1FDDA

Azotobacter vinelandii ferredoxin i: aspartate 15 facilitates proton transfer to the reduced [3fe-4s] cluster
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTNCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Aspartate 15 facilitates proton transfer to the reduced [3Fe-4S] cluster.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport(iron-sulfur)
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fddA00
1FRHA 1GTHA 4KT0C 4AYBD 1K0TA 1RGVA 3MM6A 3IR6B 1DURA 3IR7B 1B0TA 3MMAB 1B0VA 3EXYA 2FJEB 1FD2A 2V4JB 3MM7B 2C42A 3OR2A 2VPWB 1FDNA 1H7XA 5BYRA 2WB1D 1JNZB 2VPXB 1BLUA 1Y5LB 3EUNA 3PNIA 1BD6A 2C3OA 1IQZA 1GTEA 2WSCC 3HKZD 1KQFB 2FJAB 3MMBB 2PDAA 1PC4A 3EGWB 4XDDA 3IR5B 3OR1B 1FCAA 4YDDB 2XSJB 1FRMA 1PC5A 2UZAA 3MM5B 1G6BA 2V2KA 6FD1A 1FDBA 1FRXA 2IVFB 1B0PA 4Y28C 2PA8D 1KEKA 1FDDA 1FRLA 1BQXA 4XK8C 5L8RC 1C4CA 1C4AA 1H0HB 1A6LA 1SIZA 3MMCA 3LW5C 3MM8A 2WAQD 1FTCA 1DFDA 1FXDA 1FEHA 2WSEC 5CH7B 3MM6B 2Y0SD 4CI0B 1BC6A 1FRKA 1G3OA 4RKUC 7FD1A 3C8YA 3MM9A 1F5CA 2VPYB 5BYSA 2PMZD 1FRJA 3OR1A 1JNRB 2XSJA 1FDAA 1FERA 1SIWB 3MM5A 1FF2A 7FDRA 2C3UA 2ZVSA 3GYXB 1F2GA 2C3PA 1WTFA 1VJWA 3MMAA 5FD1A 1FXRA 4DHVA 4OV1A 1GAOA 1H98A 1Y5NB 3MM7A 2V4JA 2FGOA 1HFEL 1SJ1A 1XERA 1D3WA 2FD2A 2VKRA 4XDCA 1IR0A 5E7OB 3MMBA 6FDRA 1GT8A 4L6V3 1Y5IB 2Z8QA 2C3YA 4OMFG 2VPZB 3MMCB 3OR2B 3MM8B 2O01C 1AXQA 2FDNA 1DAXA 2C3MA 1BWEA 1Q16B 1JB0C 1CLFA 2GMJA 1ROFA 2FJDB 1KQGB 1F5BA 1H7WA 2WSFC 4ID8A 5CHCB 2FJBB 3MM9B 1FRIA 1R27B 1Y4ZB 5BYQA 2GMHA
chains in the Genus database with same CATH superfamily
1IM6A 3CJRA 3D6TB 1K0TA 1RGVA 5L1JA 2FVRA 4JI5J 3Q8SB 2KN4A 4NXMJ 3D4JA 2M0GB 3UPFA 5CYMA 3QJLA 2DNKA 1U25A 1KLMA 2IA0A 4Y2KA 2IM0A 1HPZB 3AA8A 1X4FA 2LEPA 3FVYA 4M5KA 1DFDA 4JI1J 1RTDB 1FEEA 5CXTA 4IG0A 2GGPA 4PRFA 1HBOA 1X4AA 2QMUB 3IWNC 3C6TB 4CYUA 1QAJA 1E6YB 1NK5A 4Q7AA 1RT5A 1O8BA 4ZVTB 2YKMB 3RBXA 3G87A 1S48A 3G8TA 4LBPA 1HW9A 5J1NA 2CNOB 1IKWA 3MMCB 2ADCA 4K4UA 1QSLA 3NCPA 4C11B 3Q2TC 2VQEF 3D6MB 3G8QA 3M8PA 4DL4A 2V67A 4R25A 4F36A 1YI2S 4CO4A 4CLZA 3IGNA 4FKXA 1U48A 3RUBL 1PGZA 3RB6A 4L3NA 4CLKA 4DUTA 1YZ7A 1F3VA 2ZHBA 6FD1A 3DLKB 3ITHA 3T9NA 4A8KA 1S10A 3JSBA 5D6GA 1HI8A 4L3KA 2YQ3A 4WFXA 4USWA 2E5HA 1TL5A 4DPYA 3CJKA 1KHWA 2GHVC 2CG8A 2A1BA 1XNRF 3HHLC 2VG6A 3QLHA 1LWXA 4RBUA 2BE2B 1FRJA 3QT5A 2XM3A 1TL1B 4YN3B 1UVMA 2C3UA 2RMLA 5GADI 2JJ4D 3OXFA 1W7WA 4OZ3A 1JLGA 4HDGA 5HL7Q 3MOZA 4DR2J 3AAWB 2DR9A 1KDNA 1LWCB 5A2QY 3DMJB 1NK7A 3KK2A 2H4YB 3GYNA 1SQGA 2LQ9A 2B9WA 4HH1A 4ANDA 2ZUAA 2E1AA 4I69A 2D41A 2WONB 4O44A 1ZM2A 2G9OA 4F4ZA 2Y3YA 4RNMA 1BD6A 3FK4A 2QN6B 2OPPB 3ENWA 3PZPA 3AY0A 2NYIA 3I56S 1TL7A 4NYZA 3I31A 4RW7B 2E5LF 3H98A 1B70B 3A8KA 3HJFA 1SIZA 3IXQA 4DUYJ 4M5IA 3ULHA 1XC9A 2Z30B 3MM6B 2UUAJ 2HBRB 1N36J 4ZITA 2X51A 3VGUA 2CQDA 1KOOA 4TLQA 1NH7A 2ZWPA 2MQ8A 2IHR1 4WP8A 3PKMA 3DI6B 4ZJQA 2HHHF 4ED1A 1K73T 2J0WA 4U9RA 4DV7J 2FDNA 5HMXA 1DBDA 1U47A 1FVQA 3A12A 4HACA 1MMLA 4I6AA 5CZVA 3IBCB 4K4ZA 3FFIB 4DWIA 4ZLJA 3KNGA 4LUBA 5HVHA 2MJUA 4ZJOA 2K3KA 3PV8A 3SCLE 3BREA 1T3OA 1FDNA 1FWPA 3PJXA 2XYPB 1WI6A 2R7QA 3MPVA 1NB2A 2YNHB 2H48B 2FHOB 4WKRA 1U49A 2IFXA 4DN0A 4XK8C 2ZJRQ 4DSFA 3BKFA 2OD4A 1K9MT 4ILLA 3HHLD 4NLYA 3JSMA 2AZ1A 4C4WA 5KG7A 1JXEA 2Q43A 2W8KA 4I6YA 3E01A 4I2QB 4ECYA 3T1HF 2YH0A 3SI8A 4P74A 5F8GA 3V81B 1ZBTA 1R8CA 4HHJA 2VZ9A 4LRBA 2XCAA 2ZH7A 3AA9A 4XPCA 2WOMB 3FZBA 4K0KF 1NRKA 4OL8A 1MROB 2HVHA 1S57A 3OR2B 1IBKJ 3B4DA 1DAXA 5DG9A 4OHZA 2VH7A 4LFAF 4NCGA 3T6BA 4WU3A 2GIFA 1U1KA 1TFYA 2WCXA 5HLFA 5HROA 2VQEJ 3G9CA 4HDHA 1RT3B 5LSOA 2I0XA 1Q8KA 3IRXB 3CJ0A 1HNXF 1QVGR 1I5OB 3BN7A 2R8IA 3ENQA 2D3UA 3QJPA 3PM9A 4OX9F 4JV5F 2F8EX 5HBMB 4X4UA 2G4BA 1RU2A 2PMWA 1ZM3A 4X4NA 3Q2SC 4WP3A 4M94A 2AJ2A 4KKOB 2HIQA 4LMZA 1SV5B 3TJ8A 2VB6A 3MPDA 4BC7A 3QAEA 1XNRJ 3IAM9 2MSTA 1S9EA 3P45B 1U2RA 2P6TA 1EB0A 4J9SA 2R9LA 3PW5A 4LSZB 2JOQA 1FKOB 3GYGA 4UUXA 3UD3P 1U1MA 1HFEL 3GMGA 3L95X 1H74A 2KT5A 2MKSA 1WF1A 1R0AB 2X3DA 4WXWA 2RSQA 1T03A 5KFIA 4ZOSA 2WW8A 4J9VA 1FKPA 3VAHA 4OX6A 1UEUA 1XJWB 1QVFR 2ROEA 4QIGA 2HZCA 3TO8A 1NK9A 2BVZA 1S97A 1OIAA 4LF5F 4DN9A 5B0FA 4AL7A 2X3GA 1RTJA 1WF2A 4CM2A 4LVNP 3W9IA 3VAGA 4PPDA 1M1KT 1S6QA 3U7JA 3BYPA 2HK2A 3GG0A 5ETLA 4J9PA 2E5LJ 3UN2A 3P8BB 2RE1A 5A8WA 4M8LA 2DGSA 1ACMB 4F3QA 1NJYA 4DLGA 5E2QA 2FHJA 2JLGA 3ISNC 4K4VA 2YKAA 2R2UA 3N28A 1Q1KA 3QMQA 3KK3B 1Y5NB 3I55S 1B7FA 1PBAA 1YWXA 4FP9A 1O0PA 5AXMA 5F8HA 1RQ0A 2ERRA 3IFEA 2HHHJ 1Y3KA 4UOFA 2W7OA 1KOHA 2OPQA 3LO3A 5D4OA 3H42A 3IS9A 3EXCX 4UUWA 3DU6A 1S1UA 2DXEA 4WE1A 4AQYF 2BQUA 1BQNA 1KFDA 1CJKA 3PRBA 1JLAB 2GX8A 1Q8BA 2J0SD 1BLUA 4ECWA 2E1RA 2KTQA 5J2NB 3FNNA 4OI4A 4ILMA 1TKTB 1T9WA 1VK8A 2DCLA 1AZSA 3VQTA 1SPBP 4U8YA 3QO9A 4C7QA 2DPJA 3W60A 1C4CA 4WP9A 1JLFA 2AQ4A 1TV6A 5E0OA 4IH6A 1FEHA 3PX4A 4MH8A 5C5JA 4MKAA 4H4OB 3NRBA 1VQLS 5H9FJ 4USKA 4MK7A 2EG1A 2H9ZA 1HNVB 1MWYA 3T1HJ 3HI9A 4B3TJ 1PSDA 2N7YA 3CUNA 1KRPA 4ZPCA 4EBDA 2OUGA 4BWJA 4JB8B 3EVOA 2IVYA 4ZPTR 3W62A 1M1GA 5J1EA 2E1CA 2ZD1B 4K0KJ 4DL2A 2HMIB 2HHWA 2QE5A 3FQKA 2DH7A 5AJ3F 1AUDA 