4IDKB

Hiv-1 reverse transcriptase with bound fragment at the 428 site
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
412
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detecting Allosteric Sites of HIV-1 Reverse Transcriptase by X-ray Crystallographic Fragment Screening.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 114
structure length 412
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4idkB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4idkB03
1RT7B 1RT1B 4I2PB 4K4YA 5FDLA 1EP4B 3M9OB 2WOMB 3V6HA 1S49A 3H4BA 1SUQB 4KKOB 2J6TA 2DPJA 5KG6A 3UDLA 5KG5A 4JV1A 5KFEA 4G1QB 2C22A 4HYKA 4IR9A 2IC3A 4LSLA 2DPIA 2FVSA 4RW8B 4NCGA 3FSIA 4TY8B 1S9FA 4K50A 3N6MA 2AU0A 1UWBB 1HARA 2E9RX 2AWZA 1JLFA 4TYBA 2JEFA 5C25A 3CJ0A 4O3NA 2W7OA 4QWDA 4NYZA 3MECA 3GIIA 1T03B 5L9XA 3DMJA 3RAXA 2GC8A 2ILYA 1LW2A 2AGPA 2W9BA 2E9ZA 1TKTB 1C0TA 3I0SB 4PUOB 4MK9A 1RYRA 3C6UB 1HYSB 4KHMA 4WFYA 2R8JA 4WZQA 4IH7A 4RNHA 3MEGB 4TY9A 1RTJB 3PJXA 2AGOA 2RKIA 3C6TB 4TQRA 1QE1B 4EEYA 2ATLA 3OL9A 3E01A 2ASJA 5DQGA 3M8QA 4RW4A 1HNVA 2JLEA 4KV8B 5KT2A 5C25B 3CO9A 4WFXA 4K4XA 2XCPA 2C2EA 1RYSA 3NMAA 3BSAA 3MECB 3DI6B 4ED3A 3IS9A 5HP1B 2ASDA 3KLFB 4RW9A 1RTIA 3HVAA 4IOBA 3QO9B 3IRXB 3RBEA 4ZPDA 4O3OA 1SH3A 1MU2A 3MEGA 2B5JA 4OL8A 2FVPA 3PR4A 1S6PA 5F8LA 3H59A 3LP2B 1K1SA 3PW0A 3D5MA 3DM2A 3DOLB 3ISND 2VG5A 1HNVB 3H5YA 1FKOB 2GIQA 5J2NA 3BJYA 4J9PA 3KJVB 1MMLA 3I5AA 4RW6B 4O3PA 5KFCA 1HMVA 3DYAB 5K14B 3CJ3A 5F8GA 4RNNA 3H5UA 3QZ8A 4IH6A 3Q8QB 1IKVB 1SV5B 1JLBB 2FVCA 5KFHA 3BQ0A 4KO0A 3JYTA 5KFLA 2IM1A 2XWYA 3QO9A 5KG7A 3BQ2A 2JEGA 4I7FA 3KMSA 4O44A 5L1LA 2B5JB 4QWAA 5KFQA 5FDLB 3CJ4A 1W25A 5KFIA 3KHRA 3NAHA 3GIKA 4NLQA 5CYMA 3G86A 2HNZB 3PJWA 1CSJA 3HVWA 4EO6A 1JLAA 1FKOA 2XI2A 4KE5A 3ICLA 2ZD1A 4IKAA 5F9NA 5DQHA 3HHKA 2IC3B 4Y34A 5KT3A 4NRTA 1QAJA 4KBIA 4NCGB 1U09A 3MEDB 1XR7A 4ZP6A 4O3QA 5JXSA 1UWBA 5KFOA 5KFFA 4RU9A 3G6YA 3OHBA 1TV6A 2ZE2B 1YVFA 4ECWA 5KFGA 5HBMA 1S1TB 1T05A 3EPIA 5KFRA 4XPEA 4R5PB 3G6XA 4I7FB 1C0UA 2EC0A 4DL6A 4O44B 4NLUA 1NNDA 5KFJA 3TAMB 2OPRA 2AX1A 3DMJB 1NHUA 2YKNA 3MFIA 1DTTA 2GIRA 5KG0A 2XGPA 1C0TB 3I0SA 3ISNC 3KHLA 4ECSA 5DLFA 3C6UA 1HYSA 3H2LA 4Y3CA 2D7SA 1JLAB 4R0EA 1JLCA 1S1WB 3DRRB 5I42B 3CJ5A 2IM2A 3SFGA 1S10A 1BQMB 1IM4A 5F8MA 5KT6A 2J6SA 3LP1A 4ZP8A 5T14A 4F50A 1LWFB 5HLFB 4WYLA 4KAIA 2HNYA 2ZE2A 2W8LA 1RTDA 4X2BA 5DGAA 1TP7A 2W9CA 4WZMA 4R5PA 3OSNA 3M9NB 4NLTA 4ID5B 4DL3A 5KG1A 3KHHA 4NLPA 1RT5B 1J5OA 1FK9B 5KG4A 4K4SA 2YKNB 3CDEA 4TN2A 2RF2A 1JLEB 4DEZA 5KFDA 4RW9B 1S4FA 5J1EA 1RTIB 2UVWA 4RW7B 4R8UA 4RUAA 4Q8FA 1HQEA 1DLOA 1JLCB 2WTFA 4TYAA 5C5JA 2AGQA 4IFVB 3RB3A 5HROB 4QW8A 3MR5A 2FJWA 2WB4A 4TXSA 3IN5A 2FJVA 1NHVA 4NLVA 2D41A 4DL4A 1S97A 4URQU 2OH2A 2FVQA 2W9CB 2I5JB 5EUHA 2AX0A 3DRPB 5D3GB 4ECUA 1RT5A 1EP4A 4Q0BA 4FBUA 4XPCA 3QIPA 2WOMA 1SV5A 3NGDA 3RB6A 4IG3A 1RT2A 4IG0B 1S9EB 1N48A 4NLRA 2QV6A 4TLRA 4RW7A 2YKMB 4R8UB 2IA6A 5J2MA 1HQEB 4ZPBA 4Y2AA 5I3UA 5KFTA 3FFIB 1RT6B 3MFHA 4FBTA 4RNMA 5DLGA 3V6JA 3TVKA 3V6KA 3ITHB 4ZVEA 4MH8A 2VG7A 3LANA 4IH5A 5CYMB 1HPZB 1N4LA 1JLQA 4PQUB 4LSNB 2JEJA 4KFBA 1DTQB 1R0AB 4Q45A 3QGHA 2I5JA 3VQSA 2ZD1B 4IRCA 1T03A 5DG7A 1T94A 5F8IA 2C2DA 3DOKA 3MEEA 1QUVA 1HNIA 5J2PA 4RZRA 1S9EA 3KLEB 1SH0A 3GQCA 4YQWA 3MR3A 5HBMB 3KK3A 4IQXA 3FQKA 3V81A 3UQSA 5L1IA 1IKXA 3HVTA 2BQUA 2HAIA 5I3UB 2YNGB 1LWCB 1XR5A 1VRTA 5KFVA 2OPRB 2RKIB 3C6TA 4ED0A 1QE1A 5J2QA 1T3NA 1DTQA 1JLGA 4ZVFA 1HQUB 3T19A 2O5DA 4NLOA 4J9OA 2OPPA 5KFSA 2XC9A 1TVRA 3IS9B 1IKWA 2HNYB 4ED6A 4NLGA 5C42B 5L1KA 4ICLB 3IG1A 3H5SA 3BSOA 3CDUA 1ZTWA 1LWCA 2W8KA 4I2PA 1S6PB 4J9RA 3OL6A 1JLEA 5EWGA 4H54A 1REVA 3Q8PB 1SUQA 2VG5B 4KKOA 3DDKA 3N6NA 5J2QB 1S0MA 1EETB 2JC1A 1S9GA 3UPFA 3GIMA 3KLIA 4NLXA 4F4XA 3GIJA 4RW8A 4TY8A 3BSCA 2J6UA 1JLBA 4I2QA 4EYHB 3JYTB 1KHWA 2UUWA 5C42A 2CKWA 3IG1B 3E51A 4Q8EA 1RDRA 2UVRA 4QPXA 4WFZA 5DGBA 4ZHRA 4ECZA 3KK2B 3D28A 3M8PB 4H4MA 2XCAA 2JC0A 3QIPB 4K4ZA 5DG9A 4PUOA 4IG3B 3T5HA 3IGVA 4MK7A 3V6DA 4YMEA 1D1UA 4WE1A 3MTKA 3KHGA 1BQNB 1ZTTA 3T5LA 2V4QA 1EETA 1RT6A 4Y2CA 3KLIB 4ED2A 4WYWA 1S1UB 5CYQA 1TL3A 3ITHA 5KFMA 4F4YA 1JIHA 5KFAA 3PVXA 4Q44A 5C24A 1TV6B 4RNOA 2XI3A 1JLQB 2C28A 4ZP9A 1S1VB 2UUTA 1SH2A 4ZHRB 3TAMA 1RTHA 1RT1A 3LP0B 1OS5A 4H4MB 3HKWA 4URGA 4G3IA 3PZPA 3MEEB 3KLFA 1S1XA 1FKPA 1QAIA 4O4GB 2FLPA 4URSA 2YNIB 3H98A 1BQNA 3LALA 1BQMA 1RAJA 5DG8A 5F8HA 2OPQA 2WRMA 1LWFA 5HLFA 2ZKUA 5KT5A 3CWJA 4ECQA 4EBEA 3DM2B 3DOLA 2WONA 1TL1A 3DRSA 4EO8A 5J2NB 2R8GA 2V9WA 2HMIA 4WXWA 3KJVA 4DL7A 1JKHA 1S1VA 4NLDA 1TKZB 1JXLA 4LQ3A 4ECYA 3QYYA 1J5OB 2OPPB 2RF2B 2WK4A 1LW2B 4NLYA 4PWDA 4ZPCA 2W9BB 5KT7A 3PW5A 1N5YB 1GX6A 2IJNA 4J9MA 3H4DA 3H40A 4B3OB 2OPSB 2WCXA 2RDIA 2YNIA 1DLOB 1RT4B 3BGRB 4KSEB 2IMWP 4O3SA 2IAJB 4IFVA 1C1CA 4K4TA 5HROA 2I1RA 5EWEA 3GV5B 4EYIB 5EWFA 1VRUA 2WONB 2BE2A 3DRSB 4KV8A 1KLMA 2HMIB 4U6PA 2HWIA 4YR2A 1JKHB 1S9GB 1TKZA 3DRPA 5D3GA 3GYNA 3KK1A 2R2UA 2FJXA 3OSPA 1TQLA 4MIAA 2IBKA 1S1TA 2YKMA 2OPSA 1T05B 2R2TA 2FLNA 4M95A 1RT4A 1MU2B 4MFBB 3KK2A 3NKYA 4NLSA 