4IDKB

Hiv-1 reverse transcriptase with bound fragment at the 428 site
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 114
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4idkB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB03
1IKWA 5KG5A 5KFRA 2W7OA 3RAQA 2FJXA 2XC9A 4KV8B 4IH6A 4ECQA 1S0MA 2XCAA 2WRMA 3QGHA 4URQU 4ZVHA 3GQCA 1VRUB 4RNOA 3DDKA 2W9BA 1RT3A 3CJ5A 1QUVA 2V9WA 4ZP9A 4WFZA 2UUTA 5KFZA 1IKVA 2ASDA 1KHWA 5K14A 3Q8PB 1J5OB 3DRSA 4RW4B 4IG3B 3E51A 5J2MA 2R8IA 3N6MA 1NHUA 1S9EB 5J1EA 4ED1A 4WE1B 4URGA 5KFQA 3BQ1A 3KJVB 3KJVA 4ED3A 5KT2A 3KLIA 1GX6A 2FLPA 2IAJB 3KK2B 1JXLA 4MFBB 2R2TA 3KLVA 3OSNA 3TQ1A 2UVVA 4NLRA 4H4MB 4H4MA 2ZE2B 5F8NA 2IJNA 3N6NA 4EYHB 4U7CA 3BSCA 4IR9A 4HKQA 5EWFA 3PZPA 1C0UB 1C0UA 4ICLA 3KHLA 1HNIB 3H5YA 2V0NA 3D5MA 4G3IA 5HP1A 4O4GB 3UQSA 3H98A 2VG6B 1TL1B 1TL1A 2VG6A 3MEDB 4ECVA 4QWDA 3CJ3A 5KFHA 4LQ9A 3RBDA 3NAHA 3T5JA 1TVRB 1TVRA 3FDSA 4RW7B 4RW7A 4HYKA 4ZMMA 1TKTB 5DGAA 5KFYA 1TKZA 1S6PB 1S6PA 3MR5A 1JLAA 1JLAB 4IRDA 3CDEA 5KT4A 1MMLA 2I5JB 2XI2A 4K4YA 2B6AB 2B6AA 3QZ7A 1T03A 2C2DA 2IC3A 1QE1A 1QE1B 2YKNB 1QAJA 4NCGA 1JLFB 4PWDB 2EC0A 4F50A 1YVFA 1S1TA 1TV6B 1TV6A 4WXOA 5KFAA 4QWAA 1RT2B 3MEGA 2D41A 2RF2B 2RF2A 3I5BA 5C24A 1HNVA 5C24B 4MK9A 4TYBA 4ZP7A 3GV5B 3PW2A 4U6PA 5CYMB 5CYMA 1HQEB 1HQEA 1BQMB 4ZHRB 3EZUA 5KFSA 3T5HA 3T5LA 3KNAA 1LWFA 1LWFB 4ED2A 4ED6A 4NLGA 4IKAA 2WOMA 4IQXA 5J2PB 5J2PA 2FVRA 2HAIA 2ZD1B 3KLHB 3KLHA 4TXSA 5KFTA 1RT6B 1RT6A 1N48A 1SH0A 4IRKA 4O3PA 5L1JA 4I2PB 4I2PA 1D0EA 3RB3A 3PJXA 2B5JB 4WXWA 1UWBB 1UWBA 2UUWA 4RNMA 2HNDB 1ZETA 1C1BB 1C1BA 3D28A 4ZPAA 3GV7B 4ECZA 3BJYA 3HHKA 3ICLA 1HYSB 1JLEB 4WFYA 4IR1A 3FQLA 4XPEA 3I5CA 5C5JA 4ECSA 4IDKB 4IDKA 1N5YB 1N5YA 1RTJB 2JC1A 3NL0A 3KMSA 3H5XA 1RTHA 5I42B 3MR6A 1DLOA 2W9AA 3QGIA 3TAMB 3MTKA 4YR2A 2WONA 4NZ0A 5DLGA 5I3UB 3IRXB 2AGPA 4ZVFA 5EDWA 4JV0A 4ID5A 4ID5B 1HPZA 2BANA 1REVB 1TQLA 4TN2A 5KFWA 3H4BA 1KLMA 1KLMB 4DL2A 2BQ3A 2UVUA 3GV8B 2AGQA 2BE2A 2YNHA 1N6QB 3T19A 1N6QA 4ZP6A 4QW8A 3QZ8A 5L1IA 3JYTB 3JYTA 4IRCA 2ASLA 3N6LA 4RU9A 3PJWA 3V6DB 1S1VB 2ASJA 2D3UA 4KB7A 1MU2A 1Z4UA 5KFEA 4ZVEA 5D3GB 5D3GA 4JV1A 2ZKUA 3GIMA 4J9OA 3DRRA 4PUOA 4KHMA 3MR3A 3CJ4A 3DLKB 3DLKA 4IOBA 2HNYA 4J9KA 3OHAA 4H4OB 5KFMA 4Y2AA 1S1XB 1S48A 3QO9B 2YNFA 3DM2A 1C1CA 1S49A 1IKYB 4KKOA 4RW8B 4RW8A 5FDLA 5FDLB 2AWZA 2HNZB 4KV8A 2C28A 3MFHA 3I0SB 2DPJA 3RBEA 1VRUA 4KE5A 2FVSA 1RTIB 1JIHA 4EBDA 2XI3A 3SFUA 3PHEA 1QAIA 2ALZA 4NRTA 3BREA 3CWJA 3OL6A 2VG5B 3GYNA 2R8HA 2AQ4A 2UVRA 1J5OA 1RT7B 1RT7A 4EBCA 2AGOA 4RW4A 4IG3A 5F8HA 1RT4B 3CDWA 1S9EA 1SV5B 1EETB 1EETA 4WE1A 4NLTA 4KHRA 3KHRA 4J9PA 3BSOA 1CSJA 2YNGB 2YNGA 3M8PB 1K1QA 3IG1B 3V81A 3V81B 2FJVA 1OS5A 3H59A 3OL7A 3H2LA 4YR3A 2XGPA 3ISND 5HBMB 4GC6A 2IAJA 3KK2A 2BQUA 5KFDA 4MFBA 3LP1B 3LP1A 2IM0A 4F4ZA 4Q43A 3C6TB 3C6TA 4PQUB 2ZE2A 4ECXA 3M8QB 3DRPA 3DRPB 2IA6A 2R8GA 2B43A 5JXSA 4NLSA 4Q8EA 3Q8RB 5CYQB 4QWCA 1TKXB 1TKXA 5F8MA 4EO8A 5J2QB 1HNIA 3LALA 2AU0A 2ILZA 5KFVA 3KOAA 4RUAA 4O4GA 4ZPDA 2VA3A 5KT7A 3MEDA 2IMWP 2CJQA 3HVAA 5KT5A 3IGVA 1JLGB 2O5DA 3G6YA 2CKWA 4RUCA 2IBKA 4XPCA 4DL5A 3KMQA 4YR0A 1HQUB 1HQUA 4MKAA 3RAXA 4Q0BB 4EBEA 4X2BA 2OPSB 1TKTA 4O3OA 2YKMB 2YKMA 4O3RA 4IFYB 4IFYA 3GILA 3UR0A 2E9TA 2C2EA 2I5JA 4NLXA 1TP7A 4QW9A 5KFBA 3OSPA 5F8JA 3OL9A 2YKNA 3KK1B 4RNNA 1JLFA 1LWEB 2FVPA 4PWDA 1S9FA 3CO9A 2D7SA 1RT2A 1LW2B 1LW2A 3DM2B 4MIBA 1JLBB 4ECYA 4RZRA 4O3QA 3DYAB 3DYAA 3E01B 3E01A 1BQMA 4ZHRA 3BSAA 4ECRA 2J6TA 3I5AA 1N56A 4DG1B 4WZQA 3FSIA 4LSLB 1S1UA 1S1UB 2FJWA 4O44B 3KK3B 3KK3A 1FKOB 1FKOA 3C6UB 3C6UA 1S10A 3VQSA 5KG2A 3FQKA 1HMVB 2ZD1A 1XR6A 4ZVGA 4ECUA 4NLUA 3RB6A 5KFOA 4J9MA 3QGGA 3M9OB 2VG7B 1VRTB 2VG7A 2XGQA 3ITHB 3LP0B 1SH2A 4ZPCA 5C25B 4TLRA 2B5JA 5KFIA 3DI6B 3DI6A 1T05B 1T05A 2HNDA 3GIJA 4LSNB 4LSNA 4QWEA 2I1RA 1RTDB 1JLEA 1RTDA 1HYSA 3OL8A 5KG0A 1XR5A 5T14A 3LANA 4R8UB 3LAKA 1RTJA 4ED0A 5KFFA 3QIPB 5I42A 1NNDA 2BQRA 2FVCA 4Y2CA 3MEEB 3MEEA 3TAMA 3DMJB 3DMJA 1RT5B 1RT5A 3KLEB 1S6QB 3IRXA 3KLEA 5I3UA 4EEYA 1IM4A 1NHVA 2AX1A 1W25A 1REVA 3Q8QB 2VA2A 2C22A 3BQ0A 1ZTWA 2JEJA 3HVTB 3NMAA 3IS9B 4J9QA 3KHHA 2WCXA 4O3NA 3V6DA 1FKPB 1FKPA 1S1VA 4XO0A 1RAJA 5L9XA 5F9LA 3GIKA 3EPIA 4GC7A 3HVWA 4NLQA 2C2RA 4NYZA 3OLAA 1RT1B 1RT1A 4MIAA 5EWGA 3OLBA 1K1SA 3CJ0A 3FFIB 1WNEA 1FK9B 2W7PA 3DLGB 3DLGA 2IM1A 3RB0A 2JEIA 4YP3A 1BQNB 1BQNA 4RW9B 4FBTA 3H40A 4O3SA 4H4OA 4JUZA 1S1XA 5HROB 3QO9A 3KHGA 4KO0B 3IN5A 4NLWA 4F4XA 3DOLB 3DOLA 3CJ2A 3I0RB 2WHOA 1IKYA 3NBPB 3FRZA 4NLVA 4J9NA 4ED7A 3PW0A 3RB4A 4FBUA 3NAIA 2RKIB 2HNZA 2RKIA 1I6JA 5DQIA 3DOKA 3DOKB 3I0SA 1TL3B 3QLHB 1S1WB 3QLHA 5C42B 2IJFA 4EO6A 2BR0A 3Q8SB 3DLEB 1RTIA 4JV2A 4Q44A 2J6UA 4G1QB 2HMIB 2HMIA 2OH2A 2E9RX 2VG5A 3BQ2A 3MECB 1XR7A 4KFBB 1S97A 1C0TB 1C0TA 1EP4B 1EP4A 1DTQB 2YNIB 2YNIA 3KLGB 3KLGA 3KLFB 2R2UA 5F8IA 3PR5B 1DTTB 1DTTA 3QYYA 5F9NA 3G6XA 2FLNA 1JLCB 5KG7A 2BRLA 3HKWA 1RT4A 1SV5A 2OPPB 4DL3A 5KFNA 1IKWB 1C2PA 2RDJA 4RNHA 5L1KA 3M8PA 4ED8A 3IG1A 2JEFA 1RYRA 1RA7A 5DG7A 5HBMA 