4KHPF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4khpF00
5IWAF 1HR0F 4DUYF 2BVZA 1HNWF 1N36F 1LOUA 2RJZA 1G7CB 4LF6F 4DR7F 1F60B 1GH8A 1FJGF 4DR3F 1XMOF 4DV7F 2KJVA 3ZZPA 1N32F 1HNZF 2UXCF 4JI2F 3T1HF 1FKAF 2HHHF 4JI8F 1N34F 4B3TF 2UUCF 4DR4F 4OX9F 4DV3F 1J5EF 4LF7F 4X64F 2UXBF 4LF4F 4JI6F 2B7BB 4YY3F 2VQFF 4YHHF 4JI7F 4B3RF 5BR8F 4DR5F 2YY3A 1VMBA 2UUBF 1XNRF 4KHPF 1IJFB 1N33F 4B3SF 5LMNF 4JI0F 1QJHA 1CQMA 5LMUF 2UU9F 2UUAF 2J5AA 4LF8F 4AQYF 4X62F 4GKKF 1G1XA 2UXDF 1B64A 4B3MF 2KJWA 4DV5F 2F4VF 4LFCF 4JI1F 4DR1F 1HNXF 4JV5F 4NXNF 4DV1F 4LF5F 4DV6F 3T1YF 2BXJA 1RISA 4DV4F 4JYAF 4JI3F 2VQEF 3OTOF 4DR2F 1IJEB 4LFBF 5AJ3F 1XNQF 4LFAF 2B7CB 1IBKF 4DV0F 4X66F 1CQNA 1XMQF 4JI4F 2ZM6F 4LF9F 2E5LF 4DV2F 4JI5F 1IBMF 4X65F 4DUZF 4NXMF 4DR6F 1I94F 4GKJF 4K0KF 1IBLF 3R3TA
chains in the Genus database with same CATH superfamily
4IG0A 2EPIA 4CO0A 1KEKA 3QJJA 1RBAA 5C42B 4L6V3 2D3ZA 3PM9A 4X84A 1P9QC 1YRTA 5FD1A 3KG0A 4ZP8A 4DL0C 3EYZA 2M9KA 1O0PA 1BMQB 2BVZA 2GMHA 3PYDA 4ZVOB 4N47A 5D0RA 4NEYA 3T41A 4RUHA 1HNIA 2CQ0A 2XGPA 1HR0J 4QYRA 5KFWA 2YX7A 3H5UA 3RAXA 4OHVA 5HVFA 2DIVA 2OMLA 3C14A 2CDRB 1TV6B 2JH3A 4J9VA 4I7FA 4N77A 4DG1A 5J2PA 2HIYA 4XO0A 3RRHA 1T7PA 4NCAA 1P9YA 4H4KC 2EC2A 4WFYA 5A8WA 2BBEA 4BCAA 3J7YI 1EX8A 2G0CA 3QO9B 4U9RA 1H2VZ 2EEYA 4DOZA 3FJ2A 3JTPA 5K9FA 5B09A 5CD4A 1R0CB 2MZJA 9ATCB 4DR2J 1U8WA 3OXLA 2NZ4A 3IWLA 1TTHB 3S1TA 2MQMA 6FDRA 5RUBA 4IRKA 1N32F 2CUYA 1Q8IA 2KU7A 4LF6J 1WF1A 3HKZD 2HFUA 5DG8A 2GGPB 3K89A 1TFWA 4X4SA 4UUWA 2HHQA 3RU0A 2LEPA 1VRTA 1RLDA 1RZMA 3AY0A 2CVIA 3CD7A 3NRBA 2QC3A 5J1NA 8AT1B 1YITS 3CCQS 4K4SA 4OZ1A 2XMJA 4WE1B 3D2WA 1UVMA 3WDOA 2VJVA 2D7SA 3MM6A 1SC4B 3EZUA 2OPPB 4DN9A 1SH3A 3B82A 5C42A 4ECQA 4DQSA 1NKBA 1I94J 3MZIA 5DDPC 4IH6A 2NREA 2QEXS 1RB0A 4LFAJ 5LXYA 2FVCA 2OPRA 2HEKA 4LSLA 3D0HE 4H54A 4ES1A 4JI7F 4F50A 2HMIA 2HWIA 1NK8A 4B3OA 2OO4A 3EXYA 2Q6BA 1T05B 3AA9A 4ID5B 3CJQA 3KNAA 1FFWB 2IYIA 3GU0A 1OWXA 3MPUB 4RW9A 5CQGA 5DETA 2ZH5A 1UFWA 2EBEA 3KUEA 3CSKA 2HG4A 5D8HB 4I6YA 4NL5A 4OYMA 1XMOJ 1U1RA 1ZPVA 5A8WB 3MR5A 1D9FA 5B0FA 1RGVA 1RTIA 2QIFA 2Z2YB 2WK4A 3KG4A 1FCAA 4JI0F 4TU7A 2OP5A 2NPFA 1NDCA 1HWIA 4BHQA 3S6EA 2L9DA 1FNXH 3D9BA 3N0VA 3R7BB 3W2WB 2QA2A 2GAGC 2A1BA 1GNKA 2W24A 1YSJA 3ZFVA 1N32J 1B64A 3IO1A 3M2RB 4HH1A 1MWQA 1EB0A 3OL7A 1SKWA 3M6UA 4M5NA 1KVJA 4KGZB 4ZK7M 1M5SA 4AYBD 2M2BA 4DDFA 5DLGA 3OL9A 2ZKTA 2M3DA 5IQQA 5IV4A 4TY8A 1KRPA 5EWEA 4PWDB 3PRDA 4KC5A 4DV6F 3VZIA 1RWWB 3TZXA 4YEAA 4YDDB 2OAUA 1T9TA 3J7Z5 2Q1LA 1IR1A 3MUTP 1HBNA 3CJ0A 5E0OA 3ZNJ1 2CQ4A 2OPPA 4AD6A 2H5JB 2EG1A 2V8GA 4DQRA 1CEZA 1KWMA 2OPRB 3D3BJ 5KTQA 1KD1T 4DX6A 1EETA 4X66F 4B3OB 4IOCQ 1O5JA 3B4MA 3W2VA 5IFMA 1XJWB 2XCAA 3R6GB 4JI7J 3Q23A 3KUHA 2ZD1B 4UT4A 5BR8J 3M8RA 3TARA 2HKEA 1ELOA 3U1LA 5IT4A 1UJ6A 4CT8A 3OV7A 1I94F 3GIIA 3QGHA 2WBRA 4DV7J 3VHQA 2B9XA 1FDNA 3IC1A 4BBYA 1WELA 1U6ZA 2PFDA 4WK1A 2G1HA 2RILA 1ZTTA 2CPXA 4ENOA 3M2RA 2MGZA 2R7WA 3BGLA 1FD8A 2DNNA 4PWUA 5GMDA 1Q79A 2HWTA 4C48A 3OR2A 4PR6A 1VBYA 5CAAA 4IRCA 3SSSA 5F8LA 2VIHA 1FJ7A 4KB7A 3C16A 3IM9A 1U45A 2RJZA 4LF6F 5K20B 3M2UA 3R5DA 4PWDA 1KLMB 1Y10A 1H7XA 4P9SA 5HQLA 2Q66A 1NO8A 1Y5NB 4ETXA 2EKYA 2ZHBA 3KOAA 1P8GA 5JUMA 1S0MA 2CNOB 1WSRA 2BJ7A 2V2VA 2XYPB 4F2RA 3C46A 5LJ5Y 2EG2A 4K8RA 1SKRA 3PYGA 3BYPA 2NXEA 1JB0C 4K2JA 3MAAA 2RU3A 7FDRA 4U8VA 2AQ4A 4A8FA 3M32B 3O2IA 3NS5A 3W2VB 1FJCA 2UUCJ 5HVHA 2R7VA 4UY8T 4ECUA 4YP3A 1M1HA 5F8NA 5HBMA 2E1AA 2YWKA 3GYXB 3SZ2A 4KPYA 4JI2F 1U1OA 3VAHA 1V3RA 3AAWB 3DRXA 1YJUA 2JHEA 2YPZA 3CDWA 3QWPA 1EQMA 1F2HA 5K14B 4DR3J 1N34F 4OZ2A 3T5HA 1TP7A 4ED0A 4ZJOA 1Q53A 4B9MA 2M70A 1O6XA 4NPOA 4Y00A 1QTNB 2YKQA 3CDAA 1ROFA 3P96A 1VJWA 2BACA 1UVKA 3NBPB 4ID8A 1XMQJ 2NPIA 2YWGA 3H8YA 2MGZB 3V81A 4DEZA 1BQNA 2VDIA 3OR2B 3MPDA 2XSFA 5DQIA 1MN7A 2IY5B 2F8EX 2VBZA 1PCAA 1LKZA 3D1HA 4N41A 3M2UB 2W25A 4Q8FA 4CLFA 4CNYA 1PO6A 3KK2B 2KDOA 2O1PA 1U1QA 5A0YB 2W4DA 1NMEB 1G3OA 1HBMA 2BV3A 1VCTA 4QIGA 1B0VA 4HEA9 2CQ2A 4EO6A 3K5LA 4B3SF 4KO0B 2J0XA 5E41A 1SJFA 5ETSA 2UXBJ 3UCZP 2W9CA 2VU5A 1J5OA 3CCWA 3GWCA 2J7WA 2VL1A 1ZM2A 3P3DA 5AXKA 3P5BP 2KT3A 4RW4A 2HQGA 5FLXU 3MMCA 1YZ7A 4ZPDA 4TU9A 1DRZA 3Q83A 1TL3A 1UZDA 3U7JA 4DUTA 5FJ4A 1I1GA 4DUYJ 5L1KA 3NMAA 3BGFA 3I4HX 4QYZJ 5J2MA 3GR1A 3JS9A 3TAPA 4F4WA 3G6VA 1NHUA 1Q5YA 3EM1A 1YRXA 1LW0A 3ENAA 4KT0C 5CZXA 4EU0A 4RW6B 1UL3A 2VQEF 2DRAA 2V94A 3RBXA 2CPEA 1S1VA 4XIUA 2XM3A 3V81B 2ASJA 1Z4UA 2VQFJ 1WG4A 2XMTA 5F8GA 4NRUA 4DHVA 2IM1A 4NCBA 2K7JA 4JI4F 2ZM6F 2XMKA 2OIHA 4LF9F 1LNQA 3W8GA 2ERRA 1G2EA 4KHMA 5HANA 3AJDA 5C25B 4DL2A 1RKJA 1WHVA 3F73A 3MMAA 2QFJA 1HBMB 3OTCA 3US5A 4Q44A 3DHXA 4U7UK 2QLBB 2N4DA 4NXMF 2MKJA 3RYLA 2YWWA 3FDSA 4E2FB 3GILA 4K0KF 2OEJA 5BXIA 2RNEA 1NUEA 1JLBA 2J0QD 1DJ0A 3B6BA 4FXDA 4RW4B 2XHCA 3ZZOA 1HARA 3DRPB 3NMRA 2AYGA 1TL3B 1CJVA 5G4DA 2DJWA 1SJQA 3I31A 2NLWA 3K2YA 4ECWA 2UVRA 1ZH5A 3E2EA 1K0VA 5H9FJ 3ZZTA 4DR7F 4ZVHA 2WVCA 5IOLA 3Q2TC 1EP4A 5FDLA 4ZVFA 3LWMA 2AV5A 2LLZA 5GAGU 3OL6A 1FRHA 1VQYA 4OZLA 