1RJJA

Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from arabidopsis thaliana
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
MATSGFKHLVVVKFKEDTKVDEILKGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKSSVVATP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords expressed protein
publication title Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 17
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rjjA00
4HH0A 4HI1A 1KQKA 2QLWA 3TRGA 5T7LA 1FVQA 1KVIA 2FIUA 1FESA 2LQBA 2RMLA 2FHMA 2XMTA 1Y9OA 5KAKA 1Q8LA 2GCFA 2XMVA 3IWLA 4U9RA 1TUVA 1N5QA 4YDXA 4ZOSA 4DN9A 2AP6A 3HHLB 2OD4A 2HQIA 3KG0A 4QOTA 3BF4A 3CJKB 2KKHA 2OAUA 2ROPA 2HFOA 4F67A 4OJHA 3BM7A 3BR8A 2ROGA 1SQEA 5B0GA 1MWYA 3QMQA 5F0UA 3UDCA 1X7VA 1FE0A 2AJ0A 5A6WA 4Q2MA 4NL5A 4EFAC 2LXFA 4ZA1A 4FNIA 4HH1A 1N5TA 1TL5A 2GV1A 4A4JA 2BYCA 2KYZA 3FRYA 4HI2A 4YEAA 3TNVA 5T7LB 1R6YA 2GGPB 2BUNA 1P6TA 2RILA 1YJRA 1XBWA 4FNHA 5A6PA 2K1RB 5B0DA 2W4PA 3VTIA 2HLTA 1V3ZA 2BJEA 3HHLC 2KT3A 3IWXA 2QYCA 2W4CA 3WDOA 2W4DA 1Q4RA 1LQ9A 3T9NA 5B0CA 3FMBA 3KKFA 1FE4A 3HDSA 3HFKA 4OJ3A 2N7YA 3HF5A 3GZ7A 2OMOA 3LGMA 4A46A 4Y2MA 1N5VA 2Q3PA 2ZDPA 4A48A 3DXSX 4NPOA 2GFFA 5B0BA 1YJTA 2N4DA 2VH7A 2OFGX 5B0FA 1IUJA 2OFHX 1Y3KA 2IYIA 2RU9A 2PD1A 1TR0A 2ACYA 5F0WA 5B0EA 1OSDA 1AFIA 3BB5A 3LGNA 1SI9A 2IYGA 2N4CA 2HIQA 2K7KA 3KNGA 2BJDA 1FD8A 1X8DA 2QLXA 1YJUA 2K2PA 3HX9A 3FGVA 1VQYA 2ASYA 1Y3JA 2RSQA 1AFJA 1URRA 1YG0A 2GA7A 4Y2IA 4DL0C 1CPZA 2XMUA 1VQSA 3E8OA 3F44A 4Y2KA 1ULRA 1K0VA 1CC8A 2ROEA 2L3MA 3I9ZA 1Q8BA 3HHLD 2AJ1A 5B09A 1JK9B 1X0PA 1YRXA 1GXTA 1OQ6A 1WD6A 2FTRA 1GXUA 2CRLA 2IFXA 2KT2A 1S6UA 2PGCA 1N5SA 2XMWA 3MCSA 1FEEA 2XMJA 4DPOA 1SB6A 1S6OA 2GGPA 2JDJA 2OKQA 2FB0A 1JWWA 1TZ0A 2K1RA 3KG1A 3MZIA 4OIXA 2LDIA 1U7LA 2XMKA 3BDEA 2QIFA 4HL9A 1OQ3A 1FVSA 1CC7A 3TOQA 1TL4A 2OD6A 2XMMA 2K7JA 2LQ9A 1APSA 3HHLA 5IXUA 1Q53A 4A47A 1AW0A 3CJKA 2GO8A 3BN7A 3K7RA 1OPZA 1YJVA 5B0AA 2BBEA 3LO3A 3QGPA 5B08A 1RJJA 4OJ1A 1KVJA 3BGUA 4OJGA 2VV5A 1W2IA 2HLUA 2OP5A 2HFNA 2ZDOA 1MWZA 1P8GA 4Q2LA 5K9FA 1Y0HA 2EW9A 3DCAA 1QUPA 2AW0A 2G9OA
chains in the Genus database with same CATH superfamily
1ZM9A 2AGPA 3E01B 1GK8A 3N6NA 2LYVA 2DHXA 2KM8C 1Q7LB 5I3PA 1FD2A 3CDUA 3H20A 3H5UA 3FFIB 1S9EA 4FKXA 3B54A 2P8IA 1N56A 3MM5A 2A18A 1S4EA 2CQCA 3AH6A 3D66A 5DRKA 2WTFA 4LSNB 5J1PA 5E3QA 2YKOA 1KLMB 2VG5A 1T0TV 5F8NA 2BQRA 5DG9A 4Z7YA 3ZZTA 2PMHA 2VOOA 4X4NA 3LGNA 2WRMA 1IKYB 4F2SA 2K2PA 2R7OA 4WP9A 2W25A 2ILZA 4I0WA 2G1HA 5D15A 3O1LA 4TY8B 1RHUB 4OX7A 1JK9B 1REVA 2FLOA 3MI7X 1GX6A 2O1PA 2QJ3A 4LR8A 1H74A 2LP4A 2E9RX 1S97A 3NGKA 3SXLA 3VGVA 4KTQA 4LVOP 5B0AA 5CHCB 3D5MA 1ROFA 4OI0A 2BDPA 2DNGA 1A9NB 3C8YA 2UVVA 2ATLA 2BE9B 3J7YU 1ZPWX 2MLYA 1MMNA 3PYFA 2ZBQA 1QAJA 2A10A 1SPBP 1IBLF 4H4OB 1EB0A 4CO5A 5F0UA 3LWLA 1WTBA 1Q95G 4EFAC 1WELA 1D1UA 3T41A 2Y1LB 3OJUA 3NGUA 2JEJA 2N3OA 3RU0A 3PR5B 1QTNB 1T3OA 1JIHA 1RT5B 1IJFB 2Q3PA 1ZTTA 1W7WA 3Q8VA 2VBXA 4RW9B 5KFJA 4I4BA 4Q7AA 1L3SA 2C3OA 2M3DA 2W7PA 3CWJA 3ENAA 1CPZA 2XNRA 3W1YC 4X65F 1XMBA 2CPHA 4I6WA 4JI0F 2GMJA 5BYSA 3G9CA 5FDLB 3RYLA 4NLSA 3RBXA 4X65J 1RABB 4JI0J 4EGLA 2C3MA 1WEZA 2Y3YA 4CRJA 4ED4A 2JOQA 4ANDA 3DLKA 1EETB 1G1XA 2FHOB 3MM8B 3TZZA 4F3OA 3DN9A 4TLQA 3M8WA 4CT8A 2EEYA 1S99A 3J7YI 5DDOC 4WP8A 3G4SS 3HD1A 2VDHA 2PE8A 1MMDA 3UNGC 4YY3F 2BANA 2H5IB 1SQEA 2EKNA 2DGSA 2DRBA 4YQWA 3KJFB 1EARA 4WYLA 3F41A 4LF4F 1M5PC 3FNNA 4I6YA 4X62F 4IRKA 2DNNA 4YY3J 1TV6B 4I7FB 4EBDA 5D0GA 2ZE2A 2GO9A 4RNHA 1P1TA 1DBDA 1AT1B 4X62J 1C1BB 5L9XA 5IT0A 4O4GB 3NGSA 4DX6A 4FP9A 5GMKa 2K7KA 3KUGA 5IT4A 3NAHA 3PM9A 2CDRB 3Q8QB 2GIQA 4NZ6A 1N34F 1F9HA 4N56A 4W90B 3O6QA 2QIFA 3KK3B 1LWCA 2NSBA 4RLEA 4DG1B 1N34J 1YX2A 1UVIA 4F4ZA 2G1DA 1C0UB 3RRKA 5LSOA 1FTRA 2GQ2A 5DDRC 1IXKA 2L08A 2JZ5A 3UDVA 2EFGA 3I82A 2KKHA 5KFLA 4E8UA 1ZPVA 2E66A 5IOLA 4CT9A 1UJ5A 2XULA 4DSKA 4X84A 3UVJA 4ANEA 3IS9B 4C97A 1RAIB 1CQNA 1WUUA 5J2NA 2QMXA 4B9MA 1WSVA 2HNDB 1H2VZ 3UPFA 4F4KA 4MFBB 5LM7E 1VJQA 3TX8A 4WYWA 1RLCL 3HX9A 2WW4A 5IT9Y 5AXKA 3PHEA 2VPWB 2BVZA 3SCIE 5ETTA 1N4LA 4CNYA 1GXUA 1HWJA 1CJKB 1NDKA 1N5SA 3OL8A 3BPDA 2V5HG 3M05A 2BQUA 2GGPA 3GV5B 1TZ0A 2C2EA 2HMIA 3HHLA 1GMVA 5DGAA 3MUVP 1IBCB 2EVZA 1IR0A 3BSNA 3HVTA 3PO5A 3VWSA 1FESA 1LOUA 5F8HA 2CQ2A 4B3MF 2JC0A 2AJ2A 2CQ0A 2JH3A 1TL7A 2A1BA 1J2VA 3UR3C 2PIIA 4KAIA 4WKYA 4TY9A 3FBBA 4B3MJ 1X5SA 1FFSB 3GJSB 3AJ1A 2OJ3A 3K5MA 4DV6F 3OTDA 2KVIA 3A8JA 5A6PA 2ZEJA 2FVSA 4WKRA 3EGWB 2LVWA 3N28A 4LJMA 4OJ3A 3CIZA 4NE9C 5EWEA 2E7XA 4DPTA 3QFWA 1YVFA 2J7UA 4DV5F 1H98A 1S49A 3FSXA 4B3OB 1HR0F 3AA8A 5A8WB 1F1BB 1RAAB 3I6PA 4DV5J 3EXYA 1TKTB 5LT5A 3Q8RB 1HR0J 4EO8A 3H8YA 1TL3B 3S8SA 3MEEB 1KTVA 3JB9k 4CLTA 3W2WA 3VCDA 3QNWB 2HHPA 2I2YA 5G0RB 1FXLA 1M1GA 4MKVA 1HWLA 1LFPA 4OYWA 4PCQA 1SC3B 2ZUGA 3DRPB 3PJ9A 2FY8A 4ID5A 4P72A 1LWXA 2BW7A 2OO4A 4DQSA 4CZCA 3LALA 2Q79A 2OHDA 2BR0A 1G6BA 2MZRA 3JYTB 9RUBA 4DLGA 2UXCF 1IQTA 2YPYA 5KT4A 4CH1A 4PPZA 4K4XA 3PNIA 3Q24A 3CC2S 1MSWD 3OLBA 2L9WA 5HSPA 2AYEA 2UXCJ 5CYMB 2XHCA 2JEGA 1YGYA 1JLGB 4RU2A 1O5JA 3JSYA 