2E9ZA 4ED4A 2E1MC 4B3RF 1XIQA 4OI3A 1PYTA 2EFPA 5T14A 1HNXJ 2OPSB 5F0UA 2P6SA 4CLSA 2DH9A 2RRNA 4FXVA 3KYLA 4DV0F 4OX9J 4JV5J 5MLCV 3DHXA 2IRUA 4ECRA 2NXEA 5KFOA 3EICA 5CYJA 4PR6A 5KT7A 5B0DA 3NOCA 1NJZA 4Y3CA 3N9UC 2HFVA 1RAEB 2C2OB 1DQ9A 1N5SA 4QJVA 3RAQA 2VC1A 2DNLA 4RW9A 1EETB 5J2MB 1NK8A 4LQ9A 1G7CB 1SC3B 2RQ4A 1JLBA 1M0SA 1ZZNA 1VQ5S 4WYLA 1S59A 5A2QU 3ZTOA 3LP2B 5F0WA 5A6WA 2QLWA 3PFOA 6FDRA 3W2WB 1JLEB 3WZ0A 1GX6A 3H5UA 4BBYA 2DYAA 2DY1A 3FSIA 3SMZA 4XIUA 2K06A 4WPAA 4Z7YA 1Z2LA 4YB5A 4Q5VA 5L1IA 4LF5J 1R8BA 3TJ9A 1ZOTA 2JHEA 3BS9A 5HO4A 3SSSA 1EAYC 1H2UX 3ZZZA 3M2VB 2C3OA 1HQ2A 2MZSA 3IR5B 1AFIA 1DTTB 4ZVGA 3DRRA 1OQ6A 4MT1A 4I67A 3HP6A 2WK4A 4AL6A 1FXDA 2BJ1A 3K5NA 1FJCA 4F4KA 3C46A 2KU7A 1WEXA 2YBVA 1IKVA 2DHHA 3H2VE 2HVDA 1SH2A 3FEZA 2A2DA 4QIFA 3VGTA 1RYSA 4FYYB 3OUYA 4PQAA 4K59A 4OI2A 5CZXA 3NMRA 3DOKA 1BWVA 1R43A 2PEHA 5C25B 3UD4P 1SKSA 4PWDA 4FKYA 1APSA 1MMNA 4ZK7M 1NSAA 4AUKA 4Y0FA 3W5XA 4GKKF 2V2ZA 4LRFA 5C42B 5SZTA 4MIAA 1XMBA 3Q24A 2O66A 4AQYJ 3U02A 3T1AA 3ADAC 3M2UB 1NDPA 4CLYA 1B0VA 1UVJA 3CPWR 3SYZA 2GJIA 1Q78A 1PC5A 1N4LA 1PO6A 5B0AA 5GAHU 3LOUA 2FPHX 2BM1A 1F2HA 2AHOB 1CVJA 3IBFB 4DR1F 1IJFB 3NMAA 2B8QA 4GVBB 1RACB 2Y0BB 1RWWB 4O3QA 4DPOA 4ZKAA 4M5GA 2MKCA 7FDRA 1AUSL 4PEOA 1CC8A 2RVJA 1T11A 2LYVA 3QGGA 3MOJB 3OTCA 2V34A 4PG7A 2VDHA 2R42A 2UXBF 4QU7A 3S7RA 3BGRA 2IJNA 4LSNB 4M5DA 2GMJA 3PW0A 5KG3A 2XMMA 5F8LA 3H0PA 1R0CB 2EBGA 3M32A 2XI3A 5IS2A 3C3LA 5AJ3J 1RU1A 2CA9A 1BUXA 5LL6d 4DPUA 2ROGA 4IG3B 4B3RJ 5A0YA 1IJEB 1NH8A 4X84A 3D68A 1WJ9A 2ASDA 4DU7A 1IUJA 3ENVA 3CT9A 4DV0J 4ZLLA 1YJVA 1ZS6A 4ZLPA 1RAIB 5LOQA 2E5IA 3NGSA 1YRUA 4DQQA 1YZ6A 3KDOA 9ATCB 3HCXA 3FDSA 4ETXA 4EGLA 1SH3A 1OY6A 1YQHA 2W9BB 2FTRA 2VKZG 5CAAA 1N52B 5JJBA 1T0TV 3MFIA 3BDEA 3UWTA 4O3NA 2LU2A 4N8OA 5I3UA 5CYQA 2NZ4A 3M8QA 4DPXA 3ZNJ1 4FNHA 2FIUA 3T6JA 5F9NA 2O01C 1YRXA 3W64A 4ZP6A 3TZYA 1IVZA 3HT0A 2MKJA 2B9EA 2I6WA 2HQGA 1CBKA 5CHCB 1VGYA 3NWGA 2AD9A 3TUZC 1WC4A 5B09A 3R5CA 2HHVA 4OIXA 4MFBA 4EK2A 2ZJQQ 1JNZB 5D15A 2MSSA 4OQJA 3C14B 1VBXA 4WTYA 3TX8A 3BBFA 2W9CB 2NR0A 4JV1A 1U26A 1FDBA 1XBWA 4CNZA 3EJMA 5I42B 5HSPA 1UVNA 3DLHA 2Z4PA 4WXOA 3DRPA 3M9NB 4WFZA 1QE1B 1UP1A 4WYWA 1GFWB 4F50A 3E51A 3Q8QB 4B9MA 2F9JA 4RBVA 2QFJA 2VC0A 4UW2A 3MM7A 4DXLA 3JTOA 2B0GA 2DO0A 3B82A 2AT1B 4ZP9A 2U1AA 1VK3A 3LWMA 1ZTTA 1NU4A 1GMUA 1X0FA 3D9BA 2V2QA 3PY8A 3R2CJ 2BE7D 4GKKJ 1YTYA 1FRHA 3UVJB 2HZAA 3IM9A 1ZH5A 2GVDB 3GJQB 2ALZA 1PBUA 4KV8A 3H25A 5KG5A 2BJ8A 4L73A 4IRCA 1TKZB 3GIKA 2UXDF 5RUBA 2PGCA 2UVRA 2OEJA 1WHYA 4ZHRA 4RLEA 1VQ7S 2ZE2A 2XZTB 3CDAA 3MM8A 3UI3A 3SQGA 2MKHA 1IN0A 3BGLA 2ZZNA 4PAAA 2HZVA 2VJVA 2XSJA 2F5GA 1KLNA 2RHSB 3MCOA 5H1SV 4LR7A 1N6QB 2V68A 2DR5A 1F2GA 2DHSA 1H73A 3TYTA 2VBWA 3HHKA 1IKYB 3T41A 5E3RA 5DRKA 1FXLA 5A76A 1TTHB 4QYRA 4IQXA 3DLEA 3D7SB 2UXBJ 2V94A 2LEBA 1RT1A 1HNIB 1JK9B 2E44A 1RKIA 2DISA 2VG5B 3KDNA 3F73A 2D3O1 2KYZA 1NHVA 1YJNS 3HHEA 4Y65A 4RWXA 3JTNA 3TJAA 3WC0A 2XGPA 4DR7F 2QLJB 4V19X 1X5PA 3G2XA 3AXKA 3OVSA 4R0EA 4M5MA 1HBUB 2BM0A 2FQQB 2XBPA 3FMWA 2HBZB 4CP5A 5KFLA 1FX2A 1S1WA 3Q83A 1YDLA 1VQSA 2I2YA 3VZHA 2J0QD 4M5NA 3PVXA 3MDFA 3RBZA 5LJ3Y 1D9DA 3PEHA 2PI4A 2ZVSA 3MCSA 4OYIA 1JJHA 3DOLB 2G2YA 3T1YF 3KUHA 3BGOP 1EQ0A 3M2RB 1YG0A 4JP8A 1WTBA 2B9XA 1ROFA 4MMOA 3HSGA 2DEJA 3KKFA 4Q2MA 3N6LA 3T5KA 1HPZA 4B3SF 1VRUB 2ZBCA 3VF0B 1K47A 3UCGA 5ETQA 3OTBA 1RTDA 3GIRA 2LMIA 4M5JA 1R8HA 1X9SA 2RUSA 3DFEA 4DEZA 2YNIB 1S72S 2N82B 2R7TA 1H3DA 1E6YA 2CJQA 1RYRA 1WOSA 1YSJA 2ZFHA 3LGHA 4ECQA 4JI8J 2WBRA 2YKMA 4DX8H 4UQTA 4IO9Q 2YKNB 4PG6A 4O0IA 3MMCA 1X4EA 1RTZA 5F3TA 3AOCA 3S1TA 1U0HB 3EDRB 3CJTA 1DJ0A 3UN5A 4C11A 5C2GA 2FYXA 1BXNA 1NBEB 3CULA 1W25A 1CSJA 4ZPDA 3NBPA 2AW0A 1VJWA 1QSYA 2JC1A 4MJKA 3VHQA 2VIHA 3PYDA 3KLIB 4JI7F 3JQJA 3AD7C 2K1RB 3N0VA 1TUGB 3DLKA 2BV3A 2C2NA 1R31A 1CLFA 1U1OA 2ZKTA 2RRAA 3Q22A 2CQBA 4R8UB 2CVIA 2VG7A 1Y4ZB 2EK6A 3L7UA 1QJHA 2RHQB 2GO9A 1Z1ZA 5HMWA 1EX8A 4QYZJ 4CT8A 2G1HA 1OYDA 1T05B 4FF4A 5KFXA 2BE2A 2E7VA 1TL1A 2RILA 4ANEA 4M1KA 2ZH8A 4KAIA 1Y5LB 1S9GB 4AFFA 2VU5A 1ZPVA 3UN3A 1REVB 3DRSB 5IT9U 2UXDJ 5L38A 1CS4B 1NJIT 4G1PA 2BBEA 2F7VA 4D3GA 3LTOA 3PYFA 4DU8A 3DMJA 3HVWA 2DXFA 5KFJA 1FKAF 3M9MB 4B17A 4C8ZA 3VQSA 4QW8A 4DQSA 1UA0A 3CCLS 4RO0A 2QT7A 1UFWA 3TZZA 5KFFA 3IMQJ 1LV5A 2KG0A 4TU7A 1OY9A 3TVYA 1A7GE 4Q0BB 2EK1A 2WONA 3W63A 2IAJB 3EGNA 2CDQA 1WC5A 1YIJS 1WSVA 1HNZJ 2OPPA 4B3OA 2AF6A 1SJ3P 4WF9Q 3M8ZA 3W66A 2B5JB 4MKYA 4UZBA 4DV5F 4PYAA 5KFCA 2YPZA 4RW7A 1U2CA 2DO4A 4RNOA 5KFTA 5DETA 1EZZB 3OFHA 1S5ZA 2WSFC 2FY8A 4RL1A 1Q7LB 3FGVA 2EEYA 4ZMMA 3G6VA 2XMAA 1S4FA 2MY8A 3MM6A 1ZM4A 3NKYA 3M8RA 2NCKL 4DR7J 3PRDA 2W01A 3CMQA 2MQNA 3NCQA 5D0EA 3D3CJ 4FN5A 3DI6A 1WELA 3ELHA 3HVRA 5A8KB 5JUMA 2A6MA 1QAXA 4X4PA 1V5VA 2YPYA 5L39A 1HQUB 1VYAA 1UW4A 1JJ2R 3HO1A 2F9DA 3GFHA 4LT6A 2ASJA 2V8DA 1SQFA 3QQCD 3W8PA 1S6PA 3MPWA 3FFIA 3GJTB 3LF0A 2NREA 1HNWF 1EJ7L 4Y00A 1HW8A 1RAHB 1FTRA 5T41A 4B3MF 3ISZA 5G4DA 1KFSA 3KHRA 1TUVA 3L7PA 3QFHA 3T1YJ 3CVKA 4RUCA 5G0RB 2ALYB 2YNHA 1E6VB 2HS3A 1B3TA 4YB7A 3AJ2A 