3VAKA

Structure of u2af65 variant with bru5 dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
molecule keywords Splicing factor U2AF 65 kDa subunit
total genus 42
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vakA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vakA02
2I2YA 1VQMS 1VQ4S 4TU9A 3G96A 2YH1A 3EGZA 2ZJQQ 2MKIA 1XN9A 2M7SA 2M9KA 4Y00A 5LJ5Y 3CC4S 2XS7A 3NNAA 2MQLA 1KOOA 3CMAS 1VBYA 2M70A 2JVOA 1X4CA 2CPXA 1SJQA 1SJFA 1WHWA 2HYIB 3B4MA 2XB2D 1SXLA 5HO4A 1KC8T 3TO8A 2MZRA 4QU6A 5GAEU 3K0JA 2V94A 2N82B 2X1GA 2BOPA 2CQPA 3NNCA 2YWKA 5LXRA 2K3KA 2MZJA 1FJ7A 2MKKA 1KQSR 3FEYB 2RS2A 2LA6A 2DNQA 3TYTA 2MXYA 3MDFA 2MQNA 4WFBQ 2MYFA 2MKHA 2KM8C 4WF9Q 3BO3A 1X4EA 2KXNB 3CXCR 3VAIA 2ADBA 4WFNQ 1FJCA 2E5HA 2G1DA 1N54B 2LA4A 2CQIA 2L08A 4C4WA 1OO0B 2DB1A 1U6FA 3CCUS 1H2UX 3P6YC 1WG1A 2OTLS 1YIJS 2QEXS 2RRBA 1JJ4A 2G0CA 3VAHA 3SDEB 5BJRA 2DITA 2KRBA 3OW2R 2M0GB 4QPTA 2MZSA 5DM6Q 2FHOB 2MQPA 5DM7Q 1WF0A 1NO8A 1Q7YT 2MZ1A 2LYVA 4CH1A 1X5OA 2OSRA 2FC9A 1Q81T 4ERDA 1S72S 4M5DB 3P3DA 3V4MA 3VAKA 2DO0A 2HVZA 1VQ7S 3NMRA 1YJNS 4PR6A 2DHSA 3SDEA 1OWXA 2DIUA 2GHPA 1X4DA 3Q2SC 1WHVA 2J0SD 2L41A 2X1FA 3H2VE 5IQQA 1X4BA 5GAHU 2KG0A 3ZZZA 2RVJA 2NLWA 1KOHA 1QM9A 4WIIA 2XS2A 1HD0A 3CCSS 2JWNA 3CPWR 2CPIA 2DIVA 4WFAQ 2X1AA 5JVHQ 2VONA 2MY8A 4Y0FA 4WCEQ 3G8TA 1VQKS 3CCES 2CQCA 1X5SA 2HGMA 1H6KX 1U2FA 5HL7Q 5H1SV 1H2VZ 2E5JA 1U6BA 5LJ3Y 1VQ6S 2CJKA 2N3LA 2RS8A 1X4FA 2RT3A 3VAGA 1DZ5A 2XS5A 1WTBA 2F9JA 4CH0S 1X5PA 2YTCA 4U67Q 1FJEB 2KXHA 2D9PA 4A8XA 3ULHA 2ERRA 1YJWS 4FXVA 1URNA 2OSQA 2DGQA 5ITHA 1WG4A 2G4BA 2OIHA 1HL6A 2F9DA 4WKRA 4LJMA 1SJ4P 2N3OA 2O3DA 4OZ1A 1X4HA 2EK1A 4ZKAA 1AUDA 2AYMA 2DK2A 1CVJA 2DNHA 2M8DB 3U1LA 2MSTA 1K9MT 2XNRA 4IUFA 2J76E 3CCMS 1M5OC 1P27B 2KI2A 2MKJA 2U2FA 5CA5A 2U1AA 3MD1A 5LSOA 2FY1A 1ZH5A 1X5TA 1FXLA 3PIOQ 1FNXH 3CCVS 1PGZA 1YHQS 1JMTA 4F25A 2CQBA 2KU7A 2DGSA 2KT5A 3S8SA 1X4AA 2CQ2A 5DDRC 2DNYA 4EGLA 4YUDA 1VBXA 1JJ2R 1VQLS 2UP1A 2KXFA 3S7RA 1O0PA 1U1QA 1M5KC 4UY8T 1VQ5S 2MB0B 3CD6S 2ZJPQ 1HA1A 3R27A 5D78A 1WG5A 2DHXA 3UE2A 2VODA 1VQOS 2LECA 2CQHA 2MZTA 1WHXA 4IO9Q 2AYEA 3BEGB 3ZZYA 4J5OA 2DNOA 1L3KA 4TU7A 2HGLA 2DO4A 5GMKa 3Q2TC 1R8PA 2MY7A 1IQTA 1YWXA 3BO4A 2CQDA 2KFYA 2AYGA 3DLLQ 2EK6A 1QVFR 1FT8A 4TLQA 3CTRA 2MSSA 1ZZNA 2LEAA 2MPUA 2LXUA 2CPHA 1WWHA 2J8AA 2MKSA 1DBDA 4YOEA 2RQ4A 3VF0B 4V19X 3SMZA 2AYBA 2DGXA 4PRFA 1OIAA 5IFMA 3NS6A 5DDQC 2LCWA 2DNMA 2LXIA 3P5TL 2CPDA 2DHGA 2DNNA 2KH9A 2XNQA 3FEXB 4QQBA 3HHNB 5IM0A 3P49B 2DNKA 2JX2A 2JRSA 5CXTA 2KVIA 2DGTA 1N52B 3VAMA 3HI9A 2BZ2A 3RW7A 1A9NB 4RU2A 2VOPA 2A3JA 2CQ1A 2AD9A 1U1OA 1WI6A 1RKJA 3EGNA 3S01A 1X4GA 2DNGA 2KN4A 5GADU 1HD1A 2MGZB 2MQMA 2DNRA 4W92B 1WELA 4LIRA 1S79A 3MUVP 1WF2A 2EVZA 3THPA 2DNZA 5GAGU 2CPEA 1A7GE 2CQ0A 3R1HA 2M8HA 4PKDB 2D9OA 2MHNA 1U1NA 3JB9k 1N88A 3IRWP 2M2BA 3G71S 3IWNC 2QFJA 2DH7A 2J0QD 1VBZA 5CYJA 2MQQA 2FPHX 3L3CA 1P1TA 3H2UB 3NS5A 2MGZA 1VQ9S 3THTA 1WEXA 1H2TZ 3MURP 3EX7B 3G6ES 1VC0A 3UWTA 5DDOC 3I56S 1N8RT 4BS2A 1Q82T 3CCQS 2YH0A 2MJUA 2M4MA 4F26A 1ZZFA 4ED5A 2E5GA 2MKCA 1VQNS 2DGUA 2LKZA 5IM0B 3UD3P 3US5A 2QA4S 2E44A 2L9WA 1OPIA 1M5PC 2CQGA 1DRZA 1U1RA 3SXLA 1KD1T 2KRRA 1VQPS 3CCLS 2MMYA 1BY9A 1SJRA 2DGVA 1UFWA 2RRAA 2DGOA 3B4DA 2D3OR 2VOOA 2DH8A 3CC7S 2N7CA 5FJ4A 3S6EA 1JJHA 3VALA 1NU4A 3U1MA 2KM8B 3CUNA 1SJ3P 3R1LA 4C0OC 1M1KT 2M88A 1R8HA 2CPFA 3MUMP 1FHTA 1FO1A 2SXLA 2DNLA 4LMZA 2HGNA 4UQTA 2Q79A 2LMIA 2WBRA 3J7YU 4CQ1A 3BO2A 2DH9A 1Q86T 2KHCA 3UCUP 2OTJS 1WEYA 1U1KA 1D8ZA 3CCRS 2B0GA 1UW4A 4IOCQ 2F3JA 1WF1A 2MZQA 3NNHA 2KG1A 1VC6A 4F02A 1M5VC 2MQOA 1U1LA 3MOJB 1U1PA 3RW6A 2DHAA 4QU7A 1F9FA 2DNPA 2CPZA 5LXYA 1W2BR 1M90T 1UP1A 1DHMA 4CIOA 2OJ3A 2I38A 4Z2XA 4TU8A 3TP2A 3D2WA 1B7FA 2GO9A 3VAJA 5DETA 2DISA 2NZ4A 1VC5A 2JVRA 3J7ZT 1QVGR 3VAFA 4OZ0A 2MJNA 4P6QA 1WEZA 1WI8A 3LQVA 4FXWA 3MUTP 5LSLA 1YJ9S 5MLCV 1NJIT 1K8AT 2DGWA 3MD3A 3UCGA 3PIPQ 2HZCA 3CC2S 2RQCA 5DDPC 1X0FA 4C7QA 3G8SA 3G4SS 1WHYA 2FC8A 5JVGQ 2RNEA 2X1BA 3MXHP 3BS9A 1YITS 3UD4P 2CQ3A 2LQ5A 2RU3A 2ZJRQ 1U1MA 3G9CA 1VQ8S 3DXBA 2YKAA 2CPYA 3N9UC 5GVQA 3UCZP 1K73T 2PE8A 2E5IA 1D9AA 1UAWA 2LEBA 2CPJA 3I55S 5D77A 2CQ4A 1YTYA 2K8GA 1G2EA 4W90B 2M52A 3CCJS 3CMES 1RK8A 2PEHA 3MI7X 3LPYA 3CF5Q 1YI2S 1PO6A 3CULA 4IOAQ 5EN1A 2KYXA 2XSFA 2RUGA 4YB1P 2ADCA
chains in the Genus database with same CATH superfamily
