1RJJA

Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
MATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVVATP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords expressed protein
total genus 17
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rjjA00
2AW0A 3HHLC 2GCFA 2L3MA 1APSA 2XMJA 4Y2IA 1JWWA 4U9RA 2QLXA 3KG1A 1URRA 4HH0A 4ZOSA 4DL0C 5B0CA 1R6YA 1XBWA 2EW9A 2OD4A 3TRGA 2W4CA 1CC7A 2IFXA 2PD1A 1YG0A 3UDCA 3KKFA 1S6UA 3BF4A 5B0FA 2ROGA 2HLTA 1TR0A 3HHLB 2ROPA 4YEAA 1FVQA 3LO3A 2K1RA 2ROEA 2ZDPA 1SB6A 2RMLA 3CJKA 2QYCA 1V3ZA 2BJEA 1N5TA 1AFJA 4A4JA 1TUVA 4HI1A 1TZ0A 3TNVA 1YJUA 3HFKA 2HLUA 5B0DA 2HFOA 1Q8BA 4Y2KA 2GV1A 1YJVA 1GXTA 2K7KA 2LXFA 3F44A 3FMBA 3LGNA 1Q4RA 2GGPB 3LGMA 3VTIA 5IXUA 5B0BA 1AFIA 2FIUA 1Q8LA 2ACYA 3KG0A 2FHMA 1Y3KA 4YDXA 1VQSA 3TOQA 2VH7A 2OKQA 3I9ZA 3MCSA 1KVJA 2N4CA 4EFAC 1SI9A 2XMWA 5B0AA 1RJJA 1FD8A 1YRXA 3BR8A 1K0VA 3BN7A 5F0WA 2OAUA 1TL5A 2HFNA 2BUNA 2K2PA 2ZDOA 4OJGA 1Y3JA 4Q2LA 1GXUA 1JK9B 2OD6A 1FE0A 3FGVA 2OFGX 1ULRA 1P8GA 2IYGA 2KYZA 1FESA 2PGCA 1N5QA 1OPZA 3HDSA 2HIQA 2BBEA 1TL4A 1MWZA 2AJ1A 3MZIA 4HL9A 1WD6A 2XMVA 3K7RA 1U7LA 2KT2A 4F67A 3BDEA 1OQ3A 1X7VA 4OJHA 5A6WA 1QUPA 2K7JA 2RU9A 5T7LB 5B09A 2LQBA 2FTRA 3FRYA 3QGPA 1IUJA 1P6TA 1YJTA 1YJRA 3T9NA 1MWYA 5F0UA 4HI2A 2GA7A 4DPOA 2BJDA 1Y0HA 2FB0A 4ZA1A 3CJKB 2AP6A 2LDIA 2QIFA 3WDOA 1N5VA 3BB5A 3QMQA 3HX9A 2OFHX 2GFFA 3E8OA 2XMKA 1X8DA 2W4DA 2OP5A 5B0GA 1X0PA 2XMMA 3DXSX 1VQYA 2GGPA 2LQ9A 4FNHA 1KVIA 2RSQA 2AJ0A 2K1RB 2HQIA 2G9OA 5K9FA 2Q3PA 3HF5A 3GZ7A 3DCAA 4NPOA 1W2IA 3IWLA 3IWXA 4HH1A 2OMOA 4OJ1A 2IYIA 5KAKA 3HHLD 1KQKA 1LQ9A 2VV5A 1Q53A 1Y9OA 1FEEA 1CC8A 1CPZA 1OQ6A 4Y2MA 2W4PA 2N4DA 4DN9A 5A6PA 2GO8A 1FE4A 2RILA 2KKHA 1SQEA 1FVSA 3BM7A 1AW0A 2XMTA 2JDJA 4OJ3A 2N7YA 4NL5A 1N5SA 4Q2MA 5B0EA 2BYCA 2XMUA 3KNGA 4A47A 2KT3A 4FNIA 3HHLA 2CRLA 2ASYA 5T7LA 4OIXA 2QLWA 3BGUA 4A46A 4QOTA 5B08A 1S6OA 1OSDA 4A48A
chains in the Genus database with same CATH superfamily
5IFMA 2DXFA 2UU9F 4JI6J 2DGWA 4P74A 4KHPF 5KG0A 2XLJA 3KG1A 3IRWP 4J9SA 4Y00A 1YBUA 2C2DA 1S49A 3CMQA 4USIA 2C2MB 3PACA 1O51A 1IVZA 4Q7AA 3QRRA 1WC6A 5GAEU 2GVZA 3BSNA 4K7QA 2KZMA 1AZSB 5F3TA 2BE7D 5KFFA 1PBUA 3VAFA 3MMBA 1A6LA 2VZ9A 1S6UA 5K8NA 3EE3A 2HZVA 4LR8A 2W25A 4UQTA 2RT3A 1FVQA 1L3UA 2EWHA 3DM2B 3OL6A 2D3OR 1VQ8S 3OL8A 4IOBA 5GADU 3CJKA 2DITA 2MJUA 1KTVA 3PVXA 4NEZA 1AUSL 1TZ0A 1BWEA 2IRUA 4LF7F 4HDHA 4KH0B 1X4EA 1R0BG 1YRUA 1KFDA 2V2KA 3AQOA 3PRBA 4G1QB 4GMKA 1F3VA 3JSBA 3ZFVA 5K8PA 5DG7A 1KLNA 3H40A 2Y1IA 2BDPA 2LCWA 1TKZB 3MEEA 5I4MA 3OTOF 4UUWA 4N8OA 4ZS6A 3MPVA 1XC9A 3KG0A 4DV1J 4W92B 2DTJA 1T3NA 4ED5A 1S9GB 3W65A 1NKBA 2DNGA 1S1XA 3IR7B 3HHDA 1NJZA 3V6HA 1OSCA 4DPTA 3JSRA 4LQ3A 3SSRA 4YB1P 1XMQF 1N5YB 2Y8WA 1E6YB 3AB4B 1D9FA 4OYPA 3RG6A 4ZMMA 4P2FA 3VVTA 3C2PA 4M95A 3CD7A 5HK4A 2P9CA 3ITHB 4OV1A 3Q8QB 2R8HA 1H2UX 4WP9A 1X60A 2ACMA 2IPOB 1IKXB 5KTQA 1V3SA 4O0NA 5K5MA 1VRTA 2Q6BA 4X64J 2OD6A 4JI5F 2KVIA 4I4BA 4QIFA 4MMOA 2DCUB 2HWHA 2CQ0A 2P5VA 4OX9J 3GR0A 3W2VA 1X4CA 2NLWA 2HIQA 2PMWA 2ZHAA 1EHWA 3W63A 1FK9B 2B8QA 1QD1A 3PEJA 3W61A 1WOOA 1SJ3P 2B6AB 5A6WA 2K7JA 5DLFA 4A8FA 2R7WA 1TFYA 3GTYX 1I94J 2XB2D 2EVZA 3ZO7A 3FUYA 3MEGB 3I5CA 2DGXA 2UUBF 3NMAA 1LKZA 4FPRA 4IH6A 3UCZP 1HW8A 2KU7A 1PCAA 4ZA1A 2YNIA 3T6BA 3HJVA 3L7PA 3H59A 4MK8A 3WX8A 4X65J 3BBCA 3KJVB 3HSDA 3KK1A 2F1FA 2R7VA 1YVFA 4LJMA 2E66A 1KOOA 1RWVB 2IDLA 3C14B 5IWAJ 4YHHJ 1VRUB 1O8BA 4L72B 3SBMA 3UDVA 2XMMA 3BGOP 4C7QA 1RHKB 2DB1A 5K14A 4QW9A 4J9LA 4O3QA 3I0SA 5AXMA 4I1TA 2ADBA 4ZPBA 1Y5NB 4JI1J 1FX4A 2RRBA 3P96A 4ANDA 3M4XA 2V68A 3DCAA 4NPOA 1N54B 3I6PA 2XI3A 4DV7F 3ZZUA 2I38A 4JI2J 1HWUA 3CDWA 2C3OA 1HR0F 2X3GA 2BQRA 3R5DA 2W24A 4J7CA 2H9ZA 4D3GA 2LEBA 1T03A 2PN6A 1EJ7L 1RWKB 3D9BA 4ECYA 3CJSA 2W8LA 4JV0A 1MNEA 3VGTA 3W5YA 5AE2A 5I42B 2X7IA 4RZRA 1TFWA 4B3OA 1UETA 3SDEA 4F4KA 2NZ4A 2KHDA 4JI6F 4KHPJ 2XEXA 2FZCB 3N28A 3IBWA 4GO7X 2M4MA 1R31A 4G1PA 4Q2MA 4YR3A 1BMQB 2EEYA 2GC8A 4C98A 3M8RA 4MKBA 2QRRA 1CVJA 4B9NA 4M5GA 4XPEA 1RCOB 2C1EB 4GKJF 3DXBA 3LW5C 4B9VA 2OJ3A 2EG2A 2ZZTA 3CT9A 3TAMA 2IBOA 2FYXA 1VBKA 3OQ2A 4FZVA 4RBTA 1G2EA 2GZOA 2PE8A 2RNEA 4LF9J 2ZBCA 4B9UA 1AT1B 3D0GE 4DXLA 5JXSA 5SZTA 5CYJA 2XHWA 4QIWD 4NMLA 2CNLB 4OX9F 3GU0A 4CWBA 1REVA 4ZIWA 2FJVA 3MM9B 1FFSB 3Q8VA 2VPZB 3POTB 4OX7A 1ZETA 3R7NB 2CQHA 2FJEB 3T1HJ 4IFYB 2E7WA 2ROPA 5KFZA 3K5LA 4WP3A 4JI8J 1HQUB 2VA3A 1RISA 2UXDF 3OBIA 1L3TA 3CCVS 4W90B 4GVLA 2JFKA 1F5CA 3O1LA 3QATA 1Z2LA 4C8LA 1J27A 3W60A 3ITHA 3G86A 2CJYB 5IZHA 2F9JA 1OMSA 4IQXA 2V2ZA 1S9EA 1RAFB 1RAHB 1IKXA 4JI7F 2V67A 3HSZA 1IR0A 2O01C 3MECA 2FJWA 3VWSA 4USJC 4ILLA 1RLCL 2OPSA 3PJXA 1D3WA 3BO3A 4DUYJ 2DNQA 1VQPS 5J2QA 5KFAA 3Q8PB 2QJ3A 4DZDA 2VJUA 4FS1A 3HHEA 4NYPA 5DQGA 4AE5A 3DFEA 4OX6A 1VQ7S 1KP6A 1RU2A 2GIFA 2ZHOA 1RJJA 2KDOA 2MLYA 4ZP8A 3W64A 5H1SV 4LFBJ 2IAJB 2E44A 2H3EB 2CQPA 2FY1A 4HTJA 2UUAF 3TO8A 4G1QA 3J7YI 2BEFA 1U47A 4EWTA 2RQKA 2XNRA 2FPHX 3AD8C 3ET6B 4LVOP 2QT7A 2VPWB 5J2NA 1KFSA 2IYGA 1YKWA 2AJ1A 4FP9A 5DRKA 1LEOA 