1BQNB

Tyr 188 leu hiv-1 rt/hby 097
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVEPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRALSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords REVERSE TRANSCRIPTASE
total genus 86
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqnB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnB03
3ITHA 3JSMB 4ED7A 2JEIA 3OL9A 4IRDA 3KJVA 3MFIA 2ASDA 3DOKB 4ZP7A 1OS5A 3IG1B 3V6KA 4MFBB 1N4LA 2ILZA 3CDEA 4XPEA 3KK3B 4I2PB 1S48A 5EWEA 4FS2A 4YR2A 1RTDA 3FQKA 3UDLA 3G6YA 2GC8A 1TVRB 2YKNA 1YVFA 3V4IB 2AQ4A 3CWJA 1REVB 3LALA 2I1RA 4IH7A 4G3IA 5DLFA 2FVSA 2YNIA 2FLLA 2BRKA 4ECSA 3NKYA 3UQSA 1BQMA 5T14A 1TQLA 5L1KA 5CYQB 3Q8PB 3T5JA 1RTIA 2XCPA 4KO0A 4URGA 5CYMB 4ZPDA 4ECYA 4WFYA 2FJXA 4ED8A 4URQU 1HMVA 4MIBA 2BANB 5L9XA 3LP1B 4KHMA 3V81B 1RT5B 4EYIB 1LW0B 5F8GA 1TP7A 4ZVFA 4RW9A 1GX6A 1DLOB 4EO6A 4NZ0A 4B3OA 4I7FB 3H98A 2BQ3A 3TQ1A 5K14B 1RTIB 1MU2B 3GV7B 4Q8FA 4K4UA 4ZHRA 4ECWA 3V6HA 1N56A 1TKZB 4DL5A 4RW6B 2J6UA 4DG1B 2E9TA 4Q0BA 4PWDB 1RT7A 2ZE2A 3QGGA 4RU9A 5KG6A 1JLGA 4RW8A 5DGBA 2AWZA 4ZP8A 1T03A 3GILA 2UVRA 3KLFB 3OLBA 3KLIB 5KT3A 2V4RA 4ECVA 4NRTA 1XR7A 1IKYA 4QWCA 4URSA 2J6TA 1LWEA 2VG7A 3QYYA 4OL8A 1RA7A 4EBEA 3QGHA 4RUCA 1RT4B 2HNZA 4TYBA 1RTHA 3QZ7A 4I2QA 2UUTA 4ZP6A 4YQWA 5DGAA 4K4XA 3HVAA 4NLUA 4IR9A 3LP2B 4NLQA 5KFPA 3RAXA 5J1EA 5DG7A 1NNDA 4RW4A 3MEDB 4TY9A 4K4TA 4DL2A 5HBMB 4ZVGA 5KFWA 3MEGB 3FRZA 3N6MA 1JX4A 2OPRA 4F4YA 1RT2B 2YNHA 5J2QB 1FK9A 3DLKB 3QO9A 4EBDA 2AGPA 5FDLB 3KK2A 3PR5B 1EETA 3BSNA 1EP4A 5J2MA 4NRUA 4M94A 4MKBA 4NLSA 4QWEA 1BQNA 3EPIA 5KT6A 1RT1B 4I2QB 1C1CB 5KFZA 3KK1B 3NBPB 1JIHA 4TN2A 3HKWA 2BE2B 5D3GB 5KG7A 2VG6B 3HVTA 3KHLA 4F4XA 1JKHB 4RUAA 2YNGB 3MEEB 1S97A 3C6TB 2C22A 3MEGA 3NGDA 3H4DA 3PW5A 3FSIA 4MK7A 5KT2A 1IKVA 5C42A 3GQCA 3MEDA 2BQRA 2OPQA 4O3QA 5KFOA 4GC7A 3DDKA 3E01A 3I5AA 4WYWA 5KFMA 4ECZA 2GIQA 1TV6A 3IRXA 5KFXA 4IFVA 3CJ3A 4HYKA 3RB4A 2C28A 3LANA 3RAQA 4JV2A 4IQXA 5F9LA 3H5SA 1S1XA 1ZTWA 3N6NA 1N6QA 5CYMA 2R8KA 4QW9A 4DL3A 5KG5A 5C25A 3IN5A 3SFGA 3QIPA 2AU0A 1LWCB 1TKXB 2AX1A 4RZRA 1IKXA 1TKTA 1FKPA 3KLEB 1S49A 2DPIA 1TL3B 1TV6B 3IRXB 1JLQA 3MR5A 2V9WA 5KFSA 1C1BB 4Q8EA 4NLYA 1RYSA 5I42A 4Q45A 1S0NA 3DLGB 3CJ2A 5KFGA 1LW2A 1QUVA 3GYNA 5KFTA 3NMAA 4KV8A 4ZPCA 4O3NA 3EPGA 4ZHRB 3JYTA 3KHHA 2FVCA 3DOLA 5EDWA 1S9GA 3BQ2A 2VA2A 4RNFA 1DLOA 4FBUA 5JXSA 3KHGA 3OHBA 3JSMA 5I3UB 2CJQA 1RT6B 4H4MB 4LQ3A 4O3RA 3RB0A 3OLAA 4MKAA 1C0TB 3PW2A 1TVRA 2YKNB 1NHVA 3FQLA 4NLXA 1EETB 5KFNA 1RYRA 1LWCA 2IM2A 4ZVEA 4QW8A 4K4WA 4LSLA 4MFBA 4NLOA 3BGRA 4TY8B 5DQGA 3PZPA 3RB3A 1IM4A 3NAHA 2FJWA 4QPXA 1BQMB 3DRSB 1HNIA 2IAJA 2YNFA 2W9CA 3LP2A 2XC9A 4K4ZA 4R5PA 2IJFA 3D28A 1ZETA 5JUMA 4Y2AA 1ZTTA 1S4FA 1C0TA 4NLVA 1DTTB 1HQEA 3Q8RB 2AGOA 3KK3A 1RT4A 2HNZB 1QE1A 5J2PB 3PVXA 4IG3A 4WXOA 5KFAA 2R2RA 5F8LA 4NLRA 1S10A 4RNOA 2R2UA 1S1TB 3GIJA 3DMJB 4MH8A 3UR0A 1S6PB 2WCXA 5F8NA 5J1EB 4DEZA 3E51A 2V0NA 1T94A 4KBIA 3OL6A 3LAKA 1HPZA 1RT7B 1HQUB 2QV6A 3N6LA 2YNFB 2W9CB 1JLFB 5FDLA 1DTQB 1N5YA 2UUWA 1C0UA 2YNHB 1UWBA 5J2QA 1RA6A 4IFYA 5KFYA 4ECRA 4ECUA 5KG3A 4KSEB 3H5XA 4NLWA 3KLHB 1LWEB 2OPSB 4F4WA 1VRUB 2B5JA 3RBDA 1WNEA 4TQSA 1JLBA 3MR2A 5HLFA 3QZ8A 3I0RA 3T5LA 1S1VA 4IG0B 1UWBB 2R8JA 1T03B 2C2DA 3CDUA 1JLFA 4J9NA 4H4MA 1RT6A 5I3UA 4R8UB 3BQ1A 4ECXA 1RTJB 2RKIB 3DRPB 1RTHB 2D7SA 3QIDA 2J6SA 4K50A 4RW6A 5HLFB 1TKZA 2B6AB 4F4ZA 2IC3A 4IDKA 1RAJA 3RBEA 1MU2A 3H4BA 4O4GB 1SV5B 4DL7A 4B3OB 2ILYA 4IOBA 3ISND 3KLFA 1C0UB 3FFIA 4IKAA 2VG6A 3HVTB 2FJVA 5DQHA 5KFJA 4R8UA 1JLQB 3V4IA 5J2NB 2I5JB 1N48A 3LP0A 3ICLA 4U7CA 3I5CA 4R5PB 3V6DB 2W7PA 3I0RB 5C25B 1RT3A 2VG5B 4PUOB 4JUZA 3DLKA 4YMEA 2IMWP 2E9RX 4QWBA 4Y34A 2HNDA 4TQRA 3KOAA 5KFUA 4IG3B 5J2PA 4FBTA 5HROA 4Y3CA 1S1UA 3RB6A 5HBMA 4J9MA 2ZD1A 3LP1A 3BQ0A 4KB7A 1HQUA 4H54A 4ZMMA 1IKVB 5C42B 1JLCB 3I0SB 3MECA 4YP3A 3FDSA 5KFCA 1D0EA 2JC0A 5KFFA 4QWAA 3PHEA 3GIKA 1XR6A 3CJ4A 4WZQA 2RDIA 4ED1A 1NHUA 5KFKA 4RNNA 3NBPA 1I6JA 3KK1A 1S0OA 4WZMA 1TL1B 4KV8B 1BQNB 1HNVA 3DLGA 3IS9B 3CJ0A 1JLGB 4RW8B 3QO9B 2W9BB 4IR1A 4KKOB 3DRRB 4ECTA 4PQUA 1SH0A 4IRKA 3PW7A 3T5KA 4O3SA 4IDKB 2RF2A 3I0SA 2WOMA 2IJNA 4X2BA 3M8QB 3KLGA 5F9NA 4IFVB 1GX5A 1RT5A 3CIZA 1S1UB 3BSOA 2HWIA 3CVKA 4WXWA 3GV8B 1QAIA 1TKXA 2OPQB 1S6QA 4ICLB 1K1SA 3BSAA 2B5JB 2R8GA 1FKOB 4G1QB 2W7OA 2JC1A 3V6JA 4PUOA 1C2PA 1RT3B 2VG5A 3ISNC 3KHRA 4NYZA 2XI2A 4EBCA 3SI8A 2D41A 3OL7A 4NLGA 1LW2B 1LWFB 4ZVHA 1QAJA 1RTJA 5I42B 4PWDA 4Q43A 3OSPA 1RT1A 2D3UA 1REVA 4DG1A 2HAIA 1R0AB 1TL3A 2ALZA 5F8JA 5F8IA 1HNVB 4O3OA 2R8IA 4WE1A 2BRLA 3MR3A 4O44B 4K4YA 2OPPA 3TAMA 2IM1A 1S1TA 4YR0A 2JEFA 1S1WB 2WB4A 4ZP9A 2WRMA 3PW4A 1S6QB 4ICLA 4ZPBA 2B6AA 4KFBA 1JKHA 4R0EA 3TVKA 5DLGA 2IM0A 3GIMA 5DG8A 4J9QA 4XO0A 3V81A 3EZUA 1SH3A 1DTQA 2CKWA 2EC0A 4KAIA 4WYLA 4J9SA 4ID5B 4J9KA 2E9ZA 3DRSA 3CO9A 2OPSA 4LSNA 1FK9B 2UVWA 3G86A 4ED6A 4TY8A 4M95A 1RT2A 2OPRB 3BJYA 4PQUB 3DRRA 1SUQA 4TLRA 4NCGA 2WTFA 3KMSA 1S1WA 2XWYA 2YNIB 4MIAA 2WONA 4EO8A 4JV1A 2AX0A 4O44A 2FVPA 