1FE0A

Crystal structure of cadmium-hah1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
66
structure length
66
Chain Sequence
b'PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER TRANSPORT PROTEIN ATOX1
publication title Structural basis for copper transfer by the metallochaperone for the Menkes/Wilson disease proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 19
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fe0A00
1SB6A 5B0DA 3DXSX 2K7JA 2HLUA 1K0VA 1YRXA 3HHLA 3I9ZA 2XMTA 2IYIA 2VV5A 3KG1A 2OD4A 4OJGA 3BDEA 5B08A 4DL0C 2OFGX 1TL4A 4HI2A 5F0UA 2BUNA 3MCSA 4ZOSA 2GA7A 1S6OA 3UDCA 1N5QA 2GFFA 2HIQA 2XMVA 1FVQA 3BGUA 1P8GA 1VQSA 2JDJA 2ROPA 2Q3PA 3CJKB 4EFAC 2KT2A 2KYZA 2AP6A 2GGPA 4DN9A 5B0EA 1S6UA 1YG0A 2EW9A 4YDXA 1OQ6A 3KNGA 5B0FA 2FIUA 1FEEA 1N5SA 1R6YA 1SI9A 2KKHA 2XMKA 5B0BA 2AW0A 5T7LB 2KT3A 3LGNA 1Y3JA 3QMQA 3VTIA 1W2IA 4A48A 1URRA 1N5VA 2RMLA 2XMUA 1OSDA 2GGPB 3BB5A 3F44A 1CC7A 3T9NA 1U7LA 2HFOA 2K7KA 4OJHA 1AW0A 2HQIA 1APSA 4HI1A 5A6PA 1FE0A 2ZDPA 4HH1A 5IXUA 2OFHX 2PD1A 3MZIA 2BBEA 2IYGA 2N4CA 3DCAA 1X0PA 1AFIA 2GCFA 4U9RA 2LXFA 2LQ9A 1JK9B 2L3MA 1OQ3A 4A4JA 2XMMA 4Q2LA 3KKFA 3HHLB 1FD8A 1TUVA 2BYCA 3HF5A 1SQEA 1QUPA 1GXTA 1ULRA 2ZDOA 2W4PA 3FRYA 3TOQA 2LQBA 1IUJA 2OP5A 2VH7A 2N4DA 2QYCA 1YJVA 1WD6A 3K7RA 1TR0A 1Y3KA 1Q53A 4FNIA 5A6WA 3LGMA 2ROGA 2G9OA 1KVIA 1KVJA 3HHLD 3FGVA 1CPZA 3FMBA 3HHLC 3E8OA 2XMWA 4OIXA 2LDIA 2K1RA 1Q4RA 1N5TA 1FVSA 2FB0A 1V3ZA 5KAKA 3BR8A 2BJDA 2FTRA 4F67A 2HLTA 5B09A 2N7YA 1LQ9A 1MWYA 1P6TA 4OJ1A 1VQYA 3KG0A 1OPZA 1YJUA 4NL5A 1X8DA 5B0CA 1CC8A 1YJRA 2ROEA 5F0WA 4NPOA 3IWXA 2RSQA 2PGCA 3IWLA 4Y2IA 2K2PA 1GXUA 4A46A 2QLWA 2W4DA 4OJ3A 3CJKA 2HFNA 1Q8BA 2AJ1A 1X7VA 2OMOA 3GZ7A 3LO3A 3TRGA 1MWZA 2ASYA 2BJEA 1Y0HA 4HH0A 5K9FA 2RILA 4FNHA 2RU9A 2CRLA 3HFKA 1TL5A 5T7LA 1FE4A 1TZ0A 2FHMA 3BN7A 1XBWA 4QOTA 4Y2MA 1RJJA 3WDOA 3QGPA 4Y2KA 2QIFA 3BF4A 5B0GA 3TNVA 1YJTA 2XMJA 2OD6A 1AFJA 2GO8A 4DPOA 5B0AA 4HL9A 2GV1A 2OAUA 3BM7A 4Q2MA 3HX9A 2OKQA 1KQKA 1Y9OA 4ZA1A 2IFXA 2AJ0A 1FESA 2K1RB 4YEAA 2QLXA 1JWWA 4A47A 2W4CA 3HDSA 1Q8LA 2ACYA
chains in the Genus database with same CATH superfamily
3ZZPA 1BWEA 2PEBA 3AD7C 3M6UA 1HNZF 4BC9A 2VQEF 2JDJA 3N28A 5JXSA 4JI4F 2IA0A 2P8IA 2PE8A 3H5SA 3MM8A 1IBMJ 5B0BA 3M2RB 4WFBQ 4FXWA 4ID8A 1GFWB 2YPYA 2JL9A 2Z0GA 3KLFA 3CT9A 3FBBA 3LW5C 2EPIA 3EPGA 2XZDB 2B9WA 3AOCA 2G9OA 3DM2B 3FMBA 2CZVC 1V3ZA 4IR9A 1F9FA 4AE5A 5K14B 2NZ4A 1U6BA 4C8NA 4CLFA 3RW6A 1U0HA 3M8WA 3HPOA 1K1SA 4WBFA 3AH6A 1MWZA 2W2NP 5DG7A 4O3SA 4C4WA 3R8YA 1CJTA 1CJUA 4ALZA 4QPXA 4DV5F 4Q8EA 3CJ0A 3KLHB 2MEWA 1MWQA 4DPXA 4NMXA 2RRBA 2VU5A 3VAFA 1N34J 2CNLB 4IRDA 2HLUA 4KT0C 2CQPA 1YRUA 4DL0C 3RBZA 1RKIA 2BKPA 3UDVA 4CNZA 2QE5A 4ZLLA 1IWAA 2VD3A 2DNQA 2PDAA 1Q5YA 3EGNA 4WK1A 4UUXA 1F1BB 1MMNA 3QWUA 1G3OA 3V81A 4LR9A 4KO0B 1U02A 1Q8KA 5C25B 1RTDA 4X4TA 4CO1A 2CKWA 2YNIA 5ETLA 2FHOB 1DRZA 2HHSA 2E1PA 1BQMB 2OPSA 2N7YA 1KFSA 2Y8YA 2C3UA 1ZBTA 2FJVA 1F5AA 3OQ2A 2VKZG 1VQ4S 4URQU 5ETTA 3G6XA 1HBMA 2VFSA 1XBWA 3KHHA 4DQSA 1MROB 4C11B 4ELTA 1T95A 3R1LA 2UUWA 4OYIA 1Q0NA 1CULB 1HNXF 3UPFA 3FZ2A 5LMUF 2J7UA 1BWVA 4LSLB 3TVYA 3ZTSA 3TX0A 2ATCB 1C0TA 4W92B 5E33A 3UCGA 2CVEA 5HBMA 2Z4PA 5GAHU 3KK3B 3IS9B 4OHXA 3RB6A 1H2UX 3HSDA 3T9NA 5KT4A 5L1LA 1S48A 2W7OA 2ZH5A 1N6QA 2LXFA 1M5VC 1WDTA 1Q86T 1SL0A 2NYHA 4KIAA 4YY3F 3IC1A 4AFFA 1XMBA 1Y00A 4PWUA 3GCXP 4IRKA 1IBKF 3BO2A 2LDIA 1WHYA 1KLMB 1UETA 4Y28C 3M8ZA 5F0WA 1TVRA 4Y2IA 4OL8A 3MEEB 4X65F 1FDAA 3SI8A 4ZVTB 4M5MA 2PSZA 1RBLA 2B8PA 3FCHA 4FP9A 3PW2A 2NSCA 2LU2A 2H3EB 2GVZB 3GWCA 1T03B 2OKQA 3RR7A 1WF2A 2AJFE 3QGGA 1FXLA 3K5OA 3MCNA 4CLLA 2MZ1A 2AGQA 1FERA 3VGTA 4LF7J 3MD1A 4UTGA 4KGVB 4O44A 3VAKA 2NUHA 2ZWPA 1FWKA 1TKDA 3V4IA 1TK8A 3TEGA 4USVA 1XNQF 2FUG9 4USHA 4ED3A 4K0KF 3M9OB 1AZSA 4PPZA 1QTMA 2G1HA 1BUXA 2NZCA 1TR0A 4J9UE 4JI5F 4B02A 2R2SA 3BBCA 2V68A 1OO0B 3S7RA 3V5RA 1FDBA 1HQUB 4NLDA 3AOAA 4NLGA 1TL5A 1NJZA 2IVYA 4J9SA 4A8XA 4QWAA 3BO3A 1SUQB 1F9EB 4HL9A 2HHHF 3JQKA 4LUBA 1N32F 3CD5A 1HR0J 3P8BB 1S0OA 1U1QA 1VMBA 4ED6A 3P4UB 1T9YA 3I55S 5ITHA 3EXYA 2GA7A 3SCLE 1LXJA 1GH8A 4RW9B 1S6UA 1R6YA 2BZ2A 1HBNA 3HHKA 3J7YI 4F3MA 5KFEA 1RXOB 1Y3JA 1S0VA 2MQ8A 3CSKA 1ZETA 2QC3A 2P9CA 4Y6IA 3WBZA 1UFLA 4ELUA 4L3KA 4DUZJ 2GCFA 5J2PA 3OXFA 3VZIA 2VZ9A 3CJ2A 1VGYA 3MR3A 4JV0A 3W65A 4DX8H 1N33J 3V6KA 2NXJA 2X51A 2J0SD 4PWDB 3F41A 5I42B 3T5LA 4LFBF 3FBCA 5IM0B 1T94A 2YVSA 4YS2A 1PO6A 3TJ9A 3UCUP 1HD1A 3GIRA 3GR1A 3NKYA 1QSYA 3GMGA 1HQ2A 3ETMA 4RNFA 4HYKA 4OX8A 3D0GE 4DBQA 1FHTA 2UXDJ 4NLYA 4LFAJ 5LMNJ 2DGQA 5DZ6A 3KJVA 4CLZA 5RUBA 2H4WB 2MZSA 3PYEA 3DGVA 3PX0A 4WZQA 3CULA 3MR6A 2U1AA 3C8YA 4YB6A 4LF9F 3I0SA 3PG9A 3NL0A 2MKSA 5H9FJ 2GZOA 4JYAF 1NCLA 2D3OR 1QSSA 1Y10A 1VRTA 1C4AA 1XR6A 3TAMA 3PW4A 2WVBA 2CQ0A 2ZDOA 1VQ5S 2JWNA 4NCBA 4C48A 4F36A 2MHNA 1LEOA 4ZCMA 2CUYA 1RT6A 3M9NB 1I94J 1JLGB 3BGLA 4DSFA 5A8RB 9ATCB 1U25A 1NB2A 4MIWA 4X4NA 1S59A 2QO3A 4H4OB 4ER8A 3OHAA 4F2SA 4LF8J 3IR7B 3EDQB 1U49A 5IC6B 4RO0A 2C2MB 2J9DA 2DRBA 1MMDA 1KTVA 1LW2A 3Q24A 2Y9HA 