5FLXU 1QUPA 2JHEA 4KGKA 2VG5B 2DNOA 2E1CA 4TY8A 4F04B 4DSEA 3CW2C 1VHFA 4ZLJA 1UTAA 3FBCA 4L74A 3CCUS 5D4OA 5GMEA 2WZ1A 3OVAA 1F6TA 4F4XA 5GMDA 3MD1A 3K5PA 3MPYA 2AJ2A 2DNYA 1WELA 3EPGA 1Y7PA 2VG6B 2UUCF 3QYYA 3J7Z5 3DLKA 2VBWA 4MJKA 2UXCF 2HVDA 1YJWS 3WC0A 4U7UD 1HNIB 4RKUC 4C0OC 1VQ6S 4OFZA 2DGUA 2J0WA 1S48A 3QAEA 2HFSA 4KYZA 5LOQA 2HQIA 3UN2A 3KMSA 1OO0B 4B3SF 4E98A 3HF5A 3CMES 1SV5B 2OUGA 2E5LJ 1HBNB 1TAQA 1WI8A 4UW2A 4EU0A 2QA1A 3RW6A 4I2PB 2UU9J 5G0RA 1NHUA 2WVDA 3CJ2A 4EBCA 1M1HA 2RKIA 1T3OA 2UUTA 3AOBA 4L76A 4RPFA 4O3OA 3TAMB 4AFFA 2HHHJ 1L3KA 1ICEB 2J9DA 5FIIA 2Z0GA 3CF5Q 3DRSA 3QLHA 2BX6A 3WC2A 4RNMA 3H4DA 2XM3A 2WW8A 3C6TB 1T94A 3M8PB 5KFXA 1RTJA 2DPIA 2DIVA 2AGPA 5C42B 4KH1B 2UV8G 4LIRA 2XY7A 4H4KA 4BHQA 4K59A 1A7GE 2CRLA 3WBZA 2CJBA 1GEHA 3G82A 3MM8B 3SYZA 2AD9A 1CQMA 1FFGB 2OTLS 4ECXA 4B3RF 1JJ2R 1FXRA 1H72C 4LBHA 3W9JA 3BGFA 4CLKA 2WONA 4K4UA 4C8MA 5B7WA 1KLMB 3HO1A 1V5VA 4OZLA 3CIMA 3QWUA 1VGYA 3BKFA 3CO0P 3TW0A 4JI0F 3TUZC 3OUYB 3ISND 3SQGA 1VLYA 4TU7A 2PA8D 3QT7A 1GX5A 3E3XA 4NX9A 2MQNA 1NSKL 1EETB 2EFPA 3CMAS 2DRAA 5B0FA 3QBCA 2AX1A 2P2CB 3EGNA 4X84A 4JI2F 3TAQA 4N76A 3ILIA 1L3VA 2UVWA 1AXQA 2RMLA 2YQ1A 3SQOP 3W1YC 3CNQP 3TNVA 2FUG9 1BQXA 4LRFA 1HQEB 2B8PA 4EZ6A 2BA9A 5B0DA 3MHYA 4LF8J 2Y0BB 5GAGU 4RW9B 3IS9B 3N9UC 1DTTA 2FIUA 3D0IE 4AYBD 4RW4B 2ACYA 2V8PA 1U1LA 5D6GA 1TQLA 2X1GA 3ZC4A 2OKQA 1FRMA 3MCNA 3EDRB 5KT6A 3N5FA 5E41A 1YRXA 2V5HG 3HPOA 3BR8A 1SVDA 4E2FB 1OIAA 1I94F 2HFNA 1JLBB 4OJGA 4LFAF 1U09A 4TN2A 4DV5F 2AGOA 1GMWD 2DHXA 2ALZA 4CO2A 3NMRA 4OYMA 2CNOB 3VHQA 1FE0A 4DS4A 3DLEB 2VDHA 2OPSB 2DNLA 2IMWP 2C3MA 2V50A 3NGTA 3R2CJ 2OPPA 1N5QA 1QE1A 2H65B 1S1XB 2D9OA 3NEKA 4RUBA 1KSPA 3OR2B 2V8DA 1OQ3A 1X7VA 4KFBA 4ES2A 3J81Y 1LV5A 2NYIA 4PQUA 1FERA 2J6UA 1HMVA 5D0HA 2PO4A 1B3TA 1IUJA 1P6TA 5CZXA 3CDUA 2CQGA 4CM2A 4HACB 4M5DA 1BHNA 3MI7X 4HI2A 4ILMA 3H7HB 2YX1A 5AXNA 3CJKB 4LSLB 2HHHF 2ASDA 2HZCA 2K06A 4O23A 1YSJA 3L9ZA 1RT5A 3M2UB 4NZ0A 1BQNA 3M6XA 3CSKA 2BACA 4OQJA 1NCLA 5J2NB 2XSFA 2IJRA 1GX6A 3HSGA 3JQMA 3OTOJ 1JB0C 4QZVB 3AHPA 3GV7B 2D74B 3R7BB 3PV8A 1JJ4A 3CC7S 1H0HB 4QU6A 4DS5A 2CPEA 2HHUA 2I8EA 4D3HA 3AH6A 3GYNA 2R7XA 2RUGA 3GONA 3HT0A 3UW1A 3LP1A 4B9MA 3ENQA 3MWBA 4ICLB 3TX8A 2YKAA 1NHVA 2F4VJ 3NLCA 1NO8A 5KG3A 4C3MA 4YS2A 1TV6B 4WPAA 1S1VA 4W98A 2J5AA 5KFWA 2GVDA 4WKRA 1S79A 1SC4B 4KC5A 1N34J 1ROFA 2BJ7A 3NXZA 4NYZA 4FYYB 4XDCA 5F8MA 3CCRS 5H9FK 4WKYA 3I4PA 2R7TA 1U6BA 4JI0J 1JKHA 3H98A 3P3DA 2W9CB 2GNKA 4WIQA 1U1NA 4ZVTB 1RWMB 2VD3A 1U0HB 5E3AA 4Q43A 2HAIA 4TYBA 4F4AA 2COLA 2OPQB 4LR9A 4OYBA 5LXRA 3HD1A 5JUMA 4YR0A 1XEZA 4NZ6A 4EYHB 3VAIA 4DMZA 3H8YA 3HHLA 4ZCIA 4R5PB 4OI0A 2WVFA 3NGUA 3NWGA 3J80Y 1XWLA 2FGCA 2FJXA 5THWA 4CT8A 3SIPB 5A2QY 3RU0A 1Q79A 1T9XA 3OPKA 5KFUA 4R25A 2VBXA 1KNZA 5L9NA 4QPXA 4CLWA 4KV8A 4ZVHA 1J2VA 1LWCB 1UFKA 4KO0B 4B02A 1Q0NA 2CXEA 1VLOA 2EFOA 1G7CB 5GADI 3JAMU 2MZ1A 4EEYA 1SBRA 2VG7A 2ZH1A 1VRUA 1VQ4S 1RT2A 2HRYA 2UZAA 4U7UK 1WOSA 2BW7A 4ZJOA 5CXTA 1PJ5A 4I68A 4L73A 1YI2S 1NJXA 4ANCA 3I5AA 3ZZRA 3LO3A 5DQHA 3I56S 1TL3A 4Q45A 4B3MJ 3KHLA 1RP5A 3TAPA 1V3ZA 2BJEA 2QFIA 3NKYA 4J9NA 1FA0A 1VHIA 3P6YC 4IH7A 3SCJE 2X51A 3KLIA 1FFWB 1N6QA 2ZVIA 2E1AA 3U1NA 2KJWA 4NE9C 3I9V9 5CABA 1EARA 5KG2A 3UD4P 1PGZA 3MMAB 1U1KA 1QSSA 2K7KA 5EN1A 3H90A 1OPIA 4KGZB 4PG7A 1WI6A 4DLGA 4J9VA 1VQ5S 2HHQA 2E5JA 1WHVA 4LRAA 4CO1A 5HVGA 2ADCA 4LF4F 3POTA 1F9HA 5FD1A 4OHVA 4QJVA 2J9EA 3MAAB 4ED2A 5EDWA 3Q24A 3HI9A 2MKCA 1FD8A 2FHKA 1SH3A 4WYWA 2QV6A 4UTGA 3NNCA 2VKRA 3AJDA 2LKZA 2B5JB 4RL1A 4S0MA 4A8QA 3D3CJ 4H54A 1FTRA 1NBEB 4J5OA 5EX3A 3SSQA 1D0EA 1JKHB 2VPYB 3D28A 3FGVA 1RHMB 3GFXA 3H5UA 4NLYA 4F25A 5F9LA 4QWAA 3F73A 3VAKA 4DV6F 5F9NA 2A2CA 2JLGA 4CLYA 1NJIT 1WSRA 3MZIA 2R2RA 3AD7C 2XZWA 1R8PA 3QRPA 4ECQA 5KG1A 2JH3A 3CJ5A 1NNDA 3AOCA 1N48A 3CCWA 2D9PA 3M32B 3MM9A 3PYEA 2QZ8A 3PJWA 3R27A 2LQBA 2W1BA 2XULA 2H5JB 2LQ8A 3DGPB 1KBRA 1BXNA 3QGPA 4KIAA 4XDDA 4YUDA 4PYDA 4DPXA 3GIMA 1TMMA 5CQGA 4FYWB 2RAQA 2LDIA 1T05A 1JLGB 1HI8A 3QGHA 2CNNB 3G71S 2HHSA 3MPWA 2G1DA 1JNZB 2XMKA 2JC1A 3HZEA 2FLOA 4NRTA 1RABB 2JEJA 1FHTA 1X0PA 3SV3A 1M0SA 2ALYB 4X4QA 1NB2A 4EYIB 4KFBB 4CO4A 5AE3A 5HQ8A 2PEHA 4TXSA 1SKUB 5L38A 5C5JA 1WG5A 5J1EB 4RW7B 4Q44A 3NS5A 1FRXA 1SC6A 3EMTA 3K5NA 1FNXH 1M5PC 1KHVA 2C3YA 2OMOA 1ZPVA 3H4BA 3QJLA 5IC6B 2B4VA 4OV6A 1JXVA 1KQKA 3ZTOA 5HLFA 5KFRA 2H5EA 1YK9A 4MIAA 1BQNB 2IJFA 1NSQA 1JLEB 3O2IA 4YP3A 2AU0A 4BS2A 4JYAF 4GVBA 4I69A 5C2GA 3IR5B 4MK9A 2DCLA 4R8UB 5I3UA 1ZTTA 2ASLA 2N3LA 2Y1LB 4C2MA 1AB8A 3BQ1A 2MLXA 2MKHA 3QSYB 3ONQA 1D9DA 4K0KJ 1YJNS 2CQ3A 2EFGA 2MKJA 4OI3A 1M5OC 2N7YA 3S1TA 1RAIB 1WKKA 2GQCA 2R7UA 2HNYA 3OTDA 4PQAA 2RDDA 1P9QC 2ZC4A 3R7SB 1RA6A 3TZWA 2U1AA 1S4FA 5DM6Q 1KWMA 2CG4A 2G13A 3UN3A 4PUOA 4H4KC 4CO3A 3GJSB 3UDLA 4ED6A 3RAXA 4Y0FA 1RB0A 3KOAA 2F4FA 2YKMA 3GYGA 4Y34A 2NXUA 2FQQB 3DRPA 4F3OA 3G4SS 3H5XA 5B0CA 1X4DA 3KK1B 3CC4S 3D6TB 3JQJA 3SCLE 2BM1A 2OD4A 2MB0B 1SH0A 1C0UA 3IMQJ 4USWA 3ZXWA 5JMNA 2VL1A 1I3OB 1IKVB 2QL5B 2VPXB 4J9MA 3CDBA 3UO0A 2FVSA 