3VAKA

Structure of u2af65 variant with bru5 dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
b'GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
total genus 42
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vakA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vakA02
1QVFR 2LA4A 3MI7X 2CPFA 4PKDB 1WELA 2G4BA 1HA1A 2ZJRQ 1P27B 1U1MA 5LXRA 2DHGA 2YH0A 3S01A 1FJCA 2RS8A 1OO0B 2A3JA 2CQ0A 2VODA 4F26A 2G0CA 1K73T 3MD1A 2N7CA 2HZCA 2KN4A 2LXIA 4WFBQ 3THPA 3BEGB 5H1SV 3UCGA 1YJ9S 2DNRA 2L9WA 2MPUA 2FPHX 4C4WA 2LEAA 1YI2S 1QVGR 1Q81T 4PRFA 2M0GB 3EGNA 3H2VE 4QU6A 1X5PA 1KOOA 1M5KC 2RQ4A 2LECA 2AYGA 3CD6S 2KRRA 4FXVA 2KFYA 2DNOA 1X5TA 2LQ5A 2MGZB 1VQ8S 4YUDA 3D2WA 5LSOA 1FXLA 5FJ4A 2RU3A 2LEBA 1IQTA 4LIRA 1X4CA 3CULA 2DISA 1WWHA 2HGNA 1U1QA 1H2VZ 2CPEA 2KU7A 1M5OC 1WHXA 2N3LA 1WF2A 2DB1A 1XN9A 2D9PA 3CCVS 3DLLQ 3P49B 2KXHA 1ZZFA 1M5PC 4IO9Q 1SJRA 2PEHA 1WEZA 1S72S 3MDFA 1X4GA 2KT5A 3CTRA 2DNPA 5LJ5Y 2O3DA 1VQOS 4WFAQ 2MKHA 5DDRC 2AYMA 2CQ3A 4WIIA 3ZZZA 1DZ5A 4ED5A 2LCWA 2DNNA 3TO8A 4Z2XA 1YTYA 1H6KX 4YB1P 5EN1A 3UE2A 1WTBA 3CF5Q 2EK1A 3NNHA 4CH1A 2XB2D 2LYVA 2CPZA 4WCEQ 2JRSA 2CQGA 1KOHA 2MKSA 1U1PA 2J0SD 1AUDA 3CPWR 1R8HA 1WEYA 5D77A 3G8TA 1U1OA 2DNHA 4CIOA 1PO6A 1F9FA 2CQHA 3CCSS 1SXLA 2KG1A 1O0PA 2KVIA 2MYFA 1N88A 2D3OR 3Q2SC 3CC2S 3BS9A 3NNCA 2RT3A 1WF0A 2F9JA 1DBDA 5LSLA 2MZQA 1RKJA 3S8SA 1UP1A 3VAKA 3UWTA 2KM8C 4V19X 2PE8A 3H2UB 1UAWA 2RNEA 1VQ9S 4Y0FA 4QPTA 4FXWA 5GAGU 2FC8A 3ULHA 1NJIT 2M4MA 2OTLS 2FHOB 3CUNA 5DDOC 2DHSA 3MXHP 2J0QD 2X1FA 1VBZA 3G71S 4WF9Q 1WI8A 1WHWA 3U1LA 3US5A 4RU2A 1B7FA 2VOPA 2CQ1A 2CQBA 2GO9A 2Q79A 3EGZA 1VQ7S 2AD9A 1N54B 1X4EA 3G96A 5DETA 2HVZA 3LPYA 2HGLA 2XS5A 2JX2A 5D78A 5IFMA 3S6EA 2KI2A 3R27A 3MUTP 2MQOA 2DK2A 2JVRA 2DNQA 2LA6A 2RRBA 4CH0S 3RW6A 1YITS 2J8AA 1W2BR 2CPYA 2CPXA 1FJEB 2MKCA 2N3OA 2MKKA 1X4AA 2X1GA 2DHXA 3UD3P 5CXTA 2K8GA 2CJKA 2KH9A 2LKZA 2QEXS 4W92B 2U1AA 5GAHU 5DM6Q 1H2UX 3VAJA 1VQ4S 5JVHQ 5HL7Q 3HI9A 3TYTA 1VBYA 3P6YC 1VBXA 2MKJA 2AYBA 2MHNA 1H2TZ 3MURP 2ADCA 1U1RA 1U1KA 3NMRA 1X5SA 3IWNC 3VAHA 2CQ2A 3SXLA 4Y00A 2DGVA 2U2FA 2CQCA 1VC0A 2I2YA 1G2EA 2M70A 3UD4P 3CC4S 5CA5A 5LXYA 3BO2A 1D8ZA 1YJNS 3VAFA 1VC5A 3VAMA 1WHYA 2ZJPQ 1KC8T 1L3KA 1RK8A 2DGQA 2M88A 3J7ZT 2MQLA 2DH7A 2DNMA 2CPJA 1R8PA 4C7QA 1OWXA 2I38A 2FY1A 1HD1A 3UCZP 2NLWA 4M5DB 1BY9A 3BO3A 2UP1A 3CCQS 1WG4A 2DIVA 4TU9A 1VQMS 2DNYA 2CQ4A 2MJNA 2F3JA 2EK6A 2E44A 1X0FA 2YH1A 2DNZA 1WG1A 1X5OA 3PIPQ 1SJQA 3B4MA 1VQKS 1FNXH 2V94A 4ERDA 3CCLS 2M8HA 3P5TL 5IQQA 2MSTA 2VOOA 4TU7A 1U6FA 1D9AA 1K9MT 1HD0A 2F9DA 2B0GA 2DIUA 1U2FA 1Q86T 2DITA 2MMYA 2M2BA 1DHMA 3THTA 2KHCA 3J7YU 2M9KA 3JB9k 1DRZA 2K3KA 3NNAA 1FT8A 1X4DA 2MQQA 3CCRS 3CXCR 1VC6A 1UFWA 2JWNA 2BOPA 2KG0A 2MQMA 2GHPA 1WG5A 3FEXB 5GMKa 2D9OA 2MZRA 1K8AT 3U1MA 1WHVA 1YWXA 5GVQA 2DHAA 3EX7B 1JJHA 3CCJS 3K0JA 2DH9A 1UW4A 4W90B 1U1NA 1VQLS 2AYEA 3IRWP 3MD3A 3CCES 2ZJQQ 3S7RA 2CQPA 2MZJA 3PIOQ 5GADU 3DXBA 3VAGA 1JJ2R 2DGWA 3TP2A 3R1HA 2MXYA 3LQVA 2X1AA 2DH8A 4C0OC 5GAEU 1SJFA 1X4FA 2E5JA 4J5OA 2OJ3A 1ZH5A 3NS6A 2XSFA 5ITHA 2CPIA 2DGOA 1HL6A 1OIAA 1FHTA 1M5VC 1A7GE 2RUGA 1M90T 2BZ2A 2E5HA 2HGMA 5JVGQ 2WBRA 3ZZYA 4OZ0A 1S79A 2QFJA 2DGTA 2HYIB 2CPDA 1YJWS 1U6BA 1PGZA 3VALA 3B4DA 4EGLA 3UCUP 1Q82T 2MQNA 3N9UC 2ERRA 1N8RT 1JJ4A 2YWKA 4WFNQ 2CPHA 1X4BA 2L08A 3CMES 2OSRA 2N82B 3R1LA 2LXUA 2M7SA 3OW2R 2MSSA 2DNKA 3P3DA 2OTJS 2KM8B 2XS2A 4U67Q 3MUMP 3G9CA 2DGUA 1U1LA 4P6QA 3I56S 2ADBA 1YHQS 2MZSA 5CYJA 4CQ1A 2NZ4A 4IOAQ 1NU4A 5MLCV 3SDEA 4OZ1A 4IUFA 2RVJA 3CCMS 2XS7A 4QU7A 4PR6A 1KQSR 1QM9A 2LMIA 4F02A 2DGSA 1VQ6S 3FEYB 2SXLA 1WF1A 1X4HA 1WI6A 1N52B 3G6ES 5IM0A 2QA4S 3I55S 2JVOA 2EVZA 2MJUA 2RQCA 1YIJS 2M52A 4ZKAA 1VQPS 3VF0B 2MKIA 4WKRA 2RRAA 4UY8T 5DDQC 3BO4A 1FO1A 2OSQA 4TU8A 1JMTA 3RW7A 4F25A 1SJ3P 4BS2A 4QQBA 2MY7A 2J76E 1P1TA 4IOCQ 2E5IA 2VONA 2YTCA 2CQDA 2RS2A 3HHNB 2DO4A 3MUVP 1VQNS 3CCUS 3G8SA 4YOEA 2MQPA 2XNRA 5DDPC 1OPIA 2MZ1A 2X1BA 5DM7Q 4TLQA 1Q7YT 1KD1T 2MB0B 4LMZA 5LJ3Y 3G4SS 3L3CA 3CC7S 2FC9A 2KXFA 2KYXA 2DNLA 3MOJB 3SDEB 2OIHA 4A8XA 5BJRA 1NO8A 5HO4A 2L41A 2DGXA 1WEXA 3CMAS 1ZZNA 1VQ5S 1URNA 3NS5A 2E5GA 2MZTA 1CVJA 1SJ4P 3Q2TC 1FJ7A 5IM0B 4UQTA 2CQIA 2M8DB 2MGZA 3V4MA 2YKAA 3VAIA 2G1DA 2MY8A 1M1KT 2XNQA 2DNGA 2DO0A 3SMZA 1A9NB 2KXNB 4LJMA 2KRBA
chains in the Genus database with same CATH superfamily
