4LF8J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf8J00
4NEZA 2VQEJ 1HNWJ 1FJGJ 4DR4J 5AJ3J 4DV3J 4DR2J 4DR5J 4NXNJ 1IBMJ 4DV4J 2VQFJ 1XMQJ 1HNZJ 4JI1J 2MQ8A 5FLXU 4JI5J 4DR6J 2MEWA 3IMQJ 5LMUJ 4YHHJ 5BR8J 3J80U 3OTOJ 4DV5J 3D3CJ 4JI2J 4LF6J 2UXBJ 2UUBJ 4JI7J 4DR1J 4KYZA 4GKKJ 1XMOJ 3W1YC 4JI3J 2KL8A 2F4VJ 5IWAJ 4OX9J 4LF4J 4DR7J 4NEYA 5A2QU 4DV6J 4K0KJ 4YY3J 4LF9J 1J5EJ 4JI4J 2ZM6J 4JI8J 3D3BJ 4X65J 4AQYJ 1N34J 4DV1J 2UUAJ 4JV5J 4DUYJ 1XNQJ 3JAMU 4JYAJ 4DV2J 3R2CJ 5LM7E 2UU9J 3J81U 3J7AN 3T1YJ 4LFAJ 1IBLJ 4B3TJ 4JI0J 4DUZJ 4X64J 1N32J 1N33J 2MTLA 4X62J 4PWWA 2E5LJ 4KY3A 4V1Ak 4GKJJ 2UXCJ 2KVQE 4JI6J 4LF7J 4KHPJ 4LF5J 3R2DJ 4HHUA 2UXDJ 4B3MJ 1XNRJ 4X66J 4B3RJ 1HNXJ 2UUCJ 1HR0J 4DV0J 2HHHJ 5IT9U 1N36J 4DR3J 1IBKJ 4B3SJ 5LMNJ 4LFBJ 4LFCJ 3T1HJ 4LF8J 4NXMJ 4DV7J 1I94J 4RJVA
chains in the Genus database with same CATH superfamily
2LMIA 1NK5A 2L08A 4I6AA 4Q0BA 4C8NA 4FF2A 1JXVA 4AL7A 4JI5J 1U0SA 2HS3A 3VGUA 5ETRA 1VQOS 2XZDB 1TZ0A 1CJKB 4K5RA 2A2CA 4KFBB 3FRZA 1DFDA 3SI8A 3T6BA 2V9WA 1RWNB 2ZHAA 3QJLA 2ZC4A 1WOSA 1X4EA 5KT6A 3HHLA 1D9FA 2GJ2A 1FNOA 4TY9A 4C3KA 3GSIA 2F40A 3EVMA 3ENWA 5F8IA 4K4SA 3DLEB 2J8AA 5LSLA 1N32F 3D6TB 3GWCA 2QGFB 1N52B 2L9WA 4YQWA 4DHVA 3PW0A 2MPUA 3NOGA 3DLHA 4LQ9A 4ED5A 2P9GA 5HJYA 3T5HA 1RAEB 1KQFB 2CJKA 2HHWA 4NXNF 1Q82T 1X5OA 4Q43A 3MDFA 1T95A 1TL4A 1HR0J 1PG5B 3JSYA 2OAUA 3OW2R 2QJ3A 2IM3A 2J6UA 2ZJRQ 2Z2ZA 3KXDA 3LWMA 2VHGA 2O1PA 4I2QA 1WKKA 2H4YB 2AIRB 2DR6A 3QIPB 1Y11A 2V2QA 2PFFB 4JI8F 1T03A 2VQFJ 2B0GA 2ALZA 2FVPA 4DF4A 4IKAA 1S1XA 4TQSA 3HI9A 4ANDA 1NJIT 3FBCA 2YWFA 1PBUA 3DOLA 2XYGB 2MZTA 3BBCA 3CCMS 4DR7F 3D9BA 4QZVB 3VQTA 4ZIWA 3I0SB 3PEJA 1N5QA 3AY0A 1SH0A 1IUJA 1HHTP 1H2UX 3POTA 2UUWA 4ED8A 1C0UA 2I1RA 4B3TJ 2CFXA 2NCKL 3O3LA 2LXFA 5IOLA 3PX0A 2B9YA 3CUNA 5E33A 3TW0A 4M95A 1EB0A 2KKHA 2HG4A 2PEHA 3L7UA 1FX2A 3ZTOA 2IBOA 1B99A 4EO8A 4CH0S 1HBMA 5KFIA 3HSJA 3J7YI 3AFGA 4L73A 5B0DA 2ZH4A 1NSAA 1C0TA 1LWCB 1RB0A 2CQ2A 2VG7A 2W9AA 2V9KA 3R7SB 4WKRA 1N54B 3KK1B 2ZOGA 1S6OA 3RB3A 3SQOP 2W7PA 1S1TB 2PI5A 4YB5A 1L3KA 2DNYA 3PRBA 1FEHA 1S4EA 3CJKA 4ENOA 2FJAB 3OTBA 3MECA 1WHWA 2D3OR 2PC6A 5J2QB 2DBBA 2B3TB 4DR1J 2H5EA 1K9MT 3CJ2A 5EX3A 4U8YA 2D69A 4DL0C 4N5SA 2CJAA 2Y1JA 2HK2A 4EI2A 2PMZD 2LFVA 5KFMA 1J5EJ 4Q7AA 4ZPTR 4DQIA 2NREA 4ZCMA 4DV2J 2DKOB 4XPEA 4DPYA 4BWMA 2XWYA 1CQNA 1NKCA 1JB0C 2VKZG 2JH3A 3A3OB 3MMAA 1R31A 2YKMB 1F9FA 2GMLA 3QWPA 2J9DE 1U0HB 4ZVRB 3E8OA 4UTGA 4HH0A 1Y5LB 5A8WB 2CNOB 1B0PA 2ASYA 2V2VA 2ZZMA 3RR8A 4LSNB 5IT9Y 4ZVSB 1VQ8S 4B3SJ 4LFBJ 4OZJA 1QAYA 8AT1B 1PYSB 1QAIA 3NGDA 3KHLA 1PJ7A 5SUHA 2HQDA 4JI1J 5HROB 3NOCA 3OLBA 4PEOA 5I42B 4FYWB 2V4JA 4HYKA 1JLEB 3T9ZA 1JJHA 3KUHA 2WB4A 1XNQF 1U25A 1X4DA 1M5VC 4TU9A 2QIFA 1AFJA 3K7RA 5A8RA 4JV1A 2QLBB 4U7CA 3MCMA 2XS2A 1YJNS 1Y00A 4LRAA 2NZ4A 4OV1A 3A12A 5KFVA 3G6VA 3PTWA 4KY3A 4LF8F 3HHEA 3RR7A 4P7TA 4JI6F 1T7PA 3US5A 4LF5J 2P9CA 2OTLS 4CO3A 4DV0J 4C8KA 1KKHA 4MYTA 2ZVIA 2ZWPA 4OX8A 3HSDA 3D28A 3D6FB 1M0SA 1IM4A 1H3DA 2ADBA 4QR2A 1I94J 3CULA 3GIRA 3JSMB 3HJVA 4OYMA 5D8HB 4ZCIA 4CLFA 3A3PB 4L76A 1Q8KA 2YNHB 1VYAA 2HWHA 2ZH3A 2EKNA 5JJBA 4IH6A 1VQPS 4DV6J 2RRBA 1UVLA 4K4YA 4PWDB 2XMKA 2ACYA 2JVOA 3RBDA 4P7VA 1VIOA 3N28A 1X5PA 4HACB 5CABA 1VQSA 3IGNA 4M94A 3KKFA 3BJYA 1S76D 4AXJA 1RWPB 2BM0A 1P1LA 2OSRA 1ZM2A 4OFZA 1ZYQA 4LRCA 1SJQA 4IRKA 4Y2KA 2V8HA 2P6TA 4ILRA 3X1LB 1TKTB 3CTRA 2PIIA 4XAKA 1YITS 4FS1A 5K14A 2FVSA 2W2OP 1XIQA 4OX7A 4WFNQ 2W1BA 2YH1A 5FD1A 3PW4A 2OH2A 1SIWB 3ITHA 5HN0A 3EZ5A 4ED3A 1WTFA 2ROPA 5ETMA 2I8EA 3UDEA 5IQ6A 4HHJA 2V94A 4J5OA 4TLQA 3EVWA 1PCAA 2VA2A 2MQQA 4UT4A 1B4SA 2DGQA 1IR2A 1U2RA 3V6JA 2QSWA 4NLGA 4U95A 4B9SA 1Q78A 4OZ3A 2KFZA 3J7AN 3KJFB 2CQGA 2R8KA 4Q5VA 4KTQA 2WVCA 2BA9A 3V2UC 3PW5A 2EFPA 3JTNA 2UV8G 2GQCA 3Q23A 1S9FA 1LV5A 5HATA 2BJ1A 2M0GB 4QIGA 2KFNA 1FDBA 4CQ1A 1LWEB 3CDWA 4Y2AA 1FKAF 2MDAA 3WQPA 4TYBA 4ANEA 1HNIB 8RUCA 2OMOA 2DNHA 3OQ2A 7FDRA 4J9MA 1RAOA 3TAPA 2NLWA 1VC6A 3P45B 2MZSA 4WE1A 3K58A 4P2XA 3QZ7A 1V9OA 3DLKA 2DR8A 3IMQJ 1P9QC 3LANA 4RW7A 4J9UE 2EFNA 1Q79A 1X4HA 5LJ3Y 3W2WB 2Z58B 3GR1A 2JHEA 2VJVA 2EXUA 3DI6B 2CA9A 2GMHA 1FKPB 4O4GA 5L1IA 4ED6A 1ZS6A 2UXCF 1KLNA 3TP2A 4LJMA 3P8BB 1SVDA 3O44A 3SV4A 4ILLA 2V2KA 3NWGA 5K20B 4KB7A 3PR4A 1RU1A 3JSBA 3N0VA 5DGAA 5I3PA 1S97A 3TVYA 1V5VA 2NQPA 1RTHA 1QM9A 4FVMA 3HMJG 3HK2A 3DOKB 2HBZB 1XN9A 3CSKA 3KJQB 1RT7A 2KZZA 2CG4A 1S57A 5AXKA 3CD5A 5L9NA 2OPSA 2PSZA 3DXBA 1ZA2B 3D0HE 2M88A 2F9DA 4UQGA 1RZMA 3PW7A 3M2UA 3KMQA 1ZETA 2R3VA 3HPOA 2LXUA 4NLTA 1R0AB 2XCPA 5CYJA 2POKA 2VZ9A 3HVAA 1ITPA 1SL2A 4FNIA 3RRGA 3ET6A 1UW9A 4LBHA 4ZIVA 4R8UB 5D0EA 1NNDA 4EK2A 2HBQB 1SQEA 3JAMY 4NLUA 3IRXA 5HBMA 4PKDB 5HLFA 5T41A 5A0YA 2WSEC 1DY3A 2VUGA 2CVIA 2LCWA 1BQXA 1V5IB 4ATNA 3KDOA 4CNZA 4ZPAA 3HZGA 4DSEA 3UCUP 3AD7C 3HD2A 4HT5A 1YBTA 3W64A 2OGUA 2A18A 3CC2S 1UAWA 3CD7A 5GAHU 3CB4A 1IR1A 1D3WA 4ER8A 2G0CA 3RBZA 3JTOA 5KG6A 5K8PA 2YH0A 2M2BA 5FDLA 2CAJA 3ZO7A 1SUQB 3BQ1A 2R8GA 4ZPBA 1JLAB 1CS4B 2CQDA 3R6GB 3KUGA 3MM9A 3PX6A 4NMXA 3G6XA 2RSQA 2DY9A 3C46A 5KFZA 2BX6A 3U1MA 3EGWB 2XWXA 2D74B 5L38A 2DCLA 4AXIA 1RADB 3PHEA 4O3SA 4PAAA 2H65B 3GU0A 3V4MA 4KGMA 4USWA 3VZIA 2HZVA 4UOFA 3W2VB 4UOGA 3MGJA 4B3RJ 3F0NA 5KG4A 1FXDA 2NS1B 3V81A 5D0HA 4OHZA 2U1AA 3R1LA 4ZVPB 4ILMA 1HLWA 1SQGA 4QWCA 4ZJOA 5KG0A 2VF3A 1CJTA 4LF4F 5M2RA 2W9BA 2IJNA 2A2DA 2OKQA 3V5RA 3DDIA 3BH7B 1BQMA 1I3OB 2JX2A 3V6DA 2KXFA 2BANB 4LFAF 4F36A 2B7BB 4DLGA 4K4TA 1QY7A 4I2PB 4P2MA 2WZ1A 1YJWS 2PFDA 4J90A 2FLLA 4JYAJ 4KGXB 2H5JB 1WG4A 4LSLB 4O44A 3D0GE 2OFGX 3VGVA 2MLXA 3U1NA 2APOA 5CCMA 3QAUA 4YP3A 4R25A 1BGXT 3R5AA 2G1DA 3HFZB 2R2SA 2QV6A 1NPRA 2GHVC 1RWMB 4KHPJ 2ADCA 1XNRJ 3BB5A 2PE8A 4RNOA 1V6HA 4DS4A 3C6TB 5GAEI 1HNVA 2P8IA 1FWPA 4I67A 3R27A 1RTJB 4LF1A 3C2PA 1LNQA 1MN7A 1T9YA 3LP2A 3TVZA 2DPJA 4WYLA 4JI4F 3M32B 2YTCA 4LT6A 2MEWA 3J80U 4J9SA 3CIZA 1VQLS 1FRKA 1RT5A 1IBCB 5CYMA 3DM2B 2AQ4A 1O0PA 2MJUA 1VISA 2RQMA 2FD2A 4N8OA 5FJ4A 4C97A 4B9TA 1UVJA 4NYZA 2K06A 2UUAJ 3CJSA 2KB2A 1KFDA 4DSKA 3CDEA 3M8RA 1GEHA 3ZZYA 2ZH2A 2YX1A 4CI0B 1Z1ZA 2LLZA 4YUDA 5IS2A 3NCQA 1U45A 3MD3A 4NASA 2MKCA 1CULA 3PX4A 4HTIA 4LF7J 4XDDA 3R2DJ 1NK4A 5KFSA 3KYLA 3M8QB 3ICLA 1U48A 1FKOA 4FKXA 1B70B 2FY1A 4ZJQA 3VVTA 4FP9A 2W7AA 2LEPA 3H0PA 1VLOA 1EX8A 4XDCA 4LRDA 1NLKL 4JI5F 1BMQB 1O8BA 2PA8D 1A6LA 3N6NA 3VWSA 2MY7A 1EETA 5AE2A 5KFCA 3AA8A 3HDSA 3IGVA 2OSQA 5SZTA 2WVDA 3KFWX 4XPCA 3IWLA 5DQHA 3I6PA 4HL9A 4MK9A 3FSIA 1NK0A 1CJKA 2VPXB 4MIBA 4CLWA 3B4DA 4KFBA 2E9RX 4EWTA 1KEKA 3WX4A 4WK1A 1OS5A 3R9LA 2XGPA 2DNLA 2EG1A 3IAM9 2FLNA 4E98A 2VH7A 1TK8A 1F3VA 2ZNZA 2C2DA 5H9EJ 3DLEA 5ETSA 2L3MA 3GTYX 1S0NA 1HR0F 3K2YA 4RR5A 2E5JA 3VVUA 3TA0A 2EBEA 3I9ZA 4ECQA 3QFHA 1JLCB 3EVOA 2J8SA 4ECRA 4RNFA 2YKAA 2LQJA 3CCVS 4WFXA 1DRZA 4PRFA 1UJ4A 2VQFF 4M5LA 2HK3A 1FESA 1D8YA 2CPYA 2CQ0A 4ED0A 5B09A 1JXLA 1LWFB 4MT1A 1KD1T 2RU3A 3GFYA 2HS4A 4ZP8A 2B4VA 1U1RA 4Z37A 3LAKA 3SSRA 4EZ6A 1BY9A 4PQUB 4X4SA 2OPQB 2GQ2A 4P75A 3R2CJ 1KSPA 2LDYA 4USTA 2GFFA 1CC7A 1TL3B 2HNDB 1F2HA 2OP5A 3I0SA 4NWBA 3JTPA 5IFMA 4NZ0A 1IBKF 1VC5A 3DLGB 2HZCA 4IH5A 3DOMB 2D9OA 4X84A 4BHQA 2KT5A 4BWJA 5MLCV 5M2UA 3IS9B 3ILLA 4CH7A 3ZTSA 1TR0A 3ZFVA 1OWXA 2MB0B 3UWTA 2RD5C 3BF4A 1BQNA 1SKWA 4YR3A 4UY8T 1GT8A 4X65F 2BM1A 5KFUA 3GSDA 4EBDA 2RE1A 4IR1A 2HQCA 3S01A 1LWCA 3CO9A 1DARA 3M1VB 4L6V3 1IBLF 5KOWA 3KK1A 1RAJA 3M9MB 3I56S 4JI3J 4Y6IA 4NEYA 4IO1A 3M2RB 4LF9J 3PEHA 1ICEB 5J2QA 1LW2B 5C42B 2AYBA 4ECYA 2HIYA 2ZBCA 2XLJA 3Q0AA 3MEDA 1WACA 3BBBA 1RLCL 4ECVA 4LFCF 4PWWA 4UY85 2CG8A 4NLYA 2KRRA 3UDCA 2E5HA 5I3UB 2DRDA 3BGFA 1VHFA 3G6YA 2JEJA 5L1JA 5EWFA 5CAAA 1JLQB 1JNRB 5LMUF 1U0HA 4LFBF 4ID5B 1U26A 2C28A 3TUZC 3BSAA 3MCOA 4EBEA 2CXEA 4KKOB 5A8WA 1V3RA 5AXLA 2FHOB 4DR4J 4KH0B 3KLGB 3AXMA 1SJ1A 4JI1F 2C1EB 2MQMA 5KFTA 1XR6A 2JEIA 5FLXY 3NAHA 3E51A 1NMEB 1WC5A 2KU7A 5H9FJ 2HIQA 2MGZB 1ZTWA 2C3UA 5HROA 2OPRB 4A8MP 4M5IA 2Q6CA 4G3IA 2UU9J 4OLOA 2EKYA 1YLXA 1JLEA 2Z2YB 3VGSA 4CLSA 2HMIB 4ZVFA 1RHJB 1TFYA 3UI3A 1NKBA 2ZH5A 1Q5YA 1IKXB 2CPEA 3PKYA 1J2VA 3W5XA 4DV0F 1MMLA 1JJ4A 3E01B 2FJEB 1X9WA 1U2FA 4K2JA 4URSA 3FZBA 4OI1A 4WJBA 3TUIC 2XY7A 4FF1A 1VQ5S 4KQZA 1AUDA 2DEJA 4J9QA 4MKYA 1NKEA 4OYXA 3IR5B 1AUSL 2V4QA 2QMXA 4ZCLA 1KOOA 1K0TA 4U6PA 4OJGA 3MPYA 1WC1A 3JSMA 2NSBA 5K9FA 2YNGB 2B5JA 1SXLA 2ZDOA 2WK4A 2HBYB 2B9WA 3NP5A 3ZNJ1 3M30A 2XMWA 4N7TA 1Q81T 4O3QA 3B82A 3RJMB 4QWBA 2XY6A 2F3JA 4Q0BB 4PWDA 1PGZA 3J81j 1WOPA 3M6WA 4OI0A 2RHSB 4IRCA 1S5ZA 1CBKA 4YB6A 2HHHJ 2GQQA 3GYNA 2OIHA 3LPYA 5J2PB 3LGHA 5LMNJ 4RBVA 4FYYB 5IM0B 2QMWA 1T0TV 2HHSA 2VQEJ 1LW0B 5ETPA 2XMVA 2UUTA 1UPPA 1A9NB 4ELVA 2DGSA 3ZXWA 2K7KA 1H73A 1OSCA 4I1TA 3BKTA 4Z7YA 4AE5A 1HQEB 3TX0A 1FFSB 4ELUA 1YQHA 1BUXA 1G1XA 2GS8A 2D7SA 2HHTA 4RNNA 3TZXA 3M8SA 3BV8A 4NI2B 2YX4A 3M05A 4USHA 4DFJA 1RGVA 3QZ8A 4ZVEA 3W9HA 1UWBA 2ZUAA 1QSSA 1Q7YT 4L72B 1T03B 4CNYA 3B4MA 1S1VB 1GMVA 3KJVB 5HVHA 5AE1A 3ISND 3LWLA 3AOAA 4WTOB 4MFBA 4K7QA 2ZOFA 3BR9A 5BYRA 3THTA 3CCSS 4USVA 1S7IA 3OXGA 3BYPA 1UZHA 5L8RC 3Q8VA 5HMWA 2DH8A 4TVAB 1Y3JA 2AGPA 4DV7J 3GB0A 3T5JA 5C7PA 3I96A 4K0KF 2HEKA 3OTCA 2FZGB 2OLWA 3OJSA 3I9V9 2BR0A 4M5HA 2I6WA 4DU8A 4NA3A 2PN6A 5KFDA 4CO4A 3C19A 2O5DA 4P73A 2OTJS 2XS7A 3KK2B 2KYXA 1HL6A 4GKKJ 2QA1A 3ZZZA 1B3TA 4X64F 3GLJA 1FA0A 4QU6A 1BLUA 1XMBA 1GTEA 1JNZB 1NSKL 3IC1A 3T9NA 1HBMB 2LU1A 4DUYJ 1LK5A 1LFPA 4H54A 5IXUA 3W2WA 4O4RA 3H7HB 1GXLA 3I0RA 1WC3A 4DL7A 3DI6A 1U1PA 4K50A 2ZHOA 2WONB 1HI8A 1FKPA 1RLDA 1TAQA 3CJKB 2W2MP 4J7CA 3MECB 4DX6A 3CJQA 2Y8YA 1F5AA 2RF2B 2PA3A 4P52A 2HRTA 2YBVA 2BJ3A 3SBMA 3I87A 4ZLJA 3KTQA 2LYVA 4YN3B 2V67A 3GZ7A 5F41A 2DPIA 2XULA 1MU2B 4DWIA 4OYPA 2BJDA 3Q24A 3C14B 1HNWJ 3MCSA 2LECA 3G2XA 2VJUA 4CLLA 2AT1B 2IYIA 3DOKA 3WC0A 3M9NB 1XTZA 2FJBB 3THVA 3CWJA 2BQ3A 1NHKL 3MD1A 3OPKA 1HBOB 3ZTRA 3C16B 3MAAB 4ZKAA 3KMSA 5JXSA 4ED4A 2HVEA 1QAXA 3QGGA 4OYWA 4DN0A 1R0AA 2H48B 2HKEA 2CJYB 2W01A 1IJFB 5HAOA 1BE4A 4F8RA 3AQPA 3D0IE 2LQ8A 5G0RB 1IKYA 4WKYA 4R8UA 4KGVB 3U27A 1RT6A 2AJFE 2JWNA 4HHUA 3PHTA 2UUCJ 3MMJA 1C4AA 2CNKB 1PBAA 4YHHF 4F0MA 3CF5Q 5U47A 1LK7A 1B64A 5CYQA 2J5AA 1FE4A 3BDPA 3J7A1 3IBCB 5F8NA 3IFEA 4GRSA 2QL7B 3OXLA 5K8MA 3ILIA 2DIUA 3W62A 1H72C 3ZZ0A 1FDDA 3IM9A 3H40A 3R7NB 4DPTA 4PXCA 4OX9J 3ILJA 4QU7A 1X60A 3L9ZA 4MKAA 4DSIA 3QWUA 4Q8FA 1SUQA 2J0QD 3OR2B 