4OX8A

Structure of prochlorococcus marinus str. mit 9313 csos1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
90
structure length
90
Chain Sequence
b'MGIALGMIETRGLVPAIEAADAMTKAAEVRLIGREFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARPHREVEPALGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide-concentrating mechanism protein CcmK
publication title Engineering Bacterial Microcompartment Shells: Chimeric Shell Proteins and Chimeric Carboxysome Shells.
pubmed doi rcsb
source organism Prochlorococcus marinus
molecule tags Structural protein
total genus 23
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ox8A01
3SSRA 5L38A 4OX7A 2A10A 3SSSA 4QIVA 4QIEA 3DNCA 2EWHA 3BN4A 3NWGA 4AXIA 3PACA 4OLOA 4OX8A 2A18A 4AXJA 3MPWA 4P2SA 3NGKA 4P7VA 2G13A 3MPYA 4P7TA 3DN9A 4OX6A 3IA0A 4RBUA 3H8YA 3I6PA 2A1BA 4OLPA 4RBVA 3I96A 3N79A 4PPDA 3VCDA 3CIMA 3CGIA 4QIGA 5DJBA 4RBTA 4DDFA 4LIWA 4QIFA 3SSQA
chains in the Genus database with same CATH superfamily
2AMCB 1M1GA 1U26A 4KGZB 4TQRA 1VLYA 1RWMB 2WB1D 1V5VA 3FCVA 2CQ1A 4DR4J 1NKCA 2CPIA 1T7PA 2J9EA 4AUKA 2DR8A 3MAHA 3G6ES 1XIQA 1O5JA 2KVIA 1RADB 2I8EA 2QFJA 5K8PA 1SJQA 3KLFB 3TUJC 1N32J 1TKDA 4KIAA 2CFXA 1LWFB 4R5PB 4PR6A 3BSOA 2DR7A 3KK2B 2HFZA 2G1HA 5IXUA 2EFPA 4AYBD 4DX6A 4KGXB 2GS8A 3POTB 4YQWA 3VAIA 5H9EK 2KFZA 2NREA 2RQMA 1SVDA 5GAEI 2PMZD 5HLFA 1SQFA 1BQMA 2RQ4A 3DDKA 4I67A 3V6HA 2C22A 1S1XA 5LSLA 2X1FA 1H0HB 2H54B 1FWLA 1HHSA 1U0HA 2XB2D 5CQGA 1KD1T 4UY8T 2NXUA 1AZSA 1K1SA 3BKUA 3OFFA 1FI4A 4KTQA 2D3ZA 5IT9U 1VQNS 1RYSA 5U47A 4EFAC 2OEJA 3M8PA 2YTCA 4NXMF 1QAIA 1BLUA 2R2TA 1RHUB 3I0SB 4X65J 3VHQA 2H5IB 3OXLA 3G82B 2HPUA 1B4SA 3VAMA 4LF9F 2FY8A 1YQHA 3MGJA 1N5YB 2QC3A 2DRBA 1OPZA 2VICA 3IR6B 1S59A 4FYVB 5FD1A 5A8KB 2W01A 2W25A 2HWHA 2RDIA 4GVBA 4DX8H 3KG1A 1F9EB 1MW7A 2W24A 2OEMA 2ZUAA 3ZZUA 5DZ6A 3DOLA 1YJ9S 4JI7J 1HBOB 1RA6A 1HR0F 1C4CA 2HHQA 4DR5F 4DU7A 2JHEA 1DTQA 2R2SA 1YJUA 2N4CA 2P6TA 3OR1A 4DMZA 1QE1B 2VG6B 1DURA 2OSQA 4X64J 3IN5A 4LFAJ 2XHWA 2HWIA 1KSPA 3X1LB 2C3YA 4OX7A 2HVZA 2X1GA 1W2IA 2MKJA 2NLWA 1RUSA 1Y3KA 1OY8A 3EZOA 2V50A 3G86A 3CCMS 3RW7A 1URNA 1X9WA 4B3MF 1RAEB 3WC0A 1X0FA 4LBPA 4DPYA 3I82A 3CCES 3NAIA 2LXFA 5AE3A 1MMNA 4FYWB 3Q8RB 2BACA 4ZCKA 2Q6BA 3W64A 3KLVA 3W61A 2WVFA 1JLAB 2WOMA 4O4GB 3T1HJ 2KH9A 1HNVB 2YXLA 4O3NA 5AT1B 2IHR1 2V6AA 1VS3A 2AYGA 3QNWB 3DCAA 3CJ0A 2AV5A 4OZ5A 4A47A 1X0PA 2ZUGA 2LXIA 4JOUA 5B0EA 4F36A 2LKZA 4KO0A 1S0MA 4O3SA 2XWXA 4Y2KA 2HHTA 4XPCA 2YWEA 5HP1B 1S9FA 3HSGA 3CCTA 1FHTA 2JC1A 4QIFA 1KWMA 4CLPA 4K59A 3EVMA 3RAXA 2FHMA 2MKCA 5DETA 5ADZA 2OLWA 1RT6B 3KK1A 2FJXA 3PTWA 2FZKB 4KHPF 3CPWR 1YDLA 5AXMA 2XLJA 3O6QA 4AE5A 2JC0A 4URQU 5T7LB 4WFNQ 2J5AA 5DDOC 1WNEA 3E01B 1GEHA 2RDDA 1YKWA 4OZNA 4FVMA 4PQAA 4XPEA 4IFYA 1PKUA 4OJHA 1UCNA 1F9HA 1F1BB 4IFVA 3IC1A 2M2BA 1TKTA 2POKA 3Q8QB 4K2XA 2HVDA 2GO8A 3THVA 1WG4A 3CCWA 5IV3A 4HI2A 2BOAA 4OYIA 3PZPA 1JNRB 2CPYA 2ERRA 2M0GB 4Q2MA 1T9TA 5D78A 3GIRA 5CYQB 4E2FB 3R3TA 2MSSA 3OR2A 3V6DB 2HQFA 4ZA1A 1YITS 3KHRA 4DG1B 1VQYA 2RNEA 1JLCB 4YHHJ 2NXJA 2Y3YA 5BR8F 1CSJA 4JI3F 2J6UA 2BZ2A 4N8NA 2XO6A 5ETOA 1SKSA 3I32A 1RHRB 1PYTA 3QZ8A 4USHA 4ECXA 2CZVC 4AXIA 1LW2A 1ULRA 3IGVA 1KNZA 1QSLA 3HXMA 1VYAA 3D66A 1NHKL 2J6SA 3CJKA 5DG8A 4DUYF 2HZAA 4NWBA 2R42A 5FDLA 3DHXA 1X5OA 1HWJA 1Y3JA 3KLGA 2CUYA 3SSQA 4MJKA 1B99A 2HNYA 2KT2A 5KFPA 5C25A 1NDPA 1KQFB 2CNNB 3NCQA 3R7SB 1NDKA 3JTNA 4P52A 1WHVA 4DV3J 1HBUA 2JEIA 4WBFA 1PAUB 3CJQA 4GO7X 2JH3A 3PX6A 1OYDA 1HI8A 4H4MA 5HLFB 2H4YB 3UO0A 2P2CB 1U8SA 1S10A 1S1XB 3DYAB 1JQGA 1QD1A 5ETSA 4LRCA 1U0HB 5D4LA 4DPXA 1AZSB 2J7WA 1GH8A 4DCJB 4DUTA 1ZS6A 3J81Y 1X4GA 3LP0A 1B0VA 1C0TA 2E5LJ 1ZH5A 3PM9A 3HX9A 2ZDOA 2W8LA 3M8PB 2UXCJ 1U7LA 4U95A 4BS2A 1RACB 2CPFA 4CIOA 1FDDA 4WKYA 1WF0A 5DGAA 1FRXA 3GFZA 5AE1A 5EX0A 3UNYA 4ICLA 4DSEA 3MM5A 3P5TL 4XDCA 3DNCA 4F26A 3I5AA 4QBUA 5KFKA 1MN9A 2RIJA 2A6MA 4GVBB 3GONA 1TK8A 3K59A 4KPCA 3T5KA 3DOLB 2F40A 4HTIA 1YJRA 1BUXA 4LF5J 4DSIA 2EG2A 2QA2A 2BEFA 4ES2A 2F8HA 3TJAA 1DTQB 2EC0A 2C2RA 4Q8EA 2IAJA 2RHQB 3MFHA 4ERDA 2FLOA 3OR1B 2YX1A 2WRMA 1RU1A 1P6TA 3JSBA 3G71S 2W7AA 2XULA 1BC6A 1VR6A 2DB1A 4K0KF 4YB6A 1WKLA 4IO1A 2QL7B 2E5HA 4OX6A 4IUFA 2ZOMA 1UVLA 4DUZJ 1SQEA 4DR1F 5KT2A 3BDPA 1X5PA 2OP5A 4ZPTR 2V8PA 1Q86T 1YTYA 3P3DA 2NPIA 1IKVA 3AD8C 3TR5A 2E44A 1QVFR 4K4ZA 3ZZPA 3KG0A 3BR9A 4DL2A 2IRUA 4RUBA 1FDBA 3F44A 3DC2A 1QLNA 2YX4A 3TW0A 2KHDA 2R7SA 4PWDA 2IM3A 1NDLA 3MAAA 5I4MA 2K3KA 4C11B 1KRPA 1HIYA 3W9JA 5IZHA 1KFDA 1CBKA 2QLXA 1N33F 4MK7A 4I68A 4P72A 1F9FA 2E1AA 3OJUA 1RWVB 1HI1A 1MROA 1WSRA 3W9IA 2HQCA 2MTLA 4NLXA 5GMDA 2V9WA 3EPIA 5DQHA 3EVWA 2NPFA 2DNYA 3A3NB 1SCJB 5LJ5Y 2DNHA 3MPDA 1ZZNA 4XTTA 1C4AA 2HEKA 3NGSA 2XLIA 1S77D 3KK1B 1S0VA 2IRXA 1B3TA 2I9SA 2DH9A 4K2JA 3CE8A 2LQ8A 4IFYB 1ZOTA 4EGLA 2D9OA 4IFVB 3SDEA 3DRXA 2ROGA 3GJQB 2VONA 4DZDA 1UEVA 2R7VA 1TUGB 2DNKA 3R6LB 3LTOA 1N8RT 1EJ7L 4IQMA 1X9MA 3U1NA 3PG9A 1CJTA 4J9UE 3DM2B 3KUHA 1QM9A 2BKNA 1RK8A 2F4VJ 2YH1A 2VOPA 1Q95G 1NSAA 3I4PA 1HNZJ 3FEXB 3NAHA 2ROEA 4V19X 1UWBA 3PR5B 4LQ3A 4E0DA 