4RW6B 3WQPA 2DHGA 2HFSA 1W26A 1OO0B 4FNHA 2CZ9A 5I3QA 1ZAVA 5BR8J 2F4FA 1DTQB 2LU1A 3IGNA 5FDLB 1XBWA 1ZA1B 4G1PA 1N5YA 1S10A 5FD1A 3OSPA 1LK5A 1KQGB 5EUHA 2GGPB 1GX5A 2LECA 2C1EB 2D3UA 1FXLA 2W24A 5A0YA 1WWHA 1P9YA 2POKA 4LQ3A 4DV5F 4EBEA 1SJRA 3AH6A 1PAEX 3AA9A 4MKBA 4PG6A 1ACMB 3MCOA 3H4DA 3K7RA 4X62F 1S6QB 4ZIWA 2ZE2A 3R7NB 3JTNA 3KLFA 2XZTB 5KFOA 4H4MA 4UOHA 1SXLA 2KKHA 2NCKL 1GMVA 2V69A 3QT8A 2YKNA 5JMNA 5HROB 4U8YA 1R3NA 4HHJA 1RJJA 3N0VA 2O67A 2CKWA 1YBTA 4WF9Q 4PUOA 3NWGA 4YHHF 2CQBA 1N54B 4NLPA 4HACA 5B0AA 3A12A 3TEGA 4K4ZA 5KFTA 3ZTQA 2BANB 3BGFA 4RO0A 2ZITA 1EJ7L 4Z37A 3HVRA 3Q8QB 1FJEB 3K5LA 2X1GA 2IJFA 2Y1IA 3OLBA 2Y1LB 3C14A 2DT9A 5B0GA 4W92B 3K17A 3VAJA 3J81U 4CI0B 2FGCA 3EE3A 1NDKA 4JI6F 3T19A 2BUNA 4S0MA 1BQMB 3EPGA 1TZ0A 1B7YB 1JKHB 4Y2CA 4LFAJ 1S59A 3ENVA 2VBYA 1JQGA 1R8PA 1UTAA 3CO9A 1HD1A 4B3RJ 3L9ZA 2JDJA 1BY9A 3OVSA 2KL8A 2DIVA 4CYUB 2VKRA 4C8KA 5THWA 1K0VA 3J81j 1XK8A 2R8IA 1JLAA 3OLAA 3ZZTA 1N5SA 4LF6J 1RTIA 2Z2MA 1EQMA 3KDOA 4R0JA 1TL5A 1HNXJ 1IUJA 1Q86T 4LF8J 2J8SA 5DQGA 2J6UA 1LWFA 2J6SA 1CSJA 4QWBA 3RGIA 4FYYB 1NK9A 3WC0A 1C0TA 3H5XA 4MYTA 3K59A 4TQRA 2HQIA 2MLXA 1RT4B 2VB6A 4NLDA 4P74A 4Z7YA 5DGBA 1SH0A 2ZNYA 2PEBA 2E9ZA 4ICLB 4I2QB 4DR3J 2MXYA 2YQ3A 2OJ3A 4A8YA 4CLPA 5I3UA 1SQGA 2H4WB 3KK3B 4I6YA 4JI3J 2BE2A 1KTVA 2PSZA 1JNZB 4F4AA 2HYIB 1KDNA 1YJWS 1Y9OA 1RU1A 4M5HA 1FRXA 4Q7AA 2B56A 1N8RT 1JJ4A 2VFVA 1PSDA 1R8AA 4P9SA 4CNZA 4USHA 2ABYA 3BGLA 4NLWA 2XGPA 4IR1A 1C0UB 3KJQB 3MR5A 2B5JA 3FNNA 1D9DA 3SDEA 2XY7A 4K4TA 2ZKUA 3QGHA 2RDIA 1N52B 3F41A 1KLMA 2D7SA 1TFWA 2OPPB 3JQMA 2VFSA 1HNZJ 3QSYB 2FHJA 4F0HA 4CLWA 1OMSA 4ZA1A 4EMDA 1PC4A 5DM7Q 3NKYA 5D4LA 2DXDA 2WHOA 1ELOA 2P9GA 2XLJA 4U6PA 5KFMA 4ZK7M 3CMAS 1I6JA 4ITSA 3EPIA 3GV7B 2QC3A 4UQTA 1UZHA 2C42A 3Q89A 2HVEA 4WP8A 4NASA 1YDLA 2Q3PA 4JI5J 2FYXA 3KLIA 1RP5A 1QVFR 2CPFA 4PKDB 1CJUB 3BB5A 3V6DA 5LXRA 1TQLA 1BXNA 3TX8A 5J2MB 2R2UA 2VH7A 3QYYA 4LF1A 1FJGF 5EWFA 5FLXU 3GPAA 2L9WA 3GCXP 1S6PA 3PHEA 4FNIA 4ZPBA 4CM0A 3PM9A 5KFCA 3A13A 4YUDA 2X51A 4B3MJ 4NZ7A 1YG0A 2HVIA 3OFFA 4K0KF 5F9LA 2E9TA 1H72C 2AJ4A 4JUZA 2G0JA 2O5DA 2KZZA 1XNQF 1S72S 5KFVA 3QJJA 4OYOA 3BR9A 4LRCA 4KSEB 2I5JA 3RZAA 3A1YG 4UZCA 5DDRC 3G82B 2UUTA 2LCWA 3JSMB 5J1NA 4F7VA 4J9PA 2UXBJ 2IJRA 2AGPA 3CF5Q 2W7OA 2XWXA 2XGQA 4TNOA 4EEYA 1B70B 1AUDA 2Y8WA 3OUYB 3MM8B 3Q8SB 3LP2A 2H4YB 3CJ2A 1S49A 3UVJA 4HR2A 1WDDA 3KK2B 2HIQA 4RNHA 3EZUA 1DJ0A 8AT1B 3HKZD 2ROPA 4O3QA 1U4BA 2HBQB 3ETMA 1RKJA 2PE8A 1M5SA 1UAWA 5KFGA 1VQ9S 3C6UA 4PQUA 3HM9A 3GFXA 2AGQA 2M4MA 3T9NA 1RAAB 3VHQA 2CJXB 1R0CB 4LRFA 4Z7CA 1DARA 2VC1A 5KT6A 4NA1A 1VQ7S 2WONA 1JK9B 1YKWA 3SYZA 2ZBRA 2CPXA 1OY8A 1YJUA 2WVEA 2W4CA 5ETMA 2RQMA 1XMOF 3FVYA 2YNGA 2V8DA 2B4VA 2HBRB 1H2UX 3J80U 4J9OA 2HWHA 4JI2F 4R25A 2MKJA 1H2TZ 1HMVB 1U1KA 4B3SF 2YXLA 1TU0B 3SXLA 1XIQA 4DI6A 3K5OA 1U2RA 2F8MA 2CFXA 1KVKA 4B3RF 5F8HA 3SFGA 3VAFA 4DV4J 1NNDA 3HSDA 3OD2A 2DNMA 3R5CA 3BV8A 2VQEJ 2B4PA 5GAHI 3I5AA 4XDDA 2IRYA 2UP1A 3CCQS 1CC8A 1RU2A 2CQ4A 2VF3A 2ZHOA 1RAJA 3J7Z5 3ZXWA 4AL6A 3HSZA 2BW2A 4LSNA 1HD0A 1S9GB 4KAIA 1UVIA 1FRMA 5KG1A 3M6VA 1DRZA 2XMUA 2DJWA 1MMNA 4ZPWR 3G6YA 4M63A 2MQQA 2HVHA 2BQ3A 4WU2A 3FEXB 2YWEA 2HS0A 3SSRA 1UW4A 1W25A 4DR3F 2V34A 2ZJQQ 1S0MA 2GCFA 1QAXA 3AJ2A 1SH2A 4I6WA 2V6AA 3BZQA 2IVFB 4OI0A 5ITHA 1UJ4A 4OMFG 4ALZA 3AA8A 3GZ7A 2OPRA 1S79A 1UETA 2VKZG 3MAHA 2L08A 2YQ1A 3M8QB 5DZ7A 3SEOA 2AT1B 3BGUA 1FEHA 2C2RA 4OZNA 5HMXA 1C1CB 1ZAXA 4IDKB 1RGVA 1AZSA 4QR2A 2ZH5A 4LSZB 3SI8A 2DPJA 4OI3A 1HNZF 3GYNA 4DR4J 2HWIA 4M5MA 2MJUA 3NY0A 3KJNB 4Q8EA 1VQPS 4ES1A 1TK0A 3BO4A 5ETKA 4H4KA 1FD2A 2H5EA 2XC9A 1NPPA 3VGUA 4DPUA 4FVMA 4YOEA 4PQAA 2ATLA 4FN5A 1YLXA 4RNNA 1T7PA 2KYXA 1GEHA 4KPYA 3MTKA 3TEHB 1NSKL 4GKJF 3ISND 2Z8QA 2FDNA 2NSCA 3MMAB 2ZM6F 3MEGB 3LWMA 3KLHA 4X65J 1CJKA 2JEFA 3SMZA 4OI2A 4LVNP 3DU6A 4DCOB 4M5JA 3KUGA 1N5TA 1NSAA 1U1MA 1FJCA 4KO0A 2CQ0A 2ZBQA 2V8HA 1K73T 3GV8B 3DCAA 3D7SB 4JI7J 2ZZMA 3OR1B 3HHEA 2CUYA 3DMJA 3UCGA 1SC3B 3NGSA 3RRKA 1X5PA 3ENAA 2XMWA 2OELA 3CEDA 4IH7A 5E5NA 1NH8A 4MTPA 4QR1A 3UNYA 3CULA 3TUPA 2IBKA 2KU7A 1M5OC 4ZHRB 3P49B 2BOAA 3K89A 1S9EB 4JI4F 4X64J 2F8EX 2HURA 4L73A 2CQ3A 2IAJB 1YVFA 2HHPA 4ZP8A 1FK9A 3DI6B 3SCLE 1N48A 3R6LB 1WTBA 2AHOB 4IFYB 4DQPA 1M1GA 4GO7X 4KH0B 2AF6A 3MHYA 3CPWR 4E0DA 4IG0B 4MJKA 3UN2A 4KV8B 5J1PA 4AXIA 2V4RA 2W9BA 4ETZA 3R97A 1BHNA 2XBPA 4FXWA 4NCGA 3ULHA 3OHAA 4IG3A 2QA2A 2DHSA 1TK5A 5KFHA 3KXDA 4G6VB 4YMEA 4DUYJ 5DLFA 3IN5A 2YPYA 5G0RA 3K5NA 5BXIA 4X4VA 2R7XA 2HGLA 4Y2AA 5IFMA 5CZVA 3MUTP 4L72B 4HTJA 1RHUB 4ZPCA 2MKKA 3VZHA 2YBVA 4E8UA 2VD3A 4WJBA 5SUHA 2B9XA 2QEXS 3FDSA 4CO1A 3HD1A 4FPRA 2Y3YA 1TVRA 1HWUA 1S99A 1QY7A 1SKUB 3PR4A 1I3OB 5DRKA 2GX8A 1UVKA 1T05B 3RB4A 2UU9F 1RBAA 2DH7A 4RNOA 4DU8A 1FTRA 3HD2A 1RWKB 1VQMS 4TU9A 1V6HA 3PRBA 2E44A 3AD9C 1LW2A 1TKZB 4NMXA 5HP1A 5AXKA 4CO4A 3TJAA 3OTBA 1PAUB 4KGXB 3V5RA 4ZJQA 1D9AA 2NS1B 2QLXA 4UZBA 2X3DA 4RZRA 3T5KA 3I0RA 4OJ1A 2YKOA 2L3MA 1UEKA 2YWGA 3CJ8A 1MWQA 5F3TA 4PXEA 5GVQA 4CT9A 4W90B 2R7SA 4ZPVR 2QLBB 5D0RA 3HK2A 3AXMA 2DR7A 3MPWA 3H42A 5D0GA 3DXBA 1R8CA 1QTNB 3TP2A 1VGYA 3TA1A 2HAFA 4CTAB 3F44A 1OIAA 1UFKA 2HSEB 2XYHB 4ECRA 3T1AA 2BZ2A 1HBMB 2HGMA 4C97A 1SC4B 1IR2A 1RTHA 5GADI 2HFVA 2ERRA 4X4RA 2GO8A 2WONB 5F8LA 2QGFB 2DNKA 3OL8A 3D28A 1U1LA 3JTPA 2ADBA 4NLSA 3ZZRA 3BKFA 1CULA 5DO2A 4QCLA 1DTTA 2XMMA 1EHWA 1KHWA 2NXCA 2LMIA 5M2PA 4PYAA 1QD1A 2MKIA 2JLEA 2ZVIA 3UN3A 3VGSA 3CJRA 5A6WA 2E5LF 1R0BG 5CABA 3DOKA 1N33J 3QIPB 2VPZB 1AFJA 2MZ1A 3RB0A 3G4SS 2OUGA 2DNLA 4I6AA 5B09A 4YY3F 4X65F 1N4LA 5J2PA 4NXMJ 3JSRA 2WCXA 1S48A 1VQ5S 1IKXB 2J6TA 3Q2TC 3MMCB 4DJBA 3EJMA 4JV1A 4USKA 4ZVGA 4PWUA 2QMXA 1FXRA 2COLA 4DL4A 4JI7F 3M2RA 2QLJB 