2ATLA 3BR9A 4YR3A 4EYHB 1K1QA 1T05A 1RTDB 2RDJA 2IBKA 5KFLA 5DQIA 5KFDA 2WONB 3PJXA 4O3PA 2BR0A 4NLTA 4ECQA 2C2EA 1SUQB 1U09A 2VG7B 5EWGA 3ITHB 4LSLB 2OPPB 1FKOA 1DTTA 1HQEB 4G1QA 1JLEB 3M8PB 3TAMB 2FVQA 4NLPA 4WFXA 5KFEA 3DM2B 2F8EX 3UPFA 1LW0A 3MTKA 2IAJB 1JLAA 1HMVB 3G6XA 3CJ5A 2HNDB 1S1VB 4HKQA 2XCAA 2O5DA 4MK9A 1VRUA 1VRTB 5EWFA 3V6DA 1KLMA 4RW9B 4DL6A 2W8LA 4H4OB 4IFYB 3LP0B 3H2LA 4KHRA 4K4VA 2HNYA 2XGQA 1HYSB 1C1BA 4NLDA 2BANA 5KFRA 3M8QA 3KLGB 4IH5A 4ED0A 1Z4UA 2DPJA 2JEGA 2HWHA 3NAIA 2RF2B 1SV5A 3T19A 4O4GA 3DOLB 2JEJA 1VRTA 3C6TA 3M9MB 3MEEA 2B43A 4FS1A 5CYQA 3IGNA 2QE5A 2BE2A 5KG0A 4ZPAA 3M9OB 2FVRA 1HYSA 1JLCA 3H5UA 5HP1A 5C24B 3I5BA 3IS9A 2FLNA 4IG0A 1KLMB 2FLPA 1TL1A 4QWDA 1IKWA 2C2RA 3BSCA 4RNMA 4J9OA 3MR6A 1N6QB 5KT7A 3DOKA 2IM3A 2OH2A 4LQ9A 5KG2A 1KHVA 4KKOA 2ASJA 3MECB 4KE5A 5KG1A 1IKWB 3PJWA 1S0MA 1C1CA 3DLEA 4GC6A 2VA3A 3DI6B 3H59A 5KG4A 4J9PA 3DM2A 5J2MB 4RNHA 3OSNA 5C24A 4TXSA 1W25A 5L1LA 3FFIB 4NCGB 1S9EA 1SH2A 5C5JA 3OHAA 3GV5B 2D3ZA 1S9GB 1IKYB 1RDRA 4LSNB 3NL0A 4F50A 2ASLA 4WE1B 3KLIA 4RW4B 2HMIB 4ID5A 4RW7A 3DI6A 5KFBA 1R0AA 4DL4A 3DLEB 1T05B 2I5JA 5KT4A 5J2NA 4Q44A 2W9AA 3KK2B 2YKMA 4IRCA 1D1UA 3T5HA 2HNYB 3T1AA 1J5OA 2BQUA 3QLHB 5HROB 3M9NB 1IKXB 1FKPB 3KLEA 2IA6A 4KFBB 1JLBB 3CDWA 3BREA 5K14A 3LAMA 4J9RA 3C6UB 4JV0A 4K4SA 2W8KA 4Y2CA 1S9FA 1T3NA 5KFIA 3HHKA 3SFUA 2WHOA 3VQSA 3QLHA 2RKIA 3DRPA 5HP1B 5KFHA 2XGPA 5L1JA 2ZE2B 3PW0A 2YKMB 4J9LA 5F8HA 1HARA 4Q0BB 3GIIA 3E01B 1KHWA 3HVWA 2JLEA 3DYAB 3IGVA 3MF5A 2AGQA 2HMIA 4O4RA 4EEYA 1JXLA 3M8PA 3DMJA 5DG9A 4ED3A 3C6UA 3JYTB 2UVVA 5F8MA 2XI3A 2IC3B 3Q8QB 2YNGA 3QGIA 4TYAA 1J5OB 1QE1B 3DYAA 3D5MA 2W9BA 4ED2A 5D3GA 1MMLA 1N5YB 3G6VA 3OL8A 1HPZB 5L1IA 1LWFA 1TKTB 5KT5A 4H4OA 2ZKUA 4RW7B 3KMQA 3QIPB 1EP4B 4I2PA 2WOMB 3KLVA 1HNIB 4KO0B 3IG1A 4I7FA 2R2SA 3KJVB 3KLHA 1S1XB 4U6PA 3BGRB 1S9EB 1CSJA 1JLAB 1XR5A 2GIRA 4IH6A 5KFVA 3KNAA 2R2TA 3H40A 2R8HA 5KFQA 2UVUA 5EUHA 4XPCA 3PR4A 3H5YA 4WFZA 2WK4A 3Q8SB 2ZD1B 1JLEA 2V4QA 1S6PA 3MFHA 4MK8A
chains in the Genus database with same CATH superfamily
2GGPA 2K3KA 2NXCA 3K5OA 2DYAA 3FCHA 3O2IA 2DH8A 4P7VA 3M2UB 4XDCA 3DNCA 3KJVA 3ZZPA 4RKUC 2MQPA 3MFIA 3CXCR 4QU7A 2M5YA 4MFBB 2CNNB 2ILZA 3T6BA 4ENOA 2HW3A 1S48A 4FS2A 3J7YU 3UDLA 3HM9A 1CJUB 2EPIA 2QLJB 2XS5A 4RL1A 4IH7A 1XMOJ 5DLFA 2FVSA 3M2VB 1APSA 3T1YF 1BQMA 3QGPA 3BKUA 1TQLA 2J5AA 2XSFA 4CZCA 3Q8PB 3T5JA 1TK5A 2UU9J 4QZVB 3DFEA 4URGA 5CYMB 1ZPVA 1IR2A 4WFYA 5AXMA 4A8WA 4JI3F 3K59A 4QIWD 1YWXA 1XERA 1ZZFA 3OFEA 2XQCA 4N7TA 3TVZA 3W1YC 4NEZA 2ZM6J 2CPJA 1RT5B 1RCXB 1SI9A 1X4CA 1WTFA 5KOXA 4AYBD 1N5TA 4RW9A 1TL7B 1VQLS 4EO6A 5GVQA 3IM9A 3NS7B 5K14B 5F41A 4CIOA 1RTIB 2IY5B 3M2RB 3GIRA 1FE4A 1CC8A 4ZHRA 2LVWA 4YB6A 3CCES 4Q8FA 4K4UA 4OYXA 1UJ5A 2J6UA 2NQPA 1BY9A 2DHHA 2E9TA 4NCBA 2H51B 1CPZA 4PWDB 1RT7A 1O0PA 1OO0B 3GILA 1JLGA 5DGBA 1OSCA 2YH1A 2EK6A 3KLFB 5B09A 3OLBA 3QT6A 3MOZA 3A8JA 4ECVA 4M8LA 1WG4A 5GAGU 1TK8A 1HBOA 2F63A 5EGYA 4EBEA 2RDDA 2Z58B 4TYBA 3M2UA 4PQAA 5M2PA 4FXVA 4O23A 3MXHP 2Z4PA 3CCJS 4OZ5A 3SSQA 3D6MB 2UUTA 3V2UC 4ZP6A 4YQWA 4DR2J 4IR9A 4NLUA 3I9V9 3RZAA 2AT1B 5J1EA 2XMWA 1VMBA 4FPRA 1WC4A 4FNHA 4WIQA 3VAFA 4TY9A 4DL2A 2ZVIA 2H5JB 4GO7X 1RKJA 3MEGB 1YGYA 1XMQJ 1H73A 1Q7LB 1KWMA 5J2QB 3QO9A 3AB2B 3TO8A 1FDDA 4EBDA 5FDLB 3HP6A 1VBXA 2MGZA 3E3XA 3OFGA 3HHLA 1EP4A 1U02A 4NRUA 4M94A 4OHVA 1GQEA 3ET6A 3IAS9 1ZM9A 4FN5A 4DS4A 2GJIA 1VIXA 3NBPB 3O1LA 2ZH5A 3AB4B 4RBUA 5D3GB 1GFWB 2BV3A 3KHLA 4RUAA 1XC9A 3MEEB 2B51A 2E5GA 2C22A 2MHNA 2XY5A 1SC6A 2AD9A 3L7PA 2ZOGA 1H7XA 3AXKA 1V5IB 2CZ9A 3GQCA 4V19X 2ZNYA 3R6LB 3DGVA 3LW5C 1K0VA 4O3QA 4GC7A 2CPDA 5E0OA 1R31A 1J27A 3TP2A 2GIQA 3BS9A 4ECZA 4DX5A 3IRXA 2C42A 5KFXA 1D09B 4HYKA 2LFVA 3W2WB 3LANA 1CJKB 1PO6A 2IDLA 4KTQA 3H5SA 2OEMA 3N6NA 1X0PA 3LGHA 2G4BA 1SB6A 2R8KA 3R1HA 1WEZA 3GSIA 4QW9A 3GJSB 2LA6A 4CO1A 5C25A 2W2OP 4DPYA 3IN5A 4CNYA 1CS4A 1TKXB 3R8YA 3KLEB 5LMNF 4F0KA 3B4DA 2DPIA 4OZLA 3NNAA 3NMRA 3MR5A 1TV6B 1JLQA 1VQ9S 1C1BB 3CCSS 4NLYA 1FDBA 5I42A 2HYIB 2LYVA 5KFGA 2LXIA 1HWIA 3BGOP 3GYNA 4CLZA 5KFTA 3NMAA 4O3NA 2FZKB 3JYTA 2KXFA 1NSPA 2FVCA 4IO9Q 2Y0SD 4JI7F 5GAEU 3HK2A 3A13A 1KFSA 2VA2A 1XK8A 1OQ3A 4NE9C 3UN3A 3HFVA 5JXSA 4CM0A 2KVIA 2DGSA 3VWSA 3OHBA 3KHGA 3QSYB 5I3UB 1G2EA 1RT6B 4DQQA 4LF8J 3RB0A 1NZAA 3PW2A 1H38A 1NZ8A 3FQLA 1GTHA 3HSDA 4NLXA 1NDCA 1PJ5A 2ZH8A 2IM2A 1JWWA 1R8BA 4ZVEA 4QW8A 1HNZJ 5IQQA 4PXDA 3IWXA 3UDCA 2CXEA 3BGRA 4OJ1A 2V4JB 4X4SA 3TRGA 4DX6A 1IM4A 3TAQA 4CRJA 1BQMB 3FBBA 5D8HB 1EKRA 3LP2A 1MROA 1C4CA 4DL4A 2LP4A 3CEDA 1ZETA 4CCHA 3CJQA 4B9UA 1ZTTA 3CW2C 1S4FA 3C15B 2OO4A 5IS2A 3FCWA 1DTTB 1HQEA 2F5GA 3NOCA 4OFZA 3Q8RB 3KK3A 3B8HA 2B7BB 1RT4A 2HNZB 4CLUA 2ZJRQ 4IG3A 1M5KC 4WXOA 1N54B 5KFAA 4AE5A 4NLRA 1DBDA 1S1TB 4DR6J 3GIJA 1Q95G 3MR7A 2BJ1A 2HQ3A 2HSEB 1MMDA 4KJIA 4NXNF 2GQCA 1QVFR 2V0NA 1E6YB 2QV6A 1HR0J 1HQUB 4FVCA 2UUWA 3I9ZA 4JI0J 1PBUA 2EBGA 4F04B 3G71S 1U45A 2YNHB 3FSYA 3R7BB 5KFYA 3CCMS 3SZ2A 5KG3A 3TVYA 3HSJA 3SDEA 3KLHB 1U4BA 4B3MJ 2OPSB 3RBDA 3JQJA 