1S0VA 1YG0A 3HZEA 1WOOA 2YVSA 2AYGA 4AE5A 3IG1A 2AT1B 3QSYB 4XPEA 1QSLA 4RNMA 2NXCA 5HBMA 4ANCA 1VYAA 5CD4H 1FVSA 4WU3A 3P6YC 5A8KB 1AW0A 5GMEA 3TVZA 2GHWA 5K5MA 1Y00A 2VIHA 4LF6F 2WZ1A 4ZK7M 3IBWA 5ETMA 4OQJA 5CD4A 4LF8F 1K44A 4I2PB 1VHFA 3OSNA 4LF6J 4RJVA 3DDIA 3C6UA 1KSPA 2DGXA 4LF8J 2HPUA 2BRLA 4UZBA 3LOUA 2FJVA 1KDNA 5LJ3Y 2E5IA 3M9MB 2MSTA 3UCGA 3G8TA 1M1HA 3TJAA 4J9SA 3A4TA 1UVLA 1RBAA 1N0VC 4O44A 3H4BA 4DMZA 4QYZK 3U1NA 2DXEA 4RW4A 1BXNA 4DCOB 3SIPB 4U6PA 3NBPB 3AOCA 2MJUA 4WU2A 2BV3A 3V6JA 1DLOA 3K59A 3EVWA 3TW0A 1UKUA 3DFEA 3KNAA 3BDEA 3CXCR 4NASA 2CJYB 5IWAF 4YN3B 4DX7A 4NA2A 3QSIA 4K4TA 2W8LA 1Y0HA 4DV7F 4OZ5A 2V4JB 5IWAJ 4YOEA 5JVHQ 1B3TA 5E5NA 1N5QA 1S9FA 3BGRA 3ILIA 4TXSA 4DV7J 2Y9HA 4ERDA 1RTZA 3PYEA 4ZVTB 3OBIA 2R9LA 2ZD1B 2GC8A 3V6KA 1NH7A 4MT1A 1N5TA 4KGXB 2OPRA 4M5HA 4JV5F 4Z37A 3N5FA 4WE1A 4ZCLA 3UCUP 2HGMA 4BHQA 4DCJB 1UWBB 3D68A 4JV5J 2VFRA 3AFGA 2BJDA 4B17A 1V3SA 4UUWA 3VGSA 2XTJP 5A2QU 4QW9A 2JVOA 1O8BA 3Q86A 2CJQA 2C2OB 2YH0A 4IFYB 3HCXA 4P9SA 4WFXA 3DU5A 5KFVA 5AE1A 2DR9A 3CSKA 4OJGA 2KZZA 4DJBA 2EW9A 2ZWPA 1H2UX 2XC9A 1P8GA 3V6DA 1ZETA 1DJ0A 1HQUA 2Z2YB 3UQSA 1LV5A 2GJ2A 4FPRA 4ECYA 3UD5A 1F2HA 4KYZA 2ABYA 1DFDA 4F67A 1TK0A 2CNNB 3PIOQ 2ZHOA 2CAJA 4CTAA 1WACA 5E3AA 4DF4A 2MQ8A 2HFZA 2CPZA 1R43A 2NXEA 3AODA 4AL7A 2XQCA 3CEDA 4DZ6A 5H9FJ 2PD1A 3KK2A 1IKXA 5A8RB 5KOWA 1FD8A 2MDAA 1RT6B 3ZFVA 2WB4A 1MLAA 2ROEA 1X4DA 4PXEA 3TO8A 1URNA 3LANA 2JFDA 1TL1A 1H2TZ 1U47A 3HM9A 3NOCA 1WC0A 3LAKA 1D8YA 3GONA 2HNYA 2YWGA 2GMHA 3OXGA 2ALYB 2A2DA 5J1EB 4Q2LA 2DNLA 4BWJA 4IH6A 3FCVA 3LPEA 1SIZA 4LRCA 4CI0B 1RADB 4PAAA 3ISNC 3I0SB 3UO0A 1SC4B 2VA3A 3KMSA 4LQ9A 4RW6B 3PKMA 4P74A 3KLVA 2DEIA 3T9NA 4UOHA 4Y2MA 2J5AA 4ECQA 3SCLE 5C25B 1GH8A 3WZ0A 1ZA2B 5F8JA 2V8PA 2OSRA 1DY3A 1XN9A 2LEAA 4BC9A 1T02A 4Y6IA 1PJ5A 3BH6B 1SJ4P 3EZ5A 1XR5A 2CPEA 1NEEA 4I2QB 2FVQA 1JJHA 1SQFA 3TUIC 2MKSA 1MWQA 3IBCB 2LCWA 2WW8A 4C8ZA 1F0XA 1Z2ZA 2D3ZA 2YKAA 1AZSA 1Y5IB 4DQPA 2VONA 3TUJC 5T7LA 1WG4A 4DR7F 3W2VA 2CNLB 1YBTA 1UA0A 3I5CA 4M94A 4UY8T 3PY8A 3V5RA 2RT3A 4JI2F 5A6WA 4DR7J 4C8OA 3NGTA 1P9YA 3BKTA 2E1AA 4DPUA 4JI2J 2XSFA 5HLFB 2C2DA 4RU9A 1U6ZA 1WKLA 1WG1A 1SKSA 1F3FA 3KOAA 1IUJA 1RWMB 2YWWA 3BB5A 1FKOA 3BV8A 4ZJLA 2RU3A 4LR7A 1YJ9S 4M5NA 1SV5B 1U09A 3S6EA 5D3GB 5F9LA 1LXNA 3F73A 1NK0A 1FWKA 5A0YA 3SQGA 3MZIA 4K4ZA 1JLFA 2IBOA 4KIAA 3IAS9 2R42A 4QIFA 1RT5A 3Q8UA 4ZN1A 2GO8A 2P9GA 3QGPA 1S72S 5SUHA 4HHUA 5F8GA 5FLXY 4J37A 2NUUG 4FPIA 4F0HA 3D2WA 4EBEA 5GVQA 2EWHA 3NNCA 2EFOA 3ULHA 3VAHA 4TU8A 1W25A 5LSLA 2MQNA 3QIDA 2VODA 1UFKA 1HNIB 3KKFA 3TJ9A 1NK9A 4TLRA 1XWLA 3U7JA 4LVNP 2CQHA 3ILJA 2BA9A 2XWYA 3MPVA 3MM8A 1S12A 3PX0A 2IIHA 2XCPA 3KMQA 4R8UB 2LDYA 2B9WA 4G1QA 4EUVA 2HQGA 4DV2F 3E2EA 4OZ0A 3PFEA 4FZVA 5KG7A 1GXTA 4JI8F 3F56A 2P5VA 4DV2J 4JI3J 1Y10A 2COLA 3EVMA 3LP1A 3WC2A 4I7FA 4ED2A 2VQEJ 4JI8J 3PR4A 4RNOA 4DU7A 5KFSA 1YHQS 4DV3F 5D78A 4O4GA 3H5XA 4DX5A 4X4UA 1GT8A 1VCTA 3DLEA 2JLGA 4UTGA 4YB6A 4DV3J 4MIAA 1DQ8A 1VFJA 2D9OA 3A3PB 1ZOTA 3MHYA 2JEFA 3ITHB 1RAFB 2VG7A 2H3EB 4J5OA 5BYQA 3G71S 2QO3A 4F26A 1CQMA 3Q8SB 3KK3A 2XZTB 1VBKA 2OMOA 4A46A 4DG1A 5EN1A 4EI2A 1RTJB 3M32A 2Z30B 2IYIA 4RWXA 2J9DE 4LSZB 1VR6A 3DM2B 4K59A 3FGVA 2ASYA 2DGQA 3KJVA 2DJWA 1IKVA 2G0CA 1CLFA 3J81Y 5L1KA 4HEA9 5KOXA 2HVZA 2Q6CA 2JDJA 2W2PP 3QATA 2BOPA 2HW3A 4NZ0A 3IS9A 3OXFA 1J5OB 4DF8A 2CJAA 4UUXA 1Z2LA 4QZVB 5KT6A 2OEKA 1UVMA 1WHXA 1X4EA 3DMJB 2MHNA 2X51A 3HHDA 1N32F 1WKJA 1PG5B 1OO0B 4C6AA 5KT5A 1RP5A 3TA2A 3K8VA 1CJKA 2QFIA 4DSFA 5KFXA 4DN0A 1I51B 1N32J 2EPIA 2RUSA 3M8QB 4EO6A 2ZUAA 4X4SA 4LSLA 5A76A 2KJVA 4NXMF 2QC3A 1UAWA 2PDAA 2GFFA 4AL6A 1T9TA 2R8JA 3TA1A 4NXMJ 2KU7A 1S0MA 2AGQA 2V8GA 1BHNA 3T19A 3BKFA 1S76D 3GCWP 4ZPTR 1NSKL 2FTRA 2DT9A 2XNQA 1NB2A 2YKPA 2JLFA 4DI6A 4Q8EA 2YY3A 1SJ1A 2YTCA 4Y28C 2PN6A 3MMAB 2OP5A 5I42A 3QBCA 1HYSA 3DCAA 1VISA 3OHAA 4OZ2A 2RMLA 4DSJA 4B3OA 3JQKA 1YI2S 2ACMA 1DAXA 2WBRA 2XY5A 4PKDB 4PWDB 3BF4A 3IXQA 2B4UA 3MDFA 4X4RA 3ET6B 2PMZD 5C42B 4J9UE 3DGVA 2HS0A 1HD1A 4ATNA 2XSJB 3UNYA 1BY9A 3N5BA 1WI6A 2Z2MA 1LW0B 2DNMA 4IDKB 1X9MA 3HI9A 3ENVA 2GS8A 1S1UB 4IRDA 2JSXA 2HBZB 3CO9A 2RB7A 5KFGA 4CH7A 3JSMB 1I1GA 1XERA 2CZVC 1HFEL 3FC9A 3MPUB 1UPMB 2CFXA 1BLUA 4TU9A 2EC2A 1JLQB 2UV8G 4ZVQB 1QSSA 2F40A 1WD6A 4TKTA 2HWHA 3JYTA 3G6VA 2OPQB 1XJWB 2PA3A 4P6QA 5ETRA 1UZDA 2ZFHA 4GVBB 5HROB 1QTMA 5ETKA 2H5JB 5F8MA 1KVJA 3DU6A 1RUSA 4ITSA 1D0EA 4M5DB 5CYMA 5AT1B 3ADAC 2LQBA 3DDNA 4WFZA 1K47A 2PSZA 2CQPA 1N48A 4WJBA 3NS5A 4ELUA 2R3VA 3VQTA 1Y5NB 3BYPA 5E33A 3KLIB 1LQ9A 3ELHA 1H0HB 1FKPA 4G1PA 3I32A 3D1QA 2Z2LA 2QFJA 4JI4F 2PEHA 4YMEA 4FBTA 3NWRA 2VZ9A 5F9NA 5DDQC 2HFSA 4PWWA 4AXJA 4YHHF 5DO2A 3PX6A 5SZTA 2LA6A 2JJ4D 4N8NA 1FNOA 5D6GA 4YHHJ 4X4TA 2DR5A 1HL6A 1HBMB 4DV4F 1YJVA 4WWSA 2FPHX 3LO3A 1FK9B 4F0KA 3KLEA 4P10A 3MAHA 3D9BA 3H0PA 4I56A 4CP5A 2EFPA 2G9OA 4DV4J 1FTCA 1FWLA 1R31A 1IM6A 2IA0A 5KFTA 3UN3A 2RAQA 1G7CB 1RZMA 4K2XA 3CVKA 3RGIA 1X7VA 2PFDA 3K58A 3NBPA 1UA1A 4JYAF 3M6UA 5IM0B 1WORA 1S1XB 1X5TA 2DNQA 2E9ZA 3HF5A 4I6AA 2V50A 