1RJJA

Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
MATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVVATP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords expressed protein
total genus 17
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rjjA00
4OJGA 2XMVA 1TL4A 2RMLA 1SI9A 2LQ9A 2XMTA 1N5SA 3IWLA 1GXTA 1RJJA 2Q3PA 2LXFA 1YG0A 1AFJA 3KNGA 5B0BA 2ROEA 1X8DA 1TUVA 2AP6A 2XMUA 5K9FA 1X0PA 4HH0A 4QOTA 1GXUA 4DL0C 2N4DA 1KVJA 1FVQA 1Y9OA 3BN7A 3HF5A 2BUNA 2RU9A 5B0EA 2XMJA 2K7KA 3LO3A 4ZOSA 4A4JA 2ROPA 2VH7A 3GZ7A 4Q2MA 4Y2IA 1N5TA 2PD1A 2JDJA 1YJTA 3I9ZA 3VTIA 2AW0A 1TZ0A 3KG0A 1N5QA 2KT2A 5A6WA 4ZA1A 1W2IA 2LDIA 3BB5A 4OJ3A 2QYCA 1V3ZA 1LQ9A 2OFGX 1S6UA 2FIUA 3FGVA 3BDEA 2VV5A 4HL9A 4OIXA 2RILA 1YJRA 1KQKA 1YRXA 2GA7A 2GGPB 5IXUA 1YJUA 2PGCA 1JK9B 1FEEA 5A6PA 2EW9A 2G9OA 2W4PA 2AJ1A 4NPOA 4Q2LA 3QMQA 5T7LA 2CRLA 2ASYA 2OKQA 2ROGA 2QIFA 2ZDOA 3IWXA 5T7LB 1R6YA 2OD4A 2K1RB 2OMOA 4YDXA 2HQIA 3HHLC 1MWZA 3T9NA 2FTRA 2HFNA 3HHLB 1TR0A 1CC8A 2W4CA 2ZDPA 2KYZA 2W4DA 1X7VA 2HLUA 2RSQA 2XMKA 3HHLD 1Q4RA 1Q8BA 2KKHA 3WDOA 1K0VA 5B08A 1QUPA 4HI1A 1VQSA 2N4CA 2GV1A 2QLXA 1CC7A 2K1RA 2QLWA 2K7JA 2BYCA 1MWYA 1N5VA 2N7YA 3MCSA 1CPZA 2XMMA 4Y2MA 1Q53A 4Y2KA 3TOQA 1XBWA 2HIQA 3BR8A 4F67A 2GCFA 1FE4A 5F0WA 3BM7A 2FB0A 4DPOA 1OQ6A 2IFXA 3MZIA 3QGPA 1Y0HA 4YEAA 4HH1A 1OQ3A 1FD8A 2GGPA 2K2PA 5B0CA 5B0AA 4U9RA 1WD6A 2KT3A 1AW0A 3DCAA 3BGUA 5B0DA 2GFFA 3UDCA 3F44A 1U7LA 2AJ0A 4FNIA 3CJKA 1S6OA 5KAKA 4OJHA 4A46A 3LGMA 1APSA 1FESA 2OP5A 1IUJA 1OSDA 3FMBA 1ULRA 2BJDA 1Q8LA 4NL5A 1Y3JA 3KKFA 4OJ1A 1SB6A 3KG1A 3BF4A 5B09A 2HFOA 2BJEA 2IYIA 1SQEA 2IYGA 3DXSX 4HI2A 3CJKB 4EFAC 3HFKA 2BBEA 3E8OA 1FE0A 3K7RA 3FRYA 1P6TA 5B0GA 2XMWA 3LGNA 2GO8A 3HDSA 4FNHA 2OFHX 2LQBA 1OPZA 3TNVA 2ACYA 3HHLA 5F0UA 1TL5A 1JWWA 1Y3KA 1VQYA 3TRGA 2OAUA 4DN9A 1AFIA 1KVIA 2HLTA 1YJVA 1FVSA 3HX9A 4A48A 2L3MA 1P8GA 4A47A 1URRA 2FHMA 2OD6A 5B0FA
chains in the Genus database with same CATH superfamily
2YPZA 1U2RA 2VBZA 5ETKA 2IVFB 2RMLA 2PSZA 3VZHA 4DV5J 1N8RT 4LF6J 4O44B 4C11A 1EKRA 2DR7A 2CPFA 4J5OA 4RX6A 3CSKA 4ZVUB 3JYTA 4DV3J 3PJWA 5J2MB 2ZC3A 1WF2A 1KFDA 1FXDA 2IHR1 3NGUA 5LSOA 4I2PB 1UCNA 3HVWA 4JUZA 4O3NA 3M30A 1IBCB 2R2RA 4UUWA 4NI2B 4KPCA 1UJ4A 2YX1A 4G3IA 1HWJA 5DDRC 3CCJS 3J81j 1VRTB 3JQJA 2LMIA 3NL0A 1DJ0A 4DFMA 5A2QY 2BE7D 2CQCA 4I64A 4AL7A 2VHGA 4PWDB 1ZAXA 3J81U 1CJUB 1RLCL 3FGVA 4NCAA 4JI4J 1S1VB 2WVFA 5KG5A 3OJUA 2VQEJ 1YRXA 1NU4A 2CYYA 1R0CB 1H74A 1JK9B 3FBFA 3IBWA 1C2PA 1H98A 4CO1A 3IR6B 5A6PA 1H6KX 4WFBQ 2DEIA 2RHQB 3QO9A 5GAGU 3Q8QB 3LW5C 2YKMB 4MK8A 3AH6A 3DLEB 2MQQA 4N56A 2R8GA 3PKMA 5I42B 1VK8A 2RUGA 3G6VA 4ED7A 4LF4J 1V5VA 4WFXA 3S6EA 1RADB 4CLPA 2XGQA 1RWNB 3TZZA 3OW2R 4GVBA 2DNOA 3R97A 4CP5A 2XCAA 1SKRA 3TQ1A 4IOAQ 1MN9A 3KLFB 1KS2A 3G6XA 2FTRA 1Y4ZB 5DLFA 1U1PA 2PE8A 4GRSA 4ELVA 4OI0A 1G4CA 2BQ3A 2KO1A 1S6PA 2VONA 2V0NA 3S1TA 3Q2TC 1T02A 1RAGB 1VYAA 1WC4A 4URGA 4R25A 1NO8A 2RSQA 1K73T 2RDIA 4BBYA 3PFOA 3OUYA 1H7XA 5E5NA 4RUHA 2EI5A 3TA1A 4M5IA 3KK3B 4B3OB 4HKQA 2K1RA 2MZJA 3D7SB 3TJAA 3CIMA 4J9UE 1RHJB 4QPTA 2MHNA 4F67A 3LP2A 3PW5A 1ZPWX 3UCGA 1Q1KA 1NHUA 2J0WA 2LQJA 1C1BB 2X3GA 3MGJA 3MEGA 4UUXA 4M1KA 2UVWA 3C16B 3G71S 1N56A 3W8PA 1LW0B 2EC2A 2ZH3A 5E3RA 1T03A 2E9TA 4DI6A 3AHPA 1YZ7A 3G9CA 4PQUB 1CJKA 1N88A 2WZ1A 3AD8C 1O6XA 3OL8A 2FHOB 2DGSA 2RQMA 2RT3A 3DGVA 3M05A 4K5RA 5FLXY 3UD3P 1S4FA 2HRUA 2ZHAA 4JI1J 1HYSB 4USJC 1GX6A 3MM5B 2A6OA 5K14B 4PZVA 1D9DA 2HWTA 4NRUA 4LF9F 2XZWA 1UZDA 2ZFHA 2F5GA 1IN0A 3AAWB 3MAAA 3B78A 4M94A 3UR3C 1X5PA 1WDTA 3V4MA 2A2CA 4OJ1A 4ZCKA 4DV4J 3GFYA 4ZVPB 2HEKA 2V5HG 2WVEA 3AODA 4EFAC 1KSPA 3JSYA 4OYAA 5AE3A 4PUOA 5KT3A 3CCVS 1LK5A 4C6AA 3DOKB 3IP0A 3PRVA 1UETA 1S1WB 4IFVA 2VG7A 3CD6S 2RJZA 3CCQS 4ZLJA 2CQIA 2DO0A 3DRYA 4QR0A 3K2YA 2W8LA 5KFXA 3AOBA 1SV5B 4YUDA 5H9FJ 3H2LA 3EE3A 1FVSA 1NCLA 1RAHB 3HX9A 4I1TA 2L9NA 3FC9A 3ZO7A 5F3ZA 3CB4A 3MOZA 3MMAB 3A8EA 3D0GE 5SZTA 4H4KC 3IWLA 1S9GB 2E29A 2UV8G 3VVTA 4KSEB 1M5KC 2Q3PA 3QJJA 2W7AA 4DR6F 2VG7B 1XMBA 5HLFA 2FJAB 3DOKA 4LVNP 4CM0A 2MKKA 1K8AT 1BXNA 3GFXA 4OI3A 2KZMA 2XMUA 4BLGA 2HHUA 2EPIA 5EDWA 4C8LA 4DR7F 2DXFA 2CQ0A 2FYXA 3MR7A 2AMCB 1FVQA 4EBCA 1UWBA 1VJQA 1RHUB 2RU9A 1FERA 4C48A 4OZ2A 2H1YA 3TEHB 4B9NA 2K7KA 2ZBQA 5T41A 2UXCJ 3J7Z5 4YFUA 4M63A 1U1QA 2PI5A 4B3TJ 1D1UA 2CPZA 2GIRA 4DZ6A 4HT7A 1KLNA 2W8KA 5MAOA 2AW0A 4FF4A 2K8GA 3CGIA 4CT8A 2XMAA 5A6WA 1TVRA 4ED5A 1W2IA 3MM5A 2JFKA 4L76A 2QFJA 1ITPA 4LRAA 1OPIA 1PJ7A 1S12A 2M8HA 1RAJA 1HR0F 5CYJA 2FD2A 2MEWA 4IRKA 4X4UA 1U02A 3BV8A 3FCHA 2NYIA 2QLBB 4J9NA 3MEDA 2PGCA 3FBBA 2YNFA 3CDAA 3PIPQ 2IA0A 3RG6A 3MEGB 2C3YA 2XWXA 2HQGA 4LIRA 5JUMA 3ENQA 1N54B 2KVQE 2LFVA 2LXUA 1Q8KA 2R7XA 4IFYB 4P72A 2EK6A 2HHWA 1XMQJ 2J7KA 3ET6A 2CG4A 3PVXA 3UCUP 2CDQA 3OR2B 3GP9A 2HNZA 3B82A 3T9NA 2IY5B 4GC6A 1D9AA 1RBLA 4ZN1A 2GHPA 3P4UB 4ZPBA 4CT9A 1S77D 1R27B 1HQUB 4UOCA 5HROB 2W4DA 3W5XA 2HLUA 2GHVC 4JI0J 2KKHA 3KHHA 1RT3B 1R7IA 4IRDA 4X62F 1NPKA 1TQLA 3MPWA 2HHHF 1UP1A 4ZCMA 1DQ9A 2M7SA 3L3CA 