4KBIA 1S0NA 2W9BB 1RT3B 4RNFA 2ATLA 2QE5A 3GIIA 4PQUA 1U09A 3M8QA 3LAMA 4FS1A 4K4UA 1IKVB 2ILYA 3CIZA 5K14B 3NKYA 2R2SA 5KG6A 3T5KA 3DRSB 5CYQA 5KFJA 3PW4A 5J2MB 5J2QA 1D1UA 3SI8A 4DL6A 5J1EB 1ZTTA 4M94A 3H5UA 5KFKA 1JLGA 1LWCB 1LWCA 4WZMA 3KLIB 5KFGA 5F8LA 1JX4A 3H4DA 4Q0BA 5KFLA 4FS2A 2OPSA 2R8KA 2DPIA 5DG9A 4K4VA 3OHBA 4R0EA 5L1LA 5KG3A 1S9GB 1S9GA 3UDLA 3G6VA 5KG1A 4ICLB 2E9ZA 1RYSA 3MF5A 3KK1A 4ECTA 4I7FB 4I7FA 4MKBA 1LWEA 2FVQA 3V6JA 4MK8A 5HP1B 4DL7A 4K50A 4DEZA 4J9RA 2BRKA 4WFXA 5DGBA 1JLBA 2R8JA 4K4ZA 4IH5A 4F4WA 4TQRA 5KFPA 4DG1A 4EYIB 4OL8A 4IH7A 4TY9A 4DL4A 5KFXA 1TKZB 4LSLA 2W8KA 4O44A 4Y34A 3BSNA 2UVWA 2R2RA 5JUMA 3PW5A 4LQ3A 1HMVA 4M95A 2GIQA 4NLDA 1T03B 3PVXA 2IC3B 4QWBA 3H5SA 4K4SA 1SUQB 1SUQA 1VRTA 4NCGB 3ITHA 3LP0A 1S1TB 5C25A 1N4LA 4K4TA 3MEGB 4I2QB 4I2QA 3V6HA 1HNVB 2OPQB 2OPQA 2HWIA 2V4QA 2W8LA 4KAIA 1RDRA 4J9SA 3ISNC 2GIRA 1IKXA 1IKXB 4O4RA 4R8UA 4F4YA 4H54A 4MK7A 5DG8A 3QIPA 5KT6A 3PR4A 2WOMB 2WB4A 1RA6A 2XCPA 3M9NB 3TVKA 2RDIA 4RW6B 4RW6A 1S6QA 3G86A 4NLYA 3EPGA 5DLFA 1JLQB 1JLQA 3HVTA 2IM2A 1GX5A 3IS9A 3QIDA 3SFGA 4TQSA 3BGRB 3BGRA 3M9MB 5J2NB 5J2NA 2W9CB 2W9CA 1JKHB 1JKHA 5KFCA 3LP2B 3LP2A 3V4IB 4R5PB 4R5PA 2OPRB 2OPRA 3V4IA 1S4FA 4WYLA 5EUHA 5KG4A 2D3ZA 1HARA 1SH3A 4NRUA 1R0AB 1R0AA 1KHVA 4TYAA 1RTHB 4K4WA 2JEGA 1DLOB 5DQGA 3FFIA 1FK9A 2WONB 1LW0A 1LW0B 4WYWA 3MR2A 4Q8FA 3MFIA 4Q45A 4RW9A 1HPZB 2BANB 2GC8A 3PW7A 2JLEA 5HROA 4MH8A 4TY8B 4KSEB 4TY8A 4Y3CA 4KO0A 4YQWA 3T1AA 2BE2B 3BR9A 2YNHB 2J6SA 3I0RA 2HWHA 3NBPA 2V4RA 4K4XA 2IM3A 4ZPBA 5DQHA 3NGDA 5HLFB 5HLFA 2AX0A 3CDUA 5C42A 1TL3A 1S1WA 3IGNA 1T3NA 4NLPA 3DLEA 2FLLA 1S0OA 1MU2B 4G1QA 4B3OA 4B3OB 1T94A 2XWYA 5F8GA 4IFVB 3MECA 4IFVA 3DRRB 4NLOA 2WK4A 4IG0B 4IG0A 4KFBA 4PUOB 3CVKA 2WTFA 1DTQA 2JC0A 3KLFA 4QPXA 4ECWA 2F8EX 5KT3A 2HNYB 2QV6A 4ZP8A 5KFUA 5EWEA 1JLCA 3V6KA 3JSMB 3JSMA 4URSA 3UPFA 4J9LA 2YNFB 2OPPA 4YMEA 1C1CB 4KKOB
chains in the Genus database with same CATH superfamily
4QIVA 2DNLA 4FP9A 3OFFA 4EMDA 5GVQA 2XMJA 5K14A 2QN6B 2Z56B 2ZOGA 4DOZA 1NHUA 4PXEA 2HHTA 4ED3A 3DU5A 1XNRJ 3SCIE 2GHPA 2MY8A 3CMQA 2AZ1A 1D09B 3OT9A 4HI1A 3O2IA 1R8BA 3RGIA 2QRRA 3W2WA 2Y1LB 5HP1A 4EFAC 2I8EA 3MEDB 3ONQA 1Q0NA 3GJRB 2JJ4D 2VOPA 4PXBA 3CC4S 1QAJA 4JI1J 4F50A 2Y3YA 4QWAA 2RF2A 4ZP7A 3T5LA 4RKUC 4B9LA 2QO3A 3UI3A 3Q86A 2HAIA 4C8YA 4DSEA 4Y2KA 4KGVB 2FDNA 3PJXA 1S77D 1R27B 2PE8A 4JOUA 3GV7B 3TEHB 1LK5A 4IDKA 2E5LF 3W1YC 1N5YB 2QJ3A 4F4AA 2APOA 2JFKA 4QIEA 4M5DA 1X4AA 1WELA 1M1GA 5HAOA 2CQHA 3BYPA 4QW8A 5LXYA 3PJWA 2W24A 2JVOA 4FN5A 3O8WA 3S7RA 4FPIA 4BCAA 1NZ8A 4OYAA 1T9XA 2VFSA 1S48A 2PT0A 3QQCD 4TU9A 3CD0A 2RU9A 4EBDA 3CC7S 3SFUA 3NNAA 1IM6A 2HW3A 2UXCF 4USHA 2VQFJ 1YGYA 1RT4B 1WSRA 4DPWA 4DV1J 1B70B 2FJVA 2DR9A 2BQUA 4R0JA 4XK8C 2IM0A 2ZBRA 1CQMA 4OZLA 4B3TJ 1X9SA 3OV7A 1DJ0A 5KT5A 1ROFA 2HQGA 1HQUA 3LPEA 2E7WA 5EX3A 2CNLB 1IBLJ 2XS5A 1MROA 1AZSA 2EBGA 2KI2A 4LF8J 2CNOB 3QT7A 2CQPA 1HIYA 1NH7A 2FY1A 4WP8A 1S1UB 1WG5A 4CIOA 2X3GA 1JXVA 2MDAA 2B7BB 2CPIA 2HFZA 4OYBA 2VG7A 4GKKF 1G3OA 2L9WA 3TJ9A 1F0XA 2N4CA 1T05B 3TX0A 3CF5Q 1RTDA 4N56A 2KN4A 1F5AA 3MM7B 3DMJA 1RT5B 3KLEB 3OQ2A 3H25A 3HP6A 2VFTA 4P74A 1VQNS 1S1VA 4K0KF 2C2RA 2HG4A 4K2JA 4NYZA 5H9EK 1RT1A 1FK9B 3ENWA 4WPAA 2Z8QA 2BDPA 3TUJC 3CJ2A 4C8NA 4CO3A 3QSIA 4YEAA 4GMKA 1WG1A 1UEUA 3CJRA 5DQIA 3QLHA 3DLEB 2YNIB 3KLGB 1DTQB 3UD3P 5F9NA 3ZTSA 5F3ZA 1ZM3A 4CTAA 4CLFA 1R8CA 1S0NA 2W9BB 4P9SA 3GIIA 4PQUA 3LAMA 4K4UA 4DR5J 1N32J 3H2VE 1NPKA 2DXEA 1G7CB 3W2VB 4DL6A 1N36J 1UEKA 2OO4A 3M8SA 3A8KA 2DNOA 3LGMA 1S79A 1NEEA 4MKBA 4MK8A 3W65A 2WVEA 4JI7J 5DGBA 3CGIA 4DG1A 2OI2A 3MCSA 3TJAA 3QRPA 2U2FA 2NXEA 1PC5A 1NKEA 1YZ7A 4NCGB 3ZXWA 3LOUA 3U1LA 2RU3A 4YB7A 2KFNA 4HDHA 2WOMB 1WDTA 5A8KA 4ZPWR 3TAPA 3CDAA 4ID8A 4DDFA 3AFGA 4TQSA 4RU2A 3CJKA 3H7HB 4DHVA 3M32A 4PYAA 5BR8F 2HGMA 4Q45A 4RW9A 2C3OA 3MUTP 5HLFB 3CW2C 4ZLJA 4G1QA 4B3OB 3CCRS 1SQFA 4LUBA 1S7IA 2F8EX 1P9QC 2DISA 4URSA 3TUIC 4ZLPA 5A2QY 1RJJA 4YHHJ 2DR6A 3F0NA 2GAGC 1N34F 2HPUA 3IR7B 2XMAA 2WRMA 1Q4RA 3UDCA 2RT3A 2VJVA 5IC4B 4WIQA 1RWNB 1J5OB 4IG3B 3KKFA 3N6MA 3OR1B 1S9EB 4M5LA 1H7XA 4WE1B 2A6OA 3KLIA 2ZNYA 3KLVA 5B08A 4H4MB 3R5CA 2NPIA 4B9VA 1JXEA 2XSJA 1LXJA 3K5MA 2E5JA 2P9GA 2G9OA 2VG6B 1TL1A 4WIIA 1REGX 4PPZA 3AOCA 2CNNB 1PBAA 4HYKA 1VQ7S 1YJUA 2I5JB 1YJVA 2B6AB 3T6JA 3EM1A 1U47A 3I4HX 2VASA 3MEGA 5K20B 5LL6d 1RTZA 3L7UA 2VDHA 5DS7A 3EZUA 2MQ8A 3SMZA 1LWFA 4DV5J 2GA7A 5D4PA 3PIPQ 3EMTA 4A8SA 1GTHA 1RT6A 2Q79A 4I2PB 4RNMA 3D28A 1WACA 4KPCA 5LMNJ 3H5XA 4PCQA 3S8SA 3TAMB 4L3KA 3HJVA 2DYAA 4ZPTR 1N0UA 4K5SA 2J0XA 4ZP6A 2UV8G 3N6LA 1Z2ZA 3PXGa 1F3FA 4J9OA 3GIMA 3HZEA 2LQ8A 4J9KA 4RW8B 5FDLA 5A0YB 4B9UA 2AF6A 1RSCA 2E29A 2ZH8A 3P3DA 4L6V3 1FRHA 4DJBA 1YWXA 1KDNA 3TA2A 2RB7A 3M2RB 3Q8VA 1RXOB 1CSJA 3O3LA 5A76A 5B0GA 4LIRA 2IA6A 2QMWA 2V8PA 4F0KA 2HBZB 2GQ2A 5JXSA 1Y5LB 4ZJOA 3G9CA 2ZJRQ 1UTAA 1XNRF 2IDEA 3HVAA 1VHIA 3I4PA 4RUCA 4O23A 4DL5A 2G2YA 2GHWA 3BPDA 3RAXA 2XMWA 1M1KT 2YKMA 1WKJA 2MQPA 2C2EA 3N9UC 2VL1A 3Q83A 