1OQ3A 5SUHA 2MLXA 2VFVA 4NLYA 3O8WA 3U02A 4DR3J 4DV0F 2JEJA 2FJDB 1O0PA 3HD1A 2M70A 4PYAA 2YNFA 4HH1A 1YLXA 4RUHA 3CCJS 3D3CJ 1LNQA 2BJEA 6FD1A 2PSZA 2ZHAA 3PO4A 2AJ2A 1IR0A 3C16A 4J37A 3TJ9A 3H0PA 3OFGA 2NXCA 4DR7J 3ZFVA 1X9SA 1SBRA 5KFUA 2E9RX 3CF5Q 4FXVA 5GADU 3CJKB 1N6QA 3TX0A 4AL5A 4LSNA 1NJZA 5RUBA 2W7OA 5CYJA 3GV5B 1RTIA 3CULA 1YBAA 3HULA 3LP2A 3KLGB 4ZP8A 2WW4A 1Z2LA 3MD3A 5BYRA 3SQGA 2C3MA 1E6YB 2M4MA 5F0WA 2K1RA 1YWXA 3PW0A 1WUUA 2VBYA 1S1WB 2HNYB 3AXKA 2OFHX 1TKZA 3PR4A 3ZNJ1 4OHXA 3SSRA 3KHLA 2RS8A 5ETLA 3W8GA 2Q43A 3Q8VA 4NEZA 4ECQA 3RZAA 1TUWA 2BUNA 4ECUA 1T9WA 1HBUB 1H73A 3KJFB 4H4MB 1R7IA 3RRGA 4QU7A 3FBCA 3T1YF 2WK4A 4WCEQ 4GKKJ 4AFFA 3ZXWA 3KTQA 1EP4A 3C66A 3RYLA 2WVCA 2AEJA 1RAFB 3N01A 3ZTOA 4YS2A 4F4KA 3AB4B 2CVEA 4U96A 3VCDA 5AXLA 4NLQA 1YHQS 3LP0B 4QQBA 1C0TB 1U1LA 5FJ4A 2XZDB 4YDXA 1FDAA 2Q79A 1IR1A 1U6FA 1KQGB 1W26A 3I31A 4LIRA 2CJYB 2AQ4A 3MCOA 5ETVA 2U2FA 3GILA 3RBEA 3MM5B 2I5JA 2B9XA 1ZAXA 1FO1A 3IG1A 3ZZRA 2DO4A 3VVUA 2Z58B 2HRTA 1S7HA 2E9ZA 3JYTA 3HFVA 4MAKA 2MZJA 4J9QA 3DLEA 1KFSA 4M5DA 3P5BP 4C98A 2HBRB 4NASA 4UUWA 4ZK7M 1WEZA 3WQPA 4JI6F 3PEHA 3KJVA 2ILZA 3EVOA 2WHOA 4LMZA 4WFAQ 2VG5A 2IAJB 5H9EJ 2B9YA 4YR3A 2AW0A 2MKIA 1ZA2B 3V4IB 5GAEU 1WTFA 1LK7A 7FD1A 5F9NA 3HZEA 3DRPA 2KVQE 3I0RA 3FSIA 1I3OB 3DGPA 5EWGA 3U1LA 1S48A 3NCRA 4MIAA 3CDBA 1SL0A 2UU9J 2CJKA 3MM9A 5ITHA 1EARA 1TL4A 3EGVA 5DZ7A 2CNLB 4ED6A 2JX2A 2V8HA 4ZS6A 4AT1B 1IKVB 1WI6A 5KFZA 2LMIA 2B4PA 4RPFA 1IJFB 4Q43A 3US5A 2OPSA 1PJ7A 2HG4A 3Q8SB 1W2BR 4V1Ak 4FNHA 4DZ6A 3A3PB 5THWA 3NWGA 1SJFA 3GLJA 4PWDB 3A3OB 2CJXB 3C14A 2HHUA 3MAAB 3VGSA 2KFYA 2R8KA 4PKDB 1D1UA 1SPBP 2GVDB 3AFGA 3D0GE 4I2QA 4J7CA 2OPPA 5CCMA 2JL9A 2ZJPQ 3HKZD 2D74B 2YKNA 1MROB 4WU2A 2M9KA 5AXNA 1SC1B 1L5UA 2BRKA 3H5SA 2XCPA 1UPMB 3N6LA 3D2WA 2FLPA 1B0TA 4FBUA 4ED7A 3OLBA 3BQ0A 4CH7A 4LBIA 1Q0NA 1HNXF 2FIUA 4OI0A 2HHHF 3PVXA 2YKOA 1Q8IA 4WE1A 3QRPA 3OXGA 3M6VA 2ZH7A 2XG8A 2YPYA 2ASJA 3BGRA 1NB2A 1ZETA 2V4JB 2MZQA 4M5LA 2XYHB 4KSEB 4DV7F 1RWKB 4OJ1A 1S12A 5IOLA 2F7VA 4ZLNA 4Y28C 5DO2A 3SDEB 3PJ9A 4B02A 3KUGA 4OL8A 1SQGA 1GTEA 4X4PA 4RUAA 5K14A 4QWCA 1CJTB 2N3LA 4DL0C 2DD8S 4RL1A 1N52B 4JI8F 3I87A 3KUEA 3GU0A 1IXKA 2NXNA 4K4TA 1UWBB 4U9RA 2BDPA 4RLEA 2B3TB 1KVKA 5LXRA 4OQJA 2J6TA 3T1AA 1JJCB 4NLVA 4YEAA 1FDNA 4J9LA 2CPZA 3D67A 1QAJA 2BABA 3AJ1A 3QGHA 1LQ9A 3C16B 1FTRA 1T3OA 4ECWA 4LF4J 3DXBA 5DG7A 2QL5B 1XMOF 2V0NA 3HHLA 3ISZA 1CPZA 1Q5VA 2XCAA 5EDWA 1N6QB 1XC9A 4LSNB 1XWLA 1FRHA 1ZA1B 1RTIB 2GHPA 1KOHA 4ANCA 3G9CA 2HNDA 3LP2B 2OH2A 4PG4A 3SQGB 2WAQD 1FVQA 3H25A 3DHWC 4ANEA 4QZVB 5A6PA 4NLTA 2K1RB 4CT8A 4OHWA 4L73A 4C0OC 2B7CB 2ZBCA 3H5UA 4CM0A 2YPZA 1L3SA 4ZMMA 1IVZA 2OI2A 3CVKA 2FB0A 1TP7A 3MTJA 5KG2A 2FPHX 3OTBA 2BE2A 2Z56B 3VTIA 4KHRA 4OZ0A 1TV6A 4LUBA 4MIWA 1XERA 2YQ3A 1NSPA 1FD2A 3EMTA 3O1LA 1G2EA 1EP4B 1D09B 3KJQB 4NRUA 2MQOA 2BBEA 4TQSA 4BLGA 2FHJA 3IFEA 1FK9A 1PYOB 2NCKL 3SV3A 2RS2A 1QJHA 2ZH6A 3L7OA 4W98A 1S0OA 5KFFA 1YRUA 2Y1IA 2ASLA 1NHVA 5IQQA 1M1HA 2GO9A 1IBMF 4NA2A 3R5CA 2L9NA 3IM8A 1F5AA 2I6WA 2HAFA 4MYTA 3CTRA 2ILYA 1U1RA 2YVSA 2FJBB 3KNAA 4G3IA 3IG1B 4PWUA 1YI2S 1VC0A 2FYXA 4F67A 1C1BA 3JYTB 5HMXA 4OLOA 4X84A 3DLEB 5HROA 1LW0B 3ILOA 1KC8T 2XS7A 3MPVA 3Q23A 2DJWA 2XTJP 4JI4J 3NLCA 1YZ6A 4M8LA 4LF2A 1AW0A 3UDCA 4GKJF 5D0HA 4L3KA 2VG5B 4WIIA 4N5SA 4CTAA 4IDKA 2MPUA 4UF4A 1DQ8A 4X4QA 1IKYB 3D6MB 4DV1J 1PJ6A 2HLUA 5L38A 3AH6A 2H9ZA 3UD5A 3LAMA 4HTJA 4M5MA 1R6YA 2V2QA 1TZ0A 4JBCA 3I0RB 3DRPB 1Q79A 1R43A 3DGPB 1H2VZ 2KJWA 1O51A 2DY1A 3GP9A 1TU0B 2CQIA 1XK8A 3GFYA 4NA3A 2IYIA 1L3UA 3AAWB 4OFZA 4DLEA 3IRWP 1DRZA 4LRDA 5L9XA 5HAOA 4JI5J 4G65A 1ZM4A 2ALYB 2PC6A 3HCXA 5KFJA 1VRUA 2ZH4A 1LK5A 1VLOA 2DNNA 3BGFA 4F4YA 4FF4A 4JV5F 4U8VA 3UR3C 3FQKA 3QT6A 4ED4A 3C14B 3ILJA 2RJZA 3FZBA 1Y9OA 3QGGA 2QIFA 1H38A 1WKKA 4B3TJ 1HMVB 1KBRA 2KXHA 2ZH3A 4DR4F 2GQCA 4I2QB 3AD7C 4NLOA 2B5JA 3CIMA 4L72B 2OPPB 4IOCQ 4DI6A 2B9WA 2O5DA 2YKNB 2V2VA 2C2DA 1RT4A 2V34A 2M52A 2RUSA 4OHYA 2HVIA 2ZBIA 1JXLA 5D3GA 3L09A 1K0VA 2BX6A 3CGIA 4G6VB 4A8WA 2I38A 4B3SF 4USVA 1S4EA 4NLWA 4WE1B 1QSSA 5KFOA 2HURA 3BGRB 5HMZA 1EKSA 3OL9A 4DR2J 1U24A 1RT5A 3UR0A 3UVJA 1IUJA 1P8GA 3GTYX 5HO4A 4MTPA 1AXQA 3GPAA 4Z37A 5D4NA 1XNRJ 2E5IA 1HQUA 3BGOP 1HPZA 1U2RA 2CADA 2MZ1A 3EYZA 4LF7F 2Q6CA 2B4UA 4PG7A 5K14B 1FKOA 4ZPBA 5EN1A 1U47A 1OPIA 4PYDA 3SMZA 2QO3A 2GQQA 1ZTWA 1G4CA 4C2MA 3TARA 1EIYB 2DT9A 2ZDPA 1NRKA 4ALZA 1RGVA 3EGWB 3V4MA 2G13A 4K4YA 2Z8QA 1GXLA 1SV5A 1JLBA 4GO5X 4RX6A 1UEKA 5G0RA 3K5MA 1Q78A 2ADCA 4M94A 2P9GA 4MIBA 2FY1A 1K8AT 4B3RF 3DOKA 2VUGA 4CLFA 2CQGA 3PFEA 5KFHA 2UUAJ 3FDSA 5J2PB 1HBNB 3U1MA 4H54A 2DCUB 2WVBA 3KLHA 4N47A 2HNDB 2FVPA 4X64F 2XY6A 4CNYA 4LIWA 4YB5A 4L6V3 3HHLD 2EKNA 3P6YC 3DI6A 5KT6A 3I9V9 4OYPA 1NKEA 4HI1A 4CM2A 4NLDA 2QLFB 3NGTA 3R2CJ 4X66J 4YB1P 1JLGA 1VQKS 2XO7A 1B70B 4WK3A 4I7FA 2ASDA 4V19J 4M5NA 1RWPB 5D8HB 2XY5A 4OV6A 1N48A 3EDRB 2LQJA 4ED1A 2A2DA 2BE2B 2FTRA 4QW8A 2KYZA 1MLAA 1OSDA 2EFNA 3DN9A 3MXHP 3UN3A 1F3VA 1TV6B 3QLHA 2CQ3A 1BQXA 3GWCA 1YJ7A 2R7RA 3OXFA 1NLKL 1M5KC 4LREA 5DS7A 3T1HF 2HVHA 