5J1PA 5D8HB 5DZ6A 4CIOA 4ANEA 3HHLB 2OIHA 2I9SA 3NNAA 2E5IA 4ZCKA 3LP2A 2QL7B 2BOAA 3LH2S 2CUYA 3CEDA 5HVFA 2IC3B 2DXDA 2HYIB 5M2UA 3TQ1A 5A8RA 1TUWA 1GFWB 5KT5A 3DMJA 3OXLA 2FDNA 4X66J 1ZAVA 3X3UA 5KFSA 2R2TA 4ECUA 1DTQB 1Q8LA 2YWFA 3GLJA 4ID8A 4PWDA 2VICA 3I0SB 2DJWA 1JJCB 1BWVA 1X4GA 4IFVA 4QR1A 4RW7A 4K4SA 2YPZA 3NCPA 3OJUA 2VODA 2ZVSA 3RB3A 1WC1A 4ZVFA 3MUMP 1N32F 1MN7A 4QR0A 4P72A 3D54A 3ZZTA 5CD4H 1T9YA 3C3LA 2CQ2A 3OJSA 5F8JA 4L75A 2QSWA 3GFZA 4I6AA 3OL7A 2V8GA 4ZVEA 3EWGA 4Y2CA 5DGBA 2QEXS 1GMVA 3K5OA 1RXOB 1Y11A 4ID5A 3BJYA 4QCLA 2KH9A 3PFOA 2DNPA 3SDEB 3TARA 3QRQA 4DR6F 2YPYA 1RAJA 3HM9A 4DV3J 5MLCV 2CVEA 1TKXA 3MTKA 2V0NA 4RNHA 1RWWB 3M2VA 4U95A 2MGZA 4NCBA 1ZZNA 2NZCA 2RE1A 3CCTA 4XTTA 1NJYA 4OJHA 2CQ1A 3QGGA 5GVQA 1Q7LB 4DCOB 5AE1A 1JXLA 3MM5A 3KLHA 2M70A 3BPSP 2V4RA 2AMCB 5JVGQ 3T9NA 3QSIA 3PW2A 5D4LA 4CNYA 5BR8F 4WU3A 1U2RA 4DL4A 2BR0A 4O3SA 1BC6A 1Y0HA 4ZHRB 1RUSA 2HZAA 3KLGA 2XY6A 1WTBA 3D1OA 4LBIA 2QIFA 3QPIA 1RHQB 5IV4A 1S10A 4NXNJ 4PRFA 2Y1RI 2HVHA 3C15B 3MDFA 3Q2TC 3TVZA 4DDFA 1QE1B 4ED7A 3Q8SB 1UWBB 1URNA 4P73A 5DDQC 3NGKA 2E5GA 4FNHA 4EO8A 3NS6A 3IBCB 3HMJG 1I6JA 1S6QA 2P6TA 3H20A 4Y65A 3R6LB 3IO1A 2IRYA 1O6XA 3VAHA 5J2MB 3MFHA 1N34F 4DR3F 2GIRA 2HNYB 1JMTA 1P9YA 2AT1B 3D6FB 4F0KA 5K8OA 4DFKA 2YNFB 1HWJA 4F0HA 2AEJA 1UVNA 1FF2A 2V2QA 4WU2A 3DLBA 3EICA 1WOPA 4JUZA 2IM1A 3JS9A 3BYPA 2BOPA 3LPYA 1FKOA 5C25B 3J7YU 1WG4A 4X4RA 1WSVA 2KKHA 4U8YA 1IKYA 1FRKA 3EXCX 1RT3A 4MYTA 4PCQA 2BQ3A 1BY9A 1AROP 2CPYA 4Z7CA 1ZM4A 4NL5A 1AZSA 3V81A 4K4ZA 5ETTA 2BRLA 3VV2B 5HVHA 2LECA 2R8JA 4N47A 4AUKA 4NXMF 5I3PA 1DY3A 4CH0S 1B0TA 2YQ0A 3JTNA 4PQUB 4NLVA 1U1RA 1C4CA 4QWEA 1HI0P 3BH7B 2DY9A 3R3TA 4R0EA 5L1LA 2G4BA 2ZD1B 3ET6A 2HQCA 1VIXA 2GCFA 4P9SA 3J81U 4WZMA 2V4JA 2XMJA 1RWNB 1LK5A 5KFDA 1CJTA 4URGA 1PAEX 1TKXB 3D6HB 1FWKA 4HEA9 4HLBA 4B3TJ 2XCPA 3EZOA 1CJUB 3HVTA 1NXIA 1SUQA 3D7SB 4ENOA 1G4CA 1YX2A 4GO5X 5ETKA 2MZJA 4I6YA 2YNGB 4R5PA 2IA6A 6AT1B 4DQRA 4LBPA 2VONA 1RSCA 2VFSA 3QO9A 4ZCMA 4N5SA 1QY7A 2CQCA 2QYCA 2XLIA 4B3SJ 4TQRA 2C2EA 1GXLA 3KUEA 3G8QA 5CYQA 5HMWA 4TU8A 3BV8A 1OY9A 4JOUA 2ZC3A 4ID5B 1UWBA 1VQMS 1NLKL 1F9EB 3BSAA 3JTPA 4ZLLA 3W9HA 2L9WA 1PAUB 2CFXA 3MEDA 5HJXA 1U1QA 2J7UA 3I5BA 2FJBB 2FHMA 3D68A 1E6VA 2W2NP 4W4MA 4DU8A 1CJKA 3BBFA 4MT1A 5IV3A 5IS2A 3CCJS 2C28A 2APOA 2H4WB 5HROB 1U1PA 2R2SA 1BQMB 2B6AA 2Z2LA 5HANA 2BMBA 1NH8A 2R42A 2Q79A 4Z7YA 4CNZA 1B4SA 2FLLA 1SQFA 2J76E 2MTLA 3CJRA 3QT8A 3KLHB 1GTHA 1X9MA 3L3CA 2JEGA 4Q0BA 1U6FA 3GSDA 3I55S 4AL7A 2CPJA 5LMNF 4LSZB 1U49A 3G9CA 1FJGF 4NCGB 3C66A 1XMBA 2B9EA 2KI2A 3MM7B 3M6VA 2ZOGA 1T9VA 3FJ2A 5T41A 4NA1A 2MHEA 2MMYA 2L08A 3DRRB 1CQNA 1RE1B 2XMVA 5C42A 4JB8B 1S5ZA 2DO0A 4KE5A 5AXKA 4ALZA 5HBMB 3MM8A 1F0XA 4DV0F 4IG0A 4QWCA 2FTRA 3ENAA 3ZTQA 2D3O1 3CULA 3J7AN 1M5VC 5KT3A 1TL3B 2XS5A 4HT7A 3CGIA 1HL6A 4M5MA 3KLFB 1FO1A 4O4GB 3T1YF 1N5VA 2CJXB 3U1MA 5G0RB 4I2QB 4L3NA 1K1QA 3GJRB 1SUQB 3ZTRA 3QZ7A 3KYLA 4PYAA 1N0UA 1NPKA 2CZ4A 2FD2A 5KG5A 4X62J 3HT3A 5I42A 3Q83A 3THVA 1WKLA 2AYGA 2BVZA 2OSQA 3JXOA 2FC9A 1TK8A 1D8YA 4JI1F 1F60B 3ILOA 4BCAA 3W62A 4ES3A 1OYDA 3SMZA 1HBMA 2XYGB 2RDIA 1SJ4P 5KFBA 2CPIA 4ZN3A 3CD5A 1Q53A 1T0TV 4N41A 2ZE2B 1V6HA 1ACMB 2AX0A 4KR0B 1OQ6A 4OZ0A 5KFYA 4FF3A 1FRHA 3PX4A 1FE4A 1IBLF 2E1PA 1VRTB 3BM7A 3GR1A 3DRPB 1QUVA 3N0VA 4ZVSB 4QQBA 4A8YA 1RGVA 3PHEA 1VC6A 2AEFA 3KJFB 3M8YA 1MLAA 1S6QB 1J5EF 3GWCA 1DQAA 1FRIA 3FBFA 5J1EA 3B4MA 2MHNA 3M2RA 4GKJJ 3T5KA 3UNGC 1AA1B 2OEKA 2QLWA 2K3KA 3FVYA 3MMCB 3VQTA 4C0BA 2D1CA 4P10A 3ZZYA 1T03B 1DRZA 2CVIA 1VISA 2YWKA 3UR3C 4F50A 2R7SA 3FEXB 5A8RB 1JWWA 1SL0A 2R2UA 4ECSA 4P2XA 1UCNA 1RT5B 2M5YA 1R6YA 5KFPA 4RW8A 2MQLA 5KFLA 4ECTA 1XNRJ 4U6PA 2FJAB 5HQMA 1QTMA 2LA6A 2UVRA 1H3DA 3PNIA 1SKSA 4C48A 4DLEA 2BE9B 5K14B 1B7YB 3BR9A 2ROGA 4HDGA 2HLTA 3RBEA 3JSYA 2CPFA 5ETPA 1EP4B 5F8GA 1H98A 1RHRB 2K1RA 2DHGA 2UXCJ 3DLHA 4RJVA 2YBVA 4IQMA 3ENVA 5LMUF 4PUOB 1AFJA 5HO4A 1RBLA 3VQSA 3HFKA 2L41A 4NI2B 4IOCQ 3SFUA 2AJQA 3H25A 2LXFA 3HCXA 2DNHA 3MD3A 3LGNA 3LGMA 4RNOA 2GGPB 2E7XA 3KWMA 4B08A 3B54A 2W01A 1K47A 5F3ZA 1QSYA 2R8IA 1HBOB 1ZA2B 2HW3A 1Y3KA 3U7JA 1NZAA 1YRTA 2AQ4A 5HMYA 1UW9A 4WP8A 1HNZF 1RZMA 3AOAA 2NPIA 4ZITA 3CUNA 1RWUA 3LP2B 3K58A 3K89A 3PW7A 1HQUA 1RYSA 1UPPA 2HBYB 2WK4A 3FZBA 3WIUA 3ZZ0A 1ZTWA 2F40A 2WVCA 2BJ1A 3LQVA 5E0OA 5IOLA 2NREA 3J7ZT 1U0SA 2V69A 4Q2LA 2E9RX 3Q86A 1RTDB 3DDKA 2ZBIA 3C16B 2HGLA 5D4PA 5KFEA 2KRRA 3MEDB 4TY9A 4DR1J 2GMHA 3RAMA 3PRVA 1FD2A 1E6VB 2BJ3A 4KV8B 4HL9A 4F4YA 1AUDA 4NLDA 2FVQA 3B82A 6FDRA 3MR5A 2VQFF 2Z2ZA 2OELA 3TJ9A 4WWSA 1C0TB 3D0HE 3MR6A 4MYUA 2F3JA 2EI5A 1RBAA 3EGWB 4OI1A 2LVWA 3OFFA 4A8KA 1HBNA 4DR5J 1NKEA 2AP6A 2KL8A 4CO5A 5KFTA 3UVJB 4K4YA 3MOJB 3DLGB 5CCMA 1LWEA 1TK5A 1HQ2A 3M2VB 2ZBRA 5KFCA 4IOAQ 3GP9A 1EZZB 1QVGR 3DM2A 1KVKA 3CDEA 3JSMA 1NJWA 2YNHB 3HULA 5J2QB 3NOCA 4WFXA 3SFGA 2VBZA 4Z37A 5CA5A 4RNNA 3QJJA 3M2RB 1ITPA 3IWLA 4C3LA 2AZ1A 4BLGA 1UJ5A 2IYIA 5LSOA 2DGQA 3CVKA 2KM8C 4KB7A 2CWKA 1Y9OA 5AXLA 3W8GA 2CPZA 5BYRA 1NHKL 2CA9A 3BZQA 