 4O23A 4NASA 1U0SA 1U1OA 2KFYA 3NMRA 1QAYA 1N8RT 3G71S 2V63A 3H2VE 4TLRA 4I2QA 3W2WB 4O3PA 1Y4ZB 3T5LA 1RT3A 4Y2KA 1EKRA 1GAOA 3V81B 1VQYA 1NJWA 5IT9Y 9RUBA 2R9LA 1GXUA 2KT5A 4AXJA 2Z2ZA 1GFWB 1RHQB 3NXZA 3CULA 1OS5A 4ECVA 1HQ2A 1RT7A 2HG4A 2O67A 3MMCB 4MIBA 4QYZJ 1CJTB 3ISND 1TL1B 4DL2A 2WB1D 1WTBA 1WHWA 3TWZA 2D9PA 1SJ3P 1S9EA 2VUGA 5KG5A 4M95A 2KB2A 4ELVA 3SCJE 5MLCV 1S9EB 3QGGA 4RW8B 2HEKA 2NZCA 1FXDA 2BV3A 2HRUA 3OBIA 3RBZA 1X4DA 4DX5A 1EJ7L 1Q8LA 4LFCF 1FT8A 4KHMA 1JLCA 1KP6A 3OTEA 3KLFA 2J6SA 1FEEA 2DKOB 2VKRA 1RAOA 2OPRB 1UL3A 3CD7A 1LK5A 3PJ9A 1OPIA 4Y2AA 5JMNA 3DLHA 2W2QP 5F0UA 4YMEA 3QZ8A 2PMHA 3HZEA 2GAGC 5I3UB 2E7XA 2MMYA 2CKWA 3TARA 3RAQA 2CQ4A 2GVDB 2L3MA 4C9DA 1S6OA 3MR7A 1KD1T 3L95X 1KTQA 4A48A 2R7SA 2Q43A 5KG2A 1N36J 3MM6A 1WORA 1LWCB 1G4CA 3DRRA 2VONA 2ZOFA 3GR0A 4J9PA 1FTRA 5LT5A 3RB0A 4OYXA 4ED7A 1RTDB 4NRTA 1ZAVA 5E3PA 3T1AA 2J0QD 2E1AA 2KL8A 3Q8YA 3Q23A 2B9YA 2F8EX 4LJMA 3UCZP 2XMVA 2LA4A 3EZOA 6FDRA 3TX0A 3D6FB 3IA0A 3LA0A 3AY0A 1LXJA 2JH3A 3P5BP 3KK1A 1SH2A 1S79A 3BM7A 3SSSA 4I4BA 4PG6A 2MJNA 4CO0A 3THPA 1IBCB 1RAFB 1N5QA 2RE1A 1R8PA 2GMJA 3DFEA 2ZH1A 4LRAA 1SC3B 4PABA 5DDOC 4K4UA 5KG1A 3MECB 1O0PA 2U2FA 3HHKA 5D78A 4U67Q 4L72B 3KLHA 1RK8A 2HGNA 4IKAA 2NYHA 2W9CA 4NL5A 1C1BA 5CZVA 2MQNA 3G2XA 1K44A 2OPSB 4F2RA 5C24B 1JKHB 3R5JB 1KKHA 1Q16B 3A3PB 3KJFB 4DEZA 4X65J 1RT1B 2DNRA 1HI0P 3DMJB 5K5MA 2DITA 4ATNA 2IA0A 2V34A 2VG7A 3KKFA 2N7YA 2N82B 2FUG9 4RNNA 1JLAA 1RISA 4I6AA 3LAKA 2IM3A 1UEVA 1SI9A 1UJ4A 2QSWA 3FMWA 2P8IA 3QPIA 4G1PA 2Q6BA 4LQ9A 4WJBA 3UR3C 1XMQJ 4OIXA 5HMWA 5BR8F 1VBXA 5KG4A 2EC0A 2N7CA 1FE4A 1Z4UA 2LP4A 3I5AA 2MYFA 2VD3A 3AD8C 3FRZA 3JQJA 4NCGA 5D4OA 3TUJC 2IC3A 4DSFA 4U7CA 4ES1A 5E3AA 3ILLA 3W60A 2D69A 4ZLJA 5KT5A 4R8UA 3DYAA 2VKZG 1AT1B 1VRQC 2B9EA 3BB5A 3BPDA 4PWUA 2LECA 4F8RA 5HVFA 3TP2A 1AYEA 1YBAA 1RAIB 2F5GA 3JSMB 3OW2R 2ZH8A 4ED5A 2XWXA 2BOAA 1YJVA 1SKUB 3BGRA 3CGIA 4D3HA 4USHA 5CYJA 5DLGA 4DLGA 4W90B 1FFGB 3NNHA 3NKYA 5KTQA 2RKIB 4DV2J 4BWJA 4ZVQB 4IRKA 2ZWPA 2HNYA 4MJKA 1R43A 2C3YA 1NCLA 5AJ3J 2XC9A 1NK5A 3W9HA 1TU0B 2MKJA 4RBTA 1K73T 1SJQA 4OZ5A 1FNMA 3LGMA 4RR5A 1REGX 1UWAA 3SDEB 3C6UA 1NHVA 1HNZJ 4X4VA 4MTPA 4RUHA 2R2SA 2QGFB 2HKEA 3CO0P 4C0OC 2ZH7A 1RUSA 4RNOA 1YJ9S 3DRPB 2CPEA 4ZPCA 2E5LF 3RBXA 3FDSA 2Z30B 3FCVA 2BOPA 3IN5A 1P1LA 1WG4A 2FLLA 2IMWP 2UUCJ 8AT1B 2BE9B 4DQRA 1AW0A 1N32J 1Q5YA 1ZBTA 1KOHA 2WTFA 3PO5A 3UD3P 2CVIA 4OI3A 4DUTA 2B0GA 4LBPA 2XG8A 2XHCA 3UFCX 2FIUA 3CJ4A 3HT0A 2DCUB 4GVBA 2RQ4A 4NXNF 2O1PA 1VQNS 1IN0A 1CULA 4DPOA 2ZH4A 4UOHA 4B9TA 3HHNB 4U7UD 1WEXA 3JQMA 4YY3J 2PD1A 5DDPC 2V4RA 3G96A 1N33F 2P9GA 1SCJB 3TJ9A 4DR3J 5HP1B 3NY0A 3OTOJ 4IUFA 2HS0A 2FJXA 2WVFA 3JYTB 4C4WA 2V4QA 1JLGB 1B4SA 2PMWA 5B7WA 4H54A 3KMSA 2J6TA 2LYVA 3CCZA 1MU2B 4RBUA 3EGVA 4K2JA 5G0RA 2KXHA 1JLGA 5GAGU 4Y2CA 3KG0A 4ZVOB 2R8IA 4J9KA 3RJMB 4WP3A 1MN9A 2GGPB 2HQGA 