4IDKB

Hiv-1 reverse transcriptase with bound fragment at the 428 site
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 114
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4idkB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB03
3EPIA 3BQ2A 2JEGA 4Q0BB 1IM4A 3OLAA 3PJXA 2ZE2B 3IG1A 3DOLB 3BR9A 2FJXA 4ZP7A 4QWAA 3Q8QB 3IRXB 1TV6A 4J9QA 3C6TA 5DG8A 3KHHA 5KFKA 5DQGA 4KKOA 1NHUA 4O44B 1JLGB 4MK8A 1TKTB 1VRUB 1JLAB 2FLPA 5HROB 3QLHB 4ECUA 2OPQA 4JV2A 4ZP9A 2YNFB 5L9XA 5KG2A 4RNOA 3OL8A 1RYSA 3H4DA 1FKPA 2VG5B 3DM2B 1S10A 1BQNA 4XPCA 2HMIB 1T94A 5F8HA 5DG7A 1S1TB 4EBCA 3CJ0A 3I0RA 3DOKB 2IM1A 1IKVA 2B5JA 3IS9A 4MK7A 4EBEA 2V9WA 4Q0BA 3T5HA 1RTIB 2AU0A 1RT6B 2ZE2A 1TVRB 4H54A 4ECYA 3DOLA 3QYYA 2BRLA 4URGA 3KMQA 4TLRA 3IRXA 1XR7A 3TAMB 3T1AA 2UVUA 2E9RX 2VA2A 5KFSA 3GIIA 3VQSA 5I42B 5L1JA 4O44A 4EO6A 4ICLB 2AX0A 1IKYB 4Y2CA 2HWIA 1JLAA 1HQUB 2IAJB 3QLHA 2R2SA 5HROA 2W9CB 2IBKA 4NLGA 2YNFA 3KLGB 1GX6A 4QW9A 3I5CA 1LWFB 1TQLA 2VG7B 4RW7B 4F4XA 4NLVA 4ECRA 1D0EA 2VG5A 4TQRA 3DRPB 2O5DA 1ZTTA 1JLFB 1HARA 2HNZB 1S9GA 4QWBA 2HMIA 1N48A 4NCGB 1K1QA 3V81B 4RNHA 4O3NA 1S1TA 4IG0B 3DOKA 2XGQA 3FRZA 1WNEA 1S6PA 3C6UB 5F8GA 3V6JA 1MU2A 3BSAA 3G6XA 3BSNA 2YNGB 3E01B 1D1UA 2UVVA 1RTIA 3QGGA 1RT6A 1N5YB 4IFYA 2FVPA 3CJ5A 3DYAB 4ID5B 4IR9A 5KFRA 3TAMA 4RW8B 3MFIA 3SI8A 3KHGA 1S1XB 4F4ZA 1TL1B 2WB4A 5F8LA 2C2RA 5I42A 3MR3A 3DRSA 4ICLA 1IKYA 4FS1A 5F8NA 3LAKA 3H59A 1HQUA 2IAJA 1QE1B 5KFOA 2W9BB 4KAIA 2W9CA 3KHLA 3KLGA 4ZVHA 5KT7A 3H4BA 1LWFA 2HNYA 2VG7A 2WCXA 4RW7A 4NLRA 4ZP8A 5KFIA 3HKWA 4K4WA 3DRPA 1Z4UA 1JLFA 2HNZA 1N6QB 1SH3A 2UUWA 1XR5A 2WRMA 4NCGA 5J2NB 4Y34A 4IG0A 4LSLB 4RU9A 3C6UA 3PW5A 4O4GB 2OPRB 2V0NA 4HKQA 2R8KA 5DGAA 3CVKA 2YNGA 3E01A 3BQ0A 4K4VA 3LANA 3GIKA 3RBEA 1N5YA 4RNFA 1S6QB 4O3PA 5KFBA 4K50A 3DYAA 4ID5A 5KFCA 3G6VA 2ILZA 3V4IB 1UWBB 4EEYA 1QUVA 2XI3A 1S1XA 1TP7A 1TL1A 2ZD1B 4ZP6A 1ZETA 5CYQB 2HNDB 2FLLA 1RT4A 5DGBA 3QIDA 5L1KA 2B6AB 3CDWA 4LSNB 4NLOA 2IMWP 3FFIB 1R0AB 1RAJA 4G1QB 3OLBA 4KBIA 4TN2A 3T5JA 1N6QA 3NMAA 3Q8PB 4G3IA 1HQEB 3IN5A 3KLEB 1SH2A 4J9LA 4LSLA 2C2EA 5DQIA 3BGRB 3GIMA 4Y2AA 2OPRA 4DL2A 4O3SA 4TYBA 3GV5B 2RDJA 3H5XA 3CDUA 3BQ1A 1RTJB 4WXOA 3QZ7A 1JLCB 1S97A 3QGHA 5D3GB 2R2TA 1JX4A 1S6QA 2AX1A 5KT2A 3MR5A 2R8IA 2YNHB 4M95A 2I5JB 4WZMA 1TKXB 3V4IA 5DLGA 2JC1A 3FQKA 3PHEA 3TVKA 3RBDA 4MKAA 2YNIA 2XCPA 3BSOA 2BE2A 2DPIA 2ZD1A 4O3RA 1K1SA 5CYQA 2D7SA 4J9KA 3SFUA 3NBPB 3ITHA 3DLKB 2D3UA 3UDLA 2B6AA 2IJFA 4O4RA 4ZPDA 3QIPB 4JV0A 4QPXA 2XC9A 4LSNA 4K4YA 3FFIA 4IG3B 1R0AA 4MFBB 5KG6A 4G1QA 2ZKUA 4ECZA 4PWDB 2DPJA 1C1CB 3MEEA 3LALA 4JUZA 1HQEA 3MECB 4F4YA 4B3OB 2E9ZA 5J2QB 4KO0B 1J5OB 4YR2A 3BGRA 5EWGA 1S4FA 2IJNA 1IKXB 3V6DB 3PW0A 1KLMB 4I2QB 4URQU 1HMVA 4WFXA 4NLSA 4K4XA 1JLQB 1RTJA 2VA3A 1JLCA 5KFJA 5D3GA 2CJQA 4RNNA 4PQUB 4IFVB 2YNHA 4LQ9A 1KHVA 2JEFA 5KT5A 4YP3A 3H5YA 1RT3B 2FVRA 2ASLA 3QO9B 4I7FB 3RAQA 1C1BB 3G86A 1SUQB 5J2PB 4R8UB 3OL7A 2RDIA 4ZMMA 3NBPA 3RB6A 3DLKA 2OPSB 3NGDA 1OS5A 3PVXA 2R8JA 1T3NA 4NRTA 3QIPA 4MKBA 2RF2B 1QAJA 2W8LA 5L1IA 4IG3A 4MFBA 4ZVEA 1JLGA 4KHMA 2QE5A 2ALZA 4KSEB 4PWDA 1TKTA 5T14A 1C1CA 1VRUA 3I5BA 2E9TA 3T5KA 3MECA 4ZHRB 3LP0B 2XCAA 4B3OA 1CSJA 3CJ2A 3DMJB 5J2QA 2WHOA 5KT3A 4KO0A 1J5OA 3KMSA 2R8GA 4EYHB 3DM2A 1HYSB 3MTKA 2IC3B 3V6DA 3Q8RB 1N56A 1KLMA 3LAMA 1VRTB 1RTHB 3OL6A 4WFZA 1JLQA 1JLBB 3JSMB 3D28A 3NAIA 4NLPA 4RUAA 5KG3A 2W7OA 4YR0A 3KOAA 4PQUA 4IFVA 2IM0A 1S0NA 3NAHA 4F50A 3BSCA 3N6NA 2R8HA 3N6MA 1RT3A 2R2UA 3RB0A 5KFLA 3QO9A 4IRKA 1TVRA 3ISND 4I7FA 2XI2A 1C1BA 5J2PA 5F8MA 5KFQA 4R8UA 3NKYA 2OPSA 4K4SA 1RT7B 3TQ1A 2GIQA 5HBMB 4NLXA 2RF2A 2W8KA 3E51A 4Q43A 5J1EB 5J2MB 4NYZA 4ED2A 4ED8A 4ECQA 1NNDA 2BANB 2EC0A 1RTDB 1YVFA 2AQ4A 1HNVB 4IH6A 5F9LA 3V6HA 3LP0A 2WONB 5KFVA 3MFHA 3DMJA 4MH8A 5KFTA 1S9EB 4Q45A 1DTTB 1JKHB 4ZPBA 3GV7B 1LWCB 3M9MB 3Q8SB 1HYSA 3PR4A 4Q8FA 4ECSA 3M8PB 1JXLA 1VRTA 1RTHA 4JV1A 3V81A 2ILYA 1JLEB 1JLBA 3JSMA 2D3ZA 4TQSA 1T03B 3NL0A 1T05B 4DL5A 2VG6B 3OSNA 1ZTWA 4MIAA 2W9AA 3ICLA 1C0UB 2JC0A 2ATLA 4IRDA 2BQRA 3T19A 1RT7A 4IR1A 4RW8A 5HBMA 1I6JA 4DEZA 2BRKA 4EYIB 2QV6A 4WFYA 1RT5B 3DRRB 5J1EA 5J2MA 1KHWA 3CDEA 1FKOB 1LWEB 4RW9B 5EDWA 1S9FA 2BANA 2R2RA 3DDKA 2YKNB 3FDSA 3KJVB 1HNVA 1QE1A 3I0SB 2W9BA 4KV8B 4J9OA 2C2DA 1MMLA 2WONA 1S48A 2WTFA 4K4ZA 1DTTA 1EP4B 1JKHA 3HVAA 4PUOB 4ED1A 3M9NB 4M94A 5C25B 3N6LA 3M8PA 1DLOB 5HP1B 5J2NA 1IKWB 4H4MB 5EUHA 4F4WA 1S1WB 4MIBA 4ED0A 5C24B 4YMEA 4O4GA 5KFNA 1T03A 3H5UA 2JEIA 2FVSA 4ZPCA 4RW4B 4KE5A 1T05A 4NZ0A 4DL4A 2VG6A 3GQCA 5I3UB 4IH5A 4IOBA 2B43A 3I5AA 1XR6A 2V4RA 5L1LA 2V4QA 2UVWA 4FBUA 1U09A 2RKIB 3KLFB 1UWBA 3C6TB 2AGQA 3MEDB 4K4UA 4FBTA 3QZ8A 1RT5A 3DRRA 3PJWA 5KFUA 4WYWA 4QWEA 1LWEA 4RW9A 2HNDA 5EWFA 3GV8B 2WOMB 4NLDA 4URSA 3RAXA 1HNIB 2YKNA 3LP2B 3HVTB 3I0SA 3KJVA 2C22A 2IM2A 2W7PA 2AGOA 2ASJA 3DLGB 4IH7A 1EP4A 4PUOA 1FK9B 4NLQA 4I2PB 5K14B 1C0TB 3PZPA 5C25A 3IGNA 5KFGA 4WZQA 3CJ3A 4R0EA 5HP1A 5EWEA 1IKWA 4H4MA 1SH0A 3I0RB 1S1WA 3KLEA 4NRUA 1RT2B 4WYLA 2IA6A 5C24A 