1RJJA

Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
MATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVVATP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords expressed protein
total genus 17
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rjjA00
2GFFA 1AW0A 4NL5A 3KKFA 1YJRA 2XMJA 5T7LB 2OFHX 1MWYA 2N7YA 1GXTA 1Y3JA 2GGPA 4A47A 3HDSA 2IYIA 5B0AA 5B0EA 1TUVA 1FD8A 5B0FA 1N5QA 1Q4RA 2LDIA 2AP6A 2ROGA 3LO3A 3MZIA 4OJHA 2GGPB 4HI2A 2VV5A 1S6OA 3T9NA 5A6PA 3BR8A 1Q53A 1W2IA 3MCSA 2GO8A 2AJ0A 2PD1A 1N5TA 2KKHA 3DCAA 3CJKB 4NPOA 4Y2KA 4DL0C 1KVIA 1VQSA 3HHLD 1X0PA 1SQEA 2BUNA 1OQ3A 3UDCA 2AJ1A 2XMKA 2OD6A 2BYCA 3HX9A 2K7KA 1FVQA 4OJ1A 5K9FA 1KQKA 4QOTA 5F0UA 1YRXA 2LQ9A 1Y3KA 2XMMA 1JWWA 3IWXA 2K2PA 2VH7A 3BM7A 2GA7A 2IYGA 5T7LA 3CJKA 1FESA 4HI1A 1IUJA 2XMWA 5F0WA 1XBWA 3BB5A 1X8DA 2HFOA 1R6YA 4ZOSA 4DN9A 3HHLA 2HLUA 2K1RA 3KG1A 2QYCA 2QIFA 1SI9A 1TR0A 3BGUA 3K7RA 4YDXA 3TOQA 4A46A 3TRGA 5B08A 1CC8A 1S6UA 3QGPA 1QUPA 1N5VA 2FB0A 2FHMA 4HH1A 5IXUA 2RMLA 2ZDPA 3DXSX 3FGVA 2KT2A 2OKQA 2ACYA 3I9ZA 1WD6A 4Q2MA 4ZA1A 2OD4A 1TZ0A 1YJTA 1FEEA 2OMOA 1AFJA 3LGMA 1LQ9A 1P6TA 4OJ3A 1K0VA 2XMVA 1JK9B 1Q8BA 3FRYA 3HFKA 2RU9A 3HHLB 2HQIA 1FE0A 2N4DA 4A48A 4EFAC 1AFIA 4U9RA 1CPZA 4A4JA 4F67A 2OAUA 3HF5A 1YJVA 2JDJA 4DPOA 5A6WA 1VQYA 2QLWA 3WDOA 1YJUA 4Y2MA 2K7JA 1U7LA 1ULRA 3F44A 1CC7A 2W4DA 1KVJA 2BBEA 4FNIA 3BN7A 2W4PA 2K1RB 3KNGA 1FVSA 3QMQA 2FIUA 1X7VA 2GCFA 1Y0HA 4YEAA 5KAKA 1N5SA 2HFNA 5B0BA 2LQBA 2ROEA 1TL5A 2ROPA 5B0GA 2IFXA 3VTIA 1OPZA 2N4CA 3IWLA 2XMUA 2OFGX 3KG0A 4HL9A 2RILA 2AW0A 2W4CA 1APSA 4OIXA 1GXUA 2CRLA 2ZDOA 3BF4A 4HH0A 4Y2IA 1OSDA 5B09A 5B0CA 4Q2LA 3GZ7A 2HLTA 1P8GA 1URRA 2Q3PA 3E8OA 1MWZA 1OQ6A 3TNVA 2BJDA 1YG0A 2RSQA 1SB6A 1FE4A 1TL4A 2GV1A 2BJEA 2EW9A 2KT3A 3FMBA 5B0DA 3BDEA 2HIQA 2LXFA 1Q8LA 2OP5A 2G9OA 2FTRA 2KYZA 3LGNA 2ASYA 2PGCA 2L3MA 4OJGA 4FNHA 2QLXA 1Y9OA 2XMTA 3HHLC 1V3ZA 1RJJA
chains in the Genus database with same CATH superfamily
3IMQJ 4UUWA 1VK8A 3MR3A 2DCUB 3EGNA 3KJVA 2IA6A 3CGIA 1RAOA 4K0KF 2VG6A 3R7BB 3VWSA 1MWQA 2IRXA 4CWBA 2HFSA 4PEOA 2C3YA 4QR2A 4J9QA 3TEGA 1HQEB 2VG6B 3MZIA 4PQAA 4YP3A 1DBDA 3GIMA 2DGWA 2D7SA 3IBCB 2I38A 5GMEA 1DY3A 2ZOMA 4DR2J 1FJCA 2Z2LA 3NBPA 3THTA 2DY9A 2D3ZA 5DG9A 4CCHA 1D3WA 2KT5A 4CM2A 3N5BA 3IG1A 2J9DA 3NGUA 1X0PA 5DZ7A 2BDPA 4K2XA 4TU7A 2OHDA 3SQOP 5DDOC 1HBUA 2I1RA 3B54A 4FN5A 1G3OA 1ZYQA 2VPWB 4NMLA 3DKDA 1MNEA 3UW1A 2R2RA 2IM3A 4M8LA 2V94A 2P9EA 2MZTA 3PVXA 4NXMJ 2KB2A 4F26A 3GYGA 3MAQA 4JI3F 2V50A 3R5BA 2XS5A 3HVRA 2VQEJ 1D1UA 4X4UA 1TFYA 3OL8A 4ANDA 2CAJA 1QE1B 1HPZA 2OEKA 2QX0A 4R0JA 5LSRA 5LMUJ 1PGZA 1T95A 2Z57B 5KFOA 4PXEA 2HK3A 2LKZA 2UUWA 4M5IA 5L1LA 3MMAA 5J2MA 4JI4F 3NNCA 1Y4ZB 5CYMB 8ATCB 2IMWP 3PKMA 2LQ5A 2YX4A 5A8WB 3G8QA 1ZM2A 1KVKA 3AD8C 4ZPDA 5KFLA 5L39A 2UUCF 2Z0GA 1JLGA 3I9ZA 4ZVUB 1FF2A 4JI7J 1TVRB 1DFDA 1FRHA 1XIQA 1TP7A 4DOZA 5A8WA 4IOCQ 1SKSA 2UUBJ 4DSLA 2LEBA 1P6TA 3DLEA 1EP4A 2W9CB 3BSNA 1AB8A 3NAIA 3OXLA 4LSNA 4B9MA 3U7JA 3PG9A 3NXZA 5I4MA 4FYYB 3FEYB 1KR4A 4USIA 5KFAA 5DQIA 1LWCB 3F73A 4F50A 1Q16B 4P2SA 3B4MA 3Q89A 3OJUA 1HI0P 2XG8A 2CJKA 1VQMS 3WDOA 2QLJB 3IN5A 2NREA 3ZZRA 3IM8A 4B9NA 2FLOA 2ZHBA 2VDHA 1TFWA 1WDDA 1HHTP 3G9CA 4FNIA 3V5RA 4YEAA 2J0WA 5L8RC 1IBKJ 3BYPA 2GMLA 1RP5A 4CLYA 5B0BA 2ROEA 2ROPA 4KRWA 2E1RA 4NLVA 3PW0A 2JL9A 3ZTQA 4CT8A 2GJ2A 4RO0A 1WC0A 4ZP8A 2EC0A 3TX0A 4KR0B 3Q24A 4ED7A 1UFKA 4WXOA 2E1CA 3MXHP 1RA7A 3TANA 2CVEA 3LPYA 4G6VB 4OYAA 3L7UA 4EU0A 5EGYA 2H5EA 3I4PA 2J7WA 4IG0A 3M05A 3ZNUA 5IS2A 3ILOA 1C1CB 4OHZA 3DRXA 3GR1A 2CKWA 1SIWB 2CZ4A 2DNQA 1QM9A 5IQ6A 4DF8A 1FJEB 3KJFB 4G1PA 3W2WB 1RTDB 3EE3A 2GVDA 2F3JA 2R7OA 3HFVA 2K3KA 2OMLA 1KN6A 2LXFA 3CJ3A 5KFXA 4ZPVR 2VA3A 3BYRA 3BSAA 1QAJA 3I31A 3WC2A 5D4OA 2G0IA 1NK8A 5F8HA 4ER8A 1FERA 3QRRA 1VRTA 1F5AA 4ZHRA 4DPUA 2AJ4A 3JQMA 2A0FB 1BLUA 3QO9A 2HPUA 2CYYA 4EO6A 1F0XA 2GS8A 1VQPS 3PJ9A 4LF9F 1Q7LB 2LCWA 3C8YA 2GQQA 5T7LB 5KFCA 1XQIA 2FJEB 1UZDA 1Y3JA 2ZC3A 3HSDA 3RGIA 3RU0A 1I94F 1BQMB 2H4WB 3M8QB 2HFZA 2KHDA 1XR5A 3W64A 2I5JB 4DR1F 1UVMA 3G87A 1KONA 1S1UA 4OZNA 3LO3A 1T8EA 3I4HX 1NK7A 3C15B 2VV5A 2QGFB 5ETPA 1YJNS 5CD4H 4WK3A 2ZWOA 2L9NA 3FCWA 3SXLA 5C25B 3MM7A 1BWVA 2AJ0A 1L3KA 2GO8A 2ZUAA 4KPCA 3CJKB 3GV7B 3IM9A 1OO0B 4IDKA 4HACB 4NCAA 1VQSA 3JXOA 2E9ZA 1YHQS 1KVIA 2P6TA 2RHSB 4LRCA 4ATNA 1NAQA 2GNKA 2B3TB 2VFSA 1G7CB 2UVWA 4K4UA 5J2QA 4OLOA 1JQGA 2BYCA 2RNEA 1R0AB 5CABA 2W7OA 3OFHA 3A3NB 4LREA 4CH1A 2J6SA 3GV5B 1N33J 2HHVA 3M8SA 4Y00A 2F4VJ 1KD1T 1IR2A 3K0JA 2ASDA 1FWPA 1WOOA 2X7IA 1D9AA 5F0WA 3TVKA 4ZLNA 5H9FK 3MR2A 4DN9A 2IA0A 3M2VB 2D3UA 3MTKA 3MPUB 4YDXA 4O3SA 1RHKB 5ETOA 2WVEA 3NNHA 3CCVS 1LWCA 4PXDA 3SV4A 4ERDA 2D9PA 3CCZA 4K59A 1EB0A 3W2VA 2PFFB 4HH1A 2AJFE 1UWBB 4UOCA 4WIIA 2YWEA 3CMQA 4ECUA 1SVDA 4YB7A 4NCBA 2W2MP 4ZVFA 4CZCA 5F3ZA 3PACA 3WX4A 2VIHA 1U0HB 3IA0A 3GCWP 2BKNA 1RCOB 2KRBA 1CEZA 1AFJA 2HQFA 1X5OA 3EGVA 3X3UA 1C1BB 2QA4G 2MYFA 1Q8BA 3FRYA 2FJWA 2AHOB 4I7FA 2J7UA 1RT3A 3I0RA 1U0HA 4RNFA 5EWFA 4C8OA 1CBKA 