1R6VA 3FQLA 3MDFA 1AXQA 2E5IA 2OPPA 2RT3A 4J9UE 4L6V3 5A0YB 3S8SA 3RTVA 2MLZA 3KNGA 1K0TA 3Q8UA 5AT1B 2Y0BB 4YR2A 2W4PA 3NG8A 3CDUA 4WE1A 3PRDA 4FVCA 1NH8A 2QA2A 4NLXA 2YKQA 4JUZA 4J9SA 4DL7A 3UDVA 2AJ2A 3NOGA 4F4KA 4CLZA 2UZAA 4P75A 3NNAA 5CD4A 1RWNB 1QAIA 1HMVA 4NLRA 4M5DA 5KT7A 1F5AA 1S1WB 4U7UK 5KFCA 3Q8SB 1RYRA 1PCAA 3BH6B 2BZ2A 4EYHB 3LPEA 1U8SA 4H4OA 1YK9A 4DQIA 4ZVGA 1TTHB 1VRUB 2BJ1A 2BXJA 2CWXA 2NXJA 2QIFA 3MEEB 3MPYA 4HR2A 2H4WB 5KFGA 1WHYA 3PW0A 1SJ4P 1P9QC 4DV5F 1T0TV 2MQQA 5KFAA 1C0UB 3MEEA 2E7WA 2AGOA 1WI6A 2DXDA 3GP9A 2JHEA 4P7VA 1T3NA 2UUCF 1KVKA 2ILYA 1XMBA 2IDLA 5A8RA 3X3UA 2HFZA 3G87A 4NLOA 1VC6A 1IXKA 3QAEA 5KFVA 1JKHA 1K0VA 2AYEA 3OXFA 3V5RA 4CNZA 3PRVA 2F65A 3Q2SC 1BE4A 3VZIA 3R5DA 1KR4A 2MKYA 3Q83A 1RSCA 1WOOA 4RX6A 3OL6A 5J2QA 2HNDB 3O8WA 2FVPA 2HS3A 3LP0A 4CO5A 3K58A 1S59A 3MR6A 4OHYA 2UUAF 1M5KC 1D9FA 3P45B 3C6TA 3LP0B 1BQNA 2IM2A 3D6MB 3R9LA 4MFBB 3DXBA 4FNIA 1S10A 4QU6A 2BVZA 5AE1A 4NOHA 1VRTA 5L1LA 2XQCA 2ZBIA 2YKMA 5BR8J 5ETPA 7AT1B 4QW9A 4TNOA 4ZIVA 1ZZNA 1YZ6A 2KVQE 3EUNA 3NBPA 2RJZA 3NS5A 3UN3A 1S0NA 4FPRA 4RW6A 4ZJLA 1VQOS 3N28A 1IKXA 2KM8B 1X4GA 3IMQJ 3MEDB 1KN6A 2KJWA 5B0CA 1HR0J 4OYIA 4P2FA 4DJBA 1WWHA 1JLEA 2DH7A 1D8ZA 3CEDA 2A6OA 4DR4F 1MWQA 4IFYB 4Q5VA 2W1BA 4JI4J 4X4QA 2JFDA 3HVTB 4PEOA 1RWWB 1A0OB 2KYZA 2W4CA 1N5TA 4IG0B 4RUAA 4DR2J 2ADCA 1VBYA 1FD8A 2L48A 5LSOA 2DGQA 2BKPA 2OFGX 2XULA 2VFUA 3C14A 4RW7A 2UV8G 4DCPB 5E3CA 3GQCA 3VALA 2FHKA 4ZVEA 2CQ1A 3ILIA 1SKWA 4DSKA 5C25A 4F50A 4OI2A 2OUGA 1YX2A 3GJTB 5LM7E 1N52B 3GIIA 4AXIA 4PG4A 3TA0A 1RACB 1EP4A 3TUIC 2CPJA 2OHDA 2GO8A 3DDIA 3DOLA 4I69A 3T9ZA 5KFZA 2Z0GA 3EMTA 4UZCA 3NS6A 3KJVA 3QFHA 4IOBA 4EBDA 2EKNA 1B0PA 2ZWOA 2GA7A 3AOCA 3D4JA 1NAQA 2AJFE 5I3QA 2ZFHA 5IQQA 2KT3A 1XNQJ 4N8OA 5KFLA 2VPWB 6FD1A 1REVA 4QIEA 2B4UA 4DV2F 1GXLA 2HVZA 4K0KJ 4CTAA 4B3SF 4LSZB 4RWXA 2KH9A 4LRFA 2FLPA 1EX8A 4WK3A 3EICA 2M5YA 2YX1A 1KQSR 3RRGA 2JVRA 4F3MA 4KHPJ 2Y1IA 2ZJQQ 3LGNA 3HFVA 4H4MA 5B0DA 2VIHA 3OVBA 1S6QA 3EWGA 2V2KA 1JLQB 3CCES 2VPYB 2EBEA 1NSQA 4DBQA 1YJNS 2QMWA 5LSLA 4F4YA 2WVDA 1S9FA 2GO9A 1JLFA 2GQCA 2V68A 3LALA 3M1VA 4M5LA 2VG5A 1MMLA 2NXCA 4PXDA 1KFSA 2JDJA 4UOFA 3PR5B 3BV8A 1ZM3A 2ZC4A 3PW4A 1MROB 2XMKA 1UFLA 2YX4A 5F8MA 3TAMA 4F26A 1C1BB 3FBFA 5E3QA 2QTWA 4HI2A 2CQCA 1TVRB 2CQIA 2CG8A 3T6JA 4NPOA 1ICEB 4TU8A 2XY6A 2XLKA 2YQ1A 4FXDA 3ZZTA 2XEXA 1LNQA 1KQGB 4G1IA 5ITHA 3M8QA 2W2NP 4LUBA 2XBPA 5J2QB 1NMEB 3OL8A 3NWRA 4KH1B 5FDLA 2V67A 3AB4B 3G9CA 1DZ5A 3JYTA 1ZA2B 3CC4S 5J1NA 5K8MA 1HW9A 4AQYF 1XR6A 2FD2A 2MZSA 2ZD1B 4ECTA 5F3TA 1V3RA 2H5EA 5BXIA 2LCWA 2ZH3A 1ZTWA 4KE5A 3D68A 1YITS 1MSWD 1DFDA 2R8GA 2CZVC 4CH0S 1SQGA 1Q82T 2ALZA 5ETTA 3NBPB 4LBIA 1DURA 4ZJOA 4CLUA 3R1HA 1S0OA 5B0FA 1DLOB 4ZCMA 4UY8T 2KHCA 5DGAA 5AXMA 3VAGA 2NREA 5EN1A 3LGHA 3MM7A 3D0IE 4ECZA 1FFWB 1R8CA 3CDWA 3NLCA 4ZPDA 2KXNB 1S77D 1T05A 2DPIA 1ZTTA 