1FE0A

Crystal structure of cadmium-hah1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
66
structure length
66
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords COPPER TRANSPORT PROTEIN ATOX1
publication title Structural basis for copper transfer by the metallochaperone for the Menkes/Wilson disease proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fe0A00
3CJKB 4DPOA 1U7LA 1QUPA 2IFXA 1V3ZA 2XMVA 2ACYA 2QIFA 2XMUA 1YJVA 2GA7A 3K7RA 4HH0A 4Q2MA 1N5SA 2HLUA 2K2PA 2AP6A 1X8DA 2OAUA 1FVSA 3BGUA 1K0VA 1FVQA 5B0GA 2KKHA 2Q3PA 4U9RA 5KAKA 2IYIA 2KT2A 2XMKA 1YG0A 3F44A 1YJTA 1TR0A 1XBWA 3BB5A 3TRGA 3HHLA 1W2IA 1Y0HA 1MWZA 3FMBA 4YEAA 2LXFA 1TUVA 2PGCA 2LDIA 3LGNA 2HQIA 2N4DA 3BR8A 3MZIA 2XMWA 1N5VA 1N5TA 1FD8A 2K1RB 2XMTA 5F0UA 2FIUA 4A48A 2G9OA 4FNIA 2BYCA 1URRA 2GV1A 2W4PA 3FRYA 5B0FA 2W4CA 1AW0A 1Y9OA 1S6UA 1CC7A 3HX9A 4F67A 1YRXA 1RJJA 3MCSA 5F0WA 2ZDPA 1TL5A 2ROGA 3DXSX 2BJEA 4HI1A 5A6PA 4HH1A 4OJGA 4OJHA 2LQ9A 4EFAC 2XMMA 5B0DA 5B08A 4YDXA 3DCAA 2OD4A 4Q2LA 1CPZA 5B0BA 1VQYA 2HIQA 5T7LA 1Q53A 3KKFA 2K7JA 2HFOA 1X7VA 1IUJA 2W4DA 1OPZA 3BN7A 1Q8LA 2GGPB 4Y2KA 2RMLA 2EW9A 5B0AA 1Q4RA 1R6YA 1SB6A 2KYZA 4FNHA 1CC8A 2ROPA 2OFGX 3HDSA 2LQBA 2OKQA 1YJRA 1YJUA 2FTRA 2QLXA 2RU9A 5K9FA 3T9NA 4OJ3A 5B0CA 4OJ1A 3BF4A 2XMJA 2RSQA 1P6TA 2GO8A 1X0PA 4Y2IA 2OMOA 1Y3KA 4A46A 1VQSA 1KQKA 2ROEA 1KVJA 1JK9B 4HI2A 5A6WA 1GXTA 2JDJA 2BUNA 4OIXA 2VV5A 1TL4A 4Y2MA 3QMQA 2N4CA 3HHLB 2L3MA 1FESA 1OQ6A 2HLTA 2BBEA 4ZA1A 2K1RA 4ZOSA 1TZ0A 2GFFA 2PD1A 3LO3A 4HL9A 1FE4A 4DL0C 4DN9A 1ULRA 1APSA 1JWWA 3HHLD 2FHMA 3QGPA 3CJKA 2ASYA 5B0EA 1FEEA 2ZDOA 2HFNA 3TNVA 2GCFA 3IWXA 2AJ1A 1P8GA 1Y3JA 2CRLA 1SQEA 2RILA 3KG1A 4A47A 1OQ3A 1OSDA 3E8OA 1WD6A 2FB0A 2QLWA 2AJ0A 1KVIA 1LQ9A 1N5QA 3TOQA 1MWYA 2AW0A 4NL5A 3KNGA 2VH7A 2KT3A 3HFKA 2BJDA 1FE0A 3VTIA 4A4JA 1AFIA 3FGVA 2GGPA 3HF5A 1AFJA 5T7LB 3UDCA 5IXUA 2IYGA 1SI9A 5B09A 1S6OA 4NPOA 2OP5A 3KG0A 2OD6A 2QYCA 3GZ7A 1Q8BA 3BDEA 3HHLC 2K7KA 3BM7A 3I9ZA 3WDOA 2OFHX 1GXUA 3LGMA 4QOTA 2N7YA 3IWLA
chains in the Genus database with same CATH superfamily
4B9NA 3DI6A 1LFPA 1R8AA 3P8BB 5HL7Q 1H2VZ 2V9WA 2JLFA 2C2OB 8ATCB 2RKIB 3OXLA 4ZPVR 4IOAQ 3CEDA 3DC2A 2MKSA 3NBPB 1JLQA 3OFEA 4EU0A 3JTPA 1F2GA 1TL5A 1RT7B 1WKLA 2RRBA 2APOA 3I55S 2X3DA 1UZHA 3H4DA 3QYYA 1JXEA 2VJVA 1TL3A 3F73A 1OS5A 4RR5A 4KV8B 1QSSA 1R8CA 4LREA 3DHXA 1KC8T 3KHHA 4MYUA 2ZFHA 1N33J 4LRAA 1JLGB 1SKUB 3DRYA 1IM6A 4DPYA 2XCAA 3QGIA 4FP9A 2HBQB 4OYOA 3DM2A 1RAJA 4DG1B 2XZTB 3AD9C 4LQ3A 3CCQS 1MLAA 2XSJB 3ZZZA 4LF9F 2ZUAA 2YWFA 4DR6J 1ZBTA 4NLQA 4KAIA 1NAQA 1FK9B 2OPPB 3MEGA 3NLCA 3FZ2A 3UR0A 1A9NB 2AX1A 4HH0A 2PFDA 2YKAA 2UUBF 1FHTA 2ALZA 1KBRA 4URGA 1XEZA 2HKEA 1F9HA 2BOAA 3PFOA 1TELA 1ZTTA 1VQ4S 2D3UA 3KK3A 1KWMA 1Q0NA 1CPZA 2UVUA 2GQCA 3NCRA 5IT0A 2UUWA 3KJVA 4XIUA 3JB9k 4OX9F 2LU2A 2MLYA 3CD6S 3MAAA 2ZM6J 2M7SA 2MKJA 2OO4A 1VBKA 3N6MA 5CYMB 4ANEA 4YR3A 4Q8FA 2B7CB 4DF4A 2VQFF 3M2UB 2ZBIA 1LKZA 1UWBB 2QA4S 2DNOA 4XDCA 4DV5J 4EGLA 4FDFA 2YNHB 4DPTA 3GWCA 1Y3JA 2GVZA 1SQEA 2EFGA 1EETB 3KG1A 2VF3A 2H5IB 4XTTA 2UUAF 4F3OA 3GCWP 2HFUA 1UW9A 4WFBQ 1VBXA 3BO2A 4FYDA 1NNDA 1K1SA 4A8OA 2O66A 3G6ES 3D2WA 5HN0A 4J9MA 1K0VA 1JX4A 3RRHA 3IGNA 1Y0HA 2JFDA 2KDOA 3LGNA 2VC0A 3GFHA 2CNLB 2E5HA 4X4NA 4RBTA 1HNIB 3R5DA 5K14B 1FX4A 5AT1B 1UVLA 3IR7B 5A8WA 1REGX 1T9YA 2LFVA 2A6OA 2XWYA 3NP5A 3H59A 4RL1A 1UWAA 4JI2J 4A8YA 3OPKA 4B3RJ 1VI7A 1FT8A 3QJJA 2VBXA 4C8MA 1HLWA 1S5ZA 4HVZA 1PYTA 4RW8A 1IBLF 2D3ZA 3I5CA 5D4LA 5SUHA 1SCJB 3CJQA 3KNAA 2Y0SD 1E6YB 2DYAA 3T6JA 3H2VE 2ZH4A 5FD1A 3OFHA 4K50A 2BM0A 2L9NA 4DV7J 3I4PA 2NR0A 3GV8B 2UXBJ 3LQVA 2EFVA 1KONA 1TUVA 1TFWA 3JSRA 4ZMMA 3ITHB 1CULA 4F67A 5D3GB 2V4RA 4Q0BB 4R25A 4E0DA 4JI6J 1M1GA 5KT3A 3HK2A 1XNRJ 4OZJA 2G13A 4ZVQB 5CAAA 4LF4F 1R0AB 1U25A 1N36F 2HAFA 2YBVA 1T3OA 2H51B 3BF4A 4B3MF 3BSNA 3KLHA 3CVKA 3CJSA 4ZCKA 1VQ8S 3M8ZA 4ERDA 1WWHA 3OSNA 4KSEB 5G0RB 2RQCA 2R4FA 5IT4A 3QGPA 4EMDA 3QLHB 3VZIA 2ZZNA 2V2VA 5RUBA 1D9FA 4IG3B 5JVGQ 1RISA 2ZC3A 3UVJB 3SSRA 2CQPA 3BDEA 4C7QA 1S6PB 5LMNF 1WG1A 3OD2A 1RT2B 3NS5A 5AE1A 2Z2LA 4KFBB 1YJTA 3G8TA 1NJIT 2MZRA 3E2EA 4NA2A 1KP6A 2KM8B 2WOMB 2WZ1A 4KY3A 1I3OB 2J7KA 3MM6A 1IVZA 1T03B 3H5SA 1LWCB 3B6BA 1DBDA 2VUGA 3IM9A 4L73A 3C15B 4ELUA 5LOQA 4QYZJ 2M9KA 1SKRA 3KLVA 5KFEA 1MROA 1RT4A 5E3CA 2IIHA 1RTIA 3QO9B 1FKOA 4FS2A 2R7QA 2Z2ZA 1VC0A 1UJ5A 4PPDA 3W61A 3DFEA 4J9OA 2CRLA 1SC6A 2ZKTA 1HNVA 1HKAA 3QT7A 5FDLA 1VFJA 1C1CA 1FXLA 3WZ0A 3Q23A 4IG0A 2XO7A 4WFAQ 3M30B 2BE9B 1Q7YT 4N7TA 5HBMB 3GIIA 2V34A 4CO4A 1RTDB 3HKWA 1QSYA 2KXNB 2OEJA 4ECWA 2RT3A 3KHRA 4UOHA 4RNNA 4GVBB 2NXCA 1JLFA 4PG6A 3BSAA 3DLHA 3K5OA 1VC5A 3IBCB 3BSCA 1HNXF 3PR4A 1GT8A 3GJTB 4ECVA 3T1YF 1G1XA 1H72C 4K7QA 3N5FA 1TL1A 5E41A 4M5NA 2JEIA 2J0QD 2UVRA 2OMLA 4DF8A 2PT0A 5KOWA 1PBUA 1HWUA 4QIFA 4RW9A 4LF2A 2M88A 1FRXA 1KDNA 2ILZA 2ZOMA 2AJ1A 3RAXA 2HS4A 1ZETA 4Z7CA 5DQIA 2DIUA 3I82A 3ISNC 2R42A 2EEYA 4YY3F 4DFKA 5DGAA 5JJBA 3I9ZA 4FXVA 3V6HA 3Q8UA 3CC2S 1LXJA 1X4CA 2MLXA 2UV8G 3ENWA 3FBEA 3QGHA 1TMMA 1YI2S 