4OX8A

Structure of prochlorococcus marinus str. mit 9313 csos1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
90
structure length
90
Chain Sequence
MGIALGMIETRGLVPAIEAADAMTKAAEVRLIGREFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARPHREVEPALGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Carbon dioxide-concentrating mechanism protein CcmK
publication title Engineering Bacterial Microcompartment Shells: Chimeric Shell Proteins and Chimeric Carboxysome Shells.
pubmed doi rcsb
source organism Prochlorococcus marinus
total genus 23
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ox8A01
3DN9A 3H8YA 3PACA 2A10A 4QIEA 3MPYA 3SSSA 5L38A 4OLOA 5DJBA 3VCDA 2EWHA 3I6PA 2A1BA 2G13A 3IA0A 3CIMA 4QIVA 3BN4A 3MPWA 4QIGA 3SSRA 4AXIA 3DNCA 3N79A 3NWGA 4OX8A 4OX6A 4QIFA 4OLPA 4RBUA 4OX7A 4AXJA 4P7VA 4PPDA 4P7TA 2A18A 3SSQA 4P2SA 4DDFA 4RBTA 3I96A 3CGIA 4LIWA 4RBVA 3NGKA
chains in the Genus database with same CATH superfamily
3PW0A 2XLJA 3A8JA 4ZPWR 2MQOA 2CNLB 4KY3A 2DT9A 4FXDA 4Q45A 4FZVA 4LBPA 3CJ0A 1JLFB 1YLXA 4BC9A 4WE1B 4AUKA 2VDIA 3IGNA 2FVPA 4ED3A 5GMDA 2ZHAA 3P5TL 2XY6A 3MR3A 3DDKA 1S9FA 1T02A 4IFYB 4RUHA 4DSIA 4PWDA 2GO9A 1QVFR 2J0QD 3MI7X 3W62A 4P52A 4WK3A 3BBBA 4C98A 1VIOA 5KAKA 2DGXA 3C3LA 1D09B 3G8SA 4WTYA 4NLQA 5J2QA 5F0WA 1DQAA 1FDAA 3P8BB 3IG1B 4PXEA 2JRSA 4LVNP 1YG0A 3TQEA 3PACA 2J0SD 3MPYA 1VQ9S 2EFVA 1CQMA 1EJ7L 4HI1A 2W1BA 4USUA 1X4EA 2YKAA 4KHPJ 3WC0A 2MGZA 3D6TB 1P6TA 3EICA 1RBAA 3DYAB 4LRDA 2MEWA 3KK2A 4LF8J 3DRRA 1H38A 3HVTA 5KFYA 2MKJA 1H7WA 1HWIA 1U1QA 2BJDA 5AT1B 2WSFC 2HK3A 3W2WB 3MR6A 5D78A 2FY8A 2X1AA 3QLHA 3OQ2A 2BV3A 4USJC 5F0UA 1WWHA 4DPWA 3CCQS 5KT6A 3CDAA 3VALA 4N56A 4IOCQ 1TL1A 2LA4A 3LGMA 3TZZA 2JHEA 1BXNA 2QFIA 3QAEA 2PO4A 1V3SA 4LVOP 1KOHA 