3DFEA 2Z2MA 4Y2KA 3D0IE 4PYAA 1RGVA 1XBWA 4JI5J 1TMJA 4K50A 1HA1A 2IC3B 3CMQA 1LWCA 3L4BC 5C24A 4WK1A 1ROFA 2H5IB 4N47A 4AUKA 1ZBTA 2QC3A 4CYUB 3S8SA 3SZ2A 3O1LA 1YGYA 2MQOA 3LTOA 1NB7A 1L3UA 4CLUA 1FEHA 1J27A 3H2VE 3M4XA 4LREA 2ATLA 2UU9F 2V9WA 4F3MA 4J9QA 2R7OA 1REGX 2ZOMA 1OSCA 3FCWA 3RU0A 3H0PA 3BGUA 3ZZ0A 4FF1A 2DXEA 4CM2A 4PWDA 2J9CA 2UUCF 1N33J 1XK8A 2OSQA 3IFEA 4OJHA 2FJDB 4WTYA 1NXIA 2C3MA 3QNWB 3TZWA 3NMRA 2RAQA 2JVOA 4LF4F 4QU6A 3ILLA 2EBGA 4G1IA 2FY8A 1H0HB 3KKFA 4WBFA 1IXKA 5THWA 4Q8FA 5KT5A 4Z7YA 4WP3A 2WB4A 3BEGB 3Q8YA 1PKUA 3DXSX 4LIWA 3CJKB 3WZ0A 5B7WA 1T0TV 3N01A 1GXLA 2QV6A 2W25A 2BBEA 3U7JA 4DR4F 4KGVB 5CYQA 2D3OR 3H98A 2E66A 2W2PP 3H8YA 4ZVSB 1ACMB 1JLEA 1NPRA 3PYEA 4CTAA 2MZ1A 4G65A 1RWMB 3PV8A 4K8RA 2DBBA 2CA9A 4AL6A 2UXDF 2HNZB 3UI3A 3G2XA 2JZ5A 1M5HA 3GCXP 4RU2A 2AYBA 3BN4A 1LWXA 2JC0A 4O0IA 3NCPA 3QAEA 3JTNA 1GFWB 3CJQA 3A13A 4RO0A 1NHVA 5HI7A 2FHKA 3OTOJ 3NGDA 3G8TA 3RB0A 1X4AA 2X1AA 2KFYA 1N0VC 3BBCA 1ZTWA 1N33F 3UN5A 2ZE2B 4CZCA 2OEJA 1RLDA 3GIIA 4LFBJ 1RTZA 4S0MA 1ZETA 4ANDA 4QIWD 1YG0A 3HLUA 3LALA 1KTQA 4TU9A 2OEMA 5ETVA 3PRDA 1X8DA 1NNDA 1X0PA 3HD2A 3Q23A 1IWAA 4ID5B 2IRYA 5KG3A 5HL7Q 5LOQA 3GIKA 2DR9A 4FVCA 1KDNA 5D0GA 1S10A 1KC8T 3E01B 3EMTA 4RBUA 3TAQA 1VLOA 5JVGQ 2P8IA 4DR4J 1RYSA 2OPQA 4A4JA 4OYWA 2IM0A 2VH7A 3GZ7A 2UUAF 1NJZA 4JI5F 1IQTA 2V4RA 5H9FK 3BPSP 3CJ5A 3V2UC 1S0NA 1TELA 2ZVSA 1NJXA 1R3NA 1N48A 3CC4S 2MZRA 4ZA1A 1HR0J 3FZBA 4OJ3A 1RHQB 4RW9B 4OI4A 1RYRA 1YWXA 2J9EA 5L8RC 4F0KA 3RB6A 2J6TA 1UWBB 4NYOA 2DNHA 2FC9A 3KYLA 4OIXA 1J2VA 1HLWA 2RILA 3DI6A 3G8SA 4C0BA 1T9XA 4LF8J 4KY3A 1IM4A 4FXWA 5GAEI 4K4TA 2AGPA 2BR0A 2ZZMA 4DSKA 3X3UA 3AOCA 2UXCF 5HLFB 1C0UA 2MDAA 4P2SA 2OH2A 3TQEA 2QJ3A 4Y0FA 5BR8J 1VRQC 2EWHA 4DL5A 4LSLA 5CAAA 1LFWA 1S0VA 2V94A 4HEA9 2OPRB 2Q6CA 2YNGA 1S1XB 5FLXU 3I5CA 3D3BJ 5CZVA 4B3MJ 5J2NB 5BXIA 3BZQA 5F9NA 2AEMA 3I82A 3BPDA 5GMDA 4DR5F 2C3UA 2C2MB 1HL6A 1TR0A 1ELOA 1MWQA 3IG1B 4PWWA 1FRLA 4EK2A 3TZXA 3W3SA 2DY9A 2RNEA 4ELUA 1R31A 1TKXB 4C4WA 5IWAF 2Y1LB 5AXLA 2D9OA 1N5YA 1XWLA 4K4YA 1QAIA 2J6UA 2CPDA 5HJXA 2R9LA 2F9JA 2QA1A 3PCOB 2YNGB 1MWYA 3LP1A 4WCEQ 2W7PA 1KOOA 1ZA2B 3TOQA 1RHRB 5D15A 4ED8A 1VC5A 4OMFG 2YQ3A 4DG1A 2L41A 5C2CA 4L3KA 2V4JA 4V1Ak 2WVCA 4WU2A 3ZZPA 4DPOA 5GAGI 1OQ6A 1XMQF 1HNXF 1C0UB 2MSSA 1BLUA 4MKBA 4UW2A 3BSAA 3I56S 2ZBRA 3UVJB 2CQ1A 2P6TA 3MR5A 3QJPA 5E3PA 2IJFA 2BJ1A 4A8MP 1PGZA 1Z2LA 4DCPB 1NK6A 1VQ5S 1EIYB 1FJGJ 2E5JA 4C3LA 2GNKA 4ED1A 3TYTA 5B0DA 2EKNA 3DMJA 2BJ7A 1DQAA 2FZKB 3DOMA 4FNIA 1WSRA 2JJ4D 1UFWA 2VC1A 2VFVA 2XYHB 2YWHA 4KKOA 4P73A 4XK8C 1X4CA 2BVZA 4ZPCA 2D41A 1MU2A 1SIZA 2MY8A 2ZOGA 3LAMA 3U27A 3TZYA 2HHHJ 2EFGA 4JOUA 3M8PB 4AFFA 2VPYB 4DX5A 5KFBA 4B9LA 2I8EA 1UMJA 3HP6A 3IN5A 4Q8EA 4UQGA 1BUXA 4O23A 4CLWA 3BSNA 1NAQA 2X3DA 4KGXB 1HD0A 3BF4A 4UTGA 3GIJA 2B9XA 2HBZB 4LSNB 2BJEA 2CVIA 3Q24A 3TARA 2HZVA 2OPPB 4ZHRA 5LMNJ 2DT9A 2HRYA 3BDPA 2XCPA 2LEAA 4JYAF 3THVA 2HVEA 4OYPA 3CT9A 3LGNA 1Q82T 3IM8A 3OFFA 1NLKL 2GVDA 2MQLA 3MHYA 3MWBA 4M5JA 2ACYA 3IRXB 4IG3B 5AXNA 4BS2A 3T1YF 3IRWP 1T7PA 2QSWA 5IS2A 1P1LA 3CO9A 4YQWA 1KP6A 1LXJA 3SV4A 3TAPA 1AFIA 4YB7A 3UCZP 1JJHA 4LFAJ 4X4QA 1IJFB 1WELA 2FJWA 2YX4A 2R7UA 3KLEA 1RKIA 3DLEA 2MLYA 3UNYA 4ZP7A 1NSAA 3SCJE 3P49B 3DDIA 1M1GA 1Q7LB 1ZS6A 2PA8D 5ETSA 5I3PA 2KM8C 3PZPA 1Q86T 1DTTB 2BW2A 3OFEA 2H5JB 5IM0B 5J2PA 1S1UB 4URSA 2YNIB 4QOTA 1GXUA 1S59A 2VFSA 3W2WA 3KHRA 2MYFA 2YX7A 3HSZA 4X4VA 2MHEA 4NMLA 1YX2A 4LF6F 2VODA 2BKPA 2YNHA 5BYSA 1X4GA 3HHEA 3VTIA 1YBAA 7FD1A 3ZTSA 4E2FB 5I3UA 4IKAA 1Z1ZA 2QA2A 2RU3A 3TAMA 2DH7A 2RRAA 1PBUA 4YS2A 5DG8A 3ICLA 4NI2A 2GS8A 1OY8A 4HACA 1SIWB 3RAQA 1IKYB 1NKEA 5D4LA 4X4NA 1S7IA 1PAUB 2AGOA 4H54A 4RWXA 1JLFB 1S99A 4FKYA 4W4MA 3ZZYA 5DDQC 1YITS 3QJLA 2BJ8A 2CDRB 3NXZA 4OLOA 1G6BA 4A8YA 2KYXA 2WSCC 4CYUA 4X66F 2HNYB 1K47A 2Q79A 2NREA 2DGOA 2IC3A 5A8KB 3TJ9A 1VGYA 2DH8A 3KG4A 5D4OA 5C24B 4O4GA 5T7LA 5I3UB 4C8OA 1QVFR 2ZWOA 2YNHB 2ASYA 4OZLA 4JI3J 2Y3YA 1R0AB 3NNAA 3EYZA 2YWWA 4TLQA 2X1GA 3T5KA 3QRPA 2DGXA 2RB7A 2ALZA 3TUPA 2QA4S 1VI7A 2ZITA 1O5JA 1FWKA 2XZTB 3ILOA 1N36F 1E6VA 5L1KA 4OX7A 1MMDA 3LQVA 1FJ7A 2DGTA 3GCWP 3SDEA 2XY7A 1DHMA 2D3O1 4IQXA 4RW7B 3BH7B 3Q8SB 2ZUGA 3C6UB 1FJGF 1RDRA 2L9DA 4HI1A 3IGNA 3D5MA 4R0JA 3G4SS 2K7JA 3HJFA 4ZJQA 4DUYF 2YXLA 5HMYA 2GAGC 2NUHA 2GCFA 1BWVA 1UW9A 1VIXA 3DLGB 3MFIA 3KK2A 4MTPA 3C14B 1B0VA 2YNFB 2WBMA 1Y0HA 1SJ1A 2QRRA 3M8ZA 4YEAA 4EGLA 2Y0SD 3DRRA 3MAQA 2HK3A 3Q83A 1DRZA 3CC7S 1FRMA 3KLIA 4EO8A 1CJTA 1T9VA 2AX1A 2BMBA 3TUZC 1VQ9S 4DHVA 4B3SF 3FJ2A 3AOAA 3IR7B 3OTDA 2D3UA 1A7GE 4DL3A 2NCKL 4X64F 4TNOA 3BYRA 2XZDB 5K8NA 5KFNA 2LQ5A 3ZNUA 2RHSB 2A0FB 1AT1B 3H2UB 4ZVGA 1O0PA 2AQ4A 2QLJB 3KUGA 5A8RA 2BJDA 3WIUA 3T3FA 2XSFA 3M8PA 3OBIA 4XDCA 3ZZRA 2WB1D 2OHDA 4ED4A 1HQ2A 3FEZA 1HNZF 4PG8A 4BCAA 1YJWS 4CNYA 2GMLA 4RNFA 1U1MA 1T3NA 4GKKF 2A3JA 1CULA 4WIQA 1QSYA 3DM2A 4ANCA 1VQLS 2HZCA 4QW8A 1R8BA 2KJVA 2CJYB 2AYEA 4ECUA 4CH0S 3D6HB 4FNHA 4DL7A 1ZM9A 4ZJLA 5LJ5Y 4M5DB 1S9GA 2IIHA 2ZNZA 3HHLA 3O3LA 2DNNA 5KFPA 