4ZVRB

Caspase-7 variant 4 (v4) with reprogrammed substrate specificity due to y230v/w232y/s234v/q276d substitutions bound to devd inhibitor.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
b'YKIPVEADFLFAYSTVPGYVSYRVPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESDSDDPHFHEKKQIPCVVSMLTKELYFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 19
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvrB00
3R7BB 1PAUB 2H5IB 2Y1LB 2QL9B 4ZVOB 2XYHB 1RHQB 3EDQB 4LSZB 3NS7B 3R6GB 2XYGB 3R6LB 2QLBB 4JB8B 1BMQB 1RWVB 2CNLB 3GJTB 2CJXB 1RWKB 1IBCB 1F9EB 1RWMB 1RWNB 1RWXB 2H4YB 1NMEB 2QLFB 3D6MB 4ZVPB 2QL5B 3KJNB 3IBCB 4DCJB 2QLJB 3D6HB 1QTNB 3GJQB 3R7SB 1RWOB 4DCPB 1GFWB 2QL7B 2H65B 1PYOB 2H4WB 2C2ZB 2CJYB 2H5JB 2C2MB 2C1EB 1RHKB 5IC4B 1RHRB 3EDRB 2XYPB 2Y0BB 1I3OB 3RJMB 1RHUB 2HBQB 3GJSB 2C2OB 1SC3B 1RHJB 2H48B 2HBZB 4ZVQB 1I51B 1RE1B 3D6FB 3KJFB 2DKOB 1SC4B 2P2CB 2FQQB 3SIPB 1RWPB 3GJRB 1RHMB 3P45B 3P4UB 1SC1B 2XZDB 4ZVTB 2CNNB 3KJQB 2H54B 4ZVRB 2H51B 2CDRB 4ZVSB 1RWWB 3R5JB 4DCOB 3QNWB 1QDUB 2CNOB 5IC6B 2CNKB 2XZTB 5K20B 2HBYB 2HBRB 3IBFB 1ICEB 4ZVUB 2C2KB 3R7NB
chains in the Genus database with same CATH superfamily
2DCUB 2CPYA 4M5HA 4I2PB 3SBMA 1LWXA 3NWRA 3FBFA 1LOUA 1BHNA 2RKIA 2CPDA 4I6AA 1DTTA 2WBMA 1XR5A 2FHMA 1HPZA 2C2RA 1W25A 3GR1A 2WK4A 4DUZJ 2ZVIA 1U2CA 2D41A 3NGDA 2GCFA 2KL8A 1S6PB 3FUYA 3WZ0A 4B3SF 5M2RA 4CLKA 1D8ZA 4K4XA 1FK9B 3AOCA 4HHJA 1X4DA 4IO1A 4USVA 5BR8F 2P9CA 3QSYB 3OJUA 1KVKA 2PMZD 4QZVB 2X3DA 4ICLA 2J8SA 1KBRA 4H54A 4RBUA 3NWGA 1MU2B 5F8HA 3MGJA 1S1UA 2JNJA 3UD5A 5DM7Q 4NLYA 2MJNA 3QNWB 2D9PA 4IQXA 3KKFA 3I9ZA 3FKBA 3I32A 2LXFA 4H4MA 1RT5A 3T9NA 2RRAA 1HQEB 3IXQA 4I4BA 4BLGA 1KS2A 2YPZA 1S0MA 1NZAA 3QRRA 5IT9Y 1M5SA 1IQTA 1WD6A 4ED7A 1U6ZA 3R6GB 4B9UA 5GAGI 1K1QA 3R6LB 3DFEA 3GJTB 5A8KB 3R3TA 4C2MA 4QW9A 2CZ9A 3LP2A 4YUDA 2V8DA 3C14B 3ZXWA 2ZDOA 1CJKB 4XTTA 1QTNB 4A4JA 2HAFA 4G1QA 1VYAA 3HVWA 5ETTA 1RAIB 3HVTA 4NPOA 1G7CB 4J9OA 2QA4S 1ZZNA 4O3PA 3PZPA 1BC6A 2AJ0A 1MMNA 2VBWA 1IN0A 4ZPCA 5DDOC 3CCSS 5AE1A 3POTB 1U1PA 4ZKAA 1YQHA 3ISND 1NNDA 1FKPA 3C15B 4DU7A 3UN2A 1CS4B 4ECQA 4JI8F 2IA0A 5B08A 2ZKTA 2FLOA 2JJ4D 4NLOA 4R5PA 2R2UA 3ISNC 4F8RA 5K20B 1F5BA 2VPYB 3TYTA 4Q0BA 1KKHA 3N6LA 3DOMA 2UVVA 2R7SA 3Q86A 4ZN1A 3CGIA 2BE7D 3LUYA 2ZEJA 4EBCA 3HHEA 4ECZA 2V4JA 1WKLA 4TY9A 2NXEA 4WXOA 4QPTA 2YKPA 2QIFA 2QEXS 2WVEA 3P96A 5CHCB 1HW8A 1RBOB 1NJIT 2W7AA 1VC0A 4ZJOA 2J9DA 2GMLA 2HS0A 3GYGA 2C28A 1T94A 1FNOA 1DAXA 4F4XA 1FXLA 3FBEA 5KG1A 2CWXA 1R8BA 1VS3A 2B9YA 1MW7A 4F4YA 4DR2J 4I6WA 4DSEA 2PD1A 4QCLA 3BO3A 1Y4ZB 3WIUA 1JJ4A 4QBUA 2HK3A 3W2WA 4CWBA 2WRMA 2ZBCA 1F3VA 4PAAA 1FJEB 4HTIA 4GKJJ 2VQFJ 3GE9A 2CQDA 4A8WA 4DUYJ 2JWNA 4X2BA 4PZVA 2VA2A 4JI6J 1S4FA 4C8OA 3R7NB 3MEKA 3V6DA 2DNHA 1S59A 3AD9C 4U95A 4URGA 5CYMB 2GA7A 3T5HA 2FC9A 4N47A 3V5RA 5LOQA 5EWFA 1KQFB 1RJJA 3S8SA 4ANCA 1Q16B 3CCUS 3QT7A 2R7RA 1JKHB 3AD8C 1YHQS 3M6WA 1VQLS 3VVTA 2XSJB 1R8HA 4JYAF 1S6QB 1S77D 2K7KA 1Y7PA 3M8WA 1ZA1B 3EXYA 2YWEA 1NDPA 3OBIA 2VHGA 2KM8C 2MDAA 1ZYQA 2HS3A 3H0PA 3JQJA 1SC3B 3CC2S 3PW2A 4G1PA 3HVRA 4NYPA 1XNQF 3GJRB 4DL6A 4K7QA 3L4BC 4OYPA 1FDBA 2E66A 1JB0C 5IC6B 4DX5A 4NYOA 4KH1B 4TU7A 5KT7A 4KO0B 4JI0J 1S1XA 2DXEA 2HS4A 2OTLS 3MR3A 2FY1A 4PG6A 2HSEB 4OI2A 2WBRA 3Q2SC 4L3KA 2BMBA 4K0KJ 2FHJA 1RWXB 1RAFB 1M5PC 2K1RB 1N8RT 3DM2B 1PSDA 4XAKA 1HL6A 1FVQA 3V81A 2QL7B 1N52B 2E9ZA 3RB4A 4CH7A 1PYOB 2G2ZA 2NSBA 4TY8A 3OFEA 2Q66A 1NU4A 2GHVC 1A9NB 2C1EB 1UA0A 4P75A 1UAWA 1I3OB 2B6AB 4FXVA 2XI2A 4RUAA 1GQEA 2J0XA 2RHSB 1B99A 3MAQA 3NRBA 1RT6A 1UPMB 4I1TA 3TEHB 4FBTA 1OSCA 1IKWB 2CQHA 3CXCR 2CJ9A 4DLEA 3IP0A 2ZM6J 1Q53A 3PW4A 1HI0P 2JFKA 2EFGA 3E01B 2V69A 3OTBA 2UUAJ 4J37A 2AGQA 3LWLA 1UTAA 1TQLA 3IWNC 3KWMA 3TA2A 2N3LA 3UW1A 2ZHOA 3M4XA 5T7LA 1IBMJ 3TAPA 1RHQB 5GMKa 2FHKA 2F8EX 5HLFA 3KDNA 1UETA 3VAHA 1Y5NB 3F0NA 4LR9A 4E98A 2V5HG 1HR0J 1KQKA 3A12A 2Z2MA 1X4GA 1Z2LA 4Q8EA 3ZZYA 3J7AN 3M2UA 2N7CA 2O67A 2X3GA 2BABA 2N82B 2HZCA 3WBZA 1SQEA 3FEZA 2ZVSA 4ZVGA 2RHQB 2DIUA 1VLYA 2DNPA 2B9EA 4DZ6A 3TA0A 2QYGA 4DF8A 2W2QP 4DSJA 1WF1A 3MMBB 2HQCA 1YGYA 4Y0FA 2ZNZA 3OV7A 2K3IA 2JZ5A 3GB0A 1HNWJ 1HARA 3W5ZA 1RBLA 1IUJA 1FESA 5F8MA 5CAAA 1PGZA 4HLBA 2GIRA 1FJGF 3KFWX 1TMMA 2HFOA 4ANDA 2IPOB 3DNCA 4USKA 1M1HA 1RAGB 1TUGB 1NRKA 3BB5A 2KG1A 4C0OC 1U0SA 4V1Ak 3A8KA 4ZK7M 2XB2D 4HEA9 2P6TA 3UDEA 3M9OB 1PIEA 4F3OA 2F1FA 4RNOA 4YY3J 1B7FA 4DV4J 2J9EA 4HACB 4RBTA 4A8YA 2R4FA 2VG5B 5DG7A 2L48A 2F5GA 3GSIA 5HAOA 4MKBA 4OJHA 3V4MA 1SUQB 4H4OA 1S12A 1JLGA 2BM0A 3RR7A 4OQJA 1LQ9A 4CTAA 2NXCA 3RBZA 2E7XA 4OX9J 1C1BA 3PYFA 3R5GA 1RAOA 1X7VA 4LF6J 4DR3F 4W98A 3KNGA 4JI5F 1KOOA 2IVMA 2YWHA 4CO0A 2CJKA 1CJTA 3TNVA 2P6SA 1X5SA 5ADZA 3UD3P 3J7YU 3RW6A 4DL4A 4NXMJ 3BQ0A 3G8TA 1EHWA 1TVRA 3G6XA 1HBMA 3C19A 4DR4J 4KHMA 3AH6A 2XHWA 2AP6A 3MMCA 4A8XA 2B0GA 2C2MB 4MFBA 2HHQA 3I55S 2AYMA 2IMOA 3KJVB 2VFRA 3H42A 2VC0A 4R0EA 2FHJD 2PT0A 4ZP8A 2AF6A 4M8LA 2VA3A 2RF2B 3TP2A 5KFCA 2HVEA 2H54B 2QX0A 4OI4A 1GMWA 2KYZA 1UVIA 2A2DA 2HGNA 4YN3B 3DDIA 1KLMB 4O3RA 1KLNA 1RT7B 2VG6B 3UDLA 1SJFA 1FXRA 4C4WA 3V2UC 2VF3A 4C3MA 3IG1A 3KLFA 4MIAA 3CTRA 2EFPA 2IDEA 1RT1A 1XQIA 2O5DA 2RB7A 2GW8A 4NZ6A 4ZOSA 5EUHA 3JSMA 4E2FB 2RQMA 2KJWA 2DVIA 1F6TA 3B78A 4JP8A 3IR5B 4KV8B 1PCAA 3NCQA 3MXHP 3MPWA 4Z37A 1NSPA 1FDDA 4ER8A 1UFWA 3TZWA 4DR5J 5E3AA 2J9DE 3M30A 2E7VA 4F7VA 3RJMB 3NGTA 5LT5A 3JYTB 1IKYA 1Y0HA 5B09A 4Q45A 3DMJB 1VBZA 4DWIA 2VJUA 1NHVA 1NBEB 2V2ZA 4GRSA 4YHHJ 3VGVA 3T1YF 5KOWA 2M7SA 5KAKA 5KFZA 2HWIA 1LWFA 3QO9B 5LMUF 1RI7A 1MMDA 2CVIA 2XZTB 2UVRA 1BGXT 4J9LA 2NXNA 3KLVA 1ZTTA 2FGOA 3MM6A 1X4EA 2FIUA 1FI4A 1JLFA 2OPQA 4DV6J 4Y65A 5HMWA 3IM8A 2DH8A 2Z8QA 3G87A 3N9UC 1M5KC 3KHHA 1HFEL 4IDKA 3GFYA 4NCGA 1FRMA 5IWAJ 1YX2A 3TUJC 2Z2YB 1X9MA 5IV4A 4IG3A 3KLGB 3CJ4A 3VZIA 1P6TA 5J1EA 4KKOA 1WNEA 5CYJA 3LGHA 4DL2A 2CPIA 2UXCF 1C0TB 1F0XA 3Q24A 3FCHA 7AT1B 3FBBA 3CJKB 4DN9A 2DNRA 2ZBPA 2IVYA 3V4IA 2BM1A 2LQ8A 4DV0F 4ELTA 3HSJA 2YX4A 4W90B 2M52A 1LFWA 3SXLA 1KRPA 2B5JB 1RA7A 3RAMA 1HBNB 2PA8D 3KOAA 4IKAA 3JTNA 3M9MB 3SSSA 4NMXA 3JSYA 3LANA 3CT9A 1QE1A 2X7IA 4LRAA 2OPPB 3T3FA 4DV5F 2WSEC 1VDHA 1RK8A 5GAHI 3VVUA 3HJVA 3K0JA 3W9HA 3HSDA 1EP4A 4QU7A 1G6BA 4LIRA 1WELA 2E7WA 3GCXP 2HFVA 4LFAF 2HHSA 4JV5F 2DHSA 3F41A 3BPDA 3MEDB 4WE1A 4QWCA 3W7BA 1KD1T 2B7CB 4A8MP 1DTQB 3IC1A 4Y34A 1T9VA 1D3WA 2C3MA 2VFVA 3BGOP 1NJYA 1R0BG 5B0EA 2EFVA 1I5OB 3CMES 1R0AA 4X4UA 3SIPB 2KKHA 1VHIA 2ZZNA 1RTJA 2GGPB 4ZA1A 4DFPA 2CVEA 2HKEA 2QMWA 2VQEJ 3TVYA 1FRJA 1TK0A 1TL1A 2DRAA 2CNKB 2I5JB 3C6TA 3EX7B 2HFNA 1KWMA 2BANA 1NKCA 1WI6A 2W2PP 3TOQA 1NPKA 3T6BA 3OFGA 2GMJA 2CYYA 1Y00A 1IJEB 1NDKA 1VFJA 1FF2A 3W66A 3UQSA 1IR1A 2MLXA 2CNLB 5KFTA 1RWNB 2I38A 1R7IA 1GMWD 3KMQA 2W01A 1VMBA 1JIHA 2PDAA 4B9SA 3MR6A 3CULA 4J91A 2EW9A 4KIAA 4NLGA 2JLEA 4L3NA 1UEUA 5IXUA 1F5CA 1TAUA 1SXLA 3MM7A 3W8PA 3NAIA 2DHXA 2OO4A 3KK1B 2VZ9A 2AW0A 3MM8A 4Y6IA 1S10A 3R5CA 1H2UX 2OH2A 5K9FA 3DLJA 4NI2B 2MKIA 2G4BA 1H2VZ 1MN7A 1EQ0A 3P3DA 5C25B 1HQUA 2FVCA 2QJ3A 2JH3A 2BEFA 2E5LF 5AE3A 2C22A 3QYYA 3ADAC 4DDFA 1HYSB 1CVJA 2L3MA 2HYIB 1HD1A 4WFBQ 4ILRA 5C2GA 3W63A 2HNDB 2CPZA 4B3RJ 2C2DA 1TUWA 2PA3A 2JX2A 3ICLA 1JLEA 2DXDA 2WW4A 2DR9A 2G13A 4ENOA 1V3ZA 3SCIE 2KXNB 1KSPA 3DKDA 4HH1A 4NCAA 4LR8A 1R8CA 1BWVA 1GFWB 4PEOA 1C0UA 2HHHF 4HTJA 2HMIB 3UPFA 2M3DA 3UVJB 3TANA 4FYDA 5IT4A 3I5AA 4C0BA 3OVAA 1DQ9A 1AA1B 3D6FB 3KJFB 4LRCA 4UZCA 4LF4F 3CJRA 4NZ0A 3SQOP 4ZDNA 3LPEA 3J80U 5D78A 1NM2A 1N5YA 4PWDB 1DARA 4Z7YA 3HFVA 2B9WA 1TKTB 4X4NA 1FDAA 3MTJA 5A0YA 2DNKA 3AAWB 1GXTA 3FQLA 5AXKA 2R8IA 1NKEA 3VZHA 4IO9Q 3SEOA 3IRWP 5EX0A 1BMQB 5IM0B 4MYTA 4UOFA 4ILMA 2OD4A 2YKMA 1E6YB 3HSZA 1S9GB 1X0FA 5D0EA 1SVDA 4B3SJ 3AODA 1MWZA 2CQ0A 5DLGA 4ECUA 2R3VA 5BR8J 2ZOMA 1QVGR 4OZ2A 3G96A 2JC0A 1HHTP 1Q86T 1RHUB 3BF4A 2HBQB 3QIPB 4NASA 1CQNA 3EVOA 3BR8A 3KG1A 4O44B 1TL3B 2ZD1A 3MUVP 4I0WA 2APOA 3VAMA 2GMHA 3N4WA 1NEEA 4OHZA 4ANEA 1RT3B 2AQ4A 2CNNB 2ATCB 2R8KA 2V6AA 4MJKA 5LMNF 5I4MA 4NX9A 2KZMA 4KPCA 3Q0AA 4UQTA 4DEZA 4PQUA 5AXMA 2GIFA 1J5OB 1QD1A 4NXNJ 4KQZA 2W9CB 3MR2A 3GYNA 1DURA 1U2RA 5KFQA 5KT3A 1Q8BA 3HI9A 4FYWB 2AYGA 2VIHA 1IKXB 4OZLA 3KK3A 4EU0A 4K59A 2GVZA 4CQ1A 4EZ6A 1FTCA 1DTTB 3B8HA 3M2VA 5IFMA 2PO4A 3MD3A 2HNYA 3W60A 4JI8J 3KDOA 2XM3A 3K7RA 2X1GA 2DHGA 2XULA 1JJHA 3W62A 2E1CA 4P74A 1T3OA 2XY6A 2Z0GA 3RAXA 2J6UA 2XG8A 2WW8A 4AYBD 2XNQA 4DPTA 3NGUA 4KY3A 4CO3A 3MM9A 5A76A 1CULB 3L09A 2RSQA 2XGQA 3DRSA 3BR9A 1S0OA 1H3DA 3IMQJ 4NLDA 3DHWC 1JJCB 2XI3A 1B70B 3KUEA 3CJ3A 2JFDA 5CZXA 2IAJA 5HQMA 3BYRA 3JTPA 3I5CA 4TU9A 1SJ1A 3UDVA 1FKOB 4Q7AA 5ETRA 3CB4A 3M2RA 1ZETA 2IYIA 3OW2R 1K8AT 4EO6A 3KK2B 1AB8A 2KU7A 2ILZA 4O3QA 2R2TA 1AZSA 1N5QA 4J9RA 4DLGA 2BDPA 3RB3A 1URNA 2EXUA 1RTIA 2IRXA 4I2QA 2J0WA 2W1BA 4DPXA 4FDFA 4F3MA 2CXEA 2A18A 3U02A 1UVLA 4IG0B 2FJDB 4USTA 1V5VA 4FF4A 1TKZA 4ZHRA 5HI7A 5EGYA 2HRTA 3B4MA 3GG0A 2HBRB 4DI6A 1DFDA 1MMLA 4UUXA 1T9TA 1YLXA 1F5AA 3KLHB 4P73A 3CPWR 3RBXA 1WOPA 4ZPWR 4K4ZA 2ZJQQ 2YNHB 2J5AA 2CRLA 3DOMB 1P8GA 4JYAJ 1RCXB 3CVKA 3GIIA 1BWEA 3NGKA 1NDLA 1VC5A 2M5YA 5KFLA 3THVA 1RABB 1HIYA 5IOLA 4DS5A 3LPYA 3IGVA 3SQGA 1B0PA 3S6EA 4J9KA 4YMEA 1VQ6S 2MHNA 1U09A 2IJRA 3FFIA 2BJ8A 1NH8A 3CEDA 2GFFA 5I3UB 4MTPA 4FZVA 3MUTP 3R2CJ 5GAEI 4YR0A 2VL1A 3CE8A 4AFFA 2XEXA 4ZVFA 1SC4B 2EK6A 2ROGA 2DHHA 1HA1A 2AEFA 5DDQC 3DLHA 2GVDB 3C46A 2H5EA 3C16A 5DETA 3W9IA 3HHKA 1RA6A 3MTKA 2UVWA 3HHLB 1N0UA 4AXJA 1WJ9A 2ERRA 3T19A 3NCRA 1T9WA 1GX5A 4NCBA 1V3RA 2CQCA 2ZE2A 4DG1B 3SFUA 4KT0C 4G3IA 2B7BB 5I42A 3G82B 1Q7YT 3OFFA 4OIXA 1SL2A 2YKAA 3MECA 4YB5A 4QWEA 1U1LA 4PUOA 2C3OA 4P9SA 3PW5A 4ZVHA 3V6HA 1YZ7A 3I0RB 1U47A 5LSRA 1JQGA 2BJ9A 1V9OA 1RT4A 4OHWA 5KG3A 3CJTA 4NRUA 1K44A 2VH7A 2ZKUA 2M9KA 3AXKA 4WIIA 2OPSB 5D15A 4CNYA 5J2PA 2DKOB 1S79A 4LF2A 3A4TA 2I2YA 2Y1IA 2O01C 2RQCA 1FX4A 3QT6A 1U1MA 5KFUA 1YITS 2OJ3A 1Q78A 1YRTA 3O1LA 4OLPA 3PM9A 1SJRA 4N41A 2PI4A 5E3QA 5CXTA 4CLWA 3HKZD 3B4DA 2FLLA 4C11A 2P9GA 1YSJA 2CDQA 4ED4A 1D9FA 1AROP 1IBCB 3OVBA 1N56A 3D2WA 4GO5X 2KRRA 1DJ0A 2C3YA 5J2NB 3RAQA 2GO8A 3MAAB 3DOLB 2CJBA 3WX4A 1CQMA 4WU3A 1HLWA 1RLDA 1VK3A 4EUVA 4CLZA 2AYEA 3J81Y 4RNNA 1FE4A 4LF5F 2FHOB 2JLGA 1U7LA 3U1NA 5D0RA 3QMQA 2CQ4A 1IQZA 1TL5A 4L76A 2GJ2A 2V68A 3DYAA 4ZCLA 4MT1A 1YRUA 1FD2A 1SC1B 4DMZA 3N0VA 2ZJRQ 1MROA 4UUWA 2N4CA 1K73T 