1FE0A

Crystal structure of cadmium-hah1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
66
structure length
66
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER TRANSPORT PROTEIN ATOX1
publication title Structural basis for copper transfer by the metallochaperone for the Menkes/Wilson disease proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 19
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fe0A00
2XMUA 3IWXA 2AJ1A 2RSQA 2EW9A 4OJ1A 1FE0A 4YEAA 3DCAA 1TR0A 2G9OA 4HI1A 2ACYA 3TOQA 1OQ3A 4F67A 1MWZA 3BGUA 2OP5A 4QOTA 1JK9B 1Y0HA 5F0WA 2BJEA 1N5QA 2XMTA 3I9ZA 5B09A 3BF4A 4YDXA 5T7LB 2L3MA 1GXTA 3FMBA 2IYIA 1FEEA 2K7KA 5B0BA 2ASYA 1X0PA 1Q8LA 3KG1A 3GZ7A 2OKQA 2BYCA 1KVJA 1U7LA 5F0UA 4A4JA 1CC8A 1V3ZA 5IXUA 1CPZA 2OFGX 3T9NA 5KAKA 2K1RB 2FHMA 3LO3A 2N7YA 4HI2A 1YJUA 1XBWA 1N5TA 1TZ0A 4EFAC 3QMQA 1KVIA 2K7JA 4FNIA 1OQ6A 2RU9A 1Y3KA 4HL9A 3E8OA 1MWYA 2GV1A 1LQ9A 1P8GA 1X7VA 1YRXA 2XMVA 3BN7A 2AJ0A 3HHLB 3KKFA 1N5SA 2GGPB 3KNGA 4HH0A 5B0AA 2BBEA 2QLWA 1K0VA 1GXUA 2HFOA 2W4DA 1FVQA 3MZIA 4OJHA 2RMLA 1TL4A 1Y3JA 4FNHA 4Y2MA 2Q3PA 4DL0C 1RJJA 1TL5A 1W2IA 1SB6A 2GCFA 2HIQA 3KG0A 1JWWA 1VQYA 2CRLA 3FRYA 4Y2IA 4ZA1A 4DPOA 1FVSA 2IYGA 2XMWA 2QYCA 1YG0A 2LXFA 1CC7A 2GA7A 2QLXA 5T7LA 3HHLA 2GGPA 2HFNA 4U9RA 2OFHX 3BB5A 1OSDA 1ULRA 2HLTA 2KT3A 4ZOSA 2GFFA 2PGCA 1AFJA 3CJKB 1QUPA 3HDSA 2ZDPA 4OJ3A 1Q53A 3BM7A 1FESA 2AW0A 5K9FA 2K2PA 5B0GA 4A47A 4Q2MA 3LGMA 3HX9A 5B0CA 2XMKA 4OIXA 4Y2KA 2KKHA 3DXSX 1OPZA 3FGVA 3F44A 3HF5A 3QGPA 1R6YA 2OD4A 4DN9A 1AW0A 3HFKA 2N4DA 1URRA 1FD8A 2K1RA 3UDCA 2VV5A 1APSA 2QIFA 4NL5A 1SQEA 4A46A 5B08A 1IUJA 3TNVA 1TUVA 1YJTA 2N4CA 3BR8A 1P6TA 2XMJA 1SI9A 2AP6A 2GO8A 2HLUA 2OD6A 2RILA 2ROPA 4Q2LA 1WD6A 5B0FA 2HQIA 3TRGA 1FE4A 1VQSA 2FB0A 3HHLD 5B0DA 1N5VA 2PD1A 2W4PA 4HH1A 4NPOA 5B0EA 2OMOA 1AFIA 2FTRA 2XMMA 2IFXA 2W4CA 1S6OA 3BDEA 3IWLA 2ROGA 2LQ9A 1X8DA 4OJGA 2BJDA 3HHLC 3LGNA 3MCSA 1Q8BA 2ZDOA 5A6WA 5A6PA 1S6UA 1YJVA 2ROEA 2KYZA 2OAUA 2LDIA 3K7RA 2JDJA 2FIUA 2LQBA 3CJKA 2KT2A 2BUNA 4A48A 1Q4RA 1KQKA 3VTIA 2VH7A 1YJRA 1Y9OA 3WDOA
chains in the Genus database with same CATH superfamily
3G82A 2IDEA 1RTHA 3PRVA 1T95A 4I2PB 2VA3A 1U49A 3MR6A 1VBZA 3M1VB 1X9MA 3R2DJ 4YY3F 3K5MA 4BWJA 2UVWA 1NKEA 4E0DA 5CZVA 4M5JA 5KFDA 4QW9A 5JUMA 4KH0B 5LMNJ 1N52B 1YRXA 4IH7A 2LXUA 3GU0A 2DRBA 3PRDA 2R42A 2VUGA 2P2CB 3M8SA 2CZ4A 1TL1B 3PVXA 2ZZNA 3C3LA 4DSLA 4A47A 2XSJA 1E6VA 4LF9J 4X2BA 2DXDA 3ZXWA 1HWIA 2XS5A 3D6HB 2OIHA 2HS0A 2ZZTA 3MPVA 1H72C 1RU1A 2MTLA 4X4VA 5HBMA 2JEIA 3MAAA 2VBZA 3AJ2A 4OHVA 5IM0B 4MK9A 1C1CA 5A0YB 1KQKA 2QRRA 1IBKJ 5E7OB 1S79A 2JC0A 4G65A 2GIQA 1Y7PA 2ZH9A 1RTDA 5HI7A 1NPPA 2KRBA 1KONA 1FEEA 1J5OB 4ZJQA 2DGXA 2L48A 2AEFA 3H2UB 2RB7A 2D74B 1FKOA 1AZSB 5H9FJ 1NSKL 3CJSA 2IM3A 2VG7B 3JQJA 1UKUA 5DDPC 5MAOA 2VPXB 2ZH8A 2VICA 4AD6A 3KNAA 5DS7A 1G3OA 3OFHA 2QE5A 2K2PA 4OIXA 3QGPA 3CD6S 2OD4A 1N6QA 1CS4A 1PGZA 4I6YA 3J81Y 3I4PA 3JQKA 5KFPA 2F9DA 4PCQA 3LPYA 1DLOA 2KZMA 4EYIB 1UCNA 2LVWA 1PBUA 1BQXA 3UD3P 2VOOA 4I1TA 4NYZA 5KT2A 1M5VC 3ENQA 1NB2A 3MM8B 2K3KA 5CH7B 1HHTP 4OI2A 3IR5B 4B9TA 1BQMA 2HHSA 4URSA 2O66A 1VQ7S 1SL2A 3FFIB 4RW4B 5E3PA 3QRRA 1PIEA 1QE1A 3CJ4A 2F4VF 1RZMA 3A1YG 1G2EA 2EG1A 3KHHA 3RRHA 5IV3A 5KFOA 3K5LA 5B0AA 3RAXA 2APOA 2J8SA 4JI2F 3LGHA 4I2QA 2DKOB 5CD4H 4ID5B 1TU0B 4M5DA 3GIMA 1U0HB 2EBEA 2XLIA 4J37A 3V81A 2EFGA 2KO1A 2ADBA 5DLFA 1DTTA 3O3LA 1IJEB 2RIJA 2V67A 3R5GA 4OI3A 5HMXA 2QLJB 1WSRA 4ZDNA 3GG1A 2KT2A 3DC2A 3MUTP 3TZWA 5AE1A 1HR0F 1XR6A 2UXBF 5CYJA 1UWAA 1V5VA 1EP4B 4M5MA 5I3QA 4DR6J 1GXTA 1J2VA 3Q22A 2PFFB 3EWGA 3NG8A 4NRUA 4N8OA 3ELHA 4NLPA 4CYUB 4NLRA 4RNFA 4CH1A 1XBWA 3I5AA 4CT8A 1R7IA 5JVGQ 2RT3A 4DG1A 3G96A 4FNIA 3J7A1 3KDOA 1VLOA 1N5SA 5HVGA 5M2RA 2HFOA 1ZAWA 1TL4A 1RJJA 3N5BA 1QUVA 2WSFC 4DLGA 2HBQB 4IFVB 4MJKA 3M2UA 4NXNJ 2BW7A 2B7CB 3C14B 3K0JA 3A4TA 2C3PA 4DF8A 4CO4A 2FVPA 1LWFA 1Z2ZA 2GQCA 4ZVEA 1Y10A 1CSJA 4DUZJ 4PXBA 1HHQA 2DR5A 1N4LA 2BJDA 3W7BA 3OTOJ 3D6MB 1SJQA 4CLSA 1HBMB 3BO2A 1UZHA 3LP1A 3FZ2A 1HBNA 2FVRA 3UVJA 3NGUA 3V6HA 5J2NB 1LW0B 2HVDA 2JLFA 2GX8A 3MOJB 3PYDA 4MYTA 1X5TA 4V1Ak 4IG0A 1B0TA 3BS9A 2C3UA 1M1KT 4N76A 3N4WA 4DV6J 4DV1J 2E1PA 4EFAC 1NLKL 4GKJF 2B7BB 3CCMS 3NCRA 1TKTB 4MK8A 3KJQB 2MKCA 1SB6A 4IFYB 3MCMA 2AV5A 3JSBA 2H4WB 4MKAA 1MROB 4CO1A 3TZXA 4PR6A 4LF5J 4DMZA 2QZ8A 4WIQA 1FKPB 2RF2B 4F4ZA 4DV3J 2MQNA 2CG8A 2M0GB 2Y1JA 2B9YA 4LR7A 4WU2A 4QWDA 1IKWB 5KFXA 5DQIA 2QTWA 4A46A 3CE8A 1YWXA 2H48B 4FDFA 5J2PB 2M52A 3H98A 4DV4F 5HATA 1XJWB 1H7XA 2CQ3A 2AKWB 2ZVIA 4ZPVR 1RTJB 2L9DA 3K59A 2Y8YA 5HSPA 2DEJA 2G2ZA 2KJVA 2M4MA 4OZNA 3UQSA 1TR0A 4NE9C 2H54B 1SPBP 2V9KA 1QTNB 5A0YA 1DTQA 1M5OC 5BJRA 1N0VC 2BOAA 2XNQA 4EEYA 1NCLA 3KLEB 2X1AA 4J9SA 4UOFA 3EVWA 1XERA 3C6TB 2GHWA 3PW0A 5ITHA 2P8IA 4EBEA 1J5OA 2DHAA 1IXKA 1QAYA 2HBYB 4HL9A 1RLCL 1KKHA 1AZSA 1C1BB 4V19X 3A8JA 4UOGA 2VG7A 2IYGA 2V8VA 4WFZA 2VKRA 3KLIA 3GYGA 2Y0BB 3QZ8A 5B0GA 3LGMA 3D54A 3H90A 5CCLA 3ITHB 5I42B 3CO9A 5AXKA 2FHKA 3W66A 2XTJP 2E5GA 3TNVA 1WWHA 2V8GA 2NXUA 3HHLD 2LKZA 