1RJJA

Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
b'MATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVVATP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords expressed protein
publication title Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 17
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rjjA00
1VQSA 2GGPB 1SQEA 3IWLA 2OAUA 2ACYA 3DCAA 5B09A 3HX9A 3TNVA 3QMQA 2GV1A 1QUPA 4FNHA 5B0FA 1MWZA 1VQYA 3LGMA 3BF4A 1RJJA 3LO3A 1V3ZA 2XMJA 1FEEA 1N5SA 2K7KA 2RSQA 1OQ6A 2HFNA 3HF5A 1APSA 1SI9A 2RU9A 2XMVA 5F0WA 4OJ1A 2XMMA 2KT3A 4OJHA 3TRGA 1KQKA 1W2IA 3FMBA 1IUJA 4F67A 2AJ0A 2BJDA 4A47A 1CPZA 1Y9OA 2N4DA 3UDCA 2HIQA 2K1RB 2KKHA 1P6TA 2QLXA 3FGVA 4OJGA 2N4CA 5A6PA 1FVSA 2EW9A 4HI1A 1X8DA 3T9NA 4Q2LA 1X0PA 2ASYA 3KG0A 4NPOA 2Q3PA 4OJ3A 1Q4RA 2HLUA 4EFAC 3TOQA 2ROGA 2GCFA 3QGPA 2OMOA 1K0VA 2BUNA 3GZ7A 1TL5A 2BYCA 4ZA1A 4Y2IA 1Y0HA 4Y2KA 2HQIA 3IWXA 2W4DA 1U7LA 4NL5A 4DN9A 5IXUA 1FESA 2OFGX 3HHLA 1R6YA 2G9OA 2RILA 4DPOA 1Q53A 4YEAA 2GGPA 3DXSX 4Y2MA 3VTIA 2GFFA 1N5TA 1YJVA 2HLTA 2VV5A 2LQBA 3LGNA 1CC7A 1S6UA 2ROPA 2FHMA 3FRYA 2OD4A 4FNIA 4A4JA 5B0DA 5KAKA 3BR8A 1Y3JA 3BGUA 3K7RA 2XMKA 1GXTA 2LQ9A 2QIFA 3BDEA 2PD1A 3CJKB 3KNGA 4ZOSA 1LQ9A 5B0EA 1AFJA 1FE0A 2W4CA 4QOTA 1TZ0A 1YJUA 2RMLA 3WDOA 2OP5A 1JWWA 1YRXA 1GXUA 1YG0A 3BB5A 2GA7A 1SB6A 1WD6A 2BJEA 4OIXA 2IFXA 2VH7A 4HH0A 5T7LB 2KT2A 3HHLD 2CRLA 1FVQA 2LXFA 2GO8A 5B0GA 2XMUA 4A48A 2BBEA 3I9ZA 1YJTA 2OFHX 1YJRA 2W4PA 3HHLC 2FB0A 2AW0A 2K1RA 2XMWA 4HH1A 2LDIA 1KVIA 4YDXA 4DL0C 1N5QA 1TL4A 2N7YA 1Q8LA 1OQ3A 5B0AA 2L3MA 3KG1A 3CJKA 1FE4A 5K9FA 1JK9B 1Q8BA 2ROEA 1AFIA 3F44A 1Y3KA 2AP6A 2XMTA 1S6OA 2OKQA 1N5VA 1OPZA 1P8GA 2OD6A 2PGCA 4HI2A 5T7LA 1FD8A 5A6WA 2QLWA 4U9RA 2QYCA 3BN7A 1MWYA 4Q2MA 2JDJA 1ULRA 2FIUA 2K2PA 1URRA 3MZIA 5F0UA 5B0BA 2K7JA 3MCSA 2ZDOA 3KKFA 2AJ1A 2IYIA 1CC8A 4HL9A 1X7VA 1XBWA 5B0CA 1KVJA 3E8OA 2HFOA 1AW0A 1OSDA 1TUVA 3BM7A 3HDSA 3HFKA 3HHLB 5B08A 2IYGA 2KYZA 2ZDPA 4A46A 2FTRA 1TR0A
chains in the Genus database with same CATH superfamily
3KUGA 1KR4A 3V2UC 1S7IA 3HK2A 4JBCA 2EWHA 2AF6A 1CJUA 4FF1A 2M88A 3OW2R 3RBZA 1HBOA 1PYSB 3CCJS 5H9EK 1S9FA 1WEZA 5B7WA 2VG7A 3ZNJ1 1OPIA 2AYGA 1WHYA 3N5BA 5IOLA 1UWBB 2YNIB 4ANDA 3TUPA 5KOXA 3NS6A 1F3FA 1HI0P 3DLEB 4RW6A 2F8EX 4F36A 2P8IA 4DV1J 4LVNP 4FYWB 2AYEA 4C97A 3C6TA 1RWUA 1Y4ZB 1VQ6S 4F3OA 4JV5J 2LDIA 1ZH5A 4UQTA 2CZ9A 1MN7A 5D4OA 2XLKA 4LRCA 3OJUA 4ILMA 1HMVA 1RA6A 3UCZP 2B5JB 2QG9B 4HTIA 1UEKA 1YX2A 3AD8C 2HZCA 3T5KA 4L73A 1NJZA 3KLIB 1X9MA 2I5JB 1JXEA 2RDJA 5L9NA 2DR6A 3M2RA 1EJ7L 3TNVA 1N36F 3AT1B 3FFIA 7FDRA 3J7YU 1OWXA 1K47A 4KGZB 3PKYA 2OO4A 2H5EA 3LAMA 4Q8FA 3H8YA 4DV5F 1NPRA 1DTTA 2NXEA 1MMDA 4O3SA 2H48B 1A9NB 1NH8A 3VV2B 4DL5A 1R0BG 2RRAA 4QIGA 3EGVA 4JI4J 1EP4B 3K0JA 3MM6A 5LMNF 2ZD1B 1EQ0A 1HQ2A 4BS2A 5HJYA 2O5DA 1NPKA 1DBDA 4WU2A 1VOMA 2CPIA 1FCAA 2R8HA 4CQ1A 3DC2A 3MM9B 2XY5A 2CRLA 3SCLE 1C2PA 1IR0A 1Q8BA 2ZWOA 1PBUA 1SH2A 3QAEA 3SFGA 3C19A 1AYEA 3GV8B 4DF4A 2AJ1A 1CC8A 2VBXA 4JI7F 5KFPA 1KOOA 2CPEA 3NOGA 4USWA 1U1MA 2YKMA 3I31A 2OTJS 1S6QB 3ET6B 1QUPA 1SL1A 4X66F 1DAXA 1UEUA 2YKNA 4R25A 3OL8A 4QQBA 2CFXA 4OJ1A 1H2UX 4HDHA 1HNXJ 1CSJA 1IWGA 1GNKA 3IR7B 4OQJA 4IG3B 2WB1D 4B9VA 1K0VA 2QLJB 4Y2IA 2AGOA 2BM0A 1S6PB 4PAAA 4YEAA 1J27A 2UVRA 2X1BA 3JS9A 1L3UA 3G8QA 2BJ8A 5M2UA 3VGTA 5L9XA 2D3ZA 2IHR1 3MM7A 1VQLS 1JNZB 2CQ1A 1RT5B 3HHLC 5LSRA 1X5TA 3JSRA 3JAMU 4C0OC 2QMUB 4DV6J 5CHCB 3W9IA 1L5UA 4DR5F 2Q6CA 3UN5A 4X4UA 1BC6A 4ECSA 2JJ4D 3WIVA 1M5VC 1YIJS 2ZFHA 2YNHB 2HQGA 3LTOA 2MLXA 3RYLA 4NEZA 3DLGB 4J9QA 4KH1B 5HSPA 5IFMA 3MR6A 5KFZA 2O66A 2UVVA 1JQGA 5KFMA 1PILA 2XCAA 2LVWA 3K5OA 3M8QB 4DR7F 2FLLA 5D0RA 2HYIB 3A8IA 4EU0A 2XC9A 1WF0A 4P2XA 3KNAA 2A10A 2ZJRQ 4JP8A 1XMQJ 3V6JA 3R2DJ 1IKXA 3VTIA 4F4KA 2B0GA 4NLGA 4NXNJ 1N34J 3B6BA 4ZLPA 3VALA 2PI4A 2AIRB 4EZ6A 1TZ0A 3PR5B 4F2SA 2ZBPA 3TEHB 4FS2A 4J9RA 1Q79A 1IBLJ 5IT9U 4OYPA 2D74B 4RW4B 4H4OA 2AJFE 2ZH2A 3DOMB 3DDKA 2N3LA 3QFWA 3WZ0A 2JC0A 4UY85 1BY9A 2FJWA 2AX1A 1XK8A 2DNPA 2DH9A 2IYIA 4R0EA 2PI5A 1RAOA 3BPSP 4CO1A 4DR6F 5ETNA 5HL7Q 1IBCB 3BSCA 3Q0AA 4RNOA 3BGRA 2DGUA 3MUVP 4KGKA 3R27A 4RUAA 2OEKA 3KJVA 4LF5F 3QZ8A 1P27B 4OI3A 2M7SA 3CC2S 3TARA 3UDCA 5KG4A 1NDLA 1RADB 3MM8B 3HCXA 5KG6A 2JEIA 4ICLB 3CEDA 4XPCA 4EEYA 3VQSA 2KHCA 1IKWA 2RILA 3GJSB 5HVGA 3C66A 3HHKA 2VC0A 3PJWA 4P75A 4IO9Q 4ED8A 3M8ZA 4B3MJ 3DXBA 2QLBB 1JJ4A 3G86A 3HHLD 1CJTB 2VG5A 4TU8A 2BW7A 3PX6A 4ZIWA 1I94J 1EQMA 4CO4A 2HG4A 2HWHA 5CCLA 3OUYA 5D3GA 3Q8UA 1ZZNA 2WSFC 2B4VA 4PXDA 5E2QA 1Z2LA 1OY9A 4RPFA 2FVSA 2RQCA 4DL3A 1LOUA 1XR7A 2VPZB 3KYLA 2PEHA 2FD2A 4CO5A 3BBFA 2IIHA 3KLEA 3JB9k 4DR2F 3ZC4A 2KO1A 3BKFA 3CDUA 4IRKA 4ECZA 3MAAA 4IR9A 3R5CA 4LF6J 4USIA 4MH8A 2R9LA 2XG8A 2LA4A 3M9OB 1S97A 3TR5A 1HI8A 2V8GA 3T1AA 1RYRA 3SBMA 1NK5A 1Y3JA 2XMKA 3V6DB 4DX7A 4DSEA 1Q1KA 2QMXA 2MZSA 1QE1B 1JWWA 3LH2S 2ASLA 1WD6A 3JTNA 1TQLA 2LXFA 1IXKA 2R2SA 4ZN1A 4DX6A 3NKYA 2DITA 3SQGA 2XMTA 1H98A 3HO1A 3MPYA 4DCOB 1TTHB 3OFHA 4RWWA 5LJ3Y 1XBWA 3FC9A 3DDNA 1TUVA 4AD6A 1MMLA 