1QAJA 1RT3B 2LEPA 1VISA 3FZBA 3IM9A 1JXLA 2XMTA 4CYUA 1NJIT 3MFHA 3AODA 4FS1A 3OTBA 2W9BB 2E1MC 4ZP7A 1Q8IA 2OH2A 5KFTA 1KTQA 2RF2A 2G4BA 4XO0A 3SFGA 1VQ9S 3MTKA 4HH1A 3U1MA 2XI3A 2CQ3A 2HFVA 5F8HA 4R5PA 2MSTA 5A8KA 3H0PA 2J7WA 3NOGA 3K5NA 3QT8A 3QIPB 2MKYA 1NH7A 2R4FA 3HHLC 2AHOB 2ALYB 1LWFB 1U26A 3H5YA 1MN7A 1U24A 4CLSA 3CIZA 4BWJA 2ROEA 5E7OB 1ZH5A 3DMJB 1YJNS 3G8SA 2KG0A 4I69A 3BBFA 3I96A 5D8HB 5MAOA 4YDDB 2V0NA 3FC9A 4ANEA 4UOCA 1RAJA 1KNZA 1FRIA 5M2UA 1R8BA 1JJCB 3HZEA 1S97A 1LW0B 4JI0J 4S0MA 2XTJP 2DITA 7FD1A 1HWKA 5KFBA 2HAIA 3KNAA 4ECWA 1JJHA 5IQ6A 3MEDA 2OPRB 4WCEQ 2ZD1B 1YJ7A 3SQGA 4DFJA 2R7XA 2CPHA 4QBUA 1FVQA 2ROPA 4NCGB 3CJKB 4CLYA 4WIIA 2CQCA 1UA1A 3HULA 5A8WA 5F3TA 3MM5A 9RUBA 1CQMA 4ZVGA 2PI4A 2F8MA 3W5YA 4P9SA 4F3QA 4PG8A 2XY6A 2WCXA 2J9CA 5KFJA 4WU3A 2DH9A 4RBVA 1LWXA 1B0TA 4KGKA 1Y3KA 3KYLA 2ROGA 1D8ZA 1CPZA 2CVIA 2YKAA 2GHPA 1UAWA 4UOHA 1VQYA 4IKAA 3D0HE 2ZC4A 5DG8A 3UNYA 1JQGA 3I0RA 2HHWA 5E41A 5L9XA 4AL5A 1DFDA 2R8GA 3QBCA 4K5SA 1HNIA 1NXIA 2HWTA 3GIIA 3IG1B 4OZ5A 2GW8A 3WDOA 4C8ZA 1DTTB 5FIIA 2BM0A 2D3UA 4NXMF 1OSCA 4DR4J 3W63A 1JLQA 2H5EA 2ZH2A 2CAJA 1SIZA 2C3MA 3M1VA 3HDSA 1SCJB 3VVUA 5K8PA 1EP4B 5L1KA 4JI7F 3M2RA 1RTHB 3DN9A 1N52B 4I7FB 3HKWA 4IH7A 4B3RJ 5CA5A 5F8LA 1HIYA 2J0WA 3M8QA 1FXRA 2HZAA 2RQMA 4BBYA 4CCHA 3QQCD 3MEKA 2GIRA 1ZAWA 1UVMA 1U7LA 4IOBA 3ENAA 1MNEA 2XNQA 3DM2A 3GSIA 2YKMA 3WQPA 4LQ3A 5K14A 4O3OA 3PX6A 4LQ9A 4I2QB 3ZTQA 4P71A 2ZH7A 3A8JA 3JXOA 3MMCA 1SL2A 5KFSA 4LF5J 5G4DA 5L1JA 4M5GA 1XNRJ 1U1KA 4TY8B 3DLBA 4QIEA 2XHCA 1DBDA 1CJVB 1M0SA 4F0KA 4ILLA 2VQFJ 1BQNA 3ZTPA 3JS9A 4IFYB 2JLEA 1CLFA 2KM8B 2DNZA 2HHQA 2BANB 2VIHA 5F8GA 2EI5A 3DRRA 4J9OA 2HIQA 1HBUB 1IBMF 4LF2A 4DCOB 2IAJA 3T5HA 3CB4A 2DH7A 3DI6A 3HCXA 3FEYB 4KAIA 1F5BA 2DR7A 5KFFA 3MAAB 2DIUA 1D3WA 2X3DA 5IXUA 4FN5A 3JQJA 4NI2B 1RU2A 2DXFA 2ERRA 2ZOFA 1G2EA 3IBFB 2FD2A 3J7Z5 1H72C 3IXQA 3CJTA 1X4EA 4ICLB 3GYGA 1BQMA 5I3UB 4R8UB 4OV1A 4F0HA 5IS2A 1CS4A 4QJVA 3GV5B 3N6NA 5ETPA 1KDNA 3H42A 1OPZA 1KR4A 4LR8A 2DJWA 1RU1A 1XMQJ 2WW8A 1HI1A 3C19A 4C11A 3D1OA 5JMNA 3AB4B 4DCPB 1SC4B 3OLAA 3ZZRA 4J37A 4ZVSB 1U2FA 2CQ4A 2HHPA 3W2VB 1WKJA 3R7NB 1TL3B 3JYTA 5EDWA 2UZAA 4JI1J 4WFAQ 3OR1B 1YBUA 1DZ5A 5BXIA 4DR3J 3IS9A 5LXYA 2AIRB 4X4SA 2CJAA 4ECVA 3VCDA 3TA1A 2VONA 3BR9A 1RT1B 1MU2B 2UUBJ 4K5RA 3CCZA 1XERA 3NWRA 4O0IA 3PXGa 2LEAA 4PKDB 4J90A 1VQPS 2HNYB 2IPOB 2KG1A 3PYFA 2EC0A 2W7AA 3MF5A 3MUVP 1OMSA 4DV4J 5KFAA 1XWLA 2XULA 4NWBA 3QWPA 3IWLA 4X64F 2R2RA 1G1XA 1HWLA 1A6LA 1RA7A 2RUSA 2VFTA 2CADA 2FJAB 3QATA 4PWWA 4DS5A 2FJEB 4K4YA 3Q8YA 1T03A 4AT1B 2DNLA 2ZH8A 4ZCIA 3MMAB 3NBPA 4K4TA 2C2EA 1FX2A 3PJXA 4Y65A 1RWNB 2AU0A 3CCUS 1T11A 2PMHA 1NK6A 5A2QU 2KRBA 1Q95G 4IDKB 4EBDA 4G65A 2KFYA 1URNA 4AQYJ 5D4OA 3C16A 4BWMA 4B3MJ 1H73A 1U8SA 4CH1A 5F8JA 1NUEA 4JI6J 3QRRA 1FJCA 1XJWB 1ZZFA 4CQ1A 4ZS6A 1I1GA 1HHTP 3BGOP 4TYBA 1TKTB 2ZITA 1FKPA 2QMUB 5KFXA 1HQUA 1MWYA 2PFFB 1FFSB 2HK3A 5J2QA 2ACMA 4NMLA 1S9EA 3I4HX 4X4RA 4I6WA 4NRTA 1NJXA 2H4YB 2GJ2A 3PKYA 4HH0A 4ED2A 2UVVA 5GVQA 4RR5A 3C14B 2WK4A 2CNKB 3G82B 4ZA1A 4F50A 2K1RB 3UDEA 4WFNQ 4BLGA 2D41A 4KSEB 4ID5B 1NDCA 3HHLA 2VV5A 4ZP8A 2A2DA 1E6YB 4LF7F 2H65B 2YWFA 4JB8B 4P75A 4TKTA 2KKHA 4FYYB 4X4UA 3ADAC 1M5HA 4UW2A 2RMLA 4IH5A 1HPZA 3R9LA 2OFHX 4ZCLA 4Z7CA 2NSBA 1WG5A 5F9NA 3L09A 4WFYA 2IJFA 2UVWA 1CJKB 1RACB 2BW2A 1Q7YT 3OXGA 3FK4A 3PEJA 3R5AA 4UT4A 4M1KA 1N5TA 5I42A 3MUTP 1U1RA 1VIOA 3KK2B 4A8OA 4OYWA 4DX6A 3J81Y 2AD9A 2E5IA 3G6YA 5H9FK 2CJQA 3OVBA 1VDHA 3UCZP 3BN4A 4DU7A 2Z2YB 2X3GA 3MEGB 3ZO7A 1JLEB 2M2BA 4RUBA 4LRFA 3W9JA 2H51B 3KUHA 2OTLS 1MN9A 2ZEJA 5D78A 2K7JA 4M5KA 4YHHF 4QYRA 3B78A 3PO5A 4HTJA 4DL5A 1SJRA 1VQSA 3MTJA 3KDOA 4N41A 3F0NA 4AL6A 1X60A 3DC2A 3L7UA 4DSIA 1X4BA 2XMUA 2MYFA 5CYMA 4FYVB 4DFKA 2R8JA 3I87A 4K7QA 2E5LJ 6FD1A 3FCVA 1VRUB 1VC6A 1N0UA 1WNEA 5H1SV 2B7BB 3QAUA 1CEZA 1N33F 3RW7A 1ACMB 4ECYA 2VC0A 4DF4A 3GG0A 3MPUB 3MOZA 4OYZA 3R2DJ 1HYSA 2A2CA 4M5JA 3A3NB 1RTJB 4ZJOA 4DEZA 5FD1A 3CMAS 5T7LA 1S5ZA 4WTOB 4QR2A 3CJRA 5FLXU 5KT5A 2CQDA 3LP0A 3SCKE 2D7SA 2ZJQQ 2W4CA 2PMWA 2W9BA 3D66A 5LMNF 1RE1B 2WHOA 4K4SA 1PILA 3EMTA 3I9V9 4JI8F 3BGRB 3LWMA 1WEXA 2B9XA 2FIUA 4PABA 4R0EA 5KT6A 2EFPA 3OBIA 4B3OB 4KH0B 1VLYA 1UP1A 2V2ZA 1ZM3A 1FE0A 3QJPA 2CPIA 1T05A 4FF1A 2PA8D 4WE1A 2FDNA 1LWFA 1GK8A 3D7SB 1OJ4A 2EFGA 3QLHB 3EE3A 1KS2A 1Q78A 3DOMB 1Q79A 2HSEB 3BQ2A 3W66A 3DMJA 4MH8A 1NDLA 1KBRA 4F26A 1QAIA 4HT7A 3QAEA 2F63A 3A3OB 3CMES 2P2CB 4JI2F 3JTPA 3J80Y 2DXDA 4M8LA 4WIQA 2L08A 1KVKA 1U4BA 3QIDA 1IR2A 2CWXA 2DNYA 2XO6A 4X4QA 4FBUA 1HW9A 3THTA 4OZ2A 4ZPVR 2C2KB 2CZ9A 2OPRA 2IVFB 2ZE2B 3W9IA 1N8RT 1WJ9A 2XMMA 2WSFC 4HHJA 3GG1A 4ZVRB 5F8NA 2YTCA 1VQOS 4IO1A 2RQ4A 4JOUA 4RUCA 2VJVA 4I0WA 5HVFA 4DR1F 2IMOA 2G0CA 2MQOA 5ETOA 4KGMA 2QL7B 3GCWP 3B4MA 2BE2A 5DJBA 1NZ8A 2KU7A 2PD1A 2XS7A 1RYRA 4NLOA 1EHWA 4RW8A 5E3CA 5EWGA 3A13A 1HMVA 4P74A 2YKNB 4B3SJ 4PQUA 1FVSA 2J8AA 4C8LA 2NPIA 2EKYA 1LQ9A 3M6VA 4C3KA 3IG1A 2WZ1A 2L48A 4EBCA 1DTTA 5CYQB 2U2FA 5B7WA 4AUKA 1BMQB 4UUWA 4DR2F 3BS9A 1KSPA 1FKOB 3UN5A 