4DUYJ

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 16
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4duyJ00
4KYZA 4AQYJ 2UXDJ 4JI1J 4LF8J 4KY3A 4DV2J 4B3SJ 4DV3J 5BR8J 2UUCJ 2MQ8A 2MTLA 2UXBJ 4DV5J 2VQEJ 4NEZA 4JV5J 4PWWA 1N36J 5FLXU 5IT9U 4JI4J 3T1HJ 4OX9J 4DUZJ 4DR3J 4KHPJ 5AJ3J 3R2CJ 1HNZJ 4DR5J 1HNWJ 3J7AN 1FJGJ 2KL8A 4DV1J 4DR1J 2VQFJ 1HNXJ 2MEWA 1XNQJ 3T1YJ 4DV4J 1N32J 4NEYA 4X62J 5A2QU 4JI6J 4NXNJ 3D3BJ 2HHHJ 4NXMJ 3JAMU 4DUYJ 4LFAJ 1XMOJ 5LMUJ 2UXCJ 4HHUA 4JI8J 3W1YC 4GKJJ 5LM7E 4LF6J 1HR0J 5LMNJ 4B3MJ 2ZM6J 4DR4J 4X66J 4B3TJ 1IBLJ 4LF4J 1N33J 1J5EJ 3D3CJ 4DR2J 3J80U 4LF7J 3J81U 4K0KJ 1IBMJ 2KVQE 1N34J 1I94J 2UUAJ 4JI5J 4DV0J 4GKKJ 4V1Ak 4JI3J 2F4VJ 2UU9J 1XNRJ 4DR7J 4LF9J 5IWAJ 4YHHJ 4X64J 1XMQJ 4JI2J 4JI7J 2UUBJ 4B3RJ 4X65J 4LFBJ 4YY3J 4DV6J 4LFCJ 3R2DJ 2E5LJ 4RJVA 3OTOJ 3IMQJ 4JI0J 1IBKJ 4LF5J 4DR6J 4DV7J 4JYAJ
chains in the Genus database with same CATH superfamily
2V6AA 2ZD1A 4LFBF 3VR1A 3AT1B 3AB2B 4L73A 3C2PA 3FBCA 5K8MA 3Q8RB 3IFEA 1LXJA 2VQEF 4F3QA 5BR8J 4IH7A 1NHKL 3K5PA 3DRXA 2XS5A 2GGPA 4NZ6A 4MYTA 4RW6A 3IA0A 3OL9A 5HO4A 1VBKA 4AL5A 5KFTA 3CB4A 4JI4F 3RW6A 1VRQC 1KHWA 1PAUB 3TAMB 1X9WA 4DX8H 4U95A 1Y4ZB 1U1RA 1HBMB 1XWLA 2KT2A 2ZH7A 2FD2A 1HWLA 4I7FA 2BV3A 3WZ0A 1TL3B 3C3LA 4P72A 1RQ0A 3W65A 2XNQA 3TR5A 3DYAB 4YHHJ 3PW2A 1JLQA 1QSSA 4X65J 2VFRA 3FJ2A 4C11B 5IZHA 1FVQA 1UVJA 1FXDA 3GPAA 1FKOB 3UR3C 1SJFA 3HULA 4JI7F 1R8HA 3C66A 3N28A 4M5GA 5EGYA 2EG2A 2MJNA 3EXCX 3E3XA 4WXWA 2YNHB 3C6TA 1NHUA 2RHSB 3K0JA 2R7RA 4MKVA 4URQU 1X9MA 5L1JA 1D8YA 2FJBB 4QJVA 4M8LA 1C1BA 3LGHA 2KZMA 1CJVA 2B7CB 2DGQA 3O8WA 3H7HB 1REGX 3Q8VA 3PX6A 2C28A 5A8KA 3RBDA 1BE4A 4CCHA 1BD6A 3M30A 1HW9A 3HSDA 1KHVA 3MCMA 3D6HB 3J7Z5 4DJBA 1MWQA 3Q8UA 3NLCA 3O44A 2FLOA 3VAHA 1DLOA 4CYUB 3HM9A 1KC8T 1F2HA 4BWJA 2IC3B 4X84A 3US5A 4NZ0A 1DQAA 2QC3A 4LF9J 4ZIWA 3KLGB 3PHTA 3AY0A 2BQRA 5DDOC 1NEEA 4JYAF 3CCJS 2QV6A 4ECYA 3N5FA 1NB2A 5GVQA 2HK2A 4FYWB 2CWXA 1KSPA 3C15A 1VK8A 2QLBB 3AA8A 5DQHA 1D9DA 4UZBA 3V6DB 2VA3A 1U48A 1EARA 3AOBA 4D3HA 5B0CA 1QE1B 1TUVA 2XGPA 2B9YA 1JXEA 4Q43A 4O44A 3BYPA 2F9DA 2V2VA 2X3GA 5A0YA 3T9NA 1U1LA 3D67A 1RA6A 1S7IA 4F4WA 1TFWA 3SMZA 4MIBA 1EZZB 4W4MA 3FC9A 4DDFA 4X4TA 3IGNA 1GAOA 2MLXA 4DL2A 3CCSS 3GFZA 1K0TA 2ILZA 2MKCA 2LQ9A 1RABB 2R8GA 4RNFA 2G1DA 3P96A 1UVLA 4U8VA 2AEMA 1NZ8A 2Z2LA 2GHWA 3B82A 1M5VC 2FHJD 1LFPA 3E01B 2D9OA 4V1Ak 3TWZA 1XERA 5CQGA 1NDPA 1XN9A 1PYTA 3HX9A 4JV1A 3IR7B 5CYJA 4J7CA 4OZLA 4J9KA 3ETMA 3OL6A 2KG1A 4LSLA 3FSXA 1MMNA 3ELHA 3BV8A 2JWNA 2LLZA 5J2QA 3QPIA 1NJWA 4M94A 2IM3A 5H9FJ 1N6QA 1Q53A 4N47A 4CIOA 2G0IA 2RU3A 3OTDA 4WWSA 1JB0C 4IG0A 2MEWA 2MGZB 2AV5A 2ZVIA 2H4YB 3BQ2A 1Q8IA 3UR0A 2DHGA 1FXRA 5B0EA 2EKYA 4FF4A 2WBMA 5E3PA 5L8RC 2NLWA 3W2VA 2YNIB 3TANA 5IQQA 4USWA 3HKZD 2EFNA 3F44A 1TFYA 2E5GA 5CYQA 2W2PP 3D0HE 2OHDA 5KFCA 1NO8A 2BW2A 3EDQB 3R5GA 4KBIA 1WOSA 2BMBA 1K0VA 5KFAA 2ZZMA 4IH5A 1CJKB 4TKTA 1U25A 4DV6F 3K89A 3HZGA 1S0NA 4B3SJ 2BE9B 3W62A 1LWXA 1S9FA 1HBNB 2Q1LA 3RB4A 3QT8A 4DV5J 3GZ7A 2R8IA 2ZBRA 3AOCA 2Z57B 4ZLLA 4BC7A 4O3RA 1V9OA 3D68A 5KFNA 3EX7B 4JV5F 3UNYA 2AU0A 4ED4A 2GAHC 4KJIA 1JLGA 2IMOA 2BUNA 2U1AA 4NLWA 4WTOB 2B0GA 2CG8A 1QDUB 1FRXA 2LQ8A 2YKPA 4MYUA 1HR0J 3ISNC 4I68A 1HMVB 1RUSA 3EPGA 4QOTA 5HMWA 3GR1A 2OMLA 2FGOA 2XMVA 5L39A 5KFDA 4GC6A 2KFYA 3PX0A 1OYDA 5HLFA 1S79A 2CDRB 3M6WA 3AJ2A 1TQLA 1JJ2R 1ZAVA 1WC6A 5CYMB 5GAHI 4OHZA 2RIJA 2DR5A 1WTBA 1X4DA 1Q5VA 4OL8A 3K59A 2FJDB 3W9IA 4ICLA 2V34A 1M1GA 1YIJS 2YH0A 1NK5A 3MMBA 3K5OA 3PFEA 5IT9U 2QMXA 4DU7A 2HURA 1PC4A 3W5XA 3HJVA 2D3ZA 3NCRA 3FMWA 3HFZB 5C2GA 2LMIA 3RR8A 5A8WB 2HGNA 4GKJJ 5DDRC 1IKVA 1F9FA 1JNRB 1T03A 3PW0A 4LF4J 3BYRA 4ECVA 3CDBA 2Z2YB 4O3SA 4IFYB 3OR2B 5T14A 1FCAA 3OTEA 2OPPA 1BGXT 2OPSA 5D4LA 1MWZA 1C0TB 2EFVA 1U0SA 2XWYA 4ZITA 1Z4UA 3QSYB 3UWTA 1RT2B 2R2SA 5KFPA 4DSKA 3H98A 1JLEB 4I56A 1FTRA 1S9EA 4TY8A 2NUUG 2QMUB 5A76A 2VBXA 5B09A 1T3NA 2XSJA 1FKPA 4IO9Q 1LW2B 2JFKA 3KHRA 3TZWA 4B9UA 1UTAA 2DR8A 2OJ3A 9ATCB 5H9FK 2RRAA 5DG7A 2M88A 4OI1A 4A8FA 4ED0A 5I3QA 3WC2A 3HHEA 3RUBL 3KLIA 2CPXA 3C16B 3PYFA 1EIYB 1RDRA 4C8OA 3BQ1A 4USHA 3TUIC 2OSRA 5E3QA 5L38A 2V63A 5J1NA 2D3OR 1IBCB 1BY9A 2OEMA 2P9EA 2RE1A 2ZH1A 3CJ3A 4MFBA 1QAJA 1I5OB 3QO9B 1X5OA 2GS8A 3CE8A 1F0XA 2EFPA 2QEXS 1PAEX 2BACA 4NLRA 3BKTA 3UNGC 4FXDA 4KPCA 1TL7A 4XDCA 3ITHB 4KTQA 1S59A 2WAQD 2ZC4A 2RKIA 2L9WA 3ZC4A 1VR6A 2FC8A 1YJUA 3SCIE 2ZBQA 1VOMA 1SQEA 4HT7A 5J2MB 1IR0A 3CCMS 3A8KA 2GVZB 4UZCA 3MTKA 1NMEB 2F1FA 2V8GA 2BOPA 2KI2A 3BF4A 2FPHX 1EAYC 2HRTA 4DSFA 1RWWB 2HNDB 2VHGA 1MROB 2NUHA 1HYSA 3NMRA 2YNFA 2W9CA 2GMHA 3PW7A 2BJ1A 2BJ7A 3NNCA 2GAGC 3I4PA 1UEKA 2NPFA 1S76D 1NDKA 3KLEA 3DNCA 5LMUJ 1I6JA 1N48A 4HHUA 4IOCQ 3FCVA 5HROA 2RVJA 2HLUA 1RAGB 1EKSA 4DMZA 1TK8A 2J0WA 4K0KJ 1NSPA 3OJUA 1I94J 2DR9A 4LF6F 2UP1A 3N6LA 3DRRA 1X0FA 4DCPB 3NNAA 3FQLA 1U49A 2ZD1B 2C3YA 2E5LJ 5AXNA 1FFSB 2FJWA 5EHHA 3ZFVA 4ALZA 1WEXA 2JH3A 2PFFB 4F0HA 1TP7A 5JMNA 2N3OA 3J7YI 2W2QP 1PBAA 3NEKA 4URGA 4QR0A 4ANEA 2COLA 5EUHA 4B9VA 2P6TA 1ELOA 3EVWA 4TQRA 1JK9B 3CO0P 3EICA 2IJNA 1N52B 3KK3A 4OHVA 2B4VA 2GFFA 4B9LA 1JIHA 3U02A 4NLPA 4BHQA 2AX0A 4F2RA 3KFWX 3BS9A 4J5OA 3GG1A 4DQIA 3OFHA 4RWWA 2LA6A 1WD6A 1XR7A 1XNRJ 4O4RA 1FWKA 2KM8B 1OQ3A 3CPWR 5D8HB 3IBFB 4ANDA 2ZH2A 1HWKA 5LSLA 5B0BA 1V3ZA 3IMQJ 3QJPA 4JI1F 4LF8F 2HNZA 1GXLA 3C6TB 2JVRA 5GAEI 5K14A 1BWEA 1P6TA 2HIYA 4E0DA 3BDPA 1NKBA 4DF8A 4C7QA 4GVBA 3PV8A 1PC5A 4PYAA 2QL9B 1RT4A 3B8HA 2MSSA 1FNXH 5A8KB 1HNWJ 3MR6A 1SQFA 2RDJA 5I3UA 3VAJA 4ZPBA 3BKUA 4M5KA 4P7VA 4HACA 2ZH3A 1SKSA 3IAM9 5D0GA 1ZM2A 5C25B 2BE2B 2WVCA 1YJWS 2Q3PA 4RO0A 1Q7LB 1TZ0A 2NPIA 2LFVA 4ED3A 4DR4F 3UVJA 4X66F 4B3TF 5KAKA 4FPRA 3W5ZA 1IM6A 5CXTA 2XNRA 3EUNA 3IRXA 4ED2A 3KJNB 4WP9A 1T7PA 4KYZA 4J9UE 3OTOF 2ZBCA 4CLUA 3HZEA 1MMLA 1AT1B 3GG0A 2IIHA 4ERDA 3MPWA 3OFEA 1HWJA 3GQCA 2BW7A 4ECXA 1UA0A 2JX2A 2NZCA 3MR7A 1V3RA 2XWXA 2PDAA 2J5AA 1WKKA 2BJ8A 2HWHA 2CPFA 3L09A 2YX7A 5KG3A 3H5UA 2ZDPA 3CIZA 4TY9A 4LFAJ 3M2RA 5G0RB 5MLCV 4GMKA 4UQTA 3M8PA 3JQJA 3DMJA 1S77D 4LF7J 2KVQE 4NRTA 2UVUA 3I87A 4X4OA 3MEDB 4I64A 4MKYA 3MCOA 4RWXA 1G6BA 4FXVA 4AXJA 1X5TA 1IN0A 4YB1P 4JI5F 4DR6F 2M2BA 2GQQA 2R4FA 1CQMA 4L6V3 2YQ0A 2IDLA 1NKCA 3EXYA 2DVIA 1VQYA 2ZZTA 4O4GB 2BE7D 4GVLA 2C3MA 2RSQA 2X1GA 3VF0B 1LV5A 5ETVA 4YMEA 2Q6CA 5D3GB 1PCAA 1GTHA 3HVWA 4DUZJ 1SCJB 2IAJB 1K9MT 2NCKL 3VAIA 5DM6Q 5HMYA 5T7LA 4DZDA 1XNQJ 5J2PA 4C8LA 1N5VA 2JNJA 3RAXA 5HL7Q 4NLOA 4DL4A 1X4GA 1AXQA 1RT7A 2AW0A 1R8CA 1HQEA 2MQPA 3MEKA 5HVFA 5HATA 2E7WA 2XYPB 1XQIA 2V4JA 3IBCB 4UY85 3UO0A 4LF1A 4OLOA 3CIMA 3R6GB 4XTTA 3CD5A 3UE2A 3H5YA 3QRPA 3VAFA 1W26A 3MM9A 1LWFB 3NCQA 1HL6A 5HI7A 3K17A 2HHUA 3MF5A 4X4QA 3OLAA 3BBBA 1DJ0A 1RT1B 5E5NA 5A6WA 3QGGA 4IOBA 4LUBA 3HD2A 1U24A 1SKWA 1YTYA 2QLFB 4CRJA 2YWWA 2GQ2A 4CTAA 4WZMA 1IUJA 2Y0BB 5AJ3F 2W9BA 2CPJA 2KXHA 3T1YF 2R9LA 2V67A 1FEHA 3PG9A 2KDOA 2OD4A 2WVFA 1ZH5A 3FEXB 4MKBA 2KFNA 1CJTA 2XLJA 2HGMA 2A3JA 5E7OB 1FVSA 2BJ9A 2NXNA 4J9NA 5IWAJ 2GHVC 3KLHA 1VIOA 2CZVC 1IKYB 2PO4A 3OVBA 5EN1A 1C0UB 1RBLA 3ENWA 2HFVA 1GEHA 4FYYB 3TP2A 1IXKA 1TTHB 5DLFA 3MMBB 4ZPTR 2CJQA 3A13A 1JKHB 4U7UK 2HQDA 2HFSA 3MPDA 1Z2ZA 1CULB 2ZNYA 4QIGA 4HDHA 3MAQA 2V8VA 2GHPA 2AX1A 2LXIA 1NLKL 2QN6B 2E1PA 3HHLA 4ZJOA 4XPEA 4QR1A 5HSPA 3ZZTA 5BR8F 3GSDA 2WB4A 2M4MA 3DKDA 2HHPA 1KKHA 2DNRA 1DY3A 4WF9Q 4F67A 1RT3A 3LPEA 5C42A 3N6MA 2HHHJ 3MR2A 2F65A 4CO0A 2H65B 4AUKA 3T41A 3PX4A 4F50A 2OPSB 3GLJA 7AT1B 4IR9A 2XZTB 2EK1A 2KT3A 1RAOA 2V4QA 4OMFG 2B5JB 4U6PA 1G4CA 4ECUA 4Y28C 4N77A 3QRRA 3T5LA 1C2PA 4NWBA 5ETQA 2XSJB 2VG5A 2N7CA 3H0PA 2ZFHA 3G2XA 3G82B 3RAQA 1A9NB 4YHHF 3VQSA 4YB6A 5DQGA 4HR2A 3CJ0A 2Y8YA 4Q0BA 5DZ7A 5HP1B 2ROEA 3P45B 2OSQA 1GMWD 3QGIA 3MHYA 3FZ2A 1AW0A 2K2PA 2D3UA 4IYQA 4Z37A 5A2QY 2OPQA 3GYGA 4JB8B 5ETOA 2A10A 5DDPC 5KFBA 4ECWA 1X5SA 1UMJA 2CAJA 2ASYA 4ITSA 3QMQA 4DV1J 4EUVA 1NAQA 4A8WA 5KFSA 1T9VA 4RW8A 4JI6J 5CAAA 1J5OB 4Y6IA 5GMEA 2BZ2A 1NJIT 4TLQA 1AB8A 1TL7B 7FDRA 2W4PA 2IMWP 1B70B 1LW0A 2CVIA 3BREA 1N0VC 2RKIB 5KT2A 2WSCC 1RWUA 4ZLJA 4RPFA 1NK9A 4A4JA 3BKFA 1ZYQA 1RJJA 2IRUA 1H7WA 4I2PB 1X8DA 4DFMA 3C14A 4RW4B 1ACMB 3PKMA 5LSOA 1VLOA 4KH1B 1FJEB 3MECA 2RAQA 2HNYA 1J27A 2W25A 2OD6A 4FF2A 3VAGA 3R7BB 1AA1B 2IHR1 2C2MB 8ATCB 4LRBA 2QL5B 3Q0AA 4MIWA 4G1QA 3KLEB 3KJVB 2L3MA 1HD1A 4YDXA 5HROB 3LQVA 4WFAQ 1UA1A 1FTCA 3TUZC 4GO7X 3G96A 3UFCX 4DU8A 1F3VA 2XTJP 3DXSX 2ZHBA 4B3MJ 2B4UA 1NJXA 4ILLA 3NGUA 3OUYB 3W9HA 1DTTA 1Y5NB 2DKOB 2FTRA 3VAMA 1S0MA 5GAGU 1AUSL 1FE0A 2AKWB 3PJ9A 3H4BA 2I5JB 3A3OB 3TYTA 5IM0B 4PUOB 1N5QA 1PSDA 4B9NA 4MTPA 1OYEA 3NWGA 2QA4S 4KO0A 5KFYA 2JVOA 3HFVA 2DXEA 3LP2A 3QT5A 5D4PA 3IM8A 2KXFA 5I42A 1HPZB 2HHWA 3G87A 3QIDA 4YDDB 4JOUA 2NZ4A 5G4DA 3CVKA 4IR1A 1FJGJ 4C8YA 2BA9A 1P27B 3RGIA 3DLGB 4ZP6A 2KN4A 3MZIA 3VGSA 1HARA 2EW9A 2NYHA 4DX6A 4ZVHA 4CLKA 4IG3B 1U1KA 4DPTA 2O1PA 3GJSB 3FRZA 1B64A 1CC8A 3RYLA 4OHWA 3DOKB 1IKXB 1HKAA 3Q8YA 3DN9A 4FPIA 2HS3A 4YOEA 1YRXA 2JFDA 5DG8A 4HTIA 4WKRA 4USUA 3C8YA 2CUYA 2IA0A 4CO5A 4X4VA 4EBCA 2MZRA 4F4ZA 1TL1A 2B9XA 4ZPVR 1Y3JA 1VQ9S 2DHHA 3V4IA 3B6BA 4DBQA 3MGJA 3KKFA 3PZPA 4J9PA 3CMES 2LYVA 2WK4A 2VBZA 4NE9C 1BMQB 3M2UB 3SQGA 2UUCF 1UWBB 3KG1A 3CC2S 4AE5A 1QM9A 1M5OC 3D1OA 4DWIA 5FJ4A 2BR0A 4P71A 2ROGA 4N8NA 4QYZK 2K3IA 4L74A 4URSA 1DURA 3TX0A 4FZVA 3L3CA 3NNHA 2QLJB 3UW1A 1U02A 1OJ4A 2GIQA 2FZCB 4PXEA 5KFHA 1S9GB 5CCMA 1VMBA 4DQPA 4FS1A 4B3OA 1VI7A 3OVAA 1QAYA 5D78A 2MY7A 1RLDA 1YRTA 1KNZA 2V2QA 3FBEA 5CABA 2E7VA 4LF5J 4QPTA 2N7YA 2OI2A 5KTQA 1SXLA 2DNNA 4OI4A 3JSMA 3NRBA 4Y0FA 2YWHA 4DPXA 4YR2A 2W7OA 4WBFA 4AL7A 1VISA 3CSKA 4P10A 4K4WA 4NYOA 1YWXA 4Y3CA 4J9SA 4CM0A 1FX2A 1KRPA 3SSSA 2DNKA 2AGPA 4HTJA 4K59A 1BQNA 1RHUB 4OZ1A 1TKZB 3M05A 2KU7A 2DIVA 1TKXA 1FRHA 4BDPA 2XI3A 1KLNA 1R27B 2MKHA 1ZZFA 1SC1B 5SZTA 2MZ1A 1T9WA 1UZDA 4GKJF 1R6YA 4MT1A 3DOMA 4LF4F 4J37A 3MUTP 1GMVA 4LFCF 2WW8A 3MR3A 4Y2AA 5L1LA 1UZHA 1D9FA 2KH9A 2G4BA 3P4UB 1RTIB 2VC0A 3DM2B 2P9CA 2RB7A 1MG7A 3M8RA 3ET6B 2GO9A 4LVOP 3KDOA 4J9QA 3NWRA 2Y1RI 3NKYA 2EVZA 1NPRA 4EZ9A 3TJ9A 4P75A 1RT6B 3M6VA 2JEFA 2I38A 5J2PB 1NK6A 1Q16B 3BDEA 4K5SA 2HEKA 4RNHA 5I3PA 2EC0A 4ED7A 2A1BA 8RUCA 3IG1A 2CNLB 2ASDA 3DGVA 1JLBB 1UPMB 2NXCA 2RHQB 3EZOA 1VQLS 2XLKA 2D9PA 3ZZZA 3PCOB 1OSDA 3H59A 5F8IA 1HQEB 3D6MB 1QSLA 5L1KA 5FDLB 2NSCA 4KKOB 