4DUYJ

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 16
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4duyJ00
4LF5J 2F4VJ 3T1HJ 2UUAJ 4JI5J 1XMQJ 5FLXU 2UXDJ 4DUZJ 3JAMU 3T1YJ 1IBKJ 5LMUJ 4KHPJ 1XMOJ 4KYZA 2UXCJ 1IBLJ 4DR3J 5LMNJ 4JI1J 4V1Ak 4YY3J 4X66J 4JV5J 1HNWJ 4DR4J 4AQYJ 4OX9J 2ZM6J 3J80U 4X62J 4DR1J 2UUBJ 4JI4J 5A2QU 3D3BJ 4DR7J 3OTOJ 3R2DJ 1N33J 2MEWA 4JI2J 4NEYA 4HHUA 2KL8A 5LM7E 1N36J 4B3MJ 4B3RJ 4DV3J 4NXNJ 4LFAJ 2MTLA 2UU9J 4LF7J 1N32J 4DR6J 5BR8J 4K0KJ 4LF4J 1HR0J 4LF8J 4JYAJ 1J5EJ 4GKKJ 4GKJJ 4NEZA 4JI0J 4PWWA 4X65J 2VQEJ 4JI7J 4DV2J 1IBMJ 4LF9J 2VQFJ 4DV6J 3IMQJ 5IWAJ 4DV4J 2HHHJ 3J81U 4KY3A 1XNRJ 4DV1J 5AJ3J 1HNXJ 2E5LJ 4DV7J 4B3SJ 1HNZJ 4YHHJ 2UXBJ 4RJVA 4DUYJ 3R2CJ 1I94J 3J7AN 4NXMJ 2KVQE 4X64J 4DR5J 4LFCJ 2MQ8A 4LFBJ 4DV5J 2UUCJ 1XNQJ 4JI8J 1N34J 3W1YC 4JI6J 5IT9U 1FJGJ 3D3CJ 4DV0J 4DR2J 4JI3J 4B3TJ 4LF6J
chains in the Genus database with same CATH superfamily
3CCES 2AF6A 4M63A 2FQQB 3N5BA 5B0CA 1TL5A 2D9OA 1FF2A 1X4GA 2C2NA 1HNWJ 3V81A 2MKKA 2XS7A 2RRNA 3PW4A 2OGUA 5GMDA 4PQUB 4DR2F 4B3TF 2YPZA 5L1JA 2QYGA 3GSDA 4QW8A 2HNYB 2BJ3A 4TLRA 4MH8A 1K1SA 1UKUA 1GEHA 2BQ3A 5J1EB 2HNZA 1UWAA 2D3ZA 2Y8WA 4QU6A 4PWWA 3K58A 2HG4A 3FC9A 1MNEA 2LA6A 2OHDA 3ILIA 3CCWA 4ES3A 4ZJQA 1M5KC 1BD6A 2C3PA 2DBBA 1VGYA 1XNQJ 2RQ4A 2J0SD 1XR6A 4Q2MA 4DPUA 1A6LA 3LALA 1QUPA 2M4MA 1UW4A 2X3GA 3QIPA 3ENAA 4F26A 4ZP9A 5GMKa 3E01A 4DG1A 5J2QB 3B78A 4MMOA 3I0RA 4O3RA 3BGUA 3S6EA 2AEJA 5D15A 1YITS 5KFZA 2IA6A 4USWA 4M5HA 1LWFB 1N8RT 2KI2A 4JI3F 1FK9B 2VV5A 1ZPVA 2ZWPA 2LCWA 3DC2A 5F8IA 3CCMS 5C2CA 2B9WA 4DL2A 2BA9A 3DM2B 2CDRB 2H48B 4UZBA 2VPXB 2HGMA 2RJZA 4NEZA 3W61A 2QLXA 1I3OB 2VFUA 1BWEA 2ZUAA 3CD6S 2CA9A 3BN4A 3HSZA 3W5XA 3PZPA 4N5SA 3HSGA 3GG1A 3UNYA 3MZIA 3CCSS 3LANA 4F0MA 2NXNA 1HR0F 2IYIA 3L95X 1RDRA 3OLBA 1FO1A 1FVSA 2KJVA 3SV4A 2P6TA 7AT1B 4IFYA 5HLFA 3JTNA 4GVLA 3OVAA 3MMAB 2Y9HA 4B3SF 4IRDA 1GNKA 2U1AA 2AYMA 3RTVA 5KFPA 3CJKB 1JJCB 3H59A 1VQMS 2CQ1A 1E6YA 4OYAA 2XULA 1S9FA 2HVIA 1XR7A 2YWWA 5KFHA 4NLPA 4OX8A 2HHSA 2PDAA 4KGKA 2EG1A 4B17A 2IA0A 5HP1B 3TOQA 3ZO7A 2Y0SD 1S79A 4KGVB 2EFQA 1U8WA 3JXOA 3KK3A 1RT3B 5B09A 2VDHA 2FPHX 3M8QA 2HFVA 3A1YG 3EXYA 4ZCKA 4UOGA 3EVMA 3FFIA 2RHQB 3IMQJ 3CCLS 1S48A 1DQ9A 2WW8A 2DHSA 5D4PA 4ZVUB 3RBEA 1FE0A 1WOPA 3QGIA 5CHCB 1WI8A 1RLDA 2AZ3A 1WOSA 2RS8A 4RNMA 4K2XA 4WK3A 3DYAB 4EZ6A 2DTJA 4J9OA 1J5EF 4P7TA 4F25A 1UVIA 1Q8KA 3D9BA 3TJ9A 3PR4A 5HO4A 1AW0A 3MR5A 1Y11A 4NX9A 5A8KB 3PFOA 3F0NA 2Z2YB 2OAUA 1PAUB 2CXEA 3EZ5A 1SKUB 1RWMB 2F65A 1J2VA 3ENWA 2DR7A 4CYUA 4NLYA 5CYMA 4F3OA 4BC7A 1RGVA 5D4NA 1YZ6A 4LSZB 4A4JA 4G6VB 5H1SV 5GADU 2PA3A 4KGMA 1M1GA 5K8OA 4JYAJ 4GKKJ 2NSBA 3IG1A 2QT7A 1A7GE 3TUJC 3LGNA 2H1YA 4ITSA 1W2IA 3GE9A 3UVJA 1Q8IA 4ECTA 1SKWA 1RWKB 1X4FA 1JNRB 2B7BB 4LRAA 3NCRA 4QWDA 4DPOA 5IXUA 2DVIA 3QJLA 5J1NA 5IM0B 3VGUA 3TUZC 2HS4A 3J7Z5 2RH3A 2RIJA 4X64F 1UP1A 4NA1A 7FD1A 4RLEA 3NEKA 3HHDA 2MZJA 3P45B 1DTQA 2CJYB 5E5NA 4KFBB 3HHLA 4JI1J 1HA1A 2CVIA 2I5JB 5DM7Q 3PVXA 3MR2A 2AMCB 5L1IA 1IR1A 3H5SA 3UE2A 1F3VA 4RL1A 5LJ3Y 4MKBA 3RRHA 4CM2A 2P2CB 2YQ3A 3CDUA 3IGVA 3EGZA 2GHWA 2B9YA 2MGZB 3MAAA 3D0IE 2V9WA 4M5KA 5K20B 1JJ4A 4RWWA 3UCZP 1NJIT 2JDJA 4B9VA 3CJ8A 3JYTB 4M5NA 5KFYA 4ZKAA 1AZSB 1YRXA 1EP4A 1ICEB 3CDBA 5KG1A 2ZWOA 3N6LA 4OZJA 3C3LA 2BZ2A 4UY85 1CJKB 2MDAA 4JOUA 2MHNA 1YLXA 2LQBA 4LQ3A 5IWAF 3TUIC 4KV8B 3DI6B 5EGYA 2C3UA 4K59A 5LXRA 3M2RB 1VBXA 1JLEB 4I6YA 3OXFA 1G2EA 2CQIA 2RQKA 1SQFA 2KFNA 2R7UA 3K8WA 5F8LA 4ZPDA 4YDXA 1IBKF 2J9DE 4WFZA 2XI2A 4DR4J 1QM9A 1U26A 4HR2A 3PDNA 4QJVA 4MAKA 3W8GA 2BE2B 3N4WA 4CTAA 3K5NA 1S6OA 2YNHA 1S12A 1RAGB 4CLUA 4NPOA 2XLIA 3E3XA 1UW9A 3CGIA 5J2NB 3ONQA 1YKWA 2V2VA 2HK3A 1HNZJ 4RJVA 1S1UA 2D74B 4NMXA 2HSEB 4DN0A 4LFAF 5E2QA 1RJJA 2HMIB 1AT1B 3DN9A 5HK4A 4PYAA 2NQPA 2CPIA 2CQHA 1EARA 4CQ1A 2FGOA 4ZPAA 4C3LA 3JAMU 2XY7A 1XERA 4G1PA 1AUDA 2IM3A 2B5JA 4C98A 1FDBA 3AHPA 5KFMA 2LECA 1GQEA 3G8TA 4WP9A 2UXCF 2D3UA 1S6UA 1XIQA 4YY3F 2JX2A 3PNIA 4FYYB 3VAMA 2WAQD 2ASLA 4RBVA 3GZ7A 2D69A 1RT4B 3B54A 2EW9A 2B3TB 4U67Q 1GMWD 1IBLF 2VOOA 5U47A 3Q22A 2BJ9A 3EGWB 4EEYA 2HLTA 4J91A 3I32A 1K0TA 3QRPA 2VJUA 2YWKA 2XZWA 3SSQA 2AEMA 2FJVA 2IMOA 1M5PC 4J9KA 2HQFA 3W9JA 4YR0A 4QR1A 2VBZA 3MPYA 1HWLA 2V2ZA 2IIHA 2GFFA 2ZBQA 2F3JA 3EPIA 2QMUB 5DGBA 1OY8A 2XS5A 1XMQF 4WU2A 2WZ1A 1VC6A 2DCUB 4UOHA 1B7FA 1UFWA 2BRKA 5EWFA 2V68A 4M94A 4ZVQB 2HQIA 2NXEA 3J80U 3V4IA 1R0CB 1RHKB 3UDLA 1WHWA 1P8GA 2HYIB 2G13A 3E51A 3A3NB 4LF5F 1N36J 4N41A 3DRSA 2EEYA 3FEZA 3RAXA 3M8YA 1KC8T 3KKFA 3OSNA 2LKZA 4IR9A 5KOWA 2UUTA 4R5PA 1DBDA 3RB0A 3HMJG 5AJ3J 4RBTA 4L3NA 4OI2A 5F41A 4ZIWA 4LF7F 3ZNJ1 1RT1A 2OH2A 2GNKA 1P9YA 2L08A 2HVHA 1ZM9A 2ZHOA 4YR3A 1NSKL 2GV1A 1G3OA 4PQAA 1YJNS 4B3OB 1M0SA 4EO6A 2WOMA 3JQKA 3LPEA 2DR9A 2GQQA 4ALZA 4A8SA 1D1UA 1FJGF 5KFWA 2DGOA 2YX7A 5F9NA 2YKPA 3R5DA 4OX9F 4OJ1A 2XYGB 2ZVIA 3CJSA 2OI2A 4NXNJ 3GWCA 4O0IA 1HWIA 3FK4A 1BC6A 2GIRA 2IJNA 3NAIA 2RDJA 1NMEB 4OYIA 1WEZA 5ETLA 3UW1A 4DQIA 1RWPB 4PCQA 4X4SA 3R1LA 2HLUA 5IFMA 3L7PA 3QZ8A 4FN5A 5ETSA 3SQGB 1HWUA 4I2PB 5CH7B 2XBPA 1HKAA 1N5VA 2QE5A 5F3ZA 2XMAA 3UD4P 3OHAA 3T9NA 5DZ7A 2RVJA 3IM9A 1FD8A 2KVIA 5CD4A 2NXCA 5HN0A 1UEUA 2IRYA 4ZLLA 3V6JA 1N5SA 1FKOB 3OHBA 1K1QA 1PIEA 1RAAB 5D78A 1QJHA 4IDKB 4OZ2A 5DRKA 1LV5A 4N8NA 4NLVA 1TFWA 3CXCR 3OR1B 5KFXA 1VFJA 4UT4A 2Y1JA 3GQCA 1LWEB 2VPYB 5J2PB 3CJ2A 3CD5A 2BYCA 2QGFB 3MM8B 4A47A 1D9AA 1RYSA 2IDLA 3P8BB 2E9ZA 2XYHB 1RB0A 3GIMA 5J1EA 1VQ7S 5CZXA 5HANA 4IOBA 3MUVP 2KDOA 1SJQA 3G71S 1LEOA 5E0OA 5E3CA 2OEJA 2FY1A 5KFFA 4O4GA 4DHVA 4TN2A 1P1TA 5C5JA 1XWLA 1NPKA 2V34A 2GX8A 4LBPA 1Q16B 3AB4B 2Y1LB 4A8KA 3H7HB 2DNHA 3TA0A 1IUJA 2PMZD 4F2RA 1CS4B 1RHMB 2F4VF 3HVTB 1JK9B 2H54B 3NGRA 4J9RA 1TTHB 3KDNA 2E29A 4ZCIA 4AQYJ 2LDYA 4PRFA 4DR7J 3M6XA 1KVKA 3H98A 4JI2J 3M9NB 3F44A 2BKPA 2Q6CA 4ZITA 3QLHB 4R25A 5KFLA 1KLNA 3I6PA 4W98A 2KXFA 1FK9A 1VYAA 5KT2A 2J0XA 2IAJA 3B82A 4C48A 1NDCA 1TKZA 1Y4ZB 2WVDA 2RDIA 3R5GA 1R8PA 1Q79A 1F9EB 4DS4A 2GS8A 1X31C 2NUHA 2WRMA 3MI7X 5IT9U 1E6VB 1L3KA 2YY3A 4KPYA 1NDLA 2Y1RI 1TVRB 5E41A 3MCOA 1RQ0A 3H25A 4P2FA 2PE8A 4K4SA 4Y2IA 1RAOA 1F5AA 3L09A 1ZTWA 1VQNS 3T9ZA 1F9FA 4E2FB 1BMQB 4U95A 5E3RA 3QT5A 3AY0A 5T41A 2AV5A 1KRPA 3MR3A 1YTYA 1FWLA 2UZAA 2VC0A 3KLHB 1TKDA 4CNYA 2AJFE 3VGTA 4DL0C 4NZ6A 2OMLA 2HS0A 1P9QC 1XN9A 4P6QA 3CIMA 4RNFA 4WU3A 2GQ2A 2VC1A 1FEHA 4ILLA 3EPGA 4L6V3 2X51A 4P71A 3IRWP 4U8VA 5HP1A 2QFIA 2KG0A 2W9AA 1I1GA 1CJVB 2RD5C 1IVZA 1FEEA 4BHQA 1TL3A 4DUYJ 2DHXA 4WKRA 2VBYA 1O0PA 3DCAA 5I42B 2KH9A 4WJBA 4HACA 2KRRA 1NAQA 3RW7A 4UY8T 3CJ5A 3RBXA 1WG1A 3ENVA 2BQRA 4YMEA 1Y10A 1F1BB 2ATCB 3CMQA 2HWIA 4IYQA 4CO2A 2XHWA 2LU2A 2LQ5A 4DX6A 1X8DA 2VODA 3BGOP 3IR6B 3CJ3A 2ZH7A 3BKUA 1C0TB 4CNZA 1D09B 4FVMA 5A8KA 1MROA 3AD7C 2J6TA 1X9MA 1PILA 2HZCA 2KN4A 5BR8J 3K89A 3QSIA 2XZTB 3MGJA 4QZVB 2OSRA 5CAAA 3ET6A 5E3QA 2PIIA 2R7QA 2F5GA 2F8EX 5T7LA 2IVFB 2CJKA 1KDNA 1B7YB 5IV4A 1HARA 2C2EA 5AT1B 4F04B 2AT1B 1O51A 3BPSP 3UO0A 4F4AA 3MPUB 1RCXB 1S1WB 1SQEA 3MCMA 3SDEA 4CT8A 3NNCA 1KLMA 4LF9F 2Y3YA 1KN6A 1BLUA 3AH6A 4LF1A 1FRLA 1D0EA 3GR0A 1IKXB 2NSCA 2GW8A 3ZTSA 1XQIA 3FSXA 2DITA 2DNOA 2ZH3A 3QGGA 2HK2A 2CPFA 3QO9A 4DL7A 2HIYA 3UNGC 1WF1A 4ID5B 2HNDA 4I7FB 2ZM6J 3TNVA 4X62J 2UUBJ 4S0MA 1VK8A 1HQEB 2VG7A 1PBAA 3DOMA 1RHRB 4KFBA 5FD1A 2C2MB 1ZAVA 3CPWR 4M5IA 1HD1A 1Y0HA 3IBCB 4DSEA 3VTIA 3JSMB 2C3YA 4X66F 4A8WA 4DV6J 1LWCA 1M5HA 3BR9A 4O3QA 1LQ9A 2HQDA 1SJRA 4OZ1A 3N01A 1EQMA 3Q2SC 2W8KA 2EXUA 3CDAA 1T11A 2ZD1B 1T95A 1NKBA 1N5YA 2VU5A 4CO4A 3GP9A 4ZP6A 1S6QB 4HYKA 2YXLA 4HVZA 2ZFHA 3FSYA 4YUDA 2DGQA 3AA8A 3MM5B 1RISA 5EX3A 3T1YJ 2RILA 1AZSA 2HZVA 5LMUJ 5HBMA 1FNXH 3CMAS 4E0DA 2BM0A 4QYZJ 3D67A 3A8EA 4WFNQ 2OD4A 1S9GB 2NS1B 3VR1A 2I38A 1M5OC 2RU9A 4ED8A 3DI6A 1IN0A 3C16A 2DHHA 2HRUA 5K8NA 5IT4A 2K7KA 2R8GA 2IRUA 2GMJA 3CNQP 4OYBA 3D6MB 2C42A 1KQGB 2F9DA 3HCXA 5K5MA 2H4YB 4CH0S 3KDOA 1EZZB 3WIVA 2YKMA 1R0BG 1YJVA 1FFGB 4GVBB 3DLHA 3KG4A 3VHQA 2DGTA 3GCWP 3DOLA 5J2NA 2D3OR 3MD1A 2QN6B 3W64A 4I0WA 2E1RA 3CD7A 1EJ7L 2W1BA 2JC1A 4NYZA 4XAKA 5KFNA 3H4BA 2BR0A 3M8PB 4LF6F 4NZ7A 3LP0B 2DNLA 2XC9A 3GV8B 1SIZA 2DD8S 5KFAA 4F67A 4URSA 5A2QY 1VQ6S 5M2RA 3R6LB 1KQSR 4U6PA 3L7UA 1IKYA 3HULA 4V19X 5FDLA 3FZBA 1X60A 4LF8F 3SI8A 3O3LA 1HPZA 3LAMA 5FIIA 1F60B 1Q86T 2DKOB 3TQEA 1RTHB 1D3WA 2W9CB 2WSCC 3UR0A 3W63A 3PXGa 2AIRB 3RBZA 1TP7A 2L3MA 4EMDA 4DFMA 2B9EA 4H4KC 4M8LA 3X1LB 2RF2B 4NLQA 3VVUA 1R6VA 2IC3B 3IFEA 1TUGB 2ERRA 2EG2A 4J9QA 2MZTA 4URGA 3BEGB 1S77D 4ZHRA 3W3SA 4IG0B 2BUNA 3PEJA 4MK9A 2HAFA 2X1GA 3SSRA 2FC8A 2HBZB 4H4OB 2CPDA 5JVGQ 1BHNA 5K9FA 2VICA 1LXNA 2G4BA 1ZM2A 1HYSA 3MEDA 1LXJA 1U1QA 5AE2A 2FHJA 4FS2A 4B3MF 1TL1A 2YNGB 3TZWA 5SZTA 1NSPA 1TFYA 1S1XB 4KY3A 1HMVB 4M5MA 3FDSA 2KM8C 2IBKA 3W2WA 3QNWB 1YDLA 2EBEA 1SL2A 4RW9A 4DV3F 3DXBA 4YHHF 2UVUA 1RZMA 3Q86A 2AYEA 2PN6A 4EBDA 4P2XA 2XSJA 4QBUA 4WTYA 3ITHB 1JMTA 4AYBD 2JNJA 5KFGA 2I2YA 3KJQB 1ZA2B 2GJFA 2P9GA 3MTKA 5CYQB 4IRKA 3DLJA 4U96A 3W8PA 4FPIA 3CUNA 3AD8C 2MQOA 3D68A 4P72A 2GO9A 4BWJA 5EN1A 4LQ9A 2MKIA 4A8OA 3HVAA 2VFVA 2DNPA 3LA0A 2IHR1 4B3OA 1WG4A 1MMDA 4WXWA 4Y2AA 1VLYA 1C4AA 3HKWA 2HVZA 2W25A 1JJ2R 2EFVA 4OI3A 4KHPF 1RKJA 1UJ5A 2ZZMA 4OLOA 5EHHA 1R7IA 2J7KA 2FDNA 4ZVGA 1R0AB 2DGSA 4D3GA 4WIIA 4RNOA 1GMUA 2JLEA 4KE5A 3WIUA 4K2JA 4JI0F 4OX7A 1VRUB 4JUZA 4C0OC 3D1OA 3O6QA 3QWPA 3V81B 1KFDA 4NZ0A 1Q8BA 1JLBA 2BW2A 2GQCA 2C2OB 3C66A 1GTHA 2EWHA 2E44A 1S57A 4FP9A 1CBKA 2YWFA 2HNZB 3L9ZA 4DXLA 2DRBA 2E9TA 2B4UA 4I4BA 5J2MA 1Y5IB 3K5LA 4KSEB 3DGVA 5J1PA 5L1LA 4NE9C 1YRTA 1DARA 1NNDA 4LFBF 2R8KA 4F4ZA 3W66A 3J7YU 2BV3A 3LO3A 1HHSA 2E1MC 4F0KA 2PMHA 1N54B 1W25A 5B0GA 1RI7A 3K57A 4Y28C 1NK8A 2KL8A 4RW8A 3NG8A 3PO5A 3ZFVA 3Q89A 3QIPB 3HFKA 3LPYA 1S76D 3E01B 1C1CB 1JQGA 3BO4A 4C8NA 1LK5A 3B6BA 2JFDA 1U47A 2BBEA 3OR1A 3ULHA 4TU8A 2XCPA 4MFBB 1ELOA 5KT6A 1YK9A 1HNXJ 3SCIE 4IOAQ 2IVMA 4IUFA 2QMXA 1LWEA 5J2PA 4G65A 5DLFA 4X64J 1T02A 4RX6A 3MM8A 4ZJLA 4XO0A 4CZCA 1UPPA 3Q8UA 2ROGA 2B0GA 2M8HA 1U25A 5C7PA 4RU9A 1NKEA 2Y1IA 1IBMF 2ZH2A 2VL1A 4FZVA 2JSXA 3CC7S 2BJ1A 4L74A 3AODA 2RU3A 1X9WA 5KFVA 3SFUA 2VFRA 3I9V9 2VG5A 2G0JA 1WF2A 2A3JA 1SPBP 4LFCF 3AAWB 2LEPA 1U1PA 4WFYA 1ZPWX 4Y34A 2VKZG 3AB2B 1N33J 1DHMA 3NWRA 1GX6A 1UVNA 3DOKA 5K8MA 4DSLA 1TAUA 2GGPA 4C11A 1IJEB 3EYZA 4IFYB 1C0UB 4PKDB 1GTEA 