4ZVRB

Caspase-7 variant 4 (v4) with reprogrammed substrate specificity due to y230v/w232y/s234v/q276d substitutions bound to devd inhibitor.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
YKIPVEADFLFAYSTVPGYVSYRVPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESDSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 19
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvrB00
2HBRB 3P4UB 2QL7B 1F9EB 1PAUB 2XYGB 3P45B 3D6HB 4DCOB 2C2MB 2HBQB 3IBCB 2QLBB 4ZVQB 4DCPB 4ZVTB 2XYPB 3R6LB 1RWVB 2C2ZB 3GJQB 1RWWB 3GJSB 2H5IB 2CNNB 2H48B 1QDUB 2FQQB 1RHMB 2H51B 1RWMB 3D6FB 2H5JB 2C1EB 3KJFB 1RHJB 1ICEB 1RE1B 2H65B 5K20B 3R6GB 2CNOB 1RWPB 1RWOB 3KJNB 2H4WB 1RWXB 2H54B 1NMEB 3NS7B 4ZVRB 3EDQB 2C2OB 3D6MB 2QLJB 1RHKB 1QTNB 2QLFB 1IBCB 1SC1B 2Y1LB 5IC6B 1I51B 3IBFB 1I3OB 3R7BB 1GFWB 1RWNB 2CJYB 2XZDB 4ZVSB 2DKOB 2XYHB 2HBYB 2CDRB 2XZTB 4LSZB 1SC3B 1RHQB 3R7SB 4JB8B 2CNLB 4DCJB 2H4YB 4ZVPB 1PYOB 2HBZB 3R5JB 3GJRB 4ZVOB 4ZVUB 2QL9B 1RHRB 2CJXB 2CNKB 3QNWB 1RWKB 3EDRB 2Y0BB 2P2CB 3KJQB 1SC4B 1RHUB 3SIPB 3RJMB 2QL5B 3GJTB 3R7NB 5IC4B 1BMQB 2C2KB
chains in the Genus database with same CATH superfamily
2DH9A 2H3EB 4U7UK 1U4BA 2EK1A 2VHGA 2KXFA 2OPPB 4KBIA 5A8WB 3C2PA 4USTA 2WSCC 5AE3A 3EVMA 3QAEA 3C3LA 1BQMA 2B9YA 4OHXA 2G9OA 1TKZB 2B4PA 3DRPB 2RT3A 4LF1A 5A2QY 2XMTA 5J1EA 3B8HA 4RW6A 2B9EA 1ACMB 2C42A 3EXCX 2AGPA 1S4EA 3NS7B 3AXMA 3IP0A 3BN7A 2ZH4A 1SQGA 4OYXA 2CZVC 1KTVA 3IR7B 1TV6B 4A48A 1FWPA 3TQEA 3MM9B 4FKXA 3CT9A 3NL0A 2LU2A 1SC3B 1JLQB 1KONA 1KLMA 2IDLA 4G3IA 3QSYB 1IM6A 1VK8A 1R43A 1WC4A 3MEEA 3MPYA 4F7VA 4ZVOB 3CJ5A 4LFCJ 3FBFA 4ZPWR 1SUQB 2L3MA 4WWSA 3EZUA 2HAIA 1RJJA 4WFBQ 3LWLA 4L72B 1SCJB 2LQ9A 4EK2A 3R2DJ 3UNGC 3HHLC 3P3DA 2KTQA 2G2YA 7AT1B 5KG5A 1LWCA 5K5MA 3SSRA 4U8YA 4RBTA 3QLHB 2ZHBA 3KNGA 1OIAA 1W26A 1DTTA 3VAIA 1QY7A 3AJ1A 3TRGA 1DY3A 1RTDA 2IFXA 2WK4A 1MMDA 4M8LA 3HX9A 2QMUB 1S7HA 1QM9A 2FTRA 4ECRA 1D9FA 4AE5A 1PJ5A 5KFFA 5DO2A 3VVUA 2KVIA 4C97A 3K5LA 3TAMA 2XWYA 2R7WA 4LR9A 1PBUA 1TK0A 2R7QA 3PRDA 4LF2A 2XSJA 2WCXA 2COLA 4ED4A 4J7CA 3NBPB 4C0BA 4DPWA 3F41A 3K17A 1C0UB 3VAGA 2YKNB 3Q89A 5F0WA 4NL5A 3HHEA 3FC9A 1VQ5S 2GAHC 1C2PA 2ZH6A 2G0CA 2HNDA 1KWMA 3UR0A 2VKRA 2RD5C 1GXTA 2CQDA 2FHJA 1EX8A 2CJKA 3EMTA 4Q45A 2HGNA 2VBWA 2YVSA 1ZAVA 3J80U 2UV8G 3TAPA 3EVOA 1U8WA 1JLFA 1MMNA 5J2MB 3BQ1A 4H4KC 4ZMMA 5B08A 2W9BB 4ECZA 1RACB 2CJBA 1HW8A 4NLVA 1CC7A 2M2BA 3NCRA 3N9UC 7FDRA 1RT5B 3AFGA 2ZE2B 3ILJA 2E9ZA 4WIIA 2B6AB 1K73T 1JJ4A 3HF5A 4JI4F 4ATNA 3MGJA 2ROEA 2Y1LB 4GC6A 3OD2A 3MI7X 1RT2B 2DK2A 3GP9A 3Q86A 3M6VA 1FTRA 2FHJD 3PG9A 3FCWA 1SC6A 3KLHB 5EX3A 5E33A 1ZTTA 2OP5A 3OSPA 5DDOC 4PUOA 3NMAA 2I1RA 2AYMA 5JVGQ 4X66J 5C2CA 4F4YA 3L7PA 2BOPA 3MUMP 5HLFB 2ZH3A 3OTOF 3LP1A 4ECSA 2JLGA 1LWXA 4Q43A 2MB0B 3G87A 4F4ZA 3ZTQA 5CYMA 5KFJA 3CULA 3OLAA 3ZNJ1 2XNQA 2R2SA 2X7IA 4RW9A 3LP2A 4P2MA 2F5GA 2ABYA 4KGZB 2ZVSA 1VRTB 3FGVA 5IM0B 2BW7A 1T94A 3LTOA 4RW8A 2MZRA 3WC0A 3G2XA 4NI2B 3DLEB 2ZJRQ 2HRYA 3M8SA 2VKZG 4E8UA 1JKHB 1K0TA 1HBNB 1PYSB 2ALYB 4H4MB 1F2HA 2GQ2A 1H6KX 2LLZA 3MHYA 3QJPA 2CZ9A 2CQ1A 4RNHA 3L7UA 1YRXA 3RAQA 3TX8A 1RBAA 3JAMU 5LT5A 5DJBA 4LF8J 3C15A 2YNGB 3MM8A 2GC8A 1SC4B 4FF2A 1S1XA 3CDWA 4LF6F 1UTAA 4KO0B 1YRTA 2AYGA 2HHVA 2AQ4A 4GC7A 2J0WA 2IM3A 1IR1A 3K59A 4HT5A 3DU5A 3PO5A 3ZTOA 3GV8B 4DL3A 2ATCB 4A46A 4NCBA 3H42A 3CJ2A 3RZAA 4YHHJ 4QOTA 5KFKA 2P9EA 3EZ5A 4XPCA 1CJVA 2GJFA 2HFOA 3QRRA 3QATA 3X3UA 3DRRA 2HHHJ 4J90A 3GG1A 1TZ0A 3ONQA 3WBZA 1GX5A 2W2MP 3CDEA 3PEHA 3HT0A 2XCPA 1Y3KA 4A8FA 4UZBA 5L1LA 4KTQA 4BLGA 2P6SA 4FKYA 3KG0A 1NSAA 2HAFA 3AAWB 3HKWA 3J80Y 3C6UA 2F9DA 4DR7F 4PWWA 1U02A 1NPKA 2QFJA 3SI8A 4I68A 2IYIA 2EBEA 3TVZA 2VG7B 3W9JA 1H3DA 3EE3A 5B0BA 3PYDA 2ZUGA 1VQ7S 4K7QA 1AROP 3WHIA 3RRKA 3CJQA 4FVMA 3NKYA 2FPHX 4DBQA 2QE5A 5LMUF 2VJVA 2HWTA 3VQSA 4DV4F 1Q5YA 1YLXA 2HS0A 3MOJB 5A0YB 2V2KA 4RNFA 3WQPA 2XMKA 1QE1A 2UUCF 3N28A 5F3ZA 2UXCJ 3ISNC 3CIMA 2CIMA 1JLCB 3SCJE 3HULA 3UFCX 1REVA 5D8HB 2POKA 4WP3A 5T7LB 4EBCA 3DDIA 3FRZA 1NNDA 2EPIA 4DV3F 2QMXA 3C14A 3MR3A 1X9MA 4X2BA 2CPYA 2C3UA 4ZPTR 5KT6A 4C9DA 3QT5A 3TVKA 3ZNUA 1F9FA 5HJYA 5C24A 2HZAA 5D0HA 3J7AN 1J2VA 2DHSA 2C2KB 2HS3A 1Z1ZA 2HFVA 3MMCA 4PXBA 4ENOA 4P73A 2QLBB 1WNEA 3GIMA 1IKVB 4FXWA 3EPIA 4CLYA 2EKNA 4KRWA 2OPSB 2EG1A 3R2CJ 2IDEA 4OX9J 2PMZD 2H5JB 2NUHA 2IVFB 4NEYA 3THTA 3W9IA 3GCXP 4DZDA 3SZ2A 3IN5A 2Q43A 1LW2B 3FBBA 2CPEA 2WVDA 2XHCA 3KLIA 3JAMY 2IA0A 1VQOS 4F4KA 1YWXA 4DPUA 1P6TA 3TO8A 4O4RA 1I3OB 3IRXB 4C2MA 2ASYA 4RPFA 1RGVA 2YQ3A 4JI6J 5I42A 4JB8B 3LPEA 2RDDA 1KP6A 3JB9k 5DDQC 3N79A 4Y0FA 2HHSA 3OL6A 1R0AA 3H7HB 3FZ2A 2I2YA 5J2NA 1N5VA 2LU1A 2VF3A 3NS6A 1GEHA 1SVDA 2E7WA 1R8CA 1TL7A 3I0SB 6FD1A 2ZEJA 3MEGA 2HQ3A 3ADAC 1EARA 5IZHA 1U25A 1JWWA 1X8DA 5HN0A 4DCOB 4DV5F 3Q8SB 1MMLA 4L75A 4OJGA 1FK9A 1WOOA 1HWUA 2BJ7A 3IAM9 1DQ8A 4I2QA 3P5BP 1RXOB 5IWAF 4CP5A 3IFEA 4NLUA 4PWUA 4NYOA 4LMZA 3HJVA 3RRHA 2YNHA 4MT1A 3ETMA 1GNKA 3KKFA 4TY8B 1RP5A 3E3XA 4DV0F 3VCDA 4S0MA 2W8LA 2YWEA 3MD1A 3OJSA 1R0CB 3I9V9 1RCXB 2BANB 4LSZB 1X0FA 3RBDA 4YS2A 1AXQA 4OV6A 1NZAA 1AFJA 4CTAA 4DCJB 1WKJA 2GQQA 2VU5A 1IM4A 3M30A 4ES3A 1S59A 1CG2A 4QQBA 2HK2A 4ES1A 2MGZB 4PG5A 1JX4A 4J9QA 2GGPA 4KGMA 1A0OB 2VA2A 1R6VA 4JI8J 4NXNF 3IBCB 4F3QA 4DL2A 5CCLA 1RBLA 4DG1B 3TP2A 5HROA 3NGKA 3HHDA 1SIZA 1IKXB 3NNAA 4AL5A 2U2FA 2X1GA 1LWEB 4LF7J 2EFVA 1N0UA 4QBUA 3J7YU 5B7WA 5L1IA 2FD2A 4FS1A 4M5IA 3FZBA 5LJ3Y 4QWDA 1T9UA 2G1HA 4CO5A 2M7SA 2DGUA 1B0TA 4M5DB 2B56A 2WB4A 4NXMF 3GCWP 1VC0A 4DN9A 3ZZZA 2OIHA 2BXJA 1H7WA 4OHYA 5KFYA 3RYLA 2A2DA 4RO0A 3Q8VA 3M2RA 3LA0A 4D3HA 1S1TB 2J9CA 4ZPAA 2HEKA 1TUWA 2OPRB 1EP4A 2DGTA 4AUKA 1M1HA 3UI3A 3FFIA 2ZNZA 5HO4A 2MXYA 3G82A 2L9DA 2ILYA 1CULB 1HWJA 3CO0P 3PW2A 4IG3A 1DFDA 3PO4A 1WJ9A 3OSNA 2GMHA 3MZIA 3M32B 1S12A 4DV7F 4X64J 2O66A 2CADA 4I6AA 4J9RA 3NP5A 1B0PA 1RA7A 4K4YA 3Q8PB 3N6LA 2GA7A 3UO0A 1WOSA 2MQ8A 4WFAQ 3RUBL 1HR0J 1S1UB 3H5UA 3WX8A 3S7RA 2B3TB 3B78A 4F67A 4KAIA 3EM1A 4DFJA 4KH1B 2A0FB 2GHWA 2J76E 1GFWB 2RQKA 3CCQS 2ZOGA 4I67A 1MLAA 1JXLA 5HBMB 1UZDA 3AOBA 4ED7A 4K59A 4LF5J 3O5TB 4ELVA 4DLGA 3I5AA 1YHQS 4R5PA 2BEFA 5J1PA 4K4VA 2MDAA 2V4QA 1MU2B 2DR8A 2F8MA 1T05A 2VASA 5B0DA 1PCAA 1Q79A 4M5HA 1XMOJ 5AT1B 4IFVB 4QR0A 3UN5A 4N47A 3CCJS 3FNNA 1K44A 1VQ6S 2RS8A 3QQCD 4DX5A 2BACA 5GMDA 4Q2MA 3THPA 3AB4B 4I64A 1JQGA 3AODA 4HI2A 3PV8A 2AX1A 4L76A 1HNIA 4UZCA 4CM2A 5T14A 2JEJA 5IT4A 3W3SA 4QIFA 4ED3A 2ILZA 3M1VB 5BYQA 3VAMA 5J2PA 1JIHA 4L74A 5F8IA 1JLAB 1NDPA 4BC9A 5E3PA 2XS7A 3CUNA 1TUVA 2DKOB 2RQMA 3OL8A 3MR6A 3LANA 3KLGA 1YJUA 1PKUA 3POTB 3DLGB 5JUMA 3KLEA 1OS5A 3H0PA 2R8GA 3NWGA 2ADCA 5EGYA 2MKIA 3Q24A 2DPJA 3OW2R 4F2SA 2VFRA 2V0NA 4DSFA 1HQ2A 2CFXA 2M3DA 1LW0A 3G8SA 3BH7B 4OX7A 3SEOA 4HHHA 4RR5A 3Q2TC 1FO1A 1FEEA 2PFFB 4ECVA 3FBEA 1YZ6A 2C2DA 1RYSA 2FHMA 5KTQA 1B70B 1RWWB 2XQCA 3AOCA 3DRSB 1GK8A 2AX0A 3HFKA 2JVRA 3GIKA 1WHYA 3I55S 4DU7A 3A4TA 1ZYQA 3V6DA 2EFGA 3HDSA 3TJAA 4X65J 4MK7A 2PMHA 4M95A 1VS3A 1A7GE 2ZM6F 3UDCA 1YTYA 1NJIT 1YITS 4FYYB 2EEYA 4YR3A 2GO8A 1KQFB 1TKTB 5LXYA 2HLTA 4FYXB 1NEEA 3D1OA 2BE7D 4CLSA 5C5JA 5A76A 3JQJA 2KN4A 4CLPA 3CCES 3BYPA 2OD4A 3G6XA 4I0WA 4NMLA 2LEPA 5T41A 2DHAA 4DUZJ 2Z0GA 4CT9A 1J5EJ 2KVQE 4UOGA 2GHPA 4ERDA 1GTEA 3MECB 2RUSA 4J9NA 7FD1A 3PFOA 1T0TV 4TLQA 3RRGA 2H48B 3HT3A 1TFWA 1K47A 3MEDA 3TZYA 1CVJA 3DI6A 3T5LA 2OJ3A 3PW4A 5K20B 3ISZA 1C4CA 1VBYA 1S76D 5I3QA 3U1MA 3H2LA 3NGRA 1IBCB 1G3OA 1RT3A 3MEKA 1K9MT 3B4MA 2V4JA 4OFZA 1UL3A 4KHPF 2NPFA 2BQRA 2XYHB 1HNWF 2Q66A 5D0GA 2F65A 4C3MA 3FBCA 1UVNA 3UWTA 3E01B 1N5YB 5KG7A 1U09A 1JLBA 4H54A 2GIFA 1RTJA 4DR7J 2NREA 2OTJS 1SV5A 4KGKA 3UVJB 3HVRA 4DL5A 3QAUA 2HNZA 4HEA9 2YKAA 2GMLA 1UEUA 3PJWA 1D8ZA 2HFSA 3ENQA 2VPZB 1URRA 3P4UB 4ZHRB 1HNZF 3EGWB 1RAHB 1FNMA 3AD8C 4C98A 3HSDA 4X4QA 1Q0NA 2E1MC 3OQ2A 2AJQA 2N82B 4LSNA 5HMZA 3I56S 3CJSA 1HBMA 4YMEA 3O1LA 5CYQA 3KLFA 3B82A 2E1RA 2JX2A 4QIEA 4TXSA 4TNOA 2MLXA 2AU0A 1RT4B 4ZVRB 4P2FA 4TVAB 1FERA 4N8OA 4X84A 5F8HA 2JDJA 3HVTB 3HZGA 3V4IA 3KJVA 1DLOA 4N5SA 2UVVA 4JI0J 5AJ3F 2BV3A 5DDRC 3SYZA 3IC1A 2HQGA 2Z4PA 1CS4A 1RT6A 1Q8BA 3KJQB 2Y0SD 2C2NA 2KXNB 5CQGA 3KTQA 3RTVA 1RB0A 3US5A 1HBOB 4NLTA 4U67Q 1TFYA 4DUTA 1F5CA 3GTYX 4JOUA 4ECUA 2ZH5A 2EFPA 2AP6A 2GVDB 1UVIA 4IG0A 3I4HX 3QGHA 2KYZA 5E3RA 3F44A 3HLUA 3OL9A 3GV5B 4DSJA 1Y4ZB 3VAHA 3IS9B 3T9ZA 1S77D 5DG7A 3H4BA 3IR6B 3RB0A 3PW5A 1EETA 1X5SA 2KT5A 4MKYA 2UXDJ 4CDIA 2QLXA 3BB5A 4K2XA 1FX2A 2UVWA 2JEIA 1QVGR 4LUBA 5A6PA 2EWHA 3BGRA 4OI3A 3SXLA 2LYVA 4FYWB 1P8GA 2RVJA 1RI7A 2DGQA 4DS5A 1V5VA 1X9WA 1VMBA 2E5HA 2JH3A 2M4MA 1E6VB 4NA3A 4F36A 3M8ZA 4EBDA 4NZ6A 5L46A 2AYEA 2YWFA 4IQMA 3T1YF 4Q8EA 4F3OA 1HBUA 1UJ4A 1FKOB 2E1PA 2OD6A 1N6QB 1Q53A 4M5LA 2H5EA 2ZDOA 3IRWP 5F0UA 2OUGA 2IVMA 3EPGA 4NCGB 2J8SA 2JSXA 2H51B 3W8GA 4ETXA 3B54A 2WONA 2LCWA 4AT1B 1PSDA 3OR2B 1XR5A 2YKMB 1I94F 3M2UB 1NPPA 1RTZA 1VJQA 2MPUA 4Q44A 2DNMA 1WF2A 1HIYA 2GS8A 3M9NB 3M2VA 3QT6A 2C22A 4DV0J 4PZVA 3VF0B 3J81U 1TMJA 4Y2AA 1I5OB 4MTPA 5D6GA 5KT5A 3R5JB 3MR2A 4NWBA 1DTQA 3SBMA 1UA1A 1O8BA 4I6WA 1FRJA 2ZHOA 4WF9Q 1HD1A 3K7RA 1KS2A 3W5XA 1V3ZA 1C1BA 1FRMA 4NZ7A 2D9PA 4JUZA 1BE4A 4XAKA 5M2PA 4XDCA 2V67A 5GADI 2HWHA 1P9QC 5KG4A 2RIJA 1ZM3A 3AOAA 1X9SA 1FCAA 1R7IA 2E5LJ 3RR8A 1WD6A 4ED8A 3WIUA 2BE2A 1DZ5A 1NJXA 1YGYA 3U27A 5A8KA 4PG4A 3FSXA 2EFQA 2OPQA 4OZ5A 4BDPA 4RWWA 3ZZYA 1WDDA 3MM7B 3OXGA 3L09A 3S1TA 2DNRA 5L1KA 1FNOA 1WKLA 2NXUA 3CD6S 1S6QB 4NLYA 3AY0A 2PA3A 1NKCA 3QMQA 1XR6A 3C16B 4OMFG 3BKFA 4CT8A 1FDAA 3R5AA 4ID8A 4DL4A 2WBMA 3T9NA 6AT1B 1WORA 1RDRA 3MAAA 2QFIA 1UFWA 2FY1A 1NH8A 4IH5A 3QRPA 1B7FA 4M5GA 4DWIA 4F0MA 4J9OA 1KFSA 1TQLA 4GKJF 4HH0A 2C3YA 2ZNYA 1S1VA 1BQXA 4R0EA 2Z58B 1SJFA 1DAXA 4TU8A 3PACA 2OEMA 4DV6F 2Y9HA 3SFUA 4CO2A 1JLEA 4NYPA 1H2VZ 1LXJA 3R6LB 4M5JA 3GIIA 1AUDA 1W2BR 4DN0A 1KHWA 3FMBA 1L3SA 2I5JB 1IR2A 1RTIA 5HJXA 4DV7J 4WJBA 4JI5F 3VR1A 3D6FB 2RMLA 4I2PB 2IAJA 2D74B 1R8AA 3D7SB 4LFAF 1Q16B 4EO8A 2KYXA 4LRCA 5GVQA 3ET6A 4DPTA 3ICLA 2QLJB 1OPIA 4O4GB 4F02A 1YKWA 2DIUA 1RISA 1FJGJ 3NAHA 2LXFA 1ULRA 2EC2A 3DGVA 2P9GA 3JSMB 2FLLA 2HYIB 1N8RT 4HVZA 2YNFB 1S0MA 3JYTA 2AYBA 2YNIA 3VGTA 1Q7YT 1Q4RA 2IBKA 2BJ1A 2YWGA 1VYAA 3NOCA 5DS7A 1JXEA 3CCZA 4M5MA 1RYRA 2JLEA 4GVBB 4MMOA 4P75A 3WZ0A 4HACB 1BC6A 5DQIA 2AV5A 2VUGA 1VFJA 3VAFA 2E44A 1EB0A 2NR0A 3MMBB 4OYAA 