5KFDA 4ECQA 3OXGA 4YDDB 1Y3KA 3OFGA 5KG7A 1QTMA 3E2EA 3M6UA 3A12A 4DG1B 2NR0A 4ERDA 2DPJA 1VCTA 4FYVB 5HP1A 1X4EA 3QYYA 2ERRA 1VQKS 1KNZA 2VD3A 2ZBCA 3QFWA 4KO0B 1N4LA 3HHDA 4I68A 4DF4A 4QJVA 1N5YB 2WONB 5AE2A 4AXIA 2BJ3A 2ILYA 1T9UA 2E1MC 2ROEA 3H42A 3R27A 4QPXA 1R6VA 2K3IA 2QL5B 5E2QA 5ADZA 2QT7A 3P5BP 3EDQB 1U48A 4JI6J 1RT7A 5KT6A 4ECWA 3CCUS 1KLMB 4ZLNA 4DPWA 1B7FA 4LF5F 4FXDA 3IS9A 4GO5X 1S1XA 4USKA 1YZ6A 4WP8A 3T6BA 2W9BB 2OPRA 4DCOB 2FGOA 2O01C 1RQ0A 1YJTA 3QIPB 4LSLB 2VC0A 4LF8F 1MMNA 2MQMA 3D2WA 2WOMA 2ZH5A 1YKWA 1EETB 5K14A 4C3KA 1URNA 3PX0A 4DV7F 1KWMA 3MM9A 5FIIA 3VGUA 5IV4A 1H2VZ 2CFXA 2GX8A 3CDBA 4G1QA 4OYIA 5KFWA 4ETZA 2QL9B 4R8UB 3ELHA 2GA7A 4NCGA 3DI6B 3VWSA 2MB0B 4GKKJ 2QMWA 4MK9A 1GT8A 2ZHOA 4NYPA 2F8MA 3KLGA 3GIRA 2DR8A 1C1BA 2F1FA 1AYEA 2NZCA 2W4PA 4ATNA 1KFSA 3MAHA 2AJ1A 1UWAA 3KUEA 3H7HB 3PYGA 3MD3A 4DR1F 3HULA 1NK7A 3RZAA 3ETMA 4OHWA 1EZZB 2K1RB 2KDOA 1DQ8A 2OPQB 2YKNB 3AFGA 3DHWC 3M2VA 2CQ2A 3OTBA 9RUBA 1MWZA 3IGVA 2MZSA 4TY9A 3J81Y 4DQQA 1U49A 3K8WA 5HBMB 1PIEA 4NLQA 2IVYA 3PW0A 1BQNA 2V8HA 2ZD1A 2DNRA 4ZP6A 4BWMA 3SFUA 1RWOB 2WBRA 3BQ1A 1PO6A 1F1BB 2QYGA 5KFLA 3H5XA 2FLLA 2N7YA 3MCSA 3SXLA 2XC9A 2DIUA 2ZBPA 5M2UA 3VCDA 3F56A 1N34J 5I42A 1CVJA 3TI0A 1GTEA 3M2RA 4TY8B 2DYAA 1R43A 5AXKA 2ZH7A 1RHMB 4P2FA 3UDVA 4WIIA 2FLPA 5GVQA 5SUHA 3MCOA 3K5NA 3PO4A 5FDLB 4W90B 3BO2A 4ZVRB 3CE8A 4OZ3A 4ED0A 3TO8A 3O2IA 4J7CA 3VAFA 3OQ2A 1VQ7S 1TUGB 4JI2J 3DLKB 4LR7A 1M5SA 3HVRA 5FD1A 2D69A 4TN2A 3HJVA 1QTNB 3CJ2A 1WHXA 2FZGB 1IVZA 1HBOB 1PAEX 3CJKA 1H2UX 4F4ZA 4X66J 1IR1A 1RT2A 2IDLA 3R8YA 3MM7B 2XY6A 3I31A 4NLVA 2UUBF 1VRTA 2GJIA 3EGVA 3IMQJ 4HHJA 4CLYA 3M32B 1NJIT 2Q6BA 1K0TA 2YWKA 4RNMA 4ECRA 2UU9J 1KQGB 3K59A 3HFVA 1AB8A 4ZJOA 1REVA 3KK1B 3G6YA 4PPDA 1VFJA 4YMEA 3M30B 4PRFA 2MJNA 3T1YJ 1U0HB 2EBEA 3HFKA 1X0FA 1WC3A 4MT1A 3D0HE 4AXJA 3M8QA 1NDKA 4KAIA 4MIBA 2HS0A 5AE1A 4ILMA 5KFJA 2UV8A 3M6WA 3EGZA 1IKXA 2FZCB 5FDLA 1YJ7A 2UVUA 3PHTA 2KI2A 2NSBA 3ILJA 4IG0A 1OY6A 2FVSA 2YWGA 3NWGA 1JIHA 2O67A 5D78A 4CDIA 2BRLA 4RUAA 1BC6A 2MY7A 4X4SA 5HN0A 4NCBA 1WACA 2EVZA 3MURP 1VQPS 2EG2A 3IWNC 4PG4A 3I96A 3FMWA 4ZKAA 3M8SA 1VK3A 4DV1J 5D77A 2AYMA 3AT1B 4DR6J 4KHRA 1JJ2R 1VR6A 3MMBB 2ZD1B 4EYIB 3MR6A 3GU0A 1BQNB 1GMWA 1X5OA 4DFJA 1NKBA 3C19A 4OI1A 2PEHA 1T3OA 4PCQA 2E1RA 5IV3A 3OR2A 4ZDNA 4URQU 2XMJA 2FVRA 4XDDA 4NZ0A 3M2VB 1N5TA 3QQCD 4DPXA 3NMAA 2NYHA 4M95A 1TZ0A 2VB6A 4FKXA 1NUEA 1XERA 4ZVQB 3SSRA 3OJSA 3KLVA 3CXCR 5E41A 2M88A 2GQCA 1U47A 1MLAA 1FX4A 2FHJD 3D67A 1RT1B 3I4PA 4ZPWR 4C8NA 4ZIWA 4HL9A 1OMSA 1VBXA 2IBOA 1F0XA 2KM8B 3QSYB 1JLQB 1C1CA 4R8UA 2KG1A 2ZKUA 2HWHA 3NNCA 1WC5A 3CCWA 1C0TA 1IBKF 1X4FA 2RUSA 4G1QB 4JBCA 3TX8A 3V6HA 3Q2SC 5IFMA 2QGFB 2XO6A 4R0EA 4J9MA 2H5EA 1Y5NB 2AJQA 1T9WA 1KEKA 3B8HA 3EUNA 3FRZA 2CQHA 2VFRA 3DXBA 3JSMB 2JWNA 1TAUA 1IJEB 5F8NA 1SL0A 1WG4A 2BM0A 4LSZB 3FEXB 1Y5IB 2JHEA 1X4BA 4RLEA 5HMZA 3NWRA 1RT6A 2H48B 3DOLB 3DYAB 2HGLA 2HFNA 3FSXA 5HVFA 4L75A 1HNXJ 1WEXA 5IT9U 3MF5A 3J7YI 4JI1F 2VG6A 4LBPA 3MR2A 2A2DA 2M3DA 5JJBA 1JNRB 3MFHA 4C0HA 3FDSA 2W2NP 2M70A 3Q22A 2E5IA 3OL7A 1T11A 2CIMA 5IC4B 2C22A 3ZNJ1 1QAJA 1N5VA 3ONQA 2XMMA 2CPJA 3DLHA 4NXMF 2KHCA 2POKA 4I7FA 2JEGA 2QFIA 3GSDA 1WEYA 1RWPB 2HHXA 4DR2J 1F2GA 4IUFA 3BGFA 5CYMA 4M5DA 5I3QA 3NKYA 2KU7A 1PYSB 2RQKA 5A2QU 4YR0A 1YJNS 2XS5A 4N41A 2G0IA 2PN6A 5AJ3J 2VICA 4PQAA 1P9QC 2AT1B 2BQUA 5H9EK 4MKYA 4U95A 4Q7AA 3TA0A 2Y8WA 5J2QB 4L74A 4CO3A 2XM3A 2YY3A 5AXMA 2IRUA 4RR5A 3P6YC 3W5YA 4XAKA 4IO9Q 4MH8A 3F73A 5DDOC 2AU0A 1XMOF 1SL2A 3T5HA 3GR0A 2B5JB 3ADAC 3DGPB 3R5GA 3KOAA 3NOCA 5D3GA 1GX5A 2CADA 3CVKA 3MPUB 4LJMA 2IYIA 5C25A 1SL1A 4NLXA 3PKYA 4OZ5A 2XO7A 2VA2A 3GIMA 4JV5J 2XYPB 5A0YB 4ICLB 4KE5A 1FE0A 1GTHA 4PEOA 3I0SA 3NEKA 4GVLA 3CO0P 2E5LF 4I67A 3KLIB 4I56A 1RUSA 2OFHX 4NRTA 1OPZA 2EFNA 2WW8A 4DPTA 1H73A 1SPBP 5KFGA 1UFKA 1U6ZA 4TLRA 1Q0NA 4TQSA 3DLGA 3LP2B 3DGPA 1IBMJ 1RAOA 1FE4A 1P8GA 2W9AA 3U1NA 1RTJA 4OJGA 2ZZTA 1ZM3A 3AA8A 5JMNA 4QU7A 4PXCA 3KK3A 3SCLE 2V6AA 4ALZA 2H9ZA 3AA9A 5CABA 2G0JA 2DEJA 1GAOA 1AFJA 3N5FA 4FBUA 1X9WA 3GJSB 3SDEB 3V6DA 4MKVA 1RK8A 2J6SA 1YBTA 3OPKA 1I51B 4AQYJ 5IC6B 3PNIA 4ZIVA 2QO3A 1S9EB 5C7PA 4U7UD 5HMXA 3CCRS 2M2BA 3PTWA 2FY1A 2EEYA 1HWIA 3LP0A 4DLEA 1N5QA 2KT2A 3H4BA 2XY5A 4ZP8A 4Q0BA 3VAMA 2AF6A 3H5SA 4KGMA 3TJ8A 2J7UA 1FRJA 1CQMA 1JLBA 2OELA 2YKPA 3FK4A 1L3TA 3FSIA 5HMWA 1JLFA 3D68A 4B3RJ 1YDLA 4P2MA 2PA3A 5CD4H 1T94A 3V4IB 4HACB 1J5OB 1U0SA 1B4SA 1R8PA 3H5YA 1LW2B 1NK5A 2OTJS 4HTJA 2Z58B 2K3KA 2ZM6F 4X64J 1IKVB 3NGSA 2CNKB 2SXLA 1JLAB 3QGIA 4WJBA 6FDRA 2ROGA 2ZDOA 4GMKA 4X4TA 2CJQA 2QIFA 4PG5A 1SKWA 3I5AA 1F3VA 2OMOA 4M5NA 4P10A 4YDXA 2K06A 3W64A 4LQ3A 3HHLC 5ETQA 1M1KT 3K8VA 3GMGA 1IBMF 1WHVA 2OO4A 1CC8A 3MEEA 1M5VC 1VC0A 2ZDPA 3OXLA 4DMZA 1BHNA 1DTTA 3B54A 3HHLD 3EXCX 3PXGa 4QBUA 1Q4RA 1WKJA 5LXRA 2WVBA 3A8IA 2B43A 1JX4A 4C11B 2Z56B 3KLEB 3H40A 3UR0A 4X62J 4A8OA 2W1BA 2LKZA 3KFWX 3D28A 4ZS6A 4DUZF 4F2RA 4L6V3 2DJWA 3HVTB 1DFDA 2COLA 4CLZA 3D9BA 2IM3A 1PJ5A 4DL2A 2GC8A 4OZ0A 4L3NA 