1WKJA 5IM0B 1X0FA 5HLFA 3T5LA 3EXYA 1NCLA 1RHRB 4FYXB 3OFFA 1T03B 4KT0C 4DSJA 3E2EA 4B3RF 1QVGR 3IWNC 1CULA 2EG1A 4LRDA 1VI7A 3H25A 4J9NA 5I3UA 1XNQF 1WF0A 1RTJB 2RKIB 3JQMA 2J6SA 2MQNA 1YQHA 1VHFA 4ELTA 4RW6A 3OUYB 2E1AA 2ZZNA 2IC3A 4IDKA 1GMWA 1EARA 5B0GA 1MU2A 1D8ZA 4X4RA 1KR4A 3TARA 1VLOA 2CYYA 4B3OB 1DQ9A 2V8GA 1T9VA 2UXDJ 1LNQA 1IJFB 3I32A 4IKAA 3VV2B 1VQSA 3LPEA 2KG1A 1S5ZA 2FJVA 1HBNB 4Q2MA 2JVRA 4ETXA 3MPDA 3THPA 3V4IA 4ZCLA 1R7IA 4ETZA 1PYSB 2P6TA 2V34A 4R5PB 5C25B 4R25A 2VG5B 3N0VA 3FBEA 2CDQA 4EUVA 3MHYA 1PILA 2ZH9A 2F1FA 4OYZA 4ATNA 4DV7F 5DDOC 4KRWA 3MAAA 2E9RX 4CT8A 1W26A 2HNDA 2DISA 2MTLA 4TQRA 1SCJB 2IBOA 3F41A 1N52B 1VK8A 2OLWA 1ZA1B 1FRLA 4Q7AA 5HROA 5LSOA 2QMWA 3ILJA 3IO1A 3JXOA 1JNZB 2IJRA 4PG5A 2CPEA 1KNZA 3QMQA 2N4DA 2HHHJ 1RWKB 2OD4A 4H54A 4DR7J 4OYBA 3POTB 3CCVS 3AJDA 1JLCB 4YP3A 4X4QA 3FDSA 4P71A 5KFFA 1FD2A 3SSRA 5D77A 1U0HB 4ZVPB 5K20B 2RHSB 1N5VA 3PRDA 3U27A 4X66J 5KFKA 1N33F 4OYIA 4FKXA 4BCAA 3NBPA 3FMWA 3KK1A 3PCOB 4QR1A 5A8WA 1Y5NB 2NREA 4C8KA 3A8EA 2IPOB 2KFYA 3H20A 1HNVA 4YFUA 1VC6A 4MTPA 1Q4RA 1N36F 3DXBA 4CDIA 2MGZB 1JLGB 1TUVA 2R7OA 2CJKA 1H2UX 3QO9B 2B8QA 2ZUAA 4QYZK 3TOQA 4KKOB 3DRRB 2VBYA 1SH0A 5D4NA 4Z7CA 4USVA 4IRKA 2CUYA 5E3PA 2C2KB 4X66F 1N33J 4A8KA 1BHNA 5AJ3F 1VFJA 2HVDA 3R3TA 3T6JA 1DJ0A 2B0GA 4IUFA 3KJQB 3KLGA 2PFDA 2CNOB 3U1LA 1NSAA 3S7RA 1V3SA 4IFVB 4KH1B 4BDPA 3V5RA 1NDPA 4RJVA 3CIZA 1WKKA 2IA0A 1KC8T 4WXWA 4LREA 1N5QA 5ETTA 3HVRA 2GAHC 3OR1B 1NK6A 2ZH6A 3BR8A 4JI0F 3PX6A 1U6FA 2ZDOA 3FGVA 2JC1A 2W7OA 5CXTA 4LFCJ 2LQJA 4ZLLA 4PUOA 1C2PA 2VG5A 4M5DA 4EBCA 2Y1RI 3FZ2A 2XI2A 4CLTA 1PAEX 1X7VA 2VH7A 4DPXA 2D41A 1T11A 4NWBA 5LJ5Y 1F6TA 2M3DA 1LWFB 2M9KA 2MSTA 4CTAA 2XHCA 4PWDA 5B0CA 2B9EA 1HI1A 1RT1A 2D3UA 1REVA 5DDRC 1M1HA 1TL3A 2BYCA 5F8JA 4O3OA 4WE1A 1UEUA 2XMAA 4I6YA 4K4YA 3TAMA 1R6VA 1XIQA 2Z2MA 1TZ0A 1QLNA 2B7CB 2L48A 3PW4A 3OR1A 3B82A 4R0EA 1JKHA 1R27B 1V5VA 2OUGA 2RJZA 3HHLD 3GIMA 1G6BA 4WF9Q 1FI4A 2JOQA 3JSYA 2QN6B 3LWLA 1B7FA 3LGNA 4AL6A 5A8RA 4LIRA 4BC9A 1UEVA 4KAIA 4NA3A 4OYAA 3DU6A 4QIVA 4P6QA 3M30A 3Q2SC 4PABA 1KDNA 1S99A 1K73T 2E9ZA 3RYLA 2RUSA 4LSNA 5AE3A 1VQ5S 1U7LA 2CZVC 5ETPA 1QSSA 2DR5A 3DRRA 1SUQA 2YKAA 2AEFA 1UPMB 4ZJQA 1N0UA 1UETA 3PEHA 2YNIB 2RUGA 1KD1T 3TA1A 2FVPA 1LOUA 4AFFA 4B9MA 2HGNA 1S72S 2L41A 4EK2A 2AV5A 1RE1B 1SJQA 2DGUA 2HRUA 2HAFA 3A3OB 3ZC4A 5DQIA 5KFDA 1NKBA 3HD1A 1PC4A 4DR3F 3VZHA 3TNVA 2FQQB 4DLGA 2ADBA 3L7UA 3L4BC 4CT9A 3J7Z5 1TUWA 2MDAA 1MG7A 1U09A 3F44A 4PEOA 1LFPA 1T9WA 2GGPB 3RRKA 1A6LA 3TAMB 3W61A 1DTTA 1HQEB 5LJ3Y 1JLEB 2WZ1A 3H8YA 3POTA 2A10A 2DNHA 1NBEB 4B3TF 3OW2R 2GJFA 1H74A 4DR7F 1B4SA 2BJ3A 2I9SA 2NYIA 3MTKA 3BZQA 3M05A 3NP5A 4J5OA 3GZ7A 1RGVA 1JLAA 3CCTA 4MIWA 3QFWA 3SIPB 3THTA 1HMVB 3ZO7A 4BLGA 3C66A 2XCAA 1YJVA 3NWRA 4UW2A 2V94A 1HA1A 2O5DA 4AXIA 1WC3A 2ZHOA 3M8SA 3PX4A 1EJ7L 4U8YA 1KLMA 1Q5YA 3UDEA 2BUNA 1ZM3A 4IFYB 3LP0B 1R0CB 1M5OC 4KHRA 3G87A 4WJBA 4K4VA 2EFNA 2KHCA 2WSFC 1AZSB 1OSDA 1SPBP 2PD1A 2ZITA 3DRYA 4RX6A 4U9RA 2QSFA 3UO0A 5KFRA 3KLGB 2Y3YA 3SV3A 2JEGA 3AOAA 3W8PA 2XLIA 3JB9k 3T19A 1RACB 3BYPA 3CTRA 5AXNA 1JJ2R 1UWAA 1VRTA 3M9MB 3MEEA 1WTBA 3OTDA 3M8WA 3IGNA 4X4VA 4C98A 2RB7A 4ZVSB 3TEHB 3KTQA 2VB6A 1AW0A 2P8IA 2ZH4A 3MMCA 4DV2F 3CMES 3UCUP 5HP1A 4C9DA 4JI5J 3HCXA 3AH6A 1WI8A 2VICA 4NXMF 1I5OB 1WHXA 4AD6A 1FNOA 4F0HA 3MCNA 3K58A 2QFJA 4C7QA 3BSCA 2C2RA 1SXLA 3DOKA 3BGFA 4DV7J 2OH2A 4NL5A 5I3PA 4DBQA 2L08A 3UDVA 5JVGQ 3HX9A 4I64A 4KKOA 5LMUF 2ASJA 3MECB 4CH1A 1I94F 2BW7A 2HGLA 3UD5A 1C1CA 3KFWX 4P9SA 1X9WA 2VA3A 3H59A 4J9PA 1F2GA 3OSNA 3IRWP 3PYEA 2CPFA 2P5VA 4TXSA 4C0BA 3HT3A 4JYAF 4ZLJA 5A8WB 2QL9B 4HDHA 2FIUA 4NZ7A 5L1LA 4NCGB 3ETMA 1NMEB 3ENAA 5C5JA 1HBOB 4JP8A 3MM6A 1RAGB 3OHAA 2D3ZA 2FHJD 4DUZF 2CQIA 1S9GB 3C14A 4NX9A 5T7LA 4LSNB 3HXMA 3EX7B 2ASLA 3KLIA 2F3JA 2R7XA 2HMIB 3M30B 3X1LB 5KFBA 2HRTA 2HEKA 3BH6B 3FRYA 1T05B 5D4LA 2I5JA 2ACYA 2YWHA 1FXLA 1Z1ZA 3CJRA 1GXLA 5D4OA 2N3OA 1VQ6S 1D1UA 2Y8WA 1GMWD 2FHMA 3GFYA 2KU7A 4DDFA 2VZ9A 4GVLA 3T5HA 1Y0HA 2RQMA 2IA6A 1IKXB 4LJMA 2BE7D 2JFKA 1JLBB 3VF0B 5G4DA 5K14A 1VQKS 3C6UB 3R5AA 3BPDA 5IQ6A 1UVJA 4DV5F 1Q86T 2F8HA 3L3CA 5C2GA 2KZZA 3DRPA 3LH2S 3MPVA 3ELHA 3OXGA 4P52A 1FX2A 3OTEA 2VASA 4J9LA 5F8HA 3E01B 1VHIA 2JLEA 3DYAB 2V68A 3MF5A 1ZPWX 2HMIA 1X4BA 1RWMB 3N5BA 3PYDA 3ZTOA 4CYUB 4DF4A 1SVDA 2UVVA 4ED3A 3KUEA 3JYTB 3QNWB 5F8MA 3OJSA 3QAUA 2IC3B 2PIIA 2YNGA 2RVJA 5LM7E 4IOCQ 3D5MA 2KB2A 3DYAA 3TJAA 3V4MA 3D3BJ 2MZ1A 4RR5A 3NCPA 2W9BA 4ED2A 2XMJA 4A8SA 1CC7A 2CRLA 3PTWA 1HPZB 2V2ZA 1E6YA 3UNYA 5GAGI 3NY0A 1UZHA 4G65A 3I96A 3QIPB 4I2PA 1KQGB 4ES1A 3KLVA 1HNIB 3M2RA 1HI8A 2C1EB 2UXCJ 4XIUA 2KT3A 8ATCB 2R2SA 3KJVB 3KLHA 4Y2IA 3VCDA 3OVBA 3BGRB 4MKVA 2ZOFA 2ATCB 1VS3A 2GIRA 2GA7A 4NPOA 5IT0A 2R2TA 5E3RA 2R8HA 3VZIA 3AD9C 1YBTA 2HFUA 4MAKA 3PR4A 3THVA 2UVUA 2C3OA 4NEYA 4E8UA 3AXMA 1F2HA 3NEKA 1MROB 4JBCA 3EICA 2HLTA 3MM8A 3ZZZA 3Q8SB 4FF1A 1RQ0A 1OMSA 5CZXA 4M5KA 4DFMA 1L3VA 3VAIA 1FRKA 3JSMB 4YB7A 2CJYB 2DH7A 5LL6d 4ED7A 2NXJA 2W25A 3CC2S 1GXTA 