2FTRA 4X65J 3TVZA 5IV3A 2JOQA 1LOUA 3CDEA 5EUHA 1JWWA 3BREA 3GIIA 1E6YB 1FKPA 4DU7A 3HHLD 3QLHA 3AD9C 4DF8A 1SUQB 3HZEA 1QUVA 3PW5A 1B0VA 1GAOA 3EGVA 3HXMA 3PM9A 2G2OA 3M4XA 3UDVA 2HZAA 1VI7A 3M8QB 2RKIB 4DV4F 1EHWA 2MQQA 1AFJA 1IXKA 2CWKA 4K4UA 1V5IB 2UXDJ 3KJFB 1IBKJ 3FFIB 4DFPA 2BJEA 3MEGA 2F40A 1OMSA 1TVRA 4QR2A 2HIQA 4I69A 4EYHB 1CULA 4UW2A 3CCQS 4K4ZA 4JV5J 2PEHA 2AGQA 2NZ4A 1K8AT 3D7SB 2QSWA 1NPRA 4RU2A 2NREA 3AA9A 1SC3B 4JP8A 3UN2A 4IOCQ 2ATLA 4C8MA 3LWLA 4DSKA 3HFVA 2GMLA 3OPKA 2AHOB 3ZZUA 1HWKA 2MQMA 2VIHA 4OZNA 1Q95G 2ILYA 1YJTA 4MIBA 2ZH6A 5DDRC 2H65B 4CYUB 5CYMB 2CG8A 3P5TL 3NXZA 1S9EB 1IKWB 2O66A 2R3VA 2FLNA 3M8ZA 4DX5A 3UD3P 4BDPA 3N0VA 2VZ9A 1X5SA 3GCXP 2MZSA 2ZZTA 3IG1B 2RQCA 4AUKA 3NNHA 3DRPA 1RAIB 3HHNB 3UVJB 4ZPVR 2UXCJ 2N3OA 3PX0A 3A8IA 1T8EA 4YY3J 2QA2A 2E5JA 2J9EA 3VAFA 3HD2A 1RHUB 4PXCA 2P9EA 2Z8QA 3RR8A 1HW8A 3TAPA 4JBCA 3PKYA 3SEOA 2L9DA 2V2QA 3RG6A 2W2QP 3TARA 2NLWA 2Z0GA 5BYSA 2GO8A 1W26A 3D1HA 2XY5A 2GMHA 5AE1A 4R0EA 3SCJE 3KK1B 4LREA 3ILOA 2OEMA 2AEFA 4NCAA 3TWZA 2BVZA 4NLUA 1Q1KA 4WP8A 2JRSA 4RWXA 3DRYA 1V5VA 4X4QA 1TUVA 2FZGB 2GA7A 2QRRA 2LQ8A 4O3NA 2AGPA 1EQ0A 3H2UB 6FDRA 2VBXA 4F2SA 4CDIA 3OV7A 1WJ9A 1XMQJ 4TU7A 1HHTP 2R7WA 4WE1A 5M2PA 2D9PA 2QLJB 5DS7A 2X1FA 1NLKL 3GR1A 2ZUGA 5DGAA 4DSJA 4P52A 1NJWA 3GB0A 3RB6A 1IKXA 1EP4B 2KT3A 1RU1A 5G4DA 3UDEA 5CXTA 5F3TA 4WFBQ 1UZHA 2ZC4A 3W9HA 1SJ1A 1I51B 4DR6J 1YSJA 2XO6A 3GLJA 4GO5X 3NBPB 1PO6A 3OD2A 4KQZA 3UFCX 1HNWF 1XMBA 1NSQA 3N6NA 1FNOA 3ISNC 4PZVA 1N88A 4IH5A 2GJ2A 2ZKTA 1VC0A 3M6WA 4USHA 2DGVA 4NXMJ 5KFKA 2WSFC 3JSMA 2KRBA 2K8GA 2N7CA 4HLBA 3KUGA 2DHAA 1SB6A 2VFSA 4CTAB 1T7PA 4MK7A 3O44A 5C2GA 2YNHB 3CVKA 2XZDB 1UZDA 2DXDA 4RUAA 1JIHA 3PX4A 4PAAA 1MLAA 1KOHA 4M95A 3W2VA 2ZJPQ 3P5BP 3BDEA 2ZD1A 2V4RA 1YJ7A 1YGYA 4AT1B 1RXOB 3R7SB 4Z37A 1Y00A 3CT9A 2V8PA 4X84A 1BWVA 1ROFA 3OFHA 3OT9A 4EYIB 2XNRA 2R42A 2OFGX 4OX9J 1NRKA 1S1UB 1XR5A 3QSYB 3MCSA 5CYJA 4YN3B 4QIEA 5A2QU 4K4XA 3ZXWA 2RQMA 1NSAA 1WDDA 3M2UB 2ALZA 5K8PA 1FRKA 1S9GA 1FDNA 2HVEA 2HURA 1RUSA 2I9SA 2GAHC 1RWVB 1T9TA 3Q8RB 2HKEA 3Q24A 2V94A 1MWZA 3SXLA 3DHWC 2V67A 3BV8A 4RZRA 4ENOA 2ZITA 4DEZA 1Y5LB 1OYDA 3BQ2A 1PSDA 3D3CJ 4FDFA 2J0WA 5K14B 5D6GA 2W4CA 2HFUA 1R27B 3FCHA 5I3QA 3FQKA 1R8BA 2AW0A 1VJWA 2V2KA 3FSIA 3I87A 1KTQA 2KKHA 1Z4UA 5D4LA 1ITPA 2HPUA 3E2EA 3CDWA 4Q44A 3CMES 2LDIA 2D7SA 4MIWA 1IM4A 1YX2A 3KUEA 1FXDA 3LP0A 3FMBA 4A8QA 3DRRB 2EBGA 3HSJA 1RT5A 1OY9A 3BSCA 3DDKA 2AX1A 2E5IA 3BGRB 4TQRA 2RRBA 1U6FA 3THVA 4KH0B 3OJSA 3IS9B 4RPFA 4FF4A 3H5XA 3GSIA 3SQOP 1X4EA 3BKTA 1HBOA 2H51B 3VVTA 2E1PA 1ULRA 3UDCA 3C46A 5ETMA 4M5LA 1Q82T 1S59A 2L48A 2F4VJ 1ZH5A 4C3MA 5CD4H 4JI5J 2V50A 1RTHA 2OPPB 1PGZA 1FNMA 5EWGA 4ES1A 3W5YA 3T5KA 2BDPA 4R5PB 5MAOA 1NH7A 2BOPA 2WB4A 5AXNA 1PJ5A 3B4DA 3H2LA 1QAXA 2B6AA 3QT6A 2IC3A 3UI3A 4DCOB 1HHQA 3GPAA 1RT1B 1QSLA 5B0AA 3VAIA 4QW9A 4P10A 1FJ7A 3VGVA 3SYZA 3AXKA 2MTLA 1NZAA 4F4XA 1WF0A 1RADB 2R8HA 3NMRA 1N0VC 1AYEA 2HFOA 3VV2B 4ED5A 1MMLA 2HVDA 3K7RA 1X0FA 3MR7A 3MM9A 4YB1P 4DPYA 1XNRF 5AXLA 1YIJS 1NK4A 2YNGA 5AXMA 1IJFB 4JYAF 5C25A 1HFEL 2M70A 3P6YC 1S1XA 2XM3A 4DR5F 1KWMA 3KLEA 2IVYA 5I3PA 2MLYA 3MM6B 3FEXB 4NLTA 2CPJA 2PGCA 2VH7A 3QZ7A 3Q2TC 4XK8C 1YVFA 3I82A 3UPFA 3HSDA 2LMIA 1BQMB 4AE5A 2UVVA 2ZOMA 4KTQA 4DZDA 1L3SA 3G9CA 4B08A 1UVKA 2FVQA 4DX8H 1FI4A 3RB4A 4OI1A 4QWCA 1T9WA 3RAQA 2MQNA 5LT5A 4ECWA 1NZ8A 4LRDA 3KMQA 4CO3A 1H7WA 4JI1F 5GAEU 4RO0A 3ICLA 3EX7B 2BKOA 3G87A 4TKTA 1YJWS 3RW6A 2IBOA 2KU7A 1R31A 4IRCA 4U7UD 5KG7A 1VQOS 1RAEB 3KLIA 3US5A 3HJFA 3D2WA 2IFXA 7FDRA 3JTOA 1SC1B 3GJTB 1R0AA 4OV1A 5ETPA 3AOBA 1VRUA 3JSYA 1SBRA 4DFKA 2EK6A 3OBIA 2VB6A 2GCFA 1WKKA 2RB7A 1NDPA 1IR0A 4NLSA 2OJ3A 2DT9A 4RR5A 4DFJA 2KXNB 2YKNB 1S72S 1NCLA 3KWMA 1APSA 4ZCLA 3EMTA 4O23A 2YVSA 4O4GB 4ED2A 2HQCA 2Q3PA 4OJGA 1FE4A 5HQMA 4HT7A 5LL6d 3SMZA 1OWXA 3S01A 5THWA 4ECQA 4OX6A 1X5PA 2VQEJ 3NP5A 4DR4F 2CQDA 5L46A 1Q5YA 2J76E 1FFSB 4MTPA 3BKFA 2YKOA 1UVMA 4K8RA 1RE1B 1HWJA 8ATCB 1C1CA 4RUCA 2H5EA 1SH3A 2OO4A 4TU9A 4MFBA 1RT2B 1VRQC 4YB6A 2DPIA 2WTFA 2QG9B 4DMZA 2IAJB 3OW2R 1HNZF 1JXEA 4DL4A 1TKZB 2NR0A 2FD2A 2KO1A 2YWHA 3PW0A 4NRTA 4UQGA 5DG7A 3U1NA 5E7OB 3EGNA 4WKYA 3FCVA 1L3TA 4JI4F 3OVSA 4V19J 4NEYA 2KYXA 2FYXA 3MECB 1QTNB 2CUYA 3TZYA 1I6JA 3FVYA 3Q8QB 1N6QA 2YWGA 4ZDNA 3OTEA 3EUNA 4HL9A 1LFPA 5GAGU 3IWNC 4Y2CA 2AX0A 1YQHA 1TUWA 1RBLA 2AP6A 2NZCA 1C0UA 1IR2A 4I6WA 5C24B 1TAQA 4Q8FA 1O8BA 4UZCA 2W9BA 1B70B 3W1YC 4KGXB 3TRGA 1RSCA 1CC7A 5KFTA 4FXVA 5LSRA 3QQCD 1X4HA 3D6FB 4CP5A 3OFGA 1RT6B 1CSJA 4U8YA 1Y9OA 4TY8A 1SUQA 5F9LA 2IM1A 4MK8A 2HEKA 4GO7X 2UVRA 1U7LA 2DNQA 5KFJA 1TL3B 2ILZA 1VBKA 3SZ2A 1SVDA 1UA1A 1K9MT 2RKIA 1XK8A 1PYOB 2DB1A 3H90A 4DR1J 3LGHA 4LRCA 4DQPA 1M5SA 1ZBTA 4K7QA 4HACB 2LQ9A 1IQZA 2X7IA 3Q8VA 3WBZA 4ZVPB 3FBBA 5HL7Q 5ETKA 2M52A 2AD9A 3C14A 1RWOB 3IRXB 4IG3A 2DIUA 2JLFA 3R27A 3VQTA 2IM0A 1HIYA 4XPEA 3KLGA 2FY8A 4A8FA 2AWZA 4QPTA 3CO0P 4E98A 2L9NA 5B0DA 3EJMA 2C28A 4OLPA 4C7QA 4CH1A 1N36F 1KR4A 3MPVA 3CF5Q 4DBQA 5ADZA 1MROB 5EX0A 2CQ3A 4OMFG 4GC6A 4ANDA 3KFWX 2F7VA 1CC8A 1URRA 4LF6J 4QR0A 3V2UC 3QGHA 4DLGA 1DURA 3ET6B 2CQ2A 4RW7B 1TELA 5AJ3F 2ZDOA 5T7LB 1S9EA 1IKWA 2OPSB 3K5OA 3KG0A 1S6PB 2O5DA 4GRSA 1T9UA 3Q83A 1V3RA 2Z2LA 4KO0B 3DMJA 3QT7A 3AFGA 5F8JA 2KM8B 1NK5A 2MQLA 2X3DA 3BO3A 3RRGA 4F02A 4PXEA 2OSQA 1C2PA 2MEWA 1WHYA 1HBMA 3I56S 5KG2A 3KTQA 3DKDA 1VHFA 3SDEB 1KLMB 3PRBA 3HPOA 4LF8J 4DDFA 1HW9A 1RTDB 3QPIA 2CJ9A 5LJ5Y 2KT5A 4ETZA 1LNQA 5M2UA 2DNKA 1NM2A 3QO9B 2HHHJ 4GC7A 5DQIA 2HNDB 4LIRA 4MYUA 4ES2A 2E1AA 4K4YA 1QVGR 2EFOA 1I94J 3PKMA 2VG7B 4NXNF 1TKXB 4IFVB 3DOMB 5JUMA 1FRJA 3DHXA 3KK1A 2UUCJ 1MU2A 2J8AA 2PI4A 3B4MA 1QAJA 3MOZA 1UFLA 4J9SA 2A1BA 3ZTRA 3TVKA 2C3MA 4QU7A 2FHMA 3HM9A 2Z4PA 3HT3A 4RKUC 4HEA9 3NS6A 2RHSB 3BH6B 1LWCB 2LP4A 3JB9k 2R7TA 3NGKA 4ZN3A 3BPDA 1XEZA 3LGMA 2MKHA 5C42A 5HSPA 1N5YB 2R8IA 2DEJA 1J27A 4UQTA 1PC4A 2M3DA 3HZGA 2G0CA 2DH9A 4KKOA 2J8SA 2AQ4A 4B3MJ 2H5JB 1VHIA 3W7BA 2M7SA 1PBUA 4RBUA 2SXLA 3R5AA 4QIWD 2V4QA 1TL7B 2DNYA 2C22A 5HBMB 1HBNA 2RAQA 2G2YA 2VJVA 1UWBA 3VCDA 4DPXA 1M1HA 2B4PA 2AKWB 4YHHJ 3NBPA 5L8RC 4NCGB 1WG5A 3C16B 2OUGA 3WX8A 4DV0J 5BXIA 4I2QA 4ZVFA 1BQNA 4PPDA 4DSIA 2QV6A 2FHJD 3CC4S 1SCJB 5HROB 3NKYA 1OPZA 3HHEA 3UR3C 2YKMB 1F5CA 3C8YA 2KFYA 4LR9A 3FKBA 4M5JA 1A0OB 4F0HA 2IYGA 4DLEA 2O3DA 2A10A 5DO2A 3CJ0A 1MW7A 2G1DA 3DDNA 4JV1A 3DOLB 3NNAA 1YJUA 5D3GA 1QAIA 2HHVA 1IWGA 1RACB 1P1LA 1U49A 1DJ0A 4IKAA 3P49B 1MSWD 1T9YA 3LP2A 4JI0J 1VBZA 1N32F 2DK2A 3PACA 4R8UB 1OYEA 4F3QA 4AQYF 4C6AA 1DQAA 3D54A 3M2UA 2M9KA 1LK7A 3Q23A 3FMWA 4LMZA 4DR7F 4ANEA 5L39A 2E1CA 4JI2F 2I0XA 5G0RB 3C2PA 4P74A 1LW2A 1CJTA 4I67A 1B64A 1T03A 1PAEX 2V8GA 2XMVA 1IKYB 5FDLB 3VQSA 1PYSB 4USJC 3KHHA 3CULA 1RBAA 2ACMA 1U0SA 4IH6A 2WVEA 1X5OA 5ETQA 1S7IA 2ZOGA 2JHEA 2QC3A 2O1PA 1HPZB 2DGWA 2F63A 5K14A 4ECVA 2OFHX 5DQHA 3D0HE 3TX8A 3QAEA 4ECUA 5F8MA 3DLKA 3KLVA 6FD1A 4CI0B 2RUSA 2YH1A 4PG7A 3TR5A 2R7SA 1OO0B 5ITHA 1JLFB 3A3PB 5A6PA 3NGDA 3QIDA 4F4WA 2JVOA 2CPYA 3BM7A 4ZHRB 2HHXA 4NRUA 2MB0B 5HMXA 2VPZB 3MFIA 3DRRA 4C4WA 4KHRA 2CFXA 4AXIA 1WD6A 3BGRA 3PG9A 2DHGA 2NCKL 3MEEB 1AA1B 3G2XA 1N34J 1HYSB 2QSFA 3Q8SB 3MEDB 4FBTA 3IS9A 4NI2B 4USMA 2VF3A 1NKCA 1EX8A 1TL1B 3GIKA 1SIWB 4A8YA 3GJSB 2QA4S 1KVIA 3NMAA 1HNVB 4DUYF 3I96A 2DH7A 2B4OA 4LJMA 3W2WB 4M5GA 4Y3CA 3H2VE 2OPPA 1H38A 2Q43A 4RW9B 2OPQB 5RUBA 2C2DA 2QIFA 4C8YA 2CQ4A 3D66A 2C3OA 3OTBA 1WORA 2J0QD 2XSJB 1DZ5A 4W4MA 1UEKA 2QTWA 2EVZA 1UJ4A 1UVJA 3GJRB 2OMOA 2RT3A 3PFEA 4Z7YA 4JI7J 4N7TA 4ZA1A 2FJAB 3M2VA 4Q45A 1RAFB 4HH0A 1FXLA 1TMJA 4G3IA 2CIMA 3J81U 3RZAA 4WYLA 4NL5A 1U45A 1B99A 3THTA 4FF1A 4Q0BB 3CO9A 1HL6A 2ZE2B 3FUYA 4DV7F 2XB2D 4FVCA 4OIXA 1OPIA 1S7HA 3C6UA 3OTCA 3GYNA 4JI6F 2RDDA 1S1VB 4DUTA 2J6SA 3OFEA 1K44A 1RTIA 2LU1A 3TAQA 2Z57B 1WHVA 3WC2A 2VKRA 4PYDA 2EKNA 3MTJA 1JB0C 5CABA 2ZEJA 2VPWB 5DDQC 4PWDB 1JJHA 3CCUS 1HQ2A 2NUUG 3MM6A 3JAMY 4OI0A 3C6TB 1UA0A 1JLBB 2M2BA 1BQMA 2F4FA 1C1BA 2P8IA 3H4DA 4O3OA 3IN5A 2H3EB 1R8AA 4HDHA 4B3RJ 2UU9J 1JLQB 1SH2A 4NYOA 1S0VA 5IC4B 2GHVC 5J2MB 3M8WA 3R7NB 3PJWA 4K0KF 1XTZA 2ZM6F 2HAIA 3PCOB 4X62F 1H98A 4HT5A 2UUBF 2JEIA 2CJQA 4UOFA 1VIXA 4ZLPA 3A13A 3DLGA 2HRYA 2LVWA 4EBCA 2ZBPA 1WC4A 3DLEA 1L3VA 2B51A 1HI0P 1KD1T 1R6YA 4KIAA 1JLGA 1GK8A 2G1HA 3MF5A 3P3DA 4OYXA 3EVOA 4RW8B 5ETOA 2FLPA 3H42A 4YS2A 1RBOB 4DV6F 3RB3A 1ZM4A 4NLRA 3H20A 4NLWA 3BYRA 4OYMA 2GIQA 1L3UA 2XG8A 1WKJA 2FVSA 4AL7A 3RBDA 2HFSA 2XSFA 2KHDA 3BSAA 5HAOA 5LMNF 3I0SA 4RNHA 2G9OA 2ALYB 4USIA 4EUVA 2F9JA 2MY8A 4J9PA 4WBFA 3J80Y 4KAIA 4IR1A 3T1YF 5LMUF 4OJ3A 2YKNA 1LKZA 4LF4J 3D6TB 5EDWA 4WXOA 3Q0AA 3R9LA 2K3IA 4HDGA 3BQ0A 3HLUA 3TVYA 4ZK7M 4ANCA 2A2DA 2VG5B 4KJIA 3ZTPA 1MWYA 2BQUA 1WNEA 2WVCA 2I1RA 5HQLA 4CO0A 3H5YA 3QRRA 3BBFA 1AXQA 4DSFA 5EWEA 3CCTA 4DL6A 2LYVA 4LBIA 4BCAA 3M32B 2KHCA 4U9RA 2YKQA 4O44B 3DOKB 4USKA 2ZH8A 1FA0A 3GG0A 4K5SA 2W7AA 3VF0B 2VD3A 1D8YA 2GGPB 4C11B 4Q8EA 2AJ0A 2PFDA 3I5AA 5KFRA 5HJYA 1FHTA 3AOCA 4KGZB 2CYYA 2UUAF 1U1LA 1RT2A 1FKPB 1QVFR 3BJYA 2R4FA 1FFWB 5D77A 3VALA 3OJUA 1FVQA 2JJ4D 4XDCA 3T6JA 2Z56B 2MSSA 5HATA 2KTQA 3G6ES 1MWQA 2MHEA 4NOHA 8AT1B 2FVRA 4ZP7A 2FJDB 1JKHA 3MEGB 1PJ7A 1GT8A 3AOAA 3VWSA 1Q7LB 2B4VA 4RUHA 1CULB 1VRTA 3EICA 5B0FA 3MECA 1MG7A 4FKYA 4O3SA 2CJAA 1YJRA 2MQ8A 4P9SA 5GADI 1H6KX 2RNEA 5CQGA 2LA4A 4QWBA 3KYLA 3QJJA 5KTQA 2NPFA 2WVBA 3FBCA 4YFUA 4YQWA 2DCLA 1VQYA 3AT1B 4LF2A 5C24A 1Q78A 4KYZA 4OYPA 2V63A 2XMTA 4DCPB 4CCHA 4N8OA 3C19A 1BGXT 3GTYX 3H8YA 1RT6A 3BH7B 2WSEC 3BR8A 3O8WA 1LW0B 4YDDB 3L4BC 2EK1A 5LM7E 3OUYB 4Q2LA 2HFZA 3BB5A 4KRWA 5JVHQ 3M7VA 1NO8A 2DEIA 1OIAA 2M8DB 2VASA 3DRPB 3UWTA 1S97A 3MPDA 2QX0A 4Z2XA 5D4OA 1BXNA 5KG0A 2E5LJ 4FXDA 1JXLA 3SBMA 4F3MA 5IQ6A 3IRXA 2RE1A 1N52B 4H4KA 4WZMA 3IBFB 4TXSA 3VAHA 1RAJA 4ECRA 1WC6A 2GHPA 1FDDA 2CQCA 1S0OA 3TZXA 3C15A 2CQPA 2LQJA 2FHOB 2PA8D 3M1VB 4J9UE 3WC0A 3TAMB 4B9SA 3ZZZA 4G1QA 1ACMB 2B7CB 3GYXB 1M1KT 4G1IA 2Q6BA 2D1CA 3DGPB 2U2FA 4RW7A 3CTRA 3MOJB 2OPSA 2NYHA 1S6PA 2A0FB 3OTOJ 3BZQA 3PHEA 4MT1A 3PX6A 4RW4B 2YNFA 4KO0A 5AXKA 2DY9A 4IQXA 2EC0A 2CNNB 3DXSX 5KT5A 4BBYA 2HHPA 4WE1B 2CQ0A 4X4RA 2ZVSA 1NU4A 1NK9A 3B8HA 4FKXA 1HNIB 3LH2S 1QY7A 4N56A 5IT0A 2HBRB 2UXBJ 5BJRA 1X4BA 1RTDA 4OYZA 1M90T 2W4PA 2BE9B 4Y0FA 5ETTA 2ZNYA 3AJDA 3I5BA 1REGX 1EAYC 2W2PP 2KXHA 1YBUA 