4KHPF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4khpF00
2UU9F 4DR3F 1N34F 4DV6F 2E5LF 1LOUA 4DUYF 4LFCF 2UUCF 1IJFB 2UXDF 4DV2F 3OTOF 5AJ3F 4DR1F 4JI1F 1B64A 1N36F 2BXJA 1HR0F 4JI0F 4X62F 4B3SF 4AQYF 4LF6F 4DV3F 1FJGF 1XMOF 1N32F 5LMUF 1N33F 4GKJF 2HHHF 4YY3F 1G1XA 1CQNA 3ZZPA 4DR5F 4JV5F 1QJHA 1IBMF 4DR4F 1XMQF 4JI8F 4X64F 4JI7F 4LF8F 1HNWF 4K0KF 4JI6F 4B3TF 2VQEF 4JI5F 2UUAF 4DR6F 2YY3A 1CQMA 4DV0F 4X66F 4LFBF 4OX9F 1F60B 4B3RF 3T1YF 1VMBA 1J5EF 1XNQF 2B7CB 4NXNF 4B3MF 1HNZF 4DV1F 2UXBF 4DUZF 1IJEB 2KJVA 2BVZA 4YHHF 1I94F 2UXCF 4NXMF 4DR7F 2B7BB 4GKKF 4JI4F 4DV4F 5IWAF 1FKAF 4DV5F 4LF9F 4LF5F 4JYAF 1IBKF 3T1HF 4KHPF 2RJZA 4DR2F 1HNXF 4LF4F 1RISA 2UUBF 2VQFF 1GH8A 2F4VF 4LF7F 1XNRF 2KJWA 4JI3F 2J5AA 1IBLF 4DV7F 2ZM6F 4JI2F 4X65F 5LMNF 3R3TA 5BR8F 1G7CB 4LFAF
chains in the Genus database with same CATH superfamily
2MZTA 1L3KA 5E0OA 1WI6A 3BH7B 1R89A 4DL3A 3W3SA 3OQ2A 4N56A 1KLMB 3KJFB 2X1AA 1HA1A 3BEGB 2AP6A 3SDEA 5A0YB 2CQDA 2OPQA 3QGIA 1K0TA 3CCMS 1VQMS 2H51B 4UF4A 1Z2ZA 4QIWD 5J1PA 1NK5A 4XIUA 4QYZJ 3A3PB 3FUYA 1P6TA 1U4BA 2NSCA 4YMEA 2JEJA 2DNYA 1HYSB 3HVTB 2IM3A 4N77A 2BXJA 2BR0A 1FDDA 1S1VB 4DDFA 4YDDB 1AXQA 1S6UA 2HQ3A 3SCKE 3PW7A 1RGVA 1WOSA 1NRKA 1YJVA 3M2VA 2J0XA 2UP1A 2ZBIA 4YP3A 1FJGF 1YX2A 2E44A 1PAUB 1RU2A 4EU0A 4ZMMA 1KONA 3CDEA 1RHKB 1RE1B 2HFNA 4TKTA 1R8HA 2X3DA 4ZVRB 4FS1A 3C16A 1XIQA 4ILMA 3G96A 2HHHF 2FLOA 3BZQA 2VJUA 3I4PA 3MUTP 4CT8A 2HLTA 2XMJA 3G8QA 5A76A 3ZO7A 2JSXA 2BQ3A 4FBTA 5IV4A 3CIMA 3LP0B 3CCZA 4NXMJ 3JSYA 1FX4A 2YKNA 1YJTA 2ZUGA 4J9MA 1TUGB 3VHQA 2KFNA 4ANCA 3GYXB 4E98A 4F0MA 4DLGA 1NEEA 2LQBA 3GV7B 2UVRA 1MMDA 4Q0BB 4GKKJ 5DDRC 1CJTA 1LW2B 3NOGA 3BKTA 4L3NA 1N54B 3ITHA 2RS2A 2YX7A 2HSEB 2Y1JA 4RW8B 2KB2A 4L72B 1SJFA 1T7PA 3ENQA 3HZGA 2XMAA 3KFWX 2VA2A 2IM0A 3TAMB 4ETXA 2XQCA 3QATA 3QT7A 3I82A 2LDIA 2E1AA 1I6JA 2EFOA 4B3RF 2ILZA 3P49B 2HS0A 2VQFJ 3I87A 4OI2A 3G2XA 4PQUB 3OR2A 3T6BA 1C1BB 2AF6A 5C25A 5DQIA 4ZVGA 2QA4G 1WI8A 3D3CJ 3C2PA 2VOPA 1ZYQA 1GTHA 1NBEB 2DTJA 3NGKA 4KC5A 1P1LA 2E5JA 5F9NA 1NH8A 3BREA 3IBFB 3MD1A 3A3OB 2W8KA 1I94F 1HI0P 2DRBA 4NI2A 2HAIA 2DCLA 2K1RB 4DR7F 2R7XA 1JLGA 1YG0A 2DNGA 4HL9A 5IZHA 2GHVC 4ZVOB 1SJQA 3I5BA 3W5XA 4C11B 1L5UA 3UR3C 1KOOA 2CPEA 4UZCA 2IAJA 4IH6A 4XO0A 4GKJJ 4ZP8A 4IFYA 2PMHA 4NYZA 4W98A 4QIFA 1S10A 3ETOA 1F5AA 1Q5YA 5E3AA 2EK1A 4JUZA 1Y3KA 3B6BA 1F3VA 2GFFA 3GWCA 3TAMA 1QLNA 4QWDA 4G1PA 4QW9A 2YH1A 1QAIA 1X0PA 2EBEA 2O66A 3HD2A 4DOZA 2GW8A 4ED5A 1S9EA 2QT7A 2LFVA 1SQGA 2W2QP 3UFCX 2RDDA 5KFEA 3RR8A 4LF7F 3FZBA 3SSQA 1S77D 2UZAA 3E3XA 2WVDA 1FD8A 5A8RB 5C24B 2FVQA 3AOCA 4DV7F 3V6JA 2RHQB 3T1HF 4C9DA 3K57A 3ZZOA 3QAEA 4WFBQ 2DY1A 2KG0A 1MN9A 5JMNA 3V4IA 5A8KB 1MMLA 4ZVSB 1RAOA 3VZIA 3BB5A 3VTIA 3JAMY 5KFPA 3RB4A 3ONQA 2G4BA 4CLZA 3THPA 3G6YA 3HP6A 4DUTA 1HARA 2RAQA 3MEGB 4RNMA 5F3ZA 1O6XA 2MXYA 4JV2A 4DSJA 3UDVA 4B9LA 1SQEA 1SH2A 1T02A 3VGUA 3DGVA 3PTWA 4NA1A 2WTFA 1S49A 3HJVA 3QFHA 3W9HA 4AD6A 2QC3A 4PWUA 2W9BA 3V81B 4ECZA 1FI4A 2C2DA 1Q0NA 2B8PA 1WHWA 1Y7PA 3MD3A 4WP8A 1IKXB 2VL1A 2HVZA 2VG5A 3WIVA 2ADCA 2Q79A 5D8HB 2Y1RI 4M5MA 1D0EA 5KFOA 1MWZA 5BXIA 1O0PA 5LSRA 4C8KA 1JLCA 1VHFA 2OPRB 3N6LA 3NBPA 1FX2A 2JFDA 3OFGA 5KFSA 4NLDA 1FD2A 3DM2B 5CAAA 3L7PA 5CYJA 1REVA 4RUAA 5D0GA 2L41A 1TAUA 4HACA 4NLOA 4RL1A 4WZQA 1TP7A 1IVZA 3FRYA 4YN3B 1LXJA 2KRRA 2F9JA 4UQTA 3I0SA 4CM2A 1REVB 2K06A 4YR0A 1G1XA 3IC1A 3BKFA 3ZZPA 3TAPA 4ID5B 4NLQA 2NCKL 3LAKA 5FDLB 3KLHA 4BWMA 1N5TA 5AE2A 2OPSB 1JJ4A 1HNWF 4C2MA 4OIXA 4YS2A 2DH9A 2DIUA 2OFHX 1LV5A 5F8GA 1BGXT 4I6AA 2JLFA 1QM9A 2Z57B 1RT6A 1XN9A 2OD4A 4NLVA 5E33A 1Z1ZA 2GO9A 5B08A 3KJVA 2QGFB 4ZP7A 1FK9B 3OL9A 3D2WA 4F50A 3SMZA 1UVLA 1SJ4P 5KFTA 1WTBA 3AHPA 3QGHA 1DLOA 3JTOA 3SFGA 1IQTA 4M5HA 1WWHA 3MM5B 1CJKA 3THVA 3RB0A 3IG1B 4A8FA 1A0OB 2NXNA 3AXKA 3KLGA 4K4UA 3MPVA 2DPIA 4USKA 2E29A 4IG0A 4DR5J 3FCVA 1RAJA 2EW9A 3FK4A 2HIQA 1XERA 4YB5A 3RBEA 3NMAA 1IXKA 2IBOA 2VC1A 1S79A 3CC4S 2FJXA 4ECVA 1OY6A 1MU2A 2M4MA 4IH5A 4XK8C 3P96A 1DRZA 1ZAVA 1NKEA 1FE0A 3MR3A 4CLLA 2VIHA 4P9SA 2V2KA 4DQSA 2CQ4A 5KFCA 2AW0A 2N4CA 1H7XA 4CO0A 3FRZA 5HQLA 4B9TA 2CVIA 5KFGA 4DCPB 1NK9A 1RA7A 2DGSA 1KHVA 3U27A 3SFUA 1TKDA 4A8SA 3QWUA 3TX0A 4WFYA 2QSWA 1F0XA 1NJIT 2HNDB 2M7SA 3QZ8A 4KH1B 5CZXA 3GJTB 4IQMA 1W2IA 4M5NA 2MZ1A 4ZCKA 1H73A 1UFLA 4FYDA 3M8ZA 2V8VA 2DNMA 5HL7Q 4J5OA 3DHXA 1EX8A 3UDLA 2ZBCA 2QJ3A 2OEJA 4F8RA 2FIUA 2QE5A 3GFXA 5GAEI 2XZDB 4RO0A 3V4MA 3PVXA 2JNJA 4Y2AA 3SV3A 1DZ5A 3DRSA 1KQFB 5KFUA 3QNWB 4EO6A 3R3TA 2XY7A 1P27B 4ZLLA 4M94A 3H59A 1RTDB 5D4PA 2XLJA 1RABB 3CO9A 4P72A 1LK7A 2CNKB 2HZCA 1VQSA 1S1XA 4NLGA 2GQ2A 1T05A 2DNKA 2J9CA 4A8XA 3NNHA 2CQHA 1VGYA 4B08A 4ECWA 1RKJA 4RW7B 4CLTA 4OL8A 1EQMA 5B7WA 2BZ2A 2WHOA 1GT8A 2ZD1A 4M8LA 3F44A 1HNZJ 1DFDA 4A8YA 2ZJRQ 2XO6A 1FXDA 2Q3PA 4RU9A 1V6HA 3GQCA 1K73T 1TVRB 2ZZTA 3FBBA 4J9UE 4OFZA 4A4JA 1FJ7A 4HTJA 3N6MA 2ATCB 1AZSA 5K8NA 4A46A 1BLUA 4M5JA 5J1NA 4KBIA 4X84A 1BMQB 3RRKA 1EZZB 1RWNB 4LF6F 1TKXA 3EICA 2MSSA 5AT1B 3NCRA 3L09A 