4IDKB

Hiv-1 reverse transcriptase with bound fragment at the 428 site
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
412
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 114
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4idkB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB03
1LWFB 2FLLA 1HYSA 3I5BA 1OS5A 4JUZA 3KHGA 3M8QB 1S97A 3M9MB 1LW0B 4RW4A 3OLBA 3CIZA 2FJXA 5DLGA 1C1CA 4IRKA 3TQ1A 4MFBA 3GIIA 4TXSA 4O3SA 2YKMA 1JLGB 4RNNA 3RAXA 3T5KA 4F4XA 2IC3B 5K14B 1N56A 5KFEA 1TVRB 5C25A 2O5DA 4EO6A 3GV5B 2FLNA 1HNVB 1HNVA 1QE1B 5KG5A 4KV8A 3PHEA 2WCXA 2C2EA 1S0OA 3MEGB 2FVSA 5KFDA 3IG1B 4ICLB 1TKZA 3Q8PB 4J9OA 5HLFB 3IG1A 2IM3A 4RNOA 3T5JA 5HLFA 2AX0A 1RA7A 5KG7A 4KO0B 3V81A 2AWZA 2GC8A 3OHAA 3PW5A 4KO0A 2ZE2B 4G1QB 5KFYA 1HQUA 1S1TB 2IM0A 1S1TA 4ZVGA 3CJ0A 1MU2B 1IM4A 1MU2A 5KFHA 1QUVA 4MIAA 2XGQA 2DPJA 4IH5A 3H5UA 5L1JA 1EETB 5KG0A 3DOKB 4H4MB 4DL2A 4Q0BA 3DMJB 2XC9A 3KMSA 1HMVB 2JEJA 3SFGA 5J2QA 2W9CB 5KG2A 5KT3A 1C0TB 3MECB 2W9CA 3DI6A 4R8UB 4DL7A 1C0TA 3CDEA 4IOBA 4R8UA 1HNIB 3BGRB 5CYQA 1HNIA 1J5OB 3BGRA 4KKOB 2V0NA 4KKOA 3KK3A 3KHLA 5L9XA 2FVRA 4J9PA 2AX1A 4WXOA 4EYIB 3H2LA 1IKXB 4ECTA 4ECWA 3QLHA 3V6JA 4IFYB 5DLFA 1VRUB 1S49A 5KG3A 4Y2CA 3BJYA 1VRUA 4KSEB 4I2PB 2DPIA 4IG0A 4I2PA 4JV1A 3LANA 3QO9A 1LW2A 1LWEB 1K1SA 3RB0A 2OPSB 4MH8A 1LWEA 3H4DA 3QIPB 4NLQA 2OPSA 4Q8EA 3Q8QB 1XR6A 3QIPA 4YMEA 4ZP6A 4WZMA 2OPQB 4J9SA 3NAIA 2OPQA 2FVCA 4J9LA 3UDLA 5DQGA 5DQHA 5D3GB 4NCGB 1TL1B 4K4VA 2R2RA 4NCGA 3DRSA 4GC7A 1RT1B 5J1EB 2BQUA 2AU0A 1RT1A 1RYSA 3HVTB 4I7FB 4ZVFA 3C6UB 3JSMB 3JSMA 4ZHRB 3OL9A 3PJXA 2IM2A 4O3OA 2W7OA 4EO8A 1RTJA 4RW8B 1QAIA 3FDSA 3BSOA 2OH2A 2AQ4A 4EBCA 1JLAA 4XO0A 4KHMA 5KFCA 1T05B 1FKPA 1T05A 4MK9A 3SFUA 2BE2B 1UWBB 4OL8A 2HNDB 2BE2A 3NBPA 1U09A 2WRMA 2ZD1B 1JLEA 4NLSA 4U6PA 3MEEB 3MF5A 2UVWA 4J9QA 3MEEA 4NLWA 4TYAA 2UVUA 4DL4A 4JV2A 2OPRA 2R2UA 4ECXA 2D7SA 3KMQA 4WZQA 5KFBA 3CDUA 2I5JB 4ZP8A 2W9BB 2BR0A 3KLVA 2I5JA 2D3ZA 3DM2A 2IAJA 2BQ3A 2W8KA 2ILZA 3CVKA 3T5HA 3GV8B 4ED3A 2JEGA 4O3RA 2WK4A 3ISND 1TKXB 4NYZA 5C24A 4RNHA 1TKXA 5L1IA 3PJWA 5J2PA 3G6XA 2R8JA 4QWBA 3MEDB 4IKAA 1RT4B 2RDJA 4U7CA 3MEDA 1RT4A 3Q8SB 4TQRA 4RW6A 2WONB 4H54A 2WONA 3PW2A 1DTTB 3V4IB 1GX5A 5I42A 5KFGA 4X2BA 1DTTA 1S1WA 1XR7A 4QWCA 1S4FA 1XR5A 3ICLA 3PR5B 2IMWP 4K4ZA 3KK2B 3V6HA 3I5CA 2WOMB 4K4TA 2V9WA 3NMAA 1C0UA 5KG1A 3HVWA 4MIBA 4NRUA 1RTIB 3V6KA 1LWFA 2F8EX 4ECRA 1RTIA 4O3PA 3H40A 2R8IA 2YKNB 4RW7B 1NNDA 2YKNA 3M8QA 4RW7A 2ILYA 4NLVA 4TY8B 2IJNA 4TY8A 2ASDA 4WE1B 3DOLB 3KLGB 1LW0A 2UUTA 1JLFB 4WE1A 3KLGA 4TYBA 1FKOB 1JLFA 4ZP7A 1FKOA 3DRRB 1RYRA 4B3OB 3NAHA 1JLBB 3DRRA 5KFXA 4B3OA 3RBEA 3NGDA 4MK8A 3KLEB 4RUAA 1HQEB 1JLGA 3QIDA 4XPCA 4WYWA 4IH6A 2IC3A 5K14A 3GYNA 2B6AB 4NLRA 1TVRA 4GC6A 2D41A 2RF2B 4H4OB 1W25A 1QE1A 1IKWB 2W8LA 3PZPA 1IKWA 3I0SB 3MEGA 2R2TA 3I0SA 5DG8A 4IR9A 4ICLA 4WFZA 4DL6A 5I3UB 3UQSA 2IA6A 5KFUA 4ECSA 1SH3A 2ZE2A 4G1QA 5F8MA 4Q45A 2RKIB 3RB3A 2RKIA 2UVVA 3H98A 4MK7A 2YNFB 4WYLA 3CWJA 4JV0A 1C2PA 2XGPA 1R0AB 1R0AA 3DRPB 4NLPA 3EPGA 4ECZA 3HHKA 2HNZB 4I2QB 1JKHB 2HNZA 1KLMB 5C5JA 5KT5A 2AGQA 1JKHA 1EETA 1KLMA 1S1XB 2XCAA 1ZTTA 1S6PB 1JIHA 1LWCB 1S6PA 3DOKA 4H4MA 5KFZA 1K1QA 1LWCA 1RTHB 3DMJA 2JC0A 1HMVA 3IS9B 3LAMA 3T5LA 3G6YA 3DLEB 1KHWA 3MECA 3DLEA 3EZUA 2HNYB 4ED1A 3PVXA 2E9ZA 3NL0A 2HNYA 3KJVB 5KFTA 4IH7A 4NLXA 4ZPCA 1J5OA 4YR2A 5KFAA 5KFMA 4G3IA 1N5YB 3E01B 4IDKB 4KFBB 3NKYA 4RUCA 4KFBA 1N6QB 4ID5B 1T3NA 5CYMB 1N6QA 1IKXA 2WTFA 3SI8A 2J6TA 4IQXA 5F8JA 4IFYA 1HARA 2B5JB 3T19A 5F9NA 2ZKUA 3RAQA 2B5JA 2R8HA 3ITHB 5DQIA 5KT2A 4ZPBA 3FQKA 1S48A 4LSLB 3IRXB 4QPXA 3PW4A 3IRXA 5J2MB 4QW9A 5J2MA 4YP3A 2HMIB 1TL3B 3LAKA 4YR3A 1TL3A 4ZPDA 4QWAA 3MR6A 5KT6A 2VG7B 5D3GA 1TL1A 1S0NA 2FJVA 5J1EA 2WHOA 3HVTA 4I7FA 1S6QB 3C6UA 1S6QA 3OSNA 4ZHRA 4R5PB 2AGOA 4R5PA 1GX6A 5FDLB 4RW8A 4O44B 2D3UA 5F8LA 2IJFA 5JXSA 2YNIB 2ATLA 2BANB 3KK1B 2JC1A 2BANA 3KK1A 1T94A 3H5SA 1ZTWA 2IM1A 4HKQA 4KAIA 4QWDA 1S1VB 1DLOB 1UWBA 3JYTB 2HNDA 1DTQB 1NHVA 3I5AA 2BRLA 1DTQA 2ZD1A 2HWIA 3FFIB 4IR1A 1MMLA 2JLEA 2UUWA 1TV6B 1WNEA 4NRTA 4ED8A 3H5XA 1TV6A 4DG1B 1N4LA 4ZVEA 1RT6B 4DG1A 5EUHA 5KFWA 1S9EB 2W9BA 4J9KA 4PUOB 3LALA 5KG6A 1C1BB 4PUOA 4ED2A 1TKTB 1C1BA 2B43A 4URSA 5KFIA 1TP7A 1TKTA 1I6JA 3Q8RB 2BQRA 3MR2A 1T03B 4PQUB 5F8NA 4EEYA 3KLHB 4PQUA 4K4WA 2RDIA 4M95A 1S9FA 3CJ2A 4NLDA 3CO9A 4DEZA 4Q43A 4J9MA 1RT2B 4NLOA 1RT2A 1SUQB 1SUQA 3V4IA 1FK9B 2QV6A 3LP1B 4TY9A 3GV7B 4KE5A 2VG6B 3DLKB 3KK2A 2I1RA 2YNGB 2WOMA 2VG6A 3DLKA 3M8PB 4NLUA 2YNGA 3PR4A 3BQ1A 2XCPA 3M8PA 4F50A 4FBTA 3CJ5A 3KLFB 2OPPB 3N6LA 4KBIA 1IKYB 1N48A 3BSCA 1IKYA 4PWDB 3RB4A 5KFNA 4ZPAA 5KFOA 2C28A 1KHVA 3QGIA 5F8IA 3GILA 3DOLA 4HYKA 5DG7A 4LSNB 4Y3CA 1BQNB 4O4RA 4LSNA 4RNMA 4EBEA 3M9NB 4O4GB 2YNHB 4K50A 1JLBA 4EYHB 3RBDA 5T14A 1RT5B 3KLEA 3QZ7A 1HQEA 1RT7B 1RT5A 1RDRA 3OL8A 3G6VA 5L1LA 1RT7A 4Y34A 5DG9A 5DGAA 3KOAA 2XI2A 2B6AA 1HYSB 3N6MA 4NLYA 2RF2A 4LQ3A 4H4OA 3H59A 1S1UB 5JUMA 5KFJA 1S1UA 2W9AA 3BQ0A 3OL7A 2FLPA 3FSIA 2VA2A 4RZRA 