4R0JA 4FBTA 4O44A 4DFPA 1VQLS 2A0FB 2ZNZA 2ZH2A 4CO4A 3W5XA 1S0VA 1WKJA 3W63A 1L5UA 3TWZA 2Y8YA 3LGHA 3DOKA 4A8KA 1F3VA 1U2CA 1N4LA 2VQEJ 3AQOA 4J9NA 4DWIA 2DY9A 2JL9A 4N7TA 3ZTRA 2R8GA 2PMWA 3G87A 1TAQA 4P6QA 3PXGa 1Z2ZA 3ZZPA 3ZZRA 1L3VA 2FLNA 5F9LA 5KFQA 3ILJA 1HMVA 2VG5B 1FKAF 1WEYA 3DKDA 3R2CJ 4IRDA 3H2VE 4FF2A 4PYAA 1DQAA 4M5MA 4RPFA 2D3O1 4I0WA 2R8JA 1U24A 3NGTA 2DNMA 3M30B 5HI7A 4DV3F 2DK2A 1JLBB 3VV2B 1UEVA 1MU2B 1SI9A 1SKUB 3MMBB 2FVRA 2UXBF 1SL1A 1TR0A 4YY3F 2GZOA 1X4DA 4KHPJ 1CJVB 1DLOA 3A13A 4G3IA 2BW2A 2HQCA 3EPGA 1SJ3P 1N56A 4LRFA 1SVDA 3W66A 1YHQS 5D3GA 2BABA 5IT9Y 3QLHA 3WX8A 4EK2A 2UUBF 5K8OA 3R9LA 5L46A 4NLSA 2Q43A 1Q7YT 2OEKA 4MYUA 2VPXB 3PX0A 3H4DA 5E3CA 2J7UA 1OYDA 1B7FA 5HSPA 4Y2AA 4M8LA 4JV5J 1GX5A 5SUHA 3NKYA 2BRLA 4CO5A 3J81Y 3DNCA 1M90T 2G0JA 2UU9F 1U02A 3DOKB 5HATA 2JEGA 2J5AA 2I9SA 3MEKA 4HHJA 1VOMA 4CLSA 3PX6A 1RT3B 1S57A 3ZZ0A 2ADBA 2BZ2A 4FZVA 1C2PA 1RHRB 2MKIA 2GJ2A 2QZ8A 2PN6A 3TUZC 2DCLA 4N8NA 3AH6A 3VTIA 2GS8A 4RKUC 2E9ZA 3W9JA 2PDAA 4FBUA 2DHXA 4FYXB 1CLFA 2JFDA 2VC0A 1YRUA 2BE7D 2RVJA 1P1LA 2DNGA 3MEEB 4WTYA 4G1IA 5B0DA 1A9NB 3OTOF 2FY1A 1V3SA 2KO1A 4LT6A 1UWBB 3MMBA 3T9ZA 5SZTA 2R7UA 2W01A 5KT3A 4NLPA 2HVEA 2AYMA 2BUNA 3CDEA 3HI9A 2DO4A 1WOSA 2CPIA 2MSSA 2GNKA 3M8ZA 2C2KB 1LEOA 3UE2A 2QE5A 3IGVA 1LK7A 3J81j 5D3GB 4F4XA 1S1WB 2J8AA 2H4YB 3CJ5A 1AXQA 4B3TJ 3BPSP 1S12A 4X65F 2JSXA 4F04B 2JEIA 1CG2A 2H65B 1GMWA 1Q1KA 1HLWA 4I2PA 5ETQA 2LQ9A 1C0TB 3TA0A 4K5RA 4GKJF 2IIHA 3HX9A 4CLZA 2JNJA 1L3TA 1QSSA 2HZVA 2LDIA 3PCOB 2C2NA 2G13A 2FJEB 2LXIA 1RWPB 1YBTA 3B4DA 3R5GA 4M5KA 3GB0A 4ZCKA 2E9TA 2RF2B 3I0RA 1LWFB 2FZCB 2Z57B 5KFDA 4YY3J 3C3LA 2LEAA 4Y2CA 4FYWB 1R8HA 4BWJA 4ZCIA 2V2KA 5E33A 4OX6A 3M4XA 3KK3A 4DR3F 1RP5A 2MJNA 5F8MA 3FCWA 3DGPA 2AYEA 2XZWA 3UNGC 5CXTA 3AD8C 1MNEA 3EUNA 2DITA 1N88A 1YJWS 3V6KA 1YK9A 1RHJB 5HMXA 1X9MA 4OYWA 2DPIA 4DX7A 1HQUB 3CE8A 4I69A 2MKHA 4USJC 4BWMA 2BOAA 3H98A 2HHSA 1WG5A 3TVZA 4USMA 2OSRA 1CC7A 2KVQE 4L3KA 2AHOB 5JJBA 2I0XA 1C0TA 2V4JA 4PG8A 2HLUA 1LWCB 4OX9F 1U0HB 2APOA 3I32A 3IFEA 2DCUB 3TAMA 4DS5A 2DNRA 4OZ0A 3QATA 1OYEA 5HMZA 3KMSA 3M8SA 2HHHJ 2OTLS 1GX6A 1RDRA 2Q6CA 2RE1A 3HHDA 1D8YA 1KKHA 1XR6A 2FJWA 2OPSA 4A8SA 1LWFA 1TL7B 1WOOA 2HHPA 3MR7A 4S0MA 4DPUA 2QRRA 3CWJA 4JI5J 3C8YA 2H48B 3MI7X 4M5JA 4MJKA 2MHEA 4F4YA 3CCES 1JLGB 1TL1B 1VBKA 2BQRA 4CP5A 2DNYA 3FMWA 4RNOA 2A3JA 2J9CA 3KJVA 3QZ7A 4KHPF 2VASA 3TEGA 1F1BB 4GVLA 1BWEA 2K8GA 4DX5A 2DH8A 2N3LA 2ZZMA 1VC0A 4ZS6A 3N4WA 2FC9A 4ANDA 3BM7A 1YKWA 4NLGA 1AW0A 1ZZNA 1TL5A 2X51A 1JX4A 4OZNA 2V68A 4R5PA 4CLYA 2BE9B 3QRPA 5J1EA 1HQUA 4UZBA 1GTEA 2IJRA 2Y1JA 2AZ1A 3ILLA 2C1EB 3MCNA 2LXUA 3L7OA 2FQQB 1IN0A 4QIWD 4KIAA 1HBOB 2B0GA 4TXSA 5JVGQ 1KQGB 3CC7S 3TX0A 1RJJA 1Q78A 1LWCA 1HNVA 1U0SA 2GV1A 2LQ8A 1YJRA 1SC3B 2EVZA 2L9NA 4USHA 4OYOA 3TAMB 2G4BA 2PA3A 5IXUA 1AZSB 4DR2F 1IJEB 2ZVIA 4NA3A 3TOQA 4LQ3A 5E3PA 1TFYA 4EFAC 4ED6A 1HWUA 4IFVB 5KG2A 2OPSB 4GC6A 3IRXA 1TL7A 3DDKA 1IVZA 3G6YA 1CSJA 3CPWR 3NOGA 4QJVA 2FVQA 2AGQA 3OTOJ 4MFBB 4UOCA 5KFSA 3D5MA 3SFGA 1VQOS 4PXCA 3OXFA 3EMTA 1XNRJ 2IMOA 2PA8D 2HHXA 1IBCB 1LWXA 3K5NA 3AD9C 1VBZA 2IJFA 3T6JA 1IBKJ 1KDNA 1C4CA 2A18A 1FKOB 2DRBA 2FJBB 1XK8A 2BM1A 4CLPA 1VRUA 3JSYA 5HJYA 2E5HA 2MDAA 3MAQA 1RWKB 3QYYA 2P6TA 2EFOA 5KFHA 1N5VA 5HK4A 5LSRA 3R97A 3VR1A 2CIMA 2VFRA 3PR4A 3THPA 2MPUA 2UU9J 3H7HB 5A2QY 3FBFA 3EZ5A 1T9UA 1TKDA 4K59A 3RAQA 2CA9A 2P2CB 4ZDNA 1HNWF 3J81U 2VZ9A 4OI3A 3WQPA 4KTQA 1X4BA 3HHLB 4DV5J 5AE2A 2ASDA 3M6WA 3N6LA 1L3KA 1HBOA 3NCRA 2L41A 1RTDA 2IM3A 4JI3J 1FDBA 3BH6B 2C3PA 5H9EJ 1RU1A 2B3TB 4V19X 1RT7B 4N56A 4DV1J 1AZSA 3JSRA 5ADZA 2Y0BB 5C2GA 1RT4B 2HNZA 4KKOA 4OQJA 5IC4B 1KQKA 1RT1A 4NCGB 4Y2IA 4U67Q 5HROA 3CW2C 4IFVA 3P6YC 5IT9U 2XLJA 3IRXB 1UEUA 1W25A 4BLGA 4DR1J 1JLEB 1QDUB 4OI4A 3AFGA 3HLUA 4YS2A 2V2ZA 4Z37A 2CJ9A 1BUXA 2N4CA 4A47A 5EDWA 4A4JA 2WW8A 3SQOP 2BKNA 3M6XA 4IYQA 3THTA 1TMMA 3LP2B 3MD1A 4IG3A 4Q7AA 4LFBJ 4CTAA 3OSNA 3I0SA 3J80Y 2OFHX 2ZBCA 1Q8LA 5IV3A 1TK0A 1TUGB 1UWAA 3UN3A 3HJFA 5DZ7A 2HHWA 2M8HA 4QZVB 1N6QA 3HF5A 4B17A 3PKMA 2HZAA 4ATNA 3LF0A 2P9EA 2JWNA 1S1UA 3JYTB 4E0DA 4NZ6A 3BBBA 5MLCV 3UD4P 1VQMS 7FD1A 1X5TA 3NCQA 4Q2LA 4CO1A 1F5AA 2HGMA 3K7RA 3NGSA 2VKZG 4AXJA 1PYSB 1V5IB 2P9CA 1NZ8A 3MWBA 1AA1B 2BANB 2Q3PA 3CEDA 2EKNA 2EFVA 4RBVA 2KG1A 3SMZA 1HNWJ 4ZPVR 2XEXA 2I6WA 1H74A 1VC5A 5JMNA 4KBIA 1AB8A 3DN9A 1H6KX 1RT4A 3KXDA 5KFMA 4QW9A 1NH8A 3MM5A 1RT1B 2RQMA 3DOLA 4O3QA 1M0SA 3UCUP 3DDIA 3Q86A 1DY3A 1EKRA 2XZTB 3CJSA 3ISND 2X1BA 2PEBA 4L76A 2A6OA 4EYIB 3CD6S 3W3SA 5KFPA 4KGVB 1VQ9S 4USTA 3AODA 5KAKA 4B3MF 2LYVA 1I51B 1OY6A 2G1DA 2JFKA 4C6AA 3KHGA 1VQ8S 5C24A 3BGRB 4NI2B 1OIAA 4OFZA 3CCRS 4LUBA 3MEGB 3W8PA 1FVSA 3BBCA 1FRXA 3GFZA 4CTAB 2LA6A 2VFSA 2KL8A 3NP5A 3QT8A 2HURA 4HHHA 2WBMA 3OTBA 1HQ2A 4LF9J 4NLXA 1WWHA 3GLJA 3W65A 1KN6A 1VRQC 2R7QA 4IOBA 5ETRA 4M94A 1BXNA 5KG3A 3KFWX 2CNNB 3QRRA 4MKVA 1UTAA 2W1BA 2MXYA 4RO0A 1W26A 1FE4A 2Z2MA 1JXEA 1PSDA 3EDQB 3MHYA 3QGIA 4UW2A 1FVQA 2DHSA 3SQGB 2HNDA 