4XO0A 3IS9B 4DL7A 4U7CA 2BQ3A 4RW4A 4ED7A 3MR6A 3CIZA 4J9RA 5I3UA 3RB3A 4OL8A 1RDRA 3DLEB 3EZUA 4YR3A 1LW0B 2I5JA 1TKZB 3IGVA 4Y3CA 3OHBA 1TKXA 1SV5B 3KLIB 2RKIA 3G6YA 3KLFA 4FS2A 5DLFA 3MEDA 2I1RA 4YQWA 3HVWA 3GIJA 4ECWA 4ED3A 2ASDA 1REVB 2OPPB 2UVRA 2WOMA 4R5PB 3GILA 4J9NA 1HNIA 3LP2A 4IRCA 3HVTA 4QWDA 4IDKB 3LP1B 4NLTA 3DLGA 5C5JA 1FK9A 3MF5A 4I2PA 5K14A 1C0TA 1HPZB 3GYNA 1S9GB 4WXWA 5KFFA 5C42B 2CKWA 4X2BA 5F9NA 4WE1B 2AGPA 1RT2A 1S1UB 1S6PB 1N4LA 1MU2B 5JXSA 1IKXA 5KG0A 1DTQB 2FJWA 1NHVA 4I2QA 4DL6A 4NLWA 3PW7A 4IFYB 3JYTB 3M8QB 3KK3B 4TYAA 1S0OA 5KFMA 5KFEA 4KFBB 3DLEA 2C28A 1LW0A 2YKMB 1TKZA 4QW8A 3ISNC 3KLIA 1SV5A 1LW2B 3KK1B 4IKAA 3KK2B 4MK9A 3DRSB 1SUQA 4RW6B 5CYMB 4NLYA 3DI6B 2FJVA 1REVA 2OPPA 4ZPAA 4R5PA 5KFHA 2HWHA 3D5MA 4ECXA 4IDKA 5KFPA 3LP1A 2HNYB 3BJYA 3H2LA 4KHRA 4TY9A 1HPZA 4LQ3A 1RT1B 3UPFA 1S49A 5C42A 5FDLB 4WE1A 4ZHRA 5HLFB 5KT6A 2UUTA 4O3QA 3UQSA 4HYKA 1W25A 1S1UA 4IQXA 4EBDA 2BR0A 2IC3A 3FSIA 1DTQA 4DG1B 1C2PA 1TL3B 3JYTA 3M8QA 3KK3A 4RUCA 4QWCA 3PW2A 4KFBA 4RNMA 2YKMA 5KFWA 1LW2A 3SFGA 3KK1A 1JIHA 4GC7A 5KFZA 4ECTA 1S1VB 3HHKA 3KK2A 4ZVFA 2JLEA 5KFAA 3OHAA 4RW6A 5KG5A 1RT4B 5CYMA 3DI6A 2AWZA 4H4OB 3PR5B 2XGPA 3KHRA 3RB4A 3UR0A 4K4TA 4J9MA 3PW4A 2J6UA 5F8IA 2J6TA 5KFYA 4KB7A 2GIRA 5KT4A 4XPEA 1RT1A 3MEGB 1RTDA 3V6KA 1RA6A 5FDLA 5HLFA 4TY8B 3M9OB 1S0MA 3KNAA 1S9EA 3KLHB 1LWCA 1EETB 3H5SA 5KG1A 3EPGA 2OH2A 4DG1A 1GX5A 4J9SA 2FVCA 5KG4A 1TL3A 1RA7A 2FVQA 1JLEA 1BQMB 3BREA 4O3OA 2XWYA 4U6PA 5KFXA 2D41A 3H40A 3H98A 4Q8EA 1RYRA 2YNIB 5DQHA 2BE2B 5JUMA 1S1VA 3IG1B 4NLUA 1C0UA 3FQLA 3T5LA 2J6SA 3ITHB 4TXSA 1TV6B 4H4OA 5KFDA 4DL3A 2IM3A 2BQUA 3MR2A 5F8JA 2HAIA 2WK4A 5DG9A 1QAIA 3CO9A 4EO8A 4KKOB 2F8EX 2JEJA 1FKOA 3MEEB 4GC6A 2OPQB 3MEGA 4KV8A 3CWJA 4TY8A 3KLVA 2FLNA 3QGIA 3KLHA 1FKPB 3CJ4A 4Q44A 1EETA 1BQNB 4ED6A 3OL9A 4ECVA 1HMVB 4RZRA 1DLOA 3OSPA 4J9PA 2GC8A 1BQMA 1IKVB 5KG7A 4ZVGA 2B5JB
chains in the Genus database with same CATH superfamily
3HSDA 4NL5A 4DPXA 4RPFA 3GR1A 4TU9A 1FI4A 2KO1A 2CJAA 2IDLA 3ISZA 4O44B 3V2UC 1RADB 1M1HA 1OJ4A 2LECA 1JXVA 1QD1A 4M5IA 5GMDA 3K5LA 4MK7A 7FDRA 1OO0B 2W4DA 3D3CJ 2ZE2A 4ZVPB 2AYGA 4B9UA 4QYZK 2G0JA 1VQ6S 2EG1A 4AFFA 4ICLB 2IFXA 4KGZB 1JLAA 1I3OB 1EHWA 3C46A 2HFVA 1D0EA 2AZ3A 1F9EB 1CS4B 2HMIA 3MAHA 3C6UB 2ZZMA 4DV3J 4BCAA 3BSNA 4QIWD 2BJ8A 3CJ5A 4Y6IA 3MM5A 3PKYA 3MFIA 4CLLA 2UXCJ 1EKRA 2C3MA 2GHPA 4U7UK 3S7RA 3HKWA 1XR5A 4X65J 2V0NA 1S12A 1AUSL 4MIWA 3MM8B 1ULRA 5D4LA 4HH1A 2M2BA 1BD6A 2LP4A 1UWBB 1AYEA 2F9DA 2OJ3A 1VIOA 2HNDB 5CHCB 1YBTA 1MLAA 1TFYA 2IMWP 2MKSA 2KFZA 4F2SA 1RU2A 4LREA 1VRQC 4LSLA 3AY0A 2YPYA 4DL2A 2RRAA 1QDUB 5D4NA 4WXOA 2CPJA 5D3GB 2PT0A 1TKXB 2JC1A 1SXLA 2DEJA 3T6JA 3TUIC 1YTYA 3BBBA 2D3UA 4F04B 2MQLA 3W2WB 1N8RT 1WDTA 3MEEA 1X4DA 2QSWA 4YEAA 4ZJLA 4USUA 1KLMB 1EJ7L 3MUTP 1UL3A 5B08A 2FVRA 4OQJA 3HO1A 1LNQA 3HSZA 3VWSA 2A6MA 1T3NA 1LOUA 1S79A 3UN2A 4F3MA 1QAJA 5L1IA 1VRUA 2ZH2A 5ETKA 2XCAA 1K0VA 3DM2A 3VF0B 2V8GA 4NYOA 1OMSA 4FP9A 3HDSA 3DLLQ 2HBZB 4QR1A 1QJHA 3BH7B 3DC2A 1UWAA 1EQ0A 2W8KA 3JQKA 4S0MA 4ED2A 4RLEA 3TUZC 4MH8A 4WIIA 5L39A 3HULA 4BHQA 2RUGA 3PEHA 4DV6J 2KH9A 1CJTB 2DGVA 2NZCA 2AHOB 4PWWA 4P73A 1Y5NB 4YY3F 3RR8A 3IWLA 3FDSA 1LWXA 2A18A 3VGVA 1Y0HA 3GP9A 2LVWA 1DLOB 2CQ4A 4DV0J 1RWKB 4F7VA 9RUBA 4K5SA 3T41A 3CJKB 2XHCA 4NXNJ 1FVSA 5CD4A 3DRRA 2YKNA 3NEKA 5IOLA 2AMCB 1B7YB 1NCLA 4B9MA 2F40A 2OAUA 3PFEA 4DPOA 3DLBA 4YR3A 3KG0A 3D0IE 2CQ0A 2CVIA 2PMHA 4IO9Q 3K2YA 4ZJQA 2CNKB 4MMOA 2JNJA 5LJ5Y 5C5JA 1Q5VA 3RBZA 5AT1B 2V63A 5C42B 1SC3B 4LRAA 1MU2B 2CZ4A 1DTQB 4I2QA 3EDRB 2ABYA 3M8QB 2OFGX 2OD6A 1M5OC 3CDBA 2K1RA 2VQEJ 2VL1A 1AFIA 1UJ5A 1C4CA 3BDPA 3DHWC 4ECXA 1MNEA 4M1KA 1KTVA 4DV7J 4PG5A 3UPFA 3ZZPA 3RU0A 4X62F 2R7UA 4NZ6A 1S1UA 1S5ZA 5FLXU 1C2PA 4W4MA 1GT8A 4OI6A 2IMOA 2KVQE 4HDGA 1CJVB 3PR5B 3K8VA 1IBMF 4RJVA 1SJ4P 4WKRA 4KB7A 2V5HG 4B9TA 3ENVA 1SCJB 4MAKA 5ETMA 2QGFB 1Q82T 2QC3A 3BREA 3WQPA 3DU5A 3H40A 4AXJA 2XLJA 3R6GB 3QAEA 1GH8A 3B8HA 1WF1A 1IUJA 2DD8S 4DWIA 5FLXY 3MOZA 1VBYA 4DUZJ 3GIRA 4HT5A 1TL5A 1W2IA 1PYOB 3LPYA 2DR8A 1RACB 4RUBA 1Y10A 4QCLA 3U1MA 3BKTA 3L4BC 2JDJA 1NHUA 4UOFA 4HHUA 3GFYA 3CC7S 5T41A 1ZAVA 1RYSA 1S10A 4DR1J 3SV4A 3N28A 3CMAS 3F73A 3JTPA 2AU0A 2QLWA 3GB0A 4TLRA 1REGX 2LQJA 4B9SA 3TJ8A 3GIIA 2KG0A 2VKRA 2X1FA 2GJ2A 2OI2A 1HQUB 2IAJB 2W9CB 4WU3A 5HQMA 4TQRA 2HVIA 1ZTTA 3DOKA 1IBKJ 2H1YA 2UVVA 4OHWA 1N5YB 2P2CB 3ZZ0A 1YRXA 2ZDOA 5IT9U 1N32F 3EGVA 2HK3A 3NCPA 3CCMS 3DCAA 4K4WA 1Z4UA 1JLFA 2UUWA 1SH3A 4NCGA 5J2NB 1WUUA 3PW5A 1U2RA 3GFZA 2MQ8A 3TJAA 5KFCA 5CYQB 2IHR1 3MUVP 5DGBA 4BC9A 4LSNB 2AKWB 2KI2A 3ILIA 2Z57B 3LW5C 1PBAA 2M5YA 1JLCB 4XK8C 3C15B 2YNHB 4C0HA 4CWBA 4PCQA 2XC9A 2YX4A 4OZ5A 2FUG9 2V94A 4CLZA 2COLA 2E9ZA 2QMUB 1IJEB 1OQ3A 1H7XA 1CLFA 4BC7A 1FDBA 2CJQA 1OQ6A 1U25A 3I32A 2FDNA 5GAGI 5AJ3F 4MJKA 1N54B 4BBYA 1YQHA 2KU7A 2XMTA 1GTEA 1CVJA 3K7RA 5GADU 2N7CA 5KTQA 1JLBB 3VALA 3JAMU 3OFHA 4L72B 2R8HA 4P7TA 2PN6A 1U02A 3TAPA 4LFCF 3TQ1A 3QPIA 4RX6A 5J1EB 5J2MB 4CT9A 4ED8A 