1FE0A

Crystal structure of cadmium-hah1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
66
structure length
66
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for copper transfer by the metallochaperone for the Menkes/Wilson disease proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords COPPER TRANSPORT PROTEIN ATOX1
total genus 19
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fe0A00
2GGPB 2OAUA 2OP5A 2VV5A 2L3MA 2FTRA 1S6UA 5T7LB 5B0DA 1FE4A 3LGMA 1SQEA 1N5TA 2GA7A 4OJHA 1Y3KA 1K0VA 4HI1A 2ASYA 2W4PA 1IUJA 4Q2MA 4A46A 1JWWA 2K7JA 2K1RA 1AW0A 3FGVA 4OJ3A 4Y2IA 2AW0A 3IWXA 2ROPA 4FNHA 2LXFA 1KVIA 2ACYA 1N5QA 2W4DA 1LQ9A 1MWZA 2KYZA 3IWLA 4A48A 4DL0C 2RILA 4A4JA 1N5SA 1AFIA 5B09A 4HH0A 1P6TA 1Y9OA 1YJRA 3KNGA 1P8GA 1CC7A 2RU9A 3K7RA 3GZ7A 2ROEA 4HH1A 1YJTA 1MWYA 2RSQA 1JK9B 1GXUA 2HFOA 3HHLC 1YG0A 1WD6A 2BJDA 3KKFA 2K7KA 2KKHA 1KQKA 4DPOA 3CJKA 3DCAA 2PGCA 2XMUA 3HHLA 1Q8BA 5F0UA 3F44A 1R6YA 2XMJA 2OMOA 3BDEA 1SB6A 4YDXA 2LQBA 1OPZA 1AFJA 3HF5A 2K2PA 1Y0HA 2FB0A 2QLXA 5B08A 1FVSA 1QUPA 1OQ6A 2HLTA 3KG0A 1TL4A 2PD1A 3BB5A 1TR0A 1APSA 1CPZA 2IYIA 1FVQA 4U9RA 2GGPA 2AP6A 2N4DA 3LO3A 4QOTA 5F0WA 4ZA1A 2OFHX 1YRXA 3I9ZA 2BBEA 4OJGA 3QGPA 1URRA 1X0PA 4YEAA 1ULRA 4Y2MA 4F67A 2HIQA 2ZDPA 2ZDOA 2CRLA 3VTIA 1U7LA 2GFFA 5KAKA 1GXTA 2JDJA 5A6PA 3HDSA 2K1RB 2XMMA 3FMBA 3HX9A 4Y2KA 2XMKA 5K9FA 5T7LA 5B0EA 2HFNA 2EW9A 2N7YA 4OJ1A 4DN9A 1YJUA 2FIUA 2GV1A 3E8OA 3TRGA 3BM7A 4OIXA 5B0CA 2KT3A 4Q2LA 2IYGA 3WDOA 1N5VA 3BGUA 3CJKB 3FRYA 5B0BA 3BR8A 1SI9A 2QIFA 4HI2A 1X8DA 1VQYA 3QMQA 3KG1A 2RMLA 1RJJA 2GCFA 2ROGA 4HL9A 1TUVA 2LDIA 2XMWA 2BYCA 2QLWA 2W4CA 3TOQA 4EFAC 1FESA 1Q8LA 2HLUA 1FE0A 1Q4RA 3TNVA 5IXUA 4FNIA 4ZOSA 3UDCA 3MCSA 1Q53A 1YJVA 2FHMA 5A6WA 3T9NA 3HFKA 1XBWA 2N4CA 1OSDA 3DXSX 4NPOA 1VQSA 2IFXA 2BUNA 2KT2A 3MZIA 2OFGX 2Q3PA 3BF4A 4NL5A 2AJ1A 1W2IA 1X7VA 2VH7A 5B0GA 2G9OA 2BJEA 2LQ9A 4A47A 5B0AA 2AJ0A 2XMVA 2OKQA 1V3ZA 1OQ3A 1Y3JA 2QYCA 3BN7A 3HHLD 1CC8A 1FEEA 1S6OA 1TL5A 1TZ0A 2OD6A 3LGNA 2HQIA 2GO8A 3HHLB 1KVJA 2OD4A 5B0FA 1FD8A 2XMTA
chains in the Genus database with same CATH superfamily
1UW9A 4OZ5A 3ITHA 1FFSB 3QBCA 2VQFJ 5FD1A 3CCLS 1VQ6S 3AOAA 5K14B 1WKJA 4R5PB 4JI0J 4DR7J 5GMKa 3M9OB 4OJHA 4TYAA 2RD5C 2L9NA 1WG5A 1CEZA 2KJWA 2C42A 4UUXA 4M95A 3MMBB 2HHVA 1NSKL 2B4UA 1F9HA 2K1RA 3M30B 4RWWA 2KHCA 1NKBA 4LRCA 2XS5A 2WCXA 2YVSA 1NPKA 3IRWP 2FJAB 1FRMA 1HWLA 2ZHOA 3CJ2A 4RW7A 5KFLA 3MR3A 4DR2F 1JJ4A 2CWXA 4Q43A 1RHQB 1TL7B 4UOHA 4H4OA 1LNQA 4F4AA 2RILA 3T1AA 4A4JA 2JLFA 2XC9A 4DLEA 3PRBA 1U1OA 5AE2A 2Z2MA 5DRKA 1WC4A 3NRBA 1P8GA 4ANCA 1PBUA 2DH9A 4NEZA 1MMDA 3C66A 3R27A 4ZN1A 2PE8A 5ETKA 4ZLLA 3SV3A 1HW8A 1AB8A 5ETNA 2XBPA 1YSJA 1SC6A 2VKRA 1S4FA 2WOMB 2YWKA 3D5MA 4M5DB 1B0VA 5ETMA 4ED6A 2ABYA 4ZVPB 3DCAA 1VQLS 3FK4A 2PGCA 2DRBA 1RA7A 1RTDB 5AE1A 2K3IA 3M05A 4UY8T 5CZXA 3MEKA 3I82A 2NPIA 5GMEA 2HAIA 1EKSA 4PKDB 1G3OA 3MR6A 1K1SA 3MUTP 2AYGA 4E8UA 3PW4A 3O8WA 1R7IA 4LSNA 4UOCA 1YQHA 3KDOA 1T9YA 3W8PA 3ENQA 5RUBA 4MIWA 1FVQA 1JLBB 1RBLA 1X4EA 6FDRA 3ZZZA 1UVMA 1WHYA 3B82A 4LFCJ 1VQPS 2AWZA 2BBEA 1H3DA 1X0PA 1DY3A 3DFEA 1S76D 1N52B 2CQIA 3KMQA 1HL6A 3M8ZA 5F3TA 3GYNA 4EMDA 2ALYB 2KVIA 2V4JB 2JEGA 4X4PA 4USKA 1J5EF 1GEHA 2XMMA 3RR8A 2AX1A 2NR0A 1U2CA 2MKSA 2YTCA 4USIA 5HVHA 3CJ8A 2UXDF 5HANA 1VQMS 2O1PA 2EKNA 4N76A 1PAUB 1TVRA 1FXDA 2GVDB 2GV1A 2XWXA 3E8OA 3A3OB 3LPEA 4U8YA 5JXSA 2BE7D 1UVJA 4H4KC 1GFWB 5KT4A 5G4DA 3ISZA 4G6VB 2VUGA 4DPTA 2W7PA 1N5VA 3KWMA 4RW8B 3I6PA 3EZ5A 1Y4ZB 3AOBA 1HI8A 3D0HE 2UZAA 4WK3A 2DR6A 2QIFA 2R3VA 3UWTA 4XDDA 3THVA 3OFEA 1X8DA 1VQYA 4PWUA 2GIQA 3ISNC 2RDJA 4EU0A 4R0EA 2AZ3A 2ROGA 3GFYA 4DL5A 2DRDA 2VBYA 4RR5A 4WE1B 2X1AA 4JI1F 4NCAA 1N33F 1KQSR 4TYBA 1HD0A 3TQEA 2OEJA 4IH7A 3FNNA 3LPYA 2HWTA 2WZ1A 4PRFA 3LAKA 5KFAA 3ET6A 2ZOFA 3NCRA 1M1GA 2I5JA 2DNKA 3ADAC 3I0RA 4X65J 3BSNA 3OUYB 2RHQB 2J8AA 3JSRA 4CLUA 4B9NA 5DDPC 2YWHA 4QIVA 1SH0A 4MYUA 1T3NA 2VG5A 2YQ3A 3CDEA 4LMZA 2CQ2A 2EFOA 4CO2A 4H54A 3RAQA 3PACA 4OZNA 4TLQA 4EYIB 1D8ZA 1YITS 1IBLF 1GAOA 3CGIA 3D1OA 2G9OA 5J2MA 2R7VA 1KLMA 1JLCB 1JJHA 2OPRB 4A47A 1LOUA 3OVSA 4GO7X 1F3FA 2NXEA 1ITPA 1S1VA 4M63A 4LF8J 3R9LA 3A8KA 4ECRA 2UU9J 2F65A 1TKXB 3CIZA 4KT0C 2MKJA 1WC1A 1TFYA 2EEYA 5IFMA 1Z4UA 5FLXY 3KK1B 1YZ7A 2UV8A 3VR1A 2FJVA 1U1QA 4ZP6A 1U4BA 4ZVUB 3KFWX 4KFBB 2R2UA 2EFVA 3LGMA 1N54B 3ZZ0A 5L46A 4Y3CA 2BANB 2MKIA 3MM8B 4HHHA 1WSVA 2UVVA 3IC1A 1AW0A 4L76A 4DS4A 3C14B 4IG0A 4EZ9A 3B4MA 4YS2A 4TXSA 1QAYA 5J2QA 3FEYB 5LSRA 4M5DA 3MF5A 4JI3J 2LA4A 1RT4A 1N5SA 4B9SA 5H9EJ 1WF0A 1Q8IA 1CS4A 2VG7A 1HNWJ 3V6DB 2FZGB 2XY6A 4OV6A 3TVYA 3DRSB 1Y5NB 3G8SA 1RQ0A 3ICLA 2DH7A 2DGXA 3DRSA 3BGOP 2BMBA 1VK3A 2XHCA 1IBKJ 3KLGB 4AQYF 1CLFA 1EAYC 4OHVA 2N82B 1CJTB 2ZH7A 1XMOF 1YG0A 1SJ3P 2O3DA 1J2VA 1PG5B 1YK9A 2DNHA 1UFKA 2ZD1B 3IGVA 3KJFB 3M2VA 4ID8A 4DEZA 3OV7A 2IJFA 4P9SA 5BYQA 2AJ2A 1T95A 1REVB 1VJQA 2XMJA 2OMOA 4ETZA 3KK2A 2V4QA 3K5NA 1M90T 5D3GA 4EBCA 2WK4A 1T9UA 2W2MP 2A2DA 3G87A 3DRXA 2DGTA 5ETTA 3TW0A 2XI3A 2F9JA 3MFHA 1EQMA 4I2QA 2W8LA 