4DUYJ

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 16
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4duyJ00
4B3TJ 1HNXJ 4DV5J 5LMUJ 4B3RJ 1I94J 2E5LJ 4DR5J 5AJ3J 1XMOJ 4K0KJ 4KYZA 3R2DJ 4AQYJ 4DR6J 3D3CJ 2F4VJ 4LF7J 4DV3J 4JI0J 4DUZJ 4DR4J 4DUYJ 4DR3J 3W1YC 4V1Ak 4DV2J 4JI1J 4B3SJ 5IWAJ 4DV6J 4LF8J 3R2CJ 3J80U 3T1HJ 2HHHJ 4DV7J 4LF4J 4NXMJ 2VQEJ 4X64J 5LMNJ 1IBKJ 2UUCJ 4RJVA 4PWWA 2UU9J 2KL8A 1HNZJ 3OTOJ 5IT9U 1HR0J 3JAMU 4JYAJ 2UXBJ 2KVQE 4DV0J 2UUAJ 2MTLA 2UXDJ 4DR2J 4LFCJ 4DR7J 1HNWJ 4GKKJ 4GKJJ 4JI6J 1N36J 3T1YJ 1J5EJ 5BR8J 1IBLJ 2MQ8A 4DV1J 4JI2J 4NXNJ 3D3BJ 4YHHJ 1N33J 1FJGJ 4JI8J 4HHUA 4JV5J 4B3MJ 2UXCJ 1XNRJ 4YY3J 4KHPJ 1IBMJ 2MEWA 4LF5J 4NEZA 4X65J 4X66J 3IMQJ 4JI3J 5FLXU 4JI7J 4LF6J 4LF9J 4JI5J 4X62J 4JI4J 1XNQJ 3J7AN 1N34J 2ZM6J 5LM7E 1XMQJ 2UUBJ 4DR1J 4LFBJ 3J81U 2VQFJ 4DV4J 5A2QU 1N32J 4NEYA 4KY3A 4OX9J 4LFAJ
chains in the Genus database with same CATH superfamily
3VQTA 1D1UA 1KLMB 3RYLA 4KB7A 3FBEA 2UVVA 2B7BB 5F9NA 1NH8A 5SUHA 5DG7A 1WNEA 2XBPA 4OZNA 1N5TA 1HNXF 5AE3A 1B7YB 1DQ8A 3SIPB 3GIIA 4EO8A 1JLFB 5ETVA 2ZEJA 3A13A 1WHVA 1X4BA 1N6QB 2R9LA 3D6FB 3CJ2A 3I0SB 3I9V9 3HVWA 1H74A 1M5VC 1OYEA 1U0SA 4FDFA 1RAOA 4Y6IA 3BDPA 4I0WA 4FF4A 1UEUA 1UA0A 1RLDA 4UUWA 4CLYA 5E0OA 5ETRA 2NREA 3DGVA 2UZAA 5IM0A 5DZ6A 2MKIA 2BRLA 4ED7A 3I9ZA 3LP1A 4CLLA 4M5NA 2KJVA 3ZTRA 1T9XA 4USHA 3FMWA 4WTOB 2NQPA 2D74B 2ZE2B 5CZXA 1WG4A 4DX8H 5ETPA 4YDDB 2X3GA 4P2FA 3IBFB 1I1GA 4C8ZA 3FK4A 4IFVA 3UCGA 1VLOA 4X4QA 2DGXA 1YBTA 1NEEA 5K14A 2GQQA 1H73A 3R5CA 3ILIA 3TEGA 3FBFA 4QPXA 2DHHA 1VDHA 7FDRA 2CIMA 2ZBPA 3DYAB 1NMEB 2ZHBA 4ZS6A 4DPXA 4KFBA 3MHYA 3KKFA 5KFHA 1EQMA 2JWNA 3PW4A 1IBLJ 1P6TA 4FBUA 2J5AA 1WD6A 2HWTA 4YMEA 4DR2F 4LFCF 4DR7F 1HW9A 1X9MA 4ZPCA 3T1YF 1VQ5S 3AD8C 1BC6A 2I5JA 4QYRA 3G6VA 2CPEA 2J9EA 4FF3A 3QZ8A 3M7VA 3TW0A 1PCAA 4O23A 4RUHA 2DNMA 1HQUA 4DL4A 3BO3A 4U7UD 1WC3A 5KFYA 4FF2A 3R5JB 3BBCA 4RW4B 2C2RA 3TVZA 3VVUA 4H54A 4OIXA 3QGIA 4YDXA 5E3CA 3D6TB 4RNNA 4DG1A 5M2UA 3QIPA 4LRFA 1VC6A 4CIOA 2MTLA 2YNHA 3BKUA 3DN9A 3RBXA 3DLKA 3OPKA 1FKOB 2XCAA 1P9QC 1K0VA 3BDEA 1HBOB 2JSXA 4EWTA 4DLGA 5KTQA 3UDVA 1AT1B 1KKHA 2P6SA 3GIKA 2L9WA 3UDCA 2N4CA 2BX6A 3S8SA 2ZH9A 3FEZA 4KKOB 4RBVA 2F5GA 3W5XA 3ZNJ1 3TAMA 1VBXA 2WCXA 5HVHA 1IR0A 1G2EA 2D9PA 4Q7AA 2A18A 4X62F 1IJFB 5HQMA 2CUYA 2W2OP 2NYHA 1QSLA 4AQYJ 2DNPA 3K8VA 2OEKA 3GMGA 4ECZA 1XMQF 2Q79A 4P7VA 3W8PA 2XHCA 2XMKA 4BWMA 2VFSA 2FHJA 1QDUB 1RJJA 1SV5A 5KT2A 4K4UA 8ATCB 2HFZA 4IRKA 1Y9OA 4MIAA 2UXBJ 2L48A 2ASJA 1S1WA 5ETMA 1CJVB 2MYFA 2IPOB 4WXWA 1T05A 4RX6A 5KFTA 3PW0A 1RAHB 2Z2ZA 1T02A 2DNQA 1YSJA 1Z2ZA 4CNZA 2A6OA 4I64A 4DPWA 4B9VA 4P52A 1TAQA 3OUYB 1TUWA 3AOAA 1FKPB 3BGUA 2KYXA 1VISA 4JI3F 2GJIA 2BYCA 2MJUA 3N5FA 3JSYA 1F2HA 1NCLA 4OYMA 1RT7A 3ENWA 4LBHA 3FJ2A 5IFMA 4NMXA 5J1EA 3ZTSA 2DTJA 1QE1A 5A8WB 2VOPA 1REVB 2DGUA 2VFRA 5L1LA 1RI7A 2BM0A 3BYPA 3FCHA 2ZDPA 2K1RA 3RR7A 4Q8FA 1C1BB 1DBDA 5KFXA 4PG6A 2WRMA 4F50A 4F0KA 3EJMA 5KFKA 4LRBA 1R8CA 2AP6A 3IO1A 3MURP 4KHPJ 2ZJPQ 3PJ9A 4P6QA 4J37A 2HAIA 4B3OB 2SXLA 1GFWB 5C24A 2CVIA 4FVCA 1AFIA 4O44B 5D4OA 4A8KA 2GO9A 5C25A 4KV8A 1NK0A 2VODA 1A9NB 3OTBA 4WYWA 3ZO7A 1SC3B 2RUGA 2F40A 3KG0A 4B3TF 3MM9B 1JLGB 1JLEA 2I2YA 2OAUA 5HROA 3OL8A 4EBCA 2UUWA 3BSNA 1KOHA 2QYGA 1OIAA 1TL7B 4WZQA 2Y8WA 1HI0P 1H2UX 3CT9A 3THTA 4EYIB 5JMNA 4MKAA 1FRLA 4K7QA 3G87A 1TMJA 3G8QA 2DGTA 3K7RA 1B7FA 2A0FB 2VQEF 2LQ5A 3W62A 4ZA1A 4P73A 1FJEB 4Y2IA 4DV1J 4E8UA 4DN9A 4YY3J 4OZ0A 3V81A 3PRVA 2NXEA 3QIDA 5FLXU 1LWEA 4UOFA 1O8BA 3J7AN 3PV8A 1T9WA 3MEDA 3OHAA 5A2QU 4IR9A 3ZZTA 1X9WA 4IO1A 5FDLA 2BJDA 2IIHA 1W25A 2CPFA 2CFXA 4C0HA 2YWEA 4K4XA 4ID5B 3L9ZA 4FYYB 4IG3A 1UKUA 1FK9A 1O6XA 3PXGa 4LF8J 3UN5A 1F0XA 2F63A 5EUHA 4FVMA 3V6DA 2HLUA 3PM9A 5B0GA 3NS6A 2XS7A 1FFWB 4M5LA 2UVUA 1ZAVA 3HD1A 3PYDA 1WOPA 4OHXA 2GIQA 3ITHA 2FIUA 1RWMB 2JJ4D 1XNRJ 1U45A 3CE8A 5D3GA 3WHIA 3BJYA 4EBDA 5K8MA 3RBEA 1HKAA 3QNWB 2AKWB 5AE2A 3SBMA 3DLHA 1HI8A 2V4QA 4DJBA 4M8LA 5D6GA 2VBYA 3MD1A 2FJBB 3ETOA 5KFEA 3S6EA 2OGUA 1UMJA 3E51A 5DQHA 2C28A 3CMES 1FDNA 2A1BA 4ZN1A 4DV4F 3CDAA 2B4OA 2BBEA 1Q81T 5DDPC 5ETOA 4CYUA 4O3OA 4KH0B 3CCWA 3DOKA 1IXKA 3IBWA 3QMQA 2HNYA 3CNQP 1T11A 1K44A 1VQSA 2J6TA 4U67Q 3KDNA 1VRTB 4F4ZA 2VASA 1S4FA 1FFGB 4ZVEA 2RB7A 1TKDA 3MECB 2B4PA 2ATCB 2OKQA 4OI3A 3I32A 1LXNA 1U1OA 1T03A 2GZOA 3F56A 2FVPA 2ZOGA 2FGOA 1MMLA 3ONQA 3UR3C 4KTQA 2YNIB 4JI8J 1FXLA 4K59A 2Z4PA 4NRUA 2OTLS 5K8OA 2E9RX 3QSYB 1FD2A 4NLSA 2YWWA 4HH1A 4I56A 2K7KA 4JBCA 2EFPA 1U47A 4N8OA 1FTCA 3W2VB 2L08A 1VQ6S 3RRHA 4ER8A 2BANB 4M5IA 2I8EA 2GHWA 1PBAA 1IKYB 1RT6B 3OQ2A 4B9SA 3IWXA 1S1VA 3MD3A 1D0EA 3CMQA 5KFNA 2MQPA 3PYEA 2MZ1A 2MQQA 3CXCR 4GO5X 4NYZA 5DDQC 1Q8LA 1AA1B 4TYBA 3NAIA 1IM6A 1PAUB 4DX6A 4DX7A 3G71S 1LWCA 5KFDA 1FDAA 5HK4A 2OPRB 3TUZC 1S0NA 4OYZA 1NSKL 3N01A 4EZ6A 3P3DA 2E5IA 2OPQA 1HYSA 1H2VZ 2HQ3A 4ZVFA 1NDKA 2ROEA 2ZVIA 1RA6A 3FRYA 4PQAA 2C2DA 1S0OA 4X65J 1JJHA 2KG0A 2E5GA 1J5EF 2F1FA 2WBRA 1SJ1A 4USIA 3TAQA 3VHQA 1WWHA 5L1JA 3PRDA 3CC4S 1UPMB 4LF1A 5JVHQ 2XY7A 1JXEA 3CCJS 2MPUA 4LREA 2VQFF 1R0AB 1TUGB 2AZ3A 5I3QA 1VK3A 1R8BA 2Z56B 4NA3A 1PGZA 1TL5A 1WG5A 2I38A 4UT4A 2XY5A 4CWBA 4GO7X 2IMWP 2FC8A 4PWWA 4ED3A 2W2QP 1R31A 2QTWA 7FD1A 1SPBP 4QR1A 1ZYQA 1RAJA 3ILLA 4KGKA 1WEXA 1I6JA 1SJ3P 4DU8A 4RL1A 3MM6A 1RHMB 4PYDA 2YX1A 1C1CA 1MG7A 2EG2A 4UUXA 2R7VA 1IBMJ 1U25A 2EPIA 4L6V3 1FE0A 1KN6A 4DBQA 1OWXA 2OD6A 2QMWA 2CG8A 4LJMA 4LMZA 4RNHA 3M8PB 2QSFA 3VZHA 2DRAA 1GT8A 3A3OB 3A8IA 2KVIA 2W7AA 2N82B 3TUPA 2GV1A 3DRYA 1QY7A 2EXUA 1VOMA 4A8QA 1U6BA 1PYOB 1V9OA 4RPFA 4DI6A 5CABA 3OL6A 2W25A 3KJVB 2HHHJ 2FUG9 1QAIA 1M1KT 1Q0NA 5LMNJ 2GVZB 1SUQA 1RE1B 2DR9A 2D3UA 1U1RA 4WU3A 2OHDA 1RCOB 1FRJA 2DXDA 3OR2A 1D8ZA 4L73A 3GE9A 5CYQA 4ZHRB 1YJUA 5ETSA 3BF4A 3GFYA 2XI2A 1OY8A 3HHLA 4YB5A 4X66J 2ASYA 3R1HA 3KXDA 3AJ2A 5J2NB 3J80Y 2AJFE 1BWEA 2CPYA 2MMYA 4AE5A 1U26A 4WZMA 2UUBJ 3JTPA 1EQ0A 4NEYA 3KLFA 4OX9J 3TWZA 3KLGB 2VDIA 2Y0SD 2V0NA 2ZOMA 3FSYA 4PG4A 3D67A 3UVJB 3OTCA 1NHVA 4LF7J 4NL5A 3W61A 3GV5B 3M6XA 2HHPA 1YITS 3K2YA 3PR4A 5IXUA 1U09A 4V1Ak 5K8PA 2LVWA 2VPZB 2YBVA 2QSWA 2HYIB 2YH0A 2AV5A 4R8UA 2YPZA 4I6WA 4ZPAA 1TL1A 3D28A 4ZVQB 1K1SA 1RT1A 4HH0A 3CC2S 2GGPA 2BRKA 5MAOA 1YJVA 2BQRA 3V6HA 1RTJB 4ZVGA 3MEEA 1IM4A 3MUVP 3W63A 4WE1A 1AZSA 2XM3A 4XPEA 4HLBA 4OYXA 4O4GA 3H98A 4OI0A 1C0UB 4C0BA 5KFJA 3BGRB 1WI6A 4WBFA 1R7IA 2B56A 4Z7CA 3M8SA 1OPZA 1LKZA 4C3KA 3MMCA 2DVIA 1RKJA 2FHOB 3PO4A 4C3MA 2NXJA 2E44A 3H5XA 3IA0A 3NKYA 3K5NA 3G82A 2XEXA 2ZUGA 4DV3F 1NKEA 3ZXWA 4B9LA 2DH7A 3MMAB 5IM0B 2ZVSA 5H9EJ 1ITPA 2MKJA 4BWJA 3SSSA 2ADBA 2HS4A 3DOMA 1CQMA 4N7TA 2WVBA 1EX8A 5AT1B 3QJPA 3WZ0A 3C15B 2G0JA 4LRAA 1CJKB 3DRRB 3TNVA 5IZHA 4OHWA 3UPFA 2RH3A 2V63A 4CLPA 1PIEA 1RHJB 2AGQA 2Z2MA 1TKZB 1X0FA 5DG8A 1Y5IB 4I69A 3HF5A 1HA1A 3S7RA 3MM5A 3NXZA 2YXLA 3IC1A 4JI7F 3ZZRA 5KAKA 1RA7A 3N4WA 5F8IA 2KRBA 3DDKA 5DZ7A 4TNOA 3HDSA 1U2FA 3T6BA 2XMWA 3NBPB 2DNNA 3CJQA 4GMKA 1S1TB 2NXCA 4DV2J 4DPOA 4B3SJ 5IWAJ 2OEMA 1F6TA 4MIWA 2HNDA 2R7TA 3DGPB 4X64J 1KWMA 4KPYA 2I5JB 4ZPVR 1B4SA 3L7OA 4Y2MA 5A76A 4F67A 2KT3A 1WHWA 2F9JA 2G0IA 3EX7B 2GMHA 2PEHA 1DFDA 3NNCA 3H5SA 3QSIA 5HBMA 1HQUB 2AGOA 2NZCA 1UFKA 1W7WA 1WOOA 2UP1A 4R5PB 4P2SA 2VG5A 4X84A 3BGOP 4NXNF 1QAXA 2AHOB 2F9DA 4PXEA 2LQBA 1RAIB 4L3KA 2FHMA 1RYSA 3UCUP 1CLFA 2FLOA 3AA8A 2IM3A 4FN5A 1RQ0A 2YNHB 3DLKB 1XR7A 1MU2B 1CJTA 2PSZA 2YVSA 1X9SA 2DPJA 3LQVA 3TQEA 2I0XA 2R42A 3GTYX 5B7WA 1PSDA 2W8LA 2CNKB 1RBAA 1MWQA 1RAGB 2OO4A 4E2FB 2KXFA 1LWFA 2J0XA 1SC4B 4DR4F 2GMLA 3W64A 1R6VA 1TK5A 3PZPA 2QZ8A 1EP4A 1F9HA 3LPEA 4HHHA 2QT7A 4DV0J 3W9JA 3TAMB 3T1HF 1H7XA 1S12A 4AL6A 3KLHA 3VR1A 3AB4B 2RS8A 3GPAA 2MQNA 3DLEB 1RAFB 3D1QA 3B6BA 4USMA 3M32A 2UUAF 4NEZA 2XMAA 3PR5B 4DL6A 2M4MA 2WBMA 2V67A 3G9CA 2HHSA 2RF2A 4JV5F 5D77A 5IOLA 1FWPA 1VBZA 1QAYA 3PFEA 4KO0A 2IVFB 4ZP6A 3QZ7A 1YQHA 4NRTA 3BZQA 5KFWA 1RTIA 4LT6A 1S1WB 2KKHA 4F4XA 1KLMA 1M5KC 2A10A 1WF1A 2X1FA 3HHEA 1KOOA 1Y00A 2N3OA 3Q2SC 4X4RA 2JVOA 2ZZNA 2H9ZA 1E6YB 4DUZF 4ZDNA 4NCBA 4UTGA 1X8DA 1JLFA 1BMQB 3EYZA 2QA4S 1PC5A 3KWMA 1R8HA 3UE2A 4CP5A 1SKRA 4CO2A 4LF4F 1U24A 3LTOA 2AU0A 3PX0A 3D66A 1N6QA 2R7XA 2BQUA 4LBIA 2VJVA 3PYGA 5F0UA 2AJQA 4DSIA 3OL9A 5HATA 1D9DA 1NJYA 4BHQA 2QE5A 5D4PA 5F0WA 4PXDA 3T3FA 2P9EA 2EFOA 2H5IB 4YR0A 2E1PA 2HS0A 2Z0GA 4CO0A 4LF9F 5DJBA 4ATNA 1K73T 2DRBA 4RW8A 5C42B 2JL9A 4ECXA 1OPIA 3RGIA 4DS4A 2H51B 4I2PA 2QIFA 3LH2S 4JI0J 5AXKA 4TY8B 1GX5A 4HT5A 1MROA 2RT3A 3CJ4A 1O51A 2AF6A 3K5LA 2KB2A 3GYNA 4UQTA 4DHVA 4YN3B 1XR5A 4F4AA 4ZCLA 2JOQA 1CG2A 5KFQA 3KUEA 1RAAB 2AYEA 3MUTP 5KG1A 4CH0S 2VU5A 4I7FA 3A4TA 1ZA1B 2DHAA 2XMJA 3C16B 1Q86T 3VAHA 3UR0A 4AL7A 1UVIA 4LSLA 2AMCB 5DGAA 2VJUA 4LF6J 4XO0A 1TTHB 2M8HA 2X1BA 1NM2A 3ZZOA 2B8QA 1Z4UA 2ZKUA 1RTZA 4J9MA 4J5OA 3HVTB 2RSQA 1P1LA 4DR5J 3RU0A 2J8AA 4UOHA 3UI3A 2PN6A 4K2XA 3EZOA 1LQ9A 1I94F 4RW9B 4OZ2A 4K4VA 4G1QA 5E7OB 3OFGA 1YJNS 1M5SA 3V81B 4HTJA 3Q8PB 5HANA 2XQCA 1UCNA 2RE1A 3MEDB 4F8RA 2BJ1A 4F4WA 2BDPA 1CS4A 3I96A 1P1TA 1VS3A 1REGX 2YKMB 1FWLA 5HO4A 3BH7B 3V4MA 4M63A 1S4EA 5FDLB 2DK2A 4DL0C 2VG7B 1H98A 2EBEA 2N4DA 4MYUA 1HBOA 3EDRB 4LF5J 1NXIA 5KFMA 5IS2A 3C6TA 3HSJA 3QBCA 2NR0A 3V4IB 3CW2C 2ZWOA 2IM2A 2MHEA 3WC2A 4NZ7A 1KQSR 4WFXA 1S99A 2KFYA 4J9RA 4EMDA 4RW7A 1BY9A 3KK1B 3G8SA 3V6DB 2BQ3A 4PR6A 3IR5B 4OZ3A 3G96A 4DF8A 4YFUA 2L3MA 1UFWA 5A0YA 3KFWX 3M8RA 1APSA 3I31A 3NS7B 3ITHB 2M5YA 1JQGA 1AW0A 3GWCA 4K4YA 1FRHA 3JYTA 5KG4A 2VONA 3R5DA 5F8HA 2AWZA 3ZC4A 3CCZA 1MMNA 2DNOA 2ZC3A 2RRAA 1B0TA 3EVWA 2RDIA 4NLWA 4IRDA 2R8HA 3IFEA 1RYRA 2IA6A 3PHTA 4TLRA 2COLA 4UF4A 4PPDA 2ASLA 1A6LA 2J9DA 1UVKA 4CYUB 2J6UA 3M1VA 3DOKB 1N33F 2HGLA 2HNYB 4FXVA 1PJ5A 1WC6A 3DU5A 1HBUA 4MK8A 4W92B 3VAMA 4PWDA 4DQQA 1FKPA 5T7LA 3I5AA 4OMFG 1IKWB 1YHQS 2LQ8A 3GFHA 4ZPTR 1VQYA 1ROFA 3UD3P 4LFAF 2YQ1A 2DNRA 2RRNA 1NO8A 2JC1A 3HPOA 4A8MP 1YBUA 3AD7C 3LP0A 2V9WA 2XS5A 2QL9B 2C3MA 4P71A 3M6VA 2HW3A 1REVA 3SZ2A 1ELOA 1TL4A 1WSVA 3MAAA 1HL6A 3JQJA 4C8YA 2KM8B 4YR2A 2KVQE 2HZCA 1NHKL 2B9YA 4P75A 4NXMF 3I0RA 4QR0A 1ZS6A 2WTFA 1N8RT 4Q0BA 3BEGB 4H4KA 1F3VA 3TOQA 5IQQA 1KFSA 4K50A 1KVIA 1SQEA 3L7PA 2PEBA 1ZBTA 5CHCB 5J2MB 2R4FA 3PYFA 4DS5A 3HX9A 1ZM4A 3BS9A 4B3OA 4C97A 3CVKA 1AFJA 4OX7A 3T6JA 4JV0A 2PA3A 5CA5A 1N0UA 3HT0A 5HMWA 5EX0A 2F3JA 3SDEA 2ZKTA 1NKCA 5IV3A 2W7OA 