3LP1B 3DU5A 3NLCA 4QOTA 2V69A 4DDFA 2E7VA 2A6MA 1UPMB 3BM7A 2Q1LA 3ENVA 1TL7B 2QT7A 2QMWA 4FYWB 1RTHA 4I7FA 3SMZA 3JSBA 3CC4S 1N36J 2PFDA 5ETKA 1NBEB 2JFDA 3PCOB 1A7GE 4P2SA 2C2ZB 2MTLA 2M8HA 1T0TV 1NK9A 4ES2A 3V4MA 3IAS9 2QGFB 3UNGC 1HQEB 1W2IA 3HMJG 5L1IA 3BB5A 3EUNA 2PC6A 3FQKA 2R7OA 1F3VA 5KG7A 3ET6A 4I2QA 4LSNA 2IM1A 5AE1A 2ZNYA 4GO7X 4CIOA 2Z58B 4ZLJA 4ZP6A 1RHJB 4HKQA 3PTWA 2DGVA 3K57A 3SFUA 5LT5A 2VG5B 1R27B 4DZDA 4M95A 1ZM9A 5D77A 4TY8A 2Q66A 4FF2A 1SJ1A 4ZJLA 1CJVA 3OTDA 2DBBA 1X9WA 1FNMA 5E3AA 4TQRA 2BANA 1TKXB 4USTA 4H54A 3UE2A 2ILZA 4ZVOB 3GJTB 2DISA 5B08A 3G86A 3MM7A 3FUYA 2VC1A 2GFFA 2XMVA 3T41A 4OMFG 3TUJC 3MAAA 1PC4A 2V9KA 4Y2AA 1BY9A 4NI2A 4WJBA 4E8UA 1GTEA 4CI0B 3M32A 1FFGB 3AD9C 4GKJF 3R7BB 3FRZA 2EFNA 1ZA2B 2AYBA 1UA0A 1D09B 3ZZ0A 4CWBA 2EK1A 1B64A 3HM9A 4E0DA 1NSQA 4J9LA 3N01A 5SUHA 2W4PA 3UR0A 2ZBCA 3TO8A 2IC3B 1LNQA 3N5FA 3NNAA 2RKIB 4OI0A 5IT4A 1S6PB 1GAOA 3W3SA 3UO0A 4NLSA 3CCES 3QJJA 4OHYA 1YJUA 1PSDA 3D0IE 1EB0A 4LF5F 1RTIB 2W9CB 2E29A 1WF1A 2HFNA 5GADI 3GZ7A 1LWEB 5CABA 4OI3A 4F2RA 1HNZJ 2VQFF 3MOJB 4DXLA 1V3RA 2NS1B 1RWWB 4JI4J 3ILIA 1HD0A 1DQ8A 1RCXB 2IJNA 2CZ4A 1SVDA 4ECQA 1RAHB 4CH7A 1MU2A 2AEFA 5I3QA 1YG0A 2HAFA 3DDIA 3CEDA 2XCAA 2F5GA 3K0JA 4HACB 3PM9A 5L8RC 2HNYA 5HK4A 4OZNA 4JI3F 1JNRB 1IKXA 3KLVA 2VBYA 2EFOA 1WC4A 1HBOA 2E9ZA 2WOMB 3OD2A 2NPFA 5MLCV 5KFLA 2HURA 1UWBA 1VBZA 3WX8A 2GMLA 2D74B 3ENQA 4DV5J 1YK9A 2B4VA 2ZBIA 4WP8A 4V19J 2QTWA 4YB5A 3M8PB 2AEJA 3W5ZA 2EFVA 3OR2B 2JRSA 4N8OA 4K4WA 1WTBA 4A8SA 4CO4A 1SBRA 5ETSA 1YJTA 4NLWA 2C3PA 3P6YC 4PAAA 2JVRA 2RNEA 4WTYA 2XSJB 4M5IA 2OHDA 2O67A 4IDKA 4DV7F 3H7HB 2DNGA 1N5QA 3PV8A 2IM3A 4GVBB 2GJFA 1REVB 1OIAA 4DQIA 4MKYA 3DNCA 2FVRA 5JVHQ 5GMDA 1GMWA 4HLBA 2WONB 2RJZA 4IRCA 1TKTA 4NEZA 2GIFA 4NA3A 4PUOA 2LA6A 1UZHA 1SKWA 2GQCA 1TUWA 4CLKA 3TR5A 1IVZA 1JB0C 4IQMA 4MFBB 2DNOA 2D3ZA 4C3MA 1YQHA 1RT7B 1T02A 2RIJA 3TUIC 3UI3A 2E9TA 1HL6A 1JXEA 2KI2A 5KFQA 2MQMA 3C14A 1HNXJ 2WBRA 2HHUA 1NSKL 3G82A 2XCPA 1RAGB 3O1LA 4KHRA 1PYTA 1UTAA 2ZHOA 2OAUA 8ATCB 1R7IA 3G87A 2V2QA 1E6YA 1RP5A 5DO2A 3PYDA 4C2MA 2XMAA 3I9ZA 3MCSA 1JLCB 3G9CA 3MPVA 3CGIA 1UFWA 3DHWC 3IFEA 5KFZA 4CLWA 1IJFB 4AQYF 1UWAA 4YY3J 1ZTTA 2B3TB 1I3OB 1IBKJ 1C0UA 4OI2A 2BJ3A 2AYEA 1CJKA 2X1BA 3RJMB 1D1UA 4CTAB 3VVTA 3T1HF 2PEHA 2DNNA 1C4CA 3PR4A 2I6WA 2F3JA 1WSRA 4K8RA 5FDLB 1SC3B 1A9NB 1LFWA 2KXNB 3VZHA 3MM9A 1RYSA 3LWLA 2X7IA 3FSYA 2MB0B 3EZ5A 5DLGA 3MEGA 2RH3A 3ICLA 1XMOF 4ETXA 1NB7A 1S10A 3CC7S 2J6UA 2C1EB 5KFGA 4UQGA 3JSMB 3DFEA 4WXWA 4FPIA 5L9NA 2Z56B 4J91A 2XB2D 2FVQA 3QSIA 4YB7A 1I51B 3PW7A 1QTNB 3NGRA 5IT9U 4DSJA 3DOLB 1HI0P 3EM1A 1YKWA 3O5TB 4RU9A 5CAAA 3D3CJ 4CNYA 3RAXA 3CNQP 5J2MB 4O3QA 3CVKA 3FFIB 3CD6S 1VRUA 4A48A 4F4WA 2FY8A 4I2PA 2I9SA 2R2TA 5D0EA 3FNNA 3ZNUA 4OYMA 4DWIA 4M5HA 2M4MA 4BC7A 4OI1A 2JX2A 1NO8A 2R42A 1KOHA 3WC0A 1H0HB 3CCRS 4NYOA 3V6JA 4O23A 4P7VA 3Q8VA 5B09A 1TU0B 5ETMA 1BE4A 1W26A 1VI7A 2HHHJ 4YB1P 4TY9A 1N32J 3MECB 4C0HA 3SCJE 5EUHA 2VG7A 5KOWA 4NLTA 4HDHA 1Q81T 5CD4A 4KFBB 4ED0A 3DRPB 4F04B 1FWPA 4FVMA 1U45A 2QLXA 2L9DA 3HVWA 3G96A 2L9NA 4KPCA 3ZZOA 2HZCA 2OMLA 3EX7B 4GRSA 2HHXA 2DNKA 1PIEA 1UW4A 4B3OA 2H48B 4LRBA 3CC2S 1S77D 1S57A 4QIGA 2H1YA 4Q0BA 2C2DA 1K8AT 4KH1B 3BZQA 3E2EA 4MKVA 2I8EA 4Y00A 2UV8A 4N47A 2BOPA 1AFIA 4C3LA 4B9UA 3M30A 4X4PA 2LLZA 1SQEA 2ZOMA 3DDKA 3M2VB 1ZOTA 4EK2A 1Q4RA 1F5CA 2HIYA 3QO9A 3VQTA 3S8SA 1HWIA 3UWTA 2SXLA 5AE2A 3RUBL 1FRJA 4G1PA 1D8YA 2FVPA 2E1CA 1VBKA 4WF9Q 4JV5J 2ZE2A 2NXNA 4RW4B 1T9TA 4LJMA 1KKHA 1RAOA 5EN1A 1Y11A 4XAKA 5C24B 2FZCB 3S01A 1Y7PA 4KV8B 3KG1A 4LF9J 4OZ0A 1LWCB 1KN6A 1UKUA 2DPJA 2I5JB 4JYAJ 3ZTRA 1TMMA 3OT9A 3T1YJ 1XC9A 5BR8J 4I1TA 4XTTA 3RBEA 3R6LB 4Q44A 4RW6B 5JVGQ 4O3PA 4N5SA 1RTZA 3SBMA 3CDAA 2HQIA 5T41A 3A8KA 2F4VJ 2YKNA 3EWGA 4KB7A 1FCAA 3DLEA 2ALZA 1U47A 4N77A 1B3TA 2WAQD 3S1TA 5KAKA 2QRRA 2FTRA 3KHLA 2ZWOA 2RQCA 4O0NA 4P2MA 4DPYA 2AV5A 1M1KT 3UDLA 3GJQB 2O01C 1TL7A 5D3GA 4O4GB 2KH9A 4FBTA 2KTQA 4P72A 2DR6A 3L95X 2ASJA 3PZPA 1SC1B 1UW9A 1GXUA 2B6AA 5ETRA 3NCRA 2CXEA 4WFXA 1P8GA 4EFAC 5CCMA 2XGQA 3R5CA 2R7VA 3ZZYA 4ZVQB 3E01A 5A0YB 4RBTA 1YX2A 1WEYA 1URRA 4FXVA 4DSEA 3M6WA 3MWBA 1E6VA 2BKNA 3Q2SC 2N4CA 1SIWB 2YQ0A 4H4KA 3CDWA 4DUYF 4NYPA 2HBYB 1ZPVA 2LQBA 2FGOA 5KG4A 1FI4A 4N56A 1J5OA 3C46A 3DOKB 3GE9A 1G7CB 1PKUA 3I32A 3BH7B 2EG2A 4DLGA 3G71S 3DXBA 3H2VE 5HJYA 3DGPB 3C6UB 3KLEA 3BO4A 4YR0A 3OTCA 2BJ8A 2BQ3A 3GJRB 1IJEB 4TU7A 4DQPA 4AXJA 3RB0A 1TKXA 3K59A 4TNOA 2QL9B 3HSZA 2VHGA 2FHMA 2AX0A 5KFIA 2XG8A 2V50A 3OL8A 2OD6A 4PYDA 1UJ4A 4X66J 5HQLA 5HVGA 2VKRA 1N36F 3NAHA 3K5LA 3Q8QB 2ZUGA 3OFHA 2DY1A 4U96A 4CH0S 1WG4A 4U7UD 3TAPA 3B82A 2FHJD 1ZS6A 3IR5B 1H98A 2J5AA 1W2BR 1WDDA 3CCWA 3EVWA 3OJSA 4AXIA 1S6QA 3I4PA 5KG1A 3HJVA 2IJRA 2F40A 1U2CA 3HO1A 3U7JA 3GIMA 5LJ5Y 2DHXA 4H4MB 3DU6A 3IRXB 2JEJA 5ETNA 2YQ1A 1EETA 5KG2A 2HVHA 4RUAA 1B0VA 3QGHA 2MGZB 2JSXA 1FJEB 5KFWA 2W9CA 5HP1A 3F56A 2BJ7A 3GP9A 2YH1A 5BYQA 3ILLA 4DI6A 4WU2A 1ZTWA 3D3BJ 2A0FB 2M0GB 4OQJA 4NXMJ 3M8YA 2Z30B 2Q6BA 2ASYA 2LCWA 2YX1A 3I31A 2ZJRQ 