3UVJB 2FGOA 2YNIB 4M63A 2MJUA 4JI6J 5IWAJ 3KLIB 4X2BA 4KBIA 1HWKA 5HN0A 3KJVB 1SL2A 2XHWA 3K5OA 5E3RA 3R7NB 4A47A 2MQOA 3A13A 3H42A 1N4LA 4EMDA 3SDEA 3VTIA 2WBRA 5KFJA 1DQAA 2RRNA 4FF1A 5THWA 1RWVB 3FVYA 1Q8KA 3A8EA 2FC9A 3KJNB 4WFXA 1G1XA 2YKAA 3GIRA 4X4PA 4DFPA 2UUBF 4QWCA 1T9YA 2LQJA 2ZZTA 2LVWA 1KHWA 4D3GA 1HYSB 2HGMA 5KFYA 4E2FB 1P9YA 2H4YB 1IR2A 4B9MA 2DY1A 3W3SA 3DRXA 3HSDA 3CIZA 4DR4J 4DL0C 1HW8A 1UVIA 2QZ8A 2ADBA 1V3ZA 5JJBA 2AQ4A 4GVBB 4MFBA 4NMXA 3BREA 1JQGA 1GK8A 1VRTB 1RHKB 2ZBQA 1LFWA 3MAAB 3FSXA 1XIQA 1HWJA 2Y1LB 1QUVA 3OTDA 4Y2MA 4WKYA 5HVHA 1L3SA 3CMQA 1PSDA 1KLMB 3TNVA 4IH5A 3WBZA 3MUTP 3ISNC 4M1KA 4DZDA 3NMAA 3FBCA 2RF2A 1MN7A 5GMDA 5KFIA 2W9BA 1RI7A 4HHUA 1TMJA 4WU3A 3CD6S 4PG7A 4UW2A 3PM9A 2LKZA 1M5VC 4CO3A 3LH2S 2B6AB 2GZOA 1IBKF 3W5XA 4JBCA 1IBMJ 1LWEB 2GGPA 2RRBA 2YKOA 1OO0B 2QLFB 3KG4A 4O0NA 4PWWA 4FYVB 4F7VA 5B0BA 1XR5A 1R0AB 5KT4A 4DV3F 3DOKA 2DO0A 3RB6A 3ZTOA 1T9WA 4I6WA 3CE8A 1FI4A 5CQGA 3OV7A 3DLBA 1RHRB 2GX8A 2OAUA 4OJGA 1FVSA 3I9ZA 3S6EA 5M2UA 3ITHB 4JV5J 4OYAA 2XTJP 4DCJB 1NB7A 1GH8A 3SEOA 2NLWA 1N6QA 4XPCA 1HMVB 2CQGA 5EWFA 4QR1A 1FESA 2ATLA 1WC0A 3MCSA 3R5BA 4MKYA 5IM0A 3J7AN 4OX7A 4Q0BB 5IT0A 2H48B 2VODA 3LUYA 2MZTA 1SBRA 1N34J 2ZOMA 4LF8J 4DG1A 2FJDB 2HPUA 4ZP6A 2DISA 3HFZB 4XIUA 1RAGB 4RO0A 2RU3A 4FP9A 1HARA 4QOTA 2WVCA 2GHWA 2X51A 3IXQA 3K57A 1NXIA 3BS9A 4HTIA 5HVGA 3FK4A 2KG1A 1QDUB 2AEFA 1U25A 3M8QB 3EPGA 2HHWA 1IQTA 1WDDA 2HLUA 3SV3A 3ZZOA 1JLBA 4CO2A 4DUYJ 2C3UA 3T9NA 2K06A 1YDLA 3DLJA 2HWTA 2HHPA 2IDEA 4KY3A 4OZ1A 1S7IA 3R27A 5AXKA 4P10A 3TA2A 1IBLF 4WP8A 2AYGA 3D2WA 2BA9A 2EFNA 2JNJA 1Y3KA 4F67A 2FVRA 2DNGA 3D6HB 1VHIA 3AB2B 3CCRS 1UFWA 5A8KA 2YNHB 3MAHA 1UETA 3SFGA 5EGYA 1N48A 2CQDA 1S9GA 1LEOA 1WG1A 1CC8A 1OPZA 2BE2A 3JTNA 3DC2A 5H9FJ 4DN0A 2XMAA 4DV1J 4ZLNA 2CIMA 3DKDA 3GPAA 1S9GB 3DHWC 3MF5A 3NGRA 2AMCB 4LIRA 3U27A 2ZH9A 3NCRA 4B3MF 2APOA 1BXNA 2AJQA 3EVWA 3MR5A 1WACA 2MY8A 2AGQA 3M9MB 2CWKA 1PYOB 3CCUS 2JRSA 1SB6A 1RT6B 2ZC3A 4XDDA 4ZCLA 3KXDA 4UUWA 3T1YJ 4YN3B 1VQMS 1BMQB 4ZPBA 2KFZA 2ZD1A 2MHNA 4TQRA 5DZ6A 5DM7Q 2FJVA 2IYGA 1RT7B 1VCTA 2FC8A 3MMCA 5ETLA 3W66A 3ZXWA 5KFMA 1L3TA 1WC6A 3N6NA 3PEHA 1CQMA 2FY8A 2J9EA 1Y10A 1RLDA 4EFAC 2LDIA 3M2RA 3OD2A 1X9SA 3SCLE 1WKKA 1X9WA 4LF5F 5GMEA 4CLPA 3OHBA 4KPYA 2VPXB 4HVZA 1VIXA 4ZHRB 4QJVA 3JSMA 1ZPWX 3ET6A 3M4XA 4XAKA 4FS1A 2GIFA 3CUNA 4HH0A 5HANA 4DOZA 3PDNA 1D9AA 2ALYB 4H4KC 2KT2A 2RHQB 3GILA 3SV4A 4N56A 5K8OA 2OD6A 1RADB 3GV7B 2QLWA 3HI9A 4ZP8A 4MKVA 3Q0AA 5H9EK 1H6KX 2B9XA 4WPAA 3KLVA 4QPTA 1CEZA 2OP5A 2C2ZB 4DQSA 3R5GA 4F02A 4O44A 5H1SV 2CA9A 4AD6A 1Y11A 1VOMA 3W64A 4RWWA 1VBZA 1N0UA 1XMQF 3VGVA 2BM1A 3BO4A 4K4ZA 2NS1B 3TAQA 5B0AA 4RNFA 3I0SB 4NI2A 4OI6A 2WB4A 1NDKA 3DNCA 2VICA 4B3TF 2W2OP 1LW2A 3DRRB 5HJXA 2IVFB 1TKZA 2XY7A 4A8WA 4PWDA 4P72A 4TU9A 2F4VJ 4B3SJ 4DX6A 3TOQA 3O5TB 2VDIA 3NEKA 5H9EJ 4KFBB 