1HYSB 4QIVA 3BGRB 2E1AA 1X8DA 2XO6A 3GFYA 3OFGA 2RS8A 2VG6B 4ICLA 3BBBA 4EWTA 4B9SA 5KT6A 1D09B 1MWZA 2OP5A 4ZP9A 3BF4A 4WCEQ 3CMAS 1T0TV 3VWSA 5C24A 3PR4A 4C3KA 1QVGR 1JLQA 3FFIA 4RW4A 1VJWA 4LQ9A 1C0UB 4YFUA 3MURP 4EBCA 4B9NA 5KG6A 5D0EA 3DHWC 2YPYA 3TAPA 3CIZA 3BZQA 1ZA1B 2G1HA 4L73A 2V8HA 2AZ1A 1XMQF 3DOKB 3U1MA 4ECXA 4ID5A 5KFEA 7AT1B 2RE1A 4URGA 4JV5F 1U0HA 4J9PA 3E3XA 2DD8S 2MQPA 2MLXA 5HO4A 4I7FB 2DK2A 4A48A 3MMCB 2VC1A 2XQCA 1RHMB 1K1QA 1VISA 3PFEA 1RWVB 1LEOA 4ZLLA 1TP7A 1K47A 5BXIA 4AXJA 2CPDA 4MH8A 1RACB 3MECB 2CQDA 1YTYA 1EP4A 1WHVA 1JXEA 2IRXA 1IR1A 2YWKA 3OTEA 1OQ6A 3NS6A 3H20A 3DRPB 2DHHA 4CLPA 5ETRA 4CYUA 2YBVA 4G1IA 3RW6A 2GCFA 3DLBA 1VMBA 4Q43A 1GH8A 3P96A 1YJ7A 2UP1A 2OFHX 5E33A 1Q8IA 1Y00A 3FEYB 3M8QA 3X1LB 1AXQA 5ETOA 4IFVA 3RBXA 4DR5J 1APSA 4J9OA 3CDUA 2MXYA 1NDKA 3P49B 1U1LA 3C14A 2W9CB 1R8BA 1G7CB 2LU2A 2YTCA 3RBEA 2FJWA 1MMLA 4QBUA 3H42A 4DLEA 3WHIA 3GE9A 2WW8A 2XULA 1T11A 1S0OA 3KK2B 1HBMA 3W9IA 4YHHF 2GAHC 4FF1A 3L95X 3HO1A 2ZM6J 3SIPB 2AEMA 5J2NA 3C15A 4HLBA 2KH9A 4CCHA 2EC2A 4ZLJA 3DM2B 1HWLA 2DRDA 4EYHB 4URQU 8ATCB 2QL5B 1TK0A 3LAKA 4Z37A 3VAKA 1QSYA 3SCLE 1FNMA 4C8KA 3RRGA 3MI7X 1BQNA 3BEGB 4HACB 2FUG9 2XNRA 2NREA 1M90T 2DH9A 2I5JB 2B56A 2U1AA 4H4OB 3W9JA 3CJ3A 5GADU 2RQ4A 2PA3A 3OTDA 1UVJA 2DR6A 1HNXJ 1FKPA 1ZYQA 1WD6A 1UWBB 4NOHA 2XB2D 1GTEA 1VQ5S 3P6YC 3PKMA 3MWBA 2FZKB 2PE8A 4DUYF 5KOWA 3M2RB 1NJZA 3VQSA 1JLCB 1FK9B 5F9LA 1RTJA 3A3NB 1OQ3A 3CXCR 1HD0A 3AQPA 3EZ5A 2ATLA 4K0KF 3CCWA 5F0UA 5F8JA 4USVA 4F4KA 1NO8A 5LMUJ 3KLEA 1ZOTA 4N41A 1IQZA 2AGOA 5BYSA 1Y3KA 1LW2B 2ZJRQ 1X7VA 2UV8G 5KFQA 4FZVA 3W2VB 1NJXA 3C6TA 1TV6A 2IM0A 2R9LA 2XO7A 5K14A 1U1OA 4IH6A 3SSRA 1VBKA 3D0HE 1C1BA 2BQRA 1U2RA 1NRKA 1IBCB 2ABYA 4ZCMA 2XMAA 2QSWA 2Z56B 1DQ8A 4ECUA 2HMIB 2PIIA 2AP6A 1W26A 5CZXA 5I42A 1U1QA 5HMZA 3EX7B 2CNOB 5GAGI 2MY7A 3LP2A 1R0CB 3TVYA 1HYSA 3I0SB 2MJNA 3WBZA 3BGRA 1WACA 2ZHBA 1QTMA 2G0IA 1KHVA 4USKA 1WHYA 3DI6B 2G9OA 2FHJA 3MM7B 2VG6A 3W5XA 2O67A 3J7Z5 1JB0C 1WEXA 1HARA 3QGIA 5D4LA 5ETLA 3PJ9A 5DQGA 3DRRB 1PBAA 3SSSA 1C0UA 4KSEB 5AXNA 1DY3A 4UW2A 2C22A 3VAJA 3PO5A 1FERA 2JHEA 4NA2A 1U6FA 3VQTA 4DR4J 3GQCA 3NGKA 2UUBJ 1F2GA 1SJFA 4F4XA 1SJ3P 2E1MC 1FDDA 2LDYA 2Z2YB 2MKIA 4Y65A 1XWLA 2NR0A 4AQYF 2W2MP 4ZVUB 2WCXA 2W25A 2CJQA 2I0XA 3NGSA 2BUNA 1OSCA 2EW9A 4LRCA 2R3VA 4I7FA 1QY7A 3OR1B 5AE2A 3MMCA 4Q5VA 3KHRA 1VYAA 4PWUA 2AT1B 3SYZA 3OHAA 1FX2A 4LFCJ 1U1MA 2OPRB 3NMAA 1TZ0A 3UNGC 1NK9A 1FX4A 1P8GA 5KG5A 2XY5A 1FWKA 4Y28C 4DXLA 2HEKA 4XPCA 1RT5B 3DRPA 4MMOA 1M5SA 4R25A 4LR9A 3HHEA 3UI3A 2LECA 1IQTA 3OL7A 1TKXB 2WTFA 4WBFA 3NKYA 3CCSS 2AJ4A 3JB9k 3VAMA 3UN2A 4O0NA 2XHWA 2XSFA 2WSCC 3RUBL 2A6MA 2HRYA 4YOEA 5HK4A 1RTZA 1GK8A 3UN5A 2CA9A 2KL8A 2LA6A 3C19A 4IH5A 2CQCA 5KT3A 3M8RA 3C16B 1HIYA 4HVZA 8AT1B 3DXBA 2MGZB 5AXMA 3GV5B 5FLXY 4MIBA 3KK2A 2K7JA 2FDNA 1LWCA 4MIAA 4DF4A 3DM2A 2VQEF 4PG5A 3MEEA 4UUWA 2XI3A 2YNGB 3H7HB 4LRAA 2ZH5A 2RNEA 4KV8B 1FRKA 2IAJB 5C5JA 2HURA 3QQCD 3ISZA 2N4CA 3TA1A 4CQ1A 4W98A 3CCVS 3AXMA 2I5JA 4WYLA 3HSZA 2HNDB 4C8LA 4CT9A 2QX0A 3QWPA 1RT7B 2W1BA 5B7WA 4KHPF 4ZVHA 3IM8A 1X31C 4P2FA 2V5HG 4NEZA 4LBHA 3PNIA 1SC3B 3I82A 3ZFVA 4RKUC 3QFHA 2CQHA 3GCWP 2Z2MA 5AT1B 4G3IA 3OR2A 3TJ8A 3BBCA 3M2RA 4KRWA 3VZHA 4JB8B 4PAAA 4WP3A 5LOQA 2MHNA 4ELTA 3PV8A 5CHCB 2PT0A 3I96A 3ZZUA 1Q86T 5IFMA 5J1EA 4RUHA 2EFPA 1I51B 4F0HA 1J5EF 2IIHA 3K8VA 4CO3A 5L1IA 3T1YJ 3OXLA 4RWXA 2UUAF 2D3UA 2GZOA 3CJ2A 2F63A 2QFJA 3RJMB 4JI0J 3R3TA 4RW9B 1LW2A 3W2VA 5F8LA 4KPCA 1S49A 2M7SA 2CPHA 1FRHA 4RUCA 5EWGA 4DV7F 2HHHJ 1IWAA 4ZJOA 1JIHA 2WVBA 1WC1A 1ZTTA 3IR7B 2WSEC 5G4DA 2XM3A 2FB0A 3T6BA 2HMIA 3CEDA 4C9DA 2HFVA 4E8UA 4JI7F 4IOAQ 2WRMA 3UCGA 3ADAC 4ZPTR 4U8YA 2HQ3A 1T9XA 1LFPA 2V50A 5CABA 4A8FA 3M30A 1UJ4A 1IBLF 4NYOA 1P9QC 2XY7A 3T1HJ 2DGVA 2OSQA 2YKPA 3I0SA 4USUA 3GYNA 2YKMB 3BKTA 3GJSB 2DEIA 2V63A 5KFAA 1RAEB 4B17A 2BE2B 2H5JB 2MZRA 1IM6A 5FJ4A 3BGFA 4B3OA 3MM7A 3HK2A 4LVOP 1TK5A 4RBUA 1KVKA 4JUZA 1T3OA 1RCXB 1LQ9A 3DLKB 5E3RA 2BBEA 2HVHA 4DR3F 1HA1A 2ZBIA 1VHFA 5IWAF 2AYGA 5F8IA 3DRRA 2GA7A 3KJVB 3HCXA 3IRWP 4ZLPA 1F3VA 4QWEA 2F9JA 5E41A 4A8SA 4NZ6A 5EUHA 3TZYA 2X1BA 5HQMA 4P72A 2DNHA 3HVRA 1F9FA 4GVBB 2EWHA 4A8MP 2PD1A 3W2WB 3V6JA 1VC6A 2CPEA 1WELA 3F41A 4KHRA 3SSQA 5F8MA 2CYYA 4E2FB 2FC9A 4ECVA 3GSDA 3PDNA 4DFJA 1OPIA 4B3RF 2DR7A 3RTVA 5E0OA 2KVIA 2XZWA 4QQBA 2YH0A 4YDXA 3LANA 3RAMA 4F3QA 2VQFF 2Q6BA 4N8NA 2IY5B 3OR1A 3G86A 3BGLA 4PQUA 1CJUB 3RBDA 4DV5F 1S77D 2H3EB 4HKQA 3VVUA 4NEYA 2UUCF 4RBVA 2W7AA 2HWHA 2M9KA 1VOMA 4QYZK 2OTLS 4RNNA 1WEYA 1KFSA 4K59A 4ED6A 1VQMS 1RT5A 1VQLS 3I5BA 3OFEA 3PW7A 1PILA 3NMRA 3HPOA 4JI5J 2XLKA 3R5BA 2YNIA 3ZTSA 2F8HA 3J81U 4HT5A 4Q2LA 2BACA 1TKXA 2W4PA 1N36J 1M5HA 2J6UA 3MMBB 1IKVB 4YB6A 4J9UE 3Q83A 3RB0A 4HR2A 2R2TA 3TUIC 3JSYA 2FY1A 3UNYA 2LCWA 5KTQA 2E1CA 4C11B 1RWUA 1KTQA 2JNJA 4F67A 3AOBA 4A8KA 4Q45A 2HVIA 1Q1KA 3L7OA 2BJ8A 4TU9A 2CQ0A 3C16A 5GMKa 3QFWA 5A8RB 3KLGA 1UFWA 4WFYA 2MGZA 2XI2A 4LF9F 1SKSA 1IJFB 1SIZA 3TA2A 1Y3JA 4ED1A 1XEZA 1SH2A 7FD1A 4FS1A 1VLYA 2PEBA 1Q7LB 