1FDDA

Azotobacter vinelandii ferredoxin i: aspartate 15 facilitates proton transfer to the reduced [3fe-4s] cluster
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTNCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport(iron-sulfur)
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Aspartate 15 facilitates proton transfer to the reduced [3Fe-4S] cluster.
pubmed rcsb
source organism Azotobacter vinelandii
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fddA00
1FRIA 3MM5A 2FJAB 3MM8A 1H0HB 5CHCB 1FDBA 1H7WA 1FTCA 3OR1B 1DAXA 1GT8A 1FXRA 4L6V3 5L8RC 3MMCA 1GTEA 1FDAA 2XSJB 4OV1A 1FRJA 5CH7B 1CLFA 1HFEL 1G6BA 2VPZB 4DHVA 1RGVA 1FRMA 3OR1A 1IQZA 2FDNA 1BC6A 1PC4A 2FJDB 2C3PA 1VJWA 1DURA 2PDAA 2XSJA 3LW5C 1FD2A 2WSFC 1XERA 4AYBD 6FD1A 4RKUC 1H98A 3EGWB 3C8YA 1SIZA 1PC5A 2FGOA 1F5CA 2PA8D 5BYQA 7FD1A 2VPWB 1FERA 3MMBB 4OMFG 1SJ1A 2GMJA 1A6LA 2V2KA 1G3OA 2WSCC 3OR2B 1C4AA 2VKRA 5BYSA 4YDDB 2WB1D 1DFDA 2V4JB 5E7OB 3EUNA 1F2GA 1BQXA 1B0VA 1D3WA 1SIWB 2FD2A 4KT0C 1FF2A 2Y0SD 2WAQD 1FRXA 3MM7B 3IR7B 2VPXB 2GMHA 2C42A 3MM6B 3MMAB 3MMBA 1BWEA 3OR2A 1F5BA 1GTHA 1FXDA 1FDDA 1FCAA 3MM9B 4XK8C 1FRKA 1KQFB 1B0PA 1KQGB 7FDRA 2V4JA 4XDCA 2C3MA 2ZVSA 3HKZD 6FDRA 1C4CA 1FRLA 1H7XA 1Y5IB 2FJBB 2UZAA 4Y28C 5FD1A 3MM7A 1BLUA 1BD6A 2WSEC 1FEHA 3MM6A 3MMAA 3IR5B 1R27B 2Z8QA 2PMZD 1KEKA 1JNZB 2VPYB 3MM9A 1K0TA 1FRHA 3EXYA 2C3UA 4CI0B 1Y4ZB 1ROFA 1JB0C 1Y5LB 3MM5B 3PNIA 1B0TA 3MM8B 1WTFA 1JNRB 1GAOA 2C3OA 4ID8A 1IR0A 4XDDA 2FJEB 2O01C 5BYRA 3MMCB 2C3YA 3GYXB 2IVFB 3IR6B 1FDNA 1Q16B 1Y5NB 1AXQA
chains in the Genus database with same CATH superfamily
1M1HA 3J81Y 2H54B 2VZ9A 4JI4J 3W9IA 3P45B 3QGPA 1G1XA 2VB6A 2KG0A 1HMVA 2C1EB 2EG2A 1RHUB 4FNHA 1TU0B 1TAUA 4ZVOB 1S99A 2HLTA 3BGRA 1OMSA 2W9BB 4DV6J 3D54A 2MZ1A 3TJ8A 2EBEA 1YZ7A 2B7CB 2IY5B 1AFJA 1H2UX 2EG1A 1PC5A 2HNYA 1FX4A 3DKDA 2G1HA 3C14A 3W8PA 5CAAA 5I3UA 1D09B 3M2VA 4ZP8A 3RB6A 4YDDB 2QFIA 3TEHB 4RNMA 3BB5A 4J9QA 4M5DA 1IKYA 1TK8A 1F60B 4IH7A 1B4SA 2XMAA 3TO8A 4F26A 4F04B 1Y5IB 2GS8A 1VQOS 2UUBF 1OYEA 5IT4A 2BZ2A 3GZ7A 4NLYA 3PDNA 4KH1B 2YNFA 5LSLA 5CCMA 2BQ3A 2HZAA 2V9KA 4MT1A 4WP8A 2JEIA 3OTDA 1YHQS 4A46A 3ENQA 5SUHA 3UDEA 1N32F 4WIQA 2Q3PA 2V2VA 2RILA 2GHVC 2EFQA 3M30B 1SJQA 1CJUA 8AT1B 3BV8A 4X4OA 1UEUA 5EUHA 1GX6A 4N41A 2DGQA 1ZPWX 4DMZA 4FBTA 1VIXA 2B3TB 4LUBA 4MAKA 2BKPA 3C8YA 3TUJC 4WFAQ 2F8HA 2IHR1 2U2FA 3TVZA 2QJ3A 4RUAA 1T9XA 4KH0B 1KTQA 2LVWA 2BABA 4EYIB 4I6YA 4NCGB 1F2GA 3M2UA 3QATA 3ZTRA 2AJFE 4KT0C 1V6HA 4F3OA 5I42B 4NI2A 1CVJA 3NS6A 4KGXB 1C0UA 3UI3A 2YBVA 1VQ8S 5KG2A 5L46A 2F63A 1NH8A 2R42A 2CG4A 2R7UA 4LT6A 1NB2A 2VFRA 3MM9A 4TYAA 5F9NA 5KFJA 2XZDB 3UW1A 2EKNA 4IDKA 1UWBA 2YKAA 2O66A 5LL6d 3Q8SB 1C2PA 2WOMB 2DRAA 5F3ZA 4KHRA 5CHCB 2ROEA 3MAAA 4NX9A 2XY7A 3PY8A 3EVMA 1Y11A 3TI0A 2ACMA 1NM2A 3HKWA 1JLGB 1OO0B 1BQMA 2VV5A 5AE2A 2IC3A 2HLUA 2KB2A 3ENWA 3MPYA 1F9HA 2MKCA 3PCOB 2XS2A 2IM1A 4BBYA 4CLSA 2BBEA 4I4BA 3BH7B 1VC6A 2HWIA 1TUWA 4LF8F 4URSA 2ZZNA 1X60A 1S9GA 4CWBA 3ZXWA 1TR0A 4W98A 1VISA 4PZVA 4DV1F 1RA7A 1KQFB 1LWFA 1X5PA 1X9WA 2FPHX 2JX2A 1X5OA 3FBFA 1N4LA 1HHSA 4RL1A 3ICLA 3MECB 2DR5A 3O3LA 1VDHA 2V8DA 2UUCJ 4PCQA 4KPCA 3OFGA 2AJ1A 3SMZA 4JI7J 2QA4S 4LF9F 4HR2A 1ZPVA 1RJJA 3VGUA 2NSBA 2KT2A 2V5HG 2YKNA 4Z37A 3JS9A 1DLOB 4RR5A 2A2CA 3LPEA 2ACYA 1YVFA 4OHYA 1TTHB 2GJFA 5HMYA 1X5TA 3W7BA 1JLCA 1S1UA 3AOAA 4PQUB 4NYOA 2E66A 2BJEA 2LQBA 3MEEB 3GU0A 1S4FA 2GZOA 2AV5A 4MMOA 1SIWB 4X84A 4KGVB 3PW0A 3EYZA 4IG0A 3I4HX 1H7XA 4ED0A 2XLKA 1FK9A 1NDCA 2ILYA 1MMDA 1EP4A 2G9OA 3V6KA 4ER8A 3TWZA 3D3CJ 3C16B 3TAQA 3HD2A 2E5LJ 1KVJA 2C28A 1NKCA 3PACA 1FDNA 3IXQA 3FDSA 1VRUB 3ONQA 1H7WA 4J9LA 4ZJQA 3MMCA 3FCHA 3O8WA 2ZD1B 3ISNC 3KK3A 2AW0A 4ES1A 3CDAA 4KGKA 2GJIA 2BXJA 1HBOA 1OPIA 1LFWA 2JL9A 1TUGB 5HL7Q 4IQMA 2R2UA 3TUZC 2HNZB 5ETQA 1YJUA 4JV5J 4DV0J 1DARA 2VOOA 2BJ8A 3FBBA 1NHUA 1RAFB 3E51A 4URQU 1LNQA 4Y00A 2BM0A 2YNGB 3JYTB 1IBKF 3T41A 1N5YA 2XYPB 3MURP 3M32A 4DOZA 3PEJA 3OPKA 3VWSA 4DU8A 3CMQA 1RTHA 4I2QA 4WE1B 1HBMA 1OSDA 4IUFA 4LRAA 5A0YA 5ETRA 1JK9B 3RTVA 4UUXA 4L75A 1QM9A 5C24B 1Z1ZA 3CT9A 3DRRB 3FFIB 1YJ9S 4OYZA 4DV2F 1FDBA 5EWEA 4DS5A 4PUOA 1FJEB 2VG5A 4M63A 3KLGA 2VH7A 1N33J 3DOKA 3MR5A 3ZZZA 4N77A 2C2OB 4ZVUB 4F50A 4FN5A 1WHVA 1LW0A 2B56A 1WI6A 4FYWB 4OJHA 4RBUA 2VKRA 1VHIA 1TKTA 3OSNA 2AD9A 1HARA 2WRMA 1Q95G 2OSQA 1R43A 5HQLA 1VOMA 3FQKA 4FBUA 2DH8A 3PG9A 2UXBJ 1NJWA 3M6XA 4DZDA 2FVSA 3JSMA 1YRXA 3JB9k 1SQGA 4OHWA 4L74A 2LQ9A 4WK1A 3HMJG 1VJQA 1QE1B 3T5HA 1M1GA 3MZIA 1X5SA 1UFWA 2RNEA 3D6TB 1U6BA 3HI9A 2ZVIA 3IP0A 2GA7A 4QQBA 2R7RA 4WZQA 4KFBB 4WXWA 5KFGA 5D4NA 3EVOA 5JJBA 4RW9B 1LK5A 4DR5F 2XSJB 4X4VA 3QWUA 3M8RA 1T0TV 2FJWA 2YKQA 3TZXA 3C6UA 4I6AA 5C2GA 3AQOA 3M9NB 3GSIA 1F5AA 1RT6B 4UQTA 4FNIA 3CD7A 4I7FB 3VGVA 2CNLB 4ECXA 3QYYA 4ZVEA 2ZFHA 3M8PB 1XNQF 4PG7A 2IYGA 2V69A 2EK6A 4PG8A 5D3GB 5BJRA 1JXLA 2RT3A 2B9WA 2OTLS 1PJ5A 1U45A 1TL4A 2CA9A 1S1TB 1RTJB 1IBMF 2C2NA 2DK2A 5GMEA 1GK8A 4XO0A 3MEKA 2HHXA 1YWXA 2WONB 1MMNA 3EXYA 3PIOQ 2MMYA 2FZKB 5F8HA 1PBAA 1RAIB 4ANEA 