1RJJA

Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
MATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVVATP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords expressed protein
publication title Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 17
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rjjA00
2PGCA 4DPOA 5K9FA 1OPZA 2OFGX 2BYCA 4QOTA 3CJKB 1V3ZA 1GXUA 3KKFA 5A6WA 4F67A 1YJTA 2GA7A 2N7YA 1URRA 3HHLC 1FD8A 1Q4RA 3BR8A 3VTIA 1JWWA 2FB0A 2XMTA 1AFIA 2K7KA 4A4JA 3LO3A 2GV1A 3HHLA 4A47A 3FRYA 2XMVA 1FVSA 4NPOA 5T7LB 2FTRA 2OAUA 2HLTA 2AJ0A 2IYGA 2LQ9A 2RILA 1YG0A 2GO8A 4U9RA 2OMOA 3LGNA 5F0UA 4A46A 1APSA 1KVIA 1SQEA 1Q8LA 2IYIA 1AW0A 1KVJA 2ACYA 3IWLA 2HFOA 2OD4A 1YJVA 1IUJA 3HHLB 2ROEA 1Y3JA 2BUNA 3TNVA 2BJEA 1RJJA 2OFHX 4HH0A 3DXSX 1WD6A 4EFAC 1N5QA 3BM7A 3FMBA 2XMUA 1QUPA 4Y2KA 2RU9A 1Q8BA 3F44A 3BB5A 1KQKA 2LXFA 3TRGA 3KNGA 4OJ1A 3GZ7A 2W4CA 1K0VA 2RMLA 5B08A 1N5SA 2GGPA 3DCAA 4Y2IA 1N5VA 1Y0HA 4DN9A 2KT2A 2LDIA 2GFFA 2CRLA 2N4DA 1LQ9A 2LQBA 2L3MA 2K2PA 5F0WA 4OIXA 4DL0C 1YJUA 2RSQA 1R6YA 2KYZA 1OSDA 3QGPA 2KT3A 1X8DA 3KG0A 5B0DA 3LGMA 1TR0A 4FNIA 3FGVA 3UDCA 1CC7A 2W4DA 2IFXA 1P6TA 2XMJA 2KKHA 4YEAA 3WDOA 3BF4A 2HQIA 2XMMA 1FESA 4ZA1A 1VQYA 4FNHA 5B0BA 2ASYA 4Q2LA 2K1RA 2HFNA 1OQ6A 1TL5A 4OJHA 5B0AA 3BGUA 2AP6A 2OKQA 2QYCA 1GXTA 5B0GA 2N4CA 4OJ3A 5KAKA 1ULRA 1W2IA 5B09A 1N5TA 5A6PA 3T9NA 1VQSA 1YRXA 3MZIA 3BDEA 1X0PA 3HFKA 2G9OA 1YJRA 2OP5A 3BN7A 2BBEA 2FIUA 1Q53A 1AFJA 1P8GA 5T7LA 4HI1A 1TL4A 1S6UA 4Q2MA 5B0EA 4A48A 2BJDA 1MWYA 5IXUA 2ZDPA 1MWZA 3K7RA 1SI9A 1JK9B 1Y3KA 2GGPB 2QLWA 2ROGA 3I9ZA 2QLXA 1Y9OA 4Y2MA 2AJ1A 2EW9A 2FHMA 2QIFA 2AW0A 4HI2A 4HL9A 4ZOSA 3TOQA 3HDSA 1S6OA 2JDJA 1FE0A 3MCSA 1CPZA 2GCFA 2VH7A 1TZ0A 2HIQA 1CC8A 3KG1A 4OJGA 2ROPA 3QMQA 3HX9A 2PD1A 1OQ3A 4NL5A 3CJKA 2OD6A 4HH1A 2XMWA 2W4PA 2XMKA 2VV5A 1FVQA 2ZDOA 3HHLD 5B0CA 1SB6A 1FE4A 3E8OA 1XBWA 2HLUA 1TUVA 3HF5A 1X7VA 4YDXA 1FEEA 2Q3PA 2K1RB 5B0FA 3IWXA 1U7LA 2K7JA
chains in the Genus database with same CATH superfamily
3AOBA 4IO1A 3PZPA 2B8QA 1K1QA 3QO9A 2MXYA 2IVYA 3TA1A 1X0FA 4OX9F 4QYRA 3RAXA 3ENVA 3SBMA 3BKUA 3DRRA 3MM5B 4LRAA 2FJXA 3UR3C 2V67A 2ZD1A 3GYXB 2UVUA 4H54A 4P74A 3CCZA 1CJTB 3JYTA 3N28A 1VC0A 2C3PA 4A8KA 1O0PA 3CDAA 3UCZP 3OTOJ 3PJ9A 3KLHA 4EI2A 1FCAA 2ZE2A 4RNNA 4OZ2A 4ZS6A 3TW0A 4U67Q 1IBKJ 2R7QA 3H5YA 2E5LF 2M5YA 2Q6BA 2F8HA 3AH6A 3ZXWA 2WB4A 2EFPA 4P72A 3MMCA 3G4SS 3NGDA 1IKXB 3ETMA 3T19A 2BJDA 4PABA 2J0XA 3D9BA 1HA1A 2XZDB 3NAIA 2PD1A 2ABYA 3NS6A 4YY3J 1KLNA 3QQCD 1T8EA 1RT7B 1RKJA 2HNZB 3OTBA 2FJBB 3DMJA 2MZQA 4ILMA 3JXOA 1CS4A 3DNCA 2XMTA 2QMWA 4Y2AA 1NJIT 2F9JA 3KHGA 4DQSA 3KFWX 1YRTA 1TELA 1SPBP 3I31A 4IQXA 1Y3JA 5FLXY 1ZAXA 2OFHX 3BEGB 3PW0A 4QYZJ 1GT8A 4DX7A 1MU2A 1RTHA 1RDRA 2LXFA 3FSYA 4Y3CA 2AWZA 1S1UB 1YZ7A 5C2CA 2IDEA 1HWIA 2KYZA 1K0TA 3LP0B 1I94J 3JTNA 3DLKA 3H42A 3POTA 2HQIA 2DPJA 3DOMA 5AXMA 1SIWB 4F4ZA 1SUQA 1F3VA 1GTEA 4B3RJ 4ECRA 3EXYA 4Z7YA 4F0KA 3RBDA 5ETLA 3MM5A 4LFAJ 4EYIB 1N32F 3UW1A 1UVLA 1XEZA 3MPYA 3J7ZT 4CM0A 1CJTA 4WFZA 3H25A 1IXKA 2E66A 1TK8A 1C1BB 4LRFA 1ZA1B 1TAQA 2GQQA 4QU6A 3GE9A 4HHUA 1H0HB 2OPRA 4KO0B 4JI5F 2BA9A 4JBCA 3ZTQA 1JJ4A 3HZGA 2CQ4A 4JI4F 1OS5A 1TFWA 1CULB 2XTJP 4NA3A 2JNJA 1UVKA 3R8YA 4XK8C 3C15A 1DTQB 3D1QA 1ELOA 1EHWA 4NYZA 2VPZB 1FNOA 4QIFA 4P7VA 3M1VA 3IO1A 2XBPA 4KHPJ 4EZ9A 2MZJA 1MN7A 5E3CA 4DV4F 4X66J 4UY85 1TV6B 1YJNS 3MOZA 4M95A 3T1AA 4ECQA 2D3O1 2B3TB 2KN4A 2H54B 2VONA 2XI2A 3VQTA 3CF5Q 1X4EA 2EEYA 5D0EA 3IM9A 1HR0J 3NP5A 3RB0A 3DRSB 3G6ES 3FDSA 2C2DA 4ELTA 4DX8H 2BYCA 4QOTA 1S1UA 3I96A 5CA5A 4DSIA 2ACMA 5ETRA 4OYMA 4LREA 2RRNA 3AA8A 3NCQA 4ZIVA 3F0NA 3UVJB 4H4KA 2ROEA 1WDDA 1DLOA 3OUYA 1A0OB 3DDNA 1WTBA 1UVMA 4FS2A 3MMAA 5FIIA 5T41A 3GIIA 3EVOA 5J2MA 2GHPA 2N4DA 2A3JA 2C2RA 3J81Y 2DGUA 3SV3A 5F8GA 5E33A 5F8IA 1EKSA 1ZM9A 4KB7A 1S6QB 1RT3B 1WOOA 2AYEA 1N5YA 1G6BA 3UDEA 1NXIA 5JXSA 4ZVSB 5DM7Q 1CULA 1XC9A 3EDQB 4N47A 2MKSA 2OSQA 1GX5A 4B3TJ 4C8LA 2ZEJA 4LR8A 1U7LA 1DTQA 4O4RA 3GWCA 1TU0B 1RHKB 4L74A 2BDPA 3SCIE 3T41A 1PC4A 4YB1P 2OPSB 2OAUA 3BGFA 1SQFA 4ED4A 4YDDB 1AUSL 4ECSA 4QW8A 4OZ3A 3CVKA 3OLAA 2AX1A 2V8GA 1IKYB 3DOLA 3JSMB 4FKXA 2CVIA 1JJ2R 1N6QA 2RSQA 1R0CB 4L73A 1WKJA 2MJNA 3MR3A 2XHWA 1RAHB 1RT5B 4NEYA 2HNDB 2QLFB 2XNRA 2B9YA 2CJ9A 1QVGR 2B0GA 4LRDA 2VQEJ 3UVJA 1Y9OA 2FHMA 2YY3A 1TKZB 1DAXA 1OQ3A 4URQU 2FYXA 4K4TA 2ZVSA 2IM3A 4DV1J 3LANA 1G4CA 2CADA 2KRRA 3HHLC 5B7WA 1URRA 1H7XA 3PRBA 4KQZA 4ZVGA 3TYTA 2BQRA 2V2KA 5CZVA 5LOQA 2DR5A 1S0NA 3TJ9A 2YNFB 4MKVA 4FF3A 5BXIA 3EZOA 1S6QA 1NHVA 2HAFA 2K8GA 4HACB 1RT3A 4I7FA 3MMBA 5K5MA 3AOCA 2CQ0A 3OJSA 4XDCA 3O3LA 1HI0P 3CW2C 2F1FA 2CDRB 1DQAA 1RSCA 2PMZD 4W98A 4PRFA 5DLGA 3OVSA 3QGGA 5BJRA 2JC0A 5EHHA 2MZRA 2SXLA 5D4NA 1RHMB 2OKQA 1FX4A 7FDRA 2MZTA 4ZJQA 1NO8A 3GV7B 1PO6A 3QATA 2JZ5A 3V6HA 2ZBRA 2VA2A 4OZ5A 3I4HX 3JQKA 4K4WA 3QMQA 2Y1RI 2QV6A 3D7SB 2XMWA 1IM4A 3QGIA 4ID5A 4QU7A 5J2QB 3L95X 1UMJA 2R8HA 1QM9A 2J7WA 3D2WA 2K7KA 3ZNUA 4WE1B 1NH7A 3QWPA 3MFHA 5F9NA 2FTRA 1HQUB 2R7RA 