4ZN1A 2G4BA 1W2IA 2RS8A 4O3PA 2LXIA 3Q8YA 2XCPA 4ANEA 4Q0BB 4PG7A 1P6TA 3I5CA 1NJZA 2KZMA 1T9VA 4ID8A 4R5PB 3H2VE 1V9OA 2GQQA 3KHRA 1RT1A 2YKPA 2DISA 4DDFA 1WHXA 1WF2A 3IG1A 5IT4A 2LP4A 2OPRB 4AL7A 2NXNA 3CIZA 4WFAQ 4YP3A 1T03A 5KFIA 2BJEA 4Z2XA 1RHQB 2RF2B 4O23A 2BXJA 2XB2D 5HSPA 3KFWX 2FJBB 4B9SA 3G8TA 3E01A 2A1BA 4JOUA 1MROB 3IO1A 3G87A 5ETPA 1QLNA 1FEEA 2VFRA 3KMQA 3CIMA 1NPRA 4P7VA 5A76A 4DR1J 2JJ4D 3C16A 1TUVA 5K20B 4FYDA 4C11B 3Q8PB 2MKYA 2HW3A 1WKJA 1E6YB 1Q95G 3IBFB 1UZDA 5HVFA 4IR9A 2RKIB 1L3TA 3IBCB 2WSEC 5CQGA 3G71S 1WC5A 3HHLD 2R8JA 4FYXB 4UOFA 1T8EA 5B0FA 4DV2F 2A2DA 5A8WA 1ROFA 1J5OB 1YBAA 2C3PA 3M8SA 2VJVA 1NAQA 2N3OA 4K4SA 1HQEB 4OL8A 5IT9Y 2K8GA 4DV0F 4DHVA 5DM6Q 1WSRA 4L3KA 3PJXA 2V9WA 2K1RA 2AYBA 3DU5A 1X5SA 1FXDA 3BGRA 3PJWA 2CNKB 3E51A 2M70A 3DLEB 4EWTA 3BKUA 1WHYA 3DRSB 4QPXA 3J7ZT 2MQLA 3C3LA 1RAIB 4DR6F 2NLWA 4RNMA 4KHRA 2J0WA 2G2YA 4OYXA 2MJNA 2ASYA 1WUUA 1ZS6A 1X5OA 1PIEA 2FZKB 1IWAA 1MMDA 1JXEA 3JYTB 1ZPVA 3JSYA 2F65A 1HLWA 5A8RB 4NA3A 2OFGX 3MR2A 5ETSA 3JB9k 2C3MA 2YNIA 4YN3B 3OTOJ 2YNFA 2VIHA 4QWEA 2BM1A 1K8AT 2J9CA 4X4OA 3X3UA 1TL4A 5CYMB 2QSWA 3MD3A 3TZXA 5E3PA 4P7TA 2H1YA 4U7UD 1IBMJ 1JJ2R 4ZLLA 3FBFA 3U02A 4FS2A 1ZOTA 3M8YA 3UR3C 3UI3A 3KG0A 1HL6A 1LNQA 1UFLA 1FD8A 4EZ6A 2YNHB 3A4TA 1U6BA 2DR9A 3D0HE 4DV7J 1TKXA 3NL0A 3BBFA 4ES2A 4FZVA 4JV5J 5IWAJ 3HHDA 3P3DA 5SZTA 2YX1A 3G9CA 1ZPWX 2AX0A 3UQSA 3HF5A 2CAJA 4RBUA 5CD4A 2RVJA 4QU7A 1QAIA 3G6VA 4N76A 3H98A 1HR0J 2OFHX 1ICEB 1FNOA 5K8MA 4F25A 2JLGA 1V3SA 4CLZA 4IOCQ 4RW9B 2V2QA 5J1EB 2RS2A 2IFXA 4NXMF 4AUKA 1HNVA 3MMJA 3POTA 1KD1T 1ZBTA 3M05A 2CJYB 4KFBA 4OI4A 4J9RA 2OIHA 3I9ZA 3UDCA 2X3GA 3NS5A 2E5GA 4NLTA 1RT6B 5KFKA 3EDQB 3IRXA 2LQ8A 1RTDB 2HHWA 1HNIA 3DDKA 1MG7A 3BPSP 1ZA2B 1REVB 2MY8A 1ZM4A 1NHKL 3CXCR 3N28A 1RT7A 1OSCA 4QW8A 4I67A 1RT5A 2HAIA 3M30A 2VODA 3MD1A 2N7CA 2HZCA 1FDAA 3RG6A 4AFFA 3R9LA 2LDIA 2DNRA 3QRQA 3DXSX 3ILJA 1NBEB 4C3KA 3K2YA 2F4VF 4ZVOB 1YK9A 2GW8A 2V8VA 2LEBA 2RMLA 4ZN3A 4A8FA 5K8OA 3PFOA 1KFSA 4JV2A 4HVZA 2KXHA 4WK1A 1I5OB 4ED8A 1FWLA 4WZMA 2EFVA 1WTFA 3Q8RB 1S6UA 4I2PA 3B54A 2PA3A 2GZOA 1IJEB 1H6KX 2HHHJ 1HHQA 4U96A 3PG9A 5ADZA 5C2CA 2CXEA 4KRWA 1ZM9A 1F5BA 1HBUB 2NUHA 4USMA 3R2CJ 3DFEA 1HI0P 4PCQA 3AODA 3MPUB 4IQMA 1DTTB 4DG1B 5EX0A 1NRKA 2I1RA 1CPZA 2CWXA 3KNGA 4NEYA 2KYZA 2FVCA 1DURA 1NJIT 1KKHA 1JLGA 5EX3A 2AZ1A 4XO0A 3US5A 2XM3A 4RU2A 2RAQA 4ZS6A 3OFHA 2EC0A 1JLQB 1B0PA 5D78A 1F3VA 1RAGB 4NLYA 2DNQA 3UPFA 1KTQA 4KGZB 4C6AA 1RZMA 3WBZA 4LF9F 2EFPA 1JLFA 3DLBA 2CNNB 2B7BB 2ASLA 3CCZA 4QR0A 3NMRA 1HHSA 4TKTA 4USVA 2WW8A 1LWEA 3VGTA 5KT2A 3I6PA 2GJ2A 2B6AB 3N79A 3KWMA 3MCSA 1V5IB 2DGQA 4NLOA 1J2VA 2GVZB 1OWXA 2NXUA 3RBXA 1H38A 3C6TA 3WX4A 5HVHA 1WG4A 3T5JA 1WORA 2OPQA 3OTEA 2R7WA 3K8WA 3GFZA 4QYZK 2OKQA 3B4MA 3HJVA 5EHHA 4AYBD 2OH2A 1GNKA 2YWWA 2MDAA 4KGKA 1LK7A 2VV5A 2MSTA 2R7TA 3OTOF 4DL5A 3MEEB 3RB3A 5HLFA 1HBOA 4IKAA 2RUSA 3RBEA 4JI0F 3NNAA 4DSEA 5GMDA 2MQMA 1T03B 2F8HA 3GTYX 3R5AA 2FJDB 1GMWD 4DL6A 2AWZA 3SSSA 3I96A 2QTWA 3H5SA 3VV2B 1IBMF 4DV6F 5LMUF 2WVDA 1VQLS 1EP4B 2FLLA 1S1XB 4K5RA 4HYKA 1Y5IB 2RU9A 2IYIA 2QYCA 2QE5A 1QUVA 4Q45A 2E1MC 4O44A 2H5IB 4ID5A 5C25B 1R43A 2Y0SD 4LF7J 2W8KA 4TQSA 3RRGA 2V8PA 1MN7A 1IKWA 2Z56B 1GX6A 2XWYA 2OLWA 4WXWA 1T11A 1TV6B 4GMKA 2V4JA 1LQ9A 4Y2MA 2OPSA 4C8YA 1MU2A 1RWXB 3DRPA 1FRKA 4TLRA 3CMES 3FFIA 2GVDB 2FZGB 2QLFB 2QL9B 4Y65A 3MUMP 4ED3A 1BMQB 2Y1JA 5F8GA 5D0HA 4KPCA 1N0UA 3R5DA 5C24B 1FE0A 2VUGA 2XY6A 2JEGA 2CNLB 3J81Y 2WB1D 2JOQA 1K1SA 1JMTA 3PW5A 2JSXA 2LQ9A 2HFZA 4OX9F 1S1TA 4JB8B 3CJ4A 1C4CA 4NOHA 3CD5A 3TA2A 3QO9B 1VQYA 4HH0A 2J9EA 2LQBA 3PACA 5HO4A 1WEXA 1SL0A 2W1BA 1RWOB 3TWZA 1TL7B 5KG0A 5IM0B 1CQNA 4O3RA 1OQ3A 1J5EF 2DVIA 2B9EA 3C15A 3JS9A 4QWCA 4LJMA 3AQOA 4PABA 1S12A 1NHVA 4D3HA 4WFZA 2PD1A 4CLYA 5AE2A 4WFBQ 2NUUG 1R8BA 1XC9A 4L75A 4PWDB 2C2EA 1U0HB 4OI6A 4A8OA 1IM4A 1DLOA 4NYZA 3DOLA 2A0FB 4LRDA 2LEPA 2N3LA 2DB1A 2C22A 4PXDA 1AROP 1UJ6A 4C8OA 4RL1A 3D68A 1NZ8A 3IM8A 4KC5A 4U8VA 1I51B 1JB0C 1D09B 1T9YA 2FJAB 1HYSA 2VQFJ 2ZHBA 2DNNA 4DCPB 4DR2J 2ZVSA 2UV8A 4KHMA 2CQGA 4B3TJ 4UQGA 4Y34A 5IT0A 2ZZTA 3OXFA 1PO6A 2PMZD 1HFEL 5E7OB 5HQMA 3KYLA 4DX5A 3FBBA 3AJDA 1N88A 2ALZA 3Q2SC 4XDCA 3M8WA 1FKPA 1IBCB 1UWAA 1WF0A 4PWWA 2F9JA 2HNDB 4LFCF 3S8SA 2FHKA 3MM9A 3HO1A 5IOLA 4Y0FA 4QPTA 3PEHA 1N6QB 4LF5F 6AT1B 3VTIA 1VRTA 1C1BB 3TI0A 2GO9A 2XO7A 2OEKA 2V2KA 2JX2A 1Q0NA 3EYZA 1G4CA 3R3TA 1RSCA 4J9KA 1D9FA 5HJXA 1H7WA 4ZVPB 1TAQA 2H9ZA 5ETTA 2UUBJ 1SI9A 1X0PA 5F0UA 1Z1ZA 5U47A 4RKUC 3O5TB 1QE1B 1RCOB 4P52A 1KQKA 1VYAA 2HNYA 3TZYA 1GH8A 1PYSB 2HK3A 2XMVA 2FQQB 1RT7B 1G2EA 3QQCD 3BO2A 4PG5A 2JLFA 3MM7B 4OZLA 1KC8T 1SJ1A 4OZ3A 1BUXA 3A3OB 1ZM3A 2FY1A 4AQYF 5T14A 3CCTA 5FLXY 3D5MA 3T41A 2F3JA 1FNMA 2XCAA 2KJVA 3MFIA 3KLGB 3A3NB 2YX4A 1KVIA 1RUSA 4U95A 2RJZA 1KLNA 4DR5J 2ZH4A 3QFWA 4ERDA 2UVWA 2M8HA 1EETA 3SZ2A 1B0TA 2BQRA 5L46A 2CWKA 3ZTRA 1DHMA 1I94J 2KHCA 2M9KA 2UXDF 2K3KA 2B4OA 4DV1J 2JWNA 1RHJB 3K58A 1Y0HA 1GMUA 1YWXA 4BC7A 3OQ2A 3QT7A 4J90A 1JLBB 3ZO7A 