4ZVUB 1TMMA 4ENOA 3ZTOA 4QWEA 3M6UA 1RCOB 1S1WA 1XJWB 3OXFA 2QX0A 3R7NB 5A8RB 5F9LA 1G1XA 2J8SA 2BQ3A 2F4VJ 3HJFA 2CQPA 4FS2A 4DG1A 1G7CB 2VONA 3QT6A 5B0DA 1HW8A 4H54A 3DRSB 3QNWB 3CEDA 4PXCA 2Q79A 5F8MA 3GIJA 3EMTA 5BJRA 4F4KA 3PVXA 3QSIA 5KFJA 1GX6A 3BBFA 2ABYA 4DF4A 4ETZA 2Y1LB 3NAHA 1WKJA 2CQCA 2XMWA 3BZQA 2AMCB 1HNVA 5D4OA 4CWBA 4W98A 3MM8B 2W9BB 2I6WA 3LF0A 4XDDA 3G8SA 2LEAA 1R8PA 2NQPA 2VA2A 4DUYJ 3POTB 2G0JA 1QSYA 2ZM6J 1CSJA 2WVBA 2ZE2B 4DR2J 2PFDA 2XMAA 3BPDA 5ETSA 3MR5A 1PJ6A 2KTQA 3ZZPA 4UOCA 1SH3A 1SIZA 3H40A 3BH7B 3CWJA 2W01A 4K0KF 4U9RA 1I94F 4K4VA 1ZA2B 5IXUA 1FDNA 3ILOA 2VKZG 2CJBA 3VWSA 1SH0A 2ZBPA 3ONQA 3GIKA 2HWIA 2FDNA 3I0SB 1P9QC 3CJRA 1RWOB 3TUJC 2PGCA 1L3SA 2E5LF 1N54B 4USKA 3SEOA 1P1LA 2ZH6A 3FFIA 4A48A 3IR5B 2JEIA 4O23A 2PN6A 4DV4F 5DRKA 1RTJA 3OW2R 3EGNA 2OPRB 1K1QA 4C4WA 2VJUA 2XQCA 2LA4A 5AE1A 2VODA 5F8JA 2I0XA 3KLFA 3W8PA 2M52A 2NS1B 1F6TA 4MK9A 4O0NA 2O67A 2CPDA 3CT9A 3MEEA 2MHNA 3Q86A 3N0VA 4WK3A 5LJ3Y 3MAAB 2HQCA 2LKZA 3D5MA 1SL1A 3E2EA 4ZVGA 4DCJB 3EVMA 1VRTB 1UCNA 3KHHA 2J0XA 5HJXA 1XNRF 4DSEA 2MPUA 1QUVA 2O3DA 2MJUA 4I1TA 2LCWA 4AQYJ 3JQKA 1CQNA 3PW5A 1HI1A 2ZC3A 4RUHA 5L46A 4L76A 3MD3A 5B0FA 4K5RA 4WFYA 2HLTA 1F5CA 3FZBA 1ZM3A 2J0QD 2Q66A 4NZ7A 3HHLC 2HHSA 4DN0A 1HNXJ 1X7VA 2CPEA 2YKNA 3W2WB 1XMOF 3V81B 1VBXA 3FBBA 5B08A 3G6VA 3GYXB 1HNWF 2CNKB 4OJ1A 4CDIA 3MTJA 3CW2C 1YJRA 2HBQB 4ZCKA 1JNZB 2ZOFA 2HQGA 2WHOA 1FDAA 2C2EA 1RWVB 2R7TA 4ZLPA 2ZWOA 4OZ2A 3IS9B 4EWTA 4UY8T 2GX8A 2A18A 4WZQA 3DI6A 1WSVA 1VDHA 3GCWP 1IR1A 1S1XB 1RISA 3BSAA 2R8JA 1B7YB 4Y2MA 3GWCA 1EP4B 2AP6A 3RTVA 5KG7A 2PC6A 2WONB 2RUGA 2LQ5A 2XY6A 1H74A 3V6HA 4I69A 2YVSA 4ID5A 4IUFA 3JYTB 3J80Y 2AIRB 4RBTA 2ATLA 3KG0A 4OJHA 3QLHB 2W1BA 4IO1A 2HVZA 3GJRB 4HKQA 3FQKA 4EO8A 4KB7A 3D9BA 1SI9A 4NXMF 3A3NB 2OTJS 4TXSA 1REVB 3NGSA 2QL7B 1O6XA 1A6LA 5LM7E 4IOAQ 4DFPA 1JJ4A 2AF6A 1SJ1A 3ICLA 2IPOB 1IBLJ 1TU0B 2FB0A 1N4LA 4LFAF 2G0CA 2VG6A 4ZVQB 1IBMJ 4JP8A 3LP0B 2Z56B 2DNYA 3LWLA 4OX7A 5FLXY 1RAEB 2DR6A 5J2NB 1JX4A 2VL1A 4F36A 4LF7F 1RCXB 3CTRA 4JI0F 2ZH5A 3HF5A 1GTEA 1EQMA 4YY3J 3VQTA 4WFXA 4CLYA 4USVA 1T94A 1DTQA 3JTOA 2YQ3A 5D0HA 1S48A 4IFVA 4QR2A 2MZTA 2GCFA 2RT3A 1N36F 2VBYA 5KG5A 2DRBA 2BVZA 2HZCA 2VQEJ 3PIPQ 2W2MP 2MQQA 3RBEA 5H9EJ 3AXMA 4R5PA 4WU3A 1S57A 2DGOA 3PDNA 2KRRA 1NK4A 3DRPB 1N5SA 1U1MA 3W61A 3R97A 3H8YA 2CQDA 3DGPA 3UN5A 2Y3YA 4DUZF 1AYEA 4M1KA 5GAHU 3TW0A 5KFEA 2XHWA 2BKNA 4ER8A 3MM6B 4W90B 2YKMA 4YB7A 4Q45A 2LQJA 1NRKA 4DL6A 2DR7A 2CJKA 3R1LA 4LMZA 1RTDB 3RU0A 4ED8A 3V4IB 5KFLA 2VBWA 1HQUA 4Q5VA 3T9ZA 2EPIA 1GMUA 4F4AA 2FY1A 1B0VA 5LJ5Y 3SQGB 4ZCIA 3NP5A 2VG7A 2VICA 2A2DA 1Q8LA 1EKRA 2QGFB 1KLMA 2GO8A 3D0GE 4DV3J 2B43A 4TLRA 4PCQA 2M9KA 1RGVA 3VTIA 5F3ZA 2FZGB 3BN7A 3NBPB 1J2VA 3JSBA 3J7AN 4X62F 1NNDA 1M0SA 1EETA 1YRUA 4MH8A 4Y2IA 2DNMA 2GJFA 1TKTA 2G2ZA 4ANCA 3MOZA 2HAIA 1RAIB 1N34F 2ASLA 1GK8A 1N5YA 3Q83A 1JQGA 3UI3A 1FXLA 4QPXA 1CJUA 5F8NA 3KOAA 1JLFA 3TNVA 1WC5A 3IP0A 4X64J 3TAPA 3R8YA 4EK2A 3JSMB 1S0OA 1JLCB 2DGTA 2UV8G 2F3JA 3BO4A 4OJGA 1XK8A 5IWAF 3RB3A 1IBKJ 3AD7C 1RHJB 2AD9A 4JYAJ 4J9OA 3LALA 1YQHA 4KH0B 2I9SA 3BSNA 4OI3A 4OYAA 2X7IA 1N0UA 2R7QA 1Q8KA 3HD1A 4O3NA 1SH2A 4Q7AA 2K3KA 2VFSA 1H3DA 4FNIA 4CH0S 2QE5A 4N7TA 4PWWA 3OL8A 2XYHB 5HN0A 4C3MA 1BQNB 2JLGA 1URNA 5MAOA 2WOMA 2KJWA 5B0GA 1HHTP 2YNGA 4EYIB 3QZ7A 2LXFA 1EQ0A 4RNNA 1CLFA 1T9TA 4KFBA 4NLVA 3UDVA 2LU1A 1SVDA 1LWEB 2APOA 2KYZA 3IWXA 3KK1A 1L3UA 4IQMA 3RRKA 2HHHF 1ZTWA 1S1VB 4RW9B 2WTFA 3HHDA 4C48A 2HIQA 3G6ES 2PMZD 2KHDA 4HI1A 2EKNA 1A7GE 1U2CA 3I0RA 2V5HG 4PWDA 3L4BC 4MK8A 4OZJA 2LDYA 6FD1A 3UDEA 4KQZA 1L3TA 1C4AA 4DQQA 1S0VA 3VAKA 2G2YA 3Q2SC 4KR0B 4KRWA 3HPOA 5EWFA 2AJ0A 1FK9B 3R7SB 1S6PB 5ETKA 5H9EK 1RKJA 3DLHA 2GMJA 3QIPB 3R5BA 1RYSA 3I56S 3H4DA 4WP8A 3WIVA 1VQ4S 4F7VA 2V2KA 5HMXA 4RBVA 5ETMA 4G3IA 4E8UA 2XI2A 1D3WA 1U0HB 1AZSA 2DPIA 1H73A 4NXNJ 2AJQA 1U6BA 4DV1F 2FUG9 2HHXA 1E6VB 5C7PA 2RRNA 2ILYA 4JI6F 2BABA 3ENVA 1R0BG 1IJFB 2CQ4A 2BRLA 5HVHA 2KRBA 3HLUA 3MEGA 2Z30B 2I2YA 3QFHA 4B08A 3TO8A 3J7YU 4H4MB 4X4UA 2QTWA 3JQMA 1Q82T 1G2EA 3EVOA 2UUTA 2UUBJ 5ETPA 1OY8A 1U09A 5KG1A 1FESA 4DLGA 4WIQA 1KQFB 2DH7A 3MI7X 3U1NA 3KK2A 2CNNB 3K5LA 3FSIA 3PRDA 4QCLA 1ZPVA 1L3KA 3DOLA 4M5IA 1U1NA 5KFVA 5C24B 1AROP 1T05A 2J8AA 4L3KA 1Z2LA 1CS4A 3CJ2A 3J7A1 5IC6B 6FDRA 2XM3A 4ECTA 3ZNUA 1O8BA 4NX9A 4BLGA 1YX2A 3BQ0A 2E29A 4M5JA 1O5JA 1PO6A 1ZPWX 5AXMA 5GAEU 5IV4A 3C46A 3G9CA 1YHQS 3MWBA 3D3CJ 1ITPA 3GJQB 4NI2B 1ZZNA 1U6ZA 1HNIA 4DV0J 2C3UA 3WX4A 4ZVTB 4QBUA 4C3KA 2RILA 2YH1A 4CNYA 2QSFA 1RT5A 1GX5A 5DO2A 4M5DB 4ZMMA 2R42A 5CZXA 3Q22A 1WC3A 2BKPA 4ZK7M 3D1QA 2UXDJ 1QVGR 1YJ9S 2N4DA 4CLLA 2X3DA 1K1SA 4UOFA 2GVDA 2H5IB 4OYOA 4I2QB 4AL6A 2WZ1A 1MU2A 2OAUA 1ZA1B 4K4TA 4N5SA 4USTA 5GADU 4DR3J 1QLNA 5CD4H 4GO5X 2V8HA 4RU2A 2XS7A 4C2MA 5DM7Q 2C3PA 2MQLA 3NOCA 5KFWA 4ECRA 3RAMA 2ZJRQ 3SCLE 3OHAA 1FJGF 1KQKA 1SV5B 2DGVA 2DEIA 3CO9A 3TVYA 3HVTB 5LSRA 4DEZA 2FHJA 4OV1A 2IYGA 4WTYA 4FVMA 3CD6S 2W2OP 2FVQA 4Q8FA 4EI2A 2IVMA 2DBBA 3D6FB 3JB9k 1Q7YT 1Y7PA 2WSEC 2G13A 3TAMA 3CJ8A 1TMJA 3HDSA 4DL5A 1Q1KA 3BBCA 2CQ2A 1HBMA 2HYIB 1VS3A 5IT9Y 3BB5A 4U8YA 3R1HA 3E8OA 4I6WA 4RW7B 2H5JB 4KY3A 2OFGX 3N5BA 1TL3A 4ELVA 2H48B 3HXMA 5RUBA 4JUZA 3DYAA 2FY8A 2PA3A 2XG8A 4O3QA 1VQKS 2AEFA 2HWTA 1KDNA 4RNOA 4DR5J 1S1TA 4C11A 3CXCR 2GJ2A 1W25A 3D4JA 4OHXA 1NPKA 1FKOA 2J9DA 3JSYA 3EJMA 2DNZA 2ZHOA 2HK3A 2EBGA 1UPPA 4M95A 2YNHA 2KKHA 2J9DE 1CPZA 3WDOA 3DLJA 3SDEA 3NCPA 3P49B 4G65A 1VGYA 4WFNQ 2BEFA 2DISA 4PXDA 2Q6BA 1T02A 1Q78A 1H6KX 4I4BA 2VOOA 4NASA 1VK3A 4UOHA 2E1CA 3HO1A 2POKA 3W66A 3JAMY 1Y00A 5KT7A 4HHHA 2KYXA 3N01A 4CO1A 1BQXA 2GIFA 3LW5C 3ZTPA 4ZN1A 1YKWA 1VJWA 1SC6A 2JC1A 4CYUA 1VIXA 3I96A 2IC3A 2B8PA 1VCTA 2OTLS 3I82A 5D0EA 3KLGA 3TQ1A 2J6UA 1BHNA 3A8IA 2RNEA 4PQUB 3HVRA 1RHMB 2HMIB 2O5DA 2CPIA 1U8SA 4K4UA 4DPOA 2V69A 2MLZA 3NS7B 3TA2A 4HHJA 2P5VA 1RHRB 3V6DA 2DO4A 2MKYA 4NLYA 3AH6A 4OZ5A 1OSCA 1QE1A 4OFZA 5B0AA 3KTQA 3KNAA 3MMCB 3PYGA 1X4HA 3RBZA 2UUAJ 2BANB 3CJKB 3MM5B 4LSNB 4FYDA 4OX6A 2RRBA 2ZNZA 5F0WA 2XLIA 4HI2A 2RQ4A 3DXBA 4N8OA 3X1LB 2D41A 3MXHP 5I4MA 3CJSA 2IVYA 1GH8A 3JTNA 3S8SA 5E0OA 3E01A 2HVEA 2FHMA 2AYEA 1M5KC 1HBOB 3DLLQ 5HJYA 4PG5A 2DNGA 1TUWA 2ZJPQ 2B4PA 2E1MC 3N4WA 1WG4A 4CLZA 2RDIA 1XR5A 2CRLA 2GMLA 4R25A 5IQ6A 2AYGA 3R5DA 1B4SA 2DHXA 4G1IA 3JTPA 2IFXA 1VJQA 3T6BA 2OEJA 3ISND 1M5HA 1HI8A 2FC9A 3NOGA 1S10A 3EDRB 3KXDA 2DY1A 4R8UB 1S1UB 3R9LA 2DYAA 1OMSA 1X0PA 1WI6A 1HA1A 1FRMA 2ASJA 3AHPA 3Q8PB 1Y3KA 2C2NA 3OR1A 3CMAS 2M8HA 3P8BB 4OZNA 1IKWA 3OTCA 2UUWA 3G8TA 2OGUA 3HT0A 2ZITA 1KS2A 4DSIA 2F4VF 1KLMB 3GB0A 2QYGA 1KWMA 3D0IE 1BWVA 5EX3A 2YNIA 5J1EB 2OH2A 4JI1J 4LF8J 2GQCA 4MMOA 1S97A 1YDLA 2HBYB 2UVRA 1UVMA 1C1CA 2L9NA 4HEA9 3NGKA 4NEZA 4OYZA 5J1PA 4H4KA 2XC9A 1F1BB 1MSWD 3AD8C 1TKTB 3W64A 4ES1A 3QAUA 1CJKA 1V6HA 2ZH4A 1H7XA 1N32J 2AT1B 5DGAA 4PPDA 1Q95G 3PO4A 1X4FA 3HSGA 2XMKA 3R6LB 5LMNJ 1B3TA 4DQSA 1HBNA 4TYAA 1P8GA 5LXRA 3IGVA 4Z7CA 4DUYF 2RF2B 4PG7A 2VFTA 2HVHA 1OQ6A 3TVZA 1LQ9A 2C2DA 2ZM6F 3EM1A 4U7UD 2ZDOA 3LGNA 3MMAB 4C8MA 1O51A 3M32B 4DR2F 4FP9A 2DH9A 4NCGB 4CO4A 1ZM9A 2KZZA 4OI2A 1V3SA 4UF4A 4PAAA 1HMVA 4CNZA 1SL0A 4DXLA 1RKIA 3M7VA 2PMWA 1R0AB 3M1VB 3GSIA 2M5YA 3RW7A 4N56A 4KIAA 2UXBJ 1RSCA 2R7WA 3DC2A 5CYMA 2YNGB 1S4FA 2YKQA 2IBKA 4C8KA 4XIUA 1YBTA 1Z1ZA 4H4OB 2PA8D 3A8JA 1TVRB 2QJ3A 4JI8F 4OYBA 3FNNA 4NRUA 4NLSA 4CLWA 4OHYA 1TV6A 1UP1A 2ERRA 4A8OA 2RU9A 4LREA 5HK4A 1NXIA 4KE5A 4Y65A 2A6OA 2MKIA 5BXIA 2ZKTA 3G86A 4AFFA 2E1AA 3I0RB 3WHIA 1FJCA 1EJ7L 3W63A 1YJTA 4C3LA 2GGPB 3ZNJ1 4RW6B 1FX4A 3OL7A 5A8WA 4M5NA 4RKUC 1UFWA 3ADAC 5DGBA 4DR6J 1VQ5S 5HBMA 3MCSA 2FVSA 3W60A 3I9ZA 4IFYA 3OR2A 3OT9A 1VQNS 4FYXB 3IWNC 1C0TA 3DRYA 3OHBA 3PIOQ 3GIIA 2DNLA 1N88A 1RT2A 1NK8A 3NAIA 3D6TB 3PR4A 2V8PA 3BJYA 2PT0A 4I7FB 4O3PA 1JLEA 3GMGA 2WVDA 1VQMS 2VQFJ 1OO0B 3TEHB 4FF3A 2H4WB 1RWPB 2R2UA 4S0MA 4TYBA 1JLQB 1LW2A 1HD0A 2ALYB 2FQQB 3D3BJ 1ZOTA 2IM1A 3KWMA 3I31A 4USMA 1DRZA 1TK0A 2R8KA 3C6UA 4DL0C 1J5EJ 1H2TZ 3J80U 4DZ6A 2AJ4A 3ZXWA 3ZZYA 4U7CA 2VPWB 2XO7A 1XMQF 4DPWA 5SUHA 2E5IA 3DDIA 3EGZA 3T6JA 1NH7A 2VC1A 2DT9A 4JI2J 2Y8WA 4HDGA 1HFEL 2HHQA 4NLTA 3KK2B 1JLAA 4UTGA 1C1BB 1CJVB 1RU1A 3DOLB 4DV2F 2DTJA 1NDCA 3ZO7A 3DLEA 3M30B 1CS4B 2BKOA 4ES3A 1NU4A 3EPIA 4FKXA 3LO3A 3TA0A 4LBIA 5FLXU 2IRYA 3MMJA 4OX9J 1DLOB 3R2CJ 4CO2A 2M0GB 2GV1A 1LNQA 3T5KA 4PYDA 2M70A 3TZYA 3QYYA 2MKJA 5J2MA 2GVZA 2QLWA 2RUSA 3HK2A 4ZOSA 3A12A 3LP1A 2CFXA 3DLBA 1WTFA 3C15B 1SB6A 2HNDA 1FJ7A 3ZZ0A 2FLLA 5F3TA 4PABA 1RT5B 1X31C 3MAHA 1NDLA 5D4NA 1R8BA 1WDDA 4O44B 4ZVOB 1Q4RA 5A0YB 1IBMF 4P6QA 4LRAA 5CHCB 1NCLA 1Y10A 3EWGA 4V19X 3LUYA 2H54B 2EC2A 1NSAA 1B0TA 3EGWB 3M8QA 1KTVA 4YY3F 1S72S 1NPPA 1H38A 2X1BA 1UFLA 2XEXA 3LPYA 1K73T 1UW9A 4LRFA 2H1YA 3OBIA 2JOQA 3KNGA 5L9XA 1FD2A 2VV5A 2AGOA 1NH8A 2NXEA 1NB7A 3TQEA 1QUPA 2FYXA 3W3SA 4BWMA 4LF2A 1RP5A 1WNEA 1LWCA 1BUXA 3MUVP 1HI0P 3DHWC 4IRKA 4PQAA 1FF2A 2MKSA 3ENAA 4ED1A 4GKKF 3A8EA 3AQPA 3GV8B 3KLVA 4LSLB 1VQ6S 1UW4A 1T11A 2C2ZB 2LXUA 2UZAA 1WJ9A 1OY6A 4LSZB 3UPFA 2CQIA 4OV6A 3TZZA 1YITS 2B3TB 5J2QB 5KT4A 5K20B 2E66A 2I8EA 3CCES 3SZ2A 1S6OA 3S7RA 1N6QB 3EZUA 4DN9A 4ZLNA 2MHEA 4IG0B 1Y0HA 4DV7J 5KOXA 4BCAA 3ILJA 2HHVA 2QSWA 1KQGB 4NL5A 2EXUA 3KJQB 3L7PA 1C4CA 2CQBA 1WF2A 4PWUA 3EE3A 1S1TB 1NSQA 2V2ZA 3W2VB 2JSXA 3BGRA 3GFYA 4DI6A 4QIFA 1WC4A 4KHPJ 4DV3F 3I5CA 4ILMA 3EGVA 4QWBA 5CYQB 5F8LA 3MDFA 1Q5YA 1TUGB 3B54A 2BJEA 3SDEB 3DCAA 4AXIA 2W4CA 4PG8A 3HSZA 1PG5B 1GQEA 2F4FA 3UQSA 5E41A 3NS5A 2DEJA 1M1HA 4DR7F 9RUBA 3OXLA 3Q89A 2OIHA 1OWXA 1S99A 3K8VA 5ETLA 1X4EA 3SYZA 1BC6A 2CQ1A 4IRCA 1K47A 1M5PC 3SCJE 2YPZA 1BXNA 5C25A 2FVRA 2BE2A 4X64F 2Y1JA 1WHYA 1SQGA 1QD1A 1JLGB 2DXDA 1IBKF 2W2NP 3L7UA 1SBRA 2C2KB 3DFEA 4ZVFA 2M8DB 4A8MP 1EX8A 5EWEA 3T5HA 2RQMA 1WC0A 5DG9A 3CCQS 4LQ9A 1WHWA 1YI2S 3P3DA 2H5EA 1U4BA 3FKBA 4OZ3A 1Q86T 5HLFB 2DD8S 2RQKA 3WBZA 2PI5A 4P74A 4PG6A 2B9EA 2KFZA 1MLAA 4NOHA 1R31A 1UJ5A 4OYXA 4TU7A 2JEJA 5KG4A 4TU9A 3SXLA 1YLXA 4C0BA 2CPZA 1HLWA 3IXQA 4ICLB 1Y11A 2QG9B 3HSJA 1XC9A 2B6AA 1SUQA 3FUYA 3OJSA 1FRIA 5G0RA 4CT9A 1FD8A 1BQMA 3Q23A 2K8GA 3H20A 1N5TA 4NMLA 3TARA 3IAS9 1FWPA 3MEDA 4NCBA 2Y9HA 1IKVB 4LBHA 4DS5A 4F0MA 1T03B 1WDTA 2HQFA 5KT6A 3I55S 1LOUA 3V2UC 2OPPB 3NL0A 3M9NB 4JV2A 3DU6A 1S5ZA 4O4GA 3BGOP 3AODA 5CZVA 2YTCA 