4WCEQ

The crystal structure of the large ribosomal subunit of staphylococcus aureus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
89
structure length
89
Chain Sequence
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
total genus 13
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wceQ00
4BS2A 1WELA 3CCLS 1URNA 5CXTA 3CCRS 2KH9A 3ULHA 5DETA 2XS2A 3NMRA 3NS5A 1DZ5A 1FJ7A 3CMAS 2KXNB 2RRAA 1HA1A 3SMZA 2DITA 2O3DA 2SXLA 4PR6A 3CXCR 3VAHA 3P6YC 2A3JA 2RT3A 2ADCA 2CPZA 2MSSA 5GAHU 4CH0S 2CQ2A 3D2WA 2X1AA 5DDRC 2EK1A 4IUFA 1SJQA 1U1OA 1U1LA 2DHSA 4P6QA 2DNGA 4QQBA 2M88A 3L3CA 5JVHQ 1VC6A 2VODA 1DRZA 1VBZA 3R27A 2AD9A 1N52B 1N54B 1WF1A 2K8GA 1UAWA 3BEGB 2KU7A 2BZ2A 1M1KT 4UQTA 3V4MA 2E5JA 1YTYA 2CQ4A 2DNRA 2VOOA 3SXLA 5LXRA 2DGXA 4Z2XA 4OZ0A 1HL6A 3H2VE 2DB1A 2MGZB 1VQ9S 4LJMA 3UCUP 2MQOA 2LEAA 5JVGQ 1WHVA 1P27B 3TYTA 2J0QD 4LIRA 1WWHA 3MD3A 1M90T 2DH9A 3ZZZA 1OWXA 2HGMA 3CF5Q 5GAEU 1YJWS 2L08A 1VQ4S 2FC9A 3CCQS 2RS2A 2VONA 5DM7Q 1OPIA 2CPFA 1U1RA 1X5SA 3UD4P 2G1DA 2MPUA 1YI2S 2DHXA 1FO1A 5EN1A 3NS6A 2OJ3A 3G6ES 1OIAA 2Q79A 3S01A 2U1AA 1FT8A 1KOHA 2ERRA 4WIIA 2MZTA 3J7ZT 3UD3P 1WG4A 2MY8A 4IOCQ 1FXLA 2DNMA 2JVOA 2CPIA 1N88A 3CCMS 4QU7A 1BY9A 2D9OA 1VC5A 3THTA 3UWTA 2CJKA 5HL7Q 2HGLA 2XSFA 2U2FA 3CCUS 1R8PA 1NO8A 3MOJB 1X5PA 2CPXA 2VOPA 2DGOA 1R8HA 2XNRA 2DNYA 5D77A 2DGWA 1WI8A 1RKJA 2MZRA 1OO0B 5LJ3Y 1D8ZA 3CCES 5D78A 2MJUA 2D9PA 2DGTA 1L3KA 2MGZA 1VQ6S 2ZJPQ 4EGLA 2AYBA 2CPDA 1UP1A 3CTRA 2L9WA 4UY8T 1U6FA 3S8SA 2N7CA 3MDFA 2M8DB 2M8HA 2DISA 3CC2S 1YIJS 1NU4A 2DHGA 4WCEQ 2E5HA 2YH0A 5GADU 2CPJA 3FEXB 2FC8A 5DDPC 2QEXS 2L41A 3CUNA 1HD1A 2PE8A 2DNHA 2KRRA 5IFMA 2B0GA 1IQTA 1AUDA 2FY1A 1JMTA 1YITS 2CPEA 2LA4A 1ZH5A 2CQBA 3CC4S 4PKDB 2X1GA 2YH1A 4PRFA 2RQ4A 4M5DB 2J8AA 4ERDA 3MUMP 2MYFA 1PO6A 2DGUA 4F02A 3VAIA 2KRBA 1XN9A 2MQLA 2MZ1A 3TO8A 4TLQA 3UCGA 2PEHA 1KC8T 3CULA 3N9UC 3CD6S 1WF0A 2KHCA 2XB2D 1X4DA 2MKIA 3DLLQ 2MKSA 2K3KA 3IWNC 1U6BA 1WI6A 2KM8B 2E44A 3VAKA 4TU8A 2DO0A 3S7RA 3RW6A 1SJ4P 4TU9A 2MY7A 3I56S 2MHNA 1VBXA 2GO9A 1CVJA 1Q7YT 2CQPA 1VC0A 4C4WA 1WHWA 2MQQA 2AYMA 2M9KA 2UP1A 5ITHA 5IQQA 2CPHA 2N3OA 2LMIA 3VAJA 2ADBA 2I38A 2DIVA 4OZ1A 3PIOQ 2MZJA 3PIPQ 2EVZA 2G0CA 3Q2SC 1WHXA 3NNAA 2DH7A 2F3JA 3R1LA 2DO4A 2JRSA 3OW2R 4CQ1A 1Q81T 3CCJS 1FHTA 3R1HA 1VQMS 1U1QA 4Y00A 3U1MA 2FHOB 5GMKa 1A9NB 2X1BA 3US5A 2CQDA 3CC7S 3NNCA 2NZ4A 4J5OA 1YJ9S 4FXVA 2CQIA 4C0OC 2EK6A 3S6EA 5DDOC 5MLCV 3BO3A 2DIUA 2MXYA 1YHQS 1N8RT 3G4SS 5LSOA 3K0JA 3P49B 2RQCA 2DNKA 3VAFA 5FJ4A 2CPYA 1SJ3P 2JWNA 4TU7A 1X4GA 3LQVA 2RS8A 1FJEB 2CQCA 1G2EA 2DGVA 1U1KA 2DK2A 2KYXA 2J0SD 1X4AA 1M5OC 1NJIT 1K9MT 1UFWA 2JX2A 2F9DA 3MUTP 1H2UX 2RNEA 2DH8A 1U1MA 2KI2A 4YUDA 4WFNQ 2MKHA 3B4MA 5DM6Q 2X1FA 5LSLA 4A8XA 2ZJRQ 2QA4S 5H1SV 2M0GB 2LEBA 2MJNA 1SJRA 2AYGA 5GAGU 1H2VZ 1QVGR 3VF0B 1U2FA 2KG1A 2V94A 3Q2TC 1Q86T 1JJ2R 2LA6A 1X4HA 3SDEA 1VQ5S 5CYJA 5LXYA 2XNQA 2HGNA 2BOPA 2KFYA 4YB1P 2ZJQQ 1YWXA 1F9FA 1VQOS 3P3DA 1WEXA 2LECA 1Q82T 1YJNS 1O0PA 3EX7B 1K73T 2MQNA 3G8SA 4WKRA 2XS7A 4IO9Q 1WG1A 1X4BA 2DHAA 2MKJA 3BO2A 1QVFR 4IOAQ 1VBYA 2G4BA 2NLWA 2KM8C 1HD0A 3MUVP 5GVQA 1VQLS 4CIOA 1KQSR 1ZZFA 3MXHP 2LCWA 2YTCA 3HI9A 4ED5A 4ZKAA 2MQPA 1FJCA 3VALA 2D3OR 2HYIB 2RUGA 3RW7A 1H2TZ 2LQ5A 2WBRA 2OIHA 3UE2A 2DNQA 2DNLA 1K8AT 2CQ3A 2E5IA 2OTLS 1B7FA 1D9AA 1X4EA 2JVRA 2QFJA 2CQHA 3JB9k 1DBDA 4F26A 3EGNA 2M4MA 1VQ8S 5BJRA 3BS9A 1U1NA 3B4DA 2DNNA 5DDQC 4LMZA 1WHYA 1QM9A 2KG0A 2I2YA 1X4FA 2M52A 1VQKS 1S79A 1S72S 5HO4A 3J7YU 3DXBA 4QU6A 1UW4A 3SDEB 1VQPS 2LKZA 3VAMA 2KT5A 2MMYA 3TP2A 2LXUA 2YWKA 3MI7X 3FEYB 4Y0FA 3P5TL 4RU2A 5IM0A 1X5TA 2HZCA 2AYEA 2DNZA 3MURP 1FNXH 2XS5A 2KXFA 2MZQA 1X4CA 1JJHA 1A7GE 2MKKA 2KVIA 4W90B 1ZZNA 3G8TA 3MD1A 1SXLA 3UCZP 2DGQA 2LXIA 3G96A 2RRBA 3LPYA 4F25A 2DNPA 2LYVA 3BO4A 1WEYA 2RVJA 2CQGA 3EGZA 1VQNS 3U1LA 1KD1T 1WEZA 1P1TA 2OTJS 2M2BA 2MZSA 3CPWR 4W92B 2M70A 5CA5A 2CQ1A 1WF2A 4WFBQ 3VAGA 1U1PA 3CCVS 1W2BR 2MKCA 4CH1A 2MSTA 3NNHA 1RK8A 2N3LA 1DHMA 4WFAQ 3I55S 2OSRA 2GHPA 1KOOA 2HVZA 2KXHA 1M5PC 1M5KC 3G71S 1VQ7S 2RU3A 1WTBA 1PGZA 3ZZYA 4C7QA 5LJ5Y 3G9CA 4WF9Q 4V19X 3CMES 2MB0B 3IRWP 2F9JA 1X5OA 1H6KX 4FXWA 2MQMA 4U67Q 2KN4A 1X0FA 1M5VC 4QPTA 5IM0B 2N82B 3THPA 2J76E 2OSQA 4YOEA 1WG5A 1JJ4A 2DNOA 3HHNB 3CCSS 1SJFA 2FPHX 2CQ0A 2E5GA 2DGSA 2YKAA 3H2UB 2M7SA
chains in the Genus database with same CATH superfamily
