3VAKA

Structure of u2af65 variant with bru5 dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
total genus 42
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vakA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vakA02
4FXWA 2MQOA 5EN1A 2CQ0A 3BO2A 1U1PA 3NS6A 1FJCA 2OTLS 1WHYA 1OPIA 1K73T 3DXBA 1X4AA 2CQ4A 3U1MA 1X4CA 1HD0A 1X5TA 2YTCA 4IOCQ 2YWKA 1FJEB 1H2TZ 1VQ6S 2DHXA 2L9WA 1WEZA 3ZZYA 4PKDB 2MQPA 4W92B 1X4GA 2M70A 2VONA 2KN4A 2HGLA 3G71S 2M52A 2MKIA 2L41A 3EGZA 2CQ1A 1VQKS 2HGNA 4IO9Q 2OIHA 1X4DA 3LPYA 1WF1A 5DDRC 4A8XA 2QEXS 2LYVA 1XN9A 3CCMS 1QVFR 2F3JA 3LQVA 2WBRA 1X5PA 4C7QA 1YI2S 3CCLS 3MXHP 2MYFA 1DHMA 2LA4A 3UCGA 2CPDA 1VBXA 2EK6A 3Q2SC 2ADCA 1SJ4P 1HL6A 1YJWS 1VBZA 2AYGA 4UY8T 2CPEA 3MUMP 2HZCA 3VAMA 3CMES 3BO3A 1VQOS 2AYBA 2A3JA 2VOPA 1SJRA 5LJ3Y 4CH0S 3SMZA 1WWHA 1DZ5A 5CXTA 1WF2A 3UD4P 2ZJQQ 2MZRA 2GO9A 3UWTA 4IOAQ 4CQ1A 2M9KA 1PGZA 2DGUA 3R27A 1N88A 2M88A 3J7ZT 1WTBA 3G8TA 5D78A 3VF0B 2DNMA 2CPXA 1QVGR 3TO8A 2N3LA 3UE2A 5IFMA 1UW4A 1L3KA 2DGTA 2FPHX 2K8GA 4WFAQ 5JVGQ 3R1LA 3MOJB 1PO6A 1NJIT 4F25A 2MXYA 1U6BA 1H2UX 5HL7Q 2DGXA 1VC6A 1A9NB 2KM8C 2QA4S 2M4MA 2E5GA 3THPA 2DGOA 2MPUA 2DNGA 3S6EA 1SJFA 3H2VE 2E44A 2MY8A 2DNLA 2HYIB 3PIPQ 2EK1A 1FO1A 2JX2A 2CPJA 2ADBA 2YH0A 5DM6Q 2CPHA 2MGZB 2M8DB 1OWXA 1RKJA 2YH1A 4W90B 1WI6A 4V19X 2RT3A 3ZZZA 1UP1A 4J5OA 1FT8A 2HVZA 2BZ2A 1X5SA 5H1SV 3VAFA 1X4FA 3EGNA 2ZJRQ 3V4MA 4TLQA 1Q82T 2FHOB 2MZSA 2F9JA 2MZJA 3RW7A 4FXVA 3VAKA 1QM9A 3Q2TC 4C4WA 2DGVA 2KT5A 3NS5A 1K9MT 3OW2R 2N3OA 3CUNA 1N54B 2DIUA 3PIOQ 1SJ3P 1YJNS 2RS8A 1WG5A 3MD1A 1VBYA 1KOOA 5LXRA 4P6QA 2RUGA 2DISA 3JB9k 2RVJA 3CTRA 4WFBQ 1KC8T 2DNKA 3U1LA 2KHCA 1YHQS 1DRZA 4WF9Q 1A7GE 3G4SS 2CQCA 1U1NA 2VODA 1WEYA 5LXYA 2FC8A 1WHXA 1AUDA 2DO4A 3S01A 4ZKAA 4TU9A 1ZZNA 3CCVS 1YIJS 1YWXA 3HHNB 3G96A 1H2VZ 2CQ3A 2SXLA 1P27B 2F9DA 1VQ9S 3MUTP 2XS7A 3NMRA 1R8PA 3VALA 1FXLA 1K8AT 2CPYA 2BOPA 2DGWA 2J8AA 2MZQA 3CCUS 2I38A 5GADU 5MLCV 4WFNQ 1VQLS 2OJ3A 3N9UC 1WHVA 3ULHA 5DDPC 1RK8A 4RU2A 1M90T 2JWNA 2DNHA 2RQ4A 3S7RA 2MGZA 3TYTA 2JRSA 4Y00A 1SJQA 1X4HA 2DNQA 4TU8A 2LEAA 3UCZP 2ZJPQ 1HD1A 2N7CA 1ZH5A 2AYMA 2MMYA 3K0JA 2U2FA 1D9AA 1U6FA 4WCEQ 1VQ7S 1CVJA 1S79A 2CJKA 3CPWR 2CQBA 1U1RA 4QQBA 1M5VC 1G2EA 2L08A 5GMKa 2DNRA 1JMTA 3MD3A 1B7FA 2MHNA 3CCES 2G0CA 4YB1P 2FC9A 2LKZA 2DIVA 2XSFA 2E5IA 4Z2XA 3BEGB 5LJ5Y 2M8HA 4U67Q 2DNZA 2EVZA 2AYEA 2KH9A 3MUVP 1U1OA 4C0OC 2D9PA 1N52B 2HGMA 2MY7A 2DNPA 4YUDA 5DM7Q 1VC5A 1M1KT 1WG1A 2ERRA 4TU7A 1O0PA 3L3CA 1KQSR 1S72S 5CA5A 2X1GA 5BJRA 3BO4A 1UAWA 3CD6S 1WF0A 3FEYB 3DLLQ 5HO4A 3SDEA 4QU7A 1FNXH 1OIAA 2RRBA 4PR6A 1D8ZA 3H2UB 2FY1A 2Q79A 1DBDA 2MQMA 2UP1A 3R1HA 2MKCA 5GAEU 2DHGA 1ZZFA 5GVQA 4QU6A 2DH7A 3CC4S 2CQPA 1WG4A 4UQTA 2YKAA 2DO0A 2AD9A 4OZ1A 2X1AA 5LSOA 4BS2A 2KVIA 2KM8B 2MSSA 2J0SD 2DB1A 3EX7B 1NU4A 2N82B 5IM0A 2DNOA 1FJ7A 2LA6A 2MZTA 5DETA 2DH8A 3B4DA 1JJHA 1HA1A 3J7YU 4LIRA 1URNA 4YOEA 1KD1T 1YTYA 3VAIA 1BY9A 2G4BA 5ITHA 1M5KC 2LECA 2XNQA 2OTJS 1U1KA 2RRAA 2RS2A 4EGLA 4F26A 1H6KX 3CF5Q 5D77A 4LMZA 3THTA 2MKHA 3CC2S 2LMIA 2KU7A 4WKRA 2D9OA 3SDEB 2KFYA 2MKKA 3IRWP 1WEXA 2B0GA 2DGSA 3CXCR 2CPIA 3P5TL 2CQGA 2XS2A 2QFJA 1VC0A 2KG1A 1JJ2R 3CCJS 3VAGA 3TP2A 2DHSA 4OZ0A 1VQ8S 2KRRA 2RQCA 2JVRA 2G1DA 1KOHA 1U1LA 2KRBA 5GAHU 2DNNA 2MKJA 3G8SA 2CQ2A 5IQQA 2X1FA 3NNAA 2KXHA 3BS9A 1VQPS 1U1MA 5CYJA 1VQ4S 3CCRS 2DNYA 4M5DB 1W2BR 2M2BA 1Q81T 2MB0B 3MDFA 5IM0B 1IQTA 1X4BA 2RNEA 4PRFA 1VQ5S 1X0FA 1Q7YT 1SXLA 5FJ4A 4IUFA 1U1QA 2J76E 2DH9A 2DGQA 2OSRA 2LQ5A 1X5OA 2GHPA 3I56S 2KG0A 1WI8A 5DDOC 2JVOA 1WELA 2I2YA 1YITS 2CPZA 1P1TA 4CIOA 2OSQA 2KI2A 3NNHA 1M5PC 3CULA 2CQDA 1YJ9S 3CC7S 2MJUA 3B4MA 1VQMS 2XNRA 3UD3P 1R8HA 4ERDA 2DK2A 2J0QD 1OO0B 2M7SA 2NLWA 3MURP 3P49B 3CCQS 1M5OC 2DITA 2XS5A 2MKSA 2MQNA 2U1AA 1X4EA 2MZ1A 1F9FA 2XB2D 3HI9A 2KXNB 4ED5A 3MI7X 1UFWA 3UCUP 2D3OR 2MSTA 1VQNS 2E5JA 3G9CA 1NO8A 2KYXA 3FEXB 4CH1A 2LXIA 3SXLA 2CQIA 3VAHA 2RU3A 2X1BA 2MQLA 5JVHQ 1FHTA 2V94A 1JJ4A 4LJMA 1WHWA 2PEHA 2O3DA 2CPFA 2M0GB 2MJNA 3VAJA 4Y0FA 2NZ4A 3P3DA 3CCSS 5GAGU 2MQQA 2LCWA 2PE8A 2CQHA 4WIIA 3RW6A 3D2WA 1N8RT 2LEBA 2KXFA 4QPTA 3I55S 2VOOA 3S8SA 1Q86T 2LXUA 3P6YC 5DDQC 1U2FA 2E5HA 5LSLA 2K3KA 3US5A 3G6ES 3NNCA 2DHAA 3IWNC 3CMAS 4F02A
chains in the Genus database with same CATH superfamily
