4ZVRB

Caspase-7 variant 4 (v4) with reprogrammed substrate specificity due to y230v/w232y/s234v/q276d substitutions bound to devd inhibitor.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
YKIPVEADFLFAYSTVPGYVSYRVPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESDSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvrB00
3GJTB 1RWMB 2HBZB 2P2CB 2XYHB 4ZVUB 1RHMB 1RE1B 2CNNB 1BMQB 3RJMB 1RHQB 3P45B 1SC1B 1ICEB 1QTNB 1RHUB 1SC3B 2HBQB 2XYPB 2CJYB 4ZVRB 4DCOB 2H65B 2H5JB 4ZVPB 2QLJB 1I3OB 1I51B 2C2KB 4ZVTB 3KJNB 3NS7B 1GFWB 3P4UB 2H5IB 1NMEB 1RHRB 2C2MB 2CNLB 2H4WB 4ZVQB 2CDRB 2H51B 3IBCB 3GJRB 2QL7B 2HBRB 2DKOB 4DCPB 4ZVSB 1RHKB 3R6GB 2Y0BB 1RHJB 3KJFB 2CNOB 1RWXB 3D6MB 1PYOB 2C2ZB 5K20B 3R6LB 3GJSB 2Y1LB 3EDRB 1QDUB 4JB8B 1RWNB 2FQQB 3EDQB 3R7BB 3R5JB 2QL9B 3R7NB 2H48B 3R7SB 1RWKB 2CNKB 1RWOB 1PAUB 2QLBB 2H4YB 2XYGB 4ZVOB 3SIPB 2C2OB 1F9EB 2XZDB 1IBCB 5IC6B 3IBFB 3D6FB 2QLFB 2XZTB 3KJQB 2C1EB 4LSZB 1RWPB 1RWVB 2QL5B 4DCJB 2H54B 3GJQB 1RWWB 3D6HB 2HBYB 1SC4B 5IC4B 2CJXB 3QNWB
chains in the Genus database with same CATH superfamily
2MZ1A 2BJ9A 1VJWA 2IJFA 3I9ZA 1X31C 5DGAA 1S6QA 3O2IA 2R4FA 4WE1B 3MMBA 5LJ3Y 3DGPA 3BSAA 2DNQA 1XERA 5CA5A 1N8RT 3GPAA 1LV5A 2B9XA 3HSDA 4NEYA 7FDRA 3FC9A 5BYSA 2A10A 5F0WA 2DEJA 3CCES 2AGQA 3OW2R 3OR1A 1EKSA 9ATCB 2KZMA 2NUHA 4DR2J 2YWEA 1XMOF 1KS2A 5HO4A 2C2NA 4O4GB 4F25A 1H72C 5IOLA 2BANB 3H0PA 3C15B 4PWDA 3DLBA 2GJ2A 1VLYA 3FBBA 2KFYA 4DPWA 1VK3A 1Q16B 4N56A 1XR5A 5J2NA 1T05B 2DGUA 2GHPA 1GXTA 2B4VA 1HD1A 4URSA 3RZAA 2X3DA 1X5PA 4DS5A 4PUOA 1FK9B 4Y2KA 3BPDA 2J5AA 4HL9A 2NUUG 3AQPA 4X4UA 8ATCB 3JYTB 3Q8YA 4KKOB 5CYJA 1WACA 3KLGA 5JUMA 2W9BA 3DLJA 1GAOA 4LIRA 1K9MT 3BPSP 4UZBA 5E3CA 2YKNA 1S1TA 1HIYA 1TUVA 1M90T 3G87A 4KE5A 1RCOB 4HYKA 2YQ1A 3I0RA 1AFIA 1QAJA 2BQ3A 3M6VA 4QU6A 1UMJA 2HQGA 1Q79A 1T3NA 4CLFA 3OVAA 4ZP8A 3JB9k 1MWYA 1OWXA 2PEHA 1Q8LA 4ZLNA 3QJPA 5GMEA 5H9FK 2CPFA 1IKXA 2LXUA 4P2XA 4OYBA 4F0KA 3T1YF 2ZKUA 2C2ZB 1Z4UA 4JYAJ 4DLEA 1XMQJ 3V6HA 4M5GA 5K14B 1ZM4A 1EZZB 4DL2A 2H1YA 5A0YB 1WJ9A 2IDLA 4U6PA 1QD1A 4OI2A 1NU4A 3Q0AA 5J2MA 1TU0B 2JOQA 2WBRA 2YNGA 4RWWA 2NCKL 3OTEA 2KU7A 3TAPA 2ZH4A 4J9SA 3NOCA 5KFFA 4RU2A 1FKOB 1WEXA 4KH1B 3PYFA 5J1EA 1T9UA 3BR9A 2EW9A 2C3MA 2YNIB 2AT1B 1LWCA 3ZC4A 5GADI 2R2RA 1T9YA 2PDAA 3K7RA 1D3WA 4LIWA 2G1DA 2JC1A 3FRYA 1CJKB 5KT2A 3BQ2A 1FEEA 1GX6A 1XTZA 4FVMA 4ED6A 3FNNA 1C4CA 1N32J 1RTHB 2QX0A 3MOJB 3UCGA 1UEUA 3MHYA 1F3VA 3VGUA 1UETA 1XJWB 5LSLA 3H98A 4NLYA 2XWYA 1R0BG 1CULB 4K4TA 1NHUA 2ZOMA 3KLEB 2HVZA 4USTA 4A8KA 1IKVA 4LSZB 4UY8T 1D9AA 3X3UA 4CNZA 1Q78A 1HD0A 1PJ7A 2UVWA 2N3OA 1KVJA 3NKYA 4OZLA 5KG1A 2ZZNA 2JFDA 3M2VA 2YKQA 3PW2A 2DVIA 2DITA 2XSJA 3QT8A 3EICA 2AEFA 3M1VB 1HBOB 1VBYA 1I51B 4G1PA 1SJ1A 2K2PA 3SFUA 3WX8A 1GFWB 1RWUA 5HMXA 2PIIA 4I4BA 2WOMB 2ZBRA 2WVFA 2VUGA 2VFSA 2G0JA 2F5GA 1NB7A 4ZIWA 5ITHA 3W62A 1A7GE 4X4NA 2UUAJ 2MZTA 5HBMA 4NLQA 4Q43A 1HBUB 3Q83A 1BQNB 2CWXA 5B7WA 4A8QA 1L3VA 3ICLA 4WP3A 2Z57B 3C66A 4DR2F 3B54A 4RW7B 1FO1A 2ATLA 3I82A 1N5SA 1DTQB 1K0VA 3FKBA 1QE1A 4C8YA 2NSBA 1KD1T 3RAQA 4N5SA 3BGFA 4B08A 4B3SJ 2ZH6A 2L3MA 3TAQA 3Q8UA 4NL5A 1T03B 1LXJA 1S9EB 4XAKA 1RE1B 3LUYA 4I0WA 2EKYA 1JIHA 1GX5A 3U02A 4Q2LA 4IG3B 2CQBA 3AXMA 1HARA 4U8YA 3CJ8A 4P72A 1U1OA 4B9SA 3V5RA 2FHMA 3W8GA 2LECA 2QLJB 2I1RA 5KAKA 1S0MA 3NL0A 1H6KX 2YTCA 2R7QA 3CJTA 2YKMA 1J27A 5DG9A 3UO0A 1VQOS 2Y0BB 3AD7C 4LF7J 1TKZB 4DX6A 2DNLA 1ZZNA 4WYLA 1TUWA 3RBDA 4FYXB 4H4KC 2YNFB 3BM7A 3ZFVA 1Z1ZA 4MFBA 4ICLA 2IVYA 2DNGA 2D3OR 4ANDA 3UQSA 1A0OB 4M95A 4UY85 3HX9A 3QT7A 2CQPA 2LXFA 1U8SA 1YK9A 3CT9A 1RWVB 1FFGB 1JB0C 4XTTA 2JLGA 3TVKA 3UDEA 3WDOA 1XMQF 4KBIA 2FJDB 1Q0NA 4LUBA 2VL1A 4R5PB 2DR6A 3Q8SB 3C2PA 3AJ2A 2HQIA 3BR8A 3LAMA 3ULHA 3RJMB 2DNKA 4I6WA 4LF5J 3MMCA 1U0HB 4J9MA 1CS4A 5HK4A 4KHRA 3MD1A 3PACA 2DO0A 2LU1A 2HMIB 1XBWA 2CIMA 3WIVA 2VU5A 2RU3A 4M5KA 2KT3A 1CJTA 3KMSA 2D3O1 4N41A 2AHOB 5CYQA 5I3UA 3TP2A 4YFUA 2EKNA 5GAEU 4Q0BA 2W4CA 1Q7YT 5CD4A 5HJYA 2OEJA 2XY5A 1G3OA 5D4LA 4XDDA 2AKWB 1N32F 4DQIA 2VASA 3FVYA 3G8TA 3ZO7A 1X5TA 1AZSA 1KVIA 1RWWB 1B70B 3N6LA 4TY9A 3OTOJ 3RW6A 3PM9A 4XPCA 2Q1LA 1X4BA 1JKHA 1RHQB 1B3TA 1T94A 5EX0A 3DOKB 2XNQA 4HLBA 1HI0P 1NB2A 2IY5B 2MKSA 1TKXA 3HFZB 3CCTA 4V19J 2CPDA 3G6XA 2RDDA 3M9NB 3VZHA 4U7UK 4HVZA 3TOQA 4CCHA 2E5GA 3D7SB 2ZOFA 1EX8A 3NMRA 1EB0A 3T3FA 3ENQA 3BYRA 2RQKA 2B6AB 4J9RA 1G1XA 5ETRA 4A8WA 1LWEB 5GAHI 2V8VA 3R6LB 4Y6IA 2EC2A 2HWIA 1LW0A 1RUSA 1TUGB 4O44A 5HLFB 2POKA 3QGHA 3BJYA 5HROA 5IFMA 4IQMA 1XC9A 1XK8A 1FKPB 1VIOA 4YS2A 2UUAF 4ER8A 3HI9A 2V0NA 1S79A 5AJ3J 1FD8A 3TA1A 1RXOB 2AEMA 2HK2A 3D5MA 1YLXA 1C0UB 1RAOA 1SUQA 3CULA 1KTQA 3KFWX 5KT4A 3RAXA 2C3PA 1UTAA 3CGIA 3S6EA 1UWBA 3O3LA 4Y2CA 2J0XA 2NZ4A 2BM1A 2VFRA 2YY3A 1HBMA 3MEKA 4B3SF 4RNHA 1O51A 3IS9B 2MKHA 3P4UB 3N4WA 3NGSA 3U27A 2OPQA 4R8UB 2DHXA 1HYSA 1YWXA 3PW7A 3BBFA 3GIIA 4F2SA 4EWTA 3M8YA 1T8EA 4ZPDA 2OMOA 1FCAA 4C11B 1FA0A 1Q8IA 4PKDB 4MK9A 1U49A 3K5PA 3CSKA 2J7WA 2HZCA 2AYBA 3RRKA 3R27A 4A48A 1XMBA 5I42A 2I38A 2W8LA 3CJSA 4JI7J 2PMWA 4DG1B 1F60B 4BWJA 2APOA 1H74A 3FJ2A 2J76E 4LBPA 1U09A 4LF7F 7FD1A 1YJ9S 1PO6A 4NLDA 1SC6A 3RUBL 4Q2MA 1S6OA 5KG7A 3HO1A 4DN9A 2QV6A 1KQFB 2QLXA 3TAMA 3QGIA 5A8KB 3CC4S 4Y00A 4ZKAA 2OLWA 4ZPWR 3WC0A 4C3LA 1IBKJ 4M5LA 1SIZA 3S8SA 4EO6A 3IAS9 3OHBA 4WIQA 3FZ2A 5J2QA 2DJWA 4O3OA 4C0OC 2EFNA 4IFVA 5JMNA 4CYUA 4K4XA 1KNZA 5FDLB 3TJ8A 4LF5F 2JVRA 1C1CA 4DV5J 4DFJA 1RWXB 4P75A 2XS7A 2ASJA 1WF2A 2Q43A 3KXDA 3TZWA 3SIPB 1SH2A 2JZ5A 2MDAA 4X2BA 3MF5A 2MLXA 2Y3YA 1IM4A 1T9VA 3MECA 4YY3J 5K8NA 2A3JA 1HBNB 2R7UA 4UOFA 1U1MA 1B0VA 3W5ZA 2IRXA 1TAUA 3VGSA 2V50A 3LO3A 2LCWA 5F8IA 1KBRA 4F3QA 3CWJA 2DCUB 3JTOA 4RBVA 3IRXB 1WKJA 3RB0A 1FNOA 1HPZA 3TA0A 4DFPA 1UVJA 1FTRA 5ETMA 1S59A 1DLOA 3OTOF 3PRVA 2QL7B 2RE1A 3D9BA 2X3GA 3KNGA 4PQUA 1BGXT 2HGLA 5KG0A 4DL6A 2BJ8A 1RKJA 1RTIA 4PYDA 4ZJQA 4L73A 2G2ZA 3OQ2A 3BH7B 2I8EA 3BDPA 4IRCA 3H5YA 4HTIA 2DNOA 3G8SA 3DLEA 2OKQA 2VC0A 4PQAA 3R5DA 2WSFC 3DLLQ 1BQMA 2E9RX 3FFIA 3ENWA 2XMVA 1EHWA 2QT7A 2VJUA 4DU8A 4EK2A 3BEGB 4ID5A 2L08A 4ECSA 4NXNJ 2ZD1A 2D1CA 2KHCA 3L7UA 2A2DA 4ZCLA 1E6YB 2HVEA 2YWHA 2HNYA 1HWIA 3FSIA 4ZVRB 3CC2S 1NJZA 1IQZA 5C25B 4WXWA 2O01C 3PX6A 2WB1D 2PN6A 5AJ3F 4KGVB 1RGVA 2ZWPA 2K1RA 2M4MA 2W2OP 3PTWA 4K8RA 2ZBQA 4P10A 1VRTA 1S77D 3KK3B 2OP5A 1BHNA 4RW4A 1EIYB 3QWPA 3A8KA 4I7FB 5LJ5Y 1HWJA 3IGVA 3L9ZA 2IBKA 3D6MB 4DMZA 1REVA 4NLUA 2DRDA 3HT3A 1MMNA 2DH8A 4OX6A 1RBLA 3TJ9A 4CH7A 1L3KA 4CLZA 4NWBA 4OYZA 3KK1B 1WWHA 5DRKA 1HNZJ 2HS4A 4L74A 1RT2A 4DF8A 2RMLA 2XMUA 2E7VA 4AL5A 1IR0A 1K8AT 4FNHA 1OPZA 1FX2A 1FXLA 1RTJB 3MM5B 2FPHX 4Z7YA 5KOXA 5RUBA 2R8IA 1FXDA 3NS5A 1GNKA 4JI7F 3CMQA 1TV6A 4F7VA 4LF8J 1VRUB 2MQPA 3NNAA 1FE0A 1IVZA 2ZVIA 3JAMU 4LF1A 4ECQA 2DRAA 1HQEB 4ANEA 3NGUA 3MD3A 3AH6A 1FRMA 4GC6A 2B4OA 2DGOA 1XR6A 3VV2B 5KFJA 1IBKF 2FLNA 1IUJA 1SV5A 3HKZD 5DZ6A 4WFXA 1X4AA 2FIUA 2IA0A 4L3NA 2YKOA 1H0HB 2OPRA 5L1JA 8RUCA 1WHVA 2CZ4A 4OZ5A 3CCJS 1NKBA 5AT1B 3GV5B 2CPXA 1U26A 4YUDA 3I56S 3HHLB 4R25A 3PHTA 3T19A 4DV5F 2Y1IA 4UZCA 4EGLA 5IV3A 4L76A 3I4HX 1Y10A 4B9UA 2G9OA 4J9KA 4EYIB 2ZH3A 3VGTA 1UA1A 3OUYA 4UUXA 5C7PA 3ZTSA 2DNZA 5CABA 4KGKA 4X4SA 1IM6A 1Y5NB 5K8OA 3O6QA 3OHAA 3UI3A 3GYNA 1FKAF 2P9CA 5HANA 1TK0A 5ETSA 1B0TA 3QYYA 3A13A 5KG2A 2BQUA 2JHEA 4C97A 2DNYA 4AL6A 3M8SA 1ZAVA 4MKVA 2W24A 3HFKA 1HNIA 4ZHRA 3BYPA 3SZ2A 2XQCA 2GIQA 1LWFA 4K4ZA 1S6QB 3FEYB 2O66A 3H2UB 2DR8A 4LBIA 3MMBB 1WF1A 4GC7A 4K50A 3TWZA 1C1BA 1XNRJ 4CO3A 1NK0A 5AXKA 2UXDJ 4BS2A 3CJQA 3HP6A 5EX3A 5D0RA 1AXQA 1ZBTA 4UQGA 4KRWA 4DS4A 4F8RA 4DV7J 3N6MA 4FN5A 2NREA 3PFOA 3ZTOA 1VOMA 2AQ4A 1H2TZ 3MEGB 5EWFA 1F3FA 3H5XA 2MYFA 2JLEA 1PSDA 1RWMB 2IVMA 3K2YA 3D54A 5J2NB 2RS2A 1YJUA 4RKUC 3J7YU 2JVOA 4LSLB 4PUOB 1YRUA 4CRJA 1U0SA 2AYGA 2PSZA 4U9RA 4NXNF 2W9BB 4OYWA 4EZ6A 2DNMA 3IM8A 3CB4A 2BJEA 5FLXY 2R7VA 1NSPA 2V2VA 1FVSA 1YSJA 2V4QA 3I0RB 3EWGA 3GTYX 1NBEB 4H4OA 4MK7A 1RAHB 4ZS6A 1SH3A 5B0EA 1FDAA 4NOHA 4EBDA 3HHDA 5CAAA 3VWSA 1YI2S 1X4EA 2VD3A 2DEIA 4YDXA 3B4MA 2MLZA 1HW9A 1LOUA 5KTQA 3GSIA 1YRTA 3FUYA 3POTA 1JLFA 2XLIA 1DURA 3MUTP 1Q95G 4CM2A 3FCVA 4KTQA 5E41A 4M5NA 1UEKA 1FDBA 4IH7A 2R42A 1WDTA 3NGTA 2CJYB 1HNZF 2YNGB 1HHSA 4EMDA 4FNIA 3ETOA 3KHGA 1KWMA 4PAAA 3EPIA 3QBCA 1KFSA 4KFBA 1CJVA 1FNXH 5J1EB 1JLGB 5D4NA 2XHCA 4LF8F 2FC9A 1B7YB 2RH3A 4WFYA 2NPIA 4GKKJ 1HMVB 4ALZA 1LWCB 2E1MC 3AXKA 3GQCA 2V69A 3W9IA 4WE1A 1FDDA 4QOTA 2HQCA 1UAWA 1TL1B 3PG9A 2DNPA 2A0FB 3RTVA 1VDHA 2QA2A 3D0GE 3OSNA 4F4AA 1JQGA 3UR3C 3HXMA 2VG5B 1XEZA 4DJBA 5K5MA 3ZTPA 2MLYA 4ZCKA 1VQKS 1WHXA 2HAFA 4ETZA 2ZE2A 2HLTA 1JLAB 2BYCA 2MTLA 3C15A 1PIEA 3J81Y 3CJKB 4IH5A 1Q1KA 3I0SA 2CNNB 1BMQB 1T05A 4RX6A 4FBUA 1YBAA 4WIIA 2IHR1 1DQAA 2AIRB 2Z2LA 3FGVA 4F4XA 4EBEA 1URNA 1HFEL 4CLUA 2IBOA 1IKVB 2C2KB 1VRQC 1V3SA 3KJNB 1NDPA 2MZSA 4KKOA 4J91A 1SBRA 3ELHA 4H54A 2NXEA 3DU5A 2M8DB 4HHUA 1F2GA 5KFEA 1JNZB 3HM9A 4A8YA 1MMLA 1ZTTA 1H38A 3Q23A 3R7NB 5FIIA 1KTVA 2WZ1A 2C2DA 3M30A 1F9EB 1WI6A 2RF2B 2AZ1A 4USIA 2HLUA 3RW7A 3D6FB 2DGQA 2XZTB 1PC5A 4H4KA 1RAFB 4ZDNA 3MPDA 1QSSA 5L38A 5KG3A 1XNRF 5KFWA 3MFHA 3NGRA 3MURP 2UXDF 4USUA 1FE4A 3BKTA 3VTIA 2DNNA 2DH7A 1TFWA 1YJ7A 3HJVA 4DR1J 4ECZA 3D0IE 4FZVA 2KM8B 4DV7F 5A0YA 1CSJA 4LR8A 2E5LJ 4ZPAA 2HRYA 4PEOA 2J9DE 1RTDB 1SKRA 1QE1B 3VAGA 1CLFA 3LGMA 4NA1A 1VC5A 4C3KA 1O8BA 2ILZA 2MKKA 2MZQA 2YH1A 3CCVS 2ASYA 4ILRA 3PJ9A 1SI9A 2Q79A 2X51A 2JRSA 3IO1A 2YNIA 3THVA 3I55S 4ED5A 1UVNA 2R7RA 3W64A 3EDQB 3TA2A 4C9DA 1NHVA 2B5JA 4B9MA 1RYSA 3ENAA 3IFEA 3MM6A 3MTKA 4J9NA 2IFXA 2DR9A 3WBZA 3GCXP 1KFDA 3D6HB 2CPEA 5GADU 5KG6A 3GE9A 4QJVA 3PX0A 3E2EA 3BKUA 3MZIA 1XQIA 2J9DA 4ICLB 1MNEA 2GNKA 3KG4A 3KDNA 4YHHJ 3TEGA 1IKWA 4YB5A 5AE3A 4CO0A 1CULA 4DL7A 4DR7J 3JSMA 3MEDB 3KLEA 3F44A 2J0WA 1VMBA 2RJZA 5KT3A 3EZUA 1T9XA 3CCMS 4E2FB 3G2XA 1SPBP 3MMCB 4OMFG 1XWLA 2BJDA 3D0HE 2YQ3A 3CIMA 2DT9A 3M1VA 4HHHA 2R7WA 1U02A 1WG4A 1PAUB 4WFZA 4F26A 4PXEA 2WOMA 3TEHB 4GKKF 3G71S 2M8HA 5D15A 3OVSA 5F0UA 1CJTB 1UPMB 1TKTB 2DGSA 5CYQB 5I3UB 3T5LA 3GU0A 1VQ4S 4QR2A 4Q0BB 2RVJA 3RBZA 4LQ3A 1PYSB 5L46A 4DEZA 1BQNA 1GMWA 2A6MA 4X84A 2EK1A 3MTJA 4K2JA 1KQGB 2MQQA 3CD5A 3TX0A 3TZYA 4BC7A 2MB0B 3ISND 4EU0A 4WPAA 4OX7A 1RHRB 2DHGA 4O4RA 1GMVA 4CT9A 4DCPB 3QGGA 1JKHB 2E7XA 1Q7LB 2V9KA 3ZZRA 4Y0FA 3EVOA 2OSQA 7AT1B 4IG3A 