2D7SA 1XWLA 5A6WA 1L3KA 3A3OB 3MM8B 4RZRA 4P7TA 3SDEA 5B09A 1S10A 4JI1F 2DGTA 1XR6A 5KAKA 3QJJA 2HHHJ 2CJXB 3IO1A 3UN3A 1VIXA 3OPKA 3DI6B 1MSWD 2CWKA 1N54B 3BBCA 3OL8A 3LANA 2P6TA 3D3BJ 5KFFA 2FPHX 2H1YA 1MN9A 2FJBB 2JDJA 1FERA 3NMAA 4HL9A 4QYZK 2DTJA 4CLZA 1WHWA 1F9FA 3ENQA 1OWXA 2DNZA 3UD5A 1RABB 1WD6A 3KHGA 2LLZA 4ED7A 3R1HA 3NAIA 4RBUA 2HMIA 1S97A 1EP4A 2R2UA 3D1QA 2ZZTA 1NUEA 1SL1A 3I9V9 2GAHC 2HQIA 4NA1A 2B4PA 3UVJB 4LRFA 3MMJA 3LQVA 5HVHA 3FEZA 3AH6A 1M5KC 3GFYA 3UFCX 2Q3PA 5KG6A 5KFJA 4DR7F 1NHKL 2E1AA 1VQ6S 6FD1A 1NJYA 3TR5A 4AE5A 1E6VB 1X4HA 2DPIA 4DBQA 5L1LA 4YN3B 3KK1A 3JB9k 2BRKA 3VAKA 2JHEA 1IBLF 4LRCA 1HWLA 2KYZA 2IC3B 3Q8UA 3MMAA 1XERA 1SKUB 3G6ES 2P9CA 1IKXB 4O4RA 4H54A 1X0FA 3AODA 4CYUA 5GMDA 3CD7A 2MEWA 4KGXB 2QLBB 3QIDA 1L5UA 2CIMA 2OPRA 4P2FA 1FTCA 3CXCR 2FHOB 3J7YU 2DB1A 4MTPA 3FSXA 4TY8B 3NBPA 4N7TA 1ZAWA 3KXDA 4NXMJ 2LEBA 3IGNA 4B9MA 2GV1A 3MMBB 3EWGA 1OIAA 2BYCA 1N33J 3MAAA 2D74B 3QAEA 5KT3A 1XMBA 1V3ZA 3V6KA 2OPPA 4CI0B 1NDPA 4ELUA 5KFRA 3D9BA 2E1RA 4URQU 5D8HB 3PKYA 3K5OA 5KFZA 2A2CA 3Q2TC 4RW4B 5J2MA 3R5AA 1U8SA 3AXMA 2LDIA 4ZVPB 3KJVA 3GJTB 5IM0B 1XK8A 2KYXA 2MKHA 4PQAA 1CJVB 2GS8A 4G3IA 3M1VA 2BKPA 4ECVA 1UFWA 1YBUA 1GFWB 2LXUA 4LF4J 4RW7A 4B3MF 5KFYA 3QATA 3GJSB 2YTCA 1WTBA 4USIA 5A8WB 3HD1A 1QE1B 1X5PA 2L9NA 1TFYA 5ETTA 2UXBJ 4U6PA 5CYMB 1VLOA 1HQEA 4ZHRB 4QU7A 2KTQA 5MAOA 4Z37A 4P71A 2KM8B 3RG6A 2UUWA 3GG1A 3HHKA 1JLEB 3ZZUA 3FQLA 4ECSA 3I5CA 4WBFA 1RTJB 2NSBA 2IY5B 3M2VA 3BYRA 3P96A 2V5HG 2AGPA 4ZVFA 3NGKA 2UP1A 2ZVSA 1FEHA 3V6DB 2ASJA 4H4KC 4JV5F 4J5OA 4KHMA 1JQGA 3NCQA 3CJ4A 1RWVB 2PSZA 3R8YA 3DM2A 1J5EJ 2Q66A 1BLUA 3HKZD 2VBXA 1JIHA 1MMNA 1X5OA 2DGSA 2L08A 3WX4A 4YHHF 1UKUA 3KHRA 2M52A 3NGTA 1IXKA 3CNQP 5CZVA 3T9ZA 1QTMA 5F8MA 4LFCJ 1P1LA 4ZPDA 4OIXA 3JAMY 3MEDA 2BUNA 5LT5A 1MG7A 3H90A 4RNNA 5B0CA 2FVPA 3QJPA 2DJWA 2ZVIA 3VGTA 2CQIA 1UP1A 3E01A 4DUTA 2KO1A 3FSIA 3KK3B 1FD2A 2A3JA 1VLYA 4IUFA 1ZPVA 1RU1A 1Y7PA 2R42A 2BJ3A 3QMQA 4NI2B 3N0VA 3RW6A 2YPZA 4RLEA 1ZM9A 2HGLA 1V3RA 2BVZA 1T11A 5LMNF 4L74A 1RUSA 2DRAA 3BR8A 3CJ0A 3FFIB 4USWA 3DLGA 2IM1A 4YP3A 1BQNB 2OTLS 1O8BA 3HHEA 4B9NA 1ZBTA 2ZUAA 3FEXB 2BR0A 1G4CA 4JV2A 4I0WA 4ILRA 1XR7A 5I3QA 4RL1A 3D66A 3QWUA 3W62A 2DHGA 1P27B 3BGOP 1RT4A 3JQKA 1UFLA 1DBDA 2FUG9 2WW4A 4RNHA 5AE2A 3IR5B 4ED5A 1Y3KA 4FS1A 5IXUA 1WI6A 5L46A 4IQMA 1VK8A 5ETRA 1OY8A 3KUGA 1Q82T 3L7OA 1ZA2B 2CQ3A 3UN5A 4R25A 4F36A 4H4KA 3A3NB 3RUBL 4RR5A 4C11B 4DUZJ 1RYSA 2YX1A 3NY0A 1RAEB 4P6QA 1WEZA 2R8JA 4OMFG 2B9YA 2A18A 1YHQS 4OYZA 4ZIVA 3LWLA 3DLBA 1NK6A 2R2RA 3CJTA 1LWXA 2ZH4A 3UDVA 4FF2A 3R2CJ 3G87A 1HNZJ 4KAIA 4AFFA 1WC0A 2CDRB 1UFKA 5A2QU 5CA5A 2WB4A 3MM7A 4CO4A 4CLWA 4DXLA 2GMJA 1JLQB 4BWMA 4EU0A 4C48A 4F0MA 1WF1A 2QL7B 3VZIA 4WYLA 4U95A 2JRSA 4F3OA 1FK9A 1G1XA 2CADA 3TWZA 3GU0A 2YNHB 4F04B 2V4RA 2IM3A 5CYJA 3ZTPA 2DGVA 3DLEA 3ULHA 3A8EA 3GR1A 2HFSA 2I6WA 2Y8WA 1DTQA 4QPXA 1BWVA 4AL7A 2RE1A 3OXFA 4K59A 4YMEA 4J9QA 2NREA 2W7OA 4WF9Q 4IH6A 3QGHA 2W9BA 2X3DA 2C3PA 1QM9A 1RHUB 3NLCA 3VCDA 1HBOA 1WEYA 1Q81T 2K8GA 1M5VC 3W2VA 2FLPA 2XNRA 2W4PA 1LNQA 4JI4F 4OHVA 2IJNA 1HNXF 1OQ6A 3VAJA 2IYGA 3W3SA 1RLDA 4DU7A 1SC3B 3D5MA 3RJMB 5C2GA 3VALA 2EI5A 1TVRA 2HVZA 2EBEA 3MURP 1TKTB 2ZH3A 3MR5A 2ZUGA 1Y9OA 4CT8A 5KT4A 2HIQA 3L7PA 1BGXT 2YKNB 3RBXA 2OTJS 2D9OA 4NCGA 2FC8A 3M6UA 3ETMA 3CPWR 4NA3A 1IBMF 6AT1B 2X1BA 4NLGA 2WOMA 1VBYA 3KG4A 1T02A 2R3VA 4IRKA 4TLQA 1O5JA 2O1PA 4C8LA 4ZPAA 4XPEA 3GSDA 1AFIA 5I42B 2MKCA 3NOGA 4OYMA 4NZ0A 1I51B 5EDWA 5KFWA 1H2TZ 2JOQA 4OX6A 2EFVA 4GVBA 1IWAA 4F2SA 2VC0A 4JI8F 4DR6F 1TL4A 4F67A 2V8DA 4CO0A 4FXDA 2F65A 2L9DA 1I94J 2UXDF 4ZVQB 2P5VA 4LF1A 4I6YA 2HNZB 2C28A 3RBEA 2DXDA 1S6UA 5K8MA 4X4QA 1J5OA 2N7CA 4IG3A 3OR1A 4WWSA 1S9EA 1SV5B 3AJ2A 4WE1A 5ITHA 4X4SA 4DSIA 3EGWB 3IG1B 2LXIA 1OSDA 2G0IA 2PEBA 3DRPB 1EQMA 3CSKA 2B43A 5J1PA 4F3MA 2CZVC 2AU0A 2XO7A 4USKA 3Q2SC 5AJ3F 1FFSB 3M6WA 4ZA1A 1YJNS 2I5JA 2ZH6A 3WIUA 1LWEB 5M2RA 3PDNA 4MIBA 5M2UA 2B56A 5FD1A 3VQTA 3PFOA 2VDIA 1FHTA 3BKUA 2GGPA 3NS6A 3EE3A 3UD4P 4OHYA 2DO0A 4LSNA 2CQDA 1UAWA 1NU4A 4L75A 3GB0A 3LAKA 3WHIA 1BE4A 4FYXB 1BMQB 2C2OB 1LXNA 2H5EA 3B6BA 3I55S 3TAMA 1TL7A 5KOWA 4EWTA 4EEYA 1NHVA 2DHAA 3J81Y 3Q8QB 1ZTWA 2E7XA 3IS9B 2KJVA 4V1Ak 1FKPB 3GIKA 2X1GA 2AEMA 4MIAA 4LF7F 3PYEA 2K3IA 3IN5A 4F4XA 1SC4B 1Q7YT 4NYOA 7FD1A 1LK7A 1PJ7A 5H9FK 3FZ2A 3M2RA 1R0CB 4K2XA 1C2PA 3QRRA 3R5DA 1FTRA 4M63A 2YQ3A 3X3UA 2DEJA 1U1OA 2R7SA 1WC4A 3MTJA 2MMYA 3BO3A 2AMCB 4OYOA 1VJWA 2ZEJA 5DG9A 4DV2J 1S9GA 1RADB 3ZZYA 4I7FB 2FVQA 3NMRA 1PYSB 4F2RA 3MM8A 3K7RA 5ETKA 2DR7A 2B4UA 4K4SA 3OJSA 1YJTA 3PACA 3NNCA 1OPIA 1KTVA 3FCVA 4MK7A 1T8EA 5DG8A 4RW6A 2W2QP 1Q5VA 4M5HA 2MGZB 2EFNA 2D1CA 3V4IB 1T9YA 2WB1D 1HARA 1V6HA 2DNQA 3IA0A 4WYWA 3W9HA 3ZZ0A 3C15B 4UTGA 2ACMA 4KSEB 3RYLA 4AYBD 5DQHA 5BYRA 3HD2A 4C0HA 4N41A 3H2UB 2WTFA 4W90B 4ECWA 2GVZB 4GO5X 3JSMA 1C1CB 2V9KA 4HHJA 4DF8A 1IBKJ 1S0MA 3TANA 2IRYA 2F4FA 2Y0SD 4M5IA 3M6VA 3JTNA 3OVBA 1R0BG 3E51A 4HT7A 1F9EB 1RE1B 3SZ2A 3SQOP 1XMOF 3OD2A 