3M8PA 3QIDA 4GC7A 1KHVA 2BRKA 1DTTB 3QZ7A 2B6AA 2VG7B 3KLGB 4EBDA 1TKXA 4IR1A 4EBCA 1VRUB 3T1AA 1KLMB 3DRRA 4GC6A 2VA3A 2D3ZA 5KFKA 4F4WA 1N56A 3KLHB 4RW6A 2ASLA 1S1UA 5CYQB 2HNDA 3DLKB 2VG6A 1HNIB 3EPGA 3RBDA 5J2PB 4ZMMA 3KLEA 1LWEA 1S6QB 3I0RA 1JLFB 1JX4A 4IRKA 4J9QA 2CJQA 3MR2A 4U7CA 4ID5A 1Z4UA 4ZVGA 5EDWA 4ECTA 4MFBA 3CIZA 3SFUA 5DQIA 5KFWA 1FK9A 3LP0A 3OLBA 4J9LA 4IRDA 5KFUA 4F4ZA 1S0NA 4K4VA 5KFYA 4JV2A 2YNFA 5J1EB 2UVVA 1FKPB 2E9TA 4FS1A 3RB0A 4ECVA 4J9KA 3G6VA 1RTJA 1RA6A 2F8EX 2BR0A 3KLHA 2HWHA 3DLGB 2AQ4A 3DLEB 1WNEA 3KMQA 1TVRB 4XO0A 2B43A 1IKWB 2W9AA 2YNHA 3KOAA 2XGQA 3M8QB 2V4RA 5KG2A 4RW4B 4J9SA 1TL1B 2IJFA 3T5KA 5L1JA 3BQ1A 3Q8RB 1C1BA 3V4IA 3OL8A 5F8NA 3JSMB 4ECRA 3KLVA 4J9NA 1LW0A 3PW4A 3I5CA 4PWDB 1RT2B 1REVB 4IG0A 4K4WA 2R8IA 3SI8A 1ZETA 1S48A 5J2MB 4IFYA 4RUCA 1S1WA 3FFIA 3BGRA 5I42A 4NRUA 4KHRA 5KFZA 5KFBA 2IAJA 3DLGA 1C1CB 2BANB 3GV7B 4I2QB 4ZPAA 5F8JA 2IM0A 2YNHB 3T5JA 4PQUA 2BRLA 1K1QA 3MF5A 4JUZA 4KFBB 2UVUA 4K4UA 4Q43A 2RDJA 3PW2A 3GV8B 4QWEA 1RT7A 1IKYA 4H4OA 4ZVHA 4JV0A 1GX5A 3V4IB 3JSMA 3DOKB 1IKVA 4HKQA 3NBPA 3EZUA 3LAMA 3I5BA 2BQ3A 3CDWA 3NAIA 4TQSA 3BR9A 4IFYB 2YNGA 5KFNA 1VRTB 1D0EA 5KG3A 4MKAA 3QGIA 4LSLB 2BANA 2B6AB 3KLGA 1TKXB 4FS2A 5C24B 2HNZA 3BREA 3QLHA 3UR0A 2C2RA 4DL2A 1N6QB 3CJ2A 3FQLA 1IKYB 4H4OB 4LQ9A 1RTHB 1I6JA 2W7PA 3PHEA 2QE5A 4MKBA 3OL7A 4Q0BB 2HNDB 3DLKA 2VG6B 3MEDA 1S1XB 1TKTA 4M94A 3PR5B 2FVRA 4O4GA 3NBPB 1LWEB 1S6QA 3I0RB 4ICLA 3QGGA 4NLWA 1RT3B 4ZP7A 4O3RA 1C0UB 2V0NA 4IDKA 2OPQB 3RAQA 1XR6A 3E01B 4ED1A 3LAKA 2VA2A 2YNFB 1HPZA 3BSNA 4LSNA 3FDSA 1S0OA 3QLHB 2R8HA 5JUMA 3NL0A 3KNAA 1R0AA 4KB7A 1N6QA 3H5XA 3OHAA 4DL5A 2JEIA 3DI6A 4DG1A 3LP1B 5KFXA 3DLEA 3N6LA 3FRZA 2R2RA 4YR0A 4ECXA 5HP1A 5KT4A 1N5YA 3RB4A 2BQRA 1C2PA 4B3OA 4WXOA 3IRXA 4YR3A 3KK3B 1RTDB 4ED8A 1RT3A 3V81B 1IKXB 3HVTB 5KFPA 3GILA 2R8KA 2R2SA 2IM3A 1C1BB 4IDKB 2FLLA 3OLAA 1LW0B 3LP2A 2ILZA 3PW7A 2WHOA 3V6DB 4QWCA 4WE1B 2BE2B 4MIBA 3IGNA 1JLGB 4RNFA 1HQUA 3Q8SB 4G1QA 3TQ1A 1HMVB 3DYAA 5K14A 4DG1B 3KK1B 3CVKA 4MK8A 1TL3B 4YP3A 2D3UA 3MR6A 3M9MB 4ED7A 4KO0B 4QWBA 2ALZA 4O4RA 4NZ0A 1RA7A 5F9LA 4QW9A
chains in the Genus database with same CATH superfamily
1RT7B 1NU4A 4DCOB 1ZAXA 2Z57B 4I4BA 1VHFA 4UOHA 1IWGA 2HGMA 4K50A 4YOEA 4P71A 2WBRA 5K20B 2MKYA 4KKOB 4ZVQB 3GJQB 3SQGB 4C0OC 2V9KA 2FC9A 5KG6A 1YJUA 3RJMB 4B17A 3M6WA 4DV5J 1SL1A 4C0BA 3GR1A 3LO3A 3MM7A 4FXWA 2QG9B 4BWJA 4DPYA 3JS9A 3SSRA 5LSRA 2BOAA 1DBDA 3GFYA 2DPIA 2P9GA 5ETOA 2ZH1A 3GTYX 2G0CA 1UWBB 2CJBA 4JI6F 3WC0A 4A46A 4L6V3 5A8RB 1HARA 2DH9A 2QFJA 4TYBA 2OFGX 4ZOSA 4CO4A 5C25A 1WKLA 3NOGA 2W7OA 2B9YA 1VQMS 5KAKA 4NYZA 3MECA 2I38A 5A76A 3GB0A 1U1OA 1VQ5S 3DMJA 4GO5X 3IAM9 4OYWA 4TU8A 7FD1A 2LQJA 2I2YA 4DSIA 2C2ZB 2VPWB 1JXVA 3HSZA 4ZIVA 2J7KA 2W9BA 1RYRA 4MK9A 3C6UB 4KHMA 2XM3A 4LRFA 5L8RC 1IQTA 2R8JA 2ZZMA 1NB2A 4IH7A 2Q1LA 4TY9A 3K8WA 1YZ6A 3PJXA 4FNHA 3CT9A 2RKIA 1QE1B 3VVUA 1FRIA 4CLTA 4YY3F 1H38A 4I64A 5DZ7A 1YRXA 2WW4A 5DQGA 5F0UA 2GJIA 5FD1A 2ZBQA 4OX8A 2ASJA 4KH0B 3CO9A 1M5HA 2AEMA 3FEYB 3R5DA 2AP6A 2XCPA 1S12A 4GKJJ 5ETQA 3IS9A 1FVQA 4KT0C 3G2XA 5ETMA 1TMJA 4DZ6A 3SV4A 4OYBA 2B4UA 4CCHA 4ZPDA 3KYLA 5BYSA 5K8MA 2K1RA 2R42A 3PR4A 5A8WB 3LGHA 4LFAJ 4IUFA 1HBNB 4TLQA 5JMNA 1D9AA 3CCJS 1K1SA 2NUHA 5AXNA 3Q22A 3MAHA 4DFPA 2VG5A 4ER8A 4NE9C 3H5YA 5J2NA 3VALA 4J9PA 4X66J 1RSCA 1P9QC 4B9NA 1X4AA 2GHWA 2RH3A 5KFCA 1HMVA 5K14B 3HVRA 3DKDA 2PMZD 3J80U 3KG1A 1QSSA 1U1MA 1SV5B 1JLBB 3VGTA 5KFHA 3TX0A 2Y0SD 3BQ0A 4KO0A 4HR2A 5KFLA 3SIPB 2ZITA 3TA0A 1Y4ZB 3BQ2A 4RX6A 3M2VB 4X4VA 1NJYA 1FI4A 3KMSA 3PRBA 1UEUA 1RLCL 1SC6A 3GLJA 4EMDA 1VC5A 1JQGA 1VCTA 4HI2A 1U2CA 2KN4A 4DXLA 5HMWA 1LOUA 3CJ4A 1W25A 2YKOA 3W5ZA 4DWIA 1RISA 1YK9A 4L74A 2C3YA 4EK2A 2HNZB 4EO6A 1G2EA 2VFSA 8AT1B 1NJWA 2XI2A 1FKOA 4DQRA 4P73A 1D9DA 4C4WA 2H65B 1HWUA 1Y00A 3EJMA 2DR8A 1NH7A 2V2QA 4DL0C 3PKMA 4KR0B 4NRTA 3TJ9A 1U09A 4G3IA 1TL7A 3ILLA 4AUKA 2RHQB 4RU9A 3G6YA 4ECWA 2ZE2B 1YVFA 1S7IA 3R5JB 4HL9A 2LKZA 3BDPA 1LWXA 1KVJA 4A8YA 4JI0J 2Y8YA 2EC0A 4PCQA 5KFJA 4CRJA 1NHUA 4EGLA 2BM1A 4NA2A 1U48A 3MM5B 3H2UB 3I0SA 2BDPA 1FRXA 2QX0A 3CGIA 1X8DA 3C6UA 3H2LA 1EARA 4WTOB 2D7SA 1SJ3P 3EX7B 1S1WB 1S10A 3JTNA 1KNZA 4QR1A 2W25A 4RWWA 4KC5A 2JX2A 2GGPA 2NXUA 3LP1A 2XMJA 4ZP8A 2HVIA 1X9SA 1S76D 1H2VZ 5HLFB 3N5FA 4OV6A 4L73A 4DS5A 4JV5J 1D8ZA 1TAUA 3MM9A 2ZE2A 2NREA 2W8LA 1RTDA 2M88A 4WCEQ 1L3SA 9ATCB 4NLTA 2YWKA 3EVWA 4JOUA 3ZTRA 4DL3A 2YX4A 3VR1A 1T11A 3F0NA 4RO0A 3OXLA 1TU0B 1VIOA 2F40A 2RF2A 1ZM9A 1JLEB 2HFNA 2CVIA 2J8SA 3CDEA 3NCRA 2M4MA 2GVZB 5CD4A 2YWGA 2G2ZA 3HCXA 2DB1A 3HHLA 2QLWA 5DRKA 2AIRB 4R8UA 1VQNS 1HQEA 3MOZA 3RBZA 2KFZA 2WTFA 2CQCA 4KIAA 4MAKA 2R7WA 2MZRA 4A8SA 1E6YA 3RGIA 4QW8A 2ZWOA 2WB4A 3EM1A 4DSFA 1FJGJ 2G13A 3N4WA 1CQNA 3UD3P 2D41A 3M2RA 2MZTA 2MKSA 3AA8A 1GQEA 1WKJA 2HFOA 3HD1A 5EUHA 5BXIA 4RL1A 4QCLA 1EB0A 1ELOA 1GFWB 1X0FA 3GJSB 2LFVA 1UPMB 3NGDA 2CIMA 4GMKA 2UUAF 3IBFB 1CS4B 1EZZB 1N48A 2QV6A 5JVHQ 4RW7A 2B4OA 3P4UB 4ZPBA 2VODA 4EFAC 4AQYJ 2CQ2A 2C2NA 2DT9A 4FBTA 4YFUA 4F3QA 