4RW4B 2CJQA 3G86A 1C1CB 4FS1A 4M94A 5KFRA 4F4YA 3D5MA 5I3UA 4ECYA 5HBMB 5KFPA 3H5YA 4MFBB 5HBMA 1RT3B 5L1KA 3DLGB 1RT3A 4NLTA 2YKMB 3DLGA 3E51A 4KB7A 5DGBA 1S0MA 2YNFA 1JLCB 2BRKA 4WFXA 3M9OB 3CJ3A 1JLCA 4IG3B 5C25B 4IG3A 2HAIA 3DRPA 2V4RA 3CJ4A 2ALZA 4KV8B 1BQMB 4K4YA 3FRZA 3HVAA 1BQMA 2XI3A 4I2QA 3QGGA 4J9NA 2R8KA 4Q8FA 1TKZB 2WB4A 1S1XA 5KFSA 5KFKA 3V81B 5EDWA 3MTKA 4DL5A 4ECUA 1RTHA 3OSPA 3IS9A 3DDKA 1HQUB 3GIKA 2IBKA 3IN5A 3KJVA 1D0EA 3QZ8A 3IGVA 1S9GB 3V6DB 1S9GA 2FVQA 3QGHA 3V6DA 1N5YA 3E01A 1EP4B 4IDKA 3HKWA 1TQLA 3N6NA 5KG4A 1EP4A 4DL3A 4TLRA 4WFYA 2GIQA 4ID5A 5CYMA 4IFVB 3BREA 4F4ZA 4IFVA 3RB6A 3EPIA 3ITHA 3KLIB 3MR5A 2J6UA 4Q0BB 3D28A 3KLIA 4FS2A 4Y2AA 3GIMA 4ECVA 4K4UA 4LSLA 1RA6A 5J2QB 3TVKA 1RAJA 3DI6B 4ED0A 3OL6A 2HMIA 5CYQB 2CKWA 2HWHA 3KK3B 3FQLA 4ZP9A 3OHBA 5KFQA 2VG7A 4FBUA 2JEIA 2R8GA 1HPZB 2AGPA 5EWEA 1HPZA 1QAJA 3TAMB 4O3NA 3LP2B 3QLHB 4ZVHA 3TAMA 3LP2A 3UR0A 3MR3A 5KT7A 1ZETA 2VG5B 2XWYA 1CSJA 4IG0B 2VG5A 3T1AA 3QO9B 1NHUA 1LW2B 5FDLA 4O44A 1SH2A 4K4XA 2YNIA 5HP1B 4RNFA 5KFFA 1JXLA 5HP1A 3QYYA 3PW0A 4K4SA 1S1VA 5J2NB 1DLOA 3JYTA 5J2NA 3H4BA 2JEFA 3DRSB 4WXWA 4ZMMA 4F4WA 4IRDA 3FFIA 2VA3A 4ED7A 5KFLA 2ASJA 4TN2A 1RT6A 1JLQB 4QW8A 1RTJB 3KHHA 1JLQA 1S9EA 4URQU 1RTDB 1JLAB 1YVFA 3BR9A 1RTDA 3BQ2A 4TQSA 4XPEA 1FKPB 2E9RX 3KNAA 4NLGA 2ASLA 1T03A 3DYAB 3NBPB 3KLHA 3DYAA 1JLEB 4ECQA 2FJWA 3LP0B 4YR0A 2OPRB 3LP0A 4MKAA 2C22A 1FK9A 4NZ0A 1REVB 1SV5B 3CDWA 3LP1A 1REVA 1SV5A 3GQCA 3DM2B 2IAJB 3UPFA 3I0RB 5EWGA 5EWFA 3I0RA 4MKBA 2C2RA 5HROB 3KLFA 2OPPA 5F8GA 5HROA 5C42B 4LQ9A 5F8HA 5C24B 1SH0A 3BSNA 5C42A 5KFVA 3ISNC 4J9RA 4ED6A 1JX4A 5J2PB 2R2SA 4PWDA 4QWEA 2C2DA 4R0EA 4URGA 3GIJA 4Q44A 4YQWA 3VQSA 3IGNA 3C6TB 4RW9B 4RW6B 3C6TA 5F9LA 3OLAA 1IKVB 4RW9A 4RU9A 3MFHA 1Z4UA 2EC0A 1IKVA 1BQNA 4O3QA 1D1UA 4KHRA 5I42B 2E9TA 4O4GA 1S1WB 2YNHA 3MFIA 2GIRA 2J6SA 5KT4A 2QE5A 1VRTB 3PW7A 2UVRA 2W7PA 1VRTA 1S10A 3BSAA 3KHRA 2V4QA 1C0UB 4EBDA 2FVPA 4IRCA
chains in the Genus database with same CATH superfamily
3QAEA 3LH2S 1LFPA 2VONA 3M30B 3S6EA 1ZA1B 1O51A 1JQGA 4CLZA 2EKNA 2LLZA 1NZ8A 4UZBA 4U67Q 2WCXA 3I6PA 4PAAA 3MEGB 5ETSA 4ICLB 3V81A 3O8WA 2GV1A 4HT7A 3TUIC 3Q83A 3BZQA 1GEHA 2XGQA 3EYZA 3H5UA 4HACA 1KP6A 4FVCA 4L73A 2FHOB 2Y0BB 2DNKA 3JQMA 3C15A 3D67A 3HVRA 1LW2A 4DR2J 5CHCB 2VJVA 2DGTA 3Q8QB 3QIPA 3RR7A 2V67A 2XYPB 4P7TA 1EQ0A 4YB5A 1RTZA 1HWKA 5KFCA 4DV1F 1ZBTA 4NLSA 4U6PA 1RZMA 4OYMA 4DL4A 2R2UA 3DN9A 4ZLNA 3KLVA 3VV2B 4NMLA 3ZNJ1 2CYYA 3RAMA 2W1BA 3K8VA 1XJWB 3MEDB 1X0FA 1UVLA 4F2RA 2WONA 8AT1B 4QWCA 5A2QU 1WC0A 3I5CA 4DR5F 2HHWA 1RTIA 2YKNA 4KYZA 1DHMA 5LMUJ 2X1GA 3MHYA 1JLBB 4ZVOB 5BR8F 4HTIA 4Y0FA 1WTFA 4IH6A 4GC6A 4NLRA 1PC5A 1RAEB 2R2TA 3I0SA 2APOA 1RHRB 2XSJA 3CWJA 5CAAA 2VQEJ 4CYUB 2K06A 2RE1A 1S6PB 1FTRA 3IS9B 3DLEA 5LMNJ 4ZJOA 4K2JA 4KFBA 2POKA 4QW9A 3ISZA 4CLYA 4FZVA 5D3GA 2ZNZA 5GMKa 2ZZTA 4K0KF 2HHVA 4CM2A 1Y00A 1T9TA 5BXIA 5A0YB 3CCLS 2V63A 4YY3F 4O44B 3NCPA 1UPPA 2G0IA 3KJQB 1HQ2A 5AE3A 5IQQA 4OHVA 5KFWA 2U2FA 4PWUA 2DNQA 4ZLJA 4OZLA 3T6JA 2NYIA 3UDCA 3B4DA 4Y28C 3T9NA 2PEHA 3LP1B 3BQ1A 3NY0A 2AZ3A 3TQEA 4QR1A 2LEPA 5H9EK 3M6UA 2O01C 1V3SA 5DG7A 1B3TA 2BACA 3U27A 3D54A 4DR7J 3MCSA 1X5OA 3BPDA 1RT7B 4Y34A 1K73T 2XI2A 2B6AA 2NS1B 4LFAF 1U6FA 4H4OA 5KFJA 2VH7A 5ETOA 1MROB 1U1MA 2GW8A 5GADU 3SDEA 4ES3A 3KUHA 2HG4A 1JLCA 4IG3B 2AJQA 4I6YA 3MM5B 4DL0C 4B9SA 1EHWA 1FXRA 1NPPA 1S1XA 2AKWB 4C8NA 2FJDB 1AUDA 2MPUA 4OHWA 4LF9J 3N6NA 3QBCA 4FYXB 3MMBB 1UWAA 3RRKA 1Q7YT 4ZVTB 5IT0A 4OV6A 1CPZA 4DX8H 3GMGA 1LK7A 2E5LF 3ILLA 5LSRA 2CKWA 3CPWR 5B0FA 1HPZA 3CJ8A 4I6WA 4JOUA 4M1KA 3UR0A 1ZYQA 3T1AA 4G6VB 5GAEU 3QYYA 5D8HB 1ACMB 1LQ9A 1F5AA 3GR1A 6FD1A 2VA3A 4A8OA 1ZM9A 4GO7X 4DPYA 1XK8A 3JSBA 1FKPB 2DIVA 1WC6A 4KGMA 4QIGA 2UXBF 3DYAA 2B4UA 1CEZA 1VGYA 2OPRB 1REVB 1F1BB 1HNXF 4NL5A 2A6OA 1YJRA 2PC6A 2P9EA 2HIQA 3T1HJ 3IO1A 4DI6A 1P27B 2GIRA 1OWXA 2W7PA 2JVRA 3K5LA 3VAHA 1N36J 4P2XA 4LIWA 4RW4A 3CF5Q 2BXJA 4KTQA 3SIPB 4OYBA 4DN9A 3M8YA 1TVRB 2B4OA 1HNVB 3M1VB 4KV8A 4U9RA 3CCZA 3FZ2A 2W4DA 2H1YA 4OX6A 4ILRA 3UCZP 4C3MA 1IM4A 2DGVA 5HN0A 3H25A 5KG0A 3B4MA 1KD1T 3A1YG 4LREA 2JEJA 4PQAA 4R8UA 3E3XA 1R43A 3H2LA 2GVDA 1IN0A 2XG8A 1NDCA 2I6WA 5GMDA 4NLQA 2OPSA 1XR6A 4YMEA 2OPQB 4DHVA 4USMA 2V8VA 2QA4S 3KUGA 2DEJA 2UV8G 4PR6A 4XO0A 2P5VA 4J5OA 4OI4A 3IBWA 1D8ZA 3W5XA 3IBFB 1WHVA 3MF5A 2UVWA 4ERDA 3K0JA 2I5JB 1U0SA 2D3ZA 4USIA 3DM2A 1A0OB 2HURA 1TKXA 3G6XA 1YHQS 1D09B 1GX5A 1VBZA 3BDEA 1UZHA 2RU3A 4C11B 3HVWA 2ZZMA 3UI3A 3MM6A 3E2EA 3M30A 4EU0A 4OIXA 1Y5LB 4DQSA 4OJGA 3MR7A 2R7QA 3H90A 1HQEB 4WYWA 1KKHA 2FJEB 2HQCA 2J0XA 4DV6F 1IKWB 1IUJA 4DFPA 3MEGA 2XHCA 1MLAA 4ICLA 3C46A 1OJ4A 1IBMJ 1Q8BA 4B3RF 4CLPA 1U1NA 1U02A 4HDGA 3HHKA 1UEVA 4WIQA 3M8WA 2XCAA 1VOMA 1SIZA 4A4JA 4ZPCA 4YR2A 4G3IA 2DKOB 4IDKB 5EGYA 2R42A 2WTFA 4NOHA 1HARA 3EWGA 5HATA 1RWKB 3IRXB 2VIHA 3X1LB 4WU3A 2HHSA 4QQBA 2B9EA 3J7YI 4QU7A 4B9LA 4LR8A 2WHOA 1GH8A 3JXOA 4ZIVA 2AZ1A 2G0JA 3GJTB 2ZH1A 2Y8WA 5LXYA 4E98A 3TANA 4ED5A 3TO8A 2HFZA 