4TXSA 3MD1A 5EN1A 2AW0A 3JYTA 2D7SA 2EI5A 5EWEA 2GW8A 3KLFB 3DLEB 2N4DA 2K1RA 5C25B 1IBKF 3BPSP 2HG4A 2WVEA 2VKZG 2HLUA 2KZZA 5KFCA 2GVDB 1JLFB 3KTQA 3MFHA 5CAAA 4IG3B 5ETMA 1X9SA 2VFUA 3OFFA 2HQFA 2HNDA 1H2TZ 3ZZTA 4NXMJ 4OJ1A 4Y0FA 2DJWA 2MKYA 4ZVQB 1U48A 1B3TA 1RK8A 1VRUA 3NWRA 1SQFA 2JRSA 3J7AN 2BYCA 1A0OB 3VAHA 3QSYB 3BQ2A 4X4PA 4H4MB 3N6NA 3QPIA 2EKYA 3NY0A 1EQMA 4MAKA 3RU0A 4OZ3A 3M6VA 3ZO7A 5KT4A 2J9DE 2EK6A 3KG0A 4WPAA 5L38A 1U2FA 4Y2IA 1GAOA 5KFRA 1VRQC 2B3TB 4ZLNA 3PHTA 3NP5A 3B8HA 2VPZB 4F36A 4HHJA 3BM7A 2ASLA 3VVTA 3V4IB 3HT3A 2YQ0A 2LEAA 3HFKA 1SUQB 3KXDA 1H73A 1RDRA 1WDDA 2MEWA 3H0PA 1NH7A 1M1GA 1X5OA 3ONQA 4DU7A 2P9EA 3ENVA 1WKKA 1Q8BA 1X9WA 2CNNB 4XAKA 3H5SA 4WZQA 4L75A 3E01A 1U1KA 2KRRA 1XTZA 2CQIA 3ETOA 1K73T 2EXUA 2Q6CA 5CYQB 3GIJA 1Q82T 2OEJA 2E5LJ 4P2MA 4CLKA 3HVTB 2AJ2A 4ITSA 3X3UA 2BE2A 2LEBA 2I2YA 3AA9A 1WC0A 2DY1A 1X5PA 2FD2A 4FF2A 3GJQB 3UW1A 3I9V9 1HNWJ 3IAM9 4C4WA 1JWWA 3D6FB 1FF2A 4FS2A 3DGVA 1YG0A 2LXFA 3DLKA 1G1XA 1NXIA 5THWA 4LQ3A 2A6OA 3PO4A 3IA0A 1M5KC 1OS5A 4AUKA 4GKKJ 1OPZA 3KJVA 2VG5A 4IQXA 5F41A 1HBUA 2KM8B 3OVBA 3AA8A 1YJTA 1FJEB 2LQJA 2R7UA 4ER8A 2ZOMA 3NOGA 5KFKA 2UU9J 4ERDA 3R1LA 4DR6F 1KP6A 2H1YA 2W9BB 3QT5A 1UMJA 2HQGA 4GVBA 4EI2A 4HYKA 5A8WB 4ZS6A 4RNOA 1E6YA 3QJLA 4YEAA 4O3QA 1FJGJ 3WX8A 3NCQA 3NRBA 1N5QA 4HTJA 4L74A 2L3MA 2HNZB 2FJEB 4LF2A 3JTNA 5M2PA 2RQCA 2IC3A 5IXUA 2IRUA 1NZAA 3GILA 2V4QA 3I0RB 3HHNB 3PIOQ 1BY9A 4KH1B 1CJUA 4AL6A 2RMLA 1IBMJ 4ED2A 1S0VA 1S6QB 2MQOA 1UVIA 2PA8D 4DUZF 4NZ0A 2BRLA 1RAHB 4XTTA 5K9FA 3TQEA 4NLYA 3HD1A 5F8NA 2DNOA 3OTOF 1C0TB 4F3OA 2Z30B 3GIRA 4LFBJ 4UY8T 2NSBA 2BR0A 2OSRA 5KOXA 2E5HA 2ZJPQ 4C0HA 4BS2A 2Z0GA 4DV0F 3U7JA 1S1XA 4K4XA 6AT1B 2MKKA 2J7WA 4KR0B 1X4DA 3PXGa 4JBCA 5D6GA 2RDDA 3JAMU 3UD4P 3GCXP 1UL3A 3FBCA 4KAIA 4R5PB 3KMQA 1IKVA 4Y00A 2NCKL 1P27B 4DV6F 2YX7A 3DCAA 1S97A 4DCJB 3TX0A 5L1KA 1IN0A 1S7IA 3R5AA 2M8HA 4P7TA 4LF8J 3FSIA 4LF5F 3NEKA 4L72B 4GO5X 1RWMB 4DV3F 2COLA 3HSDA 2DNNA 1U24A 5H9EJ 4LSNA 1CULA 3NXZA 2E9RX 5A8RA 3D5MA 3VHQA 5L9NA 2BVZA 5KG2A 4M94A 1M5PC 1TKZB 4CM0A 3MCOA 3M05A 4O44B 1Q78A 3QGHA 2OPSB 1EX8A 1URRA 4QIFA 1GNKA 4JI4F 3BR8A 3QIPB 4N5SA 2HQIA 2UVUA 2ZD1A 3KLFA 2C2KB 3DLEA 4KY3A 5C25A 2E66A 5SUHA 3RZAA 3SZ2A 2KI2A 1S6UA 2GVDA 1WC5A 5GAHI 1JLFA 2CNKB 2KM8C 2QLBB 4IG3A 1U6ZA 2W2OP 1NK5A 4F3MA 2FJDB 2KFNA 3OVAA 4P75A 2ZC4A 2YNHB 5IV4A 3TUPA 1NAQA 5BYRA 1YZ7A 4DZ6A 2C3YA 1BMQB 4R0JA 2CFXA 4J9MA 4ILLA 1YRUA 2HIQA 1NEEA 5D0RA 2KHCA 1RHUB 1YHQS 2UUTA 2WVDA 3DOLB 4C2MA 2B8QA 4WXOA 1WG5A 2O1PA 3AFGA 2A2DA 2UUWA 1DHMA 4WJBA 2KG1A 2N3LA 3O2IA 1U8WA 3WIVA 2CWXA 4RJVA 3N6LA 4PG7A 2OMLA 5HQLA 2DHSA 2EFVA 3V4IA 4FVCA 4L76A 4RZRA 3Q0AA 4A8YA 2ZKTA 1KDNA 2MQMA 2NPFA 1XC9A 3K5PA 4IQMA 1QAIA 4RUBA 5D78A 1KRPA 3L09A 4QCLA 3KK1B 3R2CJ 2A10A 3QT8A 3AXKA 5D0HA 1Y5IB 1MWQA 1JQGA 4DL2A 3KFWX 4DS5A 3MXHP 1RHRB 2DPJA 1ZTWA 3DU5A 3QMQA 3D68A 3GG0A 1R8AA 1VR6A 1TTHB 2WBRA 1RBAA 3U02A 3C2PA 5KG4A 2EG2A 1YGYA 3CJKB 5MLCV 3QAEA 5FIIA 1N34F 3B4MA 1RTHB 5D3GB 1XQIA 1VQ6S 3FVYA 2HHPA 2HNYB 1Y5LB 2GNKA 3KLHA 1MN9A 3T9ZA 2GIFA 3M2VB 2QLFB 4O3OA 4BWMA 3CCQS 2EC0A 2YKAA 4JYAF 2RAQA 1RKIA 1JLEA 3IWLA 3VCDA 3CCRS 4AXIA 3DKDA 2HHQA 2C2EA 1UFKA 2HYIB 3CDWA 2DYAA 1KWMA 2CIMA 1CJVA 4FF3A 3ZTQA 5A8WA 1JJ2R 1RISA 1R43A 2DNMA 1ZPVA 2GMJA 1FFSB 3EUNA 2XSJB 1E6VB 2IA0A 2DNLA 4I69A 2VFSA 1PO6A 1JKHB 1CPZA 2Z57B 2DCLA 3LO3A 2MB0B 2VOPA 2HNZA 2DR8A 4IUFA 1FTCA 2HBRB 4P52A 3QWUA 3Q2TC 5HBMB 4DR5F 4ID8A 1KBRA 5G0RA 2V2KA 2XC9A 3UCUP 4PXDA 4U9RA 1C1CB 2BA9A 3A3PB 3QIDA 4P9SA 3AY0A 2JLGA 1S6QA 4ECSA 3KMSA 4K7QA 3HF5A 1KR4A 1R6YA 3VGSA 3BO4A 4NLOA 4B9LA 1HFEL 2WAQD 5L39A 4C7QA 4OI6A 4ZVSB 1WHXA 4OZ0A 1C0TA 1GMUA 1RKJA 4M1KA 3D28A 1F0XA 5A6WA 1W2BR 2ZM6F 1QAXA 3G8QA 2JEGA 3IRXB 4PUOB 2D9PA 3GTYX 2HW3A 4U7UD 3MPDA 1GX5A 2QA1A 5A8KA 4O0IA 5DLGA 2HZVA 1X4EA 2V0NA 1CJKA 4WXWA 2FJAB 1YBTA 3N79A 4WE1A 1EHWA 3RYLA 2HQCA 1OYEA 4Y2KA 1DLOB 2CQ2A 4USWA 5D4NA 4CLWA 3BH6B 4I56A 1HNXF 1UAWA 2EBGA 3CCES 4B9VA 4Z2XA 4FVMA 3THVA 4OJ3A 4YR3A 5JJBA 2WZ1A 1XK8A 2UXBJ 3RB6A 4CO5A 4X65J 1K44A 2MDAA 3DXSX 4EZ9A 3P45B 2BKNA 2R2RA 4DPWA 2HPUA 1TKZA 1MU2A 4X64J 4KGVB 1FRXA 4O44A 3HMJG 3HD2A 2XHCA 3DHXA 3MFIA 2OPSA 1H3DA 5I3UB 2AYEA 1EKSA 3QIPA 2B0GA 3KWMA 4BC9A 4DPTA 5BR8J 3Q8SB 1RYRA 4FBUA 5LMUF 2HHTA 1P1TA 4D3GA 4I2QB 2H9ZA 5CXTA 4X66J 4ZP8A 4YR0A 5C42A 2VDHA 5K8MA 2DNRA 4M5DB 4KB7A 3V81B 2IJNA 1HWKA 3H4BA 3MOZA 3MR3A 1XMBA 2FHJD 2YNHA 2BQUA 2WB1D 4QWAA 1KC8T 2BQ3A 3BSNA 2X3DA 2M2BA 3OLBA 1DTTB 2ZJQQ 4B3MJ 1T7PA 1VQYA 2YXLA 4X84A 3F56A 3PCOB 2CQBA 1RAFB 3CUNA 2V4RA 5M2UA 4NLUA 3DOLA 4FXWA 1WOOA 3J7YI 2JSXA 4UOCA 1SI9A 1D1UA 3NNAA 1IR0A 5DG8A 2B6AA 3HHLC 4ANEA 3US5A 1YJVA 4DG1B 2A1BA 1AROP 2OPPA 4ZP6A 2MMYA 5GMDA 1KQFB 2DB1A 4PG8A 2ERRA 4OZ1A 1WDTA 3MR2A 3GLJA 2J0SD 2GO9A 4A4JA 1CC8A 3KK1A 5FLXU 3HHKA 4HI2A 2UUBF 4DV4J 3UWTA 2W4DA 1RA6A 2HS4A 4ZPDA 4HTIA 5CCMA 2CJBA 5D8HB 4QR0A 2JVOA 2J0XA 1PAEX 3MEGB 3CULA 1HNIA 2H5EA 3C66A 3IMQJ 1HBNB 2JJ4D 4K4UA 4USMA 1SH0A 1D3WA 2KVQE 4IG0B 4DPUA 5D3GA 1LKZA 