2F4FA 3GJRB 4UOGA 1U1QA 3D3BJ 1QD1A 1JWWA 2CDRB 3OTCA 2HURA 3DHXA 5DO2A 2ACMA 4I2PB 3MUMP 3CCMS 1TUGB 3H20A 2BRLA 4YB5A 4ILLA 1U6FA 1VYAA 5HL7Q 1JLFB 2J8AA 4OZ3A 5J2PA 2LXIA 4DV4J 4JV2A 2VG5B 1GTHA 3DRYA 4PXCA 3A8JA 3SYZA 2YWGA 3EXYA 4YHHJ 1U26A 1HQUB 2Z57B 3EM1A 3M2VA 1SQFA 4DL5A 1XEZA 2BQUA 2VOOA 4JI2F 4CT9A 1IBKJ 1WTFA 1FNOA 1UTAA 4X4SA 3CJKA 3L7OA 1RT4A 4MK7A 5GAHU 1VJWA 5F9NA 4ZVFA 3HFKA 1VQKS 2L9DA 4PXEA 4ZVUB 2XSFA 3BBCA 1X0FA 2XM3A 4FYDA 2R2RA 3QYYA 5E5NA 2CAJA 4PG8A 4X64F 1Z1ZA 4RW9A 5D4PA 3U1NA 3J80Y 2LQ5A 4HEA9 1WF0A 2MKSA 1IR0A 4CZCA 4RU9A 5LL6d 3NGUA 4JP8A 1OY6A 5IV4A 3MPUB 4O3RA 2HRYA 2R42A 4MK9A 4WFZA 3D9BA 4QWDA 3G8TA 1HBMA 3CW2C 1ZM2A 3QSIA 1VIOA 3JS9A 4B3OA 1U2CA 2E1MC 3KG1A 2GCFA 3GE9A 4ICLA 3DXSX 5DG7A 1U4BA 1HR0F 4K7QA 3TAPA 1FJ7A 4ZP7A 3NGKA 1XN9A 2DR8A 5IOLA 4M5IA 1RT2A 4X4OA 1EAYC 1EZZB 2WZ1A 2YVSA 3LANA 3GFHA 4FPIA 2LFVA 4LR9A 5HAOA 1H2TZ 1UVKA 3W62A 2C3MA 3I0RA 2EBGA 1V5VA 2VC1A 2RAQA 4DPWA 2WBMA 1RKIA 2R4FA 5CYQA 5E33A 3ZZ0A 3PFOA 3MMJA 2G0IA 1V6HA 3N5FA 5LMNJ 3QT8A 2F1FA 2QA4S 2BE7D 2KDOA 4R0JA 3VQTA 1JXEA 4ZDNA 1W2BR 1TR0A 1HNVA 1NNDA 1R8AA 3B82A 3FNNA 4AFFA 4RLEA 4ED0A 2DHXA 2Y8YA 2XCPA 3H4DA 3QJPA 1HI1A 1CC7A 1U24A 1UA1A 1FA0A 4C8OA 5HMXA 1X4EA 2CQHA 1TUWA 2OFHX 2WW4A 2C2RA 5F3ZA 3ZTRA 2EW9A 4KAIA 2MZ1A 3PKYA 1SXLA 3LP1B 4NXMF 4NRUA 1NJYA 1R8BA 2B4PA 3G8QA 1YQHA 2WVBA 3KOAA 2K7JA 3DOKB 2H3EB 2HHTA 1YIJS 3PG9A 3VWSA 3HVAA 2WSEC 2QV6A 3MPDA 1RWPB 1FKOB 3FC9A 4DX8H 4DF8A 1WKJA 3L09A 4IYQA 1MMNA 2J7WA 2I9SA 4Q7AA 1E6VA 1L3UA 5F8NA 4FBTA 3V6JA 1QE1B 2ZBPA 1UPMB 1NJZA 4O44B 4C3MA 3GMGA 8RUCA 4TYBA 1JXLA 3AQPA 2WRMA 1UAWA 1X9MA 3EDRB 3MCMA 2JL9A 2OLWA 2HS4A 2FLOA 2IMOA 3SSRA 1NK8A 2BQRA 4EBEA 1NKBA 1SJRA 4IH7A 4RNHA 4J9VA 3G4SS 2AF6A 2X3GA 3VAFA 2DIVA 1H38A 3BGLA 1RZMA 2ZM6F 1S97A 1A6LA 5KG3A 2HQ3A 4WE1B 2HMIB 1X5TA 2FDNA 4HYKA 3QO9B 3M8PA 3QBCA 5K20B 1VQ5S 5IC4B 3QMQA 3J7A1 3N6MA 2YWHA 3L3CA 5FJ4A 3PRBA 2I38A 2D1CA 3A3OB 3M32B 4QZVB 4DSJA 2WSFC 1IKYA 4PUOA 1QLNA 1S76D 2QJ3A 2IVYA 3KNAA 3FMBA 1VQSA 3GCWP 4Y34A 2CPYA 4TY8A 3A4TA 4MKAA 3I4HX 1NH7A 4ZJQA 3MR3A 1TFYA 1WC5A 2K7KA 1HWIA 3QGIA 3E3XA 3FKBA 1U0HA 1Q4RA 3CJTA 1FDAA 4C8YA 4ZVTB 3S7RA 4K5SA 2YKPA 2Q1LA 1SH0A 2Z2LA 4FN5A 4QBUA 2XS7A 1BUXA 1RTJB 5B0EA 3LPYA 3R5AA 2KRRA 4OLOA 3HHLA 2DIUA 1UZDA 4DR1J 2HQDA 3BEGB 1UP1A 2DGTA 3IBWA 2BJ3A 1Q78A 3OFEA 2HNDA 5I3PA 3CF5Q 5U47A 1OSDA 4QWAA 5D6GA 4U9RA 1XNRF 1MWZA 4IR9A 2ZE2A 3C6TB 2QN6B 4QW8A 4JI3J 4I68A 3OL9A 3QT6A 2DYAA 2RIJA 1H72C 1X4CA 3CVKA 1Z2ZA 2I8EA 4OI1A 3ZNJ1 1ZAXA 3HD2A 2GIQA 2R7QA 5KOWA 3J7Z5 5JVHQ 1NSKL 2OIHA 5G4DA 1QJHA 3TRGA 1FF2A 5KFQA 5LMUJ 2V50A 1W26A 3AOBA 3JXOA 2XMUA 1G7CB 2QL9B 4NWBA 5ETSA 3BZQA 4U6PA 1IWAA 2AZ3A 5KFSA 4Z37A 5GVQA 5C42B 5DS7A 3DLKB 3WC0A 2X1AA 3D1OA 4DV3J 5A6WA 4ECUA 4PQUB 3QATA 1XTZA 2VH7A 1B0VA 1IKWB 1TKDA 4GKKJ 3GJSB 1FD2A 2D9OA 3PFEA 4HLBA 4JOUA 