2ZH7A 2AYEA 1O6XA 3R1LA 2OPSA 4JI3J 1N6QA 1HKAA 5BR8F 3OTBA 3MXHP 4DZ6A 1FKAF 4B9SA 2DO4A 3FMBA 5KT6A 3RBDA 3D3BJ 4ZCLA 1DQAA 5THWA 3HX9A 3N5BA 3Q86A 2CQDA 1HWJA 3P8BB 1W7WA 4B9UA 3GFXA 3NGDA 3PXGa 3IWLA 2NQPA 4ICLB 4PXDA 5BYQA 3NCQA 1Y3JA 3FZBA 5F8LA 3FJ2A 3CB4A 3TAPA 3NKYA 3UD3P 4D3GA 5KFXA 4EEYA 4PG5A 2GC8A 1NDKA 3JQMA 1AFIA 1FO1A 3SQOP 3DU6A 1ZM3A 4LRDA 2YY3A 4L72B 2JNJA 1E6YB 2B43A 3G96A 4K0KF 1UL3A 2B9YA 4B3RJ 1K73T 2CKWA 3VAFA 1BQNB 1Q0NA 1N54B 2UXDF 1K0VA 1QSLA 3DGVA 4ZVSB 3Q2SC 3G6XA 1IQZA 3POTA 1FTCA 1S1XA 2WTFA 1DBDA 4WU3A 1A7GE 2H3EB 4ZITA 3CCTA 2XS7A 2ZKTA 1OQ6A 2VG7B 3TVKA 2K1RA 3MEGB 2RF2A 4ZOSA 4R8UA 1BWVA 1RTDB 3BKTA 2JEGA 4KKOA 4P10A 5B08A 3T6JA 1VQMS 4HL9A 1UETA 3QT8A 4ITSA 1FTRA 4WP3A 3R2CJ 2PGCA 1IKXB 2H9ZA 4KGMA 4C6AA 2ZH6A 2WB1D 1BGXT 2F40A 1IKVA 1XEZA 3M9OB 1I1GA 4XPEA 4F4WA 4FP9A 4IR9A 4X65J 4CO2A 3FBEA 1K47A 5KFFA 4ZJLA 1SVDA 2XZTB 4GKKJ 5JVGQ 1M5HA 4YB5A 1H38A 3TNVA 2KFZA 2BRLA 4Q43A 2ADBA 5ETPA 1JLFA 4ECQA 1RHKB 4P73A 4NLTA 1WTFA 3I32A 3QLHB 1Q8BA 1X4CA 1IUJA 1RLDA 1U8WA 1N36J 5HANA 1XNRF 3W66A 1PCAA 2V9WA 4B02A 4Q8EA 1WF2A 1AW0A 2EEYA 3LF0A 3GSDA 4OZNA 3J81U 4DSLA 3QZ7A 1PG5B 5IM0B 2HHHJ 2AKWB 1XMOF 2I9SA 4HEA9 1EIYB 5J2PB 2CPXA 2H51B 3G82B 3RG6A 1XJWB 1QAJA 2ZBIA 3E3XA 2WOMA 5FDLB 4LVOP 4NZ0A 4ANDA 4TY9A 1RKIA 1N34J 1SUQB 1SC4B 3KUHA 4NL5A 2AJ4A 3THPA 2BX6A 1F5BA 5ETSA 1UA0A 1S1WB 2L9WA 5LM7E 2XY5A 2R4FA 1IKWB 2LDYA 2W2NP 2ZJQQ 1I94J 4QWCA 3AAWB 3SDEA 4TKTA 4ZVGA 1PAEX 5HO4A 3A4TA 1KHWA 1PKUA 3IS9B 2QA2A 3CMAS 1UTAA 4O3NA 5AJ3J 2NCKL 4LQ3A 5DDOC 2DNQA 3BBCA 4CM0A 4DV7J 5K14B 4F4YA 3FUYA 1IJEB 4H54A 1NB7A 1AB8A 4P2MA 2GX8A 3GFZA 3PW2A 3Q8PB 4RBTA 3BR9A 1NPRA 2OPPA 3N5FA 2A18A 1FD2A 3EM1A 2ADCA 5C7PA 4PWDA 4BLGA 3W2VB 5F8JA 2LQ8A 4Y3CA 2JLFA 4USKA 2DH9A 2A6MA 3L09A 1QTMA 2E9RX 4C9DA 4NRUA 2DR9A 5EWGA 2XHWA 4KHPJ 4TLRA 2DIVA 2R7SA 2RUGA 1DLOA 4X64F 2XULA 2DNRA 2DNLA 4OV6A 6FDRA 2HZCA 4DPTA 2Z57B 1UJ5A 2QLWA 2DHHA 3GIKA 1RT5A 3MEEA 1VS3A 4C3MA 1FT8A 2GVDA 1YJ7A 4UUWA 3CC2S 3VCDA 4M1KA 4CLKA 5HK4A 2NZCA 2HRTA 3DOLB 3DOMA 4L6V3 4U7UD 4HLBA 5F3TA 1TK0A 1NAQA 4IFVA 4ZPTR 1RA6A 5IQ6A 4NYZA 1J5OA 3N4WA 1L3KA 1FJCA 4QIVA 1YJVA 1NK6A 3ILLA 2XQCA 2XWXA 5D78A 4H4KC 2VBZA 5D4OA 5L9XA 1HR0J 3UPFA 8ATCB 4DR7F 1WF0A 2L9DA 4OHZA 1RT3B 1WKLA 2ZZTA 5D15A 7FDRA 4TVAB 5IOLA 2HNZA 3ITHA 1CG2A 2QZ8A 5EWFA 4KR0B 1Q8LA 1KONA 2Y8YA 5D0GA 2W7OA 3HSJA 5LT5A 2XY6A 3TAMB 2EPIA 1GH8A 4G6VB 2K06A 3CCMS 4GC6A 2DVIA 1H2VZ 4DJBA 2CQ1A 1CS4A 3SV3A 2HFOA 3TA0A 3QIPB 1RISA 4WE1A 5KFCA 2FVPA 4Q0BB 4FKXA 3O1LA 2X1BA 5C24A 3NAHA 3FRZA 3T9ZA 3KJQB 2HIQA 3UCUP 3MHYA 2CWKA 1S1VB 2FUG9 2MGZB 1J5EJ 1VIOA 5M2UA 2I38A 1B0VA 4FXWA 3IR7B 3EVWA 2XGQA 5K8MA 5L1JA 4RNFA 2KJWA 2ZUGA 1S9EA 5K9FA 3TUIC 2CPJA 4IR1A 4OQJA 1N56A 4MIWA 3OTCA 1TV6B 1YKWA 4NA1A 2QV6A 4ZVQB 5M2PA 4RLEA 3H4DA 4DU7A 4KBIA 1Z4UA 4XDDA 2R8IA 3W1YC 1RQ0A 3HZGA 1NKEA 3TZZA 1UEVA 3MD1A 3BZQA 1ACMB 2ZOFA 2CYYA 3A8JA 4JB8B 1KQKA 2QRRA 3ZZOA 1UVMA 2DNKA 4C8KA 1TL3B 3MR7A 4C8LA 1U02A 1T03B 1PBUA 2AQ4A 1WC1A 4FYXB 4DL3A 3R5AA 3LW5C 4DR3F 1SJ4P 1MLAA 2DNZA 1N5SA 1KQSR 1HNVA 1AZSA 3AFGA 4AFFA 4ATNA 1T9TA 4NMLA 2GMJA 4KFBA 2DNHA 1FHTA 4ZVHA 2JVRA 4RWWA 2POKA 3M6VA 1JMTA 1HNZF 3NP5A 1Y00A 4M5JA 1TMMA 3LGMA 3WC0A 5KFZA 1GTHA 2KXNB 1NZAA 2CQHA 3RB0A 1N0VC 1S77D 1YJTA 3W9JA 1TL1B 4LF7F 4CO1A 2HPUA 2F4FA 1UAWA 1T9YA 4LRFA 2DGVA 1S0MA 3M8PA 3H25A 3LANA 2PEHA 2B6AB 5A8RA 3BN7A 2R8GA 1Q16B 2AZ3A 1CSJA 3JAMY 4JI8F 2XWYA 5KFIA 4RX6A 2VOPA 3FK4A 3PW7A 5IWAJ 3UDCA 2HRYA 4XPCA 4WJBA 2WONA 1GMVA 4PR6A 3JSBA 3CCES 1EX8A 1S0OA 3D1HA 1QUVA 4C0BA 2XMUA 4LRCA 1P6TA 3OTOF 3HF5A 4YB6A 1XMBA 5KAKA 4B3OB 3DM2B 1HWLA 2MZTA 3WC2A 2JHEA 2X1AA 2ASJA 1EZZB 3KLEB 1BWEA 5EHHA 4QIEA 1IM4A 3M8WA 2GW8A 3OL6A 1FKOB 1C4CA 2E7VA 4QWBA 3DLBA 1D9AA 1QSYA 2E9TA 1KN6A 2HYIB 1NSAA 4LVNP 1RTIA 1V3SA 2KKHA 1ITPA 3OFFA 3EGZA 3VV2B 3DLEB 1N5QA 3MUMP 3RBEA 3F73A 3G86A 4DV5J 1U1MA 4OV1A 3P4UB 3I0RB 2ZH1A 4ZPWR 3J7A1 1WC5A 4DUZJ 1FRMA 4F4ZA 4F02A 2YQ0A 3IGVA 3AJDA 4C8YA 1LOUA 5HMWA 3HVRA 3IAM9 2BANB 3QFWA 2CPZA 4KIAA 4NOHA 2DPIA 4CLYA 1ZM9A 4NE9C 3G87A 3MCMA 4A8OA 1HPZA 4I6WA 1YBUA 4J5OA 3W2WB 2RQCA 2ZM6J 2ZNYA 2HFNA 2VG7A 2MKJA 2ZHOA 3MEGA 2IAJA 4ZLJA 3MM7A 1ZOTA 1I51B 1O5JA 3IR5B 4WTOB 2JWNA 2VD3A 2Y9HA 2JLGA 3DLGA 2UV8A 1IKXA 2E5JA 3J80U 1NLKL 1FEEA 4D3HA 1VBKA 2XTJP 3HHDA 5GAGU 2XI2A 2FYXA 3GG0A 5K8OA 1B64A 5C42A 1NSKL 5HJYA 2JC1A 4UY85 4LR9A 4LBIA 5L9NA 1RYRA 3VGTA 2CJAA 3B78A 3RAQA 2FJDB 5KFRA 2R7OA 2KM8C 3T5JA 1T05A 2HFVA 5ETOA 4DI6A 1IBLJ 2WVCA 3NY0A 4R5PB 4FPIA 1YSJA 1A6LA 4NA3A 3GTYX 1NJXA 1GX5A 2FD2A 3L9ZA 1NJZA 1KOHA 5L1LA 4JI4F 3D2WA 4HHJA 2IA0A 4MKVA 4PYAA 2GMLA 4TQRA 3K5PA 3HPOA 5J2PA 3G82A 1UPMB 4DV6F 3MR6A 4CH1A 3R7NB 3KHGA 2BE9B 4Y34A 3L7UA 5E3CA 4QW8A 2FLOA 1VLOA 2BR0A 1O0PA 3GV5B 3KG4A 1S6OA 2KG1A 2AP6A 3SCKE 1FRJA 3HFKA 3FEZA 1LFPA 2EC2A 5LJ3Y 3NMRA 1U0HB 1T9WA 4KY3A 1C1BB 2DTJA 1O51A 2VBYA 3W3SA 4PKDB 3IS9A 4U7UK 3CC7S 4OYOA 3BEGB 4NLQA 2IRXA 2A0FB 4LREA 5D4PA 3TJAA 4NMXA 2QTWA 3CJKB 1CULB 3MM6B 1NDLA 1FNXH 1XMQJ 2CNKB 