1BQNB

Tyr 188 leu hiv-1 rt/hby 097
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVEPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRALSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 86
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqnB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnB03
2WTFA 1QAJA 3HVTB 1KHWA 5KG5A 4EYIB 4FS2A 5F9LA 1RTIA 4DL6A 3KLFA 1RYSA 1LWFA 4NLGA 4URQU 4NLUA 3GV5B 3H4BA 2YNIB 4GC7A 2R2TA 2IM0A 2HNYB 2ASLA 4I7FA 4RW9A 4M95A 3QO9A 2EC0A 5F9NA 4NLYA 1S1XB 1RT1A 3LP1A 3NKYA 3GIIA 4ECRA 3LAMA 2OH2A 4K4VA 4QWBA 1T03A 3JYTA 4H4MB 3H5UA 4ZP6A 2R8HA 1T05A 4J9RA 3DMJB 4F4WA 5KT5A 4R8UA 2HMIA 4Q43A 4IR9A 1C0TB 5J2QB 4WE1A 2FVRA 5EUHA 3PZPA 5J2NB 5KFLA 3EPIA 5J1EA 3E51A 5L9XA 1JLAB 2WONB 3BSCA 2XC9A 3KHHA 4NCGB 4RNNA 4Q0BA 2B5JB 2FJVA 5KT4A 2WK4A 3C6TB 3LANA 2XI2A 3GYNA 4IR1A 1TL3A 4QWEA 3H2LA 4ED0A 1J5OB 2OPQA 1VRUA 3FFIA 4RNOA 2E9TA 2B6AB 4IH5A 1S9EB 2O5DA 1GX5A 5KFWA 5KFCA 4ECVA 2ASJA 1S1WB 3MECB 1HQUB 2I5JA 3KJVB 4NRTA 5T14A 4URSA 1HNIA 3OHBA 4IFYB 4MFBA 2WOMA 1RT3B 5I3UA 3V6DA 3I5AA 3V6JA 1TKXB 3KK3B 4PQUB 4U7CA 3TAMA 3V6HA 3DOLB 1FKOB 2RF2B 2WHOA 4YR2A 3ICLA 1RAJA 2XCPA 1JIHA 5JUMA 5CYQB 1SH2A 3DLGA 3CVKA 4NLOA 4XPCA 2VG5A 2ZE2B 3LP2A 5HBMA 3CJ2A 3NBPA 4MKAA 4Y34A 3RB0A 1RA6A 1RTJA 1LWFB 3QIPA 5I42A 4O44B 1LWCB 3JSMB 1R0AB 3D5MA 4JV2A 3KNAA 4TXSA 5C25A 1SUQB 3IRXA 4U6PA 5F8JA 3BQ1A 3QGIA 1JLCA 4RNHA 4G1QA 5CYMA 4NLTA 5FDLA 2C28A 2V9WA 4NZ0A 1XR5A 3QZ7A 4DG1A 4X2BA 1T05B 3KK1B 5EDWA 3BQ0A 2VG6A 3MEEA 3MR3A 2OPSA 3PJXA 2HMIB 3MFHA 3PR5B 4B3OB 4LQ9A 1S9GA 3ISNC 1JLFA 1FK9A 2YNFA 3QZ8A 1NHUA 4K4TA 3BREA 3ITHB 1RT4B 5J2MA 4RNMA 3DRSA 2JLEA 2YKNB 3PVXA 4KKOA 5KFZA 3DM2B 2FVSA 4H4OA 4TN2A 2FJWA 1HMVA 3OL8A 1ZTWA 1TL3B 4WZMA 1VRUB 3DLKB 3MEGB 2IAJB 3M8PA 2JC0A 2W9BB 5KFGA 3RAXA 5HLFA 3GQCA 1S6QA 3V81A 1LW0A 2CKWA 3OL6A 4ED6A 2WCXA 4MIAA 1S6PA 4QWDA 3Q8SB 2W9CB 2W8KA 5DLFA 4DL2A 2WOMB 4IDKB 4G3IA 2YNGB 1IKYB 1LW2A 2BANA 5K14B 3KLIA 2R2RA 1VRTA 4KSEB 2DPIA 3HVWA 4HKQA 3PW4A 2YKMA 3QLHA 3OSPA 2RKIA 2GC8A 5KFDA 4TY8B 2JEJA 1REVA 4ED2A 4IRDA 2R8GA 1TKTB 2VG5B 2ZD1A 3T5JA 3LP0B 1IKWB 3OLBA 5C24A 2IM1A 1RTJB 5I42B 3IGNA 3I0RB 1IM4A 4R5PA 3IRXB 1DTTA 5KFIA 4RW8B 1JKHB 4TLRA 1JLCB 3TQ1A 4LSLA 3C6UA 5KFJA 4O3OA 3EPGA 1BQNB 4G1QB 3GILA 5JXSA 5FDLB 4YQWA 1S1TA 3E01A 4PUOB 3DOKA 4ICLA 4LSNA 4O3RA 3I0SA 3MEEB 1HPZA 2HWIA 5DQGA 5KFPA 3PR4A 3KHRA 4ECWA 3DRPA 1D1UA 5KFMA 2YNFB 1FK9B 4K4ZA 3FDSA 2W7PA 4EO6A 4ECTA 1HNVB 3N6MA 4RZRA 4DL3A 2BE2B 4Q8FA 1N6QA 1DTQA 2GIQA 4H4OB 4XPEA 2D7SA 3MTKA 2C22A 2VG7A 1JLQB 5EWFA 4EBEA 4KV8A 3BJYA 1KHVA 4ZVEA 3V6KA 2BQUA 1EETB 4YR0A 3RBEA 4ZHRB 5HLFB 4IRKA 4KFBA 2F8EX 3HVAA 1SV5B 5J2PA 4MH8A 2AGOA 4WYWA 4O4GB 3OL9A 2B43A 4KAIA 4QPXA 2BANB 5KG1A 4QWCA 5KG4A 1TV6B 1TVRB 5KFFA 4RW4A 1JLBA 2YKMB 3QLHB 3FQLA 5KFOA 2RKIB 2JEIA 1T94A 3PW7A 3DI6B 1K1QA 4NLPA 5HP1A 3M8QB 1YVFA 4K4UA 5DG9A 1T3NA 1JLEA 3KK2B 2ZD1B 4O4RA 4NLXA 1DLOB 5KFHA 5DG7A 3DRRA 5C24B 1N5YA 3UPFA 4EO8A 3NMAA 5DLGA 5F8IA 1NHVA 1C1BB 5KFBA 4K4WA 4EBDA 1RTHB 2VA3A 1KLMA 4KB7A 4MKBA 1GX6A 1RT2B 2R8JA 4IFVA 3KLGA 3DLEA 4WFZA 2AGPA 1MMLA 1HYSA 5KG6A 4TQRA 4R0EA 4XO0A 4LSNB 3PJWA 1JLGB 5D3GA 5DG8A 5KG2A 4J9QA 1RTDA 5KFVA 5KT6A 2W7OA 2OPPB 3MFIA 1HQEA 4MK7A 4Y2CA 3M9OB 3KHLA 4FS1A 4URGA 5KFQA 4IG0B 3LALA 2XI3A 2GIRA 3BR9A 3Q8QB 3GV8B 3HKWA 1RTIB 3SFUA 3MR5A 3KLFB 3SI8A 2IBKA 4RW7A 3H5YA 5C42A 2FLPA 2VG7B 4PWDA 1IKXA 5F8HA 2IA6A 4Q45A 4I7FB 4RW9B 4TYAA 3MEDA 3QO9B 1I6JA 1RT1B 3LP1B 1IKVA 3N6LA 3M9NB 3PW2A 1T03B 4J9SA 4K4XA 3JYTB 1RT5A 4NRUA 4JUZA 1C1CA 4R8UB 1NNDA 2IMWP 4IH6A 1C0UA 1EP4A 4WE1B 4RW4B 2J6TA 3RAQA 3T5KA 4IG3A 4IKAA 4ZVGA 1LWEA 5J1EB 4QWAA 3Q8PB 3ISND 1HARA 2XWYA 4ZPDA 3NAIA 4DEZA 5HP1B 5HROA 2HNZA 4Q0BB 4IH7A 2R2SA 4ED8A 2OPQB 3FFIB 4NLWA 2FVQA 3KLEA 4M94A 1QE1A 2I1RA 3TVKA 2I5JB 2UVRA 1RT7A 3EZUA 1HNIB 1K1SA 5DQHA 5F8GA 1W25A 4MIBA 5DGAA 2OPRA 5KFAA 4MFBB 3IG1A 5KG0A 5L1IA 2ASDA 5I3UB 2E9ZA 3V6DB 2W9AA 1UWBA 4O44A 3TAMB 4RU9A 3H98A 3HVTA 2IM2A 4YR3A 4KHRA 4F4XA 4JV0A 3DYAA 1RTDB 3CWJA 3KLHA 4Q44A 5F8LA 5KFNA 4HYKA 4J9KA 4NLDA 3RB4A 3BSAA 1S1UA 3DLGB 3FQKA 3IGVA 2YNHA 2HNYA 5EWEA 3LP2B 5HBMB 2J6UA 3NBPB 2V4RA 3IN5A 1WNEA 1ZETA 3QIPB 4ECQA 5F8NA 1FKPA 5C25B 1CSJA 3CDWA 5KFSA 4PWDB 1IKXB 4K4SA 4H4MA 4KE5A 2XGQA 3DMJA 3CDEA 2UUTA 2AX1A 5CYMB 1C0TA 5J2QA 3CJ4A 4IQXA 5J2NA 5EWGA 2DPJA 4DG1B 2ILYA 4RW6A 4ID5A 3VQSA 5KFEA 1JLAA 2WONA 4YP3A 2VG6B 3T5HA 2D3ZA 2OPSB 2ZKUA 5KG7A 2B5JA 4F50A 1C0UB 4EEYA 4WZQA 3C6TA 4TY9A 1S9GB 1EP4B 1JLFB 5KFYA 3BQ2A 2V0NA 3UQSA 4WXOA 3NL0A 1J5OA 3CDUA 5J2MB 2BQRA 3DRSB 2B6AA 4I2PA 4ECZA 1S9EA 4KKOB 5KFTA 1S1WA 3H5XA 3MECA 4J9LA 1HQUA 3KJVA 3MF5A 3UDLA 1HMVB 5KFRA 3NGDA 4TQSA 3KMSA 4IRCA 1RA7A 3FRZA 4MK9A 3G6XA 3BSNA 1BQMA 4ECYA 3M8PB 2D3UA 4EBCA 1RT3A 1JXLA 2D41A 3KK3A 4PQUA 1S6QB 3V81B 3DOLA 1S49A 2QE5A 1FKOA 1LW0B 4FBTA 2BQ3A 2UVWA 4ED3A 3IS9A 1S6PB 3I5CA 3IG1B 5CYQA 2IJFA 1LW2B 2FVPA 3KLIB 1VRTB 4ZPAA 4YMEA 4ZVHA 2ZE2A 3H4DA 2JEGA 4QW8A 4ZMMA 3DDKA 