1FTRA 4DR5J 2I2YA 4Z2XA 1HW8A 2ACYA 3OFGA 2ZUAA 3CJ8A 2FY1A 4CM2A 3OSPA 3I6PA 4PQAA 4NASA 2RKIB 1GMWA 4Y2CA 2EG2A 2LMIA 4ECXA 2FDNA 3BSAA 4R0JA 1JKHA 1K47A 4WP8A 2E5HA 2IAJB 3SCJE 1TKZA 4ZP9A 1HNWF 1LW2A 2HURA 1S10A 2EFVA 4DG1B 4NZ7A 1E6VA 2LEPA 5D3GB 4FXVA 2D7SA 4PQUB 1XMBA 1WEXA 2UUAF 3MF5A 3VVTA 1M1GA 1Y3KA 2YNFA 3AQOA 4LBIA 4CO3A 4J9NA 3FUYA 2MMYA 4HACA 1V6HA 4X4NA 2XLIA 3KJQB 4KFBA 4QIWD 2VFRA 1FE4A 1BLUA 4Q5VA 4K50A 1HI8A 3A8KA 5IM0B 2RS2A 3BO2A 4Z37A 3MM9B 2FB0A 4ERDA 3TEHB 2KDOA 2R42A 4WFYA 3Q24A 1FNMA 3KUGA 3ZTRA 2KRBA 3WC0A 2QYGA 1YTYA 5ETPA 4L76A 1F9EB 2YNGB 2VODA 3M6VA 5B08A 1Q81T 3DLBA 2J9DA 4V19X 2KJVA 4OX7A 2IHR1 5KFQA 2ZITA 2MY7A 2UV8G 4M5MA 1NK6A 2AP6A 2DVIA 2YKOA 2AYGA 2G9OA 4NMLA 1HQUA 2D1CA 2X3GA 3NY0A 5DETA 1UEUA 3QNWB 2E7VA 4DF8A 4KGZB 3MECA 2MQ8A 5H9FK 2BXJA 1HHSA 4RU2A 3E01A 2IAJA 4WBFA 1FJ7A 1OYDA 5IV4A 3KMSA 3M32B 4AFFA 1OY6A 4MK9A 1EKRA 4GVBB 4TLQA 1DZ5A 4L3KA 4R8UA 4DG1A 5D3GA 4I67A 4KE5A 5KFRA 1M5VC 2GMJA 3VF0B 2MQLA 5THWA 2XEXA 3V4IA 1BWEA 3RBXA 3M2UB 5H9EK 2FUG9 4WCEQ 3PO5A 3SCKE 3GIMA 3IBWA 1VOMA 2DXEA 3R2CJ 3H4BA 2YWGA 5IM0A 1FWPA 3I0RA 1QTNB 3PXGa 3PJXA 2E5LJ 4U7UD 5KFIA 3LWLA 4PUOA 2IRUA 2CYYA 2QA4S 1AA1B 4G65A 2ZDPA 4USHA 3GYNA 2WHOA 2VG7A 2PI5A 3I9ZA 1FEHA 4EU0A 4HI2A 1NSKL 1R27B 2DTJA 4ZCKA 2RQCA 2YNGA 4N56A 5JUMA 2WBRA 3K8VA 3MPWA 3CJKB 4DL4A 2UV8A 5AJ3F 2BQUA 4R5PB 3PRVA 3N5BA 4UUXA 3CD5A 4BC9A 5IT0A 1SKRA 1XNRF 3LP1B 3K2YA 2I38A 4RU9A 4KH1B 3DLEA 4QWAA 3C6TA 3TO8A 1NKEA 1TL7B 3GIRA 1E6YB 3GR0A 2C2ZB 4X4QA 4E0DA 3M4XA 4B9TA 2IIHA 2KKHA 2XO7A 2XSFA 4OJ3A 4C9DA 5EX3A 3JB9k 3H20A 3EZUA 1U1RA 1R8BA 4UF4A 4OLPA 2ZZMA 4GVBA 3SI8A 1NLKL 3U1LA 4DQRA 2L9WA 4QR1A 2XNQA 3TEGA 2IA6A 2P6SA 1RQ0A 4CO2A 1AB8A 3ISND 5DDOC 3MOJB 4OI6A 1H7WA 4QWEA 3V81A 1VI7A 3THTA 2BW7A 3M2UA 1VRQC 3FSXA 2HHHJ 3CEDA 4BCAA 2H1YA 4JI7J 2E9TA 4X84A 1QTMA 1H38A 4X4VA 2JC1A 2AGOA 2PIIA 1YGYA 3W62A 3K17A 1DTTA 4F7VA 5F8JA 3G82A 3DHXA 2DO4A 4ZVHA 2FLNA 4JV2A 3BYPA 2NSBA 4J37A 1QDUB 3FBBA 3PO4A 4J9SA 4JI3F 1NK4A 4KYZA 2W01A 3TA0A 3H5SA 1FXDA 3CMES 4DV4J 4CO1A 2WW8A 1IBCB 4YB5A 2LU2A 3FVYA 1FJGF 3TWZA 5L8RC 3MPUB 3QZ7A 3W5YA 3LP1A 1FRMA 4J9LA 1S1WB 3QT8A 3CCES 1RISA 4DPOA 1L5UA 2OPQB 2UXCJ 3I32A 3U27A 2HHWA 3HHLA 4L3NA 2X1GA 2ZH1A 2XMVA 5BR8F 4EO6A 1AUDA 1ZZNA 4HVZA 3SQGA 2HAIA 1BQNB 2YBVA 4I2QA 1NPPA 2MLZA 3SSSA 3HSGA 2KZZA 3KJVB 1JLGB 2FHJD 2CRLA 3GFXA 5ETQA 2R2RA 2WVEA 4Q45A 2W2PP 4TNOA 1BQMB 1ZPVA 4KT0C 3CJ0A 4LF4F 3DU6A 2HNYA 1KBRA 3HKWA 3HCXA 5KFVA 2AJ4A 4ETZA 4DQQA 2VU5A 3GJQB 4DUYJ 1WWHA 2W9BA 2IVMA 1IWGA 1VQKS 3GQCA 1ZM3A 3N4WA 1R3NA 1WOPA 2H9ZA 4LVNP 1KVKA 1Y5NB 3H59A 1TMJA 5AXNA 2QA4G 1YJTA 1HWUA 4RWXA 5F3TA 1XNQJ 4I69A 1C0TB 1GFWB 4DN0A 4DZDA 2CNNB 3N6MA 4F4AA 3FEXB 3H90A 4TLRA 5HP1B 2EK1A 4DSKA 2GX8A 3BB5A 3T5JA 4OMFG 2W4CA 3A1YG 2EKNA 4X65F 3QAEA 2LU1A 2PO4A 1M5PC 4C0OC 2G0JA 2AD9A 1KKHA 5L39A 2BOAA 1F5AA 5M2PA 2KU7A 3DHWC 5IWAF 1H98A 3TVZA 2KI2A 1HNXJ 3P49B 1BQNA 3L7PA 2HGNA 3CC4S 4HL9A 3EE3A 4ZOSA 3PW4A 4YR2A 2Z30B 5C42A 2R2SA 1HL6A 4X4UA 3A3PB 1PJ7A 2HKEA 3KJVA 2KJWA 2ALZA 4L72B 3V6KA 3EDRB 3BR8A 3HSJA 5DM6Q 5AE1A 2ILZA 2H51B 4P73A 2EFOA 3RG6A 1HW9A 1YJVA 4M5DA 3BBBA 1TQLA 4F4XA 4B9MA 3G86A 4OZLA 3VGUA 1NJYA 4DN9A 3TJ8A 2KT2A 1WJ9A 1TKXA 1LWCB 5D0HA 2VF3A 3M8PB 1EQMA 3CCJS 2WVCA 4EEYA 1RTIA 4F8RA 1QSSA 1U2FA 2WONA 3PW7A 1OMSA 1U1QA 2GHWA 3R5GA 2L9DA 1PG5B 1U6FA 2KO1A 1L3KA 1C0TA 1IKVA 2VPYB 2B4OA 1Z2ZA 3N0VA 1HQEB 5HP1A 1OJ4A 3M7VA 3GTYX 1CQNA 2GIRA 2V8PA 2EVZA 2ZDOA 4NMXA 1R8AA 3NGUA 1XBWA 4LF8F 3B82A 3IGNA 4ED3A 1T05B 3RAQA 1M0SA 3SSRA 4PXEA 4QPTA 2J0WA 4IH5A 1KVIA 1XR5A 1VQ8S 3B8HA 2B6AB 2M52A 4E8UA 1QY7A 4K4XA 1PCAA 4B9UA 2PE8A 3O8WA 2VA3A 5K8OA 5HJXA 2NZ4A 4ELUA 1BMQB 2YX4A 3UI3A 1K0VA 2HQGA 3ZTSA 3T1HF 2FGCA 1UVJA 2BKPA 3K5NA 1R6YA 1FRKA 4LR9A 2VBZA 3T5KA 3CCSS 4FN5A 4NE9C 1IN0A 2M0GB 2YPYA 4Y0FA 4CWBA 1AZSB 4P9SA 4CLUA 5E3QA 4DX6A 3J7YI 2A2DA 2ZWOA 4I6YA 5KT6A 1NBEB 2DIUA 5KFGA 1G1XA 1MWZA 2CPYA 2MB0B 5IFMA 4O44A 1RHJB 2GVDB 2QSWA 3TOQA 3TX0A 3BDPA 4NXMJ 3GB0A 4ZVFA 2I8EA 3PYDA 4X4RA 5DDRC 4BWMA 5KG2A 2HS0A 4Y65A 1RWWB 1YX2A 3A8JA 4DWIA 2H4YB 3UNGC 4QR0A 4ZVEA 1U24A 4I68A 4GO5X 4USUA 2D69A 4LSLB 3C2PA 3NCRA 3VAMA 1DBDA 2XS7A 4OX8A 1B0TA 4FF1A 4V1Ak 3NLCA 3HFVA 2CPHA 2ZJRQ 1NK5A 1HQEA 4DCJB 1JXVA 2DR8A 3I9V9 2WOMB 1CC7A 5GMDA 3PTWA 1Y00A 4LF5J 4QPXA 1SV5B 3MTKA 4RL1A 3BDEA 5LJ5Y 3DM2B 2QMUB 3AD7C 2RT3A 3PR4A 1B4SA 1G7CB 4USTA 2XC9A 1T94A 3PV8A 2U2FA 1T9XA 2CZVC 1UAWA 3CIZA 4IRCA 3R7SB 3CT9A 4NZ6A 4RJVA 1GMVA 4IFVB 1LEOA 1VBXA 2L9NA 4PWWA 4C6AA 4O0IA 2KHCA 4WYWA 1RKIA 2ZBIA 5T7LB 2ZHOA 5LM7E 1Q5YA 5KFKA 1AZSA 2DIVA 3L3CA 4DR7F 4DCPB 2HQDA 4RW7A 2ZBPA 1OSCA 1WACA 4QWBA 1WKKA 4ATNA 4Y2IA 1RZMA 2JEFA 2M2BA 3SSQA 1CJUB 3FFIA 1LQ9A 2I5JB 3EUNA 4DUTA 1YBAA 1U1MA 4LF1A 4F4YA 3WDOA 1RE1B 5LMUF 3M6UA 4N8NA 5RUBA 3IS9A 3CJRA 4U7UK 4CH7A 1T3OA 1H2TZ 3MCMA 1SL0A 4CO0A 3EZ5A 2Z2MA 3BPSP 5B0EA 2IPOB 3CD7A 1KOOA 1NDLA 5ETSA 3HI9A 3M6XA 5F8LA 1TZ0A 3GJSB 3DU5A 4N76A 4NLTA 2OPPB 5KT2A 4ECYA 2GAHC 3PYFA 