1OS5A 4FXWA 4DV6F 1BQXA 4PG6A 1EQ0A 1XJWB 1NH8A 4XPEA 3KK3B 1RADB 1F9FA 3ZXWA 4YR2A 2F4VF 2R7QA 3FQKA 2DHXA 4ZVOB 5MAOA 1PC5A 1SKWA 2XNRA 4ES2A 2AQ4A 3UVJB 3TEGA 4OX6A 1REVB 3LALA 2I1RA 4M1KA 4CI0B 2GAGC 2BRKA 3TZYA 3UQSA 1WF1A 1FRMA 5T14A 2FLOA 3RJMB 3ZZRA 1CJTB 3W5YA 4C0HA 2W4PA 2XCPA 2EWHA 1S7IA 4U95A 4KO0A 2X3GA 4PYAA 2YPYA 4ED8A 4ZS6A 2RQCA 2QGFB 4DF8A 4MIBA 1L3UA 1K8AT 3PACA 4HTIA 3D2WA 4U67Q 4KHMA 1VYAA 4EYIB 3R1LA 3PHTA 4QOTA 3UCGA 1YDLA 2CQDA 2W2MP 4ZVFA 5F8GA 3T3FA 1J5EF 1IWGA 2JHEA 1X4DA 4GKJJ 1SKRA 2I2YA 1A7GE 2AJ0A 2CQ1A 4Y6IA 3H98A 4WU3A 3WIVA 1S79A 2D3O1 1YJ9S 4GKKF 3GV7B 1MU2B 4NZ6A 2IRUA 1IXKA 2M88A 4HEA9 1QTMA 2F8MA 4DL5A 1VRQC 2HFNA 2ZKTA 3ILLA 3KG0A 3U02A 2POKA 1R43A 2NSBA 4P7TA 2E1CA 3OT9A 1IR0A 3W64A 3T1HJ 2ZE2A 3HULA 3G96A 4RU9A 1U1OA 4RW8A 4FF3A 1BWEA 4ZP8A 2R9LA 1T03A 4UZBA 3NGRA 4XDDA 2UVRA 1FJGJ 2KT2A 5LXYA 2ZHAA 3OTOF 2V4RA 5ITHA 1XR7A 2W1BA 3JTPA 3OJUA 1XMOF 2A2CA 2HQDA 3GFZA 5H1SV 3F0NA 1U25A 3QYYA 1RA7A 2Z0GA 1E6VB 4FYDA 1NUEA 1LKZA 4HLBA 2DGQA 5GMDA 3TW0A 1RHJB 2NUUG 3ZTQA 4BHQA 4DJBA 4W92B 2J7KA 2VU5A 2P2CB 2WBRA 3QZ7A 5A8KB 2CJ9A 2MKHA 2M8HA 2G0JA 2E1MC 4NLQA 5ETQA 5LSLA 5A8RB 1VBYA 2VFTA 4K4TA 3UW1A 4L75A 1T0TV 3IR6B 3N6MA 2YTCA 1JX4A 2OPRA 3RW6A 1RT2B 1NO8A 3AJ1A 4TLQA 5HANA 5D15A 1U8SA 3OXFA 3W7BA 2HZCA 2NLWA 1S77D 5A6WA 1AA1B 1NK8A 3KK2A 1NJIT 2G2YA 4A8OA 3JSBA 3CD7A 4YN3B 3I4PA 1OY9A 1SIZA 1BQNA 5KT6A 1RT1B 2FJBB 2NZCA 4KYZA 1U1MA 3R5GA 4OHYA 4OHXA 1KVKA 4CTAB 3HKWA 4OYOA 2VG6B 2RD5C 3ENVA 4Y28C 1MN7A 1QM9A 3CUNA 2L9NA 3C6TB 3K8WA 2DCUB 4OHZA 2RE1A 4ZJLA 3SCIE 1NJZA 2DR8A 3MEGA 3AOBA 4WFAQ 4PG8A 3PW5A 3N4WA 2BQRA 5HJXA 3MEDA 2YQ1A 3BYRA 2OPQA 3I55S 1KRPA 3AT1B 1YZ6A 1OYDA 3DDKA 3I5AA 3P45B 5KFMA 5CAAA 4UTGA 5DETA 4RWWA 4YY3F 2V2QA 3RW7A 2XO6A 4IFVA 4C6AA 3LA0A 3RB4A 4JI4J 4IQXA 3DHXA 1V6HA 2J7UA 1HNWJ 1RWWB 1M90T 1ZTWA 1I1GA 5CYMA 2BJEA 5KG5A 1KVIA 2BXJA 3D4JA 5D0RA 1Y00A 3QIPA 1B64A 4B3TJ 3IWLA 3D67A 3BKFA 1K47A 2VOPA 1FKPA 1TKTA 1RAAB 1Y7PA 3CB4A 4UOGA 1FFGB 3HHNB 2IMOA 2UV8A 2D3OR 3ZZTA 5DM7Q 4Q8EA 5J1PA 2FB0A 3MCSA 2HHTA 1Q8LA 2DBBA 1F3FA 4I1TA 1RYSA 3HI9A 1RBAA 2DXEA 1GAOA 4ZPCA 1UFWA 3U7JA 2XM3A 4ZHRB 3KHHA 3G8TA 3SEOA 2OFHX 3DOLA 3K7RA 3NGKA 1HNXF 4B3SF 2M4MA 2FZGB 4RNFA 1DLOA 1HIYA 1Y5LB 1AT1B 4XAKA 2F4VJ 4OZ0A 2YWEA 4H4MB 2E5LF 3PJ9A 4PCQA 5T41A 3ISZA 2Q1LA 3C15A 3OLAA 3IBFB 1NHVA 4ZOSA 2ASYA 2NXNA 3EDRB 3VR1A 1RYRA 2DNMA 5CH7B 2D9PA 2F9DA 4LSLA 4MFBA 1NRKA 4NI2B 5I3QA 2RNEA 4NLOA 4KQZA 3QFHA 4F25A 4TY8B 4TU9A 3CJTA 1HLWA 2E44A 3RB3A 2KM8C 2CA9A 1UVMA 3DRSB 3DXSX 1KSPA 2HFOA 2IAJA 2VPZB 1VQ8S 1IUJA 2LQ8A 2XC9A 2VHGA 4GVBA 2UU9F 2IJFA 2NR0A 4K4ZA 2BJ7A 2K7JA 3MAQA 4J37A 2PE8A 2MZTA 1AFJA 3FMBA 4LVOP 2XNQA 2XMUA 1O51A 1J2VA 1U2RA 1LWXA 5HVGA 3J7YI 4PG7A 1QE1A 5J2PB 1NHKL 2L9WA 3PDNA 1B0VA 5F8LA 1ZM2A 5ETRA 1FDNA 1RXOB 1TUGB 3DDIA 1GXUA 2C3YA 4P2FA 4RNOA 4DR1F 4MH8A 1U1NA 3EJMA 3FK4A 1HFEL 2M70A 1C4AA 2V67A 1KVJA 2QLWA 4CLWA 2XLKA 1IQTA 2B4VA 3LAKA 1HPZA 3H42A 3N6LA 2PMHA 2YNFB 2W9CB 4LF4F 1DTQB 1SIWB 3HFKA 1NK9A 1MN9A 4LBIA 1C0UA 2X3DA 3BEGB 4O0NA 2IYGA 2X1BA 2YH0A 4N77A 3MCMA 3P5BP 1WOSA 2OIHA 1RK8A 5SZTA 4EZ6A 1X5PA 2A18A 1X5TA 4F4WA 1YI2S 3PKYA 2B5JA 3R7SB 1WNEA 2RIJA 3QZ8A 1R8AA 1UFKA 1S1VA 2DTJA 3TUJC 3EYZA 4HACA 3M8RA 2W2NP 4QU6A 3W2WA 5ETVA 2MB0B 4U8VA 2CQBA 3CDUA 3OSPA 3CIMA 1JJCB 2ALZA 2AF6A 2W01A 4K50A 1DFDA 3DRPB 2PEBA 1VK3A 1OJ4A 4OI0A 4M5LA 2DCLA 4ZPWR 2DGOA 4F4ZA 1JXVA 4FYVB 3RBEA 3HO1A 4NYOA 1S12A 2AW0A 1T9XA 4B9LA 2H1YA 3X3UA 1MMNA 4DU7A 1ZYQA 1K0TA 1FA0A 3ISND 1AB8A 1C0UB 3FFIA 1YG0A 3SCLE 3J80U 1A9NB 1CLFA 3G4SS 2DK2A 2SXLA 5L8RC 4FYWB 2I5JB 2Z57B 4RWXA 3LP0A 3PRVA 1FE0A 2QRRA 3DN9A 3GP9A 3NGTA 2QA4S 2LCWA 2K8GA 2HIQA 1WEXA 2A6OA 1RLCL 1VIOA 4C3KA 4C8YA 2ZWOA 4F0MA 1WHWA 2IMWP 1ELOA 3LTOA 1RHQB 2KZMA 1VQ4S 4F2RA 5J2PA 2XSJA 3D0GE 2WBMA 2C3MA 2F4FA 3WC2A 3Q0AA 5HBMA 4YB5A 3OVAA 3LP1A 1Q7YT 1HQUA 2N7YA 3MMJA 1DY3A 5DS7A 2BX6A 5C42B 5E3QA 4EFAC 1RABB 3MECA 1TELA 1RB0A 3CMQA 4Z2XA 2D9OA 4DR5J 3UE2A 2A1BA 3CJ4A 2IYIA 2M2BA 2RDIA 4N8NA 4U96A 4K0KF 1NHUA 1WI6A 2IIHA 2LQ9A 2FC9A 5M2RA 3SYZA 1P9YA 1FNXH 2HVIA 3BB5A 2C3UA 3UI3A 1MWZA 4F3QA 3MZIA 2V69A 2E66A 4BWMA 4ECXA 3CJ0A 1BLUA 5K5MA 2MZSA 3MMCB 2KO1A 2W9BB 2YKOA 3RBZA 4IR1A 1WWHA 1UCNA 2PGCA 3DLJA 3T5KA 1ROFA 4PRFA 1L3SA 3DRXA 2BBEA 5E3CA 5HMYA 4AL5A 2DKOB 3R9LA 2UP1A 4CNZA 1KLNA 4OV6A 1T02A 3NG8A 2QZ8A 3U1NA 1HBMB 2H4WB 3P8BB 3TZWA 1S6UA 2FZCB 1VISA 3PKMA 4H4KC 4RLEA 2Y1JA 4X2BA 2V9KA 2QLFB 3FEYB 1RT5A 2V8VA 2HWIA 2ZBQA 4A8MP 5H9FK 3GV8B 2LDYA 2OPQB 3C19A 1S6QA 4ICLB 1PKUA 2BEFA 3CT9A 4C0OC 1K44A 1NSKL 4G1QB 1UP1A 3ZTRA 3K0JA 4CWBA 1DHMA 3ISNC 3GR1A 3SI8A 1TKDA 1AUDA 4LF5J 1JMTA 3A8KA 4IO1A 1FRXA 5I42B 5IV3A 3EVWA 4TNOA 1Q8IA 3R5BA 1TTHB 4Q43A 1OPZA 1HHTP 3CULA 2HAIA 5SUHA 5F8IA 1X5SA 4E0DA 3D9BA 2R8IA 4JI6J 1F9EB 2J9DE 3TR5A 5ETMA 2OPPA 1NPKA 2IM1A 2DEJA 3MOJB 2JEFA 2PDAA 2MZQA 4OQJA 5E3AA 1HNXJ 4QR0A 4ZPBA 3TVKA 3UN2A 1JB0C 5DLGA 1AUSL 4ZITA 2YXLA 3MMAA 2K2PA 2LKZA 1CJKA 3V81A 3BGUA 3EZUA 