1ZOTA 1JLAA 1VFJA 2FLOA 3MPDA 1RWWB 1AXQA 2CADA 2Z0GA 1G7CB 3QGIA 4FXWA 2IVFB 1R7IA 2FVQA 1MN9A 2U2FA 1PC4A 1IQTA 4BDPA 4ETXA 1GX6A 3TYTA 1FO1A 3T3FA 2I9SA 1HNZF 3EZUA 1JLFA 1XEZA 2EK1A 4J9LA 1GX5A 1WG5A 3BKFA 2RAQA 1BWEA 1Y7PA 3AJDA 1DTQB 2BRKA 2WRMA 1NK6A 3W2VA 4QIWD 1XMQJ 2K2PA 4CLZA 2MQ8A 1WHVA 1RHQB 5D0RA 3A8KA 3FVYA 3T5LA 5IWAJ 2DNGA 3PM9A 1KVJA 2HQ3A 1U8WA 5K14B 1TU0B 3UQSA 4EEYA 2BANA 2N7YA 1O51A 2IRXA 2W4CA 1MW7A 3FFIA 2X1GA 2VA3A 1E6YA 2R7OA 1VBYA 4I2PA 2ATCB 2LQ5A 1OMSA 3GJTB 1N33J 1HI1A 4C11B 5E41A 4UUXA 4B02A 3RW6A 4LSLA 3BN4A 3ZTQA 2H4WB 3Q8YA 3MM7B 1UCNA 1WORA 2AHOB 3HKWA 4QQBA 1SH2A 3C6TA 4KR0B 3CC4S 3FC9A 2JNJA 5F8HA 1YJ9S 1GXUA 4PG7A 4USUA 1LEOA 2VONA 1X4FA 2KXNB 4KBIA 1RTJA 4OX6A 2OELA 2KN4A 2L9NA 5RUBA 3FUYA 2A10A 4DX7A 2HVDA 2YXLA 1HBNB 2NUHA 3M6VA 3GFXA 1TMMA 1TKXA 3W9JA 1RYSA 2UUAF 4IDKB 1U1OA 2BE2B 4KT0C 3EGNA 1DQ8A 1X5SA 3DM2A 3W60A 5F0WA 3HJFA 3TA1A 4X4NA 2CZ9A 3QO9B 1FCAA 3JSRA 4HDGA 4RW7B 1V3ZA 1FJCA 2Y9HA 1F9EB 2CPFA 4O3PA 1I6JA 3CCZA 1WF0A 3C6UA 4WF9Q 2MJNA 5E2QA 3CCRS 3KK3B 1S48A 2ZZNA 5JUMA 1HQUA 1F1BB 5HQ8A 3L95X 2DNRA 2MLYA 2EK6A 2MKKA 5CXTA 2XGQA 4OYOA 1T11A 3QT6A 3FDSA 1NCLA 2DNMA 4LVNP 3HHDA 3CMES 4DXLA 5A8KA 4X62F 1UJ6A 3VAGA 4OZNA 1RT1A 4UZCA 5DZ7A 1T05B 3VQSA 2C2EA 3QYYA 3R5CA 2QLFB 2XQCA 1S6QB 2KO1A 5ETKA 2P2CB 2E5GA 1RT7B 2AX1A 3OLAA 4OZ2A 2IRUA 3AJ1A 4DUZJ 3NCRA 4W98A 1RYRA 3H5YA 2HWTA 1UEKA 3FCWA 3R6LB 3G87A 4F4XA 2GO9A 4Y2IA 1W2BR 1H2TZ 4G65A 2LDIA 2M9KA 1UZDA 2CQ4A 4MH8A 1DTTA 2DCUB 4A8YA 2C3YA 3ET6B 5DRKA 3FNNA 1SI9A 3FBFA 4DU7A 4JP8A 5HBMB 4NYPA 3OTEA 5HLFB 3TX8A 2XZTB 5A0YB 4IQXA 2B6AB 4USMA 2OHDA 2RUSA 3BREA 3WIUA 1JLCA 4DV5J 2DRBA 2FHJD 3Q8UA 4IFVB 4ES3A 4WXOA 1R6YA 2QTWA 2ROGA 2HHUA 1XR5A 1RU2A 3MEGB 2CQIA 2HHXA 4WFZA 3TR5A 3QMQA 2D3ZA 3N6MA 3LPEA 4F50A 2D9PA 2NXUA 3MAHA 3DN9A 3I4HX 5DETA 1OYEA 4WIQA 3EXYA 1G3OA 1OO0B 4ELTA 4UZBA 3GPAA 3GJSB 1YZ7A 3KLEB 5KT7A 1NJYA 4PQUA 3NCPA 2OPQA 5FDLB 4DL4A 5DM6Q 1FERA 1ELOA 3H2UB 4F0KA 1S4FA 1UL3A 1RA6A 1TL3A 1QE1B 3ISNC 1KVIA 2HNDA 1MSWD 4PXEA 4OMFG 3OV7A 1K44A 2VB6A 3N5BA 2CPXA 1EARA 4CO0A 1FK9A 2C2ZB 4HH1A 3C15A 4OHYA 5GMKa 4Y65A 1EKRA 5M2PA 2M8DB 3IS9A 5KFAA 2YWHA 4PCQA 2DK2A 4Z7CA 2AJQA 2H51B 1N34F 3JQMA 2WW4A 1UWAA 4A46A 4PUOA 1KNZA 3MMCA 1U47A 1FX4A 4DQPA 4JI3F 1KP6A 5KFRA 3PG9A 2F4VJ 5B08A 1HWIA 4F4WA 6FDRA 3V81B 1VMBA 3CNQP 4E0DA 5T7LB 3FMWA 4UF4A 3M1VA 1N5YA 2HGMA 3NS5A 1CJTB 3M2RA 3TQEA 3UDLA 2AMCB 2GVZA 4QWAA 3S6EA 3J7Z5 2E1MC 4DBQA 5C42A 2CPJA 4QPTA 2XLKA 2JLEA 4W90B 2W2NP 1FJGF 3GCWP 1Q7LB 3RBEA 4X4OA 5F8MA 3EPGA 4ES2A 4YMEA 5KFKA 4IQMA 4M5NA 1FI4A 1QSLA 1ZH5A 4PQAA 4MIWA 1JWWA 3W61A 1K73T 4OQJA 4NXMJ 1F9HA 4DR4F 3GIIA 2DHAA 3PR5B 3TAMB 3F41A 2F1FA 2IPOB 1PILA 2BOAA 1EQ0A 1SB6A 3G8TA 3PDNA 2XM3A 4ID5A 3W3SA 4BC9A 4TY8B 3IWXA 2QA2A 3I5CA 1IN0A 3K5PA 4KKOA 5AE3A 1X5TA 2YPZA 1NK8A 4HKQA 2CNLB 1HBUA 3G8SA 3SCKE 1FXRA 2K8GA 5ETOA 4Q2LA 2WBRA 4RKUC 2VBXA 4DG1B 1EJ7L 4CWBA 1U1QA 4P6QA 4F26A 2VFUA 5KOXA 1F5CA 5GAEU 2GHWA 4EGLA 2MGZA 3RG6A 3SFUA 2ZH1A 1RABB 5J1PA 2DR5A 2OPRA 2XMUA 2DH9A 5KT2A 4PPZA 1MWZA 2RUGA 2ILZA 2I5JB 3P6YC 1VR6A 3Q89A 3EGZA 5AJ3F 3OJUA 5K8NA 4MKVA 2IC3B 3GV8B 3GG0A 4WZQA 3K5OA 2HAFA 2UVWA 2BJ7A 1ULRA 3PJXA 3ENAA 2BACA 3ONQA 1Q53A 5LOQA 3E01A 3E2EA 4PYDA 1OY8A 2ZOMA 4NX9A 1CULB 1SBRA 2A6MA 1HYSB 5CH7B 5DG8A 5T14A 1FD8A 1U1MA 2QL5B 1CQMA 4XTTA 2M4MA 3Q8QB 1RHKB 1SV5A 4L3KA 1XQIA 1FKOB 2KT3A 1RE1B 5KFBA 1FRXA 3OL7A 4DQRA 5IT0A 4QIVA 2AD9A 3PYFA 2XO7A 3QFWA 3P4UB 3KG0A 1UVNA 3I4PA 2IBKA 1RK8A 2HPUA 2DT9A 3M6UA 2MY8A 3CCLS 1UKUA 2Z8QA 5LMNF 4LF6F 4DF8A 2YY3A 4YR0A 2BVZA 2JDJA 2V6AA 2ZDPA 2N4DA 1NK9A 3GJQB 3I55S 3PFOA 4NXNJ 1LFWA 4NCBA 2NYIA 2A3JA 2H9ZA 5J2PA 2FHJA 1RTDB 2D1CA 1SJFA 1F2GA 2QT7A 5IM0A 1Z2LA 3NEKA 4IRDA 2VDIA 3H2VE 2YNFA 1LW0A 2JL9A 4N41A 2VV5A 2YNIB 2NXCA 2ACMA 3NGUA 4I7FA 4JI8J 1HQEA 2W9CB 2NXJA 4NA2A 1HKAA 3MEEB 1IVZA 4MJKA 4Y28C 1U1NA 2YKOA 2Z57B 2KDOA 4L74A 4G1QB 2VFVA 4YB7A 2AJ4A 4NI2A 4ECXA 2E66A 4LQ3A 1UFWA 4DR5F 3AOBA 3CXCR 4DR6F 3HP6A 4KPYA 1TL7A 1AA1B 2GJIA 1S1VA 3FJ2A 5IZHA 3UR3C 3KJVA 2UXBF 2FC9A 2ZC3A 1X9MA 2IVMA 1DQ9A 2ABYA 2X1BA 2RT3A 4RBTA 3BQ0A 1FHTA 1EP4B 3H8YA 2RDDA 3G82B 1KOHA 4C3MA 1DURA 4P71A 1F3FA 1UPMB 2I38A 2IJFA 1NZAA 3DLBA 3L7OA 4KC5A 2VU5A 1C1CB 5A2QY 2P5VA 2CDQA 1TL1B 4DUYF 3LALA 1YTYA 4CLPA 1S6PB 1VK8A 3CIMA 3KK2A 3FCHA 1RWUA 4QBUA 1Q8LA 1VQMS 3CJ0A 4QJVA 1BQNB 1ZAWA 3H59A 1SC3B 4DPUA 1FXLA 4ZN3A 3PY8A 3ZZRA 4GKJJ 1WTBA 2E9TA 4BLGA 2M5YA 4U67Q 1YJVA 1K1QA 4GC6A 1HWJA 2WONA 1HNXJ 1TK5A 5HJXA 2Y1IA 2QE5A 3MUMP 3TNVA 1Q8IA 1WKJA 4WFYA 2HFNA 4JI7F 2RF2A 1VDHA 3PRVA 2CZ4A 1O5JA 3A3NB 3NGKA 2GO8A 2BYCA 3ENQA 3MEDB 4QPXA 2FJVA 3EM1A 4NLDA 3QT8A 2ZM6F 3Q2TC 4GVLA 4YS2A 4JV5F 1MU2A 2NXEA 3IR7B 1HW9A 5KFOA 2OD4A 1NH7A 3BGRA 2ZKTA 1ZPWX 3UDVA 3C14A 3VTIA 4TU7A 1TUWA 2FDNA 2Y3YA 4A4JA 3IWNC 2XYPB 2VICA 4DN9A 1FNXH 1Y3KA 1CC8A 3LGNA 2XI2A 1HBOA 1MWYA 3C16A 3MAAA 5L39A 7AT1B 1X31C 1PYTA 1L3TA 3G4SS 3QJJA 2CJBA 1TK0A 2FPHX 2DY1A 1FJ7A 3MM5B 3HHNB 3G9CA 4CLYA 4M1KA 4DEZA 2Q79A 2UV8A 1M5KC 2M52A 5G0RA 4OZ5A 3PYEA 2LQ9A 5E5NA 2VC0A 3D54A 2XC9A 4CLKA 5B0CA 4LF8J 4NLQA 4QCLA 2OD6A 4NL5A 2CQ3A 2PMHA 4M5DB 2G2YA 2H3EB 2QG9B 4WYWA 4NYOA 3SSQA 5DLGA 2DJWA 3D7SB 1KHVA 4OX9F 1CVJA 1XMOJ 1KQSR 1JK9B 2DGUA 4LRFA 4C0BA 3OVBA 1H6KX 4OJHA 1HWUA 1X8DA 2IVYA 3M6XA 1VLYA 5D15A 5DG7A 3DHXA 2RH3A 1U6FA 2IHR1 1NSPA 2B43A 2L48A 3NL0A 3OR2A 4NZ7A 2HFOA 2XBPA 3OD2A 3U7JA 1RT4B 2N82B 4I68A 4OHWA 2JC1A 4TU8A 4PR6A 5I4MA 5ETTA 3CCQS 4ZVHA 2JC0A 3DRYA 3T6JA 3BGOP 3VHQA 3FGVA 5IT9U 2B5JB 3IA0A 3GIKA 2B8PA 4ED1A 3M30B 4PG6A 5IQQA 1OJ4A 3KOAA 1RKJA 4MIAA 6AT1B 5DM7Q 4LREA 5F8GA 1R8BA 5IC6B 1DTQA 2RS8A 2UUBJ 4WFBQ 4C2MA 3FCVA 1EIYB 4A8FA 2DGXA 1ZTTA 1L3VA 1PKUA 4YY3J 5LJ5Y 4C0OC 1NM2A 2X1FA 4JOUA 4YR2A 4QR1A 2A0FB 4X66F 2R7VA 1VRTB 3QSIA 4M5GA 4ZHRB 2B4OA 4CZCA 1N33F 1QLNA 2BKPA 4ZVTB 2VOPA 1E6VB 1CG2A 3AAWB 2DEIA 2F63A 3SV3A 3FMBA 1IKWB 4ZMMA 2IFXA 2NPIA 3OVSA 2Q1LA 4DV4F 4EYHB 3GFZA 4C11A 3BN7A 3V6KA 1SQFA 3DMJB 3UD4P 2DYAA 5BYQA 1X4CA 5KFWA 4DL5A 4PPDA 1N36J 1FFWB 1MROB 2YWKA 4HTJA 4IFYB 4J9VA 4Y2MA 1FT8A 8ATCB 2WBMA 2YQ1A 3PV8A 4F67A 2E44A 1UWBB 4USJC 1S1WA 1DZ5A 1JKHB 4JUZA 2H1YA 2XHCA 3OT9A 3MM7A 4FYVB 1ZM3A 3OTOJ 3NLCA 4OZ0A 1TTHB 1RAIB 1XK8A 4AL6A 2DXEA 4WPAA 4MFBB 2ZH6A 4F4ZA 2J0SD 2CJQA 2RDJA 2E5LF 3MHYA 3BGLA 1WJ9A 1FRIA 1FRJA 3FKBA 4M8LA 1R6VA 3HFVA 5KFFA 1HBNA 3J81Y 2K3IA 4QOTA 2C2RA 2I2YA 2DITA 4IDKA 2BE7D 3NGTA 2O66A 4C8ZA 3MM6B 5DS7A 3RRKA 4LR9A 2HFSA 2BE2A 1UVKA 3F44A 4PXDA 3MMBB 4PG5A 1QDUB 9RUBA 2GA7A 2UXCJ 5BYSA 1FDAA 2RILA 1IBMF 4QYRA 1ZZFA 5LL6d 3QO9A 4NCGA 3BSOA 1FJEB 2YX7A 4JI2F 3BQ2A 3NGRA 4K4XA 4PABA 4TNOA 4I0WA 1UEUA 2E1PA 3I0RB 3KK3A 2RQCA 2CZVC 1UW4A 2GIFA 3KG4A 4DV1F 2R8IA 2R7SA 4DPOA 5J1EB 1WHXA 3K0JA 4V19X 4UW2A 4QIEA 1MG7A 1RWVB 4YDXA 2QFJA 4B3OB 1G2EA 2GC8A 2MKSA 1W25A 1KRPA 1EHWA 3MOZA 3C8YA 2GAHC 3PRDA 4F3OA 1DJ0A 4WP8A 2G0IA 2AYMA 1JJ2R 2J7KA 3GILA 3R1HA 2XYHB 1SKUB 1HD1A 4TXSA 3AT1B 1RUSA 4P2SA 2V69A 5E0OA 1T05A 5IV4A 2D3UA 4C48A 1S6QA 1RWKB 2QA4S 2FYXA 3Q8SB 2PT0A 2KVQE 4KHMA 3D2WA 1Q95G 3SIPB 2OEKA 4H4MA 3L3CA 3BGUA 3MFIA 1Z4UA 4XIUA 2CPZA 4N76A 3LA0A 1F6TA 3LGMA 1T9UA 5KFJA 1HW8A 2FZKB 4DL2A 4IO9Q 3A1YG 1P1TA 1TV6A 3NKYA 4CH1A 1H98A 2MMYA 1IKVB 5HVGA 2ZH8A 4J37A 1WDTA 5HQMA 3RRHA 1S9GB 1IKYB 3DGVA 1RT6B 1T9VA 1GQEA 1U8SA 2KG0A 3VAKA 3FRYA 2JZ5A 1S0VA 3DXSX 2B6AA 4RWWA 4DPXA 2AWZA 1VQ4S 4IFVA 1S77D 2L41A 5CYQB 1S0OA 2N4CA 2QC3A 3MEGA 2WVFA 3H90A 1QAJA 1SCJB 2ZVSA 2MZRA 5HMZA 5KG5A 2NR0A 5GADU 1VK3A 1UVMA 5DQGA 2RJZA 3NY0A 3I82A 3DYAB 4B9VA 1WSRA 2YKNB 3HULA 3HX9A 2MXYA 3LAMA 5KT4A 4AUKA 2CRLA 3KLEA 1J5OB 1U1KA 3TEGA 2AX0A 2ERRA 4QYZJ 3GYXB 2W4DA 3N4WA 3CGIA 4C0HA 4X4PA 2DTJA 3H98A 1QE1A 1WELA 1D9AA 1M5PC 2M8HA 4DR2J 3K5NA 4DFPA 1YJ7A 4R5PB 1MLAA 1WD6A 1M5HA 3BH6B 3MOJB 4X4TA 5F8LA 3LOUA 4IYQA 3LP0A 1Y9OA 2V63A 2ASLA 3M8PA 4FF4A 2IM1A 3HD1A 5HL7Q 3AB4B 2HHQA 1JLBB 4LF4J 1JLFB 2J6TA 2BW7A 1LXJA 3AD9C 2DH7A 3DGPA 3MF5A 5ETNA 4X2BA 3OHAA 5ETVA 3JAMU 4DCOB 2JJ4D 2Z2LA 4ECZA 3D6HB 1WC0A 3D68A 1HD0A 4LFAJ 5T7LA 5KFGA 4F4KA 3A13A 2HWIA 4KV8B 2VD3A 1T3NA 4CO1A 3WC2A 3SEOA 4B9MA 2ZZTA 1GK8A 4MYUA 5D78A 5BJRA 4OZ1A 2GJFA 1SIZA 1RAFB 3FFIB 1E6YB 1FE0A 2KHDA 2ZEJA 2AF6A 1LWXA 3K5MA 1G6BA 3VGTA 3T1YF 1PC5A 2HFVA 1HWKA 5DDPC 3MEKA 3PW2A 3HFKA 4AYBD 3TAMA 2KL8A 1B0VA 3W7BA 5DDRC 2I0XA 4R0JA 4KIAA 1SJRA 4TY8A 1WC6A 2BKOA 4JI4J 2QLXA 2GNKA 4F2SA 1TL5A 2BV3A 2B9XA 2V8GA 3O5TB 2ZHBA 1ZBTA 1UP1A 4DSFA 1AZSB 4FF3A 2GGPB 5CZVA 2HBRB 3PZPA 4TN2A 4ZS6A 2RS2A 4DG1A 2AGOA 3G6ES 2FVRA 3NWRA 2FIUA 1PAUB 2QYGA 3HVRA 2HVZA 3TANA 3Q83A 4DPWA 2HNYB 4W4MA 2GIRA 2I5JA 4IG3A 4ZCKA 1TKXB 3KJNB 2KTQA 3OUYB 2DISA 3TARA 3NXZA 2RDIA 4GVBB 2HRYA 2MKYA 2EBGA 4DZ6A 2KT2A 3H4BA 2IC3A 4F4AA 3MR6A 1RKIA 2LEAA 3QQCD 2JLGA 1L3SA 4OHVA 2F7VA 2OPPA 2C2OB 3W65A 2V34A 3M8WA 5KAKA 4RW8B 5DZ6A 3K57A 3PJWA 2J0WA 2MQNA 3C6UB 3HLUA 3NS6A 4RWXA 1HQUB 4EFAC 1HYSA 1HIYA 3KUEA 3CDAA 2VG5B 1GMUA 1N5SA 1VIXA 4P74A 4RPFA 1RBAA 3NG8A 4BBYA 2LVWA 5D77A 2MTLA 2KFYA 2XO6A 4CO5A 1T3OA 3TRGA 3CC7S 3DU6A 4ZJLA 1RT3A 2HSEB 1DHMA 4C7QA 5A8KB 5C24B 2V4RA 4QWEA 1RCXB 4FXVA 3GQCA 1RT1B 1YG0A 5LT5A 1WWHA 1EZZB 3UVJB 5BXIA 2MSSA 5IT4A 2E29A 3T1HJ 2UVUA 1RT2B 3CJRA 5E3RA 1FTRA 3PYGA 1KLMA 1VQNS 4Q44A 1ROFA 3P5BP 2CVEA 2A6OA 1MWQA 2Z2MA 3QT5A 4HDHA 3CD6S 1CPZA 5IC4B 3OFEA 4ANCA 2EPIA 1SC1B 4J9RA 4K8RA 2R9LA 3CD0A 2LXIA 1RTDA 1DTTB 5KFLA 3UD3P 2J76E 4AT1B 2CQ1A 2AZ3A 5KFHA 1CJVA 2CWXA 4H4KA 2YNIA 4P9SA 2E5IA 2RQKA 4LIRA 1GAOA 2G9OA 2W9CA 1M90T 3MEEA 3JQJA 4HEA9 2MYFA 4G1QA 2AKWB 1AYEA 3LH2S 2KXHA 4FN5A 4IG0A 2XLIA 5KT3A 3DLLQ 1IBKJ 3K8WA 1N0VC 2EG2A 1KWMA 4LBIA 3MR3A 4H4OB 4F7VA 3QRRA 4DX8H 1R8PA 1WI6A 3IBFB 3D3CJ 3NNCA 2R7QA 3KG1A 2Q3PA 4HHHA 4B3TF 2H54B 3W1YC 4ZP7A 4U7UK 1SKSA 4J9KA 1EP4A 4DCJB 2QA4G 4CYUB 4X65J 3G82A 3H42A 1FK9B 1S49A 3H2LA 3C15B 5LM7E 2HW3A 1IWGA 3R3TA 1N8RT 2WCXA 9ATCB 1U7LA 1IBLJ 4U96A 1C1CA 5E7OB 2P9EA 1TL1A 3CDBA 2X51A 4FZVA 4PUOB 1WEXA 4ED7A 1S6PA 4GKJF 2E1AA 3CEDA 3QAEA 1PAEX 3FBEA 3MMCB 1D0EA 4OIXA 5KG2A 4W92B 2WSFC 1VC0A 3RZAA 4DFMA 3IAS9 1HNXF 1VQYA 3M9OB 4URQU 1FFGB 1RP5A 2MHNA 5EN1A 2PGCA 1Y10A 4DR1F 4LFCJ 1SC4B 1TMJA 2BJ9A 1N5YB 1NBEB 2PMWA 1JXEA 3QT7A 1J5EF 2EEYA 5AT1B 1KONA 2GVZB 2R7RA 3W8PA 3TZWA 