4DLEA 2V4QA 1YVFA 5BYSA 1RT6B 3FQLA 1WC1A 5IQQA 4DLGA 2WOMA 2YKNB 5GAGU 5AJ3J 3S1TA 1RBAA 1S97A 3OR1B 3CCQS 2KTQA 5EWFA 4KGVB 1AT1B 1RJJA 3MUTP 2VB6A 1CJKB 2MQPA 3KYLA 3NGSA 4DR4F 2HHVA 4DX5A 4ICLA 3M2RB 1XNRJ 4G1IA 1CSJA 4F2SA 4C3LA 1RBLA 2XM3A 1HARA 4ZPAA 2EI5A 2IBOA 4QIEA 1RAFB 4QYZK 5GAHI 1HD0A 4MKAA 4IFVA 1Z1ZA 1BQXA 1T9UA 5A6PA 5K8PA 1YRXA 2GNKA 1VHFA 4WZQA 2DHGA 1GK8A 3TP2A 5T7LA 3F56A 4DL6A 4QR2A 3W2VB 4ZDNA 3THPA 3RW6A 3RZAA 2HWHA 3JAMU 4OZJA 1WDTA 3IRXA 3DLLQ 1C2PA 1HLWA 1TL3B 3JQMA 2ATLA 1EP4B 4P7TA 3KDNA 4IFYB 2P2CB 1V3ZA 1T11A 4NLGA 4OYPA 3R1LA 3CSKA 2DEIA 4WFNQ 1TKDA 3JTPA 1HBMB 2IC3A 5KT5A 1F2HA 2LQ9A 3LP2B 4A46A 2R2UA 1IM6A 3O5TB 1QE1B 1NKCA 2RE1A 5L1JA 3CCMS 5HQ8A 3G2XA 5H1SV 1LKZA 5KFPA 3KK2A 1GMUA 4FF4A 2YKMB 4ANCA 2RIJA 3L4BC 4AE5A 1RABB 2MJUA 3DI6B 1JLFB 4OYBA 3M2VB 2XLKA 2CJXB 2DBBA 1FRXA 1RT6A 2CDQA 1NMEB 4AXJA 4C0HA 3UO0A 3AJDA 1URNA 3ITHA 2M7SA 4P2MA 1ZETA 5A8RA 3IG1B 2DRAA 4CLYA 1GNKA 2P8IA 3Q8UA 4AT1B 1KQGB 2XMAA 1HI1A 1EARA 2W7AA 2ZBCA 4CO5A 2YWEA 1CC8A 3FQKA 1FJGJ 1CJKA 2DGTA 3QT6A 3PIPQ 3AOAA 5LJ3Y 4FVMA 2K1RB 5B0FA 4IG3B 1T03B 1KR4A 2R7UA 2HK2A 3FEYB 3AODA 4DDFA 2EFGA 5E3PA 2XS2A 1X9SA 4IYQA 2AJ0A 5EX0A 1JXLA 3T6JA 1BUXA 2IYIA 4TU7A 1WC4A 1REVB 4OHXA 3NG8A 1ZM4A 4OV6A 4USIA 5L1IA 4B3MF 3CNQP 3CGIA 3SXLA 1HD1A 4PAAA 1VFJA 2AIRB 5M2UA 2DR9A 1EAYC 4CZCA 2AEJA 2F4FA 3IAM9 1FKPA 1EP4A 5B0AA 5CYJA 1CJVB 3LQVA 2JVRA 2ADBA 2X1FA 4NCGA 1NUEA 1VHIA 2ZH9A 3MDFA 3OQ2A 2CWXA 4LF4J 4G6VB 1VIXA 1HBMA 4RBUA 3GMGA 1TL4A 3LP2A 3CJ4A 3BBFA 4ZLPA 5GAEU 3T1YF 2E1AA 1VBKA 1RAEB 1QE1A 3W5ZA 1QAIA 4M1KA 4ENOA 4MAKA 1VRUB 3F41A 2V4JA 3JS9A 4DUZF 1VGYA 2H5IB 2P9CA 2EXUA 1X4CA 2KM8C 1VQPS 5IV3A 1JLFA 1YZ6A 2MTLA 5HMXA 1WUUA 2LQ8A 1HIYA 1H2VZ 3K5MA 2ZUGA 3GP9A 2I0XA 4RW4B 2HHSA 2CQPA 4F26A 4EFAC 5E41A 4ED6A 1HNVB 3OTEA 1KQKA 3BGLA 3IG1A 5IOLA 4QWDA 2HFZA 4DSLA 4JI0F 3BH6B 2COLA 5I3PA 4X65J 2UU9F 3S8SA 4HEA9 2K1RA 1Q8IA 2PA8D 3BGUA 1RYRA 3PKYA 1Q5VA 5CD4H 1T03A 2QYCA 1HWKA 1MROA 2CPZA 4ALZA 5HVFA 1B64A 1ZBTA 5IWAJ 3MUVP 2W8LA 1WG1A 2HGLA 1RA7A 2ROGA 1X4BA 1KP6A 2FGOA 5KFSA 1H3DA 4Y00A 2ZH5A 3PHEA 2OLWA 3OVAA 1NH8A 4PPZA 2AKWB 3H2UB 2LXIA 3EPGA 4DCOB 3CO9A 3G8QA 4YR0A 1IBMJ 2BVZA 2HWTA 4O3OA 2CQ3A 1FFWB 3FK4A 2HFUA 1WF1A 3LGNA 3QLHA 4ZP6A 5D0GA 1P9QC 1SJRA 1CJVA 4YFUA 4GKJJ 4D3GA 4JV0A 1N33F 5K20B 1NK7A 3GYGA 3MEDB 3U7JA 4FYDA 3TAQA 3LOUA 3TAMB 3DDKA 4WJBA 1LWFB 4IG0A 1TTHB 2E1PA 2G13A 4NCBA 4XO0A 1VRUA 4I2PB 3W9IA 4ZA1A 4MK7A 1NSAA 3M9NB 2AJFE 1D9DA 1O5JA 3FCHA 3M8YA 4RUHA 3DGPB 1O6XA 4B3SF 2OP5A 3PCOB 3NL0A 1Q78A 2VQFJ 5KFMA 2MHNA 5KG5A 2HG4A 1WEYA 4WYLA 1BY9A 4RW4A 2ZM6F 2G1HA 2BKOA 2W9CA 4W4MA 2GIFA 3ILIA 3B6BA 4NA1A 2A0FB 3QBCA 3H4DA 2G0CA 3UFCX 2R8GA 1QAXA 2J6TA 4LVOP 4AD6A 2DNGA 1RWKB 1W26A 1YBTA 4FDFA 1N54B 1Y0HA 4C11B 3GV8B 3L7UA 4ZK7M 4M5LA 3JSBA 1D1UA 4HLBA 4OZNA 4ZJLA 4OJHA 2V5HG 3UCUP 4WU2A 1YBUA 3NCPA 3D3CJ 1LW0B 3BN7A 4ZCIA 2B43A 1FA0A 3MFIA 4JI8J 2XZTB 3Q8VA 1NPRA 2LFVA 1UFWA 4GC6A 5JMNA 2RUSA 3GFHA 3TUJC 4LBHA 1V3SA 1WEZA 1GAOA 3TAMA 3MD3A 1S1TB 2C2NA 3MR2A 4ZCMA 3D0HE 2FJAB 3DN9A 3KHRA 4I2PA 3GV5B 2HIYA 3W65A 2JLFA 2LEAA 5HLFA 3DGPA 4H4MA 5E5NA 1SC3B 3RYLA 3OL7A 4LF6F 4C48A 2XQCA 2E9ZA 3KNAA 4OL8A 5FLXU 4IKAA 4RX6A 4Z7CA 3RBZA 2OTJS 3K0JA 1OWXA 2W1BA 3G8TA 3LGHA 2IDLA 1N36J 3W61A 4MKBA 4CRJA 1UA0A 2ATCB 2B51A 1TFYA 2NXCA 4NLPA 2LECA 3OFFA 2AX0A 3T3FA 1RI7A 2D3ZA 2KG0A 1BXNA 3WIVA 4ES2A 3CULA 4URGA 2HK3A 4RUCA 5EDWA 3H2LA 3PDNA 3FRZA 2Q66A 1MMNA 3K5LA 3EICA 3QFHA 3UD5A 1NK0A 4M5NA 3CCWA 4C8NA 4KR0B 2FZGB 1RT4A 3NRBA 2XGQA 4MJKA 3KHLA 2EWHA 4D3HA 5DRKA 2XZWA 2J8SA 1FERA 1KEKA 4ZLJA 1X4DA 8RUCA 4DV0F 2AGQA 1UJ4A 2QLBB 1LW0A 2ERRA 4F0MA 4Y2KA 4DR7J 3SZ2A 1N56A 4O3SA 3D66A 3VHQA 2BQ3A 3IR5B 2VC1A 3CB4A 3P96A 2FC8A 2KT3A 4IOCQ 1FWKA 3OXGA 4RKUC 1NK9A 1H2UX 3NGTA 2A6OA 4RNOA 2RUGA 2WBMA 1DFDA 2ZH6A 4DPUA 5KT7A 2XO6A 3ZTPA 2FZKB 2GVZA 1WG4A 5L1KA 2WTFA 4W90B 2CG4A 3KOAA 4Q43A 3NOGA 1WTFA 2IJNA 1M90T 4JYAF 2FJWA 2I9SA 5L1LA 3C6UB 2JDJA 1UWBA 3OHAA 2UVWA 2D74B 4JP8A 5JVGQ 2QA2A 4RW6A 1RYSA 1UZDA 4PG5A 4NA2A 3D0GE 1NHKL 4LF7F 1FD8A 1JWWA 4O23A 2DXDA 4KJIA 3BPDA 2UXBF 4K4SA 2DK2A 5L9NA 3HZEA 1S57A 2CQGA 3QO9B 3AAWB 3G96A 2HBYB 2C2KB 3K5PA 3GFYA 4QIVA 1C1CB 3DRRB 1QUPA 2RU9A 4KY3A 2ZNYA 1VQOS 4I1TA 3MCNA 2ZD1B 1F3FA 1S7IA 2YNIA 2Z58B 4DR4J 4M5GA 1RWUA 4DL0C 5B0DA 3MM7A 1QSLA 3ENAA 4DU7A 1MMLA 3D3BJ 5DG7A 3HVTA 3KLHB 4ANDA 4ZIWA 4RNFA 2ZE2B 3M8RA 1NPKA 3J81U 5I3QA 5BYRA 3MUMP 4YB7A 2XY7A 1PIEA 3ADAC 1V5IB 3IM8A 3SEOA 5DQGA 3D1HA 1UJ6A 1F2GA 1U1LA 4CCHA 3GG0A 3A13A 3EGNA 1VQ6S 3GJTB 1M5SA 2YVSA 1RADB 4I4BA 1H74A 4ED7A 4LFCF 3MM6B 2CJKA 2POKA 3DMJB 4BWJA 2M88A 2QGFB 1JX4A 4ZLLA 2BJ1A 2VPWB 1CS4B 3U1NA 4J7CA 3IWLA 3AHPA 4QIGA 4QCLA 4PXBA 4LF2A 3R6GB 1S0OA 1WF0A 4M5IA 1U6BA 4ZVPB 1JLAB 3M05A 4ZP8A 4OI3A 3MM8A 4DV2F 2C3UA 5F9LA 1SKWA 1VQMS 2PFDA 5MLCV 3H98A 2OTLS 1N88A 1J2VA 3AT1B 3C6UA 5F0WA 5C5JA 1MU2B 2I6WA 3KWMA 1V9OA 2BZ2A 4PZVA 1PBAA 1KQSR 3FBFA 3L7OA 4RW9B 5JJBA 2CWKA 2N4CA 1XMQF 2BBEA 3DOMB 3IRWP 4IRDA 