1XMOJ 1N52B 2YPYA 4LR8A 1IBLF 1U6BA 3H4DA 1XNQJ 2B4PA 5F41A 2GGPA 1CS4B 1VBKA 2Y0BB 4TYBA 2MSTA 5B0AA 1WD6A 5DQGA 2A10A 2HQDA 2QN6B 4K2XA 4O3PA 1X60A 1UJ5A 3KHLA 1AW0A 2YTCA 4Y2AA 2AJ2A 1B70B 5K5MA 1FA0A 4ZN3A 2UVRA 2OIHA 3RR8A 2IJNA 4M5LA 3MR3A 3BBBA 4NOHA 1VMBA 2CKWA 2OJ3A 1OSDA 2HQCA 3NGRA 3JTPA 4TYAA 1OO0B 1WOSA 5IZHA 3MPVA 5MLCV 4DR2F 3AD9C 4DSFA 1GQEA 2R7WA 4P7VA 4DV0J 1V3SA 2UP1A 1RT4B 5KFTA 2LECA 1VRUB 2ZWPA 4P9SA 3A8KA 4DR3J 2Y9HA 1XIQA 3KJQB 1DURA 2HS4A 2ZUAA 5LMUJ 2EFVA 5DQHA 4OX6A 1HNWJ 3QLHA 1SVDA 3BKTA 2QG9B 1XEZA 1HFEL 4JV2A 2QMXA 4J9RA 4UY85 2JL9A 4USWA 2MKCA 2OAUA 2YBVA 2HRTA 2V4JB 4NLTA 3MECA 4A48A 3TANA 2J0SD 5KG1A 5CCMA 2FHMA 3ZTPA 3DDKA 1U4BA 5ETOA 4B9SA 4DSLA 3HKZD 3MM7A 2LU1A 1QAXA 3BGOP 5AJ3F 2HFZA 3KHGA 3BO4A 2MZQA 1F3FA 2BANB 1MG7A 1EP4A 1N0UA 3I6PA 2HHSA 3POTB 3LANA 4DOZA 4F4WA 2KZZA 2RRNA 2RF2A 4ENOA 2AP6A 4KFBB 4QCLA 3PACA 3R1LA 1H72C 1KOHA 3M9OB 4H4MA 2G4BA 3QRQA 3IG1A 5LJ3Y 2HW3A 2BDPA 4DXLA 1B0TA 2YKOA 5DZ6A 2PFDA 4DV6J 1SJ3P 5KFYA 2ZEJA 3RBEA 4FF3A 2V34A 3DLBA 1OJ4A 1OS5A 2IJRA 3CCTA 3DRXA 3JSBA 3OVAA 1TKDA 2IBKA 4DN0A 3X1LB 1D09B 1FF2A 1Q5YA 3S01A 1VHFA 3L7OA 1U2FA 4RNHA 1S57A 3GFHA 1S6UA 1TV6A 2FIUA 2FVCA 2YKQA 2RE1A 3NS7B 2DHXA 4J9VA 4U67Q 3UN3A 5KG2A 2MLZA 3QSIA 4I2QB 2DPIA 3LWLA 4RW8B 3GV7B 4TU7A 1WSVA 3CDUA 4LRDA 4LRCA 1LXNA 3ITHB 1YHQS 3FQKA 5DGBA 4ES1A 1RU2A 1IR0A 2WSEC 1NSKL 3OR1B 4I6WA 3NRBA 4ZVFA 5HO4A 4LFCF 2XEXA 3IAM9 3EZ5A 4FPRA 4Q2LA 1EQMA 7FDRA 3P96A 4NA2A 4WFZA 2OKQA 3W1YC 4JV5F 1IBKJ 4RU9A 2OD4A 4UY8T 1RP5A 1WOPA 2OLWA 3CW2C 1RCOB 1Y5LB 2HSEB 1FWPA 1DAXA 2FPHX 1LNQA 3OR1A 1LFPA 2AZ1A 5KG0A 4IH6A 3P5TL 2ATCB 4LUBA 3R2DJ 1CJVB 4O3RA 3G82A 1X7VA 4OYXA 5EWEA 1UL3A 4ED3A 1RA6A 3FCVA 3EPIA 2HBQB 1FRIA 5EGYA 2ZE2A 1T9TA 4M5GA 1CBKA 3MMCA 2EC0A 4DJBA 3TX0A 3O6QA 2FC8A 3VQTA 2XSJA 1T05A 3CULA 3QIPA 4W98A 3IXQA 1VLYA 3F41A 1RABB 2W9BA 1SJFA 3RR7A 1HBMB 2BRKA 4FS2A 3H90A 1HARA 2AZ3A 5DS7A 5J1EB 2AGQA 4QIEA 3G6ES 4FN5A 2KB2A 2HKEA 1S4EA 3DHXA 2WVDA 1KVKA 1V9OA 2I1RA 4OHVA 2GHWA 4KFBA 4CTAB 1NK4A 3I9V9 2HFVA 2VKRA 3POTA 2DR5A 1WC1A 1EP4B 3R3TA 1FKOA 4KO0A 4X65J 4TU8A 2JX2A 2VJVA 4JB8B 3ISND 4J91A 1TK0A 1SH0A 1RTHA 3EZOA 4Z2XA 3CMES 3SSSA 4NASA 1XQIA 1BQXA 3PYFA 2UUWA 3RUBL 5ITHA 5GMKa 5F8HA 4DV4F 1S1TB 2DVIA 3EWGA 2CNLB 4U8YA 1ZM4A 1S6QA 4PPZA 1NZAA 4LT6A 4NLUA 1WG5A 2HYIB 1HPZA 4BDPA 1KRPA 3G87A 3E8OA 4WYWA 2O1PA 1QLNA 4DEZA 1CULB 3BQ2A 2FGCA 1PCAA 5M2RA 4JYAJ 1EHWA 3V81A 1FNMA 3M8YA 1SUQA 3QFHA 2GVZB 3G8QA 4UF4A 4DS4A 1JWWA 1VQNS 4IQMA 1PG5B 4JI8F 3LH2S 4ED6A 1RWVB 1SC4B 1QM9A 3HM9A 1RI7A 1PSDA 1U1OA 1X9SA 3W60A 2R3VA 1DLOB 2HNDB 4QIVA 1KKHA 1VJWA 3C6TA 1K1SA 3C2PA 3DNCA 2C42A 4FPIA 5RUBA 3MM8A 2LXFA 2WSFC 5KFUA 2XS2A 2NXCA 2C3OA 2NXNA 1TUVA 4F8RA 2JEFA 3NCRA 4DV5F 3PYDA 2DNQA 2H54B 2HGNA 2Z57B 1S76D 4UQTA 3GJQB 2X1BA 1N34F 3WX8A 2VASA 1ZA1B 4X4OA 1L3VA 4B3MF 2DNMA 3FZ2A 3HSDA 1KR4A 4WPAA 1TU0B 2JFDA 4IOBA 1ZPVA 3KK2B 5DJBA 2RQCA 4LF9J 4I69A 1HBUA 4OZ1A 1XNRJ 3Q8VA 3SV3A 3K0JA 2NQPA 3CD0A 1EQ0A 3KG0A 3OSPA 1FKPA 2P5VA 3M8WA 3V6JA 2ZKTA 4ZPAA 3SIPB 2R8HA 2HMIA 5KFQA 4P71A 5L38A 1WWHA 1FD2A 2JRSA 2MXYA 3OTOF 3TWZA 1KQSR 2ZH2A 1W26A 2AJFE 2QX0A 2CG8A 2BZ2A 1YJUA 3I87A 5L9XA 4QYZJ 4FYWB 1FRHA 1X31C 3QRRA 3VAHA 1YSJA 3MM8B 3WBZA 2V2QA 4LRFA 4DR5J 3RRGA 4FYXB 2PMWA 4NLRA 4D3GA 3T1HJ 3GJRB 4YY3F 3KMSA 2RDJA 5IT4A 5T7LB 1KONA 1JXLA 2WRMA 2OSRA 2RKIB 3FBEA 2GIQA 4KBIA 3EVWA 2F3JA 2HQIA 3H59A 3HXMA 1HWUA 1SH3A 4OYBA 1HNIA 1LW2A 2B56A 4N8NA 3W61A 2VQFF 3J7ZT 3V81B 1N32J 1T8EA 1F5CA 4KV8A 1A9NB 3ZTRA 2IMWP 4LF7J 3IAS9 3U1LA 5HSPA 3MI7X 1CG2A 3DRSB 2JNJA 1UZHA 2NS1B 2M9KA 5GADU 4XPEA 3THTA 4DV2J 2PO4A 5F8GA 2XBPA 3Q89A 3NGTA 3GILA 3LP0B 1YVFA 1UVJA 4Y00A 3W63A 2V8PA 2HIQA 3EM1A 1L3SA 3BKUA 5F0WA 2PI4A 3R6GB 2R7VA 2EFQA 2G1HA 1NK0A 4QYZK 2PDAA 3NS5A 1V5IB 3LOUA 1OYEA 1OQ3A 4WK3A 5B0CA 3B4DA 4IFVB 3VGTA 3V6DB 2M52A 4ZPTR 4KT0C 4PUOB 3J7AN 3L9ZA 1FNOA 1MROA 2P9CA 5KFCA 3HZGA 1XC9A 2R7RA 2C2KB 4B9UA 3WIVA 3GV8B 2BV3A 1XNQF 2Y8YA 1KBRA 2H51B 4Y2CA 3A1YG 2DGUA 3HCXA 4ES2A 1Q8LA 4F4AA 1KQFB 3BBFA 4B9TA 3UO0A 1FI4A 1C4AA 1JLGB 2AWZA 2EG1A 2UUTA 2G0CA 1HQEA 3KXDA 5LM7E 3KG1A 5LL6d 1QSLA 4C8YA 1FNXH 4IG3A 1GK8A 2IRXA 1SQEA 2X51A 5LMNF 1XNRF 2LP4A 1WHYA 2KHDA 3J7YU 1SBRA 4A8XA 3ZZOA 4U6PA 2F4FA 4K0KF 2ZHBA 1ZAWA 3CDWA 3G82B 3I0SB 4PXBA 2VJUA 4ICLA 4A8KA 4PQUA 2GMHA 5CCLA 3DN9A 5ETNA 4RBVA 5DLGA 1LW0A 1TL3A 2L08A 4J9PA 1SH2A 1TL5A 3HT0A 3CJTA 3MD1A 1S7HA 3EZUA 4NA3A 5IOLA 3TVYA 3W5ZA 5D3GB 2R7QA 4ER8A 3KNAA 4LVOP 2NPIA 5C42B 5CD4A 2XQCA 3RAXA 1A0OB 2LU2A 3SQGB 4X4RA 5GMEA 2J0QD 2ALYB 2DHSA 1UVIA 2X1FA 5IT9Y 4ETXA 5A8WB 1YTYA 3VGVA 2IMOA 2L9WA 2NXJA 2ZOFA 4JI0F 2UXBJ 2MKJA 2O66A 3T19A 5HQ8A 3H5UA 4KQZA 4HDGA 2HQFA 4LF7F 1QUVA 1VISA 2KRRA 3TW0A 3UVJA 2GW8A 2BQRA 1G2EA 1EARA 3N6NA 5HANA 3RW7A 4FVMA 1VOMA 1I3OB 1TL7A 3ZTOA 4EEYA 3KLHB 4OX9J 4DR1J 5IQ6A 5K8PA 3GFZA 3AD7C 3CCMS 3DC2A 2KH9A 3SI8A 1I5OB 4NLGA 1RSCA 5EWFA 2Y1JA 2CVEA 4HDHA 5HATA 3T5LA 3W66A 2V8VA 2ZJRQ 1RZMA 2J0XA 2XGPA 3CJ4A 