1D8ZA 3MEEA 2Z2MA 3H0PA 3BN7A 2C3UA 3ILIA 4Y34A 2VBYA 3S01A 3OJUA 2VPZB 2DGXA 4G6VB 1XMQF 2CJYB 3PFEA 1VI7A 2VPWB 1G3OA 2PEHA 4R8UA 2HS4A 5D15A 5IT4A 3TARA 1SL2A 4NEZA 4D3GA 1S6OA 3C6TB 2IMOA 5L9NA 2FB0A 4I6WA 4KR0B 4ZJLA 1VBZA 4W90B 3FKBA 5KG4A 4AT1B 1UFWA 2E66A 3OLAA 3H4DA 4B17A 4ED3A 1SL1A 2VV5A 2OELA 2YQ1A 4IG3B 2QFJA 1CQMA 3FGVA 2E5GA 2LU2A 4KH0B 5EGYA 1KN6A 1WG5A 2FLLA 2MKSA 5IOLA 2ROGA 5GAGU 2GJFA 2YNIA 4P71A 2RF2B 2YH0A 5LL6d 1RHJB 1F9EB 4WFZA 1YITS 1H3DA 4CO2A 1F5CA 3MEDA 2RRNA 2FZGB 5DLGA 3IRXB 1H72C 4UOGA 5E7OB 1JLAB 1T9UA 4USHA 3WC2A 2OD6A 2W9CB 4CLWA 4NASA 4H54A 4NL5A 3TQEA 4U9RA 1UW4A 5FIIA 2V34A 4M5KA 2LQ9A 5D4OA 4NMXA 1AW0A 2UUTA 4C0OC 1TUWA 4JYAJ 1KVKA 2GQQA 4UUWA 1NH7A 1S1UB 1RKIA 2VF3A 3KHRA 4WFNQ 4AL6A 2A6OA 3KUHA 1ITPA 2BA9A 3B4MA 2GMJA 2YKMA 4MT1A 5ETOA 3S6EA 3HMJG 2J6TA 2MHEA 1NDLA 3VAJA 1U1RA 3AJ2A 3PKYA 1Z4UA 2F40A 1UWBB 2CJBA 1W7WA 3QPIA 5D0HA 2DITA 1X8DA 3MPUB 5A8KA 5BJRA 3EGZA 3GCWP 4U8VA 2XYGB 4ZCMA 3TR5A 2BE9B 3EVMA 3N9UC 5DQHA 2XY6A 4U7CA 1S1WA 2V9KA 5KG0A 4LREA 1RYSA 3EGVA 1ZA2B 5C5JA 4B3OB 2V4JA 1Y0HA 1S0VA 2YNFB 3OXGA 1CEZA 3VAGA 1T0TV 2ZVSA 4OI4A 2J5AA 3KUGA 3SYZA 3T9ZA 3RUBL 1Q7LB 1I51B 4RW9A 9RUBA 4P6QA 4RW6A 1TL5A 3K5NA 1URRA 1TTHB 3O3LA 1SUQA 3W1YC 2KM8B 3WC0A 2AV5A 1VK3A 5HSPA 3KOAA 2IPOB 4DG1A 1U0HB 4C3MA 1RBOB 4CLSA 4CT9A 3EVWA 3OHAA 3KJNB 2HWIA 3SBMA 2RQ4A 2EPIA 1FEEA 2JH3A 5KFWA 3FSYA 1JKHB 1QSSA 1NNDA 1HBUB 1O51A 2J0SD 1HQ2A 1N36J 2D3O1 2V69A 2AD9A 2ATLA 1ZOTA 1VQ4S 4LJMA 2F4FA 4ZN1A 3H2UB 3MGJA 1IR2A 1KLMA 1ZPVA 4NI2B 1FNOA 1TZ0A 2FHJA 3NS6A 3P5BP 3EZ5A 1TV6A 4OV1A 5CH7B 2AZ1A 5IQ6A 3DFEA 1N36F 5M2UA 2ZEJA 1U6ZA 2KU7A 3QLHB 1BD6A 4EBEA 2FLPA 3BSNA 3MM7A 1KOHA 3O1LA 4OYIA 2HK3A 3B78A 2YBVA 4PUOB 2V67A 4OLOA 3FQKA 2O1PA 1EAYC 3R5BA 4WIIA 4DCOB 3AB4B 4ZPVR 5GMDA 5HVFA 4DFMA 1WHVA 4OMFG 4J91A 1RWMB 2JEIA 1MW7A 1LNQA 4DG1B 3RG6A 4AXJA 1YWXA 2V2QA 3K89A 3DYAB 4FVCA 4K5RA 4EYIB 2UU9J 1JLFA 3FEZA 3R7NB 2VASA 4ALZA 4X4UA 4DV3J 2B0GA 2CWXA 4S0MA 5F8HA 2ZHBA 3Q8QB 3OUYA 3DNCA 2P8IA 1SI9A 2CXEA 1RT5A 3CD5A 5L1KA 1FRMA 3DRPB 3R8YA 2GS8A 1S1WB 5A0YA 3OFHA 4IG0B 1IKYB 1LXNA 3LTOA 2O3DA 4LRAA 4USTA 2MB0B 1KKHA 2E1RA 4JI5F 4TYAA 3ZTPA 3MR2A 1RWVB 1UMJA 1WC6A 2LXIA 3D0HE 2Q6CA 3R5AA 4I1TA 4LSLA 4OZ0A 3F41A 1X4GA 3PXGa 4CTAA 4PG4A 3DRRA 5C42B 2Z58B 4HI1A 2WAQD 4ECRA 4OI6A 5HLFA 1UVKA 4U96A 3EWGA 1U6BA 4QBUA 1M5VC 3ZNUA 2HHTA 2V9WA 2I1RA 2GA7A 1DQ8A 2IA0A 2ZH2A 4PPZA 1N8RT 2J76E 2QSFA 3Q8RB 1SBRA 1YSJA 1N6QB 1BQXA 2WBMA 5F0WA 5G0RA 2XNRA 3WQPA 2BW2A 5KT5A 2PT0A 4MMOA 1EARA 2G0IA 2M8DB 3M1VA 2OHDA 2CPXA 1U25A 5K8OA 1YJ9S 1Q82T 1R27B 3W2VB 1PO6A 3DI6B 2WOMA 2Y9HA 4KO0B 2VBZA 5H9FJ 1F5BA 4FZVA 2DH8A 4DX5A 2ZM6J 1TKXB 3G71S 1UP1A 4DV5J 1MG7A 3QGGA 3HVAA 1E6VA 2OP5A 3ZZRA 4CO5A 1HL6A 4NPOA 1VLOA 4WPAA 4CZCA 2H54B 4ATNA 2CFXA 1EQ0A 1Q8KA 3HHLD 2YWWA 3HSJA 2IRXA 4DU8A 5EX0A 4G1QB 1VK8A 4YB1P 4HH1A 5ETKA 5J2NA 4UTGA 4ES1A 3JYTA 3CJRA 1B7YB 1R8BA 3IBCB 1IKVB 1KD1T 4I69A 2P9CA 4DLEA 2FVSA 2Q66A 1R7IA 2GAGC 3C16B 2VG5B 4F4KA 5AXKA 3EPIA 1CULB 3KG4A 4QCLA 2Z2YB 3I5CA 2MQNA 2XTJP 1KFSA 3TQ1A 1PIEA 1BXNA 3Q83A 4IO1A 1FDNA 2JEFA 2IBKA 3OT9A 2R2RA 3T1HJ 1AFJA 4KV8A 1FEHA 3KLEA 4X2BA 3D4JA 4TU7A 4JI2F 4GRSA 4MKVA 3BBBA 1PJ6A 3B8HA 1M5HA 2XYHB 3DLJA 3MR7A 2KH9A 2YQ3A 3RRGA 1OQ6A 3S1TA 1OJ4A 3VGVA 1RXOB 1TL3B 2FJBB 3EUNA 2D69A 2VUGA 3MCMA 2HS3A 2V68A 4ED7A 1QVGR 3Q89A 1AZSB 4U7UD 2MZSA 3GONA 3LP0A 3DRYA 3DLBA 1QVFR 2EFVA 2DK2A 4LF5J 3N01A 4IRKA 1RWWB 4NE9C 4I2QB 2R7RA 4YUDA 2GVDA 3I31A 1Y3JA 4C98A 2AJQA 1FRXA 2LLZA 1W25A 4OI3A 2D9OA 4ELVA 2HNYA 3D28A 2Y0SD 4P74A 4B02A 4DV2F 1VRUB 1UJ4A 1X4AA 3HHLC 2RMLA 4OHWA 4RW7A 4QU7A 2BJ8A 4DN0A 2B4VA 2ZWPA 1RHUB 3DCAA 1EP4A 2WSFC 1U0HA 3KXDA 1RA6A 4UT4A 3KLVA 4DR2J 3HJFA 3FEYB 1T9TA 2ZITA 1M5KC 2WB1D 3N0VA 5CHCB 4Y2CA 1D9FA 1VBKA 3MCSA 1S1XB 1JQGA 3W64A 3KLFB 3T5HA 2RKIA 2VJVA 1YZ7A 1ZS6A 3J7A1 5B0CA 1D9AA 1BWEA 3CB4A 4CH0S 3GIMA 3TAQA 2YWEA 3FBEA 3NCPA 3C15B 2HKEA 3U1MA 2EC0A 2C3PA 3CE8A 3GG0A 1SCJB 2LQ5A 3BO4A 1CQNA 2PIIA 4K5SA 2LQJA 3CCQS 4GMKA 5KFXA 4E2FB 1S6PB 1Q16B 1HNIB 1P8GA 4U8YA 1NUEA 3MCOA 3ZTSA 2FVPA 3FEXB 4KGKA 2UVWA 5GVQA 2UUBJ 4OJ1A 5CYMA 4F0HA 2AIRB 3JXOA 3TO8A 1NXIA 1XC9A 4FF3A 2GGPB 1QTMA 4K0KF 1GMWA 4NOHA 1QTNB 1XTZA 2EXUA 3DLGB 4NZ7A 4CNZA 5GADI 3CPWR 2PD1A 4H4MA 3FBCA 2VQEF 4Z37A 2QYCA 4ZVPB 4N76A 3HLUA 1WORA 1HI1A 2GC8A 5THWA 4F3QA 4WKRA 2H48B 4HT7A 1BE4A 2FHMA 1MLAA 3FQLA 4CP5A 1X4EA 2KYXA 4L6V3 5EWEA 1I1GA 1HLWA 3DGPA 3LOUA 3M6VA 4IYQA 2L9DA 4TLQA 4DJBA 4DFKA 1FCAA 4A48A 2AYGA 2PDAA 1S9GA 2B7CB 4NA3A 4XDCA 3W9IA 1F3FA 1SL0A 4B3MF 5JVHQ 3MAHA 2QLFB 2NPIA 3PEJA 5I4MA 5E3RA 1UEKA 3CDWA 2GAHC 1RT2A 1W26A 4NLXA 5C2CA 2HMIB 5HJXA 3ISNC 2VG7B 3NAHA 2K1RA 3OHBA 4I2QA 2MY7A 3AAWB 2NLWA 3IWNC 3ZFVA 3V4IB 4B3OA 5E3PA 1HPZB 2JVRA 4FXVA 4EI2A 2G1DA 2VG7A 3CDAA 2UV8A 4P73A 3CXCR 2ZH5A 3Q22A 1S0MA 4ZIVA 2HW3A 2MJNA 2PGCA 3A13A 2RQKA 1R0CB 3HVRA 1VQYA 2IDEA 3L7OA 1VISA 2GVZA 3MHYA 4AQYJ 1VJWA 2LMIA 3W5YA 3RW6A 1NSPA 3CCUS 2R8GA 