4DV2F 5LMUJ 2QZ8A 2MKJA 1JQGA 2E7WA 1T9TA 3L09A 1R0BG 3VCDA 5KFXA 2EI5A 2ZBQA 4DZDA 1YKWA 1TAUA 3KLIA 4GMKA 3D3BJ 2X3DA 1NXIA 1R27B 2VPYB 3KLHB 3TUJC 4E2FB 2F5GA 4P10A 2CPIA 4RW9A 3RYLA 2V0NA 3WZ0A 2X7IA 3PIPQ 4X4RA 2NSCA 3QNWB 4B3SF 4RO0A 1N5TA 3R97A 2C3MA 1KHWA 5THWA 3WDOA 2ILYA 2F65A 2DIVA 2XNRA 3V4IA 1HBUB 5ITHA 1NDLA 3HHLC 5C25B 5A6WA 3KHGA 1VOMA 4D3HA 4MMOA 2VG6A 3BYRA 1RAAB 5CA5A 3MM5A 3H5SA 4ECTA 1VHIA 4FDFA 5D4PA 3BS9A 2Z30B 3VAJA 2MKIA 2ZD1B 2X1AA 1B7YB 1RWXB 2YQ0A 4TQRA 3PNIA 1J27A 1XMOF 2KYZA 2IYGA 4RNMA 4M5DA 4AL5A 3SSSA 3SYZA 1F0XA 2D3O1 1JMTA 2AYEA 1URNA 3GJRB 5JVHQ 5F0UA 1WDDA 2EC2A 4LF5F 2RMLA 2EW9A 3EWGA 3DRSA 1PYOB 3UCGA 1TKZB 1S0MA 4ITSA 1GMWD 3ZZUA 1R8CA 3PXGa 2WHOA 3M2VB 4H4KC 2FJXA 2R2UA 4QW9A 2YKQA 3IXQA 1I94F 2PEBA 1RHMB 5HMYA 1S99A 4PZVA 1YBAA 1U02A 3VALA 1K47A 1KVKA 1SV5B 2M70A 1CJUB 1UA0A 2FGCA 3D67A 1RT4A 2GW8A 1H38A 1MMDA 3HVTA 2VASA 2CKWA 2DR9A 1L5UA 4QYZK 1XWLA 4ALZA 4DV6F 1DBDA 2HS0A 2J9DA 1N88A 4FS2A 1RSCA 1UETA 2HQFA 2BW2A 2EC0A 5FLXU 1JLGA 4MKBA 1FNMA 2UUBF 5KFEA 1UFLA 1VQ6S 2EFGA 2HHPA 2RIJA 2LEBA 4YY3F 5CCLA 3QATA 1WHYA 1H74A 2F8MA 2Z4PA 4AQYJ 1R8HA 1RISA 4KGKA 1ZAXA 3ILOA 2LP4A 4ZVOB 2DXDA 3RW7A 4PYAA 2VODA 4Q45A 1RI7A 4F4YA 3P5TL 4C8LA 5HO4A 1RCOB 3RTVA 5J1NA 1K8AT 4DFKA 3AD8C 2VKRA 4XO0A 5LSRA 1VRTA 1S9EA 2DO0A 3GV5B 1PSDA 3AJ2A 3VAFA 4ZHRA 2YNFB 2B56A 2ZUGA 2XMTA 3SCIE 4FVCA 1E6VA 3KLVA 1NAQA 4MAKA 3MFHA 1N36F 3VAHA 2DHSA 3L4BC 4I7FB 1IXKA 1IKWA 1NZ8A 2M3DA 4CT8A 3IO1A 1ZAVA 1WF2A 4TKTA 2WAQD 3DMJA 5DQIA 2G2OA 2FLPA 1VQ7S 3OTOF 2KHCA 1MROA 1KDNA 4IFYA 4USKA 4K2XA 4RU9A 1FRLA 5DO2A 2C2KB 1YJUA 2KM8C 4E8UA 4RZRA 1JKHA 3TO8A 1S72S 4K0KJ 1RTZA 5EWEA 1TL7B 7FD1A 1H2VZ 5B0GA 3CCJS 5J2MB 4X64J 4LUBA 3U02A 3TQ1A 4GO5X 1PO6A 3P49B 4M5JA 1JJCB 3H25A 2BXJA 4G1IA 1VBXA 3GYGA 2VBWA 2UXDJ 1WUUA 3BEGB 4B9UA 3PCOB 2O3DA 3MM6A 5GMEA 1T94A 3EMTA 4UUWA 3MMBA 5I3QA 1RDRA 1TP7A 1C1BB 3MM8B 3AHPA 4PWUA 4IR9A 4RUBA 3B78A 2AZ1A 2G4BA 1JIHA 1FRMA 3MR5A 3BO2A 3TJ9A 3K5LA 2JOQA 3H20A 2VDHA 3HT3A 4DMZA 2DGTA 2HQIA 2IA6A 1XBWA 1X4BA 3QRPA 4URGA 2IIHA 2NXNA 2IM2A 1H7WA 2GV1A 5J1EA 2OUGA 1U09A 1SC6A 2R7WA 1WNEA 2IMWP 1QUPA 2C3PA 3JXOA 4ERDA 3UN3A 2V8PA 3Q86A 1OY6A 1RTIB 1OPZA 4B3OA 2R7TA 4NMLA 3MZIA 1N5VA 3MAQA 3DFEA 2HURA 3OFFA 5KG7A 3BGRB 4NLVA 4I6YA 3D1HA 4ZPCA 4DQSA 3TA2A 5L1LA 2KJVA 5EHHA 3N6LA 1OPIA 1WEYA 3IG1B 5KT5A 4I64A 3TZYA 3NRBA 2KVIA 1OIAA 4KAIA 1HMVB 4FYDA 1FRHA 2HFZA 4LR7A 1R89A 3CJTA 5G4DA 4M5KA 4YHHJ 2OMLA 4LRBA 2QMUB 2IAJB 1YK9A 3OXFA 3MPUB 4QWDA 1IKVA 3WBZA 1NU4A 3I5BA 3UPFA 3M4XA 1FD2A 2IM0A 4ICLB 5HP1A 1S9GA 1QJHA 3RB6A 3C66A 1I5OB 1U4BA 3LTOA 3D66A 3OR1A 3ULHA 2XB2D 1GMWA 1REVB 4Q8EA 3F73A 5H9EK 2XS5A 4B17A 2DR7A 1X4AA 4Q2MA 2W7OA 3HHKA 2ZH9A 5GADI 4B3MJ 1YRUA 2WVBA 2W8KA 4EYIB 3SCLE 3CJ5A 3HM9A 3FK4A 3RB0A 1UVIA 3DYAA 2YKNA 1VCTA 4DR2F 4CO2A 3MXHP 1U49A 1HPZB 1J5OA 4QW8A 2XSFA 3EICA 2P6SA 1HNZJ 4RNHA 2ASDA 1KBRA 2B8QA 4NZ6A 2V5HG 4IOAQ 1NUEA 1B7FA 3J80Y 4KO0B 1CSJA 5GAGU 3TAQA 3GIMA 1REGX 3AXKA 3BSCA 2GVDA 3K89A 4EU0A 1VQ9S 5D6GA 1RWOB 5C2CA 2FTRA 4R5PA 3EXCX 1AFIA 3O2IA 4ZVQB 4A8WA 4NPOA 3GE9A 1C2PA 3CMAS 4DJBA 3OTDA 3L7PA 1V3SA 2YVSA 4B3RF 1JLBA 3OVAA 2HVIA 5EGYA 1KS2A 3H4DA 2OFHX 2GCFA 4RW4A 2IDLA 3H5XA 5GMDA 4ZITA 5F9NA 3FZ2A 4IH7A 4RW6A 4CTAB 4FPIA 1UJ5A 1LKZA 3ISZA 1X4GA 3EGVA 2FJWA 2F8EX 2R8HA 2KRBA 1H7XA 3KLFB 1YRXA 4RX6A 3TJAA 4KV8A 1NPPA 4WP3A 1W7WA 2C2MB 4LVOP 2FQQB 3EE3A 5D4LA 2AEMA 2KZMA 4TYAA 1UTAA 4BS2A 4JYAF 4YOEA 5BR8J 2PI4A 3JYTB 3UW1A 3GR0A 3WX8A 2WSCC 5B0EA 3NBPA 3OHBA 3DCAA 3S7RA 3AODA 1OQ6A 3PJ9A 3I5AA 2ZE2A 1T8EA 4KHPF 1NJWA 1XNRF 2FHKA 2K7JA 4KJIA 2WOMA 2BUNA 3MR2A 1S1WB 2HFUA 3UFCX 3Q22A 1Q86T 3PVXA 4PXBA 1AZSA 2GGPA 2BJEA 2IMOA 4ZDNA 3ADAC 1SH3A 3OFGA 2PO4A 2HRUA 3QIDA 2XSJB 1HFEL 1BXNA 3R5JB 2JFKA 2GIQA 2BQUA 1HI0P 4AFFA 4CM0A 2HNYA 4DV3J 4HI1A 3OUYA 2W25A 5H9FK 1NHUA 4GVBA 4DDFA 3DDKA 4K5SA 4C8OA 4N8NA 3JQKA 1SPBP 2BZ2A 1TQLA 2BJ8A 1Z2ZA 3BPDA 4NCGB 1YX2A 3ELHA 3BSNA 1TUGB 4KHRA 1LQ9A 1N0UA 4C6AA 4A47A 1YWXA 2NZCA 4RW8A 2AU0A 4LF7F 2LKZA 4LIWA 4Y00A 1S12A 3VAIA 2XHWA 3ETMA 1AT1B 3AA9A 3IP0A 3TJ8A 4X62J 4RLEA 3UN5A 3TI0A 1K1SA 2B4PA 3HT0A 2CPHA 2VG5A 3MI7X 1FVQA 2FC8A 1YBUA 2ZJQQ 1O6XA 3A4TA 4FKYA 4D3GA 2VBYA 1M5OC 1X7VA 4DI6A 5KFNA 3T1HF 1S1UB 5DDOC 4A8QA 4WBFA 4WFAQ 5C24A 4HVZA 1IQZA 1NB2A 3TVKA 5B7WA 2DNOA 3K17A 2CYYA 3UVJA 1TVRB 2HZAA 5KFPA 2KJWA 1R0CB 5J2NB 1RT2A 2VBZA 2R8JA 1S10A 2KI2A 2V8VA 3AB2B 4DX5A 2AEJA 3VAMA 4H4MB 5K8OA 4EMDA 4O23A 4GC7A 3QSYB 1MMNA 2W2PP 1TV6B 4J91A 3ETOA 3QIPA 2AW0A 1NRKA 1R3NA 1R43A 1VJWA 1RBLA 3DC2A 2YKPA 2HGLA 3E3XA 3X3UA 2OEMA 2DHXA 4IOCQ 3GP9A 2JEFA 2BMBA 4NE9C 1TELA 4WCEQ 4F2RA 1WEZA 2MHEA 1PIEA 3D5MA 4UQTA 1HHSA 3HVWA 5IV3A 1SL0A 1APSA 1HARA 4I69A 3DLJA 5E3CA 4GO7X 1QD1A 1ZA1B 2VOOA 1M5SA 2CQPA 4H4OA 4J9NA 1OSDA 3M8YA 1DLOB 3OL8A 2J9CA 4S0MA 2VIHA 4DSJA 2V68A 3GFHA 2K1RB 2IDEA 1N34J 3F56A 2VL1A 3HSZA 2A1BA 3FEZA 3SDEB 2DXFA 3K8VA 3O1LA 3MPWA 3AQOA 1HQ2A 2DGVA 3OL6A 1S1TA 2BE9B 4CYUA 3EDQB 1XR7A 2HNZB 3SQGB 2DRAA 4JB8B 3LP0B 1KN6A 4N47A 3R5DA 1UA1A 3M8PB 5F9LA 1Q0NA 3MTJA 4MK7A 1VS3A 3ZNUA 3A8IA 3UNGC 2YPYA 4ED2A 4HI2A 2Q66A 3CDUA 3GV7B 2F8HA 3I31A 1YIJS 1QTNB 3DGPB 5D4NA 4A48A 4XK8C 4ZLLA 3IN5A 3AH6A 2DGWA 5GVQA 4LF9F 4U8VA 1FJGJ 3RAQA 2LA6A 2YKMA 3DRPB 3JB9k 3EDRB 3ZZTA 2VPWB 2R7XA 3I32A 1NHVA 5DJBA 4LSNA 2OJ3A 3FQLA 5AXMA 1RBOB 2FB0A 1UMJA 2IA0A 4ZLNA 4ZK7M 3NMRA 3T41A 2ZKUA 4JI0J 3M7VA 4K4WA 1SJ3P 4ZN1A 5CD4A 1VBZA 1U2CA 1NEEA 1IR0A 1GFWB 2O01C 3TWZA 2HVHA 1VRUB 3O8WA 3KLHA 4MK8A 5HMXA 2F4FA 5I42A 4ZLPA 5CHCB 2DNKA 3GCXP 2E1RA 2RQ4A 1K0VA 2RKIB 1FDNA 4G6VB 3UE2A 4DR3J 2DGOA 1QVFR 1F60B 2ZBPA 1TKDA 3UO0A 3TUPA 2J7UA 5AJ3J 3CPWR 5C25A 3IRWP 3LP1B 1Q4RA 3QLHB 3R5BA 2UU9F 1WSVA 1W26A 3DRRB 4USIA 4J9OA 2VC1A 2RNEA 2V8DA 3FEXB 4FBTA 3A8JA 3H5UA 4OYBA 2M7SA 1DQAA 5HANA 4IG3B 5DGBA 3O6QA 2ZD1A 3BBFA 5K5MA 1GTHA 3BO3A 1D8ZA 5DDQC 5LXYA 1LOUA 2N3LA 2VPZB 5F3ZA 4WZMA 3D6MB 2FJDB 1N6QB 1KC8T 4C3LA 3MUVP 2BQRA 3HF5A 1U6BA 4O3NA 2YNHA 5D3GB 2FUG9 2OPPB 3U1LA 4NLXA 3IBWA 1TKZA 4WU3A 5F3TA 4P2FA 5LSOA 2V50A 3ZC4A 2ASJA 5F8JA 2RVJA 3M2VA 4M63A 2PDAA 4FPRA 3G71S 2PD1A 4NRUA 1T02A 2AJ1A 3GG1A 1VI7A 1C4CA 1KTQA 4F3QA 4HACA 2AV5A 1CJUA 4EZ9A 3R8YA 2DVIA 4OL8A 4LF6J 3HHLB 1D9DA 2BABA 1RT3B 3D1OA 2XMJA 3D1QA 2CJXB 4KPCA 1TKTA 5E3QA 4ETZA 4KGZB 2NUUG 1D1UA 2XMAA 4AQYF 3CJ8A 2W4PA 1P6TA 4CCHA 4KE5A 4RUCA 4I56A 2Q6BA 2LQBA 4CT9A 1XC9A 1KTVA 2HHHF 1IWAA 2DB1A 4ZVUB 2Y1RI 3T5KA 4WP9A 3LO3A 3PYDA 1FVSA 1KLMB 2G0JA 2YWWA 1N32J 2DNNA 5A6PA 2VFSA 2XCAA 2VQEF 2E7VA 2HHVA 4I2QB 4WTYA 3MPVA 2QSFA 4MTPA 3BDEA 2QO3A 2XI3A 3SMZA 2ZWOA 1VQKS 5EUHA 3N9UC 1S6UA 4L3NA 4NRTA 3CMQA 1S1XB 4OYZA 3WHIA 2GMJA 4LF2A 2E7XA 4Y2CA 1CJVB 3DOLB 3B8HA 4DSLA 4NEZA 2JSXA 3EUNA 3V6HA 3PKMA 3KWMA 3B6BA 4DR5J 3RU0A 4JV2A 4DR6J 5EWGA 5AXNA 2UXBJ 5KFQA 3POTB 2Y8WA 1ACMB 4G1PA 1RACB 4KYZA 3SCJE 4F04B 2AP6A 1AW0A 1C0UB 2COLA 3Q8RB 3UR0A 1LWEA 4DR7J 4IG0B 2C42A 5MAOA 4ECSA 1HNIA 4HLBA 3RB4A 4KRWA 1U1LA 1D09B 4FBUA 1NDKA 2Z56B 5ETQA 2R7UA 3HZEA 3ZTPA 2J6SA 4NLWA 3RGIA 4DV7F 4C98A 3Q8PB 1C0TB 4OI2A 2CJ9A 2UXDF 5J2MA 4OZLA 2VG7B 3J7YU 1N48A 5EX0A 3FBBA 1LXNA 3UN2A 2SXLA 1Y4ZB 1P9YA 2MQLA 2ZJPQ 2G2ZA 1RHUB 2ZH7A 4GKKF 5ETLA 3QJPA 4EBCA 4FNHA 3M8ZA 1WI8A 1W2IA 4YDDB 4OHXA 4JI7J 4EO6A 1C1BA 3MM8A 3RAXA 1ZM4A 1RXOB 4BCAA 4JV0A 3DDNA 3MMAB 2ZM6J 1GH8A 1AB8A 5KFYA 4LMZA 4JV5J 4DS5A 3CCTA 4N77A 4OI6A 4U7UD 2MLZA 3FQKA 1TFWA 4Z2XA 4ZP6A 4K4ZA 4DQQA 2CQCA 1P27B 2C2NA 4U9RA 2KM8B 4IOBA 2RHQB 4R0EA 2RRAA 1HNWF 3P3DA 1RTIA 4B9LA 3G8QA 5LXRA 3IR6B 1Y5IB 3HCXA 1EAYC 1RQ0A 3QGPA 2YWGA 1G4CA 2ALYB 3EPIA 1M1GA 2FHMA 3KLIB 1SJ4P 4CP5A 3NGSA 3CO0P 5CD4H 4B9NA 1GNKA 3BM7A 1RHRB 4N56A 4RW9B 4A8KA 2V4JB 1I51B 5HI7A 1NDPA 3IG1A 1B0TA 2Y0SD 1X0FA 2X3GA 5HQLA 2DNPA 2FVCA 3R7BB 1WF1A 4C8YA 1X9SA 5A8RB 2CQBA 4NLPA 1HMVA 3UCZP 4K59A 4WWSA 3V4IB 4PG4A 2GAGC 5A2QU 4O0IA 2CDRB 5GAHI 2IAJA 1FWLA 2VG6B 1XNQJ 4OI3A 3NMAA 2G13A 2UUCF 2G1HA 1Q5VA 4RUHA 4ZA1A 4ICLA 3W5YA 4DUTA 3DHWC 3PFEA 1IJEB 1A0OB 2CPDA 1EQMA 1YJRA 2MKHA 1KQGB 1WG1A 1CS4A 3CJ4A 4X4UA 4O3OA 4B3MF 1REVA 4JI6J 2XMMA 1L3UA 3MURP 2CUYA 2E9ZA 4CIOA 5D0GA 5C5JA 2HGNA 2R4FA 2DD8S 4FXDA 4ES1A 3PO5A 3DRSB 1HHQA 2V2ZA 2B7CB 1KQKA 4DL3A 4O0NA 2UP1A 3EJMA 1QTMA 5L46A 3QPIA 3OSPA 3K59A 4M5MA 2HQGA 5JMNA 2EFVA 3KHRA 1HPZA 3CCUS 3TEHB 1YHQS 5GAGI 5JVGQ 2JLFA 4F25A 1AROP 2AGQA 4UOHA 2MQPA 4KO0A 2BBEA 2ZITA 3HVTB 3G86A 1RJJA 3ZZOA 4ZVGA 5HK4A 5A76A 5C2GA 2ZFHA 3RUBL 4LR8A 1SKRA 1YDLA 1BD6A 1JLGB 3T1AA 2GX8A 1YGYA 2BEFA 4V1Ak 3WIVA 2J9EA 3BKUA 1NJXA 2DHGA 3SXLA 2FZCB 2AEFA 1XMQF 4X66J 3ITHB 4OYIA 2K3KA 3S1TA 3LW5C 4CTAA 4NLSA 1RAHB 5IWAF 4L75A 3W63A 2RRNA 4OLPA 3DNCA 1UFKA 4DV4J 4RL1A 1M1HA 2DNZA 3NAIA 3KLFA 5BR8F 2W8LA 2C22A 4BC7A 1CEZA 1Q1KA 5KG3A 4K4UA 1NJZA 2DHHA 1S9EB 2E1CA 3ENVA 3OSNA 2YWEA 3HKZD 3MTKA 2CWKA 4WK3A 3GIJA 3LUYA 5D4OA 2KG1A 3JYTA 2LU2A 4RBUA 4X4QA 2XY5A 3W66A 4KH1B 2DO4A 4ZPDA 3M32A 1WOOA 1XERA 3CJ3A 1OY9A 2E5LJ 4ZOSA 1PJ6A 3VV2B 3A8EA 2WTFA 1NB7A 2ATLA 6FD1A 3SFGA 2MZQA 5L9XA 3DKDA 2CIMA 1WC4A 2MZJA 3SZ2A 2OEJA 3UNYA 3HO1A 4WE1B 1FEEA 4YFUA 3DLKB 3N79A 4NLOA 1BC6A 2XG8A 3AOCA 5L1KA 2EWHA 2GHPA 3LF0A 2XTJP 4DV3F 2XSJA 2HLTA 3PIOQ 3VF0B 4A8OA 1IBMJ 3PO4A 3DU5A 5CZXA 2C3OA 1NK7A 4CLUA 5FIIA 4O4GB 3MCNA 2BOPA 4JI2J 1FTCA 4ECUA 2WVEA 1QVGR 2QEXS 3CVKA 1HA1A 4LSZB 2Q43A 1URRA 4A8SA 3W5ZA 4CRJA 1XJWB 3M8QA 3NS7B 4DV1J 1BHNA 3QGHA 4ID8A 1FF2A 1RTHB 2UVRA 4KSEB 2EFOA 4PG8A 5B0BA 5HVFA 4CLTA 4RUAA 3OBIA 1CLFA 3LQVA 4JBCA 4QIFA 3T19A 2RU9A 1OQ3A 1VJQA 5DLFA 2RB7A 2OPSB 4CM2A 2BDPA 4YEAA 1YZ6A 4DL6A 2XZWA 3M2UB 3NNAA 4OJ1A 1RA7A 3CW2C 2CNNB 2L9DA 4AD6A 1NH8A 3KHHA 3THPA 3EYZA 3P96A 2XNQA 1S1UA 1Y0HA 4NA1A 3CCES 3VR1A 4DUZF 3IRXB 2Y1LB 1NDCA 2JFDA 2ROEA 2B9EA 2UZAA 1TVRA 3QBCA 3OL9A 5J2NA 1YVFA 1U24A 2EVZA 3HHLD 3J81U 3D4JA 3FSYA 2QN6B 2QLJB 3CT9A 4EUVA 4NCAA 3RBXA 1N56A 3VZHA 1GXTA 2QX0A 2ZBRA 3HXMA 4FYXB 1ZPVA 2B4UA 1U6ZA 1QSYA 2IRYA 3TZZA 2ZNYA 5E3AA 1LWFA 1FWKA 4WXWA 3EZOA 3GONA 4DV5F 5HP1B 2N3OA 2MZ1A 2MSTA 3MR7A 2OI2A 3OR1B 2UVVA 4OV6A 4ZPWR 3MM9B 4LBPA 1PJ5A 3DLGA 3EX7B 3R5GA 5CQGA 4X4VA 2R2RA 3DOMA 2D41A 4K4VA 1ZM9A 1VBKA 3J7ZT 5EDWA 1M1KT 2BRLA 2JVRA 4F3MA 4NLRA 3CE8A 2ZBIA 3RAMA 3ZZPA 2NYHA 2WW8A 4I6WA 1IM6A 1TUVA 2CQHA 3KNGA 1DLOA 2HLUA 4ZPVR 4WIIA 2K1RA 1YI2S 1EKSA 4ZP9A 4HR2A 1S59A 4Y0FA 5B0FA 1YSJA 2JEGA 2HAIA 3KNAA 3SDEA 4OYAA 2QLWA 1DAXA 2GVDB 4OI4A 2W9BB 5KG1A 1Q16B 2HNZA 3SQGA 5E3PA 3MUTP 1SL1A 4C8MA 1S7HA 1LW2A 2J7WA 3C3LA 3BPSP 1BQMB 1KFSA 3V6DB 2F4VF 2FGOA 4RJVA 3KDNA 1NO8A 2R42A 4F02A 3MWBA 1VGYA 1ZZNA 1R8AA 4RW4B 3FSXA 4DOZA 5I3UA 4RW6B 4A8XA 5H1SV 5DG9A 3OFHA 4O44B 1JLQA 1T9XA 3JS9A 1QUVA 2YQ3A 2O67A 3W9IA 4YB1P 3DRPA 1OYDA 3Q2SC 2NPFA 2EFQA 1T9WA 3N5FA 3DRXA 3T1YJ 1H0HB 4JI0F 2B51A 3KLGA 5B0AA 2QRRA 4IUFA 2AJ2A 1NPKA 3B54A 1P8GA 4UOCA 2H5IB 1HNVB 4P72A 3W8GA 2BKNA 4O3RA 4NXMF 2IY5B 4HT7A 4J9PA 1A7GE 4WU2A 4OJ3A 1F5BA 3LP2B 3PACA 3NBPB 1I1GA 4DR3F 3FEYB 1VRUA 2QL9B 2IJRA 1VRQC 1Q8BA 2LA4A 2ZE2B 2R2TA 1JX4A 2HYIB 4V19J 2QFIA 1N4LA 1RT5B 5CYMB 2W24A 4ECWA 2MQOA 2WOMB 2RKIA 2HMIA 2GZOA 4NOHA 5HSPA 3BZQA 4Y34A 4TLRA 3BO4A 1IKXA 2VFRA 4C9DA 4RU2A 2QYCA 2JRSA 2XEXA 3GMGA 2VFTA 2FY8A 3BR8A 3LP1A 2J0XA 3TOQA 4I4BA 4C4WA 4DCPB 3QLHA 4F0HA 3HSGA 3S8SA 4Y3CA 3UD5A 3DRRA 1S79A 2KH9A 1Y5NB 1X0PA 4B08A 3NNHA 2F9JA 2AJ0A 3G96A 4CDIA 2Y0BB 4DLEA 5KTQA 1WKLA 1HWLA 4QR0A 1YRTA 1BWVA 1YJTA 2WB1D 2AYGA 1N6QA 3CCWA 2OO4A 2W2QP 2N7CA 5ADZA 2YNGA 2DNQA 5D3GA 1KR4A 3QRQA 3IM8A 1RAGB 1UEVA 3N01A 1NSQA 1MNEA 1EETB
