1FDDA

Azotobacter vinelandii ferredoxin i: aspartate 15 facilitates proton transfer to the reduced [3fe-4s] cluster
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTNCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azotobacter vinelandii ferredoxin I. Aspartate 15 facilitates proton transfer to the reduced [3Fe-4S] cluster.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport(iron-sulfur)
molecule keywords FERREDOXIN
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fddA00
1G6BA 1FRJA 1FXRA 6FD1A 1FXDA 5BYQA 1H7XA 1JNRB 1FRXA 4L6V3 4RKUC 2C3PA 3MM6A 1DFDA 3MM5B 3MM9B 2VPXB 1WTFA 4DHVA 2C3MA 1FRHA 5CH7B 2GMJA 1KQGB 2VPYB 3OR2A 1A6LA 2C42A 1F2GA 1G3OA 2XSJB 3MMBB 1Y5NB 4ID8A 1GT8A 4OMFG 1FTCA 1PC4A 1FRKA 1FRLA 1FDBA 1PC5A 2WAQD 1Y5IB 1H98A 2PMZD 3IR6B 2V4JB 2VPWB 1XERA 5BYRA 2C3UA 1FDNA 2FJDB 1SJ1A 1C4CA 1SIWB 1H0HB 1BWEA 1FRMA 1H7WA 2XSJA 2FJAB 5BYSA 2FDNA 3MMCA 1Y5LB 2WSEC 1DAXA 2GMHA 1FERA 1C4AA 1BQXA 1AXQA 1IR0A 1RGVA 1FD2A 1FCAA 2FJEB 1BD6A 1FEHA 2Y0SD 1IQZA 3EGWB 4AYBD 1DURA 3PNIA 4KT0C 2WSCC 3MM6B 1GAOA 2C3YA 1B0TA 3MM8A 4XDDA 6FDRA 3IR5B 1B0PA 1F5BA 1JB0C 5L8RC 1SIZA 1Y4ZB 1ROFA 1B0VA 3OR2B 2PDAA 1KEKA 3MMBA 2Z8QA 3MM9A 2ZVSA 3OR1B 1KQFB 1R27B 3EUNA 2C3OA 4YDDB 2WSFC 1F5CA 2FD2A 5E7OB 3MM7B 3EXYA 2IVFB 1FRIA 1Q16B 1VJWA 2FJBB 3LW5C 1HFEL 3MM7A 1FDAA 5CHCB 7FDRA 2V4JA 5FD1A 2FGOA 1GTHA 3OR1A 4XDCA 2UZAA 1FDDA 2V2KA 2WB1D 1FF2A 1CLFA 2O01C 4CI0B 3MMAB 4OV1A 1BC6A 1JNZB 1BLUA 3C8YA 3MMCB 2VKRA 3MM5A 3HKZD 4XK8C 2VPZB 1K0TA 3IR7B 1D3WA 3MMAA 4Y28C 3GYXB 1GTEA 2PA8D 7FD1A 3MM8B
chains in the Genus database with same CATH superfamily
3HHLA 3JSRA 3WHIA 3TA1A 4DPTA 3KLHA 3CCSS 4DSEA 5DG7A 1EETB 3G2XA 2YWEA 4KPYA 3HO1A 2OPQA 4G6VB 1EX8A 3K89A 3M6UA 3N5BA 2PE8A 3AHPA 3ELHA 2GVDA 1L3SA 3K5NA 2V8VA 3DXSX 4RNNA 4UZBA 1QSSA 5A8KA 4RWXA 3H2VE 1VQYA 1Q0NA 3MM5B 2VPXB 3NS7B 5CABA 3JXOA 2G2OA 3PW2A 2C3MA 4G65A 1VBZA 1SXLA 1KQGB 4DV3J 2K06A 4JI6J 2BE9B 1QUPA 4ZPVR 5F8GA 2M5YA 4WWSA 3ILLA 3FBEA 5J2MB 3J81Y 3KLFA 2AYEA 3GMGA 4C98A 4ZCIA 5IT0A 4EYIB 3CW2C 3QLHB 4NLRA 2DNKA 1V3SA 3QWPA 3LAMA 4AXJA 1N33J 4AL6A 4QU6A 3J7YU 1SC6A 2B7CB 3CT9A 4JV5J 2AYGA 1RWMB 4CYUA 2DHHA 4J9UE 1VISA 5D0EA 3OFFA 3VVUA 3RAMA 1XERA 3BN7A 4RPFA 4C3MA 4WP9A 4Q44A 4NEZA 1T11A 3NMAA 1P1TA 1UZHA 2IM3A 2FLLA 2BQUA 2ZZMA 2DH8A 3BZQA 3I0SA 3OTDA 2V9KA 5C25A 2GVZB 4KE5A 4DZDA 1H0HB 3P3DA 1KLNA 1JIHA 5JUMA 3OL8A 3KNAA 1RSCA 2W7PA 3HXMA 1WF1A 3PV8A 3OL9A 3NGTA 2Y3YA 2GMLA 1KD1T 1SQGA 3DKDA 3H7HB 2BJEA 4IR1A 2VG6B 1RGVA 2J0XA 3Q23A 1FKPA 3G6VA 3H5XA 3CJQA 4FZVA 3A1YG 3PKYA 3OSPA 2D3ZA 3U1MA 1NNDA 2XLIA 4ECYA 1GX6A 1RABB 2DNOA 2O67A 2KM8C 2J76E 2V2VA 4DPXA 1LWCA 2F8MA 3SSRA 4F0MA 4KT0C 2ZH8A 2GAHC 2MHNA 2HLUA 3VWSA 4ECTA 4EEYA 3R3TA 2VFUA 4K8RA 1N0VC 3J81j 2AZ3A 2C3YA 2IYGA 3MAQA 1WC5A 3MOJB 3CDBA 3MUTP 2OSQA 2HFOA 1RWNB 1KHWA 2GAGC 2W4DA 3R5AA 1X4DA 1NK8A 2M8DB 1TQLA 1SIZA 3DRSB 2AMCB 2WVDA 1B0VA 1NXIA 2LU2A 5DJBA 2XS2A 2PDAA 4NXNF 2B4OA 3HCXA 3L4BC 1T8EA 4C11B 4KIAA 1S1VA 2YNGA 2DNQA 5DDRC 1YSJA 4WFBQ 1KQFB 4YDDB 3QRPA 2ROGA 2ZDPA 1NK9A 1UETA 4O4GA 2YWWA 4CQ1A 1NMEB 3LWMA 4J9SA 4ECWA 1YJNS 1KC8T 1N34J 1I94J 3SMZA 1KONA 2DHGA 4F2SA 3CD6S 1QUVA 9RUBA 3P45B 5HBMB 4RUBA 3VQSA 2YNGB 4M5IA 2H51B 4DR1F 1UWBA 3B6BA 4ITSA 5DM6Q 1Q16B 1D0EA 1E6VB 2AKWB 4UT4A 5JMNA 1S1XB 5E3QA 2RQCA 1DZ5A 3MM7A 4U95A 3L3CA 3LF0A 2DNPA 3SSQA 1NHUA 1UWBB 3TA2A 4Q45A 1REVA 2LA4A 5FD1A 2DHAA 2HVEA 3R7NB 4NI2B 3ZTOA 4P2MA 3VALA 1R31A 2IBOA 4ZVSB 4EFAC 2F63A 4PG4A 4DSKA 4G3IA 4AD6A 4PZVA 3W1YC 5HLFB 2EC2A 4IQMA 3KJVB 3BGRA 3FRZA 4P72A 1TKXA 3HKWA 1JNZB 5KG0A 2J8SA 4IG3B 5F8IA 1BQMA 3SI8A 3M8PB 2P9CA 3AODA 1D3WA 2DGSA 2UUBF 2KT5A 4Y28C 5F8MA 1OQ3A 2VBXA 3CJSA 4K4VA 5KFPA 1F6TA 3FNNA 1HNXJ 2XNRA 2XY5A 5B0CA 1NPKA 2W2PP 5H1SV 4QU7A 1URRA 3CJ3A 3LPEA 3NY0A 1NK6A 5E3RA 4J9NA 1B99A 1TL7B 1S1WA 2N3LA 5KFNA 4AQYJ 4LMZA 2VFVA 3BF4A 3QSIA 4JI3F 3QJJA 4C4WA 3MWBA 2BR0A 4WZMA 3FEXB 3IC1A 3EVWA 2CADA 2UUCJ 1FRHA 3M05A 2XMMA 1N88A 1WOSA 2BOAA 3DHWC 5A6WA 3TVZA 5KFIA 1VC5A 1Q82T 4QYZK 2VPYB 3JAMU 4PQAA 4HL9A 2GJ2A 3BBFA 3W2VB 4N5SA 1TK8A 3PM9A 4F02A 3M1VB 3RUBL 1KFDA 4JI0J 1S1VB 5E5NA 2XGPA 3K5LA 1S48A 3QT5A 2CG4A 3HLUA 3ILOA 2NXCA 3MEEA 4HH1A 1NSQA 2QFJA 2CJXB 2DVIA 2FHJD 1LFWA 4KV8B 4FYYB 3CC2S 2HHUA 2OMOA 1H2VZ 1C4CA 2RUGA 2RRBA 2V34A 3BB5A 2UUAF 2DBBA 3T9ZA 2I6WA 2MZ1A 1BWEA 2UU9J 1C1BB 1PBAA 3OW2R 5HROB 2L9WA 1OY6A 4ZPWR 3AJ2A 3S6EA 4MIAA 1XNQF 5GMKa 3TZWA 3B78A 3JQMA 5B0FA 4LSNB 2DRBA 2W7OA 1UVJA 4RNMA 2P2CB 3DYAA 5HROA 5HLFA 1AROP 1IBKF 2IRUA 1BD6A 2DK2A 4HDGA 2XULA 2Y1LB 2UV8A 1WACA 4IH7A 3H5SA 1IN0A 1VIOA 5ETRA 2HURA 2B43A 1W2BR 4C11A 1N5SA 2ZBQA 5CYQA 3VR1A 3V4MA 3ENVA 4NLXA 3T19A 1LW0A 2OPQB 3EGWB 1OYDA 2M70A 4FVMA 5DS7A 1MMLA 4B9VA 3JSYA 5IT9Y 3CXCR 1DQAA 2IAJB 4W90B 3NNCA 2VZ9A 3OD2A 3D6FB 1WHWA 2B5JA 3FQLA 4DFPA 4ICLA 1KFSA 2FJWA 1RWVB 4O44A 1ZAVA 3B54A 3W2VA 2IC3A 5KT6A 1L3TA 2GJIA 4I1TA 1N5TA 2D74B 4DX5A 2HAFA 3OL6A 2P9GA 3J7ZT 3DLBA 5LJ3Y 5DLFA 5BR8F 4TY9A 2WSFC 3KDOA 1U1MA 4JB8B 1PYSB 1HWJA 