1Q5VA 2OPRB 2W8LA 4DZ6A 5IT9Y 1TKXA 4IFVA 3T1HF 2HHTA 1XMOJ 4J90A 4CLZA 3GFXA 2OTJS 1FERA 4ZMMA 4LSLA 2FIUA 1X5TA 3CIZA 3MEKA 3D3BJ 1NBEB 2K1RB 2DNGA 3S1TA 4RNNA 2ABYA 3PEHA 2HQGA 3W2VB 4OFZA 1H2TZ 3HFZB 4Q5VA 1UETA 4DV2J 3R7BB 3BSNA 3HK2A 4YB5A 4DPWA 1CEZA 1XNRJ 2LLZA 4DV1J 4MKVA 1NXIA 2AGOA 3OXGA 4KR0B 1DLOA 3G6YA 3R2CJ 2VG6A 1WI6A 4BLGA 3K59A 1Y7PA 4DR5J 1TL7A 3QBCA 3AJ2A 2HRTA 1N5QA 4JI8J 1KONA 2XTJP 1WC3A 1NJYA 4EO8A 3QFHA 4ED3A 2PFFB 1U6ZA 3Q8PB 4Q43A 4PXDA 3CC2S 5D0EA 1SI9A 4USTA 4LRBA 1HNXF 3HI9A 4NCGA 2W7PA 3PRDA 1NDKA 2K2PA 3PTWA 3CJRA 2R7RA 1ZETA 2DGXA 3R8YA 4DR3F 5H9FK 4C8ZA 1S1TB 2PI5A 5HROA 5KFQA 3DLLQ 1SKSA 1WEXA 5L9NA 2WONA 3OL7A 2HHQA 1ZZNA 1H0HB 1G1XA 1VLOA 3QATA 4GKJJ 4NLOA 2NPIA 2XS2A 4F7VA 3OR2A 4CO5A 4OHZA 3CE8A 4CLKA 3NCQA 3RAMA 2GVDB 1H7XA 1G4CA 3POTB 4KH1B 4YR2A 2ASYA 2IM2A 1N33F 4D3HA 2XNQA 2W2OP 1ZA1B 4DL5A 4L3KA 3DFEA 4N47A 4DWIA 2JC0A 4R8UA 1UTAA 4PG4A 3IO1A 3M6UA 4DR2J 1RT5B 4B3TJ 5D0GA 4X65F 4ERDA 3U02A 4USVA 1SV5A 4ECZA 5G0RA 3MMBB 2QMWA 1FCAA 2QLBB 4OYOA 1REVA 2CPXA 5A8WB 4H54A 2K3KA 1RTJA 1HBOB 4Q7AA 3KLFA 1WTBA 3IM8A 2VA3A 4ZS6A 1RWWB 4MKYA 3V4MA 2UXDF 1P6TA 3TJAA 4K4WA 3R3TA 3OL6A 2IRXA 4NA2A 3EVWA 4C0BA 2JH3A 2PEBA 4JV5F 3HX9A 3HP6A 4F50A 3G82B 2BXJA 1JLCA 3M30B 2R8JA 1JLFA 2B6AB 2BANB 5T14A 1KEKA 4ELVA 4L76A 3G4SS 1JXVA 3CW2C 4ED1A 1HBUB 4ZPTR 4JI3J 2ZBCA 1NK6A 2N4CA 3KMSA 3NLCA 5HMZA 5F8GA 1RWUA 3MEEA 4MKAA 3IR5B 3FRYA 1KFSA 3KK2B 4C9DA 4LSNB 1B0TA 2CZ9A 3MM9B 2WCXA 3BF4A 3NOGA 4NI2A 3QRQA 1RP5A 4HHHA 2BACA 4JI4J 3GYGA 4W92B 3P4UB 5C25B 1QD1A 1HNVA 3NS5A 1T3NA 1Q7YT 3ISZA 2LXFA 3KLEB 5KOXA 4QQBA 4B9LA 4DN9A 4YOEA 5F0UA 1HR0J 2I8EA 1X4DA 1GXLA 4H4MA 2OPQA 3RJMB 3ZTOA 2W24A 1DTTA 5DG9A 2V8HA 3LW5C 3ETMA 2BX6A 2V4JA 4B3SJ 1GXTA 2W4DA 2E7XA 4J5OA 1HQUA 2CQGA 1U0HB 1RK8A 4QCLA 1X9SA 3IP0A 3BBCA 1FKAF 2CAJA 2HS3A 2I6WA 5L38A 1RLCL 4Q0BA 1OQ6A 4F4YA 3FGVA 1RA6A 2ZE2A 1FRIA 2GC8A 5HQ8A 2HHWA 1YZ7A 4ECSA 2DR5A 4CRJA 3KLIB 4F8RA 1S1VA 2HBYB 5JMNA 2JVRA 2IMWP 1F5BA 2MKYA 1KVJA 3ZZPA 4QYZK 2HFNA 3MM7B 1V3SA 2VHGA 4PWDA 4WZQA 4WFAQ 2MLXA 4AL6A 1J5EJ 3C6TA 4C8LA 1H72C 2ZDPA 1N0UA 1IKVB 3EZUA 3A12A 1RTZA 4C8KA 1F0XA 4HTIA 4JV0A 1JLQA 5HJXA 2BEFA 1VC5A 2ADCA 2QA1A 1VIOA 3LTOA 4NASA 4RW6A 2PC6A 3G8QA 1WWHA 1HD0A 4DR6F 4Y00A 1O5JA 1EETB 2Y0BB 2JFKA 1QSYA 2QFJA 3I4HX 3K17A 2CKWA 3NY0A 1KS2A 5DDPC 5KT3A 1FJEB 3PO4A 3IAM9 4DOZA 1FWKA 3FEYB 4NXMF 4A8XA 1UVLA 4ELTA 4B9UA 2FJBB 1UPMB 1R8HA 3FQLA 3UN5A 2YNIB 2J7WA 5KFDA 2AJ2A 4DU8A 2DR8A 3HHLC 2V9KA 4JV2A 5DLGA 4IO1A 1ZS6A 3K2YA 2HGNA 4OHVA 3HVRA 3KNAA 4TLQA 4P2MA 3H5UA 2R7XA 2DNMA 2ZBIA 4DQRA 2QO3A 2Z30B 3G8SA 3EXCX 1I5OB 3GONA 1T05B 2E66A 2E5GA 2CJBA 4XDDA 1WC1A 1WTFA 1TV6B 4AXJA 1EIYB 2Q79A 4I6AA 3JSBA 1U24A 3FZ2A 2EKYA 3O1LA 4ILRA 2PMWA 2IJRA 2JEJA 2P6SA 2DIVA 3OL9A 2GVZB 1ZTTA 3IXQA 4A48A 4QIGA 4BS2A 3LOUA 3IGNA 5D0RA 1V9OA 1N6QB 4IH7A 3M32A 4FYDA 3V6HA 2IPOB 3KJNB 6AT1B 1B0PA 4O44A 2XHCA 3T1AA 1VQ8S 4FS1A 1DRZA 1AUSL 2UV8G 2XGQA 1URNA 4WTOB 2W9BB 2A6OA 2BE7D 1S0NA 1NHKL 1RT7A 5KFOA 1D9DA 2VDIA 3MCNA 1GH8A 4CLPA 3CEDA 2ZZNA 3G6XA 1D8ZA 4WIQA 3UN3A 4TY8B 4HHJA 4CLYA 5IWAJ 3PYEA 4CH7A 1N4LA 1Y3JA 1VISA 3AXMA 3A8JA 2XI3A 5LSLA 4PQUA 3BGFA 5KT4A 1KOOA 2JL9A 3KHGA 3NS7B 2HNYA 4DI6A 3LP1B 3C14B 3LAKA 1U1RA 3TEGA 4QIFA 3IC1A 1RCOB 4IG3B 4OQJA 2O01C 1EB0A 3PHTA 2KG1A 1TK0A 2OEKA 3KLGB 4HH1A 1H3DA 1TU0B 1YBAA 3EDQB 2CRLA 4DUZF 4L75A 2N4DA 2UV8A 4K50A 3MD3A 2A18A 1CJUB 2GAGC 3I31A 3N28A 1NPPA 4J37A 3T3FA 4NMLA 1OSDA 4ZN1A 2WHOA 3M6VA 4JI5F 5KFBA 2Z58B 2W2NP 4LFAJ 3HHKA 4O0NA 1N32J 5HI7A 4X2BA 1H2VZ 5IZHA 5I3UB 1WC5A 1LW0A 5J2QA 3MMJA 4QPXA 4NYPA 3BSOA 1S99A 2HWHA 2MJNA 5A76A 4DX7A 2XMUA 3OUYA 3DMJB 4USUA 1U2CA 2VQFF 5DETA 3KXDA 3H0PA 3UCGA 2J9DA 2WW4A 3TA1A 2V5HG 1LWFA 1WACA 2H5IB 2YX1A 4JB8B 4FYXB 3MR6A 5IQQA 1HBMB 4ILMA 4KB7A 5ETVA 2V8DA 4X4UA 1FX2A 2JEGA 3FNNA 3CD0A 3DM2A 1TKTB 5H9EK 4LIWA 2XWYA 5KFUA 1O6XA 3J7ZT 1NHUA 1VQ4S 3PJ9A 3AQPA 5HVGA 1IBLJ 1FT8A 2ZH5A 2MLZA 2B9XA 2R2SA 3M1VA 3JQJA 3F41A 4NLGA 3TAMA 5H9FJ 1MU2B 3S8SA 3PRVA 2CPZA 2CG4A 1KQFB 4KHMA 1RU2A 5L9XA 5ETRA 4OL8A 3MAHA 3DGPA 3RR7A 3T5LA 3MMAA 4OJHA 2ZJQQ 4J9NA 4RW4A 3CJKA 2ZBRA 4K5RA 2W7OA 4U7UK 3NGSA 3PYGA 5C42B 2KVQE 2BJ8A 3CJ4A 2FGCA 4KKOB 2ZH1A 4BC9A 3VZHA 1NK0A 1BQXA 5B0BA 3QGPA 3D6HB 4DV5F 1HNIA 5FLXY 4I1TA 1FDAA 4CWBA 4LF5J 4A46A 2ZOFA 1RT3A 3NAHA 2WVFA 4EU0A 1RHJB 4QYRA 1HBNB 1T3OA 2ZKUA 1V3ZA 3CB4A 3KG1A 1UWBB 2M88A 1NH8A 5GMEA 4CLTA 3S7RA 2KJWA 2B56A 1VQLS 3R5JB 1ZOTA 2OPRA 4NA3A 1DAXA 5IS2A 3GV5B 2FLOA 2X1BA 3DYAA 2K7JA 4CM0A 2ZJRQ 4HHUA 4I2QB 1Q0NA 1BQNB 5HVHA 3MMCB 4F4KA 4U7CA 4LF7J 4WFXA 2G0IA 4LVNP 2DNZA 4ICLB 1Z2LA 5IC6B 2ROPA 1YHQS 1RHQB 3I55S 4EI2A 1SC4B 1U2RA 1CG2A 2K1RA 4PG6A 1VK3A 3OFFA 4WF9Q 2J5AA 4ZVEA 3M8SA 1AB8A 4DV7J 2VONA 5KAKA 3V6DB 4OV6A 4PG8A 2UP1A 3EWGA 1PYTA 4Y6IA 1Q4RA 2L41A 1QTMA 3G96A 4JI6J 5D3GB 2FVCA 1FJGJ 1SL0A 1M5VC 2POKA 3OVBA 3DU5A 4ZVTB 2VQEF 1XNQF 3UD5A 3RUBL 2QEXS 1H74A 1JLAB 3LP2B 2OKQA 1KBRA 4C2MA 4KPCA 2OLWA 1GXUA 3U1MA 1VS3A 2RMLA 2DISA 1YI2S 5IM0A 3F73A 1FTRA 1LW2B 1CJTB 2XWXA 4J7CA 2V0NA 2YQ0A 2CZ4A 1WDTA 2DXFA 2OELA 1U4BA 1T03B 3CCZA 4QWAA 1N48A 2C1EB 3SFGA 9ATCB 8RUCA 3FCWA 1U48A 2JEFA 1U09A 5A8RB 4K0KJ 5AE3A 1FESA 1F3FA 5CA5A 1W2BR 1QLNA 1S1TA 1U1OA 3VAJA 4N76A 4M5DB 3JSRA 4OYWA 1KKHA 5D8HB 3TI0A 2I5JA 1YJ9S 2YBVA 2Z2MA 3DLKB 4DF4A 4DJBA 4FF2A 5CCMA 1U1KA 3CJTA 3GU0A 4X4NA 2GVDA 1TQLA 3N9UC 3POTA 3K0JA 2CPEA 1IM6A 1N56A 3NWGA 1SJ3P 4HTJA 2MGZA 3DDIA 3SCKE 2MKCA 3DNCA 1B4SA 3A8KA 4EGLA 1MN9A 5SUHA 4PUOB 1KQKA 1UMJA 3GFZA 4J9VA 5LMNJ 2FC9A 2R2RA 3BYPA 3JYTA 4ECXA 1S49A 1SKRA 5LSOA 3MMBA 1U1NA 3TJ8A 2AJ1A 2VFTA 5ETNA 4Y65A 2PO4A 4EBEA 3WZ0A 2KFZA 3GIJA 1CJKA 3I5CA 5FJ4A 2FZKB 5A8WA 3SSSA 1HI8A 3MUMP 2EFPA 4KV8A 3K8VA 2R7OA 1H2UX 3J81j 3K5PA 3V5RA 1P27B 3M2RA 1JLEA 4DR1F 3N5FA 2RS2A 4YP3A 2E9RX 2X1AA 3BQ1A 2IDEA 4TVAB 4FNHA 3X3UA 3I4PA 3D1QA 2HQ3A 4OZ5A 2DRDA 1RKIA 2Z2ZA 1ZAXA 3G82A 2BE2A 2XO7A 3M30A 5KG4A 1LWXA 5DDOC 1N5TA 4C97A 2AYBA 2UUAJ 1FWPA 1S4EA 2BANA 3M2VB 3KOAA 2B43A 3HKZD 3ADAC 3NRBA 4UUWA 1YWXA 3V6KA 1HBUA 2B8PA 2KZMA 3T19A 3KHLA 2PD1A 1UFKA 1VQ9S 1X4CA 1DQ8A 2BM1A 3ILJA 4LR8A 1G6BA 2HW3A 1UCNA 2GZOA 4ZLNA 3ZC4A 3W9IA 3LUYA 3KK2A 4LSNA 3C6UB 2HMIA 3A3OB 2VUGA 1RTIB 1HI1A 3O5TB 1QE1B 4OHXA 4MJKA 4ZPBA 3J7YI 4MIAA 4GKKF 2KT2A 2PSZA 4ED6A 1KNZA 2QL7B 1VR6A 4YEAA 4ED4A 1WC0A 2AJQA 1HLWA 1U1MA 1EKRA 2FB0A 5KFIA 2MXYA 1C1BB 2BRLA 3IWXA 4C8OA 3E8OA 3OL8A 3PW2A 1RT4A 2HHHF 2DNRA 1U0HA 1U02A 3CCJS 2A2CA 2UUWA 4A8MP 1I94F 3ZNUA 3DLGB 1T9XA 2CQBA 2HWTA 2RSQA 1KTVA 2UUCF 2B8QA 3MPWA 4B9MA 3DLEB 3EM1A 2CDQA 4DPTA 1JLGB 4PABA 2HHUA 1UJ6A 2XMWA 4ZJOA 2C2KB 2OP5A 2WK4A 2KB2A 3ETOA 2LFVA 2M5YA 1TK5A 1GMVA 5A6WA 4KT0C 3LF0A 2N3LA 4ETXA 4DQSA 3ZTQA 4P7VA 3SV3A 3ELHA 2YX4A 2JLGA 3MM7A 4OHYA 2QLWA 4WP3A 3KHRA 3I0SB 3D5MA 1R8CA 3KJVB 3H40A 1IKVA 4KBIA 2F8HA 2Q66A 1WOOA 3HO1A 1YRUA 2ZH9A 5A0YB 1OJ4A 1PG5B 5KFEA 1IBCB 1RABB 3U7JA 4ATNA 3OSPA 3BS9A 1XC9A 2EPIA 1ZYQA 2EFGA 1EETA 4L73A 1F6TA 1T0TV 2F8MA 3PYDA 2XLKA 1J5OB 4LUBA 2CPHA 1SJFA 2BJ7A 4ZPCA 1G7CB 2CWXA 4J9MA 3QAUA 4DV0F 2R2TA 1XJWB 4P2SA 3TX0A 4Y2KA 4EWTA 3R6GB 3W5ZA 2D3O1 1U6BA 2YNIA 4DQQA 3QWUA 1NB7A 3TEHB 2BOAA 2MKSA 3DLBA 2O67A 4LF9J 5JJBA 4K4TA 1AFIA 4C3KA 5KG6A 4R0JA 2J7UA 2CADA 2XQCA 3TA2A 1T05A 2WBMA 1BY9A 5GAHI 2F1FA 3WHIA 1EKSA 1GMWA 1TV6A 3VAKA 1X4AA 1VOMA 3T1HJ 3ZZ0A 3LQVA 2EI5A 1NUEA 5H9EJ 1UEVA 1JKHB 2Q1LA 3D28A 1U8SA 2H9ZA 5KFCA 1VRTB 2GVZA 4X66J 1B3TA 2MYFA 2V8VA 1OSCA 2OIHA 3SQGA 4I2PA 3GFHA 1VQKS 3ENQA 3TQ1A 3HT0A 4AD6A 5CZVA 3TP2A 2N82B 2EFNA 3JS9A 5CCLA 2J6UA 4ID8A 3THPA 4PXBA 4X4OA 4L72B 4AFFA 2WBRA 2NXJA 2MZ1A 2CJXB 2LXUA 2MMYA 2QL5B 2A6MA 3MAQA 5JXSA 1FKOA 2QYCA 2QA4G 1VMBA 2YKAA 4IDKA 2AU0A 3O2IA 5E3AA 4CLSA 4DG1B 4CT9A 2FJWA 4ZCMA 2XMJA 5HMWA 1F9HA 1PKUA 3I0RB 4QWEA 3OLAA 4C0HA 3ZZOA 4LRFA 3PR5B 2C2RA 3VAGA 1L5UA 3DRXA 4X4PA 2DGUA 2Y8YA 1NJXA 1K47A 2DO4A 4DR3J 4TNOA 3CSKA 3R5BA 3LP1A 4URQU 2HBQB 3F56A 1GFWB 1N34F 4IO9Q 2FLLA 4GMKA 4EZ9A 5I4MA 4B02A 2CNLB 3RYLA 3C15B 4LBHA 3BBBA 3R1HA 3TZZA 1CJUA 5LOQA 3IWLA 2DO0A 1WEYA 1CS4A 3G6VA 3HVTA 4G1QB 3M8RA 4P75A 4OI6A 3ZZTA 1VQSA 3IR7B 2APOA 4PR6A 2GJIA 4ER8A 4OZLA 5I3UA 3J7AN 4O4RA 5HLFB 3RGIA 2E7WA 1FJCA 2ZNZA 3QT8A 2BW7A 4OI4A 4WCEQ 2YNFB 1S4FA 4JI7F 5B0EA 1Z1ZA 5FLXU 3KNGA 4LR7A 2EC2A 3HDSA 2AYGA 4XPCA 4NWBA 3FBEA 1T9VA 2YTCA 4CLLA 3VGSA 3G86A 3KK3B 2AZ1A 2KZZA 4Y2MA 5F8HA 3PW7A 1TKTA 2V69A 1TL4A 3HJVA 4AL5A 3VZIA 4N77A 4WYWA 4UOCA 1YBTA 1E6VA 1FRHA 3SIPB 1Q81T 5D0HA 2ADBA 3CWJA 4EK2A 5B7WA 1CQMA 5DG8A 4ZIVA 1RWNB 2W2MP 1S10A 5MLCV 1T94A 4HKQA 4HI2A 3RRKA 2XLJA 4UF4A 4O3PA 1QDUB 1NJZA 4M1KA 4LSLB 1WELA 4B3RF 4OZ0A 5GAHU 3KLHA 3GV7B 2UU9F 5E3PA 2PT0A 3JTPA 4PPZA 1R89A 4RUBA 4ECYA 5HMYA 1TMMA 2ASJA 3K5MA 2BABA 1KP6A 1SQGA 1NHVA 4OHWA 4CLFA 1SH0A 3U27A 2IJFA 1OS5A 2XMMA 1NB2A 4FYVB 4FXWA 1CJVA 4MYTA 2MZRA 2P5VA 3MDFA 2FJXA 1Y5NB 2ZHAA 1DLOB 3PY8A 2VG6B 3M9MB 3BGLA 5I42A 2NXUA 1F2GA 4DS5A 3R2DJ 3A4TA 4DV3J 5BYRA 1RYRA 4CIOA 3I9ZA 1FD2A 1GX5A 3HD1A 1S5ZA 3U1LA 3UQSA 4LVOP 4X4VA 1QAYA 2XY6A 2C2ZB 3MUTP 2VBWA 3NGTA 1ZZFA 3GFYA 3MMCA 4ZVSB 2OTLS 3AQOA 4ICLA 1C4CA 5F0WA 2R2UA 1C0TA 1DTQB 1IQTA 1CVJA 2ACYA 3OXLA 4LF4F 2FUG9 4YB7A 1X7VA 2WONB 3IAS9 1SXLA 3HHLB 3N6MA 4ZOSA 2FJEB 2JWNA 2ASDA 3MWBA 3TO8A 3W60A 3CCRS 3V6DA 2K06A 1RWXB 2CNOB 1JNZB 3OR2B 4NLXA 4KHPJ 1K73T 2CNKB 2VA2A 2MKJA 4V1Ak 4ELUA 1WSRA 4W90B 1Y3KA 3R97A 3HF5A 1JLAA 2HGLA 2BKNA 5HVFA 1VQPS 4DL3A 3MAAB 2DNNA 3OTDA 1MN7A 1VDHA 3UCUP 3D0GE 1CLFA 4OZ3A 1S1WA 2J9CA 4NLDA 4WK1A 4TYBA 4QOTA 1SV5B 1Q53A 5LXYA 2ZH4A 1PC5A 1WHXA 2FHKA 4BWMA 3TW0A 2MSTA 3HVWA 1REVB 1KHWA 3M9OB 1WKLA 2FZCB 2YQ1A 2DRAA 4ID5A 1MMNA 2GIFA 2LEAA 3N79A 2DY1A 5A8RA 4I7FA 3IBWA 1RTJB 4WWSA 3MHYA 3KLFB 2G2ZA 1VJQA 2XYPB 4LFBJ 1HQEA 4P73A 2XCAA 2DR6A 2L9WA 4M5DA 2AJ4A 4FBUA 1SC6A 3RU0A 3T5HA 2MJUA 1LFWA 2UVWA 2COLA 1SL1A 1JLCB 3T41A 4IQMA 4XIUA 1VBYA 1ZAWA 3QFWA 3J7A1 1KHVA 3T6BA 4TQSA 1K0VA 4PWUA 4ZVHA 4ZLJA 2LXIA 1S6QA 5DZ6A 4PUOA 1FRMA 2MPUA 3GILA 2P9CA 3MURP 2JZ5A 3EE3A 3ZZYA 3MM5A 3KUHA 5KFSA 2YWEA 3L3CA 4FNIA 1IBMJ 3BDPA 3AJ1A 2ROEA 4ED0A 3FRZA 4PG5A 1PCAA 3MXHP 2XGPA 2FVPA 4LFCJ 2N7YA 2OD6A 3EDRB 1DFDA 5GAEI 2BMBA 2B5JB 3TANA 4ZP8A 2W01A 1TR0A 4H4MB 5DM6Q 2MY7A 3ISND 2E5LF 3PJXA 1RA7A 2DH8A 3MFHA 3FJ2A 4FYWB 2CVEA 2QJ3A 1H73A 2YH0A 1DTTB 2E7VA 4DCJB 5GVQA 5BYQA 2V4JB 3NOCA 1HQUB 1BUXA 3TYTA 2NYIA 1OQ3A 1FRXA 3Q8YA 4GVBA 1V6HA 4X4TA 2ZC3A 2R9LA 1X0PA 2LEBA 4Z7CA 4K4VA 4CLWA 3OQ2A 3M8PA 3CJQA 1U2FA 5BR8F 3WDOA 3NGUA 3GMGA 1R3NA 1NK7A 4DV4J 2DPJA 4QIVA 4B9TA 4B9NA 4TY9A 1XBWA 3OTOF 3PV8A 5KT7A 1QE1A 3FBFA 2DXEA 4ZVRB 1VCTA 2IY5B 5DJBA 4KC5A 5E33A 9RUBA 1WUUA 2MZQA 3V4IB 3TUPA 2ZHBA 1S0MA 4E8UA 4DUZJ 4ZPWR 2UXBF 2WB1D 2QZ8A 2VOPA 3IA0A 4PEOA 2E5HA 3DRSB 2KYZA 1PJ6A 2RRAA 1KSPA 3CCVS 1JX4A 4RW6B 1Q8LA 1YG0A 4I68A 1DY3A 3T5JA 2RUGA 5F8NA 3SCLE 2W9CA 3JQMA 2QLFB 1Z2ZA 4LT6A 4I56A 4XTTA 3QJPA 4TYAA 5IOLA 2RF2A 3NCPA 1XMOF 2XEXA 1D9FA 4FPRA 3PYFA 1TK8A 2DYAA 4NCBA 2VQFJ 3M05A 4IG0A 1QSSA 4F36A 1RAHB 4H4OA 1FXRA 3EZOA 1OY6A 3P96A 4HI1A 1VQ5S 5KG3A 1SJ4P 3GJQB 2WOMB 4UUXA 4EFAC 3QYYA 2BJDA 3LWMA 4UTGA 4DV2F 5KG5A 3ZZRA 3KJVA 3D4JA 5GAGI 3L7OA 4ED7A 4DV1F 3QMQA 3DU6A 1CQNA 4ZVOB 1F2HA 4FF3A 5A0YA 2DJWA 2D41A 1HMVA 2YPYA 3BN7A 1UL3A 4JI8F 2M0GB 4J9LA 1FX4A 3W65A 5B08A 1IWAA 3ITHA 3PIPQ 1J5OA 4CO1A 1UAWA 2V6AA 3NL0A 3GIRA 3W62A 2QL9B 2H4WB 1R43A 5CYQA 2XMKA 1ZM3A 1NEEA 2R7VA 3ILLA 3R5CA 1BE4A 1A9NB 1TZ0A 2CZVC 4WPAA 1W7WA 3WX4A 4I64A 3WQPA 3PIOQ 5L1KA 3J81Y 4DV5J 1FTCA 5DQGA 1CPZA 1RT7B 1AROP 4GKJF 2MQPA 3BO2A 1WSVA
