4LF8J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf8J00
3D3BJ 5FLXU 4AQYJ 2UXDJ 1N34J 2UU9J 2UUCJ 3T1YJ 4JI2J 2MQ8A 1HR0J 3W1YC 4DR4J 4B3RJ 4B3TJ 4X62J 3JAMU 2ZM6J 3J7AN 4GKKJ 5IWAJ 4HHUA 4JI6J 4YHHJ 1N36J 4X65J 4LF7J 5A2QU 4RJVA 4KYZA 4JI4J 1XNQJ 4OX9J 4DV6J 4DR1J 4JI8J 4DUYJ 4DUZJ 2KL8A 3T1HJ 1IBKJ 3IMQJ 1IBLJ 4KY3A 3R2CJ 4YY3J 1XMOJ 4DR7J 4JYAJ 4DR6J 4NXNJ 4GKJJ 4PWWA 4DV1J 2KVQE 3J80U 1IBMJ 4LF8J 1N33J 2UUAJ 2UXCJ 5LM7E 4DR3J 4DV7J 5BR8J 4NEYA 4JI5J 4LFCJ 2VQFJ 2UXBJ 4LFBJ 4JI0J 4KHPJ 4LF6J 1J5EJ 4JI1J 1HNWJ 4DR5J 1HNZJ 4NEZA 4DV5J 2HHHJ 4DV2J 4JI3J 4X66J 4X64J 1XNRJ 4JV5J 4B3MJ 4LFAJ 4NXMJ 4DV4J 3J81U 2MEWA 2UUBJ 5LMNJ 2VQEJ 2F4VJ 4V1Ak 1N32J 5AJ3J 4B3SJ 4JI7J 4LF5J 5IT9U 4LF4J 3R2DJ 3OTOJ 4DV3J 3D3CJ 4K0KJ 1I94J 4DV0J 5LMUJ 1HNXJ 4LF9J 2MTLA 2E5LJ 4DR2J 1XMQJ 1FJGJ
chains in the Genus database with same CATH superfamily
1B0TA 4WK1A 2YX4A 4RNFA 3KHHA 3FMWA 4ELUA 3HSZA 1F9EB 3I31A 4DFPA 2F8MA 4B3SF 4XPCA 3R8YA 4F50A 4RJVA 2ZH5A 1FWLA 2WOMA 3I0SA 1Y5IB 4RX6A 1OPIA 5E3CA 3KLGB 5IOLA 5HP1A 1XTZA 5KT4A 2A3JA 4X84A 2FQQB 3J7A1 3KDNA 2ZD1A 3GJTB 2HHVA 4FBTA 2VICA 4P74A 2B4UA 2RF2A 2C1EB 4JYAF 1TK8A 1NUEA 2ZDOA 5D0GA 1EKRA 3O5TB 3GCWP 4C3KA 2JWNA 5D15A 3UN3A 5GAGI 1C4CA 3QWUA 5DGBA 1S0VA 2U1AA 3W7BA 1OSCA 2C2ZB 1REVB 2RIJA 2FLLA 1RTZA 3UDVA 4AFFA 2BE2B 2V2VA 4Q44A 1YQHA 4MT1A 2D3O1 2EW9A 3MUMP 4W98A 4DF8A 3VGSA 1OYDA 2BZ2A 1SQGA 2AZ3A 1O6XA 2QFIA 5F3TA 1B7FA 5GAHU 4USMA 3C6TB 3L09A 3M9NB 4ECZA 3OUYA 2YKNB 3KMSA 3BS9A 2GW8A 3I0RB 2VPWB 1RWOB 1N5TA 1S6QB 2CNLB 1ZOTA 3TZWA 2PC6A 2QSFA 2FVCA 5D4PA 2DR6A 2BDPA 1VYAA 4YP3A 1TMJA 4DR5F 2FHMA 2D9PA 1FRIA 2BKNA 2B7BB 3HMJG 2DNZA 2NUUG 1N32F 2IM2A 2XMWA 1UEVA 4J9MA 4X62F 1X0FA 1UWAA 5HK4A 2XGPA 3FBEA 2HVDA 2QA4S 3VAGA 2OHDA 3LP1B 1WG5A 3EE3A 1VQ9S 2PI4A 3EXYA 3F41A 1BQNA 4N47A 3QT8A 1D1UA 1O0PA 1VQ4S 1MSWD 1DTTA 2F1FA 4TQRA 1HWIA 5KFDA 3DKDA 1HBNB 2NUHA 1TAQA 4BC9A 1F60B 1RZMA 2RDJA 3FNNA 3W5ZA 1Z2ZA 4ZA1A 2FTRA 3PO5A 2MJNA 4HEA9 4A8SA 4A8MP 2FPHX 3FEYB 1CEZA 1R8AA 2EFQA 2ROGA 3HVAA 2YNIB 4M5DB 2V8GA 2BA9A 2HMIA 4CCHA 1FERA 1RACB 3ENQA 1UFKA 1TK5A 4ZCMA 3IWNC 1ACMB 1OJ4A 3W2VB 4PXCA 4NLOA 2N4DA 3NMRA 2VKRA 4ZOSA 4HLBA 1KLMA 2HZCA 4NLVA 1FK9B 2EG2A 1Z2LA 3LP0A 2V4RA 1CG2A 1A6LA 2HQDA 3T19A 1M0SA 2XZTB 3I4HX 4NE9C 1S7HA 3T1YF 2QGFB 4ZVEA 5A6WA 3UE2A 5E2QA 2FVSA 2XWYA 4YMEA 1IM6A 5K14A 4JI6F 3DLHA 2YWWA 2ZBCA 3BBBA 2F9DA 3D6MB 1TKXB 1UW4A 3VVUA 5C42B 2V4QA 3TYTA 1H73A 1RA6A 4NA2A 3QZ8A 4HTJA 1X5SA 2FGCA 4F26A 3D6TB 4FF1A 3G6VA 2OLWA 2VJVA 4ALZA 4CO2A 2RHSB 1TL4A 4EU0A 3P3DA 1VQNS 2AJFE 3H90A 2QX0A 4H4KA 2H51B 5L1IA 2IIHA 4PZVA 2DNMA 1SKSA 2ZBPA 5D0RA 2PMZD 2KJWA 3GG0A 2COLA 3I9ZA 1FESA 2VD3A 4H4MA 5U47A 5A2QU 4DEZA 5FIIA 1T05B 2XULA 1JJ2R 4ELVA 2YKNA 3FUYA 1X4AA 3I0RA 3IMQJ 3N28A 5B0BA 3G96A 3MMBB 2BM1A 3GV5B 2J8AA 3VGTA 5GAGU 4DV1J 2VV5A 4WF9Q 4C0HA 3HHLB 2W7OA 3FQLA 1T02A 4OFZA 2JEJA 1ZETA 2Y3YA 4NOHA 3ETMA 3L7PA 3CD6S 1XIQA 4JI0J 2IA0A 4KHPJ 1QJHA 2E5GA 1QE1A 2D69A 3Q0AA 1TKZB 4F02A 4Y3CA 1X9MA 4DSEA 1SQEA 3T1AA 1UVIA 1CJUB 2V6AA 2AJ1A 3PRBA 1KVJA 4QYZJ 2RNEA 4Q43A 2CDRB 3CNQP 3DGPB 2RAQA 2VKZG 2D74B 1LK7A 3CJKA 4LMZA 3LP1A 4R5PA 4ETZA 2AU0A 4K4TA 4AQYJ 4KGZB 3W5XA 4E98A 3L95X 6FDRA 4IDKB 2QIFA 4A47A 2FC8A 3A3NB 4Y0FA 4CLFA 1HBNA 4OJ1A 3MEGA 2RDDA 8AT1B 5BYQA 3H25A 2GFFA 3HLUA 2WTFA 4FYVB 3SCIE 4AE5A 5ETOA 2C28A 4B3TF 3WX4A 1KDNA 5BJRA 2CJAA 5F0WA 3G6XA 2RS8A 1RAHB 4CTAB 1JLAB 2CWXA 5L38A 4ECUA 2X1BA 2HGMA 2MSSA 3J81j 4YR2A 4DV4J 4OX8A 2I8EA 3R5CA 3W2VA 1WSVA 4JV5F 4BLGA 5CA5A 2CQ0A 1FK9A 3MOJB 3DRPA 5EX0A 2RT3A 2DNKA 2AF6A 4NI2A 4M94A 3NGDA 1XNRF 4DR4J 1LWEA 2DNLA 4UF4A 5F41A 2BQUA 2DK2A 3MM7B 2OH2A 2YNGA 3LOUA 2CNNB 4DI6A 3DM2B 1U6FA 4JI8J 4USVA 5E7OB 2O1PA 2ADCA 2HHPA 1UAWA 1W2IA 3P96A 1C1BB 4Y2CA 3THPA 1A0OB 2ZBRA 2J0QD 3HJVA 4M8LA 1EP4B 1XERA 3ZZOA 2ZVIA 1M5VC 2OMLA 4DXLA 4N56A 3PIPQ 3FBCA 4PPZA 2GV1A 3PM9A 2BOPA 2IRYA 2OSRA 3V5RA 2VBYA 3HHNB 3W65A 4ERDA 4J9UE 4DFMA 1TKDA 4NYPA 2WZ1A 4RW4B 3RGIA 2IC3B 4WFNQ 1GX6A 1T05A 2C2KB 3C6UB 2LU1A 3QO9B 4KHMA 2NLWA 1KS2A 5HQ8A 5HROA 2MYFA 2KYZA 2OPSA 4KGXB 3QNWB 3RG6A 4ZPBA 5CCMA 1CPZA 2JLFA 4NCGB 1RK8A 1HA1A 3QIDA 1KWMA 2SXLA 2H4WB 2M70A 2FJWA 3G2XA 1KQKA 2BKOA 4C4WA 3UCUP 2UV8G 4J91A 3JAMY 1DQ8A 2F65A 4ZP7A 3MXHP 1RAIB 1DTQB 2BQRA 2GJIA 4RNOA 4U95A 2RDIA 5LSOA 3G87A 5E3AA 4EZ9A 1H38A 4I2PB 2X1GA 3HPOA 5LMNJ 2VQEJ 1LWCA 3MM5A 1S48A 3D54A 2AMCB 2EFOA 2ASDA 4MTPA 2ZH6A 2Z0GA 1JQGA 2RQMA 1YBAA 2Z2LA 1XMQJ 1KR4A 2FIUA 4AUKA 1FEHA 1VK8A 1S6UA 1MG7A 3DCAA 3B54A 1G7CB 2CQGA 4PXBA 5KFFA 4PWUA 1ELOA 1RAOA 3UD3P 1U2FA 4KGVB 2YWKA 4V19J 1M1GA 2NZCA 5FLXY 5F8LA 2D3ZA 1QVFR 2R42A 2DVIA 3HHLD 4OZNA 4C97A 1HHTP 4OHXA 1ITPA 3NGUA 4F3OA 1YKWA 7FDRA 3M2UB 3Q83A 4ZP9A 5F0UA 3OLAA 3OR1A 4TYAA 1BC6A 1EHWA 3AQOA 2X3DA 3TI0A 2G2ZA 4ED6A 4FNIA 3A12A 5EWGA 2XS7A 4YN3B 3SDEB 4ZJLA 4USIA 2Y1IA 5AXKA 2Q43A 4RW9A 1B0PA 5HJXA 2IBOA 4ZVHA 3A8JA 5KFTA 1S1XA 1HBUB 3OBIA 1TUGB 3J7YI 3MCOA 2NPIA 1J5EF 2DTJA 2ZDPA 4OJGA 3ADAC 1FDBA 2OEKA 3I4PA 4DPYA 1HHSA 1XR7A 4PQUA 3CJSA 3KLEA 4F04B 4YHHJ 1MU2B 1OIAA 1PGZA 2Z57B 1TQLA 2KM8B 3TQEA 4KY3A 1IR1A 3EZOA 1DHMA 2GC8A 4NA1A 2KB2A 4LUBA 1I5OB 3BB5A 4DCOB 3HO1A 3M8QA 1OSDA 2VJUA 3LO3A 5E3QA 3RYLA 4RW4A 1SPBP 4IR9A 2IC3A 2B51A 1X4EA 3UWTA 1YJ7A 1YG0A 3QO9A 4DCJB 3CCMS 4BWMA 3MGJA 1FJCA 3CTRA 5HVGA 4NXMJ 4L72B 3CCZA 2JEGA 1NHUA 3QBCA 4O23A 4BWJA 1MROA 3V6DA 2DYAA 2M0GB 1LW0B 2H9ZA 3DLKB 3GJQB 4ZHRB 5J2QB 4C11B 4NCGA 4DL5A 1S9EB 2ZEJA 3EJMA 1RYRA 1RTHA 2UVVA 3DDNA 3OL6A 2YNFB 1LQ9A 1ZPWX 4WP3A 3UPFA 2HNZB 4WPAA 2W8LA 4ED7A 6AT1B 3M6UA 4J9KA 1T7PA 2HS0A 3H40A 4CLYA 2B6AB 2W2NP 4KO0A 1WDDA 2G0IA 1T3NA 2RRNA 4K4XA 4EFAC 1RT5B 4F0MA 1NDLA 4A8KA 1S12A 3F0NA 1P9YA 3RZAA 2HK2A 3FSIA 5J1EB 1SIZA 4TQSA 2HNDB 4A8FA 2QRRA 2ACYA 4LIRA 2POKA 2V50A 1TKTB 4PABA 4IO1A 3MR6A 1YBTA 2HHUA 1RADB 4UY8T 3PZPA 3TAMA 3TUJC 2ZUAA 1SB6A 5D6GA 4G1QA 3W2WB 4F36A 2HAFA 3R7BB 3TX0A 2HHXA 2MLXA 2BJ7A 2ZVSA 4FF4A 2C2RA 1HW8A 1YRXA 3GMGA 1KQFB 4L3KA 1RSCA 3EGVA 4L73A 1RAAB 2DNOA 1M5KC 3AXKA 4DG1A 1XBWA 3JTPA 3M6WA 4RU2A 2ZBQA 2GMLA 2JNJA 1YJRA 5IXUA 3HZEA 3NOGA 1D9AA 3MURP 3GJRB 4KKOB 2LDYA 3SSQA 4EYHB 4DQIA 4ENOA 4N41A 2HAIA 3SDEA 1BUXA 1NJWA 4KV8A 2VG7B 2DEIA 3ENVA 4J9RA 4NLYA 1QM9A 2DGOA 2LDIA 2GVZA 2M8HA 3THTA 1HPZA 5C24B 3Q86A 5A8WA 4U7UK 1X5TA 1RTIA 3BJYA 2ATLA 4ZITA 4K7QA 4EBEA 1T94A 2OPPB 4UOFA 3DMJA 1NK5A 4FBUA 1TP7A 1MU2A 1FKOA 2YQ3A 4XAKA 1IKYB 3V6HA 1TL7B 2QA1A 4JBCA 3OW2R 3G8SA 2D3UA 5HATA 3LWLA 2RE1A 5J2NA 4FS2A 1WHYA 3RB6A 1U47A 2JLGA 1ZYQA 3ILLA 2Z2ZA 1O51A 2DITA 4ANCA 3DFEA 2MGZB 4J7CA 1RHQB 3I96A 1LFPA 4G6VB 4DL2A 4QWCA 2QMWA 4ZDNA 1JB0C 3FRYA 2BJ9A 2WBMA 1RHRB 3FK4A 1VDHA 2NREA 1UA0A 3UI3A 1KRPA 2V8VA 3I5AA 2XI2A 4ZKAA 1VC6A 4NMLA 3OTCA 3AQPA 2OMOA 3CPWR 3PO4A 2ADBA 2OD6A 3PEJA 2YKMA 1JLQA 1RLCL 4RUHA 1P8GA 2YNFA 3H7HB 2O5DA 1ZH5A 3EGNA 1DFDA 4A48A 1K9MT 4P10A 3D66A 2EFGA 4CH0S 2IYIA 3QPIA 1SL1A 1RCXB 2UUAF 3RB4A 3HVWA 1S1WA 3IC1A 2LA4A 1Y5LB 3HT0A 4LFBF 5CYQA 3N4WA 4X4OA 5L1KA 3LA0A 3HVTB 3CCRS 2XNRA 1WHVA 1UMJA 4X4UA 5D0HA 2AKWB 3BQ1A 1UEKA 3ZC4A 1B3TA 2KRBA 5CYJA 5E0OA 3EDRB 4M5JA 5ETTA 4NXNJ 5K5MA 2BOAA 4I6YA 3WQPA 3AB4B 2QO3A 1RAJA 3LF0A 2A10A 4MK9A 2AEJA 3LQVA 2LEBA 3W2WA 4ZVUB 1QLNA 4PXEA 3H0PA 2VPXB 2W4CA 3KLHA 1WC1A 1NK7A 4F4WA 2DY1A 3A8KA 3WC2A 1OWXA 1Q0NA 2DNPA 3RU0A 2ZJRQ 1TL3B 3AD7C 2PDAA 5B7WA 3KK3A 1TFWA 4PR6A 3T6BA 2AJ2A 3HD2A 3AFGA 4IOBA 1WUUA 4KKOA 2OPRA 1LNQA 2Q79A 3TQ1A 3QIPB 4DV2F 4CLPA 5J2PB 1FRKA 3ETOA 4GKKJ 3VALA 2XMMA 1R0AA 4KR0B 4HHHA 1DARA 5A8KB 4IFVA 2BABA 3MF5A 5KFRA 3U7JA 4WYWA 1GEHA 4AD6A 2UXDF 3QLHB 5DJBA 3ZNJ1 2UUCF 1TV6B 2OPPA 2HWTA 3H4BA 4ZN1A 3HXMA 5K8PA 1W25A 3I82A 1EARA 3D6FB 2JL9A 3NLCA 2DHAA 3OQ2A 4Y2IA 4CYUB 4OLOA 4CLWA 3B4MA 4NCBA 1XC9A 3V6KA 3T41A 1IWGA 3TA0A 2HWHA 4JUZA 2XMAA 1EZZB 3AOCA 4EO6A 4B17A 5AJ3J 4DMZA 3J7ZT 4D3GA 3MOZA 3KOAA 2YH1A 2KXNB 3VAJA 2V2QA 4DV3J 5LMUJ 3Q2SC 4DS5A 2WB4A 1VC0A 4OL8A 4NCAA 3GSDA 3B82A 3M7VA 2B5JA 1GQEA 4B9UA 3H4DA 5I3PA 2XYPB 3GYNA 2UU9J 1VI7A 2LQBA 4LFAF 2DHSA 2W2PP 3SSRA 3FSYA 4LF7J 2CJ9A 3MM6A 5JMNA 4DX8H 3MMCB 1RT3A 1UTAA 2MKJA 1I94F 2XS5A 1HNXF 5A76A 1XQIA 4DR2F 1KKHA 3Q8UA 3SCLE 2FZKB 5KFPA 4DR7J 3N6MA 2F4FA 2JEFA 2V8PA 3IN5A 1X5OA 1GAOA 3MM8A 3OLBA 3UN2A 3KG4A 2E5JA 5HAOA 2PFDA 1JLFB 2XZDB 5M2RA 3I5CA 2YQ1A 2NSCA 4GVBA 2KHDA 4IRCA 4MYTA 3D6HB 4PUOB 4OX9F 2LYVA 1HWUA 4DHVA 2C2OB 3RW6A 1VHIA 1U24A 1S4EA 5DETA 4DPXA 2Y0BB 1FNXH 4LRCA 3L7UA 5HLFA 5L1LA 1ZBTA 1VIXA 1PYOB 1UVNA 3U27A 4HACA 5CABA 2YWEA 2EVZA 2QE5A 3GIIA 1KOOA 1Q53A 1SH2A 5CAAA 3NG8A 2DXEA 4OYAA 3TJ8A 4GC7A 2DR7A 1ZZFA 4AL7A 1HBOB 2MKKA 2HLTA 3VQTA 2DNNA 1GMWA 4HH1A 1XMOJ 1G6BA 1H2VZ 5L39A 2OEMA 1GK8A 3KJVB 4ZVRB 2HBRB 3KNAA 5DO2A 1EIYB 1RXOB 2XG8A 4RWWA 5CH7B 2VG5B 1QUVA 3CMES 4FS1A 1KFDA 2JSXA 3VF0B 2ZITA 5K8NA 3GU0A 2FUG9 3QIPA 4X64J 2B43A 4B3MJ 4B9MA 2B8QA 1RABB 4V19X 3FRZA 4BHQA 4DN0A 5KFXA 1RAGB 5A8KA 3DLEA 4IQMA 1V3ZA 3E01B 2CQIA 3PNIA 4DX7A 4DBQA 3W9JA 2AJ4A 2H3EB 2QTWA 1TFYA 3NS5A 2GZOA 1VQMS 1UP1A 3A8EA 4F4AA 1UEUA 3D5MA 1I1GA 3NGRA 4YB5A 5KAKA 3LGNA 1Y7PA 4PPDA 2NQPA 1R8BA 4QQBA 4FVMA 3QFHA 2IY5B 1S76D 2GVDA 3AY0A 4ECQA 3DNCA 3JYTA 4B3RF 4ZP6A 5LM7E 3OFHA 2CQBA 1YK9A 1L3SA 3KJNB 1HQUA 2E9ZA 2QG9B 1GMWD 4RW7A 4NMXA 2KXHA 3LH2S 5EDWA 2V68A 4QYZK 4WFAQ 4FN5A 1KP6A 4CO3A 1I3OB 5CD4H 3HHLC 3PVXA 2CWKA 1VRTA 3O2IA 4YB6A 5JXSA 2QZ8A 3OV7A 5CZVA 1QDUB 1RHJB 4PEOA 3AA9A 4ELTA 3CDAA 4IRKA 2DO4A 2DISA 2IYGA 3TX8A 4UUXA 3M8PA 2L9WA 2ZWOA 1B99A 2BKPA 2VFRA 5B0GA 2MQ8A 9ATCB 3TEHB 5T7LA 3CCSS 1NPPA 3H5UA 3PYGA 4CP5A 3KLFB 1VQOS 2W2QP 4LF9F 4TU9A 1S57A 4DJBA 1VQKS 3G6YA 1IXKA 4DUTA 4UY85 3AD9C 3U1LA 1MMLA 4LSZB 3MI7X 3PV8A 2W2MP 3CJ2A 4DV7J 2KFYA 3OXFA 2WONB 2ACMA 5CHCB 1JLBB 2E1AA 2KN4A 4HTIA 4LF6J 1JKHB 3TARA 3QAEA 3FBBA 1WOSA 3K7RA 1S0MA 5FDLB 4H4OB 3CJRA 5IT9U 3N6NA 3SBMA 2I9SA 5A6PA 1T9UA 3FGVA 1S10A 2HHSA 1NEEA 4ZCKA 2J0XA 3M4XA 1EX8A 1FF2A 4TYBA 2OPQB 4M95A 1GTEA 3OR2B 5CQGA 5IT0A 3NP5A 2EBGA 4ZJOA 2W4PA 2BJ1A 3PX6A 2GQQA 3H2UB 4LRFA 3C19A 2VG5A 3DU6A 4DV6J 1HQEA 2K3KA 4QR2A 3JSMA 1HWKA 3ZXWA 2V63A 3HSDA 4OI0A 5B0EA 3N79A 4AL5A 2M3DA 1N5SA 1B4SA 5DRKA 2EFNA 1KSPA 3I56S 2FC9A 1NZ8A 2M4MA 3C16B 3CD7A 2V9KA 4Y00A 1U02A 4X66J 1FWKA 3SQGA 1L5UA 1HNIA 2ZZTA 2XWXA 2PE8A 3RBZA 4DWIA 