1EHWA 4F4AA 3CJ2A 5LJ5Y 4LF9F 4OFZA 2V9WA 2RU9A 2YNIA 3ENWA 3K8WA 4DSLA 4DR6J 2V4JA 2WVEA 4B9SA 2SXLA 2V8HA 4IR1A 5L1IA 3OR2A 2UP1A 1FRHA 1UCNA 2V4JB 4WWSA 4J9RA 3P5TL 3C2PA 2HFSA 4J90A 5KFUA 4K59A 1E6VB 1S6UA 1LQ9A 3A3NB 4Q2MA 5AXLA 1EP4B 2ASYA 2GJIA 2HBQB 2ZBCA 5KFRA 2MY7A 3C19A 2W9AA 2HFOA 4KPCA 2HQCA 3X1LB 4UZBA 3M8ZA 3UNYA 2NR0A 3V6DB 1TK8A 1VLYA 2B4OA 1NSAA 2J9CA 1MNEA 2XYPB 3QWPA 2HHQA 2PN6A 2N3LA 3W9IA 1LW2B 3LWLA 1S7HA 3THTA 2DO4A 3BYPA 4NXMJ 2QE5A 5A6PA 2B43A 3I56S 2G13A 1N32F 4IQXA 2Z56B 4OYMA 5KFWA 1FERA 4K4TA 1HHTP 3RAMA 4TYAA 4DV7J 2UVWA 2LQ9A 2FTRA 2ILZA 5D3GB 2AYBA 1UW9A 5IS2A 2CJAA 4DQQA 3CWJA 2QYCA 1IWGA 3RBDA 4X62J 4BBYA 3HVRA 3S01A 2NUHA 1HBUA 2E44A 2F3JA 4FS2A 3HVWA 2PIIA 3NCPA 1R31A 4C3KA 4A4JA 4Z7CA 2ZHOA 3GV5B 4WCEQ 3IR7B 1A7GE 1NHUA 5L9NA 3CMAS 1UMJA 5CHCB 4ERDA 2EK6A 3KK2A 1HBOA 2K1RB 1BHNA 5ETMA 1FNXH 4KFBA 4P9SA 2D41A 4QIGA 1U0HB 3DU6A 2X1GA 3OJSA 1PYTA 4ETXA 2R2TA 2HHHF 3G86A 3PJWA 2COLA 5KFXA 4TKTA 4YB1P 1FKOA 1SIZA 2DTJA 3CIMA 2OSQA 5EX3A 4YY3F 7FD1A 4CIOA 1JNZB 2JLFA 2M3DA 4UUXA 2J9DA 3U7JA 1TL1A 4DSIA 5CYMB 1S4FA 4K4YA 3PACA 1KS2A 2ZZMA 4DV4F 2RRAA 5G0RB 2ACYA 1GMWA 1HQUA 2H5JB 3D6TB 3TUZC 5I3UA 1WDTA 5ETKA 1HBMB 3VAHA 2GVDA 5L46A 2YY3A 1MG7A 2CZ4A 5AE3A 2NQPA 1WF1A 1OWXA 3WX4A 5C2GA 3AXMA 5FIIA 1BLUA 4F2SA 1VK8A 4RW9B 2IM1A 3C15B 2NUUG 6AT1B 4X4TA 2R7TA 3I6PA 2DGWA 2C22A 4H4MB 2DEJA 4LF6F 1HNWJ 2FJEB 4LRBA 4YP3A 3K89A 2CVEA 3Q22A 1J5OA 4LF4F 4DV6F 1NLKL 3MPWA 1TAUA 5AJ3F 2MLYA 4BS2A 5HO4A 4NX9A 1VR6A 3VAJA 3ZTQA 1BGXT 1RWKB 1LWXA 3BBFA 5LXYA 1XC9A 3D28A 1N5SA 1FKPB 1Y9OA 2K8GA 2ZKUA 3IWLA 4LBHA 4LSNA 2BX6A 5L9XA 3FZ2A 1VQPS 2CQ0A 4LVOP 1T7PA 2O66A 3IRXA 3KFWX 2W7AA 5ETRA 4B9UA 2XB2D 1I51B 2RB7A 4KKOA 2JLEA 2C28A 2MKKA 2V9KA 3HHDA 4AE5A 3AJDA 2VBZA 3MXHP 1ZM4A 3KLGA 4DFKA 3V4MA 1KONA 5DM6Q 2DPJA 4PR6A 1RBLA 1Y3JA 3OVAA 3HO1A 1X31C 1R0CB 3POTA 5KT6A 3BKTA 4USJC 4J9OA 2VF3A 1QVFR 4TQSA 4NLGA 5IZHA 3SQGA 2DHGA 4BCAA 1JK9B 3K59A 3QSYB 4AYBD 3EJMA 2R7UA 1FRLA 3JTPA 2BANB 5HQLA 1N5YA 2CJ9A 2FY1A 1NK0A 3DU5A 2XGQA 2D74B 3JAMU 4CYUA 1G6BA 1U2RA 3RB3A 5CABA 2Y8WA 1Q7LB 2Y3YA 3B78A 5KFPA 2UV8A 1N34F 2JEIA 2XNQA 3H5YA 4DUYF 1FRXA 1QE1A 3GFXA 1RHUB 4MK8A 5C7PA 1CJUB 2W7PA 2DEIA 4IO9Q 4UOCA 4AL6A 3HJFA 3QWUA 1K1QA 4IFYA 3DM2A 5KOXA 1NJXA 4KJIA 1UJ5A 5BYQA 4WP9A 2CNOB 2QYGA 3KUEA 2J0SD 1JJ2R 1SL1A 2VPZB 4JYAF 3QQCD 1CJKA 2RKIA 3LP2A 1PYSB 2P2CB 1R6YA 4L3NA 3ZZRA 2EWHA 4WFBQ 3CMES 2HMIA 1CVJA 2DNMA 4DR7J 4DHVA 2YNFA 2DHHA 4ID8A 4ZS6A 5KG0A 4O0IA 1NB2A 2MQLA 2G1HA 2OPRA 3CJQA 4C7QA 5IFMA 1RWUA 3W8GA 2R7WA 4QU7A 4ID5A 2A1BA 4F04B 2HVIA 1BQMA 1HPZB 3IO1A 1DJ0A 1CLFA 2BJEA 1BQXA 2M70A 4KIAA 4DV1F 2V0NA 3DLEA 1ZYQA 2I5JB 2CDQA 3AOAA 3HT3A 1H7XA 3NS7B 2VG6A 2M88A 1OQ3A 4NI2B 5HROB 2J5AA 2E9RX 3KHGA 1FX4A 2UXCF 1RTIB 5KFTA 1HQEA 2CPIA 3ZTSA 3FSYA 1K8AT 2C3PA 3UR0A 3QO9A 1YGYA 4DFJA 2E1PA 4IG3A 