4KHPF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4khpF00
5IWAF 2BVZA 5BR8F 4K0KF 1G1XA 2E5LF 2F4VF 1XMQF 1F60B 2UXDF 1IJFB 1N33F 4B3TF 4YY3F 1FJGF 4DR3F 3T1YF 4DUZF 3OTOF 1LOUA 2VQFF 2BXJA 4DV7F 4NXMF 2RJZA 4JI7F 4LF9F 3ZZPA 4X65F 5LMUF 1XMOF 4DR1F 2HHHF 2J5AA 4DR4F 4LF4F 4DV2F 2UU9F 1IBKF 2UUCF 4LF6F 4LFCF 1GH8A 2KJWA 1IJEB 4JI2F 1N34F 1IBMF 1HNWF 2VQEF 4AQYF 4DUYF 4NXNF 1HNXF 4GKJF 4JI8F 2YY3A 4X64F 4LF5F 4DV0F 3R3TA 2ZM6F 2UXCF 1HNZF 4JI4F 2UUBF 2UXBF 4B3SF 4GKKF 5LMNF 1VMBA 4LFAF 4JYAF 4DR6F 4DV1F 4OX9F 1N36F 1N32F 2KJVA 4DV5F 1CQNA 1CQMA 1FKAF 4X62F 4LF7F 4DR7F 3T1HF 1B64A 1G7CB 4JI0F 1HR0F 4JI1F 1RISA 4JI3F 4X66F 1XNQF 4LFBF 1I94F 4DV6F 2B7BB 4JI5F 4LF8F 4JI6F 1J5EF 4YHHF 4B3RF 2B7CB 4DR5F 1XNRF 4DV3F 2UUAF 4DV4F 4DR2F 4B3MF 1IBLF 5AJ3F 4JV5F 1QJHA 4KHPF
chains in the Genus database with same CATH superfamily
3Q8RB 1YBUA 2UXDJ 2KKHA 2A6MA 1R8BA 1GK8A 2DTJA 2YKOA 4WTYA 4M5HA 3FQLA 5HQMA 4LBPA 2O1PA 2QL5B 3CIZA 3MAAB 3KTQA 3AOAA 2D1CA 1FHTA 5KFWA 4ANDA 1HYSB 2D7SA 4CM0A 2HFOA 4QWCA 4G1IA 1T8EA 1CG2A 1C1BB 4QIFA 2X7IA 1PKUA 4DX7A 4C48A 3MMCA 2E7XA 4CH7A 2CVIA 3CDEA 4PWWA 2E5GA 4OYWA 2MLYA 2XGPA 1PC5A 2W9CA 1OQ6A 2BQUA 3SYZA 4Y6IA 3BYPA 2IC3B 5KT2A 2AU0A 4HH0A 2CPEA 1VHFA 2BKPA 1R8AA 1WI6A 2R7VA 2B51A 3M6WA 1N32J 3MEDB 4PABA 2G0JA 3AAWB 4B3RF 1X7VA 3RW7A 2QJ3A 1FF2A 3CIMA 2F9JA 2WVCA 3B8HA 1DLOA 2V2ZA 2BV3A 1Y0HA 5IS2A 3CJ5A 2IM2A 3UN5A 3AOCA 4XPCA 3AB4B 3KMSA 1AFJA 4F8RA 2LCWA 2DYAA 3F0NA 4NYPA 1WC6A 2DD8S 2Q1LA 5E7OB 6FD1A 3BB5A 2B8PA 1TL4A 2HGNA 2VONA 4UOGA 4LMZA 3V81A 3VGUA 1U09A 3U02A 1NO8A 4PUOB 3R5CA 3MMAA 1EP4B 1NK7A 2DGWA 1U0HB 3GZ7A 4UW2A 2DRAA 1J2VA 3KLGA 3LO3A 4IFVB 3LP2B 1K9MT 1TELA 4GKKJ 3CCQS 1N4LA 4ID5B 3EDRB 1XQIA 4I56A 3WX8A 3HHLC 2OPQA 1H6KX 1Q5YA 2WOMA 4NCGB 4XIUA 2HIYA 3POTB 2YTCA 1APSA 2LMIA 2DISA 4USWA 2GIFA 2OFHX 1FWPA 1BWEA 2G2ZA 3UCZP 2UP1A 3OL9A 3ZTPA 2MKIA 2YKNA 4USUA 2QFIA 1UW9A 4DBQA 2ZOGA 5BR8J 3KG0A 1QD1A 4LVNP 1SKRA 3CDBA 2OJ3A 4RNHA 4P7TA 5HO4A 1VRTA 3L7UA 4KSEB 2R42A 3GIJA 1U6FA 2C28A 3M8PB 4TY9A 2HVHA 3QSYB 3D28A 3CC7S 4P6QA 2BOAA 3BR8A 3ELHA 3I31A 1YBAA 2QTWA 5K20B 2HFVA 1D0EA 3CJQA 2XHCA 3PO4A 1SJ1A 4ZVPB 1YRTA 4XDCA 1JLGA 3N9UC 4FKYA 2WW8A 3PDNA 5HN0A 3KLFA 3D0GE 2HQDA 1TZ0A 5HAOA 2Z2YB 2YPZA 1Q7YT 2W9AA 2R8HA 3GP9A 1HQEA 1XIQA 4DSKA 4RBUA 1FE0A 4EZ6A 4WJBA 1TV6B 1TKXB 3R7NB 2OD6A 3MR7A 4ZPDA 4CQ1A 4UOCA 4RUAA 3PR4A 2VJVA 4IOCQ 1B7FA 2NPFA 1NKBA 2IVYA 2W4PA 4MT1A 1MG7A 3G96A 1YK9A 2RKIA 3TX0A 1HNXF 1GXLA 5LL6d 1S1XA 1WEZA 3SIPB 4ILRA 1TKTB 5LJ3Y 4WFYA 4P73A 3ZZYA 3EWGA 2OHDA 3RW6A 1NKCA 3VZHA 3L9ZA 1HBUA 4B3SJ 5LMNJ 2VG5B 4F67A 4N56A 5A76A 1I94F 2Y3YA 4OI0A 2EKYA 3J7A1 3R7SB 5KT3A 3HZGA 2GAHC 2KHCA 2MQLA 4ZCMA 5HQLA 2H3EB 5KFYA 2YX1A 2X1FA 2DNHA 2GHPA 5KFAA 2NZ4A 1NHUA 1TL1B 4M5KA 1RABB 3KK1A 3TA0A 1WOOA 1AZSB 4NXMF 2XGQA 4A8YA 3W3SA 2XNRA 1UA1A 4O44A 3MM8B 5EHHA 4YR2A 1N88A 2OH2A 3RB4A 1HNWF 3R2DJ 3Q8UA 4DFJA 3MM6A 2GMLA 1KOOA 5KFHA 2ZFHA 2Z30B 1JJ2R 4ECZA 3BH6B 3M8ZA 4X4SA 2WAQD 3TO8A 1KQGB 2YQ1A 1I94J 1QUVA 2YWEA 2MZRA 3M9OB 2JOQA 3W2WA 4JI3F 4DLEA 2DJWA 1X31C 1URNA 2FY8A 5CYQB 1SJFA 4RNMA 1HPZB 2C2KB 2ZBCA 3TJ8A 5AE3A 1LV5A 3TOQA 1XMQF 4CLYA 1F60B 4OHVA 3TX8A 5KFMA 2CPXA 3BV8A 3EVWA 2EG1A 3MHYA 5B09A 3MAAA 3GFXA 5DZ7A 2UVUA 1S9EB 4F26A 2J5AA 1HYSA 4B3TJ 3JQJA 5BYSA 2R7OA 4J91A 1C1BA 4X4QA 2MZTA 1X9MA 2ZC4A 3HJFA 3BQ0A 1LWCB 3CNQP 4P2XA 4ZVHA 3KUHA 3E2EA 2X1AA 5CCLA 4N5SA 1NDCA 2RU9A 1S49A 1Z2LA 1T94A 1WC0A 4OJGA 2IC3A 1XR5A 2Y1LB 2GX8A 4JI3J 4FXWA 4DSIA 3W2VB 2L41A 4DN9A 3BGFA 3MEDA 5J2NB 2BRLA 3DN9A 4PYAA 3DDKA 3HO1A 4ZA1A 3GJRB 2DNGA 4YS2A 2JC0A 4ZLPA 1XMQJ 2YWHA 3ILOA 1YITS 4LFBJ 3TUJC 2BVZA 3CT9A 3D6HB 1S0VA 4RNOA 1F5CA 4M8LA 3MXHP 4NRTA 1RHKB 2X1GA 5KG2A 2DEIA 3MR6A 1S5ZA 1SVDA 5HMYA 3H7HB 3DYAB 4BBYA 1C0TB 2CQHA 2E1MC 2I9SA 4P71A 2ASJA 3RR8A 3RZAA 3W64A 4M5IA 3C6UB 2MQMA 3CCJS 3G8SA 3QAEA 4WXWA 5F8JA 1HIYA 2L08A 2W24A 4PUOA 3JTNA 2FY1A 3MCSA 4NYZA 2ZE2B 4ALZA 1SC4B 2NYHA 1NJZA 5F8LA 1P9QC 2G0IA 1U0HA 3V5RA 2DHAA 1DAXA 1JLAB 2A3JA 3LP2A 4OJHA 3TR5A 4C98A 2R8GA 1VRUB 3Q8QB 1OSDA 3BYRA 3HMJG 2N4CA 1E6YA 2AYMA 1J5EF 1RTDB 1QLNA 3POTA 1RP5A 2DBBA 5HSPA 4DR2F 3ETMA 5CQGA 4F3QA 5EWFA 1R6VA 3HHLA 2AGPA 1GNKA 1NJWA 5DQIA 4H4KC 2Z2ZA 4ZS6A 3EUNA 1DQ9A 3JQKA 1AA1B 2IJRA 2BQRA 4O3NA 1ZM9A 4ZJQA 1HHSA 3AODA 3D1QA 2E9ZA 3NY0A 1F0XA 2K8GA 3M8PA 3HSDA 3VAIA 2ERRA 2H9ZA 1Q82T 2ROEA 3N5FA 3FJ2A 4L76A 2AD9A 3HP6A 2EBGA 3BO4A 1ZAXA 4DI6A 2C2DA 3D3BJ 2AEMA 4EYHB 2AEJA 2N82B 3GIKA 3P8BB 2I2YA 4PG6A 4DR2J 4X4UA 3OVSA 2Q43A 3M4XA 2MTLA 4OX8A 2IMWP 4FBUA 5KT6A 1RWUA 1LWEB 4WP9A 5EUHA 3H90A 3C8YA 1YTYA 1TV6A 2AMCB 1TKXA 3PHTA 1EJ7L 3OTOF 4KH1B 4WK1A 5ADZA 3I87A 3CJ8A 2GJ2A 1RWPB 1HMVB 3OXFA 3KLIA 2LXIA 1GH8A 4JI7J 4K59A 2IA6A 5D4LA 3M8YA 2MQQA 4CWBA 3Q2TC 1FJEB 5B0FA 2Z2LA 1TKTA 4DU8A 2CYYA 5CD4H 2YH0A 1RWVB 4DR6F 5A0YB 3US5A 1DFDA 1TVRB 4NWBA 4A8KA 3T9NA 1Q95G 2VG5A 3IBWA 5THWA 4DR7F 4MYUA 4IQMA 3L3CA 4ER8A 1UFWA 2FJEB 1YQHA 2NREA 3K89A 2P9GA 