1FDDA

Azotobacter vinelandii ferredoxin i: aspartate 15 facilitates proton transfer to the reduced [3fe-4s] cluster
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTNCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Azotobacter vinelandii ferredoxin I. Aspartate 15 facilitates proton transfer to the reduced [3Fe-4S] cluster.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport(iron-sulfur)
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fddA00
1C4CA 1FRXA 2C3MA 1FF2A 1B0TA 3EXYA 1B0VA 2VPZB 2WSFC 3C8YA 1Y5IB 7FDRA 2V4JA 1JNRB 1SIWB 2C3PA 1Q16B 5BYSA 1GT8A 1B0PA 3OR1A 1FRIA 1PC5A 3MMCB 1K0TA 2Y0SD 1KQGB 1FDBA 4YDDB 4XK8C 2V2KA 3MMAB 1KEKA 4RKUC 2PMZD 4L6V3 6FDRA 4OV1A 3MMCA 3IR5B 5FD1A 1IQZA 3EGWB 2FJBB 1FXRA 1G6BA 1FDDA 3MM5A 1FRKA 3IR6B 2IVFB 2UZAA 1FERA 2VPYB 1BD6A 1Y5NB 2WB1D 1FTCA 1SIZA 1SJ1A 2FDNA 1FRMA 1JNZB 1BC6A 2FJEB 6FD1A 1D3WA 2GMHA 5L8RC 1WTFA 1H98A 4CI0B 3MM8B 2VKRA 1RGVA 1H7XA 2WSEC 4XDCA 1A6LA 2WSCC 3MM8A 1FEHA 1AXQA 2PA8D 1F2GA 1DURA 1Y5LB 1R27B 3MMAA 1Y4ZB 1GTEA 3MM9B 5BYQA 2PDAA 1IR0A 1DAXA 1PC4A 2C3YA 2ZVSA 1GTHA 1JB0C 3MM9A 3GYXB 3MMBB 1BQXA 3MM7B 1BLUA 2VPXB 3HKZD 2O01C 1F5BA 3LW5C 4KT0C 1XERA 3MMBA 1HFEL 2V4JB 3MM7A 2GMJA 2FJDB 2FD2A 2VPWB 3IR7B 1FCAA 2FGOA 3OR1B 1FRJA 2WAQD 2XSJB 1F5CA 1FD2A 1FRHA 5E7OB 1ROFA 1KQFB 1FDNA 1CLFA 1BWEA 5BYRA 2C3OA 1H0HB 5CHCB 3OR2B 4Y28C 4XDDA 1GAOA 1DFDA 7FD1A 1FDAA 2XSJA 1G3OA 2Z8QA 4OMFG 2FJAB 4DHVA 3MM6B 3OR2A 1VJWA 2C3UA 3MM5B 1H7WA 4AYBD 3EUNA 3PNIA 5CH7B 1FXDA 2C42A 1C4AA 3MM6A 4ID8A 1FRLA
chains in the Genus database with same CATH superfamily
5LMUF 3ENVA 3IBFB 4K4ZA 1SL1A 1L3TA 3CJ3A 1PC5A 3G4SS 4V19X 4NXMF 3A8IA 1RYRA 4PG8A 2R7SA 2FJBB 4O4RA 2ZZTA 3M6UA 3D3CJ 2DNZA 4FPRA 4K59A 4YDXA 2EPIA 3VALA 4OJ3A 1URRA 5J2QB 1VQ7S 2UXBF 2AJQA 1T9TA 1NHKL 2DNGA 3TYTA 1IR2A 4GRSA 1SBRA 2R8KA 4AXJA 3H5UA 5LJ3Y 3DCAA 2CG4A 4RNMA 2PFFB 2RDJA 1RTHB 3BSOA 5KFWA 1EIYB 4CO1A 1QM9A 5CA5A 2DRDA 3T1HJ 1S9GB 4JV0A 4R8UB 4LIWA 2I9SA 2MXYA 1IWAA 2IJNA 4ED3A 4LR9A 2BOAA 2SXLA 5HQ8A 1G4CA 1U0HA 1W26A 4NLDA 4B3SF 3KXDA 4JV1A 2HQCA 5GAHU 1NSKL 4X64F 3G2XA 3G87A 1EJ7L 4AL6A 2NPIA 2G13A 4ZVSB 2YKMB 3L3CA 2HBYB 1VQMS 5AXKA 4UQTA 4JV2A 2HBZB 2G9OA 2IPOB 3AH6A 1FDDA 3RAQA 3T1AA 2ZM6F 1BD6A 2DRAA 3LA0A 1TK0A 1V5VA 4FP9A 1HWIA 1T03B 3EM1A 3CDBA 3EPGA 3LTOA 3SV4A 3BDPA 2HKEA 4WFXA 3J7YU 3DU5A 3W3SA 1TL3A 4OZ5A 2NR0A 1UTAA 4DFPA 4MKBA 4LVOP 4FF4A 4FNIA 2VPWB 5F9NA 4QBUA 2M7SA 3IRWP 2B51A 3W60A 2JLFA 2KFZA 2LXFA 3SDEB 2G1DA 2Z8QA 4EU0A 1RWNB 5A8RB 4KIAA 1LWCB 4X2BA 4PWUA 1PG5B 3RRKA 3H0PA 3R5CA 3HVAA 1JLFB 1L3SA 3LP1A 1K0TA 5KFTA 4HH1A 3NNHA 2XMKA 2CJBA 2ADBA 2LDIA 1MG7A 5AXNA 4X65F 2UUWA 1YI2S 2GJIA 1AB8A 3VGUA 5E3RA 2I2YA 2KHCA 3NL0A 1VISA 3C14B 2HHPA 4NI2A 1UVNA 4O44A 5C24B 3CMES 1IWGA 2V2QA 1TAQA 4KH1B 2KXFA 2H4YB 3PCOB 1LKZA 4HACB 2W24A 3GJRB 3UCGA 1N48A 3IRXA 1NK9A 3P5TL 3FKBA 1OY6A 1R8PA 3MR5A 2KXHA 4JI4F 1D0EA 3IWNC 3PHTA 1FKAF 4OYIA 4G1PA 4QWCA 2CJYB 1HKAA 5DJBA 4K4UA 4DSLA 4FYXB 4F50A 1XMQF 4USTA 4K2JA 4TYBA 4OX6A 4PCQA 1LK7A 2OELA 3US5A 1FHTA 5ETSA 1YZ7A 2GO9A 5GMDA 2AEJA 2ZDOA 3ET6B 2BYCA 4NYOA 2HFUA 2OPQB 2H1YA 1FK9A 2RQ4A 2DXEA 3X1LB 1R8CA 4ZP6A 2OUGA 3OTCA 1NPRA 1ZYQA 2VBZA 5KFLA 4CP5A 4JBCA 1U48A 2PA8D 3DLEB 1N32J 1SJQA 4A47A 2YWKA 4C8KA 4JV5F 4M5LA 1SC1B 4ZLNA 2DR5A 3KHHA 4NPOA 2RRNA 2MSSA 4DL7A 3N01A 3C6TA 3W63A 2QL9B 2YKOA 2W8KA 2F1FA 3QWPA 2W2MP 1U2FA 2MLYA 1U6ZA 2ZE2B 2RQKA 1QSSA 4ZJLA 3D1OA 3K5OA 2B0GA 3BEGB 5D0GA 1RCXB 3HSDA 4ZLLA 2DXDA 2HQFA 1GT8A 3ILJA 2LKZA 1LW2B 3A3NB 2MQLA 1UEKA 1OS5A 5L38A 2I38A 2ASLA 3DGPB 1Y5NB 1SJ1A 1T9WA 1UJ5A 2FLLA 1TKZA 3DMJA 2FVPA 3RBEA 4U7UK 5JVGQ 4WXWA 3CIZA 4KKOA 3FMBA 2ZITA 5IQQA 4DV6F 1S76D 1RQ0A 3HSGA 2ZH7A 3NGKA 1DLOA 4YN3B 3KKFA 3R5BA 4NX9A 3ZZPA 5FDLB 2DNMA 2HFOA 1TK5A 1XEZA 2OD4A 4HT5A 1EKRA 1RLCL 3PXGa 1X5PA 4O23A 3DRYA 4MT1A 4NZ6A 2BW7A 2FD2A 3C46A 2A2CA 2ILYA 2IHR1 2VOOA 1S4EA 4YR2A 1FDAA 4PG4A 1BXNA 2JJ4D 1TZ0A 1OO0B 5KG6A 2BM1A 2APOA 4FPIA 4PQUA 2PD1A 2XNQA 4XO0A 3CCLS 3EUNA 1WKJA 5A0YB 1OIAA 3K5PA 2ALZA 3PW5A 4MYUA 3NS7B 2G2OA 3BH6B 4UF4A 3MD1A 1S5ZA 1HNWJ 1JNRB 3A12A 2B6AA 2CNNB 3KLEB 2H5IB 4FVMA 4JUZA 4WK3A 3GV5B 3NNCA 4TU8A 5CYQA 2XLKA 2R8JA 4JI1F 4JI5J 3JYTB 4OI2A 3ZTOA 3W61A 2RH3A 2R7UA 2QYCA 2GO8A 1T11A 1ULRA 5J1EA 2KL8A 2NCKL 4CYUA 2D3OR 3R3TA 3JQJA 3BJYA 3OFHA 5MLCV 3ZC4A 2BW2A 2IC3A 2LU1A 2VFRA 3IO1A 2RVJA 2MMYA 3C16B 1R27B 4FZVA 1HQEB 2PSZA 1U7LA 4YUDA 3AJ2A 3EXCX 1Q8BA 2B3TB 2UVVA 4WFNQ 2J7UA 5KFUA 1FJGF 4BBYA 1KR4A 1RT2B 4OI0A 4DR2J 1Z2ZA 6AT1B 5M2UA 4CNZA 2BJDA 3CJ2A 1FD2A 2HK2A 4P2MA 1LWFA 2RHSB 1ZAVA 5HO4A 1YBTA 3PYEA 2MGZB 2UU9J 3GIMA 4MKAA 4JI7F 4JI2J 1CJTA 3GYGA 1S48A 1N5TA 1C4AA 2AJ4A 4J9SA 2Y9HA 1RT3A 2FTRA 3OVSA 3T6BA 4EO6A 1YJVA 1JLBA 2DYAA 4IFVB 3M4XA 5L1JA 1X0PA 4MFBA 2YNFA 1JKHB 5K8PA 5KFJA 2VFUA 2C2NA 3CWJA 4ZN1A 4OYAA 2Z2YB 4OHXA 2HVDA 2MY8A 3VCDA 3J80U 3LQVA 3HZGA 3KLFA 1YRTA 1LW0A 4TYAA 1KLNA 3P6YC 1Q1KA 2WONA 2OTJS 5EWEA 1RABB 4P7TA 1SC6A 4W4MA 3KLHB 3RTVA 3HHLC 5FLXU 5KT4A 2ZC3A 5ETQA 