4I69A 3DLHA 3N01A 4L73A 4ILMA 1PG5B 4LF1A 2EC0A 2QEXS 1RHMB 3GU0A 4ZIWA 4PAAA 4B3RJ 4ID5B 2B4OA 2CPYA 4J9KA 5E41A 5H9EK 3G82B 2VPWB 3O44A 3CO9A 1FK9B 2CQ2A 2J9EA 1D3WA 3G86A 4CP5A 1U1QA 2XS7A 4M95A 3M6UA 5HL7Q 3MM6B 2OPRB 1RBOB 3B54A 4USHA 1ITPA 4NCGA 2LXUA 2KL8A 4UOFA 1S1WA 1KONA 4MIAA 3NNCA 2WONA 3BBBA 4EO8A 1WHYA 2AX0A 2DNPA 4D3HA 1SQGA 1L5UA 4YR3A 3SSSA 3LGMA 1T05A 3MMBA 3NXZA 4UQTA 1FXDA 2B9WA 5ETLA 1RTDB 5HATA 3PNIA 2RDJA 1IBKF 2FY1A 2DIUA 2I6WA 4ANCA 4QIGA 3PJXA 1EKSA 2F65A 2DVIA 4NOHA 4O3PA 4ECQA 2C2EA 1N5SA 2VG7B 3P49B 4EI2A 3ITHB 2Z8QA 1XWLA 3AODA 4ZIVA 4LSLB 2KVQE 1FKOA 4NI2A 4WFXA 3S1TA 2GHWA 4DOZA 5IFMA 2JLGA 1SL0A 3CCLS 1UVKA 3DM2B 1TL7A 3Q8VA 4LF7J 3LOUA 2F8EX 2EFQA 4AUKA 3UPFA 1WSVA 2DNGA 3A1YG 1P27B 4PXCA 2X1AA 2UZAA 5IC4B 3M4XA 3FVYA 1IBLJ 3G6XA 2HNDB 2PO4A 1VQOS 4MK9A 6AT1B 1ZS6A 4ILLA 1VRUA 1VRTB 2B8PA 5GMEA 5RUBA 1U1KA 3EVMA 4DL6A 1H72C 4H4OB 1H7WA 2CQ0A 2RRBA 3H2LA 3MD1A 3KXDA 3RG6A 1RAFB 2X7IA 1VQNS 2XGQA 2V8HA 2HBZB 2H65B 3LUYA 2MZRA 5IC6B 3M8QA 4DQIA 2MZJA 3R97A 3RTVA 3NAIA 2QYGA 3G8QA 4DR1J 1CQNA 2GMLA 1TR0A 2HHPA 2PC6A 3EGNA 3KG1A 2JEJA 4UY85 4WBFA 3MAHA 1DQ8A 2QE5A 1NJWA 2BE2A 1YJRA 5IWAJ 3M9OB 3RR8A 2FVRA 1W2IA 2Q3PA 2AIRB 1OY8A 2HQCA 3G9CA 5C24B 3FBFA 1P1TA 2JJ4D 3RRGA 2DGTA 1LXNA 3FSXA 4WTYA 4IG0A 1UAWA 2NSCA 1H98A 2MJNA 3GMGA 2G0CA 4QBUA 2FLPA 4X4OA 2A0FB 4DV4F 2C2NA 1S4EA 4J9OA 3SDEB 3MR6A 4PZVA 2D1CA 5KT7A 5ADZA 2IM3A 3PRBA 4ER8A 5IXUA 1X9MA 4DX7A 2XB2D 5D4PA 5KG2A 3SXLA 4F3MA 4M5HA 4DCPB 4EMDA 4UUWA 1IKWB 3M2VA 5L9NA 3AY0A 3DI6B 3CSKA 1HR0F 3DM2A 1WG5A 2HS0A 4QIFA 1CVJA 1BUXA 4DL0C 8RUCA 4PXEA 2QA4G 1ZZNA 1W25A 3C46A 3OD2A 4OX9F 1U8WA 1SH2A 3HDSA 5CD4H 2PA8D 2YX7A 1NU4A 4B3SJ 3BF4A 2RQKA 2DR9A 3T9ZA 3SQOP 3AD7C 1RDRA 4X62J 2J9CA 1X31C 4RW4B 2Q43A 2K1RA 3K5PA 2BA9A 1B7YB 3DLEB 1R8PA 2BJDA 8AT1B 4F2SA 4J90A 2HNYB 3T1AA 2HVHA 1J5OA 5AXKA 1U49A 3QLHB 1CJVA 2EKNA 2CQCA 3FC9A 3IMQJ 4ZVQB 3TX8A 1B0PA 2FUG9 3AA9A 3PEJA 3LAMA 2KM8B 2DXFA 4J9RA 1ZBTA 4ZN1A 2E5LJ 4DPWA 1UJ6A 2QJ3A 2ZBRA 2GQQA 1SBRA 3DC2A 1T3NA 2YQ3A 3SFUA 1HWJA 4FNIA 2RKIA 2MKYA 3QRPA 2MHEA 4ILRA 1GMVA 5DO2A 2ZE2B 3PW0A 4WKYA 1T3OA 3OR2A 2VQFJ 2JLFA 2JL9A 4USUA 3HVWA 3TX0A 2MQOA 1TK0A 5LXRA 2ZH7A 2O3DA 4M5DB 4I67A 3DMJA 3C6UA 2HK2A 2QA2A 3IP0A 3Q8QB 3RGIA 3R2DJ 1QY7A 3PIPQ 1J5OB 2QT7A 3DOMA 1KQKA 1V9OA 2E7XA 3SCKE 4ZCIA 3G6VA 4QYZJ 2HIYA 2ZZMA 2XZDB 2FHJA 1FVSA 2PMWA 2VJVA 4H4OA 1LK5A 1YTYA 2N3LA 2K1RB 4JB8B 2ZBIA 2EFOA 4C11A 3MM5B 4C8OA 5A6PA 1M0SA 3AOCA 4W4MA 4NCAA 4R8UA 4U7UD 4OZ2A 1GMUA 3W66A 3PV8A 3NCQA 4LRFA 5K8MA 4QIEA 3JS9A 2BM1A 2XYPB 3W9IA 3H40A 1Y9OA 3C16B 5KFQA 3J7AN 1PYTA 3H5YA 2M7SA 2QL5B 4WFZA 3CPWR 1NJYA 1EX8A 2WK4A 4EU0A 2D74B 4C3LA 3HZEA 3KUGA 1Q16B 4LUBA 1S6PA 4B17A 2BW2A 1X5OA 2KKHA 3MFHA 3OL9A 1YJ7A 4IRDA 2WSCC 4JI7J 1FXRA 4N8OA 2Y9HA 3DOKB 4ZP7A 2IDEA 1RJJA 2LECA 1IBMF 4DSKA 3IG1B 4USMA 1YRXA 3CDEA 3FNNA 4C8MA 5A2QY 4W90B 2OEKA 3LO3A 2AKWB 3BQ1A 4DV0J 1PSDA 5HMWA 5MLCV 2GC8A 5DJBA 1TVRB 2YKNA 1YVFA 5FLXY 3DGPB 1ZOTA 2MKJA 3D0IE 1FVQA 5K8NA 4G3IA 2FLLA 4OX8A 4ECSA 3NKYA 1HL6A 1FRIA 4UF4A 4DSIA 2HBRB 5HAOA 1MWYA 1GEHA 1FNMA 2G1HA 2G1DA 2J8SA 4DN0A 2CVIA 2J8AA 2E5HA 2IVMA 4NA2A 2FJXA 4ECYA 1U6ZA 5BR8J 3BBCA 3PY8A 1HMVA 4LFBJ 1RCOB 3DLBA 4USTA 2RILA 4DPOA 3LP1B 4OJHA 2ALYB 1T8EA 4DR2F 3V81B 4DN9A 5B0FA 2UUBJ 1TP7A 4BWJA 1HNWF 4OLOA 1VJWA 1FRJA 1FCAA 4B3OA 2LEBA 4I7FB 4UQGA 2GIFA 4J7CA 4HH0A 2CNLB 2HQIA 4C11B 4OI6A 1UA0A 1XN9A 2CNKB 2PMZD 2NPFA 4ECWA 2VQEF 4ZA1A 1TKZB 3V6HA 4RW6B 1VCTA 4DG1B 2G2ZA 4C3MA 3EZ5A 2XMMA 4OZ1A 2C3PA 1U6BA 3QGGA 5KG6A 3A3NB 2AWZA 4HH1A 1UMJA 2VJUA 1N34J 1IVZA 4HT5A 3RAMA 3T1YJ 1YX2A 1XNQJ 2DNOA 1IKYA 4QWCA 2ROEA 1XMQF 4URSA 3D7SB 4LR7A 3BPSP 1LWEA 2VG7A 4PWUA 2KI2A 2Y1IA 2J6TA 1G3OA 2RHQB 3QGHA 1RT4B 2HNZA 2ZFHA 3F73A 1V3RA 2KXHA 1DZ5A 4LT6A 4L3NA 4WU2A 5DZ6A 3SQGA 5K8PA 3HSGA 4I2QA 3WIUA 2U2FA 2VQFF 3CJKB 4WP3A 4DPTA 3Q83A 3TANA 4DFKA 4RW4A 2X51A 4UUXA 4ZVGA 1AXQA 1FERA 4IYQA 2BVZA 2KT5A 3FRZA 2W24A 1CG2A 4G1IA 4K2JA 2YNHA 1WD6A 1FK9A 2MXYA 4YDDB 3DLKB 3GTYX 3L9ZA 1M1KT 1MWQA 4UOHA 2IVYA 3BSNA 4NA1A 3MPYA 4MKBA 4QWEA 3EPIA 3PO5A 3I56S 2UXCF 2CQGA 5KFZA 5KAKA 2OELA 2WAQD 4Z7YA 1JIHA 3PXGa 5FIIA 5KG7A 2W4DA 3HVTA 1BMQB 1JKHB 1KFDA 4K2XA 4P73A 2YNGB 2WVBA 1NXIA 2BJ9A 2HZAA 4DCJB 1RUSA 2CJAA 4DUZJ 2Z2YB 3FKBA 3NGDA 4MK7A 2HHVA 1IKVA 1FEHA 3K89A 2R7RA 2CZ4A 3HT0A 1URNA 2GHVC 3E01A 4WYWA 2AJ4A 2UUAF 3RU0A 4DSFA 4LRAA 3LF0A 3CJ3A 2FY8A 2C28A 1PYOB 3RAQA 4JV2A 2DT9A 5F9LA 4X65F 1S1XA 1DQAA 1Y10A 1S0VA 1N6QA 2AEJA 2N82B 1VQYA 3QWPA 4X64J 4YB1P 1U47A 4F02A 3QPIA 1NKEA 3SFGA 2AU0A 2AX1A 3GYGA 2HLUA 2F9JA 1S49A 4OZNA 3VTIA 3CCUS 1YHQS 1TL3B 2V9WA 1RWOB 3ADAC 4J9VA 4JI5F 3W62A 2QYCA 5DDPC 4Q45A 1S0NA 3DLGB 2FJDB 1LW2A 1QUVA 3H7HB 1N34F 3SV4A 3EPGA 4PPZA 1K9MT 3PM9A 5HVHA 1IBMJ 1WG1A 2LXFA 1SC1B 1S97A 2H48B 1S9GA 3C14B 5T7LB 5EDWA 3BQ2A 1UKUA 1G4CA 1H6KX 1SC3B 1QTNB 4DV0F 2J0SD 3FJ2A 4P2XA 3R5CA 1YBUA 4OI2A 2CJQA 2ZBPA 2VFRA 3BM7A 3ZTSA 4LQ3A 1T9YA 4O3RA 4DV6J 4FKYA 4MKAA 1C0TB 