4DSIA 2ZE2A 3MM8A 3CJ5A 1YVFA 1Q0NA 2KB2A 1QUPA 1PCAA 3M6WA 5B0AA 4EEYA 2QMXA 4IOCQ 2B5JB 1JLQB 3EXCX 2MQPA 4W92B 4AL7A 1TMJA 3M2RA 3PDNA 1DFDA 2D3O1 5DQIA 3MCOA 3O6QA 2W7OA 2VZ9A 3TOQA 3RBXA 1X60A 3ZTQA 2ILYA 2Z2ZA 2EKYA 4LSZB 4HHUA 1F9HA 1SV5B 2CPEA 2ZZTA 5KG0A 3BQ0A 3QAUA 4C3LA 4ZIWA 3SMZA 1RHKB 4WZQA 2GO9A 4DN9A 4I7FA 2RHQB 2HHHF 5ETMA 4LREA 4NA3A 3TRGA 3WQPA 4B3SJ 2ZITA 3DMJA 3R1LA 1S4EA 4P9SA 3AXMA 3QFWA 1H2UX 5HL7Q 3BBBA 3DGVA 4RW9A 1YQHA 5I3UB 1EETB 3BGRA 4U7CA 4A48A 1RT6B 2V8PA 2KFZA 2M8DB 4GO5X 3ZTSA 4HT5A 3EJMA 3MECB 2DY9A 4I2PB 5CAAA 1EX8A 3LWMA 4Y2CA 4UZCA 1HNVA 1VRTB 1KOOA 4DN0A 2ZH6A 1HMVA 2RUGA 2FJVA 5HROB 3EICA 2AEMA 3CO0P 5LXYA 2FY8A 2RHSB 1NJXA 1KS2A 4I0WA 3HSDA 1PC4A 2SXLA 2ASYA 2IFXA 2BQUA 1Y0HA 4DL3A 3I0RA 4LRCA 2ROGA 1JLAB 4LUBA 4OI1A 3LANA 5DQGA 1U02A 4OX6A 4C11B 2HQ3A 4ZCMA 1U6ZA 4K2XA 3GIJA 3RAQA 4FYYB 3C6TB 3JQJA 4P2XA 1M90T 1HNXJ 1LKZA 3IFEA 4DR3F 4N7TA 1PIEA 3GFXA 2FHMA 2A0FB 1ZH5A 1Y5NB 3QPIA 4PG6A 1RT1A 1SH2A 1S79A 3CPWR 4LRFA 1URRA 3R5GA 1JLEA 3CCES 2NYHA 3J7Z5 5D8HB 3RRHA 5KT2A 5D0EA 4OX7A 3H40A 3NCRA 3ZTOA 3UN5A 3OFHA 4Q45A 1GFWB 1LXJA 3PACA 1GX6A 4M1KA 4N8NA 2QTWA 4QU7A 4O23A 2HLUA 4F2SA 3R1HA 2MKCA 5L8RC 3GILA 1ZAXA 4KB7A 2IM0A 4LSLA 1VCTA 4IH7A 2DB1A 3EX7B 4YN3B 3PX4A 2W2MP 2Z0GA 3OR2A 2E9ZA 3MEGB 5DJBA 3F0NA 3Q86A 2KO1A 1RHJB 3MOZA 3TAMB 3NCQA 5E3PA 4F3MA 2MKHA 4NLTA 4LF5F 4W4MA 3EM1A 4YDDB 1EP4B 5M2UA 4WBFA 5HVGA 1JLBA 1I94F 3G8SA 2BVZA 2HK2A 2EFOA 3R5BA 5E3AA 2W7PA 4LVOP 2A1BA 1XC9A 2IVYA 4KY3A 4DV4J 1OPZA 4LF2A 5ETVA 1OMSA 4GMKA 1IM6A 3PHEA 3J81Y 1RTHA 4K2JA 2GHWA 3O3LA 2LQ9A 4MKVA 3EVMA 1TTHB 2XYPB 3QRPA 2E1AA 5HLFB 5B0FA 3ZO7A 2HMIA 3NY0A 4F67A 2JHEA 2NXJA 1X4EA 5IQ6A 3W8PA 4C9DA 2PO4A 4ED5A 2R7QA 1HI1A 1UFWA 1B4SA 2ZH5A 1Y00A 3AOCA 2CQIA 2RU3A 4DU7A 1HQEA 3NOGA 4J9PA 4IR1A 2MJNA 4A8OA 4WIQA 2GA7A 4HL9A 2KXFA 3I55S 1HBUB 2VC1A 2NCKL 2WB4A 3NNCA 2VA3A 3W66A 4ZP7A 1HHSA 3O8WA 3MM5A 1SVDA 1X5TA 4P74A 3SSQA 2PD1A 5H9EK 2P9EA 1AA1B 4DV1J 1V5IB 2GQ2A 1NK7A 4WE1B 2F8EX 3CD0A 1NKCA 1RT2A 2FLNA 4IKAA 4JV5J 2CNLB 1XN9A 1OYDA 3KJNB 3UDVA 2XY6A 2X3GA 1L3SA 4C7QA 2IRYA 3C66A 3Q2SC 1AYEA 4H4MB 1TELA 4FBUA 2AYGA 1OYEA 4PYAA 4JYAJ 2ZDPA 2IM1A 1ZM9A 3ET6B 1RBOB 1OJ4A 4L6V3 1J5OB 2DGUA 4OFZA 3LF0A 3R5AA 2DNMA 3D6HB 4DPOA 2D69A 2VIHA 3TUZC 3KJQB 4LF9J 3OL9A 5C24A 4H4KA 1Y3JA 2XZDB 1X7VA 2E5GA 4P2FA 1TQLA 2GAHC 2YNHA 4TKTA 1KN6A 2G1HA 4RLEA 3LP0A 4UUWA 1H7XA 1WI6A 1MLAA 2R7VA 1RU1A 3AH6A 5E3CA 3B78A 1UKUA 3VAKA 3GU0A 4LFBF 1K9MT 1VYAA 2EBEA 1YJNS 2AJ0A 5K8NA 2AKWB 5K8MA 2VD3A 3BN7A 2XO6A 3LOUA 4ZJQA 1WHXA 2XSJA 3S01A 2PMWA 3ITHA 4ZKAA 2K1RB 3IAM9 1YIJS 2DBBA 3CIZA 5ETQA 3QRQA 4ZVFA 1NSQA 1T0TV 1JJCB 4QIFA 2HFUA 4UT4A 2XMAA 3UPFA 5J2QA 2JWNA 3TYTA 2J9EA 3IM9A 4R0JA 1FRLA 2MHEA 4QCLA 2ZH2A 2ZUGA 4J9SA 1YLXA 2YPZA 3FZBA 3QT6A 4KHPF 2QJ3A 5AXNA 3UW1A 3D5MA 3OD2A 4QQBA 1HPZB 4DCJB 3DLGA 1FKPA 1C0TA 3LH2S 5DS7A 4A8FA 4NASA 2HNZA 3IA0A 5DZ7A 4CT8A 1ZA2B 4RR5A 3HK2A 1CJTB 3CDEA 2MY7A 3PR4A 2XMJA 2ZOFA 2B8QA 2WOMB 1B70B 3UNGC 5EX0A 4YMEA 4F4YA 3C16A 3SDEA 3FBCA 3Q8UA 4USWA 1RAFB 3KK3A 1TK0A 3CC4S 3BDEA 4LRDA 1FESA 3GWCA 4WP3A 2B8PA 1C0UA 2HWIA 5L9XA 5JXSA 2BJ3A 2KVIA 2J6SA 2HFVA 1LV5A 3I5CA 3PO4A 4FF3A 4X84A 3KK1A 3GSIA 5E7OB 1SKSA 1SC3B 3TJAA 2YVSA 2IYIA 3PRVA 5KG7A 5IV4A 3I96A 3RRKA 1PJ5A 1U1KA 2RRAA 2W9BB 1RWWB 2C3MA 1QJHA 4OI3A 2W8LA 3N79A 1FDNA 3R97A 4B3RJ 1Q8LA 1U48A 3P5TL 3DLKB 2XS2A 1VC0A 4KH1B 4I56A 4MFBB 2ZDOA 1SPBP 1KOHA 2BABA 2H51B 2C2RA 3NL0A 2CQ2A 5HN0A 2DNYA 3VR1A 3C6UA 3DM2A 3KK2B 3MDFA 1RWXB 3CJKA 2IBOA 1X4BA 1MROB 4DV3F 4IUFA 3M6UA 4J9MA 4KGZB 4ICLA 3WDOA 1XBWA 4C8ZA 3DOLB 4FPIA 3M2VA 5F8IA 2HRUA 4JI5F 1RT4B 3PXGa 3KJVA 4MKAA 3PEJA 3QMQA 2GVDA 1DTQB 4ZA1A 4CP5A 1BWVA 3UD3P 4D3GA 2P6TA 3P49B 1S6QA 1HR0F 2U1AA 4MH8A 2WB1D 1H7WA 2OELA 4B02A 3IC1A 4NLQA 5IC6B 3I0SA 3RAXA 3LAKA 3DRPB 1NK8A 1UW9A 1Q4RA 2A10A 1TAQA 4DI6A 4I67A 2PE8A 3DDNA 2VG6B 1FCAA 2DHAA 1TK8A 1S1XA 5K8OA 2RE1A 5HI7A 3DI6A 3N6LA 5C7PA 1S7IA 5A0YB 1GAOA 5D4OA 5A76A 2Z8QA 2HRYA 3CDUA 2XCAA 4ZK7M 1T9YA 2CZVC 2VONA 1NNDA 2WHOA 2UUAJ 2MKIA 1EB0A 1X4DA 3GG0A 3GMGA 4RX6A 2NQPA 3CCLS 2GMJA 1YRTA 1OY6A 3KDOA 2ADCA 2ZOMA 4DUZF 3ILIA 1QE1B 1N6QA 3C14A 4M95A 2A3JA 2CJQA 5KOXA 3MMCA 3M30B 2BJ1A 3ZC4A 4YB5A 4K59A 4K5SA 2C2OB 4ZJOA 4YB7A 5D0GA 3WZ0A 1HYSB 4ED2A 1YRUA 2F63A 2B5JA 1JLQA 3MTJA 2DGXA 1N5VA 1NCLA 3K17A 2DPJA 3THPA 3GIMA 3BREA 4DPUA 3H2VE 3M8PB 3OXLA 4PQUA 2ALYB 4X4PA 3TEGA 1FRKA 1FT8A 1X5SA 1XQIA 3KLFA 4DSEA 4OJGA 1RCOB 4G1QB 2A18A 1SV5A 4C2MA 5E5NA 4Y34A 2RS8A 2ATLA 5C25B 5AJ3J 2ZKTA 3CTRA 2BXJA 3PJ9A 3TVKA 1D9FA 4NZ7A 4KV8B 3KLIA 5DG7A 2B6AA 3QJPA 3SIPB 2YWEA 2Y9HA 5KFDA 1U2CA 2F9DA 3LW5C 1SL0A 1DURA 4EUVA 4B3SF 3CCUS 1MSWD 4H4OB 1F2GA 5L1LA 3OQ2A 1WHVA 1EETA 2IPOB 3BYRA 1RT6A 3PM9A 4URSA 3W7BA 3K57A 3MECA 2LEAA 3UCZP 4U8YA 2AYMA 1SH3A 1AB8A 1NH7A 3IM8A 4ED6A 2K7JA 2BJ9A 1MWZA 2W8KA 4C8KA 3T1HJ 1B0TA 1VRTA 1R8AA 1K1QA 1JXEA 4YB1P 3V6DB 5HROA 1H0HB 3HSZA 1TV6B 2PC6A 4HVZA 4ZS6A 1N52B 1VC5A 8ATCB 4K5RA 3R5DA 5L1JA 4MYUA 3L3CA 3JQMA 2A6OA 1JLAA 1R43A 4DQIA 4C11A 2I6WA 1FJGJ 3OFEA 2DRAA 3LGHA 2ZM6J 5CCMA 2FY1A 4N76A 2JLFA 4NI2B 3C6TA 2H3EB 4LF6J 1NZAA 3AY0A 2AD9A 4O44A 4FF4A 1HNXF 3PNIA 3F41A 2JOQA 3HDSA 3KG1A 5L39A 1RYSA 1TU0B 2LLZA 4WFZA 1S1UB 1VJQA 2OH2A 3NRBA 1JJHA 2GQCA 4OYZA 1RLCL 5J2PA 1HNIA 1VK8A 2OTJS 1U24A 4RL1A 1PYOB 1XIQA 2R7XA 1RKIA 1RQ0A 3SCLE 5GAGI 4I2QA 1WC4A 2F4VF 1CC7A 3R3TA 5GAHU 4QWEA 5IQQA 3W3SA 4KPYA 1VQ4S 4K4VA 5KG2A 2IMOA 4A8KA 2E1MC 3CDAA 1SXLA 1NJZA 5FJ4A 1RTIB 1F3FA 4QZVB 3SV3A 1R89A 4C48A 2DH9A 1PSDA 2VF3A 4I6WA 4KYZA 1MMLA 4OZ5A 3MEGA 3H5YA 3B8HA 2ZWOA 2QSFA 1U25A 2C2ZB 2B51A 4FS2A 1XERA 1FD8A 3FFIB 1M5PC 1SI9A 2ASLA 3CGIA 3KMQA 4JI6J 4WP9A 2YQ3A 1VQMS 