5IQ6A 4JYAJ 2M8HA 2QV6A 3GTYX 3R5BA 1IWAA 2L9NA 5EHHA 3ZZYA 4KC5A 3GFYA 5BXIA 4FKYA 3K8WA 5HJXA 4KH1B 6FD1A 4ZIWA 1ZZFA 3OTCA 2ZD1A 4KGMA 1JMTA 4KR0B 2FB0A 1M90T 4O0IA 2NS1B 1S79A 1W2BR 1RT1B 1X4AA 2OPSB 3BN7A 1YITS 2KXHA 2PA8D 2XHWA 4DS4A 1KVIA 2ZH5A 3THVA 2HZAA 1H6KX 2MQMA 1RDRA 2R2RA 4FN5A 3D6FB 4KSEB 3BBCA 4Y34A 1JLEB 2GV1A 2OH2A 3WHIA 2VFSA 3BREA 3A3OB 3FEYB 4NRUA 2HVEA 5I4MA 2CQDA 3MD1A 3FSYA 1VBXA 1FKAF 4ZVUB 3OL9A 2VH7A 1S9EB 3LP2A 5DLFA 2QA4S 3RJMB 4IR9A 4KV8A 4DDFA 3R5AA 3H4DA 4ZPDA 4BLGA 1SI9A 3HO1A 2YX4A 5G4DA 3MM5B 3NLCA 4J9VA 2HNZA 3EDQB 2LA4A 2RQMA 1ICEB 1WEYA 4KQZA 2UXBF 2VG5B 1NPRA 4MH8A 3Q22A 2XZDB 4JBCA 1ZYQA 2UXBJ 1VIXA 4J7CA 4DL6A 1APSA 5DZ6A 4QR1A 1N52B 3QO9A 2DO0A 4I69A 2CQ4A 1R6VA 5A8RA 1TUWA 2K06A 1TUVA 4KBIA 1R8CA 4ECTA 2CZ9A 2R2SA 4KT0C 3BR8A 2WVDA 1S1VA 1IJEB 5HMYA 2J0XA 3HK2A 3VTIA 5E3CA 2F8MA 4N7TA 3HDSA 1T9WA 2ZBRA 2QE5A 3PDNA 3RW6A 2H48B 3W3SA 1FXRA 3OQ2A 4N76A 1T03B 5J1EA 5U47A 2DITA 3LPYA 3FUYA 2CPDA 2X3GA 1SJQA 3GCXP 3JQMA 3QT5A 3VAGA 3R7NB 3QT7A 4DR4F 4CH0S 4RUAA 1S77D 3QIPA 3RBZA 4DR4J 3DLBA 4BS2A 3KG1A 3G6ES 2XMKA 4ED1A 1Q53A 1NDPA 2ZC3A 2HG4A 4USVA 2B51A 3DHXA 4NCAA 2CA9A 3TRGA 4C48A 4OZJA 2W9AA 3KG0A 3QRRA 1OJ4A 2IJFA 4ZITA 2HHQA 5BYRA 2KFYA 2WONA 3GSDA 4KFBA 3GFXA 5KT7A 1U49A 4DQIA 1FRLA 3VZHA 4ZP6A 1X60A 1U8SA 4F04B 3KUHA 2BANB 1D9DA 1GEHA 5H9FK 2B7CB 2KYXA 1AUSL 1XMQF 1N5YA 3CCES 3RBDA 5T41A 1N54B 3TUZC 3DDKA 3HHKA 2B7BB 1XMQJ 2UVRA 1JKHA 1WTFA 1X4HA 2XCAA 2EFNA 3M6VA 3PW4A 1VDHA 3GIJA 2AEJA 1H38A 5HLFA 2LLZA 1BWVA 1FX2A 5KG2A 1VJWA 3CJTA 3KHHA 3LTOA 4L73A 2FJXA 3AHPA 3TAPA 4BC7A 3BKUA 3IM8A 4O4RA 2E1CA 3M9OB 5D3GA 1WC5A 5B0GA 1ITPA 3FRZA 1FXDA 4RUBA 5JXSA 1NJXA 3CD7A 2FDNA 4YEAA 5CXTA 2K1RB 3CDWA 1UEKA 4V19X 3FMBA 2OI2A 4OYXA 5A2QY 4BBYA 1VC5A 4Q44A 3CCVS 3JAMU 4N41A 4OI3A 2LEBA 3W5XA 3VR1A 2DB1A 4DX8H 1U8WA 3TI0A 5CZXA 2UUCF 3FMWA 2ZZNA 2JNJA 5AXLA 4RUHA 5KFEA 4BDPA 2XB2D 3EM1A 4QIWD 3DRRA 2CZ4A 2UUCJ 1VQKS 1PYTA 2UVUA 3J7AN 3FZBA 2XO7A 2IY5B 2DNOA 5FD1A 3V4IB 3FBEA 3CDBA 5C5JA 3M1VA 5AJ3F 4ID8A 2AJFE 4CWBA 3HHLB 3LF0A 2MZTA 3OTEA 2G4BA 2RKIA 5AJ3J 3QMQA 3HVTB 3R7SB 2KG0A 1XIQA 3BH7B 1R6YA 4M5LA 2CJKA 4NYOA 1TL7B 1V3ZA 4F0MA 3RRHA 2VUGA 1HBOB 2IC3A 2R7RA 3PW5A 4GO7X 4JI1F 1FDDA 3GV7B 1I6JA 1B70B 4M5GA 4LBPA 2KRRA 4F4YA 2ADBA 3PO4A 5ETSA 3M8PA 4NLQA 3WIUA 2RSQA 4OI4A 4JI1J 2U2FA 4IO1A 1WKKA 4ZKAA 1CULA 3PACA 2IVFB 3S7RA 4FXDA 3MGJA 4KHMA 3W8GA 3R9LA 2DHHA 4DUYF 3OFGA 4ZVEA 3W63A 4C3LA 2YNHA 2B6AA 1S5ZA 4CLZA 2UUWA 3I0RB 5KG3A 1H72C 4DUYJ 4MJKA 1KONA 3DM2A 3W2WB 4PYAA 4DR6F 3R1HA 5HVGA 3OFHA 1HBUB 2AZ1A 1JLBA 4RKUC 4EZ6A 3O5TB 1KRPA 1HNZF 4NXNF 3I55S 1M5OC 5ETLA 2AIRB 3SSRA 3L95X 4DR6J 4TNOA 2KL8A 4ED8A 2BUNA 4GC7A 4FNHA 4ID5B 4U95A 2MQQA 4HKQA 4NCBA 2W4CA 2W4DA 2E44A 3UWTA 4NXNJ 3PRDA 3CCQS 2ZVSA 3CDAA 3FSIA 2J8AA 4WBFA 2YNGA 4K0KF 1KFDA 1YBAA 4USTA 1Y3KA 4PQUA 5M2PA 1SH3A 1X8DA 4K0KJ 2CVEA 3HFZB 2ZM6F 4FYVB 4I67A 2KXFA 3KG4A 1GXLA 3IR5B 3OD2A 3C15B 4X4QA 4U7UK 2HQCA 1RAHB 3CDEA 2ZM6J 3GIIA 4OYMA 3PYDA 4ECXA 4RNNA 1R27B 4HL9A 3BO2A 1V6HA 3TUPA 4FXWA 2GHVC 1UTAA 3EGVA 3IG1B 4NOHA 1NO8A 2MJNA 5KFKA 4YR2A 5LMNF 3SBMA 1B7FA 4F2RA 2C2NA 3X1LB 5HBMB 2OUGA 3DI6B 4IFVA 2RDJA 4W4MA 3GMGA 5LMNJ 2UU9F 2F9JA 3R2CJ 2Y1IA 3UN2A 2LXFA 2IMOA 2AEFA 5CH7B 1FNXH 1SJ3P 1YJRA 2UU9J 2X1GA 1Q7YT 1S10A 3HSJA 2DY1A 3P45B 3RAMA 4Q8FA 1UW4A 3AA9A 4IOCQ 3NGDA 4IG3B 3C6UB 4OYIA 3GJRB 1XNRF 1ZA1B 3EPGA 4GKKF 4F3MA 4EYHB 3EGNA 2HIQA 1BWEA 2BM0A 2QEXS 5L46A 3PJWA 4PR6A 2GJFA 4RWWA 5E3PA 1XNRJ 3HHLD 2EFQA 3ET6A 4GKKJ 3M2VA 3AB4B 5C42A 2WSFC 3EJMA 4DQQA 1XC9A 2VBZA 2V2VA 3PCOB 3LQVA 1I94F 1S9GB 4DQRA 2XSJA 4IDKA 1M1KT 2I9SA 3CJ5A 4RW4B 3BBBA 3CCMS 4CM0A 2A6OA 3BGUA 1I94J 3IR6B 3IP0A 4I64A 3JSMA 4X66F 3RB6A 1DLOB 3GPAA 2KTQA 1FVQA 2C2MB 5CYJA 4X4VA 1UVNA 2F4FA 2VBYA 4NX9A 2N82B 4USJC 1JLQA 2D41A 5K20B 2B9EA 1HQ2A 2Y0BB 2GVZB 2FGCA 4DR3F 4JB8B 2O66A 4CCHA 4H4KC 2OPQA 2XBPA 4AT1B 4U8VA 4O3SA 3BGRB 5DS7A 3HFKA 2YWEA 1NLKL 2NZ4A 3HULA 3EDRB 3MXHP 1IVZA 4ECWA 1ZZNA 2NREA 3V6HA 5B0FA 3M2RB 1EZZB 1BD6A 4P2MA 4ZPWR 2OPRB 4B3RF 3TYTA 3ZC4A 4ZLNA 5E2QA 3CD0A 4GMKA 1EHWA 2XS5A 4WE1B 1T8EA 2DH9A 4USMA 4B3RJ 1B0TA 1EP4B 1RAGB 1RLDA 4PG4A 2W9BA 2PFFB 3G86A 4L72B 1X9WA 3KLIA 1CC7A 4LFCF 2MQLA 2XYPB 4YP3A 2CQIA 4LFCJ 2ZNZA 5M2RA 2RRAA 3LH2S 3CJ4A 4LUBA 4A8SA 1IR2A 2GMLA 2HVHA 3R27A 1EIYB 3SYZA 3OT9A 4ETXA 3V6DB 1RB0A 2BQ3A 4K4UA 1TFWA 1NZAA 1R0CB 2DK2A 3ZZRA 4ES1A 4JI6F 3OPKA 1JJCB 4C8LA 2Y8YA 1FK9A 2CG4A 2NUHA 4CTAB 3OVSA 1KQGB 2Y8WA 1Y3JA 2CADA 4Z2XA 1NKBA 1T05A 4NLXA 1QD1A 2B3TB 1FRJA 1PKUA 3KK2B 1IKXB 2F1FA 3AJ2A 4WFAQ 3H42A 3QQCD 1MN7A 4F4AA 4ELVA 3CJKA 1KWMA 3PEJA 1TL1B 2C3YA 4ETZA 1IBMF 1QUPA 1V5IB 2EKYA 4HH0A 1DRZA 2R2UA 5HN0A 3H90A 4OX6A 4XK8C 5L1IA 1IBMJ 1T7PA 2AJQA 2G2OA 4OI6A 2CUYA 2J6TA 3C66A 1T94A 4NLGA 1FERA 3QLHA 1E6VA 4Y65A 3DC2A 3MEKA 2MHEA 3DRXA 3SFGA 2AWZA 2W24A 3D6HB 3FVYA 4YFUA 2NYHA 2Y1RI 2NR0A 1PYOB 2M8DB 3HKWA 3RB4A 3M8YA 2HRUA 2OFGX 5EX3A 3VALA 4C0BA 4ZCIA 4M5JA 3SDEB 3DLHA 5DETA 1U1MA 3T5JA 5EDWA 4WTOB 