3HHKA 3U7JA 4DQRA 2YKAA 1RYRA 4ATNA 3I9V9 1S9EB 3TX8A 4LBPA 4TY8B 4KGXB 1TR0A 1XIQA 5D3GA 4HH1A 5KFMA 2X51A 1FKPB 1N33J 4NXNF 1D8ZA 1VLYA 2FLPA 3OR1B 4CH1A 2IAJA 4C97A 1IKWB 5HANA 2IBOA 1OIAA 4X65F 5F41A 2QFJA 4FYVB 2ZJQQ 1UL3A 3K5NA 1GNKA 3OD2A 3FRYA 3KLIB 1KD1T 1WC1A 1PJ5A 2HKEA 3CNQP 4C8ZA 2MSTA 2D3O1 1HQ2A 3VVUA 1GMWA 2UUBF 1C1CB 4Q2MA 4HVZA 2CJAA 1SJ4P 4I6AA 2DHAA 1CVJA 2NYIA 4L72B 4PG4A 2HQ3A 1RWXB 2UUCJ 4MFBB 4C8NA 1GXTA 3IR6B 3GP9A 4EYHB 1KTQA 5BYSA 3OLBA 2C2RA 2EG1A 2RH3A 3BN4A 2HRUA 1LWFA 1MWYA 1B7FA 2L9DA 5BYRA 2M3DA 3U1LA 3OQ2A 1ICEB 3N6NA 3PJWA 2G9OA 3PHEA 1RT1A 2CJYB 4LF9F 3THVA 3M4XA 1YJ7A 2B56A 4CP5A 4Q44A 3AQOA 4RZRA 2QYCA 5KFKA 1RLCL 5KFQA 4DPUA 2B8QA 2XMJA 2D1CA 2E9TA 4DV0F 1RAFB 4F0KA 1HYSB 2YNFB 2W9CB 4CLTA 3N79A 4PKDB 3JS9A 2ZH8A 2Z2ZA 3LTOA 4K4ZA 3BR8A 1H72C 2V8DA 4V19J 1N8RT 1RK8A 3EYZA 5D77A 3GTYX 5M2RA 4ECZA 2UXDF 1IKYA 1C0UA 3SBMA 1UEUA 3CCUS 2XSFA 2GJIA 3KMSA 2XMMA 3J81j 4H4KC 4DLEA 1TV6B 2E7XA 2GW8A 4ETXA 1FERA 4B17A 1R89A 2R3VA 3DRRB 4DR3F 1AFIA 2WCXA 2XCAA 1JKHA 2LECA 3PEJA 1T95A 4X4PA 1CULA 4RLEA 2O01C 4IRDA 3CCRS 1UKUA 5F0UA 2AQ4A 2B4OA 3VV2B 2CWKA 1IM4A 4LIRA 2GA7A 1RTHA 3MUMP 2V50A 1SJRA 3SFGA 4RUCA 3BH6B 5HBMB 1IQTA 3O2IA 4QW8A 3UN2A 2AWZA 4LFCJ 3CDAA 3ILLA 5E3AA 2IVFB 2AEJA 1XTZA 2N3LA 3GU0A 1JXLA 1FA0A 4IQXA 1S6QA 2J0SD 3D2WA 3KK3B 2B5JA 4RL1A 1UVKA 2KT5A 1YJVA 1U45A 2KVIA 4FXWA 1YZ6A 3VZIA 2WW4A 2VPZB 3G6XA 2PE8A 2BM1A 4L3NA 3PY8A 1EHWA 4A8XA 4ECQA 3G82A 2ZH9A 5IT0A 1APSA 4DR1J 2DPJA 2W8LA 5HP1A 2SXLA 4DR5F 2CADA 2WVEA 3PW4A 3JAMU 2DO0A 1MMDA 3C6UB 3ENQA 2WBRA 1GXUA 3WC0A 2E5JA 2HNZB 3ZZOA 4RUAA 2UVVA 2CYYA 1U47A 1YJNS 4NA2A 5K14B 3PJXA 4B02A 1FDDA 1JLAB 4QQBA 2YBVA 4GVBB 1RXOB 1SL2A 1FHTA 4ZP8A 3IC1A 2P2CB 1RT4B 5CH7B 4U96A 1IVZA 5KFGA 3CC4S 3DLEB 1NBEB 2BXJA 2CNOB 5I3UB 2F8HA 1J5OA 4B3SF 4HT5A 4K4YA 2HFOA 4HACB 5C5JA 3CMQA 3I4HX 1KN6A 1JXVA 4A46A 1RAAB 3KHGA 4DV5F 3NGRA 1RAHB 2HFUA 2ADBA 2ZZNA 3CULA 3RB6A 1R3NA 1KFSA 4EGLA 1HBUA 3BGLA 3SSRA 2H51B 1RHKB 4CM2A 5ADZA 4DL3A 1FE4A 5AE2A 3HMJG 4PZVA 4YQWA 3UVJB 1TL5A 2VDHA 3OFGA 4I2PA 1HR0F 2CDQA 4RW4A 3LP1B 5H1SV 4E98A 1R6VA 3IRXB 3I6PA 1K44A 1ZBTA 4ZKAA 4OZ0A 1LEOA 1VYAA 3V6KA 3UD3P 4ZS6A 1WELA 3UCZP 3QWUA 3D54A 3KJVA 2EI5A 3AD9C 2KJVA 3LH2S 3BR9A 1CBKA 3TRGA 3FCHA 2UUAF 3M8QB 2QA2A 4LT6A 3RZAA 3F73A 3LWMA 1URRA 1U1PA 4ELUA 5E3RA 2XY5A 3OUYA 5ETTA 4M5MA 4ZIVA 4QYRA 3M2RB 4O0IA 1D9AA 4ILRA 4QU6A 4ZVRB 4P9SA 3RRHA 2I5JA 3M8PB 4EBDA 3DMJB 1WACA 4F25A 2DGXA 5IM0A 4PUOA 2F63A 1WG1A 5F8GA 2FJEB 3NS6A 4Y2KA 2NXUA 2MQMA 4DV4J 1LWCB 1RADB 4OYIA 2IRXA 4ID8A 4QW9A 3ETOA 3F56A 2ZOGA 3V4MA 5F8HA 3FVYA 3W1YC 3SCKE 1HPZA 4ZP9A 2GC8A 2XMUA 2HZAA 2Y1IA 2CZ4A 2J7KA 4ZPDA 5E3CA 3DHXA 3DLGA 2LQBA 4F04B 4XAKA 2KO1A 2LU2A 1SIWB 4IG3A 3DU5A 2DNOA 3O5TB 3CF5Q 1UAWA 5T7LB 3DOKA 1IKXA 4NMXA 3BO3A 2G2OA 3O1LA 3N9UC 2HPUA 1EB0A 3BGRB 3F0NA 4WP3A 2NXJA 1RT7B 1YSJA 2C22A 3WX8A 2MTLA 4QU7A 1HHSA 2XS2A 1WKLA 3O3LA 4LJMA 2K7KA 4YEAA 4J9LA 3T1HJ 1LKZA 5AE3A 2DRDA 4WK1A 3R5CA 3KG4A 4CLSA 4AYBD 1YG0A 2V4JB 2MQOA 3BO2A 4OLPA 3QJLA 3R5JB 4NLXA 3M2UA 2CA9A 1NKEA 1XMOJ 1UWBA 4CLPA 2UXCJ 3QAEA 4UW2A 4G1PA 4P73A 1N32F 3MM9B 2RS2A 1WEYA 3VGUA 5EX0A 1OPZA 2P6SA 3W7BA 4DFKA 3MPVA 4OYPA 3B78A 2F8MA 5LMNF 3ULHA 3T1AA 2J7WA 2YKOA 5IT4A 3GE9A 2E9RX 1LK5A 4DFJA 4OI6A 4WCEQ 4B3RJ 3QRQA 3L9ZA 4K7QA 2YXLA 5A6PA 5GADI 2IA6A 3D1HA 1SPBP 4CTAB 4MIAA 2NR0A 1S9GA 2JJ4D 4XPCA 1U6FA 2B9WA 3RR7A 1RB0A 5KT3A 5IC4B 2PMHA 3TUPA 3M9MB 4UUXA 4PRFA 1F3FA 4B9SA 2KM8C 2ROPA 2HBZB 1DFDA 1HNZJ 1FI4A 4ZPCA 1XR6A 2F40A 1W2IA 1CJTB 1XEZA 2VPYB 5JXSA 1KVJA 2RS8A 2HFZA 2RQCA 1RWMB 2UXBF 1S6UA 2C1EB 5LMUF 3KLHB 4ECSA 1D1UA 4NXMJ 2PEBA 1DBDA 1NHVA 4C0OC 2FIUA 2OFHX 2YWEA 2KXNB 4K2JA 4ZN3A 1LXNA 4MK7A 3MM7A 1FRJA 3FCWA 3THTA 4W92B 4WJBA 2B6AB 1SUQB 2FZKB 3P6YC 4JI3J 1YZ7A 4ZVSB 2QIFA 4F4YA 3HHLB 1BQMB 3B4DA 1TKZA 2DH8A 4JI0J 2D69A 2BRKA 4EO6A 1A0OB 2EFQA 3AAWB 3ZTQA 2BQUA 1O0PA 1RT3B 5C42B 2CQHA 4C0HA 2D7SA 2GZOA 3R3TA 4A8KA 2DY9A 4ZDNA 4NLDA 1HIYA 4F4XA 2OKQA 1N36J 4KV8A 3RBXA 1OY9A 1RZMA 3AJDA 2OUGA 1S12A 4RU9A 1RTIA 1P9YA 5C2CA 3DM2A 4Y00A 5AT1B 3ET6A 2VG5B 2YWGA 1AUDA 4K4XA 2VQFF 3CCTA 1RT6A 4C98A 4LQ3A 4Q0BB 2AYMA 3H25A 3KHLA 2GNKA 5CD4A 3SQOP 1DQ8A 3K2YA 4WE1A 3PO5A 2OPQB 2FLNA 1JLBA 2HFNA 1J5EF 2P8IA 5ETNA 2I1RA 1V5IB 2VH7A 4A47A 5AXLA 4NA3A 4QIWD 3FBFA 5FDLA 4KKOA 3S1TA 2MLYA 3SSQA 4JI2F 4X4NA 3H5SA 4RW8B 4F3OA 5A8RA 2BX6A 2W9AA 1VHFA 3M8WA 1FO1A 3UCUP 3M2VA 4F3MA 3QT7A 2UV8A 1M90T 4P2MA 3DRSA 2ACYA 5KFUA 2VD3A 3AA9A 4C6AA 1I51B 1LW0B 3TZXA 4OX9F 2ACMA 4NEYA 4X62J 2AZ3A 3VALA 4P52A 4NLGA 1M5SA 1VC0A 5M2PA 2PI4A 3PRVA 2CJ9A 2RDDA 3IM9A 3TJ8A 2DNPA 1SC3B 3LAMA 3F41A 2N4CA 3KUGA 3C14B 2YY3A 3MM8A 1N34J 3UD5A 3GCXP 5JUMA 3CCZA 4LVNP 4B9MA 2R2RA 2DB1A 1E6YA 3MECB 1X60A 3J7ZT 1TK5A 2UU9J 1TL4A 2AJFE 2HNYB 2RJZA 2E1RA 5LXYA 1KBRA 4X4SA 2MXYA 1X4AA 1KOOA 3POTA 3H2VE 2HSEB 4G1QB 1WF1A 4CQ1A 3PNIA 4NA1A 2ZE2A 4YN3B 2J6TA 2QFIA 1VQ7S 1HWIA 3J81Y 3UN3A 4YUDA 3Q8SB 1FFWB 2XY7A 2MQ8A 3PKYA 2YQ1A 4OQJA 5DZ6A 1DTTB 2RD5C 3HHLD 4QWCA 2KL8A 3ILIA 2EFGA 5U47A 4RBUA 5B7WA 4MKAA 3I0SA 4FBUA 2CG4A 3FDSA 2LDIA 4P2XA 5E2QA 4MAKA 3U27A 1RBAA 2HBRB 4M5LA 4KO0B 3BGFA 2MZJA 2FJAB 1H98A 2MYFA 1RTHB 3CJTA 3HI9A 1W2BR 3LP2B 5KFFA 2QO3A 5LL6d 1Q81T 4BBYA 3CDEA 2OPRA 5I42B 1VQ8S 2MMYA 3QGPA 3H42A 5K5MA 3MPYA 5KFOA 4LFBJ 3KYLA 1S6QB 3V6JA 3FMBA 5HQ8A 4DSLA 2ZOMA 2EBEA 1MNEA 2CIMA 1KFDA 2XMTA 2ALZA 3FSYA 4WXOA 2VPXB 3CGIA 3MAAA 4DV7F 2DHSA 2ATCB 3PTWA 1SKUB 2AGQA 1VRTA 3PXGa 5HQMA 4ZCMA 1VBZA 4JI4J 3W5YA 2Z58B 2DRAA 1XNQF 2X1AA 1MN9A 2CPHA 3QWPA 5K8NA 3IRWP 1CC7A 4WYLA 4DOZA 1TL1B 4KHPF 2V94A 2VIHA 1RWKB 1VRUA 3AJ1A 4ZHRA 1WHXA 3BSOA 1F9HA 3UDLA 3CC7S 3TAQA 1U1OA 1S4EA 3OPKA 4QYZJ 3IBWA 2LEPA 2BDPA 3W2WA 3V81A 2NREA 4JI7J 4DL7A 4CO3A 3NMAA 5EWGA 4J9VA 2R7SA 2K1RA 1MW7A 2XBPA 3A1YG 3T3FA 1WORA 2J6SA 1HBUB 1JMTA 2HRYA 3VHQA 2W24A 5HMZA 1QY7A 3IS9A 2V9WA 2JHEA 5LT5A 2A6MA 4RX6A 4LRDA 2VZ9A 2QA4G 3CJQA 1L5UA 1FWLA 4AT1B 2FHKA 2DNHA 3B4MA 1S1XA 4OYWA 2MB0B 4LIWA 2XGQA 3H90A 2ZUGA 1EP4A 2DIUA 5ETRA 4DUTA 3QJJA 4B3OB 1QVFR 2WONA 4PPZA 2DK2A 5KFIA 4KGZB 3S6EA 1WOPA 2K06A 2MDAA 3KMQA 4KSEB 1IWAA 3JYTA 3W8GA 2AZ1A 1DHMA 3ZZUA 3QLHA 3QFWA 4KHRA 3NGDA 2FHOB 2W4DA 1U2FA 1LFWA 1MN7A 3QATA 2G1HA 1NK7A 1OPIA 1VC5A 3H2UB 2C2OB 3K5MA 3EZ5A 5GMDA 2BBEA 1REVA 1RI7A 3RJMB 5FIIA 1NZAA 3G8QA 1B99A 4KGKA 3AXKA 2DNQA 1T9XA 3X3UA 2CPYA 3T19A 1RA7A 3BSCA 3LP0A 4PR6A 1TKXB 4K50A 1TAQA 5KG2A 2DJWA 5J2NA 4WPAA 3M8SA 3MCNA 2HZVA 3ZTSA 4UOGA 1ZETA 1F2GA 3DOMB 4MJKA 3GILA 2IM2A 5KFZA 2JZ5A 5A2QU 5KG6A 2HGLA 1ZAWA 3ZTRA 2AYBA 2CQ0A 3SV4A 3UDCA 1FNMA 3M8ZA 3E51A 3IO1A 2B7BB 3DRPA 2U2FA 4L75A 1N33F 3THPA 2QLXA 4FF1A 1SJ3P 3CJ4A 3HFKA 3V5RA 4FVCA 2V4RA 3DLKA 4CT8A 2K7JA 4N41A 3MM6A 1PKUA 3IG1B 3GIRA 2VFUA 2ZWPA 4YB5A 5KG0A 2J76E 1TKDA 4IDKA 1S49A 4DCOB 2R7XA 1RTDA 3GFXA 8AT1B 2D74B 4OX8A 4K2XA 2XHCA 2W8KA 1CEZA 3M9OB 1S1WB 1NK0A 3CD0A 2O66A 3GIMA 1S7HA 2X1FA 3FK4A 3PYEA 2QMWA 4KPYA 4DG1B 4QZVB 1KONA 1W7WA 1SKRA 2PIIA 2JL9A 4JV0A 4IKAA 4LRCA 4ZA1A 2LEBA 2IJRA 2F9JA 2JC0A 4R0EA 3QBCA 3DDKA 4M63A 3NBPA 4YR0A 2CKWA 4OIXA 2VFVA 1HNVB 1U1QA 2L41A 3IN5A 3Q24A 2XO6A 3LA0A 1TELA 4OI0A 1ZS6A 4DV6J 1IJEB 1UVNA 4RR5A 3OSPA 3NG8A 1GFWB 1XBWA 2V68A 4ZPWR 3PEHA 4G6VB 1PGZA 4YR3A 4FNHA 2R2TA 3LAKA 1I3OB 2HS0A 2FJVA 4NLQA 1K8AT 4F2SA 4NYPA 2MY8A 3R5AA 4JV5J 4USJC 5D6GA 2OELA 1JLCA 2MKKA 2VDIA 2EK6A 4K4SA 2QT7A 2YX1A 4EEYA 1WUUA 2ZUAA 1YK9A 4B3MF 3JXOA 5LOQA 3MM7B 3S01A 4A8YA 4TQSA 1XMBA 2NSBA 4I67A 3H2LA 2F7VA 2DGUA 4BC9A 2OP5A 3PACA 2R8HA 4DS4A 3CJ5A 3SI8A 3JSRA 3NXZA 2CVEA 5L9NA 1RBOB 2IDEA 3FFIB 4PEOA 3OSNA 4NPOA 2OEKA 1X4BA 4DX7A 1FKAF 4ZP7A 4KHMA 1NJYA 2OLWA 1RTJB 1KVIA 2JLEA 1VQOS 1D0EA 3OXGA 1LWEA 4F8RA 4QIEA 3TI0A 1Y5LB 3G6YA 1S1VA 4RW9A 1PBUA 3HT3A 3KLFB 2J9CA 4KV8B 1ROFA 2YWFA 3VCDA 5K8PA 4GRSA 3MEEB 4GC7A 1YGYA 1NM2A 3BEGB 1F60B 4J91A 4ZCLA 3MOJB 1R8AA 1D09B 5AXKA 4FDFA 4E2FB 1AFJA 2V9KA 3K7RA 4EBEA 1FK9A 4DR1F 4DX5A 1S6PA 1PJ7A 3MPUB 2XYGB 5CA5A 2Z8QA 3D7SB 3QIPA 4TN2A 5THWA 4WE1B 4ZJLA 5F9NA 1VQPS 5D15A 4I6YA 1JJCB 3K8WA 4CH7A 1Y5IB 4YS2A 1U0HA 3M8YA 4HL9A 2CJXB 2IM0A 3GONA 1UJ4A 1E6VA 1FDBA 2YKNB 4R0JA 3M2VB 5ITHA 3I32A 1T8EA 4ZPAA 4KAIA 2HQIA 4H4MA 3HP6A 3CCWA 1I1GA 3W9JA 2YPYA 3AOAA 1M1KT 2QZ8A 2BJ3A 4ZVPB 3SFUA 3QQCD 3PR5B 3A3PB 4ELTA 3GJTB 3DI6B 1F5AA 1G3OA 4J9RA 3Q2TC 2ZEJA 5E33A 1VBYA 2E5HA 2E44A 4DHVA 5C24A 1E6YB 1WHVA 5IOLA 4Y2CA 1T9YA 2AJ1A 1B0PA 2AHOB 2ZHAA 4ID5B 4F02A 2B51A 2FVCA 3GR0A 4Q2LA 4P2FA 5JJBA 1H2VZ 4LR7A 3PRBA 3GYNA 1RTZA 1HWUA 3RRGA 4LF5F 7FD1A 4Q8EA 2L48A 5D0RA 4J9MA 1ZTTA 3H5XA 4NYZA 3VZHA 1FT8A 1BLUA 2R7OA 4FBTA 4NI2A 2N82B 1HHQA 2OMOA 1KR4A 3G4SS 4WFBQ 2J9EA 1KP6A 2YX4A 2LP4A 1LK7A 2VG6B 4ES2A 4M5DA 3FEZA 3AFGA 3P5BP 5JVHQ 4KGMA 3BM7A 4N76A 2HS4A 3OFFA 3GV5B 4I0WA 3G71S 4JI8J 4YFUA 4I2QA 4LF6J 1DTQB 3RG6A 3CCVS 5IS2A 5DJBA 2KG0A 4IFVB 1KOHA 2BM0A 3KUHA 2CXEA 1U2RA 2QA1A 4ZJQA 2XCPA 1ULRA 3UD4P 1CG2A 2HW3A 1WOOA 2JRSA 3SV3A 1X4CA 4R5PB 2DITA 1KQSR 1FRLA 3Q8QB 1UJ6A 3QGHA 3QZ8A 2UVWA 1SV5A 1ZM4A 3A4TA 3HCXA 4O3OA 1NJZA 3DGPB 3HVTA 5HAOA 2HAFA 2A2CA 2EWHA 3FEYB 1DAXA 1V5VA 2VASA 1VHIA 3KDNA 1PIEA 1Q79A 2YKMB 3VGTA 4LR9A 1IQZA 1VQSA 5HQLA 4JBCA 4Y34A 3TA1A 1WI8A 4WIIA 2CQGA 1UEVA 2DXFA 5BYQA 1VRUB 2P9GA 4ZHRB 1HQUB 1WG5A 2H3EB 3T1HF 4RW7A 3KJFB 2R7UA 4UT4A 5DLGA 3HVAA 2MGZA 3CD7A 2IJFA 5M2UA 2EEYA 2VG7B 2MZQA 2WRMA 1RACB 1GT8A 2Y0SD 2F8EX 3AB4B 3NGTA 2UXCF 2Q43A 4OYMA 1N56A 3TJAA 1T3OA 5DDQC 4TVAB 4Z7YA 4DPYA 5DS7A 3IWLA 1XMQJ 3PM9A 4OJ3A 1RAJA 2K1RB 3TOQA 3T5JA 2VUGA 1JJHA 4RJVA 1WF0A 2WB1D 2JDJA 3MD1A 1EETB 4UUWA 3TEGA 3I5AA 4B3RF 2HHTA 4XO0A 4DV2J 2DGSA 1KEKA 5GAGI 1YBUA 3HHNB 5IV3A 4P7TA 2VB6A 1DZ5A 1N5YB 1DARA 2Z0GA 2ZBIA 2HVDA 1CJUB 5HVGA 2MQNA 1NUEA 4Z2XA 3MFHA 1JLFB 5JVGQ 4EMDA 1U8WA 1RE1B 1T0TV 1HNZF 1F5BA 4ED6A 1R7IA 2LVWA 5KT5A 2ZVSA 2JLFA 2MZSA 1RWNB 4RNMA 4DR4J 4X66J 1WEZA 4B3TJ 1TAUA 3GV7B 1Q8BA 3L7OA 4NCAA 4QWDA 2Z2MA 2OO4A 4PQUA 3MFIA 2HMIA 4USIA 3L95X 2Z4PA 4UQGA 6AT1B 2ZKUA 4A8QA 1R0CB 1JWWA 3BGUA 5KFXA 2CQ3A 4ZVEA 2AJ2A 2FVPA 2PEHA 4QIVA 2QRRA 3UCGA 3WIUA 1FRKA 4WFZA 3CDWA 3CUNA 3R2DJ 4JI3F 3OTOJ 2WOMB 3U1MA 4HH0A 1VC6A 2VJVA 3ISZA 4K8RA 4ED5A 2VKRA 3MMCA 2GIRA 1Q0NA 2BANA 5T41A 3CJKA 3MM5A 4WU2A 4KFBB 4LSNA 3KK1B 2A0FB 1YVFA 3OV7A 4RUBA 3OVSA 5IFMA 3ZZRA 1VFJA 2C42A 5GMKa 2C3OA 4EU0A 1P1TA 1T9UA 3PYDA 4PWDB 3LANA 1H0HB 2XZDB 1HBOA 4EFAC 4P2SA 5K8OA 3P5TL 1UETA 1PYOB 4X4RA 1QAIA 4JI5J 4GKKJ 1H2UX 3DLKB 3DDNA 3K57A 2PSZA 5K9FA 4AQYF 4IDKB 1U7LA 2BYCA 3I5BA 2XB2D 3LOUA 3CCLS 1AZSB 1UWAA 1FNOA 1FFGB 4R8UA 4HLBA 4HYKA 1S1UA 4B9TA 2H9ZA 3WQPA 5KOWA 3HKWA 3KUEA 2VU5A 1X5PA 1ZAXA 1HNXF 3NY0A 4BS2A 2DCUB 4CI0B 1U26A 2JEGA 1WWHA 1OS5A 1UFKA 5KFRA 1KVKA 2YWKA 3MEGB 2RMLA 2HVIA 2DCLA 4PXBA 2M7SA 2IYIA 1QTNB 5J1EA 2KB2A 4NLUA 5EDWA 4CZCA 3C16A 2J7UA 2L08A 3TVKA 4A8SA 2F5GA 2CZ9A 3VVTA 2IY5B 2W7AA 1IWGA 1Y9OA 1RHQB 1SJQA 2BOAA 1YBAA 2HG4A 1RU2A 3J81U 2XULA 3VGVA 3BPSP 1SC4B 3QO9A 4FKYA 4DR7J 1IR2A 1T05B 4XK8C 3C19A 3OTBA 1NSKL 2XZWA 3GFHA 3O6QA 2FJXA 4WYWA 2E9ZA 3MURP 2UU9F 3M6XA 5FD1A 4QWAA 2KHCA 2V0NA 1F9EB 3LGMA 3ITHA 4F26A 2RF2A 2R7VA 5L1IA 3PFOA 4IH6A 2BJDA 2VOPA 4FN5A 3MMAA 3M32A 4LR8A 5CCLA 4YP3A 4U67Q 4NCGA 4KT0C 5DQIA 2EFOA 5AJ3J 1HNIB 3T1YJ 1MROA 1X9SA 1L3VA 3D66A 1R0AA 4CLFA 1QTMA 1QAXA 3M1VA 1IBLF 3D28A 2PD1A 1UVIA 1FEEA 4TU8A 4WKYA 2DGWA 4J90A 4X2BA 2FGCA 2ADCA 4C9DA 1WSRA 2VF3A 4KGVB 3SIPB 2GVDB 1PILA 4KC5A 3FGVA 4EZ6A 3CDUA 1R43A 4H4OA 4D3GA 1MU2B 1TVRA 1PYSB 2WSFC 4M5HA 4AD6A 4TNOA 3K58A 4DSJA 3R27A 2W7PA 1DQ9A 1QJHA 3RB0A 5DETA