4KJIA 5KOWA 4DV7F 3GG0A 4NRTA 1K0TA 5M2RA 4WP3A 4X64F 4RWXA 5KG6A 4Y2IA 4OYWA 1TP7A 1H0HB 2K2PA 2R4FA 3AAWB 4Q43A 5M2PA 1UZDA 4KPYA 4B3SF 2GMLA 2VASA 3CMQA 3N6LA 4LUBA 4N76A 1IR0A 4KBIA 3BSCA 4I69A 4MMOA 4DSLA 1AT1B 4O4RA 2CVIA 1LFWA 1JLBA 3RBDA 1RDRA 1URRA 4NLYA 3H20A 1KR4A 5JUMA 1X4GA 3O2IA 1E6VB 1L3VA 2HS3A 2GJIA 3E51A 5ADZA 4WFXA 3I9V9 2HVDA 3AQOA 3VAFA 4JI7J 4UTGA 2LDYA 1X5TA 4CYUA 3IS9A 3HJVA 4A46A 5GAGI 1G1XA 3BN7A 4KR0B 3R7SB 3QRRA 3HKWA 3X3UA 4F4ZA 3PRDA 3TVKA 2KT3A 2OO4A 2E7VA 4ZOSA 2R7SA 5HQ8A 4A8YA 4N56A 4O44A 4K8RA 1FRJA 5KFFA 2G2YA 1UA1A 3MMAB 1KOOA 1JWWA 5DS7A 2EPIA 3SMZA 4P71A 2N82B 3CCMS 2CJ9A 4USWA 5F0WA 1JJCB 2ASLA 1HD0A 4NMXA 2F5GA 3R5CA 1VQOS 3QT6A 4OV1A 3UD3P 3LP1A 3GQCA 1YBTA 5EWGA 1W7WA 1VC5A 2KJWA 1PSDA 1IJEB 1PO6A 1IBLF 1PAUB 2DH8A 2MSSA 5CABA 2F63A 4RBUA 4O3QA 5I42B 2E9TA 2J7UA 4ILMA 2V4QA 4EBDA 3DCAA 2H51B 3M8QB 2OUGA 2V5HG 2VOPA 5ETTA 1LW0B 3CCUS 2QMWA 4QOTA 1U49A 2OMLA 2PMHA 4LF1A 1EKSA 3MM5A 4B08A 2ZZNA 3TNVA 4KO0B 3UN5A 2VJUA 2N4DA 2DIUA 2HQIA 1VJQA 4CIOA 2E1CA 2UUBF 4NCAA 2RRNA 1D8YA 1U45A 3MMBA 3QWPA 4H4MB 3BO2A 3DMJB 3FBEA 1MWYA 3QATA 5KT3A 3BGRB 1RE1B 1RHKB 1KSPA 4B3TF 3KHLA 1ZOTA 3Q0AA 1IKXB 1EAYC 3R2CJ 4Q8EA 1LWEA 5B0CA 3MUTP 4ZP6A 1KTQA 2CPEA 4NCGB 4K4VA 3IWLA 1RSCA 2EFNA 3PJXA 5DZ6A 2W2OP 4RW8B 2V4JB 1RI7A 2GNKA 3ZO7A 5E2QA 1FKPA 1T05A 2AEMA 5E5NA 2BE2B 4K7QA 2HNDB 1RWUA 3CJSA 2ZH7A 3CCSS 1DQ8A 1G3OA 2OPRA 2KB2A 3KMQA 3AD9C 3QSIA 4K2XA 2XWXA 3PFOA 2Q79A 2UZAA 5L1IA 3Q8SB 2JOQA 5LMNF 2CJKA 1R8CA 1X4AA 4QCLA 1AFIA 2AEFA 2WVCA 1RYRA 1JMTA 2HFSA 4G65A 1TVRA 1FRMA 4LBHA 2RQKA 4ATNA 4OYIA 4USKA 2A2CA 2YBVA 3BBFA 4M5JA 3UQSA 3OV7A 2ZH2A 3JS9A 4ECSA 1NDLA 1ICEB 1Y7PA 2QG9B 4WFNQ 3VGUA 1WACA 1DQ9A 3Q23A 3NCQA 1JB0C 4KGKA 1T8EA 4AQYJ 1HI8A 3TWZA 3LAMA 3EZUA 5C2GA 4X4OA 3HHNB 2DCUB 4P75A 1N6QA 3BYRA 2B5JA 5KT2A 2KJVA 2R7TA 2HMIB 4ZPDA 3AOBA 4AT1B 3IA0A 3NGUA 5CZXA 4NZ7A 2FJVA 1S5ZA 3DLBA 4YHHF 1I3OB 4DR7F 1WSVA 2YNIB 1ZTWA 1S1VB 1DTQB 1NHVA 1X4BA 2LA4A 3DFEA 4CLUA 1WNEA 3H5XA 2CQPA 5THWA 3BGOP 2I8EA 3PYDA 5D4LA 4EEYA 2E1MC 4B3MJ 1S9FA 5IOLA 1X5SA 4B9MA 4UOHA 1FK9B 1SQGA 4LF9F 1KQFB 1YJTA 1FRLA 2CDRB 2XY6A 1TZ0A 3GILA 4E0DA 3G8TA 4EBEA 2VF3A 2CQ2A 5T14A 1Z2ZA 1HQEA 3D6MB 3L7UA 3T1YF 2ACMA 4OI2A 2E5GA 2JH3A 1NDKA 1X4EA 2NXEA 1RT3B 4C2MA 5DO2A 3BH7B 3EXYA 4K4YA 4J9NA 4JP8A 1TKZB 2HRYA 3OSPA 3LOUA 4LF4F 5DM7Q 1YTYA 3ILJA 3CXCR 3U1NA 4C7QA 4IDKA 4F7VA 4A8KA 2A6MA 2Y1IA 3RB6A 1Y3KA 3D28A 1HHTP 4FS2A 2E1PA 2IFXA 2R7RA 4ZP9A 5DDOC 2PE8A 3R5BA 4LJMA 4BS2A 4IG0B 1NHUA 4K4XA 2Y0SD 1TKDA 1U2FA 4K4SA 3MPVA 3N9UC 3AOCA 1N36F 4N41A 4I64A 4JI4J 4IOAQ 2FHMA 1PKUA 3BQ2A 3IR6B 5ETMA 2BJ9A 5F0UA 3FSXA 2C22A 4A8QA 2IAJB 1B99A 3I0RA 2E1RA 4YDXA 1FJCA 3GSIA 5C42A 3MTJA 1RABB 2M9KA 4Q44A 1QJHA 1TAQA 3OT9A 2QO3A 2R7XA 1C0UB 2B9YA 4L3NA 1K8AT 4IRCA 5D0EA 1VQ6S 1CVJA 4N77A 4WJBA 4HTJA 1FVQA 2JVOA 1TUVA 1R8AA 1XMQF 4F4XA 1AA1B 2YKQA 2MYFA 1S0OA 4DR3J 3IG1A 3AB2B 5CD4A 4DV2F 3DXBA 4ETXA 1WD6A 3HM9A 2AHOB 4X4UA 1AUSL 3TEHB 5KG2A 2JFDA 3RU0A 1IWAA 5IM0B 4EYIB 3NNCA 1AXQA 5KG3A 4LRAA 3RB0A 2KHDA 3R8YA 1TL1B 3HVTB 3C6UB 3MMCB 1J5EF 4EBCA 4OZ2A 3VAGA 3L95X 4U7UK 3SSSA 4ANCA 5I4MA 1LK5A 1LNQA 3ZZUA 5HMWA 1IBMF 1XNRJ 1R27B 4FKYA 3A3NB 4AFFA 4X66J 2UP1A 1YGYA 2CQBA 1W26A 2FZGB 2CPZA 1GXTA 2RDJA 4U7CA 1FXLA 4ELUA 5I42A 4AUKA 4DR1F 1U1PA 4USHA 4C6AA 2KXFA 3V6KA 3WDOA 2R8IA 3NNAA 3M8QA 1LW0A 3DRRA 4MK8A 4PG7A 3PTWA 2BM1A 2RIJA 1N32F 3M8RA 3ZTSA 4IUFA 2CPDA 2OEJA 3SV4A 1HBOA 2RUSA 1GTEA 4CO1A 3TVYA 2CQHA 3VCDA 4K59A 3GR0A 4I2QB 5C5JA 2R7VA 1ZTTA 4H4MA 3DMJA 4F3QA 1FRXA 2HNYB 3SI8A 1IKXA 1HBMB 4ZS6A 2A10A 2OELA 4DPWA 2E5IA 1FNXH 2QLBB 1N34F 2HIYA 1VBKA 2CIMA 4RW8A 2V4JA 4OX9J 2J8SA 4MIWA 2XLIA 2HPUA 3PFEA 3MM8A 2HNDA 2C2OB 2L41A 3FFIB 3H8YA 3W8PA 2B7CB 5EUHA 1I51B 2GAHC 3TUZC 2HKEA 1TKTB 2K7JA 4JI7F 3FNNA 1T03B 1WEZA 4HH1A 1QAYA 3LW5C 2B56A 3IAS9 1DURA 3HCXA 2KXHA 2WSFC 2CQ1A 1IKYA 2P8IA 4HYKA 1YQHA 2VFRA 3R5GA 4EYHB 3WIUA 1V5IB 4RLEA 1VRQC 4GVBB 1R0BG 4F8RA 2AIRB 1C1CB 4NYOA 3G4SS 4MFBB 1ZA2B 3O6QA 4NEZA 1Q8LA 3BB5A 1IVZA 4Y00A 3PRVA 4CTAA 5M2UA 2BJ8A 2F4FA 4GRSA 3NWGA 1YKWA 3HFVA 1SC3B 3PY8A 4DL5A 3MTKA 4P72A 3L3CA 2QL7B 2Y8YA 1Z2LA 1D0EA 4C9DA 3QGHA 3LGHA 3NGSA 5BJRA 3D1HA 3NOGA 3BR8A 1RQ0A 2PFFB 3DRYA 1U47A 2HMIA 3IWNC 3FQLA 3KK3B 2EK6A 1U1QA 3LP2B 1NKBA 2DNZA 4DV3J 5IV4A 1RWPB 4CWBA 2YNIA 3BKFA 1S1VA 2Z4PA 3DRSB 2EBGA 1TL5A 2BUNA 4CLKA 1JLAB 1RTDA 2GVZB 2GX8A 3GSDA 1X31C 3KNAA 2XMJA 3CJKB 4QYZK 3AD7C 3AT1B 4UUWA 2BBEA 2CPJA 1FK9A 1HWIA 4WPAA 4DSEA 3L7PA 5ETVA 5F8HA 4J9RA 4QYRA 3IAM9 4LRCA 5F9LA 4ZPVR 4C0BA 1VRTB 1NJZA 1S10A 3JTPA 3BSAA 3FCHA 2VFVA 4JUZA 4LRBA 2BDPA 2G9OA 3H7HB 1HKAA 2JJ4D 2LQ5A 3AXKA 3C3LA 4EGLA 1TKZA 2CPHA 3THPA 2BOPA 1NJWA 3PW5A 4EWTA 2GC8A 5A6PA 4P9SA 4ZVGA 2KI2A 1U2RA 3M2RB 4PXBA 4IOCQ 3OJSA 4FYWB 1FWPA 4DJBA 2ZOFA 1OY9A 1QSYA 1CS4B 1C0TB 3GTYX 1N54B 3V5RA 2M8HA 4P7VA 7AT1B 4PG8A 1F60B 1UEKA 4IG0A 2C3OA 1BUXA 3ZTPA 4WZMA 2R7WA 4WTYA 3FEZA 2FVCA 3DLLQ 2QLWA 3UDLA 1YZ7A 5DQHA 4CCHA 