1CPZA 1RHJB 4JI6F 3R5AA 1PJ7A 4LFAJ 2AP6A 3OL8A 1N5YA 3JTNA 3VHQA 5IS2A 2RS2A 1ZAWA 1RT4B 2MKCA 3K0JA 4KBIA 2PMZD 2B7CB 4ZHRA 5I3QA 4DUTA 4DZDA 3TZXA 2POKA 5DJBA 1VOMA 2MMYA 2EKYA 3CJ4A 3KLGA 3OVAA 4QIEA 1N0UA 1MU2A 3D28A 3UR0A 2ZBPA 2K8GA 4F2SA 1NUEA 5CQGA 2YKAA 2HHPA 5HP1A 2HHTA 1B4SA 2VOOA 1FJGF 3UDEA 3NGUA 2XZDB 4DR5F 1DQ9A 1FX2A 3MECA 2GHVC 5KT7A 2X1FA 2HKEA 3KLIA 4Z7YA 2BR0A 2B56A 2P6TA 1RLCL 9RUBA 1NSQA 5B0BA 4NZ7A 1Q5VA 3IR6B 2QV6A 1TL3B 3V6HA 1KTVA 2BQRA 2U1AA 5C42B 5LMNJ 4ZPWR 3VGSA 5L1JA 1GTEA 2KXFA 4JV2A 1TUVA 2QG9B 1S7HA 1U6FA 2K3KA 1IKVA 3C6UB 4OI6A 4UQTA 2CJXB 4CO0A 3G6XA 2DB1A 1OIAA 1JKHB 3C16B 1Y00A 2UV8G 4OYBA 1Z1ZA 4EO8A 5CAAA 3CB4A 2W9CB 2FJXA 4JYAF 1VRUA 4MKYA 4CIOA 3UDCA 3I0SB 3CC4S 1YJVA 2H48B 5C25A 2LQJA 3BH6B 3OHAA 5E33A 1FHTA 5DLFA 4U8VA 1F0XA 2F1FA 2D3OR 2G0JA 4JI2J 5HVFA 4JV5F 1DARA 1UMJA 1FERA 5HJXA 3CMES 2G4BA 4NL5A 3HLUA 1WC6A 1WKLA 3IG1A 2AJ4A 5JVGQ 3K8VA 2WONA 2XTJP 4L3NA 2HNYA 2YX1A 1NPPA 1UJ5A 3AQOA 3JXOA 5KTQA 2GIFA 3S8SA 1S48A 1NEEA 1WEXA 1PIEA 3F56A 4KFBA 1MMLA 2XMVA 2V68A 4OHXA 3UN5A 3PYFA 5MLCV 1GT8A 4ED4A 1TK0A 3W63A 1B64A 3SI8A 2R2TA 1UAWA 4B3SJ 4ZKAA 4DR3J 5HMYA 2XSFA 3AODA 1AA1B 2Y8YA 3DU5A 5FJ4A 3NLCA 4DV7F 2QSFA 3CJRA 5KFZA 3PR4A 5F8JA 2LXUA 2EK1A 5HVGA 2MDAA 4X64J 1YVFA 4X4OA 3F73A 2IM2A 2DNOA 1N32J 4TKTA 2VA3A 3RB3A 4NXNJ 1XNRJ 4LF9F 2XNRA 2ZM6F 4J9QA 4PUOB 3HSGA 8RUCA 4FNHA 5KFQA 2DT9A 3SBMA 3T5JA 3FBEA 3I0SA 5T41A 3PXGa 1KDNA 3RZAA 4DL0C 1U0HB 4M5KA 1MROB 3D1QA 2Q43A 3IWNC 2C2NA 3VVUA 2OEKA 4DS5A 1PYSB 2MSSA 1OYDA 2NQPA 4YP3A 1UKUA 4USUA 4JV0A 3BKUA 3GFXA 1NDLA 4X2BA 3MAAA 2HVIA 4NRTA 2DNNA 1RT3B 3MOJB 4ENOA 2ZZNA 2W9AA 1WD6A 3T9ZA 2RRAA 1H73A 2HBZB 2ZC3A 1RP5A 1WG4A 4RWXA 1LWCA 4RBTA 1ZAXA 4N8OA 2JLEA 1N36F 3NY0A 1QJHA 2XMUA 1WF2A 3NP5A 4NI2A 4DJBA 1T05A 1X5PA 5D4OA 1R6YA 2F8EX 3CE8A 3IO1A 4C6AA 5KFMA 2DNRA 3QGHA 2QX0A 3BSAA 3LW5C 3R6GB 4Z37A 3NGTA 1EX8A 3IA0A 5B08A 5IM0A 5H9EK 2QLJB 3DGPB 4Y28C 5KFUA 4Q44A 2J8SA 2DTJA 1WNEA 3MMAA 3Q0AA 5GAHU 4C8YA 3N0VA 1HBMA 1HMVB 2VD3A 3AD7C 4PXBA 1JLQB 2HS4A 3R5CA 3MCOA 3QATA 1NKEA 1RWXB 2MZRA 2RF2A 1Q8KA 3H4BA 2ZKTA 3QLHA 2HBRB 2R7SA 3MEEA 3OL7A 3R97A 3KLEB 3SYZA 3T6JA 3OR1B 3BQ2A 3FMBA 3L09A 2L9WA 2NXUA 4IH6A 1UVKA 1RT6B 2EW9A 1UVIA 1XK8A 1HMVA 2GQ2A 4C48A 3NAHA 3GIKA 1FFGB 3Q8PB 4JI5F 3I5CA 4CH1A 1K47A 1WORA 4ZPVR 3M9NB 1H6KX 2AHOB 4QR1A 3U1NA 1ZS6A 4DUYF 1RK8A 1UFWA 1VS3A 3LUYA 4B9TA 1E6YB 3BSOA 3R2DJ 2H54B 1RU1A 2C2MB 2DITA 4WZQA 2BE9B 5KG3A 5I42B 2ZWPA 4KV8B 2FJEB 4L72B 4QWAA 4B3RJ 1QSLA 1HBNA 2Y0SD 3EVWA 3QMQA 4PXCA 3KG1A 3O2IA 4I6AA 1Q0NA 5LT5A 4XPEA 4HL9A 4UZBA 3PKMA 2RE1A 3KHLA 2R7RA 2FUG9 3OL6A 1F60B 1EIYB 3M7VA 3ZZYA 2XYHB 4IO1A 1WACA 2BKNA 1QM9A 1S1TA 1WHWA 5J1EB 1M5PC 2RT3A 2XO7A 3MCSA 4KRWA 4USTA 3PYDA 5KT5A 2VKZG 3CULA 5SUHA 5DG7A 2LECA 2BJ9A 3P49B 2FZKB 2OSRA 2KT2A 3NOGA 1JLEB 3MMBA 3S6EA 3QGGA 3PW2A 2EBGA 2BV3A 3I96A 4FPRA 3HP6A 2W9BA 5E3AA 2VH7A 2R7TA 5F8LA 3D6FB 5EWEA 2MKHA 1XR7A 3RG6A 2MJNA 1IBCB 5HATA 4HHUA 2I2YA 2VF3A 1FDDA 4YHHF 4ECXA 1KSPA 2VBWA 3NXZA 4ZPDA 4DPYA 2F7VA 4USHA 4OYXA 1NJYA 2ZFHA 4YY3F 5BXIA 4RUAA 3ETMA 4YR0A 3WX8A 3MD3A 3HVWA 4WCEQ 4N56A 1RTZA 2V50A 4WU3A 3FZ2A 3M8PA 1KNZA 3NG8A 2G2ZA 2ZNZA 4DPUA 4J5OA 2R2SA 3WC2A 2XGQA 3PO5A 3EYZA 3EUNA 3SMZA 1RAJA 1RAFB 3BBCA 2KU7A 3FMWA 4Q2MA 1UZHA 2O5DA 3OR2A 3DN9A 4DBQA 3HO1A 3MFIA 2BX6A 2E1MC 4RBVA 2WONB 2V9KA 4MT1A 4NEYA 4N47A 4QWCA 1S7IA 2FJDB 1A7GE 4G1IA 1BGXT 2FHOB 3EVOA 4WFBQ 3RUBL 2QMWA 2NYHA 1CSJA 1Y9OA 2V67A 5D77A 3JSMB 4NYZA 4C3KA 3MM7A 4KO0B 4PYDA 2FJWA 3GG0A 4AD6A 1RAOA 4PWDB 3QZ8A 1F1BB 5HI7A 2KI2A 2YKQA 4DSJA 2IM0A 1NK6A 1NHVA 1TUGB 3SQGA 1FRHA 3KLFB 3BBFA 3EICA 2VJUA 1GXLA 5KFYA 3FSYA 2QL9B 1I1GA 2KKHA 2LEPA 4C0BA 2UUWA 3CJKA 1GTHA 3AY0A 4RBUA 3SFUA 2WW8A 4DX6A 5JJBA 2KFYA 2ZH4A 1D9AA 4FBUA 2WAQD 3QAEA 5U47A 3OJUA 4O44A 1UWBB 3ZTPA 2CDQA 3MECB 2J6TA 4ZVQB 1QAXA 2PD1A 1I94F 4GKJJ 2IAJB 4HHJA 3HD1A 1EARA 2RVJA 3IR5B 5ITHA 5KFXA 3VAKA 2HHUA 4ZA1A 4P7TA 3RRHA 1WHVA 3UCGA 4OYIA 1B0TA 2R42A 2NXJA 2CJBA 2HIQA 4KKOB 4M1KA 2ZDPA 2WVBA 4F67A 4F3OA 2XZWA 3SSQA 3MTKA 1K9MT 2O67A 5KG1A 4Y34A 5CD4H 1WC0A 2EG2A 1NJXA 5ETQA 4FF3A 5E41A 4N5SA 2I0XA 2P6SA 1IXKA 3MHYA 3D66A 4ZK7M 2ZBRA 2CZVC 1LXJA 3V4MA 3RB6A 5K8MA 4O3SA 1DZ5A 3TRGA 1PC5A 2ATCB 3P4UB 4LVOP 5DZ7A 4W90B 2DNYA 2E5HA 4J9PA 1RTJB 1SC3B 1JB0C 3FFIB 2BABA 2ZH9A 2HK3A 3BGUA 2QL5B 4HEA9 2WOMA 4TQRA 3IN5A 3K58A 4LF6J 1T9VA 1ELOA 2B9YA 1IM6A 4ZPAA 3THTA 4HI2A 3MAHA 5I3UB 3Q23A 1RT5B 3IBCB 1WELA 3V6DA 4FZVA 2AV5A 1R3NA 1RCOB 2GCFA 3M6VA 1RYSA 1HPZB 1IN0A 1SJRA 4JI4F 3NGRA 1M5KC 2QLWA 2J9DE 2JVOA 5A8WA 1P9QC 3TVZA 1EJ7L 3GV8B 1SJFA 2QLFB 2D9PA 2HLUA 1FE0A 3C14A 2ADBA 4OYPA 2ERRA 1D1UA 4NCBA 4OMFG 4RW4B 2KFZA 4RW7B 5DQIA 2D3O1 3O5TB 4ERDA 3ZNUA 5GAEI 3HFKA 4TY8B 2QFIA 5GAHI 1RT2B 4RLEA 3TUZC 5KG7A 2KM8B 1FKAF 4FF2A 1VI7A 1N88A 1X4CA 2NXNA 4FF1A 2N3LA 2Q3PA 4NA1A 2MGZB 2IM1A 3LALA 4DV3J 1VC0A 1A9NB 1C1BB 3KUGA 2YWEA 1XMQJ 3GONA 4ZVRB 1R6VA 2KN4A 1FDNA 1FT8A 3BGFA 3BH7B 3K17A 3N4WA 3W2VA 3HMJG 3KLVA 4GC6A 2AJ0A 