4LFCJ 2AQ4A 4L6V3 3MFHA 2MLXA 3SSRA 1QVGR 3NNCA 1KS2A 1NDKA 4C3MA 5D0HA 2CNNB 2BQRA 2Z30B 4DEZA 2G13A 3I87A 2G2YA 4KV8B 2JJ4D 3OPKA 1FEEA 2VDHA 4UZCA 4OHYA 3OR2B 1XMQF 2M4MA 1T05A 4ILMA 2KXNB 5C2CA 2HVEA 3R1LA 4P75A 3UNYA 4FBUA 2YWEA 3PJWA 2WOMB 4URSA 3AA9A 3I0SA 1RWPB 5BYRA 4IH7A 5C25A 5KFGA 4WZQA 1IKWA 3P3DA 3BN7A 1EB0A 5HMWA 3FEZA 2K3IA 4ED7A 4JI0F 3FGVA 1RKIA 1SJRA 5HVGA 2HHPA 2WBMA 4LF6J 4JBCA 2ASDA 4R5PB 5L38A 2A10A 2E1MC 2HFOA 4LBHA 4B9LA 2BOAA 1JNZB 1NHVA 3MM9B 4NMLA 2DY1A 1YI2S 1OIAA 4N5SA 2HVHA 4KGMA 2V68A 2FJVA 2LEAA 4DX5A 4LF1A 5FDLB 4ZHRA 2UUTA 2DR5A 3LF0A 5ETOA 3D1QA 2RNEA 2KT2A 3MM6A 1WI6A 3KK3A 5H1SV 1S4EA 1WC0A 2YKMA 3CDAA 5KFWA 1NK0A 5DO2A 4R0JA 1UMJA 1JJ4A 2NSBA 5H9FJ 2OKQA 2J6TA 4J90A 3G87A 1RT1A 3PG9A 4Q2LA 1RI7A 4KHPF 3R97A 1TL3A 2RHSB 3BZQA 1U0SA 5IC4B 3IO1A 3BKFA 1QSYA 3H98A 3CUNA 1FHTA 2YNIB 2DGWA 1QTMA 1S7IA 4CO3A 4H4OA 2LU2A 2HAIA 1QAIA 1H73A 2GHWA 3UFCX 2D3O1 4UUXA 4GC6A 1BY9A 3EYZA 3KLHA 4NASA 4LSZB 3ZZYA 4F0HA 3Q8VA 2BKNA 3X3UA 5SUHA 1KLNA 1BQMA 2HEKA 4MYTA 4ZVGA 3CJRA 4DV1F 4C98A 3DNCA 3Q8UA 1I94F 3ZTPA 3AJ2A 4QIEA 1TV6A 3NLCA 1UVMA 4W98A 5KFKA 1I94J 2NYHA 1WOSA 1JLGB 4HT7A 2IJRA 5B0EA 8AT1B 3H4DA 3R5AA 1SL1A 2X3GA 1BQNA 1TK8A 4DR6F 1HBNA 5A76A 4TVAB 4EBEA 4FF3A 3T5HA 1P9YA 2HZCA 1XR7A 5KFSA 2QMWA 1NSKL 2KM8B 3MD1A 2YNFA 1NDLA 2VG7B 3D6HB 4ECRA 4NLVA 3VAJA 2V8VA 1YJVA 1Q8IA 3A3OB 3NG8A 1WORA 1XERA 3CCUS 2G1DA 2R7SA 1BC6A 4IR9A 2UUBF 2VFUA 4RW8B 3KHGA 4PWUA 3MR3A 2UUBJ 1P27B 5KFOA 5KT7A 2XSJA 4RW7A 1N6QB 1MG7A 3T1YJ 1NK7A 1Y3KA 2YNGA 4DL0C 2Q79A 2RSQA 3BN4A 3Q8PB 3Q22A 2N3OA 2MYFA 4YN3B 1W2BR 3QZ7A 4DLEA 1K44A 2MPUA 1KVJA 4DPYA 5RUBA 2Z2MA 4AUKA 4DR5J 2IJFA 1M5HA 1S57A 2JZ5A 3R27A 4HHJA 3MURP 2DPJA 1HQEA 3W62A 3F0NA 3A8IA 1HMVA 3J7ZT 1WG5A 2CADA 1WKJA 1TK0A 4R25A 2AD9A 4I7FB 3RAQA 4ZMMA 3RB6A 4HLBA 3D9BA 1DURA 4DV5J 2CNLB 4KSEB 3L95X 5LSOA 3HI9A 3TYTA 2H4WB 3JSMB 2RDDA 4P74A 1NMEB 5GAHU 4F67A 5LMUF 2RHQB 4M5HA 3ISND 1R8PA 2OPSA 4CYUB 1YWXA 1HNXF 4Q43A 2RT3A 1X9SA 4NYZA 5L8RC 1NHKL 3LP0A 4Q45A 3M9MB 1RTHA 3QBCA 2E5LF 1JLEB 2IVYA 5JVGQ 4ETZA 2VG6B 1MN7A 2VBXA 1UVKA 2R7TA 1R3NA 1GXTA 1KHWA 1YJNS 2BANA 3TANA 4YDDB 4LFAF 3FC9A 4JI5F 2WONA 2F1FA 2GA7A 4PUOB 4DX6A 1RBAA 4Y2KA 5HP1B 4LFAJ 1CBKA 4FNIA 5EUHA 5D8HB 4DL4A 3MM8A 3I5AA 1U09A 1UWBA 2DH9A 5DS7A 3I6PA 3QZ8A 2VDIA 4QWEA 1SI9A 2HNDA 1CJUB 4NLDA 4YB6A 2FY1A 1F60B 2IIHA 5KOXA 1VGYA 4P7VA 4R0EA 2GMHA 1FKAF 4Y2MA 1KFSA 4J9VA 3J7YI 4X4OA 1VS3A 2GQQA 3M6UA 3R3TA 2DK2A 1TKXA 4OYIA 5DLFA 2XY5A 1FVQA 2CPEA 3HVWA 4XDCA 4WWSA 3HVTA 4NXMJ 4HTIA 1S9GB 4ANDA 4P2SA 2EEYA 2E29A 4FF2A 2HPUA 3KWMA 1ZAWA 4KFBB 2BKOA 2LCWA 3IWXA 3PNIA 4NLYA 4KPCA 1HBOB 2HURA 2QSFA 2UXDJ 4KHRA 2L48A 3O1LA 1QAXA 4FYXB 3FSIA 4DG1B 5CCMA 4UTGA 3GWCA 4ED4A 3H42A 4DR3J 2Z2ZA 3RJMB 2HBRB 5KFAA 4GVBB 4UOCA 4ZCMA 3I4PA 3RB4A 3PACA 1R6VA 1KD1T 3V6KA 4QJVA 4QIFA 4TLQA 4QR0A 3EPGA 4J9SA 4F3QA 2AJQA 2RRBA 4U6PA 3SCKE 1F6TA 1S1VA 2VBZA 2QLBB 3B78A 4P2XA 3MMJA 3JTNA 4QQBA 2WW8A 4TY8A 3HJVA 4DV2J 3SQGA 2MZRA 1R89A 3R1HA 1DLOA 2R2RA 4HL9A 1DAXA 3H90A 1Q95G 2CUYA 2ZUAA 1G4CA 1UZDA 4X4VA 2OPQA 2HW3A 2QJ3A 4RNOA 4GKJF 2RS2A 1GXUA 1SC6A 1S1TB 4F36A 3WX4A 3IRWP 1FO1A 3G8SA 1YG0A 1RT6B 1PJ5A 2BRLA 3T1AA 1T9TA 2VA2A 3DDNA 2X1GA 1T8EA 3FCWA 1ZBTA 1PJ6A 1GX6A 1QAYA 4LMZA 5B0AA 5H9FK 1WG1A 3SSSA 2DVIA 3NGSA 1MU2A 1CQNA 3T6BA 1X4HA 3QRRA 2OIHA 3KYLA 1YJWS 4ETXA 3W60A 3MD3A 1IKYA 3J7A1 4J91A 4DX8H 4B3RF 1V6HA 2J9EA 4LF5J 2VJUA 4ZP8A 3DRPA 2XLKA 2HNZA 3GJSB 4CLFA 2W2MP 3GIKA 1S6QB 1KN6A 4ID5A 3CCRS 4C8YA 1KQSR 2ZD1B 3EJMA 1VBZA 3I9ZA 4DPTA 1B7FA 1R0AB 3OV7A 2ZVSA 2R7WA 1SJFA 4FXDA 2PD1A 3NWGA 3NOGA 5GMEA 4IO1A 2VV5A 2AYEA 5KT2A 1WELA 3CCSS 1FNOA 2XCPA 2DPIA 1NB7A 2BJDA 1MROA 2P5VA 2B6AA 4O4RA 1XMOF 4QPXA 3QIPB 2Q3PA 2E1AA 2ZKUA 3NGTA 3U1LA 3M2RA 4JUZA 1XMOJ 5J2QB 3BGRA 2AP6A 3HFVA 3CCES 1T11A 1RTJA 2QFJA 2DHHA 3BYPA 4OZLA 3QSYB 5D15A 2V67A 1C1BB 2MLYA 3OL7A 2RDIA 4ZDNA 2QMXA 2RF2B 4IG3A 3SQOP 3Q86A 2WVCA 2B0GA 4N41A 4KO0A 3Q24A 2ZZNA 5G0RB 3MCNA 4I4BA 1N56A 2W2NP 1AXQA 2Q6CA 1JLQA 5KG3A 4PQUA 1RWOB 1CG2A 3NAHA 3MPVA 2XI2A 2VFVA 4FF1A 2L9WA 4R8UA 1RCXB 1HBUB 3PJ9A 1NNDA 3DRYA 2EC0A 1HNVB 1HR0F 3TZYA 4AXIA 3DMJA 1S9EB 4WU2A 1HR0J 1KKHA 1HHTP 1T9UA 4ALZA 4C2MA 3GPAA 4CO1A 1MWYA 4EYIB 3RYLA 2VPXB 1FKOB 1UFWA 1WJ9A 1DTTA 3M4XA 5J2NA 4WKYA 4M5KA 1RHMB 2UU9J 5D77A 2CPYA 1SJ1A 4DMZA 4K4UA 1RT5A 3GV8B 3RAXA 4OJGA 1EP4A 3IM8A 1WHVA 5D0GA 2X1BA 1BWEA 6AT1B 3I0RB 1RT2B 2YQ0A 4EFAC 4DL7A 3H25A 3GJQB 2B4PA 3M8SA 3EXCX 4YUDA 4OL8A 1RDRA 4AYBD 1VK8A 2B4UA 3MEDA 3MMAA 4BWMA 5E0OA 4QWDA 2HHTA 3LP1B 2E1PA 4B3MF 5K14A 4B3MJ 1AB8A 1X7VA 1XNQJ 3M32A 1X9WA 5KFEA 3DLEA 1RHQB 3RUBL 5HATA 2Y1JA 2EFQA 1NO8A 2EFPA 4FKYA 4UOGA 1WG4A 3LWLA 2ZBPA 3R6LB 3NGRA 3P49B 4EBDA 4N76A 2J7KA 4CTAA 1VC5A 1HWKA 3UR3C 1GFWB 1H2UX 2MSTA 4GRSA 5K8PA 3KK2A 3OHAA 4I67A 4K7QA 1CPZA 3UR0A 3PW4A 2ZBRA 3MEGB 3JSRA 5HLFA 4E2FB 1U1LA 1NKCA 1EETB 4JI8F 2B8PA 1X0FA 5KG4A 2KHCA 2D41A 4Q8EA 3T1HF 2NPIA 1HD0A 2LDYA 3J81U 3GTYX 4TXSA 