1NSQA 1Q8KA 3CDUA 4UOCA 1U1MA 1FK9B 4W4MA 4P7TA 4IH6A 2X3DA 2PE8A 2VDIA 1RYRA 3TNVA 4C8ZA 3RAMA 3NKYA 1D9AA 4JI0F 4K4WA 2AGOA 5KG5A 3IWNC 1RI7A 2KG0A 4WKRA 2NXEA 2YWKA 2Y8WA 3TUZC 3FBFA 2VH7A 2VQFF 1PBAA 2BKPA 3J7Z5 2ZH2A 1YJWS 2DHSA 4EZ6A 5DDQC 3M7VA 3D6FB 2HRUA 1JLFA 3MTKA 5JXSA 1M5HA 3JTOA 2IVMA 1Q7LB 3IWLA 1IN0A 1RWNB 4NOHA 1QUPA 2JEFA 2Z2ZA 4C3LA 5HROB 1NDCA 5K20B 4U7UD 2J9DA 3MPWA 1JB0C 1WC4A 4O44B 5MAOA 4LFBF 3U7JA 5KG4A 2AF6A 4ECZA 3C15A 2FGOA 4GC6A 1NH8A 1RAHB 3R5BA 2C28A 2KO1A 1RXOB 4OZLA 4A8OA 1TL7A 1OSCA 2R2RA 3TWZA 1QDUB 3BF4A 1TL1A 1VHIA 5E2QA 3EZ5A 2XI3A 2KZMA 1NBEB 2XEXA 2KT3A 1HA1A 2V2KA 5F3TA 3KDNA 1D0EA 4W90B 1N36J 3F41A 1VK8A 4J91A 2FUG9 2DGVA 2A1BA 4C6AA 4DPTA 2MZRA 5FIIA 4FP9A 3GCWP 5B0CA 4KYZA 4DF8A 1T9UA 3U27A 5AE2A 3NGKA 1NMEB 2FHKA 2DITA 1VRUB 2FHOB 2YQ1A 4WJBA 1GAOA 4RWXA 2JJ4D 3LUYA 4NLUA 3NNHA 4PXEA 4DV6J 2AU0A 2RHSB 4ZN1A 4UQGA 4USIA 4C8YA 3TA0A 3TA1A 4ZVOB 1Y7PA 3LANA 2QLWA 2X1AA 4DPWA 1RA7A 3K0JA 3TAPA 2ZBQA 2C2MB 1RT4B 5KFYA 3L3CA 5F8IA 4FPRA 1F6TA 5I3UB 3J80U 3RBDA 2E1PA 4WFXA 5D3GB 2H48B 3EXCX 2R9LA 2OIHA 7FDRA 4P2MA 1Y4ZB 1GT8A 4ATNA 4IG0A 1IM4A 1F2GA 5L9NA 4TYAA 1HNWF 2FGCA 1RAGB 4DV3F 3QJPA 2WZ1A 3PX0A 1RT5B 1TAQA 3UVJB 3HT0A 3CDAA 4NE9C 4XIUA 3G8TA 2P5VA 1VQLS 4ZITA 2AYBA 1KONA 3SZ2A 3A8KA 1U0SA 3M6XA 3T41A 1HPZB 3LWLA 1REGX 2MKKA 1LWXA 3M2UA 1FKOB 3CD7A 1RTHA 1QTMA 3B54A 2DR9A 2QE5A 5HVHA 4A46A 1QSYA 2XM3A 4CO5A 4X4VA 2PA3A 2UXCF 3AY0A 2BMBA 4DPOA 4B9MA 1VBXA 2ZD1A 2EFOA 1SC3B 1TAUA 2EW9A 2CZ9A 3LAKA 1KLMA 2VQEJ 2FVRA 5BJRA 1WDTA 1SV5B 3OTEA 3AJ2A 1BWEA 5G0RB 4XO0A 4TY9A 1FXLA 1CLFA 1ZPWX 1TVRA 3GYNA 4LF5F 1O6XA 4ZLJA 1RTJA 4FBTA 3MD1A 2V69A 3ZNUA 4CLUA 1OMSA 1SKWA 3HFZB 4ZVSB 5CD4H 1WG1A 4JV0A 4A8MP 4ZCIA 3K8WA 2EKYA 1JLEA 4RW6A 2HFVA 2HHVA 2QTWA 3Q22A 3ZZTA 1RBOB 2VKZG 3DI6B 1T11A 1RHJB 3BBBA 2DGXA 1TL3A 5C42A 3OW2R 4UTGA 5KT4A 4O0IA 3FCWA 3N6MA 2HQDA 3DGVA 2DNZA 4ELTA 2LP4A 1HQEA 2JWNA 3OL7A 3Q8YA 1DY3A 1EQMA 2H3EB 1WORA 1HI0P 4DS4A 5HSPA 3CJTA 3QLHB 4RZRA 3JTPA 2ZHBA 3P4UB 5AJ3F 4FPIA 3OT9A 4WTOB 2VASA 2MDAA 2JNJA 4HL9A 3KXDA 4OJGA 3GIMA 1S1TA 4K4UA 1JKHA 4ELUA 4LF9J 2V63A 4M5JA 1S97A 3QRQA 2ZJRQ 2W4PA 1ZBTA 2VHGA 3POTA 1U2FA 4FS1A 3D6TB 1UPPA 4X4OA 3AQPA 1ZM3A 3ENAA 2L3MA 2LEBA 3LW5C 1CULA 3GB0A 1S99A 2XZWA 3GYXB 1HR0J 4DR5J 1JLFB 1R8BA 4U67Q 1R8HA 3J7ZT 4JV1A 3L4BC 4KH0B 2YWHA 2R8GA 1LXNA 4X4RA 3A8EA 4X2BA 3GR1A 3NS6A 5GAGI 2UUBF 3HHNB 3K2YA 1SJRA 8ATCB 4P6QA 3TZXA 2WW8A 3I0SA 3C15B 4HVZA 2BANB 2HRYA 3TVZA 3CJ5A 1M5PC 2L9WA 3PYFA 4J9MA 1TL1B 4WZMA 2VBXA 3GR0A 2LVWA 2R7TA 3CD0A 3K5OA 2PN6A 4ZKAA 2HAIA 3ISND 2HQ3A 2FLLA 2QMWA 4CLKA 5KFLA 3LP1A 1HNZF 1NPKA 5ETPA 1M5SA 4CZCA 2OMLA 3VZIA 5D6GA 2ZE2A 4RNFA 3LALA 3GMGA 3T6BA 2VG6A 4BBYA 2KJVA 3GG0A 1RJJA 2R7UA 4URSA 3CJ2A 2G9OA 5DLFA 2EPIA 1GQEA 3WC2A 4WF9Q 3PO5A 1OQ6A 3BDEA 1JJ4A 2MZTA 4QCLA 3CEDA 2F3JA 2OJ3A 3OL8A 2JFDA 1ROFA 2ALZA 3G2XA 1KOOA 3MAQA 4USKA 4KHPJ 4DV4F 4GVLA 2FVQA 4WFYA 2A18A 4I1TA 3M8SA 3KWMA 3UD3P 5D77A 4FZVA 2PMWA 5H1SV 4OV1A 5IT4A 1TTHB 1T9VA 3BGLA 3BO4A 2BE9B 3LGHA 4IG0B 1VQPS 2UVUA 2RMLA 3AXMA 5AXKA 3NY0A 5F8LA 3T5LA 5CA5A 2AEFA 2DIVA 3O5TB 2CJAA 1DARA 4TU9A 1VOMA 1U09A 4PCQA 3UNGC 2AGPA 3DDNA 2F8EX 2LFVA 2X7IA 2RH3A 1J2VA 3UQSA 3M2UB 3VQSA 4J9VA 2NQPA 3LQVA 3EDQB 1U1OA 3JQJA 1RTHB 4DQSA 3PACA 5BR8J 2J76E 2Y1RI 4FKYA 1KVIA 3KLIA 4L74A 3ZZYA 1H3DA 2DNRA 3RGIA 5ETKA 1KLMB 4LRBA 5KFCA 4OZJA 4WTYA 2H65B 4LT6A 1WD6A 4QYZK 1C2PA 2OO4A 3PHEA 1Q82T 4K5SA 1VQ4S 2DNOA 4IOBA 2PFDA 2MQ8A 4OX9F 4DUYJ 4XDDA 1N34F 1Q1KA 1WC5A 2QYCA 5M2RA 2IM2A 3DLGA 2IA6A 1MWYA 4NXNF 4KB7A 3F73A 4DFMA 1NPPA 2UVRA 2ZC3A 4OI2A 1TVRB 3CMAS 4ILMA 2AD9A 3QGPA 4MMOA 1RTJB 5B0AA 1PYSB 5B0BA 3V5RA 3W60A 4IR9A 5I3PA 5CYQA 3N0VA 1Q8BA 1UFWA 4N76A 1EHWA 1IWGA 2LYVA 3R5AA 1DFDA 3W66A 2V8VA 3MEGB 1JLEB 3VALA 4RW6B 1T02A 4KKOA 4LSLA 3V2UC 2C3UA 3FBEA 3UCGA 1TL3B 5C42B 3FFIA 1T05A 1F2HA 3TA2A 1HFEL 2OHDA 3TEGA 2ADBA 4ZN3A 3WIUA 1HQEB 2VFSA 2GAHC 2HGLA 3CDWA 1RWUA 3L7UA 4DL3A 1UVIA 3J7YI 3M05A 3BYPA 1RBLA 4QIVA 5KFNA 1REVA 3Q0AA 3R6GB 4KRWA 7AT1B 3R1LA 5K8MA 2G0JA 1NSKL 4ED5A 3CCZA 3QAUA 2V67A 3R97A 4CI0B 3NBPA 2RVJA 2WVEA 2B9EA 1FX2A 5HVGA 3PKYA 5IS2A 1S1TB 2CQ2A 1JKHB 2Z57B 4KC5A 2QSWA 4KAIA 5ETMA 2DR5A 3SBMA 2FQQB 1H2TZ 2JFKA 2FVSA 3TJ8A 3EGNA 3IR7B 1YBUA 5KG1A 2MQMA 8AT1B 1VRQC 4QIGA 2HW3A 2Z30B 1CULB 1TELA 2FJAB 2F5GA 4QIEA 2CG8A 3D7SB 3DYAA 4RW8A 3D6HB 1G6BA 4Q45A 3ET6A 4YN3B 2RILA 4K4XA 4USWA 1XEZA 3IAM9 4USTA 3RG6A 1HD0A 1BGXT 4R25A 2RAQA 1FJCA 1MG7A 5M2PA 2OD6A 4IRCA 3RTVA 4K0KJ 4B9VA 2DGTA 2AZ1A 1X4AA 1WKJA 1Y5LB 2ASYA 2LQ9A 4A8SA 4DR1J 5KT3A 1U6ZA 2D3O1 3TI0A 2XMWA 4NYPA 4W92B 2VODA 2R7OA 3TZWA 3UN5A 2BW2A 1K0TA 2J7UA 4LFCF 4PPZA 1S0NA 1KTQA 5B09A 4ZVPB 4X4NA 1S76D 3FRZA 3LP1B 3F0NA 5KOXA 2RU3A 2EBEA 2CRLA 3BPSP 3PDNA 2ZHOA 5F8MA 2R7XA 2IMOA 3P45B 3M1VA 4ECVA 1KR4A 2ZE2B 1NK0A 4CLZA 3NEKA 4EYIB 5E41A 4M63A 4WYWA 4QWDA 3IWXA 1D9FA 1KQKA 4LQ9A 3T5HA 1TMMA 1APSA 4QPTA 2UXDJ 4EBEA 1IQZA 2ZM6J 4FYDA 2E9TA 2XNRA 1MMLA 3BSAA 3BSCA 3ZZZA 3DXSX 4EI2A 1B64A 2YH0A 4YUDA 4J9SA 3OBIA 