1RAIB 1FKOA 3EUNA 3CCLS 4LFCJ 4JI6J 1RWXB 2E1CA 1NBEB 2OD4A 2CZ9A 1FJ7A 2Y9HA 2BQRA 2XY7A 4W4MA 4ANCA 3D2WA 3V6DA 3SSRA 3AT1B 1UA0A 4OQJA 2EK1A 2BA9A 2KL8A 2M88A 2UUTA 1VC6A 3BPSP 1DRZA 5FD1A 3HF5A 5ETTA 2DEIA 4KGVB 5D0GA 4DV5J 4BBYA 2DGXA 4Q8FA 3CJRA 2V8HA 3N0VA 2F7VA 3TZXA 1N5QA 4X66J 5ETMA 3ISNC 1TFYA 4GMKA 2L08A 4UZBA 1H74A 1TL3A 3CCQS 2VU5A 2Q6CA 2XSJA 3D6MB 2CFXA 3DI6B 5F9NA 1YZ7A 5DM7Q 3VVTA 1X5SA 2G1DA 4HR2A 4LF1A 2QO3A 5LL6d 2ROEA 3N5BA 4OX7A 1GT8A 3L4BC 3HP6A 1BY9A 4QBUA 3GJTB 4I4BA 3T1YF 1R8HA 2QZ8A 3HX9A 3I0RB 3C3LA 4V1Ak 2DGWA 2AMCB 3JYTA 1NB7A 5HVGA 2B5JB 3VR1A 4GVBB 3D4JA 2VFSA 3MAQA 2B9EA 1FE4A 1YK9A 1R43A 4ZLLA 3JSBA 2CPJA 5GADU 3PACA 2FZGB 4OX9J 3ZFVA 6FD1A 4A8SA 2AGPA 3BSCA 3JSMB 4AQYJ 4O44B 4LF2A 2QMUB 3A8EA 3EPIA 2KKHA 2ZHOA 2V34A 4JP8A 1NK7A 1DTTB 4IQMA 1WF0A 2XB2D 4J37A 3D9BA 3MECB 4XO0A 1U6BA 3LP1B 4TU9A 3BH7B 1HI8A 4HVZA 1VC0A 2XQCA 4EBEA 3CDEA 4RWWA 3UN2A 5ITHA 3IC1A 5F8GA 4H4OB 3RB6A 4ZOSA 2Y1LB 4HHHA 4JI4F 4W98A 1LEOA 4USMA 4KKOB 3LPEA 2BRKA 4F2SA 3R5CA 1F2HA 4QIWD 4B9NA 3MAAB 1LWEB 5FJ4A 3WC0A 2OPRB 2ASLA 3R2DJ 5KT5A 4I67A 4WU3A 4WWSA 2VQFJ 3BSAA 3CJ2A 4DG1A 4LF6J 2AEJA 3SCLE 1MMDA 1OQ3A 1T05B 1RT4A 2WVBA 2XZTB 2RH3A 2EI5A 1YBUA 2J7UA 3OFHA 2V50A 1J5OB 4DCJB 4F4ZA 3MTJA 2W9BB 1CJTA 9RUBA 4YB1P 3W66A 4UUWA 3UR0A 2EKYA 2C2DA 4NCGA 4LFCF 1BD6A 4L76A 2LCWA 2QJ3A 3ILLA 1HPZA 4F4XA 2LXFA 2V2QA 3UE2A 3M8QA 3C19A 1UZHA 4NLGA 1K8AT 2RD5C 1Y5LB 1TQLA 2QFJA 2CQHA 3NWRA 1EKRA 1C4AA 3EGNA 1CJKB 2W7PA 2HQDA 3M32A 2E1PA 4DSIA 4IRKA 1GMWD 3OFGA 2FHKA 1S79A 4DV5F 1D9FA 2BXJA 3TA1A 2CG8A 4NXMJ 1IN0A 1RT2A 4X66F 3MURP 2XS5A 1HBMB 4DFJA 2DCUB 4A47A 4C97A 4KGKA 2ZH4A 3QJPA 4KYZA 3PYGA 5CA5A 2V67A 4TY8A 5CYMB 2PO4A 4MIBA 3Q0AA 1DHMA 4CLYA 3AA8A 1IBLJ 1IKWB 4KGXB 2LLZA 5IWAF 2IC3A 1MROA 3W9HA 4ZLPA 1XMOJ 2ZOMA 3C46A 3L7PA 3X3UA 1GMUA 4RW4A 2W8LA 2H9ZA 3DGPB 1XERA 2XMTA 3FMWA 1NJXA 4TQRA 3EVOA 3UNGC 3M2RB 1S1XB 3OTCA 2HIQA 1YJRA 1T0TV 3ENWA 1URNA 2B6AA 4WFXA 3M9MB 2EC0A 3ULHA 5ETOA 5RUBA 3HFZB 4PPZA 5HLFB 4B9VA 4ZA1A 2M3DA 2K7JA 3FVYA 5LMNF 3VAHA 4HH1A 5HQ8A 1ITPA 3I6PA 4AQYF 1BXNA 4Z37A 4C9DA 3RBEA 4L3NA 2XEXA 3GV8B 2QE5A 1RXOB 1VBZA 4NLPA 3FEZA 4LBPA 1NCLA 3PHTA 1HWLA 1IKXA 4WP9A 2D74B 2HBQB 4CDIA 1TAUA 2R2RA 2KB2A 4Q44A 4J9OA 4ECUA 1VIXA 3AOAA 3H20A 1VQ9S 2VG5B 4K50A 4LIRA 2QSFA 1OWXA 2EFOA 3BDPA 3MPDA 4OZ3A 1T3OA 2IRYA 4Q43A 4WIIA 2P9GA 1SC6A 3UD3P 1OSCA 5U47A 4ZJOA 1UA1A 2CPIA 3HHLC 1SIWB 2Q1LA 5HL7Q 5D0EA 2VQFF 3BYRA 1WKJA 4OHZA 4LF6F 1FRMA 3PW4A 3WHIA 4UY85 3H4DA 2OPQB 4RW6A 2FVPA 1UPMB 5KFMA 4K0KF 3DHWC 4RUCA 5E33A 4MFBA 1S6UA 3HM9A 1FXDA 3NS7B 1C0UB 1S1TB 4M63A 4KR0B 4NI2B 3BQ0A 1XTZA 2WOMB 1BQMA 1IQTA 3MM8B 1UEKA 2J9DA 3P96A 3DYAA 5E0OA 3KXDA 4PKDB 3Q83A 4ZVQB 4D3HA 1F3VA 2DBBA 4M5DB 2J8AA 4ERDA 2HQIA 3VVUA 2C2MB 1UFKA 1VI7A 2OFHX 4ED6A 2BJEA 3SBMA 1RT1B 3TO8A 1AW0A 1UEVA 2PEHA 3OR1A 1RT7B 1RHQB 2K3KA 5KTQA 3C14B 5CH7B 3IM9A 2W9AA 2C3UA 2HMIB 2E7XA 4CNYA 2ADBA 1NPRA 2VG7A 4TY9A 3L09A 4I1TA 4ES3A 4C48A 2NYHA 4NXMF 1PCAA 4Y34A 3T3FA 4LSNB 1HBUA 3QSIA 4CYUB 2ZC4A 3BSNA 2CPYA 1P8GA 2W7OA 1CS4A 4F3QA 1LW0A 2OELA 2XMUA 4U7CA 2PT0A 3HHDA 1RBAA 1FVQA 2AHOB 1A6LA 3SYZA 2X1FA 3HD2A 4DCPB 2CJ9A 1IBLF 4ECZA 3RYLA 5EGYA 1EHWA 4CLUA 3TWZA 3DMJB 1H2VZ 1J5EJ 2VA3A 4KFBA 1XMOF 1NK9A 4DSEA 1DQ9A 3CIMA 4IO9Q 4HL9A 3SFGA 4IRCA 1S4EA 3MM6A 1ZTWA 3HSGA 3NL0A 2VJUA 1HBNA 3DLBA 4K4SA 3RW7A 3TR5A 5ETKA 4AE5A 2HPUA 4Q8EA 2GJIA 2NREA 1D9AA 4EBDA 1NDCA 2IJFA 1VQ8S 4ZIVA 2CG4A 2ZHAA 4J9KA 1JXLA 4TN2A 1QM9A 4DX5A 3PW2A 2EFNA 3B82A 5L1KA 1T9YA 3I0SA 3I5AA 4OJ1A 4ZPCA 2XLJA 4I2PB 4PXEA 2YWKA 4LFAJ 4N76A 3E01B 1HI1A 1U8SA 2HVEA 1UETA 3W5ZA 4PZVA 2FJEB 1T3NA 5KFCA 4A8YA 3EM1A 4OLPA 4PQAA 1JLBB 3LPYA 4CLTA 2RVJA 3I9V9 2BJ8A 3MAHA 3WDOA 2Q6BA 5KFAA 4RNOA 4M95A 1NAQA 4WFBQ 2VD3A 4L75A 3QGPA 2H5JB 2C3MA 2WZ1A 3R7SB 2HVZA 3CJ0A 5EWGA 1M5KC 3M9NB 4NCAA 4ILLA 2BANB 3W8PA 3PRDA 3BGFA 3V6KA 1RT6A 4F67A 4TQSA 1RISA 1WG5A 2DGSA 1LFWA 2HHHJ 3FSIA 5J1NA 1CG2A 3GJQB 1OMSA 1S6PA 1FXRA 1RTJB 3EVMA 2CJBA 4F4KA 3IA0A 5GADI 1DZ5A 3CMAS 3SV4A 3VZHA 2AX0A 2W2QP 1WUUA 4NCBA 3IP0A 3J81j 1C1BA 1UW9A 3GFHA 1UTAA 2CQ4A 3FCWA 2VOOA 3SXLA 4Z2XA 3F56A 3H2VE 4O3SA 3GJSB 2A6MA 3MFIA 3DM2A 3MD3A 1F3FA 5GMDA 2J9CA 1M90T 3CIZA 3KTQA 5G4DA 1S1VA 4K7QA 2GGPA 3CJSA 4M5GA 2AV5A 4DI6A 1DY3A 1TK8A 3R8YA 1OIAA 3P45B 4TYAA 3CDAA 4QWEA 1U45A 5HSPA 1UKUA 3D6TB 1JLEA 3ENVA 2FLOA 2HZAA 3ZTSA 3T5LA 3PJ9A 4FN5A 3MR3A 2D3O1 4OZLA 5D77A 2YPYA 4AD6A 1RKJA 2Y1JA 2DPIA 4NXNJ 4EGLA 2W9CB 3MDFA 3IRXA 2DISA 1YIJS 4EYHB 2FC8A 3I5CA 3T9NA 2ZVSA 3R5GA 1R3NA 3PRBA 1PJ6A 5HJXA 3LAKA 3DNCA 1EIYB 2WSCC 1U8WA 2PN6A 2MZ1A 1NHKL 2ASDA 1UJ5A 2RKIA 2HWIA 3VAKA 3SZ2A 3G87A 1TV6B 1HNZF 2HSEB 2RJZA 3NBPA 5KFSA 1RDRA 2A2DA 4TNOA 2V8DA 2MLYA 3CWJA 1KQKA 4OZ1A 3J81U 4NLTA 2Y0BB 2G0CA 1G7CB 1JWWA 1Q5YA 3AOBA 4ED4A 4KJIA 4LFAF 2JFKA 3KHRA 4OX6A 2K1RA 2XYHB 4ECYA 4Y00A 3A3NB 1Z2LA 2F8HA 2K2PA 2X1BA 3J7Z5 2P5VA 1EJ7L 1YJ9S 4OV1A 3HCXA 2VQEJ 3C16A 2DXDA 3BQ1A 4J9NA 3DRSA 4I7FB 2ZE2A 4ZPBA 3ZZRA 4KE5A 2W4DA 2PMHA 3IBWA 2HLUA 2VKRA 1QTNB 1IQZA 4YUDA 3QT7A 2FVRA 1RAFB 1W26A 4URSA 2LEBA 2P9CA 4ES2A 3CGIA 4Q0BA 5HBMA 3AJ1A 4KH0B 3GFZA 3GFXA 2E7VA 3R5BA 3SDEA 2F63A 2HGNA 2V0NA 1YWXA 1WEXA 4XDCA 2HK2A 3T6JA 3T6BA 1H0HB 2CNLB 2J6SA 3OR2B 4QW9A 2WBRA 5K9FA 1RT3A 1U0HB 1W25A 2JJ4D 4LSLB 1VOMA 3PJXA 2VFUA 1D09B 5IT9Y 3GIJA 3LF0A 2M4MA 3O44A 3SFUA 3K57A 2ATLA 4JI1J 1VQPS 2KT5A 1S0NA 1CJUB 2VBZA 2BJ1A 4FDFA 2KXFA 3T5KA 2FHJD 4KV8B 5F8LA 2LXIA 2YKOA 4LBIA 2DNPA 1FKPA 3TEGA 1S6QB 2HAFA 2DR8A 4RUBA 1Q7LB 2O67A 1PAUB 3TW0A 3KDOA 4CH1A 2HQCA 4KRWA 4DR6J 3OUYA 1GTEA 1C4CA 2E9RX 3BGRA 4ZPWR 3CMES 2Q66A 5HVFA 2OLWA 1RAHB 1BMQB 4TYBA 5KFXA 3MFHA 