4U7CA 4PR6A 1U1MA 2A18A 2UU9J 1SJ1A 3T1AA 4DR6F 4KYZA 2BM1A 4ICLA 1HWLA 2F63A 3J81Y 3KNAA 4ZIVA 3M9OB 1RSCA 2FJVA 2RHSB 3MCMA 2YQ0A 1OSCA 2V50A 4DV2F 4KFBB 1EZZB 2UXBJ 2HWIA 3IG1B 2XBPA 4JBCA 4J91A 5CD4H 1NH7A 2Z2YB 2X1BA 1JLQA 4C3LA 3DOLA 2VG5B 2CG4A 3DLKA 2HQFA 2VDIA 1M5SA 1HPZA 2XMVA 1GTHA 2GVZA 3TX0A 3W2WA 1SJRA 2ZBRA 3KHGA 4OJ3A 4K4WA 1ZM9A 4MYUA 2B51A 4QW8A 4K0KJ 3O8WA 1LK7A 4BWMA 1F9HA 3G8QA 4CLKA 4DR1F 4AFFA 3HSGA 4EI2A 3PEJA 1MWYA 3D68A 1WHXA 4ECTA 2C2MB 1HD0A 4K4XA 3KXDA 3MPVA 4NRTA 1TL1B 4LBPA 5HATA 1X5OA 4EWTA 3PW7A 1YVFA 3CO9A 2HQDA 4OZJA 4QU6A 2Z2MA 5F3TA 2MTLA 1BQMB 3R5BA 3M8WA 4NEZA 1CPZA 4F2RA 3CJKA 4ZVSB 2YKNA 5J1EB 4HR2A 3SFGA 1ZAXA 4QYRA 3H40A 1EIYB 2XEXA 2FJWA 2BJEA 4RW6B 3TAQA 4ZIWA 2KO1A 2XSFA 2XS5A 4YP3A 1S7IA 2J6TA 2OFHX 3T5HA 4DFPA 2A3JA 4UW2A 4X4NA 2ZBIA 3H8YA 3GJTB 1X4AA 4CLWA 4MYTA 1YJVA 1IKWA 4QPTA 2JEFA 1HMVA 4QIWD 3DLHA 1JJCB 2WRMA 1KLMB 5J2MA 1UMJA 2MHEA 4USWA 5G0RB 4DUYF 2B4VA 2LEBA 1N5QA 2DXEA 1IQTA 4B9LA 2GW8A 4AL6A 4WZQA 4A8QA 2HHWA 4Y2KA 2D41A 2A6OA 3DNCA 2H4WB 3UDEA 2LXIA 4EZ9A 1LWCB 2R3VA 1VCTA 4IYQA 4PKDB 3AD9C 2VFUA 3R8YA 1DTTB 3CNQP 1RTDB 3TOQA 4PQUA 1PILA 3AHPA 1M5VC 1EQMA 3IXQA 2W24A 3CD0A 2NUUG 4AXJA 2RQ4A 3O6QA 4ZVUB 3TAMB 1RADB 3MR5A 2B0GA 1Y9OA 3TEHB 5KFSA 5ADZA 1OY6A 2J7WA 2XSJB 3RAXA 2FY8A 1HARA 5FIIA 3UN3A 2CPXA 4ID5A 1OJ4A 5CAAA 1S79A 1N36F 3CXCR 3P8BB 5LL6d 2R4FA 3S01A 1NK0A 1AZSA 2DRAA 2JVOA 1FKPA 2QTWA 2FJEB 1Q7LB 1PGZA 4JI1J 2HNDB 3TZZA 1F60B 1QUPA 1NUEA 2OH2A 4U9RA 2ERRA 4OI0A 2J7UA 5KFZA 1JLFB 2VPWB 3DGPA 2JC1A 4GVLA 5EWEA 3TA0A 1VQ9S 1RQ0A 4LIRA 2K3KA 4MKVA 5CA5A 5AJ3J 4ECXA 2V4RA 3OR1A 3JSYA 2OMOA 3PIPQ 4YY3J 4Y2IA 1YX2A 3L4BC 2W4CA 2OTLS 4KO0A 3SIPB 1HQEA 4QCLA 1T9WA 5CZXA 3BN4A 4ZVGA 1D1UA 3LH2S 3DN9A 3VQTA 1KVJA 1NDCA 2DH7A 2ZD1A 4G1PA 3GIRA 3U1LA 1DURA 3I9ZA 4PUOB 1HKAA 3DYAA 3OTBA 4NCAA 5AE1A 5DQGA 5GMKa 2V8VA 3LP1B 2AJ2A 1ZAWA 3NXZA 5HANA 5HL7Q 2QLFB 5CYMB 1HI1A 4OV1A 2B8QA 1OPZA 4RW9B 5E3CA 2IVYA 3LP2B 2V2VA 5E0OA 2JWNA 5JMNA 4RNNA 2OGUA 4OLPA 2QIFA 1WI6A 2CRLA 2I9SA 4RW8B 5KFAA 1AUSL 4AYBD 4XO0A 4ZP7A 9RUBA 3KHHA 1OSDA 4URSA 2KT3A 4B08A 3RJMB 1N88A 4ZJOA 2A2CA 8AT1B 2HURA 1F5AA 5D77A 2X51A 3JQKA 2AZ3A 1JJ2R 1B64A 2HZCA 2FC9A 2DGWA 1NK6A 4KH0B 1HQUA 3DXSX 2GMJA 1N32F 2FVRA 5E2QA 4JYAF 3C15B 3MM8B 1BQNA 3HI9A 2XGPA 5DZ6A 5C7PA 2D3OR 1R89A 2N4DA 2O5DA 1S1XB 1MWZA 4RU2A 1WDTA 2HVEA 2KRBA 2IRYA 1IKYA 2YPZA 4OZ2A 2QYGA 3NNCA 5H9FJ 2AEJA 3R7BB 5C25A 3PJXA 5E5NA 3DMJA 4DR2F 1EQ0A 3D5MA 2NSBA 4KR0B 2XLIA 5A6WA 4RX6A 3HHLA 2AMCB 3PKYA 1U0HA 2JNJA 4QWEA 4K5SA 5EX0A 1TAUA 4RJVA 2IA6A 1VQNS 2W8KA 3IWLA 3DRRB 3VV2B 1PBAA 2LKZA 2VQFF 1R8PA 2EXUA 3SCLE 2W2PP 4OLOA 3CC2S 3A8JA 1DBDA 3HD1A 1UVKA 2LQ5A 1NBEB 4CH7A 3BQ0A 1RAAB 5LMNJ 2MLZA 2AWZA 3C6UB 3DOMB 2ACYA 4R0JA 3PX6A 4OYPA 3G9CA 2G1DA 2G2OA 1HL6A 5A2QU 3HHLD 2E9TA 1S72S 5F41A 1HI0P 4FYDA 2J0XA 3DRXA 5C42A 4FF4A 1UWAA 3EVWA 1RBOB 2RF2A 5DZ7A 2V5HG 3CD5A 5K8MA 1QD1A 3VGVA 2HK3A 1T3NA 1N48A 4I7FA 5GAHI 2XZWA 1RU2A 2CPJA 1IBKJ 5HAOA 4LF4F 4J9KA 1AT1B 3T1HJ 3FCVA 4L3KA 1ZS6A 2BW2A 3JTPA 2V8HA 4HTIA 4P6QA 3UDLA 3F73A 2HVIA 2ROPA 2G4BA 1QE1B 3H25A 4ALZA 4H4KA 4OYZA 1KEKA 4DV1F 2HBRB 4J9LA 2RH3A 4P7TA 3A8IA 3C14B 3CC7S 1LXNA 2G13A 2PI4A 1XJWB 2VH7A 1V3SA 4NLPA 3GZ7A 5C24B 1F5BA 4RUCA 4ED0A 5FDLA 1CQNA 4X4UA 2PEHA 4C8LA 2X3GA 2DNPA 3EICA 1ICEB 4ZLPA 2CNOB 2WVEA 4LSLA 2HIYA 2CPZA 3MMCB 1QVFR 1U48A 3MURP 3DOKA 4ZCIA 1HYSA 1FXLA 5HK4A 4M5NA 2GJ2A 2Z2ZA 3GFXA 2IM0A 4PXEA 2QA4S 1AB8A 3NGSA 1SI9A 2IYGA 1CJKA 2VFSA 5LSLA 4C48A 3NY0A 2DIVA 4DR5J 1NO8A 2OEKA 2B9XA 4IRDA 2CJXB 3ZFVA 3M4XA 3M7VA 2V63A 1SB6A 2MGZA 2RUGA 3KLIB 2VB6A 3MM6A 4O0NA 1FDBA 3K5OA 3FKBA 5HI7A 2W2OP 1IQZA 4EBEA 2FC8A 1YJRA 1X5TA 1RKIA 4HTJA 1X31C 4B3RF 2RDIA 2XY7A 4YOEA 1N0VC 2XGQA 1GXLA 3D6HB 4Q0BA 5I42B 2EVZA 3I5BA 4M5KA 1R0AB 3K5NA 4KGVB 1D09B 3AQOA 2FQQB 5J2NB 3MPWA 1S1WA 5L8RC 3QGIA 1TL7B 1D0EA 3MEGB 1FD2A 3VHQA 4USMA 4TKTA 2DT9A 2KU7A 2DRDA 2QSFA 4Y2MA 1WTBA 3TA2A 3KK1A 2MQNA 4W90B 4QJVA 5ETOA 1LQ9A 1Y3JA 1KQKA 2BJ9A 1FK9B 3J81j 3MF5A 2C3PA 1TKXA 4I2QB 2Y8WA 2VD3A 3RBXA 3I31A 3JQMA 1RHQB 5F8JA 3TUIC 3PRVA 3V81A 3MCNA 2GFFA 3O3LA 4C7QA 2DXFA 3DFEA 3BPSP 4USHA 4USKA 3DHXA 3GE9A 2UUBJ 2YNHB 4DR1J 2XY6A 1H2TZ 2FYXA 3ENWA 5B0AA 2HQCA 2LP4A 1Y7PA 3JXOA 5F8NA 2NPIA 2HRTA 3PYFA 1IXKA 4WKYA 2YTCA 4B3TJ 4CTAB 1XMQF 5ETTA 1G2EA 4ETZA 4Y3CA 1U1RA 3M30B 5IXUA 4XK8C 1RWMB 4QW9A 2LDYA 5BYSA 3C19A 1MN9A 2DR7A 2WAQD 2XI3A 2EFNA 4HLBA 2GGPB 2H54B 2V34A 2ZWPA 5IS2A 5D4OA 2HGLA 2KZMA 1IWAA 2XO6A 4X4VA 3KK3A 3ZTRA 4DEZA 4IOCQ 2MQMA 1UJ6A 5HBMA 2HHPA 5HROB 2DRBA 2XZDB 1YJ9S 1NPRA 1SKSA 1FTCA 4GKKJ 4FXDA 4HHUA 3GG0A 5AXLA 1WC3A 3TJ9A 4N56A 2VPXB 4OZ0A 2WZ1A 4FXVA 4DSKA 4PYDA 4CM0A 4ZCKA 3UPFA 5KFXA 2W1BA 2VOOA 2CZ4A 2Z57B 1Y5NB 3HVAA 5IQQA 3T19A 2D3ZA 1ZOTA 4AQYJ 2R8HA 3JTOA 2IHR1 4U96A 3P45B 1ELOA 5ETQA 2GV1A 4KY3A 4DX6A 2A10A 3HHKA 2DHHA 1Q8KA 3M2RB 5AXKA 3O44A 1NU4A 4OYWA 1NB2A 1U8SA 2ZVIA 1EP4B 2HFNA 4YUDA 3FFIB 4I1TA 5CZVA 5K8PA 3G82B 1U6BA 1JLAA 1T11A 3LWMA 2BJDA 4IG3B 4O3SA 4FPRA 3TYTA 5ETRA 2YH1A 1KRPA 1RABB 1WACA 4DF4A 1YIJS 3I32A 3UR3C 4IQXA 2RKIA 2KM8B 4KIAA 4ZJLA 2EW9A 4J9SA 2IMOA 4JI3F 2VQEF 4MK9A 3KHLA 3OPKA 1S6PA 3SQGA 2K1RA 5GADU 1TAQA 3ISND 2WVFA 1IBMF 2ASJA 1RLCL 4E2FB 2ASDA 2NXJA 3CVKA 1XNRF 4FN5A 4WTYA 5ETNA 5BR8F 1GMUA 4G6VB 3VZIA 2MQPA 1N34F 4X62F 2PMWA 4R5PB 4HDGA 2CG8A 1SQEA 2AF6A 4YB1P 1T05B 4C4WA 2DVIA 4DLEA 1RT7A 4P74A 3AH6A 2C28A 3MUTP 3AQPA 3GPAA 2MY7A 3D1HA 1L3KA 4LRDA 1FA0A 2VIHA 1UEVA 1VC6A 4FF1A 2XULA 3BF4A 4K50A 3QBCA 3W2VA 4J9PA 1KOHA 4A8SA 1T02A 3NWRA 2AHOB 3RB4A 2VFVA 4TYBA 1HNIB 2ATLA 2IBOA 1S57A 1A6LA 3H2UB 3M8PA 4QWBA 5HP1A 3G86A 1HA1A 5K14A 3KUEA 4FS2A 1RUSA 2HQIA 5J2PB 2WW4A 2O1PA 2CQPA 2DNKA 4CZCA 2C2EA 3BH6B 3QGGA 2QYCA 4CO3A 2R2UA 2B5JA 4Y00A 5GAEI 3ZZOA 2DNZA 4ZS6A 1BWVA 4F4WA 3KLGB 4NYZA 1UCNA 5ETVA 1TR0A 3KLVA 2GX8A 2X1FA 3KLEB 1KC8T 4F26A 2UZAA 2FGCA 4WTOB 5F8LA 1WTFA 1QDUB 3TARA 2OI2A 2IY5B 4DPOA 1B4SA 1LW0B 3EX7B 3QPIA 5ETKA 2VJUA 4O3PA 4O0IA 1QTNB 2M9KA 4RUAA 4QIVA 1N5YA 1GQEA 4ECWA 1YBUA 3W61A 3GONA 5JJBA 3V6DB 3OXFA 3HCXA 1U0SA 4PWDA 4QWAA 4J9UE 4TQSA 5DRKA 3UNYA 2KXHA 1K0VA 3ZZRA 3TANA 5HVGA 2IC3A 4OQJA 4BS2A 2HRUA 3OXLA 3C6TA 4CO1A 4HL9A 1EKSA 4K4UA 2E1CA 3RAMA 4OZ3A 3TW0A 2NXCA 3IM9A 3TR5A 5FD1A 5F8MA 4RW4A 3NMRA 4ANCA 2XTJP 4NMXA 3DXBA 1T9XA 2D9OA 1RT4A 2R7TA 2AKWB 2NQPA 4DI6A 2FUG9 1REGX 3SSSA 1NKEA 3CDAA 1UKUA 2SXLA 1LWFA 1NSPA 3CCSS 4CCHA 1HHQA 1UVJA 3ZO7A 3MEDB 5D15A 4K4ZA 1GX6A 2DNHA 1JB0C 4ZPBA 3DI6B 3M8QA 2APOA 4B3SJ 2Y3YA 3AA8A 4ZVHA 2AJ1A 2VQFJ 2R7OA 4WE1A 3A3NB 1WG1A 2CQIA 2Y0BB 2U1AA 1RT3B 2VZ9A 2WTFA 4UOFA 4YR2A 1F3FA 1KVIA 3BKUA 2V4JB 4N7TA 1DARA 1M5KC 5F9LA 2ZC4A 4E98A 2V2ZA 4WPAA 2JL9A 4X66F 1FX4A 2HHQA 1JLBB 1RTJB 3DLLQ 2WBRA 1SV5B 2PEBA 4K8RA 4TYAA 1ZH5A 2HNZB 1CBKA 2DGSA 3QSIA 3TZWA 3EUNA 3OFGA 1FT8A 2ZHAA 4FP9A 4RWXA 4HYKA 2W7AA 4JV1A 5HVHA 1S99A 4EYHB 2WOMA 3OV7A 1SJ4P 4LSNB 4WU2A 3TJ8A 1U1NA 3RBZA 1RAJA 4DX7A 1YBAA 1HBMB 1E6VA 5CYQB 3KLFB 4KJIA 3H20A 2JEGA 4FF3A 2XG8A 4W98A 1C0TA 1U2RA 1HNXF 2J9DA 1RWKB 4U95A 3W66A 3R5GA 4PCQA 3BGLA 3V4IB 4C6AA 3KJVB 1F9EB 2GCFA 1NK9A 1DLOB 4WKRA 4G1QA 2DNLA 3K0JA 1OY9A 3OJUA 3DM2A 4LF8F 3D0GE 3FK4A 2MLYA 4K4TA 4DL7A 4USJC 1CS4B 1VRQC 3TUPA 1RT6B 1KVKA 2DO4A 1CLFA 1PJ6A 2PIIA 2ZH8A 2DXDA 3D1QA 4CQ1A 1XQIA 1YQHA 4LF9F 5KFUA 1VJWA 4NLRA 2Q3PA 1M90T 4IG0B 1R0BG 5IC6B 3UE2A 3E51A 1T9VA 4YHHF 2N7YA 3U02A 1V6HA 1ZZNA 2W9CA 4KKOA 1IUJA 2OKQA 3GMGA 2HHHF 4HDHA 5CHCB 1EETB 1YRUA 5L1JA 3L9ZA 3HKZD 2FZGB 1VQYA 2X1AA 1RAOA 3X1LB 2P2CB 3FQLA 3CJRA 4LRAA 2KKHA 3BGRB 4ZP9A 3BO4A 2VC0A 2MHNA 2JLFA 4GO7X 5M2UA 3KMSA 1O0PA 2YY3A 1ZTWA 3BQ2A 2L48A 3NGUA 3B4DA 3PR4A 3BR9A 1VQLS 3TUZC 1R6YA 3TQ1A 2BKPA 1HBUB 3R3TA 2ZH7A 4X4TA 1ZPVA 4WFYA 2BKNA 2JRSA 3CDUA 3HO1A 1VHIA 1KOOA 5KOWA 4J5OA 1N5SA 4RUBA 2FJBB 2KH9A 4JV5J 2MKHA 1FE4A 3MD3A 4GRSA 5M2RA 3HPOA 2WONB 2BDPA 4IH6A 2FLOA 2CQCA 4LQ3A 1NLKL 1NSKL 2EFOA 1UZHA 2UXCF 3M2VB 2M8DB 1RHUB 4O44A 3IGNA 5KFVA 3ULHA 3R7NB 4DQRA 4YB7A 1Y5LB 3W8PA 5EWFA 1QTMA 1FVQA 4V19X 1XMQJ 4CLTA 3ZC4A 4P9SA 2E5IA 2ZITA 2ZOMA 2D69A 2OFGX 1KKHA 3OFHA 1NKBA 2PD1A 4YDXA 1C1BB 2ZUAA 3GU0A 4B02A 2JJ4D 4N8NA 3ZXWA 3TEGA 1HNVA 3DC2A 5J2QA 3PR5B 3BSOA 1M1KT 4XTTA 4C11A 1WSVA 2BE9B 3V4MA 4HHJA 1R31A 2N3LA 2RDJA 1UVLA 4OX9F 1S6UA 4MKAA 4B3MF 4EU0A 4RUHA 1YG0A 2C2RA 4ER8A 2F3JA 2BE2B 4GO5X 4P52A 3C8YA 4B9UA 3NCPA 4I6YA 2KFYA 5A8KB 4KGXB 4WP9A 2VPYB 2OPQB 4WK1A 2XY5A 2HMIA 2H1YA 2XNRA 2EKYA 5D4LA 2E5GA 2AJ0A 4ZLNA 3W60A 2R7UA 3ZZTA 4JI6F 3A12A 2RRBA 4URQU 3D3BJ 3HFZB 1W25A 3GYXB 5H1SV 4USUA 2M5YA 1XN9A 3IWXA 1QLNA 4AD6A 4IH7A 1QSSA 4F8RA 3MAAB 5C2GA 2F8HA 2V94A 2J9DE 3BBBA 5K9FA 2OLWA 3PXGa 4HT7A 4Y28C 2VL1A 3QO9A 3MUVP 2CWXA 2YKOA 1S1VB 4DL6A 1NZ8A 3FCHA 5KG3A 2DNQA 3OUYA 1JLEB 3ZZPA 4CLZA 3P96A 3CMQA 1X4GA 2VG6A 1FDNA 4JI3J 2VQEJ 3SV3A 1VRUA 4NA1A 2IAJB 1EHWA 3DDNA 2AEFA 2DJWA 1RAIB 2P8IA 3BKTA 1C1CA 4QR2A 2WB1D 1LFPA 1IJFB 3BREA 4YB6A 2MKYA 3SSQA 1S9GA 5DGBA 1IBMJ 1HFEL 4RNOA 3OVSA 4FZVA 4C8KA 1ZETA 3JYTB 4X62J 2XS2A 5KG2A 2YNIB 5I3UA 4DZ6A 4DCPB 3G71S 3SDEA 1NK5A 4OX6A 4JI4J 3BBFA 2BA9A 2IRUA 3J7ZT 4YEAA 1H73A 2IM1A 3Q8RB 3R9LA 5KFQA 4PYAA 4JI8F 4G1IA 4NPOA 3QIPA 3GFYA 4P7VA 1IVZA 2IJRA 2K2PA 4QWCA 1AFIA 2VC1A 4FBTA 4O3QA 5GAHU 2FJDB 3D28A 4ICLB 1QJHA 2J0QD 3CCVS 4LF7F 3ILOA 2XZTB 1MROA 1MW7A 3OTOJ 2BABA 2FIUA 3O2IA 2DPIA 4EYIB 2H4YB 3R5CA 1RT1A 1PC5A 4H4OA 4LR8A 4DQQA 4TN2A 3T6JA 2GIRA 2PC6A 5IT9U 3C46A 3BSCA 2HNYA 5U47A 1HWKA 1K1SA 2J8AA 3SMZA 4UQTA 3DOLB 1FRLA 1UW4A 3DLKB 5G0RA 3GFZA 4EFAC 1HPZB 3M05A 2GVZB 1X7VA 3W2WB 2FHKA 3ITHA 4QR1A 1CEZA 2HHUA 1UWBA 2IPOB 2KFNA 5EDWA 4P71A 5A8RA 2QX0A 4P72A 2VV5A 4UUXA 4AL7A 1OYEA 2DYAA 3T5KA 4NLSA 4DQPA 3I0RA 3ZTSA 1URNA 3M9MB 2PN6A 3CDBA 2V9WA 4X64F 3Q8QB 3D6TB 3OVBA 4LF6J 3G6YA 4DS4A 2DITA 5JXSA 1HR0F 3MM5A 2K8GA 1XTZA 3LP0A 2AJFE 3QNWB 4CNZA 1N4LA 3CF5Q 2VODA 3RU0A 2J6SA 4KB7A 3C66A 1OYDA 1MNEA 3CJKB 2IJNA 2OSQA 2IRXA 4LF5F 1KD1T 4USVA 2BYCA 3LGMA 5KFGA 4CYUA 3A8EA 2Q6BA 3RG6A 3WDOA 3CD7A 1OO0B 4MH8A 1JLGA 3KG1A 5I3PA 1IR0A 3EZOA 2C1EB 3MPUB 1XMOF 3NGDA 2ZOFA 3N5BA 1IKWB 3SV4A 2P6TA 1HMVB 3CCMS 1W2IA 2LVWA 4JV2A 5KFCA 1KR4A 4FYVB 1RHKB 4PXDA 1SC1B 5EN1A 3WC2A 3QGPA 1NJZA 4QYZK 4MJKA 4W92B 1QAXA 1SL1A 1S9EB 