4USTA 1HWUA 1F5CA 3QGGA 3TO8A 2HNYA 3BDEA 4DOZA 4WYWA 4O3RA 3BSOA 2X7IA 4RL1A 2FC8A 2HGNA 3M2VA 2ROEA 3UN3A 3CTRA 1FFGB 4AT1B 3J80U 4LFCF 4EK2A 2CPZA 3PM9A 4OYOA 4X4NA 2NZCA 5J1NA 1N32F 1FFWB 1Y0HA 2LEPA 3D9BA 1QDUB 4Y34A 2QL9B 3SI8A 3QYYA 3VALA 1Z1ZA 2MYFA 1UA1A 3IC1A 2IM1A 1PG5B 2J7UA 2GS8A 2QG9B 2YWHA 4LVNP 1FVQA 1JKHA 2JEFA 4W92B 3W5YA 2Z58B 2AGQA 1DZ5A 2IRYA 4H4KC 4O3SA 2MHEA 4B02A 2HHWA 3FNNA 1A9NB 4K4VA 2JX2A 3FJ2A 5HP1A 1ZA2B 4DBQA 4DSJA 1C4CA 2J9DA 5EX0A 4KGXB 1DTQB 2FVCA 1TVRA 2H65B 2VBXA 5GAGU 4OX7A 2GO8A 2MLYA 3FUYA 2E5JA 2H4YB 3DMJA 2ZVSA 2WW4A 4W4MA 3DRSA 3DNCA 3NCPA 1NK6A 3HVAA 3QATA 5B0DA 4ZK7M 1JLAB 2ZEJA 4DSKA 4QJVA 2BRKA 3CD0A 3LOUA 2V4JB 1X0FA 2EVZA 2F7VA 4JV1A 2VPWB 3KLIB 1JK9B 3I9ZA 1YBAA 1UW9A 1RT1B 4J9KA 3T5HA 4IDKA 3G8TA 3IRXA 4PUOA 5CYMA 2RU3A 1BWVA 3FQLA 4JV5J 2ZFHA 1S5ZA 4MKYA 1NKCA 2VONA 1DAXA 3NGDA 1FT8A 2JH3A 3Q8UA 1R3NA 4YP3A 1X4BA 4K5SA 3CJTA 3LAMA 1SCJB 1K0TA 1OSDA 1QM9A 2HK2A 1CJTB 3ISNC 1XIQA 4E98A 4FPIA 4ICLB 5A76A 1TMMA 2V2VA 3BGOP 3VGVA 2BJ1A 1T03A 1B0PA 5C24B 3WZ0A 1JLQB 4B08A 2OJ3A 3G6YA 5I3UA 1VQPS 1EZZB 3A12A 2DPIA 4OLPA 1PSDA 1R0BG 4JI3F 3T1YF 3T5JA 4PQAA 1OMSA 2CDRB 3OXGA 3ZTOA 2IYIA 4JI0F 2VA2A 1S9EB 2IA6A 1AT1B 2RRBA 2FGCA 1IVZA 2BJ7A 3OPKA 2AJ0A 2HHHF 3QNWB 1S9GA 3PEHA 3OD2A 4H4KA 1U6BA 1OWXA 2POKA 1FVSA 4M5NA 1URNA 1R27B 3ET6B 3TI0A 4OYWA 2Q79A 3QLHA 1RHJB 2CVEA 5EDWA 1A6LA 1NJYA 5KFVA 4WFNQ 4EGLA 1QAJA 3TVZA 2H5IB 2O01C 2JFKA 5L8RC 3RRKA 3F0NA 3T1HF 3PJXA 2FTRA 5DDQC 4CZCA 5U47A 3D1HA 1SH3A 3W65A 2HZCA 3VTIA 1HLWA 2YQ1A 3FKBA 2IJRA 1HPZB 2BXJA 1WG4A 1YKWA 2Y0SD 5F8GA 3KOAA 1A7GE 3M8QB 3DLLQ 1VHIA 2LU1A 1YBUA 1REVA 1TAQA 2CJXB 3M9MB 4JOUA 1WOSA 1X5SA 2WBMA 2G1DA 4ZP7A 3ILIA 1MW7A 1WSVA 2G13A 1WHWA 3KLVA 1DQAA 4DUYJ 1N33J 2ZDPA 2ASJA 3H40A 5KG3A 4LR8A 2XBPA 4ZVTB 4BC7A 4ES1A 3K89A 3MEGA 2C2OB 3RAQA 1SVDA 3AD7C 1EETB 3C15B 3B6BA 1SBRA 4WTYA 3EJMA 4JV2A 2KYZA 4MT1A 2XLJA 3HP6A 1MMNA 3CC7S 4PG6A 3K57A 1NKBA 1F5BA 1BQNB 4ZPBA 4ILRA 3IBCB 3RR8A 4NRTA 3EE3A 3MUVP 4K4ZA 4OHWA 2WOMA 4FKYA 1VRTB 3QJPA 4Q0BB 2CPJA 1ZM2A 1TL5A 4JI5F 3JTOA 1I94J 2B43A 1T3NA 2J0QD 4ZIVA 3BB5A 1N36F 2DIUA 3M6UA 3LUYA 3MCNA 2WONA 2YKQA 2W01A 2NXCA 3EPGA 4OYIA 2ILZA 2NQPA 4LRFA 1FNOA 4ZCIA 1RT2A 2E44A 2HWTA 3UDLA 4A8OA 2OD6A 2F5GA 2WK4A 4PYAA 5A2QY 4LMZA 3SFUA 3TZZA 3EPIA 1CQMA 2IFXA 2BABA 4FXVA 2LQ9A 5HJXA 3VGTA 3LGNA 3W9HA 3GB0A 4CO0A 4O23A 2BDPA 5GAEI 2IM2A 4WKRA 3CVKA 1TV6B 2B4OA 5K14B 3AJDA 2M88A 3OXFA 3SMZA 4HHUA 1JLAA 1LXJA 1RTIA 3OTBA 5KT7A 1N8RT 1B70B 2V4JA 3QBCA 2JFDA 4NWBA 3PIPQ 4HT7A 3TA0A 4WP8A 1LXNA 1RT1A 5DM7Q 3G8SA 2ZUGA 3DFEA 3R7BB 1UEUA 2Q1LA 5HMWA 4AQYJ 2ZC3A 3OT9A 1WI8A 3LP2B 2GAGC 1UPPA 3H2VE 1UEVA 2HVZA 5E3AA 2V68A 4Y2CA 4X4RA 4J90A 4ECQA 1YDLA 3A8IA 5LJ3Y 3H5XA 2Y9HA 3W8GA 1CJTA 2O3DA 4NXMF 1Q5YA 1N5YA 2DVIA 3UR0A 2RQKA 1ZPWX 2KJWA 2V8PA 3TUJC 4YB1P 3IBFB 1SJ4P 2UV8A 3TJ9A 3M6WA 3P5TL 4RU9A 2GC8A 3RGIA 3EZUA 3GFXA 4BCAA 1X4CA 1S4FA 4DR1J 3EDRB 1WORA 2R7WA 4AFFA 1FI4A 3RB3A 2BMBA 4JI1F 4RBTA 3JSMA 4NLDA 1VBXA 3CDEA 1KNZA 8RUCA 3JTPA 3W60A 1S9EA 5I3PA 4PWDB 3M8WA 2WHOA 1HNVA 1DQ9A 4OJHA 2F65A 3W63A 4IO9Q 2QMUB 3MM9B 1CEZA 3Q8RB 3T6JA 2DR9A 1S1UB 3CDAA 3HDSA 3W61A 3TX8A 4BLGA 2PO4A 3H5YA 2AQ4A 3I56S 4P71A 3POTB 4Y6IA 2MY8A 3ET6A 4DCOB 5L9XA 1IUJA 1O0PA 4O3NA 2B5JB 3B82A 4ECWA 1FJ7A 3U1LA 4TY8A 2XCPA 3VV2B 3L9ZA 5ETVA 1CG2A 2YKNA 2R7OA 2E5LF 3SQGA 4DU8A 2MSSA 3JSRA 3CPWR 3KG4A 4QOTA 1HNWF 4TYAA 2GJ2A 2JZ5A 1HPZA 5DG9A 5EWFA 1ZM3A 1S4EA 3CC4S 1WEZA 4DCPB 4GKKF 3GV8B 4WK1A 1NNDA 1H98A 1B4SA 2GIRA 3P4UB 4KBIA 2VD3A 3ILJA 4NCGA 3M32A 2QYCA 3SFGA 2I8EA 1F1BB 2UU9F 3DU6A 2GJIA 3FZBA 2GHVC 2P9CA 3E2EA 4B3TJ 2VFVA 1TL3A 3DDIA 1WKLA 3OSNA 5DZ7A 4DDFA 5DG7A 1L3UA 1U2CA 1FJGF 2HGMA 5DGAA 1YJ9S 1PJ7A 3M6XA 3PJWA 4OQJA 3PW2A 4ZMMA 4ANCA 3RG6A 3ENAA 3JQMA 2FZGB 2O5DA 1EETA 3SXLA 4K8RA 1JXVA 1Y9OA 4DQQA 1VC5A 3BN4A 5IT9Y 4NA1A 3AJ1A 1LWCB 4GRSA 3RW7A 3MEEB 3TANA 1KLMB 1S99A 2N3OA 2ATCB 1IBMF 1DJ0A 4CTAA 5KFZA 2XWYA 2AX0A 4CLLA 4YUDA 2CAJA 5KAKA 4B9UA 5DDOC 1UJ6A 1B99A 4DV2J 4DR7J 4Y2AA 3FC9A 2DCUB 3HZEA 4KHMA 3G87A 4NLVA 4LFBF 2JOQA 3GYXB 1VRTA 2YX4A 3IFEA 4Q0BA 4LUBA 3FSYA 4KYZA 2XGQA 2HLTA 3JXOA 4ZOSA 3G6ES 1IBLJ 1NSQA 2XYGB 4DL7A 2X1FA 1S72S 2QN6B 5FDLB 5DRKA 1GMVA 3OR2B 3W64A 4A8WA 2UXDJ 4CDIA 1RWWB 4TU8A 2OMOA 2PEHA 2ZITA 4M63A 5J1EB 1S1WB 1R8CA 2ZDOA 7FDRA 4LF8F 1WC3A 2RSQA 2J0WA 1KHWA 3FEXB 4M95A 2MKJA 2JVRA 2RHQB 3OLAA 1ACMB 3HVWA 5IT4A 3NGRA 4DL4A 4DS4A 4KO0A 1OY8A 4DQPA 3PX4A 1NPKA 1KVIA 1X4FA 3V6DB 2DGWA 4DWIA 4F26A 5JXSA 4DL0C 3AOAA 2OGUA 2G2OA 2VZ9A 1MSWD 1RT3B 1U1RA 1FXRA 4MYUA 3FCVA 2KG0A 2CDQA 2Y8WA 3IR6B 4TLRA 3M30B 5KG1A 4D3HA 4Y3CA 1AW0A 1RUSA 4RUAA 3K5NA 1WTFA 2HWIA 4JI8J 2VQFJ 4B3SF 1FNXH 2EFQA 3DDNA 2X3GA 3C46A 2V2QA 3PX6A 2YWFA 4B3OB 3PW4A 3L4BC 3Q8QB 1KD1T 2B9XA 4ZCLA 3M8ZA 2RDJA 2MKHA 4F2SA 1JJ4A 1YSJA 5ETPA 1RWOB 4N47A 5LM7E 4QIWD 2BJEA 1F6TA 3FRZA 3BO3A 1R0AB 1NJIT 1U7LA 1V9OA 3SCIE 4FYYB 1RB0A 2R8GA 2GQQA 2QMXA 1UA0A 2KHDA 4OV1A 2CPFA 4Q8EA 1GFWB 3GFZA 4ENOA 4U67Q 4M5HA 