1BQNB

Tyr 188 leu hiv-1 rt/hby 097
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
430
structure length
430
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVEPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRALSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 86
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqnB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnB03
2WRMA 1JKHA 3HVTB 2HNDA 4YQWA 1HNIA 1LWCA 5HLFA 4NLVA 2IMWP 3UQSA 2YNFA 5DG9A 3KNAA 3NGDA 1T3NA 3H59A 4O44B 4Y3CA 5KG6A 4TY8A 4I7FB 4YMEA 3T5HA 4Q8FA 1JLQB 4K4XA 5DQIA 3CVKA 2OPSB 5KFZA 4ECZA 3CWJA 5HBMA 3DDKA 2WHOA 1S9GA 4K50A 5KG1A 3MEDB 5J2NA 3NAIA 4J9KA 4IG0B 3V6DB 3BGRB 3H40A 3CJ5A 2OPRB 3NKYA 3PHEA 2BE2B 2J6SA 1VRTB 4QPXA 2OPSA 3VQSA 1UWBB 4ECVA 1HQUA 2BRLA 4F4XA 2W9BB 4ZPCA 1S48A 3MEDA 3HVAA 4EBDA 1C2PA 1RT2A 3GYNA 4O3QA 2BE2A 4KHRA 2VA3A 1C1BA 1VRTA 1UWBA 3DLKA 1FK9A 5DG8A 1S9FA 2ZKUA 3V81B 1RAJA 2W9CB 5DG7A 2O5DA 4XPEA 3HHKA 1XR7A 3I5CA 4YR3A 3RAXA 3GQCA 4RW4B 4ZVGA 4ED8A 1RT6B 1R0AB 4O3RA 3I0RB 5EWGA 4WYWA 2YNHB 4TN2A 5KG7A 2WB4A 2GIQA 4ZHRA 2W9CA 5KFCA 2YNGB 5F9LA 3OLBA 4R0EA 3QIDA 4YP3A 1RYRA 3DOKA 2WK4A 2XI3A 1RT7A 1RT6A 2W9AA 3QGHA 2R8GA 5KG0A 5CYQB 2JC0A 5KG5A 4TQRA 2C22A 3Q8PB 4ECXA 3IG1B 1QAIA 3OL6A 3H4BA 3DMJB 2ASLA 3E51A 4TYBA 5KT3A 1S1XB 5F8IA 5DQGA 3BSOA 1T05B 2UUWA 3H98A 5CYQA 5J2MB 1DTTB 3TVKA 3DLEB 3PW2A 4Q8EA 2B6AB 2AX0A 3DMJA 3E01A 4URGA 1TKXB 1T05A 3CDUA 4IH5A 3NBPA 4QW8A 3DLEA 2ASDA 1HPZA 2B6AA 3KLIB 3KHLA 3FSIA 5KFAA 1QUVA 1IKXB 2B5JB 2RKIB 4ICLB 4IG3A 3LANA 1KHVA 1SH3A 2IC3B 2F8EX 2XC9A 3PW5A 4QWCA 4J9SA 3I5BA 4KHMA 4EO6A 3QLHB 1RT3A 3BR9A 1S1TB 4NCGB 3DLGA 3CJ3A 4NLWA 2VG5B 1IKXA 2B5JA 1S9EA 4G1QB 3C6UB 3JYTA 3I5AA 1SUQA 1S1UB 3LAKA 5KFQA 5EDWA 4QWEA 1HYSA 2XI2A 1REVA 3V6JA 5DGAA 5F8NA 4Y34A 5KFWA 4NCGA 4EBEA 1JLGB 4NLYA 4JV0A 1DLOB 4FBTA 5KFMA 4IKAA 5L1KA 1S1UA 1XR6A 4Q45A 3RB0A 3FFIA 4ZVEA 4FS2A 5KFOA 1C0TA 1RTHA 2DPIA 4RNFA 1HQEB 5FDLB 2HAIA 3PW4A 2R8JA 3G6XA 1IKYB 2VG6A 5C24A 3OL8A 3IRXB 4O3PA 1S1VA 5DLFA 1TVRB 1K1QA 2XGQA 2BR0A 3RBEA 2ALZA 2UVWA 3LALA 2D41A 4F4ZA 3MFIA 2IA6A 4H4MB 4DG1A 4F4YA 4DL4A 3LP2B 1IKYA 4RNMA 5HROB 4QWBA 3MR6A 5CYMA 5J2PB 3M9NB 5F8GA 1S4FA 4RUAA 5I3UA 4MKBA 4RU9A 3GIMA 2IM2A 3MR5A 3GIJA 2OH2A 2HWIA 2ZE2A 2OPPB 4RW9A 3JSMB 1TL3B 1RA6A 4MFBB 1N48A 4ECUA 1JX4A 2YKNA 3LP2A 4EBCA 3V4IA 2FVCA 2XCAA 3NMAA 2V4QA 1MMLA 1C1CB 2DPJA 2FLNA 4IFYB 4Q0BB 2HNZB 4RW6A 1T03A 2WTFA 4ED7A 4NLGA 1K1SA 4ID5B 3JSMA 1TL3A 3KLFB 1D0EA 2IM1A 3HKWA 3HVTA 3ICLA 3EPGA 2QV6A 1EP4B 3BSAA 1EETB 1C1CA 1LWEB 4IFYA 4Q0BA 4RUCA 2BQRA 3N6LA 2HNZA 4WE1B 3D28A 2JEJA 4ID5A 4O3NA 1S6PB 3KLFA 4O4GB 4O44A 2D3ZA 3UPFA 3PW7A 1JLEB 4I7FA 1IKWB 4O4RA 1JLQA 1OS5A 3PR5B 1TL1B 2YKMB 3BQ1A 3G6YA 3BQ0A 1EP4A 1JLBB 3CJ4A 4KB7A 1LWEA 2E9TA 1TKTB 2HWHA 4PWDB 4WE1A 3MEEB 3DRRB 1RT5B 5DLGA 1S6PA 4IG0A 4O4GA 3BGRA 3V6DA 5F8LA 5KFSA 3GV7B 4ED2A 3T5KA 2OPRA 4ECYA 2C28A 5KT4A 2YKMA 3DM2B 3CIZA 3FRZA 4NLXA 2B43A 4J9LA 2BANB 2W9BA 4DL7A 3EZUA 4NLSA 3DRRA 1NNDA 3IGNA 4LQ9A 5JUMA 5HP1B 2VA2A 2HNYB 2FVQA 1GX5A 3PJXA 4URSA 4EEYA 3QGGA 2HMIB 4U6PA 2FJVA 2BANA 4RW8B 1JLCB 1TQLA 3V81A 2V0NA 3KOAA 2FLLA 5KFVA 4PUOB 3I0SB 4MIAA 4EYHB 2ILYA 1S97A 3MEGB 5HP1A 4RW4A 1R0AA 2FJXA 3I0RA 4RW7B 4DL5A 2HMIA 2YNHA 4ZVHA 4ZPDA 4KO0B 3DYAB 1QAJA 1I6JA 3OHAA 4XPCA 3G86A 2YNGA 3BSNA 1S49A 2FJWA 3FQKA 4J9QA 1RDRA 2E9ZA 1TV6B 3OSNA 3KLHB 2IM3A 4RW7A 3DI6B 3KLEB 1T94A 4ECTA 3QZ7A 3OL9A 5C25B 1HMVB 2IJNA 3IG1A 2W8LA 2R8IA 1TV6A 1S1XA 2JC1A 3KHRA 4GC7A 3DI6A 2I5JB 4R5PB 3M9OB 4NLQA 1HNVB 5J2MA 1N5YB 1XR5A 3PW0A 5KT7A 1DTTA 3H4DA 5KFJA 4I2QB 4ZP8A 4ED0A 4YR2A 4GC6A 4FBUA 5K14B 4TXSA 4MH8A 5KFXA 4ECSA 1FKPB 1TKXA 4XO0A 3Q8RB 3LAMA 3H5UA 3MFHA 4R5PA 2OPQB 1HNVA 1C0UB 3LP0B 5KFGA 4ED3A 4MK8A 3RB6A 4NZ0A 2AGPA 5F9NA 2RF2B 3PJWA 5EWFA 3KLIA 3TAMB 3BQ2A 4QWAA 4WFXA 3UR0A 2C2EA 1RTIB 1SH0A 3UDLA 5L1JA 2RKIA 4ICLA 4ZP6A 3QO9B 2IC3A 2FVRA 3QLHA 3TQ1A 4M94A 1S1TA 5KFLA 1RTIA 5D3GB 3OHBA 1BQNB 2VG5A 4WXWA 5KFKA 4G1QA 3OLAA 3C6UA 4WZQA 4ZP9A 4RNNA 4NYZA 1RA7A 4WZMA 2IM0A 4KV8B 1HARA 1JLAB 4JV1A 3M8QB 2R2RA 1JLGA 2ASJA 2UVRA 1N6QB 4DEZA 1DLOA 4I2PB 3N6NA 5F8HA 1SV5B 3OSPA 3DRPB 1KHWA 4IFVB 1RTDB 5I42B 2GIRA 1N4LA 2W7OA 1NHUA 3BREA 4WFYA 4IRKA 2VG7B 1VRUB 1N6QA 1HQEA 5FDLA 5KG3A 4DL3A 5KG4A 1SV5A 3KMQA 3DRPA 3IRXA 4KKOB 3RB3A 1DTQB 1TVRA 4ZP7A 4JV2A 3KK2B 5I42A 1D1UA 3G6VA 3T5LA 5KT6A 3CDWA 4H4MA 2VG7A 4RNHA 1WNEA 3MR3A 5KFPA 2AQ4A 4KSEB 5HROA 5J2PA 3KLGB 3M8PB 1DTQA 4ZPBA 3H5SA 2CJQA 4MK9A 3RAQA 2OPPA 3QGIA 5L9XA 5J2QB 1GX6A 1LW0B 4MFBA 3FDSA 4PQUB 2ZD1B 2YNIB 3MTKA 5KFIA 5L1LA 1IKVB 4IDKB 4NLPA 4H4OB 1MU2B 3QIPB 2R2UA 2IBKA 1JKHB 3KLGA 4IOBA 1HNIB 3M8PA 4QW9A 3IGVA 1LWCB 2FVPA 5EUHA 4K4SA 4HYKA 2JEIA 5J2QA 3MECB 2YNFB 5KFBA 2XCPA 4NRUA 2ZD1A 3CDEA 3M9MB 1IKVA 4IDKA 4TY8B 4IR9A 4H4OA 1MU2A 3QIPA 1EETA 3ISNC 5KFEA 3KLVA 3EPIA 4ED1A 3Q8QB 5HBMB 4TYAA 2JEGA 3KK1B 1S9GB 3MECA 5J2NB 4TLRA 4LQ3A 1JLEA 4IQXA 1IKWA 3GIKA 4Y2CA 1TL1A 3DRSB 3GILA 1CSJA 1JLBA 3T19A 