1T9YA 3OLAA 1QVGR 5E3AA 4AQYF 1E6YB 2RF2B 4TXSA 4ZPDA 1H38A 4WFNQ 2PC6A 1P27B 2DHAA 3OXFA 4M5KA 3JAMY 3DYAA 2MKIA 3KDNA 2CPYA 4H4KA 4DV2F 3NNHA 4FF2A 1U2CA 2GZOA 1HMVB 3HVAA 1XR7A 2EW9A 5D0EA 5E3CA 2BKOA 4AE5A 1IKWB 3W62A 3N4WA 2D3ZA 2B4UA 3JQMA 4YN3B 3BJYA 1U1KA 1B64A 2QSFA 4E0DA 3TA2A 3GQCA 2DGQA 3PR5B 2Z2YB 2ZH8A 4IH5A 1S0MA 3P3DA 2MMYA 4FDFA 2VG5B 5KT2A 4PXDA 3O44A 3DRSA 3P45B 3LGHA 4IYQA 5H1SV 2AV5A 5HQLA 4I2PA 3QLHB 2W01A 3L7UA 1C1CB 4KV8B 4CI0B 1XR5A 1RHKB 2CQGA 4CLLA 3WDOA 3KWMA 4DV1F 4DPYA 3K5LA 2VBYA 4N77A 1VQSA 2I5JB 2NUUG 3AXMA 4O44A 1TKTA 4NEYA 4WWSA 2J7WA 2V67A 3S7RA 1VHIA 2RDDA 3AJ2A 3CJ8A 3HKWA 4IDKA 4DSEA 3BSOA 3GYXB 3BM7A 5DZ7A 1FRKA 2APOA 1ZM2A 4I4BA 5DM7Q 3ILIA 2JLFA 4QWAA 1MN7A 3NLCA 2D74B 3I55S 2J8SA 3CCES 6FD1A 1FFGB 4MK7A 4A8QA 3F44A 4U8VA 2VF3A 2R8KA 3A3OB 3MM6A 1IWGA 4WYLA 5LSLA 3Q8RB 2Z2LA 4ANEA 2B3TB 2QLFB 1NBEB 3I4HX 3LGMA 5ETLA 4C3MA 1BD6A 2C2NA 4Q43A 2JLGA 1IUJA 1JXEA 1FRXA 2ZH4A 4YOEA 1R0BG 3ETOA 5KT7A 3LPEA 1W25A 1Y3JA 3D6FB 4IDKB 2HHTA 3WHIA 1DARA 1SB6A 1TKTB 2DRDA 5F3TA 3R7SB 4NLOA 4X65F 4UZBA 1SCJB 4V19X 1IKXB 2V2KA 2CPXA 2IA6A 2EFOA 1AUDA 3HMJG 1F5BA 1BQMA 4P2XA 2RIJA 2LCWA 4P7TA 2CJ9A 2CQ4A 3MUMP 4NE9C 1TK5A 5IWAJ 1RAIB 1U0HA 3QT6A 2NXUA 4Y28C 3L09A 5ETPA 1NSQA 2VG5A 5GAHU 2P6SA 2GIFA 4Y65A 1RTDA 1WI6A 4JI4F 1YLXA 3HD1A 2QA4G 4V19J 2I0XA 4F50A 4MIWA 3CD5A 1IKVA 3HO1A 1N5SA 1S9FA 3HT3A 1VC6A 4DWIA 3DDNA 2Y1RI 4NLYA 3KNGA 4F4YA 4O3QA 3RBDA 4PR6A 2QL7B 3PJ9A 3US5A 3VALA 4HH0A 3I32A 2G1DA 4E8UA 5D4NA 4DU7A 1HNWF 3BN7A 1HW9A 1U24A 3CJ3A 4K2JA 1RKJA 2MKSA 5KFVA 5B0EA 1LWCB 1WF0A 2M4MA 4IR1A 2CXEA 2KVIA 3M1VB 1PC5A 2JLEA 1Q81T 2FVQA 1SKSA 1X4DA 1XN9A 5KFZA 3D66A 3OLBA 2LDIA 2OPSA 1UKUA 1WTFA 2MZTA 4C7QA 3OVSA 1IR2A 5L1LA 1RT3A 1NM2A 1KTVA 3PW2A 3BDEA 4MYUA 1YJRA 4M5MA 2Z8QA 2XTJP 4ES3A 4RPFA 1QE1B 1R8HA 4RZRA 1LKZA 4PABA 4N7TA 1GH8A 1PC4A 1Y11A 3PDNA 5HBMA 5A76A 4RW4A 4JI7J 1X9MA 3DLLQ 1SC3B 4MFBB 2F40A 3ET6B 2DRAA 2F8HA 4NPOA 3QMQA 3UPFA 1TK8A 2CRLA 2M5YA 4IFYA 2I6WA 3MTJA 3SQGA 3PW4A 1R6YA 4DSJA 3HZEA 1WEZA 4XIUA 1FWLA 2P2CB 3GYGA 4U7UK 2BOPA 4FXVA 2RD5C 2B8PA 1SJQA 3MUTP 2A6MA 4QW9A 3TP2A 2R42A 4GKJF 5KFRA 3R5DA 2KTQA 2XMKA 1EAYC 4PG7A 3OT9A 1F2HA 2F7VA 2IM1A 1K0VA 4J37A 3W8GA 4DV0F 1QUPA 2IDEA 2N4CA 1WG1A 2V2ZA 2VDHA 3MMJA 1CC7A 1TL1B 1TVRB 2GQ2A 2QLWA 3PO5A 4TVAB 1UTAA 2HGMA 4F4XA 4UOGA 1I6JA 4LF2A 3QT5A 5G0RA 4K0KJ 4HYKA 5F8IA 3FEYB 4X4PA 4KHPF 4F0HA 2FJEB 2XG8A 4OQJA 4WE1B 3ITHA 1HI0P 3U02A 3FNNA 1RT7B 4HH1A 1B3TA 2GJFA 3BYPA 4I2QA 3VAJA 4X2BA 3MCMA 2DNLA 4F04B 1TV6B 2W2QP 2WONA 3QAUA 4J9LA 4G1PA 1DTQB 2IVMA 5E33A 1U7LA 1WOOA 2AJ0A 2RVJA 4NA1A 2XLIA 4W92B 1NEEA 3M6VA 4B3RF 1IM6A 1N32F 5AT1B 1FESA 4JI6F 2RQ4A 4DLGA 1GNKA 3FQLA 3MMAA 3WX4A 1ULRA 4DDFA 1ZYQA 5CHCB 2BE9B 4OYMA 1SC6A 2VDIA 3PJXA 2XI3A 3NY0A 2AEFA 5E7OB 2HFOA 5F8LA 4HI2A 1FXLA 3BGRB 3OFHA 4H4MB 2CWXA 1U09A 2IPOB 3GTYX 3BQ0A 3C46A 4X84A 2WK4A 3DM2B 1UEVA 2DNZA 1FXRA 2KN4A 2VG6B 3H20A 4LRBA 4NZ7A 2JEIA 2AEJA 1AUSL 3HDSA 3L7PA 4OFZA 4OX8A 2R2UA 1HW8A 2LQBA 3WC0A 2C2ZB 3CWJA 5KFEA 2FVPA 2CJBA 5F0UA 3RW6A 3Q8PB 1RT6B 3GR1A 4C97A 1HNIB 1BY9A 1KHVA 2L3MA 4UOFA 4DSIA 1URRA 1Y7PA 3MECB 3OSNA 1RTDB 5B0FA 3VAGA 3MAAB 1L5UA 1HWLA 1ZOTA 2R7TA 1UW4A 1FT8A 2XMTA 1D8ZA 2HAFA 3FSYA 4K4XA 3PW7A 3O5TB 3MOJB 4ECYA 2G13A 5KOWA 1J5EJ 2E9ZA 4DZDA 2YVSA 3C66A 3V5RA 4N5SA 1Q5VA 4U7CA 4OZNA 2OTLS 1RBAA 4K4UA 1VQ4S 1D3WA 1F9FA 1JLQA 1HI1A 1WKKA 5KFMA 1UVKA 1BWEA 2DTJA 3C16A 2YKAA 1J5EF 1NH8A 2I38A 3T9ZA 3M8RA 1BGXT 3KJVB 2CNOB 2ZH6A 1FKPB 3SFGA 1FK9A 4Q2MA 2VA3A 2NLWA 2MPUA 1UVLA 4K5SA 1M90T 3MPYA 3IBFB 5KFIA 4USMA 3BREA 1IBLJ 2A1BA 2BE2B 2QYCA 3Q8UA 4JI2F 2N3OA 3C6UA 4NYZA 3OHBA 1U8WA 2F4VJ 4K4ZA 4RW6B 1UEUA 1LWFA 3R7NB 4CQ1A 1CS4A 4P75A 2GGPB 1LWFB 2DNYA 3MMBA 2RH3A 1E6VB 4DF8A 2RS2A 4ZMMA 4QWDA 2E9RX 1FEEA 5U47A 3J7A1 3QIDA 3ZZTA 2BE2A 3KTQA 4FS1A 4RKUC 3GG0A 2G9OA 3A3NB 2HNDA 2J5AA 4AYBD 4XPCA 2DIVA 1I94F 4JV1A 3BGLA 4KGKA 1T95A 3NAIA 1FK9B 3R9LA 2JC1A 4WXWA 4K59A 1PYTA 1WC6A 2U1AA 4HHHA 3KJVA 2YKMA 3IC1A 3RB4A 2GVZA 1FFSB 1ZZNA 5GAHI 4K4WA 4WKRA 2LQ8A 1H3DA 4C98A 5KFFA 1HNVB 1LEOA 4JI3F 1Y10A 3FUYA 2KRBA 3AXKA 3M8QB 3MEEB 1X4HA 2DHHA 1IKYA 1HHSA 3O8WA 4NLWA 4ZVOB 5G4DA 3ZZZA 4ID8A 3RYLA 2EXUA 4DU8A 4DBQA 5HJYA 1XTZA 5BJRA 2QLXA 1SC1B 2E7XA 2LYVA 5JXSA 4BHQA 3SEOA 4LF5J 3KK1A 3R5CA 1HD1A 1S6QB 2LDYA 3QGGA 4QWEA 1H2TZ 1S1TA 4ZVHA 1OIAA 3PX4A 4DX6A 1RAFB 2LEPA 1HMVA 2B7CB 3BS9A 3ENAA 4H4OA 1RTHB 4QQBA 1VQOS 1U1LA 1U45A 1R8AA 4RWWA 2DRBA 3OL9A 3AJDA 1WF1A 4RL1A 3IBCB 1E6YA 4OV1A 1VIOA 1SKUB 5ETRA 4KB7A 4Q45A 1NKCA 2C3PA 4QWCA 1RWUA 1UPPA 3EGWB 1TFYA 4NX9A 3CEDA 1S5ZA 2VFTA 3DCAA 4ZCIA 1JLBB 5DGAA 3UDCA 5J2MA 3VQSA 4Q0BB 2EK1A 2JSXA 5J1EA 4OHZA 3THPA 1CEZA 2CUYA 3QZ7A 5D6GA 2FJXA 3SCIE 3TVZA 3J80U 2QEXS 2ZJPQ 2E1CA 3FMBA 1KD1T 4EZ9A 1U8SA 1RE1B 4ZP9A 2NSCA 2NXEA 3NP5A 1S9EA 2XSJB 3E3XA 3KLHA 1RTIB 3CNQP 3HFZB 1T05B 2J76E 3R1HA 2C2OB 3VAKA 2QZ8A 2IYGA 2D1CA 4ECXA 1DTQA 1NSPA 3MXHP 1F6TA 3AJ1A 1GMVA 1WKLA 2LA4A 3K7RA 1S97A 3AQOA 5EX3A 