2MQLA 1H0HB 1VLYA 1XJWB 5LSRA 5KT5A 2IJFA 4MFBA 2VPZB 2BBEA 4TU8A 2VPYB 2HNYA 4GRSA 4WTYA 3P6YC 4NLXA 3NL0A 3M32A 5AXMA 1ICEB 1SC4B 2DR9A 1Q8KA 3NCQA 2G2YA 2B4PA 1UFLA 4NLWA 2EC0A 3M2RA 3OFGA 4GKJJ 4R25A 4HT5A 2GCFA 3KG0A 2Z2MA 4OYOA 3KTQA 5LXYA 4QYRA 3OJUA 4JI5J 3NNHA 2VODA 1MN9A 3IGNA 1YRTA 3M30B 3BREA 1PIEA 4P6QA 2Y0SD 1RAFB 3GPAA 3R5BA 1RDRA 2ASLA 1EETA 2NR0A 2DNYA 4B3SJ 2FJAB 3U1MA 1V3RA 4DR3F 3KLFA 3JSRA 1IKWA 2JFKA 4DZDA 1UVJA 2PO4A 2P6TA 3X1LB 5KFGA 2I38A 6FD1A 1LW2A 1NB2A 2W9BB 4CM0A 3W8PA 1V3SA 3EZ5A 3CDEA 4WWSA 4NA3A 1WACA 2CA9A 2MKHA 2MDAA 4O4RA 1YBUA 2UZAA 2HFSA 1FD8A 3HK2A 1YJVA 2MY7A 1SJ4P 2HQ3A 1PAEX 4JYAJ 4OZ2A 2O01C 3KG1A 3J80U 3KYLA 5K8OA 4H4OA 5LSLA 2HKEA 4L74A 3IAM9 1K8AT 2JX2A 2CPZA 3NBPB 4EMDA 4OHVA 3DOMB 3MR2A 3MD1A 4LSLB 1JNZB 1TMMA 5J2MA 3DOLA 1KC8T 2IJRA 3IWLA 2R2SA 1Q78A 4CT9A 3TUIC 4PWDB 2MXYA 4F25A 3O6QA 4DL4A 1PYTA 4K8RA 2Y1JA 2IMWP 5AT1B 5ETMA 2Q66A 1RKIA 4WU3A 1SQFA 1PILA 1T95A 3SFGA 2DR5A 1HMVB 2B0GA 2QV6A 4HT7A 5IM0B 1F1BB 2ZZMA 1IKVA 5KG3A 5CXTA 1R27B 2BJ3A 1AZSB 4I56A 3EGZA 2G1DA 2VDIA 4K2XA 1AROP 1FJ7A 3CE8A 1NKEA 3ISZA 1PAUB 5HI7A 2KJVA 3HP6A 3CCWA 3FFIB 4ZVGA 3TJ9A 3ET6B 1E6VA 3J7Z5 2VG6B 4PRFA 5KG5A 5F8GA 1X4GA 2WK4A 3UW1A 4F4KA 1SJ3P 4C8ZA 4B9LA 1RCOB 4A8YA 4LT6A 4DR5J 2KM8C 2MZRA 1SJFA 3B78A 4J37A 4ED4A 3TAPA 4ZVQB 4F4XA 1N32J 1TUWA 2GO8A 4LREA 1Y11A 2O3DA 3A3OB 4Y65A 1RB0A 1GNKA 3GJSB 4LIWA 2P8IA 2HZVA 4I7FA 5CZXA 2GAGC 3MCSA 4QIEA 5LJ3Y 2XSJA 5IQ6A 1RT6B 4K4VA 3HFKA 2R9LA 3QQCD 4A8WA 2MQMA 4UTGA 1SXLA 2LLZA 5HMZA 2KI2A 3R5GA 5HQMA 2MMYA 3MECA 1CULB 2E5IA 1FX4A 4CLTA 3BSNA 4FXVA 1BQMB 4C0BA 5DG9A 4L3NA 2LEAA 4WBFA 1QSSA 1A9NB 3AB2B 4WJBA 2RILA 1HWLA 4CLSA 3VZHA 2BJ8A 2DGUA 2YX7A 3GR0A 3PCOB 2R8HA 2XZWA 2WRMA 2HFVA 2JOQA 3KJFB 1P6TA 2H65B 4USWA 4ID5B 1S72S 4IG0A 1R8HA 4RW8B 4UUWA 4DFKA 1WC0A 2VBXA 3H42A 1VQ6S 4O3SA 3A1YG 2DPJA 5IQQA 4N7TA 4MKBA 4EO8A 1DLOB 3L3CA 2CKWA 4LBIA 1VQ5S 2R8GA 2OP5A 1TVRA 2RMLA 4U8YA 4K5RA 4IG3B 3K5NA 4LQ3A 1WEYA 2ZOMA 3WDOA 3T1YJ 1VHFA 2R2TA 3BBCA 3MHYA 1NSQA 1VCTA 2DGSA 3PRVA 4JI6J 2GMHA 1ZS6A 5T41A 4MIWA 3IO1A 1SBRA 4KH1B 4M5GA 1HLWA 3ENAA 3HFVA 3FJ2A 3VAKA 4ILLA 2AX0A 1U49A 4K4UA 3IFEA 5D4LA 3VAIA 1IQTA 4QIFA 4QWDA 2EXUA 3D9BA 1IQZA 4OQJA 3EVOA 2GIRA 5KG1A 4NLPA 2XCPA 3PR4A 3I0SB 5I3UA 5B09A 3MM9A 4EEYA 3SXLA 1RTJA 2FJBB 2GIFA 5ETNA 5HP1B 4PWDA 1UFWA 4J9QA 1NDKA 1QD1A 3GILA 2UUWA 1KD1T 4KGKA 1WHWA 3ZTSA 2ZD1B 2HW3A 3EXCX 4HH0A 4YB1P 1BWVA 4WFBQ 2RF2B 3NNCA 4EI2A 1VOMA 5IM0A 1K0VA 3TWZA 2OTLS 3LGMA 2WAQD 4UQTA 1SJ1A 2W2OP 4FF3A 2QLJB 2B9EA 2E9RX 1CS4A 3KFWX 2FJXA 3BGLA 1F2GA 3FCVA 4DLEA 4IFYA 3DLLQ 3J81Y 1M5HA 2NXCA 3R1HA 2C2DA 2CQ4A 1REGX 2CJXB 1PJ7A 3ZFVA 3IM9A 1FRHA 1HD0A 4OI6A 2VG6A 1Q7YT 2DRBA 1O8BA 4CH1A 5D78A 2GAHC 3R5AA 3RJMB 4QWEA 5IS2A 2BUNA 3GE9A 4MKYA 2ASYA 3MCNA 1SUQB 1FX2A 1Q81T 5IT9Y 3KJQB 4ES3A 2NYHA 3OFFA 4IUFA 1DJ0A 3F44A 1JLCA 3HKWA 1DBDA 5KFSA 1NK6A 4G3IA 1RU2A 4G65A 3OUYB 3AAWB 2RHQB 2AQ4A 4DSJA 2RQKA 1CSJA 2MJUA 2XC9A 2EEYA 1KOHA 2DRDA 5IV3A 5KT2A 1CULA 1XK8A 1KTQA 4M5LA 3PKMA 2KTQA 3MEEB 3POTA 2C3PA 3DRRA 1JLEA 3V6JA 2GHWA 2J76E 1K47A 3IRXA 5C25A 3C3LA 1SVDA 3M05A 4B3TJ 4KB7A 2IA6A 2WHOA 4LF5F 1PYSB 1K73T 4ZS6A 3OPKA 2GX8A 1SKUB 4P72A 1EQ0A 3RR8A 2DH9A 5DG8A 1OQ6A 5GADI 2A6OA 4IH7A 4DU7A 4Q8EA 3F56A 2LXUA 1HD1A 5ETQA 1BQNB 1NSPA 4PYDA 2QYGA 4CLLA 1ZM9A 2UVWA 3Q23A 4NZ7A 3WC0A 1IBLF 2CQ3A 1XNRJ 5ETSA 4BCAA 1NLKL 3DXBA 5H9EJ 1SJQA 3LUYA 1NPKA 3RW7A 3GP9A 3SI8A 4DSLA 2IJNA 4BC7A 1N33F 4P7TA 4OX6A 1ZM4A 3PX0A 2CPEA 4ES2A 1MN7A 4LJMA 2HMIB 1NRKA 3NS7B 3CCLS 2Z56B 3DHWC 5I42A 5KFMA 1S6PB 1FJEB 4ECYA 2HS3A 1R0BG 4RNNA 1UWBA 2HGLA 1KLMB 2AJ0A 3LP0B 2CAJA 3Q8RB 2CZ9A 4WXOA 1F3VA 5E33A 1ZA2B 2X1AA 4NASA 4FPIA 3DOKA 4FKYA 4B9SA 5GMDA 1K1QA 4P2FA 1HQ2A 1CVJA 4C2MA 3UDCA 5K14B 1RT1A 2HIYA 3ISNC 2IRXA 1K44A 3AD8C 5JJBA 2CVEA 1WKJA 3OTBA 2VA2A 4X4VA 4FPRA 4BS2A 2RB7A 2DRAA 4ZCIA 2I1RA 2FVPA 2CZ4A 4CH7A 2BQ3A 4OX7A 1UJ5A 4ECXA 1I51B 2JJ4D 2J9DA 3TW0A 3KK1A 4DCPB 1SUQA 3E2EA 1G4CA 3W64A 3D67A 5J1PA 5JVHQ 2DHGA 1N88A 4Z7YA 1FO1A 2J9EA 4C98A 2R7RA 1VBZA 2R7VA 2ZFHA 2WSFC 2LVWA 2YWHA 4H4MB 3CCTA 3MEDA 3HD1A 1C0UB 2BW2A 3Q8SB 5MAOA 2P2CB 5IFMA 4RUCA 1CJVA 3B8HA 4FZVA 3H5YA 2FYXA 4IR1A 5F8NA 2MY8A 5IV4A 4UT4A 3PJXA 3TA1A 2VIHA 3BDPA 2ZKUA 5GAEI 2YPYA 1X9SA 1XNQF 3MEEA 3CD5A 1S1UA 3M2VB 3MPYA 1FFWB 1N52B 4F67A 4C8OA 3X3UA 1QE1B 2ZNYA 3UQSA 2F40A 3PYDA 2XY6A 5HJYA 1N0UA 4L75A 1KQGB 3GZ7A 4I2QB 2MHEA 2EC2A 1AXQA 2XMJA 5ETRA 1HNZF 3CJKB 2HHHF 2W7AA 4R5PB 3QRQA 3MAAA 2LP4A 4JI7F 2V0NA 4XDCA 3FKBA 1MMNA 2DR8A 3VCDA 2OEJA 2RQ4A 2KFNA 4ZVTB 4BBYA 3QJLA 2ZWPA 1FJGF 3MEGB 2CG8A 3NRBA 3GB0A 1SL0A 3CULA 4IOAQ 1Q79A 1R3NA 4K4WA 1U09A 3U02A 3G71S 1OY6A 1LWXA 4WE1A 3QGGA 2UXBJ 5L1JA 2RUGA 2ZNZA 4DX6A 1J5EJ 3T5JA 4AXJA 2MQNA 1NK4A 5ITHA 4RBVA 5A0YA 2B56A 3CMQA 1S6PA 3O3LA 4A8XA 5GADU 2AW0A 4XIUA 1Y3KA 2K1RA 1FI4A 2PIIA 1T03B 3PW7A 2ERRA 1ZPVA 1TK0A 2B3TB 2EKYA 3CJQA 3DRPB 5GMKa 1S49A 1VISA 2WSEC 4PAAA 4TXSA 2LU2A 4NI2B 1X8DA 1P1LA 3VTIA 2G0CA 2I5JA 1N36J 4QPXA 1LWEB 2GHPA 5LT5A 2CIMA 3MMJA 2RRBA 2YNGB 4K0KF 3CB4A 3K89A 4NLUA 2I2YA 3IBCB 4H54A 5EGYA 4RBUA 4KH0B 2BEFA 4C3LA 1UETA 2OKQA 2QT7A 2HFOA 3D28A 3RBXA 1Y4ZB 3EYZA 1FXRA 3BKFA 2FVQA 3PKYA 4ILMA 1Y10A 1S59A 3CCUS 4ES1A 4ECWA 1HBMB 2JH3A 2R7QA 2KVIA 3NXZA 3MTKA 2G4BA 2QC3A 1FNMA 4IQXA 4USTA 5F9NA 4G1IA 1C0UA 4QBUA 2MKCA 3TAQA 4F0HA 4RO0A 2QJ3A 1NZAA 4TU7A 3VGVA 5HROB 1AUDA 2OPSB 1G3OA 4FF2A 2HIQA 4J9PA 1WTFA 3PW2A 4IO9Q 3FDSA 4RW6B 1GTHA 4QWAA 1RJJA 1RAEB 2J7KA 4DDFA 3TUPA 4KGMA 4KYZA 3TZZA 1Q8IA 1RBLA 3D1OA 3M2VA 1FXLA 2DNQA 2KZZA 2J8SA 2HRUA 3DDKA 3MMAB 2IM3A 4JI2F 2NXNA 2R7TA 4Q2LA 1X4DA 4U96A 4I2QA 1TTHB 2BR0A 4KSEB 4ZPCA 2W24A 4LRBA 4LSNA 2WVBA 3UNYA 2V94A 2J7WA 3IR5B 4ETXA 1F5BA 2MEWA 2OELA 4LF8F 3VWSA 3PJ9A 1L3VA 2Q1LA 1LWCB 3LW5C 3MM5B 4J9NA 2KG1A 1WJ9A 4PG4A 1PCAA 2BMBA 3OXLA 4P75A 4DPWA 1VIOA 3H98A 1GXUA 4JI3F 2GGPA 4GO7X 4URGA 1RWNB 2JLEA 5DDRC 1RGVA 2GQCA 3FCWA 1Q1KA 2A2CA 4RUBA 1R43A 2D7SA 2H54B 1FRJA 2H1YA 1ULRA 3Q8YA 2FVRA 1GXTA 2V69A 4PXDA 2R7XA 3W3SA 5MLCV 4CQ1A 3FSXA 2WVCA 3BYRA 2H4YB 2XLKA 1KHWA 3JXOA 2C2NA 1F9FA 4ZIWA 3LAKA 1T03A 2J6SA 3I6PA 1QAJA 2ASJA 8RUCA 3OR1B 4O3NA 4JV1A 3AHPA 4P52A 3RAMA 3GTYX 3D1QA 4P9SA 3M8ZA 3S7RA 1WC3A 2HBZB 3ELHA 4K4YA 4WTOB 2R7SA 3IG1B 4DQRA 4USUA 4RW9B 2F7VA 3TVKA 3K17A 3MUVP 3HCXA 1X4CA 2HRYA 1SV5A 1S1XB 5HVFA 2XO6A 5IZHA 2PFFB 1VS3A 5I4MA 1CQMA 1ROFA 5EHHA 2RS2A 5ETKA 3BPDA 3CSKA 4PQUB 3LP2A 2RKIA 3KLEB 2E1MC 2VFUA 3M6XA 4LR9A 1QTNB 3DRYA 2AYMA 4LF2A 1PBAA 3FMBA 2AEFA 2UUTA 1EB0A 4CO5A 4XK8C 5JVGQ 1HBMA 2HVHA 1NCLA 3K57A 4WZMA 2MKYA 5DGAA 4CT8A 2VUGA 2UUAJ 3M8QB 3CMAS 2FHJA 4LFBJ 4ZPVR 2M8DB 3WIUA 4OYXA 3F73A 2ALZA 3T1HF 3VGUA 3FZ2A 4WKRA 4DQPA 4YY3F 1S5ZA 5THWA 3QRPA 5CYMA 2CQ2A 1WSRA 2AGPA 1IJFB 2C42A 3RRGA 3TR5A 4RW6A 3NAHA 5KFNA 1QSLA 1U0HA 1N8RT 4J9OA 3M9MB 4DL0C 2W1BA 2DIVA 3GFXA 1MROB 3V6DB 3R5DA 1RTHB 3UVJA 2XB2D 4PCQA 3N5BA 4B02A 2N3OA 3MMAA 2GO9A 2NXEA 2V67A 5E5NA 3BKUA 3CCES 1M5SA 3HVRA 4DV0F 3C15B 1T9WA 5CD4A 2JEIA 4KO0B 3FEXB 2D3OR 4OV1A 3IR7B 2J5AA 4B9VA 2VOOA 2BANA 2R7UA 2I6WA 2QFJA 2V5HG 1YDLA 2ABYA 2DXFA 2HFNA 3NKYA 1CJTA 5ETLA 1R7IA 2WVDA 2YTCA 1FDDA 1YGYA 3RUBL 4OIXA 1N4LA 2XCAA 2PEBA 4F3MA 4HDGA 2YKOA 4DV2J 1DQAA 1N6QA 4I6AA 3KDOA 2ZZNA 4F4ZA 3V4MA 2YBVA 2QLWA 4V1Ak 2Z58B 2ZOFA 3TAMB 1YJWS 2GHVC 4MH8A 1S97A 4EZ6A 4G1QB 2APOA 2MTLA 3R9LA 2CPIA 1D0EA 3E51A 1RWPB 2UXDJ 1X9WA 2AGQA 2UUCJ 1Y0HA 1U1KA 2EK6A 4OI3A 1FT8A 4DG1B 2MZ1A 4LRAA 4FYWB 1WF0A 2AIRB 5BYSA 1LXJA 1M1KT 2JC1A 3BBFA 3P45B 2WSCC 9RUBA 1AA1B 2HHQA 2XGQA 1OY9A 1U1OA 1T9VA 2WCXA 3K8WA 4ZJQA 3RBDA 2AD9A 2XY7A 3C2PA 4KV8B 2FLOA 4LRDA 5KFOA 1B64A 1TELA 3IG1A 2JVRA 1C2PA 3ZTQA 2FJEB 2MLYA 3OHBA 4X2BA 1D8YA 2GA7A 1DAXA 2N7YA 2UXBF 3N5FA 2GVZB 1TL1B 2WW8A 4ZVSB 2DNGA 3VQSA 2W01A 5AE3A 2ZHBA 1HPZB 4LFAJ 1MLAA 5LL6d 3RAQA 5A8WB 3GG1A 5G4DA 1RTIB 1NK9A 2L9NA 3W5YA 4XDDA 3OTOJ 4J9SA 4YS2A 1I94J 1HNXJ 3DMJB 1H98A 4OHWA 1FKOB 3N9UC 4DR2J 5J2NB 3H2VE 1HFEL 3PEHA 4KJIA 2XMKA 3PR5B 2LCWA 1NM2A 3UDLA 2KT2A 1WC6A 1U7LA 3DLBA 2AV5A 1HARA 1VJWA 4OX9J 1DURA 1N36F 1NU4A 5KG2A 1Y9OA 3D7SB 2I0XA 4DN9A 3JS9A 3GLJA 2KRRA 3TP2A 2BJDA 4ICLB 2XS2A 2FB0A 3GV7B 4F2SA 1X0PA 4Q0BA 1NK0A 2YKMB 4DUZF 1JLQB 2ILYA 5AE2A 5L8RC 3O1LA 2WVEA 3PFEA 5KT3A 3KLIA 4UOCA 3UCGA 4QU6A 2BACA 4QW9A 2VL1A 3C15A 1IM4A 4MK7A 7FD1A 4N77A 1S1WB 3THVA 2DIUA 5CYQB 2DD8S 2B9WA 1P1TA 3IA0A 5D4NA 1H74A 1S4FA 4CWBA 3CF5Q 4DL7A 4KBIA 2J6TA 3JSYA 4QPTA 1FVSA 1T8EA 1UPPA 1G1XA 4F7VA 5L46A 4WIQA 4Y28C 3KK2B 1CJKA 3MCMA 3BDEA 1ZAWA 3LPYA 2GMJA 1RTDA 5A2QY 5KTQA 3HSGA 2FHKA 2YWGA 1JK9B 3WX8A 4NYOA 2RRAA 4ECTA 4DR1F 4DUYF 3KLHB 2Z8QA 2R7WA 2W9CB 3BYPA 3EGWB 4CO1A 5F9LA 1SC3B 2EPIA 2DHHA 1C1CB 2BRLA 4PG5A 3FCHA 3QT6A 3GFYA 1J27A 3OD2A 4OZ5A 4FXWA 1BY9A 1KBRA 3IR6B 3KK3B 3PFOA 2E7VA 4ZLLA 2X7IA 2YX1A 2OPRB 3MPVA 4B3RJ 3TOQA 4NZ6A 3JAMU 1N48A 1UJ6A 2ZH1A 3AJDA 1R0AB 2E5LF 1VQYA 4IFVB 4N76A 1CC7A 1WKKA 1TL1A 4E2FB 2MPUA 4O0NA 3G8QA 1U6ZA 1HR0F 2VZ9A 3CJ3A 4QR1A 1RUSA 3CO9A 3ZZUA 2ZM6F 1S1VA 3K5LA 3N01A 2IVYA 1WF1A 4X4TA 5A8RB 4BDPA 4JI4F 2LQ8A 2ZE2B 4C8MA 2R4FA 1IBKF 1PKUA 2HLUA 1U1LA 4KTQA 2FJDB 3DU5A 7AT1B 1FA0A 2XMUA 3D4JA 5RUBA 3ZTPA 2UUBJ 2JRSA 3GCXP 3BGUA 4JV0A 1JNRB 4LF9J 2DEJA 4LFCF 3DN9A 1J5OA 4M5KA 2VHGA 2Y1RI 5FLXU 3VAMA 1LEOA 2QLXA 2B5JB 3W63A 3UD5A 4UOGA 1RHUB 5HANA 4ICLA 2ZHOA 2ZJPQ 3D68A 3SIPB 5SUHA 3J7YU 2XLJA 2KKHA 2K06A 3RRHA 4ATNA 4ED5A 3MM6B 4Q5VA 1RT3B 1YX2A 4DQSA 1RBOB 4WFXA 2R8IA 5DM6Q 3P5BP 1TU0B 1IUJA 1HWJA 4O3RA 2NXUA 2ZBIA 2Z4PA 3UFCX 3LANA 3MM8B 4ZVPB 1YJNS 2AWZA 1KN6A 4X65F 4C48A 1QAYA 3QAUA 1A7GE 4GVBB 2C2EA 5H9EK 1Q5YA 4DV5J 2HFZA 1T3OA 4C8KA 1LFWA 3NS6A 3CDBA 1HNVA 1QVGR 2IDEA 1JLGB 4EUVA 5KFBA 4I67A 1TAUA 4CLKA 1S9GA 3R2DJ 4YB7A 2VASA 1FE4A 5HBMB 4AYBD 1U1PA 5HLFB 1UJ4A 2IDLA 3QATA 3W62A 3DXSX 3ZZ0A 1OPZA 3HULA 2VONA 4HACB 2K2PA 3BH6B 2BRKA 4X4SA 3KK2A 2IFXA 1B0VA 2OSQA 1RLDA 1OY8A 1IWAA 5HN0A 3TJAA 2L41A 4OLPA 2KG0A 3TRGA 1T9XA 1MW7A 1R31A 1S9FA 3R2CJ 3KLGA 1V9OA 1WNEA 2W9CA 2OFGX 4ECVA 1FDNA 4C8YA 2HQIA 2GNKA 1KNZA 1R0CB 2PA3A 1C1CA 1R89A 5IWAF 1Y5NB 3HDSA 3MPDA 1GMUA 3N0VA 5C7PA 4L6V3 3G82B 5DQGA 4EGLA 1N56A 3D1HA 1FTCA 2H5EA 3E3XA 3UNGC 3R6GB 3CC2S 1U1RA 3HZGA 3Q8QB 4P73A 2GQ2A 4DR6F 3FVYA 