3QGIA 4ER8A 3JB9k 4RUAA 1S97A 2DR5A 3P49B 3LGMA 3PW4A 3CJ8A 2YY3A 5EGYA 4K0KF 1FRIA 2BOPA 4NA1A 2JEGA 2KJVA 2HG4A 2MQNA 4I2PB 1Q8BA 4HHJA 4B3OB 5G0RA 2C2EA 1QE1A 4PG6A 3R9LA 2GC8A 1MLAA 2XHCA 4ID5A 4IFVA 2X1BA 1ULRA 2CZVC 1KTVA 3O5TB 1ZM2A 2QMXA 3QT8A 4NLPA 4PAAA 1T3NA 2XSFA 2J6TA 5L1IA 2QA1A 4ZVPB 1HBUB 2HWIA 3CJ2A 3IO1A 3G6XA 1QAJA 3IAM9 3KUEA 3RB6A 3KLVA 5HBMA 2BE7D 4CH1A 1UPMB 2A1BA 3BGUA 3QJPA 2MKJA 5A8KB 2NYHA 4MKVA 3BSAA 2JX2A 3GJQB 1WOPA 4QR0A 5KG7A 1U6BA 4X4UA 2VC1A 1G1XA 1WKLA 2QYGA 4IOCQ 2PEBA 3MECB 1N56A 4ELUA 1M5VC 3C46A 1YLXA 3PX0A 2Z2ZA 3M9NB 3FFIB 7FD1A 2B9EA 2DR8A 1RT7A 4FYVB 5KG1A 3F56A 2XMKA 3D6HB 2GHVC 4G1PA 2FVRA 2CJYB 3OVAA 1B7FA 2DGVA 4ANEA 2ALZA 5KFLA 4DR4J 1NUEA 2C2KB 1ZH5A 1JNRB 2GO8A 2Q1LA 3UCGA 3A8KA 2VF3A 5A6PA 1DTTB 1SC3B 4DG1B 3H4BA 1S0VA 2Y8YA 5EN1A 5DG8A 3V6KA 4WZQA 4OZLA 5D4NA 4DUYJ 3BQ0A 4UOFA 3KK2B 3D3CJ 2FVSA 1Z2ZA 3DLHA 1WD6A 4B9LA 4U96A 4FF1A 1RJJA 1TU0B 1M1KT 4WCEQ 1QTMA 2UXDJ 4NZ7A 2Q79A 3D4JA 4M5GA 3H40A 3HSJA 1U2RA 1ZTWA 4JI7F 4HVZA 1AB8A 2JLFA 1PC5A 2GGPB 2QTWA 3PFEA 4KGVB 5KT4A 4NYPA 2C2ZB 2YKPA 4CWBA 3AOAA 3NLCA 2OJ3A 1JLFA 3T41A 2C1EB 2KU7A 1HQ2A 1FDNA 1VS3A 4C8ZA 4USIA 3POTA 1N52B 1U0HA 1ZA2B 4FDFA 1SKRA 1RWWB 3W3SA 5KFHA 4B3OA 1ICEB 1LW0B 3M4XA 3BPDA 2APOA 2HZAA 2RHSB 2V63A 3CDWA 3ET6B 4E98A 3HX9A 1LEOA 2I5JA 1MSWD 2HBQB 1BMQB 4LFBJ 4KGMA 1OIAA 1X5TA 1XMQJ 1FJEB 2XB2D 2R7WA 1CSJA 1DTQA 2OELA 5IWAJ 5T14A 3Q2TC 4F7VA 3N6NA 4D3GA 4R5PB 2MZTA 4FP9A 3N4WA 2MB0B 1C1CA 4ZVHA 4V19J 3BQ2A 1EETA 1HW8A 2Y0SD 4K0KJ 1NB2A 1D9DA 2BEFA 2M9KA 5L39A 2J6UA 1C1BA 2L9DA 4DV6F 1NM2A 1NZAA 4YMEA 3EICA 1TR0A 3RBEA 4IOBA 1JQGA 4XDDA 3QGHA 1RT7B 5IC4B 2CDRB 2AWZA 2IHR1 1TVRB 3QGPA 4CO2A 2J0QD 4ZVTB 3DNCA 1HBNB 2DCUB 5A0YB 3H90A 2WCXA 3GFYA 5KFCA 4DS5A 2EK1A 5K8MA 4K4TA 3H0PA 3NOGA 2DO4A 3NAIA 2BJ9A 3I55S 3PVXA 3MPVA 3CJ5A 4JOUA 3H2LA 2EFNA 3RTVA 4X62J 2MJNA 2BYCA 4DU8A 4IRDA 2F40A 3U1LA 4LFCJ 1QAXA 1M5KC 1VRUA 4KV8A 4EI2A 4C0HA 3C66A 3U02A 1CS4A 4NA3A 4GVBB 5A8RA 3W62A 1ZM4A 4LR9A 2N4DA 3BKUA 2VG7B 4DV4F 5CHCB 1NZ8A 2ZKUA 2LDYA 4DR2J 5GMEA 1SQFA 2F9JA 2XO6A 2YNHA 1RB0A 3HP6A 1S1TA 2RU9A 2DH7A 3RW7A 5CCLA 1TKTB 1U48A 1EP4A 4YB7A 4ZN1A 2BM1A 2V2KA 4X2BA 3TAMB 1NJXA 1FF2A 1LQ9A 4IFYB 4Y2CA 3C6TA 1VOMA 2Z30B 3QBCA 4ZVEA 3UE2A 4DCPB 4DX7A 4O3NA 4WE1A 2NPFA 2CDQA 2RDDA 2Z2YB 3SCIE 4A8QA 3T5JA 1VQNS 2QSFA 3FCVA 3UDEA 2WVCA 4NYZA 4OHWA 2MHEA 3C6TB 3M6VA 5D0RA 3FBBA 5CYMA 1EJ7L 3M9MB 1QE1B 2HRUA 1UZDA 4LUBA 2Z56B 1KR4A 2UUBJ 1N34F 5J1EA 5EWGA 3R7SB 2W2QP 5HI7A 4X64F 1HHQA 2YX7A 1PAEX 3KYLA 2L9NA 3EGNA 1N36F 3WIVA 4LBIA 2UXCF 1R7IA 4PYAA 2KFYA 1ZA1B 4OYZA 1JLCA 1U1RA 3IWNC 2DY1A 4IYQA 3OJUA 5KFDA 5D6GA 2HGNA 4PPDA 4YDXA 4RL1A 3VAKA 3DOMA 3WZ0A 1U45A 3HHNB 2XZDB 2XGQA 2AJ0A 4ZP8A 3GP9A 4CRJA 2QA4G 4ILMA 1WF2A 2WBRA 4I68A 1S99A 2RQKA 2P6SA 3SQGA 4TQSA 2Z2MA 3P96A 1A6LA 2FLOA 4TYAA 2XS5A 2JL9A 4W98A 4M1KA 5C2GA 4ZITA 2R42A 3I6PA 3QQCD 2HMIA 4ECQA 1SC1B 1O5JA 2BMBA 2BM0A 3EPIA 1FE4A 2AT1B 2CAJA 2RQMA 4B17A 1IQTA 4RO0A 3KLGB 1DTTA 3KWMA 1NB7A 1KRPA 5I3QA 4HKQA 5BYRA 5D15A 2V67A 3LANA 3W2WB 4WFAQ 4JV1A 1C0TB 4ANCA 4TU7A 4LF8F 2HK2A 1RU1A 3MI7X 4Y2AA 2AP6A 3PCOB 4CTAB 2BABA 2MLZA 1U24A 1UL3A 2V5HG 3I0RB 4CO1A 3V2UC 2AU0A 4F4WA 4P10A 3IMQJ 1Y5LB 5HMZA 3I4PA 1LOUA 1BQMB 2N3OA 1HNWF 4RNFA 4JBCA 1RZMA 4F50A 3OVSA 3KK3A 3MCSA 2PSZA 2Q6BA 3IA0A 4MAKA 4FF2A 3PG9A 3M7VA 1CJUB 4ELVA 1JWWA 3GG0A 3WIUA 1YTYA 1X4HA 5HL7Q 2LYVA 1IKYB 2IDLA 3CD0A 5U47A 1MN7A 5I3PA 3MPYA 3CNQP 4HEA9 4JI0F 1RT2B 3DMJA 5FDLA 2MY8A 4WBFA 4ED3A 1TL7A 5LT5A 4DPUA 1LNQA 2HHVA 1S9EA 1JKHA 1UCNA 2MZRA 2PA3A 4AFFA 4DR2F 4ZVUB 3T5HA 2KZMA 1UEUA 4L73A 4DWIA 2DXFA 4CLPA 2MDAA 2MJUA 1APSA 1R0AB 1B0PA 4CT8A 3CC7S 4FS2A 1EQ0A 4Y0FA 2OPPA 3JYTA 4K7QA 1WSVA 1FJGF 1TK5A 1ZETA 2LEBA 4ECZA 3DXBA 1GH8A 5KFUA 4O3QA 2W4CA 2ZH3A 1HLWA 1HBMA 2AIRB 2DO0A 3IXQA 2VOPA 1VQLS 3EUNA 2C3OA 4OI4A 3CCLS 3FCHA 5JVGQ 1EIYB 1OS5A 1FI4A 1YK9A 1O8BA 1VQ4S 2FD2A 1P6TA 2CRLA 5C24A 1Q8LA 1RTJA 4Z7YA 5DZ7A 4DX6A 1SV5B 1YBTA 3KLEA 1SL0A 2CQ0A 1WOOA 2QL9B 2BACA 2QZ8A 4NZ6A 4EBCA 3E8OA 3DRPB 4C97A 4TU8A 5KFMA 3CDEA 2D3OR 2MY7A 2DNNA 3ISND 5GAHU 4J9LA 4DUZF 4OHVA 5ETPA 1RQ0A 4H4KC 1VQ5S 4P6QA 2LEAA 5J1EB 1GTHA 2VG5A 4NXMF 1X4FA 2UZAA 1B3TA 1ZOTA 3AOBA 3M2RA 1R8CA 4OLOA 3UDVA 3V6HA 2LECA 2DR7A 2W2OP 2PO4A 1IKVA 1TKZA 3M9OB 3T1HF 4PG5A 3CJKB 4LT6A 1MNEA 2XYPB 1HI0P 1JXVA 1YWXA 4A46A 1UKUA 3A8JA 2XBPA 3CIMA 2BJ8A 1FT8A 1YG0A 1ZAXA 3WDOA 4IH5A 5HP1B 3Q8SB 2K3KA 1DLOB 4MJKA 2NSBA 3RZAA 3T1AA 3VVTA 4C48A 5MLCV 1S1WB 5I3UA 4OZ2A 3LP0A 3KHGA 1CULB 1CJVA 1U4BA 1F1BB 1YZ7A 2E7VA 4RW7B 3W65A 2DCLA 4N77A 4U8YA 3D6MB 4JI2F 1R89A 3RBDA 1CJTB 2XM3A 1H73A 1NHVA 3D6TB 3KLHB 2ZOFA 5KG4A 3MPDA 3E2EA 1X4GA 4P7TA 4QW8A 3U1NA 2J7WA 4KGXB 1WKJA 2W9CB 4NLVA 4RBUA 3TVKA 3QNWB 3DFEA 1VC6A 3M8WA 2D1CA 4PG8A 4Y6IA 2VIHA 2Z58B 3G82A 3PHEA 1RTIA 3X1LB 1G3OA 4F0HA 1OO0B 1S12A 3HJVA 4WTOB 1PJ7A 2O3DA 2YKMA 1ZS6A 3DLJA 3PEHA 4LIRA 5L38A 5DZ6A 2HS4A 2E1CA 2NUHA 8RUCA 1F3FA 2XZWA 3HSZA 5GADI 1E6YB 4TVAB 3H5UA 2FC9A 5AT1B 2HWTA 2D9OA 