5F41A 2CNOB 2OPQB 4HYKA 1HYSB 1SKUB 3EGVA 1ZM3A 3MM9A 3JSRA 4RU9A 1TL7A 1Q7LB 4DL5A 2B5JB 4KSEB 4U6PA 2Q6BA 3GB0A 2VZ9A 2KH9A 5GMDA 1GAOA 2XB2D 1F60B 1Z1ZA 1YI2S 4ICLB 5EX3A 2K3KA 3VWSA 3CB4A 4ECTA 1HW8A 1KVKA 3DRXA 2ZNYA 1QTNB 3DLGB 3UN3A 4HACB 4S0MA 3T5HA 1S6UA 2YQ3A 3GYGA 3FZ2A 1YX2A 3P45B 3MEKA 3GV8B 5G0RA 4DV5J 5F8MA 5LMUJ 4WFBQ 4PEOA 2BMBA 3FQLA 2CJ9A 1Q8BA 1F3FA 4KGVB 4DR3J 2R8IA 1C1CB 3IM8A 1JLCB 3CO0P 4ID5A 4AD6A 2BVZA 4C48A 3DHWC 2KZMA 3U1LA 2UU9J 4URSA 1GMWA 1CPZA 1VIXA 2LA4A 3HLUA 2BJ7A 4ZIWA 2V9KA 1HWLA 1EAYC 1Y0HA 1HMVA 5KFUA 1NPRA 4FKXA 3K58A 3I55S 1SXLA 2LKZA 2ZITA 3LWLA 3Q8YA 5M2PA 3P49B 1XTZA 4FPIA 5B0BA 2BXJA 3CDWA 5C5JA 3NGTA 1AUSL 3NMAA 4NPOA 3RZAA 3L09A 1I51B 2PMWA 1UZHA 5JJBA 1SUQB 4NZ6A 2EK1A 5LJ5Y 2ROPA 1GXTA 1JK9B 2BEFA 5ETLA 2GHVC 4HHJA 5HLFB 3OR2B 1HWUA 2OELA 3VVTA 4DR1F 3KJQB 3H2UB 2NSBA 5EDWA 3D54A 4XK8C 1Q7YT 3OJUA 1PC4A 1FERA 3IAM9 3QWUA 2HS3A 2U2FA 3WQPA 2DCLA 5CXTA 2ZD1A 2YPYA 1EZZB 3NNHA 3HHLC 3BREA 3HHLB 3NGKA 4OI2A 1R3NA 3AA9A 4RJVA 2FVCA 1YKWA 5KFOA 1TQLA 2HVHA 5IT9U 3JQMA 3UNYA 3AD9C 3QLHA 1QVFR 5F3ZA 4JYAJ 1U1PA 3AB2B 1YGYA 3QRQA 1OSCA 3KHRA 2A3JA 2MLXA 2BW2A 3MECA 3KLFB 2Q1LA 4NLDA 1DARA 2ZWPA 1S6PA 2W9CA 2WSEC 1DQ9A 1ZTTA 2FGCA 2AYGA 4K4TA 4M5GA 1CBKA 3TQ1A 3PW2A 1HQEA 4QIVA 1H6KX 2R2UA 4ED2A 4RLEA 4N47A 2XTJP 4B3MF 5G4DA 4KIAA 4UOGA 3O6QA 3TZZA 1RWOB 2FDNA 1N32J 4KY3A 8AT1B 2KG1A 4R8UB 2B6AB 2VKZG 4X4PA 2IRUA 4ZLJA 3RAQA 4F0MA 4QWDA 3QJJA 3WIUA 4U96A 2BANA 1WEZA 3D0GE 4JV1A 3MEEB 4F3QA 1S0MA 2EI5A 1RT6A 1GTEA 1TKTB 4KHMA 4WE1B 1NRKA 1OMSA 3V5RA 4J9QA 1R0CB 4O4GB 5EGYA 2HVIA 2AX1A 2HBZB 5J1PA 3FSIA 2JNJA 3IN5A 2WVDA 3S1TA 3MAQA 2BACA 2V8PA 3G8TA 2C2KB 1HR0J 2FZCB 2DGWA 4MK7A 5KFPA 2WONA 2KT5A 2IYIA 1PILA 3M05A 5GADI 1GMUA 3OV7A 2L9DA 4OHYA 2OPRA 1K47A 5T14A 3GJQB 2G0CA 1F5AA 1U6FA 3R7NB 2W9BA 1WUUA 1FT8A 2OH2A 4ZCMA 1L3SA 2UVWA 1K9MT 3LF0A 3CPWR 3K17A 4MAKA 3SFUA 4RKUC 3JAMY 4ZPDA 1Y3KA 3AQOA 3PW7A 4EUVA 3SCLE 2E5LJ 3SEOA 2C3UA 2XS2A 2ZH1A 2B43A 3D4JA 2LFVA 4NX9A 5H9EK 1NPPA 1V5VA 2FVRA 2X3DA 1JLAB 2CQ2A 2VG6B 4Q44A 3GG1A 1SL2A 5AJ3F 2C1EB 1R0AA 3N5BA 3NLCA 1NJWA 4O3NA 2D3OR 3RB4A 2VBZA 4K4SA 3DLJA 4ZP8A 2HRYA 4ZVUB 2HAFA 3A12A 5KT7A 2QO3A 1WC5A 1JLQB 3SV4A 1Q79A 3TVKA 1BQNB 4C8KA 3OTOF 1XEZA 1RSCA 4FKYA 1YLXA 1VC0A 4WFAQ 4GRSA 3QT8A 1RWKB 3KLIB 1DHMA 1N36F 5AXNA 4F0HA 2KFZA 1L3UA 4A8WA 3HFVA 5L9NA 2IJFA 1FXRA 2OTJS 3FBBA 5IT0A 3U02A 3PKYA 3KMSA 4NMLA 2RQCA 2CAJA 3KOAA 2CQHA 4K0KJ 3HJFA 5SZTA 4XTTA 3BN4A 3M9NB 1Q53A 3HFKA 2P2CB 3PKMA 4H4MA 4LRDA 1IQTA 4W98A 2VICA 2Y1IA 1YJRA 4DUYJ 1GXUA 1U1NA 4CRJA 4TQSA 4KGXB 2BKPA 4B17A 1HLWA 2VG5B 3KJVA 4UOCA 2HEKA 2YKOA 2GVZA 2JEIA 3Q0AA 4FZVA 4ECWA 4Q5VA 4ERDA 3UD5A 4QW9A 2Y3YA 1IWGA 2YQ0A 2IAJB 4HDGA 2O5DA 5IQ6A 1ZZFA 5A8KA 1VQ8S 3KDOA 5J2PB 1U8SA 2DR8A 5A8RB 2FHKA 4YR3A 4Y34A 2G2YA 3KNGA 4JI2F 3CUNA 5J2NA 1RTHA 1Q8IA 3TZYA 1J5OB 2XY6A 1Y5NB 1LWFB 1U2CA 4P2XA 3SQOP 1IR1A 1EP4B 2GS8A 1XMOJ 4RWWA 4TLQA 1FI4A 3GLJA 3M2VB 2RIJA 3HJVA 1N48A 6FDRA 3UVJA 3OLAA 3IP0A 3CULA 5B0AA 2LECA 2QA4G 5D4LA 3EVOA 3M32B 3R2CJ 2UV8A 3MFHA 1IVZA 4RR5A 4M95A 1N5VA 5DQGA 3L3CA 3US5A 3GYXB 1TKXB 3KK2A 4QWCA 3CJRA 1VQNS 1JJ4A 4Y00A 2RF2B 2IBOA 1HWIA 4DL3A 1SL1A 4DN0A 3BGFA 2NS1B 2Y1JA 2ZUAA 4KO0B 4CH7A 3DXSX 3GILA 2MQ8A 3N6MA 2J76E 1RTIB 1SQGA 1H72C 2W4PA 4IFYB 4DFMA 1FEEA 4USVA 3B82A 2XYPB 2ASDA 3P5BP 1X5TA 3J81U 3OD2A 1C0UA 5ETNA 1ZPVA 3NGUA 1NAQA 2QN6B 4KQZA 1SKWA 4JI4F 1S72S 2VUGA 3W5YA 4USKA 2B7CB 2ALZA 1F5CA 1SH3A 3BGRA 4DR6J 3IM9A 3C14A 5HN0A 1V3SA 2HFSA 4LFBF 2PC6A 3CCUS 3ZZZA 1NK6A 2WSCC 2ALYB 4BBYA 2JFKA 1VBKA 5L39A 2V50A 2F4VF 1MNEA 4DV7J 2QMXA 1VHFA 2ZH8A 2Y1LB 3MXHP 2IJRA 1ZTWA 1IR2A 1LV5A 2C3OA 3NG8A 5GADU 3MF5A 3MMAA 1FCAA 2YKNA 4DSJA 2FLLA 1S1XB 2XLKA 1HNZF 1B0VA 3CJ8A 4RW8B 2DNZA 5T41A 2M2BA 1BQXA 4I2PB 4GKJF 4DEZA 3C15A 3X3UA 2HKEA 4JI6F 1CJKA 3DRRA 4NA2A 5BXIA 1MROB 2X1AA 2ZM6J 1YBAA 1P8GA 2HWHA 1HNVB 4DCPB 1PYSB 1CEZA 2CPIA 1TKZA 3ICLA 5KFBA 1QUPA 2HVZA 5JVGQ 2CWKA 1U02A 2IM1A 1TAUA 3FQKA 3N6LA 4I7FB 2QJ3A 3EE3A 5L1KA 2ZBRA 4NASA 3NBPA 3OTDA 5KG7A 1T9UA 1T9YA 4FF1A 4LSLB 1S1TA 2IC3B 1VFJA 2W24A 2G9OA 2ZH4A 3DGPA 4RO0A 3DOLA 3MCMA 2AQ4A 2G1DA 2IDEA 1H38A 4IYQA 3GV7B 1EIYB 2F8EX 2L41A 1HHSA 3VAKA 1A7GE 3CEDA 4IQMA 3IAS9 4ES1A 2MKHA 4NI2A 2GX8A 3DMJB 4JI5J 4WFYA 3J7YI 1JXVA 1SJ4P 4X4VA 4G1QB 2WOMB 3PCOB 3IRXB 2M88A 4R5PA 2IYGA 1TL3A 1RDRA 4CLWA 1LW2B 1RGVA 2BJ8A 2CZ9A 2FVSA 2VA3A 1RHQB 1IKVB 4QPTA 2OPPB 3B78A 2LQ9A 4F4YA 1CS4B 1H7WA 1SIWB 2QYCA 1FRXA 1RU2A 4K8RA 2YKQA 1MU2A 3OLBA 3KTQA 1LK7A 4WK1A 2OEJA 3C6TB 1BE4A 3KJNB 4EO6A 4AXJA 1KQKA 1N4LA 4X4SA 2CQ3A 2B9XA 3AJDA 1UEKA 4BS2A 4Q8EA 1WELA 3PO5A 1RAEB 3ISND 1QM9A 4RW7B 4OJ3A 4PXCA 2LA6A 4EGLA 2ZH2A 2AD9A 1FJGJ 4FP9A 4QYZJ 3ZZPA 2QMUB 3LALA 5MLCV 4CM0A 2EK6A 5A0YB 3DLEA 1NJIT 2ERRA 2CQDA 4DCJB 1G1XA 1IBLF 4IG0B 2VB6A 3O8WA 2MZQA 5KFLA 3W8GA 1T8EA 4X4NA 2E9TA 2CDQA 1R6YA 3JYTB 4PXBA 3VAGA 3GP9A 4DSKA 1FNXH 2LDIA 5DO2A 1XQIA 2EG1A 2R3VA 3D6HB 4KGMA 1KQFB 2V34A 3J7A1 4MIBA 3TX0A 1DJ0A 2XC9A 3W7BA 4N41A 2HMIB 3O3LA 2R7OA 3HI9A 4DV6J 3CJ3A 2DIUA 3PVXA 2R2SA 4WYLA 2ZOFA 3DKDA 2CQ0A 4OYOA 5IC6B 1O5JA 1CJUB 1VHIA 3IS9B 3MMJA 3M1VB 1X0PA 1FEHA 1E6YA 4NE9C 3LPYA 3PTWA 4DSEA 2FJWA 4RUAA 2ACMA 3L95X 1GXLA 4LVNP 1RZMA 1HBUB 4PWDB 3D0IE 4LIWA 4YHHJ 1BLUA 5T7LB 3R1LA 1JNZB 1NUEA 3P96A 2H54B 5CH7B 4Y0FA 2C3YA 4FYXB 5F8LA 1XNQJ 4J90A 4P74A 3R97A 1S76D 3LP0B 4HVZA 3ZNUA 1UVLA 2C2OB 4DFJA 1FJCA 3AY0A 3GJSB 1QJHA 4O0NA 3PJXA 4C11B 4KJIA 1JXLA 1KHVA 1J27A 2KXNB 3T9ZA 3K5PA 3MAAB 4X4TA 2O67A 1FRKA 3OSPA 3QFWA 3J81Y 2M9KA 1QVGR 2RHSB 5C42A 3I0RB 1SJRA 4K2JA 3TJ9A 3FFIA 3LGHA 4Q0BB 4H4KC 3AOBA 4AQYF 4TY8A 3JSMB 1KNZA 4ANEA 3EZUA 4DL7A 2BOAA 3O5TB 4ES2A 1IBKJ 4GVBA 4RWXA 4DLEA 2RQ4A 3A8EA 2FZGB 4DPYA 3JXOA 2IMOA 3RB0A 2CA9A 1XC9A 2VPXB 4GKKJ 2HHUA 1XK8A 5H1SV 3IR7B 1RUSA 1WF2A 2WVCA 2HQCA 5CD4H 1RP5A 4D3GA 3ISZA 3TA2A 5BR8J 2J7UA 4LUBA 4C0OC 3GSIA 3QFHA 2G4BA 2UXBF 1VQ7S 2R8KA 5H9FK 1QTMA 2V2KA 3C16A 1FA0A 2EEYA 4LF2A 1XR6A 4TN2A 2B9EA 3SDEB 4QCLA 1UJ5A 1RT5B 2IRYA 1KD1T 2HBQB 3CMAS 4J9SA 4IO9Q 1U0HA 4MYTA 4JOUA 1T95A 5DDOC 5E3RA 3DRPA 3KK3B 1S9GB 4PG5A 5KFZA 1IKXB 1UETA 3HVTA 2XMTA 1U49A 3BM7A 2W2MP 2PMZD 4RNFA 3AAWB 5D0EA 2NXNA 2PO4A 3M2RB 1W26A 2E5JA 4QR2A 1OY9A 1SI9A 4C8MA 3D7SB 4ECUA 4DPUA 5D0HA 4RW9A 2D9OA 1KS2A 4PPZA 2CPDA 1HNWJ 2DO4A 4UQGA 3M8QA 5G0RB 2UXCJ 3UQSA 3POTA 1TVRB 4WTYA 3G6YA 2R2RA 2YKMA 4CLUA 1YVFA 2EWHA 3TA1A 1NZ8A 2VG7A 1TFWA 4F26A 1MN7A 3J7YU 1DY3A 2VH7A 4IQXA 1S48A 3W5ZA 1XBWA 4KHPF 4RU2A 3KHGA 1HPZB 3H40A 3V4IA 4Q2LA 4B02A 4ETZA 1FVSA 2CNLB 4OI6A 3U1NA 3DDIA 4IDKA 3QGPA 2GAHC 5GVQA 3KK1A 2OIHA 5HMXA 3PIOQ 3DNCA 1HMVB 3W60A 1CC8A 1DURA 1NZAA 3J80U 2PD1A 3BKFA 1S1UB 2UUCJ 1NK7A 3HVRA 2QX0A 2VKRA 3D5MA 3TJAA 4ZOSA 2FPHX 2NPIA 3BR9A 3KG4A 1IUJA 2UXDJ 3WBZA 5EWEA 2MY8A 3DRSB 5CCLA 1JJCB 3FSXA 4YB7A 4YP3A 2OSQA 4N8NA 2QFIA 4W4MA 1C4AA 3EXCX 2ROGA 1X31C 2LQJA 3ULHA 4CT8A 4DV1F 4ECSA 4OYAA 1N52B 4YY3F 2WAQD 3I5CA 1S9FA 2ZD1B 1C4CA 1M1HA 2RQKA 3M4XA 5HJXA 4E98A 4B3RJ 4NLVA 2BJ9A 1KP6A 3QLHB 1HI1A 1Q5YA 3LP2A 2XGQA 4U7CA 1RT4A 3EM1A 1MW7A 4DQSA 4ECVA 1IKWA 4IOCQ 1S6PB 3Q8QB 2W9CB 2BKOA 3CCES 3W9HA 4ELTA 2HHXA 3R5BA 1HQEB 3N79A 1KQGB 2O1PA 2YNFA 4KPCA 4LF8F 4ZJQA 1YZ6A 2V69A 3T5LA 1S6QA 1TMMA 4Y3CA 1HBNB 4G6VB 5D0RA 3EICA 3TZXA 1YTYA 1ZOTA 4QQBA 3FUYA 3ZFVA 3KLEB 4URQU 4WU2A 4ZVHA 3HFZB 1N34J 2NYIA 5J2MA 2BJ3A 4IOAQ 4RW6A 5EWGA 3BR8A 3QYYA 4F3MA 1HWJA 2IHR1 1N5SA 2X51A 2C22A 4V19J 4N5SA 3G4SS 2CRLA 2WONB 1OY6A 4ED1A 4MMOA 5F3TA 1X4FA 5L9XA 4U7UK 1V6HA 2AEFA 1RWUA 5I3PA 3M30B 4JI1J 3UDLA 1RADB 1BWVA 2CQ1A 4ZPBA 2KHDA 1QUVA 4NLGA 2W9BB 1VMBA 2HFNA 2MZJA 4AXIA 5C2GA 2CXEA 3DHXA 1Y7PA 1HD0A 3PX6A 2XO7A 3F0NA 1X60A 1BD6A 3GFXA 3MPWA 2B5JA 1ZAWA 3BB5A 4K5RA 2MY7A 5KFSA 4ICLA 4J9LA 2MKYA 4Y28C 2X1GA 1HWKA 1SCJB 1FNOA 2AW0A 2YX7A 3VAFA 3DLGA 4JI8F 4HACA 1QAJA 1JMTA 3N6NA 5LOQA 2WSFC 3VZIA 2FY1A 1KTQA 1HNXJ 1Q8KA 1EHWA 4WP3A 2R7RA 5HSPA 3PEHA 2CPHA 4J9NA 3CJ5A 3JTOA 4ILRA 4YQWA 1Z2LA 1SKSA 4M5MA 2V8HA 2VF3A 1GTHA 2QA1A 1KFDA 1SQFA 1UVNA 3CJKB 4DPTA 4MKVA 3OTEA 2E5HA 3ENQA 3K8WA 1UEVA 1YJWS 4IUFA 1JLCA 3SCIE 5KG3A 4ED6A 3QAEA 1JJ2R 2VPYB 3ZZ0A 3MUMP 1TV6A 3UNGC 2GQCA 2VPWB 1VJQA 4F25A 3BQ1A 4ZLPA 3J81j 2HBYB 2AJ1A 2DEIA 1VYAA 2V4JB 1KBRA 4OFZA 2PI5A 2J9CA 1S7IA 1SH0A 2LU1A 2EFNA 4NLYA 2E9ZA 4H4MB 3W66A 4DX5A 3THPA 1BQMA 1G7CB 5LM7E 2EKYA 3AT1B 1M0SA 2Y1RI 1CQNA 1BXNA 4X65F 1IQZA 5IC4B 4A8OA 2JC0A 2M52A 5HVFA 3MFIA 3FCVA 4PZVA 2MQLA 2V2QA 4DSFA 1N56A 4Q2MA 2ZBCA 1CVJA 5HLFA 4DL2A 2GMJA 4PWUA 3W3SA 1N5YA 2HGNA 1FFSB 2AJ0A 4EYHB 5A8KB 4Z2XA 1M5HA 3K0JA 1S6OA 1C0TB 3UCZP 3GZ7A 2DO0A 2PFDA 2LP4A 2EC0A 3VCDA 1MWZA 3WIVA 4DR2J 4LFCJ 3TRGA 4DR7J 1RTHB 4MKBA 2MLZA 3OBIA 3T1YJ 2ZFHA 1G4CA 3BSCA 4BC9A 2FTRA 3AXMA 3NCRA 4NLTA 4FBTA 4XPCA 2GCFA 2MZTA 2HVEA 5KT5A 3MR5A 1X4EA 1YRTA 4ZVOB 3R8YA 2K3IA 4URGA 2ZNZA 1IBMF 1U1LA 1DLOA 4ZK7M 1WTFA 3KK2B 4CLKA 3K5OA 3R2DJ 2KI2A 2B6AA 2R8GA 1U4BA 4I2QB 2C2EA 1VQPS 4ZCKA 2RQMA 2PT0A 3ENVA 3N28A 4UY8T 1TKTA 4XDCA 4YUDA 2MLYA 3D1OA 2DEJA 2W4CA 2RRBA 2RD5C 3QQCD 4PRFA 4WJBA 4F4KA 2C3PA 2CJQA 3CDBA 3MTKA 2HHHF 1IN0A 4P7TA 1WORA 5LMNF 5AXLA 4ECYA 1NHUA 4G1PA 3AFGA 3EGNA 2Y9HA 2OJ3A 4JP8A 1N54B 3SI8A 3BKTA 3C14B 2ZHAA 4EBEA 4QOTA 3H5YA 2VBXA 3AQPA 5AXMA 4CM2A 2V68A 2ZH6A 4X62J 4KT0C 5DETA 2IJNA 2D1CA 1GX6A 1NDPA 3MEGA 1XMQJ 5DLFA 1T94A 2HRTA 4X66F 1FXDA 4DQIA 3MM7B 1TZ0A 1TU0B 2W4DA 4A8XA 4QU7A 1XWLA 3CCMS 1UJ4A 3C19A 1ICEB 2UUBF 3EPGA 1I5OB 2YKNB 4OX9F 1YJ9S 4CO3A 3WX4A 3LW5C 3CD7A 2XO6A 3V6JA 1JLAA 1JLBA 2VG6A 4LF7F 2YWFA 2MDAA 3EXYA 2ATLA 3HXMA 3JB9k 1KTVA 3QAUA 2VV5A 3LO3A 2CJXB 3NY0A 2LXFA 3M9OB 3WX8A 1UZDA 4P2MA 5BYQA 2BJEA 1WC1A 2QL7B 4L74A 2DNLA 2BE2A 2JZ5A 3R27A 1JLQA 2XMUA 3NGSA 2ILYA 2C2NA 3B54A 3E8OA 1BQNA 4I1TA 3GQCA 4EK2A 2YNGB 1UWBA 4DSLA 4JI3J 4ECRA 3MM8B 1DRZA 1OO0B 2OFGX 1HBMA 2Q6CA 2A2CA 3KLIA 1R27B 3TAPA 1HIYA 3NOCA 3SCKE 2DHXA 1B99A 1UFLA 4PG8A 1CULA 1T9TA 4USWA 3ILJA 1UW4A 5E41A 2ZZTA 3DOLB 1X4AA 2E66A 3ZTQA 2XCPA 2I9SA 5EN1A 5FIIA 1M1GA 1D09B 3MGJA 2HNZA 3WDOA 2D3O1 5D4NA 5LXRA 4NI2B 4NLUA 3EVMA 2CDRB 4Y2CA 1WSRA 3LOUA 4FYWB 2XNRA 2DR5A 2AX0A 2E1CA 2F8HA 5ITHA 2DH9A 2WK4A 1YJ7A 3H20A 3M8YA 2AEJA 4BCAA 2R7SA 4N56A 1UL3A 1YJTA 1MMDA 4EFAC 1FX2A 1TL3B 3CJSA 