4B9TA 2DKOB 4PKDB 1TR0A 2VFVA 3OL9A 4W92B 4Y2MA 2F3JA 4LVOP 4FP9A 4K50A 4OYPA 1HL6A 4DFJA 3IBFB 1REVA 3DLEB 2C2MB 2PT0A 1HNWF 2KXFA 1X31C 2BE2A 3TZXA 2F5GA 3G9CA 2F4VF 1GMVA 5KFHA 3TVZA 4G1PA 1WOOA 3NMAA 5A8RA 1AYEA 4YDDB 2ZE2A 4CNYA 3GFHA 2M7SA 1H3DA 2K7KA 1KLNA 1RP5A 2KHCA 4MMOA 3LALA 3C6TA 4H4KC 3P49B 1RT4B 3C46A 4HVZA 2GVDB 4DR3J 4OI2A 3JYTB 2HYIB 4P7VA 1DZ5A 1S6QA 3FQKA 1HQUB 3NGTA 1WI6A 2V2KA 2WW4A 4RW7B 4O3OA 2DGXA 5DDOC 1RWUA 4ZIVA 2V2ZA 2HVEA 2CVIA 1IBMF 3SQOP 1MNEA 4LF4J 2HS4A 2UXCF 2XTJP 5LOQA 2QYCA 3CT9A 1ZM3A 1VRTB 2VQFF 3P4UB 3OTOF 3PY8A 2DNHA 1VQ8S 1FRXA 2Z30B 2P9GA 3M8PB 2BX6A 2VC1A 3C14B 3FC9A 1FFGB 3P8BB 4C7QA 4U7UD 1YWXA 5BYRA 3W60A 1M5PC 3SZ2A 4NL5A 2FGOA 5T7LB 2WVFA 3JB9k 1NKBA 3JQJA 4D3HA 3BN7A 4PWWA 2JDJA 1N34F 2M9KA 2DH7A 3ZO7A 2C3UA 1JLGA 3VAHA 3W66A 4XO0A 1IN0A 3Q8PB 4HKQA 2RVJA 5HBMA 1RQ0A 4RBTA 3SV3A 3MAQA 5HMXA 2C22A 4QOTA 1VRUB 3PHEA 3KUGA 1U1NA 4KPCA 3H5SA 2MQQA 3I87A 3CJ8A 2YNIA 4M5DA 5BR8F 2ZHAA 3CJ0A 3CC4S 3T9NA 4UW2A 2LEPA 4K4SA 2W4DA 1SKWA 2EFVA 3MZIA 4JI1F 3BZQA 2JC0A 3BO2A 3H59A 4M5NA 3IRWP 1NKCA 2XEXA 5F8MA 3KNGA 2ZH4A 1VR6A 1WDTA 5KFCA 3GYXB 3K0JA 2YY3A 2HWIA 3CGIA 4GO5X 1NNDA 3SMZA 4KQZA 1ZTTA 4Q45A 3ZZPA 3G82A 2H48B 2YVSA 1HQEB 2V4JB 3QJJA 3JSMB 2VH7A 3IWXA 3C66A 4DSIA 3S01A 4WZQA 1NSAA 1W26A 3MDFA 1TKXA 4NLRA 5KFZA 4C8LA 5C42A 2MHNA 1DRZA 2KZMA 1YITS 2DH8A 2NS1B 2AYEA 4KT0C 4PG7A 2YXLA 2NCKL 2QL9B 3ULHA 2PGCA 2JZ5A 3QFWA 3SQGB 4JOUA 3VV2B 1HNIB 5D0EA 3OHAA 2UVRA 3HJFA 2RQCA 2HURA 1RHMB 2PMWA 4MFBB 2CPDA 1T9TA 4DF4A 2ZC3A 2N4CA 1YIJS 3QT5A 1WF2A 1WG4A 2HNYB 3VVTA 2XMVA 5KT7A 2Y9HA 4F0KA 3US5A 4QR0A 1RT4A 3M32B 3TNVA 3KWMA 3HM9A 3QGPA 2IM0A 2PMHA 3MMBA 2PN6A 5DZ7A 1U1QA 1FTRA 2KU7A 3HHLA 1N5YB 3QJPA 4CLZA 4EBCA 4RPFA 3M2RB 3AJ1A 2D1CA 4QW8A 2P9EA 1HIYA 3RTVA 4B9NA 2G0JA 1TKZA 1IBCB 4IH5A 1JWWA 2BVZA 3S1TA 1CJUA 4OYWA 5KFQA 3OVBA 3C14A 1PJ5A 3LAMA 2FJVA 4ED1A 3V81B 1EETB 2OIHA 3DGPA 1S99A 2UUBF 2Y1LB 2XI3A 4LBHA 4P2MA 1KONA 3OL8A 3ZTRA 3OTDA 1VK3A 1FHTA 1IKWB 3PJWA 2BJEA 3T9ZA 2GIQA 2LQ5A 2LQ9A 2HPUA 3G4SS 4IDKA 1RISA 3W1YC 3UCZP 1LW2B 1D9DA 2ZH9A 1MMDA 1CC8A 3CIMA 1U2RA 2NYIA 3EVMA 1IR0A 4RR5A 4OHYA 5E41A 1AFIA 4A46A 3PHTA 1VRUA 2YH0A 3KMQA 4UZCA 4YR3A 4JB8B 2GJFA 5CCLA 4QIWD 3PXGa 3QMQA 2E66A 4RNHA 2IBKA 2KT3A 3SCJE 1NB7A 1PC5A 1Y00A 4CTAA 1JLAA 3OTEA 3JQKA 3QZ7A 2G9OA 1U25A 2BV3A 4WP9A 4IOCQ 4I6WA 5G0RB 5J2MB 3DOLB 2NPFA 4WFYA 4ED2A 3MWBA 4DV5F 2QA4G 3NCRA 3DI6B 4NLTA 1W2BR 1H7XA 3BV8A 2HQCA 2ZC4A 3C8YA 3QT7A 3BH7B 2V4JA 3OVAA 2VFTA 4PG8A 2UP1A 2HVIA 3MM7A 3GWCA 1KTVA 5M2UA 1LWFB 4C0OC 5HO4A 1HI1A 1CLFA 4I1TA 4ZPTR 3DM2A 4C6AA 1VRQC 2FZGB 2ROPA 3CW2C 4QIVA 1BE4A 1IKVB 4MJKA 1H6KX 1C1BA 5H9FJ 3MR7A 2GS8A 4OYMA 2LMIA 1FRLA 4A8QA 2W9AA 4AT1B 2LFVA 5KFKA 1UZHA 1EP4A 2YKPA 3EZUA 1S7IA 2AZ1A 2AEMA 1RWXB 4P2SA 3UO0A 1E6VB 1LOUA 3HKZD 2PA8D 1VQPS 2X51A 1R6YA 1NMEB 2G1HA 3PYFA 3DRXA 2XY5A 1O5JA 4LF5J 4OI1A 4KE5A 3C6UA 3RRKA 4TN2A 2AX1A 4ZP8A 3QRRA 2ZJQQ 1JJ4A 5C5JA 1N5YA 4CDIA 2QLFB 4I7FB 4MKVA 1AFJA 1QSYA 5KFLA 1WKLA 2XSJB 3RR7A 2YKAA 3SFUA 3D0HE 3M6VA 2U2FA 2LECA 2LXIA 1KVIA 2XLIA 1IR2A 2VC0A 1SH3A 4IKAA 4NZ0A 4RUAA 2FDNA 2P9CA 3MECB 4HHJA 1IBLJ 4ED8A 4M5MA 4O4GB 1U26A 3BSAA 1NBEB 1SCJB 1EQMA 4FDFA 2E1RA 2F8HA 1GFWB 2K7JA 4X4RA 4CM2A 1Q86T 4TNOA 3EUNA 1DTQA 4PG6A 2FY8A 3AOAA 1N33J 3V81A 3NNAA 3BSOA 4TVAB 1ZAXA 1D09B 2CG4A 4I2PA 2VA3A 1NDPA 2PSZA 2IPOB 4IG0B 4URSA 4DV1F 1RT2B 1UA1A 3M1VB 2QL7B 5DZ6A 1M1HA 1S1TB 4DU8A 2J7UA 4LF4F 4JI0F 1TVRB 4KHPF 5EWEA 4IYQA 3CJ5A 3DYAB 3ZTOA 1U2CA 3HHEA 2ZH3A 1WELA 4NLQA 4OZJA 4ILRA 4ITSA 1EJ7L 3ONQA 5DLGA 1JX4A 5DLFA 1FD2A 5F3ZA 5G0RA 4AQYF 4ZLJA 2CPYA 1BD6A 3M2UA 3TZYA 2DGVA 1YRUA 3MUTP 5I3UB 3DI6A 3MM9B 2HK3A 2OUGA 1RTJB 3TEGA 2XO7A 1FDAA 1KFSA 1Q8LA 2DNRA 3MR3A 1ZTWA 3PACA 2VDHA 2C3YA 1OS5A 2M52A 5ETPA 4K2JA 4I4BA 5B0FA 4R0EA 4I68A 1LWFA 5B0CA 1HW9A 1S79A 1PG5B 2R2RA 2XHCA 1HBUA 4CO0A 1F5CA 3GSIA 1Q8BA 2XQCA 1L3KA 1S77D 4Y2AA 3M8SA 5IT4A 1CS4B 3HSJA 4RNMA 4M63A 4DV4F 4IFYB 4ZCLA 3M9OB 5EUHA 4FVCA 3L4BC 1U0SA 1VGYA 2ZOGA 4ZMMA 1XNQJ 2RH3A 2KFZA 1N5VA 3SYZA 4CLUA 3R97A 2MQPA 2HSEB 1BQXA 1UKUA 2YNHB 1WG1A 2MKIA 3EICA 4S0MA 3QSYB 4DR4F 1FKPB 2R8KA 3EPGA 2MLZA 4U7CA 1V6HA 2EFPA 1RBAA 3EPIA 4R8UB 1JLCB 4JI8F 3Q22A 1HNZJ 2XM3A 1U8WA 2HHHJ 1HYSB 1X7VA 2XSFA 2QEXS 2K8GA 3CO0P 4J90A 4AL6A 4JI7J 1LW0A 3UN5A 3DLKA 4ZHRA 4C11A 5J2QA 1S9EA 5AXLA 2Q3PA 3CEDA 1OO0B 3NAIA 1NH7A 2HNZA 1FJGJ 3CC7S 4O4GA 1EKSA 1RWWB 4EK2A 4WKYA 4GVLA 3POTB 2LXFA 3DRRB 1JLEB 2B6AA 2OFHX 2FLNA 1XEZA 3IRXB 5C25B 1U48A 4DL6A 1H7WA 2RJZA 2AT1B 1WI8A 2X3GA 4QZVB 1YTYA 5KG6A 2V34A 3HF5A 1YSJA 1RT5A 3ILIA 4NX9A 5J1EA 3KUHA 2Y8WA 4QU7A 1RT2A 2HNDA 3M1VA 1NHKL 2MZQA 1RT7B 4ZVOB 3GR1A 1W7WA 1TKTA 1S1TA 1AW0A 3MFIA 3K2YA 3AJ2A 1SI9A 4OI4A 2CQDA 4KHRA 1KQSR 1H72C 4CNZA 3DYAA 3DHXA 1DQ9A 2NZ4A 3S6EA 3IGVA 2QN6B 2FZCB 5J1NA 2V8DA 1IVZA 1SIWB 4FKXA 1NDCA 4K0KJ 3BGFA 3H8YA 3AH6A 3IBWA 5HL7Q 4TLRA 1WWHA 5D77A 4F8RA 4X4PA 3ZNUA 2DO0A 3IP0A 1PJ6A 5LMNF 2VQEF 4HHUA 3TVYA 3BM7A 1NPRA 2MKSA 3Q8VA 2YQ0A 5I42B 4GMKA 1KHVA 2R8JA 1JMTA 2OD4A 5DQHA 3PG9A 1XMQF 1AB8A 3IXQA 4OZ0A 2IAJB 2OAUA 1UWBB 2VG7A 2ZH7A 2QMXA 2KVQE 2ROEA 2HQGA 3W61A 3CD0A 3GFZA 2DGQA 5DM7Q 1SL2A 3FEZA 3DOKB 1JXEA 3PX4A 3JQMA 5C24A 4EYIB 2B8PA 2KYXA 4NWBA 1RT1B 3AODA 1JIHA 1NJIT 3KHRA 2KT5A 3CCJS 2E7WA 3K5OA 2IHR1 4NYZA 1IKYA 1TL7A 3O44A 2K3IA 1SJRA 4HI2A 2UV8A 1Z1ZA 2CJBA 2VBZA 1VBKA 5KOWA 3KK1B 1QY7A 5EN1A 2YNHA 2MGZA 4JI2J 2JHEA 4X4QA 1Z4UA 4WU2A 3CXCR 1FKPA 1GX5A 1F3FA 5M2PA 1X60A 3KLVA 3HHKA 2N82B 4UOHA 4HL9A 5DDPC 4R8UA 2YWFA 2AYBA 2HHTA 4USJC 3MEDB 5D4OA 2CPXA 4O44B 4KAIA 3SEOA 1HYSA 3UR3C 3TANA 2ZKTA 4DL3A 4RU9A 2HZAA 1FNOA 3ZZYA 4LF8J 1CJVB 4M1KA 2GJ2A 4YHHF 3GQCA 3GIMA 3DC2A 4NLGA 1FRMA 1FE0A 4RLEA 2OTJS 2CDQA 3A13A 4OJHA 4OJ3A 4NLDA 3H20A 4OYZA 4B3OB 3LPEA 4EWTA 1FCAA 1F2HA 4JI3J 3I5BA 4Q2MA 1E6YB 1S1UB 1RHKB 1WEXA 2EBEA 5KG4A 4QJVA 3R3TA 2FD2A 2ILZA 1HI8A 3GONA 3AOBA 3HVTA 2M5YA 4MK8A 4NRTA 1D9FA 4F3QA 4ECSA 3CCVS 1H2UX 4Y2KA 2H5JB 1QTMA 2FY1A 2NXJA 2CJQA 4NXMF 4O0IA 2HBYB 4C9DA 2B9XA 1RT7A 3MAAB 2AJQA 1U45A 1KEKA 3V4IB 3G86A 1GXLA 4UZBA 2E7XA 2E29A 4K4ZA 1YZ7A 4WIIA 3Q24A 5KOXA 4QIGA 3P5TL 1IKXB 1ZAVA 2RU3A 3JSBA 4N8OA 1NXIA 3CJTA 5KG7A 2J9CA 1N54B 2XHWA 4B08A 1VC5A 4FYDA 4R0JA 3K59A 1VBXA 4WE1B 1YJUA 2HGNA 3GIRA 3EVWA 2CJYB 3MFHA 4RKUC 4OV6A 1TL3A 2R2UA 1VMBA 2PD1A 2DGWA 3GV8B 4WK3A 5A0YB 1X5PA 1M5OC 5EWFA 1GH8A 1WHXA 5E3RA 3PW0A 1YVFA 1XR6A 2K1RB 3PRDA 3GYGA 2IVMA 2Z2YB 4CRJA 1B7YB 2IAJA 5J2PA 3KXDA 5FJ4A 2E1CA 3DLGB 5T14A 1P27B 3T5LA 2CRLA 4YFUA 4LBPA 4K59A 2B4VA 2BM0A 1DY3A 4FNHA 1RU1A 1T11A 2C3MA 5KFIA 2I5JB 3BKTA 2YPZA 3T1HJ 4C3MA 3ZZRA 3QLHA 3OXGA 4YY3J 4LR8A 1AUSL 4LF1A 1TV6A 2XBPA 3N6LA 3IM8A 4P2XA 1NJZA 2F9JA 3WBZA 1C0TB 3U1NA 3OL7A 2KO1A 1F9HA 1MWYA 1T9YA 3EM1A 4CYUA 3I32A 1WORA 3NCPA 2BE9B 5KFJA 4F2RA 1BGXT 3H5XA 2YKQA 1NAQA 3J80Y 3JTNA 3SV4A 1NJXA 1FEEA 2LQJA 2AGOA 2RU9A 3BGOP 4DQQA 1S6OA 4DV0J 1NH8A 4TY9A 3TA2A 1SKRA 4HR2A 5SZTA 3D3BJ 4O44A 5E3PA 3CVKA 2MSTA 3AXMA 1UW9A 2O66A 4OYIA 1H2TZ 3MMCA 2Q6CA 3CIZA 3A8IA 3OFEA 1V5VA 4YR0A 3SCKE 4OZ1A 4K5SA 4U67Q 2CJKA 2BYCA 3PW4A 3BF4A 5DDQC 2J6UA 4B3OA 4ZPWR 1E6YA 1JLFA 2E1PA 4FYXB 2IVFB 2AP6A 1VFJA 1UVKA 1U6BA 2HQFA 2G13A 3ISND 1SC1B 2MZTA 1D8ZA 2FHOB 4PUOA 3BGRB 4OMFG 1UL3A 1RYSA 3M8RA 3R7SB 1HHQA 1NJYA 3T6JA 1PO6A 4LSNB 1LV5A 1SH0A 4E0DA 3LWMA 4Y34A 1FXDA 2J9DE 3J81U 1BWEA 4YOEA 2JVOA 1Q7LB 2UVUA 4J5OA 2EI5A 2QL5B 4MAKA 4USHA 1CBKA 4O3QA 4WFZA 4KFBB 4TY8B 2CNOB 5KG0A 5C2GA 2D9OA 4A8OA 3V4IA 3NGSA 4ZN3A 4KPYA 1X4FA 2C3OA 2L48A 3FBFA 3O8WA 1NO8A 1U8SA 4DS4A 3OSPA 2DGTA 1HBOA 1IKXA 2GGPB 5HMWA 3HT3A 3QWPA 4OHZA 3CWJA 3KKFA 4DLGA 5DS7A 1ZA1B 4DPOA 2BXJA 3A4TA 4W90B 1RE1B 3KJVA 3DDIA 2X1FA 4CZCA 4HYKA 5HQLA 5L9NA 1IJEB 2MZJA 3MEKA 1RA7A 3CDWA 3NWGA 3ITHB 5K9FA 1TL5A 1VQ7S 1RWMB 4NEYA 3DRSB 2QLBB 5EX3A 2P6SA 4IH6A 3OSNA 3EMTA 4ZK7M 3VHQA 1VLOA 4QCLA 1U1MA 4OZ3A 1YZ6A 1S0OA 3MPUB 3DLGA 3LTOA 2DXDA 2NSBA 2DHXA 4NXNF 2JFDA 4YDXA 2PEHA 1UVMA 3VAFA 3D3CJ 3E01A 3DGVA 5KFEA 1R8CA 1V5IB 1WEZA 2RUSA 3DLJA 3EX7B 2DBBA 2HG4A 5B0DA 1RKJA 2EG1A 1SV5B 4CO4A 4X4NA 4YUDA 1HI0P 1LKZA 1Q5VA 3PTWA 1C0TA 4Z37A 3SSSA 2A0FB 4N8NA 4QWBA 4EBDA 4ID8A 3H2LA 1M90T 3RAXA 3LP2B 2RKIB 3M8WA 4DUZJ 3R6LB 4ED3A 4USKA 1WOPA 5K8MA 2AHOB 1FFSB 4DX5A 4GKKF 3MPWA 1Q95G 3HI9A 3R1LA 1NHVA 4ED0A 1Q16B 1QAIA 4WXWA 1GT8A 3OJSA 1G2EA 3NOCA 4M5HA 3JTOA 4PQAA 3W8GA 2DCLA 2LKZA 4RZRA 4WP8A 1MWQA 3KHGA 3Q2TC 1JJCB 2CQHA 3NY0A 4DPUA 2ZUGA 2OO4A 4NPOA 5CYMB 3WIVA 3BN4A 5LJ5Y 2MZSA 2V9WA 1U0HB 1EAYC 1FVQA 3G8TA 3R5JB 3PIOQ 4O3PA 5HSPA 4CI0B 3BQ0A 2RD5C 3KUEA 3UVJB 3AA8A 5AJ3F 1ZM2A 4DSFA 1LXNA 1Q82T 3BGRA 4DV3F 1XMBA 5LMUF 4NRUA 4ANEA 4DR1J 2HHWA 4DUYJ 4J9LA 4DSKA 3ILOA 2W8KA 2CQCA 5BXIA 2UU9F 3QSIA 3Q89A 5KFUA 1YLXA 3RBEA 1XWLA 1NSKL 1I6JA 2HVZA 1PSDA 2BANB 4I69A 1Y3JA 1URRA 1VQSA 2WONA 1T0TV 1QUPA 4LVNP 1JLBA 2L3MA 1JJHA 4Y6IA 4LF7F 2N3LA 1CJTB 1JKHA 4RL1A 5F8IA 4KFBA 4TY8A 3T5HA 2KH9A 3MAHA 2Q6BA 3FZBA 5FDLA 4JV2A 1OQ3A 5KFVA 4DPTA 4DR7F 4TKTA 1WTBA 4ZPDA 5IC4B 3UR0A 4FXDA 4FYYB 1N6QB 2E5HA 3AT1B 5DG7A 5GAEU 3WZ0A 4YEAA 3NGKA 1D3WA 3LGHA 1F5AA 2E5LJ 1FWPA 2OPQA 3OR2A 2CPFA 3BEGB 3PDNA 2VF3A 2FLPA 4DOZA 1YJTA 2QSWA 4Z7CA 4HDHA 5F8HA 1HR0J 1YI2S 1XR5A 2ZM6J 3ITHA 2B4OA 5HMYA 2MB0B 5H9FK 3DRSA 4JI4J 2M88A 5GVQA 1IBKJ 1RI7A 3RB0A 2V8HA 3ICLA 2H5IB 3I9V9 2CYYA 3KHLA 4N5SA 3L7OA 3WHIA 2HRTA 1RWVB 2R3VA 3MTJA 2W25A 3ZZTA 2OGUA 2F63A 4LFCJ 5KFWA 3C16A 3R27A 2CPHA 4U6PA 1L3UA 3OVSA 4F4YA 3B6BA 3K8VA 2CPJA 5KFYA 1XMOF 2CFXA 4YQWA 1XN9A 4RWXA 5D8HB 2VB6A 1BXNA 1N5QA 3HHDA 1JXVA 3M8YA 1UPMB 2BW7A 5D3GB 2B9YA 5ADZA 5HVHA 5DQIA 2DY9A 5C2CA 3V2UC 3L9ZA 3I55S 1X4BA 4X64F 1ZZNA 4B3MF 4Q8FA 2B7CB 4M5IA 4X62J 3IS9B 4ZVFA 4X65J 2RSQA 5K20B 3CCQS 2ZH2A 1LK5A 2HEKA 1YJ9S 2A18A 5B0AA 5I3QA 2OJ3A 3K5PA 4I0WA 2HBQB 3RB3A 2E44A 3QYYA 3MD3A 5IC6B 4PYAA 4C8NA 2J0WA 3M30A 2IRUA 3VR1A 3T3FA 2ATCB 1JXLA 1J2VA 2MQOA 1TZ0A 3TUZC 1WC4A 4ANDA 2ALYB 4Q0BB 4MIAA 4ZLNA 1QAXA 4LQ9A 1K0TA 2EWHA 1S0NA 3NEKA 3EDQB 3B4DA 1P9QC 4WCEQ 1C4AA 3KLIB 1R6VA 1FKAF 2DPIA 2D41A 5B08A 4LR7A 2W9BA 1VBYA 5KT6A 3S8SA 2VU5A 3OT9A 1VJQA 5IWAJ 1B70B 5GMEA 5AE1A 2XMTA 5ETVA 4A4JA 3W9HA 3D2WA 4XPEA 2J0SD 4DR6J 2DJWA 3ZZZA 2WBRA 1PBUA 3NBPA 3GIJA 1TUVA 4E8UA 2QA2A 3DOMA 4MIBA 1CJKB 4TLQA 1Q4RA 2E9TA 3D0IE 2A1BA 2XYGB 3A3PB 4HI1A 1RTDB 4LSLA 2FHJD 2W7PA 1HNWJ 4KC5A 2WOMB 3IAS9 1HKAA 2Y8YA 3BR8A 5FD1A 3T5KA 1AT1B 3BO4A 2WB1D 4U8VA 4I64A 2EKNA 2F4VJ 1MWZA 2CUYA 5AXNA 2PI5A 4WYLA 8ATCB 1SC6A 4DV7F 4URQU 4L76A 1BLUA 1PC4A 1U4BA 2OI2A 5KFAA 1RWKB 2IMOA 2DCUB 3UDEA 5GAHI 1BMQB 4LF6F 2CNKB 2HFUA 4Q7AA 1HMVA 4ZLPA 3BPSP 1F0XA 2VOPA 1WC5A 4CIOA 2DB1A 3BR9A 3J7AN 1VQLS 3ENWA 4Z2XA 4GC6A 1AZSA 3G6ES 2DT9A 1OMSA 3BQ2A 3GIKA 1YHQS 4OYBA 2VBWA 2BE7D 4U9RA 3FFIA 2ZH8A 1X4HA 2A6MA 3ET6A 2CXEA 2O67A 1IBMJ 4MYUA 3PW5A 3R7NB 2A2DA 2UXCJ 2N7CA 1F6TA 3CUNA 5F8JA 4OZLA 2L9DA 2CQ1A 2VQFJ 1S1VB 3EWGA 5D3GA 4KIAA 4NLSA 4DV6F 1URNA 2XNQA 1R8PA 4W4MA 4NEZA 2XYHB 3QGIA 4MKAA 3VZIA 3IS9A 2CZVC 3W9IA 5LXRA 2CADA 1OYEA 3ILJA 2M2BA 4UQGA 1KVKA 3HFZB 1RT6A 2VFSA 1N34J 3CDUA 1J5OB 3QGHA 2P5VA 4X66F 3K5MA 3HX9A 3PYEA 4KRWA 2LA6A 3K58A 1BQMA 2F8EX 1UZDA 2QMUB 2CQPA 3UD4P 2KL8A 3BO3A 1L3TA 2EK1A 4IRDA 5BR8J 4J9VA 1UCNA 1NK8A 2L08A 4ID5A 2KDOA 4RW8A 1K1SA 3TO8A 4JP8A 4ER8A 2R7OA 4JI1J 1N0VC 1BHNA 4XTTA 4JV5J 1DLOA 3MR5A 4GKJF 1APSA 2G2OA 3D0GE 1UVLA 2AYGA 3NWRA 5JUMA 1CQNA 1HNVB 4DZ6A 3BSCA 3CJ4A 4ZPAA 3E8OA 4P71A 4IG3A 4ECRA 5H1SV 1DTTB 5L9XA 1S9GB 2IM1A 4JI5F 4AXIA 1WD6A
