4KHPF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4khpF00
4JI1F 4YY3F 2E5LF 4JI0F 4X65F 4DV4F 4YHHF 1HR0F 4K0KF 4LFAF 4JI4F 4AQYF 1QJHA 4DV2F 1RISA 2UXCF 2UXBF 4DV3F 3T1HF 5LMNF 1N34F 1J5EF 4DV1F 4X62F 2VQEF 5IWAF 1XNQF 4DR3F 1N32F 4KHPF 1FJGF 4JI5F 4X66F 4JI6F 2RJZA 4LF6F 2KJWA 4DV6F 2ZM6F 4LF8F 4DR7F 4DR1F 2BVZA 5LMUF 1HNWF 4B3RF 4DV0F 4DV7F 4NXMF 2UUBF 1I94F 4JYAF 4LF9F 5BR8F 1XMQF 2HHHF 2YY3A 2UU9F 4LF5F 5AJ3F 1HNXF 4JI7F 4LFBF 2J5AA 1CQMA 1LOUA 4DUYF 1IBMF 2F4VF 3T1YF 1GH8A 2UUAF 4JI3F 1HNZF 4DR5F 2UUCF 4GKKF 4DR2F 4B3TF 3ZZPA 4JI2F 3OTOF 4JI8F 1IBKF 1F60B 1G7CB 2B7BB 1IJFB 1FKAF 4LFCF 1IJEB 4DUZF 4DR6F 1CQNA 4JV5F 3R3TA 1VMBA 1XMOF 2UXDF 4B3SF 1XNRF 4GKJF 4DV5F 1G1XA 4X64F 4DR4F 4LF4F 4OX9F 2KJVA 1N36F 1IBLF 4B3MF 4LF7F 2B7CB 4NXNF 1B64A 1N33F 2VQFF 2BXJA
chains in the Genus database with same CATH superfamily
5C2CA 2AEJA 4ELUA 2JRSA 5DDRC 1CC7A 4BBYA 3CCUS 2MGZB 2ZH8A 4CDIA 4LFAJ 4DF8A 1CJUB 4LSLB 5KFWA 1RTIA 2YQ3A 4ZPBA 2J0SD 2N4DA 4B9MA 1K1QA 2YKAA 5DM6Q 2M8HA 1RHRB 4NYPA 2Y0BB 1PBAA 2AJ2A 2XZWA 3NGSA 3R5BA 4RW7A 5D78A 4KV8B 4KT0C 2UU9F 3OPKA 3EUNA 3DHXA 1MROA 3H59A 1PC4A 4IFVB 2ZBQA 2JEIA 5E3CA 3CEDA 3KLFB 2E1AA 4Y2IA 4ZPTR 2VC0A 3SSQA 4WZQA 1UFKA 5KFAA 2YKOA 3W1YC 3NCRA 1U0HB 2R7TA 4LSNA 3LA0A 1IQZA 2KU7A 3PYFA 2MTLA 4HLBA 1RT6A 3MM8B 4H4KC 3HI9A 3LP1B 4YY3F 1ZM3A 3GIMA 4CH7A 4F04B 2W8KA 4KO0A 2AT1B 3BO2A 4Y2CA 1XERA 4V19X 2KT3A 2L08A 3OVSA 3G2XA 1LWEB 3I31A 3RBXA 2M8DB 4YR0A 5KFSA 1RT7B 4BWMA 2E5HA 3DRPB 3RBZA 1DY3A 1OYEA 3HHLD 1SQGA 1LQ9A 1RBOB 4PQUB 2W24A 1VQMS 4HTJA 1FKOA 3PVXA 1OQ6A 4M63A 5HJYA 4TU9A 2CPXA 3SXLA 6FD1A 2M0GB 5GAHU 1S99A 5L8RC 2VDHA 3D9BA 1IBMJ 3OTOF 2ZDOA 3B78A 2IAJB 4DS4A 4ID8A 2B7BB 4JI2J 4DR6F 1P9YA 1T05B 3PJWA 3SI8A 1PAUB 1Y10A 4RUCA 1JLCB 2AZ3A 2VDIA 1N36F 2XS7A 4Q44A 4DV5J 4WFNQ 2E5LF 3IO1A 4NA2A 2LMIA 3LTOA 2APOA 4P73A 1ZAVA 1N88A 4IO1A 4XIUA 4RR5A 2D3OR 3TUPA 2DK2A 4BLGA 5C25B 2QL7B 1DLOA 3ZTSA 1F2HA 4Y3CA 4OQJA 3CC7S 4XTTA 1SL0A 2QIFA 4IFYA 4LF6F 2KJWA 2MB0B 3IG1B 2DCUB 3LO3A 1IM6A 2KFNA 4PAAA 1SJQA 2BJ8A 2IVFB 2UUBJ 3TZWA 4P2SA 4W98A 5IV4A 5KOWA 1IUJA 2ADBA 3VALA 1VISA 4S0MA 3H4BA 3TA2A 4PWUA 2V2KA 1S1VB 4RNNA 2QRRA 4PKDB 1S76D 2F4VJ 3HKWA 1LNQA 4W92B 1NK7A 1F60B 1R8HA 2OGUA 5GAGI 2ILYA 2G0CA 4U95A 3MFHA 2LEAA 4FN5A 4WFXA 2F4FA 4IDKA 2V69A 2LLZA 1LXNA 1VC6A 2DO4A 1SKSA 2R8GA 2FJXA 4IG3A 2E5JA 1CS4B 1FD8A 3A8IA 3BYPA 4DMZA 3EXYA 3DRRA 4CTAB 2Q66A 2ASJA 1YBTA 1FHTA 2AJ0A 4E98A 1T3NA 3VCDA 5H9EJ 3EGNA 3OHBA 4A8XA 4J9MA 2ROEA 3I5AA 2NUHA 2KTQA 3DU5A 3GMGA 2DY9A 2PDAA 3QGGA 5GVQA 3L3CA 1MSWD 2HHQA 1A0OB 3QIDA 2RD5C 2EW9A 1L3SA 4DPYA 3M32B 4DUYF 1JLGA 4CH0S 3FSYA 4DQRA 4KH0B 3NWRA 3DLEA 1YHQS 4EEYA 3DRSB 1BQNB 4KBIA 2MQOA 3PXGa 3H40A 3TR5A 2V9WA 3ZZRA 3IBFB 5HAOA 2QTWA 2DEJA 1X4FA 3AJ2A 1L5UA 1AT1B 3J80U 3CXCR 4NLDA 3QGHA 2W1BA 2QMWA 3B82A 1RAHB 4OYBA 3CE8A 5IQ6A 2KT5A 3N6LA 2HNYA 1YBAA 2C2ZB 2DGSA 5E3RA 1ITPA 4WWSA 2XBPA 5CYJA 2B5JB 1FD2A 1TU0B 2LQBA 5A8WB 1FKPB 1JLAA 3W63A 2C3OA 4DN0A 1CC8A 2IFXA 1RT4A 1LWFA 4A8SA 1G6BA 5MLCV 3POTA 4O23A 5ETTA 4P6QA 3IR7B 1IR1A 1RTIB 4CNYA 1G7CB 2BANB 2HHUA 2C28A 2QZ8A 4LQ9A 1I6JA 4LRDA 3QT7A 4RW7B 2D41A 2ZVSA 4HHHA 2ZBCA 1TUGB 2I38A 3ILOA 1I51B 1MROB 3IMQJ 1IBCB 1T9UA 4NRTA 2FZKB 4ED3A 3O44A 3QIPB 1A9NB 2UXBJ 1WD6A 2HGLA 5K14B 3H4DA 3SCJE 4P52A 4WIQA 1Q86T 3LH2S 4LSNB 2X1BA 1FRKA 2PC6A 4L76A 1RT6B 1N5VA 1FO1A 4DR1J 1S0VA 3NWGA 4ZVHA 1H3DA 4OLPA 3TX0A 5HBMB 4J9PA 4UZCA 4M5LA 4OX6A 2LXFA 5HJXA 2MLXA 2I2YA 2EBGA 1RK8A 1O5JA 3D67A 1TMMA 5DRKA 1S4EA 8RUCA 2QA2A 1G1XA 2J9DE 1GEHA 3KLEB 1RLCL 2PT0A 3ZO7A 4BHQA 5DS7A 4M5KA 2F63A 2W2PP 5KFVA 2M7SA 5K9FA 1FKOB 1NK5A 3OJSA 5H9FK 5IT4A 1VQNS 3DLGB 3LWMA 5ETNA 4F4YA 2O5DA 1SJ4P 1AW0A 1UFLA 2QE5A 2F7VA 4CT8A 2GHWA 4JOUA 2YNHA 1JNRB 3I6PA 4RW4B 5FIIA 4KHPJ 2H4WB 2DR7A 2E1CA 3MECB 3KFWX 1F3VA 2ZD1B 4ED0A 4QWDA 2XI3A 1PCAA 2NXJA 1U7LA 2MMYA 4LF1A 2IBKA 2JLFA 4OIXA 5DM7Q 4H4MA 1IWGA 1C1BA 4P75A 4PWWA 1RTHB 3QRRA 3MUVP 1XIQA 4ERDA 3MXHP 3PRDA 1VDHA 4GKKJ 3DGPB 4IFYB 2EBEA 2BQRA 4KFBB 1GX6A 3JSMA 2WSCC 1FJEB 4CLKA 4WP3A 3KK2A 4A8MP 5FJ4A 1FWLA 3WQPA 2XLJA 4C48A 1UVJA 2LECA 2MJNA 2DITA 3N28A 2R8KA 5EUHA 4USTA 2G0IA 2LYVA 4KYZA 1M90T 3KHHA 2Y8WA 3BO4A 2V5HG 3OL6A 1S7IA 4ECSA 5HLFA 3K5NA 4X62J 4X84A 4NCBA 3HT3A 1NSQA 2IHR1 3IR6B 4JI7J 4QIVA 1SVDA 4IDKB 1IKVA 3WIVA 3TARA 1HQUB 5HO4A 1HHSA 1P8GA 4ICLB 4YDDB 1C4CA 2CPDA 3DRRB 5G0RA 5IT9Y 3M1VA 1TAQA 3QSIA 2L41A 4ZLNA 1QY7A 4H54A 2W8LA 4C3LA 2QEXS 5HATA 3L7OA 1GFWB 1WUUA 3WX4A 1XNRJ 2E29A 3IBCB 4B3OA 2NZCA 1X31C 4OI6A 1CULB 2BE7D 1X9MA 1JLGB 2JFKA 3ETMA 1J5EF 3QGPA 2X1FA 1X4AA 1S1UA 4K4YA 3BKFA 1FJGF 1EETB 4N7TA 4I1TA 4C8KA 4ID5A 2RKIA 1KOOA 3FVYA 4RBTA 4U8YA 5JJBA 1C0TA 4NZ0A 1CLFA 1LEOA 2EFPA 2CQ4A 1FVSA 5GMKa 4YR2A 1G3OA 3HK2A 2B3TB 2AGQA 4KGVB 4URSA 1MLAA 3H5UA 2RQCA 4F4XA 3LP0B 2MQLA 1HW8A 3MPVA 4GVLA 4JI8F 3PDNA 1YJNS 3F44A 3M2UB 3P4UB 3CJKB 3NMAA 1IVZA 1KP6A 3CJSA 4DU8A 2XYHB 1XWLA 2HRYA 4I67A 3MD3A 2ALYB 3V4IA 1HIYA 