3PKMA 5FJ4A 1EHWA 2J8AA 3OV7A 1FEHA 3B6BA 3WHIA 4C11B 2ABYA 1FFWB 1FWKA 4CLZA 4OIXA 3C19A 4FKYA 1YK9A 3GCWP 4NCBA 2E7WA 4QYZK 3KHRA 2AHOB 3PX4A 1KKHA 3RRGA 3P6YC 5IC6B 1WI8A 1YX2A 1NJYA 1HFEL 3CNQP 3TQ1A 3FCVA 1URRA 1BXNA 9RUBA 4DL4A 3CJ4A 2NXUA 4Z7CA 2LEBA 1W26A 5HMXA 1DTQA 2DNGA 3MWBA 1UZDA 3HM9A 1CPZA 3FZ2A 4HI1A 3CXCR 2VQEF 2FGCA 4LR7A 3K5NA 2G13A 2XS5A 1RU2A 3OL7A 4RW6A 4IO1A 1HD0A 3CW2C 3GYNA 2CQPA 3A8IA 3IBCB 4DUYJ 2I0XA 4DL2A 4AQYJ 1BD6A 4OJGA 4P52A 4WFXA 4EI2A 1P8GA 3VAIA 5CQGA 3RYLA 2HWTA 3CJ3A 3R5CA 2KO1A 3FKBA 2VF3A 4TY8B 1WSVA 3M8ZA 3I0SB 1P1LA 3ENAA 3LP2B 4G1QA 2FHMA 2EXUA 5H9FJ 3SFGA 3NGSA 4ELTA 2ZZMA 4LF4J 5KFKA 2G4BA 2R2TA 3C66A 2HHTA 1T02A 2KHDA 1JLEA 1G7CB 1HNWJ 4IG3B 4DV4J 4IRDA 1L3UA 2HVDA 3E8OA 2B9XA 2PE8A 5KTQA 2UUCF 1FF2A 2YQ3A 2J9DE 2PD1A 3PO5A 3HHLC 5EX0A 2Q43A 1MSWD 5CCLA 3QIPA 1KLNA 3CEDA 1OJ4A 4JI7F 5A6PA 5CYJA 1FRLA 5KFQA 3CJ2A 4DEZA 5T7LB 2LMIA 2BJ1A 1HWUA 1KLMA 1SC3B 3GE9A 3NOCA 1KEKA 1VK8A 3KMQA 1NK7A 2XB2D 3RRKA 3M4XA 2XMTA 2EFPA 2FLPA 5IT0A 3D67A 4X62J 3ET6B 3ISND 2VC1A 2IM2A 2HBQB 3DYAB 3PHTA 3GFHA 5B0DA 3AXKA 4ILMA 3AB4B 4OJ3A 3N79A 4DV3J 2I6WA 3LP1A 4J9RA 3KNAA 2L41A 4OYXA 1RT1B 2YNIA 1RT2A 1U6FA 3UN3A 3BH6B 3W5YA 2ZH3A 3FEXB 2DH7A 1U8SA 4MK9A 4DS4A 3CCZA 1S79A 1SB6A 2E5LF 1UA1A 2Y1RI 4NZ6A 1KDNA 3D4JA 2ASYA 3HHNB 3B82A 1I3OB 3IAS9 3OR2A 4CNYA 1FDDA 2XI3A 3P49B 1C1CB 1KQGB 3N28A 4GVBB 3ZZPA 1T03A 1RT4A 4JI6F 2EKYA 2BQUA 3HSDA 3JXOA 3NAIA 5C25A 1QSSA 1HBUA 4NYPA 4M8LA 1JNZB 2EI5A 4AE5A 2ZBQA 4DFPA 2H4WB 2RH3A 2KFNA 4AL7A 1GNKA 1S57A 2VONA 2MLYA 3CD5A 4EU0A 1HHTP 2YKOA 1KD1T 5IZHA 4JV5F 4DV0F 2CNOB 2RAQA 3QGGA 1EKSA 5DGBA 3RUBL 3DXSX 3M2RA 2VDHA 3JTNA 1NBEB 5L39A 5KG6A 1UPPA 2I1RA 1U6ZA 3UVJA 3MFIA 2NUHA 4HH1A 4O4GA 3V81A 1HNIA 4DQIA 1YIJS 5I3QA 1FA0A 3KWMA 1LWEB 2NYHA 3BGLA 4I56A 2MY7A 2CPHA 1DFDA 1MN7A 3GONA 4ECWA 1QY7A 2DY1A 5DM7Q 2Z0GA 1RHRB 1WEXA 3AA9A 4RZRA 4DG1A 2W9AA 1OY6A 1FRKA 1SXLA 2B0GA 1HNXJ 4B3MJ 2RDJA 2ATCB 3DHWC 2OJ3A 2HNDA 4DCJB 2DEJA 1GXLA 1Y4ZB 4OX6A 2MJUA 2YX4A 2A6OA 1JB0C 5HBMA 1WHXA 3MPUB 3IWXA 2HHPA 3D6MB 4EYHB 1T94A 5HJXA 3NCPA 5DQHA 2JDJA 1WC0A 3KLEA 3Q8VA 2LP4A 2ZWOA 2BW7A 1S7IA 2Z2LA 3HVTB 2GIRA 3NRBA 3NLCA 3CJ5A 1NSPA 2UXBF 1Q7LB 5ETVA 4JYAJ 4N8OA 4AYBD 4A8QA 5F8IA 1QVFR 1M5KC 4O3SA 2ZH4A 4K4SA 2AMCB 4CTAB 4OHVA 3UNYA 3BKUA 4UZCA 5F8MA 3DI6B 2UXCJ 4RW7B 3H5UA 1MROA 2QYGA 4MIBA 4Y2MA 3I0RA 1HW8A 2G1DA 2HAIA 2CPEA 4XK8C 1HHQA 2E1PA 1HYSA 2IIHA 2KRRA 5DJBA 4ZCMA 4C98A 2BANA 2Q79A 3NNCA 2YKMA 4DQSA 5GADI 1U1OA 3DLHA 3OFEA 4CIOA 4USTA 5F8GA 3W2WA 5J2NA 5DS7A 2LCWA 4MKAA 2AZ1A 3OR1B 3QGHA 2O5DA 3CF5Q 5HAOA 1VGYA 2PMWA 1U1KA 1JXVA 3H42A 4F4AA 4GC7A 3SSSA 2FY1A 4LF8J 2RQ4A 2ZJRQ 2DY9A 1OQ3A 2DHSA 3QGIA 2DBBA 1RBAA 3KJVB 2ZE2B 4OYPA 4LF1A 2QC3A 4C48A 1S59A 1OSCA 5ETNA 5D6GA 4WPAA 4EZ9A 4C0HA 2BRKA 2I2YA 5KT5A 4LF6J 3QO9B 4IH6A 5K5MA 4M5KA 3DGPA 3EUNA 4DSKA 4ED1A 4TNOA 3M8QA 4JI3F 2B7BB 5DQIA 5LXRA 1CC7A 2IVYA 1TVRB 2F9JA 2GO9A 1U2CA 3EZUA 4I69A 4LF9J 1DY3A 4A8FA 1FE4A 1RU1A 4J9KA 1B0TA 4IRKA 3VTIA 1X31C 3NGRA 2VUGA 4G1PA 4IYQA 4ZHRB 2P6SA 1PYOB 4HDGA 3QJLA 4ES2A 4QW9A 2B4PA 2M8HA 1NXIA 3Q8YA 4MFBB 1SC1B 3JQKA 3CCWA 1RUSA 4DSJA 3UFCX 1RZMA 4K2XA 2RMLA 2D3OR 4ZN1A 3U27A 1ICEB 2C3PA 3U02A 2D69A 1CC8A 1FKPA 1WEZA 4ZA1A 2MKHA 3M9MB 2B4UA 1AROP 1SJ1A 2GAGC 2K2PA 4F0HA 2R7TA 2N3OA 5I3PA 3KUEA 3I96A 4YY3J 3NWRA 4QIGA 1QUPA 1WACA 1R0AA 2PO4A 2VFSA 1UJ6A 2LEAA 3S01A 1RAHB 4CLPA 1V5VA 2AWZA 3KLHB 3H5XA 5GMKa 1X4GA 2V50A 2XNQA 4Y65A 4JV2A 4K4ZA 2CZ9A 3AD9C 3MM5B 4GO5X 4YR2A 4ID8A 1WKJA 1N0UA 3L7PA 1I5OB 3I31A 3MTKA 1Y5NB 2B5JB 4PABA 3VGSA 3RB3A 3P5BP 5DDRC 3Q89A 5KOXA 2QLJB 3B4MA 4C11A 1JLBB 3M7VA 3PZPA 3SSQA 2RU9A 4TLQA 4ED3A 1U1QA 2YX1A 2M52A 4YR0A 4QU6A 4ED4A 5F41A 1XN9A 2YVSA 1MU2B 2W9CA 4NXMF 1N36F 1TKZA 5E3AA 4LQ9A 5L38A 3PX6A 3MPWA 1LW2B 2M7SA 2N7YA 3GIJA 1JKHA 4HTJA 4HACA 3KK2A 1RE1B 2HHHF 2YWKA 3UD4P 3B54A 2EFNA 4ETXA 2BOAA 2OPRB 2O01C 2XYHB 2XG8A 3KK1A 1DJ0A 2NLWA 3V4IA 2OPQA 4ZKAA 2CQ4A 3MM8A 2XCAA 2FC8A 3TP2A 4CYUA 2KYZA 4WU2A 1ULRA 4HDHA 5HQMA 2UUAJ 3R5DA 4OZ5A 1N34F 3QAEA 2PSZA 2V8GA 2ZDOA 1RHMB 5DRKA 2ZHAA 2C2EA 1VBYA 1ZAXA 2WSFC 3R1HA 1FNMA 5DLGA 3EGWB 1I94F 4WK3A 4U67Q 2WCXA 3G6YA 5DDQC 4KHMA 1HI8A 1YJNS 1DZ5A 5CYMB 4LBHA 3J81j 3H8YA 5AJ3F 1M5VC 3RZAA 2A3JA 1U1PA 5B0BA 4JI5J 2IBOA 2RKIB 2RHSB 1NUEA 5KFHA 2V4QA 1WC6A 3UR0A 1REGX 2CIMA 2ZC3A 1PGZA 3OLAA 2GGPA 3PIPQ 1FWPA 4U7CA 5AE1A 3OUYB 2AYMA 4IG3A 1U1LA 2YWWA 4OYWA 4CQ1A 1S6PA 1S4EA 1YZ6A 2J0XA 1GEHA 4NCAA 4S0MA 4H4OB 5E0OA 3VR1A 3CJTA 1XNQJ 3S1TA 2ZH5A 3BO2A 1REVA 2VA2A 1JLQA 1MN9A 2ZKUA 3O5TB 1R8CA 2HAFA 4A47A 4J7CA 2MZQA 5KFBA 3DRSA 5ITHA 3FSYA 3UCZP 1Z2ZA 4ILRA 2HVZA 3MMBB 4J9MA 1LV5A 1JJ4A 2CQ2A 4QWDA 1H6KX 5BYSA 3CDEA 5J2MB 3DMJB 3M6UA 2OFHX 1NDPA 3ZO7A 2HVEA 4RW4B 3NL0A 3CC4S 1EJ7L 2CPFA 1TFYA 2D3O1 2V4JA 3ZZYA 5BR8J 5KG3A 2OEJA 4M5GA 1ROFA 1DTTB 4YB7A 2QGFB 1ZYQA 3S8SA 2HRUA 1T11A 4N56A 4K2JA 2KFYA 2KDOA 3AXMA 3IA0A 2ALYB 4P2XA 3TQEA 2MHNA 3HSZA 3N6LA 2YNHB 3CDBA 4K7QA 2I5JA 2DRBA 1VMBA 3GWCA 2NPFA 4FZVA 5LMNJ 