3Q89A 3PRBA 3ZTSA 3TAMB 3BGOP 2XCPA 2FJVA 4J37A 4OHVA 1SV5A 3UE2A 4DN9A 1MU2B 2YNGB 3CDEA 2JLEA 2ZM6F 1EETA 2H5JB 1QM9A 3KHHA 4RBTA 3G8TA 2J9CA 4MYTA 4ZPCA 4F4WA 1DLOB 1CC8A 1YGYA 4ECUA 4NYOA 3SEOA 2O3DA 4AQYJ 3LP0A 2UU9J 4DR6F 4V1Ak 1EQ0A 5C24A 2MSTA 1G1XA 3T1HF 2PI5A 1U1LA 4LMZA 3D7SB 5M2UA 1B0PA 4F0KA 3H8YA 5I42B 4ETZA 4EYIB 4IH5A 4K4UA 1RAAB 1IVZA 2I5JA 3SFGA 1VHIA 9ATCB 2CJ9A 2H1YA 1BGXT 1WSRA 4C48A 1PBUA 2IC3A 4OZ3A 3IR5B 4DBQA 2FUG9 4P2FA 2R4FA 1UA1A 3S1TA 3ZTRA 4OHWA 3BYRA 1B7YB 4JI1F 1YIJS 1I94F 2C3PA 4RR5A 4IOAQ 4DX7A 2DR7A 1VQPS 4DF8A 2GA7A 4NE9C 1JMTA 2NR0A 2CDQA 3Q23A 3OXLA 4IG3A 4N8OA 1IQTA 5JUMA 4P6QA 4FN5A 2RHSB 4KFBB 3H90A 4CLLA 3RBDA 2MKIA 2ZM6J 2XSJB 1WC4A 1N52B 4N47A 2AYBA 4MFBA 3V6JA 1DTTB 2VBWA 5D8HB 3DLKB 4NA1A 2HHHF 3T1HJ 3OTOF 2PN6A 1IQZA 1X5OA 1J5EJ 2H5EA 3LPYA 3M8QB 3GQCA 1ZBTA 3UR3C 1KEKA 4WFAQ 1UW4A 5KFMA 3HZEA 2AYEA 4QCLA 3TX0A 1S6PA 2LXIA 3QIPA 1XC9A 4LFBF 3AJ1A 1RT2B 1SJRA 4RX6A 2KDOA 4P2XA 2AQ4A 4Q0BB 1Y9OA 2HGNA 1PJ7A 1R0AB 2H54B 1M1HA 1I94J 1AB8A 1UFWA 1J5OA 4NLGA 1UJ4A 4JUZA 3NS7B 2HMIB 4YN3B 2YKMA 2ZWOA 3R1LA 2FGOA 1CLFA 3NGRA 2DY1A 2ROPA 2K7KA 3OVAA 1VC5A 3VTIA 1EHWA 4GMKA 3TEGA 5HJXA 4CIOA 4OYWA 1SPBP 4DPOA 1NPKA 1V5VA 2HVIA 4OYXA 1ZAXA 3I4HX 2V94A 4DV3F 4DV5J 2J8SA 2OFGX 4Q43A 2KTQA 3JS9A 3OTOJ 4JYAF 4TXSA 3E3XA 1FERA 3IN5A 1IKWA 3JTNA 2VQEF 2XWYA 2V4JB 2A3JA 3K17A 4X4VA 3EGZA 3HKWA 5D6GA 3FRYA 2GHPA 1PO6A 1CVJA 4HVZA 3VAMA 3VAKA 4NLWA 3IRXA 4LFBJ 3ETOA 2XMWA 1VRUA 4NLUA 4F25A 3QRQA 2VPZB 2CPDA 1TUVA 4DQQA 4ZCKA 3VVTA 1GH8A 1GEHA 3OLBA 4TU9A 2DCLA 2IVMA 2PIIA 3EVMA 5L38A 3JTOA 2EWHA 3FK4A 1N5TA 1LWEA 1JNRB 2NXUA 3B82A 4DG1A 4H4KC 2VG6A 4WK1A 4NLXA 2QX0A 4U8VA 5KFFA 3TNVA 4OX9J 3QO9B 2OPSA 3EX7B 3MCNA 1GFWB 2PEBA 4UUXA 2IBKA 3EZOA 4CH0S 2UV8G 2BMBA 