3NEKA 2ZD1B 2Y0SD 3ENVA 1HNIB 4I4BA 1RB0A 4TN2A 4HTJA 5IWAF 1G1XA 3KJVB 3PRBA 5HMXA 3OFEA 1ZA1B 1TL1A 4H54A 4KO0B 2AW0A 2RVJA 5F9NA 2MJNA 1AZSA 3GV7B 1X5TA 4IOAQ 4X65F 3MM8A 2CJAA 3HVTA 1BY9A 5F8GA 4ILMA 1IR1A 1VQSA 4OHXA 1MWYA 2XMKA 1R8CA 4F02A 3C66A 1ZPVA 4ZVSB 5KFKA 3EXCX 3KK2B 4DL5A 2ZHOA 4CLUA 1VLYA 5HJXA 5KFGA 4UOHA 1S6OA 1WORA 2Z57B 4KT0C 4Q8EA 2ZM6F 2CAJA 1MNEA 4D3GA 3PZPA 4LFAF 1TL5A 4ZN3A 2KM8C 1HWLA 3NCQA 3HKZD 4AUKA 1DRZA 4OI2A 4LR9A 1O8BA 3R9LA 4DR7J 2CPHA 3PTWA 3RAQA 3QLHB 2ZH3A 1X4GA 2NXCA 3I9V9 1Q4RA 1DQ8A 1IBCB 3G87A 4X84A 2FTRA 2ZWOA 4RW6B 5CYQA 2DGUA 1TL3B 1YDLA 4DSLA 2AX1A 1YKWA 1RKJA 1FRHA 1A7GE 5IFMA 1HPZA 2OEKA 4I69A 1VK3A 4HHJA 4KGXB 4DX8H 4DF8A 4I6YA 3DLHA 2FLNA 3UN3A 5AXLA 2LEAA 2BJ8A 3ISZA 3HJVA 2KXNB 3A8EA 3J7AN 1DQAA 5JXSA 2QL7B 4BWMA 4KHPJ 3I6PA 1S9EA 3MM5A 2HRYA 4P74A 2NXJA 4RUBA 2VOOA 4B3OB 1IVZA 1ICEB 5IXUA 4DPXA 2QMWA 1U02A 4DG1B 2HMIB 1S6QB 1UTAA 5K8OA 4EBEA 3RB0A 2JEJA 1KP6A 3UDEA 1VBKA 2H5EA 1JWWA 2DNQA 1LWCA 3PIOQ 2ZM6J 3G6YA 1UWBB 2JZ5A 4LIWA 2MY8A 4X64F 1V3RA 4QZVB 3LAKA 5JJBA 3FEZA 1F1BB 1JK9B 4XPEA 1U47A 1IKVB 1VHIA 4NX9A 3TANA 2FJVA 3GIRA 3W2VA 3OTCA 4AXIA 3RB6A 5J2NA 1DJ0A 4RL1A 5CH7B 3W63A 3TVZA 2IA0A 4LF1A 5BXIA 1U25A 2XYGB 3PJ9A 4UT4A 3GONA 1N54B 3E3XA 2B3TB 4JI0J 3H98A 3M8RA 3KG1A 5DDOC 3IRXB 2ASLA 2X3DA 2GHVC 3M05A 4KGMA 5HMZA 1Q16B 3DMJB 1OO0B 2NCKL 2DR6A 1FFSB 5AXMA 4C3LA 5AXKA 2VBYA 3DYAA 2GQCA 4NLGA 3NL0A 3LGHA 1QUPA 5ETQA 4K2JA 3SCLE 3O2IA 4LT6A 1ZS6A 4LF9J 2RQKA 2XY7A 2M8DB 5KFEA 2XHWA 2ZE2A 2ZUGA 4CO1A 4NA3A 4QIEA 2HGMA 2GC8A 2R2SA 4J9NA 5I3QA 1JLAA 2FHKA 4HTIA 4ED5A 1HW8A 2IVMA 3AHPA 2B0GA 2MQPA 1KLNA 5DJBA 4HT5A 1FKPB 5ETRA 2X1BA 4O4GB 4QCLA 1VRUA 3GJSB 2HHUA 4MKBA 4OX9J 3RBXA 2RT3A 1N5TA 1Q0NA 3P4UB 1S4FA 3WDOA 4X4TA 4DV3F 1V6HA 5AJ3F 3VWSA 3PCOB 4CIOA 4CO0A 1H0HB 1RQ0A 3SXLA 1BUXA 5LXRA 1OQ3A 4FYDA 2VQFF 5U47A 1VYAA 2OPRB 3HD2A 4ED6A 5E3AA 1LWFA 3RU0A 3W61A 4H4KA 1MMDA 4NA1A 5LM7E 4LF6F 1AW0A 4E8UA 3PNIA 5IT0A 4DU7A 2BOPA 4K8RA 4YDDB 2FJAB 3KHRA 4ZVGA 2EFPA 3OSNA 2QLXA 1WKLA 4Z7CA 2DIVA 3FCWA 2V4JB 5HMWA 1CULB 3N6MA 3BS9A 1FKAF 2I8EA 4PRFA 4X4PA 1N5SA 4CH1A 2R8KA 3PYGA 1YJTA 1TUGB 4RBTA 2VB6A 3KXDA 2C2MB 2L9NA 1RU2A 1K73T 1LWEA 2J9EA 3H5UA 5KFTA 2MZJA 2GJFA 1XC9A 2FVSA 4ED3A 1FFGB 3FGVA 5EWEA 3IN5A 5IQQA 5CA5A 4KE5A 3I4HX 3I9ZA 4DUZF 3A3OB 4IQXA 4FDFA 2BXJA 1UVJA 3MOZA 2A10A 2CG8A 4LF6J 1R89A 4DQRA 1BE4A 3IBCB 4ELUA 4CP5A 4O3QA 5LMUJ 3FZ2A 3CEDA 4LF4J 1M1KT 3WZ0A 4DQPA 3Q86A 4K4WA 4OV1A 4QR1A 3ZZ0A 1IBMJ 5A0YA 4UY8T 3W62A 4DUYJ 3O6QA 1TVRA 1CQMA 3NWRA 2VPXB 1ZZNA 2F63A 2LQ5A 2K7KA 4B9SA 4L6V3 4DCOB 2VA3A 3LH2S 4ETZA 1NJXA 1S48A 4OQJA 3PW0A 1HWJA 1RYRA 5GMKa 2ZD1A 2ZWPA 1HNIA 2HFZA 4Z2XA 3KJVA 4NLSA 1V9OA 1UFLA 3JSMB 3CWJA 3TW0A 4KO0A 4DUZJ 3DLJA 1AUSL 2GAGC 3Q8VA 3EPIA 4DWIA 3OT9A 1VBXA 5A8WB 3QNWB 5A2QU 4DR1F 2EFOA 3TI0A 3KK2A 3M9NB 2IBKA 3QZ8A 3CCWA 1YLXA 2AT1B 2CNNB 4B9MA 3RBEA 1KKHA 1SQGA 4MAKA 3UN2A 2I0XA 3V4IB 1JXVA 4H4OB 2VQEJ 2MEWA 4AL5A 3CGIA 3H42A 5K14B 3QLHA 1Q81T 3FFIB 1ZBTA 4J9SA 3NP5A 4R8UB 4RW6A 4WFBQ 4TU7A 1TL3A 4BC9A 4USIA 3GG0A 1NJYA 1Y9OA 2V2KA 2C2EA 1XNRF 1FERA 2R2TA 3CO9A 2RRAA 2KYZA 1YZ7A 3M8QA 2C3OA 2DH7A 5DO2A 4EFAC 4MIWA 1JXEA 2QLFB 1FJGF 1E6VB 3I96A 2V68A 4Q45A 2B56A 1Y4ZB 2DNPA 2EVZA 3N01A 3RRKA 3DLBA 3BN4A 2F3JA 4B3OA 3M32B 4DG1A 1N56A 4PCQA 2G2YA 3I0RA 3EICA 2XC9A 4URGA 4N77A 2OO4A 1S0MA 2C3PA 3BDEA 2V8DA 1UWBA 1U1KA 2IRUA 3UWTA 4TLQA 3SEOA 3G8TA 4Q44A 3BR9A 1KQKA 3OLAA 4WPAA 4JYAF 3C14B 1HBNB 4O3SA 4QWDA 2VC0A 1FK9B 2WTFA 5EGYA 3T9ZA 3M1VA 2AEFA 2LEPA 2XZTB 5HROB 5HJYA 3OD2A 4CO3A 1JLBB 3Q8PB 2RSQA 4A8FA 3IRXA 1JXLA 1RA7A 4GO5X 3WC2A 1R0BG 3PYDA 4Q8FA 5F3TA 3TEGA 2F8MA 3V2UC 3V6DB 1VI7A 2AYBA 5EX0A 3PFEA 5DETA 1RT7B 1K1QA 5CZXA 3MFHA 3R2CJ 2BE7D 2NZCA 3OXGA 1NSQA 1T03B 2V2VA 4Y65A 1JMTA 4PG7A 4DL6A 4Y2CA 4U95A 4TKTA 2RDDA 2B9EA 1D9FA 3IGNA 2G4BA 2UXBF 1PGZA 1D1UA 1ACMB 2DO0A 2HLTA 3G6XA 1YGYA 4KKOB 1QAXA 1WEXA 1FKPA 1K1SA 2FHOB 4O4GA 4TU8A 3PKYA 3MD3A 1A0OB 3C19A 5A2QY 1XR6A 3T5KA 2MYFA 4MK7A 7FDRA 1DHMA 3MECB 5C5JA 1PILA 3T3FA 3M9MB 1TP7A 4IRKA 4QW9A 4EU0A 5GMEA 2PD1A 3MCNA 5FD1A 1QSYA 4X4OA 1M90T 1HBOB 1TMMA 3Q0AA 1LOUA 2JC1A 3JSRA 4C3KA 2OPRA 1HFEL 1HQUB 2IAJB 1P27B 2XMAA 2GIRA 1WJ9A 4PKDB 1ZETA 1X8DA 1B0PA 3TRGA 1NK6A 2OUGA 3EGZA 4G6VB 3VR1A 2FVRA 2XMUA 1XWLA 1ZTTA 6FDRA 2MSSA 3KHGA 1RT6B 2ZBIA 1LEOA 3NKYA 4W90B 1V3ZA 4PWDB 4QPXA 1CULA 3JAMY 3FKBA 2CKWA 4KHRA 3B6BA 4RNNA 2VOPA 1Y7PA 1BHNA 4NMLA 4U7UK 3AD7C 4WZMA 3WBZA 3HHNB 3I56S 4LF7J 4RW7B 2R3VA 3JSYA 3CJSA 4JI5J 2G2OA 4PR6A 1O5JA 2PT0A 1GTHA 2JFKA 1RUSA 4WK3A 4BS2A 5HK4A 1L3UA 4U6PA 3RBZA 4WCEQ 1SQEA 4Y34A 3CJ2A 1RAOA 4YR3A 2FLLA 5KT5A 4NLTA 2BQ3A 2F4FA 2UU9F 4B9NA 3KHHA 3UDVA 4F4ZA 2CQDA 2XMMA 1TL7B 2MKHA 4CNZA 3PV8A 4FF3A 3EZ5A 2CPZA 3IMQJ 4RW9B 2A2DA 2C2ZB 3T6BA 4HR2A 4CLKA 2GGPA 1FEEA 2UXCJ 4NZ7A 4PG4A 3CDUA 3PJXA 3BPSP 5HP1B 3MAQA 2CWKA 1K0VA 4IH7A 5F8HA 1JLFA 2J6SA 3JSMA 2EFQA 3PYFA 1NK9A 2ZNYA 2P8IA 4CT9A 2ZHAA 4FPRA 1JKHB 3IC1A 