3AFGA 5G0RB 1OYDA 1YQHA 3PFOA 4D3HA 2OO4A 1M5OC 1VRQC 3AT1B 2HHHJ 4O23A 2FDNA 4LRBA 3RB3A 3EZOA 1OPIA 1RISA 3F73A 1OPZA 2PA3A 3D67A 3OR1A 4I2PA 3BPSP 4TVAB 4I56A 1RT7A 2MMYA 4H4KA 3MR6A 4DV1J 3HSDA 4Q8FA 1WDTA 1VS3A 2CZ4A 3MOJB 1NB7A 1F1BB 1RTZA 3DMJA 4Y3CA 4BC7A 2KT2A 4WCEQ 3FJ2A 1IBLF 4ELUA 3DRRB 4PPDA 3PX0A 1AFIA 1ZM9A 3OBIA 2AEMA 4X65F 3JSMA 5LMNF 1SKUB 2K2PA 2V0NA 2BUNA 1GX5A 5HAOA 4ED6A 5EN1A 2DCUB 1MSWD 2X3GA 5KFNA 1Z2LA 2MZQA 2R42A 3IGVA 3M7VA 5J1EB 3IS9A 2CPZA 1VCTA 1XR5A 2GZOA 2ZOMA 2L48A 4OJHA 1G4CA 3Q2TC 2QLWA 1C2PA 2BE7D 1HKAA 1UETA 3A4TA 4DR1J 3AOBA 3J80U 4DS5A 1X9MA 1FJEB 1AUDA 1CC8A 1FTRA 1KDNA 5KT2A 4IOCQ 1TQLA 2KDOA 4KV8B 2BRKA 3GTYX 2FYXA 3S7RA 2IA6A 4YOEA 3TVYA 4BHQA 2DNNA 4QWAA 4LRDA 2HQGA 5A8WA 2ZWOA 4OZ2A 4CH7A 1FRHA 3UI3A 2C28A 4NLRA 1HR0F 1HWUA 4DF8A 5J2MB 1KSPA 4FS2A 4KPCA 1YRUA 2XS2A 2JJ4D 1K44A 4AQYF 2AYBA 1H7WA 4X4RA 1HMVA 2AJ1A 2DHHA 2RF2A 4FN5A 3RAQA 2AGPA 2ACMA 4F4ZA 4C0BA 1S6PA 2XYPB 3VAMA 4ELTA 5KG2A 1FFGB 1HBNA 2HNZB 1FWKA 1RTIA 2CPIA 5KFMA 2CQIA 2ZE2A 3SCIE 1EIYB 1S99A 3KLIB 1RT1B 3MAAB 2R2UA 3JTNA 2BE2B 2XLKA 5A6WA 2DPJA 4K2XA 5CCLA 2CJXB 1WOPA 1WOOA 1YZ6A 3FSXA 1IR0A 3HVWA 4K7QA 5DZ7A 4ZN3A 4YFUA 2ZD1B 4JI6F 2R7UA 1UAWA 3KLFA 1J2VA 2CYYA 4RW4B 3CJKA 2I6WA 2MKIA 1NU4A 2WVEA 5K14B 5AE3A 3E8OA 5C7PA 1CS4A 2YKAA 3T1AA 4NXNJ 4NWBA 5E3CA 2DGVA 2GNKA 4P7TA 2W24A 4NLYA 4WU3A 2OTLS 2E1MC 4Q7AA 2AHOB 3CCSS 2IJNA 2J7KA 5KG5A 4J9VA 1IQZA 4C11A 5GAHI 2H5JB 2YQ0A 3ILOA 4OX9F 3KHLA 2YKNB 4TLRA 2M52A 1MNEA 2C1EB 3DLEB 4Y28C 3T19A 4DCJB 2NR0A 1V3ZA 3GPAA 1XR7A 3DU6A 3FFIA 4ZPDA 4QR0A 3WIUA 2KL8A 5DETA 3JQMA 2N3OA 4N41A 2HVDA 5H9FK 4HT5A 1Q8BA 1R8AA 1WC4A 4FPRA 3ZXWA 3ILLA 4B9SA 4JV5J 1NAQA 1FK9A 2O5DA 1XJWB 1X5PA 4YR2A 2KFZA 3Q24A 3IWXA 1NZ8A 1LW0A 2ASJA 2R8IA 2H65B 2GJ2A 4IO9Q 4JB8B 3BV8A 2XI2A 2DYAA 5ETSA 1Y11A 2R7WA 3CJ2A 3FNNA 4KHPJ 2XY5A 2EI5A 4LR9A 1T05B 4RW4A 4DX6A 1FKAF 3HXMA 3Q8PB 2JZ5A 1XK8A 2IRUA 3CSKA 5IFMA 2AGOA 4TNOA 3JSBA 5HQMA 3M9NB 2ZZNA 1X5SA 4ZCIA 2AQ4A 3BGFA 3CD6S 1KTVA 4E8UA 2MQOA 4OYOA 5JVGQ 3K8WA 4Q0BA 3I32A 4ZJQA 1DJ0A 4DR2F 1W2BR 2ZH9A 1DTTA 1XNQJ 1DBDA 3I0SB 3PYDA 1HPZA 5CD4H 1SC3B 2HFUA 3HSZA 3ZTRA 1URNA 2HRYA 4ID5A 3L9ZA 2MHNA 3I6PA 1SKSA 4MK9A 4JI3F 1GMUA 4MTPA 1DTTB 2F63A 2Y1IA 4TN2A 3W7BA 2F3JA 2W25A 2DH7A 3O8WA 4OX7A 5E2QA 3J81j 4OYPA 3EVOA 5A8RA 2HZVA 2HRUA 2JWNA 2AWZA 3AH6A 1CVJA 1FFWB 1N88A 1WC0A 2DEJA 2XO7A 3G6VA 3DYAA 3T5JA 1IBMJ 2E1CA 3BSAA 4RNHA 2OAUA 2CQ3A 2EEYA 2H4WB 4DPTA 1N6QA 3TJAA 2H1YA 8RUCA 3FDSA 2V2ZA 4DR3F 1Y9OA 2XMKA 4MIBA 4QPTA 1UJ6A 2E5LF 4M5DB 1RLDA 2WVBA 3M8WA 4IFVA 4FXWA 1E6YA 1WSRA 4HDHA 1YIJS 4LF2A 1VQ9S 2VPYB 3DOKA 4KYZA 4USVA 3PHTA 2W4DA 3GZ7A 3SDEB 3FBFA 3MEDB 4J9OA 1JLGB 3N6NA 4WZMA 2CPHA 2V4JB 4BLGA 3PACA 4CTAB 2MDAA 2QRRA 4WYWA 1HNVA 4ZPTR 2WZ1A 4Z2XA 5LOQA 2HHPA 1NMEB 4RWXA 4DPWA 1U2RA 4ED0A 5E3QA 5KFHA 2A10A 1U1LA 2Y1LB 1K9MT 4I67A 1A9NB 2QTWA 1CBKA 3HZEA 4IQXA 1RAFB 2DRDA 3TRGA 1GAOA 4ZLPA 3SZ2A 4JV1A 1K47A 1U48A 2MQMA 2DKOB 2W4CA 3R1HA 3L3CA 3G4SS 1Y4ZB 2F4VJ 2K8GA 2ZKUA 2EFPA 4X64F 5IT9U 4UW2A 2WBRA 2KI2A 2HQIA 1YJRA 4WK3A 3WZ0A 3MMAB 2BQRA 2OH2A 4F2RA 3AD7C 3L95X 3RGIA 1NHVA 2QZ8A 3ET6A 3G8SA 2XMVA 4EMDA 1P9YA 2VD3A 2UUCJ 3K5OA 2QIFA 3BGLA 2KT5A 4DN9A 3M32A 4DR6F 1T9YA 1Y00A 3UNYA 1YGYA 2NZ4A 5KFZA 3KK2B 3R2DJ 2J9EA 3J7YI 2QG9B 2FQQB 2ZDPA 2UVUA 4CDIA 3VR1A 4LQ9A 1RT4B 1PYTA 2IDLA 1VRTB 3VCDA 1SIWB 1OQ3A 4FYYB 3DLKB 4ZVQB 5CQGA 4PG8A 5LSLA 2ILYA 1LWEB 4CI0B 5HO4A 4DI6A 4KGZB 5HVGA 3H25A 2CIMA 2DT9A 4DV1F 3GFYA 1HBUA 4DL7A 2N82B 4WXOA 2XZTB 2I9SA 3R9LA 1XWLA 4BC9A 2FC9A 4WWSA 3MDFA 1NSKL 2E5IA 2HAFA 3EJMA 1OSDA 2OUGA 5FD1A 4EO8A 2FLNA 5D77A 3GJRB 2F8EX 3BQ0A 5ETPA 5KFIA 3TVKA 3IN5A 1JXLA 2DNRA 2PMZD 1UVNA 3PKMA 4K4ZA 1C1CB 2YNHA 4PABA 1I3OB 3T3FA 4YEAA 5EX3A 1F2HA 2AT1B 3UW1A 2EBGA 4QIEA 3CT9A 3ITHB 2DJWA 1WD6A 2GIQA 2OPQB 3M6XA 4ZPAA 4C8OA 3L4BC 4WU2A 3GIIA 4LF5F 5HP1B 1T9XA 2CZVC 1TFWA 1H2VZ 2BW7A 3P4UB 4GVLA 4J9QA 1FXLA 2WW4A 5J1EA 4DUYJ 2AX1A 3LALA 1JJCB 1HQUB 5D3GB 3F0NA 4UOCA 2FTRA 1BHNA 1J27A 2PC6A 3A3NB 1QAXA 5HROB 3ZZYA 4Q44A 4ECUA 5KOWA 3O2IA 2DNOA 3QRPA 4OHYA 3OPKA 4CLPA 1KQGB 4X62J 3SSRA 1H74A 1WUUA 2NUHA 4Q43A 2ASLA 2ZM6F 1S9EB 5KT4A 4PWDA 2UUWA 2W7AA 2X7IA 3BSCA 5F3TA 4KTQA 3D6TB 3ETMA 1LWFB 4R0JA 4ZDNA 3V6DB 4C48A 3MECA 3H5UA 3MTKA 5HMYA 2CZ9A 2PA8D 3VGSA 3D9BA 1U0SA 2HIYA 4DX7A 3MUMP 2IM2A 5H1SV 4CO4A 4OYBA 4IR1A 2VHGA 5KFRA 2KG1A 2F1FA 4F3MA 4DQRA 1KC8T 3UCZP 2UXBJ 3LAMA 2CNNB 3GYNA 1RHRB 3ZC4A 2M0GB 3GJSB 3ZTQA 4HH0A 2IFXA 3AD8C 1S0OA 1C4CA 5T7LB 1GXLA 3N79A 4HR2A 3KK3A 1U1MA 1GEHA 4QIVA 3PW0A 1VC0A 3O6QA 1U6FA 1TMJA 1VFJA 1WC3A 2W1BA 4KO0A 1FESA 2QA2A 1WF1A 1NJXA 3FMBA 3WHIA 4O3RA 1NLKL 5K14A 2X51A 2PE8A 1KTQA 6FDRA 1N33F 2G2ZA 4A8QA 2BACA 4OX8A 4FXDA 5BR8J 4OZNA 2W8LA 2HBRB 2BKPA 2CQBA 4PG6A 4LFAJ 1T03A 2E9TA 2L9WA 4JV5F 1B7FA 3H90A 3MEGA 3MM8B 2GJIA 2BM1A 1LW2A 1TU0B 1FO1A 3A8IA 4JI8F 3O5TB 2PFDA 3EZUA 5EWFA 4YQWA 2JLEA 1VOMA 1HQUA 3J7Z5 1WTFA 3MPDA 1T9WA 4O3NA 4ECQA 2M5YA 