chains in the Genus database with same CATH topology
4NEZA 2VQEJ 1HNWJ 1FJGJ 4DR4J 5AJ3J 4DV3J 4DR2J 4DR5J 4NXNJ 1IBMJ 4DV4J 2VQFJ 1XMQJ 1HNZJ 4JI1J 2MQ8A 5FLXU 4JI5J 4DR6J 2MEWA 3IMQJ 5LMUJ 4YHHJ 5BR8J 3J80U 3OTOJ 4DV5J 3D3CJ 4JI2J 4LF6J 2UXBJ 2UUBJ 4JI7J 4DR1J 4KYZA 4GKKJ 1XMOJ 3W1YC 4JI3J 2KL8A 2F4VJ 5IWAJ 4OX9J 4LF4J 4DR7J 4NEYA 5A2QU 4DV6J 4K0KJ 4YY3J 4LF9J 1J5EJ 4JI4J 2ZM6J 4JI8J 3D3BJ 4X65J 4AQYJ 1N34J 4DV1J 2UUAJ 4JV5J 4DUYJ 1XNQJ 3JAMU 4JYAJ 4DV2J 3R2CJ 5LM7E 2UU9J 3J81U 3J7AN 3T1YJ 4LFAJ 1IBLJ 4B3TJ 4JI0J 4DUZJ 4X64J 1N32J 1N33J 2MTLA 4X62J 4PWWA 2E5LJ 4KY3A 4V1Ak 4GKJJ 2UXCJ 2KVQE 4JI6J 4LF7J 4KHPJ 4LF5J 3R2DJ 4HHUA 2UXDJ 4B3MJ 1XNRJ 4X66J 4B3RJ 1HNXJ 2UUCJ 1HR0J 4DV0J 2HHHJ 5IT9U 1N36J 4DR3J 1IBKJ 4B3SJ 5LMNJ 4LFBJ 4LFCJ 3T1HJ 4LF8J 4NXMJ 4DV7J 1I94J 4RJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEZ A;  2VQE J;  1HNW J;  1FJG J;  4DR4 J;  5AJ3 J;  4DV3 J;  4DR2 J;  4DR5 J;  4NXN J;  1IBM J;  4DV4 J;  2VQF J;  1XMQ J;  1HNZ J;  4JI1 J;  2MQ8 A;  5FLX U;  4JI5 J;  4DR6 J;  2MEW A;  3IMQ J;  5LMU J;  4YHH J;  5BR8 J;  3J80 U;  3OTO J;  4DV5 J;  3D3C J;  4JI2 J;  4LF6 J;  2UXB J;  2UUB J;  4JI7 J;  4DR1 J;  4KYZ A;  4GKK J;  1XMO J;  3W1Y C;  4JI3 J;  2KL8 A;  2F4V J;  5IWA J;  4OX9 J;  4LF4 J;  4DR7 J;  4NEY A;  5A2Q U;  4DV6 J;  4K0K J;  4YY3 J;  4LF9 J;  1J5E J;  4JI4 J;  2ZM6 J;  4JI8 J;  3D3B J;  4X65 J;  4AQY J;  1N34 J;  4DV1 J;  2UUA J;  4JV5 J;  4DUY J;  1XNQ J;  3JAM U;  4JYA J;  4DV2 J;  3R2C J;  5LM7 E;  2UU9 J;  3J81 U;  3J7A N;  3T1Y J;  4LFA J;  1IBL J;  4B3T J;  4JI0 J;  4DUZ J;  4X64 J;  1N32 J;  1N33 J;  2MTL A;  4X62 J;  4PWW A;  2E5L J;  4KY3 A;  4V1A k;  4GKJ J;  2UXC J;  2KVQ E;  4JI6 J;  4LF7 J;  4KHP J;  4LF5 J;  3R2D J;  4HHU A;  2UXD J;  4B3M J;  1XNR J;  4X66 J;  4B3R J;  1HNX J;  2UUC J;  1HR0 J;  4DV0 J;  2HHH J;  5IT9 U;  1N36 J;  4DR3 J;  1IBK J;  4B3S J;  5LMN J;  4LFB J;  4LFC J;  3T1H J;  4LF8 J;  4NXM J;  4DV7 J;  1I94 J;  4RJV A; 
#chains in the Genus database with same CATH topology
 2LMI A;  1NK5 A;  2L08 A;  4I6A A;  4Q0B A;  4C8N A;  4FF2 A;  1JXV A;  4AL7 A;  4JI5 J;  1U0S A;  2HS3 A;  3VGU A;  5ETR A;  1VQO S;  2XZD B;  1TZ0 A;  1CJK B;  4K5R A;  2A2C A;  4KFB B;  3FRZ A;  1DFD A;  3SI8 A;  3T6B A;  2V9W A;  1RWN B;  2ZHA A;  3QJL A;  2ZC4 A;  1WOS A;  1X4E A;  5KT6 A;  3HHL A;  1D9F A;  2GJ2 A;  1FNO A;  4TY9 A;  4C3K A;  3GSI A;  2F40 A;  3EVM A;  3ENW A;  5F8I A;  4K4S A;  3DLE B;  2J8A A;  5LSL A;  1N32 F;  3D6T B;  3GWC A;  2QGF B;  1N52 B;  2L9W A;  4YQW A;  4DHV A;  3PW0 A;  2MPU A;  3NOG A;  3DLH A;  4LQ9 A;  4ED5 A;  2P9G A;  5HJY A;  3T5H A;  1RAE B;  1KQF B;  2CJK A;  2HHW A;  4NXN F;  1Q82 T;  1X5O A;  4Q43 A;  3MDF A;  1T95 A;  1TL4 A;  1HR0 J;  1PG5 B;  3JSY A;  2OAU A;  3OW2 R;  2QJ3 A;  2IM3 A;  2J6U A;  2ZJR Q;  2Z2Z A;  3KXD A;  3LWM A;  2VHG A;  2O1P A;  4I2Q A;  1WKK A;  2H4Y B;  2AIR B;  2DR6 A;  3QIP B;  1Y11 A;  2V2Q A;  2PFF B;  4JI8 F;  1T03 A;  2VQF J;  2B0G A;  2ALZ A;  2FVP A;  4DF4 A;  4IKA A;  1S1X A;  4TQS A;  3HI9 A;  4AND A;  1NJI T;  3FBC A;  2YWF A;  1PBU A;  3DOL A;  2XYG B;  2MZT A;  3BBC A;  3CCM S;  4DR7 F;  3D9B A;  4QZV B;  3VQT A;  4ZIW A;  3I0S B;  3PEJ A;  1N5Q A;  3AY0 A;  1SH0 A;  1IUJ A;  1HHT P;  1H2U X;  3POT A;  2UUW A;  4ED8 A;  1C0U A;  2I1R A;  4B3T J;  2CFX A;  2NCK L;  3O3L A;  2LXF A;  5IOL A;  3PX0 A;  2B9Y A;  3CUN A;  5E33 A;  3TW0 A;  4M95 A;  1EB0 A;  2KKH A;  2HG4 A;  2PEH A;  3L7U A;  1FX2 A;  3ZTO A;  2IBO A;  1B99 A;  4EO8 A;  4CH0 S;  1HBM A;  5KFI A;  3HSJ A;  3J7Y I;  3AFG A;  4L73 A;  5B0D A;  2ZH4 A;  1NSA A;  1C0T A;  1LWC B;  1RB0 A;  2CQ2 A;  2VG7 A;  2W9A A;  2V9K A;  3R7S B;  4WKR A;  1N54 B;  3KK1 B;  2ZOG A;  1S6O A;  3RB3 A;  3SQO P;  2W7P A;  1S1T B;  2PI5 A;  4YB5 A;  1L3K A;  2DNY A;  3PRB A;  1FEH A;  1S4E A;  3CJK A;  4ENO A;  2FJA B;  3OTB A;  3MEC A;  1WHW A;  2D3O R;  2PC6 A;  5J2Q B;  2DBB A;  2B3T B;  4DR1 J;  2H5E A;  1K9M T;  3CJ2 A;  5EX3 A;  4U8Y A;  2D69 A;  4DL0 C;  4N5S A;  2CJA A;  2Y1J A;  2HK2 A;  4EI2 A;  2PMZ D;  2LFV A;  5KFM A;  1J5E J;  4Q7A A;  4ZPT R;  4DQI A;  2NRE A;  4ZCM A;  4DV2 J;  2DKO B;  4XPE A;  4DPY A;  4BWM A;  2XWY A;  1CQN A;  1NKC A;  1JB0 C;  2VKZ G;  2JH3 A;  3A3O B;  3MMA A;  1R31 A;  2YKM B;  1F9F A;  2GML A;  3QWP A;  2J9D E;  1U0H B;  4ZVR B;  3E8O A;  4UTG A;  4HH0 A;  1Y5L B;  5A8W B;  2CNO B;  1B0P A;  2ASY A;  2V2V A;  2ZZM A;  3RR8 A;  4LSN B;  5IT9 Y;  4ZVS B;  1VQ8 S;  4B3S J;  4LFB J;  4OZJ A;  1QAY A;  8AT1 B;  1PYS B;  1QAI A;  3NGD A;  3KHL A;  1PJ7 A;  5SUH A;  2HQD A;  4JI1 J;  5HRO B;  3NOC A;  3OLB A;  4PEO A;  5I42 B;  4FYW B;  2V4J A;  4HYK A;  1JLE B;  3T9Z A;  1JJH A;  3KUH A;  2WB4 A;  1XNQ F;  1U25 A;  1X4D A;  1M5V C;  4TU9 A;  2QIF A;  1AFJ A;  3K7R A;  5A8R A;  4JV1 A;  2QLB B;  4U7C A;  3MCM A;  2XS2 A;  1YJN S;  1Y00 A;  4LRA A;  2NZ4 A;  4OV1 A;  3A12 A;  5KFV A;  3G6V A;  3PTW A;  4KY3 A;  4LF8 F;  3HHE A;  3RR7 A;  4P7T A;  4JI6 F;  1T7P A;  3US5 A;  4LF5 J;  2P9C A;  2OTL S;  4CO3 A;  4DV0 J;  4C8K A;  1KKH A;  4MYT A;  2ZVI A;  2ZWP A;  4OX8 A;  3HSD A;  3D28 A;  3D6F B;  1M0S A;  1IM4 A;  1H3D A;  2ADB A;  4QR2 A;  1I94 J;  3CUL A;  3GIR A;  3JSM B;  3HJV A;  4OYM A;  5D8H B;  4ZCI A;  4CLF A;  3A3P B;  4L76 A;  1Q8K A;  2YNH B;  1VYA A;  2HWH A;  2ZH3 A;  2EKN A;  5JJB A;  4IH6 A;  1VQP S;  4DV6 J;  2RRB A;  1UVL A;  4K4Y A;  4PWD B;  2XMK A;  2ACY A;  2JVO A;  3RBD A;  4P7V A;  1VIO A;  3N28 A;  1X5P A;  4HAC B;  5CAB A;  1VQS A;  3IGN A;  4M94 A;  3KKF A;  3BJY A;  1S76 D;  4AXJ A;  1RWP B;  2BM0 A;  1P1L A;  2OSR A;  1ZM2 A;  4OFZ A;  1ZYQ A;  4LRC A;  1SJQ A;  4IRK A;  4Y2K A;  2V8H A;  2P6T A;  4ILR A;  3X1L B;  1TKT B;  3CTR A;  2PII A;  4XAK A;  1YIT S;  4FS1 A;  5K14 A;  2FVS A;  2W2O P;  1XIQ A;  4OX7 A;  4WFN Q;  2W1B A;  2YH1 A;  5FD1 A;  3PW4 A;  2OH2 A;  1SIW B;  3ITH A;  5HN0 A;  3EZ5 A;  4ED3 A;  1WTF A;  2ROP A;  5ETM A;  2I8E A;  3UDE A;  5IQ6 A;  4HHJ A;  2V94 A;  4J5O A;  4TLQ A;  3EVW A;  1PCA A;  2VA2 A;  2MQQ A;  4UT4 A;  1B4S A;  2DGQ A;  1IR2 A;  1U2R A;  3V6J A;  2QSW A;  4NLG A;  4U95 A;  4B9S A;  1Q78 A;  4OZ3 A;  2KFZ A;  3J7A N;  3KJF B;  2CQG A;  2R8K A;  4Q5V A;  4KTQ A;  2WVC A;  2BA9 A;  3V2U C;  3PW5 A;  2EFP A;  3JTN A;  2UV8 G;  2GQC A;  3Q23 A;  1S9F A;  1LV5 A;  5HAT A;  2BJ1 A;  2M0G B;  4QIG A;  2KFN A;  1FDB A;  4CQ1 A;  1LWE B;  3CDW A;  4Y2A A;  1FKA F;  2MDA A;  3WQP A;  4TYB A;  4ANE A;  1HNI B;  8RUC A;  2OMO A;  2DNH A;  3OQ2 A;  7FDR A;  4J9M A;  1RAO A;  3TAP A;  2NLW A;  1VC6 A;  3P45 B;  2MZS A;  4WE1 A;  3K58 A;  4P2X A;  3QZ7 A;  1V9O A;  3DLK A;  2DR8 A;  3IMQ J;  1P9Q C;  3LAN A;  4RW7 A;  4J9U E;  2EFN A;  1Q79 A;  1X4H A;  5LJ3 Y;  3W2W B;  2Z58 B;  3GR1 A;  2JHE A;  2VJV A;  2EXU A;  3DI6 B;  2CA9 A;  2GMH A;  1FKP B;  4O4G A;  5L1I A;  4ED6 A;  1ZS6 A;  2UXC F;  1KLN A;  3TP2 A;  4LJM A;  3P8B B;  1SVD A;  3O44 A;  3SV4 A;  4ILL A;  2V2K A;  3NWG A;  5K20 B;  4KB7 A;  3PR4 A;  1RU1 A;  3JSB A;  3N0V A;  5DGA A;  5I3P A;  1S97 A;  3TVY A;  1V5V A;  2NQP A;  1RTH A;  1QM9 A;  4FVM A;  3HMJ G;  3HK2 A;  3DOK B;  2HBZ B;  1XN9 A;  3CSK A;  3KJQ B;  1RT7 A;  2KZZ A;  2CG4 A;  1S57 A;  5AXK A;  3CD5 A;  5L9N A;  2OPS A;  2PSZ A;  3DXB A;  1ZA2 B;  3D0H E;  2M88 A;  2F9D A;  4UQG A;  1RZM A;  3PW7 A;  3M2U A;  3KMQ A;  1ZET A;  2R3V A;  3HPO A;  2LXU A;  4NLT A;  1R0A B;  2XCP A;  5CYJ A;  2POK A;  2VZ9 A;  3HVA A;  1ITP A;  1SL2 A;  4FNI A;  3RRG A;  3ET6 A;  1UW9 A;  4LBH A;  4ZIV A;  4R8U B;  5D0E A;  1NND A;  4EK2 A;  2HBQ B;  1SQE A;  3JAM Y;  4NLU A;  3IRX A;  5HBM A;  4PKD B;  5HLF A;  5T41 A;  5A0Y A;  2WSE C;  1DY3 A;  2VUG A;  2CVI A;  2LCW A;  1BQX A;  1V5I B;  4ATN A;  3KDO A;  4CNZ A;  4ZPA A;  3HZG A;  4DSE A;  3UCU P;  3AD7 C;  3HD2 A;  4HT5 A;  1YBT A;  3W64 A;  2OGU A;  2A18 A;  3CC2 S;  1UAW A;  3CD7 A;  5GAH U;  3CB4 A;  1IR1 A;  1D3W A;  4ER8 A;  2G0C A;  3RBZ A;  3JTO A;  5KG6 A;  5K8P A;  2YH0 A;  2M2B A;  5FDL A;  2CAJ A;  3ZO7 A;  1SUQ B;  3BQ1 A;  2R8G A;  4ZPB A;  1JLA B;  1CS4 B;  2CQD A;  3R6G B;  3KUG A;  3MM9 A;  3PX6 A;  4NMX A;  3G6X A;  2RSQ A;  2DY9 A;  3C46 A;  5KFZ A;  2BX6 A;  3U1M A;  3EGW B;  2XWX A;  2D74 B;  5L38 A;  2DCL A;  4AXI A;  1RAD B;  3PHE A;  4O3S A;  4PAA A;  2H65 B;  3GU0 A;  3V4M A;  4KGM A;  4USW A;  3VZI A;  2HZV A;  4UOF A;  3W2V B;  4UOG A;  3MGJ A;  4B3R J;  3F0N A;  5KG4 A;  1FXD A;  2NS1 B;  3V81 A;  5D0H A;  4OHZ A;  2U1A A;  3R1L A;  4ZVP B;  4ILM A;  1HLW A;  1SQG A;  4QWC A;  4ZJO A;  5KG0 A;  2VF3 A;  1CJT A;  4LF4 F;  5M2R A;  2W9B A;  2IJN A;  2A2D A;  2OKQ A;  3V5R A;  3DDI A;  3BH7 B;  1BQM A;  1I3O B;  2JX2 A;  3V6D A;  2KXF A;  2BAN B;  4LFA F;  4F36 A;  2B7B B;  4DLG A;  4K4T A;  1QY7 A;  4I2P B;  4P2M A;  2WZ1 A;  1YJW S;  2PFD A;  4J90 A;  2FLL A;  4JYA J;  4KGX B;  2H5J B;  1WG4 A;  