4OZLA 2ZNYA 4DSKA 1VR6A 1NB7A 2A1BA 5KG0A 4A8FA 3HJFA 4X4QA 2XMMA 2FQQB 1V3RA 1FI4A 2BJ3A 4CT9A 3TX0A 1ACMB 4NLPA 4O44A 3TOQA 3QGPA 4XO0A 1JJCB 1VQPS 1SKWA 3H5UA 3EE3A 1S9GB 1BGXT 3FCHA 4OZJA 3EPIA 3QZ7A 2AU0A 1WOPA 1WWHA 2LMIA 1T11A 1IN0A 2B56A 4UUWA 2OPRB 2VQEF 5HI7A 4YFUA 4Q0BB 2RF2A 2WONA 4AL6A 3T9ZA 4F50A 1CULA 1YBAA 5B0BA 4JI3F 3GIRA 5KG1A 4RU9A 4LFAJ 4RUCA 3U1MA 3OL7A 1M5SA 2KVIA 1MMNA 4ILLA 3NCRA 3P3DA 2LU2A 1RABB 4DZ6A 3M7VA 4M94A 2DY1A 1YRUA 4DHVA 4ZDNA 1QDUB 3CIZA 4KSEB 1VC6A 5LMUF 3LP0B 2E7WA 4NMLA 3KLGA 4K0KF 1NZAA 4P7TA 2MKJA 1S4FA 3VZIA 3D2WA 1LFWA 2OIHA 1M5HA 4IRCA 4OX7A 2Z2YB 1HYSB 4O23A 1VRUB 1WC0A 2MTLA 1YG0A 2GA7A 1HBNB 4QCLA 3RAMA 2J8SA 2RKIA 2DPJA 1WG1A 3W3SA 1ZAWA 1FKPB 2QLFB 2GZOA 4L6V3 1S1UB 2QLWA 5L1IA 4B9SA 1NK7A 1XNQJ 3H5SA 2ZDOA 2FLOA 4P73A 1FNOA 2QSWA 1VQKS 2UUCF 3C3LA 2WVBA 2G0CA 4EO8A 3H20A 1WI6A 1FO1A 9ATCB 4ED4A 4FF3A 5IS2A 2E1PA 3MPDA 2KYXA 3PV8A 5GMDA 1TKXA 1WG4A 5HROA 4NYOA 3HFZB 3EICA 3S8SA 2W2QP 4TU7A 3OTDA 1IKYA 2GMLA 1M0SA 1C1CA 1RLCL 3JSMA 2KN4A 1V5IB 3BR8A 2Y1IA 3NOCA 3R7BB 1YQHA 3VAFA 3EMTA 3PCOB 1UCNA 1RTIA 4ZVOB 4ZP7A 1KHWA 3NXZA 1B0PA 1T02A 4EZ9A 1N56A 1S76D 3M2UB 1VRQC 1URRA 2XO7A 1JLQA 1HBMA 1I1GA 3FCWA 1C1BA 1N32F 3DCAA 4HKQA 5HMXA 3NGUA 3OFFA 2GQ2A 1H3DA 2CG4A 2RQKA 4XK8C 1APSA 3KLFB 1RT2B 2VZ9A 3O2IA 2H51B 1VJQA 4DZDA 4ZLNA 1Y9OA 4J9PA 1UAWA 2W25A 4ED6A 2MKYA 1WI8A 2PO4A 3DI6A 5G0RB 1KS2A 1D8YA 4JYAJ 2XLJA 3I55S 4Y00A 1GH8A 4J9MA 5AJ3J 1J5OA 1QAIA 3TAMA 3J81U 2BANB 1RLDA 1TL3A 4N76A 1HD1A 2RS8A 5B0GA 1YJRA 1K44A 2DKOB 3KMQA 2M0GB 1X4HA 1AZSB 1ELOA 2M52A 1L3TA 3CW2C 6FD1A 3HVWA 2CJYB 3KJFB 3PFOA 1QUVA 2V8DA 4DCJB 1TFWA 2OSQA 2MQQA 3BBBA 1X4FA 1HBOB 5IWAF 2WB4A 3MXHP 4I2QA 2EXUA 1GTEA 3CC4S 3KK1A 1UJ5A 4V19J 3CT9A 2DGWA 2ZH6A 4RW7A 4L74A 4QWDA 2X1GA 1ZTWA 1XTZA 3LQVA 2V6AA 3I0SA 2XWYA 1GT8A 4E8UA 2ZH5A 4M1KA 1RWVB 3TAQA 3ZTOA 3C6TB 3PACA 3L9ZA 2MXYA 2LQ8A 3BO2A 4ECUA 4H4KA 3VAMA 2RNEA 4JI1J 2W4CA 1YJUA 1JX4A 3L7UA 1QSLA 4LSZB 1HMVB 5L1JA 5K8OA 3JSBA 5KG5A 3CCLS 2UV8G 3HP6A 1WSVA 5LL6d 1RT7A 2GIRA 2F8MA 1HNZF 4DV0F 1NJWA 3QLHA 2I0XA 2JDJA 1O5JA 4NLOA 4OZ5A 4OI4A 1O6XA 4G65A 2JEGA 4ZPWR 1UZDA 3LP1A 5IQ6A 4QWBA 5H9FK 5KFEA 3A12A 2WTFA 2MY7A 5KFXA 3CMAS 3W66A 2F8HA 1SIZA 3LF0A 2C3MA 4UOFA 3JYTA 3V6KA 2J6SA 1UA1A 3FUYA 4MKBA 3R5DA 1R7IA 1UJ4A 4LF8J 3W2WB 4ECTA 3CCWA 1P1LA 2YWFA 3NEKA 2MYFA 2W2NP 1VQ8S 4LF1A 4DLEA 3CNQP 4MKVA 4QIFA 2FHOB 2KI2A 2EFQA 3MI7X 2MKKA 2WW8A 2RMLA 4DQRA 4OX6A 1JKHA 5T14A 2JOQA 3M6XA 4Z7CA 4ZMMA 5HQLA 1LWXA 2V50A 3ZZPA 3U1LA 2VOPA 4WIIA 3DOKB 4RW9A 4DQSA 4KGXB 3JTPA 2UU9F 3FBEA 2YKMB 2YNGA 5D0HA 4TY8B 3OHBA 2GW8A 5AXKA 4JI0J 4CLFA 2VPXB 2YKNB 2DNNA 1BWVA 3QO9A 1C0TA 4X64F 1NXIA 5I3PA 2ATLA 3ICLA 3GJTB 2X3GA 1UETA 4LBIA 1JB0C 1GFWB 3BGLA 4LR8A 2H5JB 3O1LA 1OY8A 2IA0A 2ZVSA 2OJ3A 1Q5YA 1LW2A 4O4GA 3V5RA 5CD4H 2CAJA 3M6VA 4F67A 2HQDA 5F8HA 3IFEA 4LJMA 3VZHA 3CJRA 3I56S 1VQMS 5CYMA 1NJYA 3K17A 3X3UA 2KDOA 4C3KA 1CJVA 2BR0A 4PWDB 2EC0A 3AD7C 2W01A 4DPTA 1RYSA 2I8EA 2RS2A 4HACA 3P6YC 2ZBQA 1LNQA 3CD5A 2CIMA 1SKUB 2KM8B 2G4BA 2RVJA 3QYYA 1F0XA 3P8BB 1K1QA 2BVZA 4ZPAA 4N7TA 1TL4A 1HNVB 2EG2A 3OV7A 1RU2A 3QT8A 2CQPA 5KT7A 1N5YA 2W8KA 2R7VA 4G6VB 1RWKB 3NAHA 2V8HA 1O51A 2LQ5A 3LUYA 2FJVA 2E9ZA 4GC7A 5HJXA 3E8OA 5LXYA 3N4WA 4CLLA 2ILZA 2ALZA 3W60A 2OH2A 1NRKA 2Y8WA 1LK5A 1E6VA 5A8RA 2K7KA 1XNRJ 1U25A 4ZCIA 3T5LA 5J2QB 1BLUA 3I5CA 2KXFA 1X5PA 1X5SA 4PQAA 2EW9A 5K8PA 2HNZA 1S0VA 2QL5B 1WJ9A 4QYRA 3HPOA 3OTOF 1RTHA 4ZA1A 3CCRS 3AOCA 1V3SA 1U7LA 3RZAA 4ID5A 2V68A 1KD1T 3O8WA 3ZO7A 3L3CA 3NMRA 4WK1A 3LGNA 2EKNA 3CCSS 1RK8A 2DNKA 4H4OB 2ACMA 4KC5A 1LWCA 3G71S 4WK3A 3EZUA 4P2MA 4LREA 4ZP8A 1RKIA 2B3TB 2XBPA 4TYAA 3UDVA 3BGRB 2RT3A 3RRHA 1PG5B 4MIWA 3HHLB 3KJVB 1KFDA 4QIEA 4IH6A 1R8CA 2VBZA 2F9DA 1IKWB 1YRTA 2VA2A 2AJ0A 5I42A 2DHGA 4QYZK 2ASDA 3W8PA 1H7XA 2CNKB 3MFIA 1X4BA 4KQZA 1KTQA 4ZS6A 3MR2A 2BYCA 3OL6A 4ES1A 3I0RA 3AJDA 4WE1A 1F5BA 3R3TA 1R0CB 3BKUA 2PN6A 3W2VB 5CA5A 4Y28C 4RUBA 3HT0A 2YKPA 3D1HA 2DCLA 3W5ZA 3B82A 3T5HA 2Z2MA 3MOJB 1VK3A 2BJ7A 3NBPA 5GMEA 1NJIT 4P6QA 1N36J 2OSRA 1KN6A 2O67A 1S12A 3BR9A 2MSSA 1RKJA 1HNIB 2E5IA 4DV5J 5CZVA 4H4MA 2AWZA 2V9WA 1X31C 4WCEQ 1B4SA 1VBZA 4MFBA 1RHRB 3T41A 3HF5A 4D3HA 2QL7B 1NM2A 4LMZA 5LMNJ 2R7XA 1L3KA 4ZVEA 4XDCA 4LSNA 3DHWC 3PO4A 3R97A 4WZQA 2LEBA 1G2EA 3TEGA 3P45B 5CH7B 4DUTA 3CO0P 1BUXA 2VDIA 3NGKA 3PFEA 2WVFA 1CG2A 1T9XA 2PE8A 3SQGB 3NNCA 2HIYA 4YR0A 1TVRB 3N28A 1IM4A 3GR0A 5CQGA 5HMYA 2FYXA 2DRAA 2Q79A 5E3QA 4JI7J 2YQ3A 2OEJA 4LF9J 1VISA 2IM2A 5A2QY 2QJ3A 2FJDB 1SJ3P 1TL1A 3LANA 3PRBA 3J81j 1QLNA 2FC8A 5E3RA 3DOLB 2ZOFA 3V6HA 1Q8IA 3HSJA 2GJFA 4O44B 5DGAA 1HPZA 2XHWA 2EFOA 3HSZA 2LECA 3PW7A 3R7SB 3OR2A 2IVYA 4KPYA 1JLGB 5J1EA 2N7CA 4EO6A 4UUXA 1ZTTA 2BUNA 3OJSA 3RRGA 3IO1A 4J7CA 7AT1B 1R27B 1N34F 3IGNA 3UVJA 1FK9A 2G1HA 1LK7A 2MGZA 2IBKA 2P9CA 4WFZA 1HQUB 5IT9Y 3D28A 2GO8A 4DUZF 4DR5J 3POTB 2HK2A 2K1RA 3QATA 1MWQA 2CQ2A 4FVMA 3OT9A 3PYGA 3ITHA 4AXJA 3C16B 4DR7J 4M5DB 3HFKA 1PC5A 1EZZB 3GSIA 1NHKL 1TMJA 