4F4YA 3DYAB 3KLHB 2R8KA 1LWCA 2HNDA 3JSMA 1R0AA 1Z4UA 3CJ5A 1S1UB 3I5BA 4NLVA 4RUAA 2C2EA 1REVB 3GIMA 1SUQA 2FLNA 5L1LA 2YNHB 4ZVFA 5KFUA 3KMQA 1S0OA 2UVVA 2BR0A 2BRLA 1JX4A 1TL1A 1FKPB 4R5PB 2IM3A 1DTTB 4DL4A 1TKZA 3KK1A 4LSLB 3V4IA 3C6UB 3OLAA 1S9FA 2E9RX 3OHAA 4B3OA 1C2PA 1S1VA 1S1TB 3E01B 4Y3CA 3DOKB 3ITHA 1RT4A 4ICLB 4ID5B 4RW6B 4J9NA 2C2DA 2YKNA 4KHMA 3I0SB 1RT6A 1HPZB 3CJ0A 4NLSA 3DM2A 5KFKA 5KT7A 3OL7A 5L1KA 4MK8A 3DRPB 4EYHB 1XR7A 3H59A 5DGBA 4RNFA 3DLKA 4I2PB 1QAIA 3MEGA 2IAJA 5DQIA 2J6SA 3QGGA 2ALZA 1N6QB 1DTQB 2W9BA 3QYYA 4K4YA 4I2QA 4ZPCA 4H54A 4KV8B 1BQMB 2W9CA 2BRKA 4IDKA 2YNGA 1IKYA 1D0EA 3RB3A 1S97A 5K14A 4FBUA 4KFBB 3HHKA 4IOBA 4WYLA 2VA2A 2UVUA 3IS9B 5J2PB 4J9PA 3KOAA 1S48A 3CJ3A 4J9MA 4Q8EA 4TY8A 2V4QA 4O3NA 3N6NA 3M9MB 4NLRA 4J9OA 3Q8RB 2ILZA 3LAKA 1TKTA 2JEFA 3G86A 1JLBB 3LP0A 1IKWA 2WB4A 4ECUA 3UR0A 3I0RA 2HNDB 4KO0A 2C2RA 4QW9A 4LQ3A 3MR6A 1JLEB 3GV7B 4RW8A 3QGHA 2XCAA 1JKHA 1MU2A 1N4LA 3CO9A 4ZPBA 4RUCA 3RBDA 3DRRB 2ATLA 5KT2A 1N5YB 2FVCA 4ZP9A 5L1JA 1BQNA 1TL1B 2AQ4A 4NLQA 4ZP8A 1QUVA 3PHEA 1TKZB 1RYRA 4PUOA 3T5LA 4DL5A 2IC3A 3V4IB 1KLMB 3T19A 1ZTTA 4WFXA 1S1VB 4IFVB 3BGRA 3DLEB 3KLGB 3H40A 3SFGA 4ZP7A 3KLVA 1HYSB 4KBIA 2RDIA 3GIKA 1HNVA 5D3GB 4NYZA 3G6VA 1RT6B 1S0NA 1SH3A 2BE2A 2AWZA 5F8MA 3GIJA 1RDRA 1XR6A 4JV1A 2CJQA 3CIZA 1HQEB 2AX0A 4F4ZA 3RB6A 2YNIA 1TQLA 3OSNA 1JLQA 2UUWA 4WXWA 4O3QA 1S4FA 2HWHA 1EETA 1N56A 3MR2A 4K50A 4RW7B 1S1XA 4ZHRA 4OL8A 4DL7A 5C42B 4I2QB 4ED7A 3T1AA 1SV5A 3D28A 2IJNA 2JC1A 2QV6A 1N48A 4O4GA 3MEDB 3FSIA 1TP7A 4O3PA 1IKVB 3BSOA 1TV6A 1TVRA 5KG3A 1RT5B 2FJXA 3PW5A 2R8IA 1S0MA 2AU0A 3DI6A 1C1CB 4TYBA 4NCGA 3M8QA 4ED1A 3KK2A 1OS5A 1DLOA 4IG3B 1LWEB 3H5SA 4KO0B 2RDJA 1S10A 5HROB 2HNZB 4ECXA 4WFYA 3QIDA 1U09A 1C1BA 4ECSA 2W8LA 1MU2B 4GC6A 3PW0A 4Y2AA 1RTHA 2R2UA 3NAHA 4IFYA 3G6YA 3KLEB 1RT2A 4O3SA 1TKXA 5KT3A 1QE1B 1SH0A 1RT7B 2RF2A 2WRMA 5C5JA 3KHGA 1JLGA 2IC3B 2XGPA 2AGQA 2OPRB 2OPPA 5KFXA 2FLLA 1UWBB 3BGRB 2HAIA 4IG0A
chains in the Genus database with same CATH superfamily
2NUUG 4F36A 4A8OA 2Z30B 3GV5B 3M2VA 3CJ8A 2Z0GA 1ACMB 1U0HB 3KUEA 2EC0A 2B3TB 3C66A 1UL3A 1FWLA 3IR7B 2AJQA 2OD6A 1GMWA 2WONB 3J80Y 2FJVA 2WK4A 1LFWA 1TL3A 3FFIA 2N4DA 4RU2A 3KYLA 3S7RA 1SC6A 2UU9J 3AOCA 4UY8T 4IFYB 4DJBA 1VQMS 2KHDA 1HBUA 1YSJA 2B8PA 2HVHA 1MNEA 4C0HA 5JUMA 1NMEB 3GCXP 2ZE2B 3CJ2A 1URNA 1LWFB 4JV2A 1KC8T 2J7WA 2H3EB 2YX4A 1HBMA 1I94J 2F8HA 2P5VA 2L08A 2LU1A 4IYQA 4BC7A 2NZ4A 2IBOA 1X8DA 4WFAQ 1K47A 1FF2A 1HBOB 2JLEA 3LA0A 3W64A 1HMVA 3LOUA 4OJHA 3M8WA 4BWMA 1CULA 4IDKB 4A46A 4EFAC 2DPIA 2E1AA 1TK0A 5A8RB 3W2VA 3D66A 5C24A 1RTJB 1B70B 3IGNA 1IM4A 3ZTPA 3BO2A 4MMOA 4DX8H 1JLCB 1U1NA 1HFEL 2H51B 3CJKB 4Y6IA 4A8FA 1N33F 4UTGA 1B4SA 1AROP 3N6MA 2R7UA 2DYAA 1QVGR 1QVFR 2KJVA 4KV8A 4W92B 4Y65A 1U2FA 3CD0A 1TR0A 3E8OA 4N8NA 2YKMB 2JEIA 3MM8B 1T94A 4I6WA 2HBZB 1N5TA 4NLXA 4DPOA 2CPFA 3FEYB 1AUSL 1BMQB 5BR8F 2DY9A 2XHWA 3K57A 2AGPA 2H5IB 1WJ9A 3HHEA 3OD2A 1TUGB 3EDRB 1PJ6A 1X4GA 2VODA 1NBEB 3K2YA 3KG4A 3VAJA 3MR5A 2IBKA 2XS7A 2UV8G 3M2VB 4ZIVA 5K8MA 2DISA 1ZH5A 2G2YA 1VQKS 2DKOB 3OTOF 2C3UA 2C2KB 3NGUA 3TA0A 2R9LA 1LFPA 4ZVGA 1LWEA 3ISND 3CJTA 4DR2F 3EXCX 3RUBL 3GJQB 5K20B 3FFIB 2BXJA 2B4PA 3SYZA 1IBLJ 2UVRA 3RRHA 2MKSA 4WIIA 2W9AA 4DFKA 3H98A 4YR3A 3MI7X 2M8HA 3M2RA 2LDIA 3BSAA 3FQKA 3IGVA 5IT9Y 1SBRA 3T3FA 3P6YC 1U48A 2KB2A 4I64A 1TK8A 2QL9B 4ID5A 3VQSA 1D9AA 1VJQA 2GQCA 1FE0A 4WXOA 3DXBA 4EK2A 3UDLA 1HMVB 2XNQA 2HGLA 2OKQA 5EGYA 1P9YA 4FBTA 1CULB 4ZCIA 4E2FB 3C3LA 1QSYA 4HDGA 4LVNP 1EAYC 3W2VB 1S0OA 4USJC 1JB0C 4YHHF 4JB8B 3CJ0A 5KT7A 2NCKL 2J7KA 4NLSA 4YB7A 4DXLA 2QA4S 5DGBA 3T41A 2HGNA 5CABA 4KV8B 1WEZA 2MQOA 1NSKL 4O0IA 4J9MA 4TY8A 2JJ4D 3N6NA 4PXBA 3NGRA 5A6WA 4UUXA 1RGVA 2VDHA 2Q43A 3HULA 5KT2A 3LO3A 3PFEA 4WFXA 1S1VB 4GRSA 4C3KA 2EFNA 1HHSA 3KTQA 1RT6B 2MDAA 1VISA 2FJDB 5HL7Q 2NXCA 3FMBA 3HD1A 3T1AA 1R6VA 1N48A 3VAIA 3HHDA 2Q6BA 1TV6A 2QC3A 3Q86A 3W65A 4NCGA 3IMQJ 3VAHA 1MWQA 1LWEB 5AXNA 3QIDA 5KAKA 3PW0A 1N33J 3NAHA 1TKXA 4ZLJA 2HVIA 2I38A 2J0SD 5D0EA 4NPOA 3JQKA 2LQ8A 5H9FJ 2DR6A 2ROGA 4IG0A 4TU7A 2F63A 4NA2A 3FCVA 3M2RB 1OMSA 3R5DA 5ITHA 1H3DA 2W2MP 3R7BB 2DBBA 3CO0P 1RT1A 4LUBA 1BD6A 1JWWA 1T05A 2R42A 1A0OB 3MPVA 4CT8A 4WKRA 5BR8J 1S5ZA 2HQFA 1ZS6A 2E29A 1CC8A 4BC9A 1VI7A 1B64A 2AP6A 2PSZA 4U67Q 1RAJA 1T9XA 4CO5A 1WHWA 2VFSA 4UOGA 1YWXA 2HAFA 2UUAF 3AAWB 1AZSA 4DR2J 3MEEA 1N5QA 4H4OA 4TN2A 2UUCF 4NCBA 4IOCQ 2XY5A 2ZZNA 3ENWA 1EJ7L 2W8KA 1S6PA 2CYYA 4OYZA 5G4DA 1XMQF 4TY8B 4F8RA 1SQEA 4ZK7M 4ZVQB 2GQQA 4ZLNA 4OV1A 1DAXA 3KJQB 3J81Y 1KWMA 1VC5A 2LEPA 1IBKF 2G4BA 2JFKA 3U27A 3OXLA 4JI3F 3V6KA 2PA8D 2MZQA 1FEEA 4MH8A 1FRJA 4DZ6A 5IWAF 2ZVIA 1N34F 1TV6B 1YBAA 3ZZOA 4YHHJ 3NMAA 1VBKA 1K9MT 4PG7A 3MPDA 2YQ3A 3QFWA 2GHWA 1HYSA 1Z2LA 4FXDA 4URGA 5KFQA 4IG0B 2XI3A 2GW8A 3MGJA 2HG4A 2G9OA 1E6VA 5F8HA 2W2QP 3HJFA 1WHXA 2N7YA 5DM6Q 1RT1B 4EWTA 3L7PA 4DFPA 1RT5A 4NRUA 2GQ2A 1YX2A 4M63A 4N5SA 4LF8F 2ZITA 2J6TA 4A8QA 1R7IA 1WC3A 2R7OA 2AJ2A 2B4OA 2L9WA 4UT4A 4M94A 1MG7A 