2G0IA 3HFKA 2XYHB 3T3FA 4USMA 1MN7A 3J7A1 1HFEL 3PDNA 1S1TA 3FFIA 4DUZF 4DG1B 2LU2A 3GSIA 3PRDA 5HROB 1RACB 3KHGA 5IOLA 5L46A 4BS2A 1UVKA 4I2PB 1BGXT 3DN9A 1T05B 1PGZA 4LFAF 2WOMB 4IOAQ 5HLFA 3QT7A 2U2FA 3D6TB 3V81A 4F0MA 2VG7A 2AJ1A 2YKNB 3M30A 1V3RA 1N6QB 2FJWA 3Q8VA 2V69A 3TJ8A 4ZCIA 3MAAB 2BMBA 3HD2A 3CMAS 3IWLA 3MAHA 4PRFA 1WHXA 4N7TA 3JSBA 3SIPB 2QC3A 1RWKB 4M5JA 3M2RB 3PV8A 1HBNB 1IBKF 3A13A 4YB5A 2P9GA 1E6YB 4DCJB 3JAMU 2GMLA 4Q2LA 3L95X 2DGOA 1TUGB 4C0HA 1XNRJ 4GVLA 2E9RX 4F02A 3VTIA 1UZDA 1WF0A 2GHPA 4QYZK 2RMLA 3OJUA 1S1XB 1U47A 3Q2TC 3TP2A 2ZWOA 4ECXA 3CJ5A 4YHHJ 2XSJA 3G82A 3U1NA 4NL5A 1N5YB 3G96A 1CULA 4RBVA 1JLEB 5T7LB 4C3KA 4K7QA 3T1YJ 2IM1A 7FDRA 3GJQB 4CO4A 2DNQA 3MCOA 4LBIA 3QJJA 3VGTA 1VBXA 2HIQA 5AJ3F 1U1NA 1NLKL 4F2SA 5D0RA 1WSVA 2IBOA 4U67Q 3IGVA 4OI6A 4OYPA 3CXCR 2K06A 4KHPJ 2GVZA 1IKXA 2HNZA 1NHVA 1SV5B 1VBYA 2B5JB 2XLIA 3G8QA 2RKIA 1FWKA 4K8RA 1VS3A 4DF4A 3UD3P 4DV2F 4P72A 2VBYA 4M5GA 2FHJD 2UXCF 4J9NA 2ASJA 2XMWA 3GU0A 2ZEJA 1RT7B 2LYVA 2MQNA 2YBVA 4OJGA 3MXHP 1WTBA 4AYBD 2HS4A 2VF3A 3FQLA 1MMLA 3IA0A 5KFSA 5C2GA 4C8MA 2VFSA 3K57A 1CJVA 1PKUA 4JP8A 3ZTRA 1T9VA 4MK9A 2E66A 5G4DA 5KFNA 5HATA 2YQ3A 1HHSA 3DOMA 2CWKA 1DTQB 2QFJA 4ZITA 3JSMB 4B9VA 4DR3F 3Q86A 1VR6A 5E3CA 3GFZA 2HURA 2DGTA 2UUBF 1Y5LB 1KBRA 1SKWA 2JWNA 1Y00A 1RHRB 3C19A 2V94A 2AYGA 4LF5J 2KI2A 4U7CA 3D0HE 1IR1A 1JLCB 2H5EA 4PXEA 4Q8EA 2G4BA 5ETRA 2XMUA 1IQTA 1YJNS 3M8RA 4LFBF 4LSLB 4F2RA 2ZKTA 2OTLS 1FRHA 2DKOB 1GQEA 1H72C 1PYTA 1A0OB 1HNZJ 3QRPA 3HM9A 1MMDA 3OUYB 2XGQA 1FXDA 5D4NA 1K1QA 5CCLA 3V6DA 1ZAWA 2HYIB 4ZVGA 4YY3J 2F3JA 3TWZA 5B0FA 2V67A 2XO6A 1TP7A 1NK5A 4YDDB 2ZH2A 4UOHA 4U9RA 3K5LA 4O4GA 2JSXA 1FFWB 3DRRA 4OJ1A 1PJ5A 4DFKA 3CD7A 6FD1A 4URGA 3TVYA 2P2CB 3ELHA 3M2UB 3I9V9 3KK1A 1NJIT 3VZIA 5I42A 3OV7A 2HHQA 3MUVP 1BLUA 2BRKA 1F0XA 2IFXA 2QA1A 4YMEA 5K14B 5AE1A 3OR1B 5HMXA 3SFGA 3OTOF 4HR2A 4J37A 7FD1A 2H65B 4NE9C 3EZ5A 2A6MA 5CZXA 4ECYA 4C8OA 3DRSA 4P7VA 2HZCA 4Q45A 2IIHA 3KJVA 5LT5A 4I64A 5DO2A 2YX1A 5D15A 2X1AA 2HNDA 2GC8A 2R7OA 3FUYA 1G7CB 1NB2A 1VDHA 2L9DA 2BANA 2VBXA 4F36A 1EP4B 4LF1A 4EZ9A 3A8KA 5B0DA 2GV1A 1YX2A 1T8EA 4HEA9 2AX0A 3I32A 2VKRA 1SKSA 2VDIA 4EBEA 3OSPA 3J7AN 4WCEQ 2DHSA 5T41A 2XMMA 5KFZA 2I0XA 4PZVA 2VC1A 1KWMA 3BYRA 4ECRA 4OZ0A 1PC4A 2QN6B 3FEZA 3V2UC 3RUBL 3AXKA 1Q86T 3R6GB 2DH7A 1VQNS 1LXJA 2FLNA 5KFIA 4WE1A 4OFZA 3W2VA 2ZH6A 1Q4RA 2RD5C 4ELTA 1Y7PA 2EBGA 4K4YA 2W4DA 2VKZG 2BDPA 5E33A 4PWWA 1BUXA 3RB0A 2BACA 2B7CB 3ONQA 1NJXA 3DLHA 4PPZA 3WDOA 1TL1A 4F4WA 3N6LA 3VWSA 4ZCLA 2DH9A 4O3PA 4DI6A 3RB3A 3UVJB 2MZQA 4LIRA 3HJFA 2GCFA 3D5MA 4WYLA 3MMCA 2OPRB 1BQNB 4GO5X 5A2QY 3W62A 2Z56B 4IG0B 4X62J 4N41A 2FHMA 1K47A 4WBFA 2F9DA 1CC8A 3K8WA 4P52A 2D9OA 1L5UA 1NZAA 4CI0B 5KFQA 2OIHA 3HHDA 2GVDB 3TA1A 1T9XA 1GX5A 2M88A 5DDRC 5A76A 5BR8J 5HBMB 2V8HA 4Z7CA 3LP0B 3MCMA 2IA0A 5HN0A 3M9NB 2HRUA 3MM7B 3DC2A 1L3UA 3AD9C 4NZ7A 2HMIA 4LFCJ 4EYHB 2YNIB 2PO4A 4J9QA 3MZIA 3CIMA 4HTJA 3M8QA 2JVRA 4WFBQ 1FDNA 3OLBA 2L41A 1QTNB 2NXNA 1V3SA 5B0AA 4DCPB 2AEFA 1RTIB 2BE9B 3OR2A 2F7VA 2J9DE 3HT0A 4UOFA 3SSSA 3AD8C 2UV8A 3BR9A 2ZJRQ 4G1QB 3HSZA 1WC1A 2LCWA 1HBMA 2X51A 4EUVA 4I2QB 1HQUB 4IG3B 4I6YA 3PW0A 2CPZA 2LA6A 3B82A 4F0HA 4ZA1A 2JFKA 2M3DA 2LMIA 4O3RA 1PJ6A 3MEGB 3HZEA 2DTJA 2Z0GA 1U2RA 4IYQA 3H59A 3S01A 1SJFA 1LWEB 4C8YA 1UVMA 4HL9A 4J9VA 1QY7A 2ZFHA 2AEMA 3OXFA 4FXVA 2F9JA 3LANA 4DR1F 4CNYA 4K4VA 4K4XA 4MIBA 2O01C 1S6PA 4FF3A 2M2BA 2M9KA 1GFWB 2MZJA 4DZ6A 3EVOA 1WHVA 1EETA 1FD8A 3SQGA 1PAEX 1K44A 2DNPA 8ATCB 1AA1B 2HQDA 4LMZA 4QCLA 4B9UA 1N5QA 1FNOA 1MROA 5HMYA 2V4JA 3N5BA 2I1RA 1YZ6A 3DOLA 3M6VA 2HFVA 4A4JA 2KYZA 1UW9A 3ISND 3KTQA 3MMJA 2R8HA 3KOAA 4NCGB 1U1OA 2BA9A 1NU4A 3I5CA 2IAJB 1S99A 1G2EA 1MWQA 4DSEA 5H9EJ 2KT3A 4J9LA 4DUYF 1PAUB 1KQKA 1OY8A 3CDEA 3TW0A 2UXDF 3DLKA 4ZPBA 4DPUA 1YBAA 1Y11A 1KQSR 3LF0A 2CNKB 3Q22A 4IDKB 4LSZB 3U7JA 2C28A 4IQMA 1CG2A 4R5PB 3FDSA 3GFYA 1UPMB 1XIQA 1FWPA 2OPPA 2VONA 4MKVA 3AY0A 3AT1B 3CD5A 1VRTB 1X4FA 3M32A 3ZZ0A 3ZTPA 2DY1A 3MWBA 5F0UA 4U96A 1FVQA 3W9JA 4NEYA 3OL8A 2JH3A 1SJ4P 3B78A 5BYSA 3VQTA 2PI5A 1RA7A 4H4MB 1N34F 4RKUC 2V34A 3BGLA 2DVIA 3SBMA 5LSOA 1T9YA 3K2YA 4DSKA 4DV1J 2XY7A 2IVFB 1FERA 3PW4A 4C0BA 2GMHA 3GYNA 1H98A 1EB0A 3Q23A 2CWXA 4Y00A 4E2FB 1V6HA 2XBPA 1C1CB 3H8YA 3CCQS 1P6TA 2M5YA 4FVCA 4Z2XA 3PX4A 3NGUA 1RBAA 3CDWA 2AJFE 2RUGA 4H4OA 1E6VB 4F0KA 1GNKA 4YS2A 1R8BA 2KH9A 4PUOA 2AW0A 2ZBQA 4ZJQA 5GADU 1EHWA 1U0HB 4XDDA 3NMAA 3MEDA 4OMFG 4AE5A 3O2IA 1DTTB 1NO8A 2I5JA 2OFGX 2OI2A 2UUTA 1TV6A 5HAOA 2RRAA 2J8SA 2F5GA 4CTAA 4NLRA 4UY8T 4ED2A 2VJUA 1HBUA 1YJRA 5E0OA 4CH1A 3UN5A 1FKOB 3PY8A 3R1HA 3JSRA 2YX7A 2Z30B 2B4OA 4DV7F 4LF9F 3NOGA 2VFTA 2GGPB 4K4TA 3OFGA 2CZVC 3BSAA 4NYPA 1RT1A 2VC0A 3ZFVA 3CSKA 2D69A 1D3WA 1NNDA 1V3ZA 1X8DA 2J8AA 2QLWA 1TL3B 3ITHA 3ICLA 4LR8A 4GC6A 2VIHA 2AGPA 5GAEU 1Q81T 1UVJA 1S77D 2CJ9A 2C3YA 2KJWA 3E01B 4ZN3A 5EWGA 1KHVA 4I6AA 5ETLA 3FSIA 5KFKA 1K0VA 2R8GA 1L3KA 3PYFA 3ENAA 4WU3A 2VG5A 1GAOA 2DHHA 2HAFA 5EDWA 5KFBA 1U09A 1B99A 1UWBB 1DBDA 3CJ0A 4DQQA 1RAJA 4YB7A 