3NWRA 3E3XA 2R7WA 3DM2A 3U1NA 1VC0A 5EX3A 5AXLA 2XMJA 2RSQA 2OHDA 2FY1A 4ECVA 1B3TA 4C9DA 4TY9A 1RTDA 5A6PA 1X8DA 5D0EA 3PG9A 4X4NA 4EFAC 1PGZA 1D3WA 1LFPA 2QX0A 1NJXA 2M2BA 2RKIB 2F63A 4DV4F 2F4FA 4AT1B 2RQ4A 4ZVTB 2MQLA 2H4YB 2IVFB 4K7QA 1ZS6A 3R2CJ 3FQKA 1M5KC 3PW4A 4YY3F 5A0YA 1QY7A 4PYAA 5B0AA 4UQGA 4DR6J 1DURA 3SDEA 2BACA 5D6GA 3S7RA 2DR7A 2ZH4A 1U2FA 1TK8A 2RU3A 4LF5J 2F65A 3K8WA 1MWZA 5D4PA 3NMAA 3LO3A 4P52A 2V5HG 4WPAA 2BABA 1EKSA 1FEEA 3H5YA 3TVZA 1REGX 3GPAA 2NS1B 3KHRA 5F8GA 4GMKA 1FXRA 4LF6F 1IKYB 4I0WA 1S1TA 4GO5X 2DGQA 2XTJP 1C1CB 4DR3F 1S10A 1X0PA 1LEOA 1RWNB 4WYWA 1N8RT 1S1XA 4YQWA 2BKNA 2G0JA 3ZTQA 2JSXA 3MR7A 3MECA 3GFYA 3OSPA 1XIQA 3CJQA 1RB0A 1RTIB 3ULHA 3BYRA 2VV5A 1AB8A 1R43A 4FXDA 5KFAA 1DQ9A 4USTA 2D1CA 3SFUA 3RW7A 1FVQA 1VGYA 1T05A 1BQNA 2QA4G 1JLQB 2CNLB 2V4JA 1AUSL 2XS5A 4ZCLA 4TXSA 1KFSA 2H3EB 4Q2MA 3M32B 2XZTB 5DG7A 3P49B 1N4LA 4O3RA 1FWLA 2J9DE 3ZNUA 4DR2J 1GAOA 4PXCA 1S0MA 3AODA 4B08A 2DT9A 1GK8A 4ZP6A 5F0WA 3DI6B 1Z4UA 3MFHA 5A8KA 3Q8SB 3G96A 4I67A 1EIYB 2CPYA 1J5OB 2VFUA 3R6GB 5BYQA 2B43A 1PC4A 4HHJA 2KJVA 4OHWA 2C1EB 3DLBA 2M4MA 4Q5VA 1HQEB 1Q81T 4CDIA 3VVUA 2MZTA 1WTBA 1XC9A 4TN2A 2MLYA 2QE5A 2MJNA 3HVTA 3TZXA 4M5NA 2FHJD 4PG8A 3VCDA 2B9EA 4NCGB 4X62F 4I2QB 1DFDA 2HFOA 1XR6A 2HFZA 1T03A 2X1AA 4NLTA 3DRPB 4RW7B 1QSYA 3BF4A 2J0QD 2MQPA 2F40A 2IC3A 4DU7A 1LXNA 2R2TA 4MMOA 2CQGA 5EX0A 2G2YA 3SIPB 5KFDA 2LEPA 2MZJA 4U7UD 3CIMA 2QA1A 1KLMA 4MKAA 3G8SA 4EWTA 2OELA 5ETKA 4QW9A 5H1SV 5JUMA 3H25A 2HZVA 4I7FA 2VQEJ 2KFNA 4CNZA 2HLTA 3CF5Q 3NAIA 4A4JA 5B0DA 2MHEA 2A6MA 1FKOA 5KFQA 2EI5A 3TQEA 1Y00A 3UWTA 2ZITA 1IJFB 4JI3J 1S79A 3KHHA 4AL5A 5K9FA 6AT1B 2VIHA 2HVDA 2M5YA 3W7BA 4TQRA 3TA1A 4M5IA 1R3NA 1NDPA 1N5VA 4MIAA 4MT1A 1RBOB 2MKSA 4ED0A 2SXLA 2HQCA 4TNOA 2EC2A 4OHYA 3JYTB 4DL2A 4CYUA 4X84A 2NUUG 2V2QA 1PCAA 2ZH3A 4O3PA 3KWMA 3C46A 1KONA 1YJNS 1FNMA 1WEXA 5LMUJ 4NI2A 3RB3A 1K73T 1S5ZA 4K0KJ 1ZAVA 4FDFA 1NO8A 3TVKA 1VCTA 3G6VA 3SCJE 1U0HA 1UKUA 2ROGA 4GVBB 3GZ7A 1TL5A 4C98A 3LP2B 2XI2A 1JKHB 1HFEL 1YBTA 5IT4A 5HMWA 2JZ5A 5HP1A 4ZVPB 1B7FA 4RW9B 4BC9A 5DDQC 3CJ4A 2UUBJ 1XR5A 3PJ9A 4S0MA 3CCMS 1TKTA 2ABYA 5M2RA 5C24A 2AJQA 2CDRB 5H9FJ 3UQSA 1WC1A 3D54A 3QO9B 1KKHA 3T6BA 2UUCJ 3N9UC 1UW4A 4LR9A 4ZITA 2HHUA 3PYEA 3NGDA 4ZHRA 3F73A 4ID8A 2DNQA 2J6UA 3KFWX 1XWLA 2IJFA 1FWKA 4NXMF 1AW0A 4AUKA 2L9NA 2R8JA 5F8MA 1N6QA 2GV1A 4JI5F 3Q2SC 3G6YA 2PDAA 2PC6A 1VBYA 4W90B 2MMYA 4N5SA 3SXLA 4UOCA 1J5EF 1JLEB 1WOSA 3VAIA 5CYMB 2PSZA 3PO5A 3VVTA 2JVOA 3Q89A 2ASYA 5HATA 1HHQA 4EBEA 3TJAA 5HAOA 1SC6A 3BQ0A 2E1MC 3N6MA 2P2CB 2VKZG 5KFLA 2GHPA 3GMGA 1CEZA 1CC7A 3EDQB 3DRXA 2FHKA 3IS9B 4QZVB 1HWKA 4OI2A 3G4SS 1QAJA 1N5YB 2B4UA 1HBUB 2V34A 1R0AB 1S1WA 3KXDA 4QIVA 2UZAA 1KQGB 1SC4B 1VI7A 2BQ3A 1HKAA 1XEZA 1N32J 1LWFA 1VJWA 2AYBA 3PXGa 4DFMA 3T1HJ 3ZFVA 5B08A 1SL2A 3F0NA 3UCGA 2DEIA 1Q7LB 2GVDA 1U48A 2K06A 2F3JA 1IBMF 4RBVA 4Z7YA 4MAKA 1U1NA 2HNZB 1VQOS 3PYFA 4B9NA 2F9JA 5CD4A 2B4OA 1S4EA 3KK2A 2LCWA 1T95A 3M2VA 3EGNA 2VD3A 5ETRA 4UTGA 3UNYA 2RDIA 4BHQA 4TLQA 4X65F 1LWCB 2IM1A 4B9TA 1T7PA 5F8NA 3FRYA 2AMCB 1PIEA 2FJAB 3TI0A 2DR5A 1U1OA 1AUDA 3ADAC 3KLHA 1FDAA 3MPWA 1JXLA 2E1CA 4OYMA 1GEHA 4P2FA 1NKBA 2G13A 1OPZA 2CZ4A 5IWAJ 1DTQA 1ZETA 3LPEA 2Y3YA 4QW8A 3OTBA 4XPEA 2MEWA 4WYLA 2L48A 1V9OA 1VQ9S 4FKYA 3CJ8A 2QO3A 5E41A 3GB0A 2DBBA 4DU8A 5E3PA 4PXEA 3CJ3A 4OYZA 1RZMA 2R7UA 1F1BB 3WX4A 1DY3A 2DYAA 4M5MA 3NS7B 1CBKA 3NG8A 3SSQA 5HN0A 1WHVA 4KBIA 3AFGA 2V2VA 1D1UA 5EWFA 3AB2B 1N54B 3KUHA 2E9RX 5HQMA 1S6UA 4Q7AA 3Q8QB 1VQ4S 1S57A 2Y1RI 3SEOA 1GXTA 2DB1A 4DV0J 4FN5A 4AE5A 3K5LA 5T41A 2VJUA 3S01A 2D69A 3ZZRA 1G6BA 1NLKL 1U2CA 2C2DA 1OS5A 1N0UA 4CLTA 4QYZJ 3GTYX 4C8ZA 2XB2D 2HMIA 4F0HA 1SJFA 3EYZA 3OQ2A 2IY5B 4N41A 2HZAA 1V3ZA 2P6TA 2BE2A 3HD1A 4LSNB 1FWPA 4NLVA 3FMWA 3FMBA 5A8WB 1T9VA 4Q8EA 2ATCB 1YSJA 3M30A 2CPXA 3CJ2A 1H6KX 1Y7PA 2J6TA 4HR2A 3S6EA 3IG1A 4C8OA 2D9PA 4K4ZA 3DYAA 5JXSA 1YITS 1ITPA 4K5RA 2YH0A 4WF9Q 5KT6A 2JEFA 4RKUC 1GXUA 4CNYA 3GIJA 2UU9J 2WAQD 1NK8A 2Z0GA 4EGLA 3CCVS 4J9UE 2ILYA 4AYBD 2FC9A 2HGMA 4NOHA 3BH7B 4RU2A 4JV1A 5EGYA 2CJQA 5EWGA 2GAHC 3NNHA 3SV4A 1RBLA 1Q5VA 3RTVA 2GHWA 2JWNA 2DNOA 2F5GA 4P2SA 1HPZB 3DLKA 4M5GA 3TJ9A 1RBAA 2MSTA 2YX1A 4QJVA 4Y2AA 2QL9B 4QPXA 3H4BA 4MK7A 2GX8A 5KG7A 3DU5A 3QRQA 2PFFB 3FEYB 4IYQA 4WFBQ 4LFCJ 3QIPA 2FLPA 3DDIA 3MPUB 3UVJB 4H54A 1CS4A 3I96A 2YTCA 2HAFA 3ETMA 2MGZB 3M9NB 4C4WA 5I3UA 2L9WA 2OFGX 3IXQA 4C11A 3W63A 1WTFA 3KHGA 2Z56B 2DO4A 3A3OB 1FRIA 2BEFA 2J0SD 4IG0A 1KTVA 3WQPA 3ITHB 4KFBA 3V4IB 2IPOB 3Q8PB 3AAWB 3T3FA 1EARA 4DQIA 1RACB 3DM2B 4DWIA 2YY3A 3KJNB 3AQPA 3PYDA 3B4DA 3KKFA 4WWSA 1UVKA 3TX8A 4XDDA 1WF2A 4RLEA 2F1FA 3LW5C 2C22A 4DPUA 4PYDA 1RTDB 2V94A 2XZDB 4KO0A 2XGQA 3GE9A 4USJC 3NL0A 1TUGB 3WHIA 3K5NA 3K2YA 2KL8A 5E3CA 3OTOJ 1A0OB 4KE5A 2GVZA 3PRDA 2KJWA 2ASJA 3A8JA 3CB4A 4OJGA 1RDRA 4HI1A 2R7OA 2MDAA 3UR0A 2ZC3A 3EGZA 4NL5A 5HO4A 4DX5A 3KDNA 2OMLA 4NLSA 4O3QA 3HM9A 1FXDA 2DHSA 1T9YA 3K7RA 2EVZA 4NMXA 1YZ6A 4F4AA 2OP5A 1SJQA 3SDEB 2RIJA 4K4TA 4PCQA 2CNOB 