4LSL B;  4O44 A;  3D0G E;  2OFG X;  3VGV A;  2MLX A;  3U1N A;  2APO A;  5CCM A;  3QAU A;  4YP3 A;  4R25 A;  1BGX T;  3R5A A;  2G1D A;  3HFZ B;  2R2S A;  2QV6 A;  1NPR A;  2GHV C;  1RWM B;  4KHP J;  2ADC A;  1XNR J;  3BB5 A;  2PE8 A;  4RNO A;  1V6H A;  4DS4 A;  3C6T B;  5GAE I;  1HNV A;  2P8I A;  1FWP A;  4I67 A;  3R27 A;  1RTJ B;  4LF1 A;  3C2P A;  1LNQ A;  1MN7 A;  1T9Y A;  3LP2 A;  3TVZ A;  2DPJ A;  4WYL A;  4JI4 F;  3M32 B;  2YTC A;  4LT6 A;  2MEW A;  3J80 U;  4J9S A;  3CIZ A;  1VQL S;  1FRK A;  1RT5 A;  1IBC B;  5CYM A;  3DM2 B;  2AQ4 A;  1O0P A;  2MJU A;  1VIS A;  2RQM A;  2FD2 A;  4N8O A;  5FJ4 A;  4C97 A;  4B9T A;  1UVJ A;  4NYZ A;  2K06 A;  2UUA J;  3CJS A;  2KB2 A;  1KFD A;  4DSK A;  3CDE A;  3M8R A;  1GEH A;  3ZZY A;  2ZH2 A;  2YX1 A;  4CI0 B;  1Z1Z A;  2LLZ A;  4YUD A;  5IS2 A;  3NCQ A;  1U45 A;  3MD3 A;  4NAS A;  2MKC A;  1CUL A;  3PX4 A;  4HTI A;  4LF7 J;  4XDD A;  3R2D J;  1NK4 A;  5KFS A;  3KYL A;  3M8Q B;  3ICL A;  1U48 A;  1FKO A;  4FKX A;  1B70 B;  2FY1 A;  4ZJQ A;  3VVT A;  4FP9 A;  2W7A A;  2LEP A;  3H0P A;  1VLO A;  1EX8 A;  4XDC A;  4LRD A;  1NLK L;  4JI5 F;  1BMQ B;  1O8B A;  2PA8 D;  1A6L A;  3N6N A;  3VWS A;  2MY7 A;  1EET A;  5AE2 A;  5KFC A;  3AA8 A;  3HDS A;  3IGV A;  2OSQ A;  5SZT A;  2WVD A;  3KFW X;  4XPC A;  3IWL A;  5DQH A;  3I6P A;  4HL9 A;  4MK9 A;  3FSI A;  1NK0 A;  1CJK A;  2VPX B;  4MIB A;  4CLW A;  3B4D A;  4KFB A;  2E9R X;  4EWT A;  1KEK A;  3WX4 A;  4WK1 A;  1OS5 A;  3R9L A;  2XGP A;  2DNL A;  2EG1 A;  3IAM 9;  2FLN A;  4E98 A;  2VH7 A;  1TK8 A;  1F3V A;  2ZNZ A;  2C2D A;  5H9E J;  3DLE A;  5ETS A;  2L3M A;  3GTY X;  1S0N A;  1HR0 F;  3K2Y A;  4RR5 A;  2E5J A;  3VVU A;  3TA0 A;  2EBE A;  3I9Z A;  4ECQ A;  3QFH A;  1JLC B;  3EVO A;  2J8S A;  4ECR A;  4RNF A;  2YKA A;  2LQJ A;  3CCV S;  4WFX A;  1DRZ A;  4PRF A;  1UJ4 A;  2VQF F;  4M5L A;  2HK3 A;  1FES A;  1D8Y A;  2CPY A;  2CQ0 A;  4ED0 A;  5B09 A;  1JXL A;  1LWF B;  4MT1 A;  1KD1 T;  2RU3 A;  3GFY A;  2HS4 A;  4ZP8 A;  2B4V A;  1U1R A;  4Z37 A;  3LAK A;  3SSR A;  4EZ6 A;  1BY9 A;  4PQU B;  4X4S A;  2OPQ B;  2GQ2 A;  4P75 A;  3R2C J;  1KSP A;  2LDY A;  4UST A;  2GFF A;  1CC7 A;  1TL3 B;  2HND B;  1F2H A;  2OP5 A;  3I0S A;  4NWB A;  3JTP A;  5IFM A;  4NZ0 A;  1IBK F;  1VC5 A;  3DLG B;  2HZC A;  4IH5 A;  3DOM B;  2D9O A;  4X84 A;  4BHQ A;  2KT5 A;  4BWJ A;  5MLC V;  5M2U A;  3IS9 B;  3ILL A;  4CH7 A;  3ZTS A;  1TR0 A;  3ZFV A;  1OWX A;  2MB0 B;  3UWT A;  2RD5 C;  3BF4 A;  1BQN A;  1SKW A;  4YR3 A;  4UY8 T;  1GT8 A;  4X65 F;  2BM1 A;  5KFU A;  3GSD A;  4EBD A;  2RE1 A;  4IR1 A;  2HQC A;  3S01 A;  1LWC A;  3CO9 A;  1DAR A;  3M1V B;  4L6V 3;  1IBL F;  5KOW A;  3KK1 A;  1RAJ A;  3M9M B;  3I56 S;  4JI3 J;  4Y6I A;  4NEY A;  4IO1 A;  3M2R B;  4LF9 J;  3PEH A;  1ICE B;  5J2Q A;  1LW2 B;  5C42 B;  2AYB A;  4ECY A;  2HIY A;  2ZBC A;  2XLJ A;  3Q0A A;  3MED A;  1WAC A;  3BBB A;  1RLC L;  4ECV A;  4LFC F;  4PWW A;  4UY8 5;  2CG8 A;  4NLY A;  2KRR A;  3UDC A;  2E5H A;  5I3U B;  2DRD A;  3BGF A;  1VHF A;  3G6Y A;  2JEJ A;  5L1J A;  5EWF A;  5CAA A;  1JLQ B;  1JNR B;  5LMU F;  1U0H A;  4LFB F;  4ID5 B;  1U26 A;  2C28 A;  3TUZ C;  3BSA A;  3MCO A;  4EBE A;  2CXE A;  4KKO B;  5A8W A;  1V3R A;  5AXL A;  2FHO B;  4DR4 J;  4KH0 B;  3KLG B;  3AXM A;  1SJ1 A;  4JI1 F;  2C1E B;  2MQM A;  5KFT A;  1XR6 A;  2JEI A;  5FLX Y;  3NAH A;  3E51 A;  1NME B;  1WC5 A;  2KU7 A;  5H9F J;  2HIQ A;  2MGZ B;  1ZTW A;  2C3U A;  5HRO A;  2OPR B;  4A8M P;  4M5I A;  2Q6C A;  4G3I A;  2UU9 J;  4OLO A;  2EKY A;  1YLX A;  1JLE A;  2Z2Y B;  3VGS A;  4CLS A;  2HMI B;  4ZVF A;  1RHJ B;  1TFY A;  3UI3 A;  1NKB A;  2ZH5 A;  1Q5Y A;  1IKX B;  2CPE A;  3PKY A;  1J2V A;  3W5X A;  4DV0 F;  1MML A;  1JJ4 A;  3E01 B;  2FJE B;  1X9W A;  1U2F A;  4K2J A;  4URS A;  3FZB A;  4OI1 A;  4WJB A;  3TUI C;  2XY7 A;  4FF1 A;  1VQ5 S;  4KQZ A;  1AUD A;  2DEJ A;  4J9Q A;  4MKY A;  1NKE A;  4OYX A;  3IR5 B;  1AUS L;  2V4Q A;  2QMX A;  4ZCL A;  1KOO A;  1K0T A;  4U6P A;  4OJG A;  3MPY A;  1WC1 A;  3JSM A;  2NSB A;  5K9F A;  2YNG B;  2B5J A;  1SXL A;  2ZDO A;  2WK4 A;  2HBY B;  2B9W A;  3NP5 A;  3ZNJ 1;  3M30 A;  2XMW A;  4N7T A;  1Q81 T;  4O3Q A;  3B82 A;  3RJM B;  4QWB A;  2XY6 A;  2F3J A;  4Q0B B;  4PWD A;  1PGZ A;  3J81 j;  1WOP A;  3M6W A;  4OI0 A;  2RHS B;  4IRC A;  1S5Z A;  1CBK A;  4YB6 A;  2HHH J;  2GQQ A;  3GYN A;  2OIH A;  3LPY A;  5J2P B;  3LGH A;  5LMN J;  4RBV A;  4FYY B;  5IM0 B;  2QMW A;  1T0T V;  2HHS A;  2VQE J;  1LW0 B;  5ETP A;  2XMV A;  2UUT A;  1UPP A;  1A9N B;  4ELV A;  2DGS A;  3ZXW A;  2K7K A;  1H73 A;  1OSC A;  4I1T A;  3BKT A;  4Z7Y A;  4AE5 A;  1HQE B;  3TX0 A;  1FFS B;  4ELU A;  1YQH A;  1BUX A;  1G1X A;  2GS8 A;  2D7S A;  2HHT A;  4RNN A;  3TZX A;  3M8S A;  3BV8 A;  4NI2 B;  2YX4 A;  3M05 A;  4USH A;  4DFJ A;  1RGV A;  3QZ8 A;  4ZVE A;  3W9H A;  1UWB A;  2ZUA A;  1QSS A;  1Q7Y T;  4L72 B;  1T03 B;  4CNY A;  3B4M A;  1S1V B;  1GMV A;  3KJV B;  5HVH A;  5AE1 A;  3ISN D;  3LWL A;  3AOA A;  4WTO B;  4MFB A;  4K7Q A;  2ZOF A;  3BR9 A;  5BYR A;  3THT A;  3CCS S;  4USV A;  1S7I A;  3OXG A;  3BYP A;  1UZH A;  5L8R C;  3Q8V A;  5HMW A;  2DH8 A;  4TVA B;  1Y3J A;  2AGP A;  4DV7 J;  3GB0 A;  3T5J A;  5C7P A;  3I96 A;  4K0K F;  2HEK A;  3OTC A;  2FZG B;  2OLW A;  3OJS A;  3I9V 9;  2BR0 A;  4M5H A;  2I6W A;  4DU8 A;  4NA3 A;  2PN6 A;  5KFD A;  4CO4 A;  3C19 A;  2O5D A;  4P73 A;  2OTJ S;  2XS7 A;  3KK2 B;  2KYX A;  1HL6 A;  4GKK J;  2QA1 A;  3ZZZ A;  1B3T A;  4X64 F;  3GLJ A;  1FA0 A;  4QU6 A;  1BLU A;  1XMB A;  1GTE A;  1JNZ B;  1NSK L;  3IC1 A;  3T9N A;  1HBM B;  2LU1 A;  4DUY J;  1LK5 A;  1LFP A;  4H54 A;  5IXU A;  3W2W A;  4O4R A;  3H7H B;  1GXL A;  3I0R A;  1WC3 A;  4DL7 A;  3DI6 A;  1U1P A;  4K50 A;  2ZHO A;  2WON B;  1HI8 A;  1FKP A;  1RLD A;  1TAQ A;  3CJK B;  2W2M P;  4J7C A;  3MEC B;  4DX6 A;  3CJQ A;  2Y8Y A;  1F5A A;  2RF2 B;  2PA3 A;  4P52 A;  2HRT A;  2YBV A;  2BJ3 A;  3SBM A;  3I87 A;  4ZLJ A;  3KTQ A;  2LYV A;  4YN3 B;  2V67 A;  3GZ7 A;  5F41 A;  2DPI A;  2XUL A;  1MU2 B;  4DWI A;  4OYP A;  2BJD A;  3Q24 A;  3C14 B;  1HNW J;  3MCS A;  2LEC A;  3G2X A;  2VJU A;  4CLL A;  2AT1 B;  2IYI A;  3DOK A;  3WC0 A;  3M9N B;  1XTZ A;  2FJB B;  3THV A;  3CWJ A;  2BQ3 A;  1NHK L;  3MD1 A;  3OPK A;  1HBO B;  3ZTR A;  3C16 B;  3MAA B;  4ZKA A;  3KMS A;  5JXS A;  4ED4 A;  2HVE A;  1QAX A;  3QGG A;  4OYW A;  4DN0 A;  1R0A A;  2H48 B;  2HKE A;  2CJY B;  2W01 A;  1IJF B;  5HAO A;  1BE4 A;  4F8R A;  3AQP A;  3D0I E;  2LQ8 A;  5G0R B;  1IKY A;  4WKY A;  4R8U A;  4KGV B;  3U27 A;  1RT6 A;  2AJF E;  2JWN A;  4HHU A;  3PHT A;  2UUC J;  3MMJ A;  1C4A A;  2CNK B;  1PBA A;  4YHH F;  4F0M A;  3CF5 Q;  5U47 A;  1LK7 A;  1B64 A;  5CYQ A;  2J5A A;  1FE4 A;  3BDP A;  3J7A 1;  3IBC B;  5F8N A;  3IFE A;  4GRS A;  2QL7 B;  3OXL A;  5K8M A;  3ILI A;  2DIU A;  3W62 A;  1H72 C;  3ZZ0 A;  1FDD A;  3IM9 A;  3H40 A;  3R7N B;  4DPT A;  4PXC A;  4OX9 J;  3ILJ A;  4QU7 A;  1X60 A;  3L9Z A;  4MKA A;  4DSI A;  3QWU A;  4Q8F A;  1SUQ A;  2J0Q D;  3OR2 B;  1ZOT A;  1JLA A;  1VFJ A;  2FLO A;  3MPD A;  1RWW B;  1AXQ A;  2CAD A;  2Z0G A;  1G7C B;  3QGI A;  4FXW A;  2IVF B;  1R7I A;  2FVQ A;  1MN9 A;  2U2F A;  1PC4 A;  1IQT A;  4BDP A;  4ETX A;  1GX6 A;  3TYT A;  1FO1 A;  3T3F A;  2I9S A;  1HNZ F;  3EZU A;  1JLF A;  1XEZ A;  2EK1 A;  4J9L A;  1GX5 A;  1WG5 A;  3BKF A;  2RAQ A;  1BWE A;  1Y7P A;  3AJD A;  1DTQ B;  2BRK A;  2WRM A;  1NK6 A;  3W2V A;  4QIW D;  1XMQ J;  2K2P A;  4CLZ A;  2MQ8 A;  1WHV A;  1RHQ B;  5D0R A;  3A8K A;  3FVY A;  3T5L A;  5IWA J;  2DNG A;  3PM9 A;  1KVJ A;  2HQ3 A;  1U8W A;  5K14 B;  1TU0 B;  3UQS A;  4EEY A;  2BAN A;  2N7Y A;  1O51 A;  2IRX A;  2W4C A;  1MW7 A;  3FFI A;  2X1G A;  2VA3 A;  1E6Y A;  2R7O A;  1VBY A;  4I2P A;  2ATC B;  2LQ5 A;  1OMS A;  3GJT B;  1N33 J;  1HI1 A;  4C11 B;  5E41 A;  4UUX A;  4B02 A;  3RW6 A;  4LSL A;  3BN4 A;  3ZTQ A;  2H4W B;  3Q8Y A;  3MM7 B;  1UCN A;  1WOR A;  2AHO B;  3HKW A;  4QQB A;  1SH2 A;  3C6T A;  4KR0 B;  3CC4 S;  3FC9 A;  2JNJ A;  5F8H A;  1YJ9 S;  1GXU A;  4PG7 A;  4USU A;  1LEO A;  2VON A;  1X4F A;  2KXN B;  4KBI A;  1RTJ A;  4OX6 A;  2OEL A;  2KN4 A;  2L9N A;  5RUB A;  3FUY A;  2A10 A;  4DX7 A;  2HVD A;  2YXL A;  1HBN B;  2NUH A;  3M6V A;  3GFX A;  1TMM A;  1TKX A;  3W9J A;  1RYS A;  2UUA F;  4IDK B;  1U1O A;  2BE2 B;  4KT0 C;  3EGN A;  1DQ8 A;  1X5S A;  3DM2 A;  3W60 A;  5F0W A;  3HJF A;  3TA1 A;  4X4N A;  2CZ9 A;  3QO9 B;  1FCA A;  3JSR A;  4HDG A;  4RW7 B;  1V3Z A;  1FJC A;  2Y9H A;  1F9E B;  2CPF A;  4O3P A;  1I6J A;  3CCZ A;  1WF0 A;  3C6U A;  4WF9 Q;  2MJN A;  5E2Q A;  3CCR S;  3KK3 B;  1S48 A;  2ZZN A;  5JUM A;  1HQU A;  1F1B B;  5HQ8 A;  3L95 X;  2DNR A;  2MLY A;  2EK6 A;  2MKK A;  5CXT A;  2XGQ A;  4OYO A;  1T11 A;  3QT6 A;  3FDS A;  1NCL A;  2DNM A;  4LVN P;  3HHD A;  3CME S;  4DXL A;  5A8K A;  4X62 F;  1UJ6 A;  3VAG A;  4OZN A;  1RT1 A;  4UZC A;  5DZ7 A;  1T05 B;  3VQS A;  2C2E A;  3QYY A;  3R5C A;  2QLF B;  2XQC A;  1S6Q B;  2KO1 A;  5ETK A;  2P2C B;  2E5G A;  1RT7 B;  2AX1 A;  3OLA A;  4OZ2 A;  2IRU A;  3AJ1 A;  4DUZ J;  3NCR A;  4W98 A;  1RYR A;  3H5Y A;  2HWT A;  1UEK A;  3FCW A;  3R6L B;  3G87 A;  4F4X A;  2GO9 A;  4Y2I A;  1W2B R;  1H2T Z;  4G65 A;  2LDI A;  2M9K A;  1UZD A;  2CQ4 A;  4MH8 A;  1DTT A;  2DCU B;  4A8Y A;  2C3Y A;  3ET6 B;  5DRK A;  3FNN A;  1SI9 A;  3FBF A;  4DU7 A;  4JP8 A;  5HBM B;  4NYP A;  3OTE A;  5HLF B;  3TX8 A;  2XZT B;  5A0Y B;  4IQX A;  2B6A B;  4USM A;  2OHD A;  2RUS A;  3BRE A;  3WIU A;  1JLC A;  4DV5 J;  2DRB A;  2FHJ D;  3Q8U A;  4IFV B;  4ES3 A;  4WXO A;  1R6Y A;  2QTW A;  2ROG A;  2HHU A;  1XR5 A;  1RU2 A;  3MEG B;  2CQI A;  2HHX A;  4WFZ A;  3TR5 A;  3QMQ A;  2D3Z A;  3N6M A;  3LPE A;  4F50 A;  2D9P A;  2NXU A;  3MAH A;  3DN9 A;  3I4H X;  5DET A;  1OYE A;  4WIQ A;  3EXY A;  1G3O A;  1OO0 B;  4ELT A;  4UZB A;  3GPA A;  3GJS B;  1YZ7 A;  3KLE B;  5KT7 A;  1NJY A;  4PQU A;  3NCP A;  2OPQ A;  5FDL B;  4DL4 A;  5DM6 Q;  1FER A;  1ELO A;  3H2U B;  4F0K A;  1S4F A;  1UL3 A;  1RA6 A;  1TL3 A;  1QE1 B;  3ISN C;  1KVI A;  2HND A;  1MSW D;  4PXE A;  4OMF G;  3OV7 A;  1K44 A;  2VB6 A;  3N5B A;  