3BGFA 1RWPB 5IZHA 2Q6BA 3IGVA 4YR2A 2YNIB 3OLBA 2W2OP 4DR2J 2PMZD 5KT5A 3OL7A 4QBUA 4U96A 3VAHA 1Q78A 3MR7A 3EDRB 2VICA 2P9GA 2O3DA 4H4KC 2QSWA 4IDKB 2KVQE 2L48A 4UW2A 4ILRA 2G13A 3L7UA 2QEXS 4F02A 5BR8J 1TZ0A 2WTFA 4DV4F 2YY3A 3NS6A 3H20A 2RF2B 3BKTA 1OPIA 5A6WA 3LPEA 1LFWA 2DHXA 1J27A 4KGXB 3GJSB 2W9CB 2GO8A 3LGMA 2QT7A 4F4XA 2CQ1A 3C8YA 4HACA 4A8XA 3T9NA 3DRRA 3ZNUA 1JLGA 2GHVC 2J9DA 5KFXA 1SJ4P 3I4HX 3ZZPA 5FDLB 1YJWS 2BANA 1O51A 2OPRB 1YZ7A 3CJ3A 1TVRB 2G0JA 2K2PA 3J81U 1HBUA 3BPSP 4CLSA 1WF2A 1JX4A 2EXUA 3SQGB 4CM0A 3MPUB 3TO8A 3QGPA 5IFMA 4G6VB 4NE9C 1Q1KA 4NZ6A 4OHVA 5J2NB 3RR8A 4LQ9A 1U6BA 2MXYA 3M8SA 1P8GA 1RTDB 1RT5B 4QR0A 1RAAB 3D68A 3JTPA 2WVCA 2DNGA 1SJFA 3I4PA 2IA6A 2ADBA 4DV7J 2RDIA 3AD9C 4UF4A 1OWXA 4R25A 4DV1F 4BLGA 5KTQA 4V19X 5HP1B 3V6HA 1L3TA 4JV5F 1Q82T 3UDLA 3PKYA 3KHRA 4H4MA 1TKTB 4USHA 4OZLA 4USIA 2V2ZA 3QT5A 2HK3A 3ET6A 1HBOA 2DNKA 5DRKA 4JYAF 2UXDJ 1DLOA 5FLXY 1P6TA 3MAQA 2OEJA 1BQMB 2XHCA 2B4PA 1CG2A 2DPIA 3CCVS 3QO9A 2HBYB 4MIWA 5J2MA 3NMRA 1Q8KA 2R7RA 2RB7A 3M8QA 3ENWA 2I38A 1KQFB 3EGWB 1VQLS 3Q8YA 4LF9F 3M32B 1RAJA 4OHZA 3HM9A 4RU2A 4YP3A 3E51A 1EQMA 3ICLA 2IIHA 2KJVA 3A3PB 1T7PA 3SSRA 2MMYA 3H8YA 3GFYA 5IT4A 2J0WA 2MEWA 3W9IA 2J8SA 1UEKA 3MAAA 3DGPB 1G2EA 3CVKA 1MWQA 3VGSA 1KVJA 4DCPB 1VRUA 4G1PA 3QSYB 2NSCA 2E5LJ 3L4BC 1S72S 2O01C 2X1GA 2AQ4A 4DOZA 5BJRA 3BO4A 1G1XA 4P7VA 2CJBA 1WF0A 4CTAB 4IG0A 4PR6A 4K8RA 5H9EJ 4QIGA 3G6XA 4P73A 4JV1A 4I4BA 1WG4A 2AX0A 3AJ2A 5D4LA 3T9ZA 2J7UA 3M1VB 1JQGA 5KFCA 2POKA 1BXNA 3OUYB 3GIKA 2WK4A 1FJ7A 2DH8A 1HPZA 3ZTRA 3NGKA 2HEKA 1V6HA 4DSJA 1VLYA 3GR1A 1Q5VA 3K2YA 4LMZA 5K9FA 3LGNA 2LMIA 4WKRA 2HAFA 4A8MP 4AXJA 2DGSA 3ISNC 2P9CA 2WOMA 3QAEA 5A6PA 1EIYB 4KKOB 2DRDA 2KRRA 1NDPA 2B7CB 4NLDA 2DTJA 2MKJA 1YBTA 3JSMB 4NXNJ 3PO5A 3KNAA 3MPWA 4IFVB 2AP6A 1IQTA 2HIQA 3RBDA 1U1QA 2B4UA 1RA7A 3I56S 4ZOSA 1WI8A 3IP0A 2OEMA 4NEYA 1HLWA 3MCSA 3PX0A 3ENAA 4RNHA 3GYGA 1RE1B 5G0RB 4IH6A 3MF5A 2W9BA 1VMBA 2M7SA 3P8BB 5HK4A 2BEFA 4PWDB 4AL6A 1UMJA 3MZIA 2RUSA 3DLKA 2V4QA 3CIMA 4MFBA 1S9EB 5HANA 4B3RF 1NMEB 1LK7A 5G4DA 1D1UA 4JI8J 4KFBB 2GVZA 3KK2A 2W25A 1UVKA 4MIBA 2IDEA 1LNQA 1I3OB 1MROA 5EWFA 3AFGA 2HQCA 2EI5A 2RILA 5IT9Y 2LU1A 3BKUA 4RW4A 4KSEB 2HS4A 3CD5A 3PR5B 4EI2A 1X4CA 3HXMA 3W9HA 4CLFA 2JLGA 2IA0A 1RGVA 2LDIA 3F44A 4OLOA 2AIRB 2CVEA 3O2IA 1FK9A 1N48A 1I1GA 3DRPA 2EK6A 3F56A 4LVNP 1VBZA 1EKSA 1S4FA 5JMNA 3EDQB 4KGVB 1SKWA 2VG6A 4C98A 3TANA 1DZ5A 4ETZA 1T8EA 2UUTA 4C8MA 1LWFB 3TZYA 3ZFVA 3QWPA 2KHDA 1PGZA 3GPAA 3VVTA 4ES1A 1U8WA 2N3LA 4DR7J 4WFAQ 4MIAA 2BA9A 5A0YA 2ZNYA 5B0EA 1BLUA 3T5JA 2R3VA 2MPUA 1RZMA 1S57A 3POTB 4JI4F 4FDFA 3T1AA 3D6FB 2Z4PA 2COLA 3RAMA 4DL2A 2QLFB 2UUAF 1VI7A 4RUCA 4TLQA 2MZJA 1S6OA 2OPPA 1KP6A 1IBLJ 3MR3A 3OW2R 4ZVHA 3UD5A 2C2MB 1VFJA 3MD1A 3JB9k 1IR0A 4P10A 4NRUA 3MMJA 2R7OA 2EFPA 4X4UA 2XYHB 1RA6A 3OHAA 3OVAA 4DSLA 1KEKA 5C42B 1FXLA 1M1HA 2DGWA 3DKDA 1NHVA 1SKRA 4C3MA 2CWXA 5A2QU 4R8UB 4ATNA 2HHSA 2FD2A 1RISA 2DXDA 3KUHA 2H65B 1NXIA 3IR5B 3K0JA 1U6FA 1N0UA 1XNRJ 1XWLA 4NLGA 1GMUA 2L08A 4OYOA 1NK5A 3QGHA 5C25A 5CYQB 4YQWA 2GMLA 1LWEA 3N6MA 3WIVA 4LF4J 2HVEA 3TUIC 5AJ3F 4C0OC 3IBFB 1D9DA 3CW2C 4UOCA 2N4CA 3DC2A 1CJKB 3DXSX 3DLLQ 4H4OA 2VQEJ 1DBDA 4UOHA 5KG4A 2K3IA 4CZCA 5GVQA 1G7CB 2Z2YB 4D3HA 3SI8A 2R8HA 4FBTA 1IKYB 4XPEA 2W2NP 4DV2J 1TFWA 4YR3A 4FXDA 5DETA 3NMAA 2F7VA 3GCXP 1U0SA 3T1HF 3PVXA 4B3OA 5LOQA 3PHTA 4CLYA 3H59A 1TV6A 3A3OB 4KC5A 2EPIA 1LW0B 4F26A 5M2RA 4K4SA 3THTA 2KU7A 1RHMB 1RHRB 2XHWA 1RAOA 4TY8A 5IWAJ 2CPIA 2KG1A 1BD6A 3E01B 3LA0A 5AT1B 5F8HA 1FJGF 1QD1A 1VQPS 1U1MA 2ZM6F 4NOHA 4MYTA 1CULB 1U8SA 4ITSA 1KLMB 4LF6F 4W98A 1ZPWX 5AE3A 3DLEA 2RH3A 4M8LA 1MG7A 1T9UA 2H4WB 3TJ9A 5E0OA 4DBQA 5A8RB 2X3DA 4M5KA 1M5HA 1C1CB 2GJFA 3IS9B 2XNRA 1OO0B 1MU2B 3MURP 5J1EB 1N4LA 1HNZJ 2IDLA 3L7OA 2J9DE 1RUSA 4RZRA 2X1BA 2MQLA 2CDRB 3MCMA 5CZVA 5F8GA 2YWFA 2Q3PA 4YR0A 2LCWA 1FWLA 3Q24A 2IYGA 1RTIA 1Q16B 4OZ3A 4L3KA 1K0VA 4FXWA 3FK4A 4LIWA 4NLYA 3UN2A 4LR8A 3FFIA 2EWHA 1FFGB 1VQ6S 2ROEA 4PG5A 4JI6F 3D67A 5A8WB 1UWAA 3H98A 2OIHA 1WF1A 3N28A 4L76A 2J0XA 4C6AA 5HJXA 2L9NA 1FEEA 5HMXA 3UCGA 4DR2F 1T9XA 2BW2A 2AGPA 4NL5A 4NYZA 1EARA 4DG1B 4QWAA 1SJRA 5LJ3Y 4BWMA 1DY3A 3HVRA 3AJ1A 4WXOA 3MEDB 4DFMA 2XMVA 3UFCX 2IBKA 3WC0A 2RF2A 4USMA 5BR8F 2AZ1A 1YBUA 3C3LA 4FPRA 4RUHA 3NLCA 2DGOA 2WSEC 3HFZB 2AJ1A 2BR0A 5H9FK 2XGQA 1OQ3A 1IXKA 4GKJJ 3KJFB 4CRJA 1PILA 3MMAB 5KFKA 3E3XA 4F8RA 4ZITA 5CQGA 1QM9A 1MMDA 4C4WA 3G86A 3TAPA 5FDLA 1QAJA 1HBNA 5E3QA 3MCNA 3FMWA 2HQDA 2OPRA 1WG5A 3IWXA 2J6TA 4CLKA 2ZVIA 3VHQA 5HVFA 2YWGA 2OGUA 2VPZB 4DF8A 2RQKA 4EYHB 1VQ9S 1RTDA 1QUVA 1N5TA 1RT5A 4QJVA 3ZXWA 2Z2MA 3X3UA 4MJKA 5ETLA 2K06A 4NCGB 2RIJA 1HHQA 3CJ4A 1NJYA 2V5HG 4Y00A 1U47A 2BJEA 1AW0A 1HD1A 2PIIA 1MW7A 5HP1A 4DV7F 4HHJA 1VOMA 3M8ZA 1XR5A 3RB0A 2CNNB 1TKTA 3PYDA 2CQBA 3A8JA 2M3DA 3KLVA 2Z58B 1Z1ZA 3BZQA 2LKZA 1U0HA 4K50A 4X4RA 4QPXA 1BQMA 1ZTTA 4RU9A 2JEJA 1APSA 1V9OA 2H54B 1ZM4A 2VFUA 2UXDF 5BYQA 1WOPA 5T7LB 1EKRA 3Q22A 4P72A 4PZVA 5KFSA 1SIWB 