2QYGA 3DRRB 3IRWP 2CDQA 3K57A 4CLTA 4UF4A 4ZLNA 4IH6A 4F04B 2DH8A 1SJFA 4J5OA 3WIUA 2RIJA 4WP3A 1M90T 5KT5A 4OFZA 3KHHA 5B0DA 4NZ6A 5HMYA 2HHUA 1DQ8A 1S7IA 5LL6d 2OEJA 2Y1RI 3UCUP 4A48A 1KP6A 4FVCA 1UW9A 4LR9A 1HIYA 4Q8FA 5DG9A 1RT3A 5GAEI 3W1YC 4M95A 2LXUA 5DQIA 4DUZF 2V0NA 1VJWA 2NZ4A 5MLCV 2H48B 2R4FA 1VMBA 4PR6A 4X4NA 3W63A 2R9LA 2MLYA 2C3OA 2JVOA 5HBMA 3B78A 3HXMA 3J80Y 2HLTA 4W98A 4CLFA 4LR8A 3BH6B 4CLLA 4NLGA 1NK5A 1XERA 3PTWA 2EBEA 1RISA 2X1BA 4B08A 1S1WB 1CJVA 2ZH8A 4NLQA 2FGOA 4ED6A 5KFZA 1OSDA 2PDAA 4KE5A 3M2VA 2Z2LA 2APOA 2MZTA 2RQKA 1C4AA 2G1HA 3QZ7A 1VR6A 3HPOA 1IBKF 3T1HJ 4ED0A 4GVBB 4V19J 2IVYA 1HA1A 2ZJRQ 2NREA 3OVAA 3W7BA 4DPTA 3OVBA 2UXCJ 1FFWB 3V6JA 2PA8D 3WZ0A 3FUYA 4PXCA 4OX7A 4DPWA 3N6NA 1IR0A 4F4KA 2QN6B 2E7XA 2LQ5A 4A4JA 3PKYA 3CJKA 1VRUB 5D3GA 4WTOB 1RA6A 1JLCB 4DF4A 5K5MA 2ZD1A 4DMZA 3P5BP 2VQFF 5E3CA 3LP0A 2DD8S 3ILIA 3ENQA 3MDFA 1X4GA 3RJMB 1HWJA 2DNPA 2LQJA 3M2UB 3V81B 3A3PB 3ZZZA 3ETOA 5A2QU 3KLEB 3D3CJ 1D1UA 3DYAB 2AV5A 4OV6A 4GKKJ 3EGWB 1RAFB 2IVMA 3TJ8A 3NGTA 1XMQF 1NK6A 1BE4A 3CDAA 3LOUA 2BQUA 2W2PP 2B51A 1TUGB 3BS9A 1FX4A 4ATNA 1FKAF 1DBDA 2KFZA 2P9EA 1SL2A 2KM8C 1CLFA 2JC1A 3H2UB 3PFEA 3UW1A 3D9BA 3J7AN 4UUXA 1PCAA 3EUNA 2OMOA 2KT3A 1B7FA 1YRUA 1TL3A 1S1TB 2ATCB 2VOPA 3QGPA 1O51A 1YJTA 4NXNF 2RILA 4NCAA 4X4TA 4E98A 2KI2A 3VGVA 3ET6A 3RW6A 1VLOA 2E7WA 2GMHA 2DHXA 4LFBJ 3H4BA 3DM2B 4I4BA 4KKOB 5GAHU 3D6HB 2VPYB 2ZDOA 3T5HA 2UUWA 3OPKA 2BKNA 4O4RA 4WKYA 5KFRA 3HKWA 2U2FA 4MK7A 1HBNB 4RU9A 2YKMA 3O8WA 4FXDA 3OBIA 1UVLA 3FK4A 3SV4A 4DR5F 4CH7A 2WSFC 1WC0A 3O44A 1HHTP 2D3ZA 2DHHA 2RB7A 4ECXA 4UTGA 2UVRA 4M5LA 1F9EB 1ZETA 1DLOB 3P5TL 2VOOA 3R6GB 5IQ6A 3ILOA 1SV5A 4WFYA 2MMYA 4DS4A 4B17A 4MIBA 4N77A 2P5VA 1JIHA 1Q8LA 3FSIA 1UFWA 3WIVA 1TAUA 1RBOB 2GHPA 1HYSB 1OY9A 2HMIA 1IKVA 1X8DA 3M7VA 3LF0A 1H0HB 4TVAB 2NXJA 1SUQB 1JJHA 3VR1A 4KYZA 2FLPA 2VPWB 1WDTA 2HHVA 5LMNF 3S7RA 2VG6B 3PO5A 2MZJA 4K4VA 2LDYA 3KDNA 2V63A 3MOZA 4NE9C 2WOMB 4LF2A 1ZH5A 1EQ0A 2XSFA 1A0OB 5A8KA 4C3MA 5KFYA 2CRLA 1H7XA 2ASDA 2WBRA 4J91A 3GG1A 2R7VA 3SSQA 2OO4A 2HNZA 3B4DA 3VVUA 5HMZA 4FF2A 3DOMB 4TN2A 1R27B 3R1LA 1GTHA 5DS7A 2KM8B 3HVTA 2R2SA 2DGUA 4P6QA 3G8QA 2MZSA 4W4MA 1RI7A 4DX8H 4NI2A 4OZ1A 1RTJB 1K0TA 1FDBA 1IVZA 5HQ8A 3QPIA 3DHWC 2X7IA 4K4WA 3E2EA 5L9NA 2BMBA 4B02A 4WKRA 1ZTTA 5B0BA 1P9QC 2OSQA 5I42A 3MECB 1VDHA 2MY7A 3MAAB 1HNWF 2XTJP 3GIRA 2CQDA 4TYBA 3MR3A 1Q8KA 4XIUA 3RTVA 2FJWA 3HCXA 2R2TA 2PIIA 4LF4J 2HHSA 4C8LA 3MOJB 1BD6A 1N36F 2PGCA 2L41A 4DZ6A 5AXMA 4RW7A 1UWBB 2VG5A 1NSPA 3NBPB 4DQRA 4QIFA 1GQEA 2DO0A 1Q5VA 4B3OA 2KRBA 3W2WB 3GWCA 3IXQA 2GIFA 2RD5C 1E6VA 1GFWB 3GJSB 3PYDA 2VG7A 4D3GA 3KUHA 3PW7A 3THPA 4TY8B 4LVOP 5T7LA 4H4OA 2KFNA 4KQZA 2MPUA 1U45A 4OI1A 1TKTA 2KJWA 9ATCB 1BWVA 4A8SA 3QLHA 4ZIVA 2XLIA 4PZVA 1ZAWA 1S4EA 4LIRA 3HVAA 4JYAJ 3MFHA 2HGNA 2XHCA 4QIWD 1VLYA 2D9PA 4OV1A 2ZKTA 2XMAA 2H5JB 4OZ5A 2L9DA 2PN6A 4MFBB 2O01C 1N34F 2W9CA 3S1TA 3H8YA 3LH2S 4Q2LA 1K47A 2AU0A 2J7KA 3QNWB 3KJVB 1EKSA 4URGA 4WIQA 4NRUA 4RLEA 3UE2A 1NH7A 3UN5A 4F4YA 2MKSA 4GVLA 2HHXA 5J2QA 3HVWA 2HVDA 3FRYA 2C2DA 3PKMA 4M1KA 3CCSS 2XZWA 2BJDA 4L74A 1O0PA 3TZZA 2KG1A 3NGDA 1D3WA 3CC2S 1TMMA 1CS4A 4JI8J 3FQKA 4FS1A 3HSJA 3DLGA 3HHLA 5K14A 3OHBA 5J2NA 1FE4A 4DR7J 2HBYB 5HBMB 2YWHA 3C2PA 4NLRA 3OXLA 2FHOB 3CUNA 4ZP7A 2AW0A 1WI8A 2ZH6A 3M6UA 3G96A 1B64A 5KFLA 2XS5A 2GIRA 1YZ7A 3IAM9 5D8HB 3QZ8A 3Q8UA 1YRXA 4KHPJ 3CD0A 2NYHA 4N41A 1F2HA 5CYQB 4ZP9A 4C8NA 4LSLB 3M2VB 1FDNA 1RWPB 4ES3A 4TXSA 2U1AA 2MLZA 3AY0A 2DTJA 3VCDA 2BA9A 2BJ3A 3MURP 3IWLA 5KT4A 1LW0A 1HQUB 2UUAJ 1WNEA 2DY1A 4ELTA 1MN9A 5CA5A 3ZFVA 1D8ZA 5E3AA 4QZVB 3PVXA 3MCNA 2Z57B 3KK1B 3HZGA 4Y3CA 2OEMA 3OL9A 2AJ2A 3IA0A 4DV3J 4RW8A 4A8KA 4WWSA 2J9DE 3TQEA 1NLKL 2VPXB 1SJQA 3NAIA 1S4FA 5A6PA 1ITPA 5D3GB 2CYYA 1B99A 5L38A 1JXLA 3DNCA 3QMQA 4X4PA 1HKAA 2RHQB 2YQ0A 4MKAA 3ZNJ1 2F9DA 4DL2A 2DIUA 2W4DA 2K06A 4KY3A 5K8PA 1Y00A 4NYPA 2B4UA 3CVKA 2VFUA 4RW4B 4ZOSA 2MQ8A 1LEOA 2BOPA 4IFVA 4DCJB 2JHEA 1NM2A 3AOAA 2MZRA 1F0XA 2FY8A 1QAYA 1M1HA 4CT8A 3SQGA 3CCES 1OPZA 3TX0A 3D3BJ 3TRGA 1VIXA 5GADU 1J27A 3OFEA 4I64A 3TVZA 5BR8F 2WRMA 1LWCA 2WW4A 1S1UA 2J5AA 3PW4A 6FDRA 1CJTB 3EXYA 2K7JA 2DGTA 3N9UC 5HANA 1WOOA 1LFWA 1X9SA 3MEDA 3JAMU 3I82A 3BYPA 4WE1A 2BM0A 4A8WA 2IPOB 4C9DA 2QMWA 3ITHA 4DSKA 4HLBA 1T0TV 1TL1B 4HT7A 3PZPA 2YWFA 4ZVFA 1S9FA 1FWPA 5KFWA 3W2VB 4A47A 1WF1A 1FVSA 1KN6A 1P8GA 2RRAA 3QSIA 2C2NA 2BE7D 2JZ5A 1SJ3P 2J76E 4GRSA 5HK4A 2E1PA 4KGVB 3HHNB 2E29A 5AXNA 1BQNB 3EVOA 3IR7B 3BSOA 5KFEA 3CC7S 3AFGA 1DTQA 2Z4PA 2CADA 1W7WA 2GAGC 5FDLA 4ZMMA 2W25A 2ZC3A 2GHVC 2QA4G 2GGPA 1NHUA 2XYGB 1CVJA 2R7QA 1X9MA 1IR1A 4U7UK 1Q16B 2YKAA 4I7FB 3VAIA 2XNQA 2G2OA 4M5NA 3BR8A 1AXQA 3CB4A 3BSNA 3TJ9A 5BYQA 4P75A 3MI7X 5IXUA 1WELA 3DGPB 1VFJA 3Q8VA 4FDFA 1P1LA 1R31A 4ZCMA 4M5DA 3TZWA 3KG4A 1Q81T 5C42B 4JYAF 1S6QA 2DEIA 5B08A 2MGZB 5GMEA 3X1LB 5L1JA 2WTFA 4LFAF 1SKWA 3BBCA 2UUCJ 1XN9A 4J9VA 3CCVS 2YKQA 2CNOB 2PEHA 4I0WA 5A8KB 1VJQA 3AB4B 1NJYA 1UEVA 3OR2A 4M8LA 1RLCL 4ED5A 1N5YB 