3UN2A 3ZXWA 1FDBA 1EX8A 2VBWA 1NMEB 1UA0A 2BOAA 3D54A 4L72B 4ZHRB 3NOGA 4ZVTB 2OPPA 3D1HA 4YR2A 4CLTA 5IT0A 2XLJA 4A8FA 1LK7A 4LSNA 1VQYA 2UZAA 1UVMA 4CLKA 2HLTA 1YJVA 1KVIA 5G0RB 2HK2A 3NBPB 2R2TA 5CXTA 2OD6A 3JQKA 3LF0A 2JVRA 3FVYA 1MU2B 3VV2B 2E5GA 3CJ0A 1HHTP 2V8GA 1YRTA 5KT4A 3D6MB 1TL3B 4C8ZA 4QIGA 2DK2A 3ISNC 5GAEU 3OV7A 1KHWA 3B6BA 3ZC4A 1VQ6S 2UVVA 2VPXB 5K9FA 2NZ4A 1TFWA 4IOCQ 4RBTA 3K5PA 3VAIA 5L46A 3W9IA 4ECVA 2R4FA 5DDPC 1Q8IA 2KJWA 2HPUA 3MM9B 5C25B 1HQEB 3EJMA 4KIAA 2PT0A 4ZLPA 1JLGA 4EWTA 1RACB 5CH7B 2B51A 2ROPA 1PILA 5LXYA 2W9CB 4Y2IA 5KFHA 2H3EB 2WOMB 3CUNA 3I9ZA 4NWBA 4JP8A 2CQDA 4ITSA 4GC7A 2XWYA 3LP1B 4MFBA 2CJKA 3AB2B 1LWEB 5DM6Q 5H9EJ 1MROB 1A6LA 3BB5A 2L48A 2LEBA 3VZIA 4OHYA 5LSRA 1LQ9A 2OFGX 3E51A 2X7IA 5J1PA 3CCLS 2FLNA 3PHEA 1QE1A 5HVGA 3RBXA 4B02A 2JEJA 3N9UC 3TVKA 4A8SA 5HK4A 2J9DA 4O0NA 1WHWA 3ZTQA 5M2PA 2YWFA 4KHMA 1G3OA 3AY0A 2IAJB 1WUUA 1XR6A 2KXHA 4LBIA 3HPOA 3IWXA 3L95X 3PFEA 2E1PA 2DKOB 3M1VA 4DFKA 5HQMA 2DR6A 4E98A 4EI2A 2VU5A 3KLGB 4WFYA 4I6AA 4AD6A 4ECTA 4F02A 4JI7F 2V63A 3D6TB 2B9WA 1NZ8A 3HHLB 1PJ6A 4ILRA 5ETMA 2ACMA 2C1EB 1B7YB 4DL6A 2Z4PA 3GV5B 4OX9F 4WF9Q 1N6QB 3UD5A 4B3TF 1L3KA 4ELTA 1ZZFA 2Z30B 3I5BA 2J8AA 3JAMU 2CQBA 1VRUA 1K1QA 5HAOA 3AQPA 3ENVA 2RKIA 3W9HA 3LWMA 3HSJA 4NXMJ 1RT4A 4DQRA 4USVA 2E44A 1VBZA 2M8DB 4NXNJ 4DCJB 3HI9A 4HHUA 5LMUF 4QZVB 1HHQA 1Y00A 2R2SA 2CPEA 4DQIA 2E1AA 3NAHA 2MJUA 1FDAA 3N6MA 3W2VB 4K4VA 2B4OA 2ZH1A 3UDLA 1VQ8S 2K2PA 4ZLLA 4Y3CA 5KFOA 1UA1A 3SSQA 3T1AA 1NJWA 1CJTB 2GFFA 3GSIA 4HR2A 2HMIB 2XI2A 1I94J 2I9SA 1JLCA 3T41A 2G2YA 3C8YA 3DRRB 2HG4A 1S6OA 5KAKA 4ZPVR 3R5AA 5DQIA 3PEJA 3C14A 2JH3A 5C5JA 2KG0A 2HZAA 1HBUB 2CJXB 4NL5A 4P52A 1WNEA 1W7WA 2V2VA 1FTCA 4LMZA 2P9GA 2HS3A 3UFCX 2MQPA 1JMTA 2B9EA 4LFBF 5B09A 1FJCA 3Q86A 1AXQA 4HLBA 1JLCB 4MAKA 1Q95G 2MKHA 1UFLA 2ZH9A 5ETTA 4RW7A 1P6TA 3K58A 2YH0A 2OGUA 5DRKA 1UAWA 1RXOB 2MQ8A 2GO8A 2XYGB 4IH7A 3ZZUA 8AT1B 3CC2S 1RB0A 2AYGA 2N3LA 3EX7B 3C6TB 3K5MA 2XHCA 2HBRB 1DLOA 4D3HA 4Y6IA 1NHKL 4CCHA 4DN9A 3MTKA 4F25A 4M5HA 2N7CA 1G7CB 1F9HA 3U1MA 1RAAB 1JLAA 3VVUA 4O4GB 4B17A 4NLDA 4PG6A 2Q66A 3NGKA 1F9EB 2LVWA 1RJJA 2I5JA 3EVOA 5DO2A 1LV5A 4KTQA 2VOOA 4FYDA 1RWKB 3W65A 1IQZA 1N6QA 1J5OA 4RUCA 4YHHJ 1S48A 4ED2A 5T14A 2HVDA 4OL8A 3D1QA 1F60B 3BH6B 1Y9OA 1M5PC 1O8BA 1REVB 4Z7CA 2MGZA 1QY7A 2UUCJ 2UXBF 3TAMB 4BC7A 1YI2S 3V6KA 2YQ1A 3LO3A 3PG9A 3M32A 2WHOA 4ZOSA 2CNNB 4OYZA 5EHHA 5KFKA 3SYZA 1K9MT 1TUWA 4F7VA 2PD1A 4CH7A 2DNPA 1IKWA 2FDNA 3GB0A 4DV3F 3M9NB 1HBNA 1P1TA 1JXVA 4DQPA 2RS8A 1HBOA 4K4SA 4ZITA 2AD9A 1EJ7L 1PBAA 3JSRA 4KR0B 4OYOA 4WXOA 2XHWA 1VDHA 2GMJA 2FQQB 3W2WB 4EYHB 5DG7A 2YNIA 3DLKA 4OLPA 1HQUA 4OV6A 5D0HA 1S1UA 5HROA 3IM9A 2E5LJ 1S49A 5IXUA 5KOXA 2LXIA 5L39A 5J2PB 4HTIA 4GKJJ 4P6QA 1DBDA 1HKAA 4ZVEA 3M6XA 1HBMA 2DCUB 4IO1A 3M2RB 2B6AA 3CD7A 2HQ3A 3DU6A 4NLPA 4JV0A 2N82B 1RTJB 3N0VA 1BE4A 1RT5B 5DETA 2Q1LA 3MMCB 4DX7A 2W9CA 3R7BB 1FJEB 4CIOA 1TL7B 5EUHA 1U1RA 3RJMB 3M2UB 1Q7YT 4CO5A 3OD2A 3GE9A 3IRXA 3UW1A 4YP3A 1VBYA 1M1HA 1NRKA 2GVDB 1CJVA 1QSSA 4KPYA 4O3SA 3FBCA 4KRWA 2V68A 3CIZA 2AX0A 1VQMS 2KYZA 2MLXA 2P9EA 3N5BA 2G2ZA 2UXDJ 2CQ3A 1Q8BA 5A0YA 3PY8A 3CCZA 4F0MA 3B4MA 3UD4P 2Z0GA 2V69A 5KFSA 3J80Y 1MMLA 1NH7A 5A8WA 4F26A 4CRJA 4EU0A 2BYCA 3ISZA 4I0WA 2Q43A 4Y2MA 6AT1B 1FO1A 2B4VA 3C15A 4LF1A 2ADBA 3VHQA 2OEKA 5C42A 2IM2A 1V6HA 8RUCA 1C4CA 3DKDA 2R8IA 2ASDA 3LUYA 3MPDA 3MZIA 1D8YA 3ZFVA 4KKOB 4M8LA 3JXOA 4NEZA 1FD8A 1HI8A 1QDUB 3BR9A 4NCGB 3JTOA 3GLJA 2HVIA 3D3CJ 1AA1B 4WKYA 5L1JA 1GEHA 2FLOA 4J90A 4OI2A 5D0RA 4YHHF 1UVNA 2XNRA 1HNZJ 5CYMB 1OWXA 3NG8A 4MMOA 2GAHC 3PM9A 2EKYA 4A46A 1NK9A 2C2EA 1F5AA 2OP5A 3R2CJ 3MEKA 4I7FB 3UNGC 4R5PB 4USUA 2XB2D 3I0RA 2ZNYA 3DRPB 2Y1IA 2H4YB 2FHJA 4C2MA 1FFWB 1HIYA 1HWKA 4YB1P 4B9VA 4NZ6A 5CQGA 4FBTA 1QJHA 1S1WA 1UEKA 3BKFA 2KFZA 4CO0A 3MUVP 1TKXA 2DD8S 2MKYA 9ATCB 4DQSA 3C3LA 4YB6A 1SQGA 5I4MA 5JVHQ 4CNZA 1NDPA 5F9LA 3TNVA 3K17A 2XLKA 1VS3A 3DOLA 1TAQA 4MKAA 1YRUA 2ZBIA 2BJ9A 3DRPA 3LA0A 3DLJA 4H4OB 5L9NA 1TMMA 2ZJQQ 4EMDA 3I0RB 3CPWR 1R0AA 1JB0C 2BABA 4N8OA 4R5PA 5K20B 3EXYA 3PRBA 1FDNA 1DY3A 4F3QA 1TL4A 4Q5VA 2YQ0A 1WDDA 4KHPJ 3R5JB 2DB1A 4O3OA 1GXTA 3M7VA 2AKWB 4TKTA 2CJAA 2CZVC 2EFPA 4C8MA 1HYSA 5B0BA 1NDLA 3TUIC 2DGWA 1YJ9S 2H4WB 4PWUA 2VKZG 4QR1A 4YY3J 1HNVA 1V3RA 3G86A 3G96A 2O3DA 4DL0C 1Z2ZA 2N4DA 4NLSA 1N36J 4B9MA 3QT8A 4K7QA 1RT1A 2CPHA 3CCSS 4F4KA 2ZVIA 1U6FA 5C2GA 2RRBA 1RA7A 4ZCLA 2VBXA 2BW7A 4B3SJ 4QIFA 1EB0A 1K44A 5K8MA 3IO1A 1BMQB 1WC0A 3C15B 1KN6A 5F8MA 1FTRA 3N28A 2WCXA 1U26A 1GMUA 2D9PA 4IR9A 4UZCA 4PAAA 4B3OA 3HHNB 2KXNB 5E3QA 3OUYB 3E01A 4AT1B 4NMXA 4C0OC 2VPWB 2VV5A 3HHKA 4WP9A 1R89A 5FJ4A 4ID5A 4WTOB 1WJ9A 2B7BB 4CWBA 5KTQA 3A8JA 2VIHA 1S6PB 1EKSA 4RW6A 4USHA 1R8CA 3LPYA 4DFPA 4EBEA 2CPIA 3KLFA 1RWWB 2VZ9A 3M2UA 5BYQA 1SJ4P 1CSJA 1NPPA 2WW4A 2WTFA 1SXLA 1RT5A 1W2BR 2HWIA 2BACA 1OYDA 4GVBB 1MW7A 3ENWA 4WU3A 3M9MB 2B6AB 4IRCA 4F2SA 2CQPA 1YQHA 3K89A 4U96A 3QO9B 1FDDA 1Q16B 1ICEB 4IG0B 3NS6A 1TTHB 1AROP 2MQNA 5LT5A 4XTTA 