1XNQJ 2ZHBA 3DNCA 1XQIA 2F4VF 5EN1A 5LM7E 3DDKA 3CCMS 1NMEB 3MPDA 4OZ3A 4JB8B 3T41A 3OL9A 2MLXA 1VOMA 4HH0A 4ELUA 4CLTA 3RU0A 4ED4A 4NI2B 3PFOA 5J2NA 4O44B 3LUYA 5B7WA 3RZAA 1ZM3A 2CYYA 1WTFA 5CD4A 2ZBCA 4F4YA 4FS2A 4OLOA 1QSLA 2NZCA 2VL1A 1I51B 1Q8KA 5J2MA 2EFNA 1H74A 3FJ2A 5LMUJ 2JEGA 2ZH4A 4OHYA 1XBWA 4G1IA 1GTEA 3KG4A 4DPOA 3C66A 4OX9F 3NCPA 1Q95G 1OWXA 4NXMJ 3NCRA 5KFAA 1NDLA 1KQFB 5HANA 2UXBJ 1M5HA 4QIWD 1FI4A 1MN9A 4KHMA 2K8GA 2JL9A 4QIVA 2IYIA 2N82B 4Q8FA 3GONA 2V4RA 2CPDA 1C0TB 1AZSA 3UW1A 3K0JA 2IRYA 3R6LB 3IWXA 2WK4A 1RYSA 1FK9B 3PFEA 2CQCA 4ZVFA 1W25A 4EBCA 5AE3A 2WRMA 4X4UA 2ZH1A 4DQRA 2CJXB 4L76A 4RW7A 2AZ1A 1U8WA 3MECA 4FNHA 3BBCA 1RWVB 3I0SA 3JS9A 3MM8A 2XM3A 3RYLA 3TANA 1X9MA 4GVBA 4X64J 3ILOA 5JVHQ 2C2OB 2VHGA 1R0CB 4U8YA 3UR0A 1TU0B 2AD9A 5KFYA 2DNHA 2RF2A 1RT5A 3C6TB 3P45B 1F5BA 2EI5A 2QZ8A 1M5KC 2DB1A 4FF1A 2HFZA 3PW7A 2HAIA 5A8WB 5D0HA 4LF6F 4C8ZA 1OJ4A 1DY3A 2ZH9A 4CCHA 1Q53A 1VI7A 2DIVA 2CZ4A 2D3ZA 2YWGA 2KVIA 3L09A 2D3UA 1SQEA 4DX7A 3N28A 1PILA 4C4WA 3MPWA 4Y2MA 3UE2A 1Y5IB 3Q8RB 1S1UA 2YPZA 1SIWB 3QRRA 1ZZNA 4QR1A 3KG1A 2KHDA 1UPPA 2Q6BA 2E7XA 3R7SB 4OJHA 1SL2A 2RDDA 4YOEA 1HPZA 3M9OB 1FRKA 3DMJB 5HL7Q 1RE1B 4KGMA 4KKOB 2BXJA 3CD0A 4CDIA 4B3OB 5L9XA 1DLOB 2B9YA 3NBPA 2R3VA 1OSDA 3CCRS 1DRZA 3DXBA 1R0AA 1DZ5A 3D68A 1YLXA 5DG7A 2A2DA 4CLKA 3IGNA 1JLGA 5F0WA 5DGAA 5BXIA 1TVRA 4DPXA 4X65J 4BCAA 3GB0A 2KN4A 2JOQA 3CMQA 5BYRA 3QZ7A 5IM0A 2Y1LB 1VQLS 1W7WA 4QJVA 1QSYA 4B3MJ 4M63A 1WOPA 3TUJC 1UKUA 3MCSA 2B6AB 3PIOQ 2DGWA 2HHXA 1NSPA 3AHPA 5CQGA 5CYQB 3WX4A 2QA4G 2HGLA 2CPFA 2DNYA 2BJ8A 3ILIA 2KO1A 1SQFA 1HQ2A 5DDOC 1RBLA 2XQCA 4PG6A 3Q2SC 3I87A 5J1EB 3IR6B 5C25A 4CYUB 1JMTA 4KH0B 2W2PP 2DHXA 2IC3B 2E5LF 1RHMB 1BC6A 5KFOA 3SCLE 1JLAA 5EX3A 3GCWP 1UVIA 4F3OA 4U8VA 3BKTA 3MUTP 1XMQJ 2IM0A 3PJXA 3HPOA 2HS3A 3K17A 1ZAXA 1SJRA 2E7VA 1CSJA 1LWFB 2YKQA 5D0EA 3HHKA 3I4PA 4P2FA 1WC0A 1X4EA 1CJTB 3AA8A 1C0UA 1VQ8S 1ZOTA 1C2PA 1RT3B 4UTGA 4RL1A 4JV5J 4KV8A 3OPKA 1U24A 2YNFB 1VFJA 3RW7A 1J5OA 1SH3A 1P1LA 3NWRA 4AXIA 1BY9A 1UWAA 3TAMB 4S0MA 2CUYA 4GO7X 3H5SA 1NK0A 1IQZA 4ZP9A 3EVWA 2R7VA 3O5TB 3MFHA 1ZH5A 1QD1A 1TKTA 3KLFB 1LW0B 2Y3YA 2NREA 3CD6S 2WONB 1CC7A 3PZPA 3GTYX 3LH2S 3FBFA 4DR7F 2A10A 3ISNC 5HP1B 3NCQA 1B70B 1Y0HA 1RP5A 5HI7A 4PG7A 4NEZA 3GP9A 1OSCA 1XR5A 3QFHA 2H4WB 4TLRA 4X4OA 5LL6d 4ZVHA 1VC6A 2E9TA 5F8LA 1S1TB 2HIYA 3FFIB 2XS5A 5J1PA 3PIPQ 1KVJA 3G6XA 1KOHA 2FJDB 1NCLA 3M8PA 4KGVB 1NJZA 2W7OA 3HCXA 3GZ7A 2HNYA 4X66F 1H7WA 2FB0A 3RGIA 1UA1A 3MM6A 2I6WA 2VFVA 1XWLA 1RCOB 3MR3A 3B4MA 5HLFB 3Q0AA 2VG7B 3M30B 2XNRA 4KYZA 1P1TA 3EGWB 3VAJA 3CJ8A 4A8OA 2UZAA 1IKYA 3RRHA 1VQ5S 2WW4A 4A8KA 1F6TA 5B0CA 3DLBA 3VGSA 2HQ3A 4B3TJ 4N56A 2W9CB 3NMRA 4Q44A 3OTBA 1H2VZ 3UD5A 3TZYA 3TUPA 3FBEA 3IFEA 2HRYA 3R97A 3UD4P 2YQ1A 3HDSA 3E3XA 4TLQA 2CQPA 4NWBA 4NLVA 4B9TA 2ASDA 3KWMA 5D8HB 2YWEA 2Y0BB 3N0VA 2H54B 2VICA 2XSJB 2CQ3A 3JQKA 3S1TA 2PA3A 3G82B 3UWTA 1CULB 2Z2LA 5GAHI 3G86A 3E8OA 2V50A 2FVRA 2IDLA 5M2RA 1HLWA 4R8UA 1BQMA 2K1RA 1FJGJ 2RSQA 5KG1A 4CLFA 2EC2A 2G2YA 2DR6A 1IJEB 1G6BA 2GIQA 3TI0A 2EC0A 3J7YI 3CNQP 2R9LA 5DM7Q 2GVZB 1IKXB 2HNZB 2EEYA 1TUVA 4YR3A 4OYMA 2IMWP 1PJ7A 2RKIB 1Q7YT 1YJ9S 2AU0A 2ZVSA 3A3OB 2YNGA 4LRCA 2OH2A 3KLIB 2ZVIA 1S1WA 3LPYA 3IMQJ 3LW5C 1HWKA 1UZHA 3AB4B 1T03A 1HIYA 4HI1A 2FGOA 3D1QA 2BV3A 4O3OA 4FKXA 2EWHA 3THPA 2OFHX 1WKKA 4E0DA 2C3UA 1N8RT 4EYIB 2Q66A 1LWXA 4KAIA 4M94A 3GIKA 1C4CA 4DX5A 2AYBA 2HG4A 1Q82T 2C2ZB 1CJVB 2RAQA 5AT1B 3TOQA 3BPDA 2AWZA 1J27A 2P9CA 4QW9A 3TVKA 4DUZJ 5H9EK 4L74A 1SCJB 1GX6A 3V5RA 3DLJA 1TQLA 2KRBA 1Q78A 3DOMB 1NSAA 2VH7A 1LWCA 4Y2IA 2MKYA 1RT6A 5E41A 1WG4A 1NKBA 1ZA2B 4DLGA 3BQ2A 4DFMA 3HX9A 2QG9B 4PWDA 3OXLA 1RU1A 5D4PA 1Z2LA 1EX8A 2FHOB 4LFAJ 3PRVA 1DAXA 4PQAA 1IBMF 3MTKA 4YR0A 3CDUA 1PIEA 2NQPA 2QSWA 4MAKA 2AQ4A 3FRZA 5DETA 1S9FA 2YPYA 3KHLA 4TY8A 2QL7B 2YWWA 3I31A 2J0QD 1N33F 2EK6A 5L1IA 2XZWA 5DGBA 3HO1A 3R2DJ 3ULHA 4A8MP 1H2TZ 3TUZC 3DOKA 1HR0J 1HI0P 2ZOFA 3V6DB 2G2ZA 1XMOJ 1RHQB 1AW0A 3GQCA 2K7KA 1RWWB 1MU2B 2CJAA 2B7BB 1KP6A 4L73A 1LK5A 3RR8A 4ED5A 1KQGB 3UCUP 3MOJB 4O4GB 1M5OC 4U6PA 2CDQA 3D4JA 3I4HX 4OL8A 3BBBA 1JIHA 3P5BP 3SV3A 2PT0A 1NHUA 3FSYA 1WF2A 3UPFA 1N52B 2J6UA 5HMZA 1RGVA 2J76E 2QGFB 2DNKA 1ZPWX 1M5SA 3KK1B 1A6LA 5HVFA 5I42B 2RU9A 3T5JA 4DR2F 1RT4A 2AGOA 3J80Y 4JI0F 3TX8A 1FKPA 3FBBA 5IC4B 3S7RA 5RUBA 5AJ3J 2HGNA 2BJ7A 2DO0A 5FLXY 1SH0A 1X4HA 4RWXA 4YFUA 1R3NA 4GKJF 1IVZA 2Z57B 3JTPA 1TL5A 2CAJA 2GAHC 3SCKE 3KJVB 3CJQA 4IRCA 1R6VA 1SC3B 4F04B 4M5HA 2XG8A 2HNDB 3KNAA 3UFCX 3NEKA 4ZS6A 2OEKA 4IKAA 1Z1ZA 3GSDA 4DSJA 5C42B 4F4AA 2BANB 3VGVA 2B4PA 4P9SA 1C1BA 1GMUA 5KOWA 1UFKA 1OMSA 1FESA 4DV2J 1ZM9A 5LMNF 1VQ4S 5KT5A 4CLSA 4PEOA 2D41A 4K50A 4BWMA 5T14A 2GHWA 4ANDA 2GFFA 5A6PA 3V6JA 2KVQE 4LVNP 2MZRA 2QLBB 2OO4A 3AXMA 3ZZTA 5IFMA 3L4BC 2GQQA 1IR0A 5KFXA 1YK9A 1NKEA 1WC5A 1NDPA 1I1GA 3F56A 4WE1B 3DM2A 3CW2C 4EO8A 1X5TA 1J2VA 2MKCA 2PN6A 3BF4A 4C3MA 4DR3J 5FDLA 4DV0J 1RB0A 3TJAA 1TL1B 3FEXB 2UUBJ 3BZQA 2MQ8A 2A0FB 2DNNA 4ZOSA 4MJKA 4DMZA 1VHFA 1P8GA 3FK4A 4LSNA 