1YBAA 1NK7A 3JSMA 4EO8A 3OFGA 3BSOA 3QRQA 3HJFA 1M5OC 2OMOA 1REGX 1FJ7A 3SFUA 1UWBB 4V1Ak 3UVJB 3QJLA 3CCTA 1UW9A 3AXMA 3MM7B 3HHLA 1T9WA 2IAJA 1P1TA 1QDUB 3T5HA 4JI8F 1QY7A 3L9ZA 3HF5A 1LV5A 2IDEA 4TQRA 4H54A 1L3KA 2VFUA 3PW2A 2FGCA 3V4IB 1NLKL 3OTEA 1XR5A 2HGMA 4BCAA 3V6HA 1C0UA 3D1QA 4N8NA 3UDVA 1OQ3A 1SKRA 4RW7B 1RBLA 5AJ3J 1X60A 1JLFB 4WE1A 4AL7A 3G87A 3WX4A 1CJUB 4P73A 2AW0A 3NGTA 1XMBA 2VICA 2FQQB 1RAGB 1XEZA 1QD1A 1SH3A 2Z57B 1QUPA 2RKIA 2UVVA 2HSEB 4DWIA 4KGZB 2F65A 2ZHOA 2BR0A 3WZ0A 1XN9A 4C8MA 4PZVA 4JI3J 4QYZJ 1GAOA 4DFKA 4DSKA 4NXNF 2E9ZA 1N5YB 3R5AA 5L9NA 4B3MF 2MQPA 3ZXWA 2QIFA 2NXUA 3FQKA 1NRKA 4EI2A 1LWXA 4B9NA 3M32A 4M5NA 4QWAA 2HHPA 2OP5A 1HI0P 3BN4A 3CT9A 2VG7B 1TL1A 1SJ1A 3HVTA 3C6UA 4DU7A 4DQQA 2KHCA 3W1YC 1RHUB 5JXSA 2RJZA 2BRLA 2PEBA 3MEKA 1V3RA 3HMJG 2BE7D 5F8NA 4PQUA 1U4BA 1O8BA 2QV6A 4USTA 1Q86T 2VG6B 1IBKJ 4F50A 3W3SA 2K1RB 3KG4A 3GP9A 1F3FA 2WW8A 2J9EA 1WKKA 4O4GB 4B9UA 3JQJA 4I0WA 2DR8A 1VS3A 1FRIA 3N6MA 2W9AA 4FS1A 3BPSP 3H5YA 3BH6B 2J5AA 1BC6A 2PO4A 4HL9A 3CJ3A 2Q6BA 4KPCA 3CJ4A 2V4RA 2DXDA 1SXLA 4KRWA 1DY3A 4JI4F 4I2QA 5KFSA 2XY5A 3IR5B 1Q78A 4WK3A 1NH8A 2CQ4A 2IBKA 1S9GA 1DJ0A 5SZTA 4LFCF 1T9XA 2EG2A 3DGVA 5K8NA 3SSQA 4S0MA 1HBMA 2QLXA 1P6TA 1RJJA 2QMXA 5B0AA 2HHXA 4LSZB 4PXEA 2AGPA 2MY7A 4O3NA 2CAJA 3TZZA 5LOQA 3G82B 2XWYA 2VG5A 2BA9A 2JFKA 1TFWA 2HHUA 1VHFA 2FY8A 3THTA 3DU6A 4WXWA 4F4WA 5HSPA 2XSFA 3FFIA 2CQ3A 1X9WA 2KG0A 4QIVA 1AB8A 1JLQB 1VQLS 1RTJB 2LQJA 3N4WA 3F41A 5D0RA 1VQ9S 4NLGA 1T03A 5HJYA 3ZZYA 2IBOA 4DR3F 4DUTA 4MKAA 4W98A 4ZA1A 4M5GA 1IM6A 5A76A 1UVJA 3U1LA 5HROB 5LSOA 4CLTA 4RW6B 1IKVB 3MFHA 5MLCV 2ADCA 2RUGA 3LWLA 2L3MA 1UETA 1FT8A 3P45B 3KHGA 4LBPA 1B7YB 3HULA 2NPIA 1UP1A 3CIZA 1C1CA 1HL6A 4MFBA 1DFDA 1YG0A 4B9TA 1KVKA 3W2VB 3BV8A 2ZJQQ 3BO3A 1D9DA 1RGVA 4DV1J 2C2EA 2MQQA 5KFDA 4JYAF 4DQRA 3T5JA 4RNOA 2AX0A 4ZPWR 2FZCB 1JXEA 4RL1A 2XHWA 1YITS 4LR9A 3W9IA 4MIAA 5HI7A 2YQ1A 4CH1A 1RU1A 1XNRF 1HMVB 3Q8YA 4CP5A 3MECB 4IOBA 4HR2A 4X66F 3D0HE 3KK3A 2HZAA 1UA0A 1VR6A 2C3YA 2J7KA 2YH1A 3VQTA 2RQCA 2R7OA 2YX4A 3DRSA 2H4YB 1RT1B 3FUYA 4RX6A 1VBYA 1Q79A 4QIEA 2OH2A 4F4KA 1DARA 2HVZA 1JLAA 4LF5J 4ZPTR 2IIHA 4OL8A 2XMMA 2ZD1B 4JV2A 4WZQA 2ILZA 1DZ5A 1S7IA 5EX3A 4LVNP 4FYDA 4KGXB 1VLOA 4FXWA 1QM9A 5CZVA 4LT6A 3GPAA 2IMWP 1OY8A 4PRFA 1L3UA 5KG1A 3FCWA 1S59A 2F8EX 1TAUA 2YVSA 2HGNA 4KY3A 1NNDA 3ZZZA 3LPEA 2MJNA 2WVDA 3TVZA 1EKRA 1FDDA 4YY3J 1YI2S 2GHVC 3GYNA 1ZM4A 2D41A 3BKUA 4DV0J 1Y10A 4GKKJ 2MZTA 3MCOA 4Q45A 2GAGC 5BYSA 4OX9F 3H98A 3AB4B 1BXNA 3LQVA 5HVGA 4JV0A 3GZ7A 4KT0C 1SJFA 1R0AB 1S6UA 3M2RA 4ECZA 3GFYA 1VMBA 5DJBA 3R7BB 1CBKA 4DFMA 1JNZB 1JIHA 1LWCA 2DHXA 3L7OA 5LL6d 3T3FA 1XNQJ 5KFMA 2BW2A 2G2ZA 3HO1A 1T3NA 4OFZA 3T19A 2ZKUA 3D6HB 4LSLB 4QPXA 3PW4A 2ZJRQ 2VFSA 5B09A 5J2MA 5E3PA 3V4MA 4C3LA 5K8MA 5K8OA 4CRJA 3EICA 1YWXA 2NXJA 2DGSA 1S6QB 4R5PA 4KH0B 3H5SA 3ENWA 1NJIT 2VZ9A 1UWBA 3UVJA 3IWXA 2MZQA 2WW4A 1TV6A 2B0GA 1C1BB 2QJ3A 4ZVPB 2VD3A 5K5MA 4LF8J 4MYTA 4M95A 1WF0A 1B64A 1SUQB 1UMJA 5FJ4A 3V4IA 3MPDA 3SV3A 3KG0A 2ZHBA 1RISA 3DLKA 1S4EA 5AXNA 2IPOB 4PWDB 1UEUA 5GVQA 4ELVA 2OLWA 4J9VA 1GMWA 1S1UB 5A8KA 3JAMY 4UQTA 4QZVB 4CNZA 4DV3F 3UDEA 5IXUA 2W2NP 1S0MA 1VIXA 4AL5A 3RBZA 2HHHF 1NDPA 4AD6A 2UXBJ 4ES2A 2AMCB 3PACA 4ECUA 1B0VA 2W4PA 2OSRA 4P10A 2AYMA 1N5YA 5KG4A 2YWEA 2UU9F 5AT1B 2ZHAA 4ED4A 2HQGA 2K7KA 4IFVA 5D78A 2FC9A 4TU8A 3DDNA 3FEYB 2ROPA 4YFUA 4Y2AA 3V2UC 4JV5F 2CQGA 3DI6B 3J81U 1X8DA 1ZPWX 3OHBA 2VG7A 2H5JB 2FGOA 2KU7A 2PMZD 3QO9B 3FKBA 1S76D 2HS4A 3PW0A 2VBYA 2MB0B 5F41A 1NBEB 2KYZA 2LQBA 5KFLA 4PXDA 3M2VB 5IV3A 3VAMA 5JMNA 3OQ2A 1CQNA 5C2CA 1RKJA 3LP0A 1SV5B 1U24A 4F4AA 1LEOA 2DT9A 2HGLA 2W4CA 2QSFA 2WVFA 2EI5A 1SH0A 1AFJA 2F9JA 3FRYA 2C2DA 4PXCA 5D6GA 3C6TA 3R5JB 4RW9A 4J9UE 4O4GA 2XYGB 2J6SA 1HR0J 1SB6A 1PC4A 3EVWA 2L9WA 3KHRA 1GTHA 2NCKL 2NPFA 3ZTRA 4EMDA 1S72S 3K5OA 2OIHA 4XTTA 4O3SA 2XM3A 5K14B 5H1SV 2PA8D 5ETPA 4UT4A 4ZLPA 2F40A 5HLFB 3CNQP 1DQAA 1XIQA 1X4FA 4RBVA 1SVDA 4BHQA 5KFHA 2EFPA 1QUVA 1WJ9A 4IH5A 4YDDB 4L74A 4EZ9A 3OBIA 1NMEB 2ROEA 2Q6CA 1QTNB 1HNIA 2UXCJ 4KKOA 3U1MA 3QMQA 2GHWA 1Y4ZB 1M5KC 4DMZA 3G82A 4Y2CA 2GGPA 2HS0A 3LANA 2IDLA 1CULA 4ER8A 4ZN3A 2L08A 3R1LA 4DV6J 5AE2A 1NK6A 2DR7A 1RTJA 3EGZA 4DS4A 5BYRA 5GAHU 3H0PA 2ZUAA 3MEEA 4ECXA 2J8AA 4DXLA 4HI2A 1BGXT 3TRGA 1RP5A 2JEGA 3TZYA 1M0SA 5ETQA 5KOXA 3R6GB 1RT4A 4RW6A 4JI3F 2AJFE 3EDRB 1FJGF 3FBFA 5I3QA 1S4FA 3VHQA 3NMAA 2L48A 3MMJA 3OR2B 1FKOB 2EC2A 2RH3A 4B3OA 3NXZA 4OJ1A 1RUSA 2DHSA 3KNGA 3DOMA 1S99A 4FPIA 3ZNUA 2DY9A 3D3CJ 1W25A 4ZDNA 4DV7J 1V5VA 3SXLA 1P9YA 2XB2D 4OHXA 4NX9A 3A3OB 2KN4A 4X64J 4CM0A 3JQKA 2BYCA 1WC1A 4NLPA 3CD5A 2HNZA 1KLMB 3W64A 1U7LA 3D7SB 5KFZA 1Q0NA 1HMVA 3T5LA 1FF2A 4B3SJ 3MECA 3AA8A 1B4SA 3KJVB 4IH7A 3CO0P 4ZCIA 3FVYA 4FPRA 4NA3A 2JX2A 3ENAA 3MOZA 2RS2A 2EFOA 3ITHB 1CC7A 3AJ1A 1KVJA 1FXDA 1GMVA 1U1LA 4WFBQ 1IBKF 1P1LA 2AF6A 4YR3A 1UW4A 2A3JA 5AXMA 2GFFA 5E0OA 2MQOA 1TR0A 2DHGA 2KYXA 5FDLB 2IYIA 5F8LA 2QZ8A 3KK1A 1MMDA 3TEGA 4KAIA 3JYTB 2QFJA 2ZD1A 