4J9SA 3BYPA 3PYGA 1PYSB 2GHVC 2DPJA 3G96A 4ELUA 4NRTA 3MCNA 3QSYB 2XMWA 4GO7X 4Q45A 5I3UB 4ECRA 2HWIA 2AJ0A 4Y00A 3OVSA 2J7UA 4JV5F 2R7QA 3LAKA 3CC4S 3NNAA 3MMCB 2FHJD 4H4MA 4E2FB 3CMAS 2ROPA 4H4OA 4EFAC 2W9BB 3RR8A 4F4XA 1LFPA 4I6YA 2NXNA 3OLBA 1SJQA 2VL1A 4MKAA 2HYIB 3D3CJ 1FWLA 2XB2D 1KVJA 1KC8T 1KNZA 3GFYA 3TO8A 4ATNA 3BGFA 3T19A 2LLZA 4OX7A 5IWAF 3A3NB 2UVUA 2RAQA 3TJAA 2UXCJ 1H74A 2JOQA 3HJVA 1U8SA 3FCWA 2WBMA 2ASJA 1KTVA 2RQMA 1FJ7A 2MKKA 3ETOA 4BCAA 3FEYB 2VQFJ 4V1Ak 5KFWA 1O6XA 1QJHA 3BGUA 4ZN3A 3EZUA 3LGNA 3M6UA 3TYTA 2MXYA 3CEDA 3UDEA 1CULB 4PXBA 2IC3B 2C2DA 5T41A 2KM8C 2XHCA 4WF9Q 1RAEB 3IR5B 2D3UA 4KSEB 2KXNB 3KK1A 2V69A 2IDEA 2F8MA 2A10A 3NMAA 2AZ3A 1O8BA 1N54B 4RW6A 5F0WA 3WC0A 2BW2A 1N0VC 2LQ9A 5KFTA 5DJBA 4F3QA 1NPRA 3H5SA 4W4MA 2GC8A 2QSWA 4B9UA 4H54A 3P6YC 2ZH9A 1KRPA 2V8HA 3TA1A 4E98A 3DU6A 1YIJS 1UEVA 1BQMB 2RRBA 1FRMA 2WK4A 3B82A 5KFSA 2QEXS 1EQ0A 4C3LA 4QR0A 2H5EA 5BJRA 2BDPA 2KRBA 1KLMB 3OW2R 4IQXA 3WC2A 1V5IB 2AJQA 3FVYA 3JTOA 2VF3A 2YWEA 4P2MA 1HPZB 3W60A 1LV5A 2IA6A 1NEEA 4M5GA 1D09B 5A8RB 2H4WB 1F60B 3I4PA 4X84A 1TK5A 4EYHB 1VFJA 4QPTA 3VR1A 3W2VA 5KFFA 5DM6Q 2FHOB 2J9DA 4IOBA 2GQ2A 3D68A 3HFZB 4Y6IA 1KQKA 1RWVB 3NOGA 5HAOA 1HI8A 2HFOA 2IAJA 3FZ2A 1WF0A 3M6VA 1NO8A 1I94F 2VBYA 5B0GA 3GZ7A 3ICLA 3FSYA 1X5OA 2JL9A 2FC9A 1Q81T 1IKXA 1S72S 1WJ9A 2Z56B 2NYIA 1GMWA 2QL5B 4ELTA 3QGHA 4PG7A 3MAAA 1HNIA 4TNOA 3N28A 4RUAA 3CGIA 4QWEA 4IRDA 3QZ8A 1YJNS 4PR6A 2NUUG 2RILA 2DHSA 3SIPB 5C2CA 1NUEA 1TL4A 3JQJA 2QZ8A 2Z4PA 3Q2SC 2W8KA 2UXDJ 3PZPA 2J0SD 2LDIA 4NASA 2C2OB 3LP2A 1P9YA 2I0XA 1DURA 1C4AA 2NYHA 1RT7A 2O01C 3HSGA 5C42B 4CRJA 2A2CA 2WAQD 2D3ZA 5LMUJ 1JIHA 2NLWA 3MMBA 3C46A 4A4JA 4HTIA 1QM9A 4LT6A 3EPGA 4YFUA 3F44A 1S49A 2UXDF 2BE9B 3DHWC 3IR7B 2QJ3A 5LSRA 2R8IA 1H72C 5JVHQ 2VONA 3K8VA 3MAAB 1HI0P 2XMUA 1Q1KA 2CVIA 4WFZA 2C2NA 1IKXB 1E6YB 2F7VA 4U6PA 3CCES 2YBVA 4A8SA 4B3RF 4P75A 1X5SA 3PYEA 5DZ7A 2UXBF 1REVA 2HHVA 5J2QA 2XC9A 3BM7A 1WOPA 3KDOA 1RT5B 2IVFB 3NEKA 2IM2A 1EP4B 2XG8A 1U8WA 3PXGa 3SQGA 2W2PP 2YNFA 3VZHA 4AFFA 2K1RA 4FS1A 1U6BA 1VQ6S 2CJKA 2N3LA 3VAGA 4CLTA 2ZHBA 2XS5A 1C1BA 2PMHA 4ELVA 4B3OB 4OFZA 1RT7B 1S59A 2B7CB 4DUTA 5C42A 4JBCA 4CLFA 1L3SA 2UV8A 2IVMA 3MM7B 5A8WB 5F8HA 4QCLA 3GWCA 3DM2B 3DLHA 2C2MB 3OL8A 2DGQA 5ITHA 2XY5A 4NXNJ 3TOQA 5IZHA 2QYCA 3LF0A 1VRTA 1GT8A 1RHRB 4ZPDA 4ZJLA 1FA0A 4J91A 3BB5A 1UW9A 3AA9A 4PG6A 3CJKB 3SEOA 2Z30B 3N5BA 2VJUA 2FVSA 2OIHA 1T3OA 5BR8F 2JEFA 1HL6A 3BR8A 4WKRA 4I69A 2HHPA 3RRKA 3V6JA 1RT1A 2V4QA 5LMNF 2EK1A 4MYTA 4HYKA 2XI2A 2AW0A 1YJVA 1FCAA 3A8IA 6AT1B 1V6HA 2Z0GA 1XMQF 2VA3A 3AXKA 3C8YA 3R9LA 3GJSB 1CVJA 3WDOA 3JSRA 1LW0A 2MSTA 5D4NA 1S1TB 5DGBA 4DJBA 5L1JA 2PFFB 3QATA 2RIJA 2HNYB 1RHJB 2F4VF 2HFZA 3LP1A 4M95A 1HLWA 1VJQA 5CA5A 2PA3A 2U1AA 1SV5A 4L75A 1ZH5A 3CJRA 2YNHB 3I5AA 4DPOA 4C9DA 2OP5A 1RWWB 4HHUA 4OJ3A 4ECVA 1PGZA 4WZQA 2V2VA 4DSJA 4AQYF 4A8WA 3D1OA 4ZVFA 1GK8A 2WW4A 3EZ5A 4IH7A 2IBKA 3S8SA 2IJFA 3FMBA 3HVTA 2UP1A 3PACA 4CYUB 3BKFA 1VQLS 3HHLC 3SV4A 3EYZA 1Q8IA 1M5SA 4NLGA 4UY8T 3ZTSA 4ZVTB 4DSEA 1S1XA 3Q8QB 1AUSL 1HA1A 2ZJPQ 3A8KA 3TUIC 2KZMA 4FNHA 2XYHB 1WG5A 3HP6A 2DHXA 2EFGA 2Y1RI 4I1TA 1OSDA 5ETMA 3ZC4A 2V0NA 4XO0A 1R89A 2MZTA 2EC2A 1VQOS 1FE0A 2QLXA 3L95X 4K7QA 5KTQA 1CC8A 4KY3A 1QTMA 1MNEA 2GMLA 3K17A 4ILMA 3DRPB 2AYEA 1VJWA 2RRNA 4K4WA 3GCWP 4J5OA 4MFBB 2FVRA 4KV8A 1W26A 1HI1A 2W4DA 4C3KA 4WE1B 1MU2B 1CJKB 2DO4A 4NEYA 1WC6A 3IMQJ 3ILIA 2JZ5A 2J6UA 3AODA 1UETA 1RLCL 1VK8A 3ADAC 4B9NA 4LF4J 3FQLA 4EZ9A 2IY5B 3ELHA 4Y2MA 2W2NP 3J81Y 2AYGA 5KFDA 2WZ1A 5CHCB 5EUHA 1FT8A 2W9AA 2AEMA 4O0NA 1H98A 3BQ0A 2KYZA 2UXBJ 3R5BA 1FFSB 3BSOA 1EJ7L 1XR6A 3CJ8A 4IO1A 2V8GA 2IAJB 4HI2A 1ZZNA 3R2CJ 3NWRA 1S9GB 4MK7A 4ZS6A 2MPUA 1VIOA 4J37A 3OSNA 2B4VA 3DMJA 2A18A 1FRIA 4IKAA 2K7JA 2AP6A 4EYIB 2GMHA 1TL7A 3AD8C 1TELA 1WWHA 3EGZA 4QIEA 5J2PB 2Z2YB 1U45A 4AD6A 2RQ4A 3JYTA 4AL7A 1VBXA 2UUBF 2BUNA 4M5JA 2KDOA 4MJKA 3OXGA 1X31C 2RSQA 3KKFA 3QSIA 2AX0A 3DOMB 1TFYA 1I3OB 3RB3A 1NK5A 4IG3B 2W8LA 2KHDA 2GVDB 5K14A 1ZM2A 4NLYA 5DDQC 3OHAA 1GTEA 1U26A 5B7WA 1TQLA 2DNMA 1IR0A 2BX6A 2LXIA 4ETXA 1HKAA 1HFEL 2CPDA 2DNNA 4ES1A 2R8JA 3PO4A 4QW8A 5E2QA 3KJVA 1HQEB 3D4JA 4A8MP 4RNHA 1N48A 3HHNB 4GC7A 3QPIA 2JX2A 4URSA 3QGIA 3BV8A 1N52B 3M9MB 4JI2F 1QUVA 2CNNB 3I9ZA 1PJ7A 4ZLPA 2K2PA 1KFDA 2WB1D 1REGX 2A3JA 2YNIB 2AD9A 1SBRA 2V2ZA 5A6WA 5H9EJ 1U1OA 4O3NA 1IJEB 2ZH3A 3JSBA 3F73A 1D1UA 4WWSA 3KK3A 4B3TJ 2C2RA 2R7UA 1RJJA 4DV1F 5K14B 1HIYA 2UVWA 4LF8F 3JXOA 2F40A 4MIAA 1SV5B 3SSQA 4W92B 4P10A 1WELA 3DLJA 4LIRA 1WF2A 5IS2A 4ZHRB 2WCXA 5GAGU 4NWBA 3QQCD 4N5SA 5HANA 4J9VA 2NXEA 2FD2A 2BRLA 4B02A 4DPUA 4WKYA 3QLHA 2GQCA 2CPEA 1A7GE 3KTQA 3KFWX 4P52A 1BXNA 1RHQB 1YDLA 3IGNA 2UUCF 2GJIA 3C14A 5AT1B 1FRXA 2RJZA 3W66A 1SCJB 2MHNA 2IPOB 3C19A 3PKMA 5L9XA 4ANCA 1AW0A 1UA1A 3D0GE 3Q8UA 2Y3YA 4LRCA 5AE2A 4N41A 4DL0C 1G1XA 2M2BA 1IR2A 4NPOA 4HR2A 3P5BP 3MR3A 3GQCA 2DH7A 3PHTA 2HQGA 2QFJA 5B0BA 4QW9A 2MQQA 4UZCA 4RNNA 1RT4B 3HSDA 5KFAA 3NS5A 3R2DJ 5C5JA 3OR2B 3R6GB 1H7WA 3G6YA 1HNZF 2E66A 4K4XA 1FJGJ 3MURP 2XWYA 1N33J 3G6ES 4DL7A 3UWTA 4A8QA 3KG4A 1S1WB 1WC3A 3DOMA 1BLUA 4NE9C 4QR1A 3R7NB 3GJTB 4R8UA 5IT0A 1RCXB 4DCOB 1Q82T 1RAOA 3N6LA 2IRYA 3PYFA 4N8OA 4KB7A 1HHTP 4OHYA 2O5DA 2UVRA 4B3SJ 2I6WA 3NOCA 1X7VA 4J9UE 4LVNP 5A8RA 4X62F 2LFVA 4ED5A 3GG0A 1AFJA 2EEYA 5E3CA 3EE3A 5HBMA 2CG4A 3MM5B 2V67A 3CO0P 4AXIA 3M2VB 1IR1A 4C6AA 4ZLNA 4CLUA 1DLOA 1RT2A 3W9IA 5AXLA 1U1RA 4JI8J 3W5XA 2AT1B 2VUGA 4CO4A 4QYZK 2YQ3A 5CYQA 2DTJA 5CAAA 4USIA 4X4RA 4QWDA 1UFWA 2HS0A 2DGOA 1HBMB 1ZAVA 2VOOA 3KMQA 2DRAA 1LK5A 2C1EB 4O4RA 4DEZA 1SL0A 5FJ4A 2YX4A 3PTWA 3S6EA 4B3MJ 2KT3A 5GAEI 1CJTA 1Y00A 2V4JB 3MECB 2GHWA 3QT8A 3VALA 1TUWA 