1KHWA 3FFIB 4KPYA 2L9DA 3C6TA 4JYAJ 1N5YA 1FVQA 5E3AA 2BANA 3TJAA 3MR5A 3Q86A 3ISNC 2VQEJ 1S48A 5DDQC 2HFSA 4XPCA 5KT3A 4DHVA 5HP1A 1WF2A 2XQCA 4BS2A 4RW7B 3J7A1 5F8NA 3FKBA 4DDFA 2IVFB 3Q0AA 3FMWA 5A76A 2GO8A 2QO3A 4O3PA 1URNA 4F4ZA 1LFWA 3CCTA 3CB4A 5F41A 3KWMA 2MY7A 1EP4A 4DV1J 1H3DA 4YB5A 2C3OA 5DQHA 1RAJA 3LP1B 2GGPA 1R6YA 3GFZA 3W5ZA 4DUYJ 4W92B 2R2RA 2X3DA 1N54B 2Z56B 2QE5A 1NKBA 2I2YA 1U09A 3R7NB 3TW0A 4CH7A 3HSJA 3DDNA 2CKWA 5HI7A 5HJYA 1WG4A 3I5CA 5A6PA 4OJHA 4A47A 3ULHA 3A12A 2VASA 1RT3B 2QFJA 4YS2A 1RHMB 2GC8A 1KKHA 1Q8LA 2V8PA 3HSDA 2IM0A 1CSJA 2MY8A 3MOJB 1Q8IA 3TUJC 3GE9A 1MN9A 1UEVA 2IPOB 2OMOA 3HPOA 2VG5A 1FRKA 3DRSA 3CO9A 2JC0A 3BGRA 1U2CA 4WU3A 1EIYB 4RUAA 1NK6A 4C0OC 2DRAA 5HQLA 3DLLQ 1IBLF 2BE2A 3DMJA 3FSIA 4QWAA 5CQGA 4RBUA 2AT1B 1OJ4A 1CJTB 4U9RA 2HBQB 4WXOA 2DGQA 4G65A 3HX9A 3D4JA 4QZVB 4LF5F 1N5SA 1YRUA 3MMBB 1IJEB 3QJPA 2VOOA 4ZP8A 2Y3YA 4O4GA 2AJ2A 1ZM4A 3UDCA 4K4WA 3EWGA 4PG5A 3M2RA 1OPZA 3QGGA 3B78A 3I5AA 3QJLA 3OD2A 4UZCA 5E41A 2OSQA 1F3VA 2DNZA 3P3DA 1NSAA 5FLXU 2DNLA 4YB1P 3MMCB 2QC3A 2W8LA 1L3UA 3IGVA 1V3RA 2R7RA 1S9EB 3QWPA 2XNQA 2DHXA 2O5DA 3H4BA 3KUHA 2ZDPA 4L73A 1Y10A 3W64A 5HLFA 3VAJA 4CLZA 4BCAA 2V2ZA 1TV6A 2ZC4A 4CNYA 1WHYA 3TAPA 3SMZA 4JP8A 3RRHA 4FF2A 3IC1A 2KHCA 4ECVA 4RO0A 4NYZA 4A8KA 1IBLJ 3WZ0A 3UR0A 6FD1A 2G2OA 1IBMF 3PJWA 3R5CA 3G8QA 4RW9B 3CCZA 1ACMB 3ZNUA 2ZNYA 4HACA 5GAEU 3GJTB 3FEZA 1KVKA 2W2OP 1PGZA 2LECA 2XBPA 1H72C 3RU0A 5IT4A 1OIAA 1PC5A 3PYGA 5IV4A 3ZZPA 4FPIA 1R0BG 5CCMA 1RTIB 5IT9Y 2CWXA 2XMAA 2VIHA 3AXMA 2C42A 1G4CA 1KLMB 3TUPA 1Q5VA 3NRBA 3E01B 5K20B 2KM8C 2GCFA 3BN7A 3TA2A 6FDRA 2HAIA 4CYUB 3BPDA 2MZQA 4QQBA 1SC3B 3PJXA 2V6AA 4HH1A 3KJQB 3Q8YA 3KJNB 1U0SA 2V34A 5HO4A 3QATA 2V8HA 3MHYA 4GRSA 4YB6A 3C6UB 2R7TA 5B0FA 1IBMJ 