4WYLA 1TKTA 4JUZA 4PWDA 3BSCA 2E9RX 1HQUB 3MEEA 1RT5A 4TQSA 3KK1A 4X2BA 1RT2B 2C2RA 3DRSA 5KT5A 1S0OA 3DM2A 2GC8A 1JIHA 3CJ2A 1C1BB 4NLOA 1LWFB 4QWDA 2EC0A 2XGPA 3DLKB 1FK9B 4NRTA 4RZRA 2JEFA 3NAHA 3T1AA 5KFNA 5DGBA 4ZMMA 1NHVA 4ECQA 2HNYA 2QE5A 2J6TA 5KFTA 3ISND 3BJYA 4RW8A 2BRKA 3PR4A 1JLCA 1LWFA 2J6UA 4PUOA 3I0SA 4ZHRB 3PVXA 4K4UA 1RT4B 3MEGA 4EYIB 4IH7A 4ECRA 5T14A 4K4YA 3DOKB 1RT7B 3KJVB 1LW2B 4KO0A 3DYAA 4KE5A 4ZPAA 4NLDA 4KBIA 4IRCA 3SFUA 5C5JA 4F50A 1RT4A 3CO9A 3MF5A 2V4RA 4MIBA 4B3OB 4MKAA 3KLHA 5KFYA 2R2TA 3KJVA 4Q44A 1LW2A 3KLEA 5KFUA 3RB4A 3ITHB 3GV8B 4WFZA 2AGOA 5C25A 2ILZA 2IAJB 1HMVA 4FS1A 3RBDA 2XWYA 1U09A 2BQUA 4M95A 4B3OA 1S1WB 4LSNB 3QYYA 3E01B 4K4WA 4DL6A 4ZVFA 2I5JA 1RYSA 4O3SA 3ITHA 4NLRA 1N5YA 3KHGA 5L1IA 2IAJA 2AWZA 4R8UB 4OL8A 3V6KA 3MR2A 1SH2A 5C42B 4I2QA 3NBPB 4ED6A 3PZPA 4NLTA 4IH6A 1JLFB 1HPZB 4K4TA 4G3IA 4KAIA 5K14A 1S1WA 4LSNA 4K4ZA 1FKPA 2WONB 3CJ0A 3HVWA 4TY9A 2OPQA 2RDIA 4IG3B 1C0UA 3LP0A 2JLEA 4HKQA 2UUTA 4R8UA 2RF2A 1FKOB 5C42A 3TAMA 2R8KA 3H5XA 2BQ3A 2R2SA 3KMSA 2FVSA 1JLFA 3H2LA 1RT3B 1RT1B 1JXLA 3OL7A 4MK7A 2FLPA 2WONA 3DLGB 1QE1B 4NLUA 4O3OA 3IN5A 4IRDA 1ZTWA 1S9EB 3QO9A 3JYTB 2UVVA 2D3UA 5F8MA 1SUQB 1FKOA 1KLMB 4WXOA 4J9OA 1HYSB 1REVB 3DOLB 5D3GA 4J9MA 4Q43A 1RT1A 1BQNA 3H5YA 4J9NA 1QE1A 1Z4UA 5JXSA 2ATLA 3IS9B 5DQHA 1W25A 3V6HA 5F8JA 4U7CA 1KLMA 1BQMB 4KV8A 3C6TB 1ZTTA 1JLAA 1IM4A 3DOLA 3FFIB 3M8QA 1C0TB 1RTHB 4KFBB 2IJFA 4I2PA 5EWEA 3GV5B 4YR0A 3KK3B 1RTJB 2CKWA 1S6QB 3IS9A 5KFRA 2VG6B 5C24B 1YVFA 2WOMB 5J1EB 3KHHA 2V9WA 2UVUA 4IFVA 1BQMA 1RTDA 1S1VB 3C6TA 4RNOA 3T5JA 1J5OB 4LSLB 4K4VA 5KT2A 4KFBA 3SFGA 1VRUA 1S10A 3Q8SB 4DG1B 3KK3A 4J9RA 1RTJA 3FQLA 1S6QA 2AGQA 4ECWA 3LP1B 4Y2AA 4KKOA 2WOMA 5CYMB 5J1EA 2RDJA 4DL2A 3GIIA 3NL0A 2WCXA 5I3UB 3KK2A 1J5OA 4LSLA 3D5MA 3N6MA 4EO8A 2ZE2B 1TKZB 4RW9B 2AU0A 4H54A 5KFDA 4URQU 5KFFA 2YKNB 1TP7A 2W8KA 4J9PA 2I1RA 3V4IB 2HNDB 2C2DA 3LP1A 5KG2A 4F4WA 3SI8A 5HLFB 2W7PA 2D7SA 4RW6B 3QZ8A 1T03B 1ZETA 2R8HA 1LW0A 5KFHA 1S0MA 1TKZA 4PQUA 1S0NA 2AX1A 4IR1A 2YNIA 1N56A
chains in the Genus database with same CATH superfamily
3H42A 1W2BR 1B7FA 4TVAB 1UTAA 4J5OA 4O44B 3CWJA 2KM8C 3POTB 5KG1A 1HW8A 3G87A 1QUPA 4NPOA 2X51A 5ADZA 1J5EJ 1NK6A 3POTA 3TRGA 4ELVA 2DT9A 5DG8A 2ZNYA 2H5JB 3NNAA 5EWGA 4WYWA 5H1SV 1FVSA 2D3O1 2YNGB 5J1NA 1VQ9S 3CJTA 3OLBA 3DOKA 2HAFA 2VZ9A 4DI6A 4DV6F 3O44A 1OWXA 3TARA 4P7TA 1WF1A 4DN9A 3KWMA 1MROA 2QT7A 4URGA 1L3SA 3D54A 5A8KB 1RHUB 2ZH9A 1X0PA 2RKIB 1BD6A 2VBYA 3W9JA 4C8YA 3FBBA 1YKWA 1UP1A 5D0GA 1P9YA 1V3RA 4KGXB 3DLGA 1CJUB 2V2QA 2XI2A 1REVA 1ZA2B 4DQRA 4HLBA 3MD1A 1C0TA 1E6YA 2DYAA 4B9UA 2HAIA 3OL8A 2EC2A 1K1QA 8AT1B 4PXDA 3M2VA 4F4YA 2G2YA 5J2PB 3WQPA 2AP6A 2OPPB 3F44A 1SCJB 1U1LA 2XQCA 1NXIA 4MAKA 3TOQA 1HHTP 2HNZB 4NLGA 1HI1A 1IVZA 4OYOA 1EETB 2RIJA 2HNZA 1ZS6A 4DUTA 5CABA 5CH7B 4OX7A 4OJHA 1FRKA 3W2WA 3RAMA 4J37A 3BGUA 4DJBA 4ZPTR 1H98A 2H5IB 4B3SF 3TZXA 1IBLF 1QJHA 1H2TZ 2HMIB 4P2SA 2DH7A 5KFVA 4MIAA 1NDPA 1FJGJ 2ZZNA 2F63A 2FJXA 2OJ3A 4CLZA 1YBUA 2HMIA 3W62A 5D0RA 4KO0B 2EFOA 1QVFR 5ITHA 3BSNA 1RDRA 2IM3A 1TK5A 4L3KA 1T94A 1PKUA 2E5LJ 1Y9OA 4OZ5A 1ZZFA 2BX6A 3PW0A 1I3OB 3BV8A 2V63A 1HI0P 4FVMA 1XMQJ 4XO0A 3H5UA 1RBAA 2FD2A 4DR4J 5IT9U 1FERA 2OFGX 2UUBF 2UUBJ 1ZH5A 1SV5B 2NS1B 4IRKA 1B4SA 2W4DA 4DR1F 1SV5A 3IRXA 3RB3A 4L6V3 2PMWA 4WP8A 1FNMA 5L8RC 1WNEA 2QYGA 1OPIA 3QSIA 5EX0A 2F65A 4DPWA 1N5VA 3TJ8A 3R5JB 4C0OC 2R2UA 2XY5A 3MAAB 4HR2A 1DQ9A 2KTQA 3GJSB 1NK4A 5HBMB 1H2UX 2ZC3A 1CSJA 2PO4A 1Q16B 3K89A 2NXCA 4NCBA 1YI2S 1RAGB 1ELOA 4WFNQ 3ISND 1PSDA 1ZBTA 1RLDA 3D9BA 3C66A 2SXLA 4L72B 2RU9A 3GZ7A 2UXDF 2AZ3A 2FTRA 4P72A 5BR8F 5AE3A 3D66A 2HFUA 5ETSA 5BR8J 5C25A 1R7IA 2KG0A 2BQUA 3EDQB 3ILJA 1TL7B 3R5DA 4WK3A 2J9EA 3W65A 1KOOA 3VAGA 1UVNA 3CDAA 1N8RT 2DGOA 3G71S 2B51A 4OZ0A 4MK7A 2FLPA 1QE1B 3DLBA 1S9EB 2DGUA 2GZOA 2VHGA 2VFSA 3DRYA 4J9OA 2DR5A 1N0UA 4G6VB 4FKXA 1QE1A 3MM5A 1Z4UA 2KHDA 4C3MA 3NWGA 3RYLA 1RTJB 3CD5A 1TTHB 3MPDA 4ZITA 4JI7J 4K2XA 2BW2A 3CMAS 1N36J 1XMBA 4DG1B 4J9RA 1RTJA 2OEMA 4AL7A 3DC2A 3CPWR 5I3UB 2AEFA 1NJIT 2UXCF 5DRKA 2DCUB 3V5RA 1JB0C 4G65A 1YJTA 4WK1A 1LWCA 3KNAA 3OFHA 2CJBA 2M3DA 3NGDA 4A8OA 4C0HA 3SIPB 1GMWA 1S6UA 3HVAA 5K8OA 2O5DA 1X4AA 3SCKE 3GQCA 5E0OA 2AJ1A 4X64F 4WWSA 2YXLA 1T3OA 4DL0C 4X64J 3QGHA 2C22A 1NSAA 4M5KA 5HVHA 4TYBA 3B54A 5HAOA 5J2MB 1JNZB 4YOEA 1K8AT 4RUBA 3KHLA 3P3DA 1U8SA 1PYSB 1TL4A 3JYTA 1VHIA 1U1MA 1SUQA 5DGAA 2KN4A 1DLOB 3QAEA 5L1KA 3M8RA 3FFIA 5HATA 2FGCA 1HQEB 2OO4A 3BN4A 3KJQB 3I55S 1YJRA 2R7QA 1WG4A 3ADAC 1D8YA 1JXVA 2E5GA 1YGYA 2XMWA 2UU9F 2MZJA 2NXEA 2KL8A 6AT1B 3AA9A 4PRFA 4C97A 4WTOB 1FF2A 1TL3B 2EFQA 1S77D 1XWLA 4CLUA 1TL3A 4OHZA 4O4RA 3M6WA 1TKTB 4RUHA 3GV7B 4DR7J 4KYZA 2HBRB 3VF0B 4DL7A 1D9AA 2QA4S 2BMBA 2C3MA 2RNEA 1S7HA 2GW8A 4UF4A 3OW2R 2ILYA 1VDHA 4B9TA 3FZBA 2CQDA 3I0RA 4RW7B 2EFGA 3SSQA 2FJWA 4WJBA 2L9NA 4GKKJ 4RW7A 1IBCB 3KHRA 4DOZA 1HNVB 1N5YB 1DTTA 2JLGA 4YR2A 3DU5A 1TKXA 1HNVA 3Q83A 3JSBA 1V3ZA 3UR0A 1BGXT 3UDLA 3BO3A 3TR5A 1IR0A 5D15A 3O3LA 