1HI0P 3C16B 4C11B 2I38A 2OIHA 3SZ2A 4OV6A 5A8WA 2HS3A 2V8PA 4HKQA 1RTZA 2MQNA 1DARA 4LR7A 2C42A 3J80U 3IWXA 1W2BR 1H2TZ 2CQGA 4ZVEA 1A9NB 4OZ5A 2W4CA 5IV3A 1VQ7S 2B9YA 1OWXA 1KRPA 4FBTA 4W4MA 2XULA 1H38A 2NR0A 3QGIA 4DPOA 5IZHA 2ZUAA 4JI2J 3V4IA 1M5SA 1N36F 3ZZZA 2GS8A 5K14A 5I42B 3VGVA 1S79A 3RRHA 4HHHA 3ZNUA 2J8SA 1SL0A 3FFIA 2XYPB 4R8UA 5DG9A 1FDBA 1UPMB 1VQLS 5GVQA 4OYAA 1R8HA 4ZIVA 1U6ZA 1S59A 5GAHI 2PN6A 4K4SA 1RHQB 2A0FB 3MPYA 3PX0A 2XG8A 1Q8IA 4LIRA 3AXKA 3T5HA 4F3MA 1VISA 2CDRB 3QGPA 1N48A 5EN1A 1WG5A 2QA2A 4CLPA 3HVRA 1E6VA 2E29A 3IR5B 1EARA 3PYEA 2MQ8A 1HBMB 5KG4A 4FS1A 1OPZA 2YNGB 2LECA 3BGUA 3M32A 4Y2KA 2AGQA 1WOPA 2XS5A 3KLHB 5HANA 1F5AA 3H59A 1TK8A 3MPUB 4OLPA 4EBDA 1FVSA 1NHVA 3LP1B 2HAFA 1L3KA 3C14A 2VV5A 3FDSA 2W2QP 4DL2A 1FK9A 3HFZB 5HATA 4B9TA 1YJVA 3ADAC 1HR0F 4DV6F 5HROA 1CS4B 1MSWD 4ZPCA 3D7SB 1S9FA 3RBDA 1KNZA 4FPIA 2D3OR 3IO1A 2WK4A 1EHWA 3R5JB 1EZZB 3NGDA 3CCTA 2HBRB 3HSJA 4C0OC 4OZ1A 3HCXA 2QEXS 1VDHA 3C3LA 2BUNA 4DSJA 2P6TA 3V6DA 4J9QA 2HHPA 2XB2D 1WF1A 1RT7A 5J1EB 3CCRS 1FDNA 4LUBA 4C8LA 4QIWD 5E3RA 1U49A 3EPGA 5HL7Q 4NLPA 4ZVQB 2CQ4A 1Z1ZA 1O6XA 2E5HA 5IT4A 3R1HA 1U1OA 4NYOA 4K5SA 3GFZA 2GO8A 1JJHA 4W98A 4KKOA 2CZ9A 1HI8A 1S6UA 4YB7A 4YEAA 5IV4A 4RUHA 3J80Y 4Y2MA 4HEA9 1I1GA 5SZTA 2B4UA 4ZP8A 5D4PA 3MECA 5L1JA 3GTYX 4LF8F 1CJKB 3MMBB 1ZM2A 3CCZA 1YWXA 3T1AA 5E2QA 3OVAA 2RMLA 1U2FA 2HS4A 5ITHA 2PIIA 1CEZA 1FTRA 4C4WA 1RA6A 1T3OA 3MUVP 3BKUA 1HBOA 3DU6A 1ZPWX 2G13A 1S76D 3TWZA 4C7QA 1T9WA 4F0HA 3N79A 2SXLA 1HQUA 4I1TA 2IAJA 3AQOA 1BMQB 2XSJB 2OPPB 2IJFA 1RHUB 4KTQA 4Q7AA 2GV1A 2L9DA 4NEZA 1S6PB 4I6WA 5KFCA 2HNZB 1HHTP 1YX2A 4O23A 1WF0A 2JEIA 1WSVA 4W92B 1XERA 5T14A 1RT6A 3K7RA 1NCLA 2DNMA 3MUTP 2C2NA 2XM3A 2OD4A 4ZVRB 3JSBA 1L3SA 2FZCB 1N0VC 3KJQB 2JLGA 2YVSA 4QQBA 1F3FA 1WKJA 5KTQA 1VC6A 2IVFB 5F3ZA 4LF8J 1DY3A 3ZO7A 1JLQB 1RJJA 1YJ9S 3KK3B 2EFVA 4YHHF 2AYGA 1I3OB 2VG7B 2MDAA 2NYIA 4ZLNA 4URQU 2KVQE 3S6EA 4LRAA 2E5LF 1P6TA 5ETOA 5KFQA 3CW2C 2DHGA 3QWUA 3BH7B 1YRUA 2XCAA 4AT1B 1TR0A 2FDNA 4DR3F 2HK2A 3FUYA 1R6YA 3BDPA 3ZZPA 4OZNA 3VVUA 1PJ5A 1OY8A 2FC9A 5D78A 3P96A 1WKKA 4LFCF 5DRKA 3W7BA 2DKOB 3EZUA 1B7YB 4MTPA 3D1HA 4ECQA 3VV2B 4BC7A 2CJYB 1S0OA 1TL7A 4F25A 2UUCJ 2WONB 4F0KA 2BR0A 2QN6B 4USTA 4IG0B 2W2NP 3D1OA 3PACA 1RTIB 1CSJA 2HVEA 1UJ4A 1R43A 2HWTA 2QIFA 2Z8QA 4RJVA 4HHUA 2GMHA 3NGKA 1WG1A 2NSBA 4D3HA 4RLEA 4IDKB 1NKEA 4DPTA 5HP1A 3RYLA 2R7XA 2MJUA 4YB1P 3QRPA 1JNRB 1VIOA 3RJMB 4JP8A 1U2CA 3QSIA 3TJ9A 3WX4A 4K0KF 2DPIA 3PY8A 1U2RA 1R0AB 4HYKA 1IKXB 3LQVA 4DX5A 4LBHA 3GV5B 1JKHA 2HQGA 3GIMA 3PO5A 2W9BB 4C11A 2RDJA 1TK0A 3DOLB 4GMKA 4QYRA 2FHJD 4LQ9A 2CPFA 3A8IA 2R7QA 3CCSS 3MTKA 4OYOA 3P5BP 1MROB 5K8PA 1SH3A 3WHIA 2YNHB 2PE8A 3EZOA 3IBFB 1HL6A 3IR6B 3K58A 1KC8T 2UVWA 1RAAB 4G3IA 1C4AA 4IR9A 1UETA 1WHWA 3QBCA 2GZOA 3ZFVA 5ETLA 2KO1A 2ILYA 2DNZA 2WSEC 4YOEA 2DGQA 5I42A 2VDHA 3HHDA 1XMBA 4KQZA 3UO0A 4X4NA 2G1DA 5I3UB 2CQBA 4ZPBA 2AX0A 2WSCC 2YWWA 5KG6A 4C2MA 2Y1RI 2KRBA 2V6AA 3FSIA 2DNOA 4FKXA 1JIHA 4ED7A 2JL9A 1XK8A 4WU2A 1JLCA 1ZM4A 1LW2B 5H9EK 4B17A 2NQPA 2YX7A 2BRKA 2W7PA 3HFVA 3GV8B 1RAIB 2PI5A 2ZOMA 1N33F 1RT1B 3N28A 3GPAA 1HBMA 2YNGA 3OL8A 2CG4A 3CMQA 4DL3A 2LDYA 4RPFA 2UV8A 4WIQA 4ATNA 3KLHA 5K5MA 3M2UB 3OR1B 4DQSA 3DRSB 1XEZA 2M4MA 3KFWX 4A8QA 3H0PA 2BE2A 3GR0A 3DGVA 3LP1A 4P7VA 5HBMB 4KFBB 5ETMA 1UKUA 2R2RA 5L38A 3V6HA 3OR2B 4JI4F 1WNEA 1FXRA 3RTVA 2ADBA 1RWNB 1PAUB 4AL6A 2UVRA 1S7IA 2L3MA 4E98A 2POKA 5AT1B 3NNAA 5DDPC 2HZCA 2FZKB 1D09B 1CS4A 2HVIA 3QT6A 5B7WA 4ZMMA 5KG7A 2HIQA 1GXUA 1NH7A 5KFBA 3M7VA 3VAJA 4OX7A 4RBVA 4MKAA 3C2PA 1HNVA 1F2HA 3UD4P 2V4RA 4GO7X 4M5NA 2ZH5A 4DR5J 3TZZA 3VCDA 4FVCA 4NLOA 2RU3A 2FGCA 2YNIB 5KT4A 2CJKA 2UUWA 3D66A 4M5JA 2F4VJ 3HVWA 2DB1A 2CPJA 5J1EA 2JSXA 4HI2A 5E3PA 1X4FA 1SIZA 4PEOA 5GAHU 3K5NA 3AOBA 2IM0A 2B5JB 5LJ5Y 5J2PB 3CDAA 1YJRA 2MQOA 4F4KA 2Q3PA 1LQ9A 2MHEA 4AQYF 2H54B 1UEVA 5C25B 1VBYA 4M63A 4CLLA 4AE5A 3BQ1A 3IM8A 1S72S 2AJ2A 1VOMA 4F2SA 2WBMA 2D69A 3GLJA 2E7VA 4FYYB 1BQNB 1N32F 3CJ4A 3M8WA 4ITSA 4HI1A 4RW4B 3FCVA 2PFFB 5GAGU 2KXHA 1U1LA 3CJKB 1UP1A 1R0CB 3MM9B 3AB2B 5IOLA 1S1UB 1MLAA 1CJKA 4QYZK 5EWGA 2HWHA 1YJUA 1Y3JA 5CYJA 3G6ES 4ZCIA 2QA4S 2KFNA 2UVVA 2HGLA 3L09A 4TU9A 1WEYA 3CO0P 4JV5J 1RCXB 3CPWR 2XSJA 2OPPA 4NZ6A 3SCKE 4WE1A 3SQGB 1S1WB 5CXTA 4DR4F 1S6PA 2HNZA 3PW4A 1OYDA 4AQYJ 1CLFA 4ECXA 2CADA 1KONA 4MKYA 1FESA 2RH3A 2D3UA 3NAHA 1T9VA 1RWMB 4GKKF 3ZZOA 4P2FA 4OFZA 3U1MA 3PW7A 2J0SD 1VQ6S 2ACYA 3MCOA 2ZHBA 2MB0B 5D0RA 4RUCA 4IUFA 1JLQA 1Y10A 4ECUA 3KK3A 2D9OA 2VG7A 3TARA 4A47A 4LRBA 4NLVA 3HD1A 1VR6A 1WF2A 2ACMA 2KDOA 5BR8F 4ZPVR 4L75A 2J9DE 1GMVA 1NHKL 3KLVA 3W5ZA 1T7PA 4DR4J 2JVOA 3W5YA 5BJRA 3UCUP 4GVBB 1WACA 3ET6B 2YKMB 4WP3A 4P9SA 2WBRA 9ATCB 2OFGX 4UOFA 3CCLS 2AIRB 2WONA 2C1EB 2XWXA 5KFJA 5BYQA 3B4MA 1RTIA 4DXLA 1D8ZA 4DLGA 3H2UB 1LK7A 4OHWA 3KJFB 3GCXP 1M5PC 2F9DA 4M5DB 2P5VA 4KJIA 3GMGA 4RO0A 1NDPA 2RHQB 3PRVA 1RISA 3B82A 4IDKA 2CQ1A 2V5HG 1OSCA 4ID8A 3CJ0A 2Q6BA 1Q78A 1HQ2A 5JVHQ 1H3DA 