4RW8A 1RTZA 2DXDA 2QL9B 4ENOA 3G8SA 2FZGB 2YKPA 5F9LA 3VQTA 2JSXA 1WORA 3GQCA 2PMHA 1YJRA 2AT1B 2CFXA 3VAJA 1RP5A 2RUSA 2PIIA 2H5IB 4FF1A 2E9ZA 1D3WA 4O3PA 4F2RA 3IRXB 5HQ8A 1P9YA 5A8KA 1U49A 2ZEJA 1PAUB 2HQ3A 4CO4A 1R6YA 4YUDA 1K9MT 3H98A 1Q4RA 5LSOA 5HROA 3GV8B 3V6DB 3X1LB 1V3RA 5FD1A 4FS2A 3DRPB 3H4BA 2QYCA 3N0VA 1L3SA 1LWEA 4ZPCA 4LFAJ 1KWMA 1P27B 1YTYA 2X3GA 1OY9A 1R0BG 5L1IA 2F1FA 3MF5A 3D66A 1FJGJ 3ZZ0A 2FIUA 1J5EF 2JC0A 3QJJA 2GHPA 1H72C 2HG4A 1ZAWA 1OWXA 3HVAA 2LXIA 1RSCA 3A13A 2HBZB 4DPYA 4PPDA 2DHAA 4DSIA 3CWJA 4OLPA 3N6MA 2KT5A 1ZA1B 2VL1A 2DR6A 2NPIA 4DQPA 3PV8A 3HT3A 1O8BA 3G8QA 1UEKA 2BE2A 2DGOA 1KFDA 1NPKA 2XMJA 4LSNA 3PYFA 2X1GA 4PWWA 3VZIA 3E01B 4QJVA 2C2RA 1OS5A 2MZJA 2BUNA 3A12A 1CJVB 3PM9A 1T95A 4L73A 1N5VA 2RDIA 1B99A 3R9LA 5E5NA 4F2SA 1RWKB 1TL5A 4RPFA 1EETA 3CMES 1APSA 4CT9A 1HMVB 3IR6B 2D9OA 3P3DA 3NBPA 2UUWA 3BGRB 2XGPA 1DAXA 2D3ZA 2DD8S 4DR6J 3ZZTA 1RGVA 2HNYB 3QT7A 5G0RA 1RXOB 5I3UB 4NLGA 3M2VB 2LQ5A 2V63A 1X4AA 4MK8A 2WVEA 1XIQA 3MFHA 1KS2A 3JSYA 2E1AA 3M1VA 1NMEB 1M90T 2GNKA 1IKYB 1VC5A 1E6VB 2MZSA 4HKQA 3A1YG 3SXLA 4O0NA 2J5AA 3ILJA 1VLYA 2YNFB 3BGOP 2AEJA 3Q24A 4DX7A 2ZE2A 2MKIA 3LPYA 4OI2A 3WQPA 4LSLA 2WSEC 4MKYA 2J9DA 2GIFA 5IWAF 4CH0S 1BE4A 2IJFA 3OT9A 2C3UA 4CI0B 5FIIA 1S97A 3G71S 4PQAA 3MAQA 2KYXA 4P9SA 1KP6A 4DL0C 2LKZA 2F8MA 3T5LA 1LEOA 2I8EA 2J0QD 1VRTA 3GFYA 3UD5A 4E0DA 1Q82T 5K20B 1M0SA 4C3KA 3PO4A 4PRFA 4TQSA 2P5VA 4X66J 2E1MC 2V2ZA 4UW2A 2B4VA 2V0NA 2RJZA 1KR4A 3KNGA 4NI2B 3Q8UA 1IJFB 1OY8A 4DDFA 5B0CA 3VF0B 4J9PA 1C0UB 1HQ2A 3NS7B 1RWOB 1WOSA 3PX0A 4KPYA 2B8QA 2W8KA 3MM9B 4DV5F 1H74A 2HQGA 4DR1F 3H7HB 4DF4A 2ZUAA 4CLLA 4NLXA 5KFDA 4ZIVA 4IDKB 1U2RA 3GG1A 3C15A 4DUZF 1NKBA 2BMBA 4P7VA 3Q23A 2HHSA 1FRHA 1HI0P 3NGKA 3D0IE 1RWVB 3W62A 5K8NA 2J0WA 3PKYA 3GPAA 3GYXB 1SKSA 2NR0A 3HHKA 2W24A 1S6QA 2MQOA 3BO4A 1BQMB 3QZ8A 2E44A 4F4XA 2DNNA 4CO0A 3V6HA 5KOWA 2ZM6F 2Y1IA 3I4PA 3QRQA 2EW9A 3SBMA 2OH2A 1HD1A 3A3NB 4ZVTB 2W4DA 4DR7J 2MYFA 4USIA 3MDFA 5DG9A 1T8EA 3CJ8A 3D1OA 5D8HB 3BQ0A 3CJ0A 3Q8QB 3A8KA 1S9GB 4ZVRB 4O3OA 4IH5A 2FVCA 5KFVA 2QMWA 2V2KA 3D28A 2V94A 1LWFB 3OL9A 2HGLA 2WZ1A 2YWHA 2OUGA 2QSWA 5A2QY 3QQCD 5JXSA 4DFJA 2M8DB 1FWLA 4Q7AA 1BLUA 4OI0A 3DRXA 2UU9F 3MMAA 4PG4A 2QIFA 1RWXB 2FVRA 2MSTA 1N48A 1RWMB 1HQUA 1SI9A 3TANA 3LALA 3ETOA 1IBLF 1X4FA 3K0JA 4PXEA 3C2PA 4Y2CA 1VQNS 3CDWA 1NK9A 3ETMA 4YHHJ 2YKNB 3VHQA 3A3PB 3LP0A 5L8RC 4M5IA 1RT7A 1UFLA 1RCOB 2VPZB 3SQGA 4YQWA 2W2QP 4IOAQ 1JLCB 1S1UB 1IBCB 2VC0A 1VJWA 1UWAA 5AXMA 5GAEI 3S7RA 4A4JA 1KVKA 3AOBA 3J80Y 1L5UA 1B7FA 4IG0B 1X9MA 1IXKA 3G9CA 1JLAB 1IR1A 4PG6A 2X3DA 1TMJA 1FK9B 3IFEA 1FE0A 2HS3A 1G2EA 1SH2A 1EP4B 2HHUA 3VALA 1VYAA 2W2MP 1RLCL 5KG5A 2OGUA 4R0JA 3UDLA 3SI8A 4JBCA 1SV5B 1R8BA 4L76A 5T41A 1VC0A 3TZYA 5CYQA 3MMCB 1FI4A 5C5JA 1EQ0A 2FY8A 1FVSA 4NEZA 3KK3B 2AEMA 1SJRA 2B8PA 4A8YA 2JFDA 2MSSA 3PRVA 1HBOB 4KO0A 1Q78A 3QJPA 4ED8A 3DLKB 4WWSA 5IFMA 3BKFA 1HNZJ 2M2BA 1XMQF 3SFUA 3HT0A 2VIHA 3SYZA 4OX9J 5MLCV 1H98A 4TN2A 2RIJA 2B9EA 5D4LA 3T1YJ 2W9BA 3AD7C 1N5YB 2N7CA 3M32B 1DQ8A 4H4OA 3MI7X 3R6GB 2DRDA 4FF2A 1RTHB 3I6PA 4O3QA 4I2QB 1HBMB 3HK2A 4RJVA 2Q6BA 2V4RA 1NSQA 5A0YB 4BC7A 3H5YA 2UZAA 2HQCA 1GMUA 4FXDA 1RBLA 3IGNA 4A48A 4EZ6A 3PJWA 3KG1A 3LQVA 5IV4A 4G65A 5J1EB 1JXEA 4KJIA 1T3OA 2HZVA 2PEBA 1QAYA 4PUOB 5KG1A 5LXYA 1IR0A 2KU7A 1SL2A 2VG5B 3AJ1A 3O44A 3KLGB 1UCNA 3DOKB 4XAKA 2L3MA 1AT1B 4NPOA 5HVHA 4TU9A 3IM9A 1CLFA 4JUZA 1LW0B 3R3TA 4NEYA 3BPSP 2JZ5A 3X3UA 3M30A 4WFBQ 4AQYF 2YPYA 1TKTB 3WX8A 2HW3A 1H3DA 1NK0A 3AY0A 4OHXA 1S48A 7FD1A 2X7IA 1R0CB 2AX1A 3ADAC 5CZVA 4DQRA 2LEPA 1Q53A 3K57A 2HVHA 3JSMB 1MWZA 1NU4A 3FSIA 4N8NA 3HJVA 3L7OA 1T3NA 2X1FA 1YJWS 4NCGA 1VQ7S 2ZVSA 1GMWD 4TU8A 5D0RA 2CPDA 2FHJD 1RYSA 1HBNB 2AIRB 3PW4A 5I42A 2YPZA 1BHNA 2FJVA 2PA3A 1V5IB 3I55S 3NXZA 1Y7PA 1ZBTA 4K5RA 1U1NA 5ADZA 1HIYA 5G4DA 1TK5A 2QLBB 3IRXA 2PC6A 4U8YA 2JVOA 1HNWF 3CCRS 4R25A 4DV4F 4WIIA 3C6UB 2KJVA 1VQYA 3I5BA 1URNA 2PT0A 4JOUA 1MWQA 1HW9A 2COLA 1UW9A 2J0SD 2XO6A 5KT2A 1EAYC 2Y1LB 4QBUA 4K50A 1JLGA 5KT3A 4OZ3A 4IQXA 2A2DA 5KG7A 1X4DA 2Z4PA 5GAHU 4ED6A 1U7LA 3VVTA 1PIEA 2KXFA 3H20A 4UOGA 4P6QA 1PJ7A 3FSXA 3SEOA 4X62F 2F4VJ 2HIYA 4LFBJ 4AXJA 1XTZA 4K4TA 2HQIA 2MHEA 2OPSB 4HT5A 4U9RA 1GXUA 4DV3F 3AJ2A 5I4MA 1W2BR 4AL5A 1N6QB 4E8UA 4J91A 4I64A 4A8WA 4KB7A 2HK3A 4U96A 3GIMA 4ZCKA 4NLWA 1AXQA 2BA9A 1H0HB 2M70A 4C3LA 3MECA 2ALZA 3V2UC 1G6BA 3VAKA 3VQSA 1NK5A 2FJXA 3OXLA 2XO7A 2VBXA 2VASA 1NO8A 6FD1A 3QBCA 3GCXP 1PYSB 2HURA 3HCXA 1NCLA 5HP1B 2GAHC 4FDFA 5H9EJ 4FF3A 5IC4B 1AA1B 1K1SA 2BEFA 2L9NA 1VFJA 2RDDA 2PI5A 2BKNA 1BQXA 2CQIA 2OIHA 4PQUA 2P2CB 4EMDA 3LA0A 4B08A 4CO3A 3QNWB 1CBKA 4NLRA 4UOHA 4JV0A 3AOCA 2F65A 4K59A 2C3MA 4QU7A 2RRNA 4AT1B 2XC9A 3GR0A 1EKRA 2R7QA 2DJWA 2HHQA 1WKKA 5KFMA 2OEKA 4ECRA 4WYWA 1UVIA 1SPBP 4FS1A 2R8HA 2F9DA 1X0PA 5DM6Q 3POTB 4KRWA 3R2DJ 1E6VA 1S1XB 2NYIA 3K2YA 2PI4A 4CP5A 1NK8A 1UVLA 2K1RB 2P9GA 2RF2B 4R8UB 1X0FA 3C16A 3G8TA 4KKOB 1NHKL 3O6QA 2APOA 2LFVA 2Y3YA 2AJQA 1VRUA 2MLXA 4MK7A 2QMXA 2CWXA 1VQSA 2XHCA 1UZHA 2MKKA 