2W4PA 1W25A 1DLOB 1WF1A 2UXBF 1HI1A 5HMZA 2NZ4A 4DS4A 2HHSA 3RR8A 2RUSA 5KFGA 2YNIA 1N0VC 3MGJA 1MWYA 2CZVC 5FIIA 4M5HA 2O1PA 4G1QA 4P71A 2W9BA 4DV3F 2DH8A 3SCKE 3A1YG 3SI8A 1T8EA 1V5VA 3Q8VA 2VG6B 1LXJA 4NLQA 3MEEB 4OX9F 3TP2A 4GKKF 3WIUA 2Q1LA 3OR1A 1HHTP 5DQIA 2KM8C 2U1AA 1S1XB 4KR0B 5SZTA 4CLSA 5CXTA 4C8YA 3QRRA 4CO3A 1N48A 2BXJA 1X4EA 4DLGA 3T9NA 2DNZA 3EX7B 2VBWA 3PVXA 3KLIA 2HBZB 5L39A 4UT4A 4L3KA 1ICEB 1WC6A 1VQNS 1Q53A 1SXLA 4IQXA 3LGHA 3TWZA 3IRXB 3JQKA 4M5JA 5KT3A 1BQNB 1IVZA 1RAGB 1S77D 1RHQB 4JI8F 2EPIA 2ZUGA 3ZXWA 1FTCA 2V0NA 1C0UA 1B70B 5AXMA 1TK0A 1MU2B 1Q95G 1Q8LA 4M95A 4LF9F 4ITSA 2HPUA 3N0VA 3CJ5A 3RBXA 4NA3A 3EPGA 4LRDA 2ZD1A 2OUGA 1FEHA 2DRBA 2L9DA 2DVIA 5A8KB 4MYTA 1VQSA 4NRUA 3MAHA 4KAIA 1KC8T 2AKWB 4YB5A 1FFWB 4NZ6A 3SQOP 3D4JA 1IUJA 1DRZA 3H2UB 1NK9A 4DFPA 2YWWA 2UVWA 1ZM4A 4X4SA 3NGSA 3VAHA 1SKSA 4OYOA 3SYZA 2PFDA 1S6QA 3ET6A 2MQ8A 4USHA 5HVFA 2ZJQQ 4C7QA 3RJMB 2GNKA 1P1TA 3HHEA 4ZPBA 5F41A 3NP5A 5DDOC 3TQ1A 2ZZNA 5AE3A 2AGPA 3VGVA 2YKOA 3EJMA 5A2QU 4QWEA 4YR2A 3GIMA 5J2PB 4IG3A 4LBPA 1RHUB 4ELUA 5KT4A 4J9NA 1UFKA 1S6PA 3UN3A 2N3OA 3C2PA 2HQFA 5EDWA 5KFYA 4DUYJ 1Q78A 3GG0A 1QVFR 1OQ6A 4IUFA 5D4NA 5KFSA 2PIIA 6FDRA 3EDRB 4HT7A 2B9WA 4OYBA 2CDQA 1DQAA 3TA0A 1Q4RA 3LWMA 2CQ3A 3E01A 1RTZA 2C28A 4DN9A 4DR1F 2KH9A 2QA4S 4DUZJ 5KAKA 3GCXP 5HBMA 4HT5A 3H0PA 3IBCB 4B3RF 2HNYB 4R5PA 1EB0A 4ZKAA 2OPSB 4USUA 4Y2CA 4B3TF 2ZWPA 2IRUA 1VK8A 4CYUB 2KT5A 5A6WA 1KEKA 8AT1B 3CDEA 4A8YA 3J80Y 1IJEB 4ZCMA 2C2MB 5GADI 2GGPB 2KU7A 3T1YF 5FD1A 3HX9A 4ECRA 4JI2F 3I6PA 5D78A 1GMWA 1RWPB 1RCOB 1OSCA 1U26A 2HS0A 4WU3A 3HXMA 4W92B 1M1GA 1BQMB 4DV4J 3QT7A 3QFHA 3WBZA 3CPWR 1EAYC 2J0WA 1OY6A 2XMAA 1KHVA 2DXFA 2BRKA 2RDDA 3DFEA 4OYAA 1Y5NB 4IR1A 4Y3CA 2GFFA 1OIAA 5C24B 4I69A 1WNEA 3MMAA 3G82B 2HHVA 4YY3J 1RT4B 2UXCF 3D66A 2HSEB 4ZHRB 4R0JA 1X5OA 5GMKa 4PXBA 4HH1A 4MK8A 3MM8A 2AQ4A 5DZ6A 3AY0A 4DEZA 4KGVB 4OZ2A 1SC3B 3PIOQ 4F4XA 3TO8A 1N6QB 3MF5A 4ENOA 1MN9A 2NREA 3D9BA 1H7WA 2QN6B 2B4PA 5B0CA 1TV6A 1GX6A 3BM7A 3QGGA 3O6QA 3HZGA 2NXNA 1RSCA 3Q8YA 2OAUA 3BZQA 3IC1A 2HFVA 4DR3J 4ILRA 3A13A 2XI3A 3GP9A 1TKZB 2HAIA 3AA8A 3P96A 2P9EA 2K3IA 4XAKA 3BPDA 4IH7A 3NGTA 2UP1A 2XCPA 2J9EA 2JFKA 1NMEB 2JNJA 4LUBA 2KZZA 2W7AA 4NLWA 1X0FA 5KFHA 2J9CA 3VR1A 3GFXA 5DM7Q 3TJ8A 2I9SA 3IRWP 5GVQA 4DG1A 2CVEA 2KT2A 3IN5A 4KHRA 3QSIA 2BM1A 3GIIA 1JIHA 4A8OA 3DGPB 2DNRA 3PW2A 1OQ3A 3CJKA 3BDPA 2HGNA 4M63A 1UVLA 3PIPQ 2GVDB 4PQUB 2UUWA 2CYYA 1BXNA 1CVJA 4P9SA 1B0VA 5M2PA 2V2ZA 4RZRA 1F5CA 3M1VB 2DD8S 1RWXB 2QA2A 1RE1B 2DY9A 5B0FA 2Y1JA 1FF2A 3M8RA 5DRKA 2YX7A 2KXNB 2RUGA 1E6YB 3KK2B 4K50A 3M2VB 2VDHA 3LOUA 3R5AA 2E29A 5K8NA 4B3SF 3PY8A 3ZZYA 4RW8B 2DISA 3HHDA 3H5XA 4G3IA 1NDCA 4J9SA 4UF4A 4OLPA 5F9LA 2W9CB 2BZ2A 3KLHB 2H5IB 4Y2MA 2FHMA 2AV5A 1LV5A 5LT5A 4OZ1A 2Y0SD 4YB7A 2WBMA 1TAQA 4I68A 1Q7YT 2A6OA 5BR8F 2MKCA 4X62J 3O44A 5C5JA 3R1HA 2M70A 3MM5B 2YPYA 2B6AA 1ZAXA 3GWCA 1FX2A 1R31A 2QYCA 5CYJA 2AGQA 2CQBA 1S9GA 2Q6BA 4EYHB 2ZZTA 3AOBA 3ELHA 4KV8A 3TUIC 4CI0B 5CZXA 1SPBP 3DKDA 3QMQA 5ETOA 2RHSB 4FBUA 2OPRA 3EZOA 4EI2A 2GO9A 4ZVGA 3A4TA 1RXOB 4IOAQ 2RJZA 3Q2TC 2E44A 3THVA 2MKIA 2N4DA 2CPZA 1FVSA 3ILLA 2WZ1A 3GJQB 2HLUA 1MG7A 5DQGA 3RUBL 2ZHAA 2DR8A 4CLUA 5HLFB 4LRBA 4HVZA 3V81A 1TP7A 3M4XA 2OEMA 2UUBF 2Q43A 1ROFA 3BGUA 4BLGA 5F8IA 4F4ZA 1YJ7A 2HQ3A 3PDNA 3QT5A 3QWPA 5JJBA 2WVCA 4M5LA 4PG5A 2E9TA 1KVIA 2YBVA 1UEVA 3T6JA 5J2MB 1W7WA 4LF7F 2HMIB 4N77A 4ED2A 3LP0A 1H2TZ 1QJHA 2L41A 4YS2A 2K7JA 2A0FB 1T0TV 2GMJA 4KIAA 1S1VA 2JRSA 2BE2B 2V4QA 4O0IA 1YZ7A 3R1LA 1IM6A 2Y9HA 1BQXA 4KPCA 2ADCA 3GFZA 1VRUA 1UJ6A 5ETPA 4L3NA 1YHQS 1N5SA 4WP3A 4ZLJA 3DLLQ 3MHYA 2XS2A 4CLYA 1SUQB 4U6PA 3AH6A 2C42A 1RWWB 3PX4A 1K0TA 4A47A 4KB7A 3IG1B 4A8MP 2XGPA 3B78A 2BKPA 1IBKF 3DYAB 1TK5A 1UPPA 1FX4A 3OBIA 4CH7A 4QWAA 1U24A 4DS5A 5HK4A 2XSJA 3DXSX 5L46A 3J7A1 2HW3A 2QFIA 1JLFB 3G8TA 2PD1A 3KNGA 3QAUA 4ZOSA 4ZN3A 5KFKA 4FBTA 3I87A 3KTQA 1L3SA 3OXFA 2AT1B 1TL7A 4DX8H 1VHFA 2FZGB 5C25B 3M8WA 3ENQA 2NR0A 2PA3A 2OGUA 4NXMJ 3DLKB 4ECQA 4H4KC 4DF8A 3T1HF 2C2KB 2DNGA 3G87A 5J2NA 3GSDA 3I5BA 4JI5J 1D9DA 1T9WA 3C15A 2ZZMA 3TAPA 5MLCV 2YPZA 2ZOGA 4PG6A 4LR7A 3CD6S 5GADU 2YKAA 1J5EJ 3HSDA 1GX5A 3HI9A 2J8AA 4HLBA 1QAXA 2C2OB 2M8DB 5C42B 3D67A 2J7UA 3MEDA 2OPPB 4OJHA 3SMZA 5I3UB 5KFVA 1RWOB 2CPHA 2HIQA 2N4CA 2GQQA 1X4CA 4IKAA 1VBXA 4C11B 1U8SA 4W98A 2CWKA 5DDPC 1H73A 5FDLA 3C6UB 2XY7A 2RRBA 4DXLA 2IVMA 2MQOA 3TUZC 1YTYA 2GJIA 3TZWA 2ERRA 2CQ0A 4KFBB 3UW1A 1WSRA 4I2PA 1R8HA 1MSWD 5GAGI 4YN3B 1CJUB 3QBCA 4HH0A 4NX9A 1RT2A 3ZZTA 1UVJA 2XMWA 4WKRA 3OLAA 2EFVA 4N56A 1NCLA 2RB7A 3AB4B 4AL7A 2FGCA 1U1RA 2VG7B 1TKDA 3H7HB 1IBMJ 4KO0B 4PWUA 2NXUA 4HL9A 4FYYB 4DOZA 3KMSA 4RW6B 2GVZB 5B09A 2PT0A 1RAEB 2PMWA 1YJWS 3VGSA 5KFUA 4Q44A 4PG4A 1Q82T 4N8OA 1UVMA 2AZ3A 2JVRA 3W9JA 4FP9A 2W9AA 5E3AA 1KVKA 2VODA 1AZSA 2VQFJ 3D6TB 4X65J 2XM3A 4C2MA 3GV7B 2WRMA 4DSJA 2R8IA 3A3PB 2HBRB 1WUUA 2C2EA 4UZBA 5BJRA 5JVGQ 2BMBA 3Q8RB 2MZQA 2DNMA 1RHJB 3M2RB 4LIWA 5KT5A 3FFIB 5J1PA 2BE9B 1F3VA 2VBYA 2JLGA 4MIBA 