3WIUA 1S7HA 2LVWA 3FSIA 5KFTA 4EU0A 1NHKL 1VRUA 1N54B 4Q45A 1APSA 1LW0A 3P5BP 3PYDA 2KFZA 2KB2A 4ZVSB 5HP1A 3D5MA 4FXDA 3UWTA 1Z2LA 3CMES 5H1SV 1JXLA 1T9XA 2YNIB 1HNWF 1D9FA 3RRGA 1FWKA 3H90A 5LT5A 5I3PA 1HMVA 2HS4A 1R0CB 3MR6A 1Z2ZA 4J90A 4NOHA 3W9JA 4NCGB 3CPWR 3TOQA 2HVHA 2RRBA 2O01C 4DR2F 3KLVA 3J7YI 1GT8A 1UL3A 4RWXA 2XSJA 4C0OC 4ZITA 4DR5J 5KT7A 2BM1A 1KDNA 4ANEA 2QA1A 3FJ2A 4EO8A 3X3UA 3RB4A 3N79A 3TANA 2HVEA 3CGIA 2G0JA 9ATCB 3VAGA 2MKSA 1Y5IB 3FEYB 1RT1B 2Z2LA 5AE3A 1WEXA 1Q4RA 4EO6A 4R5PB 1TZ0A 3BN7A 3SEOA 1XNQF 3R5GA 4P7VA 4B08A 1JMTA 2VFVA 2VA2A 2AKWB 1VC0A 1D8YA 1S6UA 5DG9A 3DN9A 1HBMB 1EX8A 2H51B 3VVTA 4MH8A 1NZAA 2UVWA 5D4PA 2A6OA 3M8RA 1X9SA 4C6AA 4RUAA 2Z8QA 1MW7A 3LQVA 1NXIA 2BKNA 1PILA 3M2VA 4QWAA 4LIWA 1DARA 4F50A 5ETKA 3DXSX 2HKEA 4ANDA 5LL6d 3W5XA 4USUA 2D3O1 4FYDA 2E7VA 4WIIA 1Q81T 1S6PA 1FDAA 4W90B 2XZDB 1S77D 2Y8YA 4K4WA 5EGYA 2KH9A 2D3UA 5L38A 5F9LA 5E5NA 4YR3A 4HVZA 3GV8B 2COLA 1F1BB 3M8QB 4NEYA 5A8RB 1C1BB 5CXTA 4JI4J 1KWMA 5J1PA 4TLRA 4DV2J 4WJBA 4Z2XA 2B4VA 3C16B 2Q43A 2CQGA 2G2ZA 2IRUA 1V5VA 1FFGB 2LA4A 2CPEA 1Q7YT 4LBIA 3R1HA 3LP2B 1M0SA 5ETOA 5HANA 5JUMA 1LWXA 4OZ3A 3NGTA 4USWA 4DV7F 3AH6A 2E5IA 4PCQA 3KK2B 4M5MA 1H0HB 1X4GA 3VQSA 4CLLA 1RHUB 1QAYA 7AT1B 1SJRA 4QIGA 2KG0A 4F4KA 1WHYA 4WK1A 4FKYA 2GMHA 3EWGA 1VYAA 4PXDA 1KKHA 3W5YA 2IC3A 4X4PA 4AUKA 3DM2B 3K5PA 1TL7A 1JNZB 4ZHRB 2E9TA 2RUSA 1GX5A 4I64A 2FC9A 4R0EA 4YB5A 4PG6A 1RWNB 2OFGX 4DHVA 4WCEQ 5KFGA 1IKVB 5DGBA 2LDIA 1SCJB 2DR8A 2QYCA 3Q8QB 3W7BA 4WFBQ 4X65F 2N7YA 3SDEA 4QW8A 4ZPAA 4ZDNA 3TRGA 3GCXP 4Y6IA 3AA9A 2QYGA 3BKUA 3M1VB 4ZVRB 4O4RA 3HHDA 2AF6A 1HWLA 3ZTOA 4C0BA 4CO4A 2CQPA 4MK7A 3OUYB 4RO0A 3IS9A 4JYAF 1RE1B 2R7WA 3KUEA 4XO0A 4RW9B 2C1EB 3MEDA 2C2KB 4X4TA 3VWSA 3DU6A 2YKNB 3I4HX 5KTQA 1C4AA 3KWMA 3CCJS 4DLGA 2XMJA 4MFBB 3ZZPA 5K8NA 1UJ6A 3LPYA 3C6TB 4ZN3A 1WWHA 4ID5B 4ETXA 1OPZA 4ED1A 2W2OP 3QJPA 5B0CA 4L75A 2H65B 4LFCJ 2ZWPA 2BJ1A 3KHGA 1NKBA 1C0TB 1TFYA 4OX9F 3KLHB 4XDCA 1X5SA 4LRAA 4UOGA 4ZPVR 2AGOA 3ITHB 3I55S 2BEFA 2HG4A 2EK1A 4RU9A 2JOQA 3HZEA 1QM9A 2R42A 1OMSA 1Q1KA 3D0HE 4WE1A 4TN2A 2ZKUA 1VFJA 3TW0A 4AYBD 2ALZA 3KUGA 4WF9Q 1UVMA 4GO7X 3V4IB 4NXMF 3HMJG 1NH8A 1D9AA 4CIOA 1WF2A 1DURA 2OO4A 3M7VA 1EAYC 4ILMA 4LF9J 4DCJB 2ATCB 3J7AN 2MKJA 5KG2A 1TVRA 3Q24A 1R43A 3FEXB 5DQGA 1FE0A 5HP1B 1QSYA 2JJ4D 3A4TA 3VHQA 5U47A 4HI1A 4C7QA 1N4LA 2UUWA 4I2QA 5J2QA 2RRNA 2ZH6A 4G1IA 4G65A 4GKJF 1YWXA 4FP9A 2YH0A 1TAUA 3UQSA 3IA0A 1TL3A 2FHKA 2NLWA 2LCWA 3N0VA 1CG2A 1ZA1B 2AZ1A 2ABYA 4RW8B 3BBFA 3NS7B 3T1HF 2CJBA 4K4UA 4ED7A 4B9UA 4WTYA 1V6HA 3UD5A 3PW2A 4C4WA 2RS2A 4LBHA 2MY8A 4QCLA 1OO0B 1J2VA 1XJWB 2MZJA 3T5JA 4B3RF 3O5TB 1JLQB 2XY7A 2VU5A 2CG8A 2W4PA 3HHKA 1I94F 2M70A 2V9KA 2A2CA 4J7CA 1VK8A 3BYRA 3K5MA 1XN9A 2OAUA 4F2RA 2HWHA 2NUUG 1VLOA 1HD1A 4EZ6A 2H48B 3MGJA 1F9FA 1K44A 1H2VZ 2P5VA 1SC4B 1DTTA 4I7FA 2MKHA 3MUMP 4QU6A 1Z1ZA 4FZVA 4L6V3 1XQIA 1S1TA 2CFXA 3S7RA 4ANCA 3CT9A 1O0PA 1SPBP 2P9CA 2OHDA 4OYWA 4RUHA 4NLUA 1QVFR 2B0GA 2CRLA 2B56A 1KTQA 5CYMA 2H5JB 1AB8A 1QTMA 2FB0A 4FYYB 2CPIA 2LFVA 2HIYA 2MY7A 5FDLA 2DGVA 1B0TA 3J7YU 5M2UA 4KGMA 4XDDA 1X5OA 2VFUA 3NBPB 5ETMA 2OUGA 1VHFA 3CD5A 3BH7B 1BQMA 5KFQA 4NLTA 3Q86A 5LMUF 3LGMA 3NLCA 1FRHA 3PW0A 4DV6J 3BDEA 1UPMB 5B0FA 3EYZA 2DGQA 3PACA 3D6MB 1ACMB 3IC1A 2W9BA 4NLPA 5MAOA 1TK8A 2LU2A 1WTBA 1ZTWA 3MR7A 3MM7A 4U96A 3CCES 2GHVC 2VG6A 3TQ1A 3QATA 4ECWA 4KJIA 1UVNA 1C1CB 1UEKA 1XMOF 4IOBA 5EX0A 1WKKA 5KFYA 3PRBA 1EIYB 3G71S 2JH3A 2YWFA 3F0NA 4K4TA 3CCTA 1M5PC 2HFZA 1JKHA 2IC3B 1F5BA 3LPEA 3ICLA 2GX8A 2WSEC 5D0GA 3BV8A 2B9XA 2D69A 3O6QA 1BMQB 3RB3A 1TKZB 2DR5A 4DF4A 3GCWP 2ZH9A 2Y1IA 4AXIA 3OXLA 2MSSA 3B6BA 4UTGA 3PZPA 2GHPA 1BC6A 2KYXA 1OWXA 2ZOMA 4JI7F 5K8PA 1Q7LB 1WKJA 1X4DA 1SQEA 1S6QB 3W62A 2HVIA 2RAQA 1WSVA 2XS5A 4KQZA 3R1LA 2J76E 1D9DA 5I3UA 3ZZOA 2MQNA 2YWEA 1FFWB 3UVJA 3KHRA 4ENOA 2CQDA 3G86A 3RBEA 4USHA 2W4CA 1GK8A 3HFKA 2Y9HA 4OHXA 3GJQB 2Q6CA 2HNDB 4M5DA 5KFFA 2J0WA 4JP8A 4DX8H 3B4MA 2VPWB 2DNNA 5E41A 3PX0A 3TJ9A 1HR0F 1UVLA 5KT3A 4DZDA 3UNYA 5LMNF 2A6MA 4ETZA 1GTEA 1F9HA 4IR9A 2K06A 3FZ2A 2PFDA 4JI5F 3VTIA 2R7OA 2NXEA 4C8LA 3RRHA 5A6WA 2YKMA 1NPRA 2RHSB 2AW0A 3R5JB 2B9YA 3N9UC 4FF2A 1AZSB 3BGLA 2YPZA 2HHHJ 3OXFA 4LBPA 2SXLA 2GMJA 1N8RT 1RHKB 3HLUA 1Y5LB 4WE1B 4OZ5A 4B3TF 2KDOA 2FYXA 2HPUA 5CQGA 2O1PA 3J7Z5 3IR5B 4HDGA 2DNPA 1W2IA 2CJXB 4DV4J 2FY1A 1K1SA 4ZJQA 3V6KA 1F0XA 3TJ8A 2EC0A 2CAJA 3V6DB 4X4RA 3HZGA 4F26A 2BXJA 4WKRA 4X64J 2YXLA 1DRZA 1WC3A 5I42A 1TVRB 4NPOA 4JI0J 1NHUA 2NPFA 1N0UA 3L95X 4KHRA 3A1YG 4W4MA 2HFVA 3PW5A 1IQTA 4N41A 4M5GA 1KHVA 2C2MB 1KVIA 4I2QB 5J2QB 3HCXA 2X3GA 4G6VB 1NB7A 3R6GB 2NQPA 4F3MA 3GR0A 3M8YA 1E6VA 4KPYA 3K8VA 1TL3B 5F0WA 3PR5B 3AXMA 2W2QP 4JV0A 3DI6B 4CLUA 1NJIT 1VQKS 3WBZA 2FQQB 2BQ3A 1NSKL 2YWWA 4B3SJ 2HQIA 2ZC3A 1KQFB 2BA9A 1IKYA 2RILA 3NNAA 3KLGA 4OYIA 4HEA9 3VZHA 3NOGA 3UCGA 4DPOA 4LSZB 1RXOB 4E0DA 5F8IA 2KG1A 2VL1A 2VQFJ 5EX3A 7FDRA 4UF4A 2HBZB 3HVWA 1ZH5A 2GFFA 1SUQB 1YVFA 3RB6A 3SFUA 3U02A 9RUBA 