3VAKA 2FVCA 3MMCB 3TR5A 1VLYA 4ICLA 2GQCA 3IM9A 2KFYA 4LFBJ 5K9FA 4PAAA 4ECTA 4TXSA 3CPWR 3QSIA 3D28A 1VBZA 4DF8A 3WHIA 2PI4A 2HVZA 2QEXS 4P2SA 5LSRA 3KLEA 1TUWA 2O67A 4NMLA 4DCOB 2MKSA 2XMTA 3W2WA 1XNRF 3QJLA 2YH0A 1UP1A 2PDAA 5HK4A 4PYDA 3JYTA 3HF5A 4CT9A 2HMIB 4MK8A 2OPSB 1ZA1B 3DU6A 4USIA 1JLQA 3M8QB 2CPEA 2P6SA 3TJ9A 2WAQD 2NYHA 4DLEA 2L08A 4AQYF 3BPSP 3OR2B 4Y28C 3LP2A 2GZOA 1IKWA 1YG0A 2Q3PA 4IFYA 4C97A 3CJRA 4CLYA 1RSCA 1HBMB 2V68A 1O8BA 2W25A 1F1BB 1GMWA 1CJKA 4A8SA 4WK1A 1YHQS 5HJYA 3CCUS 4PABA 1D8ZA 4LBHA 1HWJA 4N77A 2FC9A 4I1TA 2MQQA 5FD1A 4F4KA 2J9CA 3OTOJ 4DBQA 5B0BA 1T3NA 3M8SA 1JK9B 1FRMA 3WIUA 2J0SD 2LEAA 4IOCQ 2R7RA 3MR7A 3M2VB 3M05A 3PYGA 1Y9OA 1AXQA 3HT3A 3GJSB 1S6PB 5ETOA 2E5HA 4LF4F 4N5SA 4O3QA 4KGZB 3NGRA 3RBZA 4RUCA 4J91A 5F8HA 3D3BJ 2QYGA 4ANEA 1EETB 3BKFA 4TY9A 5KTQA 2XCPA 4ECZA 1GH8A 3SQGB 1JJ4A 2R7WA 1DFDA 3FEYB 4WXOA 1MROB 1G1XA 1R89A 4OZ2A 3QSYB 3E2EA 4C11A 1AFIA 4RNHA 4KPYA 2MZ1A 4ILLA 2VD3A 3DOLB 2J9DA 4WF9Q 3OBIA 2XYPB 4C9DA 5HROA 4WZQA 4ILMA 3L9ZA 2JDJA 3D1HA 3T5LA 2EKYA 2E1RA 4ZK7M 1NXIA 5A8KA 4QU7A 3BO4A 3DHWC 2J0WA 2XHCA 2XI3A 3DLKB 4BWJA 2WOMA 1VQOS 3Q89A 3FNNA 2CQ0A 4W98A 3O3LA 3B8HA 1NUEA 1YWXA 1O51A 2ALYB 5BYQA 3BN4A 3KJNB 1XN9A 3MD3A 3MAAA 5F9LA 4ERDA 2VOPA 2J7KA 2OPPB 1YJTA 1U6FA 2O66A 5KFDA 4X4SA 4YY3F 4W92B 4ANCA 1TKDA 3QYYA 4NLGA 4Z37A 2PIIA 2COLA 4F25A 2BEFA 4X4NA 2OMOA 1EZZB 3BSNA 3MMAB 3KMSA 3EWGA 2HGMA 2BJ3A 4ECQA 4BC7A 2ATLA 4KGKA 1WC3A 2BUNA 4IUFA 1KFSA 3K59A 3O6QA 1JXEA 2DGXA 4DWIA 1Y3JA 2CNOB 5AXMA 5ETNA 4RW6A 2FYXA 3THVA 1Q8LA 3BN7A 4H4OB 2NUHA 1KLMA 2V0NA 1WUUA 2GJ2A 3R1LA 3FGVA 3ZTQA 1HNIA 3ISZA 4F3MA 2JVOA 4PUOB 2HHSA 2XULA 5G0RA 2ZBPA 2GMJA 1N88A 3MOZA 1IM6A 3KUGA 3ZNJ1 2I5JB 1X9WA 1TV6B 3QAEA 4K0KF 1X4DA 4ZCKA 2ZJQQ 2B9XA 1HHQA 4NMXA 1I3OB 1HBUB 1NPKA 4DR1J 1ZPVA 4WZMA 1S6OA 2JEIA 2DEIA 2Y0SD 5KT7A 1EAYC 2CIMA 3I9ZA 3UNYA 4ZCMA 1YBUA 3HHLA 4ECSA 1RT1B 3J81U 2ZH8A 3Q8QB 2ZJPQ 1WHWA 3IXQA 3ITHB 2HVEA 2FC8A 4C48A 4ZP7A 2DR9A 3V4MA 1F2GA 4OX7A 3MEEA 2VG6A 4CIOA 3CUNA 1TL7A 1I94F 2HW3A 3J7Z5 1DTQA 1RJJA 4ZDNA 4Q0BA 4R25A 1N4LA 4ZPVR 2VU5A 4UT4A 1B7FA 1SUQA 3CDAA 2UXDJ 1TKXA 5IXUA 2O3DA 5I3QA 2DCUB 2E1CA 5LSLA 1AT1B 3D2WA 3BGFA 2Z4PA 4YP3A 5GAGU 1KHWA 1D8YA 4J9KA 3N6MA 2LQJA 3EDRB 2FY1A 3GR1A 4ZPWR 2V2VA 1NK8A 5DZ6A 4GKKF 3EX7B 5J2NB 2UUAF 1XC9A 3OUYA 2QX0A 2W9AA 2JFDA 1K8AT 2MTLA 3H20A 3LGHA 3NY0A 2FDNA 5J2MB 5KT3A 1GXTA 1WORA 2OGUA 4NLYA 4KO0A 2UP1A 4NCBA 1KOOA 1UA0A 2Y8WA 2UVWA 1WELA 1N34J 2BKOA 3HVTB 3HFVA 4J9OA 2BKNA 2PEBA 1KSPA 1CBKA 1U1MA 3DLLQ 3N4WA 4PPDA 3KJFB 4N8NA 4ZPDA 2HPUA 2J0XA 4I7FA 2FUG9 2K2PA 1AZSB 3CVKA 1FJ7A 3KJQB 3MPVA 2F8MA 2B56A 4RX6A 1FNMA 5SZTA 1RWXB 2C3PA 5KFHA 3OR1A 3CC7S 1DHMA 4ZP8A 2AGQA 3I56S 2GJFA 2QLFB 3A8EA 4X4RA 1VQKS 4ATNA 4CM2A 2XYGB 2C2EA 4TVAB 2HVHA 3N5FA 1I5OB 3MECB 1S49A 3I0SB 3MM8B 4GVBB 8AT1B 4WTYA 2OHDA 1R43A 1S97A 3D6HB 2RF2B 1VQPS 1RT5B 1K1SA 1NPPA 5DG9A 4C0OC 2ZUAA 2L3MA 4QIEA 1HYSA 4DV7J 4LF9J 3JXOA 4OI1A 5CYJA 1V5IB 3CCZA 2FLOA 5CAAA 3GJTB 1RAHB 2BE7D 2XMAA 2F4FA 1RBOB 3GV8B 3ZZYA 5KG0A 2PC6A 4PXBA 5D78A 3QO9A 2DPIA 3MM5B 3C6UA 1ZTWA 1F3VA 4NYZA 2FVQA 1S1UB 4B02A 3KK3B 1RU2A 3OVAA 4AL7A 2R42A 2DISA 1R8HA 4JI8F 4JI3F 3IS9B 2HFNA 3BH7B 1U6BA 2E5GA 1S79A 2HK3A 2VA3A 3LAMA 1FX4A 4OZ1A 3BM7A 2YNHA 1HPZB 3AQOA 2K3IA 3ZTSA 1LQ9A 4KR0B 2DXFA 5JUMA 1S6UA 1IJFB 1MNEA 3RG6A 1NK6A 4FDFA 3M8YA 3F73A 1NH7A 1UJ6A 3NBPB 1B64A 3SMZA 2ROGA 2X7IA 2OSQA 4XDCA 1CJUA 1R0AB 5A6WA 1QAXA 5L9NA 2RILA 2OPRA 1JLGB 3B6BA 3G6VA 1H73A 2ZHAA 1SJ3P 4OYXA 4O3SA 1TVRB 1FO1A 4FXWA 1DQ9A 1S1VA 2HBRB 3N79A 1LFWA 5D6GA 3K58A 3RR7A 1NBEB 5IM0B 3MR2A 2LXUA 2DR8A 3LP0A 3CCJS 1ZTTA 5IV3A 1X4AA 1RAIB 1S10A 3PACA 2LA4A 3DYAA 1HMVA 3UN3A 2HWTA 2Y1JA 2CA9A 2B8QA 3BS9A 2CVIA 4OX9J 2C2MB 1QDUB 4MIAA 4AT1B 5DQIA 2PMZD 2HWHA 5IWAF 4QYZJ 3NS6A 2BJ1A 2EVZA 4QWDA 3KLGB 1FXLA 3GCXP 3PG9A 1JLAB 1LFPA 4IRKA 2G0CA 4RPFA 4CH7A 4USUA 4M95A 1D9AA 4LR7A 2DH8A 1H7XA 4I2QA 1HQUA 4IG3A 3SSRA 3SXLA 2XEXA 4HDHA 2O1PA 2CRLA 4NA1A 4KBIA 3KNGA 2OSRA 4M5DB 4OZLA 2AHOB 3VQSA 3DI6A 2QJ3A 2XZTB 3MMBA 3FSXA 1PBUA 1M0SA 4WYWA 1F5CA 2EFQA 2DNLA 1C0UB 2W7AA 4CM0A 4XPCA 5C2CA 3CEDA 1RAFB 4I69A 5IT9Y 3LALA 1S0MA 1VRUA 1NSQA 2MPUA 3EZUA 1J5OB 2CQ1A 4TU7A 2DGSA 3W8PA 1FWLA 3H42A 1FDBA 3SQOP 2CJKA 4L6V3 4NXNJ 2V9KA 1VGYA 1TKTB 3GWCA 1MWYA 1HARA 3THTA 1RWOB 3GIRA 4UZCA 1OYEA 4LF6J 3R5AA 3OJSA 3NWGA 3TNVA 3GE9A 4ZVEA 2WBRA 4Z7YA 1QAIA 2A6OA 1Q79A 5KFPA 2NZ4A 3KDOA 3UN2A 2MHNA 1Y4ZB 3LAKA 1HBOA 1P9YA 2DRBA 4P6QA 2IYGA 1RHKB 4DL2A 2ZH3A 3GILA 3OLAA 1XERA 3DLGA 3DRPA 1NJYA 4XTTA 4X4QA 1S72S 2QO3A 3U02A 2HNYB 3MM6B 4ILRA 1UEUA 3BBFA 3H98A 3PX0A 3J81j 2C2KB 2CNLB 4URSA 1U1PA 3MHYA 4P71A 5J1NA 4NLUA 3CGIA 3CULA 2DCLA 2ZD1A 1KFDA 1AUSL 2BE2B 4B3RF 2CFXA 3H4DA 2B9EA 1SH2A 3M9MB 2IA6A 1FT8A 1WSRA 2QE5A 4HYKA 5KT6A 4NOHA 4AUKA 3SCJE 3DDNA 1SXLA 1CEZA 1B4SA 1WHYA 3NKYA 4H4MA 5HSPA 3G8SA 2PEHA 4LF8F 3PJ9A 4USJC 1GMVA 2CPYA 1XK8A 1W2IA 1AFJA 5I3UA 2V5HG 1RLDA 1VQSA 2BVZA 2WZ1A 5GADI 2BABA 3SYZA 2ROPA 2MKIA 4WIIA 4USWA 