4LF6F 4ED1A 3QATA 3NNHA 2E7VA 3CSKA 3KHLA 3VQSA 3FRZA 1K1QA 3PNIA 5AJ3J 1HNXF 1R89A 1Y10A 4LF8F 2BANA 3HVTB 2DNHA 3MPYA 5A0YB 2I0XA 4DR7F 4H54A 2KVIA 3W8PA 1TMJA 2DKOB 2BE9B 5C7PA 2RT3A 4ZP6A 2PC6A 1NUEA 3FGVA 3VAKA 1RWNB 3UD5A 4QYZJ 4B9TA 3HULA 4ZPTR 4EFAC 4FF1A 1F60B 2FC8A 3C46A 2OTLS 5IV3A 5KFBA 5DDOC 1BQMA 1NKEA 3NLCA 1N32J 2XY5A 3CWJA 2ZE2B 1JKHA 3LGHA 2EKYA 1OYEA 3KLFB 2DK2A 2W01A 4CH0S 4H4MB 4DS5A 3EM1A 3W3SA 4JI3F 4CYUA 2YKNB 4WPAA 1NZAA 5CCMA 2R7OA 4P2FA 1U6ZA 2W2NP 1VBXA 5KFFA 3T1YJ 2WVCA 4ZVHA 4CNYA 3CJ0A 2BJ9A 4PUOB 1X31C 3CC4S 3W61A 3BQ0A 1VC5A 3RAMA 3VAMA 1E6VB 4HACB 4F8RA 2VG7B 2HQ3A 2A18A 1S97A 1YJ7A 1SQFA 3TNVA 3UCZP 1VK3A 3BO3A 4DV5J 4OYWA 4H4OB 4LUBA 2K2PA 3TAMA 2OMLA 3C14B 5C5JA 3I9V9 4UOGA 2BVZA 5KFQA 2GMJA 3SCJE 2J7WA 2ZH2A 3CCLS 1AUSL 2OP5A 4ICLA 4X62J 2P2CB 4I2QA 4A8QA 5M2RA 1KWMA 1GMWA 1F2GA 1SB6A 3PO4A 5H9EK 2V2ZA 2HZVA 4ER8A 1NB2A 3DC2A 2KDOA 5I3PA 5GMKa 5D4OA 2JL9A 3GFYA 5I4MA 2DXEA 4B9VA 2VFTA 5ETQA 2F1FA 4JI5F 3MEKA 2V68A 1JLAB 2OD4A 3HT0A 4F0MA 1RTIB 1U24A 3HZEA 2ZC4A 3VAGA 2XI3A 1C0UA 3MAQA 3DRXA 1F3FA 3NAHA 5F41A 4PG8A 5HMWA 1CS4B 1LWFB 4P72A 2DGOA 4CRJA 4MIAA 4USTA 2EFGA 4AD6A 5HVGA 2V4QA 1MSWD 3PJ9A 2G13A 3NGUA 1R6YA 1C0TB 3TARA 4RWWA 3V6HA 5JVGQ 4KJIA 4OZ0A 2UV8G 2OPPA 4K4XA 3KUEA 1Y7PA 2HQGA 4B3MF 3DRYA 1RYRA 5LOQA 4AT1B 4DSIA 3T6BA 3WC2A 2OSRA 3G86A 4JI6J 1NDCA 4P2XA 4NLUA 3CD7A 2BYCA 1YHQS 5CYJA 1U8WA 4IOAQ 2IM1A 2XS7A 4F4WA 2BJ8A 5K8NA 5MAOA 3CJTA 5I3UB 3G6ES 1S0VA 2UXBF 2BE2B 3PDNA 4NLXA 3T6JA 4F2RA 4OHZA 2FJEB 3AD8C 2DEJA 4K7QA 3JQKA 4RBTA 5G4DA 3DKDA 2YTCA 4GC7A 2IA6A 2DO4A 1NK8A 2MB0B 5J2MA 3L3CA 3NEKA 5E2QA 2B5JB 3SDEB 4A8XA 4JV0A 1H74A 1X7VA 1H73A 1SJ4P 4RX6A 1KLMB 1FFSB 6FD1A 5F0WA 1KFDA 3R5GA 2C3YA 3C66A 4P2MA 5KFDA 4DQIA 2PMWA 2G0CA 1VI7A 4DN0A 2FJXA 4M5GA 4LQ9A 4QWDA 1RYSA 1L3UA 3G82A 4CO5A 2M0GB 3AQPA 3EGNA 1KOOA 5B0EA 4Q44A 2RQ4A 3W62A 4ILLA 4K4YA 2AYGA 2ZOGA 4FXVA 1VQ8S 5HN0A 3MM8A 4DV4F 3KTQA 3R8YA 3KLIB 1D8YA 2JFKA 5AT1B 2VQEF 2JH3A 1XR7A 3KK2A 2I6WA 3V6DB 5BYRA 2Q1LA 2WBMA 1PYTA 3IMQJ 4PAAA 2EKNA 1C2PA 4O4GA 2NXEA 2AYMA 3PRVA 4ECYA 3TO8A 3WHIA 2HLUA 1S6PB 2EK1A 3TUIC 2JRSA 2XEXA 3CE8A 3O1LA 4KR0B 1U1OA 4UT4A 5F8NA 1Q5YA 1KHVA 4BDPA 1ZM2A 3HFVA 3QBCA 2I5JB 1N32F 1NB7A 2R8GA 1JJCB 1HMVA 1Y3JA 4Q43A 4MK9A 2X1FA 3U1LA 5KG4A 4XPEA 4LR7A 3EGZA 1X4EA 5HQLA 3TAPA 3OFGA 3JQJA 2JVRA 2GJIA 3LP2B 2BW7A 4QYRA 3UVJB 4DX6A 1JLEA 3M32A 4MKYA 3T1YF 3RR8A 3TUJC 2EG2A 1FJGJ 4OHWA 3C6UB 5CH7B 4PQUB 1U09A 2GC8A 3JTOA 5HL7Q 3EZOA 3TYTA 4AL5A 3MF5A 3DHXA 2V2VA 1REGX 2CQCA 2IBOA 1S9GA 5LXYA 1T02A 3IBWA 1WOSA 4K0KJ 2ZJPQ 1L3KA 2ZUAA 4H4KC 2N4CA 1YZ6A 4DR4F 4M5DB 1Y5NB 4EO6A 3BJYA 1KEKA 3IM9A 1XNQJ 3KMSA 2EK6A 3I4HX 3PW0A 1RWMB 2YNGB 2V8GA 4OJGA 3GIMA 2EPIA 1FNXH 2V94A 1S0OA 2XLKA 4NRTA 3LW5C 3CJ3A 4ECVA 3D66A 5IQQA 3EGVA 1YX2A 3ZTOA 2IIHA 1IXKA 3L7UA 1U2FA 4HHUA 2RDJA 2M2BA 2DBBA 1NK7A 1SKRA 1O5JA 1UMJA 3OR2B 4ECZA 3KJFB 3CCRS 1VC6A 4BHQA 2D9OA 2DHAA 3RAXA 4ECWA 2DR8A 1MLAA 4FF3A 1BC6A 4ZPDA 3M8QA 5DLGA 3J7YI 2WSCC 4LSNB 1C1CA 4IDKA 2XMTA 3N6MA 4ZVTB 4YDDB 5IV4A 1T3OA 3KHGA 1GAOA 3CT9A 3UFCX 1Y5LB 1UPMB 4PYDA 1XMOJ 1MW7A 3OTDA 3SCIE 3BPDA 2VA3A 3VALA 2P6SA 3D1OA 1NDPA 2EXUA 3DGVA 4JI2J 4B3SJ 3CJQA 4DX7A 2OTJS 1YRTA 2BACA 3HP6A 3UNGC 1PYOB 3FMWA 4X64F 5LT5A 1IM6A 4FYVB 3MMAA 3MEGA 1V5VA 4URSA 2VDIA 4LBPA 2RQCA 2V50A 4DFMA 1VOMA 2P8IA 2QSFA 3HT3A 3RW7A 5T41A 2RE1A 4KBIA 4RWXA 3MGJA 1VQNS 1QSLA 1MMLA 3MR7A 1QSSA 4DQQA 4EYIB 1F9HA 5LJ3Y 3NCRA 3OR1A 1XJWB 1Y11A 4JP8A 1AZSB 2ZOMA 4O3NA 3TAMB 1FF2A 3LAKA 1URNA 4PG4A 4DUYF 3GYGA 2CQIA 4J9QA 1RLDA 1SC6A 2W2QP 4ZHRA 1FCAA 1AT1B 3PYGA 4LBIA 1QJHA 1FI4A 1GXUA 2A3JA 5H9FJ 1S9EA 3GE9A 2B9YA 1V3RA 1WSVA 5H1SV 2IAJA 2B7CB 3DI6A 4C4WA 1YI2S 4QU6A 1O6XA 4QWAA 3TVYA 4IFYA 3DN9A 3L7OA 4NA2A 3KLHB 3RBDA 1CJKB 3CCWA 3N4WA 5LSOA 5FJ4A 2GJFA 1H98A 4IG0A 3W60A 3D0GE 1RQ0A 2AJFE 4KV8A 4IQXA 2QV6A 1RHMB 2N7YA 2FUG9 4DLGA 4KO0B 1ZZFA 3GFHA 1LKZA 2DPIA 2ZBCA 2CJBA 2ZBIA 3SIPB 3DMJB 3BN4A 4DL3A 4J7CA 5ETRA 5KG3A 2PFFB 2R3VA 1KOHA 1S0NA 3FC9A 4F4ZA 3T3FA 4CIOA 5AXLA 2GS8A 1SL1A 2VDHA 1Q8BA 1GXTA 3OXGA 3BBBA 2BJ7A 1UP1A 1B4SA 1S5ZA 3BH7B 4F3MA 1UVNA 2E1CA 4GKJJ 4N8OA 2VBWA 2FVPA 2YVSA 2Y0BB 2BKOA 2ZM6J 1FK9B 2VU5A 2NZCA 1VBZA 3BSCA 3ONQA 4ZDNA 2IA0A 2AD9A 1T05A 4OX8A 3SBMA 4FBTA 3MPDA 3GQCA 3S6EA 1SCJB 3HMJG 2LA6A 1ZTWA 1HI8A 2J8AA 2R7RA 2DRDA 2MKCA 5GAGI 2W9BB 4XPCA 4Q5VA 3AD7C 1EZZB 2K7KA 1TKZA 4OYBA 4NCGB 1VBYA 2KTQA 4IG3B 2FD2A 1RCXB 4IOBA 1QUPA 2CQ2A 4C8ZA 3ILLA 3N01A 5G0RB 1VHIA 2OI2A 4QJVA 1OQ6A 1Z2LA 3QJLA 2H3EB 2CJAA 2IMOA 2HHTA 2EBGA 3BM7A 2QX0A 3RBZA 1FVQA 2ZNZA 4JI4J 4MKVA 4LRBA 1TVRB 3HFKA 1Q78A 3GIKA 3F0NA 3KG1A 2QA1A 1N33F 2IC3A 2OAUA 2WK4A 2QMUB 4RUBA 2B0GA 2AEJA 4CTAA 3NXZA 3RUBL 4ELUA 1HI1A 2MTLA 4CO2A 2A10A 4OYAA 4O4GB 4XTTA 1HBMA 2KG0A 1RAHB 4IO1A 3U1MA 4DXLA 1LW2B 5A2QY 4ZVRB 5HP1B 3IS9A 4C2MA 3LA0A 2VL1A 3W8GA 4EBDA 1VQSA 1S76D 3D6FB 2QIFA 3N5BA 5GAEU 7FD1A 1N5VA 5L1LA 3I0RB 2ROGA 5KG5A 1MWZA 2E5HA 2IM0A 3OJSA 2OD6A 3CDEA 3FMBA 