3MTJA 5G4DA 1T9YA 3UE2A 1SUQB 3BQ2A 1HWJA 3M8QB 2ZKUA 2KXNB 3N6LA 4NYPA 1C1CA 5KOXA 1N34J 2LXUA 5SUHA 1PJ5A 4A8SA 2CAJA 4UUWA 2UUCF 3PM9A 2EC0A 2LP4A 4PG4A 2DR7A 1U09A 2Y1IA 1X5TA 4ANEA 5KT3A 3ZTOA 1FTCA 3CMAS 1HNIA 2L41A 2ZZTA 2UXDJ 4FPIA 3HPOA 1IR1A 2NYHA 2OPRB 3C14B 2FLLA 1N5QA 4LFBF 3OD2A 4B3MJ 3NWRA 2L3MA 3PX6A 4PXDA 5CYMA 4NLRA 3C15B 3HMJG 4IR9A 2Q1LA 3UDCA 2VASA 5KFXA 1FHTA 2G2YA 3RB6A 2Z0GA 4DF4A 1N5TA 1UFKA 3M1VB 1U48A 3BH7B 3MM6A 3TVYA 2BABA 2NQPA 3AJ2A 3D28A 2A10A 1F0XA 4TY8A 3AD8C 1Z2LA 3TAPA 1S77D 2JLGA 2F4VF 4JUZA 2YX7A 2DHXA 1SC4B 1YKWA 1JLAA 2DR6A 1RU2A 4X62J 4CP5A 5F8MA 4AQYJ 2GV1A 3TQEA 2DNPA 3P6YC 3G6VA 5K14A 2KYXA 3HSDA 4NXNJ 1H6KX 4RW9A 1KFDA 3I0SB 2V2ZA 3HP6A 4YUDA 1T9TA 4OV1A 4LMZA 3LWMA 3IGVA 4NZ0A 6FD1A 4K4YA 2IJFA 2RRBA 2ZOMA 1FRIA 5ITHA 4CIOA 5EGYA 1DLOB 1SC1B 3OUYB 4V19J 1S9FA 4HTIA 3M8QA 4CNYA 3MMAB 3KJNB 4MK8A 2C3OA 1H73A 5FDLA 1WHYA 5J2MB 4J9QA 4FNHA 5ADZA 4Q2LA 1U02A 1M1HA 2BRKA 3AQPA 2F65A 3KLIB 2F63A 4O3PA 2AU0A 4DBQA 3NAHA 2NZCA 2YH0A 4Y28C 2EW9A 2BE9B 5AE3A 2UZAA 1U0HA 3BYRA 4P2FA 2X1AA 3C14A 1N5YB 1Q95G 2HS3A 3KK3A 1SXLA 2KXHA 2K7JA 1J5EJ 3V6DA 1SH3A 2YWKA 3R6LB 3TA2A 4DR1F 1ZAVA 4Q7AA 2N3LA 3T5LA 1WC6A 3UR0A 3H5XA 4NI2A 2P6TA 5KFFA 2R7WA 4R0EA 2ZHAA 2WK4A 4IO9Q 2M3DA 2BJEA 3R5JB 1Q79A 3QWUA 1N33J 4FYVB 1KS2A 3PFEA 3ZFVA 2M4MA 2ZKTA 3BQ1A 3IN5A 1RTDA 1TUWA 2RQMA 3K89A 5C7PA 1TVRB 2B5JA 3JSYA 3DOLB 3GONA 3GILA 3H8YA 1N6QB 1UEVA 5LSOA 1PKUA 4OZ1A 1JB0C 1RTJB 2PDAA 5IT4A 1RHUB 3PG9A 4EBCA 2YWFA 2HFSA 4B3SJ 1I6JA 2B8PA 3I0SA 2QIFA 4AUKA 1IJFB 1KTQA 3Q8SB 4NL5A 5K8MA 5EWEA 4ILLA 1NM2A 4IOAQ 3ZNJ1 2ZM6J 2JLEA 3A4TA 4LJMA 2BJ7A 2BM1A 4YY3F 3VTIA 2WSEC 4A4JA 4WTOB 2CQHA 2AYMA 1RCOB 1FKOA 3GR1A 2NYIA 5DDPC 2JWNA 3KLIA 1FFSB 2GJ2A 2M70A 3S01A 4QWCA 1S7HA 3Q2SC 5IC6B 1WHXA 3TRGA 1WOSA 3CC2S 4BC7A 3GZ7A 2RB7A 2YTCA 1SVDA 1U6ZA 5T14A 1P27B 2APOA 4DS5A 3D67A 1W2BR 1QD1A 3AB2B 3M6WA 4C7QA 4I7FB 3MMBB 3FGVA 1NKBA 3BSCA 2W4DA 1FRJA 3NGKA 1LWEA 2MY8A 4MKYA 3G87A 2LQJA 4LR7A 2P9GA 1PAUB 1HBUA 4M63A 3RGIA 4PYDA 3IR7B 5I42A 1FK9B 1C0UA 2NPFA 2BR0A 2OELA 5GMKa 2FHOB 3ILOA 3AY0A 2VV5A 2QO3A 2VOPA 4KV8A 4J91A 2HMIB 1TKTA 4MIWA 3QSIA 2GAGC 1V5VA 4ID5B 2QJ3A 2DNZA 1TVRA 4OHZA 2UVRA 5HMZA 1X31C 5CYQB 1B99A 3OFEA 2IM0A 1WC3A 4IH6A 2PC6A 1PYOB 2FLOA 1QSYA 3BSOA 3HVWA 1UCNA 4JI2J 4Y34A 1RTJA 2HVHA 2XYGB 4DPXA 3NXZA 4TKTA 3CC7S 4OHWA 4DI6A 5IC4B 2R2TA 4LF6J 2NPIA 1JKHB 2JRSA 1R31A 3DYAB 2JVOA 3VAIA 4ES1A 1YSJA 1RU1A 3MEEB 1CBKA 1LW2B 2KB2A 3SDEB 1U2RA 4LIRA 4N8OA 3KDOA 1E6VB 2KH9A 3CPWR 2MQNA 1D3WA 3FCWA 4UY8T 2DH8A 3KMQA 1OYEA 4KRWA 1SB6A 3W3SA 1VQ5S 3KLVA 4ZMMA 3RB3A 4HHHA 3R9LA 4YS2A 4CLKA 3W64A 4KFBB 4Q0BB 1HBNA 4GO7X 3NMRA 4JOUA 3MWBA 1SQEA 1HNZF 2HBQB 1YDLA 2IBKA 1UTAA 4RUAA 4DV0J 1WC0A 5KFBA 3CCUS 2GO9A 1FK9A 3SFUA 5C25A 1ACMB 5DG9A 1WNEA 4RUBA 2WW4A 3W7BA 3AJ1A 2O01C 4I6WA 4OYIA 4FZVA 2A2CA 2IFXA 1NDKA 1SQGA 4IH7A 4DR6F 2FHJA 2HMIA 1OQ6A 4DPYA 1AROP 4DPWA 4GC7A 4MFBA 4KPYA 2VC0A 2G2OA 2QSFA 2HEKA 1DJ0A 2UP1A 2HRYA 4CLSA 1KOHA 2J76E 1AFJA 2RF2A 3TZWA 5CYQA 4B17A 3QT5A 3U02A 1UVIA 4JYAJ 2P9EA 4ZPTR 2J5AA 2XMKA 2F5GA 3NNHA 2BV3A 2HQCA 3PACA 5KG6A 2OFGX 1HBOA 2D3UA 4KGKA 2DHAA 4ETXA 1YLXA 3MECB 5DLFA 4LF7J 1DHMA 1U25A 1ZOTA 3E01B 3DYAA 4L6V3 4DR3F 4I0WA 2LQ5A 4X4SA 2UXBJ 3KK1A 2VDIA 3MEEA 2DNRA 4P75A 3U1MA 2XG8A 1L3TA 3SDEA 4RO0A 5LSLA 4R8UB 3QRRA 3TVKA 3A12A 1EX8A 1L3SA 1S12A 3CDEA 2JX2A 2DCLA 1JLCB 3ZZOA 2WVFA 1R7IA 3V4IB 4J9RA 1IBLF 1VQ4S 1VCTA 1EJ7L 2GIQA 1D0EA 3R3TA 1VIOA 2V8DA 4YP3A 2DRDA 3KLEB 4C97A 4Q0BA 3HFKA 1RBOB 3VV2B 1UFLA 2CQDA 3I0RB 1VRTB 4NWBA 3SV4A 3B4MA 4PUOB 3MCSA 2BE2B 2XB2D 1PGZA 2VG7B 5HBMB 3CD6S 3M9MB 1QJHA 1X4FA 2VQEF 2YPZA 2KL8A 4ZITA 1UJ5A 2YKQA 4C3MA 2GA7A 1XIQA 1ZA2B 1VK8A 3B78A 3K5OA 1MWQA 4F4WA 3P4UB 1VJQA 1Q82T 3CCVS 4K0KJ 3UD4P 8ATCB 3M30B 1BWVA 2QN6B 2LKZA 3OR2B 3N01A 4DOZA 3T6BA 2N7CA 4KSEB 2ZJQQ 2ASLA 4O4GA 3RW7A 4DV2J 3TI0A 2JHEA 5HAOA 1WG5A 3DLEB 5KFAA 3C6TB 2FD2A 4CLPA 4USVA 2XYHB 1KSPA 4XDDA 3B4DA 3VGVA 2Q6CA 4Q44A 2B56A 3CJSA 3NOCA 2IM1A 1S9EA 3K7RA 5C24B 4UT4A 1XMQJ 1Q0NA 4TQSA 4FP9A 2C2EA 2O1PA 3CCTA 3BR9A 1BD6A 1VLYA 2QX0A 3HK2A 4OX9J 1X7VA 2YKAA 2FQQB 1NNDA 4P6QA 1JLCA 5CZXA 4B9VA 3FRYA 2WSCC 1FVSA 1SJ4P 2HVDA 1F6TA 5BYQA 3V81B 2GQCA 2UUCJ 4O3NA 4MIAA 3FSIA 5CD4A 3R97A 4KKOA 1RUSA 4CYUA 5CAAA 3KLEA 2UUTA 3THVA 2HFVA 5IT9Y 3F44A 2D9OA 3K58A 1VRTA 5HVGA 4WP3A 2MKCA 3UN2A 4LFBJ 1FX2A 2BE2A 4CTAA 4ZPCA 2VL1A 1ZS6A 3H5UA 5HBMA 3IBFB 1DTTB 4WPAA 3G82B 4C2MA 1X60A 4FKYA 2D9PA 5DGAA 3MZIA 4FVCA 1Q1KA 1Q16B 4Q2MA 3ET6B 2MQOA 2AQ4A 4PYAA 6FDRA 4M5HA 5EN1A 4J9KA 2UUBF 2W8KA 2DHSA 2W4PA 3M30A 5HO4A 4LF9F 2F4VJ 4HKQA 3OR2A 3MURP 3CD0A 4C8ZA 1LNQA 4N5SA 5L9XA 3RR7A 4TN2A 3ZZTA 2BANB 4CH0S 4DQIA 3MGJA 4NPOA 3TARA 4P2XA 1MSWD 2IMWP 1U2CA 5U47A 2GO8A 4USMA 6AT1B 4C8YA 4OHYA 3D4JA 4PKDB 3HHLB 4M5JA 2CZ4A 4EBEA 5D8HB 2ZOGA 3SQGB 4A8XA 4I2QB 2AV5A 5C24A 2JJ4D 1CEZA 4IUFA 4NOHA 2W24A 4IDKB 4ZVQB 3X1LB 3B54A 3QGHA 5FJ4A 1FRLA 3J7Z5 5A2QU 3HLUA 1JLQA 1B3TA 4MIBA 4P2SA 1N32J 5ETKA 