2YKNA 1FJGJ 5AE2A 2QLWA 2H1YA 2KB2A 4J7CA 4ECTA 3UFCX 2RD5C 2DNYA 4PXBA 1LW0B 1REVA 2XCAA 3SI8A 1QAIA 3C6UA 4Z7CA 3NS6A 4DSLA 4LBHA 1XBWA 1W2IA 3Q8SB 4F04B 3TAQA 4J5OA 1S9FA 3OHBA 3DRRA 3QWUA 3N28A 5M2UA 2LQ9A 4U67Q 2MJUA 4Y2AA 5G0RB 2ILYA 4R25A 4DPUA 3AD7C 3W65A 3RBDA 3RU0A 4B17A 5A2QY 1TKDA 2HVIA 2L9DA 4DSIA 1UCNA 1ZM2A 2I0XA 3MM5A 3MFIA 2GQ2A 3FEXB 1T02A 2Y8WA 1TL7A 2DT9A 4DL7A 2E9RX 3ENQA 3KTQA 4A48A 2YNFA 2B9XA 4L74A 2OSRA 4URSA 2LQ5A 2Y8YA 3SSRA 4JI5J 4UF4A 3R7BB 2V67A 1S0VA 3QFHA 2C3PA 4XIUA 2AX1A 1T11A 4C8MA 2UUBF 2A6OA 1IBLF 1RWKB 4Q43A 2EFNA 2QV6A 1SL0A 1FE0A 1RTHB 3L7PA 5HP1B 4FF1A 4KHPF 3ETMA 3MMAA 3L3CA 2B43A 2YVSA 4DR6F 1JLCA 4CLSA 4KBIA 4KRWA 4NLSA 5DZ6A 2KFZA 2OELA 1HNIA 3BGUA 3Q8VA 3D0IE 1BD6A 2NR0A 4B3TF 2HBZB 4KGXB 1SV5B 3H40A 4K5SA 3BEGB 2RJZA 1BQMB 5KFAA 2AIRB 3C66A 3TO8A 4P10A 3KLEA 1GTHA 1HNXF 2W4PA 3M8PA 4WFZA 3CMQA 3MCMA 1CC7A 2WONB 3OR1A 2VPZB 4FPIA 2C2KB 4LJMA 4I64A 2DR8A 3D67A 4M5MA 2DY1A 3KLIB 3LF0A 2JDJA 4DQIA 1FHTA 1T03B 1VQ9S 3CJ2A 1JLBA 3O44A 1T9UA 6FDRA 2UV8A 2VICA 5LXYA 4F50A 2DRBA 5HVGA 2V8GA 1FEEA 2DO4A 3OVSA 5D4NA 2ASLA 2DNMA 1V3SA 1H7XA 4K4TA 2BV3A 4DV3F 2M2BA 4IFVA 2MQQA 1CJUB 3GFHA 3LQVA 4CLFA 1WF0A 6AT1B 1K1SA 3DU5A 1TVRB 2KYXA 2MGZB 2D7SA 2J6TA 5ETMA 1B4SA 4B9TA 2UXBF 2JEGA 5HVHA 3PCOB 4MKAA 3T1YJ 4PPDA 5F9LA 3HF5A 4WFAQ 1W26A 3D9BA 4OYOA 5LMUJ 5E0OA 4L75A 2B3TB 1N34F 3U7JA 3Q22A 3PW0A 3IFEA 1W2BR 5ETSA 2VUGA 1K47A 3FEYB 2KG0A 2E5JA 2DO0A 4KFBB 3J7A1 2VODA 1S4EA 4QJVA 1LFPA 1N33F 2CG8A 1SH2A 2OLWA 3SV3A 3RW7A 5ETOA 1YJVA 2GX8A 4ELVA 2IM1A 5DQGA 2MQ8A 4ZPTR 3M32A 2DJWA 3TVZA 2UXCJ 4B9LA 4ZP6A 1CJVB 2AWZA 1R43A 3BM7A 3CJ8A 1Z4UA 3R7SB 3ITHB 1RWOB 1WEZA 1TTHB 2ZH6A 4ES1A 3DLGA 1S1VB 3AB2B 4DV0J 4EZ9A 1H0HB 4M5DB 2WVCA 4X4VA 3CDWA 4YOEA 1YJUA 4Y2CA 3K58A 2ASJA 4NL5A 2XO7A 1HMVB 4CZCA 3NMAA 3FDSA 3VHQA 1UZDA 2MY7A 3DLKB 1KQGB 4Y00A 2QGFB 4ZVRB 4DV5J 3AQOA 4ITSA 3CCVS 2W9BA 3RBEA 2VKZG 2AD9A 4DSKA 3HT0A 4RPFA 3KNAA 2AV5A 4ZCMA 3W64A 1DBDA 4NEYA 4I2PA 3C8YA 3ZTSA 4LRBA 3LOUA 4LFAJ 2AYBA 4DSFA 4LFCF 2MPUA 4JV5J 3MM6B 1MSWD 3DGPB 2ZFHA 4O3NA 1JLFB 4HHUA 1ZH5A 2QL5B 2XS5A 3D4JA 2FC8A 4LSLB 1Z1ZA 3AT1B 1PO6A 2V9KA 2WZ1A 2H4WB 2C2ZB 3M8SA 1HWKA 1S6PA 4NLVA 3QGIA 4RUHA 3MMJA 1X4AA 2W7PA 1FK9A 2EBGA 5HQ8A 2ZH5A 5LM7E 1VRUB 1XR6A 1VQNS 4YR2A 4OFZA 4X4PA 5CYQB 2XZWA 4NA1A 3GIKA 1XERA 1MU2A 3ZZTA 3D0HE 4NLWA 4A8QA 3FNNA 3UD4P 1SKWA 2CQ2A 2XLIA 3I96A 3ZFVA 2Z56B 1H72C 1HQEA 5AT1B 1NJXA 3CD7A 2VBYA 4WXWA 2R8HA 1P1LA 2K06A 2DIVA 1Y9OA 4DN0A 4C9DA 1KHVA 2OUGA 2BZ2A 2MQPA 2BACA 2G2OA 8ATCB 2FLPA 5A8KA 3ZO7A 2GJFA 2CPHA 2GZOA 3C14A 3MPDA 5IZHA 3S01A 4YFUA 3ZC4A 1HNZJ 4M94A 1CJKA 1R31A 2QE5A 2RDJA 4Q2MA 3H2LA 2FZKB 2DPJA 2CADA 1QJHA 3G4SS 1AW0A 3JSBA 4KHRA 2DGSA 4C48A 3POTA 2LFVA 2NUHA 2HIYA 1SB6A 3C15A 5K8PA 3CO9A 4GVBB 3L7UA 1CS4A 4PYAA 3NBPB 1HWIA 1GNKA 2OPRB 1R0AB 3QLHA 1ICEB 4XDCA 4FS1A 2RRNA 1ITPA 3WHIA 2E1PA 5D4PA 2NS1B 3P6YC 3AJ1A 2QZ8A 3J7YI 2HHXA 3ILLA 4X64J 1ZZFA 3WC0A 3EUNA 2QA1A 3PEJA 3T9ZA 4KC5A 2HHHJ 2WB1D 4I6YA 3MCNA 3WC2A 3QGHA 3D1HA 4P2FA 2Z30B 1RCOB 2BX6A 2DRDA 5EX3A 5GAEU 1D8YA 4I69A 1RHKB 4ILLA 2HG4A 2F3JA 4LF4J 2OI2A 1UP1A 4X4RA 5K14B 1Q1KA 4DL0C 3MM7B 1LWCB 1VGYA 1TL4A 1Y3KA 1FRKA 4WP3A 4OZ1A 2ZJPQ 2UUWA 2V0NA 4I7FB 2LU2A 4DV2F 3X1LB 1SC6A 2KTQA 1HBOB 4TVAB 2BJ7A 1S9EB 1JLQB 4DQRA 1UJ4A 1VQSA 4HR2A 2HLUA 1BXNA 1LW2B 1ZPWX 1U26A 3GV5B 5E33A 3PXGa 1JNRB 1UA1A 2XYHB 4LSNB 4F4AA 3VF0B 5CYMA 4PG7A 5F8IA 3CCRS 2KDOA 5HJYA 4LT6A 2QC3A 1Q7LB 3VV2B 2LDIA 5JXSA 3PRVA 2QLFB 2VBXA 3A8IA 3GPAA 2BJEA 2KXHA 2XSJA 4QR1A 3KYLA 1S6QA 1JLEB 3TQEA 3A8EA 5B7WA 3K2YA 3NOCA 2IA6A 1YJRA 3EZ5A 3BSNA 3N01A 2W24A 4CM2A 4F02A 4OHYA 2V94A 1Q5VA 2WOMB 3TZXA 1TUVA 1DHMA 2QT7A 3RTVA 4O4GA 3FVYA 4QR2A 5LMNJ 1FT8A 4OYBA 1VQ5S 3EZUA 5D8HB 4U8VA 4DL3A 1NSAA 5IT9U 3GZ7A 1TAQA 2K3KA 5D3GA 5MAOA 4LIWA 5K8MA 3P5TL 3N79A 3AHPA 1NK5A 3NY0A 2BE9B 3M9NB 3ZTPA 3HHNB 4FNIA 4JV0A 4KO0A 3K5OA 2KN4A 1R8AA 1BQNB 5K8NA 1VQ8S 3NS7B 2WSCC 2WVFA 4WYLA 1CG2A 1WG5A 1YG0A 3QT5A 4ECSA 4GKJF 5CCMA 1FRHA 3TW0A 1X9SA 1V5IB 4IRCA 3DM2A 1RDRA 4ZCKA 5DO2A 4CO5A 5HATA 3W9JA 5KFXA 2U2FA 1EAYC 2OGUA 4CM0A 3NP5A 4MK9A 2M70A 1IR2A 2DR6A 4DPWA 1OYEA 9RUBA 3PYDA 1Q8LA 3TR5A 2BKNA 1YKWA 1P27B 2UUCF 2F4FA 3R8YA 7FDRA 1IKWA 1CBKA 1QAYA 2BOPA 2Z57B 4DX7A 1KOHA 3E01A 1J5EJ 4QU6A 4U8YA 4JI4J 4C8LA 1UFLA 1S0NA 1TV6B 2YKQA 1UWBB 2MZSA 1IVZA 4XO0A 4FP9A 4NYZA 3D6TB 4MK7A 3MURP 2ZZMA 2ZITA 4BBYA 5KFKA 1EARA 3QJJA 5KFMA 2CZVC 2LQBA 1I6JA 4C97A 4K4VA 4DQPA 3KJNB 2JOQA 3CCWA 3QATA 3DDNA 3V6KA 4NA2A 1NXIA 4P7VA 3EVMA 1ZS6A 1F9HA 4BS2A 3M8RA 2JSXA 5J2QB 3K57A 2E1MC 3TUPA 2J9CA 2MQMA 1TFWA 5DZ7A 2FJEB 3TX0A 1GXLA 1OJ4A 4ZPBA 4BCAA 1YJ9S 5E3CA 2C3UA 3NG8A 3IGNA 3LGNA 3FJ2A 5IT0A 3MMBA 3LWMA 4R0JA 1RAAB 4AQYJ 4EYIB 2ZNYA 4PXEA 3GWCA 3EICA 5LJ5Y 2E44A 4AE5A 1KFDA 5KFEA 4LRFA 2CQGA 2UU9F 2LU1A 3GFZA 2HVDA 2RU3A 3CSKA 2FY8A 3MR5A 3SSQA 2FZCB 5KG4A 2QG9B 4KAIA 3ZTOA 1GXUA 1F9FA 5HL7Q 2HZVA 2EPIA 4ID5B 1A6LA 4LUBA 1FDNA 4HACA 4O3SA 2J7UA 3O5TB 2C2OB 2VG5A 3IA0A 2YQ3A 5IS2A 4IH7A 1FRXA 3IR7B 2BRLA 3EPGA 2RIJA 3Q23A 1SUQA 1SKUB 2VV5A 3HVAA 1AYEA 1RAEB 2UXDF 1A0OB 1M1KT 3HFKA 3ILOA 3IRXB 5J2MB 2CNOB 3A3NB 4FXDA 1BLUA 5EWEA 2R7UA 1EETB 2AGOA 4IFYB 4JV1A 2Q6CA 2UV8G 4DUTA 2AZ1A 1NDCA 3H2UB 2YBVA 3PVXA 5DDPC 1B7YB 4OV6A 1T9XA 5F41A 5LJ3Y 1L3SA 1OSDA 2VONA 1TP7A 1B3TA 5H1SV 1JJ2R 2FJVA 2V4RA 1Q8IA 2AHOB 5EWGA 2DB1A 2DYAA 4GKKF 3KJVA 2QMXA 3B54A 1I51B 4CLYA 3J7ZT 3EYZA 5KOXA 3UR3C 5BYRA 1V6HA 2RF2A 1U48A 1KFSA 3S7RA 5ETVA 4YY3F 3MWBA 2FJWA 1IBKF 1QDUB 4QIFA 1NSQA 2DD8S 2J0SD 4JI7F 3A3PB 1BQXA 2VG6A 3DU6A 2YTCA 3CJSA 5EN1A 3C16B 3K59A 5HBMB 4LVNP 2V9WA 4LSZB 2VOPA 3H98A 2IRYA 5HROB 1R89A 1O5JA 3FZ2A 2W2NP 2ASYA 2Q6BA 2F63A 4OI0A 4YDDB 2ZE2B 4U9RA 2AX0A 2XY5A 5JVGQ 4KV8A 4LF5J 3H59A 1Q79A 3A3OB 1U0HB 1CLFA 5CH7B 1JXVA 3U27A 1X4BA 1RZMA 1S57A 1HNVB 3JYTA 3BQ2A 4FF3A 4LQ9A 1WC1A 2A0FB 5ETKA 3DMJA 2FQQB 2Q1LA 3OTOF 2Z2ZA 3BGRB 4J90A 3DI6B 3G8SA 1PJ6A 4NLPA 2DGQA 3OR2B 3QO9A 1F2HA 3NGSA 2AJ2A 3I31A 3BSCA 3ONQA 2Y3YA 3N5FA 1Q8KA 4PKDB 2F65A 1Y5LB 1PC5A 4N77A 1H74A 2QSWA 1F9EB 4C3LA 2E1AA 3G8QA 2XS7A 2ZC4A 3KLGA 1KEKA 4X4OA 1L3TA 4DCPB 3Q8QB 4B9MA 1SPBP 5A6PA 3M8QB 1C0TA 4UZBA 4RW4B 3CJKA 2FZGB 3KG0A 2A1BA 3VALA 2XYPB 1RKIA 4DX8H 4KE5A 3R1LA 1P1TA 1O0PA 4TYAA 2WVDA 2M0GB 4X62F 4F67A 5A6WA 2YX1A 4QQBA 4V19J 3MF5A 1AFJA 5F3ZA 2B5JA 4CYUB 3P45B 2D3O1 2QA4G 1HBNA 2BW7A 4J9MA 3VCDA 4AUKA 4TU8A 1D0EA 3BN7A 2DCLA 3K5LA 1C1CB 1IKVB 3F56A 2OPPA 1RAJA 4GO7X 2UUBJ 3MCSA 3CIZA 1I94J 1IBLJ 5A8RA 1CEZA 3NEKA 2AJ1A 1NAQA 2QTWA 3TA1A 1NK0A 2BVZA 3R1HA 3I9V9 1VBYA 3OSPA 1L3VA 4C6AA 3OPKA 2V8HA 3CD5A 5FD1A 1VBKA 4KHPJ 1R0CB 2DNZA 4RNFA 3BN4A 1SI9A 5DDRC 4DR6J 2GO9A 2P8IA 1PJ7A 2YXLA 3CF5Q 5E2QA 1PKUA 4B3TJ 1DTQA 3GTYX 2DNQA 4LF8F 1HWJA 4HI1A 1LK7A 4P2MA 2R8JA 3OHAA 2CKWA 3SDEB 5KFIA 2M8DB 5DM6Q 4PG5A 3QQCD 1HNXJ 3UDCA 3W2VB 2GGPA 1X0PA 2VC1A 5L9NA 1VQPS 4IH6A 1H2TZ 3H25A 2IC3B 2I5JA 4UOCA 2MXYA 1UKUA 5L1KA 4QR0A 2MHEA 4F36A 2W8KA 2RAQA 5F3TA 4P2XA 4B9VA 2YNFB 2F40A 4R8UB 1E6VB 5KT6A 3PRBA 4Y2MA 1TFYA 4DV3J 1LXJA 3ET6B 2G9OA 2D69A 3I87A 3DRXA 2VPXB 1D09B 3VGUA 2A3JA 2YWWA 2UXBJ 3OTDA 1XC9A 4H4KA 1EZZB 1FTRA 4PYDA 1B64A 4QIEA 3KK1A 3UN5A 3M7VA 1SKSA 3BBFA 2YNIB 3IS9B 3OJSA 3RYLA 2RQKA 4A8OA 3GR0A 1VC6A 5LSLA 3BKFA 4NI2A 2GAHC 2LXIA 4HHHA 3LP0B 1D9DA 3BJYA 3JQKA 4KGMA 3H2VE 5C25A 3UNYA 1DLOB 4A8SA 4OI3A 4FN5A 3VTIA 4AXIA 4X65F 4HKQA 1HYSA 4F2RA 1I1GA 3EM1A 3IBWA 2KHCA 2B4UA 2M4MA 4NMLA 1H6KX 2XO6A 3QIDA 4WKRA 4C0HA 3D0GE 2KT3A 4PQAA 2KT5A 3KUHA 1RWMB 3PFOA 3GYXB 1WHYA 5I3QA 2RU9A 1X8DA 4OJ1A 2C42A 1KNZA 3BS9A 3TEGA 2ADCA 1VRTB 2OMOA 2O1PA 2HMIA 1RHRB 1T05B 3CCZA 4QW8A 3HKWA 1NZ8A 2IM2A 1YK9A 1LXNA 4CP5A 3FRYA 2PE8A 1C2PA 4ZP7A 1RHMB 2DPIA 1N6QA 1HHQA 3DOKB 1GT8A 2NREA 2LQJA 5K8OA 3PHTA 5KG7A 4RBVA 4RU9A 1J27A 3Q8PB 4PWDA 2FVQA 4RNMA 1RAHB 2VU5A 2HEKA 2FLNA 2IRUA 3Q8RB 2HLTA 2LDYA 1MWQA 4KGVB 3AFGA 2IVFB 1SH0A 2KFYA 1RP5A 4LFCJ 3H8YA 1YBTA 2XMJA 5KFOA 1ZPVA 1JNZB 3VQSA 2H9ZA 2EC2A 4ETZA 1YVFA 4OYIA 1NHKL 5C42B 2CFXA 1WC5A 2HRYA 1PG5B 1RT2B 4IRKA 3FRZA 4EFAC 1J2VA 1E6YA 1S9GA 1WORA 1YBUA 4PWUA 2MKYA 4F0HA 2WAQD 4HL9A 3W61A 2BR0A 1AUSL 4B3RF 5L8RC 1S72S 3CJQA 3PJ9A 3MFHA 5KG2A 1B0VA 2J0QD 3MPUB 2F4VJ 3JAMU 1AFIA 3BO2A 3MOZA 5BJRA 3QIPA 4K5RA 4ZVEA 4U7UK 4XDDA 1FWKA 2LA4A 2NZ4A 4YDXA 4O44A 1TL3A 3OXFA 5L39A 1KVIA 3H5YA 1T95A 4RO0A 2YH0A 4CDIA 1VQ7S 2CPEA 1RT3A 3K17A 4RW7B 5J1NA 5GADU 3FGVA 3AJDA 4ZVUB 2D74B 5L1LA 2XC9A 4Y2KA 1MNEA 1TKXA 2QL9B 1IXKA 2F7VA 4NLUA 4WCEQ 1J5OA 1U1NA 2DR7A 2C2NA 2Z4PA 3EDQB 2MZRA 4KPYA 2W9CA 2R7OA 2PFFB 2XMMA 5F8LA 1SIWB 5HMXA 2CJXB 2V63A 2XWXA 2I1RA 2A10A 3KHLA 1IKXA 2V34A 2FVSA 1NPRA 2ZOFA 3BH6B 4KGZB 5C7PA 1VQYA 4DFMA 2E1RA 3SCLE 3JAMY 1XWLA 2WVBA 1FVSA 4OYXA 3CDAA 3WDOA 3EXCX 1S1WA 2IJNA 3FMWA 4A8FA 3BDEA 1HQ2A 1YJ7A 3DN9A 1ACMB 1VK8A 3ENVA 5IV3A 1K0TA 4Q44A 2IBOA 1AT1B 4OJ3A 1P9YA 3RRGA 4LQ3A 3IO1A 2H51B 4ZLLA 2VD3A 3FSYA 3B82A 4AL5A 1CULA 3NXZA 1GX6A 3DLLQ 2IDLA 2JEFA 4J9UE 2MSSA 2LKZA 4RW6B 3LP1B 2N7YA 5E5NA 2ZBRA 2Q3PA 4H4KC 1OQ3A 1LKZA 3GCWP 4KYZA 2R42A 2K8GA 3QFWA 1U45A 1FKOA 1LV5A 2HZAA 1JLAB 2MY8A 3CD6S 1VR6A 3LTOA 2ADBA 1R6YA 4USJC 1RISA 2ZH1A 1GAOA 2KFNA 1XTZA 2H65B 3HD2A 1FKAF 2ZH4A 5AXLA 3KK2A 4NXNF 1SJQA 3TZZA 2HPUA 2CQ1A 2JRSA 3RRHA 2G2YA 2E9TA 3QJLA 2F9DA 3TI0A 2HFUA 3I4HX 5L38A 4XPCA 3M6XA 1FRLA 4ZPVR 5K5MA 5HJXA 4DV2J 3F44A 2OTJS 1YJNS 1RWPB 3IWXA 2D1CA 2AJQA 4IG0A 3OL9A 1QY7A 1F1BB 3CNQP 3P49B 4CO1A 3SYZA 3ILJA 5KG5A 2L08A 2EKNA 4CO2A 2U1AA 2MKJA 4ERDA 5DGAA 5KFSA 4OLOA 1H98A 1FD8A 1U8WA 4DXLA 3TAMB 4NWBA 3OUYB 4O0IA 3KLHA 4LF9F 2ATLA 1OYDA 3QLHB 5RUBA 4JB8B 2IMWP 2MKKA 2YNHA 2HW3A 4IQMA 4F4WA 4KGKA 4WP9A 4B3OA 3CCQS 2HFZA 1EKSA 4B08A 3IBCB 2HGLA 3FSXA 3PO4A 3NMRA 4OHVA 2KT2A 2YWKA 3EGWB 3O2IA 5DJBA 3GV8B 4CCHA 1RU2A 1WACA 2CJYB 3BPSP 2BE2A 1OY9A 1WSVA 2ZZTA 3OLAA 1S48A 5A8WB 3EVWA 1JXEA 3NS5A 4CLTA 5I3UA 3MI7X 2ABYA 3G86A 4UOGA 2MQNA 3R5AA 4USHA 2GVDA 4M5IA 3R27A 2CQ3A 1NJWA 1KC8T 4MIWA 1VQMS 4MKVA 2GAGC 2CUYA 4QYZK 3HHLA 4PG4A 2EWHA 3DRPB 4J9PA 2KI2A 2OEJA 2YQ0A 4DG1A 2HVHA 3DLEB 3PKMA 1VHFA 3AJ2A 3G82A 1RWVB 3MEGB 1U6BA 1Y10A 1H38A 1NSKL 1KDNA 3JS9A 1O8BA 1R27B 4WKYA 1KVJA 2COLA 3GIRA 4DL5A 3V6JA 1HBUB 2NPFA 1WOOA 2POKA 3HO1A 3I0RA 4LFBF 3FK4A 