1JK9B 1WDDA 1S5ZA 1W25A 1ZPVA 5HN0A 3RR7A 5ETTA 4Q44A 1BHNA 1H6KX 2LEAA 2CQHA 3ZTSA 4JB8B 4C0BA 2VC0A 2L08A 3FNNA 5K5MA 1P9YA 2KG1A 4JYAF 2VZ9A 3Q8UA 2QEXS 1T94A 5EWEA 4FXWA 4KH1B 3KOAA 3LH2S 1EAYC 1HW8A 4DX7A 4ECYA 4DV5F 4C11A 3ENVA 2E1MC 1JWWA 3H98A 3G96A 5J1NA 3PEJA 4UUXA 3HHEA 1XMBA 5A0YA 2KB2A 1A7GE 2ZC4A 3J80Y 3ZTRA 5I3QA 1X31C 2BM0A 3R7BB 2RU9A 2OGUA 2FC9A 1FRJA 5ETQA 3MPUB 5J1PA 4R8UA 1CC8A 4PEOA 3RB0A 2VDHA 1RU2A 4NLSA 4DV0J 4F4ZA 2QRRA 2IY5B 1JMTA 3A8JA 5H9FK 1FE4A 4NZ0A 4ZDNA 1S9GA 1S72S 2AJFE 4DL4A 3KLIB 3HVRA 4U7CA 4A8QA 5KFQA 1HYSB 5KAKA 3UPFA 3UN2A 1CQNA 2P9CA 1UFLA 3CCQS 5KT7A 3N5FA 1OYEA 5E3RA 4B9SA 2YWGA 2GZOA 1SL2A 2HS3A 2DNQA 4HDHA 2DHXA 3P96A 4WPAA 3DLGB 3GJSB 3TP2A 3UDVA 2W9BB 4JI4F 2DHGA 3TQ1A 3DM2A 4TNOA 1V5IB 3FSXA 1V6HA 3BN7A 4QR1A 4HKQA 3D1HA 2KDOA 4I6AA 4RW7B 3GJTB 1XBWA 4RWWA 3KDOA 3TAMA 3THPA 1R0BG 3CC4S 3MZIA 3UW1A 3EE3A 2DRAA 1W7WA 1VQ5S 4KKOB 4LSLB 4S0MA 4F0HA 1NJXA 1QAXA 4ZLPA 3T1YJ 3FFIB 3OV7A 1T05B 2WBRA 3PNIA 1WHXA 2FJWA 4IOAQ 3ICLA 3GJRB 3UWTA 4ZLLA 2C42A 2QLJB 3QGIA 3DU5A 2XSFA 4R0JA 2JVRA 1REVB 3MM6A 5HJXA 2DPJA 2BQRA 1NK7A 4F50A 4JI5F 1RLDA 1WI8A 3H4BA 2H5JB 3HFKA 4DR6F 4GC7A 4NMLA 2QZ8A 4CLLA 3ZTQA 1S7IA 3RBXA 5L39A 2J9CA 3NBPB 5SZTA 1VC5A 2L41A 1E6YA 1WOOA 2Y1JA 1I5OB 5E5NA 3SSSA 1S1WA 2BQUA 1I94F 2KT5A 1U45A 3MPYA 3NS5A 2CQ4A 2A2CA 2YNHA 4B3TF 4FVCA 2MQQA 3N28A 3R5DA 4WFZA 4IH5A 4PG6A 3TYTA 4JI6J 4ES1A 4C48A 2IC3A 1D9DA 4RW8B 3HSZA 1Z1ZA 1GMWA 3ET6B 1K1QA 5DQGA 2EFQA 3E8OA 4EO8A 5LL6d 1F60B 2O66A 5IM0B 4P2SA 1JJHA 4KGVB 2LA6A 4JUZA 2RUGA 2XYGB 2OKQA 2HNZB 4Y3CA 4DQPA 3NOCA 4DN9A 2ATCB 1LWCA 1D8ZA 1J5EJ 3OL6A 1KDNA 4ANDA 3PJWA 4Y2MA 3FBBA 1XMQF 1WOPA 3AHPA 2C2OB 1XNRF 1ELOA 4IG3A 1LWEA 5KFEA 5KFBA 1N4LA 2QA4S 3NOGA 4TLRA 3BZQA 4CLYA 2GIRA 2CYYA 1AROP 3FGVA 1S49A 4EU0A 1OIAA 5DG9A 2ZVIA 3PRDA 4P75A 1UJ4A 2DGQA 3HD2A 2IM1A 2GMHA 1FRKA 4LRFA 3GG1A 1FKPB 3M1VB 1CJUA 2W7PA 1UW9A 2UXBF 3ITHA 2IVYA 3GSDA 3MEDA 1L3KA 1IKWA 3V4IA 1IBLF 1S1UA 1P9QC 1GX6A 2X3GA 4ZCLA 3M9OB 4CO2A 2QGFB 4TN2A 2OPQA 2DKOB 5L1KA 3LPYA 4EMDA 2OAUA 3HVWA 3MMBA 4O0NA 4USMA 3G4SS 1HNXJ 1T9XA 1B0PA 4RNNA 2H51B 3EJMA 3OVBA 4J9KA 5DRKA 4CWBA 2LDIA 4WP9A 1T8EA 1U6BA 4FNIA 3NCPA 4UY85 1LFWA 4DS5A 4X66F 1VQ6S 2XWYA 3EWGA 3SV4A 3W2VA 1VHFA 3FC9A 3NMAA 2M7SA 5KFWA 2GVZB 3K8VA 4DCOB 2J0SD 3C6TA 1Q53A 2R8HA 4I6YA 4PAAA 3RB4A 2VKRA 2LECA 2GVDA 3PHTA 2VJVA 1N88A 3PIPQ 2V8GA 5A0YB 1EZZB 3NGUA 3CT9A 1VIXA 3MF5A 2RQKA 3DLJA 3MEKA 2BJ3A 2C2ZB 1SH2A 2JEGA 2HKEA 1KHVA 4HACA 4R8UB 3HPOA 3FEYB 1VFJA 2AEMA 2HS0A 4E8UA 1WEYA 1H7WA 4JI2F 1RT2B 4CLSA 4DSKA 5F8GA 1S9GB 3AT1B 1NUEA 1ZAVA 2AX1A 2A3JA 2IJNA 3KKFA 4LVNP 2V4JA 2R8IA 2RT3A 3UDLA 2FLNA 2L9DA 5C5JA 1WACA 2UUCF 4OYOA 2IPOB 1XMOJ 2PA8D 2E29A 2WBMA 4N8OA 2MMYA 3W5XA 2HBYB 5HQMA 2BXJA 4TYBA 3W5YA 2HLTA 1QTNB 1F0XA 5IC4B 3M8RA 2WSFC 2BE7D 2C3OA 1FJEB 5D0GA 1RT7A 2EXUA 4PXCA 1N0VC 2VOOA 2QV6A 1MWZA 3TAMB 2ZZNA 2ACYA 1MWQA 3I4HX 3HF5A 3HKWA 4OYWA 5DQIA 1FNXH 3RJMB 2N82B 4U6PA 4NRTA 4CQ1A 1SKUB 1F5CA 1H74A 3WHIA 1UWAA 5JMNA 4U7UK 2QT7A 4LR7A 3EPGA 2DBBA 1R3NA 3QATA 2I1RA 1UVKA 4O3PA 5A2QU 1PCAA 2DXEA 3UDEA 3IXQA 4HT5A 1RAOA 4PWWA 3ZO7A 1VCTA 3MM6B 4CO3A 3FCHA 1ITPA 4J90A 1VMBA 2HYIB 5EGYA 4F4AA 1FCAA 2ZBPA 2WVDA 3KNGA 2NZ4A 2VL1A 1IBMJ 5B08A 3L7PA 3AQOA 1RSCA 4QYZJ 3PW5A 3GE9A 3CUNA 5JUMA 1S6QB 2WTFA 5L1LA 4USJC 3UCUP 1UAWA 4OZ2A 3TVYA 5LT5A 4DF4A 4PPDA 1JX4A 2OSRA 4NPOA 1SL1A 2AX0A 2V2ZA 2YNHB 4FS2A 1URRA 1V3RA 3SCKE 2CQDA 3ELHA 2LQBA 2GGPA 4EYHB 2J0QD 4J9PA 3VZHA 2W4CA 4ZVFA 2N7CA 2IC3B 4P2FA 4GKJJ 1VQ9S 1Z4UA 2UVWA 1DHMA 4CLWA 2PEBA 2MQNA 2XY7A 3BBFA 3RRKA 1QAYA 1UVMA 1DAXA 1HW9A 2BJ7A 1ZM9A 3PW2A 4H4KC 3QIPA 2PFFB 2W8KA 4HT7A 3BBCA 1LWCB 1PAEX 3NXZA 1ZM2A 1U1NA 2Q66A 2HHXA 3QIDA 1UVJA 2ATLA 2F63A 2DK2A 1ICEB 3I5CA 4F3MA 1FFWB 3N6NA 4IG3B 1LWEB 1IKXA 1JJ2R 1AT1B 1QVGR 6AT1B 4DL6A 2M3DA 3I6PA 3AB2B 3PX4A 1NK4A 4Z2XA 4JI1F 4ZVUB 1LW0A 2DNLA 4OYAA 4KBIA 1PILA 1HHTP 4JV5J 3GZ7A 2O67A 2AHOB 3MWBA 1DTTA 1FA0A 1VRTB 1CJUB 5A6WA 2KYXA 3ITHB 2KXNB 2BYCA 5EWFA 1IKYA 3OSPA 3GIKA 4F4XA 3MEDB 3AA9A 4F2SA 3W5ZA 1IKWB 2Q3PA 5D4OA 1VQ8S 3C6UB 4Y0FA 3CSKA 1S1UB 3WZ0A 5D0EA 4Y2IA 4AL6A 3H5XA 2OPQB 3JSMA 3K58A 5L46A 1CEZA 2VV5A 2W2NP 4Q7AA 1G1XA 1XTZA 3RB6A 3MMBB 2DNGA 3BH6B 4B3SJ 4ECTA 3D0HE 2DXFA 3BREA 3W63A 1N5QA 4C4WA 1FRMA 1WEXA 1MU2A 1P1TA 1IBKF 4ZJLA 4QR2A 1TK5A 3WX4A 3W1YC 5LMUF 2DH8A 3W2VB 2DTJA 3J7AN 4AXJA 2LA4A 1B7YB 1X8DA 4ZVTB 3C6TB 1TUVA 3I96A 4LF7J 1FRLA 4DV2F 4MK9A 4EBCA 5IFMA 2UVVA 3ISNC 2DEJA 2QA1A 4A4JA 5CCLA 1HMVA 2PT0A 4ED2A 3OTDA 1WC6A 2EI5A 4KV8B 3M6UA 3MM7A 1GMVA 3D1OA 4F3QA 1KP6A 4WXOA 2Y0BB 3CJ3A 5KFDA 3A8IA 2ZVSA 2EWHA 1GK8A 4HACB 3M2RA 2GC8A 3ILLA 2JZ5A 3OTOF 1R8AA 4Y34A 5J1EB 1FT8A 2X1BA 3PYDA 3NNCA 1Y10A 3LF0A 2RSQA 5KFTA 4YB7A 2NR0A 4B3RJ 5IWAF 3DMJA 4J9OA 2MKYA 2YKQA 1PC4A 3OTCA 2BJDA 2KTQA 4TU7A 3BR8A 5CZVA 1A0OB 3I9ZA 1YVFA 4YY3J 5A8RA 3HHKA 1RT7B 4OHVA 3IM9A 3O2IA 2KKHA 2K06A 1NJIT 3VGTA 5CH7B 4Y65A 2CVIA 2BVZA 5E3QA 1I6JA 4D3HA 2GCFA 4FKXA 2FZCB 5HATA 2V9KA 1SIWB 1N5VA 3BKTA 4CLTA 5HL7Q 2DHAA 