2X1BA 4LSLB 5DJBA 4F4XA 2CJKA 2W2PP 4B3TJ 3C66A 5IS2A 3CJ4A 4K4TA 4JI8J 2A18A 2FZKB 1GX6A 4IDKA 4Y0FA 2R2SA 3BQ2A 4C4WA 1IM6A 2HNDA 2K3IA 3H2VE 1N5SA 3TJ8A 2FJAB 3HHEA 4BBYA 2MGZA 4J9LA 1JLCB 3NCQA 2LEBA 4WFXA 2VONA 4JV0A 5IC4B 4V19X 4IFVB 1F6TA 4N8OA 2QEXS 3BGRB 3OR1B 1R43A 1TFYA 3M1VB 1R6VA 1ZPWX 3MECB 1FDAA 3GIRA 3DN9A 4R8UB 2KHDA 4LR7A 3PNIA 1SJRA 2E7XA 5KFVA 3U02A 4AFFA 3CULA 4LFCJ 3PYEA 3D6FB 2JC1A 3BGRA 3VWSA 1PGZA 3KNAA 3UVJA 3BGOP 3PX6A 1JJHA 1OSCA 1RT3B 1VDHA 2LQ8A 3CNQP 3I9V9 3D68A 3NS5A 1AROP 5LJ5Y 3KTQA 4QYZK 1IJEB 2BM0A 1CJUA 2VG6B 2YNFA 3MUVP 3BO2A 2JRSA 4X4TA 1KVIA 3IS9B 2DR7A 2EKYA 3PIOQ 3G86A 4URSA 4C7QA 2V8HA 1R0AB 2MYFA 2OMOA 3AD9C 3RAMA 3QJPA 2I38A 2ZE2B 2E7VA 3DDNA 3MMBA 4UOHA 1VC6A 1KFDA 5KFKA 4DR3J 4DSKA 1RAEB 3MR5A 2HG4A 4OYWA 3TUIC 3IM8A 2MKJA 4M5IA 3G82A 4EK2A 2Y8WA 1AUSL 2VU5A 3GJQB 2HQDA 4AUKA 4EZ6A 2IJFA 4HKQA 5LXYA 3MWBA 4QWBA 3W2VA 2G2YA 2EG1A 3PZPA 4DR4J 1FHTA 4DV4J 2RS8A 2V8GA 3BH6B 2BYCA 4HHUA 5SUHA 1XR6A 3D1QA 4K0KJ 4LIRA 4NZ0A 4K4YA 1B3TA 1VIOA 4U67Q 1SKRA 2PI5A 4B9VA 3M9MB 1C0TA 4LIWA 3MFIA 2B4PA 1EHWA 3OTBA 1V9OA 2QA1A 1FKPA 4OYZA 3UN5A 2A0FB 1H98A 1MROB 3D7SB 1RUSA 2K3KA 3CWJA 3DXBA 3PCOB 4OZJA 4CM0A 1LWXA 4RUCA 2EWHA 2HFZA 2ROEA 3JYTB 1U47A 3L7UA 3CC2S 3M30A 3QLHA 4OQJA 5M2PA 2HRTA 3JQKA 4C3KA 4WBFA 3TNVA 4URQU 2XC9A 5F8MA 4K50A 1Q95G 1ROFA 2UU9F 2FPHX 5EWGA 1KR4A 3CUNA 4RBUA 1JLEA 4DF4A 1U49A 5KG6A 4DPXA 5F8NA 2DR6A 4EBDA 1QSLA 3UD4P 3QO9A 1CC7A 4A47A 4BCAA 2JX2A 3LP1A 3RBZA 1CG2A 3N5BA 2FHJD 1U2FA 2PN6A 1RP5A 1GMVA 4ZP9A 4FNIA 4U7UK 4AE5A 2IVMA 2FHOB 1WSVA 2CQPA 1S76D 1D3WA 1FT8A 1SV5A 1UZHA 4M5DA 3BSOA 3NMRA 4CLFA 4P2FA 3I55S 4Q8EA 1FNXH 5IXUA 2XGQA 2VBWA 2LEPA 1JNRB 1LKZA 1S59A 2RRBA 4CH1A 2W4PA 2AMCB 4X4PA 1X60A 4JI4J 2MKYA 1R3NA 1SIZA 1VQOS 1RDRA 4HDGA 4ZPCA 4DPOA 4F04B 3V2UC 2FD2A 3CEDA 4ID8A 1H6KX 4GKJF 3IRXA 5KFYA 5F8LA 2KXNB 3EPGA 5D0RA 5CZVA 1NZAA 1TV6B 3OD2A 2C42A 1DURA 2GQCA 3CJ3A 1KQKA 1HBNB 2HNZA 3K7RA 5HP1A 4ES3A 2CWKA 4JI7F 1PBUA 2HHQA 2RU3A 1HNVB 3IO1A 4DPUA 2RILA 3PRDA 4R5PA 2OPRA 5F41A 1R6YA 1U1OA 1MWQA 2QLBB 2HVEA 3TYTA 2P9EA 1WC1A 3E01A 4FKXA 4OJ3A 3EMTA 4XDDA 4J9NA 5DM7Q 4A8WA 3ZZUA 1ULRA 1HR0J 1VHIA 3C6TA 3E2EA 4PG5A 5GAEU 3KLEB 2XHWA 3ZZZA 4G3IA 3CJKB 1FKPB 2KO1A 3UQSA 3UWTA 3BR9A 1MMNA 5L9XA 1U8SA 2XCAA 4V19J 1UVJA 4QR2A 2IC3A 1NM2A 2HEKA 4LBHA 3M8YA 1VMBA 4FYWB 1EETA 3IMQJ 4OZ5A 2AX0A 1ZA1B 5L1LA 2DHXA 3H2LA 3IGNA 2ZJPQ 3LWMA 4NLUA 2IRYA 4K59A 5HATA 2C2NA 3HFVA 3H40A 4WTYA 2ERRA 1SC6A 3NL0A 2PFFB 4P75A 2H3EB 5LSOA 3AJDA 3FMWA 1R0AA 3K5MA 4PAAA 3D0IE 3KK2A 2JVOA 3CJ8A 3CW2C 3MMBB 1CLFA 2LXFA 1ZTTA 1TR0A 1U24A 3HHKA 2OMLA 5DDQC 5KT6A 2B7BB 4GO5X 4ZS6A 4IOAQ 2Q6BA 2MEWA 3H5XA 3SCLE 1NK8A 1HNXJ 1EKRA 1NHKL 5KG3A 4C0HA 2CQ0A 3HULA 3MM9B 4EEYA 4DV5F 1C1CA 4FPIA 3V6HA 4MIWA 1WEYA 1UVMA 3OTOJ 1S5ZA 2BANB 2DVIA 3QRQA 1JXVA 4I6YA 4ZHRB 1NJYA 2RJZA 4NRTA 3W2WB 2LP4A 1HNXF 2I8EA 2YNGA 1U1NA 3R1LA 3X1LB 2B56A 4LR8A 2D3ZA 3TP2A 4ZLNA 3EGWB 2IMWP 2XSFA 2HHWA 2B4UA 2ZC3A 2GV1A 2GVDB 4F4WA 4ZVUB 3DHWC 2MSTA 7AT1B 1QUPA 2KVQE 4YDXA 1FXRA 2HNYB 4WP9A 2RD5C 4HYKA 3G87A 1K1SA 4HVZA 5I3PA 1T3NA 1N33J 4NZ6A 2NXUA 1KHWA 2A2CA 2MZJA 5D78A 2YKQA 5IV3A 1KRPA 4CNYA 3D5MA 4MKBA 5BR8F 4F4AA 1HI8A 3QSIA 4PXCA 3JB9k 4KE5A 3UPFA 2B5JA 2RQCA 2FUG9 3P5TL 4LFAF 1T9VA 3DOMB 2XZWA 1XEZA 1S97A 3OVBA 3VAFA 3P8BB 3A8EA 4Y2IA 3TOQA 1TKZA 4ANEA 2DIVA 2ASYA 3RYLA 4C97A 4QZVB 2R8KA 1H0HB 4DV6F 3B82A 5DLFA 2V4QA 2VFVA 3GE9A 2AJ2A 1C0TB 2C2ZB 1KQSR 3Q8YA 2YX4A 1L3TA 1S4EA 2OGUA 5DDOC 2BV3A 3HHDA 3KG0A 4P2SA 1LFWA 1I94J 4I64A 3TW0A 5HMXA 1ACMB 4RNFA 5F8IA 3JSRA 4FKYA 2MKCA 5KG1A 2R2TA 3SCJE 3R5CA 3NKYA 3QFWA 3TZWA 4DL2A 2VA3A 2YWFA 3A12A 3CD0A 1FWPA 3CJTA 4MH8A 3WBZA 1YBTA 2AGQA 2DRAA 4L76A 2ASDA 2U2FA 3T1YJ 3FFIB 2VFSA 3R5GA 4FF1A 3CTRA 1HQEA 2H5IB 5MLCV 2JLGA 4X4OA 2RRAA 4KPYA 2DXEA 3R27A 3X3UA 2Y3YA 1DARA 3DI6A 2F9DA 2DEIA 2I0XA 4WJBA 3BKUA 2C3YA 1K8AT 2IYGA 2N7YA 5DDPC 3CMES 3HCXA 3IBWA 1S7IA 1RAHB 2AKWB 1PYOB 3ENVA 3W2WA 4J9KA 8ATCB 4QWEA 4DV7J 1S6QB 3PY8A 4LBIA 3PR5B 2CDQA 4CO3A 2KFYA 3PR4A 4DFPA 3V6DA 3TI0A 4KKOA 1IKWA 2CJAA 1KBRA 4KY3A 4XAKA 4FBUA 3M8PB 3H5YA 5H9EK 4DHVA 1S1VA 2NYHA 1C4AA 4O4GA 2MKKA 3PJWA 3NNAA 4C8YA 1PC4A 3CC7S 1X31C 4TXSA 5HBMA 1KWMA 3MAAA 2CPYA 2RDIA 3VZHA 4X66F 4A8OA 3WX8A 1V3RA 3JTPA 3GIJA 1RBLA 1S12A 5CYMB 1UEVA 3PW4A 5HROA 2HHUA 4FYXB 4I4BA 1M0SA 2FJDB 1QDUB 1TKTB 4RLEA 1GMWD 1KS2A 2BQUA 3LH2S 4ED4A 1UW9A 5I42B 2PI4A 3SQOP 3DLHA 3KG1A 3TX8A 3OR2B 1HWLA 1SJ1A 5ETQA 2K7JA 2YKMB 5AXMA 4ER8A 1HIYA 3MMAA 3KMSA 4PXDA 3RW7A 5L38A 3AOAA 4B3SJ 5AXNA 1RHMB 1KLNA 2OLWA 3CMAS 3IRWP 1BWVA 2YVSA 3OVSA 2DNPA 3PM9A 3BDEA 4H4OA 3P3DA 2B8QA 1ZM3A 5U47A 3HPOA 3OL6A 4DPYA 1TL7A 2M2BA 1JLAA 3M8QA 5HMWA 3QIPB 3PX4A 3LA0A 3KLHB 1DTQA 2W7PA 1ZTWA 1VQLS 2HGLA 3U7JA 2NXCA 2B9XA 1FFSB 2HGNA 3UE2A 4O3SA 3KK3B 4DQQA 1RTIB 2YNIB 3W9JA 4EZ9A 1RI7A 2QX0A 2G13A 4ECTA 3D1OA 3SEOA 1SC4B 3LF0A 2CQ2A 2WONA 4CYUB 3I0RB 3AQOA 2BBEA 3KKFA 4ZP6A 3G8TA 4F3OA 3R2CJ 5KFAA 