chains in the Genus database with same CATH topology
3D3BJ 5FLXU 4AQYJ 2UXDJ 1N34J 2UU9J 2UUCJ 3T1YJ 4JI2J 2MQ8A 1HR0J 3W1YC 4DR4J 4B3RJ 4B3TJ 4X62J 3JAMU 2ZM6J 3J7AN 4GKKJ 5IWAJ 4HHUA 4JI6J 4YHHJ 1N36J 4X65J 4LF7J 5A2QU 4RJVA 4KYZA 4JI4J 1XNQJ 4OX9J 4DV6J 4DR1J 4JI8J 4DUYJ 4DUZJ 2KL8A 3T1HJ 1IBKJ 3IMQJ 1IBLJ 4KY3A 3R2CJ 4YY3J 1XMOJ 4DR7J 4JYAJ 4DR6J 4NXNJ 4GKJJ 4PWWA 4DV1J 2KVQE 3J80U 1IBMJ 4LF8J 1N33J 2UUAJ 2UXCJ 5LM7E 4DR3J 4DV7J 5BR8J 4NEYA 4JI5J 4LFCJ 2VQFJ 2UXBJ 4LFBJ 4JI0J 4KHPJ 4LF6J 1J5EJ 4JI1J 1HNWJ 4DR5J 1HNZJ 4NEZA 4DV5J 2HHHJ 4DV2J 4JI3J 4X66J 4X64J 1XNRJ 4JV5J 4B3MJ 4LFAJ 4NXMJ 4DV4J 3J81U 2MEWA 2UUBJ 5LMNJ 2VQEJ 2F4VJ 4V1Ak 1N32J 5AJ3J 4B3SJ 4JI7J 4LF5J 5IT9U 4LF4J 3R2DJ 3OTOJ 4DV3J 3D3CJ 4K0KJ 1I94J 4DV0J 5LMUJ 1HNXJ 4LF9J 2MTLA 2E5LJ 4DR2J 1XMQJ 1FJGJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3B J;  5FLX U;  4AQY J;  2UXD J;  1N34 J;  2UU9 J;  2UUC J;  3T1Y J;  4JI2 J;  2MQ8 A;  1HR0 J;  3W1Y C;  4DR4 J;  4B3R J;  4B3T J;  4X62 J;  3JAM U;  2ZM6 J;  3J7A N;  4GKK J;  5IWA J;  4HHU A;  4JI6 J;  4YHH J;  1N36 J;  4X65 J;  4LF7 J;  5A2Q U;  4RJV A;  4KYZ A;  4JI4 J;  1XNQ J;  4OX9 J;  4DV6 J;  4DR1 J;  4JI8 J;  4DUY J;  4DUZ J;  2KL8 A;  3T1H J;  1IBK J;  3IMQ J;  1IBL J;  4KY3 A;  3R2C J;  4YY3 J;  1XMO J;  4DR7 J;  4JYA J;  4DR6 J;  4NXN J;  4GKJ J;  4PWW A;  4DV1 J;  2KVQ E;  3J80 U;  1IBM J;  4LF8 J;  1N33 J;  2UUA J;  2UXC J;  5LM7 E;  4DR3 J;  4DV7 J;  5BR8 J;  4NEY A;  4JI5 J;  4LFC J;  2VQF J;  2UXB J;  4LFB J;  4JI0 J;  4KHP J;  4LF6 J;  1J5E J;  4JI1 J;  1HNW J;  4DR5 J;  1HNZ J;  4NEZ A;  4DV5 J;  2HHH J;  4DV2 J;  4JI3 J;  4X66 J;  4X64 J;  1XNR J;  4JV5 J;  4B3M J;  4LFA J;  4NXM J;  4DV4 J;  3J81 U;  2MEW A;  2UUB J;  5LMN J;  2VQE J;  2F4V J;  4V1A k;  1N32 J;  5AJ3 J;  4B3S J;  4JI7 J;  4LF5 J;  5IT9 U;  4LF4 J;  3R2D J;  3OTO J;  4DV3 J;  3D3C J;  4K0K J;  1I94 J;  4DV0 J;  5LMU J;  1HNX J;  4LF9 J;  2MTL A;  2E5L J;  4DR2 J;  1XMQ J;  1FJG J; 
#chains in the Genus database with same CATH topology
 1B0T A;  4WK1 A;  2YX4 A;  4RNF A;  3KHH A;  3FMW A;  4ELU A;  3HSZ A;  1F9E B;  3I31 A;  4DFP A;  2F8M A;  4B3S F;  4XPC A;  3R8Y A;  4F50 A;  4RJV A;  2ZH5 A;  1FWL A;  2WOM A;  3I0S A;  1Y5I B;  4RX6 A;  1OPI A;  5E3C A;  3KLG B;  5IOL A;  5HP1 A;  1XTZ A;  5KT4 A;  2A3J A;  4X84 A;  2FQQ B;  3J7A 1;  3KDN A;  2ZD1 A;  3GJT B;  2HHV A;  4FBT A;  2VIC A;  4P74 A;  2B4U A;  2RF2 A;  2C1E B;  4JYA F;  1TK8 A;  1NUE A;  2ZDO A;  5D0G A;  1EKR A;  3O5T B;  3GCW P;  4C3K A;  2JWN A;  5D15 A;  3UN3 A;  5GAG I;  1C4C A;  3QWU A;  5DGB A;  1S0V A;  2U1A A;  3W7B A;  1OSC A;  2C2Z B;  1REV B;  2RIJ A;  2FLL A;  1RTZ A;  3UDV A;  4AFF A;  2BE2 B;  2V2V A;  4Q44 A;  1YQH A;  4MT1 A;  2D3O 1;  2EW9 A;  3MUM P;  4W98 A;  4DF8 A;  3VGS A;  1OYD A;  2BZ2 A;  1SQG A;  2AZ3 A;  1O6X A;  2QFI A;  5F3T A;  1B7F A;  5GAH U;  4USM A;  3C6T B;  3L09 A;  3M9N B;  4ECZ A;  3OUY A;  2YKN B;  3KMS A;  3BS9 A;  2GW8 A;  3I0R B;  2VPW B;  1RWO B;  1N5T A;  1S6Q B;  2CNL B;  1ZOT A;  3TZW A;  2PC6 A;  2QSF A;  2FVC A;  5D4P A;  2DR6 A;  2BDP A;  1VYA A;  4YP3 A;  1TMJ A;  4DR5 F;  2FHM A;  2D9P A;  1FRI A;  2BKN A;  2B7B B;  3HMJ G;  2DNZ A;  2NUU G;  1N32 F;  2IM2 A;  2XMW A;  1UEV A;  4J9M A;  4X62 F;  1X0F A;  1UWA A;  5HK4 A;  2XGP A;  3FBE A;  2HVD A;  2QA4 S;  3VAG A;  2OHD A;  3LP1 B;  1WG5 A;  3EE3 A;  1VQ9 S;  2PI4 A;  3EXY A;  3F41 A;  1BQN A;  4N47 A;  3QT8 A;  1D1U A;  1O0P A;  1VQ4 S;  1MSW D;  1DTT A;  2F1F A;  4TQR A;  1HWI A;  5KFD A;  3DKD A;  1HBN B;  2NUH A;  1TAQ A;  4BC9 A;  1F60 B;  1RZM A;  2RDJ A;  3FNN A;  3W5Z A;  1Z2Z A;  4ZA1 A;  2FTR A;  3PO5 A;  2MJN A;  4HEA 9;  4A8S A;  4A8M P;  2FPH X;  3FEY B;  1CEZ A;  1R8A A;  2EFQ A;  2ROG A;  3HVA A;  2YNI B;  4M5D B;  2V8G A;  2BA9 A;  2HMI A;  4CCH A;  1FER A;  1RAC B;  3ENQ A;  1UFK A;  1TK5 A;  4ZCM A;  3IWN C;  1ACM B;  1OJ4 A;  3W2V B;  4PXC A;  4NLO A;  2N4D A;  3NMR A;  2VKR A;  4ZOS A;  4HLB A;  1KLM A;  2HZC A;  4NLV A;  1FK9 B;  2EG2 A;  1Z2L A;  3LP0 A;  2V4R A;  1CG2 A;  1A6L A;  2HQD A;  3T19 A;  1M0S A;  2XZT B;  3I4H X;  4NE9 C;  1S7H A;  3T1Y F;  2QGF B;  4ZVE A;  5A6W A;  3UE2 A;  5E2Q A;  2FVS A;  2XWY A;  4YME A;  1IM6 A;  5K14 A;  4JI6 F;  3DLH A;  2YWW A;  2ZBC A;  3BBB A;  2F9D A;  3D6M B;  1TKX B;  1UW4 A;  3VVU A;  5C42 B;  2V4Q A;  3TYT A;  1H73 A;  1RA6 A;  4NA2 A;  3QZ8 A;  4HTJ A;  1X5S A;  2FGC A;  4F26 A;  3D6T B;  4FF1 A;  3G6V A;  2OLW A;  2VJV A;  4ALZ A;  4CO2 A;  2RHS B;  1TL4 A;  4EU0 A;  3P3D A;  1VQN S;  2AJF E;  3H90 A;  2QX0 A;  4H4K A;  2H51 B;  5L1I A;  2IIH A;  4PZV A;  2DNM A;  1SKS A;  2ZBP A;  5D0R A;  2PMZ D;  2KJW A;  3GG0 A;  2COL A;  3I9Z A;  1FES A;  2VD3 A;  4H4M A;  5U47 A;  5A2Q U;  4DEZ A;  5FII A;  1T05 B;  2XUL A;  1JJ2 R;  4ELV A;  2YKN A;  3FUY A;  1X4A A;  3I0R A;  3IMQ J;  3N28 A;  5B0B A;  3G96 A;  3MMB B;  2BM1 A;  3GV5 B;  2J8A A;  3VGT A;  5GAG U;  4DV1 J;  2VV5 A;  4WF9 Q;  4C0H A;  3HHL B;  2W7O A;  3FQL A;  1T02 A;  4OFZ A;  2JEJ A;  1ZET A;  2Y3Y A;  4NOH A;  3ETM A;  3L7P A;  3CD6 S;  1XIQ A;  4JI0 J;  2IA0 A;  4KHP J;  1QJH A;  2E5G A;  1QE1 A;  2D69 A;  3Q0A A;  1TKZ B;  4F02 A;  4Y3C A;  1X9M A;  4DSE A;  1SQE A;  3T1A A;  1UVI A;  1CJU B;  2V6A A;  2AJ1 A;  3PRB A;  1KVJ A;  4QYZ J;  2RNE A;  4Q43 A;  2CDR B;  3CNQ P;  3DGP B;  2RAQ A;  2VKZ G;  2D74 B;  1LK7 A;  3CJK A;  4LMZ A;  3LP1 A;  4R5P A;  4ETZ A;  2AU0 A;  4K4T A;  4AQY J;  4KGZ B;  3W5X A;  4E98 A;  3L95 X;  6FDR A;  4IDK B;  2QIF A;  4A47 A;  2FC8 A;  3A3N B;  4Y0F A;  4CLF A;  1HBN A;  4OJ1 A;  3MEG A;  2RDD A;  8AT1 B;  5BYQ A;  3H25 A;  2GFF A;  3HLU A;  2WTF A;  4FYV B;  3SCI E;  4AE5 A;  5ETO A;  2C28 A;  4B3T F;  3WX4 A;  1KDN A;  5BJR A;  2CJA A;  5F0W A;  3G6X A;  2RS8 A;  1RAH B;  4CTA B;  1JLA B;  2CWX A;  5L38 A;  4ECU A;  2X1B A;  2HGM A;  2MSS A;  3J81 j;  4YR2 A;  4DV4 J;  4OX8 A;  2I8E A;  3R5C A;  3W2V A;  1WSV A;  4JV5 F;  4BLG A;  5CA5 A;  2CQ0 A;  1FK9 A;  3MOJ B;  3DRP A;  5EX0 A;  2RT3 A;  2DNK A;  2AF6 A;  4NI2 A;  4M94 A;  3NGD A;  1XNR F;  4DR4 J;  1LWE A;  2DNL A;  4UF4 A;  5F41 A;  2BQU A;  2DK2 A;  3MM7 B;  2OH2 A;  2YNG A;  3LOU A;  2CNN B;  4DI6 A;  3DM2 B;  1U6F A;  4JI8 J;  4USV A;  5E7O B;  2O1P A;  2ADC A;  2HHP A;  1UAW A;  1W2I A;  3P96 A;  1C1B B;  4Y2C A;  3THP A;  1A0O B;  2ZBR A;  2J0Q D;  3HJV A;  4M8L A;  1EP4 B;  1XER A;  3ZZO A;  2ZVI A;  1M5V C;  2OML A;  4DXL A;  4N56 A;  3PIP Q;  3FBC A;  4PPZ A;  2GV1 A;  3PM9 A;  2BOP A;  2IRY A;  2OSR A;  3V5R A;  2VBY A;  3HHN B;  3W65 A;  4ERD A;  4J9U E;  4DFM A;  1TKD A;  4NYP A;  2WZ1 A;  4RW4 B;  3RGI A;  2IC3 B;  4WFN Q;  1GX6 A;  1T05 A;  2C2K B;  3C6U B;  2LU1 A;  3QO9 B;  4KHM A;  2NLW A;  1KS2 A;  5HQ8 A;  5HRO A;  2MYF A;  2KYZ A;  2OPS A;  4KGX B;  3QNW B;  3RG6 A;  4ZPB A;  5CCM A;  1CPZ A;  2JLF A;  4NCG B;  1RK8 A;  1HA1 A;  3QID A;  1KWM A;  2SXL A;  2H4W B;  2M70 A;  2FJW A;  3G2X A;  1KQK A;  2BKO A;  4C4W A;  3UCU P;  2UV8 G;  4J91 A;  3JAM Y;  1DQ8 A;  2F65 A;  4ZP7 A;  3MXH P;  1RAI B;  1DTQ B;  2BQR A;  2GJI A;  4RNO A;  4U95 A;  2RDI A;  5LSO A;  3G87 A;  5E3A A;  4EZ9 A;  1H38 A;  4I2P B;  2X1G A;  3HPO A;  5LMN J;  2VQE J;  1LWC A;  3MM5 A;  1S48 A;  3D54 A;  2AMC B;  2EFO A;  2ASD A;  4MTP A;  2ZH6 A;  2Z0G A;  1JQG A;  2RQM A;  1YBA A;  2Z2L A;  1XMQ J;  1KR4 A;  2FIU A;  4AUK A;  1FEH A;  1VK8 A;  1S6U A;  1MG7 A;  3DCA A;  3B54 A;  1G7C B;  2CQG A;  4PXB A;  5KFF A;  4PWU A;  1ELO A;  1RAO A;  3UD3 P;  1U2F A;  4KGV B;  2YWK A;  4V19 J;  1M1G A;  2NZC A;  5FLX Y;  5F8L A;  2D3Z A;  1QVF R;  2R42 A;  2DVI A;  3HHL D;  4OZN A;  4C97 A;  1HHT P;  4OHX A;  1ITP A;  3NGU A;  4F3O A;  1YKW A;  7FDR A;  3M2U B;  3Q83 A;  4ZP9 A;  5F0U A;  3OLA A;  3OR1 A;  4TYA A;  1BC6 A;  1EHW A;  3AQO A;  2X3D A;  3TI0 A;  2G2Z A;  4ED6 A;  4FNI A;  3A12 A;  5EWG A;  2XS7 A;  4YN3 B;  3SDE B;  4ZJL A;  4USI A;  2Y1I A;  5AXK A;  2Q43 A;  4RW9 A;  1B0P A;  5HJX A;  2IBO A;  4ZVH A;  3A8J A;  5KFT A;  1S1X A;  1HBU B;  3OBI A;  1TUG B;  3J7Y I;  3MCO A;  2NPI A;  1J5E F;  2DTJ A;  2ZDP A;  4OJG A;  3ADA C;  1FDB A;  2OEK A;  3I4P A;  4DPY A;  1HHS A;  1XR7 A;  4PQU A;  3CJS A;  3KLE A;  4F04 B;  4YHH J;  1MU2 B;  1OIA A;  1PGZ A;  2Z57 B;  1TQL A;  2KM8 B;  3TQE A;  4KY3 A;  1IR1 A;  3EZO A;  1DHM A;  2GC8 A;  4NA1 A;  2KB2 A;  4LUB A;  1I5O B;  3BB5 A;  4DCO B;  3HO1 A;  3M8Q A;  1OSD A;  2VJU A;  3LO3 A;  5E3Q A;  3RYL A;  4RW4 A;  1SPB P;  4IR9 A;  2IC3 A;  2B51 A;  1X4E A;  3UWT A;  1YJ7 A;  1YG0 A;  3QO9 A;  4DCJ B;  3CCM S;  4BWM A;  3MGJ A;  1FJC A;  3CTR A;  5HVG A;  4NXM J;  4L72 B;  3CCZ A;  2JEG A;  1NHU A;  3QBC A;  4O23 A;  4BWJ A;  1MRO A;  3V6D A;  2DYA A;  2M0G B;  1LW0 B;  2H9Z A;  3DLK B;  3GJQ B;  4ZHR B;  5J2Q B;  4C11 B;  4NCG A;  4DL5 A;  1S9E B;  2ZEJ A;  3EJM A;  1RYR A;  1RTH A;  2UVV A;  3DDN A;  