1ICEB 1J27A 1E6VA 3T3FA 1I1GA 4C3KA 5HMZA 4NLRA 1URRA 4P2SA 1TAUA 4DSKA 1C0UB 1CC7A 1ZAXA 4CM0A 4YB6A 3K57A 3AAWB 1XMQJ 1Y10A 4JYAJ 2IFXA 2BABA 1U25A 1W26A 3D3CJ 2BOAA 4LFBF 3ZO7A 2R7QA 2HBQB 1TK0A 3GFXA 2CWXA 2XNQA 2IC3A 5DDOC 4DV0F 4EUVA 3JTOA 2ZWOA 3VZHA 5IV4A 4USVA 4LSZB 4CWBA 3M30A 1D0EA 1TR0A 4LIWA 4B02A 2G13A 4ES2A 4PG6A 4OHZA 3SV3A 1TQLA 4TN2A 1KLMA 2ZWPA 4RU9A 3DKDA 1SL2A 5D3GB 4WP3A 3JAMU 3ZTOA 1BD6A 4WFBQ 1U1PA 2FB0A 1SJ4P 3QO9B 1WI8A 1IKYB 1H98A 1LOUA 3D6FB 2F8MA 2XO6A 2UVRA 4GKJJ 2RDDA 4RW4A 1U1QA 5LJ3Y 2VC1A 2AYMA 3CDWA 4ETXA 2XMVA 4KTQA 2MLXA 1WSVA 4YDXA 1VBXA 5KFDA 2J7UA 2XEXA 5IM0A 2QLXA 2BOPA 3HT3A 4X4VA 3T1HJ 1DY3A 2CQCA 3U1NA 2V4JA 2VA3A 3IGVA 2O5DA 2MYFA 1HHSA 4Q0BB 4EBEA 3KUEA 4IFYA 1TL5A 2M8HA 3IWXA 2PMHA 4DSFA 4ZVOB 3IMQJ 3VAMA 5AE3A 4I64A 2QMXA 4ZHRA 3MD1A 1FKOA 3C6UA 2W2MP 3Q24A 1LKZA 4OYPA 1JLEA 1RTJA 5MLCV 3L95X 1EIYB 3GYXB 4FXVA 4G65A 2UV8A 3V6DA 2ROGA 3JSRA 4LF6F 5F9LA 2R7VA 1S59A 4KY3A 4LF5J 4CQ1A 1K1SA 3D4JA 4X64F 1FEEA 2HFUA 3EGVA 3TZXA 3DOKA 1H7WA 4EO6A 4CO2A 2V8VA 2IVFB 2ADBA 2XS2A 3VAFA 3FUYA 4X4RA 1I94F 4KFBB 2N4DA 1C0TA 5F8IA 3VAHA 5EN1A 4CH7A 4DR3J 2HVDA 5D77A 4X65F 1M5PC 3ZTQA 3DHXA 2UU9F 5LSRA 5H1SV 1YDLA 2VPXB 3FMWA 4B3SF 3F44A 1K73T 1SXLA 3IBCB 1FRIA 3JSYA 1KQFB 3AJDA 2DK2A 3PHTA 1Q86T 2BM1A 2ZM6J 2B4OA 3UDLA 1NSKL 2KDOA 2E9ZA 2CPHA 4ZLNA 2DY1A 3V6JA 1FJEB 5HJXA 3CUNA 1RWPB 3DN9A 4DCOB 4F4WA 4HEA9 3PW5A 4Y65A 1T9UA 1UWAA 3U1MA 2XMTA 3T9NA 4ETZA 2VKRA 4NI2A 5LMUJ 3QFWA 3TA1A 5SUHA 2N3OA 3NEKA 3MMCA 1HWJA 2MSSA 1SL0A 1HD1A 3DOMA 4JI3F 2E5HA 3LP2B 2UUCJ 5D15A 1KHVA 3FFIA 4A46A 2RQKA 1WUUA 1NAQA 3PW7A 3NS5A 1Y11A 4CLTA 4CNYA 1MU2B 3RTVA 3OUYB 2CAJA 5F8GA 2KRRA 2HLTA 4J9LA 2CZ4A 4JI0J 2HAFA 3JQJA 1VQKS 3GQCA 1A7GE 2NXNA 4WTOB 1QDUB 1HBNB 2H5IB 2HS3A 1X4DA 4AXIA 5KT2A 3P6YC 3OSNA 1B64A 3DGVA 1B0VA 4ZITA 3H5YA 2EFPA 1FRKA 2BXJA 3IRWP 4OJ3A 4DV4F 4LQ9A 2KZMA 3FBCA 4USMA 2WVCA 1JLAA 1JB0C 1FWKA 4DZ6A 1G2EA 4UOCA 2BJ7A 4CLUA 5LOQA 3OTCA 4F02A 1B99A 1CULA 1U2FA 1BHNA 3SCJE 2QLWA 3TYTA 5J2PA 2HQ3A 2DIVA 1N48A 1PBUA 4O3PA 3O6QA 2OEKA 2B5JB 4DR4F 4CLKA 4ES3A 3Q23A 5C5JA 2JC1A 2W9AA 3QGIA 4YR2A 4ID5B 1DAXA 1U48A 3GV8B 4P73A 2YNHA 1N6QA 4DR2J 1NJXA 2AIRB 1F5CA 2HBRB 1FJGJ 4DPUA 1Q5YA 5IT4A 3CCVS 5DZ6A 3DLKA 1S1XB 3CCWA 1HD0A 3GYNA 1NJIT 1RT7A 3DRXA 2YXLA 1PJ6A 2XZTB 1YRUA 3V81A 2C2MB 5D4OA 2E5IA 2BW2A 1GQEA 4ZCKA 1CPZA 1H74A 5F3TA 7FDRA 3KMQA 3EVOA 3J81U 2WSFC 3C3LA 4LBPA 1TKTA 4O3RA 2ZZNA 2J5AA 3QBCA 1CS4B 4DMZA 1VC0A 2YKNA 9RUBA 4O0NA 1MWYA 3W5YA 5AE1A 2HBYB 2WVDA 4LSLB 1DURA 4O44B 2LYVA 3FQKA 2ZDPA 2NXJA 1N88A 3GP9A 1PSDA 2EK6A 1U0HB 5E2QA 1QJHA 5I42A 3MEEB 2E5LJ 4PR6A 2FHKA 3HVTB 2DNMA 4DSLA 3NRBA 5L9XA 3CCSS 3EPIA 2BBEA 4NLQA 3P4UB 4W98A 1RAGB 4E98A 5HL7Q 3DU6A 1FX2A 3DCAA 2OIHA 1DRZA 4Q5VA 2RKIA 2HNZA 1I6JA 3SQGA 1S12A 1DTTA 5KG7A 2A0FB 4QOTA 1SV5A 1RWKB 1IKWB 2EVZA 4YY3F 2UXCJ 4A8XA 4OZ0A 4WJBA 3BGFA 3IG1A 2JEFA 4GKJF 2QX0A 5D0GA 2DD8S 3BV8A 1WTFA 1U45A 3PW4A 1D1UA 4UOFA 2ZITA 2K3KA 4CH0S 2XHCA 3MM9B 2NPFA 5GMEA 2F8HA 3NWGA 4LR9A 1IR1A 3OTOF 4ICLB 1LWEA 3KDNA 3MDFA 4J9RA 3PX6A 3I96A 4DV7F 5LSLA 2FHMA 2F4VF 2F5GA 1H72C 4PKDB 5E3CA 1KRPA 1NPRA 4I2QB 4GKKJ 1RDRA 5KT6A 3CULA 2VJUA 4OX7A 3GR0A 2VD3A 4OX9F 3IS9A 3SFGA 3BGRA 3POTA 5J2NB 2W9CA 5T7LA 4R5PA 4LR8A 2CYYA 1R0AB 1AW0A 4K0KJ 3UCGA 1LW0B 2GCFA 3LO3A 2RNEA 5DDPC 1X5TA 3NS7B 3W66A 4DU8A 1O51A 5FIIA 4LBIA 2XMMA 4ZP8A 3VAGA 2FGCA 3UPFA 3W9IA 4KV8B 4E2FB 4UUWA 3RR8A 4ZP9A 1UVJA 2MZRA 1TTHB 5GAGU 1EJ7L 4URGA 4C3MA 3SEOA 2GZOA 2COLA 1UVLA 4GRSA 4EYHB 3MI7X 4EI2A 1WOPA 3W63A 3PZPA 4K7QA 1S0VA 1K0VA 4FYDA 4O4GB 3MOZA 3SSSA 3TO8A 4LFAJ 1T9WA 3CJ3A 5KFHA 2MZSA 2ACYA 4ZMMA 3HI9A 3HT0A 1S6PB 3CDEA 2PI5A 5IS2A 2DH7A 2FIUA 3PW2A 1BQMB 5KFSA 4OZ3A 5HO4A 2RUGA 4NE9C 3VWSA 5KFTA 2EFQA 3GIRA 4I6AA 4FF3A 3R3TA 3QJLA 2OHDA 3K5NA 4WXWA 1ZETA 3ZZZA 2V63A 1R3NA 2HFVA 1QUPA 1Q1KA 4UY8T 3NL0A 4DX6A 4XDCA 4N77A 1C4CA 4NL5A 3IRXB 2V68A 5F41A 3P49B 4A8YA 3UNGC 4L73A 5BR8J 2UUCF 3QZ8A 2W1BA 5BYSA 3JYTA 2CPFA 3D54A 4X4TA 4DPYA 4LT6A 3MOJB 2DHSA 1MW7A 4Y2AA 3JXOA 1C1CA 4Y28C 5CAAA 1K8AT 3I0SB 2F40A 1N34J 1FJ7A 3LF0A 1KP6A 2V94A 4WU3A 5F8HA 2QA4S 4OHWA 2O3DA 1WG4A 8ATCB 2FZGB 4Z7CA 2F9DA 2BE9B 4F4ZA 2C42A 1TKXB 3KDOA 2XSFA 5KFVA 5KT7A 2CJQA 4U96A 2IBKA 4DQSA 1AB8A 2OPSB 3PY8A 3OTEA 4NLXA 5CHCB 5F8JA 4HR2A 1WC6A 2FJAB 4OI6A 3TA0A 5DDRC 4CCHA 3BGLA 4ED4A 3DYAB 4WZQA 2CQGA 2WVBA 4DPTA 4DV6F 3I9ZA 1SPBP 3M9OB 1U1KA 5K8OA 1VRTB 1AA1B 3LP0B 2Z0GA 5CCLA 4HHUA 4B9SA 2F9JA 1FNOA 2LKZA 4R8UB 1WKLA 3E3XA 3HFKA 4AQYF 5HQ8A 3HDSA 1YITS 2KHDA 2DY9A 4I68A 1BXNA 4KIAA 2F7VA 1DQAA 1HR0F 2MKJA 2HURA 1N5TA 4Y0FA 3IR6B 3T6BA 2H9ZA 1HBUA 4DPOA 3QO9A 1VBKA 3DOLB 4C8KA 1IKYA 5H9EJ 1GTEA 5E5NA 2IJFA 2OKQA 3W8PA 2OH2A 3I87A 1FX4A 4NXNF 4ZVTB 4HH0A 3G6XA 4UT4A 1U24A 2LECA 1GMWD 5DG7A 4PABA 3J7AN 3NKYA 4IO1A 2LA6A 1M5SA 1MN7A 2QMUB 3GCWP 4AL6A 3MWBA 1P6TA 3DNCA 5JVHQ 4Q0BA 4FS2A 1EX8A 4K4VA 2FQQB 4C7QA 5KG3A 3QT6A 5LXRA 2POKA 1EKRA 2WSEC 1TAQA 2DNNA 2OSRA 2HQDA 