3U1MA 3PO5A 3M1VA 2MDAA 2N4DA 4Y2IA 2R7SA 4F04B 3FBFA 4PG8A 3PW5A 4WPAA 1ZPWX 4OYMA 3CT9A 4ECYA 4PWDA 2YXLA 4C0OC 4KTQA 1M1KT 2BKOA 1GQEA 2M88A 4HHHA 3W65A 1RT3A 2CPFA 2HQIA 1S0OA 2DNLA 1IKWA 4UQTA 1JLEA 2H5IB 2HBQB 2AEFA 5ETQA 4DV4J 3KLIA 2WBRA 4ALZA 1VBKA 4EU0A 3ISZA 4ZMMA 1IBKF 4DSKA 2HHWA 3KK2A 4GKJJ 1CJUB 4AL5A 3IA0A 4DN0A 1O51A 5AE1A 4UTGA 5KFZA 3HCXA 4DOZA 3HULA 2OTJS 1F5BA 3NL0A 2DBBA 1BQNB 5IV3A 1D8ZA 1VIXA 3TUZC 1VQYA 4RUHA 3GJRB 2DR7A 2XHWA 1XQIA 3P8BB 2XULA 3WZ0A 3PJ9A 4IOCQ 3C6TB 3FJ2A 5F3TA 1LKZA 1WF1A 2MZQA 3BF4A 4L3NA 3NNHA 3MR7A 2YNHA 3FSIA 3GIKA 4G1QB 3W8PA 4YEAA 1SC6A 1VC6A 1IQZA 4DPXA 3GV7B 3WQPA 3OUYB 2FLNA 3V6HA 1D8YA 1TV6B 3MOJB 1U1PA 1CQNA 4OZ3A 5T14A 3RG6A 3MPUB 3M32B 4Y65A 2HPUA 2MKYA 2RF2B 4TYAA 1U7LA 4ECUA 2XMTA 1TAQA 3D28A 5LXYA 3KJFB 7FDRA 1RTJB 4P2SA 1ZM4A 2NREA 4ZPBA 4ZVOB 3K59A 2GV1A 2OEMA 4L74A 3CE8A 4MK9A 2XMVA 4Z2XA 2ASDA 2W9BA 1P8GA 3D1QA 3EDQB 3TP2A 2R2UA 5FDLB 1DLOB 4P73A 4UOCA 6FDRA 2J6TA 4FF2A 4G1QA 2NZ4A 3MZIA 2G2ZA 2NXCA 2JVRA 3R7BB 1QVGR 3VAFA 1I94J 3JQMA 1N56A 4BLGA 2V6AA 3SZ2A 1WI8A 3E01B 2AEJA 1S48A 2C3OA 4FXWA 1LWEA 1WKLA 5HJYA 3KLGB 3SSSA 4P74A 4RL1A 2XO7A 3QRRA 5ETVA 4ZVPB 2Z2MA 1YJ9S 2H1YA 1HNWF 1IXKA 1G7CB 2CDRB 2PMWA 2X3DA 3K5OA 2G1HA 3UCGA 2XZDB 3TZZA 3CC2S 4Y2KA 5A2QY 2RQCA 4NLOA 2XMMA 3I31A 1UJ4A 3OFFA 2UVVA 5HVHA 1WHYA 1UA0A 4KHPJ 3CJ4A 3GFXA 2FC8A 3EPIA 2DYAA 2YPYA 1RTHA 4C11B 1OS5A 4NLVA 1RTIB 4TYBA 1VQNS 3EGVA 3RAQA 3OSPA 2CQ3A 2QG9B 3K58A 1IBMJ 2ZE2B 4FYDA 1U1MA 1BC6A 1RAIB 2OD6A 4O3PA 3TZWA 3U27A 1G4CA 1TL7B 2YKAA 3PCOB 3AB2B 5E41A 1SUQA 5HMXA 4LFAF 5AXKA 4ZPCA 3DFEA 1JXLA 2E5IA 4YQWA 2LEBA 1UZHA 1PC4A 1Q0NA 4URGA 4K59A 5DGAA 2FTRA 3D9BA 1JLQB 1G2EA 3HHLA 4NCGA 2L48A 3K8WA 5CH7B 4AYBD 4QOTA 4AUKA 3OL7A 1B4SA 3CMES 4O3SA 4DV0J 2OPQA 3HPOA 3J81j 2KO1A 3RU0A 3W5YA 4G6VB 1AYEA 3LPYA 3CULA 1W7WA 4YHHF 2VBWA 3HM9A 1UPMB 3V81B 2ADCA 1FKOB 3PHEA 3AQPA 3G6VA 4OI0A 1VQ4S 2E5LF 4IFVB 1FRLA 5KFKA 1VHIA 2AX1A 2JSXA 3IM9A 2HMIB 3DLBA 1LWCB 2V8DA 4XDDA 2A6OA 4IRKA 2BJDA 5EWEA 4TY8B 3OVAA 4JI0J 5KG1A 1EB0A 3J81U 2HVDA 1FXDA 3OTOF 3DRXA 3RYLA 4JI6F 3NCPA 4GRSA 4E0DA 2XS7A 4CT9A 2YNGA 4YDXA 3PW4A 4FN5A 1HWIA 2IRXA 3VQTA 2JVOA 3CJTA 1Y10A 3V5RA 1X4CA 3K89A 4FF1A 3QJJA 2FQQB 3R6LB 1TK0A 1EZZB 1Z2LA 5M2UA 3MCSA 3NAHA 3B4MA 4HEA9 1KKHA 2VD3A 4JOUA 3H42A 2MZRA 5DG8A 4QU6A 2CVEA 1KQGB 3OFEA 2HLTA 4ZK7M 2N82B 3BJYA 2ZH1A 2CQPA 3NCRA 4NYPA 4MH8A 4PABA 2V34A 1CJVA 3DGPA 5LXRA 2K3KA 2V8PA 4NLRA 4DI6A 1YZ6A 4PPDA 1YRXA 4CDIA 5FLXU 2R2SA 2R9LA 1IM6A 1R27B 2YQ1A 3Q8PB 3BDPA 2LU2A 4WP8A 4DPWA 2RS2A 3GU0A 1YVFA 3QFWA 3NBPB 5KOWA 3P4UB 5I3UA 5L1LA 1D3WA 3MDFA 4WFBQ 1VRTB 2MYFA 2MKHA 3QIDA 5E3PA 4FKYA 3K5NA 1OJ4A 1S1XB 3OD2A 5D15A 1NK4A 2V9WA 1HNVB 1R31A 4ZIVA 3VAIA 4B9TA 3VGSA 5HMWA 2QLFB 1QLNA 2G1DA 3MEDB 1F6TA 3EVMA 5GMDA 5I3QA 1FFGB 1Q95G 2H4YB 3HLUA 1FRHA 2CQIA 3BSCA 1H3DA 4Q43A 1HNIB 3FRYA 4K5RA 2XYPB 2CDQA 1WG1A 4OLPA 1JLGA 4YN3B 1JK9B 2OTLS 2L9DA 4DV4F 4ED3A 1WKJA 2KJVA 2P9GA 3C6TA 3PJWA 5G0RA 5HVGA 4B9MA 2VIHA 4WU2A 2DITA 3H5YA 2FY8A 3LP1B 1BMQB 1TKXB 4M63A 2EKNA 4JP8A 1SKRA 3L7UA 4ZP9A 4EO6A 2B8QA 4X2BA 5FD1A 1HQUA 5AXNA 4Q44A 3EVOA 3ZZ0A 2M0GB 3MM5A 5H9FK 2HBRB 2GGPB 2QMUB 4LBIA 4ZIWA 1HYSB 2KZZA 7AT1B 5KFMA 1V3SA 1VYAA 2GO8A 4OZ2A 4K50A 4NMXA 1NHKL 3OJUA 2HHXA 4RW4B 5KFYA 4S0MA 3UO0A 3CSKA 4K0KF 3T3FA 2ATLA 3DMJB 2F65A 2H65B 3FZBA 1JNRB 2LYVA 2MZ1A 1U48A 2J7WA 2ZM6F 3CIZA 3I0SB 1SUQB 4Z7CA 3P3DA 4C8KA 2YKQA 5F9NA 1FX2A 3MR2A 3VAKA 1XNRF 2DY1A 2C3PA 2XQCA 2HVZA 3DKDA 2ZH7A 3AA8A 1JLCB 3T5KA 3MECA 1GNKA 3D54A 3DLKA 4NRUA 1QY7A 2OHDA 1NJWA 4F0MA 2F5GA 1X4DA 5L8RC 3H2LA 2CJXB 4FYVB 2W7AA 4B9LA 3CJ2A 3A3PB 3I6PA 2Z57B 5E5NA 1QAXA 2K1RB 3QAUA 3I5CA 3NXZA 1KLNA 4L73A 4MYUA 3ZZZA 2W2MP 5C25A 1WC5A 4OYAA 1KOHA 4WIIA 1HD0A 3CCSS 4E8UA 2JFKA 4ZJOA 2JWNA 1FXRA 2DIVA 2GA7A 2OEJA 3B6BA 2ROEA 5HBMB 4Y0FA 4CM0A 2QL7B 2FLLA 1EAYC 2MTLA 4DSIA 2CFXA 2CQCA 2JHEA 1JNZB 4DLGA 1N5QA 3OTDA 1KVKA 3CCZA 1Q5YA 3I9V9 1I51B 1H6KX 3E51A 3F0NA 3MMJA 5HL7Q 3CO9A 1NZ8A 4DV2J 4I67A 2W2QP 1NH8A 1XIQA 2OUGA 1K44A 3UD5A 4MFBA 4DS4A 5B0CA 4FS2A 3ETMA 4KC5A 4RW9A 2XGPA 4GC6A 3THVA 4EK2A 4PEOA 3UDVA 4D3HA 3MEGB 1IM4A 1AROP 4QWAA 2RS8A 1X9MA 3MAQA 1DZ5A 4DXLA 3B78A 4ICLB 3RRHA 1X5PA 2AGOA 4DSFA 2RKIA 3NP5A 2KXHA 5M2RA 4DV2F 4Q0BB 1RA6A 2ERRA 1YJWS 2FJDB 3ZXWA 1QTNB 1L3VA 1GFWB 5CQGA 4ECQA 1JLAA 1NH7A 3E3XA 2WSCC 2G4BA 4DV6F 2QA4G 1HQUB 4P9SA 4EBDA 4ECTA 4M1KA 4PXEA 2ZWPA 5FDLA 5J2QB 1K0TA 1Q8KA 5KG5A 1RT5A 1B3TA 1PCAA 3ZNJ1 1REVB 3RAMA 4OMFG 1Y5IB 2ZD1A 1AUDA 1SKWA 1HMVA 4A46A 1S4EA 2PI4A 3DDKA 1D9DA 3FK4A 1TKTB 3NGTA 3IWXA 1OQ6A 4KGMA 4JUZA 3W63A 5AE3A 1NDLA 5F8IA 3KLGA 4EO8A 2BMBA 2XNRA 1BWEA 2XMKA 2YQ0A 2QLWA 3H40A 2HAFA 1LWEB 3JQKA 3MMAA 4GKKJ 2MKJA 2U2FA 2W01A 3G2XA 1HARA 1NKBA 3N79A 4M8LA 3MD1A 1T94A 1X5TA 4ZP6A 3PIOQ 5J2MB 1FNXH 4G1IA 1TKZB 2VA2A 5HP1B 1UVLA 4KGZB 1YHQS 1IJFB 5C25B 2POKA 3EVWA 4O3OA 2C2EA 4JI3J 3HVAA 4YDDB 3OJSA 1HWUA 2DGSA 4F4KA 1X4AA 2V5HG 2ZE2A 4EGLA 4YUDA 4DV3J 1RU1A 2AF6A 