5KFGA 2Z58B 3M8YA 1RWPB 2AGOA 4B3SJ 3UDLA 2J6SA 4FF1A 1SBRA 2DITA 4I2QA 2BW2A 2GV1A 4A8XA 3V81A 3EGWB 2JWNA 2DRDA 3PKYA 1H38A 2KHCA 3HVTB 3TWZA 4CH7A 2WOMA 1TKDA 2PE8A 1BQMB 4WTOB 2VBZA 3DDIA 3CCUS 2KHDA 5H9EK 2AV5A 2XHWA 2L9NA 3MTKA 4WK3A 1G3OA 3IBWA 2JNJA 1XR5A 2C22A 1GXTA 4ANCA 4C48A 3KUGA 2IM3A 3CIZA 1T9YA 5DGBA 2XC9A 1RT3A 3IRXA 3QGIA 1T95A 3Q0AA 3ENAA 2ZH9A 2O3DA 3W1YC 1VRTB 3OJSA 4JI7J 1YJUA 3D66A 2MZ1A 1L3TA 5HP1A 1RADB 4TYAA 4HTIA 2AP6A 5FDLB 4TY8A 3RJMB 1Y00A 3J81Y 2L3MA 3FSXA 2E9TA 3EMTA 2R8GA 3D28A 5T7LA 3A8EA 4CM0A 2GVZB 4YQWA 3HSJA 3HKZD 1FKOA 1WG5A 1RWUA 3NY0A 3GV5B 3CCQS 4BCAA 4NLVA 3C6UB 1T9UA 1XEZA 2M8DB 1NPRA 4C98A 5F8IA 3BQ0A 1R0AA 1X9MA 4QR1A 3QRRA 3M8WA 3TA1A 2AEJA 1FK9B 2UXCF 1OO0B 2V2VA 4OYBA 2ZHAA 4QWCA 4C0OC 1RHRB 1VIXA 5ETPA 5FD1A 2B4PA 4OV1A 3B4MA 3DNCA 3FCWA 1NDCA 3LP0A 1X4GA 1N5YB 4C6AA 4CH1A 2QZ8A 5AT1B 4PYDA 3PEJA 4ED2A 4OJGA 1UAWA 4P10A 4DV5J 3KLHB 1KVKA 4G6VB 2RKIB 4KFBB 3T5JA 4PXCA 1U8WA 3OT9A 4YP3A 4ZP8A 3HD2A 1D8ZA 1W26A 3MMAB 1NSQA 2AU0A 2GAGC 4WWSA 4OZLA 2GMLA 4HT5A 3QZ8A 1N5VA 1ZA2B 2XMUA 2XGQA 3CDWA 1LWFB 2HLTA 3AHPA 2D3OR 4N41A 4ECZA 5CABA 1WSRA 2CPXA 3IWLA 4EZ9A 3UE2A 4DS5A 2WW4A 2QA1A 3QWPA 2Y1IA 2EXUA 2H51B 2IM2A 5IQQA 4J5OA 4HI2A 4DCOB 2VL1A 2YNGB 2ZBIA 3F44A 1JLAA 4NOHA 1XERA 2VA2A 1JXVA 3MUVP 3QYYA 1Y5IB 1YJRA 3RB0A 2GFFA 2K2PA 2YXLA 3O2IA 5J2NA 2FJWA 1XR6A 1TKTA 2QLXA 2PA3A 2Q6BA 4CLTA 3DLLQ 1ZA1B 3DRXA 3R97A 4NMLA 3J80Y 2B4VA 4QWDA 1UFKA 3ET6A 2V4RA 4YEAA 2LDYA 4H4OA 3JSRA 3D1QA 3I32A 1W2IA 4A4JA 5B0BA 2MJNA 3GV7B 1HNVA 4I68A 4ID5B 2AGQA 4NLTA 3NG8A 3G8SA 1FX4A 1VIOA 3CJSA 2ZD1A 3BN4A 2IRXA 4OX7A 3UR3C 1X0PA 5KFQA 2BZ2A 1FNMA 2HMIA 5AXKA 2CRLA 3ZTRA 3VAKA 1SIWB 1KKHA 3H7HB 1QTMA 4C3LA 5AE3A 5I3PA 5GMKa 2CQ4A 1FJ7A 4DCPB 1SL1A 3RGIA 4X4QA 4DUZF 2FVQA 3H59A 1WG4A 3X3UA 1H72C 2CQCA 1IR2A 2HNDB 3CJQA 2WVCA 1R8AA 2GMHA 4O0NA 1S0OA 2BX6A 4BLGA 2V9KA 4KPYA 3MEEB 4NA3A 2LKZA 3EZUA 1EETA 5J2MA 2B4OA 2QA4G 2IMOA 4KPCA 4KH1B 4RPFA 2L9DA 3G6XA 3LALA 4KB7A 1GMWD 3LP2A 3KWMA 3W2WA 2ZH3A 1JLEA 2B43A 1N34F 4TLRA 3OPKA 2D9OA 2ZM6F 3TNVA 2UUWA 4ETZA 2M4MA 4Y2CA 2KFYA 4IFYA 4KC5A 4NCAA 1SB6A 3FJ2A 2UXCJ 2Q3PA 2XULA 2AYMA 4ER8A 3BDPA 5ETOA 3M2VA 2LQ5A 2PC6A 3DDNA 1FESA 4F4WA 1JLQA 5B7WA 2BMBA 5F8MA 4IRKA 1RAFB 2CADA 1DTTA 2FUG9 2DVIA 2QJ3A 1H7WA 1X8DA 3DLGB 1OS5A 5KFNA 4OI0A 5GAEU 3L4BC 1IR1A 5HQMA 1NSPA 3LWLA 2YWEA 4F2SA 3LPEA 2LP4A 3T19A 2WB1D 2H54B 3DKDA 1MWZA 4U8VA 3MF5A 1S1XB 3OL9A 5KFWA 3NS6A 2X1GA 4G3IA 4FBUA 1X4BA 5C25A 2QL9B 1RAGB 2G0JA 2F4FA 3A8JA 1RTIB 4ED6A 1D8YA 4C8OA 2DGVA 4KSEB 2KFZA 1SC1B 2C2EA 3PO4A 1PIEA 2RD5C 3MAHA 2V69A 1YJ9S 4NZ7A 3GR0A 2F65A 2G2ZA 1WUUA 4ALZA 3P4UB 3C16B 2MGZB 2LA6A 5KG4A 1BY9A 3K8VA 3LAMA 4W92B 2CPDA 2GW8A 5M2UA 3ZZUA 4OHVA 1JB0C 2E1PA 3PX6A 4USMA 4FXDA 3V4IB 3AJDA 4GVBA 2V0NA 2XMJA 5KT4A 4WBFA 1HYSB 2HLUA 3V6KA 4PUOA 1IQZA 1DQ8A 2YWWA 4RX6A 3OV7A 3R7NB 3HK2A 2E66A 1RI7A 3SSRA 4OX8A 2BANB 3TR5A 4YR0A 3AD8C 4DLEA 5FJ4A 2RQKA 5CA5A 4LSNA 3R6GB 1QDUB 1EP4B 2KB2A 2VBYA 3KMSA 3L3CA 4GO5X 3R5DA 3KXDA 4USHA 4H4MB 1IWGA 3PR4A 4EU0A 1B7YB 5ETTA 1S0NA 3CXCR 4DHVA 3GFYA 2J6UA 2NQPA 1HR0F 3BGUA 1KVIA 4DUZJ 4HYKA 4GC7A 1VQ8S 1EHWA 4GMKA 2AYBA 2OI2A 2XMWA 1QSSA 2IVMA 1SC6A 2Q79A 4DR4F 2R7SA 4ZS6A 3J81U 1GQEA 2ASLA 3GB0A 2HRUA 5K8PA 3KJVB 3W5YA 1C0UB 2PMHA 4LIRA 4NX9A 5AXLA 3CJ5A 1UVIA 1VC5A 1QD1A 5HATA 4CIOA 1I1GA 2HWTA 1OSDA 1L3UA 4OZ1A 2V8HA 5DZ6A 1RT5B 4JI2F 1S99A 4UZCA 3PO5A 3ZXWA 4CTAB 2IBOA 3AB2B 4C8LA 2KVIA 1X4CA 4OZNA 1UJ5A 5B0EA 2ZM6J 3HT3A 1VQPS 2MHNA 1XR7A 3UW1A 4ZVPB 4I7FB 1M1HA 1WC3A 1NLKL 1RWNB 5K8OA 4FVCA 4DSIA 5U47A 4FDFA 4FS1A 3I96A 3LAKA 2M9KA 1JJ4A 1NJWA 2W9CA 4KGKA 2GO8A 4AE5A 5I42A 2CIMA 4LFBF 3P6YC 1FWKA 2AX0A 2J7KA 2MY7A 3LPYA 4LF7F 2QL7B 2B7CB 2W7AA 1QE1A 1TQLA 1KQSR 3G4SS 3LGMA 2HHPA 2Y1LB 1VHIA 5B0GA 1S1VA 4ZJLA 1EKSA 4N47A 3TEGA 1GH8A 1WKKA 1HD1A 3DDKA 3TW0A 3R7SB 3H8YA 1S7HA 1NNDA 3UVJA 2F3JA 3NGUA 6AT1B 2GVDA 3KTQA 2HAIA 1SJRA 4DL6A 3CSKA 2FGOA 3AXMA 2W4DA 2WRMA 4V19J 3GIJA 1TKZA 2MMYA 1NAQA 3HPOA 1NM2A 1GT8A 4C8YA 1QUVA 4YB6A 1JLCB 2QFIA 1K0VA 1F0XA 3VR1A 1N54B 2C2DA 4Y6IA 1QAYA 3J80U 2PFDA 4ID8A 1RXOB 4LF9F 1NO8A 2RDIA 4RJVA 1WEZA 2M88A 3MR2A 5DQGA 3RTVA 1Q81T 1HBMB 2CJKA 3TVZA 2QEXS 3A4TA 2FLLA 1N6QA 3MEDB 4ED7A 4KGXB 2FGCA 1S1TB 4FYWB 2RIJA 3EVWA 4ZLNA 3HHDA 2QRRA 4DI6A 1RT7A 2MQLA 5DDPC 2A0FB 2FJXA 2PN6A 1HNIA 4RKUC 2K7JA 1HI1A 2VG5A 3QT7A 1VQYA 4KO0B 3OBIA 3PHTA 4ZP7A 4DPWA 2B9YA 2R7UA 2DKOB 4C0HA 2HFZA 1KVJA 1GAOA 3IO1A 5BXIA 1Y0HA 1SJ1A 4F25A 5D3GB 5L9NA 4ED5A 2XWXA 4EI2A 1HR0J 1HBUA 3FBEA 4OHWA 3EM1A 4Y2MA 4QOTA 1N0UA 3TAMB 2VQFJ 4ED3A 4DR4J 2HEKA 1P9YA 3W9HA 4NPOA 1RT6A 3D54A 3IR7B 5J2PB 2QTWA 2J5AA 4RW8B 3EX7B 4DDFA 2DT9A 5KT5A 2ASYA 3QZ7A 3GFXA 1JJCB 1CPZA 3DOLA 2F40A 3A3NB 3M2RA 1C4AA 3CD5A 4JI2J 4J9KA 2JEFA 3M6XA 4B9SA 3BV8A 3R2DJ 4FF3A 1XNQF 2ZOFA 2DD8S 2GJ2A 1K1SA 1HBNB 4K2XA 2NUHA 2XQCA 1N5TA 1PCAA 2IJRA 1U1LA 3GU0A 3QFWA 2W9AA 2EI5A 2YWKA 2YNIA 2SXLA 3D1HA 5THWA 3BKTA 2VD3A 3PACA 5KFHA 3Q86A 5EN1A 2J7WA 3SCIE 1M5SA 