5DDQC 4CM2A 4CLYA 7FDRA 4LFBF 3P6YC 5KFNA 2DNYA 3AQPA 1CS4B 1SJ3P 3I6PA 2Y8YA 4K4WA 2CG4A 1YRTA 1AYEA 3H90A 1QD1A 2GMHA 3ENWA 2PEHA 3IXQA 3CD5A 1SL2A 3G82A 4JI3J 4ALZA 3CJ8A 2AJQA 3MM5A 1R8HA 4FXDA 1FJGF 2LQBA 2MMYA 3WDOA 4R5PA 4M5NA 2OSQA 2R4FA 1Q78A 1WHVA 3DDNA 3MMBB 4DUYF 3L95X 2DY9A 3W3SA 2GQ2A 5A76A 3WHIA 4NLVA 4JI1J 1BXNA 1SQEA 2E5JA 2ZDPA 4E98A 3PVXA 2DHAA 1H2TZ 3EGWB 2V63A 4QPTA 4WIIA 4OX7A 2R2RA 2HVZA 4BBYA 3W5XA 2R2UA 1FD8A 2L9DA 2E5IA 3DMJB 2C2ZB 3CCZA 3UR0A 1S6PB 2CPZA 5LT5A 2RAQA 2WCXA 3OUYA 5J1EB 3KJNB 3MCOA 3E51A 3PFOA 3ZTPA 2RRAA 5F8NA 4P2SA 1LFWA 4KHPF 1JLFB 5FDLA 1N5YA 1ULRA 4KH0B 1Z2ZA 3IR5B 4TKTA 4C8NA 5J2QA 1RA6A 4ECUA 4IFYA 2DNZA 2RSQA 4KIAA 2HQGA 4KSEB 1S59A 2MYFA 4NLWA 2NCKL 4ED4A 4LR8A 5D0EA 2Z56B 4NMLA 1VRUB 4OV1A 4DLEA 4HL9A 1BD6A 3IBCB 1VQPS 4M5GA 2XTJP 2AEMA 4ZPTR 2R8JA 3R5JB 4MMOA 3CMAS 4ZCKA 5A8KA 2C2DA 4ZVRB 1W7WA 3JTNA 4H4MA 2OFGX 2R3VA 2DD8S 3CCWA 1PCAA 1WC6A 3M1VB 2JZ5A 3NOGA 4R8UB 1PJ7A 1NEEA 3KJFB 5HLFB 2DJWA 2B6AB 2AJFE 1E6VA 3W2VB 3GJRB 4WCEQ 2QL7B 4WPAA 3FCVA 3DHWC 2QSWA 3H4BA 1SV5B 1GK8A 1JXEA 2EFGA 4YOEA 3MUTP 3CO0P 4TU8A 4IOBA 3OV7A 3UCZP 2QLBB 1SKUB 3HVTB 2YBVA 3IAM9 3UVJA 5J2NB 2J76E 1N48A 2K06A 4L74A 3I5CA 3N9UC 3V6DB 1RLDA 2EW9A 3TYTA 1RT3A 4JUZA 2CPXA 1Q53A 1H2VZ 1QJHA 4QWBA 4KC5A 3KOAA 5KFUA 5HN0A 1NB7A 1VQMS 4LFCF 2DNNA 4Y3CA 1DRZA 1S1UA 4G6VB 3RB6A 3MM8B 2YWFA 5HI7A 2ZH3A 4LR9A 4KB7A 1LXJA 3M8ZA 3MWBA 3BQ0A 4ZMMA 2QX0A 4DHVA 1IKVB 3I0SB 4EGLA 5KFCA 3O8WA 3SQGB 1XBWA 2G2OA 3CDAA 4DXLA 2E1RA 3LPYA 4YHHJ 4QWAA 3GIKA 3UD4P 4ED1A 1HI0P 4NXMJ 3MM9B 1TMMA 1S7HA 1T9UA 3BGLA 4KGKA 1M5HA 2H9ZA 5AJ3J 1RI7A 1Y4ZB 5IOLA 2ZJQQ 1I6JA 3TZZA 1KQSR 4LF8F 2OEJA 1TL1B 4DZDA 4MYTA 5F3ZA 5ETNA 1BQNB 1RBLA 4I6WA 4F7VA 2HK3A 5GAHU 1YJWS 2QG9B 1W2BR 2DNQA 1IBKJ 6FD1A 5CA5A 3P96A 2AYMA 1SJFA 2FJAB 3GONA 2VPYB 3ENQA 4PQUA 3QT5A 3LWMA 4ECTA 5G0RB 4A48A 2CDRB 3PW7A 3CGIA 2PI4A 4AXJA 1NPRA 3HJFA 4HHJA 1EZZB 3RBXA 4OMFG 3OVSA 3J81Y 5H9EJ 2RF2A 1TAQA 3I0SA 2WOMA 2P9EA 5BJRA 5LMUJ 5F0UA 2HHUA 4CQ1A 5KTQA 2VDHA 3GYXB 3TJ9A 2WVCA 1RP5A 2DGXA 2XYHB 3Q24A 4RBVA 2E7WA 2XMVA 5J1NA 4C8ZA 1S1UB 3BSOA 3PX0A 3SMZA 3KYLA 1WF2A 2VF3A 3CVKA 1Q8KA 1XQIA 2JH3A 4HHHA 4A4JA 1K1SA 3BSAA 2B5JB 2R8GA 1FKOB 2XZWA 3OPKA 3N79A 1Q81T 3PG9A 1RT3B 2CWXA 3TJ8A 3VAMA 1B0TA 4QYRA 4DFPA 4DUTA 3W5ZA 3QQCD 4ZVHA 2RS8A 4YS2A 4AT1B 2ZUGA 2OTJS 4DG1A 1R0AB 5A0YB 4YDXA 1IBCB 2HFSA 2PA3A 1HNVB 1EIYB 1AROP 1GT8A 1UZDA 4O44B 1ZAWA 2K7KA 4YR0A 2QLXA 3D3CJ 5HMZA 4ZP9A 1D9AA 4RPFA 2YKQA 2B6AA 4KFBA 2EKYA 2XMKA 3W2VA 2IM0A 6FDRA 2OGUA 1VLYA 5DG8A 1R8CA 4B9TA 1F5BA 2KYXA 1DTQA 2VPXB 2VBZA 4LIWA 2GMJA 5AE1A 2A6MA 1RAHB 4ZJOA 1HWLA 3BO2A 2R7SA 1WDDA 4J9SA 3QATA 4MKYA 4I4BA 2N7CA 2GVZB 2Q79A 3C16A 4OYMA 2UVWA 4KGZB 3EMTA 3HF5A 4ED6A 4LF9F 3Q22A 4TY8A 3GPAA 4LF4J 1RT2A 3M32A 4FVMA 2F7VA 4A47A 5F0WA 3BJYA 2R42A 3K8VA 4TLRA 2WTFA 3KDOA 3KMSA 5IT9Y 2XWYA 4J91A 4JV1A 4GRSA 4O44A 5EX3A 4DR4F 5LSRA 1F60B 1KEKA 3B78A 1M5PC 4YY3J 2MLYA 2IBKA 2BZ2A 4L76A 5EN1A 4YUDA 4UY8T 4ANDA 4JYAJ 4JI1F 2QA1A 5CABA 4MYUA 2DHSA 4NLTA 3MM7B 3TQEA 2ZM6F 2VBWA 3H0PA 3VAKA 1NK4A 3TA2A 4G1QA 2LMIA 3M8PB 2GVZA 4N56A 5KFEA 3TAPA 3K57A 3CJSA 2OAUA 1YJTA 3Q23A 4CO5A 1LW0A 1U0SA 2HKEA 3AHPA 3AFGA 5AT1B 2DIVA 4KY3A 2J0XA 4DSLA 1HNZF 1UPPA 3HHLC 3M6XA 2ZJPQ 2M8DB 5CHCB 2DRAA 3CJ5A 4HKQA 1S1VB 2Q6BA 1PJ6A 3J7ZT 2IVFB 4D3GA 3V6DA 1R89A 2NXUA 4RW9B 2V2KA 1Q79A 3EVOA 2W8LA 2XS2A 2W4CA 3N5FA 2P6SA 3HFZB 4F4KA 3ONQA 1OYEA 4FDFA 4P72A 2HG4A 2OJ3A 4CLSA 1UEKA 1C1BA 2KJVA 5BR8F 4NLDA 5HVFA 3NWGA 2OHDA 3OBIA 4ANEA 4DCOB 1CJUA 4IH5A 4ED0A 1Z4UA 2FPHX 1URRA 2HWHA 3W9HA 4FBTA 3BV8A 4FP9A 5IT9U 2A3JA 2RF2B 4O4GA 2NYHA 3DOLB 1WC5A 4K5RA 3C6TA 3VGSA 1RHKB 3B6BA 4F67A 3EUNA 3WX4A 2R7WA 5KG0A 3S01A 3CD6S 4AQYJ 1HD0A 2VKRA 1Q8BA 3OR2B 2B56A 2CPHA 2KTQA 1HYSA 2W2PP 5GMKa 3IS9A 1RSCA 4I6AA 2DO0A 2XULA 2U1AA 1KLMB 1TL1A 1WACA 5U47A 2DITA 5F3TA 3OQ2A 3SCJE 4LFAF 3QRRA 4RNMA 2AYGA 2B4PA 3R7NB 1REGX 2XSJB 1N6QB 3BN7A 3BO4A 2XEXA 2E1PA 3VAGA 2CFXA 1KHVA 2FTRA 1FJCA 3O3LA 1JJ4A 5KG1A 1T7PA 1Y3KA 2GVDA 4PR6A 3D0HE 1R3NA 1S0MA 4IOAQ 2GHPA 3DLEA 4N5SA 4GC6A 1Y3JA 1U1RA 2DNRA 5JJBA 4JOUA 4HTJA 4PWWA 4RNHA 2YWGA 5C24A 2N4CA 4OYWA 4DR3J 3TUPA 2D69A 2KDOA 2WW8A 5GAHI 3DCAA 3FFIB 3S8SA 3JAMU 1S9EA 1F0XA 2ZEJA 2VDIA 4DPUA 2JSXA 4CLPA 2RRNA 3GV5B 1WC1A 4C8LA 1X4EA 5B0AA 5B0BA 1IKYB 1HWKA 2HS4A 3PYFA 4ZCMA 3VAJA 1WUUA 1R0BG 2EEYA 4WE1B 4H4KA 1HQ2A 2MY8A 3DI6A 4UZCA 3MUMP 5J2NA 2BKOA 3D54A 3FEXB 3UWTA 4Q44A 4IRCA 1RTZA 4EWTA 5HQLA 1IR1A 2LEPA 3M6WA 4V1Ak 1FKPB 1KTVA 4DZ6A 3TUIC 2XBPA 2EBEA 1RWXB 5ETOA 3WC0A 4FBUA 2ZVSA 3MPWA 4ZVTB 1FHTA 3NRBA 2MQ8A 3K5NA 1NH7A 2LEAA 1XEZA 2Z2ZA 4CYUA 4X4UA 2H4YB 3JAMY 4KHPJ 5CD4A 5KFHA 5L1JA 2J0WA 2YKMB 4UT4A 2ZBCA 3EZOA 2VBXA 2ZH1A 4JV5F 3JTOA 2CADA 3GIIA 4A8FA 1KHWA 3K17A 3NGSA 5L46A 2RU9A 1KP6A 3W60A 4O4RA 1JXLA 1D8YA 1PAUB 2LQ5A 3M8PA 3UFCX 5DG9A 4HVZA 4ZLPA 3DLLQ 2C2OB 3QBCA 4KPCA 2OI2A 3BH7B 2QMXA 3CF5Q 2MQQA 3GSDA 1KOHA 1MMLA 2HVEA 3M8YA 3PO4A 5EX0A 1LWFA 5KT5A 