3PM9A 5HMWA 3ETMA 1WELA 4JI5J 1FF2A 2CA9A 2KH9A 4OIXA 4ZMMA 4UOGA 1E6VB 3I4PA 3M6UA 5A2QU 3HVTA 1SQFA 4LIWA 4Y2AA 4FYVB 2DPJA 4IH7A 1SJQA 4AUKA 3R27A 1N54B 5K14B 1QTMA 1TELA 3BEGB 3D0IE 5G0RB 3QZ8A 4NZ6A 1YVFA 5D8HB 2H4YB 1JLCB 3THVA 1R8AA 2MGZB 2BKNA 1F6TA 1W2IA 3QIPB 2MQOA 4AL7A 3QFWA 4U95A 4WP3A 3GTYX 3J80Y 2CJAA 1EX8A 3ITHA 2OPSA 2FC9A 4UOCA 4X65F 3UD4P 5EN1A 3NS6A 1ULRA 2OEKA 5E3RA 2IAJA 1FT8A 1QE1A 1KOHA 2FQQB 3K5LA 5DS7A 2VG6B 2VQEF 3KHLA 5C42B 2MZTA 4ZVSB 2OI2A 1L3VA 4JV2A 1VYAA 3MEEB 2BE2A 3MR5A 2DGOA 4FYDA 1ROFA 1KLMA 2D3UA 5JUMA 1Z4UA 1TL1A 2RUSA 1XJWB 2MLXA 5HQLA 1OO0B 3A4TA 3BR8A 4LF8J 4IDKA 2D9PA 3DU6A 4ZP9A 3G6XA 2X51A 3O6QA 5IOLA 4UT4A 3CC2S 2ZOFA 1YJTA 2B4VA 3CUNA 4PWDA 1YRTA 5L1LA 1T03B 5KFYA 2AJ0A 4ZP7A 4ANEA 1RBLA 2B51A 2CUYA 2X1GA 3FRYA 4CCHA 3FCVA 1NK0A 1WJ9A 2F65A 2I5JB 2MYFA 3EDRB 1TUGB 1XN9A 3ZTRA 3FMBA 4HTJA 2A10A 3Q8RB 1Y3JA 4IQXA 1OPZA 1V3ZA 5DZ7A 2YWHA 1Y00A 2RILA 1SJ4P 3LP2A 3I56S 4LR9A 1CVJA 1PYSB 1IKYA 4M5KA 4I64A 3V5RA 1WACA 3OLAA 2I38A 5ETQA 4AXIA 1EQMA 4H4KC 3M2VA 2MZJA 2EVZA 2ZFHA 2FVQA 1Q53A 3HHEA 4IYQA 1FHTA 2GO8A 4NLDA 3NNCA 4YP3A 3M4XA 4K4YA 3S6EA 2QLJB 3H0PA 1U2RA 3OL8A 2V6AA 1Q8LA 2QFIA 3KLHA 2IVYA 1XNQF 3QIDA 4XPCA 3LANA 2PSZA 4MYTA 4HACA 4KB7A 1XBWA 2VHGA 1F0XA 2PIIA 4DX7A 3EVWA 3I32A 1SJRA 4Y2CA 2QTWA 2UV8G 1QVGR 1M0SA 1J2VA 5DLGA 4FBUA 2WVFA 2Z57B 1FNMA 2PEBA 1R0CB 5J1EA 5I3QA 2VPZB 2LECA 1Q82T 4B3MJ 4FF2A 4HKQA 5IQ6A 1AZSB 1QUVA 2QL7B 2V8PA 3QJLA 4NA2A 2G4BA 3WX8A 4JI5F 4OZ2A 1VIOA 2E5LJ 3VALA 2HYIB 1S9GB 3C66A 2FJDB 2ABYA 2W2PP 5L1JA 4U7UD 1UVJA 3TVZA 5JMNA 4C98A 3M8PA 1H38A 5CD4H 1L3TA 2M52A 1VRTA 2GVZA 3B6BA 1I51B 1O6XA 5CYQB 4ELTA 3VAMA 3N79A 4RO0A 1S59A 4OLOA 1JK9B 3VQSA 2R8JA 5M2RA 2JEFA 2YKQA 2KVIA 4IFVA 1N4LA 4ETZA 3UCZP 3G96A 5AXNA 1HBOB 2WVEA 1OYDA 1MWQA 1O8BA 5D3GB 4G1PA 4LF9F 3CPWR 3D0GE 4C8OA 2OMOA 3OTDA 3K58A 4XK8C 3L7OA 1NB2A 2QLWA 3I55S 1VK3A 2HAIA 2LQ8A 3IWXA 3GONA 2C22A 5A8KA 1U47A 1B0VA 1AA1B 1T95A 4P2XA 3WQPA 1LW2A 2MHEA 4PUOB 1H6KX 3I9ZA 5FLXU 2Z8QA 4LF8F 4GC6A 2N82B 4O4GA 1TL7B 2HURA 1RAJA 1HYSB 4NLVA 2VFVA 4FBTA 2UV8A 2ZEJA 4DXLA 4ALZA 3K89A 1KHVA 4ED0A 5B08A 4IFYA 3L7UA 2QYGA 3NMRA 2HHVA 1EP4A 1NJWA 3MF5A 4PR6A 2W1BA 4K59A 2W24A 4FXDA 1JLFA 4NPOA 2VJVA 2OHDA 3LOUA 1U1LA 1LWCB 1RACB 1PSDA 3HVWA 1RU2A 5HQMA 3OLBA 1S4FA 4GO7X 4LT6A 5DQHA 4C11A 4DS4A 3HHLA 1FWLA 4DL6A 3C6TA 2BJDA 2J0QD 4YMEA 3MPYA 4PG6A 4WXWA 4FVMA 4O23A 1VR6A 2OAUA 4HT7A 1TVRA 4RBVA 5HROA 3G6ES 3IXQA 2Z4PA 1AYEA 3ZTQA 3J7ZT 3OSPA 2MY8A 4DV1J 2DNMA 1HWJA 4ECVA 3D67A 3UWTA 3VGVA 3X1LB 1PBUA 1R8PA 1BE4A 2FIUA 3GV5B 4JI3J 1U0SA 4OMFG 2ILZA 3R2CJ 2FJWA 3CMQA 4X64F 4CLSA 4QIFA 4DUZJ 1GFWB 4QIEA 2YNHB 5HMZA 4B3OB 4IH6A 1T11A 1TU0B 3V81B 3FEXB 1RT5B 3DI6A 1PJ5A 2EFPA 3MMBA 4B3MF 1NPPA 1YITS 2E9TA 2XTJP 4HI2A 5E2QA 3E3XA 2E5LF 3VAIA 5B7WA 1NSPA 3T19A 3HVAA 1Q79A 1XNRJ 3DLLQ 2XGPA 4NLWA 4BWJA 1KNZA 2KM8B 3EE3A 4IO1A 4C4WA 1Q7YT 4M5HA 3TUPA 1WHWA 3DRRB 4WP8A 3T1HF 4B3TJ 1MG7A 2B5JA 1SKRA 4KC5A 1VJQA 3LH2S 2HQFA 2FLLA 3M8WA 1B0TA 2FZCB 2D41A 2W25A 4CQ1A 3CCJS 3LAMA 1U1QA 2OKQA 1G1XA 5E3CA 2Z58B 1SUQB 3ZC4A 3JSMA 3HD1A 4O44A 1IKVB 1VQYA 3RBXA 4XAKA 2AF6A 2HFZA 4B08A 3PYFA 3FC9A 3MECA 1U1MA 3LP1A 1TR0A 2AZ3A 4USTA 2R8KA 4EK2A 1P9QC 5DM6Q 4KIAA 3OSNA 2FUG9 5LSLA 2GIFA 2FGCA 1S49A 4EYIB 5H1SV 1WKKA 5KT6A 5D0RA 4H4OA 1MU2B 4A48A 3PEJA 3Q2TC 4M1KA 2GX8A 2GMJA 4LRFA 3KYLA 2LA6A 1FD8A 4DHVA 3W7BA 4ICLB 2FDNA 4LFBJ 4KKOA 2FTRA 1VBYA 1S7HA 1HD0A 3GR1A 1YBAA 1FESA 1LWEA 4U7UK 2OPRA 5C25A 5AXLA 2OTLS 3KJVB 2IM2A 4RW9B 3IM8A 4LR7A 4X4NA 4OV6A 3LP0B 1TK5A 4X4QA 3IO1A 1T05A 3FBCA 1N32F 2Z2YB 4F7VA 2O66A 3KK2B 1S72S 3AJ2A 1QD1A 4QU6A 3HK2A 1REGX 1J5OA 3P5BP 2LKZA 2CDQA 2G13A 4DR1J 2W9BA 2V2KA 4Y0FA 1M1HA 2YWFA 3A8IA 4TKTA 2ZOGA 3SSQA 1YKWA 1V9OA 3F0NA 4A46A 4N41A 4DUTA 2OTJS 1OQ6A 3DN9A 4M5NA 3TX0A 1KVIA 2M70A 3AD9C 1U1PA 2XMAA 3C15B 4DV1F 3POTA 2QSWA 1WTBA 3ZO7A 3AFGA 4V19X 1VS3A 2F4VF 4DV4J 4DUZF 4AFFA 5IM0B 3D66A 1MW7A 1T94A 1SL2A 3HHNB 4BWMA 1SJFA 5HP1A 1YLXA 1DTQA 2J0WA 4OYIA 1PG5B 5C24B 1HBMA 2DHHA 4GRSA 3BGUA 1QLNA 2W4CA 3PYEA 1FRLA 3P6YC 4OZ5A 1ZBTA 1VJWA 2R7TA 3LWLA 2EFGA 1U1OA 5CYMA 1R6VA 1FEEA 3QQCD 4ECXA 2AD9A 3GSDA 3MM9B 1EB0A 3UDLA 4ZLNA 1XNRF 3GCXP 1NH7A 2E5JA 3BREA 2R7XA 1C1CB 3UPFA 4OZ0A 4K4WA 2DB1A 1RWPB 4B3TF 1WHVA 2YNIB 3LA0A 1FKOB 3M2RA 2NQPA 1QY7A 2IPOB 5KFUA 3CJ4A 2VONA 2ROPA 3H7HB 1YI2S 2DHXA 1ZAWA 2OJ3A 5HLFA 1BQNB 4F4AA 3Q8YA 1B0PA 3V6DB 3BN7A 3GR0A 5BYSA 5F0WA 1RGVA 2HNYB 3R97A 3CCMS 1VC5A 3BV8A 4DL4A 3R7BB 2XSFA 1N5SA 1SQGA 5F8NA 4DEZA 3EJMA 2DR5A 1GEHA 2W2MP 1S5ZA 5KG0A 1UCNA 1S76D 4X84A 2J9EA 5B0BA 2FJBB 2FLPA 4C3KA 1UP1A 3OXFA 4MT1A 4UOFA 3M30B 4AT1B 3KLIA 4R8UB 5F3TA 2JDJA 2QEXS 2KZZA 2DY9A 4WFZA 2B0GA 1N34J 4FVCA 4RLEA 1FKAF 2R9LA 8AT1B 2C2RA 4IG0A 3QRPA 3NGSA 1ICEB 1KC8T 3TVKA 3MEGB 3PFOA 3D68A 3HSJA 3QJJA 1FFGB 5KG4A 1Q95G 4K4XA 2DO0A 3JQJA 3JYTB 3C2PA 4NOHA 3NOCA 4NASA 4JBCA 7AT1B 5E41A 3FGVA 1X9MA 3PIOQ 1HFEL 3N6NA 4R5PB 2BYCA 4DR1F 1C0UA 4NI2A 3ET6B 3U1MA 2WOMA 3US5A 