3M7VA 3T1HJ 1OY6A 1QLNA 4KV8A 2CNOB 4ED6A 2I0XA 3JS9A 2ZC3A 4IUFA 2DNNA 2B5JB 1P1TA 1IM4A 1GEHA 4FDFA 4ZVUB 2AIRB 2RD5C 2CJBA 5HSPA 4M5JA 2JRSA 3CD7A 3KHHA 1F5BA 2D69A 3FK4A 1U1KA 4ZP9A 2VJVA 5AXKA 2FZCB 5IT0A 3CJ0A 1RWMB 2LMIA 2R7VA 4DS4A 2J0XA 1TVRB 1ZH5A 1SB6A 2RMLA 1YITS 3KLGB 3D6TB 3ET6B 2KKHA 4QWBA 4ZLLA 3KDOA 3GJRB 1BUXA 2DKOB 3NMRA 2EFNA 4PXEA 4CM0A 4PRFA 3G6XA 5K20B 4C6AA 5KFRA 3AOBA 2C2RA 3LWMA 1WC3A 3H8YA 4N7TA 3C16A 2LKZA 3CCWA 3KHLA 4ZVHA 2FZGB 5KFIA 3HHLB 1OPIA 1U0HA 4O4GB 2OPRB 4UQTA 3NCRA 4X64J 4RNFA 3EGZA 1TL7B 3W5ZA 3V4IB 4DSIA 4EEYA 2G0IA 1VHFA 2ZH7A 2CWKA 3DLHA 3KLEB 3IC1A 3KNGA 3EUNA 2H3EB 4DDFA 1S97A 2Z0GA 1U1OA 2N82B 4Y0FA 2FLLA 2YNIA 2D7SA 3M2UA 4JV0A 1ELOA 4MFBB 4B3TJ 2CPXA 3A4TA 4DQSA 2RILA 3F44A 2P9CA 2DITA 2XMMA 2K8GA 3BO4A 1FX2A 2R7QA 2P9GA 2BA9A 4CP5A 1HNWF 1M1GA 4DZDA 3NGDA 3PVXA 1ZS6A 1K0TA 3PTWA 3Q2TC 2K2PA 1JLGA 2FTRA 1H2TZ 2NUUG 3IMQJ 4B3OA 3CJ2A 2WVBA 1VRTB 1IR2A 4WFZA 2RIJA 2ZDPA 3HHNB 4OZ1A 3KKFA 1RAIB 3MUMP 1YVFA 3D1HA 5KFTA 2HZVA 3TNVA 4ECSA 1Q8KA 1E6VB 1W26A 4EZ6A 4NWBA 4PG8A 4RWWA 1ZTWA 4MIAA 1KVIA 2YPZA 4RW8A 4USTA 4DLGA 4RWXA 2RRNA 3V6HA 3MAAA 3VVTA 2C2DA 1M0SA 5U47A 1MMLA 4OYXA 4M94A 4W92B 3N6LA 1B99A 5JMNA 4DSEA 2M8HA 1F5CA 3GQCA 4LR9A 5DJBA 5I3UB 4IH5A 4IOBA 2B43A 4B3SF 2OTLS 1UKUA 4RW9A 5E3QA 1HNIB 3LP2B 3PX4A 2AGOA 2Q43A 1FRKA 1GQEA 3D6MB 3VAHA 4I0WA 4WCEQ 2CPDA 3QRQA 2D1CA 1E6YB 3HVRA 2BQ3A 4OFZA 5GMKa 3A12A 3UD3P 3TUPA 4Y3CA 3G6YA 4QIVA 1KVKA 3B6BA 3GIJA 2OPPB 4HHHA 3BGFA 4E8UA 1C0TA 1HPZB 3MMBB 3PYDA 3ADAC 5F9NA 4Y00A 2AGPA 1N4LA 1WWHA 4NLWA 3JYTB 1S0OA 5KFMA 2V34A 3KLIA 1LW2B 2J0QD 3PYEA 3D4JA 1PCAA 4DQPA 3G2XA 3EZ5A 5DETA 3VHQA 3M30B 1RXOB 2MQMA 4DFPA 4WE1A 3DGPA 3EMTA 4JI6F 4IQXA 2BR0A 2RB7A 2XZTB 1TMJA 2RUSA 1V3RA 4LF9J 3UCGA 3WX8A 3SFGA 1QUPA 3KK1A 2XZWA 1JWWA 4ZVFA 2QTWA 1ZYQA 1YJRA 2D74B 4CYUA 2APOA 2L3MA 5E33A 4JI2J 5IM0A 1KOOA 5HN0A 1GX5A 5B09A 3BS9A 5A8WA 1JLEA 4EGLA 1NJWA 3MAQA 3GYXB 3FQLA 4M63A 2MMYA 5DG9A 2JOQA 1HHSA 3ETMA 2Y1RI 1VI7A 1K8AT 2KJWA 1BHNA 4M5DB 4RZRA 2AGQA 4CZCA 1UJ4A 3PYFA 3IRXB 4X66F 5HMXA 4BLGA 4HACB 1VBKA 3OR1A 3RW7A 2C3YA 5L9XA 3OJUA 1RJJA 3S1TA 3C14B 2LEPA 2AJ4A 3MCSA 2PMWA 1T95A 4V19X 2GVZB 2IDEA 4ECYA 4LBIA 3TP2A 3I55S 2HGLA 4PZVA 2VICA 4HH0A 2AX0A 5ETPA 5ETQA 4NLGA 1YJUA 4QW9A 2QL5B 1LWFB 1YIJS 2F3JA 1S9GA 1N48A 2CWXA 3FRZA 1WNEA 2V4JA 4D3HA 1N33J 2XS2A 3ZNJ1 1HBMB 2YH0A 4CT8A 3SEOA 1S1XB 5F8LA 3IA0A 5EGYA 3F56A 1HBOA 2ZH6A 1BWVA 3H4BA 1VLOA 2QL7B 2VC1A 3W64A 2H54B 3BDEA 1UVJA 1FD2A 4HKQA 3LANA 3JSBA 2J9DE 1CULB 2DB1A 4K50A 3OW2R 4TKTA 2DH8A 3MPDA 2GNKA 4GVBA 3WIUA 3CDWA 1H3DA 2ROGA 4OYMA 1VQ8S 4BDPA 2PA8D 3FBEA 2Y3YA 4TYBA 3H5XA 3MI7X 1RBLA 2GZOA 3SIPB 3A3PB 3RTVA 1S6UA 1UW4A 1QTNB 2J76E 2MDAA 5L9NA 1FRLA 4OX6A 3MECB 1OWXA 2ZOFA 1J5OB 2Y0SD 4XAKA 3D68A 2C2ZB 4ANEA 3HZEA 1NXIA 4YP3A 1XWLA 1S6OA 1KWMA 4NRTA 4AE5A 5LSRA 3G9CA 2I2YA 2EBGA 3NNAA 4EYHB 3CULA 4MKVA 4P52A 2WAQD 2XY6A 1S0NA 4KGVB 2MKHA 2ADCA 3QO9A 2ROPA 5HJXA 4U95A 2V8PA 4A8QA 3JQJA 2QA2A 3TA1A 1RTDB 5F9LA 2MEWA 3U27A 1DJ0A 2R7OA 1ZZFA 1YRTA 4I56A 2I6WA 1CQMA 3OD2A 1ZAXA 2QLXA 1D9FA 2M0GB 4IR1A 2DNQA 4L75A 5IS2A 3H2VE 3IBCB 2HFUA 3M1VB 4ENOA 4OYPA 1HNZF 3TX8A 2E7XA 2KRBA 1WOOA 4H4MB 1JJHA 4CIOA 5C24B 4NZ0A 3CJSA 1XR6A 5L1LA 2XHWA 2RKIB 3PDNA 3MHYA 4LF8F 4FVMA 1RBOB 2IM2A 2DR9A 1IBCB 1F9HA 1S1WA 3K58A 4XO0A 5GAEI 4FS2A 3KLFA 4DQQA 1OY9A 2GVDA 2CVEA 4IRCA 4IDKB 3HP6A 2VOPA 4CLUA 1B0VA 3MXHP 3MM7B 1UFKA 4OZ3A 4DF4A 2FJWA 4TYAA 1HA1A 4JV5F 5IQQA 1TKZA 4QW8A 2M70A 1SV5A 1QSSA 4RW6B 3DI6B 1NKBA 2Z56B 5KFPA 4M5MA 4QU6A 1SKUB 4ZN3A 1YGYA 2HHHJ 2P6TA 1L3TA 4Y28C 3CT9A 2FGOA 2F4VF 2XMUA 5BR8F 1IBLJ 4OJ1A 1N5SA 5KG5A 5CYMA 4P2FA 1NJIT 4DFMA 1F9FA 3CCLS 2ZEJA 5KFYA 4ED5A 2P6SA 4CH1A 2GIRA 1BQXA 3ILOA 1F2HA 1S9EA 3AQOA 4C11A 3L7OA 2Q1LA 2G4BA 2HHQA 1AW0A 3CNQP 3VAIA 2HQCA 3OFEA 1F5AA 1VQMS 4OX9J 1U1NA 1RYRA 3IG1B 4DL3A 2EVZA 1FTRA 1FKOA 3DFEA 4CLYA 3G8TA 2FLNA 2CIMA 2GV1A 3ZTQA 2V50A 1U1PA 3BQ2A 1WF0A 1KBRA 3DOLB 3K57A 1VQPS 2HIYA 4DR4J 4ZLNA 4LBPA 2ATCB 3QNWB 5LOQA 2GFFA 2VG5B 4USHA 1UJ6A 3I0RA 2OTJS 3B54A 3M8RA 3OUYB 3MMCA 1ZM3A 1U6BA 3M8WA 2AW0A 4Y2CA 3QLHA 3E2EA 3TX0A 3WBZA 2VZ9A 1U8WA 3GR0A 2I8EA 3LQVA 1NKEA 3E01B 2P8IA 4J9UE 3BM7A 3DYAB 3TAMA 5IXUA 2OSQA 3M05A 2QEXS 4F0KA 1SPBP 5I42A 2N4DA 2MGZA 1FJGF 3QFWA 4NLRA 1SQEA 1FJGJ 4IG0A 3UDEA 3CVKA 4Q2MA 3CGIA 5KFBA 2ZOMA 2EC2A 1TL1A 2J0WA 2BXJA 3POTA 2L41A 2BABA 4NLOA 1HWUA 4G1QB 3GCWP 3QAUA 2XMKA 4DFKA 1VOMA 5ITHA 2QLJB 3R7NB 3D0GE 2UXBJ 3UDLA 4RBTA 4K4YA 3FFIA 1AA1B 3Q89A 2W2PP 4CH0S 4H4KA 3V6DB 3BPSP 4RNNA 2RQCA 1GTHA 3J81j 4DSFA 3I4HX 1KHVA 1PKUA 1SUQB 5J2PB 1R27B 4ER8A 5AXLA 4PWDA 2NXCA 3KMSA 5LJ3Y 4H4KC 3Q8RB 3OL6A 4JI3F 1SL2A 3MR7A 3TAQA 3N6NA 3N6MA 1TVRA 1RUSA 5F8MA 3NKYA 2ZM6J 2NXEA 5LMNF 3L7PA 3CIMA 1RAHB 1SIWB 1BE4A 4QOTA 2YQ3A 4GVLA 1RB0A 3M8PB 3NCQA 3M8YA 1DHMA 2HK2A 3A8KA 1FDAA 1D3WA 1Y4ZB 2NS1B 1RT7A 5HBMA 2MZSA 3MZIA 1YJTA 3VVUA 1RE1B 5L46A 1LWEB 4EWTA 3NRBA 4YDXA 2QA4G 4KH0B 1JKHA 4O4GA 