1DTTB 2GQCA 2BE9B 1S57A 4DPUA 3OSPA 2HQGA 2D3ZA 4YB7A 5T7LA 2GGPA 4G1QA 1NLKL 3K5LA 3KK1A 3KK3A 1M1GA 4ER8A 1D8ZA 4EBCA 2YX1A 1FJCA 2OPSB 1U1LA 3N5FA 1REVA 4M5IA 1KSPA 4OL8A 5KFNA 2B43A 2Q6BA 2IA6A 1VCTA 4O3QA 3I0RB 1K0VA 4ZS6A 3OR1B 2VBZA 2CQIA 4D3GA 4M5JA 3ENVA 4PG8A 4CI0B 2EFVA 1BQMB 2XI2A 3ZZZA 3P45B 1Y3KA 2KRBA 1A6LA 1NPKA 3HVAA 4O4GA 3IP0A 4O0NA 1AXQA 1ZPWX 4IOCQ 3HHLC 4YHHF 4USJC 1RWUA 2OEMA 3MMCA 4ED6A 4ZLPA 5B0GA 3H7HB 5C42A 1B7FA 1FRMA 3K8WA 2QT7A 1N34F 2V4JB 2VG6B 1VOMA 3A12A 2VUGA 2AYEA 2A1BA 3MWBA 1NPPA 4Q5VA 2OJ3A 4NMLA 5BR8J 3IWLA 2YWKA 3C6UB 5A6PA 2CZ4A 2LP4A 1HNXJ 3OW2R 2BVZA 2VG7B 5D3GB 1K73T 4HH0A 2GO8A 4RNMA 4DL7A 1GMVA 4DQSA 4NLRA 4FNHA 1TV6A 2OFHX 3H2VE 2CXEA 3I0SA 2MJUA 1WHVA 4LT6A 2GVDA 1FDDA 1CJTA 3W64A 3QGIA 3MM6A 3PYGA 3GFZA 2KZMA 2B7CB 4DPWA 3MPUB 3CB4A 2KRRA 3UD4P 4ECZA 2UVRA 2HMIB 5KFUA 1UPPA 2FVCA 4AFFA 1K9MT 1WSRA 2KM8C 1WTFA 4ZVUB 3SQOP 1Y5NB 4OV1A 1N32F 3FBEA 4C2MA 4IO9Q 3UVJB 1WG5A 4DN9A 3BQ1A 3UDEA 1SH2A 2VQEJ 4FXWA 4K4VA 1S1XB 1QSLA 5CYQA 3GU0A 2V2ZA 4U6PA 5DETA 1JWWA 5K20B 3MAAB 2KFYA 1FNOA 3A8KA 2K1RA 4EGLA 1M1HA 2DBBA 5KFXA 5HN0A 5KFHA 1S10A 3QPIA 3Q8PB 1TR0A 4AE5A 1NDCA 2DNYA 1H72C 4FKXA 1NJXA 5EWGA 2EPIA 3CMQA 3ILJA 3B54A 1S9GA 4JV5J 3HO1A 4LF4F 2P8IA 4B9NA 4OZ2A 4B3MF 3MOZA 1RT2A 4L3KA 2J6SA 1OY9A 5F9NA 1HYSA 3IXQA 2VFRA 2UZAA 1HL6A 4CH1A 2GS8A 1N6QB 3AOBA 4UOFA 3TZXA 4LF8J 2HGMA 4ZP9A 2R4FA 4DV0J 4A8FA 2RDIA 5L9NA 1RTDA 1NDPA 3C14B 4CP5A 4IQXA 3W3SA 2PD1A 3SSRA 1H73A 1TKXA 1TKTA 4CLPA 3M8PA 8AT1B 4J37A 1LXJA 3CIZA 5IC6B 3MHYA 3L09A 2XB2D 1Q8LA 4P2FA 2Z4PA 3EXCX 2VIHA 1NSPA 1HNZF 1YJWS 1CJKA 2EKYA 3W2VB 2BJEA 5B09A 2FC8A 2BW2A 4TXSA 3VAJA 2P6SA 2EKNA 4ECYA 1PKUA 2HHVA 4KKOB 1U1MA 3JAMU 1E6VB 5KG0A 1HWUA 4F4WA 1B7YB 2C2OB 2R8IA 1NK0A 3OFHA 1KQSR 1Q95G 3QAEA 3RBDA 2OTJS 2FLOA 3CC2S 3R7NB 4O3NA 4MMOA 2VPZB 3G82A 1NU4A 4M8LA 3P6YC 5C7PA 1MMLA 1RHQB 2MEWA 1GNKA 3GILA 3AOAA 1PJ6A 2EWHA 5EN1A 5L1KA 2C2DA 4KTQA 2IDLA 1AUDA 1KHWA 2F8HA 2OPPB 3T9NA 2CPHA 3N6MA 5CHCB 2BE2B 2DNQA 2Z56B 4RJVA 4ZP8A 1FK9A 3NL0A 2M2BA 3FUYA 2E9RX 2M88A 2R7XA 4AL5A 4C98A 1OJ4A 1KNZA 1X0FA 4PXBA 3PIPQ 1B3TA 3ET6A 4RPFA 3MFIA 2ASLA 4GRSA 5HSPA 2HBQB 2N3OA 2QGFB 1RT3A 4HHUA 3R6LB 2DIUA 2GGPB 3QZ7A 1CQNA 3TVZA 4B9VA 5BXIA 2K8GA 3KK3B 2WRMA 2CVEA 3J81Y 4PZVA 5B0AA 3FCWA 4HT7A 1WJ9A 2RT3A 3ILLA 1WOPA 1SL2A 4CLZA 1ZPVA 1WC6A 5GMEA 3LF0A 4OI1A 3A3PB 3T1AA 5LJ5Y 4V19J 1S97A 4OHZA 2A18A 3CCVS 2P9GA 3NS5A 2GQ2A 4MKYA 3OBIA 3HHLA 3D1QA 4RWWA 4DR3J 3UD3P 4HDHA 3HHNB 1R6VA 2I0XA 4DFKA 5L1IA 3MMCB 1IR2A 1VQ5S 1V3SA 2Y1LB 4A47A 4C8MA 1JLFA 3TJAA 1VK3A 1GH8A 4CLSA 1UJ5A 1RSCA 1VQSA 1QUVA 4NLQA 3T1YJ 4DL2A 1U24A 5ETPA 2V8PA 5KOXA 4ZLJA 4DUZF 4RNHA 2ZHBA 2VJUA 1FT8A 2XMTA 3P49B 1X60A 1B0VA 1NCLA 4NXNJ 1N33J 1TV6B 5D77A 2WVDA 3V81B 5CCLA 3FQLA 1S4FA 2KVIA 3CCRS 1D1UA 3I0SB 4PUOA 3DLKB 2GVDB 4OI4A 4O44A 1SV5A 3TZZA 2Z2ZA 3MM6B 3OTEA 1NKCA 3OVBA 1UJ4A 1HW9A 3L7PA 3OLBA 3S6EA 2DGTA 2GIFA 3SCLE 1VJWA 3FFIB 4P7TA 3ZTQA 2CDQA 5LSLA 5IFMA 3HXMA 1SI9A 4LJMA 2OPQA 4CYUA 4DZ6A 1U1OA 1EKRA 3DOKA 1VQLS 1HFEL 4X4OA 3PEJA 2MLYA 4LREA 1PIEA 2A10A 4C8OA 2XYPB 4ZOSA 3SYZA 2RSQA 2XM3A 4UT4A 5BJRA 2CPJA 4CLYA 4I2PA 5IV3A 4DSJA 3Q2SC 4X4VA 3PO5A 3HFVA 1YRTA 4DR4F 3FEZA 1RADB 4G3IA 2XO7A 2PMZD 4PXEA 1BWVA 2LXUA 3K59A 4GC7A 3CCWA 2RUGA 4K0KF 3GE9A 2V34A 1FDNA 3V6JA 3HPOA 4MYTA 4HYKA 4JI6J 5K8MA 1PSDA 3IN5A 4UOHA 4TQSA 4IRDA 1Y4ZB 3US5A 3RUBL 2ADCA 1UWBB 5A2QY 2BRLA 1TK5A 3DKDA 3VAHA 1ZM4A 4V1Ak 4WZMA 5KT4A 4X66J 2VFTA 1X9WA 2W9CA 1T02A 2VH7A 1S9GB 3PW4A 1JK9B 3GWCA 4UW2A 3PY8A 2RH3A 2RDJA 1CPZA 2CWKA 3H5XA 1HYSB 4LFBF 2N4CA 1WOOA 3OLAA 4N77A 2J9DA 2VODA 1TELA 2UV8A 1P27B 4CO2A 3E51A 2VA3A 2V68A 2J9CA 2I5JA 2N7CA 5CH7B 3MM5A 1RTDB 4OHWA 1SH3A 2C42A 2IYIA 3W5ZA 2H3EB 5DO2A 1TKXB 1TKTB 3O2IA 5D6GA 1U26A 1FX2A 3MMAB 3RAXA 4DV4F 3MR3A 2HIQA 2DPJA 4RBUA 4AQYJ 3W66A 4F0KA 1S1WA 5KFIA 4U8VA 3MMJA 1CJVB 2UXCJ 4QWCA 4DV1F 1CJKB 3FGVA 3D1HA 4U9RA 3A3NB 2RU9A 1N5YB 5KFBA 3CDWA 3QRPA 3RW6A 2G1HA 1WHXA 2MKYA 4JBCA 1HBUA 2ZM6J 1S49A 1EZZB 4DR7J 4KR0B 3TAPA 2Z2MA 4OZ1A 4Y34A 3D0IE 3IWXA 1U6FA 4NA3A 1D0EA 4B9TA 2BKPA 2W7AA 2FHJD 4DBQA 3TVKA 1JB0C 3CJRA 1RCOB 1YJ9S 3G82B 3U7JA 4B17A 2XTJP 3BB5A 1O6XA 2VOPA 1HBNA 5FLXU 4FF1A 5CCMA 4B3SF 1RACB 2BOAA 1FK9B 4LF7F 2VKRA 1VQ8S 4X4SA 4DI6A 4IH5A 3TZYA 3I4PA 3SZ2A 5HK4A 1FXDA 1U6ZA 5FD1A 3DDIA 3TEGA 4DV3F 4MIBA 4JV1A 4QPXA 1WOSA 3H5YA 2BACA 2XLKA 3EVMA 3UR0A 2ZJQQ 2FVPA 2GIRA 1RT3B 4LUBA 1EKSA 1YJTA 1T9TA 2LQ9A 4RW6A 3U27A 3FNNA 1RHMB 2J6TA 5JVHQ 2HK2A 5L1LA 2WONA 1VQPS 4YDXA 3QBCA 3SQGA 1ROFA 4HACA 4P74A 2LQJA 1FTRA 1T03A 2V4QA 1ZM2A 3KLIB 3R9LA 3FSXA 4K50A 2MZ1A 3HHLB 4C8NA 1YJUA 2YNGB 2DISA 1FERA 2PEBA 4OV6A 2CKWA 3ULHA 1B64A 2Q79A 1F3FA 3BBBA 3H2UB 4JI1F 1BQXA 1X0PA 5DZ6A 2B6AB 2F3JA 3ZTRA 1SL1A 4YY3J 1KEKA 1J5OA 1FNMA 1QE1A 2QLWA 2FHOB 4Q0BB 1I1GA 3PV8A 4ECRA 1JXEA 3T6BA 4IQMA 2BOPA 3KMSA 3N4WA 1JLEB 4Y00A 4Y2MA 4OHVA 3GFHA 2GAHC 4N47A 1L3TA 1KFSA 1HBOB 2R2SA 4PWDA 2Z30B 3IRXB 1R8BA 