3OFHA 4KHPF 2GMHA 4Y0FA 1KOOA 3C3LA 3K5LA 3WHIA 1IKYB 3F41A 2MQ8A 2M2BA 2UUTA 3FCWA 3HHLB 4OX9F 3K2YA 3BJYA 1WOSA 3P6YC 3UPFA 2XGPA 2OMLA 4NEYA 1VQLS 4KGKA 2VDHA 1B7YB 3DGPA 4ZVPB 3E01A 1WJ9A 4CLWA 3ULHA 4CQ1A 3VZHA 1HI8A 2ZITA 3GSDA 3RAXA 1U1NA 4OV1A 3G82B 1VDHA 1MROA 1S48A 2A6MA 3A1YG 3DLGB 1E6YB 4CO4A 2ZVSA 3M6XA 4DI6A 3HF5A 3B8HA 1LOUA 4Q45A 1IBMF 4KYZA 4KV8B 4LF7F 1MW7A 3Q8VA 2AX1A 2QMXA 4Q43A 1S1UB 5D0EA 4DSEA 5E7OB 2WOMA 4ZKAA 1UW4A 3ZC4A 2M7SA 5JXSA 3DLKA 2JLGA 2R8KA 4Z2XA 4QWEA 2KN4A 1WI8A 3DDNA 1RA6A 3MM8B 4RJVA 3OPKA 1P8GA 4KB7A 3WQPA 4X66J 5HP1A 1JLAB 4EZ9A 1KVJA 4ED4A 4DV7F 1S57A 4JV5F 3IM9A 2W7OA 3PY8A 1DARA 1S1TB 3G8SA 3J81Y 3FQKA 1DY3A 3RZAA 2JJ4D 1RE1B 1TUVA 2HK2A 4NYOA 5IM0B 3KLHB 5D0GA 1C2PA 2UU9F 4HACB 4IDKB 4M5GA 4WYWA 1SUQB 1S4EA 5I4MA 1IKVB 3Q89A 3U02A 4OZNA 3QRPA 4HI1A 1ZA1B 3B4MA 4G1QA 1W25A 1M0SA 1M1HA 1WD6A 4WYLA 4A8XA 1C4CA 4PCQA 2DGXA 3ENVA 4CO1A 3T6BA 2XI3A 2NPFA 5KFDA 3MCOA 2M9KA 3KLGB 1SIWB 3ET6B 3HULA 1UVNA 3UD4P 2VL1A 3CCJS 4WTYA 2JX2A
chains in the Genus database with same CATH topology
4CH1A 1CG2A 1UVMA 3F44A 3O3LA 2GHVC 4K2XA 1FKPA 4LSNB 2AGPA 1KQKA 2LA6A 2BANA 2RQCA 2ZJRQ 4JI1F 2DBBA 1X5OA 3SXLA 4BHQA 4NLUA 1T95A 2DGVA 3BGRB 1TQLA 3KLEA 1OIAA 4K50A 4KRWA 3CB4A 5DQHA 4I2QB 3W2WA 2VFSA 3MPVA 2RDJA 3HMJG 3N9UC 5M2RA 4OHZA 2E1CA 1YSJA 3LO3A 1YG0A 2FJWA 2ZDPA 3CDEA 3BSNA 4CCHA 1WNEA 5EWEA 5D3GA 4DR1F 4ZLPA 3WC2A 4QIWD 4ECSA 3K0JA 3LP2B 2UXDF 1WG5A 3MD1A 1HBNA 2FVCA 5HBMA 5K14B 2BJDA 2D3UA 1HD1A 2BQ3A 3DDKA 4JI3F 3UWTA 2FJBB 4X62F 3M2RB 2KU7A 4R0EA 3EYZA 3MM9B 2XLIA 2PI5A 3I82A 4O4GB 1HWLA 1LWEA 3MM9A 1P6TA 1RTHA 1S6PB 4F3OA 1SV5A 4C3LA 2XMMA 2DVIA 2YNGB 2QLXA 2RD5C 3TANA 2WONB 2EFGA 1QSYA 1UVLA 3AJ2A 2PT0A 2CQ3A 2CQPA 3ZZUA 1N0VC 1P27B 1Y5IB 5J1EA 5GAEI 2MKCA 5E41A 2NZ4A 1FEHA 4KO0B 2C2DA 4GO5X 4NLTA 1YHQS 3DRPA 3H4BA 2P5VA 1S72S 1S1TA 2BM0A 2ZUGA 4MYUA 3TVYA 4QCLA 2OO4A 3ZZPA 1RP5A 2VG6B 4MIWA 5KFHA 4TY8B 2WW8A 2M8HA 2OTJS 2O01C 3QIPB 3TW0A 1VI7A 4CTAB 1NEEA 4K5RA 2BDPA 4MAKA 1NZAA 4LFAF 2ZNYA 2RS2A 2V94A 2JC1A 3MMAA 1RT2B 2PA8D 2DNZA 3K8VA 4I2PA 3N5BA 5F8JA 5K9FA 2GIRA 3MTKA 3POTB 2FVSA 2LU2A 2ZH5A 2CPDA 4QQBA 4KQZA 1SL0A 1ZOTA 4QR2A 2LEAA 5KFKA 2KXFA 3MECA 3UQSA 1VQ6S 2PE8A 1T94A 2PSZA 3MEKA 3N0VA 3G6ES 4EU0A 4ZOSA 4HDGA 2YNHA 4KT0C 4GC7A 4QU7A 3M2UB 3IAS9 4IDKA 4WIIA 1S49A 1VQ9S 3SCIE 1TK5A 3OXGA 2ZNZA 4DR2F 4NZ0A 3FRYA 1LWFA 4DDFA 1Q7YT 4HL9A 3Q8QB 2VFVA 1PC4A 1FRMA 2B5JA 2DD8S 1U47A 1JLEB 3PX6A 4UQGA 4PQUA 4YUDA 4OHXA 4X4UA 1F2GA 4AUKA 2HWHA 3IGNA 1TK0A 4HT7A 3EX7B 3HK2A 3N01A 4IOAQ 2ROGA 3AA8A 2B4VA 3LF0A 3PX4A 1VRUA 1KFDA 1NK7A 1FJCA 5LMNF 2W8LA 5EUHA 1Y0HA 2H9ZA 1J2VA 3MURP 1RJJA 3MOZA 2ZKTA 2WAQD 3RW6A 3H5SA 1T8EA 3U1LA 4ECYA 2GC8A 4YDXA 2KM8C 1ZETA 1SV5B 4OX6A 4LIWA 1T05B 1KNZA 2EFQA 1HNIA 1HYSA 5HMYA 2VB6A 1UJ6A 3Q24A 2DK2A 3W7BA 3HX9A 2RNEA 2EK1A 3UW1A 1LK7A 