3IS9B 1RGVA 1R0AA 4I68A 1IKXA 1BD6A 4RNFA 4RU2A 2HRTA 3DOLA 2RILA 3QAUA 2FVCA 4ZVTB 1IWAA 5DS7A 1U48A 3A3NB 2XYHB 1MROA 4JV0A 2HQFA 2RHSB 3CCES 4QU7A 4O0NA 4C8OA 2YNHA 2B43A 4FVMA 5ETNA 2HFUA 1XMOJ 1SBRA 1WTBA 2BANA 3I0SB 5CHCB 1ZAWA 2ZH1A 4B3SF 2F7VA 5LMNF 2CXEA 2WSFC 4OYMA 2FB0A 4ED8A 2GVDA 5M2RA 3MWBA 4MK8A 5I3UA 4A8MP 1ZAVA 3Q8YA 1U0SA 3G9CA 1KEKA 1WSRA 4U7UD 4ANCA 4DSEA 1KQFB 1UZDA 4RKUC 1SC1B 2PI4A 1UA0A 2H5IB 4M5LA 1LW2A 5ETPA 1IR2A 1H73A 3GSIA 2Y1JA 2R7WA 1T11A 1WD6A 2DGXA 2FVQA 2JVRA 1FA0A 5AE1A 1RT1A 4QR2A 3DI6A 1EB0A 4C6AA 2W8LA 4LRDA 3OJUA 1IKWB 2NPIA 3BBFA 2W2MP 1X0PA 4NEYA 4NL5A 3EMTA 4OYXA 3M6XA 1F5BA 3MR2A 3T1YJ 5KFPA 3OR1A 3UD5A 2RF2B 3DRSA 5KFZA 2BBEA 2BE9B 4B9VA 4KFBA 3SDEB 1U8SA 3OR2A 2DCUB 3AFGA 3DOKB 1WDDA 1PC4A 3Q23A 4KAIA 2K3KA 2QSWA 2EEYA 1QTNB 1RAGB 3CCVS 1U45A 1KSPA 1FD2A 2BJDA 2RNEA 1T02A 4M1KA 1UJ5A 1S1VB 2GFFA 1JX4A 3CUNA 3CCMS 1H98A 1HARA 2OLWA 1G3OA 4EO6A 2CQIA 4ECVA 3SFGA 1PCAA 4PYDA 1S77D 4Y0FA 4O3OA 2VDIA 3NOCA 4QWAA 2EG2A 4B3TF 2YNIA 4USHA 5SUHA 1KN6A 1SV5B 2A18A 2C2RA 4PQAA 4QW8A 4FYXB 4U96A 2B5JA 1H72C 1M5HA 5J2PA 4IG3B 1DTTB 1ZM3A 3TAPA 2PMWA 2DGVA 3I55S 4QOTA 2WW4A 4ECYA 5ETVA 1B0VA 4ZVFA 2HFSA 5BYRA 5KFVA 3MPWA 4NE9C 1RACB 2ZJQQ 2DHXA 4RZRA 1NUEA 3D2WA 3TZXA 5D3GB 4GKJJ 3UVJB 2YNFB 2DCLA 3QZ7A 4EMDA 2KXFA 3GJTB 3CJKA 2LQBA 4XDDA 3MM9A 2DNYA 4LFBF 2LU2A 1S1UA 2MY7A 4DV5J 3KNAA 4FXVA 5B0EA 5KOXA 3T6JA 4U7CA 1RHRB 3CJ3A 4MK9A 4TVAB 1S0NA 4DZ6A 2E5JA 2C22A 1I6JA 2UV8G 2ZEJA 1T9TA 3Q2SC 3S1TA 3OFHA 3GYNA 4KY3A 3SQGA 1S1WA 2X51A 2E9TA 3NGTA 1VIXA 3TAMB 3PHEA 4NLWA 2FHJA 1KTQA 1G4CA 2U2FA 1XN9A 3RRGA 2ATLA 2I1RA 4MIBA 2OMOA 3CMES 4QU6A 4PWUA 2J8AA 1FFWB 4F3OA 1K44A 1ZTWA 3PEJA 5A6PA 2GCFA 3J81U 1D3WA 2AHOB 2FVPA 2R7RA 1N34J 4P2SA 5DZ6A 1RAFB 2V9WA 1VQ4S 2JRSA 2ZH9A 1R8PA 3KG4A 2CZVC 4N41A 2F65A 4OLOA 5KFSA 2RS2A 4U9RA 5A6WA 2LDIA 3HT0A 2FHMA 5LXYA 5M2PA 4J9VA 3QT7A 2YKQA 3ZNJ1 4MH8A 2AJ0A 4R0EA 3NCPA 5IQ6A 2FJWA 1KHVA 2MZ1A 2XBPA 3ZZRA 2BYCA 3N0VA 5KFXA 2BM0A 3M2VB 5B08A 3M6UA 4WYWA 2M0GB 4GVBA 3KYLA 3NOGA 1EP4A 3ET6A 4OYBA 2YKMA 2D3O1 1FT8A 3S01A 2HHXA 2VPYB 3ETOA 2V63A 4IFVA 2DT9A 2ASYA 1LNQA 3SCJE 1NAQA 2PSZA 4ID5A 3KLEB 5D6GA 2ROGA 5A8KB 1SJ4P 1TK5A 1VQMS 1WC3A 4NCGA 3AD9C 4WYLA 2B9WA 4OZ0A 2DXFA 3I5AA 3TJAA 1OY9A 4M5DA 4DCPB 2UUBJ 1IQZA 4MFBB 3R97A 4ELVA 3V81B 4X4VA 1C4CA 1JLEB 3MR5A 5MAOA 4OI3A 8AT1B 3KKFA 3NG8A 2BJ3A 2E7WA 3GFHA 3MMAB 2MZSA 4P2MA 2MSTA 3QQCD 3R5DA 1KBRA 2QMXA 4Y2AA 3F56A 4KPCA 1ZYQA 1KTVA 2FJXA 3HT3A 2VODA 2OPQB 4KR0B 2EW9A 1S97A 2LQJA 4JI7F 4R0JA 4DQQA 1X4DA 3R7BB 3O44A 1MMLA 4IRCA 1SC3B 3AY0A 3PVXA 3DFEA 5H9FK 2EI5A 4KC5A 3BGRB 1FNXH 3I0SA 2EC0A 3CJTA 5T7LB 4DMZA 5DGAA 2DY1A 2CWXA 4L3NA 3G86A 4XAKA 2RD5C 3GQCA 4FYVB 4AXJA 1LXNA 4ANEA 3LTOA 3UFCX 3D4JA 4CRJA 2B4PA 4ECWA 3UI3A 5GAEI 2M9KA 2JEFA 2V8VA 3IXQA 6AT1B 1W26A 3J7Z5 1N0UA 1RT3B 4J9OA 5KFNA 1QDUB 2DO4A 4EI2A 2B6AB 1FE4A 1T9XA 4KV8B 2IJNA 3J81Y 1NDLA 3D0IE 3WC0A 1IKWA 1D9DA 1EETB 4Y3CA 2XLKA 3HVAA 1D8YA 4WWSA 2QYGA 2JJ4D 2EBEA 5B0BA 3EYZA 4S0MA 4QIGA 2OTLS 2RF2A 1TKZB 3BEGB 3QIDA 2EK6A 1FX2A 2Q66A 3HSZA 2COLA 1GMUA 3DOKA 2AKWB 2ZDPA 5E3QA 2VD3A 1CPZA 2UZAA 3CULA 2DVIA 2R7UA 1SJQA 3NCRA 1UAWA 3HHEA 4ZCLA 2GW8A 3HHKA 4ED4A 4K4YA 2V4QA 2LXFA 1S1VA 1UVKA 1S7HA 3VVTA 4F4XA 3FCHA 2WVBA 4PPDA 3MFIA 2F1FA 3W9HA 4OJ3A 4OI6A 2ZITA 4KHPF 1Y5IB 4UQTA 4K4XA 5LSLA 3GWCA 3A1YG 3K2YA 1IJFB 4NLYA 4L3KA 2KT5A 3VZIA 5GADI 2AJ4A 2VBXA 3BM7A 3NRBA 3IG1B 4J5OA 2QX0A 1BXNA 2QMUB 2HFNA 1J5OB 4IFYB 2ZDOA 5L39A 1MW7A 3W9JA 2IY5B 1TUVA 3K5PA 2ZVIA 4DV2J 3LOUA 3S7RA 1XTZA 2GMJA 5D3GA 3JQMA 3QGHA 3D54A 3GB0A 4WBFA 3UVJA 3D67A 4XO0A 4BLGA 2CFXA 4NLUA 2K06A 1S4EA 1RYSA 1IR0A 3LALA 1S57A 1RAJA 2JLFA 4JI0F 1XNQF 4F04B 2BM1A 4CI0B 1RZMA 3SI8A 1SUQB 2F8HA 1BQMB 2A6OA 2DIUA 4GC6A 4X66J 1MN7A 1UVLA 2BW7A 1NB7A 3GIIA 4FZVA 5KFIA 2QYCA 5T41A 1RADB 3H5YA 4UF4A 3DHXA 3M30B 4RWXA 3J7YI 1N5VA 4LF9F 5KG5A 2PEHA 3TAMA 2FZGB 2HHHF 3IWLA 1X5OA 2P6SA 2J7KA 4R25A 3I32A 3UDLA 1XBWA 5AE2A 1RAEB 2YWKA 3UE2A 1A6LA 2M52A 3NGUA 4Y28C 3PJWA 3ILIA 2GNKA 2CA9A 1RT5B 4A8XA 5DM6Q 2KL8A 4FYWB 3DC2A 4OX9F 2W2PP 4UQGA 4M94A 1XNQJ 1X4CA 2KH9A 2OELA 4C8MA 1TFYA 4USJC 2ZZTA 3CD7A 4DL0C 2B7CB 2OPSB 4DL7A 2DHSA 2E66A 4LR8A 1C0TA 2Z4PA 2VFTA 3C46A 3AJ2A 1QAJA 3IR7B 4F36A 3Q22A 2HW3A 4JI6J 1H2UX 2R8JA 1C0UB 1SQFA 1RU1A 2ZJPQ 1S10A 2ZH7A 3C6UA 3M2VA 1WHVA 4DV7F 2HHHJ 3EE3A 4KGVB 4HDHA 1YZ6A 3R5BA 2IDEA 1WOSA 5FJ4A 4TQRA 1RTHB 5AXNA 3CD0A 4B9LA 3KJNB 1K47A 2KVIA 2FD2A 5F8NA 3RAXA 2MKCA 4ZKAA 4I0WA 4ES3A 3CDWA 3H20A 2RRBA 3KLEA 3Q83A 3AD8C 3OXLA 5A8KA 3HX9A 3KMQA 5ETKA 3K5MA 1YRXA 4BHQA 5KG3A 4HT7A 1RTDA 4K2XA 4OYZA 3PIPQ 2BZ2A 2XMWA 2EFGA 1QAYA 5I4MA 4MFBA 4N8OA 1GX6A 3QFWA 4X62F 1JLEA 3ZXWA 4DSFA 1JNZB 1GFWB 2PEBA 1VCTA 1VRQC 1FRJA 5IM0B 2LA6A 1KFSA 4G1PA 4PXEA 3HXMA 1QSLA 4B3MF 3OV7A 1BLUA 3PX6A 1YBTA 4B3RJ 4DV7J 3F41A 3A8KA 1SB6A 1E6YB 3W9IA 1VQ8S 5LMUF 4LREA 4ED1A 3BO2A 4LF4F 4DPUA 1YVFA 3HHLB 3THPA 1IBMF 3BGRA 4WF9Q 2LVWA 2CJQA 4ZOSA 