3M05A 3MUVP 3NNCA 1F9EB 3ITHB 4NA3A 2MXYA 2XLJA 5EGYA 4IH5A 1IM6A 3LA0A 4F7VA 4ZLLA 1NJXA 2R7UA 2HQDA 1CJUB 1JLQA 2QSWA 3NGKA 2V50A 3R9LA 4E2FB 4KFBA 3HHLD 4RU2A 3QGHA 3VQSA 3BKFA 1T03A 1FVSA 3GSIA 2PO4A 2GNKA 1VR6A 1WHXA 3DOKA 4OZNA 2M70A 3E8OA 1Q8KA 2BKPA 1HNIA 2OD4A 1V3SA 3Q0AA 1L3KA 2ROPA 4UUXA 1G6BA 3K17A 3L4BC 3KLEB 2H5IB 3M8RA 1N52B 4OLPA 3UQSA 3UW1A 2QLBB 3WDOA 1FX4A 1URNA 2MKIA 1U47A 3OQ2A 3THPA 5KFVA 1NHKL 4X62J 1B7YB 2RVJA 3C6TA 1QE1A 4CLLA 2VFVA 1FXLA 3IWXA 3G82A 3IWLA 4UOGA 1O8BA 2DHHA 2Z4PA 3FKBA 5HJYA 5IV3A 3TYTA 1XNQJ 3LPYA 2YTCA 1JLGA 1VJQA 3RR7A 3T19A 1YQHA 3CB4A 3BBCA 3KUGA 5AXKA 3RYLA 5L9NA 2XC9A 2XYPB 2KT5A 2RE1A 3ILOA 1SC1B 1SQFA 2ZVSA 1UVKA 4GKJF 1IKWA 2X7IA 1MROB 1RK8A 4NLGA 4X64F 1PIEA 4P2SA 1UVNA 5E7OB 3UD5A 2O1PA 4ZA1A 1F1BB 3TJAA 1GT8A 2W8KA 1WC3A 3IA0A 3ONQA 8RUCA 4YHHJ 1LXJA 1CJVB 5HANA 3J81j 3TUPA 5B0GA 2JHEA 2OGUA 3Q8PB 3LTOA 4KKOA 3A1YG 1BWEA 3G6ES 5IT9U 3MCNA 2HVEA 4DSLA 3BO4A 2KVIA 1XMQF 1S0MA 3M7VA 2B9EA 5E0OA 4U95A 3GIMA 4NLXA 3UNYA 2HQIA 2F1FA 2VUGA 4TY8A 5D0GA 2VC0A 3PJ9A 4EYHB 3NRBA 3JYTB 2D9OA 1KHWA 3TEHB 4K5SA 1S59A 2RNEA 2JDJA 2W2PP 2CKWA 4Y2MA 4JI3F 1RDRA 3TJ8A 4DR2F 2JLFA 4K8RA 1JWWA 5ETTA 3KK2B 3D28A 1QM9A 4M5DA 3R2CJ 2BKNA 4P9SA 1ACMB 2VONA 1MNEA 1WEXA 4K4ZA 1U6BA 4A8XA 5MAOA 4MK7A 1M5SA 2BUNA 3T5HA 1D1UA 3MTKA 4B3SJ 2CG4A 4J7CA 4LFCF 2L9NA 3BGFA 3T5LA 3ZZTA 1YJ9S 5GADI 4ED2A 4DV4F 1LK7A 2XS2A 4FF2A 1TK8A 2CJXB 4RNOA 2XI3A 5AE1A 1F2GA 3MEKA 5K8PA 2XLIA 3T1YF 2PMHA 1ZAVA 3GPAA 5FIIA 3GYGA 1KONA 4JI0F 3TAMA 1X0PA 5FJ4A 3OD2A 3HMJG 2ZNYA 2ZJRQ 1RAEB 1YGYA 3PZPA 3BZQA 1FRLA 2DNGA 2PA3A 2DNQA 2DY9A 4ATNA 1FKPA 1RHKB 1G1XA 1R8AA 4O4GB 3ZNJ1 4URSA 2YNIB 3OXFA 1BQNA 1X5SA 3WBZA 2E1CA 1KSPA 3CD5A 5B0DA 1NDCA 3BGLA 1UAWA 5CZXA 5DG8A 3PX4A 5H9EJ 3T41A 3TA1A 2HBRB 3LWLA 1YIJS 5D4PA 1DRZA 1VQSA 4NA1A 2MQNA 5AE2A 4UTGA 3DRSA 1M0SA 2CVEA 5J2NB 5DDQC 2MZ1A 2Q66A 4I69A 3KJVA 1JKHA 1CC8A 1TKZB 3HZEA 1CPZA 1F0XA 3IM9A 2E44A 4B3MJ 2OPPB 4LR8A 3RW6A 2KZMA 3FC9A 1LW2B 4LBHA 4ILLA 1U2FA 4ZPCA 5KT7A 1GX6A 1R6YA 2EPIA 4OX9F 5LM7E 3H4DA 3H40A 2WCXA 2CZ4A 1DLOB 1KFDA 1RT4B 3QAUA 3BGRB 1PBAA 3W8PA 4IOAQ 2BA9A 4X4SA 3OVSA 4IFVA 4DSKA 5HROA 2DGWA 1YZ7A 2I1RA 5EWEA 1CJVA 2HYIB 2JVRA 1WC5A 5MLCV 2BJ3A 2MQQA 2XNRA 3OFGA 5E3RA 3AB2B 2OKQA 1SJFA 1KWMA 2L3MA 2DNMA 2K2PA 3SBMA 5IV4A 1S9GB 1TKZA 5D3GA 4ZKAA 1QDUB 1SB6A 3GYNA 2DCLA 3ZZRA 4DV6J 3KK1A 4X64J 1FEEA 1MN7A 2OMOA 2N7CA 3WIVA 2PFFB 4FYVB 1H2TZ 2EFGA 3A13A 3RW7A 2KM8C 2IBKA 2J0WA 3CMES 2R9LA 2FLNA 5BYQA 4M95A 3H7HB 2HHVA 2GZOA 1VYAA 1J27A 1SIZA 4ZS6A 4NLSA 3NKYA 3P96A 4Y28C 1KHVA 2BJ7A 4IR1A 4F25A 3MDFA 1TKXA 4DS4A 2QTWA 2LMIA 3IC1A 4WU2A 1WELA 2PGCA 2P6TA 4ANCA 2KU7A 1VRUB 2Z2LA 2ZBCA 5A0YB 1Y0HA 3B54A 4ZVPB 4DUZF 2KRBA 2KJWA 1N5QA 3B4MA 2ASLA 2SXLA 1QVFR 1J5EJ 1HNIB 4DPTA 5A8RA 3G4SS 3KLEA 2D1CA 5CD4H 1NSKL 2UV8G 1UA0A 4OJHA 1JX4A 2LEPA 3NCQA 2MZJA 2NZ4A 3BPSP 3NNHA 3RRHA 4ANEA 4ID5A 5LMUF 4A47A 4B3SF 4IRDA 3SFUA 4P72A 1FK9A 4BC7A 1UVIA 3KUEA 4HDHA 5KFYA 4F4AA 3NG8A 2OIHA 2W4CA 1RKIA 2CNLB 3C15A 3I96A 4E8UA 3J81U 2PMWA 5M2RA 5IM0A 3I87A 3TANA 2R7OA 3AB4B 4DR3F 1NPKA 1AXQA 5E3CA 1RA6A 2F8EX 2HWHA 1NRKA 3DLGB 2EI5A 2K7JA 4RBTA 4B9VA 2DNKA 2RRNA 4HACA 3AXMA 2ZH6A 2LVWA 3KOAA 4F3MA 3M8QB 1CULA 5KG2A 4OZ0A 1RAGB 1XMOF 1Y11A 3T5KA 3KWMA 4ES2A 4ZIWA 3BQ1A 1Z1ZA 2N4DA 5A2QU 4NPOA 5A8KA 3OL8A 4GKKF 4DPOA 4IO1A 4W90B 2IRXA 2JH3A 3PW4A 1CJKB 3D4JA 3R5BA 3CCRS 3M32A 4GRSA 2R8IA 1OY8A 2RUGA 3W1YC 2IIHA 4ELTA 1LQ9A 4BWMA 1KQSR 4IFYA 4RUCA 5H9FJ 3FFIA 3K5MA 5IT9Y 4KHRA 1P6TA 3MMBA 5KFZA 3N28A 2IAJA 1GEHA 3M6VA 3UDEA 4C11A 3W9IA 5KFBA 5JVGQ 1U1KA 5F8JA 2IHR1 1WTBA 1K1QA 1LV5A 3ILJA 1HBOA 1NMEB 4Q43A 3G96A 3PW2A 3GV8B 4ETZA 4ZVHA 2Q3PA 4O0NA 2XZDB 5A8KB 3R6GB 4FPIA 3DOKB 2VBZA 4ZJLA 4X4PA 2POKA 1I1GA 3KG0A 1OQ6A 2DYAA 4KGVB 3QT8A 4HKQA 3NBPA 3CNQP 4P74A 1DZ5A 3HX9A 4F8RA 5IWAF 5BR8J 3IFEA 3NAIA 5G0RA 4TQSA 2GS8A 2RB7A 4IFYB 1K9MT 2CYYA 3MM7B 3A4TA 1O51A 2VQFF 1EQMA 2IYIA 1BWVA 2Y9HA 3D68A 4ALZA 2QYCA 2V2KA 4DX8H 3CUNA 1QAYA 1PC4A 2HLUA 3D3CJ 3GJTB 1FJEB 3PIPQ 1RB0A 3W60A 4YUDA 1URRA 2GW8A 4HH1A 1H73A 1IKYB 2CZVC 5ETRA 4MKBA 3OL7A 2AHOB 9RUBA 1KQGB 3G9CA 4M94A 4B02A 2RU3A 2FY8A 2FVRA 3TVZA 4ZVTB 2AZ1A 2EKYA 5E3QA 3QGGA 4ICLA 2U2FA 3NP5A 4LRBA 3VAHA 2B8QA 4DQQA 1WG4A 2BOPA 4O3RA 1ZH5A 1AT1B 3CJQA 4KH1B 2OELA 3DGVA 3E01B 2CFXA 3FCWA 3RBEA 2YNFB 3NS5A 1KVKA 1NDKA 4A4JA 1GMWD 3HI9A 4ZN1A 4QU6A 2ACMA 3D6TB 3W9HA 1OYEA 1R0AA 3TUJC 2YXLA 1Q81T 1X60A 3PFOA 1VK8A 2JEIA 3VHQA 2H4YB 1HNWF 2F4VF 2NZCA 4DUYJ 4YR0A 3FRZA 5DJBA 5K8NA 2A2CA 5HP1A 1S0VA 1DHMA 2CQ4A 4OMFG 5LMNJ 2BQRA 4N41A 2CPFA 1SKRA 2GA7A 3IRXA 3POTB 4YR3A 2WW8A 1RTDB 4ED8A 1U4BA 3HVTB 1HWKA 3BN4A 3GILA 2R8KA 1MWZA 2QO3A 1WHVA 4LBIA 2FLLA 2KZZA 2CRLA 2GQ2A 1L3TA 3CDAA 3T3FA 1HFEL 2KI2A 3CCZA 4ZCMA 1WDDA 1L5UA 1IUJA 4PG8A 1RHMB 2I9SA 3IR6B 5GMDA 4C0HA 3PTWA 5EX3A 4HDGA 2EVZA 5E3AA 3Q8SB 3Q8UA 1XC9A 1HMVB 5K14A 1IBCB 3KK1B 1NEEA 4MK8A 1X9MA 1TL3B 4CM0A 4JI6J 4P2MA 4LVOP 1Y5IB 4KO0B 2XWXA 3CCMS 3ET6B 4ED7A 4N7TA 