3G2XA 3MZIA 2V94A 3PY8A 3OW2R 3FNNA 2GFFA 3BSAA 2KFNA 2KYZA 1VCTA 2DNYA 2E1AA 4RZRA 4WP8A 1BHNA 2IAJA 4MFBA 1DTTB 3H0PA 1DAXA 4A46A 1WF0A 5J2PA 4OX6A 2GHPA 3I4PA 5A8RA 2GIRA 4J9UE 3CCVS 4ZN3A 4B3TJ 2DXEA 4O3RA 1B70B 1G3OA 3ET6B 1J5OA 4PYAA 1U1MA 1UW9A 5HL7Q 2Q43A 1JNRB 2DPIA 1RKIA 2PI4A 5KFRA 3BO4A 1DTQB 1VQMS 3M2VA 3NAHA 3H4DA 1PYTA 3P8BB 1U2RA 3FVYA 3CF5Q 2PDAA 2MB0B 1Q95G 1WKKA 2VQEJ 3RUBL 2XSJB 4QYZK 2JH3A 1EKRA 3UDEA 2BUNA 5I3UB 4C8LA 3U1MA 2XZWA 4DV2F 2DY9A 4B3SF 5IWAF 4YB6A 1TKXA 2ZH5A 4UW2A 4X64F 4A8SA 2ZJRQ 2XMMA 3LUYA 4TY9A 4NWBA 3JS9A 2DY1A 1MN9A 3I5BA 3UD4P 5KT4A 1VRQC 2RHQB 3KG1A 2KXHA 5KFAA 1FJ7A 2L9NA 5DG9A 3TANA 3KYLA 1EETA 4IFYA 5B0EA 1BUXA 1Q82T 1FD8A 4CH1A 2B3TB 4NLXA 4OZLA 1ACMB 4LVOP 1N0VC 1RB0A 1D3WA 3R6LB 2FD2A 2HIQA 3G6ES 3BQ0A 2CG4A 1Q1KA 2XGPA 3QWPA 4NOHA 1TFYA 3UN2A 3FDSA 1F2GA 2HURA 4DFPA 3ZTPA 3RJMB 1EKSA 5BYRA 3N9UC 1RT3A 5A6WA 4DF4A 3BBBA 3MR2A 5GMEA 4KHRA 4C3LA 1JKHB 3CDEA 1AROP 2HFUA 1KSPA 1MWYA 4FS1A 1AUDA 3V2UC 2C2MB 3HO1A 2F8MA 1VQKS 9ATCB 4DV0F 5B0FA 3TEHB 1OS5A 1S1XA 2NZ4A 2R7UA 2LMIA 2BABA 2RS2A 1TR0A 3EPIA 3FFIB 1M5OC 3E2EA 2G2ZA 2CQIA 1FF2A 1Y3JA 3HCXA 4GC6A 1X4DA 4DV4J 4ECQA 1UPPA 3C6UA 4GVBB 1YIJS 5KG6A 5F8JA 1HNVA 2XYGB 4G65A 4Q43A 2MGZA 4OQJA 2PA8D 4O4RA 4CLSA 1V5IB 2LEPA 1PBUA 1HARA 4KGZB 2KZZA 2DKOB 1B3TA 3MPUB 2ZH3A 5E5NA 3TR5A 3C8YA 3E01B 1SVDA 2CQ4A 4MTPA 2HFVA 4M5KA 3CD6S 2XNQA 2MSTA 4DFKA 4F04B 1FRIA 3V6KA 2AGPA 1DZ5A 4K5SA 5F8GA 2IC3A 4NA1A 1U0HB 1J2VA 2A2DA 2HK2A 1VBYA 2RKIB 3CCTA 3HZEA 2GJ2A 3DRPB 1HHTP 2FZKB 3KNAA 5HJYA 2B4UA 5BYSA 5DS7A 2IDLA 4HI1A 3MPDA 2P8IA 4WWSA 1YRXA 1NBEB 2LEBA 3M8WA 1LFPA 4OYPA 3DMJA 3PG9A 3AODA 3RW6A 1HFEL 3W9IA 3OFHA 2IM0A 3EDQB 4NCGB 2K7JA 2OMOA 2WOMA 5D78A 4A4JA 3IRXA 1VQ4S 3OR1B 2F7VA 1VRUA 2FB0A 4ZCIA 1LW2A 3GG0A 3LGNA 4ANDA 4PCQA 5DM6Q 1IKVA 2OPPA 3M8QB 4ELVA 3NOGA 5DQIA 2RJZA 1AXQA 3HSDA 1H0HB 3WC0A 3POTB 3SCJE 3MCNA 4JI0F 2RUSA 3IRWP 1I3OB 1GQEA 5E33A 4M94A 2QLWA 4USUA 1VIOA 4TU7A 4O3QA 3MAHA 1RISA 1C2PA 1J5EJ 2VHGA 3T19A 4OZ1A 2Q66A 3TUIC 2BV3A 3HMJG 4IDKB 2DNGA 2NUHA 1SIZA 1RTDB 5LSRA 1TP7A 4WPAA 4GVLA 3SQGA 2BKNA 4LR7A 4EI2A 1CSJA 3OFEA 2VQFJ 5A6PA 3HHKA 4ITSA 5KOXA 2I6WA 4IG0A 3I56S 4LF6F 3JTNA 1FHTA 3MMBB 4CLZA 1YG0A 3NL0A 3ADAC 5CAAA 3PEJA 3A3NB 3FCWA 4WCEQ 4L75A 2ZH7A 2QV6A 3A8KA 1U48A 4M5DB 2XG8A 1RT2A 4PKDB 3CCLS 1OJ4A 2MKCA 3MPVA 2VC0A 3GCWP 4BC7A 1T3NA 3ENAA 3DM2B 4LR8A 4DR5F 3VGVA 2NUUG 3BBFA 2IY5B 2OP5A 2FHJD 3QJLA 3R5AA 2R2TA 2LEAA 2HMIA 1URRA 4TKTA 5CD4A 2P6TA 3RRKA 2ZDOA 4NLOA 1CJUA 5KFCA 1D9AA 3IS9A 4J9VA 1U1KA 3HM9A 3AOCA 5CYJA 2M0GB 4NLPA 1S9EA 4IH6A 1FDBA 3GU0A 3TARA 2E7XA 1VC5A 4WF9Q 4TXSA 2O01C 3LP2B 3IG1A 3VAJA 1RT4B 1GMVA 1HNIB 3MCOA 2JLEA 2J0QD 2HZVA 3CD5A 1KC8T 4ES3A 3C46A 4FYDA 2AEMA 4ZJOA 1LW0B 3TA0A 1FO1A 1B64A 4LF5F 4TU9A 3SYZA 3KJFB 4ZP9A 4BLGA 2ACYA 3THVA 4LBPA 1ZA2B 1SL0A 2HHTA 2YNFB 3EMTA 5F8NA 2O66A 1VR6A 4C11A 1S59A 4HKQA 2KM8C 1OQ3A 2OFHX 4OLPA 1S6QB 1VGYA 2P9GA 4C98A 4K4ZA 1VQ9S 2HBRB 4EEYA 1NB7A 2H5JB 2CPJA 4WIQA 2DITA 2GIFA 3JSMA 3AH6A 8RUCA 2GVDA 2W01A 3M6WA 1FESA 4R25A 3JAMU 1BGXT 2DGSA 2ILZA 3LANA 3ETMA 3TYTA 2Z30B 3H7HB 3LGMA 3LWMA 4RW6B 3MR7A 1MSWD 2GC8A 2E29A 5K20B 3K5MA 2KU7A 5L8RC 2QG9B 1WOSA 1SB6A 2EC2A 2DISA 2LU2A 5KFGA 3CWJA 1R8AA 2VOOA 2FJVA 3BYRA 4CTAB 1U6ZA 2IVMA 1GNKA 1RU1A 2FQQB 1Y5LB 1PAEX 1NSPA 2M7SA 3HHDA 1RT5A 2CQPA 1PKUA 4OI4A 3DLBA 3A1YG 2U1AA 2LYVA 1T0TV 3GCXP 1HHQA 5IT4A 4YOEA 2DHGA 3QO9A 2W7PA 2FC9A 3KK3A 1S9GA 3DI6A 1X4GA 3NEKA 1IKXA 4J91A 1Q16B 5FLXY 5B0CA 4B08A 2DXFA 4I4BA 3M2RA 4I6YA 5CYMB 4RBUA 2H48B 1TK0A 5A2QY 6FD1A 3F44A 3M2UA 3M9MB 4QZVB 1R0BG 4X2BA 5E3PA 4XDDA 4ILLA 3ZTOA 3C2PA 3FRZA 2HHQA 2BA9A 2JX2A 4Q45A 2MEWA 1RK8A 4OYWA 1YK9A 3TO8A 3BQ2A 4OHVA 2P9CA 4NCAA 2LDYA 4CNYA 3AHPA 1TVRA 4RUBA 3NWRA 4QU6A 5C7PA 4ILMA 2IFXA 4HDHA 3Q8SB 4ZJLA 2YKAA 3OXGA 3PX4A 4F2RA 1G6BA 5B08A 1WC4A 4FYVB 5J2QB 1GH8A 4WKYA 5KT3A 1HPZA 3VGSA 1TV6B 3K89A 4DV3J 3BH6B 3VAIA 1PJ7A 1WEYA 1L3VA 3UFCX 2LXUA 1SBRA 1ULRA 2W2NP 5B09A 2YWGA 2DIVA 2QL5B 2GNKA 4ANCA 3BN7A 1BQMB 2B9WA 2POKA 3TX8A 1S1UA 3SXLA 4A48A 1WACA 2WW4A 4K4WA 2MHNA 2W2PP 3A3PB 5AE1A 2AJ2A 4YS2A 3D68A 1SH2A 4PUOA 2ADCA 1Y4ZB 3DRSA 4OI1A 1WI8A 5I42A 2XHWA 4D3HA 2OUGA 3Q83A 3RB6A 3CO9A 4JI7J 4OL8A 1JWWA 2M3DA 2XI3A 2P5VA 4B9TA 2B51A 2FJEB 2YY3A 1N5YB 3HKZD 3Q89A 3H8YA 1CC7A 2Z2YB 4C8NA 5LT5A 2F4FA 3RW7A 1KR4A 5L46A 1D8YA 1AYEA 4TU8A 1YWXA 1S7HA 3BV8A 4DV5F 5LMUF 2CZ4A 2OMLA 3VALA 2EW9A 5HQLA 5CCMA 3GIJA 1YRUA 4ELUA 2MKKA 4WK3A 3RG6A 3U7JA 1W2BR 4OLOA 3OHBA 4DR3F 2DT9A 2BW7A 3GJRB 2DJWA 4HEA9 4PQUA 1QSSA 4G3IA 1DLOB 1O0PA 2RDJA 4LSZB 4CCHA 3RB3A 2UU9F 2YWKA 4WIIA 3MDFA 4NXNJ 4USJC 3RAXA 1VK8A 1FRMA 3CCSS 4ZVPB 2N7CA 1HBNA 3BPDA 4Y65A 5ADZA 2ZBIA 1TELA 1Q5VA 3LP1B 1S5ZA 2PMHA 9RUBA 3KLEA 3T5JA 3F41A 3I87A 4J7CA 4QIGA 5HQ8A 3SV3A 3LAMA 1WC0A 4IFVB 3H42A 2V5HG 2C42A 5K14B 4LSNA 4DR4J 2DGOA 3IR6B 3GFZA 2V2VA 4QWEA 1JIHA 2EBGA 4RNOA 2NPFA 2Z8QA 2JHEA 3T1HJ 1KLNA 1WHYA 3DCAA 4QIWD 4KFBB 3TUJC 5DLGA 1XN9A 3NRBA 3M30A 2KL8A 2OPSA 2NCKL 4U8YA 4ZITA 2CQGA 3H2LA 1NSQA 4ED8A 3MEGB 2UUAJ 3EZ5A 2V4RA 3A8JA 5L1IA 4B9NA 3B8HA 3IXQA 2AT1B 2H1YA 3D3BJ 4HHUA 5GAHI 4JV5J 4JYAF 2W1BA 3NNAA 5LJ3Y 2IRXA 4QBUA 1WJ9A 1LOUA 3IGVA 4M1KA 3L7UA 4L72B 5GAEI 3Q8UA 2HK3A 3RBDA 2CNNB 2J0WA 4OZ5A 1JX4A 2CJAA 1S57A 5FD1A 1JLBB 4CLTA 4FXDA 5KT6A 1ZM2A 1GEHA 4C6AA 3Q23A 2XZTB 3M6UA 3H4BA 2MKSA 2KTQA 1PJ6A 2XLJA 3QT5A 1Q4RA 5D15A 4RNMA 3J7Z5 1T7PA 2O3DA 4PAAA 1N32F 4DUZJ 3RR8A 2BE2B 3MOJB 4DG1B 2E1MC 2HSEB 1YDLA 1WG1A 5KFFA 2XWXA 1E6VA 3Q24A 4O3SA 4LF4J 3QIPB 1UWBB 4C7QA 2J7KA 3CJKA 2EFGA 3TJ8A 2B8PA 5HAOA 1X7VA 3H90A 1HBMB 4LQ9A 1M5PC 2FYXA 5EHHA 3HHNB 3MWBA 3PRBA 4H4OA 4QJVA 1CULB 1HR0F 5GAGI 2IBKA 2VD3A 4PG7A 2JLFA 2MJNA 3EUNA 2V4JA 4LF9J 3R3TA 4P9SA 1KONA 3T1AA 2HNZB 4DXLA 2KO1A 2CPXA 1NDCA 2EFQA 1PG5B 2B0GA 1X5PA 1WTBA 4OV1A 5HP1A 4BDPA 1FE4A 1SV5B 3W2WA 1KVJA 4OJHA 1Q78A 5KFVA 1NK4A 3NP5A 2E5LF 3O44A 1DQAA 1HQ2A 1IJEB 3FKBA 3RRGA 1NKBA 4ZVRB 2HHWA 3FEXB 3HVAA 1WHXA 3D9BA 3GONA 4MFBB 1QLNA 4NYOA 1QSYA 2KN4A 1T05B 1C0TA 2DRDA 5BJRA 1VLYA 1NPKA 2WW8A 2GAGC 2DGQA 3KUGA 2VFUA 4ED4A 2CVEA 3OVSA 5HVGA 3D1HA 2LXIA 3CDUA 3HZGA 4U95A 1U1QA 2R7WA 2JVRA 4EU0A 2J7WA 2CWXA 4J9PA 3Q22A 3HHLD 2GO8A 1ZETA 1X5OA 4I6AA 5EWFA 3I0SA 5E2QA 2QFJA 2VFVA 4KR0B 2UUTA 1S79A 2FJDB 3T9NA 1VI7A 3EWGA 5B0DA 3O1LA 3HK2A 1RT7B 1I94J 1N5QA 2AJ4A 4PABA 5J1EB 1VQLS 1VQOS 3HD2A 2QGFB 4A8FA 2BZ2A 1QE1B 3VGUA 2DCUB 1NJXA 3C66A 1S97A 4ZIVA 1ZAXA 4DOZA 3QGHA 4K0KF 3PFOA 4I2QA 2K1RB 2N7YA 1SJQA 2W8KA 4KRWA 2BE7D 4L76A 3IWLA 4DU7A 2QLJB 1RBOB 3OVAA 2JEGA 5U47A 3KUHA 4NYPA 4DUYF 2QRRA 2WHOA 2ZE2A 1EETB 3TI0A 1FKAF 4WKRA 4IH7A 5KFIA 2PFFB 4ZLNA 4QW8A 3TZWA 4R0JA 1KRPA 5HMZA 1L3KA 2A6MA 1WDDA 5C24B 1WKLA 2GA7A 4ETXA 1XIQA 3OSNA 1U7LA 4F3OA 2DD8S 3DYAA 2AZ1A 2YX4A 4OZJA 3DDNA 4L3NA 3CJTA 5K9FA 4LR9A 3K57A 5C25B 4KV8B 3OXFA 2IVYA 4AYBD 3LAKA 4KYZA 3DC2A 1RT3B 1JLEB 2CJBA 5HROB 3MM7A 3QPIA 4KC5A 1XMBA 5ETQA 2KJWA 1F5BA 1XMOF 4IKAA 5LXYA 2CZVC 1WKJA 2Z58B 4RBTA 2K8GA 1SC1B 4IRCA 2XULA 2Y0BB 5LSLA 3H59A 2RAQA 3R5GA 1OYDA 2YKPA 2CQBA 4ED5A 2X7IA 4Y2AA 2V8GA 2NLWA 4C2MA 1X4HA 3T41A 5JXSA 1NNDA 4RW4A 3C6UB 2CKWA 2FLNA 3MCSA 4F2SA 5GAHU 3DLLQ 1N33J 1N88A 1ZH5A 1FWKA 1LWEB 4A47A 1K0TA 1RLCL 4ENOA 3LA0A 3HSZA 2MGZB 2HPUA 1NH7A 4CT9A 4WFNQ 5GAEU 3ILOA 1RWWB 5HMYA 2ZZMA 1B0PA 3I4HX 2YNGA 3U27A 4O3PA 3MM8A 1FKOA 4YEAA 4LFAJ 2OLWA 1RWVB 2K06A 4P72A 2JDJA 4LQ3A 3AJ1A 2ABYA 5ETKA 2BM1A 2AIRB 2VC1A 5DRKA 4IG3B 2HZAA 1UAWA 5KOWA 4W90B 1FK9B 1R8PA 3UO0A 3TVYA 4C8OA 2H4YB 2F65A 1ZZNA 1K8AT 3W1YC 2HQDA 1UVMA 2VBWA 5ETTA 4AT1B 4KKOA 1RABB 1T3OA 3MTJA 4JUZA 4DR6F 2HWIA 3PACA 4NXMJ 2NSCA 2RVJA 3DXBA 2MXYA 5DGBA 3OVBA 1VJWA 1NK5A 4HL9A 2YTCA 3B4MA 5K8NA 4Z37A 4JB8B 3BPSP 4CO1A 4DV7F 3X1LB 3HSGA 2YH1A 5D3GB 2AYBA 1ZM9A 5KG0A 2RU3A 1EB0A 5GAGU 4HR2A 1VRUB 2APOA 4C9DA 2PGCA 3NGRA 2CJKA 4RUCA 2VIHA 1RWXB 2D7SA 3NCPA 2LCWA 1IWAA 2XWYA 1CJVA 3FMBA 1DTTA 1AB8A 1LXJA 2DR7A 4TYAA 3TP2A 2ZM6F 2ZC4A 4ZP7A 4DQRA 2V2ZA 5KG5A 3ET6A 5I4MA 3BO2A 2V8DA 1M90T 4P10A 3OUYA 4F02A 1P27B 4HI2A 1DTQA 4J9KA 1T03B 1KHWA 2OSRA 2CYYA 3FC9A 2J6SA 2WB4A 2QLXA 2FLPA 2XSJA 3SQGB 1OQ6A 2GJFA 5I3UA 1UJ6A 3HULA 1P9YA 2DYAA 5A8WA 1S10A 3H5UA 4Y2KA 4U8VA 5F9LA 2BR0A 1KDNA 1LFWA 2MQOA 1RT2B 2QLBB 1C1BA 4E0DA 1S49A 3PIPQ 4KE5A 4CQ1A 5KG2A 2J8SA 5FJ4A 1A0OB 4JI5F 2JEJA 4DMZA 2OD4A 3D3CJ 4ZPWR 1S1VB 3S01A 2PIIA 1TK8A 2HQIA 4HT7A 1TUVA 5IV4A 2WVEA 2PE8A 2XSFA 3E3XA 1S9EB 3HT3A 1PO6A 1NLKL 4MKYA 3CTRA 4N76A 4CO4A 4KBIA 3PW5A 5H9FJ 1NK8A 3IG1B 4O44A 1LWCB 1SJFA 2DBBA 1YZ7A 2YWHA 3QRRA 3D2WA 4OYBA 3I82A 5CZVA 1NJZA 2GQ2A 1JLGA 2EVZA 5LSOA 2QEXS 1H3DA 3MPYA 1JKHA 1L5UA 4USTA 3HKWA 2J0SD 3IBCB 3Q8VA 4ED0A 4MT1A 1FJGF 2B4VA 4UZCA 4IOBA 5M2RA 4DR1J 1NSAA 4OX8A 3FZBA 2G2OA 2DH8A 3F73A 1R43A 1LK5A 5J1NA 3QT6A 1FTRA 1UWAA 2GVDB 2DNHA 3CSKA 2E7WA 4LRCA 4MJKA 4DUTA 3K59A 2HQGA 3R7SB 1W2IA 5K5MA 2Z2LA 4AFFA 3MI7X 1XERA 3NCQA 3G6XA 1RXOB 4OYIA 3Q86A 2OI2A 3W65A 3MR3A 2H5EA 3E01A 1T9VA 1MLAA 1LNQA 1NB2A 3MM6B 2DB1A 4M5HA 3EGZA 4G1IA 4HTIA 4TVAB 4DV6F 2Z57B 2KHCA 2N3LA 3H25A 4B3MJ 2RKIA 3QO9B 4CZCA 3IMQJ 4A8YA 2HHVA 3DI6B 1U8WA 4QWBA 4B9UA 2XLIA 4YHHF 4ZKAA 1EJ7L 3C3LA 2HQFA 3PNIA 3NWGA 1XNQF 1URNA 4I68A 4XAKA 5RUBA 4J9OA 3FBCA 1JB0C 2BE9B 3M2UB 4FNIA 4NCGA 4CI0B 3VV2B 3CD0A 1X4CA 3CCRS 4NZ0A 2FY8A 4ZLLA 2D3ZA 2MZRA 3OR1A 3PJWA 3QGGA 4CLFA 1LEOA 1FX4A 2IA0A 2JLGA 1V3RA 3PHEA 2HLTA 3D0HE 3KHLA 4EZ9A 3IWNC 4X4OA 2JFDA 3Q2TC 3FGVA 5E3AA 5CYQB 3SFGA 1FNMA 4DZDA 1R89A 3R7BB 3KLVA 2J9DE 4OHZA 2K2PA 4AUKA 4YB1P 1IBKF 4X4UA 2HVDA 5C2CA 2MQMA 1RHKB 1OSDA 2MZSA 3H2VE 2UVRA 3Q8RB 1QD1A 2VDHA 3KMQA 3AXKA 4KH1B 4XIUA 1VRTA 4ZVSB 1ZPWX 4GKKF 2XMVA 4FPRA 5THWA 4F7VA 3NGDA 3UWTA 2H4WB 5BR8F 3CIZA 2RNEA 4ZMMA 2ZHOA 1S77D 5D0GA 1RTDA 4OJGA 2DGVA 1LWXA 2YNIA 3JQKA 2RU9A 5AJ3J 1K1QA 4N77A 2AYMA 3OFFA 1UTAA 1GK8A 4JV2A 3GR0A 1Y11A 3MMBA 2GW8A 1S0VA 1XJWB 3M8ZA 2H65B 1RHRB 2C2ZB 2BOPA 1RACB 1TL1B 3CJ0A 3NS5A 1RT1B 4PUOB 4M5DA 4ALZA 1KEKA 3ZZUA 3W2VA 4V19X 5I42B 3MOZA 2GGPB 1FDDA 7AT1B 3DM2A 1HD1A 2XZDB 3OTOJ 1IKYA 3L4BC 5DDRC 4Z7YA 3P6YC 1AZSB 1N36J 2DR6A 2V6AA 3OJSA 1X5SA 2RMLA 3OT9A 2V8VA 3CGIA 2RDDA 4CDIA 2WZ1A 2QA2A 3QATA 1HNWF 1FVQA 2HIYA 2FJAB 5JUMA 4AL5A 3CCQS 3CC7S 2E1RA 3ZZYA 1F1BB 4QIEA 2UXCF 1HNIA 3OL7A 3PDNA 3MMCB 2WVFA 1NK9A 1H2TZ 1LW0A 2HRUA 2KT2A 2I1RA 4PQUB 3N0VA 3G82B 1RBLA 2QC3A 3GSDA 3SMZA 4UZBA 1D9FA 2VL1A 3BGLA 3BSOA 3VF0B 3P5TL 4MH8A 4I67A 3DU6A 1F9EB 3CIMA 1V3ZA 3D6MB 3OXLA 3R6GB 4WXOA 3GR1A 3DOMB 3QRPA 3KHHA 3I6PA 3QT7A 2ZJQQ 2E7VA 2R7QA 5D8HB 3R9LA 2UUCF 3UW1A 1XNRF 3GIRA 4JI2J 2XYHB 3VQSA 2CQCA 2UXDF 2D69A 4NLQA 2G1HA 2H3EB 5CQGA 4LSNB 3NMRA 3MM5B 3G86A 2CPZA 4C4WA 3IGNA 4CTAA 2VFTA 2KRRA 3GJTB 4O0IA 3JSBA 2DHSA 4QWAA 1F9FA 4CO5A 2OPSB 1UA1A 3VGTA 3MR6A 2RILA 4KAIA 5GMKa 4DCOB 3RTVA 2WB1D 3SSQA 4B3RF 2HNDB 2EFVA 3M8PA 4TQRA 3VTIA 4NLRA 1IBCB 4FNHA 5E3QA 4MK9A 1RHUB 4B9MA 1SC6A 1NDLA 4FS2A 4LIRA 4IH5A 4ID8A 2KDOA 2CADA 2JEFA 4FXWA 5CYMA 5HBMB 3RAMA 4OV6A 2UV8G 4IR1A 3GIMA 4M5JA 2DNKA 3T5KA 4F36A 6AT1B 1RWPB 2Y8YA 4JI4J 5HI7A 3ELHA 3FEYB 4UY85 2W9AA 4LFBJ 2HFOA 1E6VB 3DFEA 4WFZA 2M8DB 2VA2A 4ZHRA 3B4DA 4DZ6A 4U9RA 3EGWB 1CJTB 4GC7A 1N34F 2EKNA 3ISNC 2FVQA 3P4UB 2F4VJ 2HGMA 2Q3PA 4ZVTB 4QIFA 1Y10A 5J2QA 2G13A 2HG4A 4H4OB 2MSSA 1RWNB 1UVJA 4R0EA 2FJXA 2JRSA 2R8JA 4DQPA 1RCXB 3KLGA 2QLFB 1NU4A 2LLZA 1HNZJ 3HP6A 4OJ1A 3KLHB 1GMWD 4JI1F 5L38A 2D41A 2CJYB 2NXUA 4GKJJ 1WDTA 4WP9A 4JI6J 4DWIA 5DM7Q 1L3TA 2M70A 5LL6d 1UP1A 1EARA 3O2IA 5HP1B 2ZBQA 3W2WB 3SSRA 3J7ZT 4DDFA 1RTJA 3RBZA 5IT9Y