3OL6A 1S72S 5GADI 1TP7A 1SQFA 1JLEB 1Q78A 4NXNF 1S1VA 2J9DE 5CYQB 2E7WA 3D4JA 1CJUA 2DO4A 2PMHA 2W7OA 4J9OA 5B08A 1QD1A 2GV1A 2KL8A 2V8DA 5CA5A 3OHAA 1D9FA 1HBNB 3QWPA 1CPZA 2BXJA 5K8OA 1Q53A 2DCLA 2B9YA 3BR8A 4DUYJ 5CZXA 1MNEA 3K5OA 5A8KA 1RCXB 2FB0A 2HNYA 3RAMA 1SUQB 2H65B 1RT2B 2IFXA 2ASJA 3QGPA 2E5HA 2BA9A 2MGZB 2G2OA 4P74A 5EN1A 3K57A 3V4IA 1NJYA 4YB5A 1GMWD 2LLZA 1U25A 3GJTB 1M0SA 4CO4A 3RB3A 4DX8H 2R8JA 3VR1A 1HPZB 3JYTB 3BGRA 3NCQA 5F8JA 2AJ4A 3RGIA 1LOUA 4QWBA 3RBZA 1RWXB 5KFAA 2HHVA 1APSA 4XO0A 2HFSA 2ABYA 1NB2A 2VPZB 2ZC4A 2AHOB 4FYYB 4FP9A 4TY8A 4BC9A 2V50A 3IR5B 4LR9A 4MJKA 1NK8A 4JI8J 3WQPA 4N76A 4LQ9A 3ULHA 4HVZA 3EVMA 2KT5A 3PX6A 3KMQA 1XJWB 1FKOB 4KH1B 1CQNA 4DUTA 3PR4A 3PEHA 2PIIA 3FFIA 4I6YA 2LA6A 1FKAF 5EX0A 5IM0A 3FRYA 3SBMA 2HHPA 5B0GA 2XMWA 4EUVA 2DY1A 2MTLA 1YBUA 2DHGA 1H7WA 3HSGA 1OY9A 5E0OA 2VOPA 2QE5A 3T5JA 2B0GA 2FUG9 4WE1A 2BM1A 1JKHB 4WZQA 1JNZB 2HURA 3TRGA 3IA0A 4CLSA 3BSCA 3QGHA 4A47A 8ATCB 2PMZD 2YKNA 2DH9A 2F4VF 2F9DA 2XMVA 2C2RA 4LFAF 1SI9A 4MIAA 1P9YA 2DGVA 2LQ9A 2YWEA 1TL1A 3SMZA 3RRHA 1YIJS 1D0EA 1Q79A 2HFUA 4L73A 2C2DA 5J1NA 4ILLA 4DV6F 2PEBA 5DG9A 3TUJC 1CLFA 1AZSB 1WI8A 1Z4UA 3MEDB 1PYOB 4RUBA 2DISA 3P8BB 1DZ5A 1FHTA 1ZH5A 4PKDB 3W2VA 1TKZA 2VQEF 1KVJA 3HF5A 2BUNA 1B0PA 4OI6A 3A4TA 4QR2A 3CF5Q 1NDCA 3EICA 2GO9A 4ECSA 2B5JA 1EETA 5EWGA 3GPAA 2V9KA 2JDJA 1WTBA 1X5SA 4EZ6A 2W2MP 2XULA 1ZAVA 3EGNA 3WC2A 3KJNB 4OHXA 4USTA 1SJRA 2KXFA 1RU1A 3QPIA 3DOMB 3IS9B 5J2QA 4RW4B 1MSWD 3DMJB 1KLMA 1V3ZA 2OMLA 4KGZB 4O4RA 7AT1B 5HVHA 4F3OA 3CMAS 2ZZNA 1ZTTA 2HVHA 3UE2A 4DS5A 1UJ6A 4RW8A 1KQKA 3KUHA 4F36A 2E7VA 3GONA 1M5OC 4UOHA 2Z2ZA 4G6VB 3RTVA 2HVZA 2HIYA 3CJRA 4KC5A 2DITA 1RBOB 4TQRA 4YR3A 2BX6A 3HK2A 2ADCA 1RAEB 2AIRB 2OPSB 3R5BA 3T6JA 4Y34A 4ZK7M 5D4PA 3QZ8A 4C8KA 4DUZJ 1G1XA 2YH1A 5HP1B 4UT4A 3GYNA 4CLFA 2UUAJ 3UQSA 2IAJA 2DNGA 2DNKA 3KDOA 4B08A 2U2FA 4C9DA 2VL1A 2XS7A 1FCAA 2F63A 4QYRA 1SV5A 4A8WA 1O51A 3R6LB 1JJ4A 4PYDA 4LFCJ 2FJBB 4DR7J 4WZMA 2PFFB 5BYRA 1JQGA 1WORA 4PXEA 4OZJA 2R7SA 3OVBA 2XNQA 2CZ4A 2JOQA 2W4CA 3AB4B 2M0GB 4GO7X 5D8HB 2O5DA 2F65A 3QWUA 4J9KA 5J2NA 2BANA 2B8QA 2ILZA 3CDEA 2QMUB 1LWEA 3QT7A 2UUBJ 2HBYB 4KH0B 3EDRB 4RNNA 3JSMA 5KG4A 3Q0AA 2ZM6J 2CZ9A 2W24A 3QATA 2NPFA 4WFAQ 2ASLA 2C28A 1UPMB 4USIA 5A8RB 3EPGA 4MYTA 4BWJA 1B99A 2BKNA 4CH1A 4EBDA 2VUGA 3MDFA 4DR3F 4DPUA 3SQOP 4RNOA 1JJCB 1TKZB 4ECZA 3DU5A 1C0TB 3PIOQ 3H25A 2VQFJ 3QBCA 3RRKA 2DXDA 3TR5A 4U9RA 2KT3A 3UWTA 1BQMB 2BEFA 2I2YA 1AZSA 1CJKB 3TEGA 1QAYA 3T1HF 4RW9A 4J9SA 1T03B 2QTWA 3GWCA 3OTEA 2GQQA 4CO2A 4DV7J 1S79A 5BR8F 3GG1A 2D7SA 3NBPA 3JS9A 3VF0B 1X5TA 3W7BA 3VGSA 4FZVA 3UDEA 4EO6A 1JKHA 2CAJA 3JB9k 2OUGA 2F8EX 3CJSA 2OI2A 3SCKE 5L1IA 3MM6B 1I1GA 1RISA 3OTCA 3LAKA 4AL5A 2VFUA 3FKBA 2A18A 4KYZA 3W9JA 2GJ2A 2V4QA 4RJVA 2HHQA 4Z37A 4Q44A 2WAQD 4HT5A 2CWKA 3BO3A 3D1OA 3F0NA 3KJFB 1S0OA 3FFIB 5KG6A 4KJIA 1YK9A 4DL4A 3CTRA 2W2OP 1U1NA 3MCNA 3A3PB 4LBHA 5IQQA 1RTIA 2FJVA 1FX2A 2KFNA 3HVTA 3N79A 3N6LA 2HAIA
chains in the Genus database with same CATH topology
1U2RA 2VBZA 2IVFB 2RMLA 2PSZA 3VZHA 1N8RT 4O44B 4C11A 2DR7A 2CPFA 4J5OA 4RX6A 3CSKA 3JYTA 3PJWA 5J2MB 2ZC3A 1WF2A 1KFDA 1FXDA 2IHR1 5LSOA 4I2PB 3HVWA 4JUZA 4O3NA 3M30A 2R2RA 4UUWA 1UJ4A 2YX1A 4G3IA 1HWJA 5DDRC 3CCJS 1VRTB 2LMIA 3NL0A 1DJ0A 4DFMA 5A2QY 2CQCA 4I64A 4AL7A 4PWDB 1ZAXA 3FGVA 4NCAA 1S1VB 5KG5A 3OJUA 1YRXA 1NU4A 2CYYA 1JK9B 3IBWA 4CO1A 1C2PA 1H98A 4WFBQ 3IR6B 5A6PA 1H6KX 3I55S 3QO9A 5GAGU 3Q8QB 1VQ5S 3LW5C 2YKMB 4MK8A 3AH6A 3DLEB 2MQQA 4N56A 2R8GA 3PKMA 5I42B 1VK8A 2RUGA 3G6VA 4ED7A 3NNAA 4WFXA 3S6EA 2XGQA 3OW2R 2DNOA 2XCAA 1SKRA 3TQ1A 4IOAQ 3KLFB 1KS2A 3G6XA 2FTRA 1Y4ZB 5DLFA 1U1PA 2PE8A 4ELVA 4OI0A 2VONA 2BQ3A 2KO1A 1S6PA 3Q2TC 2V0NA 3S1TA 1T02A 4URGA 4R25A 1NO8A 2RSQA 1K73T 2RDIA 4BBYA 3PFOA 3OUYA 1H7XA 5E5NA 4RUHA 2EI5A 3TA1A 4B3OB 3KK3B 4HKQA 2K1RA 2MZJA 3CIMA 4QPTA 2MHNA 4F67A 3LP2A 3PW5A 1ZPWX 3UCGA 1Q1KA 1NHUA 2J0WA 2LQJA 1C1BB 2X3GA 3MGJA 3MEGA 4UUXA 4M1KA 2UVWA 3G71S 1N56A 1LW0B 2ZH3A 5E3RA 1T03A 2E9TA 3G9CA 3AHPA 4PQUB 1N88A 3OL8A 2FHOB 2DGSA 2RQMA 2RT3A 3M05A 4K5RA 5FLXY 4B3TF 3HO1A 1S4FA 2HRUA 2ZHAA 1HYSB 4USJC 1GX6A 3MM5B 5K14B 2HWTA 4NRUA 4LF9F 2XZWA 2ZFHA 3AAWB 1IN0A 4M94A 3B78A 3UR3C 1X5PA 3V4MA 2A2CA 4OJ1A 4ZCKA 3GFYA 2V5HG 4EFAC 1KSPA 3JSYA 5AE3A 4PUOA 5KT3A 3CCVS 1LK5A 3DOKB 1UETA 1S1WB 4IFVA 2VG7A 3CD6S 2RJZA 3CCQS 2CQIA 2DO0A 3DRYA 4QR0A 3K2YA 2W8LA 5KFXA 1SV5B 4YUDA 5H9FJ 3H2LA 1FVSA 3HX9A 4I1TA 2L9NA 5F3ZA 3CB4A 3MOZA 3MMAB 3A8EA 3D0GE 5SZTA 4H4KC 3IWLA 1S9GB 2E29A 2UV8G 3QJJA 4KSEB 1M5KC 2Q3PA 2W7AA 4DR6F 2VG7B 1XMBA 5HLFA 2FJAB 3DOKA 4LVNP 2MKKA 1K8AT 3GFXA 4OI3A 2KZMA 2XMUA 2HHUA 2EPIA 5EDWA 4C8LA 2CQ0A 4EBCA 1FVQA 1UWBA 2RU9A 1FERA 4B9NA 2K7KA 5T41A 3J7Z5 4YFUA 4M63A 1U1QA 2PI5A 1D1UA 2CPZA 2GIRA 4HT7A 1KLNA 2W8KA 5MAOA 2AW0A 4FF4A 2K8GA 3CGIA 4CT8A 4ED5A 5A6WA 1TVRA 1W2IA 3MM5A 2JFKA 2QFJA 1OPIA 2M8HA 1RAJA 1HR0F 5CYJA 2FD2A 4IRKA 4X4UA 3FCHA 2NYIA 4J9NA 3MEDA 2PGCA 2YNFA 3CDAA 3PIPQ 2IA0A 3MEGB 2C3YA 2XWXA 