1P27B 3A13A 3HHDA 4Z7CA 2B3TB 2VU5A 1LWXA 8AT1B 1HWJA 3MM6A 3G6YA 1C4CA 3DOKB 3HHLB 1PYOB 1IR1A 3CIMA 1EHWA 3QAUA 1NK8A 3OL9A 2X1BA 4PWWA 2L3MA 2FTRA 1VIOA 3G2XA 2C2RA 2Z2YB 2IAJA 1O0PA 2HGLA 3H2LA 4CTAB 5KFOA 1N5TA 2E5JA 3GIIA 1Y3KA 1SQGA 2I5JB 2HQCA 2VL1A 4YB5A 2PFFB 4OX9J 3C15B 3GJQB 1FTCA 1HIYA 1H2VZ 4CO4A 3DDIA 2HMIA 2R7XA 2HGMA 4P2FA 3LAMA 1FNMA 2PSZA 1RUSA 4ECQA 3PEHA 3HULA 4A48A 2OPPB 3W1YC 3R7SB 2XNQA 2LVWA 5ETSA 2OI2A 1S99A 1P6TA 3DC2A 3ET6B 4A8QA 2QLBB 1BUXA 4ZPBA 4ANDA 2ZITA 3VGTA 2UUCF 3GZ7A 1APSA 4C2MA 1NK4A 2V9WA 4CLKA 1FRLA 3KUHA 4D3HA 4U7CA 2R7WA 2V5HG 3NGDA 4WPAA 1HYSA 3LP0A 4B3MF 3DYAA 3RAMA 2WTFA 5DDOC 1W7WA 3MDFA 1X9MA 2HQFA 1K44A 3LP0B 4C3MA 1Q8BA 4QCLA 1VBZA 3TAMB 4AL6A 3CDWA 3T1YF 3SCKE 2GHWA 3CCSS 4URQU 3V6KA 1YJ7A 5I4MA 2GAGC 1IWGA 4DR6F 3AFGA 3OTOF 5K8OA 4KHPJ 4QOTA 4ELUA 4X66J 1I51B 1OY9A 2DGUA 5MAOA 3BO2A 4HTJA 4IH5A 4RUCA 3H59A 2M8HA 2VZ9A 2GNKA 4YB7A 1YRUA 1RLDA 2C2KB 1U47A 1AROP 4CLYA 1GXTA 2BKPA 4LSNB 3J7AN 2B43A 3D4JA 2CZ4A 3KLHA 3UPFA 1OPIA 3AB2B 2HMIB 4FPIA 1DURA 4X4QA 4DR7F 5LMUJ 3GFZA 4LT6A 4C7QA 5HSPA 1X4DA 5LOQA 4ER8A 4ECTA 3H25A 4DU8A 3NNCA 3ZC4A 3H20A 1YJUA 3LTOA 5D6GA 2DPJA 1KD1T 3L7UA 2YPZA 4RNOA 1TMJA 1JLEA 3PJWA 1DTTA 2DXDA 1SC1B 5FIIA 1XR5A 3IM8A 2ZHBA 3CCVS 4GKKJ 1HI1A 4Q2LA 1WJ9A 2ATLA 4P10A 2VIHA 2CWKA 1G2EA 3DYAB 2D3UA 1QTNB 4XO0A 1U1NA 1K73T 2DHHA 2KDOA 5HBMA 3MEGA 4J9SA 2JEIA 4JB8B 3GV7B 2DEJA 4XAKA 2VBZA 1RJJA 3UD4P 1RKIA 2KH9A 2JLGA 2FC8A 1RB0A 2LDIA 2XMWA 1JKHA 2MB0B 5A0YA 2GAHC 3KLIB 4OX6A 2XCPA 2CQDA 2IBKA 2PI5A 3DLGB 3P3DA 1Q8LA 4CTAA 1QTMA 2DRAA 2FHJD 2X3GA 3K8WA 4PCQA 4PPZA 4ZOSA 2XY5A 1VRTB 4FDFA 1TL3A 1TU0B 5KFKA 5F9LA 2FVRA 3ETOA 5KFDA 3X1LB 1OSDA 1VQ4S 2IFXA 3MZIA 2OFGX 3EXCX 3P5TL 4WJBA 1IKXB 4ZVEA 4URGA 3FRZA 2DNQA 3GIRA 1SH2A 2QE5A 7FDRA 3UN2A 3NS7B 2ZBQA 3I9V9 5LXYA 4Q8EA 4FYWB 2UUAJ 4P2MA 5HO4A 1RTHA 2IRYA 3PEJA 4U95A 2OD6A 3A12A 3QLHB 4GVBA 5C2GA 2W8KA 2CG4A 2VFTA 4C9DA 3ISND 4ALZA 1NAQA 4DF8A 4F3MA 2M52A 2XMTA 4LRFA 2OAUA 2XYPB 5LL6d 3MR5A 4K4VA 4C4WA 4RZRA 2B9EA 1GMWD 1MU2B 1S0NA 1WOSA 4NLXA 5LJ5Y 2AMCB 4DQSA 3CCRS 2DGQA 1SKSA 1I6JA 4NZ6A 2F9DA 3P6YC 2XS7A 2MPUA 2UVUA 2K7JA 2AKWB 5IZHA 1BMQB 5M2RA 2IMWP 1NH8A 2AW0A 4HT5A 3GPAA 5F41A 1N6QB 4MYTA 1N5YB 4RPFA 3ZFVA 1MWZA 3PYEA 1HNXJ 1HHTP 1QLNA 3PFEA 1Q16B 2WSFC 1SQFA 1BD6A 2WVEA 3DM2A 2I6WA 4PQUA 4HH0A 5EHHA 3QRQA 1CBKA 1E6VA 4PAAA 2AEMA 2B5JA 4P75A 3OSPA 4LFBF 4USWA 1OJ4A 2KVQE 3QT5A 5E3RA 4AL7A 4IG3B 2R8JA 2LQ8A 3FVYA 3T6BA 2BRLA 1PGZA 5THWA 4WWSA 2BQUA 3WX4A 1MROA 1S10A 5ETVA 1O8BA 3HM9A 1IM4A 2HQGA 3PM9A 3OHBA 4QWEA 4M5HA 3DRRB 4X65F 1ZAVA 2DY1A 2EBEA 1F2GA 1R31A 1GK8A 4DV0F 4C8KA 2BRKA 1BLUA 3MR2A 3OJSA 2V8PA 1Y0HA 1GMVA 3SQOP 5A0YB 1SL0A 3VZIA 4WTOB 2SXLA 2Z57B 2QA1A 3SSRA 3QSIA 2W2PP 3US5A 4I6YA 1YRXA 1S1VB 2MQNA 2ZH2A 2AT1B 3UDVA 4RUHA 3J80Y 2XZTB 4IG0B 1KEKA 3DLEB 4F4YA 3J7A1 1RHRB 2CRLA 3PJXA 4LIWA 2IVFB 5BJRA 2BANA 3KJQB 3H5UA 4KSEB 4OFZA 4QIFA 2J9EA 4DFKA 3L9ZA 3ZZOA 1OWXA 2I8EA 1PCAA 2C2DA 2C2EA 4Y00A 2HURA 5KT3A 3Q8SB 1VC6A 2YX7A 1OS5A 2V2ZA 1MSWD 4J9KA 5EN1A 1RA6A 2KO1A 1SVDA 3MM7B 4KO0A 2ZJQQ 1UW4A 3GR1A 1FA0A 3CDAA 1NDPA 4RX6A 3QJPA 4U7UD 1JXEA 1RADB 2P2CB 3NGKA 4LF1A 4N7TA 1U25A 3L4BC 4NX9A 2XEXA 4HDHA 3D67A 2Q79A 1G1XA 1SI9A 3T19A 3W9HA 3CCES 3DLBA 4FP9A 2DIVA 3ENWA 4K0KF 1YIJS 4JI8F 1LFPA 2LEAA 1RTIA 2BOPA 2OTLS 2HHSA 2D69A 2VG6B 5DG9A 1AUSL 5C42A 1B99A 2EI5A 4P71A 1HBOA 3HZEA 1FRKA 4NE9C 1IBKF 4AE5A 2QA4G 3G96A 5KFEA 3M2RA 4MTPA 4F4WA 3T3FA 3M8PB 5IXUA 1FK9A 2EC2A 3CJSA 4B9VA 3GYXB 1CULA 5F8NA 1ZZFA 3OLBA 4QYZJ 4X4VA 2RKIB 1FKOA 1H0HB 4ILMA 2B5JB 3O6QA 1QSSA 5E3CA 3CJTA 2FLOA 5B0GA 2UUBJ 3QO9B 1RAIB 3UFCX 2B4OA 4LREA 4PQUB 4X4RA 4QJVA 2QN6B 3GJTB 4JI6J 1TVRB 2GVDA 4F0KA 2VFVA 3BV8A 1LFWA 2QZ8A 3FDSA 2EG1A 1JIHA 5I42A 1TFWA 1OY6A 5M2UA 1CC8A 4DQIA 4PG5A 5HROA 4NYPA 5A76A 5DDRC 5IC6B 1EETA 1NSAA 3HXMA 4LF4J 3KK3B 1FD8A 4GRSA 1C1CA 3THPA 5D4LA 5D4NA 5B0DA 1FE4A 3AOCA 2DH8A 4LBHA 2MJUA 3GCWP 4QBUA 4ECZA 3HSDA 1F6TA 5GMDA 2QYGA 4A46A 1XIQA 3N6MA 3ZNJ1 1FJGJ 1G4CA 2BZ2A 2NS1B 2H4YB 2AF6A 1HBNB 5F8GA 3EE3A 2YPYA 1IKWB 2XCAA 4IFVB 4QW9A 1KVIA 5KFJA 3N28A 3FC9A 2IHR1 3MEEB 2BEFA 1VHFA 2IVYA 3Q8UA 3PRVA 1BQMA 1N5QA 1LQ9A 1ZM2A 2R8KA 3Q22A 2FJBB 1VISA 3CT9A 5CYQA 1S1TB 5F8IA 1JLAA 4NLQA 4RW6B 2R8IA 1KBRA 2CQ4A 3P45B 3CD7A 1YJRA 1Z2LA 4IO9Q 4I6WA 4UF4A 3W2WA 4DV4F 5CHCB 4X4NA 2A18A 4QPTA 3GB0A 4L3KA 1CJUB 4RW9A 3RRKA 5AT1B 3KMSA 3RAXA 4DMZA 5H9FK 3KHGA 5IWAJ 4DQQA 3Q8VA 2HFOA 3KKFA 1RAAB 4CNYA 2ALZA 3RBDA 4W4MA 3NKYA 3W8GA 1KONA 3QGIA 2DR8A 4E2FB 4DUZJ 1LWFA 1QE1A 3NNAA 4BCAA 5K8NA 1WOPA 2KT5A 2F4VF 3KXDA 2RF2B 2YNIB 4DXLA 4CO1A 5BR8F 2HYIB 2K2PA 2RRBA 5KOWA 4IR1A 1UA0A 2HLTA 4DX8H 4EUVA 2EFQA 3KHHA 4H4OB 2QT7A 2IYIA 2RQ4A 4LF5F 1C1CB 2OEMA 2CQCA 2VFRA 3CVKA 5ETOA 4ZLJA 3CW2C 2N7CA 1BC6A 1FX4A 1O6XA 2VB6A 3TJAA 2CAJA 3Q86A 4ANEA 4Y2MA 4F4ZA 5ADZA 1U6ZA 3QIPA 3M30A 4PG4A 5HROB 4ED1A 3HHNB 3T5HA 2DK2A 3VAGA 1U7LA 2B4VA 1DHMA 2V6AA 2HRTA 3C6TB 3ZO7A 4DV7J 1WHXA 1IBMJ 4B02A 2D41A 3FCVA 1NM2A 