2MSTA 4NLOA 3QYYA 4MFBA 5CH7B 2K06A 2DHXA 1FFGB 2OELA 5LMUJ 2RQCA 2PO4A 1FDDA 1FE0A 1U49A 1SJ3P 4IR1A 4DV4J 4PQUB 4DHVA 1CJUA 2XYGB 3QZ7A 3EGZA 2EG2A 2G0IA 2DH8A 4UOCA 3V6JA 1JJHA 2E29A 4CLLA 2MSSA 1EAYC 1TL3A 2XYPB 3KK2A 3P5TL 2UUCJ 2CPHA 5K8NA 2WW8A 3G96A 1N5TA 3MR7A 2ZWOA 1FXRA 1Q8LA 3W62A 5KFIA 3OT9A 4DV3J 3LAMA 4O3NA 1UJ5A 3Q0AA 2XLKA 4ID5B 5HMWA 4ZPCA 3EGNA 2C2OB 4ANEA 2GZOA 1AZSB 1TVRA 4W4MA 5D3GA 5IT9Y 1FKPB 3BSNA 3MFHA 1X60A 3AT1B 3OTDA 1SBRA 2Z56B 2MQOA 4R8UA 4X65F 2HZVA 4UY8T 1HNXJ 2CDQA 3SCIE 1H72C 3VZHA 2PFDA 2ZKTA 4PPZA 3DGPB 1UPPA 3NRBA 3BGFA 4DOZA 3U7JA 2QRRA 3GILA 3CIZA 3ZTPA 2KJVA 4AXIA 3BO3A 4LBHA 3OR1B 1QSYA 3CCUS 2C2ZB 2CNNB 4CRJA 4NLWA 4DUZF 1RTHA 1NK4A 3H5YA 2DCUB 1J5EF 3M8RA 1HQEB 1SJQA 1J5OA 1KQSR 3R6GB 2QMWA 1VQMS 1GMVA 4LF9J 4A8XA 4IFYA 4KT0C 2HW3A 1FKAF 1E6YA 2ZD1B 2LA6A 2M88A 2F4FA 3NS5A 1M0SA 4F4AA 2QA2A 2HHXA 2HFUA 1TKDA 3QJJA 4IDKA 3DYAB 1YJTA 2F40A 2UUAF 3UN2A 5E7OB 3M6WA 3MMAA 4DV5J 1HWIA 4PAAA 1WC5A 5AE2A 2FB0A 2YWKA 1RU1A 2L9WA 5FLXU 2B4OA 1U47A 1T8EA 1XERA 2RSQA 4ZP8A 1LNQA 5IWAJ 2PSZA 3IAS9 5KFHA 9ATCB 4DXLA 4KC5A 3GWCA 2L08A 2G0JA 1KBRA 3DOMA 4C0HA 5HVFA 1WSRA 1NJWA 3IA0A 3PHEA 4UUWA 3GJQB 3UD5A 1S0NA 1PAEX 2MY8A 3F56A 1JXVA 1KDNA 1APSA 2LMIA 1BHNA 3PDNA 1OWXA 1KHVA 3ETOA 3BGOP 4LRFA 3MFIA 1TTHB 5DG9A 4V19J 4K2JA 3W5YA 3IO1A 1HQUB 1UW9A 5I4MA 3K57A 1BQNB 2XWXA 1YJ7A 2Z8QA 2R8KA 3VVTA 3KFWX 2Y8YA 1EJ7L 1NXIA 1GAOA 4NXNJ 3E2EA 2CPDA 5KG1A 4ZK7M 1KSPA 1IKYB 2BBEA 4MAKA 5GAEU 4IO1A 5KFWA 1VHFA 2FJXA 2DY9A 1VBKA 2QJ3A 1KNZA 5C25B 3DMJB 2AD9A 4U8VA 5DGAA 2CUYA 4B3OA 5E3QA 4JI0F 4DSLA 2F7VA 4NZ0A 3HHLB 2XC9A 1U0HB 3PHTA 2KHDA 2F1FA 4C8YA 5BYRA 4K4SA 1RWVB 2MKKA 3H2VE 4BHQA 1X5PA 1CQMA 1U1OA 5KFRA 1S49A 1YBTA 1MN7A 3UCGA 3PRBA 4NXMJ 3N4WA 2FLPA 4LFBF 2DR9A 2Q79A 1U45A 3LGHA 4N77A 2DR6A 2LDIA 3VAJA 4IUFA 2LA4A 4FNIA 2YX1A 2R2RA 4LT6A 4WIQA 2BRKA 1R8HA 4B3MJ 2MJUA 2CQGA 1S0VA 1X4EA 4ED2A 4WFXA 2CDRB 1B0VA 4HH1A 5KG6A 2BM0A 1DRZA 4ES2A 4O3RA 3QIDA 3WIVA 4CI0B 3PIOQ 2UXDF 2HVDA 5C42B 2W4PA 1SKRA 1FEHA 1Z2LA 2RF2B 4KSEB 3LQVA 4RW7A 2RHQB 1PC4A 1T03A 5JVHQ 4I7FB 8ATCB 2CJQA 3FEXB 3UDVA 1U7LA 1WELA 1VISA 2KDOA 4JI7F 3N6MA 1P9YA 3CW2C 1WF1A 1JNZB 1YJWS 2DGVA 2JZ5A 5B0FA 3ENVA 1CJTA 4KV8A 3FVYA 3GYGA 2GJIA 3G6VA 4MIBA 4LRBA 4O23A 4EGLA 3FEYB 3MCOA 4F0KA 3HMJG 2W9AA 3G8TA 1TK8A 2OSRA 2GHVC 3HHNB 2JFKA 4QYZJ 1R3NA 5FLXY 4IR9A 2CVIA 1RWNB 2KHCA 2CJYB 3K5PA 1TL5A 2DD8S 2OPPA 3A8KA 5FDLB 1WG4A 2MKSA 2MZSA 3R7SB 5A8WA 2HBZB 4LSLB 1VQKS 4EO6A 1S0OA 1TKZA 4ZLJA 3H90A 3DOKB 2BKOA 3DRPA 5KFBA 4DR4F 1HYSB 4OHVA 6FDRA 3D3CJ 3T5JA 4USIA 2LXUA 3OTEA 1VGYA 1NK7A 4Z37A 2DNNA 3NOGA 1D9AA 1FRXA 1Q86T 4JI2F 2MKJA 2BZ2A 1BMQB 1CJKB 4EUVA 4M1KA 2VICA 4YDDB 5KT7A 1X4HA 2C3MA 2XO7A 2DB1A 4CNYA 4ZCLA 4GMKA 5IQ6A 2R7RA 1TV6A 3MM9A 3MM6B 3IBWA 3BYRA 2FVPA 2F9JA 1IBLF 1N56A 1OQ3A 3FDSA 3CCTA 4A8KA 1NMEB 4Q0BB 4A8WA 1SUQA 3A3PB 3NNHA 2E5LF 5LSOA 4ECQA 1S1WB 1UPMB 3H98A 2HBYB 5DQHA 1QAIA 3QLHA 2V8PA 1UFLA 3W7BA 3GFHA 2QLWA 2ZJPQ 2Y1JA 2BQUA 1XWLA 3OTCA 1S5ZA 1RHRB 2CNKB 4OL8A 2LQJA 4J37A 3KK1B 1BUXA 1Q5VA 2W01A 1X4DA 3Q83A 2QL5B 1G6BA 4Y2CA 3HXMA 1TKXB 1ROFA 1G1XA 1SH2A 2R2TA 4NRUA 3V81B 4OYIA 3QFWA 4Y65A 1RAEB 2B43A 1RAFB 1DQ9A 4UOHA 2GQCA 2ZM6J 1G4CA 3QZ8A 3I6PA 1JMTA 1Y11A 2C3OA 3NBPA 1C0UA 4PQAA 4LBIA 3RGIA 2UVUA 1Y10A 3I5CA 2A6MA 3T6BA 5IT0A 3KMQA 3AJ2A 2YX7A 3NG8A 2RS2A 2M52A 1FF2A 2VOPA 1KN6A 3I4PA 4N41A 1UVMA 4A47A 1SQFA 1QAYA 3UCZP 2GIQA 4OJ1A 2W9BA 3PVXA 1T9TA 1M5HA 1KTQA 3MEEB 3KDNA 3KK3B 1FJGF 2KG1A 1V3RA 1UP1A 2V8DA 5KFPA 1RT5A 3GYNA 3BJYA 4OI4A 2ZE2A 5L38A 1FWLA 2B6AA 4R25A 2W7PA 3SQOP 5KFDA 2WSFC 4NA2A 4IRKA 2K3IA 3TUJC 4A8OA 5MLCV 3EWGA 1RT2A 1SIWB 3CWJA 3T3FA 2DY1A 3M8YA 1U1LA 4KHPJ 1HNWJ 1RHJB 1N54B 3KLHA 1LKZA 4LR7A 1TK5A 4IO9Q 2DGXA 1SPBP 2UU9F 2JHEA 3AXKA 3FSYA 4QU7A 2RRAA 1F1BB 5HLFA 3JTNA 5GAGI 3V5RA 2CVEA 5LOQA 3NLCA 2FHOB 2YPYA 3D0IE 3V6KA 2DHGA 1HNZJ 3ZZUA 3UQSA 2UXBF 1NDLA 3E8OA 1XNQF 1IWGA 5ETLA 2ZDPA 2CA9A 5IV3A 1FJ7A 3RBEA 1VRTA 5RUBA 5IM0A 3ZZ0A 1HLWA 4ITSA 1OQ6A 2OEJA 3MTJA 5LJ5Y 4WU3A 3EGVA 2RKIB 2V2QA 4NI2A 3DLEA 3RB3A 5ITHA 4C3KA 2D7SA 2XB2D 1S6PB 5F8GA 2YWHA 1JKHA 4K0KF 3SQGB 1HBNA 2E66A 2AW0A 2FGOA 1RHMB 2K1RB 3CJ4A 2QEXS 1BGXT 2K7JA 3BZQA 1GT8A 4H4MA 5DLFA 1O5JA 4DL0C 3MDFA 5KFNA 4DU8A 1RWOB 2DO0A 2EK6A 3L95X 1WHWA 3KHRA 3OL7A 3K2YA 1XBWA 2B4UA 2UUTA 2VONA 3CJ3A 3AJDA 2YNGA 1XIQA 1ZZFA 3H59A 3PY8A 2QSWA 1IJEB 2CQ3A 1H98A 1I51B 3ENAA 3IBFB 2Y1IA 3NAIA 3RB6A 4ILMA 2I8EA 3DLJA 4ZCMA 1RLDA 1RT7B 3HD2A 2V6AA 2NS1B 3QFHA 4IOBA 4C8NA 1BWEA 4UT4A 3BBCA 1D9DA 5CYJA 1TELA 1WWHA 4M94A 4XIUA 5HMXA 1U2FA 4ZA1A 3CCWA 3LPYA 3W2VB 5DLGA 1HHTP 2CYYA 1UA0A 4KHRA 1YZ7A 2QGFB 5KFTA 3BO2A 1SL2A 3PYGA 2CQ2A 4FNHA 3P49B 5CABA 2IMWP 3M8PB 1XK8A 5HP1B 3GJSB 1SH3A 1BD6A 5K14B 1J27A 2FJAB 5DM7Q 3LO3A 2F8EX 3DU6A 1MG7A 2B7CB 2RILA 1FHTA 2B5JB 4A8YA 2NSCA 2X3DA 4RKUC 1L3UA 3QRQA 2HVZA 4MKBA 3TNVA 1M5PC 3PZPA 3CSKA 1TU0B 1AYEA 2FZCB 3T1YJ 2UUAJ 1EKRA 3CJ0A 4ZN3A 2FVQA 4F25A 2VG7A 1WI8A 2CNLB 4OIXA 1SH0A 4QZVB 3UW1A 3GJRB 5G4DA 2FVSA 2Q1LA 1ZM4A 4ZKAA 1FD8A 1F0XA 1O6XA 4CLFA 2L41A 3FUYA 4B9NA 4DSIA 2HG4A 1G7CB 2YH0A 3U1NA 5A0YA 3N6NA 4WFNQ 1I94J 3S8SA 2ZC3A 3T41A 4URGA 2WVBA 4PWDB 1JLCA 1WKKA 2N3OA 5T7LA 2V8GA 3TWZA 2E5JA 3OHBA 3LUYA 3V2UC 2IC3B 1M1GA 3C6TB 3KJNB 2CJ9A 5DM6Q 4OYOA 1VC5A 1VR6A 2N4CA 1NB7A 2D3O1 2R9LA 3BSAA 4ILRA 2DNGA 1WG5A 2BVZA 4RW4B 1CJVB 4YQWA 4CH1A 2BJ8A 4BBYA 3AB2B 3PW0A 2KM8C 4U6PA 4MK8A 4QPXA 4JI1F 5KFLA 5L9NA 4CWBA 3CMAS 1ZPWX 3LOUA 4LQ9A 4I69A 1NHVA 1IKVA 2AGOA 2B9WA 1L5UA 2IM2A 2OPSA 3N0VA 4DQIA 4DR3F 3CC4S 1LWFB 4OZ1A 1VQSA 1LW2A 5AXNA 3M8QB 1Z2ZA 4YY3F 2MEWA 1ZA1B 5F9NA 2E7XA 1QAJA 4OZLA 2XCAA 2XMJA 3IRXA 4WE1B 2KL8A 4QIGA 4L73A 2D1CA 4LFBJ 5KFEA 2UVRA 1X4CA 1FRHA 3CTRA 2VDHA 4ZP6A 3OFFA 1U6FA 1X0PA 3VTIA 2CKWA 3I0SA 3PX0A 1WC1A 4DX8H 3FJ2A 4FPIA 4GKJJ 2ZBCA 2N7CA 3HP6A 2ZJQQ 1PYTA 1REVB 2MQLA 1ITPA 4ZDNA 2I6WA 2NYIA 1VIOA 1LV5A 2LQ8A 4DV6J 4P10A 3J7A1 2CQ0A 4RZRA 2ZKUA 5J1NA 1Q1KA 2W2NP 4LREA 5KOXA 1T9YA 2CQ4A 1BXNA 4JI5J 2WOMB 3D0HE 3L3CA 2H9ZA 2IIHA 2F4VF 1PO6A 3I96A 3NEKA 2O67A 2P5VA 2HFZA 3THVA 3DLBA 1TUGB 3HK2A 2EC0A 4JI7J 4LFAJ 1C0TB 2XMAA 4ZVTB 4TY8A 4LVNP 4DJBA 1X4FA 1NHKL 2BANA 2QA1A 4DFKA 3CCRS 4YR0A 3R27A 1T3OA 2DBBA 1T95A 5AXMA 4A8MP 4G1QB 3NCQA 1U1PA 3PFEA 4J9MA 1N33F 4WXOA 2Q6CA 1XMBA 3DM2B 1FFWB 4ZJQA 1WF0A 3SCKE 3EXYA 2ACMA 4KE5A 2CJAA 2OHDA 2W25A 2JOQA 2BRLA 3BM7A 4DG1A 4WYLA 1RAGB 1O51A 5HSPA 4NLDA 4DR4J 4ELUA 2RJZA 1IKXA 5K8OA 4DR6J 5GMEA 1VLYA 3LGNA 4ZLLA 3G6ES 1XC9A 1LWEA 4BCAA 4JI2J 3Q8UA 3OLBA 3D2WA 1FFSB 4P2SA 4RNMA 2CXEA 4JP8A 2R7VA 1SKWA 1K1QA 2CQBA 2W9CB 4KKOB 1HI8A 4DV2J 1KQGB 1QSLA 4DMZA 5E41A 3QT8A 2MKCA 3BGUA 4M5DA 5L39A 4Q5VA 1L3VA 4WFZA 4OZNA 4IKAA 5IV4A 2MZJA 3FEZA 1IBLJ 3KJFB 2H65B 4PEOA 4ZVEA 3PNIA 1PJ7A 1S1TA 5LMNF 3EDQB 2YKPA 2OPRA 2NCKL 3TVYA 4RLEA 1NHUA 1OY8A 5HQLA 1UETA 2NLWA 3FQKA 2E7VA 4OYBA 5KFOA 3HSZA 2DISA 2BJ3A 4X4PA 4FBUA 3K8VA 4DQSA 4WZMA 1CULA 5KG0A 1U1QA 3IR5B 3AD7C 5HQ8A 4WP8A 4CH0S 2P9CA 1FNXH 4Z2XA 4DSEA 5ETMA 4Q7AA 3LF0A 5B0EA 4ZPVR 2YQ1A 3M32A 3J7Z5 4FVCA 5EUHA 3GQCA 2LQBA 4U7UD 2R8JA 1CSJA 3MXHP 2BOAA 2BR0A 4PRFA 3BDPA 1PAUB 5DETA 2D3UA 1IBKF 1Y00A 3IGVA 1S1UA 3T1HF 1P1TA 5KT3A 1AA1B 1T7PA 4XDDA 4NLQA 2PA8D 3UD4P 1LFWA 2ZH2A 5IFMA 4O44B 4PPDA 1X4BA 4F3MA 1RWXB 2MYFA 3R97A 3LALA 1MU2A 1FESA 4Q8FA 3PYEA 5CXTA 2KT2A 1ZM2A 1GXUA 3Q2SC 1V9OA 2QN6B 4LVOP 1R27B 3WX4A 3MMJA 5H9EK 3JS9A 3OHAA 1H74A 2HHTA 3QWUA 2CAJA 2ZBQA 1K8AT 2J9EA 4RU9A 5B0CA 3CGIA 4IFVA 1HNVB 5J2QB 2XM3A 5THWA 4C11B 2UP1A 3HJFA 4DUYJ 2MZTA 3EDRB 1XR7A 2RU3A 1I1GA 2FLNA 1Q8IA 4YN3B 4TQRA 3OFEA 3GV7B 1IN0A 4DR5F 3M1VA 2J0SD 2BQ3A 1LK5A 3W5ZA 2QC3A 3MOZA 4ED5A 3Q23A 2HMIB 3R1LA 4EEYA 3POTA 3HZEA 4CO0A 1VBZA 4ZVFA 3DLGA 3G4SS 3PM9A 4UF4A 2EI5A 1UFKA 2FZKB 4E0DA 5MAOA 5CD4A 3OVAA 4C8OA 3D66A 2OO4A 4ILLA 1Q95G 5D4NA 4C0OC 2RB7A 2I38A 3QO9B 1H2UX 1XNQJ 3D54A 2J7KA 1N36J 3KOAA 4PG6A 2O01C 1R8BA 3HFVA 3DRSA 2YKQA 2YX4A 3JSBA 3OUYB 5H9FK 3BEGB 3HM9A 4DPXA 2NXEA 5L9XA 2J5AA 1JK9B 1NM2A 3K89A 4EMDA 2VG6B 3ILLA 3BS9A 3K5MA 4F50A 2GNKA 4PABA 4YFUA 3W9HA 3D9BA 4XPEA 1VRUB 2R42A 2KG0A 1S97A 2WSEC 1C1CB 3GSDA 2RNEA 2UUBF 1F6TA 2XLJA 1TKTA 4WBFA 1VLOA 2HGMA 1S9GB 1FWKA 3F0NA 1RK8A 2QV6A 1B3TA 2YBVA 1YDLA 2W7OA 4B3TF 2RRNA 1ZA2B 2NZCA 3MCSA 4YB5A 3Q22A 1H0HB 5I3UB 1NJYA 3SDEB 2YWWA 4WCEQ 2AGQA 1WHVA 3QJLA 2K7KA 1NK8A 4B9SA 1Q81T 4BC7A 2ASLA 3H4DA 4OI6A 3MECA 3QIPB 1VOMA 2E1AA 1WC0A 1RZMA 3A1YG 4ECYA 1W7WA 4LFCF 3IWNC 2Z2LA 2CWKA 1DQAA 1YK9A 4OX8A 3N01A 4GKKF 1D8YA 1KLNA 2OMLA 2XI2A 1MROB 2J6UA 1DJ0A 1F2GA 3MAQA 4OJHA 3KUGA 1RT1B 1V5IB 3GR0A 4H4OB 3GR1A 4PG8A 2DNYA 3A3OB 4I4BA 3VGUA 2CPFA 2HNYB 1S10A 4AQYF 2KI2A 4EZ6A 1U1KA 3E01A 4UY85 3CJ8A 3S6EA 3VGSA 1TL4A 3UVJA 4A4JA 2QT7A 1VIXA 3D4JA 3ITHB 2YXLA 1D3WA 2AJ4A 1UWBB 4DFMA 3LW5C 1S9EA 1NCLA 1DHMA 4ZHRA 5A8RB 3PTWA 2XMMA 5SUHA 3BV8A 5LM7E 2ZH9A 2MJNA 4OI1A 1BLUA 1TP7A 1N32J 3I0RB 4FDFA 3LAKA 4JYAJ 1NAQA 1VDHA 2VBYA 2O3DA 2LECA 4RBUA 1H38A 3BDEA 4PXCA 1U24A 2PGCA 3R1HA 2M0GB 4ZVQB 2VFTA 5BJRA 1LOUA 2HVHA 1B7YB 2GAGC 4NASA 3DKDA 3MM5B 2XHWA 4DF8A 3LP0B 3HVTA 3CB4A 1U6ZA 1S48A 1FRIA 1WEZA 1Q78A 4DR2J 1XEZA 2MQQA 1PIEA 4ED1A 4D3GA 1AW0A 4ED6A 4N76A 1H7XA 2VBZA 3IMQJ 3TI0A 3CMES 4OI2A 1FXDA 4CYUB 1WC6A 3PKMA 2FVCA 5BXIA 2JFDA 2V69A 1HBOA 5LXRA 4KQZA 5E3AA 1JLGB 1KFDA 2R7XA 1OMSA 2GVDA 1VI7A 3IM8A 4KHMA 4V1Ak 3QWPA 1GH8A 1A9NB 4DR3J 2DCLA 1VBXA 2UUWA 4IRCA 3FSIA 3A13A 3IS9A 5HMYA 4F0HA 2CPIA 3TA1A 2DNOA 2WHOA 1HHSA 1FI4A 1S4FA 2DTJA 4Z7YA 2PT0A 4LJMA 2PDAA 5EHHA 2QG9B 4X4RA 4MFBB 5KT2A 1RA6A 3CCLS 4HI1A 4P2XA 5KT4A 4MIAA 2B8PA 2Y1RI 3P6YC 2ZBPA 1N52B 3K58A 2ZFHA 1RWPB 4IOAQ 8RUCA 1CJUB 3HVWA 2KRRA 4I56A 3VAKA 3J7YI 3CEDA 4LF4J 3V6HA 1L3TA 1TL3B 5EWGA 1U2CA 1UEKA 3M6XA 1F3VA 3PX4A 3KK2B 5H9EJ 2GO9A 1P27B 1FKOA 1VK3A 1N6QA 3CJTA 2MZ1A 4Y6IA 4L6V3 4DV1J 3FMWA 3KWMA 4NCGA 1RKJA 5D0RA 2ALZA 2RU9A 3BPDA 3DCAA 4F4XA 2EBGA 3KDOA 1WEYA 1TVRB 2F4VJ 5D3GB 4ANDA 3OR2A 1FJEB 2NYHA 3ELHA 2YKMA 2UV8A 3M2UA 3RW6A 2QL7B 3PCOB 2MZQA 4OYMA 3JSRA 2HLUA 2HBQB 4R8UB 2NXNA 4WXWA 1NDKA 1C4AA 2XMUA 4B17A 2H5IB 3QT7A 1PG5B 3MPDA 2BUNA 3OBIA 3DHWC 2DR5A 4WK3A 1N33J 3EYZA 5GAGU 1Q82T 3D6MB 1FVSA 5SZTA 4B9VA 4CO4A 2I0XA 1CC8A 2L9NA 4TU9A 3M6UA 4DPYA 1RTHB 1HW9A 3KYLA 5DDPC 4RBVA 2RAQA 4C8ZA 4B3RJ 5B0GA 1J5OB 5CCMA 1MSWD 4PG7A 4ZVPB 4IFYB 2HSEB 3W1YC 4B9TA 4UQGA 4MIWA 1E6YB 5DG8A 2W2QP 1Y0HA 4OHZA 3H5SA 3B6BA 3GSIA 4OHWA 1YI2S 4IDKB 1Y5IB 3RR7A 4B3SF 4Q2LA 2HIQA 2ZZMA 3MMAB 3MM7A 3UD3P 2RE1A 3I87A 2QZ8A 2B7BB 1S9FA 1S6QA 2LEAA 1FJCA 2ADBA 1VQ8S 3Q8YA 3DDKA 3C16A 2OAUA 3D67A 2LFVA 2ZH1A 4KPCA 3MAHA 5D0EA 3FRYA 2HS4A 3BR8A 4BWJA 2VA3A 4ELTA 4X4SA 2BX6A 4M63A 3W63A 5D4PA 5KAKA 1Z4UA 2R7SA 2ROGA 1M5OC 2ZZTA 1VQ4S 2NZ4A 4UTGA 2V68A 1TMMA 3TZXA 4WYWA 3K8WA 4JV0A 4O3OA 3L7OA 1SKUB 4C8MA 4DDFA 1WOPA 1RCOB 2DEJA 4NE9C 2I5JA 3HSJA 3MWBA 3CE8A 1DTQB 4G65A 4I2PA 2HPUA 2CQHA 2W4DA 3MTKA 4J9VA 2WVCA 4O4GA 3GIJA 1YSJA 1WEXA 2M70A 1SL0A 3JSMA 4CIOA 4L3NA 2KB2A 2YNFA 1B99A 2IJFA 2JC0A 3KUHA 1RE1B 2PE8A 1GMWA 3R5DA 4F04B 2V9KA 4B3OB 3H5XA 2A1BA 3NGTA 2QO3A 2Z30B 3KG4A 5D78A 2KJWA 2VBXA 1RWUA 4GVBA 3DRYA 3PJ9A 3ILIA 4HACA 5IOLA 2DGOA 4NLXA 5HQMA 4ZOSA 2AEMA 1MWQA 1NSQA 2MMYA 4ZN1A 2AIRB 3MMBA 1QUVA 3AA9A 4NLGA 2FDNA 3I82A 2M8HA 3VALA 4HKQA 1I6JA 1VQPS 4KPYA 1NRKA 5IC4B 4B9MA 1GMWD 4NX9A 4KFBA 3IG1A 5FJ4A 1UAWA 3RW7A 5KFMA 2VG5A 1WUUA 3VWSA 4ZPDA 4RW7B 1YJNS 2KZZA 1T03B 1RTIB 1LEOA 1BY9A 3UCUP 1S6OA 1JNRB 1SXLA 2R8IA 1P1LA 2AZ1A 4RL1A 3N5FA 2DEIA 2AT1B 3ET6B 3GLJA 2G2ZA 5LSRA 1U26A 4Z7CA 4X4OA 2E9RX 1CJTB 4TLRA 4ZITA 4KV8B 4TU7A 4CLUA 1XNRJ 4LIWA 4NOHA 2KFZA 5BR8J 1PYOB 5B09A 1ZBTA 3EJMA 2PI5A 2QL9B 1N34J 2XMWA 3W64A 2BMBA 1FRKA 5ETSA 1TL1A 5ETPA 2QA4G 4Y34A 4JV5F 4TY9A 3GB0A 2ZZNA 4K5RA 3W65A 3CPWR 2HKEA