chains in the Genus database with same CATH topology
4KYZA 4AQYJ 2UXDJ 4JI1J 4LF8J 4KY3A 4DV2J 4B3SJ 4DV3J 5BR8J 2UUCJ 2MQ8A 2MTLA 2UXBJ 4DV5J 2VQEJ 4NEZA 4JV5J 4PWWA 1N36J 5FLXU 5IT9U 4JI4J 3T1HJ 4OX9J 4DUZJ 4DR3J 4KHPJ 5AJ3J 3R2CJ 1HNZJ 4DR5J 1HNWJ 3J7AN 1FJGJ 2KL8A 4DV1J 4DR1J 2VQFJ 1HNXJ 2MEWA 1XNQJ 3T1YJ 4DV4J 1N32J 4NEYA 4X62J 5A2QU 4JI6J 4NXNJ 3D3BJ 2HHHJ 4NXMJ 3JAMU 4DUYJ 4LFAJ 1XMOJ 5LMUJ 2UXCJ 4HHUA 4JI8J 3W1YC 4GKJJ 5LM7E 4LF6J 1HR0J 5LMNJ 4B3MJ 2ZM6J 4DR4J 4X66J 4B3TJ 1IBLJ 4LF4J 1N33J 1J5EJ 3D3CJ 4DR2J 3J80U 4LF7J 3J81U 4K0KJ 1IBMJ 2KVQE 1N34J 1I94J 2UUAJ 4JI5J 4DV0J 4GKKJ 4V1Ak 4JI3J 2F4VJ 2UU9J 1XNRJ 4DR7J 4LF9J 5IWAJ 4YHHJ 4X64J 1XMQJ 4JI2J 4JI7J 2UUBJ 4B3RJ 4X65J 4LFBJ 4YY3J 4DV6J 4LFCJ 3R2DJ 2E5LJ 4RJVA 3OTOJ 3IMQJ 4JI0J 1IBKJ 4LF5J 4DR6J 4DV7J 4JYAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYZ A;  4AQY J;  2UXD J;  4JI1 J;  4LF8 J;  4KY3 A;  4DV2 J;  4B3S J;  4DV3 J;  5BR8 J;  2UUC J;  2MQ8 A;  2MTL A;  2UXB J;  4DV5 J;  2VQE J;  4NEZ A;  4JV5 J;  4PWW A;  1N36 J;  5FLX U;  5IT9 U;  4JI4 J;  3T1H J;  4OX9 J;  4DUZ J;  4DR3 J;  4KHP J;  5AJ3 J;  3R2C J;  1HNZ J;  4DR5 J;  1HNW J;  3J7A N;  1FJG J;  2KL8 A;  4DV1 J;  4DR1 J;  2VQF J;  1HNX J;  2MEW A;  1XNQ J;  3T1Y J;  4DV4 J;  1N32 J;  4NEY A;  4X62 J;  5A2Q U;  4JI6 J;  4NXN J;  3D3B J;  2HHH J;  4NXM J;  3JAM U;  4DUY J;  4LFA J;  1XMO J;  5LMU J;  2UXC J;  4HHU A;  4JI8 J;  3W1Y C;  4GKJ J;  5LM7 E;  4LF6 J;  1HR0 J;  5LMN J;  4B3M J;  2ZM6 J;  4DR4 J;  4X66 J;  4B3T J;  1IBL J;  4LF4 J;  1N33 J;  1J5E J;  3D3C J;  4DR2 J;  3J80 U;  4LF7 J;  3J81 U;  4K0K J;  1IBM J;  2KVQ E;  1N34 J;  1I94 J;  2UUA J;  4JI5 J;  4DV0 J;  4GKK J;  4V1A k;  4JI3 J;  2F4V J;  2UU9 J;  1XNR J;  4DR7 J;  4LF9 J;  5IWA J;  4YHH J;  4X64 J;  1XMQ J;  4JI2 J;  4JI7 J;  2UUB J;  4B3R J;  4X65 J;  4LFB J;  4YY3 J;  4DV6 J;  4LFC J;  3R2D J;  2E5L J;  4RJV A;  3OTO J;  3IMQ J;  4JI0 J;  1IBK J;  4LF5 J;  4DR6 J;  4DV7 J;  4JYA J; 
#chains in the Genus database with same CATH topology
 2V6A A;  2ZD1 A;  4LFB F;  3VR1 A;  3AT1 B;  3AB2 B;  4L73 A;  3C2P A;  3FBC A;  5K8M A;  3Q8R B;  3IFE A;  1LXJ A;  2VQE F;  4F3Q A;  5BR8 J;  4IH7 A;  1NHK L;  3K5P A;  3DRX A;  2XS5 A;  2GGP A;  4NZ6 A;  4MYT A;  4RW6 A;  3IA0 A;  3OL9 A;  5HO4 A;  1VBK A;  4AL5 A;  5KFT A;  3CB4 A;  4JI4 F;  3RW6 A;  1VRQ C;  1KHW A;  1PAU B;  3TAM B;  1X9W A;  4DX8 H;  4U95 A;  1Y4Z B;  1U1R A;  1HBM B;  1XWL A;  2KT2 A;  2ZH7 A;  2FD2 A;  1HWL A;  4I7F A;  2BV3 A;  3WZ0 A;  1TL3 B;  3C3L A;  4P72 A;  1RQ0 A;  3W65 A;  2XNQ A;  3TR5 A;  3DYA B;  4YHH J;  3PW2 A;  1JLQ A;  1QSS A;  4X65 J;  2VFR A;  3FJ2 A;  4C11 B;  5IZH A;  1FVQ A;  1UVJ A;  1FXD A;  3GPA A;  1FKO B;  3UR3 C;  1SJF A;  3HUL A;  4JI7 F;  1R8H A;  3C66 A;  3N28 A;  4M5G A;  5EGY A;  2EG2 A;  2MJN A;  3EXC X;  3E3X A;  4WXW A;  2YNH B;  3C6T A;  1NHU A;  2RHS B;  3K0J A;  2R7R A;  4MKV A;  4URQ U;  1X9M A;  5L1J A;  1D8Y A;  2FJB B;  4QJV A;  4M8L A;  1C1B A;  3LGH A;  2KZM A;  1CJV A;  2B7C B;  2DGQ A;  3O8W A;  3H7H B;  1REG X;  3Q8V A;  3PX6 A;  2C28 A;  5A8K A;  3RBD A;  1BE4 A;  4CCH A;  1BD6 A;  3M30 A;  1HW9 A;  3HSD A;  1KHV A;  3MCM A;  3D6H B;  3J7Z 5;  4DJB A;  1MWQ A;  3Q8U A;  3NLC A;  3O44 A;  2FLO A;  3VAH A;  1DLO A;  4CYU B;  3HM9 A;  1KC8 T;  1F2H A;  4BWJ A;  2IC3 B;  4X84 A;  3US5 A;  4NZ0 A;  1DQA A;  2QC3 A;  4LF9 J;  4ZIW A;  3KLG B;  3PHT A;  3AY0 A;  2BQR A;  5DDO C;  1NEE A;  4JYA F;  3CCJ S;  2QV6 A;  4ECY A;  3N5F A;  1NB2 A;  5GVQ A;  2HK2 A;  4FYW B;  2CWX A;  1KSP A;  3C15 A;  1VK8 A;  2QLB B;  3AA8 A;  5DQH A;  1D9D A;  4UZB A;  3V6D B;  2VA3 A;  1U48 A;  1EAR A;  3AOB A;  4D3H A;  5B0C A;  1QE1 B;  1TUV A;  2XGP A;  2B9Y A;  1JXE A;  4Q43 A;  4O44 A;  3BYP A;  2F9D A;  2V2V A;  2X3G A;  5A0Y A;  3T9N A;  1U1L A;  3D67 A;  1RA6 A;  1S7I A;  4F4W A;  1TFW A;  3SMZ A;  4MIB A;  1EZZ B;  4W4M A;  3FC9 A;  4DDF A;  4X4T A;  3IGN A;  1GAO A;  2MLX A;  4DL2 A;  3CCS S;  3GFZ A;  1K0T A;  2ILZ A;  2MKC A;  2LQ9 A;  1RAB B;  2R8G A;  4RNF A;  2G1D A;  3P96 A;  1UVL A;  4U8V A;  2AEM A;  1NZ8 A;  2Z2L A;  2GHW A;  3B82 A;  1M5V C;  2FHJ D;  1LFP A;  3E01 B;  2D9O A;  4V1A k;  3TWZ A;  1XER A;  5CQG A;  1NDP A;  1XN9 A;  1PYT A;  3HX9 A;  4JV1 A;  3IR7 B;  5CYJ A;  4J7C A;  4OZL A;  4J9K A;  3ETM A;  3OL6 A;  2KG1 A;  4LSL A;  3FSX A;  1MMN A;  3ELH A;  3BV8 A;  2JWN A;  2LLZ A;  5J2Q A;  3QPI A;  1NJW A;  4M94 A;  2IM3 A;  5H9F J;  1N6Q A;  1Q53 A;  4N47 A;  4CIO A;  2G0I A;  2RU3 A;  3OTD A;  4WWS A;  1JB0 C;  4IG0 A;  2MEW A;  2MGZ B;  2AV5 A;  2ZVI A;  2H4Y B;  3BQ2 A;  1Q8I A;  3UR0 A;  2DHG A;  1FXR A;  5B0E A;  2EKY A;  4FF4 A;  2WBM A;  5E3P A;  5L8R C;  2NLW A;  3W2V A;  2YNI B;  3TAN A;  5IQQ A;  4USW A;  3HKZ D;  2EFN A;  3F44 A;  1TFY A;  2E5G A;  5CYQ A;  2W2P P;  3D0H E;  2OHD A;  5KFC A;  1NO8 A;  2BW2 A;  3EDQ B;  3R5G A;  4KBI A;  1WOS A;  2BMB A;  1K0V A;  5KFA A;  2ZZM A;  4IH5 A;  1CJK B;  4TKT A;  1U25 A;  4DV6 F;  3K89 A;  3HZG A;  1S0N A;  4B3S J;  2BE9 B;  3W62 A;  1LWX A;  1S9F A;  1HBN B;  2Q1L A;  3RB4 A;  3QT8 A;  4DV5 J;  3GZ7 A;  2R8I A;  2ZBR A;  3AOC A;  2Z57 B;  4ZLL A;  4BC7 A;  4O3R A;  1V9O A;  3D68 A;  5KFN A;  3EX7 B;  4JV5 F;  3UNY A;  2AU0 A;  4ED4 A;  2GAH C;  4KJI A;  1JLG A;  2IMO A;  2BUN A;  2U1A A;  4NLW A;  4WTO B;  2B0G A;  2CG8 A;  1QDU B;  1FRX A;  2LQ8 A;  2YKP A;  4MYU A;  1HR0 J;  3ISN C;  4I68 A;  1HMV B;  1RUS A;  3EPG A;  4QOT A;  5HMW A;  3GR1 A;  2OML A;  2FGO A;  2XMV A;  5L39 A;  5KFD A;  4GC6 A;  2KFY A;  3PX0 A;  1OYD A;  5HLF A;  1S79 A;  2CDR B;  3M6W A;  3AJ2 A;  1TQL A;  1JJ2 R;  1ZAV A;  1WC6 A;  5CYM B;  5GAH I;  4OHZ A;  2RIJ A;  2DR5 A;  1WTB A;  1X4D A;  1Q5V A;  4OL8 A;  3K59 A;  2FJD B;  3W9I A;  4ICL A;  2V34 A;  1M1G A;  1YIJ S;  2YH0 A;  1NK5 A;  3MMB A;  3K5O A;  3PFE A;  5IT9 U;  2QMX A;  4DU7 A;  2HUR A;  1PC4 A;  3W5X A;  3HJV A;  2D3Z A;  3NCR A;  3FMW A;  3HFZ B;  5C2G A;  2LMI A;  3RR8 A;  5A8W B;  2HGN A;  4GKJ J;  5DDR C;  1IKV A;  1F9F A;  1JNR B;  1T03 A;  3PW0 A;  4LF4 J;  3BYR A;  4ECV A;  3CDB A;  2Z2Y B;  4O3S A;  4IFY B;  3OR2 B;  5T14 A;  1FCA A;  3OTE A;  2OPP A;  1BGX T;  2OPS A;  5D4L A;  1MWZ A;  1C0T B;  2EFV A;  1U0S A;  2XWY A;  4ZIT A;  1Z4U A;  3QSY B;  3UWT A;  1RT2 B;  2R2S A;  5KFP A;  4DSK A;  3H98 A;  1JLE B;  4I56 A;  1FTR A;  1S9E A;  4TY8 A;  2NUU G;  2QMU B;  5A76 A;  2VBX A;  5B09 A;  1T3N A;  2XSJ A;  1FKP A;  4IO9 Q;  1LW2 B;  2JFK A;  3KHR A;  3TZW A;  4B9U A;  1UTA A;  2DR8 A;  2OJ3 A;  9ATC B;  5H9F K;  2RRA A;  5DG7 A;  2M88 A;  4OI1 A;  4A8F A;  4ED0 A;  5I3Q A;  3WC2 A;  3HHE A;  3RUB L;  3KLI A;  2CPX A;  3C16 B;  3PYF A;  1EIY B;  1RDR A;  4C8O A;  3BQ1 A;  4USH A;  3TUI C;  2OSR A;  5E3Q A;  5L38 A;  2V63 A;  5J1N A;  2D3O R;  1IBC B;  1BY9 A;  2OEM A;  2P9E A;  2RE1 A;  2ZH1 A;  3CJ3 A;  4MFB A;  1QAJ A;  1I5O B;  3QO9 B;  1X5O A;  2GS8 A;  3CE8 A;  1F0X A;  2EFP A;  2QEX S;  1PAE X;  2BAC A;  4NLR A;  3BKT A;  3UNG C;  4FXD A;  4KPC A;  1TL7 A;  4XDC A;  3ITH B;  4KTQ A;  1S59 A;  2WAQ D;  2ZC4 A;  2RKI A;  2L9W A;  3ZC4 A;  1VR6 A;  2FC8 A;  1YJU A;  3SCI E;  2ZBQ A;  1VOM A;  1SQE A;  4HT7 A;  5J2M B;  1IR0 A;  3CCM S;  3A8K A;  2GVZ B;  4UZC A;  3MTK A;  1NME B;  2F1F A;  2V8G A;  2BOP A;  2KI2 A;  3BF4 A;  2FPH X;  1EAY C;  2HRT A;  4DSF A;  1RWW B;  2HND B;  2VHG A;  1MRO B;  2NUH A;  1HYS A;  3NMR A;  2YNF A;  2W9C A;  2GMH A;  3PW7 A;  2BJ1 A;  2BJ7 A;  3NNC A;  2GAG C;  3I4P A;  1UEK A;  2NPF A;  1S76 D;  1NDK A;  3KLE A;  3DNC A;  5LMU J;  1I6J A;  1N48 A;  4HHU A;  4IOC Q;  3FCV A;  5HRO A;  2RVJ A;  2HLU A;  1RAG B;  1EKS A;  4DMZ A;  1TK8 A;  2J0W A;  4K0K J;  1NSP A;  3OJU A;  1I94 J;  2DR9 A;  4LF6 F;  2UP1 A;  3N6L A;  3DRR A;  1X0F A;  4DCP B;  3NNA A;  3FQL A;  1U49 A;  2ZD1 B;  2C3Y A;  2E5L J;  5AXN A;  1FFS B;  2FJW A;  5EHH A;  3ZFV A;  4ALZ A;  1WEX A;  2JH3 A;  2PFF B;  4F0H A;  1TP7 A;  5JMN A;  2N3O A;  3J7Y I;  2W2Q P;  1PBA A;  3NEK A;  4URG A;  4QR0 A;  4ANE A;  2COL A;  5EUH A;  4B9V A;  2P6T A;  1ELO A;  3EVW A;  4TQR A;  1JK9 B;  3CO0 P;  3EIC A;  2IJN A;  1N52 B;  3KK3 A;  4OHV A;  2B4V A;  2GFF A;  4B9L A;  1JIH A;  3U02 A;  4NLP A;  4BHQ A;  2AX0 A;  4F2R A;  3KFW X;  3BS9 A;  4J5O A;  3GG1 A;  4DQI A;  3OFH A;  4RWW A;  2LA6 A;  1WD6 A;  1XR7 A;  1XNR J;  4O4R A;  1FWK A;  2KM8 B;  1OQ3 A;  3CPW R;  5D8H B;  3IBF B;  4AND A;  2ZH2 A;  1HWK A;  5LSL A;  5B0B A;  1V3Z A;  3IMQ J;  3QJP A;  4JI1 F;  4LF8 F;  2HNZ A;  1GXL A;  3C6T B;  2JVR A;  5GAE I;  5K14 A;  1BWE A;  1P6T A;  2HIY A;  4E0D A;  3BDP A;  1NKB A;  4DF8 A;  4C7Q A;  4GVB A;  3PV8 A;  1PC5 A;  4PYA A;  2QL9 B;  1RT4 A;  3B8H A;  2MSS A;  1FNX H;  5A8K B;  1HNW J;  3MR6 A;  1SQF A;  2RDJ A;  5I3U A;  3VAJ A;  4ZPB A;  3BKU A;  4M5K A;  4P7V A;  4HAC A;  2ZH3 A;  1SKS