2KT2A 4AXJA 2EKYA 2KXFA 3HFVA 2RDJA 1UCNA 4K2JA 1UMJA 4F4YA 1U47A 1M5KC 1MW7A 2VBZA 1CEZA 3QWPA 4NZ0A 4FPIA 3GIRA 2BJ9A 1VQ5S 3BBCA 2MB0B 3R27A 3VV2B 4BHQA 1Q5VA 2CWKA 2FJBB 3JSMA 2JFDA 2BYCA 1T8EA 3RBEA 1EKSA 1HW8A 3HVRA 2LECA 4RW7A 5KT6A 4OX6A 4OYWA 4ED4A 1S6PB 1AZSB 1IUJA 1WHXA 4MIBA 3SCJE 1B0VA 3SQGB 3CD7A 1F2HA 1S99A 4O3QA 1HR0F 1KR4A 2UUCJ 1UJ6A 1GXUA 3X3UA 4TU7A 1VS3A 2JNJA 4ED2A 2HGLA 5GMKa 3Q2TC 1DQ9A 2V2QA 2CJ9A 1U2RA 5KFUA 4CLPA 1IQTA 1YWXA 3GCXP 2VBXA 4ICLA 1QSSA 4WJBA 1RWKB 2CQDA 1FWPA 4OLOA 3V81A 4LVOP 2KFYA 2H3EB 3O8WA 4NI2B 1HR0J 2OKQA 3HF5A 5D0EA 5G4DA 3SFGA 1QVFR 4NEZA 3OTCA 4WFXA 1SH2A 3MM9A 2OPRB 3CTRA 2YWHA 4X4PA 3J80U 2DPIA 3VTIA 4F4ZA 2MSSA 4C97A 9ATCB 2CG8A 2WW8A 3Q89A 3CDBA 4USWA 4FKXA 1ZAWA 1LOUA 1B64A 3JAMY 1Q7LB 3HHDA 1FVQA 2CPHA 4CLYA 4RZRA 2J8AA 4EI2A 1QE1A 2VPYB 2UV8G 3VWSA 4TXSA 3KYLA 3PKYA 1KQSR 3GP9A 1IBKJ 4KHRA 4GMKA 4Q8FA 1T9VA 2Y1LB 3VF0B 4GKJF 3LOUA 2FGOA 5CYMB 4V19X 4A8FA 3RGIA 4RR5A 3L7PA 2DGXA 2GW8A 1YLXA 3KUHA 2PI5A 3BGRB 4OI2A 2LQJA 3NS6A 1GTHA 2LCWA 1TTHB 2BXJA 4RO0A 4WTYA 3IO1A 3PVXA 3TANA 2NUHA 3P5TL 2H51B 3D6TB 4HTJA 3OTOJ 1Q8BA 1XMBA 1TL1B 4OI6A 1Z4UA 4N8NA 4JI5J 2HHSA 1C0UA 2CRLA 4ZJQA 3WIUA 2DNKA 3HVTB 1RT2B 3IBCB 4UOFA 1YBUA 2JRSA 3K5PA 2KVIA 4MT1A 3H8YA 4MAKA 3VAMA 2O66A 1S9FA 4TVAB 4R0JA 4AL6A 3J7A1 2WB4A 1HHSA 2BJ1A 3KLIB 4XDCA 3RW7A 2VOPA 2CQ1A 3KK2B 3VVTA 3LP0A 2ATCB 3LTOA 4JB8B 1QSYA 2VPXB 3O2IA 4OHVA 1S6PA 1OYEA 1CSJA 3QT5A 3KXDA 1ULRA 1V3ZA 3MM6B 2R7TA 3GIIA 2E7WA 4A8KA 5KFXA 4LIWA 1KVIA 4IQMA 3D66A 3ZZOA 1F3FA 2HWTA 5K8PA 3A12A 4KR0B 4RUCA 1LK7A 4R5PA 3M9OB 5LOQA 4NLQA 3Q86A 4K5SA 1MU2A 2B9WA 2CQ0A 2YKMA 3UDLA 5KFQA 1MMLA 4URQU 2OELA 4XIUA 2B9XA 2J0XA 3R1HA 1LWFA 1L3TA 3M6WA 2M8HA 1S1VB 4PKDB 3S1TA 1FRJA 2C28A 1RISA 3MM9B 2E7VA 3C16B 2HURA 4DX7A 5D3GA 4DF4A 3UN2A 2R7VA 4DS5A 3IRWP 1NNDA 3LP0B 5ETSA 3G71S 3UR3C 3T6BA 1RSCA 4WXOA 4XK8C 3AH6A 3T5HA 4U7UK 1S9EB 2GNKA 2GX8A 3CMQA 3QWUA 3AD7C 4XTTA 1P1TA 3H2UB 9RUBA 3L3CA 1S97A 1T9UA 2MGZA 1VQ9S 2FGCA 4NX9A 4ZHRA 2DEIA 1WEXA 3UPFA 1JLFB 3FQKA 1H2TZ 3BPSP 5A76A 3OLAA 3RB6A 1RAFB 4YY3J 4RUBA 5DDOC 3VHQA 1N8RT 4JYAF 1QSLA 1RAHB 5KFJA 3T41A 2YH0A 4X66J 3MCOA 3EM1A 4N77A 3CIMA 1UPPA 1FD8A 1H38A 3M2UB 4RW8A 4L72B 2LXFA 1ZZFA 1O5JA 2G2OA 3ZZUA 4LFBF 2E5GA 3IBFB 1X0PA 3MPVA 3G86A 5ETTA 1NDCA 5IM0B 2IJNA 2JC0A 1YJTA 4WYLA 2IMOA 1HQEA 5A2QU 1T05B 1S6OA 1M5PC 4LF6F 3LALA 3NGKA 1N6QA 3LGMA 4PXCA 2A1BA 3SXLA 1KD1T 2FJWA 3RJMB 5EWGA 1HNXF 4L76A 1WUUA 3UI3A 2RRAA 1N5YA 3OR1A 1H7XA 1HNWJ 4X4NA 3MOZA 1E6VA 5EX0A 1NPPA 2FLPA 2N7CA 2Q1LA 5CCMA 1U49A 1TL5A 2X3GA 2B5JB 1LXNA 3V6DA 3NKYA 4W98A 4NXMF 3C15A 1MROB 4HHJA 1IKYA 5HLFA 4ECWA 1RA7A 2CXEA 2FZCB 1TL1A 2ZNZA 3L4BC 4I56A 2FYXA 5A8WA 2R7WA 4RX6A 4JV5J 4MKBA 1SJ3P 1RBOB 1S10A 2DT9A 2AJ2A 1GXTA 1WC4A 2ZH4A 2ALZA 2EI5A 1FEHA 2B51A 1XTZA 3KHGA 2ACMA 4DV7J 1QUPA 1Q53A 3ONQA 1TFWA 2APOA 3FSXA 1AA1B 3GG1A 4LF8J 1JWWA 4ZVQB 2YNIA 1ICEB 3DHXA 3H25A 4LFCJ 4C8YA 4BBYA 2DD8S 1J5OA 3OL9A 3L09A 3R3TA 2H48B 4USTA 4QR2A 1YGYA 2JLFA 4I7FA 4A47A 2ZVIA 1F5AA 1HWLA 1F2GA 4KJIA 4EEYA 1U1KA 1IKVB 5E0OA 2HZAA 3CCRS 1NSPA 2B0GA 1K1SA 4DV0F 1BGXT 1F1BB 1MN7A 3A3OB 2E1MC 4LFCF 3HHKA 2G0JA 1RWNB 4ID8A 3KLHA 1SIWB 3MCMA 1Q78A 2IYGA 3MEGA 3TJ8A 2KG1A 4U96A 3OXLA 1TK8A 2EXUA 5KFNA 2XLJA 4NOHA 2E9ZA 4KE5A 1S1UB 2V50A 2GIFA 1U1LA 3GE9A 1FESA 1U0HA 2WVBA 1JLBA 3PEJA 5D4PA 3R5JB 5A8KA 2J7KA 4DL5A 1BUXA 4DR3F 1J5OB 4QU7A 4JI7F 3RR7A 4CYUA 3R5GA 2C2KB 1JQGA 2Y0BB 3QIPA 5E3QA 3RB4A 2WONB 2I38A 1MWZA 3GILA 2ZOFA 4MTPA 3K2YA 4HACA 4H4KC 3BDEA 3M30A 2WOMB 2J0WA 2VG5A 1XMOF 2HNDB 3JS9A 2Z58B 4LUBA 2XM3A 1JJ2R 1DQ8A 5CZXA 1VC5A 4DL3A 5JJBA 2ZC3A 3IAM9 2DXDA 3OFHA 4PUOA 3MWBA 4B17A 4Z37A 2EFQA 2IRUA 1B0PA 3FCHA 3LQVA 3T6JA 5KT4A 2ZWOA 1KS2A 4M5NA 5HVFA 2R2TA 3DOKB 1CJKA 1TUVA 3H0PA 1WDDA 1NSKL 4FP9A 1NB2A 8RUCA 1XMOJ 5GADI 4LQ3A 4JI6J 1XMQJ 4DG1A 1ZA1B 3TA2A 2LQ8A 2DGWA 1TU0B 3MD3A 5B08A 2DXFA 2ZBPA 1WSVA 3DU5A 3HT3A 1TKDA 1WC1A 2XSJA 4K4ZA 4USMA 1RT3B 1HQ2A 1RAAB 1PYOB 3AFGA 1YRUA 1EETB 4M5LA 3SQOP 2BACA 5KT7A 3TVZA 3G4SS 5KAKA 3KHLA 4K2XA 2QC3A 2WSFC 2RNEA 4CTAB 1ELOA 2EFPA 5K8OA 2BBEA 1KBRA 1OSCA 2I1RA 3AXMA 4LSLB 1LNQA 1ZM9A 3IP0A 1NB7A 2Q66A 1KN6A 1TP7A 4ZITA 2RU3A 2ZJRQ 3G9CA 1PSDA 2PGCA 1YK9A 4LF5F 3PG9A 1VHFA 3O1LA 1RWUA 2CPYA 4CZCA 5J2PA 5GVQA 4IFYB 2KVQE 3D6FB 2PE8A 1FERA 1AXQA 1D9AA 4DU7A 5KG2A 1NJZA 2FVPA 3KLEA 2CPJA 4OYZA 2XY6A 1WTFA 1I5OB 1C1BB 4R0EA 2CQ4A 3A1YG 2K8GA 2CJAA 1JLFA 2HFVA 3BGRA 3R97A 1VISA 4CO0A 4DZ6A 4DFKA 2M52A 4J9QA 2NCKL 1M1GA 3M8ZA 4ZPWR 3HD1A 2PEHA 1YQHA 4M5HA 2GCFA 3LANA 3SYZA 1PO6A 2W9CB 2P6SA 2RUGA 3Q8RB 2GQQA 3TRGA 4YMEA 4IR1A 1GAOA 4O4GB 2I2YA 2QFIA 1VQMS 1JLBB 3HKZD 3NBPA 3A8EA 5HK4A 1S6QA 5KFCA 2VFSA 4LSLA 5AJ3F 2W7PA 3ZTRA 2AGPA 1J27A 1K9MT 2AZ1A 3GIMA 1R6YA 2ZDOA 1XC9A 2MKIA 2M7SA 1RLDA 1HWJA 3EWGA 1XNRJ 1FE4A 1U0SA 2VC1A 4HACB 4I2PA 2ZC4A 1V5VA 1GMVA 2WONA 1NK7A 5IT9Y 4RW6B 3GR0A 1KOOA 4DUZJ 4DR1F 4ZPAA 5FLXY 1NK8A 4L6V3 2ZEJA 4DR4F 2W4PA 2WHOA 4R25A 3MEDA 3TR5A 