chains in the Genus database with same CATH topology
2HBRB 3P4UB 2QL7B 1F9EB 1PAUB 2XYGB 3P45B 3D6HB 4DCOB 2C2MB 2HBQB 3IBCB 2QLBB 4ZVQB 4DCPB 4ZVTB 2XYPB 3R6LB 1RWVB 2C2ZB 3GJQB 1RWWB 3GJSB 2H5IB 2CNNB 2H48B 1QDUB 2FQQB 1RHMB 2H51B 1RWMB 3D6FB 2H5JB 2C1EB 3KJFB 1RHJB 1ICEB 1RE1B 2H65B 5K20B 3R6GB 2CNOB 1RWPB 1RWOB 3KJNB 2H4WB 1RWXB 2H54B 1NMEB 3NS7B 4ZVRB 3EDQB 2C2OB 3D6MB 2QLJB 1RHKB 1QTNB 2QLFB 1IBCB 1SC1B 2Y1LB 5IC6B 1I51B 3IBFB 1I3OB 3R7BB 1GFWB 1RWNB 2CJYB 2XZDB 4ZVSB 2DKOB 2XYHB 2HBYB 2CDRB 2XZTB 4LSZB 1SC3B 1RHQB 3R7SB 4JB8B 2CNLB 4DCJB 2H4YB 4ZVPB 1PYOB 2HBZB 3R5JB 3GJRB 4ZVOB 4ZVUB 2QL9B 1RHRB 2CJXB 2CNKB 3QNWB 1RWKB 3EDRB 2Y0BB 2P2CB 3KJQB 1SC4B 1RHUB 3SIPB 3RJMB 2QL5B 3GJTB 3R7NB 5IC4B 1BMQB 2C2KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBR B;  3P4U B;  2QL7 B;  1F9E B;  1PAU B;  2XYG B;  3P45 B;  3D6H B;  4DCO B;  2C2M B;  2HBQ B;  3IBC B;  2QLB B;  4ZVQ B;  4DCP B;  4ZVT B;  2XYP B;  3R6L B;  1RWV B;  2C2Z B;  3GJQ B;  1RWW B;  3GJS B;  2H5I B;  2CNN B;  2H48 B;  1QDU B;  2FQQ B;  1RHM B;  2H51 B;  1RWM B;  3D6F B;  2H5J B;  2C1E B;  3KJF B;  1RHJ B;  1ICE B;  1RE1 B;  2H65 B;  5K20 B;  3R6G B;  2CNO B;  1RWP B;  1RWO B;  3KJN B;  2H4W B;  1RWX B;  2H54 B;  1NME B;  3NS7 B;  4ZVR B;  3EDQ B;  2C2O B;  3D6M B;  2QLJ B;  1RHK B;  1QTN B;  2QLF B;  1IBC B;  1SC1 B;  2Y1L B;  5IC6 B;  1I51 B;  3IBF B;  1I3O B;  3R7B B;  1GFW B;  1RWN B;  2CJY B;  2XZD B;  4ZVS B;  2DKO B;  2XYH B;  2HBY B;  2CDR B;  2XZT B;  4LSZ B;  1SC3 B;  1RHQ B;  3R7S B;  4JB8 B;  2CNL B;  4DCJ B;  2H4Y B;  4ZVP B;  1PYO B;  2HBZ B;  3R5J B;  3GJR B;  4ZVO B;  4ZVU B;  2QL9 B;  1RHR B;  2CJX B;  2CNK B;  3QNW B;  1RWK B;  3EDR B;  2Y0B B;  2P2C B;  3KJQ B;  1SC4 B;  1RHU B;  3SIP B;  3RJM B;  2QL5 B;  3GJT B;  3R7N B;  5IC4 B;  1BMQ B;  2C2K B; 
#chains in the Genus database with same CATH topology
 2DH9 A;  2H3E B;  4U7U K;  1U4B A;  2EK1 A;  2VHG A;  2KXF A;  2OPP B;  4KBI A;  5A8W B;  3C2P A;  4UST A;  2WSC C;  5AE3 A;  3EVM A;  3QAE A;  3C3L A;  1BQM A;  2B9Y A;  4OHX A;  2G9O A;  1TKZ B;  2B4P A;  3DRP B;  2RT3 A;  4LF1 A;  5A2Q Y;  2XMT A;  5J1E A;  3B8H A;  4RW6 A;  2B9E A;  1ACM B;  2C42 A;  3EXC X;  2AGP A;  1S4E A;  3NS7 B;  3AXM A;  3IP0 A;  3BN7 A;  2ZH4 A;  1SQG A;  4OYX A;  2CZV C;  1KTV A;  3IR7 B;  1TV6 B;  4A48 A;  1FWP A;  3TQE A;  3MM9 B;  4FKX A;  3CT9 A;  3NL0 A;  2LU2 A;  1SC3 B;  1JLQ B;  1KON A;  1KLM A;  2IDL A;  4G3I A;  3QSY B;  1IM6 A;  1VK8 A;  1R43 A;  1WC4 A;  3MEE A;  3MPY A;  4F7V A;  4ZVO B;  3CJ5 A;  4LFC J;  3FBF A;  4ZPW R;  1SUQ B;  2L3M A;  4WWS A;  3EZU A;  2HAI A;  1RJJ A;  4WFB Q;  3LWL A;  4L72 B;  1SCJ B;  2LQ9 A;  4EK2 A;  3R2D J;  3UNG C;  3HHL C;  3P3D A;  2KTQ A;  2G2Y A;  7AT1 B;  5KG5 A;  1LWC A;  5K5M A;  3SSR A;  4U8Y A;  4RBT A;  3QLH B;  2ZHB A;  3KNG A;  1OIA A;  1W26 A;  1DTT A;  3VAI A;  1QY7 A;  3AJ1 A;  3TRG A;  1DY3 A;  1RTD A;  2IFX A;  2WK4 A;  1MMD A;  4M8L A;  3HX9 A;  2QMU B;  1S7H A;  1QM9 A;  2FTR A;  4ECR A;  1D9F A;  4AE5 A;  1PJ5 A;  5KFF A;  5DO2 A;  3VVU A;  2KVI A;  4C97 A;  3K5L A;  3TAM A;  2XWY A;  2R7W A;  4LR9 A;  1PBU A;  1TK0 A;  2R7Q A;  3PRD A;  4LF2 A;  2XSJ A;  2WCX A;  2COL A;  4ED4 A;  4J7C A;  3NBP B;  4C0B A;  4DPW A;  3F41 A;  3K17 A;  1C0U B;  3VAG A;  2YKN B;  3Q89 A;  5F0W A;  4NL5 A;  3HHE A;  3FC9 A;  1VQ5 S;  2GAH C;  1C2P A;  2ZH6 A;  2G0C A;  2HND A;  1KWM A;  3UR0 A;  2VKR A;  2RD5 C;  1GXT A;  2CQD A;  2FHJ A;  1EX8 A;  2CJK A;  3EMT A;  4Q45 A;  2HGN A;  2VBW A;  2YVS A;  1ZAV A;  3J80 U;  2UV8 G;  3TAP A;  3EVO A;  1U8W A;  1JLF A;  1MMN A;  5J2M B;  3BQ1 A;  4H4K C;  4ZMM A;  5B08 A;  2W9B B;  4ECZ A;  1RAC B;  2CJB A;  1HW8 A;  4NLV A;  1CC7 A;  2M2B A;  3NCR A;  3N9U C;  7FDR A;  1RT5 B;  3AFG A;  2ZE2 B;  3ILJ A;  2E9Z A;  4WII A;  2B6A B;  1K73 T;  1JJ4 A;  3HF5 A;  4JI4 F;  4ATN A;  3MGJ A;  2ROE A;  2Y1L B;  4GC6 A;  3OD2 A;  3MI7 X;  1RT2 B;  2DK2 A;  3GP9 A;  3Q86 A;  3M6V A;  1FTR A;  2FHJ D;  3PG9 A;  3FCW A;  1SC6 A;  3KLH B;  5EX3 A;  5E33 A;  1ZTT A;  2OP5 A;  3OSP A;  5DDO C;  4PUO A;  3NMA A;  2I1R A;  2AYM A;  5JVG Q;  4X66 J;  5C2C A;  4F4Y A;  3L7P A;  2BOP A;  3MUM P;  5HLF B;  2ZH3 A;  3OTO F;  3LP1 A;  4ECS A;  2JLG A;  1LWX A;  4Q43 A;  2MB0 B;  3G87 A;  4F4Z A;  3ZTQ A;  5CYM A;  5KFJ A;  3CUL A;  3OLA A;  3ZNJ 1;  2XNQ A;  2R2S A;  2X7I A;  4RW9 A;  3LP2 A;  4P2M A;  2F5G A;  2ABY A;  4KGZ B;  2ZVS A;  1VRT B;  3FGV A;  5IM0 B;  2BW7 A;  1T94 A;  3LTO A;  4RW8 A;  2MZR A;  3WC0 A;  3G2X A;  4NI2 B;  3DLE B;  2ZJR Q;  2HRY A;  3M8S A;  2VKZ G;  4E8U A;  1JKH B;  1K0T A;  1HBN B;  1PYS B;  2ALY B;  4H4M B;  1F2H A;  2GQ2 A;  1H6K X;  2LLZ A;  3MHY A;  3QJP A;  2CZ9 A;  2CQ1 A;  4RNH A;  3L7U A;  1YRX A;  3RAQ A;  3TX8 A;  1RBA A;  3JAM U;  5LT5 A;  5DJB A;  4LF8 J;  3C15 A;  2YNG B;  3MM8 A;  2GC8 A;  1SC4 B;  4FF2 A;  1S1X A;  3CDW A;  4LF6 F;  1UTA A;  4KO0 B;  1YRT A;  2AYG A;  2HHV A;  2AQ4 A;  4GC7 A;  2J0W A;  2IM3 A;  1IR1 A;  3K59 A;  4HT5 A;  3DU5 A;  3PO5 A;  3ZTO A;  3GV8 B;  4DL3 A;  2ATC B;  4A46 A;  4NCB A;  3H42 A;  3CJ2 A;  3RZA A;  4YHH J;  4QOT A;  5KFK A;  2P9E A;  3EZ5 A;  4XPC A;  1CJV A;  2GJF A;  2HFO A;  3QRR A;  3QAT A;  3X3U A;  3DRR A;  2HHH J;  4J90 A;  3GG1 A;  1TZ0 A;  3ONQ A;  3WBZ A;  1GX5 A;  2W2M P;  3CDE A;  3PEH A;  3HT0 A;  2XCP A;  1Y3K A;  4A8F A;  4UZB A;  5L1L A;  4KTQ A;  4BLG A;  2P6S A;  4FKY A;  3KG0 A;  1NSA A;  2HAF A;  3AAW B;  3HKW A;  3J80 Y;  3C6U A;  2F9D A;  4DR7 F;  4PWW A;  1U02 A;  1NPK A;  2QFJ A;  3SI8 A;  4I68 A;  2IYI A;  2EBE A;  3TVZ A;  2VG7 B;  3W9J A;  1H3D A;  3EE3 A;  5B0B A;  3PYD A;  2ZUG A;  1VQ7 S;  4K7Q A;  1ARO P;  3WHI A;  3RRK A;  3CJQ A;  4FVM A;  3NKY A;  2FPH X;  4DBQ A;  2QE5 A;  5LMU F;  2VJV A;  2HWT A;  3VQS A;  4DV4 F;  1Q5Y A;  1YLX A;  2HS0 A;  3MOJ B;  5A0Y B;  2V2K A;  4RNF A;  3WQP A;  2XMK A;  1QE1 A;  2UUC F;  3N28 A;  5F3Z A;  2UXC J;  3ISN C;  3CIM A;  2CIM A;  1JLC B;  3SCJ E;  3HUL A;  3UFC X;  1REV A;  5D8H B;  2POK A;  4WP3 A;  5T7L B;  4EBC A;  3DDI A;  3FRZ A;  1NND A;  2EPI A;  4DV3 F;  2QMX A;  3C14 A;  3MR3 A;  1X9M A;  4X2B A;  2CPY A;  2C3U A;  4ZPT R;  5KT6 A;  4C9D A;  3QT5 A;  3TVK A;  3ZNU A;  1F9F A;  5HJY A;  5C24 A;  2HZA A;  5D0H A;  3J7A N;  1J2V A;  2DHS A;  2C2K B;  2HS3 A;  1Z1Z A;  2HFV A;  3MMC A;  4PXB A;  4ENO A;  4P73 A;  2QLB B;  1WNE A;  3GIM A;  1IKV B;  4FXW A;  3EPI A;  4CLY A;  2EKN A;  4KRW A;  2OPS B;  2EG1 A;  3R2C J;  2IDE A;  4OX9 J;  2PMZ D;  2H5J B;  2NUH A;  2IVF B;  4NEY A;  3THT A;  3W9I A;  3GCX P;  4DZD A;  3SZ2 A;  3IN5 A;  2Q43 A;  1LW2 B;  3FBB A;  2CPE A;  2WVD A;  2XHC A;  3KLI A;  3JAM Y;  2IA0 A;  1VQO S;  4F4K A;  1YWX A;  4DPU A;  1P6T A;  3TO8 A;  4O4R A;  1I3O B;  3IRX B;  4C2M A;  2ASY A;  4RPF A;  1RGV A;  2YQ3 A;  4JI6 J;  5I42 A;  4JB8 B;  3LPE A;  2RDD A;  1KP6 A;  3JB9 k;  5DDQ C;  3N79 A;  4Y0F A;  2HHS A;  3OL6 A;  1R0A A;  3H7H B;  3FZ2 A;  2I2Y A;  5J2N A;  1N5V A;  2LU1 A;  2VF3 A;  3NS6 A;  1GEH A;  1SVD A;  2E7W A;  1R8C A;  1TL7 A;  3I0S B;  6FD1 A;  2ZEJ A;  3MEG A;  2HQ3 A;  3ADA C;  1EAR A;  5IZH A;  1U25 A;  1JWW A;  1X8D A;  5HN0 A;  4DCO B;  4DV5 F;  3Q8S B;  1MML A;  4L75 A;  4OJG A;  1FK9 A;  1WOO A;  1HWU A;  2BJ7 A;  3IAM 9;  1DQ8 A;  4I2Q A;  3P5B P;  1RXO B;  5IWA F;  4CP5 A;  3IFE A;  4NLU A;  4PWU A;  4NYO A;  4LMZ A;  3HJV A;  3RRH A;  2YNH A;  4MT1 A;  3ETM A;  1GNK A;  3KKF A;  4TY8 B;  1RP5 A;  3E3X A;  4DV0 F;  3VCD A;  4S0M A;  2W8L A;  2YWE A;  3MD1 A;  3OJS A;  1R0C B;  3I9V 9;  1RCX B;  2BAN B;  4LSZ B;  1X0F A;  3RBD A;  4YS2 A;  1AXQ A;  4OV6 A;  1NZA A;  1AFJ A;  4CTA A;  4DCJ B;  1WKJ A;  2GQQ A;  2VU5 A;  1IM4 A;  3M30 A;  4ES3 A;  1S59 A;  1CG2 A;  4QQB A;  2HK2 A;  4ES1 A;  2MGZ B;  4PG5 A;  1JX4 A;  4J9Q A;  2GGP A;  4KGM A;  1A0O B;  2VA2 A;  1R6V A;  4JI8 J;  4NXN F;  3IBC B;  4F3Q A;  4DL2 A;  5CCL A;  1RBL A;  4DG1 B;  3TP2 A;  5HRO A;  3NGK A;  3HHD A;  1SIZ A;  1IKX B;  3NNA A;  4AL5 A;  2U2F A;  2X1G A;  1LWE B;  4LF7 J;  2EFV A;  1N0U A;  4QBU A;  3J7Y U;  5B7W A;  5L1I A;  2FD2 A;  4FS1 A;  4M5I A;  3FZB A;  5LJ3 Y;  4QWD A;  1T9U A;  2G1H A;  4CO5 A;  2M7S A;  2DGU A;  1B0T A;  4M5D B;  2B56 A;  2WB4 A;  4NXM F;  3GCW P;  1VC0 A;  4DN9 A;  3ZZZ A;  2OIH A;  2BXJ A;  1H7W A;  4OHY A;  5KFY A;  3RYL A;  2A2D A;  4RO0 A;  3Q8V A;  3M2R A;  3LA0 A;  4D3H A;  1S1T B;  2J9C A;  4ZPA A;  2HEK A;  1TUW A;  2OPR B;  1EP4 A;  2DGT A;  4AUK A;  1M1H A;  3UI3 A;  3FFI A;  2ZNZ A;  5HO4 A;  2MXY A;  3G82 A;  2L9D A;  2ILY A;  1CUL B;  1HWJ A;  3CO0 P;  3PW2 A;  4IG3 A;  