3T9NA 2H4WB 4J90A 2OSRA 1K1SA 2XWXA 4EUVA 1S6PA 2EK6A 2HNYB 1SI9A 1TL1A 2GW8A 4Q8FA 3PR5B 2KHDA 3H0PA 2AMCB 5ETTA 1QUVA 5DQHA 1JNRB 1FE0A 3HT0A 4OJGA 4BBYA 2D41A 2W9BB 2EPIA 1FWLA 4B3OA 3W5XA 1M5HA 3OLBA 2C2OB 4JI5J 4WFBQ 3KKFA 3W8GA 1M1KT 1REGX 2C3YA 4JI4J 2W25A 4ZN1A 4B9LA 4DR1J 4OYZA 4CT9A 3HKZD 4CO4A 2ZH7A 1RT2B 3ETOA 4TYAA 2P5VA 1IJEB 3K59A 3ET6A 3LA0A 1O51A 1XQIA 1N5SA 3LH2S 1P1TA 2ZC3A 1OY8A 2PEBA 2QA1A 4K7QA 4ZVUB 3VAKA 5GMEA 4X64F 3DXBA 4MT1A 1S76D 2Y3YA 5ETNA 2XMJA 5KFTA 2DH9A 3EM1A 3HT3A 2I1RA 1SBRA 2YKPA 1RT1A 1NU4A 2RD5C 1FJCA 2BANA 2FJVA 1WI8A 1SH2A 3IR6B 3Q83A 4Y2MA 2VG6A 2NCKL 3MR7A 1CPZA 1WELA 2N3OA 4NRTA 1P9YA 3X3UA 3ZZZA 4BHQA 2IA0A 5C42B 2D3OR 4IDKA 2WCXA 2PMWA 4WIIA 2Q79A 4K4UA 3AD9C 3FBCA 1YK9A 3QFWA 3O6QA 2CNKB 3MD1A 3OJUA 5J1NA 2PN6A 4WFXA 3EJMA 2MEWA 1HHQA 1RAAB 4M5DB 1GXLA 1N5VA 4P52A 1R43A 1FRHA 2HWIA 2LLZA 3OHBA 4Y6IA 3UDLA 2VBXA 2H48B 1EETA 2DNHA 4MYTA 3VVUA 2VOOA 2RDIA 1TKXB 3V2UC 1MNEA 2E5IA 3SMZA 2QT7A 4EBDA 2DO0A 4LT6A 3RJMB 4UQGA 4OI1A 1B0VA 3QIDA 1RTIB 3PIOQ 1XK8A 3CIMA 4HDGA 2WONB 1UA1A 5FD1A 1VQ9S 1VISA 4TYBA 2E44A 2WRMA 4IRKA 3D68A 3PEJA 1RT2A 1UPPA 1IKVB 2IRXA 2NXUA 1TUVA 3DLGB 1F9HA 2BE7D 5A6WA 2ASJA 3RU0A 2C22A 4ECTA 3NMAA 2NXJA 4ECVA 4FYWB 1RHQB 4YB6A 2RDJA 3MXHP 1AW0A 2CG8A 1B70B 1MG7A 1J5OB 2DHHA 1X4HA 2HHHF 1SIZA 1G2EA 2WVDA 4F02A 4JI7F 4I64A 3BM7A 2B7BB 3AXKA 4FBUA 1MLAA 2OHDA 5HMWA 3L9ZA 4UOFA 1K9MT 1OSDA 4A8QA 4ZJOA 4N77A 1PAEX 2DGOA 1IKXA 1A7GE 2MLXA 3I87A 3M8SA 1VQ7S 2A18A 1Y7PA 2IMOA 3KLGB 4NLOA 1UPMB 1VR6A 3UCGA 2AJ2A 1RT7A 2HNZA 3C3LA 1ZH5A 2ZNZA 2KVIA 1FKAF 5EWGA 4RLEA 2JFDA 2MDAA 3L09A 4HR2A 4O44B 1UEKA 1NJZA 4KPCA 3I82A 5KG3A 2YQ3A 3TUPA 2EFNA 4TQRA 4CLTA 2WSFC 5AXKA 2V9WA 4C0BA 2N82B 1FI4A 2RHQB 2W2NP 1SC6A 2GQ2A 2UXCF 3N6NA 2X1BA 4EGLA 1NDPA 2BUNA 1HNZJ 2YQ0A 1V3RA 2Q43A 3LP0A 3MEGB 5M2RA 2HBZB 4CLLA 1NDCA 2HZVA 2R7TA 1TR0A 3BZQA 2GS8A 2HRUA 3Q8YA 4X4OA 3DLGA 2DNQA 4DR6J 4PG6A 3EX7B 4Q8EA 4KAIA 1JJCB 2XGPA 4M94A 2W9AA 4F0HA 2ZH3A 2GGPB 1M5OC 1PSDA 4X2BA 4H4OB 4DSFA 1C1BA 1J5OA 3KG1A 1S5ZA 2G4BA 4DUYF 3HX9A 2CJBA 2BM0A 5HSPA 2DNMA 2DY1A 4ES3A 3QT7A 2G2ZA 1Q8KA 2PGCA 1OPZA 3K57A 4KO0A 1ZYQA 5KG1A 2V50A 5HQMA 3TZZA 2RILA 2DY9A 1AYEA 1Y5IB 3JTOA 2PA3A 4K4VA 1A6LA 1XTZA 1XNQF 2R7XA 1DQ8A 3W60A 4AL5A 3KLGA 4DR3J 1HNWJ 1TUGB 3J81j 2LCWA 4UZBA 3BREA 1SCJB 4RW7B 3ZZYA 3CO0P 3Q8PB 1M5KC 3D6HB 2JH3A 2M9KA 1TV6A 4FNIA 2OIHA 4JI1F 1X5SA 2ASDA 3R5DA 1FESA 3FFIB 4WIQA 1LV5A 2UUAJ 5KFOA 3TUZC 1FF2A 1GXTA 1IBLJ 1NSPA 1LK5A 3BS9A 1W7WA 2HPUA 1R8CA 4MTPA 2HHXA 3IS9B 3TJAA 3DRSA 1NAQA 2QTWA 4X4PA 3OL6A 3IWNC 5LSRA 1HNXF 3BO4A 2Q3PA 3MEGA 2CFXA 4C8MA 2BJ3A 1XN9A 1U1OA 2DKOB 3GFZA 4DEZA 3VAHA 3QAUA 3FMBA 1YJ9S 3EVMA 1UZHA 3FBEA 2GGPA 3R1HA 3D0IE 4H4OA 3DRYA 5MAOA 3DFEA 2K2PA 2AZ1A 4ICLB 4G3IA 2V4RA 4KHRA 3K8WA 3DRPB 1LFPA 2JEGA 1T9WA 1TL5A 8AT1B 5A76A 3CE8A 1JQGA 2R8KA 1S1VB 5KFYA 4J9VA 2ZZNA 2KFZA 2EBEA 2CQBA 3PNIA 3N5FA 1NJWA 4JV5F 1R6VA 3RR8A 1FVQA 3D6MB 3Q89A 4DL3A 1FEEA 2OPSA 2QE5A 4B9SA 3ILJA 1S9GB 2F8MA 3HULA 2MYFA 3IRXB 1KC8T 4DV5F 1NSQA 2N7YA 3R5BA 5G0RB 4EK2A 1S0VA 3SCLE 5J2NB 2J8AA 3ZO7A 2BKNA 2E7WA 1TAUA 3ELHA 1T95A 3Q8QB 1IKYA 2IC3B 1FO1A 3TNVA 3JSMA 4QJVA 3MAQA 4XTTA 4A8YA 1UP1A 4A8MP 2MQQA 4LQ9A 2LQBA 1RT5A 2VUGA 2HNDA 1B7YB 1FDBA 4YN3B 3DLHA 3KK2B 1CQMA 1ICEB 2CNLB 4U7CA 5KAKA 3NKYA 3A3NB 2GZOA 3O2IA 3HHDA 4PEOA 4OYXA 2MKHA 3CJTA 3O44A 1RWVB 1OO0B 1FDNA 3ITHB 2Y0BB 4C8KA 1I1GA 2HIQA 1RWMB 4NLUA 5A8RB 1HYSB 3WHIA 4P71A 2VFUA 3HF5A 3H7HB 4CLFA 3RUBL 9ATCB 2UUBJ 4LF9J 4ZKAA 1XR6A 3F73A 4NXMF 2XHCA 1Y11A 1S49A 3W9JA 4PXCA 3DRPA 2H65B 1MMDA 5F0UA 9RUBA 4EO8A 1U1PA 3ZC4A 1FFGB 4F4KA 2HVZA 1S1VA 2L08A 3Q2TC 5LT5A 5AT1B 3VZHA 3P5BP 3ICLA 3HJVA 2PMHA 1RWXB 1SL1A 3T5HA 4DHVA 3TQ1A 2NS1B 4U95A 3MMJA 2UVVA 1N48A 2VD3A 1S9GA 1I3OB 2Z57B 5G0RA 4DZ6A 1T02A 1S0MA 3HHNB 5J2NA 1FKPB 2CPXA 4LF5F 4NCGB 1N0VC 3MAAB 5J2QA 2AW0A 3WC2A 2J6UA 3FC9A 3HM9A 1DRZA 1U0SA 5A0YB 2HW3A 4WE1A 2LA6A 3ISZA 2MQMA 1XERA 2OI2A 2H3EB 2CJYB 2IVFB 2MSTA 2R3VA 2RS8A 4KC5A 1WKLA 4I56A 2V4JB 2ZOFA 2RKIA 1Q8LA 2HFOA 1S79A 1D09B 3I5AA 1U49A 1KLMB 4UOGA 3RBEA 3OSNA 2IJRA 2JSXA 3BGRB 2O3DA 4ELVA 1TK5A 1Z4UA 4JI3J 4YQWA 4C8OA 2HGMA 4PG7A 3W66A 4KH0B 1HYSA 4X64J 4PQUA 4YEAA 3CJ3A 2O5DA 4J9OA 5B0BA 3OL8A 4NLVA 4B9NA 3EXCX 2CIMA 3V4MA 3TUIC 2CNOB 2DCUB 4MH8A 1JLBB 1TP7A 1MROB 1NZ8A 2V8VA 4JI6F 4CI0B 2RH3A 1PYSB 1R8HA 4TY9A 3MM9A 4DL7A 4DJBA 2RQKA 2FJEB 5BR8J 4BLGA 2IRYA 4YR3A 3AA9A 5GAGI 4X4TA 3PX4A 1Q4RA 4ZVRB 2OUGA 1U8SA 2DT9A 4A47A 1NJXA 2QL5B 3CDWA 2KVQE 5HVHA 1YIJS 2DGWA 3G6YA 5L38A 1HKAA 1T9VA 4EWTA 3QLHB 1VDHA 1IR2A 3DCAA 3MAAA 4U8VA 3OTDA 3ENWA 2LEBA 4OZ0A 1Y5LB 3KG0A 5A0YA 3OBIA 2DD8S 1I5OB 1FDAA 4NRUA 5KFLA 4OFZA 3IC1A 4IG0B 3HXMA 1KHWA 1OIAA 2VBWA 4K59A 4N41A 3ZZ0A 1I51B 4ECZA 2FIUA 3C16B 1Q86T 3C46A 1S6UA 5KFDA 2CUYA 5A8WB 2XCAA 1Q7LB 1WSRA 2Y1JA 2JL9A 4HHJA 1KLMA 1RGVA 1U45A 2Y9HA 1R89A 3BGRA 3QJLA 4XPEA 2YXLA 3EGZA 3BSNA 3M32A 2W9CB 4NLDA 3P5TL 4HYKA 3OVBA 4J5OA 3PY8A 3PKMA 2NUUG 2HHQA 2GJFA 