1KC8T 3WIUA 2CQ0A 3OHBA 4WZQA 4LF1A 4J9UE 5MAOA 1Q0NA 4I69A 2ADCA 4P6QA 2AJ0A 3OUYA 2N7YA 3CJ8A 2EFNA 2UXBF 2GVDB 3FVYA 3QT6A 3FGVA 1CQNA 3GWCA 2GVDA 1SKWA 3OR1B 4OYXA 5CZVA 3W3SA 1GX6A 2K3IA 3MTKA 1SJRA 4C8NA 5KOXA 3TAPA 1EQMA 1NUEA 5EUHA 1V5VA 3RU0A 3SXLA 2B4OA 2M88A 4TNOA 5EX3A 4KTQA 4ES1A 2YWEA 1EB0A 5DDPC 1JLEA 4B3RF 3M4XA 5FIIA 1MN9A 3P96A 1Y10A 1F2GA 1F9EB 1WHXA 2CPYA 2PSZA 2HIYA 5LL6d 2C2NA 1S7IA 4Q2LA 3T1AA 3T1HJ 5HO4A 4ECQA 5E3QA 1X5OA 2J6UA 4KHPF 3JSYA 4DFMA 2FHKA 2DXFA 2LQBA 2JRSA 3S8SA 4IRCA 2GO8A 3IAM9 2FJAB 4ZCLA 1H72C 5KTQA 3KLEA 2QX0A 3CD7A 5A6PA 3EM1A 1NK9A 5AE1A 5C42B 2VB6A 4QIEA 3HHDA 5SZTA 5K14A 2OEKA 1FKPA 4TY9A 3LP0A 5C42A 3TAMA 4LRDA 2KZZA 1NJXA 1FO1A 2IDLA 4CLWA 2CXEA 2VL1A 1HR0F 1CS4A 4JI4J 2M7SA 1HR0J 3C46A 1FNXH 3FCHA 1Z2ZA 3KTQA 3I96A 4OV6A 3V2UC 2ASYA 2FHJA 4LUBA 5EWEA 3MM6A 4JBCA 1FCAA 1J5OB 4LSLB 3AODA 2IVMA 3IXQA 1QY7A 3CJKB 4KKOA 1J5OA 4LSLA 3H2VE 4CLSA 3MGJA 4B3MF 3R2DJ 4IR1A 2XZWA 3T1YJ 2YNIA 2B3TB 3HVTB 4PG7A 4X4UA 4IO9Q 4G1PA 4U95A 4YMEA 1UFLA 3PRVA 5DZ7A 3HJVA 2HRTA 3BGRB 2QSFA 3UN2A 3MCOA 3AH6A 2IDEA 3WHIA 1X5TA 3QRPA 1I94F 1H7XA 2J0SD 1I94J 2DO4A 3HHKA 4DQIA 2CVEA 5KG7A 2Z2ZA 5B09A 3E3XA 4ZHRA 2V8PA 4QYZK 1EKSA 2YKQA 2Z2LA 4WIIA 3AJ1A 2W9AA 2MLZA 1MNEA 4QU6A 3PIOQ 3TVKA 3FZ2A 5HL7Q 5CD4H 1KFSA 1GNKA 3CDBA 5MLCV 4OLOA 4ZVPB 3L7PA 1NAQA 4USJC 2Y1JA 3I87A 4J9SA 3I5BA 2MQMA 3BR9A 3P8BB 4LF5F 5BYQA 1HWKA 3NWRA 5IZHA 3PACA 1HYSA 4JI0J 3BPSP 1HBOB 5KFWA 3C3LA 1KQFB 1NHKL 2BJ3A 2WSFC 3PDNA 1XR6A 4LVNP 4FS2A 2RHSB 1U24A 4KPCA 2CQBA 4C8MA 2DHXA 4DSJA 4JI8F 3RBEA 3LALA 2D41A 1NDCA 3TZYA 2GHVC 4EI2A 4QWBA 1TELA 5L38A 2OH2A 5DDRC 3GIJA 2CNNB 5FLXY 1F9FA 1A7GE 5M2PA 1REGX 3R6GB 4DX6A 2I38A 1M5VC 3GU0A 2OLWA 4N41A 4DV5J 2HBZB 1PJ6A 2JEJA 6FD1A 2D3ZA 3PYGA 3JSRA 4KB7A 3SV4A 5HMWA 4ECYA 3TEHB 2DRBA 3HSZA 2B43A 2P9GA 4LQ9A 2PA3A 3B82A 3J7YU 1GX5A 2C42A 1U0HB 2M5YA 4DLGA 1SQFA 2FJVA 4N8OA 2VONA 2V0NA 1SQEA 4DZDA 2Z58B 3GCWP 1TK0A 4RW4A 2LXIA 5AXMA 2VJUA 2OSQA 3FSXA 2CPHA 3HM9A 2YWFA 1W7WA 4NA1A 3DI6B 2JOQA 1SVDA 4XTTA 3DI6A 3R7NB 4A8XA 4DSIA 3HHLC 1U25A 3SMZA 3VWSA 2MKIA 3UDCA 1JXEA 3DNCA 4ZP6A 2CWKA 1KQSR 3ZNUA 5D3GB 4JI5F 2J8AA 3OJSA 1A9NB 1NPRA 4NYZA 3LGMA 1AA1B 3H20A 2R7XA 3P5TL 1N4LA 1ICEB 5ETRA 1VRUB 2R42A 4HH0A 3OVBA 4OX9J 2DRAA 1TVRA 1VQNS 4L75A 2ZM6F 3KLGB 4OX6A 1PGZA 2Z2YB 4DPYA 2ZD1B 1U1KA 2HQIA 3KLGA 1HNXF 4ZLLA 4NRUA 2ZD1A 4B08A 5IV3A 3FSYA 2V4JA 3CC2S 2VBZA 2ZVIA 5CCLA 4LQ3A 1M5HA 2IMOA 1VQOS 4DR5F 3GONA 1JIHA 2XTJP 1HNZJ 4NRTA 3ZZ0A 1WKKA 1SJ3P 4PUOA 5B0AA 1HBUB 3QFHA 2K8GA 1OY8A 4DQQA 4UOCA 4LRBA 1JJCB 1IJEB 1HMVA 3QT7A 4HTJA 3HVRA 3TNVA 4YDDB 1VQLS 2J76E 4QIWD 1SH2A 2C2MB 2ZHAA 1SKUB 4CP5A 2BJDA 1DBDA 1MWQA 1RHMB 2FVSA 1RKIA 2X1GA 4XDCA 4C0BA 1S6OA 2HLUA 4LR8A 2CQ3A 4OYPA 4AL6A 5GADU 3TI0A 2FZKB 1UEVA 5C24B 1IN0A 1WORA 2H1YA 3HHLB 4A48A 5IWAF 2XS7A 1FVQA 1HFEL 2RDJA 2MLYA 2MEWA 3L7OA 2KB2A 3D5MA 4EO8A 3N6MA 2AYGA 4ELTA 2L48A 5EN1A 4CO4A 1HWIA 4CDIA 2AV5A 3M1VB 2I9SA 4RWWA 2PMZD 2A3JA 2L9WA 5KG6A 3TVZA 2J0WA 2OPSB 4ECZA 2EKYA 2CZ4A 3GFYA 1S9GA 3UD3P 5K8MA 1T9WA 2OPSA 2NZCA 4ENOA 4FF1A 1WACA 2FHMA 2XHWA 3BEGB 1RAJA 2DD8S 2VOOA 4DPXA 5DDOC 1RT6B 3ZZRA 1Q4RA 1RT6A 2IRXA 3HD2A 2MXYA 4YEAA 3VCDA 4M5HA 3JXOA 5KT3A 2NQPA 3K5LA 3CDUA 2QLJB 3P4UB 1PC4A 5KFAA 4M5LA 4QWCA 3EVOA 1UAWA 4EO6A 1VOMA 2CJAA 2HW3A 3DCAA 3RRHA 8ATCB 2VPWB 2G2ZA 1AFIA 4ZVUB 2XS5A 1A0OB 4CQ1A 2CJ9A 1RTHA 1H3DA 1RZMA 1QTMA 1VC0A 5LMUF 1IKYB 1IKYA 5IXUA 4O0IA 4EU0A 5BYSA 1JX4A 5CCMA 3ISZA 2FLNA 2OMOA 2QA4G 1PG5B 1K1SA 2MSSA 1R8AA 3AD8C 2W2OP 3LPYA 4F0MA 4P52A 1APSA 4QIVA 4OI3A 3TWZA 4K0KJ 1IKWB 3UVJB 1S72S 3D1QA 2QIFA 4ED2A 4N5SA 1OYEA 3UVJA 3DM2B 3AA8A 3EZUA 5T7LB 2BABA 3T3FA 5HP1B 4ANEA 4FXWA 3M32A 1VJWA 5T7LA 5HP1A 2A6OA 4ZJOA 3GPAA 2YNHA 4ZVHA 2V67A 2HKEA 3OD2A 2VDHA 5KAKA 1XIQA 2CADA 4I0WA 3OR2A 4RBTA 3W9IA 2RT3A 2W8LA 3VVUA 1V9OA 2CQPA 2WVDA 2FDNA 1GTEA 2N3OA 1O5JA 4NZ0A 2F4VF 1HL6A 3KLIA 1RTZA 3EZ5A 2FQQB 4ZJLA 5DJBA 1WELA 1FWKA 1R27B 4OYBA 5KFKA 3C6UA 4LT6A 4RNNA 3MI7X 5HJYA 5FD1A 3GG0A 2MHNA 4LIRA 4PABA 1U6FA 2F3JA 1U48A 3DXBA 2GO9A 3CE8A 2JH3A 4DWIA 1R89A 3MDFA 1DY3A 4U8YA 3WIVA 4ZPBA 3M6UA 3RAQA 4JI2F 3BGOP 3EYZA 2V6AA 1SKRA 2ALYB 3QIPB 1HNIB 3GFXA 2JEIA 4OHXA 2LU2A 4ILLA 3QIPA 2PI4A 3CEDA 1YSJA 2KXFA 1IR2A 1FRLA 2KU7A 1RT5A 4X2BA 4GVBB 2IRYA 1FRMA 1Q86T 4I68A 1M0SA 1RKJA 2VBWA 4GVBA 4F4AA 4KGVB 2BKOA 3BJYA 1QM9A 4U96A 4WP9A 4ECRA 2JSXA 4K4YA 1OIAA 5E3CA 3A8KA 4BWJA 5GAGU 4RL1A 2Y0SD 3MF5A 1IBKF 4HEA9 4Q44A 2DH9A 1IBKJ 4WFZA 1VBYA 2LQ8A 1U09A 4DF8A 4DL6A 3QYYA 1RYSA 3KHGA 5L1IA 2XY6A 4NLTA 3NNCA 4W4MA 3IR5B 1RBLA 3NOCA 2UUTA 5SUHA 3GFZA 4ZVOB 4I6YA 1RHQB 4PG4A 1DRZA 2FJBB 3IO1A 2HQFA 2D3UA 4HVZA 2C3UA 2IYIA 4ED5A 4LF9J 2WSEC 2R3VA 3HT3A 4DX7A 1XNRJ 2DGVA 3MM9B 3N79A 1VC5A 2VG6B 3AJ2A 3QBCA 4YY3F 1U1RA 4LF8F 5KT2A 4J90A 3MM9A 3ET6B 2XMTA 4D3HA 1TKZB 4RW9B 2HGNA 4KT0C 3LQVA 4QR1A 2C2DA 5HLFB 2Q79A 3S1TA 1TKZA 3Q89A 3AD7C 4I6WA 5HLFA 4OYMA 2HZCA 2YNFA 1BUXA 1JLQB 1YBTA 1RAFB 3RW7A 4YB1P 3V6DB 2A18A 