4QU7A 2ZKTA 3BGRB 2RRNA 3K57A 2ZD1A 2HHTA 2VFTA 2FY8A 2W9BA 4DN9A 2Z30B 1LW2B 4ZPDA 3LOUA 3ETOA 1LW0A 1TP7A 2MZSA 2UXBF 3RB0A 2VFVA 2IRXA 3FDSA 3DOMB 2JNJA 2RS2A 4ZLPA 3HVTB 1V3RA 4RBVA 1XQIA 5KFNA 4CLLA 1SQGA 4EBEA 4B3RJ 4DR4F 2BYCA 1SC3B 2H48B 4BWJA 4FNIA 4Q8EA 1XTZA 2HNZA 3ENWA 1UW4A 2YNGA 3M32A 2CQ4A 4G65A 3NWRA 4FVCA 4PXBA 1R8HA 4TKTA 4USVA 3EVWA 3K17A 2W2MP 3CDAA 5EUHA 5U47A 5L46A 1DZ5A 3HP6A 4DSJA 4A48A 4V19J 3K0JA 3PIOQ 2VFRA 1APSA 3KG4A 4ES1A 4U9RA 3M30A 2PFFB 4NWBA 4C8KA 1DARA 4XO0A 1URRA 4HH0A 4WIIA 4TYAA 4MKVA 3DRSB 3ILLA 3SSSA 4RNFA 4ZN1A 2KTQA 4OZNA 3W5XA 4JV2A 4RX6A 3OV7A 2B4UA 2NR0A 2DD8S 2HHXA 1R6VA 3PG9A 4JYAJ 2BW2A 2Z4PA 3MM6B 3BF4A 5FDLB 1NDCA 2LLZA 1PILA 3UPFA 3PX6A 5D77A 3M9NB 1NKCA 2UP1A 3HVAA 1MN9A 2ZDPA 2AHOB 5LM7E 3CJ3A 2YNIB 2VOPA 3BSOA 4RUHA 1SV5A 2VBYA 3BPDA 3FCWA 4OYZA 3TUJC 1VK3A 3G6VA 2B5JA 2ZBPA 2BV3A 3LP0B 2O66A 4OHXA 4CRJA 1EB0A 2XZTB 4HHHA 3G96A 1WDTA 4DR5F 1GXTA 3S6EA 3R9LA 2ZH6A 2B56A 2PMZD 2CPXA 1HWKA 3G6ES 1FTCA 1FNOA 1HI1A 1TKTB 2P8IA 3US5A 2FGOA 3HXMA 5DM7Q 1EKSA 4J9KA 2ZOFA 1RWPB 3EYZA 3MCSA 3T1YJ 4ZK7M 2DPJA 4QIGA 1XNQF 1FXDA 1MROA 4RUCA 5B0AA 3C6TA 1K0VA 5E3QA 5CAAA 4DV3F 2WRMA 3H5YA 1IJEB 4X4TA 3D1HA 1FT8A 2HQ3A 2J8AA 4QWBA 2J0XA 2QA2A 2ZDOA 4QR2A 1S1TB 3AB2B 3AAWB 3IM9A 2BJ8A 4I6WA 4ZJQA 1LWXA 3CE8A 4DBQA 1NSAA 2UVUA 1HYSA 4CTAA 3PR5B 3OT9A 5KG7A 1B70B 2EBGA 3TZXA 4U67Q 1FX2A 1SC1B 2B7CB 1HHQA 2EC2A 3GJQB 3HFVA 3M9MB 3Q22A 4DL5A 1NK7A 3OUYA 4FKYA 1FJ7A 3R5GA 2Q1LA 2WB4A 3VR1A 3MUVP 1UAWA 2YNHA 2XS2A 2B51A 5F8NA 2L9DA 3TA2A 5DGAA 3C46A 1S6PB 3TUPA 1JLBA 3QFHA 2N3OA 3FQKA 4X66F 3MR3A 1R8BA 2LDYA 3C6UA 1BGXT 2A18A 4AQYJ 3HFZB 2JZ5A 1LK7A 2W7AA 3P8BB 3M9OB 1HNVA 2WSFC 3EGZA 2GJIA 3BREA 2KXHA 3FFIB 2CIMA 4J90A 3CCSS 4KKOB 1S0MA 1IKVA 2XTJP 4ETXA 1FRLA 4DL7A 4M94A 3FMWA 1LW0B 4WFZA 4C97A 2ZZNA 2LYVA 3NRBA 1K1SA 4WXOA 4WTYA 3FCVA 3IRXB 4IG0B 2LMIA 3BN4A 5DS7A 3KJQB 1HW9A 1W25A 1GQEA 1S9FA 4DR7F 1Q78A 5ETNA 2JL9A 4ZJLA 1KTQA 2AWZA 4BWMA 4DI6A 3OLAA 2VA2A 3G2XA 5DLGA 1S0VA 4LF5J 1Y10A 3HHLD 3W7BA 2U2FA 4PAAA 1HNXF 1CLFA 2GMLA 2QG9B 1KHWA 3VAGA 2C3UA 4J9QA 5A8WA 4ZVUB 1RAEB 1HHTP 4NXNF 4C8ZA 1VBZA 4PWDB 2XO6A 2VIHA 4DX5A 5E7OB 3MM7A 3BH6B 3OSNA 3CJ4A 3GE9A 4LRDA 4U7CA 4ELVA 3AJ1A 5CCLA 1IWGA 3IGNA 1FJCA 1XN9A 2VFUA 3FSXA 3MMBB 4YB7A 4ECVA 3MPDA 2YX4A 3W2WA 2X1AA 2HVZA 3NGRA 2D3ZA 1HA1A 2G0JA 2C2ZB 4HHJA 4TY8B 4ZVPB 3BGRA 1GAOA 1Y4ZB 3I96A 3QIPB 1I1GA 1PC5A 1Y5IB 2HRTA 2JLEA 4Y2IA 1NUEA 2VQEJ 2F9DA 1YLXA 3RW7A 2XSJA 1B99A 2B4PA 2M8HA 1N0VC 1UKUA 3CCES 3TZYA 4CI0B 1DJ0A 1ZAWA 2OTJS 4ITSA 1C2PA 1Y00A 1TAUA 1DTQA 1CC7A 3OSPA 2CYYA 2M7SA 5GMKa 1N32J 2VG5A 1RTHA 3KUHA 2FLPA 4HKQA 2AJ4A 4ILRA 2UUWA 3EJMA 3B4DA 2R7OA 4ICLA 3D2WA 4DV1F 4DWIA 3GIIA 2HVEA 2JC0A 2E1MC 3AXKA 5HL7Q 4MKYA 1VQNS 2V8VA 2O67A 5D3GB 1V9OA 1Q82T 5LJ3Y 3V4IA 1DHMA 2MQ8A 2RH3A 4U8VA 3Q89A 4AQYF 1SJRA 3TR5A 3DOKB 3OR1B 1N33J 2MLZA 3OHAA 5IT4A 3S8SA 4ED8A 1FDBA 4CTAB 4KGVB 4DV0J 5CH7B 3ISNC 4I56A 4LVNP 4CLSA 4JI3J 3KMQA 3CJ0A 2ZUGA 3KK2B 2CNKB 3VAJA 1N36J 2DVIA 3PX0A 4NLSA 5KFIA 4OYIA 1SJQA 2CKWA 2VJVA 3PZPA 2J6SA 4NMXA 3R5BA 4DX7A 2QX0A 4IRCA 1RQ0A 4I2PA 4CDIA 1G1XA 2HHWA 1S57A 1FKOB 1ZAXA 2BUNA 1TVRB 2K2PA 3DKDA 1YJ9S 4LRBA 3AODA 4ED4A 1GXUA 3E01A 4RR5A 2QLFB 2HHVA 4WXWA 1XMOF 2O1PA 1RT3B 1P8GA 1KQFB 3OTCA 2KYZA 1OPZA 1LWEB 4DV2J 7FD1A 4DV4J 3V6KA 4ZPCA 2WBRA 1YIJS 3UWTA 3J7A1 1RDRA 4RLEA 1QLNA 3IP0A 3K7RA 1U7LA 3BDEA 3NCQA 5B09A 3KNAA 4DR2J 1ELOA 3WZ0A 3N5BA 1GK8A 5DG8A 1WC0A 2WCXA 3GIJA 1YJRA 4C0HA 1LFPA 3D4JA 1UA1A 1DURA 2MDAA 1X5TA 2HIYA 3A8IA 4E0DA 2NUHA 3IBFB 4DQIA 4I67A 4TU9A 4NLQA 1WF0A 4J9PA 3V4MA 3KLIB 2CQBA 1N6QB 1VQOS 2AV5A 3NAIA 4O44B 5F8HA 3W3SA 2DIUA 5KG4A 1YDLA 3UI3A 3WIVA 2ZM6J 2H54B 4G6VB 2UXBJ 3HD2A 1VQYA 5A76A 3B6BA 3H2LA 4MIWA 3THTA 2V8HA 3LANA 5LT5A 4CLUA 2LA4A 3V81B 4ZLNA 4K8RA 3GQCA 1XNRF 2EC0A 3GZ7A 1NH7A 2HKEA 4MFBB 3IR6B 1WTFA 1RAAB 1UEVA 2P6SA 3NCRA 3O8WA 4OJ1A 5KAKA 2N82B 2VU5A 1IBKJ 1R89A 4EK2A 3RJMB 1JLGA 2Z56B 5K20B 3VVUA 3IN5A 1CPZA 2XI2A 4I7FA 4YB6A 3D5MA 5A6PA 8RUCA 2YWWA 1CG2A 4RW4A 1SQEA 4NCGA 1AW0A 4IH5A 1KQSR 3ZNJ1 3DI6A 4GC7A 5HMZA 3BKTA 2DKOB 5HROA 4DSLA 4YDDB 3IG1B 2FHJA 2WSEC 1NK5A 2I2YA 1JXEA 2KFNA 3TYTA 4DZ6A 4F7VA 2C42A 2WVEA 4IRDA 3OR2A 3ICLA 2YXLA 5T7LA 4A46A 1LFWA 2L48A 2FHJD 5HBMA 4H4MB 4HHUA 5EWFA 4QOTA 3UN5A 2PI5A 3EVMA 1TTHB 1BUXA 4CYUA 2AW0A 2BRKA 3RR7A 5CD4A 2CADA 3DLEA 1ZS6A 3F41A 1PYOB 5CYQB 2ZZMA 1RTIA 3IGVA 3BS9A 3ZTSA 4B3OB 3CCZA 1H7XA 2PEBA 2BE2A 3R6GB 4YY3J 3DRRA 1S99A 4O0IA 2XS7A 3PCOB 3U1LA 1S1UB 3DLGA 1S1WB 3JQKA 3TRGA 4QPTA 1NEEA 2V94A 2PD1A 2J0SD 4J9UE 1RWXB 3CD0A 4USTA 4OL8A 3UCUP 1HNXJ 2HBRB 2IHR1 1PC4A 2MZRA 2HNZB 4LIWA 4HACA 1HIYA 1RT1A 4DUYF 1O5JA 1SB6A 4LSLA 4A8SA 4ECRA 2XMAA 2QC3A 1JLAA 4URSA 4NEYA 3PW0A 1IQZA 1EKRA 1WWHA 2GVDB 2GAGC 2HWIA 4I2QA 2B3TB 4TLRA 3O44A 5A2QU 2EFNA 2MZQA 3T3FA 1SKWA 2M3DA 2I6WA 1UL3A 4J9OA 4JI4J 4PWUA 1AFIA 1EX8A 1JLCA 2GX8A 1DBDA 2OGUA 5KOXA 3T9ZA 1M5KC 2G1HA 1IKWB 4YDXA 5FDLA 4DR2F 1VQKS 2HQFA 3HVRA 