2J5AA 1S97A 2C3PA 3MM8A 5J2QB 3R6GB 1YHQS 3K0JA 2DXEA 4M5DA 4XIUA 3P49B 4DZDA 1TK0A 1FDBA 5HANA 4P7TA 5IC6B 1C2PA 2B4PA 3SSSA 1RT1A 2BW2A 1WC0A 2WHOA 3Q8VA 2HKEA 3B4MA 3C14A 1AXQA 5ETPA 3OTBA 3NCRA 2A6OA 2HMIA 2GNKA 5KFEA 2MLZA 2HVHA 5KFHA 1CQNA 3BB5A 4DV4F 1CJVB 1A0OB 4FKXA 2WBMA 2CAJA 2QLBB 4U6PA 2GHWA 2HNZB 4DR2J 4LSNA 3DLEA 4RBTA 2C1EB 2KM8C 1T02A 4F04B 1DLOB 1UJ4A 4PQUB 4ED3A 2RUGA 5I42A 4CLPA 5F3ZA 2LQ5A 2BR0A 4DG1B 2CQ3A 1LWFA 3D0HE 5ETRA 1DBDA 1RT4B 1MWZA 2LQ9A 3C6UB 1HKAA 4FP9A 1U1NA 3HLUA 1JXEA 1UVLA 1EARA 3DMJA 3TVYA 4LR8A 1CJTB 1YJ7A 2RHSB 1H7WA 2HFVA 3K5NA 3ZTPA 3P5TL 1RYSA 2DNZA 2NUUG 1FNXH 3P4UB 4J7CA 3KLEB 1R0AA 3MR6A 4W90B 1X8DA 2V4JA 1U7LA 2HWHA 3KUHA 2NXJA 5L46A 4F25A 2WSFC 4BDPA 1SC1B 2X3DA 4A8WA 5KFRA 1XMQJ 2FJVA 1Y3KA 1D3WA 4GKKF 2MKCA 1ZYQA 4P71A 2FJAB 3M32B 1WD6A 2GHPA 1H72C 3RRGA 3KK3B 1ZA1B 1YSJA 1TUVA 2ZVIA 1WC4A 4ZN1A 1RT2B 1IR2A 4I2QB 4I2PA 5BYQA 3CJ8A 4RU9A 1QUPA 3E01A 3NGDA 5EHHA 1NHVA 2H5IB 2Y0SD 1U09A 3Q22A 4LVOP 3RAQA 4UOHA 3H5XA 5KFQA 4ZVOB 2WB4A 2CDRB 5B0FA 1HA1A 2O3DA 1X9SA 3H5UA 2MSSA 4PYDA 2IRXA 3AB2B 5DDRC 1RWNB 1NKEA 3W9IA 3UFCX 1N52B 2HFNA 1TAQA 4QYZK 2AJ2A 1MROB 1UAWA 4FNIA 2KU7A 2GC8A 1KRPA 3UO0A 2DNRA 5HJYA 4FYXB 2BANA 4CM0A 5LXRA 3GQCA 4RW4B 2V69A 2UVUA 3PFEA 3QGHA 2B6AB 5GAEU 4WTYA 4ID8A 4YB6A 3KHGA 3H25A 1IM6A 2H3EB 3NAHA 3PW0A 3GG1A 2BABA 4PWWA 1FO1A 2HK3A 1RTJA 2RDJA 2ASYA 3MM5B 2LU2A 5LM7E 1SL1A 2AJQA 1FRJA 1SB6A 3NGRA 3GZ7A 2HS4A 4O3NA 4IG3B 3Q24A 2ZH5A 3MMAB 1CULA 5DQIA 3T1YJ 3ONQA 2UUAF 4NYPA 4YR3A 1KLNA 1Q78A 3QSYB 1CSJA 5LJ3Y 5CD4A 5D6GA 1QDUB 1EAYC 2ACYA 4F3OA 3CTRA 2L9WA 3T9ZA 4XPEA 3EMTA 2YH0A 4ZVUB 1VISA 4JV1A 5DRKA 3J80U 4DR2F 2HS3A 2RQ4A 1GNKA 4H4KA 3BBFA 2EEYA 2J8SA 4OYZA 1S57A 3K8WA 1KP6A 4RR5A 2KRBA 3MR2A 4DLGA 3CD6S 4CNZA 2MKSA 3E8OA 5DG8A 1RHRB 4DSFA 2ZH1A 3CCWA 1NEEA 3SIPB 1PC5A 4YR2A 2ZBIA 4RW6B 2GMHA 4P7VA 3VAJA 2HHQA 4HTIA 3U1NA 4R0JA 1RAEB 2OPPB 2F3JA 3BBBA 2QMXA 3W2WB 3QO9A 4AL6A 5H9EJ 1IWAA 4DUYF 4DQIA 4DPYA 3HXMA 1ZM3A 4J5OA 1T9XA 4KY3A 4NLUA 5A2QY 4CO0A 1PYOB 3G4SS 4M5JA 3DCAA 3KJQB 5H9FJ 1RABB 3NGUA 2K3IA 1G2EA 1U1KA 1X4AA 1NJIT 5F41A 2F9DA 1KEKA 3MUTP 4CO3A 2BKPA 2KI2A 5DG9A 3A13A 1RHMB 3BR9A 2D69A 4DU7A 1U02A 1R0BG 1K1SA 5DJBA 3R5JB 4JYAJ 2UXBF 2ZH9A 2DRBA 5KFFA 5CYJA 2XNQA 4CO2A 2ZBCA 1F9FA 1YJNS 4EWTA 3CJKA 2ZH2A 2V8GA 3BO2A 1U24A 2BUNA 3RRHA 4YY3F 4ECRA 1S0VA 1RUSA 2YTCA 4EZ6A 4I7FA 1N5YB 1FJCA 1LW0B 1HNXJ 5EDWA 3HDSA 1PJ7A 2DNLA 2AEMA 2UU9J 2CZVC 2AT1B 3K2YA 3TUZC 1RHKB 3O3LA 1RP5A 2HNDA 5AT1B 2GS8A 2R7QA 2GIQA 4LBHA 2CJYB 2R8GA 2HHUA 1CPZA 3TP2A 2RE1A 4WYWA 4U8YA 2YQ3A 1U48A 2AYEA 3G2XA 3MM6B 4ZCKA 2MKKA 2PA8D 5CABA 1WSVA 1N6QA 1SXLA 3BF4A 3CDWA 3IG1B 4ANDA 2ZDPA 3MEDA 1P1TA 3OR2A 1U0HA 2N4CA 2Q3PA 1WF2A 1Q1KA 4LSLA 3TQEA 3PX6A 4GC7A 4B9SA 3G71S 2FHMA 5IWAJ 1SKSA 2CJXB 3HFKA 4MKVA 4CT8A 3CB4A 2F9JA 3GE9A 3GU0A 1M5VC 4DJBA 4DPXA 1FX4A 5K5MA 3IAS9 3TRGA 4KPCA 5BYRA 2Y8YA 3CNQP 1Q4RA 2RQKA 5CXTA 4KV8A 4LRAA 5DETA 3NRBA 4PCQA 3AA9A 3G82B 4G3IA 2DITA 2XY6A 5LMNJ 4C8NA 4Q2LA 1AFJA 2EBEA 4JB8B 2ZC3A 4H4MB 1K0VA 2OO4A 1R7IA 4BCAA 4NLXA 4P6QA 2G9OA 1ZETA 1REVA 1TTHB 3DOKB 2BZ2A 4NEYA 4TXSA 4HHJA 2ZNYA 3W62A 1RT6B 1HL6A 3VTIA 2JH3A 1PAEX 5DGAA 3BGOP 4M94A 1F9EB 2VF3A 1QAIA 1Q0NA 1CEZA 1YDLA 2DH9A 2EC2A 2ZNZA 3H98A 1S6PB 2BM1A 2BEFA 3TAPA 2CPFA 2V9KA 4IR1A 1E6VA 4BLGA 5KFJA 2DXFA 3BBCA 3IS9B 4HH0A 4ILRA 1E6YA 3OTOJ 4P74A 4O3RA 2JC1A 3THTA 5KT7A 2QLXA 1PILA 2U2FA 4A8QA 5K14A 1NO8A 4ZVRB 3MOJB 2KYZA 3MTKA 3NWGA 2XNRA 1VQSA 3MPUB 1L3KA 2MGZA 3QYYA 4QWDA 2BKOA 4K0KJ 3S8SA 4QCLA 4JYAF 1IR1A 4CLFA 2GGPB 1I5OB 4QR2A 4ZVEA 2BBEA 5BR8J 2L9NA 2ZKTA 3FQLA 3H5YA 3OHAA 2P9EA 2VG6A 5C42A 2XMKA 1HNXF 1HQUA 3MEEA 4O3QA 1CQMA 4ECSA 2EFQA 3A1YG 1FFSB 4OJGA 3SEOA 5KAKA 4ED1A 2UU9F 4OYOA 4TU8A 4DX6A 3D28A 4QIGA 4YQWA 2MHNA 2QL5B 1N0UA 1NZ8A 2QN6B 5FLXY 5J2PB 2LMIA 1FDDA 2RF2A 2CXEA 3PIPQ 2AU0A 3Q2SC 4KTQA 2CZ4A 3MPWA 1NK6A 4NE9C 2MEWA 5AE1A 1T03A 2QA4G 2CQIA 2R7OA 2ZZMA 4QPXA 3BO3A 4DBQA 2MXYA 3MWBA 2COLA 1ZPVA 2YX4A 3L95X 2JWNA 2Z30B 4G1QB 3EGVA 1FJEB 1DQAA 1EKSA 2RKIB 4ZCLA 2XMVA 3BH6B 2P2CB 3QZ7A 1UFWA 1MMNA 4X4SA 4WFNQ 4ZJQA 5EX0A 1IVZA 2XMWA 1NJYA 1FDNA 1NNDA 3NBPB 5I3UB 3WZ0A 1RAAB 5A8WB 1V3SA 2YKMB 2K1RB 4CP5A 2BOPA 3Q86A 3K5PA 4F4WA 4N77A 4NLSA 1FK9B 1UMJA 1QVFR 5KT3A 1BC6A 3MUVP 1RI7A 3DDIA 3KKFA 3GIIA 1HNVB 2JOQA 2OH2A 5A76A 4O3PA 4LF7J 3IWLA 2E5IA 1URRA 3OHBA 4F26A 4NYZA 3DOMA 5DDQC 2DNNA 1WHYA 1RE1B 5HO4A 3J7YU 3DXBA 4ID5B 3SDEB 5L9NA 5DQGA 4I0WA 2R4FA 1IJFB 1DQ8A 3FEYB 1S6OA 4EEYA 3MHYA 5L38A 1XR7A 5GAEI 3PO5A 4G1IA 3RBDA 2XZWA 2WVCA 1KKHA 3H5SA 3OXGA 1S9GA 2M2BA 3OTOF 3D5MA 1T9UA 2AJ4A 2MSTA 5I4MA 4FF4A 4WFAQ 2OSRA 4NRUA 4ELVA 4C7QA 5LJ5Y 4IH5A 2VA2A 4O0NA 4PG5A 1S0OA 4MYUA 3ENQA 2NXEA 1KFSA 2YPZA 1X0PA 3DLHA 5CYQA 1Q8KA 3BKUA 3NP5A 4ES1A 4C2MA 4OYXA 1K44A 2HRYA 1C0TB 1DFDA 5BR8F 4CI0B 1WC6A 4CTAA 1HBOA 5IT0A 4OYWA 3J7AN 3CXCR 2ADCA 5D3GA 4ELUA 3RTVA 3MMCA 2R3VA 1Y0HA 4QQBA 4QR0A 3GV7B 2VBXA 5M2PA 2BRLA 3AAWB 2Y1RI 4ILMA 2CNKB 2QV6A 4HT5A 4M8LA 