A;  3IAM 9;  5D0G A;  1ZM2 A;  5C25 B;  2BE2 B;  2WVC A;  1YJW S;  2Q3P A;  4RO0 A;  1Q7L B;  1TZ0 A;  2NPI A;  2LFV A;  4ED3 A;  4DR4 F;  3UVJ A;  4X66 F;  4B3T F;  5KAK A;  4FPR A;  3W5Z A;  1IM6 A;  5CXT A;  2XNR A;  3EUN A;  3IRX A;  4ED2 A;  3KJN B;  4WP9 A;  1T7P A;  4KYZ A;  4J9U E;  3OTO F;  2ZBC A;  4CLU A;  3HZE A;  1MML A;  1AT1 B;  3GG0 A;  2IIH A;  4ERD A;  3MPW A;  3OFE A;  1HWJ A;  3GQC A;  2BW7 A;  4ECX A;  1UA0 A;  2JX2 A;  2NZC A;  3MR7 A;  1V3R A;  2XWX A;  2PDA A;  2J5A A;  1WKK A;  2BJ8 A;  2HWH A;  2CPF A;  3L09 A;  2YX7 A;  5KG3 A;  3H5U A;  2ZDP A;  3CIZ A;  4TY9 A;  4LFA J;  3M2R A;  5G0R B;  5MLC V;  4GMK A;  4UQT A;  3M8P A;  3JQJ A;  3DMJ A;  1S77 D;  4LF7 J;  2KVQ E;  4NRT A;  2UVU A;  3I87 A;  4X4O A;  3MED B;  4I64 A;  4MKY A;  3MCO A;  4RWX A;  1G6B A;  4FXV A;  4AXJ A;  1X5T A;  1IN0 A;  4YB1 P;  4JI5 F;  4DR6 F;  2M2B A;  2GQQ A;  2R4F A;  1CQM A;  4L6V 3;  2YQ0 A;  2IDL A;  1NKC A;  3EXY A;  2DVI A;  1VQY A;  2ZZT A;  4O4G B;  2BE7 D;  4GVL A;  2C3M A;  2RSQ A;  2X1G A;  3VF0 B;  1LV5 A;  5ETV A;  4YME A;  2Q6C A;  5D3G B;  1PCA A;  1GTH A;  3HVW A;  4DUZ J;  1SCJ B;  2IAJ B;  1K9M T;  2NCK L;  3VAI A;  5DM6 Q;  5HMY A;  5T7L A;  4DZD A;  1XNQ J;  5J2P A;  4C8L A;  1N5V A;  2JNJ A;  3RAX A;  5HL7 Q;  4NLO A;  4DL4 A;  1X4G A;  1AXQ A;  1RT7 A;  2AW0 A;  1R8C A;  1HQE A;  2MQP A;  3MEK A;  5HVF A;  5HAT A;  2E7W A;  2XYP B;  1XQI A;  2V4J A;  3IBC B;  4UY8 5;  3UO0 A;  4LF1 A;  4OLO A;  3CIM A;  3R6G B;  4XTT A;  3CD5 A;  3UE2 A;  3H5Y A;  3QRP A;  3VAF A;  1W26 A;  3MM9 A;  1LWF B;  3NCQ A;  1HL6 A;  5HI7 A;  3K17 A;  2HHU A;  3MF5 A;  4X4Q A;  3OLA A;  3BBB A;  1DJ0 A;  1RT1 B;  5E5N A;  5A6W A;  3QGG A;  4IOB A;  4LUB A;  3HD2 A;  1U24 A;  1SKW A;  1YTY A;  2QLF B;  4CRJ A;  2YWW A;  2GQ2 A;  4CTA A;  4WZM A;  1IUJ A;  2Y0B B;  5AJ3 F;  2W9B A;  2CPJ A;  2KXH A;  3T1Y F;  2R9L A;  2V67 A;  1FEH A;  3PG9 A;  2KDO A;  2OD4 A;  2WVF A;  1ZH5 A;  3FEX B;  4MKB A;  2KFN A;  1CJT A;  2XLJ A;  2HGM A;  2A3J A;  5E7O B;  1FVS A;  2BJ9 A;  2NXN A;  4J9N A;  5IWA J;  2GHV C;  3KLH A;  1VIO A;  2CZV C;  1IKY B;  2PO4 A;  3OVB A;  5EN1 A;  1C0U B;  1RBL A;  3ENW A;  2HFV A;  1GEH A;  4FYY B;  3TP2 A;  1IXK A;  1TTH B;  5DLF A;  3MMB B;  4ZPT R;  2CJQ A;  3A13 A;  1JKH B;  4U7U K;  2HQD A;  2HFS A;  3MPD A;  1Z2Z A;  1CUL B;  2ZNY A;  4QIG A;  4HDH A;  3MAQ A;  2V8V A;  2GHP A;  2AX1 A;  2LXI A;  1NLK L;  2QN6 B;  2E1P A;  3HHL A;  4ZJO A;  4XPE A;  4QR1 A;  5HSP A;  3ZZT A;  5BR8 F;  3GSD A;  2WB4 A;  2M4M A;  3DKD A;  2HHP A;  1KKH A;  2DNR A;  1DY3 A;  4WF9 Q;  4F67 A;  1RT3 A;  3LPE A;  5C42 A;  3N6M A;  2HHH J;  3MR2 A;  2F65 A;  4CO0 A;  2H65 B;  4AUK A;  3T41 A;  3PX4 A;  4F50 A;  2OPS B;  3GLJ A;  7AT1 B;  4IR9 A;  2XZT B;  2EK1 A;  2KT3 A;  1RAO A;  2V4Q A;  4OMF G;  2B5J B;  4U6P A;  1G4C A;  4ECU A;  4Y28 C;  4N77 A;  3QRR A;  3T5L A;  1C2P A;  4NWB A;  5ETQ A;  2XSJ B;  2VG5 A;  2N7C A;  3H0P A;  2ZFH A;  3G2X A;  3G82 B;  3RAQ A;  1A9N B;  4YHH F;  3VQS A;  4YB6 A;  5DQG A;  4HR2 A;  3CJ0 A;  2Y8Y A;  4Q0B A;  5DZ7 A;  5HP1 B;  2ROE A;  3P45 B;  2OSQ A;  1GMW D;  3QGI A;  3MHY A;  3FZ2 A;  1AW0 A;  2K2P A;  2D3U A;  4IYQ A;  4Z37 A;  5A2Q Y;  2OPQ A;  3GYG A;  4JB8 B;  5ETO A;  2A10 A;  5DDP C;  5KFB A;  4ECW A;  1X5S A;  1UMJ A;  2CAJ A;  2ASY A;  4ITS A;  3QMQ A;  4DV1 J;  4EUV A;  1NAQ A;  4A8W A;  5KFS A;  1T9V A;  4RW8 A;  4JI6 J;  5CAA A;  1J5O B;  4Y6I A;  5GME A;  2BZ2 A;  1NJI T;  4TLQ A;  1AB8 A;  1TL7 B;  7FDR A;  2W4P A;  2IMW P;  1B70 B;  1LW0 A;  2CVI A;  3BRE A;  1N0V C;  2RKI B;  5KT2 A;  2WSC C;  1RWU A;  4ZLJ A;  4RPF A;  1NK9 A;  4A4J A;  3BKF A;  1ZYQ A;  1RJJ A;  2IRU A;  1H7W A;  4I2P B;  1X8D A;  4DFM A;  3C14 A;  4RW4 B;  1ACM B;  3PKM A;  5LSO A;  1VLO A;  4KH1 B;  1FJE B;  3MEC A;  2RAQ A;  2HNY A;  1J27 A;  2W25 A;  2OD6 A;  4FF2 A;  3VAG A;  3R7B B;  1AA1 B;  2IHR 1;  2C2M B;  8ATC B;  4LRB A;  2QL5 B;  3Q0A A;  4MIW A;  4G1Q A;  3KLE B;  3KJV B;  2L3M A;  1HD1 A;  4YDX A;  5HRO B;  3LQV A;  4WFA Q;  1UA1 A;  1FTC A;  3TUZ C;  4GO7 X;  3G96 A;  3UFC X;  4DU8 A;  1F3V A;  2XTJ P;  3DXS X;  2ZHB A;  4B3M J;  2B4U A;  1NJX A;  4ILL A;  3NGU A;  3OUY B;  3W9H A;  1DTT A;  1Y5N B;  2DKO B;  2FTR A;  3VAM A;  1S0M A;  5GAG U;  1AUS L;  1FE0 A;  2AKW B;  3PJ9 A;  3H4B A;  2I5J B;  3A3O B;  3TYT A;  5IM0 B;  4PUO B;  1N5Q A;  1PSD A;  4B9N A;  4MTP A;  1OYE A;  3NWG A;  2QA4 S;  4KO0 A;  5KFY A;  2JVO A;  3HFV A;  2DXE A;  3LP2 A;  3QT5 A;  5D4P A;  3IM8 A;  2KXF A;  5I42 A;  1HPZ B;  2HHW A;  3G87 A;  3QID A;  4YDD B;  4JOU A;  2NZ4 A;  5G4D A;  3CVK A;  4IR1 A;  1FJG J;  4C8Y A;  2BA9 A;  1P27 B;  3RGI A;  3DLG B;  4ZP6 A;  2KN4 A;  3MZI A;  3VGS A;  1HAR A;  2EW9 A;  2NYH A;  4DX6 A;  4ZVH A;  4CLK A;  4IG3 B;  1U1K A;  4DPT A;  2O1P A;  3GJS B;  3FRZ A;  1B64 A;  1CC8 A;  3RYL A;  4OHW A;  3DOK B;  1IKX B;  1HKA A;  3Q8Y A;  3DN9 A;  4FPI A;  2HS3 A;  4YOE A;  1YRX A;  2JFD A;  5DG8 A;  4HTI A;  4WKR A;  4USU A;  3C8Y A;  2CUY A;  2IA0 A;  4CO5 A;  4X4V A;  4EBC A;  2MZR A;  4F4Z A;  1TL1 A;  2B9X A;  4ZPV R;  1Y3J A;  1VQ9 S;  2DHH A;  3V4I A;  3B6B A;  4DBQ A;  3MGJ A;  3KKF A;  3PZP A;  4J9P A;  3CME S;  2LYV A;  2WK4 A;  2VBZ A;  4NE9 C;  1BMQ B;  3M2U B;  3SQG A;  2UUC F;  1UWB B;  3KG1 A;  3CC2 S;  4AE5 A;  1QM9 A;  1M5O C;  3D1O A;  4DWI A;  5FJ4 A;  2BR0 A;  4P71 A;  2ROG A;  4N8N A;  4QYZ K;  2K3I A;  4L74 A;  4URS A;  1DUR A;  3TX0 A;  4FZV A;  3L3C A;  3NNH A;  2QLJ B;  3UW1 A;  1U02 A;  1OJ4 A;  2GIQ A;  2FZC B;  4PXE A;  5KFH A;  1S9G B;  5CCM A;  1VMB A;  4DQP A;  4FS1 A;  4B3O A;  1VI7 A;  3OVA A;  1QAY A;  5D78 A;  2MY7 A;  1RLD A;  1YRT A;  1KNZ A;  2V2Q A;  3FBE A;  5CAB A;  2E7V A;  4LF5 J;  4QPT A;  2N7Y A;  2OI2 A;  5KTQ A;  1SXL A;  2DNN A;  4OI4 A;  3JSM A;  3NRB A;  4Y0F A;  2YWH A;  4DPX A;  4YR2 A;  2W7O A;  4WBF A;  4AL7 A;  1VIS A;  3CSK A;  4P10 A;  4K4W A;  4NYO A;  1YWX A;  4Y3C A;  4J9S A;  4CM0 A;  1FX2 A;  1KRP A;  3SSS A;  2DNK A;  2AGP A;  4HTJ A;  4K59 A;  1BQN A;  1RHU B;  4OZ1 A;  1TKZ B;  3M05 A;  2KU7 A;  2DIV A;  1TKX A;  1FRH A;  4BDP A;  2XI3 A;  1KLN A;  1R27 B;  2MKH A;  1ZZF A;  1SC1 B;  5SZT A;  2MZ1 A;  1T9W A;  1UZD A;  4GKJ F;  1R6Y A;  4MT1 A;  3DOM A;  4LF4 F;  4J37 A;  3MUT P;  1GMV A;  4LFC F;  2WW8 A;  3MR3 A;  4Y2A A;  5L1L A;  1UZH A;  1D9F A;  2KH9 A;  2G4B A;  3P4U B;  1RTI B;  2VC0 A;  3DM2 B;  2P9C A;  2RB7 A;  1MG7 A;  3M8R A;  3ET6 B;  2GO9 A;  4LVO P;  3KDO A;  4J9Q A;  3NWR A;  2Y1R I;  3NKY A;  2EVZ A;  1NPR A;  4EZ9 A;  3TJ9 A;  4P75 A;  1RT6 B;  3M6V A;  2JEF A;  2I38 A;  5J2P B;  1NK6 A;  1Q16 B;  3BDE A;  4K5S A;  2HEK A;  4RNH A;  5I3P A;  2EC0 A;  4ED7 A;  2A1B A;  8RUC A;  3IG1 A;  2CNL B;  2ASD A;  3DGV A;  1JLB B;  1UPM B;  2NXC A;  2RHQ B;  3EZO A;  1VQL S;  2XLK A;  2D9P A;  3ZZZ A;  3PCO B;  1OSD A;  3H59 A;  5F8I A;  1HQE B;  3D6M B;  1QSL A;  5L1K A;  5FDL B;  2NSC A;  4KKO B;  4ZVU B;  1TMM A;  4ENO A;  3ZTO A;  4QWE A;  3M6U A;  1RCO B;  1S1W A;  1XJW B;  3OXF A;  2QX0 A;  3R7N B;  5A8R B;  5F9L A;  1G1X A;  2J8S A;  2BQ3 A;  2F4V J;  3HJF A;  2CQP A;  4FS2 A;  4DG1 A;  1G7C B;  2VON A;  3QT6 A;  5B0D A;  1HW8 A;  4H54 A;  3DRS B;  3QNW B;  3CED A;  4PXC A;  2Q79 A;  5F8M A;  3GIJ A;  3EMT A;  5BJR A;  4F4K A;  3PVX A;  3QSI A;  5KFJ A;  1GX6 A;  3BBF A;  2ABY A;  4DF4 A;  4ETZ A;  2Y1L B;  3NAH A;  1WKJ A;  2CQC A;  2XMW A;  3BZQ A;  2AMC B;  1HNV A;  5D4O A;  4CWB A;  4W98 A;  3MM8 B;  2W9B B;  2I6W A;  3LF0 A;  4XDD A;  3G8S A;  2LEA A;  1R8P A;  2NQP A;  2VA2 A;  4DUY J;  3POT B;  2G0J A;  1QSY A;  2ZM6 J;  1CSJ A;  2WVB A;  2ZE2 B;  4DR2 J;  2PFD A;  2XMA A;  3BPD A;  5ETS A;  3MR5 A;  1PJ6 A;  2KTQ A;  3ZZP A;  4UOC A;  1SH3 A;  1SIZ A;  3H40 A;  3BH7 B;  3CWJ A;  2W01 A;  4K0K F;  4U9R A;  1I94 F;  4K4V A;  1ZA2 B;  5IXU A;  1FDN A;  3ILO A;  2VKZ G;  2CJB A;  3VWS A;  1SH0 A;  2ZBP A;  3ONQ A;  3GIK A;  2HWI A;  2FDN A;  3I0S B;  1P9Q C;  3CJR A;  1RWO B;  3TUJ C;  2PGC A;  1L3S A;  2E5L F;  1N54 B;  4USK A;  3SEO A;  1P1L A;  2ZH6 A;  3FFI A;  4A48 A;  3IR5 B;  2JEI A;  4O23 A;  2PN6 A;  4DV4 F;  5DRK A;  1RTJ A;  3OW2 R;  3EGN A;  2OPR B;  1K1Q A;  4C4W A;  2VJU A;  2XQC A;  2LA4 A;  5AE1 A;  2VOD A;  5F8J A;  2I0X A;  3KLF A;  3W8P A;  2M52 A;  2NS1 B;  1F6T A;  4MK9 A;  4O0N A;  2O67 A;  2CPD A;  3CT9 A;  3MEE A;  2MHN A;  3Q86 A;  3N0V A;  4WK3 A;  5LJ3 Y;  3MAA B;  2HQC A;  2LKZ A;  3D5M A;  1SL1 A;  3E2E A;  4ZVG A;  4DCJ B;  3EVM A;  1VRT B;  1UCN A;  3KHH A;  2J0X A;  5HJX A;  1XNR F;  4DSE A;  2MPU A;  1QUV A;  2O3D A;  2MJU A;  4I1T A;  2LCW A;  4AQY J;  3JQK A;  1CQN A;  3PW5 A;  1HI1 A;  2ZC3 A;  4RUH A;  5L46 A;  4L76 A;  3MD3 A;  5B0F A;  4K5R A;  4WFY A;  2HLT A;  1F5C A;  3FZB A;  1ZM3 A;  2J0Q D;  2Q66 A;  4NZ7 A;  3HHL C;  2HHS A;  4DN0 A;  1HNX J;  1X7V A;  2CPE A;  2YKN A;  3W2W B;  1XMO F;  3V81 B;  1VBX A;  3FBB A;  5B08 A;  3G6V A;  3GYX B;  1HNW F;  2CNK B;  4OJ1 A;  4CDI A;  3MTJ A;  3CW2 C;  1YJR A;  2HBQ B;  4ZCK A;  1JNZ B;  2ZOF A;  2HQG A;  2WHO A;  1FDA A;  2C2E A;  1RWV B;  2R7T A;  4ZLP A;  2ZWO A;  4OZ2 A;  3IS9 B;  4EWT A;  4UY8 T;  2GX8 A;  2A18 A;  4WZQ A;  3DI6 A;  1WSV A;  1VDH A;  3GCW P;  1IR1 A;  1S1X B;  1RIS A;  3BSA A;  2R8J A;  1B7Y B;  4Y2M A;  3GWC A;  1EP4 B;  2AP6 A;  3RTV A;  5KG7 A;  2PC6 A;  2WON B;  2RUG A;  2LQ5 A;  2XY6 A;  1H74 A;  3V6H A;  4I69 A;  2YVS A;  4ID5 A;  4IUF A;  3JYT B;  3J80 Y;  2AIR B;  4RBT A;  2ATL A;  3KG0 A;  4OJH A;  3QLH B;  2W1B A;  4IO1 A;  2HVZ A;  3GJR B;  4HKQ A;  3FQK A;  4EO8 A;  4KB7 A;  3D9B A;  1SI9 A;  4NXM F;  3A3N B;  2OTJ S;  4TXS A;  1REV B;  3NGS A;  2QL7 B;  1O6X A;  1A6L A;  5LM7 E;  4IOA Q;  4DFP A;  1JJ4 A;  2AF6 A;  1SJ1 A;  3ICL A;  2IPO B;  1IBL J;  1TU0 B;  2FB0 A;  1N4L A;  4LFA F;  2G0C A;  2VG6 A;  4ZVQ B;  1IBM J;  4JP8 A;  3LP0 B;  2Z56 B;  2DNY A;  3LWL A;  4OX7 A;  5FLX Y;  1RAE B;  2DR6 A;  5J2N B;  1JX4 A;  2VL1 A;  4F36 A;  4LF7 F;  1RCX B;  3CTR A;  4JI0 F;  2ZH5 A;  3HF5 A;  1GTE A;  1EQM A;  4YY3 J;  3VQT A;  4WFX A;  4CLY A;  4USV A;  