3DRRB 3LQVA 4MYTA 3UDCA 3QWUA 4MTPA 3V6JA 1DJ0A 1FHTA 5FLXY 2RHQB 1EZZB 2C3UA 1U49A 1XK8A 2FJDB 2UUWA 1F60B 2YKQA 2ZFHA 3BKFA 3CO9A 3HZGA 5IFMA 1D1UA 3IBWA 2KT2A 2GO9A 2GCFA 3HFZB 2E66A 2Q43A 1H7WA 1TL3B 2V68A 3HVWA 4LF4J 2ZVIA 4CLKA 1R8PA 5ETMA 2KM8B 4PXDA 4PEOA 4QJVA 4B9SA 1K73T 3OFGA 4L75A 2OIHA 1FNXH 4GVLA 3ZZYA 1FERA 1V6HA 4BDPA 3EXCX 4LF7F 1FK9B 5KG3A 3GG1A 2NR0A 4ED2A 2CQHA 4HTIA 1X5OA 3W9JA 1WJ9A 2DD8S 3H8YA 1YJWS 2X51A 2ZUAA 3D1HA 4C8MA 3PRBA 2X3DA 2K3IA 2YNIB 4QYRA 4MIBA 4RW6B 1HYSA 4NLUA 1WKKA 1NSPA 3R5JB 1XNRJ 1N54B 4MH8A 4AUKA 1S5ZA 1S1UA 4E2FB 4J9OA 2CPFA 3AT1B 3MM8A 3HMJG 4KB7A 4C3KA 1BUXA 1LWCB 4A8WA 6FDRA 2E1MC 4NRTA 5HK4A 2AEMA 5E33A 3GFXA 3LH2S 5KFYA 4DBQA 3D54A 4F0KA 1YHQS 3D7SB 5BJRA 5D3GA 3OQ2A 3Q8UA 2HNYB 4Y2IA 1DARA 2IJRA 3UFCX 2E5JA 4ZVRB 4MKBA 1CJKA 1FFGB 4RJVA 4B9UA 2F4FA 4CLWA 3O8WA 5F8NA 1HHSA 1HL6A 3MEGB 2FPHX 2RQ4A 2VKZG 5D0GA 4USUA 5IV4A 2IVFB 4JI1F 1ZZFA 1GFWB 2KXFA 3CE8A 5LXYA 4UY8T 4MYUA 2V8HA 3O44A 3MEDA 3DM2A 5F8JA 4H4KA 2I8EA 1TV6A 4A8SA 2KTQA 1NRKA 2IJFA 2DISA 2CPXA 3DOKB 2OKQA 4AE5A 1CEZA 2F5GA 1RWKB 1EAYC 3J7A1 4JI7J 2BRKA 1FDDA 2GA7A 2E1PA 2MKIA 4BWMA 1JLQB 3GCXP 4J90A 2GNKA 2OH2A 2HBRB 1VQ6S 4ILLA 1N5VA 2DTJA 1SV5A 2RRNA 4KHPF 4KPCA 5J1NA 2A3JA 1I3OB 1RAEB 2J9CA 3FZBA 4FKXA 4KFBB 2ZE2A 1XJWB 2DT9A 1SUQA 2IM2A 4JI4F 4CLYA 1SL2A 2FYXA 2G13A 3NGUA 3P5TL 3GYXB 4DR6F 1W2IA 1KDNA 1H2UX 1YRXA 1G7CB 4ZHRA 4F4KA 4DL6A 4ERDA 3RB3A 5M2UA 3HHLD 1TL4A 1PG5B 1U8WA 1MMDA 3NNAA 2R8JA 3K8WA 4ZLNA 3R5BA 5KFBA 3C16B 3W63A 3D1QA 3EMTA 1PGZA 6FD1A 1V3RA 4OI3A 3FMWA 1NDCA 3GTYX 2YQ3A 3ICLA 5A8WB 3CULA 4WXWA 3RGIA 3DLGB 4WJBA 4K2JA 1JXLA 2L3MA 5BXIA 1WTFA 2CQGA 2ZM6F 2XO7A 1TMMA 2HFZA 3Q22A 1RLDA 3GR0A 1VR6A 2XMJA 3ZZOA 4EUVA 4TU9A 2XC9A 4RW9B 4WK3A 1B7YB 2NXJA 1Y0HA 2ZWPA 2C42A 3MCNA 3AA8A 1RWUA 4OV6A 1KOOA 4HI1A 3NEKA 3T9NA 5HQLA 4EBEA 4OX6A 1PC4A 1DRZA 2HZVA 4DCJB 2A18A 2OO4A 2DGUA 2B6AA 2BXJA 3CEDA 2CQBA 1WTBA 3OJSA 4I4BA 3F73A 4OYXA 3PKMA 1S6OA 1NKEA 1BE4A 1JLAB 3JSBA 2AQ4A 2J6SA 4CNYA 4TY8A 5H9FJ 4Q8FA 2DRAA 2MEWA 1SJFA 2VFSA 3MCMA 4CLSA 3KJFB 2FJVA 2VONA 2XLKA 1VRTA 5IT9U 1H74A 3RAQA 1U2CA 3EM1A 4XO0A 2JEIA 3K0JA 1Q5VA 2K8GA 3QSYB 1S7HA 3EVOA 3NCQA 3W5XA 2IPOB 1RT6A 2MZJA 5HP1A 2ZH4A 1JLEA 2E9ZA 2CQ2A 4PXEA 2OPPB 3JYTB 1IKWA 4YR3A 1X8DA 3GONA 3MR5A 2HHWA 1FA0A 1EKSA 1S6QA 3VCDA 4USWA 1NK0A 1IQZA 3MD1A 4GKJF 4AYBD 2W24A 2ZJQQ 1NDKA 4LF2A 3BBCA 1A7GE 1GAOA 5LOQA 1HBOA 4CO0A 5D77A 2CQPA 4ZK7M 5CCMA 3PW0A 3VGVA 7AT1B 2M52A 4ZJLA 2KG0A 5DETA 5KT2A 4LF5J 4X4TA 3Q8RB 2OPSB 2HFUA 2R2RA 2FLPA 3M1VA 4B3TJ 2UXCJ 4DPOA 2PIIA 2HIQA 5K9FA 1U7LA 5EHHA 4RW4A 5KAKA 1F5CA 1GMVA 2MLYA 3CWJA 3G82B 3M8ZA 1SBRA 2N4CA 2B4VA 4URSA 4X66J 4F26A 4DV0F 1NJIT 3NP5A 3QRQA 4DR6J 3BKTA 5HQ8A 4OI6A 2EBEA 1R0BG 3LW5C 2ZITA 2OSRA 1K1SA 3FRYA 3FUYA 4ZDNA 4F4ZA 2JOQA 4PXBA 4LFAJ 1YGYA 5LSOA 4Q0BA 4M5DA 3CD7A 3DDNA 2RRAA 5KTQA 3MTJA 2JEJA 3PR5B 2KYXA 1UW4A 1CULA 2CVIA 3PIOQ 4X66F 4NXMJ 2C22A 4AT1B 1UVMA 1FK9A 1HNVB 2ZH6A 4R5PA 2ZHAA 4P73A 2FUG9 2LQ5A 4DU7A 5ITHA 4B3MF 1IKWB 3K5OA 4DF4A 2RSQA 3DHXA 4ZPAA 5J2NB 3Q86A 4IFYA 2I5JB 1K0TA 4A8MP 3KNGA 3Q8VA 1P1LA 1WC1A 2D9PA 1XWLA 3ENWA 2V2ZA 1JJHA 2U1AA 3E3XA 3O1LA 1SI9A 3HI9A 2KI2A 1WC0A 4NI2A 4N7TA 3SQOP 5GAGU 2XLJA 1T9TA 2W9AA 4FNIA 1HMVB 4CO3A 1PJ6A 3T6BA 1N6QB 1ZYQA 1S6QB 2JWNA 3NS5A 4C6AA 3DLEA 1SKWA 3GZ7A 1HNXF 2DY9A 4QWAA 3P8BB 2OFHX 4RKUC 3S01A 1L3UA 1YZ6A 1N0UA 2MYFA 3FSYA 3BO3A 4FNHA 4KYZA 4CLUA 2MQPA 2F7VA 4O4GB 4DUZJ 4L76A 2DGWA 2AV5A 2O66A 2VDIA 2YTCA 3HHDA 4MK8A 1VBXA 4PPZA 2X1FA 3G96A 1YDLA 2R7OA 3KG0A 4B9TA 3PXGa 2DHSA 2UUCF 3KK1B 1JJCB 4HT5A 1HI1A 1FDBA 2VJUA 2WAQD 1UJ5A 8AT1B 3CMES 4H4OB 2N7CA 4OX8A 1T94A 1SC4B 2B4PA 2H9ZA 2EC0A 3GWCA 3S1TA 4K4SA 1B70B 1M5SA 5A8RB 5JJBA 1M5HA 5L9NA 4Z2XA 2E9TA 4X65J 4KBIA 1FE0A 2B8QA 1RHKB 1YJ7A 1S1UB 1RTZA 4NMLA 5SUHA 4QQBA 4C0OC 5ETKA 3PO4A 3HJFA 1DAXA 2MQMA 1C4AA 2P8IA 3ZNJ1 1K47A 2JLEA 4I67A 5ETQA 1HNVA 2Q6CA 4EGLA 4JYAJ 1S6UA 1FEHA 2YPZA 2G9OA 1RT4A 3H4DA 1CG2A 4RW7A 3EE3A 3CCUS 1D9FA 3CO0P 4JI8J 2R7UA 1WHXA 1IBCB 2G1DA 1TUWA 2P6TA 3GJRB 3KG4A 3FGVA 2QA2A 4P74A 4ZCMA 4LFAF 2WSCC 4KH1B 4KC5A 2LU1A 1PIEA 3TEHB 4DG1A 1IKYA 1IJEB 2RAQA 1MU2A 1SJQA 1HMVA 3HFKA 2LXUA 2FVCA 4OZ5A 2ZJRQ 1QD1A 2DITA 4DV5F 1N6QA 2K7KA 1YJUA 1F5BA 2OHDA 5CQGA 3OTCA 3LPYA 4M94A 1RTIB 4O3SA 3W5YA 2JFDA 4OHXA 3KMSA 4LIWA 2DNRA 2DH9A 4BBYA 3KHHA 1VQSA 1NDPA 2EEYA 3CIZA 1F9HA 4I6YA 3VHQA 1BQNB 2UP1A 5A0YA 3ILIA 2WRMA 2NLWA 2W2MP 2IIHA 3FC9A 4OI2A 4A8YA 2DNHA 2AJQA 3Q2SC 1KP6A 3TYTA 3C3LA 2IVMA 2OUGA 1RWXB 4RU9A 3SCJE 2P5VA 4KHMA 1QAYA 2CPIA 3PIPQ 2HWHA 2MSSA 3RRHA 2FJBB 4UOGA 3NCRA 1U0HB 2VV5A 3U7JA 3TANA 4FF3A 2FIUA 1HR0J 3I0RA 1FDAA 3BH7B 1RT1A 1VLOA 1ACMB 4LRFA 4H4OA 4M5LA 3JQKA 1E6VA 1W7WA 2FGOA 2HK3A 2IYIA 2WONB 4Z37A 2XYHB 4ZPDA 1H38A 2WTFA 1X31C 2OEJA 1QSYA 4X84A 4CI0B 4DL0C 4P52A 2CIMA 4ZLLA 4M5JA 1D8YA 3QAEA 1XMQF 3QZ8A 4W92B 3MR7A 3ZZTA 3A3NB 3DLGA 2DIVA 3M2RB 4O0NA 2NPIA 1X5SA 3N01A 2VPZB 3TARA 2QL7B 2Z57B 2BVZA 4Z7CA 1JMTA 3D1OA 1D09B 3RRGA 3EGZA 2HFVA 3C19A 3V6DB 