2B4UA 2K3KA 1UWBA 9RUBA 1EIYB 3P96A 4OYPA 4MTPA 5KFNA 3J80U 1QAYA 2IVYA 3W8GA 2V4RA 1FRLA 3O44A 4DV4J 5MLCV 4ZVOB 1UETA 5HVGA 1H72C 5F0WA 3RBZA 3B4DA 3TZXA 3G82A 2B5JA 4TY9A 1WHYA 2FHOB 1UMJA 5KFRA 4IRCA 3FRZA 1BQMA 3N79A 3OFEA 4W4MA 1S6PB 3OTDA 2RRAA 4JV5F 3I5BA 1AA1B 3KG0A 2BRLA 2PMZD 3QRQA 1SJRA 3FJ2A 1N32F 5HSPA 3B8HA 2E5JA 2WSFC 4DF4A 2EPIA 3PY8A 2YKNA 4LR7A 3MPUB 3PJ9A 4MK8A 3H59A 2BOAA 2KKHA 1OWXA 1IJFB 5MAOA 2W25A 3TO8A 1UZDA 2UUAJ 4N76A 2AYGA 1V9OA 2XCAA 1HWLA 3Q22A 3RBDA 3VGSA 2AQ4A 3VQTA 1F9FA 1TKZB 3D67A 5L39A 5IQQA 4A8WA 2UUCJ 3CD5A 4ZP7A 1HYSB 4NYZA 2PDAA 2W2NP 5F8MA 1KONA 3TRGA 1BHNA 1V5IB 3UD4P 2ZM6J 4RO0A 4KGVB 1XMQJ 1SV5A 5A8WA 4LF2A 2A3JA 2HK3A 1SC4B 1JXVA 4J9UE 1RT5B 3CIMA 2R8IA 1U1MA 4KGZB 2YVSA 1RHRB 4LR9A 1VLYA 2B7BB 4UUWA 2R2UA 2OO4A 1IBKJ 5KT3A 3I32A 1FTCA 1UWBB 4JI3J 4F04B 4HI2A 4FS2A 1WG5A 3BDEA 3MTJA 1NK8A 3M6XA 2C2OB 5IWAJ 4P75A 2VQEF 3SXLA 2BKNA 4RUBA 1JMTA 2GMHA 4XK8C 1FWPA 4Q43A 3QMQA 2ZBQA 2N7CA 5HATA 5J1EA 3O3LA 2B5JB 1RQ0A 5KOXA 1D09B 1U24A 4QR0A 5KFCA 2HFOA 4B3SF 3OHBA 1WTBA 3UNYA 1HKAA 3SSRA 3D6FB 5T41A 1KQGB 2MQQA 2WHOA 4DLEA 3CVKA 5A8KA 3CDBA 1U4BA 1RA6A 4FZVA 2XMTA 3T6BA 2HVDA 3QGIA 4LF8J 2FHMA 4RKUC 4NLTA 4F67A 4U95A 1FK9A 3M32A 1FDAA 3DRSA 2YKNB 3FNNA 3F0NA 2FJWA 2XMAA 1ZTWA 1F5AA 2RIJA 3V81A 2CKWA 4OJGA 3FSYA 4QWDA 3TP2A 2MLYA 2BANA 2BJDA 2FJAB 4HKQA 3QLHA 2Z57B 3B4MA 5E5NA 2O01C 3HZEA 3ZZZA 3TQEA 1NDKA 4C6AA 4OI2A 5JXSA 3HI9A 2MJNA 2M7SA 2I6WA 2W7PA 2AJ1A 1UVNA 1AFJA 4Q8FA 4CTAB 1XMBA 2VBZA 5E41A 2BQUA 3ENAA 4JV5J 1M1KT 3OXFA 1RXOB 2KO1A 2V8HA 4DN0A 1SV5B 1Q8KA 2QGFB 4HHJA 2Y1IA 2YY3A 4DQQA 5B0FA 1K1QA 1N0VC 4LF9F 1N32J 3DRRA 1N5YA 3HFKA 2RUSA 1V5VA 5DLGA 2M4MA 2DRDA 2RQ4A 3R27A 5FJ4A 4QU7A 4IFVA 4NI2A 3WQPA 1HQEA 1RADB 2XLJA 5AXMA 1FRXA 4PQAA 3GG0A 3J81j 3D1OA 4TYAA 2ZFHA 4K4XA 1F1BB 2IYGA 1PYTA 3EJMA 2YH1A 1U2CA 3CGIA 4RW4B 4IG3A 4QWAA 5J1EB 1U2RA 1B0PA 5B0CA 4LF5F 1R8HA 4C8ZA 1P1TA 1V3ZA 3N4WA 1NO8A 4WJBA 4RU9A 4ZIWA 2UXBF 4JI4F 4J9KA 1WC6A 3GZ7A 4I56A 1D9FA 4M5HA 1IKXB 1Q5VA 4X4RA 1HNXF 3H20A 5LMUF 4PCQA 1HNWF 1JLAA 2ZJRQ 1SC1B 1ZAWA 5KFYA 2WBRA 3CDUA 3DRSB 3D6TB 3H5XA 3ZXWA 1EARA 3G6XA 5A2QU 5IS2A 3V81B 2QE5A 3CEDA 2VQEJ 5B0GA 1HQ2A 3SV3A 3DYAB 5IFMA 1LWCA 3JSMA 1R0AA 4RUAA 1S1UB 1WDDA 2YNHB 2DR9A 4B9LA 4LFAF 1JJCB 2MQNA 2GA7A 1DHMA 2VFVA 4B3SJ 1I1GA 1NSPA 5JJBA 1WC4A 5KFKA 4DR3F 1G6BA 5F3ZA 1R3NA 2EFQA 1F3VA 1TFYA 3N5BA 4I2QA 4CP5A 3ETOA 3Q8VA 1UVMA 1CS4A 5CD4A 2ZBPA 4DSEA 1QAXA 3CJ3A 4F0HA 1VGYA 2MHEA 5DS7A 1BWEA 3J81U 1Y5NB 4CH7A 4I1TA 5GVQA 4LQ3A 1G3OA 3QGHA 2BX6A 3DRRB 1N5YB 2FVCA 1PYOB 2OEKA 3RRKA 2E5HA 4PUOA 3V4IB 3T19A 4ILMA 2RS2A 4IFVB 2LXFA 1WHVA 2A18A 4NI2B 4LR8A 2HPUA 1HQEB 5HQLA 1S6OA 2HWHA 4WU3A 4DPXA 1TU0B 2FJXA 1F9EB 1GT8A 2MEWA 4IG3B 2XQCA 2RDJA 3HSJA 7FDRA 4GC6A 3J7Z5 4AQYF 1ZAXA 2V8PA 2KU7A 4NEYA 2OMLA 2Y1LB 2XGPA 3BGRB 2IPOB 2WTFA 3HHLC 4KYZA 2VB6A 3K7RA 4OZ1A 2R2TA 4CH1A 5DDPC 2EKYA 3LP1A 3GIIA 1R6YA 2OH2A 1T03A 1BQXA 2XS2A 2F65A 4LF9J 2KXNB 1CPZA 3EPIA 4AL5A 2DR5A 1JLAB 2CPDA 3LANA 4IR1A 1UEVA 4Y2KA 4NRTA 5T14A 1NK9A 3ILOA 4FVMA 3V6DA 2NUHA 4TNOA 3QPIA 3ZZYA 3G87A 3DLBA 1SH2A 2W4CA 4JI7F 2FB0A 4KIAA 1LWCB 3JSMB 1R0AB 3MDFA 3T6JA 4KC5A 5A6PA 3OFGA 1U25A 4UY85 1Q79A 3AJ1A 4U96A 5E7OB 4LF5J 3ISNC 3PNIA 2LVWA 4O23A 2F8MA 1SJ4P 4GKJF 1N36F 3H2UB 2XY6A 4ELVA 3C15B 3MMJA 2VPWB 4JI4J 3W62A 1CS4B 3SBMA 3H8YA 3H25A 1F0XA 1V3RA 1S59A 2FZCB 1HNXJ 5LMUJ 4DR6F 3MWBA 1Q5YA 1K0TA 3BKFA 1HNWJ 4ZS6A 5ETRA 3EZ5A 1O51A 4M5GA 3ILJA 4PUOB 5HMYA 2J9EA 3DGVA 2HWIA 3GSDA 1VQ9S 1Z2ZA 3CCTA 1B99A 2VF3A 3ZZRA 2DVIA 2ZC3A 5J2PA 2XMWA 5KG4A 4LFAJ 4X4VA 1JLEA 2XO7A 1M0SA 2ZHBA 4F7VA 4LRFA 1R89A 3EGNA 4DR3J 1XNRF 1WWHA 5IV4A 2HEKA 4KB7A 4WFZA 4C11A 1EZZB 3NRBA 3BGFA 4LSNB 1TKDA 2RH3A 3NG8A 3TVZA 3KHLA 3Q8QB 4V19X 1CJVA 2IIHA 4FVCA 4G65A 4DX6A 2FLPA 2HLTA 3MHYA 3LP1B 1CEZA 3KWMA 2OFGX 1T03B 3C14A 3TANA 1HI8A 2HFNA 2MMYA 1HWUA 2CQDA 1RU2A 1URRA 4D3GA 3I87A 5F3TA 4JP8A 3D68A 1YKWA 3V6DB 4F4KA 1RKIA 1X0PA 2LXUA 2QSWA 2RILA 2DIUA 2HNYA 1RHKB 2K06A 1UWAA 3L7OA 4ECQA 1OQ3A 3JXOA 1FKPA 4UOHA 2WW4A 3GYGA 4PG5A 2RUGA 3O2IA 4IQXA 3FMWA 4CNZA 4F50A 3HZGA 4AQYJ 2DGWA 3K8WA 2F7VA 3SCLE 1X5SA 1X4EA 2C3OA 1PAEX 2XEXA 1DQ9A 4ZPAA 4ZVHA 2YPZA 3KLHB 1DJ0A 1VBXA 4Z2XA 2ZNYA 4DU7A 4DX5A 4DV0F 2CVIA 3M05A 3KXDA 2DH8A 2CA9A 4B9TA 2ROPA 2IDEA 2YWWA 2C2DA 3OL7A 2OHDA 3CCMS 1XR7A 2G1HA 2DEJA 2M0GB 4JI7J 1S97A 2OSRA 5J2PB 4IUFA 1S12A 4O3NA 1FX2A 1APSA 5E3AA 4GKKF 3I0RA 4KO0A 1JLEB 3HX9A 1TL1B 4DSIA 4GKJJ 1N36J 1VQLS 4DL5A 1NPPA 3TAPA 2GMLA 4C11B 1KTVA 2BW2A 6FDRA 4DLGA 1CJVB 4K50A 1RISA 4DL7A 2HWTA 5ETQA 1TP7A 4DR6J 4O3PA 2VIHA 3UFCX 3PEJA 5IT0A 3C14B 5U47A 2H1YA 2IY5B 3QJJA 4ECXA 2EWHA 2Z2MA 4ECSA 2V2KA 4O3SA 1RWPB 2VU5A 4YB6A 3CMES 2YWFA 2UUBF 4M8LA 3IR6B 2ZBIA 5F9LA 2QYGA 2YNIB 2QMUB 3O1LA 2HNYB 1ICEB 4I7FA 2XYPB 1YJTA 3C16A 4P7TA 2XSJB 1IJEB 2D69A 1PGZA 2ZH4A 4PWUA 4IR9A 4NYPA 1T9VA 1R0CB 3PZPA 1U6ZA 1XNRJ 5HMZA 1REGX 1WOOA 4RNOA 3PRBA 2CJKA 2KM8C 1UVLA 1EKSA 4MFBA 5I3UA 1NZAA 