3HULA 2LA6A 1ZAWA 2UUCJ 2IIHA 1WEXA 2ZHBA 1RTDB 2QRRA 4WFNQ 2QLXA 3L9ZA 3MEEB 2OPSA 4FKYA 4USWA 4MKYA 2V2KA 2VBZA 3KXDA 4Z2XA 5KFPA 1K0VA 3JSRA 4USMA 3I0SB 5J1PA 2KM8B 2O66A 2EBEA 3HT3A 4L6V3 4WU2A 4O4GB 3OL7A 5FDLB 4CO4A 1URRA 5L46A 4AL6A 1MN9A 2RNEA 3KG4A 4NA3A 2QFIA 4OHXA 4PCQA 1N48A 1NK8A 5D3GB 2B8QA 4OZ5A 5CD4H 3L95X 3R9LA 2RKIB 2CJQA 4P2SA 4F26A 4FF2A 2V8VA 1HPZB 1TR0A 4HVZA 3R5BA 3Q2TC 3GJQB 4QIVA 3O3LA 4AL7A 3HDSA 2HHTA 5J2NA 3Q83A 4JUZA 4MYUA 2GS8A 3MAAA 3DOLA 4LVOP 4U96A 3WX8A 3MD1A 4WTOB 4F3QA 5FIIA 1QLNA 5C24A 4FPRA 1S76D 4ICLB 4WPAA 3IAS9 1X4CA 4ED5A 4USIA 1NK7A 3ZNUA 2I9SA 1XNRF 2CPFA 1X60A 3AOBA 4BDPA 3A13A 5KFWA 1ZAVA 1S1UB 4WZMA 4ZVSB 2B51A 5F0WA 4H4MB 2R7XA 1WTFA 3EJMA 4X4QA 1RT5B 4X66F 2QSFA 2J7KA 2FVPA 3DXBA 2DNOA 2ACYA 2A2CA 4UW2A 3ELHA 3RZAA 2V8PA 4CH1A 1LW0A 2DGOA 4ZVOB 2YX7A 4N76A 2E29A 2UU9J 3H90A 3VAGA 2XMUA 1UVJA 2HURA 3ULHA 2MLZA 4DV7F 4ED8A 3LP2B 5F9NA 3ZZOA 5DLFA 2CQPA 4WK3A 4P71A 9ATCB 2PEBA 4G1QB 4K4UA 4IYQA 5G0RA 2IM3A 3HVTB 3AQPA 2LEBA 5DGBA 2AU0A 2GNKA 1PJ5A 4C98A 4DFKA 2XCPA 1XIQA 4Y2IA 3SFGA 1FKPB 1U8SA 3DLBA 3OTEA 3MAHA 1S1TA 2UXDJ 4M5KA 3O8WA 2XGPA 1Y11A 3D3BJ 2EC0A 1WOSA 4R5PB 5AJ3F 1NB2A 2EK1A 4M5LA 1QSLA 1WC6A 1MG7A 3I56S 4Q0BB 3D3CJ 1NPPA 4ECWA 3UWTA 1N32F 1UW9A 3CW2C 1M5VC 2FPHX 4CH0S 4PR6A 2V4JB 4L73A 4ZITA 4LF7F 4WFYA 4F0MA 3EMTA 2RUSA 2LMIA 1YJTA 2EKYA 2CPXA 3PACA 1XNQJ 1YWXA 4DCJB 3D6HB 3HFZB 1RTHA 3HHLD 2M88A 5HP1A 4GKKJ 5KFHA 4FVCA 2ZUGA 4OI6A 4CLPA 4EEYA 3TX8A 2XMVA 3QAEA 3FMBA 4DR1F 3HHLC 5EDWA 1R8PA 3D5MA 1WHWA 2HHPA 3W2WB 2J76E 1SV5A 2FGCA 1IBKJ 1SIZA 1FWLA 5AXNA 2G0IA 4ZJLA 3CC4S 4LBPA 1BQMA 2VG7A 3I4PA 4JI7J 3PNIA 1UEVA 3BREA 2DGVA 5HVFA 3LAMA 4FKXA 2B4PA 1VCTA 5D4OA 2F9JA 3OXGA 3V6DB 1R3NA 2WONA 5HSPA 2JL9A 4YEAA 1PBAA 1KHWA 8AT1B 3KLIA 1T03A 1S7HA 3QAUA 4O4RA 3VGSA 2YNGA 2YH1A 3W8GA 1XMOF 5LSOA 1O6XA 4TQRA 3ZNJ1 2H4YB 2MMYA 3LH2S 3HLUA 4KR0B 3J81U 2CZ4A 1HW9A 4IOBA 4DBQA 2AJ4A 1D1UA 2NQPA 2BRKA 1CJUA 1XMQF 3TWZA 4WFXA 4XPEA 3SCKE 1S6UA 5D0HA 5HQLA 3MPYA 3SCJE 3T1HF 2VFTA 3QZ7A 3OTOJ 2ACMA 2MGZA 1UW4A 4ZVQB 4JI3F 4RJVA 2ZDPA 4ED6A 2LCWA 1ULRA 3I6PA 1NK6A 2DITA 2AKWB 3PV8A 1WKJA 2NUUG 4B3MF 1RWWB 1RU1A 4WYWA 4KB7A 1PC4A 3TUZC 3N6NA 4ES3A 1EX8A 4HI2A 2J8AA 4G6VB 4KFBA 1S1XB 4ALZA 2RT3A 5ETLA 4OI1A 1JMTA 4OV1A 3UNGC 1QUVA 4DX6A 4ATNA 5E7OB 3QGPA 1N5VA 3D6MB 3TRGA 4DFJA 1L5UA 4ZLNA 5A2QU 4TNOA 1CJVA 3V81B 5C5JA 1VQOS 1VBXA 3ITHA 4TY8B 3TZYA 2VJVA 2JHEA 3PJWA 1S1VA 4TYBA 4X62J 4N7TA 1ELOA 2HWHA 1NK4A 3TJAA 1LWEA 2WHOA 3HZEA 1RT6B 1KQSR 4M5DA 3CUNA 3TUIC 5CCLA 3P8BB 1U2FA 3CCES 1U25A 2R8GA 1HMVA 3P4UB 3DLKA 3ZTRA 1ZA2B 1CPZA 5GMDA 4YQWA 3M05A 2YKOA 3CJ5A 2GV1A 1FERA 2EFOA 1FRIA 5B0CA 1FJ7A 2OEMA 1HWLA 3N5BA 1HI8A 1M5HA 4P52A 5T7LB 3W1YC 5HLFB 4CRJA 2MZJA 1WC0A 5KFYA 1N36F 2GHPA 2N4DA 5IQ6A 3DGPA 3MPVA 4NOHA 2XNRA 4FNHA 5THWA 4NLQA 1U1RA 5KFFA 4LF8J 4LSLA 1AUDA 3T5JA 5KT5A 3M2UB 2ZH9A 3GFXA 3BBBA 2RUGA 4F25A 4Y3CA 1N5TA 4ZPDA 2NYIA 4DR3J 3JXOA 2MZTA 1VRUA 1RUSA 3OT9A 2VKRA 3PR5B 1WKKA 1UVNA 4FVMA 1N4LA 4BWJA 5CYQA 2KJVA 3EGZA 4EWTA 2QMUB 2D3OR 4F4ZA 4IRDA 1PYTA 2MEWA 3VAKA 1XEZA 3UN3A 4DF4A 4P72A 3NL0A 4D3GA 4DV1F 3A1YG 3QGGA 4C8KA 3DXSX 4O3OA 2EI5A 3I5BA 5H9EK 3THPA 3VWSA 3NAHA 4TXSA 2E5HA 4WWSA 4CT9A 1QSYA 5GAGU 5M2PA 5A8RB 3G2XA 1U24A 1DY3A 3VAIA 1MLAA 4M5NA 2RVJA 5KFJA 2DISA 1WDDA 3PIPQ 2ZH2A 2KZZA 4F4KA 3U1LA 4OX8A 4RUBA 4DR7F 3T41A 4H4OB 1ZM9A 1ZTWA 5G4DA 1JLGB 4DQQA 8RUCA 4CTAB 2NZCA 2PSZA 2XZDB 4GVBA 4X65J 4MAKA 3AXMA 1C1BB 3PTWA 3NBPA 3MCOA 4NE9C 4ED2A 2OPRA 5T41A 3GSDA 5FLXU 2CIMA 4KH0B 2H5IB 4K2JA 1N5SA 4LREA 4K50A 2PC6A 3M1VA 1CJTB 2OIHA 2DHAA 2PIIA 1QAXA 2CQIA 3WQPA 4DU8A 2MKCA 1Q82T 4RW9A 5ETQA 2HQFA 2PN6A 3RG6A 3AA9A 1ZM3A 2ZH8A 3LA0A 1HBMB 4PWWA 2M8HA 4ZVPB 5KFVA 1VQ4S 2BJDA 1OPZA 3H7HB 3TVKA 3MMCB 3K89A 4MFBB 5F0UA 2DNNA 1L3KA 4HT5A 4CI0B 3RGIA 2XBPA 3LALA 4ED3A 1YJWS 3CDBA 2ASDA 3ENWA 3E51A 3ZZZA 4F2SA 3ZZUA 2K2PA 4RW8A 5K14A 1RE1B 3BGFA 1PYSB 2FUG9 1RBAA 1LWCA 2BQRA 4WBFA 4WJBA 1HNZF 4NLTA 4NLRA 2QN6B 1U49A 2IHR1 1DQAA 4I7FA 1ROFA 1HBOA 1VJWA 5U47A 3BQ1A 2L41A 2BA9A 1YDLA 3QT8A 1S9EA 1JLQA 5FLXY 1XMBA 5D77A 1X5OA 1LW2A 5GMEA 2DEIA 4TQSA 2FDNA 3IG1B 1QAJA 1HKAA 5D4LA 3KLFB 2HNZA 3FCWA 1FX2A 3HSGA 1DRZA 4LSNA 3OQ2A 5ITHA 1FFGB 1SKRA 1RT1B 3HP6A 4EYHB 5DRKA 5GVQA 3S1TA 3JSMB 4FBUA 1YRXA 3AA8A 2KXFA 3IN5A 3W5XA 1NLKL 2LECA 1NH7A 2R7QA 1HWUA 2BJ1A 3P5BP 5HMYA 2YWGA 4QYZJ 1S5ZA 3M30B 2L9NA 3HCXA 4C3KA 2Y0SD 1IKYB 1WHVA 3W5YA 3PX0A 1Y5IB 4X64F 1G1XA 1VISA 4WTYA 1VI7A 3EWGA 4EI2A 4DOZA 2KHDA 2WOMA 4OYMA 4N5SA 3GLJA 4PG8A 4OZJA 3BYPA 1FEHA 5IQQA 2QYCA 5KFRA 4NLXA 1LWFB 4C8YA 4J9NA 2LP4A 4TLQA 2PFDA 4N56A 2JEIA 2YPYA 2MYFA 2XMKA 4K4YA 4JI2F 1JX4A 1GK8A 3ISZA 4WP8A 2OPQB 2DXFA 1N6QB 4BWMA 4JI1F 1S97A 1U1KA 3NLCA 3TQ1A 1BQNA 2ROEA 2XYGB 4IDKB 4NCGB 1APSA 2OHDA 1G4CA 1NO8A 2VASA 4RLEA 4IG3B 2NSCA 2OD6A 4USUA 3ETOA 2ZH7A 5J1EB 4KKOB 1OWXA 1UVKA 5CABA 2I8EA 5KG0A 1VJQA 5DQIA 3CDUA 3NCPA 3T6JA 4EO8A 3JB9k 2OP5A 1TK5A 4DPOA 3QWPA 3K8VA 2Y0BB 1JK9B 2G0CA 3V4IB 2NYHA 1M1GA 1FO1A 2F8MA 4I67A 4IUFA 1RHJB 2VDIA 5B0DA 3OSNA 1IM6A 3UO0A 2LEAA 2PI5A 3BGLA 5I3PA 3SV4A 3TJ9A 1S6OA 3BO4A 2X1BA 1G2EA 2XMWA 5CD4A 3HMJG 3JQMA 3PX6A 2PGCA 4ZP9A 4DS4A 1QE1B 2MKHA 2J7WA 1TU0B 3DCAA 3PKYA 1TV6A 2FYXA 3J80Y 4UY85 1UWBA 5BYSA 3JTOA 5LL6d 4HDGA 2W2OP 2QO3A 4CLLA 1EP4B 2NPIA 2LEPA 1BE4A 3GG1A 1RLCL 1NK9A 2VFUA 2ZH3A 3N6MA 2BQUA 3G9CA 2OSQA 2IFXA 1TKXB 2B8PA 2FB0A 1VLOA 3HM9A 4WE1B 1RWUA 6FD1A 4BC7A 5LXRA 3QJPA 2YWFA 1Q5YA 2E5LJ 4DUZF 2R7TA 1ZM4A 3EDRB 3NNAA 4K8RA 5J2QA 4X4TA 1FFWB 2HQ3A 3PFEA 3D66A 3M6VA 5L9XA 3RB0A 2V2VA 1RQ0A 1OQ6A 5HK4A 1WSRA 1RTJB 4RU2A 3PJXA 4QPXA 5DG8A 4LMZA 2W4CA 2HQGA 4DQSA 1QSSA 2P9EA 1SJ3P 1TL1B 4ZVTB 1S1WB 4K4WA 1QVFR 1YTYA 4DCOB 3C6TB 4UOHA 1T0TV 2BANB 3U1MA 1VRQC 3IR6B 4NZ7A 4LF9J 3VQTA 2RMLA 1C4CA 7FD1A 1SL1A 2ZWPA 3MUMP 1GEHA 4ZMMA 5E3RA 1J5EF 3G6YA 1EKRA 4JI4F 5KFGA 2AZ3A 1YZ6A 2AT1B 2BQ3A 3CCTA 4RUCA 2GQCA 2W8LA 1FJCA 4AT1B 2MZ1A 4M5GA 2RS8A 5IC4B 3Q8YA 2Q79A 4ID5A 3MM8B 3J7Z5 5H9FK 2BW2A 1S7IA 3UE2A 3EE3A 5B0BA 3VR1A 1OY6A 4ECVA 2X51A 2KO1A 2JVRA 1HQUB 2R7VA 5ETNA 2MTLA 1JXLA 4ZLPA 4WZQA 4NEZA 4PRFA 3T5KA 4RR5A 3IRXA 5J2MA 2UUTA 3CO0P 1RB0A 3PHEA 1EETA 1JKHA 3KHGA 2Y1LB 3PRDA 4V19X 2RRBA 4J9VA 3D7SB 1YI2S 3BKUA 1UPPA 1UJ6A 2ZBQA 1UMJA 4IFYA 1WWHA 4ZIWA 3PYGA 2YY3A 3OFHA 2LYVA 3H5XA 3D1OA 3ENAA 2MKSA 3ZTQA 2OFHX 4AQYF 3GILA 4Y28C 4QWAA 4LFBJ 3NNHA 1XK8A 4M5JA 4WF9Q 1C0UB 5MLCV 3EPIA 3NNCA 3NKYA 2DNLA 4N8NA 2DTJA 3OD2A 4XK8C 4B3OB 4ZLJA 4MK8A 5CZVA 2LLZA 2OEKA 2R9LA 2Z58B 1N54B 1SBRA 4M63A 3C3LA 3ILIA 4JBCA 3GV7B 4OJGA 4Q5VA 5CA5A 4K2XA 4DR2F 2HQIA 4MIBA 2OFGX 2BE2B 4C7QA 1NB7A 4YB6A 1N5YB 4M95A 2ALZA 2GQQA 4WIQA 1UEKA 3OL8A 3HK2A 2KVIA 2W25A 3CCLS 2SXLA 2ZC3A 3F73A 1RKJA 3BBCA 3VAJA 2VQFF 5A0YB 5SUHA 4DUYF 3H4DA 2K1RA 4JI6F 4QYRA 2WSFC 2HWTA 5HBMA 4J9SA 4M1KA 3BDPA 3SMZA 5C2CA 1W7WA 3K5NA 3G6VA 4BC9A 2YKMB 1UJ5A 1QM9A 4I56A 5HROA 3A8JA 1KN6A 2B6AA 4P7TA 2XMAA 1A7GE 3OL6A 1CC8A 4CLUA 1FA0A 3QRPA 2H3EB 1SCJB 4RWWA 1UWAA 2MZQA 3CD0A 1U0HA 2FTRA 4MMOA 2DK2A 1XNRJ 1JWWA 4HYKA 3O6QA 3E8OA 2KH9A 1HNVA 2CAJA 2ZD1B 1X4FA 2RILA 3RB6A 1KR4A 1UVMA 4X66J 5HANA 4FXWA 4UQGA 4IOCQ 5GADI 3BGRA 1EIYB 3DI6A 4IR9A 4OL8A 3AY0A 3CIMA 4YP3A 4ZJQA 4F0KA 3OR2A 4OX7A 4OYWA 4PQUB 2W7OA 1TK8A 2D3UA 4P6QA 2NLWA 2AJFE 3LO3A 4DV7J 3IWLA 3VGTA 4ECXA 3PR4A 2JLFA 3CJ0A 2BOAA 2GC8A 1N0VC 2QLBB 1T3NA 1UFKA 4JI0F 5JMNA 5BXIA 4OZ3A 2CQBA 3CC7S 3KK3B 4OX6A 4KSEB 4QIWD 2GVZB 4K0KF 3D1QA 3QBCA 1KONA 4ED0A 3DHXA 3M2VB 3M8QA 4OYAA 3H20A 1WC3A 4RW4A 3NGRA 1C4AA 3G71S 2HNYB 3D28A 2D3ZA 4Q2LA 1OS5A 2XSFA 2IM0A 3GONA 3PEHA 1SH3A 2W2MP 1Y3JA 3FCVA 1N88A 5AJ3J 4GVLA 1QTMA 1OMSA 2VPWB 4CYUA 4OZ0A 5C24B 1N32J 2CDRB 3MM9B 4UY8T 2ZM6F 3BZQA 3DRSB 2V4QA 3IBFB 2UUAF 3C2PA 4W4MA 4PABA 1C1CA 3MHYA 4FS2A 1IKVA 1PAUB 4LF7J 2N3OA 4CIOA 3IAM9 2MLYA 1BY9A 3GU0A 3R97A 2IAJB 5GAHU 2B56A 5KFDA 3PY8A 2CJAA 1IR0A 3RRKA 3PYEA 5HO4A 2HGMA 3M2RB 1IBMF 3OLBA 2HHUA 2OAUA 1WF2A 3E3XA 2XLKA 1X4HA 5L1JA 4ETXA 2WTFA 2HHWA 1NHUA 2QA2A 5DS7A 2K7JA 4YB7A 4G65A 2XWYA 4LRDA 4DR1J 3SZ2A 5KT2A 1AZSB 1HR0F 1GH8A 1S99A 3M8YA 1RTIB 4I2QB 2JEJA 1NCLA 3EGNA 3HPOA 1NKBA 4PXDA 5T14A 1OIAA 1WC4A 5H9EJ 4CT8A 1K9MT 3MR7A 2R2RA 2XHCA 3HHDA 4EGLA 1X9WA 1DZ5A 3SDEA 3Q8UA 1TKZB 4ZHRB 1RYSA 2DY9A 1M5OC 4FYYB 3W2VA 1ZOTA 4LF1A 1XN9A 3LW5C 4A47A 5KFNA 4ZCIA 5E41A 1S1TB 1FXDA 1TELA 2G1DA 2IC3A 1HHSA 2GJIA 4YS2A 1X31C 3I82A 3HD1A 4PXCA 1HNWF 3BH7B 5F8GA 4GC7A 1XMOJ 1RXOB 2KRBA 1IM4A 2HAIA 2ZUAA 4U6PA 1SJ4P 4R8UA 2X1AA 2ZOGA 1E6VA 2V50A 2OKQA 1REGX 4G1IA 1NMEB 2DGUA 1H73A 3ET6A 1XMQJ 2IY5B 3SQGB 1MWYA 3T1HJ 4RKUC 2J6SA 1I94F 4N8OA 2RH3A 3L7OA 2H5JB 3FFIB 1LNQA 2Y1RI 5B0FA 4JI3J 4HH0A 2ALYB 3PIOQ 2ZHAA 4DV4F 1D9AA 3TJ8A 1B0TA 2BUNA 2WB4A 2YNIA 3IS9A 1PBUA 2RQ4A 3GP9A 1FWPA 1KLMA 2AEMA 1RT7A 4B3MJ 3DDKA 4I68A 1RTZA 2Y1JA 3LP0A 4RL1A 3UR0A 3KJQB 4QOTA 1DLOA 1FNMA 2I6WA 1LEOA 4MH8A 3GMGA 2DNGA 5KG6A 2FJXA 2YQ1A 4ED1A 2L9WA 4DHVA 4D3HA 2IYGA 2FJBB 1Q0NA 2A6MA 4OX9F 2VG7B 2B4VA 3HX9A 4ELUA 4TLRA 5I42B 1U02A 3HJFA 3MECB 4ZIVA 4LF6F 3BSAA 2PMWA 4PUOB 4EBEA 4EMDA 1F60B 2DBBA 3FSIA 2E5IA 3ZZ0A 4ID8A 2QFJA 2CA9A 3HXMA 1GTEA 4NXMF 2GHWA 3H4BA 3KMSA 2YNGB 3M8ZA 3PDNA 2RS2A 1RT4B 4UT4A 4LR7A 3K8WA 5JJBA 2AMCB 4EBDA 1ZBTA 2IJFA 4DJBA 5KTQA 4DR4F 1Q95G 2UP1A 1VRTA 1TZ0A 1RADB 4RNHA 2XY7A 1WHXA 1T05A 5F8JA 1RACB 2CPJA 5J2PB 1FCAA 2H48B 1VIXA 4IH5A 4GMKA 4HT7A 1S49A 3BSOA 5HN0A 3CCJS 4B9NA 1XR7A 2G0JA 3UCGA 3UCZP 2HFSA 3DOKA 3ZZRA 2G1HA 1UL3A 4ES2A 4CNZA 4RX6A 3X3UA 1SQGA 4K4SA 1M0SA 3BKTA 5ETPA 1N36J 4C11B 3VAFA 2HVZA 2X1FA 2BKPA 4PPZA 3GIJA 5CQGA 2VDHA 2PEHA 2XS2A 2Y9HA 3THTA 1RYRA 5C42A 2B4OA 1HD0A 2XTJP 5B0GA 1CSJA 1RT2A 2Z2LA 5JUMA 1AXQA 2DH7A 2HK2A 4TKTA 3UI3A 3J81j 3EZOA 3K5MA 3PO5A 3NOGA 1VIOA 2UZAA 3MDFA 3OXLA 4DR5F 1FFSB 3DYAB 1U6FA 3M6UA 3QSIA 2D9OA 2BKOA 4KTQA 3MZIA 3B6BA 4JOUA 1T9YA 1LWEB 1MROB 4DV1J 3W3SA 2JVOA 2YKNB 5JVHQ 2EEYA 4YHHF 3PX4A 4JV2A 4RW7A 3PW7A 1DQ8A 3Q89A 3OTCA 1Q81T 2NCKL 1REVB 3TARA 3C6UB 3FQKA 3GQCA 3LAKA 3CWJA 4S0MA 4OYZA 2RDIA 3MEDA 3DRRB 3KUGA 4EK2A 2LVWA 2WCXA 2UVUA 2HRUA 4DV6F 1U1OA 3QZ8A 3PG9A 1H7WA 2ZBIA 1OPIA 1T7PA 4YR3A 3CDEA 5IWAF 4U7CA 5D0GA 4L72B 2LXUA 4X84A 3R5DA 1WUUA 4DR7J 1WG1A 1VOMA 2AGPA 1NJZA 5EHHA 2MB0B 3DC2A 