4C6AA 4MH8A 4PUOA 3UQSA 5SZTA 1O5JA 1NMEB 1HYSA 1BUXA 3U27A 3ZZZA 4K2XA 2PI4A 1S1WA 4Q7AA 2V8VA 4RWXA 3FSYA 1N5TA 4J9QA 4RUHA 2FYXA 4NA1A 3KNGA 4NLQA 1Q8IA 1QSSA 1JLAA 2YWWA 2R7WA 3HSZA 2JVOA 4UUXA 1LWCA 1N88A 2E7WA 2AEFA 1OSDA 1X5PA 2CNNB 1NXIA 1TKXB 1RWMB 1S12A 2HS0A 1YZ6A 3PKYA 3GLJA 4K2JA 2IBOA 3WIUA 1KTQA 3DFEA 1AB8A 5HATA 1YJUA 3TJAA 4ZVHA 3NXZA 2OPSB 2B7BB 5F8HA 1NU4A 3BJYA 1XMBA 2DNHA 2HIYA 1QE1B 3WX4A 2V9WA 4PRFA 5KG7A 1YGYA 2GW8A 4F02A 4OHXA 3N9UC 1X4DA 4LF7F 1KLMB 3IWNC 4ZVFA 1WI6A 2E44A 5D4NA 4MAKA 2MY7A 4ZHRA 1L3UA 1Q8BA 2CQPA 2LU1A 5HK4A 3K5OA 1BWEA 3CJ5A 1HNZJ 1D9DA 2XO6A 1MMLA 3BKTA 1YX2A 1RTHB 3M05A 2YNHA 4B3OA 3QLHB 2ZKUA 5JJBA 2NS1B 3A12A 5SUHA 1HQEA 3GMGA 4RNHA 1RT5A 1A9NB 3ZZOA 2WSEC 4MKBA 4WYLA 1KSPA 4DN0A 3HZEA 4K5RA 1SV5B 2B56A 4CLKA 3I31A 1HNIA 1VGYA 2EBGA 2AX1A 2N4DA 3EYZA 2E66A 5BXIA 3E2EA 2J0SD 4ZP6A 5A8RB 2IDEA 3KDNA 2YNFB 2B43A 1LK5A 4HDHA 4A8XA 2H51B 4C3LA 3DRRA 2O5DA 3EICA 4OZNA 2AYGA 3TA2A 1F5BA 4PABA 3O1LA 1N5VA 5C5JA 5KT2A 4R25A 1VQOS 4A8KA 3DRXA 4ZVPB 2RAQA 4IOAQ 5HI7A 3VWSA 3LW5C 2CKWA 2GJFA 3HI9A 4J90A 1IKVA 1VHIA 3KK1B 3DOLB 4KHPF 3D7SB 3A3PB 3ZZUA 1XR5A 4PPDA 4HACB 3Q23A 3IBFB 3RAXA 5K8PA 1RTIB 1TFWA 2DYAA 1X4EA 5K8NA 3PEHA 2VBWA 3NG8A 4L74A 3MZIA 5KFIA 4DV7J 3K8VA 5AXMA 3GIRA 1X4FA 2V2VA 1SVDA 4HHUA 1MU2A 4ENOA 1NK8A 2DT9A 2QC3A 4OJHA 5DZ6A 2LDYA 3ZXWA 2EXUA 4ICLA 4ZK7M 5T14A 1AUSL 1DARA 4JI2J 4DL2A 2C2NA 2J9DE 1Y10A 2WVDA 1WEZA 3KUEA 1F5AA 2VDHA 1W2BR 3KJVA 2N3LA 4DS5A 1U25A 4OI3A 1F1BB 3LP0A 1VMBA 1UWBA 1VQ7S 2RU3A 5F8IA 2GVZB 3AXMA 5KFNA 5IS2A 3KK2A 1V5VA 4A8MP 5LOQA 5CZXA 4RW8B 4GKJF 3UW1A 2FD2A 2B4OA 5FIIA 3AD8C 2NXCA 3CCSS 3FFIB 4LUBA 2YKAA 2R42A 3F44A 3GP9A 3QWUA 4IFVB 3N6MA 4LVNP 2NPFA 1HWIA 2IYIA 4FYWB 3CCRS 1VRQC 1QJHA 4EBCA 1I1GA 3M8SA 3NS5A 2CRLA 1Q16B 1SI9A 5B0DA 1IBMJ 2N7YA 3ICLA 3M9OB 2HZVA 2X1AA 3S1TA 2ASJA 5IXUA 3C15A 4I6WA 3M8RA 4AYBD 4I6AA 3HFVA 4USWA 1SL0A 3GYNA 3JS9A 4P9SA 4UQTA 3K17A 2GV1A 2BW7A 1ELOA 3H90A 4ED8A 3I5BA 4LJMA 4P72A 2IJRA 2LEAA 1R89A 3G8QA 3GG0A 5CHCB 1LXNA 3GYXB 1VQ4S 4Y3CA 2GA7A 2QG9B 3PX0A 5C24A 1OPIA 4X65J 1QSYA 2HHWA 1EP4B 1HR0F 1GXTA 2CVEA 2JC0A 3D1OA 3OVBA 1S0MA 1NDKA 2AGOA 3VGTA 4ED7A 1WG4A 3KLGB 3M2UB 5H9EK 5B0EA 4DV3J 3H40A 5IV4A 3UVJB 4IR9A 2C2KB 2HLTA 4RNMA 4KO0B 1U49A 1C1CA 2MZRA 3HHLB 1D8ZA 1ZPWX 4NX9A 4NWBA 4F0KA 3M1VA 5H9FK 5AXKA 2AYBA 4OL8A 4F0MA 2BM0A 4MKAA 2M8HA 3IGVA 3G6VA 3CT9A 4WCEQ 2CADA 1TVRB 5KFDA 2PE8A 1SKUB 3GIKA 1X60A 3W2VB 2KRRA 2NYIA 5HROB 5J2MB 2J6UA 3IAM9 2GJ2A 1AUDA 3U7JA 1F2GA 1BQNA 2CQBA 2VC1A 3FZ2A 1GMVA 4FZVA 3G86A 4QOTA 2H65B 1RCXB 3PZPA 1TMMA 3CEDA 4AXJA 3BM7A 2HNYA 4MIWA 1TP7A 3KG0A 2C42A 4X62J 3OJSA 3QBCA 4YDXA 1S99A 1I3OB 3IMQJ 3EXYA 3S7RA 3RW6A 4V19J 3TARA 1KFDA 4DV7F 2IRUA 1NSQA 2VIHA 2VFRA 4KT0C 4CT9A 5EWFA 1UVMA 4OYBA 1FE0A 3M30A 4R8UA 3J7YI 1UZDA 3MMBB 3OW2R 2KHDA 4ZN3A 4NA3A 2CQDA 4C0OC 1Y11A 5DDOC 2YNGB 4EZ9A 3GB0A 4JI2F 3FDSA 2VICA 1FI4A 1XNQJ 3W65A 2CQCA 4CLZA 3GWCA 2KO1A 3MEGA 2GQ2A 4WE1B 2GFFA 3ISND 2RNEA 4P2FA 3CO9A 1KQGB 1VRUB 4DV0J 3KOAA 4ITSA 4B02A 2NR0A 2V94A 3CCTA 2GIRA 2D7SA 1MSWD 1X4HA 4R5PA 2JHEA 2OEMA 5KG1A 3TZWA 1N56A 1L5UA 1G6BA 3ET6A 4O3OA 2CVIA 1WG1A 3OXLA 5J2QA 4ZPDA 4Y2KA 2Z2ZA 5GVQA 2DEJA 1LKZA 1NK5A 1ZM9A 3W3SA 4J9SA 2OEJA 4OI4A 4CLLA 3LO3A 4DDFA 3L9ZA 1IBMF 2V63A 5L1IA 5F0UA 1LFPA 3V4IB 4ETXA 5DG7A 2IIHA 3OVAA 7FDRA 1VQKS 3NCPA 1SH3A 3PX4A 1UW4A 1M1GA 2QLFB 1RWVB 1WOSA 1CJVA 4MK9A 3UDVA 4X4VA 1HMVB 4JI8J 2HNZA 2QT7A 2M5YA 2C2OB 2I0XA 5CCLA 3G8TA 3MD1A 2F5GA 5HN0A 5EX3A 5C25B 1DLOA 4ATNA 3EGZA 2GVDB 4PQUA 2BOAA 3TI0A 2R8HA 4LF9J 3QGGA 2R7UA 1K1QA 2YQ1A 4DPWA 4DL0C 2NZCA 4USHA 3R5AA 4DSLA 3C6UA 4DV3F 4DL7A 1PGZA 4LRBA 3G9CA 1FEHA 1X5OA 3SI8A 1X0FA 1WORA 3AJDA 3OV7A 1EETB 4YHHJ 1RA6A 3THPA 3N28A 8RUCA 2J76E 2IVFB 3OVSA 3CD5A 2A0FB 3HJVA 5KFPA 2BMBA 1QAYA 2ZD1A 3KLEA 4JI6F 4OYAA 1Y9OA 3CD7A 4QYZJ 2UVWA 5KFOA 4Y2MA 3PCOB 1F9HA 2KXNB 2RRAA 5KG5A 2ZZNA 5K20B 3OTEA 5GMEA 3UDEA 5F8JA 4IUFA 2DNGA 3POTB 4DSKA 4FS2A 1SBRA 3DRPB 3HT3A 2W01A 4X62F 2K8GA 3KK3A 1X7VA 2A1BA 1Y7PA 2YX1A 3H42A 2LP4A 3FCHA 5JXSA 4WIQA 4I2QA 5HP1B 1DTQB 4JI7J 5A6WA 4CO5A 2EW9A 1YJWS 2ROGA 2XMJA 2C3YA 1HQ2A 1TKZB 4H54A 5E7OB 3GYGA 2ZDOA 3S01A 2C3OA 2WW8A 4S0MA 2ERRA 1QAJA 3K5MA 3DLGA 2E29A 2RSQA 2NSCA 2EPIA 2WONB 4TLRA 2CJKA 4ZIWA 1UJ6A 1GMWA 1RLDA 1W7WA 2FGOA 2XWXA 6AT1B 1JLQB 2QYCA 2P6TA 4X64J 3CCES 5D78A 2MJUA 4J9RA 2HBRB 4DV0F 1WC5A 1VQ6S 4A4JA 1LV5A 1JQGA 3DGVA 2M8DB 2ZBRA 2E5HA 3OFFA 5DDPC 1LQ9A 3QWPA 3V2UC 4OX9F 4K4VA 1BWVA 2W2NP 1ZH5A 2YKNB 2BJ7A 3MM5A 3SV3A 2FVCA 5FDLB 2B9YA 1PO6A 1RU1A 3CVKA 1VLYA 4TLQA 4IG3A 3MMAA 3TNVA 2WB1D 4DR7J 1LXJA 1HW8A 2QIFA 1VBKA 4B9UA 1FX2A 3OPKA 4NLRA 3T1HJ 3QMQA 2N3OA 4E2FB 3NLCA 2OMLA 4M5MA 3KLIB 2VV5A 4J9UE 2V2ZA 4WK3A 4JI8F 5A0YA 2Z0GA 2VZ9A 5T7LB 3M6WA 2XWYA 4IG0B 2G0IA 4B9MA 4L72B 3SCIE 3VAFA 1TL5A 3PDNA 4TU7A 1I94J 2RS8A 1RYRA 2PDAA 4X4PA 2HHSA 4PYAA 1LK7A 2JX2A 4L3KA 3IR7B 3VGSA 2R7RA 3H4BA 2YQ0A 4G65A 4Y28C 4DQSA 3W5XA 2CJQA 1RCOB 2QA4S 4URQU 3GIMA 