4BDPA 4X4UA 2C2RA 4B17A 4NLGA 1LWFB 3Q8UA 4RU2A 1S1VB 3EUNA 2HGNA 5HJYA 3TJ8A 2DO4A 3V2UC 5LMUJ 1HFEL 3J81j 2ILYA 3NS7B 3MTJA 3Q23A 4FF1A 1IXKA 1S6PA 2B9XA 2QA4S 1QSLA 2VC1A 1RTZA 4NCAA 4X4OA 1S7HA 3C6UB 4WBFA 5FLXY 1ZBTA 1UP1A 2RIJA 3NY0A 4KPCA 4M5KA 4NLWA 3HKZD 1RI7A 4ZP9A 2OFGX 4YQWA 2CJQA 3RB4A 1OYEA 2GHVC 5DO2A 2PT0A 1U25A 5HSPA 3GSIA 3RB6A 1U8SA 3AQPA 3M8PA 3UNYA 3KK3B 3MXHP 4WFAQ 5L1JA 1YQHA 2UVVA 2GVZB 2IVYA 1XJWB 4NOHA 5T7LB 6FD1A 1PIEA 4JV1A 3M8ZA 2KXNB 3UFCX 1YHQS 3X1LB 3DRYA 5F0UA 1EP4A 1KN6A 2GA7A 1HPZA 1OS5A 2B9YA 2PIIA 2BJDA 3GFYA 4DPOA 5A8KA 2W7OA 2DNMA 3VGVA 1RT4B 1C1CA 1KOHA 3DOLB 4UOFA 4LF4J 5EWGA 1XERA 2B7BB 2HK2A 2OFHX 4IG3A 2P9EA 1NRKA 3TWZA 4DSFA 3ULHA 1IBKF 3ZNUA 5LL6d 4UT4A 2RUSA 3I87A 4WFBQ 1U45A 3KJNB 4USKA 3G6YA 3CCQS 1TKZA 2DEIA 3MEEB 4FS2A 1PO6A 2G2YA 2LQ5A 3W5ZA 2B0GA 1TKTA 1ZPWX 2AIRB 2F65A 3TQEA 5K8MA 5AJ3F 1Q81T 2Q66A 3A3OB 5ETVA 5D0EA 1RHJB 1UVKA 1VDHA 2M9KA 4K4WA 1JLFA 4FXDA 4YOEA 4JI8F 2PDAA 4KAIA 3ILJA 1X31C 1IBCB 4FVMA 3AFGA 3TZZA 1Z2ZA 2PA3A 3W9IA 3GILA 2VHGA 3KLGB 2NQPA 4K5SA 2CPHA 4RW6A 2KM8B 3P49B 2ZOMA 1DTTB 2N4DA 4O44A 4PXDA 1RTIB 2GS8A 3M7VA 3OTBA 4X4VA 2C3PA 4A8OA 2HBZB 1O0PA 1S9GA 4Y3CA 3L09A 3WX4A 2YH1A 2ZJQQ 3FC9A 2QA4G 3DN9A 4LFCF 4OJ3A 4F2SA 3PW4A 1VQLS 4DPYA 5G4DA 1EETA 1IM4A 2LXUA 2XMUA 4DN0A 2CJKA 3L7UA 2RHSB 2DISA 5LXYA 4NA2A 4OIXA 1RT6B 2QMUB 2RF2B 3HSJA 3GPAA 2L9NA 3QO9B 4GRSA 4UUXA 3EX7B 2HG4A 3MEGA 5B08A 3C16A 2ABYA 3FK4A 4DFMA 2WB1D 5CZVA 2NXEA 4OI2A 1NK9A 3QQCD 3HKWA 3VALA 2QLXA 4CT9A 1A9NB 5A0YA 1FKPB 2E7VA 4DV6J 4DSIA 4DF8A 4JV5J 1PG5B 3R5AA 2BABA 2ZHBA 2PSZA 1PJ7A 1Y5LB 3M1VB 3O5TB 3PM9A 1GNKA 3QZ8A 1N36F 1C0TA 1G6BA 4OI4A 4UOHA 4KJIA 3OL9A 1LNQA 1UPMB 3A13A 4H4MA 1NK8A 5AT1B 1CS4A 3CC2S 2F4VF 4CYUB 3I0RA 1TUVA 3T6JA 3KJVA 2MSTA 3OHBA 2J0QD 4V19X 5DETA 1WHWA 3EGVA 1S72S 2AEMA 2GV1A 1UFLA 2CJAA 4HT5A 4LUBA 1HR0J 1Q4RA 4ZCLA 5BJRA 3KXDA 3A4TA 2RKIB 3I4HX 5HP1A 1WEYA 1H2TZ 3MEKA 3JSMB 5DZ7A 3TOQA 2YTCA 7FDRA 3BQ0A 1WKJA 5D0RA 2HQDA 3CCLS 2KHCA 2XMWA 3BGLA 1T8EA 3VZIA 2YY3A 2KRBA 5DDOC 2XWYA 2OAUA 4UF4A 2DGSA 2J8SA 4F3QA 3OD2A 3GIKA 2Y1JA 1TL5A 4FBTA 3V4IB 2HPUA 2IA0A 3G82B 4Y28C 3FSYA 2N7CA 1HPZB 5EWEA 1K73T 4OHZA 1DQ8A 1QJHA 1RT4A 1VFJA 4M8LA 4KTQA 2KJVA 2DR8A 3BDPA 1NMEB 4IG3B 2YKMB 2ZH9A 2OH2A 2ZH3A 4KT0C 3HDSA 1NK4A 3OLBA 1U8WA 1TL4A 2MQOA 4IO9Q 3KK2A 1XNQJ 1UVLA 2WAQD 2IIHA 1M5SA 3U02A 4N77A 1BD6A 3DDIA 2RU9A 3Q8RB 5D0GA 3EDQB 1WC5A 4E8UA 1MMNA 1X9WA 1R0AA 1MWYA 5E3PA 4N56A 3VAMA 1VR6A 3UQSA 3A3NB 4L3KA 3RBXA 1KRPA 4KGXB 2IC3A 1JX4A 3BB5A 1FCAA 3D6MB 1R8CA 3CCMS 2GFFA 1MSWD 3LWLA 1DLOB 1UZDA 5CYMA 1X8DA 1VQ9S 5B0GA 4LSNA 1PBAA 2KXFA 5KFKA 2C2OB 4B3MF 3OFGA 2V4QA 3F56A 1U0HA 1LXJA 3DOMA 1BLUA 1X4FA 2AJ0A 3KHHA 1XR6A 2O3DA 2G9OA 1DAXA 1HMVB 3CJQA 4J91A 1CJKB 2RVJA 4LRCA 4FYXB 4P75A 4KHMA 3I0RB 2XGPA 2W9AA 2QFJA 4QYRA 3KLVA 3T5LA 1LQ9A 2M2BA 4DR3J 3R97A 2DR9A 2NXCA 1IN0A 3MF5A 1ZM3A 4EO6A 2KYXA 4LR7A 4ZVOB 3HHKA 3NL0A 3FQLA 4K4VA 4IR9A 3LTOA 2HFVA 5DQIA 2WTFA 4O3RA 1MU2B 3PTWA 2GQ2A 2FVCA 2BZ2A 4P7TA 2E29A 1HARA 2VQEF 1B64A 2Q43A 1T95A 4EGLA 5DDPC 1ZOTA 1HD1A 2RHQB 1WJ9A 4QW8A 4DV7J 2A0FB 2C22A 1F5BA 1S7IA 4PXEA 3A1YG 4FPIA 5BR8J 3C8YA 2ZUAA 2ASYA 1SPBP 2DBBA 4F0MA 1A0OB 2O5DA 1JNRB 2X1BA 1TL7B 1WORA 4M5DB 5JJBA 2IBKA 5IT0A 4EZ9A 3LGHA 1X5OA 3PW5A 2WW4A 3L7OA 3QGIA 1SJFA 4ZOSA 4A8XA 4M5JA 3A8KA 1T9TA 3LALA 1FKAF 3L4BC 1SIZA 3H2UB 3IG1A 1JLCB 1G3OA 2HNDA 4PG5A 1OY8A 4KKOA 1YBAA 1IQTA 4YB5A 2A1BA 1IKWA 4JI5J 2VDIA 3PY8A 1YTYA 1TR0A 1X5SA 3IAS9 3IC1A 1Q5YA 3LP1B 5EHHA 3BO2A 4UZCA 2DGTA 3N79A 1U1OA 3HVWA 1QAYA 4USHA 5L9XA 2VOOA 2NXJA 1VS3A 2GJFA 2HHPA 3TA1A 1GTEA 1K9MT 3E51A 1MMDA 2HLUA 1HD0A 3DNCA 3H5SA 3MPUB 2ATLA 2AYBA 1RTDA 1GH8A 1YWXA 4LSNB 3MUTP 4RW8B 4CH7A 3LWMA 2DR5A 1FNMA 5L1KA 3RYLA 4C6AA 2AZ3A 3NGSA 2HK3A 1UJ6A 3PHTA 5KFVA 3VZHA 4C11B 4DFPA 3JB9k 1UA0A 1TKDA 4LMZA 2MPUA 1KVJA 1KS2A 1NDLA 2OMLA 3O3LA 2ZJRQ 4ECZA 3TEHB 1CULB 4ZVGA 1U4BA 2ZITA 5KFQA 3DHXA 2QMWA 3M05A 4LF7J 1KONA 2HSEB 4DV4F 1QVFR 5ETOA 2KO1A 5HLFB 1TK0A 3UDEA 1PJ6A 1T02A 3DGPA 2DH8A 4TLQA 3R8YA 4AL5A 2BQUA 3MMCA 3IAM9 5A8KB 1WNEA 2V34A 2DHSA 1MU2A 1JK9B 1VMBA 3NBPA 3ETMA 5DJBA 4LFAJ 1RKJA 3D3BJ 3DLJA 1KVIA 2Z57B 3W66A 2GIQA 1S4EA 3Q2SC 3SCIE 4DG1B 4IO1A 1SCJB 2UUAJ 4F67A 3P5TL 4N8NA 4KY3A 2VF3A 3M8SA 5L8RC 5KT7A 8ATCB 4DHVA 4XAKA 4YMEA 3GG0A 1JLFB 5KFHA 2YH0A 1JLQB 2K8GA 3TUIC 4RBUA 3R5CA 2C2NA 2OI2A 1KKHA 2V9KA 2WBMA 3JYTA 5A8WB 2YQ3A 1SKRA 1C0UB 3E8OA 1CJUA 3PKYA 4ELUA 4MK7A 3GJTB 3OVSA 1VBXA 2CQIA 4QWDA 2KZZA 2EPIA 3R1LA 4F2RA 5ETSA 3EZ5A 2E1RA 1GT8A 2MKYA 2WHOA 3PYFA 1W26A 1IBLJ 1TMJA 4QIVA 5K9FA 4FKXA 1RBOB 5F41A 2DT9A 2J9CA 4WTOB 2J6TA 1ZH5A 1D09B 3IWXA 2BANB 2E5LF 1NDKA 3I32A 4ATNA 1NSPA 3FBBA 2ZH8A 3HJFA 2LU2A 3DMJB 3G8TA 1I5OB 3AA8A 1QTNB 2W2QP 3NG8A 1OWXA 3QIPA 4M5HA 1R7IA 2KG1A 1KC8T 1F5AA 3LA0A 2OHDA 5CYMB 2F63A 3HHNB 4L6V3 4A8MP 3UE2A 2R8KA 1IR1A 1X0FA 1X9SA 2CDRB 4PZVA 4F26A 1FEHA 4UOGA 5HMXA 2JOQA 2MKSA 4NLXA 1Q16B 1RTHB 3PDNA 2EFVA 1WHXA 4TQSA 3TANA 3T5JA 