3H25A 1F60B 2VZ9A 2AU0A 4ED6A 2KI2A 3C6UB 4OQJA 5L39A 3N4WA 2E1RA 2VQEF 1GNKA 5DJBA 3DLEB 2CJKA 4A8MP 4NZ6A 4C98A 1F9FA 3GB0A 3HHLD 1Q1KA 5FD1A 1HBUB 2MZQA 2RF2B 5T7LB 2JZ5A 1E6YA 1R3NA 2Z2MA 3MAQA 4A8YA 1RT3B 4DF4A 3T5JA 4GKKF 4B17A 1KSPA 4ITSA 5D77A 5KG7A 1H98A 4C8MA 4J9MA 4JI4F 3M6VA 4PPZA 1JLCB 2DCLA 5C25B 3TQ1A 4QR0A 1VQ4S 2CRLA 3V2UC 2GW8A 3S1TA 3OFFA 4WFNQ 3DRSA 3IC1A 4OZJA 5KFFA 3M1VB 1QAJA 4KTQA 1F5CA 2GQ2A 2MZRA 2HAIA 3CJKB 2BYCA 4YDDB 2ZDOA 4ECWA 5CCMA 3EPIA 1LW0B 3M2UA 5DQGA 3MM6B 4I1TA 5CCLA 5KT3A 3ZZYA 2LQBA 3CCSS 1AROP 1RQ0A 3M8PB 3MM7B 2J7KA 1S0VA 4M5DB 2OPQB 1NK4A 2X1BA 4KO0A 1IKWA 2WHOA 2PFFB 3KK1B 1VHFA 3CCWA 4YHHF 2A2CA 3FEXB 3D0HE 1D8YA 4A8FA 1K9MT 2K3IA 3J7YU 4X4NA 1SKSA 4ZP9A 2KYXA 1UVJA 1SUQA 4CNYA 3CD0A 1DQ8A 2Q79A 1YI2S 4F4XA 3D1QA 5A8RB 5M2PA 4F25A 2PO4A 2AV5A 2DNQA 3IRXB 3KYLA 1C0UA 2VBYA 5GADI 2C42A 4URSA 5GADU 1S1XA 4DR5F 3NL0A 2ZHAA 2A18A 3N79A 2PA3A 5KG6A 4IFVA 3FJ2A 3SSQA 2LU1A 2V8GA 2UVRA 3PO4A 1U1KA 4E98A 5E2QA 3VAMA 3PR4A 2IJFA 3CC7S 4OI4A 2DNOA 4FXWA 1X5PA 2VC0A 4HDHA 2DB1A 1O5JA 1R27B 3P96A 1DTQB 4JI6F 2MQMA 1L3KA 1G3OA 4Y65A 5LMUF 3SZ2A 4A8QA 4OMFG 4WKRA 3MR2A 1RTHB 1S6PA 3PX0A 2B6AA 2F7VA 4J37A 4N5SA 4RW8A 2M0GB 2DNLA 1X4FA 4R5PB 4AL5A 2BACA 2HFNA 3NWGA 3VCDA 1RYSA 2YQ3A 1TKTA 3MUVP 3LAMA 2J7UA 1XERA 2HNZA 1EETA 2HNYB 2J0XA 4JI8F 3M8SA 2RILA 1TP7A 2FHJD 2Y1RI 3HHEA 1KLMA 3VAIA 4IOCQ 2YNFB 2I2YA 4R8UB 2UVUA 2ASJA 3CCLS 4ALZA 4I0WA 5LSRA 2DGSA 1Q53A 1F5BA 2LDYA 2VASA 3NGDA 3CTRA 1FTCA 2OPPB 2RQMA 3KLFB 5DDRC 3RB4A 1BD6A 2J6UA 4PWDB 1ZPVA 2DNPA 4I56A 3OHAA 3AH6A 3SI8A 3QJLA 2RS8A 1WEZA 1BY9A 2IYIA 5J2MB 2IJNA 3M32A 1N54B 1X5SA 2R2UA 1RT5A 2ASLA 2WCXA 3TYTA 2PDAA 5EDWA 3MGJA 3I55S 4DN9A 2L9WA 3NCQA 4C8KA 1VQ7S 1FRJA 3GFZA 2QO3A 2IHR1 4NA2A 4LFBF 1W2IA 1UKUA 2U1AA 3E01B 3TVKA 1RGVA 2IAJA 3BN7A 4ZA1A 1HWUA 5SZTA 3KK2B 4TY9A 3HZGA 5KAKA 2DH9A 3GYXB 4FXVA 3K5MA 4X4RA 3H2LA 3NAIA 2OSRA 2AWZA 2C3OA 4ZCKA 2FHMA 3IFEA 2RVJA 4Y3CA 5CXTA 2JFKA 2EG2A 3W2VB 2JOQA 4DR7F 5CH7B 2DR9A 3M9NB 4YQWA 1JIHA 1Q8IA 2CJBA 2ZHBA 2F9JA 1I6JA 2EFOA 2ZH2A 4LVNP 4NLYA 3BGFA 3CSKA 1MU2A 2GFFA 2PGCA 3HM9A 3KHLA 2OH2A 2KFNA 5DLFA 4BC9A 4H4OB 2DNHA 3MZIA 2KZZA 4MIAA 4ED3A 4ZPTR 5A2QY 1H7WA 5AE2A 3RRHA 1DTQA 5MAOA 4N76A 4BC7A 2JWNA 1OQ6A 2C2EA 2DR7A 2XCAA 1DLOA 2OPQA 3H2UB 4C0HA 1MWYA 3F73A 1M5HA 2WK4A 3M9OB 2J76E 4ZK7M 2D3ZA 4NCGB 3VAKA 2V8DA 4G6VB 4PPDA 2HNZB 1R7IA 3F56A 3JAMY 1GT8A 5CYQB 1U1LA 1RKJA 1N56A 2MHEA 3PW5A 3M30B 2DT9A 2ABYA 4DL3A 4OZ0A 2CFXA 5F41A 3DCAA 5KFOA 4RUCA 4C11B 2Z8QA 4RW6B 5LXRA 2JEGA 4WXWA 1GTEA 3BSCA 2B3TB 4GKJF 4WZQA 1TFWA 2ROEA 1FDBA 1GX5A 1M90T 1REVB 1RT6A 4NMLA 4YEAA 4B9VA 1SJ1A 1K1SA 1BQNB 2AD9A 2FVQA 2HVHA 4OI0A 3Q2TC 3I4PA 1A9NB 2XI2A 4O3OA 4N47A 4K4XA 3CJ5A 3MHYA 4ZCIA 3RYLA 1JLQA 4EO8A 2NYIA 4MMOA 2XLJA 4ILMA 1G2EA 2J9DE 2IRUA 2KJVA 1T03A 3DM2B 2EVZA 3KWMA 3MFIA 2UXBF 