1DFD A;  3PO4 A;  1WJ9 A;  3OSN A;  2GMH A;  3MZI A;  3M32 B;  1S12 A;  4DV7 F;  4X64 J;  2O66 A;  2CAD A;  4I6A A;  4J9R A;  3NP5 A;  1B0P A;  1RA7 A;  4K4Y A;  3Q8P B;  3N6L A;  2GA7 A;  3UO0 A;  1WOS A;  2MQ8 A;  4WFA Q;  3RUB L;  1HR0 J;  1S1U B;  3H5U A;  3WX8 A;  3S7R A;  2B3T B;  3B78 A;  4F67 A;  4KAI A;  3EM1 A;  4DFJ A;  4KH1 B;  2A0F B;  2GHW A;  2J76 E;  1GFW B;  2RQK A;  3CCQ S;  2ZOG A;  4I67 A;  1MLA A;  1JXL A;  5HBM B;  1UZD A;  3AOB A;  4ED7 A;  4K59 A;  4LF5 J;  3O5T B;  4ELV A;  4DLG A;  3I5A A;  1YHQ S;  4R5P A;  2BEF A;  5J1P A;  4K4V A;  2MDA A;  2V4Q A;  1MU2 B;  2DR8 A;  2F8M A;  1T05 A;  2VAS A;  5B0D A;  1PCA A;  1Q79 A;  4M5H A;  1XMO J;  5AT1 B;  4IFV B;  4QR0 A;  3UN5 A;  4N47 A;  3CCJ S;  3FNN A;  1K44 A;  1VQ6 S;  2RS8 A;  3QQC D;  4DX5 A;  2BAC A;  5GMD A;  4Q2M A;  3THP A;  3AB4 B;  4I64 A;  1JQG A;  3AOD A;  4HI2 A;  3PV8 A;  2AX1 A;  4L76 A;  1HNI A;  4UZC A;  4CM2 A;  5T14 A;  2JEJ A;  5IT4 A;  3W3S A;  4QIF A;  4ED3 A;  2ILZ A;  3M1V B;  5BYQ A;  3VAM A;  5J2P A;  1JIH A;  4L74 A;  5F8I A;  1JLA B;  1NDP A;  4BC9 A;  5E3P A;  2XS7 A;  3CUN A;  1TUV A;  2DKO B;  2RQM A;  3OL8 A;  3MR6 A;  3LAN A;  3KLG A;  1YJU A;  1PKU A;  3POT B;  3DLG B;  5JUM A;  3KLE A;  1OS5 A;  3H0P A;  2R8G A;  3NWG A;  2ADC A;  5EGY A;  2MKI A;  3Q24 A;  2DPJ A;  3OW2 R;  4F2S A;  2VFR A;  2V0N A;  4DSF A;  1HQ2 A;  2CFX A;  2M3D A;  1LW0 A;  3G8S A;  3BH7 B;  4OX7 A;  3SEO A;  4HHH A;  4RR5 A;  3Q2T C;  1FO1 A;  1FEE A;  2PFF B;  4ECV A;  3FBE A;  1YZ6 A;  2C2D A;  1RYS A;  2FHM A;  5KTQ A;  1B70 B;  1RWW B;  2XQC A;  3AOC A;  3DRS B;  1GK8 A;  2AX0 A;  3HFK A;  2JVR A;  3GIK A;  1WHY A;  3I55 S;  4DU7 A;  3A4T A;  1ZYQ A;  3V6D A;  2EFG A;  3HDS A;  3TJA A;  4X65 J;  4MK7 A;  2PMH A;  4M95 A;  1VS3 A;  1A7G E;  2ZM6 F;  3UDC A;  1YTY A;  1NJI T;  1YIT S;  4FYY B;  2EEY A;  4YR3 A;  2GO8 A;  1KQF B;  1TKT B;  5LXY A;  2HLT A;  4FYX B;  1NEE A;  3D1O A;  2BE7 D;  4CLS A;  5C5J A;  5A76 A;  3JQJ A;  2KN4 A;  4CLP A;  3CCE S;  3BYP A;  2OD4 A;  3G6X A;  4I0W A;  4NML A;  2LEP A;  5T41 A;  2DHA A;  4DUZ J;  2Z0G A;  4CT9 A;  1J5E J;  2KVQ E;  4UOG A;  2GHP A;  4ERD A;  1GTE A;  3MEC B;  2RUS A;  4J9N A;  7FD1 A;  3PFO A;  1T0T V;  4TLQ A;  3RRG A;  2H48 B;  3HT3 A;  1TFW A;  1K47 A;  3MED A;  3TZY A;  1CVJ A;  3DI6 A;  3T5L A;  2OJ3 A;  3PW4 A;  5K20 B;  3ISZ A;  1C4C A;  1VBY A;  1S76 D;  5I3Q A;  3U1M A;  3H2L A;  3NGR A;  1IBC B;  1G3O A;  1RT3 A;  3MEK A;  1K9M T;  3B4M A;  2V4J A;  4OFZ A;  1UL3 A;  4KHP F;  2NPF A;  2BQR A;  2XYH B;  1HNW F;  2Q66 A;  5D0G A;  2F65 A;  4C3M A;  3FBC A;  1UVN A;  3UWT A;  3E01 B;  1N5Y B;  5KG7 A;  1U09 A;  1JLB A;  4H54 A;  2GIF A;  1RTJ A;  4DR7 J;  2NRE A;  2OTJ S;  1SV5 A;  4KGK A;  3UVJ B;  3HVR A;  4DL5 A;  3QAU A;  2HNZ A;  4HEA 9;  2YKA A;  2GML A;  1UEU A;  3PJW A;  1D8Z A;  2HFS A;  3ENQ A;  2VPZ B;  1URR A;  3P4U B;  4ZHR B;  1HNZ F;  3EGW B;  1RAH B;  1FNM A;  3AD8 C;  4C98 A;  3HSD A;  4X4Q A;  1Q0N A;  2E1M C;  3OQ2 A;  2AJQ A;  2N82 B;  4LSN A;  5HMZ A;  3I56 S;  3CJS A;  1HBM A;  4YME A;  3O1L A;  5CYQ A;  3KLF A;  3B82 A;  2E1R A;  2JX2 A;  4QIE A;  4TXS A;  4TNO A;  2MLX A;  2AU0 A;  1RT4 B;  4ZVR B;  4P2F A;  4TVA B;  1FER A;  4N8O A;  4X84 A;  5F8H A;  2JDJ A;  3HVT B;  3HZG A;  3V4I A;  3KJV A;  1DLO A;  4N5S A;  2UVV A;  4JI0 J;  5AJ3 F;  2BV3 A;  5DDR C;  3SYZ A;  3IC1 A;  2HQG A;  2Z4P A;  1CS4 A;  1RT6 A;  1Q8B A;  3KJQ B;  2Y0S D;  2C2N A;  2KXN B;  5CQG A;  3KTQ A;  3RTV A;  1RB0 A;  3US5 A;  1HBO B;  4NLT A;  4U67 Q;  1TFY A;  4DUT A;  1F5C A;  3GTY X;  4JOU A;  4ECU A;  2ZH5 A;  2EFP A;  2AP6 A;  2GVD B;  1UVI A;  4IG0 A;  3I4H X;  3QGH A;  2KYZ A;  5E3R A;  3F44 A;  3HLU A;  3OL9 A;  3GV5 B;  4DSJ A;  1Y4Z B;  3VAH A;  3IS9 B;  3T9Z A;  1S77 D;  5DG7 A;  3H4B A;  3IR6 B;  3RB0 A;  3PW5 A;  1EET A;  1X5S A;  2KT5 A;  4MKY A;  2UXD J;  4CDI A;  2QLX A;  3BB5 A;  4K2X A;  1FX2 A;  2UVW A;  2JEI A;  1QVG R;  4LUB A;  5A6P A;  2EWH A;  3BGR A;  4OI3 A;  3SXL A;  2LYV A;  4FYW B;  1P8G A;  2RVJ A;  1RI7 A;  2DGQ A;  4DS5 A;  1V5V A;  1X9W A;  1VMB A;  2E5H A;  2JH3 A;  2M4M A;  1E6V B;  4NA3 A;  4F36 A;  3M8Z A;  4EBD A;  4NZ6 A;  5L46 A;  2AYE A;  2YWF A;  4IQM A;  3T1Y F;  4Q8E A;  4F3O A;  1HBU A;  1UJ4 A;  1FKO B;  2E1P A;  2OD6 A;  1N6Q B;  1Q53 A;  4M5L A;  2H5E A;  2ZDO A;  3IRW P;  5F0U A;  2OUG A;  2IVM A;  3EPG A;  4NCG B;  2J8S A;  2JSX A;  2H51 B;  3W8G A;  4ETX A;  3B54 A;  2WON A;  2LCW A;  4AT1 B;  1PSD A;  3OR2 B;  1XR5 A;  2YKM B;  1I94 F;  3M2U B;  1NPP A;  1RTZ A;  1VJQ A;  2MPU A;  4Q44 A;  2DNM A;  1WF2 A;  1HIY A;  2GS8 A;  3M9N B;  3M2V A;  3QT6 A;  2C22 A;  4DV0 J;  4PZV A;  3VF0 B;  3J81 U;  1TMJ A;  4Y2A A;  1I5O B;  4MTP A;  5D6G A;  5KT5 A;  3R5J B;  3MR2 A;  4NWB A;  1DTQ A;  3SBM A;  1UA1 A;  1O8B A;  4I6W A;  1FRJ A;  2ZHO A;  4WF9 Q;  1HD1 A;  3K7R A;  1KS2 A;  3W5X A;  1V3Z A;  1C1B A;  1FRM A;  4NZ7 A;  2D9P A;  4JUZ A;  1BE4 A;  4XAK A;  5M2P A;  4XDC A;  2V67 A;  5GAD I;  2HWH A;  1P9Q C;  5KG4 A;  2RIJ A;  1ZM3 A;  3AOA A;  1X9S A;  1FCA A;  1R7I A;  2E5L J;  3RR8 A;  1WD6 A;  4ED8 A;  3WIU A;  2BE2 A;  1DZ5 A;  1NJX A;  1YGY A;  3U27 A;  5A8K A;  4PG4 A;  3FSX A;  2EFQ A;  2OPQ A;  4OZ5 A;  4BDP A;  4RWW A;  3ZZY A;  1WDD A;  3MM7 B;  3OXG A;  3L09 A;  3S1T A;  2DNR A;  5L1K A;  1FNO A;  1WKL A;  2NXU A;  3CD6 S;  1S6Q B;  4NLY A;  3AY0 A;  2PA3 A;  1NKC A;  3QMQ A;  1XR6 A;  3C16 B;  4OMF G;  3BKF A;  4CT8 A;  1FDA A;  3R5A A;  4ID8 A;  4DL4 A;  2WBM A;  3T9N A;  6AT1 B;  1WOR A;  1RDR A;  3MAA A;  2QFI A;  1UFW A;  2FY1 A;  1NH8 A;  4IH5 A;  3QRP A;  1B7F A;  4M5G A;  4DWI A;  4F0M A;  4J9O A;  1KFS A;  1TQL A;  4GKJ F;  4HH0 A;  2C3Y A;  2ZNY A;  1S1V A;  1BQX A;  4R0E A;  2Z58 B;  1SJF A;  1DAX A;  4TU8 A;  3PAC A;  2OEM A;  4DV6 F;  2Y9H A;  3SFU A;  4CO2 A;  1JLE A;  4NYP A;  1H2V Z;  1LXJ A;  3R6L B;  4M5J A;  3GII A;  1AUD A;  1W2B R;  4DN0 A;  1KHW A;  3FMB A;  1L3S A;  2I5J B;  1IR2 A;  1RTI A;  5HJX A;  4DV7 J;  4WJB A;  4JI5 F;  3VR1 A;  3D6F B;  2RML A;  4I2P B;  2IAJ A;  2D74 B;  1R8A A;  3D7S B;  4LFA F;  1Q16 B;  4EO8 A;  2KYX A;  4LRC A;  5GVQ A;  3ET6 A;  4DPT A;  3ICL A;  2QLJ B;  1OPI A;  4O4G B;  4F02 A;  1YKW A;  2DIU A;  1RIS A;  1FJG J;  3NAH A;  2LXF A;  1ULR A;  2EC2 A;  3DGV A;  2P9G A;  3JSM B;  2FLL A;  2HYI B;  1N8R T;  4HVZ A;  2YNF B;  1S0M A;  3JYT A;  2AYB A;  2YNI A;  3VGT A;  1Q7Y T;  1Q4R A;  2IBK A;  2BJ1 A;  2YWG A;  1VYA A;  3NOC A;  5DS7 A;  1JXE A;  3CCZ A;  4M5M A;  1RYR A;  2JLE A;  4GVB B;  4MMO A;  4P75 A;  3WZ0 A;  4HAC B;  1BC6 A;  5DQI A;  2AV5 A;  2VUG A;  1VFJ A;  3VAF A;  2E44 A;  1EB0 A;  2NR0 A;  3MMB B;  4OYA A;  4U7C A;  4PR6 A;  1U1M A;  2A18 A;  2UU9 J;  1SJ1 A;  3T1A A;  4DR6 F;  4KYZ A;  2BM1 A;  4ICL A;  1HWL A;  2F63 A;  3J81 Y;  3KNA A;  4ZIV A;  3M9O B;  1RSC A;  2FJV A;  2RHS B;  3MCM A;  2YQ0 A;  1OSC A;  2V50 A;  4DV2 F;  4KFB B;  1EZZ B;  2UXB J;  2HWI A;  3IG1 B;  2XBP A;  4JBC A;  4J91 A;  5CD4 H;  1NH7 A;  2Z2Y B;  2X1B A;  1JLQ A;  4C3L A;  3DOL A;  2VG5 B;  2CG4 A;  3DLK A;  2HQF A;  2VDI A;  1M5S A;  1HPZ A;  2XMV A;  1GTH A;  2GVZ A;  3TX0 A;  3W2W A;  1SJR A;  2ZBR A;  3KHG A;  4OJ3 A;  4K4W A;  1ZM9 A;  4MYU A;  2B51 A;  4QW8 A;  4K0K J;  3O8W A;  1LK7 A;  4BWM A;  1F9H A;  3G8Q A;  4CLK A;  4DR1 F;  4AFF A;  3HSG A;  4EI2 A;  3PEJ A;  1MWY A;  3D68 A;  1WHX A;  4ECT A;  2C2M B;  1HD0 A;  4K4X A;  3KXD A;  3MPV A;  4NRT A;  1TL1 B;  4LBP A;  5HAT A;  1X5O A;  4EWT A;  3PW7 A;  1YVF A;  3CO9 A;  2HQD A;  4OZJ A;  4QU6 A;  2Z2M A;  5F3T A;  2MTL A;  1BQM B;  3R5B A;  3M8W A;  4NEZ A;  1CPZ A;  4F2R A;  3CJK A;  4ZVS B;  2YKN A;  5J1E B;  4HR2 A;  3SFG A;  1ZAX A;  4QYR A;  3H40 A;  1EIY B;  2XEX A;  2FJW A;  2BJE A;  4RW6 B;  3TAQ A;  4ZIW A;  2KO1 A;  2XSF A;  2XS5 A;  4YP3 A;  1S7I A;  2J6T A;  2OFH X;  3T5H A;  4DFP A;  2A3J A;  4UW2 A;  4X4N A;  2ZBI A;  3H8Y A;  3GJT B;  1X4A A;  4CLW A;  4MYT A;  1YJV A;  1IKW A;  4QPT A;  2JEF A;  1HMV A;  4QIW D;  3DLH A;  1JJC B;  2WRM A;  1KLM B;  5J2M A;  1UMJ A;  2MHE A;  4USW A;  5G0R B;  4DUY F;  2B4V A;  2LEB A;  1N5Q A;  2DXE A;  1IQT A;  4B9L A;  2GW8 A;  4AL6 A;  4WZQ A;  4A8Q A;  2HHW A;  4Y2K A;  2D41 A;  2A6O A;  3DNC A;  2H4W B;  3UDE A;  2LXI A;  4EZ9 A;  1LWC B;  2R3V A;  1VCT A;  4IYQ A;  4PKD B;  3AD9 C;  2VFU A;  3R8Y A;  1DTT B;  3CNQ P;  1RTD B;  3TOQ A;  4PQU A;  1PIL A;  3AHP A;  1M5V C;  1EQM A;  3IXQ A;  2W24 A;  3CD0 A;  2NUU G;  4AXJ A;  2RQ4 A;  3O6Q A;  4ZVU B;  3TAM B;  1RAD B;  3MR5 A;  2B0G A;  1Y9O A;  3TEH B;  5KFS A;  5ADZ A;  1OY6 A;  2J7W A;  2XSJ B;  3RAX A;  2FY8 A;  1HAR A;  5FII A;  3UN3 A;  2CPX A;  4ID5 A;  1OJ4 A;  5CAA A;  1S79 A;  1N36 F;  3CXC R;  3P8B B;  5LL6 d;  2R4F A;  3S01 A;  1NK0 A;  1AZS A;  2DRA A;  2JVO A;  1FKP A;  2QTW A;  2FJE B;  1Q7L B;  1PGZ A;  4JI1 J;  2HND B;  3TZZ A;  1F60 B;  1QUP A;  1NUE A;  2OH2 A;  4U9R A;  2ERR A;  4OI0 A;  2J7U A;  5KFZ A;  1JLF B;  2VPW B;  3DGP A;  2JC1 A;  4GVL A;  5EWE A;  3TA0 A;  1VQ9 S;  1RQ0 A;  4LIR A;  2K3K A;  4MKV A;  5CA5 A;  5AJ3 J;  4ECX A;  2V4R A;  3OR1 A;  3JSY A;  2OMO A;  3PIP Q;  4YY3 J;  4Y2I A;  1YX2 A;  3L4B C;  2W4C A;  2OTL S;  4KO0 A;  3SIP B;  1HQE A;  4QCL A;  1T9W A;  5CZX A;  3BN4 A;  4ZVG A;  1D1U A;  3LH2 S;  3DN9 A;  3VQT A;  1KVJ A;  1NDC A;  2DH7 A;  2ZD1 A;  4G1P A;  3GIR A;  3U1L A;  1DUR A;  3I9Z A;  4PUO B;  1HKA A;  3DYA A;  3OTB A;  4NCA A;  5AE1 A;  5DQG A;  5GMK a;  2V8V A;  3LP1 B;  2AJ2 A;  1ZAW A;  3NXZ A;  5HAN A;  5HL7 Q;  2QLF B;  5CYM B;  1HI1 A;  4OV1 A;  2B8Q A;  1OPZ A;  4RW9 B;  5E3C A;  2IVY A;  3LP2 B;  2V2V A;  5E0O A;  2JWN A;  5JMN A;  4RNN A;  2OGU A;  4OLP A;  2QIF A;  1WI6 A;  2CRL A;  2I9S A;  4RW8 B;  5KFA A;  1AUS L;  4AYB D;  4XO0 A;  4ZP7 A;  9RUB A;  3KHH A;  1OSD A;  4URS A;  2KT3 A;  4B08 A;  3RJM B;  1N88 A;  4ZJO A;  2A2C A;  8AT1 B;  2HUR A;  1F5A A;  5D77 A;  2X51 A;  3JQK A;  2AZ3 A;  1JJ2 R;  1B64 A;  2HZC A;  2FC9 A;  2DGW A;  1NK6 A;  4KH0 B;  1HQU A;  3DXS X;  2GMJ A;  1N32 F;  2FVR A;  5E2Q A;  4JYA F;  3C15 