4FN5A 2IPOB 3KXDA 3TEGA 1OSDA 4WFNQ 2HLUA 5KFUA 1G3OA 3PYGA 3KJVA 3OVBA 7AT1B 2BW7A 1FK9B 1LXJA 4N77A 3KLEA 3IS9B 2ZH9A 2MZ1A 2OUGA 1SJQA 5T7LB 1A9NB 3D0HE 1REVB 2QA4S 2BJ1A 2ZWPA 4XIUA 4NLTA 3EE3A 9ATCB 2NXUA 4I2PA 1L3KA 2PC6A 2VUGA 4OHXA 4ERDA 1RAAB 2B9YA 4IOAQ 5JXSA 2QZ8A 2XWXA 5E7OB 2ZITA 4L76A 1LW0A 2NSCA 3ISNC 3UE2A 1PC4A 4AD6A 4GKKJ 3MTJA 1X0PA 1VQ9S 4DV3F 3LGMA 4TY9A 3CTRA 5AE2A 1FNMA 2VPWB 2UXCF 4RUCA 5CYJA 1B4SA 4A8XA 1M5PC 4LFBJ 5BXIA 2XGPA 4X65F 5B0FA 1WC4A 4XPEA 4YOEA 2LXUA 4B9NA 2FVQA 2GAGC 5KFXA 4MTPA 1E6VA 1JK9B 1X5TA 5MLCV 4NEYA 2VBWA 4CO2A 1ZM2A 4OYZA 4DPUA 5KFDA 3RRGA 1UW9A 4CLTA 2HBQB 2QT7A 3IAM9 4QIGA 3R5DA 1G2EA 3G4SS 2JEGA 4HVZA 3GE9A 3QT7A 2ZE2B 1CJKA 1X31C 1NJZA 5DQGA 1X4CA 1JLAB 4ELTA 4ECUA 1NLKL 1N52B 2HMIB 1WEXA 2OEKA 1S0VA 3UVJA 4GO7X 2V9WA 2MB0B 3KMQA 2XMJA 1KONA 2M52A 2UVUA 1M1KT 4ILRA 2DRAA 2GQ2A 4A48A 2ZH8A 5HROA 1FRMA 4KY3A 2BBEA 4F4XA 1IXKA 1DBDA 4LF2A 3V6JA 2FJBB 1VQLS 2ZJPQ 2XG8A 4F4ZA 4UOHA 2W2QP 5LSLA 3RAMA 4JI1J 1XC9A 1XN9A 4DV6F 4ZLJA 4LSLB 4JOUA 2R7XA 2V6AA 2NUHA 1FWLA 3FBBA 5DGAA 3QT5A 3PY8A 3RBEA 1RAGB 2NYIA 1U48A 1QUVA 3EZOA 2JFKA 2IY5B 2XYPB 1RAFB 5M2PA 3A1YG 3WIVA 4DV0F 1R0BG 2FHJA 4NXNF 1AZSB 5DQIA 3TVYA 1Q81T 3ZXWA 3O8WA 2ZJQQ 3IFEA 2AX1A 4OZ2A 3MR5A 1BXNA 1BLUA 4ZA1A 3EWGA 1K1SA 3SFUA 4ZPTR 1HW8A 2CA9A 5HQ8A 4DPWA 3OBIA 4O0IA 4I69A 4M5DA 5EWGA 1S4FA 4OI1A 1J5EJ 2VA3A 4C3KA 4OI4A 3QSIA 2B9XA 3GMGA 5J1PA 4HR2A 4P72A 4CI0B 4U96A 4HACA 2V2VA 3NS5A 1C1CA 4OV1A 2FB0A 1CSJA 1CEZA 2EG2A 1VBXA 4LVNP 1TUVA 2IC3B 2VQEF 1NB2A 1QY7A 5LXYA 1JXEA 4X4QA 4IFVA 1HWIA 2OSRA 4DV4F 3UCUP 1RISA 4OI2A 4DV7F 4NI2A 4DV4J 5LT5A 3W61A 5HQLA 3FCVA 3UW1A 3AXKA 5KFVA 5B0BA 2QIFA 3GV7B 1LWCB 3W2VA 2ILYA 4OMFG 3HK2A 4DR2J 2KXHA 3K5PA 1EKSA 4DF8A 4LR8A 2DO4A 2KL8A 3T19A 1I6JA 1FJ7A 3DRRB 4A8SA 2QYGA 1S9FA 4Y65A 2YKNB 4NA1A 4HDHA 4WP9A 4ED1A 2CQHA 5DZ6A 2PEBA 2V9KA 1T03A 5CH7B 2JVOA 4DUZF 3BB5A 4CNYA 1U49A 2GAHC 2GMLA 5ETSA 3CJ8A 5E3RA 2EK1A 4C8ZA 3CJ3A 2DNZA 4ZVQB 3Q2SC 4RW4A 3KUEA 2G2OA 4F4AA 3EZUA 3B4DA 2K1RB 2CJYB 1RGVA 2J9DA 4F8RA 2YXLA 3GILA 3OT9A 3UWTA 4P6QA 2CQCA 4DR1F 2NXJA 2V8HA 1U6FA 4USWA 1HL6A 2CQIA 3WDOA 4X2BA 2NZ4A 2KFYA 3B82A 3OFFA 1S1UB 3G82A 4F25A 3JQMA 2MKCA 1RAOA 1IWGA 1VYAA 1WOPA 2YWWA 2YKOA 2NR0A 3PIPQ 1IBKF 2Z2LA 4LJMA 2MQOA 3N5BA 2DR7A 4PQAA 3KHRA 1SIZA 2C3PA 3EXYA 3OXGA 3SV3A 2Q6BA 1RTDA 1OSCA 4G1PA 4OYWA 1S0MA 3HFZB 5AE1A 4K5RA 2XWYA 5GAGU 3CCJS 1N5VA 3TJ9A 4PG7A 1YBAA 1RCOB 5DQHA 3R9LA 3PRDA 3MOJB 2V8DA 3LTOA 5FJ4A 1VQYA 2Y8WA 4USMA 3L3CA 2QL9B 1PIEA 3OTCA 4ECVA 4EUVA 1UA0A 3P8BB 2DEIA 2ZH5A 2G9OA 5CAAA 3AOAA 1H38A 2FJXA 1O51A 2CPIA 3EVMA 4KKOA 3W66A 4ES3A 4JYAF 3WZ0A 5D0RA 3OL8A 8ATCB 3P5BP 2QG9B 5F8HA 4KPYA 4JYAJ 3DOKB 2IM1A 1SQGA 2MQNA 2DGQA 3KJQB 2AV5A 4Q0BA 2W4PA 4DCOB 3V5RA 2C2NA 2BJ7A 3GLJA 1WC5A 2O01C 3VGUA 2OFHX 2XMAA 3P5TL 4LIWA 4I68A 4G65A 4B17A 2CJXB 1N5TA 1JLFB 4WF9Q 4NCGB 3D1OA 2JLGA 1GMUA 5F8GA 1D1UA 1RTIA 1FWPA 2MKJA 2I9SA 3QT6A 2HRYA 3JSYA 4YB5A 3PM9A 1KR4A 3H59A 4KAIA 3DGVA 1SL0A 1H72C 4C0OC 1WTFA 4QZVB 2YKPA 1T9YA 4TNOA 1XBWA 2B7CB 2GGPB 1WF2A 3K5OA 4DR7J 3SDEA 2XI3A 2ZH3A 4DI6A 3EGWB 2NLWA 3BGOP 3R2CJ 1RAJA 1C4AA 4KBIA 4TN2A 4G3IA 2GO9A 2C2EA 3GU0A 5F0UA 4QU7A 2JH3A 2YWKA 1UPMB 2R8IA 1ZZNA 4WZMA 4KIAA 4U9RA 3FQKA 4FNHA 1A6LA 2ZVIA 2PGCA 3OTEA 3PV8A 5B0GA 4DUYF 3BF4A 5KOWA 2F8HA 3LALA 2ZZTA 3AD8C 1FDDA 4DUYJ 2XYHB 5BYSA 1R8BA 5F0WA 4FPRA 2A6OA 4LF6F 2XULA 4JI4J 1L3SA 1N0UA 5KT5A 4FKXA 1NK4A 2YKQA 3NBPA 3DLKA 4PEOA 2R8JA 1Q7LB 4Q5VA 3VGTA 4ZVEA 3A8EA 3T5KA 1UEKA 4WK1A 1LV5A 4NLPA 4FPIA 1I5OB 4LVOP 4BWJA 3PHTA 1RT3A 3N0VA 5KFLA 3GFHA 3AAWB 3JTOA 1VCTA 2B7BB 1HW9A 2O66A 4OX7A 3HKZD 1Y00A 3HM9A 3W7BA 2E1RA 2PMZD 2O1PA 3ZTRA 1HYSA 4P2MA 3LUYA 4NA3A 3FNNA 4U67Q 2WVDA 1T05B 4DL5A 2CDQA 3ICLA 4ZOSA 3RR7A 1CC7A 5A8KA 3ZO7A 2E5IA 3O2IA 2PA3A 2QV6A 3FSXA 2QN6B 3I0SB 3KJNB 1ROFA 3FRYA 2DO0A 2IYIA 3M9NB 4Z7YA 5C25B 1IKWB 2VC0A 4UY8T 1UVNA 1IVZA 1JNRB 1R8CA 1PG5B 3DU6A 2J5AA 2UUCF 3CD5A 2GJFA 2KN4A 3VQTA 3ZFVA 1Y7PA 3L9ZA 2ASJA 3QMQA 2HHWA 2UUCJ 2NQPA 3FZBA 2HWTA 4G6VB 2YBVA 1O8BA 1VLYA 1W7WA 3QJPA 2DBBA 2GCFA 1ICEB 1NSAA 3U1NA 4ED3A 3MGJA 2RH3A 2VHGA 3MEKA 2KDOA 3W65A 3DLGA 3G71S 3MF5A 3W5XA 1L5UA 1ZA1B 1FXDA 3T9ZA 1S6PB 1FRXA 4EK2A 4X4RA 4YHHJ 3ZZRA 3L7UA 3MM6B 2GQCA 4LF7J 4IFYB 3KK3B 1FNXH 2YKMB 4ZCLA 4IKAA 4MK9A 5K8MA 1I1GA 1WHXA 1SUQA 4ZPAA 3KFWX 3BO3A 2CFXA 2XZDB 2HNYB 1UVIA 1U8SA 1RT1B 5KT6A 4NX9A 1Q53A 1W25A 3QFHA 4F4KA 3NWRA 4I64A 1TL3B 1TTHB 3CJQA 1JIHA 5KFZA 1LFPA 3T1YF 4H4OB 1RHRB 3IAS9 1FRHA 2HHXA 2QO3A 3M9OB 5A2QY 3KLHB 1YSJA 2FVCA 1BQMB 5A0YA 4C8LA 2HGNA 1UPPA 2CPFA 2DHAA 4ZCIA 4WP8A 1TV6B 4EO8A 2H5JB 4KGXB 5D78A 3PXGa 3EM1A 3KLVA 1X8DA 1KFDA 1BQNB 2OMLA 1HBNB 4DR5F 3K8WA 3OLAA 3PJXA 4QBUA 1OPZA 2Y8YA 4OZNA 3DN9A 1X4FA 2YNFB 5FD1A 1FKPA 4NCAA 1SKSA 2MHEA 3J7Z5 1IKVA 3IS9A 4WFBQ 1A7GE 2D9OA 4DV5F 1PYTA 1S99A 5IWAJ 2XQCA 3VGSA 4C9DA 2OHDA 3VQSA 2FZKB 4O44A 3TZZA 2DNKA 2IBKA 2R2SA 1LQ9A 4RW7B 3ILJA 2LDIA 1DQ8A 1NAQA 4LF4J 2XS5A 