1P9QC 3W8PA 2Y1JA 2JWNA 2AD9A 5CZXA 2XMUA 3MM7B 3RB0A 1BUXA 4WK1A 5E3CA 1KSPA 3KNAA 4U6PA 4QYZJ 1FNMA 2O3DA 4GVBA 1OQ6A 5LMNF 5BYRA 5DRKA 2HMIB 3PO4A 4LQ9A 2NLWA 3CNQP 2OFHX 2KYZA 2G2OA 3RAMA 1L3TA 2J8AA 2VUGA 1UFLA 3QATA 1S6QA 5FLXY 1PBUA 2WOMB 3H2VE 2W2PP 2HVEA 1W2BR 2B9XA 4KSEB 4ZN3A 2FZGB 1REVA 2FTRA 3AOAA 2R8GA 2ZD1A 3G8TA 3OLBA 4FPRA 4O0NA 3I0RB 3QT8A 5KFIA 3M30A 4AUKA 3TZYA 3CCRS 3MAHA 2Z56B 4ICLA 3CC2S 5LL6d 3QNWB 3F44A 4ECWA 4UOFA 2ASYA 1VJWA 5H9EJ 2CQ3A 3ZTOA 4Q5VA 4OIXA 3FBCA 3GCWP 5IQ6A 2OLWA 4DCPB 4QWCA 3MM5A 1JLBA 1Q78A 1WD6A 3AQPA 2E1CA 2AV5A 3UPFA 4FYYB 4B3MF 2CDRB 1VQ8S 4C98A 4X62F 1KLMA 3BB5A 2B9EA 1B7YB 5KG6A 2YXLA 3QQCD 3LALA 2B7CB 5EX3A 3NXZA 5HJYA 4WWSA 4PWDA 4I7FB 4GKKJ 2XS5A 3C16B 1RCXB 2KVQE 4CLYA 4RR5A 4DUTA 2ZH3A 4ZPDA 5HP1B 1U02A 2R2SA 5IZHA 3NGSA 1QE1A 1CJTA 2QJ3A 4MFBB 3IG1A 5I3UB 4O44A 1G1XA 1H6KX 1ITPA 2PEHA 1RTDB 4KQZA 1Q4RA 5LSRA 2KT2A 5F0UA 2CG4A 4I68A 4GVBB 1H0HB 1V6HA 3RRGA 3DOMA 5GMDA 3GQCA 4YP3A 4U9RA 1EP4B 3Q8UA 4J9LA 1NK7A 2UUBJ 3PG9A 1HW8A 4LBHA 1DFDA 1S6QB 4LRDA 2LECA 2IJFA 5I4MA 3LW5C 5AE1A 4LVOP 2HZAA 1REVB 2IA0A 2B4VA 3FVYA 3NWGA 2FY1A 3M30B 2EFOA 5E33A 4B3OA 4ICLB 4WF9Q 3AD8C 1MMNA 2ALZA 4I6YA 4ES2A 2CPJA 3AH6A 2G2ZA 2ZOFA 3MM5B 4ZVUB 1JLBB 2QL5B 2WB4A 5LMNJ 1DARA 3OVAA 4RUCA 2XYHB 2DGUA 4PG8A 1TL7A 3ZZ0A 2GAGC 1K0VA 2ZZMA 1KLMB 1ZTTA 2F9JA 3NY0A 3H40A 1VLOA 2J9DA 4QJVA 3G6VA 1SH3A 5AE3A 3V4MA 2RE1A 4DPYA 3PV8A 1U1RA 5SUHA 1ELOA 3P4UB 5K8NA 2HZVA 4NZ7A 2DTJA 2IJNA 3ONQA 4ITSA 1RI7A 2N82B 1TVRA 3QSIA 3QWUA 1S0MA 2AMCB 4TYBA 3AODA 4CIOA 2YH0A 2EG2A 2W01A 3MMBB 3G6YA 4GO5X 3MMAB 1NRKA 1QE1B 2BJ7A 1CJTB 1JK9B 2RHSB 1KVIA 5C5JA 2GVZA 5HANA 4H4KC 4O44B 2HAIA 3D3BJ 1KHWA 2D74B 4A8MP 3IAM9 3H4BA 1NJXA 2PT0A 2K1RA 3MM9A 1PBAA 3QO9A 3F41A 5K8OA 4ECRA 2BJ9A 5T7LB 3GE9A 4HVZA 2R8HA 2DNMA 2DNNA 2OI2A 4J91A 3VCDA 3DOMB 4CLPA 1YG0A 2XZTB 3BSCA 4B3MJ 3DHXA 2GO9A 4X62J 4ED0A 4U7UK 4IH5A 5KFWA 4TU8A 1R0BG 5C2GA 1HNIA 1XK8A 3GMGA 3TAMA 3PCOB 4P2FA 3HHNB 2PO4A 2RB7A 2LXIA 3CTRA 3SV4A 3MMCB 1X0FA 1FJCA 1OO0B 3P49B 4DU8A 2W24A 2ZJQQ 2VV5A 2F40A 4X66F 3BQ1A 2PA3A 4LRAA 2MPUA 3WC0A 3POTA 2OPSA 2VD3A 1DRZA 4B3OB 3BREA 4ANEA 2JH3A 5L38A 2QFJA 4USMA 2Z8QA 3A3OB 5AJ3F 1CC7A 5D15A 1TTHB 3OSPA 5KFDA 2CFXA 2V69A 3PO5A 1GXLA 4ED2A 2BVZA 3IRXB 4O3OA 4DV1F 5FDLB 2CZ9A 2Q66A 3E01A 2EEYA 1TL7B 2FHJA 4C48A 1HPZA 1D8YA 2WVBA 5KFMA 2KFYA 2LMIA 4EO6A 2LFVA 4ECTA 1OPZA 2HHXA 5BXIA 2YQ1A 3UCZP 3GWCA 4QBUA 4KFBA 2AZ1A 2F8EX 1YRTA 2B43A 2EKNA 1TVRB 2PN6A 4HHUA 4NASA 3BYRA 1YVFA 2NSCA 1T3NA 1Q1KA 3R97A 4K4WA 1IBMF 3AXKA 4OYOA 5D0GA 2R8JA 3ELHA 3T1YF 4XO0A 2Z2ZA 3TAQA 2V8VA 3UCGA 6FD1A 1PILA 2FGCA 1E6YA 2ZOGA 4XTTA 5IV3A 2K1RB 3MEDA 3QO9B 2AJ0A 2RT3A 3IBFB 3KG1A 4KHPF 1C0UA 1RACB 3ZO7A 3FKBA 2DXFA 3Q8PB 1UAWA 3A12A 1H2VZ 1OSCA 4CI0B 2CG8A 3EZUA 1HNIB 5F41A 2KT5A 5F8GA 1TMJA 2D1CA 2CQGA 3TAMB 3QWPA 3AY0A 4JBCA 2CADA 2MYFA 1VC6A 3RG6A 2GJIA 5A76A 2J6UA 2BW7A 5M2UA 3EGZA 1IBCB 4ZA1A 3DN9A 3BM7A 3Q2SC 2DGQA 2CPYA 2AKWB 1OIAA 2OPSB 3D0GE 1WG1A 3NL0A 4I2PA 2YBVA 3DU5A 4LIRA 4TQSA 2D9PA 2IVMA 4CO4A 3OTCA 5CYQA 3PKYA 2D3OR 4YMEA 3BSNA 4NLVA 2XM3A 3TX8A 2G1DA 5KFUA 3HT0A 4BWJA 3R5AA 1ZZFA 2HIYA 4WP3A 3FRYA 2BM1A 3KK1A 1S9FA 2RSQA 5FLXU 3D2WA 2AEMA 3E01B 1YZ6A 4RW6B 1XEZA 1HPZB 1RWWB 2RD5C 2VC1A 3W2WA 1FKAF 2FPHX 2DO4A 3SSQA 3N5FA 3HCXA 4LBPA 5LSLA 2YNGA 4FBUA 4KFBB 1YBTA 3IS9B 4X66J 3Q24A 2QTWA 1U1OA 1FT8A 2HNDB 1EB0A 2NPIA 3CO9A 4OYAA 4DV7F 1FJ7A 1UEKA 4NLQA 1KEKA 3QT5A 4OYWA 3VHQA 1JJ4A 3OFFA 3RR7A 4BBYA 3THTA 1XR6A 4JV1A 3TA2A 4OZLA 1JNZB 5AJ3J 3SCJE 3W5ZA 3MR2A 2MKJA 1E6YB 2E7VA 3D28A 3MEDB 2NZCA 4CM2A 3UDCA 3BSOA 4OJ3A 2GV1A 3PRDA 3PW5A 3DI6A 2R7SA 4DV1J 1BC6A 3OR1A 4WFYA 3S6EA 5SZTA 2W8LA 3AB4B 3A8JA 1RTHA 3HSGA 1IWAA 3U02A 1IN0A 1YBUA 2RF2A 5ETSA 2AGQA 2M8DB 1RBOB 2OSQA 3HFZB 4GMKA 4DL6A 2QX0A 2XULA 5JVGQ 2P6SA 1U7LA 3BO4A 2AYEA 4RW9A 3AA8A 4ENOA 1SKRA 5LXRA 2XYGB 2P9EA 4PXEA 3NEKA 2L9NA 1PJ7A 4I69A 1KFDA 1S79A 2X1FA 2E9TA 2Q1LA 3T1YJ 3T1HF 5DJBA 1YQHA 3TW0A 2YQ0A 4Y28C 4ANCA 1YGYA 3NGKA 1KQKA 3JAMY 2XCPA 5CYQB 2MZSA 5IC4B 3DDNA 4NL5A 4KHPJ 4FYXB 1I3OB 1VIXA 4TXSA 5F8JA 3E2EA 2C2ZB 2NR0A 1YI2S 4ZVSB 1XR5A 3KK1B 2VG6A 2MQMA 3PJXA 3M2UA 4U7UD 4DI6A 1I94F 2RVJA 3LQVA 3DCAA 1R8PA 3BKTA 3N01A 4OJ1A 1VRUB 4OYIA 3MOZA 2CJXB 3RAXA 4ED6A 3MAAA 1LQ9A 4DL2A 2YNGB 2F4VF 2RKIA 3AFGA 3CCES 3WIVA 5B0AA 1Q86T 3PEHA 3EM1A 2AEFA 4TLRA 3TQ1A 1X9WA 4G1QB 3BN4A 1S1TA 3NCRA 1TFWA 2CIMA 2RRBA 5I3QA 1CVJA 5HAOA 4JI8F 4DL3A 1N6QA 2QA1A 1OSDA 4YR0A 2CXEA 2FJBB 2W7AA 2IFXA 2DNRA 1MWZA 1EHWA 4USHA 3W66A 3D54A 3PW7A 3DI6B 4NLPA 3W7BA 4K4UA 5HI7A 1FI4A 1RAIB 4DR1J 4P52A 3OR1B 1RTHB 1KN6A 1GX6A 3CCWA 3H42A 4OFZA 2CQ2A 2GIRA 3Q23A 3SI8A 4CCHA 3J7YU 2JFDA 2IA6A 2GCFA 4RW9B 4Q45A 1U6BA 1GH8A 1I6JA 2LQ5A 3QSYB 2CVEA 2EG1A 4DS4A 3TX0A 2HHHF 1HARA 3BS9A 2AJFE 5HROA 2HNZA 5ETVA 2IHR1 4NLWA 2KZMA 2XNRA 3KLEA 1G2EA 2DNPA 3NNCA 5H1SV 1FO1A 4V1Ak 1H98A 3NMRA 4DCOB 1IBLF 3CWJA 4LT6A 4K2JA 4JI6F 1RAHB 1HIYA 3TZWA 1VQ4S 2AX1A 1VK3A 2VG6B 