2WTFA 1G3OA 3V6KA 1VR6A 5BR8J 3KLVA 1A0OB 4KFBB 5FIIA 4DL4A 5HO4A 1FJEB 4DL2A 1Q4RA 1QAIA 3OUYA 3FBCA 5GAEU 2GIRA 2JEJA 3K0JA 2V94A 3PRDA 4XPEA 5HQMA 2X1GA 3MFHA 2BOPA 4PUOB 3NNCA 1KLMA 1S1VA 4LRDA 1HNXJ 4QBUA 4DR6J 2MZJA 2FHMA 5DLGA 2F1FA 3NGSA 3M9NB 5ETLA 2R2RA 4NCBA 4PQUB 3MM8B 4DR7J 2XI3A 2LA6A 2BANA 1LWCA 2DNQA 3AQOA 5SZTA 3GMGA 4ZCIA 2I9SA 2VZ9A 4FYYB 1WSRA 2MQNA 5AXMA 1K47A 2A0FB 4LR7A 5CCLA 1SH0A 1X4EA 2HVEA 4ECSA 4LF7F 4U8YA 4LFBJ 1C0UB 2HIYA 2HQDA 2NSCA 5KFLA 3UDCA 2ADBA 2CA9A 1CG2A 4QZVB 4PWWA 5K5MA 4H4MB 3EGWB 5LT5A 1YJRA 1D0EA 1RTDA 1B99A 4C4WA 2BEFA 2VJVA 2DB1A 3DI6A 1U6FA 1MG7A 4OQJA 4I2QA 1H2UX 1RADB 1MMNA 2E1PA 2QLJB 2GVZA 4A8YA 4JI4J 4LF7J 4M5DA 1RB0A 3NGDA 4WIQA 4ANDA 1ZETA 4Q2LA 1X60A 3IRXB 1T03A 2V9KA 2G0CA 3KLHB 3VAHA 1JJ4A 4ZCKA 2BJ3A 1RHKB 1EX8A 2C2ZB 5DG7A 4ZLJA 2YPZA 3DOLB 4LBPA 4N56A 2EBGA 2QMWA 3G82A 4J7CA 1RTHB 2MZSA 2IHR1 2V8VA 2HEKA 2P8IA 2Q6BA 1RTIA 2IC3A 2MQPA 4ECXA 5C2GA 4A8OA 2LEPA 3R5DA 1S9GA 5LL6d 1Q7YT 2QA1A 1S6UA 3M4XA 1U2CA 4LBHA 2OSRA 4YS2A 4CH1A 1WOOA 4PQAA 4ERDA 2CYYA 4X65F 3W2WB 5HROB 3RB0A 2UU9J 2Q43A 1Q79A 4MMOA 1FEEA 4KGVB 3V4MA 3D6HB 4UY85 1U02A 3W61A 3JSYA 5B0DA 1UZDA 1SC1B 3M8QA 1VQ7S 1QAYA 2XGQA 1NK0A 1NM2A 4KPYA 4L3KA 3TNVA 1SH3A 1OWXA 3T1HJ 2GHPA 2H9ZA 3AOCA 1PAEX 2EFOA 4X62J 1WHVA 3IN5A 2L41A 2LP4A 5F41A 4DV1J 2UU9F 2QV6A 4RWWA 5IQQA 4YR3A 1X4BA 2YKNB 3RBDA 1UEUA 2OD4A 3BH7B 1GEHA 1IKWB 5GAHU 2KG0A 4DSLA 4WK1A 1ZOTA 2RVJA 4ETZA 2W7OA 3T1YF 2Y8YA 2XS2A 4GKKF 4FBTA 3EMTA 1U6ZA 4KYZA 4WFAQ 2X1AA 2BJ7A 3UN5A 1AT1B 1YRTA 3KK1B 3Q0AA 4F67A 4TQRA 1VQKS 3WBZA 4H4KA 1VRUA 2OEKA 3JTPA 2HLUA 1DQAA 1TMMA 4HH0A 3BQ1A 1N5VA 2HGMA 2FJVA 1U24A 1U2FA 1R6VA 2L3MA 4ENOA 2VC0A 2D1CA 1BHNA 2ZBCA 1H2VZ 1N0UA 1JKHA 2CADA 4I2QB 4Q2MA 5H1SV 4P7VA 5GAHI 3LH2S 2G9OA 2WSEC 3LWMA 3T5LA 2B8PA 4WTOB 2Z2LA 3HMJG 1F9EB 4Y28C 1X4FA 1YBTA 2JC1A 2RT3A 2VDHA 1WTBA 2F9JA 1JLGB 4KAIA 4CH0S 1NK6A 3TUPA 1XEZA 2DR6A 4KGXB 4A8XA 3ULHA 4FXVA 2GFFA 5ADZA 4LF5J 2PEBA 2WRMA 4OX8A 3SBMA 1T02A 3BPDA 4B3RJ 1J5EF 1S12A 3IBWA 2CWXA 3ITHB 3KWMA 4QIFA 3H90A 3CD5A 4PPZA 2V68A 4CI0B 4X4VA 4B3MF 4DN9A 1HNVA 2BKNA 3POTB 2CJYB 4FDFA 2F9DA 3VGVA 2PFDA 4O44A 2DY9A 4CLSA 1SJ4P 1KEKA 2O3DA 4ZKAA 1X4HA 4QPXA 4UUXA 3AJDA 4B9SA 2C42A 1VQSA 1RBLA 3O44A 2AYMA 2DK2A 2GJ2A 1RUSA 2DNHA 2ZOGA 1SJ1A 3PV8A 4I68A 2AKWB 4OZLA 3VZIA 4IUFA 1NZAA 5H9EK 2MEWA 3CCMS 3DC2A 4F0HA 1TR0A 1M5OC 3IXQA 2Z8QA 3U1NA 3PY8A 2IYIA 3RAXA 1RABB 3MM6A 3DGVA 2B9EA 4Y34A 5LSOA 1ACMB 1FXLA 4HVZA 2DR8A 1DTTA 2MQ8A 3Q8VA 1YKWA 4EWTA 4FBUA 1YX2A 2BE2A 3K7RA 2ZM6J 3I0RB 3CCVS 4ED8A 1JMTA 2UUAJ 1ZTWA 2DVIA 5J1EB 2KU7A 5ETPA 5LMNJ 3D5MA 5C24A 4IDKA 3QRPA 2EC0A 1TZ0A 2KT5A 3IR6B 1NDKA 1NDPA 4AE5A 4DZDA 2CQ2A 4ID5B 1NHVA 2JEIA 5ETRA 2DKOB 4TN2A 1H73A 1RT6B 3LAMA 3FUYA 3S7RA 5A8KB 1U1QA 3AHPA 2OLWA 2JLEA 2VQEF 2OMOA 1UWBA 1V3RA 3PX0A 2QIFA 3CD6S 3FDSA 2ZD1B 4Y3CA 1SKUB 5D78A 3W7BA 4J9NA 2HHHF 2C3MA 2B3TB 3LGHA 4ZVRB 2ZFHA 3UE2A 4HLBA 5HQLA 3KK3B 2CQHA 1N36J 1I6JA 4ZA1A 1RHUB 3BGLA 1S77D 2VKZG 1IVZA 3DLEA 4IO9Q 3TA0A 1L5UA 3BEGB 2GVZB 3GTYX 3ZZYA 4R5PB 3OR2A 5F9LA 2NXJA 3WIVA 4IH5A 3M2RA 4ES2A 2VV5A 1N36F 4RBVA 1HBUB 1MWYA 2MY7A 2PC6A 2RDIA 1RTZA 4OI1A 4QIGA 4DCPB 3BO4A 4F50A 1DTQB 5C24B 4B3OA 2CNLB 2D3O1 1KHWA 1HPZA 3HSJA 4CO2A 4FF4A 1VCTA 2OAUA 2QA2A 1P9QC 3KNGA 1RWXB 5DRKA 1IBLF 3DLLQ 2EK6A 3HVWA 5KFRA 1MMDA 4TY8A 1KFSA 3AAWB 3KG1A 1R8BA 4M5MA 2ZKTA 4ZVEA 2ZH6A 2HK2A 3QGPA 3QJPA 2PDAA 2ACYA 1TVRA 4G65A 2N7YA 3P96A 2KL8A 3ZTOA 1NK9A 2LXUA 3PEHA 1XNQJ 4ZP7A 2UXCF 2XEXA 4LRFA 3ZTPA 4P71A 2MKSA 2P5VA 4QWBA 4RNMA 4YOEA 4OZ5A 1HBUA 2VFRA 3W64A 2AYBA 2FUG9 1M5HA 4UT4A 1NMEB 3AJ1A 1JLQA 4OX9J 1Y0HA 2QT7A 1OIAA 2HG4A 5BYSA 5IFMA 4Y2AA 3GONA 4RNOA 3Q23A 1TAUA 1CPZA 2PT0A 3ENWA 3M8RA 4C0HA 2YKOA 2W24A 4HI1A 4ZVHA 4B3TF 5J1PA 1RI7A 4USJC 4X65J 4I6AA 2J5AA 4TQSA 2KH9A 3QLHB 3GIJA 1DTTB 2YKMB 4QQBA 2QL9B 3ET6B 1YJ7A 5I42B 1UEKA 4KH1B 5IM0A 1LWFB 2RHQB 1SPBP 5CXTA 3SCLE 2WVDA 1S0NA 2A2DA 2JH3A 3H98A 3T9NA 2VHGA 1GXLA 2V2KA 3OHBA 4F2SA 2BZ2A 3ISNC 2IJRA 3M30B 1RT6A 2CIMA 2GAGC 2O1PA 3PX4A 4RU2A 1FK9A 4DR2J 4EMDA 1X9WA 1RKJA 3S01A 2GJFA 1S7HA 3QJLA 3MMCA 4Q5VA 2DNGA 1FKPB 4X64J 3I4HX 1HBNB 2B4PA 2EW9A 2RQKA 2XBPA 3FKBA 4IG3A 4BWMA 3T1AA 5GADU 3RTVA 1HD1A 2MGZB 3AB4B 2DNRA 3MR5A 3DXSX 4OHXA 4HT7A 5KOXA 1IBCB 1WC0A 4OI4A 2W4CA 3THPA 4DG1B 2ZKUA 3GYGA 4IG0B 4C8OA 1XBWA 2FJAB 2XO6A 2OFGX 3N6MA 2Q6CA 4PG4A 2CJQA 1N34J 1OY9A 1WORA 3DRSB 3M8PA 2HVIA 1G6BA 1LFWA 3DRRB 1CJVB 3DGPB 4CTAA 3I82A 1WDTA 4C98A 3D67A 4K4UA 2OPPB 1U1NA 2F4VJ 1F9HA 3J7AN 2F8HA 4NA3A 1N88A 3V4IB 1KDNA 2DXEA 1LXJA 1F3VA 3F41A 5D0RA 1IKVA 1NRKA 1GX5A 1Y5LB 3KJNB 4CH7A 3IWNC 1SL1A 3ZNUA 4C8NA 3W5ZA 4NCAA 1VBZA 5CYJA 3ISND 3PW2A 1NHUA 1QE1B 2FPHX 4G3IA 5DO2A 3M05A 3T9ZA 2VH7A 3Q8YA 4UF4A 3LA0A 3MEEA 3THTA 4X4SA 4QJVA 4DQQA 3MPYA 3EX7B 2W1BA 3I56S 4BS2A 1HBMA 4UQGA 3CCQS 1FDBA 2PIIA 4NXNF 1S1UA 2MJUA 1OYDA 4LSZB 1PJ5A 1RU2A 2QX0A 4GVLA 2BV3A 2PA8D 2QYGA 3BSAA 1MROA 3MPWA 1T95A 2OO4A 3G82B 5JXSA 3N0VA 2OPSB 