2AJ1A 2JFDA 3EMTA 3M1VA 2CPHA 3L4BC 3QIPA 1Q7LB 2HS4A 3GIIA 2RRNA 2G0IA 2HFUA 2FZCB 1NXIA 4I68A 4KGMA 1HWIA 3CJSA 4OLOA 2UU9J 1JLEB 3M32B 4IRCA 3A8KA 1IKXA 4WYLA 4OZJA 3MMCA 2QA4S 2EVZA 2PI4A 2XZDB 5DDQC 1FRHA 1FRIA 1FO1A 4M94A 1RTHB 4KTQA 2GHWA 3JXOA 2DY9A 1YBUA 4DR1F 4NLVA 2HZAA 1Q7YT 1OPIA 4NX9A 4F67A 2KO1A 4CLUA 1WKKA 4Q0BA 3TVKA 1YJVA 3MR6A 5BJRA 1CULB 2QZ8A 4R5PA 4BWMA 3IFEA 3CO0P 5ETVA 1IKYA 1I1GA 3ZTSA 3LGMA 1M1KT 2O1PA 4X66J 2A2CA 1DQ9A 1EB0A 3S01A 5DG8A 3DOKB 2E9RX 3TOQA 2CVIA 3GG0A 2DYAA 3LWLA 2UZAA 4EK2A 2KN4A 1SVDA 2RDDA 2W2MP 1NDLA 5J2PB 2HHQA 3AJ1A 2LEAA 2RF2A 3I32A 3G6XA 4MMOA 3ADAC 2KRRA 3UO0A 2KFYA 2DNOA 1X5TA 2CZ4A 3TW0A 1UVJA 3RRHA 2RU3A 3NOGA 3V2UC 3SFUA 1DFDA 1MROA 3NWRA 1KSPA 3M2RB 4X4UA 4P73A 1AYEA 4WYWA 3IR6B 2L9NA 4C11A 4QIGA 1E6YA 2ZWOA 3MPVA 2AQ4A 5L1KA 2D41A 1DQAA 3DLJA 1QTMA 2RKIA 3TANA 1DY3A 4OJ3A 4YB1P 1SKSA 2ZEJA 3QT6A 4HT5A 1U1PA 4RR5A 1RT1B 5D77A 5CZXA 2D3O1 3H5YA 1J5OA 2E5LJ 2Q6CA 5C2GA 1RWUA 2DCLA 3HSGA 2L48A 1HQEA 1JX4A 5EGYA 3IG1B 2MZQA 1TELA 3BF4A 4NYOA 4YY3J 1PBUA 1DAXA 1SPBP 2LXFA 4BC9A 2FB0A 1QAJA 2PMHA 4NMLA 3E8OA 2F40A 4EI2A 2FJVA 3DLEA 2HVZA 3GJTB 2NR0A 3DRSA 3BQ2A 3E01B 4RNFA 3CDBA 2VASA 2XHWA 5AE3A 1W2BR 2CPYA 1PILA 3C16B 1S7HA 4A46A 1LV5A 3PCOB 4DV7F 2ILYA 3P6YC 3JYTA 3NRBA 3MMBA 3W5ZA 4JV5F 5IWAF 3H90A 3H0PA 5DG7A 1VC0A 3ENWA 5A8RA 3EVMA 5A8WB 4NZ0A 5LSRA 2CPJA 1EAYC 1T9WA 2F5GA 2C3UA 4MIWA 1HR0F 1T9TA 3W9IA 2VA2A 4OYZA 2XYPB 2CZVC 2DNZA 5CYMA 1VQKS 3DDIA 2K1RB 1NSQA 1OJ4A 2DR6A 1RWVB 3O2IA 4TU7A 3BGRB 3OT9A 2J7UA 3QWPA 4CLKA 1T9XA 1FESA 3HLUA 2F7VA 2EI5A 2QL5B 3ZZ0A 1VBKA 1U2CA 1X4DA 2YY3A 2Q43A 1WG5A 2YNHA 2GAHC 1R0AA 3UDVA 4XK8C 1WHVA 3MM6A 3EX7B 2DH9A 1U1NA 3W5XA 1PG5B 2IJNA 1MWYA 2FIUA 3D1HA 2DGWA 3HHKA 4DV2J 2ZHAA 1L5UA 4ZCIA 2YNIB 1G6BA 2RUGA 4JI1J 2KB2A 4ED7A 3CJ5A 2F63A 2YNFB 3I5BA 3A8EA 2QFJA 2ZFHA 1PGZA 4DV0J 4C0HA 4CO0A 4J9LA 1UEUA 4RW9A 2FVQA 2YWKA 4YB6A 4LIWA 5J1EA 2M7SA 3F56A 2MSSA 3LGNA 2UVVA 2ALYB 5ETLA 1RHRB 4WP9A 2QL7B 3CNQP 4GO5X 4CLSA 4G1QA 4USWA 1QM9A 2AJQA 1RACB 1RT6A 3GJQB 1NJWA 3FEYB 1RTDA 2ACYA 2HHHF 4DR6J 1VISA 3I55S 1YIJS 4UUWA 1EIYB 5M2UA 1REVA 4TU8A 1O8BA 1TKXB 5L9XA 1U48A 4N47A 3NP5A 3CCUS 1SC1B 9RUBA 4TLQA 2KXFA 2HIYA 3NOCA 3Q0AA 1XEZA 2Z2ZA 5KG6A 2IRXA 4JBCA 2VBXA 1LXJA 1FJ7A 4X66F 2M8DB 3OL7A 1BLUA 2IC3B 3C8YA 4DWIA 3GU0A 4L76A 3V4IA 1P27B 2YH0A 1FTCA 1JXVA 4F26A 1HNVB 1TTHB 3POTB 2CDRB 5HATA 4KFBB 3SCKE 5IZHA 2XMJA 5RUBA 1YJ9S 4DSLA 1KNZA 3D0IE 3IRXB 1HNIB 1KONA 3IS9B 1LXNA 1HBUA 2CJQA 2NPFA 1X4CA 2AEFA 3ZNUA 3HX9A 2R8KA 2W7PA 1IBLJ 3DLLQ 1RT5B 5E0OA 3M8ZA 3QGGA 3TAQA 7AT1B 3M30B 3EZ5A 3H7HB 1RAOA 4DG1A 4Y28C 4DQSA 3T9ZA 3M8RA 3CTRA 1VQOS 1NCLA 1U8SA 2NSBA 4WIIA 3I31A 1DZ5A 3D54A 1U0SA 3P45B 5E3RA 3M1VB 2HWTA 4YQWA 1XR5A 3CDWA 3TQ1A 2HRUA 2ILZA 1JLQA 2J0SD 1EKRA 3JAMY 1RABB 3Q83A 2ZH3A 1SQEA 2BV3A 3NNCA 3PY8A 3GSIA 1B0VA 2GQ2A 3QAEA 3FZ2A 4I2PB 1AFIA 4YR3A 3PV8A 1RDRA 3MWBA 1UJ5A 4ELVA 4YEAA 2AZ3A 5B7WA 2EG1A 2W8LA 3AB2B 4Y6IA 2CQ1A 2JEJA 5DETA 4RUCA 2ZH1A 2B6AA 3R7SB 4ETXA 1RBLA 4MK8A 4ZCLA 2IYGA 1PJ6A 5H9EJ 3PYFA 4LF7F 2GVZA 3EVWA 1JNRB 2QG9B 2Z30B 3PX6A 2CJKA 2LKZA 2WVBA 3FEZA 3LP1A 1IKYB 1VQ4S 2HFOA 2MHNA 2Q66A 1JLGB 4DZDA 2IHR1 3IWNC 4RUHA 3VAHA 5KOWA 2F4VJ 3K5PA 3MEEA 2FLOA 4IYQA 1JWWA 1Y4ZB 1RK8A 4B9UA 4RJVA 2P9CA 2IMWP 1SIWB 3IAS9 5D6GA 2DNYA 1JLFB 4N8NA 2J0XA 4OLPA 4YDXA 1WG1A 3MZIA 2AEMA 4RUAA 1EP4A 5F8IA 1S1XA 3GV5B 3M9OB 4BWJA 2W4PA 1RB0A 3DDNA 3GCWP 1LWEB 3V6KA 4ZLPA 5F3ZA 3KKFA 1U25A 5C25A 1UPPA 3RAQA 2VICA 2ZDPA 2CVEA 1CC7A 2XSJA 1F1BB 3GLJA 4F2SA 1VIOA 1FFGB 3C6TB 1NK4A 5L39A 1TV6A 2BKPA 2R42A 1WJ9A 2OPQB 3CCJS 3AT1B 3AXKA 4ILMA 4U9RA 1F5CA 2AYEA 3R5JB 3CGIA 3NS7B 2GVDA 3O3LA 3PR5B 8ATCB 4KH1B 3P96A 4F50A 4JI1F 1VRQC 4C0OC 2ZUGA 4ZITA 2E5JA 1PJ7A 2B8QA 2CPIA 5HLFB 3MTJA 1HBOB 5C24A 2LFVA 3UR0A 4FBUA 2A6MA 5F8MA 3ZZPA 4LF9J 1KVJA 1IQZA 2EEYA 3UDEA 4PPZA 3FQLA 3ZZOA 4EGLA 2K3IA 3CMQA 2MQNA 2HQFA 2GNKA 3KLVA 4OHXA 3QO9A 2NYIA 4OIXA 2IDEA 4OX6A 1WD6A 2D1CA 2B43A 4P2SA 4PPDA 4CQ1A 3P4UB 1TUWA 3W9JA 5B0CA 4O44B 4ID5B 4IH5A 4Y2KA 2H54B 4DL0C 3OTCA 2DGSA 3VZIA 3IP0A 1TL7A 3DLKA 3NCQA 5IS2A 4X4SA 4HH1A 1WOPA 5IM0A 2MEWA 1IKWB 4DR2F 3GONA 3O6QA 3MMBB 4B3TF 2DCUB 3N5FA 5D4NA 3PW2A 2PO4A 2V4JB 4DPYA 2OPSB 1MU2B 3DRPB 3FFIB 3G8SA 4ANCA 2FHJD 2HQDA 5KFJA 2XQCA 1R7IA 1UCNA 2BABA 4HL9A 2DGXA 4JI0J 3D67A 1ZZNA 4WXOA 1NK0A 4PWDA 3M9NB 4F3OA 2XG8A 3EXCX 1U0HA 4C3LA 2QLWA 4OQJA 1WC3A 4DV6J 5LMUJ 2A6OA 4DLEA 4F4XA 5FIIA 3RR7A 2EFQA 3J7A1 2UUBF 4LREA 3LTOA 1RXOB 1XNRJ 1R0AB 4PRFA 1M5KC 2C2KB 3MM6B 3PEJA 2H51B 4C8MA 2EW9A 1IBLF 1RKIA 3C15B 5KFXA 1HW8A 3FSYA 4GC6A 1KQFB 1F6TA 2CJ9A 1XTZA 3U27A 2HNDA 4EU0A 4IO9Q 4ENOA 2AJ0A 1IN0A 1WC6A 4Y2IA 1TKDA 1N6QA 5LJ5Y 4ECSA 1LOUA 1YTYA 1WKLA 1C1BA 4CH1A 3JSBA 4QIEA 2I9SA 4USJC 1URRA 4WFXA 1R8HA 1XMBA 4TY9A 4OX9J 2M5YA 1I94F 1F9FA 3DOLB 1S57A 5CHCB 3C19A 2MYFA 2D3OR 1N0VC 1CEZA 2D74B 2B8PA 8RUCA 4DV1F 4G1QB 1APSA 1U26A 3UWTA 4V19X 3BDEA 4WK3A 2RNEA 3UDLA 1QE1A 3T5LA 4ZPAA 4HHHA 1HQ2A 