4DI6A 3ZZRA 3G6ES 2HFNA 2LFVA 4DQRA 3CCQS 3T1YJ 1YJRA 2XMUA 4AL7A 5D8HB 4UY85 4OHYA 5CD4H 1LK7A 2B6AB 2QSWA 3LP0B 4KGKA 3WC0A 1MMNA 4WFZA 1VYAA 5CXTA 3KLIB 4NE9C 2OD6A 2CWKA 3IS9B 3TNVA 3NBPA 4Q7AA 3M2UA 3TP2A 5GAGI 1VQ9S 3VZIA 1ELOA 2GMJA 1UP1A 3ZZZA 1KVIA 3N28A 4DV1J 2XMVA 3AFGA 3PJXA 1IR2A 3W64A 5DDQC 4CNZA 1N36J 1NJZA 4YN3B 3E01B 4OX7A 3BYRA 1FRKA 3BO4A 3H20A 2POKA 1BGXT 3IP0A 3G86A 3DM2B 4DSJA 4C8LA 3UD3P 3TJ8A 2GVZA 5KFZA 4KKOA 1C2PA 1IKXB 1T05B 2LKZA 2RMLA 2EKNA 4DV4J 2NUUG 4J37A 5HQMA 1RWPB 4M5KA 4UZCA 3UVJB 2QGFB 1TKTA 3WC2A 2YX1A 4OZNA 1IUJA 2MZSA 2R7QA 2Y1RI 2BKOA 3DRPA 2DNGA 4I2QA 5AXLA 5LL6d 5KFSA 1UAWA 4CYUB 4A8KA 2QMWA 2UUTA 2XSJA 4YS2A 2ZNYA 2J5AA 3Q8QB 5THWA 2UU9F 3FKBA 3OTEA 2M88A 1WUUA 2G0JA 2R3VA 3PX4A 2GMHA 2UVWA 2CA9A 3GYNA 1IR1A 1RA6A 1UFKA 4Y65A 2I9SA 3MECA 3NGSA 4AXIA 3OTOF 1AXQA 1NH8A 3TX0A 5J2PB 1FD2A 1NK4A 2CQCA 2EI5A 3N79A 1X0FA 4GC7A 1S10A 1RBLA 1J5EJ 4TY8B 1M5OC 2MKSA 2W8KA 4HYKA 3K5PA 1YI2S 5L1LA 4QIWD 4E8UA 2M3DA 2RVJA 2WVFA 4ECVA 1PILA 4ES1A 1R6YA 2VQEJ 1FJCA 5D0HA 2UVRA 3CCJS 3A3OB 2AJ1A 2D69A 1HNWJ 1FX2A 2I2YA 3R6LB 4E0DA 4MK7A 2ZZNA 1JLGB 4DPWA 2R7XA 2VA3A 3DMJB 4C8OA 3OT9A 2XYGB 4QR1A 1RTHA 1EB0A 1LWFB 3HPOA 1J5EF 4USKA 1VFJA 1HNZF 3ADAC 1NLKL 4IUFA 2QLXA 2YKMB 2YKOA 2VODA 1VBKA 3CB4A 4ECUA 4WXOA 1T0TV 3R1LA 1R0AA 4JI6F 2BV3A 5MAOA 1VCTA 2BJ7A 3D66A 2ZHBA 4DV3F 1EARA 4EZ9A 3JTOA 3GFZA 2FVPA 2C2OB 1JJ2R 4P7VA 3RR8A 3D67A 4J9MA 1LW2B 3MHYA 4WE1B 1YIJS 2R4FA 3EWGA 4IFVB 4GC6A 2CJKA 4LR8A 4U9RA 4MT1A 3HSDA 1TUGB 3TO8A 3P4UB 4X62F 1FD8A 2G2ZA 4RZRA 3DGPA 4NLSA 1R8HA 5L1JA 2R8GA 4GO5X 2V4JA 3VAIA 5ETTA 1Q8IA 1SJ3P 4NCGB 3M8QB 4OIXA 2VA2A 4F2RA 3BSOA 3QT6A 3M8SA 2XMAA 2WB1D 2AJ2A 1DTQB 3NS6A 2NS1B 3NKYA 4CLFA 1YBAA 1XC9A 4MKYA 4DV1F 3UCZP 1CJUA 3R1HA 1TELA 2LQJA 3C8YA 4I56A 3D0GE 4YB1P 2IJNA 3OL7A 2VKRA 3CJTA 3MM5A 3CCRS 2E1RA 3IR7B 2RILA 2XY7A 3CD5A 2QX0A 1B4SA 5A76A 4ZCLA 1VQ8S 5D4LA 1RT3B 1RHQB 1Q1KA 1U8SA 1S9EB 2LEPA 2YKAA 2IAJA 3IWXA 4GMKA 2KVQE 4WFXA 2MQ8A 4QCLA 4PG7A 4YHHJ 3SCKE 3R5DA 3TAMA 1TVRA 2HHSA 1Q4RA 3PYFA 4ZCKA 1T95A 3R27A 4I6AA 5CZVA 4F4AA 1FXDA 4F4YA 3ZC4A 2H4WB 1VLYA 4ZLPA 6AT1B 2EG2A 3NG8A 4L6V3 3FSXA 5M2RA 5GAEI 1ZM3A 3K57A 3IRXB 3MM6A 5KFTA 2HNYA 5HANA 4CLZA 3SFGA 2QLWA 2IM0A 4IDKB 3T3FA 3TQ1A 2DRDA 1VC0A 2IA6A 1DBDA 3PO5A 4PUOB 3ISNC 4WPAA 2F4VJ 4KH0B 3K58A 1RHMB 1K0VA 4QBUA 3C14B 1YRUA 3ZXWA 5HVHA 2W4PA 4B3MJ 1YKWA 3BPSP 4PUOA 1FTCA 4PWWA 2LA6A 3EZOA 1T9WA 1PYOB 2C2MB 3MEKA 1HPZB 4OYMA 1S6PB 1Q78A 3FDSA 5HATA 4FYXB 5IZHA 1OY8A 3W9IA 2OPRA 2M0GB 3SZ2A 4EYHB 4XAKA 1Z1ZA 5D4OA 3CUNA 4PQUA 5LMNJ 1VRQC 1WELA 1Z2LA 1UTAA 2B9WA 4ZIVA 2I38A 1S1XA 4USVA 4EU0A 2KXNB 3V4IB 1NU4A 3A12A 3QYYA 2AW0A 3VGTA 1OSCA 4ALZA 2ASJA 1JLFB 2ZKTA 2FJAB 3DN9A 4WP8A 5KFEA 2AGQA 4DV7F 2IMOA 1JX4A 3W7BA 1SUQB 4HLBA 1EKRA 3I87A 3VAHA 3BREA 1S76D 2R7TA 1OYEA 5CYMB 3EZ5A 1GXUA 1XEZA 3UN3A 3I56S 3ETMA 4MFBA 3R2DJ 1I5OB 4B3RJ 1RTHB 4UUWA 1ZTTA 1RBOB 4IG3A 2OAUA 1NPPA 2BKPA 1VQ7S 2HHQA 2PC6A 2YXLA 2AJFE 4IRCA 1HKAA 2EK6A 2IA0A 1F5AA 2OFGX 2PT0A 4K59A 4M8LA 3THTA 5C2CA 4TQRA 1SB6A 2RDJA 2E9RX 1KN6A 1RAFB 2KDOA 4A48A 3MM6B 1TK0A 2V8PA 2RD5C 2LVWA 5H9FK 4QIFA 3OXFA 2DNLA 5IQ6A 3H2UB 4LF9F 4EBDA 4F3OA 1WEZA 2HS3A 2PEHA 1F2HA 3G9CA 3AJDA 1U2FA 1IBKJ 3UCUP 2PD1A 3MOZA 4X4NA 1M5PC 2U2FA 4ZIWA 2JLGA 1K8AT 2LMIA 2ZEJA 2JRSA 3BDEA 2H5IB 4PWUA 2XQCA 3ISZA 3IM8A 2WHOA 4O23A 4RU2A 2WW8A 1TKZB 2LCWA 5G0RB 3K5MA 1NH7A 2KFNA 3W2WA 2Y9HA 1TAUA 2AX0A 4UTGA 3BR9A 4O4RA 1VJQA 2Q3PA 1XMOF 5H9EK 4N8OA 3AXMA 1PJ5A 2AX1A 4ZP6A 1RI7A 2EW9A 1VRUB 4KKOB 2DGXA 2P9EA 1NK5A 1GNKA 1XBWA 2ALYB 2GHWA 1T03B 4LQ3A 2GFFA 2ZC4A 5GMDA 2ZH1A 4DLGA 4NLWA 4I2PA 3VAJA 4NLQA 3FCWA 2QEXS 1P9QC 4R8UB 1NPRA 1YITS 1MN9A 1MWYA 1RU2A 4DV2J 3JAMY 2ZBCA 5H9EJ 2V2QA 2XEXA 1BLUA 1LWEA 3JS9A 3MAAB 3BQ1A 1L3KA 4DPYA 1S0OA 4X4VA 4ED5A 4OYPA 4YP3A 3NBPB 3TA0A 1U47A 4DR3J 4TN2A 3R6GB 4B9NA 2E5LJ 1KVKA 5SZTA 2V8DA 2J9EA 1GTEA 4NCGA 3F44A 5F0UA 4FBUA 2GVDB 4PRFA 1NDLA 1MU2B 3SFUA 3MDFA 2M7SA 3QGGA 2FZGB 2D3O1 3AJ1A 4A4JA 1ZBTA 1H7XA 2A6MA 3MEEB 2ZC3A 2OEMA 3IM9A 5DRKA 4NRUA 3TVYA 1P9YA 5AE1A 1NK7A 4LF4F 3LGNA 2PMHA 3MM9B 3M2VA 4ZJQA 4JI4J 5I4MA 4DHVA 4DR7F 2SXLA 3DRYA 5B0GA 2DGQA 2WW4A 5DDPC 2ZH9A 4ATNA 3PX6A 2YKNA 3M2VB 3C2PA 3QZ7A 1RCXB 3G8TA 4ZS6A 2BE2A 3CCZA 2WK4A 3PDNA 2X1GA 3OLBA 4MMOA 5F8HA 5AXMA 3FBFA 3I0SB 2MMYA 4EK2A 5C25B 2IM1A 1HARA 3AD8C 3EDQB 3PJWA 2V8GA 3CTRA 3EX7B 4J9VA 2ZH2A 3G8SA 1Q86T 4IDKA 4DR4F 2HQFA 1HNIB 1M1HA 4F04B 5B0DA 4N8NA 2DGTA 4KSEB 4DCOB 1RACB 4J91A 3T5KA 3MD3A 2HVIA 3DDKA 4DFKA 3GV5B 2HVHA 3KK3B 2YH1A 2EFVA 1HQUB 2OMLA 3CCWA 1QDUB 1JK9B 3SEOA 5BYSA 2DR9A 2HQGA 2WSEC 1Y3JA 4BC9A 4DN9A 2CJBA 1HQUA 1X4CA 2BRLA 4ZJOA 3RBZA 4R8UA 2XCAA 4NXNJ 1RUSA 1FCAA 2QMUB 2FJXA 4FPRA 3IBCB 1S7IA 4JI1J 3GLJA 4ZN3A 5L9XA 2I0XA 5KFRA 1KVJA 3KTQA 3J80U 4DSLA 4OHZA 3M30B 4UQGA 3BSNA 3NL0A 1JLBA 2JFKA 3KLIA 4DX8H 1RAGB 4C8YA 2VQEF 1LW2A 2YNFB 1B0TA 2HZCA 4LBHA 5LMUF 1CC7A 2NXEA 1XNRF 5ETOA 4P9SA 4MFBB 2OTJS 3SQGB 1JB0C 1X7VA 4NMXA 1KHVA 2B9YA 2N82B 4TNOA 4ILRA 