1XWLA 3NS5A 4FXVA 4OZ1A 4Y2KA 5K9FA 1KLMB 2E1CA 2QO3A 1HNIB 1XERA 2Q6CA 3JB9k 1U02A 1HARA 2ZH6A 3V81A 5HLFA 3QJJA 2W25A 1NHUA 5CYQB 2C22A 2QEXS 3HT3A 2VG5B 3PX6A 2ZHAA 2BA9A 3M8QB 4DL7A 1NH7A 2FPHX 2ZUAA 5HMXA 4OYAA 4DR4J 1H98A 1KR4A 3FRYA 4NXMF 1BWEA 4I7FA 1RT3A 1FNXH 4RL1A 1QY7A 1FRIA 2WVDA 3PZPA 3BGRA 1HA1A 1U0SA 2AIRB 1WG1A 2KJVA 5DM7Q 3AJDA 2LEBA 5KFTA 4PG8A 1FKOB 1X31C 2KZZA 1HQUB 3L95X 3NEKA 4CLSA 3D9BA 3JYTB 3UDLA 1FD2A 1RAHB 4TQSA 3K5PA 4C8OA 1RXOB 1YJ9S 2CIMA 2HWHA 5D4PA 4DF4A 1TTHB 3FJ2A 5A8RA 3DGVA 2F4FA 4X4SA 2HIYA 2ZE2A 1JXVA 4JI7J 3MAQA 3R7BB 4HT7A 5JMNA 1UJ4A 2LU1A 1RE1B 1Q86T 5L1KA 3OTDA 4M94A 2Z4PA 4O0IA 2UXCF 1KN6A 1SBRA 3HI9A 1VMBA 1RWPB 3SQGB 4WK1A 2FY8A 4LQ3A 3TAPA 1CQMA 3MWBA 2RRNA 1S1UA 2HFUA 4EK2A 1T9TA 2ZOGA 2EVZA 2OPPA 3RRGA 2GZOA 3KJVB 2DVIA 2IIHA 5L1IA 2CJ9A 1P1TA 4PYAA 3SSSA 3IGNA 1SKRA 1HR0F 1NKCA 4DHVA 1BY9A 5FDLB 1IR2A 5C24B 3QPIA 2GO8A 1KVJA 4MFBA 1NLKL 1H2TZ 5B0FA 1AFIA 1WOOA 2J0XA 1XTZA 3AQPA 2E29A 4O4GB 4ECUA 1RWMB 1U24A 3GSIA 3DLLQ 1NO8A 4NZ0A 3IAS9 3RR7A 4C97A 1ZTWA 3RJMB 5ETRA 1K0VA 2W4PA 1IUJA 2W2NP 1RSCA 4HTIA 3DOKA 4IOBA 4DV6F 4Q7AA 3OXGA 1IR0A 2GVZB 2IDEA 4P2SA 4IRKA 3UR3C 2LXFA 4MJKA 2GIRA 3BREA 3I31A 5C25B 1M1KT 1R0BG 2E7XA 2Y9HA 1S0VA 2VPXB 4R8UB 3CCTA 3EXYA 4O3RA 2DR5A 1U1PA 1S1XB 2FYXA 3POTA 5KFVA 4JBCA 3IXQA 3GIJA 1X60A 4I1TA 4AUKA 3H40A 3DHXA 2HNZB 2RU9A 3OXFA 1URNA 1UWAA 4QR0A 4YB6A 3TJ8A 2CPFA 3SZ2A 2IC3A 2FDNA 1MWYA 4EO6A 2JWNA 4IQXA 1Z2ZA 3Q8RB 4PEOA 2K7KA 3D68A 4X62F 3WIUA 3OTCA 4IFYA 2C3PA 5L1LA 1RHKB 3AA9A 5DDQC 2PI4A 2C3UA 2YNFB 1RHMB 2Y0BB 4GMKA 4DV1F 2ASDA 1FXLA 2FY1A 1SB6A 5J2NB 3H42A 2XM3A 2DXEA 1SL1A 3JTOA 3HF5A 4CT8A 4DR1F 4OZ3A 3RB0A 2CPHA 2QLXA 4WYWA 3GV5B 4IOAQ 1RAEB 1TL4A 3BB5A 9ATCB 3HT0A 2RH3A 4LF2A 2E7WA 3VV2B 2XG8A 2DHGA 2P9EA 3RBZA 4ED8A 1CS4B 1RWKB 2IRUA 2OFHX 4OJGA 4QQBA 5E5NA 1T8EA 1URRA 4USMA 2V34A 3HFZB 3M1VB 4F26A 2HK2A 4F3QA 2I38A 5EX3A 2ZWOA 3VGUA 4YY3J 2JDJA 4TU8A 2KXNB 3G82A 2VQFF 2XMKA 4WFZA 4JI0F 5CD4A 2HFNA 2N7YA 1IWAA 4OJ1A 3G6ES 3CMQA 1FRXA 1RT5A 2OLWA 5H1SV 5KT6A 3HHEA 4UY85 4G65A 2CDRB 3BM7A 3KDNA 5GAGU 4A8XA 1RTHB 2FLPA 4F4KA 1HFEL 3I87A 5CABA 2IYGA 1KS2A 4XDCA 2B0GA 2CQHA 2AYMA 2YY3A 4ZVOB 2XS2A 4ZHRB 3Q8QB 1K1QA 4OL8A 3MM5A 4KJIA 5AXLA 1AZSB 3DOLB 2M88A 2YWGA 3UVJB 5DM6Q 4O44B 5HMZA 2RMLA 1U8SA 2CJAA 5BYRA 1EZZB 1SKUB 2RQCA 2E5LJ 4ZJQA 3PIOQ 1N8RT 4IDKB 4PQAA 2X1GA 3TJ9A 3BYPA 1CJKB 1HNZF 3MPVA 5KFSA 2VOPA 3TNVA 1BQNA 3PDNA 4C8NA 3EGNA 5KG0A 2NUHA 3EJMA 4KKOA 3H8YA 4NRUA 2M0GB 5J2QB 2VJVA 1YJNS 1S1XA 3D6TB 4JOUA 1X9SA 1XBWA 3GILA 3OTEA 1BHNA 5BYSA 1OMSA 5KFCA 5KOXA 4DV2F 2V2KA 3BF4A 4NLSA 1HHSA 1X7VA 2WW4A 2WVFA 4K2JA 4LIRA 4QZVB 2VC1A 5F8HA 2CNLB 1H2UX 3BYRA 1VQ8S 3MGJA 4B9LA 4KY3A 2LQ9A 2Y1JA 2GJFA 1SCJB 3PG9A 4K4TA 4GO5X 2Y3YA 1QVFR 4LFCF 3I5AA 4I0WA 2ZJRQ 2O66A 1YX2A 3O3LA 1U26A 3V2UC 1ZTTA 5KFRA 1TKDA 1D3WA 2MKYA 1DTTB 3T41A 4ELVA 1VQNS 2R8GA 3V4IB 4WIIA 2ZZTA 4BDPA 3KLFA 1B7FA 4LSZB 1S97A 1LW2A 2VV5A 1Q78A 2Y1IA 4F50A 4A8SA 1SQEA 4CH7A 5C2CA 2XI2A 3M32B 2HZVA 1RWOB 4F2RA 5HBMB 5DQHA 3OTBA 2RKIA 2BE2A 5GVQA 4MMOA 4ZPCA 2LQ5A 4N41A 3E2EA 3NL0A 3MD1A 3NMRA 3D1HA 4OJ3A 1NHKL 1NDCA 2ROPA 2J7WA 3IWXA 1XNQJ 2FVPA 4LF6F 1F3VA 3R5BA 4KGKA 4ZN3A 2VONA 2VQEF 2MQPA 2KYZA 1WTFA 3K2YA 2ZH3A 2QMUB 4HKQA 1GH8A 2MEWA 3G4SS 1NK5A 3BGRB 2DNLA 3ILLA 2CVEA 1IJFB 2VQEJ 1C0UA 1X5TA 3TAMA 2ROEA 2WBMA 4WKYA 3AA8A 2HBYB 2AEFA 3KLHB 1KLNA 5KFFA 3G86A 3Q2SC 1B3TA 8ATCB 2R9LA 1T9XA 1KFSA 4ZP8A 1HYSB 2BJDA 3HCXA 3A8JA 4R0JA 2JRSA 3P8BB 2LKZA 4F4XA 4DSEA 2F63A 3SCJE 4L74A 3V81B 5HLFB 2DO0A 2ZBIA 3OVBA 3UD3P 2DJWA 3B4DA 1X5OA 3BDEA 2IY5B 1U1MA 1VQ5S 1S1WA 3CEDA 1LW2B 2HFSA 2RS8A 3L7OA 4C11B 2CQBA 3GSDA 4CLTA 3J80U 2QFJA 1TAUA 4P74A 3R5GA 4ZCIA 4N77A 3J81U 2Y8WA 3G6VA 2DEIA 1QSYA 1RHUB 3TUPA 1TMMA 4P73A 4ZCMA 2AJFE 4ZCKA 2DO4A 2YKMA 3AH6A 5HQ8A 5M2PA 1M5OC 2R7UA 2UU9F 1KP6A 3K89A 3N6NA 1RAGB 1R0CB 3W5XA 4DV5J 5CYJA 4NLWA 5KAKA 4Q0BB 2K1RB 2D74B 3NBPA 3W2VB 1NB2A 2J9CA 2PC6A 2PEBA 4TNOA 2AGPA 4OZLA 2NREA 2QMXA 4Q5VA 2MGZA 4K59A 3T5LA 2QC3A 4LR8A 4KGZB 1S6QA 2NYIA 1Y5LB 2K06A 3ILJA 4GVLA 2HRYA 5K8PA 1FCAA 4UTGA 3R1LA 3I5BA 3UN3A 1W26A 2W1BA 1QAJA 2Y1LB 1BQMB 2WHOA 4JI3F 1PAEX 1DLOB 4M5NA 3CPWR 1QE1B 2PA3A 4R25A 3SIPB 2HFVA 2CPZA 3TA0A 4C0HA 4ECVA 2GS8A 3J7Z5 1RWNB 1RT1B 1X4GA 2BW7A 3MM9A 3BN4A 2MXYA 2BYCA 2UUCJ 3KTQA 2GX8A 4NLGA 4DQRA 4J9RA 2O01C 2XGPA 3NOCA 4MKVA 5D3GB 2Z2ZA 2J0SD 2HNDA 1I3OB 2CJQA 4FNIA 3UD5A 2EK6A 4LRAA 3JQKA 5IV3A 3R1HA 1UVLA 5J1PA 1JLQA 3BKTA 2KG1A 3IFEA 2MSTA 5GAEU 3OT9A 1O5JA 2RUSA 4G3IA 2J7UA 2GHPA 4Y65A 1JLGB 1SV5A 1IKWA 2LFVA 1NB7A 3Q2TC 1C1BA 2KB2A 2WB4A 5E0OA 3WBZA 2BJEA 5B0AA 2ZC4A 1KHWA 4X66F 3NBPB 3QT7A 4DG1B 2CUYA 2DNPA 5K20B 4J9LA 4RUBA 1T03B 1RTJA 1LWCB 3J7YI 2FVSA 3LGNA 3HVTA 2A6OA 5GAGI 2X7IA 4GKKF 2PMWA 2HZCA 3U1LA 2OP5A 3PTWA 1IKYA 2HAFA 2E9ZA 3BPDA 4HACA 1X5SA 4RO0A 1N34F 1ZM4A 3K59A 1S1WB 4MK7A 5D15A 4WYLA 1HLWA 2C2ZB 4QIGA 4ZVFA 3KK1A 4CRJA 1DTQA 4Y2IA 3PO4A 2DGOA 2V2VA 3PIPQ 3VAIA 3PY8A 2DGVA 3B78A 2CPXA 1N0VC 