5KG5A 2QO3A 4JBCA 2AEMA 3F41A 2VOOA 3LOUA 2MQPA 3HJVA 1GH8A 5ETKA 4JYAJ 2EFQA 1AUDA 2ABYA 4WTOB 1PJ5A 2B7BB 4PYDA 4ZPCA 2Y9HA 2N82B 1DTQB 2M3DA 1XN9A 1X4AA 5DDQC 2ZD1A 5HO4A 3NMRA 1B64A 3VAGA 3D28A 1VRUB 2V8VA 3MDFA 5CYQB 4GMKA 3JTOA 1O5JA 1RTJA 3H5YA 1WTFA 3IWXA 2V63A 3PV8A 1EKSA 4F3QA 2DNLA 1UMJA 3FCHA 2MSTA 2MSSA 1AFJA 2EG1A 3FC9A 1Q7LB 3UD3P 2J0SD 1M5VC 3GFYA 3WIVA 2JVRA 2N3OA 1QAJA 1BQNB 1GMUA 3W5ZA 2VOPA 1AA1B 4CO2A 2W9CB 4F3MA 2IY5B 2K1RB 1VHFA 4BBYA 2XCPA 3HHKA 4W92B 3P5BP 3KYLA 1W25A 1RLCL 4LFBJ 1UTAA 5EUHA 2JLEA 4WFXA 3S7RA 3ZZUA 4ZHRB 4K5RA 2GGPB 1X4DA 3I5AA 4IOCQ 1WC6A 4CLZA 1SB6A 1Q95G 1FTRA 3WQPA 2YKQA 1KS2A 2E44A 1FFWB 4U6PA 2DTJA 5D6GA 1O51A 4TQSA 3M8YA 2R8HA 3BDPA 4Y2MA 4DCJB 4IQXA 1KHWA 3PYDA 2GFFA 2ZH2A 4M5IA 3DRSA 2IHR1 4MTPA 5KOXA 3LA0A 1QTMA 4M94A 4XO0A 3V81A 3HD2A 1FNXH 4DXLA 1LWFA 3FDSA 5DZ6A 1JXVA 3P96A 4OI1A 2MY8A 2CJBA 4P72A 5EGYA 2CQ4A 5L1LA 1W2BR 4X4OA 2ZBQA 1X60A 4TLQA 3NS7B 3SI8A 5E33A 3VVTA 2GV1A 3TANA 1IJFB 1SXLA 4F4KA 2QLJB 5C7PA 2FVQA 1ZZFA 1D8ZA 1X5OA 5FLXY 3K59A 2HGNA 3NRBA 1YJUA 2MTLA 1OPIA 3DYAB 4F4WA 1QTNB 4ZLLA 5AE3A 3HKZD 4NMLA 2L3MA 2VPZB 2ZJRQ 1REVB 3UDVA 4A47A 3E8OA 1KQSR 2JZ5A 2PA3A 3CD7A 3GLJA 2AJQA 3WHIA 3UO0A 2DNRA 2F8MA 2VBZA 2M4MA 4NPOA 4RUHA 2RD5C 4KH0B 5GMEA 3HLUA 3W8GA 2M52A 2YKPA 2HNDB 2MY7A 1NPRA 5HVHA 3ZZTA 1VHIA 4H4MB 3IFEA 2DEIA 4N8OA 3MMBA 5KFYA 4HACA 4RW6B 1FO1A 5A8RB 1FNOA 1IKVA 3ZXWA 4Y0FA 1RJJA 2CVEA 1VQLS 4K4XA 4QU7A 2VA2A 1HPZA 3BN7A 3DN9A 5I4MA 2DD8S 3BPDA 4X62J 3I96A 1NJZA 5ETRA 2GHPA 1NCLA 3CE8A 2OMOA 5DJBA 1A6LA 3SSQA 2VQEF 4X66F 1I94F 4PABA 2LA6A 1RI7A 3DOLB 4J9SA 1IBMJ 3EDQB 3PNIA 3TUPA 3C6TA 2MKKA 4KGZB 1TFYA 2NSBA 4RJVA 4Y65A 2KJVA 4JV0A 2DRBA 2UUBJ 1CJKB 3HO1A 2LKZA 2X1AA 2EG2A 4IR9A 3OQ2A 5AJ3F 3LTOA 2ACYA 2ADCA 1XMQF 2P6TA 4JB8B 3RYLA 1NSQA 3BYPA 3TW0A 1OSCA 4L3NA 4EI2A 1HI1A 2R7RA 4OX9J 1N6QB 4KH1B 4QIEA 3SV3A 5B0BA 1XIQA 3TJAA 3AJ1A 3VHQA 5A0YB 5MLCV 2GVDB 1EARA 2H48B 2EVZA 5F9NA 4USVA 2VQFJ 1QAYA 2P9EA 1RT3A 4NEYA 2DVIA 3R2CJ 2CG8A 4PZVA 2JC1A 2GIFA 2BUNA 1Q16B 4PKDB 3SQOP 3HHLB 1U0HA 1EP4A 1LNQA 3K2YA 2V69A 1C1BB 3DHWC 1CJUB 2LLZA 3K8VA 4IDKB 3CCVS 2FB0A 2QA4G 1JMTA 4DV0F 1XR5A 1FI4A 6FD1A 3M2VA 1KR4A 3V5RA 3G96A 4TYAA 2IBOA 2FJEB 1D9DA 1TP7A 3QAUA 3UCUP 2DY9A 2HHXA 2PO4A 4XAKA 2L48A 1KN6A 3KJNB 4K2XA 1YKWA 1FX2A 1FRLA 2FJWA 1T9WA 1XQIA 4CO5A 2D1CA 4N8NA 4F0KA 4DSJA 1B0TA 3R6GB 1BY9A 2NQPA 3CIMA 5T7LA 3J7YI 1HBNB 2W24A 3O2IA 2FVSA 2I6WA 4NX9A 2HHQA 3NNCA 3CCWA 1WKJA 3UCGA 2AGPA 4ED4A 4X2BA 5GVQA 3H20A 2PI4A 1X4BA 1U6BA 1FRMA 4A46A 2VBYA 2RB7A 4R0EA 2RIJA 1NMEB 3H5UA 2HHHJ 5CYJA 4DL0C 4KGXB 4ZP7A 2RILA 5C42A 5GADU 2G4BA 2CZ4A 2ZEJA 1HBUA 4UUWA 1VJWA 1QE1A 5I42A 3AOBA 2QYCA 4O44A 2OFHX 1PCAA 2CZVC 2Z30B 3JXOA 4XDDA 4J90A 3GV5B 1DLOA 2HIYA 1QD1A 4BWJA 2CWKA 2XYHB 3OLBA 4ZVFA 3LF0A 5ETPA 2B4VA 5CZVA 2W4CA 1I1GA 1PIEA 5IFMA 1FFGB 1LV5A 4B3MJ 5HQLA 2IPOB 4X4TA 3FVYA 4ED5A 2VC1A 1IWGA 3BBBA 7FD1A 3VAHA 1Q4RA 3PHEA 3MR6A 2H5EA 4OJ3A 4OJ1A 2PIIA 1YJWS 4H4OB 1BUXA 2Q43A 3BO3A 1X9MA 2OLWA 2C2EA 1FESA 1J5EF 4N5SA 3MMCB 2VZ9A 1RZMA 2HFNA 4WYWA 3K5MA 5IM0B 5LMNJ 3E01B 3UWTA 1Q5YA 5DETA 2WTFA 3RZAA 3TAMB 1NKCA 1SQGA 3T41A 2ZHOA 1NB7A 1C0TB 4Q2LA 2J76E 3CJKB 2KZMA 3ITHA 3U02A 2BJ9A 3K7RA 2XMUA 2DHAA 2HEKA 4NLYA 4PRFA 3IXQA 2VG5B 1HQUA 2PDAA 1W2IA 3V2UC 1KLMB 3ETMA 2V2QA 5B7WA 2K3IA 4NLUA 4JI0F 5GMDA 4DQQA 3J81U 5CA5A 1E6VA 1Y4ZB 2XZWA 3DRRB 5L38A 1CG2A 4AXJA 1NJWA 2UZAA 2YKOA 9ATCB 2HZVA 1C0UA 1Z2LA 2VPYB 3HSDA 1SJRA 1TAUA 3HSGA 3PIOQ 4LUBA 1TK5A 2ZC4A 3QMQA 3SIPB 3UPFA 1H2UX 3I6PA 1RWKB 3TX8A 3TJ9A 3ELHA 5L46A 1GNKA 3TQ1A 1DAXA 5KFIA 4DHVA 1H2TZ 5ETNA 2FJAB 3MGJA 2BDPA 2RQMA 1RCOB 4ES3A 4A4JA 1HR0F 2XGQA 2WONB 2FZGB 3I4HX 2WOMA 3W9JA 4PXDA 2LEPA 4HHHA 1K44A 2CJYB 3T1YJ 2AJFE 1S1UA 2MGZA 2HSEB 1V5IB 1T9XA 1VJQA 4DPXA 1EIYB 3R6LB 5I3UB 3D4JA 4LVNP 2B6AB 5ITHA 1RAEB 4M5DB 4CT8A 2IA0A 2ZBPA 2B0GA 3I9V9 4O0NA 4C11B 1S97A 8AT1B 2D7SA 1GMWA 2HHTA 4C3MA 3PJWA 3RUBL 3DLGB 4O3QA 1WC4A 4DQRA 1S1TA 4CLKA 3SCKE 3M9NB 1KEKA 1V3SA 5GMKa 2NXEA 2QRRA 1LFWA 1U1QA 1WI8A 2O5DA 4I7FB 1T9TA 4FXWA 1RTDA 1GFWB 1LQ9A 3PEHA 2W2NP 4N77A 1SL0A 4O3RA 3DOMA 1WG5A 2M8DB 3VZHA 2IDLA 4DI6A 5HMXA 1ZYQA 4MFBB 3FRZA 2UXCF 2GA7A 4ZS6A 2OSQA 2V6AA 4Y00A 2IM3A 3H25A 1RWUA 1EJ7L 5J1EB 2I9SA 3JYTA 4ZVTB 4RU2A 4JI8F 3GIJA 1FNMA 1WSRA 3BGRB 1FD2A 3RGIA 3ZO7A 2HVZA 4ZCMA 3T19A 3MM5B 1XMBA 5KG4A 1J5OB 1HD0A 5K8MA 1R8PA 2HW3A 3SMZA 2MMYA 1Q79A 3MPYA 2WSCC 3CO0P 2MQOA 3GSDA 3EXCX 2IM0A 1WC3A 3Q8QB 3BN4A 4QW9A 1S4EA 1U49A 2MZTA 4YS2A 3TVZA 3M6WA 4ZOSA 1RK8A 2ZH5A 4NA1A 4K4SA 1RHQB 2WVFA 1PKUA 5HLFB 2JEFA 3CXCR 4ZITA 4I2QA 2DHGA 3LH2S 2E29A 1DARA 3PYGA 2HBZB 3L09A 4A8SA 2XSFA 5J2NB 2C3OA 3Q89A 1HW8A 3A13A 1YITS 3DRPB 2DNQA 1FDNA 5LM7E 1YLXA 2RF2A 3PW2A 3PO4A 3GTYX 2Y1JA 3SBMA 4CT9A 2YNIB 5B0FA 3IRXA 1A7GE 3KMSA 5EDWA 3W65A 4OJHA 4QR1A 2OPRA 3NY0A 4IH6A 2HBYB 3M6UA 1U45A 4YR2A 2W7OA 1N5YB 1NJXA 2Y3YA 3AFGA 2F8EX 3ZNUA 2ASDA 2MQQA 1RP5A 5D77A 1DTTA 4QIGA 4RW7B 4ER8A 5J1PA 3NCQA 5KT5A 4FF1A 2ZITA 4AYBD 