chains in the Genus database with same CATH topology
4LF5J 2F4VJ 3T1HJ 2UUAJ 4JI5J 1XMQJ 5FLXU 2UXDJ 4DUZJ 3JAMU 3T1YJ 1IBKJ 5LMUJ 4KHPJ 1XMOJ 4KYZA 2UXCJ 1IBLJ 4DR3J 5LMNJ 4JI1J 4V1Ak 4YY3J 4X66J 4JV5J 1HNWJ 4DR4J 4AQYJ 4OX9J 2ZM6J 3J80U 4X62J 4DR1J 2UUBJ 4JI4J 5A2QU 3D3BJ 4DR7J 3OTOJ 3R2DJ 1N33J 2MEWA 4JI2J 4NEYA 4HHUA 2KL8A 5LM7E 1N36J 4B3MJ 4B3RJ 4DV3J 4NXNJ 4LFAJ 2MTLA 2UU9J 4LF7J 1N32J 4DR6J 5BR8J 4K0KJ 4LF4J 1HR0J 4LF8J 4JYAJ 1J5EJ 4GKKJ 4GKJJ 4NEZA 4JI0J 4PWWA 4X65J 2VQEJ 4JI7J 4DV2J 1IBMJ 4LF9J 2VQFJ 4DV6J 3IMQJ 5IWAJ 4DV4J 2HHHJ 3J81U 4KY3A 1XNRJ 4DV1J 5AJ3J 1HNXJ 2E5LJ 4DV7J 4B3SJ 1HNZJ 4YHHJ 2UXBJ 4RJVA 4DUYJ 3R2CJ 1I94J 3J7AN 4NXMJ 2KVQE 4X64J 4DR5J 4LFCJ 2MQ8A 4LFBJ 4DV5J 2UUCJ 1XNQJ 4JI8J 1N34J 3W1YC 4JI6J 5IT9U 1FJGJ 3D3CJ 4DV0J 4DR2J 4JI3J 4B3TJ 4LF6J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 J;  2F4V J;  3T1H J;  2UUA J;  4JI5 J;  1XMQ J;  5FLX U;  2UXD J;  4DUZ J;  3JAM U;  3T1Y J;  1IBK J;  5LMU J;  4KHP J;  1XMO J;  4KYZ A;  2UXC J;  1IBL J;  4DR3 J;  5LMN J;  4JI1 J;  4V1A k;  4YY3 J;  4X66 J;  4JV5 J;  1HNW J;  4DR4 J;  4AQY J;  4OX9 J;  2ZM6 J;  3J80 U;  4X62 J;  4DR1 J;  2UUB J;  4JI4 J;  5A2Q U;  3D3B J;  4DR7 J;  3OTO J;  3R2D J;  1N33 J;  2MEW A;  4JI2 J;  4NEY A;  4HHU A;  2KL8 A;  5LM7 E;  1N36 J;  4B3M J;  4B3R J;  4DV3 J;  4NXN J;  4LFA J;  2MTL A;  2UU9 J;  4LF7 J;  1N32 J;  4DR6 J;  5BR8 J;  4K0K J;  4LF4 J;  1HR0 J;  4LF8 J;  4JYA J;  1J5E J;  4GKK J;  4GKJ J;  4NEZ A;  4JI0 J;  4PWW A;  4X65 J;  2VQE J;  4JI7 J;  4DV2 J;  1IBM J;  4LF9 J;  2VQF J;  4DV6 J;  3IMQ J;  5IWA J;  4DV4 J;  2HHH J;  3J81 U;  4KY3 A;  1XNR J;  4DV1 J;  5AJ3 J;  1HNX J;  2E5L J;  4DV7 J;  4B3S J;  1HNZ J;  4YHH J;  2UXB J;  4RJV A;  4DUY J;  3R2C J;  1I94 J;  3J7A N;  4NXM J;  2KVQ E;  4X64 J;  4DR5 J;  4LFC J;  2MQ8 A;  4LFB J;  4DV5 J;  2UUC J;  1XNQ J;  4JI8 J;  1N34 J;  3W1Y C;  4JI6 J;  5IT9 U;  1FJG J;  3D3C J;  4DV0 J;  4DR2 J;  4JI3 J;  4B3T J;  4LF6 J; 
#chains in the Genus database with same CATH topology
 3CCE S;  2AF6 A;  4M63 A;  2FQQ B;  3N5B A;  5B0C A;  1TL5 A;  2D9O A;  1FF2 A;  1X4G A;  2C2N A;  1HNW J;  3V81 A;  2MKK A;  2XS7 A;  2RRN A;  3PW4 A;  2OGU A;  5GMD A;  4PQU B;  4DR2 F;  4B3T F;  2YPZ A;  5L1J A;  2QYG A;  3GSD A;  4QW8 A;  2HNY B;  2BJ3 A;  4TLR A;  4MH8 A;  1K1S A;  1UKU A;  1GEH A;  2BQ3 A;  5J1E B;  2HNZ A;  1UWA A;  2D3Z A;  2Y8W A;  4QU6 A;  4PWW A;  3K58 A;  2HG4 A;  3FC9 A;  1MNE A;  2LA6 A;  2OHD A;  3ILI A;  3CCW A;  4ES3 A;  4ZJQ A;  1M5K C;  1BD6 A;  2C3P A;  2DBB A;  1VGY A;  1XNQ J;  2RQ4 A;  2J0S D;  1XR6 A;  4Q2M A;  4DPU A;  1A6L A;  3LAL A;  1QUP A;  2M4M A;  1UW4 A;  2X3G A;  3QIP A;  3ENA A;  4F26 A;  4ZP9 A;  5GMK a;  3E01 A;  4DG1 A;  5J2Q B;  3B78 A;  4MMO A;  3I0R A;  4O3R A;  3BGU A;  3S6E A;  2AEJ A;  5D15 A;  1YIT S;  5KFZ A;  2IA6 A;  4USW A;  4M5H A;  1LWF B;  1N8R T;  2KI2 A;  4JI3 F;  1FK9 B;  2VV5 A;  1ZPV A;  2ZWP A;  2LCW A;  3DC2 A;  5F8I A;  3CCM S;  5C2C A;  2B9W A;  4DL2 A;  2BA9 A;  3DM2 B;  2CDR B;  2H48 B;  4UZB A;  2VPX B;  2HGM A;  2RJZ A;  4NEZ A;  3W61 A;  2QLX A;  1I3O B;  2VFU A;  1BWE A;  2ZUA A;  3CD6 S;  2CA9 A;  3BN4 A;  3HSZ A;  3W5X A;  3PZP A;  4N5S A;  3HSG A;  3GG1 A;  3UNY A;  3MZI A;  3CCS S;  3LAN A;  4F0M A;  2NXN A;  1HR0 F;  2IYI A;  3L95 X;  1RDR A;  3OLB A;  1FO1 A;  1FVS A;  2KJV A;  3SV4 A;  2P6T A;  7AT1 B;  4IFY A;  5HLF A;  3JTN A;  4GVL A;  3OVA A;  3MMA B;  2Y9H A;  4B3S F;  4IRD A;  1GNK A;  2U1A A;  2AYM A;  3RTV A;  5KFP A;  3CJK B;  1JJC B;  3H59 A;  1VQM S;  2CQ1 A;  1E6Y A;  4OYA A;  2XUL A;  1S9F A;  2HVI A;  1XR7 A;  2YWW A;  5KFH A;  4NLP A;  4OX8 A;  2HHS A;  2PDA A;  4KGK A;  2EG1 A;  4B17 A;  2IA0 A;  5HP1 B;  3TOQ A;  3ZO7 A;  2Y0S D;  1S79 A;  4KGV B;  2EFQ A;  1U8W A;  3JXO A;  3KK3 A;  1RT3 B;  5B09 A;  2VDH A;  2FPH X;  3M8Q A;  2HFV A;  3A1Y G;  3EXY A;  4ZCK A;  4UOG A;  3EVM A;  3FFI A;  2RHQ B;  3IMQ J;  3CCL S;  1S48 A;  1DQ9 A;  2WW8 A;  2DHS A;  5D4P A;  4ZVU B;  3RBE A;  1FE0 A;  1WOP A;  3QGI A;  5CHC B;  1WI8 A;  1RLD A;  2AZ3 A;  1WOS A;  2RS8 A;  4RNM A;  4K2X A;  4WK3 A;  3DYA B;  4EZ6 A;  2DTJ A;  4J9O A;  1J5E F;  4P7T A;  4F25 A;  1UVI A;  1Q8K A;  3D9B A;  3TJ9 A;  3PR4 A;  5HO4 A;  1AW0 A;  3MR5 A;  1Y11 A;  4NX9 A;  5A8K B;  3PFO A;  3F0N A;  2Z2Y B;  2OAU A;  1PAU B;  2CXE A;  3EZ5 A;  1SKU B;  1RWM B;  2F65 A;  1J2V A;  3ENW A;  2DR7 A;  4CYU A;  4NLY A;  5CYM A;  4F3O A;  4BC7 A;  1RGV A;  5D4N A;  1YZ6 A;  4LSZ B;  4A4J A;  4G6V B;  5H1S V;  5GAD U;  2PA3 A;  4KGM A;  1M1G A;  5K8O A;  4JYA J;  4GKK J;  2NSB A;  3IG1 A;  2QT7 A;  1A7G E;  3TUJ C;  3LGN A;  2H1Y A;  4ITS A;  1W2I A;  3GE9 A;  3UVJ A;  1Q8I A;  4ECT A;  1SKW A;  1RWK B;  1X4F A;  1JNR B;  2B7B B;  4LRA A;  3NCR A;  4QWD A;  4DPO A;  5IXU A;  2DVI A;  3QJL A;  5J1N A;  5IM0 B;  3VGU A;  3TUZ C;  2HS4 A;  3J7Z 5;  2RH3 A;  2RIJ A;  4X64 F;  1UP1 A;  4NA1 A;  7FD1 A;  4RLE A;  3NEK A;  3HHD A;  2MZJ A;  3P45 B;  1DTQ A;  2CJY B;  5E5N A;  4KFB B;  3HHL A;  4JI1 J;  1HA1 A;  2CVI A;  2I5J B;  5DM7 Q;  3PVX A;  3MR2 A;  2AMC B;  5L1I A;  1IR1 A;  3H5S A;  3UE2 A;  1F3V A;  4RL1 A;  5LJ3 Y;  4MKB A;  3RRH A;  4CM2 A;  2P2C B;  2YQ3 A;  3CDU A;  3IGV A;  3EGZ A;  2GHW A;  2B9Y A;  2MGZ B;  3MAA A;  3D0I E;  2V9W A;  4M5K A;  5K20 B;  1JJ4 A;  4RWW A;  3UCZ P;  1NJI T;  2JDJ A;  4B9V A;  3CJ8 A;  3JYT B;  4M5N A;  5KFY A;  4ZKA A;  1AZS B;  1YRX A;  1EP4 A;  1ICE B;  3CDB A;  5KG1 A;  2ZWO A;  3N6L A;  4OZJ A;  3C3L A;  2BZ2 A;  4UY8 5;  1CJK B;  2MDA A;  4JOU A;  2MHN A;  1YLX A;  2LQB A;  4LQ3 A;  5IWA F;  3TUI C;  4KV8 B;  3DI6 B;  5EGY A;  2C3U A;  4K59 A;  5LXR A;  3M2R B;  1VBX A;  1JLE B;  4I6Y A;  3OXF A;  1G2E A;  2CQI A;  2RQK A;  1SQF A;  2KFN A;  2R7U A;  3K8W A;  5F8L A;  4ZPD A;  4YDX A;  1IBK F;  2J9D E;  4WFZ A;  2XI2 A;  4DR4 J;  1QM9 A;  1U26 A;  4HR2 A;  3PDN A;  4QJV A;  4MAK A;  3W8G A;  2BE2 B;  3N4W A;  4CTA A;  3K5N A;  1S6O A;  2YNH A;  1S12 A;  1RAG B;  4CLU A;  4NPO A;  2XLI A;  3E3X A;  1UW9 A;  3CGI A;  5J2N B;  3ONQ A;  1YKW A;  2V2V A;  2HK3 A;  1HNZ J;  4RJV A;  1S1U A;  2D74 B;  4NMX A;  2HSE B;  4DN0 A;  4LFA F;  5E2Q A;  1RJJ A;  2HMI B;  1AT1 B;  3DN9 A;  5HK4 A;  4PYA A;  2NQP A;  2CPI A;  2CQH A;  1EAR A;  4CQ1 A;  2FGO A;  4ZPA A;  4C3L A;  3JAM U;  2XY7 A;  1XER A;  4G1P A;  1AUD A;  2IM3 A;  2B5J A;  4C98 A;  1FDB A;  3AHP A;  5KFM A;  2LEC A;  1GQE A;  3G8T A;  4WP9 A;  2UXC F;  2D3U A;  1S6U A;  1XIQ A;  4YY3 F;  2JX2 A;  3PNI A;  4FYY B;  3VAM A;  2WAQ D;  2ASL A;  4RBV A;  3GZ7 A;  2D69 A;  1RT4 B;  3B54 A;  2EW9 A;  2B3T B;  4U67 Q;  1GMW D;  1IBL F;  2VOO A;  5U47 A;  3Q22 A;  2BJ9 A;  3EGW B;  4EEY A;  2HLT A;  4J91 A;  3I32 A;  1K0T A;  3QRP A;  2VJU A;  2YWK A;  2XZW A;  3SSQ A;  2AEM A;  2FJV A;  2IMO A;  1M5P C;  4J9K A;  2HQF A;  3W9J A;  4YR0 A;  4QR1 A;  2VBZ A;  3MPY A;  1HWL A;  2V2Z A;  2IIH A;  2GFF A;  2ZBQ A;  2F3J A;  3EPI A;  2QMU B;  5DGB A;  1OY8 A;  2XS5 A;  1XMQ F;  4WU2 A;  2WZ1 A;  1VC6 A;  2DCU B;  4UOH A;  1B7F A;  1UFW A;  2BRK A;  5EWF A;  2V68 A;  4M94 A;  4ZVQ B;  2HQI A;  2NXE A;  3J80 U;  3V4I A;  1R0C B;  1RHK B;  3UDL A;  1WHW A;  1P8G A;  2HYI B;  2G13 A;  3E51 A;  3A3N B;  4LF5 F;  1N36 J;  4N41 A;  3DRS A;  2EEY A;  3FEZ A;  3RAX A;  3M8Y A;  1KC8 T;  3KKF A;  3OSN A;  2LKZ A;  4IR9 A;  5KOW A;  2UUT A;  4R5P A;  1DBD A;  3RB0 A;  3HMJ G;  5AJ3 J;  4RBT A;  4L3N A;  4OI2 A;  5F41 A;  4ZIW A;  4LF7 F;  3ZNJ 1;  1RT1 A;  2OH2 A;  2GNK A;  1P9Y A;  2L08 A;  2HVH A;  1ZM9 A;  2ZHO A;  4YR3 A;  1NSK L;  2GV1 A;  1G3O A;  4PQA A;  1YJN S;  4B3O B;  1M0S A;  4EO6 A;  2WOM A;  3JQK A;  3LPE A;  2DR9 A;  2GQQ A;  4ALZ A;  4A8S A;  1D1U A;  1FJG F;  5KFW A;  2DGO A;  2YX7 A;  5F9N A;  2YKP A;  3R5D A;  4OX9 F;  4OJ1 A;  2XYG B;  2ZVI A;  3CJS A;  2OI2 A;  4NXN J;  3GWC A;  4O0I A;  1HWI A;  3FK4 A;  1BC6 A;  2GIR A;  2IJN A;  3NAI A;  2RDJ A;  1NME B;  4OYI A;  1WEZ A;  5ETL A;  3UW1 A;  4DQI A;  1RWP B;  4PCQ A;  4X4S A;  3R1L A;  2HLU A;  5IFM A;  3L7P A;  3QZ8 A;  4FN5 A;  5ETS A;  3SQG B;  1HWU A;  4I2P B;  5CH7 B;  2XBP A;  1HKA A;  1N5V A;  2QE5 A;  5F3Z A;  2XMA A;  3UD4 P;  3OHA A;  3T9N A;  5DZ7 A;  2RVJ A;  3IM9 A;  1FD8 A;  2KVI A;  5CD4 A;  2NXC A;  5HN0 A;  1UEU A;  2IRY A;  4ZLL A;  3V6J A;  1N5S A;  1FKO B;  3OHB A;  1K1Q A;  1PIE A;  1RAA B;  5D78 A;  1QJH A;  4IDK B;  4OZ2 A;  5DRK A;  1LV5 A;  4N8N A;  4NLV A;  1TFW A;  3CXC R;  3OR1 B;  5KFX A;  1VFJ A;  4UT4 A;  2Y1J A;  3GQC A;  1LWE B;  2VPY B;  5J2P B;  3CJ2 A;  3CD5 A;  2BYC A;  2QGF B;  3MM8 B;  4A47 A;  1D9A A;  1RYS A;  2IDL A;  3P8B B;  2E9Z A;  2XYH B;  1RB0 A;  3GIM A;  5J1E A;  1VQ7 S;  5CZX A;  5HAN A;  4IOB A;  3MUV P;  2KDO A;  1SJQ A;  3G71 S;  1LEO A;  5E0O A;  5E3C A;  2OEJ A;  2FY1 A;  5KFF A;  4O4G A;  4DHV A;  4TN2 