1T94 A;  1DTQ A;  3JTO A;  2YQ3 A;  5D0H A;  1S48 A;  4IFV A;  4QR2 A;  2MZT A;  2GCF A;  2RT3 A;  1N36 F;  2VBY A;  5KG5 A;  2DRB A;  2BVZ A;  2HZC A;  2VQE J;  3PIP Q;  2W2M P;  2MQQ A;  3RBE A;  5H9E J;  3AXM A;  4R5P A;  4WU3 A;  1S57 A;  2DGO A;  3PDN A;  2KRR A;  1NK4 A;  3DRP B;  1N5S A;  1U1M A;  3W61 A;  3R97 A;  3H8Y A;  2CQD A;  3DGP A;  3UN5 A;  2Y3Y A;  4DUZ F;  1AYE A;  4M1K A;  5GAH U;  3TW0 A;  5KFE A;  2XHW A;  2BKN A;  4ER8 A;  3MM6 B;  4W90 B;  2YKM A;  4YB7 A;  4Q45 A;  2LQJ A;  1NRK A;  4DL6 A;  2DR7 A;  2CJK A;  3R1L A;  4LMZ A;  1RTD B;  3RU0 A;  4ED8 A;  3V4I B;  5KFL A;  2VBW A;  1HQU A;  4Q5V A;  3T9Z A;  2EPI A;  1GMU A;  4F4A A;  2FY1 A;  1B0V A;  5LJ5 Y;  3SQG B;  4ZCI A;  3NP5 A;  2VG7 A;  2VIC A;  2A2D A;  1Q8L A;  1EKR A;  2QGF B;  1KLM A;  2GO8 A;  3D0G E;  4DV3 J;  2B43 A;  4TLR A;  4PCQ A;  2M9K A;  1RGV A;  3VTI A;  5F3Z A;  2FZG B;  3BN7 A;  3NBP B;  1J2V A;  3JSB A;  3J7A N;  4X62 F;  1NND A;  1M0S A;  1EET A;  1YRU A;  4MH8 A;  4Y2I A;  2DNM A;  2GJF A;  1TKT A;  2G2Z A;  4ANC A;  3MOZ A;  2HAI A;  1RAI B;  1N34 F;  2ASL A;  1GK8 A;  1N5Y A;  3Q83 A;  1JQG A;  3UI3 A;  1FXL A;  4QPX A;  1CJU A;  5F8N A;  3KOA A;  1JLF A;  3TNV A;  1WC5 A;  3IP0 A;  4X64 J;  3TAP A;  3R8Y A;  4EK2 A;  3JSM B;  1S0O A;  1JLC B;  2DGT A;  2UV8 G;  2F3J A;  3BO4 A;  4OJG A;  1XK8 A;  5IWA F;  3RB3 A;  1IBK J;  3AD7 C;  1RHJ B;  2AD9 A;  4JYA J;  4J9O A;  3LAL A;  1YQH A;  4KH0 B;  2I9S A;  3BSN A;  4OI3 A;  4OYA A;  2X7I A;  1N0U A;  2R7Q A;  1Q8K A;  3HD1 A;  4O3N A;  1SH2 A;  4Q7A A;  2K3K A;  2VFS A;  1H3D A;  4FNI A;  4CH0 S;  2QE5 A;  4N7T A;  4PWW A;  3OL8 A;  2XYH B;  5HN0 A;  4C3M A;  1BQN B;  2JLG A;  1URN A;  5MAO A;  2WOM A;  2KJW A;  5B0G A;  1HHT P;  2YNG A;  4EYI B;  3QZ7 A;  2LXF A;  1EQ0 A;  4RNN A;  1CLF A;  1T9T A;  4KFB A;  4NLV A;  3UDV A;  2LU1 A;  1SVD A;  1LWE B;  2APO A;  2KYZ A;  3IWX A;  3KK1 A;  1L3U A;  4IQM A;  3RRK A;  2HHH F;  1ZTW A;  1S1V B;  4RW9 B;  2WTF A;  3HHD A;  4C48 A;  2HIQ A;  3G6E S;  2PMZ D;  2KHD A;  4HI1 A;  2EKN A;  1A7G E;  1U2C A;  3I0R A;  2V5H G;  4PWD A;  3L4B C;  4MK8 A;  4OZJ A;  2LDY A;  6FD1 A;  3UDE A;  4KQZ A;  1L3T A;  1C4A A;  4DQQ A;  1S0V A;  3VAK A;  2G2Y A;  3Q2S C;  4KR0 B;  4KRW A;  3HPO A;  5EWF A;  2AJ0 A;  1FK9 B;  3R7S B;  1S6P B;  5ETK A;  5H9E K;  1RKJ A;  3DLH A;  2GMJ A;  3QIP B;  3R5B A;  1RYS A;  3I56 S;  3H4D A;  4WP8 A;  3WIV A;  1VQ4 S;  4F7V A;  2V2K A;  5HMX A;  4RBV A;  5ETM A;  4G3I A;  4E8U A;  2XI2 A;  1D3W A;  1U0H B;  1AZS A;  2DPI A;  1H73 A;  4NXN J;  2AJQ A;  1U6B A;  4DV1 F;  2FUG 9;  2HHX A;  1E6V B;  5C7P A;  2RRN A;  2ILY A;  4JI6 F;  2BAB A;  3ENV A;  1R0B G;  1IJF B;  2CQ4 A;  2BRL A;  5HVH A;  2KRB A;  3HLU A;  3MEG A;  2Z30 B;  2I2Y A;  3QFH A;  4B08 A;  3TO8 A;  3J7Y U;  4H4M B;  4X4U A;  2QTW A;  3JQM A;  1Q82 T;  1G2E A;  3EVO A;  2UUT A;  2UUB J;  5ETP A;  1OY8 A;  1U09 A;  5KG1 A;  1FES A;  4DLG A;  4WIQ A;  1KQF B;  2DH7 A;  3MI7 X;  3U1N A;  3KK2 A;  2CNN B;  3K5L A;  3FSI A;  3PRD A;  4QCL A;  1ZPV A;  1L3K A;  3DOL A;  4M5I A;  1U1N A;  5KFV A;  5C24 B;  1ARO P;  1T05 A;  2J8A A;  4L3K A;  1Z2L A;  1CS4 A;  3CJ2 A;  3J7A 1;  5IC6 B;  6FDR A;  2XM3 A;  4ECT A;  3ZNU A;  1O8B A;  4NX9 A;  4BLG A;  1YX2 A;  3BQ0 A;  2E29 A;  4M5J A;  1O5J A;  1PO6 A;  1ZPW X;  5AXM A;  5GAE U;  5IV4 A;  3C46 A;  3G9C A;  1YHQ S;  3MWB A;  3D3C J;  1ITP A;  3GJQ B;  4NI2 B;  1ZZN A;  1U6Z A;  1HNI A;  4DV0 J;  2C3U A;  3WX4 A;  4ZVT B;  4QBU A;  4C3K A;  2RIL A;  2YH1 A;  4CNY A;  2QSF A;  1RT5 A;  1GX5 A;  5DO2 A;  4M5D B;  4ZMM A;  2R42 A;  5CZX A;  3Q22 A;  1WC3 A;  2BKP A;  4ZK7 M;  3D1Q A;  2UXD J;  1QVG R;  1YJ9 S;  2N4D A;  4CLL A;  2X3D A;  1K1S A;  4UOF A;  2GVD A;  2H5I B;  4OYO A;  4I2Q B;  4AL6 A;  2WZ1 A;  1MU2 A;  2OAU A;  1ZA1 B;  4K4T A;  4N5S A;  4UST A;  5GAD U;  4DR3 J;  1QLN A;  5CD4 H;  4GO5 X;  2V8H A;  4RU2 A;  2XS7 A;  4C2M A;  5DM7 Q;  2C3P A;  2MQL A;  3NOC A;  5KFW A;  4ECR A;  3RAM A;  2ZJR Q;  3SCL E;  3OHA A;  1FJG F;  1KQK A;  1SV5 B;  2DGV A;  2DEI A;  3CO9 A;  3TVY A;  3HVT B;  5LSR A;  4DEZ A;  2FHJ A;  4OV1 A;  2IYG A;  4WTY A;  4FVM A;  3CD6 S;  2W2O P;  2FVQ A;  4Q8F A;  4EI2 A;  2IVM A;  2DBB A;  3D6F B;  3JB9 k;  1Q7Y T;  1Y7P A;  2WSE C;  2G13 A;  3TAM A;  3CJ8 A;  1TMJ A;  3HDS A;  4DL5 A;  1Q1K A;  3BBC A;  2CQ2 A;  1HBM A;  2HYI B;  1VS3 A;  5IT9 Y;  3BB5 A;  4U8Y A;  3R1H A;  3E8O A;  4I6W A;  4RW7 B;  2H5J B;  4KY3 A;  2OFG X;  3N5B A;  1TL3 A;  4ELV A;  2H48 B;  3HXM A;  5RUB A;  4JUZ A;  3DYA A;  2FY8 A;  2PA3 A;  2XG8 A;  4O3Q A;  1VQK S;  2AEF A;  2HWT A;  1KDN A;  4RNO A;  4DR5 J;  1S1T A;  4C11 A;  3CXC R;  2GJ2 A;  1W25 A;  3D4J A;  4OHX A;  1NPK A;  1FKO A;  2J9D A;  3JSY A;  3EJM A;  2DNZ A;  2ZHO A;  2HK3 A;  2EBG A;  1UPP A;  4M95 A;  2YNH A;  2KKH A;  2J9D E;  1CPZ A;  3WDO A;  3DLJ A;  3SDE A;  3NCP A;  3P49 B;  4G65 A;  1VGY A;  4WFN Q;  2BEF A;  2DIS A;  4PXD A;  2Q6B A;  1T02 A;  1Q78 A;  1H6K X;  4I4B A;  2VOO A;  4NAS A;  1VK3 A;  4UOH A;  2E1C A;  3HO1 A;  2POK A;  3W66 A;  3JAM Y;  1Y00 A;  5KT7 A;  4HHH A;  2KYX A;  3N01 A;  4CO1 A;  1BQX A;  2GIF A;  3LW5 C;  3ZTP A;  4ZN1 A;  1YKW A;  1VJW A;  1SC6 A;  2JC1 A;  4CYU A;  1VIX A;  3I96 A;  2IC3 A;  2B8P A;  1VCT A;  2OTL S;  3I82 A;  5D0E A;  3KLG A;  3TQ1 A;  2J6U A;  1BHN A;  3A8I A;  2RNE A;  4PQU B;  3HVR A;  1RHM B;  2HMI B;  2O5D A;  2CPI A;  1U8S A;  4K4U A;  4DPO A;  2V69 A;  2MLZ A;  3NS7 B;  3TA2 A;  4HHJ A;  2P5V A;  1RHR B;  3V6D A;  2DO4 A;  2MKY A;  4NLY A;  3AH6 A;  4OZ5 A;  1OSC A;  1QE1 A;  4OFZ A;  5B0A A;  3KTQ A;  3KNA A;  3MMC B;  3PYG A;  1X4H A;  3RBZ A;  2UUA J;  2BAN B;  3CJK B;  3MM5 B;  4LSN B;  4FYD A;  4OX6 A;  2RRB A;  2ZNZ A;  5F0W A;  2XLI A;  4HI2 A;  2RQ4 A;  3DXB A;  4N8O A;  3X1L B;  2D41 A;  3MXH P;  5I4M A;  3CJS A;  2IVY A;  1GH8 A;  3JTN A;  3S8S A;  5E0O A;  3E01 A;  2HVE A;  2FHM A;  2AYE A;  1M5K C;  1HBO B;  3DLL Q;  5HJY A;  4PG5 A;  2DNG A;  1TUW A;  2ZJP Q;  2B4P A;  2E1M C;  3N4W A;  1WG4 A;  4CLZ A;  2RDI A;  1XR5 A;  2CRL A;  2GML A;  4R25 A;  5IQ6 A;  2AYG A;  3R5D A;  1B4S A;  2DHX A;  4G1I A;  3JTP A;  2IFX A;  1VJQ A;  3T6B A;  2OEJ A;  3ISN D;  1M5H A;  1HI8 A;  2FC9 A;  3NOG A;  1S10 A;  3EDR B;  3KXD A;  2DY1 A;  4R8U B;  1S1U B;  3R9L A;  2DYA A;  1OMS A;  1X0P A;  1WI6 A;  1HA1 A;  1FRM A;  2ASJ A;  3AHP A;  3Q8P B;  1Y3K A;  2C2N A;  3OR1 A;  3CMA S;  2M8H A;  3P8B B;  4OZN A;  1IKW A;  3OTC A;  2UUW A;  3G8T A;  2OGU A;  3HT0 A;  2ZIT A;  1KS2 A;  4DSI A;  2F4V F;  1KLM B;  3GB0 A;  2QYG A;  1KWM A;  3D0I E;  1BWV A;  5EX3 A;  2YNI A;  5J1E B;  2OH2 A;  4JI1 J;  4LF8 J;  2GQC A;  4MMO A;  1S97 A;  1YDL A;  2HBY B;  2UVR A;  1UVM A;  1C1C A;  2L9N A;  4HEA 9;  3NGK A;  4NEZ A;  4OYZ A;  5J1P A;  4H4K A;  2XC9 A;  1F1B B;  1MSW D;  3AD8 C;  1TKT B;  3W64 A;  4ES1 A;  3QAU A;  1CJK A;  1V6H A;  2ZH4 A;  1H7X A;  1N32 J;  2AT1 B;  5DGA A;  4PPD A;  1Q95 G;  3PO4 A;  1X4F A;  3HSG A;  2XMK A;  3R6L B;  5LMN J;  1B3T A;  4DQS A;  1HBN A;  4TYA A;  1P8G A;  5LXR A;  3IGV A;  4Z7C A;  4DUY F;  2RF2 B;  4PG7 A;  2VFT A;  2HVH A;  1OQ6 A;  3TVZ A;  1LQ9 A;  2C2D A;  2ZM6 F;  3EM1 A;  4U7U D;  2ZDO A;  3LGN A;  3MMA B;  4C8M A;  1O51 A;  3M32 B;  4DR2 F;  4FP9 A;  2DH9 A;  4NCG B;  4CO4 A;  1ZM9 A;  2KZZ A;  4OI2 A;  1V3S A;  4UF4 A;  4PAA A;  1HMV A;  4CNZ A;  1SL0 A;  4DXL A;  1RKI A;  3M7V A;  2PMW A;  1R0A B;  3M1V B;  3GSI A;  2M5Y A;  3RW7 A;  4N56 A;  4KIA A;  2UXB J;  1RSC A;  2R7W A;  3DC2 A;  5CYM A;  2YNG B;  1S4F A;  2YKQ A;  2IBK A;  4C8K A;  4XIU A;  1YBT A;  1Z1Z A;  4H4O B;  2PA8 D;  3A8J A;  1TVR B;  2QJ3 A;  4JI8 F;  4OYB A;  3FNN A;  4NRU A;  4NLS A;  4CLW A;  4OHY A;  1TV6 A;  1UP1 A;  2ERR A;  4A8O A;  2RU9 A;  4LRE A;  5HK4 A;  1NXI A;  4KE5 A;  4Y65 A;  2A6O A;  2MKI A;  5BXI A;  2ZKT A;  3G86 A;  4AFF A;  2E1A A;  3I0R B;  3WHI A;  1FJC A;  1EJ7 L;  3W63 A;  1YJT A;  4C3L A;  2GGP B;  3ZNJ 1;  4RW6 B;  1FX4 A;  3OL7 A;  5A8W A;  4M5N A;  4RKU C;  1UFW A;  3ADA C;  5DGB A;  4DR6 J;  1VQ5 S;  5HBM A;  3MCS A;  2FVS A;  3W60 A;  3I9Z A;  4IFY A;  3OR2 A;  3OT9 A;  1VQN S;  4FYX B;  3IWN C;  1C0T A;  3DRY A;  3OHB A;  3PIO Q;  3GII A;  2DNL A;  1N88 A;  1RT2 A;  1NK8 A;  3NAI A;  3D6T B;  3PR4 A;  2V8P A;  3BJY A;  2PT0 A;  4I7F B;  4O3P A;  1JLE A;  3GMG A;  2WVD A;  1VQM S;  2VQF J;  1OO0 B;  3TEH B;  4FF3 A;  2H4W B;  1RWP B;  2R2U A;  4S0M A;  4TYB A;  1JLQ B;  1LW2 A;  1HD0 A;  2ALY B;  2FQQ B;  3D3B J;  1ZOT A;  2IM1 A;  3KWM A;  3I31 A;  4USM A;  1DRZ A;  1TK0 A;  2R8K A;  3C6U A;  4DL0 C;  1J5E J;  1H2T Z;  3J80 U;  4DZ6 A;  2AJ4 A;  3ZXW A;  3ZZY A;  4U7C A;  2VPW B;  2XO7 A;  1XMQ F;  4DPW A;  5SUH A;  2E5I A;  3DDI A;  3EGZ A;  3T6J A;  1NH7 A;  2VC1 A;  2DT9 A;  4JI2 J;  2Y8W A;  4HDG A;  1HFE L;  2HHQ A;  4NLT A;  3KK2 B;  1JLA A;  4UTG A;  1C1B B;  1CJV B;  1RU1 A;  3DOL B;  4DV2 F;  2DTJ A;  1NDC A;  3ZO7 A;  3DLE A;  3M30 B;  1CS4 B;  2BKO A;  4ES3 A;  1NU4 A;  3EPI A;  4FKX A;  3LO3 A;  3TA0 A;  4LBI A;  5FLX U;  2IRY A;  3MMJ A;  4OX9 J;  1DLO B;  3R2C J;  4CO2 A;  2M0G B;  2GV1 A;  1LNQ A;  3T5K A;  4PYD A;  2M70 A;  3TZY A;  3QYY A;  2MKJ A;  5J2M A;  2GVZ A;  2QLW A;  2RUS A;  3HK2 A;  4ZOS A;  3A12 A;  3LP1 A;  2CFX A;  3DLB A;  1WTF A;  3C15 B;  1SB6 A;  2HND A;  1FJ7 A;  3ZZ0 A;  2FLL A;  5F3T A;  4PAB A;  1RT5 B;  1X31 C;  3MAH A;  1NDL A;  5D4N A;  1R8B A;  1WDD A;  4O44 B;  4ZVO B;  1Q4R A;  5A0Y B;  1IBM F;  4P6Q A;  4LRA A;  5CHC B;  1NCL A;  1Y10 A;  3EWG A;  4V19 X;  3LUY A;  2H54 B;  2EC2 A;  1NSA A;  1B0T A;  3EGW B;  3M8Q A;  1KTV A;  4YY3 F;  1S72 S;  1NPP A;  1H38 A;  2X1B A;  1UFL A;  2XEX A;  3LPY A;  1K73 T;  1UW9 A;  4LRF A;  2H1Y A;  3OBI A;  2JOQ A;  3KNG A;  5L9X A;  1FD2 A;  2VV5 A;  2AGO A;  1NH8 A;  2NXE A;  1NB7 A;  3TQE A;  1QUP A;  2FYX A;  3W3S A;  4BWM A;  4LF2 A;  1RP5 A;  1WNE A;  1LWC A;  1BUX A;  3MUV P;  1HI0 P;  3DHW C;  4IRK A;  4PQA A;  1FF2 A;  2MKS A;  3ENA A;  4ED1 A;  4GKK F;  3A8E A;  3AQP A;  3GV8 B;  3KLV A;  4LSL B;  1VQ6 S;  1UW4 A;  1T11 A;  2C2Z B;  