3KXDA 5C24B 3OUYB 4JYAF 3L7PA 3HZEA 4F3QA 5DQHA 4FS1A 1IM4A 1D8ZA 2GS8A 3D3BJ 3MM9A 1FFWB 4FXWA 1S9GA 5EUHA 4HH0A 4Q5VA 1F9EB 2JHEA 5AE3A 1HQEB 5F8LA 1B64A 1S79A 1SH3A 3DU6A 3MM7B 3AQPA 5KFXA 2E5LF 1YVFA 3EXYA 1U1QA 4OFZA 3PFOA 3JSMB 5E3AA 5IM0A 3D0IE 1K1QA 1PCAA 2V6AA 4I2QB 3D68A 4ICLB 4RX6A 4DV5J 2DPIA 3D9BA 1V3ZA 2BJDA 3GJSB 4ES3A 8ATCB 3JTNA 4O3OA 2FC8A 4J9PA 1ITPA 1A9NB 2HEKA 4HI2A 4XTTA 4Y2MA 4GKKF 4BC7A 3WX8A 2RT3A 4M63A 2KZZA 2KHDA 3HD2A 1O0PA 4U7UD 1WSRA 3M8YA 1HWKA 2E1AA 1FXLA 2HHXA 3CF5Q 3J7AN 2ZHOA 3H98A 2A2CA 5LJ5Y 4CLLA 3I82A 3KKFA 3T1HJ 4Q8EA 4ZP7A 3DOLA 2E44A 2J7UA 5K20B 3VGSA 3HKZD 2X3GA 1IBMF 5GAEU 3PY8A 3C15B 3JQJA 4ZMMA 3WX4A 1UPPA 3I9V9 1JLBB 1JXEA 1OPZA 3MR6A 3RR7A 4DN0A 3MM8B 2NZCA 2RIJA 1G6BA 2CKWA 5IC6B 4EO8A 2AGOA 2CNLB 1VMBA 2XZTB 2JEFA 4YHHF 2ZBPA 1MROB 2D41A 2CPEA 4I64A 2H4YB 5JVHQ 2IY5B 4URQU 3QFHA 1TFWA 1FRXA 1ZPWX 3CCMS 4DV7J 1N4LA 3HVTB 2PMWA 4QPXA 1VQMS 5ETNA 2QFIA 3B82A 3OVBA 4O3RA 3GQCA 3LP1A 1YQHA 5KG5A 3LAKA 4AQYF 2ABYA 2HMIB 1RT3A 5HO4A 3NMRA 1QLNA 2UXBJ 1S9FA 3ENQA 3IS9A 1PSDA 1T02A 2ROPA 3FZ2A 3MMBB 4U67Q 2ZM6J 1RYSA 3LP1B 4OJ1A 4J9RA 2ZD1A 3Q89A 3K7RA 5IOLA 3US5A 1U1LA 5GADU 2OTLS 2MXYA 1S4EA 1S4FA 3ILJA 4OI1A 5HMYA 2R8HA 5D4PA 2AYMA 3RJMB 2D7SA 3I5CA 3MR2A 4M5DB 4IQXA 2K2PA 2RKIB 4ANDA 2FGCA 2VOOA 4YOEA 5JXSA 2K1RB 2M4MA 3QT7A 4QWEA 2B56A 1C1CB 3AOCA 4DS4A 3W61A 1URNA 1RAIB 4Y00A 3MUMP 2HNDA 3HFVA 2IVYA 1AUDA 3EZUA 1KLMB 2YKNB 2VG6A 3J7Z5 2BW2A 3SBMA 2J9DA 1PYTA 2FDNA 4LSZB 4QWBA 5IS2A 4NLDA 3R5GA 4CLTA 4V1Ak 3I9ZA 3HDSA 5EWEA 2HHHF 1U1NA 4C7QA 1Q81T 3U27A 4CH0S 2LQBA 3BS9A 2CPZA 3QMQA 4LSLB 1TKXB 2CQ1A 2RUSA 2V50A 3Q83A 3OUYA 3V4IA 4LF9J 3UR0A 1R0CB 4OZJA 1X4BA 3O3LA 3SIPB 3HT3A 2XMTA 3PNIA 2B5JB 4YY3F 1VHFA 2GX8A 5KFFA 4ED7A 2AZ1A 4EZ6A 1UWAA 2HVDA 5KFWA 4NYOA 2F8HA 4P2SA 3ETOA 3IR5B 2KFZA 4GVBA 4I6WA 2KL8A 2FHMA 3AD7C 3N0VA 3CGIA 3TJ9A 5HMXA 5I42A 1ROFA 1WC6A 4HR2A 3C14A 1VK8A 2OEKA 3DLLQ 1C0UB 3LP2B 4WYLA 1HHTP 2J0SD 3N5FA 4G1IA 1LFPA 1HPZA 1OQ6A 2HSEB 1R27B 3CCTA 1NCLA 1U25A 1LWFA 1V5VA 4K4XA 3GIKA 2HPUA 3FEZA 3ZTSA 1HW9A 3DGPB 3KLFB 3K59A 3B4DA 1SH2A 4Q43A 2Y1JA 3MFIA 4W4MA 3TEGA 3MZIA 1VJWA 2JC1A 2BQ3A 2E29A 3POTB 4FN5A 2JVOA 4J9KA 2BQRA 2AEJA 3C15A 1Q8KA 2WVEA 4LF8J 1RBAA 2RKIA 3C6UA 1TUVA 4RUHA 2KYZA 3KOAA 4PYDA 2RDIA 5E3CA 1HNIA 2BW7A 1CQMA 3UVJA 1L3VA 4JV2A 4OX9J 2NSCA 3L09A 2WOMA 2B9XA 2KG1A 3GIJA 2KRRA 1JLEB 4U8VA 4LVOP 2VU5A 1Z4UA 2CQDA 3VQTA 2B0GA 2G0IA 2G2YA 2XY6A 2ZDOA 5CA5A 2IDEA 4DOZA 3RBXA 1YX2A 2GV1A 2WOMB 1IKVB 4RWWA 2COLA 3DDIA 5A8WA 5J2QB 1R8BA 1YBUA 2EFQA 2QC3A 2VUGA 2KRBA 3IAS9 4DZ6A 3RRKA 2X1AA 1RWOB 3VF0B 2PN6A 2YQ0A 2CWXA 4DQQA 3UD5A 1KBRA 2XNQA 1O6XA 5BYQA 2VFRA 4HT7A 1AT1B 4K2XA 4DQIA 1LWEB 1OJ4A 2DNYA 3ONQA 5K8PA 1Y7PA 4DMZA 5EWFA 4LJMA 1RYRA 1VQPS 3UD4P 4OZ0A 3ZO7A 4WFNQ 2AGPA 3PYDA 4KY3A 2A6OA 3OR2A 4CO5A 3IRXA 2VASA 5DLGA 5AJ3F 3BGLA 5B0AA 3NGDA 4F8RA 1Q5YA 1R3NA 3GFHA 1C0UA 2IRYA 1RXOB 1Y5NB 2J9DE 3BGOP 3M2UB 4DUYF 4C9DA 2AD9A 1AFJA 1WG4A 3FBCA 3OHBA 3BSCA 4R0JA 4ZVQB 1XN9A 2MSTA 2DKOB 2NQPA 1SKSA 2CQ4A 3DOKA 3HVTA 3QIPB 4ID5B 2HFSA 4DFMA 2MZQA 2ASLA 2UXDF 2ZH7A 1W25A 4K4UA 5LM7E 3RG6A 1IVZA 2AEFA 3ITHB 2RS2A 4PWDB 1S6PA 4NCAA 1U26A 1X0PA 2ZWOA 2V4QA 2HQCA 1SIWB 1U09A 4DJBA 5F3ZA 5KT3A 3PR4A 2HYIB 2YVSA 1RT1B 4DL4A 1JLAA 1OWXA 4M5NA 3AA9A 3AB2B 2QIFA 3KG1A 1F9FA 4KAIA 2BA9A 4LRCA 3TOQA 2ROEA 3DRXA 4YR0A 2W9BA 1G2EA 1TL1B 2RJZA 1CC8A 2FHKA 2I1RA 5G4DA 4NLGA 1KSPA 4TLRA 4DR5J 1YJ9S 4IKAA 3BV8A 2F1FA 2OGUA 2AYBA 1WDDA 2KO1A 4KO0B 1SL1A 2IMWP 1QSLA 1N33F 3W60A 2QV6A 2HNDB 2CG8A 1Q79A 3DLEB 2EPIA 5KFQA 2BANB 3A13A 2HHHJ 4LF6J 1LWXA 4RW8A 2LQ9A 2RF2A 4EMDA 3BN4A 1CJVB 5KFKA 4RW6A 4K4WA 4JI8F 4ED8A 1HYSB 3NWRA 2HHTA 3LOUA 1WC3A 2GIFA 3MFHA 2XI2A 4OQJA 2C2RA 3BJYA 4DR5F 3H59A 4FXVA 3TUJC 5HN0A 5B0BA 2NZ4A 1RISA 1R6VA 3G8QA 4B3RF 1IJFB 2CPDA 3SSSA 1RP5A 3QLHA 2CPHA 5BR8J 2KH9A 1MWZA 3BR8A 4CH7A 2YPYA 5K14A 1ZZNA 4B3TF 4ZPCA 4IO1A 2XCPA 2HW3A 2O5DA 4BCAA 3SDEA 2R2SA 2XMWA 5J1PA 3HVRA 4MK9A 2XHWA 1I51B 4OLPA 3SV3A 3PHTA 4PQUB 3QPIA 4NLTA 2ERRA 4ES2A 4N56A 2QA4S 2CQIA 3G4SS 1QAIA 4X4RA 4DLEA 1T9UA 2CYYA 4JV0A 5KG2A 1HFEL 3OTBA 2DNMA 3MMJA 5GAHI 2NXNA 3DRRA 5IV3A 2ZUGA 2MGZA 2BJ1A 4IG0A 5HAOA 4GO7X 1X9SA 5J2QA 2DPJA 1BQNA 4XIUA 3MAAA 3UO0A 4USMA 2R8KA 1X60A 1FKOB 4RBVA 2ADCA 4DSIA 2QLFB 4GKKJ 2ZE2B 2DB1A 2KKHA 3G87A 1UA0A 3TX8A 2Z0GA 4OV1A 2LDIA 4QZVB 5IXUA 4DV6J 2DYAA 3J81U 3MMCB 1WDTA 4P2XA 3M32B 4DXLA 3IBFB 1U6ZA 2RH3A 2KN4A 5B7WA 3NRBA 5E0OA 1XMOJ 3NCPA 1HWLA 2Y0BB 2C2NA 4DR1J 2ZOMA 2ZOGA 1RT5B 3HULA 3IFEA 1KTQA 3PRDA 4QIEA 3CC4S 3TQEA 1HBOB 3GSDA 4UOHA 4Y3CA 2V69A 2FLNA 1QTNB 3W8GA 1WI8A 3OFHA 3T6JA 4ETZA 3TUZC 2EG1A 3PTWA 4WIIA 3VV2B 5LSLA 4NASA 2Q66A 2BANA 4X64J 3DLKA 3ZTPA 3VAFA 2C2DA 4JV5F 5D78A 2C3PA 4CZCA 1VIXA 1CQNA 1AFIA 2H65B 2VC0A 5DO2A 4A47A 1EQMA 4Q2LA 3W66A 1L5UA 4PKDB 4IR9A 3D5MA 1HQEA 1S0NA 3AQOA 2CJAA 4DQPA 2H1YA 3RAXA 4YUDA 2XWYA 1U1OA 3CMAS 1PKUA 2KJWA 2HGLA 2XSJB 3GE9A 1FTRA 2A10A 3BYPA 3EDRB 3IG1B 3IGNA 3LP2A 3DCAA 4ID8A 4L72B 4QIGA 5KFVA 