3AJDA 4TNOA 1IXKA 3CGIA 4ED8A 2BJDA 4JI0F 1RT6B 4DG1A 5T7LB 3MXHP 1RHJB 4BDPA 2XMTA 1FVSA 3CCJS 3I96A 3GV7B 3QJJA 2J0SD 3UD4P 5IQ6A 3M8PB 2BKOA 4MTPA 4L72B 4LF7F 4DCPB 3LUYA 1CJVB 4CO2A 2Z30B 1FWLA 4G1PA 1R6YA 2ZNYA 2PI4A 2VKRA 4QU6A 4F4YA 5HBMA 3HD1A 2JNJA 3DLJA 3DLGA 3ONQA 4ZCMA 3M9OB 1FESA 2X7IA 2VPWB 2UUAJ 2FIUA 3WC0A 1BQMA 2R8KA 1GK8A 3OXFA 3IGVA 2EEYA 1W2IA 3V6DA 2LU2A 3JTOA 4K5RA 1TQLA 4JB8B 1IBLJ 3N79A 1NK5A 3MM9B 3DC2A 4LSLA 1RA6A 3PIPQ 4ED0A 1NAQA 2DRBA 4BWJA 1TTHB 4WIIA 1IWGA 3TAMA 3GLJA 1NSPA 1CLFA 3VGVA 2OFHX 4L3KA 1VQKS 1ZAWA 5HP1A 2VDIA 5J2NA 1YRTA 2H48B 3K5PA 4IRDA 1GMWD 3EMTA 5GADI 2ASJA 1U6BA 2V8PA 1PILA 3BR9A 1RHQB 1HBNB 1FDBA 4KHPJ 3NBPB 2UUBJ 2IVMA 2VPZB 3L09A 3HX9A 3N5FA 5FLXU 4DF8A 4I56A 4MKBA 1WOOA 4B3TJ 4IRKA 2R2SA 4PWDA 4OZ0A 3OR1A 3GIJA 3IGNA 1RXOB 1T02A 3RRGA 2RRAA 4RU9A 5DETA 3VGSA 4LRDA 3G71S 1UJ4A 2XEXA 3CB4A 2MQLA 2F8HA 1OMSA 2RSQA 2CPFA 3QRPA 3QPIA 1NSQA 5GAEI 2W24A 1JLGB 3GV5B 2FLNA 1TFYA 1M90T 1CQMA 3Q8PB 1RACB 3KXDA 1PYSB 2NSCA 2ZE2B 4G1QB 2QT7A 2FY1A 1S1TB 4NI2B 4LF5F 3J80U 1MU2A 1NPKA 3MDFA 2VC0A 2VHGA 4YB7A 2DPJA 2LXFA 1NXIA 4LF6F 3G2XA 3IBCB 2W9CA 3DI6A 4WCEQ 3CDEA 1FDNA 1T95A 3ENQA 4FKXA 1VRUB 3BJYA 3GE9A 2AP6A 4I2PA 4FN5A 3DLHA 3QO9A 2MLZA 3VTIA 3L4BC 3NAIA 4LVOP 3ENVA 2BQUA 2ZC3A 3MD3A 4C0HA 4JI2F 2I0XA 2UV8A 1H3DA 3D1OA 2ABYA 4OI1A 3D6TB 2CJYB 1B70B 1URNA 4DV0F 5IT9U 4USUA 4GKKF 2QX0A 2W7AA 1EZZB 2LXUA 2QA1A 1I5OB 3R5DA 1M1HA 1X4CA 4OHZA 4IKAA 1O0PA 1BWEA 3I9ZA 3RW7A 2EK1A 1DTTB 1N33F 3PR5B 1XNQF 5D4PA 2WOMB 4HT5A 4FF3A 4TY8A 3KLGB 2BJ1A 4P2SA 4V19J 4YHHJ 3NGDA 2BE9B 5B08A 5K14A 4WKYA 5ETKA 1ZH5A 3TJ8A 1R3NA 2CADA 2M8DB 2KH9A 1RBAA 2BV3A 3PYFA 4WFZA 4DL6A 3N01A 1KOHA 1N5VA 1KDNA 3QT7A 4MK7A 2YNFB 2XGPA 3GWCA 3KDOA 5KT5A 1JKHA 2AYGA 3ZZTA 3NGRA 3VVTA 3IMQJ 5KFAA 3WHIA 3W65A 1WORA 4LF8F 2DXFA 5F9NA 2KT5A 1S48A 2DBBA 2E66A 3HSJA 1KVIA 4DX6A 1TL3B 3T1YJ 3CJQA 3NCRA 2UXDF 4X4NA 1FEEA 2Z2YB 1AROP 3ETOA 2WB1D 2BANB 3RZAA 2F4VF 3I5AA 3AHPA 4IR1A 2QA2A 2ZVIA 5F3ZA 1EIYB 4ED2A 4PUOA 4LF4J 4O0NA 4URSA 3TYTA 1I6JA 3FMWA 3RUBL 2HLTA 2F3JA 3CO9A 2MY8A 1RT2B 2MKIA 8ATCB 2LVWA 4NLOA 2V8HA 4TY9A 5E33A 3U02A 2YNGA 3KLFB 2FJAB 4UY8T 4ZVRB 2KTQA 1YJVA 3OR2A 4LSNB 1WC5A 3CJTA 1RT5A 2HVEA 1HYSB 2HWTA 1IJFB 3G86A 1VCTA 2GO8A 3PIOQ 1TUWA 5L1KA 2ZEJA 2KRBA 2ZWOA 5C25B 2ALZA 5IC6B 3QGGA 4PEOA 1T3OA 4DS5A 5A6WA 1RWXB 1VHIA 4U95A 3A4TA 3KJVA 3MAHA 2ZM6J 2ZH9A 2VODA 1EP4A 2HVIA 3CUNA 3ITHA 2YQ3A 4Q0BB 3KLIA 4ECVA 1RAJA 4R0JA 2H9ZA 1Y5IB 1ZETA 1Q7LB 1HR0F 1RLCL 5FDLA 1XMQJ 1CJTA 2LU1A 1OYDA 4AL6A 3JYTA 2JDJA 1M5SA 1RT6A 1H2VZ 4MYUA 1HLWA 4DV2J 3P49B 2DO4A 2E9RX 2M52A 3WX8A 3FC9A 5ITHA 2B4PA 3GG1A 5L46A 1F5BA 2NUHA 3D0IE 2KFYA 2OD6A 4DCJB 1GNKA 5KFVA 2HZCA 2CQDA 1JNRB 2MGZB 1D1UA 3C16A 3R97A 1U48A 5KT4A 3DGPA 4OYZA 1O6XA 4J7CA 2UXCF 2FVPA 3IC1A 1SJ3P 2DK2A 2MMYA 5D15A 4X84A 3N5BA 1J5EJ 2B51A 3PCOB 1VQ7S 3BBCA 1SL0A 1CJKB 2IRYA 1FD2A 1FDAA 4A8WA 2AWZA 2ASYA 1VC0A 3CD6S 1D9AA 4CT8A 4ZN1A 1E6YB 4PABA 2JRSA 3KJNB 4HACB 1EETB 3DOKB 1J27A 3MM9A 3D0GE 3QNWB 4DR1J 1J5OB 5D4OA 2H3EB 2DPIA 2FC8A 2PN6A 2V34A 3QIPB 1Q5YA 1HW8A 2NUUG 1N32J 4E2FB 3I82A 5D4NA 2XZTB 3WC2A 4ZHRB 1OO0B 3MPWA 5HQMA 1TUGB 2HFUA 3T9ZA 1HBNA 4F2SA 4NYPA 3NBPA 2VUGA 4J9QA 4N7TA 2DTJA 3VZIA 4F0MA 2MQMA 4LBIA 2J76E 1WWHA 3GV8B 4O3RA 2WK4A 5A8WB 1HIYA 2E29A 2R8JA 2HQ3A 3OUYB 3MEDA 4I6AA 2WONB 3ELHA 2P2CB 2KM8C 3S7RA 4UOGA 2D3O1 1RTIB 3A13A 2YKNB 1UVKA 4DDFA 2ILYA 1MWZA 5DM6Q 3DOLB 1N34J 1KQGB 2CZ9A 4NA1A 2PDAA 1N5SA 4RUAA 1SI9A 1JLGA 4P6QA 2BKPA 3I0SB 3POTB 1VQ8S 3HLUA 1I94J 2ZE2A 4G1QA 2J7WA 4NI2A 1J2VA 4WWSA 1D3WA 2XSJB 4NASA 2YX7A 3DRPB 2XNQA 1M1KT 1S6PA 2DHHA 3DLEB 3NL0A 2L9NA 4KFBB 5E3CA 3TA0A 3OXGA 1B7FA 4IQXA 2DH7A 2J6TA 1H98A 1SL1A 3CC4S 1QAXA 4BC9A 1NSKL 2WAQD 4X4SA 1T9UA 2NXCA 2Y1JA 1VQPS 1A9NB 2EXUA 2HK2A 1KC8T 3CC7S 5A0YA 3GJSB 3UD5A 4OQJA 2VFTA 1OSCA 2HWIA 2MZ1A 1MMLA 1VJWA 1LXNA 3KDNA 1S9EB 4QBUA 4F0HA 2C3UA 2XMAA 3B54A 2UUAF 2CWXA 1NHKL 2RDIA 1NU4A 1W2BR 1RAIB 4CLWA 4KE5A 2MZJA 2WOMA 4MKYA 4RKUC 2CUYA 1N48A 1QTMA 4ZPAA 3CW2C 2HEKA 3OL8A 1M5VC 1RT7A 4GMKA 4FXDA 1MROA 3QAUA 1YLXA 2ZOGA 1N0UA 5HQLA 4KB7A 2YNFA 1JLCB 2EFGA 4RJVA 2QLJB 4IG3A 3HD2A 4WK1A 2O3DA 1T0TV 3TJAA 4UOFA 3P4UB 2GZOA 3IN5A 4KHPF 2XS5A 5I3PA 1FCAA 6AT1B 2RQ4A 3PM9A 2V8GA 5J2QB 1FD8A 4L76A 4Y2KA 3LA0A 2DY1A 2EVZA 5HK4A 1HPZB 4ZVHA 2CNKB 1VI7A 2WBMA 4F36A 5HO4A 4WP8A 3HT0A 2C1EB 1RWWB 1C4AA 4OYXA 1F2GA 3PEJA 1FX2A 5BYQA 2M4MA 2LKZA 5CCMA 4XPEA 5L38A 3SEOA 3DYAB 3I55S 1JLEB 2ZUGA 2CQ0A 5E41A 1REVA 1OQ6A 3OPKA 4AXJA 1KNZA 2Q66A 1HI1A 4TU9A 2X1FA 3DDIA 3KLFA 4FXVA 1GQEA 4ED6A 1BWVA 2YH0A 3CCQS 1KTVA 4ILLA 1LWFB 1HYSA 1WI8A 5A2QY 1VQSA 1Q53A 4ES1A 2FJXA 2AYEA 3GIIA 4DZDA 1NK9A 4DSIA 5C25A 4N5SA 3ILOA 1HNVA 3M1VA 1BHNA 4CI0B 3RGIA 2AEJA 2IM3A 5KG7A 1F9EB 2Y3YA 1HD1A 3G96A 2LXIA 2MKCA 4JI8J 1Y0HA 1PYOB 4Q0BA 3W9HA 3SFGA 2PT0A 4R8UB 1PJ5A 4NWBA 1U6ZA 4XAKA 2AX1A 2GVDB 4IFYB 1VBXA 1UVMA 4A48A 2HLUA 2OPSB 3ZZ0A 3TAPA 3BGFA 4XIUA 2GO9A 2OPQA 3HHDA 4J9LA 