1YQHA 1HNXF 5K8PA 2ILZA 4B3MF 2ZD1A 3P96A 4NZ7A 1IKVB 3K17A 3F41A 4ZN3A 2NXNA 2OP5A 3BYPA 3I5AA 2VPWB 3RGIA 3UCGA 2A1BA 5E33A 2Y1JA 3KTQA 2XMWA 2MLZA 1JLFB 2NUUG 4K4VA 3IG1B 3GJRB 3DNCA 3GJTB 2BYCA 4ZDNA 1PYTA 2YNGA 3JYTA 4O3RA 2Q1LA 4WYLA 3T5KA 1TFWA 4USVA 3R97A 3VVUA 3K5OA 4JYAF 2W4CA 1HA1A 2W1BA 3FC9A 1MNEA 4N76A 2KZMA 2NSCA 4H4MB 1WG4A 3CGIA 3K5MA 3TZWA 2UXCF 2VQEJ 4ZLPA 3RR7A 1SJ3P 2F7VA 3RJMB 3DRRA 3FFIA 2CJXB 3U1LA 1M5OC 1PC4A 4KQZA 2ZOMA 3MMJA 4PAAA 3W61A 3RW6A 3MTJA 1FERA 3H40A 4AL6A 4EO6A 5B0EA 2DNPA 5GAGI 3HSGA 3T1HJ 4TU7A 2M9KA 1BY9A 4HI2A 1PJ6A 3SDEB 2W2OP 4EO8A 5FLXU 2XYGB 2JOQA 2Q66A 4LF2A 2HFSA 4J9SA 4CLUA 2GQCA 3B4DA 2ZBRA 2EC0A 2DGTA 1J27A 3CJRA 5KFYA 2Z2YB 1QE1A 4I1TA 1IVZA 3OJUA 3T6BA 4QWAA 4QZVB 4LF5J 4LF6F 2ERRA 2W4PA 4OX7A 4PPZA 3GR1A 5B0AA 4P74A 3GB0A 2OPPB 2MXYA 2MPUA 9ATCB 3QSYB 4PWDB 3BDEA 4OYMA 2MY8A 1U25A 4RW9A 2AYGA 1WF1A 2XSJA 1F2HA 3AB2B 1B7YB 3ZC4A 2OEMA 4A8SA 3BO3A 3U1NA 4ZMMA 3FEYB 2CDQA 2KXHA 4QWEA 2CJQA 2DGXA 3MR2A 1RT6A 3R6LB 1SQEA 2FVQA 2BKOA 4I7FA 3U1MA 2Y0SD 1LQ9A 3AODA 1FFSB 3O2IA 4BWJA 2QFJA 1QLNA 3DLLQ 1S0VA 4IFYB 1Y0HA 2DCUB 3MCSA 1G4CA 1JQGA 4EBEA 1TP7A 5D3GA 3W5XA 5LSRA 3OW2R 3KJNB 2FC9A 1RT5B 4I2PB 2M4MA 3RAMA 4P2FA 2BJDA 2E5IA 1CJTB 2GVDB 2D7SA 3TUPA 4EFAC 3BBFA 4M5HA 2KRBA 2AGQA 1S1TA 4CM2A 2V34A 3MCOA 4ECUA 1RTJA 1TZ0A 4Z2XA 3DOMB 1JLAA 1Q1KA 2K8GA 2Q6CA 2E1CA 5A76A 4IFVB 3ZTOA 1X7VA 3A8EA 2OI2A 2RS2A 2KH9A 4NRTA 3NMAA 2IFXA 2N4DA 1J5OB 1FDAA 5DETA 3CCLS 3QRRA 2R7XA 4YY3F 4UT4A 2GV1A 3QWPA 4AUKA 3RW7A 4WFZA 1SV5A 5A6WA 4CDIA 3UO0A 4NA2A 1D9FA 2JH3A 2OTJS 1H2TZ 4JI6J 2PA8D 2V8HA 3G6ES 2MKSA 1WOOA 1ZTTA 2U1AA 1EARA 2MQLA 4ICLA 1U47A 4J90A 1N8RT 1QVGR 2VJVA 3DLKA 1S12A 5CABA 3ITHB 1R3NA 3V6JA 4ZK7M 2ASDA 4YB1P 5A2QU 1VHFA 2M5YA 2QN6B 5EN1A 2YH0A 4FVMA 2QL5B 3PNIA 1RKJA 1F9EB 1RAOA 3GJQB 1E6YA 3CULA 2EFOA 1CS4B 2O3DA 1OIAA 2J7KA 4NLPA 1FFGB 5DZ6A 1BQNA 2BJ7A 1WD6A 2C2MB 1RWNB 2G0JA 2ATLA 2V6AA 4HTIA 4QOTA 3HXMA 5J1EA 2DT9A 5HMZA 4DX5A 3I9V9 2IA6A 4QR1A 4NXNJ 1RTDA 4LFCJ 1FD8A 1WUUA 1RHJB 4CNZA 4W90B 4KSEB 3D68A 1XQIA 1KSPA 1S9EB 3AH6A 3QMQA 2J9CA 1FXDA 2DR7A 2EK1A 3CD0A 3B8HA 1BMQB 4MJKA 5J1PA 2UUAF 1K1QA 2AF6A 3GP9A 4R0EA 3CCQS 4DQQA 1Q7YT 1CQMA 3LUYA 3TOQA 2UVRA 2RU3A 4J9UE 4OYBA 1M1KT 2R2SA 3NNAA 3TW0A 4F8RA 4NLSA 1AYEA 2KN4A 4F3MA 4JP8A 3QSIA 3BS9A 3EZOA 3QLHA 5D0EA 3LWMA 1R6VA 1HBNA 2J7WA 2VJUA 4B3SJ 1S7HA 4OFZA 1HNVB 1AZSB 1R8PA 2QE5A 4DN9A 4F25A 2OSRA 4JI5F 3EWGA 3HFVA 3ISZA 3BR8A 2N82B 2VQFJ 5IM0A 4LRBA 3NWGA 4WP9A 4J37A 3OXFA 3LAKA 3GV7B 4GVLA 3K89A 1WJ9A 1YITS 2VPXB 2L08A 5FDLA 3ZNUA 2DIUA 4Q45A 3F44A 8RUCA 4XTTA 2FJBB 1OYDA 3OQ2A 1YGYA 3OL8A 2DNMA 5DDPC 1SUQA 1SH0A 1TQLA 4OL8A 1KRPA 5A8RB 1S1WA 2M3DA 2ZOGA 5E3RA 3WZ0A 1IKWA 1ZZFA 2J76E 3I5CA 3OXGA 4ILLA 3SIPB 3DFEA 4K4XA 4CH7A 2RHQB 4DL7A 5F0UA 1VQ9S 1U1RA 1A9NB 2FB0A 2FTRA 1WHWA 5H9FK 2O67A 2VFVA 4MYTA 2QMUB 4KE5A 2EFVA 2HBRB 1Y9OA 2WVDA 1F3FA 2FLNA 2NXEA 2IDEA 3UN5A 5K14A 2OMOA 2DXFA 5DG8A 2RVJA 4Q2LA 5IT9U 2W01A 5KT7A 2NS1B 2CVIA 3K8VA 3CVKA 4ECSA 3W2VA 3KFWX 1QJHA 3Q8RB 3T1AA 2RQKA 3CE8A 3R5BA 1B0PA 3JSRA 4OI6A 1RTIB 5E2QA 2MQPA 3D0HE 2KM8B 4DLGA 1V9OA 4G1IA 2BE7D 1VQ6S 5LMNF 3GILA 2PFDA 5HP1A 3KHLA 2QEXS 3I82A 2ZITA 3OLBA 3MPDA 5AXKA 4BHQA 4FXVA 5KFLA 2X51A 4USUA 2CVEA 4LIWA 5MAOA 2P9CA 4ZP9A 1T9UA 4EWTA 2IPOB 3KLIB 3DOLA 2MDAA 1RWWB 4BDPA 3A3OB 3KG0A 2NXCA 1HPZB 2WVBA 1X4HA 3FVYA 4I0WA 4IO9Q 2VU5A 4LFAF 4GKJJ 4DFKA 3EDQB 4JI0J 2IAJB 5LJ5Y 1CJKB 3K58A 3D0GE 2EFGA 4NWBA 3DHXA 3MM7B 2DGWA 4DR2J 1FNOA 1FJGF 1WHYA 3PVXA 4F7VA 3K8WA 5KFSA 1WSRA 4A8XA 3DLGB 3THVA 2DKOB 7AT1B 3KLVA 2FZCB 2DO0A 1F3VA 2V8VA 1UJ4A 3BF4A 4I68A 2Z30B 4B3TJ 4EBDA 5HI7A 4ERDA 3D6HB 1RT3A 5DGAA 5M2RA 2H1YA 4DR4J 4ED7A 5C42B 1HL6A 3TR5A 4K5SA 3V5RA 2XZWA 4JI1J 4LMZA 4ID5B 4ZVPB 3UQSA 3IG1A 5AT1B 3PYEA 1LWCB 1T05B 2EWHA 3TAMA 2OLWA 4ZLNA 3PW5A 3WIVA 3ZTPA 3JQJA 3EXCX 4NXMJ 1SBRA 1D9DA 3I87A 1CQNA 1UVNA 1U0SA 5IQQA 4RKUC 2ROGA 3SSRA 3RRHA 1SL0A 1A0OB 3AA8A 3PFOA 3QPIA 4FF4A 2D3UA 4H4MA 4Q0BA 2XNRA 4Z7YA 2BOPA 2OMLA 1S49A 2MQ8A 2P6TA 1S1VA 2MGZA 4K4WA 2MQNA 3D6FB 3W8GA 1XBWA 1ZS6A 3N9UC 4DR6F 2C2ZB 3Q83A 3SCLE 1XK8A 1WC4A 4Q44A 2UVVA 4JI2J 1RAJA 3R5JB 3HD1A 4USJC 2VKZG 2DPJA 2C22A 4DSEA 5LMUJ 4OI1A 1TV6A 1VR6A 4ZLLA 4O0IA 3W65A 3JTOA 2GFFA 3EE3A 1PO6A 2NXJA 4B17A 1F1BB 5D0HA 3L3CA 1YLXA 5GAEU 4UZBA 4DXLA 5F0WA 3OJSA 4CCHA 1TL3A 5ETKA 4F3QA 4V19X 3MOZA 1RHQB 4H4KA 3AD8C 3HFZB 3W9HA 1RWUA 3OHBA 2F5GA 3J7YI 1NEEA 4ECYA 4G3IA 3C46A 1HWKA 4B9VA 3NOGA 4RNOA 4ZPDA 3KYLA 1HQEB 1Q8IA 3KHHA 2MB0B 2JRSA 3IBFB 2P9EA 4YMEA 4RNHA 1YDLA 5B7WA 4B9LA 3QT5A 3ZZUA 5AXLA 1U24A 3MCNA 4ECTA 3UE2A 3I9ZA 2J9EA 2D1CA 1F6TA 5L1KA 4X66F 5KT4A 1GAOA 2CJKA 4L3NA 1TL1A 2GHWA 3EGVA 4ZVFA 2A10A 1S10A 1U2FA 3HHLB 4IFYA 2QO3A 4P72A 2XLIA 2VA3A 3UR3C 4QR0A 2B6AA 3GJSB 3QFHA 4USHA 2UUBJ 1DTQB 2IJNA 4DHVA 3OD2A 2HS0A 1KNZA 4I2PA 2RQMA 1CJTA 3CCVS 2DR8A 1Y3KA 1MG7A 4RW6B 2IRYA 4X4RA 3TX0A 3CTRA 4X4NA 5HVGA 1N32J 4QPXA 4X4PA 1IWAA 3EPIA 1MWYA 1N33F 4CO5A 1S76D 5KFTA 4L3KA 4QCLA 2BM1A 4Y2KA 