3PRBA 1SQGA 1AYEA 3FKBA 4NEZA 3JTOA 3C14A 2Z8QA 3R97A 2DGTA 3VAMA 1ZTWA 4WFBQ 1I5OB 4NLUA 2NZCA 4MYUA 3BEGB 3HHNB 4ZHRA 2JHEA 1DTQB 2VPZB 3TZYA 3T6JA 2UV8A 3MMCB 3IO1A 4N8OA 1AZSB 5T7LB 2HQDA 5CA5A 2VG6B 3W2VB 5CAAA 4QCLA 3W9IA 2QYCA 1GMUA 2BABA 3H7HB 2ZZMA 4WFNQ 2ZDPA 2ZJRQ 2V8VA 3AXMA 2RDDA 2VICA 2XGQA 3MCMA 3Q2SC 1G4CA 3VGUA 1UMJA 3IA0A 4C3MA 1NM2A 2G0IA 3BR9A 1AFJA 3K17A 1R0BG 3F44A 2WK4A 4C11B 1NJWA 3PZPA 2MTLA 3TEGA 1HW8A 1H3DA 3MTKA 4LFBF 5IZHA 1FKOB 4JP8A 1RWKB 2BEFA 3OVBA 3U27A 3UCZP 3RAXA 3P3DA 3MAAA 1NSPA 4A47A 3V81B 5J2PB 2C3PA 4FVMA 1YIJS 4LFBJ 1T03A 3EVOA 1RE1B 3BSOA 4ZP8A 5A0YB 2ZITA 3SQGB 3ZNUA 2R8HA 2K3IA 2W2MP 1JLFB 3N6MA 2YX1A 2V94A 1Q86T 1QAYA 3CCTA 3JTNA 5IQQA 3R8YA 1EJ7L 4FS2A 2L9DA 3DYAB 1FX4A 1FE0A 2AJ0A 1GTEA 3M6WA 2YKNA 4ECZA 1P6TA 4UW2A 1U4BA 3ENWA 2C2KB 4MKYA 1Y5LB 3LAMA 3ZZUA 1ZAWA 3L4BC 3J80Y 4MAKA 1XR7A 3HSZA 2ASJA 3A3NB 2J9DA 2MKHA 1VQOS 3I9ZA 3P49B 2EBEA 1RACB 2D3UA 1CBKA 1VBZA 2QZ8A 4ZLLA 5RUBA 2B4VA 1S0NA 5KT2A 2YWFA 4G1QB 2D3O1 3P5TL 3W65A 4ZLJA 1SKWA 4Z7CA 1WC6A 1PAEX 2ZVIA 1R0AB 4WPAA 1P9QC 1EQ0A 2HQ3A 1YJWS 3MPYA 4KPCA 1T95A 3KWMA 1LK7A 3GIMA 2AW0A 2J8SA 2JC1A 3LP1B 2QMUB 1RBLA 2GCFA 3SCJE 2AP6A 3THPA 5IV3A 4A8FA 2DGVA 3VZIA 7FDRA 2XWXA 2G2ZA 3DLEB 1YZ6A 4JI7F 2FD2A 3UD4P 3EZUA 2HLTA 3P5BP 3CC7S 3WDOA 1QJHA 4JI7J 2MEWA 4ER8A 2MY8A 2VG7B 4NRTA 3CB4A 2EC0A 3KHGA 2JRSA 3ETOA 3LW5C 4IQMA 1WJ9A 3NCRA 1N6QA 2CIMA 2BRKA 3RRGA 1HI8A 1RQ0A 2NSCA 1VQ9S 1UZHA 3M32B 4CQ1A 4ZLPA 1SL0A 2C2RA 4U7CA 5GAHU 3GU0A 4L6V3 4L75A 2FJEB 3MM6B 2VD3A 1RKIA 1FWPA 2F3JA 5LXRA 2K1RA 3KJVB 1JJ2R 4F3QA 1IKVB 4FF4A 1NPPA 4K4YA 2DPIA 2XMMA 1V3RA 3R5CA 5B08A 4PABA 1LWFB 1SIWB 3MPWA 3UE2A 3POTA 4ZVOB 2V8HA 4OHYA 3PX4A 1RWVB 2M0GB 4S0MA 2YQ0A 2IHR1 2YKMA 1NZ8A 2E5HA 4P7VA 4ZN3A 1RAOA 2VFTA 5LL6d 2QSFA 4NLYA 2ZH9A 2CJXB 4JUZA 1FJ7A 2ZKUA 4DSEA 2DNZA 2BJ7A 1FNMA 4USIA 3R1LA 3UDLA 2DGOA 3T5KA 1PAUB 1IN0A 3V4IA 5DM7Q 4K5SA 1Y4ZB 2FJBB 4FS1A 4M5MA 1LXJA 4PXCA 2OSQA 4LSLB 2I8EA 2CPIA 4Y2IA 1HPZA 4DV0F 2LKZA 4ILRA 1Q8KA 1UEUA 2XM3A 4QWEA 1SXLA 4ZPBA 5DDPC 2E5LF 5GAHI 4U96A 4DV0J 1WDTA 2BE2B 1HBOA 2J6SA 2E5LJ 2XS2A 4OJ1A 2QA2A 2MZJA 4DFKA 1B7YB 1C1CA 4FXVA 1TVRA 3SQOP 3W8PA 3M7VA 5I42B 1RCXB 1HYSB 4MYTA 1S7HA 4L74A 1HWUA 5J2MA 2W9CA 5FJ4A 4RNFA 3VQSA 3KLHB 3MMBB 2SXLA 2KVQE 4DL4A 4EBCA 4FYXB 4J9RA 2YWKA 1L3VA 4P7TA 3CD6S 1L3TA 1SH0A 3CO0P 2FY1A 3JTPA 2I0XA 3I0RA 1VQ6S 4URGA 2ATCB 3MM9B 1HBUA 2KJWA 3I31A 2RUGA 2HFUA 3W64A 1YRXA 1ZBTA 3FEXB 4IH7A 2M52A 1F5AA 5KFZA 5DM6Q 2M2BA 1PJ7A 3ILLA 4Q45A 1CG2A 1WNEA 2ADCA 3L7OA 2MKIA 1S59A 6AT1B 2BX6A 2Z4PA 1Q78A 4P75A 2QLWA 3BQ0A 1AA1B 3OXLA 1AUDA 3DRSA 4EU0A 3MD3A 2OD4A 3BS9A 3D3BJ 2XYGB 2VDIA 3K5LA 3C15A 3OV7A 3C19A 1ACMB 3LA0A 2RS8A 3UN5A 1TK5A 3B4DA 5HQMA 5L1LA 1CVJA 3BSCA 3M30B 3D0HE 3QZ8A 4WIQA 1YBUA 2JWNA 3NOGA 1BQNB 3KDNA 1AFIA 1PJ6A 3DI6A 2DIUA 3QT8A 4A8QA 4WIIA 1S1TA 2R7UA 3KLFA 1FKPB 5IV4A 4Y2KA 2QYGA 2DD8S 4P2SA 1F9EB 4KGKA 2HS3A 3MCNA 5F3TA 5GADU 1U2RA 4J9OA 4K4VA 5HATA 2B5JB 4QYZJ 2QTWA 3MAQA 4NA1A 5KFHA 4DU8A 4IG3A 5KFFA 1VQPS 2KN4A 1FJGF 4YR0A 3TVKA 4X2BA 4E0DA 5CCLA 2QGFB 3ZXWA 1WHWA 1N36F 1BMQB 1FJGJ 1TKZA 3CMES 3QYYA 3JAMY 3KLEB 4LIRA 1GAOA 2V63A 2BKOA 3PKYA 3OTOF 1N36J 4EK2A 1KOHA 2YBVA 4DCPB 1R8HA 1S9GA 4NLVA 4LBHA 3R5GA 1RAEB 4B02A 3OTOJ 2ZBPA 2N7YA 2APOA 2XO6A 2O5DA 3Q89A 3SSSA 3DHWC 1HHQA 1U26A 3H40A 2ZOGA 3NS6A 4RW7B 3KNGA 2HZVA 4CIOA 2LU2A 2RNEA 2XMUA 3CCJS 1OYDA 2WB1D 4MMOA 5C24A 2GVZA 4RUCA 4M8LA 2XI3A 3QGGA 1SL1A 2XMAA 3I5AA 2OKQA 2ZKTA 5GADI 1OPZA 1OY6A 1K1SA 2KT5A 4R5PA 2Q1LA 3ZO7A 3E3XA 1DURA 3M2RA 4FDFA 4LRDA 4HI1A 4ZP9A 1KQKA 5CABA 5KFBA 1BQXA 1TP7A 1WF1A 3MECB 5ETOA 1F9FA 3GILA 4IR1A 1OY8A 3PIPQ 2X3DA 4ZVPB 4ZVHA 2EK6A 2OPPA 4Y0FA 2FGOA 1EP4A 3U1LA 4N77A 2QA1A 5D4PA 3VF0B 1W26A 3IRWP 4WCEQ 3N6LA 4ZPCA 1NU4A 2RQCA 5KFUA 2GVDA 1WOSA 5F3ZA 1RU2A 5DLGA 3GZ7A 5KFDA 3Q2TC 1JB0C 2BM1A 2DVIA 2HGNA 1YJTA 2J6UA 3B6BA 2FZKB 3OR1A 3R6GB 3FJ2A 1JJ4A 4J9MA 3BN4A 1VK3A 3W7BA 1B99A 3D6MB 2DKOB 3D54A 2W7OA 3LP2B 2BOAA 3F0NA 1HI0P 4KV8B 2DPJA 2Y1JA 2HNZB 2KDOA 1L5UA 3HLUA 3ZTOA 1NDCA 1MMLA 4MKAA 3JQJA 2UUTA 3A8KA 2FVPA 1TKXA 2IRUA 1N88A 3G8SA 2LFVA 3BSAA 2FHKA 1YKWA 4KH0B 1VRTA 2K3KA 3MPDA 4FYYB 2NCKL 4P2FA 1C4AA 1HHSA 2ROPA 1T11A 3SZ2A 3PW7A 3BM7A 2KXNB 1QLNA 4KE5A 3EX7B 2WSEC 3QO9B 1CJVA 1CS4A 3G82B 4QWBA 1NHUA 1VK8A 1F5BA 3CE8A 1C4CA 1VQ7S 4A8KA 1BE4A 2J0WA 3HD2A 2BACA 4ECRA 2HWIA 4WK1A 1T9YA 1S1VB 2HWTA 3GQCA 3I5BA 1TR0A 4B3SF 2IJNA 5L8RC 2QLXA 1KBRA 4W98A 3GB0A 5HMZA 4B3SJ 3FQLA 1S57A 4D3GA 1FO1A 1Q16B 4BCAA 3W5YA 5K8OA 2IA6A 4URQU 2DR7A 1RHMB 2FZCB 2M4MA 4PXDA 1PBUA 3QIPB 1MWZA 2C42A 4O23A 3J7ZT 4TYAA 3MURP 3CJ3A 1R8PA 1OWXA 3R2DJ 4PG5A 3GFZA 2M9KA 1BQMA 3SDEA 2ASLA 3QZ7A 4DR1J 4LQ3A 2QMWA 4ENOA 2B4OA 2CWKA 5ADZA 4A4JA 3M2UB 1TUGB 4X4PA 4DL5A 2CWXA 3MCOA 4DPXA 2I38A 2B8QA 4AYBD 3J7A1 2YXLA 4C8MA 4DPYA 4FBUA 2WONB 4KFBB 2NXNA 4UY85 1DTQA 4B9SA 3RUBL 3PTWA 4Y2AA 2JL9A 3IRXA 3PRVA 3GIRA 4CLYA 1RTDA 3MMCA 5K8PA 2NPFA 3TAQA 3CCLS 3IBFB 1N5YB 1R8BA 1JXEA 4DR5F 2FLPA 4DEZA 