2R2RA 1Y9OA 2OEKA 4ZVFA 4DUYJ 1NSAA 2DEIA 3VWSA 4YOEA 3DNCA 2G1DA 3G8SA 4PG6A 4X4PA 1NK0A 3VZHA 1KFDA 2I5JA 2BQ3A 4TU7A 4YB1P 4NXNJ 5F3TA 4DX7A 3Q22A 1TKXB 1N8RT 1UL3A 4QWBA 5LSLA 5CXTA 2CNNB 2MQ8A 3ICLA 2VBXA 1WC3A 4NRUA 4C11A 1FHTA 3MM6B 3SQOP 2MJUA 3K5NA 3WIVA 1TL7B 3ZTOA 1SPBP 5KFXA 3M2UB 4ZCKA 3GB0A 4XPCA 3E8OA 2GQ2A 4BBYA 2F1FA 2QLFB 3DU5A 2WZ1A 1CJKA 1IKWA 3W5ZA 1X7VA 5DG8A 5KFUA 4ELTA 3RB3A 1VIOA 2W2MP 2Q3PA 1E6YA 1RU2A 1MNEA 1EETA 1U25A 3DOKA 2BOAA 1EARA 2GMHA 3PRBA 3PVXA 1HBUB 1J5OA 3CCES 3RR8A 3F73A 2GA7A 3RAQA 3T41A 2DGXA 1L3TA 4PG4A 3IRXA 5KAKA 4YS2A 9ATCB 2PIIA 2N3OA 2VB6A 4ZHRA 2SXLA 3CEDA 2CVEA 3GCXP 2EFQA 2IJFA 3WQPA 1OPZA 3PX6A 2BEFA 3VALA 1QSSA 2Z2MA 3LALA 5KFIA 3Q8RB 3LWMA 5A8WA 2J0QD 3TI0A 3KLHB 1AYEA 3OUYA 4DEZA 4LFCJ 2DNPA 2BJ3A 1UCNA 1RAOA 3PR4A 4N47A 2ZITA 4FBTA 2ZM6F 4TKTA 2RB7A 4HEA9 2EG1A 4J37A 3DOLA 1BQNB 1SQFA 1U2CA 2RQMA 2RILA 1RCXB 4FNIA 2XY7A 2RDDA 1NO8A 4C8ZA 1N88A 3POTA 3W5YA 2R9LA 3D5MA 4W90B 1E6VA 1ROFA 3KFWX 3UCUP 3Q8VA 4XDCA 2HVHA 2A18A 2L9DA 4RUHA 4OI0A 2HAIA 3DRPA 2GJFA 4O0IA 3EZ5A 4KH1B 1M5PC 1R8BA 3GIKA 1L3SA 1Q82T 3QZ8A 1HNWF 2JWNA 4YN3B 2HHQA 2DH9A 3OFEA 2B9XA 2VPXB 1UFKA 4QIWD 3SCIE 1FE4A 2KZZA 2FYXA 1P8GA 2DRAA 2NLWA 2WVBA 3P5BP 2K8GA 1O5JA 4DSFA 2QA4G 3MR3A 2V2ZA 2V68A 1SH2A 1GXUA 2BM0A 1YBUA 3A8IA 1WOPA 3MMAA 3R1HA 3R3TA 4JYAJ 1VQYA 1S9EA 4X62F 3EM1A 1HNZF 3O3LA 2W2PP 4BC7A 3ILIA 3HKZD 1Q81T 3GU0A 3TR5A 3PJ9A 3W8GA 2G13A 1FNOA 2KRRA 1XERA 2MZRA 3J7ZT 2B7BB 2EC0A 2ZVSA 2AT1B 3TUPA 4ZIWA 1PAEX 1KLNA 3NWRA 1RAAB 1K47A 3LF0A 3GYXB 4EUVA 3OVSA 5DLGA 4UY85 2M7SA 2PFDA 4DQIA 5B0BA 3TZXA 3R6LB 3T5KA 3QSYB 2O5DA 3C8YA 3KG1A 2D1CA 1H38A 3P5TL 3AOAA 1RA7A 4KO0A 5KFYA 3TZWA 2B9WA 2YY3A 4FF4A 1KRPA 4RR5A 4X4QA 5J2QA 3P6YC 1TK5A 2MXYA 3PNIA 3BGRA 3M05A 3C19A 4P2MA 3A8EA 3B78A 3CDAA 2CG4A 4RBTA 2ZH4A 5DDPC 4RU2A 1LWEB 2FHJD 1U1KA 4LFBF 1RAHB 4NCGA 2Z56B 1ELOA 4I7FB 2XMVA 5CD4H 3NS6A 2UUCJ 3Q86A 4TVAB 3OFFA 1K9MT 1T05B 4MK9A 2BE2A 1U09A 1JLEA 2IYGA 2RD5C 3SYZA 2GMJA 4NLWA 1EJ7L 4PYDA 1I94F 4DU8A 2HQFA 2W9BB 5RUBA 4YEAA 1Y3JA 3JSRA 1KFSA 2OJ3A 3J7A1 3IFEA 3GFXA 4Y65A 2QL5B 3BGLA 2ZOMA 1SJQA 4LIRA 4MIBA 4QJVA 1LWFA 4O3PA 2CPIA 2OKQA 1MG7A 1UVNA 4WF9Q 4NEYA 1CG2A 2MKJA 3I32A 4NA2A 1WKJA 4DUZJ 1SJ4P 2LEAA 3RBXA 2XMUA 4CT9A 3VAKA 2BABA 5I3UB 4OMFG 3K7RA 5F8MA 1NM2A 4F02A 1R6VA 1C2PA 1Q16B 3K89A 5ETNA 5FD1A 1UVIA 3SSRA 3K58A 2LA6A 3OD2A 4KC5A 3E01B 4RUCA 4DR6J 1N6QB 1TMMA 7FDRA 4IFYA 2B5JB 3PKYA 4WBFA 3BDPA 3G6ES 5H9EJ 5IZHA 2HRUA 2LMIA 1YIJS 4CQ1A 9RUBA 3D68A 5CCLA 2P6SA 4DR4F 1QVFR 2I38A 5CYJA 2M5YA 1T94A 3QT8A 3C66A 2HHHJ 1DTQA 1FRKA 1ZAVA 5L8RC 2O1PA 4OX7A 2CNOB 3C14B 1FJEB 5HVHA 2KL8A 1LXJA 1KN6A 4M5LA 2BJ7A 1RAFB 3OFHA 1KBRA 2W2QP 3CJ2A 4J9MA 2UU9J 4F3MA 2KT2A 2VBZA 3DHXA 1BMQB 1AZSB 4JV5J 4F0KA 2OTJS 1R8HA 2XCPA 3AJ2A 4Y3CA 1TL7A 3M2UA 3SQGB 2VC1A 2MHNA 4F26A 1YDLA 3B6BA 3BO4A 3H59A 1BY9A 4M94A 1RWNB 4USVA 2QMUB 3T6BA 1RT3A 4NLTA 4Q2LA 3W66A 3HVAA 2XI3A 5C7PA 4HVZA 2BMBA 4XK8C 5EDWA 1M5HA 2IJRA 1IBCB 2CQCA 2F7VA 1HBUA 2FVQA 2C2MB 2K3IA 2GS8A 2AYBA 1KWMA 4WFYA 3K59A 3EPIA 3MR5A 3HI9A 1S6OA 1VQ5S 3KKFA 3OVBA 3OL6A 2YWWA 1MN7A 1WG5A 4P52A 1T9YA 4F67A 2ALYB 2RS8A 3QLHB 2RHQB 4CH0S 1Q8IA 3QWUA 3PXGa 2QFIA 1WSRA 1PIEA 1F3VA 1U0HB 2JEFA 2DNNA 3BBBA 2DNYA 2G0CA 1RWOB 4QW8A 3KHHA 1F2HA 4URQU 4C3KA 4O23A 3FGVA 3KLHA 1RKIA 4CLFA 2AJ2A 3SCKE 2BKNA 3I0RB 2C2RA 2V94A 5C42B 3TA2A 3ISNC 5J2PB 5D0HA 2XLJA 1BQNA 2YX1A 4USJC 2I2YA 3VAJA 3TX8A 3PW7A 2MDAA 2FLLA 3MGJA 2O67A 1VQ4S 3I5BA 4YUDA 1N5QA 4ID8A 3ET6B 1S97A 3M9MB 3OLBA 4M5DB 3EUNA 3HHEA 5LJ3Y 2LP4A 1FFSB 4RNNA 1N5TA 1Q4RA 3HZEA 1QE1B 3CCRS 4L6V3 2D9PA 3PX4A 2H5IB 3IG1B 2CG8A 4DUYF 4JI6J 5K20B 2ZFHA 2MKYA 4X4RA 4EZ6A 4DFJA 2M3DA 4FF1A 2NSBA 3B8HA 4DL2A 4HHHA 1FJGJ 4MT1A 4GVLA 3DRXA 3QFWA 1Q5VA 4U96A 1ZAXA 1FFGB 1AW0A 3CMAS 1WDDA 5IM0A 5H9FK 1Q1KA 3M7VA 3UNYA 4KSEB 2H5EA 4F04B 4J9SA 2PA3A 3TUJC 3UWTA 3MMCA 2W7OA 2LDIA 1QAIA 3UNGC 4KHMA 5J1NA 4UW2A 2XTJP 4ETZA 3NMRA 4HHUA 1SKSA 5KFBA 3HDSA 2LYVA 3CDUA 1TK8A 4ED3A 3K57A 2AD9A 2FUG9 3ISND 4BLGA 4RNHA 4DV4J 4DPOA 1WUUA 2JZ5A 3A12A 2HFNA 1RCOB 5IWAJ 5CH7B 2D3OR 4MAKA 2FDNA 3H40A 3J7YU 1T7PA 3M8SA 2YXLA 2X1AA 1TK0A 3ZZOA 2ASDA 1N52B 4EK2A 4RO0A 2I9SA 3D3BJ 3DRRB 4DR2F 3GONA 1F9HA 2J9DA 3CC2S 2W8LA 1HBOB 3GFZA 3Q8UA 2XNRA 5AXLA 4JI0J 3HT3A 4WYLA 4QIFA 4V19X 4Y6IA 3GYGA 3N28A 1Q8KA 1K1QA 2OI2A 2JC0A 3M8ZA 5JVHQ 2HNYA 1HFEL 3NKYA 4ID5B 2DRDA 1WHYA 2R8HA 4LF7J 3MAAB 1S57A 5E3RA 5LMUF 4I7FA 2VU5A 2YKAA 1S77D 2D3UA 1YSJA 4XDDA 4ZITA 3MM8B 1DLOB 4CO3A 3OTBA 5G0RB 1N4LA 1R7IA 1G7CB 2W9BA 3MCNA 2MHEA 1TKTA 5GAGU 5EHHA 4DOZA 1RWVB 2VQEF 3ZTQA 1F0XA 4MJKA 2ZBPA 4J91A 1V9OA 4A47A 1IKYB 4DPUA 2F8MA 3RB4A 1FWKA 3PKMA 5KFOA 2NYHA 4CLSA 1PJ6A 2WSEC 4NCBA 1ZZNA 1SBRA 4W92B 5H9FJ 3QZ7A 4P2FA 4B02A 5L1LA 4GVBA 3W63A 4C8YA 1MWQA 3FSIA 2VA2A 5I3UA 4ITSA 3I4PA 3S01A 2CJBA 2YKMB 2Q1LA 3ULHA 4CTAB 2LEBA 4OX8A 5G4DA 4OZ5A 1HWUA 3EGVA 2VKZG 1UKUA 4LF2A 2A1BA 3IP0A 1U8SA 3E01A 1UJ5A 3JSYA 3R9LA 2CPYA 3W9JA 