2KVQE 3I0SA 3FJ2A 3DYAA 3SSRA 3HMJG 2G2ZA 4QYZJ 2BJ9A 4DFJA 4F67A 1YBUA 3GWCA 5HROB 2AWZA 4DQSA 2HS4A 2APOA 3DN9A 4K4VA 4LFBF 3R6LB 3K58A 4I6WA 3Q23A 3BO2A 5DGAA 1EKRA 1MLAA 3NS5A 4P52A 4EWTA 5ETVA 4C6AA 3FRZA 3NGRA 1X7VA 3JB9k 3ZZZA 3Q8PB 1VI7A 1KOHA 1SXLA 1OPZA 2QA4S 3HD2A 3KG0A 2DNNA 1RTZA 2EFPA 1B3TA 2M7SA 4WFAQ 3PCOB 2IJNA 1KQSR 5B0CA 4PWDA 2DRBA 3IG1B 2HHWA 4KHRA 1CJUB 1RUSA 1FFSB 1H72C 2QL5B 4Q44A 2HQCA 3TNVA 4DL6A 1O8BA 1YG0A 2WVDA 1GMWA 2KN4A 3QBCA 3PW7A 1S76D 1X4FA 2GHWA 1VK3A 1FNOA 2XY6A 3D6HB 1K1SA 4NLUA 3SMZA 3MUMP 3KJNB 3GG1A 5LMNJ 1S49A 4J5OA 2NUUG 4KQZA 5HJYA 1VQ7S 1XMOF 1X4HA 4U7CA 2KG0A 2CJYB 4ECSA 1PJ5A 2GVZB 2YKNB 5A2QY 3FMWA 2B56A 2A2CA 2Z58B 1UPPA 3OXGA 5DJBA 2ZJQQ 3QLHA 3V6HA 4CIOA 3JS9A 1MSWD 5ETNA 4FYXB 2EFVA 1HARA 2RB7A 1PYOB 4OYMA 5E3CA 1HBNB 5L38A 4UQGA 4ZLLA 3HLUA 1WORA 3UD5A 4BHQA 1TMMA 2KRRA 4DL5A 3MFIA 1N8RT 4ED5A 5M2UA 1WOPA 2QRRA 2ZFHA 2RS2A 2AEMA 3OR2B 1NSQA 2E44A 3UDEA 2PD1A 3AFGA 4DPYA 4CLPA 2C2RA 2LXUA 4DG1A 1IWAA 1O6XA 1Y11A 1UETA 1NBEB 2LDYA 5HVGA 2GW8A 3M2VA 4HT5A 4DUYJ 2C1EB 1R7IA 3MI7X 3V6KA 1GH8A 3OSPA 2RQ4A 3W5YA 4NLRA 2ZH3A 4JI0F 2YNIB 4JBCA 4MMOA 2VQFF 5IWAF 2YWWA 1OYEA 3TA2A 4L3NA 1SQFA 3IO1A 3IWXA 3R5JB 3UCGA 2FVPA 2UP1A 4LF8F 3BM7A 4FYVB 5E5NA 1DRZA 2IYGA 3MCMA 1I94J 4ILLA 4C8ZA 2EWHA 4K50A 1N54B 1IUJA 1I1GA 1YZ7A 3F56A 4DU7A 5D6GA 1WF0A 2BJ7A 1VC0A 4B3MF 4K0KJ 2K1RA 1CPZA 1UFWA 2PT0A 4LR9A 2QYCA 4X62F 3CDUA 4A8YA 3TRGA 5KOWA 2EFOA 1DHMA 2FY8A 1N34J 3W60A 1Y5IB 4U7UK 3NGKA 3K5NA 1VBKA 3LWLA 2ZHOA 3OTOF 3PRVA 2RU3A 3UD3P 3R1LA 3CJ0A 2UXCF 2IPOB 4OI2A 1BC6A 1UJ6A 3CIZA 3AD7C 4ZA1A 3T5HA 3T1HF 1H2UX 3NMAA 1NHKL 1Y00A 2LECA 1RHMB 3WIUA 1G6BA 4CLUA 1AROP 2GAGC 3Q2SC 1EARA 1LW2B 5AJ3F 2DRAA 1K0VA 3AQOA 3N9UC 1IKVB 1ZZFA 2ILYA 4J7CA 4QIVA 1JLBA 3KUEA 3GSIA 2CQ1A 4A48A 4OFZA 1QSYA 4JP8A 2CNKB 4P2FA 1TAQA 5LXRA 2GZOA 1TL1B 1GX6A 4Y65A 4PG4A 5KFZA 4A4JA 4J9RA 4DV4J 3ZZPA 4DPOA 3EM1A 4I69A 1D09B 1SV5B 3AXKA 3HVAA 2UU9F 2U2FA 3T19A 2E7XA 3BBBA 2HBQB 5KG0A 1BQMA 2IM2A 3FEXB 3CD0A 1GMWD 3KNGA 3Q0AA 1A9NB 2XY5A 2E5LJ 6FDRA 4DFPA 2A6OA 5GAHU 3H5SA 3KLHA 2LQBA 1MN7A 4UOHA 5ETRA 2F65A 7FDRA 2YKMA 2FC8A 1TV6A 3C14A 4GMKA 3TJAA 3RBXA 2E1PA 4YUDA 5DGBA 2BRKA 1WC6A 1WHYA 3CD5A 3JYTA 2DO0A 4ECVA 2WVFA 3L95X 3WX8A 2CQ2A 3OFGA 2COLA 3Q8VA 1C4AA 1E6VB 3PO4A 4RNMA 3GE9A 4DV4F 4XTTA 3J80Y 2DXEA 2GIFA 2DH7A 1X31C 4J91A 1KLMA 2WSCC 1MWZA 1C0TB 1R8PA 2F63A 3NBPB 4A8OA 3GILA 4JI3J 1C4CA 3FKBA 1C0UB 1WF1A 4ZVHA 3CJRA 2RQMA 2ZZTA 2XB2D 4OV1A 3HK2A 4X4VA 3MMBB 3OTBA 5AE1A 1U8SA 2VBYA 4UOGA 1LW0B 2UXBF 2E5JA 1F9HA 2B51A 2HQGA 3CIMA 5HK4A 4NZ6A 2CPJA 2JFKA 4UT4A 1GFWB 1FWLA 2GO9A 2XMTA 2IVMA 2D9OA 5D4LA 2ADBA 4JI4J 3J81Y 2QE5A 1UVKA 3LUYA 1JLEA 4NZ7A 3PKYA 3KJQB 3PHEA 1F5CA 4ICLB 2DH9A 2XBPA 3MFHA 3MECA 3UN2A 2ZBRA 4P74A 3KHRA 4ECYA 4H4OA 2IYIA 1RBLA 5EDWA 1RCXB 1UEVA 2HVEA 1N4LA 3V6DB 3MAHA 2XWXA 2LDIA 2ROGA 1W26A 2NSBA 1FK9A 4CLWA 1SUQB 2HHSA 2OELA 3KDOA 3CCQS 1WUUA 3OHBA 4DSJA 3U1LA 2AX1A 3I5AA 1HR0F 1N5TA 1HNXJ 5LT5A 1HNWJ 2W8KA 3C3LA 1DTTA 4CH0S 5KFQA 3M8PA 3JSBA 1SH2A 1NSPA 1C1CA 5D0RA 2MHEA 4ELVA 2AJ1A 2P9GA 1LK5A 2DB1A 3NCRA 4CTAB 3W2WA 3ZC4A 4ZMMA 5J2NA 1HBMA 4UZBA 3KLEB 5SUHA 3T41A 5A8KA 2ZH6A 2HIYA 1XNQJ 5K8MA 2HEKA 1NDPA 3KJVB 1ZZNA 2W1BA 3BKUA 4YQWA 4DV6F 3SZ2A 4DV1F 1WOSA 3JSRA 2K2PA 4KC5A 1LXJA 1JLCB 5E3RA 2EK6A 2WONA 1VBZA 2XZTB 3J80U 2C2OB 1MU2A 4Z7CA 4LFAF 1ZAWA 2HFOA 3EXYA 1DLOA 4WE1B 1SIZA 5HMWA 1KSPA 3TARA 1URNA 1XNQF 4USVA 3BGRB 4WP8A 2CDRB 1IKYB 3BGUA 1ZM3A 4A46A 4EZ9A 2UXBJ 5LOQA 4K4XA 3KK3B 1CJKB 4DS4A 3R7SB 1T9YA 3MAAA 2RQCA 4HHHA 3U02A 3D3CJ 4ENOA 4WYLA 1O51A 1UJ4A 1HR0J 1S1UB 4ZK7M 1WD6A 4QR1A 3KK3A 3C6TA 2M88A 4ZP7A 2R7TA 2NYHA 2R7WA 1N88A 3PDNA 4N7TA 2JEFA 1F1BB 2H3EB 2M0GB 2IY5B 4LIWA 4B3MJ 1LWFA 4DQPA 4QIEA 4FF3A 1N0UA 3QFWA 2XYGB 3LALA 3MMCB 2YKMB 4ECXA 1U1RA 2J6UA 2F4VF 2CPXA 3H42A 2D3OR 5D0HA 4F0HA 1RA6A 4FBTA 3DM2B 4HTJA 2DHSA 1NH8A 4IFYA 4J9UE 4CYUA 4K4YA 4GC7A 4TXSA 3PW2A 1TELA 5D3GA 5IM0A 1EETB 1ULRA 2IIHA 3F44A 4Z7YA 1UVNA 2HHXA 3MM8B 2HMIB 2BBEA 2BW2A 3BN7A 3CO0P 3FFIB 2VFVA 2D3O1 1VBXA 2QA1A 3OJSA 1NKBA 1GQEA 2OO4A 3CC4S 4JI1F 4JV5F 4I67A 3POTB 4QJVA 1QTMA 2V34A 2N3LA 1ELOA 1UMJA 1REGX 3PX0A 4PZVA 1FD2A 1S1TA 2R8GA 2BA9A 2EG1A 4JI6J 5BR8J 1K1QA 2RT3A 2JOQA 3VAGA 4MKBA 3MR6A 2BOAA 1RWOB 4P72A 1P8GA 1SC6A 1EKSA 2IAJA 1B0VA 2CIMA 2B5JB 2XHWA 4NOHA 3LP2B 2FPHX 2IBKA 2V9WA 4ILMA 1H3DA 4FZVA 1T7PA 1SB6A 2J0XA 2GV1A 4U96A 2KL8A 3HJVA 4GRSA 4ZVRB 1E6YB 3NP5A 5BR8F 4KAIA 1UJ5A 4RUCA 4P75A 4LRFA 1RACB 2IVFB 1Y9OA 1SL2A 1RHQB 3I0SB 4L72B 1PILA 2KYXA 2DNZA 1SC4B 2PMHA 1T9XA 2VPZB 5CQGA 1U45A 2JJ4D 3R7NB 3OLBA 2P5VA 2XMJA 3DRRA 5I42B 2GAHC 1S0OA 2M8HA 2OFHX 3CC2S 2WBRA 2YNGA 4IRKA 2HHHJ 1D8YA 3KNAA 1RT4A 4PYDA 1IKWB 3F41A 1U1NA 3DOKB 2HKEA 3CCES 3C66A 5I42A 1HNVA 4QWBA 3CCJS 3G82B 4YMEA 4CQ1A 5HVHA 1SJ4P 3EVMA 4OI3A 3PHTA 4RW4A 1M1KT 4RW8A 4IYQA 2KZMA 2FGCA 2VKRA 2MKIA 2MZQA 2YQ1A 1KHVA 3AJDA 2KHCA 3OTDA 1DAXA 4ZKAA 4O3RA 4V19X 4WFNQ 4NPOA 5F9NA 2E1MC 3DRPA 4QIFA 