1W25A 2JEJA 4B3OA 2BJ3A 3DM2A 5CD4H 2AGOA 3KLFB 3DRYA 1VBZA 3KMSA 4ZIWA 3D9BA 1K8AT 4C97A 1FKOA 5DQGA 2AJ2A 3BQ2A 1JJCB 3M8SA 2AEFA 2ZH2A 3IN5A 4CLFA 2C3YA 4G1QB 3CSKA 4ZJOA 3W63A 1MMLA 2YXLA 3V4MA 1GT8A 4K8RA 4TXSA 4EK2A 5JVHQ 3DLEA 2DHXA 1X9SA 2W2PP 3IM8A 2CQGA 1P9QC 1JLEB 3M05A 1RACB 1SKWA 4B9MA 2OO4A 2CADA 2PDAA 3D7SB 3G6VA 1OPZA 1UVKA 1VRQC 3CDUA 2RRBA 2JEFA 3RAXA 3T3FA 2ASLA 4O4RA 2DEIA 1UW4A 1V3ZA 1U48A 1KLMB 2HQFA 5BXIA 1SJFA 3NNHA 4YHHF 3DC2A 1FVQA 2B51A 3OVAA 1JWWA 2MQQA 1KBRA 5D77A 4Y0FA 5T14A 5DO2A 2YH1A 2HWHA 4MYUA 3DXBA 1Q79A 1N5TA 2W7AA 4WFNQ 1TKDA 4OX8A 5BYRA 3CJQA 1FJ7A 4ZS6A 5AXNA 1GQEA 1GXTA 3PJ9A 2KT3A 2UVWA 2HK2A 2R2RA 4DV1J 4B9NA 1ZM4A 2GCFA 3PHEA 3LP1B 2OAUA 2YTCA 1KC8T 4EUVA 1SH3A 2R7WA 2XEXA 3DCAA 4NLUA 1RDRA 4HYKA 2E7XA 2FDNA 2YNIB 1RT2B 2IDLA 4PXCA 2Z2MA 3K59A 2ZH9A 1W2IA 4ZCIA 4W92B 4M5MA 1NK4A 3OBIA 2XLJA 1B3TA 3OR2B 4C7QA 3PFEA 3D5MA 3I56S 4LJMA 4RUBA 1RT4B 1N52B 2E29A 1P1TA 4E98A 4R5PA 5C25B 1NJIT 1HBUB 4X4TA 1YBTA 3GIIA 1VQ5S 3BGFA 1R31A 4OZ0A 1VQKS 4BC9A 4BS2A 3VZHA 3WBZA 2XBPA 2H5JB 1ZH5A 3NS5A 4OX9F 3CUNA 2CXEA 3FGVA 1Q81T 2KI2A 1YBAA 2CUYA 2DNOA 1S9FA 2Y8WA 3M2RB 3W5ZA 3T1YF 1PILA 4NLDA 5IS2A 3GYGA 2DB1A 3QT6A 5B0FA 3IO1A 3CCJS 5ETTA 2R9LA 3UVJB 2G2OA 4O4GB 1B70B 3V81B 1HNIB 2WW8A 4P75A 3BGUA 4U6PA 3BYRA 4B3RF 1WC3A 3LTOA 2NREA 3PYDA 2ZBPA 2LLZA 2F8EX 2KZZA 4DL5A 1D8ZA 2FHKA 2RD5C 3MGJA 3MUVP 2OD6A 3QIDA 2FGOA 4PWUA 2VBWA 1U0HA 3CCSS 1C1BA 3F0NA 5ETLA 1SKRA 1VQPS 5F8NA 4DG1B 1UMJA 1KHVA 2AX0A 4O44B 1TKXB 3ZFVA 4FYYB 1QAIA 2LQJA 1KTVA 3LAMA 2HNDB 3PJXA 3C3LA 5HBMB 3CJKA 1CULA 3MM6A 4FYVB 4BWMA 2GQ2A 5J2QB 4DLEA 1ZAVA 2CZ4A 3ZNJ1 3HJFA 2OHDA 4FPRA 2F3JA 4X65F 4F0KA 2C3OA 1RK8A 5CZXA 4KV8B 1IBKJ 2AJ0A 4J9OA 4GKKF 5LOQA 2E5GA 2W25A 3BSNA 2KL8A 1SQFA 3IBWA 2QA4G 3CJSA 4Y6IA 2AGPA 2DXEA 3MAHA 3R8YA 2CJYB 1M5SA 4M5LA 1SKUB 2DHGA 1MROB 2PN6A 4DR1J 3P5TL 1WELA 1KOOA 3MR3A 4DV2J 1C4AA 2AYBA 3HLUA 1F0XA 1HYSB 3HVWA 3RR8A 2WAQD 1SC6A 3PRBA 5E3PA 2YKMB 4C8OA 3KLIA 3HP6A 2JLEA 2CQ3A 1RAEB 1NRKA 3UWTA 3UN2A 5J2NB 3TYTA 2K3IA 3M6WA 1CJKA 2IVFB 2DCLA 2KTQA 2YWGA 1FRIA 4HH0A 4Y2AA 2V2QA 2XCPA 2YQ1A 2NZ4A 3MEDB 3T19A 1YI2S 2HFUA 4ZPVR 2HEKA 4DX6A 3BSCA 4TY8A 3I0SA 1X4BA 3C6TB 3LP2A 3E2EA 3LOUA 4UOFA 4RU9A 3CPWR 2F4VF 4NLOA 4LFBF 5B09A 3DGPB 2HHVA 5GMDA 3M8QB 1VBXA 2RB7A 1FX2A 3FQLA 3WX4A 2UU9J 4DV7F 4OMFG 1WG1A 3H90A 4ID5A 1IM6A 3EX7B 5KG4A 4A8KA 2VG6B 3BSOA 2IMWP 1TAQA 3HO1A 4DR5J 2RSQA 2IM0A 1S72S 3TRGA 4DPXA 2QX0A 5A8WB 1QTNB 1LWCA 5AE3A 4M5NA 3AQPA 4USMA 4X4UA 3R27A 2JFKA 5U47A 1WEYA 3BQ1A 5ETMA 4BCAA 2LECA 4ZP7A 4HHHA 1RB0A 5T7LA 5CXTA 4KHPF 3EDRB 1TL7B 2OFGX 2ZJPQ 3OSPA 3FCWA 4YFUA 4I67A 4Y2IA 4DFMA 3H0PA 4UY8T 1LXJA 3K7RA 1IBMJ 3ET6A 1FKPB 3Q2TC 2ZDPA 3DYAA 2DGSA 4IOCQ 3K5LA 1WDTA 1VQ4S 1WNEA 1QDUB 4WKRA 3KDOA 4DCPB 4QIWD 2SXLA 3G2XA 1YG0A 4F36A 1R0AB 2J6TA 2FHOB 2MZRA 5EGYA 2WK4A 3DLJA 1NPPA 1RT1A 1CEZA 1EQMA 1RI7A 2H48B 1IN0A 2Z58B 4WBFA 2GO8A 2H65B 4B9TA 2GJ2A 3HKZD 2GQQA 4MIAA 2CRLA 4MH8A 3OTEA 3D1QA 1C1CA 3NGTA 4GVBA 2B4OA 3VAGA 1ELOA 4F67A 4C2MA 3CCUS 1HR0F 3NGUA 1D0EA 4DCOB 2DNYA 4USWA 4X4SA 3N6NA 5KFPA 1HQEA 2FJAB 2HMIB 4ED5A 5KFWA 3BREA 5CH7B 4N5SA 4DF8A 5HVFA 4YS2A 4K0KJ 3MUTP 3CD6S 2E1RA 4OYAA 4C8NA 2UXDJ 4ELVA 4UF4A 3BDPA 2W9CB 5DZ7A 4EBCA 4N47A 2WSCC 1G3OA 1TKZB 2XMKA 3HHLA 1DHMA 3JTPA 3QRPA 3BJYA 1YRUA 5CD4A 1UVJA 1JKHB 2OD4A 4EGLA 4KGZB 3SV4A 4HACB 1FESA 3KK2B 3FMWA 3US5A 4DX8H 3W64A 2GIQA 1GMWA 1S0NA 2Y0BB 4DSFA 3TVYA 1M5PC 2VPYB 3KK1B 2FHJA 2BV3A 2Z2ZA 3V4IB 2OPQB 3MM8B 2WW4A 2G0CA 3CO9A 4CYUB 3IMQJ 4YDXA 4J9VA 5DLFA 4C8ZA 3PYGA 5KG0A 2LYVA 2H5EA 5EDWA 4DPOA 3NG8A 1S6UA 1TUVA 2IRUA 5HLFB 3EMTA 2LA4A 3AHPA 3T1HF 3OFHA 3KLFA 4RNNA 4ZPBA 2WB4A 4OLOA 2LA6A 1BC6A 2LXFA 3N01A 2FQQB 1R89A 1R8AA 3HVTA 1RABB 1VI7A 3RBZA 3IC1A 4WTYA 3H2LA 4MTPA 3OVSA 1F5CA 4GO7X 3BPDA 1WG5A 2KVQE 4AD6A 1ZA2B 1TELA 1C0TB 2HKEA 1XNRJ 3DN9A 4YR3A 4CTAA 4K4UA 4DWIA 3DDKA 2GVZB 2HHWA 3DI6A 1S5ZA 4LF5F 2GGPB 3THTA 2IVMA 1XWLA 4RW7A 3LO3A 2AU0A 1J2VA 1XMOJ 3LGHA 3ENVA 2WHOA 2K7JA 1ZETA 2CAJA 4OZLA 4OJ1A 1S6PB 4WXOA 3TJ9A 3ILOA 5HSPA 4HT7A 5IV3A 1L3TA 4K4YA 2IYIA 4IKAA 1U09A 4IRCA 2CJ9A 3C14B 1D1UA 4NASA 2J7UA 1REVB 1JLQB 4GRSA 4QYZJ 4QR2A 4ALZA 4M5DB 3DRSB 2FLLA 2K3KA 4DUTA 4UQGA 1Q5YA 4IOBA 3OR1A 5KFNA 3S6EA 4P71A 3SCJE 5KFUA 5FLXY 4MKBA 1R7IA 2N4CA 1XERA 2MKYA 3FNNA 4DPWA 2CQCA 4YP3A 3QAUA 1RCXB 3L95X 3KJVA 3WIUA 3DU5A 2K7KA 2RE1A 2V4JB 3GIRA 2XM3A 4F4KA 2UV8G 3QO9A 1WTBA 1R8HA 1CJUB 1IR2A 3RBXA 2V68A 4YEAA 2ZHBA 2Z8QA 1TVRA 1WWHA 5E3QA 4OI3A 1NNDA 2JJ4D 2FJEB 3ILIA 5E41A 2D41A 2I5JB 3H5SA 2J6SA 2R7VA 5KFEA 1JJ2R 4RW8B 3KUGA 4X64J 2M0GB 1XC9A 3M2UB 4ZHRA 1IWGA 2HS4A 4MFBA 2IJRA 4HVZA 1FXLA 3PRDA 2HSEB 4KAIA 2BW2A 1LKZA 1HWIA 5A8KB 1D8YA 2WBMA 2LXUA 4ZP6A 3LWLA 4A8MP 2QLXA 4ECVA 1UWBB 2QG9B 3H2VE 5HROB 2WVFA 2CPYA 4DPUA 2HGMA 5CA5A 2DGUA 1NHVA 2CZVC 3DDIA 3KOAA 2GMHA 3EZ5A 3TX8A 2ZWPA 1QD1A 3MAAB 2ZBCA 2ZH8A 2DISA 3SZ2A 3NCRA 1L3VA 2QSFA 1R27B 4KC5A 2IC3B 2CQBA 4AXIA 2R8JA 4Q5VA 2MJNA 3FRYA 1K44A 4E2FB 3T9NA 3KLHA 2G0IA 