1S1VA 2XMAA 2KI2A 2KRRA 4ZIVA 2IDEA 2R3VA 5J2PA 3HDSA 1HBNA 1CG2A 5H9FJ 3K5PA 4DFPA 5F3ZA 3OHAA 4RW4A 2LQ5A 1HBMB 2KN4A 4OI3A 3ILIA 3LO3A 3BPDA 2V4QA 4QWBA 5J2MA 1SC6A 4JI0J 2IM0A 3W8PA 3SCJE 1LV5A 5IQ6A 3OFEA 3PCOB 2R4FA 5KFRA 2GA7A 2GMLA 3R27A 4DDFA 4PQUB 1F5BA 4ID5B 2GIFA 1RKJA 4NI2A 2VQFJ 1WC3A 1H7XA 3D0IE 1SC4B 4QR0A 5CZXA 4H4OA 2V4RA 2MGZA 1T9YA 4B9UA 3IMQJ 2QFIA 4NYZA 2C2EA 2GGPB 4ZVEA 3RAQA 5EX3A 2O1PA 2CJQA 2XMTA 4DXLA 3J7A1 2D9PA 5LMNF 2U1AA 2R2UA 3HSJA 4YR2A 2DR6A 1S79A 2VBZA 3ZC4A 1MN7A 4LFBJ 4BCAA 4N56A 4C3MA 2W9CA 3H7HB 4J9RA 1P27B 3AJDA 4LF8J 3QMQA 2Y0SD 4ETXA 4DSFA 3QIPB 4OIXA 1BY9A 4DN0A 4Y00A 3T9ZA 2HQGA 1DLOA 3X3UA 2FJVA 2VPZB 4X62F 2WB4A 1RLCL 3VV2B 2LU1A 2XGPA 3ADAC 4ILRA 4IKAA 3CB4A 3HP6A 1XNQF 1YK9A 1Y5IB 2KZZA 3D28A 1YG0A 3CO0P 4ETZA 2OEKA 1IKXB 3J81j 4Q0BA 1VI7A 2C2KB 5E0OA 1FKAF 3WX8A 2Z4PA 2GNKA 2OD4A 4DBQA 4OI6A 9RUBA 3TRGA 2GHVC 3FJ2A 5HI7A 1YX2A 4CDIA 5E33A 4P73A 5LXYA 3SCIE 3BO3A 4O44A 1DTTB 1RT1A 5B0FA 2HHWA 2PDAA 1B7FA 2G2YA 1UJ6A 3HI9A 3K57A 3OHBA 4DLGA 4P74A 3EM1A 4Z7CA 2DNPA 1UZDA 4O4RA 4GRSA 5E3PA 2LLZA 2APOA 1HHQA 2WONA 2QX0A 1VJWA 3OLAA 1OY9A 3PKMA 4NCGA 3JSMB 1QY7A 1FJ7A 4BC9A 4NMXA 3H4DA 3CCLS 4PUOA 1CJKA 1XJWB 3R5GA 2ZKUA 2ZJQQ 2QL9B 2G2OA 1HNWJ 1QUVA 4ZPCA 2ZBRA 4KFBA 5K8NA 3CCUS 4RU2A 1FEHA 1FJGF 3Q24A 1MU2B 5KG6A 3S6EA 4NYOA 2B4VA 1XQIA 1OO0B 1BQMB 3M4XA 2M5YA 1NAQA 4X4UA 4NL5A 2XSJA 3H40A 2VF3A 5MLCV 1VBZA 1EKRA 1Q5YA 4DPUA 5ETNA 1SI9A 4ES3A 3JSRA 1I51B 5T41A 1SH0A 2AYMA 3K5LA 1VBKA 2QN6B 2AJQA 2K8GA 2PMHA 3BS9A 1V3SA 1WF1A 3ENQA 2DPIA 2DIUA 2UUWA 1YRXA 4L76A 3MM7B 4KJIA 2CPXA 1BD6A 2ZOGA 1SB6A 3HSDA 1FNOA 4BHQA 5I3UA 1TKXA 2CJ9A 3M2RB 1FD8A 3K17A 1N32F 3VAGA 2B8QA 3CWJA 2ABYA 2ACMA 4CO4A 3QJLA 2W2PP 3M8YA 4RUCA 4A8XA 4WIQA 4C8KA 4L3NA 2W2QP 2R7WA 1FE0A 4K50A 3IS9A 3DMJB 5IV4A 2YNGA 1OJ4A 3RW6A 2D3UA 3TO8A 2HBQB 3RB3A 5FLXU 1TR0A 4ED8A 5A8RB 1MSWD 3P8BB 1U48A 5C24A 4NEYA 2NSCA 3OD2A 4RW9A 3HZGA 3CD6S 2YQ0A 3GCXP 4X65F 1NK5A 4ZPDA 2Y8YA 3B78A 1NB7A 1H98A 1UKUA 2CNKB 3R9LA 3N79A 4CYUA 2V8DA 4IRDA 1U4BA 1L3TA 3MR5A 5F8HA 4ID8A 3R8YA 1NU4A 2WOMB 1S1VB 5ETRA 5AJ3J 2CG4A 4YOEA 3L9ZA 2QMUB 3B82A 4EBDA 1R0CB 1ZYQA 2CQCA 3AD9C 2VFTA 4JI7F 3PYGA 2YKMA 4RW4B 2BRLA 1KEKA 2LCWA 3SYZA 2N3OA 4ENOA 3W65A 4NZ6A 2AP6A 3W3SA 3MUTP 5EUHA 4AQYJ 5J2MB 2ZFHA 3M30A 2CAJA 4LFAF 4YMEA 4EO6A 3A13A 1NNDA 2UXDF 2ZM6F 2F65A 3LA0A 3K5NA 4KO0B 3NGRA 1JXEA 4NI2B 3V6KA 1S6OA 4QW9A 4H4OB 2MGZB 2AKWB 1SJ4P 2CKWA 2DGUA 3VR1A 5DDPC 5A2QY 2G4BA 4NCAA 1GFWB 2ZITA 3LPEA 1CC7A 3MEEA 2XMVA 2UV8A 5KFSA 3M32A 2UUBJ 5HK4A 4EK2A 2W9CB 2PD1A 2B6AA 2GV1A 1E6VA 3M8QA 3HMJG 1GTHA 4Y2CA 3CCVS 1HLWA 4TY8A 3QWUA 1TKTB 5GMKa 1FRIA 1OS5A 4B9TA 3W2WA 1DLOB 1IR2A 3VVTA 3H42A 2YKPA 5IT0A 3CJ4A 2VFRA 1KLNA 2FHJD 2VPYB 2XMMA 4A8YA 1S4FA 3IRXA 1OY6A 3BEGB 4LR8A 3G8SA 3OR2B 4HLBA 2DEIA 1H2UX 2C3PA 4Q0BB 1UA1A 3QQCD 3P49B 1N5SA 4IYQA 1RTZA 1RTDA 2UV8G 5GMEA 3CMQA 4J5OA 2HFNA 3THTA 4O3OA 2DCLA 3D1QA 5K9FA 2CPJA 3I55S 4F3OA 3W62A 1RT1B 1LW2B 5CD4A 3KLEA 1VQ7S 2MB0B 4UZCA 1AUDA 3KG4A 3M8WA 3CCRS 4I2PA 5HMWA 1S6UA 2BANA 3SIPB 4O3QA 3QZ7A 2PGCA 2NSBA 4ZP9A 4I4BA 2DO0A 4DL7A 4FN5A 3PV8A 5FDLB 2WONB 4DV4J 4I69A 1LFPA 1TQLA 3VAKA 3DDIA 4RR5A 3VWSA 1LXJA 1TFWA 3TEHB 4NCGB 4DU8A 5JJBA 3S7RA 1ZTTA 1V3ZA 1V9OA 5BYQA 2OTJS 3AOCA 4PUOB 5C25B 4WFBQ 1F3FA 3G6YA 4WWSA 1CJKB 2OELA 4DOZA 3ZZ0A 4CT9A 1YGYA 5BYSA 2D3OR 4YHHF 4KFBB 3G8QA 2PO4A 2CDRB 4M5IA 4OMFG 4MKAA 3FEZA 4C97A 2OFGX 3DLKA 4I0WA 4N7TA 4ZP6A 2NZCA 2CNOB 2XSJB 5KG3A 2RRAA 1EQ0A 3TQEA 3VGUA 1RWXB 4EZ9A 2KL8A 3GFXA 4FYXB 4OLPA 4FF1A 4UT4A 4RNMA 2AZ3A 3UE2A 3SFGA 3OVAA 4B9NA 1VQOS 2G0IA 2NUUG 2H4WB 2K7JA 2DY9A 2CWXA 2CQ0A 1DJ0A 3G6VA 9ATCB 5I42A 2AGQA 1TKXB 4OHZA 4HR2A 5L1JA 1WOSA 4LRAA 2EFGA 2E1RA 4NLPA 1GNKA 4ICLB 5KT5A 3IBWA 4ZVQB 1DBDA 4PRFA 1KN6A 4OX9J 2CWKA 1NZ8A 3C2PA 2HFUA 1YJTA 3KYLA 4GMKA 4YR0A 1N34J 1JLQA 3GV7B 4DEZA 3LGNA 5IT9Y 4NXNJ 3IS9B 2EG1A 1NXIA 3MMCA 2YNGB 3AOAA 4KGMA 1R89A 4CNZA 4TVAB 2FD2A 4NA1A 3VQTA 2GMJA 3NP5A 2VU5A 1S57A 4ED3A 3PFOA 2RDJA 8RUCA 1G3OA 2E5LF 5C24B 2MHEA 1U1PA 4A8FA 4LBHA 1J5EF 4RW9B 2ZH5A 4HHUA 4NLRA 3QRRA 3OQ2A 2F1FA 4LF6J 2F9JA 4DX5A 4ZP7A 4ITSA 3TZZA 1NK9A 3DRRA 1FFGB 4CYUB 5D0RA 1X4BA 1S6PA 3VAHA 1M5OC 5M2UA 1U8WA 4CCHA 2A6OA 2B0GA 5DGBA 2BV3A 3M9NB 2AJ1A 3W7BA 4G1QA 3O44A 5L1IA 4N77A 4CH0S 4ZVHA 5LSOA 2E7XA 3JXOA 2HFOA 4IH7A 2MJUA 4F0KA 2YKMB 3JSYA 1BE4A 1WJ9A 4OYBA 4KPYA 2XMUA 1Q4RA 2EK6A 2BJ9A 3WBZA 3MEGA 1T03A 5DM7Q 3M30B 1Y0HA 1NCLA 4X4SA 1X4HA 3B6BA 1NKBA 1YBTA 3CC2S 5A76A 1XR5A 4F2RA 4DUZF 1R8PA 4C3KA 4OYZA 4HEA9 1RHKB 4P7VA 4RNOA 1UJ5A 4QIWD 3C46A 1C1CA 2EK1A 2MSTA 4C8LA 4TKTA 4MK8A 4P9SA 5D15A 2HGNA 1Q81T 1VK3A 3MEEB 1IJEB 1M0SA 1AUSL 3M32B 2CQPA 4NXMJ 3MR7A 2HZCA 3JS9A 1KHWA 3IBCB 3BM7A 2B6AB 2XI2A 1E6VB 3M8QB 2M88A 2GW8A 2KFNA 3KHHA 2B4OA 1YIJS 4TY8B 5E3CA 1PC5A 5E3AA 3MR6A 1RAIB 2DVIA 2AWZA 3FSYA 3W2WB 5F9LA 4LFCJ 1R6VA 4PABA 4J9NA 1RCOB 5KTQA 2ZKTA 3GYGA 2HSEB 3IRXB 5B0GA 3BN4A 1MNEA 3MMAA 3E2EA 5DM6Q 2VFUA 3MHYA 5HBMA 2DHHA 3MDFA 3PW4A 2XS2A 3A4TA 4Y2AA 2G1DA 4LF1A 