5HVFA 3GIMA 2DNLA 1S12A 1FEHA 5CYQB 5J1PA 5E3QA 3ADAC 5LM7E 2ZDOA 3LP2A 3NRBA 2C3MA 2KO1A 4DBQA 1BQXA 4RNFA 1SIWB 3H4BA 1MMNA 1YRUA 3C14A 2QYGA 1RTDB 1YVFA 1EB0A 2GVZA 2PSZA 3CJKA 5L39A 2DGQA 1B0PA 4YR0A 5ETLA 3ETMA 3J7AN 1P9QC 2KFNA 4LF6J 3CDWA 1AZSA 4N8OA 3UN2A 3W60A 1JX4A 5C24B 2X1BA 1RHMB 2V6AA 2CDQA 2YQ0A 3EDQB 2EWHA 2PMWA 3K8WA 1F9FA 1YJNS 3MFIA 3SQGA 3R2DJ 1VRTA 3HSZA 3G9CA 1N0VC 4Z37A 1OS5A 3FMBA 3NGKA 3LGNA 1SKWA 2ZC4A 1G4CA 3MPUB 3MPYA 1MSWD 1WG4A 5T41A 4JI2J 2H54B 2K3KA 3RAXA 2CQIA 2VOOA 3CCWA 1FE0A 5DDQC 2FVSA 1PG5B 4OJHA 2UUCF 2DD8S 2IM0A 3CJ0A 2RMLA 3M6XA 4EFAC 3MZIA 1WTBA 1DAXA 3PDNA 5L1JA 4GKJJ 4R25A 2QEXS 1N33J 1CS4A 1C0TA 2OTLS 3BS9A 3T1HF 3O5TB 4WXOA 4P74A 4OYPA 3QLHA 5DLFA 2PGCA 2FD2A 2C42A 1EQMA 1SQEA 4C8LA 4A8MP 1NK8A 1K1SA 2P9CA 3HFZB 3VGTA 1VC6A 1U0HA 4HH0A 1FERA 1RYSA 3JSMB 1I1GA 3OL9A 3M6VA 2A2DA 2IM2A 2R3VA 2AQ4A 4DUZF 3MWBA 1VFJA 4ZVQB 3KUEA 4PPZA 5HMXA 2CPXA 3HSDA 3HHLB 3MM7A 5CA5A 2E7WA 2Z0GA 2EBEA 3UW1A 1SL2A 3CVKA 2WSCC 5J2PA 2YWGA 4WU2A 4NXMJ 2C3PA 3QFHA 5KFGA 1X4HA 3G8QA 3HK2A 2QYCA 2ZH5A 1SKUB 4DR6F 5B0EA 2IHR1 2UXDJ 4RW7A 3ET6A 4OLPA 4LRFA 4WE1B 2UUTA 1JLFA 4M5DA 4ZP7A 4C48A 1CJUA 3J7Z5 3RBEA 3HP6A 3PO4A 2RF2B 3UO0A 4IO9Q 2GCFA 1QE1A 2F4VJ 4C97A 1G6BA 2D69A 3DKDA 2RKIB 5KTQA 4FYVB 2ZBRA 5GAHI 3W7BA 3OXLA 2AGQA 4C0OC 1U1OA 1NCLA 1RTHB 4A8SA 1ZS6A 2N7YA 4Z2XA 3RYLA 5KFTA 4NLXA 1X4DA 5DQIA 1SC4B 3M32B 4YP3A 5U47A 3I87A 2Z58B 4CLLA 2H4WB 3CTRA 2CZVC 2XS2A 1S0NA 1VK8A 2E5JA 3MUMP 5FIIA 4PWWA 3S8SA 5GMEA 4E8UA 2CNLB 1FRHA 2GQQA 4HKQA 2WBRA 2JLEA 1YJUA 1C4CA 2DISA 2V69A 3AFGA 1NPRA 3TA1A 1F5CA 2B43A 3CCVS 4PQUB 3BYPA 2M88A 5AXKA 2MEWA 2ROGA 4PG5A 4IO1A 4I1TA 1WEXA 3PYGA 2VG6A 2OPPB 3EZOA 2DB1A 2K1RA 4OZNA 4C4WA 2GJ2A 3QGIA 2B3TB 4RNMA 1FA0A 2YNHB 1GT8A 1IR1A 2HAFA 1RLDA 2DNGA 5DGAA 3KOAA 1RADB 1R89A 3OTOJ 3LPYA 2J9DE 2XBPA 2CJQA 2HBYB 2YKOA 5DGBA 1JXVA 3PO5A 3PEHA 4Q8FA 4OI3A 3DDKA 1HQUB 2COLA 4FDFA 1QVGR 4X65J 1S9GB 4M5MA 3W2WB 2IY5B 4PCQA 2KM8B 3US5A 4ID5A 5HAOA 2J6UA 2XMKA 1DBDA 2FPHX 3KTQA 3MAAA 2Y9HA 5KFQA 1H7XA 3BKTA 3C2PA 1A6LA 2VG5B 1CSJA 3BF4A 1JXLA 4DN0A 1YK9A 1DLOA 4ZMMA 4ED7A 5G0RA 4TN2A 1JLQA 2BJEA 4FVMA 3HPOA 1EX8A 2ZWPA 2O66A 2Z2LA 5B7WA 3QGPA 2KXNB 2XLKA 2D74B 4NPOA 1OSDA 4JI6F 1PBUA 4NZ0A 1S7HA 5EWFA 2MKSA 5HROA 4LQ9A 3GIRA 3OW2R 1A7GE 3IR7B 4YQWA 4TLQA 1ZM3A 1MN9A 1IKVA 5JJBA 4KHRA 3MURP 1X9SA 1S1WB 4JI5J 2XS7A 2MSTA 3TJ9A 3KJFB 1V3ZA 3JAMU 2M70A 4NZ6A 2U1AA 4DZ6A 2ZBCA 4TXSA 2YKMA 3W2VA 2XYHB 2XO6A 4CO4A 5K8PA 4UUXA 4J9OA 3OHAA 2RU9A 5IT4A 4D3HA 5ETRA 1WKLA 4Y2MA 2E5HA 5LJ5Y 5CYQA 2V0NA 2NR0A 2VQFJ 4DV4F 2ATCB 4ECWA 1S49A 5AE1A 1JJHA 3P8BB 1ZPVA 5IWAF 2YTCA 3FJ2A 2AJ1A 4I68A 1JJ2R 4CO5A 5J1EB 2N4CA 1RT1A 3PG9A 4OZ1A 2JLFA 3MD1A 4O3OA 1R8PA 1B0TA 2ZKTA 2KDOA 4K5SA 2WRMA 4DSJA 4TYAA 5IFMA 2XO7A 2Z8QA 1V6HA 1XWLA 1H2TZ 3ZZPA 2KZMA 1PGZA 2W8KA 1VQNS 2HYIB 2HW3A 3QJPA 5C24A 2R7UA 2IA0A 4X2BA 4K4ZA 3BM7A 2VPYB 1L5UA 3SBMA 2E7XA 4DV5J 3N0VA 5HMYA 2C2KB 1S0VA 2FZKB 2IJNA 1TU0B 5B0DA 1WF2A 2A0FB 2WVEA 2DXEA 4X4VA 2FB0A 2NQPA 3O1LA 1FO1A 2MLXA 4ZLLA 2DNRA 1HHQA 2M2BA 2FJBB 4IR9A 3NS5A 2DNOA 3UCGA 4AYBD 4ZVUB 2QC3A 5EX0A 1R0AA 1HWJA 3EVOA 1LWCB 2DYAA 3TOQA 4MKVA 4ED1A 3GJRB 1NB7A 1Y11A 2X3GA 4DLEA 5J2MB 2GHPA 3LAKA 4JI1J 1YZ6A 3TAQA 4ZCLA 5A8RB 1S6QA 3MI7X 1GFWB 4R5PB 1H6KX 3FK4A 2ATLA 3A8KA 1KEKA 3BEGB 2DVIA 3D6FB 2EFVA 1TV6B 1SC1B 3A8JA 1C1BA 2AJ4A 3MR2A 4CZCA 2DO0A 2DGUA 5E7OB 4AQYF 4M5IA 1SUQA 2V2KA 2AJ0A 3DLKB 2I1RA 2RAQA 3CJ5A 2N3LA 3I56S 2YWKA 2C28A 1KHVA 5F8IA 2RHSB 2HBQB 2V8DA 3BGUA 1PCAA 3G6VA 4AE5A 2QSWA 2RF2A 5A8KB 1S1UA 3OL7A 2IMOA 1IQZA 1WI6A 3EX7B 3PHTA 2BRKA 2VBWA 2DNHA 1WOSA 1YJWS 4A8FA 3RG6A 3FEXB 2NXNA 2HQDA 1RTHA 3UN3A 2C2NA 1UFWA 4ALZA 2DJWA 3R7NB 4DL3A 5K9FA 4IFVB 3BREA 3FSYA 4D3GA 2HRTA 3IM9A 3LGMA 1HHSA 1ULRA 4FBUA 2QTWA 4GO5X 5DRKA 4ZJLA 1QAJA 3JTNA 3D4JA 5KT7A 4PYAA 4B9VA 3SCLE 4CDIA 2B8PA 2V2VA 3A3PB 2DNMA 1HA1A 2CWKA 3EE3A 1Y5NB 3M2VA 1CC8A 2PD1A 3UFCX 4Z7CA 4TQSA 1XMOJ 2ERRA 5DZ7A 2IVYA 1NJYA 1DRZA 2FJWA 3LP0B 1VYAA 2D9OA 4CO0A 1X0PA 1SV5A 1FKAF 2OPPA 1Q95G 2YKPA 2LQ9A 4R0EA 3MOJB 3C6TB 5DDRC 2Y1LB 4RW9B 4GKJF 8RUCA 1H73A 1T11A 5SUHA 2YNHA 2QE5A 2MLYA 4DLGA 4I67A 5E3AA 1NB2A 1R31A 4FF2A 4RPFA 3TQ1A 1IQTA 3IRWP 2IC3B 1HWLA 5KG5A 3PHEA 5HLFA 3VF0B 1VK3A 3TP2A 1HQUA 5D77A 5MAOA 1R0CB 2J0WA 3W2WA 3AA9A 3NOCA 1TL4A 1KQKA 2RRBA 4HI1A 4LMZA 4YB6A 2CXEA 3KMSA 2GIFA 2XZWA 4DL7A 1HNIB 3I4HX 4KKOB 1SC6A 1U26A 5L9XA 4J9PA 1SCJB 1S79A 2GGPB 4NXMF 4A8XA 5IC4B 1CULB 3B82A 1HW9A 3OVAA 4AXIA 4UF4A 4GC7A 2AU0A 4IYQA 2N7CA 3MCMA 3FDSA 1FTCA 2Z2ZA 1VDHA 4WFAQ 2E44A 1NKEA 3FBBA 3MEEB 2UVUA 1X5PA 2D7SA 2DR9A 4ZP8A 4QPTA 1OIAA 3AQPA 4NYZA 3GCWP 4DPTA 2NZCA 1RT4B 5LT5A 3Q2SC 1WEYA 3O44A 2F9DA 2LFVA 1S1WA 4OI6A 3KK2B 2V9WA 4ECRA 4PPDA 1ZM2A 1TMJA 4NLVA 4TYBA 2Q43A 1FKOA 4B3OB 1FNMA 3KLEB 2ZJPQ 3DOMB 2CFXA 4OYAA 4JBCA 3QT5A 1UPMB 3WBZA 3PZPA 3Q24A 3RRHA 2VL1A 3M4XA 2IA6A 2DR6A 4OZ3A 1GMUA 2CJXB 3EPGA 4ZK7M 1U1RA 2HNZB 3QQCD 1KLMA 2B4VA 1FFWB 3G6YA 1KONA 