2CPX A;  1EAR A;  4CO0 A;  1FK9 A;  2C2Z B;  4HH1 A;  3C15 A;  4OHY A;  5GMK a;  4Y65 A;  1EKR A;  5M2P A;  2M8D B;  3IS9 A;  5KFA A;  2YWH A;  4PCQ A;  2DK2 A;  4Z7C A;  2AJQ A;  2H51 B;  1N34 F;  3JQM A;  2WW4 A;  1UWA A;  4A46 A;  4PUO A;  1KNZ A;  3MMC A;  1U47 A;  1FX4 A;  4DQP A;  4JI3 F;  1KP6 A;  5KFR A;  3PG9 A;  2F4V J;  5B08 A;  1HWI A;  4F4W A;  6FDR A;  3V81 B;  1VMB A;  3CNQ P;  4E0D A;  5T7L B;  3FMW A;  4UF4 A;  3M1V A;  1N5Y A;  2HGM A;  3NS5 A;  1CJT B;  3M2R A;  3TQE A;  3UDL A;  2AMC B;  2GVZ A;  4QWA A;  3S6E A;  3J7Z 5;  2E1M C;  4DBQ A;  5C42 A;  2CPJ A;  4QPT A;  2XLK A;  2JLE A;  4W90 B;  2W2N P;  1FJG F;  3GCW P;  1Q7L B;  3RBE A;  4X4O A;  5F8M A;  3EPG A;  4ES2 A;  4YME A;  5KFK A;  4IQM A;  4M5N A;  1FI4 A;  1QSL A;  1ZH5 A;  4PQA A;  4MIW A;  1JWW A;  3W61 A;  1K73 T;  4OQJ A;  4NXM J;  1F9H A;  4DR4 F;  3GII A;  2DHA A;  3PR5 B;  3TAM B;  3F41 A;  2F1F A;  2IPO B;  1PIL A;  2BOA A;  1EQ0 A;  1SB6 A;  3G8T A;  3PDN A;  2XM3 A;  4ID5 A;  3W3S A;  4BC9 A;  4TY8 B;  3IWX A;  2QA2 A;  3I5C A;  1IN0 A;  3K5P A;  4KKO A;  5AE3 A;  1X5T A;  2YPZ A;  1NK8 A;  4HKQ A;  2CNL B;  1HBU A;  3G8S A;  3SCK E;  1FXR A;  2K8G A;  5ETO A;  4Q2L A;  2WBR A;  4RKU C;  2VBX A;  4DG1 B;  1EJ7 L;  4CWB A;  1U1Q A;  4P6Q A;  4F26 A;  2VFU A;  5KOX A;  1F5C A;  5GAE U;  2GHW A;  4EGL A;  2MGZ A;  3RG6 A;  3SFU A;  2ZH1 A;  1RAB B;  5J1P A;  2DR5 A;  2OPR A;  2XMU A;  2DH9 A;  5KT2 A;  4PPZ A;  1MWZ A;  2RUG A;  2ILZ A;  2I5J B;  3P6Y C;  1VR6 A;  3Q89 A;  3EGZ A;  5AJ3 F;  3OJU A;  5K8N A;  4MKV A;  2IC3 B;  3GV8 B;  3GG0 A;  4WZQ A;  3K5O A;  2HAF A;  2UVW A;  2BJ7 A;  1ULR A;  3PJX A;  3ENA A;  2BAC A;  3ONQ A;  1Q53 A;  5LOQ A;  3E01 A;  3E2E A;  4PYD A;  1OY8 A;  2ZOM A;  4NX9 A;  1CUL B;  1SBR A;  2A6M A;  1HYS B;  5CH7 B;  5DG8 A;  5T14 A;  1FD8 A;  1U1M A;  2QL5 B;  1CQM A;  4XTT A;  2M4M A;  3Q8Q B;  1RHK B;  1SV5 A;  4L3K A;  1XQI A;  1FKO B;  2KT3 A;  1RE1 B;  5KFB A;  1FRX A;  3OL7 A;  4DQR A;  5IT0 A;  4QIV A;  2AD9 A;  3PYF A;  2XO7 A;  3QFW A;  3P4U B;  3KG0 A;  1UVN A;  3I4P A;  2IBK A;  1RK8 A;  2HPU A;  2DT9 A;  3M6U A;  2MY8 A;  3CCL S;  1UKU A;  2Z8Q A;  5LMN F;  4LF6 F;  4DF8 A;  2YY3 A;  4YR0 A;  2BVZ A;  2JDJ A;  2V6A A;  2ZDP A;  2N4D A;  1NK9 A;  3GJQ B;  3I55 S;  3PFO A;  4NXN J;  1LFW A;  4NCB A;  2NYI A;  2A3J A;  2H9Z A;  5J2P A;  2FHJ A;  1RTD B;  2D1C A;  1SJF A;  1F2G A;  2QT7 A;  5IM0 A;  1Z2L A;  3NEK A;  4IRD A;  2VDI A;  3H2V E;  2YNF A;  1LW0 A;  2JL9 A;  4N41 A;  2VV5 A;  2YNI B;  2NXC A;  2ACM A;  3NGU A;  4I7F A;  4JI8 J;  1HQE A;  2W9C B;  2NXJ A;  4NA2 A;  1HKA A;  3MEE B;  1IVZ A;  4MJK A;  4Y28 C;  1U1N A;  2YKO A;  2Z57 B;  2KDO A;  4L74 A;  4G1Q B;  2VFV A;  4YB7 A;  2AJ4 A;  4NI2 A;  4ECX A;  2E66 A;  4LQ3 A;  1UFW A;  4DR5 F;  3AOB A;  3CXC R;  4DR6 F;  3HP6 A;  4KPY A;  1TL7 A;  1AA1 B;  2GJI A;  1S1V A;  3FJ2 A;  5IZH A;  3UR3 C;  3KJV A;  2UXB F;  2FC9 A;  2ZC3 A;  1X9M A;  2IVM A;  1DQ9 A;  2ABY A;  2X1B A;  2RT3 A;  4RBT A;  3BQ0 A;  1FHT A;  1EP4 B;  3H8Y A;  2RDD A;  3G82 B;  1KOH A;  4C3M A;  1DUR A;  4P71 A;  1F3F A;  1UPM B;  2I38 A;  2IJF A;  1NZA A;  3DLB A;  3L7O A;  4KC5 A;  2VU5 A;  1C1C B;  5A2Q Y;  2P5V A;  2CDQ A;  1TL1 B;  4DUY F;  3LAL A;  1YTY A;  4CLP A;  1S6P B;  1VK8 A;  3CIM A;  3KK2 A;  3FCH A;  1RWU A;  4QBU A;  1Q8L A;  1VQM S;  3CJ0 A;  4QJV A;  1BQN B;  1ZAW A;  3H59 A;  1SC3 B;  4DPU A;  1FXL A;  4ZN3 A;  3PY8 A;  3ZZR A;  4GKJ J;  1WTB A;  2E9T A;  4BLG A;  2M5Y A;  4U67 Q;  1YJV A;  1K1Q A;  4GC6 A;  1HWJ A;  2WON A;  1HNX J;  1TK5 A;  5HJX A;  2Y1I A;  2QE5 A;  3MUM P;  3TNV A;  1Q8I A;  1WKJ A;  4WFY A;  2HFN A;  4JI7 F;  2RF2 A;  1VDH A;  3PRV A;  2CZ4 A;  1O5J A;  3A3N B;  3NGK A;  2GO8 A;  2BYC A;  3ENQ A;  3MED B;  4QPX A;  2FJV A;  3EM1 A;  4NLD A;  3QT8 A;  2ZM6 F;  3Q2T C;  4GVL A;  4YS2 A;  4JV5 F;  1MU2 A;  2NXE A;  3IR7 B;  1HW9 A;  5KFO A;  2OD4 A;  1NH7 A;  3BGR A;  2ZKT A;  1ZPW X;  3UDV A;  3C14 A;  3VTI A;  4TU7 A;  1TUW A;  2FDN A;  2Y3Y A;  4A4J A;  3IWN C;  2XYP B;  2VIC A;  4DN9 A;  1FNX H;  1Y3K A;  1CC8 A;  3LGN A;  2XI2 A;  1HBO A;  1MWY A;  3C16 A;  3MAA A;  5L39 A;  7AT1 B;  1X31 C;  1PYT A;  1L3T A;  3G4S S;  3QJJ A;  2CJB A;  1TK0 A;  2FPH X;  2DY1 A;  1FJ7 A;  3MM5 B;  3HHN B;  3G9C A;  4CLY A;  4M1K A;  4DEZ A;  2Q79 A;  2UV8 A;  1M5K C;  2M52 A;  5G0R A;  4OZ5 A;  3PYE A;  2LQ9 A;  5E5N A;  2VC0 A;  3D54 A;  2XC9 A;  4CLK A;  5B0C A;  4LF8 J;  4NLQ A;  4QCL A;  2OD6 A;  4NL5 A;  2CQ3 A;  2PMH A;  4M5D B;  2G2Y A;  2H3E B;  2QG9 B;  4WYW A;  4NYO A;  3SSQ A;  5DLG A;  2DJW A;  3D7S B;  1KHV A;  4OX9 F;  1CVJ A;  1XMO J;  1KQS R;  1JK9 B;  2DGU A;  4LRF A;  4C0B A;  3OVB A;  1H6K X;  4OJH A;  1HWU A;  1X8D A;  2IVY A;  3M6X A;  1VLY A;  5D15 A;  5DG7 A;  3DHX A;  2RH3 A;  1U6F A;  2IHR 1;  1NSP A;  2B43 A;  2L48 A;  3NL0 A;  3OR2 A;  4NZ7 A;  2HFO A;  2XBP A;  3OD2 A;  3U7J A;  1RT4 B;  2N82 B;  4I68 A;  4OHW A;  2JC1 A;  4TU8 A;  4PR6 A;  5I4M A;  5ETT A;  3CCQ S;  4ZVH A;  2JC0 A;  3DRY A;  3T6J A;  3BGO P;  3VHQ A;  3FGV A;  5IT9 U;  2B5J B;  3IA0 A;  3GIK A;  2B8P A;  4ED1 A;  3M30 B;  4PG6 A;  5IQQ A;  1OJ4 A;  3KOA A;  1RKJ A;  4MIA A;  6AT1 B;  5DM7 Q;  4LRE A;  5F8G A;  1R8B A;  5IC6 B;  1DTQ A;  2RS8 A;  2UUB J;  4WFB Q;  4C2M A;  3FCV A;  1EIY B;  4A8F A;  2DGX A;  1ZTT A;  1L3V A;  1PKU A;  4YY3 J;  5LJ5 Y;  4C0O C;  1NM2 A;  2X1F A;  4JOU A;  4YR2 A;  4QR1 A;  2A0F B;  4X66 F;  2R7V A;  1VRT B;  3QSI A;  4M5G A;  4ZHR B;  2B4O A;  4CZC A;  1N33 F;  1QLN A;  2BKP A;  4ZVT B;  2VOP A;  1E6V B;  1CG2 A;  3AAW B;  2DEI A;  2F63 A;  3SV3 A;  3FMB A;  1IKW B;  4ZMM A;  2IFX A;  2NPI A;  3OVS A;  2Q1L A;  4DV4 F;  4EYH B;  3GFZ A;  4C11 A;  3BN7 A;  3V6K A;  1SQF A;  3DMJ B;  3UD4 P;  2DYA A;  5BYQ A;  1X4C A;  5KFW A;  4DL5 A;  4PPD A;  1N36 J;  1FFW B;  1MRO B;  2YWK A;  4HTJ A;  4IFY B;  4J9V A;  4Y2M A;  1FT8 A;  8ATC B;  2WBM A;  2YQ1 A;  3PV8 A;  4F67 A;  2E44 A;  1UWB B;  4USJ C;  1S1W A;  1DZ5 A;  1JKH B;  4JUZ A;  2H1Y A;  2XHC A;  3OT9 A;  3MM7 A;  4FYV B;  1ZM3 A;  3OTO J;  3NLC A;  4OZ0 A;  1TTH B;  1RAI B;  1XK8 A;  4AL6 A;  2DXE A;  4WPA A;  4MFB B;  2ZH6 A;  4F4Z A;  2J0S D;  2CJQ A;  2RDJ A;  2E5L F;  3MHY A;  3BGL A;  1WJ9 A;  1FRI A;  1FRJ A;  3FKB A;  4M8L A;  1R6V A;  3HFV A;  5KFF A;  1HBN A;  3J81 Y;  2K3I A;  4QOT A;  2C2R A;  2I2Y A;  2DIT A;  4IDK A;  2BE7 D;  3NGT A;  2O66 A;  4C8Z A;  3MM6 B;  5DS7 A;  3RRK A;  4LR9 A;  2HFS A;  2BE2 A;  1UVK A;  3F44 A;  4PXD A;  3MMB B;  4PG5 A;  1QDU B;  9RUB A;  2GA7 A;  2UXC J;  5BYS A;  1FDA A;  2RIL A;  1IBM F;  4QYR A;  1ZZF A;  5LL6 d;  3QO9 A;  4NCG A;  3BSO A;  1FJE B;  2YX7 A;  4JI2 F;  3BQ2 A;  3NGR A;  4K4X A;  4PAB A;  4TNO A;  4I0W A;  1UEU A;  2E1P A;  3I0R B;  3KK3 A;  2RQC A;  2CZV C;  1UW4 A;  2GIF A;  3KG4 A;  4DV1 F;  2R8I A;  2R7S A;  4DPO A;  5J1E B;  1WHX A;  3K0J A;  4V19 X;  4UW2 A;  4QIE A;  1MG7 A;  1RWV B;  4YDX A;  2QFJ A;  4B3O B;  1G2E A;  2GC8 A;  2MKS A;  1W25 A;  1KRP A;  1EHW A;  3MOZ A;  3C8Y A;  2GAH C;  3PRD A;  4F3O A;  1DJ0 A;  4WP8 A;  2G0I A;  2AYM A;  1JJ2 R;  2J7K A;  3GIL A;  3R1H A;  2XYH B;  1SKU B;  1HD1 A;  4TXS A;  3AT1 B;  1RUS A;  4P2S A;  2V69 A;  5E0O A;  1T05 A;  5IV4 A;  2D3U A;  4C48 A;  1S6Q A;  1RWK B;  2QA4 S;  2FYX A;  3Q8S B;  2PT0 A;  2KVQ E;  4KHM A;  3D2W A;  1Q95 G;  3SIP B;  2OEK A;  4H4M A;  3L3C A;  3BGU A;  3MFI A;  1Z4U A;  4XIU A;  2CPZ A;  4N76 A;  3LA0 A;  1F6T A;  3LGM A;  1T9U A;  5KFJ A;  1HW8 A;  2FZK B;  4DL2 A;  4IO9 Q;  3A1Y G;  1P1T A;  1TV6 A;  3NKY A;  4CH1 A;  1H98 A;  2MMY A;  1IKV B;  5HVG A;  2ZH8 A;  4J37 A;  1WDT A;  5HQM A;  3RRH A;  1S9G B;  1IKY B;  3DGV A;  1RT6 B;  1T9V A;  1GQE A;  1U8S A;  2KG0 A;  3VAK A;  3FRY A;  2JZ5 A;  1S0V A;  3DXS X;  2B6A A;  4RWW A;  4DPX A;  2AWZ A;  1VQ4 S;  4IFV A;  1S77 D;  2L41 A;  5CYQ B;  1S0O A;  2N4C A;  2QC3 A;  3MEG A;  2WVF A;  3H90 A;  1QAJ A;  1SCJ B;  2ZVS A;  2MZR A;  5HMZ A;  5KG5 A;  2NR0 A;  5GAD U;  1VK3 A;  1UVM A;  5DQG A;  2RJZ A;  3NY0 A;  3I82 A;  3DYA B;  4B9V A;  1WSR A;  2YKN B;  3HUL A;  3HX9 A;  2MXY A;  3LAM A;  5KT4 A;  4AUK A;  2CRL A;  3KLE A;  1J5O B;  1U1K A;  3TEG A;  2AX0 A;  2ERR A;  4QYZ J;  3GYX B;  2W4D A;  3N4W A;  3CGI A;  4C0H A;  4X4P A;  2DTJ A;  3H98 A;  1QE1 A;  1WEL A;  1D9A A;  1M5P C;  2M8H A;  4DR2 J;  3K5N A;  4DFP A;  1YJ7 A;  4R5P B;  1MLA A;  1WD6 A;  1M5H A;  3BH6 B;  3MOJ B;  4X4T A;  5F8L A;  3LOU A;  4IYQ A;  3LP0 A;  1Y9O A;  2V63 A;  2ASL A;  3M8P A;  4FF4 A;  2IM1 A;  3HD1 A;  5HL7 Q;  3AB4 B;  2HHQ A;  1JLB B;  4LF4 J;  1JLF B;  2J6T A;  2BW7 A;  1LXJ A;  3AD9 C;  2DH7 A;  3DGP A;  3MF5 A;  5ETN A;  4X2B A;  3OHA A;  5ETV A;  3JAM U;  4DCO B;  2JJ4 D;  2Z2L A;  4ECZ A;  3D6H B;  1WC0 A;  3D68 A;  1HD0 A;  4LFA J;  5T7L A;  5KFG A;  4F4K A;  3A13 A;  2HWI A;  4KV8 B;  2VD3 A;  1T3N A;  4CO1 A;  3WC2 A;  3SEO A;  4B9M A;  2ZZT A;  1GK8 A;  4MYU A;  5D78 A;  5BJR A;  4OZ1 A;  2GJF A;  1SIZ A;  1RAF B;  3FFI B;  1E6Y B;  1FE0 A;  2KHD A;  2ZEJ A;  2AF6 A;  1LWX A;  3K5M A;  1G6B A;  3VGT A;  3T1Y F;  1PC5 A;  2HFV A;  1HWK A;  5DDP C;  3MEK A;  3PW2 A;  3HFK A;  4AYB D;  3TAM A;  2KL8 A;  1B0V A;  3W7B A;  5DDR C;  2I0X A;  4R0J A;  4KIA A;  1SJR A;  4TY8 A;  1WC6 A;  2BKO A;  4JI4 J;  2QLX A;  2GNK A;  4F2S A;  1TL5 A;  2BV3 A;  2B9X A;  2V8G A;  3O5T B;  2ZHB A;  1ZBT A;  1UP1 A;  4DSF A;  1AZS B;  4FF3 A;  2GGP B;  5CZV A;  2HBR B;  3PZP A;  4TN2 A;  4ZS6 A;  2RS2 A;  4DG1 A;  2AGO A;  3G6E S;  2FVR A;  3NWR A;  2FIU A;  1PAU B;  2QYG A;  3HVR A;  2HVZ A;  3TAN A;  3Q83 A;  4DPW A;  2HNY B;  4W4M A;  2GIR A;  2I5J A;  4IG3 A;  4ZCK A;  1TKX B;  3KJN B;  2KTQ A;  3OUY B;  2DIS A;  3TAR A;  3NXZ A;  2RDI A;  4GVB B;  2HRY A;  2MKY A;  2EBG A;  4DZ6 A;  2KT2 A;  3H4B A;  2IC3 A;  4F4A A;  3MR6 A;  1RKI A;  2LEA A;  3QQC D;  2JLG A;  1L3S A;  4OHV A;  2F7V A;  2OPP A;  2C2O B;  3W65 A;  2V34 A;  3M8W A;  5KAK A;  4RW8 B;  5DZ6 A;  3K57 A;  3PJW A;  2J0W A;  2MQN A;  3C6U B;  3HLU A;  3NS6 A;  4RWX A;  1HQU B;  4EFA C;  1HYS A;  1HIY