2FUG9 2VG6A 2MGZA 2MXYA 1FI4A 3IN5A 2IM1A 2OTJS 4ES2A 2XYHB 4ZJQA 4DFMA 1JKHB 4HYKA 3L09A 4DR5J 1F2GA 4I1TA 5HK4A 1A0OB 2OEJA 1IKWB 4CLLA 1Q8LA 1NHKL 3H5YA 4YB1P 1RWWB 1HARA 3HVAA 4C11A 3J81U 2ROGA 3D3CJ 3FBCA 4ILMA 2HRTA 1FDNA 3QFHA 2RDIA 2BYCA 2A3JA 3MF5A 1FT8A 2VJVA 1FJEB 1R8AA 2M88A 1HD0A 2F8EX 2R7QA 3V81A 5J2PA 5I3UB 4DZDA 4DLEA 2HBQB 3DLGB 5F41A 3QWUA 4GKJF 3MWBA 3T5LA 4XAKA 1NH8A 4X4OA 3OTBA 1Q0NA 2X1AA 4HVZA 4F36A 3DYAA 2GNKA 4HTJA 3BJYA 1ZAXA 4GKJJ 1FEEA 1KN6A 4OYOA 1D09B 3PFOA 3EGZA 1NJIT 3TP2A 2RF2B 4K4SA 4K8RA 3MTJA 5JMNA 1OMSA 2R8GA 1EKRA 1TKDA 1HQEA 2YPZA 1LKZA 2J9CA 1UL3A 3KK1A 4IYQA 1LW2B 3DRRB 3CMAS 2OIHA 3WIVA 1RTIA 2WAQD 2CG8A 3ISZA 4DUTA 3UDCA 2I1RA 3HT0A 3A8EA 1YJNS 3M1VB 1EKSA 1R89A 4IKAA 3E51A 3Q8YA 2KI2A 4JI3F 1KD1T 3IWXA 1R0AA 2RKIB 2HFVA 3GR0A 2B56A 1SBRA 2NPIA 3DGPA 4GRSA 2VQEF 1N8RT 1SUQB 1S4FA 2HKEA 5F0WA 1XR6A 1IBLJ 3PG9A 4QR2A 4TYBA 1YJ7A 1C0TB 4LF2A 2GA7A 2NXUA 2IC3B 3JS9A 2HAIA 4QW8A 1KFSA 2D7SA 3DOMA 1V9OA 4U8YA 5DZ7A 4ZP7A 1ELOA 4LF5F 4CLUA 3M8PB 4MKBA 3UFCX 3GR1A 1PC5A 4CO1A 1TMMA 2YKQA 3AY0A 3GV8B 5KFAA 1F6TA 3QGHA 4LF5J 1GQEA 1RA6A 5K9FA 3Q83A 1CULB 4OL8A 1IQZA 1RTHA 3LUYA 3P4UB 3T3FA 3MEDA 2YWHA 4ICLA 2IM0A 3JXOA 2XZWA 4HR2A 2YNHB 2B6AB 1EQMA 3OFEA 3W62A 2LEPA 1NSAA 5ETQA 5KFYA 4M63A 5HANA 1R3NA 2WVEA 3MM6A 2WVBA 3GIKA 3HSDA 3PW0A 1S1WA 5IC6B 5B0DA 3K57A 3CD5A 1A7GE 1JLBB 1LWFA 2MLZA 3IGNA 4LRFA 3BDPA 1K73T 3ZZZA 4KRWA 2AX1A 2E7WA 4LF1A 1YK9A 2F4VF 4TQRA 3RTVA 2VHGA 4OLPA 4N5SA 4LF4J 2YNGB 4AD6A 1VC6A 2F4VJ 2VC0A 4PQUB 1FDAA 2CYYA 4OYBA 2FVCA 1JWWA 4OX8A 2AF6A 2DBBA 1OQ3A 3TOQA 1WC1A 2PO4A 4BWMA 3GLJA 3PV8A 3SMZA 2BBEA 3DRYA 1Q79A 2UXDF 1W2IA 3ZTPA 4YB5A 5MAOA 5H1SV 3HMJG 3VHQA 3H25A 4QR0A 4EEYA 4CO0A 5MLCV 4C4WA 2UXDJ 3BGLA 4ED5A 4CO3A 3PEHA 4GC6A 2IRYA 2VFVA 1OSCA 2VBWA 5LXYA 1NMEB 4FF3A 4MK8A 1HMVB 2RQKA 3NWGA 2B9YA 4IFVB 4XDCA 4ZDNA 5L38A 2GQCA 2M7SA 2BE2A 1NK8A 5KG0A 1O51A 1N0UA 3ETMA 4PQAA 3LP0A 1PGZA 2RQ4A 2ZJPQ 1DQAA 2C1EB 3GSIA 3CCRS 2A6MA 5B0EA 2E29A 2GJIA 4P73A 2XLIA 2AJ4A 1T9XA 1HNVA 3TANA 1H73A 1RHQB 3TWZA 4CLFA 3C16A 2PGCA 4EYIB 1JX4A 4RR5A 5EWFA 3TAMB 5D0EA 3KLHA 3MMBA 5HQ8A 2NXJA 1HIYA 5K14A 2FLNA 2KM8B 4QBUA 5F8IA 3CMQA 2ZNYA 1X0FA 3TR5A 3M2VB 1RT3A 2FC8A 5D0RA 4RBUA 2K8GA 2P6TA 3VAKA 2FJDB 1VQMS 2YH1A 3VGTA 4QU6A 3MM9A 2ZHBA 2V68A 1B64A 1NJYA 5D8HB 1NPKA 3GYGA 2DTJA 3KLGA 3AJDA 3QT6A 1RYSA 4DV1F 2WSCC 4GVLA 1MG7A 2MZSA 4OX9F 4CYUA 1HBNA 3I4PA 5D77A 1Q81T 3RG6A 3TJ8A 3OR2A 1NCLA 4DV1J 4ZMMA 4MK7A 4OX9J 3THTA 2HS4A 2AQ4A 2CPFA 2VB6A 2F5GA 1P27B 2POKA 4J9NA 3AD8C 4LMZA 4Q43A 4QU7A 1XQIA 1OPIA 4DV6J 1OQ6A 1YRTA 1SH2A 4OLOA 3G6YA 4FYDA 2YNFA 1XTZA 3M30A 4K4WA 2AEMA 2L41A 1BQNA 3PW2A 2W9BB 4YDDB 2RRBA 1K8AT 4NLWA 2MKKA 1F5CA 2RVJA 4KKOA 5KFQA 3VVUA 5L1JA 3AOBA 4XIUA 2FJAB 3FRYA 1Z4UA 3P96A 2IM2A 2EFVA 2HK2A 5E7OB 2B0GA 2B5JA 1C2PA 4I68A 4Q0BA 4A48A 2RJZA 4ZJOA 4TU7A 3Q8PB 4AFFA 1OSDA 5CYQA 1S6QA 2IYGA 5HVFA 3GFHA 1GMWD 3E8OA 5IFMA 4ZCKA 1NKEA 1TU0B 3H59A 3O44A 4HACA 1VLYA 3T9ZA 4C2MA 1Q82T 4KHPF 4OHVA 3ZZOA 4H4MA 4LF7F 1AROP 2H65B 2MY7A 2DXDA 2ERRA 3IMQJ 1T05B 2GAHC 4KHPJ 2HLUA 2B8PA 5HQLA 1S6PA 2IM3A 5J2QB 4LF7J 4B9LA 2ZOFA 4RW7A 3CCWA 4DUZF 3NS7B 2FHMA 3WX4A 4U9RA 4IQXA 3H2UB 1WC3A 2RIJA 2O67A 3CJKB 4LF9F 4CNZA 4RBTA 4PXBA 3MFIA 4DUZJ 4IOBA 4ZA1A 2D3OR 2AHOB 4DR2F 4LF9J 3UI3A 2DH8A 2D69A 1CJTA 1Q8IA 3CULA 2DIVA 2W4PA 3GJTB 3RB0A 1HI1A 2AMCB 2CQBA 3FEZA 4NPOA 4DR2J 3TEHB 4B3TF 3QLHB 2HIYA 2DCLA 1CJUB 3LGHA 4ECVA 4B9NA 1E6VB 6FDRA 3I87A 4K7QA 2V6AA 3MECA 4B3TJ 2E9TA 2L3MA 5DQHA 3WC0A 2IFXA 2KT2A 4FF1A 4P71A 2RHSB 3DOKB 1RAJA 1U0HA 3D0GE 3O8WA 2M5YA 2EG1A 1UCNA 1E6YA 3QAUA 2KO1A 1UVJA 4NLPA 2HBYB 2ZBIA 5D0HA 3K5NA 1UETA 3MR7A 2DY9A 3QJPA 1KHWA 1U25A 1RWPB 4B9TA 3QRQA 3C14B 3FCHA 4DN9A 2PEBA 3QRPA 2QLFB 1RYRA 2FYXA 1MWYA 4DL7A 4DSLA 2PI5A 5KFRA 4ZHRB 1ZH5A 1TMJA 2I5JB 4RBVA 2DH7A 3HHLC 4CO4A 2ALZA 2W8KA 3DOLB 3P8BB 2ZH6A 1NK4A 2R4FA 2C28A 3HSGA 4GO5X 3CPWR 1T9UA 5KFWA 4HTIA 2VC1A 3VVTA 1VRQC 4NMLA 2CRLA 3G82A 2YNIA 4NMXA 5T14A 3H5SA 2ZH3A 4WXOA 5IXUA 2AYMA 2VASA 1S0OA 5D4OA 2HFNA 3V4MA 1NRKA 4QIGA 1P1LA 4DL2A 5IS2A 5EGYA 5KAKA 5HAOA 4YDXA 3IWLA 1VMBA 3MAAB 1J5EF 2IPOB 4FVCA 2V9KA 4NLDA 1YQHA 1JQGA 3TZXA 2W1BA 4TN2A 2P9EA 1QVFR 1J5EJ 3O2IA 1X4CA 1WG5A 5JUMA 2A2CA 4RX6A 1Q4RA 2FHJD 3T5HA 1KQFB 5L9NA 1K0TA 5DGBA 3AQPA 3MOZA 3ONQA 3DXSX 8ATCB 1NUEA 2CPJA 1U6BA 1J27A 2YKNB 3IC1A 4IOAQ 1NBEB 3FCWA 2MLXA 2CNOB 1KR4A 3QAEA 4NYZA 1HWIA 1CC8A 1TAQA 2CKWA 1RT2A 2HHWA 2WOMA 2QL5B 4R25A 3RR8A 1S6UA 4CLSA 3EE3A 4NI2A 4ED6A 2DGWA 2JLEA 3M2UA 2WCXA 2GIFA 1GTHA 3MEGA 2ZOMA 4ECSA 1HA1A 2VJUA 1VRUA 1JLAB 3M4XA 1F3VA 2DCUB 2ZDOA 4DPWA 3SV3A 2BXJA 4RZRA 4B08A 2XEXA 1MW7A 5GAGU 3BO4A 3W9HA 2NQPA 1REGX 1QUVA 5GAEU 2HFOA 2R8IA 5E3RA 4Q5VA 3MFHA 3DLJA 3MM7A 4PUOA 2LQ8A 3KHLA 1G3OA 3H98A 3KFWX 2XS7A 3C3LA 2HYIB 3N79A 1WSRA 2CJBA 3T6BA 5HO4A 1IKWA 4USUA 2D74B 1MU2A 1NNDA 3J81j 2J7KA 4IG0A 1M0SA 1G2EA 3L7PA 1SVDA 1Q8BA 7AT1B 2CVIA 1QE1A 1X4GA 4KO0A 4QWDA 2X1BA 3M9NB 1QVGR 2IAJA 3IGVA 2H54B 3W61A 