2LXU A;  2UZA A;  1WJ9 A;  1OY6 A;  4LSZ B;  3UPF A;  2CQI A;  4OV6 A;  3TZZ A;  1YIT S;  2B3T B;  5J2Q B;  5KT4 A;  5K20 B;  2E66 A;  2I8E A;  3CCE S;  3SZ2 A;  1S6O A;  3S7R A;  1N6Q B;  3EZU A;  4DN9 A;  4ZLN A;  2MHE A;  4IG0 B;  1Y0H A;  4DV7 J;  5KOX A;  4BCA A;  3ILJ A;  2HHV A;  2QSW A;  1KQG B;  4NL5 A;  2EXU A;  3KJQ B;  3L7P A;  1C4C A;  2CQB A;  1WF2 A;  4PWU A;  3EE3 A;  1S1T B;  1NSQ A;  2V2Z A;  3W2V B;  2JSX A;  3BGR A;  3GFY A;  4DI6 A;  4QIF A;  1WC4 A;  4KHP J;  4DV3 F;  3I5C A;  4ILM A;  3EGV A;  4QWB A;  5CYQ B;  5F8L A;  3MDF A;  1Q5Y A;  1TUG B;  3B54 A;  2BJE A;  3SDE B;  3DCA A;  4AXI A;  2W4C A;  4PG8 A;  3HSZ A;  1PG5 B;  1GQE A;  2F4F A;  3UQS A;  5E41 A;  3NS5 A;  2DEJ A;  1M1H A;  4DR7 F;  9RUB A;  3OXL A;  3Q89 A;  2OIH A;  1OWX A;  1S99 A;  3K8V A;  5ETL A;  1X4E A;  3SYZ A;  1BC6 A;  2CQ1 A;  4IRC A;  1K47 A;  1M5P C;  3SCJ E;  2YPZ A;  1BXN A;  5C25 A;  2FVR A;  2BE2 A;  4X64 F;  2Y1J A;  1WHY A;  1SQG A;  1QD1 A;  1JLG B;  2DXD A;  1IBK F;  2W2N P;  3L7U A;  1SBR A;  2C2K B;  3DFE A;  4ZVF A;  2M8D B;  4A8M P;  1EX8 A;  5EWE A;  3T5H A;  2RQM A;  1WC0 A;  5DG9 A;  3CCQ S;  4LQ9 A;  1WHW A;  1YI2 S;  3P3D A;  2H5E A;  1U4B A;  3FKB A;  4OZ3 A;  1Q86 T;  5HLF B;  2DD8 S;  2RQK A;  3WBZ A;  2PI5 A;  4P74 A;  4PG6 A;  2B9E A;  2KFZ A;  1MLA A;  4NOH A;  1R31 A;  1UJ5 A;  4OYX A;  4TU7 A;  2JEJ A;  5KG4 A;  4TU9 A;  3SXL A;  1YLX A;  4C0B A;  2CPZ A;  1HLW A;  3IXQ A;  4ICL B;  1Y11 A;  2QG9 B;  3HSJ A;  1XC9 A;  2B6A A;  1SUQ A;  3FUY A;  3OJS A;  1FRI A;  5G0R A;  4CT9 A;  1FD8 A;  1BQM A;  3Q23 A;  2K8G A;  3H20 A;  1N5T A;  4NML A;  3TAR A;  3IAS 9;  1FWP A;  3MED A;  4NCB A;  2Y9H A;  1IKV B;  4LBH A;  4DS5 A;  4F0M A;  1T03 B;  1WDT A;  2HQF A;  5KT6 A;  3I55 S;  1LOU A;  3V2U C;  2OPP B;  3NL0 A;  3M9N B;  4JV2 A;  3DU6 A;  1S5Z A;  4O4G A;  3BGO P;  3AOD A;  5CZV A;  2YTC A;  3HHK A;  3U7J A;  4DQR A;  2YKA A;  1RYR A;  4ATN A;  3I9V 9;  1S9E B;  3TX8 A;  4LBP A;  4TY8 B;  4KGX B;  1TR0 A;  1XIQ A;  5D3G A;  4HH1 A;  5KFM A;  2X51 A;  1FKP B;  1N33 J;  4NXN F;  1D8Z A;  1VLY A;  2FLP A;  3OR1 B;  4CH1 A;  2IAJ A;  4C97 A;  1IKW B;  5HAN A;  2IBO A;  1OIA A;  4X65 F;  5F41 A;  2QFJ A;  4FYV B;  2ZJQ Q;  1UL3 A;  3K5N A;  1GNK A;  3OD2 A;  3FRY A;  3KLI B;  1KD1 T;  1WC1 A;  1PJ5 A;  2HKE A;  3CNQ P;  4C8Z A;  2MST A;  2D3O 1;  1HQ2 A;  3VVU A;  1GMW A;  2UUB F;  1C1C B;  4Q2M A;  4HVZ A;  2CJA A;  1SJ4 P;  4I6A A;  2DHA A;  1CVJ A;  2NYI A;  4L72 B;  4PG4 A;  2HQ3 A;  1RWX B;  2UUC J;  4MFB B;  4C8N A;  1GXT A;  3IR6 B;  3GP9 A;  4EYH B;  1KTQ A;  5BYS A;  3OLB A;  2C2R A;  2EG1 A;  2RH3 A;  3BN4 A;  2HRU A;  1LWF A;  1MWY A;  1B7F A;  2L9D A;  5BYR A;  2M3D A;  3U1L A;  3OQ2 A;  1ICE B;  3N6N A;  3PJW A;  2G9O A;  3PHE A;  1RT1 A;  2CJY B;  4LF9 F;  3THV A;  3M4X A;  1YJ7 A;  2B56 A;  4CP5 A;  4Q44 A;  3AQO A;  4RZR A;  2QYC A;  5KFK A;  1RLC L;  5KFQ A;  4DPU A;  2B8Q A;  2XMJ A;  2D1C A;  2E9T A;  4DV0 F;  1RAF B;  4F0K A;  1HYS B;  2YNF B;  2W9C B;  4CLT A;  3N79 A;  4PKD B;  3JS9 A;  2ZH8 A;  2Z2Z A;  3LTO A;  4K4Z A;  3BR8 A;  1H72 C;  2V8D A;  4V19 J;  1N8R T;  1RK8 A;  3EYZ A;  5D77 A;  3GTY X;  5M2R A;  4ECZ A;  2UXD F;  1IKY A;  1C0U A;  3SBM A;  1UEU A;  3CCU S;  2XSF A;  2GJI A;  3KMS A;  2XMM A;  3J81 j;  4H4K C;  4DLE A;  1TV6 B;  2E7X A;  2GW8 A;  4ETX A;  1FER A;  4B17 A;  1R89 A;  2R3V A;  3DRR B;  4DR3 F;  1AFI A;  2WCX A;  2XCA A;  1JKH A;  2LEC A;  3PEJ A;  1T95 A;  4X4P A;  1CUL A;  4RLE A;  2O01 C;  4IRD A;  3CCR S;  1UKU A;  5F0U A;  2AQ4 A;  2B4O A;  3VV2 B;  2CWK A;  1IM4 A;  4LIR A;  2GA7 A;  1RTH A;  3MUM P;  2V50 A;  1SJR A;  3SFG A;  4RUC A;  3BH6 B;  5HBM B;  1IQT A;  3O2I A;  4QW8 A;  3UN2 A;  2AWZ A;  4LFC J;  3CDA A;  3ILL A;  5E3A A;  2IVF B;  2AEJ A;  1XTZ A;  2N3L A;  3GU0 A;  1JXL A;  1FA0 A;  4IQX A;  1S6Q A;  2J0S D;  3D2W A;  3KK3 B;  2B5J A;  4RL1 A;  1UVK A;  2KT5 A;  1YJV A;  1U45 A;  2KVI A;  4FXW A;  1YZ6 A;  3VZI A;  2WW4 A;  2VPZ B;  3G6X A;  2PE8 A;  2BM1 A;  4L3N A;  3PY8 A;  1EHW A;  4A8X A;  4ECQ A;  3G82 A;  2ZH9 A;  5IT0 A;  1APS A;  4DR1 J;  2DPJ A;  2W8L A;  5HP1 A;  2SXL A;  4DR5 F;  2CAD A;  2WVE A;  3PW4 A;  3JAM U;  2DO0 A;  1MMD A;  3C6U B;  3ENQ A;  2WBR A;  1GXU A;  3WC0 A;  2E5J A;  2HNZ B;  3ZZO A;  4RUA A;  2UVV A;  2CYY A;  1U47 A;  1YJN S;  4NA2 A;  5K14 B;  3PJX A;  4B02 A;  1FDD A;  1JLA B;  4QQB A;  2YBV A;  4GVB B;  1RXO B;  1SL2 A;  1FHT A;  4ZP8 A;  3IC1 A;  2P2C B;  1RT4 B;  5CH7 B;  4U96 A;  1IVZ A;  5KFG A;  3CC4 S;  3DLE B;  1NBE B;  2BXJ A;  2CNO B;  5I3U B;  2F8H A;  1J5O A;  4B3S F;  4HT5 A;  4K4Y A;  2HFO A;  4HAC B;  5C5J A;  3CMQ A;  3I4H X;  1KN6 A;  1JXV A;  4A46 A;  1RAA B;  3KHG A;  4DV5 F;  3NGR A;  1RAH B;  2HFU A;  2ADB A;  2ZZN A;  3CUL A;  3RB6 A;  1R3N A;  1KFS A;  4EGL A;  1HBU A;  3BGL A;  3SSR A;  2H51 B;  1RHK B;  4CM2 A;  5ADZ A;  4DL3 A;  1FE4 A;  5AE2 A;  3HMJ G;  4PZV A;  4YQW A;  3UVJ B;  1TL5 A;  2VDH A;  3OFG A;  4I2P A;  1HR0 F;  2CDQ A;  4RW4 A;  3LP1 B;  5H1S V;  4E98 A;  1R6V A;  3IRX B;  3I6P A;  1K44 A;  1ZBT A;  4ZKA A;  4OZ0 A;  1LEO A;  1VYA A;  3V6K A;  3UD3 P;  4ZS6 A;  1WEL A;  3UCZ P;  3QWU A;  3D54 A;  3KJV A;  2EI5 A;  3AD9 C;  2KJV A;  3LH2 S;  3BR9 A;  1CBK A;  3TRG A;  3FCH A;  2UUA F;  3M8Q B;  2QA2 A;  4LT6 A;  3RZA A;  3F73 A;  3LWM A;  1URR A;  1U1P A;  4ELU A;  5E3R A;  2XY5 A;  3OUY A;  5ETT A;  4M5M A;  4ZIV A;  4QYR A;  3M2R B;  4O0I A;  1D9A A;  4ILR A;  4QU6 A;  4ZVR B;  4P9S A;  3RRH A;  2I5J A;  3M8P B;  4EBD A;  3DMJ B;  1WAC A;  4F25 A;  2DGX A;  5IM0 A;  4PUO A;  2F63 A;  1WG1 A;  5F8G A;  2FJE B;  3NS6 A;  4Y2K A;  2NXU A;  2MQM A;  4DV4 J;  1LWC B;  1RAD B;  4OYI A;  2IRX A;  4ID8 A;  4QW9 A;  3ETO A;  3F56 A;  2ZOG A;  3V4M A;  5F8H A;  3FVY A;  3W1Y C;  3SCK E;  1HPZ A;  4ZP9 A;  2GC8 A;  2XMU A;  2HZA A;  2Y1I A;  2CZ4 A;  2J7K A;  4ZPD A;  5E3C A;  3DHX A;  3DLG A;  2LQB A;  4F04 B;  4XAK A;  2KO1 A;  2LU2 A;  1SIW B;  4IG3 A;  3DU5 A;  2DNO A;  3O5T B;  3CF5 Q;  1UAW A;  5T7L B;  3DOK A;  1IKX A;  4NMX A;  3BO3 A;  2G2O A;  3O1L A;  3N9U C;  2HPU A;  1EB0 A;  3BGR B;  3F0N A;  4WP3 A;  2NXJ A;  1RT7 B;  1YSJ A;  2C22 A;  3WX8 A;  2MTL A;  4QU7 A;  1HHS A;  2XS2 A;  1WKL A;  3O3L A;  4LJM A;  2K7K A;  4YEA A;  4J9L A;  3T1H J;  1LKZ A;  5AE3 A;  2DRD A;  4WK1 A;  3R5C A;  3KG4 A;  4CLS A;  4AYB D;  1YG0 A;  2V4J B;  2MQO A;  3BO2 A;  4OLP A;  3QJL A;  3R5J B;  4NLX A;  3M2U A;  2CA9 A;  1NKE A;  1XMO J;  1UWB A;  4CLP A;  2UXC J;  3QAE A;  4UW2 A;  4G1P A;  4P73 A;  1N32 F;  3MM9 B;  2RS2 A;  1WEY A;  3VGU A;  5EX0 A;  1OPZ A;  2P6S A;  3W7B A;  4DFK A;  3MPV A;  4OYP A;  3B78 A;  2F8M A;  5LMN F;  3ULH A;  3T1A A;  2J7W A;  2YKO A;  5IT4 A;  3GE9 A;  2E9R X;  1LK5 A;  4DFJ A;  4OI6 A;  4WCE Q;  4B3R J;  3QRQ A;  3L9Z A;  4K7Q A;  2YXL A;  5A6P A;  5GAD I;  2IA6 A;  3D1H A;  1SPB P;  4CTA B;  4MIA A;  2NR0 A;  1S9G A;  2JJ4 D;  4XPC A;  1U6F A;  2B9W A;  3RR7 A;  1RB0 A;  5KT3 A;  5IC4 B;  2PMH A;  3TUP A;  3M9M B;  4UUX A;  4PRF A;  1F3F A;  4B9S A;  2KM8 C;  2ROP A;  2HBZ B;  1DFD A;  1HNZ J;  1FI4 A;  4ZPC A;  1XR6 A;  2F40 A;  1W2I A;  1CJT B;  1XEZ A;  2VPY B;  5JXS A;  1KVJ A;  2RS8 A;  2HFZ A;  2RQC A;  1RWM B;  2UXB F;  1S6U A;  2C1E B;  5LMU F;  3KLH B;  4ECS A;  1D1U A;  4NXM J;  2PEB A;  1DBD A;  1NHV A;  4C0O C;  2FIU A;  2OFH X;  2YWE A;  2KXN B;  4K2J A;  4ZN3 A;  1LXN A;  4MK7 A;  3MM7 A;  1FRJ A;  3FCW A;  3THT A;  4W92 B;  4WJB A;  2B6A B;  1SUQ B;  2FZK B;  3P6Y C;  4JI3 J;  1YZ7 A;  4ZVS B;  2QIF A;  4F4Y A;  3HHL B;  1BQM B;  3B4D A;  1TKZ A;  2DH8 A;  4JI0 J;  2D69 A;  2BRK A;  4EO6 A;  1A0O B;  2EFQ A;  3AAW B;  3ZTQ A;  2BQU A;  1O0P A;  1RT3 B;  5C42 B;  2CQH A;  4C0H A;  2D7S A;  2GZO A;  3R3T A;  4A8K A;  2DY9 A;  4ZDN A;  4NLD A;  1HIY A;  4F4X A;  2OKQ A;  1N36 J;  4KV8 A;  3RBX A;  1OY9 A;  1RZM A;  3AJD A;  2OUG A;  1S12 A;  4RU9 A;  1RTI A;  1P9Y A;  5C2C A;  3DM2 A;  4Y00 A;  5AT1 B;  3ET6 A;  2VG5 B;  2YWG A;  1AUD A;  4K4X A;  2VQF F;  3CCT A;  1RT6 A;  4C98 A;  4LQ3 A;  4Q0B B;  2AYM A;  3H25 A;  3KHL A;  2GNK A;  5CD4 A;  3SQO P;  1DQ8 A;  3K2Y A;  4WE1 A;  3PO5 A;  2OPQ B;  2FLN A;  1JLB A;  2HFN A;  1J5E F;  2P8I A;  5ETN A;  2I1R A;  1V5I B;  2VH7 A;  4A47 A;  5AXL A;  4NA3 A;  4QIW D;  3FBF A;  5FDL A;  4KKO A;  3S1T A;  2MLY A;  3SSQ A;  4JI2 F;  4X4N A;  3H5S A;  4RW8 B;  4F3O A;  5A8R A;  2BX6 A;  2W9A A;  1VHF A;  3M8W A;  1FO1 A;  3UCU P;  3M2V A;  4F3M A;  3QT7 A;  2UV8 A;  1M90 T;  4P2M A;  3DRS A;  2ACY A;  5KFU A;  2VD3 A;  3AA9 A;  4C6A A;  1I51 B;  1LW0 B;  3TZX A;  4OX9 F;  2ACM A;  4NEY A;  4X62 J;  2AZ3 A;  3VAL A;  4P52 A;  4NLG A;  1M5S A;  1VC0 A;  5M2P A;  2PI4 A;  3PRV A;  2CJ9 A;  2RDD A;  3IM9 A;  3TJ8 A;  2DNP A;  1SC3 B;  3LAM A;  3F41 A;  2N4C A;  3KUG A;  3C14 B;  2YY3 A;  3MM8 A;  1N34 J;  3UD5 A;  3GCX P;  5JUM A;  3CCZ A;  4LVN P;  4B9M A;  2R2R A;  2DB1 A;  1E6Y A;  3MEC B;  1X60 A;  3J7Z T;  1TK5 A;  2UU9 J;  1TL4 A;  2AJF E;  2HNY B;  2RJZ A;  2E1R A;  5LXY A;  1KBR A;  4X4S A;  2MXY A;  1X4A A;  1KOO A;  3POT A;  3H2V E;  2HSE B;  4G1Q B;  1WF1 A;  4CQ1 A;  3PNI A;  4NA1 A;  2ZE2 A;  4YN3 B;  2J6T A;  2QFI A;  1VQ7 S;  1HWI A;  3J81 Y;  3UN3 A;  4YUD A;  3Q8S B;  1FFW B;  2XY7 A;  2MQ8 A;  3PKY A;  2YQ1 A;  4OQJ A;  5DZ6 A;  1DTT B;  2RD5 C;  3HHL D;  4QWC A;  2KL8 A;  3ILI A;  2EFG A;  5U47 A;  4RBU A;  5B7W A;  4MKA A;  3I0S A;  4FBU A;  2CG4 A;  3FDS A;  2LDI A;  4P2X A;  5E2Q A;  4MAK A;  3U27 A;  1RBA A;  2HBR B;  4M5L A;  4KO0 B;  3BGF A;  2MZJ A;  2FJA B;  1H98 A;  2MYF A;  1RTH B;  3CJT A;  3HI9 A;  1W2B R;  3LP2 B;  5KFF A;  2QO3 A;  5LL6 d;  1Q81 T;  4BBY A;  3CDE A;  2OPR A;  5I42 B;  1VQ8 S;  2MMY A;  3QGP A;  3H42 A;  5K5M A;  3MPY A;  5KFO A;  4LFB J;  3KYL A;  1S6Q B;  3V6J A;  3FMB A;  5HQ8 A;  4DSL A;  2ZOM A;  2EBE A;  1MNE A;  2CIM A;  1KFD A;  2XMT A;  2ALZ A;  3FSY A;  4WXO A;  2VPX B;  3CGI A;  3MAA A;  4DV7 F;  2DHS A;  2ATC B;  3PTW A;  1SKU B;  2AGQ A;  1VRT A;  3PXG a;  5HQM A;  4ZCM A;  1VBZ A;  4JI4 J;  3W5Y A;  2Z58 B;  2DRA A;  