5CHCB 2DB1A 5DQHA 3DDKA 1BQMA 2GCFA 4FBUA 4X4RA 3T1HJ 4R8UA 1SV5A 2V8HA 3C6UB 4J5OA 5KFCA 2AIRB 4WXWA 2AMCB 3BGFA 4H4KC 1VQNS 1TV6B 2H1YA 3MTJA 2V4QA 3QZ8A 2JSXA 3MAQA 2VKRA 4YR0A 3BH7B 1FWKA 2G2YA 1WUUA 5KG1A 3SQGA 1CC7A 1YRXA 4LF5F 5GAGI 3P49B 2DH8A 4HH1A 5B08A 3OHBA 1S10A 1CQNA 1WHWA 4KHPF 3NMAA 3PW4A 4PWDA 4IFVB 2BE2B 2VIHA 3K0JA 4WK3A 2GJFA 1MMDA 2ZZMA 3LP0A 1SIZA 2DCLA 4RZRA 2RRNA 3PRBA 3KUGA 3FJ2A 4K5SA 2R7SA 1WC0A 5CD4A 2AHOB 4K59A 2M70A 3MD3A 2Q66A 2A0FB 1HWJA 1TK8A 2QFJA 1FEEA 4KO0B 1U1RA 4X64F 1RGVA 3KOAA 1SJQA 2QLWA 3R5JB 2VFUA 3G82B 1GX5A 3UDLA 4UT4A 3QQCD 4DR7J 3IA0A 3JQKA 4R0JA 1VGYA 3RBEA 1GAOA 2Y1IA 5EHHA 4PUOB 2V2KA 3BKTA 2VPWB 1FVSA 1Y5NB 5IV3A 1SUQA 2KH9A 3PM9A 5A8KA 1DZ5A 5KFMA 4DPWA 2UXDF 2D9OA 4OZ1A 1P1TA 1RKJA 4DL3A 2BOPA 4ZLPA 1X5PA 1SKSA 2GHVC 1FRKA 1T05B 2IC3B 3UR3C 4L75A 3P5TL 3DLEB 3A8EA 4X66J 4HT5A 1I94J 2DISA 1F60B 2GQQA 4DQIA 1UJ4A 3GU0A 4WF9Q 1M5HA 1VC6A 1RT5A 5L9NA 4USWA 4LQ9A 4ICLB 3BSOA 1WOSA 3KLGB 4ZCLA 1TZ0A 1NK6A 4WZMA 3EICA 5AJ3J 2YPYA 1JLCA 3M8PA 4ZCIA 4DR6F 3R7NB 2EC2A 2GMHA 4JV5F 3HFVA 4USJC 2KL8A 3EWGA 4M1KA 4BCAA 1LWXA 1NLKL 1L3SA 4WE1B 2RAQA 2BJ1A 1K73T 2C2DA 5E3RA 4DBQA 4LT6A 3CO9A 4K4YA 3BR9A 1N5VA 3S8SA 2RS2A 3AD8C 3ONQA 2HURA 3BS9A 1UETA 1VIXA 3CDEA 1L3VA 3AQOA 2CQ2A 3EPIA 2YNGA 4WK1A 3A3PB 2XI3A 3TWZA 2YKMA 2RUSA 2JL9A 3N6LA 4TXSA 2AJ2A 3QIDA 1TTHB 1VQSA 2O1PA 3I87A 1ELOA 1HQEB 4J9QA 4DV0J 2B43A 3TI0A 5D4OA 4LF7J 4RBUA 1FDBA 2IDEA 4CH0S 3GP9A 4NYPA 2JX2A 2CPHA 2ZOFA 4TY8B 2OPQB 1H73A 4K4VA 2ZH7A 1L3UA 3CCES 3LALA 2XNRA 2HLUA 2OAUA 2XGPA 1S9EB 5KAKA 1OMSA 2W9AA 3MUTP 2BR0A 4YEAA 3C3LA 4KKOB 2B8PA 2RDIA 1HHSA 3IG1B 2LQ5A 2V0NA 4ZVRB 2LCWA 3CJ3A 2RS8A 3NCPA 4A8MP 4B3OA 2MKIA 2W9BA 4I4BA 4HDHA 2QFIA 2COLA 4JI2F 2UVVA 2CG4A 4B3RF 4JOUA 1P6TA 3Q2SC 2X1BA 1XNQF 3LP2A 1MU2B 4P2FA 4ZP8A 2CKWA 4UW2A 1SC4B 2DNNA 1X4FA 5KFJA 2MEWA 2WCXA 3IBWA 2PD1A 2DXFA 1XMOF 3OR2A 2QL9B 5DM6Q 2U1AA 2IA6A 4P52A 3DNCA 3ZZOA 3C66A 1S1XB 4WIQA 3EXYA 3VAFA 1JJ4A 2CQBA 4ANDA 4ID5A 1IKWA 3FBFA 2XS5A 5KFRA 1YGYA 5KFHA 4R5PB 2XNQA 5K8OA 4NYOA 1RBOB 2V68A 2FJBB 3JSMA 2MB0B 3HSJA 4RNFA 4O3OA 2B4OA 4DU8A 1Q81T 4O3PA 2E5JA 5J1NA 4PG4A 4F4AA 3QFWA 4CM0A 3O44A 3VF0B 1RSCA 2HNZA 3Q8PB 4IRCA 1YBUA 1NKEA 1I5OB 4UOFA 2MQNA 2FD2A 4C98A 4Q43A 2E1AA 4DL4A 1UEKA 4F0HA 4DV6J 1NB2A 4WP3A 2VG7B 2NPIA 3RB6A 3QRPA 3R9LA 2YWEA 4C4WA 1OIAA 1WTBA 1O6XA 4UY8T 2X7IA 3EZ5A 1N52B 2DXEA 4DSEA 3V6DA 2HHUA 4RUAA 3RW6A 2WHOA 4DLEA 3M8QA 3B54A 4CTAA 3DOKB 3TAQA 2L9WA 4X4UA 4ZK7M 4QIVA 2A1BA 2OEKA 4DPOA 3B4DA 4OI2A 3LANA 1VBZA 3ENQA 3MM7A 3SFUA 2E1MC 4URQU 4FKYA 2F9DA 2E1RA 5KFSA 3SDEA 1SPBP 1YIJS 1NHUA 5L1IA 1HWLA 4PXEA 2DBBA 1SL2A 3AOAA 2VICA 1TVRA 5ETQA 1DHMA 3LWLA 4HR2A 2FVRA 3MMCA 1CC8A 2K8GA 4M8LA 2G2OA 3CTRA 3VR1A 1HMVB 5GAEU 3MPDA 3A12A 3EMTA 3GJQB 3KK1B 2IRXA 2HZCA 2J8SA 3I0RA 1VLYA 2E7VA 2W2QP 1S1VB 5LXRA 1LOUA 2F5GA 3CB4A 2HK3A 4HL9A 3MECA 4NI2A 2Y8WA 4KGKA 3CJKA 1IKYB 4USIA 5IS2A 4CLYA 3ET6A 3PW0A 4DPUA 1CJVA 4ETZA 1P27B 2UUTA 4Y6IA 3GZ7A 4KIAA 3LPYA 1UFWA 2CWXA 5JUMA 1S1WB 4RX6A 1R0BG 5DGBA 1RT1A 4ZJQA 2GMLA 2XS7A 3KLIB 2N3LA 3M9OB 1TUGB 4ATNA 5C24B 3T6BA 1L5UA 4G6VB 1BMQB 2KZZA 2CJKA 1QVFR 1ZA1B 4NWBA 5IWAJ 3Q8VA 1EHWA 1CJTA 1RCXB 5L39A 2OFGX 5ETVA 1ZM3A 2WSEC 1X31C 1WEXA 3I0SB 2RH3A 3KK2B 3TUIC 1RT6A 3VAIA 3MFHA 4NASA 4WKYA 1XWLA 3HI9A 3L95X 4HTIA 4X65F 4P6QA 1M90T 4CNZA 2DGOA 2UXCJ 3CNQP 3KNGA 1U8WA 3WX4A 1KSPA 1V6HA 3M05A 3GFXA 3M7VA 4JI7J 4WFYA 4I0WA 4IRKA 4JI8J 2ZKUA 1NDKA 4KB7A 4N56A 4MKBA 2MQ8A 2QT7A 4P71A 2MKHA 5KFVA 3MF5A 4TN2A 2EFOA 5IT9U 2HVDA 4NLOA 4O3SA 5CD4H 2VFSA 1JLEA 5HVFA 3RBZA 2YWHA 2H4WB 1HYSB 4OHYA 1WEZA 4JYAF 4DCOB 2BJ8A 1AW0A 2HHVA 1LWEA 4ECQA 1PYOB 3T5LA 5IZHA 4TU7A 3MEKA 3A8KA 3K8WA 4G1QB 4P9SA 4DUTA 1P9YA 3CW2C 3GCXP 3NGRA 4QYRA 2I5JB 2OKQA 5F8HA 4J7CA 3OW2R 4HEA9 4Y2IA 3THTA 2CPZA 3OUYB 4IO1A 3DMJA 5ETMA 1XR7A 2AWZA 4M5KA 1EQMA 5KFZA 3ADAC 1T7PA 4PYAA 5I3QA 1HBMB 1MWQA 2HYIB 1S9GA 1PG5B 3MEEB 1MG7A 4Y3CA 4GKKF 1S79A 3PR5B 4QOTA 3VCDA 3MOJB 1WHVA 1RBAA 4K4TA 4I2PB 4LSNB 4J9KA 2MZ1A 2QMUB 4EBCA 2E9RX 3NWGA 2BW2A 1ICEB 2OPSA 3LP1B 2XY7A 3W7BA 2ZVIA 1M1KT 2F40A 1UAWA 4LFBF 2C3UA 4YMEA 1HL6A 3G8SA 1WJ9A 2DGSA 3JTNA 1T8EA 1YX2A 2ZWPA 1WACA 5EWGA 1G6BA 2F1FA 2FY8A 3AJ2A 1VBYA 4QWDA 1PYSB 3RB0A 1MN9A 1RTZA 1SH3A 5ETTA 3DLKB 3J81j 3B8HA 4LBPA 4W98A 2W8LA 3GIKA 1YSJA 2QE5A 5BJRA 1N48A 2R2RA 2R9LA 2XHCA 3KUEA 4USHA 4F04B 3N9UC 1FCAA 1TKXA 2ZNZA 1ULRA 2NYIA 1RWXB 1UEUA 3MOZA 1SKWA 4QCLA 2DO0A 2G0IA 2B51A 5HMZA 4MIWA 2XM3A 1V3ZA 4U96A 5AXKA 4O4GA 2BKPA 1FVQA 5GAEI 2DGTA 3U1LA 2G1DA 3CDAA 4OFZA 4QPTA 3TA2A 2E1PA 2LXFA 3QJPA 4NLSA 2ZBCA 1N5YA 5HROB 2W1BA 4BWMA 3IS9B 2YPZA 1QJHA 2MQMA 2QL7B 1BLUA 4EUVA 4ED3A 4ED2A 3EZOA 4Y2KA 2WBRA 3MM8A 3S01A 3T9NA 3D67A 4DV4J 1TKZA 4LF6F 4X64J 3M6XA 4JV1A 1NH8A 4RNOA 4NZ0A 2MXYA 4OYPA 2BW7A 4DDFA 5KFNA 3W60A 1U6ZA 5J2PB 4OI4A 4QWBA 2GS8A 4LIWA 3R8YA 1HARA 4NA3A 3W2VA 2BKOA 4MT1A 2O67A 4OI3A 2UXDJ 4B02A 1H6KX 1PGZA 1TL7B 2NUHA 2BJ7A 2DNMA 3CT9A 2AP6A 2GQ2A 4XPEA 1Q5VA 3RG6A 