2YWHA 2RE1A 1KEKA 3HSZA 4MK7A 1VDHA 4MYTA 4B9UA 4QYZK 1B7FA 3UDLA 1BMQB 2KU7A 2Z2MA 1NSAA 5I3PA 5K9FA 1H73A 1AXQA 3PIPQ 4DUZF 1KQKA 2VB6A 3IR7B 2LQ9A 1OPIA 5KT6A 1TL3B 3ZZ0A 1IWGA 3L7PA 3PYGA 2KH9A 4DV7F 5HROA 4B9LA 2O66A 1RAFB 2VH7A 4I2PA 1RTIB 3UR3C 5E0OA 3A3OB 3MWBA 2LVWA 1HW8A 1HIYA 2XZWA 1GNKA 2DNLA 2WB1D 2Y3YA 4X65F 2L41A 3GB0A 3QSYB 3KG1A 2HWHA 1K8AT 3CDBA 5DDPC 1KTVA 3DDNA 2NS1B 1JLAA 3PRDA 1LOUA 2GIQA 3KG4A 4C3LA 5J1EA 3T5KA 3TUPA 2YNHB 3B8HA 3QT7A 4JUZA 3LH2S 5IM0B 5DQGA 2WOMB 3M2RA 3HM9A 1N52B 1YJTA 1FEEA 3CSKA 3J7AN 5HMZA 2HVZA 3PFOA 2JFDA 3Q8YA 5CYQA 1H7XA 5A0YB 1LQ9A 2QMUB 2FZKB 3UI3A 3BDPA 2KZZA 2B6AA 4KO0A 5CZXA 1ITPA 4FF4A 2FJXA 1S72S 3OXFA 1U6ZA 3BZQA 2C3OA 4KV8B 3DLKB 3ULHA 1BE4A 2ZOGA 3A13A 3CD7A 4DCPB 3MCNA 2UXDJ 3HD1A 3CUNA 1S97A 3AD9C 1X4BA 1CJVB 1YJUA 3RBZA 4USKA 5T41A 3SCIE 4LMZA 1X4EA 2ZH5A 2CNLB 2DRDA 2B5JA 4H4KC 5KT4A 2G2OA 1FVSA 1SC1B 2E5GA 3O1LA 1UPMB 4H4KA 3H98A 3JYTB 5JMNA 3LPEA 1PYTA 1FDNA 4I68A 4B3OA 2CQ3A 4LF6J 2V8PA 4N56A 2YKOA 1Q81T 2AW0A 1NO8A 1U49A 2PA8D 3MR7A 4M94A 2QFIA 5CA5A 2RDJA 5IOLA 2VHGA 2DGXA 5J2MB 2C22A 2AJ2A 4LUBA 3G6YA 3W61A 4LF4F 2ZEJA 2Q3PA 2HWIA 2VOPA 5F41A 3TWZA 3UPFA 1U47A 1OY9A 4NCGA 4QPXA 4YR3A 3RB4A 5ETMA 4DR6F 2VC0A 5FDLA 1YGYA 2WCXA 4HKQA 2VU5A 1RK8A 3UNYA 4ZDNA 4NYPA 1UZHA 2F8HA 1BQNB 3H8YA 4QQBA 4HDHA 4ED8A 4IO1A 3LGHA 5D4NA 4CLZA 2AJQA 3CEDA 2P2CB 1M1HA 3NKYA 3A8KA 3WIVA 2HFVA 3FSYA 3ONQA 3HCXA 4O23A 3IXQA 2IDLA 4IUFA 2KFNA 4PXCA 1RHUB 1WG5A 4UZCA 2HSEB 4YB6A 3VCDA 1RT6B 5M2PA 2JEIA 1GXTA 2LU2A 1XMQJ 4R5PA 2MZSA 3SSQA 4J9LA 3US5A 4LF5J 2AZ3A 1ACMB 5AXNA 2OJ3A 2V69A 1CJUA 2MQ8A 2Y1RI 1IR0A 2VBZA 3NAHA 4UQTA 3QNWB 4ZP6A 5IT0A 1N56A 4B3TF 4N76A 5C5JA 5KFRA 4GVBB 1BQXA 1HA1A 1VRUA 3VV2B 3GIIA 4IR1A 1W2IA 1WTFA 1MN9A 2ERRA 4F04B 2UUCJ 4E98A 2DXDA 1HPZB 1OY8A 1M5OC 1SQEA 1RWPB 3UDCA 4U67Q 5KFBA 4DSFA 2W2QP 2FHOB 3RAXA 4OYBA 2Q43A 2K7KA 3ITHA 4DR1J 4CDIA 4EZ6A 1SJ1A 3N6NA 2ZM6J 4CLFA 2W24A 4XK8C 3BEGB 4RL1A 2BZ2A 2YX1A 5K5MA 1VS3A 2GA7A 1IKYA 4L76A 3UFCX 2HNZA 1NEEA 1FEHA 1SV5A 2E66A 3ILIA 3IS9B 1YBAA 2ASJA 1UCNA 2JLGA 1TK5A 2VKZG 3QRPA 5K8OA 2XSJB 4W4MA 1HBUB 1S57A 3OUYA 2HNZB 1CG2A 2HRUA 5F8MA 1FWKA 1S6UA 3B82A 5C2CA 4YHHF 1PAEX 4PR6A 1R27B 4H4OB 1H2TZ 4MKYA 4C11B 4HR2A 4FYWB 5FD1A 4D3GA 4KHPF 3P6YC 4DLGA 2BACA 1RADB 1WKLA 2OMOA 4AL7A 1JKHB 3DRSA 3QGHA 2M9KA 4YR2A 5EX0A 3BH7B 2CPHA 4Q43A 3HP6A 3G6ES 1S1WA 4CNYA 2IRYA 5D3GB 2VBWA 2XCAA 4WWSA 4X4TA 3G6VA 1VQKS 1X5TA 2R7VA 4QW9A 3VZHA 1AFIA 1T9UA 4MT1A 4U9RA 4WU2A 4RWXA 4DL2A 2D69A 2HRYA 1YJVA 4CRJA 4B9TA 3D66A 4E8UA 4F3QA 4Y2MA 2K7JA 4G65A 4O3OA 5DDQC 2WRMA 4WCEQ 2AZ1A 4OHYA 5CH7B 2F9DA 2W4PA 1Y5NB 3ET6B 2XO7A 1U26A 3HZGA 3IGNA 3KUHA 2ZJPQ 4F4WA 1QY7A 5FIIA 4R8UA 1A7GE 4NI2A 2CWKA 4Q7AA 1IXKA 1A0OB 1HMVA 2V0NA 4NEZA 2Y8WA 2B9XA 2XMUA 4O0NA 2EC2A 2XSFA 4OZ2A 5GAEU 4J9PA 2K06A 3M8RA 1RXOB 1XJWB 3LWMA 1YJ9S 2FLNA 1HWLA 3C46A 2BQ3A 1H7WA 4NLWA 1WKKA 2WSEC 3BGRA 2DR8A 3G96A 4OZ0A 2HBZB 2MSSA 3SCKE 4X66J 2XULA 3GJRB 2CQGA 3HKWA 3Q8SB 1CJKA 3PX6A 2BOPA 3BV8A 4WYWA 2W8LA 4JV2A 2U1AA 1JXLA 2MJNA 3MEGB 2C3PA 1XEZA 4EI2A 4WIQA 2BJ3A 1BHNA 4Y2AA 4BC9A 4Q5VA 1NKCA 3M2UB 2GJIA 5CAAA 2AGQA 3VALA 3KMSA 2DGTA 4OV6A 1H6KX 3DYAB 4WF9Q 2V2KA 2L3MA 2XYPB 1K73T 4M5KA 2GIRA 1R0AA 3M32B 3TAPA 2ZH1A 1H2VZ 2HZCA 3M7VA 1FJGF 2ZUGA 3O44A 2ZNZA 3M8YA 1AZSA 2C42A 2OEJA 5CYJA 2AEJA 3W9HA 2MTLA 5H9FJ 1FRXA 1YKWA 1LFWA 1NMEB 3VQTA 2EKYA 2IRUA 4ZCKA 1EIYB 3PW5A 2MLXA 1SH3A 3GSDA 5LM7E 2ZBPA 4LF5F 4R0EA 1LKZA 2DEIA 2YNHA 5HSPA 3V6JA 5D0GA 5CXTA 3N79A 3AB4B 4PPZA 1S7IA 3KLVA 3TI0A 1OJ4A 5ETLA 5AE3A 1S10A 1IBMJ 5GAHI 4K4ZA 2EFQA 1D8ZA 3MOZA 1J5EF 4DL3A 1V6HA 4DU8A 1H98A 1FFWB 2BABA 1C0UA 2MPUA 2O3DA 4DL0C 1HFEL 2FHJD 1VCTA 3HHLD 3HHKA 2R8HA 3IRXB 3K8WA 3MDFA 1OQ3A 3CCMS 4NLDA 3EPGA 1T9VA 2PI5A 4OYIA 1VHFA 1FTCA 2R4FA 4LSLA 1BGXT 2A3JA 2LEAA 4RLEA 3CXCR 1V3SA 4NLPA 5LMUF 3TX8A 3I6PA 2MGZA 1B70B 1PIEA 2KM8B 4OX9F 3RAQA 3OW2R 4M5MA 4CYUB 3ZTRA 4Q45A 1Q1KA 2EFNA 5KT2A 1QVFR 1G2EA 4ZPCA 4B9SA 3BN4A 5LJ3Y 5L1IA 5KT5A 1XBWA 2OSQA 4QU6A 5LSLA 1R6YA 1FRMA 4O4GA 2W9AA 3EYZA 4FXDA 1SBRA 2D1CA 1JJCB 1KFDA 4NA3A 3W9IA 1T05A 3M6WA 2PMZD 3SBMA 3H5YA 4YS2A 1GEHA 2GMJA 4NWBA 4DLEA 1OS5A 1X5PA 2FB0A 1NLKL 2KVIA 5MAOA 2QFJA 4OI0A 1KS2A 3M6UA 4MH8A 2VZ9A 1YITS 4B3SF 1RAGB 1JNZB 3RJMB 4X4RA 3TYTA 2ACYA 1S1XA 4MKVA 2XQCA 5JVGQ 5CCLA 1WG4A 2MQPA 2R2UA 1N6QA 1HD1A 2E1AA 3LGMA 3FUYA 1FRKA 2EK1A 3CW2C 5C2GA 3TJ9A 1FDDA 3PX4A 2WW8A 2KJWA 3JSYA 4L6V3 3WHIA 3HHDA 2DPIA 1QAXA 1Q8IA 3QFHA 1YQHA 3MM9B 3QPIA 4ZLJA 2GHPA 1KWMA 5IC6B 2FLLA 4TVAB 1D9DA 1Q8KA 1RU2A 2Y0SD 5BXIA 4LT6A 3M8WA 4RW9A 1QLNA 4NXNF 2ZD1B 3HSJA 4EGLA 2HBYB 4JI7F 2XGPA 1FXDA 4EMDA 5B7WA 4F36A 1Y0HA 2HFNA 3M8ZA 1HLWA 4YHHJ 2FJBB 4MIBA 2YKAA 4F25A 2AKWB 4K4WA 4CO5A 1RTIA 2Y8YA 4NLQA 1Z1ZA 2MQQA 1U1QA 2CJXB 1T94A 4OYOA 2V68A 2BMBA 2ZH2A 5C7PA 1R8AA 4TN2A 2CRLA 1YJWS 5D77A 2XGQA 4M5DB 2ZH9A 4LFAJ 3D6TB 3LOUA 2GQCA 1RTDA 4C9DA 3HT0A 2CQCA 1DZ5A 1VQ8S 2MDAA 1VLOA 2E7VA 4ED0A 4TY8B 3IWNC 4DQQA 5KG5A 2DR6A 1KKHA 3CT9A 3D67A 1X4GA 3GQCA 2V4JB 2B9WA 4G1QB 3GFHA 2KYZA 4OJGA 2ASYA 2ADCA 4BCAA 3N5FA 2GC8A 2A10A 2VJUA 1S1VB 4N5SA 2NXCA 3WBZA 3W9JA 4R5PB 2GFFA 5AXKA 2FHJA 3VVTA 1RWWB 2EEYA 3DOLB 3HULA 5JUMA 2AYMA 3QGGA 1EJ7L 2A6MA 2C28A 1KTQA 2CADA 4X4SA 2KTQA 4L3KA 5B0EA 1VQOS 3ZO7A 1JXEA 2V2ZA 5LL6d 5CZVA 3K5PA 3A3PB 2MQMA 1F9FA 1S6QA 2JC1A 5B0FA 3KLHB 8AT1B 4B3OB 2BV3A 3PJWA 4OQJA 2NR0A 3FCVA 1PAUB 2MSTA 3ENVA 3VZIA 2XLIA 4WBFA 4UW2A 2MGZB 1DARA 1NHVA 1U09A 1DTQB 1HBOB 1FTRA 5J1EB 3SI8A 1PSDA 2GVZA 2P6SA 2YKNA 3QAUA 2KKHA 4XO0A 2M4MA 1TVRA 3UNGC 2BANA 2VG5A 3IBFB 2NXUA 1RKIA 2FQQB 3MURP 5DM6Q 3VAHA 1WSRA 3MEEA 7AT1B 1N5YA 1U2CA 3MCOA 4DR5J 2HVDA 3RBDA 1BXNA 2IJFA 3KLFA 4BLGA 4Q0BA 3GIKA 3MEDB 3D54A 1YRXA 3TP2A 2ZBIA 3QJPA 1FRLA 2BRLA 3R5GA 4IFVA 4GC6A 3PJXA 2XLKA 4DX5A 2OPQB 3RAMA 2I9SA 3D5MA 1UFLA 2FGOA 3KLIA 5C42A 4PQUB 4OZ5A 3DLJA 2NZ4A 3DGVA 1VR6A 3C2PA 3CDWA 1GXLA 2EPIA 3EICA 4KSEB 2M70A 4PG7A 3H4BA 5DQHA 2FJDB 3KLIB 4IRDA 3MD1A 1LW2A 2L9DA 2H54B 2F8MA 4GO7X 3W1YC 2O5DA 4ZVTB 1TR0A 3TOQA 3HJFA 2MKHA 3K17A 3N4WA 1CC8A 4DR5F 1RTHB 3P8BB 2PMWA 1U1KA 2ZZMA 2L08A 1ZA1B 3IRWP 3Q2TC 1JIHA 4U8VA 4AL5A 3B78A 3E01B 1CS4A 3DFEA 2DNHA 3RBEA 4KH1B 5LSOA 3HFKA 4RUAA 4DR4F 8RUCA 2LA6A 3OPKA 3PYDA 5IV4A 5HMYA 5GAGI 4URSA 4KE5A 1WEYA 3TVZA 2CQ4A 4OX8A 3D7SB 1IQTA 3RW7A 3J7YU 2N7CA 3C6UB 1XWLA 3IAM9 2ZWPA 4MTPA 4ZVGA 4J9VA 5ETSA 1QE1A 4JI8F 2CQBA 3ZZYA 3BPSP 4FS2A 3V81A 1VFJA 3SQGA 2EI5A 1F3VA 3FC9A 5HAOA 3B4DA 2RJZA 4LR8A 2CPIA 2ZE2B 4P10A 5E7OB 3VGSA 4P73A 3UN3A 4F02A 3H20A 1HW9A 3OLAA 1TL5A 3ADAC 3RZAA 2RUGA 1JLCA 4ES3A 1TKXB 2N4CA 2XNQA 5IFMA 3M4XA 4DUTA 4B3RJ 2B7CB 3N0VA 2QMXA 2ZE2A 4I1TA 3C16A 4JI8J 4KGKA 4QCLA 5CCMA 4HVZA 2J0SD 2M5YA 3A8IA 4AXJA 4LFCF 2BVZA 2B4UA 1HHSA 3GPAA 3E8OA 3C15A 5L9NA 5HL7Q 1M1GA 4YY3J 4RUBA 3GYXB 1HNZF 4CO2A 2RH3A 1U0SA 2BM1A 2W2PP 5GADU 2UUAF 1I6JA 9RUBA 3EX7B 1T02A 4C3KA 4C7QA 4F8RA 4C8YA 3C14B 5GVQA 3LP2A 2HGLA 4MK9A 4RWWA 3TZWA 3I9V9 3K8VA 1QUVA 3R6GB 4RW7A 4DHVA 1KRPA 3E2EA 4USUA 4MKAA 1L3VA 5HVFA 4C4WA 1H74A 1W25A 3D4JA 1SQGA 1WDTA 1XERA 3OVSA 2KXNB 4ZPTR 2HG4A 3UVJB 1FCAA 4DV0J 1TKZB 3UD4P 2DNMA 4IFYB 3MM7B 2AEFA 4BWMA 1H38A 2MLZA 1EQ0A 1AA1B 2VG5B 2LA4A 3GJTB 3M1VB 4JI2F 1VHIA 1EQMA 3ZFVA 3OBIA 3IGVA 4XPEA 3VAMA 4DQRA 4F4ZA 4PUOB 1T11A 3EZUA 3KWMA 1P9YA 5HQLA 1YRUA 4KGVB 2B9YA 1YBTA 2K8GA 4LF1A 4NLTA 4PXBA 4RR5A 1FO1A 2Q6CA 2MY8A 4DG1B 4NLSA 2FD2A 4UY85 1O5JA 2RF2B 1HQUB 1RHRB 3A8EA 3FQLA 3MM6A 3R8YA 5HMXA 3M9MB 3V4IB 1JLQB 3OL9A 1U25A 1XNRJ 1RT1A 3QT8A 3AOCA 5KFPA 3OSNA 1Q5YA 2FZCB 5DS7A 2E5IA 3M6XA 2VASA 3FBBA 3AH6A 5KFVA 1AYEA 4MK8A 1XR6A 1BQNA 5ETTA 1JLFB 2JWNA 4EBDA 4ED6A 4AUKA 3EWGA 3PTWA 3KTQA 2HHQA 2POKA 4QPTA 3FZ2A 4DFMA 1UWAA 2R7SA 4Y6IA 1Y3KA 2BE9B 3M2UA 4EK2A 3SV3A 1JWWA 3DI6A 2R8JA 4GO5X 1TL7A 1Y7PA 2ABYA 4O4GB 4ZP9A 5GMDA 1WACA 2OIHA 2ACMA 2RRAA 2MHNA 3HHNB 3CF5Q 2DCLA 3S8SA 3EPIA 4ECQA 1B64A 4FPRA 4AQYJ 4DR7F 4GKJF 2VJVA 5IV3A 3KLGB 1AZSB 1V5VA 4CP5A 4LRAA 3IP0A 4M95A 2BQUA 1Q5VA 1NK6A 5B08A 4F0KA 4OYPA 1QUPA 4IG0B 3V4MA 2CUYA 3DM2A 3BGLA 3T9ZA 2V4RA 2R7UA 2F5GA 2H5IB 2MKCA 2R8IA 1X9MA 4OZJA 2CQDA 5A76A 5ADZA 3T1YJ 1EETA 4Q2MA 1WHVA 4X64F 4YOEA 1IKVA 1IR1A 4P7TA 2XHCA 3NL0A 4PWDB 2JRSA 1RDRA 2CJAA 2OPPA 3I32A 4KHMA 3ZZOA 3Q86A 3MM9A 2RDDA 4OJ3A 5BJRA 2XMVA 2UXDF 1PC4A 2CJBA 2LQ8A 3H25A 2Q1LA 4DL7A 3AB2B 1FE0A 4ALZA 3K5LA 1Z2ZA 1T03B 9ATCB 1RWNB 1WC1A 3AOBA 2JVRA 2Z56B 1IM6A 3TUJC 1VQ9S 2F7VA 4I2QB 2RVJA 2CPEA 3L3CA 4OL8A 4TQRA 1S77D 3JAMU 1M0SA 1UVIA 2IAJB 3BSCA 3D1OA 4FKYA 2UXCJ 3RW6A 1R31A 2H51B 2B0GA 5D78A 3THPA 3AY0A 5E3PA 4DZDA 1LWFB 4A8SA 5B0GA 1MROA 4URGA 3IWLA 4PG8A 3G71S 2UU9J 4AL6A 2RILA 4F7VA 3J7ZT 3BBCA 4S0MA 3EVWA 5LXYA 4USJC 2R7RA 1HI8A 3RRGA 1NDCA 2VDIA 1QTNB 1S48A 5G4DA 3PXGa 2IVYA 2HLTA 1RI7A 2EKNA 4KGMA 3TAQA 4N47A 4DQIA 2QLBB 1OQ6A 3CDEA 1V5IB 2DH8A 2RSQA 3ENQA 4R25A 2KXFA 2V5HG 2XM3A 4PRFA 1YX2A 1WNEA 4DCOB 4RNNA 1Y5LB 4IFVB 5CYQB 2BE7D 2OP5A 4RUHA 2C2DA 3KOAA 1Q7YT 2OPRB 2ASLA 2DHXA 2HK2A 4LSNB 5EN1A 1RT2B 4CLSA 3NWRA 3PEHA 3Q83A 1MMDA 1NM2A 2HWTA 5L1KA 1GMUA 4KT0C 2BXJA 2H1YA 2J76E 2OPSA 4IG3B 3SDEA 3VHQA 5G0RB 4DEZA 1IKXB 3RRHA 2YKPA 1XTZA 3UWTA 2DR7A 2UVVA 1FA0A 4I4BA 4XPCA 3DRYA 3MEKA 4OX6A 4A8KA 2UUAJ 4TQSA 4USMA 1NDKA 2N7YA 4C8LA 1TKTA 2CPZA 1FDBA 2ALYB 2DD8S 4OYWA 3FSXA 1U2FA 3OVAA 2BJ1A 4ECWA 1VQ5S 3ENWA 3MM5B 2Y1JA 1IBLJ 2OI2A 1GT8A 2XYHB 3BREA 1P9QC 3ISND 1QVGR 5IC4B 4JI5F 3QRQA 2HRTA 4AXIA 1JB0C 2AQ4A 2CJQA 2AIRB 2ZBCA 2OUGA 2Y9HA 2SXLA 4C0OC 2CPFA 5BYRA 4C97A 4DWIA 2NPFA 1NDLA 3H59A 2F40A 5KFTA 5J2NB 4CTAA 1WTBA 2N3OA 1KNZA 3GYNA 5M2RA 2ALZA 3HO1A 1VRUB 4FXVA 3QZ8A 2O01C 4PPDA 1U1PA 1SL1A 4JOUA 2MB0B 4JYAJ 2XY7A 1KQGB 2IC3A 1VJWA 2ATCB 2HAFA 2QYGA 3AAWB 4KBIA 4Y3CA 5DLFA 4A8XA 4TKTA 3K59A 1NU4A 1RTJA 4Q8EA 3D0HE 1S59A 2XMMA 3KYLA 4NA1A 3RR8A 3D68A 2X51A 2P9CA 3J81j 3GR0A 3QLHB 4ILRA 2DGVA 3VAIA 5HQ8A 3O3LA 3BB5A 2YNFA 2MQLA 4CT9A 4X2BA 3I87A 1HBNA 3CMES 1KFSA 2FYXA 4JYAF 3KK1B 2JEGA 1FHTA 5HANA 1XMOJ 3QGPA 4EYHB 4GKKF 1VIOA 