4UQTA 5KG0A 1RTDB 2XZTB 1VIOA 2VA2A 4I64A 4RJVA 2YNFB 1WHYA 3HJFA 4ILLA 4DFKA 4ZIWA 2DXDA 4C8NA 3D3BJ 1UMJA 2J9DE 1J5OA 3KLEB 3R7NB 1K9MT 5E7OB 1XN9A 1G7CB 4I2PB 3TX8A 3ENWA 4TXSA 4ZVRB 4URGA 4K5RA 5L8RC 4B3MJ 1X4EA 3D54A 2HHSA 3DLBA 4HDGA 2XHCA 3TANA 4ZVGA 4RNHA 2BA9A 2HS4A 2Q1LA 3O3LA 4ZPVR 2N7YA 1WWHA 2P6SA 4JYAJ 2J0WA 2F4VF 1TKZB 2IJFA 3BH7B 5HJYA 3A1YG 2XNQA 4KQZA 1IWAA 5LSRA 2KRBA 2EBGA 4ZHRA 2BW7A 3GSIA 4DR3F 4DV5J 1X60A 1RWWB 3DLKB 3IP0A 3CDEA 1BQNA 3LWMA 4C7QA 3H2VE 4L75A 3MECA 1SUQA 2W4DA 2NYHA 1CJVA 2OUGA 1BMQB 2RE1A 4ZJQA 4DR7F 5CABA 4IO9Q 2EC2A 4M5HA 4P2XA 4EEYA 4I56A 1IBCB 1HWLA 3TUIC 2D1CA 1RT3A 4Q5VA 2FDNA 2ZWOA 2VJUA 5GAHI 2MKHA 3CIZA 5I42B 4UW2A 4OZ3A 3R5JB 3EICA 1P1LA 3GV8B 2YWFA 2RRNA 2I5JB 4NCBA 2GIQA 4K8RA 4Z7YA 3AA8A 1XR7A 2O01C 2HQIA 2D41A 2JLFA 2DNMA 2HK2A 3VAJA 1JLQB 4M5DB 4OI1A 2OMOA 3JAMU 3I56S 4O3RA 2PIIA 5DJBA 3MMCB 4QU6A 4OYXA 3KJVB 4GKKF 1VDHA 2IRYA 4NX9A 3NMRA 1J27A 1MMDA 1Q8LA 3MCMA 3M2VA 3JQKA 2OTLS 5KG7A 4CH1A 4QOTA 1ZAWA 1OWXA 3B4MA 4WXWA 2M8DB 4JI3J 3BQ1A 4F25A 1FX4A 3DFEA 5CHCB 2MLZA 2VIHA 3PY8A 3TOQA 1UFKA 3Q8PB 1RBAA 1HYSA 3MM9B 2D69A 2XQCA 4ZJOA 3MOJB 2COLA 1WELA 3QT5A 1NK6A 3Q2TC 3FKBA 3EUNA 3DRRB 3OJSA 5J2NA 2YNIA 2BKOA 2ZEJA 5GVQA 3UD4P 2MHNA 3N9UC 3QBCA 2AIRB 3BKFA 4B3OA 1S6PB 5FLXY 2H5EA 4D3GA 3RRHA 2BR0A 2DGSA 4NLGA 4DR6J 1H72C 2OPSB 4XK8C 2HWTA 4Q8FA 4G1QB 2IBKA 2W9BA 5B7WA 1Z2ZA 4FYYB 3ETOA 5D4PA 4X4TA 1VQSA 2FZGB 1GX5A 4A8KA 3PXGa 4RW7A 1I94J 4KHMA 3K89A 1N54B 1T03B 4PXDA 4DSJA 1M1KT 3OSNA 4C8MA 1VGYA 1FFSB 2X51A 5LOQA 2HIYA 3KMQA 3MFIA 2J7KA 1JXVA 4HYKA 2DRDA 1SXLA 5B0DA 2E7WA 2UU9F 1RE1B 4DQRA 4M95A 3QFHA 3BYRA 3ULHA 3KK3A 3KMSA 1C1CB 1AA1B 5KFXA 1FXDA 1FWPA 2HHPA 2VPWB 4FXDA 1N56A 3FK4A 1BWVA 1PJ5A 2AJ4A 3C19A 3FMWA 2IYGA 4YP3A 3BSNA 2KXFA 4DWIA 1FTCA 4ER8A 4R0EA 1XMQJ 2AT1B 1RAJA 2MXYA 1FEEA 3MOZA 4MYUA 3T6JA 2RD5C 2J8AA 3ZZOA 2B56A 4QYRA 4ED0A 2E5JA 3H2LA 3V81A 4ZCMA 1SH3A 1WSVA 1XR6A 1X7VA 2MEWA 3MMAB 2RF2A 3W9HA 1HARA 2ZNZA 3HJVA 3NGDA 5HBMB 1K73T 1LKZA 2VG7A 3QT7A 3CC7S 3CD5A 1WF2A 2RKIA 2GFFA 1PBUA 1U02A 3QO9A 1WC0A 4Y6IA 2UXBJ 2MKSA 4K7QA 1R8CA 3T9NA 5IM0A 3TAQA 1LOUA 4UZBA 2HNZA 5HANA 1IBLJ 5G4DA 3M8ZA 3WIVA 2MYFA 1J5OB 2F9DA 1RHQB 1K47A 2CQBA 2DGWA 2UZAA 4DQIA 3GQCA 3HHLB 5T14A 2KM8B 2J8SA 1SKRA 4H4KA 1TFYA 3AODA 3S8SA 3DKDA 1EB0A 4P71A 2DGOA 2DH7A 3Q2SC 1FNMA 1NEEA 3UFCX 4YY3F 1IM6A 1HNIA 2UP1A 2W2MP 3CJ8A 4PZVA 1UETA 3L95X 2MY8A 2NYIA 4G1PA 3TZYA 2GAGC 2QLBB 3DU6A 1SIZA 4UOFA 3RBZA 4B08A 3FUYA 1RZMA 4NZ7A 3PW7A 2C2NA 2JLEA 2F4FA 4ZHRB 4DFJA 2GJIA 3HK2A 1FKPA 3DLLQ 1RKIA 2JRSA 4JP8A 2BQ3A 2G2ZA 3V6JA 3QWPA 1CS4A 3C3LA 1DQAA 2CPDA 1NH7A 3Q89A 4RKUC 3RUBL 1N33J 1FF2A 1BQNB 1RAAB 1IQTA 4M1KA 3MECB 1S9EA 3JB9k 1SUQB 4QWAA 1CJVB 2BM1A 3SEOA 1EX8A 4LF4F 1WG5A 3D9BA 3RR8A 3FVYA 3M9MB 3MI7X 5C7PA 3MUVP 4JI2J 1RT3B 2ROPA 4KY3A 2CPHA 2MQLA 2AYEA 3CW2C 2HFSA 4HHHA 3QPIA 3MURP 2WSEC 2GX8A 2UUCJ 1EETA 2B7BB 3QSYB 2H1YA 1C1BB 2GVZA 3NL0A 4DCPB 3CJSA 2IA0A 1UZHA 2JVOA 4ZOSA 4TLQA 3S01A 4ECRA 2I2YA 3SCLE 2EEYA 4FF2A 2PI5A 1RDRA 2CJBA 2FJEB 1AFIA 3TVKA 1FESA 4YDDB 2ZWPA 2MLYA 3PIOQ 4CTAB 4IDKB 3M2VB 2XGQA 4LF8F 2CDQA 3MM8A 3H59A 3QJJA 1R31A 4M5GA 1RT2A 2V68A 3H5YA 2YKAA 4UOGA 1ACMB 2J0XA 2YX7A 1X5SA 4I6WA 4BWJA 1UEUA 5BXIA 5HQLA 3IR5B 2FVCA 3K7RA 1WTBA 5J2NB 2YNIB 4MT1A 1JIHA 3UCZP 3D4JA 5J2QA 1A6LA 4ECSA 4B3OB 1UA0A 4FDFA 2XMKA 2HIQA 3QT8A 4OJ3A 4Q2LA 2LXUA 4KT0C 3NWRA 3HLUA 3Q86A 5KFVA 2A10A 2R8JA 3DLHA 3OFHA 2A0FB 3E3XA 5F41A 2HMIA 4A48A 2RQCA 1GXUA 1U49A 1T3NA 4C0HA 5KOWA 2V5HG 3HHDA 3G87A 4DV1F 3TUPA 1WHWA 3KHGA 3QFWA 2B5JB 1UP1A 5LJ3Y 4USUA 1HWKA 3RU0A 2HZVA 3AOBA 2VC1A 1HQ2A 5A8WA 2LU2A 2ZH1A 1NK8A 3EXYA 3A12A 3GIJA 2M8HA 2EFVA 1R0AA 2HGMA 2ZH8A 3KK3B 2VPXB 4B9LA 4MFBA 1M5VC 1WC1A 3ONQA 2Y9HA 2CZ4A 5CYMA 1UTAA 2IMWP 3H8YA 2Z0GA 4CO1A 1O8BA 2EVZA 2HVEA 4CO0A 1NHUA 4UOHA 3D68A 2XBPA 1S6QA 1LEOA 1VJQA 1HQUB 4F7VA 4KE5A 4DQQA 3KJNB 1X4CA 1PO6A 4F8RA 3V81B 2IVFB 4MKVA 4WP8A 4JI1J 2K2PA 3M6WA 1X5TA 3VAFA 2RF2B 3B8HA 1X4DA 3PRVA 3EZUA 3HVTA 1KQSR 3BGUA 1AB8A 2VG7B 4LVOP 2RKIB 2MZSA 2JLGA 1I1GA 3FZ2A 3OUYA 3QO9B 3HHLC 2IBOA 2LEPA 1C0UA 3DRSA 3WDOA 3UI3A 2KM8C 3E51A 4DJBA 3G6XA 5KFGA 1NZAA 1KS2A 2KU7A 3QAEA 1JLBB 1YJNS 3BJYA 2NUHA 1VC6A 4DR2F 1DQ9A 4OYMA 1YSJA 3DOKB 3IBFB 5HMYA 2Z2MA 3CJRA 2AJ0A 3OVSA 1PSDA 3KLHB 2GHWA 4OI4A 3DOMA 2B51A 1HWIA 1AFJA 2OPRA 3NNAA 5K8OA 1HNIB 1TL5A 3LGMA 3N5BA 2MQPA 4DSLA 2N4DA 2FC8A 3IA0A 2B8PA 2Y1LB 4F04B 1IBKJ 2LDYA 1JLGB 1HL6A 4MKBA 3SQOP 1VBYA 2C1EB 1L3VA 3BQ2A 5LMUJ 4TU8A 4I7FB 1RB0A 3N4WA 1FVSA 2YBVA 3MR2A 4F0MA 4BC7A 1VRTA 5EHHA 4DV2J 4F02A 1CS4B 1GXTA 2L48A 2E66A 5KFIA 4CRJA 5C2GA 2CPEA 2E1CA 3C6UA 1TK0A 1SJ3P 1S9EB 2IFXA 2XC9A 2GJFA 4ZPAA 4AD6A 4IR1A 4AL7A 3CO9A 1DZ5A 2UUAF 1SJ1A 3KLFA 2QYGA 5F8JA 5IC6B 3MR3A 2E7VA 3CNQP 2KHCA 2P9EA 2VD3A 3J81U 5F8NA 1LWFA 3OPKA 4R5PA 3KK2A 2HHHJ 3OTOJ 2O3DA 2K3IA 3BV8A 2NS1B 4AQYF 5LM7E 1HD1A 4RBTA 5GAGU 2I0XA 4FF3A 5JVGQ 2MY7A 3PRBA 4RO0A 5KFAA 2IIHA 4DV7J 5CXTA 5IWAJ 2MJNA 4O23A 1EETB 3T5JA 3SXLA 1NJYA 1YRTA 2YWWA 1Y5NB 3BB5A 