4Y2AA 3JSYA 3W2WA 5BR8F 4E8UA 3IAM9 4NWBA 2ZH2A 2NYIA 3VGVA 2Q1LA 1HNXF 2JZ5A 5D0EA 4A4JA 2WB1D 3KKFA 4ALZA 1LOUA 2FZCB 4ZN1A 2LEBA 3K17A 1TUWA 5DJBA 4IH7A 2W7PA 5AXKA 3QO9A 2WTFA 1FX4A 2DEIA 1YI2S 2HHPA 3NOCA 3QZ8A 4ES2A 4MKAA 1ZAXA 1B4SA 3OTOJ 3DYAA 1M1KT 1PJ5A 2DVIA 1LW2A 2VFSA 6FDRA 2MKIA 3L9ZA 3S01A 4DR6J 4OYPA 4MKVA 4NX9A 3AB2B 5KFMA 1T9VA 4EYHB 4CYUB 1TL5A 4OX7A 1N36J 4FBUA 4OZ0A 1GMWA 4M95A 4M1KA 1N5TA 2E5LJ 3W9HA 1EQ0A 3ZZYA 2CZVC 1SXLA 5J2MA 2YNFB 1RBAA 2AGPA 1IKWB 4J9KA 4DLEA 1QTNB 4ZVQB 3MEEB 2VV5A 1X5TA 4PYAA 4I2PB 2PA8D 2ASDA 1UVKA 4LF6J 1TL1A 1HPZB 4P2MA 4YN3B 3DOMA 2LU1A 4LF5F 5D4LA 3DOLA 2IBOA 1UMJA 3NNCA 4J9OA 3FMWA 3P3DA 3EGWB 2BZ2A 3GV7B 3KHLA 3MUTP 4DXLA 5KG3A 4DL4A 4ED4A 1NH7A 3CSKA 1IJFB 5D4NA 2GW8A 1H7XA 2VG5A 2UUTA 4ES3A 3CIMA 1KVJA 2W9CB 1RKJA 5M2RA 4I69A 1VIOA 3BF4A 5J2NA 2BQUA 5HMZA 5SUHA 2HHWA 1WEZA 3MDFA 2FVQA 2ZBRA 1RWVB 3M2RA 3BJYA 4I4BA 2ZITA 4WBFA 5A8KB 4OFZA 2PEHA 4OYOA 1NEEA 3HDSA 1RAJA 2F1FA 2KHDA 3UPFA 1Q5VA 5CAAA 3EDRB 3MM5B 4GVBA 4HR2A 4U7CA 2WOMA 4LF8F 2OI2A 4I56A 3PR4A 3BQ0A 4DV0F 4N8OA 3SV3A 4ED8A 1DAXA 2BJ3A 3TA1A 4GMKA 2Z0GA 1RAAB 2RQKA 3I9V9 5JVGQ 2GVZA 3E01A 3EPIA 2ZHAA 3QMQA 2F5GA 3BGFA 3CWJA 3QAUA 3Q8VA 5RUBA 3UCZP 2OEKA 1S6OA 2WZ1A 4A8QA 1MMNA 5IM0A 4AXJA 2NXUA 4OZJA 4P72A 4J9NA 5LSOA 4K4SA 5KFOA 4ZKAA 1HBUB 3P5TL 3VR1A 3ILIA 2I6WA 2XWYA 2RF2A 3MI7X 2AWZA 3H0PA 5KFDA 4C3KA 4RBVA 1KR4A 2OH2A 2IM2A 4FPRA 1C0UA 4A8WA 2QG9B 3TUZC 1N5QA 2WW8A 3GFYA 5KG6A 2OSRA 2KL8A 4KO0B 2EFGA 2XULA 1S9EA 1SC3B 2HFNA 1R3NA 1EARA 4F3QA 4DL0C 1U1NA 2DRAA 4OI0A 4Y28C 4EBEA 5AJ3F 2XEXA 2HHSA 3K57A 2DHAA 3AQOA 1YITS 3HULA 2N82B 5GAEU 4ED5A 5DLGA 4CLFA 3MTJA 4QZVB 4CRJA 2ZOFA 3T6JA 3DGVA 1YKWA 3TWZA 3LWLA 2V4RA 4RW6B 3RAMA 5ETRA 1RWMB 1CJUA 2YH1A 4URGA 3KG0A 2R7RA 4XPCA 2DRDA 4NI2A 2CYYA 1NM2A 4EFAC 3R27A 3KMQA 1W7WA 4HACB 3OXGA 5H9FJ 2VBXA 2X3DA 4K59A 2HFUA 2V8VA 3FRZA 3UI3A 3WZ0A 1W25A 4DL5A 5HL7Q 3KG1A 2F65A 4ECUA 5CZVA 3Q83A 2E66A 1DLOB 3VAKA 3NEKA 2O66A 4X2BA 3OSNA 2R8HA 1T3OA 4WK3A 5L39A 2DKOB 1J5OB 4O3RA 3Q8RB 1QE1B 4DL3A 2R7QA 2UUAF 4KPCA 2UUCF 1JQGA 2DTJA 4NLWA 3J80Y 4ELTA 3MM8A 3LP1A 2EG2A 1L3VA 2ROPA 3CDBA 3R3TA 3ISNC 2AU0A 2E9ZA 3OT9A 3OTBA 1LWEA 3W2WB 2DR9A 1RYRA 2QFJA 3KJVA 3D7SB 1VQOS 4DCPB 3R8YA 2DY1A 3KNGA 5C2GA 3AFGA 2AYBA 4B9LA 4OZLA 4PQUA 2Z2YB 1GTHA 3HM9A 2K3KA 4IG3B 4FBTA 1WORA 3F56A 3MMBA 1DZ5A 1LW2B 3DCAA 4KH1B 1FA0A 4R0JA 4ZJOA 5DG7A 1SC6A 1HQ2A 1S59A 4ZVEA 2LQ8A 3S1TA 3TVYA 2BW7A 1WF1A 2CQ0A 8ATCB 3Q2TC 3MURP 2HK3A 4ZLLA 2E5GA 2QLXA 1JLCA 4B9SA 2L48A 2YKPA 4QW9A 2GZOA 2HAIA 2BJDA 2ZH7A 5J2MB 1WC4A 3OTCA 2IM3A 2DRBA 1U49A 1FKAF 1T9WA 1V9OA 1YLXA 2GIQA 1PYOB 3WX8A 4QYRA 1TL1B 3DLEB 3C3LA 2ZEJA 2FZGB 4F36A 4DJBA 1QLNA 1LK5A 4CZCA 2XMKA 4R8UA 1DQ9A 5T41A 2HWTA 4NZ6A 4KGKA 5AT1B 2VKZG 4R25A 2H4YB 5KG7A 4USMA 1GXLA 2J7UA 3CULA 4JI6F 5F8MA 5C24A 1IXKA 1YSJA 2K3IA 2VG5B 3D1OA 5EHHA 4P2XA 4OYAA 4C8ZA 1H98A 2HVDA 4O3SA 1M5KC 4LRCA 1MMDA 2E44A 5J2NB 2DIVA 2HNYB 3ETOA 4MIAA 3EPGA 2WVBA 3JYTA 4KGZB 1J27A 4UY85 2AX0A 1RT5A 5ETSA 1F9EB 1ZOTA 1JLAB 1S0OA 4DL6A 3MF5A 1RT4B 3HSJA 1YJRA 1X4EA 3JQJA 2FIUA 2HZAA 2X51A 1LWFB 1VQ9S 2I8EA 3POTB 2K7KA 1CS4A 3CCQS 4QJVA 1FRLA 2WAQD 3THPA 3OFEA 1XBWA 3UE2A 1F6TA 4C11A 2GVZB 3E01B 4QIEA 1HARA 4LFAF 1SJ3P 4Q7AA 2BM0A 4F4ZA 4ZVPB 5KFKA 3PJ9A 5ETLA 3O8WA 2IY5B 3NAHA 5CD4A 1N0VC 1FVQA 1HNVA 2E1PA 1WI8A 2BBEA 3PKMA 2ZH5A 1J5EJ 2DNHA 3PNIA 5THWA 4YB6A 4KSEB 5A76A 2KXHA 4J9VA 2N3LA 3BM7A 5KFEA 3X1LB 3VAMA 1PYTA 2XCPA 1FJGJ 4ZCLA 3DXBA 4ZCMA 1H7WA 2OD4A 2EEYA 2BYCA 3CJQA 5IS2A 2RF2B 4PG5A 2V94A 2F9JA 3DRYA 2QSFA 3DRSA 1BQNA 4ZPWR 1SC1B 2GJ2A 1GAOA 1V5IB 2RMLA 4TLQA 1HKAA 3ZXWA 1T94A 2EFQA 3G6VA 1ZAWA 5HVHA 3V4MA 3BN4A 1WACA 3GYNA 4JI8J 4EUVA 2A0FB 1E6YA 3GIJA 5KFLA 4DPXA 4HL9A 1ZTTA 3W65A 3DC2A 4LRBA 4I6YA 5A8WA 1FKPA 3NNHA 4M94A 1WHWA 2WVFA 3V2UC 2FUG9 1FTCA 4NASA 1YK9A 4N8NA 3MCNA 4RNFA 3DRXA 2A3JA 5C5JA 1SKWA 3N6NA 2HS0A 4MIWA 1VQYA 3FBBA 3PRVA 2YNHB 1HNWJ 1H2UX 4NI2B 1DJ0A 3NXZA 3RW7A 2BANA 5G4DA 4KY3A 1IBMF 3N01A 4JI2F 1GMUA 3GZ7A 2ZWOA 4NZ7A 4H4MB 1PC5A 3KG4A 3H2LA 2VICA 4DR2J 2FJWA 1U47A 4ZPCA 1VQ7S 4A46A 2PMWA 4DV5F 3JSBA 1KD1T 1S0MA 3M9NB 2WBRA 1RWKB 3UR3C 5KFRA 3QIPA 2XSFA 5D8HB 1MWZA 2EFNA 4C3MA 3G8SA 3T41A 5K14A 3JSMB 2AV5A 2C3YA 4KC5A 2R3VA 4IKAA 2ROGA 4L73A 2G1DA 2MQQA 2MKCA 2OPRA 5DDOC 3LAMA 3U1MA 4EK2A 4A8KA 1XNQJ 1M5HA 1VLYA 2IM1A 5HBMA 4J5OA 3BGUA 3IAS9 1FEHA 3R7SB 2UUBF 1QAIA 5HLFB 2JDJA 2HFSA 3KJVB 2OELA 4DX6A 1CVJA 2F4VF 4EYIB 2WVEA 2HW3A 3KLEA 2BX6A 2E7WA 1N52B 2IPOB 2ILZA 4QPTA 3CJ8A 1PG5B 4IOAQ 3E8OA 3MMBB 3LANA 4LRFA 4FDFA 4DQPA 5G0RB 1FESA 1UTAA 2VD3A 4BWJA 5LJ3Y 3DLGA 3U1LA 2AJ1A 3M9OB 2R2UA 2ZVIA 1KN6A 1Q16B 3AD8C 2IMOA 1XEZA 3N5BA 4I6AA 4NLVA 4K2JA 3BQ2A 4J9LA 4RW4A 1R8CA 2VBYA 3NGDA 3CJ0A 3GIRA 2VHGA 3NGUA 3MECA 3AJ1A 2ZD1A 4H4OA 2WK4A 4I0WA 1WC5A 4B3OB 2F9DA 1V3ZA 2OD6A 2RVJA 3CO0P 3KXDA 3GJSB 3M8SA 4HT5A 2GV1A 4EI2A 1RTHA 1S1UB 3S8SA 4MK8A 4DV7J 2RKIB 2QX0A 1FWPA 4R8UB 2HAFA 3DGPA 1NK4A 