4BDPA 2LA4A 2Y0BB 3M2UB 2HHSA 2KFYA 1KKHA 4DL4A 2YX7A 4Y34A 1RACB 1SVDA 1Q7LB 4FYWB 1X4CA 5HI7A 3VAIA 2XY7A 1CC8A 2CQBA 3PO4A 2XCPA 3ISZA 2K2PA 1Y5NB 2BW7A 1WKKA 1IJEB 2BJ8A 2FZKB 4DQQA 1IR2A 3D6MB 2VHGA 1KD1T 1U1LA 3NGRA 3PYDA 2B9WA 2JEGA 3NCRA 1O6XA 1WHYA 2HZCA 2WONB 4Q8FA 1QLNA 1X4GA 5IOLA 3DDIA 4DN0A 2BMBA 2BE2B 3D0GE 2CJAA 2C3YA 4EZ6A 3TW0A 4XTTA 2QYCA 2CJYB 4CO5A 4IFVB 2WK4A 4IG0B 4KFBA 2DKOB 3BGUA 2DNRA 2KL8A 3NNHA 4ZVHA 3A12A 4HT5A 4D3HA 2ASDA 5C7PA 2W01A 2DR8A 1FD8A 1YBTA 4DR7J 1TMJA 1S57A 2GHVC 4QJVA 1AUSL 3MPVA 4J37A 3N6NA 2Q43A 2XZDB 2E1PA 4HKQA 4USUA 4OYXA 3W2WB 2L3MA 2HKEA 1X4BA 1S6OA 1FESA 1CVJA 4K4YA 3D6HB 2DNYA 4WXOA 5KFAA 5JJBA 3QRQA 2RF2B 1OSCA 3T5HA 4ED6A 1VQOS 2AD9A 4KJIA 1Q95G 1NJZA 4ILLA 5LM7E 4ECZA 2GVDB 1ZM2A 4IDKB 2NSCA 2PI4A 2Z2ZA 1FDNA 3UWTA 4M5DB 3W61A 4JV0A 1XNQF 1SJRA 2UVUA 4WK1A 8AT1B 5K5MA 4ZPVR 1NH8A 3SXLA 2LMIA 2KHCA 4OI2A 1MU2A 2EKYA 2RHSB 3CCES 3IBWA 3K0JA 3MAHA 1VISA 2AWZA 3ZNJ1 5CD4H 3K5LA 4A8MP 3E2EA 3FBBA 2RRNA 1PC4A 2FLOA 1RTIB 1F2GA 4WFAQ 1RKJA 1GEHA 2VG5B 4P2XA 3N28A 1EETA 4OJ1A 2YNGA 3ISND 3LP1A 1U0SA 3C16A 1RWMB 1LQ9A 4BC9A 4QWCA 5J2QB 1WC3A 3KOAA 2ZOFA 4P72A 1HQUB 3HLUA 2QLFB 4X62J 3MR7A 1QAYA 1KS2A 1MROB 4B3MJ 1TP7A 1KQSR 3OSPA 3MPUB 2ADCA 2X1AA 4DUYJ 3OL9A 4LFAF 2J8AA 4W92B 4QIWD 2LFVA 4M8LA 2H3EB 5HSPA 2MHNA 4AUKA 3BSAA 2FJWA 1N5SA 3TQEA 2DR5A 4ECUA 4JI6F 4Y00A 2VG7B 2KKHA 2B5JA 3EUNA 4C2MA 1RTDB 4ATNA 5T14A 3DMJB 3ZZOA 2VH7A 4I1TA 1M5HA 3QFHA 4PAAA 4UOGA 2G0CA 2CQ4A 4GC7A 2XULA 1RT1B 3OLBA 2V67A 5GADU 1LFPA 3M8RA 2D3OR 2AV5A 4QYZJ 4JV5J 3LWMA 4HH1A 1S1XA 3L9ZA 3FJ2A 1WORA 1XN9A 3QLHB 1S1WB 1FWLA 2KU7A 4OI3A 4CNZA 2BKNA 3MECB 2ZHBA 1L3VA 2CNKB 4X66F 5HANA 1X31C 4N76A 3KJQB 4JI5F 4LJMA 2CDQA 3CCUS 3MM6A 3EZOA 3T5KA 3DRSB 2JX2A 3G82B 1RWOB 1AUDA 4CO1A 5KFKA 1NDLA 3MAQA 1R8AA 2HHQA 1T3OA 3EDRB 2R8KA 2HYIB 1TMMA 1CS4A 2E5GA 4QR2A 3P45B 3IFEA 4ES1A 4KRWA 4I67A 4HI2A 2B3TB 1WOSA 1IQTA 2Z2MA 1Z1ZA 4LF9J 4LSLA 1VC6A 4O44A 1KWMA 3RRGA 2MZTA 2GJIA 1SUQA 2YH1A 3OFEA 5CH7B 1U0HA 2W8LA 1ZM4A 1QSLA 4F4YA 2QTWA 1H73A 2J9DA 5A8KB 1X9MA 1KEKA 1W2IA 3G86A 3GWCA 3AQPA 3HVTA 2MLYA 3G2XA 1I5OB 4RWWA 4K4WA 5DQGA 5F0WA 4FF4A 2C2NA 2G1DA 4C8MA 4MH8A 3ZFVA 3R97A 4ZPBA 2Z57B 2GQQA 4NLPA 4DQPA 2H65B 2VZ9A 2CA9A 2V34A 3WQPA 2JSXA 2KJWA 1IKWA 1R8HA 2ZH1A 2AKWB 2PO4A 4DSJA 1FKAF 2IRUA 3QSYB 3CE8A 1FFGB 2QA2A 1KLNA 4QIFA 4PXDA 1U26A 1WF2A 2R2TA 2UVVA 5GAGI 1NBEB 3CD6S 5EWFA 4ICLA 3JQMA 5G0RA 1L3SA 3FEYB 3H20A 3BDPA 4HACA 1TL1B 2PGCA 4DS4A 1UMJA 3BBFA 3FDSA 3D2WA 2DGXA 4B3RJ 3QZ7A 2GJ2A 2KT3A 4PWDB 2EC0A 1TV6A 5C24A 3Q89A 1LWFB 3F56A 2HLUA 3ILLA 1H2VZ 1UJ4A 3M05A 3KLHA 1RT6B 3R7SB 1X7VA 2NYHA 1FO1A 1UWBA 1C1BA 2FZCB 2DT9A 1RAAB 1TFWA 1FE4A 2AHOB 5D0EA 3H4BA 4V19X 1OMSA 2CPEA 3EGNA 4RBTA 1NK0A 3PCOB 1T95A 5FDLB 1KTQA 4KV8A 5AXNA 1LFWA 2B51A 4NRTA 1D8ZA 4YDDB 2ZOMA 5DM6Q 2H48B 5GMKa 4JUZA 1B0PA 3DGPA 4GC6A 3H2LA 2ZFHA 4OJGA 1PILA 3C6TA 1Q8KA 2EKNA 4J9VA 4JI4J 4NLSA 3Q8RB 1HNXJ 2G2OA 4KGMA 1K44A 1RHQB 2W4DA 4Q2LA 2IPOB 4O4GA 2RJZA 1BQXA 4DCPB 1VS3A 4YR0A 5HMWA 2J0SD 4A4JA 2YKMB 1UETA 1YK9A 3J7Z5 1A9NB 2W2NP 1VYAA 1LW2A 1WOOA 2HRTA 5C2CA 2GW8A 1G6BA 4ECRA 1BQMA 3M8WA 2KT2A 1N56A 3SDEB 1IBMJ 5HN0A 5AXMA 5I4MA 1DFDA 4ZPCA 3DLLQ 1TUGB 1SJ3P 1PGZA 3O1LA 2E1CA 2HEKA 2DHXA 6FDRA 4RX6A 4F3QA 4KHPF 1Q8BA 1S6QB 3IRXA 5CXTA 1PO6A 2AX1A 3A1YG 2C22A 4ZK7M 3BQ0A 1FA0A 1CJUB 1NO8A 3WIVA 3CCZA 1SIWB 4O3NA 2WCXA 4XO0A 2DNKA 4JI8J 4DR6J 1RK8A 1Q79A 2RIJA 2MQNA 1RLCL 2JLGA 3OR2B 2UXDJ 3I0SA 4WFNQ 3HMJG 2MZ1A 3B4DA 1SQEA 2HMIB 3BPSP 1EP4B 1EHWA 3EJMA 4QPTA 3HKWA 1RWWB 3ILJA 2MKYA 1FWPA 2GFFA 1RT3B 4RNFA 2QE5A 1CG2A 1CBKA 2ZH7A 4KC5A 2P6SA 4JP8A 1K0TA 3H5UA 4B08A 1LWCA 3OFHA 5AJ3J 1UL3A 2OPSA 2QL5B 2XZWA 4DX8H 3MGJA 4ECTA 2HHUA 2Q6BA 3D7SB 5EX0A 3MCNA 3K58A 4YUDA 1JMTA 2CG4A 4X62F 4DS5A 4IH5A 3IXQA 4DUYF 4MKVA 1VJQA 4OLOA 2J0QD 3PVXA 3M6XA 4N47A 1VRTA 2NUUG 2RQ4A 3LP0A 1S1TB 4PZVA 3UNYA 3TJ8A 3HPOA 4C8OA 2OPQA 4R8UA 2VIHA 5HK4A 2HZVA 3PR4A 3HSJA 4CYUB 2RDIA 2YY3A 1VI7A 4QCLA 5DLFA 3OTBA 5HVGA 4X4UA 2HHWA 1JKHA 2OMOA 4ELTA 1NK8A 2OPRB 3CMES 2WAQD 1RTHB 1RAHB 3MM5B 4LF7J 2GC8A 1NK5A 4K4XA 2AJ0A 5D0RA 2BKOA 3R1LA 2PA3A 4OYIA 4MYTA 3R5JB 1RHRB 1NSAA 1D9FA 5D4NA 1URNA 3U02A 4KKOB 3ENAA 4ECQA 3ET6B 1FRJA 4DLEA 5DETA 4N8NA 4RNOA 3CJ5A 2YWKA 4UZBA 3PJ9A 1X60A 2WSCC 3K17A 3DRYA 3KJVB 2V6AA 4PG8A 2HHPA 4RWXA 2UUBF 4ANEA 3QAUA 1H6KX 1ITPA 4Y2IA 5GAEU 1Y3JA 3M1VB 3R5GA 3UQSA 2LQ5A 4JI2F 4RW7B 2WZ1A 5ETPA 5HJYA 4WKRA 1C4AA 5IT9Y 4P52A 1UVKA 3AOBA 4UOHA 1RT2B 2D41A 2MY7A 4MK9A 4TYBA 4LF9F 4FNIA 1HQEB 3A3PB 3AB4B 2MQMA 3N5BA 3HF5A 4IKAA 3WZ0A 4X84A 4IQXA 2FVRA 4DPXA 2KXHA 1N5VA 3EDQB 2OP5A 2I0XA 5L1JA 5HQMA 1W2BR 1WC1A 3ICLA 3M7VA 5E3RA 4WFYA 1N5YA 2RILA 2CPJA 1FDAA 2BACA 3HX9A 3RRHA 2WONA 2QG9B 3FSYA 3OTDA 3GCXP 2DGUA 1REVB 5THWA 2BE2A 2NXCA 4JBCA 3MCOA 3BZQA 1HFEL 3NXZA 2BJ9A 3PKMA 2H51B 3FCHA 1HA1A 9ATCB 3AD8C 2VPZB 1WDDA 5BYQA 1TKDA 2B7CB 2CQ0A 4ZIWA 2ALZA 2M3DA 3K8VA 5CQGA 4EBCA 2U1AA 1ACMB 4LRAA 2IVYA 