3OL6 A;  2YNF B;  1LQ9 A;  1ZPW X;  4WP3 A;  3UPF A;  2HNZ B;  4WPA A;  2W8L A;  4ED7 A;  6AT1 B;  3M6U A;  4J9K A;  1T7P A;  2HS0 A;  3H40 A;  4CLY A;  2B6A B;  2W2N P;  4KO0 A;  1WDD A;  2G0I A;  1T3N A;  2RRN A;  4K4X A;  4EFA C;  1RT5 B;  4F0M A;  1NDL A;  4A8K A;  1S12 A;  3F0N A;  1P9Y A;  3RZA A;  2HK2 A;  3FSI A;  5J1E B;  1SIZ A;  4TQS A;  2HND B;  4A8F A;  2QRR A;  2ACY A;  4LIR A;  2POK A;  2V50 A;  1TKT B;  4PAB A;  4IO1 A;  3MR6 A;  1YBT A;  2HHU A;  1RAD B;  4UY8 T;  3PZP A;  3TAM A;  3TUJ C;  2ZUA A;  1SB6 A;  5D6G A;  4G1Q A;  3W2W B;  4F36 A;  2HAF A;  3R7B B;  3TX0 A;  2HHX A;  2MLX A;  2BJ7 A;  2ZVS A;  4FF4 A;  2C2R A;  1HW8 A;  1YRX A;  3GMG A;  1KQF B;  4L3K A;  1RSC A;  3EGV A;  4L73 A;  1RAA B;  2DNO A;  1M5K C;  3AXK A;  4DG1 A;  1XBW A;  3JTP A;  3M6W A;  4RU2 A;  2ZBQ A;  2GML A;  2JNJ A;  1YJR A;  5IXU A;  3HZE A;  3NOG A;  1D9A A;  3MUR P;  3GJR B;  4KKO B;  2LDY A;  3SSQ A;  4EYH B;  4DQI A;  4ENO A;  4N41 A;  2HAI A;  3SDE A;  1BUX A;  1NJW A;  4KV8 A;  2VG7 B;  2DEI A;  3ENV A;  4J9R A;  4NLY A;  1QM9 A;  2DGO A;  2LDI A;  2GVZ A;  2M8H A;  3THT A;  1HPZ A;  5C24 B;  3Q86 A;  5A8W A;  4U7U K;  1X5T A;  1RTI A;  3BJY A;  2ATL A;  4ZIT A;  4K7Q A;  4EBE A;  1T94 A;  2OPP B;  4UOF A;  3DMJ A;  1NK5 A;  4FBU A;  1TP7 A;  1MU2 A;  1FKO A;  2YQ3 A;  4XAK A;  1IKY B;  3V6H A;  1TL7 B;  2QA1 A;  4JBC A;  3OW2 R;  3G8S A;  2D3U A;  5HAT A;  3LWL A;  2RE1 A;  5J2N A;  4FS2 A;  1WHY A;  3RB6 A;  1U47 A;  2JLG A;  1ZYQ A;  3ILL A;  2Z2Z A;  1O51 A;  2DIT A;  4ANC A;  3DFE A;  2MGZ B;  4J7C A;  1RHQ B;  3I96 A;  1LFP A;  4G6V B;  4DL2 A;  4QWC A;  2QMW A;  4ZDN A;  1JB0 C;  3FRY A;  2BJ9 A;  2WBM A;  1RHR B;  3FK4 A;  1VDH A;  2NRE A;  1UA0 A;  3UI3 A;  1KRP A;  2V8V A;  3I5A A;  2XI2 A;  4ZKA A;  1VC6 A;  4NML A;  3OTC A;  3AQP A;  2OMO A;  3CPW R;  3PO4 A;  2ADB A;  2OD6 A;  3PEJ A;  2YKM A;  1JLQ A;  1RLC L;  4RUH A;  1P8G A;  2YNF A;  3H7H B;  2O5D A;  1ZH5 A;  3EGN A;  1DFD A;  4A48 A;  1K9M T;  4P10 A;  3D66 A;  2EFG A;  4CH0 S;  2IYI A;  3QPI A;  1SL1 A;  1RCX B;  2UUA F;  3RB4 A;  3HVW A;  1S1W A;  3IC1 A;  2LA4 A;  1Y5L B;  3HT0 A;  4LFB F;  5CYQ A;  3N4W A;  4X4O A;  5L1K A;  3LA0 A;  3HVT B;  3CCR S;  2XNR A;  1WHV A;  1UMJ A;  4X4U A;  5D0H A;  2AKW B;  3BQ1 A;  1UEK A;  3ZC4 A;  1B3T A;  2KRB A;  5CYJ A;  5E0O A;  3EDR B;  4M5J A;  5ETT A;  4NXN J;  5K5M A;  2BOA A;  4I6Y A;  3WQP A;  3AB4 B;  2QO3 A;  1RAJ A;  3LF0 A;  2A10 A;  4MK9 A;  2AEJ A;  3LQV A;  2LEB A;  3W2W A;  4ZVU B;  1QLN A;  4PXE A;  3H0P A;  2VPX B;  2W4C A;  3KLH A;  1WC1 A;  1NK7 A;  4F4W A;  2DY1 A;  3A8K A;  3WC2 A;  1OWX A;  1Q0N A;  2DNP A;  3RU0 A;  2ZJR Q;  1TL3 B;  3AD7 C;  2PDA A;  5B7W A;  3KK3 A;  1TFW A;  4PR6 A;  3T6B A;  2AJ2 A;  3HD2 A;  3AFG A;  4IOB A;  1WUU A;  4KKO A;  2OPR A;  1LNQ A;  2Q79 A;  3TQ1 A;  3QIP B;  4DV2 F;  4CLP A;  5J2P B;  1FRK A;  3ETO A;  4GKK J;  3VAL A;  2XMM A;  1R0A A;  4KR0 B;  4HHH A;  1DAR A;  5A8K B;  4IFV A;  2BAB A;  3MF5 A;  5KFR A;  3U7J A;  4WYW A;  1GEH A;  4AD6 A;  2UXD F;  3QLH B;  5DJB A;  3ZNJ 1;  2UUC F;  1TV6 B;  2OPP A;  2HWT A;  3H4B A;  4ZN1 A;  3HXM A;  5K8P A;  1W25 A;  3I82 A;  1EAR A;  3D6F B;  2JL9 A;  3NLC A;  2DHA A;  3OQ2 A;  4Y2I A;  4CYU B;  4OLO A;  4CLW A;  3B4M A;  4NCB A;  1XC9 A;  3V6K A;  3T41 A;  1IWG A;  3TA0 A;  2HWH A;  4JUZ A;  2XMA A;  1EZZ B;  3AOC A;  4EO6 A;  4B17 A;  5AJ3 J;  4DMZ A;  3J7Z T;  4D3G A;  3MOZ A;  3KOA A;  2YH1 A;  2KXN B;  3VAJ A;  2V2Q A;  4DV3 J;  5LMU J;  3Q2S C;  4DS5 A;  2WB4 A;  1VC0 A;  4OL8 A;  4NCA A;  3GSD A;  3B82 A;  3M7V A;  2B5J A;  1GQE A;  4B9U A;  3H4D A;  5I3P A;  2XYP B;  3GYN A;  2UU9 J;  1VI7 A;  2LQB A;  4LFA F;  2DHS A;  2W2P P;  3SSR A;  3FSY A;  4LF7 J;  2CJ9 A;  3MM6 A;  5JMN A;  4DX8 H;  3MMC B;  1RT3 A;  1UTA A;  2MKJ A;  1I94 F;  2XS5 A;  1HNX F;  5A76 A;  1XQI A;  4DR2 F;  1KKH A;  3Q8U A;  3SCL E;  2FZK B;  5KFP A;  4DR7 J;  3N6M A;  2F4F A;  2JEF A;  2V8P A;  3IN5 A;  1X5O A;  1GAO A;  3MM8 A;  3OLB A;  3UN2 A;  3KG4 A;  2E5J A;  5HAO A;  2PFD A;  1JLF B;  2XZD B;  5M2R A;  3I5C A;  2YQ1 A;  2NSC A;  4GVB A;  2KHD A;  4IRC A;  4MYT A;  3D6H B;  4PUO B;  4OX9 F;  2LYV A;  1HWU A;  4DHV A;  2C2O B;  3RW6 A;  1VHI A;  1U24 A;  1S4E A;  5DET A;  4DPX A;  2Y0B B;  1FNX H;  4LRC A;  3L7U A;  5HLF A;  5L1L A;  1ZBT A;  1VIX A;  1PYO B;  1UVN A;  3U27 A;  4HAC A;  5CAB A;  2YWE A;  2EVZ A;  2QE5 A;  3GII A;  1KOO A;  1Q53 A;  1SH2 A;  5CAA A;  3NG8 A;  2DXE A;  4OYA A;  3TJ8 A;  4GC7 A;  2DR7 A;  1ZZF A;  4AL7 A;  1HBO B;  2MKK A;  2HLT A;  3VQT A;  2DNN A;  1GMW A;  4HH1 A;  1XMO J;  1G6B A;  1H2V Z;  5L39 A;  2OEM A;  1GK8 A;  3KJV B;  4ZVR B;  2HBR B;  3KNA A;  5DO2 A;  1EIY B;  1RXO B;  2XG8 A;  4RWW A;  5CH7 B;  2VG5 B;  1QUV A;  3CME S;  4FS1 A;  1KFD A;  2JSX A;  3VF0 B;  2ZIT A;  5K8N A;  3GU0 A;  2FUG 9;  3QIP A;  4X64 J;  2B43 A;  4B3M J;  4B9M A;  2B8Q A;  1RAB B;  4V19 X;  3FRZ A;  4BHQ A;  4DN0 A;  5KFX A;  1RAG B;  5A8K A;  3DLE A;  4IQM A;  1V3Z A;  3E01 B;  2CQI A;  3PNI A;  4DX7 A;  4DBQ A;  3W9J A;  2AJ4 A;  2H3E B;  2QTW A;  1TFY A;  3NS5 A;  2GZO A;  1VQM S;  1UP1 A;  3A8E A;  4F4A A;  1UEU A;  3D5M A;  1I1G A;  3NGR A;  4YB5 A;  5KAK A;  3LGN A;  1Y7P A;  4PPD A;  2NQP A;  1R8B A;  4QQB A;  4FVM A;  3QFH A;  2IY5 B;  1S76 D;  2GVD A;  3AY0 A;  4ECQ A;  3DNC A;  3JYT A;  4B3R F;  4ZP6 A;  5LM7 E;  3OFH A;  2CQB A;  1YK9 A;  1L3S A;  3KJN B;  1HQU A;  2E9Z A;  2QG9 B;  1GMW D;  4RW7 A;  4NMX A;  2KXH A;  3LH2 S;  5EDW A;  2V68 A;  4QYZ K;  4WFA Q;  4FN5 A;  1KP6 A;  4CO3 A;  1I3O B;  5CD4 H;  3HHL C;  3PVX A;  2CWK A;  1VRT A;  3O2I A;  4YB6 A;  5JXS A;  2QZ8 A;  3OV7 A;  5CZV A;  1QDU B;  1RHJ B;  4PEO A;  3AA9 A;  4ELT A;  3CDA A;  4IRK A;  2DO4 A;  2DIS A;  2IYG A;  3TX8 A;  4UUX A;  3M8P A;  2L9W A;  2ZWO A;  1B99 A;  2BKP A;  2VFR A;  5B0G A;  2MQ8 A;  9ATC B;  3TEH B;  5T7L A;  3CCS S;  1NPP A;  3H5U A;  3PYG A;  4CP5 A;  3KLF B;  1VQO S;  2W2Q P;  4LF9 F;  4TU9 A;  1S57 A;  4DJB A;  1VQK S;  3G6Y A;  1IXK A;  4DUT A;  4UY8 5;  3AD9 C;  3U1L A;  1MML A;  4LSZ B;  3MI7 X;  3PV8 A;  2W2M P;  3CJ2 A;  4DV7 J;  2KFY A;  3OXF A;  2WON B;  2ACM A;  5CHC B;  1JLB B;  2E1A A;  2KN4 A;  4HTI A;  4LF6 J;  1JKH B;  3TAR A;  3QAE A;  3FBB A;  1WOS A;  3K7R A;  1S0M A;  5FDL B;  4H4O B;  3CJR A;  5IT9 U;  3N6N A;  3SBM A;  2I9S A;  5A6P A;  1T9U A;  3FGV A;  1S10 A;  2HHS A;  1NEE A;  4ZCK A;  2J0X A;  3M4X A;  1EX8 A;  1FF2 A;  4TYB A;  2OPQ B;  4M95 A;  1GTE A;  3OR2 B;  5CQG A;  5IT0 A;  3NP5 A;  2EBG A;  4ZJO A;  2W4P A;  2BJ1 A;  3PX6 A;  2GQQ A;  3H2U B;  4LRF A;  3C19 A;  2VG5 A;  3DU6 A;  4DV6 J;  1HQE A;  2K3K A;  4QR2 A;  3JSM A;  1HWK A;  3ZXW A;  2V63 A;  3HSD A;  4OI0 A;  5B0E A;  3N79 A;  4AL5 A;  2M3D A;  1N5S A;  1B4S A;  5DRK A;  2EFN A;  1KSP A;  3I56 S;  2FC9 A;  1NZ8 A;  2M4M A;  3C16 B;  3CD7 A;  2V9K A;  4Y00 A;  1U02 A;  4X66 J;  1FWK A;  3SQG A;  1L5U A;  1HNI A;  2ZZT A;  2XWX A;  2PE8 A;  3RBZ A;  4DWI A;  2MQL A;  1H0H B;  1VLY A;  1XJW B;  5LSR A;  5KT5 A;  2IJF A;  4MFB A;  2VPZ B;  2BBE A;  4TU8 A;  2VPY B;  2HNY A;  4GRS A;  4WTY A;  3P6Y C;  4NLX A;  3NL0 A;  3M32 A;  5AXM A;  1ICE B;  1SC4 B;  2DR9 A;  1Q8K A;  3NCQ A;  2G2Y A;  2B4P A;  1UFL A;  4NLW A;  2EC0 A;  3M2R A;  3OFG A;  4GKJ J;  4R25 A;  4HT5 A;  2GCF A;  3KG0 A;  2Z2M A;  4OYO A;  3KTQ A;  5LXY A;  4QYR A;  3OJU A;  4JI5 J;  3NNH A;  2VOD A;  1MN9 A;  3IGN A;  1YRT A;  3M30 B;  3BRE A;  1PIE A;  4P6Q A;  2Y0S D;  1RAF B;  3GPA A;  3R5B A;  1RDR A;  2ASL A;  1EET A;  2NR0 A;  2DNY A;  4B3S J;  2FJA B;  3U1M A;  1V3R A;  4DR3 F;  3KLF A;  3JSR A;  1IKW A;  2JFK A;  4DZD A;  1UVJ A;  2PO4 A;  2P6T A;  3X1L B;  5KFG A;  2I38 A;  6FD1 A;  1LW2 A;  1NB2 A;  2W9B B;  4CM0 A;  3W8P A;  1V3S A;  3EZ5 A;  3CDE A;  4WWS A;  4NA3 A;  1WAC A;  2CA9 A;  2MKH A;  2MDA A;  4O4R A;  1YBU A;  2UZA A;  2HFS A;  1FD8 A;  3HK2 A;  1YJV A;  2MY7 A;  1SJ4 P;  2HQ3 A;  1PAE X;  4JYA J;  4OZ2 A;  2O01 C;  3KG1 A;  3J80 U;  3KYL A;  5K8O A;  4H4O A;  5LSL A;  2HKE A;  4L74 A;  3IAM 9;  1K8A T;  2JX2 A;  2CPZ A;  3NBP B;  4EMD A;  4OHV A;  3DOM B;  3MR2 A;  3MD1 A;  4LSL B;  1JNZ B;  1TMM A;  5J2M A;  3DOL A;  1KC8 T;  2IJR A;  3IWL A;  2R2S A;  1Q78 A;  4CT9 A;  3TUI C;  4PWD B;  2MXY A;  4F25 A;  3O6Q A;  4DL4 A;  1PYT A;  4K8R A;  2Y1J A;  2IMW P;  5AT1 B;  5ETM A;  2Q66 A;  1RKI A;  4WU3 A;  1SQF A;  1PIL A;  1T95 A;  3SFG A;  2DR5 A;  1HMV B;  2B0G A;  2QV6 A;  4HT7 A;  5IM0 B;  1F1B B;  2ZZM A;  1IKV A;  5KG3 A;  5CXT A;  1R27 B;  2BJ3 A;  1AZS B;  4I56 A;  3EGZ A;  2G1D A;  2VDI A;  4K2X A;  1ARO P;  1FJ7 A;  3CE8 A;  1NKE A;  3ISZ A;  1PAU B;  5HI7 A;  2KJV A;  3HP6 A;  3CCW A;  3FFI B;  4ZVG A;  3TJ9 A;  3ET6 B;  1E6V A;  3J7Z 5;  2VG6 B;  4PRF A;  5KG5 A;  5F8G A;  1X4G A;  2WK4 A;  3UW1 A;  4F4K A;  1SJ3 P;  4C8Z A;  4B9L A;  1RCO B;  4A8Y A;  4LT6 A;  4DR5 J;  2KM8 C;  2MZR A;  1SJF A;  3B78 A;  4J37 A;  4ED4 A;  3TAP A;  4ZVQ B;  4F4X A;  1N32 J;  1TUW A;  2GO8 A;  4LRE A;  1Y11 A;  2O3D A;  3A3O B;  4Y65 A;  1RB0 A;  1GNK A;  3GJS B;  4LIW A;  2P8I A;  2HZV A;  4I7F A;  5CZX A;  2GAG C;  3MCS A;  4QIE A;  5LJ3 Y;  2XSJ A;  5IQ6 A;  1RT6 B;  4K4V A;  3HFK A;  2R9L A;  3QQC D;  4A8W A;  2MQM A;  4UTG A;  1SXL A;  2LLZ A;  5HMZ A;  2KI2 A;  3R5G A;  5HQM A;  2MMY A;  3MEC A;  1CUL B;  2E5I A;  1FX4 A;  4CLT A;  3BSN A;  4FXV A;  1BQM B;  4C0B A;  5DG9 A;  4L3N A;  2LEA A;  4WBF A;  1QSS A;  1A9N B;  3AB2 B;  4WJB A;  2RIL A;  1HWL A;  4CLS A;  3VZH A;  2BJ8 A;  2DGU A;  2YX7 A;  3GR0 A;  3PCO B;  2R8H A;  2XZW A;  2WRM A;  2HFV A;  2JOQ A;  3KJF B;  1P6T A;  2H65 B;  4USW A;  4ID5 B;  1S72 S;  4IG0 A;  1R8H A;  4RW8 B;  4UUW A;  4DFK A;  1WC0 A;  2VBX A;  3H42 A;  1VQ6 S;  4O3S A;  3A1Y G;  2DPJ A;  5IQQ A;  4N7T A;  4MKB A;  4EO8 A;  1DLO B;  3L3C A;  2CKW A;  4LBI A;  1VQ5 S;  2R8G A;  2OP5 A;  1TVR A;  2RML A;  4U8Y A;  4K5R A;  4IG3 B;  3K5N A;  4LQ3 A;  1WEY A;  2ZOM A;  3WDO A;  3T1Y J;  1VHF A;  2R2T A;  3BBC A;  3MHY A;  1NSQ A;  1VCT A;  2DGS A;  3PRV A;  4JI6 J;  2GMH A;  