2O67A 3MD1A 5KT2A 1GXTA 4KFBA 2HBYB 3HT0A 2V8DA 1U02A 4OX8A 2OLWA 1HI1A 1U2FA 3Q0AA 5C24B 4MJKA 2DO0A 2DPIA 4LR8A 3W61A 1NDKA 3M30A 3GONA 4LQ3A 1JJCB 1RHJB 4F4AA 3A8EA 2KHCA 2R8JA 3EGZA 3TUIC 1P1LA 3GQCA 3JYTB 5DGAA 4KGXB 4LVNP 2MDAA 4FXVA 2IVYA 4PG4A 1RT5B 3R2CJ 2W2MP 4X65J 3GYGA 2Z58B 2WVCA 2AD9A 2XMUA 2ZH3A 2C3UA 3KTQA 2F8EX 2QJ3A 2HS3A 1HQUA 1U6BA 5H9EK 2C22A 3ZFVA 4ICLA 2OTLS 2ZH4A 1VRUB 1YBUA 5J2PA 3MCMA 1LW0B 2QA4S 2BUNA 2DNKA 5GADU 2V6AA 1Q0NA 4C11B 3IM8A 3AA8A 3GPAA 4JYAJ 5LXYA 5HROA 1VRQC 3QT8A 2IVMA 4RUBA 3RAQA 1UEVA 3QWPA 1HMVB 1HNVB 2DNMA 2QFIA 1CULA 1G4CA 4TVAB 4F25A 2FD2A 5F8HA 3HD2A 2XSJB 3G8QA 3TAQA 3AOCA 1CBKA 3CD7A 4OX9J 2JC0A 4D3HA 5IWAJ 1EETA 3C46A 4PQAA 3C8YA 3H42A 4NLOA 3GG1A 1UAWA 4UZBA 2UXBF 3D3CJ 1Z4UA 3M9MB 3BSNA 1YZ7A 5AXMA 4DCOB 4ZCKA 4K4ZA 1NK8A 1RABB 2AP6A 2U1AA 3GSIA 1E6YB 3AHPA 3ENWA 1T8EA 4DR1F 4Z7YA 5AE2A 3EZ5A 3R5AA 3LP0A 2EXUA 4QQBA 4NXMJ 1U2CA 2DNZA 2R2TA 3M2UA 3CJKA 2ZKTA 1S5ZA 5E0OA 2XNRA 1OY6A 2FJAB 3K89A 2XZTB 2VF3A 4DWIA 1SKUB 4FVMA 1GQEA 3MAQA 1JIHA 3G87A 2EI5A 2MQ8A 3UN3A 3DFEA 2YQ1A 2VJVA 3M2VB 5BYRA 1U8SA 1VRTA 4J9SA 1NRKA 2H5IB 1Y3JA 2CNOB 1U1KA 1QUPA 1Q78A 1BGXT 5IT9U 4GKJJ 4X4NA 4MT1A 4LF2A 2AYMA 2V2VA 3WC2A 1MG7A 1S6PB 2J8SA 4Y0FA 2DNGA 2YNIA 3GIIA 4DFMA 3T1HJ 4NRUA 4KHPF 2BV3A 2XWXA 1VC5A 3QJJA 4M5NA 4WPAA 1RU2A 3GP9A 4NCGA 3I9ZA 2YBVA 2XMWA 2NCKL 4B3RJ 3ONQA 4DSFA 4H4KA 1I94J 4PR6A 1IBKJ 3NG8A 3V6HA 3EVWA 4LR9A 3MEKA 1ZBTA 3ZZTA 2OPRB 4GKKF 4LVOP 2ZC4A 4DUTA 4NYZA 4MK9A 1U48A 4C9DA 3FZBA 2YWHA 3I82A 3JS9A 2ERRA 3D54A 2P9EA 5DDQC 3D6HB 1RT1A 4RNOA 2ZZNA 3NP5A 3CW2C 1TQLA 2HWIA 4FYVB 2W7OA 2KJVA 4NLGA 2FLLA 4R5PA 1TL7B 3NCQA 2DNRA 2LDYA 3VVUA 1XK8A 1HBMA 1KFDA 3G8TA 4X62F 4UQGA 1FEEA 3IRWP 3CUNA 1BHNA 3SDEB 4ZA1A 3RR8A 2QV6A 3MR2A 4Q43A 1YZ6A 2KO1A 2HGNA 5I4MA 1RLDA 3QFHA 3R97A 2W2NP 4PEOA 3CC4S 2J0QD 4CM0A 3HX9A 5IC4B 5LMUJ 4ZIVA 4BCAA 4P9SA 5ADZA 4A48A 1R27B 2NXNA 1S72S 2RQMA 5HI7A 2DGUA 1CQMA 5T14A 3ZTPA 3IS9B 4H4OB 4WKYA 2DYAA 4J9UE 1TP7A 4ATNA 3MEDB 3OD2A 5BYSA 4MKBA 2JWNA 3IGVA 3M8QA 5A8RA 3SBMA 1XNRF 5IT0A 3AAWB 2ACMA 4CNZA 2XQCA 1XMOJ 1MU2A 3MM9A 3UDVA 4I68A 2PMHA 3TUJC 5HQLA 3C16A 4NYOA 1EJ7L 1WG1A 4IUFA 2DGWA 2DXFA 3LP2A 5KFCA 2MQMA 2KKHA 3FMBA 5HVGA 3J7ZT 2JEJA 2HQCA 1U09A 4AL7A 4OHYA 3KDNA 1JLBA 2HFOA 1S79A 3EICA 3M8WA 3K2YA 5D15A 4QWBA 1MWQA 2RS8A 2ZBIA 3M30B 1GMWD 4WTOB 2KVQE 4ZCIA 1NMEB 3FQKA 2XY6A 2DHXA 3NAIA 4WYWA 2VBWA 3DM2A 3I56S 2ZH1A 4ZHRA 2B8QA 1WDDA 4I6WA 2CPFA 3FBCA 4DQIA 3R2DJ 2ATLA 3LW5C 3M05A 2K7JA 3CDEA 6AT1B 4DSEA 4NLSA 4RX6A 4K7QA 2ZNZA 3WHIA 1Q8KA 4OI3A 1YIJS 4JUZA 5J2PB 3OFFA 5B0BA 2AEFA 3IBWA 4PXCA 2IYGA 3SCIE 4IYQA 2AX1A 1NAQA 1JJ2R 3J81j 3BH6B 5DQHA 2JLGA 3ENQA 5D0RA 1G2EA 5IXUA 4QIFA 4DDFA 4N56A 4F8RA 3T5HA 5HROB 3OHAA 1ZS6A 1WC0A 1OS5A 2VONA 1HR0J 3K7RA 1YGYA 3LUYA 3OUYA 3GG0A 5L1JA 1QD1A 5LMNJ 3QT6A 3SCKE 2P2CB 4RW9A 1LV5A 5HQMA 1TK0A 2YKNA 4JI5J 1GXUA 1SIZA 1Y7PA 3J7A1 2CJYB 4WFAQ 1K8AT 1XR6A 4MFBA 1QSSA 3ISZA 5L46A 5CZXA 3VQTA 4NLXA 3C6TA 3LALA 5M2PA 2HHTA 4NLYA 4Y65A 2PI5A 5GAGU 5CA5A 2UXDJ 2JLEA 4DR5F 3KLHA 2DJWA 1VQ4S 2HURA 1F2GA 2OIHA 4B3TJ 1VJQA 3TP2A 2PA3A 2HZVA 1RTJA 3ITHA 1NSAA 3G6YA 3DHWC 4DU7A 1IWAA 3ZC4A 4UUWA 5D4OA 2HVZA 4I7FB 2NS1B 2GJFA 4ZMMA 1TFWA 4F0MA 1FXLA 5SZTA 1UW4A 1T95A 1QJHA 1S1TB 1U1PA 1VBXA 4OYXA 1FCAA 2CIMA 3HFZB 2FVRA 1HNIA 2GCFA 3AD7C 5DZ7A 2DHHA 3PCOB 5CYMB 1VRTB 3MAHA 2H54B 1RWOB 5FDLB 4NEZA 2NR0A 1YRXA 3W9IA 4WFYA 1KTVA 3IWNC 1Q82T 2FJDB 2DH7A 3BR9A 3NKYA 1RGVA 4QBUA 3PHEA 4USKA 3CTRA 2D9PA 3R5DA 3GJTB 2IM0A 2YWGA 3DDNA 1BY9A 4QIWD 3HP6A 4CQ1A 2W9BB 3PO4A 4ES1A 5D0HA 1VR6A 3MM7B 1DQ8A 1EP4A 4RW8A 3PW7A 1T11A 2FLPA 2DXDA 4HH1A 3DMJA 3JXOA 3NRBA 3IFEA 5IZHA 3VGTA 3GR1A 2X7IA 1ZZNA 2YKQA 1X7VA 4JI4F 3KJFB 4DV2F 1WEYA 2E7XA 3G6XA 2R9LA 3D3BJ 4HTIA 2IMWP 1JLQA 3MTKA 3BSAA 1HLWA 3CO9A 4DSKA 1UCNA 4O3OA 1AA1B 3OVAA 2UV8G 3M6UA 1JKHB 1HWIA 4G1PA 3TNVA 3BREA 3ADAC 5KG1A 2JL9A 3BZQA 1ULRA 2J5AA 3JSRA 3PYEA 4CCHA 1YDLA 3B8HA 1UA0A 1Q53A 1X8DA 1Q79A 3LGHA 1T0TV 2QMUB 1RAGB 2XHCA 3OJUA 3UCUP 3HD1A 2V8HA 2AMCB 3ENAA 4QOTA 3HJFA 2AJQA 4DG1A 4IG0A 3H5SA 2XNQA 4ZP6A 2JEFA 3MR5A 2YVSA 3MCSA 4OJHA 2GJIA 5I3UB 3NMRA 3PIOQ 2W01A 2ZJRQ 5KG5A 2IIHA 2H5EA 4QR1A 2CWXA 3NBPA 2IRXA 4ECQA 4YHHJ 2NZ4A 2HQFA 4ELVA 4M5DB 1TL4A 2B51A 2JC1A 1RCXB 2QC3A 3V5RA 1N34J 3OR2A 4BC7A 4C97A 1W2BR 2Y1RI 1MU2B 3TX8A 3MM9B 2GC8A 2O3DA 4J9QA 1FNXH 2RQ4A 4ECTA 2YKMB 4K4XA 2JX2A 2G4BA 1C1CA 4UQTA 4JV2A 3K0JA 2VPXB 2MSTA 3Q22A 1LK7A 2Y1JA 4WU2A 2CJKA 3THTA 2AEMA 2PFFB 1JLBB 4LFCF 2A2DA 5J1NA 3T5KA 2CG4A 2DH9A 2HQ3A 1R0BG 3EJMA 2RU3A 3BPDA 2DR6A 1WF0A 3E3XA 1BD6A 1S0NA 3TEHB 5A0YA 1DFDA 1PO6A 2R2RA 3UDLA 1FI4A 2B8PA 4YUDA 3KUHA 1TKZA 2WSFC 2NSBA 3O3LA 1UP1A 2AJ4A 5EWEA 2HQDA 4C0HA 3G6ES 2OEJA 2XLIA 3BPSP 4FF4A 5I42B 1NUEA 4HI2A 1N32J 4OZNA 2GA7A 2RB7A 1S6QA 2U2FA 3NGRA 2X1AA 2I9SA 2WBMA 1FRJA 4LF9F 3JQKA 4XK8C 2UP1A 4TY9A 3EVOA 3HF5A 4ECXA 4F0HA 4FF3A 1R6YA 1NDLA 2MHEA 3PHTA 3MPWA 1NK9A 4HKQA 4F7VA 2HNDA 