1IR2A 3ENWA 5KG3A 1PSDA 2K3KA 4G1QB 1YJ9S 2W9BB 4J9OA 2ZC4A 1M1HA 1DTTB 2ZOMA 4WP8A 2QC3A 2N82B 1X9SA 2R7RA 3LPYA 4X4PA 3UI3A 4DL6A 5F0UA 2K2PA 3OR1B 2CJXB 4ZJOA 2IM3A 3P5BP 4OV1A 3MM6B 5L8RC 1FRLA 1RJJA 3S1TA 2EEYA 3RGIA 2W7PA 4DI6A 3MCOA 3NY0A 5I4MA 4LRAA 3RRKA 3HKWA 1XMOF 2FDNA 2VB6A 2BQUA 1ZM3A 3TA2A 4K8RA 1SJRA 1JXVA 1CQNA 1RT1A 2W2OP 4GC6A 1PAUB 2IRXA 4HHHA 1VQ5S 1BD6A 3BN4A 1C0UB 3W8GA 2CQDA 4DSLA 4W4MA 2HS3A 2QSFA 2XLIA 2UUAF 4N8NA 2H1YA 2CNNB 1WHXA 4YUDA 2IFXA 3CWJA 2E5JA 3W2WA 3GONA 2DGVA 2EFPA 2B9YA 2F4VF 3IR5B 1S6OA 4J5OA 5JMNA 3CUNA 2ZBIA 3OXLA 4NLUA 4ATNA 4CP5A 1RAFB 2CVIA 4DV7F 2YKQA 2BQRA 1U4BA 4LFBF 4ER8A 3IBWA 2D41A 3MM7B 4FPIA 2HFSA 5KOWA 4LFCF 1FHTA 2IAJA 3DOKA 4EUVA 4B17A 2YWHA 4Q43A 4TY8A 1W2BR 1Z2ZA 1F9HA 5IC6B 4ES2A 3DRYA 2LDYA 4OMFG 4ED1A 2J0XA 4CH1A 1IQZA 2FJBB 1FXLA 5KFJA 1WHWA 2Z2ZA 2XEXA 3DU6A 4DCPB 3H90A 1Q86T 3RW6A 3MEKA 3TZYA 1UTAA 3U7JA 3EVOA 4ERDA 2RQMA 5C2GA 3THPA 2Z2LA 4QIWD 2RD5C 3DRSA 2YX4A 3L7OA 3QT6A 2YNFA 2LYVA 1RCXB 2AZ1A 4YR3A 1RAHB 2HGLA 1FD2A 5T7LA 3BQ1A 1DARA 1NK6A 3AXMA 3GU0A 4V1Ak 1VLOA 4ZLLA 2PMHA 3QPIA 4PWDA 1RWMB 1IKXB 2HKEA 3HVAA 2H65B 1U47A 1FT8A 4F26A 1HWUA 1VLYA 2IRYA 2BW2A 2HNDA 1PJ5A 4BDPA 3M9MB 2HFUA 5L38A 1IQTA 4ZVUB 3E01B 1HNVA 3I5AA 1TMMA 4DL7A 1NB2A 2CPJA 3QJLA 3AHPA 4I64A 5HBMB 5EN1A 3W61A 4YHHF 1WC3A 4RNNA 5DLGA 2VFTA 4FVCA 3F41A 4R5PB 1WOOA 1XJWB 1I6JA 4Y65A 2FGOA 5IQQA 3OHAA 3Q23A 2DGSA 2XO6A 1RA7A 2NPIA 2U2FA 1K8AT 2FJXA 3BQ2A 3ZTSA 1FKAF 4FPRA 4P72A 3CDAA 4YMEA 5J2QA 1NZ8A 3L4BC 3N5FA 1Y5IB 2VUGA 1Y3KA 2AP6A 4OLOA 4DBQA 1LKZA 1WG5A 3R8YA 3CDBA 1CQMA 3HD2A 2DXDA 1ULRA 3EVMA 1REVA 2HHPA 2XULA 5DGBA 3BEGB 3K5MA 4X4RA 4B3OA 1NK4A 1A6LA 4IOBA 4P10A 2ZJPQ 5AE1A 2XMVA 4JV2A 2XS7A 1W2IA 4RJVA 2IDEA 2VG5B 1I5OB 2XY6A 1U45A 3PHEA 1KSPA 3H2VE 1SL0A 4WTYA 3CE8A 3MMAB 2XYPB 2JH3A 3CCES 4DFJA 3OUYB 3NLCA 5DG8A 5D3GB 4CH0S 2GMHA 3HHLA 5K8MA 1WDDA 4DPOA 1T94A 2NYHA 1NSKL 1HIYA 1CLFA 2GIQA 4CWBA 4MJKA 2CPFA 4USVA 2HHQA 5GAGU 2IM0A 5EUHA 2UXBJ 1EHWA 4QOTA 3RR7A 3I9V9 3LA0A 4A48A 3KLEB 2OFHX 3ENAA 2CQCA 3KG4A 2Z58B 2N7YA 4QR0A 4DV3J 2KRBA 1TV6B 5IC4B 2EKYA 3MAAB 2VJVA 1RHMB 4U7CA 4XIUA 4OX9J 4UOHA 4I6AA 2E7XA 3ONQA 4GKKJ 3VAGA 2QFJA 3HZEA 3KDOA 3FK4A 1FJCA 3O5TB 3DGVA 3W2VA 1U6ZA 1GMUA 2BX6A 2KG0A 3UDEA 1ZA2B 3US5A 4TYBA 4KTQA 3X1LB 3M8SA 1AA1B 2KTQA 2D3O1 1WACA 2A2DA 1U02A 3BSAA 4A8WA 5ETSA 1Y0HA 5DJBA 4JI8J 2BA9A 2KB2A 1F2HA 3PRVA 2G9OA 4DG1B 3QRPA 3SV3A 1PAEX 1HNIA 2HRTA 3NGRA 4FNIA 3RAXA 4DPWA 4X4OA 1OYDA 3CJKB 4AFFA 3BYPA 1UFLA 2JC1A 4FS1A 1SV5A 4F25A 1TAUA 4Q45A 1S9EA 1NSAA 2CQIA 2AW0A 3BGOP 1Y11A 2RE1A 3GR1A 4OHZA 3FSXA 4CIOA 4NE9C 4E98A 4AQYF 3GIKA 3BSNA 3OTEA 1SH0A 5DDRC 4K4SA 4ZK7M 1VRTA 4KHPF 2VKRA 2NXJA 1WEYA 5KG2A 4DUYF 1EETA 4O4RA 1TVRA 4I4BA 2IJNA 5BYSA 3E2EA 1D9AA 1SVDA 4LRFA 2RF2B 2WONB 2A2CA 3MD1A 4NZ7A 2MHNA 2DGTA 1LW0A 3R6LB 2E1RA 5D15A 1CULB 4QPTA 4DV2F 1U49A 4GKJJ 1Y5LB 1YJVA 4I6WA 2I1RA 3DOLA 2CQ4A 1JLCA 4OV6A 2CJBA 2B6AB 2BJEA 4FF2A 3UO0A 2WW4A 1QSSA 1RU1A 4OZNA 2R8KA 2BJ1A 3Q24A 4NEYA 1JLGA 1ZBTA 3QGIA 4KV8B 5KFTA 1NHUA 2ZKTA 2NUHA 2DCUB 4HYKA 4OI6A 2R4FA 3HKZD 4R8UA 5FJ4A 4C48A 3DHXA 3KLGB 3I4HX 2VFSA 3MR5A 4B02A 2V8PA 2AJ2A 1VIOA 3K59A 2LXIA 4PWWA 4C8MA 4C3MA 2NSBA 1HQUA 3K8VA 2E5LF 1S72S 2LP4A 2FZCB 2GQCA 2YWEA 4ED3A 3POTA 4QU7A 1ZZFA 2C2ZB 4DL4A 4CM0A 4Y6IA 3V81B 4DR1J 3ZZOA 1T9TA 5AE2A 1X4DA 2XNRA 1G4CA 3C16A 4M5DA 3HHNB 3UFCX 3CCQS 4FXVA 1N52B 4B3RJ 1H74A 1N5TA 5F8JA 4JUZA 3FSIA 1WC4A 2J9DA 3TVYA 3N6LA 4LSLA 4B3TJ 3D0HE 4DFKA 2UXDF 3K57A 2IMWP 1U2RA 2HRUA 4IFVA 1TKXB 2D9OA 5HROB 4M5KA 3J80U 4ZP9A 1S1VB 1PKUA 4F3MA 5KFBA 2VFRA 2OKQA 2YQ0A 4A8XA 2AJ4A 1QVGR 4U9RA 1G7CB 3T1YJ 1NK0A 3W9HA 3QJPA 2FIUA 4JI2J 2R2UA 3QQCD 3RB4A 4DR4F 4I6YA 3OXGA 1T3NA 1H72C 2A18A 2ZDPA 1YVFA 2CJ9A 3IWLA 3JSMB 1IWAA 4PEOA 2C3YA 3D1QA 4BBYA 5IZHA 2V9KA 4CLWA 2MY8A 2E1AA 2EG1A 1RI7A 4I1TA 4NA1A 2IJRA 3OSNA 2VOOA 1DJ0A 2XSJB 3JTOA 1QTMA 3GYXB 4URQU 3HJVA 5D77A 2VASA 4QR2A 2GCFA 1AXQA 1U8WA 2IMOA 5C7PA 3FDSA 1HNWJ 2UXCJ 2FVQA 1TL7B 5FLXY 4NRTA 1HBMB 2YWGA 2C2NA 1C1BB 2HVHA 1AFJA 1N33F 2VICA 1JLBA 2FPHX 2HURA 3MMCA 3KOAA 3E51A 5J2NB 1T9UA 2UUTA 1YJTA 3C15B 3FEZA 3LALA 4NZ0A 3D6FB 2MPUA 1IKVA 1YKWA 4CCHA 2AYMA 2B9XA 4E2FB 4IFYA 2R8GA 1RAJA 3MEDB 1MW7A 4RNMA 3EWGA 1NHVA 2G1DA 4QWCA 1WKKA 3QJJA 3TAMB 2DO0A 5F8LA 2ZM6F 4JOUA 1TL3B 5FDLB 2AHOB 2H9ZA 3SZ2A 2WHOA 3TW0A 1M5PC 1X9WA 3OVBA 1F60B 2M8HA 4UW2A 2DIUA 5DETA 3C14A 3M32A 3G2XA 4I2PB 4OI0A 3IWXA 1OJ4A 2C3OA 2CADA 3AD9C 5BYRA 2EK1A 3BS9A 4FKXA 5GAHI 3CD7A 3IWNC 3CD0A 2BOPA 4KKOA 1F5AA 4JB8B 2W7OA 1FRXA 2I2YA 2NLWA 3KK1B 2DGOA 1PBAA 3O3LA 1UVIA 3MOZA 1KRPA 2ZBRA 1VBKA 4DSFA 1N88A 4OHVA 1D0EA 4U95A 3I0SB 3D3CJ 1X7VA 4B9UA 3M6UA 4K4YA 2CG8A 5HANA 4D3GA 1HQEA 4GVLA 3FBCA 1LWEA 2DGXA 4B3SJ 1JMTA 3RB6A 2ZHOA 3UD3P 3AJ2A 4K4WA 2NYIA 2ZBCA 2V67A 3VAKA 4K5SA 3H2LA 1IR1A 4PZVA 1AROP 3N01A 3DNCA 1RT7B 3KG0A 4NCGA 3Q86A 2BDPA 1M1KT 1B99A 3QLHB 1HWLA 3VHQA 2HQIA 4WKYA 1R6YA 5F3ZA 3TANA 2R7QA 3DRPA 5BR8J 2MB0B 4OX8A 3LP1B 3IAM9 