chains in the Genus database with same CATH topology
4B3TJ 1HNXJ 4DV5J 5LMUJ 4B3RJ 1I94J 2E5LJ 4DR5J 5AJ3J 1XMOJ 4K0KJ 4KYZA 3R2DJ 4AQYJ 4DR6J 3D3CJ 2F4VJ 4LF7J 4DV3J 4JI0J 4DUZJ 4DR4J 4DUYJ 4DR3J 3W1YC 4V1Ak 4DV2J 4JI1J 4B3SJ 5IWAJ 4DV6J 4LF8J 3R2CJ 3J80U 3T1HJ 2HHHJ 4DV7J 4LF4J 4NXMJ 2VQEJ 4X64J 5LMNJ 1IBKJ 2UUCJ 4RJVA 4PWWA 2UU9J 2KL8A 1HNZJ 3OTOJ 5IT9U 1HR0J 3JAMU 4JYAJ 2UXBJ 2KVQE 4DV0J 2UUAJ 2MTLA 2UXDJ 4DR2J 4LFCJ 4DR7J 1HNWJ 4GKKJ 4GKJJ 4JI6J 1N36J 3T1YJ 1J5EJ 5BR8J 1IBLJ 2MQ8A 4DV1J 4JI2J 4NXNJ 3D3BJ 4YHHJ 1N33J 1FJGJ 4JI8J 4HHUA 4JV5J 4B3MJ 2UXCJ 1XNRJ 4YY3J 4KHPJ 1IBMJ 2MEWA 4LF5J 4NEZA 4X65J 4X66J 3IMQJ 4JI3J 5FLXU 4JI7J 4LF6J 4LF9J 4JI5J 4X62J 4JI4J 1XNQJ 3J7AN 1N34J 2ZM6J 5LM7E 1XMQJ 2UUBJ 4DR1J 4LFBJ 3J81U 2VQFJ 4DV4J 5A2QU 1N32J 4NEYA 4KY3A 4OX9J 4LFAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T J;  1HNX J;  4DV5 J;  5LMU J;  4B3R J;  1I94 J;  2E5L J;  4DR5 J;  5AJ3 J;  1XMO J;  4K0K J;  4KYZ A;  3R2D J;  4AQY J;  4DR6 J;  3D3C J;  2F4V J;  4LF7 J;  4DV3 J;  4JI0 J;  4DUZ J;  4DR4 J;  4DUY J;  4DR3 J;  3W1Y C;  4V1A k;  4DV2 J;  4JI1 J;  4B3S J;  5IWA J;  4DV6 J;  4LF8 J;  3R2C J;  3J80 U;  3T1H J;  2HHH J;  4DV7 J;  4LF4 J;  4NXM J;  2VQE J;  4X64 J;  5LMN J;  1IBK J;  2UUC J;  4RJV A;  4PWW A;  2UU9 J;  2KL8 A;  1HNZ J;  3OTO J;  5IT9 U;  1HR0 J;  3JAM U;  4JYA J;  2UXB J;  2KVQ E;  4DV0 J;  2UUA J;  2MTL A;  2UXD J;  4DR2 J;  4LFC J;  4DR7 J;  1HNW J;  4GKK J;  4GKJ J;  4JI6 J;  1N36 J;  3T1Y J;  1J5E J;  5BR8 J;  1IBL J;  2MQ8 A;  4DV1 J;  4JI2 J;  4NXN J;  3D3B J;  4YHH J;  1N33 J;  1FJG J;  4JI8 J;  4HHU A;  4JV5 J;  4B3M J;  2UXC J;  1XNR J;  4YY3 J;  4KHP J;  1IBM J;  2MEW A;  4LF5 J;  4NEZ A;  4X65 J;  4X66 J;  3IMQ J;  4JI3 J;  5FLX U;  4JI7 J;  4LF6 J;  4LF9 J;  4JI5 J;  4X62 J;  4JI4 J;  1XNQ J;  3J7A N;  1N34 J;  2ZM6 J;  5LM7 E;  1XMQ J;  2UUB J;  4DR1 J;  4LFB J;  3J81 U;  2VQF J;  4DV4 J;  5A2Q U;  1N32 J;  4NEY A;  4KY3 A;  4OX9 J;  4LFA J; 
#chains in the Genus database with same CATH topology
 3VQT A;  1D1U A;  1KLM B;  3RYL A;  4KB7 A;  3FBE A;  2UVV A;  2B7B B;  5F9N A;  1NH8 A;  5SUH A;  5DG7 A;  1WNE A;  2XBP A;  4OZN A;  1N5T A;  1HNX F;  5AE3 A;  1B7Y B;  1DQ8 A;  3SIP B;  3GII A;  4EO8 A;  1JLF B;  5ETV A;  2ZEJ A;  3A13 A;  1WHV A;  1X4B A;  1N6Q B;  2R9L A;  3D6F B;  3CJ2 A;  3I0S B;  3I9V 9;  3HVW A;  1H74 A;  1M5V C;  1OYE A;  1U0S A;  4FDF A;  1RAO A;  4Y6I A;  3BDP A;  4I0W A;  4FF4 A;  1UEU A;  1UA0 A;  1RLD A;  4UUW A;  4CLY A;  5E0O A;  5ETR A;  2NRE A;  3DGV A;  2UZA A;  5IM0 A;  5DZ6 A;  2MKI A;  2BRL A;  4ED7 A;  3I9Z A;  3LP1 A;  4CLL A;  4M5N A;  2KJV A;  3ZTR A;  1T9X A;  4USH A;  3FMW A;  4WTO B;  2NQP A;  2D74 B;  2ZE2 B;  5CZX A;  1WG4 A;  4DX8 H;  5ETP A;  4YDD B;  2X3G A;  4P2F A;  3IBF B;  1I1G A;  4C8Z A;  3FK4 A;  4IFV A;  3UCG A;  1VLO A;  4X4Q A;  2DGX A;  1YBT A;  1NEE A;  5K14 A;  2GQQ A;  1H73 A;  3R5C A;  3ILI A;  3TEG A;  3FBF A;  4QPX A;  2DHH A;  1VDH A;  7FDR A;  2CIM A;  2ZBP A;  3DYA B;  1NME B;  2ZHB A;  4ZS6 A;  4DPX A;  4KFB A;  3MHY A;  3KKF A;  5KFH A;  1EQM A;  2JWN A;  3PW4 A;  1IBL J;  1P6T A;  4FBU A;  2J5A A;  1WD6 A;  2HWT A;  4YME A;  4DR2 F;  4LFC F;  4DR7 F;  1HW9 A;  1X9M A;  4ZPC A;  3T1Y F;  1VQ5 S;  3AD8 C;  1BC6 A;  2I5J A;  4QYR A;  3G6V A;  2CPE A;  2J9E A;  4FF3 A;  3QZ8 A;  3M7V A;  3TW0 A;  1PCA A;  4O23 A;  4RUH A;  2DNM A;  1HQU A;  4DL4 A;  3BO3 A;  4U7U D;  1WC3 A;  5KFY A;  4FF2 A;  3R5J B;  3BBC A;  4RW4 B;  2C2R A;  3TVZ A;  3VVU A;  4H54 A;  4OIX A;  3QGI A;  4YDX A;  5E3C A;  3D6T B;  4RNN A;  4DG1 A;  5M2U A;  3QIP A;  4LRF A;  1VC6 A;  4CIO A;  2MTL A;  2YNH A;  3BKU A;  3DN9 A;  3RBX A;  3DLK A;  3OPK A;  1FKO B;  2XCA A;  1P9Q C;  1K0V A;  3BDE A;  1HBO B;  2JSX A;  4EWT A;  4DLG A;  5KTQ A;  3UDV A;  1AT1 B;  1KKH A;  2P6S A;  3GIK A;  2L9W A;  3UDC A;  2N4C A;  2BX6 A;  3S8S A;  2ZH9 A;  3FEZ A;  4KKO B;  4RBV A;  2F5G A;  3W5X A;  3ZNJ 1;  3TAM A;  1VBX A;  2WCX A;  5HVH A;  1IR0 A;  1G2E A;  2D9P A;  4Q7A A;  2A18 A;  4X62 F;  1IJF B;  5HQM A;  2CUY A;  2W2O P;  2NYH A;  1QSL A;  4AQY J;  2DNP A;  3K8V A;  2OEK A;  3GMG A;  4ECZ A;  1XMQ F;  2Q79 A;  4P7V A;  3W8P A;  2XHC A;  2XMK A;  4BWM A;  2VFS A;  2FHJ A;  1QDU B;  1RJJ A;  1SV5 A;  5KT2 A;  4K4U A;  8ATC B;  2HFZ A;  4IRK A;  1Y9O A;  4MIA A;  2UXB J;  2L48 A;  2ASJ A;  1S1W A;  5ETM A;  1CJV B;  2MYF A;  2IPO B;  4WXW A;  1T05 A;  4RX6 A;  5KFT A;  3PW0 A;  1RAH B;  2Z2Z A;  1T02 A;  2DNQ A;  1YSJ A;  1Z2Z A;  4CNZ A;  2A6O A;  4I64 A;  4DPW A;  4B9V A;  4P52 A;  1TAQ A;  3OUY B;  1TUW A;  3AOA A;  1FKP B;  3BGU A;  2KYX A;  1VIS A;  4JI3 F;  2GJI A;  2BYC A;  2MJU A;  3N5F A;  3JSY A;  1F2H A;  1NCL A;  4OYM A;  1RT7 A;  3ENW A;  4LBH A;  3FJ2 A;  5IFM A;  4NMX A;  5J1E A;  3ZTS A;  2DTJ A;  1QE1 A;  5A8W B;  2VOP A;  1REV B;  2DGU A;  2VFR A;  5L1L A;  1RI7 A;  2BM0 A;  3BYP A;  3FCH A;  2ZDP A;  2K1R A;  3RR7 A;  4Q8F A;  1C1B B;  1DBD A;  5KFX A;  4PG6 A;  2WRM A;  4F50 A;  4F0K A;  3EJM A;  5KFK A;  4LRB A;  1R8C A;  2AP6 A;  3IO1 A;  3MUR P;  4KHP J;  2ZJP Q;  3PJ9 A;  4P6Q A;  4J37 A;  2HAI A;  4B3O B;  2SXL A;  1GFW B;  5C24 A;  2CVI A;  4FVC A;  1AFI A;  4O44 B;  5D4O A;  4A8K A;  2GO9 A;  5C25 A;  4KV8 A;  1NK0 A;  2VOD A;  1A9N B;  3OTB A;  4WYW A;  3ZO7 A;  1SC3 B;  2RUG A;  2F40 A;  3KG0 A;  4B3T F;  3MM9 B;  1JLG B;  1JLE A;  2I2Y A;  2OAU A;  5HRO A;  3OL8 A;  4EBC A;  2UUW A;  3BSN A;  1KOH A;  2QYG A;  1OIA A;  1TL7 B;  4WZQ A;  2Y8W A;  1HI0 P;  1H2U X;  3CT9 A;  3THT A;  4EYI B;  5JMN A;  4MKA A;  1FRL A;  4K7Q A;  3G87 A;  1TMJ A;  3G8Q A;  2DGT A;  3K7R A;  1B7F A;  2A0F B;  2VQE F;  2LQ5 A;  3W62 A;  4ZA1 A;  4P73 A;  1FJE B;  4Y2I A;  4DV1 J;  4E8U A;  4DN9 A;  4YY3 J;  4OZ0 A;  3V81 A;  3PRV A;  2NXE A;  3QID A;  5FLX U;  1LWE A;  4UOF A;  1O8B A;  3J7A N;  3PV8 A;  1T9W A;  3MED A;  3OHA A;  5A2Q U;  4IR9 A;  3ZZT A;  1X9W A;  4IO1 A;  5FDL A;  2BJD A;  2IIH A;  1W25 A;  2CPF A;  2CFX A;  4C0H A;  2YWE A;  4K4X A;  4ID5 B;  3L9Z A;  4FYY B;  4IG3 A;  1UKU A;  1FK9 A;  1O6X A;  3PXG a;  4LF8 J;  3UN5 A;  1F0X A;  2F63 A;  5EUH A;  4FVM A;  3V6D A;  2HLU A;  3PM9 A;  5B0G A;  3NS6 A;  2XS7 A;  1FFW B;  4M5L A;  2UVU A;  1ZAV A;  3HD1 A;  3PYD A;  1WOP A;  4OHX A;  2GIQ A;  3ITH A;  2FIU A;  1RWM B;  2JJ4 D;  1XNR J;  1U45 A;  3CE8 A;  5D3G A;  3WHI A;  3BJY A;  4EBD A;  5K8M A;  3RBE A;  1HKA A;  3QNW B;  2AKW B;  5AE2 A;  3SBM A;  3DLH A;  1HI8 A;  2V4Q A;  4DJB A;  4M8L A;  5D6G A;  2VBY A;  3MD1 A;  2FJB B;  3ETO A;  5KFE A;  3S6E A;  2OGU A;  1UMJ A;  3E51 A;  5DQH A;  2C28 A;  3CME S;  1FDN A;  2A1B A;  4ZN1 A;  4DV4 F;  3CDA A;  2B4O A;  2BBE A;  1Q81 T;  5DDP C;  5ETO A;  4CYU A;  4O3O A;  4KH0 B;  3CCW A;  3DOK A;  1IXK A;  3IBW A;  3QMQ A;  2HNY A;  3CNQ P;  1T11 A;  1K44 A;  1VQS A;  2J6T A;  4U67 Q;  3KDN A;  1VRT B;  4F4Z A;  2VAS A;  1S4F A;  1FFG B;  4ZVE A;  2RB7 A;  1TKD A;  3MEC B;  2B4P A;  2ATC B;  2OKQ A;  4OI3 A;  3I32 A;  1LXN A;  1U1O A;  1T03 A;  2GZO A;  3F56 A;  2FVP A;  2ZOG A;  2FGO A;  1MML A;  3ONQ A;  3UR3 C;  4KTQ A;  2YNI B;  4JI8 J;  1FXL A;  4K59 A;  2Z4P A;  4NRU A;  2OTL S;  5K8O A;  2E9R X;  3QSY B;  1FD2 A;  4NLS A;  2YWW A;  4HH1 A;  4I56 A;  2K7K A;  4JBC A;  2EFP A;  1U47 A;  4N8O A;  1FTC A;  3W2V B;  2L08 A;  1VQ6 S;  3RRH A;  4ER8 A;  2BAN B;  4M5I A;  2I8E A;  2GHW A;  1PBA A;  1IKY B;  1RT6 B;  3OQ2 A;  4B9S A;  3IWX A;  1S1V A;  3MD3 A;  1D0E A;  3CMQ A;  5KFN A;  2MQP A;  3PYE A;  2MZ1 A;  2MQQ A;  3CXC R;  4GO5 X;  4NYZ A;  5DDQ C;  1Q8L A;  1AA1 B;  4TYB A;  3NAI A;  1IM6 A;  1PAU B;  4DX6 A;  4DX7 A;  3G71 S;  1LWC A;  5KFD A;  1FDA A;  5HK4 A;  2OPR B;  3TUZ C;  1S0N A;  4OYZ A;  1NSK L;  3N01 A;  4EZ6 A;  3P3D A;  2E5I A;  2OPQ A;  1HYS A;  1H2V Z;  2HQ3 A;  4ZVF A;  1NDK A;  2ROE A;  2ZVI A;  1RA6 A;  3FRY A;  4PQA A;  2C2D A;  1S0O A;  4X65 J;  1JJH A;  2KG0 A;  2E5G A;  1J5E F;  2F1F A;  2WBR A;  1SJ1 A;  4USI A;  3TAQ A;  3VHQ A;  1WWH A;  5L1J A;  3PRD A;  3CC4 S;  1UPM B;  4LF1 A;  5JVH Q;  2XY7 A;  1JXE A;  3CCJ S;  2MPU A;  4LRE A;  2VQF F;  1R0A B;  1TUG B;  2AZ3 A;  5I3Q A;  1VK3 A;  1R8B A;  2Z56 B;  4NA3 A;  1PGZ A;  1TL5 A;  1WG5 A;  2I38 A;  4UT4 A;  2XY5 A;  4CWB A;  4GO7 X;  2IMW P;  2FC8 A;  4PWW A;  4ED3 A;  2W2Q P;  1R31 A;  2QTW A;  7FD1 A;  1SPB P;  4QR1 A;  1ZYQ A;  1RAJ A;  3ILL A;  4KGK A;  1WEX A;  1I6J A;  1SJ3 P;  4DU8 A;  4RL1 A;  3MM6 A;  1RHM B;  4PYD A;  2YX1 A;  1C1C A;  1MG7 A;  2EG2 A;  4UUX A;  2R7V A;  1IBM J;  1U25 A;  2EPI A;  4L6V 3;  1FE0 A;  1KN6 A;  4DBQ A;  1OWX A;  2OD6 A;  2QMW A;  2CG8 A;  4LJM A;  4LMZ A;  4RNH A;  3M8P B;  2QSF A;  3VZH A;  2DRA A;  1GT8 A;  3A3O B;  3A8I A;  2KVI A;  2W7A A;  2N82 B;  3TUP A;  2GV1 A;  3DRY A;  1QY7 A;  2EXU A;  1VOM A;  4A8Q A;  1U6B A;  1PYO B;  1V9O