2LXUA 5D4LA 2IBOA 3WDOA 3HVTA 1J5OB 5F9LA 4MH8A 4R5PA 3KTQA 5IQ6A 2DJWA 4NLSA 4LF8F 2HWIA 1HL6A 3EXCX 3M6UA 4ELTA 4F4WA 2E5JA 4ID5B 4WF9Q 4PXBA 1HPZA 2QT7A 5I42A 2AX0A 3I9V9 2KRBA 3DOLB 1PC5A 3FCHA 1V3SA 2DHSA 4NLVA 5I42B 2KZMA 4ES3A 1NU4A 4QIVA 1S99A 2XNRA 2QRRA 2E66A 3DN9A 2GV1A 1TKZB 3CD5A 4RBVA 5EHHA 2IAJB 4ELUA 3HP6A 2KVIA 4A8OA 3C66A 3MEGB 2LMIA 3FFIA 2QFJA 1DTTA 4ECXA 2Q66A 4YR3A 5DG9A 2BW2A 2EPIA 1DTTB 3H40A 4O3NA 3W2VA 4ZMMA 3TI0A 2OD4A 3C8YA 5SUHA 3KK3A 4WFYA 5FDLB 4J9LA 3QLHB 3RBEA 4J9NA 2G0CA 4F4ZA 2HW3A 1WHVA 3EGNA 4J5OA 1YJTA 1L5UA 4K4WA 2MSSA 4Y6IA 3LW5C 5A8KB 1IM4A 3D1HA 3QGHA 3TAMB 2QA1A 4WU2A 2VQFF 2D3OR 4EUVA 1KEKA 3R5CA 4A8KA 3G6YA 3CJ0A 2JSXA 3BQ1A 2DGOA 4XDCA 2E9ZA 3THVA 4QWBA 3IS9B 1URRA 2DRBA 4FBUA 4NA3A 2HIQA 3I5CA 2G1DA 3EZUA 2MQPA 3O2IA 2R7OA 3V4IB 1KRPA 3PW2A 2VG7B 3MTJA 3T1YF 3QIDA 1U09A 2W4DA 2W24A 1U45A 1VGYA 4YB7A 1N5VA 2PMZD 1JB0C 4A8SA 1HBNB 5HBMB 2YKNB 1VFJA 1QM9A 2YX7A 3GV8B 1U1MA 1IKXB 3M30A 1J5EF 1JJHA 1S1VB 2ZOGA 1LFPA 5B0GA 3KMQA 3DYAB 1NKEA 4HHJA 4F02A 3OLBA 2HLTA 2R7RA 5L38A 2YWKA 5AXNA 1ULRA 1X8DA 3H59A 4N77A 4JI5F 4OHVA 2P6TA 4Q8FA 3RR7A 5J1PA 2AW0A 4ES2A 4PG5A 3CXCR 4OJ3A 4ZPWR 2OKQA 3SMZA 3PW7A 1X4HA 4JI0F 3ICLA 3H98A 4IRCA 5IXUA 2KO1A 2YH1A 2VBWA 2EFVA 5F8IA 4M8LA 1HNVB 3CPWR 4YFUA 4RW4B 1B0TA 5L1KA 4Q44A 4C8LA 3GYNA 3BQ0A 2I5JA 2QSFA 3PJXA 1M5SA 2CYYA 3E51A 3HHLC 1LKZA 1RTIA 1M5PC 2ZH6A 4KR0B 1P1TA 4C2MA 5J2NB 2F8MA 2DH8A 2XMJA 1FO1A 3HKZD 1HBOB 2K1RA 3FZBA 1X4AA 3NRBA 2NXUA 3Q8PB 2MB0B 4B3RF 2DR5A 4P7TA 3E2EA 4B9NA 2N4CA 1KLNA 2E9TA 4B02A 3PKMA 1UEUA 3G6VA 1HNWF 1NO8A 4Q2LA 2AJ4A 4PRFA 1Q86T 4URGA 4F3QA 4FF3A 1FK9A 5CD4H 1JLBB 3HPOA 3OTOF 1AFIA 1BC6A 5K8PA 2VV5A 3IWXA 3OL7A 2JC0A 1X4BA 3T5KA 4EEYA 1FXLA 5B08A 1RT4B 3LQVA 1QSLA 2FPHX 3OJUA 1R0AA 4I67A 2WOMB 2I0XA 2OPSA 1Q81T 4EWTA 4V19J 3UCGA 4XO0A 1ELOA 4XPEA 3R1LA 1X7VA 2HHVA 2VOPA 1RT1A 3IS9A 4NYZA 3FFIB 3JSYA 4UQTA 3BGUA 3HDSA 3CT9A 1TL4A 4O4RA 5GMKa 1IKVA 3QLHA 1YTYA 2DNYA 4DS5A 4JI7F 1WEYA 2HHSA 4QIFA 4K4SA 1U49A 3IRWP 3VR1A 4DFMA 4NLDA 1CPZA 4JV0A 3K5PA 1S1VA 3J7ZT 3MMAB 2ERRA 2VA3A 3US5A 1SQEA 3T5HA 3D0GE 2UUWA 5KFEA 4LQ3A 4DMZA 4IRDA 1R89A 1HNIB 1VC5A 1MMDA 3AQOA 4ZVHA 1H2UX 3V4IA 4FVMA 3H8YA 1HNXF 5IT4A 5HMZA 5D4NA 3RW7A 2RSQA 2EKYA 4NLQA 4KC5A 2P6SA 5KT2A 1C0TA 2X1FA 2P9EA 1YVFA 3JB9k 2DNKA 4MKBA 4C8NA 3TO8A 5JUMA 4USIA 3PV8A 2G4BA 3B4DA 4EO6A 2DHAA 4I64A 3I31A 3KHHA 2MZJA 2FHOB 4FF2A 1PGZA 4C0BA 4E0DA 1R8HA 1T3OA 2LLZA 3BO2A 2B9WA 2HGLA 3OFGA 2G9OA 2K3KA 5J2NA 1VC0A 3O1LA 1JNRB 3BDPA 3M6WA 3OUYA 1XNQF 1FDDA 5DDQC 2BR0A 5HQ8A 1Y5NB 4IQMA 2N4DA 1TKTB 3I87A 3JTOA 3CC2S 3L7PA 4RW7B 2Y1JA 3RAXA 1NKCA 2XY5A 3UCUP 3EGWB 1FXRA 4Y28C 2E5HA 2B51A 2W9BB 2POKA 1TV6B 3DRSB 2M52A 2BABA 2B56A 5J2PB 4DL4A 3V6DA 1TKXB 3IG1A 4DWIA 4GO7X 1NRKA 1KTVA 2XS5A 3UE2A 3M8RA 1M5OC 1TKXA 1F0XA 4HT5A 3HXMA 5EX0A 2FJAB 1WHXA