1ZS6 A;  5T41 A;  4MIW A;  3IO1 A;  1SBR A;  4KH1 B;  4M5G A;  1HLW A;  3ENA A;  3HFV A;  3FJ2 A;  3VAK A;  4ILL A;  2AX0 A;  1U49 A;  4K4U A;  3IFE A;  5D4L A;  3VAI A;  1IQT A;  4QIF A;  4QWD A;  2EXU A;  3D9B A;  1IQZ A;  4OQJ A;  3EVO A;  2GIR A;  5KG1 A;  4NLP A;  2XCP A;  3PR4 A;  3I0S B;  5I3U A;  5B09 A;  3MM9 A;  4EEY A;  3SXL A;  1RTJ A;  2FJB B;  2GIF A;  5ETN A;  5HP1 B;  4PWD A;  1UFW A;  4J9Q A;  1NDK A;  1QD1 A;  3GIL A;  2UUW A;  1KD1 T;  4KGK A;  1WHW A;  3ZTS A;  2ZD1 B;  2HW3 A;  3EXC X;  4HH0 A;  4YB1 P;  1BWV A;  4WFB Q;  2RF2 B;  3NNC A;  4EI2 A;  1VOM A;  5IM0 A;  1K0V A;  3TWZ A;  2OTL S;  3LGM A;  2WAQ D;  4UQT A;  1SJ1 A;  2W2O P;  4FF3 A;  2QLJ B;  2B9E A;  2E9R X;  1CS4 A;  3KFW X;  2FJX A;  3BGL A;  1F2G A;  3FCV A;  4DLE A;  4IFY A;  3DLL Q;  3J81 Y;  1M5H A;  2NXC A;  3R1H A;  2C2D A;  2CQ4 A;  1REG X;  2CJX B;  1PJ7 A;  3ZFV A;  3IM9 A;  1FRH A;  1HD0 A;  4OI6 A;  2VG6 A;  1Q7Y T;  2DRB A;  1O8B A;  4CH1 A;  5D78 A;  2GAH C;  3R5A A;  3RJM B;  4QWE A;  5IS2 A;  2BUN A;  3GE9 A;  4MKY A;  2ASY A;  3MCN A;  1SUQ B;  1FX2 A;  1Q81 T;  5IT9 Y;  3KJQ B;  4ES3 A;  2NYH A;  3OFF A;  4IUF A;  1DJ0 A;  3F44 A;  1JLC A;  3HKW A;  1DBD A;  5KFS A;  1NK6 A;  4G3I A;  1RU2 A;  4G65 A;  3OUY B;  3AAW B;  2RHQ B;  2AQ4 A;  4DSJ A;  2RQK A;  1CSJ A;  2MJU A;  2XC9 A;  2EEY A;  1KOH A;  2DRD A;  5IV3 A;  5KT2 A;  1CUL A;  1XK8 A;  1KTQ A;  4M5L A;  3PKM A;  2KTQ A;  3MEE B;  3POT A;  2C3P A;  3DRR A;  1JLE A;  3V6J A;  2GHW A;  2J76 E;  1K47 A;  3IRX A;  5C25 A;  3C3L A;  1SVD A;  3M05 A;  4B3T J;  4KB7 A;  2IA6 A;  2WHO A;  4LF5 F;  1PYS B;  1K73 T;  4ZS6 A;  3OPK A;  2GX8 A;  1SKU B;  4P72 A;  1EQ0 A;  3RR8 A;  2DH9 A;  5DG8 A;  1OQ6 A;  5GAD I;  2A6O A;  4IH7 A;  4DU7 A;  4Q8E A;  3F56 A;  2LXU A;  1HD1 A;  5ETQ A;  1BQN B;  1NSP A;  4PYD A;  2QYG A;  4CLL A;  1ZM9 A;  2UVW A;  3Q23 A;  4NZ7 A;  3WC0 A;  1IBL F;  2CQ3 A;  1XNR J;  5ETS A;  4BCA A;  1NLK L;  3DXB A;  5H9E J;  1SJQ A;  3LUY A;  1NPK A;  3RW7 A;  3GP9 A;  3SI8 A;  4DSL A;  2IJN A;  4BC7 A;  1N33 F;  4P7T A;  4OX6 A;  1ZM4 A;  3PX0 A;  2CPE A;  4ES2 A;  1MN7 A;  4LJM A;  2HMI B;  1NRK A;  3NS7 B;  3CCL S;  2Z56 B;  3DHW C;  5I42 A;  5KFM A;  1S6P B;  1FJE B;  4ECY A;  2HS3 A;  1R0B G;  4RNN A;  1UWB A;  2HGL A;  1KLM B;  2AJ0 A;  3LP0 B;  2CAJ A;  3Q8R B;  2CZ9 A;  4WXO A;  1F3V A;  5E33 A;  1ZA2 B;  2X1A A;  4NAS A;  4FPI A;  3DOK A;  4FKY A;  4B9S A;  5GMD A;  1K1Q A;  4P2F A;  1HQ2 A;  1CVJ A;  4C2M A;  3UDC A;  5K14 B;  1RT1 A;  2HIY A;  3ISN C;  2IRX A;  1K44 A;  3AD8 C;  5JJB A;  2CVE A;  1WKJ A;  3OTB A;  2VA2 A;  4X4V A;  4FPR A;  4BS2 A;  2RB7 A;  2DRA A;  4ZCI A;  2I1R A;  2FVP A;  2CZ4 A;  4CH7 A;  2BQ3 A;  4OX7 A;  1UJ5 A;  4ECX A;  1I51 B;  2JJ4 D;  2J9D A;  3TW0 A;  3KK1 A;  4DCP B;  1SUQ A;  3E2E A;  1G4C A;  3W64 A;  3D67 A;  5J1P A;  5JVH Q;  2DHG A;  1N88 A;  4Z7Y A;  1FO1 A;  2J9E A;  4C98 A;  2R7R A;  1VBZ A;  2R7V A;  2ZFH A;  2WSF C;  2LVW A;  2YWH A;  4H4M B;  3CCT A;  3MED A;  3HD1 A;  1C0U B;  2BW2 A;  3Q8S B;  5MAO A;  2P2C B;  5IFM A;  4RUC A;  1CJV A;  3B8H A;  4FZV A;  3H5Y A;  2FYX A;  4IR1 A;  5F8N A;  2MY8 A;  5IV4 A;  4UT4 A;  3PJX A;  3TA1 A;  2VIH A;  3BDP A;  2ZKU A;  5GAE I;  2YPY A;  1X9S A;  1XNQ F;  3MEE A;  3CD5 A;  1S1U A;  3M2V B;  3MPY A;  1FFW B;  1N52 B;  4F67 A;  4C8O A;  3X3U A;  1QE1 B;  2ZNY A;  3UQS A;  2F40 A;  3PYD A;  2XY6 A;  5HJY A;  1N0U A;  4L75 A;  1KQG B;  3GZ7 A;  4I2Q B;  2MHE A;  2EC2 A;  1AXQ A;  2XMJ A;  5ETR A;  1HNZ F;  3CJK B;  2HHH F;  2W7A A;  4R5P B;  3QRQ A;  3MAA A;  2LP4 A;  4JI7 F;  2V0N A;  4XDC A;  3FKB A;  1MMN A;  2DR8 A;  3VCD A;  2OEJ A;  2RQ4 A;  2KFN A;  4ZVT B;  4BBY A;  3QJL A;  2ZWP A;  1FJG F;  3MEG B;  2CG8 A;  3NRB A;  3GB0 A;  1SL0 A;  3CUL A;  4IOA Q;  1Q79 A;  1R3N A;  4K4W A;  1U09 A;  3U02 A;  3G71 S;  1OY6 A;  1LWX A;  4WE1 A;  3QGG A;  2UXB J;  5L1J A;  2RUG A;  2ZNZ A;  4DX6 A;  1J5E J;  3T5J A;  4AXJ A;  2MQN A;  1NK4 A;  5ITH A;  4RBV A;  5A0Y A;  2B56 A;  3CMQ A;  1S6P A;  3O3L A;  4A8X A;  5GAD U;  2AW0 A;  4XIU A;  1Y3K A;  2K1R A;  1FI4 A;  2PII A;  1T03 B;  3PW7 A;  2ERR A;  1ZPV A;  1TK0 A;  2B3T B;  2EKY A;  3CJQ A;  3DRP B;  5GMK a;  1S49 A;  1VIS A;  2WSE C;  4PAA A;  4TXS A;  2LU2 A;  4NI2 B;  1X8D A;  1P1L A;  3VTI A;  2G0C A;  2I5J A;  1N36 J;  4QPX A;  1LWE B;  2GHP A;  5LT5 A;  2CIM A;  3MMJ A;  2RRB A;  2YNG B;  4K0K F;  3CB4 A;  3K89 A;  4NLU A;  2I2Y A;  3IBC B;  4H54 A;  5EGY A;  4RBU A;  4KH0 B;  2BEF A;  4C3L A;  1UET A;  2OKQ A;  2QT7 A;  2HFO A;  3D28 A;  3RBX A;  1Y4Z B;  3EYZ A;  1FXR A;  3BKF A;  2FVQ A;  3PKY A;  4ILM A;  1Y10 A;  1S59 A;  3CCU S;  4ES1 A;  4ECW A;  1HBM B;  2JH3 A;  2R7Q A;  2KVI A;  3NXZ A;  3MTK A;  2G4B A;  2QC3 A;  1FNM A;  4IQX A;  4UST A;  5F9N A;  4G1I A;  1C0U A;  4QBU A;  2MKC A;  3TAQ A;  4F0H A;  4RO0 A;  2QJ3 A;  1NZA A;  4TU7 A;  3VGV A;  5HRO B;  1AUD A;  2OPS B;  1G3O A;  4FF2 A;  2HIQ A;  4J9P A;  1WTF A;  3PW2 A;  4IO9 Q;  3FDS A;  4RW6 B;  1GTH A;  4QWA A;  1RJJ A;  1RAE B;  2J7K A;  4DDF A;  3TUP A;  4KGM A;  4KYZ A;  3TZZ A;  1Q8I A;  1RBL A;  3D1O A;  3M2V A;  1FXL A;  2DNQ A;  2KZZ A;  2J8S A;  2HRU A;  3DDK A;  3MMA B;  2IM3 A;  4JI2 F;  2NXN A;  2R7T A;  4Q2L A;  1X4D A;  4U96 A;  4I2Q A;  1TTH B;  2BR0 A;  4KSE B;  4ZPC A;  2W24 A;  4LRB A;  4LSN A;  2WVB A;  3UNY A;  2V94 A;  2J7W A;  3IR5 B;  4ETX A;  1F5B A;  2MEW A;  2OEL A;  4LF8 F;  3VWS A;  3PJ9 A;  1L3V A;  2Q1L A;  1LWC B;  3LW5 C;  3MM5 B;  4J9N A;  2KG1 A;  1WJ9 A;  4PG4 A;  1PCA A;  2BMB A;  3OXL A;  4P75 A;  4DPW A;  1VIO A;  3H98 A;  1GXU A;  4JI3 F;  2GGP A;  4GO7 X;  4URG A;  1RWN B;  2JLE A;  5DDR C;  1RGV A;  2GQC A;  3FCW A;  1Q1K A;  2A2C A;  4RUB A;  1R43 A;  2D7S A;  2H54 B;  1FRJ A;  2H1Y A;  1ULR A;  3Q8Y A;  2FVR A;  1GXT A;  2V69 A;  4PXD A;  2R7X A;  3W3S A;  5MLC V;  4CQ1 A;  3FSX A;  2WVC A;  3BYR A;  2H4Y B;  2XLK A;  1KHW A;  3JXO A;  2C2N A;  1F9F A;  4ZIW A;  3LAK A;  1T03 A;  2J6S A;  3I6P A;  1QAJ A;  2ASJ A;  8RUC A;  3OR1 B;  4O3N A;  4JV1 A;  3AHP A;  4P52 A;  3RAM A;  3GTY X;  3D1Q A;  4P9S A;  3M8Z A;  3S7R A;  1WC3 A;  2HBZ B;  3ELH A;  4K4Y A;  4WTO B;  2R7S A;  3IG1 B;  4DQR A;  4USU A;  4RW9 B;  2F7V A;  3TVK A;  3K17 A;  3MUV P;  3HCX A;  1X4C A;  2HRY A;  1SV5 A;  1S1X B;  5HVF A;  2XO6 A;  5IZH A;  2PFF B;  1VS3 A;  5I4M A;  1CQM A;  1ROF A;  5EHH A;  2RS2 A;  5ETK A;  3BPD A;  3CSK A;  4PQU B;  3LP2 A;  2RKI A;  3KLE B;  2E1M C;  2VFU A;  3M6X A;  4LR9 A;  1QTN B;  3DRY A;  2AYM A;  4LF2 A;  1PBA A;  3FMB A;  2AEF A;  2UUT A;  1EB0 A;  4CO5 A;  4XK8 C;  5JVG Q;  1HBM A;  2HVH A;  1NCL A;  3K57 A;  4WZM A;  2MKY A;  5DGA A;  4CT8 A;  2VUG A;  2UUA J;  3M8Q B;  3CMA S;  2FHJ A;  4LFB J;  4ZPV R;  2M8D B;  3WIU A;  4OYX A;  3F73 A;  2ALZ A;  3T1H F;  3VGU A;  3FZ2 A;  4WKR A;  4DQP A;  4YY3 F;  1S5Z A;  5THW A;  3QRP A;  5CYM A;  2CQ2 A;  1WSR A;  2AGP A;  1IJF B;  2C42 A;  3RRG A;  3TR5 A;  4RW6 A;  3NAH A;  5KFN A;  1QSL A;  1U0H A;  1N8R T;  4J9O A;  3M9M B;  4DL0 C;  2W1B A;  2DIV A;  3GFX A;  1MRO B;  3V6D B;  3R5D A;  1RTH B;  3UVJ A;  2XB2 D;  4PCQ A;  3N5B A;  4B02 A;  2N3O A;  3MMA A;  2GO9 A;  2NXE A;  2V67 A;  5E5N A;  3BKU A;  3CCE S;  1M5S A;  3HVR A;  4DV0 F;  3C15 B;  1T9W A;  5CD4 A;  2JEI A;  4KO0 B;  3FEX B;  2D3O R;  4OV1 A;  3IR7 B;  2J5A A;  4B9V A;  2VOO A;  2BAN A;  2R7U A;  2I6W A;  2QFJ A;  2V5H G;  1YDL A;  2ABY A;  2DXF A;  2HFN A;  3NKY A;  1CJT A;  5ETL A;  1R7I A;  2WVD A;  2YTC A;  1FDD A;  1YGY A;  3RUB L;  4OIX A;  1N4L A;  2XCA A;  2PEB A;  4F3M A;  4HDG A;  2YKO A;  4DV2 J;  1DQA A;  1N6Q A;  4I6A A;  3KDO A;  2ZZN A;  4F4Z A;  3V4M A;  2YBV A;  2QLW A;  4V1A k;  2Z58 B;  2ZOF A;  3TAM B;  1YJW S;  2GHV C;  4MH8 A;  1S97 A;  4EZ6 A;  4G1Q B;  2APO A;  2MTL A;  3R9L A;  2CPI A;  1D0E A;  3E51 A;  1RWP B;  2UXD J;  1X9W A;  2AGQ A;  2UUC J;  1Y0H A;  1U1K A;  2EK6 A;  4OI3 A;  1FT8 A;  4DG1 B;  2MZ1 A;  4LRA A;  4FYW B;  1WF0 A;  2AIR B;  5BYS A;  1LXJ A;  1M1K T;  2JC1 A;  3BBF A;  3P45 B;  2WSC C;  9RUB A;  1AA1 B;  2HHQ A;  2XGQ A;  1OY9 A;  1U1O A;  1T9V A;  2WCX A;  3K8W A;  4ZJQ A;  3RBD A;  2AD9 A;  2XY7 A;  3C2P A;  4KV8 B;  2FLO A;  4LRD A;  5KFO A;  1B64 A;  1TEL A;  3IG1 A;  2JVR A;  1C2P A;  3ZTQ A;  2FJE B;  2MLY A;  3OHB A;  4X2B A;  1D8Y A;  2GA7 A;  1DAX A;  2N7Y A;  2UXB F;  3N5F A;  2GVZ B;  1TL1 B;  2WW8 A;  4ZVS B;  2DNG A;  3VQS A;  2W01 A;  5AE3 A;  2ZHB A;  1HPZ B;  4LFA J;  1MLA A;  5LL6 d;  3RAQ A;  5A8W B;  3GG1 A;  5G4D A;  1RTI B;  1NK9 A;  2L9N A;  3W5Y A;  4XDD A;  3OTO J;  4J9S A;  4YS2 A;  1I94 J;  1HNX J;  3DMJ B;  1H98 A;  4OHW A;  1FKO B;  3N9U C;  4DR2 J;  5J2N B;  3H2V E;  1HFE L;  3PEH A;  4KJI A;  2XMK A;  3PR5 B;  2LCW A;  1NM2 A;  3UDL A;  2KT2 A;  1WC6 A;  1U7L A;  3DLB A;  2AV5 A;  1HAR A;  1VJW A;  4OX9 J;  1DUR A;  1N36 F;  1NU4 A;  5KG2 A;  1Y9O A;  3D7S B;  2I0X A;  4DN9 A;  3JS9 A;  3GLJ A;  2KRR A;  3TP2 A;  2BJD A;  4ICL B;  2XS2 A;  2FB0 A;  3GV7 B;  4F2S A;  1X0P A;  4Q0B A;  1NK0 A;  2YKM B;  4DUZ F;  1JLQ B;  2ILY A;  5AE2 A;  5L8R C;  3O1L A;  2WVE A;  3PFE A;  5KT3 A;  3KLI A;  4UOC A;  3UCG A;  4QU6 A;  2BAC A;  4QW9 A;  2VL1 A;  3C15 A;  1IM4 A;  4MK7 A;  7FD1 A;  4N77 A;  1S1W B;  3THV A;  2DIU A;  5CYQ B;  2DD8 S;  2B9W A;  1P1T A;  3IA0 A;  5D4N A;  1H74 A;  1S4F A;  4CWB A;  3CF5 Q;  4DL7 A;  4KBI A;  2J6T A;  3JSY A;  4QPT A;  1FVS A;  1T8E A;  1UPP A;  1G1X A;  4F7V A;  5L46 A;  4WIQ A;  4Y28 C;  3KK2 B;  1CJK A;  3MCM A;  3BDE A;  1ZAW A;  3LPY A;  2GMJ A;  1RTD A;  5A2Q Y;  5KTQ A;  3HSG A;  2FHK A;  2YWG A;  1JK9 B;  3WX8 A;  4NYO A;  2RRA A;  4ECT A;  4DR1 F;  4DUY F;  3KLH B;  2Z8Q A;  2R7W A;  2W9C B;  3BYP A;  3EGW B;  4CO1 A;  5F9L A;  1SC3 B;  2EPI A;  2DHH A;  1C1C B;  2BRL A;  4PG5 A;  3FCH A;  3QT6 A;  3GFY A;  1J27 A;  3OD2 A;  4OZ5 A;  4FXW A;  1BY9 A;  1KBR A;  3IR6 B;  3KK3 B;  3PFO A;  2E7V A;  4ZLL A;  2X7I A;  2YX1 A;  2OPR B;  3MPV A;  4B3R J;  3TOQ A;  4NZ6 A;  3JAM U;  1N48 A;  1UJ6 A;  2ZH1 A;  3AJD A;  1R0A B;  2E5L F;  1VQY A;  4IFV B;  