4UQGA 4ZPWR 3DLHA 2OPRB 1HQUA 2RJZA 4D3GA 2Y8WA 2QMUB 1C1BA 3EMTA 5CA5A 1ACMB 1URRA 3V81B 2W25A 5ETVA 3RAXA 3A12A 3UDVA 3P45B 4ZVGA 2ZH6A 3HDSA 1S4EA 1R8PA 2B9YA 4F4KA 1HQ2A 2F7VA 5IQQA 1JNRB 4M5JA 4K2JA 3SQOP 4HDHA 2B8QA 1KFDA 3TA0A 3ELHA 3BSOA 4OHWA 2ZUGA 3WX8A 2AX0A 4PXEA 1U02A 2J9DE 3Q86A 1RABB 1TFYA 3FMWA 4ZN1A 3BPDA 4ICLB 4IG3A 2IC3B 2DK2A 1Q8KA 3QLHB 1RT3A 1HNWF 4Y28C 3IR7B 5A2QY 3IM9A 1VI7A 4J7CA 2CVIA 5EDWA 1HI8A 3TAQA 1CULB 1KNZA 4NLYA 3GG1A 1NKEA 3UN3A 1UZHA 1U7LA 3W9HA 3BZQA 2AYBA 4RNFA 2R8JA 2VQEF 2HHTA 2VQEJ 4QIFA 4YHHF 2BV3A 2HFZA 4DL4A 5D6GA 4LR7A 3RRKA 4ZS6A 2RRAA 2DHAA 1EARA 2KJVA 3V4IA 5JVHQ 1MMLA 3UCZP 1T03A 2MDAA 4NASA 5HSPA 3OFGA 1XQIA 1N88A 1RAOA 2WVBA 4RO0A 4Y0FA 2QG9B 4AFFA 3G8TA 2HHPA 4IG0A 5F8LA 3T5KA 3PIPQ 4F7VA 1KQKA 3IGNA 4EEYA 1YHQS 5L9NA 4O0NA 1OMSA 3R8YA 4ZPDA 3DYAB 4RR5A 3G86A 3A1YG 4E8UA 2UUCF 3BH6B 2VKRA 2NXUA 5E33A 2DHHA 2IJRA 5D77A 2OTLS 2G0CA 3W8GA 4OFZA 2B4VA 5GAHI 3S7RA 1LWXA 2F1FA 5KFXA 4DV0F 2RF2B 3BN7A 1RTIB 1WKJA 1TL5A 4P2MA 2DIUA 4OX8A 2CNKB 1RTIA 1XMOF 1WEYA 4F3MA 3AB4B 2YX4A 3OTOJ 1O6XA 3KDOA 4DSLA 3TANA 4Y00A 2X1BA 1RTDB 4JI6F 2BYCA 1R43A 1NHUA 5FDLA 2ROPA 5HMYA 2Q6BA 2KXNB 1IXKA 5HROA 3WDOA 4PQUB 3HXMA 2FC9A 1JKHB 2BXJA 1WHWA 4C9DA 4NE9C 1X7VA 3CDEA 2BA9A 1EIYB 5KFEA 2L9DA 2DY1A 5J2NB 4NMLA 3CCQS 4JUZA 3MEEA 2RUGA 2Y1LB 1VQ5S 2CPDA 1K47A 5DM7Q 3DLKB 2FGOA 3MMBB 4DPTA 3DRXA 4FNHA 4RW8A 3PR4A 3QMQA 1WG5A 2H48B 1F5AA 4CT8A 4IH7A 4KJIA 1ZM2A 4KBIA 1T8EA 2OEJA 3DDIA 3RR8A 2B4UA 3DN9A 1T0TV 2FLOA 4W92B 1L3KA 3HF5A 3B4DA 3CMQA 1N5QA 3D6TB 3CJ0A 2ATCB 2OPQA 1ZYQA 2QSWA 1SL0A 1VMBA 1L3VA 2GX8A 2KFZA 2BDPA 1TFWA 2DXDA 1PIEA 4MYTA 1W25A 1FA0A 4MTPA 2KYZA 2GIFA 3M8QA 1CC7A 3KK3B 5LXRA 1VQKS 1L3TA 1AUSL 5B08A 2JDJA 3CCJS 1GMVA 3KK3A 2KVQE 3KG0A 3GIIA 2JVRA 4V1Ak 2ZE2B 3ZTSA 5KFDA 2YKNB 2HHHJ 4F4WA 3PKMA 1S0MA 3QT8A 3M8WA 2QEXS 1AB8A 3P6YC 1T3NA 3T5HA 3ZTOA 5HMXA 3NAIA 1O0PA 3CJQA 3CJ5A 3CGIA 3UR3C 2LEAA 4NX9A 4F4XA 4O23A 3OT9A 1RT2A 3GYNA 4KHRA 4C3LA 1Y00A 2DHGA 1U8WA 2AYMA 3I5CA 4ES2A 5G0RB 1Q53A 2M0GB 6FDRA 2KHCA 5KFCA 3BO2A 5GMDA 2WBRA 1O51A 3M8ZA 3VTIA 5KG5A 4OZ3A 2CNOB 3W66A 3Q0AA 3SDEB 3MAQA 4DR3F 3SDEA 3OJUA 2HFOA 4OHVA 1ZA1B 4RLEA 3FSIA 5F0WA 3CCMS 3LGHA 2V8HA 5EHHA 1NK7A 5LMNF 3K5NA 1Z1ZA 2Q43A 3CJ3A 2EBGA 4G1QB 4EZ9A 4OYWA 3ZFVA 4OYIA 3LAKA 4JYAF 4LMZA 4F0HA 1JLGB 1RLCL 4EUVA 4FBTA 2M52A 4IKAA 4KR0B 2QL7B 4ED4A 3CD0A 3FBEA 1FDDA 2BR0A 2EPIA 4H4MB 1S4FA 4V19J 4MKBA 3GIMA 3HJFA 4QBUA 1W26A 2JHEA 2F40A 4U67Q 3Q2SC 3JQMA 3GMGA 4Y2KA 3OL9A 4I7FA 4ES3A 1TL1B 1NSPA 2E9TA 2HWHA 4LBIA 2VPZB 1U1NA 2HHSA 1XNQF 4J9LA 3K0JA 2N4DA 2FVQA 4URSA 5ETLA 2MSTA 1DQ8A 3EGWB 3NCQA 4S0MA 4EYHB 3AXMA 3H90A 2ZZTA 4WPAA 1N33F 4OZJA 3GJQB 1X4DA 2DJWA 4XPCA 1LK7A 3KLHB 2FYXA 2MZTA 4GC7A 3US5A 2DR9A 2HQDA 1XR5A 3TX8A 2MQ8A 5CD4A 4MH8A 2EW9A 2HZVA 3MFHA 3D4JA 3UWTA 2Z2MA 3MPVA 4DV1J 2BKPA 3QO9B 2M4MA 3AT1B 3ZO7A 3FEZA 1S1TA 2WVCA 2CNLB 4F26A 3T9NA 2BOPA 2A6MA 1RA7A 3NNHA 1CEZA 3DRPB 2W2QP 4K7QA 2HQGA 1RP5A 3M05A 1WC3A 2GIRA 1TUGB 4C8LA 1V6HA 3DRPA 1SL2A 3SCLE 3OVAA 4Y2IA 4YB7A 2A10A 4RNHA 2YTCA 2AQ4A 4NCAA 2M9KA 3J81j 4CNYA 2XG8A 2H51B 1RWKB 2R7WA 5H9FK 4ZJQA 1MWZA 2DISA 2GNKA 3F56A 4PWDA 2E9RX 3ILIA 4KGZB 3FRYA 1U6ZA 1UJ5A 2ZBPA 4A8WA 1WEXA 5JJBA 2HBYB 4NXNF 2DGWA 3MEGA 4NXNJ 4DR6J 3NCPA 4C11A 3HULA 3TQEA 4AQYJ 1RT7B 2ZHOA 4B3OB 2XLJA 1BQXA 4QYZJ 4B3OA 3CULA 2ZH1A 3VAFA 4DV4J 1ZM4A 4BBYA 3HVWA 5DM6Q 3EE3A 2VQFF 1X5SA 3H5XA 1VLOA 4O3OA 1BC6A 3TO8A 2UVVA 2WAQD 1JMTA 4I56A 1BQNA 2ZOFA 1VC6A 2DNZA 4RPFA 3VZIA 1YJVA 1O8BA 2CDQA 2G2OA 1F0XA 4L76A 4ECWA 4X4SA 3NL0A 3KK2A 1CPZA 1TP7A 3G8QA 5KG2A 1SPBP 4RW6B 1LW0A 2QC3A 2DCLA 3W5YA 1YJUA 2G9OA 3H59A 4X66F 4Q8FA 1CG2A 4BS2A 1PAEX 2WHOA 5E5NA 3EGZA 3VGSA 2J6SA 4QPXA 3HLUA 1YJ7A 1ULRA 2IPOB 3MCSA 4HT7A 1FK9A 5DG7A 1SC4B 1LFPA 2JZ5A 2BJEA 2HVEA 2XMKA 1H0HB 4YP3A 2PI5A 2WK4A 2DGSA 2ZBQA 2DNKA 1RU2A 2F8HA 3H4BA 1S1XB 3O1LA 1RHRB 5E3PA 1TZ0A 4CLFA 4UZCA 3UW1A 1WC5A 3OQ2A 3E01A 1SKSA 2K7KA 4P10A 2NYIA 4QW8A 3PO5A 1OSDA 2YKPA 1X0FA 3VQTA 4FN5A 5D8HB 3B4MA 5DS7A 5F0UA 2LXUA 3IM8A 4OV1A 3HZEA 1TK8A 3ETOA 4CZCA 3DFEA 3RRGA 1WHYA 4LFCF 2DGTA 2MGZB 2CJKA 3PW4A 1CJKA 2CQ2A 1B0VA 1UETA 2QLWA 3MFIA 2GS8A 4WFAQ 4DX8H 3OTBA 3MR6A 5F8GA 3EJMA 2HK3A 2HWIA 1NM2A 1XTZA 4MFBB 1OQ6A 4EBCA 4F2RA 1SXLA 4WKYA 4IQMA 3NGUA 4EMDA 2OELA 1HWLA 3WZ0A 3LGNA 2DNYA 2NCKL 2QV6A 2YWGA 3CSKA 1RAHB 4DSEA 3JB9k 1OS5A 2YKMB 2BM1A 1TUWA 2ROEA 1NBEB 5A8WB 2YKMA 2KVIA 2NSCA 2WW4A 3GJRB 5IFMA 5GMEA 5CXTA 2HNYB 3PJXA 3QGGA 3HSJA 3DGVA 4IO1A 3I0SB 2EG2A 4M5DB 2HYIB 5D78A 1R0AA 2MHEA 3OHAA 2EFVA 1KOHA 1WOOA 2E9ZA 3HI9A 4BHQA 5AJ3J 3CCWA 4DS4A 2Q66A 3IG1A 4YB6A 2R8IA 3G96A 2I5JB 1YZ6A 4CNZA 4P71A 4N77A 1C0UB 2QMXA 1SH0A 4NL5A 3MURP 1KS2A 4JI1F 3U1LA 4M63A 1N34F 2X3DA 1HD1A 4ZIVA 4JV1A 3K58A 5AXNA 4I2PB 5F8HA 1URNA 3M2RA 4F3OA 1AYEA 3MMJA 2NLWA 4A8FA 2HZAA 4JV2A 1RAAB 4U7UK 3LWLA 1SJFA 1KSPA 2B9XA 5A0YA 3PYDA 3NRBA 4KQZA 2QMWA 1SC3B 2GQCA 3TX0A 3N28A 4PWUA 1SI9A 4KH0B 3R3TA 3VGVA 1IBMJ 1Q8LA 1JLBA 