1BE4A 4BS2A 4B02A 5KFJA 2QL5B 5F8GA 4YFUA 5DDPC 2CZ9A 1SIWB 2BJ9A 2NSCA 3UNGC 3DLJA 2F8MA 1Q8BA 2Y0SD 1IKYB 4LF4J 3KLGB 4B3MJ 5KFPA 2RNEA 4EWTA 3PX6A 1Y0HA 1RKIA 3EDQB 2Q3PA 4TNOA 1KS2A 1Q5YA 2DB1A 5IWAF 2FTRA 1U2RA 1SKRA 1RWXB 1PYSB 5DG8A 1RTJB 1AZSA 3H25A 4DX7A 2XS2A 1W26A 4ED2A 1WC1A 1C2PA 3CMAS 2ZZTA 3NCPA 4J91A 4WP9A 2FHJA 5T7LB 2YQ0A 3KYLA 2IJFA 2FDNA 1BXNA 1U1RA 4G1QB 3NS6A 1OSDA 5B08A 3KK1B 1MN9A 4PPDA 1AYEA 2J6UA 1IR0A 3RTVA 3M8ZA 1HNIB 2WB4A 3V6DA 3SIPB 1REVB 1IBLJ 1HNZJ 3C66A 2XMMA 3EE3A 3UFCX 2OKQA 2K2PA 2HHXA 2UVUA 2MZQA 2ZNYA 4WXOA 2MYFA 2DHGA 3P96A 3R7BB 5E3PA 1URRA 1RDRA 3GLJA 1NKEA 2LEPA 4O4GB 1XTZA 2WCXA 2DXEA 2EC2A 2HLTA 3EMTA 1XMQJ 1SJ1A 4K8RA 4DV6F 4TQRA 2ZE2A 1Q8IA 5C42B 3BR8A 1EP4B 2QO3A 3KDOA 5E3AA 4EZ9A 4LMZA 3A8JA 3DI6A 3F73A 3DMJB 2DNLA 4ZP7A 1N5SA 4OLOA 2CQBA 1REGX 4YS2A 4ZVGA 1R0AA 2QMXA 1RBLA 2QLFB 1MWYA 2P6TA 1V3RA 2WW4A 2LKZA 1FRXA 2JSXA 1IBKF 3QJLA 3JTNA 3MEGA 3BSCA 2CJAA 4E2FB 3GYXB 3L4BC 2LA6A 1I3OB 1SUQA 3FBFA 1CJTB 2XYGB 1AFJA 1HQEA 3D4JA 2PIIA 3UO0A 1IM4A 1YG0A 2AHOB 4UUXA 5ITHA 1EQMA 4IRKA 5KT6A 3QRQA 3PEHA 3Q8SB 2B9WA 3I5BA 3RR7A 1XR7A 5HMXA 2OPSA 4DG1B 4IG0B 1PJ7A 4M5HA 4RKUC 3TO8A 2HSEB 4CT9A 2Z57B 3I0RA 3BO3A 3FDSA 4XPEA 3ISND 3OR1A 1ZM9A 3L7UA 2GAGC 2IJNA 1P6TA 2MZSA 3C15A 2CPYA 2R7VA 4F2SA 2V63A 4Q2MA 3JTOA 5F8LA 5CYQB 3JAMY 4CWBA 2PN6A 1LKZA 3Q89A 1YX2A 2GO9A 2MZRA 4DQQA 2XG8A 3THVA 2CDRB 2K1RB 1R8PA 3OR2B 3SFGA 4GO5X 4DUZJ 2PGCA 1SQFA 4BC9A 1R8AA 4TY8A 2CADA 2V4JA 2CQ2A 4AD6A 2EK6A 1UETA 4RL1A 4JB8B 2UVVA 1K47A 2FHMA 3C6UA 2CVIA 4UOCA 4A8OA 2W9AA 1L3UA 2CQ3A 2B4OA 2KI2A 3H20A 2VG7A 5D3GA 2B4PA 4NA1A 1RT2B 4PPZA 3C2PA 4CLTA 3HVRA 3QT5A 5LOQA 2OP5A 2QA4G 4CO3A 2CNNB 3T9ZA 2F40A 2LQ5A 1WKLA 3CJ4A 3JQMA 4DFPA 3AXKA 3SV4A 1UVIA 2PE8A 2ZHOA 2HHHF 1O51A 2L9NA 3QWUA 1JX4A 4JI3J 5A0YB 2CJ9A 5EDWA 2QN6B 2XGQA 3HSZA 1DHMA 1WG4A 2W25A 2ZUAA 3M8PB 3I87A 3QNWB 1KC8T 1U45A 3UN5A 1OY8A 2V67A 1IJEB 2ZJPQ 1HD0A 2JNJA 1ZA2B 2HMIA 2HYIB 1VBZA 2HBRB 1SB6A 1RA6A 4HHJA 1QAJA 1T7PA 4OYZA 5GAEI 4X64F 5F8JA 2MLZA 1EB0A 5KAKA 4WP8A 2VZ9A 2C3PA 1FJ7A 4OJ3A 2IDEA 2ZBPA 1JXVA 3Q8UA 3RYLA 4DR4J 4JI0F 4DSIA 4Z7CA 2DNOA 1OIAA 2M3DA 2KXNB 1RISA 3ZZ0A 4K0KJ 1S1XA 3QQCD 4PYDA 3BDPA 3OFGA 2H9ZA 4ZJLA 2YX4A 4O0IA 3JTPA 2V8GA 3T3FA 2QSWA 2HRTA 1TMJA 3MAAA 3SSSA 2DCLA 5ETQA 2PSZA 2ASYA 3PFOA 3MPDA 1CSJA 4YP3A 1FE4A 2D7SA 3TAMA 3BSOA 5CD4H 2G2OA 2QLJB 1NZ8A 4CM2A 3H8YA 2EFOA 2NREA 5B0DA 5I3QA 3IM9A 3G9CA 3EGVA 4N76A 2M5YA 2ACYA 5K8OA 4LFBJ 1I5OB 4FVCA 3PX4A 4DOZA 2CQHA 2B4UA 2J7WA 4DX5A 1VBKA 3G96A 4DSLA 4TYBA 2UXDF 1QVGR 2FPHX 3PKYA 1N6QA 3ET6B 3VV2B 3AT1B 3CJ5A 3DLBA 2VQFF 3HJVA 4Z37A 1S9FA 2HNZA 3D68A 2CUYA 2CNKB 1H74A 4PABA 2C2RA 3QYYA 3C14A 2GQQA 3BGRA 3M6VA 3K5OA 1VBYA 1VI7A 2KXFA 4YQWA 2VC1A 5F3TA 3BBCA 4DV1J 3W8PA 1DTQA 1UKUA 2UU9J 1XR5A 1Y00A 1UEUA 3G4SS 3FK4A 2QLBB 1RQ0A 2FY8A 1HI0P 3A3OB 1KLMA 1PBUA 3RGIA 2HLUA 1DBDA 3W60A 1X4CA 4TU7A 3QLHA 5K5MA 4F02A 2XMVA 3W2VA 2OMOA 4N5SA 1UFWA 2KT2A 3CJTA 3HSDA 2RDDA 1VHIA 5E3QA 3LAKA 4KKOA 1KQKA 5B0EA 3VGSA 4P71A 3EZUA 1U1QA 1M5VC 1L3KA 2GNKA 3AY0A 3C19A 2ZE2B 3CDAA 1JLFB 5HMWA 1RZMA 4KIAA 4DFJA 1RJJA 4Q8EA 3NGKA 3LGNA 3DLLQ 2CA9A 2MZTA 1M5OC 2V50A 4XAKA 1R0AB 4LF7J 1K0TA 2XY5A 1LWCA 2FJVA 1LFWA 4PRFA 2OPPA 2BMBA 2BE2A 2LXIA 4DV3J 3CF5Q 4TKTA 3CDUA 4RLEA 2IJRA 3QFWA 3GTYX 2GMLA 2L9DA 3GFXA 3MEGB 4ZVFA 4KE5A 3F41A 4PUOB 4LR7A 1OQ3A 5E7OB 4O44B 3CD0A 3VAFA 1SV5B 5AE1A 1HQEB 2BABA 5JXSA 2ZUGA 3CVKA 4CO5A 3I96A 2V0NA 4MYUA 1MNEA 3Q8YA 1NNDA 4DS5A 3D0GE 2KM8B 3VZIA 3RRKA 1HWJA 1F5CA 2OPQB 2FLNA 1Y11A 3DOKB 4QWEA 1NBEB 1IKXA 2DH8A 4U7UK 2G13A 3DNCA 2EG1A 4ZVOB 1OSCA 5E33A 4KRWA 2CJQA 4RZRA 1BLUA 3C15B 1B0PA 3OTDA 4JI1J 5IOLA 1Y9OA 2VOOA 1YJVA 5HVFA 1HWKA 1RU1A 4L74A 1UZHA 3PM9A 2VQEF 4WU3A 1U8WA 4OMFG 2J7KA 3D6TB 2D9OA 2RJZA 3TI0A 4Q2LA 1S12A 3HVTA 4QR0A 4TY8B 2R7SA 2M52A 4KB7A 3BKTA 4FYXB 3W8GA 5FLXY 1NB2A 1RI7A 1VS3A 2DHSA 2BDPA 3PJXA 1OPIA 2D74B 3TYTA 3K58A 2JVRA 3FCVA 1AFIA 5BYQA 3CCLS 4JV5F 1VMBA 3WC0A 3V81A 4U7UD 1VQ6S 3DLKA 3VGUA 3ZNUA 3ZNJ1 2I5JB 2YPYA 1X5PA 5EWFA 4P10A 2DGOA 3HHEA 3FFIA 3I32A 4OYMA 1UZDA 3J81U 1EHWA 3M6WA 3AQPA 2EVZA 1BUXA 2C3MA 1X4HA 2XC9A 5L9XA 1RUSA 2HZCA 3UN2A 4LIRA 4X4QA 3Q23A 1S1WB 5KT5A 3HSGA 3KJNB 3M6XA 3D28A 4DUYJ 4EMDA 4ZIWA 7FD1A 1AROP 2FJBB 2ZZMA 1R31A 2G9OA 3ZZUA 3BS9A 2AIRB 1RWPB 4OJGA 4LF5J 2FJEB 3TQEA 1U4BA 1XC9A 4IRCA 2BRKA 1HHQA 3GV5B 5AXLA 2DGXA 3MZIA 4K5SA 3A13A 4FPIA 1O8BA 3TAMB 3OV7A 2RIJA 1VIXA 5J1EA 1HBNB 4YEAA 2BJ7A 2RHQB 3T5LA 2M4MA 4QYZK 1UWBA 1H6KX 4ITSA 1RWWB 2MHNA 2HRUA 2JHEA 1LFPA 1KLNA 3RG6A 3B4DA 3H98A 1H2TZ 2IRYA 4NMXA 1HHTP 2G2YA 1TUVA 4QYZJ 4ZVTB 3EX7B 4C8YA 4KHMA 2FGCA 2J8AA 1RP5A 3CJ2A 4AT1B 3D6FB 2JEGA 1U25A 3RJMB 3JB9k 4CLWA 4USIA 3FRYA 2YTCA 2HNZB 4NE9C 4O3PA 2AYGA 2X1GA 1MN7A 4WXWA 4FNIA 2MGZA 2MXYA 3BGRB 3I5CA 3BEGB 1TTHB 1OYDA 1NK6A 4LSLA 1VGYA 2WONB 4YB1P 2AJFE 1RAEB 3MMAA 2XGPA 1DTQB 1WDTA 3SQGB 1QDUB 5AXNA 4OI2A 3EZOA 3GIKA 2HEKA 1KLMB 1T03B 1P1TA 1IBLF 1CJVA 