2YKNA 2W4CA 3R6LB 5IT0A 4LFBJ 1WNEA 3I87A 4LF7J 1U0HA 3I6PA 3KMQA 1VCTA 1WG1A 4F8RA 3IRWP 1NB7A 3M7VA 4K8RA 3RR7A 3HD1A 5KFYA 2BOAA 3P3DA 4HVZA 1XMOJ 3OFGA 1R3NA 3H90A 2P9EA 3I0RB 1WC0A 3A8IA 1UFLA 3BF4A 1RA7A 3GCXP 1FNOA 2V4QA 2CNNB 3RBEA 4IKAA 4RBTA 2XCPA 1LFPA 2K1RA 4EUVA 1T03B 4ECXA 1FKPB 1G2EA 3HJVA 1L5UA 4KGMA 1TR0A 3MM5A 1VS3A 4EYIB 2NXJA 3KOAA 1UWBA 3JXOA 3QAUA 4GO7X 2V50A 2LCWA 2BACA 3MECA 3VZIA 3K5MA 3J81j 1UVLA 3AD9C 1RA6A 4P71A 1REVA 1RTJB 2BEFA 3SSQA 4N5SA 3DRSA 2YWFA 1CS4A 3C66A 3ZZOA 2X1FA 1DRZA 5AXNA 4Y34A 1S6QB 4IDKB 3POTB 4R5PA 5HN0A 2ACYA 4LF9J 4ZCKA 5EWGA 3UQSA 2DGQA 3G6YA 4Q0BA 5ETMA 5A6PA 2PDAA 3J7A1 2IAJA 1X9WA 4HR2A 1FRXA 3BH7B 3AB4B 1FRLA 5KFKA 2V8VA 2B5JA 2G2OA 3ZC4A 3VV2B 1RCXB 1ZZFA 1Y7PA 2JSXA 2M5YA 2OPQB 4OZJA 5DS7A 2PMZD 2YKPA 4CO5A 3K2YA 1FA0A 4WZMA 3IS9B 5A8RB 4ES2A 4ZVEA 4ICLA 4WE1B 3PCOB 2RQMA 4JYAF 2FVCA 3J7YI 4IQMA 1DARA 5DQHA 2DGUA 2DH8A 1YBUA 3O5TB 5A8KA 2HK3A 4DZDA 2CQGA 3SBMA 3K7RA 4Z37A 2CQ3A 1M5HA 2Z2MA 2JVRA 1UCNA 2CQ2A 4PXBA 3C2PA 1HQUA 3OQ2A 2HNZB 3FRYA 3QO9B 3CC7S 5CCLA 2W2NP 4KJIA 1JLFB 4F7VA 2VPWB 3QT8A 2E29A 2E5JA 2MZTA 2FLNA 3S6EA 5ITHA 2OJ3A 1Q86T 4K4SA 1QUPA 3FSYA 4K5SA 5LSRA 4DFMA 1KTVA 5IXUA 2JFDA 2FVPA 2IVFB 1N48A 3BR8A 4EWTA 5L9XA 3OLAA 2IY5B 2JH3A 5G0RA 3W3SA 2IC3B 3HSDA 1Z4UA 5IC4B 1M90T 1MG7A 3ILJA 4DSLA 3HFVA 3LA0A 5J1EB 1D0EA 1XNQJ 2EFNA 3JTPA 4IR1A 2J9CA 2XNQA 2GCFA 3KK1B 2GQCA 3ZZ0A 2AZ3A 3EGVA 4TQSA 4QIWD 4MK9A 2OMLA 3M05A 1R8PA 2Y8YA 1HHSA 5J2QA 2H1YA 3HVTA 1BQMA 3O1LA 1GTHA 2JDJA 1RHMB 3AQPA 4I2PA 4KR0B 3C19A 2Y9HA 3RZAA 4DL3A 3EDQB 3GTYX 4PG4A 2AGPA 4WIIA 3FKBA 3KLGB 2FJVA 4UTGA 3CCMS 2KXFA 1S77D 2D3ZA 2HHUA 1YBTA 3RRKA 4YDXA 1JLBB 4TVAB 1UJ6A 1VRTA 3LGNA 1RHQB 5KG0A 1BQXA 2U2FA 1OQ3A 4KQZA 2KZZA 5D78A 2XI2A 3KLFB 3SDEA 2VODA 4Q45A 4YR3A 3CIMA 4DR5F 4RUAA 2MEWA 4UY8T 1OPZA 4P7TA 3D67A 1B4SA 1HKAA 3FQLA 4KHPF 1YLXA 1F9HA 3FMBA 3GWCA 1P1TA 1UPPA 2FZCB 3BKUA 2DNRA 1RCOB 4N8NA 2RU9A 5EWFA 3SEOA 1SH0A 4QCLA 4RW4B 3C6UA 2KM8B 2GIQA 2MLXA 2HAFA 2C2KB 5C7PA 2DGXA 3QRQA 4NLGA 2AEFA 3TOQA 2CKWA 3R1HA 4B02A 1V9OA 1WKLA 3BQ1A 1FK9A 4X2BA 5K9FA 4UOCA 5KFPA 2RQCA 3RB4A 3BQ2A 1LK7A 3IN5A 7AT1B 3G6ES 1N5YA 4PG8A 3NCRA 3R7BB 1SL0A 3D6HB 1B64A 2WAQD 1FTCA 4ZPVR 1F5AA 2WSEC 4PWDB 4HHUA 4RR5A 2RKIA 4A8MP 2OTJS 5GAGI 3A3PB 1U09A 1X4HA 3MMAA 2AYEA 3LANA 1WOPA 4ECVA 5IV3A 2FD2A 4JYAJ 1RAJA 2JLEA 4BS2A 2HIYA 5KT2A 4Z7CA 4GVLA 2DEIA 3I0SB 5M2PA 4HH0A 2VUGA 2FZGB 4DS4A 3NAHA 4ELVA 1UZDA 1LW2B 1FT8A 2KG1A 1J5OB 1EARA 5F3ZA 1LWEB 3NP5A 3TVKA 1HIYA 5HANA 3PW7A 2DR8A 5HVFA 1WI8A 1OWXA 2MDAA 4QWBA 1HLWA 4L76A 3N4WA 1U0SA 2HG4A 2LVWA 1GX5A 3FEYB 1ITPA 2G13A 2YKQA 2CWXA 3UO0A 2GQ2A 2CNKB 1Y11A 5E3CA 1QAIA 4PZVA 2LQJA 2YVSA 2Y8WA 2LXFA 3NGRA 4M5DB 1PG5B 3NAIA 4JV0A 1C0TB 5ETSA 4MAKA 2RRBA 5EX3A 4LFAJ 1FNXH 1YJ7A 2Z2YB 4RNNA 2JEGA 4RZRA 2WB4A 5E7OB 1Y10A 4BDPA 1TP7A 1ZYQA 1AXQA 4S0MA 1WHWA 3JB9k 2QL5B 2YH1A 5HMZA 5BYQA 3SV3A 1KTQA 2BDPA 2N4CA 2XYHB 3IP0A 3W7BA 4OI1A 3E8OA 3IG1B 5GAHI 1FVSA 3GSIA 4U7UK 1PJ5A 2HGLA 2ZHOA 2D9PA 2VONA 5LXRA 1ZAWA 1DTQA 1FRMA 1S49A 4USIA 3GFZA 4ZVSB 2XS5A 2ZBRA 1NK0A 1JKHB 3GILA 3M9OB 1PYOB 5L8RC 3D0GE 2XNRA 5CYQB 1A6LA 3LW5C 1QM9A 3D0IE 1NPKA 2HNDA 3M8QB 3CB4A 1FWLA 5DM6Q 2MYFA 2RDDA 1TL4A 4J9UE 2K8GA 4Q8FA 4DR5J 4LJMA 1FE4A 4KHPJ 2HRTA 3MEEA 4L74A 3PJWA 2P2CB 2OH2A 3PX0A 4UOHA 1NHUA 3K57A 4CLUA 3ZZTA 1AB8A 2HHQA 2BABA 2Z8QA 1IXKA 1RKJA 3BPDA 3N6NA 3GR1A 4U7CA 3MUTP 1F5BA 3BO4A 2FJBB 1VI7A 1G1XA 3ONQA 2DNYA 3GP9A 3LH2S 5F9LA 3I9V9 3KG4A 2FHJD 4IFVB 2M3DA 3DM2B 2OEMA 2UUTA 4Y2IA 3BH6B 2CXEA 2UU9F 4B9TA 4E0DA 3M6UA 2UP1A 4QPTA 3HHNB 1S6UA 2QA2A 1HI0P 4AXIA 3DGVA 2XMVA 1KHVA 1X7VA 2ABYA 5K14B 2DNMA 1VQ6S 1Q5VA 2ZBQA 1IQTA 3DLGA 4W90B 5H9EJ 2GHPA 1RISA 1IBLF 1CJUA 1SJ4P 3R9LA 1T02A 4KH0B 3I5AA 3CWJA 3KLEB 3EGZA 1UWAA 1SUQB 3CD6S 2YY3A 2KM8C 4KV8B 5EDWA 1S1XA 3NS5A 3GONA 2LU1A 4EMDA 3MPUB 2CJBA 4LQ3A 3BYRA 5BR8F 2M70A 4RNFA 4P2MA 5KFSA 2ZE2B 3KUEA 4B08A 2V9WA 1RTIA 2WHOA 1NZAA 2GQQA 2BQRA 3R3TA 1FD2A 3AQOA 3SQGB 4ZPBA 4RU9A 4JI6F 2RB7A 3MWBA 3PTWA 2QYCA 3VWSA 3T3FA 4WZQA 2WSCC 5M2RA 3EVMA 3RYLA 2XSJB 4BWMA 1T7PA 2V2KA 3C16A 3CJ3A 3MR5A 3THPA 2MGZA 3LP1B 3CCTA 3QJJA 4P52A 4MYTA 3PDNA 4CNYA 3VAIA 4U7UD 1U6FA 2MXYA 1Q82T 1WORA 5DGAA 4CLLA 4J9LA 3DLEB 2KDOA 2KZMA 3G82B 3V4IA 4YMEA 3OHBA 1Z2ZA 1HMVB 1WTFA 1HYSA 5E33A 1H98A 1HQEB 2VKRA 1TMJA 4GKJF 3H20A 1KNZA 2JFKA 2Z57B 2XYGB 1RB0A 4DSKA 2ZBPA 1FD8A 1SVDA 3MHYA 1P9QC 2V8PA 4DV7F 1EP4A 1M5VC 4ES1A 3MAAB 4O4GB 2R7VA 5DDQC 4NZ0A 3WC2A 3CE8A 1WDTA 4U95A 3W61A 3T5LA 2DHAA 3MMBB 1JIHA 3V5RA 1SKUB 1RJJA 3M1VB 2CQHA 4XTTA 4DZ6A 3QIPB 4CO1A 1B0PA 2F1FA 2Z56B 1TL3A 2MTLA 1W2BR 3ZZPA 1N0VC 2AJ1A 3PFEA 3AH6A 4NLOA 2ZC3A 3OR1A 1AROP 2Z2ZA 3GIMA 3KJVA 4YHHF 5ETRA 5GVQA 1UMJA 1C0UA 4KY3A 1LXNA 5KOWA 3JAMY 4F0MA 2R7OA 4F67A 1YKWA 1TUWA 2KKHA 1IKXB 2FC8A 3KLVA 3OL7A 4USUA 3O3LA 4J90A 1ZAVA 3HHLA 2FJDB 4C2MA 1HWIA 3SCJE 4LF6F 2GNKA 2VFSA 5FLXY 1FRIA 1J27A 1ICEB 1X60A 4CTAA 2EFVA 1QTNB 2CPFA 3EWGA 2PEBA 2RS8A 1IBKF 2DRAA 4OFZA 4O3OA 5DO2A 