A;  4RPF A;  4DI6 A;  5CAB A;  3OL6 A;  2W25 A;  3KJV B;  2HHH J;  2FUG 9;  1QAI A;  1M1K T;  1Q0N A;  5LMN J;  2GVZ B;  1SUQ A;  1RE1 B;  2DR9 A;  2D3U A;  1U1R A;  4WU3 A;  2OHD A;  1RCO B;  1FRJ A;  2DXD A;  3OR2 A;  1D8Z A;  4L73 A;  3GE9 A;  5CYQ A;  4ZHR B;  1YJU A;  5ETS A;  3BF4 A;  3GFY A;  2XI2 A;  1OY8 A;  3HHL A;  4YB5 A;  4X66 J;  2ASY A;  3R1H A;  3KXD A;  3AJ2 A;  5J2N B;  3J80 Y;  2AJF E;  1BWE A;  2CPY A;  2MMY A;  4AE5 A;  1U26 A;  4WZM A;  2UUB J;  3JTP A;  1EQ0 A;  4NEY A;  3KLF A;  4OX9 J;  3TWZ A;  3KLG B;  2VDI A;  2Y0S D;  2V0N A;  2ZOM A;  3FSY A;  4PG4 A;  3D67 A;  3UVJ B;  3OTC A;  1NHV A;  4LF7 J;  4NL5 A;  3W61 A;  3GV5 B;  3M6X A;  2HHP A;  1YIT S;  3K2Y A;  3PR4 A;  5IXU A;  1U09 A;  4V1A k;  5K8P A;  2LVW A;  2VPZ B;  2YBV A;  2QSW A;  2HYI B;  2YH0 A;  2AV5 A;  4R8U A;  2YPZ A;  4I6W A;  4ZPA A;  1TL1 A;  3D28 A;  4ZVQ B;  1K1S A;  1RT1 A;  4HH0 A;  3CC2 S;  2GGP A;  2BRK A;  5MAO A;  1YJV A;  2BQR A;  3V6H A;  1RTJ B;  4ZVG A;  3MEE A;  1IM4 A;  3MUV P;  3W63 A;  4WE1 A;  1AZS A;  2XM3 A;  4XPE A;  4HLB A;  4OYX A;  4O4G A;  3H98 A;  4OI0 A;  1C0U B;  4C0B A;  5KFJ A;  3BGR B;  1WI6 A;  4WBF A;  1R7I A;  2B56 A;  4Z7C A;  3M8S A;  1OPZ A;  1LKZ A;  4C3K A;  3MMC A;  2DVI A;  1RKJ A;  2FHO B;  3PO4 A;  4C3M A;  2NXJ A;  2E44 A;  3H5X A;  3IA0 A;  3NKY A;  3K5N A;  3G82 A;  2XEX A;  2ZUG A;  4DV3 F;  1NKE A;  3ZXW A;  4B9L A;  2DH7 A;  3MMA B;  5IM0 B;  2ZVS A;  5H9E J;  1ITP A;  2MKJ A;  4BWJ A;  3SSS A;  2ADB A;  2HS4 A;  3DOM A;  1CQM A;  4N7T A;  2WVB A;  1EX8 A;  5AT1 B;  3QJP A;  3WZ0 A;  3C15 B;  2G0J A;  4LRA A;  1CJK B;  3DRR B;  3TNV A;  5IZH A;  4OHW A;  3UPF A;  2RH3 A;  2V63 A;  4CLP A;  1PIE A;  1RHJ B;  2AGQ A;  2Z2M A;  1TKZ B;  1X0F A;  5DG8 A;  1Y5I B;  4I69 A;  3HF5 A;  1HA1 A;  3S7R A;  3MM5 A;  3NXZ A;  2YXL A;  3IC1 A;  4JI7 F;  3ZZR A;  5KAK A;  1RA7 A;  3N4W A;  5F8I A;  2KRB A;  3DDK A;  5DZ7 A;  4TNO A;  3HDS A;  1U2F A;  3T6B A;  2XMW A;  3NBP B;  2DNN A;  3CJQ A;  4GMK A;  1S1T B;  2NXC A;  4DV2 J;  4DPO A;  4B3S J;  5IWA J;  2OEM A;  1F6T A;  4MIW A;  2HND A;  2R7T A;  3DGP B;  4X64 J;  1KWM A;  4KPY A;  2I5J B;  4ZPV R;  1B4S A;  3L7O A;  4Y2M A;  5A76 A;  4F67 A;  2KT3 A;  1WHW A;  2F9J A;  2G0I A;  3EX7 B;  2GMH A;  2PEH A;  1DFD A;  3NNC A;  3H5S A;  3QSI A;  5HBM A;  1HQU B;  2AGO A;  2NZC A;  1UFK A;  1W7W A;  1WOO A;  2UP1 A;  4R5P B;  4P2S A;  2VG5 A;  4X84 A;  3BGO P;  4NXN F;  1QAX A;  2AHO B;  2F9D A;  4PXE A;  2LQB A;  1RAI B;  4L3K A;  2FHM A;  1RYS A;  3UCU P;  1CLF A;  2FLO A;  3AA8 A;  2IM3 A;  4FN5 A;  1RQ0 A;  2YNH B;  3DLK B;  1XR7 A;  1MU2 B;  1CJT A;  2PSZ A;  2YVS A;  1X9S A;  2DPJ A;  3LQV A;  3TQE A;  2I0X A;  2R42 A;  3GTY X;  5B7W A;  1PSD A;  2W8L A;  2CNK B;  1RBA A;  1MWQ A;  1RAG B;  2OO4 A;  4E2F B;  2KXF A;  1LWF A;  2J0X A;  1SC4 B;  4DR4 F;  2GML A;  3W64 A;  1R6V A;  1TK5 A;  3PZP A;  2QZ8 A;  1EP4 A;  1F9H A;  3LPE A;  4HHH A;  2QT7 A;  4DV0 J;  3W9J A;  3TAM B;  3T1H F;  1H7X A;  1S12 A;  4AL6 A;  3KLH A;  3VR1 A;  3AB4 B;  2RS8 A;  3GPA A;  2MQN A;  3DLE B;  1RAF B;  3D1Q A;  3B6B A;  4USM A;  3M32 A;  2UUA F;  4NEZ A;  2XMA A;  3PR5 B;  4DL6 A;  2M4M A;  2WBM A;  2V67 A;  3G9C A;  2HHS A;  2RF2 A;  4JV5 F;  5D77 A;  5IOL A;  1FWP A;  1VBZ A;  1QAY A;  3PFE A;  4KO0 A;  2IVF B;  4ZP6 A;  3QZ7 A;  1YQH A;  4NRT A;  3BZQ A;  5KFW A;  1RTI A;  4LT6 A;  1S1W B;  2KKH A;  4F4X A;  1KLM A;  1M5K C;  2A10 A;  1WF1 A;  2X1F A;  3HHE A;  1KOO A;  1Y00 A;  2N3O A;  3Q2S C;  4X4R A;  2JVO A;  2ZZN A;  2H9Z A;  1E6Y B;  4DUZ F;  4ZDN A;  4NCB A;  4UTG A;  1X8D A;  1JLF A;  1BMQ B;  3EYZ A;  2QA4 S;  1PC5 A;  3KWM A;  1R8H A;  3UE2 A;  4CP5 A;  1SKR A;  4CO2 A;  4LF4 F;  1U24 A;  3LTO A;  2AU0 A;  3PX0 A;  3D66 A;  1N6Q A;  2R7X A;  2BQU A;  4LBI A;  2VJV A;  3PYG A;  5F0U A;  2AJQ A;  4DSI A;  3OL9 A;  5HAT A;  1D9D A;  1NJY A;  4BHQ A;  2QE5 A;  5D4P A;  5F0W A;  4PXD A;  3T3F A;  2P9E A;  2EFO A;  2H5I B;  4YR0 A;  2E1P A;  2HS0 A;  2Z0G A;  4CO0 A;  4LF9 F;  5DJB A;  4ATN A;  1K73 T;  2DRB A;  4RW8 A;  5C42 B;  2JL9 A;  4ECX A;  1OPI A;  3RGI A;  4DS4 A;  2H51 B;  4I2P A;  2QIF A;  3LH2 S;  4JI0 J;  5AXK A;  4TY8 B;  1GX5 A;  4HT5 A;  1MRO A;  2RT3 A;  3CJ4 A;  1O51 A;  2AF6 A;  3K5L A;  2KB2 A;  3GYN A;  4UQT A;  4DHV A;  4YN3 B;  1XR5 A;  4F4A A;  4ZCL A;  2JOQ A;  1CG2 A;  5KFQ A;  3KUE A;  1RAA B;  2AYE A;  3MUT P;  5KG1 A;  4CH0 S;  2VU5 A;  4I7F A;  3A4T A;  1ZA1 B;  2DHA A;  2XMJ A;  3C16 B;  1Q86 T;  3VAH A;  3UR0 A;  4AL7 A;  1UVI A;  4LSL A;  2AMC B;  5DGA A;  2VJU A;  4LF6 J;  4XO0 A;  1TTH B;  2M8H A;  2X1B A;  1NM2 A;  3ZZO A;  2B8Q A;  1Z4U A;  2ZKU A;  1RTZ A;  4J9M A;  4J5O A;  3HVT B;  2RSQ A;  1P1L A;  4DR5 J;  3RU0 A;  2J8A A;  4UOH A;  3UI3 A;  2PN6 A;  4K2X A;  3EZO A;  1LQ9 A;  1I94 F;  4RW9 B;  4OZ2 A;  4K4V A;  4G1Q A;  5E7O B;  3OFG A;  1YJN S;  1M5S A;  3V81 B;  4HTJ A;  3Q8P B;  5HAN A;  2XQC A;  1UCN A;  2RE1 A;  3MED B;  4F8R A;  2BJ1 A;  4F4W A;  2BDP A;  1CS4 A;  3I96 A;  1P1T A;  1VS3 A;  1REG X;  2YKM B;  1FWL A;  5HO4 A;  3BH7 B;  3V4M A;  4M63 A;  1S4E A;  5FDL B;  2DK2 A;  4DL0 C;  2VG7 B;  1H98 A;  2EBE A;  2N4D A;  4MYU A;  1HBO A;  3EDR B;  4LF5 J;  1NXI A;  5KFM A;  5IS2 A;  3C6T A;  3HSJ A;  3QBC A;  2NR0 A;  3V4I B;  3CW2 C;  2ZWO A;  2IM2 A;  2MHE A;  3WC2 A;  4NZ7 A;  1KQS R;  4WFX A;  1S99 A;  2KFY A;  4J9R A;  4EMD A;  4RW7 A;  1BY9 A;  3KK1 B;  3G8S A;  3V6D B;  2BQ3 A;  4PR6 A;  3IR5 B;  4OZ3 A;  3G96 A;  4DF8 A;  4YFU A;  2L3M A;  1UFW A;  5A0Y A;  3KFW X;  3M8R A;  1APS A;  3I31 A;  3NS7 B;  3ITH B;  2M5Y A;  1JQG A;  1AW0 A;  3GWC A;  4K4Y A;  1FRH A;  3JYT A;  5KG4 A;  2VON A;  3R5D A;  5F8H A;  2AWZ A;  3ZC4 A;  3CCZ A;  1MMN A;  2DNO A;  2ZC3 A;  2RRA A;  1B0T A;  3EVW A;  2RDI A;  4NLW A;  4IRD A;  2R8H A;  3IFE A;  1RYR A;  2IA6 A;  3PHT A;  4TLR A;  2COL A;  4UF4 A;  4PPD A;  2ASL A;  1A6L A;  2J9D A;  1UVK A;  4CYU B;  2J6U A;  3M1V A;  3DOK B;  1N33 F;  2HGL A;  2HNY B;  4FXV A;  1PJ5 A;  1WC6 A;  3DU5 A;  1HBU A;  4MK8 A;  4W92 B;  3VAM A;  4PWD A;  4DQQ A;  1FKP A;  5T7L A;  3I5A A;  4OMF G;  1IKW B;  1YHQ S;  2LQ8 A;  3GFH A;  4ZPT R;  1VQY A;  1ROF A;  3UD3 P;  4LFA F;  2YQ1 A;  2DNR A;  2RRN A;  1NO8 A;  2JC1 A;  3HPO A;  4A8M P;  1YBU A;  3AD7 C;  3LP0 A;  2V9W A;  2XS5 A;  2QL9 B;  2C3M A;  4P71 A;  3M6V A;  2HW3 A;  1REV A;  3SZ2 A;  1ELO A;  1TL4 A;  1WSV A;  3MAA A;  1HL6 A;  3JQJ A;  4C8Y A;  2KM8 B;  4YR2 A;  2KVQ E;  2HZC A;  1NHK L;  2B9Y A;  4P75 A;  4NXM F;  3I0R A;  4QR0 A;  1ZS6 A;  2WTF A;  1N8R T;  4Q0B A;  3BEG B;  4H4K A;  1F3V A;  3TOQ A;  5IQQ A;  1KFS A;  4K50 A;  1KVI A;  1SQE A;  3L7P A;  2PEB A;  1ZBT A;  5CHC B;  5J2M B;  2R4F A;  3PYF A;  4DS5 A;  3HX9 A;  1ZM4 A;  3BS9 A;  4B3O A;  4C97 A;  3CVK A;  1AFJ A;  4OX7 A;  3T6J A;  4JV0 A;  2PA3 A;  5CA5 A;  1N0U A;  3HT0 A;  5HMW A;  5EX0 A;  2F3J A;  3SDE A;  2ZKT A;  1NKC A;  5IV3 A;  2W7O A;  5F41 A;  2CNO B;  2OPQ B;  4HYK A;  1HYS B;  1SKU B;  3EGV A;  1ZM3 A;  3MM9 A;  3JSR A;  4RU9 A;  1TL7 A;  1Q7L B;  4DL5 A;  2B5J B;  4KSE B;  4U6P A;  2Q6B A;  3GB0 A;  2VZ9 A;  2KH9 A;  5GMD A;  1GAO A;  2XB2 D;  1F60 B;  1Z1Z A;  1YI2 S;  4ICL B;  5EX3 A;  2K3K A;  3VWS A;  3CB4 A;  4ECT A;  1HW8 A;  1KVK A;  3DRX A;  2ZNY A;  1QTN B;  3DLG B;  3UN3 A;  4HAC B;  4S0M A;  3T5H A;  1S6U A;  2YQ3 A;  3GYG A;  3FZ2 A;  1YX2 A;  3P45 B;  3MEK A;  3GV8 B;  5G0R A;  4DV5 J;  5F8M A;  5LMU J;  4WFB Q;  4PEO A;  2BMB A;  3FQL A;  2CJ9 A;  1Q8B A;  1F3F A;  4KGV B;  4DR3 J;  2R8I A;  1C1C B;  3IM8 A;  1JLC B;  3CO0 P;  4ID5 A;  4AD6 A;  2BVZ A;  4C48 A;  3DHW C;  2KZM A;  3U1L A;  2UU9 J;  4URS A;  1GMW A;  1CPZ A;  1VIX A;  2LA4 A;  3HLU A;  2BJ7 A;  4ZIW A;  2V9K A;  1HWL A;  1EAY C;  1Y0H A;  1HMV A;  5KFU A;  1NPR A;  4FKX A;  3K58 A;  3I55 S;  1SXL A;  2LKZ A;  2ZIT A;  3LWL A;  3Q8Y A;  5M2P A;  3P49 B;  1XTZ A;  4FPI A;  5B0B A;  2BXJ A;  3CDW A;  5C5J A;  3NGT A;  1AUS L;  3NMA A;  4NPO A;  3RZA A;  3L09 A;  1I51 B;  2PMW A;  1UZH A;  5JJB A;  1SUQ B;  4NZ6 A;  2EK1 A;  5LJ5 Y;  2ROP A;  1GXT A;  1JK9 B;  2BEF A;  5ETL A;  2GHV C;  4HHJ A;  5HLF B;  3OR2 B;  1HWU A;  2OEL A;  3VVT A;  4DR1 F;  3KJQ B;  3H2U B;  2NSB A;  5EDW A;  3D54 A;  4XK8 C;  1Q7Y T;  3OJU A;  1PC4 A;  1FER A;  3IAM 9;  3QWU A;  2HS3 A;  2U2F A;  3WQP A;  2DCL A;  5CXT A;  2ZD1 A;  2YPY A;  1EZZ B;  3NNH A;  3HHL C;  3BRE A;  3HHL B;  3NGK A;  4OI2 A;  1R3N A;  3AA9 A;  4RJV A;  2FVC A;  1YKW A;  5KFO A;  1TQL A;  2HVH A;  5IT9 U;  3JQM A;  3UNY A;  3AD9 C;  3QLH A;  1QVF R;  5F3Z A;  4JYA J;  1U1P A;  3AB2 B;  1YGY A;  3QRQ A;  1OSC A;  3KHR A;  2A3J A;  2MLX A;  2BW2 A;  3MEC A;  3KLF B;  2Q1L A;  4NLD A;  1DAR A;  2ZWP A;  1S6P A;  2W9C A;  2WSE C;  1DQ9 A;  1ZTT A;  2FGC A;  2AYG A;  4K4T A;  4M5G A;  1CBK A;  3TQ1 A;  3PW2 A;  1HQE A;  4QIV A;  1H6K X;  2R2U A;  4ED2 A;  4RLE A;  4N47 A;  2XTJ P;  4B3M F;  5G4D A;  4KIA A;  4UOG A;  3O6Q A;  3TZZ A;  1RWO B;  2FDN A;  1N32 J;  4KY3 A;  8AT1 B;  2KG1 A;  4R8U B;  2B6A B;  2VKZ G;  4X4P A;  2IRU A;  4ZLJ A;  3RAQ A;  4F0M A;  4QWD A;  3QJJ A;  3WIU A;  4U96 A;  2BAN A;  1WEZ A;  3D0G E;  4JV1 A;  3MEE B;  4F3Q A;  1S0M A;  2EI5 A;  1RT6 A;  1GTE A;  1TKT B;  4KHM A;  4WE1 B;  1NRK A;  1OMS A;  3V5R A;  4J9Q A;  1R0C B;  4O4G B;  5EGY A;  2HVI A;  2AX1 A;  2HBZ B;  5J1P A;  3FSI A;  2JNJ A;  3IN5 A;  2WVD A;  3S1T A;  3MAQ A;  2BAC A;  2V8P A;  3G8T A;  2C2K B;  1HR0 J;  2FZC B;  2DGW A;  4MK7 A;  5KFP A;  2WON A;  2KT5 A;  2IYI A;  1PIL A;  3M05 A;  5GAD I;  1GMU A;  3OV7 A;  2L9D A;  4OHY A;  2OPR A;  1K47 A;  5T14 A;  3GJQ B;  2G0C A;  1F5A A;  1U6F A;  3R7N B;  2W9B A;  1WUU A;  1FT8 A;  2OH2 A;  4ZCM A;  1L3S A;  2UVW A;  1K9M T;  3LF0 A;  3CPW R;  3K17 A;  4MAK A;  3SFU A;  4RKU C;  3JAM Y;  4ZPD A;  1Y3K A;  3AQO A;  3PW7 A;  4EUV A;  3SCL E;  2E5L J;  3SEO A;  2C3U A;  2XS2 A;  2ZH1 A;  2B43 A;  3D4J A;  2LFV A;  4NX9 A;  5H9E K;  1NPP A;  1V5V A;  2FVR A;  2X3D A;  1JLA B;  2CQ2 A;  2VG6 B;  4Q44 A;  3GG1 A;  1SL2 A;  5AJ3 F;  2C1E B;  1R0A A;  3N5B A;  3NLC