2A6OA 4RL1A 3JSYA 2Y8YA 3M2UB 2ZH2A 4ED5A 3TYTA 3PYEA 4LJMA 1S1WA 5DDRC 4ELUA 4P74A 5BYQA 1NHKL 3KK3A 1UKUA 4MKVA 3DOLA 3MAAB 1PKUA 1AB8A 1HD0A 3CJ5A 1PIEA 2DHGA 1TUVA 1IWGA 4PEOA 1NZ8A 4QIWD 3UR3C 2YWGA 4F0KA 1S1TB 1W7WA 3T1HJ 5E3QA 2X1BA 2DHXA 2I0XA 5K5MA 3BKUA 1C4CA 4TLQA 1N6QB 2YKQA 1VC0A 2E66A 4C8LA 3ZTRA 5AXKA 2N3OA 2ZC4A 4IOBA 1Q7LB 2R7RA 4Q8EA 3Q8RB 2VDIA 3UR0A 1FFSB 3MR6A 5HMXA 1ZM4A 2RQMA 1RWOB 3QT7A 1QUVA 1Q8BA 2VJVA 2IC3A 2CNOB 4ZKAA 1QM9A 3CJQA 2AX0A 3CSKA 2UUWA 1SPBP 2F4VJ 3VGUA 4USUA 4BHQA 4Z37A 1VCTA 1RBLA 5J1PA 3M8QA 2BJEA 3KK2A 1P27B 5B0BA 2ZH1A 4CLZA 1YRXA 3GTYX 5HROB 2HNZB 1MU2B 3R5GA 1D9DA 1HA1A 3KLEB 1UFWA 4JI8J 1RT2A 1WEXA 2CQ1A 2EK6A 1VYAA 1T3OA 1DBDA 3A3PB 3EVMA 2YX1A 3SSSA 8RUCA 3OW2R 3K5NA 4OHVA 4EYIB 4FDFA 4URQU 3MEKA 3HHLD 4N77A 3WBZA 4B9MA 1S1XB 2QEXS 3QRRA 3B54A 3DDIA 4DPTA 3OJSA 4MAKA 1YTYA 2D3O1 4M5NA 2OPQA 4PZVA 1S1WB 4NX9A 3QT6A 3ENQA 1FRKA 3KK3B 4U7CA 4AL7A 3DOLB 1GXTA 1M5HA 4WKYA 2WVDA 2H4YB 1ZOTA 5HQ8A 4YB5A 2VG5A 3BBCA 2LKZA 5B0DA 5HBMA 3IBCB 3HHLA 3HJVA 1MN7A 3R5CA 2HHHJ 3Q8YA 4L73A 4OI6A 5ETNA 1S9GA 2YNFA 3ISZA 4DL0C 4ZVTB 2FVSA 4NYOA 1K44A 2XMKA 1TL3B 4EZ9A 4P6QA 2E1MC 3I55S 2KVIA 4CO1A 1HBUB 4JI6J 3AB2B 2QLWA 4J90A 1RHUB 3GSIA 1WKJA 1NLKL 1H38A 1DTTA 2BUNA 3BO3A 3GFHA 5KFJA 2BBEA 1HBMB 2BJ1A 2FD2A 4YQWA 1K8AT 4OI4A 1YITS 4DSLA 2VFRA 1D1UA 3FDSA 4N8OA 3S1TA 5D4PA 4DX7A 2V34A 2VG7A 4OZNA 4EBEA 5B09A 4DR4F 1GFWB 2Y0SD 2M3DA 4KAIA 3M8QB 1RAFB 3S01A 2MZ1A 1XN9A 3KK2B 1UVIA 4RWXA 5DG7A 5C24B 2JLGA 2YPYA 1K73T 1P8GA 2DRAA 3P8BB 1RCOB 2MKKA 1RT2B 1P6TA 4X64F 5IM0A 4M5DA 1NPRA 3GV8B 3AD7C 2DR8A 3X1LB 3TOQA 3UN3A 4ELTA 4HHHA 4F2RA 3TARA 3ILLA 1AW0A 4JI2F 2YKAA 2DGVA 1NNDA 5C7PA 3RAQA 1BWVA 2DGOA 3GR1A 2OPQB 1FFGB 2JX2A 1YJVA 3OUYA 1RT7A 4CLUA 4MIBA 5DGAA 3GP9A 1JJHA 4AFFA 5L1IA 3A8IA 1U1LA 1HR0F 4IQMA 2MKCA 1RTZA 3QAUA 2HYIB 1X5PA 3RR8A 1WNEA 5HBMB 3HHLB 4XDCA 1C0TA 4CLLA 1LKZA 1MWYA 2ZKUA 4DV4F 3EYZA 1S9GB 2GNKA 3BQ2A 3JAMU 2ZVSA 1Q0NA 2BQRA 1S9EA 3IM9A 4XAKA 2JRSA 2HURA 4CO0A 2MGZA 4ED3A 3EICA 4ZMMA 3DDKA 2HFVA 2X3GA 5D8HB 3R7SB 2HVZA 3D9BA 1KP6A 5CQGA 4JI0F 1WF2A 1DTTB 5FD1A 1Q95G 2V63A 1WSVA 2V9KA 5ETTA 1C4AA 3JSBA 1FVSA 1TMMA 4ID5B 2VPZB 4EYHB 1NXIA 4WP9A 1FRHA 1NK4A 5GAEI 2HHVA 2XMVA 3BGOP 3EDQB 1IKYA 3CCVS 1SI9A 2F5GA 3G8QA 3IA0A 3LWMA 1S48A 4WBFA 1O5JA 5ADZA 3G86A 3KDOA 3MCMA 4QW9A 1N4LA 1H7XA 1CQNA 4C8KA 4A8YA 4JI5F 1RYRA 3T5LA 2ZHAA 4B9UA 3GIKA 5IM0B 1HNVA 1PCAA 4M5DB 4FP9A 4OV6A 4F4ZA 2V5HG 4HTJA 3F56A 1S4FA 4RBUA 3VAMA 3AD9C 2ZM6F 5KG3A 2AU0A 7FD1A 1QJHA 5HMWA 1Q81T 3CT9A 5B0EA 1BXNA 2HRYA 3AOBA 4Y2AA 3KJNB 2E5IA 3OUYB 1SH0A 1RT7B 2DNYA 2H4WB 3EZOA 3CMQA 4RLEA 2I2YA 4ER8A 4DQSA 4DR4J 3NGTA 4NLGA 4CLWA 4GC7A 3NKYA 1OY8A 1WI8A 2RHQB 2N4CA 4DBQA 3H5UA 3EXYA 4KH0B 4ZJLA 1C0TB 1HWKA 1YZ7A 3E51A 1T7PA 4NCGB 2XI2A 3O6QA 3H2LA 2EBGA 1XJWB 5LXYA 1S9EB 1L3UA 4X64J 1FWKA 4URSA 1G7CB 1T9UA 3I5AA 1TKXB 3ZTQA 2Y1RI 1TAQA 2MGZB 1U26A 2E1RA 3ICLA 1T9WA 2RJZA 4I67A 1JIHA 4ILRA 3UE2A 5I42A 1PC5A 2KZZA 4JI2J 2IDLA 1FCAA 3IWXA 5CYMA 5ETPA 3EX7B 3QZ7A 4X2BA 1T05B 4YDDB 1W2IA 5I3PA 4K4TA 3VV2B 3EGWB 3M8SA 1SIZA 2AF6A 1B0VA 2BKPA 4UF4A 3CB4A 4QOTA 3D1QA 1HR0J 5HLFA 3HM9A 3OL6A 2V50A 5DLFA 4L3KA 4G3IA 1IKYB 1NK0A 3HVWA 2RNEA 2YX7A 2GC8A 1ZPWX 2VQFF 4NA1A 1I5OB 3NLCA 2FQQB 1MW7A 1ROFA 3US5A 1Y9OA 1AZSB 2Z58B 3MEEB 3KHRA 5KFPA 4A8KA 3LF0A 1HNVB 4H4OB 3K58A 3MTKA 1VS3A 2DNLA 1RLDA 1VQOS 3CF5Q 3SQGA 4AYBD 4LSZB 3FQLA 4JI0J 3OFHA 2OTJS 5DG9A 1FERA 2HHWA 1PYSB 2EXUA 1U6FA 1S57A 2DXDA 1RU1A 1YHQS 1Q8LA 3CDAA 5KFVA 4DPUA 3SDEA 4OX9F 4Y2CA 2HGMA 4OQJA 2RRNA 3P5BP 3UWTA 2F3JA 3HF5A 3FBEA 5IXUA 4DFJA 5LT5A 2PE8A 1KNZA 2H54B 1X4FA 2KG1A 3GFXA 3T5KA 4JI5J 1IQZA 2F9DA 1YDLA 3CXCR 4A8SA 3ET6A 4BLGA 3PX4A 1QLNA 3LPYA 4PYDA 3MURP 2HBQB 4DWIA 1HHQA 4KHRA 4JV0A 2CJBA 3R5JB 2GIFA 4OI0A 1T9YA 3DFEA 1E6VB 1RWXB 1NK5A 5AT1B 4HLBA 3CDEA 1M5KC 2UUTA 5CYMB 3A8KA 3TUZC 3T5HA 2X51A 4C8YA 2V2VA 2XHCA 3R5BA 1S7HA 4KTQA 1YJUA 2KXHA 5KFTA 1SIWB 1VDHA 1WC1A 1RA7A 4ECYA 3MCNA 3P3DA 1FKOA 2KM8B 1Y3JA 3I5CA 2CAJA 1QSLA 3FK4A 1KRPA 2JEGA 4F4YA 3EUNA 1Z4UA 3VAFA 5DZ6A 3GIMA 4QIGA 4DSFA 2FLNA 4YOEA 3KMQA 1RB0A 7AT1B 4QIVA 4DL4A 3KNGA 4YUDA 3MCSA 2PI4A 2QG9B 4Y3CA 1MN9A 2HHQA 3G82B 4ETXA 2H5EA 3DNCA 3O5TB 2J76E 2OTLS 3LGHA 5IT9U 4RX6A 2W9BA 2QLXA 3G96A 1RP5A 4K4YA 4X4TA 1BQMB 3P5TL 3IWNC 2UVUA 3SQGB 4J9PA 2GS8A 3UD3P 2NQPA 2ERRA 2JEFA 2MY7A 1N54B 2CZVC 4M5LA 1VR6A 3UDEA 4ZPBA 2CNNB 1S7IA 3RU0A 1XBWA 5L1JA 3OTEA 2HKEA 1MMDA 3PDNA 1HD1A 1N5VA 4KBIA 1RDRA 3SDEB 3OSNA 4OI3A 2V8GA 4WXWA 4O3QA 1PG5B 4F3MA 1M5VC 4X4UA 2E5LF 4DQPA 3OT9A 2VQFJ 2QMWA 2A2CA 3OR2A 1SJ1A 4E0DA 1J27A 3RTVA 2J0XA 1VQ5S 1C1BA 4IO9Q 4IFYA 2CQ0A 2XZDB 4UZBA 3W5XA 4F2SA 5E3RA 5KFXA 4I4BA 1QAJA 1KOOA 1SQFA 3KLFA 1LWFA 4B9VA 4FXWA 3B82A 4P2MA 1WG4A 2ZH8A 4M95A 2BM0A 4LRCA 1RWMB 4FF2A 4USVA 2FZKB 1TUWA 3NP5A 4ZP6A 5A8WB 4J9RA 2DXEA 4OZ5A 2XZWA 2WB1D 3KHHA 2VJUA 4X65F 4RNNA 5HJXA 3TJ8A 3V5RA 4DV3F 2CPHA 2GX8A 2VKRA 4HACA 4OX9J 2NREA 2J0WA 1FKOB 3SMZA 1XTZA 