1FRIA 5L1JA 4RR5A 3M4XA 2OKQA 3C15A 1QUVA 1S1UA 3KHHA 4OLPA 1N4LA 1IKWB 2OSQA 3CJSA 2B9WA 2KM8C 3UD3P 5GAGI 2GX8A 2YWKA 3HKWA 6FD1A 5AE1A 2FC8A 3OSPA 2DR5A 1YLXA 2YPZA 3W8PA 3QJLA 3IR5B 3I5AA 2DO0A 5F0UA 2NXJA 4ZPBA 4JOUA 2WSEC 4NRUA 3PYGA 1HW8A 2BOPA 3TA2A 1UKUA 1XBWA 1CJTB 1ZAXA 1IJFB 5ETTA 3W65A 1YVFA 5J2QA 1O8BA 5K20B 2RSQA 5B0EA 2LCWA 5DGBA 2R8JA 1FDBA 5FLXY 2EG2A 4ZPWR 1AA1B 4DR1F 3CCVS 3CJ0A 3PIPQ 2KYZA 4KB7A 2VODA 1HHSA 3K5LA 2CQ1A 2KXFA 2V6AA 2MQPA 2BJ7A 4X62F 2MY8A 4GVBB 3M8RA 3GLJA 1QAJA 1RTJB 4B3SF 2UXCJ 1ZETA 4G1IA 5B0GA 1ELOA 5DGAA 1DY3A 3LP2A 2CUYA 3BPDA 1R0BG 4H4KC 4ED8A 2M70A 1XMQJ 2B9EA 3RAXA 1ZH5A 2IYIA 3AB2B 4X4VA 3FC9A 1ZM2A 1GFWB 3NGDA 2OJ3A 1TK5A 3DOKB 4DSEA 1JJ2R 1HBMA 1RT3A 5RUBA 1VQNS 3QMQA 5EUHA 3KUEA 5A8WB 2EFNA 2ZNYA 3ADAC 1S6QA 4TYBA 2CNLB 1HFEL 3C19A 1Q4RA 2DNHA 3M6UA 4ICLA 1S1TA 2XEXA 4P52A 3NWGA 3VVUA 5LMUJ 1HBMB 2HHXA 4LSNA 2ZUAA 3BBCA 4JI3J 2RE1A 4I68A 1T94A 2RH3A 2C2MB 4CWBA 1YJNS 1SXLA 4WYLA 2OPSA 4JI1J 4EYHB 2CJQA 4G1QA 3DOMA 1QAYA 4G65A 2GGPA 3JQJA 4HHHA 4DL6A 4MYUA 4N8NA 5E41A 2IJRA 1JLEB 2P6TA 5HJYA 2CPDA 2IM1A 2QYGA 4OYMA 4LF1A 3TZYA 1YRTA 1X9WA 4JI0J 4NCAA 1WDDA 2ZBPA 1UA0A 1JLBA 2CAJA 3HT0A 4LF7J 5HQ8A 2JDJA 3NGRA 1N34J 1J5EF 2HPUA 2NXEA 2XSJA 1FVSA 3UDEA 2FJVA 1RCXB 1X4DA 4KT0C 3TA0A 1AT1B 4OZ1A 4TY9A 1HNZF 3ET6B 3PW2A 4Y65A 3SV4A 2LKZA 3RBDA 1S9GB 4DUZF 4MK8A 4QQBA 2DHSA 1IWGA 2KJVA 1R8PA 4OI1A 3TJ9A 4YHHF 2E9ZA 1LWFA 2M88A 4ICLB 1CJVA 1FKOA 4RPFA 1BC6A 2I5JB 3UR0A 2C2OB 4X4QA 1HNWJ 2KT3A 4WTOB 2G0JA 3THTA 3VQSA 3DLGA 3C14B 2DNQA 4RBTA 2FVCA 3VQTA 3VAIA 4DV4F 4USMA 3HO1A 4YHHJ 3IAM9 5D3GA 1YDLA 4WP3A 4YY3J 4JYAF 4C6AA 5ITHA 5DM6Q 4N5SA 2B9YA 2SXLA 3D0GE 3LUYA 1KP6A 3I4HX 7FD1A 1WKKA 3HHLB 1OY8A 2V63A 3RU0A 2J9DE 3MMCB 1GH8A 1CJKB 2CRLA 4OZLA 2MPUA 2YXLA 2Z56B 2F4VF 2QN6B 2KJWA 3EDQB 4R0EA 4U6PA 1H2TZ 1UVIA 1JLFB 2D41A 4CLYA 3E51A 5KT7A 4Q2MA 1E6YB 3OUYB 4XPEA 3NGSA 1XMOJ 2HFVA 3C6UA 3PJ9A 4HLBA 1NK4A 2QL5B 1R31A 2CQGA 4DEZA 4QPXA 1TAQA 2DNLA 2F65A 5GADU 3C6UB 3QJJA 3NS7B 3K2YA 1NB2A 3CO0P 3MEKA 4NCGA 2AEJA 5K8PA 3HFKA 3V81A 2ZBQA 1FRJA 2BE2A 2MTLA 1IUJA 4PR6A 3OL8A 3DXSX 3V6KA 5HLFB 3TEGA 1VRUA 4NYPA 3AJ1A 4PXBA 3OSNA 4OX6A 5J2NB 2V94A 1MWYA 2BKNA 3CJ5A 2FY1A 3G82B 2M8HA 5CCMA 4DWIA 5EHHA 1RT4A 3DDKA 5LXRA 4ECSA 4MFBA 5D0EA 4GVBA 5EDWA 1Q81T 4OJGA 5JJBA 3B4DA 2Z0GA 3R6GB 1DQAA 3ICLA 4YB6A 2I2YA 1FERA 4EUVA 1HWJA 1OYEA 3HD1A 1RT5B 3MCNA 3Q2SC 3Q8SB 1IBCB 2DR8A 3K17A 3PW5A 3N4WA 4ZVEA 5AXLA 2UXDJ 1YBUA 2KN4A 5JXSA 3OXFA 3I96A 3EXCX 1EB0A 5HN0A 2ZHOA 5J2MA 4X4SA 2XMTA 5A2QU 5LMNJ 1M1KT 5KFFA 3M2RA 4ZCLA 3EX7B 3TZZA 2W9CA 2EFQA 3R5JB 4PKDB 2X1GA 3OLBA 2QMUB 2ZVIA 3W60A 2NS1B 2H9ZA 2DY9A 1FVQA 1LWCB 1X4FA 1IM4A 3H8YA 1B0TA 3PRBA 4RW9B 2OI2A 4CLKA 4EWTA 4ZK7M 3CDBA 4LF8F 1YRXA 1MN7A 1OO0B 2HBYB 3GSIA 3M6WA 1TKTA 5T41A 3GILA 2R8HA 3MMCA 2HGMA 3VALA 4B3TF 5IC6B 2HK2A 2XB2D 4MFBB 1HHQA 4O0IA 4RKUC 3BF4A 2QMXA 2WRMA 3TUPA 3KNGA 1DLOB 4PQAA 5IWAJ 5KFDA 4KHMA 2U1AA 1M90T 4DL5A 3T5LA 5KFLA 1OMSA 2BJ1A 5B0AA 5G4DA 2HWHA 3TA1A 4PQUA 1L3SA 2LU1A 3RB6A 4NX9A 2R9LA 4LFBF 2IHR1 2RKIB 1S1TB 3QGPA 1UPPA 1ZM4A 4LF6J 3MM6A 3SQGA 1VJQA 4I7FA 1N5YB 2VBXA 1PBAA 4DR7J 4O3OA 2UXBF 3BDPA 5C2GA 2XI3A 2F8HA 1NKBA 4ZOSA 2OIHA 2RQMA 2BJ3A 3GV5B 4CQ1A 4F02A 3T5KA 4L73A 5JUMA 2XNQA 1SJ3P 3MURP 4J9PA 2HWTA 3NRBA 4URGA 1WF0A 5FDLA 1Q86T 3OXLA 4UY8T 2OEKA 2ADBA 2ZNZA 1WACA 1FF2A 2QLJB 5T7LA 2GIRA 3A8JA 3OVAA 1C0UA 1FNMA 3GCXP 3QT8A 4O44B 5IT0A 1JB0C 1VLYA 1NK0A 2ZDOA 3J7AN 3BO3A 4P2MA 3PV8A 2D3UA 2J6UA 4CIOA 1BQMB 2NZCA 2J8SA 1C1BA 3H98A 1NDCA 3D6HB 2CKWA 1VQPS 3DRPA 3MOZA 5AJ3J 4OI0A 2DHAA 1PSDA 4F0KA 2H5EA 3C8YA 3GR0A 5KTQA 3DGPB 1KEKA 3GV8B 4JI7J 3ELHA 5KOXA 1LEOA 1B99A 3K0JA 4OX9J 3DKDA 3IA0A 2BANA 1TL1B 2LDYA 2ZH6A 4KKOB 3W61A 4PZVA 2OPPB 3DRXA 4I7FB 4C8MA 3NNCA 2PSZA 5ETMA 2XM3A 1YI2S 1P1TA 1ZZFA 1P9QC 2JFKA 4KFBA 5CA5A 3KK1B 2C2EA 2LECA 2J0QD 3HHNB 2KZMA 4B9UA 2Z4PA 3MEEB 4DUZJ 1HYSA 3QBCA 2DNZA 3OTCA 1DQ9A 1OS5A 4DV6J 3E01B 1G7CB 4QOTA 2WONB 5KG7A 3KLIA 2D9PA 2QLXA 4Y2KA 4XTTA 3LP1B 3G9CA 1JXEA 4LFBJ 2OFGX 2PMWA 4ECXA 4HTIA 2J9DA 3LW5C 4O44A 3WDOA 1ZZNA 3PO4A 1SC1B 1SH3A 3KDNA 4MIAA 4DL0C 3M8SA 4J9SA 1O5JA 4CCHA 2RIJA 1IKYA 3CGIA 2W7OA 3HK2A 3CJQA 3DMJB 3GB0A 3R97A 4QR1A 4R25A 3BS9A 1PC5A 1VYAA 2WVCA 1EETB 5K8MA 1T03B 3J80Y 1CS4B 2BRLA 2BEFA 1Q78A 2COLA 3CIZA 4USIA 4N7TA 3G6XA 4RJVA 4JI1F 2RUGA 3P45B 1SKWA 1YBAA 1M1GA 1RCOB 4JI0F 3A1YG 1U1KA 4QIGA 1JLQA 2DXDA 4WE1B 3M2RB 3ISND 4O3QA 2K7KA 2ZH4A 3FSIA 1XMOF 1SUQB 2HBQB 2DISA 1GTEA 3QWPA 5IM0B 3QSYB 2F5GA 2AJFE 4LBPA 4DSLA 3OTEA 2MQLA 1VQ6S 2D3OR 2ZH3A 2MGZB 1TL4A 2LA6A 1Q8IA 1QJHA 2POKA 1YJWS 5FLXU 5F9LA 2FHKA 4FVMA 1D8YA 4KGMA 3AODA 4RBVA 5MAOA 2XGPA 4DFJA 3QT5A 2WSCC 5LT5A 1N56A 4DQIA 3SI8A 5K5MA 3TEHB 4KIAA 3NOCA 2XS7A 1E6VB 1GNKA 1RZMA 3DU5A 3VF0B 4UOFA 3QIDA 2R4FA 4PEOA 1J5OB 3N5FA 5C25B 2N3LA 3OL7A 4W92B 4USWA 5H9EJ 4B9NA 1V5VA 2CVEA 2PO4A 3VGTA 1D1UA 3KYLA 1I5OB 3VAHA 1TL7B 4L74A 2E5HA 5E5NA 3RBXA 3KDOA 