3NRBA 3C6TB 4JI7J 2L9WA 2GV1A 1NLKL 3AXKA 3KJFB 3NAIA 2K3IA 3C3LA 3JAMU 4OV6A 4USWA 2HGLA 1EARA 3MHYA 4ZHRB 3EJMA 1TL4A 4LRCA 3CCMS 5HQ8A 3HSJA 4HACA 1NHUA 3JQMA 4YFUA 3I6PA 4U6PA 2AW0A 2GAHC 2NXUA 2YWKA 2KB2A 2GC8A 1N5VA 3GQCA 1FRHA 2WOMA 2HMIB 3OTEA 2VBXA 2R3VA 4LRDA 2YKOA 4C97A 5EWFA 1KQGB 3IO1A 4PXCA 1WD6A 3BSOA 1FNXH 4J7CA 4LIRA 2I38A 3KJQB 4USKA 3M8PA 3OR2A 1IKWB 3DLGB 1R8PA 4A46A 2AMCB 2CJYB 2NXEA 3SV4A 5F41A 1NMEB 2C2NA 3D4JA 4Y2MA 1SV5A 3TNVA 3ENWA 3KMSA 1C1CB 2WSCC 1VC5A 2F8EX 1RWOB 2IM0A 3DKDA 2ACYA 4ENOA 4GMKA 4CP5A 3NMRA 2V34A 2OFGX 4KR0B 1LXNA 4EU0A 5J1PA 4OLOA 2BOAA 4L6V3 2D3O1 2R7SA 2DR5A 1FEEA 3Q23A 1FFWB 2VDHA 2ABYA 1FDDA 1YZ7A 1L3UA 2HS4A 5HLFB 5E3QA 2YKPA 4UOGA 2ASDA 5KG3A 2DRAA 4MFBA 2W1BA 3M9MB 4WZMA 2HNZB 1RT7A 4FNIA 3SDEB 5E3PA 2D9OA 1KHVA 2V8HA 4CO3A 5LM7E 1S1TA 2XBPA 3LF0A 3J7YU 2F65A 3PHEA 2J6TA 5J2NB 3CD0A 4NA1A 1JIHA 3E3XA 2DGUA 1TZ0A 2PA3A 2UU9F 2AJQA 2LKZA 1DARA 1XR7A 3BSAA 2XEXA 4LF6F 3Q8UA 1PAEX 3GYXB 1BQXA 3BDPA 3LP2B 5CCLA 1RDRA 2RRAA 4KBIA 1S1WA 1MSWD 4DN9A 1GX6A 2BABA 1OQ6A 3KNGA 1IKVA 4ZP9A 1O6XA 6FDRA 1VS3A 1N5SA 3DLLQ 4Q5VA 2MQPA 5DLFA 4IG3B 2DNHA 1YITS 2RVJA 3DRXA 2FY1A 2NQPA 2VOPA 1APSA 1U2RA 4TLRA 5KFOA 3AQPA 2ZZNA 3KUEA 2QEXS 5T14A 1U1LA 4YN3B 3CMQA 3LGHA 4F4XA 1FD2A 2KXFA 1KLNA 5C5JA 4USUA 3NCQA 4MIAA 5FDLA 4X64J 2F9JA 1ZM4A 1DAXA 1O51A 3W60A 1Y4ZB 1S7IA 1DTQA 1UEKA 4X4VA 3H5XA 2P6SA 3J81j 3AQOA 3TAQA 1T3NA 2QA4G 4WWSA 5CYJA 4DL6A 3H25A 1RHQB 5HL7Q 4U7UK 3HVTB 3DOLA 5KT3A 1K47A 2EC2A 3TARA 1K9MT 4DUTA 2OEKA 2MQQA 2C42A 2RQKA 2HVIA 3A1YG 2BUNA 3CJ4A 4ZN1A 3UDCA 3TJ8A 2Z2ZA 3K8WA 3PX4A 1S9GB 2QA2A 2FZKB 5HMXA 1V3SA 2AQ4A 4CM0A 1DQAA 3L4BC 2ZC3A 2LQ8A 4OHVA 4DQRA 4HI1A 4KGZB 1WOPA 2DHGA 3M6XA 2HNDA 4P6QA 1GXTA 4KPYA 3W1YC 3TA2A 2CA9A 1T9XA 2Y1RI 3H4BA 2GIQA 3CO9A 4I67A 5H9EJ 2J6SA 1VK8A 2MQNA 2KO1A 3MECA 2HVEA 2HQFA 4B9TA 2FGCA 3AHPA 2FJXA 1WTFA 4UQTA 1RWMB 2H54B 2JJ4D 3FCWA 4CM2A 1YWXA 1WHVA 4Z2XA 4YR2A 2BJ9A 2D1CA 1PJ5A 3V6DA 1T7PA 3BYRA 4LSZB 4I6YA 2H5IB 4J9QA 2O1PA 5K20B 1EQMA 2G0JA 2OD4A 3LA0A 2JFKA 3MCOA 4O4RA 2KYZA 4AD6A 3NMAA 3IRWP 1J5EF 4IG0B 1CJTB 3CXCR 2HRYA 1GQEA 5DZ7A 2F4FA 1GTHA 4F8RA 2HW3A 2K06A 1M90T 3TANA 1ULRA 1D9AA 1X4GA 2W24A 4ATNA 2Y1IA 2LQ5A 1X5OA 4EMDA 2IRUA 2AZ3A 4DG1B 4N8NA 4QIFA 4RW4A 2QG9B 5HROA 4XDDA 2I2YA 2R2UA 3V81B 2KL8A 2VFRA 4L73A 3CCSS 4YHHJ 5GMKa 2QV6A 2EG1A 4KV8A 4Q2MA 4PXEA 1LWCA 2MSSA 3PO4A 2FJBB 4A8YA 2OPSB 5B0DA 2VICA 3TA0A 1SH2A 3BGFA 1RHMB 5E5NA 3QT5A 1FKAF 3GFZA 3BQ0A 3IBCB 1RKJA 2FZGB 5KFVA 2G2ZA 4K4VA 3DHXA 5ADZA 2RUGA 4UY8T 2DR8A 4U9RA 1UFKA 2YWGA 3AA8A 4WYWA 1RUSA 4TU9A 3BSNA 4A8KA 1IUJA 1RZMA 1VOMA 5J1EB 1AUDA 5HBMB 1O0PA 2CPZA 4U95A 5B0CA 5HJXA 4NLPA 3R5DA 3ZTOA 3OUYA 2JOQA 4DR6J 4CO5A 4JV5F 1S4EA 2AYMA 1TV6B 2MY7A 2LFVA 1JXVA 1HNVA 2CYYA 1R8AA 1IKYB 4PZVA 4QCLA 4JI8J 1N88A 7FDRA 5K8NA 2OTJS 1X4HA 4DV6F 2DKOB 2NLWA 3DXSX 5IWAF 1ZM2A 2DEIA 2KJWA 3R1HA 1TVRB 5A0YA 4USIA 4K50A 3T1YF 3GTYX 5BR8F 3PIOQ 3KLIA 3EZOA 3EDRB 5HATA 2XNRA 2F4VF 1X5PA 4URSA 4EUVA 3M2UA 3C15B 1YGYA 3NY0A 2YNFB 4PR6A 1VQ7S 2J8SA 3DGPA 4JI2J 5J1NA 1AYEA 1IR0A 5I4MA 1QSLA 2FB0A 2JEFA 1C1BB 2YX7A 1JLBA 4DV3F 3V4IB 1QAXA 2ZH3A 3W64A 4HHUA 2FJDB 3BKTA 2F1FA 1BXNA 2JNJA 2XSFA 2EXUA 2E7XA 2KXHA 1AZSB 1S99A 3TQEA 1RHKB 2R7WA 4AL7A 2QA1A 4DR1J 5L38A 1P9YA 2ADBA 3Q83A 1NZAA 4B3TJ 4DV0J 2W01A 1J2VA 3K8VA 2Y8WA 3OVSA 4FZVA 4C98A 3BPSP 2RB7A 2Y0BB 5EX3A 2KT5A 2KT3A 4NLVA 4CT9A 3U1LA 4W90B 4QWDA 2HWIA 3SXLA 4NX9A 2BQUA 2OEJA 1I6JA 2B5JB 3A8IA 4ILMA 3U02A 4TLQA 3TI0A 3OTOF 3M7VA 2Z2LA 2P9EA 2DIVA 3JSYA 3OW2R 2CFXA 5C42B 2VG6A 4DR2J 3G4SS 4L74A 1TL1A 2OSRA 4OX9F 4ED5A 2B4UA 3AAWB 1KQSR 4DX7A 3C6TA 3PJWA 4I68A 4DFPA 4RKUC 1P9QC 2VF3A 2WB1D 4X66F 2OPQB 2GHVC 4ZHRA 2HWHA 1TFWA 1V6HA 2K3KA 7AT1B 3QSYB 2ZVSA 3SV3A 1UJ6A 2Z8QA 1EQ0A 2MZTA 1JLAA 1H74A 2ZH1A 3AXMA 3MMJA 4F7VA 3AJ1A 3KG4A 1Q7LB 3OFEA 3KLGA 3P45B 2HMIA 5KT7A 1VRQC 3NS6A 2OGUA 4ZVHA 3OHBA 4ZIVA 4JUZA 3C66A 1TUVA 2BYCA 1GNKA 1QUPA 4PYAA 5LSLA 1K44A 4KHMA 3CCLS 4OYAA 1KVIA 4ECRA 4YR3A 3PR5B 1F9HA 1Y5NB 4FS2A 4B9MA 4C8OA 2MLXA 1C1CA 3PRBA 2OELA 3GFYA 1VBYA 2AGPA 3TAMB 4BHQA 4ED1A 5DS7A 3KJNB 1RT6B 2GO9A 4A8QA 2JHEA 2OUGA 4B9LA 4NZ6A 1S76D 4EBEA 4GKJJ 4ZPWR 3TX8A 4XPEA 3MUMP 2OJ3A 4B9VA 3CDUA 2V8PA 3VQSA 5I3PA 1SI9A 1IBCB 2V9WA 2IY5B 4ZVEA 2ZH6A 3MURP 3QMQA 4K4XA 2CJ9A 1CC7A 5IOLA 3O44A 2DRDA 5A6PA 2ZJPQ 3AJ2A 2FPHX 3SDEA 1OQ3A 2MHEA 4HEA9 1TK0A 3J7A1 1PJ7A 2B43A 3DLHA 1B4SA 2KDOA 3KLHA 3VGUA 4WP9A 2XMWA 5J2NA 3PVXA 2HFSA 1OPIA 1V9OA 3T5JA 2BX6A 4NASA 2CPYA 2NCKL 2RF2B 1UVLA 1L3SA 2N3OA 5DGBA 1J27A 2W4DA 3QNWB 1S79A 3NGDA 4ZDNA 4R5PB 4ZVPB 5A8KB 2UXBJ 1FE4A 2R7TA 3IM8A 2GQQA 1PYSB 2RDDA 2IBOA 5LXRA 1U6FA 2XC9A 4HVZA 2BW7A 4KO0A 1FESA 5AXNA 5C2GA 5C25A 1LOUA 4DPTA 2BV3A 2ZNZA 3ISND 3D6HB 4NEYA 3T1AA 4UY85 3ZXWA 2MZQA 4IG3A 3BGUA 2E5GA 4JI3J 2PN6A 2FJWA 5B0FA 5CXTA 3SIPB 4DV2F 1M1GA 2CPJA 2Q6CA 3Q86A 5JUMA 1N5YB 1D9FA 3IN5A 2B51A 1QY7A 3MEDB 3CO0P 1T9VA 2XWXA 1WC5A 4RBUA 1VYAA 3SQGB 1MROA 1ELOA 2CIMA 5KFPA 1CULA 1Q16B 2YNGB 4OZ1A 