A;  1NJW A;  4O3N A;  2D3O R;  3RB4 A;  2VBZ A;  4K4S A;  3DLJ A;  4ZP8 A;  2HRY A;  4ZVU B;  2HAF A;  3A12 A;  5KT7 A;  2QO3 A;  1WC5 A;  1JLQ B;  3SV4 A;  1Q79 A;  3TVK A;  1BQN B;  4C8K A;  3OTO F;  1XEZ A;  1RSC A;  4FKY A;  1YLX A;  1VC0 A;  4WFA Q;  4GRS A;  3QT8 A;  1RWK B;  3KLI B;  1DHM A;  1N36 F;  5AXN A;  4F0H A;  2KFZ A;  1L3U A;  4A8W A;  3HFV A;  5L9N A;  2IJF A;  1FXR A;  2OTJ S;  3FBB A;  5IT0 A;  3U02 A;  3PKY A;  3KMS A;  4NML A;  2RQC A;  2CAJ A;  3KOA A;  2CQH A;  4K0K J;  3HJF A;  5SZT A;  4XTT A;  3BN4 A;  3M9N B;  1Q53 A;  3HFK A;  2P2C B;  3PKM A;  4H4M A;  4LRD A;  1IQT A;  4W98 A;  2VIC A;  2Y1I A;  1YJR A;  4DUY J;  1GXU A;  1U1N A;  4CRJ A;  4TQS A;  4KGX B;  2BKP A;  4B17 A;  1HLW A;  2VG5 B;  3KJV A;  4UOC A;  2HEK A;  2YKO A;  2GVZ A;  2JEI A;  3Q0A A;  4FZV A;  4ECW A;  4Q5V A;  4ERD A;  3UD5 A;  4QW9 A;  2Y3Y A;  1IWG A;  2YQ0 A;  2IAJ B;  4HDG A;  2O5D A;  5IQ6 A;  1ZZF A;  5A8K A;  1VQ8 S;  3KDO A;  5J2P B;  1U8S A;  2DR8 A;  5A8R B;  2FHK A;  4YR3 A;  4Y34 A;  2G2Y A;  3KNG A;  4JI2 F;  3CUN A;  5J2N A;  1RTH A;  1Q8I A;  3TZY A;  1J5O B;  2XY6 A;  1Y5N B;  1LWF B;  1U2C A;  4P2X A;  3SQO P;  1IR1 A;  1EP4 B;  2GS8 A;  1XMO J;  4RWW A;  4TLQ A;  1FI4 A;  3GLJ A;  3M2V B;  2RIJ A;  3HJV A;  1N48 A;  6FDR A;  3UVJ A;  3OLA A;  3IP0 A;  3CUL A;  5B0A A;  2LEC A;  2QA4 G;  5D4L A;  3EVO A;  3M32 B;  3R2C J;  2UV8 A;  3MFH A;  1IVZ A;  4RR5 A;  4M95 A;  1N5V A;  5DQG A;  3L3C A;  3US5 A;  3GYX B;  1TKX B;  3KK2 A;  4QWC A;  3CJR A;  1VQN S;  1JJ4 A;  4Y00 A;  2RF2 B;  2IBO A;  1HWI A;  4DL3 A;  1SL1 A;  4DN0 A;  3BGF A;  2NS1 B;  2Y1J A;  2ZUA A;  4KO0 B;  4CH7 A;  3DXS X;  3GIL A;  2MQ8 A;  3N6M A;  2J76 E;  1RTI B;  1SQG A;  1H72 C;  2W4P A;  4IFY B;  4DFM A;  1FEE A;  4USV A;  3B82 A;  2XYP B;  2ASD A;  3P5B P;  1X5T A;  3J81 U;  3OD2 A;  1C0U A;  5ETN A;  1ZPV A;  3NGU A;  1NAQ A;  2QN6 B;  4KQZ A;  1SKW A;  4JI4 F;  1S72 S;  2VUG A;  3W5Y A;  4USK A;  2B7C B;  2ALZ A;  1F5C A;  1SH3 A;  3BGR A;  4DR6 J;  3IM9 A;  3C14 A;  5HN0 A;  1V3S A;  2HFS A;  4LFB F;  2PC6 A;  3CCU S;  3ZZZ A;  1NK6 A;  2WSC C;  2ALY B;  4BBY A;  2JFK A;  1VBK A;  5L39 A;  2V50 A;  2F4V F;  1MNE A;  4DV7 J;  2QMX A;  1VHF A;  2ZH8 A;  2Y1L B;  3MXH P;  2IJR A;  1ZTW A;  1IR2 A;  1LV5 A;  2C3O A;  3NG8 A;  5GAD U;  3MF5 A;  3MMA A;  1FCA A;  2YKN A;  4DSJ A;  2FLL A;  1S1X B;  2XLK A;  1HNZ F;  1B0V A;  3CJ8 A;  4RW8 B;  2DNZ A;  5T41 A;  2M2B A;  1BQX A;  4I2P B;  4GKJ F;  4DEZ A;  3C15 A;  3X3U A;  2HKE A;  4JI6 F;  1CJK A;  3DRR A;  4NA2 A;  5BXI A;  1MRO B;  2X1A A;  2ZM6 J;  1YBA A;  1P8G A;  2HWH A;  1HNV B;  4DCP B;  1PYS B;  1CEZ A;  2CPI A;  1TKZ A;  3ICL A;  5KFB A;  1QUP A;  2HVZ A;  5JVG Q;  2CWK A;  1U02 A;  2IM1 A;  1TAU A;  3FQK A;  3N6L A;  4I7F B;  2QJ3 A;  3EE3 A;  5L1K A;  2ZBR A;  4NAS A;  3NBP A;  3OTD A;  5KG7 A;  1T9U A;  1T9Y A;  4FF1 A;  4LSL B;  1S1T A;  2IC3 B;  1VFJ A;  2W24 A;  2G9O A;  2ZH4 A;  3DGP A;  4RO0 A;  3DOL A;  3MCM A;  2AQ4 A;  2G1D A;  2IDE A;  1H38 A;  4IYQ A;  3GV7 B;  1EIY B;  2F8E X;  2L41 A;  1HHS A;  3VAK A;  1A7G E;  3CED A;  4IQM A;  3IAS 9;  4ES1 A;  2MKH A;  4NI2 A;  2GX8 A;  3DMJ B;  4JI5 J;  4WFY A;  3J7Y I;  1JXV A;  1SJ4 P;  4X4V A;  4G1Q B;  2WOM B;  3PCO B;  3IRX B;  2M88 A;  4R5P A;  2IYG A;  1TL3 A;  1RDR A;  4CLW A;  1LW2 B;  1RGV A;  2BJ8 A;  2CZ9 A;  2FVS A;  2VA3 A;  1RHQ B;  1IKV B;  4QPT A;  2OPP B;  3B78 A;  2LQ9 A;  4F4Y A;  1CS4 B;  1H7W A;  1SIW B;  2QYC A;  1FRX A;  1RU2 A;  4K8R A;  2YKQ A;  1MU2 A;  3OLB A;  3KTQ A;  1LK7 A;  4WK1 A;  2OEJ A;  3C6T B;  1BE4 A;  3KJN B;  4EO6 A;  4AXJ A;  1KQK A;  1N4L A;  4X4S A;  2CQ3 A;  2B9X A;  3AJD A;  1UEK A;  4BS2 A;  4Q8E A;  1WEL A;  3PO5 A;  1RAE B;  3ISN D;  1QM9 A;  4RW7 B;  4OJ3 A;  4PXC A;  2LA6 A;  4EGL A;  2ZH2 A;  2AD9 A;  1FJG J;  4FP9 A;  4QYZ J;  3ZZP A;  2QMU B;  3LAL A;  5MLC V;  4CM0 A;  2EK6 A;  5A0Y B;  3DLE A;  1NJI T;  2ERR A;  2CQD A;  4DCJ B;  1G1X A;  1IBL F;  4IG0 B;  2VB6 A;  3O8W A;  2MZQ A;  5KFL A;  3W8G A;  1T8E A;  4X4N A;  2E9T A;  2CDQ A;  1R6Y A;  3JYT B;  4PXB A;  3VAG A;  3GP9 A;  4DSK A;  1FNX H;  2LDI A;  5DO2 A;  1XQI A;  2EG1 A;  2R3V A;  3D6H B;  4KGM A;  1KQF B;  2V34 A;  3J7A 1;  4MIB A;  3TX0 A;  1DJ0 A;  2XC9 A;  3W7B A;  4N41 A;  2HMI B;  3O3L A;  2R7O A;  3HI9 A;  4DV6 J;  3CJ3 A;  2DIU A;  3PVX A;  2R2S A;  4WYL A;  2ZOF A;  3DKD A;  2CQ0 A;  4OYO A;  5IC6 B;  1O5J A;  1CJU B;  1VHI A;  3IS9 B;  3MMJ A;  3M1V B;  1X0P A;  1FEH A;  1E6Y A;  4NE9 C;  3LPY A;  3PTW A;  4DSE A;  2FJW A;  4RUA A;  2ACM A;  3L95 X;  1GXL A;  4LVN P;  1RZM A;  1HBU B;  4PWD B;  3D0I E;  4LIW A;  4YHH J;  1BLU A;  5T7L B;  3R1L A;  1JNZ B;  1NUE A;  3P96 A;  2H54 B;  5CH7 B;  4Y0F A;  2C3Y A;  4FYX B;  5F8L A;  1XNQ J;  4J90 A;  4P74 A;  3R97 A;  1S76 D;  3LP0 B;  4HVZ A;  3ZNU A;  1UVL A;  2C2O B;  4DFJ A;  1FJC A;  3AY0 A;  3GJS B;  1QJH A;  4O0N A;  3PJX A;  4C11 B;  4KJI A;  1JXL A;  1KHV A;  1J27 A;  2KXN B;  3T9Z A;  3K5P A;  3MAA B;  4X4T A;  2O67 A;  1FRK A;  3OSP A;  3QFW A;  3J81 Y;  2M9K A;  1QVG R;  2RHS B;  5C42 A;  3I0R B;  1SJR A;  4K2J A;  3TJ9 A;  3FFI A;  3LGH A;  4Q0B B;  4H4K C;  3AOB A;  4AQY F;  4TY8 A;  3JSM B;  1KNZ A;  4ANE A;  3EZU A;  4DL7 A;  2BOA A;  3O5T B;  4ES2 A;  1IBK J;  4GVB A;  4RWX A;  4DLE A;  2RQ4 A;  3A8E A;  2FZG B;  4DPY A;  3JXO A;  2IMO A;  3RB0 A;  2CA9 A;  1XC9 A;  2VPX B;  4GKK J;  2HHU A;  1XK8 A;  5H1S V;  3IR7 B;  1RUS A;  1WF2 A;  2WVC A;  2HQC A;  5CD4 H;  1RP5 A;  4D3G A;  3ISZ A;  3TA2 A;  5BR8 J;  2J7U A;  4LUB A;  4C0O C;  3GSI A;  3QFH A;  2G4B A;  2UXB F;  1VQ7 S;  2R8K A;  5H9F K;  1QTM A;  2V2K A;  3C16 A;  1FA0 A;  2EEY A;  4LF2 A;  1XR6 A;  4TN2 A;  2B9E A;  3SDE B;  4QCL A;  1UJ5 A;  1RT5 B;  2IRY A;  1KD1 T;  2HBQ B;  3CMA S;  4J9S A;  4IO9 Q;  1U0H A;  4MYT A;  4JOU A;  1T95 A;  5DDO C;  5E3R A;  3DRP A;  3KK3 B;  1S9G B;  4PG5 A;  5KFZ A;  1IKX B;  1UET A;  3HVT A;  2XMT A;  1U49 A;  3BM7 A;  2W2M P;  2PMZ D;  4RNF A;  3AAW B;  5D0E A;  2NXN A;  2PO4 A;  3M2R B;  1W26 A;  2E5J A;  4QR2 A;  1OY9 A;  1SI9 A;  4C8M A;  3D7S B;  4ECU A;  4DPU A;  5D0H A;  4RW9 A;  2D9O A;  1KS2 A;  4PPZ A;  2CPD A;  1HNW J;  2DO4 A;  4UQG A;  3M8Q A;  5G0R B;  2UXC J;  3UQS A;  3POT A;  1TVR B;  4WTY A;  3G6Y A;  2R2R A;  2YKM A;  4CLU A;  1YVF A;  2EWH A;  3TA1 A;  1NZ8 A;  2VG7 A;  1TFW A;  4F26 A;  1MN7 A;  3J7Y U;  1DY3 A;  2VH7 A;  4IQX A;  1S48 A;  3W5Z A;  1XBW A;  4KHP F;  4RU2 A;  3KHG A;  1HPZ B;  3H40 A;  3V4I A;  4Q2L A;  4B02 A;  4ETZ A;  1FVS A;  2CNL B;  4OI6 A;  3U1N A;  3DDI A;  4IDK A;  3QGP A;  2GAH C;  5GVQ A;  3KK1 A;  2OIH A;  5HMX A;  3PIO Q;  3DNC A;  1HMV B;  3W60 A;  1CC8 A;  1DUR A;  1NZA A;  3J80 U;  2PD1 A;  3BKF A;  1S1U B;  2UUC J;  1NK7 A;  3HVR A;  2QX0 A;  2VKR A;  3D5M A;  3TJA A;  4ZOS A;  2FPH X;  2NPI A;  3BR9 A;  3KG4 A;  1IUJ A;  2UXD J;  3WBZ A;  5EWE A;  2MY8 A;  3DRS B;  5CCL A;  1JJC B;  3FSX A;  4YB7 A;  4YP3 A;  2OSQ A;  4N8N A;  2QFI A;  4W4M A;  1C4A A;  3EXC X;  2ROG A;  1X31 C;  2LQJ A;  3ULH A;  4CT8 A;  4DV1 F;  4ECS A;  4OYA A;  1N52 B;  4YY3 F;  2WAQ D;  3I5C A;  1S9F A;  2ZD1 B;  1C4C A;  1M1H A;  2RQK A;  3M4X A;  5HJX A;  4E98 A;  4B3R J;  4NLV A;  2BJ9 A;  1KP6 A;  3QLH B;  1HI1 A;  1Q5Y A;  3LP2 A;  2XGQ A;  4U7C A;  1RT4 A;  3EM1 A;  1MW7 A;  4DQS A;  4ECV A;  1IKW A;  4IOC Q;  1S6P B;  3Q8Q B;  2W9C B;  2BKO A;  3CCE S;  3W9H A;  4ELT A;  2HHX A;  3R5B A;  1HQE B;  3N79 A;  1KQG B;  2O1P A;  2YNF A;  4KPC A;  4LF8 F;  4ZJQ A;  1YZ6 A;  2V69 A;  3T5L A;  1S6Q A;  1TMM A;  4Y3C A;  1HBN B;  4G6V B;  5D0R A;  3EIC A;  3TZX A;  1YTY A;  1ZOT A;  4QQB A;  3FUY A;  3ZFV A;  3KLE B;  4URQ U;  4WU2 A;  4ZVH A;  3HFZ B;  1N34 J;  2NYI A;  5J2M A;  2BJ3 A;  4IOA Q;  4RW6 A;  5EWG A;  3BR8 A;  3QYY A;  4F3M A;  1HWJ A;  2IHR 1;  1N5S A;  2X51 A;  2C22 A;  4V19 J;  4N5S A;  3G4S S;  2CRL A;  2WON B;  1OY6 A;  4ED1 A;  4MMO A;  5F3T A;  1X4F A;  5L9X A;  4U7U K;  1V6H A;  2AEF A;  1RWU A;  5I3P A;  3M30 B;  4JI1 J;  3UDL A;  1RAD B;  1BWV A;  2CQ1 A;  4ZPB A;  2KHD A;  1QUV A;  4NLG A;  2W9B B;  1VMB A;  2HFN A;  2MZJ A;  4AXI A;  5C2G A;  2CXE A;  3DHX A;  1Y7P A;  1HD0 A;  3PX6 A;  2XO7 A;  3F0N A;  1X60 A;  1BD6 A;  3GFX A;  3MPW A;  2B5J A;  1ZAW A;  3BB5 A;  4K5R A;  2MY7 A;  5KFS A;  4ICL A;  4J9L A;  2MKY A;  4Y28 C;  2X1G A;  1HWK A;  1SCJ B;  1FNO A;  2AW0 A;  2YX7 A;  3VAF A;  3DLG A;  4JI8 F;  4HAC A;  1QAJ A;  1JMT A;  3N6N A;  5LOQ A;  2WSF C;  3VZI A;  2FY1 A;  1KTQ A;  1HNX J;  1Q8K A;  1EHW A;  4WP3 A;  2R7R A;  5HSP A;  3PEH A;  2CPH A;  4J9N A;  3CJ5 A;  3JTO A;  4ILR A;  4YQW A;  1Z2L A;  1SKS A;  4M5M A;  2V8H A;  2VF3 A;  1GTH A;  2QA1 A;  1KFD A;  1SQF A;  1UVN A;  3CJK B;  4DPT A;  4MKV A;  3OTE A;  2E5H A;  3ENQ A;  3K8W A;  1UEV A;  1YJW S;  4IUF A;  1JLC A;  3SCI E;  5KG3 A;  4ED6 A;  3QAE A;  1JJ2 R;  2VPY B;  3ZZ0 A;  3MUM P;  1TV6 A;  3UNG C;  2GQC A;  2VPW B;  1VJQ A;  4F25 A;  3BQ1 A;  4ZLP A;  3J81 j;  2HBY B;  2AJ1 A;  2DEI A;  1VYA A;  2V4J B;  1KBR A;  4OFZ A;  2PI5 A;  2J9C A;  1S7I A;  1SH0 A;  2LU1 A;  2EFN A;  4NLY A;  2E9Z A;  4H4M B;  3W66 A;  4DX5 A;  3THP A;  1BQM A;  1G7C B;  5LM7 E;  2EKY A;  3AT1 B;  1M0S A;  2Y1R I;  1CQN A;  1BXN A;  4X65 F;  1IQZ A;  5IC4 B;  4A8O A;  2JC0 A;  2M52 A;  5HVF A;  3MFI A;  3FCV A;  4PZV A;  2MQL A;  2V2Q A;  4DSF A;  1N56 A;  4Q2M A;  2ZBC A;  1CVJ A;  5HLF A;  4DL2 A;  2GMJ A;  4PWU A;  3W3S A;  1N5Y A;  2HGN A;  1FFS B;  2AJ0 A;  4EYH B;  5A8K B;  4Z2X A;  1M5H A;  3K0J A;  1S6O A;  1C0T B;  3UCZ P;  3GZ7 A;  2DO0 A;  2PFD A;  2LP4 A;  2EC0 A;  3VCD A;  1MWZ A;  3WIV A;  4DR2 J;  4LFC J;  3TRG A;  4DR7 J;  1RTH B;  4MKB A;  2MLZ A;  3OBI A;  3T1Y J;  2ZFH A;  1G4C A;  3BSC A;  4BC9 A;  2FTR A;  3AXM A;  3NCR A;  4NLT A;  4FBT A;  4XPC A;  2GCF A;  2MZT A;  2HVE A;  5KT5 A;  3MR5 A;  1X4E A;  1YRT A;  4ZVO B;  3R8Y A;  2K3I A;  4URG A;  2ZNZ A;  1IBM F;  1U1L A;  1DLO A;  4ZK7 M;  1WTF A;  3KK2 B;  4CLK A;  3K5O A;  3R2D J;  2KI2 A;  2B6A A;  2R8G A;  1U4B A;  4I2Q B;  2C2E A;  1VQP S;  