4DL5A 1FRLA 2QO3A 4NOHA 5C5JA 1H6KX 3VTIA 4H4MA 4LF5F 2QE5A 2BKNA 2MGZB 4CTAA 2ILZA 5E2QA 4NLOA 2CPJA 4LBPA 3VGUA 1P27B 1DQ8A 4PABA 2R2TA 1KOHA 5KFOA 3HHEA 2KT3A 2OI2A 4DR7J 1Y9OA 1RE1B 1FRMA 4C0BA 2ZH5A 1A0OB 3E01A 3OHAA 4B9MA 5HVGA 4XPEA 2YQ1A 4Q0BB 3NGKA 3OXGA 2ZD1B 2HIYA 1WI6A 2PI5A 4QYZJ 3M32A 3M8PA 3IRWP 1RK8A 1R8AA 3PW5A 1JLQA 1FFSB 1H72C 2DGOA 3I32A 3KUHA 5F9LA 2CVEA 1NKCA 3BGRB 3NOCA 3HT0A 4HTJA 4CDIA 4K5RA 5DG9A 4U6PA 1X9WA 1RAAB 2A0FB 4NCBA 2CFXA 3E51A 2W01A 3IWLA 2L41A 3GYGA 3VAGA 1U1PA 2YWHA 3TAQA 2PFFB 1DURA 1JLCB 2ASYA 3VZHA 2X7IA 3CDAA 3THVA 3M6WA 1VDHA 5C42B 2NREA 3QAUA 4WF9Q 1K9MT 3CSKA 2H54B 4NL5A 4EO6A 1GXTA 1IBLJ 3MXHP 2AF6A 1HI8A 1RKJA 3HK2A 5DDOC 2IBKA 1Q95G 4OYBA 1ZPVA 5J2MA 4JI5J 5AXKA 1X4AA 4RW4B 2DHXA 2MQLA 3IG1A 2GHPA 1VGYA 4WYWA 3MMBA 1WF0A 1WG1A 3TUIC 5CZXA 1UFWA 2B4UA 1W26A 3GJTB 1F2GA 4Y2KA 3PZPA 2ATLA 3KK2A 4QR2A 1FJGJ 2OLWA 5E3PA 3ZTQA 1FO1A 1JJ4A 2GQ2A 5E41A 1U1KA 5T7LB 2NXUA 2GIQA 5EDWA 1IWAA 1S1TB 4RLEA 4YB5A 5LMUJ 2GW8A 2M2BA 3ZZPA 4OYAA 4KR0B 4UF4A 2R7RA 3JTPA 4CO4A 5K8OA 4YQWA 2MKCA 2HNZB 4J9QA 3QIPA 2UXBF 3KLGA 4C8NA 1KNZA 2AJ4A 5KFGA 3S8SA 1RT5A 5IM0B 1KQSR 3I5BA 1QVFR 3OR1A 1HIYA 1H3DA 1R43A 2MTLA 1HD0A 1NSKL 3G71S 4IO9Q 2Y1IA 1CLFA 3K8VA 2O01C 1FWKA 1QY7A 2RS8A 5HSPA 5J2PA 2VDHA 1BC6A 4UUXA 2YWFA 4X4QA 4BHQA 1NJYA 2O1PA 4DDFA 1GMWA 1RAOA 2CXEA 3A8IA 1AYEA 3MGJA 5T41A 5F41A 2CNNB 3S7RA 4PCQA 2W9BB 2DR6A 3TZXA 1RKIA 4K5SA 1TKDA 3HHLC 3CCES 4M95A 4IG0B 4NLYA 1TL5A 2F8EX 4OYIA 3KJNB 3TZYA 1T03A 1N5YB 1CJTA 2JH3A 1J2VA 2CZ9A 3LO3A 3NAHA 3MTKA 2EWHA 2EVZA 1JLGA 2Z4PA 2RNEA 3NGRA 1X9MA 1FWLA 1KS2A 1V5IB 2Y8WA 4X4SA 2GQQA 2E5HA 1QVGR 2F65A 3V81A 4HACB 1NO8A 3FQKA 2DNZA 1PAUB 2OPRB 3CDUA 4IRKA 2JC0A 3FJ2A 4NA2A 1DFDA 4CIOA 1TMJA 2FY8A 4ECSA 4ED0A 5FLXU 4JI2J 4O3PA 2UUAJ 2VBYA 1N48A 5FJ4A 4ZHRB 4M5MA 4ELTA 3I31A 2OPSA 1LKZA 1RHRB 1VRTB 4DFJA 3QATA 1WWHA 1XR6A 4K50A 4FVCA 4YFUA 3ET6A 2HQDA 4QW9A 3GIRA 1UJ4A 2UV8G 3GU0A 3K2YA 4NWBA 2XI3A 4DV0J 2C28A 1QJHA 4ED6A 5ETSA 1Y5IB 4OYOA 4YY3J 1HA1A 2V4JB 2CPYA 2VPWB 2VD3A 2H5JB 4RUCA 4OI0A 2EFPA 4MIWA 3WBZA 1S59A 1XIQA 5T7LA 4HDHA 4LR7A 3P6YC 1CS4B 3KJQB 3MPWA 4CM0A 2XG8A 1E6YA 2BZ2A 4JP8A 2V0NA 3N6MA 3L7UA 3GILA 1XTZA 1HWIA 3GR1A 2HNZA 3L95X 4JUZA 4JI5F 2E5IA 1U02A 2BE2B 4QIVA 2FHOB 3LA0A 5HVFA 2JSXA 3MR3A 1UVIA 3A8EA 1BHNA 2ZBIA 2V4RA 1HR0F 1SH0A 1RTDA 1AW0A 4G1QB 1BQXA 2QN6B 3GSIA 4L74A 4USJC 2HRTA 3SCLE 3QIDA 1IR0A 2HLTA 4NX9A 1RADB 4ZOSA 2HBZB 5M2PA 3UDLA 3AD9C 4R25A 1WEYA 5LSRA 1DY3A 1U0SA 1KWMA 1SJRA 1Y00A 1UVLA 3O2IA 2JZ5A 1RTDB 3TUPA 1VK3A 2LXIA 2WB4A 2VL1A 2VHGA 3R8YA 1I94F 2ACMA 4LF1A 4FPIA 4L3KA 4UQTA 2FVQA 1RT4B 2ATCB 2KB2A 4DL2A 2B51A 3BDPA 1ZAWA 4P71A 4ECXA 3F41A 3KUGA 1Q7LB 1RT2A 3ZZUA 4OJHA 3THPA 1XQIA 1PO6A 3QO9B 5HJYA 3CJ0A 5F9NA 3KMQA 1VHIA 5L8RC 4P2FA 5DQGA 4CM2A 4ZP9A 1CJKB 1UFLA 4RW9A 5ETLA 5B09A 2MQQA 4OJGA 3L7OA 3GIMA 5B0EA 2YWGA 4RNHA 5L46A 2WVBA 3T1YF 1GXLA 2VBZA 3OR1B 2EFGA 1AA1B 2E7XA 2HQ3A 1SKUB 4TLQA 1WEXA 3UW1A 4K4YA 4NPOA 5E7OB 1SVDA 1MW7A 2CJQA 1RA7A 2DJWA 2RU3A 2ASDA 4A8FA 4IOAQ 1F0XA 1X4EA 2N7YA 1BXNA 2HHPA 2HS0A 2BJ3A 3HM9A 2VJVA 3M6XA 1WORA 2VFTA 1TL3A 1I6JA 3GPAA 1LXNA 2WBMA 3L9ZA 7FDRA 3RYLA 3FEYB 1IKXA 3TRGA 1T3OA 3GIIA 1T05A 2QLJB 5C7PA 3QJLA 2M8HA 4ZLJA 3OSNA 2ZBRA 4B3SF 4WKRA 4ED1A 2KVIA 3MEDB 4N41A 4KFBA 5DGBA 4X65F 4PR6A 4Q2MA 2KHCA 2QL5B 3MUVP 1OSDA 3MMAB 2CUYA 4WK1A 1N32F 3W9HA 1AZSB 5CYJA 2H48B 2WONA 4KO0A 1REGX 4LFBF 2HRYA 2E7WA 2DEIA 3AH6A 3IGVA 2JNJA 4FKYA 1DHMA 3MMAA 4G1QA 2VICA 4V19X 3N9UC 3DGVA 2F9DA 2YNHB 4WFYA 2RF2B 2BDPA 2YNFA 3HVAA 1FRJA 1H2TZ 2YNIA 2PFDA 4H54A 4XPCA 1VQKS 1Q7YT 1F3VA 1XR5A 2HQIA 4LRAA 4WTYA 1WNEA 2ZNZA 3M30A 1EHWA 2LP4A 2J7KA 3W8PA 1QM9A 4BS2A 4ECRA 4UW2A 5EX3A 4OZ1A 3OBIA 1J27A 3BM7A 3SXLA 9ATCB 4LRBA 2A2DA 5CH7B 4CT9A 1S72S 2E5GA 4GRSA 1S0MA 1UEKA 2MLXA 1CPZA 1NSAA 3SDEB 1TP7A 3ENAA 2EBGA 1P8GA 2CNOB 4KRWA 3RB4A 1GT8A 1WG5A 1KQKA 3SV4A 4K4ZA 3J7YI 2QJ3A 4FF4A 2YWKA 2F3JA 4QWCA 2ILYA 3DLKB 2HBYB 2RB7A 4L3NA 4LFCF 3CJRA 5KOXA 3MAHA 1LXJA 3IR6B 1FKAF 2JJ4D 3UPFA 2W1BA 5IWAF 2R7SA 2IFXA 3A4TA 4ZKAA 2J0WA 1KKHA 3KLEB 2YX4A 1M0SA 3FMBA 1SJ1A 4X4OA 1UEVA 1GK8A 4DSFA 2GZOA 4USTA 4URGA 4LVNP 4KHPJ 4N76A 3TZZA 4CCHA 1UW9A 5AXNA 1GQEA 4F4XA 2JVRA 1I1GA 5FDLB 2BX6A 5C42A 1RAJA 3MMCA 2AHOB 4H4MB 3DOLB 4WKYA 2EKYA 2FZKB 4I7FA 5J2NA 5KFAA 4ENOA 2D3UA 2EFOA 4ZVFA 3CCVS 1XMBA 2FJEB 4RBTA 4ZPTR 5B08A 1LK5A 1FEEA 3MF5A 3C16A 2EXUA 2QT7A 4HHHA 3LALA 1BWVA 2XWXA 4ED4A 2HAIA 2PGCA 4TXSA 4ZVOB 3WQPA 1DLOA 4ETXA 5I3UB 3QRRA 3HF5A 3HSGA 1WHVA 3FK4A 3O6QA 3X3UA 2VQFJ 1N5YA 1N5QA 1GMWD 2GIRA 2CQ3A 3PJ9A 5CYQB 2Z2LA 3R97A 1HNZJ 4GKJJ 3AB4B 3UN2A 1Y3KA 4BLGA 4RW8B 1RLCL 1Y4ZB 4ZPBA 4LSLA 4FYWB 1TFYA 1GX5A 1PBUA 3MEGA 2Z8QA 5KT7A 2ZVSA 2VG5B 5CAAA 3KHLA 4BWJA 3IN5A 5IQQA 2GQCA 5K5MA 5L1KA 3SYZA 2VBWA 2G4BA 1RHJB 4OZ3A 1IWGA 3ITHA 3EVMA 3GV8B 1C0TA 3M8QA 2XS7A 4KHRA 5F3TA 1NHKL 5FIIA 2JDJA 4O0IA 1NBEB 1UMJA 4NZ0A 4LQ9A 4C3LA 1FESA 3W5ZA 1FNMA 1UVNA 3OV7A 3DC2A 4FYDA 4DEZA 2ACYA 3V6DA 1SPBP 3Q8PB 4AL5A 4F25A 