3RUBL 3UCUP 3MM5B 2MQLA 3DRYA 1GMVA 2P2CB 2ZWOA 2CWKA 1TL7B 4FYXB 1F3FA 2Q43A 2VOOA 3WIVA 5SZTA 1EJ7L 2F4VF 1L3UA 2XQCA 2NXUA 1BUXA 1Z2ZA 3DGVA 4URQU 4KJIA 3AB4B 3AOAA 4RW6A 3LP1A 1EQMA 1PAEX 1EB0A 4Q8FA 5BYQA 1X5TA 3IM9A 4C8NA 3CCMS 3FBCA 1YIJS 2QLJB 2XLJA 4QWBA 3US5A 1JLAA 2FJAB 3MMAB 4BHQA 1T8EA 4LBIA 1N34J 1JLCB 1ZAXA 1F2GA 1UZHA 1HNIB 1IWGA 5KFBA 2DR5A 3GJSB 1N33J 4W92B 4RZRA 1IJFB 4HDHA 2R7WA 4OZNA 3KLEB 4RWXA 1PILA 1SQFA 4WK1A 2HNDA 1U1QA 2VFSA 3BV8A 3R5JB 3E2EA 2HIQA 3M8PB 3KHRA 1R6VA 1X5PA 4UTGA 2HBYB 3D54A 3OR1B 2VQEF 5F8NA 4E0DA 1RGVA 4NRTA 2ROPA 1KTQA 5H9FJ 4FYVB 2KVQE 4ECRA 2PMHA 4C8ZA 1JLBB 3TAMA 2BBEA 3OUYA 2CG4A 4A46A 2XMTA 3D68A 2O3DA 2DGXA 4AD6A 3HZGA 3UVJA 3M1VB 2DH9A 4IFVB 1WTBA 1WDTA 4RW9B 1XJWB 1O51A 2DEJA 4YB1P 2C2EA 2W4DA 1GMUA 4DZDA 2P5VA 1M90T 5FJ4A 2JC1A 2IBKA 5DG9A 5A8WA 4B02A 3R2DJ 2HHVA 1TKTA 4JI2J 3H5SA 5L1IA 2AEJA 3QPIA 2V2QA 4ZPAA 4RW8B 4JI1J 4A8KA 3T5LA 2NXJA 1VQKS 5B0AA 2FD2A 5IM0A 1KP6A 1G3OA 3EGVA 1YBAA 2VB6A 3DRPA 2OMLA 2MSTA 4J9QA 3FC9A 1OY8A 2DGTA 2DGWA 2R2SA 1IWAA 4O0NA 2EG1A 3DLEA 4QIGA 2HQDA 4TN2A 3QRQA 3M32B 4GC6A 2E5GA 1RSCA 4ZS6A 5HMZA 3MEGA 4ECYA 2HNZB 3G6ES 3T1AA 2EVZA 5DQHA 5KT4A 4DPYA 3GIMA 1TMJA 3DLGB 3FZBA 3H5UA 2GIQA 1HBUA 5E3PA 1OO0B 1KTVA 3LGMA 4OMFG 1NUEA 1FNXH 3MOJB 1HI1A 3K5PA 4QWDA 2BYCA 4IOAQ 2FVRA 2RE1A 1RTDA 2EFQA 1LK5A 2W9AA 3CMAS 3MEEA 2F8HA 1P9QC 2BXJA 1WI8A 4ZN3A 3RR8A 4X4SA 3ZZPA 1QUPA 3I0SA 2W9BB 2RDDA 4O23A 2BJ3A 4IR1A 4U7UD 4E8UA 1U4BA 1WEYA 2EG2A 1Q4RA 2MQOA 1WG4A 5D6GA 5FDLA
chains in the Genus database with same CATH topology
3R7BB 1PAUB 2H5IB 2Y1LB 2QL9B 4ZVOB 2XYHB 1RHQB 3EDQB 4LSZB 3NS7B 3R6GB 2XYGB 3R6LB 2QLBB 4JB8B 1BMQB 1RWVB 2CNLB 3GJTB 2CJXB 1RWKB 1IBCB 1F9EB 1RWMB 1RWNB 1RWXB 2H4YB 1NMEB 2QLFB 3D6MB 4ZVPB 2QL5B 3KJNB 3IBCB 4DCJB 2QLJB 3D6HB 1QTNB 3GJQB 3R7SB 1RWOB 4DCPB 1GFWB 2QL7B 2H65B 1PYOB 2H4WB 2C2ZB 2CJYB 2H5JB 2C2MB 2C1EB 1RHKB 5IC4B 1RHRB 3EDRB 2XYPB 2Y0BB 1I3OB 3RJMB 1RHUB 2HBQB 3GJSB 2C2OB 1SC3B 1RHJB 2H48B 2HBZB 4ZVQB 1I51B 1RE1B 3D6FB 3KJFB 2DKOB 1SC4B 2P2CB 2FQQB 3SIPB 1RWPB 3GJRB 1RHMB 3P45B 3P4UB 1SC1B 2XZDB 4ZVTB 2CNNB 3KJQB 2H54B 4ZVRB 2H51B 2CDRB 4ZVSB 1RWWB 3R5JB 4DCOB 3QNWB 1QDUB 2CNOB 5IC6B 2CNKB 2XZTB 5K20B 2HBYB 2HBRB 3IBFB 1ICEB 4ZVUB 2C2KB 3R7NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7B B;  1PAU B;  2H5I B;  2Y1L B;  2QL9 B;  4ZVO B;  2XYH B;  1RHQ B;  3EDQ B;  4LSZ B;  3NS7 B;  3R6G B;  2XYG B;  3R6L B;  2QLB B;  4JB8 B;  1BMQ B;  1RWV B;  2CNL B;  3GJT B;  2CJX B;  1RWK B;  1IBC B;  1F9E B;  1RWM B;  1RWN B;  1RWX B;  2H4Y B;  1NME B;  2QLF B;  3D6M B;  4ZVP B;  2QL5 B;  3KJN B;  3IBC B;  4DCJ B;  2QLJ B;  3D6H B;  1QTN B;  3GJQ B;  3R7S B;  1RWO B;  4DCP B;  1GFW B;  2QL7 B;  2H65 B;  1PYO B;  2H4W B;  2C2Z B;  2CJY B;  2H5J B;  2C2M B;  2C1E B;  1RHK B;  5IC4 B;  1RHR B;  3EDR B;  2XYP B;  2Y0B B;  1I3O B;  3RJM B;  1RHU B;  2HBQ B;  3GJS B;  2C2O B;  1SC3 B;  1RHJ B;  2H48 B;  2HBZ B;  4ZVQ B;  1I51 B;  1RE1 B;  3D6F B;  3KJF B;  2DKO B;  1SC4 B;  2P2C B;  2FQQ B;  3SIP B;  1RWP B;  3GJR B;  1RHM B;  3P45 B;  3P4U B;  1SC1 B;  2XZD B;  4ZVT B;  2CNN B;  3KJQ B;  2H54 B;  4ZVR B;  2H51 B;  2CDR B;  4ZVS B;  1RWW B;  3R5J B;  4DCO B;  3QNW B;  1QDU B;  2CNO B;  5IC6 B;  2CNK B;  2XZT B;  5K20 B;  2HBY B;  2HBR B;  3IBF B;  1ICE B;  4ZVU B;  2C2K B;  3R7N B; 
#chains in the Genus database with same CATH topology
 2DCU B;  2CPY A;  4M5H A;  4I2P B;  3SBM A;  1LWX A;  3NWR A;  3FBF A;  1LOU A;  1BHN A;  2RKI A;  2CPD A;  4I6A A;  1DTT A;  2WBM A;  1XR5 A;  2FHM A;  1HPZ A;  2C2R A;  1W25 A;  3GR1 A;  2WK4 A;  4DUZ J;  2ZVI A;  1U2C A;  2D41 A;  3NGD A;  2GCF A;  2KL8 A;  1S6P B;  3FUY A;  3WZ0 A;  4B3S F;  5M2R A;  4CLK A;  1D8Z A;  4K4X A;  1FK9 B;  3AOC A;  4HHJ A;  1X4D A;  4IO1 A;  4USV A;  5BR8 F;  2P9C A;  3QSY B;  3OJU A;  1KVK A;  2PMZ D;  4QZV B;  2X3D A;  4ICL A;  2J8S A;  1KBR A;  4H54 A;  4RBU A;  3NWG A;  1MU2 B;  5F8H A;  3MGJ A;  1S1U A;  2JNJ A;  3UD5 A;  5DM7 Q;  4NLY A;  2MJN A;  3QNW B;  2D9P A;  4IQX A;  3KKF A;  3I9Z A;  3FKB A;  3I32 A;  2LXF A;  4H4M A;  1RT5 A;  3T9N A;  2RRA A;  1HQE B;  3IXQ A;  4I4B A;  4BLG A;  1KS2 A;  2YPZ A;  1S0M A;  1NZA A;  3QRR A;  5IT9 Y;  1M5S A;  1IQT A;  1WD6 A;  4ED7 A;  1U6Z A;  3R6G B;  4B9U A;  5GAG I;  1K1Q A;  3R6L B;  3DFE A;  3GJT B;  5A8K B;  3R3T A;  4C2M A;  4QW9 A;  2CZ9 A;  3LP2 A;  4YUD A;  2V8D A;  3C14 B;  3ZXW A;  2ZDO A;  1CJK B;  4XTT A;  1QTN B;  4A4J A;  2HAF A;  4G1Q A;  1VYA A;  3HVW A;  5ETT A;  1RAI B;  3HVT A;  4NPO A;  1G7C B;  4J9O A;  2QA4 S;  1ZZN A;  4O3P A;  3PZP A;  1BC6 A;  2AJ0 A;  1MMN A;  2VBW A;  1IN0 A;  4ZPC A;  5DDO C;  3CCS S;  5AE1 A;  3POT B;  1U1P A;  4ZKA A;  1YQH A;  3ISN D;  1NND A;  1FKP A;  3C15 B;  4DU7 A;  3UN2 A;  1CS4 B;  4ECQ A;  4JI8 F;  2IA0 A;  5B08 A;  2ZKT A;  2FLO A;  2JJ4 D;  4NLO A;  4R5P A;  2R2U A;  3ISN C;  4F8R A;  5K20 B;  1F5B A;  2VPY B;  3TYT A;  4Q0B A;  1KKH A;  3N6L A;  3DOM A;  2UVV A;  2R7S A;  3Q86 A;  4ZN1 A;  3CGI A;  2BE7 D;  3LUY A;  2ZEJ A;  4EBC A;  3HHE A;  4ECZ A;  2V4J A;  1WKL A;  4TY9 A;  2NXE A;  4WXO A;  4QPT A;  2YKP A;  2QIF A;  2QEX S;  2WVE A;  3P96 A;  5CHC B;  1HW8 A;  1RBO B;  1NJI T;  2W7A A;  1VC0 A;  4ZJO A;  2J9D A;  2GML A;  2HS0 A;  3GYG A;  2C28 A;  1T94 A;  1FNO A;  1DAX A;  4F4X A;  1FXL A;  3FBE A;  5KG1 A;  2CWX A;  1R8B A;  1VS3 A;  2B9Y A;  1MW7 A;  4F4Y A;  4DR2 J;  4I6W A;  4DSE A;  2PD1 A;  4QCL A;  3BO3 A;  1Y4Z B;  3WIU A;  1JJ4 A;  4QBU A;  2HK3 A;  3W2W A;  4CWB A;  2WRM A;  2ZBC A;  1F3V A;  4PAA A;  1FJE B;  4HTI A;  4GKJ J;  2VQF J;  3GE9 A;  2CQD A;  4A8W A;  4DUY J;  2JWN A;  4X2B A;  4PZV A;  2VA2 A;  4JI6 J;  1S4F A;  4C8O A;  3R7N B;  3MEK A;  3V6D A;  2DNH A;  1S59 A;  3AD9 C;  4U95 A;  4URG A;  5CYM B;  2GA7 A;  3T5H A;  2FC9 A;  4N47 A;  3V5R A;  5LOQ A;  5EWF A;  1KQF B;  1RJJ A;  3S8S A;  4ANC A;  1Q16 B;  3CCU S;  3QT7 A;  2R7R A;  1JKH B;  3AD8 C;  1YHQ S;  3M6W A;  1VQL S;  3VVT A;  2XSJ B;  1R8H A;  4JYA F;  1S6Q B;  1S77 D;  2K7K A;  1Y7P A;  3M8W A;  1ZA1 B;  3EXY A;  2YWE A;  1NDP A;  3OBI A;  2VHG A;  2KM8 C;  2MDA A;  1ZYQ A;  2HS3 A;  3H0P A;  3JQJ A;  1SC3 B;  3CC2 S;  3PW2 A;  4G1P A;  3HVR A;  4NYP A;  1XNQ F;  3GJR B;  4DL6 A;  4K7Q A;  3L4B C;  4OYP A;  1FDB A;  2E66 A;  1JB0 C;  5IC6 B;  4DX5 A;  4NYO A;  4KH1 B;  4TU7 A;  5KT7 A;  4KO0 B;  4JI0 J;  1S1X A;  2DXE A;  2HS4 A;  2OTL S;  3MR3 A;  2FY1 A;  4PG6 A;  2HSE B;  4OI2 A;  2WBR A;  3Q2S C;  4L3K A;  2BMB A;  4K0K J;  2FHJ A;  1RWX B;  1RAF B;  1M5P C;  2K1R B;  1N8R T;  3DM2 B;  1PSD A;  4XAK A;  1HL6 A;  1FVQ A;  3V81 A;  2QL7 B;  1N52 B;  2E9Z A;  3RB4 A;  4CH7 A;  1PYO B;  2G2Z A;  2NSB A;  4TY8 A;  3OFE A;  2Q66 A;  1NU4 A;  2GHV C;  1A9N B;  2C1E B;  1UA0 A;  4P75 A;  1UAW A;  1I3O B;  2B6A B;  4FXV A;  2XI2 A;  4RUA A;  1GQE A;  2J0X A;  2RHS B;  1B99 A;  3MAQ A;  3NRB A;  1RT6 A;  1UPM B;  4I1T A;  3TEH B;  4FBT A;  1OSC A;  1IKW B;  2CQH A;  3CXC R;  2CJ9 A;  4DLE A;  3IP0 A;  2ZM6 J;  1Q53 A;  3PW4 A;  1HI0 P;  2JFK A;  2EFG A;  3E01 B;  2V69 A;  3OTB A;  2UUA J;  4J37 A;  2AGQ A;  3LWL A;  1UTA A;  1TQL A;  3IWN C;  3KWM A;  3TA2 A;  2N3L A;  3UW1 A;  2ZHO A;  3M4X A;  5T7L A;  1IBM J;  3TAP A;  1RHQ B;  5GMK a;  2FHK A;  2F8E X;  5HLF A;  3KDN A;  1UET A;  3VAH A;  1Y5N B;  3F0N A;  4LR9 A;  4E98 A;  2V5H G;  1HR0 J;  1KQK A;  3A12 A;  2Z2M A;  1X4G A;  1Z2L A;  4Q8E A;  3ZZY A;  3J7A N;  3M2U A;  2N7C A;  2O67 A;  2X3G A;  2BAB A;  2N82 B;  2HZC A;  3WBZ A;  1SQE A;  3FEZ A;  2ZVS A;  4ZVG A;  2RHQ B;  2DIU A;  1VLY A;  2DNP A;  2B9E A;  4DZ6 A;  3TA0 A;  2QYG A;  4DF8 A;  2W2Q P;  4DSJ A;  1WF1 A;  3MMB B;  2HQC A;  1YGY A;  4Y0F A;  2ZNZ A;  3OV7 A;  2K3I A;  2JZ5 A;  3GB0 A;  1HNW J;  1HAR A;  3W5Z A;  1RBL A;  1IUJ A;  1FES A;  5F8M A;  5CAA A;  1PGZ A;  4HLB A;  2GIR A;  1FJG F;  3KFW X;  1TMM A;  2HFO A;  4AND A;  2IPO B;  3DNC A;  4USK A;  1M1H A;  1RAG B;  1TUG B;  1NRK A;  3BB5 A;  2KG1 A;  4C0O C;  1U0S A;  4V1A k;  3A8K A;  4ZK7 M;  2XB2 D;  4HEA 9;  2P6T A;  3UDE A;  3M9O B;  1PIE A;  4F3O A;  2F1F A;  4RNO A;  4YY3 J;  1B7F A;  4DV4 J;  2J9E A;  4HAC B;  4RBT A;  4A8Y A;  2R4F A;  2VG5 B;  5DG7 A;  2L48 A;  2F5G A;  3GSI A;  5HAO A;  4MKB A;  4OJH A;  3V4M A;  1SUQ B;  4H4O A;  1S12 A;  1JLG A;  2BM0 A;  3RR7 A;  4OQJ A;  1LQ9 A;  4CTA A;  2NXC A;  3RBZ A;  2E7X A;  4OX9 J;  1C1B A;  3PYF A;  3R5G A;  1RAO A;  1X7V A;  4LF6 J;  4DR3 F;  4W98 A;  3KNG A;  4JI5 F;  1KOO A;  2IVM A;  2YWH A;  4CO0 A;  2CJK A;  1CJT A;  3TNV A;  2P6S A;  1X5S A;  5ADZ A;  3UD3 P;  3J7Y U;  3RW6 A;  4DL4 A;  4NXM J;  3BQ0 A;  3G8T A;  1EHW A;  1TVR A;  3G6X A;  1HBM A;  3C19 A;  4DR4 J;  4KHM A;  3AH6 A;  2XHW A;  2AP6 A;  3MMC A;  4A8X A;  2B0G A;  2C2M B;  4MFB A;  2HHQ A;  3I55 S;  2AYM A;  2IMO A;  3KJV B;  2VFR A;  3H42 A;  2VC0 A;  4R0E A;  2FHJ D;  2PT0 A;  4ZP8 A;  2AF6 A;  4M8L A;  2VA3 A;  2RF2 B;  3TP2 A;  5KFC A;  2HVE A;  2H54 B;  2QX0 A;  4OI4 A;  1GMW A;  2KYZ A;  1UVI A;  2A2D A;  2HGN A;  4YN3 B;  3DDI A;  1KLM B;  4O3R A;  1KLN A;  1RT7 B;  2VG6 B;  3UDL A;  1SJF A;  1FXR A;  4C4W A;  3V2U C;  2VF3 A;  4C3M A;  3IG1 A;  3KLF A;  4MIA A;  3CTR A;  2EFP A;  2IDE A;  1RT1 A;  1XQI A;  2O5D A;  2RB7 A;  2GW8 A;  4NZ6 A;  4ZOS A;  5EUH A;  3JSM A;  4E2F B;  2RQM A;  2KJW A;  2DVI A;  1F6T A;  3B78 A;  4JP8 A;  3IR5 B;  4KV8 B;  1PCA A;  3NCQ A;  3MXH P;  3MPW A;  4Z37 A;  1NSP A;  1FDD A;  4ER8 A;  1UFW A;  3TZW A;  4DR5 J;  5E3A A;  2J9D E;  3M30 A;  2E7V A;  4F7V A;  3RJM B;  3NGT A;  5LT5 A;  3JYT B;  1IKY A;  1Y0H A;  5B09 A;  4Q45 A;  3DMJ B;  1VBZ A;  4DWI A;  2VJU A;  1NHV A;  1NBE B;  2V2Z A;  4GRS A;  4YHH J;  3VGV A;  3T1Y F;  5KOW A;  2M7S A;  5KAK A;  5KFZ A;  2HWI A;  1LWF A;  3QO9 B;  5LMU F;  1RI7 A;  1MMD A;  2CVI A;  2XZT B;  2UVR A;  1BGX T;  4J9L A;  2NXN A;  3KLV A;  1ZTT A;  2FGO A;  3MM6 A;  1X4E A;  2FIU A;  1FI4 A;  1JLF A;  2OPQ A;  4DV6 J;  4Y65 A;  5HMW A;  3IM8 A;  2DH8 A;  2Z8Q A;  3G87 A;  3N9U C;  1M5K C;  3KHH A;  1HFE L;  4IDK A;  3GFY A;  4NCG A;  1FRM A;  5IWA J;  1YX2 A;  3TUJ C;  2Z2Y B;  1X9M A;  5IV4 A;  4IG3 A;  3KLG B;  3CJ4 A;  3VZI A;  1P6T A;  5J1E A;  4KKO A;  1WNE A;  5CYJ A;  3LGH A;  4DL2 A;  2CPI A;  2UXC F;  1C0T B;  1F0X A;  3Q24 A;  3FCH A;  7AT1 B;  3FBB A;  3CJK B;  4DN9 A;  2DNR A;  2ZBP A;  2IVY A;  3V4I A;  2BM1 A;  2LQ8 A;  4DV0 F;  4ELT A;  3HSJ A;  2YX4 A;  4W90 B;  2M52 A;  1LFW A;  3SXL A;  1KRP A;  2B5J B;  1RA7 A;  3RAM A;  1HBN B;  2PA8 D;  3KOA A;  4IKA A;  3JTN A;  3M9M B;  3SSS A;  4NMX A;  3JSY A;  3LAN A;  3CT9 A;  1QE1 A;  2X7I A;  4LRA A;  2OPP B;  3T3F A;  4DV5 F;  2WSE C;  1VDH A;  1RK8 A;  5GAH I;  3VVU A;  3HJV A;  3K0J A;  3W9H A;  3HSD A;  1EP4 A;  4QU7 A;  1G6B A;  4LIR A;  1WEL A;  2E7W A;  3GCX P;  2HFV A;  4LFA F;  2HHS A;  4JV5 F;  2DHS A;  3F41 A;  3BPD A;  3MED B;  4WE1 A;  4QWC A;  3W7B A;  1KD1 T;  2B7C B;  4A8M P;  1DTQ B;  3IC1 A;  4Y34 A;  1T9V A;  1D3W A;  2C3M A;  2VFV A;  3BGO P;  1NJY A;  1R0B G;  5B0E A;  2EFV A;  1I5O B;  3CME S;  1R0A A;  4X4U A;  3SIP B;  2KKH A;  1VHI A;  2ZZN A;  1RTJ A;  2GGP B;  4ZA1 A;  4DFP A;  2CVE A;  2HKE A;  2QMW A;  2VQE J;  3TVY A;  1FRJ A;  1TK0 A;  1TL1 A;  2DRA A;  2CNK B;  2I5J B;  3C6T A;  3EX7 B;  2HFN A;  1KWM A;  2BAN A;  1NKC A;  1WI6 A;  2W2P P;  3TOQ A;  1NPK A;  3T6B A;  3OFG A;  2GMJ A;  2CYY A;  1Y00 A;  1IJE B;  1NDK A;  1VFJ A;  1FF2 A;  3W66 A;  3UQS A;  1IR1 A;  2MLX A;  2CNL B;  5KFT A;  1RWN B;  2I38 A;  1R7I A;  1GMW D;  3KMQ A;  2W01 A;  1VMB A;  1JIH A;  2PDA A;  4B9S A;  3MR6 A;  3CUL A;  4J91 A;  2EW9 A;  4KIA A;  4NLG A;  2JLE A;  4L3N A;  1UEU A;  5IXU A;  1F5C A;  1TAU A;  1SXL A;  3MM7 A;  3W8P A;  3NAI A;  2DHX A;  2OO4 A;  3KK1 B;  2VZ9 A;  2AW0 A;  3MM8 A;  4Y6I A;  1S10 A;  3R5C A;  1H2U X;  2OH2 A;  5K9F A;  3DLJ A;  4NI2 B;  2MKI A;  2G4B A;  1H2V Z;  1MN7 A;  1EQ0 A;  3P3D A;  5C25 B;  1HQU A;  2FVC A;  2QJ3 A;  2JH3 A;  2BEF A;  2E5L F;  5AE3 A;  2C22 A;  3QYY A;  3ADA C;  4DDF A;  1HYS B;  1CVJ A;  2L3M A;  2HYI B;  1HD1 A;  4WFB Q;  4ILR A;  5C2G A;  3W63 A;  2HND B;  2CPZ A;  4B3R J;  2C2D A;  1TUW A;  2PA3 A;  2JX2 A;  3ICL A;  1JLE A;  2DXD A;  2WW4 A;  2DR9 A;  2G13 A;  4ENO A;  1V3Z A;  3SCI E;  2KXN B;  1KSP A;  3DKD A;  4HH1 A;  4NCA A;  4LR8 A;  1R8C A;  1BWV A;  1GFW B;  4PEO A;  1C0U A;  2HHH F;  4HTJ A;  2HMI B;  3UPF A;  2M3D A;  3UVJ B;  3TAN A;  4FYD A;  5IT4 A;  3I5A A;  4C0B A;  3OVA A;  1DQ9 A;  1AA1 B;  3D6F B;  3KJF B;  4LRC A;  4UZC A;  4LF4 F;  3CJR A;  4NZ0 A;  3SQO P;  4ZDN A;  3LPE A;  3J80 U;  5D78 A;  1NM2 A;  1N5Y A;  4PWD B;  1DAR A;  4Z7Y A;  3HFV A;  2B9W A;  1TKT B;  4X4N A;  1FDA A;  3MTJ A;  5A0Y A;  2DNK A;  3AAW B;  1GXT A;  3FQL A;  5AXK A;  2R8I A;  1NKE A;  3VZH A;  4IO9 Q;  3SEO A;  3IRW P;  5EX0 A;  1BMQ B;  5IM0 B;  4MYT A;  4UOF A;  4ILM A;  2OD4 A;  2YKM A;  1E6Y B;  3HSZ A;  1S9G B;  1X0F A;  5D0E A;  1SVD A;  4B3S J;  3AOD A;  1MWZ A;  2CQ0 A;  5DLG A;  4ECU A;  2R3V A;  5BR8 J;  2ZOM A;  1QVG R;  4OZ2 A;  3G96 A;  2JC0 A;  1HHT P;  1Q86 T;  1RHU B;  3BF4 A;  2HBQ B;  3QIP B;  4NAS A;  1CQN A;  3EVO A;  3BR8 A;  3KG1 A;  4O44 B;  1TL3 B;  2ZD1 A;  3MUV P;  4I0W A;  2APO A;  3VAM A;  2GMH A;  3N4W A;  1NEE A;  4OHZ A;  4ANE A;  1RT3 B;  2AQ4 A;  2CNN B;  2ATC B;  2R8K A;  2V6A A;  4MJK A;  5LMN F;  5I4M A;  4NX9 A;  2KZM A;  4KPC A;  3Q0A A;  4UQT A;  4DEZ A;  4PQU A;  5AXM A;  2GIF A;  1J5O B;  1QD1 A;  4NXN J;  4KQZ A;  2W9C B;  3MR2 A;  3GYN A;  1DUR A;  1U2R A;  5KFQ A;  5KT3 A;  1Q8B A;  3HI9 A;  4FYW B;  2AYG A;  2VIH A;  1IKX B;  4OZL A;  3KK3 A;  4EU0 A;  4K59 A;  2GVZ A;  4CQ1 A;  4EZ6 A;  1FTC A;  1DTT B;  3B8H A;  3M2V A;  5IFM A;  2PO4 A;  3MD3 A;  2HNY A;  3W60 A;  4JI8 J;  3KDO A;  2XM3 A;  3K7R A;  2X1G A;  2DHG A;  2XUL A;  1JJH A;  3W62 A;  2E1C A;  4P74 A;  1T3O A;  2XY6 A;  2Z0G A;  3RAX A;  2J6U A;  2XG8 A;  2WW8 A;  4AYB D;  2XNQ A;  4DPT A;  3NGU A;  4KY3 A;  4CO3 A;  3MM9 A;  5A76 A;  1CUL B;  3L09 A;  2RSQ A;  2XGQ A;  3DRS A;  3BR9 A;  1S0O A;  1H3D A;  3IMQ J;  4NLD A;  3DHW C;  1JJC B;  2XI3 A;  1B70 B;  3KUE A;  3CJ3 A;  2JFD A;  5CZX A;  2IAJ A;  5HQM A;  3BYR A;  3JTP A;  3I5C A;  4TU9 A;  1SJ1 A;  3UDV A;  1FKO B;  4Q7A A;  5ETR A;  3CB4 A;  3M2R A;  1ZET A;  2IYI A;  3OW2 R;  1K8A T;  4EO6 A;  3KK2 B;  1AB8 A;  2KU7 A;  2ILZ A;  4O3Q A;  2R2T A;  1AZS A;  1N5Q A;  4J9R A;  4DLG A;  2BDP A;  3RB3 A;  1URN A;  2EXU A;  1RTI A;  2IRX A;  4I2Q A;  2J0W A;  2W1B A;  4DPX A;  4FDF A;  4F3M A;  2CXE A;  2A18 A;  3U02 A;  1UVL A;  4IG0 B;  2FJD B;  4UST A;  1V5V A;  4FF4 A;  1TKZ A;  4ZHR A;  5HI7 A;  5EGY A;  2HRT A;  3B4M A;  3GG0 A;  2HBR B;  4DI6 A;  1DFD A;  1MML A;  4UUX A;  1T9T A;  1YLX A;  1F5A A;  3KLH B;  4P73 A;  3CPW R;  3RBX A;  1WOP A;  4ZPW R;  4K4Z A;  2ZJQ Q;  2YNH B;  2J5A A;  2CRL A;  3DOM B;  1P8G A;  4JYA J;  1RCX B;  3CVK A;  3GII A;  1BWE A;  3NGK A;  1NDL A;  1VC5 A;  2M5Y A;  5KFL A;  3THV A;  1RAB B;  1HIY A;  5IOL A;  4DS5 A;  3LPY A;  3IGV A;  3SQG A;  1B0P A;  3S6E A;  4J9K A;  4YME A;  1VQ6 S;  2MHN A;  1U09 A;  2IJR A;  3FFI A;  2BJ8 A;  1NH8 A;  3CED A;  2GFF A;  5I3U B;  4MTP A;  4FZV A;  3MUT P;  3R2C J;  5GAE I;  4YR0 A;  2VL1 A;  3CE8 A;  4AFF A;  2XEX A;  4ZVF A;  1SC4 B;  2EK6 A;  2ROG A;  2DHH A;  1HA1 A;  2AEF A;  5DDQ C;  3DLH A;  2GVD B;  3C46 A;  2H5E A;  3C16 A;  5DET A;  3W9I A;  3HHK A;  1RA6 A;  3MTK A;  2UVW A;  3HHL B;  1N0U A;  4AXJ A;  1WJ9 A;  2ERR A;  3T19 A;  3NCR A;  1T9W A;  1GX5 A;  4NCB A;  1V3R A;  2CQC A;  2ZE2 A;  4DG1 B;  3SFU A;  4KT0 C;  4G3I A;  2B7B B;  5I42 A;  3G82 B;  1Q7Y T;  3OFF A;  4OIX A;  1SL2 A;  2YKA A;  3MEC A;  4YB5 A;  4QWE A;  1U1L A;  4PUO A;  2C3O A;  4P9S A;  3PW5 A;  4ZVH A;  3V6H A;  1YZ7 A;  3I0R B;  1U47 A;  5LSR A;  1JQG A;  2BJ9 A;  1V9O A;  1RT4 A;  4OHW A;  5KG3 A;  3CJT A;  4NRU A;  1K44 A;  2VH7 A;  2ZKU A;  2M9K A;  3AXK A;  4WII A;  2OPS B;  5D15 A;  4CNY A;  5J2P A;  2DKO B;  1S79 A;  4LF2 A;  3A4T A;  2I2Y A;  2Y1I A;  2O01 C;  2RQC A;  1FX4 A;  3QT6 A;  1U1M A;  5KFU A;  1YIT S;  2OJ3 A;  1Q78 A;  1YRT A;  3O1L A;  4OLP A;  3PM9 A;  1SJR A;  4N41 A;  2PI4 A;  5E3Q A;  5CXT A;  4CLW A;  3HKZ D;  3B4D A;  2FLL A;  4C11 A;  2P9G A;  1YSJ A;  2CDQ A;  4ED4 A;  1D9F A;  1ARO P;  1IBC B;  3OVB A;  1N56 A;  3D2W A;  4GO5 X;  2KRR A;  1DJ0 A;  2C3Y A;  5J2N B;  3RAQ A;  2GO8 A;  3MAA B;  3DOL B;  2CJB A;  3WX4 A;  1CQM A;  4WU3 A;  1HLW A;  1RLD A;  1VK3 A;  4EUV A;  4CLZ A;  2AYE A;  3J81 Y;  4RNN A;  1FE4 A;  4LF5 F;  2FHO B;  2JLG A;  1U7L A;  3U1N A;  5D0R A;  3QMQ A;  2CQ4 A;  1IQZ A;  1TL5 A;  4L76 A;  2GJ2 A;  2V68 A;  3DYA A;  4ZCL A;  4MT1 A;  1YRU A;  1FD2 A;  1SC1 B;  4DMZ A;  3N0V A;  2ZJR Q;  1MRO A;  4UUW A;  2N4C A;  1K73 T;  2YKN A;  1FJG J;  5AE2 A;  2QLW A;  2H1Y A;  2KB2 A;  4J7C A;  4ECT A;  3UFC X;  2RD5 C;  2DNY A;  4PXB A;  1LW0 B;  1REV A;  2XCA A;  3SI8 A;  1QAI A;  3C6U A;  4Z7C A;  3NS6 A;  4DSL A;  4LBH A;  1XBW A;  1W2I A;  3Q8S B;  4F04 B;  3TAQ A;  4J5O A;  1S9F A;  3OHB A;  3DRR A;  3QWU A;  3N28 A;  5M2U A;  2LQ9 A;  4U67 Q;  2MJU A;  4Y2A A;  5G0R B;  2ILY A;  4R25 A;  4DPU A;  3AD7 C;  3W65 A;  3RBD A;  3RU0 A;  4B17 A;  5A2Q Y;  1TKD A;  2HVI A;  2L9D A;  4DSI A;  1UCN A;  1ZM2 A;  2I0X A;  3MM5 A;  3MFI A;  2GQ2 A;  3FEX B;  1T02 A;  2Y8W A;  1TL7 A;  2DT9 A;  4DL7 A;  2E9R X;  3ENQ A;  3KTQ A;  4A48 A;  2YNF A;  2B9X A;  4L74 A;  2OSR A;  4URS A;  2LQ5 A;  2Y8Y A;  3SSR A;  4JI5 J;  4UF4 A;  3R7B B;  2V67 A;  1S0V A;  3QFH A;  2C3P A;  4XIU A;  2AX1 A;  1T11 A;  4C8M A;  2UUB F;  2A6O A;  1IBL F;  1RWK B;  4Q43 A;  2EFN A;  2QV6 A;  1SL0 A;  1FE0 A;  1RTH B;  3L7P A;  5HP1 B;  4FF1 A;  4KHP F;  3ETM A;  3MMA A;  3L3C A;  2B43 A;  2YVS A;  4DR6 F;  1JLC A;  4CLS A;  4KBI A;  4KRW A;  4NLS A;  5DZ6 A;  2KFZ A;  2OEL A;  1HNI A;  3BGU A;  3Q8V A;  3D0I E;  1BD6 A;  2NR0 A;  4B3T F;  2HBZ B;  4KGX B;  1SV5 B;  3H40 A;  4K5S A;  3BEG B;  2RJZ A;  1BQM B;  5KFA A;  2AIR B;  3C66 A;  3TO8 A;  4P10 A;  3KLE A;  1GTH A;  1HNX F;  2W4P A;  3M8P A;  4WFZ A;  3CMQ A;  3MCM A;  1CC7 A;  2WON B;  3OR1 A;  2VPZ B;  4FPI A;  2C2K B;  4LJM A;  4I64 A;  2DR8 A;  3D67 A;  4M5M A;  2DY1 A;  3KLI B;  3LF0 A;  2JDJ A;  4DQI A;  1FHT A;  1T03 B;  1VQ9 S;  3CJ2 A;  1JLB A;  3O44 A;  1T9U A;  6FDR A;  2UV8 A;  2VIC A;  5LXY A;  4F50 A;  2DRB A;  5HVG A;  2V8G A;  1FEE A;  2DO4 A;  3OVS A;  5D4N A;  2ASL A;  2DNM A;  1V3S A;  1H7X A;  4K4T A;  2BV3 A;  4DV3 F;  2M2B A;  4IFV A;  2MQQ A;  1CJU B;  3GFH A;  3LQV A;  4CLF A;  1WF0 A;  6AT1 B;  1K1S A;  3DU5 A;  1TVR B;  2KYX A;  2MGZ B;  2D7S A;  2J6T A;  5ETM A;  1B4S A;  4B9T A;  2UXB F;  2JEG A;  5HVH A;  3PCO B;  4MKA A;  3T1Y J;  4PPD A;  5F9L A;  3HF5 A;  4WFA Q;  1W26 A;  3D9B A;  4OYO A;  5LMU J;  5E0O A;  4L75 A;  2B3T B;  1N34 F;  3U7J A;  3Q22 A;  3PW0 A;  3IFE A;  1W2B R;  5ETS A;  2VUG A;  1K47 A;  3FEY B;  2KG0 A;  2E5J A;  2DO0 A;  4KFB B;  3J7A 1;  2VOD A;  1S4E A;  4QJV A;  1LFP A;  1N33 F;  2CG8 A;  1SH2 A;  2OLW A;  3SV3 A;  3RW7 A;  5ETO A;  1YJV A;  2GX8 A;  4ELV A;  2IM1 A;  5DQG A;  2MQ8 A;  4ZPT R;  3M32 A;  2DJW A;  3TVZ A;  2UXC J;  4B9L A;  4ZP6 A;  1CJV B;  2AWZ A;  1R43 A;  3BM7 A;  3CJ8 A;  1Z4U A;  3R7S B;  3ITH B;  1RWO B;  1WEZ A;  1TTH B;  2ZH6 A;  4ES1 A;  3DLG A;  1S1V B;  3AB2 B;  4DV0 J;  4EZ9 A;  1H0H B;  4M5D B;  2WVC A;  4X4V A;  3CDW A;  4YOE A;  1YJU A;  4Y2C A;  3K58 A;  2ASJ A;  4NL5 A;  2XO7 A;  1HMV B;  4CZC A;  3NMA A;  3FDS A;  3VHQ A;  1UZD A;  2MY7 A;  3DLK B;  1KQG B;  4Y00 A;  2QGF B;  4ZVR B;  4DV5 J;  3AQO A;  4ITS A;  3CCV S;  2W9B A;  3RBE A;  2VKZ G;  2AD9 A;  4DSK A;  3HT0 A;  4RPF A;  3KNA A;  2AV5 A;  4ZCM A;  3W64 A;  1DBD A;  4NEY A;  4I2P A;  3C8Y A;  3ZTS A;  4LRB A;  3LOU A;  4LFA J;  2AYB A;  4DSF A;  4LFC F;  2MPU A;  4JV5 J;  3MM6 B;  1MSW D;  3DGP B;  2ZFH A;  4O3N A;  1JLF B;  4HHU A;  1ZH5 A;  2QL5 B;  2XS5 A;  3D4J A;  2FC8 A;  4LSL B;  1Z1Z A;  3AT1 B;  1PO6 A;  2V9K A;  2WZ1 A;  2H4W B;  2C2Z B;  3M8S A;  1HWK A;  1S6P A;  4NLV A;  3QGI A;  4RUH A;  3MMJ A;  1X4A A;  2W7P A;  1FK9 A;  2EBG A;  5HQ8 A;  2ZH5 A;  5LM7 E;  1VRU B;  1XR6 A;  1VQN S;  4YR2 A;  4OFZ A;  4X4P A;  5CYQ B;  2XZW A;  4NA1 A;  3GIK A;  1XER A;  1MU2 A;  3ZZT A;  3D0H E;  4NLW A;  4A8Q A;  3FNN A;  3UD4 P;  1SKW A;  2CQ2 A;  2XLI A;  3I96 A;  3ZFV A;  2Z56 B;  1H72 C;  1HQE A;  5AT1 B;  1NJX A;  3CD7 A;  2VBY A;  4WXW A;  2R8H A;  1P1L A;  2K06 A;  2DIV A;  1Y9O A;  4DN0 A;  4C9D A;  1KHV A;  2OUG A;  2BZ2 A;  2MQP A;  2BAC A;  2G2O A;  8ATC B;  2FLP A;  5A8K A;  3ZO7 A;  2GJF A;  2CPH A;  2GZO A;  3C14 A;  3MPD A;  5IZH A;  3S01 A;  4YFU A;  3ZC4 A;  1HNZ J;  4M94 A;  1CJK A;  1R31 A;  2QE5 A;  2RDJ A;  4Q2M A;  3H2L A;  2FZK B;  2DPJ A;  2CAD A;  1QJH A;  3G4S S;  1AW0 A;  3JSB A;  4KHR A;  2DGS A;  4C48 A;  3POT A;  2LFV A;  2NUH A;  2HIY A;  1SB6 A;  3C15 A;  5K8P A;  3CO9 A;  4GVB B;  3L7U A;  1CS4 A;  4PYA A;  3NBP B;  1HWI A;  1GNK A;  2OPR B;  1R0A B;  3QLH A;  1ICE B;  4XDC A;  4FS1 A;  2RRN A;  1ITP A;  3WHI A;  2E1P A;  5D4P A;  2NS1 B;  3P6Y C;  3AJ1 A;  2QZ8 A;  3J7Y I;  2HHX A;  3ILL A;  4X64 J;  1ZZF A;  3WC0 A;  3EUN A;  2QA1 A;  3PEJ A;  3T9Z A;  4KC5 A;  2HHH J;  2WB1 D;  4I6Y A;  3MCN A;  3WC2 A;  3QGH A;  3D1H A;  4P2F A;  2Z30 B;  1RCO B;  2BX6 A;  2DRD A;  5EX3 A;  5GAE U;  1D8Y A;  4I69 A;  1RHK B;  4ILL A;  2HG4 A;  2F3J A;  4LF4 J;  2OI2 A;  1UP1 A;  4X4R A;  5K14 B;  1Q1K A;  4DL0 C;  3MM7 B;  1LWC B;  1VGY A;  1TL4 A;  1Y3K A;  1FRK A;  4WP3 A;  4OZ1 A;  2ZJP Q;  2UUW A;  2V0N A;  4I7F B;  2LU2 A;  4DV2 F;  3X1L B;  1SC6 A;  2KTQ A;  1HBO B;  4TVA B;  2BJ7 A;  1S9E B;  1JLQ B;  4DQR A;  1UJ4 A;  1VQS A;  4HR2 A;  2HLU A;  1BXN A;  1LW2 B;  1ZPW X;  1U26 A;  3GV5 B;  5E33 A;  3PXG a;  1JNR B;  1UA1 A;  2XYH B;  4LSN B;  4F4A A;  3VF0 B;  5CYM A;  4PG7 A;  5F8I A;  3CCR S;  2KDO A;  5HJY A;  4LT6 A;  2QC3 A;  1Q7L B;  3VV2 B;  2LDI A;  5JXS A;  3PRV A;  2QLF B;  2VBX A;  3A8I A;  3GPA A;  2BJE A;  2KXH A;  2XSJ A;  4QR1 A;  3KYL A;  1S6Q A;  1JLE B;  3TQE A;  3A8E A;  5B7W A;  3K2Y A;  3NOC A;  2IA6 A;  1YJR A;  3EZ5 A;  3BSN A;  3N01 A;  2W24 A;  4CM2 A;  4F02 A;  4OHY A;  2V94 A;  1Q5V A;  2WOM B;  3TZX A;  1TUV A;  1DHM A;  2QT7 A;  3RTV A;  4O4G A;  3FVY A;  4QR2 A;  5LMN J;  1FT8 A;  4OYB A;  1VQ5 S;  3EZU A;  5D8H B;  4U8V A;  4DL3 A;  1NSA A;  5IT9 U;  3GZ7 A;  1TAQ A;  2K3K A;  5D3G A;  5MAO A;  4LIW A;  5K8M A;  3P5T L;  3N79 A;  3AHP A;  1NK5 A;  3NY0 A;  2BE9 B;  3M9N B;  3ZTP A;  3HHN B;  4FNI A;  4JV0 A;  4KO0 A;  3K5O A;  2KN4 A;  1R8A A;  1BQN B;  5K8N A;  1VQ8 S;  3NS7 B;  2WSC C;  2WVF A;  4WYL A;  1CG2 A;  1WG5 A;  1YG0 A;  3QT5 A;  4ECS A;  4GKJ F;  5CCM A;  1FRH A;  3TW0 A;  1X9S A;  1V5I B;  4IRC A;  3DM2 A;  1RDR A;  4ZCK A;  5DO2 A;  4CO5 A;  5HAT A;  3W9J A;  5KFX A;  2U2F A;  1EAY C;  2OGU A;  4CM0 A;  3NP5 A;  4MK9 A;  2M70 A;  1IR2 A;  2DR6 A;  4DPW A;  1OYE A;  9RUB A;  3PYD A;  1Q8L A;  3TR5 A;  2BKN A;  1YKW A;  1P27 B;  2UUC F;  2F4F A;  3R8Y A;  7FDR A;  1IKW A;  1CBK A;  1QAY A;  2BOP A;  2Z57 B;  4DX7 A;  1KOH A;  3E01 A;  1J5E J;  4QU6 A;  4U8Y A;  4JI4 J;  4C8L A;  1UFL A;  1S0N A;  1TV6 B;  2YKQ A;  1UWB B;  2MZS A;  1IVZ A;  4XO0 A;  4FP9 A;  4NYZ A;  3D6T B;  4MK7 A;  3MUR P;  2ZZM A;  2ZIT A;  4BBY A;  5KFK A;  1EAR A;  3QJJ A;  5KFM A;  2CZV C;  2LQB A;  1I6J A;  4C97 A;  4K4V A;  4DQP A;  3KJN B;  2JOQ A;  3CCW A;  3QAT A;  3DDN A;  3V6K A;  4NA2 A;  1NXI A;  4P7V A;  3EVM A;  1ZS6 A;  1F9H A;  4BS2 A;  3M8R A;  2JSX A;  5J2Q B;  3K57 A;  2E1M C;  3TUP A;  2J9C A;  2MQM A;  1TFW A;  5DZ7 A;  2FJE B;  3TX0 A;  1GXL A;  1OJ4 A;  4ZPB A;  4BCA A;  1YJ9 S;  5E3C A;  2C3U A;  3NG8 A;  3IGN A;  3LGN A;  3FJ2 A;  5IT0 A;  3MMB A;  3LWM A;  4R0J A;  1RAA B;  4AQY J;  4EYI B;  2ZNY A;  4PXE A;  3GWC A;  3EIC A;  5LJ5 Y;  2E44 A;  4AE5 A;  1KFD A;  5KFE A;  4LRF A;  2CQG A;  2UU9 F;  2LU1 A;  3GFZ A;  2HVD A;  2RU3 A;  3CSK A;  2FY8 A;  3MR5 A;  3SSQ A;  2FZC B;  5KG4 A;  2QG9 B;  4KAI A;  3ZTO A;  1GXU A;  1F9F A;  5HL7 Q;  2HZV A;  2EPI A;  4ID5 B;  1A6L A;  4LUB A;  1FDN A;  4HAC A;  4O3S A;  2J7U A;  3O5T B;  2C2O B;  2VG5 A;  3IA0 A;  2YQ3 A;  5IS2 A;  4IH7 A;  1FRX A;  3IR7 B;  2BRL A;  3EPG A;  2RIJ A;  3Q23 A;  1SUQ A;  1SKU B;  2VV5 A;  3HVA A;  1AYE A;  1RAE B;  2UXD F;  1A0O B;  1M1K T;  3HFK A;  3ILO A;  3IRX B;  5J2M B;  2CNO B;  3A3N B;  4FXD A;  1BLU A;  5EWE A;  2R7U A;  1EET B;  2AGO A;  4IFY B;  4JV1 A;  2Q6C A;  2UV8 G;  4DUT A;  2AZ1 A;  1NDC A;  3H2U B;  2YBV A;  3PVX A;  5DDP C;  1B7Y B;  4OV6 A;  1T9X A;  5F41 A;  5LJ3 Y;  1L3S A;  1OSD A;  2VON A;  1TP7 A;  1B3T A;  5H1S V;  1JJ2 R;  2FJV A;  2V4R A;  1Q8I A;  2AHO B;  5EWG A;  2DB1 A;  2DYA A;  4GKK F;  3KJV A;  2QMX A;  3B54 A;  1I51 B;  4CLY A;  3J7Z T;  3EYZ A;  5KOX A;  3UR3 C;  5BYR A;  1V6H A;  2RF2 A;  1U48 A;  1KFS A;  3S7R A;  5ETV A;  4YY3 F;  3MWB A;  2FJW A;  1IBK F;  1QDU B;  4QIF A;  1NSQ A;  2DD8 S;  2J0S D;  4JI7 F;  3A3P B;  1BQX A;  2VG6 A;  3DU6 A;  2YTC A;  3CJS A;  5EN1 A;  3C16 B;  3K59 A;  5HBM B;  4LVN P;  2V9W A;  4LSZ B;  2VOP A;  3H98 A;  2IRY A;  5HRO B;  1R89 A;  1O5J A;  3FZ2 A;  2W2N P;  2ASY A;  2Q6B A;  2F63 A;  4OI0 A;  4YDD B;  2ZE2 B;  4U9R A;  2AX0 A;  2XY5 A;  5JVG Q;  4KV8 A;  4LF5 J;  3H59 A;  1Q79 A;  3A3O B;  1U0H B;  1CLF A;  5CH7 B;  1JXV A;  3U27 A;  1X4B A;  1RZM A;  1S57 A;  1HNV B;  3JYT A;  3BQ2 A;  4FF3 A;  4LQ9 A;  1WC1 A;  2A0F B;  5ETK A;  3DMJ A;  2FQQ B;  2Q1L A;  3OTO F;  2Z2Z A;  3BGR B;  4J90 A;  3DI6 B;  3G8S A;  1PJ6 A;  4NLP A;  2DGQ A;  3OR2 B;  3QO9 A;  1F2H A;  3NGS A;  2AJ2 A;  3I31 A;  3BSC A;  3ONQ A;  2Y3Y A;  3N5F A;  1Q8K A;  4PKD B;  2F65 A;  1Y5L B;  1PC5 A;  4N77 A;  1H74 A;  2QSW A;  1F9E B;  4C3L A;  2E1A A;  3G8Q A;  2XS7 A;  2ZC4 A;  3KLG A;  1KEK A;  4X4O A;  1L3T A;  4DCP B;  3Q8Q B;  4B9M A;  1SPB P;  5A6P A;  3M8Q B;  1C0T A;  4UZB A;  4RW4 B;  3CJK A;  2FZG B;  3KG0 A;  2A1B A;  3VAL A;  2XYP B;  1RKI A;  4DX8 H;  4KE5 A;  3R1L A;  1P1T A;  1O0P A;  4TYA A;  2WVD A;  2M0G B;  4X62 F;  4F67 A;  5A6W A;  2YX1 A;  4QQB A;  4V19 J;  3MF5 A;  1AFJ A;  5F3Z A;  2B5J A;  4CYU B;  3P45 B;  2D3O 1;  2QA4 G;  1HBN A;  2BW7 A;  4J9M A;  3VCD A;  4AUK A;  4TU8 A;  1D0E A;  3BN7 A;  2DCL A;  3K5L A;  1C1C B;  1IKV B;  3F56 A;  2OPP A;  1RAJ A;  4GO7 X;  2UUB J;  3MCS A;  3CIZ A;  1I94 J;  1IBL J;  5A8R A;  1CEZ A;  3NEK A;  2AJ1 A;  1NAQ A;  2QTW A;  3TA1 A;  1NK0 A;  2BVZ A;  3R1H A;  3I9V 9;  1VBY A;  3OSP A;  1L3V A;  4C6A A;  3OPK A;  2V8H A;  3CD5 A;  5FD1 A;  1VBK A;  4KHP J;  1R0C B;  2DNZ A;  4RNF A;  3BN4 A;  1SI9 A;  5DDR C;  4DR6 J;  2GO9 A;  2P8I A;  1PJ7 A;  2YXL A;  3CF5 Q;  5E2Q A;  1PKU A;  4B3T J;  1DTQ A;  3GTY X;  2DNQ A;  4LF8 F;  1HWJ A;  4HI1 A;  1LK7 A;  4P2M A;  2R8J A;  3OHA A;  2CKW A;  3SDE B;  5KFI A;  2M8D B;  5DM6 Q;  4PG5 A;  3QQC D;  1HNX J;  3UDC A;  3W2V B;  2GGP A;  1X0P A;  2VC1 A;  5L9N A;  1VQP S;  4IH6 A;  1H2T Z;  3H25 A;  2IC3 B;  2I5J A;  4UOC A;  2MXY A;  1UKU A;  5L1K A;  4QR0 A;  2MHE A;  4F36 A;  2W8K A;  2RAQ A;  5F3T A;  4P2X A;  4B9V A;  2YNF B;  2F40 A;  4R8U B;  1E6V B;  5KT6 A;  3PRB A;  4Y2M A;  1TFY A;  4DV3 J;  1LXJ A;  3ET6 B;  2G9O A;  2D69 A;  3I87 A;  3DRX A;  2VPX B;  1D09 B;  3VGU A;  2A3J A;  2YWW A;  2UXB J;  3OTD A;  1XC9 A;  4H4K A;  1EZZ B;  1FTR A;  4PYD A;  1B64 A;  4QIE A;  3KK1 A;  3UN5 A;  3M7V A;  1SKS A;  3BBF A;  2YNI B;  3IS9 B;  3OJS A;  3RYL A;  2RQK A;  4A8O A;  3GR0 A;  1VC6 A;  5LSL A;  3BKF A;  4NI2 A;  2GAH C;  2LXI A;  4HHH A;  3LP0 B;  1D9D A;  3BJY A;  3JQK A;  4KGM A;  3H2V E;  5C25 A;  3UNY A;  1DLO B;  4A8S A;  4OI3 A;  4FN5 A;  3VTI A;  4AXI A;  4X65 F;  4HKQ A;  1HYS A;  4F2R A;  1I1G A;  3EM1 A;  3IBW A;  2KHC A;  2B4U A;  2M4M A;  4NML A;  1H6K X;  2XO6 A;  3QID A;  4WKR A;  4C0H A;  3D0G E;  2KT3 A;  4PQA A;  2KT5 A;  3KUH A;  1RWM B;  3PFO A;  3GYX B;  1WHY A;  5I3Q A;  2RU9 A;  1X8D A;  4OJ1 A;  2C42 A;  1KNZ A;  3BS9 A;  3TEG A;  2ADC A;  1VRT B;  2OMO A;  2O1P A;  2HMI A;  1RHR B;  1T05 B;  3CCZ A;  4QW8 A;  3HKW A;  1NZ8 A;  2IM2 A;  1YK9 A;  1LXN A;  4CP5 A;  3FRY A;  2PE8 A;  1C2P A;  4ZP7 A;  1RHM B;  2DPI A;  1N6Q A;  1HHQ A;  3DOK B;  1GT8 A;  2NRE A;  2LQJ A;  5K8O A;  3PHT A;  5KG7 A;  4RBV A;  4RU9 A;  1J27 A;  3Q8P B;  4PWD A;  2FVQ A;  4RNM A;  1RAH B;  2VU5 A;  2HEK A;  2FLN A;  2IRU A;  3Q8R B;  2HLT A;  2LDY A;  1MWQ A;  4KGV B;  3AFG A;  2IVF B;  1SH0 A;  2KFY A;  1RP5 A;  4LFC J;  3H8Y A;  1YBT A;  2XMJ A;  5KFO A;  1ZPV A;  1JNZ B;  3VQS A;  2H9Z A;  2EC2 A;  4ETZ A;  1YVF A;  4OYI A;  1NHK L;  5C42 B;  2CFX A;  1WC5 A;  2HRY A;  1PG5 B;  1RT2 B;  4IRK A;  3FRZ A;  4EFA C;  1J2V A;  1E6Y A;  1S9G A;  1WOR A;  1YBU A;  4PWU A;  2MKY A;  4F0H A;  2WAQ D;  4HL9 A;  3W61 A;  2BR0 A;  1AUS L;  4B3R F;  5L8R C;  1S72 S;  3CJQ A;  3PJ9 A;  3MFH A;  5KG2 A;  1B0V A;  2J0Q D;  3MPU B;  2F4V J;  3JAM U;  1AFI A;  3BO2 A;  3MOZ A;  5BJR A;  3QIP A;  4K5R A;  4ZVE A;  4U7U K;  4XDD A;  1FWK A;  2LA4 A;  2NZ4 A;  4YDX A;  4O44 A;  1TL3 A;  3OXF A;  5L39 A;  1KVI A;  3H5Y A;  1T95 A;  4RO0 A;  2YH0 A;  4CDI A;  1VQ7 S;  2CPE A;  1RT3 A;  3K17 A;  4RW7 B;  5J1N A;  5GAD U;  3FGV A;  3AJD A;  4ZVU B;  2D74 B;  5L1L A;  2XC9 A;  4Y2K A;  1MNE A;  1TKX A;  2QL9 B;  1IXK A;  2F7V A;  4NLU A;  4WCE Q;  1J5O A;  1U1N A;  2DR7 A;  2C2N A;  2Z4P A;  3EDQ B;  2MZR A;  4KPY A;  2W9C A;  2R7O A;  2PFF B;  2XMM A;  5F8L A;  1SIW B;  5HMX A;  2CJX B;  2V63 A;  2XWX A;  2I1R A;  2A10 A;  3KHL A;  1IKX A;  2V34 A;  2FVS A;  1NPR A;  2ZOF A;  3BH6 B;  4KGZ B;  5C7P A;  1VQY A;  4DFM A;  2E1R A;  3SCL E;  3JAM Y;  1XWL A;  2WVB A;  1FVS A;  4OYX A;  3CDA A;  3WDO A;  3EXC X;  1S1W A;  2IJN A;  3FMW A;  4A8F A;  3BDE A;  1HQ2 A;  1YJ7 A;  3DN9 A;  1ACM B;  1VK8 A;  3ENV A;  5IV3 A;  1K0T A;  4Q44 A;  2IBO A;  1AT1 B;  4OJ3 A;  1P9Y A;  3RRG A;  4LQ3 A;  3IO1 A;  2H51 B;  4ZLL A;  2VD3 A;  3FSY A;  3B82 A;  4AL5 A;  1CUL A;  3NXZ A;  1GX6 A;  3DLL Q;  2IDL A;  2JEF A;  4J9U E;  2MSS A;  2LKZ A;  4RW6 B;  3LP1 B;  2N7Y A;  5E5N A;  2ZBR A;  2Q3P A;  4H4K C;  1OQ3 A;  1LKZ A;  3GCW P;  4KYZ A;  2R42 A;  2K8G A;  3QFW A;  1U45 A;  1FKO A;  1LV5 A;  2HZA A;  1JLA B;  2MY8 A;  3CD6 S;  1VR6 A;  3LTO A;  2ADB A;  