3D5MA 1RBAA 5HMZA 2V4JB 1NK7A 4LSLA 2JEGA 4DV1F 3Q8RB 1S1VB 1Q8BA 2J7KA 1R0CB 3AFGA 1F6TA 1FTCA 4J9VA 1XR5A 3NNHA 4DV7J 1K0TA 3KK3A 1GMVA 1Z2ZA 3OSNA 3MMBB 4WPAA 5BJRA 3R6GB 5LL6d 5H9EK 3SQOP 5HAOA 2YNHB 2J0QD 3VAGA 2HHTA 4YQWA 4V19X 2OI2A 2P9GA 2HVZA 1S9GA 2DNPA 1L3TA 5D4LA 8AT1B 3I0RB 2N82B 1RCOB 2AP6A 2XY7A 3HHEA 1KLMA 5LOQA 1HNIB 2X1GA 4ES3A 4K59A 3G6VA 3AB2B 1FJ7A 2C2OB 2G1DA 3CCJS 2IHR1 3HJFA 2LU1A 3F44A 3MEEA 3EGZA 1U1OA 1JLQB 4N76A 2A3JA 3M1VB 3FDSA 2FC9A 3LPEA 5DDRC 2GVZA 3TZXA 2GMJA 1WI8A 4DR7J 3K5PA 2BJDA 4J5OA 3M8QB 4MKBA 1X31C 2ZOGA 4DU8A 4R25A 3SYZA 2DPIA 4GO5X 2KYXA 4ZCKA 3TP2A 4RLEA 3EVMA 2DGXA 1RABB 2YKMB 3BJYA 4UOFA 1B7YB 1WF0A 3CWJA 4P10A 1DQ9A 1YZ6A 1V5VA 2EKNA 1P27B 3K89A 2KT2A 4BDPA 4X84A 1FT8A 4IG0A 1XQIA 3MMCB 2WB4A 4Q45A 3ZC4A 3H20A 3JSRA 2CQ1A 2KM8C 3VF0B 3N5BA 3UR3C 3T1HJ 4KYZA 5KG6A 1F60B 2VBZA 1NKBA 1FRXA 1S0MA 2WBMA 4ZPDA 2C22A 2H9ZA 1BQNB 2ZKTA 3NGTA 4DL3A 1FRLA 4LBHA 4RL1A 3OVAA 4Q2LA 1FK9B 3QJLA 1SUQA 1U1NA 4KRWA 1F3FA 2VH7A 4DG1A 3DRRB 1XMOJ 5IV4A 3N6LA 2IAJB 1MW7A 5KFMA 3PRDA 3E51A 3DI6B 4WFZA 1RADB 1ZA1B 2AWZA 3EYZA 1UEUA 4X4OA 1BD6A 4RW9A 2AJ2A 4FVCA 1U8WA 4PG5A 3UFCX 2FLNA 4ZPAA 4ILRA 1NDKA 5GAEI 3BF4A 2CG4A 1SKSA 1XK8A 4RU2A 4OI4A 1CS4B 2ZKUA 2AJ0A 2LMIA 1TUGB 3EGWB 2BRLA 1PC5A 2HYIB 1T3OA 2AJ4A 3DYAB 3CIMA 2FYXA 1IWGA 2DVIA 1PYOB 4PWDA 2XZTB 1YBTA 4NOHA 3SZ2A 2HQGA 4ZKAA 3J81U 5IM0A 3JYTB 3I5CA 2L3MA 1OYDA 5J1EA 2CG8A 1LK5A 2YBVA 2KVQE 3OL7A 3FVYA 4PQAA 3OV7A 1TV6A 2HK2A 3CJQA 3D28A 2JC0A 1IKYA 4ZIWA 4G1QB 2BJ1A 1N4LA 1SJFA 4FNHA 1Z1ZA 2XY5A 1H2TZ 4RW7B 3WZ0A 2UV8G 2KHCA 3RYLA 1QUVA 1TFYA 2HRUA 1FNOA 4MT1A 2M88A 3P96A 1AA1B 1KQFB 1RSCA 1D9DA 1WUUA 4HI2A 3JTOA 5AJ3F 1YVFA 1JLGA 3HD2A 1SQFA 4TU8A 4URGA 3THPA 1TQLA 4WYLA 1R89A 5A8RA 3O2IA 3C15A 4MYUA 3ZNJ1 2DNRA 3CF5Q 1IQZA 1U09A 2YNFA 1VIXA 4OYOA 4H4OA 3NBPB 2APOA 2IBKA 4NXNF 3DCAA 4DR5F 2V8DA 2YPZA 2CPXA 2C28A 1CSJA 3FRYA 5E0OA 3D1QA 3R7SB 1C1BA 1S1UB 1HA1A 2RD5C 2UUCJ 2GX8A 3CPWR 5BYSA 4QQBA 1RT3A 2DNMA 5IZHA 3IWXA 5CZXA 2IA6A 4DR6F 1EZZB 3C16B 1S9FA 1R6VA 3OPKA 3IP0A 3M8RA 1EX8A 1S0NA 4MKAA 2XLJA 1RJJA 2RS2A 2K8GA 4PXBA 1RWVB 3JB9k 1FKPB 1AROP 2XYPB 4NLQA 1FO1A 4OJGA 5HO4A 5J2QB 3QIPA 5G0RB 1S9EB 2AF6A 1RAEB 4MAKA 5KTQA 1UVNA 5GADU 4F3OA 4HDGA 2WVCA 4DPUA 2B5JA 4JV1A 2VPZB 4WXOA 1CBKA 4WKRA 1WSVA 1Q82T 1RGVA 2VUGA 1RT4B 5C42A 2Q43A 3HHLB 3X1LB 3J80U 1LW0A 2M7SA 4CZCA 3PKMA 2QX0A 2QZ8A 3V2UC 2ZHBA 1UVKA 1EAYC 2ZD1A 2RU3A 1UEVA 4NCGA 3CJKA 1HPZB 5C7PA 4EYHB 2WVFA 2OPQA 3N4WA 4DJBA 2GJIA 2IM2A 1FA0A 2EVZA 4GC6A 4X2BA 2UUTA 3CCTA 1OWXA 3T6JA 2MKCA 3NS7B 2GO8A 1HW8A 2CDRB 5BYRA 4B17A 4B9NA 4DZ6A 3J7ZT 4GKKF 4B3TF 4DV0F 2FLPA 4RUHA 5HVHA 3R5BA 3UQSA 2HHVA 2BRKA 4PCQA 5B0EA 2M9KA 3D6TB 4DUYJ 1TAUA 2J0XA 2GGPB 2MZJA 2ZBRA 3US5A 5AXLA 4DCJB 1FXDA 2LDYA 1PAUB 4RWXA 4EZ9A 4ES1A 3QFHA 2W2MP 2E5HA 3FJ2A 4CT8A 1CQNA 1G6BA 2XO7A 5CZVA 3FGVA 1R31A 4I4BA 4FYDA 5LJ3Y 3QGIA 3ILJA 1EP4A 3N9UC 3EGVA 3ULHA 3TVZA 1OS5A 5CYMB 2OPPB 4CDIA 1VR6A 2XM3A 2FQQB 1Y0HA 4CO0A 4YMEA 5GAHI 1M5OC 4DSKA 1VQKS 3HVRA 1D0EA 1RHUB 3NNCA 4O3RA 1VQ8S 2N7CA 4E2FB 5HMWA 1WKKA 4LVNP 3VGSA 2IRYA 1HYSB 4FKYA 1AFJA 4QYZJ 4LRAA 4M63A 2IIHA 1NJWA 1SC6A 1NK8A 4USMA 5T7LB 1KHWA 2KZMA 1H6KX 3HP6A 4LREA 1XEZA 1NPPA 1SQGA 3LP0B 4USJC 2GMHA 1X4AA 4ED8A 3NWGA 1SJQA 2CNNB 3H2UB 3LAMA 1R8CA 1YJVA 2CDQA 3K7RA 1LKZA 3F73A 3LGMA 4IFYA 1NPRA 4I56A 2JZ5A 5D15A 3GV7B 1Q5VA 3MFIA 1HBUA 3U1NA 5D0RA 1T05B 1IBLF 4OZ3A 4WE1B 3BV8A 2QSFA 2M70A 3OSPA 3QGPA 2QFIA 2WVDA 4P73A 1RWXB 4J9NA 1QJHA 3CUNA 2ADCA 2IYIA 4ICLA 4ZOSA 5I3UA 1S6OA 4R8UA 3PW5A 2AYGA 3Q22A 3VR1A 4EYIB 4TXSA 1HWUA 2DCUB 1N5YA 2OO4A 1PG5B 3I56S 4CLPA 1S4FA 1MMLA 2DGOA 2HBQB 4XK8C 2V4QA 2V5HG 4PRFA 4Z37A 1RT5B 3IWNC 3KKFA 5IV3A 2VASA 2YNGA 3W9HA 3HFZB 2KFZA 8RUCA 2B4OA 1R0AB 2V4JA 1VJWA 3W2VA 2MKKA 2UVUA 5E2QA 1HFEL 4Q8FA 1TL3A 1S1VA 2IVMA 3RTVA 2DHHA 2Z2MA 1KONA 4QWBA 1RWPB 3OR1A 4ETZA 2K2PA 4EEYA 2BE2B 5KFCA 3MMBA 1R43A 1X0FA 1X7VA 1RA6A 2Q79A 2UXBF 1FDNA 5K9FA 2C2RA 4FF4A 1RT1A 2ZH9A 3W2WB 2YNHA 4RW8B 3FBEA 1EJ7L 1HMVB 1X9MA 4NZ0A 3B6BA 4R0JA 3BEGB 4PQUB 4K4ZA 4MK9A 3VAIA 2MXYA 1AT1B 2KHDA 2DGSA 1NAQA 3AY0A 4XDCA 2UUAJ 2BR0A 2ZHAA 5KFHA 4A8WA 4DOZA 3GSDA 2ZM6J 3BQ1A 2HKEA 1L5UA 3TW0A 3P3DA 4X62J 2EFQA 3HLUA 4KHPF 3ISZA 2MKJA 4LR7A 2PO4A 4JP8A 2QA4S 4KTQA 1NU4A 4C0OC 4IUFA 1IXKA 3MMAA 4NYZA 4MTPA 2EWHA 3ETOA 4HT5A 1BGXT 3TZWA 2UU9J 4KY3A 1VQMS 3K58A 3JTNA 4J9RA 4H4KC 2EK6A 1WC6A 4FDFA 1B70B 4LF6J 3ET6B 3CJSA 4YOEA 3VHQA 4LSNB 2HS0A 4ZK7M 1SXLA 3RZAA 5D4PA 1X9SA 2O3DA 3LANA 3EVOA 2LEBA 1WC1A 1FJGF 5ETVA 5DG9A 1CVJA 3CCQS 4WKYA 5EHHA 5CD4H 2MPUA 3D68A 4LF4F 2ZBQA 2XMKA 2D9PA 1RBOB 1WKLA 1O5JA 1JMTA 1FK9A 4KC5A 4NZ7A 3BBBA 2VFUA 3FSXA 3I5BA 4M94A 2CQBA 1JK9B 4DL4A 2AZ1A 4Q43A 2RE1A 3HF5A 1GT8A 2RDIA 2V67A 3MM7B 4DR7F 1RAIB 3GV8B 3OL9A 2K1RA 3BR8A 3HI9A 2HLTA 4ID5A 1EIYB 2V8VA 1R0BG 3M32B 4ED7A 4F4YA 2YQ3A 3GIJA 2BVZA 3PFEA 1KFDA 1S1XB 2B8QA 5B0AA 2ZVIA 2XYGB 4MJKA 1M5PC 3K5MA 3D6FB 4YP3A 3KTQA 2UXCJ 2OEMA 2HG4A 2QL5B 2XWYA 1RAFB 2AKWB 3DYAA 