4O3RA 3LAMA 2J76E 4DUYF 2YH1A 5T7LA 3D68A 3FBFA 3FC9A 4CO4A 1ZA2B 2H4WB 2IYIA 2J6TA 3V4MA 2WVFA 1WTFA 2HNDB 4X62J 1F2GA 2AJQA 3K59A 4WFZA 2CQ2A 3EDQB 2Z0GA 4KGKA 4Y00A 3IP0A 3IWNC 3AA8A 3O1LA 3J81j 4B3MJ 1M5VC 3PM9A 2YQ3A 1ITPA 1J27A 1RT3A 2FGOA 2WB1D 2CJ9A 4F0MA 4QR0A 4Y2IA 1G2EA 2B6AA 1HMVA 4NLXA 1UFKA 4KV8A 1JQGA 3OFGA 2J9CA 3MTJA 2PC6A 1HW9A 1VJQA 2AJFE 2ZBRA 2GVZB 1NH8A 4NLDA 1EETA 3BJYA 4KIAA 5M2UA 2G1HA 3MPDA 1TKZA 1SH2A 2CPYA 3MI7X 2GHWA 1H74A 1URRA 3G6VA 2VQEF 2MXYA 2XZWA 3TVYA 1T0TV 3LP0B 4OIXA 3QMQA 4KHMA 1GX5A 4I2PB 4TYBA 1D9AA 4DN0A 4IH6A 3KLIB 2IRYA 4EYIB 1FCAA 2QC3A 4ZLJA 3H5SA 2ALYB 3P6YC 3EM1A 2IM3A 3ENAA 3KWMA 2KI2A 4GVLA 2HHVA 1V5IB 1NDKA 1FEHA 4Z37A 2H65B 1NXIA 1F9FA 4ZJLA 5C42B 4Q0BB 2OEJA 2ABYA 3ILJA 4WP8A 2LQ9A 1FNOA 5CZVA 3OTBA 1U8WA 3G82B 3IG1A 4F4WA 2B4VA 1FO1A 4A4JA 4QPTA 5GAEU 3NNCA 3W8GA 3V6KA 1J5OA 2KFZA 3NBPB 4IFYA 5D0EA 5F9LA 4IR1A 4PPZA 4L73A 4ZP9A 1JB0C 4M5MA 2P9CA 2JEGA 1U1NA 3HVTB 2WZ1A 1ROFA 1FDDA 4TNOA 1CJVB 4MKVA 5C7PA 1HNXJ 2ASDA 1VQKS 3JS9A 3OW2R 3LUYA 4WTOB 2QLBB 5KFRA 4PXDA 1FRMA 3ZTQA 3X3UA 3RGIA 4V1Ak 5L1KA 3JAMU 2YPYA 4WKYA 1AYEA 1K0TA 3MEEB 1SUQA 1BQMA 2WHOA 4E0DA 2JLEA 3M6VA 4UZBA 4HACB 2JNJA 3AT1B 4HVZA 2HMIA 4ZIWA 2HVZA 1S6QA 4ERDA 3EGVA 1SJRA 5F8IA 3BZQA 2CNLB 2R9LA 3M30A 1T95A 1CJTB 3N5BA 2N3OA 2CPDA 3B54A 5CYMB 2HYIB 3VAKA 1X4EA 4AYBD 2V2QA 5KG1A 4LSNB 1PJ7A 4DS5A 1ZH5A 4AD6A 1IKVA 1WC5A 3Q89A 4NXMJ 2ZNZA 1XR7A 3FK4A 5L46A 2DHHA 3R27A 3RAMA 4O4RA 3O3LA 5D0HA 1RT5A 4CYUB 3L7OA 3MM5B 3R3TA 4OX6A 1NPKA 1P9YA 1HNWJ 5GADU 3H4BA 3G2XA 4N76A 2YX4A 3AH6A 4Z7YA 4XTTA 1X4AA 3HFKA 2DR7A 3NMAA 3LANA 2B8QA 1N5YB 2B7BB 2GO9A 3DMJA 2KZMA 3MOJB 4ZLLA 1WHYA 3TA2A 2CQCA 2OPSA 1SKSA 2ZOFA 1OY6A 1P8GA 2AZ1A 3TUIC 5D4OA 4YUDA 2QO3A 2EKNA 3W1YC 4KBIA 4AFFA 1LXJA 2M88A 1RWOB 1YIJS 4LJMA 1C0UA 1RHJB 2G9OA 4FNHA 3VTIA 2GQ2A 1RDRA 4DOZA 4N47A 1UEUA 2OGUA 2ZBQA 4LSLB 3LWMA 2V67A 1RTHA 4NMXA 3H25A 2DY9A 3BKFA 3BPDA 2J9DA 4PZVA 5E41A 4QJVA 4ZJOA 3MURP 1IWGA 3MR3A 3L4BC 2IBOA 4LF5F 4LVOP 4WU3A 1QVGR 2W4DA 1NNDA 4ZP7A 5L1LA 3N4WA 3T19A 2IFXA 3L95X 3J7YU 2KRRA 3FMBA 2A2CA 2DGTA 1RI7A 2HLUA 2P9EA 4LF7F 4ED0A 2J0QD 1RT2B 2LA4A 3VAHA 2F5GA 2VJUA 5IM0A 4UUXA 2QLJB 3ENWA 4JI5F 3CC2S 1VQOS 1KQSR 4NPOA 4WFNQ 3OQ2A 4K4TA 4B02A 1TAQA 4IOBA 1BC6A 1WELA 3DHWC 2CZ4A 2WVEA 3GYGA 2VZ9A 1IM6A 2HEKA 3U1NA 3NLCA 3GU0A 1KLMB 5KT7A 2V4JA 1CVJA 1UJ6A 2LLZA 2G0CA 2AQ4A 2BJ7A 3K5LA 1U4BA 1FRXA 1WHXA 1NPPA 5FDLB 1Q7LB 4LF5J 3TNVA 3TQ1A 4C8YA 1RBOB 1FKOB 2YWGA 3X1LB 2KYXA 1V3SA 2UXCF 2XEXA 1VQ9S 4KH0B 4IH5A 1LWFB 1Y00A 4A8SA 2DK2A 3DRXA 2ROPA 2HNDA 1UVMA 1RSCA 3QGGA 1R7IA 2VFVA 1RHMB 1GXTA 3TUZC 2ZH6A 1TAUA 1M1GA 2HURA 2XZDB 1B64A 2CNOB 1KWMA 5K8NA 2HWIA 1SL1A 3VF0B 4F4YA 2HBYB 2KU7A 2DNLA 4DX6A 4C97A 2U1AA 4TY8B 1J5EJ 3QPIA 1R27B 2GVZA 2DNRA 4WIIA 2B9XA 5K9FA 2E44A 2OI2A 2RUSA 1CC7A 4Q43A 1MWQA 3C6TB 3G71S 5I3PA 3P49B 2HS0A 2AF6A 3LA0A 3DKDA 2YQ0A 1Q5VA 3VGTA 4YMEA 1HD1A 2V94A 2HVDA 3MCMA 4ICLB 4JI2F 1X5SA 3KDOA 5K8MA 4USMA 1VQYA 2QE5A 4CM2A 2XNQA 2IYGA 2VF3A 2FC8A 3DRRB 4PAAA 3LP0A 3WQPA 4JI8F 1Q86T 3PR5B 2BJ9A 1HD0A 2RQMA 4I6AA 4I2PA 3GE9A 3QIPB 3U27A 4IO9Q 4ZCKA 1GTEA 2DR5A 2C3UA 1M1HA 3IAS9 3M8SA 1GAOA 4IKAA 4J90A 4CO2A 4DF4A 3UD3P 1GT8A 3MZIA 4DDFA 2ZZNA 3OTDA 3OL7A 2BABA 4C8NA 4J9LA 2QFJA 5C42A 4Q0BA 3QO9B 4CH0S 3OPKA 3UCGA 2Z2MA 3R8YA 3G8QA 1QVFR 4YY3F 4A8OA 3KNGA 3G82A 5DLFA 4OZLA 1LW0B 5IC4B 3NBPA 2AV5A 1SKWA 1IBKF 4R5PB 1Q79A 4H4OA 5KFLA 4F7VA 3OTOJ 1FRIA 1REVB 2MHNA 1FX4A 3AJ1A 1ZOTA 2R4FA 4JI8J 4G1QB 1S99A 3KHLA 3B78A 3D6FB 4IRDA 3D5MA 4ZDNA 1S9GB 1RLDA 2YXLA 2Q79A 4N8NA 4V19X 4DPYA 1CJVA 4L74A 3HLUA 3VHQA 1Z4UA 4TLRA 4YP3A 5L9XA 3CB4A 4IYQA 3TZYA 4DR6J 3NAIA 1RBLA 4JV1A 2B4OA 3MEEA 4OYIA 4USKA 3CSKA 4YN3B 1DURA 1SKUB 1IBLF 4HACA 1RKIA 2HNYB 5F41A 2E9RX 2XS7A 2LP4A 4PQUB 2BJ1A 4YY3J 2KM8B 2PDAA 5JMNA 5LSOA 2QRRA 2WRMA 1NMEB 1CJTA 4NCAA 3CF5Q 2HQIA 8ATCB 5IWAJ 5CYMA 2DR9A 3I82A 1IBKJ 1R31A 4LSNA 3M8QB 5HQ8A 3D6TB 4B08A 4CNYA 2MKYA 2KTQA 1HBNA 3TAQA 1IM4A 3A3PB 4YDXA 3TQEA 4X65J 3PRDA 1PSDA 3U1LA 3D3CJ 1FWLA 4DS4A 4CYUA 2XSFA 2N3LA 3THTA 5D77A 2K2PA 4J7CA 5G0RB 1TMJA 1S1TB 3E01B 3I0RB 2VA2A 3O8WA 1JLBA 2ZZMA 3CC4S 5G4DA 2KFYA 2FLOA 3UR3C 2LQ8A 3NXZA 4LFAJ 3HDSA 3T1HF 1N5YA 3GILA 3ZTSA 2E1PA 4QBUA 4B9UA 1W25A 5D0GA 1IBLJ 2W1BA 1UCNA 3SV3A 1KVJA 4OL8A 1JJ4A 1KHWA 1RT4B 1L3TA 1Q53A 2QSFA 2KHDA 1IQTA 3QATA 4OZJA 3B4DA 2HAIA 1HA1A 3M1VB 1SIWB 1VGYA 1T03A 2HPUA 3GR1A 2ALZA 1LFWA 2AZ3A 5EDWA 5DM7Q 5DQGA 1I51B 4P72A 3FVYA 4LSLA 2RS8A 1V5VA 1K8AT 1KS2A 3QYYA 1U1RA 2OEMA 2KJWA 2HRUA 1IJEB 2XWYA 3VQTA 2W8KA 1DBDA 1HKAA 1ULRA 4NI2B 3GCWP 2EWHA 3BO3A 2XMVA 2OP5A 4F4AA 3NMRA 2DRDA 2CQPA 4ZITA 1VMBA 2F40A 4C3MA 1MU2B 4UTGA 2HZAA 4WFXA 4X64J 1B4SA 4HLBA 3T1HJ 1U7LA 1UZHA 1RT2A 1GMWD 5DG8A 2E1RA 3DNCA 3A13A 2MPUA 2FQQB 3ICLA 2W25A 3ULHA 3MDFA 4DL4A 3OUYB 4LF2A 2CRLA 1Y5LB 2E1AA 2NXEA 1YHQS 2ZC3A 4EEYA 4ZPAA 1B70B 1PJ6A 2DXDA 4CLSA 2PA8D 1CJUB 5F8MA 2R7SA 3UDCA 2NXUA 3R5AA 1KLMA 4PWDA 