2E5LJ 2CVEA 1KRPA 1C1CA 1OQ3A 3V6KA 3VAMA 4RW4B 1S57A 1HA1A 5LXYA 2NSCA 2JHEA 2LP4A 1E6VA 1BQMB 2K1RB 2LQ9A 2FPHX 1B0PA 3FBCA 4CLZA 1M1HA 1PO6A 2V2KA 4KFBA 1CS4B 4DX6A 3UDLA 1DTTA 4J90A 4YEAA 3RBDA 1FJCA 3EZOA 2N7CA 2OP5A 3I0RA 5EGYA 2EBEA 5ETTA 3K7RA 5K8MA 5GAEI 1FKOA 3L7OA 2WVDA 2H51B 2RS2A 2FY8A 1UL3A 2YNGB 2ZC4A 3P4UB 4QWAA 1S1WB 2GGPA 3CJKA 3Q24A 4N76A 4QPXA 4MMOA 3GV7B 2B4UA 5ETMA 2JNJA 2E29A 1VCTA 2V63A 3H2VE 2VQEF 1OYDA 2NPFA 4ZPCA 1AROP 3GLJA 4DR7J 4ENOA 3E01A 4DR5F 2ZZMA 4FF2A 2VODA 4IO9Q 1HWLA 3GR0A 2CQDA 1X4CA 2KM8C 1TFWA 2DY9A 2N3LA 3EPIA 3KDNA 1ZBTA 6FDRA 1U1LA 1BWVA 3NG8A 1UWBA 3MUMP 1RT6B 4NA2A 3U27A 1HNVB 2WB1D 4M8LA 1RAOA 1SPBP 4CWBA 2GS8A 5FJ4A 2KU7A 4X66J 3O8WA 4PWDB 1N5SA 2NXCA 1NZ8A 2YQ0A 3CTRA 4C8LA 4HT7A 4RBTA 2C1EB 3M1VA 3H7HB 1WC4A 4FXDA 1YITS 3Q8UA 5K8NA 2RQMA 4QR2A 1J5EF 3CCVS 4V19J 4TY8B 3TX0A 2KKHA 4WTOB 4B3MF 2QLJB 4KC5A 1FCAA 3TAPA 4JYAJ 2ZNYA 2A1BA 1ROFA 4DSFA 3DOKB 2QIFA 1UFWA 4QWEA 2HHHF 2HRTA 3BSCA 1JJ2R 5GMEA 4EK2A 1RADB 1FF2A 1HI1A 2WSFC 2KB2A 1XJWB 2MQPA 4IR1A 4NZ0A 1HNXF 5HQLA 3H90A 3BGRA 4UUWA 4KRWA 1S7HA 2L9NA 1WF1A 3GG0A 3IR5B 4QIFA 4ITSA 3QIPA 2BJEA 2YKAA 3AD7C 2HHUA 3BDEA 1IN0A 1YVFA 1C0TA 2B8PA 2DGUA 3CC2S 4IQXA 1MW7A 1RT4B 2VA2A 1FKPB 8RUCA 3JTOA 4RWWA 3TEHB 3MAQA 2VQFF 4EBDA 2QFIA 5L1LA 2V8DA 2DHAA 2UUCJ 1KVKA 3MFIA 3HVRA 1TR0A 5H9FJ 1RK8A 1YKWA 3IAS9 4OV6A 1CQMA 3BO2A 2FHJA 1YRUA 2N4DA 2XHWA 3C15A 1TTHB 1QAJA 5L39A 1UJ4A 2IM2A 3TVZA 2X1GA 2MKJA 3DGVA 3PVXA 3GIIA 4A8XA 4Y2KA 4DX8H 3C8YA 1JQGA 4RUHA 1C1BB 4MH8A 3VR1A 1T0TV 4I6WA 5A8WA 1XTZA 1M1GA 4C6AA 4CH0S 4XK8C 2ZOGA 1S4FA 2LQBA 1JJCB 2HHVA 5KG3A 3A8JA 4IOBA 1S12A 5EX0A 3VZHA 4RNOA 4WU2A 5DS7A 1ITPA 2AKWB 2NXUA 4WFAQ 5JXSA 4HTIA 2H5JB 3FRYA 4DR6F 1F3FA 1N5VA 3PJWA 2A18A 4IO1A 3VAGA 3DM2B 2LFVA 2R2TA 2HS0A 2XTJP 2IVMA 4J9RA 4B3OA 4B9LA 4MK7A 2HFSA 1VYAA 3R5GA 2XSFA 2OLWA 3WQPA 4M5MA 2I8EA 3S6EA 2BRLA 1S0VA 2MSTA 4LF2A 4B9MA 4ID8A 5E3QA 4LSNB 1NDCA 3NGTA 1IBMJ 4ICLB 1Q16B 3POTA 1REGX 4LRFA 3PKYA 2BZ2A 2C2RA 4B3TF 1A9NB 1IKVA 1S6QA 2HVIA 1N33J 2JEFA 4ES2A 3GIJA 1PCAA 3N9UC 2J6SA 4HLBA 2LQ8A 3W2WB 2IY5B 1H6KX 4DQPA 2MHEA 4LF7F 4ZLJA 3HSJA 2XY6A 2WHOA 1JLQB 4ZMMA 1QE1A 4DL3A 3MM9A 5CYMA 2HZVA 4RNFA 1B3TA 4Y6IA 3LP2B 4QU6A 1IKWB 4K4SA 3F41A 1KTVA 4IFYB 1VJWA 4KE5A 3PO5A 4I67A 1CJKB 2K7JA 3MGJA 4JI0J 4B17A 3WBZA 2BQ3A 3R2CJ 5KFFA 1VC0A 1RTDA 2R2SA 3HLUA 1JXVA 3JSYA 2L9WA 3H25A 3HXMA 2IBKA 2JC0A 4FKYA 2BKPA 4X84A 4MIWA 3IN5A 3UNGC 4GKJJ 1NB7A 4L3KA 4ZVTB 1YJ7A 4DR4F 3KK2A 1M90T 1L3VA 2RT3A 2ERRA 2AIRB 3TAMA 3W1YC 4RUAA 5C5JA 4ECUA 1FFSB 4OIXA 1FE0A 4LBPA 4GC7A 3ZNUA 3QT6A 2Z2MA 4ECWA 2GW8A 3RAXA 1N0UA 1QUVA 7AT1B 5LMNJ 3D0GE 5HP1A 2E7WA 3LP1B 2H9ZA 4NLTA 4WP8A 4WJBA 1G3OA 1U2CA 4DHVA 4C11B 3TA0A 4KJIA 1R0BG 4P74A 4DU7A 2CQBA 1B0TA 4C3LA 2W9BA 4EEYA 4IH6A 4CLUA 4JI6F 2CKWA 1SC4B 4C8NA 3W5YA 1VK8A 2DR7A 2GQ2A 3Q8PB 5KG2A 3HJVA 5A8KB 5F3ZA 3NXZA 4OYOA 1Z4UA 2MJNA 2W8LA 1IBLF 3A4TA 3IRXB 1N36F 3RJMB 5K8OA 2WSEC 4DV5F 5ADZA 1BMQB 2F63A 1NK4A 1RDRA 4MTPA 4V1Ak 3W66A 3IG1A 4RW8A 2MYFA 2BJ9A 5F8NA 3CF5Q 1OQ6A 1B7YB 4J7CA 1TMMA 1HR0F 3PR4A 2FZGB 5IC6B 2W9CA 1XMOF 3HMJG 4WIQA 3UO0A 2CJQA 4WFZA 4OHWA 4J9MA 2HWIA 5AXLA 3LOUA 2RQCA 1KKHA 1QVGR 3WX8A 3QMQA 3FVYA 1M5PC 1U26A 4PYAA 4CO5A 3P96A 2F8HA 1VQYA 2EW9A 4RUBA 3X3UA 3CB4A 1ICEB 4NRUA 3U1LA 4OLPA 4B3SJ 3W8GA 4AQYJ 1QJHA 4Y3CA 3AJDA 3T9NA 3O44A 2PFDA 3T19A 1X4BA 1SIZA 2ZWPA 3WIVA 4GMKA 1M1KT 2RE1A 3I5BA 4DOZA 1S9EA 3M6XA 4RW6B 4ZPTR 2J7WA 4C98A 2ZM6J 1T95A 3QT5A 5K5MA 1KLMB 5CD4H 3QPIA 2CADA 1YGYA 1HNIB 2AMCB 2GAGC 2ZOMA 3LGNA 5CZVA 5G0RB 5EUHA 4NLPA 3QT8A 2XO7A 3I96A 4DV4F 1GXLA 3LO3A 4DS5A 1DQAA 3OL7A 3OTDA 2R7TA 2BX6A 3EMTA 4HHUA 1KD1T 4HI2A 4Y0FA 3VVTA 5DDQC 3KLIA 4KHRA 1TKZB 2C3MA 4DV3F 3EXYA 3CT9A 4ZHRA 1VRQC 4LF4J 2YVSA 3RRGA 2IRXA 3HHLB 1ZM2A 3T6JA 1FXRA 2ACYA 3RW6A 1HW8A 3CJTA 3PX6A 2XCAA 5J2PA 2V9WA 3T5HA 2VASA 3A1YG 2NXJA 4LJMA 5KFGA 5L8RC 2EXUA 2WVCA 1RHJB 3MEEB 3ETMA 4QIGA 2VG6B 3VAHA 2KTQA 1RTJA 3ADAC 1SL0A 1TL7B 4PQUB 4ER8A 4CZCA 2XLJA 3MCNA 3R5JB 3QLHA 3AFGA 5E3AA 4ETXA 5DLFA 1PYOB 3RB4A 4DV0F 1TELA 4Q0BB 2D1CA 1H2UX 1QTMA 2VJVA 1BE4A 1SUQB 1MSWD 4UOCA 3WC0A 1GXUA 1TKXB 1U0SA 1NAQA 1U25A 3BO3A 2Q6CA 5FIIA 1SB6A 3ENQA 1T3OA 3D67A 4JI4J 4ED1A 3QRQA 5MAOA 3W64A 1F9HA 2JRSA 4URQU 4RW9A 4ID5A 1WDTA 3TARA 3T1HF 2NUUG 3T9ZA 3PR5B 1GEHA 3EDQB 3CO9A 3OHBA 2ILZA 3VHQA 4A8WA 2AJ0A 3BYPA 4PG5A 1MU2A 4KO0B 3W65A 2UV8G 3D54A 1XMBA 3NGDA 5F8JA 1MWZA 4EWTA 3CCES 1NEEA 1X4GA 4TQRA 2LQ5A 3TZXA 2KYXA 1YJWS 4OI3A 4DS4A 2R4FA 4TN2A 5I4MA 3EVMA 3SZ2A 2P5VA 4ZJOA 1JLBB 3SCIE 3OXGA 4M5KA 2W2NP 4DUTA 2E5JA 3G6YA 1KVIA 2XY5A 5E7OB 1Q8IA 4MFBB 1BWEA 2C3OA 3EICA 4DPTA 3OFFA 2JX2A 1SKUB 4I7FB 2R7QA 3V4IA 1QVFR 2CQ4A 1HHTP 4FYYB 3MTJA 4KGXB 4AD6A 4HHJA 1NM2A 2EK1A 4B08A 1Y3KA 3OQ2A 5IZHA 3RBXA 4Q5VA 1VBKA 2CXEA 1OY9A 2VPYB 3D7SB 5K20B 2D9PA 3R7BB 4K0KJ 2YKPA 1O5JA 1JWWA 3C2PA 3KYLA 5C42A 4B9SA 1X5OA 4O3NA 2AYMA 5M2PA 3K8VA 4IR9A 1HYSB 3TZZA 2AT1B 3HHNB 2IMOA 2VPXB 5KT2A 5IV4A 2Y1RI 4CQ1A 2V4QA 3QQCD 5D3GA 4DV6J 