2RAQA 1XMOJ 1K1QA 3HULA 2XGPA 1RHJB 3BB5A 1DHMA 4C0BA 2ASYA 3US5A 3W5XA 2ZBCA 1S99A 4U7UK 5CYQB 1D9DA 3B4MA 3SIPB 4DV3J 3KFWX 4A47A 3FCWA 2DGWA 1KVJA 1XIQA 2FD2A 3GILA 4UQTA 4OZJA 4LFBJ 2YWEA 5I3PA 2MKKA 1S9FA 4ER8A 4DV0J 3CCLS 2G2ZA 3E01B 4B3RF 3W7BA 1S1UA 1OYDA 5L8RC 3CCTA 3VQSA 1NK9A 4CDIA 2W2PP 4NLUA 5KFOA 4M5JA 2W7AA 1UW4A 2AW0A 2MTLA 1T05A 2PN6A 2GVDA 3SV4A 2GJFA 3IAS9 2FVCA 2K1RB 2I2YA 1RT5A 3KLEA 4DQRA 3J81j 2JEJA 3ETOA 3HCXA 1KVKA 3AQOA 3CB4A 1RAJA 3C66A 2OMLA 5LSOA 3GE9A 4I69A 2JEIA 1S4EA 3DLGB 3RB0A 3TARA 5E3PA 3FKBA 3I0RB 2WHOA 2WVFA 1YG0A 5IV3A 1D3WA 1B7FA 4AD6A 3Q8SB 1RTIA 5GADI 3I32A 2VG5A 2YNIA 3KLGA 2YQ1A 1B0TA 2M8DB 2MZJA 1JLCB 2KT5A 3H0PA 2CFXA 4ED8A 1SI9A 1H38A 5H9FJ 1U2CA 2MQQA 1IKVB 2VODA 3CIZA 1ZPWX 3LGNA 2R2SA 1U2RA 3OW2R 4G1PA 5J2QA 3B82A 2Z30B 3RR7A 1JX4A 3TUZC 3AA9A 4EZ9A 3QT8A 3MF5A 1UJ6A 4DEZA 2UUAJ 4KGKA 5AXKA 5HMXA 5KFPA 3D1OA 1SKSA 4C6AA 4BHQA 1D8YA 2QT7A 3HFZB 1T7PA 1T03B 3NOCA 3GYGA 4IYQA 4M1KA 4NMXA 4D3GA 5BJRA 2BA9A 4ZVRB 2HWIA 3CJSA 1MMDA 1HI1A 1F9HA 3BO2A 3GZ7A 4OV6A 4ILMA 1WHVA 4NASA 3KYLA 1NK7A 4DLGA 3EPGA 3HK2A 3RZAA 3HSGA 1GX5A 1N5QA 1IQZA 2VQEF 4YOEA 4HLBA 1FXDA 1S4FA 2YWWA 4NMLA 1SH3A 5AXLA 4LF6J 1DLOB 1WHXA 3R6GB 1KOHA 1S7HA 2BANB 1OPZA 2YPYA 2JLEA 4A8KA 3T1AA 2J6SA 1UPMB 5HLFA 1SCJB 4X64J 1S1WA 1T3NA 4B3OA 4TU8A 3MECA 4PUOB 2PMWA 2HNYB 5KFUA 5EWEA 1APSA 3PEJA 2YNFB 4WK3A 2X51A 4X65J 3RAQA 3HSZA 4KT0C 1KQKA 3PX0A 3VR1A 2HVEA 2CPDA 1QUVA 2GO9A 2UU9J 4F26A 2Q6CA 1RCXB 2ZNZA 1ELOA 1HBOB 3Q8PB 3DRSA 4ZCMA 3BN7A 3G82A 2GMHA 4B3SJ 2R8IA 1YLXA 1XQIA 3PIOQ 3BQ1A 4ANDA 1F5BA 4H4MA 2E1MC 1SJ1A 1H2UX 3NCPA 3KHLA 2VG6A 2LQ9A 2QYGA 5EGYA 1NSPA 2MKIA 1TVRB 2ZH5A 5B0BA 4CP5A 2JLFA 3JTPA 3ZC4A 3R6LB 1MMLA 2XI2A 2B6AA 1YVFA 2UZAA 4DFKA 1T0TV 1QY7A 1FI4A 4P75A 3A8IA 3DHWC 4OYWA 2MHEA 3EZ5A 1D9AA 4QZVB 4I2PA 2HVHA 2ZC4A 4OI0A 4JI3J 3G96A 4DR1F 2QLJB 3OBIA 4NPOA 2ROEA 3S01A 1MWQA 1GXTA 4GVBB 1S72S 1QVGR 3L4BC 4OZ5A 2GMLA 1Q53A 2F63A 1U8WA 4ZVSB 2H54B 1CJTB 1VIOA 1XBWA 3SYZA 4RW8A 4NOHA 5A0YA 4KE5A 5L9NA 2C1EB 3PHEA 4ZCIA 3CWJA 3WDOA 2JVRA 3OL6A 1W7WA 4B17A 2HS0A 4NLTA 1MWZA 3GG0A 1GK8A 2HIYA 3BKTA 1OS5A 2ZBPA 4UY85 4YR3A 3V4MA 4Y2MA 3PNIA 3TOQA 3T1YF 3EGZA 2IMWP 1JLGB 3G6YA 4MKAA 4ELVA 4DV4J 4CM2A 2W2OP 4QW9A 5KFBA 4WTYA 4PWDA 1RAFB 1YKWA 4ECYA 4O3QA 2LCWA 2VONA 2J6TA 2J7WA 1RWXB 4PG7A 3I5AA 2N82B 3GTYX 4Z2XA 1HNWF 5ADZA 2CPZA 2GGPB 2DBBA 5F0UA 4FYVB 5D4LA 3F41A 1HBMB 1FCAA 3ITHB 3V5RA 2KXNB 5C25B 2KG0A 3BS9A 3DI6A 1RZMA 2HQCA 4A8OA 4LSNB 4DR4J 5KG0A 1NCLA 4I56A 2M70A 1M90T 1NJWA 1TL7B 2YWGA 2DNGA 3ILOA 1NB2A 2OLWA 3KHHA 4KR0B 4CRJA 1WEXA 4U8YA 2W7PA 1VR6A 1JNZB 1VFJA 1GNKA 3DXSX 1N0VC 5E0OA 4J9NA 2OELA 1UPPA 2G0JA 3TP2A 1GXLA 2R7TA 3J7YI 2XY6A 4DCJB 3I56S 4ZLLA 3UVJA 1N52B 1MNEA 4KBIA 2QA4G 2CRLA 4IOAQ 2VUGA 2KM8C 2ZH9A 2AJQA 1CEZA 1PYOB 1BC6A 2MQOA 4LRDA 2EFOA 1P8GA 1ZA1B 3IC1A 1UZDA 2AYGA 1S9GB 4DV3F 3C2PA 2BX6A 5ETNA 2VU5A 2JL9A 4OL8A 1T9TA 1TKZB 4HVZA 2R7UA 5JUMA 2HGNA 3GPAA 1PYTA 2GIQA 3K5PA 4UF4A 1HNVB 3A8JA 4J7CA 1IKXA 2YKQA 3N01A 3AA8A 3W60A 4RW6B 1S6QA 2IDLA 1Y5IB 2GNKA 1CJUA 1U1RA 1FFWB 5KG4A 2HVIA 3MZIA 1UCNA 3MFIA 3OR2A 1HPZB 1A6LA 3LTOA 4TY8A 3BR9A 5ETOA 4BWJA 2AZ3A 1B7YB 2DXFA 3MMBA 1RGVA 2XWYA 2ZBIA 4NLOA 3CVKA 3J7ZT 2QV6A 1P9YA 1OY9A 3JSMB 3OFGA 5B0FA 2A2DA 2FJXA 2RSQA 2V8GA 4M5KA 1U4BA 2XCAA 2Z2LA 4YY3J 5IT9U 1RT3A 2EG1A 1KHWA 1NZAA 4GO7X 2VQFF 4A8FA 3BN4A 2DNHA 3I82A 4DV1F 2BZ2A 1X4FA 1SKWA 2LQBA 1BUXA 2QEXS 2IAJB 3KK2B 4MFBB 2DCUB 4B3TF 3EYZA 4MMOA 4DL0C 3PRVA 1U1NA 3LA0A 1HNIB 1CJVA 4ZN1A 3OTOJ 2QC3A 3H98A 2OJ3A 3MCMA 3IAM9 2RS8A 1A0OB 2M2BA 4DV7J 3G8QA 5A8WA 4LF8F 3N79A 7AT1B 5GAEI 1QE1A 2UUAF 1S1TA 1R89A 2EEYA 4L76A 2HK3A 1IJFB 2F4VJ 3AB2B 4FKXA 5CYMA 1SIZA 4Q7AA 4ZS6A 2ZD1B 3HVRA 3X1LB 4J91A 3UN2A 1SH0A 3BBBA 3THVA 1RBOB 3M30B 2CG8A 4OX9J 2QIFA 4DQIA 3HJFA 3BJYA 1HYSB 2A1BA 1RTHA 3MR6A 3MM5A 1RKIA 5DLGA 3ZZRA 2OEMA 4ZKAA 3RAMA 3DLJA 1KLMB 5CABA 5L1IA 4KB7A 5GAHU 1Z4UA 5KFEA 1SC6A 1P1TA 3JSBA 3HXMA 1K9MT 4YB5A 3HHLB 2IJRA 1YJRA 1S49A 3N5FA 4KKOA 3QNWB 4C4WA 2QFIA 3ET6A 3VVTA 4CT9A 2A10A 4AT1B 3LUYA 1GT8A 3KNAA 2HSEB 1CLFA 3M8PB 3A4TA 3JS9A 4DR5F 1N32F 4IOCQ 2ATCB 5DRKA 2OFGX 4PG5A 1SQGA 4Q8EA 1N36F 3L3CA 4WU2A 4CLYA 2V4JB 4QQBA 5KOXA 2CKWA 4XPCA 1JWWA 1KOOA 4IFYB 2YVSA 3AT1B 2XYGB 5HQLA 2JWNA 3PTWA 4CLLA 3SCKE 3BM7A 3HHDA 3K59A 4JI7F 1JJ4A 1KVIA 1RT2A 1FVQA 3Q8YA 2G4BA 4NWBA 2EG2A 3KK3A 1FKOB 3C6UB 5KG2A 3DC2A 3QGGA 3AD7C 1SH2A 4C97A 1WF0A 2PIIA 4QWEA 1RQ0A 1YRXA 1XR5A 4KPYA 4P10A 2CXEA 3AY0A 2CZ9A 1NNDA 1REVA 2XLIA 4RPFA 3UDEA 5FJ4A 3PV8A 4MT1A 4DFMA 1CQNA 4DFJA 3HVWA 1YBAA 2CUYA 1F60B 1BQNA 3Q0AA 3H40A 1RBLA 1NSQA 2MXYA 4OLPA 3PW0A 3DOKB 1TL3B 2J6UA 4BBYA 1C0TB 3AD9C 2FLNA 1KBRA 1ZS6A 5FLXY 5L1KA 2OEJA 1RA7A 3ZTRA 2FJEB 2HRUA 3FK4A 1U09A 3PRDA 5IZHA 2ILYA 4DI6A 4DX5A 4TVAB 1EAYC 5CYQA 2Y1RI 4FDFA 1V9OA 2XWXA 3SI8A 4OQJA 5J1EB 4XIUA 4WZMA 5F8LA 3ZNUA 4NCBA 4EGLA 5KFLA 1HW8A 2AEFA 1NK4A 3VHQA 2VBYA 4QR0A 3U7JA 3TZWA 4C11A 2XS7A 4FNHA 