1NK0A 4Q7AA 5ETRA 4ILLA 2BQUA 1FE4A 4K5SA 1S1VA 5HATA 4WFZA 2HVZA 1Q7YT 5DGAA 3C15B 4ECXA 2DCUB 4B9VA 1U8WA 3T5HA 1N0UA 4YFUA 4KIAA 3H5XA 2O67A 4KTQA 3ET6A 3IA0A 4KYZA 3P5BP 4ZVFA 3M6WA 4JV1A 3HHLA 3CJKA 3OXGA 2W9BA 4G1QB 1C1CB 1MROB 1KQFB 5KFPA 5DETA 5CHCB 3DC2A 3ZNJ1 3V2UC 3NWGA 3KHGA 1RWKB 3M2UB 3ENWA 4UT4A 1N34F 2J5AA 2XZWA 1S72S 2NYHA 2DYAA 5AXNA 5D3GA 1RSCA 1BC6A 2VD3A 2ASJA 1UFLA 3QMQA 2J0XA 3NKYA 4A8MP 3HSZA 1ZA2B 4ECZA 1FRIA 3EDQB 3HHEA 3RW7A 4Y65A 1HMVB 5DG7A 3BBFA 5K14B 2DNNA 1HR0J 5THWA 5T7LB 2WONA 2FGCA 4B3TJ 4C3KA 3LUYA 1A0OB 3H98A 1LWFA 4FF3A 2UXBF 2ZH8A 4A8WA 3EGVA 1CJUB 3M05A 1AFIA 4FP9A 2UXDF 3FQKA 1S0NA 4OLOA 3VQTA 2MPUA 1SXLA 1H0HB 1KSPA 1U2RA 4JI7F 3QT8A 1F1BB 4PKDB 3C14A 5LM7E 1LWCB 2VFUA 2PDAA 1GQEA 2Y1LB 4ZVQB 1MLAA 3KLIB 3DKDA 1RKIA 3AD8C 3HKZD 4OZ2A 3CJQA 2JEGA 1P9QC 3MAHA 2HNDA 1REVB 1UP1A 4K0KJ 4LSNA 3DGVA 2JLGA 4DSLA 1WC5A 2R2TA 1QY7A 1VYAA 2VUGA 1UVLA 2YXLA 5DJBA 4R0EA 1HD0A 3Q83A 5L1KA 4KRWA 1TFYA 1DURA 2UXBJ 3UCUP 4WXWA 1RTHB 4JV2A 3FBEA 3TO8A 1GMVA 1RZMA 2ILZA 2Z58B 3BO4A 3W3SA 4OI1A 3NS5A 5JVHQ 2QL9B 3D0IE 1VQ7S 4KBIA 1CS4A 4OX8A 5I3UB 2WCXA 1UA0A 1P9YA 4U7CA 2RUGA 4GVBB 4ZVTB 1RBLA 2W01A 3G96A 3J81Y 4OYZA 4MJKA 2AEFA 1JXVA 5F9LA 4IH6A 4DFPA 3KLFB 2CZ9A 2GVZA 2H9ZA 3VAGA 3GIMA 4G6VB 4GKJF 1D1UA 1BQMA 3HHLD 5FJ4A 2HW3A 1TMMA 2GVDB 3H25A 1FDNA 5CYQB 2FLLA 2UUAJ 3FDSA 2I38A 3MM7A 1IR2A 4YY3J 1KFSA 2CIMA 2NS1B 4EBDA 2FVCA 3QWUA 1SC1B 2ILYA 3C16A 3BR9A 3K58A 2HWIA 3WHIA 2FJWA 5KFLA 3OR1A 3M8RA 2V68A 1ELOA 4ED0A 4RW4A 2E5LJ 2AKWB 1S4FA 4JI3F 5AXKA 1F9EB 1FK9B 1QD1A 1S1WB 2RDJA 1YJ7A 2CJQA 1GT8A 1XMOJ 4A46A 1SQEA 1ZOTA 1OO0B 2QN6B 2LYVA 2E44A 3IR7B 3QNWB 2E7WA 1RWVB 3ZTOA 3IAM9 2KRRA 2R7XA 4WF9Q 4FF4A 4ED5A 2A6MA 4PZVA 3ZC4A 5DQIA 3GR1A 4HEA9 3MFIA 1LK5A 3PRDA 