2L08A 3MM6B 4JBCA 3SQGB 4RW8A 3DOLA 1XQIA 4RWWA 1QY7A 2B51A 4PCQA 5D4NA 1GK8A 1PJ7A 1WG1A 4PUOA 4ITSA 4ED1A 2GIFA 2CJ9A 1JX4A 3US5A 4WF9Q 1JIHA 1Q1KA 4KAIA 2YPYA 3I0RA 2F7VA 1M1HA 1RT1A 4RUHA 5IT9Y 4RU2A 3MFHA 2DD8S 1S48A 2LXUA 4FP9A 4ENOA 1U02A 5GMKa 4Q45A 3RRHA 2J8AA 3GFZA 1DAXA 2P5VA 1KNZA 1U8WA 1PYSB 4TQSA 3Q23A 1K0VA 2HVIA 4X4NA 2WOMB 5C24A 1FRKA 3W62A 3MM5A 1CJUB 2VG6A 2R7VA 3C46A 1A7GE 2UV8G 1WC5A 4F7VA 1SQFA 2UUAJ 2BABA 5DO2A 1NPRA 5B0DA 3CCWA 1X0FA 1NK6A 4E0DA 4FF4A 2XMMA 4LSZB 1NCLA 1K1QA 1N5YA 2A1BA 1FTCA 2RB7A 4JI6J 2QV6A 1QSYA 2CDRB 3GFHA 3H5SA 3Q86A 3QYYA 3ENAA 4UZBA 2VC0A 3UCUP 3HVTA 4ANDA 2QFIA 1EP4B 1SVDA 3TVZA 3MXHP 5HMZA 1Y5NB 1XNRF 3RZAA 4WFAQ 1B0PA 2O01C 3NP5A 3DRSB 3LQVA 1Q8LA 3MI7X 3NWRA 1NSAA 3I56S 3OFFA 3IR6B 3MF5A 3QT6A 2Z2ZA 4PG7A 4AL7A 2E7WA 2CG8A 3V5RA 1S0NA 5I3UB 4W4MA 1HQEB 3Q8UA 3Q8VA 3UD5A 1YKWA 4KJIA 2VFRA 5M2RA 4CO1A 3VVTA 3LPYA 7FDRA 4C8LA 2NPFA 4GC6A 1WJ9A 2CPFA 2RNEA 3NG8A 3IM9A 3BM7A 4LF9J 3MPYA 1RQ0A 3AQPA 2EFGA 2QMWA 3LGNA 2Z2LA 4LF8J 3J7ZT 4IKAA 1RTHA 4P10A 2IC3B 3H4BA 4DUYF 2UUCF 5CYQA 3FCWA 2ACYA 3D1HA 3U1NA 1X9SA 2XG8A 3POTA 4ES2A 4RZRA 3M9OB 3IFEA 2E9RX 5AJ3F 9ATCB 3T6JA 1RTHB 2MJUA 3MM7B 1PG5B 1HW9A 2RU9A 4C3LA 2N7CA 1SB6A 3K58A 1OY9A 2J6SA 1CPZA 4USUA 1RAIB 5B0FA 4LRCA 3MZIA 4MK7A 4PYAA 1S4FA 2WVFA 1FRLA 1BQMA 1RWPB 2FJEB 3HFZB 2DGQA 3PDNA 3TUJC 4TU8A 4MJKA 3DLKA 4QWCA 5BYSA 2HBZB 3CCRS 2B6AA 5LMUF 3D66A 1IWAA 2QO3A 1T3OA 2P9GA 2VB6A 3FZ2A 4I0WA 4RNOA 3J81Y 1X5OA 1RBAA 3IWLA 4IG3A 5HI7A 1S72S 4HACB 1X7VA 2CNOB 2VOOA 2DBBA 1FJGJ 3P6YC 4MKYA 3M8QB 3MTJA 3NY0A 2Q1LA 2CADA 4M5LA 4ZITA 1BUXA 2MKHA 5ETNA 3KK1A 2BJEA 2N4DA 2I5JA 4L3KA 4ZA1A 1NDPA 2KHCA 4ZHRA 1UEUA 1VBXA 2YNGB 5IQQA 2FZCB 5CYQB 4ZKAA 3CCLS 4X65J 1JWWA 4QU6A 1RWOB 3W63A 1JK9B 1TELA 2ZOGA 2ABYA 2W01A 1AYEA 2GCFA 1TUVA 1UZDA 1RK8A 2XMUA 3QQCD 4P2XA 4UUXA 5DRKA 1T8EA 1MU2B 1HBOA 3O44A 4DX8H 4LQ3A 2JOQA 1N5QA 1U2CA 2ZZMA 4U95A 4DV0F 1GXTA 1Q53A 5D6GA 1U1PA 1EJ7L 2LVWA 2LEAA 1F60B 3H7HB 3RR7A 2P2CB 2B5JB 3BBFA 1NK7A 2B3TB 1NJZA 4NXNF 1BQNB 2PEBA 1PJ5A 3PHEA 2MZRA 1U09A 4DV0J 3ULHA 4J9RA 2YX1A 2CA9A 3LANA 2R3VA 4OHVA 2ALZA 5SZTA 4JI2J 3NBPB 1UJ5A 3M32B 2W9AA 2OEMA 1YJ7A 2HZAA 5KFQA 3SIPB 2ZJQQ 3UDCA 1VQ7S 1VQ5S 1TL3A 4I2PB 5J2QB 2IVFB 2VZ9A 2GMHA 3UCGA 2AU0A 4NLSA 4GO7X 2UXCF 2FGOA 2WCXA 3D54A 1Y5IB 3HSGA 1WEXA 3C3LA 3DOLB 1X4CA 4ECYA 4Y2MA 1WELA 2GMLA 4KQZA 1CJVB 1FKOB 4KGVB 5K9FA 3S8SA 4LF4J 2AYMA 2Q43A 4NLWA 2RT3A 2DGOA 4F4YA 1WKJA 2V50A 2V2VA 2WW8A 1FA0A 1RACB 2RHSB 4F25A 3GSDA 2GVZB 3PJXA 1T95A 2HHSA 5C42A 1N52B 2AZ3A 4QYRA 4AL5A 4KHPF 4R5PB 2YKOA 4ZVFA 2YTCA 4PXEA 2FJWA 4J7CA 2C3MA 4M5GA 1V3SA 3MMJA 1VQ8S 1VQKS 4LF4F 4P7VA 1NPKA 3R7BB 4WKYA 2DR9A 2KXHA 4FDFA 4ILLA 4ED2A 3BJYA 1UPMB 4PWWA 1C0UB 4EBCA 2MQQA 1RWKB 1LQ9A 3CMQA 4Y6IA 4DU7A 4OHXA 2C3OA 4J37A 1PKUA 2J7WA 4ILRA 3IR7B 2XCPA 2O67A 1JKHA 2JC0A 2VFTA 3W5ZA 3ZZ0A 1RU1A 1VIXA 3QIPA 1NDKA 4EGLA 3GIKA 2BDPA 3PO5A 3PRVA 1R8CA 1L3VA 4F2SA 1WHXA 3JS9A 3UNGC 4LF9F 2RDJA 2CQCA 4M63A 4KSEB 2GHWA 1QE1B 2RVJA 3D6MB 4ZVHA 3CCTA 4ZLJA 1TL1A 5HANA 4WXWA 5LJ3Y 1IBKJ 2A6MA 2D1CA 4IFYB 2Z30B 2OTJS 2IVYA 1OWXA 2M9KA 5BYQA 4C8ZA 4PWDB 2BMBA 3CVKA 2UXDF 1LW0B 1IKVA 1KVJA 2C2KB 1QD1A 3QO9B 3MPWA 4O4RA 4BWJA 3BQ1A 2G0CA 4IOBA 2VQEJ 4USJC 3F56A 3K59A 1WF2A 2JL9A 2J7UA 2G9OA 3BGUA 4HHJA 2E5LJ 1UL3A 3EGNA 3LP2B 3PEHA 1N32F 3M2UB 1IBMF 2X1FA 2B6AB 4DZ6A 3HT3A 4DQPA 3DDIA 5J2PA 4RNNA 3ZNJ1 3IG1A 3WX4A 4DV3F 4DL4A 1S9FA 4B3MJ 3DLEA 1UFKA 4LT6A 3NLCA 5HVHA 1SH0A 2XWXA 1WHYA 2KVIA 4HI2A 4LVNP 4O0NA 3MM8A 4F36A 2ZH8A 2AJ4A 4O4GB 3UVJB 3J7YU 1RJJA 1N5VA 2XLIA 1NJWA 4DR5F 2F8MA 2R7SA 1F2GA 1ICEB 1N0VC 2P6SA 2D74B 3SSSA 2OPPA 2VICA 4ZVTB 2R7OA 1EKSA 5B0BA 4Y00A 3LWLA 2A2DA 3AXMA 2ZHAA 1A6LA 4K4VA 4TY8A 2HQCA 3EE3A 2L3MA 2NSBA 5LM7E 3NGUA 4FF2A 2HLUA 1RAAB 2BX6A 4HEA9 1RTDA 3QRRA 4FNHA 1TK8A 1N0UA 3EYZA 4CRJA 5KT3A 1U45A 4TU9A 1Q7YT 2UUAF 4X64J 2EKNA 1GQEA 2M3DA 1WKLA 1AB8A 3W66A 1JLBB 2DGUA 4ETZA 2HYIB 2Y8YA 2HQFA 2XWYA 2YY3A 5L1IA 2FGCA 3OFEA 3M2UA 3UN2A 1ZBTA 4NMLA 1PCAA 1BQNA 4O3PA 3OTDA 2LYVA 3OV7A 4OYAA 5T14A 2BJ9A 2V8DA 3EDRB 5ETRA 5CABA 2A3JA 2WK4A 1NO8A 1XNRJ 1IR1A 4IH7A 3MAQA 5DG7A 1N32J 2GO8A 4Z7YA 4YR3A 4KGXB 3BR8A 4DSIA 1N48A 3UO0A 1RLCL 4A8MP 3GMGA 1H38A 4K4SA 1DTQB 3T41A 2QA4S 2J0WA 1IBLJ 4L75A 4UY85 3PYFA 3M2VB 1UCNA 4LMZA 4YB7A 2BVZA 3LPEA 4DMZA 1CSJA 1DHMA 1FWLA 2CG4A 3EXYA 3N28A 5L8RC 3M05A 4NXMF 3POTB 4A8KA 3ZTOA 4K8RA 4OZ3A 4UQGA 1J5EJ 4M95A 3PG9A 4GKKF 3ENWA 3NXZA 4OYXA 4RW6B 4WIQA 1TKZB 4H4MB 1UTAA 5IWAF 4PYDA 4C8NA 1RSCA 5ETLA 4K4WA 3HHLA 1X4HA 3U1LA 5J2PB 5B09A 1M5SA 5BYRA 3B54A 2XBPA 3ILJA 2E1PA 3CD7A 5ETVA 3JAMU 2DXFA 3NGTA 1Y5LB 4K2JA 1G6BA 2W2OP 2WB4A 4M1KA 4NLTA 4TQRA 1U1QA 1NKCA 1UWBA 2G2OA 5DS7A 3R6LB 5D4LA 5CD4A 1TVRA 2VQFF 3VAKA 3RJMB 3ISZA 4B3RJ 2Y0BB 4JP8A 2ZH1A 1LK5A 2L9NA 3KWMA 5DG9A 4NLPA 3M8PA 2YNHB 2H4YB 4EFAC 4DSFA 2JHEA 4QJVA 1HBOB 2LA4A 3C14A 4CLUA 4RUBA 3KHGA 3CCES 4JI5J 3EM1A 2KRBA 4NCGB 2NREA 4TY8B 3AY0A 4H4OB 