3QT8A 2MQ8A 1RWWB 1RHUB 4E0DA 2OPPA 1JJ2R 4D3GA 2ZJQQ 3W2WA 4YHHF 4BC9A 3HHLD 1XQIA 3LALA 5CQGA 3DLKA 2HQGA 2W8KA 4OX8A 1AROP 2ZITA 5B09A 4YS2A 2E9ZA 1VFJA 1FRHA 4ED5A 2JLFA 4G6VB 1H2TZ 4PAAA 5ETSA 3MEKA 2DNQA 4FPIA 3O8WA 2ZWOA 4OHVA 3KLFB 2JLEA 1NH8A 2QMWA 1T9VA 3QFHA 1N32J 4MTPA 2I2YA 1UWAA 2GHVC 3PW5A 1PBAA 4F8RA 2VKZG 4P73A 3V6HA 3JQKA 2H5EA 4JI7F 2HZCA 4QR1A 3DLEB 2BQUA 1X4CA 2ZBPA 3TX8A 3TAMB 2IDLA 2OFGX 3JSYA 5I42B 3IR5B 1N5YA 3TEHB 1KD1T 1LWXA 5C7PA 1WSRA 4EI2A 1LWFB 3PR4A 2HFUA 2B3TB 3CSKA 3O2IA 3NNHA 2VASA 2KXHA 1WOOA 4MMOA 2MTLA 1N0VC 3TQ1A 3D3BJ 4OI1A 3SCKE 3CJ3A 1S1UB 4C3MA 2ZUAA 2F4VJ 4ZPVR 5CCMA 6FDRA 4JI0J 3MM7B 3VHQA 2OGUA 4ZPTR 3RZAA 1R0AB 2DRDA 4NMLA 3DC2A 2V4JB 4BS2A 1IBCB 3BKFA 1RTDB 5J2NB 3GSIA 4RPFA 1FWPA 5T41A 4DQPA 3IG1A 2XMMA 2SXLA 1MNEA 5E3QA 3PR5B 4DV6J 1JXVA 2XY5A 2DHSA 4YB7A 3PG9A 3Q8SB 2RMLA 5I3PA 1U6ZA 3TJ8A 4DQRA 5J1PA 4DR7F 3V4MA 1YTYA 2XI2A 3EXCX 4X4UA 3I0RA 2IA6A 3GJRB 3CO0P 3ADAC 1P6TA 3HULA 3VZIA 2HGMA 1OY9A 4GVBA 4A8OA 1JKHB 1NSAA 1I6JA 4YN3B 4IOBA 4YB5A 1RA7A 3QNWB 1U1RA 3M6VA 3A3OB 4NZ7A 1NZAA 1GTHA 4Z7CA 1FRKA 4ZJLA 2Q79A 3G82A 2U1AA 3KHHA 1R27B 3B8HA 4NZ0A 1AT1B 4H4MA 4CWBA 1I94F 4QU7A 4OYPA 4N5SA 1GXUA 3AH6A 3CCUS 1DTTA 2CPXA 1QAXA 3DOKA 1N48A 2J7WA 4N7TA 3OL9A 4F36A 1G3OA 4RW7B 3PV8A 2XG8A 4Q5VA 4FF1A 3W8GA 2EG2A 1OS5A 3PRVA 2AWZA 2ALYB 4ECTA 2R2TA 2H1YA 5E3PA 3KG4A 2DHGA 4DPOA 2C2EA 1EQ0A 4E8UA 4MK8A 3PXGa 3HVRA 2CYYA 4E98A 2JL9A 3H59A 3PJWA 3IS9A 2DGUA 3MAAA 1RADB 1FTCA 2MQLA 1CULB 3CULA 1RB0A 4HDGA 4EO6A 2MKIA 3FSXA 3D1QA 2ZUGA 2FLNA 4WXOA 1V6HA 4DN9A 1VBXA 5CZVA 1HI0P 2J0XA 3SQOP 4AL5A 5D0HA 1S48A 4PXBA 2IM3A 4CLWA 4CO4A 1GX5A 5EUHA 3W9JA 2DVIA 4DLEA 3HKZD 4HLBA 4JV5J 1NLKL 3MCOA 1UPPA 4F0HA 2DKOB 2FHOB 3CC7S 2F4FA 5A6PA 2WAQD 4DZ6A 2LQBA 5MLCV 2DIUA 4EUVA 3MMJA 5LSOA 2DNKA 1WDTA 3MGJA 1SJ3P 2WK4A 2POKA 3M7VA 1MLAA 2DGVA 3HMJG 2HHTA 3CE8A 2XULA 1K9MT 1H3DA 1RQ0A 1Q5VA 3OL6A 3HO1A 3JAMU 2FB0A 1CJKA 2M0GB 1WOPA 5GAGU 5J2PA 1J5EF 1S9EB 2HFOA 1FA0A 3QO9B 1SC4B 1FJGJ 4JI0F 4YFUA 1UFLA 3G8SA 1HW9A 4CIOA 2VFTA 1KQSR 1PIEA 1S9FA 1TKTB 2UVRA 4G1QA 2QL9B 4KGZB 3M8ZA 1O51A 3KNAA 4RL1A 1B7FA 2NXUA 4DV6F 4OHYA 4NLOA 2C2ZB 1JLGB 2BDPA 3BS9A 2LVWA 3SQGB 1IKWA 5I3UA 1JB0C 2JFDA 1ZOTA 1GK8A 2QA1A 5A8WA 4F4YA 2YKMA 4J91A 3CJKB 2V4RA 1KDNA 3DGPA 2XHWA 2DD8S 1S1XA 3CW2C 1JJHA 4FYYB 1FK9A 2D3ZA 4UTGA 2E1MC 2DGQA 1WEYA 5DGBA 1VQNS 4DCOB 2I6WA 1HNVA 1IXKA 1FWKA 4KHRA 2RQMA 1TUWA 1R6YA 2CNOB 3OQ2A 4GKKJ 3K7RA 2YWEA 4LREA 3TZZA 1RK8A 5F9LA 2HNDB 3LUYA 3Q8UA 2PI5A 5KG2A 4J9PA 4ID5A 2L9DA 4WU2A 4QPTA 1ZTTA 4DV2J 2VG5A 1D1UA 4YOEA 2B4UA 2X7IA 4ZS6A 1N6QB 2HHHF 1HNWJ 2AZ1A 2DR9A 1TL3B 4PXDA 2XSJB 4QYRA 3MEDB 1TL4A 3AY0A 4UF4A 3DDNA 2A3JA 1NDLA 5GAHU 2F8EX 3PKMA 1OYEA 5DLFA 4KPYA 4OI2A 2R2SA 1MN7A 3W61A 1WF1A 1UL3A 3BPDA 3D6HB 1M1KT 5B0GA 4RJVA 1SKWA 4NYOA 1CBKA 4PWUA 2HFSA 3H8YA 2BX6A 1H73A 1N36J 1KONA 2IM0A 2YVSA 3UCUP 3TYTA 4EMDA 2OPQA 4DR4J 1HHSA 3HJFA 4JV5F 1UVIA 1SH2A 1C0TA 4IRDA 1S1TA 4LSZB 4J9MA 1RWKB 3FK4A 4B9TA 3TANA 1LOUA 1REVB 2H54B 1Z1ZA 4CH7A 4CZCA 2UUAJ 1RT7A 3QT6A 1WI8A 5L9XA 1DAXA 3FJ2A 4X2BA 2RIJA 3KFWX 3MOZA 3AODA 2P8IA 4NXNF 2D1CA 2G2ZA 1SJ1A 2CPDA 4UY8T 4DWIA 2FHJA 2KJWA 4PG7A 4DFMA 2YWGA 3IBCB 4PXCA 1FJGF 2EKNA 5IFMA 4WBFA 2FY1A 1JMTA 1ZAVA 3N01A 4DFKA 2YH1A 1E6YB 4OFZA 1IWGA 2Z56B 3TAQA 1OJ4A 3MUMP 2WTFA 1U2CA 4C8MA 4CYUA 2XBPA 2K7KA 3UCGA 2HBYB 1NKCA 5LSRA 2ZH8A 3DU5A 4CM2A 4DL5A 1KN6A 1TKXA 2NPIA 3RRKA 2V4QA 2ILYA 4RNFA 2GO9A 3K59A 2AYMA 2PMZD 3AXKA 3OBIA 5IQQA 3RB3A 3J7A1 5AE3A 3NGKA 2DIVA 1WC1A 3VV2B 3NNAA 5AJ3J 1SIZA 1Q81T 2PGCA 3MCSA 4DUYJ 5GMKa 3ZTOA 4RKUC 4FXVA 2J7KA 4URGA 3TUIC 4NCGB 3FKBA 1EZZB 2ZH6A 2RQCA 2VBYA 2KT3A 5KFLA 1HQUB 4MKYA 3LQVA 1RWOB 1HPZB 1XWLA 3NOGA 5ETVA 3M8QB 2HHXA 1M5OC 1KVKA 4M5LA 2DH8A 3JTNA 4I56A 5KFZA 2Y1IA 3R6LB 3DLJA 3QRQA 1BHNA 2B9WA 1JJCB 2IM1A 1K47A 3AB4B 3MPVA 2RF2B 1RTHA 4DF4A 2UXBJ 5CAAA 3QLHA 2VC0A 5LXYA 4KBIA 3OL7A 2KFYA 3VGUA 4EO8A 4DV2F 4KGMA 2XZDB 3D54A 3Q89A 4WKRA 1TZ0A 4PG8A 4K4ZA 3KMQA 5C2CA 2OD6A 1X4BA 1HNWF 1NUEA 4YY3J 1D0EA 2NLWA 2HRUA 2I8EA 3QGIA 1SV5A 2KJVA 1JLBA 4ZKAA 2D3OR 2FZKB 4WZQA 1X31C 5ADZA 3KJFB 1YRXA 4TY8B 3ISZA 5A8RA 2YNFA 3OD2A 1S77D 1G4CA 4C8LA 2IC3B 4USVA 4GO5X 3A8JA 2BACA 4JI1F 5C2GA 4I69A 3LGMA 2VL1A 1N36F 2JNJA 1X5TA 3LGHA 2R7VA 1NM2A 4DL3A 4DR4F 4P75A 2RRBA 4DMZA 1SCJB 3BO4A 1HWUA 1P1LA 1HLWA 3DOLA 4R0EA 3KK1A 2L48A 1YRUA 3GCWP 2WRMA 3P8BB 5KFWA 1RTIA 1B4SA 2IA0A 3RB4A 1VDHA 4DR6F 3DOMB 5THWA 4ZP8A 3MR7A 5K8MA 1NPKA 5HMXA 1IKXB 3EDQB 2MB0B 2V5HG 2GCFA 4FNHA 5IC4B 3CDBA 4J9VA 2AJFE 3HSDA 4NEZA 5HMYA 2FPHX 5LMUJ 4DSJA 3W1YC 3EZ5A 3M8YA 3QATA 2KT2A 2KFZA 4NMXA 4J9LA 2XS2A 2PC6A 1BGXT 3EZUA 2G2OA 1V5IB 4USIA 3JSRA 4CH0S 2CQ2A 4HYKA 3DRYA 4WPAA 1XEZA 3QPIA 2BJ9A 4B9LA 1YG0A 3U02A 3DHXA 2ZH7A 2HBZB 3RR7A 1SPBP 5D4PA 4RW8A 5HVHA 3EZOA 2A18A 1P27B 2O01C 4P52A 3FFIA 4MFBB 2XYPB 2W9CA 3AQPA 2JEIA 5AJ3F 2RS2A 3FUYA 2JEGA 2F1FA 4CTAB 1BQMB 2MDAA 5EWEA 3W64A 3FBFA 3DYAB 2EWHA 3MMCB 5KFVA 3CD0A 2F40A 2Q43A 5B0CA 