B;  3MM8 B;  1BQN A;  3HI9 A;  2XGP A;  5DZ6 A;  5C7P A;  2D3O R;  1R89 A;  2N4D A;  2O5D A;  1S1X B;  1MWZ A;  4RU2 A;  1WDT A;  2HVE A;  2KRB A;  2IRY A;  1IKY A;  2YPZ A;  4OZ2 A;  2QYG A;  3NNC A;  5H9F J;  2AEJ A;  3R7B B;  5C25 A;  3PJX A;  5E5N A;  3DMJ A;  4DR2 F;  1EQ0 A;  3D5M A;  2NSB A;  4KR0 B;  2XLI A;  5A6W A;  4RX6 A;  3HHL A;  2AMC B;  3PKY A;  1U0H A;  2JNJ A;  4QWE A;  4K5S A;  5EX0 A;  1TAU A;  4RJV A;  2IA6 A;  1VQN S;  2W8K A;  3IWL A;  3DRR B;  3VV2 B;  1PBA A;  2LKZ A;  2VQF F;  1R8P A;  2EXU A;  3SCL E;  2W2P P;  4OLO A;  3CC2 S;  3A8J A;  1DBD A;  3HD1 A;  1UVK A;  2LQ5 A;  1NBE B;  4CH7 A;  3BQ0 A;  1RAA B;  5LMN J;  2MLZ A;  2AWZ A;  3C6U B;  3DOM B;  2ACY A;  4R0J A;  3PX6 A;  4OYP A;  3G9C A;  2G1D A;  2G2O A;  1HL6 A;  5A2Q U;  3HHL D;  2E9T A;  1S72 S;  5F41 A;  1HI0 P;  4FYD A;  2J0X A;  3DRX A;  5C42 A;  4FF4 A;  1UWA A;  3EVW A;  1RBO B;  2RF2 A;  5DZ7 A;  2V5H G;  3CD5 A;  5K8M A;  1QD1 A;  3VGV A;  2HK3 A;  1T3N A;  1N48 A;  4I7F A;  5GAH I;  2XZW A;  1RU2 A;  2CPJ A;  1IBK J;  5HAO A;  4LF4 F;  4J9K A;  1AT1 B;  3T1H J;  3FCV A;  4L3K A;  1ZS6 A;  2BW2 A;  3JTP A;  2V8H A;  4HTI A;  4P6Q A;  3UDL A;  3F73 A;  2HVI A;  2ROP A;  2G4B A;  1QE1 B;  3H25 A;  4ALZ A;  4H4K A;  4OYZ A;  1KEK A;  4DV1 F;  2HBR B;  4J9L A;  2RH3 A;  4P7T A;  3A8I A;  3C14 B;  3CC7 S;  1LXN A;  2G13 A;  2PI4 A;  1XJW B;  2VH7 A;  1V3S A;  4NLP A;  3GZ7 A;  5C24 B;  1F5B A;  4RUC A;  4ED0 A;  5FDL A;  1CQN A;  4X4U A;  2PEH A;  4C8L A;  2X3G A;  2DNP A;  3EIC A;  1ICE B;  4ZLP A;  2CNO B;  2WVE A;  4LSL A;  2HIY A;  2CPZ A;  3MMC B;  1QVF R;  1U48 A;  3MUR P;  3DOK A;  4ZCI A;  1HYS A;  1FXL A;  5HK4 A;  4M5N A;  2GJ2 A;  2Z2Z A;  3GFX A;  2IM0 A;  4PXE A;  2QA4 S;  1AB8 A;  3NGS A;  1SI9 A;  2IYG A;  1CJK A;  2VFS A;  5LSL A;  4C48 A;  3NY0 A;  2DIV A;  4DR5 J;  1NO8 A;  2OEK A;  2B9X A;  4IRD A;  2CJX B;  3ZFV A;  3M4X A;  3M7V A;  2V63 A;  1SB6 A;  2MGZ A;  2RUG A;  3KLI B;  2VB6 A;  3MM6 A;  4O0N A;  1FDB A;  3K5O A;  3FKB A;  5HI7 A;  2W2O P;  1IQZ A;  4EBE A;  2FC8 A;  1YJR A;  1X5T A;  1RKI A;  4HTJ A;  1X31 C;  4B3R F;  2RDI A;  2XY7 A;  4YOE A;  1N0V C;  2XGQ A;  1GXL A;  3D6H B;  4Q0B A;  5I42 B;  2EVZ A;  3I5B A;  4M5K A;  1R0A B;  3K5N A;  4KGV B;  1D09 B;  3AQO A;  2FQQ B;  5J2N B;  3MPW A;  1S1W A;  5L8R C;  3QGI A;  1TL7 B;  1D0E A;  3MEG B;  1FD2 A;  3VHQ A;  4USM A;  4TKT A;  2DT9 A;  2KU7 A;  2DRD A;  2QSF A;  4Y2M A;  1WTB A;  3TA2 A;  3KK1 A;  2MQN A;  4W90 B;  4QJV A;  5ETO A;  1LQ9 A;  1Y3J A;  1KQK A;  2BJ9 A;  1FK9 B;  3J81 j;  3MF5 A;  2C3P A;  1TKX A;  4I2Q B;  2Y8W A;  2VD3 A;  3RBX A;  3I31 A;  3JQM A;  1RHQ B;  5F8J A;  3TUI C;  3PRV A;  3V81 A;  3MCN A;  2GFF A;  3O3L A;  4C7Q A;  2DXF A;  3DFE A;  3BPS P;  4USH A;  4USK A;  3DHX A;  3GE9 A;  2UUB J;  2YNH B;  4DR1 J;  2XY6 A;  1H2T Z;  2FYX A;  3ENW A;  5B0A A;  2HQC A;  2LP4 A;  1Y7P A;  3JXO A;  5F8N A;  2NPI A;  2HRT A;  3PYF A;  1IXK A;  4WKY A;  2YTC A;  4B3T J;  4CTA B;  1XMQ F;  5ETT A;  1G2E A;  4ETZ A;  4Y3C A;  1U1R A;  3M30 B;  5IXU A;  4XK8 C;  1RWM B;  4QW9 A;  2LDY A;  5BYS A;  3C19 A;  1MN9 A;  2DR7 A;  2WAQ D;  2XI3 A;  2EFN A;  4HLB A;  2GGP B;  2H54 B;  2V34 A;  2ZWP A;  5IS2 A;  5D4O A;  2HGL A;  2KZM A;  1IWA A;  2XO6 A;  4X4V A;  3KK3 A;  3ZTR A;  4DEZ A;  4IOC Q;  2MQM A;  1UJ6 A;  5HBM A;  2HHP A;  5HRO B;  2DRB A;  2XZD B;  1YJ9 S;  1NPR A;  1SKS A;  1FTC A;  4GKK J;  4FXD A;  4HHU A;  3GG0 A;  5AXL A;  1WC3 A;  3TJ9 A;  4N56 A;  2VPX B;  4OZ0 A;  2WZ1 A;  4FXV A;  4DSK A;  4PYD A;  4CM0 A;  4ZCK A;  3UPF A;  5KFX A;  2W1B A;  2VOO A;  2CZ4 A;  2Z57 B;  1Y5N B;  3HVA A;  5IQQ A;  3T19 A;  2D3Z A;  1ZOT A;  4AQY J;  2R8H A;  3JTO A;  2IHR 1;  4U96 A;  3P45 B;  1ELO A;  5ETQ A;  2GV1 A;  4KY3 A;  4DX6 A;  2A10 A;  3HHK A;  2DHH A;  1Q8K A;  3M2R B;  5AXK A;  3O44 A;  1NU4 A;  4OYW A;  1NB2 A;  1U8S A;  2ZVI A;  1EP4 B;  2HFN A;  4YUD A;  3FFI B;  4I1T A;  5CZV A;  5K8P A;  3G82 B;  1U6B A;  1JLA A;  1T11 A;  3LWM A;  2BJD A;  4IG3 B;  4O3S A;  4FPR A;  3TYT A;  5ETR A;  2YH1 A;  1KRP A;  1RAB B;  1WAC A;  4DF4 A;  1YIJ S;  3I32 A;  3UR3 C;  4IQX A;  2RKI A;  2KM8 B;  4KIA A;  4ZJL A;  2EW9 A;  4J9S A;  2IMO A;  4JI3 F;  2VQE F;  4MK9 A;  3KHL A;  3OPK A;  1S6P A;  3SQG A;  2K1R A;  5GAD U;  1TAQ A;  3ISN D;  2WVF A;  1IBM F;  2ASJ A;  1RLC L;  4E2F B;  2ASD A;  2NXJ A;  3CVK A;  1XNR F;  4FN5 A;  4WTY A;  5ETN A;  5BR8 F;  1GMU A;  4G6V B;  3VZI A;  2MQP A;  1N34 F;  4X62 F;  2PMW A;  4R5P B;  4HDG A;  2CG8 A;  1SQE A;  2AF6 A;  4YB1 P;  1T05 B;  4C4W A;  2DVI A;  4DLE A;  1RT7 A;  4P74 A;  3AH6 A;  2C28 A;  3MUT P;  3AQP A;  3GPA A;  2MY7 A;  3D1H A;  1L3K A;  4LRD A;  1FA0 A;  2VIH A;  1UEV A;  1VC6 A;  4FF1 A;  2XUL A;  3BF4 A;  4K50 A;  3QBC A;  3W2V A;  4J9P A;  1KOH A;  4A8S A;  1T02 A;  3NWR A;  2AHO B;  3RB4 A;  2VFV A;  4TYB A;  1HNI B;  2ATL A;  2IBO A;  1S57 A;  1A6L A;  3H2U B;  3M8P A;  4QWB A;  5HP1 A;  3G86 A;  1HA1 A;  5K14 A;  3KUE A;  4FS2 A;  1RUS A;  2HQI A;  5J2P B;  2WW4 A;  2O1P A;  2CQP A;  2DNK A;  4CZC A;  2C2E A;  3BH6 B;  3QGG A;  2QYC A;  4CO3 A;  2R2U A;  2B5J A;  4Y00 A;  5GAE I;  3ZZO A;  2DNZ A;  4ZS6 A;  1BWV A;  4F4W A;  3KLG B;  4NYZ A;  1UCN A;  5ETV A;  1TR0 A;  3KLV A;  2GX8 A;  2X1F A;  3KLE B;  1KC8 T;  4F26 A;  2UZA A;  2FGC A;  4WTO B;  5F8L A;  1WTF A;  1QDU B;  3TAR A;  2OI2 A;  2IY5 B;  4DPO A;  1B4S A;  1LW0 B;  3EX7 B;  3QPI A;  5ETK A;  2VJU A;  4O3P A;  4O0I A;  1QTN B;  2M9K A;  4RUA A;  4QIV A;  1N5Y A;  1GQE A;  4ECW A;  1YBU A;  3W61 A;  3GON A;  5JJB A;  3V6D B;  3OXF A;  3HCX A;  1U0S A;  4PWD A;  4QWA A;  4J9U E;  4TQS A;  5DRK A;  3UNY A;  2KXH A;  1K0V A;  3ZZR A;  3TAN A;  5HVG A;  2IC3 A;  4OQJ A;  4BS2 A;  2HRU A;  3OXL A;  3C6T A;  4CO1 A;  4HL9 A;  1EKS A;  4K4U A;  2E1C A;  3RAM A;  4OZ3 A;  3TW0 A;  2NXC A;  3IM9 A;  3TR5 A;  5FD1 A;  5F8M A;  4RW4 A;  3NMR A;  4ANC A;  2XTJ P;  4NMX A;  3DXB A;  1T9X A;  2D9O A;  1RT4 A;  2R7T A;  2AKW B;  2NQP A;  4DI6 A;  2FUG 9;  1REG X;  3SSS A;  1NKE A;  3CDA A;  1UKU A;  2SXL A;  1LWF A;  1NSP A;  3CCS S;  4CCH A;  1HHQ A;  1UVJ A;  3ZO7 A;  3MED B;  5D15 A;  4K4Z A;  1GX6 A;  2DNH A;  1JB0 C;  4ZPB A;  3DI6 B;  3M8Q A;  2APO A;  4B3S J;  2Y3Y A;  3AA8 A;  4ZVH A;  2AJ1 A;  2VQF J;  2R7O A;  4WE1 A;  3A3N B;  1WG1 A;  2CQI A;  2Y0B B;  2U1A A;  1RT3 B;  2VZ9 A;  2WTF A;  4UOF A;  4YR2 A;  1F3F A;  1KVI A;  3BKU A;  2V4J B;  4N7T A;  1DAR A;  1M5K C;  5F9L A;  2ZC4 A;  4E98 A;  2V2Z A;  4WPA A;  2JL9 A;  4X66 F;  1FX4 A;  2HHQ A;  1JLB B;  1RTJ B;  3DLL Q;  2WBR A;  1SV5 B;  2PEB A;  4K8R A;  4TYA A;  1ZH5 A;  2HNZ B;  1CBK A;  2DGS A;  3QSI A;  3TZW A;  3EUN A;  3OFG A;  1FT8 A;  2ZHA A;  4FP9 A;  4RWX A;  4HYK A;  2W7A A;  4JV1 A;  5HVH A;  1S99 A;  4EYH B;  2WOM A;  3OV7 A;  1SJ4 P;  4LSN B;  4WU2 A;  3TJ8 A;  1U1N A;  3RBZ A;  1RAJ A;  4DX7 A;  1YBA A;  1HBM B;  1E6V A;  5CYQ B;  3KLF B;  4KJI A;  3H20 A;  2JEG A;  4FF3 A;  2XG8 A;  4W98 A;  1C0T A;  1U2R A;  1HNX F;  2J9D A;  1RWK B;  4U95 A;  3W66 A;  3R5G A;  4PCQ A;  3BGL A;  3V4I B;  4C6A A;  3KJV B;  1F9E B;  2GCF A;  1NK9 A;  1DLO B;  4WKR A;  4G1Q A;  2DNL A;  3K0J A;  1OY9 A;  3OJU A;  3DM2 A;  4LF8 F;  3D0G E;  3FK4 A;  2MLY A;  4K4T A;  4DL7 A;  4USJ C;  1CS4 B;  1VRQ C;  3TUP A;  1RT6 B;  1KVK A;  2DO4 A;  1CLF A;  1PJ6 A;  2PII A;  2ZH8 A;  2DXD A;  3D1Q A;  4CQ1 A;  1XQI A;  1YQH A;  4LF9 F;  5KFU A;  1VJW A;  4NLR A;  2Q3P A;  1M90 T;  4IG0 B;  1R0B G;  5IC6 B;  3UE2 A;  3E51 A;  1T9V A;  4YHH F;  2N7Y A;  3U02 A;  1V6H A;  1ZZN A;  2W9C A;  4KKO A;  1IUJ A;  2OKQ A;  3GMG A;  2HHH F;  4HDH A;  5CHC B;  1EET B;  1YRU A;  5L1J A;  3L9Z A;  3HKZ D;  2FZG B;  1VQY A;  2X1A A;  1RAO A;  3X1L B;  2P2C B;  3FQL A;  3CJR A;  4LRA A;  2KKH A;  3BGR B;  4ZP9 A;  3BO4 A;  2VC0 A;  2MHN A;  2JLF A;  4GO7 X;  5M2U A;  3KMS A;  1O0P A;  2YY3 A;  1ZTW A;  3BQ2 A;  2L48 A;  3NGU A;  3B4D A;  3PR4 A;  3BR9 A;  1VQL S;  3TUZ C;  1R6Y A;  3TQ1 A;  2BKP A;  1HBU B;  3R3T A;  2ZH7 A;  4X4T A;  1ZPV A;  4WFY A;  2BKN A;  2JRS A;  3CDU A;  3HO1 A;  1VHI A;  1KOO A;  5KOW A;  4J5O A;  1N5S A;  4RUB A;  2FJB B;  2KH9 A;  4JV5 J;  2MKH A;  1FE4 A;  3MD3 A;  4GRS A;  5M2R A;  3HPO A;  2WON B;  2BDP A;  4IH6 A;  2FLO A;  2CQC A;  4LQ3 A;  1NLK L;  1NSK L;  2EFO A;  1UZH A;  2UXC F;  3M2V B;  2M8D B;  1RHU B;  4O44 A;  3IGN A;  5KFV A;  3ULH A;  3R7N B;  4DQR A;  4YB7 A;  1Y5L B;  3W8P A;  5EWF A;  1QTM A;  1FVQ A;  4V19 X;  1XMQ J;  4CLT A;  3ZC4 A;  4P9S A;  2E5I A;  2ZIT A;  2ZOM A;  2D69 A;  2OFG X;  1KKH A;  3OFH A;  1NKB A;  2PD1 A;  4YDX A;  1C1B B;  2ZUA A;  3GU0 A;  4B02 A;  2JJ4 D;  4N8N A;  3ZXW A;  3TEG A;  1HNV A;  3DC2 A;  5J2Q A;  3PR5 B;  3BSO A;  1M1K T;  4XTT A;  4C11 A;  1WSV A;  2BE9 B;  3V4M A;  4HHJ A;  1R31 A;  2N3L A;  2RDJ A;  1UVL A;  4OX9 F;  1S6U A;  4MKA A;  4B3M F;  4EU0 A;  4RUH A;  1YG0 A;  2C2R A;  4ER8 A;  2F3J A;  2BE2 B;  4GO5 X;  4P52 A;  3C8Y A;  4B9U A;  3NCP A;  4I6Y A;  2KFY A;  5A8K B;  4KGX B;  4WP9 A;  2VPY B;  2OPQ B;  4WK1 A;  2XY5 A;  2HMI A;  2H1Y A;  2XNR A;  2EKY A;  5D4L A;  2E5G A;  2AJ0 A;  4ZLN A;  3W60 A;  2R7U A;  3ZZT A;  4JI6 F;  3A12 A;  2RRB A;  4URQ U;  3D3B J;  3HFZ B;  1W25 A;  3GYX B;  5H1S V;  4USU A;  2M5Y A;  1XN9 A;  3IWX A;  1QLN A;  4AD6 A;  4IH7 A;  1QSS A;  4F8R A;  3MAA B;  5C2G A;  2F8H A;  2V94 A;  2J9D E;  3BBB A;  5K9F A;  2OLW A;  3PXG a;  4HT7 A;  4Y28 C;  2VL1 A;  3QO9 A;  3MUV P;  2CWX A;  2YKO A;  1S1V B;  4DL6 A;  1NZ8 A;  3FCH A;  5KG3 A;  2DNQ A;  3OUY A;  1JLE B;  3ZZP A;  4CLZ A;  3P96 A;  3CMQ A;  1X4G A;  2VG6 A;  1FDN A;  4JI3 J;  2VQE J;  3SV3 A;  1VRU A;  4NA1 A;  2IAJ B;  1EHW A;  3DDN A;  2AEF A;  2DJW A;  1RAI B;  2P8I A;  3BKT A;  1C1C A;  4QR2 A;  2WB1 D;  1LFP A;  1IJF B;  3BRE A;  4YB6 A;  2MKY A;  3SSQ A;  1S9G A;  5DGB A;  1IBM J;  1HFE L;  4RNO A;  3OVS A;  4FZV A;  4C8K A;  1ZET A;  3JYT B;  4X62 J;  2XS2 A;  5KG2 A;  2YNI B;  5I3U A;  4DZ6 A;  4DCP B;  3G71 S;  3SDE A;  1NK5 A;  4OX6 A;  4JI4 J;  3BBF A;  2BA9 A;  2IRU A;  3J7Z T;  4YEA A;  