3SCIE 1X4HA 3C66A 1Q86T 3Q83A 4DV3J 3BYRA 5HL7Q 1N0UA 1M5VC 2K06A 1XK8A 1RA7A 2XZTB 5GAEI 4M5NA 2FB0A 2XLKA 3MCOA 4K2JA 4L76A 4DUTA 2JFDA 1PYTA 1EP4B 2FHMA 1KOHA 2V69A 2VPYB 3R1HA 2V8VA 2HEKA 3THVA 3V6HA 4XK8C 4CP5A 2DH7A 4PR6A 3H4BA 2J6TA 2HKEA 2RQKA 4X66F 3DLBA 3F73A 1NLKL 3UDLA 1I3OB 2HQ3A 5KG5A 2DR6A 2DVIA 4JV1A 4F2SA 4IR9A 2IC3A 4LSLA 2FVSA 3O8WA 4L3NA 1FDNA 2ZC3A 4USJC 4DN0A 1SXLA 1NJIT 4FXVA 3ET6A 4KY3A 4LF6F 1V5VA 4KHPJ 3FZBA 1JLFA 3TP2A 5HQ8A 3MHYA 3ENAA 4O3NA 5H1SV 2MKJA 2DJWA 3D1QA 4ZLJA 1NK4A 2O67A 3EE3A 4I0WA 2GC8A 2ILYA 2KH9A 1GAOA 1G4CA 2AGPA 2E9ZA 3MWBA 1TKTB 1C0TA 2YQ0A 3D9BA 3ZXWA 2GJFA 2MGZA 1Q1KA 4WFYA 1Y3JA 4JI1J 3RRKA 4G1PA 1N36J 4DR3J 4PPDA 2AGOA 3C6TB 4CNZA 4TQRA 3NEKA 2VU5A 3L3CA 4EEYA 2BZ2A 2HBQB 2YKPA 3M8QA 2LA4A 4J90A 3UVJB 3F41A 1HNVA 3VGVA 2UXCJ 1APSA 5KT2A 5C25B 4DZDA 1F2HA 4WFXA 1K0VA 3ENVA 1ZOTA 3DDNA 1WJ9A 3DI6B 3DN9A 3FSYA 2MKKA 5A6WA 2ASDA 3KUHA 2P8IA 2ZH2A 4WFBQ 4RW9A 2V8GA 3CCVS 1RTIA 3F44A 3C14A 2J76E 4A8OA 3AQPA 2CPXA 1EX8A 4DR7F 4KYZA 2MMYA 1M1KT 1FE4A 4B3TJ 4OL8A 2P6SA 1S6PA 1U02A 2QSFA 2GX8A 1VQ6S 1FRKA 3H59A 2AD9A 2XZWA 1Y7PA 5AXLA 1DJ0A 3D5MA 3DM2A 3DOLB 3ISND 5D15A 2VB6A 3PW0A 5F41A 4F4KA 3DLHA 2G4BA 3I4PA 3R5AA 3KJVB 1MMLA 2RMLA 3AJ2A 3I5AA 3HPOA 1FT8A 1AFJA 4O3PA 5F8GA 3EGWB 1FO1A 3CXCR 5M2PA 1SI9A 2FVCA 3BF4A 2IJRA 3AH6A 4CM2A 3U7JA 1JNRB 1S6UA 2XWYA 3HJVA 1RHJB 5KG7A 2JEGA 3TW0A 1M90T 5BR8F 2G2OA 2Y1JA 1FD8A 2DNOA 5CA5A 3TRGA 1SKSA 3DOMB 1N5VA 3K5OA 1NK7A 3TQEA 3CJTA 4LF1A 4PEOA 1T9YA 3UE2A 4NLQA 3GIKA 4HH0A 2O3DA 1PKUA 4DQPA 4UW2A 3TAPA 1JLAA 2GVDB 1TFWA 2HHPA 2NS1B 4LJMA 3ICLA 5EHHA 5DQHA 3HT3A 1UW4A 3M6XA 1E6VB 2MLZA 3M6UA 4RJVA 4Y34A 5KT3A 5L1KA 4KBIA 2EK6A 4ZP6A 1XR7A 3PXGa 2DNRA 1WF2A 4PXDA 2E5GA 4OYMA 4O3QA 2IFXA 3TNVA 3OHBA 3V6JA 2X3GA 3JSRA 5KFGA 5HBMA 1T05A 3D6FB 4OZ1A 3IM8A 5KFRA 1S57A 4C2MA 4XPEA 1NO8A 1UMJA 3G6XA 4O44B 3J7YU 3TAMB 1T7PA 2HHWA 2FJEB 4DFMA 2YKNA 1O0PA 1MW7A 1DTTA 2DRBA 6FDRA 2LEBA 2AYMA 2ZVIA 5I3PA 4CWBA 2OSQA 4GC7A 2K7KA 2E1MC 3R1LA 2G1DA 2V2VA 1HBUB 1N54B 5K8OA 1UJ6A 5A0YA 4AQYF 4R0EA 5IQQA 1DFDA 3CJ5A 3DRRB 4LF9F 1U7LA 2Y8WA 3P6YC 1KN6A 5F8MA 1IM4A 4LF6J 1PGZA 1ZZNA 5T14A 2L9WA 1LWFB 3PFEA 5D77A 3G8TA 1P27B 4KAIA 1QUPA 2FY1A 2X51A 2HNYA 2QZ8A 3HFKA 4LT6A 2F9DA 2RQ4A 3N0VA 5B0EA 3JB9k 5DGAA 1Z2ZA 1RWNB 2CG8A 3G87A 5IT0A 4X62F 3OSNA 3M9NB 2HVZA 1CJTB 4ID5B 1V3RA 3IXQA 4LFBJ 4NLPA 1TUWA 5KG4A 1FK9B 2QL9B 3EZ5A 2YKNB 2FTRA 2PE8A 2VBWA 1VQ7S 5KFDA 2UVWA 1RTIB 3W63A 4FYYB 4RW7B 3W61A 1TKDA 4Q8FA 5IM0B 5EX0A 1XMBA 4D3GA 5GADU 1RBLA 4ZVUB 4OJ1A 1SKUB 4DV0F 1XN9A 2OO4A 4OHVA 3GG1A 4X4QA 1AFIA 2IY5B 4IFVB 2X1BA 3BN7A 3RB3A 5LXRA 2VPXB 3MPWA 3IN5A 1FNMA 3AQOA 3UR3C 4BDPA 4USKA 1R7IA 2DEJA 4OYIA 4URQU 2FVQA 1S4EA 1WG1A 3EXCX 4YHHF 2KXNB 2W9CB 1XIQA 2ZHBA 3DRPB 3D6HB 4FDFA 1EKRA 4LF5J 1TAQA 1RT5A 4FP9A 4Q0BA 4FBUA 1IR0A 5D0HA 3FMWA 3I56S 4IG0B 1S9EB 2L41A 4NLRA 3IO1A 3CJKA 2M52A 5IOLA 3HHLB 4R8UB 1XMQJ 4E98A 2DHSA 4JYAF 1GK8A 4Y2AA 5I3UA 3MFHA 3FFIB 3MPDA 5E3PA 4WZMA 3BDEA 3TZYA 3GCXP 3TVKA 3QMQA 4ZVEA 3LANA 1QY7A 2BYCA 1HPZB 5M2UA 2DHAA 3Q24A 2V8DA 4ILRA 4CH0S 3C46A 2DGQA 4QR2A 1R0AB 2I5JA 1UFWA 2CQIA 3HULA 4CTAA 2IDLA 2VFTA 3R2DJ 5F8IA 4U96A 4X2BA 5JJBA 5D78A 5J2PA 1WWHA 4Y2IA 3OTOJ 3GQCA 2VBXA 4C7QA 4IQXA 2XEXA 5L1IA 1IKXA 2KTQA 2DISA 1U0HB 1UW9A 1LWCB 2F4FA 1VRTA 3G71S 1T9WA 5CXTA 3V2UC 4PRFA 2HK2A 2RKIB 5D6GA 4M5MA 3PM9A 2DNPA 3HHDA 4B08A 3IBCB 4JI8F 2X1GA 1CJUA 2QL7B 3NWGA 4YB6A 1EAYC 1WOPA 4ZVFA 1B0VA 4NMLA 2HW3A 4HTIA 5GAGI 5KFSA 4N8OA 4F26A 4PPZA 1UTAA 3IS9B 1I5OB 1IBLF 1SJQA 3DHXA 2H4WB 2ZOFA 5ITHA 1WDTA 1ZA2B 4ZN3A 1N32J 3IG1A 4FYXB 3H5SA 3UO0A 3I4HX 2XY6A 3B78A 3CDUA 1F9HA 3D54A 3IAS9 4KGKA 4NX9A 1FNOA 2CQDA 4I2PA 3B8HA 3T1HF 3EVMA 1HNXJ 2V4JA 3OL6A 2XS5A 2CQ3A 1JLEA 4L75A 4RWXA 2OTLS 2OHDA 1SUQA 2VG5B 1XEZA 5J2QB 1EETB 4QYZJ 1UP1A 3KLIA 2MEWA 3N79A 2B4VA 1RHQB 3R97A 5GMKa 4G6VB 4CH7A 3IRWP 1JLBA 3SYZA 4LR7A 1IQZA 3PRDA 4BC9A 2DBBA 3MD1A 5C2CA 2KL8A 3ZZOA 3X1LB 2HWTA 2B7BB 3AD9C 3O5TB 1T9XA 1I94F 2UVRA 3W9JA 2A6OA 2GMHA 4ECZA 1N34J 1WEZA 2KYXA 3S8SA 4H4MA 4I6AA 4DV5F 1K73T 4JI5F 4WP8A 4WFNQ 4Q2LA 2GAGC 3AODA 3NGSA 4FKYA 4PUOA 4IG3B 4F0HA 4DV7J 1GXTA 1CS4A 1UJ4A 3V6DA 3VAFA 4NXNJ 4WE1A 3TA2A 4UF4A 1ZTTA 4PABA 2V4QA 2XB2D 3S01A 1RT6A 1QTMA 5A2QY 4OI4A 1JJ2R 3OTBA 4OYZA 1R8BA 5CYQA 5ETLA 3OUYA 1TL3A 3ITHA 1MSWD 1TL7B 4PG7A 4PKDB 5B08A 2GCFA 1VFJA 4Q44A 5C24A 1U25A 2H54B 3BKUA 4QZVB 5KTQA 2MQPA 1VS3A 5AJ3J 4LF5F 4NXMF 4HTJA 1YBUA 1AA1B 2FLOA 1SH2A 3FVYA 2EEYA 5CH7B 2J8AA 1RT1A 1OS5A 2FZCB 4URGA 2GMJA 1S1XA 3C16A 4ZLPA 4YY3J 2XQCA 3P5TL 2YWWA 1T0TV 3H98A 1YBTA 5J1NA 3D67A 2IA6A 1N5SA 1RAJA 2XO6A 1ZYQA 2CDQA 2HZVA 1G3OA 2WRMA 2HS0A 2ZKUA 3LF0A 3CWJA 5KT5A 4ECQA 2MQLA 4NEZA 1IJFB 3G82B 3CJRA 2VOPA 5DM6Q 2KXFA 3PYEA 4DPWA 1TL1A 2HBZB 2J0XA 4KGZB 4DV6F 2WVDA 2XNQA 2ZBPA 2CJAA 4AXJA 4BCAA 4X65J 4DL7A 3QRRA 1ITPA 4NLDA 3QPIA 1YJTA 4W4MA 1JXEA 3M30B 1WSVA 4I6WA 5HAOA 2RF2B 2DIUA 4CO0A 1KOOA 1H98A 3FEXB 4DI6A 2W9BB 4OV1A 1SBRA 4A48A 4B3OB 2RDIA 2MGZB 