4K2JA 4PWDA 2XG8A 4IO1A 1FJCA 2E5IA 3VAIA 4DPYA 4UF4A 1RHQB 4ETZA 4FYXB 1H2VZ 5IZHA 2BANB 3MM9A 4DPXA 1S1UA 2D3ZA 1XNRJ 5B08A 1L3VA 2BV3A 2ZNZA 1KTVA 4NI2B 2OLWA 4ZIWA 1FA0A 1ROFA 1O6XA 2P6SA 2FLNA 2Y1IA 3IGVA 4F02A 3POTA 2QSFA 3MPUB 4ZPWR 4PQUB 1UW4A 4NCAA 4ALZA 3DYAB 2B5JA 4USIA 2AHOB 2KB2A 2W8KA 4LIRA 4LRBA 3T3FA 3LWLA 2HGLA 4DEZA 4ED3A 2FQQB 2BE9B 1OO0B 4F8RA 1X0PA 3T41A 2CQGA 5HVFA 1FWPA 5GVQA 1BGXT 3MGJA 1LWXA 4PABA 4X4TA 3BYPA 2IBOA 5SZTA 2YNIB 4LBPA 5DGBA 2DGUA 3KYLA 4Q44A 1ZM9A 3FCWA 4ZVOB 2ZBQA 2R8IA 4DSIA 4TYBA 4O4RA 2V94A 4CWBA 4RU2A 4USJC 3MD3A 2A0FB 4MFBA 4CIOA 3N01A 4FXDA 3MHYA 5D15A 2ZZMA 2L08A 1U25A 1T05A 3R6LB 2DH8A 3GMGA 5GAHU 4BHQA 2YX1A 5DETA 1PJ6A 3KLGB 2U2FA 3CMES 1H6KX 2XMUA 4QYRA 1HQUB 3ZNJ1 3Q8YA 3OQ2A 1TUGB 2Q43A 3P5BP 1BC6A 2ASDA 2DISA 1SJ1A 4CLZA 2GMLA 1NSAA 4X62J 4OYPA 3JYTB 1PCAA 5BYQA 1KLMA 2P6TA 5KG7A 1Z4UA 4NZ7A 2ALYB 2K1RB 1N48A 2W2NP 2G4BA 4F7VA 2DHXA 1S1VB 4ECTA 1PC5A 5J2MB 1ZBTA 4ZCKA 1KQSR 1S57A 1S76D 1IKYA 2HSEB 5LJ5Y 2CJKA 1TELA 3HFZB 3K2YA 1D0EA 4CH7A 1QD1A 3MR5A 3UPFA 1CQNA 1VRUB 2L41A 5FDLA 1N0UA 3LALA 4XDCA 4AL7A 3MM6B 2B4VA 1DRZA 4UZBA 2NUHA 5LSRA 4DX8H 1P1LA 2ZOGA 2QA4S 4WK3A 1S1WA 1R8HA 3B54A 3HM9A 1H7WA 4P10A 1S12A 4AYBD 1RT4A 3CJ8A 3D3CJ 2C3OA 3S8SA 1LFWA 2AWZA 5T41A 2DO4A 2IMWP 4OLOA 3HFVA 3BR9A 2HRTA 2YVSA 3M8PA 4TU7A 2HAIA 3OV7A 1NMEB 1YJUA 3D66A 4X65F 3TW0A 3M9OB 3D6TB 4TKTA 5T7LB 1XNQJ 2R7TA 1PKUA 1GTHA 2QLWA 2Q3PA 4X64F 2N7CA 1NZ8A 3V6DA 1NDPA 1CC7A 5KFTA 2SXLA 2DNKA 3ZZZA 3E01B 9ATCB 2BOPA 2PSZA 1VQNS 2ZHOA 4KFBA 2EPIA 5BR8F 3HKZD 2HHUA 1UP1A 1RT3A 3UDCA 2D41A 2LQ5A 3I55S 4WFAQ 2JEJA 2C1EB 3EZOA 1QJHA 3D7SB 2CQPA 5K8PA 4OX9F 4FP9A 4NLTA 4X66F 5L1LA 3MEKA 1ZAXA 2JLEA 4IOBA 4QU7A 3MMJA 2C2ZB 4O4GB 2DNZA 2QL7B 3IWXA 2DITA 1F5AA 2AJFE 4HI1A 4K4TA 4DL3A 2UXCF 5F0WA 4C48A 1B0VA 3CF5Q 4B3MF 1PYOB 3MAQA 2VG5B 3T9NA 2HS3A 1HBUB 4DV0J 3HXMA 1R0AA 3UFCX 2J5AA 4HH0A 1GMWA 2OUGA 1GXUA 3MR7A 2DO0A 4NLQA 4M8LA 1WTBA 4I2PA 1OY9A 2YQ3A 3K17A 4JI6J 3M1VA 2R7XA 3PFOA 4OYMA 1V5IB 2JWNA 4H54A 2RRAA 1E6YB 4OZJA 1CLFA 1TAUA 3KK3B 4WWSA 3O8WA 2QC3A 2BANA 2RVJA 4GMKA 4IR9A 2IC3B 1X4GA 2VBYA 4LFAJ 1SC1B 4NI2A 2DXFA 5AJ3J 1KOHA 1TL1A 1JLGB 1FDNA 1NBEB 3WC2A 3DYAA 3CSKA 2AIRB 3FBBA 2VHGA 1H0HB 4EU0A 2CQ4A 4KQZA 1M0SA 1VQ8S 3BPDA 2E29A 2VB6A 3B4DA 1VGYA 3SCJE 1H2UX 1S10A 4JI4J 4KJIA 1LOUA 4ED0A 1Q95G 5IM0A 5B09A 3KKFA 1S1XB 2RUGA 4UQGA 5KFWA 3ZTRA 1EARA 2DNYA 4ZA1A 1LNQA 5KG0A 1TMJA 1F9EB 3O44A 5D77A 3E51A 1ZETA 3GIIA 2VJVA 3CC2S 4DR2J 2DGOA 1VBYA 5LMNF 4ES3A 5EGYA 5AXLA 4GC7A 1S6OA 1GXLA 2V2ZA 1NK8A 2QV6A 1HBOB 4M5IA 2J76E 1RCOB 2W2PP 2I1RA 3AQOA 3IM9A 1C4AA 4G1PA 4RNMA 1JNZB 3PYFA 4CH0S 4LSNB 1CULB 3R5JB 5KFUA 2V69A 2VFRA 2D69A 3LH2S 2CVIA 3TARA 2AMCB 2VFTA 3HULA 2CWKA 1BE4A 1WF1A 3UDVA 2C2RA 1HQUA 3JAMY 4JV0A 5HMYA 1FHTA 1YI2S 5DJBA 5KFYA 2OFGX 3T1AA 1KOOA 3H59A 1WF2A 2RKIB 3ZTPA 2ZD1B 4UTGA 1NK4A 1HHSA 4P2XA 3MM8A 3MZIA 2R2UA 3BSAA 1H38A 2AEJA 4P2SA 3O6QA 2E1RA 3AB2B 2A2CA 1YLXA 1S1VA 3ETMA 5J2MA 3J7YU 3K58A 1RXOB 4R8UB 1JLBB 3BKUA 1NH8A 2J7KA 2CZVC 1TFWA 4CNZA 1HD1A 2IVYA 2E9TA 4TLQA 2ADCA 2RILA 3B78A 1N5VA 4HH1A 3RR7A 3AOCA 2IVFB 5L46A 2QA2A 1BD6A 2PDAA 3ULHA 2PMZD 4LSLB 3D3BJ 4X4QA 4KGKA 4LF6J 1YJRA 3QO9B 1HI0P 2MZSA 3MM6A 2R7SA 1U1NA 1EQ0A 2DRAA 4QWCA 5F9NA 1D9FA 1RBOB 3SV3A 1N34J 5LSLA 3R5DA 4WFXA 1Q8LA 1HI8A 1NDLA 3SCKE 3WX4A 3EGZA 3HHDA 4J9VA 2VDIA 3G4SS 1BUXA 1K8AT 4JYAJ 4F25A 3BJYA 2F8EX 1K0VA 1I6JA 1S1TB 1VK3A 1YRTA 2RD5C 1VDHA 3G6VA 1B7FA 4F2RA 1T8EA 3JS9A 5T7LA 2UZAA 3T5LA 3A3OB 2Y1LB 4P73A 5K20B 1OIAA 2LLZA 4M5LA 2JL9A 4FF4A 3LW5C 1LK5A 2ZUAA 4CLTA 2B4UA 2VL1A 3R7NB 3CD7A 3EVMA 5KFGA 2YWGA 4RX6A 1V6HA 2WB4A 3U1NA 3CJ5A 1IM4A 2OEMA 3SQOP 1YQHA 2WVCA 3CCLS 4J9NA 2QO3A 1S6PB 1Z2LA 1P9YA 2AJ1A 1RWPB 2HVEA 2YH1A 2ACYA 3D1OA 3RB4A 4LF1A 1RBLA 1V3SA 4O4GA 2HBZB 2J6TA 4A8QA 3GFHA 1OJ4A 4OL8A 3MDFA 1REGX 3KLHB 5H9EK 1HQEB 2LYVA 3H8YA 3MMAB 4G6VB 5K5MA 2DGTA 1JLEB 4ED7A 3FRYA 3R9LA 3GR0A 2I9SA 1W25A 1S7HA 1LW0A 2GMHA 5HQ8A 3I87A 3N9UC 3KUEA 1CJVB 2KYXA 2GHPA 3TJAA 4QR2A 3OL8A 3H4DA 3ISND 3OVSA 1S9FA 4I68A 3PYGA 2ROPA 2KFYA 1SQGA 1RSCA 3I6PA 1TKTA 1FRMA 5A2QU 1F2HA 4U96A 4IFYA 3VR1A 5KFNA 2E7VA 3KK3A 4YR2A 3CWJA 4XO0A 1MROA 4DX6A 4X4UA 3TWZA 2VBWA 2P9GA 3NAIA 1QSSA 2RF2A 4LREA 1XMOJ 1ZH5A 4NXNF 4AL5A 1RI7A 5G0RB 3GJRB 2CUYA 4USHA 2H51B 3NBPB 4I4BA 4RNHA 1IKWA 1JLGA 1RAGB 3OSPA 3O5TB 5J2PA 1KVJA 4OZLA 5GMEA 4KTQA 4U7UK 1N33F 2F8MA 4ZVGA 5DQHA 1NDCA 2J9CA 2MJUA 3OJSA 5ETSA 2ZH7A 4LJMA 1VI7A 3V6KA 3A8EA 2QLXA 3ZZPA 1MG7A 3ZZOA 3Q89A 3I5CA 5AE3A 3V2UC 2MZQA 1U47A 2NYIA 5EHHA 2CPXA 3CT9A 2CQ1A 3Q8VA 3D4JA 1Q81T 1M1HA 5IC4B 1S0MA 2ZH1A 1SQEA 2YKOA 5A8KB 2XWXA 3CMQA 5B0FA 4DV1F 2DHGA 1CJKB 4LF4J 1HW8A 4KPYA 3TAQA 5HN0A 2B8PA 1G6BA 4QWBA 5KFMA 3TUZC 5A6PA 4WE1B 5T14A 4B9MA 4ES2A 3MM5B 3EM1A 1YZ6A 4RLEA 4GVLA 5IQQA 3S7RA 1WJ9A 1HBOA 2BKOA 3ITHA 3HSGA 1FEHA 1DURA 4X4SA 1O51A 1G4CA 4DFMA 5RUBA 1I94F 3SDEB 3LA0A 3M7VA 2DGQA 4P74A 2VJUA 1MU2B 1GEHA 3UE2A 2PC6A 4NMXA 1V3RA 3N6MA 4OI4A 2IBKA 4F04B 1YITS 