A;  1P1T A;  5C5J A;  1XWL A;  1NPK A;  2V34 A;  2GX8 A;  4LBP A;  1Q16 B;  3AB4 B;  2Y1L B;  4A8K A;  3H7H B;  2DNH A;  3TA0 A;  1IUJ A;  2PMZ D;  4F2R A;  1CS4 B;  1RHM B;  2F4V F;  3HVT B;  1JK9 B;  2H54 B;  3NGR A;  4J9R A;  1TTH B;  3KDN A;  2E29 A;  4ZCI A;  4AQY J;  2LDY A;  4PRF A;  4DR7 J;  3M6X A;  1KVK A;  3H98 A;  4JI2 J;  3M9N B;  3F44 A;  2BKP A;  2Q6C A;  4ZIT A;  3QLH B;  4R25 A;  5KFL A;  1KLN A;  3I6P A;  4W98 A;  2KXF A;  1FK9 A;  1VYA A;  5KT2 A;  2J0X A;  2IAJ A;  3B82 A;  4C48 A;  1NDC A;  1TKZ A;  1Y4Z B;  2WVD A;  2RDI A;  3R5G A;  1R8P A;  1Q79 A;  1F9E B;  4DS4 A;  2GS8 A;  1X31 C;  2NUH A;  2WRM A;  3MI7 X;  5IT9 U;  1E6V B;  1L3K A;  2YY3 A;  4KPY A;  1NDL A;  2Y1R I;  1TVR B;  5E41 A;  3MCO A;  1RQ0 A;  3H25 A;  4P2F A;  2PE8 A;  4K4S A;  4Y2I A;  1RAO A;  1F5A A;  3L09 A;  1ZTW A;  1VQN S;  3T9Z A;  1F9F A;  4E2F B;  1BMQ B;  4U95 A;  5E3R A;  3QT5 A;  3AY0 A;  5T41 A;  2AV5 A;  1KRP A;  3MR3 A;  1YTY A;  1FWL A;  2UZA A;  2VC0 A;  3KLH B;  1TKD A;  4CNY A;  2AJF E;  3VGT A;  4DL0 C;  4NZ6 A;  2OML A;  2HS0 A;  1P9Q C;  1XN9 A;  4P6Q A;  3CIM A;  4RNF A;  4WU3 A;  2GQ2 A;  2VC1 A;  1FEH A;  4ILL A;  3EPG A;  4L6V 3;  2X51 A;  4P71 A;  3IRW P;  4U8V A;  5HP1 A;  2QFI A;  2KG0 A;  2W9A A;  1I1G A;  1CJV B;  2RD5 C;  1IVZ A;  1FEE A;  4BHQ A;  1TL3 A;  4DUY J;  2DHX A;  4WKR A;  2VBY A;  1O0P A;  3DCA A;  5I42 B;  2KH9 A;  4WJB A;  4HAC A;  2KRR A;  1NAQ A;  3RW7 A;  4UY8 T;  3CJ5 A;  3RBX A;  1WG1 A;  3ENV A;  2BQR A;  4YME A;  1Y10 A;  1F1B B;  2ATC B;  3CMQ A;  2HWI A;  4IYQ A;  4CO2 A;  2XHW A;  2LU2 A;  2LQ5 A;  4DX6 A;  1X8D A;  2VOD A;  3BGO P;  3IR6 B;  3CJ3 A;  2ZH7 A;  3BKU A;  1C0T B;  4CNZ A;  1D09 B;  4FVM A;  5A8K A;  1MRO A;  3AD7 C;  2J6T A;  1X9M A;  1PIL A;  2HZC A;  2KN4 A;  5BR8 J;  3K89 A;  3QSI A;  2XZT B;  3MGJ A;  4QZV B;  2OSR A;  5CAA A;  3ET6 A;  5E3Q A;  2PII A;  2R7Q A;  2F5G A;  2F8E X;  5T7L A;  2IVF B;  2CJK A;  1KDN A;  1B7Y B;  5IV4 A;  1HAR A;  2C2E A;  5AT1 B;  4F04 B;  2AT1 B;  1O51 A;  3BPS P;  3UO0 A;  4F4A A;  3MPU B;  1RCX B;  1S1W B;  1SQE A;  3MCM A;  3SDE A;  4CT8 A;  3NNC A;  1KLM A;  4LF9 F;  2Y3Y A;  1KN6 A;  1BLU A;  3AH6 A;  4LF1 A;  1FRL A;  1D0E A;  3GR0 A;  1IKX B;  2NSC A;  2GW8 A;  3ZTS A;  1XQI A;  3FSX A;  2DIT A;  2DNO A;  2ZH3 A;  3QGG A;  2HK2 A;  2CPF A;  3QO9 A;  4DL7 A;  2HIY A;  3UNG C;  1WF1 A;  4ID5 B;  2HND A;  4I7F B;  2ZM6 J;  3TNV A;  4X62 J;  2UUB J;  4S0M A;  1VK8 A;  1HQE B;  2VG7 A;  1PBA A;  3DOM A;  1RHR B;  4KFB A;  5FD1 A;  2C2M B;  1ZAV A;  3CPW R;  4M5I A;  1HD1 A;  1Y0H A;  3IBC B;  4DSE A;  3VTI A;  3JSM B;  2C3Y A;  4X66 F;  4A8W A;  4DV6 J;  1LWC A;  1M5H A;  3BR9 A;  4O3Q A;  1LQ9 A;  2HQD A;  1SJR A;  4OZ1 A;  3N01 A;  1EQM A;  3Q2S C;  2W8K A;  2EXU A;  3CDA A;  1T11 A;  2ZD1 B;  1T95 A;  1NKB A;  1N5Y A;  2VU5 A;  4CO4 A;  3GP9 A;  4ZP6 A;  1S6Q B;  4HYK A;  2YXL A;  4HVZ A;  2ZFH A;  3FSY A;  4YUD A;  2DGQ A;  3AA8 A;  3MM5 B;  1RIS A;  5EX3 A;  3T1Y J;  2RIL A;  1AZS A;  2HZV A;  5LMU J;  5HBM A;  1FNX H;  3CMA S;  4E0D A;  2BM0 A;  4QYZ J;  3D67 A;  3A8E A;  4WFN Q;  2OD4 A;  1S9G B;  2NS1 B;  3VR1 A;  2I38 A;  1M5O C;  2RU9 A;  4ED8 A;  3DI6 A;  1IN0 A;  3C16 A;  2DHH A;  2HRU A;  5K8N A;  5IT4 A;  2K7K A;  2R8G A;  2IRU A;  2GMJ A;  3CNQ P;  4OYB A;  3D6M B;  2C42 A;  1KQG B;  2F9D A;  3HCX A;  5K5M A;  2H4Y B;  4CH0 S;  3KDO A;  1EZZ B;  3WIV A;  2YKM A;  1R0B G;  1YJV A;  1FFG B;  4GVB B;  3DLH A;  3KG4 A;  3VHQ A;  2DGT A;  3GCW P;  3DOL A;  5J2N A;  2D3O R;  3MD1 A;  2QN6 B;  3W64 A;  4I0W A;  2E1R A;  3CD7 A;  1EJ7 L;  2W1B A;  2JC1 A;  4NYZ A;  4XAK A;  5KFN A;  3H4B A;  2BR0 A;  3M8P B;  4LF6 F;  4NZ7 A;  3LP0 B;  2DNL A;  2XC9 A;  3GV8 B;  1SIZ A;  2DD8 S;  5KFA A;  4F67 A;  4URS A;  5A2Q Y;  1VQ6 S;  5M2R A;  3R6L B;  1KQS R;  4U6P A;  3L7U A;  1IKY A;  3HUL A;  4V19 X;  5FDL A;  3FZB A;  1X60 A;  4LF8 F;  3SI8 A;  3O3L A;  1HPZ A;  3LAM A;  5FII A;  1F60 B;  1Q86 T;  2DKO B;  3TQE A;  1RTH B;  1D3W A;  2W9C B;  2WSC C;  3UR0 A;  3W63 A;  3PXG a;  2AIR B;  3RBZ A;  1TP7 A;  2L3M A;  4EMD A;  4DFM A;  2B9E A;  4H4K C;  4M8L A;  3X1L B;  2RF2 B;  4NLQ A;  3VVU A;  1R6V A;  2IC3 B;  3IFE A;  1TUG B;  2ERR A;  2EG2 A;  4J9Q A;  2MZT A;  4URG A;  3BEG B;  1S77 D;  4ZHR A;  3W3S A;  4IG0 B;  2BUN A;  3PEJ A;  4MK9 A;  2HAF A;  2X1G A;  3SSR A;  2FC8 A;  2HBZ B;  4H4O B;  2CPD A;  5JVG Q;  1BHN A;  5K9F A;  2VIC A;  1LXN A;  2G4B A;  1ZM2 A;  1HYS A;  3MED A;  1LXJ A;  1U1Q A;  5AE2 A;  2FHJ A;  4FS2 A;  4B3M F;  1TL1 A;  2YNG B;  3TZW A;  5SZT A;  1NSP A;  1TFY A;  1S1X B;  4KY3 A;  1HMV B;  4M5M A;  3FDS A;  2KM8 C;  2IBK A;  3W2W A;  3QNW B;  1YDL A;  2EBE A;  1SL2 A;  4RW9 A;  4DV3 F;  3DXB A;  4YHH F;  2UVU A;  1RZM A;  3Q86 A;  2AYE A;  2PN6 A;  4EBD A;  4P2X A;  2XSJ A;  4QBU A;  4WTY A;  3ITH B;  1JMT A;  4AYB D;  2JNJ A;  5KFG A;  2I2Y A;  3KJQ B;  1ZA2 B;  2GJF A;  2P9G A;  3MTK A;  5CYQ B;  4IRK A;  3DLJ A;  4U96 A;  3W8P A;  4FPI A;  3CUN A;  3AD8 C;  2MQO A;  3D68 A;  4P72 A;  2GO9 A;  4BWJ A;  5EN1 A;  4LQ9 A;  2MKI A;  4A8O A;  3HVA A;  2VFV A;  2DNP A;  3LA0 A;  2IHR 1;  4B3O A;  1WG4 A;  1MMD A;  4WXW A;  4Y2A A;  1VLY A;  1C4A A;  3HKW A;  2HVZ A;  2W25 A;  1JJ2 R;  2EFV A;  4OI3 A;  4KHP F;  1RKJ A;  1UJ5 A;  2ZZM A;  4OLO A;  5EHH A;  1R7I A;  2J7K A;  2FDN A;  4ZVG A;  1R0A B;  2DGS A;  4D3G A;  4WII A;  4RNO A;  1GMU A;  2JLE A;  4KE5 A;  3WIU A;  4K2J A;  4JI0 F;  4OX7 A;  1VRU B;  4JUZ A;  4C0O C;  3D1O A;  3O6Q A;  3QWP A;  3V81 B;  1KFD A;  4NZ0 A;  1Q8B A;  1JLB A;  2BW2 A;  2GQC A;  2C2O B;  3C66 A;  1GTH A;  2EWH A;  2E44 A;  1S57 A;  4FP9 A;  1CBK A;  2YWF A;  2HNZ B;  3L9Z A;  4DXL A;  2DRB A;  2E9T A;  2B4U A;  4I4B A;  5J2M A;  1Y5I B;  3K5L A;  4KSE B;  3DGV A;  5J1P A;  5L1L A;  4NE9 C;  1YRT A;  1DAR A;  1NND A;  4LFB F;  2R8K A;  4F4Z A;  3W66 A;  3J7Y U;  2BV3 A;  3LO3 A;  1HHS A;  2E1M C;  4F0K A;  2PMH A;  1N54 B;  1W25 A;  5B0G A;  1RI7 A;  3K57 A;  4Y28 C;  1NK8 A;  2KL8 A;  4RW8 A;  3NG8 A;  3PO5 A;  3ZFV A;  3Q89 A;  3QIP B;  3HFK A;  3LPY A;  1S76 D;  3E01 B;  1C1C B;  1JQG A;  3BO4 A;  4C8N A;  1LK5 A;  3B6B A;  2JFD A;  1U47 A;  2BBE A;  3OR1 A;  3ULH A;  4TU8 A;  2XCP A;  4MFB B;  1ELO A;  5KT6 A;  1YK9 A;  1HNX J;  3SCI E;  4IOA Q;  2IVM A;  4IUF A;  2QMX A;  1LWE A;  5J2P A;  4G65 A;  5DLF A;  4X64 J;  1T02 A;  4RX6 A;  3MM8 A;  4ZJL A;  4XO0 A;  4CZC A;  1UPP A;  3Q8U A;  2ROG A;  2B0G A;  2M8H A;  1U25 A;  5C7P A;  4RU9 A;  1NKE A;  2Y1I A;  1IBM F;  2ZH2 A;  2VL1 A;  4FZV A;  2JSX A;  3CC7 S;  2BJ1 A;  4L74 A;  3AOD A;  2RU3 A;  1X9W A;  5KFV A;  3SFU A;  2VFR A;  3I9V 9;  2VG5 A;  2G0J A;  1WF2 A;  2A3J A;  1SPB P;  4LFC F;  3AAW B;  2LEP A;  1U1P A;  4WFY A;  1ZPW X;  4Y34 A;  2VKZ G;  3AB2 B;  1N33 J;  1DHM A;  3NWR A;  1GX6 A;  1UVN A;  3DOK A;  5K8M A;  4DSL A;  1TAU A;  2GGP A;  4C11 A;  1IJE B;  3EYZ A;  4IFY B;  1C0U B;  4PKD B;  1GTE A;  2FTR A;  4X65 J;  3TVZ A;  5IV3 A;  2JOQ A;  1LOU A;  3CDE A;  5EUH A;  1JWW A;  3BRE A;  3GII A;  1E6Y B;  1FKP A;  4DU7 A;  3HHL D;  3QLH A;  3AD9 C;  4DF8 A;  1SUQ B;  3HZE A;  1QUV A;  3PW5 A;  1B0V A;  1GAO A;  3EGV A;  3HXM A;  3PM9 A;  2G2O A;  3M4X A;  3UDV A;  2HZA A;  1VI7 A;  3M8Q B;  2RKI B;  4DV4 F;  1EHW A;  2MQQ A;  1AFJ A;  1IXK A;  2CWK A;  4K4U A;  1V5I B;  2UXD J;  3KJF B;  1IBK J;  3FFI B;  4DFP A;  2BJE A;  3MEG A;  2F40 A;  1OMS A;  1TVR A;  4QR2 A;  2HIQ A;  4I69 A;  4EYH B;  1CUL A;  4UW2 A;  3CCQ S;  4K4Z A;  4JV5 J;  2PEH A;  2AGQ A;  2NZ4 A;  1K8A T;  3D7S B;  2QSW A;  1NPR A;  4RU2 A;  2NRE A;  3AA9 A;  1SC3 B;  4JP8 A;  3UN2 A;  4IOC Q;  2ATL A;  4C8M A;  3LWL A;  4DSK A;  3HFV A;  2GML A;  3OPK A;  2AHO B;  3ZZU A;  1HWK A;  2MQM A;  2VIH A;  4OZN A;  1Q95 G;  2ILY A;  1YJT A;  4MIB A;  2ZH6 A;  5DDR C;  2H65 B;  4CYU B;  5CYM B;  2CG8 A;  3P5T L;  3NXZ A;  1S9E B;  1IKW B;  2O66 A;  2R3V A;  2FLN A;  3M8Z A;  4DX5 A;  3UD3 P;  4BDP A;  3N0V A;  2VZ9 A;  1X5S A;  3GCX P;  2MZS A;  2ZZT A;  3IG1 B;  2RQC A;  4AUK A;  3NNH A;  3DRP A;  1RAI B;  3HHN B;  3UVJ B;  4ZPV R;  2UXC J;  2N3O A;  3PX0 A;  3A8I A;  1T8E A;  4YY3 J;  2QA2 A;  2E5J A;  2J9E A;  3VAF A;  3HD2 A;  1RHU B;  4PXC A;  2P9E A;  2Z8Q A;  3RR8 A;  1HW8 A;  3TAP A;  4JBC A;  3PKY A;  3SEO A;  2L9D A;  2V2Q A;  3RG6 A;  2W2Q P;  3TAR A;  2NLW A;  2Z0G A;  5BYS A;  2GO8 A;  1W26 A;  3D1H A;  2XY5 A;  2GMH A;  5AE1 A;  4R0E A;  3SCJ E;  3KK1 B;  4LRE A;  3ILO A;  2OEM A;  2AEF A;  4NCA A;  3TWZ A;  2BVZ A;  4NLU A;  1Q1K A;  4WP8 A;  2JRS A;  4RWX A;  3DRY A;  1V5V A;  4X4Q A;  1TUV A;  2FZG B;  2GA7 A;  2QRR A;  2LQ8 A;  4O3N A;  2AGP A;  1EQ0 A;  3H2U B;  6FDR A;  2VBX A;  4F2S A;  4CDI A;  3OV7 A;  1WJ9 A;  1XMQ J;  4TU7 A;  1HHT P;  2R7W A;  4WE1 A;  5M2P A;  2D9P A;  2QLJ B;  5DS7 A;  2X1F A;  1NLK L;  3GR1 A;  2ZUG A;  5DGA A;  4DSJ A;  4P52 A;  1NJW A;  3GB0 A;  3RB6 A;  1IKX A;  1EP4 B;  2KT3 A;  1RU1 A;  5G4D A;  3UDE A;  5CXT A;  5F3T A;  4WFB Q;  1UZH A;  2ZC4 A;  3W9H A;  1SJ1 A;  1I51 B;  4DR6 J;  1YSJ A;  2XO6 A;  3GLJ A;  4GO5 X;  3NBP B;  1PO6 A;  3OD2 A;  4KQZ A;  3UFC X;  1HNW F;  1XMB A;  1NSQ A;  3N6N A;  1FNO A;  3ISN C;  4PZV A;  1N88 A;  4IH5 A;  2GJ2 A;  2ZKT A;  1VC0 A;  3M6W A;  4USH A;  2DGV A;  4NXM J;  5KFK A;  2WSF C;  3JSM A;  2KRB A;  2K8G A;  2N7C A;  4HLB A;  3KUG A;  2DHA A;  1SB6 A;  2VFS A;  4CTA B;  1T7P A;  4MK7 A;  3O44 A;  5C2G A;  2YNH B;  3CVK A;  2XZD B;  1UZD A;  2DXD A;  4RUA A;  1JIH A;  3PX4 A;  4PAA A;  1MLA A;  1KOH A;  4M95 A;  3W2V A;  2ZJP Q;  3P5B P;  3BDE A;  2ZD1 A;  2V4R A;  1YJ7 A;  1YGY A;  4AT1 B;  1RXO B;  3R7S B;  4Z37 A;  1Y00 A;  3CT9 A;  2V8P A;  4X84 A;  1BWV A;  1ROF A;  3OFH A;  3OT9 A;  4EYI B;  2XNR A;  2R42 A;  2OFG X;  4OX9 J;  1NRK A;  1S1U B;  1XR5 A;  3QSY B;  3MCS A;  5CYJ A;  4YN3 B;  4QIE A;  5A2Q U;  4K4X A;  3ZXW A;  2RQM A;  1NSA A;  1WDD A;  3M2U B;  2ALZ A;  5K8P A;  1FRK A;  1S9G A;  1FDN A;  2HVE A;  2HUR A;  1RUS A;  2I9S A;  2GAH C;  1RWV B;  1T9T A;  3Q8R B;  2HKE A;  3Q24 A;  2V94 A;  1MWZ A;  3SXL A;  3DHW C;  2V67 