3RW7A 1DFDA 3GR0A 1RAIB 4HDGA 1WKKA 4MKVA 5JXSA 4DSKA 3PTWA 3A1YG 4LF8F 2H65B 3W8PA 3BH6B 1GX6A 1AB8A 1JKHB 4NLRA 4X62F 4A8FA 2HIQA 3OV7A 1KKHA 1IUJA 3CJ4A 2GO9A 1C4CA 3SSSA 1NSPA 4KR0B 2RSQA 1UW4A 4WCEQ 3DI6B 1VRQC 5F8LA 5AE2A 2W01A 3OLAA 1IBMF 4JV5J 3G87A 5KFUA 1H0HB 3A4TA 9RUBA 3V6KA 1JLQB 3R1HA 4ZN3A 2EXUA 4B9UA 4QW8A 2XMAA 4BLGA 2OD6A 2FVPA 3ZTPA 1NBEB 2YVSA 4ES1A 4Q45A 4MIBA 1TL3B 3OR1A 2J7UA 1AROP 3T9ZA 2Z0GA 5CH7B 3CCJS 1H3DA 1KD1T 4X4PA 5HQMA 2GJ2A 2XWXA 1YJ9S 4NXNJ 3M1VA 3DM2B 1C2PA 2E7XA 5A6PA 4OJGA 2QN6B 4NCGB 3HVTA 3VQTA 3ILOA 4FZVA 4ED8A 3CMAS 1SC3B 1SL1A 3EX7B 4OZ0A 1YZ7A 3M2RA 3MEGB 3OTOJ 2J9DA 3OVAA 3N0VA 4YHHJ 5I3PA 4F4ZA 2R7OA 4DWIA 4IUFA 3L9ZA 2JDJA 1VQKS 1RA7A 2GAGC 2XI2A 5FLXU 4I6YA 2HGLA 1RU2A 5IQQA 2CPIA 1WD6A 1Q86T 5D4NA 2DR7A 3AHPA 4B17A 4QQBA 3IM8A 1FE0A 2IYGA 2FC9A 1G7CB 1GTHA 3QT8A 4DR2J 2P9GA 4ILRA 3MURP 2XYGB 1LEOA 1QUPA 3MAAB 1NZ8A 3K17A 2CIMA 4RW4B 3EGVA 1RACB 2IYIA 2A6MA 5M2RA 4KQZA 1N32J 2F63A 5DM7Q 4JV2A 4DFMA 2R2TA 1S6UA 4C8KA 5CCLA 2ZDPA 2GVZB 4X4QA 2YNFA 1XNQJ 3AT1B 5DG8A 2W4DA 4G65A 1PC5A 2HHSA 2KFZA 1YRUA 3NGDA 2LQBA 4ZDNA 1RAHB 1XMOJ 2IAJA 2D3OR 2HHHF 2DNKA 3OL9A 1XERA 3BEGB 2WW4A 3V4IA 1HIYA 2PFFB 2WSFC 1TKDA 2HVHA 1QDUB 1FKPA 3K5NA 3VVUA 2ASJA 3J7ZT 3CCZA 3QIPA 3FUYA 5KT2A 4LSLA 4WYLA 2FVCA 4NXMF 2BJDA 1U24A 1BWVA 2CPXA 4P7VA 5A8WB 4GO7X 3FFIA 1HA1A 1SC1B 2C2ZB 3W62A 4WP8A 1R8BA 1TKTA 2FC8A 3PW5A 3HVRA 4TQRA 2LEAA 3QT5A 2E5GA 4ZIVA 1CS4A 5F9LA 6FDRA 2MKYA 2R8JA 1YG0A 3HHDA 4JUZA 1R89A 4RW8B 2R2UA 5F41A 2VDHA 3CGIA 3H0PA 3NG8A 4HT7A 2BRLA 3DXSX 2JVOA 4CZCA 3SXLA 3CCSS 3D9BA 4G3IA 4TY9A 1JNRB 1Q53A 3VAMA 4OX8A 3MD1A 4K2JA 4WXOA 1U1OA 1AZSA 1X5SA 2KB2A 4IH5A 2I8EA 4KGVB 5IT9Y 1BC6A 4ZVPB 1L3TA 1DURA 2YY3A 5LJ5Y 4OHWA 3H42A 2XQCA 4M63A 1Y10A 1KLNA 4P2MA 2EKNA 1HBOA 4CO1A 2RVJA 3MR7A 4C8ZA 1YRTA 1CULB 3L7OA 1IBKJ 2EPIA 4ZLJA 4RNHA 5K8PA 1ZH5A 3MEDA 3BGLA 1T0TV 2BQ3A 2OGUA 3D0GE 3W66A 2FLLA 3FBBA 3OFFA 3UN2A 4DQPA 3KLHB 3BPSP 4C0BA 2Q3PA 2V94A 2QYGA 1HW9A 3SCLE 3T5HA 1LK7A 3IBFB 4P2XA 2UU9J 2AYGA 3KLEA 2W4PA 3Q83A 5HP1A 3HX9A 2DNHA 1LW0B 4DV3F 1NHKL 5ETLA 3BZQA 3KLFA 3KXDA 2K7JA 4OL8A 4WBFA 4U95A 5CCMA 2QMWA 3ILLA 4Z37A 1WORA 3M8RA 1F3FA 4YFUA 2ZOGA 3MCMA 1BWEA 2RJZA 1OY9A 3P45B 3SFGA 1WG4A 2ILYA 4FKXA 2V4JA 1WNEA 2I38A 1U48A 3W5XA 2DR8A 2NXJA 5D0RA 5F8MA 4NZ7A 4WFZA 3GILA 4RLEA 2ZH6A 1PBAA 2DJWA 3MM6B 5IC6B 1SIWB 3Q8YA 3W64A 1FXDA 1S59A 3DGPA 5F8NA 3DLBA 2R3VA 1RYSA 3ZTQA 3LWMA 1KRPA 3C14A 2IMWP 1X0FA 2FY1A 2E5LF 1UVJA 2UP1A 3R5CA 2UUCJ 5LSLA 2B56A 3F44A 5HJXA 1MROB 1RT4B 4W4MA 2D74B 3MM9A 1LK5A 1AUSL 1FFSB 1RTIB 1NDPA 2DGWA 1FKOB 3FQKA 2I2YA 2VB6A 4DR1J 4LRBA 3PX4A 3IMQJ 2XMMA 1IKXA 4YB6A 1HNVB 4IKAA 3W9IA 3I31A 5FDLB 1S49A 4FNHA 4IG0B 2Z8QA 3QGGA 3D5MA 4NOHA 2F65A 3VAJA 3GJRB 2XLIA 2FJDB 4P7TA 5LL6d 3OTBA 1TK0A 1WDTA 4JI3F 2C22A 3TP2A 4X65J 5LJ3Y 1UP1A 2ATLA 5J2MA 3FEXB 1ZM9A 3MR5A 4ZVEA 4ZJOA 5D4PA 1JLFB 3LAKA 1FJGF 2ZHAA 3TNVA 2JJ4D 1MNEA 3T5JA 1MN7A 2HFSA 1Y11A 1TL1B 2VG6A 2CQIA 2HRUA 1GXUA 1TU0B 4ECYA 4DX7A 1KVKA 3KJFB 4AXIA 7AT1B 4U9RA 1AXQA 4Z2XA 4DS5A 1B0VA 4RW9B 3DXBA 3CMQA 5C25A 4FYVB 5LSRA 4E8UA 2HQFA 1NSAA 2YTCA 2MKCA 1R43A 1UPMB 2P5VA 3H5XA 1VMBA 1PC4A 1O8BA 1ZPVA 1HHQA 3OTDA 3H7HB 1VRTA 3HD1A 1OPZA 2AZ1A 1NUEA 4C3KA 4Y28C 3B82A 1QSLA 1BGXT 4I6AA 5DS7A 1HNWJ 3IR6B 2GIQA 2ROEA 2B9WA 5EN1A 2NZCA 2RDDA 3CCLS 5M2UA 3CSKA 2AU0A 4KGMA 1W26A 2A10A 2JRSA 3EYZA 2CDQA 2LXIA 2DHSA 2CQ3A 1SJ3P 1FRJA 4ZVUB 1S48A 4GKKJ 1QAXA 3HT3A 1S7IA 3GONA 2VH7A 3FK4A 1S4FA 3KG0A 2AQ4A 1HYSA 4U67Q 3CF5Q 5D78A 3GJSB 4D3GA 1NK9A 2KO1A 4MK8A 2VL1A 1X8DA 2ZD1B 3CJ5A 1S6QA 4JI4F 4KTQA 4IQMA 2LXUA 3MZIA 2Y8YA 4DR3J 3OT9A 1FA0A 4FNIA 1RTJB 2BMBA 3R3TA 3OL6A 1PO6A 2ZE2A 2HNYA 4CDIA 3Q8RB 4TKTA 4E98A 2LEBA 2F4VF 5B0AA 2CQDA 3H98A 1V3RA 2R8IA 3TQEA 3W2WA 2HMIA 1X0PA 1GQEA 2ATCB 2FHKA 2DH7A 2KXHA 3Q2TC 3RB3A 4OV6A 3T1HF 4FVCA 2JH3A 2XY5A 2H5JB 4FXDA 1ZAWA 4D3HA 1XK8A 5DDOC 3O1LA 5HAOA 1Q82T 4LFCF 1PSDA 2MPUA 2ADBA 1NK0A 2RUGA 2BQRA 1PJ7A 1VS3A 3V6JA 4CQ1A 2AYBA 5E3QA 2A2CA 1BD6A 1OWXA 2XMKA 2DNYA 4PXBA 2XULA 2BABA 1U1MA 4DUYJ 3DRSB 3CPWR 4DL2A 1OY8A 2BKNA 1RXOB 3MMJA 1GXLA 5H9EK 4LF6J 1D0EA 1YBTA 3V81B 2HVEA 4P10A 3HT0A 1LWFB 2XMJA 2GC8A 1B70B 4IFYA 2J8AA 1GXTA 5J2QA 2EBGA 1ROFA 3DRXA 2LP4A 4B3SF 1JLBA 4GKJJ 4NLGA 2CNNB 4NMXA 2YKNA 4ES2A 3TA0A 2I1RA 1KVIA 1JLAA 4DR7F 3BV8A 1WHXA 2Z58B 1NDCA 4LBIA 3M32A 2R7VA 3POTA 4QWAA 2W2MP 4EBDA 2VASA 1DJ0A 4OZLA 2XMVA 3OL7A 4HKQA 3IGVA 2HWIA 2C42A 4C8LA 4LF8J 4YB7A 3WC0A 2PGCA 3KHGA 2ERRA 2WVBA 1PJ6A 1FRHA 2XBPA 3VQSA 2B5JA 3IRWP 1VQ9S 4BS2A 3FQLA 4WU3A 4PQUA 3KFWX 3LAMA 3ENAA 1F9EB 4CH1A 3GE9A 3KDOA 2A3JA 1SVDA 1FJEB 3JQMA 1D9AA 2FJVA 2RKIA 5DLFA 3SV4A 2AT1B 3MMBB 4HTJA 4V1Ak 1OQ6A 4HACB 3NBPA 4LSZB 1IKVB 5DDRC 4ZPBA 5HI7A 1RT7A 2AJ0A 4ZPTR 3J80U 3AAWB 2CQCA 2ZUGA 3J7A1 1HPZB 4QZVB 2PMHA 1Z4UA 3LGHA 1RKIA 4PWWA 3NGKA 3EPGA 2YWKA 4KV8A 4CM2A 3JSYA 2R7WA 3EVMA 4PQAA 1JLGA 4DUZJ 2KG1A 3UN5A 1NU4A 2FIUA 2KT5A 3KMQA 1R27B 4DG1A 1CSJA 3HHNB 2GW8A 2XSJA 3C6TB 4DX8H 