3A13A 4N8OA 5HO4A 4I69A 4CYUA 2PSZA 4ZMMA 2RRBA 2FQQB 3M32A 4EWTA 2B7BB 5HQ8A 2BE2A 4U9RA 3K58A 1SUQB 1E6VA 2ZD1B 1ZAWA 3OJSA 4DPTA 2Y8WA 2FUG9 2J0SD 5CH7B 2FYXA 1RT3B 4X66J 1NK6A 5FLXU 3DGPA 2RKIA 2QN6B 1FVSA 2IAJB 3KYLA 4EFAC 4KJIA 3HVAA 3HSJA 2B9YA 4TLRA 3Q89A 2E5LF 4TYBA 4X2BA 1ZM2A 3AAWB 1Y4ZB 3AQPA 4CTAA 3B82A 3HHLC 1HWIA 3GG1A 3KFWX 3NNAA 1U7LA 5K20B 2HNYB 3BR8A 3QIPB 3M1VA 2CYYA 4O3QA 4LBHA 3OUYA 1B7YB 5DLFA 2OSRA 2LQ5A 4MK8A 1WUUA 4IRCA 3D6TB 2XLIA 3NNHA 3CULA 3DRSB 3MTKA 4YFUA 1R8HA 2DK2A 1XMOJ 4ZP8A 5E33A 1GXTA 3ZZOA 1S0MA 2FGOA 1WKJA 3BSOA 3JSRA 3FQLA 1NK4A 2BKOA 4JOUA 1F9FA 4Y2IA 4KKOA 4NLSA 4V1Ak 2WW4A 1N5QA 3W62A 2L9DA 1T05B 2A6MA 1N5YA 3JSMA 4F4KA 2PMHA 3W8GA 2PEHA 4M63A 3UQSA 3W60A 1Y9OA 2KDOA 3RBZA 3IBCB 4OJ3A 3RR7A 4IFVA 3LP2B 3CCSS 4NXNF 4WIIA 2E1PA 1BQNB 5LSLA 2VB6A 1IBMJ 1IR2A 4GVBB 3UVJA 4OI0A 4DMZA 1WACA 4I64A 3TX8A 4ED1A 4CM2A 1RWMB 2FZCB 1R27B 1WC1A 5G0RA 4MTPA 3MPDA 2L9WA 4KAIA 4PWDA 1X4GA 2ROPA 3PW4A 3W5YA 3G71S 3EGZA 1KHWA 1PBAA 4OX9J 3LQVA 2B4VA 3K7RA 2EW9A 1DHMA 2LA4A 2GQQA 3NEKA 2FJWA 4KFBA 1IKXA 2R2TA 3D1HA 1N33J 4UY8T 3L7PA 3DOKA 2MLYA 2R7SA 1TL1A 5CXTA 5T41A 7AT1B 6FD1A 2MZRA 3UWTA 2M9KA 3MR5A 2V2VA 1ZOTA 3J7ZT 1S9GB 3G8TA 4MT1A 2FLLA 4KO0A 4PUOB 2W01A 3DLBA 2M4MA 3NXZA 3CJ8A 1VS3A 4M5LA 3PIPQ 2R9LA 2JZ5A 2VA2A 1DARA 4DV6J 4RW8B 1JXLA 4X65J 3QLHB 2MKYA 2V9WA 1KDNA 4J5OA 3W9JA 3KNGA 1X4FA 1F5AA 3GZ7A 3MM7A 2JDJA 2IMWP 1QDUB 2DIUA 5IT9U 1FRHA 1AFIA 1VBYA 1YDLA 4P6QA 2LDYA 2IY5B 3KG4A 2HFNA 1Y5LB 5HMWA 3VVUA 1AUDA 2JH3A 2OAUA 3SFGA 1B99A 2ZOGA 4DUTA 1WTFA 1BHNA 1R8PA 4NPOA 2R2SA 1UVIA 3EPIA 2XMWA 1K0TA 4F7VA 1TL7B 5HAOA 4DR7F 2W4CA 5DDPC 3POTA 2XULA 4OI4A 3R2DJ 1RAIB 3D6MB 3AOAA 4USUA 4K4ZA 2FJAB 2FHKA 3PW5A 3TUJC 1UWBB 4JB8B 2HHVA 1FXDA 4WXWA 3K8WA 2BJDA 3NKYA 3A8EA 3DFEA 1B7FA 4B9SA 1KLNA 2G0CA 1S6PB 1IBLF 2NUUG 1QY7A 4B17A 3HP6A 2QG9B 4U67Q 4L3NA 2KKHA 3MUVP 4RW6B 3GYNA 2ZBQA 4OI2A 2Z57B 4R5PB 2N4DA 2ZWPA 4YEAA 5I42B 3KLEB 4DQRA 3QBCA 3KLGB 1EZZB 3ENQA 4JV2A 3I31A 5HQLA 2BQRA 1ZZFA 3G8QA 1U26A 2QLWA 2LVWA 4OZ1A 2VH7A 4BS2A 1KVIA 2Y0SD 3PJXA 1ZM3A 3TX0A 4Q0BB 3I6PA 1XNRF 1BUXA 1HA1A 1VIOA 3QSIA 3BKFA 6FDRA 2G4BA 4J90A 5ITHA 2ALZA 3HCXA 2DEJA 5IS2A 5D77A 2CUYA 3VQSA 1IWGA 3CC2S 4LF4F 3M8WA 1QAIA 2QLBB 3G6YA 1NDLA 1S59A 1FDDA 1E6YA 2AZ3A 3TP2A 3NGRA 2FZKB 1M1GA 2YKMB 2JVRA 4GKKJ 4LR9A 2V6AA 1VHFA 3W2VB 4CNZA 1WKLA 3BS9A 4QIVA 4NCAA 5MAOA 2VQEF 1IKYA 3A1YG 1Q7YT 3CJRA 4AYBD 2UVWA 3PZPA 2DGQA 3D7SB 3M9OB 4OYWA 2JEIA 3FCVA 4NYOA 2DY1A 1Y10A 1ROFA 4RUAA 2OSQA 3BH7B 1YJ9S 4Z7YA 1FDBA 3Q23A 4QW8A 3HVTB 2XMUA 4Y2MA 2V2KA 4K4XA 3J80Y 4TQSA 2F4FA 4FYWB 4LT6A 5KFUA 2XB2D 2D3OR 3E01A 2MSTA 2EBGA 2MQ8A 1NO8A 5IWAF 2V68A 1F0XA 2CNOB 2OP5A 1FF2A 5E3RA 2Q66A 3W65A 1FHTA 1WHWA 3CJQA 3MGJA 4HI1A 1YJ7A 1S77D 5EDWA 3W2WB 1S1WB 2V4JB 4RUBA 2FLPA 1Q53A 2HW3A 3BO2A 4DFJA 2F5GA 4OIXA 2XG8A 1FXRA 5AE2A 3TVZA 3EXYA 3K5NA 1SL2A 5A8RA 2YNGA 1C1CA 1FJEB 1MU2A 5J1EA 4YY3J 3ZZ0A 1NH8A 4OMFG 5A8KB 5D4NA 2B9WA 1NHUA 3LPYA 2AGOA 1T9WA 5KFHA 1HNZF 2CPDA 1MN9A 1NK0A 1R3NA 2C2KB 1NDCA 4UY85 2NUHA 3QGGA 3CMES 2UUBJ 3BO3A 1VQOS 2VPWB 3P45B 2ZE2B 3VGUA 2D74B 4A4JA 1FFWB 4PG4A 1REVB 5K8PA 3OR1A 1WTBA 2MLXA 1XMQJ 1U4BA 2HHUA 1CJVA 1YSJA 4F25A 4QR2A 3M2RB 1KSPA 1WC3A 4ZLNA 4NLOA 3M9MB 2CXEA 3SCKE 1A9NB 4HTJA 2BKNA 1D0EA 3S6EA 3SFUA 2HYIB 3T5KA 4YHHJ 5ADZA 4HLBA 1OY9A 4KHMA 2CPHA 2MGZB 2A2DA 3NWGA 5DZ6A 1FEHA 4PXBA 1LWCA 1UETA 4M5JA 3V81A 2F9JA 3Q2TC 2IM2A 4QWCA 4ZPBA 3NS5A 4B9UA 1Y3KA 4I7FB 2GV1A 4DG1A 2HURA 4Q8FA 2Y1IA 1NKEA 2W2PP 2ACYA 1RLDA 1U1NA 3KWMA 4ID8A 2F8MA 4NCBA 2DO4A 1S0OA 1ZZNA 2QE5A 4IQMA 3C15A 1WC6A 4N47A 2NXEA 5GAEI 1WC5A 1GMWA 3BGRB 4DX8H 2H9ZA 4DXLA 4ZN1A 4EZ6A 5GADU 2BBEA 2IRXA 1UPMB 3TNVA 1RK8A 3OFGA 2R8KA 3MWBA 4M94A 3FBEA 3J7YI 1RXOB 4ANCA 4UOFA 3CDBA 4GKJF 5KFRA 2AJFE 1ICEB 4WCEQ 1HMVB 3LUYA 4RWXA 5KFWA 5B7WA 3ZZUA 3BGUA 4NLPA 1ZBTA 2ACMA 2AYEA 1VR6A 2V67A 1RWNB 1RSCA 4C8OA 2O67A 2LXFA 2C3YA 1S1TB 1DQAA 3TWZA 3KG0A 3J81j 1DJ0A 1W7WA 4NCGA 2UP1A 3SCJE 2UXBJ 1PYTA 2HPUA 2HRTA 4BCAA 1TKDA 2FVCA 1PKUA 1KONA 1RTZA 4M5MA 4ECWA 2VKRA 1NSKL 2H1YA 1JLEB 2C2DA 2HNDB 4ECRA 1ZAVA 1R0CB 3CCTA 4PYDA 5HVHA 3FCWA 4KGKA 3BF4A 2P5VA 4PPZA 2R8JA 3EYZA 2AEFA 4O3OA 5C2GA 3CWJA 3JS9A 2ZC3A 3VZHA 1F6TA 4ZJLA 2GCFA 1VJWA 3MMBA 2B0GA 3CXCR 1GXLA 1VQSA 2IVFB 2UV8G 1MMNA 1U1LA 2NS1B 4BC9A 4NLVA 1CS4A 3F73A 1K1SA 3BBFA 3HFVA 5H9FJ 3OXFA 5CYJA 1SUQA 2UUCJ 5AXMA 3BB5A 3RB3A 2ZD1A 4RPFA 1HI0P 2J76E 4RNOA 1RT3A 1HWKA 2VG7A 4ECXA 2JVOA 2AV5A 1HBMA 2YNFA 3JQKA 4X66F 3DN9A 5GADI 2MJUA 3B4MA 3CJSA 3PTWA 5KT7A 1SC1B 1TKZA 1G6BA 2DITA 2MKSA 1TL3A 1F3VA 1TUWA 4YDXA 3MI7X 3P4UB 9RUBA 4LBIA 3FEXB 4CH1A 1P9QC 2VBXA 3H7HB 4OHXA 4BHQA 1B64A 1JJ4A 2FIUA 4Y28C 2HNYA 3H2LA 2MQQA 1SIZA 2HVDA 2VOOA 2LXUA 1RTHB 3HVWA 3R5JB 2EG1A 2UUWA 1NM2A 4AFFA 3MR2A 2OTLS 1IJEB 3CD7A 2V8GA 4EO8A 1WHYA 4DV5J 2HMIB 3NGTA 2YTCA 3CB4A 1H2TZ 4V19J 4B9MA 3M6VA 2NREA 1REGX 1RWUA 2QV6A 2R2RA 2FDNA 3CCMS 3OTEA 2FJEB 4ID5A 4F3OA 5D3GB 1T05A 4ZN3A 1X5PA 