2Y8YA 1DARA 3J80U 2GHVC 3CUNA 1XMOF 3TANA 5CCLA 1Q8BA 3I5BA 1JLBA 5ETVA 1SJ3P 2F7VA 2EKYA 2GMLA 4OHVA 1U8WA 1YQHA 4KGXB 3UN5A 1VQSA 5KT4A 1Q7YT 2K3KA 4LBPA 4YHHF 3NWGA 1PILA 3PVXA 4WK3A 4W92B 3I55S 4F3MA 3VAFA 3OXLA 1KQFB 3C66A 3CJKA 4HH1A 4DV6F 4R5PA 2DGXA 2O67A 2FVSA 2X3DA 5D78A 2DNLA 1ROFA 1RAGB 4QQBA 5KFWA 3DRXA 2V2QA 2DJWA 1KTVA 3FJ2A 3G9CA 1S72S 2RRAA 2YQ1A 4IR1A 4F3OA 2DITA 2X7IA 1TL7A 4LQ3A 2XY5A 2DH7A 1E6YA 3H40A 1X5PA 3DGVA 3C16A 3G6XA 5A8WA 1U1NA 5HLFB 3FCVA 4H4MB 1OPIA 4ZPBA 1UETA 3GLJA 5F8HA 4ED2A 1KD1T 3IBCB 4RWWA 3Q86A 2NREA 4MYUA 3PRDA 4USJC 1EB0A 3BKFA 3IXQA 5GAEI 5LXRA 2OGUA 2Z56B 4R25A 5LMNF 4UZCA 1B0PA 4HI1A 5KFNA 4LRBA 1X9WA 5F8NA 1X5OA 4LF8J 4OI2A 3P45B 3OXFA 2FVCA 3MEKA 3CXCR 4ER8A 4AXIA 4DFPA 3GCXP 3CCRS 2RVJA 3RTVA 1RA6A 1GXUA 2HZCA 2J7KA 2NXNA 3KUEA 5DDQC 4FBTA 1UKUA 2VIHA 4WWSA 2KXFA 3Q23A 1XR7A 1TMMA 1GMWD 4NLXA 1X4AA 5D4OA 1RT4B 4E2FB 5D0RA 2HVIA 3T1HJ 4K2XA 2FJDB 3DXSX 3P8BB 1FT8A 3E3XA 4ED5A 1YI2S 2DGQA 2AGPA 2VJUA 1JXEA 3HSZA 2YH1A 2FVRA 4U6PA 1CVJA 2DYAA 4F2RA 4WF9Q 1JIHA 1UVNA 1SJFA 2PSZA 3V5RA 4JI1J 4IQMA 2CPJA 2R7OA 1X0PA 3UN3A 3GU0A 1S48A 2R4FA 1S1WA 2GVZB 3J7YU 1FXRA 1S6OA 4ID8A 2OH2A 4J9UE 7FD1A 2OPQA 3M9OB 4HDHA 4DV3F 3RRHA 3S6EA 2ZWPA 1T7PA 2B9XA 4DL5A 1UWBB 2JEIA 4RW6B 2CVEA 2WB1D 2Y1LB 3C19A 5HN0A 1APSA 4U9RA 3NS5A 3M8ZA 3KG4A 4YOEA 2F3JA 1IBMF 1JLGA 2NSCA 2RDDA 2FVQA 3G71S 5I4MA 1U26A 1JMTA 1S4FA 3QPIA 2ZVIA 4GKJF 1BQMA 3AXMA 1KNZA 3W1YC 3MCOA 4OIXA 3SYZA 4AYBD 4E98A 2NXEA 4CLWA 3EVWA 3PFOA 2QL7B 2YNIB 2MGZB 1SH0A 2HFNA 2BOPA 4EYHB 1NZAA 3MM7B 5AXLA 3HVTB 5F41A 4DMZA 4PWDB 4K5RA 1ZAWA 3VGTA 2R7VA 2AF6A 2DGVA 2VQFF 2DGSA 5GADI 4ZP7A 4OYWA 2VHGA 1C4CA 3E8OA 2HSEB 2B7CB 5HK4A 3LGMA 4UW2A 4FYXB 4JV5J 4ED8A 3WX8A 3R7NB 4DR2F 3AB4B 2JFKA 3N79A 1X9MA 4NLQA 4DV5J 2V0NA 2ZBQA 3LAKA 2VFSA 5DO2A 1KWMA 1F9FA 2KM8B 4WKYA 3EGVA 1GTHA 1QVFR 5KFEA 5LMUJ 2E1MC 3BQ0A 2XI3A 1NB7A 1WF2A 3VR1A 3AFGA 5KG0A 3MM8B 3T9ZA 3N9UC 4WU3A 1VC6A 2VFTA 4OQJA 3KLFB 3CCLS 1Y10A 1RAJA 2V69A 3CJ5A 3NEKA 2J0QD 5A2QY 4DU8A 1N8RT 1YJRA 4OYAA 3LALA 5LXYA 1JNZB 2E1CA 4KIAA 4USWA 4OYOA 5HL7Q 4WK1A 3BBCA 5I3UB 4JI8F 3E2EA 5D4LA 2E7XA 4O0NA 3WQPA 1FNXH 4UOHA 2G0IA 3VCDA 4F67A 3GPAA 5CCMA 3LPYA 5DZ7A 1ZTWA 2OMLA 2HLTA 4PR6A 2MGZA 5HQLA 4CT8A 2G1DA 1VJWA 1KONA 4PCQA 4J9MA 3KTQA 2EC2A 2XLJA 2LVWA 4WP9A 1XWLA 4DFKA 1SKUB 2FHKA 1LWCA 4P10A 1N0UA 4A8OA 2DISA 3M8PA 2BJ8A 1HNIB 4PWDA 2M8DB 2XY6A 2MKKA 5CABA 2FY8A 1IWAA 3NBPB 1RWNB 4O3QA 3GSDA 4ZCLA 5AE2A 2DNOA 2VBYA 4DV7F 1DQ9A 3D6TB 4RW8B 5CYMB 1YHQS 3VZIA 1W2IA 4B08A 2E5GA 5GAHU 1MN9A 4DSEA 1WHWA 4ZPDA 4UQTA 1N36F 2HVEA 2XS5A 2QLXA 3Q8RB 3D6FB 1T05A 1IQTA 3TZYA 2ROPA 1D8ZA 2HHPA 4TY8B 1S4EA 2FZCB 1RWPB 2VKRA 2QFJA 1BHNA 3HVRA 1FJEB 2B6AA 3QJJA 5DJBA 3CJ2A 1VS3A 2HYIB 4BS2A 3KLFA 2AYBA 3R2DJ 4I6AA 3FEZA 1DURA 1VBYA 4FYYB 2DNYA 5K14B 4K2JA 1WD6A 4OLOA 4DSJA 1BE4A 2V34A 2ILYA 2Z2ZA 4J9PA 5KTQA 1YJ7A 1YJUA 3QGPA 1X8DA 5I3UA 4DS4A 2XMMA 2C42A 3DC2A 1UW9A 2IM2A 2DEJA 3FZBA 2EBGA 5FDLB 1KHVA 3GJRB 2KT5A 2HQ3A 4RZRA 2DB1A 3OFHA 2GVDA 4TU9A 3QRQA 2H5JB 1VQNS 2AJ1A 2VJVA 5HATA 1HQ2A 2VH7A 4ILRA 5KFZA 2KFNA 3HHLD 4JI6J 4RBTA 1U0HB 3Q22A 3P3DA 1D9FA 4GKKF 5K9FA 3PW2A 3LUYA 1QLNA 3BKTA 1IKWB 3BO3A 3NBPA 3KK3B 2BACA 2CQ1A 2MLYA 3CTRA 4LSLA 3EYZA 3V6DB 2YWWA 3UDVA 4RW8A 1KVJA 2XWYA 2WVBA 1BGXT 4F50A 2Y0SD 1YITS 4NI2B 1ZTTA 2EG1A 2XMUA 2QZ8A 3QRPA 4XPCA 4OJ1A 2C1EB 2CQ2A 4ITSA 4A8FA 3LW5C 3LF0A 2VPXB 2B4UA 1RCXB 5K8NA 1SV5A 3PW5A 1NCLA 3I4PA 3DM2A 2CQIA 2ASYA 2RU3A 1KN6A 1RTDB 4WXWA 3EPIA 4TU8A 3T1YJ 1ULRA 5B09A 3R5AA 2B5JB 4ED0A 1P8GA 3TX8A 3KXDA 1S59A 5IZHA 1VC5A 4DUZJ 3O1LA 2V2VA 1VBZA 5ETOA 3OW2R 4QZVB 5CQGA 2WZ1A 2BX6A 1PC5A 1R0AB 4MMOA 2GC8A 3EGWB 3Q0AA 2OEJA 4A8WA 3R5CA 2VICA 4JV1A 2MHEA 2KG1A 1SJQA 2A6MA 3GG1A 1YJWS 2ZJPQ 2Z2YB 4XAKA 4ZLNA 2FLPA 1FKOB 1CJUA 4HH0A 4AL6A 2I5JA 4JI0J 3A8IA 2UU9J 3GCWP 2NLWA 3OTCA 4C3KA 1XMOJ 4RR5A 2LDIA 3ZZRA 2V8HA 2X51A 2RJZA 1QAYA 2DPIA 2HRTA 2HHTA 2RHSB 3KHHA 3IAS9 4C98A 2DRBA 3KJFB 4U96A 1IKWA 5HI7A 2OJ3A 1LWEB 3PEHA 1SJ1A 4A48A 1A9NB 5H9FJ 3MHYA 3W63A 2AJQA 1XJWB 2OPPA 1JK9B 1HMVB 5DS7A 4YHHJ 2QFIA 1HBUB 3IA0A 3HD1A 3NS7B 1GEHA 5I42B 4FS1A 3W2WB 1C0UB 2F8EX 2QL9B 4DFMA 3GIJA 4ZHRB 2YKNA 5E3AA 1ZZFA 4DV6J 2V63A 1IVZA 2B4PA 1VMBA 3OR1A 4KBIA 1AFIA 1RXOB 4KV8B 3LO3A 1N34F 2EFQA 2IYGA 1TKTB 2HZAA 2WAQD 3M2RA 4WFAQ 1EQ0A 2BEFA 3ZZUA 4DQPA 1IUJA 3HHEA 5H9EJ 1QAJA 1UL3A 4M8LA 3OTOF 2AT1B 2R7SA 4M5KA 1IQZA 1KFSA 5E2QA 2UXDF 2E29A 1SKSA 5KFJA 1IBKF 3VAJA 1F5BA 5D6GA 4JB8B 1R0AA 1U4BA 4ECWA 3ILLA 2XULA 2W7OA 1D8YA 3J7AN 3W2VA 1FD2A 2M8HA 1EZZB 3OPKA 1CG2A 1LOUA 1LFWA 2J9CA 5F3ZA 5J2PB 4EMDA 1T0TV 5LMNJ 1AXQA 3UD3P 1TL3A 3HDSA 4NLWA 4IFYA 1U47A 3IWXA 4F04B 1JJHA 1F5CA 4WKRA 1WHVA 4F36A 3SIPB 4NCAA 4G1QB 1RAIB 2HQFA 5D77A 2CKWA 2OO4A 2PEHA 5GVQA 3FKBA 5DGBA 4X62F 4WZMA 2ALYB 2W2MP 1HBNB 4AQYF 4CDIA 2MKJA 2MKIA 1N4LA 2YKMA 2MZ1A 3HO1A 3QYYA 2YWHA 4NXNF 3DI6A 3QZ8A 4NEZA 1HMVA 3M2VA 1I94F 2BW2A 1UWAA 2B4VA 4PPDA 3UNYA 5IT9U 5C25B 3W2WA 2HS4A 1P1LA 1SL2A 