4ZCK A;  2RQM A;  2PT0 A;  3ENV A;  3N28 A;  4UY8 T;  1TKT A;  4XDC A;  4YUD A;  2MLY A;  3D1O A;  2DEJ A;  2W4C A;  2RRB A;  2RD5 C;  3QQC D;  4PRF A;  4WJB A;  4F4K A;  2C3P A;  2CJQ A;  3CDB A;  3MTK A;  2HHH F;  1IN0 A;  4P7T A;  1WOR A;  5LMN F;  5AXL A;  4ECY A;  1NHU A;  4G1P A;  3AFG A;  3EGN A;  2Y9H A;  2OJ3 A;  4JP8 A;  1N54 B;  3SI8 A;  3BKT A;  3C14 B;  2ZHA A;  4EBE A;  4QOT A;  3H5Y A;  2VBX A;  3AQP A;  5AXM A;  4CM2 A;  2V68 A;  2ZH6 A;  4X62 J;  4KT0 C;  5DET A;  2IJN A;  2D1C A;  1GX6 A;  1NDP A;  3MEG A;  1XMQ J;  5DLF A;  1T94 A;  2HRT A;  4X66 F;  1FXD A;  4DQI A;  3MM7 B;  1TZ0 A;  1TU0 B;  2W4D A;  4A8X A;  4QU7 A;  1XWL A;  3CCM S;  1UJ4 A;  3C19 A;  1ICE B;  2UUB F;  3EPG A;  1I5O B;  2YKN B;  4OX9 F;  1YJ9 S;  4CO3 A;  3WX4 A;  3LW5 C;  3CD7 A;  2XO6 A;  3V6J A;  1JLA A;  1JLB A;  2VG6 A;  4LF7 F;  2YWF A;  2MDA A;  3EXY A;  2ATL A;  3HXM A;  3JB9 k;  1KTV A;  3QAU A;  2VV5 A;  3LO3 A;  2CJX B;  3NY0 A;  2LXF A;  3M9O B;  3WX8 A;  1UZD A;  4P2M A;  5BYQ A;  2BJE A;  1WC1 A;  2QL7 B;  4L74 A;  2DNL A;  2BE2 A;  2JZ5 A;  3R27 A;  1JLQ A;  2XMU A;  3NGS A;  2ILY A;  2C2N A;  3B54 A;  3E8O A;  1BQN A;  4I1T A;  3GQC A;  4EK2 A;  2YNG B;  1UWB A;  4DSL A;  4JI3 J;  4ECR A;  3MM8 B;  1DRZ A;  1OO0 B;  2OFG X;  1HBM A;  2Q6C A;  2A2C A;  3KLI A;  1R27 B;  3TAP A;  1HIY A;  3NOC A;  3SCK E;  2DHX A;  1B99 A;  1UFL A;  4PG8 A;  1CUL A;  1T9T A;  4USW A;  3ILJ A;  1UW4 A;  5E41 A;  2ZZT A;  3DOL B;  1X4A A;  2E66 A;  3ZTQ A;  2XCP A;  2I9S A;  5EN1 A;  5FII A;  1M1G A;  1D09 B;  3MGJ A;  2HNZ A;  3WDO A;  2D3O 1;  5D4N A;  5LXR A;  4NI2 B;  4NLU A;  3EVM A;  2CDR B;  4Y2C A;  1WSR A;  3LOU A;  4FYW B;  2XNR A;  2DR5 A;  2AX0 A;  2E1C A;  2F8H A;  5ITH A;  2DH9 A;  2WK4 A;  1YJ7 A;  3H20 A;  3M8Y A;  2AEJ A;  4BCA A;  2R7S A;  4N56 A;  1UL3 A;  1YJT A;  1MMD A;  4EFA C;  1FX2 A;  1TL3 B;  3CJS A;  3G2X A;  3MZI A;  2V94 A;  3PY8 A;  3OW2 R;  3FNN A;  2GFF A;  3BSA A;  2KFN A;  2KYZ A;  1VCT A;  2DNY A;  2E1A A;  4RZR A;  4WP8 A;  1BHN A;  2IAJ A;  4MFB A;  1DTT B;  3H0P A;  1DAX A;  4A46 A;  1WF0 A;  5J2P A;  4OX6 A;  2GHP A;  3I4P A;  5A8R A;  2GIR A;  4J9U E;  3CCV S;  4ZN3 A;  4B3T J;  2DXE A;  4O3R A;  1B70 B;  1G3O A;  3ET6 B;  1J5O A;  4PYA A;  1U1M A;  1UW9 A;  5HL7 Q;  2Q43 A;  1JNR B;  2DPI A;  1RKI A;  2PI4 A;  5KFR A;  3BO4 A;  1DTQ B;  1VQM S;  3M2V A;  3NAH A;  3H4D A;  1PYT A;  3P8B B;  1U2R A;  3FVY A;  3CF5 Q;  2PDA A;  2MB0 B;  1Q95 G;  1WKK A;  2VQE J;  3RUB L;  2XSJ B;  4QYZ K;  2JH3 A;  1EKR A;  3UDE A;  2BUN A;  5I3U B;  4C8L A;  3U1M A;  2XZW A;  4DV2 F;  2DY9 A;  4B3S F;  5IWA F;  4YB6 A;  1TKX A;  2ZH5 A;  4UW2 A;  4X64 F;  4A8S A;  2ZJR Q;  2XMM A;  3LUY A;  4TY9 A;  4NWB A;  3JS9 A;  2DY1 A;  1MN9 A;  3I5B A;  3UD4 P;  5KT4 A;  1VRQ C;  2RHQ B;  3KG1 A;  2KXH A;  5KFA A;  1FJ7 A;  2L9N A;  5DG9 A;  3TAN A;  3KYL A;  1EET A;  4IFY A;  5B0E A;  1BUX A;  1Q82 T;  1FD8 A;  4CH1 A;  2B3T B;  4NLX A;  4OZL A;  1ACM B;  4LVO P;  1N0V C;  1RB0 A;  1D3W A;  3R6L B;  2FD2 A;  2HIQ A;  3G6E S;  3BQ0 A;  2CG4 A;  1Q1K A;  2XGP A;  3QWP A;  4NOH A;  1TFY A;  3UN2 A;  3FDS A;  1F2G A;  2HUR A;  4DFP A;  3ZTP A;  3RJM B;  1EKS A;  5BYR A;  3N9U C;  1RT3 A;  5A6W A;  4DF4 A;  3BBB A;  3MR2 A;  5GME A;  4KHR A;  4C3L A;  1JKH B;  3CDE A;  1ARO P;  2HFU A;  1KSP A;  1MWY A;  4FS1 A;  1AUD A;  3V2U C;  2C2M B;  3HO1 A;  2F8M A;  1VQK S;  9ATC B;  4DV0 F;  5B0F A;  3TEH B;  1OS5 A;  1S1X A;  2NZ4 A;  2R7U A;  2LMI A;  2BAB A;  2RS2 A;  1TR0 A;  3EPI A;  3FFI B;  1M5O C;  3E2E A;  2G2Z A;  2CQI A;  1FF2 A;  1Y3J A;  3HCX A;  4GC6 A;  1X4D A;  4DV4 J;  4ECQ A;  1UPP A;  3C6U A;  4GVB B;  1YIJ S;  5KG6 A;  5F8J A;  1HNV A;  2XYG B;  4G65 A;  4Q43 A;  2MGZ A;  4OQJ A;  2PA8 D;  4O4R A;  4CLS A;  1V5I B;  2LEP A;  1PBU A;  1HAR A;  4KGZ B;  2KZZ A;  2DKO B;  1B3T A;  3MPU B;  2ZH3 A;  5E5N A;  3TR5 A;  3C8Y A;  3E01 B;  1SVD A;  2CQ4 A;  4MTP A;  2HFV A;  4M5K A;  3CD6 S;  2XNQ A;  2MST A;  4DFK A;  4F04 B;  1FRI A;  3V6K A;  2AGP A;  1DZ5 A;  4K5S A;  5F8G A;  2IC3 A;  4NA1 A;  1U0H B;  1J2V A;  2A2D A;  2HK2 A;  1VBY A;  2RKI B;  3CCT A;  3HZE A;  2GJ2 A;  3DRP B;  1HHT P;  2FZK B;  3KNA A;  5HJY A;  2B4U A;  5BYS A;  5DS7 A;  2IDL A;  4HI1 A;  3MPD A;  2P8I A;  4WWS A;  1YRX A;  1NBE B;  2LEB A;  3M8W A;  1LFP A;  4OYP A;  3DMJ A;  3PG9 A;  3AOD A;  3RW6 A;  1HFE L;  3W9I A;  3OFH A;  2IM0 A;  3EDQ B;  4NCG B;  2K7J A;  2OMO A;  2WOM A;  5D78 A;  4A4J A;  3IRX A;  1VQ4 S;  3OR1 B;  2F7V A;  1VRU A;  2FB0 A;  4ZCI A;  1LW2 A;  3GG0 A;  3LGN A;  4AND A;  4PCQ A;  5DM6 Q;  1IKV A;  2OPP A;  3M8Q B;  4ELV A;  3NOG A;  5DQI A;  2RJZ A;  1AXQ A;  3HSD A;  1H0H B;  3WC0 A;  3POT B;  3SCJ E;  3MCN A;  4JI0 F;  2RUS A;  3IRW P;  1I3O B;  1GQE A;  5E33 A;  4M94 A;  2QLW A;  4USU A;  1VIO A;  4TU7 A;  4O3Q A;  3MAH A;  1RIS A;  1C2P A;  1J5E J;  2VHG A;  3T19 A;  4OZ1 A;  2Q66 A;  3TUI C;  2BV3 A;  3HMJ G;  4IDK B;  2DNG A;  2NUH A;  1SIZ A;  1RTD B;  5LSR A;  1TP7 A;  4WPA A;  4GVL A;  3SQG A;  2BKN A;  4LR7 A;  4EI2 A;  1CSJ A;  3OFE A;  2VQF J;  5A6P A;  3HHK A;  4ITS A;  5KOX A;  2I6W A;  4IG0 A;  3I56 S;  4LF6 F;  3JTN A;  1FHT A;  3MMB B;  4CLZ A;  1YG0 A;  3NL0 A;  3ADA C;  5CAA A;  3PEJ A;  3A3N B;  3FCW A;  4WCE Q;  4L75 A;  2ZH7 A;  2QV6 A;  3A8K A;  1U48 A;  4M5D B;  2XG8 A;  1RT2 A;  4PKD B;  3CCL S;  1OJ4 A;  2MKC A;  3MPV A;  2VC0 A;  3GCW P;  4BC7 A;  1T3N A;  3ENA A;  3DM2 B;  4LR8 A;  4DR5 F;  3VGV A;  2NUU G;  3BBF A;  2IY5 B;  2OP5 A;  2FHJ D;  3QJL A;  3R5A A;  2R2T A;  2LEA A;  2HMI A;  1URR A;  4TKT A;  5CD4 A;  2P6T A;  3RRK A;  2ZDO A;  4NLO A;  1CJU A;  5KFC A;  1D9A A;  3IS9 A;  4J9V A;  1U1K A;  3HM9 A;  3AOC A;  5CYJ A;  2M0G B;  4NLP A;  1S9E A;  4IH6 A;  1FDB A;  3GU0 A;  3TAR A;  2E7X A;  1VC5 A;  4WF9 Q;  4TXS A;  2O01 C;  3LP2 B;  3IG1 A;  3VAJ A;  1RT4 B;  1GMV A;  1HNI B;  3MCO A;  2JLE A;  2J0Q D;  2HZV A;  3CD5 A;  1KC8 T;  4ES3 A;  3C46 A;  4FYD A;  2AEM A;  4ZJO A;  1LW0 B;  3TA0 A;  1FO1 A;  1B64 A;  4LF5 F;  4TU9 A;  3SYZ A;  3KJF B;  4ZP9 A;  4BLG A;  2ACY A;  3THV A;  4LBP A;  1ZA2 B;  1SL0 A;  2HHT A;  2YNF B;  3EMT A;  5F8N A;  2O66 A;  1VR6 A;  4C11 A;  1S59 A;  4HKQ A;  2KM8 C;  1OQ3 A;  2OFH X;  4OLP A;  1S6Q B;  1VGY A;  2P9G A;  4C98 A;  4K4Z A;  1VQ9 S;  2HBR B;  4EEY A;  1NB7 A;  2H5J B;  2CPJ A;  4WIQ A;  2DIT A;  2GIF A;  3JSM A;  3AH6 A;  8RUC A;  2GVD A;  2W01 A;  3M6W A;  1FES A;  4R25 A;  3JAM U;  1BGX T;  2DGS A;  2ILZ A;  3LAN A;  3ETM A;  3TYT A;  2Z30 B;  3H7H B;  3LGM A;  3LWM A;  4RW6 B;  3MR7 A;  1MSW D;  2GC8 A;  2E29 A;  5K20 B;  3K5M A;  2KU7 A;  5L8R C;  2QG9 B;  1WOS A;  1SB6 A;  2EC2 A;  2DIS A;  2LU2 A;  5KFG A;  3CWJ A;  1R8A A;  2VOO A;  2FJV A;  3BYR A;  4CTA B;  1U6Z A;  2IVM A;  1GNK A;  1RU1 A;  2FQQ B;  1Y5L B;  1PAE X;  1NSP A;  2M7S A;  3HHD A;  1RT5 A;  2CQP A;  1PKU A;  4OI4 A;  3DLB A;  3A1Y G;  2U1A A;  2LYV A;  1T0T V;  3GCX P;  1HHQ A;  5IT4 A;  4YOE A;  2DHG A;  3QO9 A;  2W7P A;  2FC9 A;  3KK3 A;  1S9G A;  3DI6 A;  1X4G A;  3NEK A;  1IKX A;  4J91 A;  1Q16 B;  5FLX Y;  5B0C A;  4B08 A;  2DXF A;  4I4B A;  3M2R A;  4I6Y A;  5CYM B;  4RBU A;  2H48 B;  1TK0 A;  5A2Q Y;  6FD1 A;  3F44 A;  3M2U A;  3M9M B;  4QZV B;  1R0B G;  4X2B A;  5E3P A;  4XDD A;  4ILL A;  3ZTO A;  3C2P A;  3FRZ A;  2HHQ A;  2BA9 A;  2JX2 A;  4Q45 A;  2MEW A;  1RK8 A;  4OYW A;  1YK9 A;  3TO8 A;  3BQ2 A;  4OHV A;  2P9C A;  4NCA A;  2LDY A;  4CNY A;  3AHP A;  1TVR A;  4RUB A;  3NWR A;  4QU6 A;  5C7P A;  4ILM A;  2IFX A;  4HDH A;  3Q8S B;  4ZJL A;  2YKA A;  3OXG A;  3PX4 A;  4F2R A;  1G6B A;  5B08 A;  1WC4 A;  4FYV B;  5J2Q B;  1GH8 A;  4WKY A;  5KT3 A;  1HPZ A;  3VGS A;  1TV6 B;  3K89 A;  4DV3 J;  3BH6 B;  3VAI A;  1PJ7 A;  1WEY A;  1L3V A;  3UFC X;  2LXU A;  1SBR A;  1ULR A;  2W2N P;  5B09 A;  2YWG A;  2DIV A;  2QL5 B;  2GNK A;  4ANC A;  3BN7 A;  1BQM B;  2B9W A;  2POK A;  3TX8 A;  1S1U A;  3SXL A;  4A48 A;  1WAC A;  2WW4 A;  4K4W A;  2MHN A;  2W2P P;  3A3P B;  5AE1 A;  2AJ2 A;  4YS2 A;  3D68 A;  1SH2 A;  4PUO A;  2ADC A;  1Y4Z B;  3DRS A;  4OI1 A;  1WI8 A;  5I42 A;  2XHW A;  4D3H A;  2OUG A;  3Q83 A;  3RB6 A;  3CO9 A;  4JI7 J;  4OL8 A;  1JWW A;  2M3D A;  2XI3 A;  2P5V A;  4B9T A;  2B51 A;  2FJE B;  2YY3 A;  1N5Y B;  3HKZ D;  3Q89 A;  3H8Y A;  1CC7 A;  2Z2Y B;  4C8N A;  5LT5 A;  2F4F A;  3RW7 A;  1KR4 A;  5L46 A;  1D8Y A;  1AYE A;  4TU8 A;  1YWX A;  1S7H A;  3BV8 A;  4DV5 F;  5LMU F;  2CZ4 A;  2OML A;  3VAL A;  2EW9 A;  5HQL A;  5CCM A;  3GIJ A;  1YRU A;  4ELU A;  2MKK A;  4WK3 A;  3RG6 A;  3U7J A;  1W2B R;  4OLO A;  3OHB A;  4DR3 F;  2DT9 A;  2BW7 A;  3GJR B;  2DJW A;  4HEA 9;  4PQU A;  1QSS A;  4G3I A;  1DLO B;  1O0P A;  2RDJ A;  4LSZ B;  4CCH A;  3RB3 A;  2UU9 F;  2YWK A;  4WII A;  3MDF A;  4NXN J;  4USJ C;  3RAX A;  1VK8 A;  1FRM A;  3CCS S;  4ZVP B;  2N7C A;  1HBN A;  3BPD A;  4Y65 A;  5ADZ A;  2ZBI A;  1TEL A;  1Q5V A;  3LP1 B;  1S5Z A;  2PMH A;  9RUB A;  3KLE A;  3T5J A;  3F41 A;  3I87 A;  4J7C A;  4QIG A;  5HQ8 A;  3SV3 A;  3LAM A;  1WC0 A;  4IFV B;  3H42 A;  2V5H G;  2C42 A;  5K14 B;  4LSN A;  4DR4 J;  2DGO A;  3IR6 B;  3GFZ A;  2V2V A;  4QWE A;  1JIH A;  2EBG A;  4RNO A;  2NPF A;  2Z8Q A;  2JHE A;  3T1H J;  1KLN A;  1WHY A;  3DCA A;  4QIW D;  4KFB B;  3TUJ C;  5DLG A;  1XN9 A;  3NRB A;  3M30 A;  2KL8 A;  2OPS A;  2NCK L;  4U8Y A;  4ZIT A;  2CQG A;  3H2L A;  1NSQ A;  4ED8 A;  3MEG B;  2UUA J;  3EZ5 A;  2V4R A;  3A8J A;  5L1I A;  4B9N A;  3B8H A;  3IXQ A;  2AT1 B;  2H1Y A;  3D3B J;  4HHU A;  5GAH I;  4JV5 J;  4JYA F;  2W1B A;  3NNA A;  5LJ3 Y;  2IRX A;  4QBU A;  1WJ9 A;  1LOU A;  3IGV A;  4M1K A;  3L7U A;  4L72 B;  5GAE I;  3Q8U A;  2HK3 A;  3RBD A;  2CNN B;  2J0W A;  4OZ5 A;  1JX4 A;  2CJA A;  1S57 A;  5FD1 A;  1JLB B;  4CLT A;  4FXD A;  5KT6 A;  1ZM2 A;  1GEH A;  4C6A A;  3Q23 A;  2XZT B;  3M6U A;  3H4B A;  2MKS A;  2KTQ A;  1PJ6 A;  2XLJ A;  3QT5 A;  1Q4R A;  5D15 A;  4RNM A;  3J7Z 5;  1T7P A;  2O3D A;  4PAA A;  1N32 F;  4DUZ J;  3RR8 A;  2BE2 B;  3MOJ B;  4DG1 B;  2E1M C;  2HSE B;  1YDL A;  1WG1 A;  5KFF A;  2XWX A;  1E6V A;  3Q24 A;  