5A2QY 1B70B 4NCBA 4IRCA 4DR6J 4BDPA 1OIAA 5GAHU 4FYVB 4ZJOA 1TK0A 2IY5B 3RTVA 1U26A 1RT6B 1X5TA 3IXQA 3GR1A 3IAS9 4KRWA 3FVYA 3K5PA 3QAUA 2W2MP 4MYTA 1NHUA 3CF5Q 1SV5B 1N34F 4IUFA 5HK4A 3W8GA 1LOUA 2FVRA 1JNZB 4OHZA 2EK6A 2FY8A 2B43A 2CPJA 3Q0AA 5KFJA 1VC5A 4IR9A 4LFCF 1M5PC 2HVHA 5ADZA 3ZZTA 1UA1A 4Q2LA 3OTOF 2ZH7A 5I3UA 2VPXB 4KHRA 1B64A 2B4OA 3HDSA 1HD0A 1HMVB 5KFBA 3QZ7A 4DS4A 1RADB 4OV6A 1YK9A 2OSRA 4MAKA 4LSNB 3UN3A 4F67A 5HBMB 3HM9A 2C2RA 1HHTP 1G2EA 4F26A 5A6PA 6AT1B 8AT1B 1VBYA 4PRFA 1REGX 2AYEA 1PILA 4KFBB 4MKAA 1MROA 1UWAA 4RX6A 2YWHA 3VV2B 4GC7A 3OW2R 2W9BB 2ALYB 4YY3F 3LGMA 3KMQA 3TZXA 5DG8A 1WG4A 1F9HA 2GHPA 2D7SA 2IAJB 2IIHA 4DZDA 1Y10A 1Q79A 4AXIA 2ZC4A 1JMTA 1L3UA 5CXTA 4DR4F 2DHGA 3K8VA 2APOA 2QL7B 3HF5A 1SPBP 1T11A 1VRTA 4CYUA 4V1Ak 2RUSA 2XSJB 3G6ES 3LGHA 3R5DA 1F9FA 1RTJA 4XPCA 4LUBA 1VR6A 1D9DA 1WNEA 5FJ4A 2BJDA 1ZAWA 4DV2J 1IN0A 1RWXB 2DGWA 3H42A 2VKRA 3CCJS 2W2NP 1RAGB 2MLYA 2VDHA 2YKPA 1U7LA 2BKOA 4B9MA 1X4BA 1B0VA 4ERDA 1XMBA 3J81U 3GP9A 3R7SB 2VH7A 3KJQB 4LVOP 4NEYA 1RWUA 3HX9A 2KKHA 5F8JA 5I3QA 1D09B 1B4SA 1LWCA 2R7TA 3GU0A 4ZIWA 4AYBD 3T1YF 4N47A 1FJCA 1S57A 1XNQF 4NYOA 2EC2A 3OJSA 1IKXA 1V5IB 2XULA 2NQPA 1RHQB 3AA9A 2R7QA 2ZBRA 3SXLA 2MQ8A 2ZKTA 2HHVA 2V4RA 2JEGA 2VKZG 3HKZD 3TWZA 2YWGA 1LWEA 1YJUA 2NYIA 2V8PA 3FCHA 1HWKA 2QL9B 2V5HG 3IP0A 4IDKB 4NA2A 3BN4A 1YHQS 2ZFHA 3HI9A 4K4XA 2HFSA 2HFOA 5I42A 3BYPA 1S7HA 2MLXA 1Q5VA 2BOAA 3BYRA 5L39A 1LFPA 2EVZA 1TMMA 4BS2A 4JI4F 1H2UX 3KLGB 3NEKA 2DGTA 2ZOFA 4Z7CA 3JSMB 1YTYA 2UVVA 1HD1A 3DC2A 1HNIA 3H20A 2VDIA 4J90A 3DM2A 1HWIA 1RT2B 3CDUA 3TANA 1FE4A 2DB1A 3M30B 4WK1A 1IBKF 2DO4A 2HMIA 4X66J 1RT7B 2XMWA 2XHCA 3D3BJ 3I9ZA 4IRDA 5DZ6A 1GXUA 3GG1A 5IM0A 4Q5VA 2KZZA 5L46A 1RYRA 2UUBF 3NAIA 4QW8A 1QE1A 3KJVB 5DQGA 2XS5A 4DBQA 3LO3A 1JLQB 2HURA 4WE1A 1WEZA 2G1HA 3AA8A 1CULA 5KAKA 3GYGA 3TUZC 2C22A 1PAEX 4LRFA 1NSQA 3DLLQ 2NUUG 4DXLA 2AEFA 1RB0A 3MM9A 5GMEA 2AJ0A 1BY9A 2VFUA 1APSA 1NPPA 2KTQA 2ROPA 1J5OA 2MLZA 2Z8QA 3A8KA 3T9NA
chains in the Genus database with same CATH topology
2MZTA 1L3KA 5E0OA 1WI6A 1R89A 4DL3A 3W3SA 3OQ2A 4N56A 1KLMB 2X1AA 1HA1A 3BEGB 2AP6A 3SDEA 5A0YB 2CQDA 2OPQA 3QGIA 1K0TA 3CCMS 1VQMS 5J1PA 1Z2ZA 4QIWD 1NK5A 4QYZJ 4XIUA 1P6TA 1U4BA 2NSCA 4YMEA 2JEJA 2DNYA 1HYSB 3HVTB 2IM3A 4N77A 2BXJA 2BR0A 1FDDA 1S1VB 4DDFA 4YDDB 1AXQA 1S6UA 2HQ3A 3SCKE 3PW7A 1RGVA 1YJVA 1NRKA 3M2VA 2J0XA 2UP1A 2ZBIA 4YP3A 1FJGF 1PO6A 2E44A 4EU0A 1N32F 4ZMMA 1KONA 3CDEA 2C2RA 2HFNA 4TKTA 1R8HA 4FS1A 4ILMA 3G96A 2HHHF 2FLOA 3BZQA 3I4PA 3MUTP 4CT8A 2HLTA 2XMJA 3G8QA 2BQ3A 2JSXA 4FBTA 3CIMA 3LP0B 3CCZA 3JSYA 2YKNA 1BWEA 1YJTA 2ZUGA 4J9MA 2KFNA 2UVRA 3GYXB 4E98A 4DLGA 4Q0BB 1NEEA 2LQBA 3GV7B 1MMDA 5DDRC 1LW2B 4L3NA 1N54B 3ITHA 2RS2A 2YX7A 2Y1JA 4RW8B 2KB2A 4L72B 1SJFA 1T7PA 3ENQA 3HZGA 3KFWX 2VA2A 2IM0A 3TAMB 4ETXA 3I82A 2LDIA 2E1AA 1I6JA 2EFOA 4B3RF 2ILZA 3P49B 2HS0A 3I87A 4OI2A 4PQUB 3OR2A 3T6BA 1C1BB 2AF6A 5C25A 5DQIA 4ZVGA 2QA4G 1WI8A 3C2PA 2VOPA 1ZYQA 1GTHA 2DTJA 3NGKA 4KC5A 1P1LA 2E5JA 5F9NA 1NH8A 3BREA 3MD1A 1HI0P 2W8KA 1I94F 2DRBA 2HAIA 2DCLA 2K1RB 4DR7F 2R7XA 1JLGA 1YG0A 2DNGA 4HL9A 5IZHA 2GHVC 1SJQA 3I5BA 4C11B 1L5UA 3UR3C 1KOOA 2CPEA 2IAJA 4IH6A 4XO0A 4ZP8A 4IFYA 2PMHA 4NYZA 4QIFA 1S10A 3ETOA 1F5AA 5E3AA 2EK1A 4JUZA 1Y3KA 1QLNA 2GFFA 3GWCA 3TAMA 4QWDA 4G1PA 4QW9A 2YH1A 1QAIA 1X0PA 2EBEA 2O66A 4DOZA 2GW8A 4ED5A 1S9EA 2QT7A 3UFCX 4LF7F 5KFEA 3RR8A 3FZBA 3SSQA 2UZAA 3E3XA 5A8RB 1FD8A 5C24B 2FVQA 4DV7F 3V6JA 4C9DA 3K57A 3ZZOA 3QAEA 4WFBQ 2KG0A 3V4IA 5A8KB 1MMLA 3JAMY 3VTIA 3VZIA 3BB5A 5KFPA 3RB4A 2G4BA 3ONQA 3THPA 3G6YA 3HP6A 1HARA 3MEGB 4RNMA 5F3ZA 2MXYA 4JV2A 4B9LA 1SQEA 1SH2A 1T02A 2WTFA 4NA1A 1S49A 3V81B 2W9BA 4PWUA 2C2DA 4ECZA 1WHWA 1Y7PA 3MD3A 1IKXB 2VL1A 2HVZA 2VG5A 2ADCA 2Q79A 5D8HB 2Y1RI 1D0EA 5KFOA 1MWZA 1O0PA 5LSRA 4C8KA 1JLCA 1VHFA 2OPRB 3N6LA 3NBPA 3OFGA 2JFDA 5KFSA 4NLDA 1FD2A 3DM2B 4RUAA 3L7PA 5CYJA 1REVA 2L41A 1TAUA 4NLOA 4WZQA 1TP7A 3FRYA 1LXJA 2KRRA 2F9JA 4UQTA 3I0SA 1REVB 4YR0A 1G1XA 3IC1A 3ZZPA 3TAPA 4ID5B 4NLQA 3LAKA 5FDLB 3KLHA 4BWMA 1N5TA 5AE2A 2OPSB 1JJ4A 1HNWF 4C2MA 4OIXA 2DH9A 2DIUA 2OFHX 1LV5A 5F8GA 1BGXT 4I6AA 2JLFA 1QM9A 1RT6A 1XN9A 2OD4A 4NLVA 5E33A 1Z1ZA 2GO9A 5B08A 3KJVA 4ZP7A 1FK9B 3OL9A 3D2WA 4F50A 3SMZA 1UVLA 1SJ4P 5KFTA 1WTBA 3AHPA 3QGHA 1DLOA 3JTOA 3SFGA 1IQTA 1WWHA 3MM5B 3THVA 3RB0A 3IG1B 4A8FA 3KLGA 4K4UA 3MPVA 2DPIA 2E29A 4IG0A 4YB5A 1RAJA 2EW9A 3NMAA 2HIQA 1XERA 3RBEA 1IXKA 2IBOA 2VC1A 1S79A 3CC4S 4ECVA 1MU2A 2M4MA 4IH5A 4XK8C 3P96A 1DRZA 1ZAVA 1NKEA 1FE0A 3MR3A 2V2KA 4DQSA 2CQ4A 5KFCA 2AW0A 2N4CA 1H7XA 4CO0A 3FRZA 4B9TA 2CVIA 5KFGA 1NK9A 1RA7A 2DGSA 1KHVA 3U27A 3SFUA 1TKDA 4A8SA 3QWUA 4WFYA 2QSWA 1F0XA 1NJIT 2HNDB 2M7SA 3QZ8A 5CZXA 4IQMA 1W2IA 2MZ1A 4ZCKA 1UFLA 4FYDA 2V8VA 2DNMA 5HL7Q 4J5OA 3DHXA 3UDLA 2ZBCA 4F8RA 2FIUA 2QE5A 3GFXA 5GAEI 3V4MA 3PVXA 4Y2AA 3SV3A 1DZ5A 3DRSA 1KQFB 5KFUA 2XY7A 4EO6A 3R3TA 1P27B 4M94A 3H59A 1RTDB 5D4PA 2XLJA 3CO9A 1LK7A 2HZCA 1VQSA 1S1XA 4NLGA 2GQ2A 