1R6Y A;  4USJ C;  1RIS A;  2ZH1 A;  1GAO A;  2KFN A;  1XTZ A;  2H65 B;  3HD2 A;  1FKA F;  2ZH4 A;  5AXL A;  3KK2 A;  4NXN F;  1SJQ A;  3TZZ A;  2HPU A;  2CQ1 A;  2JRS A;  3RRH A;  2G2Y A;  2E9T A;  3QJL A;  2F9D A;  3TI0 A;  2HFU A;  3I4H X;  5L38 A;  4XPC A;  3M6X A;  1FRL A;  4ZPV R;  5K5M A;  5HJX A;  4DV2 J;  3F44 A;  2OTJ S;  1YJN S;  1RWP B;  3IWX A;  2D1C A;  2AJQ A;  4IG0 A;  3OL9 A;  1QY7 A;  1F1B B;  3CNQ P;  3P49 B;  4CO1 A;  3SYZ A;  3ILJ A;  5KG5 A;  2L08 A;  2EKN A;  4CO2 A;  2U1A A;  2MKJ A;  4ERD A;  5DGA A;  5KFS A;  4OLO A;  1H98 A;  1FD8 A;  1U8W A;  4DXL A;  3TAM B;  4NWB A;  3OUY B;  4O0I A;  3KLH A;  4LF9 F;  2ATL A;  1OYD A;  3QLH B;  5RUB A;  4JB8 B;  2IMW P;  2MKK A;  2YNH A;  2HW3 A;  4IQM A;  4F4W A;  4KGK A;  4WP9 A;  4B3O A;  3CCQ S;  2HFZ A;  1EKS A;  4B08 A;  3IBC B;  2HGL A;  3FSX A;  3PO4 A;  3NMR A;  4OHV A;  2KT2 A;  2YWK A;  3EGW B;  3O2I A;  5DJB A;  3GV8 B;  4CCH A;  1RU2 A;  1WAC A;  2CJY B;  3BPS P;  2BE2 A;  1OY9 A;  1WSV A;  2ZZT A;  3OLA A;  1S48 A;  5A8W B;  3EVW A;  1JXE A;  3NS5 A;  4CLT A;  5I3U A;  3MI7 X;  2ABY A;  3G86 A;  4UOG A;  2MQN A;  3R5A A;  4USH A;  2GVD A;  4M5I A;  3R27 A;  2CQ3 A;  1NJW A;  1KC8 T;  4MIW A;  1VQM S;  4MKV A;  2GAG C;  2CUY A;  4QYZ K;  3HHL A;  4PG4 A;  2EWH A;  3DRP B;  4J9P A;  2KI2 A;  2OEJ A;  2YQ0 A;  4DG1 A;  2HVH A;  3DLE B;  3PKM A;  1VHF A;  3AJ2 A;  3G82 A;  1RWV B;  3MEG B;  1U6B A;  1Y10 A;  1H38 A;  1NSK L;  1KDN A;  3JS9 A;  1O8B A;  1R27 B;  4WKY A;  1KVJ A;  2COL A;  3GIR A;  4DL5 A;  3V6J A;  1HBU B;  2NPF A;  1WOO A;  2POK A;  3HO1 A;  3I0R A;  4LFB F;  3FK4 A;  3HUL A;  2LA6 A;  1ZAW A;  2UUC J;  2IIH A;  1WEX A;  2ZHB A;  1RTD B;  2QRR A;  4WFN Q;  2QLX A;  3L9Z A;  3MEE B;  2OPS A;  4FKY A;  4USW A;  4MKY A;  2V2K A;  2VBZ A;  3KXD A;  4Z2X A;  5KFP A;  1K0V A;  3JSR A;  4USM A;  3I0S B;  5J1P A;  2KM8 B;  2O66 A;  2EBE A;  3HT3 A;  4L6V 3;  4WU2 A;  4O4G B;  3OL7 A;  5FDL B;  4CO4 A;  1URR A;  5L46 A;  4AL6 A;  1MN9 A;  2RNE A;  3KG4 A;  4NA3 A;  2QFI A;  4OHX A;  4PCQ A;  1N48 A;  1NK8 A;  5D3G B;  2B8Q A;  4OZ5 A;  5CD4 H;  3L95 X;  3R9L A;  2RKI B;  2CJQ A;  4P2S A;  4F26 A;  4FF2 A;  2V8V A;  1HPZ B;  1TR0 A;  4HVZ A;  3R5B A;  3Q2T C;  3GJQ B;  4QIV A;  3O3L A;  4AL7 A;  3HDS A;  2HHT A;  5J2N A;  3Q83 A;  4JUZ A;  4MYU A;  2GS8 A;  3MAA A;  3DOL A;  4LVO P;  4U96 A;  3WX8 A;  3MD1 A;  4WTO B;  4F3Q A;  5FII A;  1QLN A;  5C24 A;  4FPR A;  1S76 D;  4ICL B;  4WPA A;  3IAS 9;  1X4C A;  4ED5 A;  4USI A;  1NK7 A;  3ZNU A;  2I9S A;  1XNR F;  2CPF A;  1X60 A;  3AOB A;  4BDP A;  3A13 A;  5KFW A;  1ZAV A;  1S1U B;  4WZM A;  4ZVS B;  2B51 A;  5F0W A;  4H4M B;  2R7X A;  1WTF A;  3EJM A;  4X4Q A;  1RT5 B;  4X66 F;  2QSF A;  2J7K A;  2FVP A;  3DXB A;  2DNO A;  2ACY A;  2A2C A;  4UW2 A;  3ELH A;  3RZA A;  2V8P A;  4CH1 A;  1LW0 A;  2DGO A;  4ZVO B;  2YX7 A;  4N76 A;  2E29 A;  2UU9 J;  3H90 A;  3VAG A;  2XMU A;  1UVJ A;  2HUR A;  3ULH A;  2MLZ A;  4DV7 F;  4ED8 A;  3LP2 B;  5F9N A;  3ZZO A;  5DLF A;  2CQP A;  4WK3 A;  4P71 A;  9ATC B;  2PEB A;  4G1Q B;  4K4U A;  4IYQ A;  5G0R A;  2IM3 A;  3HVT B;  3AQP A;  2LEB A;  5DGB A;  2AU0 A;  2GNK A;  1PJ5 A;  4C98 A;  4DFK A;  2XCP A;  1XIQ A;  4Y2I A;  3SFG A;  1FKP B;  1U8S A;  3DLB A;  3OTE A;  3MAH A;  1S1T A;  2UXD J;  4M5K A;  3O8W A;  2XGP A;  1Y11 A;  3D3B J;  2EC0 A;  1WOS A;  4R5P B;  5AJ3 F;  1NB2 A;  2EK1 A;  4M5L A;  1QSL A;  1WC6 A;  1MG7 A;  3I56 S;  4Q0B B;  3D3C J;  1NPP A;  4ECW A;  3UWT A;  1N32 F;  1UW9 A;  3CW2 C;  1M5V C;  2FPH X;  4CH0 S;  4PR6 A;  2V4J B;  4L73 A;  4ZIT A;  4LF7 F;  4WFY A;  4F0M A;  3EMT A;  2RUS A;  2LMI A;  1YJT A;  2EKY A;  2CPX A;  3PAC A;  1XNQ J;  1YWX A;  4DCJ B;  3D6H B;  3HFZ B;  1RTH A;  3HHL D;  2M88 A;  5HP1 A;  4GKK J;  5KFH A;  4FVC A;  2ZUG A;  4OI6 A;  4CLP A;  4EEY A;  3TX8 A;  2XMV A;  3QAE A;  3FMB A;  4DR1 F;  3HHL C;  5EDW A;  1R8P A;  3D5M A;  1WHW A;  2HHP A;  3W2W B;  2J76 E;  1SV5 A;  2FGC A;  1IBK J;  1SIZ A;  1FWL A;  5AXN A;  2G0I A;  4ZJL A;  3CC4 S;  4LBP A;  1BQM A;  2VG7 A;  3I4P A;  4JI7 J;  3PNI A;  1UEV A;  3BRE A;  2DGV A;  5HVF A;  3LAM A;  4FKX A;  2B4P A;  1VCT A;  5D4O A;  2F9J A;  3OXG A;  3V6D B;  1R3N A;  2WON A;  5HSP A;  2JL9 A;  4YEA A;  1PBA A;  1KHW A;  8AT1 B;  3KLI A;  1T03 A;  1S7H A;  3QAU A;  4O4R A;  3VGS A;  2YNG A;  2YH1 A;  3W8G A;  1XMO F;  5LSO A;  1O6X A;  4TQR A;  3ZNJ 1;  2H4Y B;  2MMY A;  3LH2 S;  3HLU A;  4KR0 B;  3J81 U;  2CZ4 A;  1HW9 A;  4IOB A;  4DBQ A;  2AJ4 A;  1D1U A;  2NQP A;  2BRK A;  1CJU A;  1XMQ F;  3TWZ A;  4WFX A;  4XPE A;  3SCK E;  1S6U A;  5D0H A;  5HQL A;  3MPY A;  3SCJ E;  3T1H F;  2VFT A;  3QZ7 A;  3OTO J;  2ACM A;  2MGZ A;  1UW4 A;  4ZVQ B;  4JI3 F;  4RJV A;  2ZDP A;  4ED6 A;  2LCW A;  1ULR A;  3I6P A;  1NK6 A;  2DIT A;  2AKW B;  3PV8 A;  1WKJ A;  2NUU G;  4B3M F;  1RWW B;  1RU1 A;  4WYW A;  4KB7 A;  1PC4 A;  3TUZ C;  3N6N A;  4ES3 A;  1EX8 A;  4HI2 A;  2J8A A;  4G6V B;  4KFB A;  1S1X B;  4ALZ A;  2RT3 A;  5ETL A;  4OI1 A;  1JMT A;  4OV1 A;  3UNG C;  1QUV A;  4DX6 A;  4ATN A;  5E7O B;  3QGP A;  1N5V A;  3D6M B;  3TRG A;  4DFJ A;  1L5U A;  4ZLN A;  5A2Q U;  4TNO A;  1CJV A;  3V81 B;  5C5J A;  1VQO S;  1VBX A;  3ITH A;  4TY8 B;  3TZY A;  2VJV A;  2JHE A;  3PJW A;  1S1V A;  4TYB A;  4X62 J;  4N7T A;  1ELO A;  2HWH A;  1NK4 A;  3TJA A;  1LWE A;  2WHO A;  3HZE A;  1RT6 B;  1KQS R;  4M5D A;  3CUN A;  3TUI C;  5CCL A;  3P8B B;  1U2F A;  3CCE S;  1U25 A;  2R8G A;  1HMV A;  3P4U B;  3DLK A;  3ZTR A;  1ZA2 B;  1CPZ A;  5GMD A;  4YQW A;  3M05 A;  2YKO A;  3CJ5 A;  2GV1 A;  1FER A;  2EFO A;  1FRI A;  5B0C A;  1FJ7 A;  2OEM A;  1HWL A;  3N5B A;  1HI8 A;  1M5H A;  4P52 A;  5T7L B;  3W1Y C;  5HLF B;  4CRJ A;  2MZJ A;  1WC0 A;  5KFY A;  1N36 F;  2GHP A;  2N4D A;  5IQ6 A;  3DGP A;  3MPV A;  4NOH A;  2XNR A;  4FNH A;  5THW A;  4NLQ A;  1U1R A;  5KFF A;  4LF8 J;  4LSL A;  1AUD A;  3T5J A;  5KT5 A;  3M2U B;  2ZH9 A;  3GFX A;  3BBB A;  2RUG A;  4F25 A;  4Y3C A;  1N5T A;  4ZPD A;  2NYI A;  4DR3 J;  3JXO A;  2MZT A;  1VRU A;  1RUS A;  3OT9 A;  2VKR A;  3PR5 B;  1WKK A;  1UVN A;  4FVM A;  1N4L A;  4BWJ A;  5CYQ A;  2KJV A;  3EGZ A;  4EWT A;  2QMU B;  2D3O R;  4F4Z A;  4IRD A;  1PYT A;  2MEW A;  3VAK A;  1XEZ A;  3UN3 A;  4DF4 A;  4P72 A;  3NL0 A;  4D3G A;  4DV1 F;  3A1Y G;  3QGG A;  4C8K A;  3DXS X;  4O3O A;  2EI5 A;  3I5B A;  5H9E K;  3THP A;  3VWS A;  3NAH A;  4TXS A;  2E5H A;  4WWS A;  4CT9 A;  1QSY A;  5GAG U;  5M2P A;  5A8R B;  3G2X A;  1U24 A;  1DY3 A;  3VAI A;  1MLA A;  4M5N A;  2RVJ A;  5KFJ A;  2DIS A;  1WDD A;  3PIP Q;  2ZH2 A;  2KZZ A;  4F4K A;  3U1L A;  4OX8 A;  4RUB A;  4DR7 F;  3T41 A;  4H4O B;  1ZM9 A;  1ZTW A;  5G4D A;  1JLG B;  4DQQ A;  8RUC A;  4CTA B;  2NZC A;  2PSZ A;  2XZD B;  4GVB A;  4X65 J;  4MAK A;  3AXM A;  1C1B B;  3PTW A;  3NBP A;  3MCO A;  4NE9 C;  4ED2 A;  2OPR A;  5T41 A;  3GSD A;  5FLX U;  2CIM A;  4KH0 B;  2H5I B;  4K2J A;  1N5S A;  4LRE A;  4K50 A;  2PC6 A;  3M1V A;  1CJT B;  2OIH A;  2DHA A;  2PII A;  1QAX A;  2CQI A;  3WQP A;  4DU8 A;  2MKC A;  1Q82 T;  4RW9 A;  5ETQ A;  2HQF A;  2PN6 A;  3RG6 A;  3AA9 A;  1ZM3 A;  2ZH8 A;  3LA0 A;  1HBM B;  4PWW A;  2M8H A;  4ZVP B;  5KFV A;  1VQ4 S;  2BJD A;  1OPZ A;  3H7H B;  3TVK A;  3MMC B;  3K89 A;  4MFB B;  5F0U A;  2DNN A;  1L3K A;  4HT5 A;  4CI0 B;  3RGI A;  2XBP A;  3LAL A;  4ED3 A;  1YJW S;  3CDB A;  2ASD A;  3ENW A;  3E51 A;  3ZZZ A;  4F2S A;  3ZZU A;  2K2P A;  4RW8 A;  5K14 A;  1RE1 B;  3BGF A;  1PYS B;  2FUG 9;  1RBA A;  1LWC A;  2BQR A;  4WBF A;  4WJB A;  1HNZ F;  4NLT A;  4NLR A;  2QN6 B;  1U49 A;  2IHR 1;  1DQA A;  4I7F A;  1ROF A;  1HBO A;  1VJW A;  5U47 A;  3BQ1 A;  2L41 A;  2BA9 A;  1YDL A;  3QT8 A;  1S9E A;  1JLQ A;  5FLX Y;  1XMB A;  5D77 A;  1X5O A;  1LW2 A;  5GME A;  2DEI A;  4TQS A;  2FDN A;  3IG1 B;  1QAJ A;  1HKA A;  5D4L A;  3KLF B;  2HNZ A;  3FCW A;  1FX2 A;  3HSG A;  1DRZ A;  4LSN A;  3OQ2 A;  5ITH A;  1FFG B;  1SKR A;  1RT1 B;  3HP6 A;  4EYH B;  5DRK A;  5GVQ A;  3S1T A;  3JSM B;  4FBU A;  1YRX A;  3AA8 A;  2KXF A;  3IN5 A;  3W5X A;  1NLK L;  2LEC A;  1NH7 A;  2R7Q A;  1HWU A;  2BJ1 A;  3P5B P;  5HMY A;  2YWG A;  4QYZ J;  1S5Z A;  3M30 B;  2L9N A;  3HCX A;  4C3K A;  2Y0S D;  1IKY B;  1WHV A;  3W5Y A;  3PX0 A;  1Y5I B;  4X64 F;  1G1X A;  1VIS A;  4WTY A;  1VI7 A;  3EWG A;  4EI2 A;  4DOZ A;  2KHD A;  2WOM A;  4OYM A;  4N5S A;  3GLJ A;  4PG8 A;  4OZJ A;  3BYP A;  1FEH A;  5IQQ A;  2QYC A;  5KFR A;  4NLX A;  1LWF B;  4C8Y A;  4J9N A;  2LP4 A;  4TLQ A;  2PFD A;  4N56 A;  2JEI A;  2YPY A;  2MYF A;  2XMK A;  4K4Y A;  4JI2 F;  1JX4 A;  1GK8 A;  3ISZ A;  4WP8 A;  2OPQ B;  2DXF A;  1N6Q B;  4BWM A;  4JI1 F;  1S97 A;  1U1K A;  3NLC A;  3TQ1 A;  1BQN A;  2ROE A;  2XYG B;  4IDK B;  4NCG B;  1APS A;  2OHD A;  1G4C A;  1NO8 A;  2VAS A;  4RLE A;  4IG3 B;  2NSC A;  2OD6 A;  4USU A;  3ETO A;  2ZH7 A;  5J1E B;  4KKO B;  1OWX A;  1UVK A;  5CAB A;  2I8E A;  5KG0 A;  1VJQ A;  5DQI A;  3CDU A;  3NCP A;  3T6J A;  4EO8 A;  3JB9 k;  2OP5 A;  1TK5 A;  4DPO A;  3QWP A;  3K8V A;  2Y0B B;  1JK9 B;  2G0C A;  3V4I B;  2NYH A;  1M1G A;  1FO1 A;  2F8M A;  4I67 A;  4IUF A;  1RHJ B;  2VDI A;  5B0D A;  3OSN A;  1IM6 A;  3UO0 A;  2LEA A;  2PI5 A;  3BGL A;  5I3P A;  3SV4 A;  3TJ9 A;  1S6O A;  3BO4 A;  2X1B A;  1G2E A;  2XMW A;  5CD4 A;  3HMJ G;  3JQM A;  3PX6 A;  2PGC A;  4ZP9 A;  4DS4 A;  1QE1 B;  2MKH A;  2J7W A;  1TU0 B;  3DCA A;  3PKY A;  1TV6 A;  2FYX A;  3J80 Y;  4UY8 5;  1UWB A;  5BYS A;  3JTO A;  5LL6 d;  4HDG A;  2W2O P;  2QO3 A;  4CLL A;  1EP4 B;  2NPI A;  2LEP A;  1BE4 A;  3GG1 A;  1RLC L;  1NK9 A;  2VFU A;  2ZH3 A;  3N6M A;  2BQU A;  3G9C A;  2OSQ A;  2IFX A;  1TKX B;  2B8P A;  2FB0 A;  1VLO A;  3HM9 A;  4WE1 B;  1RWU A;  6FD1 A;  4BC7 A;  5LXR A;  3QJP A;  2YWF A;  1Q5Y A;  2E5L J;  4DUZ F;  2R7T A;  1ZM4 A;  3EDR B;  3NNA A;  4K8R A;  5J2Q A;  4X4T A;  1FFW B;  2HQ3 A;  3PFE A;  3D66 A;  3M6V A;  5L9X A;  3RB0 A;  2V2V A;  1RQ0 A;  1OQ6 A;  5HK4 A;  1WSR A;  1RTJ B;  4RU2 A;  3PJX A;  4QPX A;  5DG8 A;  4LMZ A;  2W4C A;  2HQG A;  4DQS A;  1QSS A;  2P9E A;  1SJ3 P;  1TL1 B;  4ZVT B;  1S1W B;  4K4W A;  