1WF2A 2DNRA 2ZITA 3DMJB 3EUNA 1HWUA 5K8PA 5KFHA 3CC7S 2QV6A 1DQ8A 3JTOA 3MPWA 4K5SA 3P49B 2JLEA 1K0TA 2IDEA 1NKEA 1JJ2R 3CCWA 1B7YB 1HKAA 2DO4A 2PA3A 3CTRA 4QWAA 3CJ4A 5RUBA 5C24A 2YH0A 2GQ2A 3VAKA 4GVBA 4C8KA 4Q8FA 4J9OA 2DKOB 2F8EX 4TY8A 4LF8J 3ISNC 2YKQA 2N4DA 3MTJA 1RAEB 2Z8QA 5KFSA 3SYZA 4EUVA 2G0CA 1ICEB 3JQJA 4NA2A 4USWA 4Z2XA 4DCJB 3N6LA 3HF5A 3K5OA 1O0PA 4QYRA 2KM8C 3EDQB 1D9FA 1FJ7A 1YJ7A 4K5RA 3TUIC 2VFRA 1RB0A 3DLHA 4JB8B 1EHWA 4ELUA 2FUG9 2FIUA 5KFIA 1EP4B 1ZBTA 4M5LA 4Y2CA 2ZJRQ 2FJVA 2G2YA 1T9WA 3CNQP 2RS8A 2HAIA 4FVMA 5BYQA 2VICA 4KFBB 4AFFA 2EBEA 1U2RA 4LF2A 5FJ4A 3HVWA 2W4CA 2CPYA 2PDAA 2P8IA 3OFFA 5DM7Q 5KFEA 3OTCA 3V6DA 4DPTA 5DETA 4ZS6A 3CJTA 3PR5B 4C98A 1URRA 1G1XA 1KP6A 1RYSA 1UKUA 2HNYB 4P2MA 1XMQF 5IT4A 1FE4A 2V8HA 2CZ9A 2W2NP 1EX8A 2ZVIA 4OHXA 4YR0A 1NJIT 2EW9A 2KT3A 2V6AA 3R3TA 4WTYA 3DLLQ 3CULA 1DTTB 1KQFB 2MXYA 4LF6F 1M5SA 2AV5A 2HQDA 4LQ9A 4AD6A 3TZZA 2DY1A 4OYZA 1N5YB 2PN6A 2DEJA 4RX6A 4C48A 4A8MP 4F2RA 2CVIA 5KFMA 4ED1A 1MMLA 1R0BG 1XK8A 3HHLC 4YFUA 4FXWA 1RAHB 1RT4B 2LU1A 3UR0A 4M5GA 3CDAA 4HYKA 3H5XA 3B6BA 2DNGA 6FD1A 1CLFA 4DR2F 4CI0B 4RW4B 4RW6B 2UZAA 2BE2B 1YDLA 1W2BR 2AMCB 2FC9A 1FRIA 4QWDA 3Q8RB 1QJHA 1N5QA 3GIRA 2J5AA 2D74B 1S9EB 1X4CA 5AXMA 3BQ0A 2OTLS 3O5TB 2GGPB 2MQNA 3QWPA 4FBUA 1RTHA 3W62A 2O67A 2DR9A 2ZKUA 1RSCA 4WFXA 3L09A 5KG3A 1UWBA 2QZ8A 1X4DA 3AOAA 2KJVA 3MCSA 5EWGA 1UA1A 2W2OP 2DGQA 2FVQA 2RDIA 3AT1B 1MU2B 1RT6A 1R0CB 3DC2A 3W63A 4K2JA 2F1FA 5I3UA 1U1LA 4LF7J 4ID8A 2X1GA 4K8RA 1I51B 3TAMA 5DLGA 1TL7B 5K14A 2WK4A 2OD6A 3AXMA 1R89A 3CE8A 4I7FB 4OJ1A 4O3NA 4EBEA 4LFBJ 1HNIA 3I5BA 5F0UA 2HGNA 3PO5A 2DNYA 2VL1A 5KFJA 1RLDA 1CULA 1ZAXA 2MEWA 3CJQA 3HKZD 4LIRA 3TEHB 4YDDB 4J9NA 3CB4A 5K14B 3RTVA 4KGZB 3CJKA 4WKYA 3CJ8A 1MROB 4WXWA 2HHHF 1FESA 2F9JA 3FK4A 4DJBA 2XMWA 4RJVA 4ZOSA 3DLGA 3CMAS 3FNNA 3N28A 5E2QA 2JEJA 1SC3B 1SI9A 1E6VA 3JQKA 4KHPJ 2CNOB 3NGSA 4G1IA 4IH5A 4ID5A 4UUXA 5KTQA 4QR0A 2MLYA 3ETMA 1Z4UA 3DDKA 1UVLA 4IOAQ 4LRBA 2PC6A 1C0TA 2RMLA 2K3IA 2V2QA 3FBCA 4KGXB 5LMNF 3H2LA 2LMIA 1X60A 2BANB 2W7AA 4J37A 2OD4A 5HP1B 1TU0B 2Y0BB 3W5XA 3FFIA 2HURA 3OT9A 3ET6A 3MMBA 2ZZNA 3PYEA 4KV8A 2R7XA 3HHLB 2GJFA 4C0BA 2RU9A 3DOMA 5K8NA 3KLFB 1RT2A 3G4SS 3S01A 1IBLF 4LSZB 4YY3F 2CWXA 3NNAA 2QSWA 3KK2B 2DR5A 2I2YA 3BKFA 2C2MB 4HT7A 4M5NA 3W2VB 5C42B 4X66F 4ELTA 3V2UC 4ICLA 1NPPA 2HNDA 4NZ0A 1R3NA 3W65A 5A6WA 2AYBA 2HHUA 1ZPVA 4U7UD 2R9LA 1CC7A 3LA0A 4PWWA 1KVJA 4ECRA 1VYAA 4FDFA 2ZOFA 2V8DA 3TJ8A 1PKUA 2H4YB 2VPYB 2HNDB 3DI6B 3OR1B 5ETQA 2VG7A 1GTEA 2MY7A 3CD6S 3HFZB 3R5AA 3FBFA 4E0DA 1RWUA 4N8NA 4QW8A 4DX7A 3GFZA 2WW4A 2X3GA 3MAAB 1AUSL 3AQPA 5F8LA 2BKPA 4ZVPB 2RIJA 2NXJA 3UCUP 1ZTWA 5F8JA 2MKJA 4EO8A 1APSA 3MHYA 3KHLA 3M32A 1SJ3P 1FX2A 3C6TB 1BUXA 3HHEA 5B09A 2XI2A 2YVSA 4QWEA 1L5UA 3I82A 1C1BA 1GK8A 1Q0NA 3C19A 1IQZA 4NYOA 1RWXB 4ZPWR 1GX5A 5FDLB 2RF2A 3HVTA 2DXFA 2AGOA 4DX8H 1NXIA 2YNGB 4LBIA 3SIPB 2BJEA 4FYDA 2E5HA 3N6MA 5B0DA 3BDEA 1B99A 2HIQA 3NOCA 4H4MB 1ZTTA 1VC6A 3DOKA 4DL4A 1XMBA 3LGNA 3LP0B 1QSLA 4LRDA 4DSKA 4Y28C 4RNHA 3MM8A 2HMIA 2WONB 3SQGB 1WEXA 2YX7A 1VMBA 3DLBA 2WBMA 4NRUA 5D15A 4ZIVA 3NCPA 1NZAA 3LP0A 5HATA 5MLCV 1AW0A 1TKXA 2J9CA 1RWMB 1CQNA 2PSZA 3MM5A 4DPWA 2EFGA 1U6FA 2ZD1A 4HHUA 1RBOB 2JC0A 1KC8T 3DMJA 3CCUS 3P3DA 4DV3J 2X1FA 3HDSA 2GHVC 4NEYA 1NB7A 2FLPA 1B4SA 3H7HB 3SFGA 3TA1A 1JXVA 1HL6A 5HQMA 3EMTA 1VQLS 4RBTA 5D8HB 1OMSA 2PO4A 4ECTA 3FCHA 4OMFG 4W90B 5IWAJ 2XNRA 1J5OA 4ZVEA 2AX0A 1CULB 4LJMA 3BR8A 4U8YA 5A6PA 4ED4A 3ETOA 4LVNP 3VTIA 3KHHA 4J9SA 4F4YA 2BKOA 3J81U 2UV8G 3NLCA 4KKOA 1RAIB 2DIVA 2WOMA 3M2RB 1ZA2B 3OD2A 4TY9A 2D41A 4JI1J 4JV5J 1RTJB 3DNCA 4MYUA 5KG1A 1G4CA 2OPPB 1A6LA 2B4OA 2C2NA 2VD3A 2WZ1A 1TKDA 3CJSA 3KDNA 1LWEB 1NSKL 3W8PA 1NJXA 3PFEA 1NK4A 2AYGA 2XTJP 4FS1A 4QOTA 4JV1A 5KFWA 1HWIA 1RISA 4I56A 3T5JA 3EDRB 1IBMF 4QIWD 2XCPA 5J2QB 3F0NA 1S1XB 3W5ZA 1KHWA 3M1VA 3NG8A 3DGPA 2RD5C 1X5SA 1CJVA 3MD3A 1T3OA 2W7PA 3GMGA 5A0YA 4DXLA 3IRXA 3G8TA 1IKWA 3BO4A 1P1LA 2OPQA 4OI1A 4IG3A 4ZPAA 3SDEB 3UE2A 2HYIB 3NWGA 1X9SA 1GAOA 4ZPBA 5HI7A 4BWJA 1ZOTA 1PYSB 2WB4A 1N5VA 2VPXB 1NK0A 1NPKA 1TV6B 2UUTA 1K44A 4Y0FA 1JLQA 3NY0A 3Q8QB 2HNYA 3MUVP 4B3SJ 2OKQA 3LANA 3EGZA 5KG6A 2DISA 2FDNA 2X1AA 1TZ0A 1WC3A 2QLFB 5DG8A 3R1HA 4TYAA 3U27A 4A8WA 5CD4A 1PBAA 3SSSA 1FKOB 4L75A 3HPOA 1CS4B 2HQIA 4NCGB 3IBWA 4NLOA 3S6EA 2XWYA 4D3HA 4P2XA 5THWA 3OL7A 2ZHAA 4C8NA 4HHJA 4CH7A 2XZDB 4ETXA 4ANEA 1WKJA 2IMOA 2KG1A 3QATA 4QIGA 1S0VA 1RT3B 4G3IA 2IC3B 2OPRA 2OGUA 2PFDA 3ELHA 3GFXA 3UO0A 2VF3A 5A8KB 3BPDA 2DGOA 3NRBA 1NUEA 2YTCA 1J27A 1RGVA 2K1RB 4LR7A 4O3QA 2Y1LB 1YWXA 5GADI 3HI9A 1N5SA 1WSVA 4ITSA 4Z37A 2W9CA 4X4PA 1GMVA 1N48A 3I96A 5GAGU 4B08A 4RW8B 3M9NB 3HZEA 2V63A 1TL1A 1ZM4A 4NYZA 4PG5A 2MQOA 4J90A 2PE8A 4OIXA 3J7Z5 1IVZA 1ZH5A 4ZN1A 3DRPB 4USTA 4F4XA 1X9WA 3IC1A 1UEKA 5EX3A 1FT8A 4Y34A 3DU6A 3S1TA 4DX6A 4FF1A 1UAWA 5F8GA 1WG1A 2DBBA 3HXMA 1L3UA 2HVIA 3BBFA 2ZBQA 3T6BA 2HZAA 3V81B 1L3TA 1N32J 3EZOA 1RT7A 4P6QA 4CNZA 2LYVA 4JI0J 1TL3A 2H48B 1U48A 1K9MT 2CNNB 