3KYLA 1J5EF 1M1HA 1FRXA 3VAJA 1LWFB 2XGPA 3C15A 2J6TA 4OZNA 3G6ES 1JLCA 1LWFA 4HT5A 3CCZA 2LQ9A 3LTOA 1JWWA 3DOKB 1LW2B 4K59A 4PXBA 4PQAA 4ERDA 4OZ1A 3IWNC 1QTNB 3IAS9 1LW2A 1P8GA 4FS1A 3RBDA 3SQGA 1AXQA 2DRDA 4YB5A 1MROB 1LNQA 2RMLA 4PG6A 3U1MA 4I2QA 2N82B 2DNPA 2ZJPQ 4X4NA 4KRWA 4XDDA 2JWNA 2BQ3A 3R5CA 3DLGB 3IN5A 4LRCA 4OJ1A 2OMLA 1WDTA 1REVB 4J9NA 1S79A 3AQPA 4MJKA 2OI2A 5F8JA 1JLAA 3FCVA 3KFWX 1C0TB 1E6YB 1UMJA 5KFRA 4ZCKA 2PEBA 1JQGA 3HHEA 4LREA 3SFGA 2R7SA 3M2VB 3PEJA 2ZOGA 3FQLA 3CXCR 1QSLA 3LP1B 4Y2AA 3OXLA 4FPIA 1TUVA 2AMCB 1ZM9A 4CLPA 3LP1A 3PHTA 3QZ8A 1WDDA 4HHHA 1S0NA 3CD6S 4IUFA 4ALZA 4YQWA 1RACB 3M7VA 2EBEA 5KFZA 4K50A 4J9KA 3W2WB 2BE2B 4ZLJA 1RWVB 1R0CB 2LLZA 1RSCA 3OV7A 1VQ4S 2BE2A 4QZVB 1EQ0A 2P5VA 2ZKUA 2H9ZA 1N0VC 1KONA 4FYVB 4NZ6A 4CRJA 2HS3A 3U27A 3MPYA 1F2HA 4LFBJ 2GMLA 1FJGF 3NS5A 2KDOA 3GR0A 1PBAA 5AT1B 1FI4A 3W2VA 5HVGA 3Q24A 4FYYB 2E5LF 2UUWA 2KM8B 2NR0A 2K1RA 5J1PA 3W7BA 1X31C 1QAYA 2BZ2A 2RQMA 2K3KA 1BE4A 4IH5A 3ZTQA 3D7SB 1XMQF 1QUVA 1FJ7A 2B5JB 4DR4F 1SH3A 1KHVA 3LO3A 2XC9A 4L73A 2B5JA 3HZGA 1I5OB 2FY1A 3NOGA 4WBFA 2V69A 4DV3J 2YVSA 3JS9A 1G1XA 3HK2A 3HD1A 4ZVQB 1LEOA 3D6HB 2LKZA 2IVYA 3IRXB 1RQ0A 5DLFA 2V2ZA 4UQTA 2JL9A 1RJJA 1FWLA 2HQ3A 4IOCQ 1PBUA 3R1HA 4Q0BB 3RBXA 3NMRA 2RHQB 2AJ4A 3EPGA 1WF2A 1NEEA 4Q0BA 3NS6A 2UZAA 4NA3A 2C2ZB 3NG8A 3R9LA 1M90T 3EZOA 2Z57B 5DLGA 4RU2A 1VQ7S 2QZ8A 1HIYA 1CJTA 4ZPVR 3AQOA 4NXMJ 4QU7A 2CPJA 2DEJA 4C8OA 9RUBA 4LF6J 1FE0A 2E66A 4OI6A 3L09A 1Q5YA 3M30A 3FQKA 4LFAJ 3QZ7A 5C25B 3VZHA 4CYUA 5F41A 4PG5A 4FF4A 5IV4A 1S76D 5KT7A 4XAKA 2EK1A 2XSFA 3FMBA 3H4DA 3LH2S 1FWPA 2F4FA 5FLXU 1KKHA 4DBQA 3LAMA 2FHJD 2OD6A 4ED3A 2AGPA 3NXZA 2C2EA 2QA2A 2HRUA 2XZTB 2XYGB 1XJWB 2AD9A 5HN0A 4TU9A 3MM5B 4ZP9A 2APOA 4WZMA 3Q23A 2HBQB 3UD4P 3WX4A 2HURA 1A6LA 4FVCA 4PZVA 5KG3A 4JI7F 1Q95G 3UNYA 2C3OA 4DDFA 1N36F 3CDWA 4GRSA 1UFWA 3MR3A 1AUDA 2JFKA 2WB1D 4CI0B 1XERA 2VU5A 5GAEI 2KO1A 1LWCB 1B70B 3C16B 3M9MB 1RU1A 1VCTA 4TYAA 3C16A 3GP9A 4P75A 1GT8A 1UWAA 2BACA 2XM3A 1RCOB 1TAUA 1VQ6S 3BSCA 4TQSA 4CLTA 1HBMA 5KT5A 4WKRA 4JI3J 4DHVA 1H2VZ 4L3NA 1Q78A 2J7WA 2OHDA 4ZMMA 1FJCA 2F9DA 2VKZG 4EYIB 1VISA 1KEKA 3CCSS 3TJAA 2ZEJA 2NZ4A 4HI2A 5CHCB 4F50A 1XC9A 2CDRB 3CO9A 3GCXP 2IY5B 1YQHA 2ILZA 5D4PA 4BCAA 3Q8VA 3JAMU 1VIXA 4OI1A 2AWZA 3K5PA 4OL8A 1Y4ZB 2W4PA 5LM7E 3EVMA 3MCMA 4JOUA 2UV8G 3JYTB 4AT1B 1SUQB 4DV7J 2CYYA 1YRUA 3FFIB 5E41A 2E1RA 3BO4A 1DURA 3HX9A 1S10A 4KIAA 2J8SA 3CCLS 1X9WA 2WCXA 3L95X 4LIWA 5E3RA 1K9MT 2FY8A 5D4OA 3NP5A 2HNDB 4AE5A 4DUZJ 3E8OA 2D7SA 2HSEB 2OAUA 3GLJA 1BWVA 1FX2A 2HNDA 5DG9A 2HHUA 1FFGB 4B3TJ 2XB2D 4W90B 2CG4A 3MEDB 4M1KA 1VRTB 2ZVSA 1UWBB 3E2EA 1GXLA 4B02A 4DR7F 3R1LA 3MEDA 1Q5VA 3H0PA 1VRTA 2GMJA 1UWBA 2W9CB 3R2CJ 1UVMA 4O3RA 3I0RB 1WHVA 3DDNA 2GIQA 2W9CA 2DNGA 2XI3A 2CZVC 4DMZA 2JC0A 1FEEA 3Q8PB 1ROFA 3PJ9A 1X4CA 4GKKF 2YBVA 3W64A 3VGUA 1DTTB 3PW2A 2B6AB 2BBEA 2ZDOA 1VLYA 1TKXB 3L4BC 2H65B 2G1DA 2B6AA 5B0BA 4MT1A 4J9VA 2F8EX 5ETPA 5U47A 1UKUA 4HHJA 3CT9A 4DCOB 3OUYB 2AF6A 3O8WA 1SIWB 4M8LA 4USKA 1S1VA 2N4CA 2RVJA 4F4ZA 4A8KA 2JVOA 2A2CA 3MHYA 4AYBD 1ZAVA 2RE1A 4RU9A 3AD9C 4X4RA 4FYWB 1E6VA 3IMQJ 3NMAA 3MM8A 2E44A 5THWA 2MKYA 3I31A 2FPHX 3UPFA 1JLEB 2Z8QA 3K7RA 1OSCA 1X9SA 4F67A 1QSYA 4X84A 3IP0A 2W9BA 2O66A 2YWWA 2JFDA 1YITS 3I9ZA 3T1HF 2H4WB 3EXYA 5BJRA 1PCAA 1S97A 1KP6A 2XWXA 2XEXA 2CJXB 2B9WA 3BKTA 3HFKA 2E29A 3K8WA 2ZH3A 4KY3A 1S49A 2ZH2A 7FD1A 1FRHA 3PX0A 3KLEB 4A46A 2CPEA 2LMIA 4X65J 4R5PB 2I6WA 3W5ZA 5K14B 4C8KA 2KG1A 1FKPB 2QLXA 4R5PA 4ZLPA 3LP0B 3TAMB 4QWAA 5LT5A 4WFXA 4USHA 1CS4B 2VODA 2COLA 3DGPA 1WC1A 2VG5A 4JI4F 2WSCC 1T02A 3HHLD 2PMHA 3D68A 4OJ3A 2JX2A 3MM6B 3N6NA 4N7TA 2AEMA 2G0IA 3M8SA 4DL3A 1R8BA 1VFJA 4EK2A 3J7A1 4KKOB 3GJTB 4ZP7A 3T5LA 2N7CA 7AT1B 2AW0A 3M8PB 3FC9A 5CZXA 2QLBB 2XLKA 3KUEA 2YNIB 4NLPA 3P5BP 4UW2A 3M8PA 4A4JA 4QW9A 3T1YF 1AZSA 4CT9A 4TLRA 1U49A 3DRSB 2BE9B 5HQLA 2LEPA 1V5IB 3DRSA 2EC0A 5KFNA 4WIQA 1FESA 3M6XA 4ZHRB 2UV8A 2JNJA 3UCUP 4B9LA 4FPRA 1AROP 4KC5A 3MUMP 4X4VA 3SFUA 2ZNZA 3IBFB 2X7IA 5KFYA 2HHXA 4DZ6A 1KN6A 2LU1A 1FX4A 2O3DA 4DV2F 5IOLA 3TZWA 3MZIA 1B0TA 4LSNB 4DV2J 4NLRA 4ITSA 2ZWPA 1NRKA 3V6KA 3D6FB 4K4TA 4K4ZA 4LSNA 1X60A 4M5NA 1UJ4A 2BEFA 2R8KA 3A3NB 1GQEA 4Z2XA 3MXHP 1ZAWA 5LSRA 4NLUA 3MR7A 1R8CA 3R6LB 2D9PA 1HYSB 5HQMA 1HLWA 3THVA 1IR1A 5DQHA 4JI0F 3V6HA 4KV8A 3TA1A 5LXYA 2RB7A 2C1EB 4IFVA 2PGCA 3T5JA 4GMKA 4PXCA 4K4VA 3RUBL 3DHWC 3I9V9 2AGQA 1KTQA 2NPIA 4P7VA 2AU0A 1OPZA 4X62J 1WKLA 1RGVA 2ACYA 2W7PA 4LF7J 3ZZTA 3THTA 1U26A 2GVZA 2FC8A 2NYHA 2B0GA 4ZIWA 4UOFA 2V9KA 4TY8A 2R7TA 2PDAA 4DV5F 3F73A 1DHMA 1V3SA 3VQSA 4ZK7M 4ZPCA 3HT0A 3PRBA 1UFKA 4UTGA 2AJ2A 2IRUA 2VA3A 4NYPA 3N0VA 4CO2A 1FRIA 3W61A 4RW4B 3I6PA 1NKBA 2XO6A 4FF2A 1DQAA 2KT5A 3PM9A 4J91A 3ZZOA 4DPUA 2LEBA 3TUZC 3QIDA 1YDLA 4DCJB 2X1FA 1CBKA 3HCXA 4FXVA 3CTRA 3PG9A 4TQRA 3J80U 2XNRA 3IA0A 5ETTA 2J5AA 4JV5J 2AT1B 4E98A 2AJFE 3NBPA 4UOGA 1HPZA 1XN9A 1IKXB 3LANA 3NGSA 4UT4A 2UUAJ 1IKXA 3W8PA 2Q1LA 1HBNA 2VIHA 1S1UB 2RS2A 3EUNA 2CA9A 2DGXA 