2R42A 4AXIA 4ZPCA 4ELVA 5DQHA 2XMUA 4UOGA 2X51A 1FDNA 1NPPA 3OPKA 3W5YA 3HSGA 3JXOA 2XSFA 3KG1A 3GV5B 2COLA 2HHHF 1P8GA 2IA6A 3UE2A 1RT3A 3M05A 1NKCA 1U09A 2L08A 2W2MP 3MWBA 1UMJA 3DMJA 4CTAA 4PUOA 1SJ4P 4OYXA 3UN2A 1UPMB 1VYAA 1FJGF 5CYQA 1KP6A 4TLRA 4C6AA 4DMZA 3J7ZT 3DLJA 4JI6F 3R5GA 3DRRA 3M8PA 1R89A 1RT1B 5H9EJ 3W65A 2B7BB 4YB1P 3IMQJ 3K5PA 4ECXA 3U02A 5CCMA 3T5JA 2KKHA 1UVNA 1SQFA 3W5XA 4OZ3A 2R3VA 1GXLA 4TQSA 3TYTA 2YNGB 3K89A 1K9MT 1Q16B 3T19A 3H40A 1C0TB 3UCUP 3ZZZA 1HR0J 2B8QA 1TELA 1JJ2R 4WP9A 2VPYB 4LF7J 1TU0B 4YP3A 1LW2B 4O4GB 4OHXA 3I32A 3N79A 1U1KA 4RBUA 2VA3A 3CJSA 1H38A 4LF4F 5GAEI 4GVBA 2M3DA 1FD8A 2KZMA 4ED5A 3LP2A 1Z1ZA 4J37A 1JLAA 4P7VA 4L72B 1CJVB 4DJBA 3R7NB 2IAJB 3MCMA 2FY8A 1RAIB 4HACB 2PA8D 2HBYB 4YOEA 1IBKJ 2KFZA 2B51A 2BJDA 3KJQB 5A76A 3CC7S 4K4VA 4WXWA 4LVOP 2VF3A 2W4DA 4PPZA 1FNXH 4CO0A 3DRSB 2LQBA 2BOAA 2YNFB 4NCBA 1PJ6A 1JLEA 1VMBA 1FA0A 1O8BA 1S59A 5T7LB 1RISA 1E6VB 1HW9A 5A8RB 1OMSA 5MAOA 4LBHA 3HT3A 1UFWA 4PRFA 2PGCA 4HI2A 2LU1A 1NSPA 5EHHA 2D3UA 2HNDB 2GC8A 4IO1A 1PYOB 1RTHB 4MKYA 3RB0A 3D68A 2X3DA 4ID5B 2NXCA 4TVAB 4URGA 3IS9A 3QNWB 1H2VZ 2VONA 3ZTRA 4J91A 1HBUA 4ECYA 3CDWA 1GMVA 2VQFF 3GYGA 1R0AA 3VAJA 4DN0A 1CJKA 3PW5A 2DHXA 1D9FA 5KFOA 3N6NA 1CPZA 3FGVA 4Z37A 2RRNA 1F6TA 4K4XA 1PO6A 5IT0A 3FRZA 4YB6A 4C3LA 5F3TA 4U8YA 1OYEA 2K8GA 4KRWA 2P6SA 1VDHA 1UL3A 5ETVA 2OI2A 1FE0A 4ZVRB 4F0MA 1KQSR 2HS4A 1YWXA 1RT6A 4CLPA 4DV1F 4M8LA 1F9EB 4YDDB 3RU0A 2WCXA 3MUTP 3ISNC 1YDLA 1REVB 2DHAA 1FE4A 3NWGA 5I42B 2FVCA 3U27A 3PNIA 4RUHA 2AD9A 2X7IA 2MQNA 4B3OB 4ZVSB 4JV5F 3MCSA 4A8QA 5KFIA 2OLWA 4PABA 4FYVB 1FTRA 3I0RB 4WE1B 3FZ2A 1SQEA 1ZPVA 2WVDA 3MEGA 4ZJQA 3QGHA 1ZA1B 2DH7A 1S48A 2AEMA 3UDLA 4DSIA 4OL8A 2CKWA 5DG9A 4NLYA 2HHTA 2RAQA 3PTWA 5K20B 3SSRA 1SH3A 4TU9A 4RNFA 3NBPB 3D5MA 4IH5A 4Y2KA 3FVYA 5L1LA 5D4LA 3IP0A 5GAHU 2ZVIA 1YBUA 1WC5A 4WFXA 2OPQA 2R7SA 2XZWA 4WXOA 2LQ9A 1YGYA 4GRSA 4HHUA 3FSYA 4H4MB 1HD0A 2LLZA 4JI4F 2MKHA 2XYHB 1F2GA 4MFBB 2LA6A 4C8LA 4ZVQB 3IGVA 3DLHA 2L3MA 3PEHA 3CGIA 1XERA 2C3UA 3RAQA 2LXUA 4PPDA 7FD1A 1UW9A 4NASA 2JLEA 3BN7A 3UPFA 5IM0A 3RBDA 5KFRA 2I38A 4KT0C 5HQ8A 1URNA 1XMOJ 2ZNZA 4L75A 3VF0B 3KK3A 3IM9A 2AX0A 1J2VA 2E5GA 4U96A 5E5NA 4QBUA 2UVUA 3W64A 3MD3A 2KT3A 4ZIVA 2P9GA 1BE4A 3AQOA 4BC7A 3RG6A 4ANEA 4OYIA 4X4TA 3AJ1A 2V2KA 4KGMA 3UNGC 4K2JA 4IOCQ 4B9MA 2UUAJ 4URSA 5KTQA 1HNXF 3PJXA 5DM6Q 1Q8KA 4ED7A 1SV5B 4A8SA 3LGMA 4BWJA 2OD4A 2ZE2A 1S9EB 3V4MA 2ZH8A 4ZPDA 1TL1B 3IM8A 2XHCA 2KG1A 2QRRA 2QIFA 1MROA 4A8KA 2F4VJ 1WELA 1NNDA 2ZKUA 5HVHA 3CMQA 5THWA 3BO3A 2NCKL 5A8WA 3ISND 2Y1LB 2FB0A 4MK9A 1NDKA 2D3OR 1VRTB 3MMBA 2I6WA 3OR2B 4DQQA 5J1EB 2EFGA 1EETB 4DV7J 1YLXA 5CAAA 4XTTA 4LFBJ 3K58A 3JAMY 1NUEA 4MTPA 2GJ2A 4RWXA 5B0EA 1S0OA 3D3BJ 2J5AA 4DV6F 4WFNQ 1FK9B 3J7Z5 3HVRA 3L09A 1FRMA 3PM9A 2LFVA 1LW0B 1NBEB 2HHWA 4X66J 3PX0A 4X2BA 3FBFA 2POKA 2IDLA 4U7UK 3CULA 2BE7D 2K1RB 2ZH7A 2YH1A 2G0IA 1R6VA 1BMQB 3MUMP 3THTA 3TZZA 2W1BA 3G9CA 1JLCB 4F0KA 2DTJA 3W1YC 1P9QC 3D0IE 2WOMA 2M9KA 2RH3A 1VHIA 3W62A 4F3QA 4F4YA 1HW8A 4C8KA 1XMQF 4ZCKA 1LQ9A 5K14A 2J76E 2Y0BB 1QAYA 3MR3A 4ETXA 4C8NA 4LIRA 4R8UB 4NXNF 4YDXA 5GAEU 4O3OA 1ZM2A 4WFYA 1FFSB 1KBRA 3CO9A 2NPFA 3MCNA 1IBLF 5IV4A 2DR9A 3GQCA 3FEXB 5ETLA 3D6HB 4IDKA 2KHDA 2IYGA 3OLBA 1KNZA 3EXYA 2QV6A 4LF2A 4J9KA 4WFAQ 1RTJA 1RP5A 5IV3A 4RNHA 3V4IA 5AT1B 4YHHJ 5KT2A 5A0YB 2QGFB 3GG1A 2MLZA 3CJTA 1S99A 2VHGA 5KFNA 2OMOA 4OI1A 4LSLB 3RBEA 4F7VA 3EM1A 3IBFB 4MYUA 4NYPA 4NLDA 4IFVB 2HEKA 4DDFA 3MTJA 2KXHA 1UWBA 4WZMA 4J90A 1NEEA 2FZKB 2R7TA 2VH7A 3DLEA 5L1KA 3PKMA 4B3MF 2V69A 4HDGA 2DRDA 4F02A 3NS5A 2CA9A 3OTCA 1S1TB 3BH6B 1NU4A 3JQJA 3CTRA 3HMJG 1I94F 3GLJA 2XWXA 5CABA 4KY3A 3MECB 4RR5A 1TR0A 1JJHA 3D6MB 5LSOA 2B5JA 3OD2A 2BJ9A 1M5OC 2I5JA 1DLOA 2APOA 1KQKA 1U1LA 3BBCA 2RHQB 1T05B 2QLXA 2Z57B 4Q2LA 2V4JB 1VS3A 4ZVFA 3ZTPA 2DEJA 3GCWP 3GFHA 1JLBB 2VG6A 2HK3A 3MMCB 4CT8A 2X1FA 3MEEA 2C3PA 4BCAA 1DQ8A 3CXCR 1IKVB 1HHSA 2QT7A 1SB6A 1EP4A 2YVSA 4IFYB 1Q0NA 3EXCX 3LWLA 1C4AA 4ZVHA 1RUSA 5ETMA 2DXEA 3MM9A 1TUWA 3C8YA 2Z30B 2NSCA 3UR3C 5KFFA 3FJ2A 3KUEA 3IRXA 1V6HA 2JEJA 2FVPA 1U6BA 1W26A 2FTRA 3PEJA 2YXLA 3C14B 2IBOA 3MDFA 4UZCA 2RU9A 4EBDA 1MU2A 1MLAA 2MZRA 3BGFA 3HVTB 3VGUA 3P4UB 2WBRA 1ZYQA 2WSEC 2ZHBA 2ZH1A 3SCIE 3IA0A 4GKJF 4KKOB 1F9FA 1S7HA 4KYZA 4G1IA 3GJRB 5IXUA 4NLRA 1PYTA 1FESA 3MPVA 4NYZA 3CMES 1G3OA 1U1QA 2ROPA 1D8ZA 1R8AA 4K4UA 3NRBA 1T03B 2CUYA 2FHJA 3EVWA 2D7SA 1FFGB 2EBEA 3OVSA 1MNEA 2IC3B 4AQYJ 2BBEA 1SKRA 2W24A 3I82A 1U6FA 1FRHA 4DL0C 1VQ7S 2EK6A 2HRYA 1AFIA 2ALYB 4KHPJ 2G2ZA 1FJ7A 1LWEB 4DPYA 2QYGA 1KLMB 3BO4A 1RT5A 4WBFA 4KH0B 1VFJA 1HWJA 1XMBA 4U67Q 3AXKA 4I7FB 4HTJA 1G1XA 4OFZA 3I4PA 4EK2A 3D1OA 4LFAF 1FKOB 2HFNA 1HA1A 3GYNA 1EX8A 2YNHA 2YQ1A 3TRGA 4DV2J 4DQPA 3DLGA 5DO2A 5J2PA 2AEFA 2WK4A 3P5TL 1SQGA 3AA9A 3M8QA 3B8HA 5LSLA 3HLUA 2MQMA 9RUBA 3HFVA 2DPIA 3H42A 3NCPA 3BV8A 2GIFA 3BKTA 1X4AA 1DZ5A 3G6XA 4RX6A 3L95X 4USKA 1SIWB 2VPWB 1NAQA 2HHXA 4WIQA 5E0OA 1RT3B 4NI2B 4E0DA 4FXWA 2LKZA 2V63A 1BWEA 3DMJB 2DIVA 4CTAB 2V4RA 4PUOB 5DZ7A 2ZUAA 5CYQB 3WC2A 1U0HB 1FRKA 3ILJA 2E5LJ 1KVJA 3A8EA 3DRRB 1C4CA 3M8PB 2KVQE 4RW4A 1OSDA 3MURP 3CCUS 3DOMA 2GS8A 1TFYA 4QR1A 5HP1B 1XNQF 4RL1A 1EKRA 2HNYA 2OPSA 4P74A 2B8PA 2LEAA 1TKTB 1L3VA 3ZZUA 1PJ7A 5BXIA 2A3JA 1ZOTA 1HNWF 1UA0A 4QU6A 1GMWD 2BKOA 3A3NB 2UXDJ 1SCJB 2GGPA 3CJ0A 1D09B 4ZPVR 1ZM9A 4ICLA 1NSQA 2R2RA 4ALZA 3BDEA 3MMJA 3VWSA 5LXRA 4J9VA 3NNAA 3D7SB 3L7PA 4WJBA 1QTNB 2JX2A 1JLAB 1BQMA 4DR4J 8RUCA 3NCQA 1WORA 1RGVA 4CM2A 1R8BA 1CJTA 1FDDA 4G1PA 3MZIA 4CLZA 5U47A 2FLNA 3G82A 4K59A 1RT4A 4FNHA 5RUBA 1O0PA 1VQYA 3PZPA 3MTKA 2DNHA 1HWIA 2JFDA 2NZCA 3OL9A 1SI9A 5F9NA 3KHLA 4B9LA 3WX8A 1VIXA 2QMWA 3H4DA 3D0GE 1I51B 4CLKA 1S1WB 1U1PA 2Z4PA 5FLXU 2FUG9 2C2RA 1OO0B 3GILA 1LWFB 1RAAB 4O3NA 1N33J 4L76A 1SJ1A 2HVIA 3M6WA 1GTHA 2W2PP 4JYAF 3TUJC 1X4GA 1KDNA 1YK9A 2CQHA 1TKZA 3FBBA 3M8YA 3FZBA 3EUNA 2DNLA 1B7YB 4NLXA 3I9ZA 5AJ3F 1B0TA 2CWXA 1XQIA 3J81Y 1N5QA 3VQTA 3V6DA 1FRJA 2ROEA 2HWIA 1QE1A 2Z8QA 4NWBA 2O01C 2QEXS 4KJIA 1UZHA 3PHTA 2MZ1A 2ZM6J 3B4MA 2KYZA 1X60A 2KRRA 4ZJLA 2BRLA 1CJKB 2E66A 4CZCA 5I3QA 2DHHA 3Q83A 2HBQB 2YWKA 5ITHA 4N47A 4PG7A 4EBCA 5ETTA 3J7YI 3ISZA 2DJWA 3DGPA 3FQLA 3AOAA 4U8VA 3BSOA 3IAS9 2O3DA 3ILOA 2Y8YA 3OFEA 4FZVA 4PQUA 5D0GA 1DTQB 1HL6A 3BREA 4KHMA 3LAKA 4PR6A 3QWUA 4I56A 4GO7X 4CRJA 1VC5A 3M1VA 2VFVA 1RT6B 4RO0A 1KOHA 2V8VA 1WKLA 1E6YA 1QM9A 2E7VA 2WVEA 5C2CA 4OIXA 3WC0A 1YI2S 1DHMA 3R5JB 2GHVC 4RW8A 5KFCA 4JI1F 2GAGC 1I3OB 3MEGB 4Q0BA 2W9CA 3PW0A 2FVRA 2F7VA 4EYIB 4WTOB 1B64A 3QIDA 3JQMA 2EFNA 3H59A 4C0BA 5SUHA 3F56A 1HARA 3CSKA 2G2OA 3A8KA 1KWMA 2XQCA 3FNNA 1FDBA 2JLFA 4K2XA 3EZ5A 5LM7E 3MM5A 5DS7A 5K5MA 2CJKA 4USMA 5G4DA 2LQJA 2DNYA 2OPQB 4OYWA 4Y0FA 1BHNA 2MJUA 1NKEA 4DPXA 4O0NA 4OZ0A 4LF8F 1HR0F 4IRDA 3OFGA 1AT1B 1SC1B 4ETZA 1S0NA 2UV8A 3FCVA 4CO2A 1M90T 3IR6B 3WDOA 1H0HB 3BB5A 3UD4P 2HHHJ 4F04B 4Y34A 4ECWA 5AXNA 3R5BA 3BJYA 5IM0B 1R8PA 4Z2XA 2EBGA 3UD5A 1HYSA 2HWTA 2J7WA 1NH7A 3M30B 1HBNA 2BV3A 3CVKA 5HLFA 1FJGJ 1HNZJ 1FKPA 3KK3B 5JVHQ 2OTLS 4JI6J 3HDSA 1S1UA 1JNRB 2W8LA 2ACYA 4JI0F 2CXEA 4HEA9 4LT6A 2JL9A 3G6ES 1KLNA 3EGWB 5DLFA 2DK2A 5D8HB 1Y10A 2QZ8A 2KFYA 3MAQA 5J2MA 2WSCC 4ZPTR 2CPDA 4RBTA 1XN9A 1FERA 3CCTA 4NPOA 2Q3PA 2ZE2B 4LQ3A 1MROB 4F8RA 2HVEA 2JHEA 1UWAA 3ETOA 4ANCA 1RHKB 3KLVA 3OVAA 5ETQA 1HLWA 3FKBA 3DN9A 3QSYB 3MMBB 3JSYA 4LF4J 1YRXA 4EMDA 1WDTA 1SUQA 2QTWA 1UP1A 2AEJA 1JK9B 3ENVA 1ZPWX 4LQ9A 5ADZA 3HULA 2OD6A 2Q66A 3QIPB 3ILIA 3CCZA 1CS4B 4UY8T 2XYGB 2XNQA 4J9LA 2VU5A 1JLFA 2HVZA 3M2UA 5E33A 2FJEB 1SBRA 4X64J 4PKDB 4FF4A 4TKTA 2VL1A 5LOQA 4JV0A 4FYDA 1P9YA 5C25A 4IG0B 3R9LA 1RQ0A 1QD1A 2B7CB 3Q22A 2NQPA 3SSSA 2WOMB 1P6TA 3B54A 1GQEA 4F2RA 4OJ3A 1XNRF 4C0HA 5EWEA 4F4WA 3KLFA 3PR4A 5K14B 1K1SA 2VC1A 1T3OA 5C42A 5KFWA 5G0RA 4NA2A 3ZZ0A 1KQFB 2H4WB 4FYXB 2PMZD 3H98A 2OPPA 4BWMA 5LJ5Y 8ATCB 5E7OB 4IQMA 4ES3A 2J7KA 1FJEB 2ZH9A 1A7GE 2BANA 4IDKB 3F44A 2H54B 2P5VA 2ZEJA 1WKJA 2CJAA 3C6UA 4ELTA 4V19X 1U0SA 4X4VA 5J1NA 2ADBA 2PEBA 4NCAA 2E5HA 3J7AN 1RTJB 1S49A 4A46A
chains in the Genus database with same CATH topology
3HZGA 1KR4A 2FC8A 2OAUA 5E3RA 3V2UC 3HK2A 1FJGF 3DOLB 4JBCA 2EWHA 2AF6A 5CYQA 4TLRA 4DMZA 3BZQA 2ZOFA 4FF1A 3J7ZT 2M88A 3DLJA 3IC1A 4JI6F 3V6HA 1Q8IA 4ILRA 4O44B 3DRRA 5DGAA 1HPZA 3M8PA 2XI3A 1R89A 2XHWA 1RT1B 2EFOA 1TKZB 3OW2R 5H9EJ 1HBOA 2B7BB 4YB1P 3CCJS 3K5PA 4ECXA 2HAIA 3AA8A 1S9FA 3P96A 3U02A 2P9EA 2LECA 3PW7A 2K3IA 5CCMA 3T5JA 2KKHA 4XAKA 1WEZA 3OR2A 5B7WA 1UVNA 2IVYA 4KPYA 4IH7A 1JLGB 2VG7A 5J1EA 2N7CA 4EO6A 1OPIA 2AYGA 1GXLA 4UUXA 1WHYA 3TYTA 4TQSA 2UP1A 2XCPA 1ZTTA 3N5BA 1UWBB 2BUNA 2J9EA 2YNGB 2JFKA 3OJSA 3RRGA 1K9MT 3IO1A 2YNIB 1Q16B 3T19A 5KOXA 3NS6A 4LUBA 1R27B 1HI0P 2KZZA 3DLEB 1N34F 3H40A 2W7AA 4NLWA 4RW6A 5KFHA 1X0FA 2F8EX 1C0TB 2J9CA 3IGNA 3VR1A 3UCUP 3ZZZA 1FK9A 3GFXA 5DM7Q 1LK7A 4LVNP 2AYEA 2MGZA 4C97A 2IBKA 2I9SA 3IRWP 2P9CA 1JJ2R 5GVQA 2VPYB 4WFZA 4DG1A 1HQUB 5IT9Y 2CVEA 2KT2A 3C6TA 1RWUA 3IN5A 4YP3A 3D28A 2GO8A 4DUZF 4KHRA 1Y4ZB 1VQ6S 3POTB 1LW2B 4F3OA 2K1RA 2BM1A 4O4GB 1JIHA 2LDIA 3GIIA 4A8OA 1ZH5A 2DNRA 4UQTA 3PW2A 1OQ3A 4OHXA 3CJKA 3BDPA 2CQ2A 5D4OA 3I32A 3N79A 1U1KA 4RBUA 2VA3A 1H38A 4FVMA 4LF4F 2HGNA 2XLKA 4M63A 5GAEI 2M3DA 1UVLA 3PIPQ 3OJUA 4ILMA 1FD8A 2KZMA 1HMVA 4ED5A 4PQUB 1RA6A 3UCZP 3LP2A 2B5JB 4HTIA 2UUWA 1Z1ZA 4J37A 3ITHA 2CYYA 4AXJA 1CVJA 2HZCA 3T5KA 1JLAA 1NJZA 3KLIB 4L72B 4P7VA 4M5DB 1B0VA 5M2PA 1X9MA 3HFKA 4RZRA 1PC5A 1F5CA 2I5JB 4DJBA 1JXEA 3M1VB 2DD8S 2RDJA 3E3XA 2IAJB 5L9NA 2QA2A 3M2RA 3DM2A 3TNVA 5B0FA 3U1NA 2R7WA 2Y1JA 1N36F 1FF2A 3M8RA 1VC0A 5DRKA 5EX3A 2YX7A 2KXNB 3FFIA 2RUGA 1E6YB 2PA8D 7FDRA 5AXLA 2XMJA 3J7YU 3KK2B 4K50A 1OWXA 3M2VB 2RSQA 3LOUA 3PKYA 2OO4A 2H5EA 3R5AA 2FY1A 4YOEA 2KFZA 3LAMA 4Q8FA 2B51A 4ECVA 2E29A 3H8YA 4DV5F 1DTTA 4C9DA 5K8NA 4B3SF 3PY8A 2BJDA 4TY9A 3ZZYA 1RTDA 4RW8B 1MMDA 4O3SA 2DISA 3HHDA 5A6PA 3H5XA 3CC7S 1X8DA 4G3IA 1A9NB 4K4VA 1NH8A 4X4NA 4EFAC 1PGZA 4WXWA 4DL5A 2RRAA 1D3WA 4J9SA 1LFPA 4LVOP 4QIGA 4OLPA 2W4DA 5F9LA 2W9CB 2BZ2A 1NJXA 1EP4B 2M2BA 4PPZA 3KLHB 2RKIB 