2OKQA 1SC4B 4I7FA 4USTA 5DM7Q 5E3QA 2UU9J 3NBPB 3CW2C 3QBCA 3CJ2A 1KEKA 1URNA 1LW0A 3PR5B 4A8QA 2LECA 3ZTQA 1RTHA 3PIOQ 3GSDA 4QQBA 3CCSS 4TXSA 2KYXA 2J9DA 4NASA 1BC6A 3BSNA 3FBBA 4LBIA 2IYIA 3P5BP 3H4DA 3OFEA 2QV6A 5GMDA 2M52A 4PXEA 3CO0P 4B9NA 1RK8A 4FYXB 2VG7B 1IBLJ 4DFJA 4E98A 2FVSA 2MLYA 2XMTA 3NGKA 1D3WA 2M7SA 1RDRA 2CJYB 2J76E 3QSYB 5MAOA 2QMXA 4TNOA 2ZNZA 4WJBA 3Q8PB 2OAUA 4C8MA 1S76D 4OJ3A 1BMQB 3D5MA 2ADBA 2CZVC 5BR8J 4YOEA 4EO6A 4JI0F 2YQ1A 2NPFA 4NLQA 1RT2B 1TELA 4CDIA 2HNYB 2YNFB 3UDCA 3TX0A 2ZH2A 2FHKA 3N79A 1YBAA 1NKBA 4DL5A 4FBTA 3QGPA 1CULB 1TVRA 3TZXA 3VCDA 4DR1J 1HWLA 4JI6J 2HHSA 4URGA 3H4BA 1NSKL 2C28A 5FIIA 3TP2A 1RUSA 2I9SA 3UNGC 3GIIA 2GIRA 1JLCA 4A48A 1D1UA 2XS2A 4B3OB 3FZ2A 1S0VA 2R2SA 4OJHA 4U6PA 1N32F 1KONA 1F5CA 2BXJA 1FO1A 1UZHA 3AOAA 3OSNA 3N5FA 4ILRA 2J0XA 2BKNA 1HBMA 4OZ5A 2DHGA 5KFUA 1VLOA 2DNPA 3MEDA 4DV3F 1S1TA 4RW6B 1UKUA 5F41A 4GKJJ 3LUYA 2IYGA 2DRBA 4K4WA 3VALA 4ELTA 5CD4H 2CUYA 3ILIA 2AJQA 5E3PA 4DX6A 1KN6A 5IM0A 2HWHA 2APOA 4NE9C 4M95A 1F3FA 3K59A 4QZVB 4KO0A 1KR4A 4DR6F 1BHNA 3HKWA 3CC4S 1S6PB 1FE0A 1GXLA 3JYTA 4F02A 5ETNA 2PI5A 2Q6CA 5D3GA 1U2FA 3Q23A 5HJXA 5L46A 2OFHX 4Z2XA 5K8MA 4HT7A 3TAMA 1NKCA 2I5JB 2O1PA 4P6QA 2RJZA 4HEA9 3L7OA 2GJFA 2N3LA 3ZNUA 2ZH4A 1R6VA 4YHHJ 5J2PA 4RW8A 5KFZA 3DGPB 2Z2LA 3DC2A 2PT0A 3AJ1A 4J9RA 1ULRA 3BB5A 2UVUA 3C6TA 4B3TF 5GADU 1T8EA 1RBLA 1MU2B 4NA2A 4EO8A 2KFNA 5IQ6A 4LF6J 3Q8RB 2BJ9A 2UVVA 1DURA 3HDSA 4NYPA 4ZCMA 1HBNA 3PNIA 4RWWA 2EKNA 1S4EA 2ZZMA 2N4DA 9RUBA 5DDOC 4ED0A 3H2UB 3IA0A 2BRLA 3BSAA 2FB0A 2J9EA 2C2MB 4KHMA 1RAOA 1YGYA 2LDIA 2W25A 4CH0S 5DJBA 1C2PA 5HP1B 3GJSB 4O23A 3NL0A 3RW7A 2MZJA 2DR7A 1FF2A 2KXHA 3GYXB 3ZTPA 4DBQA 3SZ2A 4TY8B 3FCVA 1I94F 4DV4F 1XN9A 1WDDA 1VISA 3I0RA 1CJTB 5T7LB 3VGVA 5LMNF 4W98A 5KT3A 4X4SA 2RH3A 5DLGA 2EBEA 1LK5A 5KG1A 2UV8A 2DHXA 2OIHA 3FBCA 2L48A 3AT1B 4F26A 5E5NA 4NLSA 5DLFA 2HQCA 1T9XA 2W2QP 3R5AA 1VQKS 4JI0J 1P6TA 3H5SA 3HSZA 3GJRB 1OMSA 3ZO7A 2HQIA 1LWCA 1D9FA 4OYZA 4AT1B 4ZN1A 1WOOA 1UW9A 2ATCB 3QIDA 3J7YU 2A18A 3H5YA 3QT6A 3LP0B 1UPMB 3CCRS 2N7CA 3CCVS 1AFJA 3MR7A 4H4KC 7FD1A 4IDKA 5J1PA 5L1KA 2OD6A 3POTA 1N32J 2CPYA 3WX4A 4DG1B 5HAOA 3H2LA 1MSWD 4IOAQ 2ZKUA 1A0OB 5HI7A 2B51A 2HW3A 4DV3J 4G65A 1RWVB 2KJWA 4Q2LA 3WBZA 1R27B 3TI0A 4V1Ak 4FXWA 4F4XA 3GLJA 4YS2A 3MFHA 3W2VB 1NHKL 3K17A 2W8LA 4R0JA 1C1BB 2QLFB 1T9TA 4C8NA 4AL5A 2V5HG 1X5SA 4DR6J 5A8RA 4MKBA 1EIYB 1KQKA 4OLOA 1REGX 2XWYA 4UOGA 2R7WA 2OSQA 3N5BA 1L3VA 4LRCA 2VHGA 2PD1A 3P49B 2V63A 2ZC4A 2BKOA 1TFWA 5IC6B 2WZ1A 2H5IB 4QIEA 3F41A 5KTQA 5JMNA 4ZCLA 4LSLB 3GV8B 1FDAA 2PFFB 4IH7A 3JAMU 2HNZA 4F2RA 1M5KC 4DQIA 1NCLA 3ET6B 2DJWA 2KJVA 1R89A 3UNYA 1ZETA 1U6BA 2DR6A 1R0BG 2IBKA 5FLXU 4FPRA 4WU2A 4I4BA 2MPUA 1P1LA 1VBZA 2IC3A 3KNAA 3CDUA 2MLZA 1M5OC 4DV1F 5C24B 3J7ZT 1MROA 3V6HA 2MZRA 3OR2A 3T9ZA 2BYCA 5K5MA 2HVIA 1J2VA 3KK1A 5D0GA 1PAEX 4HI1A 2YX4A 3M30B 2OLWA 1O6XA 3QNWB 3DXBA 4FF2A 4UY85 5EX0A 4ZVFA 4WFNQ 2MKIA 2RUGA 3C8YA 5HBMA 2BOPA 2XO7A 5KT6A 1VRQC 1K44A 8RUCA 2ZUGA 2WVBA 1DY3A 2YQ0A 2O5DA 2NXCA 4KKOA 2V6AA 4IOCQ 1GMVA 2I38A 5DZ7A 1Q0NA 2L41A 1Y3JA 3KLGA 1I94J 1SV5A 4DV4J 4DMZA 3V6DB 3G71S 1RWOB 3ISND 1MW7A 3B8HA 4HHHA 3M6WA 3VVTA 5F8JA 1Q16B 5LMNJ 1G4CA 4DF8A 4A46A 1S9FA 1KWMA 2CPZA 3QSIA 2XY7A 3BSCA 4ZVQB 3KLFA 3CD0A 2E5GA 2Q1LA 3CF5Q 1DLOB 2VICA 4F04B 1B0TA 1N88A 3BGFA 3OD2A 4NA1A 1IM4A 4ENOA 5GAGU 3E2EA 4D3HA 4ELUA 4IFYB 2FJAB 3MGJA 3TZWA 4QPXA 1VR6A 1RWMB 3CO9A 1TZ0A 2NSBA 2WTFA 4OYPA 3HX9A 4TN2A 5GMEA 4RW4A 3CCZA 2HSEB 1AW0A 5KFEA 1JLQB 4YFUA 1VQOS 2HVZA 3V2UC 1RABB 4UQGA 4X65F 1VQMS 2CDRB 4F3MA 2MQPA 4OYAA 5IWAF 4IO1A 4KHRA 3MZIA 2VA3A 1RWKB 1NJXA 3WQPA 2OSRA 4CO2A 1VJQA 5F8NA 3JQKA 3ZZRA 4YY3F 2XSFA 4YR2A 2J8SA 3KK3A 3EPIA 1RLDA 2XO6A 2XLIA 2VBXA 5D0RA 4M63A 3RG6A 1TK8A 4K5RA 3C15B 4OHXA 2ZJPQ 1I51B 2NZCA 3BR9A 2UZAA 1MN9A 1RLCL 1H2VZ 2POKA 2QG9B 1VBKA 3NNAA 1FDDA 2BJDA 4PQUB 2CJAA 2HQDA 4TQRA 1NEEA 1HNWJ 4XO0A 2ZWOA 4DFKA 4B3MJ 8ATCB 3L9ZA 1WHXA 3I0SA 2G1DA 1C1CB 2J7UA 1LW2A 3OL6A 5IT9Y 1J5OA 4NI2B 3MD3A 4OYXA 3TA2A 4G1QB 1LWEA 4E2FB 2OPRB 3PXGa 2J6TA 3B54A 5GAEI 4P9SA 3K58A 2JZ5A 2PO4A 4J9OA 3W8GA 1EKRA 4P2FA 2WVDA 3R8YA 3PJ9A 5LT5A 2R8KA 4PUOB 5DG7A 2C3MA 1J5EF 3BO2A 5ETVA 2FZKB 4DX5A 3SV4A 4NZ6A 4ZVHA 4GC6A 2LLZA 1RT4B 1FFSB 2WVFA 1ZPWX 2BQ3A 4UF4A 2V8GA 4DV1J 2V4JB 2BA9A 1H7XA 1VC6A 2L08A 1KQFB 1C0TA 3D0HE 4XDDA 3OFFA 2JVOA 1S7IA 5KFMA 3HF5A 1X4DA 1OPIA 4I0WA 4ED8A 2KL8A 4ITSA 1JX4A 1SJFA 4FNIA 5K20B 2OPSA 3CC2S 2BJEA 4PABA 1PILA 2DY9A 1Y9OA 2A3JA 3KJNB 3MEGB 3BEGB 1JNRB 1FERA 4IYQA 3DOMB 3VAJA 1CJVB 3ETMA 2HGMA 3IG1A 4DF4A 2UVWA 4P2SA 2K7KA 2GS8A 4OHYA 1VOMA 4K4YA 3MXHP 3S8SA 4ZIVA 1KS2A 5IT4A 1GK8A 1TKXB 1URRA 4USJC 3AODA 5EHHA 3OW2R 1JKHA 1DHMA 2HWIA 2R3VA 4QR2A 3IC1A 3UFCX 2IIHA 1VQNS 3RR8A 3NLCA 5C2CA 1VDHA 1RSCA 2R2TA 2D7SA 1KC8T 3TAQA 4CWBA 3G96A 2MHEA 2OEKA 4LF1A 2CWKA 2KO1A 1QLNA 2VFTA 4YDDB 4WCEQ 2ZZTA 4JI4F 2RNEA 4C3KA 4NWBA 3A1YG 3MI7X 4CO0A 5B0CA 5CH7B 4JI8F 1U4BA 1WWHA 2DIUA 2EW9A 1WEYA 1JXLA 1SL2A 4HTJA 3UCZP 3TUPA 1UEVA 