3T9ZA 1F2GA 2YWEA 3LALA 3HKZD 2BKOA 4QPTA 3CD7A 3AT1B 4DL7A 6AT1B 2XGPA 1RQ0A 3KK2A 1N34F 2XI2A 4ECZA 1B99A 2MLZA 2C3YA 1VQ6S 5K8OA 2XQCA 1JKHB 4OJHA 3DLKB 3HVAA 1UZDA 2BBEA 2CPEA 2A18A 3QYYA 2CJKA 3A3PB 1YLXA 5KFYA 3I82A 4ED4A 5CH7B 4NLXA 1SL1A 3IAM9 1SH0A 1NEEA 4NLUA 1JLEA 2QFJA 1RB0A 4G1QA 1B7FA 2E5JA 4PEOA 2V2VA 2QLWA 4RW7A 1ROFA 3NGKA 1IKXB 2M8DB 3ITHB 1HBOB 1NDPA 4K2XA 4ANDA 3MR2A 2R7QA 3PNIA 1H2VZ 4A8MP 2FVSA 3GIKA 5F8MA 2LP4A 3UVJB 2E1AA 1J5EJ 3QFWA 1NKCA 2ZZTA 1Q8LA 5F8IA 1UWBB 1ITPA 4BCAA 4ZPBA 1M1HA 3BDEA 2RHQB 4IOCQ 4OI6A 4YDXA 1RI7A 2HBZB 2HBRB 4DMZA 2IRXA 1GXLA 3TYTA 5L46A 2KZZA 3MM6B 1RTJA 4PG7A 1QM9A 1S1UA 1YHQS 2R8IA 2LVWA 2PMZD 2D69A 3TOQA 5A2QY 1UMJA 3M05A 2VBWA 3DRSB 1X4DA 2HFUA 1P6TA 1DJ0A 3N79A 1DURA 2R8HA 2XYHB 1NRKA 3BGRA 5DM7Q 4NA2A 2PIIA 3GLJA 1S72S 2RU9A 4IFVB 2CJXB 4PUOB 1DLOB 5E3RA 2XS2A 1SJ4P 1IM6A 1YBAA 4Y2KA 3WC2A 5D6GA 1RT2B 3W7BA 5DM6Q 2CPDA 4XPCA 2R7RA 4G3IA 2IFXA 3VAJA 5G0RA 2DEJA 4LF1A 1PJ6A 3N0VA 3QLHA 4EWTA 1L3KA 4OYXA 3DOMA 1S7HA 4PXDA 5K5MA 3BREA 1IR1A 4D3HA 2ASLA 3H4DA 1KD1T 2NXCA 1ZAVA 1RT4A 2L41A 3V6HA 4JBCA 1TELA 4YUDA 1RLDA 1HNWJ 1H7XA 2LA4A 3IA0A 1EKRA 4EO6A 1ZAXA 3VALA 2B56A 2UUCF 4F02A 1Q53A 4ZJQA 1KVJA 4GVLA 5HMYA 5DQHA 5AXMA 4QR1A 4J9PA 1C0UB 1F0XA 4DV6J 4LMZA 2C3OA 5DQGA 4P7TA 3FQLA 2R8KA 5IWAJ 2CRLA 2DT9A 1UVIA 1XIQA 1WEZA 1TKZB 4U8VA 3QT6A 5D0HA 2BDPA 2CPFA 3Q89A 1KRPA 1BLUA 4DN0A 3MM9B 3UW1A 4J9MA 1H7WA 3RRHA 2DTJA 2GGPA 1HR0F 3U27A 2YKQA 2XLIA 3IGVA 4OYBA 3CW2C 5D0GA 2DCLA 5CYQA 5KT2A 4ZPCA 1VJQA 1FKOA 3CDBA 3LP1A 4DV3J 4E98A 1FF2A 4U67Q 4QYZK 3HHLD 4QIVA 3TEHB 2CQ2A 2FHJA 4DUZF 2OPPA 4LBIA 4QWEA 3HK2A 2NUUG 2GAGC 1VBXA 3SSSA 3LOUA 2PGCA 1HI8A 4RPFA 3DRYA 1W25A 3N6MA 4I2PB 3PY8A 1VLOA 3IR6B 1JJ2R 3ZZZA 2AGOA 3IMQJ 5FJ4A 3QT7A 1HQEA 1LFPA 2N3LA 3KMQA 1VQNS 3WIVA 3OFGA 3RR8A 4IQXA 1SB6A 5DGAA 5IC4B 1OY6A 1VK3A 4FYXB 1HWJA 1MLAA 2RS8A 1NK0A 3PJ9A 1QE1B 3HZGA 5FLXY 2VG7B 4LT6A 4RZRA 4FF3A 3OTOJ 2BMBA 2VG5A 2UXDF 2WVEA 2CJBA 4LFAF 2WW4A 4XIUA 1A0OB 2DHAA 5A76A 5DDPC 1YJ9S 1OY8A 3G2XA 4OX9J 2O66A 1WHXA 4LFCJ 2G13A 3CE8A 3AD8C 4QW8A 2YH0A 4K2JA 1WOOA 1O8BA 3GFXA 2DHSA 3H8YA 2E9RX 2DB1A 3FMWA 4Y3CA 3WX4A 1X8DA 4MIBA 2JC1A 4Q0BB 2UVRA 4OFZA 4OLPA 5GAGU 4A8FA 2HGMA 2Y1LB 2XLKA 1EKSA 3EPIA 2OMOA 5KFNA 1I94F 1XN9A 1NSAA 1FX4A 3M30B 3BPDA 1U0SA 2Y1JA 4F4KA 4PG6A 2W8LA 4RNHA 1RISA 4ELVA 2ZBPA 4QR0A 2VPYB 4DL2A 4LF8F 4G1IA 4C7QA 3UN3A 3QO9B 3OJUA 1VHIA 4KJIA 3MCMA 1VCTA 2IC3A 4NCAA 2RKIA 3TUPA 2EW9A 1S6PA 2FVCA 4Y0FA 4TVAB 3LPYA 2OIHA 3MPWA 4DX5A 4EGLA 3GYNA 2B9EA 5M2RA 4K4UA 3VTIA 3AJDA 1RT5A 1QD1A 4F0MA 1NK5A 2B0GA 1RTIA 1R0AA 5THWA 1LWEA 5C2CA 4KKOB 4Y34A 3EXCX 4DS4A 3B8HA 3DDNA 2W7PA 1YRTA 3MPDA 3G8QA 3J7AN 3SEOA 3Q0AA 3UD4P 2DGWA 1S49A 4NL5A 4KGXB 2KJVA 2RRNA 3W2WA 2B4PA 2YWWA 3CJ8A 3NGUA 3RBDA 3UD3P 2DYAA 3BN7A 1KWMA 1MG7A 4EI2A 2PT0A 4DPOA 1ZYQA 2MKHA 2QN6B 1UJ5A 3DLEB 3R97A 1LV5A 1T9UA 3Q2TC 3RRKA 4M5DB 1P1LA 3HT0A 2QSWA 4JI0F 4IR1A 1V5IB 4QZVB 3W8GA 3D1HA 3RBXA 3HFVA 2NREA 5D3GB 3GONA 3OLBA 3CJ5A 3D67A 1QDUB 1AW0A 2Z57B 5F3ZA 1NNDA 1ICEB 4Y2CA 1JLFB 3TZYA 1P1TA 4IH6A 2B6AB 2H5JB 3TZZA 2OP5A 4MYTA 2XSJA 1VHFA 1H38A 1M5SA 1WOSA 4ECSA 2HQCA 1OY9A 4WP3A 3E01B 4OJ1A 3ZZUA 4DLEA 2GVDB 3H40A 4DQQA 3L7OA 1E6VB 1WWHA 3TRGA 1KOOA 2MJUA 4GVBA 2A6OA 1REVA 1XTZA 3KWMA 2BQRA 4UF4A 5DRKA 1U1PA 1J5OB 2I0XA 2LECA 2WONA 1NH8A 3FEZA 4A47A 3KG0A 3KK1B 4DV2J 1WORA 3T19A 1HLWA 3KLEB 4RWWA 1IN0A 2UUAF 4CO2A 2V63A 4DR4F 3BYPA 4IOAQ 5HQMA 3GFHA 1B0PA 3W5XA 4EO8A 3KHRA 3PW0A 2ZM6F 4OYPA 1KEKA 4UZCA 2KRRA 4MK8A 3POTB 2ATLA 2WRMA 5HSPA 1QVGR 4X62F 2ZDPA 1UPPA 4B3RF 4B9SA 4A4JA 3ONQA 4P2XA 4O3NA 3BKUA 3OL6A 5U47A 4DV1J 5KFKA 2O5DA 2MDAA 4OIXA 3W61A 3HXMA 1T9WA 1S6QB 4RNNA 3VAMA 2DY9A 1OYEA 2FLLA 3H2LA 4HHHA 4QW9A 4C8YA 2Y3YA 3MI7X 1JLCA 4OHZA 1S1XA 5EX0A 3LO3A 3D2WA 4NE9C 2ZZMA 5KFUA 4KQZA 2G2YA 3RU0A 1HKAA 2I1RA 1EETB 2WTFA 1QVFR 5LSRA 3A4TA 1GX5A 1JWWA 5HP1B 3GR0A 2V2KA 3LTOA 3OXLA 4CTAA 5GAGI 3EZUA 4I64A 1XNRF 2V4RA 3M4XA 3L7PA 4V1Ak 4Q7AA 3KHGA 2VQEJ 1JKHA 3DLKA 1HHQA 4PPDA 4L3NA 1RAAB 4CRJA 2KFNA 2F9DA 4KE5A 3TVKA 3JSMA 5ETQA 2JEIA 3MAHA 2E44A 2N4DA 3KUGA 2LYVA 1JJ4A 2DR9A 2OSQA 3X3UA 3MAQA 2VOOA 4NPOA 3ITHA 5KFDA 3KXDA 4OJ3A 1NHKL 3R5JB 5J2MA 4CLUA 2IDLA 2BEFA 2BJEA 2RILA 3UVJA 3FFIA 3A8EA 5HN0A 2QIFA 3PFOA 2HRTA 1ZZNA 1XMQF 3HX9A 2UXCF 4DPWA 1X4FA 2A1BA 2QJ3A 5CQGA 3ISNC 3WIUA 2VDIA 2MZRA 4F4ZA 5EGYA 4ZVFA 1Q1KA 3VAHA 3R5GA 1K73T 3MM6A 3FSIA 4OZJA 3ZFVA 4JI1F 1SV5B 1PGZA 3MM8B 2NR0A 3O6QA 4DR3F 1N0VC 1BHNA 3DRSA 4J9KA 4KFBA 2UUBF 3KLFB 3DRPA 5GMEA 3H59A 3PEHA 2VL1A 5AE3A 4ZMMA 2Y0SD 3NG8A 1WG1A 1IQTA 4RJVA 3TUZC 4B08A 1T8EA 2XHWA 1FWLA 3VGVA 1CC8A 4IFVA 1DLOA 1U6ZA 2IMWP 3H5UA 2P6TA 2AJ1A 1RT2A 2BE7D 5D4NA 2KN4A 4DV4F 1KP6A 1X4CA 3HHNB 2DO0A 3RGIA 5CHCB 1U0HB 4MK7A 5B0GA 3H90A 2MJNA 1YTYA 5IFMA 2RHSB 4AYBD 4ZLPA 1S1TB 1CJUB 3O3LA 2COLA 5IT0A 4FKXA 1RWKB 3M2VA 5LMUJ 2QLBB 1WACA 1QLNA 3NGSA 3P5BP 1AB8A 4LVOP 3RB4A 3L9ZA 3PYGA 2HFOA 2K7KA 3LH2S 2B9YA 2ILYA 2M5YA 5L39A 3PDNA 2LQ9A 1VC0A 4L75A 2J9DE 