2HPUA 4QR0A 2WVFA 2CJBA 2KVIA 4H4OA 4ZPBA 1IXKA 3C15B 2HHUA 1AFIA 2HRUA 1IBMJ 4WKYA 3UNYA 1JLFB 3JQJA 3S01A 3MM5B 2VH7A 1FJGJ 2ZFHA 3C6TB 3EJMA 2VB6A 4XAKA 3MXHP 3PZPA 3HHLD 4WU3A 1Y3JA 2WSFC 5A8KA 2YKOA 1RYRA 1AUDA 2K2PA 2HVHA 2MMYA 4OI6A 2L3MA 1F2GA 3MTJA 2F1FA 2Z8QA 5GAEU 1CJUB 1VIOA 3G8TA 4DSFA 3C2PA 1S6PA 2RQ4A 2MZQA 4NI2A 3BR9A 4F7VA 1Q81T 2FGOA 1NSKL 4IO9Q 1JXVA 1JNZB 2D1CA 1Y5IB 4DMZA 3KLGA 2MTLA 2YKMA 3H5YA 1S48A 1KQFB 5LMUJ 4CNZA 1T02A 3OTDA 3PYEA 4HACB 2KRBA 1Q8KA 3JSBA 5C5JA 1FJGF 3CIMA 2JRSA 3KLHB 4MK9A 5L1LA 4GRSA 3K59A 4IQMA 1V3ZA 1PYOB 3TI0A 3H25A 3G2XA 1S1XB 4X65J 1XQIA 5KFLA 3T6BA 2HFNA 4PXDA 1K73T 2J6SA 2W7PA 5GADI 4MK8A 1SKSA 2LEBA 2VPWB 3QQCD 3SQGA 4NYZA 1N54B 2HNDB 1WEXA 3P5TL 3QGPA 1FEHA 4PEOA 4CWBA 1KBRA 2BJ8A 1SIWB 1SJ1A 2IHR1 1HWLA 3I9ZA 3VQSA 4ZMMA 3C15A 2KM8C 2KFNA 4Y6IA 3GCWP 1JLAA 3KDOA 4Y34A 3EVWA 1JLQB 1JLFA 4CLUA 3SFUA 4P75A 3HVAA 2Z58B 3GP9A 1HFEL 2Y1RI 4LF2A 1N8RT 1FK9B 4P10A 3NEKA 3SSQA 4GVBA 5LJ3Y 3OVSA 1PBAA 3IR6B 5KT7A 4WU2A 1S59A 3DCAA 2VPYB 3H2UB 1CJUA 3PEHA 1WKKA 3LAKA 2E1CA 4IR9A 1PC5A 2RUSA 4RUBA 3RR7A 3W61A 1ZTWA 5IT0A 3DI6A 1ZYQA 1FO1A 1U2RA 2OUGA 1KS2A 1HI0P 3TUPA 1QLNA 2YKMB 5GAHU 2W2NP 1XNRF 4LREA 3TA1A 5E5NA 1DTTB 2OEMA 5AXMA 3VGTA 5FLXY 1GTHA 1H2TZ 5D6GA 4ZKAA 1H2UX 3GSIA 3Q0AA 3V6HA 4ZLJA 2IFXA 3CTRA 3D6FB 1QJHA 1S1XA 1IKVA 1I3OB 3TJAA 1PYTA 1M5HA 4K4WA 2AYBA 2UUAF 4KJIA 3NGRA 3PTWA 2FVSA 2DYAA 1S1TA 2M4MA 1NHVA 3I82A 4Q5VA 3TAQA 5G0RB 2CJXB 1JJ4A 2F4VF 2E1RA 4JI1F 1GMVA 1QUVA 1TKTB 4ZP6A 1HNXF 1KLNA 2B8QA 3PW4A 1NPRA 1RU2A 3BPDA 4BC9A 1X9WA 2DR9A 2GC8A 2YVSA 1OQ3A 3PFOA 4RUAA 4OIXA 2PIIA 3L09A 4U7UD 4XK8C 4KGXB 1RISA 1VDHA 1CJTB 2HNYB 4MIBA 3PRBA 1S9EA 4JI4J 1FK9A 3MR6A 2IBOA 1DFDA 2W9BB 1X0FA 5B08A 4J9KA 3T5LA 1UVLA 4LFBF 2ASLA 2I5JA 1RK8A 2AT1B 3VGSA 3VVUA 1WKLA 1FWLA 1YZ6A 1V6HA 2FTRA 1B70B 4FDFA 5CCLA 2X7IA 1RWUA 2QL9B 3P49B 1UA1A 3DI6B 2KYXA 2QG9B 3N79A 4OV1A 4AT1B 4F0MA 1K1SA 2O67A 1HL6A 2LXFA 2CJQA 5AXLA 2ZH7A 3IS9A 3GYGA 1T03A 4FF3A 1JWWA 4DV6J 1RTJB 3UO0A 3NCPA 2PMHA 1FTRA 1DTTA 4NOHA 3JSMB 4PRFA 1XC9A 2FUG9 2CAJA 1XERA 3EVMA 4KV8B 1RA7A 3QJPA 4Z2XA 2AEJA 1SCJB 1ACMB 2VBWA 1IBLJ 2AZ3A 3FQKA 2AX0A 2B6AB 3DLJA 3R8YA 3D66A 4ECRA 4C3KA 3SV3A 4J9MA 2C2OB 1IQTA 1S99A 4DCJB 3HSJA 2KM8B 4EBDA 2DVIA 4TLRA 1XWLA 3A12A 1UCNA 4CIOA 3BZQA 4EZ9A 1X4HA 2OI2A 2FJXA 1J5EJ 2HLTA 4IFYB 5KFOA 5F8JA 2HFVA 2MLYA 1TK8A 4WKRA 1RAAB 5KFUA 5ETTA 4DU8A 3BQ2A 1W2IA 1LWEA 4NLRA 4ZVEA 1FX4A 4ZIVA 4OYIA 2MLZA 3G8QA 2H3EB 3Q24A 5HO4A 1U4BA 2VA2A 1CS4B 5I42B 1T3OA 3EVOA 4DFMA 1QUPA 2QYGA 2R3VA 4HR2A 5EX0A 4ZLNA 3SI8A 3OPKA 4ECYA 2X1FA 2RUGA 2CVEA 4DV7F 4OJGA 4DBQA 5J2NA 4LQ9A 2VV5A 4ZVRB 4A8MP 4ECVA 1T03B 3V5RA 2ZE2A 4ER8A 1R0BG 5KT2A 1EHWA 1ZAXA 4ETZA 1TKZA 5D0GA 4DFKA 3GYNA 2C3UA 1U1PA 3X1LB 3JSMA 1NK7A 1UKUA 3Q8UA 1Y4ZB 3TJ8A 4RUCA 5HLFA 2CPFA 2MY7A 1RABB 1LXNA 3KMQA 1YVFA 1OO0B 1UFKA 2IDEA 3ENQA 4HI2A 2WCXA 2N7CA 4ED2A 2XY7A 1UA0A 1NDPA 2PI4A 5B0BA 2WTFA 4QQBA 3J7AN 2HBRB 2O3DA 2FHOB 2QL5B 3RUBL 3TZZA 3CXCR 2M0GB 2E7XA 3EWGA 4EMDA 3MM8A 4KQZA 3M9NB 5J2QB 4NLYA 3DLGB 3OUYA 3FC9A 1EKSA 2ACMA 4R0EA 1ZM9A 4YUDA 3MPWA 3JQMA 4I6WA 1HNIB 2YNHB 2AMCB 2B43A 4ZPAA 2EFQA 1KOHA 4IFYA 2MZTA 1OY9A 2FIUA 2YXLA 4RWWA 2N3OA 5B0AA 4DG1B 3PR5B 2XLIA 1LWEB 3MOJB 2HHTA 5DO2A 4YHHJ 1FRMA 5KFNA 1JJHA 4HLBA 5HMWA 3IR5B 1AYEA 5LMNF 2JVOA 4DUZJ 1NJZA 1Q7LB 3FBCA 1Y3KA 3LQVA 3QO9A 4RR5A 3UQSA 4X64J 2HAIA 2RB7A 2ZC3A 3A8JA 4ZPTR 4CZCA 4X62F 1G1XA 1MG7A 4M5DB 4OYBA 4TLQA 4WXWA 4W92B 3ULHA 1NJIT 3LO3A 4O3SA 4RX6A 2CQ1A 1WDDA 3G82A 4KH1B 4M63A 3UD3P 3JB9k 2VA3A 3G9CA 2ZE2B 1Q5VA 3CMQA 2DR7A 2GMJA 2RRBA 3RB3A 4ZOSA 2GIFA 4RW8B 4OJ1A 2GIQA 3CD5A 3OR1A 3L95X 2HRYA 5HLFB 4ZPCA 1C0UB 2XTJP 1NRKA 3R5BA 4WE1A 4F36A 3LP0A 1S76D 4IO1A 3CGIA 1FRJA 2RT3A 3THVA 1UW4A 2W7OA 5L9NA 2EFPA 4XPCA 5J2QA 1MMDA 3UVJA 4OHZA 3I6PA 4USIA 1XEZA 4LSLB 2XMMA 2XG8A 2VG6A 2DO0A 2W7AA 1RWXB 3MM7B 8ATCB 3N9UC 1TUWA 5M2UA 2VFUA 2HMIB 4B9SA 3CIZA 2YNHA 1T05A 2YWHA 1VK8A 4ID5A 3M9MB 2KFZA 4NYOA 4OHXA 3FSYA 4RW9B 3LP1B 3CDBA 3KHLA 5ETOA 3K0JA 1NNDA 2HWHA 2YQ3A 1SC6A 3EGWB 2ZBPA 2WSEC 3M8WA 4PG4A 3D6MB 2CADA 5MAOA 1S72S 3H90A 1R31A 4C4WA 1S4EA 5AXNA 3Q8YA 2O66A 3BKUA 3Q8VA 1VHIA 1V5VA 3LTOA 5IWAF 2ZJPQ 3DM2A 4M5DA 4QIFA 4MIAA 5JXSA 4J9QA 3A3PB 4LF4J 4PABA 3DLEB 4YR0A 3D7SB 1YJ9S 4L75A 4UQTA 3RR8A 3UD5A 5CYJA 3QIDA 4JI6J 1S6UA 3T9NA 2HYIB 5HQ8A 3UR0A 2UVVA 2NCKL 1DHMA 2DIUA 5KFYA 3OR1B 3K8VA 3P45B 3IWNC 3JQKA 1IR2A 2DEJA 1C0UA 2UUAJ 5F9NA 2BMBA 3ZTOA 3D54A 2R2UA 5KFKA 1JMTA 3RGIA 2RSQA 1RA6A 4ICLA 4CM2A 3O44A 2VODA 2MB0B 2QX0A 2MJUA 2B56A 2B4OA 2LA4A 3ILOA 2JEJA 1RT5A 1EETB 2YQ1A 3LUYA 1FKPB 3MM7A 4TY9A 1FX2A 4ZVQB 2KJVA 1X4AA 3J80U 4NLDA 2GQ2A 1U26A 4TVAB 4HYKA 1SPBP 2L48A 4MKYA 2V50A 4ZP9A 4UY85 2NSBA 3KLIB 1HBUB 2K3KA 4FVCA 3I96A 2CFXA 4X4QA 2CG8A 3LP1A 1F5BA 4X4TA 2F65A 4CQ1A 1F6TA 2HQ3A 3M2VA 3KYLA 2IMWP 2IBKA 5I3QA 3M8QB 3KHRA 4H4MB 1X4GA 2CRLA 2IVYA 1EAYC 1BHNA 2DGOA 5CYMA 3MFIA 2UUCF 4WFXA 3P8BB 4FXVA 1HNZJ 