4KV8A 1YRUA 4Y2KA 3QLHB 2RE1A 3GSDA 4F67A 1N5YA 3FKBA 1FDBA 5GAHI 4CO0A 4IFVA 4YOEA 2XCAA 2M9KA 3KLFA 2MQPA 2ZOGA 4TYAA 4DR3F 4L72B 3FCHA 1YQHA 3QSYB 5E2QA 3OL9A 2CQCA 1ZETA 3GJRB 5ETVA 4YMEA 1U0HA 3TA0A 1FFSB 5LSRA 4U67Q 2KN4A 4TU8A 1KONA 4K5RA 3CNQP 1XMQF 2VB6A 1SH0A 1NJZA 2J0XA 5A2QU 1KRPA 4WFZA 1LWCB 4PWDB 5AJ3J 4ILLA 1BWEA 4URQU 3T1YF 1RYSA 2R7UA 2XMAA 1RT7A 1B70B 2NXCA 3WDOA 3DRPA 4ILRA 3R5CA 4MAKA 2POKA 1WNEA 2BR0A 1X4BA 1R89A 3QO9B 2MPUA 1FXRA 4NXNF 3MCOA 1N33F 3VF0B 1ICEB 2XO6A 5GMDA 1H38A 3DYAB 3T19A 4QR2A 4ZK7M 4NCAA 2CQ1A 3AD9C 1CEZA 2WHOA 4F3OA 2I1RA 4DPTA 3HKZD 2ZFHA 1KQGB 1WI6A 2IAJA 4PG7A 2W4DA 1S48A 1IKXB 2V2QA 3KJQB 4USVA 5HQ8A 3VAIA 1T05A 3KOAA 1QAXA 5DQIA 2VASA 4FYWB 3DDKA 3DLHA 4L3NA 2XHWA 4KAIA 3KLIA 4OJ1A 3M4XA 4X4UA 2DD8S 2CNLB 3LOUA 2L9WA 4FS1A 5LXRA 2YNGA 5GADI 4EBDA 2Y3YA 1U0SA 5C25A 1NJWA 3DOMB 1UWAA 2UUAJ 3DOLB 2QL9B 2UUCJ 2YX7A 2B6AA 4A8YA 1HA1A 4MTPA 1N56A 2ZDPA 1NJYA 1JJ4A 2D1CA 2AQ4A 1T9YA 1R7IA 2BKOA 3D2WA 4AL6A 3HVTB 3IG1A 3SMZA 4UY8T 4Q0BA 1NO8A 1RAFB 2JFDA 3NY0A 1JLEA 1P9QC 2FVSA 4Q8FA 1AUSL 1HBOA 1RTZA 2L3MA 3RU0A 5KFZA 1KVKA 3CCZA 1S1VA 3CJ3A 3IRXA 2KZZA 3PFEA 4X66F 3M2RB 3PTWA 2JVOA 1JJHA 1M5SA 2C2NA 3MPYA 4ZPDA 3P8BB 5KG4A 1HI8A 1YJ7A 2YY3A 3RZAA 3MOJB 4GVBB 4IH6A 2WOMB 3E2EA 1F5AA 4K2XA 5F0UA 4J9RA 2H1YA 2J9EA 4CTAA 4JI3F 3CCSS 4FS2A 1YTYA 1TKDA 2NPIA 3PG9A 1FRIA 1N48A 2OMLA 3EM1A 3CCMS 3O1LA 2NYHA 1NHVA 3D66A 1XMBA 1UA1A 2FGOA 5IM0B 3BGOP 3OL7A 1IN0A 1D09B 3OQ2A 3UW1A 1RB0A 5F3ZA 2VPYB 1PGZA 2YNFA 3RB0A 3ELHA 3AB4B 1IKWA 2E1MC 2KYZA 4CO1A 4AQYF 3MEEA 5F8NA 5JMNA 1WELA 2UXCF 3FC9A 3M32A 1ELOA 1PAEX 1RAIB 1HPZA 4ECVA 4DEZA 2CPZA 3AODA 4RU2A 1URNA 5DLFA 2PI4A 1C0UB 2ZM6F 1FF2A 1RAOA 4DR7F 5B7WA 5IQQA 1SBRA 5J1EB 2B9EA 3CD6S 2IA0A 4IR1A 5F41A 2DT9A 2OSQA 4BDPA 1UW9A 5LM7E 3UDCA 2PO4A 1ZYQA 1S9EB 3OL8A 4GC6A 4QU7A 3GB0A 3AJDA 5CABA 1DQAA 1ZZFA 3IGNA 2E1RA 4NL5A 1RA7A 2MKKA 1B99A 2B5JA 2C2EA 3KNAA 1KOHA 3U1NA 1D3WA 5A8KA 5HMYA 1SJFA 2RRAA 4WYLA 1A7GE 1KBRA
chains in the Genus database with same CATH topology
3PRBA 2XWYA 2RF2A 3NMRA 3MI7X 3PIOQ 2AWZA 3G71S 4ELUA 2JH3A 2JRSA 5KFDA 5DDRC 2ZJRQ 2YWFA 1CC7A 4BBYA 5KG5A 2H5EA 4C3KA 4QR1A 4RBVA 1KR4A 3NBPA 3CCUS 2IRXA 4K4TA 3CCTA 2OH2A 2IM2A 4ECQA 4FPRA 2MGZB 2NZ4A 1C0UA 4A8WA 2ZH8A 4ELVA 1M5PC 4M5DB 1TL4A 4DF8A 2B51A 3TUZC 4LSLB 2JC1A 2HFZA 1JKHA 2IC3B 1N5QA 1RTIA 5KFWA 1F5BA 2WW8A 3GFYA 5KG6A 2YQ3A 2OSRA 4ZPBA 2J0SD 3ICLA 3V5RA 2GX8A 2WSEC 4KO0B 2EFGA 2N4DA 2XULA 2B9XA 4B9MA 1K1QA 2YKAA 1S9EA 3O6QA 2HFNA 5DM6Q 1TKZB 3RB3A 1R3NA 2DR5A 3OR2A 2M8HA 4BC7A 4DL0C 4F3QA 2ZH9A 4DF4A 4C97A 1W2BR 4NYPA 2Y1IA 4AXIA 2XZWA 2Y1RI 3OXLA 1U1NA 3R5BA 2MSSA 1MU2B 3TX8A 2DRAA 3MM9B 4RW7A 5D78A 4OI0A 4KV8B 3PZPA 4Y28C 2GHPA 4KT0C 4EBEA 1BC6A 2UU9F 2GC8A 2O3DA 5AJ3F 4J9QA 1FNXH 2KYXA 2RQ4A 4ECTA 2XEXA 1OWXA 2ZOMA 4JI7F 2YKMB 5K8PA 1Q7LB 2JX2A 4K4XA 3OPKA 2DHAA 1X4DA 3K57A 1SQEA 2G4BA 1S6QB 1C1CA 4UQTA 3EUNA 3DHXA 1MROA 3AQOA 3H59A 1PC4A 4JV2A 3K0JA 2VPXB 4IFVB 2HVIA 2JEIA 2MSTA 3Q22A 5E3CA 1YITS 3CEDA 3KLFB 1LK7A 2XS5A 2Y1JA 2E1AA 4Y2IA 4KQZA 4WU2A 3R1LA 2J76E 2N82B 2CJKA 1D9DA 4ZPTR 5GAEU 2VC0A 3SSQA 3THTA 5I3UA 4ED5A 3ZZOA 2MQNA 2YWEA 5DLGA 4WZQA 2PFFB 1JLBB 3MTJA 4LFCF 3KHRA 2A2DA 4QZVB 5KFAA 2YKOA 2CQDA 3G86A 3RBEA 2ZOFA 3NCRA 2W4CA 4USHA 5J1NA 3T6JA 3T5KA 3HFKA 2R7TA 4OHXA 4LSNA 3LWLA 2Q6CA 2CG4A 2DH9A 2HQ3A 2V4RA 1IQZA 4RW6B 2KU7A 2HNDB 4HLBA 4M5DA 3RAMA 5KFFA 2RU3A 1RT6A 2YH1A 3MM8B 4URGA 3KG0A 2J0WA 1WF0A 3E3XA 2R7RA 1BD6A 4H4KC 3HI9A 3LP1B 4DX8H 1ZM3A 3B4MA 4YY3F 4XPCA 3GIMA 1S0NA 4CH7A 2CYYA 2VPWB 2W8KA 2DNNA 5E41A 5A0YA 3PX0A 1HR0F 4EFAC 1PO6A 1DFDA 2R2RA 4KO0A 1UVLA 3UDLA 3R27A 3KMQA 3BO2A 4Y2CA 1XERA 4YUDA 2KT3A 2L08A 3OXGA 5KT3A 4V19X 1TKZA 3OVSA 5H9FJ 2WSFC 5LMNF 2NSBA 3O3LA 1LWEB 1UP1A 2AJ4A 3I31A 2VBXA 5EWEA 4ETZA 4C0HA 1GTEA 2M8DB 4YR0A 4K59A 4IR9A 3G6ES 2V8VA 5KFSA 3FRZA 3UI3A 2XLIA 3WZ0A 1W25A 1RT7B 3FZ2A 4FF4A 4JI5F 4BWMA 2R7OA 3VTIA 5I42B 5HL7Q 4DL5A 4C8LA 4HI2A 3RRHA 5A6WA 2E5HA 2YKMA 3KG1A 3DRPB 4OZNA 2GA7A 4ECUA 5CZVA 2RB7A 1S6QA 2AW0A 3HHLD 2U2FA 2X1AA 2E66A 1LQ9A 1DLOB 2I9SA 2B9YA 3N9UC 2WBMA 4FF2A 1FRJA 3VAKA 4LF9F 4PQUB 2O66A 4X2BA 2W24A 3OSNA 2R8HA 1VQMS 4XK8C 1T3OA 2UP1A 4TY9A 4HTJA 4WK3A 1FKOA 3HF5A 4ECXA 3PVXA 1OQ6A 5L39A 3BGLA 4M63A 4TU9A 1J5OB 2CPXA 3OXFA 2SXLA 4FF3A 2GMJA 1R6YA 4O3RA 2MHEA 3Q8RB 1N8RT 3MPWA 3SXLA 6FD1A 3HLUA 1NK9A 1QE1B 4DL3A 2R7QA 2M0GB 5GAHU 1Y5LB 1S99A 4HKQA 5L8RC 2UUAF 4WE1B 4OZ5A 2HNDA 2UUCF 2DTJA 4NLWA 3J80Y 4B3TF 4ELTA 3OTOF 4BS2A 2KDOA 2ZDOA 3B78A 3MM8A 4B02A 2HPUA 5KFJA 2IAJB 5CQGA 2O1PA 3LP1A 3J7Z5 4DS4A 4ID8A 5F8GA 2B7BB 4YFUA 2EG2A 1L3VA 3IR5B 4HDGA 5DDPC 2DNPA 1SIWB 2NSCA 2ROPA 3UNGC 1W2IA 3DLJA 2F8MA 4DR6F 3CDBA 3PJWA 3R3TA 3SI8A 1T05B 2FY1A 3ISNC 4RUCA 1K1SA 2AU0A 1JLCB 3V6KA 2E9ZA 1F0XA 3OTBA 1Q8BA 2EC0A 2Y0SD 1LWEA 1N36F 3W2WB 4X4RA 3HZGA 3V6DB 2DR9A 2XS7A 4F26A 4Q44A 2BXJA 1RYRA 4WKRA 2QFJA 4WFNQ 1IKYB 2E5LF 3IO1A 4NA2A 3KLGB 3KJVA 2LMIA 1DRZA 5KFPA 