2CPFA 2V6AA 3VGSA 2V94A 4ZHRA 4B3RF 1OY9A 5E7OB 4B02A 4LFAF 2LYVA 4ECUA 3LTOA 1PJ6A 1ZPWX 2VG5B 4MFBB 1PBUA 4LRCA 4USKA 1RAOA 2W2OP 2VKZG 2RF2B 1VLOA 2GCFA 5SZTA 4IG3A 4AL7A 1KRPA 3MPVA 5KFCA 2BRLA 1RLDA 2DNKA 2OEMA 1W25A 3FNNA 1HFEL 4K5SA 5B0CA 1CLFA 2QC3A 2PFFB 4LUBA 4K8RA 3ZZPA 3D1OA 4FF2A 1KDNA 2V9KA 4DV3J 1NK8A 1K8AT 2CXEA 1VK3A 1REVA 3DKDA 1HBOB 1J5EF 3J7A1 4K4ZA 3UWTA 1K73T 3TZXA 1LK7A 1WORA 1S1XB 1MW7A 1N52B 1IR0A 3KNGA 1L3UA 3R7BB 5J2PA 1HPZB 4DFJA 3KK1B 1YRUA 3PX0A 4KHPF 4OI4A 1J27A 5KFUA 2FC9A 4RNHA 2CQCA 4X66F 3DLJA 1NB2A 1F1BB 3WZ0A 2VDHA 5J1EB 4URSA 2FPHX 4G1QA 3HVAA 2U1AA 3GIKA 3WX4A 1HR0F 5J1PA 4XIUA 5D15A 3HFZB 4FPRA 1WC5A 1YWXA 3CDBA 3NGRA 2J0SD 3PJWA 2UUWA 4YDXA 3RB4A 4QBUA 1GQEA 3PYGA 3ENQA 2O66A 2QLJB 1X4GA 2YX1A 2C2MB 3CJQA 3EMTA 1RACB 4DR2J 1NEEA 4RBVA 3VALA 4F25A 1HNVA 4KHMA 1RLCL 3NNAA 2HBRB 2OD4A 3A3OB 1FDDA 2K06A 2AEMA 2LDYA 4L75A 3RAMA 4KGMA 5GADU 5A8KB 1RB0A 1NHUA 2ZH4A 4PG8A 2DNNA 2VG5A 5CHCB 5HANA 4ZPVR 2VZ9A 4UOCA 1R8PA 2XCPA 1JLEB 4GVLA 4CQ1A 4NYOA 3WBZA 5KFHA 1WSVA 3RRKA 4QW9A 3BF4A 4BDPA 3G8SA 3I5CA 4O4GB 2GMHA 4IOBA 3VWSA 2YNHB 2J7UA 3JAMY 2CZ9A 2B9WA 2F40A 1MWYA 2CPIA 2CPEA 1WI6A 2W7PA 4B3TF 1S1XA 5KG4A 1S9EB 1RK8A 4NLYA 1HWLA 2B9EA 4NLSA 2H5EA 1HPZA 2QLWA 2MPUA 2Y8WA 2A1BA 5IQ6A 4YMEA 2F9DA 3OL9A 1ZM2A 2XSJB 3MEDA 4TXSA 3BGOP 4FXDA 5J1EA 3WIUA 2E1RA 4KTQA 4FXWA 3BV8A 1LWFA 3MAHA 3LAMA 2GJIA 4C4WA 1LWXA 4KKOB 4CYUB 2OEKA 5JVHQ 4F3QA 1NRKA 4JI2F 3S7RA 2ZHBA 4U8YA 1T3NA 3BN4A 3HD2A 3OT9A 3PHTA 3A8EA 3W9HA 1VQYA 2QRRA 4PWUA 4CTAB 4DV7J 4ED1A 2CJQA 1G3OA 2JEJA 3OV7A 5KOWA 1EIYB 5HROB 4HTJA 2HHUA 4DV1F 5HJYA 4N7TA 2E5JA 3W8PA 5A8KA 4RPFA 4LFCJ 3DOKB 2R8IA 4S0MA 1C4AA 2Z4PA 5EUHA 1JLEA 1RTZA 4DXLA 3SQOP 2AHOB 1FXLA 5E0OA 4H4KC 1H72C 2AEFA 3H2VE 2QG9B 4C11A 3PYEA 2YNHA 2PT0A 1F60B 2BJ9A 2NUHA 1U1KA 2C28A 2GFFA 3I56S 1DY3A 4ZPWR 2MZSA 3ONQA 2KZMA 1S99A 1PYTA 3NNCA 1VQLS 4CNZA 1LXJA 5KG7A 3C8YA 3MR5A 2KFYA 1BC6A 3CMQA 2QMXA 4WTYA 5D4PA 3MPDA 1L3VA 3VAGA 2CA9A 3BJYA 3QJPA 1Q53A 2J6SA 2XSJA 1JLQB 4UTGA 4DPTA 1GX6A 5IXUA 2Z8QA 4EZ6A 2W2QP 4HT5A 2Z2LA 2ZH2A 4ZVOB 1S6PB 3VQSA 1O8BA 1S1TA 5HMYA 2OD6A 1TL1B 1R0BG 2CJAA 3GSIA 3CWJA 3CDUA 3E51A 4LSNB 2AZ3A 3IMQJ 5IS2A 3MI7X 3D5MA 1Y4ZB 4B3OB 4DR5F 2DXFA 4GKKJ 3JQJA 2R9LA 2R8JA 5CXTA 2BMBA 1VYAA 2OMOA 4ZN3A 3D54A 3LPEA 3QIPB 5DG8A 1RHRB 2CPDA 3J80Y 2RAQA 5LL6d 2C3MA 3US5A 3ISNC 2E9RX 2RMLA 2K3IA 5HROA 2J9EA 3SFGA 2L48A 3M8WA 1LXNA 4TVAB 1P6TA 3DOKA 4LSZB 1RP5A 1GH8A 4WXOA 5B0GA 3QSYB 1K44A 5DZ6A 2IY5B 3HJFA 3DDIA 5E3RA 5ETMA 3JYTB 1TK0A 3MR6A 1RT1B 2PI4A 2MKYA 2JOQA 3IFEA 5L46A 3UQSA 3EWGA 4CLZA 2HLUA 3JSRA 2VG6B 4NX9A 2V68A 3UPFA 5C2GA 5DQIA 2VFVA 3MMCB 4OX6A 4GMKA 5CH7B 4LIWA 3KUHA 3FZ2A 1YG0A 4ZVTB 1RWOB 2XYPB 1HHTP 4G1PA 3TR5A 3HHKA 3FMWA 2FVPA 2NR0A 2ZFHA 4K0KF 1ITPA 3ULHA 4HT7A 1D9AA 2MSSA 1B7FA 2ZH8A 1UW4A 3V6JA 4LSNA 1EETB 2RQ4A 4O3RA 3RRGA 4RNMA 2ADCA 2QEXS 2RNEA 4DL2A 3R27A 1RTHB 2J9DE 3IP0A 3QIPA 2ZC4A 7AT1B 4GRSA 4CH1A 2LA4A 3DLKB 3POTB 4OI0A
chains in the Genus database with same CATH topology
4IFVB 4ZMMA 4IO1A 3PZPA 1VBXA 2FVSA 3RB3A 2L9NA 1K1QA 5D78A 2DNLA 1ROFA 3QO9A 4KFBB 4O0IA 4Q0BB 2KHCA 4QQBA 4WYWA 1HBNA 1RKIA 2IVYA 3DRXA 4GO7X 3TA1A 5KFWA 1X0FA 2ZBIA 4OX9F 4QYRA 5T7LB 2ZHOA 3RAXA 2DJWA 3NMRA 3ENVA 1KTVA 3FJ2A 3DRRA 4JOUA 3G9CA 3MWBA 5KFKA 3MM5B 1SQEA 2FJXA 1S72S 1HNZF 2DIVA 3L3CA 2RRAA 3UR3C 4IR1A 4DR7F 2ZD1A 2IBKA 4F3OA 2DITA 4RW7A 4LQ3A 3GYXB 2UVUA 4H54A 2XY5A 2DH7A 1E6YA 3H40A 1X5PA 4RUAA 3CCZA 1OSCA 1WACA 4QWBA 3G6XA 3JYTA 4ATNA 5A8WA 5KFBA 3CCUS 3N28A 2GO9A 1VC0A 2C3PA 4Y2IA 1FK9A 3SFUA 1O0PA 3CDAA 5C25A 4A8KA 5HLFB 1U1NA 5DG9A 3UCZP 2JEFA 2M2BA 4H4MB 3SSQA 1WNEA 3FFIA 1LQ9A 2I5JB 3EUNA 1OPIA 4ZPBA 3W7BA 3KLHA 1YBAA 1U1MA 3AJ1A 1UETA 2O01C 1FCAA 4I6WA 5F8HA 2ZE2A 4FZVA 4RNNA 4ZS6A 3TW0A 4U67Q 4F4YA 2A2CA 2IFXA 2R7QA 4ED2A 3WDOA 1KD1T 3H5YA 2E5LF 4IH7A 4DR6F 2M5YA 2FHJA 4RWWA 5LMUF 3M6UA 2HMIA 1OQ6A 4N8NA 2NREA 3IS9A 4MYUA 1AROP 4GC7A 4MFBA 3PRDA 4KPYA 2VC0A 4USJC 3IXQA 5GAEI 2Q6BA 2QSFA 2F8HA 3AH6A 4U7UK 2WB4A 2EFPA 5LXRA 1DJ0A 4CH7A 2UP1A 1T3OA 2HRYA 3MMCA 3G4SS 1H2TZ 1KOHA 4CO0A 2J76E 1SL0A 3NGDA 4R25A 5LMNF 3EZ5A 1IKXB 2Z2MA 1AFJA 2RF2A 1B0PA 4HI1A 5B0EA 5CYQA 3T19A 4B17A 5KFNA 3CD7A 2BJDA 1KOOA 1X9WA 5F8NA 1X5OA 2J0XA 3HI9A 3M6XA 5F8LA 4OI2A 1HA1A 3OXFA 2FVCA 3U02A 3MEKA 1UVIA 1TZ0A 3NAIA 2P9EA 3CXCR 4ZPTR 3DU5A 4AXIA 2PD1A 2ABYA 3NS6A 4DFPA 4N76A 1KLNA 4NLTA 2OPPB 3CCRS 2J5AA 2XMKA 5KT2A 4ECYA 1T8EA 1RT7B 1RKJA 2RVJA 2HNZB 3OTBA 3NNHA 2FJBB 3RTVA 2BV3A 3DMJA 4DLEA 3PACA 2V4QA 1YVFA 5KG6A 1RA6A 2OFGX 1HBOA 2D3UA 5BYSA 1GXUA 2HZCA 2MZQA 1RT6B 4ILMA 4KGKA 3FQLA 2DHAA 2J7KA 3DNCA 4ETXA 2XMTA 2QMWA 3MECB 5DDQC 4Y2AA 4FBTA 5IQQA 1NJIT 1UKUA 4DLGA 2F9JA 2WOMA 3KHGA 5DLFA 4DQSA 3KFWX 2YKNB 5GAGU 2KXFA 1YRTA 3Q23A 1XR7A 3S1TA 1DHMA 4NLXA 1X4AA 5D4OA 1U25A 1RT4B 1ZOTA 3DYAA 3E01B 3I31A 1S97A 3OR1B 4L6V3 3CCQS 2KTQA 4DR3F 4I0WA 2HVIA 2LQ5A 4X4SA 5EWFA 4IQXA 1Y3JA 5FLXY 4K2XA 3KK1A 1ZAXA 1RJJA 2OFHX 3BEGB 2VB6A 3MUTP 2FJDB 