2MZTA 4PWDB 1PIEA 1K0VA 5E2QA 1WHWA 2AD9A 1NK7A 4QOTA 3MM9A 4ANDA 1FWPA 1ULRA 1M5SA 5KG0A 3KUGA 3L09A 5CA5A 4WIQA 2VC0A 1ZZNA 1NJYA 1KOOA 5J2QB 2R8GA 1FRLA 2XO7A 1M5PC 2BRKA 3PYDA 2UXCF 2GX8A 3NL0A 3QPIA 4GC6A 1JXLA 2MGZB 3KG1A 2BDPA 3KK2B 1T9WA 3DRRB 3HVTB 3T6BA 3OL9A 2GJ2A 1NHKL 2QG9B 3TUIC 3NOGA 5U47A 3GMGA 3PCOB 3QLHB 1NLKL 4LBHA 2HIQA 2DO4A 2ZH7A 4IG0B 2KJVA 3NLCA 1UWBA 2D3O1 2XO6A 3IAS9 4WP3A 1TL1B 1NJWA 4OYAA 5KTQA 2OPPA 9RUBA 5C7PA 2RSQA 2B51A 3BR8A 2V4RA 3FBFA 5DLGA 1DTQA 1WD6A 2YKNA 1VBKA 3LP2A 3SIPB 1SV5B 1F3FA 2RS8A 2R9LA 1EETB 2F3JA 3AB2B 3UDEA 2XI3A 4CM2A 4J5OA 3LP0B 2BJ3A 2CQDA 3VV2B 2UXCJ 5KFGA 3SQGA 5C24B 1S97A 1SH2A 2JX2A 2V5HG 4W90B 2DRDA 3CJSA 1VBXA 3TZWA 2V63A 1FO1A 2I5JB 3FCWA 4FNHA 2GZOA 3ILOA 1K47A 4MKYA 3GYNA 2ACMA 4NXNJ 1WDTA 2IC3B 2W4DA 1SCJB 5GAEI 2UVRA 4LFCF 2AYMA 1XBWA 2W8KA 1UEUA 4DR4J 3PXGa 3SZ2A 3THPA 1RABB 1YJWS 2D3OR 3FBBA 2IM3A 4UOHA 1JWWA 4OYIA 1BWEA 3LALA 3VR1A 5CD4H 5AE1A 4IG3B 2VFSA 4R8UA 4PG4A 2CPIA 2QYGA 2RMLA 2ZHOA 3RAXA 2APOA 4X64J 5K8PA 1F2HA 1JKHA 1H2UX 4HT7A 3CCWA 4LSLA 2DNOA 2MJNA 3D1QA 5HSPA 2DIVA 3V6HA 4MFBB 4XAKA 3J80U 3K5MA 1U0HA 5C25A 5C5JA 2H48B 3SSSA 3ISZA 4CO3A 1U1KA 4K2XA 1N0VC 2P9GA 2VG7A 2MQMA 5LMNJ 2E1AA 3HMJG 1UVKA 3HFVA 1APSA 4TQRA 3WQPA 3OTEA 2X1GA 1RWUA 1GXTA 3PZPA 1S6PB 2EK1A 3ZZYA 3QIPB 4X4TA 1VQOS 4MH8A 1RTZA 1TUWA 2QT7A 3LA0A 4CNZA 4H4MB 1E6YA 1RYSA 1TL5A 2B0GA 2AHOB 4EFAC 5KFTA 1NH8A 3DM2A 4ZN1A 4I56A 1AW0A 1ZH5A 2YKMB 4C97A 3K8WA 5DQGA 3DLGA 2QLJB 2E5IA 1FJEB 5BYSA 2MKCA 5LOQA 3MF5A 4OYOA 2IJNA 2U2FA 3VGTA 3AXKA 3D28A 3KUEA 4LFAF 1DARA 4DCJB 3SV4A 4PYDA 3UPFA 3CD6S 4LF4F 2DNRA 1R8PA 1RISA 4CLWA 5HMYA 2GQQA 2MKHA 1NSQA 1Y3KA 3MUMP 4I6YA 4P9SA 4GO7X 3RAQA 1IKWB 1BMQB 3FNNA 2E7VA 1R8BA 3I87A 1LW2A 1TAUA 2NXNA 2IDEA 