3V81B 4RNHA 2HRTA 3BGUA 4WFAQ 2YNGB 2ROEA 4E0DA 1GMWA 5IV3A 2LEBA 4ICLA 2PSZA 2OLWA 4L3NA 1UEVA 1RP5A 1LK7A 2ZH1A 1CS4A 5LXRA 2MY8A 2ZHAA 4K2JA 3TA0A 2PEHA 3C6UA 3OJSA 3HMJG 2FD2A 4O3PA 3G6VA 2ILZA 5CCLA 3CC4S 2KYZA 5L1KA 1VQNS 3IBFB 1R31A 1RU1A 1H2VZ 1HQEB 1SKWA 2BJ9A 1ZM4A 3IN5A 2KZMA 4J9LA 5HAOA 3FJ2A 2RQ4A 3HPOA 3GV5B 1X5OA 3P45B 3VAKA 4M95A 2I5JB 4X84A 1YDLA 2A1BA 1VQ7S 2J0SD 2DISA 3AB2B 3CE8A 2AEMA 5KG6A 3DLJA 1IKXB 4WFXA 4DX7A 3DXSX 5D3GA 2VFRA 5AXNA 2XYGB 3H5YA 2Y1IA 4NXMF 3G86A 1U26A 2OPSB 3S8SA 3W2WA 1U47A 1IM6A 2HAFA 3R5BA 2QE5A 1VDHA 4GMKA 5C2GA 1VQOS 3LP0B 3NGUA 4ES2A 2WHOA 3KTQA 1PGZA 1Q5YA 1KLMA 1RTHB 2IM0A 2UXDF 5KFQA 3TEHB 2B4OA 1UETA 2U1AA 1UAWA 2BANB 1B3TA 5SZTA 2WONB 2XB2D 4ZPBA 1FE0A 3Q8SB 2N3LA 4DR3F 1JXLA 1VFJA 4DBQA 3R2DJ 2KTQA 3TW0A 5ADZA 1BMQB 3OSNA 4LRBA 2ZC4A 1C0UB 1DZ5A 4OHZA 2ATLA 2DNMA 2HS4A 1Y3JA 1S48A 4K4ZA 1S7HA 2L9NA 3W3SA 4KQZA 5CA5A 2BMBA 2YWFA 3N01A 4HEA9 1CJTA 4DV2F 3C6TB 3CW2C 1Q79A 5IV4A 1T0TV 2C22A 3HVTB 3HFKA 4A8OA 4UF4A 5ETNA 1B0PA 3Q0AA 3LGNA 3PZPA 2ZJRQ 3FVYA 4USVA 1AZSA 2WSCC 3CJKA 1V5IB 4J9RA 3VZHA 2GMJA 3X1LB 3VZIA 5A6WA 1M5SA 4I6YA 2H5EA 4CLWA 2OMOA 1LKZA 4A46A 4FYWB 4X4UA 3C66A 2FHJD 1FFSB 2ACYA 1FFGB 1GAOA 1RAEB 3FMBA 2PFFB 1K47A 1JB0C 2E1CA 5A8RB 1ZM9A 2FYXA 4CNZA 3LPEA 3HHEA 5HMYA 4WIQA 1P9QC 1Q78A 4LQ3A 4UZBA 1S49A 5C42A 1WKLA 3TRGA 2Y9HA 2IC3A 1DTQA 2H5IB 3M8QA 1KTQA 2X3DA 4QWCA 2E5HA 4ZN1A 1RK8A 3PKMA 4LF5F 1S1VB 4OI0A 3AT1B 5F3ZA 3Q23A 5KT4A 2DCUB 4TY8B 5HO4A 2J7UA 2QRRA 3SQGB 1LWCA 1MSWD 4YY3J 2CZVC 1X5SA 1P8GA 1CJVA 3ITHB 1X5PA 2L08A 1R0CB 4X4TA 2IBOA 4C8OA 4A8KA 2FJEB 2OO4A 2F65A 2OPQB 4K8RA 3CWJA 1KC8T 3E3XA 5B7WA 1KQGB 3OVSA 2LQ9A 2GC8A 1VQKS 3K59A 2C2OB 3W63A 5K8NA 1U6ZA 3V4MA 3GSIA 2KB2A 4M5LA 3AJDA 4CDIA 2E7WA 2DHXA 5DZ7A 4K0KF 5CZXA 1YBUA 4K0KJ 2CDRB 1IJFB 2RS8A 2PI5A 4DQIA 2FHOB 2Z58B 1UTAA 4FYYB 1Q4RA 1HHQA 2A2DA 1IKYB 2CJKA 4ITSA 4DSLA 3W9JA 2V69A 5D4PA 2MKYA 3Q8YA 2KRRA 3DRPB 4A8WA 2HNZB 2BW2A 2HQFA 5M2RA 3HD2A 1A0OB 3H20A 1WSVA 3G6ES 3PO4A 4N8OA 4X62J 2BE9B 3HCXA 1HFEL 5AXMA 5HJYA 4ID5B 5IFMA 2F63A 5F8NA 1HQUA 2IAJA 2W9CA 1D9DA 1MMNA 4UUWA 4K59A 1IBMJ 2HHSA 4UW2A 3AFGA 3BKUA 2R42A 3BH6B 4TU8A 4K4VA 1N5YA 2ZBQA 3NGKA 2DYAA 5ETTA 4G1IA 1MROB 4MYUA 4ZS6A 2B6AB 3UD4P 3OLBA 2VIHA 2W7AA 4NOHA 3M2RB 2UU9F 3BGRB 4Y2AA 1KQKA 4B9VA 1RTJB 3QGHA 3UNGC 4JI7F 5CYQA 2CXEA 2V2KA 3ELHA 3CD6S 4ZPDA 4JI7J 4LSNA 2NXNA 4IG3B 4ECZA 3UN3A 2UV8G 4KO0B 3ZNUA 4K4XA 1JLQB 1JLCA 3C15A 4PQUB 2YNHA 1X4BA 2JEFA 2LQ8A 4O23A 2ASLA 2G2ZA 1AT1B 2VB6A 4R8UB 4M5NA 2M3DA 2XBPA 4QYRA 1FFWB 2B8QA 2W8LA 4OHVA 1XNQF 1PBUA 2M8DB 3DMJB 3EGNA 4IQMA 4ILLA 1IR1A 2JLFA 2N7YA 4ZLPA 2BDPA 4YR0A 1D8ZA 3PCOB 3CCZA 5I3QA 2GIQA 4FXVA 2RQMA 2ZFHA 2DGUA 2NREA 3P4UB 4QR2A 3PX0A 2MJNA 1N32J 1DTTB 3GJTB 3PRVA 3PR4A 3FZ2A 3TA2A 1JLBA 4DN9A 1XMBA 4C8NA 3US5A 2K7JA 3D2WA 1T3OA 3VAGA 1RT5B 5J1EA 5J2MA 1F3FA 1FTCA 1EP4B 2E5GA 4DSJA 1YLXA 3GG1A 4UT4A 5IT9Y 2L9DA 3U7JA 2GGPA 5C7PA 2V4RA 2HQIA 2DTJA 4J5OA 3MEDB 2HSEB 1S72S 3MMAB 4YB1P 1PAEX 3EICA 4ZVTB 5I3PA 5K14B 1EX8A 4B08A 4CLPA 4FYDA 4WYLA 1WDDA 3OR2A 3BGLA 1VJWA 3M32B 3RB3A 3DLEB 4LT6A 2I1RA 2M9KA 2WOMA 3GYNA 5AJ3J 1OY8A 2H65B 3UN5A 5IZHA 2O67A 4CTAB 1Q86T 1NJYA 2BZ2A 2LA4A 3KK2B 4R5PA 2DH7A 3PEJA 4DCPB 4A8MP 5HLFB 3G8QA 2VU5A 2QX0A 1Z2LA 3SSQA 3MM9A 3QWUA 4CRJA 2IVFB 4RNMA 2W2OP 4B02A 3I82A 3ZZUA 2JLEA 1RT4B 1NPKA 5H9EJ 3H2UB 1VQ4S 4X64F 5FDLA 1FRJA 3JAMY 3GSDA 5KG1A 3HD1A 1GNKA 2CQPA 4PPZA 4DHVA 5GADI 3GYGA 3TWZA 3T5LA 2J6SA 3MR2A 3CO0P 2BOPA 1XMQJ 2HGMA 3SCIE 3T9NA 2WZ1A 2CJ9A 4RKUC 2HLTA 2MLZA 3CJTA 1YJ7A 1URNA 4O3QA 5KG7A 3PX6A 5F3TA 1B0TA 3LA0A 3B4MA 4B3TF 3BR9A 4QWAA 1T7PA 1CC8A 4JI0J 4MK8A 1NH7A 5BYQA 4Z37A 4USJC 3FCHA 4X4PA 5FIIA 5LM7E 4XPCA 2POKA 3VTIA 3M6WA 5DG7A 2MZTA 3RG6A 1U24A 4CLKA 3QYYA 3HJFA 2YX1A 3THPA 2E9RX 1LEOA 2OEJA 2DNYA 3CD0A 3P6YC 4EO6A 3VV2B 1FXRA 3C16B 3IXQA 2CPZA 1RWUA 2XO6A 1TQLA 4KJIA 4N47A 2C3OA 3DOMB 3C2PA 1U0HB 1S6PA 3ZTSA 1N36F 1Q8LA 4IFYA 3OTOF 2A3JA 2NCKL 4LUBA 2CQDA 1TU0B 3SI8A 1N36J 1RKJA 5BJRA 4ANCA 4J7CA 3OTOJ 3I9V9 2B56A 4JB8B 1U2FA 2HNYA 2VG7A 3N5FA 1RWNB 5JJBA 2WRMA 1NSPA 2DNGA 4Y34A 2VPYB 1RTZA 3W8PA 4RU9A 2XNRA 2R8KA 3O6QA 3TVZA 2VH7A 4KHPJ 2BX6A 2HHUA 3J80U 2PI4A 3M2UB 2KM8C 4V19J 5DM6Q 2VKZG 1G6BA 5CD4H 1N6QA 2XMVA 2WB1D 1LFWA 1YX2A 3G96A 1XK8A 3KG1A 4J9KA 4DV1J 4RR5A 3AQPA 4B3OB 5MAOA 1H6KX 5B0DA 4Z2XA 3J80Y 1JJ2R 5KFJA 3O5TB 2J7WA 4DR6J 2EBEA 3H0PA 1NDCA 2HQGA 1IQTA 4MKBA 2DNLA 3A13A 3I5BA 1O6XA 2HFSA 4DJBA 4L74A 5KT3A 3M2VB 3CF5Q 5M2UA 1DQ9A 2PIIA 1N0VC 1FD8A 4WPAA 3E8OA 2JX2A 2R2UA 4I7FA 3AD9C 2HYIB 3F41A 2KFNA 2V2QA 3MAAB 1LK5A 1HD1A 1Y5LB 4LF9F 1SBRA 3CPWR 3V81A 3I31A 3JSMA 1YZ7A 2CPHA 2OD4A 2FHKA 1RZMA 3OTBA 1FWKA 2PDAA 2HQ3A 4A8FA 5JVHQ 4JI2F 1LXNA 2YTCA 4CM2A 1WEZA 2DNRA 3HSGA 3CDEA 4RW9B 1FRIA 3TARA 2CAJA 1JMTA 2E44A 4XDDA 4F02A 2FJAB 4YMEA 2VG6A 1WD6A 3JB9k 1GMWD 2V4QA 2OP5A 3LH2S 2AJ0A 4FBTA 4DS5A 1VC0A 1D09B 5EWFA 3HT3A 4RL1A 1K9MT 5I4MA 4PUOA 4KR0B 2MKKA 1C0TB 