3M8PB 4QU7A 2B8QA 5HBMA 3RUBL 2PGCA 4ZITA 2WSFC 1M5PC 3BGOP 1R8CA 3TQEA 5DO2A 3L7OA 2FHKA 2JNJA 2YPYA 1RJJA 2RKIA 1S0NA 3DLGB 5JJBA 1FRJA 4DV2F 2XS2A 2VBXA 5KT3A 2HW3A 3KKFA 2JZ5A 3NOGA 1FI4A 1CJTA 4N8OA 2DNOA 4X4NA 1P1TA 2QL7B 3KUGA 2NXEA 2HHPA 3IFEA 1NRKA 2GGPA 2M2BA 3JTPA 3MEEB 4WE1A 1I5OB 1LW0A 1JLGB 1CJTB 3FVYA 3GFYA 4OJHA 3VGUA 3S7RA 2B4VA 2VQFJ 2NUHA 5HLFA 5IT9U 1RLCL 1RZMA 4HI2A 3T9NA 4KFBA 2VONA 2A1BA 4CO4A 4A8QA 1NPRA 3KXDA 4TYBA 4U6PA 5I3UB 2MJUA 1RWVB 1TTHB 1H0HB 2BW7A 4J9MA 4DUYF 2BQRA 2HFUA 3DCAA 2MZJA 3DDIA 1S9GA 3M30A 4Y2KA 2J8AA 4QWCA 3D2WA 2QG9B 1N36F 1QAIA 1VISA 3W66A 2KFYA 1KBRA 3DLKA 3MM6B 3PM9A 3OR2A 3VGVA 1TUWA 3V4IA 1S9FA 2UVUA 2G1DA 3G2XA 2HBRB 2I5JA 3CJ2A 3ZTOA 1PC5A 1S9GB 2LEPA 3M30B 3VVUA 1UL3A 5E41A 4X4QA 2YPZA 1FK9B 5T14A 2YY3A 1VOMA 3CJ5A 5H9EK 3J7A1 1OY6A 2L9WA 3WQPA 1IJFB 2R7QA 5LJ5Y 5FLXY 2W9BA 3OR1A 3RG6A 1ZETA 1F2GA 4MFBB 3W7BA 3BJYA 4ZCIA 4DV3F 4DPXA 1T0TV 2YNIA 4NMXA 1R6VA 3OV7A 3EZ5A 1T05B 4UY8T 1HYSB 3DU5A 1Q82T 4TNOA 3MPYA 5A2QU 4ZJOA 2HS0A 2R8KA 3H5UA 2FVCA 3IR5B 4USHA 2AU0A 3K7RA 5JVHQ 3R2DJ 4X64J 3DRRB 4OZLA 3SFUA 3UDVA 4LBHA 3T1HJ 2XLJA 2CFXA 3TVYA 4ANCA 5HP1A 3QGIA 4PUOA 4WP3A 4IH6A 2IJRA 3DXSX 3O8WA 1KLNA 1HI1A 3K2YA 4KH0B 4CM0A 3PNIA 4BC7A 3LW5C 4CO1A 1J5EJ 2WVCA 1P27B 3D0GE 1UP1A 2JHEA 3DXBA 4HTIA 2RRNA 4O4RA 4ED2A 4BS2A 2KXHA 4R8UB 1JK9B 3R5DA 1F5BA 2NCKL 4ZVQB 3MUTP 3QAEA 3PR4A 4IRCA 3A12A 2YWKA 5GMKa 2M52A 3BR9A 3QIPA 1VRTB 4CO0A 4ZHRB 5JXSA 1YIJS 1NZ8A 3QJJA 4KIAA 1S0MA 2B4PA 1EAYC 2N82B 4OX9J 3GU0A 3D1HA 2DGSA 2OAUA 2B9EA 1JLFA 1M90T 4IQMA 3I5CA 3UCZP 5CHCB 1RKJA 1XN9A 1HNIB 5KFUA 1LFPA 1LNQA 2BR0A 5IT9Y 2VFTA 3QMQA 2C3UA 3FBEA 1WI6A 4O3PA 3MEGA 5KAKA 2HQ3A 3CWJA 3FQKA 4KY3A 4FF2A 3D6MB 1V3RA 4I2PB 1KDNA 3JAMY 1M5VC 1U8WA 4WU3A 2FVSA 2ZH7A 5KG7A 1RT5A 3LF0A 1NJWA 2VODA 3VAJA 1R43A 1LXNA 4QZVB 4UTGA 4WPAA 5C25A 4X4OA 1GXUA 2QMWA 3BF4A 1HQEA 1IN0A 2PEHA 4KKOB 1JKHA 2Z4PA 3DRSB 3GZ7A 4Q2LA 2JX2A 4XDCA 3T1AA 3TO8A 2O1PA 3UVJA 1D0EA 1RAJA 2RKIB 4TLQA 4NLGA 4G1QA 4C3MA 4H4MA 3K5MA 4DV7J 5FLXU 1VIXA 2V8GA 1PJ6A 4O44A 2BX6A 2UUBF 1FNMA 3FMBA 5KG2A 3KHGA 1RE1B 3D3BJ 3G6XA 3E51A 3H40A 2CDQA 4RBVA 3CVKA 4FKXA 4WFYA 2HVHA 2KDOA 1SCJB 4FNHA 4K7QA 2QLXA 1YTYA 1IM4A 1RHJB 3IS9A 3QT6A 5F8NA 4M63A 1UW4A 1WC5A 1FXRA 3NS6A 4I6YA 5AE2A 4F3MA 3CO9A 3M8QA 4L74A 2OLWA 4ES1A 3FZBA 1RT1B 2B8PA 4OHVA 1Q95G 2KI2A 1S6QB 5KFDA 2GX8A 2C2EA 1NCLA 5D0EA 2NZCA 2QTWA 3D1QA 1HNZJ 1S1TB 3DHXA 4H54A 1F9EB 1J5OB 2NQPA 1IKXA 1BY9A 2DHAA 5B0AA 3ICLA 3ZTSA 1TUVA 2I0XA 2PEBA 3LAKA 4C11A 3P45B 2R3VA 1HBOA 3IAS9 3L9ZA 2EBGA 2NYIA 3BSOA 3T3FA 2Q66A 3BH6B 1CSJA 2XI3A 3ILLA 3P4UB 1VQ4S 4MJKA 4P7VA 1JNRB 3QIDA 1S99A 3JTNA 2XEXA 3VR1A 1YI2S 1NH7A 2VUGA 4DF4A 4MFBA 2YBVA 1TQLA 4HLBA 4JV0A 5HN0A 4DV2J 4ZCMA 4DV0F 4Q0BB 1Q79A 5J2PA 2DNPA 1HD0A 2BUNA 4ZJQA 1AT1B 4FVCA 4PKDB 3QZ7A 2DK2A 1CVJA 2H65B 4CO3A 2YWGA 5KFKA 2M3DA 1N34F 2M8DB 2VOOA 4RZRA 4ZVSB 2E9TA 2G13A 2B6AB 4KO0B 5E3QA 3D0IE 2C2KB 4GKJJ 4DR7J 3CPWR 3MMJA 4NX9A 1K47A 2CXEA 5F3TA 1S6PB 1AUDA 1HMVB 3LP1B 3DHWC 4HI1A 4I6AA 3PIOQ 4RU2A 2QO3A 1UW9A 3D9BA 5DG7A 1OWXA 4LF4J 4KPYA 1X8DA 4B02A 2ZH4A 1VQ6S 3OHAA 1N33F 3LQVA 5G0RA 4WKRA 1HWJA 2E29A 2F4FA 2ZC4A 5DZ6A 4CLLA 1PCAA 2DITA 2Q6BA 3BO3A 3VGTA 1L3SA 3LP1A 2VG7B 2Z2ZA 1JLBB 4ZN3A 1RYRA 1ZPWX 2LP4A 3QIPB 1S12A 4EBCA 3U1MA 1YVFA 2XS7A 1OSCA 1S79A 2I8EA 4WFZA 2CG4A 3FDSA 3GCXP 3FGVA 3MOJB 3AA8A 2J9EA 3RR7A 4NE9C 5IQQA 3K57A 1NK5A 2KFZA 4DSIA 1UVJA 2GMHA 4EEYA 2JVOA 5I3QA 1JJHA 3BS9A 1M5KC 3BQ2A 2ZKTA 1CQMA 1SJQA 1YZ6A 4DV5J 4F4AA 4A8FA 3BGFA 3EGWB 3OQ2A 4BBYA 5EHHA 1OIAA 5KFYA 6AT1B 3UQSA 2XC9A 3AHPA 3H2VE 1FX4A 1LK7A 1S4FA 3K89A 1RT5B 3P96A 3CCLS 4DR3J 3NMRA 3UN5A 3JSMB 2CQHA 2QN6B 2ZNYA 4J9KA 4F2SA 3PZPA 4ES2A 4DR4J 2ZM6F 1W7WA 4NXMF 3VQSA 3W8GA 1C2PA 2W4DA 2MKYA 1TK8A 3TUZC 1KLMB 4RU9A 3QWUA 3MF5A 3QO9B 2YWFA 2DJWA 2QT7A 4MIAA 5HLFB 2B43A 7FD1A 1FDAA 1F6TA 1VGYA 1QSSA 2PI4A 1VRQC 1YSJA 1SJRA 1WC4A 2VC1A 5KG4A 4AE5A 4WTOB 2YNFB 3H90A 3FSIA 2NLWA 4YB1P 3GIJA 3SCJE 3J7YI 4IO9Q 3BKTA 1DJ0A 2DHHA 2OEMA 1NNDA 4HH0A 2NSCA 2ZDOA 2WAQD 3O6QA 4Y2IA 5J2PB 4DMZA 4UF4A 1B0TA 2AT1B 1BWEA 4U95A 4DN0A 2QL9B 2BJDA 3DOLA 1J2VA 3NS7B 4QBUA 4IH7A 2J8SA 4LSLB 1QAYA 3PV8A 2AGPA 2G1HA 3RB0A 2HGMA 5J1NA 5KFFA 4RW9B 4IKAA 4UOFA 1SUQA 3OTEA 1IBKF 1NB2A 4LBPA 3ZZUA 1HYSA 4YB5A 1VJQA 2J0QD 5KOXA 3PY8A 4FP9A 5DRKA 1FNXH 3I55S 1F3FA 2FY1A 3MGJA 1YJRA 4JI5J 1WHXA 4DBQA 1MWYA 1U24A 4ECZA 1WEZA 2E7WA 4A47A 4IQXA 2H9ZA 1Y10A 1KOOA 3GJSB 1RAAB 2RRBA 4NI2B 1EZZB 2FZGB 4DV6J 1MG7A 4PG6A 4LFCJ 2AYEA 3PEJA 4M5JA 4O0IA 1S6OA 2BE2A 1SH0A 1PO6A 5L1JA 2IHR1 1PBUA 2OPSB 5HO4A 3DLEB 1U4BA 4PCQA 2J9DE 3MPVA 4GVLA 4F0MA 4XIUA 1TK0A 2NXNA 3GV8B 3MECB 3ENAA 4MIWA 5AT1B 1WELA 2RAQA 2A18A 4ZIWA 1T3NA 1VQNS 4WZMA 3HX9A 1FVQA 2CQIA 5L9XA 2QA2A 2QC3A 2OH2A 4I64A 5H9EJ 2RQKA 5A8RB 3WZ0A 2PIIA 5EWEA 2V8VA 3CCSS 4K4SA 3KLGA 1N0VC 3GJQB 3SCLE 1JX4A 3Q22A 5ITHA 2E9RX 5T7LA 4L73A 4JI2J 1FKPB 1UTAA 2V2VA 3ZXWA 1NJYA 3KFWX 4DUZJ 2ATLA 3H2UB 4LF9J 3T6JA 