4O3S A;  4LF4 J;  3QIP B;  1UWB B;  4C7Q A;  2J7K A;  3CJK A;  2EFG A;  3TJ8 A;  2B8P A;  5HAO A;  1X7V A;  3H90 A;  1HBM B;  4LQ9 A;  1M5P C;  2FYX A;  5EHH A;  3HHN B;  3MWB A;  3PRB A;  4H4O A;  4QJV A;  1CUL B;  1HR0 F;  5GAG I;  2IBK A;  2VD3 A;  4PG7 A;  2JLF A;  2MJN A;  3EUN A;  2V4J A;  4LF9 J;  3R3T A;  4P9S A;  1KON A;  3T1A A;  2HNZ B;  4DXL A;  2KO1 A;  2CPX A;  1NDC A;  2EFQ A;  1PG5 B;  2B0G A;  1X5P A;  1WTB A;  4OV1 A;  5HP1 A;  4BDP A;  1FE4 A;  1SV5 B;  3W2W A;  1KVJ A;  4OJH A;  1Q78 A;  5KFV A;  1NK4 A;  3NP5 A;  2E5L F;  3O44 A;  1DQA A;  1HQ2 A;  1IJE B;  3FKB A;  3RRG A;  1NKB A;  4ZVR B;  2HHW A;  3FEX B;  3HVA A;  1WHX A;  3D9B A;  3GON A;  4MFB B;  1QLN A;  4NYO A;  1QSY A;  2KN4 A;  1T05 B;  1C0T A;  2DRD A;  5BJR A;  1VLY A;  1NPK A;  2WW8 A;  2GAG C;  2DGQ A;  3KUG A;  2VFU A;  4ED4 A;  2CVE A;  3OVS A;  5HVG A;  3D1H A;  2LXI A;  3CDU A;  3HZG A;  4U95 A;  1U1Q A;  2R7W A;  2JVR A;  4EU0 A;  2J7W A;  2CWX A;  4J9P A;  3Q22 A;  3HHL D;  2GO8 A;  1ZET A;  1X5O A;  4I6A A;  5EWF A;  3I0S A;  5E2Q A;  2QFJ A;  2VFV A;  4KR0 B;  2UUT A;  1S79 A;  2FJD B;  3T9N A;  1VI7 A;  3EWG A;  5B0D A;  3O1L A;  3HK2 A;  1RT7 B;  1I94 J;  1N5Q A;  2AJ4 A;  4PAB A;  5J1E B;  1VQL S;  1VQO S;  3HD2 A;  2QGF B;  4A8F A;  2BZ2 A;  1QE1 B;  3VGU A;  2DCU B;  1NJX A;  3C66 A;  1S97 A;  4ZIV A;  1ZAX A;  4DOZ A;  3QGH A;  4K0K F;  3PFO A;  4I2Q A;  2K1R B;  2N7Y A;  1SJQ A;  2W8K A;  4KRW A;  2BE7 D;  4L76 A;  3IWL A;  4DU7 A;  2QLJ B;  1RBO B;  3OVA A;  2JEG A;  5U47 A;  3KUH A;  4NYP A;  4DUY F;  2QRR A;  2WHO A;  2ZE2 A;  1EET B;  3TI0 A;  1FKA F;  4WKR A;  4IH7 A;  5KFI A;  2PFF B;  4ZLN A;  4QW8 A;  3TZW A;  4R0J A;  1KRP A;  5HMZ A;  1L3K A;  2A6M A;  1WDD A;  5C24 B;  1WKL A;  2GA7 A;  4ETX A;  1XIQ A;  3OSN A;  1U7L A;  4F3O A;  2DD8 S;  3DYA A;  2AZ1 A;  2YX4 A;  4OZJ A;  3DDN A;  4L3N A;  3CJT A;  5K9F A;  4LR9 A;  3K57 A;  5C25 B;  4KV8 B;  3OXF A;  2IVY A;  4AYB D;  3LAK A;  4KYZ A;  3DC2 A;  1RT3 B;  1JLE B;  2CJB A;  5HRO B;  3MM7 A;  3QPI A;  4KC5 A;  1XMB A;  5ETQ A;  2KJW A;  1F5B A;  1XMO F;  4IKA A;  5LXY A;  2CZV C;  1WKJ A;  2Z58 B;  4RBT A;  2K8G A;  1SC1 B;  4IRC A;  2XUL A;  2Y0B B;  5LSL A;  3H59 A;  2RAQ A;  3R5G A;  1OYD A;  2YKP A;  2CQB A;  4ED5 A;  2X7I A;  4Y2A A;  2V8G A;  2NLW A;  4C2M A;  1X4H A;  3T41 A;  5JXS A;  1NND A;  4RW4 A;  3C6U B;  2CKW A;  2FLN A;  3MCS A;  4F2S A;  5GAH U;  3DLL Q;  1N33 J;  1N88 A;  1ZH5 A;  1FWK A;  1LWE B;  4A47 A;  1K0T A;  1RLC L;  4ENO A;  3LA0 A;  3HSZ A;  2MGZ B;  2HPU A;  1NH7 A;  4CT9 A;  4WFN Q;  5GAE U;  3ILO A;  1RWW B;  5HMY A;  2ZZM A;  1B0P A;  3I4H X;  2YNG A;  3U27 A;  4O3P A;  3MM8 A;  1FKO A;  4YEA A;  4LFA J;  2OLW A;  1RWV B;  2K06 A;  4P72 A;  2JDJ A;  4LQ3 A;  3AJ1 A;  2ABY A;  5ETK A;  2BM1 A;  2AIR B;  2VC1 A;  5DRK A;  4IG3 B;  2HZA A;  1UAW A;  5KOW A;  4W90 B;  1FK9 B;  1R8P A;  3UO0 A;  3TVY A;  4C8O A;  2H4Y B;  2F65 A;  1ZZN A;  1K8A T;  3W1Y C;  2HQD A;  1UVM A;  2VBW A;  5ETT A;  4AT1 B;  4KKO A;  1RAB B;  1T3O A;  3MTJ A;  4JUZ A;  4DR6 F;  2HWI A;  3PAC A;  4NXM J;  2NSC A;  2RVJ A;  3DXB A;  2MXY A;  5DGB A;  3OVB A;  1VJW A;  1NK5 A;  4HL9 A;  2YTC A;  3B4M A;  5K8N A;  4Z37 A;  4JB8 B;  3BPS P;  4CO1 A;  4DV7 F;  3X1L B;  3HSG A;  2YH1 A;  5D3G B;  2AYB A;  1ZM9 A;  5KG0 A;  2RU3 A;  1EB0 A;  5GAG U;  4HR2 A;  1VRU B;  2APO A;  4C9D A;  2PGC A;  3NGR A;  2CJK A;  4RUC A;  2VIH A;  1RWX B;  2D7S A;  3NCP A;  2LCW A;  1IWA A;  2XWY A;  1CJV A;  3FMB A;  1DTT A;  1AB8 A;  1LXJ A;  2DR7 A;  4TYA A;  3TP2 A;  2ZM6 F;  2ZC4 A;  4ZP7 A;  4DQR A;  2V2Z A;  5KG5 A;  3ET6 A;  5I4M A;  3BO2 A;  2V8D A;  1M90 T;  4P10 A;  3OUY A;  4F02 A;  1P27 B;  4HI2 A;  1DTQ A;  4J9K A;  1T03 B;  1KHW A;  2OSR A;  2CYY A;  3FC9 A;  2J6S A;  2WB4 A;  2QLX A;  2FLP A;  2XSJ A;  3SQG B;  1OQ6 A;  2GJF A;  5I3U A;  1UJ6 A;  3HUL A;  1P9Y A;  2DYA A;  5A8W A;  1S10 A;  3H5U A;  4Y2K A;  4U8V A;  5F9L A;  2BR0 A;  1KDN A;  1LFW A;  2MQO A;  1RT2 B;  2QLB B;  1C1B A;  4E0D A;  1S49 A;  3PIP Q;  4KE5 A;  4CQ1 A;  5KG2 A;  2J8S A;  5FJ4 A;  1A0O B;  4JI5 F;  2JEJ A;  4DMZ A;  2OD4 A;  3D3C J;  4ZPW R;  1S1V B;  3S01 A;  2PII A;  1TK8 A;  2HQI A;  4HT7 A;  1TUV A;  5IV4 A;  2WVE A;  2PE8 A;  2XSF A;  3E3X A;  1S9E B;  3HT3 A;  1PO6 A;  1NLK L;  4MKY A;  3CTR A;  4N76 A;  4CO4 A;  4KBI A;  3PW5 A;  5H9F J;  1NK8 A;  3IG1 B;  4O44 A;  1LWC B;  1SJF A;  2DBB A;  1YZ7 A;  2YWH A;  3QRR A;  3D2W A;  4OYB A;  3I82 A;  5CZV A;  1NJZ A;  2GQ2 A;  1JLG A;  2EVZ A;  5LSO A;  2QEX S;  1H3D A;  3MPY A;  1JKH A;  1L5U A;  4UST A;  3HKW A;  2J0S D;  3IBC B;  3Q8V A;  4ED0 A;  4MT1 A;  1FJG F;  2B4V A;  4UZC A;  4IOB A;  5M2R A;  4DR1 J;  1NSA A;  4OX8 A;  3FZB A;  2G2O A;  2DH8 A;  3F73 A;  1R43 A;  1LK5 A;  5J1N A;  3QT6 A;  1FTR A;  1UWA A;  2GVD B;  2DNH A;  3CSK A;  2E7W A;  4LRC A;  4MJK A;  4DUT A;  3K59 A;  2HQG A;  3R7S B;  1W2I A;  5K5M A;  2Z2L A;  4AFF A;  3MI7 X;  1XER A;  3NCQ A;  3G6X A;  1RXO B;  4OYI A;  3Q86 A;  2OI2 A;  3W65 A;  3MR3 A;  2H5E A;  3E01 A;  1T9V A;  1MLA A;  1LNQ A;  1NB2 A;  3MM6 B;  2DB1 A;  4M5H A;  3EGZ A;  4G1I A;  4HTI A;  4TVA B;  4DV6 F;  2Z57 B;  2KHC A;  2N3L A;  3H25 A;  4B3M J;  2RKI A;  3QO9 B;  4CZC A;  3IMQ J;  4A8Y A;  2HHV A;  3DI6 B;  1U8W A;  4QWB A;  4B9U A;  2XLI A;  4YHH F;  4ZKA A;  1EJ7 L;  3C3L A;  2HQF A;  3PNI A;  3NWG A;  1XNQ F;  1URN A;  4I68 A;  4XAK A;  5RUB A;  4J9O A;  3FBC A;  1JB0 C;  2BE9 B;  3M2U B;  4FNI A;  4NCG A;  4CI0 B;  3VV2 B;  3CD0 A;  1X4C A;  3CCR S;  4NZ0 A;  2FY8 A;  4ZLL A;  2D3Z A;  2MZR A;  3OR1 A;  3PJW A;  3QGG A;  4CLF A;  1LEO A;  1FX4 A;  2IA0 A;  2JLG A;  1V3R A;  3PHE A;  2HLT A;  3D0H E;  3KHL A;  4EZ9 A;  3IWN C;  4X4O A;  2JFD A;  3Q2T C;  3FGV A;  5E3A A;  5CYQ B;  3SFG A;  1FNM A;  4DZD A;  1R89 A;  3R7B B;  3KLV A;  2J9D E;  4OHZ A;  2K2P A;  4AUK A;  4YB1 P;  1IBK F;  4X4U A;  2HVD A;  5C2C A;  2MQM A;  1RHK B;  1OSD A;  2MZS A;  3H2V E;  2UVR A;  3Q8R B;  1QD1 A;  2VDH A;  3KMQ A;  3AXK A;  4KH1 B;  4XIU A;  1VRT A;  4ZVS B;  1ZPW X;  4GKK F;  2XMV A;  4FPR A;  5THW A;  4F7V A;  3NGD A;  3UWT A;  2H4W B;  5BR8 F;  3CIZ A;  2RNE A;  4ZMM A;  2ZHO A;  1S77 D;  5D0G A;  1RTD A;  4OJG A;  2DGV A;  1LWX A;  2YNI A;  3JQK A;  2RU9 A;  5AJ3 J;  1K1Q A;  4N77 A;  2AYM A;  3OFF A;  1UTA A;  1GK8 A;  4JV2 A;  3GR0 A;  1Y11 A;  3MMB A;  2GW8 A;  1S0V A;  1XJW B;  3M8Z A;  2H65 B;  1RHR B;  2C2Z B;  2BOP A;  1RAC B;  1TL1 B;  3CJ0 A;  3NS5 A;  1RT1 B;  4PUO B;  4M5D A;  4ALZ A;  1KEK A;  3ZZU A;  3W2V A;  4V19 X;  5I42 B;  3MOZ A;  2GGP B;  1FDD A;  7AT1 B;  3DM2 A;  1HD1 A;  2XZD B;  3OTO J;  1IKY A;  3L4B C;  5DDR C;  4Z7Y A;  3P6Y C;  1AZS B;  1N36 J;  2DR6 A;  2V6A A;  3OJS A;  1X5S A;  2RML A;  3OT9 A;  2V8V A;  3CGI A;  2RDD A;  4CDI A;  2WZ1 A;  2QA2 A;  3QAT A;  1HNW F;  1FVQ A;  2HIY A;  2FJA B;  5JUM A;  4AL5 A;  3CCQ S;  3CC7 S;  2E1R A;  3ZZY A;  1F1B B;  4QIE A;  2UXC F;  1HNI A;  3OL7 A;  3PDN A;  3MMC B;  2WVF A;  1NK9 A;  1H2T Z;  1LW0 A;  2HRU A;  2KT2 A;  2I1R A;  4PQU B;  3N0V A;  3G82 B;  1RBL A;  2QC3 A;  3GSD A;  3SMZ A;  4UZB A;  1D9F A;  2VL1 A;  3BGL A;  3BSO A;  3VF0 B;  3P5T L;  4MH8 A;  4I67 A;  3DU6 A;  1F9E B;  3CIM A;  1V3Z A;  3D6M B;  3OXL A;  3R6G B;  4WXO A;  3GR1 A;  3DOM B;  3QRP A;  3KHH A;  3I6P A;  3QT7 A;  2ZJQ Q;  2E7V A;  2R7Q A;  5D8H B;  3R9L A;  2UUC F;  3UW1 A;  1XNR F;  3GIR A;  4JI2 J;  2XYH B;  3VQS A;  2CQC A;  2UXD F;  2D69 A;  4NLQ A;  2G1H A;  2H3E B;  5CQG A;  4LSN B;  3NMR A;  3MM5 B;  3G86 A;  2CPZ A;  4C4W A;  3IGN A;  4CTA A;  2VFT A;  2KRR A;  3GJT B;  4O0I A;  3JSB A;  2DHS A;  4QWA A;  1F9F A;  4CO5 A;  2OPS B;  1UA1 A;  3VGT A;  3MR6 A;  2RIL A;  4KAI A;  5GMK a;  4DCO B;  3RTV A;  2WB1 D;  3SSQ A;  4B3R F;  2HND B;  2EFV A;  3M8P A;  4TQR A;  3VTI A;  4NLR A;  1IBC B;  4FNH A;  5E3Q A;  4MK9 A;  1RHU B;  4B9M A;  1SC6 A;  1NDL A;  4FS2 A;  4LIR A;  4IH5 A;  4ID8 A;  2KDO A;  2CAD A;  2JEF A;  4FXW A;  5CYM A;  5HBM B;  3RAM A;  4OV6 A;  2UV8 G;  4IR1 A;  3GIM A;  4M5J A;  2DNK A;  3T5K A;  4F36 A;  6AT1 B;  1RWP B;  2Y8Y A;  4JI4 J;  5HI7 A;  3ELH A;  3FEY B;  4UY8 5;  2W9A A;  4LFB J;  2HFO A;  1E6V B;  3DFE A;  4WFZ A;  2M8D B;  2VA2 A;  4ZHR A;  3B4D A;  4DZ6 A;  4U9R A;  3EGW B;  1CJT B;  4GC7 A;  1N34 F;  2EKN A;  3ISN C;  2FVQ A;  3P4U B;  2F4V J;  2HGM A;  2Q3P A;  4ZVT B;  4QIF A;  1Y10 A;  5J2Q A;  2G13 A;  2HG4 A;  4H4O B;  2MSS A;  1RWN B;  1UVJ A;  4R0E A;  2FJX A;  2JRS A;  2R8J A;  4DQP A;  1RCX B;  3KLG A;  2QLF B;  1NU4 A;  2LLZ A;  1HNZ J;  3HP6 A;  4OJ1 A;  3KLH B;  1GMW D;  4JI1 F;  5L38 A;  2D41 A;  2CJY B;  2NXU A;  4GKJ J;  1WDT A;  4WP9 A;  4JI6 J;  4DWI A;  5DM7 Q;  1L3T A;  2M70 A;  5LL6 d;  1UP1 A;  1EAR A;  3O2I A;  5HP1 B;  2ZBQ A;  3W2W B;  3SSR A;  3J7Z T;  4DDF A;  1RTJ A;  3RBZ A;  5IT9 Y; 
#chains in the Genus database with same CATH homology
 4B3T J;  1HNX J;  4DV5 J;  5LMU J;  4B3R J;  1I94 J;  2E5L J;  4DR5 J;  5AJ3 J;  1XMO J;  4K0K J;  4KYZ A;  3R2D J;  4AQY J;  4DR6 J;  3D3C J;  2F4V J;  4LF7 J;  4DV3 J;  4JI0 J;  4DUZ J;  4DR4 J;  4DUY J;  4DR3 J;  3W1Y C;  4V1A k;  4DV2 J;  4JI1 J;  4B3S J;  5IWA J;  4DV6 J;  4LF8 J;  3R2C J;  3J80 U;  3T1H J;  2HHH J;  4DV7 J;  4LF4 J;  4NXM J;  2VQE J;  4X64 J;  5LMN J;  1IBK J;  2UUC J;  4RJV A;  4PWW A;  2UU9 J;  2KL8 A;  1HNZ J;  3OTO J;  5IT9 U;  1HR0 J;  3JAM U;  4JYA J;  2UXB J;  2KVQ E;  4DV0 J;  2UUA J;  2MTL A;  2UXD J;  4DR2 J;  4LFC J;  4DR7 J;  1HNW J;  4GKK J;  4GKJ J;  4JI6 J;  1N36 J;  3T1Y J;  1J5E J;  5BR8 J;  1IBL J;  2MQ8 A;  4DV1 J;  4JI2 J;  4NXN J;  3D3B J;  4YHH J;  1N33 J;  1FJG J;  4JI8 J;  4HHU A;  4JV5 J;  4B3M J;  2UXC J;  1XNR J;  4YY3 J;  4KHP J;  1IBM J;  2MEW A;  4LF5 J;  4NEZ A;  4X65 J;  4X66 J;  3IMQ J;  4JI3 J;  5FLX U;  4JI7 J;  4LF6 J;  4LF9 J;  4JI5 J;  4X62 J;  4JI4 J;  1XNQ J;  3J7A N;  1N34 J;  2ZM6 J;  5LM7 E;  1XMQ J;  2UUB J;  4DR1 J;  4LFB J;  3J81 U;  2VQF J;  4DV4 J;  5A2Q U;  1N32 J;  4NEY A;  4KY3 A;  4OX9 J;  4LFA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...