2R7UA 3GFHA 3LP2A 4WWSA 1NK9A 5KFAA 4ED7A 4F50A 2D41A 1ZPVA 4GVBA 3MM5B 5HJYA 3R27A 5D78A 1IBMF 4WKYA 3UE2A 2HWHA 1L3KA 2DGTA 3OFFA 2BDPA 2AF6A 4I1TA 3MFHA 2EC0A 2YKNA 3C46A 4RBVA 2OHDA 3D1QA 1RT2B 1RBAA 2QA4G 2XWXA 4ZVPB 1YGYA 2YH0A 4Y65A 2MLZA 1V3RA 1C4AA 4W90B 2Z2LA 1JIHA 3RJMB 4PWWA 5H1SV 2C2EA 4OX9F 1LQ9A 3HKWA 2DGVA 3PIOQ 4L72B 1GTEA 2G2ZA 2KTQA 1FRXA 4PQAA 5F8LA 1N33F 3FBFA 4ETXA 3U1LA 2CQCA 2WCXA 1X0PA 4WK1A 1YWXA 2GC8A 4PUOA 2XYGB 4WTYA 1HKAA 3NCPA 2JEFA 3T1YJ 1UJ5A 2CPYA 2MZQA 1S7HA 5KG5A 3LP0B 2KJWA 4ZLLA 2OJ3A 1S12A 5F9NA 2V63A 3D3BJ 4Z7CA 4IG3B 4DV0J 2ZHOA 4RW7A 3EZ5A 2CDQA 5KFVA 3S7RA 2JRSA 3DOMA 1SJQA 3QLHA 2W4PA 4DV6F 3FQKA 2U2FA 4G3IA 1Y5IB 2PA3A 2RRNA 4X65F 2VG5A 3K59A 3K89A 4ZCKA 1NKBA 2I8EA 1FI4A 4U7UD 5AXLA 4C8YA 3ISZA 3TZXA 2XSJB 1RAEB 3TR5A 5LJ5Y 4FN5A 2BUNA 4KT0C 2J7KA 1RHQB 3T41A 1U1OA 3B6BA 4EO6A 2Y0BB 1CLFA 1M1KT 4O4GB 5CA5A 4U6PA 4FVMA 5J2QB 1R0BG 5LMUJ 4A8YA 1TL7A 2UXCJ 1FKOA 3QNWB 4ZVQB 3CJTA 4QYZK 1UEVA 5JUMA 1RT7A 2Q6CA 3MM9B 1S5ZA 2OD6A 1SC4B 4X4VA 2GJIA 3OV7A 2BM0A 3GYXB 3TZWA 1IQZA 2OKQA 4OZNA 4AXIA 4DR6J 3ILOA 1UWBA 1C2PA 4I68A 1Q8IA 5IM0A 1N32F 2MZTA 2HNZB 1GMWD 3FBBA 2C3OA 2DKOB 1RAHB 1S6PA 1YTYA 1Z4UA 4DR5J 4CDIA 3SDEB 2H5IB 3UI3A 4R5PA 1WEXA 4KH0B 3HKZD 4NXMJ 1FRIA 3ENVA 3KLEA 1IN0A 2JNJA 1HI8A 2H5JB 3NAHA 3GTYX 2XI2A 3KLGA 3BGLA 3KDNA 3GJQB 5I3QA 2NPIA 3V4IB 5K5MA 4JI2J 4J9RA 2FTRA 1C4CA 2NSBA 2XLJA 1YKWA 3KK1B 2HKEA 2DR9A 2GIFA 1SC6A 4KQZA 1AZSA 3U7JA 3TI0A 3PKMA 1A6LA 5KFGA 4Q0BA 4DX5A 4Q43A 3BQ1A 2J6UA 1DQ9A 1C1BA 2KI2A 1GTHA 5KFNA 1GK8A 4CO0A 3CMQA 1X9MA 2J0QD 3CCQS 1RCXB 3FGVA 2B9XA 4DQQA 3M4XA 1B0VA 1M5SA 3JAMY 3FRYA 1VQNS 1FE0A 3C6UB 4QIWD 1XNQJ 1KFDA 4GC7A 4Q44A 3CJKB 1P1LA 1IVZA 5AE1A 4GKKF 1NHKL 2BQ3A 3W64A 3W1YC 4ICLB 5GAGU 2JEGA 3D2WA 3M2VB 2ZZNA 4CO2A 2OO4A 2GVDB 4DS5A 1HWUA 5LL6d 2WSFC 1FJCA 3PCOB 1FE4A 4C97A 3KLHB 1S6QB 3ZZRA 4NMLA 1HD0A 3AA9A 2E1CA 4USJC 4G65A 4WU2A 3DU6A 4A47A 1ACMB 1ZETA 2CWKA 1FX4A 4CO1A 2QL5B 2LEPA 5EX3A 2GZOA 3R6GB 2M5YA 1FFSB 5I3UA 1S6UA 5CZXA 4CLTA 1BC6A 2C22A 3IXQA 4PWUA 2G2YA 5CD4H 3BYPA 4B3TJ 4PABA 4I2PA 3DNCA 3M8RA 1S9FA 3BQ2A 2CVIA 1BGXT 1S1XB 2AYBA 3BSNA 4OLPA 1S1WA 1AXQA 4JI1J 3DI6B 4IOAQ 2AJQA 2OFGX 1RAGB 1PC5A 3H5UA 4L74A 2HBQB 3GB0A 2CPXA 2G2OA 2W2QP 3T6BA 3J80U 3OJUA 1PO6A 1NJIT 4GRSA 3GV5B 2KM8C 3K8VA 2MY8A 5A8KA 4O0IA 5JJBA 2CPJA 1RJJA 5DM6Q 1S76D 4YY3F 1EAYC 2DCUB 2ILZA 3PRBA 1IM4A 3EGNA 1N6QB 2ZJRQ 2MZSA 4KGMA 2C28A 3RW7A 4K0KJ 1HNWJ 1R6YA 1LOUA 2N3OA 1N54B 4F04B 2ZH8A 4ANDA 3EZUA 4Y2KA 3IRXB 3M9NB 4WFBQ 2FJXA 3HSGA 1HWJA 1REVA 2UUBF 1BMQB 4MK7A 1WOOA 1O6XA 3CE8A 4DZ6A 4PXEA 1MN7A 3ETOA 1O5JA 3MUTP 2LFVA 1XMQF 4DL4A 4PQUB 4ECTA 1X8DA 1IKWB 3Q0AA 3N9UC 1V3ZA 2RQ4A 2MGZA 1UTAA 2DNQA 1VRQC 3KLFB 4YHHF 4JP8A 3N4WA 4M5NA 4J9VA 3L9ZA 4X62J 5LMNJ 2RSQA 3Q8QB 2GX8A 1M5VC 3KOAA 1S99A 2VFSA 3KLIB 1KHVA 2B6AB 1VLOA 2KH9A 4DUYJ 2D3ZA 4FF1A 1VDHA 3N5BA 1CBKA 3TAMA 4RKUC 1WG1A 5KFMA 1UAWA 3CD6S 4B3MJ 4IYQA 2YWHA 3CDWA 4RWWA 3R8YA 4XAKA 1IJFB 3H2UB 1EP4A 1B3TA 1SKUB 4DLEA 4Q2MA 1YJUA 4UQTA 4HDGA 4URGA 4B9LA 2ZNZA 2EEYA 3H5SA 5DGBA 3A8KA 1CQMA 2LA6A 1FRJA 2XMKA 3R2CJ 4LQ3A 3OVBA 2DXFA 2Y1JA 1CSJA 2CJ9A 4B9VA 4ZCLA 4CH7A 4DLGA 3EGVA 4ZLJA 1JWWA 2KFYA 3QT8A 2C2NA 4QWDA 3IRWP 1FKAF 1S1TA 2QFJA 4DL5A 3OVSA 5HLFA 3CCJS 2WW8A 1KQGB 2G1DA 2LQJA 4O44B 4LRAA 2F40A 2X1FA 2OI2A 3OTCA 1W2BR 2EG2A 2UXBF 1VQYA 1IR1A 3TA1A 2HNDA 3HMJG 4K4TA 2GHPA 5J2PB 3HHKA 1HNIB 3PV8A 4K4WA 2GNKA 2I2YA 1YITS 3HZEA 5U47A 3OBIA 2F4VJ 5KFYA 1A0OB 4FVCA 2NLWA 4LFCJ 3IR7B 1CJUB 4I2QB 4ZPAA 4JBCA 3IO1A 2HVHA 2GIQA 3LP1B 1R31A 4X4OA 4WE1A 3SXLA 2I5JB 2HS3A 4EU0A 3ZNJ1 1N8RT 2UUCF 1U2FA 2XO7A 1FNMA 2CIMA 4LSNB 3BBCA 1J5OA 2QL9B 5HATA 2ZUAA 2WVFA 5KFTA 1S48A 2KN4A 1Q8BA 4EK2A 1TR0A 1GT8A 5DDRC 1HIYA 1EJ7L 4X4TA 2WBRA 2BRLA 5HBMB 2D1CA 1YI2S 2KL8A 2Y1RI 3MXHP 3R7NB 3FZ2A 3PW2A 3QATA 4GC6A 3AT1B 1MWYA 2OEKA 3BH6B 1TAUA 1WWHA 2CKWA 2V4RA 2W7AA 4J37A 2ZJQQ 5EUHA 1QAYA 3FNNA 7FD1A 2VUGA 2M88A 4JV0A 3W63A 1JKHB 4JI7J 2K1RA 3AD8C 2VC0A 5KFFA 4HACB 4DV5F 5HSPA 2LP4A 4HH0A 3R5CA 1SCJB 3DRRB 3PYEA 1JLGB 4I6AA 5CCLA 4EBCA 3UN3A 4FZVA 3NS7B 2BANB 3D54A 2BMBA 2CADA 3VAFA 5D3GA 3V4MA 3ADAC 4Q8EA 4OQJA 2Z56B 1UVLA 2FZGB 1HQ2A 2DT9A 2EFQA 2BRKA 3CJ2A 2C1EB 3RTVA 5KFQA 1XR7A 2DISA 1KC8T 1UA1A 4PXCA 2WSCC 4MAKA 1YJVA 4OYPA 3JSYA 4TU9A 2J7WA 4WFYA 3HO1A 3TAQA 3OTDA 5E41A 4Y2AA 3DYAB 5F0UA 1CJTA 3DHWC 4AT1B 1GMVA 1RWOB 3ULHA 2QMWA 3LTOA 4WK3A 3MEEB 3JYTB 3W5XA 5C2CA 1X4HA 3JTOA 2BV3A 2AW0A 2PGCA 4X4QA 1HBOB 2I1RA 3KKFA 5K14B 2FHJD 4JI3J 1U1RA 1RBLA 1DLOB 3PW0A 1UZHA 3ELHA 2FC9A 1NZ8A 3PRDA 2AHOB 4UUXA 3QO9B 5J2MB 3M8QB 1XEZA 2DNPA 4WU3A 5DM7Q 4RNFA 1ITPA 3DHXA 1GQEA 2F1FA 4HDHA 2FGCA 4DEZA 2DVIA 3BJYA 4OX8A 1SQFA 2V69A 2J9CA 2GFFA 3T1YF 2BE9B 4IG3A 2NZCA 4P2MA 2R8IA 3NGDA 4TN2A 2YBVA 4OHYA 2DO0A 4WTOB 4DV0F 3MAAB 4N56A 2ZVSA 3R7BB 1VRUB 4KBIA 3QQCD 2DJWA 3KTQA 2DNOA 3BDPA 3GR0A 1KTVA 4OHWA 4YOEA 3DOLA 2XNQA 5ETNA 4EGLA 1RT4A 2YXLA 3FSXA 3RB4A 3WC2A 4IQXA 4O4GA 1DTQA 4IG0B 