1PJ5A 1BXNA 4XK8C 2RKIA 2NYHA 5KFJA 2KT3A 1FESA 4Q2MA 1UEKA 3HX9A 1HMVB 2KDOA 4QIGA 4LRDA 3DOMB 4R8UA 1WF0A 1JLBA 5C42B 4TNOA 3TP2A 1N56A 2Z4PA 4KGZB 2WVFA 4UUXA 1L3KA 4LF7J 1SC6A 2DNQA 3WQPA 1HNZJ 4EO8A 1ITPA 3N0VA 1SKWA 5CD4A 1TL7B 2FLOA 3DOKA 5D4OA 1Q79A 2BX6A 1C2PA 4LSLA 3CD5A 3QT7A 2DNGA 3ZC4A 4OHZA 3QO9A 1NK0A 3HJFA 3DGPB 2N7YA 2IDLA 1VS3A 2ZWPA 5KFLA 2W9AA 4JP8A 4ELUA 1NHVA 3QRPA 1PYSB 4KKOB 3ICLA 1EAYC 1LWEB 1PYTA 2CJ9A 4HDHA 1ZS6A 4YY3J 3Q8PB 1W2IA 2B6AB 3ZZYA 1HKAA 1S1TA 1WUUA 2C28A 2MQLA 2OPPB 3MECA 3CCJS 3BQ1A 1T9UA 3BSCA 1N32J 2ZE2B 4GO7X 3HT0A 2CNLB 5E2QA 4ZVPB 3HLUA 4DR1F 2ZBRA 3I31A 1AFIA 3PG9A 1RGVA 2VASA 1U4BA 2D3O1 4DUTA 5KFHA 5IC6B 3ZNUA 5IT9U 1S6PA 3AH6A 2OTJS 5CQGA 1R8PA 2RDIA 4YB5A 2EEYA 1Y11A 1FRIA 2XEXA 3CCUS 1HNIB 2W9CA 3QJJA 3KJNB 1KSPA 4DI6A 3GV7B 2FVSA 1OYDA 4KT0C 2PFDA 1FRLA 3NGTA 1HQEA 1T9VA 2OHDA 2XMWA 1AB8A 4DFPA 4DL6A 2F4FA 3MMAA 5B0CA 3FMWA 4MKVA 4RW6B 3FK4A 3NS5A 4GC6A 3AT1B 3VGUA 2LA4A 2RHSB 3ILOA 2KT5A 3HJVA 3NNCA 2W8LA 3HKWA 3IWNC 3PR5B 3R8YA 4C3MA 3H5UA 2XMMA 2W4CA 4ECZA 5GAEU 3LQVA 1JX4A 1XN9A 3EGNA 2NXJA 4X4OA 1I5OB 4HACA 3PZPA 2XS2A 2XYPB 2NUUG 2DT9A 2ZOFA 4KIAA 4DQRA 2PMWA 3LF0A 4H4OA 2A3JA 1X60A 2X1GA 2C2DA 2K7KA 1UWBA 1J27A 3NBPA 2I38A 5HP1B 3UD5A 1SIWB 3J80Y 3KJFB 3PTWA 5E5NA 4OYXA 1TVRB 1RAAB 1UVMA 2Y3YA 3E8OA 3HHLB 2OI2A 2AYBA 4B3TF 3DMJB 1JLCA 1FK9A 3RBZA 4C8NA 2NSCA 1NK7A 2F4VJ 4FBTA 1UPMB 3DRSB 6FD1A 4JI3J 3TAMB 1RE1B 1U02A 1X4HA 3L7PA 2MQQA 2W7PA 2DH7A 5LSOA 1RQ0A 4YDDB 1FD8A 1U26A 4ZVFA 2B9EA 3TVKA 1TUWA 4WP9A 4JI2J 2CADA 2V6AA 3V4MA 3PX0A 4IDKB 1EJ7L 5CYMB 2GVZB 2EK1A 2HHVA 1D8YA 3D2WA 1Q16B 2MZTA 2ZKUA 3N28A 4QW8A 1HW9A 3CJQA 4ZHRB 4FYWB 3S6EA 4DV2F 4DR7F 3L3CA 4L3KA 3GONA 2B51A 4PZVA 1SKRA 3MM5A 1NJWA 4WIIA 1WNEA 4CLFA 2CZ9A 2ASYA 2Q66A 4OMFG 1Y4ZB 4UOHA 1VJQA 3IS9B 2R8HA 2AJQA 2LFVA 1HR0J 1YJNS 3SV4A 1D9DA 3SDEA 1T03B 2E7WA 4DPOA 4KC5A 3D0GE 2R2SA 5C7PA 4U6PA 1UVNA 5HANA 3DI6A 3EMTA 2NS1B 2UXDF 4C8MA 2NXEA 4ECYA 4DSEA 2DXEA 2IPOB 5JMNA 5E3CA 2KKHA 3QRQA 3UCZP 2AZ3A 2VV5A 2YY3A 1TUVA 2XYHB 2HIYA 2C42A 1FE4A 4AE5A 1HMVA 4J5OA 3MTKA 2RRNA 2MKSA 2ROGA 1FDAA 3DOMA 2MLZA 4XIUA 2QGFB 3ZZRA 1LK7A 4NYPA 2EFNA 2DNPA 2VH7A 1S9GB 3MPWA 2F3JA 4NLGA 1ZM4A 3FBEA 3THTA 1TL7A 1YIJS 2DIVA 4RW7B 2HQDA 3MUMP 5B0BA 5HVHA 3UO0A 2BZ2A 3R27A 3C8YA 3QLHB 1MMDA 5HLFB 3NOCA 3TQ1A 3EICA 2I6WA 3EXYA 4DJBA 2NZ4A 2BJ9A 4BBYA 3DGPA 4JI8F 2FHOB 1BLUA 4ANDA 1KLNA 3Q86A 1IR2A 4KKOA 1LWEA 2IMOA 1QUPA 4L6V3 1Q53A 2MZ1A 3C6UB 5JVHQ 4GKJJ 3U27A 2CJYB 3AHPA 1JJCB 1FRJA 3OL6A 4F50A 2QEXS 4KE5A 2RS2A 4NMLA 2OPRA 3DN9A 4IR1A 3GJTB 2QJ3A 3TRGA 5IS2A 2ZE2A 1QSLA 3PRBA 4C0OC 2DGSA 4IRKA 1SV5B 3Q2SC 4NLWA 4PWWA 2ILYA 3PACA 2R7QA 4C8YA 4C8ZA 3T19A 4I0WA 1REVB 2KU7A 2FIUA 4CM2A 2LQBA 3CB4A 1UJ5A 1UTAA 3GPAA 4PRFA 3FCHA 5F8HA 3TEGA 2GJFA 2XZTB 4DR4F 4FN5A 4EZ6A 1UZDA 1XR5A 2OKQA 2HK3A 2IJFA 2BKPA 2OPQB 2Y1RI 1HI1A 4J7CA 1FXLA 1RWNB 1XNRF 2J9EA 1H74A 1I3OB 1Q7YT 2N82B 2ZWOA 1NM2A 5D0GA 4N77A 3VZIA 3ENWA 4MKBA 1U8SA 3IXQA 4I6AA 3FQKA 2BM1A 2VF3A 2HRUA 5D4PA 3AD8C 3BH7B 4RW6A 1O8BA 2FLPA 2ZHAA 4J9LA 3ZZ0A 2WOMB 1MN7A 4WZMA 3K7RA 2YNGA 1S0NA 1VIOA 3ILLA 4KV8A 3R7SB 3BREA 2IAJA 3DRYA 2OELA 3EGWB 2XMTA 1AUDA 3HZGA 1ZZNA 1RWXB 2MQ8A 2WONB 3KG1A 3NNHA 2OH2A 1RADB 3W5ZA 1RT7A 1N54B 1RT2B 2D3OR 3IP0A 1MWYA 2XMVA 1HWJA 3SBMA 3MTJA 4LSZB 4LBIA 4U95A 1VCTA 3CJRA 1TK8A 3HHLA 4QYZJ 5DO2A 1NB7A 5ETQA 2XGPA 2XMKA 2QMWA 3NWGA 3PY8A 1MNEA 3FGVA 1F60B 4JI1J 3AB4B 4C97A 1K1SA 2F40A 3TAMA 1FO1A 1RTIB 1BHNA 5DDRC 2HFZA 2L9WA 1XMQJ 5GADI 4DX7A 2K8GA 2M5YA 4RW9A 4C98A 6FDRA 4QZVB 4U7CA 4OYZA 2UVRA 4J9RA 2GVZA 4X62F 5KFFA 2FY8A 4OFZA 3WDOA 4ZKAA 4CI0B 2E9ZA 4U8VA 5ETKA 4ZN3A 4ED8A 3M9NB 3GSIA 3FDSA 4ZHRA 3FMBA 1WOPA 2YWWA 2X51A 4ZPCA 4C0BA 3D67A 1KFDA 1DBDA 1FD2A 1N5YB 2RU9A 3PKYA 5HAOA 3BN7A 3IS9A 2XS7A 4OYAA 4WFBQ 2VU5A 4EUVA 5LT5A 3LTOA 2CRLA 4OX8A 3P8BB 2YKMA 1WC4A 1ULRA 2KTQA 4CLUA 1GT8A 1T94A 4RW8B 4OV6A 4IRDA 4Q8FA 5KT5A 2J6SA 2HAFA 3VAGA 3JSMB 3QT6A 3PEJA 1VQSA 5LXYA 3BBFA 1SJRA 3WC0A 3PYEA 2PI5A 2C2MB 3G6XA 4WF9Q 1RABB 1AA1B 4ZN1A 2CKWA 1U0SA 1Q4RA 5FD1A 2RUSA 2P5VA 1HNVB 4EO6A 5H1SV 4QU6A 3HI9A 4OI1A 4QPTA 2FPHX 4Z7YA 1PAUB 2W24A 1XNQF 3BGUA 4ZITA 4DX5A 1IWGA 4C8OA 4NCBA 3VF0B 2W7OA 3P3DA 1JNRB 4PXCA 3W2WA 2FGOA 1RYSA 4RW7A 4YMEA 1D8ZA 5I4MA 3OUYB 2YNFB 2XZDB 3GIKA 4Z7CA 5HLFA 2HKEA 3IG1B 1VQ4S 4TY8B 1ZZFA 2CXEA 4YHHJ 3CNQP 1YJWS 2YKNB 3DRXA 5C2GA 3IAS9 3SQGB 4PYDA 4MIWA 3O1LA 5KFIA 1RT6B 1GMWD 2FLLA 4FYVB 4DN9A 2R7VA 2L9NA 1JXLA 3C6UA 3FEZA 1TFYA 1B64A 4PPZA 4DQSA 2LP4A 2ZNYA 1SL0A 4I6WA 3QAUA 4UY85 1MLAA 3DDKA 3DLGB 4ED4A 4MTPA 2AYMA 4NA3A 4XDDA 1SV5A 4C6AA 3LP0B 1T9WA 2R4FA 4NCGB 3M32B 1NU4A 5F3TA 2IHR1 2K3IA 3OBIA 3MF5A 2OO4A 4JI6F 4NLXA 2NPIA 3CJ0A 1NHKL 4R0EA 4O3PA 2M3DA 3MMBA 4ILMA 1RA7A 1TL3B 1L5UA 1Q8KA 3EDQB 4ATNA 2FJXA 5IT0A 2OPQA 4CNYA 4FNHA 5HROB 2D9OA 4C11A 5DZ6A 5E3QA 4A8XA 2QYGA 4K0KJ 4FYDA 3KHLA 1TQLA 1AFJA 1K9MT 4DSFA 4LFAF 1U1PA 1YX2A 4S0MA 5AJ3F 3R1HA 4BDPA 1UETA 5IQ6A 3H25A 1DFDA 2QIFA 1S59A 1VK8A 4FKXA 