3DXSX 3MEEA 2MQPA 3KYLA 3PW0A 4QYZJ 1FT8A 4DR4F 2DNRA 1GT8A 3E3XA 2HHVA 1MU2A 3U1MA 1RTHA 4ICLA 1RDRA 2DGQA 2LXFA 2XG8A 3M2RB 3SDEA 1JXEA 2AGPA 4G1IA 3FSYA 1L3TA 1CSJA 5LSLA 4R8UB 4Y3CA 4F2SA 2AWZA 3TVKA 2YH1A 2FVRA 4C3LA 4U6PA 1L3SA 1CVJA 1HARA 4ZPAA 1S1UB 2EI5A 2IBOA 1HWIA 2JX2A 3CDEA 4F2RA 2DCLA 4QIEA 1JLCB 4WF9Q 2KYZA 3ZZOA 1K0TA 1R7IA 3LP0B 3JTNA 5GAHI 1JIHA 3DLKA 4J9RA 3V4IB 1HD0A 1IBLF 1VQ4S 3POTA 1UVNA 2HQIA 2DPJA 1SJFA 2PSZA 2GIQA 3DOMA 4MKAA 1D0EA 3R3TA 4IFVA 5AXMA 1SIWB 3V5RA 1Z1ZA 1VIOA 2V8DA 1BQXA 4IQMA 2CPJA 2R7OA 4F4ZA 4YP3A 5A6PA 3KLEB 1SUQA 5K8PA 4C97A 1YRXA 1VHFA 2GNKA 1X0PA 3HFKA 4Q0BA 1GTEA 2DHGA 4WZQA 3TP2A 4ECRA 3EXYA 1S48A 1UFLA 5T7LA 2CQDA 2R4FA 3I0RB 3F56A 1S1WA 3RBDA 1VRTB 4DL6A 4QR2A 3MM5A 4EYIB 3J7YU 1N32F 3W2VB 3UW1A 1UVLA 4NWBA 3SV4A 1XEZA 3MPYA 3J7ZT 4ZDNA 1FXRA 3THPA 1S6OA 3B4MA 4PUOB 3RW6A 3MCSA 4ID8A 3RZAA 2OH2A 2HWHA 4OZJA 2BE2B 2XB2D 3IRXA 7FD1A 1PGZA 2OPQA 3M9OB 2VG7B 4WFZA 5HBMB 4HDHA 3CD6S 3M9MB 1QJHA 4DV3F 1X4FA 3H25A 1IXKA 2VQEF 3RRHA 2E66A 1C2PA 3S6EA 1TL3B 1UJ5A 1T7PA 2ATLA 3DLLQ 1TK8A 1C1BB 2B9XA 1EP4B 1UWBB 4DL5A 2JEIA 4P7TA 2YKQA 4IFYB 4C3MA 1V3ZA 4RW6B 1TAQA 2GQQA 4QU6A 2CVEA 2GA7A 4NLGA 3R1LA 3GE9A 3CSKA 2WB1D 1H0HB 4WFNQ 1TKDA 1VK8A 1HBMB 2IC3A 3B78A 3JTPA 5HN0A 5KT5A 3K5OA 2LQ9A 3LP2B 2OPRA 1APSA 4U9RA 4F4WA 4KO0B 4A46A 2BA9A 4JI5F 4JBCA 2R2UA 1JJ4A 3NS5A 3KG4A 4YOEA 3HZGA 2CQ4A 3O5TB 1Q82T 4ED5A 4JI4F 1OS5A 2F3JA 3CCVS 1IBMF 1QE1B 1TFWA 1JLGA 2NSCA 1NKCA 2FVQA 3G71S 5I4MA 2RE1A 1U26A 1JMTA 5L1JA 3UD4P 1S4FA 4NA3A 1UVKA 3M30B 3QPIA 3CCMS 5HQ8A 4XK8C 5H1SV 1LKZA 2LKZA 3OR2B 4GKJF 3N01A 1BQMA 4DOZA 3T6BA 5KFPA 3KK2A 2N7CA 1KNZA 1DTQB 4KSEB 2ZJQQ 4FF4A 3D1QA 1ELOA 2YKMB 2ASLA 4O4GA 2RIJA 4NYZA 4OIXA 3SYZA 3RW7A 4AE5A 2VPZB 2JHEA 3TI0A 1FNOA 1WG5A 4AYBD 2MJUA 3DLEB 5KFAA 4E98A 3C6TB 4QIFA 2FD2A 3DI6B 4P7VA 3PFOA 1JLFB 2YNIB 3M1VA 2MGZB 3M2VB 3IO1A 2XBPA 1SH0A 4EZ9A 2XLKA 2MZJA 5E3CA 4XDDA 2HFNA 3B4DA 1KSPA 2BOPA 2DBBA 2Q6CA 4EYHB 4DV4F 4UY85 1NZAA 1TV6B 3MM7B 1FRXA 1RT6A 1YJNS 4Q44A 2CDQA 4AXJA 3MOZA 4C0HA 4M95A 3T1AA 4ECQA 2B56A 5AXLA 1URNA 2B3TB 3HVTB 3ITHA 2KN4A 2IM1A 2M7SA 5F41A 1ZETA 2VONA 1S9EA 5A8RA 3IG1B 4DMZA 3K7RA 2XI2A 4K5RA 5C24B 2DRAA 1GNKA 4PWDB 3VQTA 3CF5Q 1X4EA 1KQGB 1ZAWA 1HI1A 2W7AA 4TQSA 4FP9A 2ZBCA 2C2EA 2R7VA 4CO5A 2AF6A 2O1PA 1CC8A 2DGVA 2YWEA 2VQFF 2DGSA 3CCTA 3FQKA 5GADI 4ZP7A 2DGTA 3NP5A 3BR9A 1BD6A 3RB0A 3DRSB 1C4CA 1VLYA 3PIPQ 3HK2A 3E8OA 3G6ES 1X7VA 3FDSA 2B7CB 2YKAA 3LGMA 2K1RB 4FVMA 5B0FA 4UW2A 5LJ3Y 2C2DA 4DX8H 4ELTA 4IG3B 4ED8A 1T03B 2BYCA 4QOTA 1KR4A 1S1UA 3I96A 5CA5A 2R7UA 4DSIA 1NNDA 4P6QA 3FEYB 1JLCA 4DDFA 4DR2F 3AB4B 2EFGA 5CZXA 2JFKA 5E3PA 4B9VA 2XS2A 3FRYA 2RRNA 2WSCC 3N79A 1X9SA 1FVSA 1SJ4P 1X9MA 4IYQA 4NLQA 3AA8A 2AJ0A 5BYQA 3NCQA 5EX0A 3V81B 2GQCA 1JXLA 3T6JA 4O3NA 2V0NA 4MIAA 2IYIA 3FSIA 4KKOA 4TU7A 3LAKA 4H4KA 2ROEA 2VFSA 5DO2A 1DLOA 1REVB 4OHXA 3NG8A 3KLEA 1ZM4A 1F9FA 2KM8B 2UUTA 3OUYA 4WKYA 4USIA 5L1IA 3THVA 4B3MF 3DDNA 1WTBA 1UVMA 4FS2A 3MMAA 3CGIA 5IT9Y 3F44A 3SXLA 1HD1A 2D9OA 1GTHA 5FIIA 3K58A 1VRTA 5T41A 1QVFR 3GIIA 1VFJA 5KFEA 5J2MA 2GHPA 2MKCA 2N4DA 2A3JA 5M2UA 2E1MC 3BQ0A 2DR9A 2XI3A 1NB7A 1WF2A 3VR1A 2C2RA 2BE2A 4CTAA 3J81Y 4ZPCA 5KG0A 2DGUA 3MM8B 2VL1A 3T9ZA 4CZCA 3SV3A 3H5UA 5HBMA 3N9UC 4WU3A 3IAM9 1VC6A 5F8GA 1DTTB 5E33A 2VFTA 4OQJA 1FKPA 5F8IA 3KLFB 3CCLS 1EP4A 5B0AA 4C2MA 5CYJA 3LQVA 2JVRA 2ADBA 1RAJA 1ZM9A 3CJ5A 4KB7A 2D9PA 2X1FA 4NCGA 2J0QD 5A2QY 2ZH9A 5DGAA 1S6QB 3MDFA 3MZIA 3OQ2A 4FVCA 1N8RT 4G6VB 1YJRA 1RT3B 1VIXA 3LALA 1HBMA 4RBUA 5LXYA 3GMGA 1JNZB 1Q1KA 1Q16B 1TL4A 4Q2MA 2MQOA 2AYEA 2E1CA 3LP2A 2AQ4A 3CJ4A 4KIAA 1N5YA 1G6BA 4ZLPA 6FDRA 5GAEU 3T1YF 5JXSA 2E1AA 5HL7Q 5DM7Q 5EN1A 1QE1A 4J9KA 4WK1A 1XC9A 1QAIA 5I3UB 2W8KA 2DHSA 4JI8F 2UUBF 2W4PA 3M30A 3E2EA 4N47A 2MKSA 4M1KA 5HO4A 4LF9F 4MAKA 1VRUB 2OSQA 3F41A 1GX5A 5D4LA 2E7XA 2V4JA 3OR2A 3MURP 3CD0A 4C8LA 4C8ZA 4HKQA 1U7LA 4N5SA 4DUZF 1FNXH 1VGYA 1DTQA 5L9XA 4O4RA 3GWCA 3VCDA 2P9CA 4F67A 3RR7A 4TN2A 2BDPA 3ZZTA 1X4CA 3SCIE 2BANB 2KM8C 1VQPS 1PC4A 5CCMA 3LPYA 4CH0S 4YB1P 4DQIA 2OPSB 3MGJA 1JLFA 2OMLA 4NPOA 1ZTWA 3TARA 2OAUA 2HLTA 4PR6A 3BGFA 2MGZA 5HMXA 5U47A 4CT8A 2G1DA 2IMWP 1MSWD 2GO8A 1VJWA 1KONA 4C8YA 4PCQA 4OHYA 4YDDB 4J9MA 1H2VZ 3KTQA 4ECSA 2XLJA 4PKDB 2LVWA 3K5MA 2ZUGA 4QW8A 2I0XA 1YI2S 3HHLB 4RW4B 2CZ4A 4EBEA 1XWLA 4DFKA 2HHSA 2CQPA 2ZOGA 3CVKA 4F26A 5D8HB 2FHKA 3OLAA 1LWCA 4EFAC 5E41A 1N0UA 4A8OA 4ED6A 3SQGB 2DISA 1HNVB 2AX1A 3OTEA 2V8GA 3M8PA 1KQKA 4A8XA 1HNIB 3BGLA 4I2QB 3IG1A 1IKYB 2AV5A 4QWDA 5C24A 2M8DB 4PWDA 2JJ4D 3DOLA 2XY6A 2HFZA 4DSLA 1CEZA 3JSMB 2MKKA 2CVIA 4IUFA 4NOHA 1JJ2R 2W24A 2RSQA 3NBPB 4IDKB 2COLA 5I3PA 4JI0F 1N6QA 4O3QA 3GSDA 4ZCLA 2UU9F 3X1LB 3S8SA 5AE2A 2MJNA 2DNOA 2VBYA 3QGHA 4DV7F 4HEA9 3MR3A 1DQ9A 5FJ4A 1FRLA 2XHWA 3J7Z5 2K1RA 1Q8IA 1RT5B 2PA8D 3BGUA 3HLUA 4RW8B 1RYRA 1JLQA 5CYMB 5CD4H 3PKYA 1YHQS 1T03A 2HNDB 2QYCA 4MIBA 4P2SA 1HWKA 3VZIA 1W2IA 4B08A 1MROA 2E5GA 3T9NA 2CPZA 2XNRA 2OSRA 5GAHU 1K1SA 4ALZA 2B9YA 4DSEA <