1QVF R;  1YTY A;  4DCO B;  3C6T B;  4UOH A;  1T0T V;  2BAN B;  3U1M A;  1VRQ C;  3IR6 B;  4NZ7 A;  4LF9 J;  3VQT A;  2RML A;  1C4C A;  7FD1 A;  1SL1 A;  2ZWP A;  3MUM P;  1GEH A;  4ZMM A;  5E3R A;  1J5E F;  3G6Y A;  1EKR A;  4JI4 F;  5KFG A;  2AZ3 A;  1YZ6 A;  2AT1 B;  2BQ3 A;  3CCT A;  4RUC A;  2GQC A;  2W8L A;  1FJC A;  4AT1 B;  2MZ1 A;  4M5G A;  2RS8 A;  5IC4 B;  3Q8Y A;  2Q79 A;  4ID5 A;  3MM8 B;  3J7Z 5;  5H9F K;  2BW2 A;  1S7I A;  3UE2 A;  3EE3 A;  5B0B A;  3VR1 A;  1OY6 A;  4ECV A;  2X51 A;  2KO1 A;  2JVR A;  1HQU B;  2R7V A;  5ETN A;  2MTL A;  1JXL A;  4ZLP A;  4WZQ A;  4NEZ A;  4PRF A;  3T5K A;  4RR5 A;  3IRX A;  5J2M A;  2UUT A;  3CO0 P;  1RB0 A;  3PHE A;  1EET A;  1JKH A;  3KHG A;  2Y1L B;  3PRD A;  4V19 X;  2RRB A;  4J9V A;  3D7S B;  1YI2 S;  3BKU A;  1UPP A;  1UJ6 A;  2ZBQ A;  1UMJ A;  4IFY A;  1WWH A;  4ZIW A;  3PYG A;  2YY3 A;  3OFH A;  2LYV A;  3H5X A;  3D1O A;  3ENA A;  2MKS A;  3ZTQ A;  2OFH X;  4AQY F;  3GIL A;  4Y28 C;  4QWA A;  4LFB J;  3NNH A;  1XK8 A;  4M5J A;  4WF9 Q;  1C0U B;  5MLC V;  3EPI A;  3NNC A;  3NKY A;  2DNL A;  4N8N A;  2DTJ A;  3OD2 A;  4XK8 C;  4B3O B;  4ZLJ A;  4MK8 A;  5CZV A;  2LLZ A;  2OEK A;  2R9L A;  2Z58 B;  1N54 B;  1SBR A;  4M63 A;  3C3L A;  3ILI A;  4JBC A;  3GV7 B;  4OJG A;  4Q5V A;  5CA5 A;  4K2X A;  4DR2 F;  2HQI A;  4MIB A;  2OFG X;  2BE2 B;  4C7Q A;  1NB7 A;  4YB6 A;  1N5Y B;  4M95 A;  2ALZ A;  2GQQ A;  4WIQ A;  1UEK A;  3OL8 A;  3HK2 A;  2KVI A;  2W25 A;  3CCL S;  2SXL A;  2ZC3 A;  3F73 A;  1RKJ A;  3BBC A;  3VAJ A;  2VQF F;  5A0Y B;  5SUH A;  4DUY F;  3H4D A;  2K1R A;  4JI6 F;  4QYR A;  2WSF C;  2HWT A;  5HBM A;  4J9S A;  4M1K A;  3BDP A;  3SMZ A;  5C2C A;  1W7W A;  3K5N A;  3G6V A;  4BC9 A;  2YKM B;  1UJ5 A;  1QM9 A;  4I56 A;  5HRO A;  3A8J A;  1KN6 A;  2B6A A;  4P7T A;  2XMA A;  1A7G E;  3OL6 A;  1CC8 A;  4CLU A;  1FA0 A;  3QRP A;  2H3E B;  1SCJ B;  4RWW A;  1UWA A;  2MZQ A;  3CD0 A;  1U0H A;  2FTR A;  4MMO A;  2DK2 A;  1XNR J;  1JWW A;  4HYK A;  3O6Q A;  3E8O A;  2KH9 A;  1HNV A;  2CAJ A;  2ZD1 B;  1X4F A;  2RIL A;  3RB6 A;  1KR4 A;  1UVM A;  4X66 J;  5HAN A;  4FXW A;  4UQG A;  4IOC Q;  5GAD I;  3BGR A;  1EIY B;  3DI6 A;  4IR9 A;  4OL8 A;  3AY0 A;  3CIM A;  4YP3 A;  4ZJQ A;  4F0K A;  3OR2 A;  4OX7 A;  4OYW A;  4PQU B;  2W7O A;  1TK8 A;  2D3U A;  4P6Q A;  2NLW A;  2AJF E;  3LO3 A;  4DV7 J;  3IWL A;  3VGT A;  4ECX A;  3PR4 A;  2JLF A;  3CJ0 A;  2BOA A;  2GC8 A;  1N0V C;  2QLB B;  1T3N A;  1UFK A;  4JI0 F;  5JMN A;  5BXI A;  4OZ3 A;  2CQB A;  3CC7 S;  3KK3 B;  4OX6 A;  4KSE B;  4QIW D;  2GVZ B;  4K0K F;  3D1Q A;  3QBC A;  1KON A;  4ED0 A;  3DHX A;  3M2V B;  3M8Q A;  4OYA A;  3H20 A;  1WC3 A;  4RW4 A;  3NGR A;  1C4A A;  3G71 S;  2HNY B;  3D28 A;  2D3Z A;  4Q2L A;  1OS5 A;  2XSF A;  2IM0 A;  3GON A;  3PEH A;  1SH3 A;  2W2M P;  1Y3J A;  3FCV A;  1N88 A;  5AJ3 J;  4GVL A;  1QTM A;  1OMS A;  2VPW B;  4CYU A;  4OZ0 A;  5C24 B;  1N32 J;  2CDR B;  3MM9 B;  4UY8 T;  2ZM6 F;  3BZQ A;  3DRS B;  2V4Q A;  3IBF B;  2UUA F;  3C2P A;  4W4M A;  4PAB A;  1C1C A;  3MHY A;  4FS2 A;  1IKV A;  1PAU B;  4LF7 J;  2N3O A;  4CIO A;  3IAM 9;  2MLY A;  1BY9 A;  3GU0 A;  3R97 A;  2IAJ B;  5GAH U;  2B56 A;  5KFD A;  3PY8 A;  2CJA A;  1IR0 A;  3RRK A;  3PYE A;  5HO4 A;  2HGM A;  3M2R B;  1IBM F;  3OLB A;  2HHU A;  2OAU A;  1WF2 A;  3E3X A;  2XLK A;  1X4H A;  5L1J A;  4ETX A;  2WTF A;  2HHW A;  1NHU A;  2QA2 A;  5DS7 A;  2K7J A;  4YB7 A;  4G65 A;  2XWY A;  4LRD A;  4DR1 J;  3SZ2 A;  5KT2 A;  1AZS B;  1HR0 F;  1GH8 A;  1S99 A;  3M8Y A;  1RTI B;  4I2Q B;  2JEJ A;  1NCL A;  3EGN A;  3HPO A;  1NKB A;  4PXD A;  5T14 A;  1OIA A;  1WC4 A;  5H9E J;  4CT8 A;  1K9M T;  3MR7 A;  2R2R A;  2XHC A;  3HHD A;  4EGL A;  1X9W A;  1DZ5 A;  3SDE A;  3Q8U A;  1TKZ B;  4ZHR B;  1RYS A;  2DY9 A;  1M5O C;  4FYY B;  3W2V A;  1ZOT A;  4LF1 A;  1XN9 A;  3LW5 C;  4A47 A;  5KFN A;  4ZCI A;  5E41 A;  1S1T B;  1FXD A;  1TEL A;  2G1D A;  2IC3 A;  1HHS A;  2GJI A;  4YS2 A;  1X31 C;  3I82 A;  3HD1 A;  4PXC A;  1HNW F;  3BH7 B;  5F8G A;  4GC7 A;  1XMO J;  1RXO B;  2KRB A;  1IM4 A;  2HAI A;  2ZUA A;  4U6P A;  1SJ4 P;  4R8U A;  2X1A A;  2ZOG A;  1E6V A;  2V50 A;  2OKQ A;  1REG X;  4G1I A;  1NME B;  2DGU A;  1H73 A;  3ET6 A;  1XMQ J;  2IY5 B;  3SQG B;  1MWY A;  3T1H J;  4RKU C;  2J6S A;  1I94 F;  4N8O A;  2RH3 A;  3L7O A;  2H5J B;  3FFI B;  1LNQ A;  2Y1R I;  5B0F A;  4JI3 J;  4HH0 A;  2ALY B;  3PIO Q;  2ZHA A;  4DV4 F;  1D9A A;  3TJ8 A;  1B0T A;  2BUN A;  2WB4 A;  2YNI A;  3IS9 A;  1PBU A;  2RQ4 A;  3GP9 A;  1FWP A;  1KLM A;  2AEM A;  1RT7 A;  4B3M J;  3DDK A;  4I68 A;  1RTZ A;  2Y1J A;  3LP0 A;  4RL1 A;  3UR0 A;  3KJQ B;  4QOT A;  1DLO A;  1FNM A;  2I6W A;  1LEO A;  4MH8 A;  3GMG A;  2DNG A;  5KG6 A;  2FJX A;  2YQ1 A;  4ED1 A;  2L9W A;  4DHV A;  4D3H A;  2IYG A;  2FJB B;  1Q0N A;  2A6M A;  4OX9 F;  2VG7 B;  2B4V A;  3HX9 A;  4ELU A;  4TLR A;  5I42 B;  1U02 A;  3HJF A;  3MEC B;  4ZIV A;  4LF6 F;  3BSA A;  2PMW A;  4PUO B;  4EBE A;  4EMD A;  1F60 B;  2DBB A;  3FSI A;  2E5I A;  3ZZ0 A;  4ID8 A;  2QFJ A;  2CA9 A;  3HXM A;  1GTE A;  4NXM F;  2GHW A;  3H4B A;  3KMS A;  2YNG B;  3M8Z A;  3PDN A;  2RS2 A;  1RT4 B;  4UT4 A;  4LR7 A;  3K8W A;  5JJB A;  2AMC B;  4EBD A;  1ZBT A;  2IJF A;  4DJB A;  5KTQ A;  4DR4 F;  1Q95 G;  2UP1 A;  1VRT A;  1TZ0 A;  1RAD B;  4RNH A;  2XY7 A;  1WHX A;  1T05 A;  5F8J A;  1RAC B;  2CPJ A;  5J2P B;  1FCA A;  2H48 B;  1VIX A;  4IH5 A;  4GMK A;  4HT7 A;  1S49 A;  3BSO A;  5HN0 A;  3CCJ S;  4B9N A;  1XR7 A;  2G0J A;  3UCG A;  3UCZ P;  2HFS A;  3DOK A;  3ZZR A;  2G1H A;  1UL3 A;  4ES2 A;  4CNZ A;  4RX6 A;  3X3U A;  1SQG A;  4K4S A;  1M0S A;  3BKT A;  5ETP A;  1N36 J;  4C11 B;  3VAF A;  2HVZ A;  2X1F A;  2BKP A;  4PPZ A;  3GIJ A;  5CQG A;  2VDH A;  2PEH A;  2XS2 A;  2Y9H A;  3THT A;  1RYR A;  5C42 A;  2B4O A;  1HD0 A;  2XTJ P;  5B0G A;  1CSJ A;  1RT2 A;  2Z2L A;  5JUM A;  1AXQ A;  2DH7 A;  2HK2 A;  4TKT A;  3UI3 A;  3J81 j;  3EZO A;  3K5M A;  3PO5 A;  3NOG A;  1VIO A;  2UZA A;  3MDF A;  3OXL A;  4DR5 F;  1FFS B;  3DYA B;  1U6F A;  3M6U A;  3QSI A;  2D9O A;  2BKO A;  4KTQ A;  3MZI A;  3B6B A;  4JOU A;  1T9Y A;  1LWE B;  1MRO B;  4DV1 J;  3W3S A;  2JVO A;  2YKN B;  5JVH Q;  2EEY A;  4YHH F;  3PX4 A;  4JV2 A;  4RW7 A;  3PW7 A;  1DQ8 A;  3Q89 A;  3OTC A;  1Q81 T;  2NCK L;  1REV B;  3TAR A;  3C6U B;  3FQK A;  3GQC A;  3LAK A;  3CWJ A;  4S0M A;  4OYZ A;  2RDI A;  3MED A;  3DRR B;  3KUG A;  4EK2 A;  2LVW A;  2WCX A;  2UVU A;  2HRU A;  4DV6 F;  1U1O A;  3QZ8 A;  3PG9 A;  1H7W A;  2ZBI A;  1OPI A;  1T7P A;  4YR3 A;  3CDE A;  5IWA F;  4U7C A;  5D0G A;  4L72 B;  2LXU A;  4X84 A;  3R5D A;  1WUU A;  4DR7 J;  1WG1 A;  1VOM A;  2AGP A;  1NJZ A;  5EHH A;  2MB0 B;  3DC2 A;  3RUB L;  3UCU P;  3MM5 B;  2MQL A;  3DRY A;  1GMV A;  2P2C B;  2ZWO A;  2CWK A;  1TL7 B;  4FYX B;  1F3F A;  2Q43 A;  2VOO A;  3WIV A;  5SZT A;  1EJ7 L;  2F4V F;  1L3U A;  2XQC A;  2NXU A;  1BUX A;  1Z2Z A;  3DGV A;  4URQ U;  4KJI A;  3AB4 B;  3AOA A;  4RW6 A;  3LP1 A;  1EQM A;  1PAE X;  1EB0 A;  4Q8F A;  5BYQ A;  1X5T A;  3IM9 A;  4C8N A;  3CCM S;  3FBC A;  1YIJ S;  2QLJ B;  2XLJ A;  4QWB A;  3US5 A;  1JLA A;  2FJA B;  3MMA B;  4BHQ A;  1T8E A;  4LBI A;  1N34 J;  1JLC B;  1ZAX A;  1F2G A;  1UZH A;  1HNI B;  1IWG A;  5KFB A;  2DR5 A;  3GJS B;  1N33 J;  4W92 B;  4RZR A;  1IJF B;  4HDH A;  2R7W A;  4OZN A;  3KLE B;  4RWX A;  1PIL A;  1SQF A;  4WK1 A;  2HND A;  1U1Q A;  2VFS A;  3BV8 A;  3R5J B;  3E2E A;  2HIQ A;  3M8P B;  3KHR A;  1R6V A;  1X5P A;  4UTG A;  2HBY B;  3D54 A;  3OR1 B;  2VQE F;  5F8N A;  4E0D A;  1RGV A;  4NRT A;  2ROP A;  1KTQ A;  5H9F J;  4FYV B;  2KVQ E;  4ECR A;  2PMH A;  4C8Z A;  1JLB B;  3TAM A;  2BBE A;  3OUY A;  2CG4 A;  4A46 A;  2XMT A;  3D68 A;  2O3D A;  2DGX A;  4AD6 A;  3HZG A;  3UVJ A;  3M1V B;  2DH9 A;  4IFV B;  1WTB A;  1WDT A;  4RW9 B;  1XJW B;  1O51 A;  2DEJ A;  4YB1 P;  2C2E A;  2W4D A;  1GMU A;  4DZD A;  2P5V A;  1M90 T;  5FJ4 A;  2JC1 A;  2IBK A;  5DG9 A;  5A8W A;  4B02 A;  3R2D J;  2HHV A;  1TKT A;  4JI2 J;  3H5S A;  5L1I A;  2AEJ A;  3QPI A;  2V2Q A;  4ZPA A;  4RW8 B;  4JI1 J;  4A8K A;  3T5L A;  2NXJ A;  1VQK S;  5B0A A;  2FD2 A;  5IM0 A;  1KP6 A;  1G3O A;  3EGV A;  1YBA A;  2VB6 A;  3DRP A;  2OML A;  2MST A;  4J9Q A;  3FC9 A;  1OY8 A;  2DGT A;  2DGW A;  2R2S A;  1IWA A;  4O0N A;  2EG1 A;  3DLE A;  4QIG A;  2HQD A;  4TN2 A;  3QRQ A;  3M32 B;  4GC6 A;  2E5G A;  1RSC A;  4ZS6 A;  5HMZ A;  3MEG A;  4ECY A;  2HNZ B;  3G6E S;  3T1A A;  2EVZ A;  5DQH A;  5KT4 A;  4DPY A;  3GIM A;  1TMJ A;  3DLG B;  3FZB A;  3H5U A;  2GIQ A;  1HBU A;  5E3P A;  1OO0 B;  1KTV A;  3LGM A;  4OMF G;  1NUE A;  1FNX H;  3MOJ B;  1HI1 A;  3K5P A;  4QWD A;  2BYC A;  4IOA Q;  2FVR A;  2RE1 A;  1RTD A;  2EFQ A;  1LK5 A;  2W9A A;  3CMA S;  3MEE A;  2F8H A;  1P9Q C;  2BXJ A;  1WI8 A;  4ZN3 A;  3RR8 A;  4X4S A;  3ZZP A;  1QUP A;  3I0S A;  2W9B B;  2RDD A;  4O23 A;  2BJ3 A;  4IR1 A;  4U7U D;  4E8U A;  1U4B A;  1WEY A;  2EG2 A;  1Q4R A;  2MQO A;  1WG4 A;  5D6G A;  5FDL A; 
#chains in the Genus database with same CATH homology
 3R7B B;  1PAU B;  2H5I B;  2Y1L B;  2QL9 B;  4ZVO B;  2XYH B;  1RHQ B;  3EDQ B;  4LSZ B;  3NS7 B;  3R6G B;  2XYG B;  3R6L B;  2QLB B;  4JB8 B;  1BMQ B;  1RWV B;  2CNL B;  3GJT B;  2CJX B;  1RWK B;  1IBC B;  1F9E B;  1RWM B;  1RWN B;  1RWX B;  2H4Y B;  1NME B;  2QLF B;  3D6M B;  4ZVP B;  2QL5 B;  3KJN B;  3IBC B;  4DCJ B;  2QLJ B;  3D6H B;  1QTN B;  3GJQ B;  3R7S B;  1RWO B;  4DCP B;  1GFW B;  2QL7 B;  2H65 B;  1PYO B;  2H4W B;  2C2Z B;  2CJY B;  2H5J B;  2C2M B;  2C1E B;  1RHK B;  5IC4 B;  1RHR B;  3EDR B;  2XYP B;  2Y0B B;  1I3O B;  3RJM B;  1RHU B;  2HBQ B;  3GJS B;  2C2O B;  1SC3 B;  1RHJ B;  2H48 B;  2HBZ B;  4ZVQ B;  1I51 B;  1RE1 B;  3D6F B;  3KJF B;  2DKO B;  1SC4 B;  2P2C B;  2FQQ B;  3SIP B;  1RWP B;  3GJR B;  1RHM B;  3P45 B;  3P4U B;  1SC1 B;  2XZD B;  4ZVT B;  2CNN B;  3KJQ B;  2H54 B;  4ZVR B;  2H51 B;  2CDR B;  4ZVS B;  1RWW B;  3R5J B;  4DCO B;  3QNW B;  1QDU B;  2CNO B;  5IC6 B;  2CNK B;  2XZT B;  5K20 B;  2HBY B;  2HBR B;  3IBF B;  1ICE B;  4ZVU B;  2C2K B;  3R7N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...