1VFJA 3Q8SB 2DK2A 2NYIA 3RAQA 1S1WB 1RTDB 3E8OA 4B3MF 5C24A 1IKVB 4EZ6A 3T5KA 2YNIB 4JI6F 2GHWA 1F2HA 1PCAA 2KVIA 1FEHA 1NJYA 3IGNA 2R7UA 3QPIA 3TQ1A 2GS8A 2I5JA 4X65J 1TKZA 1YJWS 3KFWX 1L3VA 1GMWD 3A12A 1R3NA 2XMJA 4RW6A 5AJ3J 4P52A 3ZZTA 3W8PA 1Y9OA 2GNKA 1HBMB 1NSPA 4OX7A 4PG4A 1DTQB 5HI7A 4OHWA 3K2YA 4NXNJ 3GILA 4DR5J 3MR7A 4M5LA 5IQQA 3QZ7A 5IT9Y 2HQDA 1RWUA 2W2OP 4C8MA 2JVOA 1C0TB 2E7WA 1HNWF 2F7VA 3G6ES 3MZIA 1SH3A 1XNQJ 4O4GA 2JLFA 4K0KJ 2QYGA 4DSLA 3BSCA 1N6QB 3CJ3A 3AOBA 4QU6A 4TQSA 1KC8T 1IM4A 3R2CJ 4JI5J 1YJRA 1JX4A 2RSQA 1WC0A 2G0IA 2W9AA 3OFFA 2EBEA 1AXQA 2GQ2A 3NXZA 1U48A 4CLTA 2HNDB 3T6BA 1YSJA 3CCVS 1JNZB 2XS5A 2DH8A 2VPXB 2HQ3A 1SPBP 2BE9B 2M3DA 1QE1A 4G6VB 4DF8A 1H3DA 5M2PA 2ZFHA 3MDFA 2XZWA 2X1AA 1Y5LB 2POKA 3DOKA 1SKUB 3LGNA 1TAQA 4N7TA 3C6UA 3LAKA 1SJ3P 3V6DB 4ZITA 2J76E 4O44B 2RDJA 3SCIE 2AX1A 4MMOA 2FHKA 5DDOC 3LQVA 4HR2A 4OZLA 2W2PP 2IDEA 3ELHA 2ZH4A 2VFVA 2E5LF 4F25A 4U7CA 3KOAA 1N48A 3HD1A 2F8HA 3S6EA 1QAYA 4WK3A 2MY8A 1W7WA 2DXEA 4LFBJ 4NLRA 2CWKA 3GU0A 4GKKJ 5EWEA 2EBGA 3HHDA 1FRKA 3HSGA 4H4MA 4DHVA 1KQKA 3PRVA 2V94A 1RLCL 3I5AA 3IRXA 1NPKA 2EEYA 5KFRA 1WHWA 4ZN3A 2MMYA 3QZ8A 5HROB 1X5TA 3UN2A 2RAQA 3FBFA 4FPRA 3NS5A 2MGZA 2VPWB 2HEKA 3PACA 4KKOA 1FTRA 1OSDA 5DDQC 1UVJA 1HBNB 1NM2A 2HGNA 2IYGA 3WHIA 4LFCF 1FD8A 2LXIA 2UP1A 1RK8A 3M8SA 2X1FA 5J2PB 1N56A 5F9LA 2DGTA 4ITSA 2CQGA 3C2PA 4L72B 2YWHA 3EICA 5KG5A 3GJSB 4LIWA 3MPYA 2JLGA 1GEHA 3RRGA 2YX4A 1ZPWX 4M5DA 1BC6A 2LXUA 3BKFA 3BH6B 3QRQA 2AT1B 1CG2A 1YRXA 1C2PA 3OUYB 1DHMA 4M5NA 4ECTA 3MGJA 2BM1A 2CQHA 5K8MA 2W25A 3T3FA 4QWCA 1IKWA 1HNVB 3DLGA 1JLFA 3PIPQ 3KJVB 4JV2A 4D3GA 1NKEA 4U8YA 3K17A 2W2QP 2WSEC 4ERDA 3I0SB 2HPUA 2HS3A 4L76A 2VODA 2QYCA 1U1MA 1FRMA 5A6WA 5DETA 4Z7YA 3UD5A 1S12A 2E66A 1VRTB 3KLIB 1IBLJ 2GVDA 2V6AA 5AXKA 3QRPA 2W8KA 4TYAA 3FEXB 3VWSA 5KG0A 5LSOA 3W62A 3Q8PB 3GB0A 3TJAA 2FC8A 2PI5A 3M2UB 4B3SF 1WC3A 2LQJA 3P5TL 3KK1A 3CTRA 4OX6A 3H98A 5HLFA 4W4MA 3VV2B 4GC7A 1SKRA 1K0VA 2AEMA 3ILOA 1JLBB 3FKBA 2VJUA 5F0UA 1LW2B 2HNZA 2Q3PA 1NHVA 1REGX 1RHRB 3POTA 4HTIA 2HFZA 1GMUA 2E1RA 4CYUB 3NOCA 3D9BA 2A10A 3D54A 5GAEU 3THVA 2B7CB 3PHTA 2BA9A 3D6MB 4UZBA 5HANA 1WELA 4ZLNA 4ANCA 4ECUA 3G8TA 3RAMA 4FXDA 1HARA 2G2OA 1NK4A 1Y5IB 1WI6A 3R27A 2HZVA 1UCNA 4C6AA 1YI2S 3MXHP 1R8HA 4ZVUB 3CDEA 5AT1B 2VA3A 1TK5A 2ZUAA 4BS2A 4RNOA 3LP2A 3KDNA 2QMXA 3RB3A 4NRUA 1PBUA 1AUSL 2FLOA 4I6AA 4ZPTR 1M5KC 2JH3A 3IBWA 4IO9Q 3TWZA 3HFKA 4QIWD 3MR5A 4RX6A 4DFMA 1I5OB 3B54A 4RNMA 4W98A 2P5VA 3L3CA 1DY3A 2VG6B 3MD3A 2R9LA 2CNOB 1TP7A 1TL1B 1TTHB 2CQIA 2DO4A 1N54B 1TMJA 4QU7A 5DQIA 3GPAA 4KHPJ 4C0BA 3B4DA 2J9EA 3DLJA 2VA2A 3NCPA 4C8KA 2QLJB 3JAMY 2HVDA 3SSQA 5KOXA 4C9DA 1G4CA 4ECXA 5A8WB 1X0PA 1VQLS 3MM5B 4LBPA 1Z4UA 1HHSA 3O8WA 3HVTA 3SSRA 1UL3A 3RG6A 2BXJA 1JLAB 2VB6A 2M52A 2QLFB 3KLGB 4F67A 4P2FA 1K1QA 2DD8S 2MQLA 3R3TA 1YIJS 1X5SA 2YXLA 1FJGJ 5JJBA 2BACA 1PBAA 2OLWA 2YY3A 3HT3A 1YDLA 1LK7A 3NEKA 2V8GA 5SZTA 4F4AA 2RT3A 3AA9A 3LUYA 4LF4J 3P49B 4TN2A 4IYQA 1Z2LA 4YEAA 2MKIA 2MLYA 3NP5A
chains in the Genus database with same CATH topology
1UWBB 3DXSX 3ZZPA 5IWAF 1ZM2A 4BCAA 1BWEA 4ZPBA 3BDEA 2KJWA 2JFDA 1A7GE 3R1HA 1TVRB 4IOCQ 5A0YA 3M6UA 1HNZF 4USIA 4K50A 4P2SA 4BC9A 2VQEF 2JDJA 3N28A 3T1YF 4OI6A 5JXSA 5BR8F 2IA0A 2PE8A 4JI4F 3PIOQ 3KLIA 3H5SA 4YDXA 1RI7A 3MM8A 2M8HA 1NK9A 4ES2A 5B0BA 3V4MA 4DMZA 3M2RB 3IAS9 2IRXA 4WFBQ 4FXWA 4ID8A 3UNGC 1GXLA 1HQEB 3TYTA 1W2IA 3HMJG 5L1IA 3BB5A 2JL9A 2KZZA 3EUNA 2PC6A 3MM6B 2Z0GA 2XNRA 1RTJA 4PG7A 2F4VF 1X5PA 3FQKA 2R7OA 3CT9A 3KLFA 1QM9A 4URSA 4EUVA 5KG7A 3M2UA 1S1UA 1YHQS 3LW5C 2R8IA 2EPIA 3EPGA 1YGYA 4I2QA 2B9WA 2LVWA 4LSNA 2IM1A 2PMZD 5AE1A 2ZNYA 4GO7X 2YNFB 4PR6A 4CIOA 3TOQA 5A2QY 1VQ7S 1UMJA 3M05A 3DGPA 5J1NA 2VBWA 2G9OA 3DM2B 1IR0A 1X4DA 3DRSB 5I4MA 3FMBA 4ZP6A 2CZVC 4HKQA 1QSLA 2FB0A 1V3ZA 4IR9A 1F9FA 2JEFA 4AE5A 1C1BB 5K14B 2YX7A 1JLBA 1P6TA 2DGVA 3K57A 1DJ0A 2NZ4A 1U6BA 4C8NA 3SFUA 3N79A 1DURA 2VG5B 5LT5A 2R8HA 1R27B 4DV3F 1QAXA 3V4IB 4M95A 3RW6A 2ZH3A 1ZM9A 5D77A 4TY8A 1NRKA 2FJDB 3BGRA 5DM7Q 2F1FA 4FF2A 1SJ1A 2Q66A 3HPOA 1K1SA 3AH6A 4NA2A 2PIIA 1MWZA 2XSFA 5DG7A 3OTDA 4O3SA 2E7XA 1S72S 2RU9A 2DBBA 4IFVB 4C4WA 4PUOB 1DLOB 5E3RA 1X9WA 2XS2A 2KXHA 1FNMA 1SJ4P 1YBAA 5E3AA 1S99A 4TQRA 4Y2KA 3WC2A 4ALZA 4QPXA 5D6GA 4DV5F 4Q8EA 1RT2B 3W7BA 2BANA 1TKXB 3CJ0A 5DM6Q 3KLHB 2CPDA 4H54A 4XPCA 3UE2A 2R7WA 2R7RA 4G3IA 2IFXA 2ILZA 2RRBA 5G0RA 3VAJA 3VAFA 4AL7A 4IRDA 2QA1A 2HLUA 5L38A 4KT0C 2DISA 3N0VA 2ADBA 2CQPA 5B08A 3QLHA 4EWTA 1YRUA 4DL0C 1L3KA 3G86A 1NZAA 1RKIA 3DOMA 3MM7A 1S7HA 2VC1A 4PXDA 2GFFA 2XMVA 4CNZA 2QE5A 5K5MA 1J2VA 3K8VA 4OMFG 3OVSA 3TUJC 4FZVA 4C98A 3BREA 4Y2AA 1PC4A 2V9KA 2VD3A 2DNQA 2RB7A 5EX3A 2KT5A 4D3HA 2KT3A 1BY9A 4NLVA 4CT9A 4WJBA 2PDAA 3U1LA 2ASLA 3H4DA 1KD1T 1ZAVA 1RT4A 4E8UA 1GTEA 3EGNA 4W90B 4QWDA 2L41A 3V6HA 2HWIA 4WK1A 3SXLA 4CI0B 4UUXA 3M32A 1MMNA 3QWUA 4JBCA 4NX9A 4GKJF 1G3OA 3FRZA 4YUDA 2EFNA 2BQUA 3V81A 2AYBA 1I6JA 1UA0A 2B5JB 4KO0B 3ZZ0A 1H7XA 2EK1A 2LA4A 3IA0A 5C25B 4CO1A 4X4TA 1RTDA 4ILMA 1B64A 