4LRDA 1NPPA 1RQ0A 1Y5LB 2DTJA 2AKWB 2M5YA 4WCEQ 3DM2B 4R25A 1RWVB 2DT9A 3BB5A 1FI4A 3H4BA 1X31C 4DX8H 3N5FA 2BJEA 3HM9A 1B0PA 2CWXA 2YQ0A 3QWUA 2E5JA 1WC3A 1OS5A 2LDYA 3IGNA 3MGJA 3MECA 3OQ2A 2CJYB 4KHRA 2V6AA 4EWTA 4DR5F 1FHTA 2W8KA 4TQRA 2E9RX 4QIVA 1UFLA 2F8HA 4K7QA 4CO3A 5AE1A 4C97A 3RB0A 5DM6Q 1SL2A 4CI0B 1RWNB 3AOBA 3D3CJ 5HJXA 5GADU 2DGUA 2VG7A 3DGVA 4ICLB 3R7NB 2R7RA 4JI1J 2F4VJ 1BD6A 1CQMA 3QSIA 4UQGA 3DU5A 2P6SA 2ZEJA 5F0UA 1B4SA 5M2RA 1RT5B 1NKCA 2VOOA 1ZS6A 3BGUA 5F41A 2MZ1A 2UXDF 2V8VA 3A8KA 2KJWA 2Z56B 4ZJLA 4RW7B 2VUGA 3W7BA 2R8KA 1RADB 3KLIA 2V9KA 2CYYA 4Y65A 5GMEA 5HBMB 5K8PA 3T5JA 4A8WA 1T9YA 3UI3A 1C4AA 1QE1B 2MSTA 2MQNA 3PO4A 2RS2A 2AF6A 4RNFA 3OJSA 3RAMA 2FLLA 3FUYA 3M8QA 2VOPA 2E7VA 1WI8A 2CQ3A 4KFBB 8RUCA 4NMXA 3NGKA 1GK8A 3Q89A 5I3UA 5ETMA 2OTJS 2Y0SD 4HT5A 3NS7B 4OL8A 2QMUB 2VJUA 2HBQB 5EUHA 3NBPA 2XI3A 5ETPA 3UFCX 1NM2A 4QWCA 1C1BA 2IAJA 3BKTA 3VZHA 2WB1D 1X4FA 1BQNB 3CJ8A 3WIVA 2A6MA 3CCJS 3HULA 4EEYA 3L4BC 2C2DA 4Q45A 1GMWD 1H0HB 2JC1A 2KXHA 2JOQA 4OI2A 2E44A 3I9V9 2ZWOA 3MECB 4ZP7A 4QWAA 2X1AA 3BO4A 4A8QA 4CH1A 3KLFA 4BDPA 2XNRA 3H2LA 4OJ3A 1PJ6A 3POTB 2YNGB 2E5LF 3KK2A 2GAHC 2AGPA 1X60A 1SQEA 4J9UE 3HP6A 4QCLA 4YB7A 2R7XA 1SQFA 2VONA 2VG7B 4USWA 3HZEA 3OFEA 2C2ZB 4CO2A 4KO0A 2XBPA 1X9SA 2XS5A 2FDNA 2ZDPA 5KFIA 1J5OB 1FXLA 3ZTPA 3GIJA 4RU2A 3KNGA 2J0WA 5D78A 1PIEA 4C8KA 2GO9A 3TANA 4C11B 3A4TA 2LVWA 3AD7C 1NEEA 1HR0F 4JI0J 1XMBA 2W2OP 1VJQA 1VLYA 2ZOGA 4NLWA 4OV6A 4WPAA 4NMLA 3RRKA 4HT7A 4CDIA 6AT1B 2ALZA 3DRYA 1FFGB 4M5HA 2H1YA 1LXJA 3RJMB 2BRKA 2IRYA 4JB8B 3BO3A 2CQPA 4F3MA 2YX4A 1FEEA 3VQTA 4KFBA 5T14A 1LW0B 1P1TA 5I3UB 1R8BA 5GAEI 4KY3A 1N5YB 1AT1B 1OSDA 5DLFA 1S1VB 2J9EA 1JKHA 5BYQA 3UPFA 2DNHA 2Z0GA 1BY9A 1VYAA 5ETNA 4PQAA 4Y28C 5D0EA 3PEJA 1VQ7S 3DLBA 4LF7J 1DQ9A 1R27B 4LMZA 4QU6A 2E5IA 2H54B 3DDNA 4KH0B 4DZDA 3KLFB 3HO1A 1U2FA 3POTA 2G0IA 2YNGA 4TYAA 5CYQB 3RRGA 3DFEA 1SJRA 5A6PA 3MMAB 3MCMA 2VHGA 2HFOA 4F8RA 2G2YA 1S6QB 2OFGX 2OMOA 5CD4H 2Y1LB 3J7A1 5IZHA 4QW8A 4F26A 1RKIA 2KKHA 4ZVPB 1Y00A 1R89A 5JVHQ 4B3TF 2GJFA 2XI2A 2AWZA 4MAKA 4IR1A 3DRSB 4ZA1A 1N33J 3IR7B 3M6VA 4G1PA 4U7CA 3CF5Q 4NZ0A 5CHCB 2BJ9A 2R2RA 3CCSS 2PC6A 2R2TA 3ZC4A 5BJRA 3BDPA 1VI7A 3FCHA 3PNIA 1Y9OA 3QRQA 2BA9A 5IC6B 2IPOB 1NB7A 3DYAB 2K3IA 3ZXWA 2U2FA 4DFJA 3GR0A 1FDDA 2WOMB 3NGDA 4J9PA 5FDLB 2AIRB 4JV1A 1N5YA 1U25A 4YDXA 2CNLB 3B8HA 4O44B 1HYSB 4J91A 2FLPA 4L72B 2GFFA 2WONA 4DS4A 1NJYA 1N48A 2DGQA 2LFVA 3BO2A 2C42A 1U48A 3LWLA 1QD1A 2GJIA 1TL4A 2CQCA 2YX1A 3GZ7A 4OYXA 4ZIWA 2JX2A 2V4RA 4YOEA 1HKAA 3Q8RB 4DQIA 2DNLA 2W4CA 1A7GE 1JLCB 1HA1A 1REGX 1KOOA 4GMKA 4P2XA 3CJKB 2J9DA 4DV5F 1FNOA 3HSGA 5CYQA 5KT4A 4WZMA 2OH2A 4JV5F 4NXNF 1NZAA 2RHQB 4G1QB 4NXNJ 3VAGA 3BDEA 1HMVB 1S6QA 2VG5A 5ETKA 5H1SV 2DR8A 2MZSA 2BW7A 1X7VA 2L9WA 4FNHA 4OX8A 4WP8A 3W9IA 5KT6A 1HQEA 1RAEB 5DZ6A 1REVA 3TZYA 2XNQA 4X4OA 2B4PA 2KI2A 4TU8A 3DRSA 1DARA 1ZBTA 2FHJA 3CB4A 3M30A 3PJ9A 3ICLA 2ZWPA 3WIUA 2BJ3A 1N34J 1MU2A 5KFEA 4Q8EA 2VD3A 1RYSA 1WTFA 2ZBQA 2RIJA 4DPTA 1IBKF 2HGNA 3PJXA 4ED4A 1R8AA 2I1RA 2OD4A 4N8OA 4HH0A 4M95A 3DYAA 3EE3A 5EWFA 1CC8A 1SV5A 1TU0B 3BR8A 4KPCA 3OFGA 4YMEA 4ERDA 1PAUB 1S9GA 3BQ0A 2MLXA 4NYPA 2ZNYA 3LALA 2B9YA 4RLEA 4MT1A 2ZVSA 4A46A 1HYSA 4C2MA 5GMKa 2M8DB 1NU4A 2L08A 4P2SA 4C3MA 3KLEA 1MN9A 4WZQA 2F3JA 2E5LJ 3WBZA 2MQLA 2V67A 3HHKA 1M5PC 2YKNB 4WFZA 3SBMA 4CT9A 2RQCA 2BDPA 3SCJE 3PW0A 3CJKA 1JLCA 2LU1A 4ED7A 4IQXA 2XYHB 2C3YA 3C6UB 2QMWA 2X3GA 5A6WA 2BYCA 4RJVA 1N36F 3TVKA 1LOUA 4CLLA 3HCXA 1TVRA 2V8DA 2XY5A 2KXNB 1P6TA 3ISNC 4QWDA 3FQLA 5KFFA 1HQEB 4L3NA 1REVB 1UJ4A 1VIXA 2MKSA 2QO3A 1CULB 3MEEA 1BWVA 5LM7E 5LL6d 2CZVC 4FVMA 2KXFA 3V4IA 4DQPA 2K7KA 5F8HA 4I67A 1LK5A 5GAHI 2ZH9A 2KH9A 2N82B 3T1HJ 2DHAA 5IM0B 1FTCA 4N5SA 1E6YB 2D69A 4I2QA 4O4GB 4YN3B 5IS2A 3IMQJ 3FEYB 1FD2A 2R9LA 1TZ0A 3AB4B 4ED3A 1S1WA 3WZ0A 3PVXA 3OT9A 2LQ5A 2R42A 1SV5B 2YNFB 1S49A 3MPYA 4ZN3A 4ZJQA 3J7ZT 1S7HA 2UXCF 1S9GB 4QU7A 4W90B 2G9OA 3NNHA 1NK5A 2X3DA 2HAFA 5BYSA 2HQDA 1SC1B 3PACA 1NH7A 3RB4A 1MMNA 1D09B 4I2PB 1NAQA 2ROGA 2M7SA 5KG5A 3KLEB 2PD1A 2JVRA 3VAFA 4FYVB 1Q82T 3G86A 2R7SA 4X4VA 2YKNA 4UUXA 2OHDA 3NY0A 1N5TA 3FEXB 3FFIA 3T19A 1FWKA 5A8RA 3GPAA 2BQ3A 2G2ZA 3NS6A 2Z4PA 5KFTA 2RF2A 1VQSA 3C6UA 2VQFF 5B0EA 3KG1A 2QA4G 4B3RF 2XWYA 2ZH4A 4TKTA 1BQMB 2HVZA 4URQU 3M9OB 4XTTA 2JLEA 2VDHA 2B9WA 1FFSB 2PSZA 4Q0BA 1HHQA 3B54A 4MTPA 2AW0A 5KFCA 3OJUA 2CNKB 4AQYJ 1N0VC 2MZRA 3V4IB 3MPVA 2VBYA 3DGPB 3CD0A 3GV7B 1H73A 2QJ3A 3A8EA 5LMUF 4PG7A 3D1OA 1E6YA 1E6VB 1RTHB 1QAJA 4O4GA 4GC7A 2GO8A 2P9GA 4QR1A 4AL5A 3R6LB 5CABA 4EGLA 1CVJA 5HMYA 2XHWA 4LSZB 2I2YA 2CPJA 2HBYB 3L7UA 1HW9A 4LFCF 4CLTA 2KG0A 4C98A 3AT1B 3ENVA 3HSZA 4B3SJ 5AJ3J 2PGCA 2ZHOA 4LF5F 3IAM9 1LFWA 2Z2ZA 4C8MA 1TMJA 2EW9A 3C14B 2ZOMA 3OLAA 5J2PB 2CJKA 3FMBA 1FDAA 2QT7A 2BM0A 3FNNA 3H20A 1J27A 1U0HA 4I7FB 4L74A 5D15A 4TN2A 4DQQA 4C0HA 4X4PA 1XNQF 2ZOFA 4JBCA 5H9EK 2UZAA 2D74B 5K8NA 1FE0A 2CPYA 2DHHA 2DXDA 1M1GA 2LU2A 4J9RA 2OELA 2F4FA 2C28A 2V9WA 4K4ZA 