5I42A 2RNEA 4EWTA 3PX6A 1TVRB 1VQOS 2APOA 4NPOA 1ZAVA 3KNGA 1N88A 1NHUA 1Y0HA 2NPFA 1RKIA 1N0UA 2Q3PA 4IO1A 2AYBA 3L95X 4B9LA 4TNOA 4XIUA 4KHRA 1KS2A 3A1YG 2D3OR 2DB1A 2DK2A 5C25B 1DLOA 5IWAF 4Y3CA 2FTRA 4OQJA 3PW5A 1U2RA 1SKRA 3CC7S 1IQTA 4N41A 4OZLA 4PQUA 1GTHA 3HM9A 2K3KA 4IG3B 1SL0A 1KHVA 2QIFA 4FBTA 5DG8A 4IFYA 1KVIA 1RTJB 4LF6F 3F56A 3MMBA 2KJWA 4I2QB 3H25A 5J2QB 1DZ5A 1LW2B 2X3GA 3DCAA 2XS2A 2MB0B 1FA0A 3IG1B 4G6VB 4R0JA 1NB7A 2DCUB 2NQPA 3LO3A 4F3MA 3GR0A 5DG7A 4ED2A 1SC6A 2KFNA 1E6VA 4KPYA 4ZVEA 1C2PA 3CMAS 3S1TA 3K8VA 1SJQA 3TVYA 1WF1A 2CQ0A 2IVFB 1TL3B 3NCPA 2FHJA 5T7LB 4P2SA 3Q2TC 3KYLA 2IJFA 3MURP 2FDNA 5F0WA 3PR5B 1U1RA 5KOWA 1IUJA 2ADBA 4G1QB 3VALA 2E5GA 3NS6A 1OSDA 4JV0A 5B08A 3KK1B 3DI6B 1NJIT 3H4BA 4PPDA 3TA2A 4PWUA 2V2KA 1VQKS 2QLXA 1JLCA 3WBZA 4B9SA 2J6UA 2L48A 2BQ3A 1S1VB 1IR0A 2YKPA 4RNNA 4QW9A 3RTVA 2QRRA 2HAIA 4PKDB 1HNIB 2BJDA 2WB4A 2ZH7A 5J2MB 1S76D 2HQIA 3V6DA 2ZC3A 1KQFB 3HKWA 4W92B 1NK7A 1F60B 3OTCA 2IM3A 2DRBA 1REVB 1R8HA 2BA9A 1IKYA 1U49A 2RILA 3NNAA 5GAGI 3KLGA 1FKAF 3C66A 2XMMA 2ILYA 2G0CA 4HEA9 3UFCX 3VZHA 3MFHA 2OKQA 1V9OA 2K2PA 2HHXA 2LEAA 4FN5A 3UCGA 4DPOA 2GIQA 4WFXA 4QYRA 4IDKA 1TL1B 2LLZA 1LXNA 1VC6A 2UVUA 2DO4A 2MZQA 3DLEB 4E0DA 1SKSA 3C3LA 2ZNYA 4WXOA 2MYFA 5F8IA 2DHGA 3P96A 5E3PA 4DJBA 2KG1A 2VL1A 1QLNA 1LK5A 4CZCA 2R8GA 2FJXA 1URRA 2XMKA 4IG3A 5EX3A 2E5JA 4R8UA 1RDRA 7FDRA 1FD8A 4DMZA 1DQ9A 3EXYA 3HVWA 5T41A 1ZH5A 2GFFA 3DRRA 4CTAB 1SUQB 2HWTA 1NKEA 4NZ6A 2Q66A 2ASJA 1YVFA 2LEPA 1FHTA 2AJ0A 4KGKA 4E98A 1T3NA 4O4GB 3SFUA 3RB6A 3U02A 2VKZG 1DTTB 2GQCA 1XTZA 3VCDA 4R25A 2WCXA 5KG7A 3OSPA 1GXLA 2J7UA 2HLTA 3CULA 4JI6F 5F8MA 5C24A 5H9EJ 1IXKA 1YSJA 1SJ1A 2D3ZA 2K3IA 3EGNA 4YB7A 5T7LA 2VG5B 3D1OA 5EHHA 2GGPA 3OHBA 4A8XA 1H98A 4TQRA 4J9MA 4DV6F 2ZE2A 4C8ZA 1Q8IA 5C42B 2ROEA 3BR8A 3I5AA 4G1QA 1EP4B 2NUHA 2QO3A 5E3AA 4EZ9A 4O3SA 1M5KC 4LMZA 3K5LA 1MMDA 3KK1A 2KTQA 2E44A 3DI6A 3DU5A 3GMGA 5J2NB 3KK3A 3F73A 2DIVA 2HNYB 3ETOA 3DMJB 2DNLA 4MIAA 1D8ZA 1N5SA 4OLOA 4ZP7A 3EPGA 2PDAA 3QGGA 4EBCA 2YX1A 1FJCA 5GVQA 3L3CA 2CQBA 3JYTA 1MSWD 4UY85 4ZVGA 2OPSB 1U1LA 1R0AA 2HHQA 3N5FA 2QMXA 1REVA 3QIDA 2AX0A 1KSPA 2RD5C 2EW9A 4OL8A 5KFNA 1L3SA 1RT5A 1MWYA 2B43A 2P6TA 2Q6BA 2IA6A 1V3RA 3M32B 4DUYF 1ZOTA 1JLAB 1JLGA 1S0OA 4O3QA 4CH0S 4DL6A 3MF5A 3I0RB 2LKZA 3FSYA 4DQRA 1FRXA 1K0VA 4ZS6A 3OR1B 2JSXA 2VBZA 2CQIA 3DLEA 1YHQS 1IBKF 1RT4B 4EEYA 3DRSB 4D3GA 1BQNB 1X4EA 1YJRA 4KBIA 3QJLA 2FIUA 2X51A 2MQOA 1LWFB 1VQ9S 3JTNA 3ENVA 3MEGA 4PG8A 3BSCA 4CI0B 2CJAA 2EFVA 1BQMB 2I8EA 3GYXB 3POTB 3PXGa 3H40A 2XI2A 3ZZZA 3TR5A 2K7KA 3ZZRA 2V9WA 1Y3KA 3CCQS 2KRBA 4QJVA 2LA6A 1X4FA 3AJ2A 1FRLA 1SUQA 2WAQD 1A6LA 3THPA 3HVAA 3OFEA 1XBWA 1L5UA 4O4GA 3CXCR 4NLDA 3UE2A 3QGHA 1AFJA 1AXQA 4C11A 1ZPWX 4IOCQ 3E01B 1HQEA 3HHLC 4YHHF 4USJC 4QIEA 1HARA 4LFAF 2PIIA 2QMWA 1RWUA 3B82A 1SJ3P 3MMCA 4Q7AA 2BM0A 4F4ZA 4ED6A 3CE8A 5KFKA 4ZLPA 5B0GA 1IM4A 5C42A 1B7FA 1FRMA 5IQ6A 1YG0A 4UUXA 5ITHA 3K8WA 3O8WA 2QT7A 2KT5A 3N6LA 5KT6A 4IRKA 1N34F 2V4JB 2VG6B 3PEHA 2HNYA 1VOMA 1YBAA 3NAHA 1N0VC 2VUGA 2DGSA 3Q8SB 1FVQA 2AYEA 1HNVA 2B9WA 1WI8A 2A1BA 2BBEA 3I5BA 5E3RA 2ZH5A 3RR7A 3MWBA 3PKMA 4Q5VA 1XR7A 2DNHA 3PNIA 5THWA 2OJ3A 4YB6A 5HMXA 4KSEB 2OPSA 4NMLA 4DG1B 2KXHA 3IWLA 2N3LA 3BM7A 4IG0B 5KFEA 2YWKA 2XBPA 5CYJA 3X1LB 3VAMA 2B5JB 3C6UB 5A6PA 2XCPA 2CZ4A 1FD2A 4ZCLA 3DXBA 4RKUC 2LQBA 4ZCMA 3OW2R 5A8WB 2BVZA 1H7WA 3TO8A 1FKPB 2OD4A 2VG7B 5D3GB 4CT9A 1JLAA 1K73T 4HH0A 2BYCA 3I0RA 2GO8A 4RNMA 5IS2A 3BO3A 3FDSA 2C3OA 4XPEA 4DL7A 2RF2B 3ISND 4DN0A 3OR1A 1CC8A 2IFXA 4PG5A 1ZM9A 2F9JA 1RT4A 2QSFA 2V94A 3DRYA 3DRSA 4FNHA 4NLRA 4DQSA 2IJNA 1P6TA 1BQNA 2MZSA 1LWFA 1TV6A 2OFHX 4ZPWR 4A8SA 1G6BA 2CPYA 5MLCV 2R7VA 3POTA 4O23A 4F2SA 3H2VE 4P6QA 4Q2MA 2GJ2A 3JTOA 1GAOA 3I0SA 5F8LA 2MJUA 2RMLA 4TLQA 5CYQB 3JAMY 1T94A 1WHVA 3IR7B 4LT6A 1RTIB 1FDDA 2PN6A 1LKZA 2EFQA 4CNYA 2GO9A 3G6VA 1ZAWA 3QGIA 3MM6A 3V4MA 2MZRA 1G7CB 4DQQA 3BN4A 2BANB 2XG8A 3THVA 2HHUA 1WACA 3GYNA 2K1RB 2C28A 4EUVA 1R8PA 1E6YA 3OR2B 2QZ8A 3SFGA 4LQ9A 1I6JA 4GO5X 3GIJA 3GFZA 5KFLA 2PGCA 4BC9A 4RW7B 1R8AA 4HL9A 4TY8A 2KZMA 1ZTTA 2B7CB 2D41A 2ZVSA 2V4JA 2CQ2A 2EK6A 2ZBCA 2I38A 3CB4A 2KRRA 1UETA 3UD4P 4ECZA 2UVRA 2HMIB 3DC2A 5KFUA 2UVVA 2FHMA 1MROB 3C6UA 2FVCA 2CVIA 4UOCA 4A8OA 4AFFA 2W9AA 4NRTA 1L3UA 2CQ3A 2B4OA 1K9MT 4I6YA 2KI2A 3H20A 5A8WA 1FKPA 2KM8C 2VG7A 5D3GA 2B4PA 3NNHA 4NA1A 1RT2B 1WTFA 4PPZA 4ED3A 3O44A 3QIPB 3C2PA 4M94A 1WHWA 1A9NB 1WD6A 1Y5NB 3HVRA 4OV1A 1N32F 3V2UC 2FUG9 2OP5A 4C2MA 2QA4G 4CO3A 4IO9Q 1FTCA 2HGLA 3T9ZA 1WG5A 4DN9A 2F40A 3BQ1A 2LQ5A 5K14B 1SH2A 3CJ4A 4N8NA 3H4DA 4FXWA 3SCJE 4K4VA 1Q86T 4RNFA 3DRXA 3LH2S 2A3JA 4LSNB 1S1XB 2X1BA 4DFPA 5C5JA 1SKWA 3N6NA 1FRKA 2HS0A 2PC6A 3SV4A 1QSLA 1UVIA 1RT6B 4MIWA 5CYQA 1VQYA 2YNHB 1N5VA 1FO1A 2PE8A 1S0VA 2ZHOA 4U6PA 1H2UX 2HHHF 3NWGA 1O51A 5DETA 2L9NA 4ZVHA 1JWWA 1DJ0A 3QWUA 1JX4A 5A0YB 2CJ9A 3RW7A 5EDWA 2KFYA 1FNOA 2XGQA 2BANA 1H3DA 1DHMA 4OLPA 5G4DA 1WG4A 2W25A 5HBMB 2K1RA 4EGLA 2DBBA 4J9PA 1IBMF