4CI0B 2FJBB 4LRCA 2RU9A 4OJ3A 4QWCA 3TR5A 1R8HA 2EEYA 3AA9A 1TKXB 1SIWB 2E1RA 5L8RC 3TQEA 3GLJA 1PCAA 4LF6J 1P27B 3GFHA 1S9FA 2DY9A 3DC2A 5DETA 3RRGA 2F7VA 1S4FA 4LVOP 2HFOA 2MQOA 2Z30B 2BX6A 4O3SA 4K7QA 2G13A 1LW0B 2N82B 1JMTA 1NK6A 2YNFA 4CLSA 1N48A 2F8MA 2C28A 5HROB 3W8PA 4KR0B 4QYZK 1RHUB 2J6TA 4DL4A 4WTYA 1VFJA 3R97A 5KG4A 3VGVA 4DPXA 3IN5A 1X9WA 2X1AA 3JSYA 3TYTA 4DR1F 4R5PA 1R8CA 2CNLB 5LSOA 5B0DA 5M2UA 1B99A 4N77A 3HT0A 2XS2A 2AJ0A 1SUQB 3ZZZA 3DRPA 4LQ9A 2E5LF 1DFDA 2F9DA 1V3ZA 1U0HA 4J90A 2Y1JA 3SDEA 3DGVA 4OYAA 3LWLA 3C46A 2HMIA 3MCNA 2B3TB 2OPQB 2WCXA 1N0UA 1HYSB 1TZ0A 1N5TA 1NKCA 3OTBA 4JI2J 4B9LA 2BKOA 5DLGA 3BF4A 4IOBA 2FJAB 1LKZA 3OFGA 5ETPA 4EUVA 4Y2AA 4Z7CA 3OR2B 3H4DA 1N36J 5I42B 4LFBJ 4LJMA 4IUFA 3VHQA 4RNMA 4X4RA 1PBAA 3GSDA 1NSAA 2LU2A 2IA6A 4GVBB 2Z8QA 3X1LB 2DYAA 4P2MA 3NEKA 3G82B 3TAMB 4MKYA 4OX9J 2EFOA 3CCSS 1Q4RA 3GFXA 2DH9A 2CPHA 3ENVA 4YHHF 4DV4J 2ATCB 2HNDA 4ED0A 3ZZYA 3RB6A 4DR7F 3PY8A 3G6ES 3V6JA 1CQMA 2G0IA 2J7KA 4BHQA 3HHEA 4CT8A 1UL3A 4OFZA 2XZDB 4CYUB 3BO4A 3PW0A 2MSSA 3WX4A 2NLWA 2WONB 1QAXA 1CC7A 2B6AA 1BWVA 3QRRA 1LWEA 2VF3A 5F9NA 4JV0A 2ZM6J 2VPYB 2NSCA 1W25A 2EG2A 4HACB 2GCFA 3VVUA 5E2QA 2BMBA 4JI1J 2DO4A 5DQGA 3MDFA 3I5BA 2R2UA 5D4OA 2NXJA 5GAHU 3LP1A 2F65A 4NXMJ 2E5HA 3IWLA 2VV5A 1U25A 3A3OB 1RHKB 4MKAA 4N8OA 4IRDA 1GH8A 3W2VA 1PG5B 3AFGA 4XIUA 1FVQA 2PFFB 1VLOA 1VQYA 3LGNA 1QSLA 3DNCA 3LA0A 1DLOB 3G6YA 2KVIA 3SCJE 5B0AA 2W8KA 4PQUB 3SQGA 3KJQB 3EM1A 1HW8A 4WK3A 1RTIB 4YN3B 4TXSA 3W1YC 3LOUA 3PRBA 1M0SA 3C6TA 3Q24A 2AJ4A 5DO2A 3BQ1A 4LF6F 3HSJA 3EGWB 2QG9B 2VBZA 1BQMB 3FFIB 3OPKA 4DQSA 1U4BA 2HIYA 2RHQB 2LXIA 2C3OA 1SQFA 2YXLA 1UVKA 2ZD1B 2JEIA 2RQ4A 4X4OA 5A8KA 1U48A 4DX5A 2BE7D 4Q45A 3BSOA 3IXQA 4P74A 2HHHJ 2N4DA 3SMZA 3ILLA 1FEHA 3TNVA 1VRTB 2B8PA 4Y34A 3UCUP 4NLPA 1SKSA 3EZOA 3OJUA 4JV5F 3QGPA 3MPVA 2KVQE 1ZAWA 5IC4B 4P2SA 5H9EJ 3CCLS 4GO7X 1R8AA 3C6UB 4DR6J 2ZH2A 5KG5A 3E01A 3CD7A 3P45B 2XGQA 4PPZA 5ETTA 4JI2F 3CTRA 3PRDA 1RT2B 4FF3A 4MH8A 4C8LA 1RSCA 5F8HA 3MR3A 5DGBA 4CWBA 3SCKE 4HI1A 1N36F 4C0HA 4LFBF 1PC4A 1NNDA 1TV6B 2OI2A 4P2FA 4FF4A 4A4JA 1UW9A 2GQ2A 2VFVA 2W7OA 4WFBQ 1H98A 1MWQA 3AY0A 3AOAA 3IRXA 4IH6A 1T3OA 1M1GA 4FP9A 3CCQS 3J81j 4YEAA 1TR0A 2Y9HA 4OZ0A 3HD1A 3W7BA 1RU1A 4OX9F 3MFIA 2KRBA 5DM7Q 3PDNA 2E9ZA 2HNZB 4CTAB 4DV4F 1JXVA 1SV5B 1ZM3A 3MM9B 2R7SA 1NH7A 4MMOA 3PXGa 3MR2A 4RL1A 4B3OB 1TP7A 1DJ0A 1S48A 1RBOB 4ES3A 5H1SV 2Q3PA 1PAEX 1YX2A 5A8WB 1X0PA 3KLIB 3M9OB 4I6YA 3HZGA 1TELA 4DSJA 1FHTA 2Z2MA 3QQCD 1EAYC 1TL5A 4OJ1A 2YKAA 3H8YA 2ZM6F 4QIWD 2DHHA 2C2MB 1ROFA 3NGDA 2FUG9 3IBCB 3CPWR 3KMQA 4PR6A 3IRWP 4JI1F 2W4PA 1YZ6A 1X4HA 4ZLLA 1E6YA 2B8QA 1MSWD 3ZZPA 2G2YA 2XMWA 3I87A 4KAIA 1KKHA 4DV2J 4FYWB 4AT1B 4NXMF 1N56A 1LWFB 2XI3A 1MN7A 2VH7A 2EWHA 1IWGA 5ETKA 4J9VA 1RWPB 3CJ3A 1C1BB 2JNJA 5ETOA 2B4UA 1J5OA 3DYAB 1KDNA 4P7VA 2XLJA 1AUDA 3HF5A 4NLOA 5KFRA 3J7ZT 3DMJA 5DJBA 1P9QC 4IO9Q 4AFFA 3KLFB 2KDOA 3GR1A 2HGNA 2QA4G 4LF4J 4DCOB 5DDPC 3RR7A 2BBEA 3CMAS 5BYRA 2CJ9A 4ECWA 1FFWB 1P6TA 4RR5A 4C3MA 4QU7A 2GMLA 1RTJA 3MM5A 4ZITA 4WKYA 4OI4A 1VRUA 4TNOA 4QCLA 3QSYB 5KFBA 1A9NB 4NZ0A 2BOPA 1QDUB 1HQEA 2J8AA 4PG7A 2JJ4D 4MIAA 1WORA 2LKZA 1I5OB 2BRLA 5SUHA 2LMIA 2UUTA 4IFYA 1KLMA 1FRJA 4JI3J 4DQRA 4J37A 3JSBA 3LALA 4ZJLA 1ELOA 2ZWOA 2MHEA 1QVFR 2AWZA 5FLXU 3QPIA 3QJJA 1WUUA 3DM2A 4TU7A 3QNWB 2HHHF 1SB6A 1T9TA 2NYIA 1RCXB 4MYUA 2HVDA 5J1PA 2W25A 1Q81T 3ZTRA 3W3SA 3ZZUA 3JQJA 4URQU 3TANA 1JLFB 3C16A 1SCJB 2MGZA 2CQ0A 1NDCA 2N7CA 4ID8A 2CPZA 3D3CJ 4X62J 5T41A 4QWDA 2BKNA 5CZVA 4DR6F 2HBRB 1U1KA 2IM2A 2FHKA 2HQ3A 2ZBCA 4X64J 2VB6A 2CZVC 4LVNP 4X65J 5JJBA 4LSNA 1YQHA 5CYMA 3K17A 2LEPA 1KEKA 2V67A 4W4MA 5J1NA 5IT4A 3CCRS 4NEZA 4C6AA 1URRA 4LF2A 2GVZB 1NO8A 1N5QA 5HMZA 1C4AA 3DDIA 1NZAA 4CDIA 1Q8BA 5E3AA 1HWKA 2V63A 2FHOB 3U7JA 3DCAA 4J9UE 1NJWA 1VK8A 3IR6B 4K5RA 3CJ4A 2ASDA 2BDPA 4RUHA 3HVTA 5B0FA 3MCMA 2NR0A 4I2PB 2XGPA 3J7Z5 3JTNA 1JJ2R 1H7WA 1LK7A 1WKKA 2IIHA 5GMDA 2VG6A 1IKYB 4NMLA 2ABYA 3PIOQ 2GA7A 1N4LA 2WVBA 3M8QA 2ZE2B 1R3NA 3OVBA 3MAQA 1NH8A 3BS9A 2PI5A 1IWAA 2LQ8A 4YB7A 3D1HA 1SQEA 5F3TA 4W90B 3MEGA 4L75A 1R8PA 3CF5Q 2CDRB 3TI0A 2P6TA 4DPTA 3I0SB 4IKAA 3GG1A 3J81U 2KXHA 5EN1A 3KNAA 1LXNA 1MU2B 1FWKA 3JQMA 4LSLA 4RPFA 4LRBA 1M5PC 5C42A 1P9YA 2GV1A 2Y1LB 4B9VA 4RNFA 1KN6A 4GO5X 2J9CA 1ZA1B 4GRSA 1VISA 1S9GB 4EEYA 2VJVA 3UN3A 3QAUA 2CQDA 4P71A 1S10A 1WF0A 2XM3A 3NGKA 4FXDA 3BN7A 1S6PA 4B9TA 1L5UA 5HN0A 4A8SA 2W2NP 3PYDA 5I3QA 1AROP 4A8XA 2YX4A 3LANA 2VA2A 4DV2F 2MHNA 3FCHA 3CO0P 1C2PA 3T9NA 1FTCA 3WIUA 1M1HA 3M30B 4FVCA 3MPUB 2FHJA 3B78A 3EZ5A 2RKIB 1LW2A 5D78A 4O23A 2J9EA 3O8WA 3HHNB 3E3XA 1KHVA 2M9KA 5HVFA 5DDQC 1PBUA 2IM1A 2MJUA 1UFWA 2IYGA 3OV7A 5ADZA 4JV2A 4LF4F 4Q5VA 3QFWA 3EUNA 4DL0C 3TQ1A 5DLFA 1QUVA 2DIVA 1RISA 5D8HB 4NCAA 1DQ9A 2HIQA 4QIVA 4C4WA 5C2GA 3GV7B 3N28A 2XSFA 5BR8J 1S4EA 4ZPCA 3DI6B 1NZ8A 5MLCV 1JLGA 1UPPA 3D4JA 1HMVA 3N9UC 3W5XA 4ZLJA 4ES2A 4TY8B 4RW9B 2ZJRQ 2HFVA 3VALA 1TL1A 2B5JB 2AF6A 4JI3F 2FC8A 4IRKA 1WTFA 1Q5YA 3GCWP 4LMZA 1TFYA 3MM6B 4KJIA 2VG5A 4QR1A 4O0NA 2ALYB 2IC3A 4F2RA 4NCBA 5IQ6A 4FDFA 3OD2A 2AMCB 1V6HA 3H40A 1JLBA 4ITSA 3NCQA 2CPJA 1JLAA 2DNHA 5A6WA 6FDRA 2JH3A 1HNWJ 3CJKA 3FMBA 1NM2A 1GMUA 1N6QA 3GWCA 2B56A 1IKWB 3SV4A 2ADCA 3OL8A 1K44A 3JSMB 2BKPA 2WVCA 1SL2A 2MJNA 4X62F 3DN9A 3I9V9 3OTCA 3KJVA 4H4MB 4XO0A 3QIPA 1WC3A 3ET6B 1RAAB 2QLBB 3P5TL 3A8EA 4J7CA 2XMAA 4DHVA 4X64F 5KFNA 1HWLA 4X65F 2B51A 2CPYA 5KFHA 3ILOA 3BBCA 1JXLA 1R8BA 4WJBA 2D9OA 3QZ7A 4P7TA 3CEDA 5KFGA 4RW6A 1UKUA 1UZDA 3SEOA 1RYRA 2R3VA 2RF2A 1SC3B 2NPFA 5BJRA 5F8LA 4PCQA 3GONA 4HR2A 3OXGA 4DV0J 2XB2D 1RABB 2NZCA 4OYIA 4DWIA 4NLVA 2H5EA 3UDCA 3SSRA 3FSXA 1RTDA 2V4JA 2VONA 5E33A 1UA0A 1YRXA 1HNVA 1X8DA 1X4DA 3QAEA 1IXKA 5LOQA 3UD5A 2AU0A 4B3RJ 5IS2A 1FJ7A 2ZH8A 2FGCA 2N7YA 2FD2A 3R3TA 2Z0GA 2CKWA 4G3IA 1D9FA 3DOLB 2G1HA 4CLYA 2A1BA 2ZNYA 2QE5A 2E1CA 2EPIA 2RD5C 4ILLA 5A2QU 1DQ8A 4DDFA 1LWXA 2E7WA 3QFHA 1HLWA 5LXYA 3D3BJ 1PGZA 2QIFA 2VC1A 4OHXA 4YQWA 2ZBPA 1FD2A 2DRBA 3R5GA 5E0OA 1Y9OA 4DZ6A 2JEJA 1IN0A 2W7AA 4NLXA 3KJFB 3PKMA 2AEJA 4YB1P 1S1UB 4KH0B 2M0GB 4PRFA 2HRTA 2GQCA 3D67A 1WNEA 1OO0B 5B09A 4NI2B 3MEDA 4JYAF 4BDPA 3EMTA 1NSKL 3M32A 2E44A 2R2SA 4O3NA 4BLGA 1S12A 4PG4A 4FS1A 5IT9U 2UV8A 4TQRA 2R2TA 3DRPB 3R8YA 1QSYA 5C2CA 3DFEA 4DZDA 3Q2TC 5A8RA 1NUEA 2BM0A 5DG8A 1GEHA 2GJIA 1UP1A 3SDEB 4CLPA 2XMMA 5BR8F 2RHSB 4WP9A 3AJ1A 5DS7A 2CQIA 2Y8WA 3TUIC 1RAEB 2VIHA 5F3ZA 4DN0A 3AHPA 2XMTA 1BWEA 2OO4A 3MCSA 4RNNA 2HEKA 4ZOSA 1TKTA 3PFEA 3CDBA 5A6PA 1R0AB 3AB4B 4OYOA 3GJRB 3TZZA 2OMLA 2XG8A 1RAIB 1Y7PA 4RO0A 2O67A 2BXJA 1DAXA 2BRKA 3M8PA 3Q89A 1NJXA 1QVGR 2RDIA 2YWKA 2VICA 1NSQA 1TVRB 1FRHA 3L4BC 2QL9B 5I3PA 1HNWF 5F8MA 3NLCA 2GW8A 2HHPA 3JTPA 1BQXA 3H2VE 2J6SA 4GMKA 2HNDB 2J0QD 2F3JA 2XY6A 1WD6A 2VQFJ 3T1HJ 4YR3A 5D4PA 1X4FA 1L3TA 3M2RB 2HG4A 5T7LA 2B7BB 3GJTB 3ZXWA 5C24A 4DOZA 4NYOA 2XYHB 1RHMB 1DRZA 3QT6A 3QMQA 9RUBA 1Z2LA 4ZK7M 1S1VA 4F3OA 4U67Q 1QTNB 2B0GA 3MCOA 3K8WA 1AFJA 2FJEB 3NG8A 2RUSA 2XHWA 1VYAA 4DV1J 5EWEA 3Q8QB 1CPZA 2NYHA 2BE2A 2CDQA 2B9YA 4WU2A 3SV3A 2ZUGA 4HDGA 3JSRA 5CD4H 2QC3A 5AXMA 4NA2A 1X5OA 5K8PA 2B7CB 3CCUS 1OSDA 2E66A 2ROGA 3LP1B 5KFPA 2AP6A 4DV0F 1HA1A 2XYGB 3G96A 4B3TJ 4DQQA 2MQNA 2MZRA 1YGYA 2VKZG 4MIBA 5JVHQ 2DGVA 3MMJA 2KN4A 2DBBA 1VGYA 4J9PA 3W2VB 4USVA 4EYHB 2CQGA 3NS6A 4CLLA 1JJHA 1KONA 1UCNA 4B3RF 4TKTA 3S7RA 3PR4A 4JBCA 3WC2A 3SQGB 2B4PA 5AXNA 4NLWA 2MQ8A 2U2FA 1YJVA 3BKFA 1O0PA 1Q53A 3HDSA 1NAQA 3PEJA 4OHZA 3C6TB 5D0GA 2C3UA 1NMEB 2H4WB 5CXTA 3OR2A 2IM0A 3R1HA 1HKAA 1RAJA 2QYGA 3ETMA 1DTTA 3QO9A 3CJ5A 2JEFA 1WKLA 2KG1A 4GVBA 4NCGA 6FD1A 3VQTA 3B4DA 4WYWA 1JJCB 5M2RA 4ZVOB 2FVCA 3G82A 3SSSA 2P9EA 4J9LA 2KI2A 3CO9A 1O5JA 1XN9A 4QW8A 4UW2A 1P8GA 1JJ4A 2DGWA 4QWBA 5LSRA 1ZZFA 1R43A 1OY9A 3SQOP 2HWHA 1FERA 4QWAA 2Z58B 3QIDA 3DLKA 1DHMA 4OV6A 4DI6A 3MAAA 5IT0A 1KR4A 2WONA 2DGTA 2ZZTA 3CJ2A 4FF2A 1ZS6A 1HI8A 2XC9A 2OJ3A 4AD6A 2FZCB 4ZVHA 2QSWA 2CQCA 4HACA 2DKOB 3E01B 2KXFA 4DL3A 4LF9J 1TQLA 4QZVB 4I1TA 2L9WA 3O5TB 2FQQB 4X4VA 2OH2A 2W1BA 2HPUA 4OLOA 1CG2A 3DLHA 2H9ZA 5IXUA 1RT1A 2ZH9A 2YBVA 2M52A 4HTJA 2C42A 4RBUA 4ES1A 3Q22A 3MAHA 2E9TA 3A12A 3JAMY 4ED2A 3HMJG 4NLRA 1MW7A 1OQ3A 2F9JA 2WSEC 2NS1B 3IGNA 3PIPQ 1LEOA 4IR9A 4WZMA 1FJCA 3NY0A 2HHQA 1R27B 2VQFF 3T1HF 4DUTA 2CJAA 3ZNUA 2FY8A 4C2MA 1UWAA 5ETLA 5BYQA 2A6OA 2V4RA 2YKPA 4M5DA 1I6JA 2MQLA 3THTA 4NMXA 1R6VA 2CQ2A 4C8NA 4UT4A 2CVIA 3L3CA 2J0SD 2JDJA 3EX7B 3HVAA 1EETA 2WVDA 4MJKA 2GJFA 3IMQJ 3TARA 1YZ7A 3KYLA 1RJJA 1RT3A 3T41A 2MQMA 3UR0A 4HEA9 2YQ0A 4MKBA 3GG0A 4B3TF 4MIWA 1Q86T 1QY7A 1T9WA 5H9FJ 3NBPA 3MMAB 1ZOTA 4ZP6A 4OZ1A 1J5OB 2WW8A 1NK7A 3IP0A 3N0VA 2H5IB 5D0HA 2E1AA 1YITS 2H51B 3HFVA 3PHEA 3DMJB 3KKFA 4FPRA 3C6UA 1RA6A 5LM7E 3MUMP 4KHMA 3SBMA 3ZZ0A 2HSEB 5IM0A 4OZNA 2EC0A 2UUWA 4A8MP 1REGX 3TUZC 4KB7A 3HPOA 2KYXA 4OLPA 4NLGA 2WRMA 4HHJA 3THPA 3AODA 1K1SA 3CD0A 3IWNC 4B3MJ 4QWEA 3KHRA 5G0RA 2OFGX 4AYBD 3BZQA 2KFZA 1O6XA 3LQVA 3Q8VA 4RU9A 2KFNA 4M8LA 5CZXA 4IFYB 1KLMB 2HBZB 3VAIA 4DR3J 5A76A 5GAGI 2HHXA 1U2CA 2FB0A 2VODA 2HNZA 2CJBA 4DR4J 4CTAA 4G65A 4KT0C 2XMKA 2HZVA 3MM9A 3DM2B 2DB1A 1DARA 1GTEA 4DUZJ 2Y0SD 3OXFA 3ISZA 3W61A 4B3OA 1S1WA 4NRUA 4KGXB 4JUZA 4PXDA 1T11A 1CBKA 1JX4A 2W2QP 3UN5A 2DY1A 2KJWA 4AQYJ 5A8WA 2BVZA 3NOGA 3C16B 3KLIA 3M6XA 3CE8A 2MGZB 3EXCX 2MPUA 3CXCR 3M7VA 2QJ3A 1FWPA 4ELTA 5KFIA 2B9EA 2YWGA 2L9DA 3IA0A 1M5HA 4TYBA 4LF9F 2GX8A 1YJTA 2Z2ZA 5LT5A 3W9HA 4DQPA 2IMWP 4NA3A 4LSNB 4F4KA 4OZJA 5CYMB 4TLQA 1WSRA 3OTDA 1YTYA 1Y00A 4YY3F 2DHAA 3GMGA 2EFQA 1K0TA 1FI4A 3G9CA 2DXEA 2XI2A 3RYLA 3BGOP 4UUWA 2FLOA 4E0DA 3HZEA 4WFAQ 3L7OA 1VQNS 3HVTB 1EARA 1DY3A 2DPJA 5LMUJ 3D68A 2AGPA 2ZZMA 2LLZA 2OGUA 2JX2A 1MWZA 3DYAA 2RT3A 1D1UA 1I1GA 2CVEA 2VG6B 3NWGA 2BJ3A 3V6DA 1ZA2B 4KHPJ 4LT6A 1VHIA 3M8QB 3KLFA 3SXLA 1PYOB 1B7FA 4CO5A 5HMYA 3KLHA 5B0BA 3DKDA 2DHSA 4I2QA 2G4BA 1OY6A 4G1QB 2GZOA 3I5CA 1S7HA 4OV1A 1HL6A 5L9NA 3F0NA 4RNOA 2YWFA 5L1LA 1SJFA 1M5KC 3TW0A 2AZ3A 1GMWD 3LH2S 4ED8A 3ILIA 2AX1A 4PG5A 5C42B 5IQQA 1U1LA 3VVTA 4K0KJ 3KK2A 2KZZA 1R89A 2VQEJ 3A3PB 3FSYA 3KTQA 5CHCB 4R0JA 1MMDA 1S6PB 3EJMA 3FMWA 2ACMA 1GT8A 1RU2A 2R7XA 2P6SA 2JLFA 3KG1A 2WB4A 3CCWA 1TL7B 4RBTA 4DV6J 1BXNA 1B64A 3LWMA 4LR9A 1M5OC 5B0CA 1WC1A 3KHLA 4Y65A 5I4MA 4JI0J 1LW2B 2QA1A 