4K5SA 3MXHP 4C98A 2G9OA 3B6BA 2PI5A 1CG2A 4MAKA 3I0SA 1J5EJ 3MM7A 1S77D 3MM5A 3R27A 2GA7A 2RRBA 1YSJA 4TYAA 3WX8A 2AX1A 4KB7A 4CCHA 4ECUA 1S6OA 1WC1A 4AE5A 4E2FB 1X4AA 1NJXA 3UD3P 4CP5A 1FKPB 3MM9B 3KLGA 3F73A 4WU3A 1A6LA 1EARA 1NEEA 2QFIA 1FX2A 2P6TA 2ASJA 5CCLA 3M8PA 3W66A 4G1IA 4J9NA 1VRTB 4O3SA 1AA1B 2GFFA 2I2YA 3NG8A 4FKYA 3GIJA 3V4IB 4OYIA 1YJNS 1QDUB 3VVTA 4DFKA 4K50A 4CDIA 2I38A 1V3ZA 4N56A 2XI2A 3QRPA 2Z58B 7FDRA 2RH3A 3ISNC 5L1IA 1PC5A 4X84A 2ZZNA 1VS3A 1JLBA 4HEA9 4K4UA 3LUYA 4YFUA 3DRRA 2RSQA 1UA1A 2HNYB 4I69A 3ZTPA 1U6FA 1RADB 3QT5A 2IM3A 1OY6A 4YB7A 2XULA 4J9SA 3IGVA 1SBRA 4LFCJ 4DFJA 3H20A 3NGRA 2FVSA 3K0JA 2HEKA 1RT2A 3T1HF 4OJHA 4LF5J 4R8UA 1S1VA 4OYPA 3K5MA 1R6VA 2R8HA 2CQPA 1EETB 3A8JA 1G3OA 2UXCF 3MCMA 3QGIA 1UA0A 2DR5A 2ZH9A 1WC4A 1YQHA 5ETNA 4DN9A 2UVUA 4USUA 2BDPA 3KOAA 1CQMA 2CG8A 4QOTA 1FHTA 1LWXA 3FCWA 5JXSA 2VBZA 3HJFA 3NCPA 4DU7A 3FBCA 1Q82T 4RBVA 2Z0GA 3EWGA 4B9MA 4CWBA 3A8IA 2V5HG 1X4BA 3R5BA 3BGOP 2XS2A 5KFUA 1S1WA 5D4PA 4ILRA 2R7UA 1HWKA 2ZWPA 3LP1B 3FKBA 2JNJA 4AQYJ 3W5YA 1ZYQA 3VF0B 4ZLJA 4GKKF 2OHDA 2WZ1A 3QWUA 1PKUA 2FVRA 4GVBA 4ANDA 1D0EA 2E5IA 2VONA 2V9KA 1RT3B 4ECTA 3MUVP 2GV1A 2DRBA 1N56A 4UW2A 2B3TB 4URQU 2N4DA 4F0KA 3WDOA 4UY85 2EFNA 4UOCA 4O0IA 1NO8A 4M5KA 2UXDJ 1FDDA 4A8MP 2BX6A 2AKWB 1VRUA 4WBFA 4I1TA 4LRAA 1PJ5A 1JLCA 1FWKA 1A9NB 4HDGA 1Q79A 4C48A 1XNRF 3B82A 4BLGA 2XSJB 4LFBF 4DSFA 3M2UA 5F8JA 1CJVB 4IRKA 3W9HA 3V81A 2DXFA 1TR0A 3FCHA 5EDWA 1QVGR 3RU0A 3KLEA 4DBQA 3D6MB 3DYAA 2LLZA 3NMAA 3CD6S 1L3SA 2CA9A 2D69A 3B8HA 4J9MA 3Q86A 2C2MB 1IQTA 5CD4H 1H2VZ 2CPEA 3G2XA 1FRLA 2VJUA 4J9UE 3PX0A 4MH8A 4DUZJ 4K8RA 3BSAA 4ZJOA 3IC1A 2DRAA 2NQPA 2PT0A 2O3DA 1VCTA 1VHFA 3FZBA 2E66A 4ED2A 2EWHA 4NEZA 2LYVA 2B9WA 2CPZA 3PHTA 1M5HA 1Q53A 3L95X 3CJKB 1HPZA 1VK8A 4O0NA 1H3DA 2CQHA 3ZZUA 2ZD1B 1LFPA 3W65A 1FKOA 3FSXA 3TA0A 1AB8A 3DM2A 2HKEA 4KKOA 3LP0B 3DLKB 2IRUA 1KS2A 1M0SA 1BQXA 1T9UA 5KOXA 4R0EA 2J0QD 4DUTA 4K59A 3AHPA 5IC6B 1WHWA 2EFOA 1XR6A 2KHDA 2HK2A 4QIVA 2Q79A 1HBNA 3LPYA 3QRRA 3PYEA 5E41A 2MQOA 3FCVA 5KFAA 1IBKJ 4EBCA 4U7CA 2ACMA 4NWBA 1GTEA 2WVFA 3IR5B 3OSNA 2YPZA 4DL7A 4NCBA 5KFPA 2WB4A 2KH9A 2GMLA 4USIA 1XWLA 3HI9A 3ISZA 4CZCA 3M4XA 3M9MB 1TL3B 3VQTA 4NPOA 3UD4P 3BDPA 1TP7A 2MHEA 1BGXT 4P10A 2W7AA 3ET6B 4C7QA 1RAEB 3D6TB 3NGKA 2FTRA 3ZC4A 2QT7A 4HTIA 3IWXA 1X0FA 1SUQA 2YH1A 3W64A 4IRDA 1RE1B 3PIPQ 2ROEA 3D4JA 2VG6A 2OGUA 1IWGA 3AAWB 2HRYA 4DEZA 3H40A 1K9MT 4RW6A 3BKTA 2WOMA 3BYRA 4LF4F 1XMQJ 2DITA 3OL6A 2YKMB 4CM2A 3J7YU 2HQCA 5K9FA 4MT1A 2NPIA 2C2OB 4ED4A 3QIDA 1NPKA 1U02A 2ZH7A 5DQHA 3DOMA 3CDUA 4B9NA 1Q4RA 2ZBPA 5IC4B 1FRJA 1B3TA 4J37A 2QRRA 1YGYA 2W9AA 3PIOQ 2HS3A 4NXNJ 4DPOA 3R1HA 1SV5B 3LQVA 3BN7A 3K8VA 1RTJA 1X4FA 4O3OA 3NS6A 4B9LA 4DFPA 1M5VC 1A7GE 1Q8IA 5HJYA 4I56A 2HMIB 3BQ1A 2CPDA 1IKVB 1SH3A 3MECA 1QSYA 2C2ZB 3MAAA 5F9NA 3I0SB 4C0BA 1FA0A 3OW2R 1EX8A 3I4PA 3MM5B 2HRTA 2JEIA 4YS2A 5LM7E 3I56S 3R7BB 1YJRA 1GK8A 2HBZB 2O66A 4IUFA 3CCMS 2BRLA 1KQSR 3EDRB 4ZVEA 2GIQA 4DPXA 5KFSA 5HROA 2W2OP 2PFDA 1VQ6S 4EUVA 1WI6A 4N5SA 2AGOA 4X2BA 1UWBA 3NBPA 2M52A 3M8PB 3GYXB 4K2XA 2YX7A 1KR4A 2HNZB 3HFZB 3W2WA 2E1RA 5DJBA 1BWEA 3HHLC 4QQBA 5KT3A 4FKXA 1U7LA 2MQPA 2XNRA 5DDPC 2HFNA 4JI8F 2FC9A 3U7JA 2EC2A 4TY8A 1IJFB 1G7CB 1NKCA 4NI2B 5IT9U 1ULRA 1X60A 3Q22A 4G65A 2GQCA 1Z2ZA 4ZVSB 3E3XA 1T94A 2AMCB 5I42B 5KTQA 5L8RC 2LA4A 1MNEA 4NL5A 5LMNJ 3HDSA 4KHPF 4EZ9A 4MFBA 2E1AA 2VHGA 3H25A 5HAOA 3BEGB 5BYSA 3SQOP 4Q2MA 1RWWB 2R2RA 3KJVA 3THVA 2FPHX 3FBEA 1HWLA 4F36A 4RW7B 2UUAF 2IDLA 4LBHA 1RT2B 1N5QA 4R8UB 4KIAA 2VG5B 1S1VB 3D2WA 1T3NA 3ELHA 4ZCKA 4B3OB 1U1QA 4ECQA 2Z2YB 2RHSB 3AOBA 1K44A 2HG4A 4K2JA 4QW9A 5EWEA 1G1XA 1M5PC 3DLHA 4DV3F 1WEZA 4N7TA 2KT5A 5KT7A 2LU2A 3LALA 1Y3KA 1SIZA 2JC0A 5T7LB 3U1NA 5E3QA 1PBAA 2MKHA 3D1QA 3M6WA 1RT4A 3P8BB 1HW9A 1TKTB 4EYHB 5EN1A 4PXBA 4FPIA 4WCEQ 1KRPA 4FF4A 1F5AA 3QLHB 3TR5A 3EICA 1WEYA 1Q1KA 2M3DA 2HPUA 2BRKA 1HNWJ 4OYMA 2BBEA 5CYQA 5KAKA 3OV7A 4LSLA 1HARA 5LSLA 3PXGa 2W9CB 3RB6A 1N36J 4X4QA 3KK3A 1AW0A 5GAGU 1KBRA 3FJ2A 4YR0A 5KFNA 1TFYA 1UVMA 3H59A 1HQUA 4QBUA 1GXLA 5J2QB 2XMKA 4YHHJ 4HKQA 4RPFA 1YITS 3KK1A 3L7PA 3PX4A 5CXTA 4PEOA 5KG7A 4WZQA 3KNAA 1U49A 4KT0C 3DLGB 3HHLB 5K14B 5J2NB 3CW2C 2FLNA 4V1Ak 5JVHQ 4HDHA 4YB5A 2J9DA 2ADCA 1U1RA 1OYDA 1TK8A 3GILA 4Y00A 2DGVA 4P71A 2ZOFA 4DOZA 2VC0A 2IY5B 2KT2A 2M88A 3VWSA 4RW4A 4EO8A 2QO3A 3LAMA 3LO3A 1FERA 4L6V3 4HI1A 1N34J 3AOCA 3GB0A 5D0EA 4BBYA 4XAKA 4DF8A 4WTYA 2Q6BA 2AIRB 1LW0B 1U47A 2H65B 2CIMA 1UKUA 1CJUA 4YR2A 2VZ9A 2QJ3A 3QFHA 5DZ6A 3THTA 4FYWB 5H9FK 4ZJLA 1FT8A 3GP9A 1OS5A 2BEFA 5E33A 1CJTA 4M5IA 1GT8A 3M6XA 3H2LA 5ETOA 4RW8B 1UL3A 4MYUA 4OZ2A 2BR0A 1T95A 3L09A 4BCAA 3N6LA 1HPZB 1WACA 5CAAA 1NMEB 4FP9A 3OJUA 3Q23A 4ZVUB 3TUZC 4OHYA 1TL1A 4CO3A 1FKOB 2X1AA 1NKBA 1L3VA 3W2VA 2FHMA 5DGAA 5EWGA 4DSJA 3RYLA 4IFVB 3ZZYA 1X9WA 2IM2A 4G3IA 3JSMA 3GR0A 4LT6A 3BREA 2UUCF 4WFNQ 3SQGB 1RA7A 2N82B 3R2DJ 1BQNA 2G2ZA 3OUYA 3SV3A 4U67Q 3I87A 3GR1A 5HI7A 1NU4A 3QAUA 2AP6A 3GJRB 5D15A 4L3NA 1RHKB 3ICLA 4F3QA 4F02A 1LWCB 2SXLA 1X4HA 1S1UB 2BJ1A 4ZVQB 4ZKAA 4UY8T 3H5UA 4I7FA 5AJ3F 3QJPA 1CBKA 5JJBA 4OHVA 3Q24A 4BS2A 2V67A 5KG2A 1P1TA 3MEDB 3DGPA 3GMGA 2LVWA 4WE1B 4LMZA 5JUMA 3LPEA 3ITHB 2KVQE 2XO6A 1RTZA 1Z4UA 2C28A 3GSDA 3LANA 4AXJA 4HI2A 5C42A 3PRDA 2WAQD 5AE1A 2Y9HA 2MGZA 3V4MA 1XQIA 2G1DA 2DNGA 2I8EA 2Y8YA 2KXNB 2CG4A