4EO6A 3HM9A 4E0DA 3U02A 2CKWA 4TLQA 4J9LA 3OTOF 3N01A 5SUHA 3TI0A 2W4PA 2YNIA 3UR0A 2Z2LA 2ZBCA 2P9EA 2DIVA 3TO8A 1ZAXA 2IC3B 3JSYA 3VALA 2B56A 2UUCF 4F02A 1Q53A 2FHOB 3N5FA 2CFXA 3OW2R 3NNAA 2RKIB 5C42B 1KVJA 4OI0A 5IT4A 2VG6A 1DRZA 2HHSA 1S6PB 1GAOA 3W3SA 5HMYA 3G4SS 4NLSA 1BQMB 5DQHA 2OPSA 3CCES 5AXMA 2N7YA 1KFSA 3QJJA 4OHYA 2C3UA 1YJUA 1TL1A 1PSDA 1ZBTA 2OSRA 3D0IE 4OX9F 2FJVA 1F5AA 2B4UA 4LF5F 4ED5A 1RTIB 3AAWB 4QR1A 1KQSR 4J9PA 2W9CB 1C0UB 2E29A 3OQ2A 3C6TA 1F0XA 1WF1A 2VKZG 3PJWA 4I68A 2HFNA 4LMZA 2C3OA 1VQ4S 4DFPA 4URQU 5DQGA 5GADI 3GZ7A 4RKUC 1LWEB 1P9QC 4P7TA 3FQLA 3G6XA 2R8KA 2CRLA 2DT9A 1HBMA 1UVIA 2VFSA 4OI3A 1XBWA 3KHHA 2WB1D 1WEZA 4F2RA 1TKZB 4DQSA 4X66F 1MROB 2OPQB 2GHVC 4ZHRA 4C11B 2VQFF 3MOJB 1V3RA 2NS1B 2HWHA 4ELTA 1TFWA 1T95A 1V6HA 2BDPA 1HD0A 3R1LA 2UUWA 2K3KA 1DQ8A 1HNXF 2IJNA 2CPFA 2CZ4A 1BLUA 3UPFA 1KRPA 4DN0A 3FZ2A 5LMUF 3MM9B 2ZVSA 3UW1A 3SV3A 2J7UA 1UJ6A 4J9MA 4ECQA 2Z8QA 4LSLB 3TVYA 4CH7A 1H7WA 1MU2A 2MZTA 3RRHA 1JLAA 2DTJA 2ZH1A 3MMJA 2GGPA 3AJ1A 3KG4A 5I3QA 1YG0A 1Q7LB 3OFEA 1HR0F 1C0TA 3CEDA 4W92B 5E33A 2XCAA 3UCGA 3KLGA 3U27A 2CVEA 2YKQA 5HBMA 2HMIA 3K0JA 2Z4PA 5GAHU 5KT7A 2XLIA 3KK3B 3NS6A 3PM9A 3IS9B 4OHXA 5L8RC 3RB6A 3IGVA 1H2UX 2HNYA 4ZVHA 3T9NA 3OHBA 5KT4A 5L1LA 2DCLA 4OZNA 5CYQA 5KT2A 4ZPCA 1S48A 2W7OA 4JI3F 2ZH5A 1JNRB 1IKXA 1N6QA 3KLVA 2LXFA 2VBYA 4JUZA 1M5VC 2EFOA 1FKOA 3C66A 3CDBA 1SL0A 1HBOA 3LP1A 1Q86T 1TUVA 2BYCA 1GNKA 1QUPA 4E98A 5LSLA 1FF2A 4KIAA 4U67Q 4YY3F 2E9ZA 3IC1A 4KHMA 4AFFA 3CCLS 2WOMB 1XMBA 1Y00A 4PWUA 4IRKA 1IBKF 1KVIA 3HHLD 3BO2A 4ECRA 4QIVA 2LDIA 2CQ2A 2FHJA 2NPFA 1WHYA 4DUZF 1KLMB 2OPPA 5MLCV 5KFLA 1UETA 4QWEA 2NUUG 3HK2A 4YR3A 1VBXA 1UWBA 3SSSA 3LOUA 3PR5B 1VBZA 2GMLA 4Y28C 1Y5NB 5F0WA 2D74B 3ENQA 2PGCA 2B4VA 1HI8A 1TVRA 4FS2A 3DRYA 4Y2IA 4B9MA 2ZBIA 3MEEB 4X65F 4V19J 4OL8A 1W25A 4YB5A 4C8OA 3N6MA 4I2PB 1FDAA 3SI8A 3M8PB 1C1CA 3PRBA 3GFYA 2EFVA 3PY8A 3OR2B 2JRSA 4N8OA 4K4WA 1WTBA 3IR6B 4A8SA 1JJ2R 1VBYA 4CO4A 2PSZA 3ZZZA 2AGOA 2AGPA 5FJ4A 3FCHA 3TAMB 4BHQA 1SBRA 4FP9A 1HQEA 4ED1A 1LFPA 2N3LA 1YJTA 3PW2A 5DS7A 4NLWA 2C3PA 3P6YC 2NSCA 2LU2A 3GWCA 1RT6B 2GO9A 2JVRA 3KMQA 1T03B 1VQNS 2RNEA 2OKQA 3OFGA 4WTYA 4A8QA 2JHEA 2XSJB 4B9LA 3RR8A 3RR7A 1WF2A 2AJFE 4IQXA 4NZ6A 3QGGA 1S76D 1SB6A 1FXLA 5DGAA 2O67A 3K5OA 1VK3A 4EBEA 1HWJA 4IDKA 4DV7F 2DNGA 2RS8A 4ZPWR 1N5QA 3TX8A 2MZ1A 1FERA 2AGQA 3PV8A 1NK0A 4XPEA 3MUMP 2OJ3A 1QE1B 2IM3A 4B9VA 3CDUA 3MD1A 3VQSA 3HZGA 5FLXY 5I3PA 1SI9A 4O44A 3VAKA 2VG7B 1REVB 2NUHA 4LT6A 4RZRA 4FF3A 2V9WA 1OIAA 4ZVEA 2ZH6A 4DQIA 3MURP 3QMQA 4K4XA 1TKDA 4MKYA 2VG5A 3V4IA 3DNCA 2FVRA 5JVHQ 1TK8A 2CJ9A 1CC7A 2UXDF 2CJBA 4LFAF 4HLBA 2WONB 3O44A 5A6PA 2RJZA 2ZJPQ 4XIUA 3AJ2A 2FPHX 1XNQF 2FUG9 3SDEA 4USHA 4IRCA 2DHAA 4ED3A 1TKTA 4NA3A 4K0KF 4PUOA 2LA6A 1OQ3A 2MHEA 4HEA9 5DDPC 1TK0A 1SKWA 2GQCA 1YJ9S 3J7A1 3M9OB 4PPZA 2O66A 3TR5A 1QTMA 2B43A 1WHXA 3DLHA 2G13A 2KDOA 1JB0C 3CE8A 4IQMA 1TR0A 4QW8A 3KLHA 2YH0A 2XMWA 1O8BA 3GFXA 2DHSA 3H8YA 5J2NA 4JI5F 4B02A 4MFBB 3PVXA 2R2SA 2DNOA 2E9RX 1OPIA 1V9OA 2DB1A 2D3ZA 3FMWA 4Y3CA 3T5JA 3WX4A 4C3MA 1YQHA 2CPYA 1RT7B 1X8DA 4MIBA 1T02A 2JC1A 2RIJA 4Q0BB 2UVRA 3TUIC 4OFZA 2RF2B 3UI3A 4OLPA 1UVLA 1L3SA 1OO0B 2E9TA 5GAGU 1HL6A 2N3OA 3S7RA 5DGBA 4A8FA 3V5RA 2W4DA 1JXEA 1S79A 2KI2A 2HGMA 5KFQA 2MQMA 2XLKA 3EPIA 1FDBA 3NGDA 1HQUB 2OMOA 4NLDA 4ZDNA 5KFNA 4R5PB 2WBRA 1I94F 2HHUA 1XN9A 3M30B 5A8KB 4NLGA 1TL5A 1NJZA 1FE4A 2IVYA 2XCPA 2R7TA 4J9SA 4A8XA 4QWAA 2GQQA 3O1LA 2Y1JA 3BO3A 4F4KA 1SUQB 4PG6A 2W8LA 4KHRA 4RNHA 1RISA 2IBOA 4HL9A 2ZHOA 2HHHF 4ELVA 2OAUA 5LXRA 4LUBA 1N32F 3CD5A 1U6FA 2XC9A 1R7IA 4HVZA 4QR0A 1S0OA 2VPYB 4KO0A 1E6YA 1FESA 1RP5A 5AXNA 4DL2A 4LF8F 4G1IA 1U1QA 4C7QA 5DO2A 4C2MA 1VMBA 5C25A 1LOUA 2BV3A 2ZNZA 3ISND 3QO9B 3I9ZA 4ED6A 3T1AA 3OJUA 4UY85 3I55S 5ITHA 3MCSA 3EXYA 4KJIA 2GA7A 3SCLE 2MZQA 1LXJA 1JLCB 2IC3A 4IG3A 3G9CA 1GH8A 3BGUA 4NCAA 4RW9B 3MPVA 2RKIA 3CGIA 2E5GA 1UFWA 1S6UA 3DHWC 2EW9A 1S6PA 2FVCA 4Y0FA 2PN6A 3IFEA 5B0FA 2FJWA 3LPYA 2OIHA 1R6YA 2BZ2A 1IJFB 1HBNA 3MPWA 5KFZA 5CXTA 3HHKA 3J7YI 4EGLA 4F3MA 5KFEA 3GYNA 4AQYF 5M2RA 1Y3JA 4DV2F 1S0VA 1ZTTA 4K4UA 3CSKA 3VTIA 1RT5A 1ZETA 2P9CA 1NK5A 4Y6IA 2B0GA 2CPJA 1RTIA 3WBZA 2B3TB 2Q6CA 1UFLA 1C0UA 4ELUA 4OI2A 5JUMA 1N5YB 1R0AA 1D9FA 3IN5A 2B51A 2AYEA 5THWA 2X1BA 1LWEA 2GCFA 1QY7A 5J2PA 1D1UA 3OXFA 4KKOB 4Y34A 3VZIA 4CTAB 3T1HF 3EXCX 3MEDB 4DS4A 2PEHA 3CJ2A 2VZ9A 1VGYA 2XWXA 2DNNA 3MR3A 3B8HA 4RBUA 4JV0A 3SQGB 3DDNA 1MROA 1C4CA 1ELOA 2W7PA 2CIMA 1YRTA 3PR4A 3G8QA 5KFPA 2F3JA 4DX8H 3V6KA 2YNGB 1Q16B 4OZ1A 3D5MA 3SEOA 5FDLB 3Q0AA 3UD4P 1A9NB 5HMZA 2DGWA 1LFWA 2V4JB 2KXNB 3VZHA 1S49A 2X51A 3MM9A 4NL5A 1RYSA 3LWLA 2J0SD 1NK7A 3FSYA 4LSLA 2MB0B 2KJVA 2JEGA 3EZ5A 2RRNA 4DV1F 4PWDB 3W2WA 2B4PA 3F41A 5DLGA 3Q8RB 5I42B 3T5LA 1S1VB 4LFBF 1Q8BA 2J7KA 3MEGA 3UD3P 3RBDA 5IM0B 2RH3A 1T94A 2YVSA 3ICLA 1XMOF 4ETXA 1FTCA 1S10A 1NB7A 1PO6A 1XR5A 3CC7S 3UCUP 2J6UA 4UQGA 5KFGA 1HD1A 3JSMB 3DFEA 4WXWA 3NNHA 5L9NA 3BN7A 2XB2D 1K0TA 3KK3A 1Z2ZA 3OSNA 2FVQA 3MMBB 2PT0A 4DPOA 4YB7A