3HDSA 4KR0B 4XDCA 1RAHB 2DNOA 2YKAA 1XMQF 2ZITA 1UVNA 2P5VA 3R1LA 2W2QP 2KN4A 2V5HG 2QA1A 3BREA 1JLGA 5CCMA 4YB6A 4Q0BB 2DHGA 4IUFA 1K44A 3OXGA 4ECZA 2JDJA 2DBBA 5T41A 3I55S 2HFSA 2DRDA 5D0HA 3ZNUA 2H51B 3AA8A 4NLOA 5E3RA 1N5SA 1E6VA 1RTHA 2QFIA 3MCSA 2CKWA 2FLOA 3OTEA 1BLUA 2E29A 5L9XA 4DL5A 4N76A 4D3HA 4WBFA 4C8YA 4R5PB 4QR2A 4DR6J 3D0GE 2NXUA 1D8ZA 3TR5A 1KHWA 2Z2LA 2PE8A 2FHKA 2WVDA 2B8PA 4ELVA 1I5OB 3I5CA 1RAOA 1YLXA 3C19A 4KGMA 3HD2A 3BN7A 3PHEA 5KG4A 3QMQA 4Q2MA 5A2QU 2QLXA 4F2SA 3VAMA 2PI5A 3NNCA 2WVEA 3LANA 2XLKA 2EI5A 3IN5A 3EGVA 2WW4A 3C66A 4PG6A 3K5MA 1KQSR 1KTQA 2J6TA 1Q8BA 1RTIB 5L8RC 3CDUA 1YBAA 2D41A 4PXEA 4WIQA 2FC8A 1T0TV 4J90A 4C8NA 3W2WA 2W9AA 5CZVA 4WFNQ 4DR4J 2KB2A 1WC1A 2CPZA 2A2CA 4G65A 1WOPA 3LGMA 3FCVA 4Z7CA 2MYFA 4C3LA 3A3NB 4PKDB 4TY8B 1FKOA 2HHVA 3HHLC 1EJ7L 2HK2A 2P8IA 1HWJA 1XIQA 3AJ1A 4OYZA 2ALYB 2E5GA 1IWGA 1HBNB 4JYAJ 2UVWA 3KJQB 1OQ6A 5KG0A 3K17A 1UEKA 2ZHAA 4FF1A 4ILLA 2RDIA 3CO0P 3AOCA 1P27B 5LSLA 2YTCA 1SJ4P 2A10A 4IH7A 1YJVA 1HHTP 4DSLA 4O0NA 3HHLA 4MKAA 2EBGA 5AT1B 3MEDB 1RTDB 1B7YB 2V2QA 3MM9B 2GCFA 1ZM4A 1Q4RA 2ZD1A 4GO5X 3R7SB 3TA2A 4HDGA 3MDFA 4U6PA 4B3RJ 4ECTA 1H72C 4M5IA 4KKOB 5HROB 2ZJQQ 3PV8A 1X5SA 1R6YA 2JZ5A 4NCGA 3B78A 3GG0A 3A1YG 2IVFB 3CCLS 1RUSA 1JLEA 2O01C 2QTWA 4PZVA 4I68A 2FGCA 3IXQA 1T8EA 5D4LA 4DR7J 3KHHA 3F44A 1QAYA 4P2FA 2RAQA 4YB1P 4F4KA 1YG0A 4C0BA 3PIOQ 3GV5B 3CULA 4Y2MA 3TJ9A 1FRIA 1XNQJ 3C16B 4J5OA 4Q43A 2ZH3A 2KFYA 3UR3C 2ZKUA 3AXKA 3CJTA 4IG3B 2AU0A 3PYFA 4LBHA 1KLMA 3I0SB 4I64A 4O4RA 3V4MA 3MMJA 3HT3A 3T1YF 1KONA 2WSCC 4DSKA 2OSQA 2NSCA 4DCPB 4B9TA 4F02A 2F5GA 1O51A 5K5MA 3U1NA 2WRMA 3HKWA 1FRKA 5AJ3F 3RBEA 3CCVS 2YPYA 4F4ZA 4DLGA 2HK3A 2GW8A 3MAAB 3JYTA 5HP1A 1U49A 3HD1A 2YH0A 1YIJS 4DV3J 2AJQA 1U1MA 2DGVA 4ZVUB 3M32A 4DL6A 4X2BA 3N01A 4JP8A 1IKYA 3MEDA 2C2EA 1K0TA 2V34A 3SEOA 2BANA 1IR0A 2VC1A 5C2CA 3MM9A 4J9OA 1IBMF 1D9AA 2IA0A 4FP9A 1X8DA 3KKFA 4M5GA 5K14A 2DD8S 3GSDA 2OKQA 3PFEA 4ZN1A 1PJ7A 3H5SA 4ZITA 2LMIA 3ZZUA 3G96A 3QBCA 4DZ6A 5L1JA 1EZZB 3GFXA 1M5KC 1EIYB 3ETMA 1PAEX 3GFYA 3MOZA 1S7IA 2ATCB 4YR3A 1KC8T 2LQBA 2DGSA 3L9ZA 4DXLA 1U1NA 5GAGI 4LJMA 4DJBA 4DN0A 4DUYF 3BGRA 1EARA 4QIEA 3BSOA 3DHWC 5FIIA 3M1VB 1S9FA 3CNQP 3J7YU 1B99A 3OHAA 3IBWA 4J7CA 1VR6A 3AOAA 1PGZA 2FJVA 1TUVA 1WI6A 5A0YA 3SDEB 1B0TA 2WHOA 3H0PA 4LIWA 1PJ5A 1ZAVA 3EZOA 4ZCMA 3RW7A 4RZRA 2CDQA 1OPZA 3G6ES 1RHKB 1YJNS 1D0EA 4ELUA 2NR0A 4IOAQ 1GAOA 1ZZFA 3ONQA 2W9CB 1Z2LA 3JTOA 1HNXJ 1UZHA 3GG1A 3G4SS 1M1KT 2KZZA 1A6LA 3PW5A 1FA0A 4RBTA 3HHNB 2Q79A 3MMCB 2V0NA 5C7PA 5KOWA 4QWEA 1IKYB 1NXIA 2GHVC 3FRZA 3HSDA 1OSCA 3BJYA 3UN2A 1FRLA 4QBUA 3ZZZA 4UTGA 3BSNA 1SL0A 1VQ5S 2B4UA 4JOUA 5LMNJ 4F0HA 3K57A 2HHHF 4O0IA 2XWXA 5J2MB 4ED8A 1YJTA 1RXOB 1O8BA 3BS9A 2Y9HA 5KOXA 4P2MA 3C6TA 2MQQA 4OX9J 2BJDA 4RW6A 3MUMP 5A8KB 2QL7B 3M05A 3VWSA 1WG1A 2HIQA 4A8XA 1ZPWX 4YR2A 4BS2A 1DURA 4WWSA 3LPYA 3HFZB 3R5AA 5DGAA 2H4WB 4O3OA 1ZM3A 3ADAC 4Y0FA 1VFJA 2XQCA 4F4AA 4EBEA 5IQ6A 3M1VA 4FKYA 1YGYA 2QLFB 1VS3A 4USUA 1VBXA 1VMBA 2E1MC 1FERA 5C25A 5HN0A 2J8SA 3EXCX 4L73A 4NRTA 4GO7X 1L3UA 1NSPA 3SDEA 2E66A 3DU6A 1RE1B 3RG6A 1S77D 2FB0A 1KHVA 2EXUA 2J9DE 4EUVA 2QSWA 3VAKA 4JV2A 2K06A 2C22A 1H38A 4OLPA 1RAIB 2XS2A 3MCOA 4ANCA 5HP1B 1X4EA 4ZHRB 3BBFA 4R8UB 1MMLA 2JEFA 3IAS9 5KG7A 4OMFG 4B02A 5J1PA 2EFGA 2HS3A 3DRPA 3IBFB 3M8PB 3M8YA 4UOGA 9RUBA 4FYDA 4D3GA 4IKAA 5HAOA 3EX7B 1Q0NA 4DV1F 2EWHA 1F0XA 2B51A 2ZH8A 4DF4A 1JLAB 2R2SA 2LQJA 4ZVTB 3DLHA 2AJ4A 1Q86T 2FVPA 3FZBA 1EP4B 3KUGA 1WORA 3CCMS 3W64A 3QJLA 3UDLA 1CPZA 5DRKA 5A76A 3MR2A 3G71S 1JXLA 5DG9A 4JI8J 1U6FA 2UV8G 2B7CB 1RTZA 4FPIA 5ETLA 3IBCB 2F7VA 4RNHA 2F9DA 3VF0B 3L3CA 4K4XA 2KZMA 5H9FK 1GEHA 1F5CA 1WJ9A 2LP4A 3D6HB 3FSXA 3Q8PB 1WHXA 2GMLA 2UV8A 4CLKA 1HI8A 1X0PA 2MHNA 2V69A 3AB2B 3GCXP 3DXBA 4DSEA 4YFUA 4OX7A 3T1YJ 6FD1A 3GIMA 4EYHB 4JI5F 4JI2J 2XMAA 1UW9A 2RU9A 3BQ1A 1WSVA 4NA2A 2RD5C 1KP6A 2V63A 1WACA 2VICA 4J9SA 5DG7A 4DR6F 5F3ZA 3BKFA 2XB2D 1R8PA 1IKVB 5LOQA 3RTVA 2F40A 2VBXA 2Z30B 3MD3A 3TW0A 4RNNA 2YNIA 4F25A 4ZHRA 2GVZA 3VCDA 4F0KA 4R8UA 4H4KA 2DPJA 1PILA 5G0RA 4AUKA 2DXFA 3N6MA 3M8PA 1PG5B 5DGBA 1UMJA 1TKTA 3IWXA 1C1CA 1DLOB 3GJTB 7AT1B 4AL6A 2HQIA 4PCQA 2J0SD 1U47A 4QPXA 1NPKA 1WC6A 5DS7A 5THWA 1DZ5A 3R27A 3AQPA 1F60B 2IVMA 3QLHB 3QFHA 3TP2A 1URNA 2ZJRQ 3S7RA 1CJTA 2HNYA 1S9EB 4EI2A 4DSIA 4OYPA 1I6JA 1S79A 1H7WA 3QZ8A 2HBZB 1UPPA 2AJ0A 2CJAA 2QMXA 4RU9A 2I5JB 3R2DJ 2IM2A 1MROA 2LKZA 5L1IA 4DV2J 2RMLA 2XC9A 3HVWA 4NZ7A 2HFZA 5AE3A 4DF8A 3OFHA 3Q2SC 2EC0A 1QVGR 3H42A 2KHCA 1RT3A 4PPDA 1NHKL 4OI1A 4LF5J 4PYDA 2MKKA 1N52B 2KHDA 2C3OA 2J7KA 3K8WA 4DPOA 2NXJA 3IS9B 1RHUB 3IRWP 3T1HF 2BKOA 3NWRA 3I87A 4Z7YA 5I3PA 3W5YA 3EGNA 2D9PA 2XO7A 2M88A 4O3NA 3HFKA 2D3OR 3QSYB 3KJNB 3A8IA 5D4PA 4W98A 1T3NA 4URGA 3CMES 3KJFB 1JNRB 2YNIB 3TQ1A 4DCOB 2GVZB 4F67A 4CYUA 1UWBA 1JQGA 4PQUB 3W62A 4GKJJ 4X4RA 3GFHA 4WP3A 4EBCA 3ITHA 4PAAA 4U96A 3H40A 3H5XA 1C1CB 1WF2A 1OJ4A 1RAFB 3DLLQ 1HIYA 1LQ9A 4URSA 2C2MB 4YQWA 4I56A 4B9UA 