1XNQ F;  2X1A A;  1MN9 A;  2CPH A;  3QWP A;  5K8N A;  3IRW P;  1CC7 A;  4WYL A;  4DOZ A;  1TL1 B;  4KHP F;  2V94 A;  2VIH A;  1RWK B;  1VRU A;  3AJ1 A;  4ZHR A;  1WHX A;  3BSO A;  1F9H A;  3UDL A;  3CC7 S;  3TAQ A;  1U1O A;  1S4E A;  3OPK A;  4QYZ J;  3IBW A;  2LEP A;  2BDP A;  3W2W A;  3V81 A;  2NRE A;  4JI7 J;  4DL7 A;  4CO3 A;  3NMA A;  5EWG A;  4J9V A;  2R7S A;  2K1R A;  1MW7 A;  2XBP A;  3A1Y G;  3T3F A;  1WOR A;  2J6S A;  1HBU B;  1JMT A;  2HRY A;  3VHQ A;  2W24 A;  5HMZ A;  1QY7 A;  3IS9 A;  2V9W A;  2JHE A;  5LT5 A;  2A6M A;  4RX6 A;  4LRD A;  2VZ9 A;  2QA4 G;  3CJQ A;  1L5U A;  1FWL A;  4AT1 B;  2FHK A;  2DNH A;  3B4M A;  1S1X A;  4OYW A;  2MB0 B;  4LIW A;  2XGQ A;  3H90 A;  2ZUG A;  1EP4 A;  2DIU A;  5ETR A;  4DUT A;  3QJJ A;  4B3O B;  1QVF R;  2WON A;  4PPZ A;  2DK2 A;  5KFI A;  4KGZ B;  3S6E A;  1WOP A;  2K06 A;  2MDA A;  3KMQ A;  4KSE B;  1IWA A;  3JYT A;  3W8G A;  2AZ1 A;  1DHM A;  3ZZU A;  3QLH A;  3QFW A;  4KHR A;  3NGD A;  2FHO B;  2W4D A;  1U2F A;  1LFW A;  1MN7 A;  3QAT A;  2G1H A;  1NK7 A;  1OPI A;  1VC5 A;  3H2U B;  2C2O B;  3K5M A;  3EZ5 A;  5GMD A;  2BBE A;  1REV A;  1RI7 A;  3RJM B;  5FII A;  1NZA A;  3G8Q A;  1B99 A;  4KGK A;  3AXK A;  2DNQ A;  1T9X A;  3X3U A;  2CPY A;  3T19 A;  1RA7 A;  3BSC A;  3LP0 A;  4PR6 A;  1TKX B;  4K50 A;  1TAQ A;  5KG2 A;  2DJW A;  5J2N A;  4WPA A;  3M8S A;  3MCN A;  2HZV A;  3ZTS A;  4UOG A;  1ZET A;  1F2G A;  3DOM B;  4MJK A;  3GIL A;  2IM2 A;  5KFZ A;  2JZ5 A;  5A2Q U;  5KG6 A;  2HGL A;  1ZAW A;  3ZTR A;  2AYB A;  2CQ0 A;  3SV4 A;  3UDC A;  1FNM A;  3M8Z A;  3E51 A;  3IO1 A;  2B7B B;  3DRP A;  2U2F A;  4L75 A;  1N33 F;  3THP A;  2QLX A;  4FF1 A;  1SJ3 P;  3CJ4 A;  3HFK A;  3V5R A;  4FVC A;  2V4R A;  3DLK A;  4CT8 A;  2K7J A;  4N41 A;  3MM6 A;  1PKU A;  3IG1 B;  3GIR A;  2VFU A;  2ZWP A;  4YB5 A;  5KG0 A;  2J76 E;  1TKD A;  4IDK A;  1S49 A;  4DCO B;  2R7X A;  1RTD A;  3GFX A;  8AT1 B;  2D74 B;  4OX8 A;  4K2X A;  2XHC A;  2W8K A;  1CEZ A;  3M9O B;  1S1W B;  1NK0 A;  3CD0 A;  2O66 A;  3GIM A;  1S7H A;  2X1F A;  3FK4 A;  3PYE A;  2QMW A;  4KPY A;  4DG1 B;  4QZV B;  1KON A;  1W7W A;  1SKR A;  2PII A;  2JL9 A;  4JV0 A;  4IKA A;  4LRC A;  4ZA1 A;  2LEB A;  2IJR A;  2F9J A;  2JC0 A;  4R0E A;  3QBC A;  3DDK A;  4M63 A;  3NBP A;  4YR0 A;  2CKW A;  4OIX A;  2VFV A;  1HNV B;  1U1Q A;  2L41 A;  3IN5 A;  3Q24 A;  2XO6 A;  3LA0 A;  1TEL A;  4OI0 A;  1ZS6 A;  4DV6 J;  1IJE B;  1UVN A;  4RR5 A;  3OSP A;  3NG8 A;  1GFW B;  1XBW A;  2V68 A;  4ZPW R;  3PEH A;  4G6V B;  1PGZ A;  4YR3 A;  4FNH A;  2R2T A;  3LAK A;  1I3O B;  2HS0 A;  2FJV A;  4NLQ A;  1K8A T;  4F2S A;  4NYP A;  2MY8 A;  3R5A A;  4JV5 J;  4USJ C;  5D6G A;  2OEL A;  1JLC A;  2MKK A;  2VDI A;  2EK6 A;  4K4S A;  2QT7 A;  2YX1 A;  4EEY A;  1WUU A;  2ZUA A;  1YK9 A;  4B3M F;  3JXO A;  5LOQ A;  3MM7 B;  3S01 A;  4A8Y A;  4TQS A;  1XMB A;  2NSB A;  4I67 A;  3H2L A;  2F7V A;  2DGU A;  4BC9 A;  2OP5 A;  3PAC A;  2R8H A;  4DS4 A;  3CJ5 A;  3SI8 A;  3JSR A;  3NXZ A;  2CVE A;  5L9N A;  1RBO B;  2IDE A;  3FFI B;  4PEO A;  3OSN A;  4NPO A;  2OEK A;  1X4B A;  4DX7 A;  1FKA F;  4ZP7 A;  4KHM A;  1NJY A;  2OLW A;  1RTJ B;  1KVI A;  2JLE A;  1VQO S;  1D0E A;  3OXG A;  1LWE A;  4F8R A;  4QIE A;  3TI0 A;  1Y5L B;  3G6Y A;  1S1V A;  4RW9 A;  1PBU A;  3HT3 A;  3KLF B;  2J9C A;  4KV8 B;  1ROF A;  2YWF A;  3VCD A;  5K8P A;  4GRS A;  3MEE B;  4GC7 A;  1YGY A;  1NM2 A;  3BEG B;  1F60 B;  4J91 A;  4ZCL A;  3MOJ B;  1R8A A;  1D09 B;  5AXK A;  4FDF A;  4E2F B;  1AFJ A;  2V9K A;  3K7R A;  4EBE A;  1FK9 A;  4DR1 F;  4DX5 A;  1S6P A;  1PJ7 A;  3MPU B;  2XYG B;  5CA5 A;  2Z8Q A;  3D7S B;  3QIP A;  4TN2 A;  5THW A;  4WE1 B;  4ZJL A;  5F9N A;  1VQP S;  5D15 A;  4I6Y A;  1JJC B;  3K8W A;  4CH7 A;  1Y5I B;  4YS2 A;  1U0H A;  3M8Y A;  4HL9 A;  2CJX B;  2IM0 A;  3GON A;  1UJ4 A;  1E6V A;  1FDB A;  2YKN B;  4R0J A;  3M2V B;  5ITH A;  3I32 A;  1T8E A;  4ZPA A;  4KAI A;  2HQI A;  4H4M A;  3HP6 A;  3CCW A;  1I1G A;  3W9J A;  2YPY A;  3AOA A;  1M1K T;  2QZ8 A;  2BJ3 A;  4ZVP B;  3SFU A;  3QQC D;  3PR5 B;  3A3P B;  4ELT A;  3GJT B;  3DI6 B;  1F5A A;  1G3O A;  4J9R A;  3Q2T C;  2ZEJ A;  5E33 A;  1VBY A;  2E5H A;  2E44 A;  4DHV A;  5C24 A;  1E6Y B;  1WHV A;  5IOL A;  4Y2C A;  1T9Y A;  2AJ1 A;  1B0P A;  2AHO B;  2ZHA A;  4ID5 B;  4F02 A;  2B51 A;  2FVC A;  3GR0 A;  4Q2L A;  4P2F A;  5JJB A;  1H2V Z;  4LR7 A;  3PRB A;  3GYN A;  1RTZ A;  1HWU A;  3RRG A;  4LF5 F;  7FD1 A;  4Q8E A;  2L48 A;  5D0R A;  4J9M A;  1ZTT A;  3H5X A;  4NYZ A;  3VZH A;  1FT8 A;  1BLU A;  2R7O A;  4FBT A;  4NI2 A;  2N82 B;  1HHQ A;  2OMO A;  1KR4 A;  3G4S S;  4WFB Q;  2J9E A;  1KP6 A;  2YX4 A;  2LP4 A;  1LK7 A;  2VG6 B;  4ES2 A;  4M5D A;  3FEZ A;  3AFG A;  3P5B P;  5JVH Q;  4KGM A;  3BM7 A;  4N76 A;  2HS4 A;  3OFF A;  3GV5 B;  4I0W A;  3G71 S;  4JI8 J;  4YFU A;  4I2Q A;  4LF6 J;  1DTQ B;  3RG6 A;  3CCV S;  5IS2 A;  5DJB A;  2KG0 A;  4IFV B;  1KOH A;  2BM0 A;  3KUH A;  2CXE A;  1U2R A;  2QA1 A;  4ZJQ A;  2XCP A;  1ULR A;  3UD4 P;  1CG2 A;  2HW3 A;  1WOO A;  2JRS A;  3SV3 A;  1X4C A;  4R5P B;  2DIT A;  1KQS R;  1FRL A;  3Q8Q B;  1UJ6 A;  3QGH A;  3QZ8 A;  2UVW A;  1SV5 A;  1ZM4 A;  3A4T A;  3HCX A;  4O3O A;  1NJZ A;  3DGP B;  3HVT A;  5HAO A;  2HAF A;  2A2C A;  2EWH A;  3FEY B;  1DAX A;  1V5V A;  2VAS A;  1VHI A;  3KDN A;  1PIE A;  1Q79 A;  2YKM B;  3VGT A;  4LR9 A;  1IQZ A;  1VQS A;  5HQL A;  4JBC A;  4Y34 A;  3TA1 A;  1WI8 A;  4WII A;  2CQG A;  1UEV A;  2DXF A;  5BYQ A;  1VRU B;  2P9G A;  4ZHR B;  1HQU B;  1WG5 A;  2H3E B;  3T1H F;  4RW7 A;  3KJF B;  2R7U A;  4UT4 A;  5DLG A;  3HVA A;  2MGZ A;  3CD7 A;  2IJF A;  5M2U A;  2EEY A;  2VG7 B;  2MZQ A;  2WRM A;  1RAC B;  1GT8 A;  2Y0S D;  2F8E X;  3AB4 B;  3NGT A;  2UXC F;  2Q43 A;  4OYM A;  1N56 A;  3TJA A;  1T3O A;  5DDQ C;  4TVA B;  4Z7Y A;  4DPY A;  5DS7 A;  3IWL A;  1XMQ J;  3PM9 A;  4OJ3 A;  1RAJ A;  2K1R B;  3TOQ A;  3T5J A;  2VUG A;  1JJH A;  4RJV A;  1WF0 A;  2WB1 D;  2JDJ A;  3MD1 A;  1EET B;  4UUW A;  3TEG A;  3I5A A;  4B3R F;  2HHT A;  4XO0 A;  4DV2 J;  2DGS A;  1KEK A;  5GAG I;  1YBU A;  3HHN B;  5IV3 A;  4P7T A;  2VB6 A;  1DZ5 A;  1N5Y B;  1DAR A;  2Z0G A;  2ZBI A;  2HVD A;  1CJU B;  5HVG A;  2MQN A;  1NUE A;  4Z2X A;  3MFH A;  1JLF B;  5JVG Q;  4EMD A;  1U8W A;  1RE1 B;  1T0T V;  1HNZ F;  1F5B A;  4ED6 A;  1R7I A;  2LVW A;  5KT5 A;  2ZVS A;  2JLF A;  2MZS A;  1RWN B;  4RNM A;  4DR4 J;  4X66 J;  1WEZ A;  4B3T J;  1TAU A;  3GV7 B;  1Q8B A;  3L7O A;  4NCA A;  4QWD A;  2Z2M A;  2OO4 A;  4PQU A;  3MFI A;  2HMI A;  4USI A;  3L95 X;  2Z4P A;  4UQG A;  6AT1 B;  2ZKU A;  4A8Q A;  1R0C B;  1JWW A;  3BGU A;  5KFX A;  2CQ3 A;  4ZVE A;  2AJ2 A;  2FVP A;  2PEH A;  4QIV A;  2QRR A;  3UCG A;  3WIU A;  1FRK A;  4WFZ A;  3CDW A;  3CUN A;  3R2D J;  4JI3 F;  3OTO J;  2WOM B;  3U1M A;  4HH0 A;  1VC6 A;  2VJV A;  3ISZ A;  4K8R A;  4ED5 A;  2VKR A;  3MMC A;  2GIR A;  1Q0N A;  2BAN A;  5T41 A;  3CJK A;  3MM5 A;  4WU2 A;  4KFB B;  4LSN A;  3KK1 B;  2A0F B;  1YVF A;  3OV7 A;  4RUB A;  3OVS A;  5IFM A;  3ZZR A;  1VFJ A;  2C42 A;  5GMK a;  2C3O A;  4EU0 A;  1P1T A;  1T9U A;  3PYD A;  4PWD B;  3LAN A;  1H0H B;  2XZD B;  1HBO A;  4EFA C;  4P2S A;  5K8O A;  3P5T L;  1UET A;  1PYO B;  4X4R A;  1QAI A;  4JI5 J;  4GKK J;  1H2U X;  3DLK B;  3DDN A;  3K57 A;  2PSZ A;  5K9F A;  4AQY F;  4IDK B;  1U7L A;  2BYC A;  3I5B A;  2XB2 D;  3LOU A;  3CCL S;  1AZS B;  1UWA A;  1FNO A;  1FFG B;  4R8U A;  4HLB A;  4HYK A;  1S1U A;  4B9T A;  2H9Z A;  3WQP A;  5KOW A;  3HKW A;  3KUE A;  2VU5 A;  1X5P A;  1ZAX A;  1HNX F;  3NY0 A;  4BS2 A;  2DCU B;  4CI0 B;  1U26 A;  2JEG A;  1WWH A;  1OS5 A;  1UFK A;  5KFR A;  1KVK A;  2YWK A;  3MEG B;  2RML A;  2HVI A;  2DCL A;  4PXB A;  2M7S A;  2IYI A;  1QTN B;  5J1E A;  2KB2 A;  4NLU A;  5EDW A;  4CZC A;  3C16 A;  2J7U A;  2L08 A;  3TVK A;  4A8S A;  2F5G A;  2CZ9 A;  3VVT A;  2IY5 B;  2W7A A;  1IWG A;  1Y9O A;  1RHQ B;  1SJQ A;  2BOA A;  1YBA A;  2HG4 A;  1RU2 A;  3J81 U;  2XUL A;  3VGV A;  3BPS P;  1SC4 B;  3QO9 A;  4FKY A;  4DR7 J;  1IR2 A;  1T05 B;  4XK8 C;  3C19 A;  3OTB A;  1NSK L;  2XZW A;  3GFH A;  3O6Q A;  2FJX A;  4WYW A;  2E9Z A;  3MUR P;  2UU9 F;  3M6X A;  5FD1 A;  4QWA A;  2KHC A;  2V0N A;  1F9E B;  3LGM A;  3ITH A;  4F26 A;  2RF2 A;  2R7V A;  5L1I A;  3PFO A;  4IH6 A;  2BJD A;  2VOP A;  4FN5 A;  3MMA A;  3M32 A;  4LR8 A;  5CCL A;  4YP3 A;  4U67 Q;  4NCG A;  4KT0 C;  5DQI A;  2EFO A;  5AJ3 J;  1HNI B;  3T1Y J;  1MRO A;  1X9S A;  1L3V A;  3D66 A;  1R0A A;  4CLF A;  1QTM A;  1QAX A;  3M1V A;  1IBL F;  3D28 A;  2PD1 A;  1UVI A;  1FEE A;  4TU8 A;  4WKY A;  2DGW A;  4J90 A;  4X2B A;  2FGC A;  2ADC A;  4C9D A;  1WSR A;  2VF3 A;  4KGV B;  3SIP B;  2GVD B;  1PIL A;  4KC5 A;  3FGV A;  4EZ6 A;  3CDU A;  1R43 A;  4H4O A;  4D3G A;  1MU2 B;  1TVR A;  1PYS B;  2WSF C;  4M5H A;  4AD6 A;  4TNO A;  3K58 A;  4DSJ A;  3R27 A;  2W7P A;  1DQ9 A;  1QJH A;  3RB0 A;  5DET A; 
#chains in the Genus database with same CATH homology
 4KYZ A;  4AQY J;  2UXD J;  4JI1 J;  4LF8 J;  4KY3 A;  4DV2 J;  4B3S J;  4DV3 J;  5BR8 J;  2UUC J;  2MQ8 A;  2MTL A;  2UXB J;  4DV5 J;  2VQE J;  4NEZ A;  4JV5 J;  4PWW A;  1N36 J;  5FLX U;  5IT9 U;  4JI4 J;  3T1H J;  4OX9 J;  4DUZ J;  4DR3 J;  4KHP J;  5AJ3 J;  3R2C J;  1HNZ J;  4DR5 J;  1HNW J;  3J7A N;  1FJG J;  2KL8 A;  4DV1 J;  4DR1 J;  2VQF J;  1HNX J;  2MEW A;  1XNQ J;  3T1Y J;  4DV4 J;  1N32 J;  4NEY A;  4X62 J;  5A2Q U;  4JI6 J;  4NXN J;  3D3B J;  2HHH J;  4NXM J;  3JAM U;  4DUY J;  4LFA J;  1XMO J;  5LMU J;  2UXC J;  4HHU A;  4JI8 J;  3W1Y C;  4GKJ J;  5LM7 E;  4LF6 J;  1HR0 J;  5LMN J;  4B3M J;  2ZM6 J;  4DR4 J;  4X66 J;  4B3T J;  1IBL J;  4LF4 J;  1N33 J;  1J5E J;  3D3C J;  4DR2 J;  3J80 U;  4LF7 J;  3J81 U;  4K0K J;  1IBM J;  2KVQ E;  1N34 J;  1I94 J;  2UUA J;  4JI5 J;  4DV0 J;  4GKK J;  4V1A k;  4JI3 J;  2F4V J;  2UU9 J;  1XNR J;  4DR7 J;  4LF9 J;  5IWA J;  4YHH J;  4X64 J;  1XMQ J;  4JI2 J;  4JI7 J;  2UUB J;  4B3R J;  4X65 J;  4LFB J;  4YY3 J;  4DV6 J;  4LFC J;  3R2D J;  2E5L J;  4RJV A;  3OTO J;  3IMQ J;  4JI0 J;  1IBK J;  4LF5 J;  4DR6 J;  4DV7 J;  4JYA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...