3P49B 5HQMA 5ETPA 1HD0A 5B0GA 2D74B 3V81B 3QO9B 4EZ6A 2PMWA 3C6UB 1REVA 4RBUA 2CPIA 3DXSX 2IJFA 4OI4A 3FZ2A 3EGNA 1FRXA 2KG1A 4E98A 1KONA 5JJBA 4PXDA 3W5ZA 2YNHB 2Q79A 1I94J 3P3DA 4ZIVA 2M4MA 2P9EA 2WBMA 3OTEA 4Y2AA 3O1LA 4RU9A 3CJ4A 5B0EA 1YDLA 1FE4A 2HBQB 1CJUB 3WC2A 3BKUA 1ELOA 3MR6A 3KUHA 5J2QA 4JI1J 4ZLPA 4DPYA 1KC8T 3DFEA 1LNQA 5D4LA 3IM8A 1UVLA 4X4VA 2OJ3A 1S1VB 3QNWB 1N56A 2UVUA 3MF5A 3UDCA 4GKKJ 1RTHA 1YJUA 1WKLA 5F3TA 4Q43A 2UUAJ 2HZAA 2HHTA 5ETKA 3M8WA 1RTZA 3QGPA 2DHGA 1S9GA 5E2QA 2YY3A 1YTYA 4PXCA 4QW8A 2QL5B 3DYAB 4ED7A 1HMVB 2O5DA 4G3IA 1KTQA 2OPSA 3K5NA 2PE8A 3D6FB 3H2LA 2VPZB 1N32F 1KDNA 1UCNA 1UEVA 3OD2A 4JI7J 1GK8A 1HD1A 5IT0A 2YKMA 3DDIA 2OMLA 3KG0A 4XIUA 1X9SA 4EMDA 2IM3A 1D1UA 3QAUA 3TA2A 5GVQA 4ES1A 2RJZA 5U47A 4R0EA 1FTCA 1X0FA 4B9NA 4DPWA 2AX1A 3IBCB 3F0NA 4NLOA 4CO2A 1RA6A 1CVJA 3ZZUA 3J81Y 3QGGA 5H9FK 2XC9A 1T02A 4CO0A 2Z2ZA 1TAUA 2E9ZA 3H5YA 1KS2A 2WB4A 3DI6B 5BJRA 3B4DA 2YX4A 3GYXB 3MMBB 2MKKA 1U02A 4A46A 1YQHA 3KMQA 2P6TA 3GMGA 3QIDA 4A8YA 3M2VA 1CLFA 3PW2A 2RHQB 2DJWA 3SSQA 2CPXA 3SDEA 1VRUB 2DT9A 1RUSA 3IP0A 4LREA 2FZCB 4M5IA 2B9WA 5A8RA 4XPEA 2XS7A 2UVRA 1T9UA 3P8BB 4Q7AA 5D4OA 2LEBA 2W1BA 3G6ES 1FRIA 1M5VC 1U45A 1JLFA 3SEOA 3CE8A 2Q43A 4UY85 4BC9A 5AE2A 2DPJA 9ATCB 2FJEB 4O0NA 3C14A 2RRBA 1WI8A 4UUXA 5C24A 4ZKAA 1HBOB 3HP6A 4JI8J 4JI3J 1JX4A 5E3PA 2X1FA 3WZ0A 1FX2A 4C7QA 2YXLA 5DLGA 1HNWF 1V9OA 3L7PA 3DLGB 4Y34A 1BQXA 2XS2A 1O0PA 3DRPB 1NDKA 4HACA 1IBKJ 3PO4A 2KRRA 4TNOA 1HWUA 4DL5A 4F4XA 3JTNA 3NP5A 4JI5F 4HDGA 4J5OA 1NJWA 3FC9A 1WEXA 3LWMA 2N4CA 1U1QA 1Y10A 2HHWA 4CLPA 3VV2B 3W7BA 3DRRB 3H5XA 5C7PA 1Q0NA 4WPAA 2FJXA 2KM8B 3PM9A 4OYWA 3MURP 1F9FA 2PGCA 2ZD1B 3DHXA 2MQMA 1U1RA 3HD1A 1ZM4A 4NLXA 1KEKA 3MI7X 1UETA 1IM4A 3GFHA 1VQ6S 3R5DA 2HQIA 3ET6A 4PKDB 2EG2A 2QA2A 4LUBA 2OPQA 3HHEA 3QBCA 1QLNA 4IH7A 5LOQA 1SVDA 2AYEA 2YWFA 1RZMA 2ZUGA 2UU9F 3VVUA 4JI2F 4LQ3A 3PKMA 4EI2A 3G8TA 4O0IA 2DNRA 3K5MA 3MMAA 3AOBA 4ZVRB 5KG5A 2Y1IA 5E5NA 5I3UB 1WACA 3DLEA 3DRXA 2LLZA 3H2UB 3DRSB 4QOTA 1UMJA 5IQ6A 2IVYA 5IWAJ 1F60B 2ZBIA 3TUIC 4WKYA 3OSNA 2DEJA 4P73A 2DBBA 4L3NA 5B08A 1UAWA 3EGZA 2AJ2A 2N3OA 2EFVA 2Y8YA 4PR6A 1WDDA 3Q83A 3H4BA 1EKSA 2ZE2A 2XMVA 2FHKA 2WVFA 5THWA 1RWPB 4ED8A 2UXCJ 1PSDA 4U95A 4D3GA 1XR6A 3I6PA 3JQMA 2MZTA 4P2XA 1FJEB 2M0GB 3M8ZA 5F8IA 4KFBB 5KAKA 1LEOA 2PMHA 1LW2A 4W90B 3I0RB 2QMUB 4DQSA 2V8GA 5DQHA 2CDRB 2W4PA 2EFOA 5KG7A 2WW8A 3DGPA 4X4TA 3RB6A 4Y65A 3W9IA 2QV6A 3B54A 4ED6A 2MDAA 1HW9A 2KZZA 1Q5VA 3W2VB 1TK8A 2D7SA 5B09A 1DURA 3JAMY 1WOSA 4TU9A 3CJKB 5JMNA 2NYIA 4CT8A 2ZHOA 3OT9A 3AA9A 4DL4A 3W9HA 4NA3A 2P8IA 4BLGA 2XZDB 1FVSA 2WTFA 2QMXA 2DD8S 3GPAA 4HVZA 2FGCA 4OYBA 4UQGA 3U1MA 4KY3A 4DXLA 3VAFA 4LRBA 2D3O1 2XI2A 1Q5YA 2CPHA 2H3EB 4WP3A 2OD6A 2KXNB 2ASYA 5GAGI 2EKNA 1APSA 1IXKA 5IT9U 3OL6A 5A0YA 4F26A 4USKA 3D66A 1VIOA 2RDIA 4OV1A 5I3PA 3FZBA 4WP9A 3PYDA 2MKHA 2V2ZA 3CO0P 2LVWA 2DIUA 2BBEA 4YHHF 2CQGA 4NASA 4DL6A 4ETZA 1Q7LB 3M1VB 3GG1A 4I56A 1RAEB 1U8SA 3PEJA 1EQMA 3C16A 3T1YF 1HQEA 2MQOA 2FIUA 2QA4S 3G9CA 4B3RJ 1CPZA 1IBCB 3OW2R 2KJVA 4ZVOB 3BQ0A 1K73T 2YTCA 2IJRA 1RT2A 2CZ9A 2KFNA 3ZZOA 1VIXA 1OPIA 3HKWA 3TQEA 5DZ7A 2ABYA 3IC1A 1RHUB 2MGZA 1U1KA 5HJXA 4LF8J 4KHPF 3HVTA 3BGRB 1SI9A 1IUJA 3OHAA 1F2HA 4R0JA 4F4ZA 2AP6A 4IFVA 3AOAA 1NH8A 2KG0A 4U7UD 1LXNA 1W2BR 3IBWA 3TQ1A 3QIPB 1JKHA 3I82A 2RB7A 2ADCA 2ROEA 2VV5A 2R7XA 1QAYA 3PRBA 1U4BA 4WKRA 4KQZA 4UZBA 2VUGA 3IAM9 4QQBA 2WSCC 1WJ9A 2BR0A 2WVBA 3M7VA 4YB1P 2GNKA 3KLHA 4KPCA 3DKDA 3R7NB 2NSBA 2OEMA 5F8MA 5LXRA 1TFYA 3KUEA 1PBAA 2M8HA 1H38A 2IRUA 3ENWA 3C15B 2V4JB 4Q2MA 4K4WA 4WWSA 4UW2A 4F8RA 1H0HB 2XWYA 4DG1A 1TL4A 2L48A 3AB2B 2FVSA 4MKYA 4A8QA 4J9UE 4USVA 2GIFA 4NXNF 3RAMA 4I2PA 5GMKa 2K3KA 5F41A 2QLXA 2W7PA 3FCVA 4LF5F 4RJVA 2MB0B 3FCHA 1T05A 2DNOA 4BHQA 2LXIA 3EGVA 4DL0C 4G6VB 3TAQA 1R6YA 2DK2A 3GFXA 1VHIA 2YKNA 3MM5A 2VQEJ 2POKA 1N6QA 4KSEB 1R31A 3KK3A 3MEKA 2GHVC 1HNZF 1OPZA 4RO0A 2VDHA 4ED0A 2RUSA 3IS9A 4RR5A 4DR5J 3EE3A 3AQPA 3V6HA 3ETOA 2E5IA 3M2RA 1HBNA 3M32B 4CO3A 2W01A 1BHNA 1VC5A 1RKJA 1E6YA 1MMNA 3BB5A 3BGUA 3HKZD 1VLOA 4AL5A 4ZIWA 2QMWA 4F67A 1LV5A 4D3HA 2IDEA 5KG4A 1KNZA 3CCWA 1S1XA 3CCTA 1FTRA 5KFVA 5HVHA 4E8UA 4USHA 5ETVA 4K5RA 1N5YA 5A2QU 3POTB 4EGLA 1JLEA 5T7LA 4FYWB 2KZMA 2KT2A 2E44A 4EFAC 3S8SA 2CPJA 1J5EJ 3NS5A 2J5AA 4OX8A 1IKVB 4TQSA 4AFFA 1S6QB 2JLGA 3UQSA 2AF6A 1QUPA 2WCXA 1YRXA 2RS8A 2WVEA 2HHHJ 3UR3C 3HULA 1UFLA 1JJHA 2ZBRA 5CCMA 1WEYA 1X31C 3MEDB 2JZ5A 4OQJA 1QE1B 1H3DA 3MM9B 5CYMB 1HNXJ 3TRGA 3QWUA 4IRDA 3KLGA 3CC4S 1SV5A 5EWFA 2B5JA 4CTAB 1WI6A 3QZ8A 5IT4A 4DN9A 5F8GA 3NAIA 5LJ5Y 3UDEA 3AODA 2LEPA 2FJAB 2F40A 4N8OA 1N54B 5D77A 1YIJS 1XR7A 1RT7A 5CH7B 2C42A 1ZS6A 4M5DA 3E51A 2LECA 2V6AA 2FZKB 2VQFJ 3Q8YA 1RTDB 3LPEA 3NNAA 5EHHA 1HI8A 2ATCB 2YH1A 3FQKA 4J9PA 2QRRA 3JB9k 3R27A 3KK2B 1X7VA 2CQHA 1X5SA 1SKRA 4ZVPB 4KB7A 4DZDA 2R8IA 2E1AA 2XWXA 3NLCA 1WG1A 3KFWX 2VG5B 4OZJA 3JSMA 3AOCA 1S0OA 3MDFA 4ZVUB 4M5NA 2LDYA 4HKQA 2RIJA 4DUYJ 1JB0C 3PEHA 5KOXA 3H40A 4NRTA 5H1SV 3EJMA 4I4BA 3FMWA 2KT5A 1JLCA 2OKQA 