1K44A 3RYLA 5FLXY 2HFNA 1KHVA 1N88A 1NU4A 4WFNQ 3L95X 1JLAA 3IRXB 2DH7A 1VRUB 3CVKA 2GMHA 3U1MA 1ITPA 3D67A 3CCVS 3L7UA 1TTHB 5L9XA 2M52A 2Q3PA 4O4RA 2Q66A 2HRTA 1HHTP 4QPTA 4FYXB 3RB4A 4U95A 3BBCA 1URRA 5IS2A 2YQ0A 2VJVA 3RB0A 5HL7Q 2VF3A 2HLTA 1LWEB 3L7PA 2OUGA 4ZS6A 4DG1B 2VG6B 1X4CA 2W7AA 3D6HB 4LFAJ 3FSXA 1TAQA 2OPSB 3JSMA 3K59A 1AA1B 5F8LA 5HMXA 4LF4J 5KT4A 3RRGA 3C6TB 1N5YB 3M8WA 2BANB 3MUTP 3OTDA 5HP1B 1LW0A 3KMSA 1Q8KA 4U7UK 5MLCV 1WHXA 2WSCC 3TA0A 4E98A 4YEAA 2HNZA 3G82A 1HFEL 4NX9A 2VOPA 3QZ8A 1MMNA 1Q95G 2KB2A 3CPWR 2QGFB 4B9TA 3BN4A 4O44A 1EP4B 2IM2A 2FVSA 1S6QA 4OZNA 4ZCLA 4NLSA 3UI3A 1Y5LB 4PXCA 4YQWA 1FVSA 1SJFA 2ZH1A 1RK8A 2GGPB 1W2IA 3LTOA 4K2JA 2BR0A 3BH6B 5KFZA 3GJSB 3MR7A 1R0CB 4HYKA 2AEJA 1LK7A 3CCMS 2NUHA 3CJ5A 4DQSA 3ENQA 2CPEA 2NXEA 4DV6J 4KJIA 2JOQA 1ZM3A 2RJZA 3WX4A 4CO1A 4ZVSB 4DX5A 5BR8F 1Q82T 2XS7A 5B09A 3CC2S 1TP7A 2XCAA 2VG5B 4MT1A 1M0SA 2HWTA 1Z1ZA 3DRSB 4IRCA 3BGRB 2P8IA 2M8HA 1X5SA 3WIUA 3HHNB 5LXYA 3GB0A 1NDPA 3MM8A 3V4IA 3VAFA 1N5QA 2BE2B 4CLPA 3DMJB 3EGWB 2DVIA 5D0GA 1WEXA 5KFDA 3B8HA 2YY3A 2WVFA 3GPAA 5CCLA 1LKZA 3AT1B 3Q2TC 2EVZA 3EPIA 2KT5A 3Q8SB 1WF0A 2NSCA 1U1PA 1F60B 3HO1A 2ZH3A 3N5BA 4O4GB 3QFHA 2XY7A 4Y2CA 4JI5F 4IR1A 3WX8A 2KFYA 1RT4A 4DR2F 2CQ0A 2LQ5A 3M2RB 1VJWA 1UVMA 2BVZA 1RAFB 1XMQF 3KLEA 4EBCA 2YWKA 1HNVA 1W26A 3IS9A 3SV3A 4NASA 5BR8J 1XR6A 1KS2A 1HBOA 3H0PA 1KVIA 1TZ0A 3RR7A 1XWLA 3CSKA 1U45A 1VFJA 4E2FB 3DOLA 4X62F 4WWSA 1TV6B 1AXQA 4NMLA 4XPEA 3PW4A 1WC6A 2R8IA 4ELTA 1NSPA 1PSDA 4Y3CA 3DGPA 2ZZTA 3UW1A 1F5BA 2ZBQA 2HHVA 4NPOA 2AGPA 2N4CA 1L3VA 2W7PA 3UCZP 3DHWC 1SUQA 2CWKA 4ZVRB 4R0JA 5J1EA 1I1GA 3VWSA 3FEXB 1JK9B 4EZ6A 3GYXB 4HACB 1TK8A 1U1MA 4QIGA 1HI8A 3SBMA 4F04B 5G0RA 2UVUA 4QWBA 2Q43A 4JI5J 4DR2J 2EC0A 4LIWA 4EI2A 1U1RA 5GADU 