5HP1A 5EWEA 1NK8A 3LO3A 1NK9A 1UEUA 2W1BA 2HFNA 2I5JA 3KLIB 3AA8A 3CC2S 2QLFB 4YQWA 4ECWA 1CJUA 1HKAA 2DXDA 1FJCA 4WXWA 2DNPA 4WE1B 3DGPB 3AJ1A 2Q66A 1IKXA 4FZVA 1WSRA 4AL5A 4KRWA 3KK1B 5IQ6A 2B9WA 3DRSB 5KFHA 3D5MA 2YY3A 5LMUJ 4I1TA 3VCDA 1N33F 2W24A 5IM0B 3NXZA 3QQCD 1HNXJ 4WK3A 1U1MA 2G0CA 5A8WB 3C19A 4KFBA 1GK8A 1HWLA 1U1QA 2HS0A 1I51B 2F9JA 2E5LJ 3HF5A 2K7KA 4F26A 3D67A 2ZWOA 4K4TA 1SJ3P 2QFIA 3KJFB 2RAQA 1SKRA 4DG1A 1RA7A 4JI5J 1RWWB 2HKEA 3J7AN 2MHNA 2BE2B 4NLUA 2AJFE 1C0UA 2XY7A 3R5CA 4P9SA 5GAHI 2BQUA 5F8JA 2BV3A 3SZ2A 5HL7Q 3OR1B 4A47A 2WSEC 4OJ3A 4KT0C 4OI3A 2C42A 3TZXA 2B4VA 4J9PA 1PYSB 1NUEA 4GC7A 4MKYA 3FSYA 1KNZA 4ZP7A 4L3KA 1KQFB 4C48A 3UO0A 3DDIA 3W9IA 1TMMA 2PFDA 3C6TA 2BKPA 2RQKA 1H98A 4ES1A 2VBYA 2E7VA 2H48B 3IWNC 3HX9A 2GX8A 3JXOA 1T9VA 1OYDA 3KDNA 1WC6A 5HVHA 2V4JB 4PG6A 1UVLA 1U7LA 3T3FA 3ILLA 1HI8A 4CO5A 5L1JA 2XTJP 4ZK7M 2OGUA 3Q83A 3I5CA 1Q1KA 5KAKA 2O5DA 5H9EK 4ZIWA 1AROP 1S1TA 2H9ZA 2JFDA 2DGSA 1NJXA 1RT6A 5K5MA 4J37A 2WBRA 2EFOA 5A8RA 3S6EA 3AB4B 3DKDA 2W9BB 1QE1B 4U8VA 3OTDA 3SCLE 1KOHA 5GAEU 4ELUA 4C8KA 1J2VA 2FHMA 2J9CA 1VHIA 4LRDA 1EZZB 2CQ1A 3BQ0A 2Z8QA 3IR6B 1WI8A 3UDCA 1TP7A 4ZVSB 2ALYB 4WTOB 1X4EA 1S76D 2DRBA 3RBXA 3NMAA 1R7IA 1SH2A 1PAUB 4F3OA 4PAAA 4LIRA 1S6QA 4I6WA 4NA2A 5DLGA 1NK5A 3BSOA 2ZHOA 2ZD1A 2AJ1A 4O3RA 4OLOA 3ITHA 1WHWA 4E98A 2B3TB 3LGHA 1EAYC 1R0AA 3ZZTA 3AOCA 1HIYA 3R8YA 3H7HB 3TZWA 4NLSA 4DFJA 4GKJJ 1UCNA 2JWNA 2W01A 4LQ9A 2KT3A 3QO9B 3GONA 1D8YA 1MWZA 1APSA 2ZUGA 3QIPA 1RLCL 1EQMA 3CB4A 5EN1A 4XTTA 2ALZA 1T02A 5J2QA 4PR6A 3MTKA 1AFJA 3NAIA 2VD3A 4RUAA 3BPDA 3BSCA 4QPTA 1Q8BA 3FMWA 1C1BA 2QYCA 2HZAA 2MJUA 3WC0A 2HHHF 2RF2A 5ETVA 1FESA 2KXFA 2KZZA 8RUCA 2DXFA 3CCVS 2MZQA 2C1EB 4M8LA 3OVAA 4L73A 5G0RA 4IYQA 4Q8FA 3THTA 3O44A 1IBLF 5ETLA 2MTLA 4B3RJ 3TO8A 2DHSA 2W9AA 1HBUA 3WC2A 5DDPC 4WFYA 1KSPA 1HNVA 4PKDB 4OX9F 2BUNA 4F4WA 1S1WB 2YX7A 5KFNA 2FVSA 4V1Ak 3D6FB 1Q16B 2UVWA 2NPFA 3KLFB 5DDQC 2GVDB 1U45A 4ZITA 4AL7A 4HI1A 1R8HA 3R5JB 1VQSA 1WTBA 1YZ6A 4DR4F 3EDQB 5IT4A 3RGIA 2B51A 1TKZB 3FBFA 1SV5B 4C97A 3M6XA 1HI1A 1M5KC 4UQGA 2XS7A 1NSQA 4EZ9A 5KFFA 3IBWA 4ZVRB 3UDVA 1RT2A 4OX8A 5HMZA 4DU8A 4DXLA 3A3NB 4Q7AA 1U2CA 3OFGA 5CYMB 2EKYA 4RBUA 3NS6A 1F2GA 2DNHA 2HQDA 4A8YA 3LP1A 2DT9A 4NZ7A 1X4AA 1QVFR 1TUWA 1Y5IB 4C11B 2FQQB 3D7SB 1NDPA 3A8JA 4GO5X 2Y0BB 3HHKA 1L3VA 3ETOA 2AWZA 3ZZZA 5F8IA 2A0FB 2RU3A 1PO6A 2F8MA 3CCQS 2KG1A 2DCLA 4C8MA 4ZPVR 2EKNA 4O3OA 1HQ2A 1B64A 2FY8A 1XQIA 4NE9C 3MEGA 5K9FA 1EETA 3OL9A 1IWAA 1Y9OA 4A4JA 2UXBF 3HLUA 1TL4A 1FE4A 3MMCB 3UCZP 3Q8QB 1NK6A 4J9QA 1DQAA 3N4WA 2ERRA 2ACMA 1KP6A 2ZKTA 1TKTB 4W90B 3QLHB 4F0MA 1T94A 4U8YA 5K8OA 2B5JA 2CZ9A 3FKBA 3ULHA 4NMXA 3IR5B 3TAMB 2DR6A 5E41A 5I42B 4YS2A 2MGZB 2R9LA 1VISA 2F4FA 1X4GA 3FBCA 3AH6A 4IG0B 2XGQA 4EMDA 2ZM6F 2YVSA 3GFXA 3KUGA 4ZJOA 4OYBA 1SC1B 1TFWA 2CRLA 1TL1B 3POTB 2XLIA 3BEGB 3KLGA 2WCXA 3ET6A 1YKWA 4KGKA 1F0XA 1XJWB 4C3LA 4RBVA 4O0NA 7FD1A 2DRDA 5ETRA 5E3AA 3MDFA 1HI0P 4JI8J 1URRA 1FDNA 3HSJA 4ZP6A 1RT4A 3D3BJ 3QIDA 3CMES 1NEEA 3FFIB 3LOUA 2FGCA 3HHLA 2OPRA 3K5NA 4O3SA 2RDJA 3CDUA 2MSSA 2R2TA 1TL7A 2B9EA 5HI7A 3V4IA 3QATA 3M8ZA 3W8GA 3BYRA 3HHDA 4CO0A 2GW8A 4PWDB 3NNHA 1PSDA 4F4YA 2U2FA 3HHLC 3PW0A 2UV8A 4URQU 3J81Y 4NCBA 3HZGA 4ZIVA 2ZNZA 4U7UD 4MFBA 4KC5A 5T14A 5CXTA 2EWHA 1JQGA 4ZCKA 4NEZA 2FPHX 4GKKF 3D28A 2W7OA 4X4SA 4CLSA 2X1AA 4K4SA 1RT7B 1T9XA 5HBMB 1FX4A 5THWA 2WW4A 1ZOTA 4CQ1A 4PYAA 1Z1ZA 1JKHB 3FEYB 2MKIA 3DOMA 3AODA 4LFBF 1VRTA 1VR6A 2VF3A 2I38A 4USIA 1OYEA 2PE8A 3D54A 1G7CB 2AJ2A 1VJQA 2VODA 3KJVB 2WSFC 2JHEA 4N8NA 3UI3A 2BEFA 2RU9A 4ED0A 2XEXA 4EI2A 3H5UA 2YH1A 4ZPCA 2HS3A 3K5MA 1KDNA 3C3LA 1IQZA 1N5QA 2HVZA 3K17A 2UZAA 2CQGA 4I2PB 2YQ1A 3IGNA 1TR0A 1SH0A 4NYPA 2IA6A 1FCAA 2IVMA 5I3UA 1U1RA 3FEXB 1YK9A 3UD5A 1LW0B 3IGVA 3OHBA 3QJJA 2E5JA 2DGTA 2VFSA 2PO4A 2D9PA 2CYYA 3ZTOA 3W1YC 1HNIA 3LP2A 1PJ7A 1Q0NA 1HNWJ 1H0HB 4OLPA 2XNQA 1E6YA 1B70B 3MPWA 3AHPA 2LA6A 4KYZA 3VAMA 2C28A 3MM5B 5GVQA 3OXFA 1SQFA 2VOOA 2BE7D 2OPPA 2XM3A 1HPZA 3MMBA 3M2VA 4IOCQ 2KYXA 1DRZA 4BS2A 3JYTA 3PW2A 3BBFA 4PXCA 2VQFF 1LW2A 4JI1F 1QSLA 1TAQA 2ZBIA 2VQFJ 4J9MA 2J6UA 3M30A 4DU7A 2DY9A 3BO2A 3H5SA 1S77D 1DFDA 2O3DA 2VFTA 5DDRC 3P96A 1CJKB 2WVFA 2IA0A 3MCMA 1TUGB 3CO9A 1N34F 2XO7A 4OV6A 1X9MA 2JEJA 3K89A 2EFGA 3MEEB 4B3SJ 1UZHA 1BGXT 2G1HA 2Z2YB 1N34J 3CJ4A 4Q44A 2JSXA 3BV8A 4LR7A 3OSPA 3S01A 3UVJB 3IM9A 2IRYA 2X7IA 1ZPVA 5DRKA 5DG8A 2CG4A 2R3VA 1VRUB 1J5EF 5HROB 4JV2A 4OJHA 3DM2B 1F1BB 3SYZA 3QJLA 1X60A 4EBCA 4I6AA 2BACA 3K0JA 3FUYA 1HLWA 4H54A 4C4WA 3IRXA 2IRUA 4Z7CA 5DM7Q 2BJ3A 2SXLA 2BVZA 3C14A 3PIOQ 2YWHA 4Y2IA 4ZPWR 1XNRF 4KTQA 1VC6A 2GVZA 3QGGA 1IN0A 2CQ3A 1XNRJ 2FVPA 4JI6J 1FERA 4F2RA 1RABB 2KHDA 3DRSA 2K06A 4K2XA 3EX7B 3LAKA 3ZC4A 1WACA 1V3SA 1LWFA 4DR2F 4DCJB 2E66A 2GJIA 3RRHA 3TR5A 1HBMA 1MMDA 1S1XA 4PG4A 2Y1LB 1VK3A 2P9EA 4C0BA 5D0EA 3ENQA 3PO5A 4RU2A 2M88A 1CULA 2AYMA 3WHIA 1RHJB 2HFZA 3PHEA 1V3ZA 4ZVOB 2BE2A 2ZOGA 3QRPA 2LU1A 3TQEA 1FA0A 2OEMA 2JVRA 3CEDA 1C1CB 1V5VA 