3LOUA 2ZH9A 3VF0B 1TMJA 4K4VA 1UW4A 4QPXA 2V94A 2D7SA 1JNZB 4BDPA 5HQ8A 3VGVA 4JI8J 4KV8A 4ZPWR 2ZZMA 1HKAA 1PG5B 5HVFA 3B4DA 4EUVA 1M90T 1N5TA 1R27B 4RBVA 3MCNA 2G0CA 3G82A 3GFHA 2BJ1A 1BXNA 3MM8B 1TL7B 4EWTA 4QJVA 2GJ2A 1PGZA 1N5YA 2W2OP 1RP5A 1U25A 5J1EA 4PG8A 4LR9A 3QYYA 3BO2A 5A8KA 4N41A 1U1QA 3NRBA 3JAMY 3FQLA 4HHJA 1KKHA 4K4SA 3S1TA 3CXCR 2PEHA 4JV2A 1AYEA 2YY3A 2E5GA 1GMUA 2JDJA 1HBOA 2HBZB 5J2QB 3QSIA 2DYAA 2CIMA 2P8IA 5DLGA 2W9AA 5KFMA 5CAAA 5GAHU 1Q7YT 1N0UA 1NM2A 1Y11A 2CA9A 4IQXA 1QE1A 5C2CA 4OX8A 4XAKA 2XLKA 2Z2LA 1KVJA 2XS5A 4C8OA 2HMIB 2HK3A 2WCXA 2W1BA 2SXLA 2JOQA 1YJVA 1FERA 1D3WA 4MH8A 1T95A 1RHMB 3GIIA 1T0TV 1K44A 2XMJA 4B17A 3SI8A 3PJXA 1HWUA 3C8YA 1X4FA 4LSZB 4KGKA 5LMNJ 4P10A 5A8WB 4WP3A 1CQMA 3F56A 1JLAA 2VA3A 3HO1A 3NS7B 2QJ3A 4O4GA 1N36F 2ZNYA 1U2CA 1R0AB 1RWOB 1HNVA 5DDRC 1Y00A 2DISA 3MMJA 3PYEA 2CXEA 3ETMA 4MFBB 3Q83A 2BJ8A 1HBMA 5F0UA 3KFWX 1RABB 4PXBA 4QWEA 5JVHQ 5CYMB 4BWMA 4X62J 1FXRA 1XNQJ 3HVAA 4DV6F 1NJWA 4ID5A 4PQUA 2QSFA 1Q16B 2QA4G 2K7KA 4OZ1A 1KTVA 2F8MA 5HP1A 4G1IA 4WK1A 2ZZTA 5GADI 1RT6A 2PI4A 2ZD1B 4YFUA 1A9NB 4MKYA 3HVTB 3HT3A 5T7LA 3NG8A 4WZQA 1YZ7A 1NO8A 2RB7A 3E01A 1PIEA 4C9DA 2VB6A 4HH0A 2R7QA 4CP5A 3T19A 1RISA 3OUYB 1D8YA 1FWKA 3H2UB 1VQMS 1ZZFA 4KR0B 1C0UB 3DRSB 1RQ0A 2RRBA 3R1HA 3HM9A 4DHVA 3SFUA 3H20A 4M5KA 1U1KA 3FRYA 1UVNA 4E98A 1GMWD 2Z2YB 3IAS9 1UL3A 4RU9A 2JSXA 4F4WA 6FDRA 4IRKA 3CCSS 1VISA 3J7YU 4DL5A 3R2DJ 3ZTPA 2IDLA 2IJRA 3MCSA 2B43A 2ZOFA 3V6DA 3DOMB 3EX7B 4WYLA 4LJMA 2OPRB 2QG9B 4DG1A 3I5BA 3CMES 4WU3A 4U8YA 3T3FA 1JLCA 3H90A 2BOPA 1NPRA 3MUMP 1FJGJ 2WSCC 3FMBA 2UUTA 1CVJA 2VBWA 2QMXA 3D5MA 3DRYA 4LF6F 3IGNA 3IO1A 4RBUA 2VQEF 4PG5A 2GQ2A 3JQMA 4ELVA 3EGZA 1RCXB 2XYPB
chains in the Genus database with same CATH topology
2B9WA 4A8FA 2O5DA 2EFQA 2YKNB 3E8OA 1U26A 2C2DA 1J5EF 1RT4A 4EO8A 4RW9B 4TQRA 2ZH5A 5LL6d 1VLYA 4NLRA 2M52A 4OHYA 1F60B 2O66A 2F1FA 3OQ2A 5IM0B 4P2SA 2F9JA 2HVIA 2WB1D 2ZBIA 1JJHA 2CQ1A 2LA6A 4JUZA 1JXLA 5D3GA 1NKCA 2RUGA 2CPIA 1T7PA 3L09A 1K0VA 2OKQA 2HNZB 2J9EA 4AUKA 4Y3CA 4DQPA 2DR8A 3MAHA 4ZP7A 4ITSA 3CGIA 4G6VB 3G6ES 4A8WA 4DN9A 1LWCA 1NK9A 2I38A 3DRRA 1D8ZA 1O5JA 4B3SF 3OL6A 2KVIA 2I8EA 2QFJA 5K8PA 1X4BA 1SJQA 3PJWA 4NLWA 4Y2MA 4WE1B 1XMQF 1QSSA 5KFOA 3KLFB 1S6PA 3AHPA 3TUJC 3VAHA 1M5OC 5M2UA 4CCHA 2B0GA 1TKDA 3BGRB 1XNRF 5DGBA 4KIAA 2BV3A 3M9NB 5HMZA 3OL9A 2CFXA 1U24A 2AJ1A 1ELOA 1LWFB 3W7BA 1RT5A 4G1QA 4R5PB 4PR6A 3UR0A 1IUJA 3O44A 3BSOA 2DR7A 3KK2B 4IG3A 2HFZA 1LWEA 5L1IA 1P8GA 4N77A 4ZVHA 4CH0S 5KFBA 5IXUA 5LSOA 5KFEA 2QA4S 2E7XA 1N4LA 2EFPA 4AYBD 2HFOA 3POTB 4MTPA 5HO4A 4IH7A 1AXQA 2MJUA 2YKMB 4TLRA 4YQWA 3JSYA 4Z37A 3BZQA 3VAIA 2GIRA 2CYYA 2KFZA 5D4NA 1AROP 4KPYA 2E5IA 2NREA 2XMUA 1Q4RA 2EK6A 3FGVA 1S49A 1HQUA 1HPZA 1U2RA 2RQMA 4EU0A 1OIAA 5GAEI 2PMZD 5DG9A 2MZ1A 3EYZA 5HLFA 4LF7F 3WBZA 1BQMA 2Q6CA 2B4UA 4PG7A 3PRDA 5K14B 1UJ4A 2RQ4A 3DDKA 1FKOA 3MEGA 4ZPBA 1T03A 4I67A 2DGQA 5EN1A 1U47A 3V6HA 1OPIA 2IM1A 2GMHA 2C22A 5DM7Q 1S1XA 3M30B 5LSLA 3SMZA 1FRKA 2X1FA 1H0HB 1Y0HA 2GQQA 2QO3A 3GG1A 4X4SA 1ZTWA 1HHSA 1FKPB 3M1VB 1X4HA 2XB2D 5CQGA 2W7PA 1KD1T 4UY8T 2NXUA 4C2MA 1NKBA 1K1SA 2UXBF 3ITHA 3TARA 3OFFA 3CC2S 2DT9A 2IVYA 2ZDPA 1XR5A 4KTQA 3GSDA 3MEDA 2D3ZA 1L3KA 4F2RA 4DUZF 1VQNS 1NRKA 1R8PA 1RYSA 4C3KA 4ALZA 1IKWA 1RGVA 3EGWB 5U47A 3V4IA 4HEA9 1IBLF 3V4MA 4EFAC 4P7VA 2G13A 1S1UA 4RNOA 3M8PA 2YTCA 4NXMF 1QAIA 1UJ5A 1BLUA 1P9QC 1GX6A 2X3GA 4QIWD 4ZCLA 3C46A 1C1CA 2EK1A 2MSTA 4K4YA 4C8LA 2Z8QA 1GXLA 4MK8A 4TKTA 2R2TA 3M9OB 4CO2A 4TN2A 2OPQA 2HGNA 1Q81T 3I0SB 5L1KA 1SV5A 1VK3A 3LPYA 3MEEB 1IJEB 1M0SA 3M32B 3OXLA 2CQPA 2OAUA 2HPUA 3VAMA 1JLBA 4GO5X 4RX6A 5G0RA 3K5MA 1Q78A 3HVWA 3MMBA 2ADCA 4M94A 4LF9F 2P9GA 4MIBA 2FY1A 1YQHA 3MGJA 2HZCA 3G4SS 1K8AT 4B3RF 1KHWA 1N5YB 3DOKA 2VUGA 1B0PA 3BM7A 4RNNA 2DRBA 2B6AB 2CQGA 2XI2A 1OPZA 3PFEA 5KFHA 3IR6B 3OVBA 3FDSA 5J2PB 1E6VB 3M8QB 4J9KA 1HBNB 2M88A 2GW8A 2KFNA 5FD1A 5A8KB 3KHHA 2W25A 5DRKA 2B4OA 2HWHA 3U1MA 1YIJS 2RDIA 4DX8H 4TY8B 3KG1A 4H54A 1MW7A 2LDIA 2W24A 5E3CA 2DCUB 1PC5A 3KLHA 5E3AA 3MR6A 1T8EA 3ZZUA 1U6BA 2DVIA 4FNIA 3NCPA 3DOLA 2AWZA 1LFWA 4UY85 3FSYA 3W2WB 1YJ9S 4DS5A 4N47A 5F9LA 4X66F 1VQ6S 2XWYA 3SV4A 2HNDB 2FVPA 3W2VA 4X64F 1VHFA 4J9NA 2XY6A 5KTQA 1HBOB 1RA6A 4CNYA 3NMAA 4LIWA 2ZKTA 1HR0F 1C4CA 2HHQA 2M7SA 5KFWA 4DR5F 4YB5A 4L6V3 4V19X 2JHEA 3IRXB 3HHLD 3K8VA 1DTQA 2J0SD 5B0GA 3BN4A 3P6YC 1MNEA 3C6TA 3DI6A 5KT6A 2R2SA 3I9V9 3MMAA 3E2EA 1NKEA 1YJUA 2N4CA 2P6TA 4HI1A 4NLDA 1Q53A 2R8HA 5DM6Q 4I6YA 1VQKS 4YB1P 1JLGA 2VFUA 3MHYA 3OR1A 4DMZA 2XO7A 3RB4A 5HBMA 1QE1B 2VKRA 4WK3A 2VG6B 4I7FA 1DURA 3MDFA 2OSQA 2LECA 3PW4A 4Y2AA 2XS2A 2G1DA 3IN5A 2ASDA 2XHWA 4V19J 2HWIA 1KSPA 3X1LB 2C3YA 5D8HB 1N88A 3PIPQ 4UQTA 2XY5A 2V8GA 4OX7A 5KG0A 5A0YB 1N48A 1RTDB 2HVZA 2X1GA 3CT9A 2LQJA 4ED1A 1W2IA 2A2DA 1VIXA 2BE2B 3MF5A 2FTRA 1VIOA 2RQKA 3DLJA 3MEKA 2VA2A 2MKJA 4QW8A 2KYZA 2NLWA 4I64A 1OSDA 1SH2A 2EFNA 1Y3KA 2JEGA 3DN9A 3MXHP 2YNFB 3G86A 1TV6B 3CCMS 3QLHA 1WHYA 3HJFA 2CQ3A 4DFKA 4ILLA 1KHVA 1BQXA 3GWCA 4C8NA 4R8UB 3RW7A 3HPOA 3FEYB 