4PPDA 2MPUA 2YWEA 4J9QA 2BEFA 4CTAB 3VAFA 4QPXA 3OL9A 1VC0A 1JMTA 4RO0A 3OW2R 5HJYA 3DLHA 1WI6A 4DZDA 3S1TA 4TQSA 4PKDB 2W2QP 1NPRA 2ZH3A 2K06A 1FE0A 4DHVA 1KEKA 4ZVRB 4YQWA 3FBFA 2XY6A 3AD9C 4ECRA 5KFBA 1WG1A 4YS2A 1SL1A 4IKAA 2QT7A 3Q23A 4B3SJ 3R6GB 1UVLA 4CRJA 2AGPA 2GGPB 4DR2F 2JC1A 4MK7A 4DN0A 3H2LA 5EX3A 1FXDA 3V5RA 4EMDA 1CBKA 3CIMA 1KN6A 2GFFA 4G1QB 2BW2A 5C2CA 2G0CA 4OI0A 3CGIA 1Q0NA 1QVFR 3F44A 3MEDB 4H4MA 1IKXB 2PMHA 4UQTA 4NL5A 3QSIA 2LXIA 2XMJA 9RUBA 3F73A 2HFUA 2BJ3A 5DM6Q 3TYTA 3A8KA 3EVOA 3MCSA 4OZ2A 4KO0B 3EXCX 4M5KA 3IGNA 1OY6A 1T9TA 3CCZA 3PHEA 4FPRA 2MZJA 1SUQA 3TOQA 1W7WA 2HZAA 1F9HA 2LMIA 2KXNB 4C3LA 3R5CA 3LPEA 3IO1A 2RQMA 2G0JA 4OZ5A 4PEOA 3Q24A 2PN6A 5LL6d 1RP5A 4QR1A 4CP5A 3KNGA 5LXRA 1GX6A 5ADZA 1U45A 4I67A 2HFNA 5CYQA 5J2QB 4ED5A 1RLDA 3KDNA 1LV5A 1R6VA 4YB7A 1WC6A 2BE7D 4K5RA 2B4PA 3HVTA 4LF6F 3W8PA 3OHBA 1X4AA 1T9YA 3CCTA 1Y5NB 1ZAVA 4RW8A 2IVMA 4CO2A 3L7UA 2DY9A 2ZH4A 5B0EA 1Q5VA 4N56A 3G82B 2VODA 1NUEA 2XCAA 5J1PA 2RJZA 2JDJA 3NS7B 3N5FA 1ICEB 2C3MA 3IN5A 2OEKA 2ZBPA 1NHUA 2ZH6A 3UDEA 5K8NA 2Z2LA 4TY9A 4F4WA 2D1CA 1V3ZA 2AF6A 4OHYA 1VQOS 4HDGA 1N5TA 2HHXA 1KS2A 2W9BA 4IRCA 4V19J 2VC0A 2CPIA 3R97A 2AD9A 1FTRA 4Y2MA 2A18A 2KXHA 3OUYA 2YNFA 4M5GA 2EKNA 3IG1A 2PGCA 4F4YA 3S01A 1UVKA 3IBWA 2PI4A 4K2XA 3G71S 2MSTA 1FKAF 3DLJA 3I0RA 3MAAB 1BWEA 4TQRA 2VQEJ 2M8DB 5F3ZA 1RT6A 4F0MA 1U09A 1DARA 4NLSA 4NPOA 1CVJA 2FZCB 1VIXA 1AYEA 4WKYA 4KGMA 3KUGA 4OHXA 1RTDB 5L1JA 3GWCA 1YVFA 4HHHA 1ELOA 2NLWA 3DLGA 3D1QA 4K4WA 1I1GA 2GQ2A 2ACMA 2ALZA 1FKOB 1SKUB 3LP0A 2B9WA 3W62A 1SXLA 2QFIA 4KHPJ 4PXEA 4MFBB 2V34A 4F0KA 1L3TA 1O5JA 2FHMA 4EBDA 1T02A 3I32A 2FJVA 1T05B 5KFSA 3M8YA 3I4HX 5ETTA 1NSPA 4TN2A 4RR5A 3K8WA 4R5PA 4OX6A 4P7VA 1RHKB 3J81j 1UFLA 2FVQA 1WKJA 2FJBB 1HQ2A 1N6QB 1CS4B 1L3SA 3UR3C 3FSXA 5HROA 5ETNA 4RWWA 1J5EJ 2VPYB 3G2XA 2UUAJ 1B7YB 2R8KA 4L3NA 1XMOF 1R31A 2VIHA 3K5OA 2UVVA 1KQGB 4W90B 3HSJA 4UZCA 4DFKA 4TVAB 5HL7Q 4DV7J 1BQMB 4F4AA 1N88A 4WU3A 1QE1B 4Q7AA 1HL6A 1PC4A 3BYRA 1VQKS 2RH3A 3CW2C 1IKYB 1XR7A 4JI7J 3AODA 3AAWB 4NX9A 3GP9A 2R8JA 1D9AA 2AX1A 4P6QA 2G2YA 4YN3B 3NL0A 1FDBA 5K8OA 3TR5A 4LT6A 3GR1A 4PG4A 3G9CA 2GV1A 4OX9J 1EB0A 1EKRA 4UT4A 1GQEA 1TKDA 3MPYA 1QLNA 4K50A 3CDBA 2BM0A 3A13A 4QIEA 4ELVA 4K4YA 2GGPA 3KHGA 4LF4F 3PW5A 4HEA9 1RAJA 3TEHB 2UXCJ 2FYXA 2HFSA 1RT4B 4DR3J 4G1QA 1RWKB 2CJAA 1P6TA 5IWAJ 2NXNA 1F3FA 1JJHA 2ZH2A 3MEDA 3THPA 1IKXA 3M8PB 4XPEA 2AU0A 4NASA 4IYQA 1S48A 3WIUA 2LDIA 2F1FA 3BDPA 2DTJA 2KN4A 1RAIB 2CG4A 4DL5A 3KUHA 4ETXA 3EYZA 1FCAA 2C2NA 1VQ9S 3BKFA 4WTOB 4J91A 1SC4B 4OYBA 2KFZA 2R7RA 1VFJA 5IOLA 3GZ7A 2V9WA 4KFBB 4ZPAA 4DQIA 1RAOA 1RU2A 2M70A 2ZBCA 3NLCA 4B3RJ 2V8DA 2Z8QA 1EIYB 3M4XA 1R89A 4CLYA 4K4SA 3BV8A 3M2UB 3CO0P 3MAHA 5H9FK 3SEOA 2Z2ZA 3D0IE 4LIWA 4DV5J 1LWFB 4LF7F 3OTCA 1HNZF 2UUCJ 3OJUA 2YPZA 4ZJLA 5CA5A 5J2QA 3QZ7A 3W1YC 3EGVA 3J7ZT 1YK9A 2LQ8A 3W3SA 4IOCQ 1AUSL 4RPFA 1FWLA 4I64A 2E7XA 2QA4G 2EFOA 3NAHA 4OJGA 3T5KA 4N7TA 2DBBA 3LP1B 3BQ0A 2KXFA 2CPYA 2OAUA 3UVJB 3LWMA 3CJKA 2J8AA
chains in the Genus database with same CATH topology
1Q79A 2LCWA 5KTQA 2E1CA 2IM2A 4C11B 1RTHA 4WKRA 3CVKA 1C2PA 1T95A 1TV6B 4I2PB 2VA3A 2B4OA 1RWUA 4LSLA 5K14B 1U49A 1KTQA 3MR6A 3CD5A 2M88A 1VBZA 2DNGA 4F67A 3M1VB 3OXFA 3SMZA 3ZC4A 1X9MA 4OHZA 4A8KA 1JLAA 3QO9A 1LXJA 1RTIA 3OTBA 4YY3F 3K5MA 4Q45A 4BWJA 5KT7A 2HVIA 1N8RT 2UVWA 1NKEA 1NK0A 4E0DA 3HJFA 2V4JA 5CZVA 1Q1KA 5KFDA 2JFDA 3L7OA 4QW9A 5JUMA 4NWBA 3PIPQ 4HT7A 3TA0A 4TU9A 2CQ0A 5GMKa 1LXNA 2N7YA 1RT1A 1VS3A 5KFLA 5A8RB 3KLGA 1N52B 1UFWA 4WFYA 2MGZA 3G8SA 2W9AA 5DM7Q 2ZUGA 1NHVA 3DFEA 4ELUA 2XI2A 4LF9F 1UEUA 1YRXA 1SKSA 4KKOB 1IJFB 1SIZA 2Q1LA 3ICLA 2LXUA 4IH7A 3TA2A 5HMWA 1LWEB 1Y3JA 2CJ9A 4ED1A 4HDHA 3Q8PB 2ZC3A 3PRDA 2DRBA 1W2IA 1WI8A 1XEZA 1SH2A 3LP2B 7FD1A 4FS1A 2B6AB 2VUGA 1VLYA 3M8SA 3H2VE 1UEVA 2HVZA 5E3AA 2CZ4A 3ZZYA 1S1TA 1TL1B 1Q7LB 3PVXA 4Y2CA 2ZZNA 4TXSA 4X4RA 3MD1A 5EN1A 2C28A 4ECQA 2AW0A 2MQLA 4DSLA 3C3LA 4A47A 2XSJA 2OPPB 3MECA 5LJ3Y 3CCJS 1E6VA 3BQ1A 3BSCA 3H5XA 4X2BA 3JYTA 1HWIA 2D7SA 2EI5A 2ZE2B 5EWEA 2GW8A 3KLFB 3DLEB 2N4DA 4GO7X 2K1RA 5C25B 2O3DA 2XS5A 1IBKF 4NXMF 2HG4A 2OIHA 1N5YA 2HS0A 2DVIA 2VKZG 3UR0A 5E2QA 2HLUA 2RQKA 1ZPWX 2KJWA 3MPVA 3HLUA 2KZZA 4DR1F 5KFCA 3I31A 1AFIA 4X4VA 5HBMA 1JLFB 3KTQA 3TUJC 2JEIA 3MFHA 4YB1P 1SJ4P 4IG3B 2VBZA 2UV8A 1X9SA 3AJ2A 4OHVA 2VFUA 5IM0B 3M6WA 4MK9A 3OFFA 1RGVA 2VASA 3P5TL 1C1CA 5A0YB 1U4BA 1KQKA 4RU9A 2QRRA 2HNDA 1H2TZ 2GC8A 3ZZTA 5E7OB 3EZUA 3GFXA 5KFHA 4BCAA 4OJ1A 4Y0FA 2DJWA 1S79A 1X4CA 2JC0A 1S4FA 1U48A 1S6PA 2GIQA 3AH6A 1RK8A 1Y7PA 2ZH9A 2R7WA 1RTDA 4AFFA 2OTJS 3RB3A 5HI7A 4JI1F 4RBTA 2KRBA 1KONA 1VRUA 3JSMA 5CQGA 4NLDA 1R8PA 2RDIA 1FEEA 1J5OB 4YB5A 2JRSA 2DGXA 1VBXA 1FRIA 2XEXA 2L48A 2BYCA 3CCUS 3CDEA 1HNIB 3H2UB 2W9CA 3VAHA 1KNZA 3QJJA 3BQ2A 2RB7A 2D74B 4X4PA 1KSPA 1FKOA 4H4MB 3GV7B 3JTPA 3N6NA 3QPIA 5H9FJ 2EKYA 2IM3A 2VG7B 1S9EA 4MAKA 3RU0A 1UKUA 5I3PA 5DDPC 5MAOA 2FVSA 4PWDB 3M6VA 2WHOA 2VPXB 1DQ9A 1HNVA 5KT4A 4OJHA 2J9DE 4IO9Q 2EK6A 3KG0A 4KT0C 2ZH8A 5L38A 