4AQYF 2RHQB 3HZGA 3IWNC 2W2NP 4E98A 1T9VA 3E01A 2IVYA 2Z2ZA 2G13A 1IWGA 1YDLA 1N6QB 1NB7A 3NY0A 4AQYJ 3IFEA 5I3UA 3FFIA 3DLGA 1XMOF 1QM9A 3SCKE 1VBYA 1HWKA 4M95A 5GAGI 1FA0A 2RE1A 2HQIA 4ZPVR 4LSNA 1WHYA 1XMOJ 2BW2A 4OJHA 5ETPA 3OL7A 3SI8A 5GAEI 1KLMA 1WI8A 3BYRA 3POTB 2GW8A 4FF2A 2G2YA 2KH9A 4ZCMA 5H9EJ 1IKYA 2RF2A 4C0HA 3ZZPA 2YKMB 5B0CA 5E0OA 5EX0A 4TY8A 2EXUA 3GJQB 4L76A 2N4DA 1YRUA 5KG5A 1FHTA 3M8RA 3EXCX 1WF0A 2MSSA 2VPYB 1LW2A 3VAJA 4LRBA 1Y7PA 4HT7A 3FQKA 2BJ8A 4USKA 2CQ3A 3FDSA 3BGFA 1F60B 2LMIA 4H4KA 4DHVA 2CQ1A 1TL4A 1HPZB 2LQ9A 2J7WA 2DXFA 3K7RA 4H4OA 3GYXB 4PPDA 3HFVA 3T1HF 2WBMA 1SUQA 3C6TB 1OS5A 2D9PA 4EZ9A 4IUFA 2EK1A 2IDLA 3CIMA 1C0TA 1KLNA 4XO0A 1SCJB 1PO6A 4B9VA 3MR2A 3T1HJ 2VFUA 1M5HA 3SSQA 3D28A 1OIAA 1UP1A 4WP3A 3ZTRA 2V0NA 4FNIA 4RW9A 1LWEB 2RILA 1C1CB 1TVRB 4OHZA 1A6LA 2JFKA 1RISA 4ED3A 4L3NA 1DHMA 4PYDA 5FDLA 5KFPA 4KGVB 5J2MB 2W9CB 3R6LB 2V4QA 4C9DA 4R0EA 4QWAA 2L48A 4QQBA 3KUEA 1DQ9A 5D4LA 2Q43A 2HRYA 5GMDA 1EETA 1U0SA 3TZWA 1EX8A 2DR8A 4USWA 5DJBA 4WZMA 3K2YA 2PT0A 2FLLA 1RJJA 8AT1B 1M5SA 3DKDA 1MROB 1Q5VA 3MR6A 4C98A 2V69A 4WF9Q 4G65A 1TV6A 4OI2A 1LNQA 2V9WA 3AD7C 2OMLA 1C1BA 5KG6A 4JV2A 3M8ZA 1JXLA 2Y0SD 2IVMA 3EYZA 3DRSB 3AOAA 4R0JA 4HDHA 2DO4A 1FEHA 1OY9A 2F63A 1WOPA 3R5JB 1RWOB 3QPIA 2WVCA 2NLWA 1VS3A 2HZCA 1GMWA 1YJUA 1VQ8S 1U45A 3NCPA 4DS5A 3GYNA 4LREA 2XMWA 1C0UA 1KEKA 4HHJA 1HMVA 2MKCA 3CTRA 1NHVA 1SKUB 5LMUF 3PYGA 1S1TB 3KDOA 2KHCA 1RA7A 3KLFB 3I56S 4NZ7A 1U1QA 5KFCA 4UOCA 4DSIA 3A13A 5LMUJ 3M8SA 3A8IA 4NLTA 4DOZA 1UEVA 2I6WA 4CLWA 3N01A 5JVGQ 3MR3A 3ILOA 2VA2A 2HNDA 1TL5A 1EAYC 4HI2A 4XPCA 4MFBA 1KC8T 3TAMA 3L3CA 4IRCA 1RU1A 1UW9A 1TKZB 4OYPA 2ILYA 2F9DA 3G8QA 3PJXA 1GNKA 2FQQB 1FCAA 5EWGA 3NAIA 3D4JA 4QPTA 5C2CA 1YTYA 2XGPA 4YS2A 3CCUS 2RH3A 4OIXA 1FDBA 3EWGA 3EUNA 5C24B 1O6XA 4O3OA 2OTLS 3O3LA 2AYBA 1U24A 1RWNB 1ZAVA 2F8HA 2HHUA 4R5PB 4V19J 4M5KA 1I3OB 5IC4B 2F7VA 4H54A 3I96A 1GFWB 3I9V9 4O0NA 4M5IA 2HHHF 2W2OP 2BJEA 5CQGA 2KT3A 5A8WA 4NLRA 3AT1B 3X3UA 2BKNA 3LGMA 4D3HA 1TKTA 2HHHJ 2W2QP 2OPPB 4P52A 4A8XA 3CJ2A 4HT5A 2ZH4A 1TL3A 1KS2A 3MEEA 4OI1A 2GVDB 1JNZB 4DL0C 5G0RA 2BZ2A 4M1KA 1K0VA 3NG8A 1LK5A 4V1Ak 2LECA 3DLLQ 3TQ1A 2KZMA 2AX0A 3OR1B 3DRPA 1D9AA 4NCGB 2BMBA 4JOUA 1WWHA 2ZH1A 2UP1A 3US5A 2XG8A 4YB7A 1MN9A 4MK9A 1M5VC 5C7PA 1XEZA 1LFWA 4UOGA 4K2JA 1SC1B 3ZTQA 4OZ3A 5EUHA 4WTYA 4F4WA 1IM4A 3NMRA 5CCMA 1UVKA 4PG6A 3OUYB 3CJQA 2FVRA 4USHA 5HP1B 1TKXB 3N4WA 1TFYA 9ATCB 4LIWA 3TNVA 1PSDA 1JLGA 1VRTB 2FHJA 1KQSR 2B43A 2KB2A 4CLKA 1U1RA 1RWXB 1HLWA 3DXBA 1CJVB 4DFJA 1CS4B 2DRDA 4ZIVA 5J2QA 2BJ1A 3ISND 3FZ2A 1HW9A 2ZHAA 3RZAA 2ZH7A 3L9ZA 2EG2A 1URRA 3QWPA 2PC6A 5JJBA 4WFYA 1ULRA 5A8KA 2ZH2A 2B9XA 4K50A 1U6FA 4MIWA 2Z58B 3K5OA 3BQ2A 1WEXA 3HKZD 4A8WA 2H4YB 4JI4J 4QYRA 4I2PA 2KG1A 1L3KA 2QG9B 4DBQA 2CQGA 1T3NA 1CJUA 3RBEA 1RK8A 3J80U 2ZC4A 3N9UC 3AD9C 2XMTA 5LOQA 2QLBB 3UDEA 3NNHA 1RT7B 2B4PA 1HKAA 3CW2C 3RB3A 3K89A 3DOKA 2O01C 2JX2A 3CJSA 4O3QA 4G1IA 3NKYA 1BQMB 3OW2R 2IDEA 3ZZ0A 3CJ0A 1RT4B 1JLCB 5THWA 3TX0A 2H4WB 4Y3CA 4L3KA 5E41A 1U1KA 2KFNA 5DG8A 3KHRA 4QIVA 3SFUA 5ETNA 1CSJA 5K8NA 1NXIA 3ENQA 3M6XA 1VQ5S 4DPOA 2V4JA 2W7AA 2I5JA 1VQLS 4EWTA 4RPFA 2E5JA 2E7VA 3IRXB 3W60A 1RGVA 5KG4A 1RTDB 3DOLA 2J0SD 2DISA 5AE3A 4JI5F 4O3PA 3T1AA 4ED7A 1SKRA 4RW8B 3CT9A 2MGZB 3CNQP 4JI5J 5L39A 2HGLA 3BGOP 4ES3A 3FK4A 1FFGB 2DNRA 1S48A 1UJ6A 2E1RA 2HHVA 1U1OA 3WQPA 1DTTB 3KJQB 1UWBA 5FIIA 3Q23A 4OHXA 1ZS6A 1UPPA 1RHJB 3NNAA 2BJ3A 3NCQA 2KFZA 1VLOA 1U1LA 1X9SA 1KOOA 2HHSA 2RU9A 2ACYA 4IFYA 1M5KC 4AUKA 3FBFA 1PCAA 4KGZB 4KJIA 3G2XA 1U02A 2V2KA 2LU1A 2H5EA 5IT9U 1FF2A 2R7TA 1VOMA 2MKYA 1VQNS 2HURA 2AGOA 3OHBA 4UT4A 2JEIA 4QOTA 2LQ5A 2NYIA 1REVB 1HQEB 2V34A 1RCOB 1VIOA 4KY3A 4J91A 4X64F 1VQ4S 2DYAA 3KK1B 3R3TA 4B9UA 2WHOA 5HL7Q 4PG7A 4C8YA 5KFMA 1RTIB 1RT6A 3WX8A 1JLAA 1N5VA 4X64J 1MNEA 2QSWA 2DGUA 4A8OA 2CNKB 2EI5A 1UFWA 2DEJA 1QY7A 2DNKA 5KFNA 5HMXA 1VQYA 2R7SA 4J9QA 3HP6A 3H2VE 4OMFG 3DGPB 1B0PA 3UD3P 3T1YF 4CDIA 1YLXA 2HQFA 2AD9A 2A0FB 3T1YJ 1V5VA 3U1MA 1DZ5A 3HJVA 4AXIA 1KNZA 1AXQA 1FRHA 3OFFA 1KKHA 4JV1A 3IR7B 5I3QA 3I0SA 3DNCA 2N7CA 3DOMB 1HHTP 4RW6A 1SL2A 5B7WA 1RWUA 2VPXB 2EBGA 2GHPA 3OSPA 3EPIA 5ETVA 4Q2MA 4KPYA 1NSQA 5M2UA 5C25A 2UZAA 3MOJB 1RTHB 2ZJQQ 3MEDB 4PWUA 2V2ZA 3IM9A 4ICLB 3Q0AA 4LR9A 2X1FA 2O3DA 4OZLA 4PG8A 3DLKB 4NEYA 3AB2B 4DFPA 1WHVA 2F65A 2V2QA 4I2QA 1RKJA 3W5ZA 1S1WB 1X5PA 2HVIA 2J0QD 4LFAF 4FYWB 3D0IE 2ASDA 2Z57B 4OFZA 3G6XA 4LFAJ 3GP9A 3D1OA 1H7XA 4OYZA 3RW7A 3CC4S 1B0VA 3BBFA 3D1HA 1Z1ZA 2ZE2B 4PRFA 3UR0A 3R5DA 4HLBA 4OZNA 3OL6A 1X4BA 3QJJA 2HAFA 3HHEA 4UQTA 4U67Q 1TELA 2X7IA 3G96A 4F50A 2P9CA 3AAWB 2CPXA 1D8ZA 3D67A 4E2FB 2FZGB 5F8LA 1XBWA 3BQ1A 3OLAA 1SV5A 3MUTP 4WXWA 1LWCB 2QLJB 3EZOA 1KTQA 3HT3A 2V67A 4N47A 3C6TA 2XLJA 2XLKA 4XDDA 4ECUA 4MTPA 4F7VA 2DHSA 2JVRA 3MMJA 5BR8F 3LP0B 1L3UA 3BZQA 1LEOA 4O3NA 1FRIA 3N0VA 2VKRA 4HDGA 1LWEA 5BR8J 1U1PA 4OHWA 2FC9A 1HNVB 2DNYA 3UVJB 5KT3A 3VV2B 5HMWA 3C16B 5J2NB 1NK5A 2DR6A 1SC6A 4UQGA 4C8KA 2J76E 3H2LA 2YX7A 1ZM4A 5K14B 1HNIA 5DQIA 