2BKNA 2ZKUA 5GAEI 1PBAA 1N32F 3KMQA 2Y1LB 1RAIB 1VJQA 1NK0A 4KO0B 2GW8A 1M1GA 1VGYA 3IG1A 2GFFA 3UN5A 1FKAF 4I7FA 3Q89A 3SBMA 1S1XB 2OP5A 3RR7A 5G0RA 1CSJA 1JLAB 1XR5A 7AT1B 4N76A 3KNAA 5HSPA 2MEWA 2J0QD 2VOOA 3EGZA 2HBYB 4WK3A 2LLZA 5EUHA 4XPCA 4C4WA 2ZC4A 1UVIA 2BM0A 3L09A 2LU1A 4DR5F 1JLEA 2V4QA 1QSYA 3Q2TC 4Y2KA 5BYSA 3W9JA 4MK8A 3ITHA 2R7VA 2AMCB 4DV5J 1FFSB 2JEIA 2FD2A 2ASDA 2V8DA 2DRDA 3MM9A 2GCFA 3V6KA 4PKDB 4WKRA 1N4LA 4NASA 1TMJA 2E29A 3B4MA 4DV2J 4I2PB 3VVTA 5EWEA 3BBFA 1ACMB 1RHUB 1RTDA 1JJHA 5IWAF 3OTBA 4CO3A 3G6YA 3QJLA 1KKHA 2ERRA 2HBQB 3V4IB 3HZGA 3CWJA 1QSLA 3R2CJ 4A8QA 1I3OB 2GVDB 2YNIA 3F56A 4O0IA 1SC4B 3HPOA 1RZMA 1NK5A 1V3ZA 1D9DA 2H5IB 5L1KA 5CYQB 3AD8C 3EE3A 1RWVB 1LQ9A 3S6EA 1RTIA 2DGWA 1F5CA 2DH9A 3GB0A 2WSEC 5D78A 1YIJS 2HRYA 2H3EB 4ZPDA 2OMLA 5KOWA 2EI5A 2BACA 3KKFA 4HR2A 2BANB 4URQU 5L9XA 2OKQA 1XTZA 1I51B 3NS6A 3US5A 1X4GA 4FF4A 1LW0B 1WOPA 3OTOJ 5JVHQ 1U1LA 1UVLA 3ZNUA 2KHDA 1HBUA 4HT7A 1GX6A 1DLOB 3EWGA 3MD3A 4K8RA 4NZ0A 2HHQA 2CIMA 2V5HG 3I87A 3TQ1A 4X4TA 2BQ3A 2PSZA 3H2UB 4ID8A 4M63A 2DNLA 2HQFA 4DSEA 2GO9A 3R27A 1N56A 1TAUA 2PFFB 2G13A 5I4MA 2EVZA 4Q0BA 2AYBA 1Q82T 1HBNA 2AJ2A 1KS2A 3I31A 3MTJA 2DR7A 1Y11A 3CC4S 3GE9A 2ROPA 2MJUA 3KLIB 5KT3A 1JK9B 3O5TB 3D6TB 4NRTA 4EZ9A 1UA1A 1EAYC 3D68A 2GS8A 4OL8A 1HBUB 2VUGA 4RUCA 5H9FJ 5FJ4A 3FBCA 4LSZB 1RTHA 1VC0A 4DR4J 1Q5VA 3KDNA 1ZA2B 4Z37A 2ZHBA 3K5MA 3Q8UA 2FHOB 3VGTA 3HMJG 1S76D 3IA0A 5DGAA 2ZOMA 4K4XA 3HVAA 4JV5J 3LP2B 2Z2LA 3BKTA 4RBTA 1FX4A 3KUHA 1NNDA 5KFPA 1ZAXA 5DG7A 3RAXA 3MEDB 1RAEB 4DV4J 4JI4F 5HBMB 4LFAJ 2HHXA 5KFWA 1U48A 3ZZ0A 4F4YA 3Q86A 2JFDA 4M5IA 4DQRA 2AGPA 1WDTA 2EXUA 4ERDA 3PR5B 1EETA 2CJBA 2IRYA 5J2MA 3P4UB 2CVEA 2GJ2A 2KRRA 3KNGA 4C97A 3T1HF 2CAJA 4LBPA 4NLSA 2MKIA 2VC1A 1N8RT 4I2QB 1C1CB 1N0VC 2JDJA 5AE2A 3KK1B 5HQMA 1U24A 4TN2A 3VVUA 1TFYA 2BE2B 1RU1A 2GV1A 4F4XA 3O6QA 3UNGC 1L3TA 1TFWA 2V2VA 3J81U 4CO2A 1YZ7A 4ZDNA 1RWUA 2QIFA 1UL3A 3WZ0A 3H4DA 3FSIA 5KT2A 1NAQA 5C42A 2J9DA 2YX1A 2DRBA 2M52A 2DNKA 4K7QA 5KFOA 1IN0A 2UUCJ 1HHQA 2ZH2A 1PIEA 3G8SA 1TL5A 2IFXA 3M1VA 1TV6A 2NXEA 3NLCA 4Y2MA 4I0WA 4OHWA 1OIAA 3GR0A 2AP6A 3I82A 2AZ3A 4I56A 2BOAA 4ES3A 2OTLS 4DL3A 3C8YA 5E5NA 3VAHA 4TVAB 1LWCB 1NK7A 2CQHA 2GX8A 1RISA 4RZRA 1IKXA 5CYJA 2DHGA 3IRXB 5KFSA 1FTCA 5C2CA 1AZSA 3GJTB 3P5TL 4QQBA 2Q6CA 4DU8A 1KN6A 2BJ8A 3CJ2A 3QJJA 1GNKA 1UTAA 4YEAA 4HDGA 2GZOA 4ZLNA 4KV8A 4TU7A 4ZVUB 2FGOA 4L3KA 2LU2A 4L72B 1LV5A 2BKPA 4M5JA 2YVSA 4HI2A 4WK1A 4PYDA 5LMNJ 1OWXA 2HURA 2OD6A 1IWAA 2BABA 4USWA 3OTCA 4RUHA 1F9HA 2VD3A 1RAOA 1YSJA 3JSMA 3D6HB 3GCWP 3M6VA 3HJVA 2MLZA 2EFVA 1QDUB 2ROGA 2YY3A 3A12A 3Q8YA 1TVRA 2YKNB 2CQ4A 3CD0A 4NMXA 3HHLB 4S0MA 1EETB 4GKJF 1HW8A 1LWCA 5CCLA 2UUBF 1EHWA 3N28A 4LF6F 3J7A1 3EGVA 3J80Y 1VBKA 2JVOA 4K5SA 4CLKA 1LEOA 5DQGA 1YBAA 3GWCA 4LVNP 5M2UA 2JNJA 5CZVA 3PZPA 3NAHA 2FJWA 4QJVA 4QPXA 2VFSA 1Y5IB 4PPDA 1WC0A 1HNIA 2YNFA 1A0OB 1LK7A 2W9CA 4QCLA 2XZTB 3D28A 3VQTA 4GKKJ 5JUMA 2XYGB 3OXLA 4Y2AA 2B3TB 4USKA 1C0TA 2P9CA 3UR3C 2EK1A 2NUHA 2RH3A 2ZZTA 1WJ9A 5FD1A 5L38A 2AGOA 2I38A 2WVEA 4JI2J 2DEIA 2L3MA 2XG8A 2ZNZA 5BXIA 4DV1F 1DAXA 2V8PA 3MAAB 2O67A 3QAEA 1S10A 3A4TA 2CQPA 2VFUA 4F3OA 1CQMA 2HFVA 2KRBA 2HHWA 1I94J 3MDFA 3M7VA 5B0EA 3RUBL 4AQYF 4DQPA 4WFBQ 4DEZA 4DI6A 1T94A 4KBIA 3OL6A 1RT7B 3MURP 5DRKA 3JSRA 4X84A 3ZFVA 3CDBA 3CCQS 2F40A 4R0JA 2UV8G 1MLAA 2MKSA 1UWBA 4ECRA 1SJ1A 1TU0B 4B9NA 2B9XA 2VC0A 3H5XA 1FF2A 1LWEB 4NYPA 3G6ES 2KFZA 1NLKL 4TQSA 1JLBA 5B0DA 3MR2A 1KOOA 2UXDF 3I0RA 1Q1KA 1G1XA 4IG0B 2UXBJ 1UWBB 1P8GA 3MGJA 3ULHA 2YPZA 5FLXU 4K4SA 1FEEA 1X60A 3RRHA 1JLFA 4GMKA 1RT6A 1FWLA 3AA8A 3DU5A 2K3IA 2D7SA 1FO1A 1RTHB 3QIDA 1H3DA 1L3KA 2E7VA 3WQPA 3HSZA 4A8YA 2VONA 1TKZA 4V19J 1HW9A 3NNHA 1RAJA 3P3DA 2CJXB 4O4GB 4CH7A 1X4AA 4DL7A 3GLJA 1VOMA 2ILYA 2ZC3A 5LOQA 4JI8J 3KLFA 4KGMA 2VG6A 4X62F 3QT8A 5BYQA 5DQHA 5KFJA 1O5JA 4OIXA 1JLQB 2GO8A 1IJEB 3IM8A 3I4HX 2BE9B 4LBHA 3LQVA 4OLPA 3VGVA 2XLJA 5CQGA 1FWKA 3ICLA 4U7CA 2XO7A 4OX9J 2W7PA 3I0RB 1P6TA 2IRXA 4PUOB 4WFNQ 4C48A 3NS5A 3AAWB 3C2PA 1OPIA 3MEKA 3DLKA 4YMEA 4ELUA 2XY7A 4Y34A 1U0HA 5K8OA 4IG3B 5AXLA 1WSRA 4BC7A 4P75A 2JX2A 3PIOQ 3TA0A 4J9MA 2ZD1A 2P9GA 5IZHA 1N32J 3CC7S 2CPIA 4C2MA 2FJEB 2RQ4A 2KJWA 3QT7A 1SQFA 4KGXB 1X9SA 2QFIA 1ICEB 2V50A 1VQ7S 3VALA 3J81j 3A8IA 1D0EA 2JC0A 1XNRJ 3PHEA 3A3PB 1XR6A 2B9YA 4WZQA 1N88A 2I8EA 2HPUA 4M5MA 1M5VC 5HJYA 2YWKA 2VKZG 2VL1A 1EQMA 9RUBA 1QUPA 5E2QA 4RNNA 2W2QP 1S0OA 4WZMA 2DXDA 1U26A 4F4AA 4KV8B 2C2MB 2H5EA 3ET6B 2COLA 4JI8F 3U1MA 2KH9A 3DLGA 3IS9B 1B70B 4RW8B 1FFWB 3D66A 2IHR1 1XNRF 1F5AA 1Q0NA 1SKSA 1HHSA 2HS3A 4Y0FA 4IQMA 1G7CB 4RU2A 4CO4A 3C3LA 4MJKA 4O3SA 1HD1A 2G0IA 2A2DA 2YX4A 5ETKA 4DV3J 4IDKB 1U2CA 1KTQA 3HHDA 4RUBA 4PG4A 2HGMA 2IJNA 3VGUA 1DURA 3M8QB 4USIA 3HKZD 5F9NA 1F1BB 1P9QC 4P10A 3IBWA 5HO4A 1GX5A 1FT8A 4P2MA 4KR0B 5A2QU 4ZN3A 2YWWA 1QAIA 1TKXA 4X65J 3BO3A 4P74A 3ZNJ1 1IBLF 2CWKA 4DV3F 3V6JA 1X4HA 3CCRS 2WB1D 4B9VA 3KHRA 4NYZA 5E33A 4X4NA 4FZVA 1UW4A 2PN6A 1NM2A 1YK9A 1LW2B 3OL7A 1VC5A 4NLGA 