2ILYA 1A0OB 1QM9A 2WVBA 5DM7Q 2I38A 5KFRA 3SYZA 3Q8QB 3QIPB 3EGZA 2WAQD 2XY6A 4WFAQ 2RQKA 3OBIA 4TQSA 2FYXA 1S97A 2M52A 1GXUA 2B9EA 4WFBQ 3CCUS 4WK3A 2XULA 1MROB 1RHQB 4MYTA 2DKOB 5LT5A 4A48A 1KVIA 3V6JA 3UDVA 1VHFA 2AP6A 4NE9C 4CCHA 3GQCA 2F8MA 2D3UA 3FRYA 3FSIA 1N0UA 1SB6A 3OD2A 2C3MA 3KK1B 3PW7A 4DPYA 3I0RB 3AXMA 4DR1F 4DL4A 2H9ZA 3TO8A 3UDCA 5L38A 3JAMY 2E7WA 3CO9A 4ZVGA 1BGXT 2V8PA 1R7IA 5LSOA 2YWEA 1LV5A 4B3MJ 1GXLA 3QT5A 4NA1A 2QLJB 2RDDA 4YB5A 5K8MA 1R43A 3VALA 1JJCB 2WZ1A 4MKBA 3KK3B 4JI3F 2VFVA 4LVNP 1BC6A 3W60A 3HVTB 2ROPA 5E3QA 1S5ZA 4WP9A 4AE5A 4CYUB 3TUIC 3MM8B 1VC6A 4LFAF 1QVFR 3WC2A 1NCLA 4MIWA 4PQUA 3DLGA 3OUYB 1TAUA 3ITHB 3GE9A 1MSWD 3TX8A 2UUWA 1AUSL 4KYZA 2KRRA 4W4MA 3O6QA 5EHHA 2ZM6J 2QA4S 4CM0A 1U8SA 3W1YC 2HSEB 4I4BA 1GT8A 2AEFA 3KWMA 1B3TA 2HQFA 1KVKA 3QIPA 3ET6A 2MEWA 5LXRA 4P74A 4K4UA 5E3AA 1OPIA 3VAIA 2VPZB 3CC2S 4FN5A 1S10A 2V4JB 3UDEA 3BN4A 1M5VC 3TZWA 5IWAJ 2QSFA 1Q16B 4LBPA 5ITHA 3MURP 4FF4A 3JXOA 3CUNA 1RBOB 1YTYA 2VF3A 5GVQA 3KK1A 1KFSA 3G82B 4ZPWR 3HVRA 2QV6A 2BOPA 2CQGA 2CPDA 3I5BA 3QAEA 4K5SA 4EZ6A 3K58A 4C8LA 3BV8A 1DBDA 3ZTQA 1G7CB 1V9OA 4RW8A 1XBWA 2XYGB 3TRGA 4XPEA 1TL1A 2FHJD 5D77A 1GH8A 3KJVB 1FWPA 3LP0B 3E51A 3BH7B 5E7OB 4ZVSB 1YWXA 4FS1A 4NEZA 1WUUA 1VQPS 3HVTA 3NLCA 2IM0A 1H98A 1VQKS 3OVAA 3EPIA 3BF4A 3FEZA 3UVJB 3GIKA 1WNEA 2BR0A 3NAIA 5M2PA 3FZ2A 3WX4A 3FBEA 2VG6B 3OLBA 1NBEB 1SQGA 1K8AT 1NJWA 3K5PA 4HKQA 2BKPA 1G6BA 2YH1A 1ZOTA 5J1EB 2KT2A 3IP0A 5KFBA 1UP1A 1W7WA 3ET6B 3IM8A 3QPIA 1VK3A 2QLWA 5KG6A 1S4FA 3PHTA 1HHSA 2NYHA 4OHWA 4FNIA 2GQCA 1HD0A 2BQUA 2UXCJ 1GXTA 1HNVB 2FPHX 2I8EA 1WF0A 4MH8A 2HRTA 4UOHA 2BX6A 3UN5A 2HVDA 2CQIA 4IH5A 4X64F 1NK0A 3DLEA 4JI6F 2CQBA 1ULRA 1NDKA 2DEIA 1DAXA 2RRAA 2GA7A 1IM4A 1FNMA 4YHHF 5U47A 3VGUA 1WC4A 2F63A 1K9MT 4NLUA 4I6AA 1Z1ZA 4M5LA 4MFBA 1UJ5A 1DTQA 1NLKL 2PO4A 5D4NA 1K1QA 5T7LB 3NGUA 2GQQA 3LGNA 3E8OA 4FXWA 1KTVA 2GX8A 5B0CA 2YBVA 3DMJB 3E3XA 4DPXA 2ABYA 2X1GA 1D9DA 3RB6A 4U8YA 3Q22A 1DQ8A 1VRUB 2OPQB 1PC4A 1X5OA 3NAHA 1VGYA 4HHUA 4TNOA 3VGVA 1VQNS 4FYYB 2Y8WA 3VAJA 2R7OA 3GMGA 1RSCA 4LF8F 3F56A 4GKKJ 1FKPA 2FJDB 2B4VA 3T3FA 4O3RA 4OLOA 4WYWA 3QNWB 2DR6A 3MR3A 4NX9A 1WD6A 4AXIA 3QFWA 4K50A 1HBUA 3UW1A 2DGWA 3SCLE 4FPRA 3M2VB 2XO6A 1WEZA 2NUHA 4WXOA 3SSRA 4CRJA 2XMVA 5KFZA 3PO5A 3AHPA 4ES2A 4H4MA 5CYMB 3DLKB 3CCZA 3I56S 5KFAA 4B08A 4NASA 4DV4F 4JYAF 3BGOP 3D6TB 4B9NA 3RBZA 2KYZA 3KDNA 1RT7A 4K4YA 1X5PA 1YI2S 4B9VA 4ES3A 3RZAA 4HL9A 2HNZB 1WC5A 2HGLA 1PKUA 2MQ8A 1TELA 3GV8B 2R4FA 1XR7A 4AFFA 3R1HA 3CJRA 5KFGA 3MFHA 3IG1A 4DV0F 2W2MP 4A8OA 3D68A 5DDQC 1KNZA 3MUVP 4WJBA 3TEHB 4WYLA 4CH0S 1F9FA 5B0GA 1R6VA 4CH7A 1R0AA 1DTQB 2MKCA 1GQEA 4LRAA 2FD2A 2AD9A 1IQZA 5T7LA 4K0KJ 3PJWA 2VFTA 5CA5A 1NKEA 2XSJA 4ECXA 3HZGA 3OFFA 4DV2F 3DMJA 4MMOA 3LP2A 1TQLA 2ILZA 4LIRA 4USKA 5EX3A 4LSNA 2OPQA 3I5AA 4DU7A 1Y0HA 1W2BR 3X3UA 1UPMB 2XMUA 2UP1A 1NSQA 4F3QA 3N6NA 3PX4A 3GJRB 1N6QB 3BSCA 2DISA 4LR9A 4DR5J 1RBLA 2ATLA 4RW7A 4A8YA 3TNVA 3N5BA 2LECA 3DRRA 3K5OA 1S1UB 1QY7A 1RT2A 2AEMA 2ZUGA 4B9LA 3LOUA 4OZ3A 1QE1A 3D1QA 1XTZA 4QWBA 3T1AA 4C9DA 3QAUA 3TVYA 1RWOB 3ELHA 3O3LA 4PXBA 4K4TA 4DL3A 4PUOB 2HW3A 2GIRA 2WB4A 3DLKA 3RW6A 2AJFE 3LA0A 1F3FA 1WHWA 3PG9A 4QOTA 1QSYA 1RAGB 1HWKA 2J76E 1R8CA 1VQ6S 1FT8A 2FY8A 2ZC4A 2IRUA 4I1TA 1XMOF 2DNPA 2YWFA 2IAJB 1C1BB 1U09A 1S6OA 3DOLB 3MF5A 3QT7A 1RT6B 3W5ZA 2R8IA 3SV4A 3RBDA 4DL7A 3IG1B 4P72A 1SH2A 4DPWA 1D1UA 1UETA 1Y7PA 2D9OA 2Y3YA 3CJ2A 3F0NA 4ED5A 1SXLA 4E8UA 3GONA 1IM6A 2E1PA 2RRNA 2CPHA 2GVDA 1R0AB 4C8ZA 2DY1A 1KR4A 5C24B 2XCPA 2CXEA 2XSJB 3NL0A 3D4JA 3PW2A 1TK5A 2CG4A 1HPZA 1FESA 3MEGA 4JI8F 1H3DA 2DB1A 3AJ2A 4PPZA 4Y3CA 4C7QA 1CJKA 4RNMA 3NWGA 4LSNB 2UXDJ 3H59A 1JK9B 2GHPA 2ZZNA 3MTKA 1QTMA 4DR4F 2G2OA 2R8HA 2N7YA 4ILMA 3U1MA 3CMAS 1QAXA 1MWZA 4OZJA 4ZCLA 4ELTA 2BE2A 1XR5A 2COLA 1MLAA 4PG5A 4C11A 5HQMA 4LF7F 4DSJA 4UZCA 2B7BB 3DRRB 4NLQA 3SCIE 3L7PA 3U02A 1RT2B 1SIZA 1T9XA 2GHWA 5KFJA 4X4UA 4OI0A 3LH2S 5F0WA 4JUZA 5BYRA 5BR8F 2AGOA 3CT9A 1NJXA 4LFCJ 1FXDA 4LBIA 3PY8A 3ZZYA 3UWTA 4P52A 4PUOA 2J6UA 4O23A 2PFFB 4H4OB 2Y1IA 2EFNA 3WC0A 1ZA1B 2RS8A 3IA0A 4LF1A 2PMZD 1N33F 1VISA 1CBKA 1JKHB 1NDLA 5ETVA 3PKYA 3PIPQ 1RT6A 1T9WA 3FBBA 1RHMB 4NLTA 4AQYF 3GTYX 3GIRA 1PBUA 1RCOB 4FS2A 4G6VB 2OGUA 4JV0A 4ED1A 2OLWA 2GVDB 2XS7A 1JJ2R 2W8LA 2W2PP 3LW5C 4RL1A 1S6PB 1APSA 3OL8A 3HJVA 4QPTA 3ZTSA 2EK6A 4LR8A 1HPZB 2JJ4D 4FKXA 4QYZK 3KLGB 5DJBA 1CJKB 1LW2A 1SH0A 2BXJA 3EDRB 5E2QA 1U6BA 1F9EB 1MWYA 1WHYA 2W4PA 2B5JB 2IRXA 4HACA 4WTOB 3OW2R 1XN9A 2BEFA 2PEHA 1SBRA 2V4QA 1SUQB 4O3PA 3KLHA 3R5JB 2BE2B 4CLWA 1HI1A 5F3TA 2JLGA 4KRWA 1IWAA 4XDDA 2ZBRA 4K4VA 4ITSA 3TYTA 4WIIA 3F41A 3UCGA 2HVIA 3CVKA 4MK7A 4J37A 2K1RB 4HVZA 2UUBJ 2A2DA 5DDRC 2DNKA 5DQHA 4KSEB 2WOMA 4KE5A 1FF2A 2PT0A 3TUJC 4X62J 3G6XA 1NK6A 3U27A 3OSPA 4M1KA 4DV0J 1NK9A 1FXRA 1TKXB 2ACYA 4DUZF 4UF4A 4U95A 4NXMJ 2DNQA 1JLQA 1Y11A 3A3OB 4C0OC 1U1LA 2NYIA 2WONB 3NNAA 1GFWB 3DOMA 2NUUG 2VKRA 3CJ4A 5EWGA 5HL7Q 4X4NA 3Q8SB 3ENWA 1UVJA 2EK1A 