4LIRA 5JUMA 3ENQA 1N54B 2LXUA 2R7XA 4IFYB 2EK6A 2HHWA 2J7KA 2CG4A 3PVXA 3UCUP 2CDQA 3OR2B 2HNZA 3B82A 3T9NA 4GC6A 1D9AA 2GHPA 4ZPBA 4CT9A 1S77D 1R27B 1HQUB 4UOCA 5HROB 2W4DA 2HLUA 2GHVC 2KKHA 3KHHA 1RT3B 1R7IA 4IRDA 4X62F 1TQLA 3MPWA 2HHHF 1UP1A 4ZCMA 1DQ9A 2M7SA 3L3CA 3DFEA 2Z2MA 4Y2KA 3D0IE 1RGVA 1XBWA 4K50A 1HA1A 2IC3B 5C24A 1LWCA 4N47A 4QPXA 4WK1A 1ROFA 1NKBA 4AUKA 1ZBTA 3S8SA 3SZ2A 3O1LA 1YGYA 2MQOA 1NB7A 1L3UA 1FEHA 3H2VE 3M4XA 2ATLA 2UU9F 2V9WA 4F3MA 4J9QA 2R7OA 2ZOMA 1OSCA 3RU0A 3ZZ0A 3BGUA 4FF1A 4PWDA 2J9CA 2UUCF 1XK8A 2OSQA 3IFEA 4OJHA 2FJDB 4WTYA 2C3MA 4QU6A 3NMRA 4LF4F 2JVOA 2EBGA 4G1IA 1H0HB 3KKFA 1IXKA 5THWA 4Q8FA 5KT5A 2WB4A 3BEGB 4LIWA 3DXSX 3CJKB 5B7WA 3WZ0A 3N01A 1GXLA 2QV6A 2W25A 2BBEA 3U7JA 4DR4F 5CYQA 2D3OR 3H98A 2E66A 3H8YA 4CTAA 2MZ1A 1JLEA 3PV8A 2DBBA 4AL6A 2HNZB 3UI3A 2AYBA 2JZ5A 1M5HA 4RU2A 3BN4A 2JC0A 4O0IA 3NCPA 3QAEA 3JTNA 5HI7A 1NHVA 3NGDA 2FHKA 3G8TA 3RB0A 1X4AA 2X1AA 2KFYA 1N0VC 1ZTWA 1N33F 2ZE2B 4CZCA 3GIIA 1ZETA 4QIWD 1YG0A 3HLUA 3LALA 1KTQA 4TU9A 3PRDA 1X8DA 1NNDA 1X0PA 3Q23A 4ID5B 5KG3A 2IRYA 5HL7Q 3GIKA 2DR9A 4FVCA 1S10A 1KC8T 3E01B 4RBUA 3TAQA 5JVGQ 1RYSA 2OPQA 4A4JA 2IM0A 2VH7A 3GZ7A 2UUAF 1NJZA 4JI5F 1IQTA 2V4RA 3V2UC 3CJ5A 1S0NA 2ZVSA 1NJXA 1R3NA 1N48A 3CC4S 2MZRA 4ZA1A 3FZBA 4OJ3A 4RW9B 4OI4A 1RYRA 1YWXA 2J9EA 5L8RC 3RB6A 2J6TA 1UWBB 4NYOA 2DNHA 2FC9A 3KYLA 4OIXA 1J2VA 2RILA 3DI6A 3G8SA 4C0BA 1IM4A 4FXWA 5GAEI 4K4TA 2AGPA 2BR0A 2ZZMA 4DSKA 3X3UA 2UXCF 5HLFB 1C0UA 2MDAA 4P2SA 2OH2A 4Y0FA 2EWHA 4DL5A 4LSLA 1S0VA 1LFWA 2V94A 4HEA9 2OPRB 2Q6CA 2YNGA 1S1XB 3I5CA 5CZVA 5J2NB 3BZQA 5F9NA 3I82A 4DR5F 1HL6A 2C3UA 1TR0A 1ELOA 3IG1B 1FRLA 2RNEA 4ELUA 1R31A 1TKXB 4C4WA 5IWAF 5AXLA 2D9OA 1N5YA 1XWLA 4K4YA 1QAIA 2J6UA 2CPDA 2R9LA 2F9JA 2QA1A 2YNGB 1MWYA 3LP1A 4WCEQ 2W7PA 1KOOA 3TOQA 4ED8A 1VC5A 4OMFG 2YQ3A 4DG1A 2L41A 2V4JA 4WU2A 5GAGI 3ZZPA 4DPOA 1XMQF 1OQ6A 1HNXF 1C0UB 2MSSA 1BLUA 4MKBA 4UW2A 3BSAA 3I56S 2CQ1A 2P6TA 3MR5A 5E3PA 2IJFA 1PGZA 4A8MP 1Z2LA 1NK6A 2E5JA 4C3LA 2GNKA 4ED1A 3TYTA 5B0DA 3DMJA 1DQAA 3DOMA 4FNIA 2YWHA 2JJ4D 1UFWA 2VC1A 2VFVA 4KKOA 4XK8C 3QZ8A 1SL2A 1X4CA 2BVZA 4ZPCA 2D41A 2MY8A 1MU2A 1SIZA 2ZOGA 3LAMA 3U27A 2EFGA 4JOUA 3M8PB 4AFFA 2VPYB 4B9LA 2I8EA 1UMJA 3HP6A 3IN5A 4Q8EA 4UQGA 3BSNA 4O23A 1BWEA 1NAQA 3GIJA 3UD3P 1HD0A 3BF4A 2B9XA 4LSNB 2BJEA 2CVIA 3Q24A 3TARA 2OPPB 4ZHRA 2DT9A 2HRYA 3BDPA 2XCPA 2LEAA 4JYAF 3THVA 3CT9A 3LGNA 1Q82T 3OFFA 2MQLA 3MHYA 3MWBA 2ACYA 3IRXB 4IG3B 5AXNA 4BS2A 3T1YF 3IRWP 1T7PA 2QSWA 5IS2A 1P1LA 3CO9A 4YQWA 1LXJA 3SV4A 3TAPA 1AFIA 4YB7A 3UCZP 1JJHA 4X4QA 1IJFB 1WELA 2FJWA 2YX4A 2R7UA 3KLEA 1RKIA 3DLEA 4ZP7A 3SCJE 3P49B 2PA8D 1Q7LB 2KM8C 3PZPA 5I3PA 1Q86T 1DTTB 2BW2A 3OFEA 5IM0B 5J2PA 1S1UB 4URSA 2YNIB 4QOTA 1GXUA 2VFSA 3W2WA 3KHRA 2MYFA 2YX7A 4X4VA 2MHEA 4NMLA 4LF6F 2VODA 2YNHA 5BYSA 1X4GA 3HHEA 3VTIA 1YBAA 7FD1A 5I3UA 4IKAA 1Z1ZA 2QA2A 2RU3A 3TAMA 2DH7A 2RRAA 5DG8A 3ICLA 3RAQA 1SIWB 1NKEA 1IKYB 4X4NA 5D4LA 2AGOA 4H54A 4RWXA 1JLFB 1S99A 3ZZYA 5DDQC 1YITS 3QJLA 4OLOA 1G6BA 4A8YA 2KYXA 2WSCC 2NREA 4X66F 2HNYB 2Q79A 2DGOA 2IC3A 5A8KB 5C24B 1VGYA 2DH8A 3KG4A 5D4OA 5I3UB 4O4GA 5T7LA 4C8OA 1QVFR 2YNHB 2ASYA 4OZLA 1R0AB 3EYZA 4TLQA 2X1GA 3T5KA 2DGXA 2RB7A 2ALZA 2QA4S 1VI7A 2ZITA 1O5JA 1N36F 1E6VA 5L1KA 4OX7A 1MMDA 3LQVA 1FJ7A 2DGTA 3SDEA 2XY7A 1DHMA 4IQXA 4RW7B 3Q8SB 2ZUGA 3C6UB 1FJGF 1RDRA 2L9DA 4HI1A 3IGNA 3D5MA 4R0JA 3G4SS 2K7JA 3HJFA 4DUYF 5HMYA 2NUHA 2GCFA 1VIXA 3DLGB 3MFIA 3KK2A 4MTPA 1B0VA 2YNFB 2WBMA 1Y0HA 1SJ1A 2QRRA 4YEAA 4EGLA 2Y0SD 3DRRA 3MAQA 1DRZA 3CC7S 1FRMA 3KLIA 4EO8A 3TUZC 2AX1A 1VQ9S 4DHVA 4B3SF 3FJ2A 3IR7B 3OTDA 2D3UA 1A7GE 4DL3A 4X64F 4TNOA 5KFNA 5K8NA 2LQ5A 3H2UB 4ZVGA 1O0PA 2AQ4A 4LFAF 5A8RA 2BJDA 3T3FA 2XSFA 3M8PA 3OBIA 4XDCA 3ZZRA 2WB1D 3FEZA 1HNZF 4PG8A 4BCAA 1YJWS 4CNYA 2GMLA 4RNFA 1U1MA 1T3NA 4GKKF 2A3JA 1QSYA 3DM2A 1VQLS 2HZCA 4QW8A 1R8BA 2KJVA 2AYEA 4ECUA 4CH0S 4FNHA 4DL7A 1ZM9A 5LJ5Y 4TU8A 4M5DB 1S9GA 2ZNZA 5KFPA 3HHLA 3O3LA 2DNNA 5KFDA 4ECQA 1D9DA 3OXGA 4YDDB 1Y3KA 3OFGA 5KG7A 1QTMA 3E2EA 3M6UA 4DG1B 2NR0A 4ERDA 2DPJA 5HP1A 1X4EA 3QYYA 2ERRA 1VQKS 1KNZA 2VD3A 2ZBCA 4KO0B 1N4LA 3HHDA 4I68A 4DF4A 4QJVA 1N5YB 2WONB 5AE2A 4AXIA 2ILYA 2E1MC 2ROEA 3R27A 3W3SA 2K3IA 5E2QA 5ADZA 2QT7A 1U48A 1RT7A 5KT6A 4ECWA 3CCUS 1KLMB 1B7FA 4LF5F 4FXDA 3IS9A 4GO5X 1S1XA 2W9BB 3T6BA 2OPRA 2FGOA 2O01C 1RQ0A 1YJTA 3QIPB 4LSLB 2VC0A 4LF8F 1MMNA 2MQMA 3D2WA 2WOMA 2ZH5A 1EETB 5K14A 4C3KA 1URNA 3PX0A 4DV7F 3MM9A 5FIIA 1H2VZ 2CFXA 2GX8A 3CDBA 4G1QA 5KFWA 4ETZA 4R8UB 2GA7A 4NCGA 3DI6B 3VWSA 2MB0B 2QMWA 4MK9A 1GT8A 2ZHOA 4NYPA 2F8MA 3KLGA 2DR8A 1C1BA 2F1FA 2W4PA 4ATNA 1KFSA 3MAHA 2AJ1A 3MD3A 4DR1F 1NK7A 3RZAA 4OHWA 3DHWC 2K1RB 2KDOA 1DQ8A 2OPQB 2YKNB 3M2VA 3OTBA 2CQ2A 1MWZA 3IGVA 2MZSA 4TY9A 3J81Y 4DQQA 1U49A 3K8WA 5HBMB 4NLQA 2IVYA 3PW0A 1BQNA 2V8HA 2ZD1A 2DNRA 4ZP6A 4BWMA 3SFUA 2WBRA 3BQ1A 1PO6A 5KFLA 3H5XA 2FLLA 2N7YA 3MCSA 3SXLA 2XC9A 2DIUA 5M2UA 3VCDA 3F56A 1CVJA 5I42A 4DR7F 3TI0A 1GTEA 3M2RA 4TY8B 1R43A 5AXKA 2ZH7A 4WIIA 2FLPA