4ELTA 4F25A 2E1MC 1RT3B 3A1YG 2VOPA 3K0JA 2P6SA 2KYZA 5H9EK 1Q5YA 2GGPB 3GWCA 4R8UA 3WBZA 3B78A 3NGRA 3CUNA 1TAUA 2R8KA 2HMIB 4QJVA 4WZQA 4TVAB 3KLGB 1MROA 1QAXA 3PHTA 4NYPA 2W01A 3U02A 1PC4A 3HPOA 5K8MA 4P2XA 4CYUB 2RD5C 2OEMA 1HBNB 2CPYA 1UWAA 1WC4A 2FJWA 3MR5A 2C22A 3OR2B 4O3RA 3MCSA 2LQJA 4ALZA 3GG1A 2PMWA 2HHXA 2DHGA 4LRAA 1NK6A 4KHRA 3VAFA 2ZZTA 1YSJA 3BPSP 1U7LA 4F8RA 3EICA 2K7JA 5D4NA 5DG7A 2YQ3A 2R7XA 4OYAA 3PXGa 3ZNJ1 3ITHA 2FIUA 1KHVA 2YNFB 4NWBA 1U48A 4ZPAA 3PVXA 3CCZA 4Y2CA 2MYFA 3BO3A 1YZ7A 4DWIA 1RTJA 2AKWB 4NL5A 1TQLA 1TTHB 3B82A 2R2TA 5CZVA 3LWMA 5KTQA 3MUMP 3OVAA 3ICLA 4IO9Q 4KKOB 2VF3A 1PIEA 2Q66A 1NKCA 1D9FA 3GE9A 3B8HA 3HXMA 3CCSS 3NXZA 2H1YA 4QIEA 3W9JA 1K1QA 1HNZJ 4CLPA 3I4HX 4G6VB 4Q0BB 5KFOA 3TARA 1X0PA 1J5OA 3AXKA 4WK3A 1R7IA 2VU5A 5CYQB 3SEOA 1S6QB 4C3KA 4TQSA 1X31C 2LDIA 3S1TA 3CF5Q 5HJYA 3DMJA 2HBRB 4MIBA 4OV1A 3CGIA 4HACB 2YQ1A 2P2CB 1FRXA 3R7BB 1U2FA 2AZ3A 8RUCA 2MKJA 4JV0A 1CEZA 3QJLA 1Q1KA 3M8QA 3TVYA 4H4MB 1FJCA 4ZOSA 2H51B 2VKZG 4W92B 1U2CA 4C7QA 1X4FA 5KFIA 3RR7A 1X5OA 4J9PA 3JSRA 3B4MA 1S6PB 3G87A 5KG1A 3NEKA 5C2GA 1VI7A 1XK8A 3KYLA 1FE4A 1JXVA 4AL5A 1RSCA 1D3WA 4LT6A 2GIRA 2M70A 2U1AA 3ZTSA 3K5PA 5HVHA 4J9KA 4NLOA 3HJFA 1B4SA 1CJTB 4QPXA 4QWCA 1KP6A 3W66A 1VQSA 1UJ4A 4UZCA 5DQGA 2PI4A 3TQEA 2AJ1A 1RI7A 3MMAA 4OZ1A 1XNQF 1FRKA 2HK3A 2R7WA 2MZ1A 4PEOA 2XMJA 1RHRB 1SB6A 2V4RA 3OJSA 2DNPA 1NDLA 3S01A 1WF2A 2V8DA 1XNQJ 2QA4G 4PWDA 2E1PA 2DHAA 2C3UA 4K5RA 2H9ZA 1JNRB 4A8MP 2UUBF 1PILA 3KXDA 1U0HB 4O44B 3TA0A 2XY6A 5AXMA 2QL7B 2UUAF 4KB7A 2XY7A 1E6YB 2UUBJ 1LW0A 4ZVSB 2MQOA 2GAGC 4F4XA 2OAUA 4ED0A 1S1UA 4ZVGA 4LBIA 1RHKB 1DARA 2RS2A 2UUAJ 4HH1A 3VAIA 3A12A 1O0PA 2CJ9A 3UW1A 4F02A 4J9LA 4NCGA 4PZVA 2QT7A 2G0JA 4EMDA 2MB0B 4X66J 5B0BA 3L7UA 2BJ9A 2HVDA 3C2PA 2QX0A 3GG0A 1QAIA 1VC0A 1WDDA 2IRXA 5HROA 4GVBA 2LXIA 1PBAA 3OUYA 4DR3J 2QN6B 4RO0A 5HP1A 4UF4A 3NL0A 3V2UC 1VHIA 3EMTA 3JSBA 4M5DA 1S6OA 4ZVFA 3NMAA 1K9MT 2ZBCA 2UVWA 2OGUA 4HHHA 2HEKA 4URSA 2MQPA 4DXLA 2VV5A 3QGIA 3C46A 2YNIB 1VGYA 1BGXT 1H7WA 2IJRA 4UOFA 2XI2A 2HSEB 7FD1A 2RRNA 5BJRA 1NJZA 2AV5A 1HNXF 2MZQA 1YWXA 5AXNA 5FLXU 1N33F 2DRAA 1PYSB 3SV4A 2GZOA 2OELA 3HVRA 3J7Z5 1HNXJ 3AQOA 1N33J 3NP5A 1BC6A 2IMWP 2OFHX 1HQUB 1QSYA 1QDUB 2N4CA 1NK7A 2E5GA 2VQFF 5LSRA 1RT7A 1HNWF 1NAQA 1HBMA 1FRMA 5B09A 1SJFA 1S7IA 4CM2A 2BE7D 4DR1F 2MPUA 4XTTA 2Q6BA 3CJ8A 2VQFJ 1RXOB 1HNWJ 4JI6J 4J90A 4ZS6A 3D7SB 4A8YA 3HVWA 4RL1A 3RAQA 4CO2A 2N3LA 5LJ5Y 2VL1A 2ZWOA 1RT2B 4C8NA 2WOMB 2Z56B 2KHDA 1ZM2A 1RT4A 4DL3A 1JLCA 3KJNB 4NI2B 1U1NA 5J1NA 2IBKA 2J9EA 2CDQA 4ZVRB 5IM0A 1Y9OA 4YR3A 2XMVA 1BUXA 1IR1A 3MEGB 1S1XA 1VRUB 1GX5A 2LXUA 3NRBA 2GQQA 2BKPA 4Y00A 2D1CA 2QL9B 4IH5A 2WVFA 3KTQA 2R7VA 5AE2A 4OV6A 1UFLA 2MMYA 2HNYB 1KVKA 1AB8A 1TK8A 4U7UD 3D6TB 2C2ZB 1IBKF 4NA3A 4C0OC 2ZH8A 2QRRA 2CXEA 3MM7B 3CJRA 4RW8A 4PUOB 1SJRA 1ZM3A 1FFWB 1IBKJ 1RBOB 4G3IA 1RT1A 2OPSA 2HHTA 4YUDA 2OLWA 2GX8A 2Z0GA 1DTTA 1MU2B 2KRBA 4IG0B 2OD6A 1Y11A 5HI7A 1QE1B 4ILLA 4KO0B 1OYEA 2DNHA 1JLEA 2IAJB 2AU0A 5ITHA 3IAM9
chains in the Genus database with same CATH topology
1ZM9A 2D9PA 4EZ9A 4IUFA 2EK1A 2Z4PA 1FTCA 1Q78A 2QLWA 3BQ0A 1R31A 2AGPA 3CIMA 1C0TA 3E01B 3OXLA 1AUDA 3DRSA 4EU0A 2IA0A 5KFTA 3N6NA 1KLNA 4XO0A 2LYVA 2DHXA 3MD3A 2KM8C 1PO6A 4B9VA 3MR2A 1Q7LB 2OD4A 3BS9A 2VFUA 1M5HA 1G7CB 4K2XA 5I3PA 3CVKA 3SSQA 1FD2A 3D28A 3CDUA 1OIAA 3K5LA 1X7VA 3H20A 3H5UA 3K58A 1UP1A 3FFIB 2V0NA 4FNIA 3OV7A 3NBPA 1S9EA 1UA1A 4RW9A 4JYAF 1LWEB 2RILA 3M6UA 1N56A 5IM0B 2RS8A 1C1CB 1TVRB 3MM5A 1TK5A 2A18A 4OHZA 2CQCA 3AH6A 3B4DA 1A6LA 1S1XB 5DRKA 4LSNB 5J1PA 2WTFA 1X5TA 2DNQA 5L1LA 2E9ZA 1CVJA 3BSCA 3HF5A 3M30B 4I6AA 3D0HE 3QZ8A 5E3QA 5IQ6A 2JFKA 2YKOA 1KLMB 1RISA 2M8HA 2QV6A 2VG5A 4ED3A 5F8NA 2BQRA 2JWNA 3R5BA 5DG9A 4L3NA 1BQNB 1DHMA 5FDLA 3ZZTA 2PMHA 2VOOA 4X4NA 5KFPA 1AFIA 2L9NA 3LGNA 5J2MB 2W9CB 5EHHA 3DI6A 2DIUA 2WRMA 1IKYB 4A8QA 3ZZYA 4F2SA 4WIIA 2K2PA 2V4QA 4C9DA 1S1TA 4KC5A 2R7UA 4R0EA 3KLFA 4QWAA 2R7OA 3GFYA 2L48A 2W25A 4QQBA 2ILZA 1FKPB 4I0WA 4Y2KA 3K8WA 3O1LA 6FD1A 1DQ9A 5D4LA 4TY8B 2Q43A 1ZZFA 1JK9B 3OTCA 4OX7A 1REVA 2DD8S 2FLOA 2ZD1A 4P2SA 3MI7X 1GX6A 2O1PA 2HRYA 4KGKA 4KGMA 1JMTA 2HS3A 1EETA 2E9RX 4KR0B 2FB0A 5F3TA 1M90T 1S97A 2DR8A 5GADU 4O0IA 2NS1B 1U2RA 4J9OA 1S79A 5DJBA 1W2BR 3NGKA 4WZMA 3K2YA 3SXLA 4K4VA 1RT1B 4KTQA 4LVOP 2B5JB 1X4AA 2OPSB 2PT0A 4QYZJ 3BN7A 5B0AA 5CHCB 2FLLA 1YITS 3MAQA 1RJJA 3D5MA 1ROFA 4NA1A 4OI0A 2KXHA 2PA8D 1M5SA 5KFHA 2BDPA 2XHWA 2DNGA 4IG3A 1MROB 3MR6A 5KFFA 1VQPS 2KN4A 4C98A 1FJGF 1A9NB 4YR0A 3C8YA 3TVKA 2UVVA 4X2BA 2ATLA 4DS4A 4E0DA 5CCLA 3J7YU 1ZPWX 1MMNA 1WHWA 1KVIA 2ZH5A 3THVA 4WF9Q 1QAJA 1TV6A 2A10A 1H6KX 1N36F 4OI2A 2MQMA 1RDRA 1IBLF 2R2RA 4H4OB 4FN5A 4CO5A 1TKZA 2V9WA 3CMES 3QYYA 4KSEB 4Y34A 3JAMY 3KLEB 5F0UA 1JLEB 1GAOA 2OMLA 4LIRA 1C1BA 3LWLA 1WTBA 5KG6A 4JV2A 4EFAC 3PKYA 3OTOF 1WELA 1D1UA 1JXLA 2Y0SD 2GV1A 1KOHA 2IVMA 3EYZA 2OH2A 3OJUA 2VFSA 3BREA 2JEJA 2N3OA 1R8HA 3RU0A 3FEYB 4NRUA 1S9GA 3DRSB 4NLVA 3PR5B 4R0JA 5I4MA 4HDHA 2DO4A 1FEHA 2CQDA 3MD1A 1T3OA 