2D69A 4JV0A 1HWUA 4TKTA 1NB7A 4EGLA 1HHQA 1S1UA 1WI6A 4ZVEA 2G13A 5HK4A 2W24A 2HIQA 3G6XA 2OIHA 1H38A 1TVRB 4NYOA 2PFFB 4LF4F 2IBOA 4OX9F 4LF4J 1M1KT 1XEZA 5CYMA 3JAMY 1L5UA 3BDPA 3S6EA 2FVCA 2FZCB 1SB6A 1EX8A 2VV5A 2YX1A 1VR6A 4FYDA 1T9TA 2BJ1A 4U8VA 1F3FA 3BSAA 2V4JB 2BQRA 3D28A 4AD6A 4O3NA 3OXGA 4O44A 3DXSX 3FUYA 2EVZA 1C4CA 3FK4A 4NLXA 2J7KA 3FRZA 1X4BA 1UVJA 5H9FJ 4C4WA 2BM0A 2AKWB 1HNZF 5A2QU 2GV1A 2YQ3A 1S12A 4PUOB 3CCES 4PG8A 4P73A 1UVLA 4Q7AA 4WTYA 4X4QA 1GXTA 2NSBA 2MY7A 4DV6J 4DSFA 2YNGA 1N54B 1TV6B 3ENWA 2IYGA 1HMVB 1LK5A 2GMHA 2ZH5A 3O2IA 1TV6A 1MN7A 2OP5A 2N3LA 3UN5A 1OQ3A 4HI1A 5KFJA 2LYVA 4YN3B 5H9EK 4ECSA 5DDQC 5A8KA 1VK3A 5KFGA 5F9NA 5EWFA 3BQ2A 2AZ1A 1NJZA 4QR0A 2RKIA 2QA1A 2R7OA 2MZSA 3H25A 1VQ8S 1CJUA 4PKDB 5G4DA 3C2PA 2D1CA 2QL5B 3G82B 4DEZA 1N5SA 2XLIA 4C7QA 3HFZB 3OSPA 4PYAA 4CO5A 2CPXA 5I42B 3G82A 2W7OA 1FDBA 1SC6A 1YTYA 5I42A 1X4FA 5I4MA 5J2PA 2Y0BB 4MIWA 2OPPA 3QGIA 3H7HB 3IBWA 3JTPA 2LXFA 4LR9A 4OHYA 4HYKA 5KFBA 2XCPA 5GMKa 2PIIA 1EETA 3EPIA 1UCNA 2KKHA 1S9GB 1J2VA 4I6AA 2IFXA 1R31A 4DN0A 4WYLA 3HSDA 2VUGA 2U1AA 2FUG9 3G8SA 1P6TA 4B3SJ 1IBLJ 2RILA 2NPFA 2KFNA 4OI2A 1K0VA 3RBZA 3KXDA 4X4PA 3HKZD 3AOAA 4WU3A 3I56S 3KJVB 4Z7CA 4KO0A 4KE5A 2DR7A 4NMXA 4P2FA 2CIMA 3JQJA 3EDRB 4W98A 3KJVA 5KFUA 1ZM3A 2AGOA 4G3IA 2J0QD 1BMQB 4E0DA 2IAJB 2DB1A 4ZVSB 5B0GA 3WC0A 2MKHA 2V68A 2IAJA 3Q8UA 2WONB 3J7ZT 2WONA 2CPZA 1KLMB 4PYDA 4WXOA 4EFAC 2G4BA 1XBWA 5JXSA 3IS9B 1KLMA 3MUVP 1RTHB 1NKCA 1I1GA 3RZAA 3IS9A 2GGPB 4DR1J 2CPFA 1NZ8A 1RWXB 2GGPA 2RSQA 2P8IA 1K0TA 2DBBA 3TUIC 4ZKAA 2KXHA 1NZAA 3JTNA 2HWTA 1N5TA 4WCEQ 2DPIA 2R8HA 3MAAA 2MQQA 2XHCA 1GMUA 2D9OA 1IM6A 4PAAA 5JMNA 5DETA 3UQSA 1UVIA 5HBMA 4K0KF 3DU6A 3GYGA 3NKYA 1YLXA 2EKNA 4ZVTB 1U6BA 2NUHA 4O3QA 3MUTP 4V19X 3M32B 2C2KB 1M5PC 2YNHB 3D1HA 2WB4A 3R97A 2YPZA 3ZTRA 4R0EA 2UXDJ 1RYRA 3QJPA 4CCHA 3OR2B 2B56A 3ZZUA 3F0NA 3W1YC 1T05B 4Q8EA 3VV2B 1TL7A 1T05A 1EZZB 1YWXA 1PILA 3BBCA 4P9SA 3MAHA 3KLIB 1VIOA 2BUNA 4LRFA 2A0FB 1CQMA 4DCPB 1S9EA 3C6UB 3CO0P 4YFUA 5KFQA 3QRQA 1VQPS 2Z0GA 1RWMB 3VVTA 5CAAA 4Z7YA 2F5GA 2ZZMA 1YIJS 3RB0A 1WF0A 1RWWB 2RS8A 2Q6CA 2LP4A 4O3PA 1WC0A 2UVWA 4DG1A 2CFXA 2RRNA 2UXCJ 3SZ2A 5I3UA 2KH9A 4A8MP 4A8YA 4ATNA 2IM1A 3CUNA 3J7YI 5AXLA 2CAJA 1G2EA 5ETOA 1S57A 1FTRA 3FJ2A 4M5GA 1RI7A 1RT5B 1RWOB 4OLPA 3VAHA 4NLSA 1NNDA 1KD1T 4USTA 4U6PA 2EEYA 3HSGA 1H7WA 2MB0B 2RRBA 4KGMA 3A3OB 1F5BA 1G7CB 5HJXA 2X3GA 1NJYA 8RUCA 1SBRA 3KJNB 1JJHA 2RU3A 3M9OB 5J2MA 5T41A 4RBUA 3ZTPA 3GE9A 2MPUA 2MZQA 1U1PA 1ZPWX 1RBOB 3ZXWA 3TQ1A 1NK0A 1VHFA 1FE4A 1Y3JA 2IM0A 4LF9F 4HL9A 2WZ1A 3OTCA 2DGQA 1DLOA 1MG7A 2E1CA 1M5KC 7FDRA 2YKAA 1XNRF 3QAUA 4CM0A 1HQEA 3D6MB 2NXJA 3J80Y 2UU9J 1DTQB 1IQTA 1D1UA 4ILMA 3AOBA 5KT6A 2W4CA 4KSEB 3NY0A 1NPKA 3A8JA 1DTQA 2MTLA 2DHSA 2AYEA 2CJQA 2IBKA 4N47A 3IGVA 1Q7YT 2MZRA 2YNFB 3G9CA 1RUSA 4IR9A 1ZOTA 3ISNC 5CQGA 3Q8QB 4A8SA 2E7WA 3GILA 1TKTA 1HQUB 1KTVA 2H54B 4HTIA 4DSKA 1C1BB 4NLOA 3HFVA 4HHUA 2DY9A 3GTYX 2CQ1A 2BRKA 2QTWA 1ZPVA 2HHWA 1RT4B 2XNQA 2CQGA 1RT4A 2V4RA 4B9MA 1RE1B 4ZCMA 3T6BA 3VAMA 4ZVFA 1N5YA 4YUDA 2D3OR 3UDEA 5GADI 4IG3B 4WP3A 4GKJF 4USUA 1RT3B 3OL7A 4GKJJ 2ADBA 5E2QA 2DVIA 1YRXA 2ZFHA 3DOLB 2DNMA 2ATLA 4USVA 2KRBA 1BQMB 1ZTTA 3DOLA 1S6QB 2RQKA 2UXBJ 1BQMA 4CH1A 3CJSA 2Y9HA 3NCRA 1S6QA 3AB2B 1YJNS 2XYHB 4ZVRB 1RWNB 4AXIA 5KFFA 2E1PA 2I1RA 3V4IB 3OR1A 3PFEA 3OVSA 2IHR1 1D3WA 1ZETA 1T03B 2CQCA 3M8YA 5KFHA 3Q8YA 2KZMA 4WF9Q 2VD3A 2BOAA 2DO0A 5IC6B 1DZ5A 4B3RJ 3R5BA 4IG0B 3H40A 3SYZA 1S48A 4K5RA 3FBCA 4F36A 4CIOA 4EBDA 1RWUA 2IIHA 1AW0A 3U7JA 4KHPJ 1CVJA 4YR3A 4NOHA 1RAEB 2YX7A 1SQGA 2LECA 4NA2A 2GHPA 3EXCX 1NH7A 2E7XA 2HFNA 3GSIA 3KNGA 1KRPA 5ETKA 2XSJB 2RUSA 2ASDA 3A4TA 1MSWD 1WSRA 1VQSA 5F3TA 2XSJA 2MYFA 2QFIA 1L3UA 2WW8A 2G1HA 5HMZA 5EGYA 3MMAB 2ZBRA 1LXNA 1S99A 2DNQA 5B0DA 1UEUA 3OTOF 3VAKA 3MMAA 2RDDA 2YWHA 5FDLB 1EKRA 4UY8T 3I32A 2VC0A 3PV8A 1G6BA 2IA6A 3CJKA 5HROB 4B3MJ 3JSMB 1X4HA 1VBKA 4Y2MA 2ZJRQ 3MTJA 5IT9Y 1FDNA 2DPJA 4ED7A 2WTFA 2M70A 3L9ZA 4ID5B 3JSMA 3HKWA 3ZC4A 3HVTA 2QYCA 3N6LA 2NUUG 4ID5A 2LFVA 1GAOA 1FT8A 3FKBA 3NEKA 4EWTA 1ZAXA 2D74B 3GB0A 3MEEB 3DRRB 1PC5A 3BGRA 2HVDA 1FKAF 5KT4A 3UE2A 1FJEB 3AXKA 3DRRA 1F6TA 4U7UD 4BC7A 4PWWA 4RW8B 1TQLA 2I8EA 1QAJA 3MM7B 4J9QA 2YH1A 3MM7A 2KRRA 3IC1A 2Y3YA 4M5IA 2B7CB 1RHKB 2MJNA 4B9VA 4ZP8A 3CB4A 1F3VA 1CJVB 3RTVA 2OPQB 2GQQA 5B0EA 2LVWA 2J9CA 2E5JA 2F8MA 1CJVA 3FBFA 4LF5J 1NLKL 2M2BA 1W2IA 2EWHA 1T95A 3OLAA 1FHTA 4QPTA 1Y3KA 1HBOA 1HARA 3ENQA 3X1LB 3M8QB 2V2KA 2UVRA 3G4SS 2XBPA 2R7UA 2KT3A 3DLLQ 4JI8J 5LSOA 2P2CB 3VHQA 2P9EA 4Q5VA 3VGTA 3D0IE 4OZ2A 3CW2C 4IYQA 5K20B 4CLKA 3H5SA 2HHHF 2XMMA 5A76A 1FTCA 4IOBA 4K4SA 2IVFB 2VICA 4FDFA 3BGFA 2JEGA 3KK1B 2GCFA 4IQXA 1UJ6A 5GAGI 3EICA 3KK1A 5D4LA 2FJDB 1RT2B 3B6BA 1PO6A 2R4FA 2X1AA 5D4NA 2QE5A 2ZOMA 1U0HA 4YS2A 4PR6A 1UA1A 2QJ3A 3PVXA 5T14A 5HI7A 1VQYA 1WUUA 3NS7B 5E3AA 1OY9A 1OYDA 5IQ6A 1LFWA 3PEHA 2KYXA 2ZH7A 3EWGA 1T7PA 2K2PA 3ITHB 4CWBA 1FXRA 1VBZA 1PJ7A 2XWYA 4M95A 3H2UB 4K4WA 3ITHA 3L7UA 5LJ3Y 1H74A 