2W2OP 3UCZP 1FRJA 4X62F 4LSLA 1JXLA 1ZETA 4DN0A 3UDVA 2R2UA 4P10A 4DR6J 2W9BB 4XAKA 4NLWA 3HK2A 5CABA 4P75A 5BR8F 3QATA 1B0VA 2E1PA 2X1BA 4DEZA 1R7IA 4I68A 3G71S 1DQ8A 5HVGA 4LFCF 4A48A 1U49A 1VJQA 1AYEA 2HLTA 3HVWA 2NLWA 2C2DA 1UW4A 2MJUA 3QJPA 4LRDA 1DARA 4A8FA 4M1KA 1CQNA 2HEKA 4KTQA 2NXEA 2BE2A 3IG1B 4RW8B 3M2UA 4DU8A 4JYAF 1FNXH 1ZZFA 2BQRA 4K5SA 4LRAA 1HL6A 2F65A 4ZPAA 4I0WA 1T7PA 2HQGA 2V8PA 1WWHA 3F44A 2J6TA 1FA0A 5K14A 2BM0A 1RAGB 4N47A 1WOOA 2F8EX 3PHEA 4RU2A 2EFGA 3PNIA 3OFEA 4F7VA 4LF7J 5ITHA 4F3QA 4RW7B 4QPTA 2H48B 4CLLA 3VF0B 1GMWD 1K9MT 4FYVB 3R8YA 3BV8A 3AAWB 3EYZA 4ES3A 3I5AA 2FLPA 3KLVA 4DJBA 2OEJA 4RW4A 2CQ2A 2JEJA 3BREA 3MPUB 2XMJA 3TZWA 3Q8SB 1EP4A 1S9EB 3N6NA 2ZZNA 2EG1A 2VZ9A 3TO8A 2YWHA 4DFJA 3R9LA 3BR8A 2UUCF 5IS2A 1RI7A 1WC6A 3J7ZT 2QSFA 3LWLA 4NLSA 9RUBA 2HLUA 2DITA 1CS4A 4YQWA 1RWUA 2OAUA 5KFMA 2M8DB 2MZSA 1D09B 1MLAA 3NRBA 4LQ9A 1D9DA 4QWBA 2RNEA 4ELVA 2VB6A 2DO4A 2GIRA 4ZVQB 4DR4J 3TEGA 4DQIA 4L72B 1EARA 3L7UA 4WFYA 2JLEA 4ZHRB 2W2QP 1DJ0A 4QYRA 5DDPC 2E1MC 4OZNA 2CG8A 1NKCA 2JC1A 1RAAB 4YB6A 2J9EA 4RNNA 3UVJA 4OHZA 2F4VJ 1RKIA 5J2PB 4X4PA 2R2RA 3AJ1A 2QTWA 1BQNA 2MLZA 2MEWA 4IG0A 5SUHA 1AUDA 1JNZB 3M6WA 4HHHA 1A7GE 1P9QC 3CJSA 1RTJB 1N0VC 1VMBA 3QFWA 1X60A 3VAIA 1YSJA 1URNA 2GVDA 2C22A 3I55S 3C3LA 1WNEA 5HBMA 1F9EB 3QLHB 3QGIA 2M70A 4JI6J 1GTHA 2DGVA 1HNVA 1NK7A 4H54A 4UOGA 1NRKA 3MM7A 2B43A 3HFZB 2YNIA 4DV1F 4H4KA 4OYZA 1IBLJ 5CHCB 2Z58B 5L1KA 2ZDPA 1N36J 2NS1B 4QZVB 5C25B 4DV5J 1RTIA 3A3PB 2MY7A 4CRJA 2ZH5A 4QR0A 1F5AA 4L75A 4RW9B 2CQIA 1WD6A 3ILLA 2N7YA 1RXOB 4ECVA 4ID5B 5HMWA 3SI8A 2QT7A 4G1QA 3CCSS 2GX8A 4RLEA 2FQQB 1VK3A 2AV5A 2VBWA 5KFRA 2U1AA 3SFUA 3MPYA 1WG5A 3BGOP 4RZRA 2G0JA 4BDPA 3W5XA 3MEGA 3NGSA 4MYTA 2A3JA 3T5KA 1FEHA 1LWEA 1LOUA 3BQ1A 2B4VA 3HI9A 1T94A 3ZO7A 5CXTA 3QGHA 2ACMA 5DG8A 2W4CA 2ZKUA 1FEEA 2X3GA 1R8AA 4KT0C 4FBTA 4KV8B 4FBUA 2XGPA 2RU3A 3IR7B 4ALZA 3OVBA 2GA7A 3V4IB 2BQUA 2XB2D 1VQ9S 1O6XA 3ZZRA 4NLQA 1KN6A 2ZNZA 2AZ3A 4C2MA 4DSIA 1FRLA 5DRKA 2V8VA 4CLWA 4FS1A 2HSEB 3NAHA 1D9FA 1RISA 4FYDA 2Q1LA 1PYSB 3NOCA 3K89A 3PTWA 4DV4J 4TKTA 1TMJA 3LGMA 2G1HA 4FN5A 3D9BA 1I6JA 2EFPA 3HHLD 4OHVA 4LT6A 5DQGA 4NCGA 3UI3A 1WEZA 2IAJA 3M8PB 3D6MB 5KFCA 4DV3J 1EQ0A 1XNQF 3D0IE 2BOPA 4G65A 1ACMB 1P27B 1S59A 5D3GB 2M52A 4DDFA 1FFGB 4NCAA 3FCWA 4K2XA 4Y2CA 2DGQA 2KDOA 1RWMB 3ZZZA 4IDKA 5DM6Q 2X3DA 5KFEA 4H4KC 1REVB 1SQGA 4IH5A 4R5PA 2FJVA 3ZXWA 1S0NA 3KHRA 1VRTA 1IKYB 4JOUA 1S7IA
chains in the Genus database with same CATH topology
4CTAA 5LMUF 1HHTP 2DCUB 2E1CA 4NLRA 5LSLA 4UY8T 3ENVA 4ED2A 3D2WA 3MTJA 3BGFA 1HBUA 1YJRA 2Z4PA 5E0OA 4YP3A 4CH1A 4HHJA 5GAGU 4K4ZA 1FKOB 1SL1A 1L3TA 1KHWA 3PY8A 3CJ3A 1D8YA 4J9KA 1PC5A 3N6MA 2LQJA 3G4SS 4V19X 2FY1A 3GR1A 3R1HA 4NXMF 2EK1A 4ZPWR 4B08A 3JSRA 2YX7A 4PG8A 1NK8A 1RYRA 2B4OA 4DV7F 1Y3KA 2R7SA 4LF9F 4GKKF 3EX7B 3OQ2A 5IZHA 5J2NB 4Q5VA 2FJBB 4O4RA 2UUAF 2VFTA 1XC9A 3M6UA 3OUYA 2DNZA 2GGPB 4FPRA 3OFGA 2CZVC 4K59A 2W9AA 4K4TA 2VPYB 2JFDA 3BSAA 4NYPA 1K8AT 4YDXA 3H20A 2EPIA 3VALA 4OJ3A 2FDNA 1RT1A 1URRA 2VC0A 5J2QB 2D9PA 3ZFVA 1VQ7S 2UXBF 2AJQA 3CSKA 1D3WA 1NNDA 2YKPA 1O5JA 1V3ZA 5J2MB 2DNGA 5KT3A 1JWWA 3C2PA 3KYLA 5C42A 3TYTA 4B9SA 1GXTA 1X8DA 2J8AA 2QLWA 1SBRA 2R8KA 1X5OA 4NLYA 4KO0A 4O3NA 1TL3B 3ITHA 2AYMA 3ICLA 4AXJA 4GC6A 2UP1A 3H5UA 5LJ3Y 4NCBA 1KOOA 5M2PA 3K8VA 2AGPA 5GAEU 3DCAA 1Q81T 1UVJA 1UA0A 2CG4A 4IR9A 1S77D 1HYSB 2CJ9A 4RNMA 3HHNB 2PFFB 2C3YA 2KJWA 2RDJA 3E01B 1RTHB 3BSOA 2UVWA 1WELA 5KFWA 5EWGA 1KHVA 4CO1A 1QM9A 2IMOA 2VPXB 5KT2A 2Y1RI 4I6AA 4CQ1A 5CA5A 2V4QA 5D3GA 3FSIA 5KFKA 1K0VA 2R8GA 3HVTB 1S9GB 4JV0A 1L3KA 4R8UB 3P49B 4J9OA 4LIWA 2I9SA 1HD0A 2MXYA 1KSPA 5B0GA 2IJNA 2D74B 4WU3A 4ED3A 5HQ8A 2SXLA 2VG5A 1U1MA 3V81B 1GAOA 3QO9B 4EZ6A 3DLLQ 3N4WA 4PPDA 3C6UB 5EDWA 4N8NA 5KFBA 1REVA 1U09A 4RBUA 2CPIA 3DXSX 4ZPDA 4NLDA 1UWBB 1DBDA 3CJ0A 2HPUA 1RAJA 2J0XA 4DQQA 2IJFA 4I7FA 4OI4A 3TAQA 3FZ2A 4YB7A 4B3SF 2FUG9 2K2PA 2ZHBA 3DNCA 3CVKA 3EGNA 1FJ7A 4JV1A 1FRXA 2KG1A 5GAHU 2F4VF 5EN1A 4E98A 3MPVA 4X64F 3DDKA 2F8MA 1KONA 3CCMS 2B56A 4AL6A 2NPIA 1FNMA 4RX6A 5SZTA 2C3PA 5KFHA 2G13A 5JJBA 4PXDA 2YNHB 3OR1A 3CC7S 2YKMB 3L3CA 2Q79A 3OL9A 1VQMS 1VOMA 4HH0A 1DHMA 5AXKA 4UQTA 3P3DA 4JV2A 4ZP8A 4ELUA 2M4MA 2P9EA 2WBMA 2G9OA 3RU0A 2AGQA 3AH6A 3I56S 3OTEA 3A8EA 4Y2AA 4X4RA 1VQKS 3O1LA 1FDDA 4ATNA 3PFOA 3RAQA 4RU9A 2C2EA 3CJ4A 3T1AA 2ZM6F 5J2NA 1BD6A 4O44B 3LUYA 2HVHA 2DRAA 5B0EA 3N5FA 5B7WA 1TK0A 3RZAA 1FE4A 4FP9A 3MECB 1HWIA 1S49A 1ZM3A 2CYYA 1T03B 1WTFA 3WC2A 1ELOA 2ZBCA 3CDBA 3I0SB 3MM8B 3EPGA 4F4YA 4FS2A 4OLOA 1QSLA 3MR6A 5J2QA 3SV4A 2VL1A 3BDPA 4WTYA 4ZLPA 5J2MA 4WFXA 1R43A 1S97A 2EFNA 3J7YU 3FJ2A 2JEGA 3DU5A 1KC8T 3DFEA 2ZH4A 4OHYA 1XBWA 5D4LA 3W3SA 2RF2B 1VQPS 4G1IA 1RT5B 1GTEA 1TL3A 1K1SA 4OZ5A 1UVLA 4X4VA 3KG4A 4DPOA 2NR0A 3C66A 1S1VB 5DG9A 2OJ3A 4C0OC 4OX9F 3NCPA 4DFPA 1N56A 2UVUA 1OWXA 2L3MA 4QIEA 4MKBA 1HYSA 3NCRA 3MF5A 3UDCA 1RTHA 4LVOP 4FF4A 4OI1A 1YJUA 5F3TA 4Q43A 4FNIA 5KFAA 2VPWB 2HHTA 5F9NA 5CYJA 4QBUA 2M7SA 3CCZA 2FLOA 3IRWP 2B51A 3QGPA 2DHGA 