2Y1IA 1JXEA 2HHUA 2GGPA 5CABA 1HYSA 2ZBIA 2ASYA 1Y7PA 3EXCX 2DGUA 2LKZA 3N6NA 2ZHOA 3PFOA 5KG0A 5JMNA 2YWFA 3UD3P 4ZPVR 1TVRB 2GZOA 5RUBA 2QA4S 1OPIA 2OH2A 2HNZB 1S0MA 1VDHA 1DRZA 3HJFA 1K0VA 5KFIA 3PW0A 1JLEB 1VQPS 2VPWB 2EPIA 4FVMA 3BQ2A 1KQFB 3G87A 3GSIA 1SJRA 4DQRA 2DGVA 2YKPA 5L1KA 5HROA 1NKCA 2QTWA 4ZVSB 3AT1B 2DH8A 3NCQA 3HSZA 4I6WA 1NXIA 1NJXA 4RW7B 3DN9A 2VICA 3H20A 4IFYA 1S1WA 3E01A 2KB2A 3C66A 3C6UA 3GYNA 3KDNA 4I0WA 4NLDA 4USUA 3C3LA 2PSZA 2RKIB 4NYOA 4OJHA 1JLCA 2V63A 3K57A 3PX6A 2AMCB 4UUWA 5I3PA 4IRCA 5B0FA 2FZKB 2HWHA 3MM8A 4OIXA 2IM0A 2EFVA 2VPZB 4DX5A 4OZJA 3HX9A 1MLAA 2XMAA 1FHTA 3JAMU 5DLFA 1EETA 4LMZA 2HGNA 3MAHA 5KFOA 3LW5C 2IA0A 2RB7A 2LMIA 3P45B 3GFZA 2X51A 3DRSA 3MMBB 3O3LA 4NI2A 4OL8A 1GH8A 4LF9F 1BWVA 1YZ7A 2Y0SD 1ZS6A 3BO2A 4HDHA 5D8HB 4BC7A 2BA9A 2P2CB 3HK2A 2VFTA 2VB6A 1S57A 4NL5A 3UCUP 3SFUA 4FYXB 1RWOB 2XYGB 5KG6A 1R0AB 1FRKA 1WEYA 3KHHA 4EBCA 3TX0A 1FDNA 4QIVA 5DQGA 3BGOP 2VDIA 1C4CA 3MGJA 1EHWA 1RXOB 4EZ6A 2HHTA 3R5CA 2J8SA 4JYAJ 3V6DB 2YNGB 1EP4A 3ILLA 1IN0A 1Z2ZA 2ZOMA 3M8YA 4CNYA 3KOAA 5GMEA 4MIWA 2HNDA 3NG8A 4GO5X 2DR5A 2HRUA 3QRQA 2VQFF 3H7HB 2HFSA 4GVBB 4OYXA 1DY3A 1M5VC 2DRDA 2MQOA 3M8PB 4O4GA 4JI1J 3GSDA 3ZZRA 3KNAA 2FB0A 3B8HA 1Y9OA 5IQ6A 2M5YA 1VK3A 3DM2A 2ZDPA 4C48A 5DQHA 3RW6A 2LDYA 3TZYA 2JEGA 1CJUA 3AOBA 2KJWA 5L38A 2DNPA 3QNWB 3CDWA 3GR1A 5I4MA 1W2BR 1FTCA 2AIRB 3TI0A 1UP1A 2IBOA 3HZGA 1UTAA 4CIOA 1KWMA 1RZMA 3Q8SB 3PFEA 3JTNA 3QZ7A 2COLA 3DDNA 1RE1B 3POTA 4CO1A 5F8GA 1RGVA 2LQBA 2P9EA 1U4BA 1L3UA 3D2WA 1D9FA 4HKQA 3DLEB 5M2PA 3IS9A 1DARA 4U95A 3GV8B 3HXMA 3VAJA 4NMLA 1RT1B 5DETA 1B7FA 1UVNA 4NZ7A 1HBOA 1Q8LA 4ES3A 5C7PA 1AB8A 1FI4A 1T9TA 3HKWA 3BSNA 5B0AA 5KT5A 1CS4B 5AJ3J 4BC9A 5D6GA 5EDWA 4DV5J 2MJNA 4P6QA 2XCPA 2F63A 1CJTB 2V4JA 2VFVA 5LSLA 3MUTP 3G6XA 4KO0B 2R8KA 2RF2A 2FJXA 2GS8A 1RAJA 3DRYA 3GFHA 1K8AT 2CNOB 5G0RB 1GMUA 3ZO7A 4O0IA 4DR2F 3M32A 3PIPQ 4KHMA 3HHLB 2HZCA 4JI0F 3CJ0A 1RP5A 2AJ4A 1CULA 1M0SA 2ZBRA 1RCOB 1RKIA 5DDPC 4KGKA 1X0FA 2DCUB 1XR5A 2R7XA 2QLBB 3CWJA 3ENQA 4DMZA 2BE2B 3RZAA 3M2VA 1F5CA 5JVGQ 3QIPB 1HNZJ 3W2VB 2G0IA 2N4CA 3DLGA 3DYAA 3LPEA 3D0HE 4NLSA 4IFVA 4DV6J 1YITS 3MXHP 3CCTA 3QBCA 4N47A 4K4VA 2LQ5A 5T7LB 4DPYA 5MAOA 3GJQB 3SV3A 3TVKA 3TWZA 4J9RA 1PYTA 3UR0A 1RACB 4J9LA 2VG6B 3ZTQA 1VQ8S 2J9DE 3TEHB 1FX4A 1LW2B 2B5JA 1PILA 3HD2A 1K73T 1Q16B 3C6UB 3MF5A 4FZVA 3OVBA 4F36A 2GVDA 3VQSA 3KG0A 1BQMA 5D77A 4DLEA 1SI9A 2XY7A 2HRYA 4KPCA 2B7BB 1ZYQA 4KHPF 2KFNA 1UKUA 4I64A 1SB6A 3QT7A 4LR9A 1TL3B 3D0IE 1RK8A 3ZFVA 3TVYA 4DDFA 3BREA 3MI7X 4WP3A 3CF5Q 2XSJB 2I8EA 2I5JA 3KUGA 3LP2B 4DFJA 2KYXA 1XNQF 4IOAQ 1DTQA 4CWBA 4LF2A 1FDDA 1ZAXA 5KT2A 2QO3A 1U0HB 2BE7D 2OFHX 3J7Z5 3AOAA 4FNIA 3W3SA 4QYZJ 1EIYB 2BVZA 2KTQA 3DLGB 3DYAB 4TLRA 1KHVA 5HSPA 4TU9A 2XLKA 4IYQA 4K4SA 2YH1A 1FFWB 4WK3A 2ZJQQ 3J7YI 1XN9A 1Y4ZB 1S5ZA 2M9KA 3NGUA 5K8NA 2ABYA 1FK9B 1SC3B 3ENVA 1EKRA 2E1RA 5LJ5Y 1RQ0A 4DUYF 3GV5B 2C22A 3WX4A 4B08A 2MQLA 2VG5B 2E5LJ 1VBYA 1HHQA 2M70A 4DR5F 3OTBA 2CPXA 4WYWA 4JV1A 2A6MA 1CS4A 2ROGA 1SJFA 3GPAA 4F4WA 1WHWA 3CNQP 2PO4A 4UW2A 1HBOB 3PW7A 1SXLA 3DOKA 2OPQB 2WVFA 4DHVA 2NZCA 3KHRA 4OYPA 1TKZA 4Z7YA 1SKSA 4DR7F 2BW7A 2YWKA 5IXUA 1Y3KA 3FGVA 3HFKA 4ILRA 3ILJA 1UVJA 2R8HA 3V4IA 3D1HA 2XCAA 2UZAA 5ETOA 5A0YB 2M3DA 1JLAB 2XZTB 4ZLLA 4X4QA 3OTEA 4JV2A 3FFIB 5L46A 1FJGF 3BO3A 3KLFB 4WXWA 3BBBA 5HMZA 4V19J 2P6TA 1VLYA 3CXCR 4PAAA 4PZVA 4WFNQ 1FJCA 3MPDA 1E6YA 1IWAA 2E5HA 3TAQA 2UUAF 1ZM3A 4ZDNA 1UWAA 1VGYA 2FLOA 3M8SA 4K4TA 2CJBA 5CZVA 2LA4A 4CLZA 2L08A 2AGQA 1OO0B 2OI2A 4I7FB 5LM7E 4U7CA 3CCUS 1QAJA 2D69A 1GMWD 1FNMA 4ANEA 4ZCLA 4K0KJ 2YNFB 3W62A 3CDAA 4KIAA 4UOGA 4DX6A 1OQ3A 4CNZA 1FKPA 1GX6A 4R8UB 3SDEB 5ETNA 3F56A 2HNYA 1Z1ZA 2LU1A 1FVSA 2W25A 3ITHA 3TEGA 2J9EA 2ASLA 4NLXA 3VGTA 2I5JB 1A6LA 3RBZA 1TL3A 4DQIA 1KTQA 4KT0C 4LRBA 4NLTA 1KSPA 2FIUA 4XAKA 5J1EA 2RMLA 4WFYA 4CLKA 5DM7Q 1OY8A 5KFEA 2R8GA 3CDEA 3BH6B 4JI5F 4WZMA 1OPZA 3OR1B 1NJYA 4YB6A 5DQIA 5CD4A 5CYQB 4DUZF 4DR1J 3VCDA 5D0HA 1RBAA 1VOMA 3CJQA 4M5DB 4OI3A 1N5YB 5HN0A 2ILYA 1S9EA 4KRWA 4JI8F 4J9PA 2QGFB 3N5FA 3KUEA 1RT4A 2DO0A 4NYZA 3T5JA 5D4LA 3NMRA 4DFMA 2BRKA 1T9YA 1DJ0A 2MLYA 2IM3A 3SDEA 3QFHA 4DF8A 3TQ1A 1IKYB 1VLOA 2DIUA 2YX1A 5H9FJ 5HLFB 2EG1A 3I0RA 5IV4A 3HHEA 5DS7A 2X1FA 5IC6B 3H2VE 1YBAA 1R3NA 3EJMA 3MTJA 2ZBQA 3TUJC 5KFGA 2VG7B 3BBFA 2R3VA 2CUYA 1N32J 1UJ5A 4YB7A 5ETKA 3M2UA 4RW8B 2ZH5A 1XERA 1JJCB 4LF6J 4PQUA 4UOHA 5IWAJ 3CPWR 2D7SA 2CPIA 1LEOA 3RRGA 4RLEA 4PYDA 2RU9A 2B4UA 3E2EA 1Y5NB 2MY8A 2ZVSA 4LR8A 4WCEQ 1T05A 2HHQA 4NLPA 2NXUA 3UQSA 3DCAA 2G13A 3G8TA 1RHMB 2AQ4A 2KFZA 1KONA 4H4OB 2HBZB 2RHSB 4D3GA 3KLFA 1R0AA 4LF4F 2O67A 1T11A 2G2YA 1UVKA 2FVCA 2P9CA 2UUTA 4RJVA 2BM0A 5HJXA 3FCVA 2E5JA 4EBEA 1FDAA 5LJ3Y 1ITPA 4JV0A 2MHEA 5EX3A 3HDSA 1RYSA 1EQMA 1MN9A 2YTCA 4U67Q 3M1VB 3MTKA 4HDGA 3RBXA 2D9PA 4LF1A 2ZUGA 3Q24A 1FF2A 2MLZA 2BR0A 4MKVA 5F8MA 4AT1B 2OSQA 2W2OP 4J9MA 1HW9A 2J6SA 1URNA 1NSAA 4IH6A 4ZVUB 3FMWA 3A13A 1TKXA 3PDNA 1WG4A 2X7IA 5IT4A 2OPPA 4Q7AA 3UW1A 3UVJB 4DPTA 