A;  3KUE A;  3CDA A;  2VG5 B;  1GMU A;  1N5S A;  1VIX A;  4P74 A;  4RPF A;  1RBA A;  3NG8 A;  4BBY A;  2LVW A;  5D77 A;  2MTL A;  2KFY A;  2XO6 A;  4CO5 A;  1T3O A;  3TRG A;  3CC7 S;  3DU6 A;  4ZJL A;  1RT3 A;  2HSE B;  1DHM A;  4C7Q A;  5A8K B;  5C24 B;  2V4R A;  4QWE A;  1RCX B;  4FXV A;  3GQC A;  1RT1 B;  1YG0 A;  5LT5 A;  1WWH A;  1EZZ B;  3UVJ B;  5BXI A;  2MSS A;  5IT4 A;  2E29 A;  3T1H J;  2UVU A;  1RT2 B;  3CJR A;  5E3R A;  1FTR A;  3PYG A;  1KLM A;  1VQN S;  4Q44 A;  1ROF A;  3P5B P;  2CVE A;  2A6O A;  1MWQ A;  2Z2M A;  3QT5 A;  4HDH A;  3CD6 S;  1CPZ A;  5IC4 B;  3OFE A;  4ANC A;  2EPI A;  1SC1 B;  4J9R A;  4K8R A;  2R9L A;  3CD0 A;  2LXI A;  1RTD A;  1DTT B;  5KFL A;  3UD3 P;  2J76 E;  4AT1 B;  2CQ1 A;  2AZ3 A;  5KFH A;  1CJV A;  2CWX A;  4H4K A;  2YNI A;  4P9S A;  2E5I A;  2RQK A;  4LIR A;  1GAO A;  2G9O A;  2W9C A;  1M90 T;  3MEE A;  3JQJ A;  4HEA 9;  2MYF A;  4G1Q A;  2AKW B;  1AYE A;  3LH2 S;  2KXH A;  4FN5 A;  4IG0 A;  2XLI A;  5KT3 A;  3DLL Q;  1IBK J;  3K8W A;  1N0V C;  2EG2 A;  1KWM A;  4LBI A;  3MR3 A;  4H4O B;  4F7V A;  3QRR A;  4DX8 H;  1R8P A;  1WI6 A;  3IBF B;  3D3C J;  3NNC A;  2R7Q A;  3KG1 A;  2Q3P A;  4HHH A;  4B3T F;  2H54 B;  3W1Y C;  4ZP7 A;  4U7U K;  1SKS A;  4J9K A;  1EP4 A;  4DCJ B;  2QA4 G;  4CYU B;  4X65 J;  3G82 A;  3H42 A;  1FK9 B;  1S49 A;  3H2L A;  3C15 B;  5LM7 E;  2HW3 A;  1IWG A;  3R3T A;  1N8R T;  2WCX A;  9ATC B;  1U7L A;  1IBL J;  4U96 A;  1C1C A;  5E7O B;  2P9E A;  1TL1 A;  3CDB A;  2X51 A;  4FZV A;  4PUO B;  1WEX A;  4ED7 A;  1S6P A;  4GKJ F;  2E1A A;  3CED A;  3QAE A;  1PAE X;  3FBE A;  3MMC B;  1D0E A;  4OIX A;  5KG2 A;  4W92 B;  2WSF C;  1VC0 A;  3RZA A;  4DFM A;  3IAS 9;  1HNX F;  1VQY A;  3M9O B;  4URQ U;  1FFG B;  1RP5 A;  2MHN A;  5EN1 A;  2PGC A;  1Y10 A;  4DR1 F;  4LFC J;  1SC4 B;  1TMJ A;  2BJ9 A;  1N5Y B;  1NBE B;  2PMW A;  1JXE A;  3QT7 A;  1J5E F;  2EEY A;  5AT1 B;  1KON A;  2GVZ B;  2R7R A;  3W8P A;  3TZW A;  4DV2 F;  5LMU J;  2QZ8 A;  2MKJ A;  1JQG A;  2E7W A;  1T9T A;  3L09 A;  1R0B G;  3VCD A;  5KFX A;  2EI5 A;  2ZBQ A;  4DZD A;  1YKW A;  1TAU A;  3KLI A;  4GMK A;  3D3B J;  2X3D A;  1NXI A;  1R27 B;  2VPY B;  3KLH B;  3TUJ C;  4E2F B;  2F5G A;  4P10 A;  2CPI A;  4RW9 A;  3RYL A;  2V0N A;  3WZ0 A;  2X7I A;  3PIP Q;  4X4R A;  2NSC A;  3QNW B;  4B3S F;  4RO0 A;  1N5T A;  3R97 A;  2C3M A;  1KHW A;  5THW A;  3WDO A;  2ILY A;  2F65 A;  2DIV A;  2XNR A;  3V4I A;  1HBU B;  5ITH A;  1NDL A;  3HHL C;  5C25 B;  5A6W A;  3KHG A;  1VOM A;  4D3H A;  4MMO A;  2VG6 A;  3BYR A;  1RAA B;  5CA5 A;  3MM5 A;  3H5S A;  4ECT A;  1VHI A;  4FDF A;  5D4P A;  3BS9 A;  2Z30 B;  3VAJ A;  2MKI A;  2ZD1 B;  2X1A A;  1B7Y B;  1RWX B;  2YQ0 A;  4TQR A;  3PNI A;  1J27 A;  1XMO F;  2KYZ A;  2IYG A;  4RNM A;  4M5D A;  4AL5 A;  3SSS A;  3SYZ A;  1F0X A;  2D3O 1;  1JMT A;  2AYE A;  1URN A;  3GJR B;  5JVH Q;  5F0U A;  1WDD A;  2EC2 A;  4LF5 F;  2RML A;  2EW9 A;  3EWG A;  3DRS A;  1PYO B;  3UCG A;  1TKZ B;  1S0M A;  4ITS A;  1GMW D;  3ZZU A;  1R8C A;  3PXG a;  2WHO A;  3M2V B;  4H4K C;  2FJX A;  2R2U A;  4QW9 A;  2YKQ A;  3IXQ A;  1I94 F;  2PEB A;  1RHM B;  5HMY A;  1S99 A;  4PZV A;  1YBA A;  1U02 A;  3VAL A;  1K47 A;  1KVK A;  1SV5 B;  2M70 A;  1CJU B;  1UA0 A;  2FGC A;  3D67 A;  1RT4 A;  2GW8 A;  1H38 A;  1MMD A;  3HVT A;  2VAS A;  2CKW A;  2DR9 A;  1L5U A;  4QYZ K;  1XWL A;  4ALZ A;  4DV6 F;  1DBD A;  2HS0 A;  2J9D A;  1N88 A;  4FS2 A;  1RSC A;  1UET A;  2HQF A;  2BW2 A;  2EC0 A;  5FLX U;  1JLG A;  4MKB A;  1FNM A;  2UUB F;  5KFE A;  1UFL A;  1VQ6 S;  2EFG A;  2HHP A;  2RIJ A;  2LEB A;  4YY3 F;  5CCL A;  3QAT A;  1WHY A;  1H74 A;  2F8M A;  2Z4P A;  4AQY J;  1R8H A;  1RIS A;  4KGK A;  1ZAX A;  3ILO A;  2LP4 A;  4ZVO B;  2DXD A;  3RW7 A;  4PYA A;  2VOD A;  4Q45 A;  1RI7 A;  4F4Y A;  3P5T L;  4C8L A;  5HO4 A;  1RCO B;  3RTV A;  5J1N A;  1K8A T;  4DFK A;  3AD8 C;  2VKR A;  4XO0 A;  5LSR A;  1VRT A;  1S9E A;  2DO0 A;  3GV5 B;  1PSD A;  3AJ2 A;  3VAF A;  4ZHR A;  2YNF B;  2B56 A;  2ZUG A;  2XMT A;  3SCI E;  4FVC A;  1E6V A;  3KLV A;  1NAQ A;  4MAK A;  3MFH A;  1N36 F;  3VAH A;  2DHS A;  3L4B C;  4I7F B;  1IXK A;  1IKW A;  1NZ8 A;  2M3D A;  4CT8 A;  3IO1 A;  1ZAV A;  1WF2 A;  4TKT A;  2WAQ D;  3DMJ A;  5DQI A;  2G2O A;  2FLP A;  1VQ7 S;  3OTO F;  2KHC A;  1MRO A;  1KDN A;  4IFY A;  4USK A;  4K2X A;  4RU9 A;  1FRL A;  5DO2 A;  2C2K B;  1YJU A;  2KM8 C;  4E8U A;  4RZR A;  1JKH A;  3TO8 A;  1S72 S;  4K0K J;  1RTZ A;  5EWE A;  1TL7 B;  7FD1 A;  1H2V Z;  5B0G A;  3CCJ S;  5J2M B;  4X64 J;  4LUB A;  3U02 A;  3TQ1 A;  4GO5 X;  1PO6 A;  3P49 B;  4M5J A;  1JJC B;  3H25 A;  2BXJ A;  4G1I A;  1VBX A;  3GYG A;  2VBW A;  2UXD J;  1WUU A;  3BEG B;  4B9U A;  3PCO B;  2O3D A;  3MM6 A;  5GME A;  1T94 A;  3EMT A;  4UUW A;  3MMB A;  5I3Q A;  1RDR A;  1TP7 A;  1C1B B;  3MM8 B;  3AHP A;  4PWU A;  4IR9 A;  4RUB A;  3B78 A;  2AZ1 A;  2G4B A;  1JIH A;  1FRM A;  3MR5 A;  3BO2 A;  3TJ9 A;  3K5L A;  2JOQ A;  3H20 A;  2VDH A;  3HT3 A;  4DMZ A;  2DGT A;  2HQI A;  2IA6 A;  1XBW A;  1X4B A;  3QRP A;  4URG A;  2IIH A;  2NXN A;  2IM2 A;  1H7W A;  2GV1 A;  5J1E A;  2OUG A;  1U09 A;  1SC6 A;  2R7W A;  1WNE A;  2IMW P;  1QUP A;  2C3P A;  3JXO A;  4ERD A;  3UN3 A;  2V8P A;  3Q86 A;  1OY6 A;  1RTI B;  1OPZ A;  4B3O A;  2R7T A;  4NML A;  3MZI A;  1N5V A;  3MAQ A;  3DFE A;  2HUR A;  3OFF A;  5KG7 A;  3BGR B;  4NLV A;  4I6Y A;  3D1H A;  4ZPC A;  4DQS A;  3TA2 A;  5L1L A;  2KJV A;  5EHH A;  3N6L A;  1OPI A;  1WEY A;  3IG1 B;  5KT5 A;  4I64 A;  3TZY A;  3NRB A;  2KVI A;  1OIA A;  4KAI A;  1HMV B;  4FYD A;  1FRH A;  2HFZ A;  4LR7 A;  1R89 A;  3CJT A;  5G4D A;  4M5K A;  4YHH J;  2OML A;  4LRB A;  2QMU B;  2IAJ B;  1YK9 A;  3OXF A;  3MPU B;  4QWD A;  1IKV A;  3WBZ A;  1NU4 A;  3I5B A;  3UPF A;  3M4X A;  1FD2 A;  2IM0 A;  4ICL B;  5HP1 A;  1S9G A;  1QJH A;  3RB6 A;  3C66 A;  1I5O B;  1U4B A;  3LTO A;  3D66 A;  3OR1 A;  3ULH A;  2XB2 D;  1GMW A;  1REV B;  4Q8E A;  3F73 A;  5H9E K;  2XS5 A;  4B17 A;  2DR7 A;  1X4A A;  4Q2M A;  2W7O A;  3HHK A;  2ZH9 A;  5GAD I;  4B3M J;  1YRU A;  2WVB A;  2W8K A;  4EYI B;  3SCL E;  3CJ5 A;  3HM9 A;  3FK4 A;  3RB0 A;  1UVI A;  3DYA A;  2YKN A;  1VCT A;  4DR2 F;  4CO2 A;  3MXH P;  1U49 A;  1HPZ B;  1J5O A;  4QW8 A;  2XSF A;  3EIC A;  2P6S A;  1HNZ J;  4RNH A;  2ASD A;  1KBR A;  2B8Q A;  4NZ6 A;  2V5H G;  4IOA Q;  1NUE A;  1B7F A;  3J80 Y;  4KO0 B;  1CSJ A;  5GAG U;  3TAQ A;  3GIM A;  1REG X;  3AXK A;  3BSC A;  2GVD A;  3K89 A;  4EU0 A;  1VQ9 S;  5D6G A;  1RWO B;  5C2C A;  2FTR A;  4R5P A;  3EXC X;  1AFI A;  3O2I A;  4ZVQ B;  4A8W A;  4NPO A;  3GE9 A;  1C2P A;  3CMA S;  4DJB A;  3OTD A;  3L7P A;  1V3S A;  2YVS A;  4B3R F;  1JLB A;  3OVA A;  2HVI A;  5EGY A;  1KS2 A;  3H4D A;  2OFH X;  2GCF A;  4RW4 A;  2IDL A;  3H5X A;  5GMD A;  4ZIT A;  5F9N A;  3FZ2 A;  4IH7 A;  4RW6 A;  4CTA B;  4FPI A;  1UJ5 A;  1LKZ A;  3ISZ A;  1X4G A;  3EGV A;  2FJW A;  2F8E X;  2R8H A;  2KRB A;  1H7X A;  3KLF B;  1YRX A;  4RX6 A;  3TJA A;  4KV8 A;  1NPP A;  4WP3 A;  1W7W A;  2C2M B;  4LVO P;  2FQQ B;  3EE3 A;  5D4L A;  2AEM A;  2KZM A;  4TYA A;  1UTA A;  4BS2 A;  4JYA F;  4YOE A;  5BR8 J;  2PI4 A;  3JYT B;  3UW1 A;  3GR0 A;  3WX8 A;  2WSC C;  5B0E A;  3NBP A;  3OHB A;  3DCA A;  3S7R A;  3AOD A;  1OQ6 A;  3PJ9 A;  3I5A A;  2ZE2 A;  1T8E A;  4KHP F;  1NJW A;  1XNR F;  2FHK A;  2K7J A;  4KJI A;  2WOM A;  2BUN A;  3MR2 A;  1S1W B;  2HFU A;  3UFC X;  3Q22 A;  1Q86 T;  3PVX A;  4PXB A;  1AZS A;  2GGP A;  2BJE A;  2IMO A;  4ZDN A;  3ADA C;  1SH3 A;  3OFG A;  2PO4 A;  2HRU A;  3QID A;  2XSJ B;  1HFE L;  1BXN A;  3R5J B;  2JFK A;  2GIQ A;  2BQU A;  1HI0 P;  4AFF A;  4CM0 A;  2HNY A;  4DV3 J;  4HI1 A;  3OUY A;  2W25 A;  5H9F K;  1NHU A;  4GVB A;  4DDF A;  3DDK A;  4K5S A;  4C8O A;  4N8N A;  3JQK A;  1SPB P;  2BZ2 A;  1TQL A;  2BJ8 A;  1Z2Z A;  3BPD A;  4NCG B;  1YX2 A;  3ELH A;  3BSN A;  1TUG B;  4KHR A;  1LQ9 A;  1N0U A;  4C6A A;  4A47 A;  1YWX A;  2NZC A;  4RW8 A;  2AU0 A;  4LF7 F;  2LKZ A;  4LIW A;  4Y00 A;  1S12 A;  3VAI A;  2XHW A;  3ETM A;  1AT1 B;  3AA9 A;  3IP0 A;  3TJ8 A;  4X62 J;  4RLE A;  3UN5 A;  3TI0 A;  1K1S A;  2B4P A;  3HT0 A;  2CPH A;  2VG5 A;  3MI7 X;  1FVQ A;  2FC8 A;  1YBU A;  2ZJQ Q;  1O6X A;  3A4T A;  4FKY A;  4D3G A;  2VBY A;  1M5O C;  1X7V A;  4DI6 A;  5KFN A;  3T1H F;  1S1U B;  5DDO C;  4A8Q A;  4WBF A;  4WFA Q;  5C24 A;  4HVZ A;  1IQZ A;  1NB2 A;  3TVK A;  5B7W A;  2DNO A;  3K17 A;  2CYY A;  3UVJ A;  1TVR B;  2HZA A;  5KFP A;  2KJW A;  1R0C B;  5J2N B;  1RT2 A;  2VBZ A;  2R8J A;  1S10 A;  2KI2 A;  2V8V A;  3AB2 B;  4DX5 A;  2AEJ A;  3VAM A;  4H4M B;  5K8O A;  4EMD A;  4O23 A;  4GC7 A;  3QSY B;  1MMN A;  2W2P P;  1TV6 B;  4J91 A;  3ETO A;  3QIP A;  2AW0 A;  1NRK A;  1R3N A;  1R43 A;  1VJW A;  1RBL A;  3DC2 A;  2YKP A;  2HGL A;  3E3X A;  3X3U A;  2OEM A;  2DHX A;  4IOC Q;  3GP9 A;  2JEF A;  2BMB A;  4NE9 C;  1TEL A;  4WCE Q;  4F2R A;  1WEZ A;  2MHE A;  1PIE A;  3D5M A;  4UQT A;  1HHS A;  3HVW A;  5IV3 A;  1SL0 A;  1APS A;  1HAR A;  4I69 A;  3DLJ A;  5E3C A;  4GO7 X;  1QD1 A;  1ZA1 B;  2VOO A;  1M5S A;  2CQP A;  4H4O A;  4J9N A;  1OSD A;  3M8Y A;  1DLO B;  3OL8 A;  2J9C A;  4S0M A;  2VIH A;  4DSJ A;  2V68 A;  3GFH A;  2K1R B;  2IDE A;  1N34 J;  3F56 A;  2VL1 A;  3HSZ A;  2A1B A;  3FEZ A;  3SDE B;  2DXF A;  3K8V A;  3O1L A;  3MPW A;  3AQO A;  1HQ2 A;  2DGV A;  3OL6 A;  1S1T A;  2BE9 B;  4CYU A;  3EDQ B;  1XR7 A;  2HNZ B;  3SQG B;  2DRA A;  4JB8 B;  3LP0 B;  1KN6 A;  4N47 A;  3R5D A;  1UA1 A;  3M8P B;  5F9L A;  1Q0N A;  3MTJ A;  4MK7 A;  1VS3 A;  3ZNU A;  3A8I A;  3UNG C;  2YPY A;  4ED2 A;  4HI2 A;  2Q66 A;  3CDU A;  3GV7 B;  2F8H A;  3I31 A;  1YIJ S;  1QTN B;  3DGP B;  5D4N A;  4A48 A;  4XK8 C;  4ZLL A;  3IN5 A;  3AH6 A;  2DGW A;  5GVQ A;  4LF9 F;  4U8V A;  1FJG J;  3RAQ A;  2LA6 A;  2YKM A;  3DRP B;  3JB9 k;  3EDR B;  3ZZT A;  2VPW B;  2R7X A;  3I32 A;  1NHV A;  5DJB A;  4LSN A;  2OJ3 A;  3FQL A;  5AXM A;  1RBO B;  2FB0 A;  1UMJ A;  2IA0 A;  4ZLN A;  4ZK7 M;  3NMR A;  3T41 A;  2ZKU A;  4JI0 J;  3M7V A;  4K4W A;  1SJ3 P;  4ZN1 A;  5CD4 A;  1VBZ A;  1U2C A;  1NEE A;  1IR0 A;  1GFW B;  2O01 C;  3TWZ A;  2HVH