1I6JA 1LK7A 4NXNF 4O44A 1TKXA 4X4QA 4LFCF 3MM5A 3R7SB 4PXBA 3MOJB 3U7JA 2UVUA 4OZ1A 2G2ZA 3LGNA 4RUCA 4HHUA 3ZZRA 3H2UB 1HI1A 2VDIA 4WZMA 2B5JA 5J2QA 1NZ8A 1DURA 2UUTA 4FVCA 4J9NA 3WDOA 1YRTA 3BSAA 3NEKA 1JX4A 4LSZB 1JLBA 2CNNB 4KV8A 2V67A 3VAMA 2EVZA 4RBVA 4KTQA 2CPIA 1HLWA 3M8YA 2BE2B 2ZC4A 5E7OB 3G4SS 1XR6A 2HBYB 4LSNB 3VAHA 2C42A 1MU2A 4ES3A 2VICA 2BDPA 3R7BB 1UFKA 4PEOA 1QAXA 3TARA 2IM3A 4P2SA 4U95A 1EETB 4B3SF 2N3LA 3J7AN 3F56A 3NBPB 1LW2A 2DITA 1SL1A 2J6UA 2LU2A 1RAGB 5GAHI 4V1Ak 1H73A 2VQFF 3L4BC 1RAAB 5G0RB 2OPRA 1FXRA 4JV1A 2LU1A 5IXUA 3GLJA 2EBGA 1SCJB 3CIMA 3M1VB 4QIFA 3RB4A 6AT1B 3CO0P 3TA1A 3PEHA 1RBOB 2VFUA 4LR8A 3BM7A 1AUDA 3ZTSA 4CT8A 5KFOA 1ZZNA 3Q0AA 3JAMU 3IRWP 1ZM2A 4DL6A 2IBKA 3MEDA 3EJMA 1X8DA 4CLTA 2RS8A 2R3VA 2C2KB 4LSLB 2VODA 4PYDA 4C8MA 4ELUA 3C6TA 4KYZA 4ZPAA 2YWEA 4DR3J 2QL7B 1EB0A 3PTWA 5CYMA 2O1PA 3HZEA 4OZJA 3IWNC 2PMZD 1XR7A 1K0TA 3TA2A 2D74B 1VRTB 2RKIA 4M94A 2CQ0A 3PR4A 2VG6A 2CDRB 3RU0A 1RADB 4RO0A 2BVZA 5A8WA 5JUMA 3OUYA 2PFFB 2QT7A 3HULA 4TYBA 3DDNA 5SZTA 1NH7A 2MQMA 1N88A 4FYDA 5B0GA 4LF7J 1UKUA 3J7YU 2E5HA 2W8LA 3EPGA 3MD3A 3OVBA 2W7PA 2CG8A 3HDSA 4LBPA 3EGNA 1SIZA 4O23A 1ZTWA 4P7TA 1TL7A 2Z56B 4UTGA 3R5GA 4ED2A 2ZNZA 4JI8J 1T7PA 2UP1A 4CLWA 4UOCA 3BBBA 3UDVA 3C15B 3MMBA 4C4WA 4RUHA 2DYAA 2D9PA 2XSFA 5J2MA 3DMJA 2G2YA 2QLFB 1VCTA 1Y10A 4RW4A 3KXDA 4M95A 5HN0A 1GFWB 1UP1A 4ECZA 2HQDA 1JIHA 2HGNA 3OTOJ 1KFSA 4CRJA 2OELA 1S6QB 3ULHA 3LH2S 4GMKA 4NLVA 4DUYF 2XMMA 1KVIA 5IT9Y 3UNGC 1BUXA 1T9VA 1WOPA 2MEWA 1MW7A 4GKJF 4JI0F 1DTTA 1DRZA 5H1SV 3HHLD 4DR2F 4LIRA 2ROPA 5J1NA 3BN4A 4OI4A 4V19J 2R8KA 2HVIA 3EICA 3GMGA 2YNHA 4RU2A 3PR5B 4YOEA 4B3TF 4RWXA 3J7Z5 3OHAA 1JJHA 2XMVA 5H9EK 2H4YB 3H59A 1LWXA 2V8PA 4DR4F 4URGA 2HMIA 4ANCA 4Q2MA 4LF4F 1Z2LA 1FRXA 4JI1F 2LDIA 3ZTQA 5DG7A 2MTLA 3AT1B 1Q86T 3MMAB 2KHCA 1U26A 5HATA 4ETZA 4XDCA 3HHEA 1Q8KA 2YWFA 1HQUB 4Y28C 2C2DA 2VFTA 2VHGA 4F0MA 1XR5A 2P8IA 1Y5LB 3V6DA 3DRPA 3LP0B 1U4BA 4N7TA 4WF9Q 1RT7B 2BACA 1X4EA 4U8VA 3SQGB 5JMNA 3KJFB 1Q5VA 2YX7A 3J7ZT 4OZ2A 2BJ9A 1GTEA 1F9FA 1RWPB 2CJBA 3CIZA 1AUSL 4DN0A 3W60A 5KFAA 4CZCA 2KVIA 3Q22A 5RUBA 2IMOA 4Q8FA 2J8SA 4YN3B 2M88A 5GADU 4WCEQ 4OYIA 1WDDA 2QA1A 5EX3A 4JI2F 1LXNA 2L48A 3SCIE 4C0OC 4X2BA 2OKQA 4XIUA 3KKFA 1VK3A 5LMUF 3ELHA 5HLFA 2BQRA 1VQLS 1FCAA 5C2CA 4QYRA 2RRAA 3MPVA 5CYQB 2HFZA 4QPTA 4DBQA 3FBCA 3TEGA 4WKYA 5GVQA 1C0TA 4W4MA 2WBRA 1JNRB 1IQTA 3E01A 3KDNA 4KO0B 1CJVA 1PSDA 4WFYA 2GVZA 1DQ9A
chains in the Genus database with same CATH topology
1U2FA 1S6QA 3J81Y 3GG0A 5K8OA 3HHLB 2MQOA 3BO4A 5C42A 1BQMB 2VZ9A 4IFYA 1B64A 3QZ8A 2QO3A 2E44A 2XLIA 2VA3A 3UR3C 2JC1A 4QR0A 4F4XA 3QGPA 2DNNA 1G1XA 2VB6A 4CO0A 2KG0A 4UY85 3V6HA 5KOWA 1HMVA 2B6AA 4USHA 2ZM6F 2Y1IA 2EG2A 3I4PA 5L9NA 1DTQB 4FNHA 2EW9A 2IJNA 4DHVA 2OH2A 2HS0A 1TAUA 1HD1A 1KNZA 4I2PA 1RYRA 1S99A 2HLTA 2CJAA 2RQMA 3BGRA 2W4DA 2MYFA 3B78A 2W9BB 3RAQA 2FJDB 3CCVS 3D54A 2DR8A 2MZ1A 1Y3KA 4USIA 5KFRA 2R7OA 3MDFA 5DG9A 2KM8C 2EBEA 2B7CB 1T8EA 1AFJA 1H2UX 4RW6B 3D1OA 2IRYA 4X4RA 3T5JA 2EG1A 1T05A 1PC5A 3BQ0A 5D8HB 2HNYA 3CTRA 3CJ0A 4X4NA 3Q8QB 1S9GB 4O3OA 4R5PB 4IH5A 2FVCA 1YSJA 4QPXA 5KFVA 5I3UA 4X4PA 2QMWA 1A6LA 2V2KA 3M2VA 4ZP8A 3RB6A 3D28A 4NA3A 2V94A 3EPIA 1MWYA 1N33F 4YDDB 1NJXA 1LWFB 3OL9A 2HGLA 1GX5A 2YWHA 2FD2A 4CO5A 4RNMA 3BB5A 1S76D 4J9QA 2QSWA 4M5DA 1IKYA 5A2QY 1TK8A 5KFTA 1F60B 1KOHA 1NJZA 4IH7A 4QCLA 2BM1A 4Y2KA 3TO8A 4F26A 5L1LA 1W25A 5JXSA 4JI4F 3D2WA 4DFJA 2JEJA 4B3OA 4HHJA 2IA0A 2M8DB 3DM2A 5CD4H 1Y5IB 4Q7AA 1VQOS 2AGOA 1BLUA 2UUBF 3KLFB 4OI0A 3DRXA 2UU9F 3MMAA 2GMLA 4TQRA 4PG4A 5IT4A 3DRYA 2QIFA 1VBZA 3K5PA 2BZ2A 3KMSA 3GZ7A 3HPOA 5J2PA 2FVRA 4NLYA 3PDNA 2MSTA 1K8AT 1N48A 2YNFA 5LSLA 4C97A 5CCMA 2BQ3A 1FKOA 5DQGA 4DV6F 3BQ2A 2V9KA 3MR6A 1HQUA 3OTDA 1SI9A 3M8SA 3IN5A 2ZH2A 3TANA 1YHQS 2JEIA 3LALA 4CH1A 3ETOA 3KHGA 2C3YA 4G1QB 4A46A 4Y34A 1IBLF 5E3CA 3CSKA 1X4FA 3ENQA 4QW8A 3K0JA 2FLOA 4PXEA 3C2PA 4Y2CA 1VQNS 3CDWA 5SUHA 1NK9A 1MMLA 1N32F 2BR0A 1O0PA 2YKNB 3GV5B 2Q3PA 3KG4A 3V4MA 2RILA 1GT8A 2GHVC 3LP0A 2EFQA 5L8RC 1S6OA 3M30B 2KG1A 1SJQA 2AP6A 3SCKE 4TXSA 1FRJA 1RT7A 3HFKA 5JVHQ 4X4OA 1UEUA 3DLEA 2DHXA 5EUHA 1GX6A 1X9SA 1UFLA 4N41A 2VPZB 2CQGA 2DGQA 3FEZA 1LFPA 3SQGA 1P9QC 1ZPWX 4DMZA 4YQWA 5LJ3Y 1JLEB 3NMRA 4FBTA 1VIXA 4IOAQ 2B3TB 1JLCB 4LUBA 1S1UB 3M05A 1SKWA 4B9MA 1C1BB 2VC0A 2DTJA 1O51A 1VJWA 2OO4A 4MAKA 2VBYA 2PDAA 3G6VA 3W3SA 3C8YA 5AXMA 4PKDB 1OPZA 5GAEI 3S7RA 3TUJC 3IS9A 4WFAQ 1UVKA 2F8HA 2IHR1 4U7UK 4A4JA 3CC7S 2U2FA 3TVZA 3BEGB 3CDUA 2RRBA 4NLQA 2IRXA 4RUAA 3RAXA 2JEFA 3J80Y 5D4PA 1KTQA 2LVWA 1L5UA 2BABA 4IG0B 1B7FA 1X9MA 4EYIB 3T3FA 2ASLA 1IXKA 4O4RA 3G9CA 1JLAB 4I6YA 1UW4A 4NCGB 1V3ZA 1F2GA 3M2UA 2AJFE 4KT0C 4PG6A 1U48A 3CJKB 1V6HA 1FK9B 3IFEA 1KLMB 3MM6B 1FE0A 1SJFA 4F3OA 3NNHA 5I42B 4YHHF 3DC2A 1CVJA 1FVQA 2HS3A 1FNXH 3NS6A 3PKMA 2B51A 5FJ4A 3OVAA 1JWWA 1C0UA 1G2EA 1SH2A 3UI3A 2J8AA 1EP4B 2MQQA 2HHUA 1VQ8S 5KG2A 3OV7A 5D77A 4Y0FA 3VALA 5T14A 1NH8A 5DO2A 1FEHA 2CG4A 2YH1A 2HWHA 5KG5A 4MYUA 2R7UA 3SI8A 4R0JA 4LT6A 3UDLA 3DXBA 