3M2VA 2NLWA 2Z58B 5SZTA 2DNLA 4JI8J 2IAJB 4TNOA 4OJGA 2P2CB 5LSLA 2NCKL 1C1CA 4P6QA 3HO1A 2F9JA 3OBIA 3GFXA 5EWFA 5B0AA 1PCAA 2LQBA 2DD8S 4PXEA 2WONB 2BE2A 4PWUA 4C6AA 4KV8A 2HMIB 2GHPA 1ULRA 2HWIA 2JRSA 1JKHB 2XY7A 1N32F 4ZDNA 4WFAQ 2ZEJA 4OZLA 2FJXA 2NXEA 1HHSA 2C2OB 3J7A1 3Q2SC 3FSXA 4DQSA 1UFKA 1WG5A 2AEFA 3GE9A 5HI7A 3T1HJ 1S79A 1S1TA 1YITS 1Q7YT 3D0HE 1R6VA 5F0WA 5G0RB 1D3WA 1RT4A 2XMMA 3FNNA 4CLFA 1VC6A 4ZJQA 2W2MP 2B4PA 1GTHA 2F3JA 2EBGA 2J0QD 4USIA 5HMYA 3QIDA 4B9UA 2KYZA 1HW8A 1DTTB 4PYAA 2B6AA 3KLGB 1V9OA 2VASA 4EBCA 4LF8J 2IA0A 1NPPA 4J9UE 1FWKA 1HBUA 2ZM6J 2HVHA 1RWUA 2ZUAA 1TK0A 3DRRA 3MM6A 5CAAA 1QVGR 2VA3A 4F4WA 1GMWA 1Q5YA 1OJ4A 3KLHB 1WC6A 3I6PA 3S1TA 3WIUA 4X4UA 1R27B 1S1UA 1HI1A 2MKHA 3W2WA 2B9WA 4USHA 3WQPA 2FYXA 3CIMA 4USMA 3EPGA 3RBDA 1WSRA 1RAIB 1PO6A 1KLNA 1FERA 1LWEA 1S6QB 5HQLA 3I0RA 3NS7B 1JLFB 4KGMA 1AB8A 4DSEA 2CJQA 1PJ6A 1FF2A 4U7CA 4USTA 5EDWA 1VQPS 2K8GA 3I9V9 4NI2B 1NDLA 4X84A 3AY0A 2E5IA 1RAOA 2YNFA 3MI7X 4JB8B 3CTRA 1FKPB 3CCTA 3CO0P 4KGXB 3R5CA 2VZ9A 4USUA 4X4TA 2VJVA 1ZPWX 2QGFB 4FS1A 2G9OA 2QLFB 1HNZF 2UXBF 1WTFA 3UNGC 1H7XA 2CPDA 4NXMJ 4DU7A 1RI7A 1WNEA 4QR0A 2DY1A 3KMQA 3EXYA 1V6HA 2IPOB 2VDHA 4RBVA 5T41A 3ZTQA 2QA4G 2F8MA 2XGQA 3NOCA 2E5JA 4RW4B 1Y5LB 5A6PA 2IRUA 5KOWA 2IJFA 1ZPVA 1OSDA 4IQMA 1R0CB 1C1BA 3JSMB 1B7FA 3KLVA 5K9FA 1RT2B 2M2BA 3RZAA 4K4WA 2EBEA 2F8HA 3C14B 4LF7F 3MGJA 3QAEA 2VQFJ 5J2MB 1OSCA 2Z56B 3OTCA 3PNIA 5HO4A 3M8SA 3BGRA 1YRTA 2BJ1A 2IYGA 4MKYA 3I32A 1D8YA 3H20A 4X65F 1FJCA 1C1CB 1OPIA 2BANB 3BH7B 4CLWA 4ZLNA 2ZH3A 1LK5A 4B9MA 4BHQA 2UUCJ 2R7SA 2WSEC 1SJ1A 1WKKA 4KPYA 1SCJB 4OYOA 4JUZA 4DV3F 4K4UA 4QWEA 4H4OA 4M63A 4JV0A 4I1TA 2CUYA 3NMRA 3T9NA 1FD2A 5GAEU 2CJKA 3UN3A 5LT5A 3UD4P 4B3RJ 2FZKB 3CCES 1U6FA 2J9DA 1BD6A 2EFOA 2MY8A 4OJ3A 3LAMA 2EWHA 3CDWA 1SPBP 2XHWA 4OYPA 5HVGA 3BR9A 2EKNA 2B7CB 2QEXS 1IJEB 1UL3A 2QLXA 3KFWX 1RQ0A 5KG3A 2Z8QA 4MKAA 3UFCX 1CEZA 3DOMA 1HL6A 1ROFA 1VLOA 1U45A 2BANA 5HQMA 1U1QA 5C24B 2YVSA 2M5YA 3H42A 2JFKA 4YB5A 4DQIA 1F60B 1S77D 5EN1A 1YSJA 4L72B 1FA0A 4DL2A 1WEYA 2C2RA 2LECA 4U9RA 1DURA 1NCLA 2R4FA 5HMXA 2W7PA 3TAQA 2QE5A 1NK9A 2HNDB 3DLKA 1XNRJ 3OR2B 1S1XB 3C16B 1KC8T 5T7LA 2N3LA 2KO1A 5LJ5Y 4AL7A 4DV4J 1RT3B 3GG0A 2ZNZA 4ZP7A 1C0UB 4QPTA 2ZM6F 4IDKA 3Q8YA 3GZ7A 1Q79A 2W2OP 1OQ3A 4ZCLA 1TL4A 4YS2A 3K2YA 3DCAA 1Q8LA 2GO8A 2JWNA 2VQEF 3BSNA 3VAGA 3PV8A 1S0OA 1ICEB 2R8HA 3NL0A 3PHTA 3TZZA 1UEVA 3LP1B 5KFXA 3N6LA 4HACB 4ECXA 2R2RA 2D69A 4GO7X 4LRAA 1CVJA 5LXYA 4ERDA 1MMDA 1UETA 2BW2A 4B3OA 1VQYA 1X4FA 4WXOA 2LCWA 4DR7J 1RT3A 3V81B 1DQAA 2IVYA 3JQMA 4NYOA 2R2SA 3UN5A 2G1HA 2NXCA 1K47A 4XTTA 4P10A 3CSKA 3LP2A 2BBEA 1X4GA 4QWCA 4WE1B 1ZM3A 3FBFA 3TVYA 5HSPA 3BEGB 1T95A 1JLGB 2ZJPQ 1HQUA 2ZZNA 1FCAA 2UUBF 2PC6A 3CVKA 4DV2F 2U1AA 2D9PA 2D3UA 2RIJA 2ZZTA 3MCMA 1X9WA 7FDRA 4QWBA 3GONA 1MROA 1T9TA 4CLYA 5F9LA 4QW9A 4RUBA 1PJ7A 1RT1B 4I2PB 1UEKA 4K4YA 3KDOA 5FDLA 4OX7A 2WOMB 2A1BA 2Z2MA 3TWZA 1X5TA 4XDCA 1S49A 3Q23A 1VGYA 2DRDA 2J9CA 3CULA 1ZBTA 2E7WA 1A9NB 2YY3A 1FHTA 4ES1A 1IR2A 5KFEA 2C22A 4HYKA 1UVMA 4DR6F 4LREA 1IR1A 1B0PA 3MPYA 4HHHA 4TY8B 3FSIA 1KQFB 3W64A 4UOCA 1S9FA 1TR0A 2XMVA 3MAAA 4L3KA 4JI4J 1FFGB 4Y0FA 4WWSA 2FJBB 3CJ0A 2LU2A 4PWWA 3GIIA 3C3LA 1IBKJ 1T03B 5L9XA 3BB5A 1R3NA 3DNCA 3J7Z5 4PUOB 1HYSB 2QC3A 3AJ1A 1B99A 2ACYA 4ZCKA 1H2UX 2J7UA 4C8ZA 4WPAA 4M5JA 1IVZA 4DX6A 3MEGB 1NH8A 2MHEA 1ZAWA 1N0VC 3HDSA 1PAEX 2ZC4A 2DGOA 2QL5B 4C48A 5LMUJ 1RU2A 4TVAB 2C3MA 2JLEA 3VZHA 1KR4A 2XG8A 5RUBA 2OSRA 5CHCB 2NYIA 2NPFA 2VV5A 3SDEB 4J37A 4NASA 2OJ3A 1LXNA 5HP1B 1SQEA 3X3UA 3DHWC 3RUBL 3HVAA 2HRTA 1RCOB 2NXJA 3CW2C 5GAHU 3JXOA 1SH3A 4ITSA 4O3OA 4DV0J 3MEGA 4ZPWR 3FJ2A 3GSDA 3IBWA 3W62A 4MMOA 5F8LA 1XMOJ 3L09A 1QSYA 2B0GA 3EDRB 3LP2B 2A18A 1NPRA 1RU1A 2GIQA 2YH0A 2DO0A 3BJYA 4CLSA 3R7NB 4TU7A 2VHGA 1VISA 2CNOB 2DNNA 5CYJA 2XO7A 3DYAB 3CJ3A 2O66A 1RWXB 4CO1A 3H5UA 4IH6A 1IKVB 4U8YA 4P7VA 2VDIA 2ZH7A 3JYTA 2YPZA 1BY9A 2IM1A 4N77A 3FUYA 2BJ8A 3LWMA 2HZAA 2B3TB 2DXDA 3EDQB 4O44A 3ULHA 5L1LA 4CT9A 4DCJB 1OMSA 4QWAA 4I6YA 5KFQA 2D3O1 5FDLB 1REGX 3H90A 2K3KA 3KHRA 3MM5A 3QJPA 3GMGA 4LF4F 3VVTA 3MUTP 3RTVA 4UY8T 2MTLA 4LF9J 2FPHX 1T3OA 2HAFA 1MN9A 2OEKA 2OI2A 3LGNA 4WK3A 5DDRC 3MUMP 2ALYB 1JNZB 2LXFA 4KE5A 3KJFB 1WF1A 2KXHA 1NUEA 4IKAA 1LNQA 3HHKA 1RYSA 1QAJA 3PYDA 4NCGB 3MEDB 4B9SA 5KFOA 5KFFA 1UWBA 4IRCA 1RUSA 2UXDF 3VCDA 2J5AA 1V3ZA 1QAXA 2N7YA 4OHWA 5U47A 3JAMY 4TU9A 4I7FB 1C0UA 4E0DA 1P9YA 2AF6A 4NLUA 4DL6A 1NNDA 2AJ1A 3AOAA 4K0KF 2OPRA 3MFIA 3DMJB 1WHYA 3FGVA 1B70B 4DV1F 3MR7A 5KG0A 2MB0B 3G8QA 1C0TB 3ISNC 4DR6J 5DLFA 1HYSA 4Y3CA 2I8EA 4CIOA 1JLAB 5IZHA 1JLCA 2ROGA 3SFGA 3CPWR 2M9KA 3T9ZA 4ENOA 1FWLA 5CCLA 2HHUA 3NY0A 3HT0A 1KS2A 2Q79A 4WK1A 5E41A 1RWVB 3BR8A 4F50A 3OTOF 4WYLA 4GKKJ 2DITA 2XMKA 1KTVA 2YX7A 3J7AN 4MIWA 2W9CA 1YJNS 3QWUA 2E66A 2W7AA 3JQJA 1UKUA 5KG1A 3KHHA 1J5OA 4TN2A 2G0JA 2B51A 3MMAB 3DGPB 1M1HA 3P5BP 2EFQA 4DEZA 5L46A 4RW9B 1S4FA 5J1EA 5LJ3Y 3J7YI 4RBUA 1AUDA 2F4VJ 2HQFA 3NWRA 2FGCA 4RUAA 2ZBRA 1DLOA 2KFNA 2YBVA 3AD7C 2CPHA 