1H73 A;  2IM1 A;  3Q8R B;  3R9L A;  5KFQ A;  4PYA A;  4JI8 F;  4G1I A;  4NPO A;  3QIP A;  3GFY A;  4P7V A;  1IVZ A;  2IJR A;  2K2P A;  4QWC A;  1AFI A;  2VC1 A;  4FBT A;  4O3Q A;  5GAH U;  2FJD B;  3D28 A;  4ICL B;  1QJH A;  2J0Q D;  3CCV S;  4LF7 F;  3ILO A;  2XZT B;  1MRO A;  1MW7 A;  3OTO J;  2BAB A;  2FIU A;  3O2I A;  2DPI A;  4EYI B;  2H4Y B;  3R5C A;  1RT1 A;  1PC5 A;  4H4O A;  4LR8 A;  4DQQ A;  4TN2 A;  3T6J A;  2GIR A;  2PC6 A;  5IT9 U;  3C46 A;  3BSC A;  2HNY A;  5U47 A;  1HWK A;  1K1S A;  2J8A A;  3SMZ A;  4UQT A;  3DOL B;  1FRL A;  1UW4 A;  3DLK B;  5G0R A;  3GFZ A;  4EFA C;  1HPZ B;  3M05 A;  2GVZ B;  1X7V A;  3W2W B;  2FHK A;  3ITH A;  4QR1 A;  1CEZ A;  2HHU A;  1UWB A;  2IPO B;  2KFN A;  5EDW A;  4P71 A;  5A8R A;  2QX0 A;  4P72 A;  2VV5 A;  4UUX A;  4AL7 A;  1OYE A;  2DYA A;  3T5K A;  4NLS A;  4DQP A;  3I0R A;  3ZTS A;  1URN A;  3M9M B;  2PN6 A;  3CDB A;  2V9W A;  4X64 F;  3Q8Q B;  3D6T B;  3OVB A;  4LF6 J;  3G6Y A;  4DS4 A;  2DIT A;  5JXS A;  1HR0 F;  3MM5 A;  2K8G A;  1XTZ A;  3LP0 A;  2AJF E;  3QNW B;  4CNZ A;  1N4L A;  3CF5 Q;  2VOD A;  3RU0 A;  2J6S A;  4KB7 A;  3C66 A;  1OYD A;  1MNE A;  3CJK B;  2IJN A;  2OSQ A;  2IRX A;  4LF5 F;  1KD1 T;  4USV A;  2BYC A;  3LGM A;  5KFG A;  4CYU A;  3A8E A;  2Q6B A;  3RG6 A;  3WDO A;  3CD7 A;  1OO0 B;  4MH8 A;  1JLG A;  3KG1 A;  5I3P A;  1IR0 A;  3EZO A;  2C1E B;  3MPU B;  1XMO F;  3NGD A;  2ZOF A;  3N5B A;  1IKW B;  3SV4 A;  2P6T A;  1HMV B;  3CCM S;  1W2I A;  2LVW A;  4JV2 A;  5KFC A;  1KR4 A;  4FYV B;  1RHK B;  4PXD A;  1SC1 B;  5EN1 A;  3WC2 A;  3QGP A;  1NJZ A;  4QYZ K;  4MJK A;  4W92 B;  1QAX A;  1SL1 A;  1S9E B;  2MST A;  4NLO A;  3QYY A;  4MFB A;  5CH7 B;  2K06 A;  2DHX A;  1FFG B;  2OEL A;  5LMU J;  2RQC A;  2PO4 A;  1FDD A;  1FE0 A;  1U49 A;  1SJ3 P;  4IR1 A;  4DV4 J;  4PQU B;  4DHV A;  1CJU A;  2XYG B;  3QZ7 A;  3EGZ A;  2EG2 A;  2G0I A;  2DH8 A;  4UOC A;  3V6J A;  1JJH A;  2E29 A;  4CLL A;  2MSS A;  1EAY C;  1TL3 A;  2XYP B;  3KK2 A;  3P5T L;  2UUC J;  2CPH A;  5K8N A;  2WW8 A;  3G96 A;  1N5T A;  3MR7 A;  2ZWO A;  1FXR A;  1Q8L A;  3W62 A;  5KFI A;  3OT9 A;  4DV3 J;  3LAM A;  4O3N A;  1UJ5 A;  3Q0A A;  2XLK A;  4ID5 B;  5HMW A;  4ZPC A;  3EGN A;  2C2O B;  4ANE A;  2GZO A;  1AZS B;  1TVR A;  4W4M A;  5D3G A;  5IT9 Y;  1FKP B;  3BSN A;  3MFH A;  1X60 A;  3AT1 B;  3OTD A;  1SBR A;  2Z56 B;  2MQO A;  4R8U A;  4X65 F;  2HZV A;  4UY8 T;  1HNX J;  2CDQ A;  3SCI E;  1H72 C;  3VZH A;  2PFD A;  2ZKT A;  4PPZ A;  3DGP B;  1UPP A;  3NRB A;  3BGF A;  4DOZ A;  3U7J A;  2QRR A;  3GIL A;  3CIZ A;  3ZTP A;  2KJV A;  4AXI A;  3BO3 A;  4LBH A;  3OR1 B;  1QSY A;  3CCU S;  2C2Z B;  2CNN B;  4CRJ A;  4NLW A;  4DUZ F;  1RTH A;  1NK4 A;  3H5Y A;  2DCU B;  1J5E F;  3M8R A;  1HQE B;  1SJQ A;  1J5O A;  1KQS R;  3R6G B;  2QMW A;  1VQM S;  1GMV A;  4LF9 J;  4A8X A;  4IFY A;  4KT0 C;  2HW3 A;  1FKA F;  1E6Y A;  2ZD1 B;  2LA6 A;  2M88 A;  2F4F A;  3NS5 A;  1M0S A;  4F4A A;  2QA2 A;  2HHX A;  2HFU A;  1TKD A;  3QJJ A;  4IDK A;  3DYA B;  1YJT A;  2F40 A;  2UUA F;  3UN2 A;  5E7O B;  3M6W A;  3MMA A;  4DV5 J;  1HWI A;  4PAA A;  1WC5 A;  5AE2 A;  2FB0 A;  2YWK A;  1RU1 A;  2L9W A;  5FLX U;  2B4O A;  1U47 A;  1T8E A;  1XER A;  2RSQ A;  4ZP8 A;  1LNQ A;  5IWA J;  2PSZ A;  3IAS 9;  5KFH A;  9ATC B;  4DXL A;  4KC5 A;  3GWC A;  2L08 A;  2G0J A;  1KBR A;  3DOM A;  4C0H A;  5HVF A;  1WSR A;  1NJW A;  3IA0 A;  3PHE A;  4UUW A;  3GJQ B;  3UD5 A;  1S0N A;  1PAE X;  2MY8 A;  3F56 A;  1JXV A;  1KDN A;  1APS A;  2LMI A;  1BHN A;  3PDN A;  1OWX A;  1KHV A;  3ETO A;  3BGO P;  4LRF A;  3MFI A;  1TTH B;  5DG9 A;  4V19 J;  4K2J A;  3W5Y A;  3IO1 A;  1HQU B;  1UW9 A;  5I4M A;  3K57 A;  1BQN B;  2XWX A;  1YJ7 A;  2Z8Q A;  2R8K A;  3VVT A;  3KFW X;  2Y8Y A;  1EJ7 L;  1NXI A;  1GAO A;  4NXN J;  3E2E A;  2CPD A;  5KG1 A;  4ZK7 M;  1KSP A;  1IKY B;  2BBE A;  4MAK A;  5GAE U;  4IO1 A;  5KFW A;  1VHF A;  2FJX A;  2DY9 A;  1VBK A;  2QJ3 A;  1KNZ A;  5C25 B;  3DMJ B;  2AD9 A;  4U8V A;  5DGA A;  2CUY A;  4B3O A;  5E3Q A;  4JI0 F;  4DSL A;  2F7V A;  4NZ0 A;  3HHL B;  2XC9 A;  1U0H B;  3PHT A;  2KHD A;  2F1F A;  4C8Y A;  5BYR A;  4K4S A;  1RWV B;  2MKK A;  3H2V E;  4BHQ A;  1X5P A;  1CQM A;  1U1O A;  5KFR A;  1S49 A;  1YBT A;  1MN7 A;  3UCG A;  3PRB A;  4NXM J;  3N4W A;  2FLP A;  4LFB F;  2DR9 A;  2Q79 A;  1U45 A;  3LGH A;  4N77 A;  2DR6 A;  2LDI A;  3VAJ A;  4IUF A;  2LA4 A;  4FNI A;  2YX1 A;  2R2R A;  4LT6 A;  4WIQ A;  2BRK A;  1R8H A;  4B3M J;  2MJU A;  2CQG A;  1S0V A;  1X4E A;  4ED2 A;  4WFX A;  2CDR B;  1B0V A;  4HH1 A;  5KG6 A;  2BM0 A;  1DRZ A;  4ES2 A;  4O3R A;  3QID A;  3WIV A;  4CI0 B;  3PIO Q;  2UXD F;  2HVD A;  5C42 B;  2W4P A;  1SKR A;  1FEH A;  1Z2L A;  2RF2 B;  4KSE B;  3LQV A;  4RW7 A;  2RHQ B;  1PC4 A;  1T03 A;  5JVH Q;  4I7F B;  8ATC B;  2CJQ A;  3FEX B;  3UDV A;  1U7L A;  1WEL A;  1VIS A;  2KDO A;  4JI7 F;  3N6M A;  1P9Y A;  3CW2 C;  1WF1 A;  1JNZ B;  1YJW S;  2DGV A;  2JZ5 A;  5B0F A;  3ENV A;  1CJT A;  4KV8 A;  3FVY A;  3GYG A;  2GJI A;  3G6V A;  4MIB A;  4LRB A;  4O23 A;  4EGL A;  3FEY B;  3MCO A;  4F0K A;  3HMJ G;  2W9A A;  3G8T A;  1TK8 A;  2OSR A;  2GHV C;  3HHN B;  2JFK A;  4QYZ J;  1R3N A;  5FLX Y;  4IR9 A;  2CVI A;  1RWN B;  2KHC A;  2CJY B;  3K5P A;  1TL5 A;  2DD8 S;  2OPP A;  3A8K A;  5FDL B;  1WG4 A;  2MKS A;  2MZS A;  3R7S B;  5A8W A;  2HBZ B;  4LSL B;  1VQK S;  4EO6 A;  1S0O A;  1TKZ A;  4ZLJ A;  3H90 A;  3DOK B;  2BKO A;  3DRP A;  5KFB A;  4DR4 F;  1HYS B;  4OHV A;  6FDR A;  3D3C J;  3T5J A;  4USI A;  2LXU A;  3OTE A;  1VGY A;  1NK7 A;  4Z37 A;  2DNN A;  3NOG A;  1D9A A;  1FRX A;  1Q86 T;  4JI2 F;  2MKJ A;  2BZ2 A;  1BMQ B;  1CJK B;  4EUV A;  4M1K A;  2VIC A;  4YDD B;  5KT7 A;  1X4H A;  2C3M A;  2XO7 A;  2DB1 A;  4CNY A;  4ZCL A;  4GMK A;  5IQ6 A;  2R7R A;  1TV6 A;  3MM9 A;  3MM6 B;  3IBW A;  3BYR A;  2FVP A;  2F9J A;  1IBL F;  1N56 A;  1OQ3 A;  3FDS A;  3CCT A;  4A8K A;  1NME B;  4Q0B B;  4A8W A;  1SUQ A;  3A3P B;  3NNH A;  2E5L F;  5LSO A;  4ECQ A;  1S1W B;  1UPM B;  3H98 A;  2HBY B;  5DQH A;  1QAI A;  3QLH A;  2V8P A;  1UFL A;  3W7B A;  3GFH A;  2QLW A;  2ZJP Q;  2Y1J A;  2BQU A;  1XWL A;  3OTC A;  1S5Z A;  1RHR B;  2CNK B;  4OL8 A;  2LQJ A;  4J37 A;  3KK1 B;  1BUX A;  1Q5V A;  2W01 A;  1X4D A;  3Q83 A;  2QL5 B;  1G6B A;  4Y2C A;  3HXM A;  1TKX B;  1ROF A;  1G1X A;  1SH2 A;  2R2T A;  4NRU A;  3V81 B;  4OYI A;  3QFW A;  4Y65 A;  1RAE B;  2B43 A;  1RAF B;  1DQ9 A;  4UOH A;  2GQC A;  2ZM6 J;  1G4C A;  3QZ8 A;  3I6P A;  1JMT A;  1Y11 A;  2C3O A;  3NBP A;  1C0U A;  4PQA A;  4LBI A;  3RGI A;  2UVU A;  1Y10 A;  3I5C A;  2A6M A;  3T6B A;  5IT0 A;  3KMQ A;  3AJ2 A;  2YX7 A;  3NG8 A;  2RS2 A;  2M52 A;  1FF2 A;  2VOP A;  1KN6 A;  3I4P A;  4N41 A;  1UVM A;  4A47 A;  1SQF A;  1QAY A;  3UCZ P;  2GIQ A;  4OJ1 A;  2W9B A;  3PVX A;  1T9T A;  1M5H A;  1KTQ A;  3MEE B;  3KDN A;  3KK3 B;  1FJG F;  2KG1 A;  1V3R A;  1UP1 A;  2V8D A;  5KFP A;  1RT5 A;  3GYN A;  3BJY A;  4OI4 A;  2ZE2 A;  5L38 A;  1FWL A;  2B6A A;  4R25 A;  2W7P A;  3SQO P;  5KFD A;  2WSF C;  4NA2 A;  4IRK A;  2K3I A;  3TUJ C;  4A8O A;  5MLC V;  3EWG A;  1RT2 A;  1SIW B;  3CWJ A;  3T3F A;  2DY1 A;  3M8Y A;  1U1L A;  4KHP J;  1HNW J;  1RHJ B;  1N54 B;  3KLH A;  1LKZ A;  4LR7 A;  1TK5 A;  4IO9 Q;  2DGX A;  1SPB P;  2UU9 F;  2JHE A;  3AXK A;  3FSY A;  4QU7 A;  2RRA A;  1F1B B;  5HLF A;  3JTN A;  5GAG I;  3V5R A;  2CVE A;  5LOQ A;  3NLC A;  2FHO B;  2YPY A;  3D0I E;  3V6K A;  2DHG A;  1HNZ J;  3ZZU A;  3UQS A;  2UXB F;  1NDL A;  3E8O A;  1XNQ F;  1IWG A;  5ETL A;  2ZDP A;  2CA9 A;  5IV3 A;  1FJ7 A;  3RBE A;  1VRT A;  5RUB A;  5IM0 A;  3ZZ0 A;  1HLW A;  4ITS A;  1OQ6 A;  2OEJ A;  3MTJ A;  5LJ5 Y;  4WU3 A;  3EGV A;  2RKI B;  2V2Q A;  4NI2 A;  3DLE A;  3RB3 A;  5ITH A;  4C3K A;  2D7S A;  2XB2 D;  1S6P B;  5F8G A;  2YWH A;  1JKH A;  4K0K F;  3SQG B;  1HBN A;  2E66 A;  2AW0 A;  2FGO A;  1RHM B;  2K1R B;  3CJ4 A;  2QEX S;  1BGX T;  2K7J A;  3BZQ A;  1GT8 A;  4H4M A;  5DLF A;  1O5J A;  4DL0 C;  3MDF A;  5KFN A;  4DU8 A;  1RWO B;  2DO0 A;  2EK6 A;  3L95 X;  1WHW A;  3KHR A;  3OL7 A;  3K2Y A;  1XBW A;  2B4U A;  2UUT A;  2VON A;  3CJ3 A;  3AJD A;  2YNG A;  1XIQ A;  1ZZF A;  3H59 A;  3PY8 A;  2QSW A;  1IJE B;  2CQ3 A;  1H98 A;  1I51 B;  3ENA A;  3IBF B;  2Y1I A;  3NAI A;  3RB6 A;  4ILM A;  2I8E A;  3DLJ A;  4ZCM A;  1RLD A;  1RT7 B;  3HD2 A;  2V6A A;  2NS1 B;  3QFH A;  4IOB A;  4C8N A;  1BWE A;  4UT4 A;  3BBC A;  1D9D A;  5CYJ A;  1TEL A;  1WWH A;  4M94 A;  4XIU A;  5HMX A;  1U2F A;  4ZA1 A;  3CCW A;  3LPY A;  3W2V B;  5DLG A;  1HHT P;  2CYY A;  1UA0 A;  4KHR A;  1YZ7 A;  2QGF B;  5KFT A;  3BO2 A;  1SL2 A;  3PYG A;  2CQ2 A;  4FNH A;  3P49 B;  5CAB A;  2IMW P;  3M8P B;  1XK8 A;  5HP1 B;  3GJS B;  1SH3 A;  1BD6 A;  5K14 B;  1J27 A;  2FJA B;  5DM7 Q;  3LO3 A;  2F8E X;  3DU6 A;  1MG7 A;  2B7C B;  2RIL A;  1FHT A;  2B5J B;  4A8Y A;  2NSC A;  2X3D A;  4RKU C;  1L3U A;  3QRQ A;  2HVZ A;  4MKB A;  3TNV A;  1M5P C;  3PZP A;  3CSK A;  1TU0 B;  1AYE A;  2FZC B;  3T1Y J;  2UUA J;  1EKR A;  3CJ0 A;  4ZN3 A;  2FVQ A;  4F25 A;  2VG7 A;  1WI8 A;  2CNL B;  4OIX A;  1SH0 A;  4QZV B;  3UW1 A;  3GJR B;  5G4D A;  2FVS A;  2Q1L A;  1ZM4 A;  4ZKA A;  1FD8 A;  1F0X A;  1O6X A;  4CLF A;  2L41 A;  3FUY A;  4B9N A;  4DSI A;  2HG4 A;  1G7C B;  2YH0 A;  3U1N A;  5A0Y A;  3N6N A;  4WFN Q;  1I94 J;  3S8S A;  2ZC3 A;  3T41 A;  4URG A;  2WVB A;  4PWD B;  1JLC A;  1WKK A;  2N3O A;  5T7L A;  2V8G A;  3TWZ A;  2E5J A;  3OHB A;  3LUY A;  3V2U C;  2IC3 B;  1M1G A;  3C6T B;  3KJN B;  2CJ9 A;  5DM6 Q;  4OYO A;  1VC5 A;  1VR6 A;  2N4C A;  1NB7 A;  2D3O 1;  2R9L A;  3BSA A;  4ILR A;  2DNG A;  1WG5 A;  2BVZ A;  4RW4 B;  1CJV B;  4YQW A;  4CH1 A;  2BJ8 A;  4BBY A;  3AB2 B;  3PW0 A;  2KM8 C;  4U6P A;  4MK8 A;  4QPX A;  4JI1 F;  5KFL A;  5L9N A;  4CWB A;  3CMA S;  1ZPW X;  3LOU A;  4LQ9 A;  4I69 A;  1NHV A;  1IKV A;  2AGO A;  2B9W A;  1L5U A;  2IM2 A;  2OPS A;  3N0V A;  4DQI A;  4DR3 F;  3CC4 S;  1LWF B;  4OZ1 A;  1VQS A;  1LW2 A;  5AXN A;  3M8Q B;  1Z2Z A;  4YY3 F;  2MEW A;  1ZA1 B;  5F9N A;  2E7X A;  1QAJ A;  4OZL A;  2XCA A;  2XMJ A;  3IRX A;  4WE1 B;  2KL8 A;  4QIG A;  4L73 