3R1HA 4NLOA 4XPCA 3LP2A 4Y34A 3NBPA 4H4KA 1RTJA 3PIOQ 1JLCA 5K9FA 2KXFA 5H9FK 3BGUA 3CJKA 4WTOB 2VFUA 2GFFA 2N3LA 3D1HA 4MKYA 1NHUA 2RQCA 4RNMA 4U8VA 2ROEA 1GK8A 1VQYA 4WZMA 1HNZF 2DNHA 3I4HX 2JC0A 2W9BB 2XLIA 1LW0A 1IUJA 4FPIA 3A1YG 1LW2A 1KVJA 2DCUB 2YKMA 2JEJA 3MXHP 5A8KB 1NB7A 2R7WA 3G9CA 1EX8A 4AXIA 3R7NB 3HXMA 1WOSA 2RDDA 3P45B 2XMJA 1T95A 4P9SA 1L3SA 2KL8A 2U2FA 4USWA 2XLKA 3DRPA 4P7VA 4C4WA 1FK9B 4K4ZA 3M32B 4XIUA 1OPIA 4FNHA 4UW2A 2D7SA 2POKA 1SJ3P 3MCOA 3CW2C 1F5CA 1JQGA 4Z7YA 2NXEA 1F3FA 3IO1A 3OR2B 2BANB 4ID8A 3GPAA 3QLHB 3W9JA 2VL1A 2VONA 3FEZA 5LSOA 1HL6A 4DQIA 5GAHU 6AT1B 2E1PA 4EMDA 3CJRA 3J7A1 1C1BB 4EBDA 4NWBA 3R6LB 3RJMB 3ULHA 3CPWR 5HQMA 2HHTA 1W26A 5KT6A 2W7OA 3MFIA 3R3TA 4MK7A 4WU2A 3L3CA 1FXLA 3KLFB 5C42A 2ADCA 5E0OA 4UQGA 3N6LA 4PG6A 2ZEJA 2EC2A 3PW2A 1X9MA 2HS3A 1SJQA 2Y0BB 2HQ3A 2GZOA 1X7VA 2XWYA 1UFKA 2COLA 1ZAVA 1RJJA 4HACB 2CJ9A 1W25A 1VMBA 3WHIA 2HQGA 2L48A 2DH9A 2ZWOA 5J1NA 2IRYA 2E5GA 5GMKa 2AEJA 2E5LJ 2EW9A 8ATCB 4RPFA 1O8BA 2HRTA 2QA4G 4DN9A 3LP2B 3NBPB 3GYXB 2UXDF 1M90T 3K17A 4H4MA 2UV8A 1T02A 2OD4A 1NJWA 2W1BA 5EWGA 1V3SA 2FUG9 2W2OP 3C6TA 2BE9B 2Q79A 3OTBA 3UO0A 4G1PA 2I8EA 3W3SA 4CO2A 3U7JA 1LW0B 5JVHQ 2QMXA 1LW2B 2FVPA 3CCJS 5CZVA 4QW8A 1VQPS 3TJ9A 2UVVA 2CJAA 2WSCC 1JX4A 1XIQA 5DDOC 4X65J 1C2PA 1S1VA 2B0GA 3VVUA 4DV3J 2ASLA 2IVFB 2LEAA 4Y00A 4Q7AA 1RT6A 3HDSA 1TL4A 3DRPB 1MROA 2ZUGA 4ZN1A 3VF0B 3R2CJ 5DQIA 4YY3F 3QGGA 2VH7A 1RWVB 4UOCA 2EBEA 3KOAA 3UN5A 1NH8A 1M5OC 3LP0A 4ANDA 2A0FB 4OYBA 1UEUA 1Y7PA 4DZDA 1RABB 4B08A 4ZP8A 2HIQA 1HNZJ 3O8WA 1SKWA 2CJQA 3CIZA 4FYVB 3RB6A 2PC6A 5C42B 4I2QB 2C3YA 4O4GA 1XQIA 1RLCL 2QLFB 5M2PA 3NS5A 5CAAA 1KFSA 2F1FA 4QPTA 4DR7F 1ZM2A 2YWKA 2BEFA 3VGTA 1X4AA 1R8AA 1FJGF 2WRMA 5BJRA 1Q8IA 2BV3A 5DM7Q 2JVOA 1RTIA 4HH1A 1RYSA 1YK9A 4NLUA 3TWZA 2X1GA 4NLYA 4K4VA 5LJ3Y 2DB1A 1NKEA 4H4MB 4RWWA 4PR6A 2XTJP 4QIFA 4N41A 2WW8A 3CJSA 2FGOA 3V2UC 2P9CA 3C6TB 3GYNA 3QFHA 2ZZTA 3EVOA 3U1NA 3VR1A 3W9IA 3EVWA 2Q6CA 3VZHA 2I5JA 3U1LA 4ZJOA 2LDYA 3MUVP 1N52B 2HHPA 1YJ7A 3DLGA 3IAS9 3NCQA 1DZ5A 2ALYB 4J9VA 4A4JA 1F5BA 4B02A 4CDIA 4OYMA 5HK4A 1Y11A 2V9WA 4YS2A 1SXLA 5EDWA 3MR3A 1BGXT 3HKZD 3QZ8A 4EGLA 2JOQA 1FTRA 4HR2A 2LEBA 1MROB 1XMOF 3OL8A 1Y00A 1GXUA 2LCWA 1WKLA 2WCXA 3UVJA 3Q8SB 4X4OA 5ETOA 1VRTA 3PW4A 2UXDJ 4J5OA 3GIRA 1YJWS 1KS2A 2X1AA 3LP0B 4J37A 2H9ZA 3K5PA 4Z7CA 4RBVA 2ZH7A 4ZLLA 4W90B 3THVA 2NYHA 3H7HB 1X5TA 1ZZNA 2EK1A 3W60A 3PYDA 3HP6A 4XPEA 1HHTP 1LOUA 1VQ6S 3NNHA 5LOQA 1CG2A 1RHJB 4WYWA 4O4GB 1SCJB 2VHGA 4USIA 3ETMA 3MUMP 1PSDA 3DRYA 4DV2F 4OHWA 2CPEA 1UP1A 1NKBA 3AJ2A 4F0MA 5F8IA 4BS2A 5KFBA 3NOGA 4ZCLA 3B6BA 3T9ZA 3ZFVA 3G2XA 2JNJA 4YY3J 3PJWA 5D3GA 4AD6A 1HLWA 1FVQA 3LGMA 1RTIB 3OQ2A 5L9NA 4RW7A 2WZ1A 2DD8S 3OTOJ 5A2QY 1Y5LB 1WOPA 4M5JA 4LBIA 2JHEA 3MM6A 1KOHA 1N0UA 3C8YA 1C1CA 2NXNA 4NXMF 4DEZA 4FF1A 4EUVA 1UW9A 3DC2A 2MQLA 1B0TA 4ED8A 2FVQA 2I1RA 2I5JB 3SQOP 2OPRA 1N88A 2DRBA 1RHQB 2R7XA 2E9ZA 4C8MA 1NM2A 2XB2D 2PEBA 1SVDA 3HVTA 2IM2A 1XC9A 1AYEA 4HYKA 3RB4A 3DLGB 5IT4A 3IN5A 4R25A 2CNKB 2HK2A 4LREA 4N56A 4A48A 4HEA9 3GJRB 1SL0A 5J2QA 1VQ7S 1FRIA 3M8YA 4L74A 2HBYB 2ILYA 2B8QA 4DR7J 5KG7A 1VFJA 3EWGA 4NZ6A 3CE8A 5GAGU 1FJGJ 1CJKA 1HQUA 3KJVA 3I31A 2D3UA 2D41A 3UVJB 9ATCB 1P1LA 1UJ6A 3SZ2A 1VRTB 3BV8A 2OELA 2MY8A 4X4NA 3NCPA 2UP1A 2RU9A 1AUDA 2BR0A 1I51B 1WUUA 5D4LA 2QL7B 1FKPB 2IM3A 1TKZA 4P73A 2PD1A 2HHUA 4LMZA 4OI1A 4HT5A 2IAJA 4P10A 4MT1A 3QYYA 4ZPCA 1D0EA 1UPPA 3RB3A 3HPOA 2VICA 3FBFA 3VVTA 2IYIA 1R8CA 3AA9A 3DGPA 2V94A 2J8SA 2C2RA 3IWLA 4Q2LA 1JKHA 2BMBA 3G6ES 2ATLA 2VASA 1ZA1B 2MLZA 2XSFA 1NDLA 1XMOJ 2KFNA 1LEOA 1X4HA 2XWXA 5EN1A 2EI5A 2DNZA 5D3GB 1S0NA 4RUHA 2F4FA 4RW7B 4OL8A 2ZOMA 1FD2A 3SCIE 4GVLA 1S4EA 3FSIA 5HVFA 3MM6B 1UA0A 1Q82T 4ZPTR 2DJWA 1VIOA 1C1CB 1WORA 3Q2TC 4K7QA 1FESA 1NJZA 4CZCA 1NB2A 4KO0B 4QQBA 2EVZA 1NK6A 1Y0HA 2B56A 2XBPA 1IR0A 1R31A 1JLGA 2HZCA 5GADU 1QDUB 2OPRB 3K5LA 2OPPA 3K89A 1LV5A 1DQAA 2V2QA 4TKTA 3HVTB 1SKUB 3M6WA 2JL9A 2QA2A 3M8ZA 2SXLA 4PABA 4G1IA 2B51A 2I9SA 4DV2J 3LUYA 4OLPA 3I96A 5J2QB 2BACA 2K8GA 5KFLA 3QJPA 3HO1A 4B9NA 3TEHB 2O5DA 2ZDPA 2CPZA 1CJKB 4C3MA 1HQUB 3KJVB 1G4CA 2RU3A 3W63A 2V4JA 3C46A 3QGPA 2MZRA 1FFWB 5C25A 1U8SA 2DHHA 1H7WA 4NXMJ 3F73A 2WVCA 2APOA 4F3OA 4USTA 3J7YI 2BDPA 3FEXB 3PR5B 4WFBQ 1CJUA 4QR2A 2GHVC 5J2MA 4KKOA 5KFZA 1WF0A 1L3VA 4CTAA 2IAJB 2X3DA 4MIAA 3Q83A 1RKJA 3NS6A 4Y2IA 1BE4A 1D3WA 3DGPB 2CRLA 1FDNA 4R5PA 1JKHB 4WTYA 4NMLA 2FIUA 3BZQA 4ZJQA 4ZOSA 2VBWA 4DUZF 5DQGA 2J7UA 3MOJB 2GIQA 2C3PA 1HW9A 1SB6A 1N34J 5KTQA 2ZHOA 4YFUA 2HFUA 5FIIA 3E3XA 4RW4A 5KFOA 1FNOA 2YKPA 2ZD1B 4O4RA 5KFHA 1R27B 3PX6A 4UQTA 3DXSX 2QRRA 3KDNA 4NEZA 4ED4A 5D0RA 2VA3A 4KRWA 3KLGA 2Z2YB 1PO6A 1JLGB 2AHOB 1YLXA 2VBXA 5KG2A 5DG8A 2OPPB 3GJSB 3H5YA 2DHSA 1IKXA 1EQMA 3TEGA 2UXCF 2C42A 1WC0A 4CT9A 1IKVA 2HW3A 4C97A 1FD8A 2O1PA 1HI0P 3M6VA 5RUBA 4ALZA 2A2DA 1F60B 4IH7A 1QSSA 4NA3A 2A1BA 3R8YA 3Q0AA 3KKFA 2G0JA 2V4JB 2FHKA 3DYAA 4AE5A 4ZPWR 1S1UA 2K2PA 2YNHA 1IR1A 1ZETA 2VKZG 2AJ4A 5C25B 4PWDB 