1URNA 2R7RA 3OXFA 1VFJA 1M5KC 1UMJA 2J9DE 1J5OA 1X9WA 2HS0A 4E8UA 4B3MF 5DS7A 3T1HF 2HVHA 1WEYA 1H7WA 3WC0A 4JI2F 3KLEB 1X0FA 1RT2B 3I82A 3CDUA 3CCES 4DSKA 4UOCA 3NAIA 5F8GA 1S9GB 2LXFA 1K9MT 5E7OB 1XN9A 5AE3A 1U1MA 1G7CB 4I2PB 3TX8A 1FK9B 1MMNA 3ENWA 4P7TA 3Q8RB 2BACA 4TXSA 1ZAVA 4ZCKA 2AX1A 2Q6BA 4IH6A 2A3JA 2IJNA 3KLVA 3KKFA 1JLAB 4LVNP 2WOMA 2PE8A 2V4JA 4O4GB 4K5RA 4URGA 5L8RC 1X4EA 1RYRA 3D54A 2R8IA 2HHSA 3DLBA 2KH9A 4HDGA 2RT3A 3TNVA 3UDLA 3TANA 2FLNA 4C8ZA 2L9DA 3RAMA 5C5JA 1HNVB 1WACA 4ZVGA 2UUCF 4RNHA 2BA9A 2HS4A 3NKYA 4O3NA 1D9AA 4JI0F 2PA8D 2Q1LA 4K4WA 2AGOA 3O3LA 5KG5A 2E29A 4ZPVR 2N7YA 3IWNC 1WWHA 1RI7A 2IHR1 2P6SA 2WBMA 4N8OA 2KG0A 4WKRA 2MMYA 2YWKA 2J0WA 2AYGA 1VS3A 2F4VF 3TUZC 2BXJA 4TYBA 2HLTA 1F0XA 2VH7A 3DCAA 2VQFF 1TKZB 3CJ0A 3J7Z5 2IJFA 2ZH2A 3M8RA 2WSFC 2AV5A 1YJWS 2DHSA 2C3OA 4OZ5A 4EZ6A 3A1YG 1FJEB 2XNQA 5DDQC 1RT7A 4KQZA 4A47A 1X0PA 2ZUGA 2LXIA 5LSRA 2KRBA 2EBGA 2HRUA 1JLFA 3MTKA 4JOUA 5JXSA 1M5HA 3JTOA 4ZHRA 2IVMA 1Q7LB 3IWLA 4PXCA 1IN0A 4DR3F 5B0EA 4NOHA 2LKZA 1N0VC 2VOOA 1QUPA 2JEFA 2QV6A 4KO0A 5HROB 4C3LA 1MWZA 1S0MA 3TAMB 3DLKB 4O3SA 2ZZNA 2ACYA 2J9DA 2XWXA 3CDEA 3I4HX 4Y2KA 1BQNA 2HHTA 4XPCA 2YWEA 3LWMA 5HP1B 3MPWA 3HF5A 4C7QA 3HKWA 1JB0C 3H2VE 5DQIA 1S9FA 3MECA 1FNXH 1SUQA 4O44B 2W4DA 5MAOA 3CCTA 4LFBF 1FHTA 2N82B 4U6PA 4NRTA 2JC1A 4CQ1A 4QIFA 3U7JA 5KG4A 2AF6A 2RE1A 4K59A 3RAXA 2FHMA 2MKCA 5DETA 5ADZA 1F5CA 4ECZA 2OLWA 4DR7F 1RT6B 3KK1A 2FJXA 2FGOA 4GC6A 4IO9Q 1NH8A 4KHPF 3R5BA 3CPWR 5AXMA 2XLJA 3O6QA 4AE5A 2JC0A 4U7UK 4URQU 5T7LB 4WFNQ 2C28A 2KO1A 2QT7A 2J5AA 5DDOC 3EPGA 2DBBA 4OZLA 4A8OA 4EEYA 1WNEA 3E01B 1R3NA 4I56A 2I1RA 1UVKA 1OSCA 2R2RA 1HWLA 4O3PA 3TUIC 4OZNA 4FVMA 2D1CA 4PQAA 4XPEA 1RT3A 3BF4A 4IFYA 4Q5VA 3IXQA 1TL1A 2FDNA 4HT5A 5E2QA 4OJHA 5GAHI 3EZ5A 2XI3A 2KZMA 4IFVA 3IC1A 3MM6B 2XEXA 4CO3A 2KT3A 3FCHA 2M2BA 2MKHA 1HA1A 3CIZA 2V2KA 5I42B 4UW2A 1VMBA 2HYIB 5F3TA 5EGYA 1TKTA 1D0EA 2POKA 1P1LA 3GV8B 4W90B 3F41A 1FCAA 1VK8A 2YWFA 2RRNA 2I5JB 3Q8QB 3KNGA 2FUG9 2DGVA 4K2XA 2NZ4A 4NCBA 2GO8A 2A1BA 2VL1A 2GIQA 2MZRA 5FIIA 4FP9A 3THVA 1WG4A 3CCWA 5B0CA 5B08A 3L7PA 3AA8A 3AQOA 4HI2A 1XR7A 2O01C 4DF8A 4QYZJ 3PW5A 3GE9A 3U27A 2HQIA 2D41A 2JLFA 2DNMA 3PZPA 5AE2A 1JNRB 2CPYA 3CUNA 5JUMA 3NGKA 2M0GB 4Q2MA 3VAJA 1S6QB 2WTFA 2ERRA 1JLQB 4M5DB 4OI1A 5D78A 2OMOA 5CYQB 3R3TA 3I56S 4USJC 2MSSA 2FHKA 2DITA 5L1LA 3OR2A 3UCUP 1VRUB 3V6DB 1UAWA 3TVYA 5LT5A 2FHOB 4ZA1A 4DF4A 4PPDA 1YITS 1JX4A 3KHRA 4O3RA 2PIIA 2OSRA 5DJBA 3MMCB 4NPOA 1VQYA 4DG1B 1SL1A 4QU6A 2RNEA 3KJVB 4WJBA 2AX0A 4GKKF 1GAOA 2YNHB 4FS2A 1URRA 1JLCB 4RWXA 1V3RA 3SCKE 2JJ4D 2CQDA 3LUYA 4NLUA 2IRYA 4PXEA 3NNHA 4NX9A 2LQBA 5BR8F 3NMRA 1CSJA 2GGPA 4JI3F 2AU0A 2J6UA 4UQGA 4EYHB 4USIA 2J0QD 1MMDA 2BZ2A 4N8NA 4J9PA 1Q8LA 3VZHA 1SKSA 2W4CA 4ZVFA 3M2VA 4C8YA 2OTLS 3I32A 3TA0A 3TA1A 2N7CA 2IC3B 5KG7A 4CH1A 3QZ8A 4USHA 4QOTA 4ECXA 1VQ9S 1ZAWA 1Y7PA 1OWXA 3B4MA 2CZVC 4WXWA 2M8DB 1Z4UA 4AXIA 1LW2A 3LANA 2UVWA 2QLWA 1DHMA 1ULRA 3IGVA 3BQ1A 2X1AA 1KNZA 4F25A 1RA7A 3DFEA 2MQNA 3TAPA 1QSLA 3K0JA 5CHCB 2XY7A 1RT4B 5KFYA 3RRKA 3L3CA 5F8IA 3PY8A 4FPRA 3TOQA 3HXMA 1QAYA 1UVMA 1DAXA 5I3UB 1HW9A 3Q8PB 1HYSA 3RBDA 1ZM9A 2J6SA 4WFXA 3CJKA 4H4KC 5DG8A 3QIPA 3PW2A 5D3GB 4DUYF 3MM9B 4NWBA 2PFFB 2W8KA 3MOJB 3EXCX 2R9LA 2COLA 2OIHA 4HT7A 7FDRA 1WELA 1NK6A 3Q2TC 1LWCB 3EUNA 3DRRB 1Y4ZB 5FDLA 1GT8A 4ATNA 3OJSA 3DHXA 5J2NA 2YNIA 1ZM2A 1X5OA 4IG0A 1HWJA 1IM4A 1F2GA 1Y3JA 5GVQA 3KLGA 3UD4P 5L9NA 2MHNA 3N9UC 4TYAA 1U1NA 1HNWF 2Q66A 2HHXA 4B3OA 2FGCA 1S6PB 5FLXY 2H5EA 3QIDA 3SSQA 1UVJA 4DV3F 2ATLA 4D3GA 3RRHA 2BR0A 2DGSA 4NLGA 3QJPA 4MJKA 2DK2A 3I5CA 2HNYA 2OPSB 2KT2A 4XK8C 5KFPA 3PX0A 5C25A 2HWTA 4Q8FA 1RT5B 4G1QB 1TAQA 4F3MA 2IBKA 3N6NA 4IG3B 1KQFB 1LWEB 2W9BA 1IKXA 3CDAA 5B7WA 1JJ2R 3NCQA 4XIUA 1Z2ZA 3G8TA 1QVGR 2P5VA 4DL6A 2M3DA 3I6PA 3AB2B 1VQLS 3PX4A 1NK4A 3ETOA 3JTNA 5D4PA 1WHVA 4X4TA 2AYBA 4Z2XA 1KONA 1VQSA 1HBUA 3SZ2A 4JI1F 1GX5A 2JEIA 4A8KA 3PXGa 3M6XA 1LW0A 2JH3A 4GO7X 4RW7A 3PX6A 1HPZB 3LWLA 1HI8A 4H4MA 2DNLA 4KHMA 5HLFB 2MKKA 4KBIA 3M2UA 1N54B 1T03B 1FKOB 1PILA 4PXDA 1HHTP 1U8SA 4DSJA 1S10A 1M1KT 1S1XB 3CD7A 3OSNA 1RTHA 2O67A 3GZ7A 4C8MA 1QTMA 1VGYA 3DYAB 2DR9A 2QE5A 3MWBA 4A46A 1QSYA 1DTTA 4CO5A 1FA0A 4X4VA 2PA3A 2UXCF 5D4LA 1VRTB 3AY0A 4DPOA 2X51A 5A6WA 2KYXA 4B9MA 3ITHB 2KXNB 1VBXA 2ZD1A 2BYCA 5EWFA 2J7WA 3KMQA 1GH8A 2EFOA 3MFIA 1IKYA 3OSPA 2J7KA 3GIKA 4F4XA 3MEDB 1TAUA 4HYKA 2EW9A 1SXLA 3AA9A 2E7WA 1KLMA 1X4GA 3LAKA 5B0DA 3LP0A 3J81Y 2UU9F 1B0VA 1C0TA 1IKWB 4F2SA 2Q3PA 1ZH5A 3PM9A 5D4OA 4DQRA 1VQ8S 3C6UB 4Y0FA 4M95A 3CSKA 2ZDOA 3HX9A 2FVRA 1S1UB 3WZ0A 5BJRA 2W8LA 3M8PB 3ULHA 4Y2IA 3KK3A 1U7LA 3KMSA 4AL6A 1C1CB 5KFXA 4BS2A 1FXDA 2CPFA 4CIOA 3H5XA 1FDDA 2HHPA 4WKYA 2OPQB 2VPWB 4FXDA 1WF0A 5DGAA 1N56A 1FRXA 1SV5B 3OTEA 3GFZA 3JSMA 3K58A 5AE1A 2AJ4A 5EX0A 3AJ2A 3FMWA 4ICLA 3MM5A 4DSEA 1CEZA 2IYGA 1BWEA 2VV5A 4Q7AA 5G0RB 4YP3A 1G1XA 4XO0A 1XTZA 3BSNA 3RB6A 2KXFA 3MMBB 4DWIA 4TY9A 1FXLA 1CLFA 2DNGA 3P5TL 4ECTA 1FTCA 4XDCA 1ZPWX 3D0HE 3DNCA 4F26A 3I5AA 3BREA 4R0EA 4QBUA 1TVRA 3GYNA 5KFKA 4L