2HHXA 3U27A 3J7ZT 3W7BA 2YWEA 2EXUA 1DQ8A 3DDIA 2FJWA 2CWXA 2X3DA 4QOTA 4R25A 1KQKA 1NHVA 4NLVA 2IDEA 2KT3A 3K0JA 2Y0BB 1BUXA 1NSQA 2ADCA 1N33F 1WC1A 3ZNUA 1VBYA 1EP4A 4ZCIA 2HIQA 4XPCA 4NYPA 4IO9Q 2CJ9A 2WOMA 3MCSA 1SV5A 1VHIA 2DNZA 4GVBA 4IG3A 1RT2A 4NOHA 1SKWA 1FJGF 2HHQA 1FRHA 4TLRA 3TUIC 2ZH4A 2E1AA 2V63A 5D8HB 3TO8A 1R31A 1HQEB 1XERA 3QGPA 4ZPTR 5KFTA 3MMBB 3R5GA 5THWA 1F9FA 3DXSX 1X31C 4C11B 1DARA 2LP4A 3MM8B 4NMXA 3HK2A 1NK6A 1MG7A 4OZ5A 5F3TA 3CF5Q 1GXLA 1N4LA 4FF4A 3CJ8A 1Q82T 1OO0B 3AT1B 2JEJA 1RCXB 1PJ5A 1HBOB 5ETSA 1VQ8S 4HI1A 1N8RT 2RQCA 4Q45A 2RRBA 3KNGA 4OLOA 4Q5VA 4XIUA 2JOQA 3K7RA 4DR5F 1P1TA 1YLXA 2DEIA 1E6VA 1T94A 2NSCA 1OIAA 3EMTA 4PXBA 4USWA 1GH8A 1QUVA 2ROEA 2MPUA 1FX2A 4RZRA 3UI3A 1VQLS 1SH0A 2WVCA 1F3FA 4LSZB 3MR3A 3TR5A 2BQUA 2OH2A 2YNGB 2I6WA 2AJ4A 1EQ0A 1HBMB 3ZO7A 2RDDA 3DLJA 3WZ0A 1O5JA 1RLDA 4P52A 4DUYF 2MSSA 2WAQD 3DU5A 3MZIA 1DTQA 2YQ1A 2VIHA 4NLOA 2O01C 1UPPA 2LLZA 3BV8A 4DU8A 3WC2A 2YWHA 3FEZA 4J9OA 2BV3A 2OPPA 2WSFC 3HF5A 3L9ZA 3W65A 2XYGB 1KTQA 1NSAA 2UUAJ 1AYEA 2LA6A 1T9VA 2DGVA 4LUBA 3PKYA 1I94J 3V5RA 3BO2A 4ICLB 4WKYA 1N34F 1NAQA 2W01A 1JB0C 4GVLA 1LWCA 2K1RB 5D4OA 3D3BJ 2ZH8A 1FTRA 1S6PB 1GMVA 3M1VB 4RR5A 3B6BA 3A8JA 3OTEA 4DV7F 1GMUA 4NXNF 3ELHA 4QU7A 3P49B 3DGPA 5EWGA 2RS2A 1REVA 3UDVA 3N6NA 3R8YA 3DDKA 3A8KA 2F65A 3CJSA 4WBFA 2JC1A 2DHGA 6FD1A 2EFVA 5D4LA 3GIJA 1HR0F 3BSCA 3CEDA 2N4CA 3M2UA 2UUWA 3MMCA 5D0EA 4ELVA 5HK4A 2BMBA 3IG1B 3QJJA 1RJJA 4QPXA 4WFZA 5DGBA 2AYGA 1T9UA 2XCAA 1U8WA 1TELA 4OYXA 4CDIA 2MQ8A 1NBEB 3KKFA 1HKAA 4W92B 3BM7A 2P9EA 5IC6B 2F63A 3QT7A 2FUG9 3BYPA 4TKTA 1BQNB 1SC4B 3OXGA 4PG6A 1U6ZA 1EETA 2H51B 3BGUA 4Y2CA 1XWLA 2MLXA 2KKHA 1FXDA 3MAQA 4WYWA 2UU9J 1S1UB 3EUNA 3FCHA 4WTYA 1Y10A 5KFAA 4CNYA 2EFPA 1X4CA 2RAQA 4B9TA 1TV6B 1N33J 1JLQB 3PY8A 2GAHC 3EGNA 3HHEA 4UZBA 1S72S 4HVZA 1S1VB 1XTZA 4HLBA 2GO9A 1HD0A 3QSIA 4WJBA 4ZP9A 3H25A 4A8WA 1HLWA 1X7VA 3L95X 3LP0B 3VGUA 4H4MB 2CNNB 3GR0A 5B7WA 3KLFA 5ADZA 2DR9A 2GHVC 3C15B 3EYZA 3C8YA 5CQGA 2GIFA 3OTDA 4F0MA 4ELUA 4LF8F 3T1YJ 4KHPF 3LALA 5HATA 3AFGA 2OMLA 2PFDA 2LQ9A 3AHPA 4P2XA 3WHIA 2AJ2A 1LWFA 2MLYA 4QYZK 4LIRA 2C3OA 2BJDA 4MT1A 5IC4B 2WONA 2LYVA 2NYHA 3QWPA 2R8GA 3DLLQ 2H5EA 2XS7A 1KDNA 3JAMU 4RLEA 4CO2A 2FZGB 4ECYA 4LQ3A 1J5OB 1Y3KA 2FC8A 2MYFA 4KJIA 2RD5C 4NLYA 4NZ7A 4PWDA 1B0TA 1HQ2A 1N5YB 1KKHA 1WACA 2HRUA 2IJNA 3M32B 1X5OA 2B8PA 4PYDA 4RUHA 1PAUB 2V5HG 2LDYA 2ZOMA 2KVQE 4ILMA 5DZ6A 4O3SA 3FMBA 1U26A 1ZM4A 2VFUA 5I4MA 4EYIB 1BMQB 2OFHX 3B82A 4NCBA 2B56A 3OFFA 3G8SA 2BW7A 3DU6A 2C2KB 3UVJA 1UFLA 2GVDA 1KLMA 4U6PA 3MM6B 5ETVA 4WKRA 5F3ZA 1Z2LA 3DRPA 3QT5A 2R7XA 1UVLA 2MSTA 2V34A 2Z30B 3PYGA 3RG6A 1PILA 1WD6A 1TQLA 2HFVA 1C4CA 2Y3YA 2ZWPA 1I51B 2FHJD 4C98A 5L38A 2YKMA 2OPSA 1VDHA 3PEJA 4DPUA 1WI8A 5DETA 4DR1J 1SJ4P 2Y1LB 3BKTA 3S7RA 1IBMF 3KK2A 4M5DB 3M8PA 1R0BG 1WC4A 2BRKA 3O1LA 4M5KA 2PD1A 3PACA 3SXLA 3CMQA 3HD2A 2FGOA 4EBDA 2YKAA 1W2IA 2VFRA 3NXZA 4FYWB 4K7QA 5HVFA 2ZJQQ 1HNZJ 1HR0J 2UXBJ 3T1AA 2BE7D 2Q6CA 1KLMB 4C8YA 3H0PA 2DCUB 2D3ZA 5KFKA 1N56A 4RW6A 2NPIA 4DF4A 5CYQB 2G2YA 4YDXA 2K3IA 4OIXA 3OUYB 2HNDA 3DLKB 3PO4A 2CQHA 5J2PB 4UUWA 3TEGA 5T7LB 4CI0B 4WIIA 1BLUA 4W98A 4U7UK 3KTQA 2XULA 5ETKA 4QBUA 1FDDA 4OHZA 1NK5A 2HFSA 4DHVA 1YDLA 2C42A 4ZVGA 1Z4UA 1KD1T 1VOMA 4MFBA 3CIZA 5KFWA 3K59A 3OLBA 5KFUA 4C3MA 1S0NA 1HA1A 2HVDA 4JV2A 2MZQA 1C4AA 1UCNA 3QFWA 4X4NA 2UVVA 4Y00A 2IVFB 2UUCF 3OW2R 4EZ6A 2E9TA 1ZS6A 2CNKB 4LF2A 4UOFA 4ECVA 3EGZA 1B3TA 2IMOA 3G6VA 2CXEA 1Q95G 2BR0A 3I31A 3KLHA 8ATCB 3HZGA 1S99A 3W2WB 1XBWA 2PT0A 4XO0A 2VOOA 2B43A 4V1Ak 2W9AA 2GFFA 5BYRA 2V4RA 2EC2A 3ISZA 1YWXA 3D0GE 4J9SA 1SC3B 3RR8A 4LFAF 4B9LA 5L1JA 3ENWA 3GU0A 3BBBA 2KG1A 2XTJP 4DJBA 3Q8RB 3V4IA 2EG1A 2RS8A 3DFEA 5E5NA 4ANDA 1YJVA 4ECRA 2X1AA 1NJZA 1LW0A 3I5CA 4PWDB 4IG0A 1REVB 1R89A 2M3DA 2MJUA 4XDDA 3KJNB 2HSEB 2NSBA 1Q16B 1RWPB 3ENQA 3OPKA 3QNWB 1QTNB 1S48A 2E29A 1H72C 1NSPA 4FVMA 4LR9A 3W2VB 1S1WA 1SJRA 4NRUA 4PG5A 3SCJE 2IVMA 1U0SA 3B4DA 3DLGA 2CPIA 3L7PA 5A8WA 3EICA 1FWPA 2RRAA 3CE8A 4I2QB 3CDBA 1RWOB 2IM0A 3W3SA 2XHCA 4G65A 2M0GB 4DPXA 3T5JA 3K5PA 2OUGA 2FJDB 2AT1B 2BRLA 3PYFA 3JSYA 1HNXF 3O2IA 3LW5C 1H3DA 2RDJA 1RT7A 2QMUB 2DGTA 4JYAJ 2DH8A 3V4IB 4C97A 3JSMA 4Z37A 2HBYB 2HLTA 1IKVA 2CZ9A 2HPUA 3I82A 4DFJA 2EFNA 3I5BA 1A0OB 2FJAB 3SCKE 3T6BA 4C8NA 1RXOB 4IOCQ 1K0TA 3Q2TC 2CPYA 1WC0A 3LH2S 3QBCA 1JK9B 4CYUB 4WP3A 3QGIA 2DHXA 4ED4A 1M5OC 5B09A 1FRJA 2ZDPA 1IWAA 4DMZA 2VQEJ 4Y2KA 1TKXB 2LDIA 4JI4F 2BM0A 2HNZA 1TUGB 4LMZA 3KXDA 4F2RA 3OVAA 2CPEA 3CJ2A 3MPUB 4H4OB 4N47A 4CLPA 1RTHB 2MHNA 4KRWA 4EI2A 2BABA 1U1NA 5E33A 3MEDA 2NUUG 2Y1RI 3QT6A 3MTJA 3U1MA 3PR5B 1IBMJ 3NNAA 4O4GA 3NBPB 1EJ7L 1HHQA 2DGUA 3I0RB 2R7QA 4RKUC 4NLWA 5GAHI 3BO3A 2EG2A 2PDAA 1RAAB 2M7SA 2V0NA 4NCAA 3M4XA 3M1VA 5AJ3F 1SQGA 3OT9A 3SV3A 3FBBA 3RAQA 1WI6A 2DR7A 2PI4A 1HWJA 4ED1A 2VA2A 5B0CA 1QLNA 1HHTP 4LSNA 3QLHB 2RJZA 1KBRA 2ERRA 4FNIA 1N6QA 2RQMA 3GFZA 4H4KC 4KB7A 4N8NA 3OHAA 4DL5A 4DG1A 3H5XA 4CTAB 3D66A 1VJWA 2XMTA 3DLEA 4DN9A 2YKQA 1B64A 2D3OR 