1S9GA 5E2QA 1KQFB 2JLFA 2YY3A 2KFZA 2LXFA 1YTYA 4PXCA 1M5HA 3SDEB 3GV8B 3ZZYA 4QIWD 5KG0A 2G1DA 2Z8QA 2PC6A 4QW8A 4PXBA 4EU0A 4KHMA 5D78A 3DYAB 3QO9A 5A8RB 1HMVB 4KIAA 4ED7A 2K8GA 2JL9A 3MM5B 2DPIA 2O5DA 4QIVA 2IYIA 2N82B 3C6UA 1ZTWA 4Q8FA 4G3IA 4NYZA 1KTQA 2OPSA 3K5NA 2FVQA 2PE8A 1LWCB 4X2BA 1S1UB 4PWUA 4B02A 3KK3B 3OVAA 4AL7A 3H2LA 2DISA 1R8HA 2VPZB 4JI8F 2V4RA 2CPDA 1N32F 4JI3F 3IS9B 1C0TB 2HFNA 3RRKA 3R5CA 3HVAA 1U6BA 3UW1A 2E5GA 1UEVA 3K0JA 1S79A 1JLFB 1L3SA 2IRYA 3LP1A 1K0TA 2VA3A 3IWXA 3LAMA 1HD1A 5IT0A 5KFTA 2WK4A 4OZ1A 1RYSA 3BM7A 4HH1A 1FK9B 1HPZB 2YNHA 3AQOA 3PFEA 2K3IA 2XMKA 2YKMA 3NNHA 2CJBA 1LQ9A 2CQCA 2OMLA 4ZVFA 4KR0B 1W25A 2ADBA 2LDIA 3KG0A 4XIUA 4EBCA 1X9SA 2IM3A 5AXNA 5AE3A 5JUMA 1S6UA 2UUWA 4X65F 2GJIA 1IJFB 1YI2S 1D1UA 2WRMA 3QAUA 4X4UA 5E3RA 1MNEA 2I2YA 2ZH1A 2KHCA 3TA2A 3NL0A 5GVQA 4ES1A 2RJZA 5U47A 4DQRA 4R0EA 1FTCA 1NK6A 1X0FA 2HHPA 3F73A 4B9NA 1NH7A 1UJ6A 4RW7A 3NBPB 2Y1IA 1B64A 1UVNA 4O44A 5C24B 3SMZA 3CMES 2AX1A 2ROGA 3MECA 4FNHA 4NLOA 2OSQA 4XDCA 4CO2A 1R0AB 3I0SA 1TAQA 3MM8A 5A6WA 1RA6A 1CVJA 3RYLA 1QAXA 3ZZUA 3J81Y 3QGGA 3TANA 1X9MA 2XC9A 5L9NA 5JVHQ 2KXFA 1T02A 2RILA 4CO0A 1TAUA 3UR0A 2E9ZA 2OPRA 3H5YA 1JLGB 1KS2A 1LKZA 2WB4A 2AD9A 3G6VA 5KFYA 2DNHA 2W24A 3DI6B 5BJRA 2RF2A 2ZHAA 1SJ3P 3B4DA 1RT5A 4O3SA 1TVRB 2YX4A 3C6TB 3GYXB 3MMBB 1FO1A 4FXWA 2MKKA 1DQ9A 1S1VA 1F5BA 4A46A 2EI5A 1YQHA 3N79A 3KMQA 2QZ8A 3UCGA 1M5KC 1LFWA 2DB1A 1N48A 3IRXA 4FF1A 1NK9A 2HFZA 2P6TA 5D6GA 3P5TL 3K58A 3GMGA 3PW7A 3QIDA 2HAIA 4A8YA 3RR7A 5A8WB 5IM0B 3MR2A 2LXUA 3M2VA 1R8PA 1CLFA 3MR5A 2KXHA 4JI4F 1D0EA 2DR8A 4LF6F 3IWNC 4C8ZA 3LP0A 3PW2A 1FKAF 2ZH9A 3CCJS 4CCHA 4G1PA 1Q53A 1VI7A 2DJWA 2DIVA 3SSQA 4QWCA 1ZTTA 2CPXA 2CZ4A 1X4AA 3SDEA 1VRUB 2DT9A 1S10A 2D3ZA 2YWGA 2KVIA 3L09A 5DJBA 3PACA 2D3UA 4K4UA 1SQEA 2LA4A 4DSLA 2B9WA 3DYAA 5A8RA 1HMVA 3N28A 4F50A 1XMQF 1PILA 4XPEA 2XS7A 4C4WA 3MPWA 4TYBA 4Y2MA 4OX6A 3UE2A 2UVRA 1Y5IB 2HWTA 4PCQA 4Q7AA 1LK7A 5D4OA 3Q8RB 2LEBA 2Y1JA 1S1UA 3BS9A 2CVIA 1SIWB 3US5A 1FHTA 2GO9A 3G6ES 1ZZNA 1FRIA 1M5VC 4QR1A 3KG1A 2KHDA 4MIAA 2Q6BA 5DQIA 2PMZD 2HWHA 1U45A 2ZDOA 1JLFA 3SEOA 2BYCA 2E7XA 3CE8A 4NYOA 5IWAF 4OJHA 1SL2A 4QYZJ 3NS6A 2OPQB 4YOEA 2Q43A 1FK9A 1HPZA 2EVZA 2RQ4A 3M9OB 1FRKA 4QWDA 3DMJB 3KLGB 4UY85 1FXLA 3X1LB 1JLAB 1LFPA 4BC9A 5HL7Q 4IRKA 2G0CA 5AE2A 1R8CA 2DPJA 4KGMA 4KKOB 4CH7A 4ZP6A 2FJEB 3OTCA 4M95A 2BXJA 3CD0A 1D9AA 4B3OB 1ZYQA 2VBZA 5L9XA 2DH8A 1DLOB 5KFLA 2B9YA 1H7XA 4JBCA 3NBPA 2RRBA 1U48A 4I2QA 1HQUA 4IG3A 1WI8A 4UUXA 1OSDA 5C24A 4ZKAA 3CCRS 3SSRA 1HBOB 2PA8D 3SXLA 3DLEB 2XEXA 3HP6A 1DRZA 4HDHA 2O1PA 3DXBA 1SJQA 1JX4A 2CRLA 5E3PA 4A47A 1R0AA 3WZ0A 2X1FA 2YWKA 1DZ5A 4C8KA 4JV5F 4C7QA 5DLGA 4NA1A 5DG7A 1HNWF 2A2DA 4KBIA 3KNGA 2OSRA 1V9OA 3L7PA 3IGNA 1JLGA 3DLGB 2DR5A 4M5DB 4OZLA 1BQXA 4Y34A 5F0WA 3VQSA 4NPOA 3KHHA 5DGAA 1O0PA 2RRNA 3DRPB 2XS2A 2MSSA 3DI6A 4DL7A 3PO4A 3N01A 1TVRA 2KRRA 3C6TA 3FSXA 3MMBA 4TNOA 2YKOA 1HWUA 4DL5A 4BCAA 2W8KA 1M0SA 3JTNA 3NP5A 4F4XA 4JI5F 4WYWA 2F1FA 3GB0A 3QWPA 1F5CA 2KN4A 2JOQA 2EFQA 2DNLA 4HDGA 1C0UB 1U2FA 5BYRA 2W7AA 4J5OA 3QZ7A 1NJWA 1U6ZA 2ZE2B 1WEXA 3LWMA 2RQKA 2N4CA 5IM0A 1U1QA 1QSSA 4XPCA 1VQLS 3D1OA 4QJVA 3CEDA 1QSYA 2HHWA 4M63A 3K5OA 2B0GA 3BEGB 3W7BA 4I69A 3DRRB 3H5XA 3TUJC 5IT9Y 1UKUA 2FJXA 2KM8B 3LALA 3MCSA 1S0MA 1VRUA 2B6AB 3PM9A 3PIOQ 2DGWA 2MPUA 3EZUA 3MURP 1J5OB 1F9FA 2CQ1A 2PGCA 2ZD1B 3DHXA 4TU7A 2HHXA 3AHPA 2DGSA 5CQGA 5CYQB 3WX4A 2MQMA 1GT8A 1U1RA 2QA4G 2HGLA 2CPFA 2DNYA 2LKZA 1FDBA 2CJKA 1ZM4A 4NLXA 1KEKA 1LW2B 3MI7X 2KO1A 1UETA 4L6V3 1IM4A 2V9KA 1VGYA 1TKTB 3GFHA 3GWCA 2MQLA 1MWYA 5DDOC 1HARA 4PG6A 3THTA 3Q2SC 1VQ6S 3R5DA 1OS5A 5L38A 3I87A 2HQIA 5J1EB 3IR6B 5C25A 4PKDB 2I38A 2ASLA 2EG2A 1JMTA 2QA2A 4LUBA 3R5AA 1Y5NB 2OPQA 2DHXA 3HHEA 2IC3B 1SJ1A 3OJSA 1UJ5A 2E5LF 1TKZA 3DMJA 3NWGA 4IH7A 2FLLA 5KFOA 1QLNA 3SCLE 2FVPA 1JLAA 3TNVA 3GE9A 1BC6A 3RBEA 4ZVEA 4U7UK 2WBRA 4WXWA 5JVGQ 5EX3A 2AYEA 3CIZA 4KKOA 2YWFA 1QAIA 3FMBA 2ZUGA 4F3OA 1UVIA 2UU9F 4JI2F 1Q79A 3MUTP 4LQ3A 5KFPA 3PKMA 2NZ4A 2ZITA 3G8TA 5IQQA 4DV6F 4O0IA 1RQ0A 1S76D 2ZH7A 3NGKA 1DLOA 2DNRA 3K5MA 2MHNA 3MMAA 1Y4ZB 3LAKA 5KG5A 2IM0A 3KKFA 3R5BA 4NX9A 1WACA 5E5NA 1HBOA 3ZZPA 5FDLB 3PJXA 3DLEA 5I3UB 3HPOA 3DRXA 2DNMA 2LLZA 2HFOA 2DRBA 4P6QA 2HS3A 3H2UB 3DRSB 1TK5A 2IYGA 1XEZA 2OD4A 1ZAXA 1SJRA 4HT5A 4DL2A 4QOTA 2ZH3A 1UMJA 5IQ6A 2IVYA 3GILA 1F60B 1X5PA 3PXGa 2ZBIA 3OLAA 4O23A 1XERA 3DRYA 3DLGA 3TUIC 1CSJA 4NZ6A 1LWFB 2FD2A 3DRPA 2A2CA 3C46A 2ILYA 2YKQA 4WKYA 1NJYA 3HHKA 3OSNA 4X4QA 2IHR1 1S72S 2DBBA 2QO3A 4L3NA 3I4PA 3U02A 2VOOA 5B08A 1UAWA 4YR2A 3EGZA 1FDAA 2HNYB 4PG4A 2EFVA 2N3OA 1X4EA 4PR6A 2JJ4D 3AA8A 1C0UA 1TZ0A 1OO0B 5KG6A 1VQ8S 2BM1A 3MM6B 3H4BA 1ZOTA 2APOA 4ILRA 4PQUA 2PD1A 1UEUA 2XNQA 2ZE2A 4XO0A 1C2PA 3CCLS 2XMVA 3EUNA 3H98A 1RT3B 2FHKA 3PX0A 5THWA 5A0YB 1OIAA 3K5PA 4ED8A 2ALZA 4URSA 1U1PA 3PW5A 3MHYA 5J1NA 4MYUA 1PSDA 3MD1A 4KV8A 4NLUA 4D3GA 1XR6A 3CGIA 3OPKA 1JNRB 3CULA 2B6AA 1U24A 2DCLA 2YNFB 3I6PA 1VFJA 2MZTA 3KLEB 1FJEB 2M0GB 4FVMA 3RW7A 4JUZA 1J5OA 1SH3A 1P1LA