1T95A 2VHGA 3B6BA 3F41A 3MWBA 3U1MA 1WTBA 2L48A 4DX8H 3GYGA 3K5OA 4ZJOA 2KH9A 3BREA 4C8OA 2RRNA 5IZHA 3K58A 2FY1A 3HD2A 1W26A 2PA3A 2C1EB 3M6UA 4N7TA 2BQRA 1HQ2A 1X4CA 1WELA 2C3YA 2EK6A 4DL5A 3QLHA 1ACMB 2GVZA 2WBMA 3MPWA 1VHFA 1NPRA 3ITHB 3A1YG 2V34A 3A4TA 3FZBA 2MKIA 1N52B 1ICEB 3LF0A 4B3MF 2XCAA 2IJRA 4CIOA 3QATA 3OBIA 2M3DA 2Z4PA 4JV1A 2K7KA 4HI2A 1IJEB 3WHIA 4I2PA 1SXLA 2HQFA 5EDWA 4TYAA 2HHWA 4DR3F 2GGPA 3G86A 1BY9A 1SVDA 1IKYA 1CC8A 4K4UA 2IC3B 1NK5A 3B82A 4DR4F 3JXOA 2V8HA 4QR0A 3UDVA 1JLBB 1VQSA 2XO7A 3T5JA 3UPFA 4NASA 4DUZF 4P52A 2ZJPQ 3QRPA 2R8GA 2QO3A 1RT4B 1MROA 1R31A 1Q8KA 1EQMA 4WFNQ 3F73A 1N6QB 3IBFB 1FT8A 4AQYF 3GIJA 1VBKA 4WWSA 1NLKL 4DBQA 3QJLA 1MU2A 1UVMA 3UW1A 4K4WA 3EVWA 5HP1A 4KQZA 4X4PA 3KJVB 3QIPB 2C22A 1S9GA 1V5VA 2VPZB 4ZP7A 1PKUA 3UDLA 2EI5A 1UVLA 3H90A 3L09A 3UFCX 3OT9A 2BE9B 3IG1A 3O1LA 2EG1A 4KPYA 2MMYA 4DFMA 1KRPA 1JLCB 4RUAA 2CRLA 3NS7B 4IR1A 1HQUB 1RT7A 4O3QA 5D77A 3DRSA 4LBHA 5KFUA 4RW6B 4C8KA 4ZVSB 4IG0B 2QYCA 2HKEA 3JQKA 3TVYA 1VS3A 1NXIA 4F0HA 1W2BR 1Y0HA 2X1BA 1YIJS 2RKIA 3HULA 1S1XA 4PXCA 3K5MA 5LMUF 1K73T 5M2PA 2DIUA 1T0TV 3SCIE 1VBZA 1EKRA 2JSXA 4OYPA 4KHPF 4U8VA 2RIJA 3DXBA 2LQ5A 1JLEB 4NLTA 3L95X 1F9HA 1RZMA 3RB4A 3SSQA 4K2XA 1UJ4A 2V4JB 3WZ0A 4FKXA 1EQ0A 2VBWA 1JNRB 1LQ9A 1HNVB 5JXSA 1VQPS 2V8PA 3DI6A 1XNQJ 4PWWA 3VQSA 2YX7A 2MXYA 2DXFA 3M8RA 2V6AA 4G6VB 1ZH5A 2RILA 2XCPA 4K0KF 4TY8A 2MEWA 1NHKL 4E8UA 2VQEF 3CIZA 3NAHA 4RW9A 2O5DA 2W01A 3VAFA 2ERRA 2UU9J 2RS8A 1VCTA 4KGZB 3EYZA 3FCWA 2W9CA 2PMZD 2QTWA 5HMWA 1XR7A 4KPCA 2UXBJ 1IR2A 2CA9A 2V2ZA 2RB7A 2XLKA 3R2CJ 3P6YC 1FJEB 3TUJC 1KQKA 4YDDB 3QRQA 4DV6F 1KVKA 2FJWA 2UP1A 3S1TA 4DFKA 2R7OA 4JI0F 2F40A 1A6LA 2HS3A 3C8YA 2ZHOA 5J2PB 3V4IB 5HQMA 4YR2A 4ZMMA 4MK8A 1V5IB 3LTOA 5E3QA 1QJHA 3M32B 3C3LA 3CDUA 5LMNJ 1FNMA 1PJ6A 4H4MA 1G4CA 3ET6A 1U1RA 1H73A 1SC1B 4BWMA 3MM8B 3LP0B 2I5JA 3H5SA 3KUHA 4WKRA 1NKEA 1KP6A 2YNHB 5A8RB 5EHHA 4ZPBA 4LR7A 1RLCL 4DSFA 4OI6A 4CP5A 1S5ZA 1YG0A 4I64A 4NRTA 2GVDB 3SFGA 2K7JA 4DUYJ 3M6WA 5KT5A 2WSCC 4NX9A 2CG4A 2G0CA 5EWGA 1F1BB 2F63A 2G2OA 2IMOA 3DLGA 4IYQA 1YVFA 3KUEA 4ED3A 4KO0A 4BCAA 2F1FA 4USHA 3NNHA 1Z2ZA 2ZOGA 1ZPWX 1D0EA 4EBCA 2FLLA 2ALZA 3DOMA 1CJUA 5KFYA 5CH7B 2AJ2A 1SJ3P 2NXNA 3M8PB 1AW0A 3GFZA 2QA4S 3R5BA 3CCZA 3AAWB 1GK8A 1UW4A 2P2CB 3NWRA 2OEMA 2J7UA 1OYEA 1KSPA 3PZPA 2I0XA 3I96A 2VBXA 4QIFA 4USJC 2L41A 3DOLA 1E6VA 3NMAA 5DG7A 4QBUA 2B43A 5T7LB 2E29A 4YR0A 2B9WA 5C24B 2GQQA 2ZNZA 2GMHA 2CQ3A 2PC6A 4RLEA 1S1VB 3LAKA 2CPIA 5DQHA 2AV5A 3CC7S 2J8SA 3HJFA 3TVZA 3HKWA 1QUPA 2X7IA 3N5FA 2DR7A 3R5JB 2ZJQQ 3P8BB 5IWAJ 2XZWA 2IDEA 1NDKA 2VOOA 1WOSA 2BE2B 2BV3A 3BSCA 3PCOB 3KWMA 1IBCB 5IC6B 2HYIB 1K47A 2EFVA 2L9NA 4NYPA 2R7TA 4DCJB 4UOHA 1S1UA 1NEEA 1N5YB 2PE8A 2PEBA 1Q5VA 1TTHB 4NI2A 5CCMA 3H2LA 1FRIA 2YX1A 5MAOA 2XYPB 4IO1A 5KFMA 3M2UA 2GIFA 2LVWA 4USKA 3W2WA 5EGYA 3JS9A 2W2PP 4C0BA 3K0JA 3C14A 1N88A 5KFDA 3RBEA 4DU7A 2P5VA 3T6JA 3T1AA 1C0TB 8AT1B 3OFFA 1XNQF 3P49B 3EVMA 4DLGA 4B9NA 3HLUA 1G2EA 3DRYA 3MM7B 5D3GB 3CDWA 5E3PA 2FZGB 2QGFB 1GXLA 3E8OA 3VZIA 1WC5A 2DGXA 1R0AA 5KFTA 2UU9F 4F02A 2HFZA 3SI8A 3VR1A 4Y28C 4G1IA 4Y2MA 4FKYA 4PZVA 1B0PA 1DTTB 1L3UA 3QO9B 3J80Y 4OHVA 4ZCIA 4ED7A 2UXBF 4L6V3 3R9LA 1N54B 2D3ZA 2RNEA 4NCGB 5BXIA 3NCPA 2MKYA 4C98A 2HFNA 1WHYA 1VQ5S 2CJKA 1HHTP 5HATA 4RJVA 1TVRA 3LW5C 2P8IA 2EFPA 1LK5A 3UVJB 3EGVA 1OJ4A 5KFOA 1VBXA 3IM9A 3V81A 3BH6B 1FRXA 3M8ZA 2CQHA 2I2YA 2IJNA 1YKWA 4OX8A 3M2RA 1NK8A 2ZC4A 5LMNF 2WAQD 4QYRA 4A8OA 2V8GA 4EZ9A 3ZZOA 4DSKA 2KT2A 3DLKB 4AXIA 2CAJA 3MAAB 1JLQB 3ZTQA 1X9SA 1JXEA 1UFLA 3N01A 3TRGA 2C2EA 1RWNB 2PMHA 1ZTWA 1OSCA 2KTQA 4P9SA 4F50A 3OSPA 4ECYA 4DUYF 3FQKA 2HFUA 2LDYA 1S49A 2UVRA 3HHLD 5L9XA 4UOGA 4PG6A 2CADA 1TAQA 2LDIA 1RK8A 1EP4B 4ECXA 5CCLA 3HSGA 1J5EJ 5KT6A 1U1NA 1U45A 2BJ1A 3AD9C 5AE2A 4LFCJ 3BBBA 3ZNJ1 1RT1B 4ZIVA 2HBQB 1LFWA 5GMKa 2HVHA 1UZHA 2OPPB 3UD3P 1VI7A 4ZA1A 4K4YA 1ZM9A 2W2MP 4IDKA 5KFXA 4Q44A 3PO5A 2I9SA 2MSTA 2GC8A 4CM0A 4F04B 2FZKB 3CDAA 2OFHX 4YMEA 4W98A 1NDLA 4CO2A 4NZ7A 4ECUA 1KQSR 3BO3A 2N4CA 3DRRB 1WG1A 2LEBA 1QAYA 1TK8A 3I4PA 1T02A 2EXUA 2IAJA 2ZBIA 4KIAA 4Q8FA 2XWXA 2HHVA 2M7SA 3BV8A 1S57A 4BC9A 1NPPA 3GIMA 3OLBA 2FJXA 2BW7A 4Q8EA 3M05A 4YB6A 3OL9A 1RAGB 2FLPA 2OUGA 2KJVA 4E98A 2DTJA 4M5DB 2RDJA 2RQMA 2JC0A 4M94A 2CG8A 3K59A 3D6TB 5K9FA 3LP2B 1NJYA 1TK5A 4FXWA 1F6TA 1Y5IB 2KKHA 5IWAF 1EETB 4HDHA 4R0EA 1IQTA 3E51A 1UJ6A 1FDNA 4O3RA 2NXUA 1RT5A 1FFSB 3FBEA 2V5HG 4KV8A 1RT3B 3GV8B 2LP4A 4M1KA 2FJVA 2VG7B 3BGRB 2D69A 4WTOB 1BLUA 3BDEA 2ZUAA 1SKUB 3ISNC 1RP5A 5HL7Q 2F8EX 4PG8A 2ZHBA 4C7QA 4C8MA 3MI7X 5KFAA 4CH1A 2CNOB 2ZH7A 3TX8A 3NBPB 3MGJA 1FRKA 1ZM2A 2EBEA 1VIXA 2MZJA 5KFQA 4TN2A 5D6GA 5AXLA 2H3EB 4M5JA 3DGPB 4CLTA 2FGOA 1RTZA 3MEEA 1X4GA 2DCLA 1RQ0A 2FHJD 4ZP9A 3UD4P 1NPKA 2OPSA 3A3NB 1MN9A 2XULA 1BUXA 1F0XA 5IM0B 1GQEA 1H2UX 4KSEB 2J6UA 1YBTA 3OR1B 1UJ5A 2BR0A 2OEKA 1VQ7S 4CO1A 2C2RA 3MXHP 4A8FA 3W5YA 3H42A 4PWDB 3SCLE 1TL4A 5G0RB 4OZ3A 3HCXA 3KLVA 2LEAA 2VDIA 5AE1A 4MAKA 4WK1A 4DSLA 2YVSA 4RW8A 2HZAA 2W7PA 2ZC3A 1X0FA 2XMJA 4F4YA 2ZHAA 2ZVSA 4AE5A 4L72B 2ZH5A 1FJGJ 1RT6A 3PYGA 2D74B 3LGHA 4KC5A 3KLGB 4XK8C 2BUNA 1BC6A 2FDNA 3GR0A 4GVLA 3K5NA 1S76D 3FDSA 3D66A 2I6WA 1S1WB 3KG0A 2YKNB 3MR5A 3J7A1 1NCLA 2M88A 1TL3A 3IR7B 1SL1A 1S1TB 4D3HA 3HSZA 5KFKA 5ETVA 5DDOC 4V1Ak 1M1KT 1R0CB 2ZDOA 4OJHA 3AA8A 2F4VJ 2V94A 5KFSA 1FF2A 1IKXB 3I5AA 4A46A 2XO6A 2K3IA 2UXCJ 4UTGA 2MKCA 4MT1A 5H9EK 1YJRA 1J5EF 2VPWB 4ZVTB 3MR6A 1KOOA 1S97A 3D1OA 3OLAA 4PPDA 2LA4A 4J5OA 1TMMA 2RRBA 1HWUA 1F9FA 3P5BP 5J2MB 4LFCF 4J9OA 3L7PA 3UCZP 4I56A 3LPEA 3NCRA 2Y1RI 3CDEA 5K8MA 1QLNA 1AUSL 4NZ6A 1I94J 4QPTA 1K1QA 2FVQA 3PW4A 3PX4A 3KUGA 1IBMJ 3MMAA 2VZ9A 2E1PA 4ETXA 2UUCJ 4W92B 1S0VA 2R8JA 3T9ZA 5F8NA 4U95A 4OL8A 5DDRC 3V6DB 3VAJA 3OFEA 3Q2SC 2GS8A 5HSPA 2V8DA 1JWWA 2KB2A 3NAIA 3KLHB 2QFJA 4JI8J 1GTHA 2CJXB 3T5HA 4I6AA 4I2QB 2V68A 4DXLA 4N76A 2WW4A 4RWXA 4CLKA 2QZ8A 1VC0A 2AYMA 2GO8A 2LQBA 1HNXJ 4O4GA 3T6BA 3HHLC 2UZAA 2BANA 3I6PA 2AX0A 2X1GA 3KDOA 4WP8A 4FXVA 1VR6A 2BW2A 2LQ9A 2VFUA 3U1NA 3H4BA 1S0NA 1UFKA 3KK2B 1ULRA 4Z2XA 4DPOA 4I67A 3IC1A 1V3RA 3RR8A 4M5IA 1VQ6S 3VAKA 4ZN1A 2GHVC 2ZKTA 2E5JA 1FK9A 3Q8PB 3IBWA 2GO9A 4CQ1A 3JYTA 4U7CA 2D7SA 4GKJJ 1VC6A 2HFSA 3R7BB 2HW3A 3G4SS 3TO8A 3M2VB 2VDHA 1RACB 1F2HA 2OHDA 4ZPTR 2XSJB 2BACA 2PO4A 1F5BA 2MKJA 1W2IA 4ANCA 2Z2YB 2VPXB 2BJ7A 4ECTA 2KO1A 5GAGU 2QMXA 1OPIA 4WZQA 2GFFA 3KHHA 4EFAC 1IBLJ 4KY3A 4AUKA 4AL7A 2W4DA 2ACYA 4NE9C 3G8QA 3D2WA 2QMUB 2HVIA 5FD1A 5HBMB 3MR7A 1WC0A 5K14A 3QLHB 4O0IA 3M8WA 1OS5A 2BOAA 1EJ7L 1Y4ZB 1KOHA 3NP5A 4WU3A 3R6GB 3RAMA 1RHJB 2QLWA 3CVKA 4Q7AA 3KOAA 2YH0A 5K20B 1BD6A 4I68A 4LRAA 2ZH1A 1FKOA 1RWOB 2DK2A 4B02A 3PYEA 1RB0A 4URGA 2GGPB 1KC8T 1H2VZ 2UUBJ 1R7IA 1FJGF 2NXCA 3BGUA 3HK2A 2H54B 3DHWC 5HVHA 3GJQB 1ITPA 4UOCA 1AA1B 1CJKA 4OI0A 2YKMB 3OXLA 3PEHA 3G6VA 4ZVUB 1MROB 4G1QA 1IR1A 4FS2A 4QIGA 4ILMA 4JI4J 3CUNA 2CZ9A 1RTHA 4DPUA 3W60A 4C48A 4CH0S 2JFKA 2OSRA 2Q6BA 4LREA 1HR0J 2CXEA 2D3UA 1UVIA 4FYYB 1WDDA 2YWWA 4MFBB 4QIEA 5HP1B 1H3DA 2M70A 2DD8S 3IAM9 4JP8A 4ECRA 1FRLA 2COLA 4S0MA 2F4VF 1KLNA 2VFTA 4FYVB 4XDCA 3OL6A 2Q6CA 2QEXS 3GIRA 2ROEA 2AJFE 2KXNB 3QSIA 4DSIA 2WTFA 3IG1B 4OIXA 2XNRA 1YJNS 1N0VC 2PGCA 2RRAA 2UXCF 2CQ4A 4F4WA 2IVFB 2OIHA 1D9DA 2RAQA 5LXRA 1RT7B 2HHUA 5E3RA 1AB8A 1TL7A 3DRSB 2HHTA 1CS4B 5HQLA 2X1FA 2GIRA 1YHQS 5GAEI 4PABA 4QYZJ 3GZ7A 2RQCA 1I94F 1S72S 3UE2A 3NXZA 2P9GA 3VCDA 1SH0A 1HBOA 1S1XB 2UV8G 2DISA 1IBMF 3PKYA 5KFLA 5THWA 1SJRA 2UUCF 2HRUA 2HWTA 3R5CA 3ONQA 3EGNA 1HHQA 2D9PA 2ZFHA 5DZ7A 1SJ4P 4JOUA 1FWLA 4JI8F 4DSEA 2F4FA 3R1LA 1HBUA 1Y3KA 5GVQA 4RUCA 3DXSX 2AYEA 3ITHA 1NK4A 4Z37A 5L1IA 2XTJP 2FVRA 3HVWA 1AZSB 3K57A 3S01A 1HNXF 4RW7A 2DNRA 4D3GA 1YDLA 1DTQA 3OFHA 5EUHA 2KL8A 4MTPA 1T03A 2H4YB 1S9EA 1SKWA 1WHWA 3QZ8A 2XY7A 2QFIA 1TKDA 2W9CB 2RUGA 5B08A 4M5MA 2Z56B 5A2QY 4WXOA 4LFAJ 3R2DJ 1X60A 1HI1A 1V9OA 4GKJF 2F8HA 3Q8RB 3N6NA 3R5AA 3C19A 4NPOA 1F5AA 5G4DA 1RT4A 1RA7A 4ZPVR 1TKZA 4ELUA 2YPYA 2CFXA 4NLSA 1CVJA 4FPIA 2ASLA 3UN2A 4O44B 4KYZA 4U7UD 2ILYA 2KT5A 1RDRA 1IBLF 4OJGA 4WF9Q 5KOWA 2GHWA 2A18A 4K4SA 3H59A 5E7OB 1NRKA 1U47A 4ZVGA 2I5JB 1WEYA 2KM8C 4C8ZA 1WOOA 1NK9A 1L3SA 2PA8D 2HHSA 2LYVA 5ETQA 4FBTA 5IT9Y 3HHKA 2V2QA 1RADB 3EGZA 2AD9A 1T7PA 1VQMS 4JI5J 1FESA 1JLCA 2SXLA 1HQUA 4JV5J 2YPZA 4OI3A 1RBAA 1X5SA 1UWBB 4IG0A 4F36A 4TVAB 3DLGB 1HBMB 5IV4A 2UVVA 4KO0B 2HBYB 3GFYA 3A8IA 1APSA 2NQPA 1OMSA 3TUPA 5E5NA 2VKRA 4RZRA 4CZCA 3MUVP 3DOMB 1CJUB 1DBDA 1FXRA 5HAOA 5HJXA 3P3DA 2UUBF 2PFDA 4ZCMA 2A2CA 4EO8A 2Y8YA 4HT7A 2CQ1A 1JLEA 2WHOA 1MLAA 4QW9A 1U6FA 4F0MA 4ZVQB 5KFZA 1ZYQA 3AJDA 4IOAQ 3CNQP 4JI4F 4TU9A 1S99A 1HR0F 1N33J 2K06A 1U2FA 1Y11A 2Q66A 1E6VB 2WK4A 4DX7A 4BBYA 3D28A 2CNKB 2PI4A 3PO4A 3V4MA 3AOCA 5F9LA 2BA9A 4X4QA 4HH1A 4PXBA 1U6BA 1SJQA 3DOKA 5F8JA 4OZ2A 3RRHA 2R9LA 2EVZA 2U1AA 2JWNA 2O3DA 3SYZA 3GILA 1WI8A 1GXUA 5J2QB 2VOPA 4IFVB 3M4XA 2K3KA 1J2VA 1YBUA 3TZXA 4ELVA 1AT1B 1AYEA 5DQIA 1C1CB 4DF4A 4DR5J 4HH0A 5B0GA 2QN6B 1WC4A 4U96A 4A47A 3VAMA 3NRBA 2O1PA 2D41A 2OTJS 3BGLA 2IRUA 4V19X 3LPYA 1S0OA 3CJRA 3BB5A 5J2PA 2XS5A 3V4IA 2CUYA 3BQ0A 5HLFA 5F8GA 2OAUA 1M5VC 3MECB 1FKPA 3RU0A 3M2UB 3PJXA 1Y5LB 3MM8A 3W2WB 3LP0A 4CLWA 1MG7A 2YNHA 3MOZA 4J9QA 3C14B 1VJQA 2XBPA 1C0UA 2GVDA 3RG6A 1OYDA 5KT7A 1W7WA 2QLFB 3N79A 1U6ZA 2WVEA 4ECVA 1VQ8S 1WOPA 4UF4A 2JEGA 3EPGA 3EE3A 1HPZB 5CQGA 1NJIT 1JK9B 1X9MA 3IR5B 1X7VA 4OQJA 2HGMA 3IS9A 5D0EA 2AGOA 1N5VA 4YOEA 4WCEQ 4UQTA 4USWA 4R8UA 2HK3A 4ZN3A 2IM3A 2PT0A 1TMJA 4C11A 4LFAF 2H65B 1N34J 2H5JB 4ZVPB 1I3OB 1S7IA 2KYZA 3J80U 3DLEB 2BABA 4YP3A 4K59A 4FF1A 4DG1A 5DM6Q 1Y3JA 4K4VA 2AW0A 2OTLS 3U1LA 3I32A 4ID5B 3PW5A 3GJSB 3V81B 4AXJA 3ILJA 2H48B 3R7SB 1RWKB 4DV3J 1ZAXA 3FK4A 2V9WA 1RKIA 2HNYB 5HQ8A 3QT5A 2IPOB 3RBXA 3BSNA 2EBGA 4P6QA 3US5A 2OD4A 4TQSA 2QL5B 2K1RB 4CO4A 1D8ZA 3EXYA 4QQBA 2MY8A 3UNYA 4X66J 1U24A 4MYTA 4RW4B 4L3KA 1LFPA 2KRRA 4JI5F 3GP9A 4ZVFA 1QAIA 4ZLPA 3O44A 5FDLA 3FBFA 3F56A 1REVB 4O3PA 3P96A 1B4SA 5ETNA 3V2UC 2R8HA 2JL9A 3FRZA 5KFCA 4K5SA 4B17A 4RUBA 4JI6J 3FEXB 1YJWS 2QSFA 1N5YA 3ADAC 3WQPA 2V2KA 2R8KA 3VAHA 1S6UA 5HI7A 1HBNA 2KHDA 3DRXA 4IDKB 2OD6A 3ZZTA 3H5UA 3CJ0A 1G7CB 3K8VA 2BZ2A 4M5HA 2GAGC 3N5BA 4I69A 4HT5A 3W63A 3QWUA 2C2OB 3D1QA 1WSVA 4ZVEA 1DZ5A 1OQ6A 1C0TA 4USMA 4FYDA 3FQLA 1WEZA 4ATNA 4Y2IA 2QMWA 5FJ4A 5JVGQ 1N33F 2CYYA 2IAJB 4KGMA 1SC4B 4Y3CA 2VBYA 3MM7A 1PILA 5D3GA 3OJSA 3GYXB 1F5CA 3DU6A 4OYXA 2K8GA 1R6YA 3W65A 1XMOJ 2LQJA 1BE4A 2OPRB 1P1TA 2OELA 4ENOA 2MY7A 3BN4A 3RGIA 2XEXA 3PV8A 1XIQA 1WC6A 1D8YA 4OHWA 1SL0A 4ERDA 4EI2A 3CD6S 2PD1A 5L39A 1SQGA 3FEZA 2ZEJA 2FTRA 3AQOA 3I31A 3GIKA 4DR5F 2GMJA 1RT5B 2HAIA 4NYZA 1OIAA 1IJFB 4OI1A 1OY8A 3UVJA 2LFVA 4KV8B 6AT1B 3OUYB 1WG5A 2ZITA 1UEVA 3H20A 5F41A 3UWTA 1CEZA 1VQLS 5U47A 3B8HA 1U7LA 1VQ9S 3TJAA 5HVGA 1KHWA 4F3MA 1PYTA 2HQDA 4LRFA 2DPIA 3FBCA 1P1LA 2FYXA 5C25A 3M9MB 4ED1A 3K89A 2W9AA 4ED4A 1HNIB 3H25A 1JLQA 4ZHRB 4HKQA 4PYAA 3KK3A 1ZPVA 1RI7A 2FVPA 4I7FA 4CNYA 1D09B 3MEEB 1U8WA 2LA6A 1ZETA 4P73A 4WBFA 2ADBA 3T1YJ 2M2BA 2OPSB 3AT1B 2EFGA 3W66A 2KG0A 2ZDPA 1EP4A 2DR5A 2HURA 3W9JA 2IYIA 3J7YI 3AB2B 2GAHC 3CW2C 2E5IA 4F4ZA 1Q82T 2QRRA 3KK1A 2AJQA 3K5LA 1CQNA 3PR5B 3CMES 2OPPA 4JB8B 3Q86A 1N34F 1RLDA 5L1KA 2N3LA 4OYMA 1U2RA 4RW8B 3DDKA 2AJ1A 3T5KA 4LRDA 3NNCA 2IRYA 3PJWA 1U1QA 3PNIA 3DRRA 3RB3A 4IOCQ 2RSQA 2BEFA 4F67A 4TU8A 4N47A 2FVSA 2M5YA 1RT6B 1QM9A 4M63A 3DHXA 3V6KA 3UNGC 4XPEA 4DV3F 3AD8C 2DXDA 2CWKA 3PVXA 5SZTA 1TL3B 3HVRA 3OL7A 4H4OB 1QTMA 4IQXA 4X66F 3AOBA 3J7AN 3LP2A 4DPYA 5C5JA 2UVUA 3HHLA 4N8NA 4DV1F 1U1PA 3POTB 2VA3A 5T14A 3GB0A 5KFVA 3H7HB 1G6BA 3VF0B 4X4TA 3EDRB 5LL6d 1PJ5A 3IWXA 4QPXA 1LNQA 1FX4A 4JI6F 2VG7A 3BGRA 3A8JA 3MPYA 2HS0A 1M5SA 3BO2A 2CJQA 1H7XA 2ROPA 3DDNA 4TLRA 4OHYA 4KFBB 1CJVB 4PWUA