1J5EJ 2IAJA 2OSRA 1PSDA 2GAHC 4ELTA 1RAOA 2OEJA 3BGUA 1MG7A 4IDKB 2EK1A 1S12A 4UZBA 2KN4A 1NK0A 1FRJA 2G2OA 4DPUA 4NLPA 2L3MA 1LW2A 2JFDA 1VC0A 4DEZA 4C3KA 2G0CA 1S9EB 3DGVA 1XR5A 2V2VA 4DL0C 3F0NA 2YVSA 4HTIA 3PKMA 1C4AA 2MQMA 2BJ9A 2BKOA 1GMUA 5MAOA 4IUFA 2LEPA 3MOZA 2DNRA 3WHIA 1CULA 1WUUA 2FZGB 4F4WA 3CD6S 1QAIA 2Y9HA 4K50A 4P52A 3HK2A 4CH1A 5E5NA 1C1BA 4LT6A 4DQSA 1N5TA 2QL9B 4YFUA 4A4JA 4F4ZA 2FLNA 4LF8F 4O3NA 1YJUA 1VCTA 2WVBA 2YKQA 3H2VE 4OYOA 2OO4A 4IR1A 1NU4A 1Q8BA 2I5JB 1B0PA 5ETRA 5A0YB 5IXUA 4TNOA 2LEAA 3TX0A 3EXYA 4K4XA 1VOMA 3FRZA 3VTIA 3GV8B 4YHHF 4HVZA 2MQPA 3KHRA 1HYSB 2AYMA 5J2PB 4IRKA 4QYZJ 3MM6A 4OLPA 4JI7J 3ZZZA 2XNQA 3I9ZA 1H2VZ 2F5GA 2H4YB 4PABA 3SCKE 3DLLQ 1TV6A 4ZP7A 1SI9A 1WC3A 4B9LA 3QJPA 4DU7A 4JV5F 3TEGA 2ZFHA 1RCXB 1F3FA 1TL1B 2CJ9A 4UOCA 3TP2A 1VK8A 2F8MA 2WOMB 2JEFA 3K5MA 1NAQA 2Z2YB 3G6XA 4OYWA 3DI6B 4RWXA 4ZVRB 3JYTB 1YGYA 4DR6J 2PGCA 1RACB 3JAMY 2XYHB 3Q8YA 2BBEA 4WYLA 4B3TF 2RQMA 5GAHI 2IM0A 1S1UA 1AYEA 3DRXA 4P2MA 2LP4A 4CLFA 5F8IA 4FF2A 3FRYA 2PC6A 3IM8A 4DUZF 1EIYB 4MFBA 1IBMJ 2YWGA 1H6KX 3CIZA 1S1TA 4J37A 4LQ9A 2FB0A 1B7FA 1CJTB 3D66A 2MJNA 3NBPB 4I0WA 2ASJA 2R8GA 4CLTA 2IM2A 4QYZK 1VYAA 1U24A 1RYRA 3QFWA 1Q7YT 1XR7A 4NI2A 4ZKAA 2UXDJ 1QM9A 2OP5A 4N7TA 4DG1A 4EBDA 1RT2B 5C24B 3DXSX 1Z4UA 4DR7J 4C4WA 3UCGA 4ZVQB 1WF2A 1U1MA 2K1RB 3MM5B 3P4UB 1D1UA 1FDDA 2D69A 2YWEA 2JRSA 1PYSB 2MY8A 1HWLA 5ETQA 5IT9Y 2VUGA 4I64A 3L95X 4NASA 4X62F 2AGQA 1RT7B 1KD1T 5D15A 4WZQA 4OMFG 1UEKA 2W7PA 4NLOA 3MMAA 1M1KT 2CG8A 1WF1A 2R4FA 4F3MA 4NLUA 4RW9A 3DLKB 2WONB 4Y2AA 5IQQA 3AJ2A 1FVSA 3NOGA 3UD3P 5RUBA 5KG6A 5LJ5Y 1K44A 2JDJA 2DR7A 2X3DA 3FNNA 3FZ2A 1LWFA 3MCMA 4AXJA 4K4TA 3IRXA 3OFEA 1WEXA 1E6YA 5M2RA 5DG9A 3N4WA 1DFDA 1HBUA 4X4PA 5B0EA 1IWAA 4AT1B 1FWPA 2DEJA 2NSCA 2JWNA 5IQ6A 3B8HA 3FEYB 5IM0B 2MQQA 4OI6A 5KFGA 2AYEA 2JVOA 3K2YA 4V1Ak 1S6OA 5J1NA 1W2BR 3FBEA 3HHLC 4DCPB 1KQGB 1H74A 5LSRA 4NA3A 1L5UA 4RWWA 1CBKA 2F7VA 4X4NA 2OPPB 1DQ9A 1VJWA 3RRGA 4RU9A 2DGVA 1SL1A 2XG8A 1XBWA 2EW9A 9RUBA 3PFEA 4Z2XA 2F8EX 3KK3A 4YR2A 3TVYA 2W4CA 2IFXA 4ECWA 1WHYA 2FVPA 1NPPA 3JTOA 3KFWX 5KT2A 2ZJPQ 1CJVA 2AF6A 1D8ZA 2XHCA 3NP5A 4X64F 1J5OA 1F2GA 2HS3A 3BO4A 3FCHA 2UUBJ 4LF6F 1BQMA 5C25A 2RB7A 2DHAA 1F2HA 2DXEA 2RJZA 1LOUA 3T1AA 5KT4A 3KLFA 2ZM6F 4JI4F 4Q0BB 5H9EJ 4P2SA 4Q5VA 2PMHA 1ZYQA 3UVJA 5EX0A 3J80U 1RWOB 2V4JB 4OZ2A 2F8HA 2NS1B 2EKNA 4USUA 2HFOA 2XSJB 1RAGB 1W7WA 3GB0A 4PWWA 3FMBA 1YJVA 4Y2KA 2MYFA 3PXGa 3NGDA 2ZH4A 3DYAB 5H9EK 4DQPA 2W9BB 4JP8A 4IYQA 2HNDB 1NK6A 2OPRA 4DL3A 1NPRA 4HR2A 1N8RT 2IVMA 4NLTA 4LF6J 1IKYB 2KT5A 4WE1B 3MR2A 4ED3A 3T19A 2EK6A 2N4CA 2DK2A 2D7SA 4JBCA 4FBUA 2BXJA 2CZ9A 2LFVA 3GFHA 2JVRA 2BKPA 2QYGA 2A3JA 3GCWP 3C19A 3OXFA 3FSIA 4DV2F 2QMXA 2VC0A 4DR1F 1X4HA 2CAJA 1LXNA 2M0GB 2YX7A 4M5LA 2EBEA 3ZZOA 5D3GA 3TA0A 3M8QB 2I5JA 3SZ2A 4PXCA 1TL7A 2ZNYA 3MAHA 4BC7A 4P7VA 5CHCB 5L1IA 2OLWA 2HEKA 2P9GA 3P45B 1MWZA 3P5BP 4DFJA 3PJ9A 2OPQA 1FWLA 4IKAA 3RRKA 3PIPQ 1XMQJ 1SL2A 2QTWA 5LMNJ 4ED0A 4MTPA 1RT6A 4R0JA 2IMOA 1M1GA 2WOMA 5IC4B 4LFBF 3LUYA 3AY0A 2Y8YA 5KFOA 1QDUB 4J9RA 1CS4B 3RUBL 2RS8A 2RQ4A 1S0NA 1FXLA 2R9LA 2FHOB 4RW6B 2YKOA 3KLEA 4OX8A 3WQPA 2W4DA 4PEOA 1Q1KA 3MR7A 4K2JA 2DR6A 2IVFB 5E33A 4YN3B 2VASA 2RSQA 3K8WA 1EAYC 3A8JA 4G1IA 1U6ZA 1UEUA 4C11A 4K5RA 1X5PA 1SJ1A 4XK8C 1U26A 2JLFA 1REGX 4LF1A 2XGQA 3EPIA 2DH7A 5ETLA 1OJ4A 2GHWA 2NCKL 3LP0A 2IDEA 2EFQA 1UVJA 4O4GA 3BQ2A 3T1HF 1WACA 2DH9A 3M2UA 5BYQA 5BYSA 5EGYA 5FJ4A 1ZA1B 2VG6A 2UV8A 1KR4A 4FDFA 3GIRA 3MECB 4ER8A 4GKKJ 1MWQA 3PO5A 3A3PB 2XYPB 3TI0A 3E01B 3LAMA 2IY5B 5C24A 2B4OA 2Y0SD 4IFVB 4WJBA 4DPWA 1LWCA 4KO0A 1MROB 4CM0A 1OY6A 2G0IA 4OYXA 2GMJA 3BEGB 4K2XA 2MGZB 2I0XA 1N5SA 1HWIA 3MMJA 2A6OA 2PI4A 4CLPA 1T11A 4LREA 1WDDA 3KNGA 1H38A 1M5HA 4OYAA 3CB4A 3BBBA 4EI2A 4NXMJ 1M90T 1Q95G 2A10A 1OSDA 2MEWA 4B9TA 1XMOJ 4UQGA 2GO9A 1JLQA 1RA7A 2HWTA 3CXCR 3K59A 2FVRA 1VIOA 3W2VB 1T9UA 2AKWB 4CLZA 2CWXA 2MSSA 4DX8H 2NUUG 1RU1A 2HMIB 1S59A 1HNWJ 1ZZFA 2FC8A 3DDNA 2DYAA 2NSBA 3I82A 2GQQA 2K3IA 5T14A 2BKNA 2XQCA 5HP1B 2QGFB 1RTJB 3KKFA 5AJ3J 4ZPAA 4O4RA 1I51B 1R0AB 2XWXA 3EVOA 2ATCB 4YEAA 4ED1A 1QAJA 3N6LA 2SXLA 1MMLA 4P6QA 4MIBA 4CZCA 1FDAA 2M88A 4ZHRA 1UVIA 2DRBA 1UWAA 4PPDA 2DY1A 2UUCJ 2BANA 5HATA 1B0VA 1VJQA 3MFIA 4C9DA 1JQGA 3TJAA 3FFIA 4RUAA 4MAKA 4OZJA 2KFZA 2ZE2A 3F44A 4OHYA 1R43A 3G8SA 4DUTA 4I7FB 5B0BA 2MY7A 4K0KF 4X2BA 3SQGB 3GV5B 3RRHA 4KBIA 3KHGA 2XY5A 2HBQB 2B43A 1VQSA 3H0PA 3M6UA 4NZ7A 3S01A 2G2ZA 4QBUA 5DDRC 4ZPWR 1P1TA 2HFZA 4ZPVR 4NYOA 3AA9A 1F9FA 3OW2R 2YKNB 4H4OB 3ELHA 3KDOA 4C8NA 5F0WA 8AT1B 2YKPA 4DSKA 1R3NA 1BE4A 4DOZA 2ZH5A 3GMGA 1WC4A 4GVBB 4R8UA 2HQGA 1Q8KA 1WG1A 5D4NA 2ZEJA 3RZAA 1N88A 3QT6A 1MW7A 2MZTA 3A12A 4CCHA 2XCAA 4WFYA 3MCOA 5KOWA 2XO7A 1VI7A 4UY85 1SH2A 1U2FA 3TVKA 3KLEB 1XK8A 5I3QA 1FESA 3D67A 2RRAA 3H42A 3AT1B 4NLRA 4F36A 3QNWB 1U48A 4OHWA 2M52A 2A2DA 3ISZA 1WD6A 2FZKB 2KT2A 1QAXA 4AD6A 4CP5A 1VRQC 2ZH7A 4DV5J 2RDJA 4KPYA 4OZ1A 1HLWA 1S0OA 3FEZA 1RKIA 1FI4A 2QN6B 4PG4A 4DF4A 4DL6A 3NNHA 