4N76 A;  1CC7 A;  1WKK A;  1TL1 A;  4E2F B;  2MPU A;  4O0N A;  3G8Q A;  1U6Z A;  1HR0 F;  2VZ9 A;  3CJ3 A;  4QR1 A;  1RUS A;  3CO9 A;  3ZZU A;  2ZM6 F;  1S1V A;  3K5L A;  3N01 A;  2IVY A;  1WF1 A;  4X4T A;  5A8R B;  4BDP A;  4JI4 F;  2LQ8 A;  2ZE2 B;  4C8M A;  2R4F A;  1IBK F;  1PKU A;  2HLU A;  1U1L A;  4KTQ A;  2FJD B;  3DU5 A;  7AT1 B;  1FA0 A;  2XMU A;  3D4J A;  5RUB A;  3ZTP A;  2UUB J;  2JRS A;  3GCX P;  3BGU A;  4JV0 A;  1JNR B;  4LF9 J;  2DEJ A;  4LFC F;  3DN9 A;  1J5O A;  4M5K A;  2VHG A;  2Y1R I;  5FLX U;  3VAM A;  1LEO A;  2QLX A;  2B5J B;  3W63 A;  3UD5 A;  4UOG A;  1RHU B;  5HAN A;  4ICL A;  2ZHO A;  2ZJP Q;  3D68 A;  3SIP B;  5SUH A;  3J7Y U;  2XLJ A;  2KKH A;  2K06 A;  3RRH A;  4ATN A;  4ED5 A;  3MM6 B;  4Q5V A;  1RT3 B;  1YX2 A;  4DQS A;  1RBO B;  4WFX A;  2R8I A;  5DM6 Q;  3P5B P;  1TU0 B;  1IUJ A;  1HWJ A;  4O3R A;  2NXU A;  2ZBI A;  2Z4P A;  3UFC X;  3LAN A;  3MM8 B;  4ZVP B;  1YJN S;  2AWZ A;  1KN6 A;  4X65 F;  4C48 A;  1QAY A;  3QAU A;  1A7G E;  4GVB B;  2C2E A;  5H9E K;  1Q5Y A;  4DV5 J;  2HFZ A;  1T3O A;  4C8K A;  1LFW A;  3NS6 A;  3CDB A;  1HNV A;  1QVG R;  2IDE A;  1JLG B;  4EUV A;  5KFB A;  4I67 A;  1TAU A;  4CLK A;  1S9G A;  3R2D J;  4YB7 A;  2VAS A;  1FE4 A;  5HBM B;  4AYB D;  1U1P A;  5HLF B;  1UJ4 A;  2IDL A;  3QAT A;  3W62 A;  3DXS X;  3ZZ0 A;  1OPZ A;  3HUL A;  2VON A;  4HAC B;  2K2P A;  3BH6 B;  2BRK A;  4X4S A;  3KK2 A;  2IFX A;  1B0V A;  2OSQ A;  1RLD A;  1OY8 A;  1IWA A;  5HN0 A;  3TJA A;  2L41 A;  4OLP A;  2KG0 A;  3TRG A;  1T9X A;  1MW7 A;  1R31 A;  1S9F A;  3R2C J;  3KLG A;  1V9O A;  1WNE A;  2W9C A;  2OFG X;  4ECV A;  1FDN A;  4C8Y A;  2HQI A;  2GNK A;  1KNZ A;  1R0C B;  2PA3 A;  1C1C A;  1R89 A;  5IWA F;  1Y5N B;  3HDS A;  3MPD A;  1GMU A;  3N0V A;  5C7P A;  4L6V 3;  3G82 B;  5DQG A;  4EGL A;  1N56 A;  3D1H A;  1FTC A;  2H5E A;  3E3X A;  3UNG C;  3R6G B;  3CC2 S;  1U1R A;  3HZG A;  3Q8Q B;  4P73 A;  2GQ2 A;  4DR6 F;  3FVY A;  4B9T A;  2DKO B;  4PKD B;  1TR0 A;  2VFV A;  3OL9 A;  4W92 B;  4Y2M A;  2F3J A;  4LVO P;  4FP9 A;  4K50 A;  4OYP A;  1HL6 A;  4DFJ A;  3IBF B;  1REV A;  3DLE B;  2C2M B;  2PT0 A;  1HNW F;  2KXF A;  1X31 C;  2BE2 A;  3TZX A;  2F5G A;  3G9C A;  2F4V F;  1GMV A;  5KFH A;  3TVZ A;  4G1P A;  1WOO A;  3NMA A;  5A8R A;  1AYE A;  4YDD B;  2ZE2 A;  4CNY A;  3GFH A;  2M7S A;  1H3D A;  2K7K A;  1KLN A;  1RP5 A;  2KHC A;  4MMO A;  3LAL A;  3C6T A;  4H4K C;  3P49 B;  1RT4 B;  3C46 A;  4HVZ A;  2GVD B;  4DR3 J;  4OI2 A;  3JYT B;  2HYI B;  4P7V A;  1DZ5 A;  1S6Q A;  3FQK A;  1HQU B;  3NGT A;  1WI6 A;  2V2K A;  2WW4 A;  4RW7 B;  4O3O A;  2DGX A;  5DDO C;  1RWU A;  4ZIV A;  2V2Z A;  2HVE A;  2CVI A;  1IBM F;  3SQO P;  1MNE A;  4LF4 J;  2HS4 A;  2UXC F;  2XTJ P;  5LOQ A;  2QYC A;  3CT9 A;  1ZM3 A;  1VRT B;  2VQF F;  3P4U B;  3OTO F;  3PY8 A;  2DNH A;  1VQ8 S;  1FRX A;  2Z30 B;  2P9G A;  3M8P B;  2BX6 A;  2VC1 A;  3C14 B;  3FC9 A;  1FFG B;  3P8B B;  4C7Q A;  4U7U D;  1YWX A;  5BYR A;  3W60 A;  1M5P C;  3SZ2 A;  4NL5 A;  2FGO A;  5T7L B;  2WVF A;  3JB9 k;  1NKB A;  3JQJ A;  4D3H A;  3BN7 A;  4PWW A;  2JDJ A;  1N34 F;  2M9K A;  2DH7 A;  3ZO7 A;  2C3U A;  1JLG A;  3VAH A;  3W66 A;  4XO0 A;  1IN0 A;  3Q8P B;  4HKQ A;  2RVJ A;  5HBM A;  1RQ0 A;  4RBT A;  3SV3 A;  3MAQ A;  5HMX A;  2C22 A;  4QOT A;  1VRU B;  3PHE A;  3KUG A;  1U1N A;  4KPC A;  3H5S A;  2MQQ A;  3I87 A;  3CJ8 A;  2YNI A;  4M5D A;  5BR8 F;  2ZHA A;  3CJ0 A;  3CC4 S;  3T9N A;  4UW2 A;  2LEP A;  4K4S A;  2W4D A;  1SKW A;  2EFV A;  3MZI A;  4JI1 F;  3BZQ A;  2JC0 A;  3BO2 A;  3H59 A;  4M5N A;  3IRW P;  1NKC A;  2XEX A;  5F8M A;  3KNG A;  2ZH4 A;  1VR6 A;  1WDT A;  5KFC A;  3GYX B;  3K0J A;  2YY3 A;  2HWI A;  3CGI A;  4GO5 X;  1NND A;  3SMZ A;  4KQZ A;  1ZTT A;  4Q45 A;  3ZZP A;  3G82 A;  2H48 B;  2YVS A;  1HQE B;  2V4J B;  3QJJ A;  3JSM B;  2VH7 A;  3IWX A;  3C66 A;  4DSI A;  3S01 A;  4WZQ A;  1NSA A;  1W26 A;  3MDF A;  1TKX A;  4NLR A;  5KFZ A;  4C8L A;  5C42 A;  2MHN A;  1DRZ A;  2KZM A;  1YIT S;  2DH8 A;  2NS1 B;  2AYE A;  4KT0 C;  4PG7 A;  2YXL A;  2NCK L;  2QL9 B;  3ULH A;  2PGC A;  2JZ5 A;  3QFW A;  3SQG B;  4JOU A;  3VV2 B;  1HNI B;  5D0E A;  3OHA A;  2UVR A;  3HJF A;  2RQC A;  2HUR A;  1RHM B;  2PMW A;  4MFB B;  2CPD A;  1T9T A;  4DF4 A;  2ZC3 A;  2N4C A;  1YIJ S;  3QT5 A;  1WF2 A;  1WG4 A;  2HNY B;  3VVT A;  2XMV A;  5KT7 A;  2Y9H A;  4F0K A;  3US5 A;  4QR0 A;  1RT4 A;  3M32 B;  3TNV A;  3KWM A;  3HM9 A;  3QGP A;  2IM0 A;  2PMH A;  3MMB A;  2PN6 A;  5DZ7 A;  1U1Q A;  1FTR A;  2KU7 A;  3HHL A;  1N5Y B;  3QJP A;  4CLZ A;  4EBC A;  4RPF A;  3M2R B;  3AJ1 A;  2D1C A;  4QW8 A;  2P9E A;  1HIY A;  3RTV A;  4B9N A;  2G0J A;  1TKZ A;  1IBC B;  4IH5 A;  1JWW A;  2BVZ A;  3S1T A;  1CJU A;  4OYW A;  5KFQ A;  3OVB A;  3C14 A;  1PJ5 A;  3LAM A;  2FJV A;  4ED1 A;  3V81 B;  1EET B;  2OIH A;  3DGP A;  1S99 A;  2UUB F;  2Y1L B;  2XI3 A;  4LBH A;  4P2M A;  1KON A;  3OL8 A;  3ZTR A;  3OTD A;  1VK3 A;  1FHT A;  1IKW B;  3PJW A;  2BJE A;  3T9Z A;  2GIQ A;  2LQ5 A;  2LQ9 A;  2HPU A;  3G4S S;  4IDK A;  1RIS A;  3W1Y C;  3UCZ P;  1LW2 B;  1D9D A;  2ZH9 A;  1MMD A;  1CC8 A;  3CIM A;  1U2R A;  2NYI A;  3EVM A;  1IR0 A;  4RR5 A;  4OHY A;  5E41 A;  1AFI A;  4A46 A;  3PHT A;  1VRU A;  2YH0 A;  3KMQ A;  4UZC A;  4YR3 A;  4JB8 B;  2GJF A;  5CCL A;  4QIW D;  3PXG a;  3QMQ A;  2E66 A;  4RNH A;  2IBK A;  2KT3 A;  3SCJ E;  1NB7 A;  1PC5 A;  1Y00 A;  4CTA A;  1JLA A;  3OTE A;  3JQK A;  3QZ7 A;  2G9O A;  1U25 A;  2BV3 A;  4WP9 A;  4IOC Q;  4I6W A;  5G0R B;  5J2M B;  3DOL B;  2NPF A;  4WFY A;  4ED2 A;  3MWB A;  4DV5 F;  2QA4 G;  3NCR A;  3DI6 B;  4NLT A;  1W2B R;  1H7X A;  3BV8 A;  2HQC A;  2ZC4 A;  3C8Y A;  3QT7 A;  3BH7 B;  2V4J A;  3OVA A;  2VFT A;  4PG8 A;  2UP1 A;  2HVI A;  3MM7 A;  3GWC A;  1KTV A;  5M2U A;  1LWF B;  4C0O C;  5HO4 A;  1HI1 A;  1CLF A;  4I1T A;  4ZPT R;  3DM2 A;  4C6A A;  1VRQ C;  2FZG B;  2ROP A;  3CW2 C;  4QIV A;  1BE4 A;  1IKV B;  4MJK A;  1H6K X;  1C1B A;  5H9F J;  3MR7 A;  2GS8 A;  4OYM A;  2LMI A;  1FRL A;  4A8Q A;  2W9A A;  4AT1 B;  2LFV A;  5KFK A;  1UZH A;  1EP4 A;  2YKP A;  3EZU A;  1S7I A;  2AZ1 A;  2AEM A;  1RWX B;  4P2S A;  3UO0 A;  1E6V B;  1LOU A;  3HKZ D;  2PA8 D;  1VQP S;  2X51 A;  1R6Y A;  1NME B;  2G1H A;  3PYF A;  3DRX A;  2XY5 A;  1O5J A;  4LF5 J;  4OI1 A;  4KE5 A;  3C6U A;  3RRK A;  4TN2 A;  2AX1 A;  4ZP8 A;  3QRR A;  2ZJQ Q;  1JJ4 A;  5C5J A;  1N5Y A;  4CDI A;  2QLF B;  4I7F B;  4MKV A;  1AFJ A;  1QSY A;  5KFL A;  1WKL A;  2XSJ B;  3RR7 A;  2YKA A;  3SFU A;  3D0H E;  3M6V A;  2U2F A;  2LEC A;  2LXI A;  1KVI A;  2XLI A;  1IR2 A;  2VC0 A;  1SH3 A;  4IKA A;  4NZ0 A;  4RUA A;  2FDN A;  2P9C A;  3MEC B;  4HHJ A;  1IBL J;  4ED8 A;  4M5M A;  4O4G B;  1U26 A;  3BSA A;  1NBE B;  1SCJ B;  1EQM A;  4FDF A;  2E1R A;  2F8H A;  1GFW B;  2K7J A;  4X4R A;  4CM2 A;  1Q86 T;  4TNO A;  3EUN A;  1DTQ A;  4PG6 A;  2FY8 A;  3AOA A;  1N33 J;  3V81 A;  3NNA A;  3BSO A;  4TVA B;  1ZAX A;  1D09 B;  2CG4 A;  4I2P A;  2VA3 A;  1NDP A;  2PSZ A;  2IPO B;  4IG0 B;  4URS A;  4DV1 F;  1RT2 B;  1UA1 A;  3M1V B;  2QL7 B;  5DZ6 A;  1M1H A;  1S1T B;  4DU8 A;  2J7U A;  4LF4 F;  4JI0 F;  1TVR B;  4KHP F;  5EWE A;  4IYQ A;  3CJ5 A;  3DYA B;  3ZTO A;  1U2C A;  3HHE A;  2ZH3 A;  1WEL A;  4NLQ A;  4OZJ A;  4ILR A;  4ITS A;  1EJ7 L;  3ONQ A;  5DLG A;  1JX4 A;  5DLF A;  1FD2 A;  5F3Z A;  5G0R A;  4AQY F;  4ZLJ A;  2CPY A;  1BD6 A;  3M2U A;  3TZY A;  2DGV A;  1YRU A;  3MUT P;  5I3U B;  3DI6 A;  3MM9 B;  2HK3 A;  2OUG A;  1RTJ B;  3TEG A;  2XO7 A;  1FDA A;  1KFS A;  1Q8L A;  2DNR A;  3MR3 A;  1ZTW A;  3PAC A;  2VDH A;  2C3Y A;  1OS5 A;  2M52 A;  5ETP A;  4K2J A;  4I4B A;  5B0F A;  4R0E A;  4I68 A;  1LWF A;  5B0C A;  1HW9 A;  1S79 A;  1PG5 B;  2R2R A;  2XHC A;  1HBU A;  4CO0 A;  1F5C A;  3GSI A;  1Q8B A;  2XQC A;  1L3K A;  1S77 D;  4Y2A A;  3M8S A;  5IT4 A;  1CS4 B;  3HSJ A;  4RNM A;  4M63 A;  4DV4 F;  4IFY B;  4ZCL A;  3M9O B;  5EUH A;  4FVC A;  3L4B C;  1U0S A;  1VGY A;  2ZOG A;  4ZMM A;  1XNQ J;  2RH3 A;  2KFZ A;  1N5V A;  3SYZ A;  4CLU A;  3R97 A;  2MQP A;  2HSE B;  1BQX A;  1UKU A;  2YNH B;  1WG1 A;  2MKI A;  3EIC A;  4S0M A;  3QSY B;  4DR4 F;  1FKP B;  2R8K A;  3EPG A;  2MLZ A;  4U7C A;  1V6H A;  2EFP A;  1RBA A;  3EPI A;  4R8U B;  1JLC B;  4JI8 F;  3Q22 A;  1HNZ J;  2XM3 A;  1U8W A;  2HHH J;  1HYS B;  1X7V A;  2XSF A;  2QEX S;  2K8G A;  3CO0 P;  4J90 A;  4AL6 A;  4JI7 J;  1LW0 A;  3UN5 A;  3DLK A;  4ZHR A;  4C11 A;  5J2Q A;  1S9E A;  5AXL A;  2Q3P A;  3CED A;  1OO0 B;  3NAI A;  1NH7 A;  2HNZ A;  1FJG J;  3CC7 S;  4O4G A;  1EKS A;  1RWW B;  4EK2 A;  4WKY A;  4GVL A;  3POT B;  2LXF A;  3DRR B;  1JLE B;  2B6A A;  2OFH X;  2FLN A;  1XEZ A;  3IRX B;  5C25 B;  1U48 A;  4DL6 A;  1H7W A;  2RJZ A;  2AT1 B;  1WI8 A;  2X3G A;  4QZV B;  1YTY A;  5KG6 A;  2V34 A;  3HF5 A;  1YSJ A;  1RT5 A;  3ILI A;  4NX9 A;  5J1E A;  3KUH A;  2Y8W A;  4QU7 A;  1RT2 A;  2HND A;  3M1V A;  1NHK L;  2MZQ A;  1RT7 B;  4ZVO B;  3GR1 A;  1W7W A;  1TKT A;  1S1T A;  1AW0 A;  3MFI A;  3K2Y A;  3AJ2 A;  1SI9 A;  4OI4 A;  2CQD A;  4KHR A;  1KQS R;  1H72 C;  4CNZ A;  3DYA A;  3DHX A;  1DQ9 A;  2NZ4 A;  3S6E A;  3IGV A;  2QN6 B;  2FZC B;  5J1N A;  2V8D A;  1IVZ A;  1SIW B;  4FKX A;  1NDC A;  4K0K J;  3BGF A;  3H8Y A;  3AH6 A;  3IBW A;  5HL7 Q;  4TLR A;  1WWH A;  5D77 A;  4F8R A;  4X4P A;  3ZNU A;  2DO0 A;  3IP0 A;  1PJ6 A;  5LMN F;  2VQE F;  4HHU A;  3TVY A;  3BM7 A;  1NPR A;  2MKS A;  3Q8V A;  2YQ0 A;  5I42 B;  4GMK A;  1KHV A;  2R8J A;  1JMT A;  2OD4 A;  5DQH A;  3PG9 A;  1XMQ F;  1AB8 A;  3IXQ A;  4OZ0 A;  2IAJ B;  2OAU A;  1UWB B;  2VG7 A;  2ZH7 A;  2QMX A;  2KVQ E;  2ROE A;  2HQG A;  3W61 A;  3CD0 A;  3GFZ A;  2DGQ A;  5DM7 Q;  1SL2 A;  3FEZ A;  3DOK B;  1JXE A;  3PX4 A;  3JQM A;  5C24 A;  4EYI B;  2B8P A;  2KYX A;  4NWB A;  1RT1 B;  3AOD A;  1JIH A;  1NJI T;  3KHR A;  2KT5 A;  3CCJ S;  2E7W A;  3K5O A;  2IHR 1;  4NYZ A;  1IKY A;  1TL7 A;  3O44 A;  2K3I A;  1SJR A;  4HI2 A;  2UV8 A;  1Z1Z A;  2CJB A;  2VBZ A;  1VBK A;  5KOW A;  3KK1 B;  1QY7 A;  5EN1 A;  2YNH A;  2MGZ A;  4JI2 J;  2JHE A;  4X4Q A;  1Z4U A;  4WU2 A;  3CXC R;  1FKP A;  1GX5 A;  1F3F A;  5M2P A;  