4KE5A 2LA6A 5J2NA 3VWSA 3M6UA 3N28A 3G71S 2D3ZA 1LK5A 1CJUB 2RMLA 4LRBA 2V0NA 3G8SA 1J5OA 5J2MB 5GMEA 2FLOA 4KKOB 1UW4A 3MF5A 3KMSA 4U8YA 2ABYA 2CQHA 1JXLA 1S49A 2XY7A 2UVWA 3QJLA 3IG1B 3R9LA 2FY8A 5BYSA 3KFWX 3D4JA 1JNRB 1A7GE 4QCLA 2YWEA 2BJ3A 1HWIA 1XNQF 2K3IA 1Y4ZB 4AL6A 4R5PB 3V4IA 3OLAA 2QO3A 1FDDA 3DM2A 3DLJA 2DGXA 2FC9A 1QAIA 3IRWP 2J6SA 1HWJA 1AT1B 3RGIA 1FRMA 3M9MB 4NLRA 2ILZA 3GV7B 3TNVA 2MTLA 3H0PA 2O66A 3HSDA 2W4DA 3KLGB 3BGRA 4ERDA 4E8UA 1NKCA 3UI3A 2BE2A 1Q7YT 1OJ4A 1ULRA 2JC1A 1QTMA 4GO7X 1IKVB 3CULA 1J2VA 3FCWA 4ED1A 1OS5A 3H5SA 4DUZJ 4FKYA 4RJVA 4L75A 2VZ9A 2PMWA 5K8PA 3RYLA 1T8EA 4YN3B 3MPYA 1RAEB 4DOZA 3J7AN 3LPEA 5CA5A 3MPWA 1GEHA 4QWBA 2G0IA 4N47A 4WE1A 2FVRA 5EUHA 5J2NB 3K0JA 1LWXA 5KT4A 3C15A 1J5OB 4EU0A 4ECVA 2Z4PA 3JS9A 1VHIA 4PAAA 4L6V3 1DY3A 1NDPA 3MZIA 3IFEA 1TELA 5ETMA 2MB0B 2E44A 2GVZB 8AT1B 2UXCJ 1WDTA 4M1KA 3D5MA 3QIPA 1FJEB 1DURA 3MM9B 2KRBA 4NCAA 2CWXA 2KTQA 4DG1A 2ZWPA 2C3MA 3CC7S 4M5MA 2MQ8A 1JLFA 4LFBF 4OLOA 2PGCA 3DM2B 1S76D 1M1GA 1SC3B 2AZ3A 2KHCA 5KFGA 2WBMA 2BJ8A 3AT1B 3PHTA 1TL5A 1VQNS 2KDOA 3LH2S 3KLIA 3I9V9 1S6UA 2UZAA 3ZNUA 1U1KA 1CLFA 3T5JA 3NOCA 4F02A 4QU6A 5D78A 3QRPA 4F3QA 3C6UA 1IR2A 3VAKA 4LSNA 1QTNB 3POTB 3PR4A 4MJKA 1AXQA 3TUIC 3M7VA 4BDPA 2BE2B 5L8RC 1DTQA 4QYZK 4G6VB 3BJYA 4ZVEA 1ZPVA 3FCHA 3BN7A 3HVAA 4QR1A 2AGOA 2RS8A 2GJFA 1KQFB 4QPXA 3BBFA 1GAOA 5GAEU 1XNQJ 3HMJG 2BA9A 2LP4A 3ZZUA 1SJFA 3SEOA 4ZITA 3VZIA 1F6TA 4CO3A 1Y10A 3I56S 4C8NA 4DR1F 1MMLA 3M8RA 2KH9A 1HI1A 1QUPA 3BR9A 1RUSA 2L9DA 4OX6A 2MZJA 4HTIA 3OVSA 3G4SS 3A13A 1FXRA 3PACA 3W5YA 4WE1B 3DHWC 5H9EK 4IO1A 4L76A 3NAIA 4NE9C 4CWBA 1ZYQA 2MJUA 3PYFA 2UXBJ 3TVKA 4ATNA 1K1SA 5DQHA 1RAOA 2JDJA 4DMZA 3HLUA 4F4XA 1WF1A 1S72S 3KLHA 4Q44A 5F8LA 1Z1ZA 2M2BA 5AE2A 3QIPB 5F8NA 1CSJA 4NOHA 3IBWA 2AT1B 2AIRB 2CQCA 1X4DA 2DPJA 1YRUA 4DG1B 5KFEA 4EEYA 1C0UB 4C2MA 1JLFB 3UQSA 1YJNS 3MECA 5EX0A 2WAQD 4MK9A 2HHSA 1RT3A 4PQUA 2J9CA 2GMJA 3I82A 4P72A 4V19J 3KLIB 3C19A 4M5IA 3GFZA 2R8KA 1KTQA 4P2SA 1UVJA 4CLTA 1RHMB 1TL1A 4HI1A 2Q3PA 3C6UB 2E9RX 3UNGC 1RT4A 4OZ0A 4QYRA 2DGSA 4DV6F 4JYAF 2M70A 3TR5A 4RNFA 3DLKA 4I2PB 2AYMA 1DTQB 2ZH5A 2W9CA 4C8OA 1S0VA 1S77D 4ZDNA 3HHKA 2IRXA 4DF8A 4J9OA 4F26A 4CM0A 4ECUA 4AT1B 1FA0A 2DO0A 1X9SA 3R6GB 4RW8A 1X4CA 1EKRA 1BQNA 2JZ5A 4LFBJ 4DUYF 4MYTA 3GU0A 2DIVA 2WVEA 3SFGA 1MSWD 2AWZA 3HD2A 3GIJA 2YNIA 3W2WB 1N56A 1EETA 3S8SA 4ZHRA 2NXUA 2XSJA 2OIHA 3MR7A 1NUEA 1N5SA 2J0QD 2YTCA 1NDCA 1RAAB 3CUNA 1XERA 3QAEA 5HVHA 4LF4F 5CCLA 3L4BC 4DPWA 3DLLQ 1T9TA 3KHGA 2VPYB 4CQ1A 2FLLA 3PRVA 2QSFA 4JI1F 3MM7A 2ZDOA 1KR4A 2ZJPQ 1ZA2B 3MAQA 2GHPA 2QLBB 2IM0A 2MSSA 2KFZA 5F9NA 4J7CA 3BBBA 2M9KA 3CD6S 4FXVA 4EI2A 4F4WA 2HMIA 1VHFA 3CC4S 4QWEA 3BPSP 1FNXH 3OPKA 1T0TV 1BY9A 1GX5A 2GVDA 1WSRA 3MECB 2MSTA 2VOOA 2WOMA 1RT3B 3WIUA 4PQUB 1GTEA 4PXCA 2RF2B 1L3KA 1SKSA 1NJIT 3W61A 2PFDA 4P2XA 3CCUS 1X4BA 3GR0A 3GJTB 4K2XA 1B3TA 2LU2A 1RT4B 3PVXA 4X4SA 3DLKB 3PFOA 4Y0FA 2OMOA 2W9CB 1OYEA 4HDHA 3CCZA 2HFSA 2ZBCA 2FYXA 4PXDA 3PKMA 3VTIA 3SCKE 3JTPA 4IRDA 4MIWA 3CCSS 1RBAA 4RW8B 3ZC4A 4WPAA 1M5SA 1BQNB 2L41A 3N0VA 4O3RA 3I0SA 1OY6A 3HVRA 3ZNJ1 3Q89A 2R7QA 3K8VA 3VALA 4RZRA 1KVKA 2XO6A 4WK3A 4N7TA 1KHVA 1EETB 4ZHRB 3PIPQ 2KRRA 2RKIB 2NXJA 1UPMB 2HRUA 4C9DA 5HP1A 4PWWA 4EO8A 3I4PA 5AXLA 4DV6J 4JYAJ 3LTOA 2LQ9A 5C2CA 2HBRB 1RTDA 4FS1A 4LF7F 3HKWA 1HBNA 2HQDA 4S0MA 3A4TA 3VAGA 3UDVA 4KY3A 2NYIA 1EP4A 4DUYJ 4IKAA 2QZ8A 3FSXA 3GFYA 2CQIA 1FXDA 3I9ZA 1DQ8A 2GVDB 3WDOA 5L46A 5M2RA 5KG0A 1BLUA 3JTNA 1UJ5A 1D8ZA 5DZ7A 1A9NB 4B3RF 1RWKB 4NLDA 4B9SA 3UD5A 3AQOA 3H90A 3JQMA 2VPXB 2LQBA 4PPDA 2MXYA 5HN0A 3BF4A 4DCJB 1NU4A 3THPA 4LF4J 2M88A 1RSCA 1A6LA 1OYDA 2VOPA 2HQCA 1VBYA 1U1QA 3N9UC 1H2UX 1F9HA 4YEAA 3MUTP 2YKOA 4JI1J 2LQJA 2HS0A 5A0YA 2BQ3A 1NJYA 5DETA 1QY7A 1FX4A 4DHVA 4DV0J 2DNKA 2HFZA 1SUQA 5L1LA 2DNGA 4B3TF 3HK2A 2ZNZA 2CPXA 4PPZA 3HT3A 3LWLA 2H48B 3NWRA 1NAQA 3ZZTA 2CZ4A 4JOUA 4KHMA 3I0SB 3JSRA 3D0HE 5L1KA 4PG4A 2V2ZA 4ES1A 4P71A 2J9DE 2GO8A 3D6MB 2FDNA 3L7UA 2Z2LA 3BPDA 2VA2A 4CNYA 1KQSR 2V4QA 1TKTA 3ENVA 3KUGA 2KYXA 3CCQS 4HH0A 1IQTA 2EFPA 5IC6B 2EFGA 3MMBA 3IXQA 3MMAA 1H73A 3U1MA 1LNQA 3D3CJ 1JLQA 1PAUB 3RW7A 3M4XA 2G13A 1WC5A 1HBNB 2R4FA 2A10A 4ED7A 4FYWB 5T7LA 2OEMA 4Y2MA 4X4QA 3TUJC 4Q2MA 3BDPA 1DLOA 4ZCMA 2RAQA 4NXNF 3GONA 4OX8A 2CQBA 3DKDA 3L95X 3ZTSA 2P2CB 3WX8A 3PX0A 2IC3B 2V68A 2GAHC 1NSQA 1TAUA 3PM9A 2ACYA 3D7SB 3MMCA 4J9QA 1WEYA 4DFMA 4F25A 4FYDA 3NS7B 5D6GA 3BH7B 4WCEQ 1ZBTA 2MKIA 1Y5IB 3LAMA 4KR0B 3JYTA 5KT5A 2M5YA 4OZ3A 3CD7A 5CCMA 1EQ0A 5ETKA 4PYAA 1M1HA 2MHNA 3BYPA 4K5RA 2DCLA 2DHAA 4UZCA 5GAHI 3V6JA 4LF7J 3V6HA 2ZH9A 5A0YB 4YR2A 4OHXA 4MKAA 1GMVA 4CLFA 2LLZA 3L9ZA 4WP8A 1SUQB 3IRXA 1UVKA 3BGLA 1CBKA 4ZCKA 3EMTA 2E7XA 2C28A 5FDLA 4NZ0A 2DITA 1QD1A 3MFHA 4OX7A 1M5PC 4LIWA 4OYXA 3PYGA 1RWNB 4ETZA 4B3RJ 2DEIA 2C2NA 2WSEC 3FGVA 1JXEA 3IP0A 3GLJA 3TJAA 1TKTB 1H2TZ 2VG5B 3TA1A 3OV7A 2WVFA 3EPGA 3R1LA 2K7KA 3DOKA 1GMUA 1JJ2R 2P6TA 2PI5A 2YNFB 4HT7A 5CD4H 1IXKA 1LXNA 2IJRA 1RE1B 2IMOA 3QBCA 