3MR2A 4IH6A 1JLFB 4CO0A 3A8EA 1N32F 2RDIA 1N32J 1FKOB 1SJQA 1T9YA 2HS4A 1JLFA 4ZCIA 1WI8A 4JI5J 5F8MA 1FKOA 1BHNA 4LRAA 5D3GA 3H5YA 3L3CA 3U02A 2Q3PA 4U7CA 1LQ9A 1TMJA 4KFBB 3OTDA 4YR0A 4R25A 2VFUA 4KFBA 1VRUA 4H4KC 4DQSA 4NEYA 2ZM6J 1U47A 4WFBQ 3GFHA 4I4BA 5B7WA 1H6KX 1Q8IA 1P1TA 4CH7A 1HNXJ 2V5HG 2FZGB 3PXGa 4KGKA 2V34A 4YDXA 3KUHA 2IMWP 2P6SA 3OBIA 4I7FB 2J7UA 2CUYA 1VYAA 4DR5J 3CNQP 1C2PA 3B78A 4ID8A 2PEHA 2HVIA 4L74A 1MLAA 1XR7A 3SBMA 1FNOA 1HBUA 3ILLA 4ZN3A 1VGYA 1T11A 2R8GA 1X4EA 1QAXA 1NDKA 2YPYA 2PA8D 2YKOA 1Q81T 5C7PA 2YH0A 5F8IA 3MEKA 3DLEB 1TAQA 4OIXA 2P9CA 3DLEA 5HVFA 2KFYA 1BWEA 3IRWP 2MKJA 2OKQA 1HWJA 2VPYB 2LA4A 4DV1F 1BLUA 4ETZA 5F3ZA 1S1TB 4NCGB 4NLWA 2E7VA 3I5AA 3V6JA 4C48A 4QWEA 1UL3A 4Y34A 4DQPA 4NCGA 3D0HE 2R9LA 3SSSA 4Q45A 2L41A 5C24A 2I0XA 2GJ2A 5IWAJ 2QFJA 2ALZA 3HHLA 2YWKA 3LA0A 1WG1A 2V2VA 3R7SB 5L46A 3I4HX 4ECUA 3J81U 4PPDA 2BVZA 2V4QA 2HHQA 4IFYB 2LCWA 3KLFB 3M1VA 3AAWB 1EJ7L 1HKAA 4FZVA 4P74A 1VS3A 1LWEB 4IFYA 2J9DA 5A8RB 3KLFA 4O4GB 3OXFA 3IBCB 1LWEA 4PWDB 5A8RA 4O4GA 3QSYB 4ZDNA 2DEIA 2OTJS 1FRJA 1WTBA 2HEKA 4H4KA 1KWMA 2FLLA 3FCWA 1UW4A 3MEGB 3RW6A 4C11B 1GFWB 1GH8A 2BJ9A 1I6JA 4CTAB 4DR6F 2L3MA 4AQYF 5M2RA 3OSNA 2W2PP 4ECTA 2Z56B 1DARA 4CTAA 5AE2A 4OMFG 1B0PA 4TU8A 2ROGA 2W1BA 3SCIE 4MMOA 4DV4F 4TXSA 5IM0B 1RWPB 3DOMB 1KVJA 5LJ5Y 5IM0A 1VRQC 3K57A 2C2OB 3HO1A 1BQNB 3DOMA 4UUXA 2U2FA 2MQLA 5GAHU 5IT0A 2R2RA 1TKDA 1SL1A 2W01A 5LMUJ 3CF5Q 4ETXA 3I4PA 3KMQA 1MMNA 4FF3A 3KK2B 3G6VA 2XY7A 1D9DA 5KFPA 4N8NA 4QIGA 5L9XA 1LW0B 4AUKA 5E7OB 1U45A 3NLCA 1MU2B 2QN6B 2BE7D 1D9FA 2FVPA 1FD2A 2FJEB 1G4CA 2DKOB 2QLFB 3OFFA 1MU2A 3M2UB 3MCNA 3T41A 4ED1A 1IKWA 3M2UA 3T19A 2XMUA 4MKYA 2ZJQQ 1M1GA 1WC4A 2XYPB 3DM2A 3THPA 1FK9B 3NAHA 4R0JA 3HP6A 1IWGA 1GK8A 1NHVA 9ATCB 2GQ2A 1R3NA 1T9UA 2ZC4A 1SIZA 4C6AA 3CCUS 1I51B 2DH8A 3G2XA 2DR8A 2XO7A 4U9RA 1N52B 3RB4A 4WU2A 3AY0A 2KT2A 3E01B 1B99A 3PZPA 3MPUB 2HGMA 2F4VJ 1QDUB 4HKQA 1WTFA 3K8VA 3BKUA 4F04B 3KMSA 2XMAA 1RT1B 1F1BB 4IRDA 1ZTWA 2ZDPA 2K7JA 3TYTA 4CLLA 3OTEA 1RT1A 1S59A 3O6QA 1Y5NB 1IM4A 2VFVA 3X3UA 3CC4S 3GV5B 3CJRA 3PTWA 1CJKB 2YQ1A 1XK8A 2LQJA 4N76A 5FJ4A 4DFPA 1HW9A 1OY6A 4EZ6A 4JI2J 4H54A 2H3EB 1U0SA 3KG1A 1K73T 1GTHA 4MYUA 2AX1A 4LBPA 2GHWA 1HNIA 2ACMA 3N01A 2NXNA 4F02A 1WWHA 4K4XA 5DQIA 2ZH8A 5D0HA 2W2NP 2VC1A 3BDEA 3GSDA 1WOPA 2BRLA 2YY3A 4KH1B 4DU8A 2V94A 2OGUA 2PN6A 3TW0A 1R0AB 2KI2A 3C14B 1K44A 1RAIB 2R7RA 5F9LA 1D09B 3C14A 1MMDA 1G3OA 3DHXA 2XZDB 2WVEA 4USWA 4ECXA 3IG1B 1QAIA 3OL6A 4FXDA 5CYJA 3E51A 5AJ3F 5C2GA 1TU0B 3SSRA 3N5BA 3S01A 4F0KA 5A6WA 1X9MA 5HANA 4NZ7A 3N5FA 3K17A 2L08A 3N9UC 2Z4PA 1U1OA 2GFFA 5H9EJ 4C98A 3AJDA 2Y1IA 2J0XA 1NCLA 4RKUC 3UD5A 4PPZA 3M2RB 4DPOA 2M8DB 2GA7A 2EG1A 4YY3J 4LF8J 5L39A 1RHJB 2VG6A 1EHWA 2XGQA 2V8GA 4LF2A 2DNHA 1NO8A 1NSKL 5A0YB 3LPEA 3ET6A 4RUAA 4RW9A 1P1LA 1RA6A 1N48A 4AL5A 3QNWB 2AJQA 1GMWD 4MKVA 5ETMA 1LKZA 3ICLA 1KVIA 4RUCA 3R7BB 4WE1B 3PW7A 2F9JA 3BQ1A 1JLQA 3MOJB 4QJVA 3VAIA 1JLBB 1IBMF 4WE1A 3N4WA 3TA2A 3V6DA 5KFSA 2OPRA 3BR8A 3QFWA 1IQZA 2RH3A 2ZITA 3C15B 4P2XA 5K8PA 1JLCB 4UOHA 3V81A 3ETMA 3K2YA 3KOAA 2O01C 4BLGA 2ZUAA 1M5OC 3Q22A 3PY8A 2IJNA 3SQGB 1NB2A 4DR2F 2MQOA 3ILOA 4DR2J 4I2QB 4ED0A 4GC6A 2CQIA 2VH7A 1UA0A 3BBFA 1WSVA 2OFHX 3IR6B 1OO0B 3Q8RB 3RB6A 4MK8A 3PJWA 5IS2A 2MQPA 2I2YA 2HPUA 5L1JA 1HNWJ 4ICLA 3CIMA 2IC3A 2FVRA 3SV3A 2VPXB 3QLHA 4M94A 4GO5X 4USIA 3PRDA 1OJ4A 2ZBIA 1CULA 1JLAB 4LVOP 2QRRA 4ELUA 4CO1A 5HQ8A 4YHHJ 2W7AA 5KG4A 1R6YA 1P27B 1KDNA 1PYTA 4ANCA 2HHVA 1QLNA 2V8DA 5GVQA 4RWXA 2JLFA 4MK9A 3JTOA 5J2QB 3QPIA 3EGVA 2HQCA 1IKVB 4DFKA 2KJWA 4F3QA 1NU4A 3A8IA 5J2QA 1FFWB 2PT0A 1IKVA 4TLQA 4BDPA 4OJGA 4HH1A 4M5MA 4Y2CA 1RB0A 1F9HA 2VOPA 1ZZNA 2MQNA 3KKFA 4QWDA 4JP8A 3TZZA 2GJIA 3QJJA 4K5SA 4K4UA 3AHPA 4LFBF 3NGRA 2AIRB 3RGIA 3DYAA 3TJ9A 1P9QC 4NLDA 3CCRS 2UUCJ 3W2VB 3D2WA 1IUJA 3J81Y 3UNGC 2HK2A 4IOAQ 3GV8B 2K1RB 2CQHA 4Y6IA 2R7VA 3ZZZA 1KBRA 4O3SA 2CPIA 4RBVA 4ED6A 4DV0J 3BYRA 2XMVA 2DNOA 3HPOA 2RF2A 3O5TB 3CCVS 2R2SA 3H2LA 3MPWA 1KQGB 1YZ7A 2H4YB 2XS2A 4UZBA 2CWXA 1KLNA 1XMOJ 1J27A 1S0VA 1Q1KA 2C3YA 4J9MA 3SEOA 4LBHA 5LOQA 4HACB 3PFOA 4GVLA 5BXIA 4BC9A 4JI6J 2IJFA 3CC7S 2CJYB 1QD1A 4HACA 2CKWA 4DV3F 1YVFA 2V9WA 1RTDA 3RG6A 1WD6A 5K5MA 4A47A 4DL2A 1R0BG 1LV5A 2E1MC 3BYPA 3SI8A 4PQUA 1TR0A 2V8VA 1N56A 3AOCA 1JKHA 5B0FA 5I3QA 3IWXA 2MKCA 4Y3CA 3UFCX 3PKYA 1IJFB 3DDKA 3LOUA 3Q2TC 5J2NA 1U2CA 3PHEA 1CJTB 1YK9A 2MLXA 3BF4A 1NDLA 2B4PA 2HVZA 2DNLA 2ERRA 1GEHA 1FXDA 3DLKA 4NXMF 3ZNJ1 3MMBA 2CG8A 3KUGA 4QR2A 4FKYA 3M30B 4Z37A 2DTJA 4LF6F 3M6VA 2HFSA 3F41A 3FEYB 4CYUB 4LFAF 4G1IA 2ASLA 2ZKTA 2EI5A 3H98A 2LDYA 3IWLA 3P49B 1Q79A 2MKSA 2XMJA 2ZBCA 1YRTA 1JJ4A 3QQCD 5JVGQ 2Y8YA 5IT4A 4NEZA 2DNRA 3W60A 2GAGC 5F8NA 2FB0A 1PYOB 4EBEA 3WBZA 2BJ8A 3OFEA 4XK8C 3PX4A 5KFOA 1NJWA 2MJUA 1NK8A 1B3TA 3BBBA 4NWBA 4A8QA 1T9VA 2GJFA 3M9NB 3GIRA 4KPYA 2IM2A 2ZE2A 2A1BA 2WVFA 4DXLA 3TEGA 3NGKA 4ZLNA 2YKNA 3OPKA 5IC4B 1C1CB 4USMA 5DO2A 1SJ1A 3EX7B 1D0EA 3K5MA 4ANDA 1RK8A 3RJMB 1C1CA 1UPMB 3MOZA 1S6PB 