chains in the Genus database with same CATH topology
3GJTB 1RWMB 2HBZB 2P2CB 2XYHB 4ZVUB 1RHMB 1RE1B 2CNNB 1BMQB 3RJMB 1RHQB 3P45B 1SC1B 1ICEB 1QTNB 1RHUB 1SC3B 2HBQB 2XYPB 2CJYB 4ZVRB 4DCOB 2H65B 2H5JB 4ZVPB 2QLJB 1I3OB 1I51B 2C2KB 4ZVTB 3KJNB 3NS7B 1GFWB 3P4UB 2H5IB 1NMEB 1RHRB 2C2MB 2CNLB 2H4WB 4ZVQB 2CDRB 2H51B 3IBCB 3GJRB 2QL7B 2HBRB 2DKOB 4DCPB 4ZVSB 1RHKB 3R6GB 2Y0BB 1RHJB 3KJFB 2CNOB 1RWXB 3D6MB 1PYOB 2C2ZB 5K20B 3R6LB 3GJSB 2Y1LB 3EDRB 1QDUB 4JB8B 1RWNB 2FQQB 3EDQB 3R7BB 3R5JB 2QL9B 3R7NB 2H48B 3R7SB 1RWKB 2CNKB 1RWOB 1PAUB 2QLBB 2H4YB 2XYGB 4ZVOB 3SIPB 2C2OB 1F9EB 2XZDB 1IBCB 5IC6B 3IBFB 3D6FB 2QLFB 2XZTB 3KJQB 2C1EB 4LSZB 1RWPB 1RWVB 2QL5B 4DCJB 2H54B 3GJQB 1RWWB 3D6HB 2HBYB 1SC4B 5IC4B 2CJXB 3QNWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJT B;  1RWM B;  2HBZ B;  2P2C B;  2XYH B;  4ZVU B;  1RHM B;  1RE1 B;  2CNN B;  1BMQ B;  3RJM B;  1RHQ B;  3P45 B;  1SC1 B;  1ICE B;  1QTN B;  1RHU B;  1SC3 B;  2HBQ B;  2XYP B;  2CJY B;  4ZVR B;  4DCO B;  2H65 B;  2H5J B;  4ZVP B;  2QLJ B;  1I3O B;  1I51 B;  2C2K B;  4ZVT B;  3KJN B;  3NS7 B;  1GFW B;  3P4U B;  2H5I B;  1NME B;  1RHR B;  2C2M B;  2CNL B;  2H4W B;  4ZVQ B;  2CDR B;  2H51 B;  3IBC B;  3GJR B;  2QL7 B;  2HBR B;  2DKO B;  4DCP B;  4ZVS B;  1RHK B;  3R6G B;  2Y0B B;  1RHJ B;  3KJF B;  2CNO B;  1RWX B;  3D6M B;  1PYO B;  2C2Z B;  5K20 B;  3R6L B;  3GJS B;  2Y1L B;  3EDR B;  1QDU B;  4JB8 B;  1RWN B;  2FQQ B;  3EDQ B;  3R7B B;  3R5J B;  2QL9 B;  3R7N B;  2H48 B;  3R7S B;  1RWK B;  2CNK B;  1RWO B;  1PAU B;  2QLB B;  2H4Y B;  2XYG B;  4ZVO B;  3SIP B;  2C2O B;  1F9E B;  2XZD B;  1IBC B;  5IC6 B;  3IBF B;  3D6F B;  2QLF B;  2XZT B;  3KJQ B;  2C1E B;  4LSZ B;  1RWP B;  1RWV B;  2QL5 B;  4DCJ B;  2H54 B;  3GJQ B;  1RWW B;  3D6H B;  2HBY B;  1SC4 B;  5IC4 B;  2CJX B;  3QNW B; 
#chains in the Genus database with same CATH topology
 2MZ1 A;  2BJ9 A;  1VJW A;  2IJF A;  3I9Z A;  1X31 C;  5DGA A;  1S6Q A;  3O2I A;  2R4F A;  4WE1 B;  3MMB A;  5LJ3 Y;  3DGP A;  3BSA A;  2DNQ A;  1XER A;  5CA5 A;  1N8R T;  3GPA A;  1LV5 A;  2B9X A;  3HSD A;  4NEY A;  7FDR A;  3FC9 A;  5BYS A;  2A10 A;  5F0W A;  2DEJ A;  3CCE S;  2AGQ A;  3OW2 R;  3OR1 A;  1EKS A;  9ATC B;  2KZM A;  2NUH A;  4DR2 J;  2YWE A;  1XMO F;  1KS2 A;  5HO4 A;  2C2N A;  4O4G B;  4F25 A;  1H72 C;  5IOL A;  2BAN B;  3H0P A;  3C15 B;  4PWD A;  3DLB A;  2GJ2 A;  1VLY A;  3FBB A;  2KFY A;  4DPW A;  1VK3 A;  1Q16 B;  4N56 A;  1XR5 A;  5J2N A;  1T05 B;  2DGU A;  2GHP A;  1GXT A;  2B4V A;  1HD1 A;  4URS A;  3RZA A;  2X3D A;  1X5P A;  4DS5 A;  4PUO A;  1FK9 B;  4Y2K A;  3BPD A;  2J5A A;  4HL9 A;  2NUU G;  3AQP A;  4X4U A;  8ATC B;  3JYT B;  3Q8Y A;  4KKO B;  5CYJ A;  1WAC A;  3KLG A;  5JUM A;  2W9B A;  3DLJ A;  1GAO A;  4LIR A;  1K9M T;  3BPS P;  4UZB A;  5E3C A;  2YKN A;  1S1T A;  1HIY A;  1TUV A;  1M90 T;  3G87 A;  4KE5 A;  1RCO B;  4HYK A;  2YQ1 A;  3I0R A;  1AFI A;  1QAJ A;  2BQ3 A;  3M6V A;  4QU6 A;  1UMJ A;  2HQG A;  1Q79 A;  1T3N A;  4CLF A;  3OVA A;  4ZP8 A;  3JB9 k;  1MWY A;  1OWX A;  2PEH A;  1Q8L A;  4ZLN A;  3QJP A;  5GME A;  5H9F K;  2CPF A;  1IKX A;  2LXU A;  4P2X A;  4OYB A;  4F0K A;  3T1Y F;  2ZKU A;  2C2Z B;  1Z4U A;  4JYA J;  4DLE A;  1XMQ J;  3V6H A;  4M5G A;  5K14 B;  1ZM4 A;  1EZZ B;  4DL2 A;  2H1Y A;  5A0Y B;  1WJ9 A;  2IDL A;  4U6P A;  1QD1 A;  4OI2 A;  1NU4 A;  3Q0A A;  5J2M A;  1TU0 B;  2JOQ A;  2WBR A;  2YNG A;  4RWW A;  2NCK L;  3OTE A;  2KU7 A;  3TAP A;  2ZH4 A;  4J9S A;  3NOC A;  5KFF A;  4RU2 A;  1FKO B;  1WEX A;  4KH1 B;  3PYF A;  5J1E A;  1T9U A;  3BR9 A;  2EW9 A;  2C3M A;  2YNI B;  2AT1 B;  1LWC A;  3ZC4 A;  5GAD I;  2R2R A;  1T9Y A;  2PDA A;  3K7R A;  1D3W A;  4LIW A;  2G1D A;  2JC1 A;  3FRY A;  1CJK B;  5KT2 A;  3BQ2 A;  1FEE A;  1GX6 A;  1XTZ A;  4FVM A;  4ED6 A;  3FNN A;  1C4C A;  1N32 J;  1RTH B;  2QX0 A;  3MOJ B;  3UCG A;  1UEU A;  3MHY A;  1F3V A;  3VGU A;  1UET A;  1XJW B;  5LSL A;  3H98 A;  4NLY A;  2XWY A;  1R0B G;  1CUL B;  4K4T A;  1NHU A;  2ZOM A;  3KLE B;  2HVZ A;  4UST A;  4A8K A;  1IKV A;  4LSZ B;  4UY8 T;  1D9A A;  3X3U A;  4CNZ A;  1Q78 A;  1HD0 A;  1PJ7 A;  2UVW A;  2N3O A;  1KVJ A;  3NKY A;  4OZL A;  5KG1 A;  2ZZN A;  2JFD A;  3M2V A;  2YKQ A;  3PW2 A;  2DVI A;  2DIT A;  2XSJ A;  3QT8 A;  3EIC A;  2AEF A;  3M1V B;  1HBO B;  1VBY A;  1I51 B;  4G1P A;  1SJ1 A;  2K2P A;  3SFU A;  3WX8 A;  1GFW B;  1RWU A;  5HMX A;  2PII A;  4I4B A;  2WOM B;  2ZBR A;  2WVF A;  2VUG A;  2VFS A;  2G0J A;  2F5G A;  1NB7 A;  4ZIW A;  5ITH A;  3W62 A;  1A7G E;  4X4N A;  2UUA J;  2MZT A;  5HBM A;  4NLQ A;  4Q43 A;  1HBU B;  3Q83 A;  1BQN B;  2CWX A;  5B7W A;  4A8Q A;  1L3V A;  3ICL A;  4WP3 A;  2Z57 B;  3C66 A;  4DR2 F;  3B54 A;  4RW7 B;  1FO1 A;  2ATL A;  3I82 A;  1N5S A;  1DTQ B;  1K0V A;  3FKB A;  1QE1 A;  4C8Y A;  2NSB A;  1KD1 T;  3RAQ A;  4N5S A;  3BGF A;  4B08 A;  4B3S J;  2ZH6 A;  2L3M A;  3TAQ A;  3Q8U A;  4NL5 A;  1T03 B;  1LXJ A;  1S9E B;  4XAK A;  1RE1 B;  3LUY A;  4I0W A;  2EKY A;  1JIH A;  1GX5 A;  3U02 A;  4Q2L A;  4IG3 B;  2CQB A;  3AXM A;  1HAR A;  4U8Y A;  3CJ8 A;  4P72 A;  1U1O A;  4B9S A;  3V5R A;  2FHM A;  3W8G A;  2LEC A;  2QLJ B;  2I1R A;  5KAK A;  1S0M A;  3NL0 A;  1H6K X;  2YTC A;  2R7Q A;  3CJT A;  2YKM A;  1J27 A;  5DG9 A;  3UO0 A;  1VQO S;  2Y0B B;  3AD7 C;  4LF7 J;  1TKZ B;  4DX6 A;  2DNL A;  1ZZN A;  4WYL A;  1TUW A;  3RBD A;  4FYX B;  4H4K C;  2YNF B;  3BM7 A;  3ZFV A;  1Z1Z A;  4MFB A;  4ICL A;  2IVY A;  2DNG A;  2D3O R;  4AND A;  3UQS A;  1A0O B;  4M95 A;  4UY8 5;  3HX9 A;  3QT7 A;  2CQP A;  2LXF A;  1U8S A;  1YK9 A;  3CT9 A;  1RWV B;  1FFG B;  1JB0 C;  4XTT A;  2JLG A;  3TVK A;  3UDE A;  3WDO A;  1XMQ F;  4KBI A;  2FJD B;  1Q0N A;  4LUB A;  2VL1 A;  4R5P B;  2DR6 A;  3Q8S B;  3C2P A;  3AJ2 A;  2HQI A;  3BR8 A;  3LAM A;  3ULH A;  3RJM B;  2DNK A;  4I6W A;  4LF5 J;  3MMC A;  1U0H B;  4J9M A;  1CS4 A;  5HK4 A;  4KHR A;  3MD1 A;  3PAC A;  2DO0 A;  2LU1 A;  2HMI B;  1XBW A;  2CIM A;  3WIV A;  2VU5 A;  2RU3 A;  4M5K A;  2KT3 A;  1CJT A;  3KMS A;  2D3O 1;  4N41 A;  2AHO B;  5CYQ A;  5I3U A;  3TP2 A;  4YFU A;  2EKN A;  5GAE U;  4Q0B A;  2W4C A;  1Q7Y T;  5CD4 A;  5HJY A;  2OEJ A;  2XY5 A;  1G3O A;  5D4L A;  4XDD A;  2AKW B;  1N32 F;  4DQI A;  2VAS A;  3FVY A;  3G8T A;  3ZO7 A;  1X5T A;  1AZS A;  1KVI A;  1RWW B;  1B70 B;  3N6L A;  4TY9 A;  3OTO J;  3RW6 A;  3PM9 A;  4XPC A;  2Q1L A;  1X4B A;  1JKH A;  1RHQ B;  1B3T A;  1T94 A;  5EX0 A;  3DOK B;  2XNQ A;  4HLB A;  1HI0 P;  1NB2 A;  2IY5 B;  2MKS A;  1TKX A;  3HFZ B;  3CCT A;  4V19 J;  2CPD A;  3G6X A;  2RDD A;  3M9N B;  3VZH A;  4U7U K;  4HVZ A;  3TOQ A;  4CCH A;  2E5G A;  3D7S B;  2ZOF A;  1EX8 A;  3NMR A;  1EB0 A;  3T3F A;  3ENQ A;  3BYR A;  2RQK A;  2B6A B;  4J9R A;  1G1X A;  5ETR A;  4A8W A;  1LWE B;  5GAH I;  2V8V A;  3R6L B;  4Y6I A;  2EC2 A;  2HWI A;  1LW0 A;  1RUS A;  1TUG B;  4O44 A;  5HLF B;  2POK A;  3QGH A;  3BJY A;  5HRO A;  5IFM A;  4IQM A;  1XC9 A;  1XK8 A;  1FKP B;  1VIO A;  4YS2 A;  2UUA F;  4ER8 A;  3HI9 A;  2V0N A;  1S79 A;  5AJ3 J;  1FD8 A;  3TA1 A;  1RXO B;  2AEM A;  2HK2 A;  3D5M A;  1YLX A;  1C0U B;  1RAO A;  1SUQ A;  3CUL A;  1KTQ A;  3KFW X;  5KT4 A;  3RAX A;  2C3P A;  1UTA A;  3CGI A;  3S6E A;  1UWB A;  3O3L A;  4Y2C A;  2J0X A;  2NZ4 A;  2BM1 A;  2VFR A;  2YY3 A;  1HBM A;  3MEK A;  4B3S F;  4RNH A;  1O51 A;  3IS9 B;  2MKH A;  3P4U B;  3N4W A;  3NGS A;  3U27 A;  2OPQ A;  4R8U B;  2DHX A;  1HYS A;  1YWX A;  3PW7 A;  3BBF A;  3GII A;  4F2S A;  4EWT A;  3M8Y A;  1T8E A;  4ZPD A;  2OMO A;  1FCA A;  4C11 B;  1FA0 A;  1Q8I A;  4PKD B;  4MK9 A;  1U49 A;  3K5P A;  3CSK A;  2J7W A;  2HZC A;  2AYB A;  3RRK A;  3R27 A;  4A48 A;  1XMB A;  5I42 A;  2I38 A;  2W8L A;  3CJS A;  4JI7 J;  2PMW A;  4DG1 B;  1F60 B;  4BWJ A;  2APO A;  1H74 A;  3FJ2 A;  2J76 E;  4LBP A;  1U09 A;  4LF7 F;  7FD1 A;  1YJ9 S;  1PO6 A;  4NLD A;  1SC6 A;  3RUB L;  4Q2M A;  1S6O A;  5KG7 A;  3HO1 A;  4DN9 A;  2QV6 A;  1KQF B;  2QLX A;  3TAM A;  3QGI A;  5A8K B;  3CC4 S;  4Y00 A;  4ZKA A;  2OLW A;  4ZPW R;  3WC0 A;  4C3L A;  1IBK J;  4M5L A;  1SIZ A;  3S8S A;  4EO6 A;  3IAS 9;  3OHB A;  4WIQ A;  3FZ2 A;  5J2Q A;  2DJW A;  4O3O A;  4C0O C;  2EFN A;  4IFV A;  5JMN A;  4CYU A;  4K4X A;  1KNZ A;  5FDL B;  3TJ8 A;  4LF5 F;  2JVR A;  1C1C A;  4DV5 J;  4DFJ A;  1RWX B;  4P75 A;  2XS7 A;  2ASJ A;  1WF2 A;  2Q43 A;  3KXD A;  3TZW A;  3SIP B;  1SH2 A;  2JZ5 A;  2MDA A;  4X2B A;  3MF5 A;  2MLX A;  2Y3Y A;  1IM4 A;  1T9V A;  3MEC A;  4YY3 J;  5K8N A;  2A3J A;  1HBN B;  2R7U A;  4UOF A;  1U1M A;  1B0V A;  3W5Z A;  2IRX A;  1TAU A;  3VGS A;  2V50 A;  3LO3 A;  2LCW A;  5F8I A;  1KBR A;  4F3Q A;  3CWJ A;  2DCU B;  3JTO A;  4RBV A;  3IRX