3H4DA 4RPFA 2CNKB 2OPRA 5KG3A 4JI4F 5U47A 4N76A 4LJMA 1CLFA 1ZA2B 4IDKB 3IS9B 2CAJA 2N3OA 2HBYB 4OZ1A 2R4FA 1N34F 3PM9A 4LFAJ 1B7YB 5E3AA 5E7OB 3IM8A 3SSRA 5J2NA 4ZP8A 1CBKA 2F8EX 2HKEA 2B56A 5THWA 1AFIA 2HFUA 4LSNB 4YR2A 2EWHA 2M8DB 3N01A 1T9XA 3U1LA 2VFUA 4ER8A 2K06A 3O6QA 1I1GA 5GAGI 3L7OA 3T1HF 4Q0BA 4JI2J 2XZWA 2J76E 4KH0B 1BQNA 3GB0A 2AHOB 1P27B 2KI2A 1SQFA 3PNIA 4KV8B 2FY1A 3OXFA 3SCKE 5A6PA 4GVBA 4USHA 1M1HA 3DRPA 1R0CB 3PRVA 4P2FA 4RWXA 2XLIA 8AT1B 3K5MA 4DUYJ 3IAS9 4I4BA 4CT8A 4F25A 2CQBA 4OYOA 5D4OA 4O44B 2VG7A 3QYYA 4CLWA 2DEJA 3PR4A 4O23A 3IC1A 4J9KA 5DDRC 3BKUA 2DNYA 5T7LA 3SI8A 1V9OA 3ZZPA 4NZ6A 4CP5A 4DV5F 1O0PA 4X64F 2IM1A 4KQZA 2ZNYA 4M5IA 3W2WA 3J80Y 3OFGA 2V4RA 1VMBA 1VRUB 2WVCA 3HT0A 4F4AA 4WU3A 4NLUA 1HBNA 4WP9A 3QT6A 4FYWB 4OZNA 2VODA 1XWLA 4U7UD 4F3OA 1C1CB 3D6MB 2JDJA 1NCLA 3BN4A 4PYAA 3DI6B 4RW9B 3KLEB 2IDLA 1YG0A 1WOSA 3MMAB 4DCJB 1MSWD 2BM1A 3CJSA 1S7IA 1JKHB 2DNOA 3D7SB 1UFLA 4OHZA 1L3KA 4DR5J 2BQ3A 3ILOA 3W9JA 2NR0A 1R8PA 2HZVA 5CYMA 4K4YA 2ALYB 2R7OA 3MM7A 4OHWA 5BYRA 5L39A 2HFNA 5HI7A 4DQPA 3NLCA 4A48A 3CCWA 2CZ4A 4Y2CA 1N5SA 3UN3A 4YR0A 4FXDA 4ID5A 1Y11A 1K1QA 1DFDA 2YVSA 1RDRA 4C0BA 1N33F 1NPKA 2RE1A 4ZVGA 4TLQA 2DHHA 3B54A 4ED0A 4I2PB 1N5TA 5D3GB 2E1CA 2HIQA 5CD4H 8ATCB 2HRTA 2VU5A 5DZ6A 3I87A 3WHIA 2LEAA 3H5XA 3OPKA 3JSMB 1UVMA 1T7PA 3OQ2A 3TAPA 2QRRA 4QWCA 1T3NA 1XR7A 2OMLA 2ZHAA 1DBDA 4F0KA 2EG2A 2VG6A 3UFCX 5E33A 4DV7F 4FF3A 5DG9A 3A4TA 1NBEB 3H59A 3SMZA 4RBUA 4OJGA 3UNYA 3X1LB 4PRFA 3EDRB 1U25A 2BOAA 1PBUA 7FD1A 4U9RA 1OY6A 2MLXA 4QYRA 4QIWD 4J90A 2BJEA 1WKKA 1ROFA 2DHGA 2WVEA 3CJKA 1Y3JA 3DDIA 1URRA 2XNQA 5EHHA 4IG0A 3FEXB 1SQEA 4TKTA 5J2MA 1R7IA 2NQPA 1BE4A 1CC7A 2BKPA 3W1YC 2Q3PA 3P49B 3M6XA 2DGTA 3QAEA 4G1PA 1RTDB 5J2NB 1S4FA 1ZPVA 2AWZA 5BYQA 3HI9A 4AQYJ 4DR4J 2YWWA 1HMVB 1A9NB 2HHHJ 5J1NA 2NPFA 4P7TA 1TKTA 5K20B 1WI6A 1XK8A 2YY3A 1YJUA 3C16A 1SQGA 5B0EA 3EGNA 4X66F 1N32F 1RWPB 4CM2A 2B6AB 1C1CA 1X4GA 4ZOSA 3IRXA 1T03B 5F8JA 2KN4A 1N4LA 3RUBL 4LREA 4NLWA 1P6TA 2CZ9A 2MQMA 3QO9B 1LWXA 2FHJA 2AJ1A 1S79A 4PWUA 3MUVP 2EVZA 2RH3A 5IT9U 4WE1A 3MEEB 2DNZA 3TW0A 3EUNA 4ZCMA 1HWKA 1R0BG 2ZITA 4C8ZA 2EFNA 2ZZNA 1JXVA 1SC4B 4ILLA 4CLLA 5KG7A 3ENAA 3EXYA 2HS3A 3KJVB 4EUVA 3VGUA 5BXIA 2NSBA 1VI7A 3NRBA 4C11A 2CZVC 2D9OA 4MK8A 4BWJA 3GYXB 4RW4A 3JB9k 1OMSA 3R8YA 4DX8H 4F7VA 3Q22A 2UUBJ 3FBEA 2NPIA 3PRBA 2B6AA 1XJWB 2HNZA 3EZOA 5KFBA 3E8OA 4YP3A 2Y9HA 2FZGB 2DJWA 1LW2A 5KG4A 2J0QD 2VKRA 2Y8WA 1MWQA 2IFXA 1R8CA 3V2UC 4C2MA 2C3YA 1YSJA 4LSNA 2NS1B 4UZBA 3JYTB 2K7KA 2JLGA 4X4TA 4OYBA 2VQEJ 4ECZA 1E6VB 1UVIA 5L1IA 4RBTA 4J9OA 1VC0A 3TAMB 2IIHA 2HK3A 1TV6A 1PC5A 2IVYA 4KKOB 1NKEA 4JI3F 4PG5A 3TQEA 2W9CA 2M4MA 2B9YA 2E29A 3L9ZA 4ED6A 4ED7A 3NS7B 1U09A 2DCLA 3IWLA 5F3ZA 2BQRA 4F26A 4PWDB 1KP6A 3FRZA 1NSQA 3U02A 5HMYA 2YWGA 5HQ8A 1B0TA 2ZH8A 1IBMF 3KMSA 2MKCA 2H5JB 2VASA 3BKTA 3WX8A 6FD1A 2E9RX 4FVCA 1BQXA 2AV5A 3NGRA 1BD6A 4NA2A 4DQSA 2ZUAA 4P72A 4Q8EA 2BABA 3US5A 4DL6A 5IOLA 2E44A 3ET6A 5I42A 2L9WA 4F2RA 2CQGA 5EWFA 1PAUB 1W25A 1C0TB 2HQFA 2KRRA 3IGVA 3PJXA 3PYDA 3CCLS 1RYRA 4JI1F 2MMYA 4ZN1A 1BY9A 2WOMA 2Z2ZA 3H4BA 5LMUF 2AU0A 1T9WA 3M8WA 1J2VA 3CVKA 3N4WA 1P1LA 3B4DA 3A8JA 3I0SA 3IG1B 3BN7A 3NWGA 2D3OR 3CC7S 2PN6A 4FPRA 4KKOA 4ZPTR 4HL9A 4CO3A 3FC9A 3HHLD 2GIQA 3OBIA 2DRBA 1JJHA 2FVQA 2F4FA 2D74B 4DR3J 3MFIA 4JI7J 1NU4A 4C8LA 4KO0A 3G8QA 3M8QB 3T1YJ 3K5LA 1X9SA 2PMZD 1VRQC 3FEZA 3DLKB 2KM8B 3M2RB 2KKHA 3CUNA 4LQ9A 1SL2A 3MEKA 3HO1A 5F0UA 5KFVA 3R1LA 3LWLA 2E7XA 1WNEA 1R8HA 3KJQB 2L9NA 3OT9A 3C14B 4OX9F 2YKNA 1FO1A 2SXLA 3UVJA 5SUHA 4YY3F 3MUMP 1C0TA 2Q79A 3TJ9A 2HQCA 5D0GA 4OJ1A 2AJFE 3VVUA 3J7YU 1APSA 2OGUA 3IFEA 5IC4B 4CQ1A 5EGYA 3NAIA 2DH9A 3LUYA 4ED1A 1PBAA 1Q86T 1X8DA 2C3UA 2KHCA 2CKWA 3MR6A 4YHHJ 4OYIA 4WBFA 4RKUC 4DR6F 1TMJA 3CW2C 1NLKL 3R7SB 4NA1A 1LW0B 1JB0C 1WD6A 2K3IA 1F0XA 1WACA 2ILZA 1RAGB 3SCIE 4CO5A 1S1TA 1UW4A 4HH1A 4RNFA 5K9FA 4NCGB 2UUWA 1TUGB 2F3JA 3DNCA 3PR5B 3CDUA 3C2PA 4DV3F 3I96A 3HZEA 5HATA 5F8LA 2B4OA 2XMJA 3TAMA 3U7JA 3AY0A 1J5EJ 2QSFA 4F02A 3R5AA 2R7RA 4KBIA 1FKOA 5E3RA 3DRRA 2GAHC 4F3MA 4DBQA 3Q83A 1PJ6A 1S6QB 4USVA 3UNGC 2HSEB 2QMXA 3BR9A 3EICA 4MKYA 2DHAA 4LRAA 1F9FA 4U8VA 4NXMJ 3GLJA 2CPZA 2HW3A 1M90T 3O5TB 1DHMA 2B43A 3CJ3A 2OJ3A 4M5KA 2RDDA 3FNNA 1S76D 2GMJA 4ITSA 1FTRA 1PIEA 5B09A 4TU8A 2E1AA 2H54B 1AZSA 1N6QB 2GO9A 5KT3A 1NAQA 2DISA 1EARA 1PKUA 3M7VA 4OV6A 3FBBA 4IR9A 2XWXA 1S0VA 5K8MA 3H5UA 3BYRA 2FHKA 3I5BA 3ZZTA 3J7ZT 1QDUB 3NY0A 4OZ0A 4KFBA 1WEZA 4CCHA 1FKAF 4PCQA 1LQ9A 4O3RA 4DWIA 4X4UA 2RUSA 3QO9A 5MLCV 4YB5A 3BZQA 3LO3A 2R42A 1NJIT 3CD0A 1UFKA 4BDPA 3TX8A 2OPSA 2BANB 3C15B 4P2XA 3OL6A 4B3SF 2QE5A 5A0YA 1R8AA 3TZXA 4B9VA 1W2IA 1FWKA 3AD9C 3FFIA 5L9NA 4F8RA 4HT5A 2DR9A 4C7QA 3G8SA 3W8GA 1B70B 2HQ3A 2J9CA 3CJ5A 5HP1A 4LF9J 2YX7A 1RTJA 2LVWA 3CB4A 1CQMA 2IMWP 2HAIA 4C8MA 2X1BA 2ZZTA 3BS9A 2EBEA 4DFPA 3UD4P 1C2PA 2HVHA 2HMIA 2PD1A 5F8NA 1UWBB 2ZZMA 4OV1A 1ZTTA 4XPCA 1DAXA 3OV7A 1R43A 1SIZA 2D41A 3QGGA 3IG1A 1UL3A 4X4OA 3DXBA 3I32A 3TARA 4TY9A 4RU9A 2E9TA 4C3MA 3N9UC 2BJ8A 3UCZP 1QD1A 3W9HA 2XTJP 1UAWA 4K8RA 3I55S 2JJ4D 1JX4A 5KFHA 4M94A 5KFPA 1IWGA 3D3BJ 1YTYA 1H0HB 2FJEB 4USKA 2RD5C 3MHYA 4W90B 1ZBTA 1FNOA 1SVDA 2ZH2A 3CCJS 1IBLJ 1PG5B 2HS4A 3QMQA 4PXDA 4DU8A 2BQUA 1RWMB 5JUMA 1YI2S 3DOLA 3AJ2A 1FD2A 5EN1A 2XSFA 4YB1P 1T0TV 2QN6B 4N7TA 2Y1JA 2FDNA