2HQ3A 4NLYA 3D54A 5CYMB 4NWBA 1WI6A 1WTBA 3U1MA 1U8WA 1HD1A 5LXRA 4M5LA 3KUEA 4JI1J 1N33J 1K8AT 4DX5A 1AYEA 4HH1A 4KPYA 1NMEB 1YKWA 4CYUA 4FXDA 2OH2A 1WC3A 3IBFB 6FD1A 3IAM9 2QA2A 1U49A 4KB7A 4O23A 1VRUB 3F0NA 1RTIB 4DPOA 1KQKA 2J0WA 3PHTA 4LF7J 3CDBA 4EZ6A 4JI2F 3DNCA 2GQCA 1IKVB 3C6UA 3VQTA 3OR2B 2YQ1A 2ZEJA 6AT1B 5HL7Q 2RNEA 2QJ3A 4RU9A 4WFNQ 3FSIA 1IBLJ 2HQDA 5HAOA 5J1NA 4W98A 4BWJA 3PX0A 1LEOA 4DLGA 2E1PA 2Z2LA 3CCQS 5KFBA 1NK0A 1F5AA 2DXFA 1BQXA 4WXWA 2GMLA 4H4MB 1QVGR 1TELA 2YKOA 2B8QA 4LF8F 2R8HA 1RWWB 1ULRA 2YKPA 3W64A 2J5AA 4ZDNA 4B3SF 1BWVA 2DHAA 2P5VA 4A8OA 3ULHA 5CCMA 1X4AA 2LA6A 4DWIA 3HDSA 2VPYB 4UQGA 1UP1A 4ZCLA 3GCXP 5D0GA 1DQ8A 2M4MA 4H4MA 4ES2A 4X64F 3FEXB 2CYYA 3OLAA 3KHRA 1DFDA 1F2HA 3CO0P 3R6LB 2J7KA 2FIUA 3MEDA 4LF9J 2BW2A 4OIXA 3DI6A 3M2UB 4PG7A 1JQGA 2C3YA 3CTRA 3LQVA 2H5IB 3PX4A 1RBAA 2NSCA 1IQTA 4J37A 4PPDA 3MOZA 4CM0A 1PILA 3H5YA 1L3UA 1GMWA 4RW8A 2B51A 3EZOA 4WP3A 1HNXF 4DZ6A 5KG2A 1U1RA 5HP1B 4DFMA 4U7UK 1HQEB 3KYLA 2AX0A 3OQ2A 2AYBA 2DCUB 3BJYA 4LFAF 3JYTA 4LFBJ 3LF0A 1S0MA 1G7CB 3RBEA 2DD8S 2VFUA 3G82B 2FVQA 1V5IB 3TUJC 1FESA 3DLKB 3H90A 2ZD1A 2ZOMA 2MY7A 3Q89A 1LXNA 4F36A 3DDKA 3DM2B 1N36J 1TQLA 3EGVA 5AE3A 3RB4A 2HSEB 2D7SA 2BJ7A 4L75A 5DGBA 1A0OB 3C15A 3CD6S 2DR7A 2HS0A 3NGSA 2AGQA 1N6QA 3WIVA 2BQ3A 4XTTA 2L9DA 3I32A 1JLGA 1SV5B 1WKKA 2JC0A 2IDLA 2NSBA 4TLRA 3WHIA 3TX8A 4AT1B 4K4YA 1YTYA 1VC5A 4KTQA 3MMCA 2KTQA 4ZIWA 1J27A 3W5ZA 3D0GE 1OQ3A 3TQ1A 1TV6B 1SKWA 3MR7A 1Y3JA 1F5CA 4ED2A 2B6AA 3O1LA 4KIAA 4KYZA 1T94A 2QRRA 4LVNP 3AT1B 4HLBA 1JXLA 2FHKA 2JSXA 2IC3B 1WC5A 3CJ3A 1RT7B 2YWFA 1EP4A 1S6UA 2NPFA 4C3LA 3TWZA 3DDNA 4WU2A 4CDIA 5D0EA 2VG7B 2ASYA 2BACA 4ZLPA 2E5GA 3BO4A 3KOAA 1R8CA 2EPIA 2CA9A 4X4UA 5J2NA 3ZXWA 4YN3B 2MZSA 5L9NA 4DUYJ 4CLFA 4ZJOA 4HR2A 3K5LA 3UCUP 4B3OA 1VYAA 3ZTOA 3M4XA 3MMAB 1IVZA 2OPRA 4WTYA 1RU2A 1S57A 2YKNB 4LQ9A 1AT1B 4E0DA 3CJKB 1UVNA 4DL6A 4B3RF 4YFUA 2G2OA 2E5IA 1JLAB 4RW6A 2DY9A 2MYFA 3KNGA 1HQEA 3QWPA 1RT1A 5K5MA 1HBUB 1FNOA 1Y10A 4W92B 2RSQA 4IRDA 5EDWA 1U45A 1GXUA 1U0HA 1P1LA 5K14A 3ZTQA 1IJEB 4UT4A 2HG4A 4R5PA 3EPIA 3VAJA 1OSCA 3UI3A 1VJWA 4K8RA 3MEGB 1RABB 1HBMB 1MW7A 1R43A 5DETA 3QFHA 5F0UA 5AJ3J 3KJVA 3CCMS 2BE2B 2HRUA 1SJ4P 3R7NB 1L5UA 2OJ3A 3CCZA 4ED3A 3DGPA 4OI4A 3A4TA 4HYKA 2JH3A 5A2QU 1OQ6A 4X84A 3GJSB 2ILYA 2OPQA 2C1EB 4OLOA 2GJ2A 4K4WA 3TZYA 4XK8C 4FVCA 4M5GA 3LO3A 2OO4A 4O4GA 4USVA 5F0WA 4ED7A 3I9ZA 2YXLA 3I0RB 4WXOA 1RWVB 3JSBA 4YHHJ 1MG7A 3W5YA 2ZJPQ 2V8GA 2VPZB 3A8EA 3GP9A 3JQMA 4A8MP 3A3PB 2JEFA 1Q7LB 2UP1A 5I3PA 3ZTSA 4ZPTR 4FYVB 3ZZPA 3PHEA 2E66A 4OV1A 4LRBA 3SV4A 3T1HJ 2CPEA 3LP1A 4NOHA 1G6BA 2UVRA 2CJKA 3J81Y 1S1UB 4AXIA 4H4KA 1F9EB 4QR2A 2ASLA 1S0OA 2FQQB 4NXNF 1XNRF 3TYTA 1HWIA 1VK8A 1H74A 2ZM6J 3WQPA 3EDRB 1S72S 4NLVA 2AD9A 4ECSA 2JFKA 4OZJA 1L3VA 1UZDA 4DDFA 5KFIA 1M5SA 1QUVA 3QIDA 2KL8A 1HBUA 4O4RA 1VRQC 1Y5IB 2C3OA 2RQMA 2W9CA 3PV8A 4QWBA 3BR8A 2RU3A 4WKRA 4URSA 3N6LA 2FZCB 3ZZTA 4F25A 1CULB 2PFDA 1RBOB 5KFPA 1S6PB 3GU0A 1TKTA 3TI0A 1C0UB 2Q6BA 4J9VA 1WWHA 4DL3A 1YLXA 3LWLA 2ZUGA 3DU6A 1KOOA 2CVIA 2FGOA 3E01B 3EWGA 5IV4A 4Y2CA 5F9NA 3ILIA 1XEZA 1Q53A 1T02A 3KJNB 4ZJLA 1SH3A 1VQ9S 4K5RA 5H9FJ 3QNWB 2D3ZA 3BS9A 4NPOA 4RNFA 2XMAA 2BUNA 2A10A 1YHQS 1M0SA 4HVZA 2DCLA 2DISA 4XPCA 2UXBF 1FWLA 1R89A 1ZPVA 2EXUA 4I56A 1Q1KA 1HNIA 3X3UA 1I94J 2YKNA 4X4TA 4DX7A 3MPDA 4TU9A 1FKPA 3DXBA 3BKFA 3HPOA 3DRPB 1HWKA 2HW3A 2QTWA 4B9UA 4B3TJ 1LWFB 3HHLD 2AGOA 3VCDA 1TZ0A 4G1PA 3V4IA 2ILZA 3TANA 4CQ1A 4OYWA 1XR6A 2XLJA 1VFJA 4LUBA 4YDXA 4EBEA 1YBUA 1HNVB 1VHIA 1DAXA 4M5IA 3UNYA 3KNAA 5T7LB 3JAMU 2HWIA 4G1QA 4OI1A 2H65B 3J7ZT 3UW1A 3OBIA 4JI5J 1W2BR 1FDBA 3I55S 1VQ7S 3MM5B 3KK2B 1FFWB 2VFSA 2M2BA 3FEZA 3FGVA 1ICEB 1PKUA 1RI7A 1UEKA 4MKAA 3L3CA 1UEVA 4P72A 1NJZA 4OI3A 4DR4F 1SUQB 4LBIA 2ACYA 2BKOA 3LWMA 2NUUG 3NCPA 1K0TA 3OSNA 1UPPA 4FKXA 4RKUC 4O3NA 1T0TV 4NMLA 2NZ4A 4JV1A 1BXNA 4Y2AA 2JFDA 3W2WB 4RU2A 4F0HA 4YUDA 4GC7A 1ZYQA 3D0IE 1PYTA 4B17A 4R8UA 1FI4A 1KWMA 4IQMA 4J7CA 3HK2A 4BLGA 5DQGA 2HHXA 1PSDA 1VBYA 4BS2A 2Z58B 5B7WA 2HHHF 3HKZD 4USJC 1OPZA 3D7SB 5L9XA 4Q8FA 3HKWA 2FB0A 3A8IA 2V69A 3R5DA 1QUPA 4M5MA 3MM9B 1KQGB 1OY8A 4V1Ak 4C98A 5D0HA 1TK5A 3LGHA 1R8HA 2IM3A 4ZIVA 4DSKA 3A3NB 3D2WA 2XLKA 4NLTA 3C2PA 2P8IA 3F41A 3LOUA 3UNGC 3H2UB 2CNNB 1WF1A 4IKAA 3VTIA 5J2PA 2LYVA 1WUUA 1D09B 2Y1RI 3FBCA 1PJ6A 4JP8A 3TVKA 1ZA1B 2VICA 4ID5B 4ED5A 4UOGA 1AFJA 2M3DA 4J9MA 1UFLA 5T7LA 1H7WA 2MQ8A 1PO6A 3QRPA 3JSYA 4A8KA 3TX0A 4DN9A 5IT9U 5KFGA 3DRPA 2WBRA 2CNKB 2CQGA 4RNNA 1ACMB 3MUMP 4YB1P 4OX9F 1TL1B 1FWKA 1VDHA 3EDQB 2E1AA 3SCIE 1YBAA 2YNGB 2A6MA 5EWFA 4DR2J 2B9XA 3WDOA 5C5JA 2VDIA 4PXDA 4IFYB 3RBXA 3VQSA 4U6PA 4PWDA 3BBBA 1R0AB 2M5YA 3ONQA 1B0PA 4TY9A 2AU0A 4WE1A 1GX6A 2LDYA 1U48A 3BQ1A 1YDLA 2ACMA 2W2QP 2G1HA 4OI0A 1VIXA 4WP9A 2FGCA 3CJ5A 3N5BA 3TA2A 1N48A 2BJ1A 2PT0A 3E01A 3L7PA 4X62J 4B3MJ 4DCOB 4YR3A 5DO2A 2GO9A 2CQ3A 2VBXA 3FSXA 5A8RB 1F5BA 2N4CA 1L3KA 4UUWA 4OZ0A 3OFFA 2CQ1A 3TA1A 2BVZA 4WBFA 1UJ6A 2DGSA 1LV5A 1DTQB 2CADA 2R4FA 3GMGA 4MH8A 4P7VA 2E7VA 5L39A 