1X60 A;  3KLV A;  3HHK A;  2N82 B;  4UOH A;  4HL9 A;  5DDP C;  4R8U A;  2YWF A;  2AYB A;  2HHT A;  4USJ C;  3MED B;  5D4O A;  2CPX A;  4O44 B;  4KAI A;  3SEO A;  1HYS A;  3UR3 C;  3TAN A;  2ZKT A;  4DL3 A;  4RU9 A;  2HZA A;  1FNO A;  3ZZY A;  4LF8 J;  1CJV B;  4M1K A;  2GJ2 A;  4YHH F;  3GQC A;  3GIM A;  3DC2 A;  4NLG A;  1FRM A;  1FE0 A;  4RLE A;  2OTJ S;  2CDQ A;  3A13 A;  4OJH A;  4OJ3 A;  4NLD A;  3H20 A;  4OYZ A;  4B3O B;  3LPE A;  4EWT A;  1FCA A;  1F2H A;  4JI3 J;  3I5B A;  4Q2M A;  1E6Y B;  1S1U B;  1RHK B;  1WEX A;  2EBE A;  5KG4 A;  4QJV A;  3R3T A;  2FD2 A;  2ILZ A;  1HI8 A;  3GON A;  3AOB A;  3HVT A;  2M5Y A;  4MK8 A;  4NRT A;  1D9F A;  4F3Q A;  4ECS A;  3CCV S;  1H2U X;  4Y2K A;  2H5J B;  1QTM A;  2FY1 A;  2NXJ A;  2CJQ A;  4NXM F;  4O0I A;  2HBY B;  4C9D A;  2B9X A;  1RT7 A;  3MAA B;  2AJQ A;  1U45 A;  1KEK A;  3V4I B;  3G86 A;  1GXL A;  4UZB A;  2E7X A;  2E29 A;  4K4Z A;  1YZ7 A;  4WII A;  3Q24 A;  5KOX A;  4QIG A;  3P5T L;  1IKX B;  1ZAV A;  2RU3 A;  3JSB A;  4N8O A;  1NXI A;  3CJT A;  5KG7 A;  2J9C A;  1N54 B;  2XHW A;  4B08 A;  1VC5 A;  4FYD A;  4R0J A;  3K59 A;  1VBX A;  4WE1 B;  1YJU A;  2HGN A;  3GIR A;  3EVW A;  2CJY B;  3MFH A;  4RKU C;  4OV6 A;  1TL3 A;  2R2U A;  1VMB A;  2PD1 A;  2DGW A;  3GV8 B;  4WK3 A;  5A0Y B;  1X5P A;  1M5O C;  5EWF A;  1GH8 A;  1WHX A;  5E3R A;  3PW0 A;  1YVF A;  1XR6 A;  2K1R B;  3PRD A;  3GYG A;  2IVM A;  2Z2Y B;  4CRJ A;  1B7Y B;  2IAJ A;  5J2P A;  3KXD A;  5FJ4 A;  2E1C A;  3DLG B;  5T14 A;  1P27 B;  3T5L A;  2CRL A;  4YFU A;  4LBP A;  4K59 A;  2B4V A;  2BM0 A;  1DY3 A;  4FNH A;  1RU1 A;  1T11 A;  2C3M A;  5KFI A;  2I5J B;  3BKT A;  2YPZ A;  3T1H J;  4C3M A;  3ZZR A;  3QLH A;  3OXG A;  4YY3 J;  4LR8 A;  1AUS L;  4LF1 A;  1TV6 A;  2XBP A;  3N6L A;  3IM8 A;  4P2X A;  1NJZ A;  2F9J A;  3WBZ A;  1C0T B;  3U1N A;  3OL7 A;  2KO1 A;  1F9H A;  1MWY A;  1T9Y A;  3EM1 A;  4CYU A;  3I32 A;  1WOR A;  3NCP A;  2BE9 B;  5KFJ A;  4F2R A;  1BGX T;  3H5X A;  2YKQ A;  1NAQ A;  3J80 Y;  3JTN A;  3SV4 A;  1NJX A;  1FEE A;  2LQJ A;  2AGO A;  2RU9 A;  3BGO P;  4DQQ A;  1S6O A;  4DV0 J;  1NH8 A;  4TY9 A;  3TA2 A;  1SKR A;  4HR2 A;  5SZT A;  3D3B J;  4O44 A;  5E3P A;  3CVK A;  2MST A;  3AXM A;  1UW9 A;  2O66 A;  4OYI A;  1H2T Z;  3MMC A;  2Q6C A;  3CIZ A;  3A8I A;  3OFE A;  1V5V A;  4YR0 A;  3SCK E;  4OZ1 A;  4K5S A;  4U67 Q;  2CJK A;  2BYC A;  3PW4 A;  3BF4 A;  5DDQ C;  2J6U A;  4B3O A;  4ZPW R;  1E6Y A;  1JLF A;  2E1P A;  4FYX B;  2IVF B;  2AP6 A;  1VFJ A;  1UVK A;  1U6B A;  2HQF A;  2G13 A;  3ISN D;  1SC1 B;  2MZT A;  1D8Z A;  2FHO B;  4PUO A;  3BGR B;  4OMF G;  1UL3 A;  1RYS A;  3M8R A;  3R7S B;  1HHQ A;  1NJY A;  3T6J A;  1PO6 A;  4LSN B;  1LV5 A;  1SH0 A;  4E0D A;  3LWM A;  4Y34 A;  1FXD A;  2J9D E;  3J81 U;  1BWE A;  4YOE A;  2JVO A;  1Q7L B;  2UVU A;  4J5O A;  2EI5 A;  2QL5 B;  4MAK A;  4USH A;  1CBK A;  4O3Q A;  4WFZ A;  4KFB B;  4TY8 B;  2CNO B;  5KG0 A;  5C2G A;  2D9O A;  4A8O A;  3V4I A;  3NGS A;  4ZN3 A;  4KPY A;  1X4F A;  2C3O A;  2L48 A;  3FBF A;  3O8W A;  1NO8 A;  1U8S A;  4DS4 A;  3OSP A;  2DGT A;  1HBO A;  1IKX A;  2GGP B;  5HMW A;  3HT3 A;  3QWP A;  4OHZ A;  3CWJ A;  3KKF A;  4DLG A;  5DS7 A;  1ZA1 B;  4DPO A;  2BXJ A;  3A4T A;  4W90 B;  1RE1 B;  3KJV A;  3DDI A;  2X1F A;  4CZC A;  4HYK A;  5HQL A;  5L9N A;  1IJE B;  2MZJ A;  3MEK A;  1RA7 A;  3CDW A;  3NWG A;  3ITH B;  5K9F A;  1TL5 A;  1VQ7 S;  1RWM B;  4NEY A;  3DRS B;  2QLB B;  5EX3 A;  2P6S A;  4IH6 A;  3OSN A;  3EMT A;  4ZK7 M;  3VHQ A;  1VLO A;  4QCL A;  1U1M A;  4OZ3 A;  1YZ6 A;  1S0O A;  3MPU B;  3DLG A;  3LTO A;  2DXD A;  2NSB A;  2DHX A;  4NXN F;  2JFD A;  4YDX A;  2PEH A;  1UVM A;  3VAF A;  3D3C J;  3E01 A;  3DGV A;  5KFE A;  1R8C A;  1V5I B;  1WEZ A;  2RUS A;  3DLJ A;  3EX7 B;  2DBB A;  2HG4 A;  5B0D A;  1RKJ A;  2EG1 A;  1SV5 B;  4CO4 A;  4X4N A;  4YUD A;  1HI0 P;  1LKZ A;  1Q5V A;  3PTW A;  1C0T A;  4Z37 A;  3SSS A;  2A0F B;  4N8N A;  4QWB A;  4EBD A;  4ID8 A;  3H2L A;  1M90 T;  3RAX A;  3LP2 B;  2RKI B;  3M8W A;  4DUZ J;  3R6L B;  4ED3 A;  4USK A;  1WOP A;  5K8M A;  2AHO B;  1FFS B;  4DX5 A;  4GKK F;  3MPW A;  1Q95 G;  3HI9 A;  3R1L A;  1NHV A;  4ED0 A;  1Q16 B;  1QAI A;  4WXW A;  1GT8 A;  3OJS A;  1G2E A;  3NOC A;  4M5H A;  3JTO A;  4PQA A;  3W8G A;  2DCL A;  2LKZ A;  4RZR A;  4WP8 A;  1MWQ A;  3KHG A;  3Q2T C;  1JJC B;  2CQH A;  3NY0 A;  4DPU A;  2ZUG A;  2OO4 A;  4NPO A;  5CYM B;  3WIV A;  3BN4 A;  5LJ5 Y;  2MZS A;  2V9W A;  1U0H B;  1EAY C;  1FVQ A;  3G8T A;  3R5J B;  3PIO Q;  4O3P A;  5HSP A;  4CI0 B;  3BQ0 A;  2RD5 C;  3KUE A;  3UVJ B;  3AA8 A;  5AJ3 F;  1ZM2 A;  4DSF A;  1LXN A;  1Q82 T;  3BGR A;  4DV3 F;  1XMB A;  5LMU F;  4NRU A;  4ANE A;  4DR1 J;  2HHW A;  4DUY J;  4J9L A;  4DSK A;  3ILO A;  2W8K A;  2CQC A;  5BXI A;  2UU9 F;  3QSI A;  3Q89 A;  5KFU A;  1YLX A;  3RBE A;  1XWL A;  1NSK L;  1I6J A;  2HVZ A;  1PSD A;  2BAN B;  4I69 A;  1Y3J A;  1URR A;  1VQS A;  2WON A;  1T0T V;  1QUP A;  4LVN P;  1JLB A;  2L3M A;  1JJH A;  4Y6I A;  4LF7 F;  2N3L A;  1CJT B;  1JKH A;  4RL1 A;  5F8I A;  4KFB A;  4TY8 A;  3T5H A;  2KH9 A;  3MAH A;  2Q6B A;  3FZB A;  5FDL A;  4JV2 A;  1OQ3 A;  5KFV A;  4DPT A;  4DR7 F;  4TKT A;  1WTB A;  4ZPD A;  5IC4 B;  3UR0 A;  4FXD A;  4FYY B;  1N6Q B;  2E5H A;  3AT1 B;  5DG7 A;  5GAE U;  3WZ0 A;  4YEA A;  3NGK A;  1D3W A;  3LGH A;  1F5A A;  2E5L J;  1FWP A;  2OPQ A;  3OR2 A;  2CPF A;  3BEG B;  3PDN A;  2VF3 A;  2FLP A;  4DOZ A;  1YJT A;  2QSW A;  4Z7C A;  4HDH A;  5F8H A;  1HR0 J;  1YI2 S;  1XR5 A;  2ZM6 J;  3ITH A;  2B4O A;  5HMY A;  2MB0 B;  5H9F K;  3DRS A;  4JI4 J;  2M88 A;  5GVQ A;  1IBK J;  1RI7 A;  3RB0 A;  2V8H A;  3ICL A;  2H5I B;  3I9V 9;  2CYY A;  3KHL A;  4N5S A;  3L7O A;  3WHI A;  2HRT A;  1RWV B;  2R3V A;  3MTJ A;  2W25 A;  3ZZT A;  2OGU A;  2F63 A;  4LFC J;  5KFW A;  3C16 A;  3R27 A;  2CPH A;  4U6P A;  1L3U A;  3OVS A;  4F4Y A;  3B6B A;  3K8V A;  2CPJ A;  5KFY A;  1XMO F;  2CFX A;  4YQW A;  1XN9 A;  4RWX A;  5D8H B;  2VB6 A;  1BXN A;  1N5Q A;  3HHD A;  1JXV A;  3M8Y A;  1UPM B;  2BW7 A;  5D3G B;  2B9Y A;  5ADZ A;  5HVH A;  5DQI A;  2DY9 A;  5C2C A;  3V2U C;  3L9Z A;  3I55 S;  1X4B A;  4X64 F;  1ZZN A;  4B3M F;  4Q8F A;  2B7C B;  4M5I A;  4X62 J;  3IS9 B;  4ZVF A;  4X65 J;  2RSQ A;  5K20 B;  3CCQ S;  2ZH2 A;  1LK5 A;  2HEK A;  1YJ9 S;  2A18 A;  5B0A A;  5I3Q A;  2OJ3 A;  3K5P A;  4I0W A;  2HBQ B;  3RB3 A;  2E44 A;  3QYY A;  3MD3 A;  5IC6 B;  4PYA A;  4C8N A;  2J0W A;  3M30 A;  2IRU A;  3VR1 A;  3T3F A;  2ATC B;  1JXL A;  1J2V A;  2MQO A;  1TZ0 A;  3TUZ C;  1WC4 A;  4AND A;  2ALY B;  4Q0B B;  4MIA A;  4ZLN A;  1QAX A;  4LQ9 A;  1K0T A;  2EWH A;  1S0N A;  3NEK A;  3EDQ B;  3B4D A;  1P9Q C;  4WCE Q;  1C4A A;  3KLI B;  1R6V A;  1FKA F;  2DPI A;  2D41 A;  5B08 A;  4LR7 A;  2W9B A;  1VBY A;  5KT6 A;  3S8S A;  2VU5 A;  3OT9 A;  1VJQ A;  5IWA J;  1B70 B;  5GME A;  5AE1 A;  2XMT A;  5ETV A;  4A4J A;  3W9H A;  3D2W A;  4XPE A;  2J0S D;  4DR6 J;  2DJW A;  3ZZZ A;  2WBR A;  1PBU A;  3NBP A;  3GIJ A;  1TUV A;  4E8U A;  2QA2 A;  3DOM A;  4MIB A;  1CJK B;  4TLQ A;  1Q4R A;  2E9T A;  3D0I E;  2A1B A;  2XYG B;  3A3P B;  4HI1 A;  1RTD B;  4LSL A;  2FHJ D;  2W7P A;  1HNW J;  4KC5 A;  2WOM B;  3IAS 9;  1HKA A;  2Y8Y A;  3BR8 A;  5FD1 A;  3T5K A;  1AT1 B;  3BO4 A;  2WB1 D;  4U8V A;  4I64 A;  2EKN A;  2F4V J;  1MWZ A;  2CUY A;  5AXN A;  2PI5 A;  4WYL A;  8ATC B;  1SC6 A;  4DV7 F;  4URQ U;  4L76 A;  1BLU A;  1PC4 A;  1U4B A;  2OI2 A;  5KFA A;  1RWK B;  2IMO A;  2DCU B;  3UDE A;  5GAH I;  1BMQ B;  4LF6 F;  2CNK B;  2HFU A;  4Q7A A;  1HMV A;  4ZLP A;  3BPS P;  1F0X A;  2VOP A;  1WC5 A;  4CIO A;  2DB1 A;  3BR9 A;  3J7A N;  1VQL S;  3ENW A;  4Z2X A;  4GC6 A;  1AZS A;  3G6E S;  2DT9 A;  1OMS A;  3BQ2 A;  3GIK A;  1YHQ S;  4OYB A;  2VBW A;  2BE7 D;  4U9R A;  3FFI A;  2ZH8 A;  1X4H A;  2A6M A;  3ET6 A;  2CXE A;  2O67 A;  1IBM J;  4MYU A;  3PW5 A;  3R7N B;  2A2D A;  2UXC J;  2N7C A;  1F6T A;  3CUN A;  5F8J A;  4OZL A;  2L9D A;  2CQ1 A;  2VQF J;  1S1V B;  3EWG A;  5D3G A;  4KIA A;  4NLS A;  4DV6 F;  1URN A;  2XNQ A;  1R8P A;  4W4M A;  4NEZ A;  2XYH B;  3QGI A;  4MKA A;  3VZI A;  3IS9 A;  2CZV C;  3W9I A;  5LXR A;  2CAD A;  1OYE A;  3ILJ A;  2M2B A;  4UQG A;  1KVK A;  3HFZ B;  1RT6 A;  2VFS A;  1N34 J;  3CDU A;  1J5O B;  3QGH A;  2P5V A;  4X66 F;  3K5M A;  3HX9 A;  3PYE A;  4KRW A;  2LA6 A;  3K58 A;  1BQM A;  2F8E X;  1UZD A;  2QMU B;  2CQP A;  3UD4 P;  2KL8 A;  3BO3 A;  1L3T A;  2EK1 A;  4IRD A;  5BR8 J;  4J9V A;  1UCN A;  1NK8 A;  2L08 A;  4ID5 A;  2KDO A;  4RW8 A;  1K1S A;  3TO8 A;  4JP8 A;  4ER8 A;  2R7O A;  4JI1 J;  1N0V C;  1BHN A;  4XTT A;  4JV5 J;  1DLO A;  3MR5 A;  4GKJ F;  1APS A;  2G2O A;  3D0G E;  1UVL A;  2AYG A;  3NWR A;  5JUM A;  1CQN A;  1HNV B;  4DZ6 A;  3BSC A;  3CJ4 A;  4ZPA A;  3E8O A;  4P71 A;  4IG3 A;  4ECR A;  5H1S V;  1DTT B;  5L9X A;  1S9G B;  2IM1 A;  4JI5 F;  4AXI A;  1WD6 A; 
#chains in the Genus database with same CATH homology
 3D3B J;  5FLX U;  4AQY J;  2UXD J;  1N34 J;  2UU9 J;  2UUC J;  3T1Y J;  4JI2 J;  2MQ8 A;  1HR0 J;  3W1Y C;  4DR4 J;  4B3R J;  4B3T J;  4X62 J;  3JAM U;  2ZM6 J;  3J7A N;  4GKK J;  5IWA J;  4HHU A;  4JI6 J;  4YHH J;  1N36 J;  4X65 J;  4LF7 J;  5A2Q U;  4RJV A;  4KYZ A;  4JI4 J;  1XNQ J;  4OX9 J;  4DV6 J;  4DR1 J;  4JI8 J;  4DUY J;  4DUZ J;  2KL8 A;  3T1H J;  1IBK J;  3IMQ J;  1IBL J;  4KY3 A;  3R2C J;  4YY3 J;  1XMO J;  4DR7 J;  4JYA J;  4DR6 J;  4NXN J;  4GKJ J;  4PWW A;  4DV1 J;  2KVQ E;  3J80 U;  1IBM J;  4LF8 J;  1N33 J;  2UUA J;  2UXC J;  5LM7 E;  4DR3 J;  4DV7 J;  5BR8 J;  4NEY A;  4JI5 J;  4LFC J;  2VQF J;  2UXB J;  4LFB J;  4JI0 J;  4KHP J;  4LF6 J;  1J5E J;  4JI1 J;  1HNW J;  4DR5 J;  1HNZ J;  4NEZ A;  4DV5 J;  2HHH J;  4DV2 J;  4JI3 J;  4X66 J;  4X64 J;  1XNR J;  4JV5 J;  4B3M J;  4LFA J;  4NXM J;  4DV4 J;  3J81 U;  2MEW A;  2UUB J;  5LMN J;  2VQE J;  2F4V J;  4V1A k;  1N32 J;  5AJ3 J;  4B3S J;  4JI7 J;  4LF5 J;  5IT9 U;  4LF4 J;  3R2D J;  3OTO J;  4DV3 J;  3D3C J;  4K0K J;  1I94 J;  4DV0 J;  5LMU J;  1HNX J;  4LF9 J;  2MTL A;  2E5L J;  4DR2 J;  1XMQ J;  1FJG J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...