1QAJA 1RTJA 2ZWPA 1O8BA 4LF2A 1S6OA 1X4FA 3MUVP 1CULB 4BS2A 2VODA 1AFIA 3DGPA 5D0GA 1RKIA 4CO0A 3PYGA 4JI2F 2BRLA 2QTWA 4E2FB 1RWPB 3MR3A 2PI5A 2WVFA 1NJXA 1Z2LA 2Q66A 1S1TA 4ZK7M 3EM1A 1O6XA 1S1WB 2MLXA 2OMOA 2WB4A 2WRMA 9ATCB 3K5LA 4FPIA 1GH8A 3PFEA 1S6QB 4ICLA 1NDLA 2V6AA 4OZJA 4LF9J 5C7PA 3IR7B 1U1PA 4J9QA 3D1HA 4XO0A 3R5DA 2O01C 2YKPA 1SH3A 2CKWA 2FGCA 4ELVA 5IT4A 4WTOB 3CJKA 3ZZYA 4WYLA 1HBMA 1D9FA 2MQMA 1FTRA 4ITSA 3DRSA 2NPIA 4MT1A 2OPSA 3FEZA 4LF6J 5L39A 2FHKA 2V4JA 2ABYA 4OZ3A 4OJ3A 1UVNA 2RT3A 2RU3A 2XWXA 2KFNA 4FYYB 4OJGA 4PQUB 4KPYA 1YKWA 2O1PA 7FD1A 4K59A 4AL7A 3QSIA 3TWZA 2LDIA 4CLLA 3R6GB 3NCRA 2ATLA 3BR9A 4EYHB 1F3VA 1K1QA 3K2YA 2KYZA 4OYPA 3T41A 2EG2A 2UUAJ 1ZM4A 2FC8A 1YJUA 2NS1B 1N36J 5KFLA 2BDPA 2DO4A 3ZZUA 3MMAB 4JI6F 2WONB 2QC3A 4XTTA 4B02A 4WWSA 2BR0A 2PT0A 4I68A 1SUQB 1OY6A 5EWGA 2APOA 2OPPB 2FVQA 4Y2CA 1BC6A 1FRHA 1MNEA 2RMLA 1QAXA 4NLPA 4LRCA 2HFZA 4Y65A 3EDQB 1KQFB 2ADCA 5D0HA 4CH0S 2MKCA 3GJQB 2IAJB 2WW4A 4A8XA 1BWVA 1U2FA 3GFXA 1JQGA 1UW9A 5D6GA 4X4PA 2XY6A 1B3TA 4RO0A 5EWFA 1X8DA 4DMZA 2AZ1A 2KXNB 2DGVA 2KN4A 4N41A 2G9OA 4J9UE 2KG0A 3BN4A 3E8OA 5K9FA 1YRUA 3MPUB 3TUZC 1FESA 2UXBF 2HNYA 1XMBA 4DS5A 1HYSB 3W65A 5BYRA 4NXNJ 2BANA 1H0HB 2DPJA 2J7WA 4ED5A 1IQZA 2X1GA 3BDEA 1SV5A 3T9NA 5CCMA 2MKKA 4B9SA 1ZH5A 2MPUA 3D1QA 2QMUB 4K0KJ 4W98A 2BOPA 2B43A 4FS1A 2R7UA 1VR6A 5CYQA 1ZAVA 3L7OA 4YHHF 2NZ4A 4ZPAA 3TI0A 2MQLA 3D1OA 1JLCA 2O66A 2W7AA 3H5UA 3I5BA 3IC1A 1DARA 1P1LA 3MI7X 2FLNA 3QRQA 1CEZA 2VV5A 4ZPVR 4QWDA 1IKWA 3HHEA 3KG4A 1OQ6A 1WEYA 1WELA 1UJ4A 2WVDA 1M5SA 3OFHA 4USJC 4Q5VA 2HWTA 4LQ9A 4B3MF 4LF7F 2UUCF 2AJ1A 1WORA 3FUYA 3MM7A 3ILIA 5GADU 3QJPA 4LMZA 3GG1A 4KE5A 3PJWA 4DR6F 1MSWD 2DB1A 1FDAA 3JQKA 5KG4A 4QR2A 4U7UK 5J2MB 1FJ7A 2XHWA 3DKDA 4OI4A 5THWA 1MW7A 4OI1A 4DWIA 1WKLA 2Y0BB 3AJ2A 1NSQA 1QAYA 4CLFA 1BE4A 3G2XA 4Q2LA 3M32B 1IM6A 1EB0A 1FWPA 3AQOA 3W8GA 4DX8H 1YITS 4F50A 3VHQA 1YJNS 3NL0A 2AHOB 1YLXA 3HD2A 4ID5A 4RW7A 2JWNA 1NPPA 1R0AA 5A0YA 4PXBA 4N47A 4F36A 1NDKA 2VQEJ 1TL4A 5KT4A 1BGXT 2W9AA 2VFVA 3HLUA 3KK2B 2YKMA 1RWNB 1FJEB 2DY1A 1VDHA 1R6YA 1SJ4P 2CQ3A 2BQUA 3GCXP 4ZKAA 3M9NB 5HROB 3KLEA 4KFBB 3CDWA 4A46A 3TZXA 2DR6A 3BREA 4G1PA 5ETSA 4X64F 2VIHA 3BDPA 4JV0A 4FF2A 3QWUA 2W8KA 1S9FA 5DZ7A 3GG0A 1NB2A 4OI3A 2OSRA 2I0XA 3CE8A 3HHKA 2CG8A 2AYEA 2WHOA 5KFIA 4GO5X 3QLHA 1CJVB 3VQSA 5EHHA 5HP1B 1UFLA 3GFHA 4LRBA 4UOCA 5JMNA 2XGPA 4DQSA 1T95A 5E7OB 4F8RA 3WX8A 1HARA 3IFEA 4Q0BB 2Z30B 4HACB 4XK8C 5HQ8A 2HHSA 3IGVA 2X1FA 3CNQP 3DOMB 2AGQA 3KWMA 2RS2A 4WP8A 4EEYA 1SL1A 3D6FB 4HHUA 1GTEA 4DV1J 3NGUA 1CJTA 2BMBA 2QO3A 2XI3A 4LF5F 2MSSA 3QGIA 4TYAA 4WP9A 1QE1B 3ZZOA 5D3GA 1N5YB 4Y00A 2FYXA 5DM6Q 4DUYJ 4F26A 3OL8A 2JRSA 5HK4A 1RU2A 1TKTB 3H2VE 5HMXA 2FDNA 5L1IA 1VBZA 5IV4A 4RW7B 5B08A 1NKCA 2M0GB 2HHHF 4HI1A 1EP4B 3WBZA 1SJRA 4B08A 2EC2A 2WOMB 1T9TA 1KBRA 2LA4A 3EXCX 2XMTA 5IM0A 3FZBA 4U6PA 4DFJA 2GNKA 2R7TA 1S9EB 3ILOA 4KGVB 5B7WA 4IH6A 5KFVA 1HKAA 2MY7A 2YQ0A 2H54B 1JNRB 3W63A 3ETOA 1J5EJ 1S57A 1PGZA 1B99A 2B4UA 5GADI 4GVBB 2ZD1B 1WOOA 1HWUA 2HZVA 4L6V3 3UD3P 2EFPA 1CBKA 2ACMA
chains in the Genus database with same CATH topology
2GGPA 2K3KA 4XDCA 3K5OA 5EGYA 3FCHA 3O2IA 2DH8A 4P7VA 3M2UB 2MQPA 3DNCA 3KJVA 3ZZPA 4RKUC 3MFIA 3CXCR 4QU7A 2M5YA 4MFBB 2HW3A 2ILZA 3T6BA 1S48A 4FS2A 3J7YU 3UDLA 3HM9A 2EPIA 2XS5A 4IH7A 5DLFA 2FVSA 3M2VB 1APSA 3T1YF 1BQMA 3QGPA 1TQLA 2J5AA 2XSFA 4CZCA 3Q8PB 3T5JA 1TK5A 4QZVB 3DFEA 4URGA 5CYMB 1ZPVA 4A8WA 4WFYA 5AXMA 4JI3F 3K59A 4QIWD 1YWXA 1XERA 1ZZFA 3OFEA 3TVZA 1T7PA 2CPJA 1RT5B 1X4CA 1SI9A 1WTFA 5KOXA 4AYBD 1N5TA 4RW9A 1VQLS 4EO6A 5GVQA 5K14B 5F41A 1RTIB 3M2RB 1FE4A 1CC8A 4ZHRA 2LVWA 4YB6A 3CCES 4Q8FA 4K4UA 1UJ5A 2J6UA 2NQPA 1BY9A 2E9TA 4NCBA 1CPZA 4PWDB 1RT7A 1O0PA 1OO0B 3GILA 1JLGA 5DGBA 1OSCA 2YH1A 2EK6A 3KLFB 5B09A 3OLBA 3MOZA 4ECVA 4M8LA 1WG4A 5GAGU 1TK8A 1HBOA 4EBEA 4TYBA 3M2UA 4PQAA 5M2PA 4FXVA 4O23A 3MXHP 2Z4PA 3CCJS 4OZ5A 3SSQA 2UUTA 3V2UC 4ZP6A 4YQWA 4IR9A 4NLUA 3I9V9 3RZAA 5J1EA 2XMWA 1VMBA 4FPRA 3VAFA 4FNHA 4DL2A 4TY9A 4GO7X 1RKJA 3MEGB 1YGYA 1Q7LB 5J2QB 3QO9A 3AB2B 3TO8A 1FDDA 4EBDA 5FDLB 3HP6A 1VBXA 2MGZA 3E3XA 3OFGA 3HHLA 1EP4A 4NRUA 4M94A 4OHVA 1GQEA 3IAS9 1ZM9A 4FN5A 4DS4A 2GJIA 1VIXA 3NBPB 3O1LA 2ZH5A 3AB4B 4RBUA 5D3GB 2BV3A 3KHLA 4RUAA 1XC9A 3MEEB 2B51A 2E5GA 2C22A 2MHNA 2XY5A 1SC6A 2AD9A 3L7PA 2ZOGA 1H7XA 3GQCA 4V19X 2ZNYA 1K0VA 3LW5C 4O3QA 4GC7A 2CPDA 5E0OA 1R31A 3TP2A 2GIQA 3BS9A 4ECZA 3IRXA 2C42A 5KFXA 4HYKA 3W2WB 1PO6A 3LANA 4KTQA 3H5SA 3N6NA 1X0PA 2G4BA 1SB6A 2R8KA 3R1HA 1WEZA 4QW9A 2LA6A 4CO1A 5C25A 3IN5A 4CNYA 1TKXB 3KLEB 5LMNF 2DPIA 3B4DA 3NNAA 4OZLA 3NMRA 3MR5A 1TV6B 1JLQA 1VQ9S 1C1BB 3CCSS 4NLYA 1FDBA 5I42A 2HYIB 2LYVA 5KFGA 2LXIA 1HWIA 3GYNA 5KFTA 3NMAA 4O3NA 3JYTA 2KXFA 2FVCA 4IO9Q 3HK2A 2Y0SD 4JI7F 5GAEU 1KFSA 2VA2A 1OQ3A 1XK8A 5JXSA 3KHGA 2KVIA 2DGSA 3VWSA 3OHBA 1G2EA 5I3UB 1RT6B 4DQQA 3RB0A 1NZAA 3PW2A 1H38A 3FQLA 1GTHA 4NLXA 2ZH8A 2IM2A 1JWWA 1R8BA 4ZVEA 4QW8A 5IQQA 4PXDA 3IWXA 3UDCA 3BGRA 4OJ1A 2V4JB 4X4SA