2UUCF 5FDLA 1RTJB 4C8KA 5KAKA 2YKAA 3U7JA 4ILLA 1FKOA 2BACA 2C3MA 3R1LA 4DV0F 3FMWA 4P75A 5DLGA 3C15B 3ITHB 4YB5A 3DLKB 3DOMB 2J7WA 1NEEA 1QAIA 4F2RA 4RW7A 2NXNA 1BQXA 3WIUA 2XI3A 2NLWA 2L48A 2ATCB 3ZZUA 1C1CB 1RAHB 5HI7A 2IDLA 1F9EB 1N8RT 1Q8BA 3HPOA 1Q8KA 1FJ7A 3H2VE 1G7CB 2XO6A 3E51A 3E8OA 3T41A 5A8RB 2V34A 2H51B 4DV4F 2CVEA 2CNKB 1KFDA 2IRXA 1QJHA 5D4NA 2AGOA 4CT8A 3CTRA 4TY8A 3KUGA 4O3PA 1VBZA 1WG4A 2IHR1 4DV3J 5IC6B 3N6NA 3W65A 1UVIA 5AJ3J 2VBZA 3C6TA 3MEGB 2ZKTA 5C2CA 2Y0BB 1YJWS 1RWWB 3IGVA 4RW9A 2GQQA 2FJDB 1ZZFA 5ETSA 5KFDA 1P1LA 4ICLA 3IRWP 2MZQA 2VQFJ 2PMZD 2ZH2A 4ZN1A 5D8HB 4EWTA 3HI9A 1RE1B 3DRRA 4DV0J 4NOHA 1DTQB 2Y9HA 3GG1A 3QJPA 1HNZF 3QIPA 4CZCA 2XLJA 1JJCB 5DGBA 5KOWA 1VFJA 3SCIE 1FJCA 4TYAA 4UZCA 4CCHA 2OAUA 2ZBPA 1VJWA 2AJ1A 1BGXT 5B0AA 3C16A 2BW2A 4DV4J 2BKOA 1CBKA 7AT1B 3R6GB 1FXDA 1M5OC 2UUAF 2BEFA 3QO9A 3DRPB 4J9UE 2VL1A 2GGPB 3LF0A 1YJNS 4UUWA 3BBBA 4KYZA 1M5KC 1NSKL 2I6WA 4I7FB 1LW0A 2RJZA 3H5XA 2DGSA 1JLFB 3WIVA 1SXLA 3OHBA 4R5PA 2CQ0A 2A1BA 4WZQA 4KPYA 2ZH4A 1REVA 3DLGB 3BKTA 4ZPTR 3TVKA 1PO6A 3D0HE 2W7OA 4G1QA 2Z58B 1HNZJ 4ZVOB 2DH8A 5KFUA 3TUPA 3NS5A 4DFPA 1S9GA 1H7WA 4I67A 2KN4A 2VU5A 4OHYA 2JX2A 4DJBA 1FTCA 3EVMA 1YSJA 2ZH8A 2VKZG 4PG8A 4CLTA 4MIAA 4CDIA 2E5IA 3A12A 4LSZB 2CJBA 5JVGQ 2NUHA 2UUAJ 3BN7A 3K57A 4DR5F 1OIAA 1H7XA 2HNYA 2V8HA 3UW1A 3TYTA 1U1QA 3T5JA 1OS5A 4PQUA 3HZEA 2HK3A 2F4VF 3QJJA 3AJDA 3VAMA 2E1CA 3ZC4A 2RQCA 2K7JA 4V19J 2JDJA 4KB7A 2YKPA 2XLIA 4Q2LA 1NM2A 2OMLA 3QWPA 1SC6A 5RUBA 2VFSA 1KOHA 4RR5A 1RBAA 1X4BA 3I5CA 3KUEA 1EIYB 4DR1J 3FRYA 3P3DA 3BSNA 4FXDA 3Q24A 3NS6A 5G0RA 5DDQC 1S1TA 3E01A 3K8VA 2VFUA 1OYEA 1L5UA 2DNKA 3UNYA 3VALA 5KG0A 4TXSA 1F6TA 2HG4A 3CE8A 3BQ2A 1IKYB 1IUJA 1WWHA 2QA1A 2MGZB 3EJMA 1RT4A 2IPOB 4K4ZA 1RLCL 4J9PA 2CUYA 2BKNA 3RG6A 3FBBA 4JV5F 5CAAA 2AWZA 1FRKA 1LKZA 4WKRA 4FNIA 3LWLA 3W60A 2OTJS 1LWXA 3CD6S 1XJWB 1XNRJ 1KR4A 2EK1A 3OHAA 2HSEB 2N4DA 4YB6A 7FD1A 3CCUS 2M7SA 2PGCA 3OFFA 2CIMA 2BA9A 3HF5A 5L1IA 1EKRA 2WB4A 1FJGJ 2F8EX 1UVNA 3EXYA 4U67Q 4NI2A 4JUZA 1MMNA 1Q8LA 2J0WA 2MKSA 2RIJA 5GMDA 4RX6A 1VQPS 3MMBA 3J7ZT 2H5JB 1MU2A 3RUBL 1U24A 1T05B 2PMHA 2H48B 4JYAJ 4C8ZA 1UEKA 3MM7B 2MLZA 5IT9U 2O01C 3M2RB 5H9EJ 1TKDA 3EGNA 4LRCA 2H1YA 1FD8A 2RDIA 3OUYA 1N6QB 1SCJB 4DQIA 1CJUA 1OPIA 5EX3A 1EX8A 1KVKA 3O5TB 1SPBP 1NK5A 8RUCA 1RTJA 2JH3A 4CTAB 2K1RB 1AROP 3H8YA 3NGRA 4NZ0A 2O5DA 2VC1A 3FRZA 1X9SA 1Q1KA 4O0IA 3IAM9 2XO7A 5F0WA 1H2VZ 2V9KA 3C15A 3ITHA 4K5RA 3DOMA 3DLKA 2LKZA 3DCAA 4HL9A 1C1CA 2NUUG 3MPVA 2UXBJ 2XMTA 1AT1B 2BX6A 1CC8A 3DGPB 2HKEA 4JI1F 3H4DA 2FLPA 1VS3A 1NZAA 5A8RA 4HDGA 2LFVA 2Q6CA 2ZKUA 4EBCA 2Y1IA 3LPEA 1T9UA 4U8VA 1PBAA 1NZ8A 2APOA 2FPHX 3DRYA 2HZVA 2C2OB 3FNNA 3MEGA 2V8GA 1Y11A 1IXKA 3K17A 1XMOF 4H4MB 4DZDA 3FQKA 3GFYA 4IG0A 1NBEB 2HHWA 3P45B 5LSRA 4C9DA 2OKQA 2ZJRQ 4OZ2A 4EUVA 4BDPA 1GEHA 2LEBA 3GSDA 5HVGA 2NS1B 1DTQA 1IN0A 5B0DA 2VG6B 1HI1A 4G65A 1N5QA 1PYOB 1HWUA 1F9HA 4NLRA 1VLOA 2AYEA 1FXLA 1QSSA 1UMJA 4JI1J 1VC0A 5C24B 4QYZJ 2W9BA 3EGWB 1I5OB 1Y5NB 5J2MB 1NSAA 4OMFG 3MEKA 3UQSA 3HM9A 3MGJA 3H2LA 1U1MA 2N7CA 1UPPA 2V0NA 3TA1A 4IO1A 3DRPA 1RK8A 9RUBA 3K8WA 1QY7A 4GC7A 4OYPA 4K4UA 2RAQA 5CCMA 3DU5A 2VPWB 2ZVSA 4NA2A 4I7FA 3T1YF 2FYXA 4JBCA 2O3DA 2QLWA 1HWKA 2HQCA 2DPJA 3DLGA 1U26A 5IT9Y 1NRKA 4QWBA 3NWGA 1DZ5A 3ISND 1W7WA 5MLCV 4DHVA 1WC1A 4K4VA 2C3YA 5B0CA 4M95A 2YY3A 3QT5A 2UU9J 1RCOB 3VAGA 2J7UA 2KT2A 2WVDA 2W7AA 1OJ4A 2O67A 3BREA 1TUWA 5CD4A 4OZ3A 3QJLA 2BDPA 4A8WA 2GIQA 1LK5A 3I4PA 3SSRA 1GMWA 2HHQA 2PO4A 4JV2A 4FS2A 3JYTB 4DCJB 3NS7B 2H4YB 2LXUA 2ADCA 1ELOA 2DGOA 4J9RA 4BCAA 1QE1B 4N7TA 1VQ5S 4Q2MA 1PIEA 4I2QB 4MYTA 5ETTA 4YFUA 1BWVA 2RQ4A 3M2UA 2WCXA 4A48A 2RB7A 3LW5C 2CQ3A 3BSOA 2NSCA 3DM2B 5HBMA 2DNNA 2I5JB 1JLCB 5HLFB 2M5YA 1S12A 3ILLA 1EQ0A 4OI1A 1SL2A 1YG0A 1PAEX 3ONQA 1WUUA 1U6BA 5LT5A 2VFRA 4NXNF 4GKJF 1QTMA 4EO8A 1FI4A 3HKWA 3DXSX 5GAGI 3SSSA 3SV4A 4DV5F 1LFPA 4HH1A 2J6UA 2BE2B 4CLFA 2HBQB 2O66A 1N36J 1IKYA 2RUGA 2K3IA 2MGZA 1FWKA 3P5TL 2VH7A 2M8HA 3DLEB 4CLZA 5HVFA 3RB3A 1L3VA 1AXQA 3SQOP 5J2QB 2DH9A 2LYVA 2CDQA 2D3ZA 1HWIA 2QZ8A 5L8RC 3TP2A 4TQSA 2EC2A 2MMYA 1FRLA 4DUTA 3S8SA 4EGLA 5C25A 1YJ7A 2VPZB 1VC5A 5LOQA 3BF4A 2IM1A 1NSPA 2M2BA 2R8IA 2UUTA 1KDNA 4FN5A 1HNVB 3FSXA 1BQNA 4RW8B 5L9NA 3D9BA 1N34F 4NXNJ 2LU1A 4RW4A 1NK0A 2W2OP 3PEHA 3PKMA 4QIVA 1QM9A 1UWAA 2QV6A 3OL6A 3JB9k 2J0XA 1TTHB 4ZK7M 1REGX 4J37A 3SFUA 1CQNA 2GJIA 1TU0B 3NGSA 2VBWA 1T05A 4FP9A 2QL9B 4ELTA 3JTPA 2QGFB 3VQSA 3ZTRA 3MM7A 4Q5VA 3FSYA 3TEHB 4ZHRB 2Z56B 3BSAA 3M2RA 1MWZA 2P2CB 4J9MA 1N6QA 4UY85 1UW4A 3CD5A 1VQNS 3DXBA 3H40A 1HR0J 4DV6J 3BSCA 3ENQA 1YI2S 5FLXU 3LPYA 1EQMA 1Y3KA 2JWNA 4NRUA 1VK8A 2XS2A 3IM9A 3SMZA 1RXOB 1WC4A 2L9WA 2KZZA 1MN9A 2K1RA 4CTAA 3ISNC 3IA0A 3KDNA 5E33A 4ZP6A 4CO5A 1X9WA 2FUG9 3D6MB 4ECTA 4ECSA 3V6JA 3MF5A 3PW5A 3HSGA 3MUMP 1WI8A 1X60A 2XY5A 4KRWA 4MMOA 4WE1B 2UUBF 3MMCB 1W2IA 1FDAA 3LGNA 1AFIA 2XQCA 4PXBA 3GYXB 2W9CB 3GJQB 2GA7A 3QRQA 4L72B 3DGPA 4ED2A 1U1PA 2D74B 3HK2A 3THVA 5KFOA 