2EKYA 2NYHA 2AJFE 2DRDA 3BYRA 3CTRA 3M30B 4GKKF 4OLOA 4DQQA 1N4LA 2DGOA 3QMQA 3HX9A 5ADZA 4GC6A 3N6NA 2H1YA 2HAFA 3FKBA 5I3UB 3DC2A 3V6DA 1RHUB 3CO9A 3O6QA 2Q6CA 4LF2A 4C8YA 4CQ1A 3PYDA 1R0CB 2ZNZA 1VC5A 2GGPA 2LQ9A 3IS9A 2I1RA 4DX6A 4Q8FA 2R7QA 1IJFB 3PO4A 1K0TA 3K8VA 2FJDB 1HBOA 2DHHA 2V9WA 2CDQA 2NXNA 3R2DJ 3W8PA 1UZHA 2Q3PA 1KEKA 3NAHA 3VCDA 4HH1A 1Z1ZA 2IJNA 3LF0A 4PPZA 4WK1A 4B9SA 3RR8A 4F02A 2Z2MA 1HQEA 2QSFA 2VV5A 2E9TA 1C1CB 1FEEA 3DOLA 4MH8A 1TL1A 3QIDA 3THPA 4EMDA 3RGIA 2W4PA 2WSCC 2IM3A 3M8WA 5GAGI 1IM6A 2GO8A 3C14A 2HS4A 4F8RA 1VBYA 1K8AT 1U02A 4AL6A 1EQMA 2M8DB 2XMTA 2D41A 1NM2A 5IWAF 3PYGA 3QWPA 3MURP 5HQLA 2ZH2A 3AXMA 2ILZA 4ZP6A 1XIQA 1JJHA 1P27B 2QLJB 2J7KA 2YKNA 4H4OA 5HN0A 3CJTA 4X65F 2W8KA 3CPWR 4A8WA 1J5OB 4LF9F 2KT3A 2VB6A 4O3PA 2ERRA 2LU1A 1Q5VA 4IFYA 4PG8A 2MXYA 1IBMF 5L39A 3HLUA 3UD5A 3R1HA 4PG6A 1SXLA 9ATCB 1YJ7A 1S77D 1JLEA 1R27B 2V63A 3ADAC 4OZ5A 2RQCA 3AD9C 2VQFJ 2OEMA 3PRDA 5D78A 2W9CA 2EXUA 3T5HA 2ZWPA 1H73A 3UR0A 3SI8A 3N6MA 4USMA 2V6AA 1CSJA 4M63A 3IFEA 3ZTPA 2JSXA 3MGJA 1UVMA 2EG1A 4WCEQ 3OFHA 1YG0A 3A8EA 2CQDA 1X4BA 3UDCA 1HBUB 2ZBQA 2E5HA 4FYVB 3QAUA 1TU0B 4FF4A 3OVBA 4FXWA 5IM0A 1JIHA 2H51B 3GYXB 5C7PA 2KFYA 2ROEA 2CZVC 1P1LA 3B78A 3IXQA 4KRWA 2RU3A 1N5YA 3BSCA 3I31A 4M1KA 2GW8A 2W2PP 4TVAB 3OTEA 4WK3A 3V5RA 1HBMB 1HNVB 1V5IB 4HI1A 4DL2A 4U96A 5ITHA 1SIWB 1RT7A 2A6MA 4ERDA 1HHSA 4EUVA 4JI3F 1HNZJ 3T41A 2PFDA 5BXIA 1FKPA 2VKZG 2HMIA 1HNIA 1U2CA 3VGSA 1REVB 3CJ8A 2MKIA 4AXIA 2BM0A 1NZ8A 4HYKA 5E3CA 7AT1B 1CJVB 4X4SA 2VH7A 2XC9A 3Q0AA 5J2MA 1N33F 2HVIA 1TELA 5KFMA 1YBTA 1UJ4A 3LPEA 4FXVA 4EFAC 2YNFA 2H5IB 1H7WA 2POKA 3QT5A 5E3RA 4WF9Q 1YZ7A 3BN7A 3HZGA 4M5NA 4ZPTR 5HAOA 3R5JB 2E9ZA 5IT9U 1D9AA 3SV4A 3D1QA 2RF2A 3V6DB 1Y3JA 1YITS 2HRUA 2QLBB 1RK8A 3DYAA 3E2EA 2XLKA 1ULRA 5JVHQ 2HURA 2J7WA 3DU5A 3M6WA 2DNKA 2ZKUA 4OZ3A 1R8AA 3C15A 3DU6A 2D3UA 2W2OP 4P71A 3GG1A 2KG0A 1Q8IA 4XPCA 2HFUA 3LAKA 3MAAA 1N56A 4DR4J 3W2WB 1T9WA 1S97A 3ZZPA 1NB7A 3VGUA 2HGMA 1FJGJ 3KDNA 4MKAA 2ZWOA 2JEIA 3M1VA 2DNZA 2R3VA 1T7PA 2GJ2A 2JJ4D 3PEHA 2MKKA 1TUGB 4RO0A 1YJTA 3RBZA 4WFNQ 1FJEB 2X1FA 1GMWA 3OXGA 1RT1B 3M8QA 4QIEA 2C2KB 2DNNA 1C1BB 4G3IA 3RBDA 1KLMA 3GCXP 4KHRA 3BKUA 3IA0A 3RAQA 4FYDA 3WDOA 2BE2B 2Z8QA 2RD5C 3RTVA 5E2QA 4KQZA 4ZDNA 4M5IA 4LFCJ 3EM1A 1S1WA 3IWNC 4BBYA 4PKDB 2VG7B 4DCJB 3N01A 3V6JA 1IR2A 1YZ6A 2KVQE 1PKUA 1S76D 2GHPA 2XBPA 3CWJA 3QLHB 5J2PA 2OPRB 4C8OA 2Z58B 2R7RA 4PR6A 1FDNA 1UMJA 4WE1A 5C2CA 4BC9A 3VF0B 1W2IA 4LF5F 1JLAB 4ZIVA 1HNWF 2HS0A 2QO3A 3G87A 3KTQA 5SUHA 5H9FJ 4IDKA 5M2PA 1T05B 1CC8A 2B9WA 3DOKA 3OR1A 4KGMA 1ZM9A 4Y2MA 3SXLA 5LSLA 1CEZA 1DLOA 4URQU 3MAQA 2CPDA 2RILA 1N52B 1WEZA 4ETZA 1NDPA 4FN5A 4YY3F 2NPFA 4UY8T 3EZUA 5GAEI 4CO0A 4DJBA 1X4AA 1F1BB 4DUZJ 2LQJA 3PR4A 2J9DE 1UFWA 1HKAA 1RLDA 2LXIA 1RADB 4XIUA 1KDNA 1FK9A 2JX2A 3SEOA 2QE5A 1Q86T 1L3SA 4Y6IA 4NRUA 3DHWC 3U27A 2KB2A 1PYTA 2YWHA 3S7RA 2XZDB 4A47A 4KSEB 5F8LA 1TVRA 1EQ0A 1ZM2A 5KFJA 3KUGA 5GAHU 2Y3YA 5HI7A 5ETMA
chains in the Genus database with same CATH topology
5IFMA 2UU9F 4KHPF 2DGWA 5KG0A 2XLJA 3KG1A 3IRWP 4J9SA 2C2DA 1S49A 4USIA 3PACA 1O51A 4Q7AA 5GAEU 3BSNA 2KZMA 5F3TA 5KFFA 3VAFA 3MMBA 1A6LA 2VZ9A 1S6UA 5K8NA 2W25A 4UQTA 2RT3A 1FVQA 1L3UA 2EWHA 3DM2B 3OL6A 2D3OR 1VQ8S 3OL8A 4IOBA 5GADU 3CJKA 2DITA 2MJUA 1KTVA 3PVXA 1TZ0A 1BWEA 2IRUA 4LF7F 4HDHA 1X4EA 1YRUA 2V2KA 1KFDA 3AQOA 3PRBA 4G1QB 4GMKA 3ZFVA 5DG7A 3JSBA 1KLNA 5K8PA 1GH8A 3H40A 2Y1IA 2BDPA 2LCWA 1TKZB 3MEEA 5I4MA 3OTOF 4UUWA 4N8OA 4ZS6A 3MPVA 1XC9A 3KG0A 4W92B 2DTJA 1T3NA 1S9GB 1NKBA 2DNGA 1S1XA 3IR7B 3HHDA 1NJZA 3V6HA 1OSCA 4LQ3A 3JSRA 3SSRA 4YB1P 1XMQF 1N5YB 1E6YB 3AB4B 1D9FA 4ZMMA 3C2PA 4M95A 3CD7A 2P9CA 3ITHB 4OV1A 3Q8QB 2R8HA 1H2UX 5KTQA 5F8NA 1IKXB 1V3SA 5K5MA 1VRTA 2Q6BA 4JI5F 2OD6A 2KVIA 4I4BA 4QIFA 4MMOA 2DCUB 2HWHA 2CQ0A 2P5VA 3GR0A 3W2VA 1X4CA 2NLWA 2HIQA 2ZHAA 1FK9B 3PEJA 1SJ3P 2B6AB 5A6WA 2K7JA 5DLFA 4A8FA 2R7WA 1TFYA 2XB2D 2EVZA 3MEGB 3I5CA 2DGXA 3NMAA 1LKZA 4FPRA 4IH6A 3UCZP 1HW8A 2KU7A 4ZA1A 2YNIA 3T6BA 4MK8A 3L7PA 3H59A 3KJVB 3KK1A 2F1FA 2R7VA 1YVFA 4LJMA 2E66A 1KOOA 1VRUB 1O8BA 4L72B 2XMMA 4C7QA 4J9LA 2DB1A 5K14A 4QW9A 4O3QA 3I0SA 5AXMA 4I1TA 2ADBA 4ZPBA 1Y5NB 2RRBA 3P96A 3M4XA 3DCAA 4NPOA 1N54B 3I6PA 2XI3A 4DV7F 3ZZUA 2I38A 1HWUA 3CDWA 2C3OA 1HR0F 2X3GA 2BQRA 3R5DA 2W24A 1T03A 2H9ZA 4D3GA 2LEBA 2PN6A 4ECYA 2W8LA 4JV0A 1MNEA 4B3OA 5AE2A 5I42B 4RZRA 1TFWA 1UETA 3SDEA 4F4KA 2NZ4A 2KHDA 4JI6F 2XEXA 4GO7X 3N28A 3IBWA 2M4MA 1R31A 4G1PA 4Q2MA 4YR3A 2GC8A 3M8RA 4C98A 4MKBA 2QRRA 1CVJA 4B9NA 4XPEA 4GKJF 3DXBA 3LW5C 4B9VA 2OJ3A 2EG2A 3CT9A 3TAMA 3K5LA 2IBOA 3OQ2A 1G2EA 4RBTA 4FZVA 2PE8A 2RNEA 2ZBCA 4B9UA 3D0GE 5SZTA 5JXSA 5CYJA 2XHWA 4QIWD 4NMLA 4OX9F 2MGZB 2FJVA 1REVA 3MM9B 2VPZB 3POTB 4OX7A 1ZETA 2CQHA 2FJEB 4IFYB 2E7WA 2ROPA 5KFZA 1HQUB 2VA3A 1RISA 2UXDF 3OBIA 1L3TA 3CCVS 4W90B 2JFKA 1F5CA 3O1LA 1Z2LA 4C8LA 3ITHA 3G86A 5IZHA 2F9JA 4IQXA 1S9EA 1IKXA 4JI7F 1IR0A 2O01C 3MECA 2FJWA 3VWSA 4USJC 4ILLA 2OPSA 3PJXA 3BO3A 1D3WA 2DNQA 1VQPS 