4A46A 2AT1B 2F8HA 2CQGA 2GJ2A 1EHWA 4K7QA 2RQCA 1RHUB 3MM9A 1Z2ZA 5KG6A 5LMUF 1TFYA 1GEHA 2KXHA 2OPSB 1JXVA 2UXCF 1TUGB 3IBWA 1SL1A 4ALZA 5KFIA 3CCZA 3V5RA 5FD1A 1PAUB 1YJRA 1XK8A 4XO0A 2J5AA 2PFFB 3KHHA 3OT9A 3IG1B 4DR6F 5DG8A 3N5FA 2QYGA 1HQUB 3VZIA 2HQIA 3QT7A 4ILLA 3U27A 5DGAA 1I51B 3TA2A 1S0NA 3UDCA 1LW2B 1M0SA 4KE5A 4ZVSB 2XS5A 4EYIB 4DR5F 4B9TA 1W25A 3DRXA 3HPOA 4RNMA 3UCUP 1L3UA 5KFPA 4NXMF 4KTQA 3THVA 1S10A 3AA8A 1QSYA 3V4IA 1HARA 1IBCB 4FYXB 2CPFA 2M0GB 2QLJB 2UU9J 4IRDA 5KT4A 4QIEA 2YWWA 1T11A 4DZDA 2BX6A 1ZTWA 1T9VA 4JI2F 1R0AB 2K3KA 3M8YA 1QE1A 4WJBA 1JLFB 2CQ0A 3M30A 1R8CA 5B09A 1XTZA 4L73A 1KR4A 1NB2A 5IXUA 1L3VA 1K73T 3DXBA 2VASA 3CO9A 2HS0A 2YWKA 4WZMA 1UFKA 2PDAA 2R8GA 1JB0C 4F2RA 1B0PA 1HYSA 2D7SA 2UV8A 4LF7J 4IO9Q 2HWTA 4ECVA 2LYVA 2FVPA 2GVZB 3PY8A 4OJ1A 3M8PA 3I87A 4DJBA 1LEOA 4I6YA 1N36J 4QYZJ 4F36A 2QA2A 1HL6A 1XNQF 4ER8A 2VOPA 1PJ6A 3CCWA 4G1QA 1RU2A 4RW4B 3HHLB 3JTNA 3WBZA 1N88A 2B4OA 4ZCIA 1UW4A 3T19A 1JNRB 3KLHA 5KFLA 4FNHA 1NSPA 1HHTP 4X64J 2O66A 2H48B 3JAMU 3GQCA 4KV8A 1FERA 2HLTA 1YBAA 4OYBA 4X4SA 4ECQA 1TKXB 4AUKA 2E66A 3Q8PB 1FK9B 4BC7A 2YH1A 4DQPA 4LF1A 1UP1A 1U49A 4K4UA 4ECYA 4B08A 5HMZA 2FHOB 3H0PA 3SZ2A 1DAXA 2FVRA 2B56A 5GMDA 2LQBA 3EMTA 1Y11A 2EKNA 1W26A 4NLXA 4B3TF 3I9ZA 3I9V9 2CNKB 1T02A 3HFKA 4TNOA 2IJNA 1A7GE 2JFKA 2VODA 3MAHA 2Q43A 3W61A 4JI4J 2V50A 3V6DA 4JI1F 3J7A1 4NX9A 1ULRA 4R0EA 1UL3A 5L38A 2OMLA 3BGOP 2BOPA 1RI7A 2BE7D 5MLCV 4FP9A 3NAIA 5A2QY 1AFJA 4UOGA 4AQYJ 2OPPB 3H4BA 2HHXA 1H74A 4NI2A 3BPDA 4UTGA 4TY9A 3DRYA 3U02A 2AEJA 4HHHA 4ED3A 2XM3A 1WDTA 2X7IA 2GAGC 2DNRA 2IRUA 4K0KF 3IRXA 1HNWF 3TQEA 4DPYA 5EHHA 3VTIA 1S1UA 4A8QA 1WC0A 8RUCA 2NPFA 1LXNA 3AODA 1FVQA 2ERRA 3OPKA 1F1BB 3OSNA 1X31C 2HIYA 1XR6A 1IKWA 5T14A 2MQMA 1FDAA 2HG4A 4ZP6A 2XI3A 4ZIVA 1VIXA 3BM7A 2DHGA 3GSDA 3VGTA 2VJUA 2DXEA 2G0IA 2XZWA 3A8IA 2MSSA 3I5AA 1LWEB 4DL7A 1FA0A 2C3PA 3B4DA 2HBRB 2X51A 4X62F 4DFKA 5LMNF 1U45A 5KT3A 2G9OA 2PI4A 3HHDA 1NPPA 2RS2A 4N41A 2FJDB 3HHEA 1K47A 2I0XA 2ZHAA 4OZJA 3R7SB 4DUYF 5B08A 4QOTA 2DHSA 4OZ0A 1VQ8S 3HJFA 5L46A 1CPZA 3PG9A 2DNNA 4B3MF 1NAQA 2YNIA 4HTIA 4P52A 3JSBA 2AMCB 2YKPA 4M5DB 2CJAA 3AOBA 2MB0B 4PRFA 4ZVEA 5THWA 4IDKA 1IKVB 1N0VC 1RABB 2E9TA 1NDKA 4B3OB 3AQOA 4ZPVR 4OJHA 4CIOA 1GXUA 2HZVA 2BYCA 2ZKUA 1T03B 1N5SA 1L5UA 3QGIA 4TY8B 2W9AA 2WVEA 2P8IA 1HFEL 3PFOA 3RG6A 3OLAA 1YG0A 4BWJA 1WD6A 2DCLA 2W9CA 2E5JA 1F5CA 2YKQA 2V94A 4F4AA 5LSRA 3K5PA 3CSKA 3DLEB 1UVNA 3KHGA 3C2PA 2E1RA 3S8SA 2QA1A 3P6YC 1RDRA 5KFJA 4A8SA 1TVRA 1FNOA 4DHVA 3UR0A 3QYYA 4IH5A 3SQGA 4M5IA 1OS5A 2CAJA 3I5BA 2DR6A 4URQU 4ZPDA 1CJUA 3ZZYA 5J2NA 5DQHA 3T6JA 2WONB 3FUYA 2HGLA 2UVRA 4E98A 4LFCF 2HGNA 4MKYA 3DDIA 3LP1A 2RD5C 2F3JA 2RDDA 2I5JA 2MYFA 5DLGA 1VBXA 3JXOA 3T5HA 3X1LB 4P2SA 1YX2A 2W24A 3VAMA 3UO0A 5AXKA 2IVMA 4DQSA 4DR4J 1F60B 2BW7A 1HW9A 3MEKA 1I6JA 4CQ1A 1ELOA 1BWEA 4LSNA 3VF0B 4O3RA 1QVGR 2ZFHA 4XIUA 2FPHX 5JVGQ 3U1NA 3E2EA 4PPDA 4F0KA 4J9LA 2DNLA 1FO1A 2VDHA 3RRGA 1Y7PA 4TXSA 2YX4A 2OUGA 3KHLA 3D0HE 2RT3A 2F65A 4FYDA 5HBMA 5D0HA 2RU9A 1UPPA 2JSXA 2OPQB 3ILLA 4FXVA 5KFOA 2KT5A 2XEXA 3CUNA 2V9KA 4PG8A 3D1OA 2RVJA 4ZDNA 4MK9A 2VFVA 2XBPA 4WF9Q 1QSSA 1WEYA 3GONA 3HHNB 2P2CB 4DR1J 1FWKA 2CQ3A 3FJ2A 2BM1A 2HAIA 3OSPA 1JKHA 1WSVA 2GIRA 1K8AT 2PN6A 2J8AA 5CYMB 3NBPB 1DTTB 2JFDA 4JI7F 3DLHA 2W1BA 4TQRA 4Z37A 3N0VA 4ZLPA 5D4PA 1PG5B 4E0DA 3SEOA 3K5MA 1HBNB 3VGVA 1WNEA 3CNQP 1CVJA 5KFBA 3KUGA 2UVUA 3FSIA 4JUZA 1QSLA 4OZ2A 2E5IA 3GLJA 4USKA 3FC9A 2QC3A 4S0MA 5L9NA 1IBKJ 4M5GA 5GAHI 1IWAA 2V34A 3GV8B 1ZS6A 1VK3A 1KQSR 1QTNB 3E8OA 3DYAA 2FVSA 1FNXH 5B0CA 3O5TB 3ISND 1PYSB 2BKPA 3MEEA 2ASDA 3JYTA 3NGSA 4RO0A 2JC1A 4CWBA 3AJDA 1SH0A 1JLCB 4LFAJ 2LQ8A 2JJ4D 4GO7X 5KAKA 5B0GA 1VGYA 5K14A 5J1NA 1U0HB 1OSDA 2PFDA 5D6GA 2CA9A 1ZYQA 2XWYA 4ED8A 4JI3F 3G82B 1M5KC 5IT0A 2LECA 3LAMA 2ZH9A 4CO4A 4HT7A 1RTJB 2DD8S 4NWBA 4CYUB 5F8JA 4ILMA 4MMOA 4TVAB 1H72C 1P9YA 4IO1A 3D66A 3TW0A 2BE2B 2AJ4A 4FS1A 1MNEA 1E6VB 1S9EA 2CRLA 1S0VA 2XY7A 2WVDA 2MDAA 4UQGA 1S97A 4ZPWR 2KT2A 2RKIB 4U95A 4DL0C 4ES3A 3OTOJ 5ETPA 1YRXA 4JI8F 4HEA9 2KG0A 3WHIA 5CHCB 4NA1A 4M5HA 5DDOC 1WELA 3LWLA 4FYVB 1NBEB 2KFNA 4AD6A 3CC7S 2WAQD 4N5SA 3OTBA 4DU8A 4UZBA 4CLWA 2CG8A 2VKZG 1FWPA 3KXDA 5BYSA 2KXNB 4ELTA 3AB4B 5FIIA 4U8VA 2B9EA 2ZC4A 4HR2A 4Q5VA 5IV3A 4CT9A 5JVHQ 5KOWA 2OPSA 3DU5A 5D0RA 1PBUA 3VAJA 1NRKA 4Y0FA 2NZ4A 3BSCA 2IC3B 1Q95G 1S1VB 1Q86T 3Q8RB 5DDQC 2VBWA 5KG1A 4FNIA 3D9BA 2B43A 3IG1A 2R42A 3GCWP 1LWFA 1SQEA 4NZ0A 1HQUA 2YQ1A 3H5XA 1UA0A 4P75A 3QRRA 3ZTPA 2QL7B 4L75A 1LW2A 2KYZA 2VQFJ 4ZVUB 2M52A 2L41A 4KPCA 1N5YB 4CLUA 3DDKA 3BR9A 2ZHBA 1I5OB 3R9LA 4CCHA 1D8YA 2QX0A 4X4NA 5F41A 1N34J 3C19A 3WX8A 4F4ZA 1NPRA 2GGPB 3FCHA 4ZHRB 3UVJB 1R0AA 4BDPA 1PJ7A 2UU9F 3D3CJ 4J91A 2ZH7A 3QJLA 1JLFA 2CFXA 3K5OA 2VFRA 1FX2A 4ELUA 1TP7A 2DR8A 3QWUA 4IR9A 2VJVA 3AHPA 4OL8A 2E44A 5C42A 4DDFA 1SBRA 2MTLA 3H25A 3M05A 2R7TA 4HH1A 2VL1A 3GP9A 3TQ1A 4R8UA 1IKXB 3LO3A 2K7KA 2XGPA 2HVZA 4LF7F 4ZVRB 3DOKB 1TL1B 5IC4B 4CI0B 3S1TA 1N36F 