4GVBB 2SXLA 1VQ4S 3ILIA 4X66J 3PDNA 3DC2A 2POKA 4HDHA 1YJ7A 3P4UB 1T9VA 1NSAA 2DH7A 2MQPA 1VLOA 4KAIA 4G1QA 1WTBA 2IYGA 3BYRA 2JLFA 4USVA 1RAJA 2OJ3A 1ICEB 2AX1A 2ZDOA 2RH3A 4HTIA 2ZH1A 2IDLA 4P7VA 1LW2B 3QT6A 1QAIA 4OHYA 1LFPA 1GMUA 2B5JA 3GJSB 1BQXA 4NWBA 1HD1A 2HZCA 2RHSB 4EO8A 2RDJA 1SUQA 2LCWA 3ISZA 3FKBA 4AL7A 1YQHA 1N5QA 2H5IB 3HFVA 4LRBA 5D4OA 1T94A 2DGTA 3OHBA 2DR5A 2RKIA 2QGFB 3MAHA 5HVGA 1AROP 5I4MA 2NXNA 1NK4A 2V8HA 1AFJA 3LAMA 1RCXB 1RWMB 1S1TB 5DQGA 1IKWA 2JC0A 2K1RA 4Y2KA 3HK2A 3D0IE 4LVOP 1N36J 1HNZF 2MKYA 2MY8A 2FZKB 2QYCA 3ZO7A 2UVUA 5EN1A 3E01B 2F9JA 2AJ2A 2DXEA 1UAWA 2NS1B 1HW8A 1TKXA 3FVYA 3M7VA 4LRCA 2CZ9A 4P71A 3T5KA 3WHIA 1BE4A 1F9HA 1RI7A 3O5TB 3SIPB 5L39A 2CQDA 1RLCL 1NB2A 1OMSA 2DGXA 3DOMB 1YBUA 2IJNA 1FJEB 2IC3B 4C8OA 1RACB 1X4CA 4NLVA 4RBUA 4DI6A 5B7WA 2W9BA 1J5EF 4ZLLA 1U1KA 3HXMA 1K47A 3KTQA 2HS0A 2XMWA 3O1LA 3BSAA 2XGQA 4LF4F 3O8WA 1ZAWA 3NXZA 4PWWA 4E98A 2XZDB 3V2UC 1G4CA 1IKXA 2CZ4A 1OY8A 2NXCA 2MQOA 3V6DA 3OVBA 3G8SA 4DV4J 1TVRB 2DNZA 2C2RA 2YY3A 3CC4S 4IDKB 4DLEA 1KSPA 3ETOA 3TQEA 1QSLA 1RTJA 2ROEA 2KTQA 1CULA 4HTJA 3S8SA 1ZA2B 2CWKA 1IJFB 2ZZTA 3D28A 1JIHA 2NZCA 3R5CA 1KFDA 4P7TA 4V1Ak 3NG8A 4KV8A 3SCKE 2RKIB 3GJQB 1MW7A 1Q95G 5IM0A 1S0OA 1YX2A 4I2QB 1R3NA 2B6AA 4IG0B 2FZGB 4LF8J 4GKKF 1IKWB 2UUTA 5DDOC 5CH7B 4ECSA 3W9HA 3JTNA 2YNFA 1ZETA 1IUJA 4TYBA 2HS4A 5KFVA 1S0NA 4BC7A 4UOFA 3E01A 4J9LA 4HI1A 5KFXA 3CCTA 2DH9A 4OYAA 1WDTA 4ALZA 3CJ3A 3QGGA 1WC0A 2R7TA 3KLVA 5EGYA 3DXSX 3N28A 1J2VA 3LPEA 4ILRA 1TV6A 3NOCA 4V19J 2IC3A 1YDLA 2H5EA 2ZUAA 3PRVA 1T95A 2KT5A 4KGKA 2ZBIA 3FFIB 2IA6A 1U7LA 5A8RB 3EICA 1CS4A 5I42A 3HMJG 4OZ5A 2ZH6A 2FHMA 3BEGB 1EQ0A 4F3OA 4ZLPA 4OJHA 5KG1A 4RWXA 1IKXB 3VVTA 1CQNA 2O5DA 2U1AA 3I4PA 4ANEA 3V6DB 1BQMA 4K2XA 5J2NB 2AJ1A 2ASYA 2YKPA 4IDKA 5F8IA 4WF9Q 2ADCA 1URRA 2GGPA 2QN6B 4P73A 1T11A 1TKZB 4LR7A 2BJ1A 1ITPA 3HHEA 3HT0A 1UVIA 1VRTB 1D3WA 3SXLA 5KT5A 1L3SA 3FGVA 1M5OC 3D67A 2NQPA 2FJAB 3FK4A 2CQHA 3MM6B 3JAMU 3HPOA 1IBLF 3R3TA 2OD6A
chains in the Genus database with same CATH topology
4IG0A 2EPIA 4CO0A 1KEKA 3QJJA 5C42B 4L6V3 2D3ZA 3PM9A 4X84A 1P9QC 1YRTA 5FD1A 3KG0A 4ZP8A 4DL0C 3EYZA 2M9KA 1O0PA 2BVZA 2GMHA 4N47A 4RUHA 1HNIA 2CQ0A 2XGPA 4QYRA 5KFWA 2YX7A 3H5UA 3RAXA 4OHVA 1N48A 2DIVA 2OMLA 5J2PA 1TV6B 2JH3A 4DG1A 4I7FA 4N77A 4XO0A 3RRHA 1T7PA 4NCAA 4H4KC 4WFYA 5A8WA 2BBEA 4BCAA 3J7YI 2G0CA 4U9RA 3QO9B 4DOZA 1H2VZ 5B09A 2DPJA 3FJ2A 3JTPA 5K9FA 2MZJA 3OXLA 2NZ4A 3IWLA 3S1TA 2MQMA 6FDRA 4IRKA 1N32F 1Q8IA 2KU7A 1WF1A 3HKZD 5DG8A 2GGPB 1TFWA 4X4SA 4UUWA 2HHQA 3RU0A 2LEPA 1VRTA 2DR5A 3AY0A 2CVIA 3CD7A 5J1NA 2R7TA 1YITS 3CCQS 4OZ1A 2XMJA 4WE1B 3D2WA 1UVMA 3WDOA 2D7SA 3MM6A 3EZUA 2OPPB 4DN9A 1SH3A 3B82A 5C42A 4ECQA 4DQSA 1NKBA 3MZIA 5DDPC 4IH6A 2NREA 2QEXS 5LXYA 2FVCA 2OPRA 4LSLA 3D0HE 4H54A 4ES1A 4JI7F 4F50A 2HMIA 2HWIA 1NK8A 4B3OA 2OO4A 3EXYA 2Q6BA 1T05B 3AA9A 4ID5B 3KNAA 2ZH5A 2IYIA 5CQGA 1OWXA 4RW9A 5DETA 1D9FA 5D8HB 1UFWA 2EBEA 3CSKA 2HG4A 4I6YA 4NL5A 1U1RA 1ZPVA 5A8WB 3MR5A 5B0FA 1RGVA 1RTIA 2QIFA 3KG4A 2WK4A 4JI0F 1FCAA 4TU7A 2OP5A 2NPFA 4BHQA 1HWIA 3S6EA 2L9DA 1FNXH 3N0VA 3W2WB 2QA2A 2W24A 2A1BA 1GNKA 3ZFVA 1YSJA 1B64A 3IO1A 3M2RB 4HH1A 1SKWA 3M6UA 4ZK7M 1M5SA 4AYBD 2M2BA 4DDFA 5DLGA 3OL9A 2ZKTA 2M3DA 5IQQA 4TY8A 1KRPA 5EWEA 4PWDB 3PRDA 4KC5A 4DV6F 3VZIA 4YEAA 4YDDB 2OAUA 3J7Z5 2Q1LA 3MUTP 1HBNA 3CJ0A 5E0OA 2CQ4A 2OPPA 2EG1A 2V8GA 4DQRA 1CEZA 2OPRB 5KTQA 1KD1T 4B3OB 1EETA 4X66F 4IOCQ 1O5JA 3B4MA 3W2VA 5IFMA 2XCAA 3Q23A 2ZD1B 3M8RA 3TARA 1ELOA 3U1LA 5IT4A 1UJ6A 4CT8A 3OV7A 1I94F 3GIIA 3QGHA 2WBRA 2B9XA 1FDNA 3IC1A 4BBYA 1WELA 1U6ZA 4WK1A 2RILA 1ZTTA 2CPXA 2MGZA 3M2RA 2R7WA 3BGLA 1FD8A 2DNNA 4PWUA 1Q79A 2HWTA 1VBYA 3OR2A 4PR6A 4IRCA 3SSSA 5F8LA 1FJ7A 4KB7A 1U45A 2RJZA 4LF6F 3M2UA 3R5DA 4PWDA 1KLMB 1H7XA 2Q66A 1NO8A 1Y5NB 4ETXA 2EKYA 2ZHBA 3KOAA 1P8GA 5JUMA 1S0MA 4F2RA 3C46A 5LJ5Y 2EG2A 1SKRA 1JB0C 2RU3A 7FDRA 2AQ4A 4A8FA 3M32B 3O2IA 3NS5A 3W2VB 1FJCA 2R7VA 5F8NA 4UY8T 4ECUA 4YP3A 5HBMA 2E1AA 2YWKA 3GYXB 3SZ2A 4KPYA 4JI2F 1U1OA 3VAHA 1V3RA 3AAWB 3DRXA 1YJUA 2JHEA 3CDWA 3QWPA 5K14B 1N34F 3T5HA 1TP7A 4ED0A 1Q53A 4B9MA 2M70A 4NPOA 4Y00A 2YKQA 3CDAA 1ROFA 3P96A 1VJWA 2BACA 1UVKA 3NBPB 4ID8A 2NPIA 2YWGA 3H8YA 2MGZB 3V81A 4DEZA 1BQNA 3OR2B 2XSFA 5DQIA 2F8EX 2VBZA 1LKZA 3D1HA 4N41A 3M2UB 2W25A 4Q8FA 4CNYA 1PO6A 3KK2B 2KDOA 2O1PA 1U1QA 5A0YB 2W4DA 1G3OA 1HBMA 2BV3A 4QIGA 1B0VA 4HEA9 2CQ2A 4EO6A 3K5LA 4B3SF 4KO0B 2J0XA 5E41A 1SJFA 3UCZP 2W9CA 1J5OA 3CCWA 3GWCA 2J7WA 2VL1A 1ZM2A 3P3DA 5AXKA 2KT3A 4RW4A 3MMCA 4ZPDA 4TU9A 1DRZA 1TL3A 3U7JA 5FJ4A 1I1GA 3NMAA 5L1KA 3BGFA 3I4HX 4QYZJ 5J2MA 3GR1A 4F4WA 3G6VA 1NHUA 1YRXA 1LW0A 4KT0C 5CZXA 4EU0A 4RW6B 1UL3A 2VQEF 2DRAA 2V94A 2ASJA 2CPEA 1S1VA 4XIUA 3V81B 1Z4UA 1WG4A 2XMTA 5F8GA 4NRUA 4DHVA 2IM1A 4NCBA 2K7JA 4JI4F 2ZM6F 2XMKA 2OIHA 4LF9F 2ERRA 1G2EA 4KHMA 5C25B 4DL2A 1RKJA 1WHVA 3F73A 3MMAA 2QFJA 1HBMB 3OTCA 3US5A 4Q44A 3DHXA 4U7UK 4NXMF 2N4DA 2MKJA 3RYLA 3FDSA 3GILA 4K0KF 2RNEA 1JLBA 2J0QD 