A;  3BV8 A;  4RZR A;  4ENO A;  2ZIT A;  4DEZ A;  1Y5L B;  1OYD A;  3BQ2 A;  1PSD A;  3D3C J;  4FDF A;  2J0W A;  5K14 B;  5D6G A;  2W4C A;  2HFU A;  1R27 B;  3FCH A;  5I3Q A;  3FQK A;  1R8B A;  2AW0 A;  1VJW A;  2V2K A;  3FSI A;  3I87 A;  1KTQ A;  2KKH A;  1Z4U A;  5D4L A;  1ITP A;  2HPU A;  3E2E A;  3CDW A;  4Q44 A;  3CME S;  2LDI A;  2D7S A;  4MIW A;  1IM4 A;  1YX2 A;  3KUE A;  1FXD A;  3LP0 A;  3FMB A;  4A8Q A;  3DRR B;  2EBG A;  3HSJ A;  1RT5 A;  1OY9 A;  3BSC A;  3DDK A;  2AX1 A;  2E5I A;  3BGR B;  4TQR A;  2RRB A;  1U6F A;  3THV A;  4KH0 B;  3OJS A;  3IS9 B;  4RPF A;  4FF4 A;  3H5X A;  3GSI A;  3SQO P;  1X4E A;  3BKT A;  1HBO A;  2H51 B;  3VVT A;  2E1P A;  1ULR A;  3UDC A;  3C46 A;  5ETM A;  4M5L A;  1Q82 T;  1S59 A;  2L48 A;  2F4V J;  1ZH5 A;  4C3M A;  5CD4 H;  4JI5 J;  2V50 A;  1RTH A;  2OPP B;  1PGZ A;  1FNM A;  5EWG A;  4ES1 A;  3W5Y A;  3T5K A;  2BDP A;  4R5P B;  5MAO A;  1NH7 A;  2BOP A;  2WB4 A;  5AXN A;  1PJ5 A;  3B4D A;  3H2L A;  1QAX A;  2B6A A;  3QT6 A;  2IC3 A;  3UI3 A;  4DCO B;  1HHQ A;  3GPA A;  1RT1 B;  1QSL A;  5B0A A;  3VAI A;  4QW9 A;  4P10 A;  1FJ7 A;  3VGV A;  3SYZ A;  3AXK A;  2MTL A;  1NZA A;  4F4X A;  1WF0 A;  1RAD B;  2R8H A;  3NMR A;  1N0V C;  1AYE A;  2HFO A;  3VV2 B;  4ED5 A;  1MML A;  2HVD A;  3K7R A;  1X0F A;  3MR7 A;  3MM9 A;  4YB1 P;  4DPY A;  1XNR F;  5AXL A;  1YIJ S;  1NK4 A;  2YNG A;  5AXM A;  1IJF B;  4JYA F;  5C25 A;  1HFE L;  2M70 A;  3P6Y C;  1S1X A;  2XM3 A;  4DR5 F;  1KWM A;  3KLE A;  2IVY A;  5I3P A;  2MLY A;  3MM6 B;  3FEX B;  4NLT A;  2CPJ A;  2PGC A;  2VH7 A;  3QZ7 A;  3Q2T C;  4XK8 C;  1YVF A;  3I82 A;  3UPF A;  3HSD A;  2LMI A;  1BQM B;  4AE5 A;  2UVV A;  2ZOM A;  4KTQ A;  4DZD A;  1L3S A;  3G9C A;  4B08 A;  1UVK A;  2FVQ A;  4DX8 H;  1FI4 A;  3RB4 A;  4OI1 A;  4QWC A;  1T9W A;  3RAQ A;  2MQN A;  5LT5 A;  4ECW A;  1NZ8 A;  4LRD A;  3KMQ A;  4CO3 A;  1H7W A;  4JI1 F;  5GAE U;  4RO0 A;  3ICL A;  3EX7 B;  2BKO A;  3G87 A;  4TKT A;  1YJW S;  3RW6 A;  2IBO A;  2KU7 A;  1R31 A;  4IRC A;  4U7U D;  5KG7 A;  1VQO S;  1RAE B;  3KLI A;  3US5 A;  3HJF A;  3D2W A;  2IFX A;  7FDR A;  3JTO A;  1SC1 B;  3GJT B;  1R0A A;  4OV1 A;  5ETP A;  3AOB A;  1VRU A;  3JSY A;  1SBR A;  4DFK A;  2EK6 A;  3OBI A;  2VB6 A;  2GCF A;  1WKK A;  2RB7 A;  1NDP A;  1IR0 A;  4NLS A;  2OJ3 A;  2DT9 A;  4RR5 A;  4DFJ A;  2KXN B;  2YKN B;  1S72 S;  1NCL A;  3KWM A;  1APS A;  4ZCL A;  3EMT A;  4O23 A;  2YVS A;  4O4G B;  4ED2 A;  2HQC A;  2Q3P A;  4OJG A;  1FE4 A;  5HQM A;  4HT7 A;  5LL6 d;  3SMZ A;  1OWX A;  3S01 A;  5THW A;  4ECQ A;  4OX6 A;  1X5P A;  2VQE J;  3NP5 A;  4DR4 F;  2CQD A;  5L46 A;  1Q5Y A;  2J76 E;  1FFS B;  4MTP A;  3BKF A;  2YKO A;  1UVM A;  4K8R A;  1RE1 B;  1HWJ A;  8ATC B;  1C1C A;  4RUC A;  2H5E A;  1SH3 A;  2OO4 A;  4TU9 A;  4MFB A;  1RT2 B;  1VRQ C;  4YB6 A;  2DPI A;  2WTF A;  2QG9 B;  4DMZ A;  2IAJ B;  3OW2 R;  1HNZ F;  1JXE A;  4DL4 A;  1TKZ B;  2NR0 A;  2FD2 A;  2KO1 A;  2YWH A;  3PW0 A;  4NRT A;  4UQG A;  5DG7 A;  3U1N A;  5E7O B;  3EGN A;  4WKY A;  3FCV A;  1L3T A;  4JI4 F;  3OVS A;  4V19 J;  4NEY A;  2KYX A;  2FYX A;  3MEC B;  1QTN B;  2CUY A;  3TZY A;  1I6J A;  3FVY A;  3Q8Q B;  1N6Q A;  2YWG A;  4ZDN A;  3OTE A;  3EUN A;  4HL9 A;  1LFP A;  5GAG U;  3IWN C;  4Y2C A;  2AX0 A;  1YQH A;  1TUW A;  1RBL A;  2AP6 A;  2NZC A;  1C0U A;  1IR2 A;  4I6W A;  5C24 B;  1TAQ A;  4Q8F A;  1O8B A;  4UZC A;  2W9B A;  1B70 B;  3W1Y C;  4KGX B;  3TRG A;  1RSC A;  1CC7 A;  5KFT A;  4FXV A;  5LSR A;  3QQC D;  1X4H A;  3D6F B;  4CP5 A;  3OFG A;  1RT6 B;  1CSJ A;  4U8Y A;  1Y9O A;  4TY8 A;  1SUQ A;  5F9L A;  2IM1 A;  4MK8 A;  2HEK A;  4GO7 X;  2UVR A;  1U7L A;  2DNQ A;  5KFJ A;  1TL3 B;  2ILZ A;  1VBK A;  3SZ2 A;  1SVD A;  1UA1 A;  1K9M T;  2RKI A;  1XK8 A;  1PYO B;  2DB1 A;  3H90 A;  4DR1 J;  3LGH A;  4LRC A;  4DQP A;  1M5S A;  1ZBT A;  4K7Q A;  4HAC B;  2LQ9 A;  1IQZ A;  2X7I A;  3Q8V A;  3WBZ A;  4ZVP B;  3FBB A;  5HL7 Q;  5ETK A;  2M52 A;  2AD9 A;  3C14 A;  1RWO B;  3IRX B;  4IG3 A;  2DIU A;  2JLF A;  3R27 A;  3VQT A;  2IM0 A;  1HIY A;  4XPE A;  3KLG A;  2FY8 A;  4A8F A;  2AWZ A;  4QPT A;  3CO0 P;  4E98 A;  2L9N A;  5B0D A;  3EJM A;  2C28 A;  4OLP A;  4C7Q A;  4CH1 A;  1N36 F;  1KR4 A;  3MPV A;  3CF5 Q;  4DBQ A;  5ADZ A;  1MRO B;  5EX0 A;  2CQ3 A;  4OMF G;  4GC6 A;  4AND A;  3KFW X;  2F7V A;  1CC8 A;  1URR A;  4LF6 J;  4QR0 A;  3V2U C;  3QGH A;  4DLG A;  1DUR A;  3ET6 B;  2CQ2 A;  4RW7 B;  1TEL A;  5AJ3 F;  2ZDO A;  5T7L B;  1S9E A;  1IKW A;  2OPS B;  3K5O A;  3KG0 A;  1S6P B;  2O5D A;  4GRS A;  1T9U A;  3Q83 A;  1V3R A;  2Z2L A;  4KO0 B;  3DMJ A;  3QT7 A;  3AFG A;  5F8J A;  2KM8 B;  1NK5 A;  2MQL A;  2X3D A;  3BO3 A;  3RRG A;  4F02 A;  4PXE A;  2OSQ A;  1C2P A;  2MEW A;  1WHY A;  1HBM A;  3I56 S;  5KG2 A;  3KTQ A;  3DKD A;  1VHF A;  3SDE B;  1KLM B;  3PRB A;  3HPO A;  4LF8 J;  4DDF A;  1HW9 A;  1RTD B;  3QPI A;  2CJ9 A;  5LJ5 Y;  2KT5 A;  4ETZ A;  1LNQ A;  5M2U A;  2DNK A;  1NM2 A;  3QO9 B;  2HHH J;  4GC7 A;  5DQI A;  2HND B;  4LIR A;  4MYU A;  4ES2 A;  2E1A A;  4K4Y A;  1QVG R;  2EFO A;  1I94 J;  3PKM A;  2VG7 B;  4NXN F;  1TKX B;  4IFV B;  3DOM B;  5JUM A;  1FRJ A;  3DHX A;  3KK1 A;  2UUC J;  1MU2 A;  2J8A A;  2PI4 A;  3B4M A;  1QAJ A;  3MOZ A;  1UFL A;  4J9S A;  2A1B A;  3ZTR A;  3TVK A;  2C3M A;  4QU7 A;  2FHM A;  3HM9 A;  2Z4P A;  3HT3 A;  4RKU C;  4HEA 9;  3NS6 A;  2RHS B;  3BH6 B;  1LWC B;  2LP4 A;  3JB9 k;  2R7T A;  3NGK A;  4ZN3 A;  3BPD A;  1XEZ A;  3LGM A;  2MKH A;  5C42 A;  5HSP A;  1N5Y B;  2R8I A;  2DEJ A;  1J27 A;  4UQT A;  1PC4 A;  2M3D A;  3HZG A;  2G0C A;  2DH9 A;  4KKO A;  2J8S A;  2AQ4 A;  4B3M J;  2H5J B;  1VHI A;  3W7B A;  2M7S A;  1PBU A;  4RBU A;  2SXL A;  3R5A A;  4QIW D;  2V4Q A;  1TL7 B;  2DNY A;  2C22 A;  5HBM B;  1HBN A;  2RAQ A;  2G2Y A;  2VJV A;  1UWB A;  3VCD A;  4DPX A;  1M1H A;  2B4P A;  2AKW B;  4YHH J;  3NBP A;  5L8R C;  4NCG B;  1WG5 A;  3C16 B;  2OUG A;  3WX8 A;  4DV0 J;  5BXI A;  4I2Q A;  4ZVF A;  1BQN A;  4PPD A;  4DSI A;  2QV6 A;  2FHJ D;  3CC4 S;  1SCJ B;  5HRO B;  3NKY A;  1OPZ A;  3HHE A;  3UR3 C;  2YKM B;  1F5C A;  3C8Y A;  2KFY A;  4LR9 A;  3FKB A;  4M5J A;  1A0O B;  4F0H A;  2IYG A;  4DLE A;  2O3D A;  2A10 A;  5DO2 A;  3CJ0 A;  1MW7 A;  2G1D A;  3DDN A;  4JV1 A;  3DOL B;  3NNA A;  1YJU A;  5D3G A;  1QAI A;  2HHV A;  1IWG A;  1RAC B;  1P1L A;  1U49 A;  1DJ0 A;  4IKA A;  3P49 B;  1MSW D;  1T9Y A;  3LP2 A;  4JI0 J;  1VBZ A;  1N32 F;  2DK2 A;  3PAC A;  4R8U B;  1OYE A;  4F3Q A;  4AQY F;  4C6A A;  1DQA A;  3D54 A;  3M2U A;  2M9K A;  1LK7 A;  3Q23 A;  3FMW A;  4LMZ A;  4DR7 F;  4ANE A;  5L39 A;  2E1C A;  4JI2 F;  2I0X A;  5G0R B;  3C2P A;  4P74 A;  1LW2 A;  1CJT A;  4I67 A;  1B64 A;  1T03 A;  1PAE X;  2V8G A;  2XMV A;  1IKY B;  5FDL B;  3VQS A;  1PYS B;  4USJ C;  3KHH A;  3CUL A;  1RBA A;  2ACM A;  1U0S A;  4IH6 A;  2WVE A;  1X5O A;  5ETQ A;  1S7I A;  2ZOG A;  2JHE A;  2QC3 A;  2O1P A;  1HPZ B;  2DGW A;  2F63 A;  5K14 A;  4ECV A;  2OFH X;  5DQH A;  3D0H E;  3TX8 A;  3QAE A;  4ECU A;  5F8M A;  3DLK A;  3KLV A;  6FD1 A;  4CI0 B;  2RUS A;  2YH1 A;  4PG7 A;  3TR5 A;  2R7S A;  1OO0 B;  5ITH A;  1JLF B;  3A3P B;  5A6P A;  3NGD A;  3QID A;  4F4W A;  2JVO A;  2CPY A;  3BM7 A;  4ZHR B;  2HHX A;  4NRU A;  2MB0 B;  5HMX A;  2VPZ B;  3MFI A;  3DRR A;  4C4W A;  4KHR A;  2CFX A;  4AXI A;  1WD6 A;  3BGR A;  3PG9 A;  2DHG A;  2NCK L;  3MEE B;  1AA1 B;  3G2X A;  1N34 J;  1HYS B;  2QSF A;  3Q8S B;  3MED B;  4FBT A;  3IS9 A;  4NI2 B;  4USM A;  2VF3 A;  1NKC A;  1EX8 A;  1TL1 B;  3GIK A;  1SIW B;  4A8Y A;  3GJS B;  2QA4 S;  1KVI A;  3NMA A;  1HNV B;  4DUY F;  3I96 A;  2DH7 A;  2B4O A;  4LJM A;  3W2W B;  4M5G A;  4Y3C A;  3H2V E;  2OPP A;  1H38 A;  2Q43 A;  4RW9 B;  2OPQ B;  5RUB A;  2C2D A;  2QIF A;  4C8Y A;  2CQ4 A;  3D66 A;  2C3O A;  3OTB A;  1WOR A;  2J0Q D;  2XSJ B;  1DZ5 A;  4W4M A;  1UEK A;  2QTW A;  2EVZ A;  1UJ4 A;  1UVJ A;  3GJR B;  2OMO A;  2RT3 A;  3PFE A;  4Z7Y A;  4JI7 J;  4N7T A;  4ZA1 A;  2FJA B;  3M2V A;  4Q45 A;  1RAF B;  4HH0 A;  1FXL A;  1TMJ A;  4G3I A;  2CIM A;  3J81 U;  3RZA A;  4WYL A;  4NL5 A;  1U45 A;  1B99 A;  3THT A;  4FF1 A;  4Q0B B;  3CO9 A;  1HL6 A;  2ZE2 B;  3FUY A;  4DV7 F;  2XB2 D;  4FVC A;  4OIX A;  1OPI A;  1S7H A;  3C6U A;  3OTC A;  3GYN A;  4JI6 F;  2RDD A;  1S1V B;  4DUT A;  2J6S A;  3OFE A;  1K44 A;  1RTI A;  2LU1 A;  3TAQ A;  2Z57 B;  1WHV A;  3WC2 A;  2VKR A;  4PYD A;  2EKN A;  3MTJ A;  1JB0 C;  5CAB A;  2ZEJ A;  2VPW B;  5DDQ C;  4PWD B;  1JJH A;  3CCU S;  1HQ2 A;  2NUU G;  3MM6 A;  3JAM Y;  4OI0 A;  3C6T B;  1UA0 A;  1JLB B;  2M2B A;  1BQM A;  2F4F A;  1C1B A;  2P8I A;  3H4D A;  4O3O A;  3IN5 A;  2H3E B;  1R8A A;  4HDH A;  4B3R J;  2UU9 J;  1JLQ B;  1SH2 A;  4NYO A;  1S0V A;  5IC4 B;  2GHV C;  5J2M B;  3M8W A;  3R7N B;  3PJW A;  4K0K F;  1XTZ A;  2ZM6 F;  2HAI A;  3PCO B;  4X62 F;  1H98 A;  4HT5 A;  2UUB F;  2JEI A;  2CJQ A;  4UOF A;  1VIX A;  4ZLP A;  3A13 A;  3DLG A;  2HRY A;  2LVW A;  4EBC A;  2ZBP A;  1WC4 A;  3DLE A;  1L3V A;  2B51 A;  1HI0 P;  1KD1 T;  1R6Y A;  4KIA A;  1JLG A;  1GK8 A;  2G1H A;  3MF5 A;  3P3D A;  4OYX A;  3EVO A;  4RW8 B;  5ETO A;  2FLP A;  3H42 A;  4YS2 A;  1RBO B;  4DV6 F;  3RB3 A;  1ZM4 A;  4NLR A;  3H20 A;  4NLW A;  3BYR A;  4OYM A;  2GIQ A;  1L3U A;  2XG8 A;  1WKJ A;  2FVS A;  4AL7 A;  3RBD A;  2HFS A;  2XSF A;  2KHD A;  3BSA A;  5HAO A;  5LMN F;  3I0S A;  4RNH A;  2G9O A;  2ALY B;  4USI A;  4EUV A;  2F9J A;  2MY8 A;  4J9P A;  4WBF A;  3J80 Y;  4KAI A;  4IR1 A;  3T1Y F;  5LMU F;  4OJ3 A;  2YKN A;  1LKZ A;  4LF4 J;  3D6T B;  5EDW A;  4WXO A;  3Q0A A;  3R9L A;  2K3I A;  4HDG A;  3BQ0 A;  3HLU A;  3TVY A;  4ZK7 M;  4ANC A;  2A2D A;  2VG5 B;  4KJI A;  3ZTP A;  1MWY A;  2BQU A;  1WNE A;  2WVC A;  2I1R A;  5HQL A;  4CO0 A;  3H5Y A;  3QRR A;  3BBF A;  1AXQ A;  4DSF A;  5EWE A;  3CCT A;  4DL6 A;  2LYV A;  4LBI A;  4BCA A;  3M32 B;  2KHC A;  4U9R A;  2YKQ A;  4O44 B;  3DOK B;  4USK A;  2ZH8 A;  1FA0 A;  3GG0 A;  4K5S A;  2W7A A;  3VF0 B;  2VD3 A;  1D8Y A;  2GGP B;  4C11 B;  4Q8E A;  2AJ0 A;  2PFD A;  3I5A A;  5KFR A;  5HJY A;  1FHT A;  3AOC A;  4KGZ B;  2CYY A;  2UUA F;  1U1L A;  1RT2 A;  1FKP B;  