3TAPA 3TR5A 4LRDA 4PWDA 2G0CA 3UI3A 5DQIA 1SJ4P 2ADBA 2DXEA 4J5OA 2DEJA 2FZCB 4Y34A 4N47A 5HMWA 3BO2A 2QLBB 3CPWR 1T9XA 5LMNF 2FTRA 2B8PA 4IH6A 5A2QY 1G4CA 1T9VA 2W25A 1FKOA 4OJ3A 4DV2F 3CMQA 3DOMB 3GB0A 1HBUA 4LSNA 4I7FB 4UOCA 2R8IA 4LREA 1BY9A 2V94A 3TWZA 2W9CA 3MURP 2BBEA 4DR3F 3V5RA 3EPGA 3N6LA 3HD1A 4C8KA 3FVYA 3HHKA 1RCOB 1J5OB 1IBMJ 1TTHB 2OP5A 1NJWA 2V9WA 4KJIA 1WHYA 3ZTRA 3G6YA 1FJ7A 3ZFVA 4J7CA 4KTQA 1FXRA 4D3HA 4F3MA 1WC4A 2F4VF 5KOWA 3I96A 3GV7B 1O51A 4ZA1A 3UN5A 1JKHB 4DL3A 1XNQJ 5GVQA 2DXDA 3LTOA 3D2WA 2FY1A 3BBBA 3BGFA 3Q8YA 2HKEA 4OYWA 5ETVA 4F36A 3AAWB 4NEYA 1OY9A 1S9GB 3BH6B 3ULHA 4RNOA 4QOTA 3OLAA 3KK1A 2HGMA 4WP3A 4P75A 4PXCA 1FVSA 2ZJPQ 3KHRA 4C2MA 2VB6A 4DQSA 3H42A 3OXLA 4ZVGA 4OMFG 5DGAA 2UVVA 4YR2A 1GEHA 5K14B 4EWTA 1Y10A 1IXKA 2QG9B 5K8NA 2MPUA 4R0EA 1DQ9A 1RHUB 2VG7A 1H98A 4KGZB 4TKTA 2PMZD 3CJ4A 2H5EA 5KT5A 3J80Y 2VQFF 1K44A 1VI7A 1YRTA 1XR7A 1MG7A 3UNGC 2CZ4A 2KXHA 2UVUA 3FSIA 3MPUB 3PRVA 4DF8A 1TV6B 1NKBA 1RAHB 1M90T 2LLZA 3D28A 1RT6B 2ZZTA 2CJ9A 3TJAA 2BUNA 1N8RT 3CJKA 3F0NA 3UWTA 4JI3J 3KDNA 3DI6A 3NXZA 3B4MA 2OD4A 4A8XA 2L48A 3PYGA 4U7CA 3QFWA 1CBKA 1NAQA 4M5HA 1YJTA 3Q24A 3OFEA 4DL7A 5I42B 3KJVA 2K7JA 2NCKL 2W2NP 1AZSA 2NYIA 3CVKA 3DRSA 3DI6B 4YEAA 4QPTA 1YJVA 2IC3B 3TW0A 4WU2A 2W8LA 4WIQA 3UR3C 3I5AA 2DIUA 3NWGA 5D3GB 1CVJA 1TL1A 2FQQB 5ADZA 1MROA 3R5CA 3ZZ0A 1IM6A 3I4HX 3PYEA 2LQ8A 3P5BP 4HACA 2MQOA 2W7AA 3V81B 3OPKA 1HBNA 2MKYA 4MKAA 3FFIA 4FBTA 4S0MA 2YH0A 3RW6A 3H5YA 5DM7Q 3HHLB 1J5OA 2G1HA 3NNHA 2IRXA 1MWQA 3R2CJ 1HBMB 1AUSL 3AXKA 3LUYA 4OX9F 4A8OA 5KFJA 3EYZA 3EGVA 3OR2B 5KG6A 2R2UA 1M1GA 2HVZA 2L08A 4USHA 3K17A 3GCWP 1KEKA 5RUBA 1Q53A 1RTJB 5CD4A 2WZ1A 5AJ3J 2FB0A 2MKKA 4OL8A 4U7UK 2H3EB 1SCJB 3LGHA 1OPIA 3PACA 3RB0A 4LF7J 3PEJA 3UQSA 2B3TB 1V9OA 2XTJP 3UNYA 4LF6F 1RDRA 1S49A 3DU5A 5F0WA 4QWDA 4TYBA 2R9LA 1T9YA 2LXFA 4B02A 1TZ0A 3AY0A 3M8RA 2K1RA 5HJXA 1FX4A 4DUTA 3QO9A 1IBLF 1LV5A 1NEEA 2GJFA 1ZM9A 3Q0AA 2MKHA 1EP4B 1UVKA 5IT4A 4O44B 4HHUA 4X4PA 3PW7A 2B7BB 3D0HE 3T5LA 2GGPA 1KLMA 2RE1A 3A3PB 4F67A 1Y11A 2CNKB 3TI0A 1FWPA 2VH7A 3MCOA 3JSMA 1UA1A 1GMUA 1OMSA 1S57A 5AE2A 5LXRA 3B8HA 4RR5A 4XDCA 1HD1A 3BEGB 4YB6A 4B3SJ 4CP5A 4I69A 4FXDA 1U6FA 1FVQA 5EX0A 3VAMA 1FKPB 4WU3A 1S77D 2FHJA 3OTOJ 4B08A 3LWLA 1HWUA 4KQZA 1VBYA 1VQOS 1UJ6A 1N32J 3RU0A 4I0WA 1T7PA 2R7VA 3KFWX 2PI4A 2J8AA 4XK8C 5A2QU 1X5PA 1TAQA 2QYCA 3DYAB 3EJMA 3H25A 3C6UB 1SQEA 1REVB 2QRRA 1D9AA 1FNOA 3ZNUA 2PA8D 2YBVA 3R7BB
chains in the Genus database with same CATH topology
3HHLA 3JSRA 3CCSS 3TA1A 4DSEA 3KLHA 5DG7A 1EETB 4KPYA 2YWEA 3HO1A 2OPQA 4G6VB 3M6UA 3N5BA 2PE8A 3AHPA 1L3SA 3K5NA 2V8VA 3DXSX 4RNNA 1QSSA 5A8KA 4RWXA 3H2VE 1VQYA 3MM5B 2VPXB 3PW2A 2C3MA 1VBZA 1SXLA 1KQGB 5J2MB 1QUPA 4ZPVR 5F8GA 2M5YA 3J81Y 3MR2A 3KLFA 3V6JA 2NQPA 2AYEA 3GMGA 4C98A 4ZCIA 5IT0A 4EYIB 3QLHB 4NLRA 2DNKA 1V3SA 3QWPA 3LAMA 4AXJA 4AL6A 4QU6A 3J7YU 1SC6A 2B7CB 3CT9A 2AYGA 4GC6A 1IQTA 3OFFA 3RAMA 1XERA 3BN7A 4C3MA 4Q44A 3NMAA 1P1TA 2IM3A 2FLLA 2BQUA 2ZZMA 2DH8A 3BZQA 3I0SA 3OTDA 2V9KA 5C25A 4KE5A 4KJIA 1H0HB 3P3DA 1KLNA 1JIHA 5JUMA 3OL8A 3KNAA 2W7PA 3HXMA 1WF1A 3PV8A 3OL9A 2GMLA 1KD1T 2BJEA 4IR1A 2VG6B 1RGVA 2J0XA 3Q23A 1FKPA 3G6VA 3H5XA 4FZVA 3A1YG 3PKYA 3OSPA 2D3ZA 3U1MA 1NNDA 2XLIA 4ECYA 1GX6A 2KM8C 2DNOA 2O67A 2J76E 1LWCA 2F8MA 3SSRA 4KT0C 2ZH8A 2MHNA 2HLUA 3VWSA 4ECTA 4EEYA 3R3TA 2VFUA 1N0VC 2C3YA 2IYGA 3MAQA 3MOJB 3CDBA 3MUTP 2OSQA 2HFOA 2W4DA 1KHWA 3R5AA 1X4DA 1NK8A 2M8DB 1TQLA 1SIZA 3DRSB 5DJBA 1B0VA 2LU2A 2XS2A 2PDAA 4NXNF 2B4OA 1T8EA 4C11B 4KIAA 1S1VA 2YNGA 2DNQA 5DDRC 1YSJA 4WFBQ 1KQFB 4YDDB 2ROGA 2ZDPA 1NK9A 1UETA 4O4GA 4CQ1A 3LWMA 4J9SA 4ECWA 1YJNS 4F2SA 3SMZA 1KONA 2DHGA 3CD6S 1QUVA 5HBMB 3VQSA 4DR1F 2YNGB 1UWBA 4ITSA 5DM6Q 1D0EA 1Q16B 1E6VB 1S1XB 5E3QA 2RQCA 1DZ5A 3MM7A 3L3CA 3LF0A 2DNPA 3SSQA 1NHUA 1UWBB 3TA2A 4Q45A 1REVA 2LA4A 5FD1A 2DHAA 3VALA 4DSKA 1R31A 2IBOA 4EFAC 4PG4A 4G3IA 5HLFB 4IQMA 3KJVB 3BGRA 3FRZA 1TKXA 3HKWA 1JNZB 5KG0A 4IG3B 3SI8A 5F8IA 1BQMA 3M8PB 2P9CA 1D3WA 2DGSA 2UUBF 2KT5A 4Y28C 5F8MA 1OQ3A 2VBXA 4K4VA 5KFPA 3FNNA 2XNRA 2XY5A 5B0CA 5H1SV 4QU7A 1URRA 3CJ3A 1NK6A 5E3RA 4J9NA 2N3LA 1S1WA 5KFNA 4LMZA 2VFVA 3BF4A 4JI3F 3QJJA 4C4WA 4WZMA 3MWBA 2BR0A 3FEXB 3IC1A 1FRHA 3M05A 2XMMA 1N88A 5A6WA 3DHWC 3TVZA 1Q82T 1VC5A 5KFIA 2VPYB 1TK8A 4PQAA 4HL9A 2GJ2A 3W2VB 4N5SA 4F02A 3PM9A 3M1VB 1KFDA 1S1VB 5E5NA 2XGPA 3K5LA 1S48A 2CG4A 3HLUA 3MEEA 4HH1A 2QFJA 2DVIA 2FHJD 1LFWA 4KV8B 3CC2S 2HHUA 2OMOA 1H2VZ 1C4CA 2RUGA 2RRBA 3BB5A 2UUAF 2DBBA 3T9ZA 2MZ1A 1BWEA 1C1BB 3OW2R 5HROB 2L9WA 4ZPWR 3AJ2A 3S6EA 4MIAA 1XNQF 5GMKa 2DRBA 3B78A 1UVJA 5B0FA 4LSNB 2W7OA 4RNMA 3DYAA 5HROA 5HLFA 1AROP 1IBKF 2IRUA 1BD6A 2DK2A 4HDGA 2XULA 2UV8A 4IH7A 1WACA 3H5SA 1IN0A 1VIOA 1W2BR 2B43A 4C11A 1N5SA 5CYQA 3VR1A 3V4MA 3ENVA 4NLXA 3T19A 1LW0A 2OPQB 3EGWB 2M70A 4FVMA 5DS7A 1MMLA 4B9VA 3JSYA 3CXCR 1DQAA 2IAJB 4W90B 3NNCA 2VZ9A 1WHWA 2B5JA 3FQLA 4DFPA 4ICLA 1KFSA 2FJWA 4O44A 3W2VA 1ZAVA 5KT6A 1L3TA 2IC3A 2GJIA 4I1TA 1N5TA 2D74B 3OL6A 2P9GA 3J7ZT 3DLBA 5LJ3Y 5DLFA 5BR8F 