3PR5B 4QCLA 3IFEA 3J7Z5 1S6PA 3HHNB 1HBMB 3ONQA 1TMMA 2BANB 3K59A 2IA0A 5JUMA 4JI3F 2HGLA 3LW5C 2BANA 4Q2MA 2PE8A 4UUWA 2HVHA 4DX5A 4F2SA 2BW7A 5G0RA 4DL5A 4I1TA 5DZ6A 3QT5A 2HLTA 1DAXA 4I64A 2JC1A 4DR3J 4NLQA 3MD3A 1Q8BA 2MY8A 2Z30B 2MZ1A 2ABYA 4ER8A 1AT1B 1YBAA 5LMNJ 4FNIA 3EVWA 4PCQA 3BM7A 1YJWS 5KFLA 4JYAJ 3D3CJ 4WXWA 4G1QA 2E1AA 2VFTA 4DV7F 1JLGA 2ASJA 1N6QB 2VF3A 1FD8A 1ITPA 1RCXB 3BREA 2AEJA 1N6QA 1WEZA 5K8NA 2CZ9A 3ENAA 3LWMA 4H4MA 3R5GA 2B7BB 4F8RA 3FDSA 2CQ4A 5KFIA 4IDKB 3KG4A 4DUZF 2XULA 4CH0S 2OUGA 3MECB 4RJVA 4IDKA 3UO0A 3KLVA 3NGTA 1HA1A 3MECA 2B8PA 3GIKA 1TL1A 4B3TF 2RQCA 1XNQJ 3U1NA 1UZDA 1C4AA 1S0OA 1UVKA 3CJ2A 1BY9A 2JEFA 5KOWA 5DGBA 3C19A 1FFSB 3PYFA 5KFTA 1N33J 1Y5IB 3QWPA 3GYXB 4JB8B 1R6VA 2VFRA 4ZPAA 5ETQA 1YJ9S 1U2FA 4MIBA 3KLHA 2R2TA 1FXLA 1DJ0A 2WBMA 2DIVA 2BKNA 1FEHA 1SJ4P 4KAIA 4QQBA 1VBXA 5D0EA 1PAUB 4DF4A 3D1OA 2UP1A 4F25A 2LA6A 1JXLA 3R27A 3QO9A 1Q82T 1VQMS 1LXJA 3TP2A 2MMYA 2O67A 3QRRA 4K8RA 3BS9A 4B9NA 2RQ4A 5J1EB 1S1VB 5BYRA 2HS0A 4ZOSA 2VASA 4X4OA 3Q8SB 4LSZB 3LUYA 5J1EA 1FDAA 1E6VB 3SCJE 2W8KA 1WOSA 1QVGR 4C3KA 3MM8B 2WRMA 2HFVA 1SC1B 3T6JA 4CM2A 1D8ZA 4NLVA 2CRLA 2Y1RI 2DITA 3CVKA 2V50A 3J7AN 1DFDA 1KVKA 4ECVA 2W9BB 3QWUA 3PNIA 3FEXB 3KJFB 1Q7LB 1S9FA 4XPEA 3BKFA 2DR6A 2NREA 4ED8A 4TN2A 1WC6A 3R5AA 2HRYA 2PC6A 4FP9A 4AXJA 1NPPA 1RT7A 4OQJA 5KG0A 5CYQB 1WJ9A 2E5HA 4QYRA 5AXKA 3DMJB 3VR1A 2H5EA 5DQGA 2RAQA 5CYQA 2DXEA 3TUJC 4NI2B 3GR1A 2LDIA 3DMJA 3BB5A 4B17A 4X65F 3QGPA 2FHOB 2VQFJ 4NI2A 3H8YA 4C8ZA 3PW5A 4OZLA 4KHMA 1EAYC 3DGPB 1AFJA 3QATA 2VG5B 2POKA 1KR4A 3RR7A 1Y0HA 1HHSA 2B9EA 1M5SA 5KFMA 1Y5LB 3D67A 2C3PA 2ZH4A 2EFPA 3JQKA 4C2MA 2GAHC 2A2DA 3LP2B 5M2UA 3CCTA 4RNMA 3MR5A 5LSLA 4PEOA 3K5OA 3LP2A 2VJVA 2XCAA 4RW6A 1NMEB 1YG0A 3CMES 1AZSB 4N56A 4GO7X 4X66J 1EP4B 2PFDA 3G6YA 3BQ0A 3TUPA 1EP4A 3ENVA 3CJ4A 1MWYA 1PJ5A 3UCGA 1RISA 2ZHBA 1B64A 2C28A 1QSSA 2YQ0A 3CIZA 2G0JA 3C8YA 3DLJA 2VA2A 1NH8A 5RUBA 2QO3A 1B7YB 1Z2LA 2ZWOA 3T9ZA 1NK5A 3AFGA 3W63A 1CC8A 4OI4A 4ILRA 4LJMA 1S1XA 5C2CA 4FBUA 1JK9B 3MMCB 5B0CA 3ZZYA 3UI3A 3PX6A 2M8HA 3WC2A 3MMCA 1UW9A 3LF0A 1LOUA 4KV8B 4TU7A 4E2FB 1RXOB 4OYZA 4LFCJ 1R8HA 4OYAA 3B8HA 1KHWA 2VDIA 1YX2A 2VBXA 4IFVB 2BJ7A 3BH7B 3EGNA 4WFYA 1IWAA 2VG7B 2MGZA 1UEKA 2JJ4D 3ULHA 4XIUA 3VALA 1U4BA 1F5CA 2VG7A 4Y65A 1UPPA 1U2RA 4MFBA 5L1LA 4H4OB 4X4TA 4X62F 2GVZB 4LF7F 3V4MA 4DFJA 1VK8A 3DKDA 3PYEA 4TY8B 4H4OA 1Y11A 2EXUA 1F60B 1JJ2R 2FIUA 3KDNA 2QGFB 1H73A 1RADB 5A8WA 4DS5A 2AHOB 2C2RA 2GC8A 2HG4A 4RX6A 1CLFA 5K9FA 4RZRA 5GAEU 2P6TA 3I82A 2HNYA 1X8DA 5I3PA 2DNNA 3I0SA 1Y7PA 3HMJG 4M5DA 5ETNA 5C5JA 2W2MP 4UY85 1S5ZA 4BWMA 4B9SA 1U1QA 2K06A 1X5PA 4MKAA 1VJQA 2OD4A 3A13A 1BXNA 1X4GA 1GXUA 1S1WB 1HD0A 2O1PA 2I5JA 4R8UB 4HDGA 3NBPB 2MKKA 4JV5F 2PD1A 1HPZB 1T9XA 3FNNA 1S1WA 3MWBA 2QL9B 3PCOB 1C0UA 2JLEA 3QJLA 4I67A 4ZA1A 4R8UA 4CO3A 4CLYA 1NSQA 2E5IA 4JI1J 1HBNB 2UUAF 1N34J 1MW7A 2EK6A 4Q43A 3D3BJ 4DLEA 3C6TB 2OSRA 4I2PA 4FYXB 2WOMB 3KHHA 2UVUA 4RNOA 3C6TA 2LQ5A 3BGLA 4QOTA 3TVYA 4OI0A 2WOMA 5CYMB 2RD5C 3PO4A 3D0GE 4URQU 4J9PA 4DUYF 3W5XA 3A3PB 4DUYJ 4DU7A 3ZZPA
chains in the Genus database with same CATH topology
4KGKA 2HNDA 4YDXA 1W2BR 1B7FA 5HLFA 2IMWP 2HZCA 2YNFA 5DG9A 4J5OA 2P6SA 4O44B 3OBIA 2HHUA 4I7FB 1JLQB 3CWJA 2KM8C 2J7UA 3POTB 2XB2D 4W90B 2CG4A 5KG1A 3MEDB 3RW7A 1HW8A 4YB1P 3V6DB 1QUPA 4NPOA 2A18A 4UQGA 4ZPWR 3DLHA 2OPRB 2X51A 4M1KA 5ADZA 1VRTB 2ZVSA 1UWBB 1HQUA 1NK6A 3E2EA 1GXLA 3POTA 4B02A 4DR7F 3R1LA 2RJZA 3MEDA 3TRGA 4ELVA 4D3GA 1C2PA 3B78A 4ID8A 2PEHA 1C1BA 1VRTA 5CA5A 2GMJA 2HVIA 1UWBA 2DT9A 1URRA 5DG8A 2ZNYA 3V81B 2W9CB 2W25A 1XR7A 3RAXA 3NNAA 4ZVGA 1UVMA 4O3RA 3I0RB 5EWGA 4WYWA 1WHVA 2ZH6A 5H1SV 1FVSA 3DDNA 3HDSA 2GIQA 2W9CA 2DNGA 2YNGB 5J1NA 1FNOA 1HBUA 1VQ9S 3OLBA 3DOKA 1R8PA 2XI3A 1VGYA 2CZVC 4DMZA 2VZ9A 2B9YA 4DV6F 2R8GA 1X4EA 3O44A 4F4KA 1QAXA 1OWXA 2F7VA 2JC0A 5IQQA 1JNRB 1FEEA 3TARA 3Q8PB 1ROFA 4P7TA 1X4CA 4GKKF 2PA8D 2YKOA 1WF1A 1Q81T 4HDHA 4DN9A 2YH0A 1KFDA 5F8IA 3TA0A 3BSOA 3KWMA 3MEKA 1DTTB 3DLEB 3PW2A 4OHWA 2B6AB 2BBEA 2AX0A 2ZUGA 4PXEA 2ZDOA 1MROA 1TAQA 2QT7A 1VLYA 4URGA 1L3SA 2J9DE 3D54A 1TKXB 5A8KB 4OIXA 2ZH9A 2G1DA 2P9CA 3DLEA 1TFYA 2KFYA 2B6AA 3FMWA 1BWEA 5B0BA 3IRWP 1X0PA 2MKJA 2OKQA 2RKIB 4ICLB 4IG3A 1BD6A 1HWJA 2VBYA 4C8YA 2IC3B 2DK2A 1UP1A 2VPYB 2F8EX 2LA4A 1V3RA 4DV1F 1BLUA 4ETZA 5F3ZA 3QLHB 1RT3A 1HNWF 4Y28C 1S1TB 4NCGB 3DLGA 3IR7B 4NLWA 5A2QY 5U47A 1UKUA 4HHJA 1VI7A 3I5AA 2CVIA 5EDWA 4QWEA 1HI8A 3V6JA 2XI2A 1REVA 1UL3A 3TAQA 4Y34A 4DQPA 1KNZA 4NCGA 4NLYA 3D0HE 3CT9A 2R9LA 3GG1A 1NKEA 4DQRA 3OUYB 2AF6A 1U7LA 3SSSA 4Q45A 4HLBA 3MD1A 1C0TA 3BZQA 1E6YA 3O8WA 2AYBA 4B9UA 4RNFA 2L41A 2HAIA 2R8JA 2VQEF 2HHTA 1SIWB 4M8LA 5C24A 3OL8A 2I0XA 2GJ2A 4QIFA 1S1VA 4YHHF 2QFJA 2N4CA 2BV3A 1K1QA 2RVJA 2HFZA 2ALZA 3HHLA 4PXDA 4F4ZA 3M2VA 4F4YA 4A8KA 4DL4A 2JVOA 2YWKA 5D6GA 2A2CA 1WG1A 3MHYA 5J2PB 4AYBD 1ZAVA 2AP6A 2RE1A 4RU9A 3RRKA 4ZS6A 4X4RA 2OPPB 2RRAA 1E6VA 2DHAA 3I4HX 4ECUA 3F44A 1U1LA 2KJVA 4PPDA 3V4IA 5JVHQ 2BVZA 2V4QA 3NMAA