3O44A 2QLXA 3TVYA 4J9OA 1H38A 2E29A 2DRBA 2C3UA 3M2UB 5LM7E 1V5VA 2ZH4A 3UR3C 1DRZA 4LF8J 4KO0B 3G4SS 3HHLA 4Q2LA 4XDDA 2FC8A 4N77A 5KG3A 5CYQA 1J5EJ 2ASJA 5BYRA 1P27B 3HLUA 2XS7A 2BJ7A 2ZH3A 5I4MA 4RBTA 4WFNQ 1R8BA 4X64F 1TKXA 2YX7A 3GE9A 1CJKA 1D09B 4CLPA 2VHGA 2R2UA 2CZ9A 3MM6B 3MM7B 2WZ1A 2HQFA 3NWRA 2ZBIA 2OLWA 1W2IA 3B54A 2NXNA 1CQNA 2ZEJA 5GMKa 1JMTA 1XMBA 3MD3A 4IFYB 2UVVA 4CNYA 3KUEA 3EVOA 1KRPA 2XSFA 3QIDA 4F3QA 2DNZA 2EVZA 4DV2F 4DX6A 4Q7AA 3HZGA 3SV4A 3TUPA 4B9NA 2D9PA 2E9RX 4MKBA 1RWVB 4DL6A 4ECSA 4NLWA 4BBYA 2V8HA 1LK5A 3IN5A 1LW0A 3PYGA 3MHYA 1U2RA 3FEYB 4OV1A 4O3NA 5GAEU 5KT6A 2YKAA 4OV6A 5BXIA 3M7VA 2C42A 4F4WA 1X9WA 3SQOP 4AQYF 4PXDA 2WVBA 3GIRA 1CULA 1KLMA 2VBZA 5ETKA 3J7YU 1OSCA 1URNA 4JI0J 1RWKB 1BY9A 4QYRA 2YQ0A 1UJ6A 3IAS9 1T94A 3RGIA 1CC8A 3CF5Q 4QWBA 1NB7A 2D9OA 3IS9A 2ZZMA 1JJ2R 3BSAA 2YKOA 1AUSL 3KMSA 4PEOA 4OYAA 1KVKA 1VHIA 3TARA 3GJTB 2GMHA 1SJ1A 2M2BA 4ENOA 1Q81T 3NGUA 3V2UC 2XC9A 3OL8A 2RNEA 3QZ7A 1X0FA 1CEZA 2EC2A 2VPYB 4H54A 4NRTA 3MM8B 4C0BA 5E2QA 1P1TA 4J9KA 1H73A 3RU0A 2HSEB 4OI6A 3G87A 3TJ8A 3GFZA 4O3SA 2JC0A 1Z2LA 1E6YB 2XY5A 2VDIA 2QRRA 3UNYA 4DPWA 3WIUA 1NUEA 2HBZB 2AWZA 3A4TA 2DR7A 3G9CA 5LT5A 4EZ9A 5A8WA 2RJZA 4F0MA 1TUVA 2YPYA 4M5DA 5KFZA 3R6LB 4O4RA 3P3DA 4C8NA 1GX5A 2RQMA 5M2PA 2HHHJ 3J7AN 4QPTA 8AT1B 1IKVA 2E5HA 3CJ0A 3US5A 3G6ES 3IWNC 1RACB 3SYZA 2MQOA 3MPYA 5EN1A 1U1PA 1HW8A 1QTMA 3N01A 4DWIA 3DMJB 1WSRA 3MEDA 2VFTA 4A8WA 1T03A 3U1MA 1G3OA 4PKDB 3RUBL 4RW9B 2EFGA 2NXCA 3W5ZA 1JK9B 1T95A 4J9UE 4ZVOB 1VQKS 3GV7B 3QFHA 4LBPA 1NPKA 3EE3A 3GJRB 4XTTA 1OQ6A 5L1IA 2Z30B 2FLOA 3BV8A 4ED4A 1BQXA 3MMAA 2GS8A 3MUMP 3TEHB 1HNVB 4XPCA 1G4CA 4CH0S 3UD4P 2DHHA 2OD4A 2ABYA 3FKBA 3FEZA 2YNGB 3QJJA 2I9SA 2K8GA 2WBMA 3I0RB 4AE5A 1VC6A 4OYIA 3GIIA 2AX1A 2QA4S 4DR3J 2RAQA 3HX9A 2WONA 2EK1A 2HFZA 1YJTA 3OL6A 3EVWA 4FF2A 1T3OA 4NYPA 1RYRA 1RKJA 3L09A 2IHR1 1RT1B 2XQCA 3VWSA 5B0BA 3AXKA 4PG7A 3FDSA 1LWXA 3A12A 1SJ3P 2Y3YA 2HFSA 3FRZA 5LXRA 2QZ8A 3OR1B 3EUNA 1CJVB 1YHQS 4E2FB 2O1PA 4RJVA 4OYXA 2QMUB 4DR4F 4XK8C 2Y1LB 3AB2B 1H2VZ 1TK5A 5RUBA 2Q1LA 3VALA 1FTCA 3AD7C 3ZZTA 5T7LA 1LWCB 3PW7A 3H4DA 4ZP9A 1KTQA 2V2QA 4XDCA 2FB0A 3V81B 2DYAA 4TU8A 1WOSA 2R7WA 2ZJPQ 4LSLB 1WDDA 1N56A 3H90A 1D9AA 2OPQA 2ZBRA 4ED0A 2XMTA 3OR2B 4RNNA 3P96A 2MHNA 3ILJA 5F3TA 5EWGA 2DIVA 2PI5A 3C15B 4LF5J 2BOAA 4FKYA 1KKHA 3V6JA 2HGMA 2IAJA 4U7UK 1KNZA 5ETTA 3HD1A 3Q8VA 3DCAA 3HJVA 2KZZA 1I94J 3IMQJ 1YK9A 4WYWA 3V6KA 9ATCB 5CYMA 3NBPA 1DTTA 4DR1F 2VV5A 1OIAA 4NLRA 1JLBB 3RBEA 2KZMA 3A3NB 5F3ZA 2H4YB 2XTJP 1O8BA 4QU6A 1SB6A 1SQGA 2X1AA 2APOA 4LR7A 3ETMA 1RADB 3HHLD 2KM8B 2QO3A 5F9LA 1NU4A 5C5JA 1QAXA 5I3PA 3QIPA 4TYAA 5F8NA 2DR5A 4Y6IA 3CEDA 3VAIA 4DCOB 1NJWA 4YB6A 3I82A 3IGNA 1H6KX 2P6SA 5D15A 3BN4A 2MKKA 3DRSA 2WRMA 2QGFB 1IBKF 4P7TA 2HFOA 1UFLA 3IR6B 1ZA1B 2KRBA 3HT0A 1XMOF 2PT0A 1HQEB 4WP8A 2OFHX 4IOBA 3CCRS 3MFIA 3H42A 2ZBPA 1OY8A 4J9NA 2ZH1A 1JLCA 4OYMA 1K44A 1GNKA 3IWLA 1JNZB 1U09A 2L3MA 3LALA 3MR6A 2R4FA 4G1IA 3SBMA 1FTRA 3NOCA 1X5OA 4LFAF 2XCPA 2B3TB 1BQNA 4CO3A 1PAEX 1UJ4A 2V8DA 2EFVA 3PJWA 3G82A 4GVLA 3D4JA 3MMBB 4ERDA 4QW9A 4USTA 1RTJA 2CZ4A 2PA8D 3HD2A 2E7WA 2MQNA 1KFSA 5HMYA 2Y8YA 4ELVA 1CS4B 2A2CA 5DO2A 4ZVTB 1UVMA 3OXGA 2RDJA 3RW6A 2QIFA 2LEBA 2VG7B 5HQMA 4ZVGA 2CJXB 1HBMB 4HYKA 2YNFB 4DFPA 4KIAA 3RB6A 2PEBA 3TZZA 3D28A 2BJ8A 3OTOF 1X4AA 2CQ4A 4C3KA 1TKZB 5C24B 1TL3B 1S9GA 1UZDA 1WEZA 1IUJA 2HHTA 2YX1A 4CLLA 2M70A 3HF5A 2YNHB 1X9SA 1R6VA 2LU2A 1QVFR 2AU0A 4LFBJ 2HHQA 1TL4A 3T3FA 4RW8A 4DSFA 3EPGA 5ETOA 1F5BA 2HZAA 2EFNA 4EBEA 2HZCA 4ECZA 2IC3A 2FVQA 4CLZA 4KRWA 4DX7A 1T3NA 1S1VA 4O3PA 3ONQA 5CD4A 3PX6A 4ZPCA 4IRKA 4FKXA 4ECUA 3ITHB 3VQTA 3G6VA 7FDRA 3MOJB 2VU5A 1AT1B 4USVA 2ATCB 3SCIE 4P71A 3NG8A 3I32A 2JX2A 4ID5B 4EMDA 1UVJA 1EQ0A 4C8LA 4HI2A 2N7YA 3ZZZA 2VQFF 4KHPJ 1WJ9A 2BZ2A 4LRBA 1TL5A 3EWGA 2KT3A 3O1LA 1H3DA 4NA2A 2GGPA 4ZHRA 3DLGB 1FKPB 1C0TB 4KHRA 4PAAA 1N34F 5SZTA 2XLKA 1J2VA 1GH8A 2KHCA 1S49A 2YKNB 2NR0A 3G96A 3PEHA 4F0HA 2V0NA 2JL9A 4RW6A 4Y3CA 3K5LA 3MPVA 3C16B 1Q7LB 3M6XA 3Q83A 5I42A 5IOLA 1LFPA 2ZBCA 3KK3B 2DNHA 4WPAA 2UZAA 1FRMA 3D0IE 4NLUA 4YS2A 4K4YA 2N7CA 4WFXA 1C0UB 3EZOA 1T9TA 1Q79A 3D0GE 3P5BP 1AROP 4NEZA 5J1PA 4DS4A 1VQ7S 2CJKA 2JLEA 3TA0A 5B0DA 1RP5A 4KR0B 4E8UA 2H5EA 1F2HA 3M2UA 3FSYA 1F9EB 3BEGB 4WYLA 4Z2XA 5L1KA 2M8HA 5ETSA 4CO5A 4RBUA 1Q5YA 2E7VA 2CJYB 2HVIA 4YUDA 1UCNA 1FD2A 2NXUA 4LF8F 2BACA 5F8MA 3FMBA 3QZ8A 5KFEA 1R7IA 2VBYA 1DQ8A 1O0PA 4TU7A 3FVYA 4RW7B 1J5EF 3DOMB 3N6NA 1NEEA 2OMOA 2NYIA 4DF4A 1D8ZA 2Q79A 1H98A 1WORA 4QR1A 3MM6A 4DV3J 4AL5A 2DH7A 2CQPA 2YKMA 2VG5B 2QYCA 2IM3A 3DM2B 2HHWA 2HQGA 4ANEA 5LSOA 4C0HA 3W2VA 1D3WA 4PCQA 2CG4A 3VCDA 3Q8SB 1KQKA 4JI5J 2N82B 4IFYA 4LIRA 3G2XA 2D3UA 3KJVB 1KD1T 3NP5A 2O5DA 4NMXA 1HR0J 5ETRA 2AJ2A 2W4DA 2E7XA 5EWEA 1FKOB 5F0WA 1RT7B 3OHBA 3HVTA 6AT1B 2QFIA 1BE4A 1RB0A 3VAGA 4O0NA 2V8VA 2XMMA 3I0SB 2XZTB 5CABA 2GW8A 4DSKA 1N32J 1XJWB 1TMMA 3VV2B 1KWMA 5IM0B 1VQ5S 3PYFA 5DG9A 1QLNA 3CT9A 4ES2A 4J9QA 1YZ6A 3W2WA 2CPZA 2V4JA 2DEIA 1HWLA 2CQDA 3HT3A 3DLJA 3PFEA 4DPXA 4JI0F 1UEUA 2FHJA 4J7CA 1NSAA 1M5OC 3SSSA 2MZ1A 3UDEA 4HKQA 3HULA 3HI9A 2IJFA 1NLKL 4EBDA 2IJRA 2KYXA 1KBRA 2LXIA 3T5LA 4DUZJ 3RYLA 1VISA 2RMLA 4LJMA 5EGYA 5SUHA 4ZPTR 2FJBB 1WKKA 1VBKA 1AZSB 3L95X 2AGQA 5GMEA 2VPXB 1V3SA 2CQHA 3C14B 3RZAA 3WX4A 3MMCB 1C1BB 2HHPA 3CMAS