2OGUA 4IFVA 4X65J 4C3MA 2H4WB 3DM2A 2MZQA 4EBCA 2BW7A 5IWAJ 4QU6A 1TK0A 4DSEA 2GA7A 2F8HA 4EEYA 2AEMA 1VQ4S 4X64F 2I8EA 1MLAA 4IR9A 4F0HA 2P9GA 5JVGQ 1S1VB 4YY3J 3R27A 5L1LA 2HURA 4OLPA 4FZVA 4KGVB 1PJ6A 5K14A 4WFYA 3THTA 2UUCF 4DSJA 2KT3A 2XHCA 2ZH1A 4XAKA 3CTRA 3TA0A 2B8PA 1L3SA 1IWAA 3RB3A 4B9LA 2IDEA 5C42A 3KLEA 1SUQA 2XS7A 3KG0A 2CQPA 3W9JA 5ADZA 4E8UA 3M2UA 2B6AB 1YITS 4YB1P 1JMTA 4ZN3A 1CG2A 3Q8YA 4ZVRB 4P7VA 3MAQA 2YWGA 4DV6F 1RHUB 3CDBA 4K4TA 4QBUA 3IAS9 3UR0A 4WFAQ 3I4PA 3GG1A 2BR0A 4ERDA 1RHJB 4J9NA 2CG4A 4DJBA 3NOGA 1J5EJ 2EC2A 4NXNF 1XTZA 3LP1A 5AE1A 1EQMA 4FPIA 3MM9B 3DYAB 2ZVIA 1HNZF 1RT7B 1SKRA 4LFCF 4ZCIA 5KG6A 2MB0B 3G82A 2O67A 1RBAA 2Y1RI 1HMVA 1XMQF 2RF2B 3U1MA 3NGDA 4OYWA 1HQEA 2FC9A 3HLUA 3N6MA 4MK8A 4QWEA 4F4AA 4IG3A 4LRAA 2KRRA 1DQAA 3UD5A 2IDLA 1WHVA 1N56A 2KI2A 3V4MA 1P27B 1NXIA 2F63A 4DR3F 3MCNA 2IA6A 3K5LA 4TYBA 5CYMB 1LOUA 3BBBA 3MAAA 1H6KX 2CVEA 4O4GA 1RT6B 1KLMB 2DK2A 5ETKA 2ATLA 2E9RX 1NK6A 3MMBA 2VPZB 4USVA 3FC9A 3WHIA 3M1VA 3QIPA 2W9BA 2HFOA 2YX7A 4IG0B 1HARA 2GGPB 2NS1B 2UUBF 3B6BA 1HBOB 1KSPA 3CCJS 4CYUB 4C0BA 5LMUF 2N3OA 3TEHB 5DDRC 2HQFA 2XY5A 1OYEA 4WIQA 1F9FA 4DCJB 2R7RA 5IZHA 3KJFB 1UVKA 5KFVA 1N34J 2QSWA 1NDLA 1S0MA 4EBEA 2LXIA 3FUYA 2QO3A 1IKWB 4B9UA 1DZ5A 4CLFA 3BO3A 2DB1A 3DLJA 2Z0GA 2R4FA 3CD7A 1FHTA 2B3TB 4DX7A 2YKOA 4NRUA 2XEXA 1IKXA 4JI4J 3M8PB 4C8KA 2HBYB 1GEHA 1S6OA 1YJWS 3C14A 3DXSX 3JS9A 3R1LA 4OJ1A 3MEKA 2AKWB 2LA4A 5BYSA 3D1OA 2ZH6A 3A13A 3M8SA 4I6WA 2EKYA 4Y2AA 2HBQB 2P5VA 4IOBA 3DCAA 1RHKB 3H40A 3ITHB 2AJFE 3EZ5A 3CJKB 4A8YA 3MPYA 4X64J 2PIIA 3OTDA 2CPHA 2EVZA 4WFBQ 2VG6B 3QLHB 4CT9A 2H65B 3ILLA 2DGTA 1Q8LA 4K7QA 1JLGB 2UUCJ 1FJGF 3FRZA 4H4KA 3EUNA 4UT4A 3GE9A 4NMXA 1WKJA 3EYZA 2GZOA 1ZM9A 1YJTA 4CLWA 2JX2A 2BUNA 3EZOA 3MM5B 3I9ZA 1UWBB 2OTLS 2QIFA 4Y28C 1UETA 3MECB 3KK2B 3SCKE 2MQOA 2ILYA 2BE9B 5H9FK 4X66F 2J8AA 1N8RT 2VFUA 3OLBA 2M2BA 3A3OB 3SIPB 2DNNA 2KRBA 3OHAA 2NSCA 3U1NA 4O44B 1CQNA 2DGWA 3VTIA 1NDKA 2K3IA 4EFAC 8AT1B 3LQVA 1O5JA 1RT2A 3OTOF 3K5PA 3OSPA 2HNYA 2YNFA 4R5PB 4DV6J 4G1IA 1U24A 3R5JB 1TL7B 3NWRA 4C9DA 1CULA 5CD4A 5D4PA 2AIRB 1FFGB 3WX8A 4RUBA 4P72A 3BM7A 2E7XA 4NRTA 3FCHA 2VF3A 4O3RA 3HXMA 4NXNJ 2AYGA 2P8IA 2DNZA 1U1PA 5JXSA 1IKYA 2W24A 3KG1A 4PKDB 4JI3F 1FI4A 2AJ4A 1OJ4A 4F0KA 2DGOA 4U96A 4LFCJ 3AOBA 3M4XA 2ZDOA 3PHEA 2HHXA 4XPEA 1HA1A 4CRJA 4Q44A 2IRYA 4RUHA 3CCES 1XMQJ 1NK4A 2HFSA 4ICLB 3MMJA 4EZ6A 4HACB 3O6QA 4RW6A 3KHGA 3F56A 2CPJA 4CQ1A 1IBMF 1HWUA 4Q43A 1FFWB 3D3BJ 5AE2A 3O44A 4DR3J 3HZEA 4JV2A 3R5BA 2BJ3A 3I82A 1F60B 3WDOA 4CLPA 4FYDA 2GHWA 2X1BA 2UV8G 1I6JA 3K89A 2VJUA 2HVEA 5EGYA 3QRPA 1FJEB 3P96A 3X1LB 3WIUA 3HULA 3JSMB 3ZZYA 3EE3A 3TRGA 2KT2A 2ZITA 2L9WA 4K50A 1ZAXA 2UUBJ 3E01B 2PSZA 4WK1A 3Q8UA 2NLWA 5LMUJ 2I5JA 2NXUA 4FVMA 2FJEB 4NLWA 4HL9A 3N01A 4OYMA 2YWHA 4NLPA 2OHDA 4MYUA 1O51A 1U02A 5LXYA 1FCAA 1VRUA 3DGPA 3TARA 4NCGB 2PA8D 1S79A 4NLXA 3UDEA 2DBBA 4A8WA 2W7PA 2Q66A 2A10A 5HLFB 2KVQE 5HROB 2B56A 1JQGA 2HRYA 1OY8A 2YTCA 2NYHA 1MU2A 5J2QB 3RW6A 4NLRA 4QWAA 2GC8A 3QPIA 1RZMA 5EUHA 3PYEA 2JLFA 4GRSA 1TU0B 4WKYA 3W5ZA 3MR3A 3K0JA 4I2PB 2F8MA 4KIAA 4JBCA 2C3YA 3UDVA 1T9VA 2CNLB 2LQBA 1CQMA 4KYZA 3ZFVA 1SJQA 4ZPWR 2JC0A 1S9EB 1GXUA 4X4TA 4AYBD 1PYSB 4OI6A 2GAHC 3KLIA 1MMDA 2B7BB 4PG5A 3MD1A 4A8FA 3SDEB 1AT1B 3CNQP 5BYRA 1FJGJ 4JUZA 4NLDA 3ICLA 2DIVA 3I5CA 4N56A 2ACMA 3TUIC 4R8UA 4LR8A 1BGXT 4A8OA 1G6BA 1RWXB 4PPZA 4J91A 4L72B 2JRSA 4X62F 1CJTA 2CPIA 4NCBA 5D0HA 1T05A 1Q5YA 1NZ8A 2EPIA 3E3XA 3MURP 1Q4RA 1NPPA 4X66J 2LXUA 1S9GA 4P2XA 2VOPA 3S01A 2EFQA 4OYOA 1SXLA 3KHLA 1KD1T 3VAFA 4DPTA 3RAMA 3M6VA 4IRDA 2WVEA 5D8HB 1VFJA 3OTOJ 1HWJA 2ZOGA 4LREA 3SQOP 1MN7A 1HHTP 1U1NA 1IR0A 1GMWA 2YX1A 2ROPA 2W1BA 3GQCA 4KE5A 4N7TA 1V3ZA 1PAUB 2MQMA 1YRTA 5A8WB 3PW4A 3JSYA 5JVHQ 4K2JA 3PYGA 1LNQA 4OZ2A 1X5OA 5DG8A 3THVA 4X4RA 2MKYA 3V6JA 1QY7A 1WC1A 3PW2A 3FEXB 2QA4S 3CDEA 4JI3J 3EXYA 3QGHA 1ZTWA 3TANA 4J37A 4O3SA 4I1TA 3RRGA 4DG1A 2COLA 3OXGA 3US5A 4PXDA 2CYYA 1B99A 2XG8A 3OJUA 2OP5A 3Q8VA 4ZIWA 3IM8A 1S1UB 3ZTSA 3BPSP 5HK4A 1BQNB 1X31C 1WACA 1IBMJ 2CQIA 4AD6A 2G0IA 1CJKB 4PWUA 4DOZA 1VMBA 3OTEA 3OXLA 3W2VA 4NLUA 1BE4A 3IWXA 3AFGA 4P75A 1C1BA 3H5XA 5IOLA 1AZSB 3DN9A 5KFAA 5DQIA 1TV6B 3NNHA 3CEDA 5K8NA 5HMYA 3CMAS 4B9VA 2R8HA 3OVBA 1TMMA 4TKTA 1H2TZ 3J7Z5 3CJ4A 2EFOA 1HHQA 3WIVA 2DNGA 2R8JA 4LSLA 2FHMA 2XLJA 1E6VA 3T5HA 4JOUA 1KBRA 4KRWA 4LF4F 1WC6A 2RS2A 4ES3A 2DXDA 3SXLA 2JL9A 4QW9A 3SFUA 3RU0A 5E41A 2VFVA 2XLKA 1S12A 3R5GA 2M8HA 2ZH5A 2W2PP 2DCUB 4X4OA 2VOOA 5LSLA 5C24A 2XY6A 3I5BA 2FY1A 2FLPA 4DV2F 4AXJA 3MUMP 1V3RA 1U1QA 2DTJA 2KH9A 3HFKA 3CGIA 3PIPQ 1LFWA 1U8SA 3M30A 2QYGA 4J9MA 2EG2A 1DTQB 3RRHA 2R2RA 3FBFA 4RW9B 5I4MA 1WF0A 1SCJB 3EPGA 1I3OB 3GCWP 1Q95G 2C1EB 2D69A 2VPXB 3BZQA 4MIBA 2XZWA 3VVUA 2BJ7A 1AA1B 1WD6A 5FDLA 2EWHA 1V3SA 3HFZB 4ZVUB 5IFMA 3W65A 3V6DA 3DHWC 3BSOA 3CMES 1TK5A 2CPEA 1YVFA 5KFBA 4X62J 2QC3A 3MCMA 4LBHA 4DFPA 2F4VF 4LF8F 3KHHA 2GVZA 4P73A 3ILOA 4NL5A 2P9CA 4NYOA 2VPYB 1T3NA 3J7AN 2ZOMA 1DLOA 5B08A 1Q7YT 3TUJC 3MTJA 3DLBA 4N76A 