1DJ0A 4FXDA 4RW4B 3ZZOA 1HARA 3DRPB 3NMRA 2AYGA 1TL3B 5G4DA 2DJWA 1SJQA 3I31A 2NLWA 3K2YA 4ECWA 2UVRA 1ZH5A 3E2EA 1K0VA 5H9FJ 3ZZTA 4DR7F 4ZVHA 3Q2TC 1EP4A 5FDLA 4ZVFA 3LWMA 2AV5A 2LLZA 5GAGU 3OL6A 1FRHA 1VQYA 4OZLA 4R0JA 4FBTA 4O44A 4DFPA 1VQLS 2ZNZA 2ZH2A 4CO4A 1S0VA 1L5UA 3DOKA 4A8KA 3AQOA 4J9NA 4DWIA 2JL9A 2R8GA 4P6QA 3ZZPA 1TAQA 3PXGa 1Z2ZA 1L3VA 3ZZRA 2FLNA 5F9LA 5KFQA 1HMVA 2VG5B 1FKAF 1WEYA 4IRDA 3H2VE 4FF2A 1DQAA 4I0WA 2R8JA 1U24A 2DNMA 3M30B 5HI7A 4DV3F 2DK2A 1JLBB 1UEVA 1MU2B 1SI9A 2UXBF 3MMBB 2FVRA 1SL1A 1TR0A 4YY3F 1X4DA 1DLOA 4G3IA 2BW2A 3EPGA 1SJ3P 1N56A 5D3GA 5IT9Y 1YHQS 2BABA 3QLHA 2UUBF 5K8OA 4NLSA 2Q43A 1Q7YT 4MYUA 2VPXB 3PX0A 3H4DA 5E3CA 2J7UA 1B7FA 4Y2AA 4M8LA 1GX5A 5SUHA 3NKYA 2BRLA 4CO5A 3J81Y 3DNCA 1M90T 2UU9F 3DOKB 2JEGA 2J5AA 2I9SA 3MEKA 4HHJA 1VOMA 3PX6A 1RT3B 3ZZ0A 2ADBA 2BZ2A 4FZVA 1C2PA 2MKIA 2GJ2A 2QZ8A 2PN6A 3TUZC 2DCLA 4N8NA 3AH6A 3VTIA 4RKUC 2E9ZA 2PDAA 4FBUA 2DHXA 1CLFA 2JFDA 2VC0A 1YRUA 2RVJA 1P1LA 2DNGA 3MEEB 4WTYA 4G1IA 5B0DA 1A9NB 3OTOF 2FY1A 1V3SA 2KO1A 4LT6A 1UWBB 3MMBA 3T9ZA 5SZTA 2R7UA 5KT3A 4NLPA 2AYMA 2BUNA 3CDEA 3HI9A 2DO4A 2CPIA 2MSSA 4PXEA 2GNKA 3UE2A 3TAPA 4DSKA 2QE5A 3IGVA 1LK7A 5D3GB 4F4XA 1S1WB 2J8AA 3CJ5A 1AXQA 4X65F 2JSXA 2JEIA 1CG2A 3TA0A 1Q1KA 4I2PA 2LQ9A 1C0TB 4K5RA 4GKJF 3HX9A 1L3TA 1QSSA 2LDIA 2G13A 2FJEB 2LXIA 3B4DA 3GB0A 4ZCKA 2E9TA 2RF2B 3I0RA 1LWFB 5KFDA 3C3LA 2LEAA 4Y2CA 1R8HA 4BWJA 4ZCIA 2V2KA 5E33A 4OX6A 3M4XA 3KK3A 4DR3F 1RP5A 2MJNA 5F8MA 3DGPA 2AYEA 2XZWA 3UNGC 5CXTA 1MNEA 3EUNA 2DITA 1N88A 1YJWS 3V6KA 5HMXA 1X9MA 2DPIA 1HQUB 3CE8A 4I69A 2MKHA 4USJC 4BWMA 3H98A 2HHSA 1WG5A 3TVZA 2OSRA 1CC7A 5JJBA 1C0TA 2I0XA 2V4JA 4PG8A 2HLUA 1LWCB 4OX9F 2APOA 3I32A 3TAMA 3IFEA 2DCUB 2DNRA 4OZ0A 3M8SA 5HMZA 2UVVA 3KMSA 2OTLS 1GX6A 1RDRA 2Q6CA 2RE1A 3HHDA 1D8YA 1XR6A 2FJWA 2OPSA 4A8SA 1LWFA 3THVA 2HHPA 2QRRA 3CWJA 3C8YA 3MI7X 4MJKA 2MHEA 4F4YA 3CCES 1JLGB 1TL1B 2BQRA 2DNYA 3FMWA 4RNOA 2A3JA 2J9CA 3KJVA 3QZ7A 4KHPF 2VASA 1BWEA 2K8GA 2ZZMA 2DH8A 2N3LA 1VC0A 4ZS6A 3N4WA 2FC9A 3BM7A 4NLGA 1AW0A 1ZZNA 1TL5A 2X51A 1JX4A 4OZNA 4R5PA 5J1EA 1HQUA 1GTEA 2Y1JA 2LXUA 3L7OA 1IN0A 4QIWD 4KIAA 1HBOB 2B0GA 4TXSA 5JVGQ 1KQGB 3CC7S 2W7AA 1RJJA 1Q78A 1LWCA 1HNVA 2GV1A 3NRBA 1YJRA 2L9NA 2EVZA 4USHA 3TAMB 2G4BA 2PA3A 5IXUA 4DR2F 4LQ3A 1IJEB 3TOQA 4NA3A 5E3PA 1TFYA 4EFAC 4ED6A 1HWUA 4IFVB 5KG2A 2OPSB 4GC6A 3IRXA 3DDKA 3G6YA 1CSJA 3CPWR 4QJVA 2FVQA 2AGQA 4MFBB 4UOCA 5KFSA 3D5MA 3SFGA 1VQOS 4PXCA 3OXFA 2IMOA 2PA8D 2HHXA 3K5NA 1VBZA 2IJFA 3T6JA 1C4CA 2A18A 1FKOB 2DRBA 2FJBB 1XK8A 2BM1A 1VRUA 3JSYA 3MAQA 2E5HA 2MDAA 3QYYA 2P6TA 2EFOA 5KFHA 1N5VA 5LSRA 3VR1A 2CIMA 2VFRA 3PR4A 3THPA 2MPUA 5A2QY 3EZ5A 1TKDA 4K59A 3RAQA 4ZDNA 1HNWF 2VZ9A 4OI3A 4KTQA 1X4BA 3HHLB 2ASDA 5AE2A 3M6WA 3N6LA 1L3KA 1HBOA 3NCRA 2L41A 1RTDA 2IM3A 1FDBA 2C3PA 5H9EJ 2B3TB 4V19X 1RT7B 4N56A 3JSRA 5ADZA 1RT4B 2HNZA 4KKOA 4OQJA 1KQKA 5HROA 1RT1A 4NCGB 4Y2IA 4U67Q 4IFVA 3P6YC 2XLJA 3IRXB 1UEUA 1W25A 1JLEB 4OI4A 3HLUA 4Z37A 2CJ9A 4A47A 2N4CA 5EDWA 4A4JA 2WW8A 3M6XA 4IYQA 3THTA 3LP2B 4Q7AA 3MD1A 4IG3A 4CTAA 3OSNA 3I0SA 3J80Y 2OFHX 2ZBCA 1Q8LA 1TK0A 3HJFA 2HHWA 2M8HA 4QZVB 1N6QA 3HF5A 4B17A 3PKMA 4ATNA 3LF0A 2P9EA 2JWNA 1S1UA 3JYTB 4E0DA 4NZ6A 5MLCV 1VQMS 3UD4P 7FD1A 1X5TA 3NCQA 4Q2LA 4CO1A 1F5AA 2HGMA 3K7RA 2VKZG 4AXJA 2P9CA 3MWBA 2EFVA 2BANB 2Q3PA 3CEDA 4RBVA 2KG1A 3SMZA 4ZPVR 2XEXA 1VC5A 4KBIA 3DN9A 1H6KX 1RT4A 5KFMA 4QW9A 1NJXA 1NH8A 3MM5A 1RT1B 2RQMA 3DOLA 4O3QA 1M0SA 3UCUP 5F41A 3GQCA 3CD6S 3W3SA 3ISND 2X1BA 4EYIB 5KFPA 1VQ9S 5KAKA 4B3MF 2LYVA 1VQ8S 2G1DA 2JFKA 3KHGA 5C24A 3BGRB 1OIAA 4OFZA 3CCRS 4LUBA 3MEGB 1FVSA 1FRXA 3GFZA 4CTAB 2LA6A 2VFSA 3NP5A 2WBMA 3OTBA 4NLXA 1WWHA 2R7QA 4IOBA 4M94A 5KG3A 3KFWX 4EBCA 2MXYA 1FE4A 2Z2MA 1JXEA 1PSDA 3MHYA 3QGIA 4UW2A 3SQGB 1FVQA 2DHSA 2HNDA 2HPUA 4QR0A 2CJBA 2KVIA 4H4OA 4ZPBA 1IXKA 2HHUA 1AFIA 2HRUA 4WKYA 1JLFB 3S01A 3MM5B 2VH7A 2ZFHA 3C6TB 2VB6A 4XAKA 3MXHP 3PZPA 3HHLD 4WU3A 1Y3JA 2WSFC 5A8KA 2YKOA 1AUDA 2HVHA 2K2PA 2MMYA 4OI6A 2L3MA 1F2GA 3MTJA 2F1FA 2Z8QA 5GAEU 3G8TA 1VIOA 3C2PA 4DSFA 1S6PA 2RQ4A 2MZQA 3BR9A 1Q81T 2FGOA 4IO9Q 1JNZB 2D1CA 1Y5IB 4DMZA 3KLGA 2YKMA 3H5YA 1S48A 1KQFB 4CNZA 1T02A 3OTDA 1FJGF 5C5JA 2KRBA 3JSBA 3CIMA 2JRSA 3KLHB 4MK9A 5L1LA 3K59A 4IQMA 1V3ZA 3TI0A 3H25A 1S1XB 5KFLA 3T6BA 2HFNA 4PXDA 1K73T 2J6SA 2W7PA 5GADI 4MK8A 1SKSA 2LEBA 2VPWB 3SQGA 4NYZA 1N54B 2HNDB 1WEXA 3P5TL 3QGPA 1FEHA 1SIWB 1SJ1A 2IHR1 1HWLA 3I9ZA 3VQSA 4ZMMA 2KM8C 2KFNA 4Y6IA 1JLAA 4Y34A 1JLQB 1JLFA 3SFUA 3HVAA 1HFEL 2Y1RI 1N8RT 1FK9B 3SSQA 5LJ3Y 3OVSA 3IR6B 5KT7A 4WU2A 3DCAA 2VPYB 3H2UB 3PEHA 3LAKA 2E1CA 4IR9A 1PC5A 3RR7A 1ZTWA 5IT0A 3DI6A 1ZYQA 1FO1A 1U2RA 1HI0P 1KS2A 1QLNA 2YKMB 5GAHU 1XNRF 3TA1A 5E5NA 1DTTB 5AXMA 5FLXY 1H2TZ 1GTHA 5D6GA 4ZKAA 1H2UX 3V6HA 3Q0AA 5LMNF 2IFXA 3CTRA 4K4WA 1QJHA 1S1XA 1IKVA 2AYBA 4KJIA 1M5HA 2UUAF 2FVSA 2M4MA 1S1TA 3I82A 1NHVA 4Q5VA 3TAQA 5G0RB 1JJ4A 2F4VF 2E1RA 4JI1F 1HNXF 1QUVA 1TKTB 4ZP6A 1KLNA 2DR9A 3PW4A 4BC9A 1X9WA 2GC8A 2YVSA