4DUTA 3QGPA 3MPYA 4X66J 4YR2A 3VR1A 2IJNA 4I2QB 2D3OR 1R6YA 1M90T 4IFVB 2X51A 3GCXP 2MQPA 1OS5A 4NI2B 1ZA2B 5EHHA 2AZ1A 2FC9A 2AT1B 4KHMA 2LQBA 2E9TA 3TUJC 3MECA 1V9OA 1J5OA 3W2VB 3LAMA 2R4FA 3KOAA 1KRPA 2MXYA 2ZHBA 4IRKA 1M5VC 4DSKA 3E51A 1FT8A 1XIQA 4ECQA 1VMBA 2ADBA 5IC6B 4JV1A 4PXBA 3ENWA 2D3ZA 4FVCA 3C8YA 1K73T 2LXFA 2W25A 1T03B 2HIQA 3NL0A 3NS7B 2EK6A 4PPDA 1FJEB 1Z2ZA 1TK5A 2HRUA 3OQ2A 2Z4PA 2ZNYA 2W9BA 1QE1A 4ELVA 4CO4A 1JJCB 2AF6A 2OELA 4RW4B 2QA1A 4ID8A 3ENAA 4CCHA 1KEKA 3M1VA 4WYWA 4P71A 2W7PA 3W5YA 4NLQA 2F7VA 5D6GA 4H4MA 1NM2A 2MQQA 1DY3A 5C24A 1FXLA 4YB7A 5CZVA 2RJZA 3G82B 4HTJA 3MR6A 1WHYA 2UUAF 2RKIA 2C2KB 2EPIA 4WTYA 1TELA 2UUAJ 2EI5A 1NPPA 3QT8A 1P6TA 1SC4B 1DARA 2C2MB 1PILA 1YRUA 2CKWA 5E5NA 4P10A 5KG0A 4DL6A 3PW7A 3L09A 3O3LA 1RWVB 1AUDA 3RRKA 5B0CA 4DN0A 1O0PA 1NPRA 2HWHA 1MWQA 2BM1A 4IDKA 2R7RA 3CMQA 1TZ0A 3H2LA 1UP1A 3CXCR 3MM7A 1NZ8A 3UQSA 4YFUA 4HYKA 1WKKA 2XMWA 4QYZJ 4FYVB 5D4OA 5AE3A 5EX0A 4RW6A 3DI6A 2UP1A 1QM9A 2J8SA 4JP8A 2RVJA 3MWBA 2OH2A 4DR7F 1HNZJ 3R7BB 2IRXA 4WBFA 5JUMA 4EU0A 2GHVC 4KKOB 4NPOA 1Y11A 2LXIA 4LF8J 3EPIA 5E3PA 4Q0BB 1TKDA 4TU7A 4USKA 3IG1A 2H4YB 4PYDA 4N56A 1P1LA 4WJBA 2FJDB 3I56S 1L3UA 2DXEA 1RWXB 2HBYB 2FLPA 4JI4F 3R7SB 5KG2A 6FD1A 1FEHA 2DGXA 2MY7A 2HVDA 4OZJA 1RTIB 1Q7YT 4X4NA 3SBMA 3DOLA 4URGA 2HG4A 1N88A 1PC5A 1TAUA 4JV5J 2HWIA 5HANA 3BBCA 4OZ0A 4DZ6A 1UA1A 1U4BA 1J27A 2VG5A 3KUHA 2GO8A 1HARA 1K1QA 1FF2A 4O3NA 1O5JA 4OYAA 3BSAA 3OUYA 1NU4A 3ZZOA 3RZAA 5A6PA 3SDEB 5EX3A 2WB4A 5J1NA 4FS1A 2F4VJ 2ZBCA 5BR8J 5HK4A 1WC1A 2LFVA 2J8AA 2A2CA 3PFOA 3D66A 2AEJA 3E01A 5HVFA 2EW9A 3DYAA 3EVWA 3SCJE 3HXMA 1ZETA 3DXBA 3QWPA 2F5GA 5CQGA 3T5JA 2YWGA 4DQRA 2H51B 1NZAA 2DJWA 3GIMA 2KJVA 1RQ0A 4UY85 3BQ1A 1JX4A 3IR7B 2AYBA 2FC8A 3BR8A 2DIVA 3RBDA 3TVKA 4MKAA 3NBPB 2BYCA 3DLKB 3N9UC 5E3CA 4G1QA 1ACMB 2BJEA 4FXWA 1NRKA 3SXLA 2CQBA 3MPUB 4C7QA 1RT3B 1F3VA 5LL6d 4ATNA 3ONQA 5G4DA 1XEZA 1EARA 3AXMA 4WP3A 1RSCA 2WVEA 3EVOA 4YHHF 1TKTA 2EXUA 1WEYA 4LF7F 4ZHRB 1UFLA 2R8GA 3SMZA 3I96A 3MCOA 1HYSB 2GS8A 3V6DA 2JL9A 4DOZA 1R43A 2CQ2A 2AEFA 5A2QU 4F50A 3RB0A 4OYOA 5J2PA 3NOCA 5A8KB 2MZJA 4NLXA 1VIXA 2IYGA 4MT1A 4IH6A 1RHUB 3TI0A 4D3GA 2DHGA 3CSKA 4AT1B 4TQSA 1HWJA 1YJ9S 2ASYA 1YHQS 2LYVA 2JC0A 2M7SA 4IRDA 2BRKA 5EDWA 3GG0A 3KG4A 3DDKA 1MN9A 1NBEB 2BM0A 4J9OA 2WTFA 2DGOA 4RUHA 3HVAA 3OXLA 1D9AA 3M8PA 5CABA 2HHVA 4MIBA 3GZ7A 2FIUA 2JEIA 4KE5A 2LLZA 3IP0A 4RO0A 4AQYF 3R5GA 2RE1A 1LWEA 4AQYJ 3RW6A 4HI2A 3DLGB 2XSFA 3N79A 4KH1B 5DDOC 1EIYB 2W4CA 4NRUA 3PRBA 3AD7C 4U7CA 6FDRA 1VQ5S 2LQ5A 3CIZA 1MW7A 2VPZB 2DIUA 2UVRA 4J9NA 2K3KA 2DNOA 1FK9A 3HHLD 3VAFA 3TOQA 5IWAF 2EFVA 2CG8A 2VONA 5F41A 1GMVA 4CH7A 1GXLA 3DHXA 5T7LA 4JI3J 3THVA 1REVA 4M5GA 4LF4F 2XSJB 3BJYA 1ITPA 2V2ZA 5LMNJ 4PXDA 4AL6A 1R8AA 3HT0A 2KVIA 4PABA 5A0YB 1G1XA 4ECTA 4OIXA 2VASA 2ZH4A 1RHKB 4ZKAA 3NP5A 3W9HA 3J7YU 2FLOA 1RA6A 1ZPWX 1H7WA 3KNAA 5E2QA 2YKAA 3NY0A 4FF4A 1IR0A 1NH8A 1XTZA 2N4CA 3CCTA 1RLDA 2C3UA 2IM3A 2WK4A 4LRFA 4LRCA 2F8EX 3U02A 3DRXA 2GIFA 3QGIA 2KT5A 1FKPB 1HMVB 1H74A 1S59A 1T9WA 3M6VA 1IKVB 1SVDA
chains in the Genus database with same CATH topology
4NL5A 3FSYA 2ZH5A 1P1TA 2G9OA 1IM4A 1KNZA 3GR1A 4TU9A 2FJXA 4ZP7A 1H38A 2RD5C 1KQFB 2KO1A 1O51A 2CJBA 2CPIA 2JRSA 3C6TA 3CD7A 1F5BA 3KHHA 2CJAA 4KKOA 3ISZA 4O44B 3V2UC 4ES3A 2RQKA 1U1KA 1H98A 4ZP9A 4JYAF 4ES1A 3WZ0A 3OL8A 2VBYA 2LECA 3IWNC 3HX9A 5AXKA 2GX8A 5IT0A 5F8HA 4KPYA 3CJ0A 3K5LA 3DOKB 2IM1A 2MQNA 2V4JB 2LMIA 2DGQA 4MK7A 4PG6A 2AV5A 1OO0B 1U7LA 2W4DA 4Q0BA 7FDRA 1UVLA 2R7VA 2W4PA 4DS4A 2J0XA 2ZE2A 1TVRB 3T3FA 3V5RA 1HI8A 2AYGA 1ZH5A 2O01C 1SB6A 2RMLA 4CO5A 4B9UA 2OFHX 5L1JA 1VQ6S 2EG1A 4AFFA 4ICLB 2IFXA 3P5TL 1JLAA 4ZK7M 1YITS 3KLGB 4LIWA 3I5CA 3C46A 4I68A 1Q1KA 1D0EA 4B17A 5KAKA 2KKHA 1N5TA 2O5DA 1JLFB 4QWBA 4WF9Q 2HMIA 4NCGB 3MAHA 3D1OA 2JLGA 1AROP 1S1TA 2H9ZA 3NMRA 2EFNA 3C6UB 2ZZMA 5F8GA 2JFDA 4PXEA 4BCAA 2DGSA 1NJXA 4PRFA 3G6XA 3BSNA 1D1UA 4QIWD 1RTIA 1RT6A 5K5MA 4J37A 2MKJA 2WBRA 3CJ5A 4Y6IA 5KFRA 3MM5A 3PKYA 2I9SA 2EFOA 5A8RA 3MFIA 2C2RA 2HRYA 3LWMA 3JSYA 3S6EA 3H8YA 4YB5A 3PM9A 3AB4B 1KR4A 3H59A 2LKZA 3CCWA 1QE1B 2C3MA 2W9BB 2GHPA 4KAIA 3KHLA 3OTDA 4ZVHA 3SCLE 4U7UK 1KOHA 3S7RA 1SL0A 5KFIA 3HKWA 5GAEU 3HHLB 4ELUA 4C8KA 1J2VA 1XR5A 1OPIA 2FHMA 2J9CA 4C0OC 1WTFA 4QZVB 2YKPA 4O4GB 2OPRB 2V0NA 2CQ1A 4UQTA 4MIWA 3BQ0A 3NCRA 3MM8B 4TNOA 1XBWA 2B7CB 4RNFA 3EGZA 2Z8QA 2GGPB 1ULRA 3IR6B 5D4LA 1WI8A 4HH1A 1WF2A 3K5OA 2M2BA 3V4IB 4DSIA 3UDCA 1BD6A 1UWBB 4EEYA 2F9DA 3SDEA 2XI3A 2ZH3A 2OJ3A 1TP7A 1VIOA 3EGWB 2HNDB 1VHFA 2ZH7A 5CHCB 2NLWA 1X4EA 1S76D 2DRBA 1TFYA 2IMWP 1RAJA 3DLHA 2MKSA 1C4AA 4KBIA 2KFZA 4TN2A 4F2SA 3NMAA 4G3IA 2GO9A 3KLEB 1R7IA 1SH2A 2C2EA 4LSLA 3AY0A 3IC1A 3KNGA 4F3OA 5F0UA 4QU7A 2JH3A 3EUNA 2YWKA 4DL2A 2RRAA 5D4NA 4DDFA 4LIRA 4WXOA 1S97A 2Z0GA 2CPJA 5D3GB 2PT0A 1U1OA 1S6QA 4I6WA 2N82B 2R8IA 1ZZNA 4WZMA 4Y0FA 1TKXB 4KIAA 4NA2A 4U9RA 5DLGA 2JC1A 1NK5A 3FQKA 1SXLA 2FLLA 2YNIA 2ZHOA 3BSOA 4FNHA 3T6JA 2ZD1A 2AJ1A 3TUIC 1YTYA 4O3RA