3MURP 5LSOA 1D8YA 2R2RA 2ZH1A 4GKJF 3EM1A 1S9FA 1KFDA 2KRBA 1X9WA 2G0CA 2OKQA 3CJ0A 3C46A 2JOQA 2MY8A 2CJYB 3BN7A 1KVKA 7AT1B 2XLIA 1TL5A 3QIPB 3M6UA 3PYGA 1RISA 2AJQA 3VZHA 1NCLA 3W61A 4QYZK 4AL5A 2DNGA 2RB7A 3BSCA 1JLBA 4NLOA 5A8KA 1J5EJ 2GMHA 1M5HA 2UXDJ 2HVEA 2CG8A 1H38A 3LP1B 2XY7A 4E98A 4FYDA 4DG1A 2DGWA 4K2XA 2OTJS 1RKJA 2CQ0A 2OPSB 3AJ1A 4P52A 3ENVA 3JS9A 3SEOA 4CT9A 2XQCA 3V5RA 2Z30B 1ZETA 2JL9A 4J91A 5J1EA 3M6WA 2ZH8A 2NZCA 3FQLA 4QU7A 3AXMA 4DOZA 2F40A 5EWGA 3QWUA 3SXLA 2DHXA 4KGMA 1NSPA 3CDUA 3NNHA 1FRJA 1XN9A 3TO8A 1MWQA 3UO0A 1REGX 1VLYA 3UE2A 2M70A 5CH7B 2B8PA 3AD9C 4OHWA 3CCJS 3S1TA 4KH0B 4EI2A 4A8YA 3MMJA 3VWSA 2E5LF 4DPWA 1HNZJ 4ZLNA 4CI0B 2EFPA 1TL7A 1U1LA 2OMLA 5LJ3Y 3NWGA 2JC1A 1HW9A 4OQJA 2E44A 4KV8A 4ZVGA 3HHLA 2JVRA 2Q1LA 4ZMMA 1S9EB 1SC4B 2HEKA 1NNDA 3SCLE 2KFNA 2MZJA 4QYRA 3MXHP 2DHSA 1FVSA 5IOLA 3KG0A 2YWWA 4KPCA 4G1QB 4I69A 3FBFA 2KYXA 2DIUA 3FCHA 4ICLB 2I1RA 4DCPB 5KFWA 3D3CJ 1SPBP 3E3XA 3ITHB 1Q79A 1RWUA 4XIUA 1X0FA 1SL2A 4DFJA 3EX7B 3W60A 2UUAF 1FO1A 1TV6A 2HBQB 2A1BA 3J7YU 4GVBB 1S6QB 4CWBA 2M8DB 1MNEA 4Q0BA 3DLGA 1RACB 2LCWA 1TKZA 2Z8QA 3OPKA 2QA4S 1ZM3A 3TP2A 3NMAA 4S0MA 2V2QA 4NLDA 5B0EA 2YQ0A 2XO6A 4WZMA 2HVZA 2YKMB 4F8RA 4O0NA 4NI2B 1T05B 1H7XA 3MMCB 1IKXA 2F8HA 3HSZA 4OI2A 5KFNA 2YNIA 5KG4A 5B0CA 3TEGA 1KHVA 5A8KB 5JVHQ 4O3PA 3MAAB 1KTQA 1XNQF 1WI8A 5DS7A 2B7BB 5ETPA 2XB2D 3AB4B 4CP5A 1UPMB 4LJMA 4DPXA 4ZVHA 4CNZA 3MPUB 4DCJB 1FF2A 3QZ7A 1HNWF 2COLA 2IRXA 3KG4A 4ITSA 3W7BA 4IYQA 2CXEA 2HNZA 1XQIA 2OPSA 2QGFB 3QYYA 2D9OA 1ZBTA 3HFVA 4AQYJ 3S01A 3BGLA 5E2QA 5EGYA 1RYRA 2FVCA 4FBTA 2RHSB 3R2CJ 4KHMA 1XMOJ 1Q4RA 4PABA 3HD2A 3D6MB 4DQPA 3C3LA 2WRMA 5A6WA 2PMHA 3PW7A 5JUMA 2A0FB 4M5JA 1NDKA 3DXSX 4V19X 2JZ5A 2JEJA 4DN0A 2U2FA 1SXLA 2H5JB 4CO3A 1I5OB 2X51A 2XWYA 3W65A 1R8AA 2B9WA 3FFIA 2LP4A 2BXJA 5E3PA 1LK5A 4FYYB 5L38A 4DL4A 1D9FA 3HSJA 1KKHA 3R3TA 4LR7A 5KFHA 4BHQA 2FLLA 3LP2B 1ROFA 3CUNA 2PO4A 2KZMA 5DGAA 3POTB 1TKXA 4MAKA 3SDEA 4CLWA 4EEYA 3DLEA 4QW8A 4BWMA 3FZBA 4F04B 4Q45A 4IRCA 4WF9Q 3IBWA 2CPIA 2KG0A 3MEDB 1N56A 1MN7A 2J6SA 2HNYB 2CPJA 2AYEA 1B7YB 1HBOB 3NWRA 1JLCA 1SJQA 2V8HA 1NK9A 2GW8A 3DMJA 4N8NA 5LMUF 1NPRA 2OPQB 2GA7A 4OX8A 5T14A 1YWXA 2E9RX 3GE9A 3CC7S 4C8LA 3UCZP 4OYZA 1CJVB 2YNHA 3DRYA 1JWWA 1R8PA 3CWJA 4DR5J 4DL2A 1BQNB 4CH0S 1RZMA 3C16A 1R27B 4EWTA 3IG1B 4CYUB 1Q5YA 3P5BP 5KT2A 2JNJA 2NXCA 3EZUA 3BEGB 4KC5A 4WFYA 4K0KJ 1S4EA 4J9NA 1JLFA 3VF0B 1AZSA 3DOLA 1JNRB 2V94A 4RNMA 4YDDB 5F8MA 1AXQA 2AQ4A 5LMNF 3JQJA 1CG2A 2IBOA 1NU4A 2L41A 3K7RA 3K57A 3QSYB 4ZITA 1YI2S 2IJRA 2XSJB 1V3SA 2KXHA 2M7SA 4IDKA 2VASA 2DBBA 1YJTA 3AAWB 5HN0A 2B4PA 1JK9B 1UEUA 2WSEC 4FXWA 2UVWA 4JYAJ 3AXKA 4J9UE 1R0AA 2BJ3A 3TZZA 3M8WA 3T5KA 3QJLA 2BDPA 5CYMA 2ZE2B 2ZH5A 3S7RA 2JJ4D 1WDDA 2EFGA 4JV5J 5CZVA 1S49A 4HACB 3RYLA 2V63A 3M8RA 4ED0A 1Q81T 2LQBA 2X3DA 2V4RA 2P9GA 3N01A 1S59A 4OLPA 3W66A 1UETA 2W7AA 3U27A 3CJQA 2AEJA 2UUBF 4LRDA 3M8SA 2IJNA 5AXNA 3Q8YA 1LWEB 4ECWA 3M8YA 2A3JA 2N4DA 1EP4B 2Z56B 4ES3A 5SZTA 3U02A 1FXRA 3QGPA 1TUWA 4TY8A 2AZ1A 3BO3A 2APOA 1Q7YT 2ZDOA 3W9IA 2EC0A 4DR3F 1HI0P 1PBAA 4C8MA 4LF4F 3W3SA 2V8VA 2CZ9A 3LH2S 5A6PA 4AXJA 2MZTA 1VLOA 2MLYA 3O44A 4ILRA 3IP0A 4ILLA 3PR5B 1WEYA 1T03A 1GQEA 4OYMA 1E6VB 1NXIA 1N32F 2RAQA 3W9JA 1N34J 1L3TA 1ZA2B 2JX2A 4CO5A 1HHQA 4FF4A 4OZ2A 5GADU 1ZZNA 1XMBA 3HVTB 3IR7B 1QAIA 4EYHB 1CJTA 4EGLA 7FD1A 2VA2A 3D6HB 1N4LA 2N3OA 2W7OA 2MQOA 5EUHA 1EB0A 1V3RA 2BJ8A 1LW0B 2MQMA 2WSCC 3DLKA 4YQWA 3U7JA 3NCQA 4DSFA 1V5VA 1YRTA 4NLUA 1KQFB 4PG6A 5HMWA 3G71S 3CD0A 3G8QA 3M2VB 1X4BA 4ES1A 4ZVTB 3RTVA 2GMJA 1DBDA 1JX4A 3MM8A 1LK7A 2RUGA 4QU6A 2CPYA 4OX7A 1DQAA 2VC0A 3BZQA 5IWAF 3CF5Q 2LMIA 1V6HA 1WSRA 4KR0B 4EFAC 3VAMA 1WEZA 1R8BA 2E9TA 2HNDB 1M5VC 4LF7F 1SUQA 3QRRA 3HZGA 2F8MA 3OFGA 2BOAA 1VRTA 2NLWA 5IT4A 2HPUA 3GJRB 2OIHA 2XSJA 4DV0J 3RW6A 1X4HA 4RJVA 1X4FA 1IQZA 2AJ1A 5BR8J 1W2IA 1UTAA 3VAHA 3GIMA 3OR1A 3LANA 4ICLA 3I4HX 2EFNA 4MK9A 4LSLB 1VQOS 2IA6A 1V3ZA 2MQQA 4CCHA 2F4VJ 4A8WA 1UCNA 2MTLA 1RDRA 1RT6A 3JTPA 2LXIA 2RQKA 4NLPA 1FEEA 1S6OA 2G2YA 4UZCA 1S9EA 4O3QA 3GWCA 3Q24A 1CJVA 2VPWB 1MLAA 1XJWB 2XHWA 2YBVA 2YNHB 2OD4A 4TU7A 4IOCQ 3KLEA 3H0PA 4NASA 2GGPB 1IBMF 2OHDA 3DKDA 1FKPB 2J0QD 1S9GA 3GG1A 2J6UA 3I4PA 3NS6A 4K4XA 3PRDA 3PW0A 1VBKA 1EQ0A 1HKAA 5HK4A 4HI1A 1JLFB 3OUYA 4C8ZA 1ZOTA 2HVHA 4L6V3 1TKTB 3HJVA 3E51A 4NMXA 4DI6A 1U1KA 2G13A 2H51B 4DU7A 5IM0B 3KK3A 4C11A 3RU0A 1O51A 1PJ5A 4M8LA 4LR9A 2RDDA 5CCLA 2HFZA 1D0EA 4NXMJ 3IWLA 2VHGA 4KAIA 1EKRA 2ASJA 3H2VE 3PNIA 1OO0B 4I2PB 4NCGA 3EPGA 3FBBA 5IT0A 2YH1A 3DLHA 4JI8J 3K5MA 3A1YG 2OELA 4PUOA 2KHDA 2D1CA 4PXEA 3PFOA 3CCUS 1TAQA 3QO9A 4FN5A 2W2OP 2ZVIA 3EGWB 4L73A 1U2FA 3N9UC 4B08A 4YOEA 2F5GA 2MHNA 3H4DA 1QD1A 4QIWD 5L8RC 1P9YA 3DLJA 4JI7F 3SDEB 2CPDA 3QQCD 4KH1B 4V19J 4WIQA 3V6JA 3M32A 5F3ZA 2BM0A 2YH0A 1SIWB 1HQUA 3F44A 1KRPA 4NA3A 2UXCJ 5HQMA 2H1YA 2GJIA 3TARA 1HWUA 1Y11A 1C0TA 4ETXA 1J5OA 3BDPA 3PJ9A 4QPXA 4YR2A 1YJWS 1C0TB 2CQPA 3MI7X 1VR6A 1J5OB 1TR0A 2MQLA 2LLZA 1CQNA 3MTJA 3FUYA 1YBTA 4NA2A 2XULA 