5J2QA 5KFAA 3Q8PB 4FS1A 3HHEA 4NYPA 5DQGA 4AE5A 3DFEA 4OX6A 1VQ7S 2ZHOA 5H1SV 1RJJA 2KDOA 4ZP8A 2IAJB 2E44A 2CQPA 2FY1A 4HTJA 2UUAF 3TO8A 4G1QA 3J7YI 1U47A 4EWTA 2RQKA 2XNRA 2FPHX 4LVOP 2QT7A 2VPWB 5J2NA 1KFSA 2IYGA 4FP9A 2AJ1A 5DRKA 1QUPA 2JHEA 4KGKA 2VG5B 2DNOA 2E1CA 4TY8A 4DSEA 1VHFA 3CCUS 5D4OA 3OVAA 4F4XA 3MD1A 3K5PA 3MPYA 2DNYA 1WELA 3EPGA 1Y7PA 2VG6B 2UUCF 3QYYA 3J7Z5 3DLKA 2VBWA 4MJKA 2UXCF 1YJWS 3WC0A 1HNIB 4RKUC 4C0OC 1VQ6S 4OFZA 2DGUA 2J0WA 1S48A 3QAEA 4DSIA 2HQIA 3KMSA 1OO0B 4B3SF 4E98A 3HF5A 3CMES 1SV5B 1HBNB 1TAQA 1WI8A 4UW2A 4EU0A 2QA1A 4I2PB 5G0RA 1NHUA 3CJ2A 4EBCA 2UUTA 2RKIA 1T3OA 4O3OA 4AFFA 3TAMB 1L3KA 2J9DA 5FIIA 2Z0GA 3CF5Q 3DRSA 3QLHA 3WC2A 4RNMA 3H4DA 2WW8A 3C6TB 1T94A 3M8PB 5KFXA 1RTJA 2DPIA 2DIVA 2AGPA 5C42B 2XY7A 2UV8G 4LIRA 4K0KF 4H4KA 4BHQA 4K59A 1A7GE 2CRLA 3WBZA 2CJBA 3RW6A 2AD9A 3MM8B 3SYZA 2OTLS 1CQMA 4ECXA 4B3RF 1JJ2R 1FXRA 3BGFA 2WONA 4K4UA 4C8MA 5B7WA 1KLMB 3HO1A 4OZLA 3CIMA 3QWUA 1VGYA 3TUZC 3TW0A 4JI0F 3OUYB 3ISND 3SQGA 1VLYA 4TU7A 2PA8D 2DRAA 1GX5A 3E3XA 4NX9A 2MQNA 3CMAS 1EETB 2EFPA 5B0FA 2AX1A 3EGNA 4X84A 3TAQA 4JI2F 4N76A 1L3VA 2UVWA 1AXQA 2RMLA 3TNVA 2FUG9 1BQXA 1HQEB 4EZ6A 2BA9A 5B0DA 3MHYA 5GAGU 4RW9B 3IS9B 3N9UC 1DTTA 2FIUA 3D0IE 4AYBD 4RW4B 2ACYA 1U1LA 5D6GA 1TQLA 2X1GA 3ZC4A 2OKQA 1FRMA 5KT6A 3N5FA 5E41A 1YRXA 2V5HG 3HPOA 3BR8A 1OIAA 1I94F 2HFNA 1JLBB 4OJGA 4LFAF 1U09A 4TN2A 4DV5F 2AGOA 2DHXA 2ALZA 4CO2A 3NMRA 1FE0A 4DS4A 3DLEB 2OPSB 2DNLA 2IMWP 2C3MA 2OPPA 1N5QA 1QE1A 1S1XB 2D9OA 1KSPA 3OR2B 2V8DA 1OQ3A 1X7VA 4KFBA 4ES2A 3J81Y 1LV5A 2NYIA 4PQUA 1FERA 2J6UA 1HMVA 2PO4A 1IUJA 1P6TA 5CZXA 3CDUA 2CQGA 4ILMA 4M5DA 3MI7X 4HI2A 2YX1A 5AXNA 3CJKB 4LSLB 2HHHF 2ASDA 2HZCA 4O23A 1YSJA 3M2UB 1RT5A 4NZ0A 1BQNA 3M6XA 3CSKA 2BACA 4OQJA 5J2NB 3KHGA 2XSFA 3GV7B 1GX6A 1CEZA 1JB0C 4QZVB 3AHPA 3PV8A 2D74B 1JJ4A 4QU6A 3CC7S 1H0HB 2HHUA 4DS5A 2CPEA 2I8EA 4D3HA 3AH6A 3GYNA 2R7XA 2RUGA 4B9MA 3UW1A 3LP1A 3ENQA 3MWBA 4ICLB 3TX8A 2YKAA 1NHVA 3NLCA 1NO8A 5KG3A 4C3MA 1TV6B 1S1VA 2J5AA 5KFWA 4WKRA 1S79A 4KC5A 1ROFA 4NYZA 5F8MA 3CCRS 4XDCA 4WKYA 3I4PA 2R7TA 1U6BA 1JKHA 3H98A 3P3DA 2W9CB 2GNKA 1U1NA 2VD3A 4Q43A 5E3AA 2HAIA 4TYBA 2COLA 2OPQB 5LXRA 5JUMA 4YR0A 4EYHB 1XEZA 4NZ6A 3VAIA 4DMZA 3H8YA 3HHLA 4ZCIA 4R5PB 4OI0A 3NWGA 3J80Y 1XWLA 2FGCA 2FJXA 5THWA 4CT8A 5A2QY 3RU0A 1Q79A 3OPKA 5KFUA 4R25A 2VBXA 1KNZA 5L9NA 4QPXA 4KV8A 4ZVHA 1J2VA 1LWCB 4KO0B 4B02A 2EFOA 1G7CB 5GADI 4EEYA 2MZ1A 1SBRA 2VG7A 2ZH1A 1VRUA 1VQ4S 1RT2A 2HRYA 2UZAA 4U7UK 5CXTA 4I68A 1YI2S 1NJXA 3I5AA 3ZZRA 3LO3A 5DQHA 3I56S 1TL3A 4Q45A 3KHLA 1RP5A 3TAPA 1V3ZA 2BJEA 3NKYA 4J9NA 3P6YC 1FA0A 4IH7A 3SCJE 2X51A 3KLIA 1N6QA 2E1AA 3U1NA 2KJWA 3I9V9 5KG2A 1PGZA 3UD4P 5EN1A 3MMAB 1U1KA 1QSSA 2K7KA 1OPIA 4PG7A 1WI6A 4DLGA 1VQ5S 2HHQA 2E5JA 1WHVA 4CO1A 2ADCA 4LF4F 3POTA 5FD1A 4OHVA 4QJVA 2J9EA 4ED2A 5EDWA 3Q24A 3HI9A 2MKCA 1FD8A 2FHKA 1SH3A 4WYWA 2QV6A 3NNCA 2VKRA 2LKZA 2B5JB 4A8QA 4H54A 1FTRA 4J5OA 5EX3A 3SSQA 1D0EA 1JKHB 2VPYB 3D28A 3FGVA 3GFXA 3H5UA 4NLYA 5F9LA 4F25A 4QWAA 3F73A 3VAKA 4DV6F 5F9NA 2A2CA 2JLGA 1NJIT 2R2RA 3MZIA 2XZWA 1R8PA 4ECQA 5KG1A 2JH3A 3CJ5A 1NNDA 1N48A 3CCWA 2D9PA 3M32B 3MM9A 2QZ8A 3PJWA 3R27A 2LQBA 2XULA 4RU2A 4KIAA 3QGPA 4XDDA 4YUDA 3GIMA 5CQGA 2LDIA 1T05A 1JLGB 1HI8A 3QGHA 3G71S 2HHSA 3MPWA 2G1DA 1JNZB 2XMKA 2JC1A 3HZEA 2FLOA 4NRTA 1FHTA 2JEJA 1X0PA 3SV3A 1M0SA 4X4QA 4EYIB 4KFBB 5AE3A 5HQ8A 2PEHA 4TXSA 5L38A 5C5JA 1WG5A 5J1EB 4RW7B 4Q44A 3NS5A 1FRXA 1SC6A 3K5NA 1FNXH 1M5PC 1KHVA 2C3YA 2OMOA 1ZPVA 3H4BA 3QJLA 2B4VA 5HLFA 1KQKA 5KFRA 2H5EA 4MIAA 1BQNB 2IJFA 4YP3A 1JLEB 3O2IA 2AU0A 4BS2A 4JYAF 4R8UB 4I69A 5I3UA 3IR5B 4MK9A 2DCLA 1ZTTA 2ASLA 2N3LA 4C2MA 3BQ1A 2MKHA 1D9DA 3ONQA 1YJNS 2CQ3A 2EFGA 2MKJA 4OI3A 1M5OC 2N7YA 3S1TA 2GQCA 2R7UA 2HNYA 3OTDA 4PQAA 1P9QC 2ZC4A 1RA6A 2U1AA 1S4FA 5DM6Q 2CG4A 2G13A 4PUOA 4H4KC 4CO3A 3UDLA 4ED6A 3RAXA 4Y0FA 3KOAA 2YKMA 4Y34A 2NXUA 3DRPA 4F3OA 3H5XA 3G4SS 5B0CA 1X4DA 3KK1B 3CC4S 3SCLE 2BM1A 2OD4A 2MB0B 1SH0A 1C0UA 2VL1A 1IKVB 2VPXB 4J9MA 3CDBA 2FVSA 5J1PA 5D8HB 4CIOA 3HHLB 2OIHA 2I9SA 3NNAA 2E5IA 4ZCKA 3LP2A 3LH2S 3CEDA 2IC3B 2HYIB 5M2UA 3TQ1A 5A8RA 5KT5A 3DMJA 3OXLA 2FDNA 1ZAVA 3X3UA 5KFSA 2R2TA 4ECUA 1DTQB 1Q8LA 2YWFA 4ID8A 4PWDA 3I0SB 2DJWA 1X4GA 4RW7A 4IFVA 4QR1A 4K4SA 3NCPA 3OJUA 2VODA 2ZVSA 3RB3A 4ZVFA 3MUMP 1N32F 4QR0A 3D54A 3ZZTA 5CD4H 3C3LA 2CQ2A 3OJSA 5F8JA 2QSWA 3GFZA 4I6AA 3OL7A 2V8GA 4ZVEA 4Y2CA 5DGBA 2QEXS 3K5OA 4ID5A 3BJYA 4QCLA 2KH9A 3PFOA 2DNPA 3SDEB 3TARA 4DR6F 1RAJA 3HM9A 5MLCV 2CVEA 1TKXA 3MTKA 2V0NA 4RNHA 3M2VA 2MGZA 4NCBA 1ZZNA 2RE1A 3CCTA 1NJYA 4OJHA 2CQ1A 3QGGA 5GVQA 1Q7LB 5AE1A 1JXLA 3MM5A 3KLHA 2M70A 2V4RA 5JVGQ 3T9NA 3PW2A 5D4LA 4CNYA 5BR8F 4WU3A 1U2RA 4DL4A 2BR0A 4O3SA 1BC6A 1Y0HA 4ZHRB 3KLGA 2XY6A 1WTBA 3D1OA 2QIFA 3QPIA 1S10A 4PRFA 2HVHA 2Y1RI 3MDFA 3Q2TC 3TVZA 4DDFA 1QE1B 4ED7A 3Q8SB 1UWBB 1URNA 5DDQC 3HMJG 3NGKA 2E5GA 4FNHA 4EO8A 3NS6A 1I6JA 2UUBF 1S6QA 2P6TA 3H20A 4Y65A 3IO1A 2IRYA 3VAHA 5J2MB 3MFHA 1N34F 4DR3F 2GIRA 2HNYB 1JMTA 4DFKA 1UVNA