4M5GA 4IH7A 3QBCA 3G86A 3CULA 4DZ6A 3C8YA 2C2RA 4FVMA 5BR8J 1FK9A 2OPPA 3PZPA 4Y2CA 2W25A 1S7HA 3NGTA 2C28A 1JJ2R 5AXNA 2CJQA 2IVYA 4K4WA 3ILJA 4UF4A 4LF7F 2MJUA 1HI0P 3PVXA 1T94A 4KPYA 1M5PC 1N56A 3TEHB 1N5QA 4ZJLA 4CLUA 3PX6A 1NRKA 1NXIA 4DFJA 1WI6A 1NKBA 2FZKB 2FUG9 3NNAA 2DXDA 2KU7A 1RT3B 2VFVA 3CD0A 5CYMA 4NCGA 5C2GA 3AJDA 1LW2B 3M2UA 1UVNA 1R7IA 1UWBA 4CI0B 1U0HB 1EP4B 1WOOA 1RTHB 2YNHA 4YP3A 1EETA 3VGSA 2MQLA 2XB2D 2KTQA 3ENVA 3KKFA 2YQ1A 3M2VB 1VQMS 3SEOA 1NK8A 2KM8C 2HWTA 4HYKA 4PWUA 4O4RA 2OIHA 2ALYB 2EFNA 2Z4PA 2X1GA 5KFBA 3K5PA 4A8WA 3CJTA 4NXMJ 1WC1A 4G1PA 1IM4A 1F3VA 4OYWA 1APSA 3D1OA 1HNIA 4L3KA 5K14A 2NREA 3RR8A 1OQ3A 2Q1LA 4RW4A 4C0OC 1SJ4P 2AF6A 2C2MB 2WRMA 1R0CB 2E9ZA 5T7LB 4C48A 3OXGA 2OP5A 1S0VA 1SJFA 5ADZA 3US5A 3HMJG 4WKRA 3THVA 2IJNA 3PYEA 2PMZD 1MMNA 1H74A 2F4FA 5HMYA 2GNKA 4CO0A 4UY85 2KJWA 4ZP6A 3GSIA 2YH0A 2VD3A 4DFPA 1E6YA 3UFCX 5C42B 4DR5J 2LQ9A 4FS1A 5D0GA 1HBUB 3IWNC 3H4BA 1QE1B 5I42B 2QA1A 4DV6F 4URSA 4O44B 4QU6A 1YDLA 2RU9A 2VA3A 2JWNA 4USKA 3GIMA 3GYGA 1PILA 2HS3A 4GC6A 3R5BA 4OV1A 1DLOB 2AEFA 4OYBA 2JNJA 2RQ4A 2OSRA 2VU5A 4AE5A 1H7XA 3OFGA 1F5CA 4I1TA 5D3GA 4Q0BA 3MTKA 1W7WA 4J9LA 3E51A 4P74A 2FLOA 3RJMB 3RBDA 1R0AA 1XJWB 2DGVA 1YJ7A 2JEGA 1J2VA 4Y34A 4YB5A 4ANCA 1UA0A 2HAIA 2B9YA 4DV3J 2CPJA 1HFEL 2EBEA 5G0RA 1N5TA 2RRAA 4A48A 3QLHA 1NEEA 1GK8A 4JI1J 3HJFA 3L4BC 4OZ5A 3EM1A 4RWXA 2LVWA 5T41A 4DV2F 2JHEA 5B0DA 4IG3A 3K57A 2GAHC 3UVJA 4KBIA 1KOHA 4XPCA 1Q8LA 1S6PA 4ZKAA 5KFPA 5B0CA 4FYYB 2KVIA 2DRDA 1RT2A 1UA1A 5K5MA 1M5OC 3DKDA 2KN4A 4WIIA 4KFBA 1KOOA 2XLKA 1HQUB 3GG0A 3HFZB 4YUDA 4CLSA 1S77D 3TAPA 5F3TA 5LSOA 3PACA 3THPA 2ZJQQ 1T03A 4LR8A 1F5BA 4KYZA 3FBCA 2CJXB 2E5LJ 5G4DA 3MPUB 2XEXA 1E6VB 3GYXB 2CDRB 1LWCA 3MFIA 4F25A 1SI9A 2IJFA 3IN5A 3W3SA 3C15A 1C0UB 1JNZB 2SXLA 2FHOB 3L3CA 3EVWA 1LW0A 3G4SS 1A0OB 4N76A 4PEOA 3KWMA 3FMBA 2XTJP 1K1QA 2G0CA 4DQSA 3CJ0A 3QO9A 4P75A 3D66A 2AEJA 5BYRA 3GG1A 2J5AA 1YVFA 3MCSA 1TAQA 5IWAF 2Z2YB 3DCAA 4H54A 4JI3J 4GRSA 2VFRA 2VHGA 5CZXA 3M30A 3M6VA 2FJXA 5HBMA 2QA2A 4YQWA 4M5MA 1FJGJ 1OYEA 1Q78A 2KG0A 1F1BB 4A8XA 3G9CA 3LPEA 3IC1A 2NLWA 1S1UB 3OJUA 2MGZB 4C6AA 2DR9A 4GVBA 1WOPA 2PMWA 4B9TA 4C3LA 3UD5A 2VDIA 4LFAJ 3CDWA 1RADB 2DO4A 1RHJB 4JI7F 5F8JA 1AFIA 2JEJA 1ZZNA 1EAYC 4V19X 1X4EA 2QMXA 1WEYA 4NLDA 4N47A 3FCVA 3JQJA 3NKYA 5GADI 3AA8A 2YX4A 1S1TB 3P4UB 5EX3A 3CCRS 1JB0C 1XBWA 3ZFVA 2HVIA 2XG8A 1N54B 4DOZA 2P9CA 3K89A 4I64A 3UDEA 1VQOS 3HXMA 2BXJA 5LMUJ 2CQ0A 1ZA2B 3NL0A 2J6TA 1U1KA 1YK9A 4CWBA 3DOMB 2UV8A 3VAKA 1AT1B 1FJ7A 4NLTA 2W2OP 4RBVA 4C0HA 4IR1A 1DQ8A 3RAQA 4Y2AA 1HNZF 2A18A 4F2RA 4NLWA 2XZDB 3JYTB 5L1KA 3DU6A 3LW5C 3LUYA 2B9EA 1JWWA 3Q22A 4I69A 3R1LA 1I6JA 1X9SA 2ZVSA 2YQ3A 1VQPS 3TOQA 1RWMB 4Q44A 2GJIA 2DIVA 1DTQA 2JOQA 1CVJA 4DR4J 4JI4J 3KJQB 3FMWA 4PG7A 5HMWA 1P1LA 3FSXA 3T1AA 1QLNA 2KT2A 1VRUA 3TRGA 5CYQA 4DV1J 1VLOA 2IVMA 3UNYA 3OL8A 1FDDA 5KT4A 3NNHA 2F4VJ 2M8HA 1L3KA 1OJ4A 1KTQA 4EBEA 4ECRA 4I2QB 4DX6A 3J80Y 3N79A 1S76D 3Q0AA 1XC9A 5KFWA 2BANB 1V9OA 5KTQA 1SJ1A 3OVBA 5BYSA 4ED0A 3C2PA 2PC6A 1BQNA 2DNGA 5SZTA 3AB2B 3UNGC 3D0IE 2RF2B 2YX7A 2W9CA 3JAMU 4DMZA 2XYPB 2K1RA 3PKYA 1YHQS 4LFCJ 3IRXB 4UOGA 1UPPA 5KFAA 4ZHRA 2OPRB 2GGPA 4FPIA 1G4CA 5B09A 2CAJA 2BE7D 4X4SA 2KHDA 3KUHA 1N5SA 2LQ8A 1RWVB 1DTTB 4CLFA 1T11A 2NCKL 2FLNA 4AQYJ 1BXNA 3RR7A 3MXHP 4TYBA 4DCPB 4DU7A 3NAIA 4YOEA 5DQGA 1BQMB 2DGQA 1U8SA 2WVDA 4R8UB 1SV5B 4WP9A 5HQ8A 2IMOA 4U8VA 2FZCB 4DV4F 2ROPA 4B3SJ 4RWWA 1F2HA 2WK4A 1RWNB 5KG6A 3W1YC 4F36A 5E7OB 5IOLA 3F0NA 3S1TA 5M2PA 3FSIA 3UQSA 1S0MA 3GIRA 4M95A 2MYFA 3SQGB 2W7AA 2PI5A 1GTEA 1VK3A 3UI3A 3ZTOA 2J9DE 1VQ7S 4OHXA 4PWDB 3HHLC 2L9DA 3QSIA 5H9FK 2DNPA 2LECA 1M5SA 3LP0B 3DDNA 1QUVA 2B4UA 1K8AT 3DYAA 2FDNA 3MPWA 5B0GA 1UEVA 4ED1A 3J7YU 4DEZA 3MCNA 3S6EA 5A2QU 1RB0A 1Q1KA 4DN0A 1HWKA 1URRA 1REVA 3FRYA 4Q5VA 3NAHA 5E0OA 2Z56B 1YBAA 2C3MA 3WC2A 1QVGR 3D3CJ 4UUXA 4LF1A 3ZTRA 3O6QA 4B3TJ 2F8HA 4QPXA 2DPIA 2HNDA 3PIPQ 1UL3A 4H4MA 1SUQB 4WTYA 1M0SA 2MHEA 1RWOB 1WF1A 4M5JA 2H9ZA 5A8KB 4RW6A 3LO3A 5A8RA 4CCHA 1GMWD 4ZPAA 4W90B 2V8DA 1NK7A 1ZM4A 3O8WA 3TZXA 4ILMA 4LRFA 1UVKA 1GMVA 3W5YA 1N4LA 2VFTA 2XO6A 1KQFB 4WFNQ 3RBXA 1RT5B 3B4MA 4ELTA 2BJ3A 1U2FA 4YB1P 4OLOA 4OHZA 3DOLA 2PE8A 1ZAXA 2GMJA 4NXNF 5F0UA 5CABA 1T02A 1JLCB 3M8PB 5DG7A 1K9MT 3DGVA 4F50A 3D1HA 1CJKA 1RAGB 2KHCA 4YN3B 2IVFB 3OTOF 1N34F 4KRWA 3HDSA 4YHHF 2B3TB 3H90A 1XR6A 3QJLA 3BKFA 4DLGA 2CFXA 3U1MA 1VK8A 3CDUA 2FPHX 4RUBA 1ZPWX 2MJNA 4EO8A 2M5YA 3UD4P 1U26A 2HBRB 1FE4A 2KYXA 5T14A 2I0XA 2A2DA 2ZDOA 1N6QA 3T3FA 1DQAA 4RO0A 2DY1A 4DR2F 1AYEA 1NDLA 5A0YA 3FGVA 2GVDA 2YNGB 4K8RA 4LF9J 2NS1B 5HK4A 3R27A 4J91A 1D1UA 1S0OA 2YKMB 4F8RA 3H8YA 3UW1A 1MMLA 5E3AA 3TO8A 2XY6A 1N32F 2MZSA 2E66A 3HHLA 2BEFA 5AXMA 2LDIA 2CYYA 1C1BA 3NXZA 1CJUA 3J7Z5 5F3ZA 4IDKA 2BACA 2RE1A 1Y9OA 1ACMB 2QJ3A 4NRUA 1I51B 5HVGA 4JI5F 3HZEA 5H1SV 3OHAA 3MI7X 3MWBA 8RUCA 1U1PA 3ZZRA 1R31A 1FXRA 2EKYA 4FBTA 3MMAB 2GZOA 4ECSA 3PJXA 4QR2A 2LQJA 1SBRA 1UFKA 2KRBA 4C8YA 4MK9A 1OY6A 1BQXA 2QC3A 1Z1ZA 3DDIA 3BQ1A 