A;  1VRU B;  3O8W A;  3KLH A;  4MK8 A;  5HMX A;  2F4F A;  5I42 A;  4ZLP A;  5CHC B;  2DNK A;  3GCX P;  2E1R A;  2RQ4 A;  1K0V A;  2RKI B;  1FDN A;  4G6V B;  3UE2 A;  4DR3 J;  2DGO A;  1QVF R;  1F60 B;  2ZBP A;  1TKD A;  3UO0 A;  3TUP A;  2J7U A;  5AJ3 J;  3CPW R;  5C25 A;  3IRW P;  3LP1 B;  1Q4R A;  3QLH B;  3R5B A;  2UU9 F;  1WSV A;  1W26 A;  3DRR B;  4USI A;  4J9O A;  2VC1 A;  2RNE A;  2V8D A;  3FEX B;  4FBT A;  3A8J A;  3H5U A;  4OYB A;  2M7S A;  1DQA A;  5HAN A;  4IG3 B;  5DGB A;  3O6Q A;  2ZD1 A;  3BBF A;  5K5M A;  1GTH A;  3BO3 A;  1D8Z A;  5DDQ C;  5LXY A;  1LOU A;  2N3L A;  2VPZ B;  5F3Z A;  4WZM A;  3D6M B;  2FJD B;  1N6Q B;  1KC8 T;  4C3L A;  3MUV P;  2BQR A;  3HF5 A;  1U6B A;  4O3N A;  2YNH A;  5D3G B;  2FUG 9;  2OPP B;  3U1L A;  4NLX A;  3IBW A;  1TKZ A;  4WU3 A;  5F3T A;  4P2F A;  5LSO A;  2V50 A;  3ZC4 A;  2ASJ A;  5F8J A;  2RVJ A;  3M2V A;  4M63 A;  2PDA A;  4FPR A;  3G71 S;  2PD1 A;  4NRU A;  1T02 A;  2AJ1 A;  3GG1 A;  1VI7 A;  1C4C A;  1KTQ A;  4F3Q A;  4HAC A;  2AV5 A;  1CJU A;  4EZ9 A;  3R8Y A;  2DVI A;  4OL8 A;  4LF6 J;  3HHL B;  1D9D A;  2BAB A;  1RT3 B;  3D1O A;  2XMJ A;  3D1Q A;  2CJX B;  4KPC A;  1TKT A;  5E3Q A;  4ETZ A;  4KGZ B;  2NUU G;  1D1U A;  2XMA A;  4AQY F;  3CJ8 A;  2W4P A;  1P6T A;  4CCH A;  4KE5 A;  4RUC A;  4I56 A;  2Q6B A;  2LQB A;  4CT9 A;  1XC9 A;  1KTV A;  2HHH F;  1IWA A;  2DB1 A;  4ZVU B;  2Y1R I;  3T5K A;  4WP9 A;  3LO3 A;  3PYD A;  1FVS A;  1KLM B;  2G0J A;  2YWW A;  1N32 J;  2DNN A;  5A6P A;  2VFS A;  2XCA A;  2VQE F;  2E7V A;  2HHV A;  4I2Q B;  4WTY A;  3MPV A;  2QSF A;  4MTP A;  3BDE A;  2QO3 A;  2XI3 A;  3SMZ A;  2ZWO A;  1VQK S;  5EUH A;  3N9U C;  1S6U A;  4L3N A;  4NRT A;  3CMQ A;  1S1X B;  4OYZ A;  3WHI A;  2GMJ A;  4LF2 A;  2E7X A;  4Y2C A;  1CJV B;  3DOL B;  3B8H A;  4DSL A;  4NEZ A;  2JSX A;  3EUN A;  3V6H A;  3PKM A;  3KWM A;  3B6B A;  4DR5 J;  3RU0 A;  4JV2 A;  4DR6 J;  5EWG A;  5AXN A;  2UXB J;  5KFQ A;  3POT B;  2Y8W A;  1ACM B;  4G1P A;  1RAC B;  4KYZ A;  3SCJ E;  4F04 B;  2AP6 A;  1AW0 A;  1C0U B;  2COL A;  3Q8R B;  3UR0 A;  1LWE A;  4DR7 J;  4IG0 B;  2C42 A;  5MAO A;  4ECS A;  1HNI A;  4HLB A;  3RB4 A;  4KRW A;  1U1L A;  1D09 B;  4FBU A;  1NDK A;  2Z56 B;  5ETQ A;  2R7U A;  3HZE A;  3ZTP A;  2J6S A;  4NLW A;  3RGI A;  4DV7 F;  4C98 A;  3Q8P B;  1C0T B;  4OI2 A;  2CJ9 A;  2UXD F;  5J2M A;  4OZL A;  2VG7 B;  3J7Y U;  1N48 A;  5EX0 A;  3FBB A;  1LXN A;  3UN2 A;  2SXL A;  1Y4Z B;  1P9Y A;  2MQL A;  2ZJP Q;  2G2Z A;  1RHU B;  2ZH7 A;  4GKK F;  5ETL A;  3QJP A;  4EBC A;  4FNH A;  3M8Z A;  1WI8 A;  1W2I A;  4YDD B;  4OHX A;  4JI7 J;  4EO6 A;  1C1B A;  3MM8 A;  3RAX A;  1ZM4 A;  1RXO B;  4BCA A;  4JV0 A;  3DDN A;  3MMA B;  2ZM6 J;  1GH8 A;  1AB8 A;  5KFY A;  4LMZ A;  4JV5 J;  4DS5 A;  3CCT A;  4N77 A;  4OI6 A;  4U7U D;  2MLZ A;  3FQK A;  1TFW A;  4Z2X A;  4ZP6 A;  4K4Z A;  4DQQ A;  2CQC A;  1P27 B;  2C2N A;  4U9R A;  2KM8 B;  4IOB A;  2RHQ B;  4R0E A;  2RRA A;  1HNW F;  3P3D A;  1RTI A;  4B9L A;  3G8Q A;  5LXR A;  3IR6 B;  1Y5I B;  3HCX A;  1EAY C;  1RQ0 A;  3QGP A;  2YWG A;  1G4C A;  2ALY B;  3EPI A;  1M1G A;  2FHM A;  3KLI B;  1SJ4 P;  4CP5 A;  3NGS A;  3CO0 P;  5CD4 H;  4B9N A;  1GNK A;  3BM7 A;  1RHR B;  4N56 A;  4RW9 B;  4A8K A;  2V4J B;  1I51 B;  5HI7 A;  1NDP A;  3IG1 A;  1B0T A;  2Y0S D;  1X0F A;  2X3G A;  5HQL A;  2DNP A;  2FVC A;  3R7B B;  1WF1 A;  4C8Y A;  1X9S A;  5A8R B;  2CQB A;  4NLP A;  1HMV A;  3UCZ P;  4K59 A;  4WWS A;  3V4I B;  4PG4 A;  2GAG C;  5A2Q U;  4O0I A;  2CDR B;  5GAH I;  2IAJ A;  1FWL A;  2VG6 B;  1XNQ J;  4OI3 A;  3NMA A;  2G13 A;  2UUC F;  2G1H A;  1Q5V A;  4RUH A;  4ZA1 A;  4ICL A;  3W5Y A;  4DUT A;  3DHW C;  3PFE A;  1IJE B;  1A0O B;  2CPD A;  1EQM A;  1YJR A;  2MKH A;  1KQG B;  1WG1 A;  1CS4 A;  3CJ4 A;  4X4U A;  4O3O A;  4B3M F;  1REV A;  4JI6 J;  2XMM A;  1L3U A;  3MUR P;  2CUY A;  2E9Z A;  4CIO A;  5D0G A;  5C5J A;  2HGN A;  2R4F A;  2DD8 S;  4FXD A;  4ES1 A;  3PO5 A;  3DRS B;  1HHQ A;  2V2Z A;  2B7C B;  1KQK A;  4DL3 A;  4O0N A;  2UP1 A;  3EJM A;  1QTM A;  5L46 A;  3QPI A;  3OSP A;  3K59 A;  4M5M A;  2HQG A;  5JMN A;  2EFV A;  3KHR A;  1HPZ A;  3CCU S;  3TEH B;  1YHQ S;  5GAG I;  5JVG Q;  2JLF A;  4F25 A;  1ARO P;  2AGQ A;  4UOH A;  2MQP A;  4KO0 A;  2BBE A;  2ZIT A;  3HVT B;  3G86 A;  1RJJ A;  3ZZO A;  4ZVG A;  5HK4 A;  5A76 A;  5C2G A;  2ZFH A;  3RUB L;  4LR8 A;  1SKR A;  1YDL A;  1BD6 A;  1JLG B;  3T1A A;  2GX8 A;  1YGY A;  2BEF A;  4V1A k;  3WIV A;  2J9E A;  3BKU A;  1NJX A;  2DHG A;  3SXL A;  2FZC B;  2AEF A;  1XMQ F;  4X66 J;  3ITH B;  4OYI A;  2K3K A;  3S1T A;  3LW5 C;  4CTA A;  4NLS A;  1RAH B;  5IWA F;  4L75 A;  3W63 A;  2RRN A;  4OLP A;  3DNC A;  1UFK A;  4DV4 J;  4RL1 A;  1M1H A;  2DNZ A;  3NAI A;  3KLF A;  5BR8 F;  2W8L A;  2C22 A;  4BC7 A;  1CEZ A;  1Q1K A;  5KG3 A;  4K4U A;  1NJZ A;  2DHH A;  1S9E B;  2E1C A;  3ENV A;  3OSN A;  2YWE A;  3HKZ D;  3MTK A;  2CWK A;  4WK3 A;  3GIJ A;  3LUY A;  5D4O A;  2KG1 A;  3JYT A;  2LU2 A;  4RBU A;  4X4Q A;  2XY5 A;  3W66 A;  4KH1 B;  2DO4 A;  4ZPD A;  3M32 A;  1WOO A;  1XER A;  3CJ3 A;  1OY9 A;  2E5L J;  4ZOS A;  1PJ6 A;  3VV2 B;  3A8E A;  2WTF A;  1NB7 A;  2ATL A;  6FD1 A;  3SFG A;  2MZQ A;  5L9X A;  3DKD A;  2CIM A;  1WC4 A;  2MZJ A;  3SZ2 A;  2OEJ A;  3UNY A;  3HO1 A;  4WE1 B;  1FEE A;  4YFU A;  3DLK B;  3N79 A;  4NLO A;  1BC6 A;  2XG8 A;  3AOC A;  5L1K A;  2EWH A;  2GHP A;  3LF0 A;  2XTJ P;  4DV3 F;  2XSJ A;  2HLT A;  3PIO Q;  3VF0 B;  4A8O A;  1IBM J;  3PO4 A;  3DU5 A;  5CZX A;  2C3O A;  1NK7 A;  4CLU A;  5FII A;  4O4G B;  3MCN A;  2BOP A;  4JI2 J;  1FTC A;  4ECU A;  2WVE A;  1QVG R;  2QEX S;  3CVK A;  1HA1 A;  4LSZ B;  2Q43 A;  1URR A;  4A8S A;  3W5Z A;  4CRJ A;  1XJW B;  3M8Q A;  3NS7 B;  4DV1 J;  1BHN A;  3QGH A;  4ID8 A;  1FF2 A;  1RTH B;  2UVR A;  4KSE B;  2EFO A;  4PG8 A;  5B0B A;  5HVF A;  4CLT A;  4RUA A;  3OBI A;  1CLF A;  3LQV A;  4JBC A;  4QIF A;  3T19 A;  2RU9 A;  1OQ3 A;  1VJQ A;  5DLF A;  2RB7 A;  2OPS B;  4CM2 A;  2BDP A;  4YEA A;  1YZ6 A;  4DL6 A;  2XZW A;  3M2U B;  3NNA A;  4OJ1 A;  1RA7 A;  3CW2 C;  2CNN B;  2L9D A;  4AD6 A;  1NH8 A;  3KHH A;  3THP A;  3EYZ A;  3P96 A;  2XNQ A;  1S1U A;  1Y0H A;  4NA1 A;  3CCE S;  3VR1 A;  4DUZ F;  3IRX B;  2Y1L B;  1NDC A;  2JFD A;  2ROE A;  2B9E A;  2UZA A;  1TVR A;  3QBC A;  3OL9 A;  5J2N A;  1YVF A;  1U24 A;  2EVZ A;  3HHL D;  3J81 U;  3D4J A;  3FSY A;  2QN6 B;  2QLJ B;  3CT9 A;  4EUV A;  4NCA A;  3RBX A;  1N56 A;  3VZH A;  1GXT A;  2QX0 A;  2ZBR A;  3HXM A;  4FYX B;  1ZPV A;  2B4U A;  1U6Z A;  1QSY A;  2IRY A;  3TZZ A;  2ZNY A;  5E3A A;  1LWF A;  1FWK A;  4WXW A;  3EZO A;  3GON A;  4DV5 F;  5HP1 B;  2N3O A;  2MZ1 A;  2MST A;  3MR7 A;  2OI2 A;  3OR1 B;  2UVV A;  4OV6 A;  4ZPW R;  3MM9 B;  4LBP A;  1PJ5 A;  3DLG A;  3EX7 B;  3R5G A;  5CQG A;  4X4V A;  2R2R A;  3DOM A;  2D41 A;  4K4V A;  1ZM9 A;  1VBK A;  3J7Z T;  5EDW A;  1M1K T;  2BRL A;  2JVR A;  4F3M A;  4NLR A;  3CE8 A;  2ZBI A;  3RAM A;  3ZZP A;  2NYH A;  2WW8 A;  4I6W A;  1IM6 A;  1TUV A;  2CQH A;  3KNG A;  1DLO A;  2HLU A;  4ZPV R;  4WII A;  2K1R A;  1YI2 S;  1EKS A;  4ZP9 A;  4HR2 A;  1S59 A;  4Y0F A;  5B0F A;  1YSJ A;  2JEG A;  2HAI A;  3KNA A;  3SDE A;  4OYA A;  2QLW A;  1DAX A;  2GVD B;  4OI4 A;  2W9B B;  5KG1 A;  1Q16 B;  2HNZ A;  3SQG A;  5E3P A;  3MUT P;  1SL1 A;  4C8M A;  1S7H A;  1LW2 A;  2J7W A;  3C3L A;  3BPS P;  1BQM B;  1KFS A;  3V6D B;  2F4V F;  2FGO A;  4RJV A;  3KDN A;  1NO8 A;  2R42 A;  4F02 A;  3MWB A;  1VGY A;  1ZZN A;  1R8A A;  4RW4 B;  3FSX A;  4DOZ A;  5I3U A;  4RW6 B;  4A8X A;  5H1S V;  5DG9 A;  3OFH A;  4O44 B;  1JLQ A;  1T9X A;  3JS9 A;  1QUV A;  2YQ3 A;  2O67 A;  3W9I A;  4YB1 P;  3DRP A;  1OYD A;  3Q2S C;  2NPF A;  2EFQ A;  1T9W A;  3N5F A;  3DRX A;  3T1Y J;  1H0H B;  4JI0 F;  2B51 A;  3KLG A;  5B0A A;  2QRR A;  4IUF A;  2AJ2 A;  1NPK A;  3B54 A;  1P8G A;  4UOC A;  2H5I B;  1HNV B;  4P72 A;  3W8G A;  2BKN A;  4O3R A;  4NXM F;  2IY5 B;  4HT7 A;  4J9P A;  1A7G E;  4WU2 A;  4OJ3 A;  1F5B A;  3LP2 B;  3PAC A;  3NBP B;  1I1G A;  4DR3 F;  3FEY B;  1VRU A;  2QL9 B;  2IJR A;  1VRQ C;  1Q8B A;  2LA4 A;  2ZE2 B;  2R2T A;  1JX4 A;  2HYI B;  4V19 J;  2QFI A;  1N4L A;  1RT5 B;  5CYM B;  2W24 A;  4ECW A;  2MQO A;  2WOM B;  2RKI A;  2HMI A;  2GZO A;  4NOH A;  5HSP A;  3BZQ A;  4Y34 A;  4TLR A;  3BO4 A;  1IKX A;  2VFR A;  4C9D A;  4RU2 A;  2QYC A;  2JRS A;  2XEX A;  3GMG A;  2VFT A;  2FY8 A;  3BR8 A;  3LP1 A;  2J0X A;  3TOQ A;  4I4B A;  4C4W A;  4DCP B;  3QLH A;  4F0H A;  3HSG A;  3S8S A;  4Y3C A;  3UD5 A;  3DRR A;  1S79 A;  2KH9 A;  1Y5N B;  1X0P A;  4B08 A;  3NNH A;  2F9J A;  2AJ0 A;  3G96 A;  4CDI A;  2Y0B B;  4DLE A;  5KTQ A;  1WKL A;  1HWL A;  4QR0 A;  1YRT A;  1BWV A;  1YJT A;  2WB1 D;  2AYG A;  1N6Q A;  3CCW A;  2OO4 A;  2W2Q P;  2N7C A;  5ADZ A;  2YNG A;  2DNQ A;  5D3G A;  1KR4 A;  3QRQ A;  3IM8 A;  1RAG B;  1UEV A;  3N01 A;  1NSQ A;  1MNE A;  1EET B; 
#chains in the Genus database with same CATH homology
 4NEZ A;  2VQE J;  1HNW J;  1FJG J;  4DR4 J;  5AJ3 J;  4DV3 J;  4DR2 J;  4DR5 J;  4NXN J;  1IBM J;  4DV4 J;  2VQF J;  1XMQ J;  1HNZ J;  4JI1 J;  2MQ8 A;  5FLX U;  4JI5 J;  4DR6 J;  2MEW A;  3IMQ J;  5LMU J;  4YHH J;  5BR8 J;  3J80 U;  3OTO J;  4DV5 J;  3D3C J;  4JI2 J;  4LF6 J;  2UXB J;  2UUB J;  4JI7 J;  4DR1 J;  4KYZ A;  4GKK J;  1XMO J;  3W1Y C;  4JI3 J;  2KL8 A;  2F4V J;  5IWA J;  4OX9 J;  4LF4 J;  4DR7 J;  4NEY A;  5A2Q U;  4DV6 J;  4K0K J;  4YY3 J;  4LF9 J;  1J5E J;  4JI4 J;  2ZM6 J;  4JI8 J;  3D3B J;  4X65 J;  4AQY J;  1N34 J;  4DV1 J;  2UUA J;  4JV5 J;  4DUY J;  1XNQ J;  3JAM U;  4JYA J;  4DV2 J;  3R2C J;  5LM7 E;  2UU9 J;  3J81 U;  3J7A N;  3T1Y J;  4LFA J;  1IBL J;  4B3T J;  4JI0 J;  4DUZ J;  4X64 J;  1N32 J;  1N33 J;  2MTL A;  4X62 J;  4PWW A;  2E5L J;  4KY3 A;  4V1A k;  4GKJ J;  2UXC J;  2KVQ E;  4JI6 J;  4LF7 J;  4KHP J;  4LF5 J;  3R2D J;  4HHU A;  2UXD J;  4B3M J;  1XNR J;  4X66 J;  4B3R J;  1HNX J;  2UUC J;  1HR0 J;  4DV0 J;  2HHH J;  5IT9 U;  1N36 J;  4DR3 J;  1IBK J;  4B3S J;  5LMN J;  4LFB J;  4LFC J;  3T1H J;  4LF8 J;  4NXM J;  4DV7 J;  1I94 J;  4RJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...