4Y2MA 4DV4F 3K0JA 1FNXH 3MM6A 5LMNF 4CO0A 3DRSB 2LQBA 2RQ4A 2ZD1B 2FHMA 2AV5A 2YNFB 1LV5A 5LT5A 4OZ1A 2MQLA 4BS2A 4NCBA 2O5DA 2IVFB 1DBDA 2Y0SD 4WU2A 1VOMA 2CPIA 1FCAA 4YB7A 1JLEA 2WBMA 1VMBA 1TAQA 2R8HA 1FA0A 4I68A 4CQ1A 1Q7YT 3DC2A 1O8BA 3MM9B 3FQKA 2XY5A 5T7LB 1M5KC 1RISA 1E6VB 2CRLA 3SCLE 1HW9A 5A8RB 5BR8F 2MKCA 2JEIA 3PW4A 3O44A 5MAOA 5C5JA 1C2PA 3R1HA 3HT3A 1IR0A 4YY3F 5A0YA 1QY7A 5B0AA 4UQGA 2M70A 1Q8BA 3MM5B 1UFWA 4PRFA 2B6AA 1DURA 1SH2A 3QAEA 1ZAXA 3SDEA 2PGCA 4HI2A 2LU1A 2BACA 3GWCA 3SFGA 4ED7A 5D6GA 1R31A 2QYCA 5CYJA 3S7RA 3GV8B 4DF4A 5EHHA 2D3UA 2HNDB 2GC8A 4IO1A 2AGQA 2DR7A 1RTHB 2AJ1A 2CQBA 1CC8A 1S9GA 2VBXA 2ZH4A 2Q6BA 1U2FA 5KFPA 3RB0A 1KOOA 1TK8A 4EYHB 4JI7F 4MKYA 2RU3A 4ID5B 2CPEA 4KV8A 3TUIC 4CI0B 1U1MA 4URGA 2YKMA 3IS9A 5CZXA 3I31A 3K8WA 2OTJS 1S6QB 1H2VZ 3QMQA 1QUPA 1MWZA 2VONA 5D4PA 3NMAA 1SL1A 4X66F 3LO3A 4FBUA 1DAXA 1UEUA 2V5HG 2YKNA 4R25A 2BABA 1HBUA 2OPRA 3CDWA 4ECYA 1FEEA 3H5YA 3TVZA 3OL8A 4QQBA 2VQFF 1R0AA 2GO9A 2NS1B 3KHRA 3VAJA 4ZVGA 2CFXA 4OJ1A 5F8GA 1H2UX 4GMKA 4DN0A 4IOAQ 2RJZA 1FXRA 4HDHA 4LF6F 2E44A 3PW5A 2DHXA 1D9FA 1IKYB 3Q2TC 4I0WA 3N6NA 1S1TA 4GO5X 1CSJA 2DGQA 5KFOA 2MKIA 3THVA 2N4DA 1CPZA 1C1CB 2CPZA 1GNKA 3FGVA 4Z37A 1FVSA 2RRNA 4DR3F 1S10A 1X0PA 4K4XA 3IR7B 2HLUA 1PO6A 4OQJA 4WYWA 1N8RT 1S1XA 4IG3B 2WB1D 5IT0A 4B9VA 4YQWA 1K0VA 5DQGA 3FRZA 4Y2IA 2JSXA 4YB6A 4C3LA 3MECA 2ZHAA 5HLFB 2AGOA 2DR8A 3GFYA 5F3TA 4HVZA 3V81A 1TP7A 3OSPA 3M4XA 2BM0A 1S6PB 4YEAA 1RTIB 3ULHA 2UVRA 2X1BA 2VV5A 2K8GA 1L3UA 4KRWA 2P6SA 2UUBF 1UL3A 1R43A 1ROFA 2Q43A 3G8QA 3BGUA 5M2UA 4FXDA 5KFAA 5F8IA 5L9XA 4F4ZA 1DQ9A 2D3ZA 1FE0A 2IHR1 1KQSR 2D1CA 2HQ3A 3MM7A 2HS4A 1YWXA 3PDNA 3QWPA 3RW7A 3SFUA 5JJBA 1VQLS 1FVQA 1JNZB 1RT6A 2CQ1A 4PG5A 1KVIA 1RT5B 1VGYA 3HHLC 2E9TA 5LSRA 1X5TA 4M8LA 1BQNA 4YDDB 4DV1F 3JSRA 1T05A 3RU0A 2QA4G 2WCXA 1JLQB 3ISNC 3MUTP 1REVB 1UEVA 1FE4A 2DHAA 2V4JA 3NWGA 5I42B 3T6JA 5J2MB 4LF7F 4C0OC 2HMIB 4N77A 2FVCA 4ED2A 3LP0A 3U27A 3PNIA 5CHCB 1L5UA 4DR5F 2Q6CA 4RUHA 2AD9A 4ZCLA 4TXSA 1H2TZ 1KFSA 2XS5A 2MQNA 1QJHA 4B3OB 4Q2MA 4X4UA 2L41A 4JV5F 3M32B 1BC6A 2K7JA 3MCSA 4A8QA 4ECSA 2JJ4D 2GMJA 5DG7A 4KIAA 2OLWA 5KFIA 1YIJS 1S1VA 1N4LA 1M5VC 3P49B 2JRSA 1FTRA 3I0RB 2ZFHA 4O3RA 4WE1B 2BE2B 2V4QA 2YNHB 2J9DE 4O0IA 3FZ2A 3R1LA 3RYLA 1SQEA 1BQXA 1ZPVA 3DLGB 4J9QA 2ADCA 1GAOA 5IFMA 3MR6A 5KFZA 3MEGA 2O66A 3GFZA 4PXCA 1VRUA 2UVVA 5KFMA 1S0MA 1PILA 1UJ6A 2XCAA 2LVWA 3QGHA 2DH7A 1S48A 4B08A 3K5OA 3M8QB 4DR7F 2DT9A 4L3NA 1YHQS 1N5SA 2FLLA 4ZP6A 3DLLQ 5F0WA 3UDLA 3DI6B 3MHYA 2HYIB 1Z4UA 4DSIA 2XS2A 3MFHA 4OL8A 5A8KA 2CKWA 1SUQB 5DG9A 4EU0A 4U6PA 3Q8SB 3AH6A 2C42A 2XC9A 4NLYA 3G96A 3PX4A 1K0TA 4I67A 4A47A 4KB7A 2HHTA 1WF0A 3IG1B 4A8MP 2XGPA 3B78A 3KNAA 2A10A 2ZJRQ 2CPYA 3SSRA 1IBKF 1J5OB 3DYAB 1TK5A 2VFUA 1SH3A 4TU9A 4RNFA 3V6JA 3OBIA 4CH7A 4QWAA 3NBPB 1U24A 3D5MA 1IKXA 4IH5A 2B43A 4Y2KA 5BYQA 3FVYA 5L1LA 1PC4A 4DS5A 5D4LA 4HHJA 2KJVA 2XSJA 3DXSX 5GAHU 3J7A1 3VTIA 4F4KA 4OHWA 4WFXA 2B0GA 2OPQA 4NLGA 2HW3A 2R7SA 3DLBA 1JLFB 2M4MA 4Q5VA 1HQEB 2XZWA 4WXOA 2LQ9A 4ZLPA 1YGYA 3G8TA 2PD1A 3VALA 3KNGA 1Q81T 3QAUA 4ZOSA 5KFKA 4FBTA 2PI4A 4EZ6A 1TZ0A 2MZTA 1WTBA 3FSYA 3I87A 1HD0A 2LLZA 4H4MB 3PR5B 3KTQA 1XC9A 4JI4F 1L3SA 3OXFA 2MKHA 4TN2A 4F2SA 4DX8H 2QE5A 1F2GA 4MFBB 4FS2A 1VHFA 2LA6A 4C8LA 2MJNA 4J9RA 1Q79A 5C25B 3IGVA 3ENQA 3HVTA 3DLHA 2NR0A 2L3MA 3PEHA 2D74B 2PA3A 4RW4B 3DLKB 3CGIA 1XERA 4H4OA 2AJFE 2FHJD 2C3UA 4PG8A 3VCDA 2ZH2A 3DDKA 2LXUA 4H4KC 4ECQA 4DF8A 2N3LA 3T1HF 3RAQA 4PPDA 7FD1A 2DNGA 5J2NA 3WZ0A 2JC0A 2JLEA 3BN7A 1BY9A 3GSDA 3I5BA 4NCGB 3UPFA 4X62F 1D9DA 2FJWA 4UY85 4I2QB 5IM0A 2AX1A 3TAPA 3RBDA 2ZZMA 5MLCV 1DFDA 1XK8A 2DNPA 2DH9A 2IYIA 2ZOGA 4PG6A 4R0EA 2PI5A 4CO1A 3CD6S 5GADU 2HFOA 4DR6F 2YKAA 5KFRA 1XR6A 2I38A 4KT0C 5HQ8A 2HFZA 1T03A 2X1AA 1GX5A 5HL7Q 1URNA 3HI9A 2J8AA 4HLBA 4NLTA 3DRPB 4RW7B 3BSCA 1QAXA 3Q0AA 2M8DB 2ZNZA 4RNOA 1QSYA 3BF4A 5C42B 3BGRA 2DGUA 2J0QD 2MQPA 2F40A 3VF0B 3KK3A 3MUVP 4KGKA 3R27A 2J7UA 2IC3A 4RUAA 2AX0A 1J2VA 2E5GA 5E5NA 1LXNA 4QBUA 2R2TA 4MMOA 3KJVA 3MD3A 3MEDA 2CQGA 2UVUA 4LF5F 2OPPB 2KT3A 4OJHA 3QZ8A 5EX0A 1P27B 3SMZA 2P9GA 5I3UB 4OI3A 2M7SA 3AQOA 4BC7A 3CC2S 5KFVA 3TARA 5KFDA 2CPHA 2LEPA 2MZJA 3UDCA 2HIQA 5KG4A 2N4CA 2GQQA 1X4CA 4IKAA 1VBXA 4C11B 3MM8B 1U8SA 5KG6A 5DDPC 3CIMA 4ICLB 2QA1A 3CEDA 4X4TA 1KLMA 3AJ1A 4MKAA 4XPCA 2V2KA 4EEYA 4KGMA 3VQSA 3UNGC 3G8SA 2KHCA 4EWTA 5FDLA 3C6UB 1IKWA 2XY7A 4IOCQ 4B9MA 2RRBA 4URSA 5KTQA 1HNXF 3PJXA 5DM6Q 2IVMA 4QW9A 2RILA 5H1SV 5JUMA 2MQOA 3C66A 3H25A 1SV5B 4I7FA 3TUZC 3HHKA 3PRBA 2VC0A 3PJWA 4A8SA 2KFNA 4CNZA 4IO9Q 1YTYA 2HLTA 2GJIA 3LGMA 3CF5Q 3NAIA 4ED8A 4BWJA 2ERRA 2OD4A 2CQ0A 1S9EB 2ZE2A 3V4MA 2ZH8A 4ZPDA 1TL1B 4A4JA 5B0DA 3DXBA 2KG1A 2QRRA 2MHEA 2QIFA 4KFBB 3UW1A 1MROA 4A8KA 1FKOA 4I2PA 1JJ4A 1R8HA 1WELA 1NNDA 1MSWD 5GAGI 2ZKUA 5KFQA 2EI5A 5THWA 4HH0A 4NX9A 1RT2A 3BO3A 1Y00A 3G86A 3HHLD 3UWTA 3ZZTA 1UVJA 2VG5A 5A8WA 4TU8A 2ZITA 3ISND 3PX6A 2FB0A 2XMWA 1IJFB 1S79A 4WKRA 3KHHA 4MK9A 3OLAA 4AL5A 2EFVA 5K9FA 2D3OR 2M5YA 1VRTB