3NG8A 2B8QA 3VR1A 1XBWA 4DR5J 5LXRA 3HHLC 4F3OA 1FX4A 5CYMB 3DXSX 5BR8J 4CNYA 2V50A 2Y1RI 1UJ6A 5KT6A 2DHAA 2DITA 3J81Y 5J1EA 1YJ7A 4UQGA 1WG1A 3I31A 1ZZFA 2LQ8A 1D9FA 1GX6A 3GFHA 4ENOA 3KK1B 4M8LA 3HXMA 2IM1A 4L75A 4QWDA 3OTOF 2KFZA 2BZ2A 5EN1A 2UUWA 4DG1B 3JB9k 4ZVEA 5T7LA 2BQRA 1NH7A 1HNWJ 2G2OA 3H2VE 1K44A 4K4WA 1NJXA 4UOCA 2LECA 2NREA 2OGUA 3H42A 1Z1ZA 5JVGQ 4X65F 3M8PA 1U8WA 3RTVA 2KG1A 2W01A 2X3DA 4K0KJ 4K50A 1CJVA 2MKHA 5DG9A 1YJ9S 4M63A 2XULA 4RZRA 3K5MA 4WP9A 2FLOA 5KFRA 1BE4A 4ECYA 5HBMB 5KFPA 3HFKA 3DLGB 4X62J 1JK9B 1HNZJ 1BQMB 3FRZA 1WHXA 2QN6B 2PI5A 2VV5A 5KFKA 3V81B 1FI4A 4QR0A 2ZH8A 2RNEA 1WDTA 1G2EA 4NE9C 3V6DB 4OZJA 3HHLD 4RWWA 2C2ZB 4FYYB 2BW7A 2BVZA 2DCLA 4CH7A 2MQNA 2HWHA 4LFAJ 2R8GA 4OLOA 5EWEA 3TAMB 5A8RA 3C15B 2FHKA 2DGOA 4C8OA 2ZDPA 4JI5F 3CULA 3THVA 1LW2B 3EXCX 5HP1B 4UZCA 3RJMB 5J2NB 1H7WA 4HHJA 3Q89A 4G1IA 3FZBA 3NEKA 2OFGX 4DX5A 1X9MA 4QR2A 2HFVA 2VDHA 2E5LJ 1MW7A 4Q5VA 4WKRA 2V2QA 3BSNA 3CE8A 3OR1B 4URGA 2CJAA 3OLAA 1Z4UA 4FP9A 2HK3A 2P9GA 2OD4A 3VAIA 2VQFF 2RT3A 4LFBJ 2XZDB 1SJRA 4BWMA 3OTDA 3NS7B 3IXQA 1LOUA 3PV8A 2RVJA 1N56A 5KFEA 3R27A 4EO6A 3TARA 3UR3C 4LR7A 3RW6A 2V9KA 1HNXJ 3HZGA 2IRXA 4H4KA 1S1TA 3NNHA 1MU2B 1GXLA 2BX6A 3CD0A 3DHWC 4OHYA 1WELA 2MKKA 1NEEA 1LKZA 2XC9A 2W25A 2W9CB 4C8KA 3AODA 2FVRA 2NZ4A 2E1AA 3CD7A 4ECTA 3V6JA 2GQCA 1VRUA 4I2PB 4JV1A 3ZC4A 4MH8A 3H4DA 2G4BA 4DV5F 3ZZRA 3LTOA 2ZH3A 5DQGA 5D3GB 2OEMA 2YWHA 1XTZA 3U7JA 3CMES 4OYOA 4F25A 3P3DA 3FBCA 6FDRA 1OYEA 1BLUA 3MUVP 1NK4A 2P6TA 4J90A 2QRRA 4Z7YA 2ACYA 1RBOB 2OAUA 2JSXA 7FD1A 2ZBQA 2X51A 3TW0A 3AD8C 3PJWA 2ZBIA 4M5HA 4DCOB 4ZKAA 2HBZB 1WC4A 1DTTA 1XR7A 4Q7AA 1RB0A 2EW9A 4K4TA 3W62A 3CDBA 3AH6A 4TY8B 1YX2A 3KLGA 3ZFVA 2KKHA 3EGNA 2YPYA 3M6WA 3NAHA 3EJMA 4DR4J 4U7UD 3QIDA 3KYLA 3FCVA 2IC3A 4JI1F 2B6AB 4H4OB 2IRUA 4IQMA 4PKDB 2OSQA 3IM8A 1NUEA 1YRXA 2ADBA 5HANA 1XC9A 3SDEB 2KVQE 2EKYA 1JKHB 3F0NA 3P96A 1S1XB 3AY0A 4KIAA 4DQPA 1KHWA 2XMWA 4FNHA 3K2YA 1F6TA 5F8JA 4ZPBA 4OJ3A 4KGVB 2YWFA 5HMZA 1TL3A 1OY6A 2OHDA 1K0VA 3MR6A 1H2UX 3CSKA 3UE2A 1UAWA 1KS2A 2JLGA 5AJ3F 2M0GB 2MZSA 2JHEA 2HFOA 3OTCA 4DF4A 4KQZA 3OSNA 2AGOA 4B3RJ 1H74A 2JC1A 2BANA 4M5KA 2QGFB 3HSGA 4HDHA 1APSA 4C98A 2JL9A 3S1TA 1QLNA 4I4BA 4J9KA 4PUOB 2FTRA 3PX0A 1BD6A 3J81j 5IS2A 2CRLA 4NLDA 3TX0A 1RT2A 5FLXY 3KK2A 2YNGB 4NLUA 1IR2A 3Q2TC 2CZ4A 2LCWA 2KVIA 5KFNA 1RK8A 1PYTA 3D2WA 1UTAA 1M1GA 1NKCA 2HZVA 4LSNA 2FHJA 3H2UB 3M9NB 3MAQA 1RT5B 3KLEA 1T9VA 3CIMA 4LQ3A 3BQ0A 2FLPA 4RW4B 1PJ7A 3EVMA 4Q2MA 5HJXA 3F44A 1RWMB 1ITPA 4KV8B 1H72C 2WB4A 3LO3A 4ANEA 1TELA 5D0GA 2G1HA 1UFLA 3NP5A 1XMOF 4X4TA 1EP4B 1NZAA 2AV5A 4TLRA 3CJRA 4U8VA 2GIQA 3J80Y 5CYMA 2IVFB 1WF1A 3KLIB 2MTLA 4HLBA 5HL7Q 1OPIA 4K4UA 4RUBA 3D9BA 1JJ4A 3F56A 3SZ2A 2H65B 3VVUA 2JEIA 4WTOB 3OJUA 1QSLA 4ZVSB 2ZH6A 1PBAA 3D66A 4ZJQA 3NLCA 3SCJE 3PYEA 2HBRB 2HHTA 1CJTB 1VISA 4U8YA 1VQMS 3EGWB 3W61A 4ANDA 2YPZA 3KWMA 1XQIA 3GJQB 1WHWA 2CA9A 5CQGA 2QL9B 4ECQA 5IT9Y 3DM2B 2DR5A 3UPFA 5B0GA 5F8GA 1VLYA 2XQCA 2DGWA 4QWEA 4W4MA 4H4KC 3VQSA 3K17A 2MGZA 3C16B 3DGPB 2UVRA 4DPXA 4B17A 2J9CA 1KQSR
chains in the Genus database with same CATH topology
4Z37A 3IC1A 3QAEA 1SJ3P 3LH2S 1OS5A 2DK2A 2MMYA 2VFVA 3FMBA 3NGKA 1LFPA 4JUZA 2BDPA 3M30B 4F4ZA 3S6EA 2VONA 3LGNA 1SKWA 2G9OA 2ZC4A 3MPYA 4X84A 1O51A 1MSWD 1WG4A 5T41A 3N5BA 2B51A 1VQ7S 2K3KA 3RAXA 2JJ4D 2CQIA 2LQ5A 2VOOA 3CCWA 1SL0A 2LLZA 1FE0A 4U67Q 2WCXA 3I6PA 3C3LA 2IRYA 5DDQC 3MEGB 2FVSA 4EGLA 4ICLB 1TKZA 2CPHA 3THPA 2BOPA 1NJWA 1FD2A 1FDAA 4OJHA 3V81A 3O8WA 2AWZA 2GC8A 4EWTA 4A8WA 3PW5A 2UUCF 5A6PA 2ASYA 2GV1A 1VC0A 3CD6S 4HT7A 2DD8S 2IM0A 3TUIC 4ZVGA 1D9AA 2KI2A 3CJ0A 3BZQA 4CT8A 1E6YB 2RMLA 3M6XA 4EFAC 1U2RA 3MZIA 3M2RB 4PXBA 1WTBA 2XGQA 3EYZA 1DAXA 3OJSA 2JRSA 4IOCQ 3PDNA 4DJBA 2ZOFA 3H5UA 5L1JA 1EETB 4FVCA 4R25A 3DOKB 1QSYA 2QEXS 3MM9A 3D0GE 1C0TB 2FHOB 1C0TA 2DNKA 1J5OB 5D4OA 2OTLS 3BS9A 3T1HF 3O5TB 1N54B 3V5RA 4WXOA 2M8HA 3QLHA 4P7VA 5DLFA 2PGCA 2FD2A 4PG8A 2C42A 1F60B 1SQEA 4C8LA 4A8MP 2DPIA 4IG0A 3HVRA 2C3OA 1NK8A 2FC8A 2PN6A 1LW2A 5CHCB 1K1SA 2P9CA 3QIPB 2DGTA 3Q8QB 3QIPA 4WZMA 2R7WA 4WTYA 1HW8A 3RR7A 3FEZA 2FVCA 2NUUG 2QLWA 3DLLQ 3UDLA 1VC6A 5DQHA 3I82A 4HH0A 5D4NA 1FERA 1RYSA 4CCHA 3JSMB 1YBAA 1NK7A 1I1GA 3JSMA 3WC2A 4ZHRB 3OL9A 3M6VA 4P7TA 2A2DA 2IM2A 4EO8A 3OFGA 3BSOA 4YB5A 1OO0B 3HJFA 2AQ4A 1M5OC 3MPWA 1HWKA 2OMOA 3MWBA 4DUZF 5KFCA 3T9ZA 1VFJA 1HBNA 4F2SA 4NYPA 1FJ7A 4PPZA 3SFUA 1UWBB 4DV1F 3QJLA 3NBPA 1ZBTA 4NLSA 5HMXA 4U6PA 2VUGA 3CCTA 4J9QA 4DL4A 2DTJA 2R2UA 2CPXA 3VZIA 3HHLB 3MM7B 2MQMA 3DN9A 3HHLA 3MM7A 2J76E 5CA5A 3KLVA 2E7WA 2IAJA 2Z0GA 2EBEA 1P1TA 3UW1A 4NMLA 1SL2A 1WWHA 3CVKA 3T5HA 3GV8B 4O3RA 2WK4A 2CYYA 1QY7A 4JI8F 3RAMA 5A8WB 3HF5A 2WSCC 5J2PA 2E29A 3K8VA 1LV5A 2R8JA 3MEDB 2YWGA 2HQ3A 3OUYB 1X0FA 1UVLA 3MEDA 4WU2A 4I6AA 4TQRA 2WONB 4H54A 1L3KA 2VFUA 2WONA 3PW2A 4F2RA 2FGCA 3V4IB 2C3PA 3OTEA 5KFGA 1X4HA 4QWCA 2KM8C 1XR5A 2HGMA 4BCAA 3G8QA 3S7RA 3HK2A 3V6HA 2QYCA 3I5CA 2ZH5A 1C0UA 3D1QA 4N8NA 1RTIB 4DR5F 2HHWA 1RTIA