1U2FA 4Y2IA 1GAOA 1FRLA 5KFRA 3KNAA 1HQEA 2XMWA 2B3TB 3MM9B 1CEZA 3Q8RB 3T6JA 4DFPA 4DL6A 5DS7A 2DR9A 1S1UB 1G3OA 3CDAA 3MMAA 3NP5A 3HDSA 3B8HA 2VPZB 2QE5A 3OFHA 4HHJA 3BM7A 2ASLA 2K2PA 3V4IB 3TX8A 5B0CA 3FMWA 4RW6B 4OIXA 2PO4A 3HT3A 3H5YA 2AQ4A 3QGPA 3CD6S 3I56S 2OD4A 3NS5A 1N6QA 2LEAA 3HFKA 4GC6A 1PGZA 1SUQB 3POTB 4Y6IA 2MY8A 2LA4A 1RDRA 4I6YA 2KT5A 5L9XA 3NNCA 1IUJA 1O0PA 3J81Y 2W8LA 3I4PA 3HKWA 4O3NA 3IWNC 2B5JB 1NH7A 5KFPA 3B82A 2F9DA 1X5OA 3PR5B 4PCQA 3LPYA 1DLOA 3ONQA 2KZMA 4ECWA 4EYIB 4C3MA 3H5UA 2LVWA 3U1LA 1FJ7A 4TY8A 2XMMA 2W4CA 4ECZA 2P9EA 5GAEU 3LQVA 2XCPA 3ENVA 1JX4A 1BQXA 1XN9A 3UD3P 3EGNA 2VOOA 1Q8BA 4X4OA 1X9WA 4I1TA 4NYZA 4XAKA 3H5SA 3PZPA 5KT2A 1CG2A 2YKNA 2NUUG 1M5VC 2R7OA 2XS2A 4WZQA 3ENQA 2E5LF 3E01A 2DT9A 1U1KA 3SQGA 2KRRA 3MM8B 2K3KA 2ZOFA 5CH7B 1XTZA 4KIAA 2CQIA 1HHTP 4OI2A 3ETOA 3IR5B 4DQRA 4B9TA 1K73T 2MSSA 3JSRA 3CPWR 3LF0A 3KG4A 4H4OA 1BQMA 2HHSA 4URSA 2O66A 2A3JA 1VQ7S 1SL2A 2X1GA 2Q6CA 2C2DA 3FFIB 4RW4B 4QOTA 5CYQB 5E3PA 3GIJA 1Q82T 1HNWF 4TYAA 2GJ2A 2JZ5A 2K7KA 1HPZA 1QE1A 1UWBA 3CJ4A 2F4VF 3NBPA 2I38A 5HP1B 5DG9A 1SIWB 5EWFA 3J80Y 3A1YG 3HVTB 4ITSA 1ZM3A 5E5NA 3X3UA 1G2EA 2BE2A 2LEBA 2EG1A 2I2YA 3AA9A 1TVRB 3KHHA 3CC4S 3RRHA 5KFOA 1WEZA 1UVMA 1X5PA 2FD2A 3E8OA 4FF2A 4GKKF 3GV8B 3K5LA 3HHLB 4WK1A 5B0AA 1NNDA 3UW1A 3RAXA 2AYBA 4B3TF 3I9V9 1H98A 2GIRA 3DMJB 2APOA 4KBIA 1JLCA 2VD3A 1FK9A 3IAM9 4C4WA 1JWWA 4JI2F 4NCGA 4C8NA 2NSCA 3M32A 1FF2A 4I2QA 1NK7A 4FBTA 4FS2A 3DRSB 5CD4H 2QYCA 1YG0A 2LXFA 3SFGA 4ID5B 3DLKA 1G1XA 2I8EA 5THWA 2UU9F 6FD1A 4LQ3A 3DU6A 3TAMB 3PO4A 3IA0A 1M5KC 1X4HA 2GJIA 3FZBA 4M5DA 3GIMA 3L7PA 2EBEA 1OS5A 2GHVC 2P9CA 2MQQA 2XLIA 4J37A 4AUKA 3V81A 3E2EA 2W7PA 2EFGA 2DH7A 1OPZA 5LSOA 1RQ0A 4YDDB 3KJVA 2VG5A 4IQXA 2KO1A 5F41A 2VFVA 1FD8A 1TL3A 1U26A 4ZVFA 1HBUA 3OSNA 3TVKA 2KM8B 2ADBA 3AA8A 3OVBA 1YJTA 4DDFA 5DG7A 5DLFA 1L3UA 1FJEB 3V4MA 3PX0A 4IDKB 2LQJA 2R7UA 1FJGF 2HGMA 5DGAA 5CYMB 1DTTA 1YJ9S 2ZOMA 2EK1A 3O3LA 5KFKA 4ERDA 3M6XA 2HHVA 3R1LA 4DR6F 3PJWA 1IJEB 2RIJA 4OQJA 3PW2A 1D8YA 4OI3A 5HMXA 3D2WA 4ZMMA 2W9BB 1Q16B 1UMJA 4ZDNA 2MZTA 2ZKUA 3N28A 3GG1A 2O5DA 1EETA 4QW8A 3SXLA 4HYKA 2KT2A 1HW9A 3DC2A 5A8WB 4ZHRB 1Y9OA 3MUTP 4DQQA 4ZS6A 5AE1A 1VC5A 3BN4A 5IT9Y 4NA1A 4RNOA 3S6EA 1E6YA 4DV2F 1HR0F 4DR7F 3L3CA 3AJ1A 3QJLA 1LWCB 1XR6A 4YEAA 4O3QA 2UXBF 5CYJA 2B51A 3RW7A 1SKRA 1EP4B 3MEEB 3MM5A 3NCQA 1NJWA 3TANA 5I3QA 1KLMB 4WIIA 1WNEA 3NRBA 1S99A 1N5QA 4HTJA 2N3OA 2L3MA 1GXTA 1J2VA 2HNZB 3Q22A 2PFFB 3NG8A 4NRUA 2ASYA 1DJ0A 4N8OA 4CTAA 5KFZA 2FJEB 4OMFG 1IBMF 2XWYA 2Q66A 1Y4ZB 2AX0A 3JTNA 4YUDA 5M2PA 2RQCA 4NLPA 3IS9B 4NLRA 2IC3A 5IXUA 2R8HA 2AJQA 4RNFA 4CH1A 5KAKA 2IRUA 1NZAA 5DDOC 3GILA 4B9UA 1UJ6A 2V4QA 1XBWA 3I5AA 4CT8A 3I0RB 1R7IA 5JVGQ 4Y2AA 1YJNS 2RT3A 3SV4A 1D9DA 4DG1A 3SDEA 4FNIA 3G96A 3PIOQ 1BY9A 3HHNB 3J7A1 1T03B 2E7WA 2DCUB 4DPOA 1N5SA 4KC5A 3D0GE 5M2RA 2R2SA 2HFOA 1ZAWA 3HZEA 4KHMA 4AL6A 2RMLA 1TL4A 4NLVA 4LFBF 1RJJA 3N5BA 2JOQA 4U6PA 1QUVA 3GYXB 1UVNA 3DI6A 4ED2A 2WSFC 1S0VA 1S6QB 2MQOA 1VRTA 2YX4A 2NS1B 2UXDF 3IFEA 4Q0BA 4C8MA 4DLGA 1UVIA 4LUBA 3FSYA 2XGQA 2PA8D 2HLTA 4ZOSA 4IFVB 4NZ0A 3G6ES 4DUZF 4MJKA 2BRLA 3M2UA 4ECYA 4DSEA 5K9FA 4DL7A 2B7CB 2X1FA 1S72S 4NLYA 5F8NA 2DNOA 5E3CA 5FDLB 3OTOF 3K0JA 2KKHA 5DRKA 1C0TB 4F3OA 3UCZP 2C3PA 4DF8A 2VV5A 2YY3A 4CO4A 3OR2B 4UY8T 2FVPA 2NSBA 1LWFA 2BR0A 1Z2ZA 2GQCA 2OSRA 1TUVA 2E5HA 5KOXA 2ZJPQ 4A8WA 4C0HA 4BS2A 2Z0GA 4ZVEA 2C42A 1FE4A 4DV0F 3U7JA 1S1XA 1CSJA 4AE5A 4TU8A 1HMVA 2OMOA 4K4XA 4J5OA 3MTKA 2RRNA 2PEHA 4PXBA 2MKKA 2MKSA 2ZITA 2ROGA 4M63A 1N4LA 2DR5A 1FDAA 3DOMA 5J1EB 2J7WA 4XIUA 2BJDA 4KR0B 1S1WB 1R8CA 3ZZRA 1X4DA 2ZDOA 3W7BA 3PXGa 4JBCA 7FDRA 5D6GA 1LK7A 4NYPA 3UD4P 2EFNA 4LF8F 1UL3A 1SJQA 2DNPA 2VH7A 4KAIA 4R5PB 1S9GB 3KMQA 1IKVA 3MPWA 4Y00A 2F3JA 2RSQA 1HBMB 1P27B 3BO2A 4DV6F 2YX7A 4NLGA 2J0WA 1ZM4A 3LP1A 3FZ2A 3DCAA 1HBNA 2FVRA 3THTA 1S97A 3V6HA 1KHWA 1YIJS 5L1KA 5J2NB 1LW0B 2JLFA 2DIVA 2GX8A 3MOJB 3FEXB 1IN0A 4RW7B 3MUMP 4MYTA 4M95A 1X5TA 5B0BA 4IG0A 2MKJA 1B0TA 2JVRA 3R5AA 3BS9A 2M8HA 2BZ2A 4P7TA 3OLAA 3R27A 3C8YA 3HVWA 3QLHB 2C3UA 1MMDA 5HLFB 1M1KT 5IT4A 3FSIA 4LF5F 4DL4A 4N76A 3N4WA 4DS4A 4KO0A 4DQPA 4L72B 4EFAC 4GO5X 3TQ1A 3PX4A 1KVIA 4GKJF 2B7BB 3CCMS 4DV3F 1X4FA 3V6DB 3NCRA 2COLA 2DGWA 3EXYA 1TKTB 4DJBA 2NZ4A 4MK8A 4DWIA 2DNNA 4F26A 4BBYA 5JXSA 2MKCA 4DL0C 3DGPA 1U24A 1SB6A 4IFYB 4LSNA 2FHOB 4JI8F 1BLUA 5H9EJ 2E9RX 5A8RA 2AV5A 3JSBA 3D5MA 2VZ9A 1KLNA 4MKAA 1MROB 1MSWD 4CO1A 5L9NA 4KKOA 4PR6A 1RT3B 1LWEA 1U1RA 2IMOA 2BVZA 1QUPA 4DMZA 5KG2A 1FXRA 1Q53A 4L6V3 4MYUA 2MZ1A 1TKZB 2QZ8A 3C6UB 1M5PC 2KG0A 5JVHQ 3M05A 2CDQA 1FKPB 2RF2B 3IR6B 4TLRA 3M30B 4F4ZA 5KG1A 4O44B 3U27A 4D3HA 2MQNA 1Q78A 2M0GB 3QGHA 3AHPA 4Y3CA 1AW0A 2Y1JA 2OPSB 1FRJA 2B9YA 3OL6A 4F50A 4WU2A 2QEXS 4KE5A 4QWDA 4NMLA 1URRA 4RUAA 3K5NA 1IKWB 2RS2A 5KFXA 2OPRA 4QIFA 3DN9A 1WTFA 1GNKA 2HWIA 5DQIA 4B3SF 4IR1A 4A46A 3CE8A 4JI4F 3BR8A 3QIPB 1FNXH 1YWXA 4N5SA 3TRGA 5IS2A 2HQIA 2EFQA 3DDNA 2ZD1A 2UVUA 2ZE2A 2X3GA 5J2PB 1QSLA 3KLFA 3PRBA 3C46A 3DLEA 2M52A