1QVF R;  3BJY A;  2R4F A;  1FFW B;  5D77 A;  3VAL A;  3OJU A;  1FVQ A;  2JJ4 D;  4XDC A;  3T6J A;  2Z56 B;  2MSS A;  5HAT A;  2KTQ A;  3G6E S;  1MWQ A;  2MHE A;  4NOH A;  8AT1 B;  2FVR A;  4ZP7 A;  2FJD B;  1JKH A;  3MEG B;  1PJ7 A;  1GT8 A;  3AOA A;  3VWS A;  1Q7L B;  2B4V A;  4RUH A;  1CUL B;  1VRT A;  3EIC A;  5B0F A;  3MEC A;  1MG7 A;  4FKY A;  4O3S A;  2CJA A;  1YJR A;  2MQ8 A;  4P9S A;  5GAD I;  1H6K X;  2RNE A;  5CQG A;  2LA4 A;  4QWB A;  3KYL A;  3QJJ A;  5KTQ A;  2NPF A;  2WVB A;  3FBC A;  4YFU A;  4YQW A;  2DCL A;  1VQY A;  3AT1 B;  4LF2 A;  5C24 A;  1Q78 A;  4KYZ A;  4OYP A;  2V63 A;  2XMT A;  4DCP B;  4CCH A;  4N8O A;  3C19 A;  1BGX T;  3GTY X;  3H8Y A;  1RT6 A;  3BH7 B;  2WSE C;  3BR8 A;  3O8W A;  1LW0 B;  4YDD B;  3L4B C;  2EK1 A;  5LM7 E;  3OUY B;  4Q2L A;  2HFZ A;  3BB5 A;  4KRW A;  5JVH Q;  3M7V A;  1NO8 A;  2DEI A;  1OIA A;  2M8D B;  2VAS A;  3DRP B;  3UWT A;  1S97 A;  3MPD A;  2QX0 A;  4Z2X A;  5D4O A;  1BXN A;  5KG0 A;  2E5L J;  4FXD A;  1JXL A;  3SBM A;  4F3M A;  5IQ6 A;  3IRX A;  2RE1 A;  1N52 B;  4H4K A;  4WZM A;  3IBF B;  4TXS A;  3VAH A;  1RAJ A;  4ECR A;  1WC6 A;  2GHP A;  1FDD A;  2CQC A;  1S0O A;  3TZX A;  3C15 A;  2CQP A;  2LQJ A;  2FHO B;  2PA8 D;  3M1V B;  4J9U E;  3WC0 A;  3TAM B;  4B9S A;  3ZZZ A;  4G1Q A;  1ACM B;  2B7C B;  3GYX B;  1M1K T;  4G1I A;  2Q6B A;  2D1C A;  3DGP B;  2U2F A;  4RW7 A;  3CTR A;  3MOJ B;  2OPS A;  2NYH A;  1S6P A;  2A0F B;  3OTO J;  3BZQ A;  3PHE A;  4MT1 A;  3PX6 A;  4RW4 B;  2YNF A;  4KO0 A;  5AXK A;  2DY9 A;  4IQX A;  2EC0 A;  2CNN B;  3DXS X;  5KT5 A;  4BBY A;  2HHP A;  4WE1 B;  2CQ0 A;  4X4R A;  2ZVS A;  1NU4 A;  1NK9 A;  3B8H A;  4FKX A;  1HNI B;  3LH2 S;  1QY7 A;  4N56 A;  5IT0 A;  2HBR B;  2UXB J;  5BJR A;  1X4B A;  1RTD A;  4OYZ A;  1M90 T;  2W4P A;  2BE9 B;  4Y0F A;  5ETT A;  2ZNY A;  3AJD A;  3I5B A;  1REG X;  1EAY C;  2W2P P;  2KXH A;  1YBU A;  1Q5V A;  2OPR B;  2W8L A;  4DZ6 A;  5IT9 Y;  1TKX A;  4IFV A;  3T1H F;  2HHT A;  1XMO J;  4J90 A;  4CLZ A;  3GFX A;  2OTJ S;  1FER A;  4ZMM A;  4LSL A;  2FIU A;  1X5T A;  3CIZ A;  3MEK A;  3D3B J;  1NBE B;  2K1R B;  2DNG A;  3S1T A;  4RNN A;  2ABY A;  3PEH A;  2HQG A;  3W2V B;  4OFZ A;  1H2T Z;  3HFZ B;  4Q5V A;  1UET A;  4DV2 J;  3R7B B;  3BSN A;  3HK2 A;  4YB5 A;  4DPW A;  1CEZ A;  1XNR J;  2LLZ A;  4DV1 J;  4MKV A;  1NXI A;  2AGO A;  3OXG A;  4KR0 B;  1DLO A;  3G6Y A;  3R2C J;  2VG6 A;  1WI6 A;  4BLG A;  3K59 A;  1Y7P A;  4DR5 J;  1TL7 A;  3QBC A;  3AJ2 A;  2HRT A;  1N5Q A;  4JI8 J;  1KON A;  2XTJ P;  1WC3 A;  1NJY A;  4EO8 A;  3QFH A;  4ED3 A;  2PFF B;  1U6Z A;  3Q8P B;  4Q43 A;  4PXD A;  3CC2 S;  5D0E A;  1SI9 A;  4UST A;  4LRB A;  1HNX F;  3HI9 A;  4NCG A;  2W7P A;  3PRD A;  1NDK A;  2K2P A;  3PTW A;  3CJR A;  2R7R A;  1ZET A;  2DGX A;  3R8Y A;  4DR3 F;  5H9F K;  4C8Z A;  1S1T B;  2PI5 A;  5HRO A;  5KFQ A;  3DLL Q;  1SKS A;  1WEX A;  5L9N A;  2WON A;  3OL7 A;  2HHQ A;  1ZZN A;  1H0H B;  1G1X A;  1VLO A;  3QAT A;  4GKJ J;  4NLO A;  2NPI A;  2XS2 A;  4F7V A;  3OR2 A;  4CO5 A;  4OHZ A;  3CE8 A;  4CLK A;  3NCQ A;  3RAM A;  2GVD B;  1H7X A;  1G4C A;  3POT B;  4KH1 B;  4YR2 A;  2ASY A;  2IM2 A;  1N33 F;  4D3H A;  2XNQ A;  2W2O P;  1ZA1 B;  4DL5 A;  4L3K A;  3DFE A;  4N47 A;  4DWI A;  2JC0 A;  4R8U A;  1UTA A;  4PG4 A;  3IO1 A;  3M6U A;  4DR2 J;  1RT5 B;  4B3T J;  5D0G A;  4X65 F;  4ERD A;  3U02 A;  4USV A;  1SV5 A;  4ECZ A;  5G0R A;  3MMB B;  2QMW A;  1FCA A;  2QLB B;  4OYO A;  1REV A;  2CPX A;  5A8W B;  4H54 A;  2K3K A;  1RTJ A;  1HBO B;  4Q7A A;  3KLF A;  1WTB A;  3IM8 A;  2VA3 A;  4ZS6 A;  1RWW B;  4MKY A;  3V4M A;  2UXD F;  1P6T A;  3TJA A;  4K4W A;  3R3T A;  3OL6 A;  2IRX A;  4NA2 A;  3EVW A;  4C0B A;  2JH3 A;  2PEB A;  4JV5 F;  3HX9 A;  3HP6 A;  4F50 A;  3G82 B;  2BXJ A;  1JLC A;  3M30 B;  2R8J A;  1JLF A;  2B6A B;  2BAN B;  5T14 A;  1KEK A;  4ELV A;  4L76 A;  3G4S S;  1JXV A;  3CW2 C;  4ED1 A;  1HBU B;  4ZPT R;  4JI3 J;  2ZBC A;  1NK6 A;  2N4C A;  3KMS A;  3NLC A;  5HMZ A;  5F8G A;  1RWU A;  3MEE A;  4MKA A;  3IR5 B;  3FRY A;  1KFS A;  3KK2 B;  4C9D A;  4LSN B;  1B0T A;  2CZ9 A;  3MM9 B;  2WCX A;  3BF4 A;  3NOG A;  4NI2 A;  3QRQ A;  1RP5 A;  4HHH A;  2BAC A;  4JI4 J;  3GYG A;  4W92 B;  3P4U B;  5C25 B;  1QD1 A;  1HNV A;  3NS5 A;  1T3N A;  1Q7Y T;  3ISZ A;  2LXF A;  3KLE B;  5KOX A;  4QQB A;  4B9L A;  4DN9 A;  4YOE A;  5F0U A;  1HR0 J;  2I8E A;  1X4D A;  1GXL A;  4H4M A;  2OPQ A;  3RJM B;  3ZTO A;  2W24 A;  1DTT A;  5DG9 A;  2V8H A;  3LW5 C;  3ETM A;  2BX6 A;  2V4J A;  4B3S J;  1GXT A;  2W4D A;  2E7X A;  4J5O A;  1HQU A;  2CQG A;  1U0H B;  1RK8 A;  4QCL A;  1X9S A;  3IP0 A;  3BBC A;  1FKA F;  2CAJ A;  2HS3 A;  2I6W A;  5L38 A;  1RLC L;  4Q0B A;  1OQ6 A;  4F4Y A;  3FGV A;  1RA6 A;  2ZE2 A;  1FRI A;  2GC8 A;  5HQ8 A;  2HHW A;  1YZ7 A;  4ECS A;  2DR5 A;  4CRJ A;  3KLI B;  4F8R A;  1S1V A;  2HBY B;  5JMN A;  2JVR A;  2IMW P;  1F5B A;  2MKY A;  1KVJ A;  3ZZP A;  4QYZ K;  2HFN A;  3MM7 B;  1V3S A;  2VHG A;  4PWD A;  4WZQ A;  4WFA Q;  2MLX A;  4AL6 A;  1J5E J;  3C6T A;  4C8L A;  1H72 C;  2ZDP A;  1N0U A;  1IKV B;  3EZU A;  3A12 A;  1RTZ A;  4C8K A;  1F0X A;  4HTI A;  4JV0 A;  1JLQ A;  5HJX A;  2BEF A;  1VC5 A;  2ADC A;  2QA1 A;  1VIO A;  3LTO A;  4NAS A;  4RW6 A;  2PC6 A;  3G8Q A;  1WWH A;  1HD0 A;  4DR6 F;  4Y00 A;  1O5J A;  1EET B;  2Y0B B;  2JFK A;  1QSY A;  2QFJ A;  3I4H X;  3K17 A;  2CKW A;  3NY0 A;  1KS2 A;  5DDP C;  5KT3 A;  1FJE B;  3PO4 A;  3IAM 9;  4DOZ A;  1FWK A;  3FEY B;  4NXM F;  4A8X A;  1UVL A;  4ELT A;  4B9U A;  2FJB B;  1UPM B;  1R8H A;  3FQL A;  3UN5 A;  2YNI B;  2J7W A;  5KFD A;  2AJ2 A;  4DU8 A;  2DR8 A;  3HHL C;  2V9K A;  4JV2 A;  5DLG A;  4IO1 A;  1ZS6 A;  3K2Y A;  2HGN A;  4OHV A;  3HVR A;  3KNA A;  4TLQ A;  4P2M A;  3H5U A;  2R7X A;  2DNM A;  2ZBI A;  4DQR A;  2QO3 A;  2Z30 B;  3G8S A;  3EXC X;  1I5O B;  3GON A;  1T05 B;  2E66 A;  2E5G A;  2CJB A;  4XDD A;  1WC1 A;  1WTF A;  1TV6 B;  4AXJ A;  1EIY B;  2Q79 A;  4I6A A;  3JSB A;  1U24 A;  3FZ2 A;  2EKY A;  3O1L A;  4ILR A;  2PMW A;  2IJR A;  2JEJ A;  2P6S A;  2DIV A;  3OL9 A;  2GVZ B;  1ZTT A;  3IXQ A;  4A48 A;  4QIG A;  4BS2 A;  3LOU A;  3IGN A;  5D0R A;  1V9O A;  1N6Q B;  4IH7 A;  3M32 A;  4FYD A;  3V6H A;  2IPO B;  3KJN B;  6AT1 B;  1B0P A;  4O44 A;  2XHC A;  3T1A A;  1VQ8 S;  4FS1 A;  1DRZ A;  1AUS L;  2UV8 G;  2XGQ A;  1URN A;  4WTO B;  2W9B B;  2A6O A;  2BE7 D;  1S0N A;  1NHK L;  1RT7 A;  5KFO A;  1D9D A;  2VDI A;  3MCN A;  1GH8 A;  4CLP A;  3CED A;  2ZZN A;  3G6X A;  1D8Z A;  4WIQ A;  3UN3 A;  4TY8 B;  4HHJ A;  4CLY A;  5IWA J;  3PYE A;  4CH7 A;  1N4L A;  1Y3J A;  1VIS A;  3AXM A;  3A8J A;  2XI3 A;  5LSL A;  4PQU A;  3BGF A;  5KT4 A;  1KOO A;  2JL9 A;  3KHG A;  3NS7 B;  2HNY A;  4DI6 A;  3LP1 B;  3C14 B;  3LAK A;  1U1R A;  3TEG A;  4QIF A;  3IC1 A;  1RCO B;  4IG3 B;  4OQJ A;  2O01 C;  1EB0 A;  3PHT A;  2KG1 A;  1TK0 A;  2OEK A;  3KLG B;  4HH1 A;  1H3D A;  1TU0 B;  1YBA A;  3EDQ B;  2CRL A;  4DUZ F;  4L75 A;  2N4D A;  2UV8 A;  4K50 A;  3MD3 A;  2A18 A;  1CJU B;  2GAG C;  3I31 A;  3N28 A;  1NPP A;  4J37 A;  3T3F A;  4NML A;  1OSD A;  4ZN1 A;  2WHO A;  3M6V A;  4JI5 F;  5KFB A;  2Z58 B;  2W2N P;  4LFA J;  3HHK A;  4O0N A;  1N32 J;  5HI7 A;  4X2B A;  1H2V Z;  5IZH A;  5I3U B;  1WC5 A;  1LW0 A;  5J2Q A;  3MMJ A;  4QPX A;  4NYP A;  3BSO A;  1S99 A;  2HWH A;  2MJN A;  5A76 A;  4DX7 A;  2XMU A;  3OUY A;  3DMJ B;  4USU A;  1U2C A;  2VQF F;  5DET A;  3KXD A;  3H0P A;  3UCG A;  2J9D A;  2WW4 A;  3TA1 A;  2V5H G;  1LWF A;  1WAC A;  2H5I B;  2YX1 A;  4JB8 B;  4FYX B;  3MR6 A;  5IQQ A;  1HBM B;  4ILM A;  4KB7 A;  5ETV A;  2V8D A;  4X4U A;  1FX2 A;  2JEG A;  3FNN A;  3CD0 A;  3DM2 A;  1TKT B;  5H9E K;  4LIW A;  2XWY A;  5KFU A;  1O6X A;  3J7Z T;  1NHU A;  1VQ4 S;  3PJ9 A;  3AQP A;  5HVG A;  1IBL J;  1FT8 A;  2ZH5 A;  2MLZ A;  2B9X A;  2R2S A;  3M1V A;  3JQJ A;  3F41 A;  4NLG A;  3TAM A;  5H9F J;  1MU2 B;  3S8S A;  3PRV A;  2CPZ A;  2CG4 A;  1KQF B;  4KHM A;  1RU2 A;  5L9X A;  5ETR A;  4OL8 A;  3MAH A;  3DGP A;  3RR7 A;  3T5L A;  3MMA A;  4OJH A;  2ZJQ Q;  4J9N A;  4RW4 A;  3CJK A;  2ZBR A;  4K5R A;  2W7O A;  4U7U K;  3NGS A;  3PYG A;  5C42 B;  2KVQ E;  2BJ8 A;  3CJ4 A;  2FGC A;  4KKO B;  2ZH1 A;  4BC9 A;  3VZH A;  1NK0 A;  1BQX A;  5B0B A;  3QGP A;  3D6H B;  4DV5 F;  1HNI A;  5FLX Y;  4I1T A;  1FDA A;  4CWB A;  4LF5 J;  4A46 A;  2ZOF A;  1RT3 A;  3NAH A;  2WVF A;  4EU0 A;  1RHJ B;  4QYR A;  1HBN B;  1T3O A;  2ZKU A;  1V3Z A;  3CB4 A;  3KG1 A;  1UWB B;  2M88 A;  1NH8 A;  5GME A;  4CLT A;  3S7R A;  2KJW A;  2B56 A;  1VQL S;  3R5J B;  1ZOT A;  2OPR A;  4NA3 A;  1DAX A;  5IS2 A;  3GV5 B;  2FLO A;  2X1B A;  3DYA A;  2K7J A;  4CM0 A;  2ZJR Q;  4HHU A;  4I2Q B;  1Q0N A;  1BQN B;  5HVH A;  3MMC B;  4F4K A;  4U7C A;  4LF7 J;  4WFX A;  2G0I A;  4LVN P;  2DNZ A;  4ICL B;  1Z2L A;  5IC6 B;  2ROP A;  1YHQ S;  1RHQ B;  3I55 S;  4EI2 A;  1SC4 B;  1U2R A;  1CG2 A;  2K1R A;  4PG6 A;  1VK3 A;  3OFF A;  4WF9 Q;  2J5A A;  4ZVE A;  3M8S A;  1AB8 A;  4DV7 J;  2VON A;  5KAK A;  3V6D B;  4OV6 A;  4PG8 A;  2UP1 A;  3EWG A;  1PYT A;  4Y6I A;  1Q4R A;  2L41 A;  1QTM A;  3G96 A;  4JI6 J;  5D3G B;  2FVC A;  1FJG J;  1SL0 A;  1M5V C;  2POK A;  3OVB A;  3DU5 A;  4ZVT B;  2VQE F;  1XNQ F;  3UD5 A;  3RUB L;  2QEX S;  1H74 A;  1JLA B;  3LP2 B;  2OKQ A;  1KBR A;  4C2M A;  4KPC A;  2OLW A;  1GXU A;  3U1M A;  1VS3 A;  2RML A;  2DIS A;  1YI2 S;  5IM0 A;  3F73 A;  1FTR A;  1LW2 B;  1CJT B;  2XWX A;  4J7C A;  2V0N A;  2YQ0 A;  2CZ4 A;  1WDT A;  2DXF A;  2OEL A;  1U4B A;  1T03 B;  3CCZ A;  4QWA A;  1N48 A;  2C1E B;  3SFG A;  9ATC B;  8RUC A;  3FCW A;  1U48 A;  2JEF A;  1U09 A;  5A8R B;  4K0K J;  5AE3 A;  1FES A;  1F3F A;  5CA5 A;  1W2B R;  1QLN A;  1S1T A;  1U1O A;  3VAJ A;  4N76 A;  4M5D B;  3JSR A;  4OYW A;  1KKH A;  5D8H B;  3TI0 A;  2I5J A;  1YJ9 S;  2YBV A;  2Z2M A;  3DLK B;  4DF4 A;  4DJB A;  4FF2 A;  5CCM A;  1U1K A;  3CJT A;  3GU0 A;  4X4N A;  2GVD A;  1TQL A;  3N9U C;  3POT A;  3K0J A;  2CPE A;  1IM6 A;  1N56 A;  3NWG A;  1SJ3 P;  4HTJ A;  2MGZ A;  3DDI A;  3SCK E;  2MKC A;  3DNC A;  1B4S A;  3A8K A;  4EGL A;  1MN9 A;  5SUH A;  4PUO B;  1KQK A;  1UMJ A;  3GFZ A;  