2C22A 4XDDA 1JLQB 5EWFA 4DQRA 3LGNA 5G0RA 3JTOA 2HQIA 3RBEA 3BEGB 1O6XA 2CPIA 2PMHA 3W9HA 5KG1A 4B3TJ 4DSJA 5KFFA 2OGUA 2X7IA 1RK8A 2JSXA 1YJRA 2BABA 1DLOB 2V6AA 5D4OA 4R0JA 1NHVA 2PFFB 3K5MA 2K7JA 4OHYA 2A6MA 4TVAB 5LM7E 2QIFA 1TK5A 3FBBA 2C1EB 3SFUA 3AJDA 2RQKA 2VG7B 1UCNA 3M9NB 3FZBA 4J9SA 3JYTB 1VQSA 2JLFA 2FHJD 2IMWP 1U8WA 3TVYA 4AXJA 1FE4A 2DK2A 2OEJA 4NMXA 4K0KF 4X4PA 2ATCB 2QLJB 3HFVA 2YWHA 3CDWA 4A8XA 4K4SA 4FF4A 2XGQA 3DMJA 5B08A 2QYCA 3BH6B 5CYJA 3UN2A 4NXNJ 4RW6A 4WZQA 3AXMA 2CNLB 4LF6F 1KBRA 2B6AA 1U0SA 4FF3A 2OAUA 3NGDA 5D77A 1VOMA 2LYVA 4W98A 2P8IA 2P9GA 2D9OA 4FKXA 3IS9A 1VRQC 4QZVB 2V8DA 1Q16B 4LFCF 3A3NB 2HNDA 3GB0A 2C2EA 1NCLA 4WFNQ 2GGPA 3OBIA 1X31C 3TZZA 4DDFA 1KLNA 4L3NA 3OHAA 1TZ0A 3DOKB 3ITHA 2XMMA 2ADBA 2MKYA 3MEGA 4B17A 4CYUA 2L3MA 5G0RB 2MZTA 2HLUA 5K14A 5E2QA 4YDXA 1RWUA 5ETLA 5LJ5Y 3A8EA 1PC4A 3GG1A 3UCUP 3LAKA 1U49A 4FNIA 3K59A 1IKWA 1LXJA 4KT0C 4DS5A 1U47A 2E7WA 4CRJA 2BZ2A 2CQ4A 1NH7A 3PHEA 2HSEB 4KGMA 2RDIA 1ZM3A 2ZH6A 2V67A 4USKA 1TQLA 2C2MB 4KH1B 1UZHA 1SL2A 1GTHA 1R8BA 1NSAA 2QV6A 1J5EF 1U45A 3RW6A 2OP5A 1F2HA 3EGVA 1WKKA 4OHZA 1FEHA 3D0IE 2QFIA 4I0WA 1WACA 1O0PA 4DV5F 3MD1A 2DR7A 1NEEA 2BYCA 4CH0S 1L5UA 4WIQA 1Y3KA 3L09A 3RZAA 2KN4A 1H74A 3ZZPA 5KG5A 2G0CA 2VBYA 3FC9A 4C7QA 2ZKTA 1AFIA 2Y9HA 5HO4A 3KJFB 3W1YC 1SQGA 2H65B 3TI0A 2W4PA 3RBXA 5DDQC 3DMJB 4MYUA 4R8UA 2R7TA 2PIIA 5L9XA 2XC9A 3NNAA 3M1VA 4Q0BA 5CHCB 2Y8WA 4C0OC 1VBZA 1VRUA 2B6AB 2ASJA 1YIJS 2QN6B 3WX4A 2DNQA 2HS4A 2AYBA 1ZM9A 2GJ2A 4OMFG 3AHPA 1PJ5A 4RNHA 2GGPB 4G1QA 2KT3A 4C3LA 4KPYA 1Q53A 3BQ0A 3ITHB 2MQPA 2B9WA 1X5OA 4K0KJ 5KOWA 4ES3A 1FDBA 3CCLS 1X60A 4FN5A 2ZUAA 3MEGB 3M8PA 4CYUB 1WI6A 2BE7D 2R2RA 5K14B 1GQEA 1IVZA 4X84A 4DR5F 3ADAC 1KD1T 5B7WA 1IKWB 2IM1A 5D4NA 5I42B 1KDNA 4EZ6A 1B7FA 1WELA 4LSLA 3EE3A 2QT7A 5IOLA 4LF6J 3GILA 2CUYA 2CQPA 1F2GA 3IM8A 4DSKA 4ZPVR 4K8RA 2DT9A 2R7VA 1CQMA 1UA1A 5GAGI 5HLFB 4IRKA 4LFCJ 4M5KA 3FZ2A 3OL9A 4QIEA 4OZJA 1IBMJ 2KJWA 4ZVPB 2DNOA 4TU9A 4MKBA 1SL1A 3DLEA 5E3PA 4TQRA 4R0EA 4HL9A 2U1AA 4OZ2A 2UU9F 4K59A 3M9OB 3TUPA 5D0HA 3JB9k 3DU6A 3R2DJ 2LA4A 3IC1A 4KJIA 2DH7A 4CLSA 3UW1A 3T9NA 4JUZA 4R8UB 1MLAA 4IH6A 3C2PA 3M1VB 4Q0BB 3SIPB 3PXGa 1R43A 4PRFA 1FHTA 3FUYA 4PKDB 5KFAA 2ASDA 3DLHA 1VK8A 1RZMA 1XWLA 3I6PA 2OUGA 2ZBRA 1LK7A 3ILIA 1J5EJ 3PTWA 5EWEA 1U0HA 2DGTA 4KGKA 4ZVRB 3D6HB 4E98A 4YB1P 2CWKA 5KFSA 2NSBA 1NPKA 3HSZA 2ACMA 5DO2A 2DY1A 3CJ4A 3IR5B 4KPCA 4DV5J 2WONA 3JQJA 2O67A 4ECZA 4KGXB 3ET6B 2B9YA 2FJEB 3OJUA 3M8PB 4EBCA 1UTAA 2JVRA 4D3HA 3X3UA 2H5JB 3CMAS 2EFVA 3OVBA 5CH7B 1WTFA 2ZE2A 3H4DA 2FC8A 2VFTA 1S99A 5GADI 4ZVFA 4LF1A 3KUHA 4RBTA 4K5SA 4LSLB 1RAGB 2IRUA 1GNKA 2CDQA 2KI2A 2XG8A 1HBOA 5EHHA 4J9NA 2R3VA 2NS1B 5JMNA 4L72B 3K5OA 1KKHA 4H54A 2BRKA 4IDKA 4CLKA 4BCAA 1OY9A 4WYLA 4F4AA 2AW0A 5A8RA 4DV7J 4A47A 2MKHA 3WC2A 4C0BA 1MU2A 1U1PA 4IOAQ 4ZP9A 1YJ9S 1T11A 2NPFA 3OXGA 5THWA 3VGVA 3DLEB 3KLVA 1UJ4A 3B78A 2BOPA 2M52A 2CJYB 2VC0A 3J7ZT 1S1XA 2BKOA 4DR5J 2OJ3A 4I6AA 2Y3YA 3BR8A 3MM8A 1GMWD 5CXTA 4ZLPA 1S10A 3DRXA 1U09A 3MD3A 4ILLA 2J5AA 3WZ0A 1N8RT 2MLXA 2KG0A 1IM6A
chains in the Genus database with same CATH topology
2NUUG 3IR6B 2ZBIA 5F9LA 4A8OA 4DQSA 4NLGA 3GV5B 3M2VA 2YNIB 3O1LA 5CA5A 2Z0GA 4GC7A 2HNYB 4I7FA 2EC0A 2B3TB 3C66A 3MPWA 3NKYA 1YJTA 1WI8A 4P7TA 2XSJB 1IJEB 2N4CA 4QWBA 4DBQA 3H5UA 1PGZA 3EXYA 2ZH4A 4N47A 4PWUA 4IR9A 1UL3A 4NYPA 1C0TB 4WE1A 2FVRA 5EUHA 3PZPA 1U6ZA 1HWKA 5J2NB 3IR7B 2AJQA 2OD6A 3K0JA 3E51A 3J80Y 2WONB 1T7PA 4NCGB 5KT4A 2FJVA 5HMZA 2WK4A 1LFWA 2XI2A 1TL3A 3O6QA 3H2LA 2EBGA 1J5OB 3FFIA 4EU0A 2N4DA 4RNOA 4RU2A 3PRBA 5LXYA 1S9EB 1L3UA 2KM8C 4ECVA 3KYLA 3S7RA 2CJKA 2Z4PA 1SC6A 4URSA 4UY8T 1UVLA 1G7CB 4L6V3 4IFYB 3MZIA 4MFBA 2KHDA 4DJBA 1VQMS 1HBUA 5I3UA 3I5AA 1TKXB 1NZAA 1YSJA 3IFEA 1P9QC 2Y1RI 1TAQA 2MGZB 1U26A 2E1RA 2MB0B 2Y1JA 1MNEA 3ICLA 2E44A 2RJZA 4I67A 2HVHA 2JWNA 4C0HA 1JIHA 5JUMA 2AD9A 4ILRA 5CZXA 3UE2A 2XMUA 2ZE2B 3MM7B 3CJ2A 4M1KA 3RB0A 1URNA 4WK1A 5E3CA 5I42A 1LWFB 3QIPA 3D5MA 1KSPA 1FJEB 4JV2A 1PC5A 1KC8T 2J7WA 3KNAA 2KZZA 4U6PA 1DURA 3MM9B 4QYZJ 1FNMA 2O3DA 2YX4A 1FCAA 1HBMA 1OQ6A 2KRBA 3IWXA 5CYMA 5LMNF 4NCAA 3EX7B 2KTQA 3QZ7A 4DG1A 2F8HA 2P5VA 1T05B 2C3MA 5BYRA 2L08A 4YDDB 3CC7S 1W2IA 5DRKA 2LU1A 4IYQA 2HMIB 5I3PA 4BC7A 3PO4A 2IBOA 1X8DA 2NLWA 4LQ9A 4K4TA 1JLFA 3EGWB 2NZ4A 4WFAQ 3M8SA 1FF2A 1SIZA 2AF6A 4OLOA 2PGCA 4LFBF 1HBOB 2JLEA 2OFHX 2KYZA 3DM2B 1S76D 1B0VA 1HMVA 3RAMA 1L3TA 2J8AA 3LOUA 2VUGA 4OJHA 3CB4A 4QOTA 3D1QA 1UFLA 2KHCA 5KFGA 2WBMA 5HLFA 1S6QA 3HM9A 4BWMA 3OL6A 5FLXY 5DLFA 1TL5A 2WOMB 3H2VE 4IDKB 4G3IA 1VQNS 1IKYB 2KDOA 4A46A 1NK0A 3LH2S 3KLIA 1W2BR 2B9XA 4KSEB 3I9V9 4EFAC 3HVWA 2RNEA 2DPIA 2E1AA 1TK0A 2YX7A 2GC8A 1ZPWX 1S6UA 2UZAA 1U1KA 5A8RB 1CLFA 3W2VA 2VQFF 1REVA 2FTRA 2R8GA 3T5JA 2ZD1A 4F02A 4QU6A 4NA1A 3G8TA 3OLBA 5C24A 4FPRA 1RTJB 3IGNA 3I0RB 1IM4A 3BO2A 5D78A 5KFIA 3NLCA 4MMOA 4DX8H 1JLCB 1U1NA 4F3QA 3C6UA 3M30A 3VAKA 1HFEL 4AUKA 3CCRS 3MAHA 3CJKB 1MW7A 4ICLA 1ROFA 4LSNA 1Y9OA 3POTB 4Y6IA 5LL6d 3US5A