B;  1WKJ A;  3RB0 A;  1FNO A;  1HPZ A;  3TA0 A;  4DFP A;  1UVJ A;  1FTR A;  5ETM A;  1S59 A;  1DLO A;  3OTO F;  3PRV A;  2QL7 B;  2RE1 A;  3D9B A;  2X3G A;  3KNG A;  4PQU A;  1BGX T;  2HGL A;  5KG0 A;  4DL6 A;  2BJ8 A;  1RKJ A;  1RTI A;  4PYD A;  4ZJQ A;  4L73 A;  2G2Z A;  3OQ2 A;  3BH7 B;  2I8E A;  3BDP A;  4IRC A;  3H5Y A;  4HTI A;  2DNO A;  3G8S A;  3DLE A;  2OKQ A;  2VC0 A;  4PQA A;  3R5D A;  2WSF C;  3DLL Q;  1BQM A;  2E9R X;  3FFI A;  3ENW A;  2XMV A;  1EHW A;  2QT7 A;  2VJU A;  4DU8 A;  4EK2 A;  3BEG B;  4ID5 A;  2L08 A;  4ECS A;  4NXN J;  2ZD1 A;  2D1C A;  2KHC A;  3L7U A;  2A2D A;  4ZCL A;  1E6Y B;  2HVE A;  2YWH A;  2HNY A;  1HWI A;  3FSI A;  4ZVR B;  3CC2 S;  1NJZ A;  1IQZ A;  5C25 B;  4WXW A;  2O01 C;  3PX6 A;  2WB1 D;  2PN6 A;  5AJ3 F;  4KGV B;  1RGV A;  2ZWP A;  2K1R A;  2M4M A;  2W2O P;  3PTW A;  4K8R A;  2ZBQ A;  4P10 A;  1VRT A;  1S77 D;  3KK3 B;  2OP5 A;  1BHN A;  4RW4 A;  1EIY B;  3QWP A;  3A8K A;  4I7F B;  5LJ5 Y;  1HWJ A;  3IGV A;  3L9Z A;  2IBK A;  3D6M B;  4DMZ A;  1REV A;  4NLU A;  2DRD A;  3HT3 A;  1MMN A;  2DH8 A;  4OX6 A;  1RBL A;  3TJ9 A;  4CH7 A;  1L3K A;  4CLZ A;  4NWB A;  4OYZ A;  3KK1 B;  1WWH A;  5DRK A;  1HNZ J;  2HS4 A;  4L74 A;  1RT2 A;  4DF8 A;  2RML A;  2XMU A;  2E7V A;  4AL5 A;  1IR0 A;  1K8A T;  4FNH A;  1OPZ A;  1FX2 A;  1FXL A;  1RTJ B;  3MM5 B;  2FPH X;  4Z7Y A;  5KOX A;  5RUB A;  2R8I A;  1FXD A;  3NS5 A;  1GNK A;  4JI7 F;  3CMQ A;  1TV6 A;  4F7V A;  4LF8 J;  1VRU B;  2MQP A;  3NNA A;  1FE0 A;  1IVZ A;  2ZVI A;  3JAM U;  4LF1 A;  4ECQ A;  2DRA A;  1HQE B;  4ANE A;  3NGU A;  3MD3 A;  3AH6 A;  1FRM A;  4GC6 A;  2B4O A;  2DGO A;  1XR6 A;  3VV2 B;  5KFJ A;  1IBK F;  2FLN A;  1IUJ A;  1SV5 A;  3HKZ D;  5DZ6 A;  4WFX A;  1X4A A;  2FIU A;  2IA0 A;  4L3N A;  2YKO A;  1H0H B;  2OPR A;  5L1J A;  8RUC A;  1WHV A;  2CZ4 A;  4OZ5 A;  3CCJ S;  1NKB A;  5AT1 B;  3GV5 B;  2CPX A;  1U26 A;  4YUD A;  3I56 S;  3HHL B;  4R25 A;  3PHT A;  3T19 A;  4DV5 F;  2Y1I A;  4UZC A;  4EGL A;  5IV3 A;  4L76 A;  3I4H X;  1Y10 A;  4B9U A;  2G9O A;  4J9K A;  4EYI B;  2ZH3 A;  3VGT A;  1UA1 A;  3OUY A;  4UUX A;  5C7P A;  3ZTS A;  2DNZ A;  5CAB A;  4KGK A;  4X4S A;  1IM6 A;  1Y5N B;  5K8O A;  3O6Q A;  3OHA A;  3UI3 A;  3GYN A;  1FKA F;  2P9C A;  5HAN A;  1TK0 A;  5ETS A;  1B0T A;  3QYY A;  3A13 A;  5KG2 A;  2BQU A;  2JHE A;  4C97 A;  2DNY A;  4AL6 A;  3M8S A;  1ZAV A;  4MKV A;  2W24 A;  3HFK A;  1HNI A;  4ZHR A;  3BYP A;  3SZ2 A;  2XQC A;  2GIQ A;  1LWF A;  4K4Z A;  1S6Q B;  3FEY B;  2O66 A;  3H2U B;  2DR8 A;  4LBI A;  3MMB B;  1WF1 A;  4GC7 A;  4K50 A;  3TWZ A;  1C1B A;  1XNR J;  4CO3 A;  1NK0 A;  5AXK A;  2UXD J;  4BS2 A;  3CJQ A;  3HP6 A;  5EX3 A;  5D0R A;  1AXQ A;  1ZBT A;  4UQG A;  4KRW A;  4DS4 A;  4F8R A;  4DV7 J;  3N6M A;  4FN5 A;  2NRE A;  3PFO A;  3ZTO A;  1VOM A;  2AQ4 A;  1H2T Z;  3MEG B;  5EWF A;  1F3F A;  3H5X A;  2MYF A;  2JLE A;  1PSD A;  1RWM B;  2IVM A;  3K2Y A;  3D54 A;  5J2N B;  2RS2 A;  1YJU A;  4RKU C;  3J7Y U;  2JVO A;  4LSL B;  4PUO B;  1YRU A;  4CRJ A;  1U0S A;  2AYG A;  2PSZ A;  4U9R A;  4NXN F;  2W9B B;  4OYW A;  4EZ6 A;  2DNM A;  3IM8 A;  3CB4 A;  2BJE A;  5FLX Y;  2R7V A;  1NSP A;  2V2V A;  1FVS A;  1YSJ A;  2V4Q A;  3I0R B;  3EWG A;  3GTY X;  1NBE B;  4H4O A;  4MK7 A;  1RAH B;  4ZS6 A;  1SH3 A;  5B0E A;  1FDA A;  4NOH A;  4EBD A;  3HHD A;  5CAA A;  3VWS A;  1YI2 S;  1X4E A;  2VD3 A;  2DEI A;  4YDX A;  3B4M A;  2MLZ A;  1HW9 A;  1LOU A;  5KTQ A;  3GSI A;  1YRT A;  3FUY A;  3POT A;  1JLF A;  2XLI A;  1DUR A;  3MUT P;  1Q95 G;  4CM2 A;  3FCV A;  4KTQ A;  5E41 A;  4M5N A;  1UEK A;  1FDB A;  4IH7 A;  2R42 A;  1WDT A;  3NGT A;  2CJY B;  1HNZ F;  2YNG B;  1HHS A;  4EMD A;  4FNI A;  3ETO A;  3KHG A;  1KWM A;  4PAA A;  3EPI A;  3QBC A;  1KFS A;  4KFB A;  1CJV A;  1FNX H;  5J1E B;  1JLG B;  5D4N A;  2XHC A;  4LF8 F;  2FC9 A;  1B7Y B;  2RH3 A;  4WFY A;  2NPI A;  4GKK J;  1HMV B;  4ALZ A;  1LWC B;  2E1M C;  3AXK A;  3GQC A;  2V69 A;  3W9I A;  4WE1 A;  1FDD A;  4QOT A;  2HQC A;  1UAW A;  1TL1 B;  3PG9 A;  2DNP A;  2A0F B;  3RTV A;  1VDH A;  2QA2 A;  3D0G E;  3OSN A;  4F4A A;  1JQG A;  3UR3 C;  3HXM A;  2VG5 B;  1XEZ A;  4DJB A;  5K5M A;  3ZTP A;  2MLY A;  4ZCK A;  1VQK S;  1WHX A;  2HAF A;  4ETZ A;  2ZE2 A;  2HLT A;  1JLA B;  2BYC A;  2MTL A;  3C15 A;  1PIE A;  3J81 Y;  3CJK B;  4IH5 A;  1Q1K A;  3I0S A;  2CNN B;  1BMQ B;  1T05 A;  4RX6 A;  4FBU A;  1YBA A;  4WII A;  2IHR 1;  1DQA A;  2AIR B;  2Z2L A;  3FGV A;  4F4X A;  4EBE A;  1URN A;  1HFE L;  4CLU A;  2IBO A;  1IKV B;  2C2K B;  1VRQ C;  1V3S A;  3KJN B;  1NDP A;  2MZS A;  4KKO A;  4J91 A;  1SBR A;  3ELH A;  4H54 A;  2NXE A;  3DU5 A;  2M8D B;  4HHU A;  1F2G A;  5KFE A;  1JNZ B;  3HM9 A;  4A8Y A;  1MML A;  1ZTT A;  1H38 A;  3Q23 A;  3R7N B;  5FII A;  1KTV A;  2WZ1 A;  2C2D A;  3M30 A;  1F9E B;  1WI6 A;  2RF2 B;  2AZ1 A;  4USI A;  2HLU A;  3RW7 A;  3D6F B;  2DGQ A;  2XZT B;  1PC5 A;  4H4K A;  1RAF B;  4ZDN A;  3MPD A;  1QSS A;  5L38 A;  5KG3 A;  1XNR F;  5KFW A;  3MFH A;  3NGR A;  3MUR P;  2UXD F;  4USU A;  1FE4 A;  3BKT A;  3VTI A;  2DNN A;  2DH7 A;  1TFW A;  1YJ7 A;  3HJV A;  4DR1 J;  4ECZ A;  3D0I E;  4FZV A;  2KM8 B;  4DV7 F;  5A0Y A;  1CSJ A;  4LR8 A;  2E5L J;  4ZPA A;  2HRY A;  4PEO A;  2J9D E;  1RTD B;  1SKR A;  1QE1 B;  3VAG A;  1CLF A;  3LGM A;  4NA1 A;  1VC5 A;  4C3K A;  1O8B A;  2ILZ A;  2MKK A;  2MZQ A;  2YH1 A;  3CCV S;  2ASY A;  4ILR A;  3PJ9 A;  1SI9 A;  2Q79 A;  2X51 A;  2JRS A;  3IO1 A;  2YNI A;  3THV A;  3I55 S;  4ED5 A;  1UVN A;  2R7R A;  3W64 A;  3EDQ B;  3TA2 A;  4C9D A;  1NHV A;  2B5J A;  4B9M A;  1RYS A;  3ENA A;  3IFE A;  3MM6 A;  3MTK A;  4J9N A;  2IFX A;  2DR9 A;  3WBZ A;  3GCX P;  1KFD A;  3D6H B;  2CPE A;  5GAD U;  5KG6 A;  3GE9 A;  4QJV A;  3PX0 A;  3E2E A;  3BKU A;  3MZI A;  1XQI A;  2J9D A;  4ICL B;  1MNE A;  2GNK A;  3KG4 A;  3KDN A;  4YHH J;  3TEG A;  1IKW A;  4YB5 A;  5AE3 A;  4CO0 A;  1CUL A;  4DL7 A;  4DR7 J;  3JSM A;  3MED B;  3KLE A;  3F44 A;  2J0W A;  1VMB A;  2RJZ A;  5KT3 A;  3EZU A;  1T9X A;  3CCM S;  4E2F B;  3G2X A;  1SPB P;  3MMC B;  4OMF G;  1XWL A;  2BJD A;  3D0H E;  2YQ3 A;  3CIM A;  2DT9 A;  3M1V A;  4HHH A;  2R7W A;  1U02 A;  1WG4 A;  1PAU B;  4WFZ A;  4F26 A;  4PXE A;  2WOM A;  3TEH B;  4GKK F;  3G71 S;  2M8H A;  5D15 A;  3OVS A;  5F0U A;  1CJT B;  1UPM B;  1TKT B;  2DGS A;  5CYQ B;  5I3U B;  3T5L A;  3GU0 A;  1VQ4 S;  4QR2 A;  4Q0B B;  2RVJ A;  3RBZ A;  4LQ3 A;  1PYS B;  5L46 A;  4DEZ A;  1BQN A;  1GMW A;  2A6M A;  4X84 A;  2EK1 A;  3MTJ A;  4K2J A;  1KQG B;  2MQQ A;  3CD5 A;  3TX0 A;  3TZY A;  4BC7 A;  2MB0 B;  3ISN D;  4EU0 A;  4WPA A;  4OX7 A;  1RHR B;  2DHG A;  4O4R A;  1GMV A;  4CT9 A;  4DCP B;  3QGG A;  1JKH B;  2E7X A;  1Q7L B;  2V9K A;  3ZZR A;  4Y0F A;  3EVO A;  2OSQ A;  7AT1 B;  4IG3 A;  4CI0 B;  2FJB B;  4LRC A;  2RU9 A;  4OJ3 A;  4QWC A;  3TR5 A;  1R8H A;  2EEY A;  3AA9 A;  1TKX B;  1SIW B;  2E1R A;  5L8R C;  3TQE A;  3GLJ A;  1PCA A;  4LF6 J;  1P27 B;  3GFH A;  1S9F A;  2DY9 A;  3DC2 A;  5DET A;  3RRG A;  2F7V A;  1S4F A;  4LVO P;  2HFO A;  2MQO A;  2Z30 B;  2BX6 A;  4O3S A;  4K7Q A;  2G13 A;  1LW0 B;  2N82 B;  1JMT A;  1NK6 A;  2YNF A;  4CLS A;  1N48 A;  2F8M A;  2C28 A;  5HRO B;  3W8P A;  4KR0 B;  4QYZ K;  1RHU B;  2J6T A;  4DL4 A;  4WTY A;  1VFJ A;  3R97 A;  5KG4 A;  3VGV A;  4DPX A;  3IN5 A;  1X9W A;  2X1A A;  3JSY A;  3TYT A;  4DR1 F;  4R5P A;  1R8C A;  2CNL B;  5LSO A;  5B0D A;  5M2U A;  1B99 A;  4N77 A;  3HT0 A;  2XS2 A;  2AJ0 A;  1SUQ B;  3ZZZ A;  3DRP A;  4LQ9 A;  2E5L F;  1DFD A;  2F9D A;  1V3Z A;  1U0H A;  4J90 A;  2Y1J A;  3SDE A;  3DGV A;  4OYA A;  3LWL A;  3C46 A;  2HMI A;  3MCN A;  2B3T B;  2OPQ B;  2WCX A;  1N0U A;  1HYS B;  1TZ0 A;  1N5T A;  1NKC A;  3OTB A;  4JI2 J;  4B9L A;  2BKO A;  5DLG A;  3BF4 A;  4IOB A;  2FJA B;  1LKZ A;  3OFG A;  5ETP A;  4EUV A;  4Y2A A;  4Z7C A;  3OR2 B;  3H4D A;  1N36 J;  5I42 B;  4LFB J;  4LJM A;  4IUF A;  3VHQ A;  4RNM A;  4X4R A;  1PBA A;  3GSD A;  1NSA A;  2LU2 A;  2IA6 A;  4GVB B;  2Z8Q A;  3X1L B;  2DYA A;  4P2M A;  3NEK A;  3G82 B;  3TAM B;  4MKY A;  4OX9 J;  2EFO A;  3CCS S;  1Q4R A;  3GFX A;  2DH9 A;  2CPH A;  3ENV A;  4YHH F;  4DV4 J;  2ATC B;  2HND A;  4ED0 A;  3ZZY A;  3RB6 A;  4DR7 F;  3PY8 A;  3G6E S;  3V6J A;  1CQM A;  2G0I A;  2J7K A;  4BHQ A;  3HHE A;  4CT8 A;  1UL3 A;  4OFZ A;  2XZD B;  4CYU B;  3BO4 A;  3PW0 A;  2MSS A;  3WX4 A;  2NLW A;  2WON B;  1QAX A;  1CC7 A;  2B6A A;  1BWV A;  3QRR A;  1LWE A;  2VF3 A;  5F9N A;  4JV0 A;  2ZM6 J;  2VPY B;  2NSC A;  1W25 A;  2EG2 A;  4HAC B;  2GCF A;  3VVU A;  5E2Q A;  2BMB A;  4JI1 J;  2DO4 A;  5DQG A;  3MDF A;  3I5B A;  2R2U A;  5D4O A;  2NXJ A;  5GAH U;  3LP1 A;  2F65 A;  4NXM J;  2E5H A;  3IWL A;  2VV5 A;  1U25 A;  3A3O B;  1RHK B;  4MKA A;  4N8O A;  4IRD A;  1GH8 A;  3W2V A;  1PG5 B;  3AFG A;  4XIU A;  1FVQ A;  2PFF B;  1VLO A;  1VQY A;  3LGN A;  1QSL A;  3DNC A;  3LA0 A;  1DLO B;  3G6Y A;  2KVI A;  3SCJ E;  5B0A A;  2W8K A;  4PQU B;  3SQG A;  3KJQ B;  3EM1 A;  1HW8 A;  4WK3 A;  1RTI B;  4YN3 B;  4TXS A;  3W1Y C;  3LOU A;  3PRB A;  1M0S A;  3C6T A;  3Q24 A;  2AJ4 A;  5DO2 A;  3BQ1 A;  4LF6 F;  3HSJ A;  3EGW B;  2QG9 B;  2VBZ A;  1BQM B;  3FFI B;  3OPK A;  4DQS A;  1U4B A;  2HIY A;  2RHQ B;  2LXI A;  2C3O A;  1SQF A;  2YXL A;  1UVK A;  2ZD1 B;  2JEI A;  2RQ4 A;  4X4O A;  5A8K A;  1U48 A;  4DX5 A;  2BE7 D;  4Q45 A;  3BSO A;  3IXQ A;  4P74 A;  2HHH J;  2N4D A;  3SMZ A;  3ILL A;  1FEH A;  3TNV A;  1VRT B;  2B8P A;  4Y34 A;  3UCU P;  4NLP A;  1SKS A;  3EZO A;  3OJU A;  4JV5 F;  3QGP A;  3MPV A;  2KVQ E;  1ZAW A;  5IC4 B;  4P2S A;  5H9E J;  3CCL S;  4GO7 X;  1R8A A;  3C6U B;  4DR6 J;  2ZH2 A;  5KG5 A;  3E01 A;  3CD7 A;  3P45 B;  2XGQ A;  4PPZ A;  5ETT A;  4JI2 F;  3CTR A;  3PRD A;  1RT2 B;  4FF3 A;  4MH8 A;  4C8L A;  1RSC A;  5F8H A;  3MR3 A;  5DGB A;  4CWB A;  3SCK E;  4HI1 A;  1N36 F;  4C0H A;  4LFB F;  1PC4 A;  1NND A;  1TV6 B;  2OI2 A;  4P2F A;  4FF4 A;  4A4J A;  1UW9 A;  2GQ2 A;  2VFV A;  2W7O A;  4WFB Q;  1H98 A;  1MWQ A;  3AY0 A;  3AOA A;  3IRX A;  4IH6 A;  1T3O A;  1M1G A;  4FP9 A;  3CCQ S;  3J81 j;  4YEA A;  1TR0 A;  2Y9H A;  4OZ0 A;  3HD1 A;  