2HLUA 1WHWA 5IXUA 5KFNA 2QIFA 4DI6A 3MPDA 1HBMB 3KLEA 4NLXA 3A4TA 2EVZA 5ETKA 2YQ3A 4RW6A 3HSGA 1VBYA 3C6UA 3NGTA 2BJ8A 4NLYA 2XO6A 1OYDA 4W92B 2KT2A 3PYFA 1XNRF 4ETZA 3T5LA 4HACA 2ZVSA 2GVDB 4X62J 1SJFA 4O44B 1U1OA 1RABB 2MKKA 2YQ0A 5GAEI 4X84A 1N32F 1LV5A 2WHOA 4IOBA 4C8MA 2CZVC 1REVB 4AQYF 3ITHB 2IBOA 2DHGA 3R9LA 3TW0A 3KK1A 2FVRA 4PABA 2R2TA 4DV1J 4HEA9 2DPJA 1SKRA 1FFGB 3AJ2A 3LTOA 3TAMB 2AD9A 5HBMB 2OSRA 1JMTA 1NHUA 3OVBA 2MZ1A 4KJIA 1UEUA 3Q8UA 3R2CJ 2W01A 2OTJS 2XSJA 5C24B 2QSFA 1PJ7A 1XC9A 2HS3A 2GCFA 5EUHA 4I0WA 3OL6A 2W9BB 1TKZA 2WVBA 2JSXA 3WC0A 3ZNJ1 1F2HA 2LFVA 2CA9A 2IFXA 4N77A 4EYIB 1E6YA 1VC5A 1N36J 5IZHA 1U6BA 4B3TJ 3QT5A 4W98A 4CLKA 1SKUB 4DR6J 2QEXS 3G8SA 4B17A 4IDKB 4ZVOB 2MZRA 2RUSA 3QQCD 1HHQA 2FJAB 5CYMA 2Y1IA 4FPIA 1WJ9A 3RB3A 1S1WB 1IJEB 5E33A 2CG8A 1ROFA 5U47A 4JI6F 1MMNA 4OYXA 3P5TL 2HHTA 1ZS6A 1ZM9A 2IM0A 3POTA 3D28A 3GLJA 1YK9A 1Q8LA 2G0JA 2MMYA 2G9OA 1S4EA 2FTRA 2A2DA 4M5HA 4AYBD 1S6PA 3AODA 1DURA 3DOMB 3SEOA 1UA0A 2V4QA 1S9EA 4RBUA 2CPDA 4LF7F 2QJ3A 2UV8A 5SZTA 3ZZTA 3H0PA 3GP9A 2C3MA 1V3ZA 1HQUA 1Q86T 2KO1A 3TA0A 3VF0B 2HZVA 4NXNJ 1U02A 4LQ3A 2IM1A 2DTJA 4XDDA 4NL5A 4N41A 2J7KA 3L4BC 1JJ4A 3GG0A 2VFUA 1TUGB 2C2ZB 3CCTA 2V9KA 1XR7A 2LXIA 3R27A 1FKAF 1WI8A 1TMJA 3GONA 1FD8A 2WTFA 4PAAA 3CCRS 1Q4RA 1RU1A 1TAUA 2AP6A 5AJ3J 4URQU 4CLTA 2EG2A 1X0FA 3H4DA 2DYAA 4OZ1A 1YRTA 4DZ6A 3QSIA 5A8RA 1Q53A 4P71A 2XMAA 4BDPA 1F60B 4KTQA 3OFEA 3I0RB 1RT7B 4ZCLA 4OI6A 4B3RF 3A8JA 3W3SA 3JSMA 1HQ2A 4RW7B 3EVOA 4OHWA 2DT9A 2LLZA 4KYZA 1VLYA 4WK1A 3TR5A 2XMKA 1NK9A 3PW4A 4V19J 1S7HA 3PRBA 4V1Ak 2X1BA 2Z2YB 3G82A 1V9OA 1RWKB 5L46A 4C2MA 2V4JA 4F4KA 2AF6A 4X65J 3AJ1A 5F9LA 1DQAA 3NCQA 1T03A 1DLOB 1LWEA 2YXLA 2X3DA 4AT1B 3QYYA 4M1KA 1WWHA 3THVA 4HDGA 3NEKA 1RBAA 3I56S 4TU8A 1S1VA 1Z2LA 2VQEF 2J6TA 3ISZA 3P5BP 1FXLA 2JH3A 3C16B 4RPFA 2DGUA 1I3OB 2R42A 4DFKA 3HHLA 1T9TA 1REVA 5K20B 4RNOA 4E2FB 3X1LB 3DGPB 5H1SV 1S5ZA 3R5CA 4LVOP 3KK2A 2ILZA 1SKWA 2FHMA 2RHQB 3N01A 1HNWF 2G4BA 2ZDPA 3OUYB 3O2IA 4I2QA 5KT7A 4WZQA 1ZAVA 2UVRA 4C0HA 2Z30B 2W25A 3MMCA 4OI4A 4M5DA 3M9OB 2CJ9A 1R8HA 1PG5B 3IR6B 3VAFA 2BEFA 2CQPA 2B7BB 1DTQA 3EXCX 2H5JB 4ZJLA 4IR9A 2DVIA 4TU9A 2DNKA 3M6VA 3MMAB 4OX7A 4ZLPA 4ID5B 4OLPA 4EFAC 1HWKA 3D6FB 3QJLA 2L48A 1LWXA 2NPIA 2MKSA 2I6WA 1JLAB 1QD1A 3MR5A 4DS5A 2Q79A 4WFBQ 1NJZA 5F8IA 2JDJA 4YN3B 1VQYA 2QLWA 4B9VA 1U7LA 3BQ1A 5J1PA 1RQ0A 3MEDA 1LEOA 5E3AA 5BYSA 1IBCB 5HJXA 3ZTPA 1FJGJ 1MW7A 1U1MA 2EXUA 1JLEB 3E3XA 3HVTB 4PQUA 4K4TA 4DDFA 3OTOJ 1HNVB 3NGDA 5D4PA 1Q78A 3RYLA 4MAKA 1QDUB 4PWUA 3U1NA 4GKKJ 2OFGX 4HL9A 1HNXF 2BM0A 3RB6A 1SL0A 2VA2A 3KMQA 4KB7A 2CQ0A 3A1YG 4RKUC 5AXLA 4ED3A 3HT3A 2JLFA 4P9SA 5DDRC 3LAMA 4F3OA 1OSDA 4PYAA 1N6QB 2R2SA 2YH1A 1BD6A 1GTHA 1SPBP 2LQJA 4DR3F 3TZYA 1X4AA 3GTYX 4NRTA 4WP9A 1TL4A 3E01A 4WJBA 5KFGA 4OZ3A 4DV5F 2V67A 1TKTB 4TLRA 3AA9A 4XAKA 3EJMA 1B0PA 1R8BA 3TZXA 4DSEA 1M5HA 3TQ1A 3G86A 3T1YF 1FKOA 4NASA 2E5LF 1FKPA 2ZH8A 1DQ9A 3ILJA 3RRKA 1YLXA 3FEZA 2DIUA 3R97A
chains in the Genus database with same CATH topology
4UUWA 1VK8A 3MR3A 2DCUB 3EGNA 3KJVA 2IA6A 3CGIA 4K0KF 2VG6A 3VWSA 2IRXA 2C3YA 4QR2A 4J9QA 1HQEB 2VG6B 3MZIA 4PQAA 1DBDA 3GIMA 2DGWA 2D7SA 2I38A 2ZOMA 1FJCA 2Z2LA 3NBPA 3THTA 2D3ZA 5DG9A 4CCHA 1D3WA 2KT5A 3N5BA 3IG1A 2J9DA 1X0PA 2BDPA 4K2XA 4TU7A 5DDOC 1HBUA 2I1RA 4FN5A 1G3OA 1ZYQA 2VPWB 4NMLA 3UW1A 1MNEA 2R2RA 2IM3A 4M8LA 2V94A 2P9EA 2MZTA 3PVXA 2KB2A 4F26A 3MAQA 4JI3F 3R5BA 2XS5A 3HVRA 1D1UA 4X4UA 1TFYA 3OL8A 1QE1B 1HPZA 4R0JA 5LSRA 1PGZA 1T95A 5KFOA 4PXEA 2LKZA 2UUWA 5L1LA 5J2MA 3NNCA 3MMAA 4JI4F 1Y4ZB 5CYMB 2IMWP 3PKMA 2LQ5A 2YX4A 5A8WB 3G8QA 1ZM2A 4ZPDA 5KFLA 5L39A 2UUCF 2Z0GA 1JLGA 3I9ZA 1FF2A 1DFDA 1TVRB 1FRHA 1TP7A 4DOZA 5A8WA 4IOCQ 1SKSA 4DSLA 2LEBA 1P6TA 3DLEA 1EP4A 2W9CB 3BSNA 3OXLA 3NAIA 4LSNA 4B9MA 3U7JA 5I4MA 5DQIA 4USIA 3FEYB 1KR4A 5KFAA 3F73A 1LWCB 4F50A 1Q16B 4P2SA 3B4MA 3OJUA 1HI0P 2XG8A 2CJKA 1VQMS 3WDOA 3IN5A 2NREA 3ZZRA 4B9NA 2FLOA 2ZHBA 1TFWA 4FNIA 3V5RA 4YEAA 2J0WA 5L8RC 2GMLA 1RP5A 5B0BA 2ROEA 2ROPA 4KRWA 2E1RA 4NLVA 3PW0A 2JL9A 4CT8A 2GJ2A 4ZP8A 2EC0A 4KR0B 3Q24A 4ED7A 4WXOA 2E1CA 1RA7A 3TANA 2CVEA 3LPYA 4G6VB 5EGYA 4EU0A 5IS2A 2H5EA 3I4PA 2J7WA 4IG0A 3M05A 5KFVA 1C1CB 4OHZA 3DRXA 3GR1A 2CKWA 1SIWB 2CZ4A 2DNQA 1QM9A 5IQ6A 1FJEB 4G1PA 3W2WB 1RTDB 2F3JA 2R7OA 2K3KA 2OMLA 1KN6A 2LXFA 3CJ3A 5KFXA 4ZPVR 2VA3A 3BSAA 1QAJA 3I31A 3WC2A 5D4OA 1NK8A 5F8HA 1FERA 1VRTA 1F5AA 4ZHRA 2AJ4A 1BLUA 3QO9A 2HPUA 2CYYA 4EO6A 1F0XA 1VQPS 4LF9F 1Q7LB 2LCWA 3C8YA 2GQQA 5T7LB 5KFCA 2FJEB 1Y3JA 2ZC3A 3RU0A 1I94F 1BQMB 3M8QB 2HFZA 2KHDA 1XR5A 4DR1F 2I5JB 1UVMA 1KONA 1S1UA 4OZNA 3LO3A 1T8EA 3I4HX 1NK7A 2VV5A 1YJNS 5CD4H 4WK3A 2L9NA 3SXLA 5C25B 3MM7A 2GO8A 2AJ0A 1L3KA 3CJKB 3GV7B 1BC6A 4NCAA 2E9ZA 1OO0B 4IDKA 1KVIA 1VQSA 1YHQS 2P6TA 4ATNA 1NAQA 2GNKA 2B3TB 2VFSA 1G7CB 2UVWA 4K4UA 5J2QA 4OLOA 2BYCA 2RNEA 2W7OA 3OFHA 2J6SA 4CH1A 3GV5B 2HHVA 3M8SA 4Y00A 1KD1T 3K0JA 2ASDA 5F0WA 3TVKA 1D9AA 3MR2A 4DN9A 2IA0A 3M2VB 2D3UA 3MTKA 4YDXA 4O3SA 3NNHA 3CCVS 1LWCA 