4TY9A 2WSFC 1U1MA 3JB9k 1HWJA 3QGIA 1S97A 4RUAA 2DR5A 3P49B 3LGMA 3PW4A 2YY3A 5EGYA 4K0KF 1FRIA 2BOPA 4NA1A 2JEGA 2KJVA 2HG4A 2MQNA 4I2PB 1Q8BA 4HHJA 4B3OB 5G0RA 2C2EA 1QE1A 4PG6A 2GC8A 4ID5A 4IFVA 2X1BA 1ULRA 2CZVC 1KTVA 3O5TB 1ZM2A 2QMXA 4NLPA 1T3NA 2XSFA 2J6TA 5L1IA 2QA1A 1HBUB 2HWIA 3CJ2A 3IO1A 3G6XA 1QAJA 3IAM9 3RB6A 3KLVA 5HBMA 4CH1A 2A1BA 3BGUA 3QJPA 2MKJA 5A8KB 4X4UA 3BSAA 2JX2A 4QR0A 1U6BA 5KG7A 2VC1A 1G1XA 4IOCQ 3MECB 1N56A 4ELUA 1M5VC 3C46A 3PX0A 3M9NB 3FFIB 7FD1A 2DR8A 1RT7A 5KG1A 3F56A 2XMKA 2GHVC 4G1PA 2FVRA 3OVAA 1B7FA 2DGVA 2ALZA 5KFLA 1ZH5A 1JNRB 2GO8A 2Q1LA 3UCGA 5A6PA 3H4BA 1S0VA 1DTTB 4DG1B 5EN1A 5DG8A 3V6KA 4WZQA 4OZLA 5D4NA 3BQ0A 2FVSA 3KK2B 1Z2ZA 3DLHA 1WD6A 4B9LA 4FF1A 1RJJA 1M1KT 4WCEQ 1QTMA 4NZ7A 2Q79A 3H40A 1U2RA 1ZTWA 4JI7F 4HVZA 3PFEA 2JLFA 1PC5A 2GGPB 5KT4A 1GH8A 4NYPA 2YKPA 3NLCA 2OJ3A 1JLFA 2KU7A 1FDNA 1VS3A 4USIA 3POTA 1N52B 1SKRA 3W3SA 5KFHA 4B3OA 1LW0B 3M4XA 2APOA 3CDWA 4E98A 3HX9A 2I5JA 1MSWD 4KGMA 1OIAA 1X5TA 1FJEB 2XB2D 2R7WA 1CSJA 1DTQA 5T14A 3Q2TC 3N6NA 4D3GA 4R5PB 2MZTA 4FP9A 3N4WA 2MB0B 1C1CA 4ZVHA 4V19J 3BQ2A 1EETA 1HW8A 2Y0SD 1D9DA 5L39A 2M9KA 2J6UA 1C1BA 2L9DA 4DV6F 1NZAA 4YMEA 1TR0A 3RBEA 4IOBA 4XDDA 3QGHA 1RT7B 3QGPA 2AWZA 2IHR1 1TVRB 2J0QD 4CO2A 3DNCA 1HBNB 2DCUB 5A0YB 2WCXA 3GFYA 5KFCA 4DS5A 2EK1A 5K8MA 4K4TA 2DO4A 3NAIA 3I55S 3PVXA 3MPVA 3CJ5A 4JOUA 3H2LA 2EFNA 3RTVA 2MJNA 2BYCA 4IRDA 2F40A 3U1LA 1M5KC 1QAXA 1VRUA 4KV8A 4C0HA 3C66A 3U02A 4NA3A 5A8RA 1ZM4A 2N4DA 2VG7B 4DV4F 5CHCB 2ZKUA 2LDYA 2F9JA 3HP6A 2YNHA 1S1TA 2RU9A 2DH7A 3RW7A 5CCLA 1TKTB 1U48A 1EP4A 4YB7A 2BM1A 2V2KA 4X2BA 3TAMB 1NJXA 1FF2A 1LQ9A 4IFYB 4Y2CA 3C6TA 1VOMA 4ZVEA 3UE2A 4A8MP 1YJWS 4O3NA 4WE1A 2NPFA 2CDQA 3SCIE 4A8QA 3T5JA 1VQNS 2QSFA 4NYZA 4OHWA 2MHEA 3C6TB 3M6VA 5CYMA 3M9MB 1QE1B 2HRUA 4LUBA 1KR4A 1N34F 5J1EA 5EWGA 4X64F 5HI7A 3KYLA 2YX7A 2L9NA 3EGNA 1N36F 2UXCF 1R7IA 2KFYA 1JLCA 1U1RA 3IWNC 4IYQA 3OJUA 5KFDA 5D6GA 2HGNA 4PPDA 4YDXA 3VAKA 1U45A 3DOMA 3WZ0A 3HHNB 2XGQA 2AJ0A 4ZP8A 2QA4G 4ILMA 1WF2A 2WBRA 4I68A 1S99A 2RQKA 2P6SA 3SQGA 4TQSA 2Z2MA 3P96A 1A6LA 2FLOA 4TYAA 2XS5A 2JL9A 4M1KA 3I6PA 2HMIA 4ECQA 1O5JA 2BM0A 3EPIA 1FE4A 2RQMA 4B17A 3KLGB 4HKQA 1DTTA 3KWMA 1NB7A 1KRPA 5I3QA 5BYRA 3LANA 4JV1A 3W2WB 4WFAQ 4LF8F 1C0TB 4TU7A 3MI7X 4Y2AA 2AP6A 4CTAB 2BABA 1U24A 1UL3A 2V5HG 3I0RB 4CO1A 3V2UC 2AU0A 4F4WA 1Y5LB 5HMZA 3I4PA 1LOUA 1BQMB 2N3OA 1HNWF 4RNFA 4JBCA 4F50A 3OVSA 3KK3A 3MCSA 2PSZA 2Q6BA 3IA0A 4MAKA 4FF2A 4ELVA 1JWWA 3GG0A 1YTYA 1X4HA 5HL7Q 2LYVA 1IKYB 3CD0A 5U47A 5I3PA 3MPYA 4HEA9 4JI0F 1RT2B 3DMJA 5FDLA 2MY8A 4ED3A 5LT5A 2HHVA 1S9EA 1JKHA 2MZRA 2PA3A 4AFFA 4DR2F 3T5HA 2KZMA 1UEUA 4DWIA 2MDAA 2MJUA 1APSA 1R0AB 1B0PA 4CT8A 3CC7S 4FS2A 4Y0FA 2OPPA 3JYTA 1FJGF 1TK5A 1ZETA 2LEBA 4ECZA 3DXBA 5KFUA 4O3QA 2W4CA 2ZH3A 3IXQA 1HBMA 2DO0A 2VOPA 1VQLS 3EUNA 2C3OA 4OI4A 3CCLS 3FCHA 5JVGQ 1OS5A 1VQ4S 1O8BA 2FD2A 1P6TA 2CRLA 5C24A 1Q8LA 1RTJA 1SV5B 3KLEA 1SL0A 2CQ0A 4NZ6A 2QZ8A 2BACA 3E8OA 3DRPB 4C97A 4TU8A 5KFMA 3CDEA 2D3OR 2MY7A 2DNNA 3ISND 5GAHU 4J9LA 4DUZF 4OHVA 1RQ0A 4H4KC 1VQ5S 4P6QA 2LEAA 5J1EB 1GTHA 2VG5A 4NXMF 1X4FA 2UZAA 1ZOTA 3M2RA 4OLOA 1R8CA 3V6HA 2LECA 2DR7A 2PO4A 3M9OB 1IKVA 1TKZA 3T1HF 4PG5A 3CJKB 4LT6A 1MNEA 1HI0P 1YWXA 4A46A 1UKUA 3CIMA 2XBPA 1FT8A 1YG0A 1ZAXA 3WDOA 4IH5A 5HP1B 3Q8SB 2K3KA 1DLOB 4MJKA 2NSBA 3RZAA 3T1AA 5MLCV 5I3UA 1S1WB 3LP0A 3KHGA 1U4BA 4RW7B 2DCLA 4N77A 4JI2F 1R89A 3RBDA 1NHVA 3KLHB 2ZOFA 5KG4A 3E2EA 1X4GA 4P7TA 4QW8A 3U1NA 2J7WA 2W9CB 4NLVA 4RBUA 3TVKA 1VC6A 3DFEA 2D1CA 4PG8A 4Y6IA 3PHEA 3X1LB 1RTIA 1G3OA 4YY3F 1OO0B 5IT9Y 5JVHQ 2YKMA 2O3DA 4LIRA 3DLJA 3PEHA 2HS4A 2E1CA 2NUHA 2XZWA 5GADI 1E6YB 3H5UA 2FC9A 4FYDA 2HWTA 2D9OA 3DRRB 3LQVA 4MYTA 3UDCA 3QWUA 4MTPA 1FHTA 1DJ0A 5FLXY 2C3UA 1U49A 1XK8A 2FJDB 2UUWA 1F60B 3CO9A 2YKQA 2ZFHA 3HZGA 5IFMA 1D1UA 3IBWA 2KT2A 2GO9A 2GCFA 2E66A 2Q43A 1H7WA 1TL3B 3HVWA 1R8PA 2KM8B 4PXDA 4QJVA 4B9SA 1K73T 3OFGA 2OIHA 1FNXH 3ZZYA 1FERA 1V6HA 4BDPA 3EXCX 4LF7F 1FK9B 5KG3A 3GG1A 2NR0A 4ED2A 2CQHA 4HTIA 1X5OA 2DD8S 3H8YA 2X51A 3D1HA 4C8MA 3PRBA 4QYRA 2K3IA 2YNIB 4MIBA 4RW6B 1HYSA 4NLUA 1N54B 4MH8A 4AUKA 1S1UA 4J9OA 2CPFA 3MM8A 3HMJG 4KB7A 4C3KA 1LWCB 4A8WA 6FDRA 2E1MC 4NRTA 5E33A 3GFXA 3LH2S 5KFYA 4DBQA 3D54A 1YHQS 5BJRA 5D3GA 3OQ2A 2HNYB 4Y2IA 1DARA 3UFCX 2E5JA 4MKBA 4B9UA 3O8WA 5F8NA 1HHSA 1HL6A 3MEGB 2FPHX 2RQ4A 2VKZG 4JI1F 2IVFB 1ZZFA 3CE8A 2KXFA 5LXYA 4UY8T 5F8JA 4MYUA 2V8HA 3O44A 3MEDA 3DM2A 4H4KA 2I8EA 1TV6A 4A8SA 2KTQA 1NRKA 2IJFA 2DISA 2CPXA 3DOKB 2OKQA 4AE5A 1CEZA 3J7A1 2BRKA 1FDDA 2GA7A 2MKIA 4BWMA 1JLQB 2GNKA 2OH2A 1VQ6S 4ILLA 1N5VA 2DTJA 1SV5A 2RRNA 4KHPF 5J1NA 2A3JA 4KFBB 2J9CA 3FZBA 2ZE2A 2DT9A 1SUQA 2IM2A 4JI4F 1SL2A 2G13A 3P5TL 3GYXB 4DR6F 1W2IA 1H2UX 1YRXA 1G7CB 4ZHRA 4F4KA 4DL6A 4ERDA 3RB3A 5M2UA 3HHLD 1TL4A 1MMDA 3NNAA 2R8JA 3K8WA 3R5BA 5KFBA 3D1QA 1PGZA 6FD1A 1V3RA 4OI3A 3FMWA 3ICLA 5A8WB 2YQ3A 3CULA 4WXWA 3DLGB 4WJBA 1JXLA 2L3MA 1KC8T 1WTFA 2CQGA 2ZM6F 2XO7A 2HFZA 3Q22A 3GR0A 2XMJA 3ZZOA 4EUVA 4TU9A 2XC9A 4RW9B 4WK3A 1Y0HA 2C42A 3AA8A