3OR1B 3NY0A 2W2OP 2VH7A 4QW8A 2QX0A 2JSXA 3UDCA 2VOPA 5KG3A 2KZMA 3C8YA 4JUZA 2DNYA 3N6LA 1NJZA 2PD1A 2APOA 3IGNA 4UW2A 1TV6A 4CRJA 2EFVA 3FBBA 3PO4A 3BN4A 2VG7B 2N7CA 1S1WB 5GAGI 3WIVA 1NHUA 3ZZ0A 2BQ3A 2P6SA 1WKLA 1HHTP 3FQKA 4ZVTB 3NCQA 3T5JA 1HBUB 2LA4A 1HARA 1YJVA 2IY5B 3IN5A 1JLAB 2HEKA 1CS4B 3KLGA 1MWYA 2KFNA 2AW0A 3M2UA 5KFBA 1SC3B 2ZWPA 1D8YA 1T7PA 4UZCA 3UVJA 4ZVGA 4KO0A 5D4LA 1RBOB 3M6XA 4C0BA 4A8FA 2L3MA 1LNQA 4KFBB 2YY3A 3LTOA 1U4BA 2NXNA 1WHXA 2VPYB 4WFYA 3UR3C 4LQ3A 2FVSA 1XC9A 1KHWA 2R7SA 5J2MA 3W2VA 3T1AA 2NZ4A 1OY6A 4XTTA 1CC7A 1ZM4A 2OUGA 1J27A 1HBNB 2DY1A 3PTWA 1X4GA 3JTOA 5IZHA 3TZYA 2DK2A 2KYXA 3UI3A 1B99A 1GQEA 4LQ9A 4ZHRB 2AP6A 5M2UA 2ZM6J 1RZMA 2ZJRQ 2AKWB 1B3TA 2MJNA 2YKPA 3NAIA 5IV3A 3A8KA 3O5TB 1HHQA 5B0AA 1U2FA 4KHMA 3I0SB 9ATCB 1HQEB 1VQ5S 3CCZA 1N33J 2EG1A 2OP5A 1CLFA 1CJUA 1K73T 4N8OA 4B17A 2XS7A 1RSCA 3BSOA 5E3AA 4U96A 2DHAA 5LMUF 2MKJA 2Y8WA 1FERA 4QWAA 2YNGA 4QWCA 1VQLS 1HNIB 3ELHA 1ZZFA 2BE7D 4CO1A 3EWGA 2GMLA 1R31A 4MIAA 1HIYA 2ACMA 5AE2A 1S6QA 4ZPAA 3NGTA 4WE1A 2VB6A 4ZCIA 5GAHI 2DCLA 3JB9k 4QZVB 5HAOA 5BJRA 3E51A 2HVIA 4I68A 3B4DA 1VRUA 4LRCA 2KTQA 2XCAA 2G2YA 3RAMA 4RU2A 2Z2LA 3B54A 4USJC 1PYTA 2MZQA 2XYGB 2HRTA 1ZZNA 2K06A 1KTVA 2DTJA 3ILJA 1HWKA 2CQGA 4TVAB 4DF8A 1GX6A 3IFEA 3N5FA 3F73A 1SH0A 2V68A 3U1LA 1X9WA 1RLCL 2HG4A 1T9WA 2IJNA 1C1BB 4C8ZA 3V4IA 2UZAA 3UNYA 3R7NB 3FBEA 4U9RA 5G0RA 4WF9Q 3HZGA 1T8EA 3BYPA 3CJQA 4WKYA 3RUBL 1JLCA 5IT4A 3BZQA 3DM2B 4LF5J 3QIPA 1RKIA 2CQ0A 1HMVA 3W63A 1S1VB 4C8YA 5ETNA 2HQ3A 2PA3A 2UXCJ 2GVDA 1MN9A 2CWXA 3SMZA 2AJ1A 2UUBJ 4JV0A 1JLEB 2KVQE 2W7AA 3GILA 4RNNA 3T41A 3L3CA 5JVHQ 2VODA 4YEAA 3KJNB 5L39A 1UWBB 2ZZTA 4WJBA 4USUA 1ZA2B 2YX7A 3B78A 5D15A 1VLOA 2JEJA 1FD2A 3LGNA 4FPRA 4QIVA 4LF4J 4FKYA 1V3RA 1EETA 1WWHA 3IRXB 1S7IA 5KFKA 2RU9A 3DXSX 4P10A 2IMWP 2UXDJ 3LWMA 1RAOA 1GH8A 1IR0A 1WTFA 3VQTA 1IJEB 2MPUA 4BHQA 3PW7A 2PMWA 1FRXA 1PKUA 1R8CA 1JIHA 4Y65A 3BGLA 1B7YB 3UN3A 2I5JA 1OY8A 4P2SA 2D9OA 3MCMA 4L6V3 3DRPA 3RBZA 4WZMA 3N4WA 3ZZPA 2ZH3A 4JI3F 5E5NA 1FNOA 2LFVA 2ZM6F 4DPUA 4ECWA 4JOUA 2DGTA 2ZJPQ 2O1PA 3HKWA 1U6FA 2AGQA 3OFEA 4Y2IA 4GVLA 1N33F 4LRDA 3W60A 2L41A 1HD1A 2ALZA 3R5DA 2F8MA 4IKAA 1TKZA 4DR5J 1XIQA 3C16B 3DRSB 2ZE2B 3KWMA 2KHCA 2WONA 7FD1A 4NRTA 1P9YA 1WC3A 4M5IA 4YDDB 4WK1A 3T5HA 4ER8A 2YXLA 3AOCA 1JLQA 3M1VB 2UP1A 2UVVA 2DR7A 4WTOB 4Q0BB 1XR6A 1F5CA 4DPTA 5HBMB 2Z2MA 2RDDA 3PY8A 3KLVA 1APSA 2DH7A 1XK8A 2DO4A 2W4PA 2HW3A 3Q8PB 1IBKJ 2XC9A 2BE9B 2YKNA 5LT5A 3G6YA 2CIMA 2I9SA 2QA2A 1AZSA 3RJMB 2XLKA 2PFFB 5FDLA 1RTZA 3ILIA 4N56A 1IM4A 3PYDA 1RT3B 3R3TA 2XGQA 1H2UX 4O4RA 1BQXA 4OZJA 4RX6A 2MKHA 4I6YA 1RHJB 4L73A 2HWTA 1Y5NB 2PFDA 4U8VA 4YR0A 2LDIA 1NDPA 3RR8A 1TMJA 1CC8A 3F41A 2E1AA 4X4RA 4LF5F 1O0PA 3EX7B 1SQEA 2MQNA 4LFBF 2IMOA 2UUCJ 1FVSA 1VK8A 2FJXA 3KUGA 4ED2A 1JNRB 5KOWA 5T7LA 2MKYA 4RZRA 1FKPB 4DFPA 3MXHP 3JXOA 2MQPA 2UXCF 3FNNA 5ETLA 4KHPJ 2OIHA 3NEKA 3BQ2A 1NK4A 2HHPA 2UUBF 3ZNUA 3OUYB 3MCNA 2DJWA 3BGRB 4K8RA 1H7XA 4LMZA 2KG0A 1UEUA 4DR3J 4EU0A 2XHCA 1KQFB 4K4UA 1FCAA 2LXUA 3HPOA 3MI7X 4LF4F 1UVNA 4F3MA 1JNZB 2ATCB 1TL7A 2B8QA 2KDOA 2UXDF 2IHR1 2VDIA 5DO2A 4PG4A 1B70B 2LYVA 3RB0A 3HVTB 4HEA9 1ZM2A 2MZSA 2CQ1A 2AIRB 1Y5IB 3KLFA 2DRAA 1JX4A 3ZZYA 1T9TA 3ZZTA 1KVJA 2QRRA 3PNIA 3NMAA 2QGFB 2GQCA 4FXWA 4OI6A 4U67Q 2KN4A 3QAEA 4B3RJ 1VCTA 4GKJJ 1L3SA 4NL5A 1GAOA 3AQOA 1RJJA 1RAGB 1JJ4A 2DNOA 2WCXA 1FDAA 2RB7A 2NUHA 3R9LA 2E5GA 3ITHB 3H2UB 5L8RC 2CPHA 1GXLA 1KR4A 2VPWB 2NCKL 3TAMA 2UUWA 4B3SJ 1FFWB 2IYGA 4F50A 2AQ4A 3IR6B 2HVDA 2IAJB 3RG6A 2B7CB 3H2LA 4DR5F 2RT3A 3NKYA 2I1RA 2CPZA 3Q8QB 3CDUA 3KMSA 3KG1A 1B64A 1WNEA 2J6TA 4N8NA 3PVXA 3HT0A 2BE2B 1M5HA 3FZBA 8ATCB 4N47A 3JAMY 1KS2A 3VCDA 3TA0A 2VUGA 3W5YA 1TL1B 1S1UA 1U26A 4IDKB 4ZITA 3QRRA 3MM7A 5JVGQ 2BV3A 2R8IA 2JLGA 2ZD1B 4ECQA 3D1HA 3CF5Q 3V81A 4PWDB 2ZBQA 1RTDA 5J2NA 1IBKF 1R8BA 2G1HA 2JZ5A 1HR0J 1H98A 2A2CA 2XM3A 3I82A 1DURA 3BDEA 2B9XA 4IOCQ 1FXLA 2LQJA 3I4HX 2Y3YA 2HGLA 3FRZA 1QSLA 2LEPA 5IT9U 2GZOA 4C0HA 3LP2B 4FS1A 3HHKA 3J81Y 1IKYB 2GAHC 4USKA 2XLIA 4O0IA 3M2VB 2H4WB 4X4OA 1AFIA 1YBTA 3ENAA 3GPAA 4EFAC 1JKHA 1VHFA 2VPXB 3DKDA 4NLYA 3WBZA 5KOXA 3WC2A 2GQQA 1N34F 2CPEA 2UUCF 3CC4S 4Q2MA 4QWBA 1K0TA 3DLGB 4DX8H 1SUQA 3KLHB 3ZNJ1 4OYMA 3AD7C 3CJTA 3GFYA 2IVMA 2NSBA 2BJ3A 5MAOA 4DQQA 1DJ0A 4C8KA 2MQQA 2IFXA 2M9KA 4RW7A 3D3CJ 1KBRA 5D4OA 4DR3F 2FY8A 4ZCMA 5J1EB 1Y4ZB 1ACMB 3R1LA 2JRSA 2C28A 1ZS6A 4Y6IA 3R1HA 1VQMS 1ZAXA 2RRNA 2CWKA 4KQZA 2EK6A 2E1RA 4X4TA 1N8RT 1F60B 4UQGA 3ILOA 3OT9A 4DOZA 4F2RA 3JTPA 4FF3A 2R2UA 4RBUA 2XCPA 4PEOA 1S10A 1TKDA 4RW9A 3M8PB 3I96A 3TUJC 2X3GA 1VRTB 3D6FB 3VF0B 2YBVA 2B8PA 2KG1A 3JQMA 3I87A 1Q86T 4KAIA 4DU8A 4B3RF 4OJ3A 3TJ9A 3UD5A 4ZDNA 3P3DA 1NKBA 1YQHA 1M5SA 5A0YB 4ZLJA 1UVKA 3V6JA 4Z7YA 4B3SF 1NRKA 4RUAA 4Q45A 2WW4A 2JVRA 3OJUA 1PC4A 5K8OA 5KFTA 1FRIA 5A8KB 3AHPA 4OHWA 3UN5A 1NSKL 4MK7A 1LW2B 1S9EA 3EGWB 3ETOA 2XI3A 1WDDA 4MJKA 2H48B 1RWUA 4K5SA 4KH1B 2GAGC 4JI4J 2MMYA 2DR6A 3RGIA 4O4GB 2IBKA 1FTRA 5KT4A 3DLKB 5IM0A 4OI0A 3DDKA 5F8MA 1A7GE 3EPGA 4IFYB 1Z2ZA 3PHEA 1IUJA 1KWMA 2RHQB 1XMQF 1TKTA 4BC7A 1JLFB 2RDIA 4W92B 3TOQA 3VAGA 3CCVS 4P2MA 1KOOA 1JLGA 1M5PC 5KFGA 4XDDA 3MM9A 3SQGA 4KSEB 3QT5A 3IRWP 3RU0A 4K4TA 2MQMA 4C11B 4HI1A 1BLUA 2G0JA 2BVZA 3C6TB 3SCJE 2OSQA 5KG6A 2XO7A 4QJVA 3QAUA 2YNIA 2ZHBA 2M7SA