2FJBB 2DITA 4CLWA 1SJ3P 1WDTA 1O51A 1EAYC 3QFHA 3BBCA 2VIHA 1DLOB 3DDNA 1X4HA 3A8JA 1AB8A 2MKKA 4DEZA 4H4MA 3DDIA 4I64A 4ENOA 1N52B 3PXGa 4FF4A 3TZWA 3PX4A 4ZVUB 1FVQA 1B0TA 2IIHA 2KG0A 2VG6A 1TFWA 3F44A 3CXCR 2V69A 4P10A 1HHQA 5C2GA 2QA4G 1FNMA 3HULA 3EX7B 4DV1F 3R5GA 5E3CA 2PA3A 3MD1A 3IS9A 4X2BA 4JOUA 4QWEA 3K0JA 2VKRA 5C24A 2RE1A 3KOAA 3FBEA 5KFFA 3KLGB 1NK8A 1F3VA 5J2MA 4ZPWR 2RRNA 1T9YA 2V50A 4OI4A 5F0UA 4XK8C 3CMAS 5FIIA 2VUGA 2WOMB 4YR0A 1HLWA 4LQ3A 2KG1A 3UR0A 4F50A 4X4RA 3VAFA 2N7YA 3QT8A 2OSRA 3AXMA 3MAHA 4E2FB 1C2PA 3OLBA 2DR8A 1PBUA 2DEJA 3FBCA 4YHHJ 4ETXA 2VHGA 4M5GA 3VGSA 5DG7A 4YQWA 2R7TA 5H1SV 3FEYB 2YKNB 3PG9A 2E5LJ 4EK2A 1NJIT 4ECRA 3RR7A 2CJXB 4K7QA 2MLXA 4AL7A 4KGZB 4DR3J 4RWWA 3AA9A 4NASA 3ZZTA 2OSQA 5JUMA 3CVKA 1RWKB 2EXUA 2EFNA 1VRTB 3OBIA 1X5PA 1NU4A 2QT7A 2AP6A 2FIUA 2M3DA 2EPIA 4URSA 4DV1J 4LFCJ 3W5XA 2XTJP 3OVBA 2IMOA 5FLXY 2HBZB 3SBMA 2KJVA 3FEXB 2BANB 1B99A 1TQLA 3AQPA 4C0HA 3F73A 3OSPA 4PXCA 1R3NA 2Y8YA 3SSQA 1SH0A 3JYTA 1JLGB 2PFDA 4LRFA 2XMJA 3KLFB 2GVDB 1QE1A 3Q8SB 2D41A 5E5NA 4I2QA 2YWFA 2CPIA 1NPRA 2VICA 2W01A 1EKSA 3N6LA 1HQEB 4C0BA 3DM2A 2KT3A 2BMBA 3BGOP 2Y8WA 5CABA 2I5JA 2KB2A 1GQEA 4K0KJ 3SDEA 5E0OA 4U8YA 5D15A 3W8PA 5HLFA 1B3TA 3JXOA 3OTEA 1T3NA 4DV2F 1AUDA 4FF2A 2JFDA 4DPWA 4LBIA 3DI6B 4K50A 2M70A 2YBVA 1O0PA 4BWJA 2ILZA 2RKIB 4DFKA 2DRBA 2X3GA 3FZBA 1Z2ZA 3MMJA 1P1TA 1S1XB 1SI9A 3NNHA 3JTOA 3L7PA 3LGMA 2HHTA 3UNGC 2VASA 1NLKL 3I5BA 3W66A 3DLLQ 2HHSA 3PW2A 3ZTOA 2MKJA 2XI2A 1HBUB 3CJRA 2HQ3A 4OHZA 4DFMA 2D9PA 5DDRC 4X66F 1KVIA 2JHEA 1NK4A 1KD1T 1SV5A 3HHLD 4A46A 4P52A 4NLQA 1X0FA 3DLEA 4OJ1A 3A4TA 4WXOA 5J2QA 4GRSA 5DQHA 4ES1A 4IG3A 1DTTA 2UXDF 2XY6A 1OMSA 4WFAQ 4NCBA 1PYSB 1PG5B 3KK1B 4RU9A 2R2UA 1N33J 4O44B 5H9FJ 4RW8A 3EVOA 2XCPA 5B0GA 2YNFA 4MJKA 2QG9B 4JB8B 4USVA 3R6LB 1NB2A 3T5LA 5J1NA 3PFOA 3MM6B 4PG5A 1G6BA 3BGLA 3G4SS 1PYTA 4J9KA 5J1PA 4JI4J 1M0SA 3IFEA 2DXEA 1RWXB 1UL3A 4ZHRA 4EZ9A 3W2WB 3UPFA 4JI6F 4FF1A 2BJEA 3K5OA 3OJSA 4ES2A 3QRRA 5HVHA
chains in the Genus database with same CATH topology
3Q8RB 4A8FA 2KKHA 3IRXA 1S0NA 1R8BA 2DTJA 2YKOA 3B4DA 2HAIA 1HA1A 2E5JA 1JXLA 1RA7A 4WTYA 2C22A 3M1VB 4GO5X 3WC2A 1I6JA 2UV8G 1SIWB 3FQLA 1VGYA 2O1PA 1T03A 2HPUA 3Q2SC 4Q8FA 3GR1A 3S1TA 2ALZA 1LFWA 5F3TA 3OFHA 3GYNA 2F8MA 5EDWA 5DM7Q 3CIZA 5DQGA 3FVYA 3SQGA 3V2UC 4LSLA 3V6DB 1VI7A 2AYBA 1S1WA 3KTQA 5EX0A 2X51A 2D1CA 2E9TA 1FHTA 1VIXA 3TAMB 3PHEA 2RS8A 4NLWA 2FHJA 1KTQA 3PFEA 5KFWA 1K8AT 5DETA 1RT7B 1K1QA 1KS2A 3QYYA 1HYSB 2U2FA 2D7SA 1XN9A 3RRGA 2HFOA 5CZXA 3MFHA 2ATLA 2I1RA 1U1RA 4QWCA 4MIBA 2OMOA 3OXGA 2KJWA 3CMES 2HRUA 1IJEB 4QU6A 4PWUA 1T03B 4G1IA 1T8EA 2J8AA 2XWYA 1CG2A 3VQTA 1C1BB 4QIFA 4Y65A 4F3OA 1JMTA 1DBDA 1ULRA 4PG7A 2W8KA 2EWHA 4DL6A 4Y2CA 3BO3A 4TKTA 2XMVA 1ZTWA 3PEJA 5A6PA 2OP5A 3NMRA 3MMCA 2E7XA 2GCFA 3IGNA 1D9FA 2G4BA 2UXBF 4CH7A 1PGZA 1D1UA 1D3WA 2CVIA 3CDEA 2CQPA 2FVPA 2E5GA 1VMBA 2R7RA 2F40A 4P2SA 4C3MA 2XGPA 2DO0A 1MU2B 1PC5A 2W9CA 1OQ6A 2HLTA 2BQUA 3SYZA 4Y6IA 3G6XA 4WFXA 1YGYA 2V9WA 1VQ4S 4HLBA 2IC3B 2JRSA 4KKOB 1QAXA 1U7LA 1WEXA 2ZH9A 1FKPA 1R8PA 5KT2A 3KG4A 1K1SA 1RT2A 2FHOB 2CZVC 2AU0A 4O4GA 4N41A 4TU8A 4HH0A 4OLOA 3PKYA 2CPEA 3MD3A 5A2QY 5DG8A 1VHFA 1XR6A 1R8AA 2E1RA 3T5KA 1WI6A 2MYFA 3DNCA 4MK7A 5KFSA 2RS2A 2B51A 3M6WA 2R7VA 3MEDB 4U9RA 7FDRA 1DHMA 3MECB 5C5JA 5A6WA 2LDIA 3AAWB 4B3RF 1X7VA 1PILA 2MPUA 2FHMA 3RW7A 3ICLA 2W25A 1FF2A 3T3FA 5LXYA 3M9MB 3ULHA 3CIMA 3MDFA 5M2PA 1TP7A 4IRKA 4QW9A 2F9JA 4DL4A 4EU0A 2YKQA 3OUYB 3B8HA 4MH8A 2PD1A 1DLOA 2AJ0A 4R0EA 2CRLA 3NCPA 5FD1A 2BV3A 5IQ6A 1QSYA 4X4OA 1Y0HA 1M90T 2FJWA 1Y5LB 1KHVA 2E1AA 5IS2A 2MZ1A 1HBOB 1YHQS 3CJ5A 2ZC3A 4EEYA 2XBPA 2IM2A 3ZZRA 2BYCA 4ZPAA 3N0VA 5KFXA 3Q0AA 2PA8D 4XPCA 1LOUA 2BM0A 3AB4B 3M2VB 5F8MA 2JC1A 5B08A 3JSRA 4C3KA 3KMSA 2R7SA 3UDCA 2OPRA 3M6UA 1HFEL 2NXUA 4F8RA 1AFJA 3R5AA 1HQUB 2LCWA 4WYWA 1KLMA 2IAJB 2M0GB 3KYLA 1P27B 2GIRA 4PWDA 1EP4A 4NYPA 2DD8S 4PKDB 1ZETA 1X8DA 2UUCF 2Q1LA 5E7OB 1B0PA 2YKMA 3TRGA 6FD1A 3BB5A 1FT8A 5FDLA 3S01A 1NK6A 2HHXA 1RTJB 3EGZA 4G6VB 2VPYB 1TL4A 3VR1A 2HGNA 2FVRA 3ETOA 4C8KA 5KAKA 2VONA 2YKAA 2XMUA 4IFVA 3U7JA 2DT9A 1XWLA 4LMZA 4ILLA 2ASYA 1FKOA 2BACA 3SCJE 2MSSA 6FDRA 1NAQA 3V81A 1U09A 2C3MA 3KHGA 1ZTTA 2PSZA 1RT6B 3R1LA 4ID5A 2ZBIA 3U02A 1NO8A 4DV0F 4PUOB 3FMWA 3KLEB 3NKYA 4W90B 5D6GA 2ROGA 3R5CA 1V3ZA 5A8KB 5DLGA 1SJ4P 1TK5A 4PWDB 3MMAA 1EP4B 4QPXA 1VQMS 1NK7A 3ITHB 4YB5A 4NCGA 3DLKB 4WYLA 3JAMY 2J7WA 2B9WA 4OZ0A 1NEEA 2CKWA 3I5AA 1QAIA 4F2RA 2DGWA 4RW7A 4KHRA 3GZ7A 4M5DA 4UW2A 2DRAA 1BQXA 2XI3A 4RNNA 2NLWA 2L48A 1J2VA 3ZZUA 3KLGA 1C1CB 3LO3A 2VOPA 1IQZA 4IFVB 5HI7A 3LP2B 4MFBB 1K9MT 4ELVA 3V81B 1N8RT 4X4VA 1Q8BA 1Y7PA 3HPOA 1C4CA 3CCQS 1FJ7A 1JLEB 3H2VE 1G7CB 4ID5B 3MR5A 1N4LA 5MAOA 4OI3A 4I56A 3KKFA 3E51A 3NG8A 3HHLC 4NMLA 2E7WA 4U7UK 2OPQA 3GFHA 1H6KX 3E8OA 2MZSA 3MMAB 2MSTA 5A8RB 2WOMA 4NCGB 4WZMA 4XIUA 3WBZA 3HHNB 3I56S 3R5DA 2CVEA 4DV4F 4RW7B 3POTB 2QMXA 2YTCA 1KFDA 1APSA 4Y2AA 2IRXA 1QJHA 3JSYA 3F56A 2LMIA 