3W7B A;  1RU1 A;  4OX9 F;  3MFI A;  2KRB A;  5DM7 Q;  3PDN A;  2E9Z A;  2HNZ B;  4CTA B;  4DV4 F;  1JXV A;  1SV5 B;  1ZM3 A;  3MM9 B;  2R7S A;  1NH7 A;  4MMO A;  3PXG a;  3MR2 A;  4RL1 A;  4B3O B;  1TP7 A;  1DJ0 A;  1S48 A;  1RBO B;  4ES3 A;  5H1S V;  2Q3P A;  1PAE X;  1YX2 A;  5A8W B;  1X0P A;  3KLI B;  3M9O B;  4I6Y A;  3HZG A;  1TEL A;  4DSJ A;  1FHT A;  2Z2M A;  3QQC D;  1EAY C;  1TL5 A;  4OJ1 A;  2YKA A;  3H8Y A;  2ZM6 F;  4QIW D;  2DHH A;  2C2M B;  1ROF A;  3NGD A;  2FUG 9;  3IBC B;  3CPW R;  3KMQ A;  4PR6 A;  3IRW P;  4JI1 F;  2W4P A;  1YZ6 A;  1X4H A;  4ZLL A;  1E6Y A;  2B8Q A;  1MSW D;  3ZZP A;  2G2Y A;  2XMW A;  3I87 A;  4KAI A;  1KKH A;  4DV2 J;  4FYW B;  4AT1 B;  4NXM F;  1N56 A;  1LWF B;  2XI3 A;  1MN7 A;  2VH7 A;  2EWH A;  1IWG A;  5ETK A;  4J9V A;  1RWP B;  3CJ3 A;  1C1B B;  2JNJ A;  5ETO A;  2B4U A;  1J5O A;  3DYA B;  1KDN A;  4P7V A;  2XLJ A;  1AUD A;  3HF5 A;  4NLO A;  5KFR A;  3J7Z T;  3DMJ A;  5DJB A;  1P9Q C;  4IO9 Q;  4AFF A;  3KLF B;  2KDO A;  3GR1 A;  2HGN A;  2QA4 G;  4LF4 J;  4DCO B;  5DDP C;  3RR7 A;  2BBE A;  3CMA S;  5BYR A;  2CJ9 A;  4ECW A;  1FFW B;  1P6T A;  4RR5 A;  4C3M A;  4QU7 A;  2GML A;  1RTJ A;  3MM5 A;  4ZIT A;  4WKY A;  4OI4 A;  1VRU A;  4TNO A;  4QCL A;  3QSY B;  5KFB A;  1A9N B;  4NZ0 A;  2BOP A;  1QDU B;  1HQE A;  2J8A A;  4PG7 A;  2JJ4 D;  4MIA A;  1WOR A;  2LKZ A;  1I5O B;  2BRL A;  5SUH A;  2LMI A;  2UUT A;  4IFY A;  1KLM A;  1FRJ A;  4JI3 J;  4DQR A;  4J37 A;  3JSB A;  3LAL A;  4ZJL A;  1ELO A;  2ZWO A;  2MHE A;  1QVF R;  2AWZ A;  5FLX U;  3QPI A;  3QJJ A;  1WUU A;  3DM2 A;  4TU7 A;  3QNW B;  2HHH F;  1SB6 A;  1T9T A;  2NYI A;  1RCX B;  4MYU A;  2HVD A;  5J1P A;  2W25 A;  1Q81 T;  3ZTR A;  3W3S A;  3ZZU A;  3JQJ A;  4URQ U;  3TAN A;  1JLF B;  3C16 A;  1SCJ B;  2MGZ A;  2CQ0 A;  1NDC A;  2N7C A;  4ID8 A;  2CPZ A;  3D3C J;  4X62 J;  5T41 A;  4QWD A;  2BKN A;  5CZV A;  4DR6 F;  2HBR B;  1U1K A;  2IM2 A;  2FHK A;  2HQ3 A;  2ZBC A;  4X64 J;  2VB6 A;  2CZV C;  4LVN P;  4X65 J;  5JJB A;  4LSN A;  1YQH A;  5CYM A;  3K17 A;  2LEP A;  1KEK A;  2V67 A;  4W4M A;  5J1N A;  5IT4 A;  3CCR S;  4NEZ A;  4C6A A;  1URR A;  4LF2 A;  2GVZ B;  1NO8 A;  1N5Q A;  5HMZ A;  1C4A A;  3DDI A;  1NZA A;  4CDI A;  1Q8B A;  5E3A A;  1HWK A;  2V63 A;  2FHO B;  3U7J A;  3DCA A;  4J9U E;  1NJW A;  1VK8 A;  3IR6 B;  4K5R A;  3CJ4 A;  2ASD A;  2BDP A;  4RUH A;  3HVT A;  5B0F A;  3MCM A;  2NR0 A;  4I2P B;  2XGP A;  3J7Z 5;  3JTN A;  1JJ2 R;  1H7W A;  1LK7 A;  1WKK A;  2IIH A;  5GMD A;  2VG6 A;  1IKY B;  4NML A;  2ABY A;  3PIO Q;  2GA7 A;  1N4L A;  2WVB A;  3M8Q A;  2ZE2 B;  1R3N A;  3OVB A;  3MAQ A;  1NH8 A;  3BS9 A;  2PI5 A;  1IWA A;  2LQ8 A;  4YB7 A;  3D1H A;  1SQE A;  5F3T A;  4W90 B;  3MEG A;  4L75 A;  1R8P A;  3CF5 Q;  2CDR B;  3TI0 A;  2P6T A;  4DPT A;  3I0S B;  4IKA A;  3GG1 A;  3J81 U;  2KXH A;  5EN1 A;  3KNA A;  1LXN A;  1MU2 B;  1FWK A;  3JQM A;  4LSL A;  4RPF A;  4LRB A;  1M5P C;  5C42 A;  1P9Y A;  2GV1 A;  2Y1L B;  4B9V A;  4RNF A;  1KN6 A;  4GO5 X;  2J9C A;  1ZA1 B;  4GRS A;  1VIS A;  1S9G B;  4EEY A;  2VJV A;  3UN3 A;  3QAU A;  2CQD A;  4P71 A;  1S10 A;  1WF0 A;  2XM3 A;  3NGK A;  4FXD A;  3BN7 A;  1S6P A;  4B9T A;  1L5U A;  5HN0 A;  4A8S A;  2W2N P;  3PYD A;  5I3Q A;  1ARO P;  4A8X A;  2YX4 A;  3LAN A;  2VA2 A;  4DV2 F;  2MHN A;  3FCH A;  3CO0 P;  1C2P A;  3T9N A;  1FTC A;  3WIU A;  1M1H A;  3M30 B;  4FVC A;  3MPU B;  2FHJ A;  3B78 A;  3EZ5 A;  2RKI B;  1LW2 A;  5D78 A;  4O23 A;  2J9E A;  3O8W A;  3HHN B;  3E3X A;  1KHV A;  2M9K A;  5HVF A;  5DDQ C;  1PBU A;  2IM1 A;  2MJU A;  1UFW A;  2IYG A;  3OV7 A;  5ADZ A;  4JV2 A;  4LF4 F;  4Q5V A;  3QFW A;  3EUN A;  4DL0 C;  3TQ1 A;  5DLF A;  1QUV A;  2DIV A;  1RIS A;  5D8H B;  4NCA A;  1DQ9 A;  2HIQ A;  4QIV A;  4C4W A;  5C2G A;  3GV7 B;  3N28 A;  2XSF A;  5BR8 J;  1S4E A;  4ZPC A;  3DI6 B;  1NZ8 A;  5MLC V;  1JLG A;  1UPP A;  3D4J A;  1HMV A;  3N9U C;  3W5X A;  4ZLJ A;  4ES2 A;  4TY8 B;  4RW9 B;  2ZJR Q;  2HFV A;  3VAL A;  1TL1 A;  2B5J B;  2AF6 A;  4JI3 F;  2FC8 A;  4IRK A;  1WTF A;  1Q5Y A;  3GCW P;  4LMZ A;  1TFY A;  3MM6 B;  4KJI A;  2VG5 A;  4QR1 A;  4O0N A;  2ALY B;  2IC3 A;  4F2R A;  4NCB A;  5IQ6 A;  4FDF A;  3OD2 A;  2AMC B;  1V6H A;  3H40 A;  1JLB A;  4ITS A;  3NCQ A;  2CPJ A;  1JLA A;  2DNH A;  5A6W A;  6FDR A;  2JH3 A;  1HNW J;  3CJK A;  3FMB A;  1NM2 A;  1GMU A;  1N6Q A;  3GWC A;  2B56 A;  1IKW B;  3SV4 A;  2ADC A;  3OL8 A;  1K44 A;  3JSM B;  2BKP A;  2WVC A;  1SL2 A;  2MJN A;  4X62 F;  3DN9 A;  3I9V 9;  3OTC A;  3KJV A;  4H4M B;  4XO0 A;  3QIP A;  1WC3 A;  3ET6 B;  1RAA B;  2QLB B;  3P5T L;  3A8E A;  4J7C A;  2XMA A;  4DHV A;  4X64 F;  5KFN A;  1HWL A;  4X65 F;  2B51 A;  2CPY A;  5KFH A;  3ILO A;  3BBC A;  1JXL A;  1R8B A;  4WJB A;  2D9O A;  3QZ7 A;  4P7T A;  3CED A;  5KFG A;  4RW6 A;  1UKU A;  1UZD A;  3SEO A;  1RYR A;  2R3V A;  2RF2 A;  1SC3 B;  2NPF A;  5BJR A;  5F8L A;  4PCQ A;  3GON A;  4HR2 A;  3OXG A;  4DV0 J;  2XB2 D;  1RAB B;  2NZC A;  4OYI A;  4DWI A;  4NLV A;  2H5E A;  3UDC A;  3SSR A;  3FSX A;  1RTD A;  2V4J A;  2VON A;  5E33 A;  1UA0 A;  1YRX A;  1HNV A;  1X8D A;  1X4D A;  3QAE A;  1IXK A;  5LOQ A;  3UD5 A;  2AU0 A;  4B3R J;  5IS2 A;  1FJ7 A;  2ZH8 A;  2FGC A;  2N7Y A;  2FD2 A;  3R3T A;  2Z0G A;  2CKW A;  4G3I A;  1D9F A;  3DOL B;  2G1H A;  4CLY A;  2A1B A;  2ZNY A;  2QE5 A;  2E1C A;  2EPI A;  2RD5 C;  4ILL A;  5A2Q U;  1DQ8 A;  4DDF A;  1LWX A;  2E7W A;  3QFH A;  1HLW A;  5LXY A;  3D3B J;  1PGZ A;  2QIF A;  2VC1 A;  4OHX A;  4YQW A;  2ZBP A;  1FD2 A;  2DRB A;  3R5G A;  5E0O A;  1Y9O A;  4DZ6 A;  2JEJ A;  1IN0 A;  2W7A A;  4NLX A;  3KJF B;  3PKM A;  2AEJ A;  4YB1 P;  1S1U B;  4KH0 B;  2M0G B;  4PRF A;  2HRT A;  2GQC A;  3D67 A;  1WNE A;  1OO0 B;  5B09 A;  4NI2 B;  3MED A;  4JYA F;  4BDP A;  3EMT A;  1NSK L;  3M32 A;  2E44 A;  2R2S A;  4O3N A;  4BLG A;  1S12 A;  4PG4 A;  4FS1 A;  5IT9 U;  2UV8 A;  4TQR A;  2R2T A;  3DRP B;  3R8Y A;  1QSY A;  5C2C A;  3DFE A;  4DZD A;  3Q2T C;  5A8R A;  1NUE A;  2BM0 A;  5DG8 A;  1GEH A;  2GJI A;  1UP1 A;  3SDE B;  4CLP A;  2XMM A;  5BR8 F;  2RHS B;  4WP9 A;  3AJ1 A;  5DS7 A;  2CQI A;  2Y8W A;  3TUI C;  1RAE B;  2VIH A;  5F3Z A;  4DN0 A;  3AHP A;  2XMT A;  1BWE A;  2OO4 A;  3MCS A;  4RNN A;  2HEK A;  4ZOS A;  1TKT A;  3PFE A;  3CDB A;  5A6P A;  1R0A B;  3AB4 B;  4OYO A;  3GJR B;  3TZZ A;  2OML A;  2XG8 A;  1RAI B;  1Y7P A;  4RO0 A;  2O67 A;  2BXJ A;  1DAX A;  2BRK A;  3M8P A;  3Q89 A;  1NJX A;  1QVG R;  2RDI A;  2YWK A;  2VIC A;  1NSQ A;  1TVR B;  1FRH A;  3L4B C;  2QL9 B;  5I3P A;  1HNW F;  5F8M A;  3NLC A;  2GW8 A;  2HHP A;  3JTP A;  1BQX A;  3H2V E;  2J6S A;  4GMK A;  2HND B;  2J0Q D;  2F3J A;  2XY6 A;  1WD6 A;  2VQF J;  3T1H J;  4YR3 A;  5D4P A;  1X4F A;  1L3T A;  3M2R B;  2HG4 A;  5T7L A;  2B7B B;  3GJT B;  3ZXW A;  5C24 A;  4DOZ A;  4NYO A;  2XYH B;  1RHM B;  1DRZ A;  3QT6 A;  3QMQ A;  9RUB A;  1Z2L A;  4ZK7 M;  1S1V A;  4F3O A;  4U67 Q;  1QTN B;  2B0G A;  3MCO A;  3K8W A;  1AFJ A;  2FJE B;  3NG8 A;  2RUS A;  2XHW A;  1VYA A;  4DV1 J;  5EWE A;  3Q8Q B;  1CPZ A;  2NYH A;  2BE2 A;  2CDQ A;  2B9Y A;  4WU2 A;  3SV3 A;  2ZUG A;  4HDG A;  3JSR A;  5CD4 H;  2QC3 A;  5AXM A;  4NA2 A;  1X5O A;  5K8P A;  2B7C B;  3CCU S;  1OSD A;  2E66 A;  2ROG A;  3LP1 B;  5KFP A;  2AP6 A;  4DV0 F;  1HA1 A;  2XYG B;  3G96 A;  4B3T J;  4DQQ A;  2MQN A;  2MZR A;  1YGY A;  2VKZ G;  4MIB A;  5JVH Q;  2DGV A;  3MMJ A;  2KN4 A;  2DBB A;  1VGY A;  4J9P A;  3W2V B;  4USV A;  4EYH B;  2CQG A;  3NS6 A;  4CLL A;  1JJH A;  1KON A;  1UCN A;  4B3R F;  4TKT A;  3S7R A;  3PR4 A;  4JBC A;  3WC2 A;  3SQG B;  2B4P A;  5AXN A;  4NLW A;  2MQ8 A;  2U2F A;  1YJV A;  3BKF A;  1O0P A;  1Q53 A;  3HDS A;  1NAQ A;  3PEJ A;  4OHZ A;  3C6T B;  5D0G A;  2C3U A;  1NME B;  2H4W B;  5CXT A;  3OR2 A;  2IM0 A;  3R1H A;  1HKA A;  1RAJ A;  2QYG A;  3ETM A;  1DTT A;  3QO9 A;  3CJ5 A;  2JEF A;  1WKL A;  2KG1 A;  4GVB A;  4NCG A;  6FD1 A;  3VQT A;  3B4D A;  4WYW A;  1JJC B;  5M2R A;  4ZVO B;  2FVC A;  3G82 A;  3SSS A;  2P9E A;  4J9L A;  2KI2 A;  3CO9 A;  1O5J A;  1XN9 A;  4QW8 A;  4UW2 A;  1P8G A;  1JJ4 A;  2DGW A;  4QWB A;  5LSR A;  1ZZF A;  1R43 A;  1OY9 A;  3SQO P;  2HWH A;  1FER A;  4QWA A;  2Z58 B;  3QID A;  3DLK A;  1DHM A;  4OV6 A;  4DI6 A;  3MAA A;  5IT0 A;  1KR4 A;  2WON A;  2DGT A;  2ZZT A;  3CJ2 A;  4FF2 A;  1ZS6 A;  1HI8 A;  2XC9 A;  2OJ3 A;  4AD6 A;  2FZC B;  4ZVH A;  2QSW A;  2CQC A;  4HAC A;  2DKO B;  3E01 B;  2KXF A;  4DL3 A;  4LF9 J;  1TQL A;  4QZV B;  4I1T A;  2L9W A;  3O5T B;  2FQQ B;  4X4V A;  2OH2 A;  2W1B A;  2HPU A;  4OLO A;  1CG2 A;  3DLH A;  2H9Z A;  5IXU A;  1RT1 A;  2ZH9 A;  2YBV A;  2M52 A;  4HTJ A;  2C42 A;  4RBU A;  4ES1 A;  3Q22 A;  3MAH A;  2E9T A;  3A12 A;  3JAM Y;  4ED2 A;  3HMJ G;  4NLR A;  1MW7 A;  1OQ3 A;  2F9J A;  2WSE C;  2NS1 B;  3IGN A;  3PIP Q;  1LEO A;  4IR9 A;  4WZM A;  1FJC A;  3NY0 A;  2HHQ A;  1R27 B;  2VQF F;  3T1H F;  4DUT A;  2CJA A;  3ZNU A;  2FY8 A;  4C2M A;  1UWA A;  5ETL A;  5BYQ A;  2A6O A;  2V4R A;  2YKP A;  4M5D A;  1I6J A;  2MQL A;  3THT A;  4NMX A;  1R6V A;  2CQ2 A;  4C8N A;  4UT4 A;  2CVI A;  3L3C A;  2J0S D;  2JDJ A;  3EX7 B;  3HVA A;  1EET A;  2WVD A;  4MJK A;  2GJF A;  3IMQ J;  3TAR A;  1YZ7 A;  3KYL A;  1RJJ A;  1RT3 A;  3T41 A;  2MQM A;  3UR0 A;  4HEA 9;  2YQ0 A;  4MKB A;  3GG0 A;  4B3T F;  4MIW A;  1Q86 T;  1QY7 A;  1T9W A;  5H9F J;  3NBP A;  3MMA B;  1ZOT A;  4ZP6 A;  4OZ1 A;  1J5O B;  2WW8 A;  1NK7 A;  3IP0 A;  3N0V A;  2H5I B;  5D0H A;  2E1A A;  1YIT S;  2H51 B;  3HFV A;  3PHE A;  3DMJ B;  3KKF A;  4FPR A;  3C6U A;  1RA6 A;  5LM7 E;  3MUM P;  4KHM A;  3SBM A;  3ZZ0 A;  2HSE B;  5IM0 A;  4OZN A;  2EC0 A;  2UUW A;  4A8M P;  1REG X;  3TUZ C;  4KB7 A;  3HPO A;  2KYX A;  4OLP A;  4NLG A;  2WRM A;  4HHJ A;  3THP A;  3AOD A;  1K1S A;  3CD0 A;  3IWN C;  4B3M J;  4QWE A;  3KHR A;  5G0R A;  2OFG X;  4AYB D;  3BZQ A;  2KFZ A;  1O6X A;  3LQV A;  3Q8V A;  4RU9 A;  2KFN A;  4M8L A;  5CZX A;  4IFY B;  1KLM B;  2HBZ B;  3VAI A;  4DR3 J;  5A76 A;  5GAG I;  2HHX A;  1U2C A;  2FB0 A;  2VOD A;  2HNZ A;  2CJB A;  4DR4 J;  4CTA A;  4G65 A;  4KT0 C;  2XMK A;  2HZV A;  3MM9 A;  3DM2 