2GGPA 3GR0A 4F0MA 1ZM9A 3OW2R 2VODA 3FCWA 3R5JB 3HJFA 4YEAA 1FJ7A 4IR9A 5KG6A 4A8FA 1GX5A 3MM6B 2HHWA 2QL7B 4ZP9A 4B3OB 1YGYA 4ZS6A 2FD2A 3PVXA 2DYAA 2W24A 3VGVA 3HX9A 1SJ1A 3N79A 1S9GB 5DG8A 2FHJA 3AD8C 4P6QA 4JUZA 3PKYA 1NJIT 2RIJA 2C28A 3B6BA 1GNKA 4MKBA 5EX0A 3W62A 2MLZA 3OFHA 4FVMA 4I2PA 4NCGB 4PZVA 3WZ0A 4AFFA 4WFAQ 2KRRA 3TR5A 1RT7A 1SIZA 4P2XA 5HJYA 1LKZA 3AHPA 2PDAA 2MHEA 3H5SA 4KHPF 1CJUA 4RW9B 4LSLA 1VBXA 4ZP7A 2J9DA 2V8DA 3MPYA 3UVJA 1U6BA 3HHKA 4TN2A 2IPOB 1HPZA 3ZTRA 4DV4J 4KGVB 2F3JA 1UL3A 4I4BA 1CJKA 1T11A 3QT8A 2W4CA 4O3OA 1TKZB 3H7HB 1ZPWX 4IFVA 3IS9A 3TOQA 4CM2A 3EGZA 2JHEA 1FWPA 4ID5A 2R7OA 3EMTA 1RT2A 3DRRA 4DUZF 2IA0A 2RJZA 5AJ3F 1F9FA 2IVMA 3BPSP 1GMUA 2EWHA 1QDUB 2YX4A 2MZ1A 1C2PA 4Y6IA 4CZCA 1KC8T 1VQKS 2HHQA 3TZWA 4DR1J 3ENAA 4FS2A 4QWDA 2ADCA 4B9MA 4CLPA 3IRXA 5G0RA 4I64A 1KOHA 4I2QB 1DJ0A 3CD5A 2V0NA 1LW0A 2PA8D 3M6XA 2ZNYA 1PC4A 4OHZA 2OUGA 2M9KA 3SFGA 3GQCA 3HVRA 1V9OA 3J81j 4EBDA 1NK7A 1L3SA 3R8YA 2DNMA 4CLZA 4WP8A 4ZVSB 1REVA 2ZVSA 3RW7A 2ZBCA 2B6AB 4D3GA 3H5XA 2DNZA 3D3BJ 1EETB 1S79A 4KGXB 5A8WB 4MK8A 4LF5J 3T1HF 4U96A 3CCWA 2YNFA 2NCKL 1NZ8A 5D0RA 1FJEB 1ZH5A 4Y0FA 3GLJA 4ATNA 4KHRA 5A2QY 3GFHA 1BE4A 4ELTA 3K5OA 3WC0A 2ZKUA 3M2RB 5AXKA 2HGNA 2UUTA 3GTYX 2KM8C 5LSLA 2XYGB 2FLNA 1FTRA 2GC8A 2H5EA 4UOFA 2A2CA 2H4WB 3C8YA 2OSQA 2W4DA 1M1HA 3AJ2A 3DOMB 1LWEA 4RW4A 5DZ6A 1XC9A 2MLXA 2P9CA 3IS9B 4F02A 3BQ0A 5B09A 4U67Q 4MIBA 2DR9A 5E3QA 5IQQA 3MPWA 2DKOB 4K5SA 1CC7A 4NLRA 4UW2A 2E1RA 3TUIC 4BBYA 3JSMA 4FKYA 4DFPA 4JI4J 2Q66A 1UWBA 2HVDA 3G8TA 3CSKA 4WFXA 2CNOB 4K7QA 4PR6A 5I3UA 3HHLC 3ZZRA 1FK9B 3C19A 1HNVA 3MUVP 4DSLA 4DSIA 1VCTA 3PCOB 3OXLA 1JMTA 4MIAA 4HDGA 4DV2J 4LBPA 3G9CA 3DI6B 1MMNA 2VG6A 3M2UA 4KQZA 4RNHA 2R7QA 4DV3F 2PEHA 3JAMY 2UXBJ 4K4UA 5C7PA 1XMQF 1C4AA 2GVZA 3NAIA 1B70B 2LU2A 2WVCA 1H72C 3DMJB 5J2MB 3VALA 2PN6A 1NJWA 1D9DA 3EVMA 4U9RA 1T9WA 5IT9Y 2Z0GA 3CC2S 1TP7A 1WDTA 2BM1A 3FQKA 3CXCR 5DLGA 3FKBA 3B54A 3TAQA 1HR0J 4TVAB 2CKWA 1MN9A 2GQQA 4B3TF 5KG5A 2G1DA 4IUFA 3ILOA 2HZAA 4FYXB 1TL1A 4K50A 2MZQA 3N5FA 4AYBD 1YZ6A 2GFFA 3PW5A 1HQ2A 4K4SA 5FLXU 2L48A 1W25A 3IM9A 1VGYA 4I68A 4KE5A 5D78A 5CA5A 3M9MB 1DRZA 4BC7A 2HS3A 1UA1A 2FC9A 3QFWA 3RGIA 1AUDA 1NZAA 3CO9A 1T3OA 3HVAA 4MFBB 4NYOA 4J9OA 5J2PB 1NRKA 1S6PA 4DV6J 5FDLA 5C24A 1Q95G 5LM7E 2KT3A 3BR9A 2CFXA 1Y7PA 2J76E 2QSWA 2YNGA 3LA0A 3MCMA 2OGUA 3DOMA 3MCNA 3QT6A 4J90A 3LP2A 3VVTA 2WB1D 1S12A 3IMQJ 2L08A 3TEHB 4I67A 2H9ZA 2RDIA 4K4ZA 2ZZMA 5D8HB 5E7OB 4YMEA 5AXMA 1Q82T 1RCXB 4OHYA 2I9SA 4Z2XA 2IMOA 2C2OB 4IG3A 2H3EB 3VAFA 3P96A 2DPIA 3B8HA 5ETLA 1U09A 3ELHA 1IKYB 3GYGA 1OYEA 4F7VA 2MKKA 4OYOA 1JJCB 1FJCA 2FHMA 4BC9A 3T9NA 5IC4B 2C3MA 5IQ6A 2HHHJ 3UQSA 3CMAS 5GADI 4DV1J 1RGVA 1VQSA 1FDAA 3DHWC 3T1YJ 1JJ2R 4CLLA 1S5ZA 3H98A 5HQLA 4FS1A 1T7PA 4C0OC 3I56S 2W9BB 1TK8A 4DR6J 5CXTA 3OTOJ 4I7FB 1CVJA 3IRXB 1JNZB 5G0RB 4ECYA 1S77D 3CNQP 2W01A 3Q83A 1DLOA 2QYCA 3ZZUA 3M8QA 1NBEB 2VDHA 3M1VA 2HQIA 3OD2A 1A6LA 1E6YA 1FEHA 2G0IA 1RTDA 4DV5F 3C6TA 2V4JA 2PIIA 1U2RA
chains in the Genus database with same CATH topology
4OZ5A 3ITHA 3CCLS 1VQ6S 5FD1A 5K14B 4R5PB 5GMKa 3M9OB 4OJHA 4TYAA 2RD5C 2L9NA 1WG5A 1CEZA 2KJWA 2C42A 4UUXA 4M95A 3MMBB 2HHVA 2B4UA 2K1RA 3M30B 4GKKF 1NKBA 4RWWA 2KHCA 2XS5A 2WCXA 2YVSA 3IRWP 2FJAB 1FRMA 1HWLA 2ZHOA 3CJ2A 4RW7A 5KFLA 3MR3A 4DR2F 1JJ4A 4Q43A 2XCPA 4H4OA 2RILA 3T1AA 4A4JA 2JLFA 2XC9A 4DLEA 3PRBA 1U1OA 5AE2A 2Z2MA 5DRKA 3NRBA 1P8GA 2DH9A 3SV3A 1MMDA 3C66A 3R27A 2PE8A 1HW8A 2XBPA 1YSJA 1SC6A 2VKRA 1S4FA 2WOMB 2YWKA 3D5MA 4M5DB 1B0VA 4ED3A 4ED6A 2ABYA 3DCAA 1VQLS 2DRBA 2PGCA 1RA7A 1RTDB 5AE1A 2K3IA 3M05A 4UY8T 5CZXA 3MEKA 3I82A 2NPIA 4PKDB 2HAIA 3MR6A 1G3OA 1K1SA 3MUTP 2AYGA 4E8UA 3PW4A 3O8WA 1R7IA 4LSNA 4UOCA 1YQHA 3ENQA 4MIWA 1FVQA 1JLBB 1X4EA 6FDRA 3ZZZA 1UVMA 1WHYA 3B82A 1VQPS 2AWZA 2BBEA 1H3DA 1X0PA 3DFEA 1S76D 3KMQA 1N52B 2CQIA 1HL6A 5F3TA 3GYNA 2KVIA 2V4JB 2JEGA 4X4PA 1J5EF 2XMMA 3RR8A 2AX1A 2NR0A 2MKSA 2UXDF 2YTCA 4USIA 1VQMS 2O1PA 4N76A 1TVRA 1FXDA 2GV1A 2XWXA 3E8OA 5JXSA 4IR1A 1UVJA 4H4KC 5KT4A 5G4DA 3ISZA 4G6VB 2VUGA 2W7PA 1N5VA 3KWMA 4RW8B 3I6PA 3EZ5A 1Y4ZB 1HI8A 3D0HE 2UZAA 4WK3A 2QIFA 3UWTA 4XDDA 3THVA 3OFEA 1X8DA 1VQYA 4PWUA 2GIQA 3ISNC 2RDJA 4EU0A 4R0EA 2ROGA 3GFYA 4DL5A 4JI1F 2VBYA 4WE1B 2X1AA 4NCAA 1N33F 1KQSR 4TYBA 1HD0A 4IH7A 3FNNA 3LPYA 2HWTA 4PRFA 3LAKA 5KFAA 2ZOFA 3NCRA 2I5JA 2DNKA 3BSNA 3I0RA 3DLLQ 4B9NA 3OUYB 2J8AA 3JSRA 5DDPC 2YWHA 4QIVA 1SH0A 4MYUA 1T3NA 2VG5A 3CDEA 2YQ3A 4LMZA 2CQ2A 2EFOA 4CO2A 4H54A 3RAQA 3PACA 4OZNA 4TLQA 4EYIB 1D8ZA 1YITS 1IBLF 1GAOA 3CGIA 3D1OA 2G9OA 5J2MA 2R7VA 1KLMA 1JLCB 1JJHA 2OPRB 4A47A 1LOUA 3OVSA 4GO7X 1S1VA 4M63A 4ECRA 1TKXB 3CIZA 4KT0C 2MKJA 1TFYA 5IFMA 1Z4UA 5FLXY 3KK1B 2UV8A 3VR1A 2FJVA 1U1QA 4ZP6A 1U4BA 3KFWX 4KFBB 2R2UA 2EFVA 3LGMA 1N54B 3ZZ0A 4Y3CA 2BANB 2MKIA 3MM8B 2UVVA 3IC1A 1AW0A 4DS4A 4IG0A 3B4MA 4TXSA 1QAYA 5J2QA 3FEYB 5LSRA 4M5DA 3MF5A 2LA4A 1RT4A 1N5SA 4B9SA 5H9EJ 1WF0A 1Q8IA 2VG7A 3V6DB 2XY6A 3TVYA 3DRSB 1Y5NB 3G8SA 1RQ0A 3ICLA 2DH7A 2DGXA 3DRSA 1VK3A 