2UVWA 4F2SA 2E9TA 2CA9A 3NOGA 1UVMA 1WF0A 1S72S 1HBNA 3PDNA 4B3OB 1LW2A 5L8RC 3SZ2A 1B0PA 3I5BA 2W9BB 2UUAJ 5D0EA 2V2ZA 5KFQA 3WDOA 3UCZP 2V50A 5F8GA 3RRKA 3LGMA 1RTHA 2WAQD 1UKUA 2C1EB 3Q86A 1WELA 3LP2B 3U7JA 4TU8A 3D7SB 1TR0A 4FF4A 3KG4A 3L7UA 1MWZA 4CLLA 2N4DA 3N01A 1Y7PA 3OR2B 1FWPA 5IC4B 4OYMA 1X9WA 3EVOA 2CNKB 3BBFA 4TU9A 4U7CA 5JMNA 4YDXA 1U09A 2WB1D 2P2CB 2PSZA 2R7XA 3PY8A 1YJRA 4ID5B 3ZTSA 1IKWB 4C8OA 1UVIA 1KQKA 1JK9B 2XC9A 4CP5A 2AGOA 3L7PA 1G3OA 4M5HA 3JSMB 2CNOB 3J7AN 2ASYA 1IBKF 1IBLJ 4C9DA 2VODA 3T5KA 1RAFB 2QTWA 2DNZA 2HHWA 4FYWB 3NOCA 4J9NA 2QSFA 2HNZB 4LRCA 4P2SA 2HHPA 3PX0A 1Q8BA 1T3NA 2K3KA 3BO4A 2R2SA 1T9UA 1CBKA 4Q8EA 1VYAA 4H4OA 1JJCB 2OEMA 5IV4A 4DV2J 2UU9F 3V4MA 1UJ6A 4QWEA 1JXLA 1H98A 1NH7A 2FHJA 5H9EJ 3FEZA 2DKOB 3DLLQ 2B9XA 3JS9A 1EQ0A 5IM0A 1VQ5S 3E01A 2ROGA 3V6DB 4ITSA 4UZCA 2QEXS 1NPPA 4K4ZA 2IRUA 3TAMA 3M8QB 1RHRB 4CTAB 1B3TA 1IBCB 1RQ0A 5LXYA 1C0TA 4LF4J 2LA4A 5D0HA 4UTGA 1N36J 2J9CA 2VG5A 1KTVA 3MM7B 3N4WA 5D15A 4ETXA 1Y3KA 3HHEA 1KLMA 2N4CA 4J9UE 2HLTA 4ZIWA 4DL6A 4OYXA 1P8GA 3SDEB 2JLGA 4P73A 5CXTA 4NL5A 2OELA 4DL7A 3DRRA 2DR6A 4KJIA 3ISND 1TVRB 4ZPWR 2NSCA 3AD7C 3IR5B 3QT6A 2MDAA 3C46A 2UUCF 4J9RA 2ZZTA 4TNOA 2K2PA 3A3OB 4N41A 3PFEA 4IOBA 3I0RB 3CJRA 3JAMY 3G6YA 4NI2B 3MECB 1H7WA 3TR5A 1ZS6A 4DR1F 3TZWA 4IO9Q 1ZM2A 1Y5IB 2BJEA 2ACMA 3ET6B 2WONA 1CJVB 1S0NA 2PA8D 3FEYB 3EJMA 3U1NA 3HPOA 3X1LB 4M5LA 4J9PA 1RT1B 2POKA 4DJBA 1FDAA 1GEHA 5A6WA 4LVOP 4FYXB 2HZAA 4GC7A 5I3UA 4B9MA 4ZVHA 1RU1A 3GFZA 2BBEA 2C3YA 3VGVA 4C8NA 4EZ9A 3G6XA 2B6AA 5EWFA 3BQ2A 2AYEA 3FKBA 3CJ8A 4M5DA 4USMA 3TEGA 4C11A 2R8KA 4ZVGA 1RLDA 1CJTB 3BM7A 1EX8A 5KG7A 4QIWD 4B08A 3DLGA 2EK1A 5GAGU 4ECUA 1KFDA 1U2CA 2KKHA 1T95A 1C4AA 4PAAA 5FJ4A 2KFNA 2F7VA 1RT6B 1EB0A 1HD1A 2FGOA 2EC0A 5KG2A 4I7FA 4ID8A 1HHTP 2IJRA 2OJ3A 1HNXJ 2NUUG 3B78A 1D3WA 1XTZA 3D54A 1B99A 4K0KF 2CPEA 5ETOA 1HNZJ 4OMFG 4MFBA 1HNWF 5HJYA 1YQHA 4V19J 1RBLA 3H2UB 4USTA 5J1EA 4G1IA 2VV5A 3BGRA 4OX6A 5A2QY 1JLEB 1N0VC 2RHSB 3HHLD 2DHHA 2CADA 4UQTA 4ZP9A 4J37A 3I56S 4Z7YA 3QNWB 4LR7A 2HPUA 3MM5A 1LWEB 1J5OA 3CWJA 5KFKA 4YY3J 2XHWA 2ZBRA 2L08A 1F5AA 4Q2MA 1FRIA 4AD6A 4NLVA 2BV3A 4L74A 2BRKA 3QWPA 4JP8A 4IRDA 2RU3A 4DR3F 2JFKA 3DMJB 1LXNA 3BREA 2X3GA 4DSIA 4J9VA 3SCIE 2G2ZA 5HLFA 1D8YA 3IAM9 2FLPA 4MK7A 7FDRA 4NZ6A 4F0MA 5J2NA 1S9GB 4CLWA 2RNEA 2YWGA 3M8WA 3PRVA 3R2DJ 3NS6A 2C3PA 2O3DA 3DRPA 2GO8A 2ZWOA 2EWHA 1UFLA 1R6VA 2CPDA 1DQ9A 3G8QA 3RTVA 4BC9A 4OIXA 2OPSB 2E7WA 4HHJA 3TZZA 3CC4S 2YNIA 5U47A 1PAEX 3CJ2A 2W7PA 2OI2A 2CJ9A 3AXKA 5KT6A 2H54B 2EI5A 3ULHA 1RWPB 1FJCA 4UZBA 1J27A 2Z2MA 3SCJE 4UQGA 1RAAB 2DR5A 4MYTA 3EGNA 2HS0A 4RUCA 4RW7A 1MW7A 4L72B 5KG0A 2C2KB 3BKUA 4DUYF 2BANA 1QAIA 3G6VA 4RU9A 4KPCA 1BHNA 4S0MA 4E2FB 1TKXB 3C16B 1NK4A 2K06A 4FN5A 2HFVA 3C6UA 3VALA 1CLFA 2DH9A 4QWCA 5HATA 3MCOA 1QM9A 4ZVOB 3QRQA 2KYZA 1B4SA 1TV6A 2AYMA 1Q8KA 4GVLA 2RDJA 4O4GB 2VONA 4LR9A 3BYRA 4I67A 3M8SA 4AUKA 4GKJF 4MH8A 2WVCA 1V5VA 3ZZ0A 3F56A 1N0UA 4ZA1A 3H40A 3Q24A 4F26A 2NPFA 2FHJD 1NZAA 4ALZA 1ZOTA 5HSPA 2CXEA 4U8YA 4IFVA 2BE2A 2Y1LB 3MM8B 4DX5A 2KVQE 3QFHA 5DRKA 4CYUB 2N7YA 1JJHA 1WC5A 5BYQA 4BDPA 2YXLA 1TKZB 2J0WA 2Q6BA 2AX0A 1U47A 2DGXA 3K5LA 3GMGA 1U0SA 2BX6A 5K8NA 3OSPA 5KFTA 2BYCA 2HK2A 4KO0A 2KFYA 3P6YC 3EGZA 1S12A 5L1JA 3G82A 2VKZG 1FERA 3W2VB 4PUOA 2BA9A 2G0JA 5ETSA 4CO3A 1U1NA 4OZNA 2XLJA 5DDPC 1KFSA 1D09B 3QATA 2J6SA 2EK6A 3H2LA 1RHMB 4QYZK 2ZHBA 3ZNJ1 1VDHA 2LMIA 4KT0C 1T05A 2IC3A 4UOCA 3D6MB 4RKUC 1K47A 5KG3A 3DLEA 3RB4A 3AH6A 3QWUA 5C2CA 2GIRA 2MZQA 3IWLA 1U7LA 3AQPA 1F6TA 4OZ3A 1T9VA 4DUZF 1IXKA 4ICLA 4HHUA 4KE5A 1IR1A 1YZ6A 3KLGA 3AODA 2XMWA 2CQ1A 4CRJA 1N34J 1QY7A 1ZAVA 1U1LA 3ZZPA 3TA1A 5BR8F 1Y00A 1HI8A 3MAHA 1WSVA 3ZC4A 3NEKA 3TUJC 3VWSA 2CPYA 4WE1A 3A8JA 4EEYA 3OR1B 1VQ6S 3KK3B 3MR3A 2M0GB 4RPFA 3Q8SB 4WZQA 2HQ3A 3RRGA 3KJVB 4DSFA 1RABB 1PAUB 1O0PA 2VQEJ 4ECXA 3P3DA 2QLFB 1WF2A 3M1VB 1VOMA 1N33F 4EK2A 3HVTB 4B9LA 4BHQA 3TUZC 4NLXA 1X4HA 4ENOA 1S6OA 4USUA 2C2NA 2QG9B 2D9PA 2Z57B 3M2RB 2V8GA 4DZDA 3R97A 4DSLA 2QIFA 2D41A 2MHNA 4K4UA 2Y0BB 4A8QA 4WWSA 2ZH9A 3CD5A 3BB5A 4I6WA 1HQEA 1EZZB 1XMQJ 2V8PA 4JI5J 2LYVA 4O23A 2RQKA 3CMES 2V67A 3ETOA 3FSYA 2U2FA 4EFAC 4B9SA 3QRRA 3TZYA 2DK2A 1X7VA 4H4KA 3PKMA 4TY8A 2AGQA 3PCOB 2OPQA 2H3EB 3PXGa 2QL5B 5DZ7A 2BVZA 1S9EA 3TVYA 4HLBA 3IO1A 3PHTA 4KKOA 1H38A 2ZM6F 3IG1A 4EYHB 2FHMA 3OTEA 3HM9A 3JSBA 2R7UA 4EWTA 4DL5A 4TLRA 4AL7A 3G2XA 2YNFB 2KT3A 3MR2A 4DV5F 1Q8IA 2OTJS 2DHXA 3I32A 1SQFA 1WDDA 1FWLA 4KC5A 4OQJA 4OI6A 1MU2A 2IAJB 3D6TB 2DRAA 3J81Y 1RWWB 4WU2A 4ED7A 5KFFA 3PO5A 4WPAA 2HQIA 3GPAA 3V4IB 6AT1B 1FKPB 3MMAA 4DR5F 3FZBA 4I56A 3FCWA 1SH2A 1NO8A 3QIPB 5F0WA 1S1XA 4YDDB 4LSLB 1OO0B 3O5TB 4BC7A 2OD4A 3HCXA 4MAKA 2M2BA 1MSWD 3HVAA 3KTQA 5AXLA 3E3XA 3TARA 3FFIB 1VCTA 2FTRA 1TKTB 4RNMA 5CQGA 1TQLA 3OXFA 4X84A 4R5PA 2X1FA 1KVJA 1CS4B 4HI2A 3HSZA 1RDRA 1NJYA 2F3JA 3VV2B 4OHVA 2IM1A 1YJNS 3DLJA 1F9FA 4KHRA 2HQDA 1OSDA 2ZNYA 1VISA 2B4PA 1G2EA 3CUNA 5EWEA 4MKYA 4AT1B 3OBIA 1AZSB 3A8IA 2IFXA 1YJVA 3PEJA 4F7VA 