A;  2D1C A;  4LFB J;  5KFE A;  2UVR A;  1X4C A;  1FRH A;  3CTR A;  2VDH A;  4ZP6 A;  3OFF A;  1U6F A;  1X0P A;  3VTI A;  2CKW A;  3I0S A;  3PX0 A;  1WC1 A;  4DX8 H;  3FJ2 A;  4FPI A;  4GKJ J;  2ZBC A;  2N7C A;  3HP6 A;  2ZJQ Q;  1PYT A;  1REV B;  2MQL A;  1ITP A;  4ZDN A;  2I6W A;  2NYI A;  1VIO A;  1LV5 A;  2LQ8 A;  4DV6 J;  4P10 A;  3J7A 1;  2CQ0 A;  4RZR A;  2ZKU A;  5J1N A;  1Q1K A;  2W2N P;  4LRE A;  5KOX A;  1T9Y A;  2CQ4 A;  1BXN A;  4JI5 J;  2WOM B;  3D0H E;  3L3C A;  2H9Z A;  2IIH A;  2F4V F;  1PO6 A;  3I96 A;  3NEK A;  2O67 A;  2P5V A;  2HFZ A;  3THV A;  3DLB A;  1TUG B;  3HK2 A;  2EC0 A;  4JI7 J;  4LFA J;  1C0T B;  2XMA A;  4ZVT B;  4TY8 A;  4LVN P;  4DJB A;  1X4F A;  1NHK L;  2BAN A;  2QA1 A;  4DFK A;  3CCR S;  4YR0 A;  3R27 A;  1T3O A;  2DBB A;  1T95 A;  5AXM A;  4A8M P;  4G1Q B;  3NCQ A;  1U1P A;  3PFE A;  4J9M A;  1N33 F;  4WXO A;  2Q6C A;  1XMB A;  3DM2 B;  1FFW B;  4ZJQ A;  1WF0 A;  3SCK E;  3EXY A;  2ACM A;  4KE5 A;  2CJA A;  2OHD A;  2W25 A;  2JOQ A;  2BRL A;  3BM7 A;  4DG1 A;  4WYL A;  1RAG B;  1O51 A;  5HSP A;  4NLD A;  4DR4 J;  4ELU A;  2RJZ A;  1IKX A;  5K8O A;  4DR6 J;  5GME A;  1VLY A;  3LGN A;  4ZLL A;  3G6E S;  1XC9 A;  1LWE A;  4BCA A;  4JI2 J;  3Q8U A;  3OLB A;  3D2W A;  1FFS B;  4P2S A;  4RNM A;  2CXE A;  4JP8 A;  2R7V A;  1SKW A;  1K1Q A;  2CQB A;  2W9C B;  4KKO B;  1HI8 A;  4DV2 J;  1KQG B;  1QSL A;  4DMZ A;  5E41 A;  3QT8 A;  2MKC A;  3BGU A;  4M5D A;  5L39 A;  4Q5V A;  1L3V A;  4WFZ A;  4OZN A;  4IKA A;  5IV4 A;  2MZJ A;  3FEZ A;  1IBL J;  3KJF B;  2H65 B;  4PEO A;  4ZVE A;  3PNI A;  1PJ7 A;  1S1T A;  5LMN F;  3EDQ B;  2YKP A;  2OPR A;  2NCK L;  3TVY A;  4RLE A;  1NHU A;  1OY8 A;  5HQL A;  1UET A;  2NLW A;  3FQK A;  2E7V A;  4OYB A;  5KFO A;  3HSZ A;  2DIS A;  2BJ3 A;  4X4P A;  4FBU A;  3K8V A;  4DQS A;  4WZM A;  1CUL A;  5KG0 A;  1U1Q A;  3IR5 B;  3AD7 C;  5HQ8 A;  4WP8 A;  4CH0 S;  2P9C A;  1FNX H;  4Z2X A;  4DSE A;  5ETM A;  4Q7A A;  3LF0 A;  5B0E A;  4ZPV R;  2YQ1 A;  3M32 A;  3J7Z 5;  4FVC A;  5EUH A;  3GQC A;  2LQB A;  4U7U D;  2R8J A;  1CSJ A;  3MXH P;  2BOA A;  2BR0 A;  4PRF A;  3BDP A;  1PAU B;  5DET A;  2D3U A;  1IBK F;  1Y00 A;  3IGV A;  1S1U A;  3T1H F;  1P1T A;  5KT3 A;  1AA1 B;  1T7P A;  4XDD A;  4NLQ A;  2PA8 D;  3UD4 P;  1LFW A;  2ZH2 A;  5IFM A;  4O44 B;  4PPD A;  1X4B A;  4F3M A;  1RWX B;  2MYF A;  3R97 A;  3LAL A;  1MU2 A;  1FES A;  4Q8F A;  3PYE A;  5CXT A;  2KT2 A;  1ZM2 A;  1GXU A;  3Q2S C;  1V9O A;  2QN6 B;  4LVO P;  1R27 B;  3WX4 A;  3MMJ A;  5H9E K;  3JS9 A;  3OHA A;  1H74 A;  2HHT A;  3QWU A;  2CAJ A;  2ZBQ A;  1K8A T;  2J9E A;  4RU9 A;  5B0C A;  3CGI A;  4IFV A;  1HNV B;  5J2Q B;  2XM3 A;  5THW A;  4C11 B;  2UP1 A;  3HJF A;  4DUY J;  2MZT A;  3EDR B;  1XR7 A;  2RU3 A;  1I1G A;  2FLN A;  1Q8I A;  4YN3 B;  4TQR A;  3OFE A;  3GV7 B;  1IN0 A;  4DR5 F;  3M1V A;  2J0S D;  2BQ3 A;  1LK5 A;  3W5Z A;  2QC3 A;  3MOZ A;  4ED5 A;  3Q23 A;  2HMI B;  3R1L A;  4EEY A;  3POT A;  3HZE A;  4CO0 A;  1VBZ A;  4ZVF A;  3DLG A;  3G4S S;  3PM9 A;  4UF4 A;  2EI5 A;  1UFK A;  2FZK B;  4E0D A;  5MAO A;  5CD4 A;  3OVA A;  4C8O A;  3D66 A;  2OO4 A;  4ILL A;  1Q95 G;  5D4N A;  4C0O C;  2RB7 A;  2I38 A;  3QO9 B;  1H2U X;  1XNQ J;  3D54 A;  2J7K A;  1N36 J;  3KOA A;  4PG6 A;  2O01 C;  1R8B A;  3HFV A;  3DRS A;  2YKQ A;  2YX4 A;  3JSB A;  3OUY B;  5H9F K;  3BEG B;  3HM9 A;  4DPX A;  2NXE A;  5L9X A;  2J5A A;  1JK9 B;  1NM2 A;  3K89 A;  4EMD A;  2VG6 B;  3ILL A;  3BS9 A;  3K5M A;  4F50 A;  2GNK A;  4PAB A;  4YFU A;  3W9H A;  3D9B A;  4XPE A;  1VRU B;  2R42 A;  2KG0 A;  1S97 A;  2WSE C;  1C1C B;  3GSD A;  2RNE A;  2UUB F;  1F6T A;  2XLJ A;  1TKT A;  4WBF A;  1VLO A;  2HGM A;  1S9G B;  1FWK A;  3F0N A;  1RK8 A;  2QV6 A;  1B3T A;  2YBV A;  1YDL A;  2W7O A;  4B3T F;  2RRN A;  1ZA2 B;  2NZC A;  3MCS A;  4YB5 A;  3Q22 A;  1H0H B;  5I3U B;  1NJY A;  3SDE B;  2YWW A;  4WCE Q;  2AGQ A;  1WHV A;  3QJL A;  2K7K A;  1NK8 A;  4B9S A;  1Q81 T;  4BC7 A;  2ASL A;  3H4D A;  4OI6 A;  3MEC A;  3QIP B;  1VOM A;  2E1A A;  1WC0 A;  1RZM A;  3A1Y G;  4ECY A;  1W7W A;  4LFC F;  3IWN C;  2Z2L A;  2CWK A;  1DQA A;  1YK9 A;  4OX8 A;  3N01 A;  4GKK F;  1D8Y A;  1KLN A;  2OML A;  2XI2 A;  1MRO B;  2J6U A;  1DJ0 A;  1F2G A;  3MAQ A;  4OJH A;  3KUG A;  1RT1 B;  1V5I B;  3GR0 A;  4H4O B;  3GR1 A;  4PG8 A;  2DNY A;  3A3O B;  4I4B A;  3VGU A;  2CPF A;  2HNY B;  1S10 A;  4AQY F;  2KI2 A;  4EZ6 A;  1U1K A;  3E01 A;  4UY8 5;  3CJ8 A;  3S6E A;  3VGS A;  1TL4 A;  3UVJ A;  4A4J A;  2QT7 A;  1VIX A;  3D4J A;  3ITH B;  2YXL A;  1D3W A;  2AJ4 A;  1UWB B;  4DFM A;  3LW5 C;  1S9E A;  1NCL A;  1DHM A;  4ZHR A;  5A8R B;  3PTW A;  2XMM A;  5SUH A;  3BV8 A;  5LM7 E;  2ZH9 A;  2MJN A;  4OI1 A;  1BLU A;  1TP7 A;  1N32 J;  3I0R B;  4FDF A;  3LAK A;  4JYA J;  1NAQ A;  1VDH A;  2VBY A;  2O3D A;  2LEC A;  4RBU A;  1H38 A;  3BDE A;  4PXC A;  1U24 A;  2PGC A;  3R1H A;  2M0G B;  4ZVQ B;  2VFT A;  5BJR A;  1LOU A;  2HVH A;  1B7Y B;  2GAG C;  4NAS A;  3DKD A;  3MM5 B;  2XHW A;  4DF8 A;  3LP0 B;  3HVT A;  3CB4 A;  1U6Z A;  1S48 A;  1FRI A;  1WEZ A;  1Q78 A;  4DR2 J;  1XEZ A;  2MQQ A;  1PIE A;  4ED1 A;  4D3G A;  1AW0 A;  4ED6 A;  4N76 A;  1H7X A;  2VBZ A;  3IMQ J;  3TI0 A;  3CME S;  4OI2 A;  1FXD A;  4CYU B;  1WC6 A;  3PKM A;  2FVC A;  5BXI A;  2JFD A;  2V69 A;  1HBO A;  5LXR A;  4KQZ A;  5E3A A;  1JLG B;  1KFD A;  2R7X A;  1OMS A;  2GVD A;  1VI7 A;  3IM8 A;  4KHM A;  4V1A k;  3QWP A;  1GH8 A;  1A9N B;  4DR3 J;  2DCL A;  1VBX A;  2UUW A;  4IRC A;  3FSI A;  3A13 A;  3IS9 A;  5HMY A;  4F0H A;  2CPI A;  3TA1 A;  2DNO A;  2WHO A;  1HHS A;  1FI4 A;  1S4F A;  2DTJ A;  4Z7Y A;  2PT0 A;  4LJM A;  2PDA A;  5EHH A;  2QG9 B;  4X4R A;  4MFB B;  5KT2 A;  1RA6 A;  3CCL S;  4HI1 A;  4P2X A;  5KT4 A;  4MIA A;  2B8P A;  2Y1R I;  3P6Y C;  2ZBP A;  1N52 B;  3K58 A;  2ZFH A;  1RWP B;  4IOA Q;  8RUC A;  1CJU B;  3HVW A;  2KRR A;  4I56 A;  3VAK A;  3J7Y I;  3CED A;  4LF4 J;  3V6H A;  1L3T A;  1TL3 B;  5EWG A;  1U2C A;  1UEK A;  3M6X A;  1F3V A;  3PX4 A;  3KK2 B;  5H9E J;  2GO9 A;  1P27 B;  1FKO A;  1VK3 A;  1N6Q A;  3CJT A;  2MZ1 A;  4Y6I A;  4L6V 3;  4DV1 J;  3FMW A;  3KWM A;  4NCG A;  1RKJ A;  5D0R A;  2ALZ A;  2RU9 A;  3BPD A;  3DCA A;  4F4X A;  2EBG A;  3KDO A;  1WEY A;  1TVR B;  2F4V J;  5D3G B;  4AND A;  3OR2 A;  1FJE B;  2NYH A;  3ELH A;  2YKM A;  2UV8 A;  3M2U A;  3RW6 A;  2QL7 B;  3PCO B;  2MZQ A;  4OYM A;  3JSR A;  2HLU A;  2HBQ B;  4R8U B;  2NXN A;  4WXW A;  1NDK A;  1C4A A;  2XMU A;  4B17 A;  2H5I B;  3QT7 A;  1PG5 B;  3MPD A;  2BUN A;  3OBI A;  3DHW C;  2DR5 A;  4WK3 A;  1N33 J;  3EYZ A;  5GAG U;  1Q82 T;  3D6M B;  1FVS A;  5SZT A;  4B9V A;  4CO4 A;  2I0X A;  1CC8 A;  2L9N A;  4TU9 A;  3M6U A;  4DPY A;  1RTH B;  1HW9 A;  3KYL A;  5DDP C;  4RBV A;  2RAQ A;  4C8Z A;  4B3R J;  5B0G A;  1J5O B;  5CCM A;  1MSW D;  4PG7 A;  4ZVP B;  4IFY B;  2HSE B;  3W1Y C;  4B9T A;  4UQG A;  4MIW A;  1E6Y B;  5DG8 A;  2W2Q P;  1Y0H A;  4OHZ A;  3H5S A;  3B6B A;  3GSI A;  4OHW A;  1YI2 S;  4IDK B;  1Y5I B;  3RR7 A;  4B3S F;  4Q2L A;  2HIQ A;  2ZZM A;  3MMA B;  3MM7 A;  3UD3 P;  2RE1 A;  3I87 A;  2QZ8 A;  2B7B B;  1S9F A;  1S6Q A;  2LEA A;  1FJC A;  2ADB A;  1VQ8 S;  3Q8Y A;  3DDK A;  3C16 A;  2OAU A;  3D67 A;  2LFV A;  2ZH1 A;  4KPC A;  3MAH A;  5D0E A;  3FRY A;  2HS4 A;  3BR8 A;  4BWJ A;  2VA3 A;  4ELT A;  4X4S A;  2BX6 A;  4M63 A;  3W63 A;  5D4P A;  5KAK A;  1Z4U A;  2R7S A;  2ROG A;  1M5O C;  2ZZT A;  1VQ4 S;  2NZ4 A;  4UTG A;  2V68 A;  1TMM A;  3TZX A;  4WYW A;  3K8W A;  4JV0 A;  4O3O A;  3L7O A;  1SKU B;  4C8M A;  4DDF A;  1WOP A;  1RCO B;  2DEJ A;  4NE9 C;  2I5J A;  3HSJ A;  3MWB A;  3CE8 A;  1DTQ B;  4G65 A;  4I2P A;  2HPU A;  2CQH A;  2W4D A;  3MTK A;  4J9V A;  2WVC A;  4O4G A;  3GIJ A;  1YSJ A;  1WEX A;  2M70 A;  1SL0 A;  3JSM A;  4CIO A;  4L3N A;  2KB2 A;  2YNF A;  1B99 A;  2IJF A;  2JC0 A;  3KUH A;  1RE1 B;  2PE8 A;  1GMW A;  3R5D A;  4F04 B;  2V9K A;  4B3O B;  3H5X A;  2A1B A;  3NGT A;  2QO3 A;  2Z30 B;  3KG4 A;  5D78 A;  2KJW A;  2VBX A;  1RWU A;  4GVB A;  3DRY A;  3PJ9 A;  3ILI A;  4HAC A;  5IOL A;  2DGO A;  4NLX A;  5HQM A;  4ZOS A;  2AEM A;  1MWQ A;  1NSQ A;  2MMY A;  4ZN1 A;  2AIR B;  3MMB A;  1QUV A;  3AA9 A;  4NLG A;  2FDN A;  3I82 A;  2M8H A;  3VAL A;  4HKQ A;  1I6J A;  1VQP S;  4KPY A;  1NRK A;  5IC4 B;  4B9M A;  1GMW D;  4NX9 A;  4KFB A;  3IG1 A;  5FJ4 A;  1UAW A;  3RW7 A;  5KFM A;  2VG5 A;  1WUU A;  3VWS A;  4ZPD A;  4RW7 B;  1YJN S;  2KZZ A;  1T03 B;  1RTI B;  1LEO A;  1BY9 A;  3UCU P;  1S6O A;  1JNR B;  1SXL A;  2R8I A;  1P1L A;  2AZ1 A;  4RL1 A;  3N5F A;  2DEI A;  2AT1 B;  3ET6 B;  3GLJ A;  2G2Z A;  5LSR A;  1U26 A;  4Z7C A;  4X4O A;  2E9R X;  1CJT B;  4TLR A;  4ZIT A;  4KV8 B;  4TU7 A;  4CLU A;  1XNR J;  4LIW A;  4NOH A;  2KFZ A;  5BR8 J;  1PYO B;  5B09 A;  1ZBT A;  3EJM A;  2PI5 A;  2QL9 B;  1N34 J;  2XMW A;  3W64 A;  2BMB A;  1FRK A;  5ETS A;  1TL1 A;  5ETP A;  2QA4 G;  4Y34 A;  4JV5 F;  4TY9 A;  3GB0 A;  2ZZN A;  4K5R A;  3W65 A;  3CPW R;  2HKE A; 
#chains in the Genus database with same CATH homology
 2HBR B;  3P4U B;  2QL7 B;  1F9E B;  1PAU B;  2XYG B;  3P45 B;  3D6H B;  4DCO B;  2C2M B;  2HBQ B;  3IBC B;  2QLB B;  4ZVQ B;  4DCP B;  4ZVT B;  2XYP B;  3R6L B;  1RWV B;  2C2Z B;  3GJQ B;  1RWW B;  3GJS B;  2H5I B;  2CNN B;  2H48 B;  1QDU B;  2FQQ B;  1RHM B;  2H51 B;  1RWM B;  3D6F B;  2H5J B;  2C1E B;  3KJF B;  1RHJ B;  1ICE B;  1RE1 B;  2H65 B;  5K20 B;  3R6G B;  2CNO B;  1RWP B;  1RWO B;  3KJN B;  2H4W B;  1RWX B;  2H54 B;  1NME B;  3NS7 B;  4ZVR B;  3EDQ B;  2C2O B;  3D6M B;  2QLJ B;  1RHK B;  1QTN B;  2QLF B;  1IBC B;  1SC1 B;  2Y1L B;  5IC6 B;  1I51 B;  3IBF B;  1I3O B;  3R7B B;  1GFW B;  1RWN B;  2CJY B;  2XZD B;  4ZVS B;  2DKO B;  2XYH B;  2HBY B;  2CDR B;  2XZT B;  4LSZ B;  1SC3 B;  1RHQ B;  3R7S B;  4JB8 B;  2CNL B;  4DCJ B;  2H4Y B;  4ZVP B;  1PYO B;  2HBZ B;  3R5J B;  3GJR B;  4ZVO B;  4ZVU B;  2QL9 B;  1RHR B;  2CJX B;  2CNK B;  3QNW B;  1RWK B;  3EDR B;  2Y0B B;  2P2C B;  3KJQ B;  1SC4 B;  1RHU B;  3SIP B;  3RJM B;  2QL5 B;  3GJT B;  3R7N B;  5IC4 B;  1BMQ B;  2C2K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...