2W2OP 2C2ZB 3DRRB 4L6V3 4LR9A 2EFGA 1N33F 4QR0A 1SQEA 1BWEA 2D1CA 4RU2A 4YUDA 5KOXA 1IKVB 1V5IB 2AMCB 3OVAA 1RBOB 1UA1A 3D6FB 4URQU 3OUYB 1HL6A 3F0NA 1SI9A 1IBCB 1PKUA 4DL0C 4HKQA 2CZ4A 2C42A 3DOKB 4LRDA 4FS2A 2QSFA 4ECSA 1VLYA 2DPIA 1NUEA 1TAUA 4LIWA 1Q53A 1NMEB 4X4VA 1F9EB 2HQ3A 5CQGA 3KLHA 3MR6A 2HKEA 4KFBA 3VAMA 1CJUB 5KFRA 4ECUA 2C2RA 5HJYA 4M5HA 1LQ9A 1L3KA 3CJ8A 1HWKA 4Q8EA 4J7CA 5KFDA 1OSCA 2B4UA 3PRVA 2HS4A 4L75A 3K8WA 1LWFA 2IJFA 1KP6A 2W2MP 3C15A 4O3PA 2KXNB 4URSA 2BRKA 4PWWA 4ECTA 1K8AT 2RDJA 3NS7B 2LFVA 2NUUG 3O8WA 3BJYA 2HFUA 3RBDA 1XK8A 3CCWA 2FLOA 3K5OA 4PQUA 1SKWA 2OO4A 4ZA1A 2YNGA 5IV4A 2EC0A 1U7LA 1D9AA 2HHTA 4MTPA 2MQQA 1LXJA 1LEOA 4H54A 1C1CA 2JEIA 1YHQS 3KJQB 1N5QA 3L09A 4NI2A 2WBMA 3DU5A 4G1QA 3BGRB 2OPRA 4LF2A 4LF4J 2A2CA 4M5LA 3M32B 4EYHB 2HFNA 3QATA 4KBIA 4CI0B 4MKVA 2HS0A 5A0YB 5HQ8A 4CO3A 4W4MA 3HM9A 4KGZB 1RT4A 4ID5A 3HVAA 4QIVA 1MWQA 4F4YA 2DNOA 2J9DE 5D77A 2XMKA 1LKZA 2V4JA 4OZ0A 4DV2J 4ATNA 1ELOA 3NEKA 2OELA 4OMFG 2G0CA 1U1RA 5D4LA 2E7WA 4QYZK 2AJ0A 1P8GA 5SUHA 1U6ZA 4JI5F 2QX0A 4NEZA 1TL3B 4NXMF 5I3QA 1UTAA 3MEGA 5I3UB 2NPIA 2VQFF 5E3AA 1XQIA 3DOMA 1D09B 3NNCA 1GTEA 1CJVA 2IPOB 2QMWA 3OR1B 4A47A 2A6OA 2MKKA 2XTJP 2VDIA 4CZCA 2R7XA 2HGNA 1F1BB 2VV5A 4J9QA 1H0HB 2QGFB 4JI1F 3BBCA 1TKXA 1YX2A 2DNQA 2F4VJ 5HQLA 2AWZA 4LF8J 1GNKA 4F3OA 1R7IA 3DRYA 4ZPAA 4MFBB 3HHLB 3RAXA 1K1QA 1XWLA 1VC0A 1PJ7A 2W4PA 4I64A 3B78A 1M5PC 4OV6A 1VQ9S 2ILZA 1R6YA 1RAAB 4K4XA 1CEZA 2JEJA 2IM1A 5D4NA 3UCUP 4DQPA 1UL3A 3HMJG 1UEKA 1N33J 4I56A 1Q8IA 3DRPB 3G86A 1U45A 3VGSA 3P5TL 5BJRA 2I1RA 1MNEA 2RU3A 1LW0B 2HPUA 1RTHB 3MM7B 3TAPA 4LVOP 2XZDB 4TU9A 4KTQA 2CJ9A 1PC4A 2VASA 4ZDNA 4DQRA 3U1LA 2CAJA 1XMOF 2H5JB 2CZ9A 1VHFA 2CFXA 4O4RA 2D74B 2QLBB 3QWUA 3IGVA 2CQ0A 4BC9A 2Y0SD 1F6TA 4HLBA 3GZ7A 3PG9A 1RP5A 2H5EA 1YK9A 4MIWA 4U67Q 2X1AA 2CJXB 1CC7A 4DL7A 3TQEA 1T94A 4DR2F 3GPAA 3SFGA 3HZGA 3NXZA 2AX1A 4ZHRB 2IMWP 2OMOA 3Q89A 2ZDPA 2VFRA 3MM8B 1V6HA 2NXNA 4BHQA 3U27A 1TVRB 4NEYA 1KQGB 4ZVOB 2DNHA 3OL8A 2B6AA 4KT0C 2RT3A 2LEAA 4PCQA 3IR6B 2ZEJA 3D2WA 2LQ8A 1RE1B 2CQ1A 2ZNYA 1UJ4A 1A9NB 1Q79A 5KAKA 1NKEA 3KFWX 5EWEA 2XB2D 2HYIB 2H3EB 1RT1B 3ETOA 4RNHA 4DUYF 1TAQA 5LM7E 4N77A 3JQMA 2Y1JA 2UUAF 4TU8A 4FYVB 1FRKA 1N36F 1AYEA 1JWWA 5KG2A 1HD0A 3MM9A 2BKPA 3DYAA 3TQ1A 2RAQA 4C97A 4IH5A 2C3PA 1FXRA 2BANA 5CCMA 4TY9A 5IM0B 2X7IA 3NGTA 5LJ5Y 4XDCA 5HVGA 4A8SA 2OFGX 2RF2A 1S1WB 1VBYA 4CCHA 4IUFA 3I4HX 4H4MA 1X5TA 3JYTB
chains in the Genus database with same CATH topology
1Q7LB 3FGVA 3IC1A 4NLGA 3UFCX 4ZMMA 3G6VA 3TOQA 1K0TA 1RGVA 1S4FA 2MY8A 1VQNS 3RR8A 2CKWA 1ZM4A 3MM6A 3NKYA 3NLCA 5L1JA 3R1HA 3M8RA 2FVRA 2R2TA 3Q8SB 2D7SA 2KN4A 4B02A 1V9OA 1KC8T 2M0GB 3PRDA 3BQ1A 3TAQA 3UPFA 1FK9A 3G96A 4X2BA 5K9FA 4UOCA 5CYMA 2MHEA 5KFPA 2MQNA 3NCQA 2RQCA 3RB4A 3QJLA 2KO1A 1QLNA 3BQ2A 4FN5A 1LK7A 2VFTA 2DNKA 1WELA 3DI6A 4YDDB 3IN5A 3HVRA 1U25A 5A8KB 5JUMA 1KLMA 3G6ES 4WCEQ 1N5YA 1QAXA 4PG8A 2IA0A 4X4PA 4JI4F 4Y2KA 2RNEA 3NCRA 4C3KA 1SL0A 2IM0A 1HPZB 3AA8A 1X4FA 2LEPA 3A1YG 4NWBA 3FVYA 5L39A 3MI7X 4CO0A 1B64A 1HQUB 2WAQD 1FTCA 1DFDA 4ZPVR 1F5AA 1UW4A 1JJ2R 3HO1A 2F9DA 5B0CA 3GFHA 1RTDB 2WSEC 4LT6A 5CH7B 4JI8F 2ASJA 1FEEA 2V8DA 1U4BA 1WWHA 5CXTA 4PWDB 4IG0A 2GGPA 1S6PA 4PRFA 3MPWA 2DIUA 2EW9A 1HBOA 1X4AA 2RKIA 1WEYA 3IWNC 3C6TB 3FFIA 4A8MP 1JXLA 1SL2A 2OTJS 4HTJA 1QAJA 3UCZP 1UEVA 3LF0A 2NREA 5GAGI 1HNWF 1E6YB 1NK5A 4Y00A 1HW8A 1U09A 1X4HA 3MMAA 1FTRA 4IFVA 4Q7AA 5T41A 2AYEA 4C3MA 4B3MF 1RT5A 3ISZA 1O8BA 3DM2A 3LANA 5G4DA 3KHRA 1KFSA 2YKMB 1TUVA 4ECVA 3L7PA 2MZQA 2FD2A 1RAJA 1S48A 2JLEA 3G8TA 4EBCA 3CVKA 4QU6A 4RUCA 1TK0A 4DSEA 5J1NA 1HW9A 2GA7A 5G0RB 4BS2A 2F8HA 5KT2A 1IKWA 3MMCB 4EEYA 1VQ4S 4X64F 2YNHA 1E6VB 2I8EA 2ADCA 2HS3A 4K4UA 1QSLA 4IR9A 4YB7A 3NCPA 3AJ2A 3I0SB 4C11B 5KFGA 5M2PA 3Q2TC 4HH0A 2VQEF 2P9GA 2VUGA 5JVGQ 3G8QA 1S1VB 4DS4A 3NAHA 3M8PA 4ELVA 3R27A 1LW2B 4DL4A 2AGOA 1FT8A 4R25A 2KG1A 5L1LA 1YI2S 4CO4A 3UDLA 4OLPA 1J5OB 4FZVA 5K14A 3THTA 4WFYA 2UUCF 3IGNA 4DSJA 2J6SA 5F3ZA 4FF1A 1U48A 1SBRA 1LWEB 3NP5A 1PGZA 3TVKA 2DITA 4I2QA 2KT3A 2BW2A 3PW7A 3RB6A 2DR8A 4L3NA 2GV1A 4XAKA 2ZH1A 3CTRA 3TA0A 4A8XA 3V81A 3EGWB 1L3SA 2JWNA 1WI8A 1OWXA 3PKYA 3RB3A 4B9LA 2ZHBA 1H38A 2MDAA 5C42A 2KHCA 4QWBA 6FD1A 3DLKB 3ITHA 3KLEA 3HVTB 3T9NA 4CH7A 2WOMA 1TKDA 1SUQA 3N4WA 4A8KA 1S10A 2HG4A 3JSBA 2LVWA 1HI8A 1BQMB 1GX5A 2PE8A 2YQ3A 3FEYB 4WFXA 5D6GA 2XS7A 3KG0A 2VBZA 2E5HA 1TL5A 2CQPA 3CCUS 2G13A 2YKQA 5ADZA 3CJKA 1KHWA 3M2UA 4E8UA 2KHDA 2B6AB 2GHVC 2AV5A 1YITS 2XHWA 2L9NA 2GQ2A 3MTKA 4WK3A 4YB1P 5E3CA 1JMTA 1G3OA 1QAIA 2A1BA 1XNRF 3HHLC 3IBWA 2VG6A 3QLHA 2LQJA 2YVSA 1XR5A 2LXFA 1CG2A 2C22A 1GXTA 4RBUA 2BE2B 1FRJA 1TL1B 4P7VA 4M5DB 1UVMA 2C3UA 2IM3A 2RMLA 5GADI 2JJ4D 3OXFA 3CIZA 5DGBA 2XC9A 1RT3A 3NAIA 4JV0A 3MAQA 1C0TB 2YWGA 4DV6F 3IRXA 4MAKA 2RRBA 1JLGA 4HDGA 5EX3A 3QGIA 1T95A 5HL7Q 1FNXH 3CDBA 4K4TA 3MOZA 3Q0AA 4RNNA 2JEGA 3AAWB 4QBUA 2ZH9A 2O3DA 3IAS9 2DR9A 1VRTB 3UR0A 4RZRA 4WFAQ 3I4PA 2WB4A 5E7OB 3OJSA 3GG1A 1YJUA 1LWCB 4BDPA 2MZ1A 1TP7A 5A2QY 2BR0A 4ERDA 