1JIHA 4B02A 2N7YA 3FSYA 1RT5B 2APOA 1IJFB 2O5DA 2Q3PA 1VBXA 3SSSA 1FKAF 3OL9A 1ZTTA 2VH7A 3DHWC 3QPIA 1S9EB 3LP2A 1U26A 3H40A 5DLFA 2QA4S 2VBXA 4IR9A 2ZOGA 4RW9B 5KFJA 4KV8A 4I4BA 4Q7AA 2NLWA 3R5AA 4DDFA 1L3SA 2C3OA 3NS6A 4ZPDA 3H4DA 1VS3A 1SI9A 2HZCA 2M3DA 4RW7B 3HO1A 2YX4A 3KNGA 5G4DA 3MM5B 3NLCA 2W7PA 1YJUA 3CWJA 1VQ8S 2HNZA 2LA4A 4CIOA 2LU2A 2RNEA 2RQMA 1CPZA 2XMUA 1WEYA 4KQZA 3CCJS 2UXBF 2WB1D 4MMOA 2XNRA 5C24A 4X65F 1U45A 3NCPA 2VG5B 1XMBA 2CPHA 4DS5A 3GYNA 4I6WA 4JI0F 4RUCA 4MH8A 2GMJA 4M8LA 5BYSA 2XMWA 3Q22A 1C0UA 2XI3A 5FDLB 1KEKA 3G9CA 4HHJA 1HMVA 3QGGA 1SL1A 3RYLA 2MKCA 4JBCA 4NLSA 3CTRA 1NHVA 3I5AA 1ZYQA 2OKQA 5LMUF 1VIXA 2ZKTA 1S1TB 2KHCA 1RA7A 3KLFB 3I56S 4NZ7A 5GADI 1U1QA 5KFCA 4DL6A 1APSA 4UOCA 1OPZA 4EGLA 4DSIA 1K1SA 2KT5A 4QR1A 2C3MA 1WEZA 4R5PA 2JOQA 2Q1LA 1N52B 3DLKA 3E3XA 1DURA 3QO9A 2DO0A 1EETB 4I69A 3M8SA 2CQ4A 4NLTA 4DOZA 1G1XA 2FHOB 3MM8B 3M2RA 4F3OA 3DN9A 4HI1A 4TLQA 4ZP9A 1KQKA 4CT8A 5A8RA 5KFBA 1BQXA 1UEVA 1TP7A 1S99A 1WF1A 3J7YI 5DDOC 1TUVA 3MECB 4KBIA 1R8CA 3G4SS 2PE8A 1F9FA 4ECTA 3GILA 1MMDA 3UNGC 3N01A 4IR1A 2R2SA 4YY3F 5JVGQ 4KT0C 2BANA 3BR8A 3MR3A 1SQEA 3PIPQ 2DGSA 1S1VA 2DRBA 4YQWA 1IJEB 4WYLA 5HMYA 2VA2A 3F41A 4LF4F 2HNDA 4ZVHA 2EK6A 2OPPA 1TL5A 1M5PC 2J0XA 4Y0FA 2FGOA 3FNNA 1EP4A 4HI2A 3U1LA 4I6YA 4N77A 4X62F 4XPCA 4IRKA 2QA1A 3HK2A 5D4PA 4MFBA 3VF0B 2DNNA 3IRWP 1KC8T 1TV6B 3TAMA 3N6LA 4WCEQ 4I7FB 3VTIA 4ZPCA 5E3CA 1NU4A 3L3CA 2RQCA 5KFUA 2F8MA 4EBDA 4IRCA 2ZE2A 5F3ZA 3HDSA 2GO9A 1TKZB 4RNHA 3GZ7A 5DLGA 5KFDA 3Q2TC 1P1TA 2QE5A 1DBDA 1JB0C 2BM1A 2ILYA 3PDNA 2HGNA 2DVIA 3RW6A 3W3SA 1FXRA 1C1BB 5L9XA 1YJTA 2J6UA 3OQ2A 4N76A 1T03B 5J1EA 5U47A 2F9DA 3G8QA 5IT0A 4O4GB 2DITA 3LPYA 2CPDA 2X3GA 3PJXA 4FP9A 1SJQA 5GMKa 3OR1A 1GNKA 2K7KA 1JJ4A 3FJ2A 3VAGA 5IT4A 4J9MA 1FCAA 5EWGA 4DR4F 3NAIA 3NAHA 4CH0S 3BN4A 1VK3A 3PM9A 4QPTA 3W7BA 4RUAA 3Q8QB 1S77D 3D54A 1YTYA 2W7OA 3QIPA 2XGPA 2GIQA 3LP2B 1HI0P 4NZ6A 4KV8B 1N34F 4N56A 4W90B 3DLBA 3CCUS 2RH3A 4BS2A 3KG1A 4OIXA 2DPJA 3O6QA 2Y1JA 2HNZB 2KDOA 3G6ES 1L5UA 2XMKA 3HLUA 2QIFA 4ED1A 3KK3B 1LWCA 1FDBA 2NSBA 3EUNA 1Q53A 1MMLA 4RLEA 4DG1B 5C24B 4MKAA 2ZC3A 1UVIA 4F4ZA 2HG4A 2G1DA 1C0UB 2B51A 2UUTA 4O3OA 3RRKA 3DHXA 5LSOA 1TKXA 2FVPA 1FTRA 4NCAA 2IRUA 1N88A 2GQ2A 5DDRC 3G8SA 3TRGA 1IXKA 3BSAA 2OTLS 2FHKA 3O3LA 2L08A 2AYBA 1VRTA 4OZJA 2W9AA 2JZ5A 2K3KA 1U24A 2EFGA 3I82A 3KG0A 1ZAVA 1C4AA 2F8HA 1HHSA 2KKHA 2HHUA 2ROPA 3SZ2A 3PW7A 2IJFA 3BM7A 5KFLA 2KXNB 4R5PB 2HHQA 1QLNA 4KE5A 4V19J 5BYRA 2KFYA 3EX7B 2WONA 2WSEC 3QO9B 3GSDA 4KFBA 4E8UA 1ZPVA 2E66A 2F7VA 3GFXA 4H54A 5KT7A 3I96A 3I9V9 4QWBA 1NHUA 1U49A 4DQIA 2HHHF 1VK8A 4CT9A 1FRLA 1UJ5A 3VZHA 1F5BA 2XULA 4ZP6A 2BJEA 4DSKA 5CQGA 2KT3A 3CE8A 4X84A 1C4CA 1VQ7S 5A8WA 4NLRA 4A8KA 1U8SA 2J0WA 3IS9B 2BACA 4C97A 3X3UA 3LGMA 2BANB 4ECRA 1D9DA 4D3HA 1TKTA 2HWIA 1CQNA 4WK1A 2B7CB 1S1VB 5J2NA 2QMXA 2HWTA 2KYXA 4B9MA 2HNDB 1H2VZ 3GQCA 3UPFA 2OPPB 3I5BA 1TR0A 4B3SF 4A8XA 3CJ2A 4HT5A 2IJNA 1XMQF 2ZH4A 1N5YA 3CCES 1TL3A 4MFBB 5L8RC 1KS2A 3RBDA 4F4KA 5T41A 3MEEA 1N54B 3TX8A 4OI1A 2QLXA 3TUZC 4WYWA 3HX9A 1JNZB 3DDKA 3GB0A 5IT9Y 4DL0C 5G0RA 2BZ2A 4M1KA 1K0VA 5HMZA 5AXKA 3PHEA 3FQLA 2VPWB 3HHKA 4D3GA 2B7BB 2BVZA 3SCIE 3NG8A 1FO1A 1Q16B 4BCAA 2UVRA 1JKHA 1WTFA 1N4LA 1X4HA 4CNYA 2XCAA 1LK5A 1GXUA 1HWJA 1N5SA 2LECA 5K8OA 2EFNA 3OL8A 3TQ1A 3M6VA 3DLLQ 3PW4A 2KZMA 2IA6A 2AX0A 2V5HG 3M05A 3OR1B 3DRPA 2GGPA 4URQU 1D9AA 3GV5B 2BQUA 2DR7A 4NCGB 4JOUA 3GIJA 1TZ0A 2C2EA 1WWHA 2ZH1A 2UP1A 1H38A 3US5A 2M4MA 5HLFA 2HMIA 2LLZA 2XG8A 3HHLA 4PXDA 4YB7A 5KG2A 1VJWA 4MK9A 1M5VC 5DGAA 3KHHA 3MUVP 1XEZA 2EVZA 3QIPB 1IR0A 1MWZA 3BSNA 2C42A 1LFWA 3HVTA 4O23A 3J7ZT 3AHPA 2FJXA 3TAPA 4TYAA 3MURP 3CJ3A 4BC7A 1R8PA 1OWXA 3PO5A 4PG5A 3VWSA 1FESA 1LOUA 5EUHA 3GFZA 4WTYA 2M9KA 5F8HA 2CQ2A 4O4RA 4F4WA 1IM4A 1BQMA 2JC0A 4B3MF 3NMRA 2E1CA 2CQ0A 2JH3A 3SDEA 2ASLA 5CCMA 3QZ7A 3M9OB 1UVKA 2A1BA 1J2VA 4LQ3A 2QMWA 4PG6A 3UR3C 3OUYB 2B4OA 2PIIA 4KAIA 5D3GA 4WKYA 5ADZA 4TY9A 2FVRA 5B0GA 3FRZA 1FXDA 4USHA 5HP1B 5JXSA 1NJXA 1TKXB 3N4WA 3CD7A 1X5SA 1TFYA 4A4JA 2FDNA 4YEAA 3M2UB 3AJ1A 4LIWA 3TNVA 4X4PA 3K5MA 4DV6F 2OJ3A 3OTDA 2KVIA 1PSDA 4DL5A 1JLGA 5CXTA 5A6PA 1VRTB 2K1RB 2FHJA 2FVSA 2I38A 3CDWA 4V19X 3EGWB 4WKRA 2LVWA 3N28A 4AYBD 1KQSR 3FMBA 4LJMA 3J7A1 2B43A 2KB2A 4OJ3A 5A2QY 3CIZA 4BBYA 1VC5A 4C8MA 1U1RA 5EWEA 4Q44A 2E7XA 4FBUA 3CCVS 2WONB 3DXBA 4KFBB 4DFJA 1YVFA 4N41A 2J7UA 4DV5F 5J2QA 4UY85 3ISND 1H98A 3FZ2A 1DTQA 1S49A 4OI3A 4B9SA 1HW9A 3FSXA 2ZHAA 2LEBA 4B3OB 1HR0F 3RZAA 2ZH7A 3AA8A 5A8WB 2EG2A 4Y2AA 1URRA 3VR1A 2DB1A 3QWPA 2JL9A 2PC6A 3I6PA 4DX8H 3IRXA 5JJBA 3EXYA 1ULRA 4WFYA 5A8KA 1TKTB 5LT5A 1RTDA 3MMCA 5CZXA 3Q8RB 2ZH2A 3TI0A 2B9XA 5K8PA 2UUCF 3FMWA 2NPFA 3TAQA 4K50A 1U6FA 4MIWA 2ZZNA 5AXLA 4RUHA 4EO8A 5KFEA 4BDPA 3CCLS 3H8YA 1N5YB 1TL3B 1R8BA 1JXEA 3K5OA 3BQ2A 1WEXA 4DR5F 2FLPA 4DEZA 2FUG9 3S8SA 2VG6A 3MEEB 2XB2D 1KTVA 4QIWD 3JB9k 3HKZD 3DRRA 3W2WA 4A8WA 2CZ4A 2MGZA 3VCDA 2HHPA 2MXYA 1VQKS 2I2YA 5G0RB 2UVUA 3IN5A 3FZBA 2IM1A 2OTJS 4ES2A 4QYRA 1FXLA 2XO7A 4I2PA