2HQFA 2MPUA 4C3LA 3B8HA 1FXRA 4IH7A 4TY9A 1AROP 2W8KA 2JFDA 1M1HA 4QWBA 4DV6J 2J76E 1RCOB 1N4LA 4PG4A 2X7IA 3UO0A 5M2PA 4DV5F 2KXFA 3MMCB 2K1RA 3TVKA 4DX7A 1VQ9S 4F4KA 5JVGQ 4AQYJ 1JLQA 2IM2A 1U6BA 3DOMB 3UCUP 1U02A 4QBUA 3M9MB 2CJBA 1FNMA 2GO8A 4NRUA 1GXUA 2Y1IA 4TYAA 4NEZA 1HR0J 1NLKL 2NS1B 3IBFB 3WX8A 1EKSA 3I0RA 3G8SA 3DLHA 1IR0A 2AX0A 1S0OA 1TK8A 3CEDA 3TZZA 2XYPB 1JLCA 4NXNJ 1VMBA 1Q16B 1YIJS 4Y6IA 3D6TB 4WFZA 3GJQB 1IKVA 2VB6A 1IBCB 4ED1A 1VQ8S 3MEKA 4S0MA 1GX6A 4RUBA 3TQ1A 2ZE2B 5F8NA 2B9XA 3AHPA 2YBVA 4PWWA 1LV5A 3NGSA 2VFRA 1PAUB 1VGYA 2NLWA 4BS2A 3NAHA 1F6TA 1JLAB 4IRDA 1X5SA 1T03A 4F7VA 1JLFB 1Z2LA 2EWHA 1IUJA 4RO0A 3KUHA 3NWRA 5EHHA 1CULB 3CT9A 3OVSA 3FBEA 2HHHF 2R4FA 2QA1A 5J2PB 4OI1A 1ZYQA 1NPPA 2CQ2A 4HHHA 2DVIA 1DLOA 5I3UB 1QSYA 1NXIA 1YJ7A 2BANA 2MJNA 4DL2A 2AGQA 5K9FA 1N6QB 1BY9A 3HZGA 1EB0A 3G4SS 5HATA 3VTIA 4ZVEA 5IT0A 1PIEA 4FVMA 4PUOA 2CVIA 3MR3A 3ZZPA 1PCAA 3DLKB 1WC5A 2HNYA 1KFDA 2NCKL 2SXLA 3KTQA 2YNFA 3KG0A 3OXLA 1VDHA 1T9VA 2DHHA 2R8HA 1YJWS 1RT7B 1Y0HA 4PEOA 4QR1A 4KHRA 3D68A 3H59A 1KC8T 3V81B 5HBMB 2C3UA 3RU0A 5B7WA 3DRPA 3W64A 3IP0A 4BLGA 4X4NA 3TRGA 2ILZA 4RUAA 5T41A 2MQLA 3THTA 2HRYA 4ZJLA 4X2BA 1VOMA 1SJQA 1Y4ZB 2R7OA 2IRXA 1R31A 2ALYB 1UZHA 2R9LA 1JLBB 4C9DA 2J9CA 4GVLA 4C98A 1HMVB 3CTRA 5KFIA 3IWNC 4ANCA 1OY6A 1OO0B 4XDDA 4ED0A 1U6FA 4Y2CA 1LEOA 2NUHA 3C19A 4LF2A 1HWUA 4HTIA 3BH6B 1XNQJ 2YQ0A 1FKPA 4I6WA 2OD6A 5SZTA 2EW9A 1XEZA 1CJTA 3I31A 5IFMA 2OAUA 5HROB 4KO0B 1XC9A 4NLWA 4NXMF 3RB4A 2RKIB 1N33F 3SQGB 3GONA 3B78A 4A48A 1FXLA 1GMWA 1DTTB 2VBWA 3VGSA 4I4BA 2PFDA 4B9TA 2J0WA 3M8ZA 2AJ2A 2OSQA 2V2VA 2FJDB 4OV1A 1JLGA 1OYEA 4OHXA 3H4DA 1NDKA 3PYGA 3VGUA 4NA2A 4R0EA 2LEPA 1HL6A 1HWKA 2EC2A 3O5TB 4MKYA 1YI2S 4I7FA 3V2UC 4LF4F 4OJHA 4WFXA 1QSSA 1QVFR 1AFJA 5ETMA 5KFXA 3BSNA 2UVWA 3MHYA 1Q8IA 2XLKA 4LQ3A 1RB0A 3C14B 4M95A 2PMZD 3LGHA 1HBMA 3ITHA 2UXBF 5DJBA 5C25A 2VV5A 4JI6J 2XY5A 2DRBA 2R7XA 3ISNC 3QGPA 1SBRA 3A13A 4NLYA 2MGZA 2LU2A 2DH9A 3BGRB 3POTB 2W9CB 5T7LB 3V4IA 4R5PB 4LVNP 2KFZA 4LVOP 1X9WA 2F3JA 3GSIA 4A8WA 4FYYB 4AL5A 3C15A 1CJKB 3J80Y 4Y3CA 4ZVUB 1VHFA 3C46A 2F1FA 2IA0A 3NG8A 3DRRB 1WWHA 3G71S 1J5EF 4UUXA 2PC6A 2GVZA 4MJKA 3KG1A 4X66J 3D0IE 4C0OC 2ROPA 4QU6A 2XC9A 3LPYA 3U27A 3BF4A 1VRUB 4JI5J 1YSJA 2XQCA 2AYBA 5IQ6A 4X4OA 1E6YB 4PRFA 1X0PA 2XYHB 1K47A 1SKRA 4U8VA 3PO5A 4ZDNA 2XBPA 4LFCF 3HHNB 2PEHA 1C0UA 4TNOA 2V69A 2RMLA 3ZZTA 3PM9A 2I38A 2BJEA 2QFJA 1VQLS 4EK2A 3RBDA 2RQMA 1YX2A 3W8GA 8RUCA 2DCLA 2ZH2A 3HHLC 1TKZA 3N4WA 1FRLA 3SSQA 1VQPS 2HK2A 3ADAC 2K06A 4U9RA 1JJHA 1HNVA 1F1BB 4ED2A 3BH7B 3O44A 2DGQA 1NRKA 4TXSA 4FPRA 2WBRA 3PFEA 2QGFB 4ERDA 2HNDB 5DO2A 4ALZA 4ZOSA 2A6MA 1TUVA 2VFVA 2YH0A 3MTKA 1HHTP 1VCTA 2AYEA 5A8RB 1XJWB 1HPZA 4OZNA 1NKCA 2FY8A 2KRBA 3MPDA 4IRCA 2PA8D 3JYTB 1J2VA 3NGUA 4J9UE 5D3GA 1IN0A 1V5VA 2ZKUA 3CCJS 2ZZMA 3P5BP 4IOBA 4H4OB 5KFMA 1ULRA 5E41A 5GAHI 3MFHA 1FF2A 2XI3A 4USJC 3CMAS 5RUBA 2C2KB 2AGOA 4M5MA 1PAEX 3THPA 3HM9A 2IAJA 3KK2A 4MFBA 3MD3A 5B0EA 3F73A 3M8QB 3S1TA 3H8YA 2H5JB 4EO8A 1HNIA 3LALA 3AXKA 1VK3A 2M9KA 2O67A 2ERRA 2YKAA 2XM3A 3W5ZA 1AYEA 4DUZF 3UR0A 1MLAA 3SSRA 3LH2S 3CDBA 3CO9A 5CD4A 3VGVA 4DN9A 1I3OB 3TEGA 1TK5A 2J8SA 1Y00A 3P8BB 1TUWA 4FVCA 2ZD1A 3AJ1A 2NR0A 3RB6A 3K2YA 3DFEA 1HNZF 4FKYA 2B9EA 1HYSA 2CJKA 3QIPB 5FLXU 3NP5A 3BO4A 2EK1A 2VA2A 4DWIA 1F2HA 1JJ2R 3OLAA 5BXIA 3TVYA 1WNEA 5HVFA 3GFHA 1FDDA 3HHLA 1HBUB 4HDGA 2P2CB 1PJ5A 4NYPA 2DH8A 1HQ2A 4NLVA 4IO9Q 5C42B 4FZVA 1RWUA 4Q44A 2E9RX 1EQ0A 3KLFB 2RRAA 3QYYA 4U7UD 2L41A 2BRLA 2M4MA 2ZJPQ 2CVEA 5KFNA 2CPXA 2RDJA 3M8PA 2DRDA 2ATLA 5L39A 1HLWA 2QL9B 2RVJA 3EXYA 5K14B 2KZZA 2NXUA 4P7VA 2IVMA 5D78A 3GFZA 2H4WB 4J90A 4OX8A 4OZ2A 4PWUA 2Y8YA 3UCZP 3OJUA 3TAQA 5LJ5Y 4ENOA 1VQMS 4OZ1A 1R8PA 5KG1A 1TZ0A 5HP1B 4TKTA 4NZ6A 3FBFA 2AJ4A 1M5OC 3D67A 5IWAJ 2O01C 2GIFA 1HI0P 1UJ5A 2QSWA 2DGOA 4NLDA 2MSTA 2V4QA 3CCQS 2J7KA 2HZAA 2KH9A 1HWIA 3FRYA 5L38A 3CO0P 1N8RT 4KHPJ 3GLJA 1TU0B 3TVZA 3VF0B 3CCMS 3S6EA 4A8QA 2D9PA 2J9EA 3LP2A 4YFUA 1R43A 5EUHA 3TI0A 4FF1A 4BC7A 3VVUA 2BJDA 4YQWA 2L48A 2DO4A 3HFVA 3CDUA 1TL3A 2M5YA 1OQ3A 2FLLA 4P2MA 3OUYA 1YZ6A 3TZYA 1X8DA 2FTRA 3KNGA 5KG5A 1UEVA 1BWEA 4XAKA 2BEFA 2UUTA 3EXCX 3K8WA 2CPYA 4M5GA 1HBNA 1GAOA 2FYXA 5J1EA 2JZ5A 1HKAA 2H4YB 1EZZB 4U7CA 1VC5A 2YWHA 5AT1B 3PX4A 2ABYA 1RISA 4QWDA 4O0IA 2LVWA 2ZHOA 5DGAA 3BEGB 2E66A 5ETVA 1AZSB 2C2DA 2VOOA 4CH1A 3I5BA 1RHMB 3GV5B 3T41A 1DQ8A 2IHR1 2O66A 3EVMA 1RU2A 2XHWA 3VV2B 2LU1A 1AT1B 2IYIA 2YKPA 1GMUA 4IR1A 2Y9HA 2MJUA 2C2ZB 3KMSA 2KVQE 1KR4A 4ID5A 2HHVA 2EXUA 2IMOA 2BQ3A 3R5BA 1TELA 2OD4A 1S1VB 2D3UA 4X4PA 1VQ5S 4F0HA 4MYUA 3OHAA 1L3TA 4E0DA 3Q22A 3UE2A 4YB1P 5E33A 2QZ8A 3FGVA 3HHLD 3E8OA 1QAIA 3BREA 2AQ4A 4KGZB 2ZHAA 2M7SA 4CTAB 1EETB 5ETQA 3BSOA 2YNGB 1B4SA 4DZDA 3OL7A 2NYIA 3LP1B 1FDBA 3PEHA 4ECXA 4PQUB 3C16B 2ZE2A 2FHJA 2Q1LA 4RJVA 4G6VB 3FZBA 2UUBJ 4Q2MA 1S5ZA 3I6PA 1RBAA 2VBZA 2JH3A 2BE7D 4DV2F 4NX9A 2V2QA 3M8YA 4O3OA 1PKUA 4JI2J 1YRTA 2XLJA 3K89A 2EFGA 1NM2A 1HW9A 1JLFA 2QSFA 4DFPA 