5KT4A 3IR5B 3O6QA 4G1IA 2UV8A 2UUBJ 4OI1A 5L39A 4RPFA 5CCMA 2GMLA 1HW9A 2HFUA 1IKXB 1GTEA 2XMUA 2NXNA 3T6JA 5KFPA 2M8DB 2J9DE 1VQ4S 1C1BB 4WF9Q 3R27A 3ZZUA 4IDKB 3V4MA 4DF8A 3OLAA 2QA1A 1U24A 1HBNA 1EKSA 2HURA 3F56A 3VV2B 3A3OB 1LW0B 3NGUA 4AXIA 2ILZA 3HHNB 2E5LJ 4UZCA 3V6DB 3MD3A 1TK5A 2HGNA 2BE2B 1YJ7A 5LSOA 4MIBA 4DSJA 2C1EB 4YDDB 4WIQA 1YRUA 4YEAA 4G1QA 5GMEA 4OI2A 2PI5A 3DYAA 1JMTA 3MPVA 1YX2A 4NL5A 3IWNC 3SZ2A 3PCOB 2ZUGA 1PBUA 4JI5J 4JP8A 2ALZA 3CCUS 2DGXA 4O4RA 3PIOQ 1RZMA 1TZ0A 4BS2A 2DRAA 2DXFA 1IBKF 2R7RA 4ZITA 1NM2A 1RWMB 3EWGA 4C9DA 2Z2ZA 2WSCC 4UT4A 1QSLA 3M9OB 4XAKA 4F04B 1ZZFA 5B0BA 5ETPA 1BXNA 4CQ1A 4AE5A 3D0IE 1SUQB 4WU3A 2W24A 2OTJS 2DPJA 3IR7B 3NGRA 3AAWB 3ZFVA 4G1QB 3CCQS 2W2QP 4RW8B 4NCGA 2G0IA 3GYXB 2AMCB 3TUZC 3N6MA 2AU0A 2XSJB 4I67A 2AYEA 4JBCA 4FVCA 4DX7A 2AWZA 2E9RX 3CD6S 1MMNA 2CAJA 4FXDA 4LIWA 2DNYA 2JEFA 2GJ2A 7AT1B 1JJHA 3QJLA 2AV5A 1F6TA 3A3PB 1H6KX 1HIYA 4JI2F 4QWDA 2EW9A 3RAXA 4LF4J 4DV1J 1LW2A 2PA8D 2CDRB 4P7TA 4A8FA 3I0SB 3L7OA 2A0FB 1CG2A 4Z2XA 3CCLS 3SQOP 2BVZA 4CZCA 4AL6A 4WZQA 3H2VE 4RNHA 1RTJB 2AJ0A 2QA2A 2GGPB 2KHCA 2WVBA 3GJRB 3K57A 2AKWB 3K89A 3TX8A 1YJRA 2ATLA 3OL9A 2XY5A 1NZ8A 3E01A 3M8YA 4OQJA 3US5A 3HM9A 4F3OA 4J91A 4RW4A 2F5GA 2N3OA 4KV8B 4JI1F 4NWBA 4K4XA 1VQOS 1P8GA 1N36F 2C2EA 3NMAA 3VZIA 2NQPA 3BSAA 3MECB 3D1HA 1BQXA 1VRQC 2LQ8A 3Q8VA 1Q5VA 4NZ6A 4ED3A 5H9FK 3P3DA 4I56A 3CCWA 3KLFB 5AT1B 2GVZA 1Q8BA 4DLEA 4QYRA 3ZTPA 4IOBA 3QO9B 1AZSB 3IRXB 1H7WA 3POTA 3GIRA 1D9FA 2VF3A 4FN5A 1MU2A 3ZTOA 3OJUA 2B5JA 1Q7LB 5HJXA 2FVPA 3WX8A 3KJQB 4OI3A 4OX9J 3W5YA 2QN6B 4AFFA 2D74B 3TOQA 1YTYA 3HSJA 3J81Y 4QQBA 2DTJA 2GQQA 1HNVB 3TZXA 1FKOB 4DCPB 4KQZA 3VAKA 2MKCA 2BKOA 2WB1D 2LEAA 3HXMA 2L48A 4B3TF 4RW6B 3QQCD 4A8MP 2ZKTA 3DRYA 1NKEA 3MOJB 4LF7J 3SI8A 4P2FA 4OX6A 4RNNA 3QZ8A 3Q8QB 2LQ5A 4GVBB 1PC5A 3A8EA 1FFSB 2L08A 1K8AT 1Q0NA 3KG4A 3QO9A 1AZSA 1RWWB 2HS4A 2C2DA 1OPZA 4JI7F 4K0KJ 4I7FA 1FE0A 2OEMA 2B5JB 1V5IB 1W7WA 4U67Q 3AOBA 1WOSA 2J7WA 5KFIA 3NAHA 5HMZA 1RHUB 5CYMA 2QRRA 3G86A 5CZVA 3PJWA 1CSJA 3HVWA 4ZJOA 4EZ9A 1LFWA 4MYTA 1FTCA 1IN0A 4DR5J 2ZD1A 1KRPA 5F9NA 3R7BB 3I55S 2IC3B 2MY7A 3OR2A 5JXSA 2L9DA 2XSJA 3NLCA 4FKXA 1KEKA 2NR0A 1TV6A 4DUZJ 5FLXU 1S1TB 3BBFA 3EPIA 3JQKA 3THTA 4R5PB 2DXEA 2RSQA 2DO4A 4WP9A 2DK2A 2AX1A 4DX5A 1F5AA 2BJ9A 2HGLA 3QFHA 3JTPA 2GIRA 2PEBA 2W4PA 4QIFA 5E2QA 4DBQA 1K44A 2XGPA 3KHLA 4ECSA 4B3MF 1D09B 1RADB 3VGSA 1VI7A 2PIIA 2HK3A 2IBOA 5I42B 1OYDA 4K2XA 2IM2A 4M5IA 1XQIA 1BQMB 1KFSA 2KT2A 2QJ3A 5KT6A 2J6SA 1E6YB 2IRYA 4ES3A 3GCWP 3VF0B 4DFKA 1CLFA 1FDAA 2R7VA 5C7PA 1W26A 2ZH9A 3I9ZA 3PDNA 1TP7A 4R5PA 2E5HA 3RAMA 4J9VA 2CQBA 4YB7A 4YB1P 1RT5B 2QIFA 2VICA 2V4JB 3PO5A 1BGXT 4K4SA 3Q86A 1NKCA 1MLAA 4K4VA 4J5OA 1L3VA 1YKWA 5C2GA 4FYDA 1RBOB 4F02A 1JLCB 4LFBF 1AROP 4TYAA 5C5JA 2AJQA 2QLJB 2AGQA 3OFHA 5HROB 3SSQA 2QMWA 3MR5A 2C3UA 2GV1A 4TXSA 4Z7CA 4QIEA 2FJVA 2ZHAA 1U1PA 2FIUA 2ZDOA 3GFHA 4DL4A 1S97A 4LRDA 4ZK7M 2I5JB 2AX0A 5D3GB 1EIYB 5AXMA 4ECUA 3TI0A 3QIPA 3FRYA 3ZTSA 1CQMA 1VQKS 1F5CA 3RB6A 2HHTA 2COLA 3O3LA 4UQGA 1UJ5A 2AYBA 2YKMB 3VQTA 1WORA 3FBEA 3E3XA 5J2MA 2WVFA 3Q89A 2ZOGA 4MKVA 1U0HA 2LXIA 2WBMA 1RT6B 1RKJA 4OI0A 1HBMA 4RNMA 3N5BA 5DLGA 3V6KA 1RWKB 4MH8A 2VG7A 2F7VA 2H3EB 3GP9A 3MAAB 3UN2A 5CYMB 2Q6BA 2GQCA 2XYHB 2UP1A 4PQUB 4LSNB 2HHHF 4Z7YA 3OV7A 3IMQJ 1DTQB 5DO2A 3U02A 3ZZPA 3KDNA 4C3KA 1HI0P 2ZD1B 4OZJA 3FK4A 5DG7A 3OVBA 4AT1B 2RT3A 3MEEA 4S0MA 3AD8C 1Y5NB 1S9EA 4JV5F 1UA1A 4YQWA 5AE3A 2YPYA 5HBMB 3KK3A 1UZDA 2H9ZA 3FQKA 3V81A 3O44A 2W1BA 3HVTA 5IQ6A 1YHQS 2HAIA 5I3UB 3DRXA 1XR5A 3ETOA 4PZVA 1H74A 1L3UA 2KRRA 2OPRB 3AA9A 4F0KA 1PG5B 4ED0A 4OHXA 2C3PA 1PSDA 2AEJA 4X4OA 2V8PA 1S6OA 3K5NA 2OP5A 5J2QA 3QSYB 2R7TA 2ABYA 1T3NA 1A7GE 4IYQA 1HQUB 2O5DA 1RAHB 3OFEA 2JLGA 3M30A 4UQTA 3EGVA 2FQQB 2CQ1A 1TVRA 1P1LA 3A3NB 3BH6B 1R8CA 2HNYB 3OR1B 2QA4S 1G7CB 4ED6A 1CULB 5C42B 2V2ZA 1BHNA 2M8HA 1YG0A 1FXRA 3VWSA 3HLUA 3EZOA 3OJSA 3BSOA 1ZTWA 1DQ9A 2XMAA 1FESA 3PX0A 3S6EA 5LMNF 4J9RA 4V19J 1S5ZA 1IBLJ 2MQOA 3FZ2A 2Q43A 5BJRA 4H54A 2H1YA 4LBPA 2X1FA 5SUHA 4YN3B 4QIVA 1S9GA 5K5MA 3UPFA 3CC7S 1UVJA 3W66A 3UCUP 4NEYA 4F4XA 2CQ0A 2HHSA 5GVQA 4RW8A 1ZA1B 2J6UA 4I2QA 4C8KA 2RUSA 2AZ3A 3A8IA 1RABB 5C42A 4ZPVR 4DR1F 1WOOA 3E51A 3ZZYA 3HSDA 4Q8EA 4ETXA 3RU0A 4ZHRA 4JI7J 3ZZ0A 3CC4S 3M8PB 2V67A 1UZHA 2LU1A 2XBPA 2JC0A 4FF1A 3QIPB 4C8LA 4FF3A 5DG9A 2VJUA 3QATA 1FJ7A 4MYUA 4PXCA 3IGVA 4CLKA 4YMEA 3CJKB 3KHGA 5FLXY 1QJHA 4QIWD 4CO3A 2E1PA 1R8PA 3R7SB 3KLIB 2FDNA 4LVNP 1U1RA 1JJ4A 2JZ5A 5KFMA 4F4YA 2OLWA 1JIHA 4PG4A 4CLUA 2A10A 3PVXA 4N56A 1RP5A 4OZ3A 3RRGA 2VBYA 1OWXA 2E1RA 2C28A 4OZ2A 2UUTA 3HJFA 3K8VA 1XNQF 2KG0A 4ZHRB 3TZWA 4JI3J 1RTHA 3ETMA 3HKWA 5B0FA 5CABA 3CCSS 2KM8B 1B4SA 1IXKA 5D4NA 5DM7Q 3MEEB 1BE4A 4ZVOB 4N76A 1RGVA 1CC7A 1VK3A 3QRQA 1QAIA 3TARA 3PEHA 4I68A 2FLPA 2EK1A 3SQGA 1FNXH 1M1GA 2MJNA 1TFYA 1BQMA 4AD6A 4LFCJ 4ZVRB 5F8HA 3CC2S 2OPQA 1SVDA 5HLFA 1Q53A 2YH1A 4HEA9 4EBEA 1Q78A 2PN6A 2V94A 4O23A 3DM2B 3DOLA 3C19A 4EO8A 2V9WA 3R3TA 2HMIA 3NGTA 4WXWA 1VBKA 2BE9B 