chains in the Genus database with same CATH topology
4J9SA 2GHVC 2DPJA 3G96A 4ELUA 4NRTA 2XMWA 4GO7X 4Q45A 5I3UB 4ECRA 2HWIA 2AJ0A 4Y00A 3OVSA 2J7UA 4JV5F 2R7QA 3LAKA 3CC4S 3NNAA 3MMCB 2FHJD 4H4MA 3CMAS 2ROPA 4H4OA 4EFAC 2W9BB 3RR8A 4F4XA 1LFPA 4I6YA 3OLBA 1SJQA 2VL1A 4MKAA 2HYIB 1KVJA 2XB2D 1KC8T 3GFYA 3TO8A 4ATNA 3BGFA 3T19A 2LLZA 4OX7A 5IWAF 2UVUA 2JOQA 1U8SA 2WBMA 2ASJA 1KTVA 2RQMA 1FJ7A 2MKKA 3ETOA 4BCAA 3FEYB 1KQSR 5KFWA 1QJHA 3BGUA 3EZUA 3LGNA 3M6UA 3TYTA 2MXYA 3CEDA 4PXBA 2IC3B 2C2DA 5T41A 2KM8C 4WF9Q 3IR5B 3KK1A 2D3UA 4KSEB 2KXNB 2F8MA 2A10A 3NMAA 1O8BA 1N54B 4RW6A 5F0WA 3WC0A 2BW2A 1N0VC 2LQ9A 5KFTA 5DJBA 4F3QA 3H5SA 2GC8A 2QSWA 4B9UA 4H54A 3P6YC 2ZH9A 1KRPA 2V8HA 3TA1A 4E98A 3DU6A 1YIJS 1UEVA 1BQMB 2RRBA 1FRMA 2WK4A 3B82A 5KFSA 2QEXS 4C3LA 4QR0A 2H5EA 5BJRA 2BDPA 2KRBA 1KLMB 3OW2R 4IQXA 3WC2A 2AJQA 3FVYA 3JTOA 1LV5A 2YWEA 1HPZB 2IA6A 1NEEA 5A8RB 3I4PA 1F60B 4X84A 1TK5A 4EYHB 1VFJA 4QPTA 3VR1A 3W2VA 5KFFA 5DM6Q 2FHOB 2J9DA 4IOBA 2GQ2A 4Y6IA 1KQKA 1HI8A 2HFOA 2IAJA 3FZ2A 1WF0A 3M6VA 1NO8A 1I94F 2VBYA 5B0GA 3GZ7A 3ICLA 3FSYA 1X5OA 2JL9A 2FC9A 1Q81T 1IKXA 1S72S 2NYIA 4ELTA 3QGHA 4PG7A 1HNIA 4TNOA 3N28A 4RUAA 3CGIA 4QWEA 4IRDA 3QZ8A 1YJNS 4PR6A 2NUUG 2RILA 2DHSA 1TL4A 2W8KA 2QZ8A 2Z4PA 3Q2SC 3PZPA 2J0SD 2LDIA 3LP2A 4NLRA 2I0XA 1DURA 1C4AA 2O01C 1RT7A 5C42B 2A2CA 2WAQD 2D3ZA 1JIHA 2NLWA 3MMBA 3C46A 4A4JA 4HTIA 1QM9A 4LT6A 3EPGA 4YFUA 3F44A 1S49A 2UXDF 3DHWC 3IR7B 5LSRA 2R8IA 5JVHQ 2VONA 3K8VA 1HI0P 2XMUA 1Q1KA 2CVIA 4WFZA 2F7VA 1IKXB 1E6YB 4U6PA 3CCES 4A8SA 4B3RF 1X5SA 1REVA 5J2QA 2XC9A 3BM7A 2IVFB 1RT5B 2IM2A 1EP4B 2XG8A 4FS1A 3PXGa 3SQGA 3VZHA 2YNFA 1U6BA 4AFFA 2K1RA 1VQ6S 1UVNA 2CJKA 2N3LA 3VAGA 2ZHBA 2XS5A 1C1BA 2PMHA 4ELVA 4B3OB 4OFZA 1RT7B 5C42A 2B7CB 4JBCA 1L3SA 2UV8A 2IVMA 3MM7B 5A8WB 5F8HA 4QCLA 3GWCA 3DM2B 3DLHA 3OL8A 2XY5A 2DGQA 5ITHA 3TOQA 5IZHA 2QYCA 3LF0A 1VRTA 1GT8A 4ZPDA 1FA0A 3BB5A 3AA9A 4PG6A 3CJKB 3SEOA 3N5BA 2FVSA 2OIHA 1T3OA 5BR8F 2JEFA 1HL6A 3BR8A 4WKRA 4I69A 2HHPA 3RRKA 3V6JA 1RT1A 2V4QA 5LMNF 2EK1A 4MYTA 4HYKA 2XI2A 2AW0A 1YJVA 1FCAA 1XMQF 2VA3A 2Z0GA 1V6HA 3C8YA 1CVJA 3WDOA 3JSRA 1LW0A 2MSTA 5D4NA 1S1TB 5DGBA 4DJBA 5L1JA 2PFFB 2F4VF 2RIJA 2HNYB 2HFZA 3LP1A 4M95A 5CA5A 2PA3A 2U1AA 1SV5A 1ZH5A 2YNHB 3I5AA 4DPOA 2OP5A 4OJ3A 4ECVA 1PGZA 4WZQA 4DSJA 4AQYF 4A8WA 3D1OA 4ZVFA 2IBKA 3EZ5A 4IH7A 3S8SA 2IJFA 3FMBA 3HVTA 2UP1A 3PACA 1VQLS 3HHLC 3SV4A 3EYZA 1Q8IA 1M5SA 4NLGA 4UY8T 4DSEA 1S1XA 3Q8QB 2ZJPQ 1HA1A 2KZMA 3TUIC 4FNHA 1WG5A 3HP6A 2DHXA 2EFGA 2Y1RI 4I1TA 1OSDA 3ZC4A 1VQOS 2V0NA 4XO0A 1R89A 2MZTA 1FE0A 2QLXA 3L95X 5KTQA 1CC8A 1QTMA 1MNEA 2GMLA 4ILMA 3DRPB 2AYEA 1VJWA 2RRNA 4K4WA 4J5OA 4MFBB 2FVRA 4KV8A 1HI1A 2W4DA 4C3KA 4WE1B 1MU2B 2DO4A 2JZ5A 2J6UA 4B9NA 1UETA 1VK8A 3FQLA 4EZ9A 4Y2MA 3J81Y 2AYGA 5KFDA 5CHCB 2W9AA 5EUHA 1FT8A 3BQ0A 1H98A 2KYZA 3R5BA 3BSOA 1XR6A 4IO1A 2V8GA 2IAJB 4HI2A 1ZZNA 4MK7A 1S9GB 4ZS6A 2MPUA 1VIOA 4J37A 3OSNA 2B4VA 3DMJA 2A18A 1FRIA 4IKAA 2K7JA 2AP6A 4EYIB 2GMHA 1WWHA 4QIEA 5J2PB 1U45A 2RQ4A 3JYTA 4AL7A 2UUBF 2BUNA 2KDOA 4MJKA 3OXGA 2RSQA 3KKFA 2AX0A 1TFYA 3RB3A 1NK5A 4IG3B 2W8LA 2KHDA 5K14A 5DDQC 1ZM2A 4NLYA 3OHAA 1GTEA 1U26A 5B7WA 1TQLA 1IR0A 2DNMA 2LXIA 4ETXA 1HFEL 2CPDA 2DNNA 4ES1A 2R8JA 3PO4A 4QW8A 5E2QA 3KJVA 1HQEB 1N48A 4A8MP 4RNHA 3HHNB 4GC7A 3QPIA 2JX2A 4URSA 3QGIA 1N52B 3M9MB 4JI2F 1QUVA 3I9ZA 4ZLPA 2K2PA 1KFDA 2WB1D 2A3JA 2YNIB 2AD9A 1SBRA 5A6WA 5H9EJ 1U1OA 4O3NA 1IJEB 2ZH3A 3JSBA 3F73A 1D1UA 3KK3A 2C2RA 2R7UA 1RJJA 4DV1F 5K14B 2UVWA 4LF8F 2F40A 4MIAA 1SV5B 3SSQA 4W92B 1WELA 3DLJA 4LIRA 1WF2A 5IS2A 4ZHRB 2WCXA 5GAGU 4NWBA 4N5SA 4WKYA 2FD2A 2BRLA 4B02A 3QLHA 2GQCA 2CPEA 1A7GE 3KTQA 3KFWX 2UUCF 3IGNA 2GJIA 1FRXA 2RJZA 2MHNA 3PKMA 5L9XA 1AW0A 1UA1A 3D0GE 4N41A 5AE2A 1G1XA 2M2BA 4NPOA 3MR3A 3GQCA 2DH7A 2QFJA 5B0BA 4QW9A 2MQQA 4RNNA 1RT4B 5KFAA 3NS5A 5C5JA 3OR2B 1H7WA 1HNZF 2E66A 4K4XA 3MURP 2XWYA 3G6ES 4DL7A 3UWTA 4A8QA 3KG4A 1S1WB 3DOMA 4QR1A 1BLUA 1Q82T 4R8UA 5IT0A 3N6LA 2IRYA 4N8OA 4KB7A 1HHTP 4OHYA 2O5DA 2UVRA 1X7VA 5A8RA 4LVNP 4X62F 4ED5A 3GG0A 1AFJA 5E3CA 5HBMA 2CG4A 3MM5B 4AXIA 3M2VB 1DLOA 1RT2A 5AXLA 1U1RA 2VUGA 4CO4A 2YQ3A 5CYQA 2DTJA 4USIA 4X4RA 4QWDA 1UFWA 2HS0A 2DGOA 1HBMB 1ZAVA 2VOOA 3KMQA 2DRAA 1LK5A 4O4RA 4DEZA 1SL0A 5FJ4A 2YX4A 3S6EA 2KT3A 5GAEI 1Y00A 2V4JB 3MECB 2GHWA 3VALA 3U1MA 3PO5A 3M1VA 2MDAA 2N4DA 4Y2IA 2R7SA 4PG8A 3PW5A 1ZPWX 3CT9A 4ECYA 4PWDA 4C0OC 4KTQA 1M1KT 1GQEA 2M88A 1RT3A 2CPFA 2HQIA 1S0OA 2DNLA 1IKWA 4UQTA 1JLEA 3KLIA 2WBRA 4ALZA 4EU0A 4DSKA 3ISZA 4ZMMA 1IBKF 2HHWA 3KK2A 4AL5A 3IA0A 4DN0A 1O51A 5AE1A 5KFZA 2OTJS 4DOZA 1F5BA 3NL0A 2DBBA 1BQNB 3TUZC 1D8ZA 1VIXA 1VQYA 4RUHA 2DR7A 2XHWA 2XULA 3WZ0A 4IOCQ </