3KLGB 4AQYF 1CLFA 4OHVA 2N82B 2ZH7A 1XMOF 1YG0A 1SJ3P 2O3DA 1J2VA 2DNHA 2ZD1B 3IGVA 3M2VA 4ID8A 4DEZA 4ZHRA 3OV7A 2W8KA 2IJFA 5BYQA 1T95A 1REVB 2XMJA 4ETZA 2OMOA 3KK2A 2V4QA 3K5NA 1M90T 5D3GA 4EBCA 2WK4A 2A2DA 3DRXA 2DGTA 3TW0A 2XI3A 2F9JA 3MFHA 4I2QA 2W8LA 1CPZA 4JI6F 3R5AA 2AP6A 3OL8A 1N5YA 3JTNA 5IS2A 2RS2A 1ZAWA 1RT4B 2MKCA 3K0JA 4KBIA 2PMZD 2B7CB 5I3QA 2POKA 5DJBA 1VOMA 2MMYA 2EKYA 3CJ4A 3KLGA 3OVAA 4QIEA 1N0UA 1MU2A 3D28A 3UR0A 2K8GA 4F2SA 5CQGA 2YKAA 2HHPA 5HP1A 2HHTA 2VOOA 1FJGF 4DR5F 1DQ9A 3MECA 2GHVC 5KT7A 2X1FA 3KLIA 2BR0A 2B56A 2P6TA 5B0BA 4NZ7A 3IR6B 2QV6A 1TL3B 3V6HA 1KTVA 2BQRA 2U1AA 5C42B 4ZPWR 5L1JA 4JV2A 1GTEA 2KXFA 1TUVA 3ZZTA 1S7HA 1U6FA 2K3KA 1IKVA 3C6UB 4OI6A 4UQTA 4CO0A 3G6XA 1JX4A 2DB1A 1OIAA 1JKHB 2UV8G 1Y00A 2D3OR 4EO8A 1Z1ZA 4JYAF 2FJXA 3CB4A 2W9CB 1VRUA 4MKYA 4CIOA 3UDCA 3I0SB 3CC4S 1YJVA 3OHAA 5C25A 2LQJA 1FHTA 5E33A 1F0XA 2F1FA 4JV5F 1DARA 1UMJA 1FERA 3CMES 2G4BA 4NL5A 3HLUA 3IG1A 5JVGQ 2AJ4A 3K8VA 2WONA 4L3NA 2HNYA 2YX1A 1UJ5A 3AQOA 5KTQA 3S8SA 1S48A 1NEEA 1WEXA 3F56A 4KFBA 1MMLA 2XMVA 4OHXA 5MLCV 1TK0A 1GT8A 1B64A 3SI8A 2R2TA 1UAWA 4ZKAA 5HMYA 2XSFA 5FJ4A 3DU5A 5F8JA 3NLCA 4DV7F 2QSFA 5KFZA 3PR4A 2LXUA 2EK1A 2MDAA 1YVFA 4X4OA 3F73A 2IM2A 2DNOA 4TKTA 2VA3A 3RB3A 4LF9F 2XNRA 2ZM6F 4J9QA 4PUOB 4FNHA 5KFQA 2DT9A 3T5JA 3I0SA 5T41A 3RZAA 3PXGa 4DL0C 1MROB 3D1QA 2Q43A 3IWNC 4DS5A 2MSSA 2NQPA 4YP3A 1UKUA 4JV0A 3GFXA 4X2BA 2HVIA 4NRTA 2DNNA 1RT3B 3MOJB 2ZZNA 2W9AA 1WD6A 3T9ZA 2RRAA 2ZC3A 4RWXA 1RP5A 1WG4A 1LWCA 4RBTA 1ZAXA 4N8OA 2JLEA 1N36F 1QJHA 2XMUA 1WF2A 3NP5A 4DJBA 1T05A 1X5PA 5D4OA 1R6YA 2F8EX 3CE8A 3IO1A 5KFMA 2DNRA 3QGHA 3BSAA 3LW5C 4Z37A 3IA0A 5B08A 5IM0A 5KFUA 4Y28C 4Q44A 2DTJA 1WNEA 3MMAA 3Q0AA 5GAHU 4C8YA 3N0VA 1HBMA 1HMVB 2VD3A 4PXBA 1JLQB 2HS4A 3R5CA 1NKEA 2MZRA 2RF2A 3H4BA 2ZKTA 3QLHA 2R7SA 3MEEA 3OL7A 3KLEB 3SYZA 3T6JA 3OR1B 3BQ2A 3FMBA 3L09A 2L9WA 2NXUA 4IH6A 1UVKA 1RT6B 2EW9A 1UVIA 1XK8A 1HMVA 2GQ2A 3NAHA 3GIKA 3Q8PB 4JI5F 3I5CA 4CH1A 4ZPVR 3M9NB 1H6KX 4QR1A 3U1NA 4DUYF 1RK8A 1UFWA 1VS3A 3LUYA 4B9TA 1E6YB 3BSOA 2DITA 4WZQA 5KG3A 5I42B 4L72B 4KV8B 2FJEB 4QWAA 1QSLA 1HBNA 2Y0SD 3QMQA 4PXCA 5LT5A 3KG1A 3O2IA 4I6AA 4XPEA 3PKMA 4HL9A 2RE1A 3KHLA 2R7RA 2FUG9 3OL6A 1F60B 3ZZYA 4IO1A 1WACA 1QM9A 1S1TA 1WHWA 5J1EB 2RT3A 2XO7A 3MCSA 4KRWA 5KT5A 3P49B 2VKZG 3CULA 5SUHA 5DG7A 2LECA 2OSRA 2KT2A 1JLEB 3MMBA 3S6EA 3QGGA 3PW2A 2EBGA 2BV3A 3I96A 4FPRA 3HP6A 2W9BA 5E3AA 2VH7A 2R7TA 5F8LA 5EWEA 2MKHA 1XR7A 2MJNA 2I2YA 1FDDA 4YHHF 4ECXA 1KSPA 2VBWA 4ZPDA 2F7VA 4USHA 1NJYA 2ZFHA 4YY3F 4RUAA 4YR0A 3MD3A 3HVWA 4WCEQ 4N56A 4WU3A 3FZ2A 3M8PA 1KNZA 3NG8A 2ZNZA 4J5OA 2R2SA 3WC2A 2XGQA 3PO5A 3EYZA 3EUNA 3SMZA 1RAJA 3FMWA 2KU7A 4Q2MA 2O5DA 3OR2A 3DN9A 4DBQA 3HO1A 3MFIA 2E1MC 4RBVA 2WONB 2V9KA 4N47A 4QWCA 2FJDB 1A7GE 4G1IA 1BGXT 2FHOB 4WFBQ 2QMWA 1CSJA 1Y9OA 5D77A 3JSMB 4NYZA 4C3KA 3MM7A 4KO0B 2FJWA 3GG0A 4PWDB 3QZ8A 5HI7A 2KI2A 2YKQA 4DSJA 2IM0A 1NK6A 1NHVA 3SQGA 1FRHA 3KLFB 1GXLA 5KFYA 3FSYA 1I1GA 2KKHA 2LEPA 4C0BA 2UUWA 3CJKA 1GTHA 3AY0A 4RBUA 3SFUA 2WW8A 5JJBA 2KFYA 2ZH4A 1D9AA 4FBUA 2WAQD 3QAEA 5U47A 3OJUA 4O44A 1UWBB 2CDQA 3MECB 2J6TA 1QAXA 2PD1A 1I94F 2IAJB 4HHJA 3IR5B 2RVJA 3VAKA 5ITHA 2HHUA 5KFXA 4ZA1A 4P7TA 3RRHA 1WHVA 3UCGA 5DLFA 1B0TA 4F67A 4KKOB 2CJBA 2HIQA 4F3OA 4M1KA 2ZDPA 2XZWA 3SSQA 3MTKA 1K9MT 2O67A 5KG1A 4Y34A 5CD4H 1NJXA 2EG2A 4FF3A 5E41A 4N5SA 2I0XA 2P6SA 1IXKA 3MHYA 4ZK7M 2CZVC 1LXJA 3V4MA 3RB6A 5K8MA 4O3SA 1DZ5A 3TRGA 1PC5A 4LVOP 4W90B 2DNYA 2E5HA 4J9PA 1RTJB 1JB0C 3FFIB 2BABA 2ZH9A 3BGUA 4HEA9 4TQRA 2WOMA 3IN5A 3K58A 1ELOA 2B9YA 3THTA 4ZPAA 4HI2A 3MAHA 5I3UB 3Q23A 1RT5B 1WELA 3V6DA 4FZVA 2AV5A 1R3NA 2GCFA 3M6VA 1RYSA 1HPZB 1IN0A 1SJRA 4JI4F 1M5KC 2QLWA 2J9DE 2JVOA 5A8WA 1P9QC 3TVZA 3GV8B 1SJFA 2ADBA 2D9PA 2HLUA 1FE0A 1D1UA 4NCBA 2ERRA 4OMFG 4RW4B 2KFZA 4RW7B 5DQIA 3O5TB 5GAEI 3HFKA 4TY8B 5GAHI 2KM8B 1RT2B 4RLEA 3TUZC 5KG7A 1FKAF 4FF2A 1VI7A 1N88A 1X4CA 4FF1A 2N3LA 2Q3PA 4NA1A 2MGZB 2IM1A 3LALA 1VC0A 1A9NB 1C1BB 2YWEA 2KN4A 1FDNA 1FT8A 3BGFA 3W2VA 3KLVA 3N4WA 3HMJG 4GC6A 2AJ0A 1P27B 3HHDA 2B3TB 1HWJA 3MM6A 3G6YA 1C4CA 3DOKB 3HHLB 3CIMA 3QAUA 1NK8A 3OL9A 2X1BA 2L3MA 2FTRA 1VIOA 2C2RA 4CTAB 2IAJA 1O0PA 2HGLA 3H2LA 5KFOA 1N5TA 2E5JA 3GIIA 1Y3KA 2PFFB 2I5JB 2VL1A 4YB5A 4CO4A 1FTCA 1H2VZ 2HMIA 2R7XA 2HGMA 3LAMA 1FNMA 2PSZA 4ECQA 3PEHA 4A48A 2OPPB 2XNQA 2LVWA 1S99A 1P6TA 3DC2A 4A8QA 4ZPBA 2ZITA 2UUCF 3GZ7A 4C2MA 1NK4A 2V9WA 1FRLA 4D3HA 4U7CA 2R7WA 2V5HG 3NGDA 1HYSA 3LP0A 4B3MF 3DYAA 3RAMA 2WTFA 5DDOC 3MDFA 1X9MA 3LP0B 4C3MA 1Q8BA 4QCLA 1VBZA 3TAMB 4AL6A 3CDWA 3T1YF 3SCKE 2GHWA 3CCSS 4URQU 3V6KA 5I4MA 4DR6F 3OTOF 5K8OA 4QOTA 4ELUA 2DGUA 3BO2A 5MAOA 4HTJA 4IH5A 4RUCA 3H59A 2M8HA 2VZ9A 2GNKA 4YB7A 1YRUA 1U47A 1AROP 1GXTA 4LSNB 2B43A 2CZ4A 3KLHA 3UPFA 1OPIA 3AB2B 2HMIB 1DURA 4X4QA 4DR7F 3GFZA 4LT6A 4C7QA 1X4DA 4ECTA 3H25A 3NNCA 3ZC4A 3H20A 1YJUA 2DPJA 5D6GA 1KD1T 4RNOA 1JLEA 3PJWA 1DTTA 5FIIA 3CCVS 4EZ9A 1XR5A 2ZHBA 1HI1A 4Q2LA 2ATLA 1G2EA 3DYAB 2D3UA 4XO0A 1U1NA 2KDOA 5HBMA 2JEIA 3MEGA 4J9SA