B;  2DB1 A;  1DAR A;  1GTE A;  4DUZ J;  2Y0S D;  3OXF A;  3ISZ A;  3W61 A;  4B3O A;  1S1W A;  4NRU A;  4KGX B;  4JUZ A;  4PXD A;  1T11 A;  1CBK A;  1JX4 A;  2W2Q P;  3UN5 A;  2DY1 A;  2KJW A;  4AQY J;  5A8W A;  2BVZ A;  3NOG A;  3C16 B;  3KLI A;  3M6X A;  3CE8 A;  2MGZ B;  3EXC X;  2MPU A;  3CXC R;  3M7V A;  2QJ3 A;  1FWP A;  4ELT A;  5KFI A;  2B9E A;  2YWG A;  2L9D A;  3IA0 A;  1M5H A;  4TYB A;  4LF9 F;  2GX8 A;  1YJT A;  2Z2Z A;  5LT5 A;  3W9H A;  4DQP A;  2IMW P;  4NA3 A;  4LSN B;  4F4K A;  4OZJ A;  5CYM B;  4TLQ A;  1WSR A;  3OTD A;  1YTY A;  1Y00 A;  4YY3 F;  2DHA A;  3GMG A;  2EFQ A;  1K0T A;  1FI4 A;  3G9C A;  2DXE A;  2XI2 A;  3RYL A;  3BGO P;  4UUW A;  2FLO A;  4E0D A;  3HZE A;  4WFA Q;  3L7O A;  1VQN S;  3HVT B;  1EAR A;  1DY3 A;  2DPJ A;  5LMU J;  3D68 A;  2AGP A;  2ZZM A;  2LLZ A;  2OGU A;  2JX2 A;  1MWZ A;  3DYA A;  2RT3 A;  1D1U A;  1I1G A;  2CVE A;  2VG6 B;  3NWG A;  2BJ3 A;  3V6D A;  1ZA2 B;  4KHP J;  4LT6 A;  1VHI A;  3M8Q B;  3KLF A;  3SXL A;  1PYO B;  1B7F A;  4CO5 A;  5HMY A;  3KLH A;  5B0B A;  3DKD A;  2DHS A;  4I2Q A;  2G4B A;  1OY6 A;  4G1Q B;  2GZO A;  3I5C A;  1S7H A;  4OV1 A;  1HL6 A;  5L9N A;  3F0N A;  4RNO A;  2YWF A;  5L1L A;  1SJF A;  1M5K C;  3TW0 A;  2AZ3 A;  1GMW D;  3LH2 S;  4ED8 A;  3ILI A;  2AX1 A;  4PG5 A;  5C42 B;  5IQQ A;  1U1L A;  3VVT A;  4K0K J;  3KK2 A;  2KZZ A;  1R89 A;  2VQE J;  3A3P B;  3FSY A;  3KTQ A;  5CHC B;  4R0J A;  1MMD A;  1S6P B;  3EJM A;  3FMW A;  2ACM A;  1GT8 A;  1RU2 A;  2R7X A;  2P6S A;  2JLF A;  3KG1 A;  2WB4 A;  3CCW A;  1TL7 B;  4RBT A;  4DV6 J;  1BXN A;  1B64 A;  3LWM A;  4LR9 A;  1M5O C;  5B0C A;  1WC1 A;  3KHL A;  4Y65 A;  5I4M A;  4JI0 J;  1LW2 B;  2QA1 A;  1T95 A;  2VHG A;  3B6B A;  3F41 A;  3MWB A;  3U1M A;  1WTB A;  2L48 A;  4DX8 H;  3GYG A;  3K5O A;  4ZJO A;  2KH9 A;  3BRE A;  4C8O A;  2RRN A;  5IZH A;  3K58 A;  2FY1 A;  3HD2 A;  1W26 A;  2PA3 A;  2C1E B;  3M6U A;  4N7T A;  2BQR A;  1HQ2 A;  1X4C A;  1WEL A;  2C3Y A;  2EK6 A;  4DL5 A;  3QLH A;  1ACM B;  2GVZ A;  2WBM A;  3MPW A;  1VHF A;  1NPR A;  3ITH B;  3A1Y G;  2V34 A;  3A4T A;  3FZB A;  2MKI A;  1N52 B;  1ICE B;  3LF0 A;  4B3M F;  2XCA A;  2IJR A;  4CIO A;  3QAT A;  3OBI A;  2M3D A;  2Z4P A;  4JV1 A;  2K7K A;  4HI2 A;  1IJE B;  3WHI A;  4I2P A;  1SXL A;  2HQF A;  5EDW A;  4TYA A;  2HHW A;  4DR3 F;  2GGP A;  3G86 A;  1BY9 A;  1SVD A;  1IKY A;  1CC8 A;  4K4U A;  2IC3 B;  1NK5 A;  3B82 A;  4DR4 F;  3JXO A;  2V8H A;  4QR0 A;  3UDV A;  1JLB B;  1VQS A;  2XO7 A;  3T5J A;  3UPF A;  4NAS A;  4DUZ F;  4P52 A;  2ZJP Q;  3QRP A;  2R8G A;  2QO3 A;  1RT4 B;  1MRO A;  1R31 A;  1Q8K A;  1EQM A;  4WFN Q;  3F73 A;  1N6Q B;  3IBF B;  1FT8 A;  4AQY F;  3GIJ A;  1VBK A;  4WWS A;  1NLK L;  4DBQ A;  3QJL A;  1MU2 A;  1UVM A;  3UW1 A;  4K4W A;  3EVW A;  5HP1 A;  4KQZ A;  4X4P A;  3KJV B;  3QIP B;  2C22 A;  1S9G A;  1V5V A;  2VPZ B;  4ZP7 A;  1PKU A;  3UDL A;  2EI5 A;  1UVL A;  3H90 A;  3L09 A;  3UFC X;  3OT9 A;  2BE9 B;  3IG1 A;  3O1L A;  2EG1 A;  4KPY A;  2MMY A;  4DFM A;  1KRP A;  1JLC B;  4RUA A;  2CRL A;  3NS7 B;  4IR1 A;  1HQU B;  1RT7 A;  4O3Q A;  5D77 A;  3DRS A;  4LBH A;  5KFU A;  4RW6 B;  4C8K A;  4ZVS B;  4IG0 B;  2QYC A;  2HKE A;  3JQK A;  3TVY A;  1VS3 A;  1NXI A;  4F0H A;  1W2B R;  1Y0H A;  2X1B A;  1YIJ S;  2RKI A;  3HUL A;  1S1X A;  4PXC A;  3K5M A;  5LMU F;  1K73 T;  5M2P A;  2DIU A;  1T0T V;  3SCI E;  1VBZ A;  1EKR A;  2JSX A;  4OYP A;  4KHP F;  4U8V A;  2RIJ A;  3DXB A;  2LQ5 A;  1JLE B;  4NLT A;  3L95 X;  1F9H A;  1RZM A;  3RB4 A;  3SSQ A;  4K2X A;  1UJ4 A;  2V4J B;  3WZ0 A;  4FKX A;  1EQ0 A;  2VBW A;  1JNR B;  1LQ9 A;  1HNV B;  5JXS A;  1VQP S;  2V8P A;  3DI6 A;  1XNQ J;  4PWW A;  3VQS A;  2YX7 A;  2MXY A;  2DXF A;  3M8R A;  2V6A A;  4G6V B;  1ZH5 A;  2RIL A;  2XCP A;  4K0K F;  4TY8 A;  2MEW A;  1NHK L;  4E8U A;  2VQE F;  3CIZ A;  3NAH A;  4RW9 A;  2O5D A;  2W01 A;  3VAF A;  2ERR A;  2UU9 J;  2RS8 A;  1VCT A;  4KGZ B;  3EYZ A;  3FCW A;  2W9C A;  2PMZ D;  2QTW A;  5HMW A;  1XR7 A;  4KPC A;  2UXB J;  1IR2 A;  2CA9 A;  2V2Z A;  2RB7 A;  2XLK A;  3R2C J;  3P6Y C;  1FJE B;  3TUJ C;  1KQK A;  4YDD B;  3QRQ A;  4DV6 F;  1KVK A;  2FJW A;  2UP1 A;  3S1T A;  4DFK A;  2R7O A;  4JI0 F;  2F40 A;  1A6L A;  2HS3 A;  3C8Y A;  2ZHO A;  5J2P B;  3V4I B;  5HQM A;  4YR2 A;  4ZMM A;  4MK8 A;  1V5I B;  3LTO A;  5E3Q A;  1QJH A;  3M32 B;  3C3L A;  3CDU A;  5LMN J;  1FNM A;  1PJ6 A;  4H4M A;  1G4C A;  3ET6 A;  1U1R A;  1H73 A;  1SC1 B;  4BWM A;  3MM8 B;  3LP0 B;  2I5J A;  3H5S A;  3KUH A;  4WKR A;  1NKE A;  1KP6 A;  2YNH B;  5A8R B;  5EHH A;  4ZPB A;  4LR7 A;  1RLC L;  4DSF A;  4OI6 A;  4CP5 A;  1S5Z A;  1YG0 A;  4I64 A;  4NRT A;  2GVD B;  3SFG A;  2K7J A;  4DUY J;  3M6W A;  5KT5 A;  2WSC C;  4NX9 A;  2CG4 A;  2G0C A;  5EWG A;  1F1B B;  2F63 A;  2G2O A;  2IMO A;  3DLG A;  4IYQ A;  1YVF A;  3KUE A;  4ED3 A;  4KO0 A;  4BCA A;  2F1F A;  4USH A;  3NNH A;  1Z2Z A;  2ZOG A;  1ZPW X;  1D0E A;  4EBC A;  2FLL A;  2ALZ A;  3DOM A;  1CJU A;  5KFY A;  5CH7 B;  2AJ2 A;  1SJ3 P;  2NXN A;  3M8P B;  1AW0 A;  3GFZ A;  2QA4 S;  3R5B A;  3CCZ A;  3AAW B;  1GK8 A;  1UW4 A;  2P2C B;  3NWR A;  2OEM A;  2J7U A;  1OYE A;  1KSP A;  3PZP A;  2I0X A;  3I96 A;  2VBX A;  4QIF A;  4USJ C;  2L41 A;  3DOL A;  1E6V A;  3NMA A;  5DG7 A;  4QBU A;  2B43 A;  5T7L B;  2E29 A;  4YR0 A;  2B9W A;  5C24 B;  2GQQ A;  2ZNZ A;  2GMH A;  2CQ3 A;  2PC6 A;  4RLE A;  1S1V B;  3LAK A;  2CPI A;  5DQH A;  2AV5 A;  3CC7 S;  2J8S A;  3HJF A;  3TVZ A;  3HKW A;  1QUP A;  2X7I A;  3N5F A;  2DR7 A;  3R5J B;  2ZJQ Q;  3P8B B;  5IWA J;  2XZW A;  2IDE A;  1NDK A;  2VOO A;  1WOS A;  2BE2 B;  2BV3 A;  3BSC A;  3PCO B;  3KWM A;  1IBC B;  5IC6 B;  2HYI B;  1K47 A;  2EFV A;  2L9N A;  4NYP A;  2R7T A;  4DCJ B;  4UOH A;  1S1U A;  1NEE A;  1N5Y B;  2PE8 A;  2PEB A;  1Q5V A;  1TTH B;  4NI2 A;  5CCM A;  3H2L A;  1FRI A;  2YX1 A;  5MAO A;  2XYP B;  4IO1 A;  5KFM A;  3M2U A;  2GIF A;  2LVW A;  4USK A;  3W2W A;  5EGY A;  3JS9 A;  2W2P P;  4C0B A;  3K0J A;  3C14 A;  1N88 A;  5KFD A;  3RBE A;  4DU7 A;  2P5V A;  3T6J A;  3T1A A;  1C0T B;  8AT1 B;  3OFF A;  1XNQ F;  3P49 B;  3EVM A;  4DLG A;  4B9N A;  3HLU A;  1G2E A;  3DRY A;  3MM7 B;  5D3G B;  3CDW A;  5E3P A;  2FZG B;  2QGF B;  1GXL A;  3E8O A;  3VZI A;  1WC5 A;  2DGX A;  1R0A A;  5KFT A;  2UU9 F;  4F02 A;  2HFZ A;  3SI8 A;  3VR1 A;  4Y28 C;  4G1I A;  4Y2M A;  4FKY A;  4PZV A;  1B0P A;  1DTT B;  1L3U A;  3QO9 B;  3J80 Y;  4OHV A;  4ZCI A;  4ED7 A;  2UXB F;  4L6V 3;  3R9L A;  1N54 B;  2D3Z A;  2RNE A;  4NCG B;  5BXI A;  3NCP A;  2MKY A;  4C98 A;  2HFN A;  1WHY A;  1VQ5 S;  2CJK A;  1HHT P;  5HAT A;  4RJV A;  1TVR A;  3LW5 C;  2P8I A;  2EFP A;  1LK5 A;  3UVJ B;  3EGV A;  1OJ4 A;  5KFO A;  1VBX A;  3IM9 A;  3V81 A;  3BH6 B;  1FRX A;  3M8Z A;  2CQH A;  2I2Y A;  2IJN A;  1YKW A;  4OX8 A;  3M2R A;  1NK8 A;  2ZC4 A;  5LMN F;  2WAQ D;  4QYR A;  4A8O A;  2V8G A;  4EZ9 A;  3ZZO A;  4DSK A;  2KT2 A;  3DLK B;  4AXI A;  2CAJ A;  3MAA B;  1JLQ B;  3ZTQ A;  1X9S A;  1JXE A;  1UFL A;  3N01 A;  3TRG A;  2C2E A;  1RWN B;  2PMH A;  1ZTW A;  1OSC A;  2KTQ A;  4P9S A;  4F50 A;  3OSP A;  4ECY A;  4DUY F;  3FQK A;  2HFU A;  2LDY A;  1S49 A;  2UVR A;  3HHL D;  5L9X A;  4UOG A;  4PG6 A;  2CAD A;  1TAQ A;  2LDI A;  1RK8 A;  1EP4 B;  4ECX A;  5CCL A;  3HSG A;  1J5E J;  5KT6 A;  1U1N A;  1U45 A;  2BJ1 A;  3AD9 C;  5AE2 A;  4LFC J;  3BBB A;  3ZNJ 1;  1RT1 B;  4ZIV A;  2HBQ B;  1LFW A;  5GMK a;  2HVH A;  1UZH A;  2OPP B;  3UD3 P;  1VI7 A;  4ZA1 A;  4K4Y A;  1ZM9 A;  2W2M P;  4IDK A;  5KFX A;  4Q44 A;  3PO5 A;  2I9S A;  2MST A;  2GC8 A;  4CM0 A;  4F04 B;  2FZK B;  3CDA A;  2OFH X;  4YME A;  4W98 A;  1NDL A;  4CO2 A;  4NZ7 A;  4ECU A;  1KQS R;  3BO3 A;  2N4C A;  3DRR B;  1WG1 A;  2LEB A;  1QAY A;  1TK8 A;  3I4P A;  1T02 A;  2EXU A;  2IAJ A;  2ZBI A;  4KIA A;  4Q8F A;  2XWX A;  2HHV A;  2M7S A;  3BV8 A;  1S57 A;  4BC9 A;  1NPP A;  3GIM A;  3OLB A;  2FJX A;  2BW7 A;  4Q8E A;  3M05 A;  4YB6 A;  3OL9 A;  1RAG B;  2FLP A;  2OUG A;  2KJV A;  4E98 A;  2DTJ A;  4M5D B;  2RDJ A;  2RQM A;  2JC0 A;  4M94 A;  2CG8 A;  3K59 A;  3D6T B;  5K9F A;  3LP2 B;  1NJY A;  1TK5 A;  4FXW A;  1F6T A;  1Y5I B;  2KKH A;  5IWA F;  1EET B;  4HDH A;  4R0E A;  1IQT A;  3E51 A;  1UJ6 A;  1FDN A;  4O3R A;  2NXU A;  1RT5 A;  1FFS B;  3FBE A;  2V5H G;  4KV8 A;  1RT3 B;  3GV8 B;  2LP4 A;  4M1K A;  2FJV A;  2VG7 B;  3BGR B;  2D69 A;  4WTO B;  1BLU A;  3BDE A;  2ZUA A;  1SKU B;  3ISN C;  1RP5 A;  5HL7 Q;  2F8E X;  4PG8 A;  2ZHB A;  4C7Q A;  4C8M A;  3MI7 X;  5KFA A;  4CH1 A;  2CNO B;  2ZH7 A;  3TX8 A;  3NBP B;  3MGJ A;  1FRK A;  1ZM2 A;  2EBE A;  1VIX A;  2MZJ A;  5KFQ A;  4TN2 A;  5D6G A;  5AXL A;  2H3E B;  4M5J A;  3DGP B;  4CLT A;  2FGO A;  1RTZ A;  3MEE A;  1X4G A;  2DCL A;  1RQ0 A;  2FHJ D;  4ZP9 A;  3UD4 P;  1NPK A;  2OPS A;  3A3N B;  1MN9 A;  2XUL A;  1BUX A;  1F0X A;  5IM0 B;  1GQE A;  1H2U X;  4KSE B;  2J6U A;  1YBT A;  3OR1 B;  1UJ5 A;  2BR0 A;  2OEK A;  1VQ7 S;  4CO1 A;  2C2R A;  3MXH P;  4A8F A;  3W5Y A;  3H42 A;  4PWD B;  3SCL E;  1TL4 A;  5G0R B;  4OZ3 A;  3HCX A;  3KLV A;  2LEA A;  2VDI A;  5AE1 A;  4MAK A;  4WK1 A;  4DSL A;  2YVS A;  4RW8 A;  2HZA A;  2W7P A;  2ZC3 A;  1X0F A;  2XMJ A;  4F4Y A;  2ZHA A;  2ZVS A;  4AE5 A;  4L72 B;  2ZH5 A;  1FJG J;  1RT6 A;  3PYG A;  2D74 B;  3LGH A;  4KC5 A;  3KLG B;  4XK8 C;  2BUN A;  1BC6 A;  2FDN A;  3GR0 A;  4GVL A;  3K5N A;  1S76 D;  3FDS A;  3D66 A;  2I6W A;  1S1W B;  3KG0 A;  2YKN B;  3MR5 A;  3J7A 1;  1NCL A;  2M88 A;  1TL3 A;  3IR7 B;  1SL1 A;  1S1T B;  4D3H A;  3HSZ A;  5KFK A;  5ETV A;  5DDO C;  4V1A k;  1M1K T;  1R0C B;  2ZDO A;  4OJH A;  3AA8 A;  2F4V J;  2V94 A;  5KFS A;  1FF2 A;  1IKX B;  3I5A A;  4A46 A;  2XO6 A;  2K3I A;  2UXC J;  4UTG A;  2MKC A;  4MT1 A;  5H9E K;  1YJR A;  1J5E F;  2VPW B;  4ZVT B;  3MR6 A;  1KOO A;  1S97 A;  3D1O A;  3OLA A;  4PPD A;  2LA4 A;  4J5O A;  1TMM A;  2RRB A;  1HWU A;  1F9F A;  3P5B P;  5J2M B;  4LFC F;  4J9O A;  3L7P A;  3UCZ P;  4I56 A;  3LPE A;  3NCR A;  2Y1R I;  3CDE A;  5K8M A;  1QLN A;  1AUS L;  4NZ6 A;  1I94 J;  4QPT A;  1K1Q A;  2FVQ A;  3PW4 A;  3PX4 A;  3KUG A;  1IBM J;  3MMA A;  