chains in the Genus database with same CATH topology
5BYQA 4RW6B 1RT7A 3MI7X 5IXUA 1WELA 3V4IA 1OSCA 4QW8A 1P27B 4I67A 1VFJA 2DHGA 1FTCA 1RT5A 2YH0A 2HAIA 3M30A 1OO0B 2VODA 4F26A 1HNVB 4FNHA 3POTB 3MD1A 1P1LA 1R31A 1ZAVA 4ZCMA 2HZCA 5I3QA 2N7CA 3MR5A 1FDAA 4KFBB 4AFFA 3SCKE 5IZHA 1DTQB 4M5DA 3KG4A 2LU1A 2LDIA 2XMJA 3IGNA 5FDLB 1XBWA 1YJ9S 2DNRA 4G1PA 1N5YA 3DXSX 4DSLA 1S10A 5FD1A 3OSPA 1Q81T 1KNZA 1LK5A 1KQGB 5EUHA 2GGPB 3D0IE 5C42B 4JYAF 3IRXB 4C3KA 1GX5A 1S6QA 2LECA 1HNIB 1KONA 3IS9B 5B08A 3K2YA 2MGZB 2D3UA 2F4VF 1LXNA 3X1LB 5L1JA 1FXLA 1HBUA 2WTFA 2W24A 4LFAF 2CJQA 2NPFA 1SKWA 2GW8A 2V8VA 2LEBA 1X4CA 2RMLA 5A0YA 1WWHA 4A8FA 5K8OA 3PFOA 3HX9A 1KFSA 4JV2A 1XN9A 2R8KA 3CCVS 2W7PA 3DLLQ 1RT5B 2POKA 4HVZA 5E0OA 2YKQA 3QGGA 2KXHA 3TAQA 3M30B 4LQ3A 3EZ5A 4DV5F 4EBEA 4WK1A 4ED8A 4WZMA 1SJRA 2PEHA 3AH6A 4Y28C 4I0WA 4DG1A 5A8KB 3AB4B 4DQSA 3AA9A 2EFVA 1NJYA 3T9ZA 1UEVA 3CTRA 3M8RA 1WTFA 3OR2A 3Q8RB 4M8LA 4MKBA 4PG6A 1S6UA 4I2PA 1VQOS 1U8SA 2PA3A 2NSBA 4WIIA 3I31A 1DZ5A 3D54A 4ED5A 1N5YB 3H4DA 1IJEB 1H6KX 4LF6F 4ED1A 5E3RA 3M1VB 2HWTA 5ADZA 4YQWA 3NNHA 1XR5A 3CDWA 3K7RA 4X62F 3CSKA 3KHLA 3VQSA 3TQ1A 1S6QB 3FRZA 1K1QA 2HRUA 2ZE2A 2ILZA 1JLQA 4KRWA 3PNIA 3JTNA 2J0SD 1HNXF 1R89A 1ZM9A 3KLFA 1F5BA 1HBUB 3JAMY 4LF8F 2BANA 2NUHA 3HVTB 2DNHA 5KFOA 3MPYA 3DFEA 4H4MA 5A0YB 1SXLA 1HI0P 2I0XA 2KKHA 4PCQA 4DR7F 4H54A 2KVIA 2ZH3A 1SQEA 2BV3A 4IQMA 3NNCA 1DTTB 3PY8A 2RT3A 4ZP6A 2YKNA 2PC6A 3FGVA 5HROB 3VAKA 4DG1B 5EX0A 1B0VA 2GQ2A 4QYZJ 1NRKA 1R3NA 2I1RA 4B9TA 4ZPTR 1CPZA 3KNGA 3QAEA 3FZ2A 2KYZA 4EFAC 4I2PB 4FF1A 1F60B 2FC8A 2FVCA 4HHJA 1DURA 1RJJA 3N0VA 4YR3A 3PV8A 1NJIT 2O67A 1RDRA 2OTLS 3C46A 5KFBA 2CKWA 3MWBA 1UJ5A 1JLGA 5EX3A 5DDOC 4ELVA 1BQMA 4YEAA 4XO0A 4WF9Q 5B7WA 2EG1A 3US5A 2W8LA 1NKEA 3AB2B 4RU2A 4PUOA 3NWGA 3NLCA 4ZS6A 4YHHF 4Y6IA 2CQ1A 2XY5A 3CWJA 2CQBA 3OFHA 2JEJA 2EC0A 1N54B 2ZE2B 5DETA 1JKHA 1JLQB 2B6AA 1B0PA 4RUCA 2ZH1A 2EKYA 4ETXA 4NLPA 5D78A 5B0AA 3KLFB 4K4ZA 5KFTA 2BANB 2DK2A 4MK8A 4NLYA 3BGFA 2DNQA 4ZCLA 2IYGA 4CH0S 2ZITA 3UPFA 1KTQA 4H4MB 5H9EJ 4DS5A 4LF7F 4Z37A 3HVRA 3Q8QB 1FJEB 3W3SA 1JNRB 3K5LA 3WBZA 2X1GA 2IJFA 4LF9F 4JI3F 2Y1IA 3OLBA 3PX6A 2YKNB 2EFPA 1JLFA 2CJKA 2DT9A 3DLBA 5B0GA 1NZAA 2LKZA 2B7BB 3FEZA 2ASLA 4W92B 3LP1A 5CCMA 2R7OA 3VAJA 1IKYB 1VQ4S 3CCZA 4QR0A 4CI0B 2FGCA 2HFOA 1U6ZA 1VBXA 5KFFA 2MHNA 3NMRA 2Q66A 1JLGB 1HHSA 3T19A 4TKTA 4JI6F 2BUNA 2IHR1 1BQMB 3EPGA 4ZVHA 4CNYA 3CJ0A 4RUHA 3VAHA 3IWNC 4PUOB 2WW8A 1TZ0A 1LWEA 5KT2A 5KOWA 3I6PA 3CC4S 3K5PA 3BQ0A 1JKHB 2GJ2A 2B6AB 4Y2CA 1VC5A 3RAMA 3VAMA 1E6VB 2FLOA 3MEEA 3N79A 4IYQA 1JWWA 3KWMA 4F8RA 1Y4ZB 2VG7B 3MCSA 1RK8A 2DGQA 3ENVA 4B9UA 2HQ3A 2A18A 2VBYA 2P9CA 1R8PA 4NLOA 1S97A 1J2VA 2IMWP 3CO9A 1OWXA 2NXUA 1HD1A 3TNVA 1SIWB 3UCZP 1H38A 2JDJA 1BY9A 1VK3A 3OVSA 3BO3A 3C6TA 3IAS9 3WX4A 4H4OB 1WG4A 5D6GA 2DIVA 3T5JA 2DNYA 4LUBA 2K2PA 3TAMA 2VKRA 4C8KA 1JLFB 2OMLA 4N8NA 2J0XA 5THWA 5C5JA 1K0VA 1XK8A 2OPQA 3OTEA 2R7WA 3K8WA 3GFZA 4OLPA 4YDXA 1WG1A 3I9V9 2R8IA 2OKQA 2BVZA 3B4MA 5KFQA 5EHHA 1JLAA 2GMJA 3MZIA 4AYBD 2OH2A 1GNKA 2J7WA 3SCJE 2ZH2A 4RUAA 1EP4A 3OLAA 3CCLS 3ZZTA 1N5SA 2MDAA 2OP5A 5F8IA 1RTIA 1S1XA 4KGKA 1LK7A 2Z2MA 4ICLA 2VV5A 3GV5B 2MSTA 3M9OB 4BWJA 2W4PA 3DDNA 4R0JA 1LWEB 4I2QA 3V6KA 1TL5A 4A8QA 2R7TA 3OTOF 4ZLPA 1IUJA 5F3ZA 1Q86T 3KKFA 5DQGA 1U25A 4DL5A 3MEEB 5M2RA 5C25A 1LWFA 2J6UA 3RB3A 3RAQA 5HLFA 2J6SA 1HBOA 4IKAA 3RBEA 1F2GA 2ZDPA 1SB6A 2CVEA 1CC7A 2XSJA 4JI0F 1CSJA 4QWBA 3NNAA 3PO4A 1NK9A 3WC0A 4DSEA 4F2SA 1C0TA 1VIOA 3CXCR 3H5XA 4MYTA 3K59A 4TQRA 3DC2A 2HQIA 2MQMA 3C6TB 1T03B 1RT4B 2F8HA 2KDOA 5I3PA 5GMKa 2VB6A 3R5AA 5D4OA 2FJDB 1NK4A 2JL9A 4DL6A 4NLDA 5L39A 2AWZA 3GFYA 1TV6A 5I4MA 4B9VA 5DGBA 3SSSA 3I96A 2VFTA 3H5SA 2OPQB 1SH0A 3CCJS 2F1FA 1IBMF 4JI5F 3MEKA 4DV6F 4ILMA 5LMUF 1JLAB 4U9RA 1VQLS 2OD4A 1F5CA 2ZNYA 2AYEA 3CGIA 1EP4B 3O3LA 3PR5B 2FLLA 1RTIB 1S1XB 1U24A 2E9ZA 4ICLB 3P96A 4K5RA 3HZEA 4HYKA 2ZC4A 1Y5IB 3VAGA 2XI3A 1C0UA 4F50A 2RU9A 2IYIA 4JI1F 4I2QB 2MXYA 2QYCA 3MAQA 2QE5A 3DRXA 4C0OC 2YQ3A 2ZUGA 3NAHA 1QUVA 4Q45A 2E1MC 2E5JA 4O44A 5F41A 4PG8A 2OJ3A 4ID5A 5HMWA 5C25B 1LWFB 4A8YA 1R43A 5I3UA 2CPIA 2DGOA 3MTJA 2Y0SD 1HBOB 4MIAA 5HLFB 2EFGA 5C24A 2W8KA 4TQSA 3RRGA 2V4QA 1MSWD 3KK3B 4I6YA 2G13A 1IKWA 1R6YA 1C0TB 3UR0A 4FBUA 5F8MA 3ZZPA 1GX6A 3TARA 1IQZA 4RWWA 2BE2A 3V6HA 1KVJA 5JVGQ 1KTVA 2PSZA 4PPZA 1JNZB 2XWYA 4KJIA 4OZ0A 3FQLA 2OPPA 2OLWA 2UV8G 4WXWA 4K4XA 2HYIB 1Y7PA 1YJWS 1Y9OA 3ZZOA 4EGLA 2K3IA 1TV6B 4GMKA 2V4JA 2MQNA 4B3MF 1FRXA 4Q7AA 1LQ9A 2B56A 4Y2MA 1N8RT 3DRYA 1JJ4A 2OPSA 4C8YA 1RYRA 1MU2A 2GNKA 3KLVA 3DRPA 4DSIA 1FRKA 4TLRA 4OHXA 3T6BA 3CMES 3WC2A 2OSRA 3G86A 2VFVA 3FFIA 1PSDA 1R8AA 3QO9A