4PXDA 3SV4A 4ERDA 2D9PA 3CCZA 4K59A 3W2VA 2PFFB 4HH1A 2AJFE 1UWBB 4UOCA 4WIIA 2YWEA 4ECUA 4NCBA 4YB7A 5F3ZA 4ZVFA 4CZCA 3PACA 3WX4A 3IA0A 1AFJA 1CEZA 2KRBA 1X5OA 3X3UA 2QA4G 1C1BB 2MYFA 1Q8BA 3FRYA 2FJWA 4I7FA 2J7UA 1RT3A 3I0RA 4RNFA 5EWFA 4C8OA 3I0SA 3FJ2A 3DYAA 3SSRA 3HMJG 4QYZJ 4DFJA 4F67A 3GWCA 5HROB 2AWZA 4DQSA 2HS4A 2APOA 3DN9A 4K4VA 4LFBF 3K58A 4I6WA 3Q23A 3BO2A 5DGAA 3NS5A 4EWTA 3FRZA 1X7VA 3JB9k 3ZZZA 3Q8PB 1VI7A 1KOHA 1SXLA 1OPZA 2QA4S 3KG0A 2DNNA 2EFPA 2M7SA 4WFAQ 2IJNA 1KQSR 5B0CA 4PWDA 2DRBA 3IG1B 2HHWA 4KHRA 4Q44A 3TNVA 4DL6A 1O8BA 1YG0A 2KN4A 3PW7A 1S76D 1X4FA 2GHWA 1VK3A 1FNOA 2XY6A 1K1SA 4NLUA 3SMZA 3MUMP 3GG1A 1S49A 4J5OA 2NUUG 4KQZA 1VQ7S 1XMOF 1X4HA 4U7CA 2KG0A 4ECSA 5A2QY 2YKNB 3FMWA 2B56A 2A2CA 5DJBA 3OXGA 2ZJQQ 3QLHA 3V6HA 4CIOA 1MSWD 2EFVA 1HARA 2RB7A 5E3CA 1HBNB 5L38A 4UQGA 3HLUA 4BHQA 2KRRA 4DL5A 3MFIA 1N8RT 4ED5A 5M2UA 2QRRA 2ZFHA 2RS2A 3OR2B 2E44A 2PD1A 2C2RA 2LXUA 4DG1A 1UETA 2LDYA 2GW8A 3M2VA 4HT5A 1R7IA 3MI7X 3V6KA 1GH8A 3OSPA 2RQ4A 4NLRA 2ZH3A 4JI0F 2YNIB 4JBCA 4MMOA 2VQFF 5IWAF 3TA2A 4L3NA 3IO1A 3IWXA 2FVPA 3UCGA 2UP1A 4LF8F 4ILLA 4C8ZA 3BM7A 5E5NA 1DRZA 2IYGA 2EWHA 4K50A 1N54B 1IUJA 1I1GA 3F56A 5D6GA 1VC0A 4B3MF 1WF0A 2K1RA 1UFWA 2PT0A 2QYCA 4X62F 3CDUA 4A8YA 3TRGA 5KOWA 2EFOA 1DHMA 1Y5IB 4U7UK 3NGKA 3K5NA 3LWLA 2ZHOA 3OTOF 2RU3A 3UD3P 3R1LA 3CJ0A 2UXCF 4OI2A 1UJ6A 3CIZA 3T5HA 4ZA1A 3T1HF 1H2UX 3NMAA 1Y00A 2LECA 1G6BA 2DRAA 1AROP 3Q2SC 5AJ3F 1LW2B 1K0VA 3AQOA 3N9UC 1IKVB 1ZZFA 2ILYA 4QIVA 1JLBA 2CQ1A 4A48A 4OFZA 1QSYA 5LXRA 1TAQA 1TL1B 1GX6A 4Y65A 4PG4A 5KFZA 4A4JA 4J9RA 3ZZPA 4DPOA 4I69A 1SV5B 3HVAA 2UU9F 2U2FA 3T19A 2E7XA 5KG0A 1BQMA 2IM2A 3FEXB 3CD0A 3KNGA 1A9NB 3Q0AA 2XY5A 6FDRA 4DFPA 5GAHU 3H5SA 3KLHA 2LQBA 7FDRA 3MXHP 2YKMA 2FC8A 1TV6A 4GMKA 4YUDA 5DGBA 2BRKA 3JYTA 1WHYA 3CD5A 2DO0A 4ECVA 3L95X 2CQ2A 3OFGA 2COLA 1C4AA 1E6VB 3PO4A 4RNMA 3GE9A 4DV4F 3J80Y 2DH7A 1KLMA 2WSCC 1MWZA 1C0TB 1R8PA 3NBPB 4A8OA 3GILA 1C4CA 4ZVHA 1C0UB 1WF1A 2RQMA 2XB2D 4X4VA 4OV1A 3HK2A 3MMBB 3OTBA 5AE1A 1U8SA 2VBYA 1LW0B 2UXBF 2E5JA 2B51A 3CIMA 4NZ6A 2CPJA 2JFKA 2GO9A 2XMTA 2IVMA 2D9OA 5D4LA 2ADBA 3J81Y 2QE5A 1UVKA 3LUYA 1JLEA 4NZ7A 3PKYA 3PHEA 1F5CA 4ICLB 2DH9A 2XBPA 3MFHA 3MECA 3KHRA 4ECYA 4H4OA 2IYIA 5EDWA 1UEVA 1N4LA 3V6DB 3MAHA 2XWXA 2LDIA 2ROGA 2NSBA 1FK9A 1SUQB 2HHSA 3CCQS 3OHBA 4DSJA 3U1LA 2AX1A 3I5AA 1HR0F 1N5TA 5LT5A 2W8KA 3C3LA 1DTTA 4CH0S 5KFQA 3M8PA 3JSBA 1SH2A 1C1CA 2MHEA 2AJ1A 2P9GA 1LK5A 2DB1A 3NCRA 4CTAB 3W2WA 3ZC4A 4ZMMA 5J2NA 1HBMA 3KLEB 5SUHA 5A8KA 2ZH6A 5K8MA 3KJVB 1ZZNA 4DV6F 4YQWA 3SZ2A 4DV1F 3JSRA 2K2PA 4KC5A 1LXJA 1JLCB 5E3RA 2EK6A 2WONA 1MU2A 4LFAF 1ZAWA 2HFOA 3EXYA 1DLOA 4WE1B 1SIZA 5HMWA 1KSPA 3TARA 1XNQF 3BGRB 3BGUA 1IKYB 4A46A 1ZM3A 4EZ9A 4K4XA 3KK3B 4DS4A 2RQCA 3U02A 4WYLA 1O51A 1UJ4A 1S1UB 4ZK7M 1WD6A 4QR1A 3KK3A 3C6TA 2M88A 4ZP7A 2R7TA 2R7WA 1N88A 3PDNA 2JEFA 2M0GB 4LIWA 4FF3A 1LWFA 4DQPA 4QIEA 1N0UA 3LALA 3MMCB 2J6UA 2YKMB 4ECXA 1U1RA 2F4VF 2CPXA 2D3OR 4FBTA 1RA6A 3DM2B 4HTJA 2DHSA 1NH8A 4IFYA 4K4YA 4GC7A 3PW2A 5D3GA 4TXSA 5IM0A 1EETB 1ULRA 3F44A 1UVNA 2HHXA 3MM8B 2HMIB 2BBEA 2BW2A 3BN7A 3FFIB 2VFVA 1VBXA 2QA1A 3OJSA 1NKBA 1GQEA 2OO4A 3CC4S 4JI1F 4JV5F 4I67A 3POTB 4QJVA 1QTMA 2N3LA 1ELOA 1UMJA 3PX0A 1FD2A 1S1TA 2R8GA 2BA9A 2EG1A 1K1QA 2RT3A 2JOQA 3VAGA 4MKBA 3MR6A 1P8GA 1SC6A 2CIMA 1B0VA 2IAJA 2XHWA 2B5JB 4NOHA 4ILMA 3LP2B 2FPHX 2IBKA 2V9WA 1H3DA 4FZVA 1T7PA 1SB6A 2J0XA 2GV1A 5BR8F 1E6YB 3NP5A 4KAIA 1UJ5A 4RUCA 2IVFB 1Y9OA 1SL2A 3I0SB 4L72B 1PILA 2PMHA 2DNZA 2KYXA 2VPZB 1U45A 5CQGA 2JJ4D 3OLBA 2P5VA 2XMJA 3DRRA 5I42B 1S0OA 2M8HA 2OFHX 3CC2S 2WBRA 2YNGA 4IRKA 1D8YA 3KNAA 1RT4A 1IKWB 3F41A 1U1NA 3DOKB 5I42A 3CCES 3C66A 1HNVA 4QWBA 3CCJS 4YMEA 4CQ1A 1SJ4P 4RW4A 4OI3A 1M1KT 4RW8A 4IYQA 2KZMA 2FGCA 2VKRA 2MKIA 2MZQA 3OTDA 1KHVA 4ZKAA 2KHCA 4O3RA 1DAXA 4V19X 4WFNQ 4NPOA 5F9NA 2E1MC 3DRPA 4QIFA 2YWHA 2RE1A 1KEKA 4MK7A 4MYTA 4B9UA 1B7FA 3UDLA 2Z2MA 2KU7A 4HKQA 5I3PA 5K9FA 3PIPQ 1AXQA 4DUZF 1KQKA 2VB6A 3IR7B 2LQ9A 1OPIA 5KT6A 1TL3B 3ZZ0A 2KH9A 3L7PA 4DV7F 5HROA 4B9LA 2O66A 2VH7A 4I2PA 1RTIB 3UR3C 5E0OA 3MWBA 2LVWA 1HW8A 2XZWA 1GNKA 2DNLA 2WB1D 4X65F 2L41A 3GB0A 3KG1A 2HWHA 1K8AT 3CDBA 5DDPC 1KTVA 3DDNA 2NS1B 1JLAA 3PRDA 1LOUA 2GIQA 3KG4A 4C3LA 5J1EA 3T5KA 2YNHB 3B8HA 5DQGA 4JUZA 3LH2S 5IM0B 2WOMB 3M2RA 3HM9A 1N52B 1YJTA 1FEEA 3CSKA 5HMZA 2HVZA 3PFOA 2JFDA 5CYQA 5A0YB 1H7XA 2KZZA 1LQ9A 3BDPA 3UI3A 2B6AA 4KO0A 5CZXA 4FF4A 2FJXA 1S72S 3OXFA 1U6ZA 3BZQA 2C3OA 4KV8B 3DLKB 3ULHA 3CD7A 2ZOGA 3CUNA 1S97A 1X4BA 1YJUA 5T41A 3SCIE 4LMZA 1X4EA 2ZH5A 2B5JA 4H4KC 5KT4A 1FVSA 2E5GA 3O1LA 3JYTB 4H4KA 3H98A 1FDNA 4I68A 4B3OA 2CQ3A 4N56A 2YKOA 1Q81T 2AW0A 1NO8A 1U49A 2PA8D 4M94A 5CA5A 2RDJA 2DGXA 5J2MB 2C22A 4LUBA 3G6YA 4LF4F 2Q3PA 2HWIA 2VOPA 5F41A 3UPFA 1U47A 4NCGA 4QPXA 4YR3A 3RB4A 4DR6F 2VC0A 5FDLA 1YGYA 2WCXA 1RK8A 4ZDNA 4NYPA 2F8HA 1BQNB 3H8YA 4QQBA 4HDHA 4ED8A 4IO1A 5D4NA 2AJQA 3CEDA 3NKYA 3FSYA 3ONQA 4O23A 3IXQA 4IUFA 2KFNA 4PXCA 1WG5A 4YB6A 3VCDA 5M2PA 1RT6B 2JEIA 1GXTA