5D4NA 2AGOA 2DISA 4CT8A 4PR6A 1ZYQA 2OFHX 3CTRA 4TY8A 1O5JA 1KTVA 2PT0A 1BWEA 1GTHA 4O3PA 3UCZP 1VBZA 2UP1A 2JFKA 2MKIA 3OL9A 1WG4A 2IHR1 4WK3A 2FJXA 4BS2A 3HT3A 3N6NA 1UVIA 2VODA 1L3UA 2OPQB 4KR0B 2EW9A 4U6PA 2YKNA 1S97A 2VBZA 4WCEQ 2LQJA 3C6TA 1SQEA 4Y34A 3MEGB 2ZOGA 4DBQA 2ZKTA 3KG0A 4JI7F 4R0JA 4DQQA 1X4DA 4LVNP 3O44A 1SKRA 1YJWS 3CJ2A 3CDBA 3IGVA 4YR3A 1MMLA 2FLLA 2OJ3A 4RW9A 4RNHA 4P7TA 4IRCA 2GQQA 3AY0A 5KT5A 2FJDB 4NLTA 2BQ3A 2UU9F 4B9NA 1ZZFA 5HO4A 5KFDA 1P1LA 4ICLA 3KHHA 3IRWP 2MZQA 1VRTA 2PMZD 4F4ZA 2ZH2A 4KSEB 3PVXA 5D8HB 3DFEA 4EWTA 3GIJA 2EI5A 4KC5A 3BGRB 3HI9A 3DRRA 1U6FA 2C28A 2CQDA 4NOHA 3M8PB 1FNXH 4TY9A 3I0SA 1DTQB 2XMMA 3GG1A 2EC0A 2HVHA 2MKHA 3QJPA 4CNZA 1HNZF 3D28A 3CC7S 5T7LB 3PV8A 3EZ5A 4FF3A 2CPZA 4P6QA 3QIPA 4DMZA 4RW9B 5DGAA 2A2DA 3T6BA 4CZCA 3BR8A 2XLJA 5DGBA 3I31A 4L3NA 1YBAA 3G86A 4XAKA 5KOWA 2RD5C 1VFJA 3GQCA 2GGPA 4AXJA 1FEEA 1LXNA 3SCIE 1D0EA 3UFCX 1FJCA 4TYAA 4CCHA 2OAUA 4NZ7A 3PO4A 1VJWA 1SJ1A 4PG4A 2AJ1A 2B4PA 1BGXT 3CDUA 5B0AA 4ECWA 1YRTA 4XDCA 2BW2A 3UI3A 3PJXA 5GAEI 2M9KA 1JLGA 3N9UC 5HP1B 2JEFA 3MAQA 1K0VA 2WW8A 3PDNA 5HN0A 4IH7A 1FXDA 1M5OC 2V8VA 3IXQA 3KLFA 2UUAF 5F8HA 3QO9A 3D0GE 3J7Z5 1N0UA 1JLFA 1RT3B 3DRPB 2J6SA 4J9OA 5KFNA 1TZ0A 2GGPB 2VL1A 2DO4A 3LF0A 3JSMA 1YJNS 2EFQA 4UUWA 2B6AB 1Q7YT 1NK9A 2ZNYA 2W9AA 1FE4A 3J81Y 4KV8B 2IJNA 2R8HA 4CT9A 2ZHAA 3D0IE 1M5KC 4FPRA 1HQEA 4DSKA 4RBUA 1JKHB 1FE0A 3IC1A 1HI0P 3WC0A 4EZ6A 4WJBA 4C11B 1TV6B 1IKWA 2I38A 2OIHA 3SZ2A 4I7FB 5A8WA 1TKXB 2HS3A 4HKQA 1LW0A 1D9DA 2RJZA 1EETB 2OD6A 2MQNA 4Y3CA 1DARA 3H5XA 2XLKA 2C42A 3HVAA 2DGSA 4UOCA 4ZPDA 4CQ1A 1D8YA 4RUAA 2JJ4D 3IWXA 1JLFB 2EBEA 3PR4A 1SXLA 3OHBA 1H2TZ 5B0BA 3EYZA 4IOCQ 1W2BR 4R5PA 1B7FA 2CQGA 2CQ0A 2A1BA 4ZVEA 4WZQA 4KPYA 2NPFA 2ZH4A 1A9NB 4OZ5A 4QIGA 2W4CA 1REVA 3DLGB 4ZPTR 3TVKA 2OTLS 1PO6A 2RF2A 3D0HE 2W7OA 2IVYA 1NKBA 2W4PA 1TKZB 1VQ7S 2B9YA 3BEGB 3QIDA 1OWXA 4G1QA 1KRPA 2EK6A 4FBTA 2Q66A 3G96A 2RKIA 2COLA 2XULA 2DH8A 5KFUA 3NS5A 4DFPA 1S9GA 3DOKA 1HNXF 1H38A 1H7WA 1GXLA 5LL6d 1S1XA 1WEZA 2NR0A 4ILRA 4I67A 3QGIA 4DPOA 2KN4A 5IZHA 2ZDPA 5E3QA 3V4IA 1TKTB 5LJ3Y 4WFYA 2VD3A 1CPZA 3ZZYA 4OHYA 1M5SA 2UZAA 2JX2A 4DJBA 1FTCA 3CULA 2DVIA 3RW6A 1YSJA 2ZH8A 1N36F 2R7UA 1SJQA 3ZZZA 3NCRA 2VKZG 4PG8A 1UAWA 3HHEA 5K14A 5I42B 1NKCA 1S79A 3RRHA 3VZHA 1SL0A 3FFIA 4MIAA 4ZCLA 2GW8A 1HBUA 2E5IA 3HHKA 4R8UA 2VG5B 4F67A 4N56A 5DG9A 1FDBA 1VQLS 4K4YA 2V4QA 1I94F 2LXFA 1S1VA 5GVQA 4OI0A 1R8HA 1S7HA 1UVKA 2EKYA 1U6ZA 3J7A1 2CJBA 5JVGQ 2NUHA 5GAHI 4F4XA 3FCHA 2PN6A 3BN7A 4K4SA 3K57A 3MPYA 4PPDA 4DR5F 3MFIA 2F1FA 3PX0A 2XG8A 1Q8IA 4LIRA 1OIAA 1H7XA 4OJ3A 5KT3A 2HNYA 2V8HA 3HZGA 2ZITA 4OI6A 2KHCA 3UW1A 3TYTA 1U1QA 3T5JA 2MQLA 1OS5A 3T5HA 4PQUA 4F3MA 4ZCMA 3HZEA 4KHPF 1Y5IB 4UQTA 2F4VF 3QJJA 4K4XA 5LSLA 3QGPA 1N48A 3GWCA 5KFYA 5EN1A 2YX1A 3A1YG 1WG5A 2QA2A 3VAMA 2X1FA 3K2YA 1IJFB 3ZC4A 2DNHA 2RQCA 3HVRA 2GHPA 5KFAA 2E1CA 2NZ4A 1NHUA 1TL1B 2K7JA 4NLYA 4V19J 1E6VA 2E29A 2JDJA 2KT5A 3IR5B 4KB7A 3VZIA 3KK1A 2YKPA 2XLIA 1HBMB 4Q2LA 3TA0A 2OMLA 5GADI 4NXMF 5KG4A 2XGQA 4A8YA 2AJ4A 4FS1A 1OPZA 2VBXA 3BM7A 3W3SA 2YNGB 2XNRA 3NRBA 2LECA 3IG1B 3BGUA 4J5OA 3QWPA 3M32A 1UA1A 4O44A 3MM8B 4Y2KA 1SC6A 2AGQA 2HFNA 1J5OB 2VFSA 4IFYB 5EHHA 2XS5A 1KOHA 4YR2A 1N88A 3KLHB 2ZDOA 1F5AA 5L39A 1MW7A 3H59A 2OH2A 1X4BA 1TK8A 3I5CA 3RB4A 1HNWF 1TUVA 3K5PA 4OLPA 4DFJA 4EBDA 3MM6A 3FRYA 3P3DA 1FVSA 3BSNA 2GMLA 1NHVA 3LP1B 1KOOA 4FXDA 3Q24A 3NS6A 5G0RA 5KFHA 1L3KA 2ZFHA 5DDQC 1S1TA 3E01A 3K8VA 2VFUA 3LOUA 2VV5A 3S7RA 1XTZA 2GMJA 3FDSA 5D3GA 1JJ2R 4ECZA 3QGHA 3D54A 3GB0A 1L5UA 4XO0A 2DNKA 2CFXA 4X4SA 3VALA 4DL2A 2WAQD 3TO8A 1FK9A 1KQGB 5KG0A 1QUVA 4NLUA 4TXSA 2YWEA 2HG4A 3CE8A 4B9TA 1RYSA 1IR0A 2MZRA 3LALA 3M9OB 1YJVA 2JOQA 3W2WA 1RAJA 2JLFA 4JI0F 3BQ2A 1HR0F 4JI3F 1XNQF 4DV6F 4DLEA 5HROA 2DJWA 1MSWD 2BM1A 1URNA 4ZPCA 4CI0B 1IKYB 5CYQB 1IUJA 1WWHA 2QA1A 2MGZB 1RT4A 3SI8A 1S9FA 3RBDA 1KNZA 1SUQB 4K4ZA 1SJFA 2F8HA 4RNMA 4J9PA 1BQMB 1HPZB 2D3OR 2DIUA 4JV5F 4GC6A 2ZBCA 5AE3A 3IO1A 2WK4A 2AWZA 1FRKA 1UVLA 1LV5A 1LKZA 3TOQA 3NGDA 1NB7A 3CCTA 3GIIA 1XMQF 4WKRA 4FNIA 4FZVA 4C0OC 3LWLA 1F60B 4OHVA 4OZ1A 3TX8A 5KFMA 5KFIA 2QYCA 2OTJS 5T41A 3CD6S 2CPXA 2QEXS 2EG1A 3C3LA 1KR4A 2EK1A 2BUNA 3OHAA 3MHYA 3H5YA 5B09A 4DSJA 2P6TA 3DHXA 2N4DA 4YB6A 3M30B 4RWXA 7FD1A 3GFXA 3V6DA 3CCUS 3J7YI 1N5VA 2M7SA 4J9QA 4LF9F 5KG5A 2PEHA 3TAMA 2HHPA 2UVUA 1S9EB 2PGCA 3OFFA 2CIMA 4F26A 2HHHF 1WF1A 2XB2D 2J5AA 1RT7A 2BA9A 3IWLA 5J1EB 1HYSA 3CCRS 1FDNA 1X5OA 2P6SA 2J7KA 3HF5A 5L1IA 4R25A 3I32A 2WB4A 1XBWA 4LUBA 3UDLA 5AE2A 5BYSA 2F8EX 2R7OA 4C8LA 2YWKA 3UE2A 1A6LA 2M52A 1UVNA 3EXYA 4U67Q 4Y28C 4QIWD 1C1BA 5E3RA 4X4QA 1U49A 3PJWA 4JUZA 3EPGA 2MZTA 2GNKA 1MMNA 2ZC4A 5HL7Q 1X9MA 4NLPA 3HJFA 3BQ0A 1LWCB 2CQ4A 1RT5B 1Z1ZA 1Q8LA 2J0WA 2E5HA 4A8XA 5DM6Q 5IT4A 3R1HA 2MKSA 2RIJA 4ZVHA 1U1OA 4NYOA 3E2EA 4K5SA 2X1AA 4RX6A 1VQPS 3MMBA 5CCLA 3GFZA 4N5SA 3J7ZT 2RU9A 1MU2A 1S49A 2GO8A 3DC2A 1JJHA 4OX9F 1Z2LA 1T94A 4UQGA 4OJGA 2IC3A 4KKOA 1XR5A 4M94A