chains in the Genus database with same CATH topology
4ALZA 1FKOA 2DR9A 1TL3B 1KHVA 4PXDA 3EUNA 2HRYA 2XSJB 1C0TB 3CCLS 4ED0A 5B08A 1DFDA 4QYRA 4IFYA 2E1CA 5BR8F 4CI0B 3NMRA 2HHVA 2OD4A 3MEDB 4CTAA 1HBOA 1TL4A 5IT0A 2BQRA 3AY0A 1FJ7A 1EP4A 1NJWA 2XY7A 3MF5A 4PR6A 3CXCR 3DDNA 4K59A 2A3JA 2ADCA 5GAHU 2W24A 4FXDA 1JLFA 5D3GA 2F8EX 4NPOA 3D2WA 3RTVA 4ELUA 3V6DA 3SSRA 1UA0A 4OQJA 3MMCA 2EK1A 3PKMA 2BA9A 3LOUA 1U1LA 1Y0HA 1LWCB 2M88A 2UUTA 4OI2A 1PSDA 4QR0A 3HVWA 4QQBA 5DLFA 1VC6A 1DRZA 3GV7B 2R2SA 2VBXA 1WF1A 3HF5A 5FD1A 1UL3A 5M2PA 2BRLA 3AAWB 2Y1RI 1M1KT 5B0GA 4ILMA 1SKWA 3OLBA 1S4FA 4BBYA 2QV6A 4NYOA 4HT5A 4PWUA 2DGXA 3H8YA 4M8LA 4MH8A 4PUOA 4Q8FA 4GO7X 4LT6A 5DQHA 3UQSA 2V8HA 4C11A 4DS4A 3HHLA 3N0VA 1KONA 2IM0A 2YVSA 3UCUP 2F7VA 5SZTA 4DL6A 3C6TA 1N5QA 2BJDA 1O5JA 3TYTA 2J0QD 4YMEA 2OPQA 3ISNC 3MPYA 1TFYA 1HYSA 3ZZZA 3U27A 1HHSA 3HJFA 4PG6A 4K2XA 4WXWA 2PI4A 4FVMA 4GMKA 2L08A 4O23A 1S1WA 4JV5F 1UVIA 1TL3A 1SH2A 3CCQS 2Q6CA 1C0TA 2OAUA 2CFXA 2XSJA 3DI6B 4IRDA 5F9NA 5DM7Q 4HT7A 4Q7AA 1S1TA 1X5SA 2G1DA 1TVRA 4RBVA 4J9MA 2V8VA 4RWXA 5HROA 3G6ES 3FSYA 3IXQA 1N5TA 4J9QA 4RUHA 4NA1A 2Z4PA 2QO3A 3KNGA 4NLQA 5LL6d 1Q8IA 2ROEA 3J7ZT 3OSPA 4B9TA 3N5BA 4OX7A 1QSSA 2MY8A 1JLAA 3TANA 1LOUA 2R7WA 1GT8A 2DNMA 2JVOA 1REVB 4UUXA 1HWJA 1LWCA 1N88A 3HP6A 1BY9A 4QBUA 4ECVA 3UWTA 2E7WA 4I4BA 3X1LB 1OSDA 1R8PA 1Z1ZA 1X5PA 2FIUA 3T1YF 4CH7A 1TKXB 4CZCA 3GV5B 1R8HA 1RT7A 2QZ8A 3HX9A 3I0RB 3C3LA 2HS0A 4OMFG 2ILZA 2DGWA 1WI8A 2FJWA 3PKYA 4X64F 5L9XA 3JYTA 4QIFA 1DAXA 1NB7A 3FJ2A 4X2BA 2RIJA 3KFWX 2B5JB 3MOZA 3VR1A 2IBOA 4NXNF 4QIEA 2D1CA 1KTQA 3DFEA 1SJ1A 2CPDA 2YNHB 5HMZA 4UY8T 4DWIA 4B3OB 1YJUA 2FHJA 2KJWA 4IH6A 4PG7A 4ZVHA 2OPSB 4DFMA 2B7BB 2VFSA 5F8HA 3V81B 3MAQA 1FE4A 1NU4A 2YWGA 1R43A 4PXCA 3BJYA 3JSBA 2CPJA 5GADU 3FEXB 1FJGF 1XMBA 1RT5B 3PACA 3DI6A 2DNHA 2EFPA 3MMBA 5IFMA 4B3MF 2FY1A 1QE1B 1JMTA 3ZFVA 1YITS 1ZAVA 3N01A 6FD1A 4A8SA 2E9TA 2AGPA 4DFKA 3WX4A 2V9WA 2YH1A 3BSCA 4PRFA 3JSMB 1E6YB 4OFZA 4O44B 5KG7A 3TAQA 1YGYA 3MUMP 4HI2A 5E2QA 3E3XA 2WTFA 3A8EA 2GW8A 3EPIA 4F02A 4OHXA 2E5LF 3VAIA 5B7WA 4C8MA 2KKHA 2XBPA 2ZHOA 3T19A 2K7KA 3HVAA 3UCGA 1NK7A 1DTTB 4IQMA 3N9UC 1NKCA 1WF0A 5LSRA 2XB2D 1Q79A 1X4DA 2ZH8A 4J37A 4LF7F 1KLMB 3DU5A 3DLLQ 2XGPA 3MECB 4NLWA 4BWJA 4XO0A 4ZVFA 1WI6A 1U6BA 3LP1B 2KM8B 4DL5A 1KNZA 3IWNC 2E44A 1KN6A 1TKXA 2NPIA 3RRKA 2V4QA 2ILYA 4IO1A 5D4NA 4MAKA 4TU9A 2MY7A 4RNFA 4ZHRA 2GO9A 1HI8A 1Q8BA 4HVZA 2CQPA 2LU1A 1VC0A 1Q7YT 1L3UA 4C4WA 1WHWA 3K5OA 3K59A 4EBEA 3CDEA 3DRRB 2AYMA 2PMZD 3OBIA 1BWEA 3CJ5A 4RWWA 3T1HF 5ITHA 3IC1A 5IQQA 3RB3A 1D9DA 2B5JA 1SKRA 3J7A1 1MMLA 5AE3A 4KC5A 4H4OB 5F8GA 1RTHB 3NGKA 3RB6A 2DIVA 3LH2S 3M05A 2YNHA 4B3OA 4ZOSA 3QLHB 2FLLA 2ZKUA 5JJBA 3NNAA 4JI4F 2NS1B 5SUHA 1B0TA 1HQEA 1SIZA 2D41A 3GMGA 2W25A 4CQ1A 1Q81T 4RNHA 2PGCA 3CCJS 1RT5A 3MCSA 3LAMA 1U1QA 4KKOB 5GMKa 1A9NB 2OKQA 4FXVA 4RKUC 2J7KA 1G1XA 3ZZOA 5E3CA 2BRKA 4URGA 2WSEC 4MKBA 4WYLA 3TUIC 3R5CA 1KSPA 4F2SA 1SUQB 4NCGB 4DN0A 3ZC4A 4QIWD 3JSMA 4B9NA 2ZH6A 3HZEA 2RQCA 4K5RA 2VBYA 1AW0A 1SV5B 2KT3A 4O44A 2B56A 1LWEB 5KFLA 5FJ4A 1IKVB 1HQUB 3I31A 3WC0A 2OPRB 1HNIA 2ASLA 4MKYA 3LQVA 5KT5A 1VQYA 1VGYA 2AX1A 1HPZB 1XWLA 2EBGA 2N4DA 3EYZA 2E66A 4I67A 3M8QB 4XAKA 3E2EA 2J0SD 4WU3A 2AF6A 4ZP6A 2HHXA 3BSAA 1M5OC 3CJ2A 2HFZA 5A8RB 4B08A 4DG1A 2YNFB 3MECA 2DH8A 1U1MA 3JTNA 3LP1A 4I56A 2B43A 1LK5A 1TR0A 4HDHA 3SCLE 5KFZA 2Y1IA 2R8KA 1MMDA 1P9QC 3DLJA 1OQ3A 5DM6Q 4KIAA 3OSNA 2FUG9 5LSLA 2FGCA 4A8XA 1T05B 1S49A 1RT4A 2B9WA 4C3LA 4EYIB 3DRRA 2O5DA 5H1SV 2RH3A 4OZNA 2EI5A 5KT6A 2AYGA 2IM1A 3TA2A 2J7UA 3AB4B 1F5BA 3MPVA 2RF2B 3OFHA 4H4OA 1MU2B 1RTHA 4A48A 4DF4A 1J5OB 3O1LA 3PEJA 1N5VA 3Q2TC 4M1KA 3QLHA 4F4ZA 5C5JA 2GX8A 2GMJA 3KYLA 3MTJA 2LA6A 2W9BB 1FD8A 2VC0A 4KBIA 5LXYA 5KT2A 3OL7A 4YB1P 4R25A 2KFYA 4DHVA 4EO8A 3W7BA 1VQOS 4A8KA 4DV2F 4ICLB 4KGMA 2FDNA 3D54A 3DRXA 4WKRA 1TZ0A 4PG8A 4UUWA 4K4ZA 4KKOA 3KMQA 2OD6A 3UR0A 1X4BA 1HNWF 2EKYA 2FTRA 1VBYA 4IOAQ 1S7HA 5HI7A 1D0EA 2NLWA 3VWSA 2HRUA 1HD0A 3GR1A 4NCGA 2C2DA 4LFCF 1BD6A 2I8EA 3LW5C 1YBAA 2CKWA 2LCWA 3QGIA 1SV5A 3HI9A 1FESA 1JLBA 2KJVA 4ZKAA 1LWEA 2D3OR 1IKVA 4U7UK 2OPRA 5C25A 4WZQA 5ADZA 3DOLB 3KK1B 4KHPF 1HPZA 4F4XA 3ZZUA 1XR5A 2LXFA 5AXLA 3UE2A 3M8QA 4PPDA 1YRXA 4TY8B 4NLGA 3Q23A 1K8AT 3RAXA 5K8PA 2RD5C 3ISZA 1RTIB 1Y5LB 5A8RA 1TQLA 3KJVB 2OTLS 2IM2A 2YNFA 1TFWA 1X4EA 4RW9B 2QFJA 5K8NA 2CQHA 3PEHA 2VBWA 3NG8A 1C4AA 3EGNA 3MZIA 5KFIA 4X4NA 1S77D 3LP0B 1TK5A 2W7PA 3M32A 4X4QA 3IO1A 1T05A 1N32F 3K8VA 2IC3B 4C8LA 1B64A 5AXMA 4DSIA 4IRKA 2O66A 4GO5X 1X4FA 3KK2B 2XS7A 3OFGA 2FHKA 1S79A 4DV5F 1S72S 3AJ2A 1MU2A 4QU6A 3HK2A 2BACA 1NK8A 1J5OA 4JI1F 1D9FA 2BXJA 3TA1A 2LKZA 2CDQA 2G13A 2DT9A 4I69A 3LGMA 2VL1A 1N36F 2W9BA 4OJHA 2V2KA