3DMJB 1ZYQA 1L3TA 4J9NA 5HP1A 1AXQA 2CG4A 1WHWA 4DJBA 1NK7A 3JB9k 4TYAA 4NXNF 1XTZA 3KK2A 3LP1A 4HTIA 5AE1A 2YH1A 2AP6A 3MM9B 5HMZA 5BYQA 5FDLB 3SV3A 3DYAB 1HNZF 4TY8A 1KTQA 3GYNA 2BDPA 1Y00A 2L3MA 1RT7B 2LQ9A 2B9WA 4HH1A 2N4CA 3J81Y 1SKRA 3FSXA 2E1AA 4I69A 2E9TA 3W7BA 2D41A 3E8OA 4OI1A 2WONB 3IG1B 5GAHI 2R8GA 4LFCF 1FVSA 4U7UK 3D28A 4O44A 2HGLA 1ZM2A 5T7LA 2ZHOA 2D9PA 2G9OA 5KG6A 4ZCIA 2MB0B 4F4ZA 2VONA 3A8EA 2O67A 4RNMA 1BD6A 4YQWA 2Y1RI 5LXRA 3HKZD 2OPPB 1HMVA 1FKOA 3ENWA 3PZPA 1WG5A 1RWUA 1XMQF 1ZAWA 3AY0A 1DTQA 2RF2B 3U1MA 4BCAA 3NGDA 3GV5B 4NLVA 2NYIA 1FRMA 1S49A 4USIA 1HQEA 3C6UB 3I56S 3GFZA 2FC9A 1XEZA 4NYZA 2XS5A 3I31A 3HLUA 4RW7B 2E5LF 3H98A 1NK0A 2M8DB 4C98A 1JKHB 3N6MA 5F8IA 3GILA 3BQ0A 4MK8A 5L8RC 4QWEA 3D0GE 3M9OB 1R0AA 2XNRA 4IG3A 5CYQB 3HJFA 1SIZA 1A6LA 1DQAA 2KRRA 3LW5C 1QM9A 3D0IE 3IXQA 2HNDA 3M8QB 3CB4A 1WHVA 3ULHA 5DM6Q 1X9MA 1N56A 1XC9A 2KI2A 3MM6B 2MYFA 3V4MA 1TL4A 2K8GA 1P27B 4QR1A 4Q8FA 4LJMA 3TA1A 4DR3F 1FE4A 1FK9B 2UXCF 1OO0B 2IA6A 3K5LA 4TYBA 5CYMB 2ZHAA 1LOUA 4QWCA 2X51A 4C0OC 2CQDA 1KOOA 4TLQA 1NH7A 1VIXA 1H6KX 2CVEA 5FD1A 3MEEA 2IHR1 4O4GA 3PKMA 2B4PA 4OV1A 3B4MA 3DI6B 3DNCA 3PJWA 1RT6B 1KLMB 2HHHF 2OH2A 3LP0A 1X4GA 2DK2A 3PX0A 1N5YB 4ED1A 1K73T 2J0WA 4U9RA 2ATLA 2E9RX 1NHUA 3K57A 1NK6A 3ZZTA 3MMBA 2HHQA 2BABA 4CH1A 2Z8QA 2QZ8A 2VPZB 1IXKA 3PEJA 2FDNA 5HMXA 1DBDA 3M1VA 3QIPA 4ED2A 1RKJA 4OJGA 2W9BA 1U47A 1FVQA 2HFOA 3N6NA 1UAWA 3GR1A 4U7CA 3MUTP 2YX7A 4IG0B 1HARA 2GGPB 2NS1B 1F5BA 2UUBF 3BO4A 3KLHB 1MMLA 2FJBB 4G6VB 4I6AA 5CZVA 1HBOB 1VI7A 2RKIB 4KFBB 4K4ZA 3T5JA 1G1XA 3FFIB 1KSPA 3ONQA 3CCJS 4PXCA 2DNYA 4DWIA 4C0BA 5LMUF 4YP3A 2N3OA 4ZP8A 3LH2S 5DDRC 1D8ZA 3KNGA 4LUBA 5F9LA 3I9V9 3KG4A 2FHJD 3MMAB 4IFVB 2XY5A 2M3DA 1F9FA 3DM2B 2MJUA 2K3KA 3PV8A 2R7RA 2AU0A 5IZHA 3SCLE 3BREA 1T3OA 1FDNA 1UVKA 2UUTA 3PJXA 5KFVA 4OZLA 4Y2IA 2GMLA 2QSWA 2UU9F 4B9TA 1WI6A 4HT5A 3QZ8A 4EBEA 3M6UA 2LXIA 1S0MA 4E0DA 1N5VA 2UP1A 2R7QA 2QO3A 4QPTA 1IKWB 3MPVA 2XMUA 2XGQA 4B9UA 1DZ5A 3HHNB 1S6UA 2YNHB 3CDWA 3BO3A 2DB1A 1LWFB 2HLTA 2FHOB 3AHPA 2Z0GA 3DLJA 4WKRA 1U49A 2QA2A 2R4FA 3CD7A 2D3OR 4N41A 2IFXA 2B3TB 4ECZA 1HI0P 1FHTA 2YKOA 4NRUA 4AXIA 2XEXA 2CPXA 4DN0A 4XK8C 2ZJRQ 3IWLA 1IKXA 4EZ9A 3M8PB 3UE2A 4C8KA 4DSFA 2XMVA 2OD4A 1K9MT 4ILLA 3HHLD 1S6OA 1KHVA 1X7VA 4NLYA 3JSMA 2ABYA 4DS5A 1YJWS 3DXSX 5K14B 4C4WA 5KG7A 2DNMA 1VQ6S 3R1LA 2QA1A 3QWPA 1JXEA 4OJ1A 2Y1IA 2Q43A 3DLGA 3MEKA 2W8KA 4W90B 2LA4A 4I6YA 3E01A 4I2QB 5BYSA 4ECYA 5H9EJ 3D1OA 2GHPA 2ZH6A 3T1HF 3M8SA 2IM2A 1RISA 2YH0A 4I6WA 5IQQA 3SI8A 1IBLF 4J5OA 1SJ4P 4HI2A 5F8GA 2EKYA 3V81B 1ZBTA 1R8CA 4HHJA 1T02A 2VZ9A 3I5AA 4Y2AA 4IOBA 2P5VA 2VL1A 2YNGB 2ZBIA 3F44A 3DCAA 1JLAA 4NOHA 2XCAA 2ZH7A 3CWJA 3KLEB 3AA9A 3ITHB 3H40A 3EGZA 1XERA 4XPCA 2WOMB 2AJFE 2VA2A 1SUQB 3FZBA 3CD6S 2YY3A 3MUVP 3EZ5A 3QYYA 2KM8C 4K0KF 4KV8B 1NRKA 5EDWA 1Y5IB 1S1XA 1YJRA 3RB0A 2GFFA 2K2PA 3NS5A 3CJKB 4OL8A 1MROB 2HVHA 3OR2B 3O2IA 5J2NA 2LU1A 2FJWA 3B4DA 1DAXA 5DG9A 4A8YA 3MPYA 4OHZA 2VH7A 4LFAF 1XR6A 4NCGA 2CJBA 2PIIA 3OTDA 1TKTA 4WU3A 3T6BA 2QLXA 2CPHA 2PA3A 4LQ3A 1U1KA 2Q6BA 2EVZA 4WFBQ 3DLLQ 2VG6B 3QLHB 5BR8F 2M70A 4CT9A 2WCXA 1TFYA 5HLFA 3DRXA 5HROA 2DGTA 3G9CA 4RNFA 2AYBA 4NMLA 5KFSA 2ZE2B 4B08A 2V9WA 3J80Y 1Q8LA 2B4VA 1RTIA 1RT3B 4HDHA 4QWDA 2WHOA 1NZAA 2GQQA 5LSOA 2BQRA 2I0XA 3R3TA 3IRXB 3CJ0A 2V4RA 1HNXF 4YEAA 1JLGB 1QVGR 2LDYA 3BN7A 4H4OA 2R8IA 3JSRA 3ENQA 3D1QA 3I32A 1FD2A 1W2IA 1FJGF 4A4JA 2D3UA 3AQOA 3FRZA 3SQGB 4ZPBA 4RU9A 4H4KA 3EUNA 5B0BA 3GE9A 3EYZA 3QJPA 4JI6F 2MJNA 2RB7A 3MWBA 2QYCA 3VWSA 3PM9A 3GV7B 3T3FA 1HNVA 4WZQA 2WSCC 4OX9F 4JV5F 1ZM9A 2F8EX 5M2RA 1YJTA 5HBMB 4X4UA 2G4BA 2JX2A 3RYLA 2BUNA 4I68A 2XSJB 3MM5B 4ID5B 1ZM3A 4BWMA 1T7PA 2V2KA 3I9ZA 2AGQA 3Q2SC 4X4NA 1UWBB 3CJ3A 4M94A 4NLTA 3MR5A 2QIFA 2OTLS 3NG8A 4Y28C 3THPA 1UETA 2MGZA 3MECB 3KK2B 3G8SA 3LP1B 3SCKE 3CCTA 2MQOA 4KKOB 2ILYA 3QJJA 1VIOA 2HIQA 2ZD1A 4MYTA 3PDNA 4LMZA 3BN4A 4X66F 4CNYA 2IRXA 4OX7A 3VAIA 2J8AA 1U6FA 1N8RT 2MXYA 1SV5B 3UR3C 1Q82T 1X0PA 2VFUA 3OLBA 2VB6A 5DGAA 5KFQA 2BZ2A 1FNMA 2M2BA 4BC7A 4J9LA 2HMIA 2DNNA 2KRBA 3OHAA 2NSCA 3DLEB 3U1NA 3QAEA 2KDOA 1CQNA 2CRLA 3IAM9 4O44B 2MSTA 5AXKA 1S9EA 2DGWA 3VTIA 1U2RA 2K3IA 3VAKA 1SIWB 2KZMA 2P6TA 4EFAC 4J9SA 2R9LA 3V4IA 4YMEA 3PW5A 1QTMA 2JOQA 3OHBA 1Z2ZA 1HMVB 1O5JA 1FKOB 1RT2A 3LQVA 4C3LA 3K5PA 5AE3A 3OTOF 1WTFA 5I3PA 5GMKa 3OSPA 2CQ4A 2HNYA 4UUXA 2YNFA 1HYSA 1FJ7A 4R5PB 5E33A 1H98A 1U24A 4G1IA 3UD3P 1HQEB 1U1MA 1HFEL 1SL1A 3GMGA 4X4QA 4DUZF 2VKRA 2FVQA 3H59A 1WG4A 3L95X 3X3UA 4C9DA 2KT5A 2MKSA 2CQCA 1WF1A 1R0AB 5D4PA 4WXWA 2RSQA 1T03A 4GKJF 5KFIA 4ZOSA 2WW8A 3H20A 1FKPA 2HNDB 1KNZA 2JFKA 3VAHA 4OX6A 3BM7A 2E7XA 1UEUA 4NRTA 3FCHA 1QVFR 4O3RA 3HXMA 2ROEA 4QIGA 1R8AA 2HZCA 3TO8A 1NK9A 2BVZA 1S97A 2AYGA 4DSKA 1FD8A 2GMHA 1OIAA 3MHYA 1P9QC 4LF5F 4DV7F 2DNZA 1U1PA 1EP4A 4DN9A 1M5VC 5B0FA 1S0OA 2V9KA 5JXSA 4ES1A 1IKYA 2W24A 3KG1A 4PKDB 4AL7A 4JI3F 3MEEB 2X3GA 4KPYA 4O4GB 2AJ4A 1RTJA 4NA3A 2DGOA 2LKZA 3EZUA 5DDQC 1EETA 5J2MA 1WF2A 4NZ0A 2R7VA 4LVNP 2B4OA 3WC2A 2QA4G