2VG7A 1KHVA 3BQ0A 1TUWA 3TX0A 4F4XA 3BR8A 3ICLA 4JI1F 4DV7F 1ZTWA 4QBUA 2QGFB 4NLPA 2PN6A 1DY3A 1KQGB 3D6FB 2UXBF 1HBOB 4OLPA 1OYDA 4B9VA 3DOKA 2E5IA 2W2PP 4NEZA 2RMLA 2G1HA 4EYIB 1YWXA 3MEDB 2J7WA 4KHMA 4JI6F 2CUYA 5FIIA 5DG9A 1S57A 1XNRF 3MUVP 3QSYB 3CIZA 1IN0A 1RHKB 1TL4A 2LU1A 2V5HG 4ZVSB 1NSKL 1U2RA 1RYRA 2Q79A 5B0EA 2KXFA 3KLEB 1J5EJ 5HP1B 2BQUA 5H9FJ 4LBHA 4OYIA 2OTLS 5EX0A 3VTIA 2L41A 1HWIA 3HF5A 3MPVA 3KLFB 2KI2A 2HRTA 2O01C 2PEBA 2CQHA 3ZZYA 4NE9C 3D1QA 3W9HA 1HMVA 5D8HB 3KK1A 3EGWB 1RAOA 3UN3A 2ZJPQ 3R7SB 1S1VA 1C1CB 2YWWA 1R3NA 3N28A 2V4JB 2MZJA 3CCUS 2HG4A 4FF3A 1IKYA 3NGUA 1IJEB 4OYAA 3CDBA 3AOCA 3AB4B 4OZ2A 1KNZA 1RA6A 4JI0J 1IQTA 4MJKA 1VIOA 3SYZA 3DGPB 2W8KA 2WBMA 5IQ6A 1R6YA 2ZH3A 3OTCA 3IP0A 1S1WA 4PG8A 1SH0A 2AD9A 3C14B 3ISZA 3G71S 3GR1A 4MIAA 4LRDA 2E1CA 1R8HA 5LT5A 5E2QA 4L6V3 3KLIA 1U6FA 1UCNA 4LFAF 2HGMA 3EUNA 3QPIA 2NXUA 4CNYA 3MM9B 4OYZA 5C24A 5GAHU 2F9JA 2JC0A 2AV5A 2HRYA 4ILLA 3R5GA 1MWYA 3GQCA 3HFKA 1U02A 1IKXB 4PXCA 5KT7A 5F8IA 2P8IA 2IBKA 2BZ2A 5DLGA 1FKAF 1HR0J 4CIOA 3BJYA 3R7BB 4PPZA 1P9QC 3BGUA 4ECZA 3PG9A 3I0SA 1U4BA 2XS2A 1X4GA 4PG5A 3KK2A 5HANA 3OVSA 5J2MB 3MHYA 3K58A 1NPKA 3OJSA 1FD8A 5LMUF 4K0KJ 1IR0A 2EFPA 2G9OA 3X3UA 3QAEA 1EKRA 1JIHA 1RUSA 4CLTA 2WW8A 4OX7A 1ITPA 1VQYA 5KFLA 5L9XA 2QV6A 4QR0A 1M1HA 1N8RT 2VG6B 4LJMA 5A76A 2QLXA 5K9FA 4QJVA 1IWAA 1URNA 2WVEA 2D69A 3TVKA 4NCBA 4AFFA 2R7TA 3D0HE 3M4XA 3EE3A 5C25B 4O0IA 2AJ4A 3AXMA 2HQGA 2D3O1 5JVHQ 2NYHA 5E3PA 2HQCA 4AL5A 2AW0A 4G1QA 2OUGA 3HP6A 3AY0A 4DR4F 1VRTB 3UDCA 2WB4A 2I5JA 3TJ8A 2K7KA 2YX1A 4XK8C 1NHVA 1VR6A 4ZPDA 3OUYA 2X51A 4ZLNA 4DV1F 1DRZA 4ED6A 1WHYA 2FGCA 4WJBA 3BBCA 3VGUA 1CQMA 2DPJA 4CLPA 4ZN1A 3VGTA 5KFDA 5K20B 2FQQB 1HBMA 1IQZA 4GO5X 3MUMP 1BE4A 1RE1B 2CQGA 2HFOA 3MEEA 5BXIA 3CCTA 3KDNA 2DITA 3DU5A 1HQ2A 2PEHA 3QZ7A 2FYXA 4ELVA 2DT9A 4ECTA 2DEJA 4EO6A 4I2PA 4LSNA 3CCMS 1NK5A 2QZ8A 2VJUA 2H4YB 3LP1A 4IYQA 1S6QB 2CPFA 4MMOA 4O3NA 4DN9A 3M9MB 3A3NB 3PYFA 3O3LA 3KHLA 4F4YA 1IR2A 2ASLA 4DS4A 3N6NA 2P6SA 4U7UK 3UE2A 3FNNA 2VPXB 3N5BA 5IXUA 3WBZA 1RHUB 1X5TA 2LDYA 1TMJA 2ZE2B 2HNYB 3DLKA 2QSWA 3ILIA 2V9KA 2ZH8A 5E5NA 3W2WB 3D6HB 2HMIB 2GHWA 4AQYF 5DO2A 2YQ0A 3TYTA 3GB0A 2R8GA 4Q7AA 3HZGA 2XMTA 1B7FA 3HVWA 5C5JA 4F02A 4NCAA 3EZUA 2QLBB 5KFXA 3PW7A 2GX8A 2Q6CA 3NWRA 3D68A 2EW9A 2RHQB 3BGOP 2AKWB 1JQGA 5KFOA 3U27A 3GYNA 4NRTA 4PR6A 3R5AA 3PRDA 5KFGA 4C2MA 1CEZA 2CVIA 5HROA 2J9EA 3IS9A 3AA9A 2N7CA 3NGSA 3PJ9A 2OH2A 1F0XA 5THWA 4L76A 4TVAB 2KRRA 3C16A 1UZDA 4FPRA 3CC7S 3EDRB 2MLZA 1M5KC 4IFYB 5J2QB 2CJAA 3WIUA 5J2PA 4PCQA 1JLBB 3HULA 2IM2A 5GAHI 2AZ3A 4U7UD 2YKNB 5MAOA 4HI1A 4OI0A 2IRYA 3GV7B 1FEHA 1B7YB 2YH1A 1JLAB 2NXNA 1FTCA 4EZ6A 4LF5J 2OHDA 4A8KA 4B3TF 2DCUB 4I68A 2Y1RI 3IAS9 3M32B 4CH7A 3POTB 4KHPJ 1FF2A 1NM2A 4FF2A 1TL7A 2B8QA 4LMZA 4NYZA 1K0TA 3C19A 4AL6A 3RU0A 2NZ4A 2J0XA 1S9FA 2DGUA 3RAMA 2J6UA 4CYUA 3W63A 1S99A 3WX8A 4C97A 1YTYA 3D3BJ 2B5JB 4MKAA 1JKHA 2ZH1A 4LIRA 1Y5LB 4PQUB 2QX0A 2HFZA 1Z2ZA 1N88A 4X4VA 2CZ9A 2HWHA 2VBWA 2BM1A
chains in the Genus database with same CATH topology
2WAQD 1YITS 1UKUA 2IMWP 1X0FA 4B9NA 3DI6A 1LFPA 1R8AA 2FY1A 5HL7Q 1WELA 3DRPB 2E5LF 1H2VZ 1FDNA 2DNQA 1UVJA 2UP1A 3LP2B 2V9WA 3R5CA 3U7JA 2JLFA 4TU8A 5LSLA 2B56A 2RF2A 3F44A 3PW2A 2RKIB 1TR0A 3OXLA 4FF4A 3KG4A 4ZPVR 3PO4A 1MWZA 4IOAQ 1MROB 1RT4B 2Y1JA 2N4DA 3N01A 1Y7PA 2D74B 3MM9A 3CEDA 1LK5A 2DGWA 1RTIB 1FKOB 4CT9A 2YNIB 5B0FA 3FQKA 3DC2A 3OR2B 2I2YA 2MKSA 3IRXA 1A7GE 3NBPB 3KMSA 1X9WA 1JLQA 3OFEA 4EU0A 3JTPA 5EDWA 1F2GA 1TL5A 2VB6A 1RT7B 4OJHA 4TU9A 3PX4A 2RRBA 2APOA 4QR1A 2XMMA 3I55S 2OPRA 4U7CA 1IKXA 4YDXA 4YB6A 4IH6A 1HNVB 3H4DA 1U09A 2WB1D 4IKAA 3I31A 5FDLB 3M6UA 1U45A 4YR2A 2PSZA 3QYYA 1JXEA 1S49A 2W7OA 4FNHA 2R7XA 4IG0B 3PY8A 1N5YB 2Z8QA 1NJXA 3QGGA 1YJRA 3D5MA 1TL3A 4NOHA 3F73A 1OS5A 4ID5B 3VAJA 2F8EX 1IKWB 2XLIA 2FJDB 4P7TA 5LL6d 3OTBA 2MQQA 4KV8B 2ASDA 1TK0A 4JI3F 2C22A 1QSSA 1R8CA 4C8OA 1UVIA 3TP2A 1RP5A 5D77A 1KQKA 1DTTA 5LJ3Y 1UP1A 1JK9B 3DHXA 2ATLA 4QIGA 1KC8T 4RW7B 2XC9A 3KHHA 5J1PA 5J2MA 3FEXB 2ZFHA 1ZM9A 4MYUA 3NCQA 1JLGB 5KT5A 4ZVEA 3MR5A 2AGOA 3DRYA 3L7PA 5D4PA 4FF1A 1G3OA 1JLFB 2ZITA 3LAKA 4AYBD 5CHCB 1FJGF 2DB1A 2XCAA 3JSMB 5DQHA 3QGIA 4FP9A 2ASYA 1N48A 1IBKF 4C9DA 3DDKA 3DM2A 1RAJA 3TNVA 4DG1B 1BQMA 2GCFA 2ZHAA 3CCQS 3T5KA 4FBUA 2VODA 2JJ4D 4X4RA 2XSJB 4R8UA 1SV5A 2DNZA 2V8HA 3ZZZA 2HHWA 4LF9F 3C6UB 4J5OA 1MNEA 2YWFA 5KFCA 3T5JA 4J9NA 2QSFA 4WXWA 1ZBTA 4NLQA 4KAIA 1TL1B 2HNZB 1NAQA 3BGFA 4H4KC 2HHPA 4P2SA 3PX0A 2VG6A 1FK9B 1Q8BA 2CQIA 2K3KA 2OPPB 3BO4A 1T3NA 1VQNS 1TV6B 2HRUA 3MEGA 1GXUA 2R2SA 3MTJA 3NLCA 3FZ2A 3UR0A 4Q8EA 2V4QA 1A9NB 2AX1A 4H4OA 4HH0A 4ECYA 3QZ8A 2JSXA 2YKAA 3MAQA 2VKRA 2UUBF 4AXIA 1FHTA 4U9RA 2ALZA 1AXQA 4Z2XA 4YR0A 4DS5A 1B0VA 2UU9F 4RW9B 3DXBA 3V4MA 5C25A 5LSRA 1UJ6A 4E8UA 4QWEA 4URGA 2YTCA 2MKCA 1JXLA 1H98A 1XEZA 1NH7A 2FHJA 5H9EJ 3FEZA 1R43A 2P5VA 3DLLQ 3H5XA 2B9XA 3PFOA 1VMBA 5KG1A 3SQGA 1PC4A 1ZTTA 1CC7A 1O8BA 1YRXA 5IM0A 4LF5F 1VQ4S 1VQ5S 3E01A 2ROGA 3V6DB 1ZPVA 5GAGI 4ITSA 2DH8A 4HH1A 