1S1VA 1CJTA 2FHOB 4BLGA 5IT4A 3M8ZA 1Q8IA 3QYYA 1JXLA 2E7XA 2CPZA 4OYAA 2UXCF 3MMAA 2WK4A 1LFPA 3D7SB 4AL5A 2VC1A 4HHUA 3PW5A 3RBXA 2VKRA 3OR1A 4J9MA 5LL6d 2ASYA 3VAIA 2OPSB 2JL9A 2YNIA 1LKZA 2WVEA 4KSEB 1FDBA 2VD3A 2IMWP 5LOQA 1VLYA 2OAUA 1VQ9S 4M5LA 1R43A 2KDOA 4K4TA 3GV5B 4KTQA 1R8HA 2RILA 4A8QA 1VRUA 3DRSB 4EWTA 2OEJA 4C8MA 2MZSA 2RHSB 3JSBA 2JVOA 4YR2A 2LXUA 3BGOP 4USVA 4Y6IA 1HWIA 1SL0A 1BC6A 2R2UA 2VKZG 3K5LA 5DS7A 1AUSL 4M5GA 2N82B 3OSPA 3M2UB 1Q4RA 1NK0A 2UZAA 4MIAA 1T05B 1ZM2A 2HZCA 2R2TA 2R3VA 2HIYA 4MJKA 4N5SA 1MU2B 4DR2J 1SL2A 4MFBB 2BACA 3MURP 3D1OA 1X5PA 1OY6A 3MM8A 3QZ7A 4OFZA 1VC0A 2VG7B 1HWLA 3MXHP 3AOCA 3LQVA 1FRMA 4C3LA 2BX6A 4M5HA 1RHRB 2HQCA 2DR5A 3LUYA 2HHHJ 4GC6A 1U2RA 1VBZA 4PAAA 2B9XA 2FD2A 2W4DA 1FKAF 2VG6A 3K58A 1LEOA 2JJ4D 4FZVA 2HG4A 4ZMMA 2MQMA 2VH7A 3BS9A 3PX6A 4CLZA 2P9CA 4DOZA 4IRKA 4J9QA 1T8EA 3LGMA 5ETNA 1M5KC 3MR2A 4Y65A 4ECTA 1TUVA 4F36A 2VPZB 3J80Y 1NK8A 1X4EA 2HFZA 5DQIA 4J9LA 2ADBA 3LP0A 2JSXA 3A12A 3NCPA 1RAFB 4FPRA 3ADAC 2ATCB 2J9EA 2XMWA 2PSZA 2ZH5A 3CMAS 1MWYA 3WX4A 4F4ZA 3U1NA 5J1EB 1NXIA 1S7HA 1M5PC 1KVIA 3UWTA 3GWCA 3RB0A 1AW0A 4J9KA 1T02A 2ZBIA 2C2MB 3NS6A 2QMXA 1JJCB 2FHKA 1N5TA 1OY9A 1RTJA 2HQGA 4CT8A 2AQ4A 1WHWA 1EHWA 3VAJA 3DLEB 4F67A 1TVRB 4K59A 4MTPA 1IKWB 2YNHA 3P8BB 4M8LA 3VTIA 3D2WA 1J5EF 4DR4F 1TL1B 2A6MA 3IP0A 4EU0A 5KOXA 2AW0A 2H48B 5IS2A 1O6XA 1HD1A 1Y9OA 2QYGA 3HHLC 2AJFE 2BXJA 1VBXA 2APOA 5F8NA 1UWAA 4V19X 2YX1A 3JTOA 4J9NA 4ED5A 2MDAA 2Z2YB 2A3JA 3UDCA 1TTHB 5J1PA 2I0XA 3SMZA 1KP6A 1ZETA 1VIXA 5IXUA 4QJVA 5I42A 4CYUA 2DIVA 2KJVA 5HN0A 3SSSA 4CO5A 3GV7B 4ZPAA 4B3RF 2FHJA 2YNHB 1WF0A 3MMCB 3MMJA 4PQUA 3MF5A 4KFBB 3AXKA 4A8KA 2UVUA 2HS3A 1DY3A 1SIWB 3ILIA 1IKYA 4EUVA 1GX5A 1F5BA 3HP6A 5DDPC 2UXDJ 1PYSB 2H5JB 3HFVA 2DGSA 2QT7A 2A2DA 3CD0A 1TL5A 1YBAA 4HT5A 3EZUA 3C2PA 3DXBA 2BQ3A 1H0HB 2V6AA 2HRYA 3W2VA 3ZZZA 1W2BR 2YNGA 3PRVA 3HFZB 1VRTB 1D0EA 5KFNA 3U1LA 4LSLB 4BBYA 2PEHA 2Y1IA 3R6LB 4K5RA 1CBKA 3N9UC 2B6AB 3KLGA 4FS2A 3L7UA 3BREA 3QLHA 4U8VA 2YQ3A 2BEFA 3M2RB 4Q2MA 3UR0A 2XSFA 1N6QB 3SCLE 1RBAA 3FQLA 2E7VA 2CPJA 3DC2A 1I6JA 3PG9A 3PHEA 4LQ9A 2CADA 3H8YA 3M8WA 4ZVSB 4Q0BB 1MWQA 3VAMA 1N88A 1U49A 2VG6B 2DNHA 2OD6A 1TKTA 2V8HA 3UCZP 1J2VA 2UU9F 1LWEB 1S6QA 2CQGA 3W8GA 2QFIA 1YJWS 3CD7A 6AT1B 2ZFHA 3P45B 5GAGU 4M1KA 5IWAJ 5IFMA 1RE1B 3LPEA 1NDPA 2RU9A 2OPQB 4NI2A 2E5LF 3ZC4A 3UCGA 1XNRF 2J0SD 1XR6A 3W5XA 3LAKA 2ZHOA 3HSGA 1HPZA 1QD1A 2JNJA 3FDSA 2VL1A 2CJYB 3KNAA 5JUMA 1HI8A 2KB2A 3SDEA 4LRCA 3DI6A 4ID8A 4X4RA 4D3HA 3FBCA 3FCVA 1NZAA 1U1LA 2W2NP 1RTZA 4OI6A 4DDFA 1U8SA 1N5YA 4AYBD 5D0RA 1C2PA 4CH1A 3RB4A 1YI2S 3MM9B 4Q7AA 4U7UD 2WZ1A 3KK3B 3SEOA 3D6MB 5HVHA 4KPCA 4C8OA 5H9EK 1F3VA 1NKBA 2IM3A 1VMBA 2CA9A 1XJWB 3AJDA 4R0JA 5G4DA 4H4KA 4DV2J 1GNKA 4HT7A 1X4DA 2BJEA 1CJKA 1X4BA 1TMMA 2DKOB 3PW7A 1WUUA 3HKZD 2WHOA 4PQAA 4DLGA 3QRPA 1GXUA 2CWKA 2KHDA 3IGNA 4P75A 4QIGA 3LOUA 4RNFA 2V68A 1DAXA 3EVOA 3TQ1A 1FEHA 4O0IA 4DR4J 4DG1B 3BPDA 3N01A 2P5VA 2YWFA 5DDOC 4YP3A 4HHJA 3MR6A 3M9MB 1HNWJ 2KFYA 4UY85 1FFWB 1A6LA 2CQPA 2Z0GA 3E2EA 4NZ0A 1NB7A 4JI2J 4OHYA 1PYOB 5I3QA 1RACB
chains in the Genus database with same CATH topology
1RT7B 1NU4A 1ZAXA 4I4BA 1VHFA 2HGMA 4YOEA 2WBRA 4KKOB 3SQGB 4C0OC 2V9KA 2FC9A 5KG6A 1YJUA 4B17A 3M6WA 4C0BA 3GR1A 3LO3A 3MM7A 4FXWA 4BWJA 5LSRA 3SSRA 2DPIA 3GFYA 1DBDA 2P9GA 2ZH1A 2G0CA 1UWBB 2CJBA 4JI6F 3WC0A 4A46A 4L6V3 5A8RB 1HARA 2DH9A 2QFJA 4TYBA 2OFGX 4ZOSA 4CO4A 5C25A 2W7OA 1VQMS 2B9YA 1VQ5S 5KAKA 4NYZA 3MECA 2I38A 1U1OA 3GB0A 2I2YA 3DMJA 4GO5X 3IAM9 4TU8A 4DSIA 7FD1A 2LQJA 2VPWB 2W9BA 2J7KA 1RYRA 4MK9A 3C6UB 4KHMA 5L8RC 1IQTA 2R8JA 2ZZMA 4IH7A 2Q1LA 4TY9A 3K8WA 3PJXA 4FNHA 3CT9A 2RKIA 1QE1B 4YY3F 1FRIA 1H38A 4I64A 1YRXA 5DQGA 2ASJA 5F0UA 2GJIA 5FD1A 4OX8A 3CO9A 1M5HA 3FEYB 3R5DA 2AP6A 2XCPA 3IS9A 1FVQA 4KT0C 3SV4A 2B4UA 4CCHA 4ZPDA 5BYSA 5K8MA 3KYLA 2K1RA 3PR4A 5A8WB 4IUFA 1HBNB 4TLQA 1D9AA 3CCJS 1K1SA 2NUHA 5AXNA 3Q22A 3MAHA 4DFPA 2VG5A 3H5YA 5J2NA 3VALA 4J9PA 1P9QC 1X4AA 2GHWA 2RH3A 5KFCA 1HMVA 5K14B 3HVRA 2PMZD 3KG1A 1QSSA 1U1MA 1SV5B 1JLBB 3BQ0A 5KFHA 2Y0SD 4KO0A 5KFLA 3TA0A 2ZITA 1Y4ZB 3BQ2A 4RX6A 3M2VB 4X4VA 1NJYA 3KMSA 3PRBA 1UEUA 1SC6A 1VC5A 4HI2A 5HMWA 2KN4A 1LOUA 3CJ4A 1W25A 2YKOA 4DWIA 1RISA 2C3YA 2HNZB 4EO6A 1G2EA 2VFSA 1NJWA 2XI2A 1FKOA 4DQRA 1D9DA 4C4WA 1HWUA 1Y00A 2DR8A 1NH7A 4DL0C 3PKMA 4KR0B 4NRTA 1U09A 4G3IA 4AUKA 4RU9A 3G6YA 4ECWA 2ZE2B 1YVFA 4HL9A 1KVJA 3BDPA 2LKZA 4A8YA 2EC0A 4PCQA 5KFJA 1NHUA 4EGLA 2BM1A 4NA2A 1U48A 3MM5B 3H2UB 3I0SA 2BDPA 1FRXA 3CGIA 3C6UA 1X8DA 3H2LA 1SJ3P 2D7SA 3EX7B 1S1WB 1S10A 3JTNA 1KNZA 4QR1A 2W25A 4RWWA 4KC5A 2JX2A 2GGPA 2NXUA 3LP1A 2XMJA 4ZP8A 2HVIA 1X9SA 1S76D 1H2VZ 5HLFB 3N5FA 4DS5A 1D8ZA 1TAUA 3MM9A 2ZE2A 2W8LA 1RTDA 2M88A 4WCEQ 1L3SA 4NLTA 2YWKA 4JOUA 4DL3A 2YX4A 3VR1A 3OXLA 2F40A 1VIOA 2HFNA 2RF2A 1ZM9A 1JLEB 3CDEA 2CVIA 3NCRA 2M4MA 2YWGA 2DB1A 3HHLA 2QLWA 5DRKA 4R8UA 1VQNS 1HQEA 3MOZA 2KFZA 2WTFA 2CQCA 4KIAA 4MAKA 2R7WA 2MZRA 4A8SA 1E6YA 4QW8A 2WB4A 4DSFA 2G13A 3N4WA 1CQNA 3UD3P 2D41A