4J9V A;  5LMN J;  2FC9 A;  2R2R A;  3BYP A;  3JYT A;  4ECX A;  1S49 A;  1SKR A;  5LSO A;  3MMB A;  1U1N A;  3TJ8 A;  2AJ1 A;  2VFT A;  5ETN A;  4Y65 A;  2PO4 A;  4EBE A;  3WZ0 A;  2KFZ A;  3GIJ A;  1CJK A;  3I5C A;  5FJ4 A;  2FZK B;  5A8W A;  3SSS A;  1HI8 A;  3MUM P;  2EFP A;  4KV8 A;  3K8V A;  2R7O A;  1H2U X;  3J81 j;  3K5P A;  3V5R A;  1P27 B;  3M2R A;  1JLE A;  4DR1 F;  3N5F A;  2RS2 A;  4YP3 A;  2E9R X;  2X1A A;  3BQ1 A;  2IDE A;  4TVA B;  4FNH A;  3X3U A;  3I4P A;  3D1Q A;  2HQ3 A;  4OZ5 A;  2DRD A;  1RKI A;  2Z2Z A;  1ZAX A;  3G82 A;  2BE2 A;  2XO7 A;  3M30 A;  5KG4 A;  1LWX A;  5DDO C;  1N5T A;  4C97 A;  2AYB A;  2UUA J;  1FWP A;  1S4E A;  2BAN A;  3M2V B;  3KOA A;  2B43 A;  3HKZ D;  3ADA C;  3NRB A;  4UUW A;  1YWX A;  3V6K A;  1HBU A;  2B8P A;  2KZM A;  3T19 A;  3KHL A;  2PD1 A;  1UFK A;  1VQ9 S;  1X4C A;  1DQ8 A;  2BM1 A;  3ILJ A;  4LR8 A;  1G6B A;  2HW3 A;  1UCN A;  2GZO A;  4ZLN A;  3ZC4 A;  3W9I A;  3LUY A;  3KK2 A;  4LSN A;  3C6U B;  2HMI A;  3A3O B;  2VUG A;  1RTI B;  1HI1 A;  3O5T B;  1QE1 B;  4OHX A;  4MJK A;  4ZPB A;  3J7Y I;  4MIA A;  4GKK F;  2KT2 A;  2PSZ A;  4ED6 A;  1KNZ A;  2QL7 B;  1VR6 A;  4YEA A;  4ED4 A;  1WC0 A;  2AJQ A;  1HLW A;  1U1M A;  1EKR A;  2FB0 A;  5KFI A;  2MXY A;  1C1B B;  2BRL A;  3IWX A;  4C8O A;  3E8O A;  3OL8 A;  3PW2 A;  1RT4 A;  2HHH F;  2DNR A;  1U0H A;  1U02 A;  3CCJ S;  2A2C A;  2UUW A;  4A8M P;  1I94 F;  3ZNU A;  3DLG B;  1T9X A;  2CQB A;  2HWT A;  2RSQ A;  1KTV A;  2UUC F;  2B8Q A;  3MPW A;  4B9M A;  3DLE B;  3EM1 A;  2CDQ A;  4DPT A;  1JLG B;  4PAB A;  2HHU A;  1UJ6 A;  2XMW A;  4ZJO A;  2C2K B;  2OP5 A;  2WK4 A;  2KB2 A;  3ETO A;  2LFV A;  2M5Y A;  1TK5 A;  1GMV A;  5A6W A;  4KT0 C;  3LF0 A;  2N3L A;  4ETX A;  4DQS A;  3ZTQ A;  4P7V A;  3SV3 A;  3ELH A;  2YX4 A;  2JLG A;  3MM7 A;  4OHY A;  2QLW A;  4WP3 A;  3KHR A;  3I0S B;  3D5M A;  1R8C A;  3KJV B;  3H40 A;  1IKV A;  4KBI A;  2F8H A;  2Q66 A;  1WOO A;  3HO1 A;  1YRU A;  2ZH9 A;  5A0Y B;  1OJ4 A;  1PG5 B;  5KFE A;  1IBC B;  1RAB B;  3U7J A;  4ATN A;  3OSP A;  3BS9 A;  1XC9 A;  2EPI A;  1ZYQ A;  2EFG A;  1EET A;  4L73 A;  1F6T A;  1T0T V;  2F8M A;  3PYD A;  2XLK A;  1J5O B;  4LUB A;  2CPH A;  1SJF A;  2BJ7 A;  4ZPC A;  1G7C B;  2CWX A;  4J9M A;  3QAU A;  4DV0 F;  2R2T A;  1XJW B;  4P2S A;  3TX0 A;  4Y2K A;  4EWT A;  3R6G B;  3W5Z A;  2D3O 1;  1U6B A;  2YNI A;  4DQQ A;  3QWU A;  1NB7 A;  3TEH B;  2BOA A;  2MKS A;  3DLB A;  2O67 A;  4LF9 J;  5JJB A;  4K4T A;  1AFI A;  4C3K A;  5KG6 A;  4R0J A;  2J7U A;  2CAD A;  2XQC A;  3TA2 A;  1T05 A;  2WBM A;  1BY9 A;  5GAH I;  2F1F A;  3WHI A;  1EKS A;  1GMW A;  1TV6 A;  3VAK A;  1X4A A;  1VOM A;  3T1H J;  3ZZ0 A;  3LQV A;  2EI5 A;  1NUE A;  5H9E J;  1UEV A;  1JKH B;  2Q1L A;  3D28 A;  1U8S A;  2H9Z A;  5KFC A;  1VRT B;  2GVZ A;  4X66 J;  1B3T A;  2MYF A;  2V8V A;  1OSC A;  2OIH A;  3SQG A;  4I2P A;  3GFH A;  1VQK S;  3ENQ A;  3TQ1 A;  3HT0 A;  4AD6 A;  5CZV A;  3TP2 A;  2N82 B;  2EFN A;  3JS9 A;  5CCL A;  2J6U A;  4ID8 A;  3THP A;  4PXB A;  4X4O A;  4L72 B;  4AFF A;  2WBR A;  2NXJ A;  2MZ1 A;  2CJX B;  2LXU A;  2MMY A;  2QL5 B;  2A6M A;  3MAQ A;  5JXS A;  1FKO A;  2QYC A;  2QA4 G;  1VMB A;  2YKA A;  4IDK A;  2AU0 A;  3O2I A;  5E3A A;  4CLS A;  4DG1 B;  4CT9 A;  2FJW A;  4ZCM A;  2XMJ A;  5HMW A;  1F9H A;  1PKU A;  3I0R B;  4QWE A;  3OLA A;  4C0H A;  3ZZO A;  4LRF A;  3PR5 B;  2C2R A;  3VAG A;  1L5U A;  3DRX A;  4X4P A;  2DGU A;  2Y8Y A;  1NJX A;  1K47 A;  2DO4 A;  4DR3 J;  4TNO A;  3CSK A;  3R5B A;  3LP1 A;  4URQ U;  2HBQ B;  3F56 A;  1GFW B;  1N34 F;  4IO9 Q;  2FLL A;  4GMK A;  4EZ9 A;  5I4M A;  4B02 A;  2CNL B;  3RYL A;  3C15 B;  4LBH A;  3BBB A;  3R1H A;  3TZZ A;  1CJU A;  5LOQ A;  3IWL A;  2DO0 A;  1WEY A;  1CS4 A;  3G6V A;  3HVT A;  4G1Q B;  3M8R A;  4P75 A;  4OI6 A;  3ZZT A;  1VQS A;  3IR7 B;  2APO A;  4PR6 A;  2GJI A;  4ER8 A;  4OZL A;  5I3U A;  3J7A N;  4O4R A;  5HLF B;  3RGI A;  2E7W A;  1FJC A;  2ZNZ A;  3QT8 A;  2BW7 A;  4OI4 A;  4WCE Q;  2YNF B;  1S4F A;  4JI7 F;  5B0E A;  1Z1Z A;  5FLX U;  3KNG A;  4LR7 A;  2EC2 A;  3HDS A;  2AYG A;  4XPC A;  4NWB A;  3FBE A;  1T9V A;  2YTC A;  4CLL A;  3VGS A;  3G86 A;  3KK3 B;  2AZ1 A;  2KZZ A;  4Y2M A;  5F8H A;  3PW7 A;  1TKT A;  2V69 A;  1TL4 A;  3HJV A;  4AL5 A;  3VZI A;  4N77 A;  4WYW A;  4UOC A;  1YBT A;  1E6V A;  1FRH A;  3SIP B;  1Q81 T;  5D0H A;  2ADB A;  3CWJ A;  4EK2 A;  5B7W A;  1CQM A;  5DG8 A;  4ZIV A;  1RWN B;  2W2M P;  1S10 A;  5MLC V;  1T94 A;  4HKQ A;  4HI2 A;  3RRK A;  2XLJ A;  4UF4 A;  4O3P A;  1QDU B;  1NJZ A;  4M1K A;  4LSL B;  1WEL A;  4B3R F;  4OZ0 A;  5GAH U;  3KLH A;  3GV7 B;  2UU9 F;  5E3P A;  2PT0 A;  3JTP A;  4PPZ A;  1R89 A;  4RUB A;  4ECY A;  5HMY A;  1TMM A;  2ASJ A;  3K5M A;  2BAB A;  1KP6 A;  1SQG A;  1NHV A;  4OHW A;  4CLF A;  1SH0 A;  3U27 A;  2IJF A;  1OS5 A;  2XMM A;  1NB2 A;  4FYV B;  4FXW A;  1CJV A;  4MYT A;  2MZR A;  2P5V A;  3MDF A;  2FJX A;  1Y5N B;  2ZHA A;  1DLO B;  3PY8 A;  2VG6 B;  3M9M B;  3BGL A;  5I42 A;  2NXU A;  1F2G A;  4DS5 A;  3R2D J;  3A4T A;  4DV3 J;  5BYR A;  1RYR A;  4CIO A;  3I9Z A;  1FD2 A;  1GX5 A;  3HD1 A;  1S5Z A;  3U1L A;  3UQS A;  4LVO P;  4X4V A;  1QAY A;  2XY6 A;  2C2Z B;  3MUT P;  2VBW A;  3NGT A;  1ZZF A;  3GFY A;  3MMC A;  4ZVS B;  2OTL S;  3AQO A;  4ICL A;  1C4C A;  5F0W A;  2R2U A;  1C0T A;  1DTQ B;  1IQT A;  1CVJ A;  2ACY A;  3OXL A;  4LF4 F;  2FUG 9;  4YB7 A;  1X7V A;  2WON B;  3IAS 9;  1SXL A;  3HHL B;  3N6M A;  4ZOS A;  2FJE B;  2JWN A;  2ASD A;  3MWB A;  3TO8 A;  3W60 A;  3CCR S;  3V6D A;  2K06 A;  1RWX B;  2CNO B;  1JNZ B;  3OR2 B;  4NLX A;  4KHP J;  1K73 T;  2CNK B;  2VA2 A;  2MKJ A;  4V1A k;  4ELU A;  1WSR A;  4W90 B;  1Y3K A;  3R97 A;  3HF5 A;  1JLA A;  2HGL A;  2BKN A;  5HVF A;  1VQP S;  4DL3 A;  3MAA B;  2DNN A;  3OTD A;  1MN7 A;  1VDH A;  3UCU P;  3D0G E;  1CLF A;  4OZ3 A;  1S1W A;  2J9C A;  4NLD A;  4WK1 A;  4TYB A;  4QOT A;  1SV5 B;  1Q53 A;  5LXY A;  2ZH4 A;  1PC5 A;  1WHX A;  2FHK A;  4BWM A;  3TW0 A;  2MST A;  3HVW A;  1REV B;  1KHW A;  3M9O B;  1WKL A;  2FZC B;  2YQ1 A;  2DRA A;  4ID5 A;  1MMN A;  2GIF A;  2LEA A;  3N79 A;  2DY1 A;  5A8R A;  4I7F A;  3IBW A;  1RTJ B;  4WWS A;  3MHY A;  3KLF B;  2G2Z A;  1VJQ A;  2XYP B;  4LFB J;  1HQE A;  4P73 A;  2XCA A;  2DR6 A;  2L9W A;  4M5D A;  2AJ4 A;  4FBU A;  1SC6 A;  3RU0 A;  3T5H A;  2MJU A;  1LFW A;  2UVW A;  2COL A;  1SL1 A;  1JLC B;  3T41 A;  4IQM A;  4XIU A;  1VBY A;  1ZAW A;  3QFW A;  3J7A 1;  1KHV A;  3T6B A;  4TQS A;  1K0V A;  4PWU A;  4ZVH A;  4ZLJ A;  2LXI A;  1S6Q A;  5DZ6 A;  4PUO A;  1FRM A;  2MPU A;  3GIL A;  2P9C A;  3MUR P;  2JZ5 A;  3EE3 A;  3ZZY A;  3MM5 A;  3KUH A;  5KFS A;  2YWE A;  3L3C A;  4FNI A;  1IBM J;  3BDP A;  3AJ1 A;  2ROE A;  4ED0 A;  3FRZ A;  4PG5 A;  1PCA A;  3MXH P;  2XGP A;  2FVP A;  4LFC J;  2N7Y A;  2OD6 A;  3EDR B;  1DFD A;  5GAE I;  2BMB A;  2B5J B;  3TAN A;  4ZP8 A;  2W01 A;  1TR0 A;  4H4M B;  5DM6 Q;  2MY7 A;  3ISN D;  2E5L F;  3PJX A;  1RA7 A;  2DH8 A;  3MFH A;  3FJ2 A;  4FYW B;  2CVE A;  2QJ3 A;  1H73 A;  2YH0 A;  1DTT B;  2E7V A;  4DCJ B;  5GVQ A;  5BYQ A;  2V4J B;  3NOC A;  1HQU B;  1BUX A;  3TYT A;  2NYI A;  1OQ3 A;  1FRX A;  3Q8Y A;  4GVB A;  1V6H A;  4X4T A;  2ZC3 A;  2R9L A;  1X0P A;  2LEB A;  4Z7C A;  4K4V A;  4CLW A;  3OQ2 A;  3M8P A;  3CJQ A;  1U2F A;  5BR8 F;  3WDO A;  3NGU A;  3GMG A;  1R3N A;  1NK7 A;  4DV4 J;  2DPJ A;  4QIV A;  4B9T A;  4B9N A;  4TY9 A;  1XBW A;  3OTO F;  3PV8 A;  5KT7 A;  1QE1 A;  3FBF A;  2DXE A;  4ZVR B;  1VCT A;  2IY5 B;  5DJB A;  4KC5 A;  5E33 A;  9RUB A;  1WUU A;  2MZQ A;  3V4I B;  3TUP A;  2ZHB A;  1S0M A;  4E8U A;  4DUZ J;  4ZPW R;  2UXB F;  2WB1 D;  2QZ8 A;  2VOP A;  3IA0 A;  4PEO A;  2E5H A;  3DRS B;  2KYZ A;  1PJ6 A;  2RRA A;  1KSP A;  3CCV S;  1JX4 A;  4RW6 B;  1Q8L A;  1YG0 A;  4I68 A;  1DY3 A;  3T5J A;  2RUG A;  5F8N A;  3SCL E;  2W9C A;  3JQM A;  2QLF B;  1Z2Z A;  4LT6 A;  4I56 A;  4XTT A;  3QJP A;  4TYA A;  5IOL A;  2RF2 A;  3NCP A;  1XMO F;  2XEX A;  1D9F A;  4FPR A;  3PYF A;  1TK8 A;  2DYA A;  4NCB A;  2VQF J;  3M05 A;  4IG0 A;  1QSS A;  4F36 A;  1RAH B;  4H4O A;  1FXR A;  3EZO A;  1OY6 A;  3P96 A;  4HI1 A;  1VQ5 S;  5KG3 A;  1SJ4 P;  3GJQ B;  2WOM B;  4UUX A;  4EFA C;  3QYY A;  2BJD A;  3LWM A;  4UTG A;  4DV2 F;  5KG5 A;  3ZZR A;  3KJV A;  3D4J A;  5GAG I;  3L7O A;  4ED7 A;  4DV1 F;  3QMQ A;  3DU6 A;  1CQN A;  4ZVO B;  1F2H A;  4FF3 A;  5A0Y A;  2DJW A;  2D41 A;  1HMV A;  2YPY A;  3BN7 A;  1UL3 A;  4JI8 F;  2M0G B;  4J9L A;  1FX4 A;  3W65 A;  5B08 A;  1IWA A;  3ITH A;  3PIP Q;  1J5O A;  4CO1 A;  1UAW A;  2V6A A;  3NL0 A;  3GIR A;  3W62 A;  2QL9 B;  2H4W B;  1R43 A;  5CYQ A;  2XMK A;  1ZM3 A;  1NEE A;  2R7V A;  3ILL A;  3R5C A;  1BE4 A;  1A9N B;  1TZ0 A;  2CZV C;  4WPA A;  1W7W A;  3WX4 A;  4I64 A;  3WQP A;  3PIO Q;  5L1K A;  3J81 Y;  4DV5 J;  1FTC A;  5DQG A;  1CPZ A;  1RT7 B;  1ARO P;  4GKJ F;  2MQP A;  3BO2 A;  1WSV A; 
#chains in the Genus database with same CATH homology
 4LF5 J;  2F4V J;  3T1H J;  2UUA J;  4JI5 J;  1XMQ J;  5FLX U;  2UXD J;  4DUZ J;  3JAM U;  3T1Y J;  1IBK J;  5LMU J;  4KHP J;  1XMO J;  4KYZ A;  2UXC J;  1IBL J;  4DR3 J;  5LMN J;  4JI1 J;  4V1A k;  4YY3 J;  4X66 J;  4JV5 J;  1HNW J;  4DR4 J;  4AQY J;  4OX9 J;  2ZM6 J;  3J80 U;  4X62 J;  4DR1 J;  2UUB J;  4JI4 J;  5A2Q U;  3D3B J;  4DR7 J;  3OTO J;  3R2D J;  1N33 J;  2MEW A;  4JI2 J;  4NEY A;  4HHU A;  2KL8 A;  5LM7 E;  1N36 J;  4B3M J;  4B3R J;  4DV3 J;  4NXN J;  4LFA J;  2MTL A;  2UU9 J;  4LF7 J;  1N32 J;  4DR6 J;  5BR8 J;  4K0K J;  4LF4 J;  1HR0 J;  4LF8 J;  4JYA J;  1J5E J;  4GKK J;  4GKJ J;  4NEZ A;  4JI0 J;  4PWW A;  4X65 J;  2VQE J;  4JI7 J;  4DV2 J;  1IBM J;  4LF9 J;  2VQF J;  4DV6 J;  3IMQ J;  5IWA J;  4DV4 J;  2HHH J;  3J81 U;  4KY3 A;  1XNR J;  4DV1 J;  5AJ3 J;  1HNX J;  2E5L J;  4DV7 J;  4B3S J;  1HNZ J;  4YHH J;  2UXB J;  4RJV A;  4DUY J;  3R2C J;  1I94 J;  3J7A N;  4NXM J;  2KVQ E;  4X64 J;  4DR5 J;  4LFC J;  2MQ8 A;  4LFB J;  4DV5 J;  2UUC J;  1XNQ J;  4JI8 J;  1N34 J;  3W1Y C;  4JI6 J;  5IT9 U;  1FJG J;  3D3C J;  4DV0 J;  4DR2 J;  4JI3 J;  4B3T J;  4LF6 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...