4C11B 1Q79A 2VFRA 3MM9A 2ABYA 4JBCA 4TYAA 1SV5B 5F9NA 1R8BA 5KFJA 3UW1A 5T41A 1N5TA 2W7AA 1VC0A 4IDKA 4WFNQ 5CYQA 1TKDA 4OX8A 5BYRA 1UWBA 2YKAA 3MMCB 4OIXA 2O66A 5LL6d 1FJ7A 4ZS6A 5AXNA 1GQEA 5C5JA 3Q8SB 4NCBA 2E7WA 1GXTA 2KT3A 1FVSA 1C2PA 2UVWA 3KHRA 2WOMB 3KK3B 2R2RA 1SJRA 4A8YA 3PX4A 4B9NA 2JFDA 5F3ZA 1ZM4A 4KHRA 3RRGA 5CHCB 2DRAA 2GCFA 3PHEA 2MSSA 2ROEA 4NX9A 2XY7A 3PY8A 3P6YC 3LP1B 1HBOB 2OAUA 2YTCA 1WI8A 4KO0A 1Q78A 3TI0A 1KC8T 4EUVA 1SH3A 2R7WA 3QJPA 2XEXA 1NJYA 3DCAA 4ED8A 3DLKB 1HFEL 3HKWA 3TQ1A 4NLUA 5IFMA 1JLGB 1RDRA 4HYKA 1OO0B 1URRA 1BQMA 2VV5A 5AE2A 2IC3A 2HLUA 2KB2A 2M2BA 2E7XA 2FDNA 3ENWA 2YNIB 1RT2B 3CJ4A 3MPYA 3SFUA 4DL4A 1XMQF 4PXCA 2MKCA 2Z2MA 2NXUA 3SYZA 2XS2A 2LEBA 2IM1A 4BBYA 3K59A 5HMXA 1DTQA 5MLCV 2DNGA 2BBEA 1H98A 3MWBA 4I4BA 4TN2A 2ZH9A 1W2IA 2RIJA 4ZCIA 3HM9A 4W92B 1CPZA 1VC6A 2HWIA 3FZ2A 4HI1A 3CXCR 5D4LA 1NK4A 2W9BA 3OBIA 2VQEF 2FGCA 1N5YB 3K5NA 2XLJA 2G13A 2XS5A 3OR2B 2N7CA 3M32B 4C7QA 3PFEA 3D5MA 3I56S 1DQ8A 4H4OA 4LF8F 3OL7A 4RW6A 4URSA 4IO1A 3MI7X 4LJMA 1HD0A 1RT4B 2ZZNA 1N52B 3GYNA 2CQPA 2E29A 1S9GA 1P1TA 4E98A 4R5PA 4FF2A 5C25B 1NJIT 1RTHB 3I6PA 4O3QA 1HBUB 4I2QB 2I0XA 1TR0A 4X4TA 4DL2A 4DV1F 1HBMB 1RA7A 3HK2A 3GIIA 1APSA 1KQFB 2Q6BA 2V4RA 1LWFA 1X5PA 5A0YB 1X9WA 1VQ5S 4BC7A 3H5YA 2FPHX 3BGFA 2JX2A 2UZAA 1R31A 1X5OA 4OZ0A 1VQKS 4FXDA 1BD6A 3IGNA 4A48A 4EZ6A 4OJGA 3PJWA 4BC9A 3KG1A 4BS2A 3LQVA 3VZHA 1N4LA 4WFXA 1HHSA 3WBZA 5J1EB 1JXEA 1P8GA 2XBPA 4KJIA 1T3OA 1ZH5A 3VAIA 3ICLA 3NS5A 4OX9F 3CUNA 1QAYA 5CQGA 3RYLA 4PUOB 5KG1A 5LXYA 3MECB 2DR5A 1IR0A 2KU7A 3FGVA 3O3LA 1SL2A 2V8DA 2VG5B 2HWTA 3AJ1A 4PCQA 1Q81T 2KI2A 1YBAA 3CJ3A 2DNOA 3R5CA 1S9FA 3O44A 3KLGB 2KO1A 3M2RB 3T1YF 3DOKB 3OFGA 4XAKA 1PILA 4NLDA 5IS2A 4TY8B 2DB1A 2AJ1A 2L3MA 3I0SB 4NPOA 5B0FA 1P1LA 3IO1A 3CCJS 3LP2B 2R9LA 4TU9A 3SMZA 2QA4S 4O4GB 4G1QA 4LF9F 3V81B 1HNIB 1ZPVA 2WW8A 1CLFA 2FHMA 4U6PA 3BGUA 5H9FJ 4JUZA 1RJJA 3SFGA 4B3RF 2NSBA 2KT2A 4ELTA 2ZZMA 2NREA 2V5HG 2YKNA 1LW0B 5KFKA 3R3TA 2LLZA 2F8EX 2G4BA 4Z37A 2KZZA 2R2TA 1DLOB 1D8ZA 4DL5A 3C66A 2FHKA 2JZ5A 3X3UA 2RD5C 3MGJA 3M30A 4WFBQ 4AQYF 2HHTA 1T02A 2A2CA 2ACYA 1YVFA 3MUVP 4OHYA 2OD6A 1TKTB 3QIDA 5HMYA 2HW3A 1H3DA 2FGOA 4PWUA 2KHDA 1NK0A 1JLEA 1X5TA 3W7BA 3AY0A 4OHXA 1S48A 1JLCA 7FD1A 1G7CB 1S1UA 2VBWA 4PQUB 3CCSS 4NYOA 2E66A 1C1BA 2AX1A 4IG3B 1SKRA 4IRDA 5CZVA 4DQRA 2BJEA 2LQBA 1VQPS 1L3UA 5F8NA 4DG1B 2LEPA 1Q53A 3E8OA 2B9XA 1UMJA 3MEEB 3K57A 1S4FA 2PE8A 2HVHA 5KTQA 2AV5A 1KHVA 1MWZA 4MMOA 1NU4A 1SIWB 4X84A 3JSMB 2UUCF 2AX0A 1FF2A 2YQ3A 2J9DE 4O44B 3FSIA 3PW0A 1TKXB 2PD1A 3ZFVA 1QAIA 3PO5A 4N8NA 2LQJA 3HHLC 5EX0A 2Q43A 3EYZA 1KTVA 3L7OA 1MSWD 1T3NA 5CCLA 3QIPA 2X1FA 3LAMA 4IG0A 1YJWS 2HNDB 1KLNA 3CEDA 4NCGA 5IT9Y 1VQ7S 2ZVSA 3PJXA 4JI7F 4TU8A 3C3LA 3I4HX 5A6PA 5HBMB 5CYJA 1FRLA 1H7XA 5KFQA 3CJ2A 3CJKA 4ED0A 4DEZA 2XLKA 2CPDA 2LMIA 1FK9A 2FHJD 5T7LB 1RYSA 1HWUA 1HBNB 1KLMA 3MM6A 4BWMA 3GE9A 3PW4A 2GQ2A 5J2QB 5I42A 1KEKA 1VK8A 3KMQA 1NK7A 4DLEA 1ZAVA 2CZ4A 2ILYA 3HJFA 1MMDA 2FJVA 2XB2D 1EP4A 2PA3A 4FPRA 2G9OA 3V6KA 3I55S 2F3JA 3RRKA 4X65F 3M4XA 2XMTA 2C3OA 1Y7PA 1ZBTA 4K5RA 1RK8A 3TAQA 1U1NA 2EFPA 2FLPA 5ADZA 5IT0A 1KVJA 5G4DA 2C28A 1TK5A 5CZXA 1NKCA 3PACA 1FDNA 3IXQA 3FDSA 3ISND 3IRXA 2PC6A 2AJ0A 2JVOA 2VC1A 4KV8B 3CCRS 4J9OA 1HNWF 1VRUB 4GKKF 4R25A 2IM2A 4DV4F 3ONQA 4WIIA 3C6UB 2KJVA 2E5GA 1H7WA 3DYAB 4J9LA 3GFHA 2W25A 5B0DA 1VQYA 3I5BA 4ILMA 1URNA 3BSNA 3MMCA 2PT0A 3FCHA 4JOUA 3AB4B 3O8WA 4OJ3A 3IBWA 2QA4G 2ZD1B 3ISNC 3N79A 4Y6IA 3KK3A 2AW0A 4ES1A 1HW9A 3CDAA 2AGPA 4KGKA 3MAHA 2GJIA 1M5SA 2BXJA 2COLA 3LP1A 1HBOA 4J9RA 2J0SD 3KNAA 1OPIA 5KT2A 1LFWA 2DHGA 2L41A 2JL9A 4QBUA 4K50A 5HL7Q 1MROB 2PN6A 1JLGA 4IQMA 5KT3A 2R2UA 3TUZC 2HNZB 1RT1B 2YNIA 1RT2A 1U6FA 3P5TL 4IQXA 1YJUA 1WELA 2A2DA 5KG7A 1X4DA 1KOOA 2Z4PA 5GAHU 2ZH3A 3MR3A 4ED6A 3FEXB 1DARA 2VOOA 1C4AA 1U7LA 2AYBA 2KXFA 2DH7A 1NHUA 1F0XA 1U8SA 3H20A 3HLUA 4MK9A 4P6QA 4DS4A 3E51A 3CCZA 1HYSB 4URQU 1S79A 1SB6A 3FSXA 3HVWA 1UA1A 2E5LF 3RR8A 2Y1RI 2WAQD 4NZ6A 3SEOA 1SC6A 4Y00A 2BM0A 2YNGB 4X62F 3PRBA 3JYTB 1IBKF 2ASYA 3HHNB 3B82A 5E3PA 1N5YA 2YKMB 3IAS9 3OR2A 4C8OA 3MURP 3M32A 4CNYA 1FDDA 4DOZA 2XI3A 1C1CB 3KLIA 1KQGB 3N28A 3ZZPA 3PEJA 3HP6A 1T03A 3P49B 3OPKA 4AXJA 1XTZA 1RT4A 4K4TA 3VWSA 2HQIA 2JLEA 2CQ3A 4JI6F 2EKYA 2MHEA 1NRKA 2BQUA 3NAIA 2OPSB 5C25A 4HT5A 1RTHA 4U9RA 1QSSA 1GXUA 3UWTA 1HBUA 4I2QA 4NYPA 4M8LA 4DV3F 4WE1B 1HBMA 1OSDA 3AJ2A 5J2NB 5I4MA 1W2BR 1JNZB 4IUFA 3TYTA 4AL5A 2EI5A 4AE5A 2K3IA 5A0YA 4E8UA 1N6QB 1JK9B 3M6WA 4DFPA 3RTVA 2RH3A 4UUXA 1QM9A 2KFNA 4I64A 5C24B 1Z1ZA 4AL7A 1GNKA 4A8WA 3CT9A 4KB7A 2VONA 2IVFB 3CD5A 2DCLA 4EU0A 3GIMA 3DRRB 1HHTP 3FFIB 2KTQA 2YKOA 4ZCKA 1KD1T 2YWGA 4NLWA 1YJ9S 1AXQA 2BA9A 1FRIA 4HH0A 4Y2AA 5IZHA 4JV5F 4DV0F 4DV2F 1H0HB 2M70A 1FDBA 2XCPA 5EWEA 4DS5A 3QGGA 4C3LA 4PUOA 3MECA 2ALZA 1FJEB 5DGBA 2VG5A 2NZ4A 3MEDB 4M63A 3T19A 1YI2S 4ZPVR 3KLGA 3DXSX 3M2RA 2VH7A 3DOKA 3V2UC 3JTNA 3BSCA 1G6BA 5L39A 5KG6A 4TY8A 3MR5A 3I0SA 1X4BA 2I1RA 3C6TB 3ZZZA 3VAKA 4N77A 3LP2A 3VQSA 1U6ZA 3MFIA 3E2EA 2NUHA