2VZ9 A;  2E1P A;  4ETX A;  2UUC J;  4W92 B;  1S0V A;  2R8J A;  3T9Z A;  5F8N A;  4U95 A;  4OL8 A;  5DDR C;  3V6D B;  3VAJ A;  3OFE A;  3Q2S C;  2GS8 A;  5HSP A;  2V8D A;  1JWW A;  2KB2 A;  3NAI A;  3KLH B;  2QFJ A;  4JI8 J;  1GTH A;  2CJX B;  3T5H A;  4I6A A;  4I2Q B;  2V68 A;  4DXL A;  4N76 A;  2WW4 A;  4RWX A;  4CLK A;  2QZ8 A;  1VC0 A;  2AYM A;  2GO8 A;  2LQB A;  1HNX J;  4O4G A;  3T6B A;  3HHL C;  2UZA A;  2BAN A;  3I6P A;  2AX0 A;  2X1G A;  3KDO A;  4WP8 A;  4FXV A;  1VR6 A;  2BW2 A;  2LQ9 A;  2VFU A;  3U1N A;  3H4B A;  1S0N A;  1UFK A;  3KK2 B;  1ULR A;  4Z2X A;  4DPO A;  4I67 A;  3IC1 A;  1V3R A;  3RR8 A;  4M5I A;  1VQ6 S;  3VAK A;  4ZN1 A;  2GHV C;  2ZKT A;  2E5J A;  1FK9 A;  3Q8P B;  3IBW A;  2GO9 A;  4CQ1 A;  3JYT A;  4U7C A;  2D7S A;  4GKJ J;  1VC6 A;  2HFS A;  3R7B B;  2HW3 A;  3G4S S;  3TO8 A;  3M2V B;  2VDH A;  1RAC B;  1F2H A;  2OHD A;  4ZPT R;  2XSJ B;  2BAC A;  2PO4 A;  1F5B A;  2MKJ A;  1W2I A;  4ANC A;  2Z2Y B;  2VPX B;  2BJ7 A;  4ECT A;  2KO1 A;  5GAG U;  2QMX A;  1OPI A;  4WZQ A;  2GFF A;  3KHH A;  4EFA C;  1IBL J;  4KY3 A;  4AUK A;  4AL7 A;  2W4D A;  2ACY A;  4NE9 C;  3G8Q A;  3D2W A;  2QMU B;  2HVI A;  5FD1 A;  5HBM B;  3MR7 A;  1WC0 A;  5K14 A;  3QLH B;  4O0I A;  3M8W A;  1OS5 A;  2BOA A;  1EJ7 L;  1Y4Z B;  1KOH A;  3NP5 A;  4WU3 A;  3R6G B;  3RAM A;  1RHJ B;  2QLW A;  3CVK A;  4Q7A A;  3KOA A;  2YH0 A;  5K20 B;  1BD6 A;  4I68 A;  4LRA A;  2ZH1 A;  1FKO A;  1RWO B;  2DK2 A;  4B02 A;  3PYE A;  1RB0 A;  4URG A;  2GGP B;  1KC8 T;  1H2V Z;  2UUB J;  1R7I A;  1FJG F;  2NXC A;  3BGU A;  3HK2 A;  2H54 B;  3DHW C;  5HVH A;  3GJQ B;  1ITP A;  4UOC A;  1AA1 B;  1CJK A;  4OI0 A;  2YKM B;  3OXL A;  3PEH A;  3G6V A;  4ZVU B;  1MRO B;  4G1Q A;  1IR1 A;  4FS2 A;  4QIG A;  4ILM A;  4JI4 J;  3CUN A;  2CZ9 A;  1RTH A;  4DPU A;  3W60 A;  4C48 A;  4CH0 S;  2JFK A;  2OSR A;  2Q6B A;  4LRE A;  1HR0 J;  2CXE A;  2D3U A;  1UVI A;  4FYY B;  1WDD A;  2YWW A;  4MFB B;  4QIE A;  5HP1 B;  1H3D A;  2M70 A;  2DD8 S;  3IAM 9;  4JP8 A;  4ECR A;  1FRL A;  2COL A;  4S0M A;  2F4V F;  1KLN A;  2VFT A;  4FYV B;  4XDC A;  3OL6 A;  2Q6C A;  2QEX S;  3GIR A;  2ROE A;  2AJF E;  2KXN B;  3QSI A;  4DSI A;  2WTF A;  3IG1 B;  4OIX A;  2XNR A;  1YJN S;  1N0V C;  2PGC A;  2RRA A;  2UXC F;  2CQ4 A;  4F4W A;  2IVF B;  2OIH A;  1D9D A;  2RAQ A;  5LXR A;  1RT7 B;  2HHU A;  5E3R A;  1AB8 A;  1TL7 A;  3DRS B;  2HHT A;  1CS4 B;  5HQL A;  2X1F A;  2GIR A;  1YHQ S;  5GAE I;  4PAB A;  4QYZ J;  3GZ7 A;  2RQC A;  1I94 F;  1S72 S;  3UE2 A;  3NXZ A;  2P9G A;  3VCD A;  1SH0 A;  1HBO A;  1S1X B;  2UV8 G;  2DIS A;  1IBM F;  3PKY A;  5KFL A;  5THW A;  1SJR A;  2UUC F;  2HRU A;  2HWT A;  3R5C A;  3ONQ A;  3EGN A;  1HHQ A;  2D9P A;  2ZFH A;  5DZ7 A;  1SJ4 P;  4JOU A;  1FWL A;  4JI8 F;  4DSE A;  2F4F A;  3R1L A;  1HBU A;  1Y3K A;  5GVQ A;  4RUC A;  3DXS X;  2AYE A;  3ITH A;  1NK4 A;  4Z37 A;  5L1I A;  2XTJ P;  2FVR A;  3HVW A;  1AZS B;  3K57 A;  3S01 A;  1HNX F;  4RW7 A;  2DNR A;  4D3G A;  1YDL A;  1DTQ A;  3OFH A;  5EUH A;  2KL8 A;  4MTP A;  1T03 A;  2H4Y B;  1S9E A;  1SKW A;  1WHW A;  3QZ8 A;  2XY7 A;  2QFI A;  1TKD A;  2W9C B;  2RUG A;  5B08 A;  4M5M A;  2Z56 B;  5A2Q Y;  4WXO A;  4LFA J;  3R2D J;  1X60 A;  1HI1 A;  1V9O A;  4GKJ F;  2F8H A;  3Q8R B;  3N6N A;  3R5A A;  3C19 A;  4NPO A;  1F5A A;  5G4D A;  1RT4 A;  1RA7 A;  4ZPV R;  1TKZ A;  4ELU A;  2YPY A;  2CFX A;  4NLS A;  1CVJ A;  4FPI A;  2ASL A;  3UN2 A;  4O44 B;  4KYZ A;  4U7U D;  2ILY A;  2KT5 A;  1RDR A;  1IBL F;  4OJG A;  4WF9 Q;  5KOW A;  2GHW A;  2A18 A;  4K4S A;  3H59 A;  5E7O B;  1NRK A;  1U47 A;  4ZVG A;  2I5J B;  1WEY A;  2KM8 C;  4C8Z A;  1WOO A;  1NK9 A;  1L3S A;  2PA8 D;  2HHS A;  2LYV A;  5ETQ A;  4FBT A;  5IT9 Y;  3HHK A;  2V2Q A;  1RAD B;  3EGZ A;  2AD9 A;  1T7P A;  1VQM S;  4JI5 J;  1FES A;  1JLC A;  2SXL A;  1HQU A;  4JV5 J;  2YPZ A;  4OI3 A;  1RBA A;  1X5S A;  1UWB B;  4IG0 A;  4F36 A;  4TVA B;  3DLG B;  1HBM B;  5IV4 A;  2UVV A;  4KO0 B;  2HBY B;  3GFY A;  3A8I A;  1APS A;  2NQP A;  1OMS A;  3TUP A;  5E5N A;  2VKR A;  4RZR A;  4CZC A;  3MUV P;  3DOM B;  1CJU B;  1DBD A;  1FXR A;  5HAO A;  5HJX A;  3P3D A;  2UUB F;  2PFD A;  4ZCM A;  2A2C A;  4EO8 A;  2Y8Y A;  4HT7 A;  2CQ1 A;  1JLE A;  2WHO A;  1MLA A;  4QW9 A;  1U6F A;  4F0M A;  4ZVQ B;  5KFZ A;  1ZYQ A;  3AJD A;  4IOA Q;  3CNQ P;  4JI4 F;  4TU9 A;  1S99 A;  1HR0 F;  1N33 J;  2K06 A;  1U2F A;  1Y11 A;  2Q66 A;  1E6V B;  2WK4 A;  4DX7 A;  4BBY A;  3D28 A;  2CNK B;  2PI4 A;  3PO4 A;  3V4M A;  3AOC A;  5F9L A;  2BA9 A;  4X4Q A;  4HH1 A;  4PXB A;  1U6B A;  1SJQ A;  3DOK A;  5F8J A;  4OZ2 A;  3RRH A;  2R9L A;  2EVZ A;  2U1A A;  2JWN A;  2O3D A;  3SYZ A;  3GIL A;  1WI8 A;  1GXU A;  5J2Q B;  2VOP A;  4IFV B;  3M4X A;  2K3K A;  1J2V A;  1YBU A;  3TZX A;  4ELV A;  1AT1 B;  1AYE A;  5DQI A;  1C1C B;  4DF4 A;  4DR5 J;  4HH0 A;  5B0G A;  2QN6 B;  1WC4 A;  4U96 A;  4A47 A;  3VAM A;  3NRB A;  2O1P A;  2D41 A;  2OTJ S;  3BGL A;  2IRU A;  4V19 X;  3LPY A;  1S0O A;  3CJR A;  3BB5 A;  5J2P A;  2XS5 A;  3V4I A;  2CUY A;  3BQ0 A;  5HLF A;  5F8G A;  2OAU A;  1M5V C;  3MEC B;  1FKP A;  3RU0 A;  3M2U B;  3PJX A;  1Y5L B;  3MM8 A;  3W2W B;  3LP0 A;  4CLW A;  1MG7 A;  2YNH A;  3MOZ A;  4J9Q A;  3C14 B;  1VJQ A;  2XBP A;  1C0U A;  2GVD A;  3RG6 A;  1OYD A;  5KT7 A;  1W7W A;  2QLF B;  3N79 A;  1U6Z A;  2WVE A;  4ECV A;  1VQ8 S;  1WOP A;  4UF4 A;  2JEG A;  3EPG A;  3EE3 A;  1HPZ B;  5CQG A;  1NJI T;  1JK9 B;  1X9M A;  3IR5 B;  1X7V A;  4OQJ A;  2HGM A;  3IS9 A;  5D0E A;  2AGO A;  1N5V A;  4YOE A;  4WCE Q;  4UQT A;  4USW A;  4R8U A;  2HK3 A;  4ZN3 A;  2IM3 A;  2PT0 A;  1TMJ A;  4C11 A;  4LFA F;  2H65 B;  1N34 J;  2H5J B;  4ZVP B;  1I3O B;  1S7I A;  2KYZ A;  3J80 U;  3DLE B;  2BAB A;  4YP3 A;  4K59 A;  4FF1 A;  4DG1 A;  5DM6 Q;  1Y3J A;  4K4V A;  2AW0 A;  2OTL S;  3U1L A;  3I32 A;  4ID5 B;  3PW5 A;  3GJS B;  3V81 B;  4AXJ A;  3ILJ A;  2H48 B;  3R7S B;  1RWK B;  4DV3 J;  1ZAX A;  3FK4 A;  2V9W A;  1RKI A;  2HNY B;  5HQ8 A;  3QT5 A;  2IPO B;  3RBX A;  3BSN A;  2EBG A;  4P6Q A;  3US5 A;  2OD4 A;  4TQS A;  2QL5 B;  2K1R B;  4CO4 A;  1D8Z A;  3EXY A;  4QQB A;  2MY8 A;  3UNY A;  4X66 J;  1U24 A;  4MYT A;  4RW4 B;  4L3K A;  1LFP A;  2KRR A;  4JI5 F;  3GP9 A;  4ZVF A;  1QAI A;  4ZLP A;  3O44 A;  5FDL A;  3FBF A;  3F56 A;  1REV B;  4O3P A;  3P96 A;  1B4S A;  5ETN A;  3V2U C;  2R8H A;  2JL9 A;  3FRZ A;  5KFC A;  4K5S A;  4B17 A;  4RUB A;  4JI6 J;  3FEX B;  1YJW S;  2QSF A;  1N5Y A;  3ADA C;  3WQP A;  2V2K A;  2R8K A;  3VAH A;  1S6U A;  5HI7 A;  1HBN A;  2KHD A;  3DRX A;  4IDK B;  2OD6 A;  3ZZT A;  3H5U A;  3CJ0 A;  1G7C B;  3K8V A;  2BZ2 A;  4M5H A;  2GAG C;  3N5B A;  4I69 A;  4HT5 A;  3W63 A;  3QWU A;  2C2O B;  3D1Q A;  1WSV A;  4ZVE A;  1DZ5 A;  1OQ6 A;  1C0T A;  4USM A;  4FYD A;  3FQL A;  1WEZ A;  4ATN A;  4Y2I A;  2QMW A;  5FJ4 A;  5JVG Q;  1N33 F;  2CYY A;  2IAJ B;  4KGM A;  1SC4 B;  4Y3C A;  2VBY A;  3MM7 A;  1PIL A;  5D3G A;  3OJS A;  3GYX B;  1F5C A;  3DU6 A;  4OYX A;  2K8G A;  1R6Y A;  3W65 A;  1XMO J;  2LQJ A;  1BE4 A;  2OPR B;  1P1T A;  2OEL A;  4ENO A;  2MY7 A;  3BN4 A;  3RGI A;  2XEX A;  3PV8 A;  1XIQ A;  1WC6 A;  1D8Y A;  4OHW A;  1SL0 A;  4ERD A;  4EI2 A;  3CD6 S;  2PD1 A;  5L39 A;  1SQG A;  3FEZ A;  2ZEJ A;  2FTR A;  3AQO A;  3I31 A;  3GIK A;  4DR5 F;  2GMJ A;  1RT5 B;  2HAI A;  4NYZ A;  1OIA A;  1IJF B;  4OI1 A;  1OY8 A;  3UVJ A;  2LFV A;  4KV8 B;  6AT1 B;  3OUY B;  1WG5 A;  2ZIT A;  1UEV A;  3H20 A;  5F41 A;  3UWT A;  1CEZ A;  1VQL S;  5U47 A;  3B8H A;  1U7L A;  1VQ9 S;  3TJA A;  5HVG A;  1KHW A;  4F3M A;  1PYT A;  2HQD A;  4LRF A;  2DPI A;  3FBC A;  1P1L A;  2FYX A;  5C25 A;  3M9M B;  4ED1 A;  3K89 A;  2W9A A;  4ED4 A;  1HNI B;  3H25 A;  1JLQ A;  4ZHR B;  4HKQ A;  4PYA A;  3KK3 A;  1ZPV A;  1RI7 A;  2FVP A;  4I7F A;  4CNY A;  1D09 B;  3MEE B;  1U8W A;  2LA6 A;  1ZET A;  4P73 A;  4WBF A;  2ADB A;  3T1Y J;  2M2B A;  2OPS B;  3AT1 B;  2EFG A;  3W66 A;  2KG0 A;  2ZDP A;  1EP4 A;  2DR5 A;  2HUR A;  3W9J A;  2IYI A;  3J7Y I;  3AB2 B;  2GAH C;  3CW2 C;  2E5I A;  4F4Z A;  1Q82 T;  2QRR A;  3KK1 A;  2AJQ A;  3K5L A;  1CQN A;  3PR5 B;  3CME S;  2OPP A;  4JB8 B;  3Q86 A;  1N34 F;  1RLD A;  5L1K A;  2N3L A;  4OYM A;  1U2R A;  4RW8 B;  3DDK A;  2AJ1 A;  3T5K A;  4LRD A;  3NNC A;  2IRY A;  3PJW A;  1U1Q A;  3PNI A;  3DRR A;  3RB3 A;  4IOC Q;  2RSQ A;  2BEF A;  4F67 A;  4TU8 A;  4N47 A;  2FVS A;  2M5Y A;  1RT6 B;  1QM9 A;  4M63 A;  3DHX A;  3V6K A;  3UNG C;  4XPE A;  4DV3 F;  3AD8 C;  2DXD A;  2CWK A;  3PVX A;  5SZT A;  1TL3 B;  3HVR A;  3OL7 A;  4H4O B;  1QTM A;  4IQX A;  4X66 F;  3AOB A;  3J7A N;  3LP2 A;  4DPY A;  5C5J A;  2UVU A;  3HHL A;  4N8N A;  4DV1 F;  1U1P A;  3POT B;  2VA3 A;  5T14 A;  3GB0 A;  5KFV A;  3H7H B;  1G6B A;  3VF0 B;  4X4T A;  3EDR B;  5LL6 d;  1PJ5 A;  3IWX A;  4QPX A;  1LNQ A;  1FX4 A;  4JI6 F;  2VG7 A;  3BGR A;  3A8J A;  3MPY A;  2HS0 A;  1M5S A;  3BO2 A;  2CJQ A;  1H7X A;  2ROP A;  3DDN A;  4TLR A;  4OHY A;  4KFB B;  1CJV B;  4PWU A; 
#chains in the Genus database with same CATH homology
 3GJT B;  1RWM B;  2HBZ B;  2P2C B;  2XYH B;  4ZVU B;  1RHM B;  1RE1 B;  2CNN B;  1BMQ B;  3RJM B;  1RHQ B;  3P45 B;  1SC1 B;  1ICE B;  1QTN B;  1RHU B;  1SC3 B;  2HBQ B;  2XYP B;  2CJY B;  4ZVR B;  4DCO B;  2H65 B;  2H5J B;  4ZVP B;  2QLJ B;  1I3O B;  1I51 B;  2C2K B;  4ZVT B;  3KJN B;  3NS7 B;  1GFW B;  3P4U B;  2H5I B;  1NME B;  1RHR B;  2C2M B;  2CNL B;  2H4W B;  4ZVQ B;  2CDR B;  2H51 B;  3IBC B;  3GJR B;  2QL7 B;  2HBR B;  2DKO B;  4DCP B;  4ZVS B;  1RHK B;  3R6G B;  2Y0B B;  1RHJ B;  3KJF B;  2CNO B;  1RWX B;  3D6M B;  1PYO B;  2C2Z B;  5K20 B;  3R6L B;  3GJS B;  2Y1L B;  3EDR B;  1QDU B;  4JB8 B;  1RWN B;  2FQQ B;  3EDQ B;  3R7B B;  3R5J B;  2QL9 B;  3R7N B;  2H48 B;  3R7S B;  1RWK B;  2CNK B;  1RWO B;  1PAU B;  2QLB B;  2H4Y B;  2XYG B;  4ZVO B;  3SIP B;  2C2O B;  1F9E B;  2XZD B;  1IBC B;  5IC6 B;  3IBF B;  3D6F B;  2QLF B;  2XZT B;  3KJQ B;  2C1E B;  4LSZ B;  1RWP B;  1RWV B;  2QL5 B;  4DCJ B;  2H54 B;  3GJQ B;  1RWW B;  3D6H B;  2HBY B;  1SC4 B;  5IC4 B;  2CJX B;  3QNW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...