chains in the Genus database with same CATH topology
5KFJA 4A8SA 2EI5A 4DSIA 2EG1A 2RILA 5IT9Y 2UUWA 1TVRA 1FNOA 4DHVA 3UR0A 2ZE2A 2LU1A 3MM8A 4AFFA 3MR2A 3CJ5A 3QYYA 2OTLS 1IJEB 3CD7A 1YVFA 2V8GA 4RW4A 1WHYA 4IH5A 2KB2A 4EO8A 4KSEB 1QUPA 2HS4A 3M6WA 3SQGA 2HMIB 5B0AA 3CD5A 1OS5A 3PR5B 4EEYA 1X4CA 2QMXA 2YTCA 4IOCQ 2B5JB 1JLQB 3CB4A 3I5BA 1H2TZ 4V19J 4B9MA 3EXCX 4URQU 4ZPDA 3M6VA 3HXMA 3ZZYA 5J2NA 5DQHA 2MQPA 4W92B 4AL7A 2NREA 3T6JA 2WONB 3M2RA 3PDNA 1DFDA 1RWUA 2HGLA 5DQIA 2UVRA 2QV6A 2JLGA 2IA0A 3O6QA 4E98A 4LFCF 2HGNA 1RGVA 2W7OA 2LDIA 2VZ9A 3TOQA 2R2RA 4MKYA 3LP1A 2FDNA 2RD5C 3CCMS 2F3JA 3OTEA 2FJEB 2ILYA 3F44A 4ID5A 4OLOA 4F3OA 5D3GB 2CVEA 1T05A 3O2IA 1X5PA 2R7UA 2I5JA 1FK9A 2EKYA 1N48A 1I1GA 2MYFA 3DRPA 5DLGA 1VBXA 2EK6A 3F56A 3GFHA 4LVNP 3T5HA 1VBZA 3X1LB 1S4FA 1SV5B 4P2SA 3LP2A 2CPEA 2W24A 3VAMA 5KG0A 3BQ0A 5AXKA 3QAUA 1SKWA 2VG6A 4C3LA 4C98A 1NK9A 3TANA 2IVMA 4DQSA 5KFAA 3SMZA 1DZ5A 4ETZA 1T8EA 2UUTA 4C8MA 1F60B 1LWFB 1HW9A 4ED7A 3MEKA 4F50A 1I6JA 3ZFVA 2D41A 4WZQA 3QWPA 2GO9A 4DN9A 1ZPVA 4I7FA 4CQ1A 3MM5B 2KHDA 1PGZA 1ELOA 2HHHF 3R27A 1BWEA 4LSNA 4NA3A 3TRGA 4ES1A 5D78A 3VF0B 1IBMF 4O3RA 4WKYA 2ZITA 1QVGR 2N3LA 3UE2A 2ZFHA 3DMJA 4XIUA 2HWHA 1L3KA 2DGTA 2FPHX 3OFFA 4WFAQ 4MIAA 2BA9A 5JVGQ 3U1NA 2AF6A 3R1LA 5A0YA 4I1TA 3MFHA 2ZNYA 5B0EA 2BDPA 2EC0A 3E2EA 2YKNA 1H2UX 4PPDA 5HL7Q 1BLUA 3C46A 4RBVA 4J9LA 3D1QA 1RT2B 3T5JA 2MPUA 4RW9A 1YQHA 5I3UB 2QA4G 2DNLA 1EETB 3POTB 3BGRA 4U7CA 4A48A 1FO1A 1RT6B 2XWXA 3RRGA 4JI4F 1Y7PA 1YGYA 2YH0A 4TXSA 2YX4A 3T1AA 2KFZA 2M8DB 4GO5X 4Y65A 1V3RA 2Z4PA 4HT5A 1C4AA 2COLA 3MECB 3KHLA 3RAMA 4DL2A 4W90B 3D0HE 2RT3A 4I2PB 2Z2LA 2UUAF 1JIHA 4FYDA 5H1SV 5HBMA 1VI7A 4RUCA 2RU9A 4TLQA 2C2EA 3LWMA 2JSXA 2OPQB 4OX9F 2MZJA 4Y2CA 1LQ9A 3HKWA 4FXVA 1S6OA 2OPPA 2DGVA 5KFOA 2KT5A 2XEXA 3MR3A 3OW2R 3CUNA 4ZVHA 4L72B 3PIOQ 1GTEA 2KTQA 1HNVA 1VFJA 1VRTB 2V9KA 1FRXA 3MD1A 1KOOA 4DN0A 4PG8A 3D1OA 2ZH6A 1HMVA 2RUGA 4PQAA 5F8LA 3JB9k 2FJVA 2RVJA 4ZDNA 1IR0A 1N33F 5HROB 4MK9A 4NRUA 2VFVA 4ETXA 3U1LA 2XBPA 4WF9Q 3MMJA 1QSSA 2CQCA 2R7OA 2EFPA 4X4UA 1WEYA 2WCXA 5LXYA 1X0PA 1RA6A 3OHAA 1NJXA 1KS2A 4WK1A 1YWXA 3HHNB 4I0WA 2GC8A 1PC4A 3OVAA 4PUOA 2CQ3A 2SXLA 2ASYA 3FJ2A 4WTYA 1KEKA 4DSLA 2IFXA 2BM1A 2HAIA 3OSPA 2BQUA 1Y0HA 1JKHA 3NCPA 5C42B 4DL3A 2JEFA 3I0RA 4OI1A 2ROGA 1JLAB 4LUBA 3LANA 1FXLA 5DQGA 1UJ5A 4OX6A 4C11B 2GIRA 1K8AT 2PN6A 2CPYA 2HQ3A 2DGWA 2J8AA 2MZQA 1NHVA 4ZCMA 1S7HA 3NBPB 1DTTB 3LP0B 5CYMB 1U6ZA 4C3MA 2JFDA 5KG5A 2KJWA 4K2XA 3GIJA 3RAQA 2OJ3A 5F9NA 4R8UB 4ATNA 4JI7F 3C6TB 4IG3B 3DLHA 2ZHOA 1M90T 4RW7A 3EZ5A 2HHSA 2CDQA 2FD2A 1LKZA 3IFEA 5KFVA 3S7RA 4DR3F 2JRSA 1RISA 3DOMA 4TQRA 1SJQA 4Z37A 3N0VA 3GFXA 3QLHA 2FHMA 4ZLPA 2W4PA 5D4PA 1ZH5A 1Y5NB 3QPIA 4E0DA 4PG6A 3SEOA 1HBNB 1RT1A 3K5MA 4DV6F 3IR5B 3K0JA 1WNEA 1SH2A 3FQKA 2U2FA 4G3IA 2PA3A 1Y5IB 2RRNA 1U6FA 4X65F 1N0UA 2VG5A 3K59A 1S79A 1CVJA 1XWLA 5KFBA 4NLGA 3CPWR 4ZCKA 2UVUA 1NKBA 3FSIA 2I8EA 2L08A 5AXLA 4JUZA 1URRA 4C8YA 1QSLA 1NK5A 3QGHA 1JLEA 3ISZA 3CCES 2XSJB 5C25A 5CYQB 4YQWA 2GMLA 3J7Z5 2E5IA 1LWEA 3N6MA 3TR5A 5LJ5Y 4FN5A 2BUNA 3TUIC 4KT0C 2J7KA 5D8HB 1U1OA 5L9NA 5AJ3F 3RRHA 4C0OC 4EO6A 5GAHI 1D9DA 5KT2A 4UOCA 1CLFA 1M1KT 4O4GB 3GV8B 4OX7A 1VK3A 1KQSR 5CA5A 3H40A 2N4CA 4U6PA 3DC2A 4FVMA 3NCRA 3E8OA 3DYAA 3OFHA 4Q45A 5J2QB 3DXSX 1LXJA 3PACA 1GX6A 3DLLQ 4M1KA 4N8NA 4A8YA 4H4OA 2FVSA 4QU7A 4O23A 1FNXH 1FKOA 1DBDA 2HLUA 1UEVA 5JUMA 5B0CA 1RT7A 3O5TB 3ISND 4F2SA 2Q6CA 3MM9B 5KG4A 2K3IA 4CZCA 3R1HA 2MKCA 2OD6A 3MEEA 2ASDA 5GVQA 3JYTA 1G7CB 4X4VA 2GJIA 4D3HA 5L8RC 2JC1A 3SI8A 3OV7A 2R8HA 4FBTA 2BM0A 3GYXB 3GILA 1IQZA 1SH0A 2OKQA 1ZAXA 4OZNA 4AXIA 4KB7A 2IM0A 4LSLA 1IKYB 4XPEA 1JLCB 2JJ4D 4GO7X 4IH7A 1UWBA 2DB1A 3EX7B 1TFWA 5KAKA 1C2PA 5B0GA 4I68A 1Q8IA 4YR3A 1VGYA 5IM0A 3PX4A 1N32F 2Z0GA 5K14A 5J1NA 3OR2A 2E9ZA 1OSDA 4FXDA 2MZTA 3MEGB 5DETA 2HNZB 5D6GA 3NMAA 5DJBA 2KO1A 1ZYQA 2F7VA 2XWYA 2C3OA 3T1HF 1S6PA 4ED8A 1YTYA 3PVXA 4JI3F 3MOZA 4B3OA 3TAMB 3H59A 3NCQA 1TV6A 5E3PA 1M5KC 5IT0A 2LECA 3LAMA 2ZH9A 4KC5A 1Z4UA 2EPIA 4CO4A 1LW0B 4F26A 4HT7A 1RTJB 5M2RA 3THTA 2MKHA 4F3MA 4K4SA 2KU7A 2DD8S 4NWBA 2XHWA 3SDEB 4NLTA 5F8JA 3UI3A 4LF5F 4ILMA 4R5PA 4TY8A 1WEXA 4MMOA 3HKZD 4YDDB 1EP4B 2CPIA 1FRIA 5M2UA 3ENVA 3KLEA 2KG1A 1IN0A 1HI8A 1BD6A 3E01B 3NAHA 4IO1A 2XI2A 3TW0A 3KLGA 2BE2B 2AJ4A 1JLBA 3BGLA 1I94F 4FS1A 1MNEA 1E6VB 5I3QA 2NPIA 3G8SA 5F8HA 1S9EA 2BVZA 1FJGF 2CRLA 1S0VA 1VQPS 3V4IB 2EFOA 3R5BA 2XY7A 5E3AA 1U1MA 5K5MA 4J9RA 2FTRA 2ZM6F 1C4CA 2W7PA 4NOHA 2NSBA 2MDAA 2XLJA 4MYTA 4LVOP 2A1BA 3KK1B 4UQGA 1U8SA 4ITSA 1XC9A 1KLMB 2IVYA 1S97A 4LF6F 4ZPWR 2DR9A 2KT2A 2RKIB 4DL0C 1SC6A 4KQZA 4ES3A 1OPZA 3U7JA 3TI0A 4GMKA 3PKM