2D3UA 3P49B 2QEXS 3KK3A 4K4ZA 5B08A 2IRUA 3OTDA 3OHBA 1S10A 1CQNA 1WHWA 1VRTA 3TAMA 2UVUA 1CPZA 3M8QB 4KHPF 2GQCA 3NCRA 5IT0A 3NMAA 3PW4A 2UUWA 1OPZA 3KJVA 4PWDA 4CTAB 4C3KA 1RQ0A 5LXYA 4Y28C 4XIUA 3B82A 4IFVB 2BE2B 1QSLA 1C0TA 3JB9k 4WK3A 3K0JA 4OX9F 1BGXT 2LU2A 3CD6S 1MMDA 2ZZMA 2LA4A 3LP0A 1SIZA 2M7SA 2DCLA 2MKJA 4I6AA 2OO4A 4RZRA 5DS7A 2RRNA 2J9CA 2VG5A 3PRBA 1KTVA 3MM7B 3N4WA 3N6MA 4ETXA 1Y3KA 3IR6B 2GIQA 3FJ2A 4K5SA 5CYMB 4YR3A 2ROEA 2R7SA 4Q8FA 2B9WA 5EN1A 3HHEA 2B7CB 3CCLS 5M2UA 3CSKA 4K59A 2AU0A 2M70A 4KGMA 1KLMA 4DF4A 2N4CA 2VQFF 3M2UB 2ZBIA 2A10A 2HLTA 1LKZA 2JRSA 3MD3A 3EYZA 1UWBB 2CDQA 2QA4S 2Q66A 2DNOA 4XDCA 2LXIA 1HWJA 1TK8A 4EGLA 2DHSA 2QFJA 2CQ3A 1FEEA 2YNHB 1FRJA 4KO0B 1SJ3P 4DL6A 1S48A 1U1RA 4X64F 1P8GA 1RGVA 1Y3JA 1SQEA 2EFGA 1EETB 3GWCA 3KG1A 1SJQA 3SDEB 2JLGA 2QLWA 3KOAA 5CXTA 1QAXA 3HT3A 2UUAF 4NL5A 2VFUA 1GX5A 2VH7A 4DL7A 3UDLA 3DRRA 1S4FA 4F3OA 4KJIA 4LQ3A 3IA0A 3ISND 1TVRB 4R0JA 1VGYA 3RBEA 1GAOA 4ZPWR 2Y1IA 3KG0A 2NSCA 3IR5B 5EHHA 4WFBQ 2V2KA 2AQ4A 4PUOB 1HYSA 1VBXA 4U67Q 3CF5Q 3BO2A 4FYDA 1NNDA 1K1SA 4A8OA 2MDAA 2O66A 3G6ES 2UUCF 3C46A 5D78A 4J9RA 3D2WA 4TNOA 4D3GA 5HN0A 2VPWB 1NK9A 2KO1A 4MK8A 2K2PA 2VL1A 1X8DA 4N41A 1FVSA 1Y5NB 4J9MA 1K0VA 1SUQA 2ZD1B 2KH9A 3CJ5A 3PM9A 3PFEA 1JX4A 5A8KA 4IOBA 1DZ5A 1S6QA 5KFMA 3I0RB 3RRHA 3IGNA 1Y0HA 4JI4F 2JFDA 4KTQA 2UXDF 4IQMA 2KDOA 2LXUA 3LGNA 3MZIA 2D9OA 4OZ1A 3JAMY 3G6YA 2VC0A 1FA0A 3GFHA 3MECB 1H7WA 1P1TA 2E5HA 4FNIA 3TR5A 1RKJA 1RTJB 4DR1F 4DL3A 2BOPA 4X4NA 4ZLPA 1X5PA 4RBTA 1HNIB 4IO9Q 1SKSA 3R5DA 1ZM2A 2GHVC 5K14B 1FRKA 1Y5IB 2BJEA 1T05B 2IC3B 3UR3C 1UVLA 3IR7B 3R3TA 5A8WA 3OL6A 1PO6A 2WONA 2ZE2A 3P5TL 2HNYA 2LEBA 3Q8RB 3DLEB 4TKTA 2PA8D 2XWYA 4E98A 5B0AA 1S0NA 2F4VF 2CQDA 3FEYB 3NP5A 3H98A 3A8EA 3H59A 4HT5A 1V3RA 2DISA 1F60B 2R8IA 3U1NA 3HPOA 3W2WA 2GQQA 4DQIA 2HMIA 1UJ4A 3X1LB 4WF9Q 1X0PA 4A8YA 1GQEA 1M5HA 1VC6A 1RT5A 5L9NA 3OPKA 4J9PA 1RT1B 1FT8A 1VI7A 2POKA 5A8RB 4DJBA 3QJJA 2VBXA 1FDAA 2FHKA 5A6WA 4C8MA 4LQ9A 4LVOP 2DH7A 2KXHA 4HVZA 4ICLB 4GC7A 5I3UA 4B9MA 3BSOA 4RW8A 4ZVHA 3GFZA 2BBEA 1IBLF 3KLGB 4ZCLA 3Q2TC 2D3ZA 2C3YA 1TZ0A 3RB3A 4C8NA 3I5CA 4EZ9A 3G6XA 5D4LA 2B6AA 5EWFA 3BQ2A 3T1HF 1NK6A 5SUHA 4FVCA 2JH3A 2XY5A 4WZMA 2AYEA 3KNAA 2Y0SD 4M5DA 1JLCA 1ZAWA 3M8PA 4D3HA 4ZCIA 4DR6F 1E6YB 4FXDA 1XK8A 5DDOC 3O1LA 2GMHA 4JV5F 3T6JA 4C11A 2R8KA 3H2VE 4ZVGA 4USJC 2ZH4A 4M1KA 1Q82T 4LFCF 1PSDA 2MPUA 5FD1A 3BM7A 4BCAA 2ADBA 5KG7A 3OFHA 1NK0A 4K50A 1L3SA 4QIWD 2BM0A 4B08A 2L9NA 2RUGA 2BQRA 3DLGA 3I4PA 2NR0A 2EK1A 4WE1B 1VS3A 3V6JA 4CQ1A 5GAGU 2AYBA 4ECUA 1KFDA 2A2CA 2KKHA 1T95A 5E3QA 1BD6A 3GV8B 5E3RA 2C2DA 1K73T 1OWXA 1C4AA 2XMKA 2DNYA 4PXBA 4DBQA 3LQVA 3CO9A 4LT6A 2EFVA 5FJ4A 2KFNA 1KONA 1TUVA 2XULA 1TFWA 2F7VA 2BABA 4K4YA 3BR9A 1RT6B 3JSRA 1N5VA 3S8SA 1HD1A 1U1MA 2FGOA 2EC0A 5KG2A 4I7FA 2RS2A 4ID8A 3DRSB 3ONQA 1HHTP 4ZMMA 3ITHB 2OJ3A 4F67A 5D3GB 2V4RA 4Q0BB 4R25A 4E0DA 2NUUG 3BS9A 3B78A 1UETA 5KT3A 3CPWR 3HK2A 1VIXA 3CDEA 4DL2A 1L3VA 3AQOA 4OZJA 2CQ2A 2G13A 3EPIA 3MMJA 1D3WA 1XTZA 3D54A 1GXLA 2YNGA 4LF4F 1R0AB 2CPEA 4K0KF 1D0EA 1U25A 1RTHA 4WK1A 4OMFG 3V81B 1N36F 2XI3A 4MFBA 1HNWF 1YQHA 1T3OA 1LWFB 2YKMA 3BF4A 2XMJA 2JL9A 3N6LA 4TXSA 4V19J 3QIDA 4B3MF 3BSNA 3KLHA 2GC8A 3CVKA 3H2UB 1VQSA 4ZCKA 2O1PA 4IFYA 2J8AA 5J1EA 1GXTA 3I87A 5J2QA 1ELOA 4G1IA 2EBGA 2VV5A 3BGRA 1ROFA 1VQ8S 4ERDA 1HQEB 4J9QA 3DRXA 4OX6A 5A2QY 1WWHA 3OSNA 1JLEB 1JLBA 4B3SF 1N0VC 4KSEB 2B43A 5G0RB 2RQCA 2R4FA 3HHLD 5D4OA 3TI0A 5IT4A 4NLGA 3QGPA 4UQTA 4ZP9A 4J37A 3I56S 3QLHB 2YKNA 4ES2A 4RBUA 3VZIA 2HPUA 3TA0A 2I1RA 3MM5A 1LWEB 1KVIA 1JLAA 4DR7F 1FDBA 2ZZNA 1J5OA 1WHXA 3CWJA 1D9FA 4IG3B 4CH0S 5JVGQ 1RISA 2ZC3A 4NYPA 5KFKA 2JX2A 2CPHA 3SSRA 3M32A 2R7VA 3POTA 2CQPA 3BDEA 2ZOFA 4TY8B 4C7QA 4QWAA 2OPQB 4EBDA 1S6PB 2VASA 4K4VA 2ZH7A 5LMNF 1DJ0A 1WG1A 4OZLA 2XMVA 2XHWA 1L3UA 2L08A 3CCES 1F5AA 4Q2MA 3LALA 3OL7A 2XNRA 4HKQA 1FRIA 1RT2B 2HLUA 3NS5A 2OAUA 3IGVA 2XGPA 5AE1A 2HWIA 4NLVA 1S9EB 2BV3A 2C42A 2Z2LA 4DR5F 2BRKA 3QWPA 5KAKA 4IRDA 4KFBB 2W9AA 1YJTA 2RU3A 4DR3F 3G8TA 4C8LA 2JFKA 3MUTP 4YB7A 1NJIT 2MZRA 3DMJB 2BR0A 4YEAA 3E2EA 3WC0A 1LXNA 4NA2A 3C3LA 4KKOB 2PGCA 3KHGA 2ERRA 2RDIA 3BREA 2KM8B 2X3GA 1HHSA 3IG1B 4DSIA 2WOMB 2LQ5A 3SCIE 2V0NA 5HLFA 2LCWA 1FRHA 2J7KA 3CJ3A 2XBPA 1D8YA 3IAM9 3MM6A 2RS8A 3VQSA 2B5JA 2FLPA 3IRWP 1VQ9S 4MK7A 4BS2A 3FQLA 7FDRA 4WU3A 4NZ6A 1T03B 3NCPA 4A8MP 4PQUA 4B3OA 2MKIA 3H5SA 2W9BA 5J2NA 1S9GB 1LWCB 4I4BA 3KFWX 3LAMA 2RNEA 4HDHA 2COLA 1DBDA 2VUGA 2YWGA 4CH1A 3GE9A 4JI2F 2UVVA 3NS6A 2C3PA 2O3DA 2CG4A 4ELUA 2A3JA 1FJEB 4B3RF 4JOUA 3DRPA 4QYZJ 1P6TA 2GO8A 3Q2SC 2EWHA 2X1BA 1XNQF 3LP2A 1MU2B 1D9AA 1UFLA 4ZP8A 2M9KA 2FJVA 2CKWA 4UW2A 2CPDA 1DQ9A 2DNNA 2RKIA 5DLFA 1SKRA 1X4FA 3G8QA 3KLVA 3RTVA 4BC9A 3SV4A 4OIXA 5KFEA 2OPSB 2E7WA 1MROA 1RT4A 4HHJA 2WCXA 5KFJA 3MMBB 4HTJA 5E3CA 3CC4S 1OQ6A 3IBWA 1RTIA 2PD1A 3QO9B 1FKOA 4FS2A 1XMOF 2YNIA 5U47A 2R7QA 3OR2A 3CJ2A 1VC0A 3NBPA 1UJ5A 5DM6Q 2U1AA 4PPDA 2IA6A 3DFEA 4J9OA 1IKVB 5DDRC 2CRLA 4ZPBA 5HI7A 2W7PA 1RT7A 3DNCA 1SC6A