3FMBA 5E7OB 2V8HA 4PYDA 4DG1B 3W9JA 3WC2A 4CZCA 2KG1A 3HO1A 1U1MA 4ZVGA 4L3NA 4N8OA 2B4VA 3GIJA 4KH0B 1KNZA 5A6PA 3MEEA 5I3UA 1JNRB 2NZCA 3P5TL 4QYRA 2LQJA 2Z4PA 2YKOA 3R7BB 1JK9B 1UW9A 1VQSA 3CJKB 4E8UA 2LXFA 3M32B 4RBVA 1M0SA 4RW9B 1GMVA 4FBTA 1NDCA 3DXBA 2DITA 4CLSA 3GMGA 2MZQA 3R2DJ 5E3QA 4F8RA 4G1QB 2FC9A 1FJCA 3BQ2A 4CLPA 3PR5B 1IBKF 5DM7Q 1RYRA 5HBMA 4U67Q 1R7IA 3CD5A 5D6GA 4UZCA 5DZ7A 3TUPA 3MM6B 4Z7YA 5ETSA 4LR7A 2RHQB 4WCEQ 4LREA 1ZTTA 4M94A 5CCMA 3MM9A 3KLIB 1XTZA 5KFGA 1QD1A 3EX7B 1VQ4S 2C3MA 5KTQA 2KB2A 2XSJB 2XG8A 3BDEA 3CIMA 1XMQF 4JYAF 4DL7A 4K50A 2HFNA 1JLBA 3J80U 1FNXH 5IQQA 4EYIB 2EPIA 1HMVA 2ZBQA 1IVZA 1SUQB 1YJ9S 4UQGA 2P9EA 4K4TA 3MEGB 4I2QA 2IIHA 4J9SA 5IC6B 2V2KA 3M9NB 1RA6A 1H0HB 1UVIA 2W4CA 3R9LA 4LMZA 1UVNA 3MPYA 5J2NA 1FT8A 3IM9A 5KFCA 2OUGA 3KWMA 4KYZA 1R0AA 4K8RA 5G4DA 2E44A 1LW0A 4NZ7A 3EVWA 5HROA 4KO0A 2OFHX 2HWHA 1NMEB 5B0DA 1VBZA 3NGDA 4M5NA 2RD5C 4QIGA 3R7NB 4TU7A 3D1HA 1RAIB 4L72B 2NZ4A 2DNPA 3KJFB 4W4MA 2V50A 2DEIA 3BKFA 2GQCA 2VPWB 3IWLA 2D69A 3MUMP 2AJFE 1DQ9A 2R7RA 2PDAA 1FE0A 1V3SA 1RI7A 3DDKA 4F25A 1R6YA 2V9WA 3QWPA 2WBMA 1WJ9A 2M0GB 2RQCA 1FVSA 1U49A 3OXGA 2D3O1 4OFZA 3TNVA 5KFQA 2V2ZA 1HHQA 2E7VA 1JXLA 3T1HF 3BSCA 4IR9A 1KN6A 2AJ1A 2W25A 5G0RB 2V0NA 4C8ZA 4HACB 5K8PA 2FHJD 3T5JA 1O0PA 3RW7A 2VFUA 1RHKB 1S6PA 3C14A 4AXJA 1TV6B 5IWAF 4OI4A 5C24B 2MLZA 4RUHA 1UA0A 4V19J 3KLHB 4USTA 2RS2A 1KFSA 3FVYA 3RB3A 2FGOA 3AOAA 1UWBB 2LDYA 1C1BB 2VQEJ 2VF3A 5E3AA 2K7JA 1NKBA 3CJ8A 1UA1A 3QPIA 1CJKA 2Y1JA 4JB8B 1RAOA 3T19A 1FRXA 2Z2YB 2HHXA 5U47A 2MKSA 2ASLA 4LF5F 3DDNA 1FRMA 2BV3A 4JV1A 1Q78A 3DRRA 3UW1A 2N7YA 2HWTA 4KH1B 1SC1B 2B8PA 1KONA 1ZZFA 1NB7A 2X1FA 1DARA 3MXHP 2DPJA 3WBZA 1VRUA 4DF4A 2FVSA 4KQZA 4MAKA 4DR3F 1SB6A 2B8QA 1E6YA 2R7WA 4PPDA 2LP4A 2PD1A 1B3TA 3SBMA 4J9PA 4G1IA 2VPYB 3DGPB 4WP9A 2XMUA 2HS4A 2YWFA 2NQPA 4LRBA 1H3DA 4Q43A 3C6TB 4K5RA 2R8GA 1S76D 5K8NA 3ENVA 3MPWA 1TKXA 1VQYA 3QT5A 2ZKTA 2CJ9A 3ELHA 2RRBA 2ZM6F 2PFFB 1Q8LA 2E9TA 3LW5C 3KK1B 1LW2B 2CQ1A 3DYAA 2B0GA 1U7LA 2JNJA 1DZ5A 1ZAVA 4J9MA 5B0AA 5J1NA 2ZC3A 2XGQA 3MMAB 2XMKA 5LMUF 4TLRA 2HNDA 2BJ1A 2I1RA 2J9DE 1V5IB 3HSDA 1X4EA 1VRQC 4FXWA 2BQRA 4DR1J 4NEYA 5A8RA 1IM4A 1W25A 3CJQA 2K7KA 3B54A 4MIWA 3EICA 2GX8A 1JJCB 4UW2A 2ZJQQ 5EWGA 2P8IA 4O3SA 4H4OA 1EARA 3ILIA 4PXCA 3DOLA 4WKYA 1QAXA 3NBPB 3FRZA 2VKZG 4FBUA 3C8YA 3PRBA 2WW8A 2MB0B 4ZCLA 3RBZA 3MAAB 4ZN3A 1RP5A 1YTYA 1ZZNA 2AT1B 3RRKA 5DDQC 4JI0F 2OPPB 1ZOTA 4DL3A 3TX8A 3D0HE 1KSPA 4ITSA 2M88A 2XB2D 3M8QA 2KVIA 5J2MB 3T1YJ 3H42A 1LWCB 2HFOA 3WC0A 1SJFA 2AP6A 3OHBA 4HTJA 3G6VA 2ZDOA 1QTNB 5CZXA 5JMNA 1UVMA 3IM8A 2XTJP 3J7A1 2G1HA 2IBOA 1R6VA 3PG9A 4K4ZA 3FC9A 4N5SA 2RH3A 3M2UA 4TQRA 3M4XA 1F3VA 1ZH5A 3MUVP 1HNWJ 3H5SA 2OGUA 3V6HA 2LEAA 2OPQB 2Z58B 2YX4A 5D0HA 1U6ZA 2GIRA 3QIPA 2I9SA 3PYFA 3CC2S 3FNNA 1AXQA 1JKHB 3OVAA 2N3LA 1PG5B 2D3ZA 3KJNB 3UR3C 4LBHA 3M2VB 1OJ4A 1KQGB 3MR2A 1L3UA 1HI8A 4YS2A 1IWGA 4DR2F 1FJGF 4NCAA 5C42A 3R27A 2VICA 4ZJQA 5ETLA 1T94A 1GH8A 4IFVA 4IG0A 3G8TA 2JC0A 3KLFA 2AEJA 2RUSA 2BM0A 2DIUA 1YQHA 3SCLE 3L09A 3DM2B 5HMYA
chains in the Genus database with same CATH topology
1IKWA 1R8HA 2V9KA 1Q16B 4HHJA 4QIVA 2ZH1A 4DF8A 2DNLA 4FP9A 3OFFA 1S0MA 1YIJS 2PO4A 4Y6IA 2IRYA 3TANA 4DSJA 4WFZA 2Y0SD 5GVQA 1FKAF 1IKVA 2IRUA 2XMJA 5K14A 3JTNA 3M6VA 2ZOGA 3OVBA 4DOZA 3CE8A 3E51A 4HT7A 3SZ2A 2VB6A 2QA2A 1XMOF 1KLNA 1NHUA 4QIFA 4ED1A 1VQ8S 4PXEA 3MEKA 2HHTA 4ED3A 3DU5A 1GX6A 4PXDA 1E6VA 3T3FA 3SCIE 1I1GA 2GHPA 1U26A 1WF2A 2R2TA 2MY8A 4C3KA 5HMZA 3TQ1A 2UVVA 4NLRA 2ZE2B 1URRA 4P2SA 5F8NA 1TAUA 2B9XA 5GAGI 3CD6S 5EWFA 3AHPA 4DSKA 4HI1A 3O2IA 1R8BA 1C0UB 4ICLA 2QRRA 5G0RA 3W2WA 1CC7A 1LV5A 1L3SA 3FEYB 5HP1A 1ZAXA 3H20A 4EFAC 3BDPA 1TL1B 3MEDB 2I8EA 2PGCA 2VFRA 4YB6A 1VGYA 3K57A 3AAWB 2NLWA 4DS4A 3ONQA 1UMJA 2BABA 2IFXA 3NAHA 4BS2A 3FDSA 3D2WA 1U25A 2DGXA 4LFBF 1JLAB 2R7QA 4IRDA 1X5SA 1TK0A 3GFXA 3QZ7A 2JJ4D 2GJ2A 1T03A 2XNQA 4PXBA 2VOPA 2IC3A 3CC4S 1QAJA 5DDOC 2KT3A 4DV0F 1JLFB 4PWDB 2EC0A 4F50A 4EUVA 1TV6A 3JTOA 1Z2LA 2EWHA 4QWAA 1IUJA 2RF2A 4ZP7A 5C24A 3T5LA 4RKUC 5EHHA 3VZHA 3CT9A 4B9LA 1LWFB 3F56A 3OVSA 2QO3A 3UI3A 2HHHF 2R4FA 2QA1A 5J2PB 2HLUA 4OI1A 1ZYQA 1H2VZ 2HAIA 1UJ4A 3M05A 3KLHA 4C8YA 4DSEA 4Y2KA 1RT6B 4O3NA 2FDNA 1X7VA 3M30A 1D0EA 3PJXA 1S77D 1FO1A 1R27B 1UWBA 2PE8A 4JOUA 1C1BA 2CQ2A 3GV7B 1LK5A 1TR0A 4LIWA 4B02A 4IDKA 2DT9A 2E5LF 1N5YB 2G13A 2APOA 4ES2A 2DVIA 1TFWA 1DLOA 1FE4A 2JFKA 4PG6A 5I3UB 4QIEA 1QSYA 4M5DA 1X4AA 4OHZA 3SV3A 1WELA 2BANA 1TQLA 2MJNA 4TN2A 3H4BA 4DL2A 1KLMA 4V19X 2CQHA 2AGQA 5K9FA 1N6QB 1BY9A 4QW8A 3HZGA 5LXYA 4RU9A 3PJWA 2W24A 3G4SS 2CPEA 1SL2A 2JVOA 3EGNA 4FN5A 3VTIA 4ZVEA 5D3GB 5IT0A 4RBTA 3O8WA 4FVMA 4PUOA 2CVIA 3S7RA 3MR3A 1BD6A 1NK0A 3ZZPA 4BCAA 3DLKB 2HNYA 4WFBQ 1U1PA 1KFDA 2FB0A 2SXLA 3KTQA 2VFSA 1T95A 1S48A 3QO9B 1SJ4P 2PT0A 4TU9A 2YNFA 1WI8A 1IKYB 5FDLB 1KTQA 3CD0A 3KG0A 3OXLA 4KV8A 5AXNA 1LFWA 2B51A 2RU9A 1H98A 4DLEA 4EBDA 3CC7S 3SFUA 3NNAA 1LOUA 4NRTA 2F8MA 1D8ZA 4YDDB 2R8HA 2UVRA 1YJWS