1T05A 2DNKA 2J9CA 4A8XA 3NNHA 2CQHA 1VGYA 4B08A 4ECWA 1RKJA 4RW7B 4OL8A 5B7WA 2ZD1A 2BZ2A 2WHOA 1GT8A 4M8LA 3F44A 1DFDA 4A8YA 2ZJRQ 1FXDA 2Q3PA 4RU9A 1V6HA 3GQCA 1K73T 1TVRB 4OFZA 4A4JA 1FJ7A 4HTJA 3N6MA 5K8NA 4A46A 1BLUA 5J1NA 4KBIA 4X84A 3RRKA 4LF6F 1TKXA 2MSSA 3NCRA 3L09A 1D8ZA 3MEEA 2Z2MA 3BN7A 2C3UA 4Y34A 2VBYA 3S01A 3OJUA 2VPZB 2DGXA 4G6VB 1XMQF 3PFEA 1VI7A 2VPWB 1G3OA 2PEHA 4R8UA 2HS4A 5IT4A 1SL2A 3TARA 4D3GA 1S6OA 3C6TB 2IMOA 5L9NA 2FB0A 4I6WA 4KR0B 1VBZA 4W90B 3OLAA 5KG4A 3H4DA 1UFWA 2E66A 4ED3A 4B17A 1SL1A 2VV5A 4IG3B 2QFJA 1CQMA 3FGVA 2E5GA 2LU2A 5EGYA 1KN6A 1WG5A 2FLLA 2MKSA 5GAGU 2ROGA 2YNIA 2RF2B 2YH0A 5LL6d 4WFZA 1YITS 1H3DA 4CO2A 1F5CA 3MEDA 2RRNA 5DLGA 3IRXB 5E7OB 1JLAB 4USHA 3WC2A 2OD6A 2W9CB 4H54A 4NL5A 4U9RA 1UW4A 5FIIA 2LQ9A 5D4OA 1AW0A 2UUTA 4C0OC 2GQQA 4UUWA 1NH7A 1S1UB 1RKIA 3KHRA 4WFNQ 4AL6A 2BA9A 3B4MA 2GMJA 2YKMA 3HMJG 3S6EA 2J6TA 2MHEA 3VAJA 1U1RA 3AJ2A 3PKYA 1Z4UA 1UWBB 2CJBA 2F40A 3QPIA 4U6PA 3EGZA 2DITA 1X8DA 5BJRA 5A8KA 4ZCMA 3TR5A 3N9UC 5DQHA 2XY6A 4U7CA 1S1WA 2V9KA 5KG0A 1RYSA 4B3OB 5C5JA 2V4JA 1Y0HA 1S0VA 2YNFB 3OXGA 1CEZA 3VAGA 2ZVSA 4OI4A 2J5AA 3SYZA 3T9ZA 1Q7LB 4RW9A 4P6QA 4RW6A 1TL5A 3K5NA 1URRA 3O3LA 1SUQA 2KM8B 3WC0A 2AV5A 1VK3A 3KOAA 4DG1A 4C3MA 4CT9A 3OHAA 2HWIA 2RQ4A 2EPIA 1FEEA 2JH3A 5KFWA 3FSYA 1JKHB 1QSSA 1NNDA 1HBUB 1O51A 2J0SD 2AD9A 2ATLA 1ZOTA 1VQ4S 4LJMA 3H2UB 3MGJA 1ZPVA 1KLMA 1FNOA 1TZ0A 2FHJA 3NS6A 3EZ5A 1TV6A 4OV1A 5CH7B 5IQ6A 3DFEA 1N36F 5M2UA 1U6ZA 2KU7A 3QLHB 1BD6A 4EBEA 2FLPA 3BSNA 3MM7A 1KOHA 3O1LA 3B78A 4PUOB 4OLOA 3FQKA 2O1PA 3R5BA 4WIIA 3AB4B 4ZPVR 4DFMA 1WHVA 4OMFG 2JEIA 1MW7A 4DG1B 4AXJA 1YWXA 4EYIB 3DYAB 4FVCA 4K5RA 1JLFA 3FEZA 4X4UA 2VASA 4ALZA 2B0GA 5F8HA 2ZHBA 3Q8QB 3OUYA 3DNCA 1SI9A 1RT5A 3CD5A 5L1KA 1FRMA 3DRPB 1S1WB 5A0YA 3OFHA 4IG0B 1IKYB 1LXNA 2O3DA 2MB0B 2E1RA 4JI5F 4TYAA 3MR2A 1UMJA 3D0HE 2LXIA 3R5AA 4I1TA 2Q6CA 4LSLA 4OZ0A 3PXGa 4DQQA 3F41A 1X4GA 4CTAA 4PG4A 3DRRA 5C42B 5HLFA 4HI1A 2WAQD 4ECRA 4OI6A 1UVKA 2HHTA 1U6BA 4QBUA 1M5VC 2V9WA 2I1RA 2GA7A 1DQ8A 2IA0A 2ZH2A 4PPZA 1N8RT 2J76E 2QSFA 3Q8RB 1SBRA 1YSJA 1N6QB 1BQXA 2WBMA 5F0WA 5G0RA 2XNRA 2BW2A 5KT5A 2PT0A 4MMOA 2M8DB 3M1VA 2CPXA 1U25A 5K8OA 1YJ9S 1Q82T 1R27B 3W2VB 3DI6B 2WOMA 4KO0B 2VBZA 5H9FJ 1F5BA 4FZVA 2DH8A 3G71S 1TKXB 1UP1A 3QGGA 3HVAA 1E6VA 2OP5A 3ZZRA 4CO5A 1HL6A 4NPOA 4CZCA 4ATNA 2CFXA 3HHLD 2IRXA 5EX0A 4G1QB 1VK8A 4YB1P 4HH1A 5J2NA 4ES1A 3JYTA 1R8BA 1IKVB 2FVSA 4I69A 2P9CA 4DLEA 2Q66A 1R7IA 4F4KA 2VG5B 5AXKA 3EPIA 3KG4A 3I5CA 2MQNA 1KFSA 3TQ1A 4IO1A 1FDNA 2JEFA 2IBKA 2R2RA 1AFJA 4KV8A 1FEHA 3KLEA 4X2BA 4TU7A 4JI2F 3B8HA 1M5HA 3DLJA 3RRGA 2KH9A 2YQ3A 1OQ6A 3S1TA 1TL3B 2FJBB 3EUNA 4ED7A 2VUGA 1QVGR 2HS3A 2MZSA 3LP0A 3DRYA 3DLBA 1QVFR 2EFVA 2DK2A 3N01A 4IRKA 4I2QB 2R7RA 4YUDA 3I31A 1Y3JA 4C98A 2AJQA 1FRXA 2LLZA 1W25A 4OI3A 2D9OA 4ELVA 2HNYA 3D28A 2Y0SD 4B02A 4DV2F 1VRUB 1UJ4A 1X4AA 3HHLC 2RMLA 4OHWA 4RW7A 4QU7A 4DN0A 2B4VA 3DCAA 1EP4A 2WSFC 1RA6A 3KLVA 3HJFA 3FEYB 1M5KC 2ZITA 2WB1D 3N0VA 5CHCB 4Y2CA 1D9FA 3MCSA 1S1XB 3T5HA 3KLFB 2RKIA 3J7A1 5B0CA 1D9AA 3CB4A 4CH0S 3GIMA 3TAQA 2YWEA 3NCPA 3U1MA 2C3PA 3CE8A 3GG0A 2LQ5A 3BO4A 1CQNA 2PIIA 4K5SA 2LQJA 3CCQS 4GMKA 5KFXA 1IBMF 1S6PB 1Q16B 1HNIB 1P8GA 2FVPA 1UVNA 2UVWA 3FEXB 4KGKA 5GVQA 4OJ1A 5CYMA 3TO8A 1XC9A 4FF3A 2GGPB 1QTMA 4K0KF 4NOHA 1XTZA 4CNZA 3DLGB 4NZ7A 5GADI 3CPWR 2PD1A 4H4MA 2VQEF 4Z37A 2QYCA 4N76A 3HLUA 2GC8A 1HI1A 5THWA 4F3QA 4WKRA 4HT7A 3FQLA 2FHMA 5EWEA 1X4EA 2KYXA 4L6V3 1I1GA 3M6VA 3DGPA 3LOUA 4IYQA 4DFKA 2L9DA 4TLQA 4DJBA 1FCAA 4A48A 2AYGA 2PDAA 1S9GA 2B7CB 4NA3A 4XDCA 1SL0A 4B3MF 5JVHQ 3MAHA 2NPIA 3PEJA 5I4MA 5E3RA 3CDWA 4NLXA 1RT2A 2HMIB 3ISNC 2VG7B 3NAHA 2K1RA 3OHBA 4I2QA 2MY7A 3AAWB 2NLWA 3IWNC 3ZFVA 3V4IB 4B3OA 5E3PA 1HPZB 2JVRA 4FXVA 2G1DA 2VG7A 3CDAA 2UV8A 3CXCR 2ZH5A 3Q22A 1S0MA 2HW3A 2MJNA 2PGCA 2RQKA 3HVRA 1VQYA 3L7OA 3MHYA 1VJWA 2LMIA 3RW6A 3CCUS 2R8GA 5G0RB 3PFOA 1YQHA 4D3HA 2OO4A 1M5OC 4O23A 2FDNA 3RB3A 1OPIA 1RISA 3F73A 1OPZA 2PA3A 3OR1A 4I2PA 4I56A 1RT7A 2MMYA 4H4KA 3MR6A 4Q8FA 2CZ4A 1VS3A 3MOJB 1NB7A 3DMJA 4BC7A 4Y3CA 4WCEQ 1IBLF 2KT2A 4ELUA 3FJ2A 3DRRB 4PPDA 3PX0A 1AFIA 1ZM9A 3OBIA 4X65F 3JSMA 5LMNF 2K2PA 2V0NA 2BUNA 1GX5A 4ED6A 5EN1A 2DCUB 1MSWD 2X3GA 5KFNA 1Z2LA 2MZQA 3IGVA 5J1EB 3IS9A 2CPZA 1XR5A 2ZOMA 2L48A 4OJHA 3Q2TC 2QLWA 1C2PA 1UETA 4DS5A 1X9MA 1FJEB 1AUDA 1CC8A 1FTRA 5KT2A 4IOCQ 1TQLA 2KDOA 4KV8B 2BRKA 3S7RA 2IA6A 4YOEA 3TVYA 4BHQA 2DNNA 4QWAA 5A8WA 4CH7A 1FRHA 3UI3A 2C28A 4NLRA 1HR0F 1HWUA 4DF8A 5J2MB 1KSPA 4FS2A 1YRUA 2XS2A 2JJ4D 4AQYF 2AYBA 1H7WA 4X4RA 1HMVA 2AJ1A 3RAQA 2RF2A 4FN5A 2AGPA 4F4ZA 4C0BA 1S6PA 3VAMA 4ELTA 5KG2A 1HBNA 2HNZB 1RTIA 2CPIA 5KFMA 2CQIA 2ZE2A 3SCIE 1S99A 3KLIB 1RT1B 2R2UA 3JTNA 2BE2B 2XLKA 5A6WA 2DPJA 4K2XA 5CCLA 3FSXA 3HVWA 1IR0A 4YFUA 2ZD1B 4JI6F 2R7UA 1UAWA 3KLFA 1J2VA 2CYYA 4RW4B 3CJKA 2MKIA 1NU4A 5K14B 5AE3A 3E8OA 2YKAA 3T1AA 4NWBA 5E3CA 2DGVA 2GNKA 4P7TA 2W24A 4NLYA 4WU3A 2OTLS 2E1MC 4Q7AA 3CCSS 2IJNA 2J7KA 5KG5A 1IQZA 4C11A 5GAHI