1GX6A 5CYMA 4RNNA 3G6ES 4RNOA 1RWMB 5HANA 2DK2A 2QV6A 1X4FA 2FJEB 1YTYA 3W66A 4GO5X 2QLWA 4ED8A 2VA3A 1JLCA 2XMJA 1IM6A 3LGHA 4AE5A 1FNMA 2FVRA 2FC9A 4OI4A 3P96A 2WSEC 2FPHX 5SUHA 1VQLS 3CD0A 3DNCA 5C42A 2F4VJ 4Y00A 3GSIA 3X3UA 5D0EA 4FVCA 2YNIA 4NLRA 1N6QA 1VK8A 3U27A 2N7YA 1RYRA 1S1VB 4O3SA 3G87A 3HXMA 1JLBA 3KHLA 2FIUA 4DFMA 2VODA 4EZ9A 2XYGB 3LAKA 4ZPBA 2E29A 3ZXWA 2HHSA 2GS8A 3ET6B 4P71A 2BEFA 2HHWA 1VISA 4MKAA 1UVIA 2GV1A 1NPPA 3HHLB 3U1LA 3CJKB 2G0JA 4HDGA 3UN5A 4HKQA 3DLHA 2BOPA 2P2CB 2DIUA 2OPRA 3NCQA 2CZ4A 1RHRB 2GAGC 3MEGA 1UJ6A 2CQGA 1S99A 1S6OA 3H4DA 5JVGQ 3PYFA 3LO3A 1MW7A 1FWKA 1Q79A 3GSDA 3K89A 2YWGA 2GAHC 2QRRA 3M32A 1GAOA 4KKOA 2MQLA 2JSXA 1MNEA 1SVDA 5D3GB 1NMEB 2HGMA 1IUJA 3OFEA 2JC1A 3O2IA 4ID5A 2KI2A 5F3TA 2PMZD 1H7XA 5GMEA 3PW2A 1Q7LB 1K0TA 3QGHA 3ZO7A 1LWXA 5IC6B 1PG5B 3QAUA 2WONB 5DDRC 2VJUA 2KO1A 4Y28C 1NEEA 3HD1A 1LWFB 3OTBA 3BO2A 2LDYA 3N6LA 2JFDA 2LKZA 1U6BA 3BV8A 5K8NA 4Q5VA 3IM9A 4DV2J 1QTMA 4C0HA 1VQ6S 1UKUA 3VZHA 2Y9HA 4HI2A 1HQUA 4DL4A 4MKVA 4WYWA 4OZ5A 5LSRA 1LQ9A 3PY8A 1Y7PA 4NRTA 4FYVB 1JX4A 4C8NA 2OEMA 2DR9A 3JAMU 1YZ6A 1D8YA 2CVIA 1T9YA 3C14B 2JFKA 3DOMA 1TKXA 2W2QP 3AJ2A 3T5LA 1FX2A 3VHQA 3SSRA 3PEJA 1Y4ZB 2P6SA 5IZHA 1FRHA 2MQQA 2HNDB 4FYWB 2G9OA 1RAIB 5KFKA 1H74A 2LXUA 3NXZA 4LSNB 2WAQD 2ADCA 1S9GA 3DXSX 3KG0A 3R5AA 3C46A 3IFEA 4DR5F 5CABA 3I0SA 2QA1A 2V2QA 3A8IA 2RAQA 1VC6A 4M95A 2QEXS 2HFVA 5CD4A 2XLKA 3H2LA 2Z8QA 1Q16B 2CJBA 1AZSA 1WC3A 2KVQE 2MJUA 4UZBA 2VV5A 2DITA 2M7SA 1KDNA 5C2GA 5H9FK 1ZZFA 1CS4B 3H5YA 3IXQA 4F4KA 1U7LA 3J7Z5 5AE3A 2R8HA 5A2QU 2KJWA 1WC1A 2Z2YB 2DR6A 1XK8A 2SXLA 1FNOA 2GJIA 5T41A 5DDPC 2GVZB 3GCWP 2KZMA 2G0CA 3CE8A 3P45B 1BQMB 2CRLA 3I56S 2AW0A 4ZP6A 4ECSA 2BQRA 3LAMA 5IM0B 5DO2A 4B3MJ 1PJ6A 4XIUA 1IR1A 1VLYA 1DY3A 4I7FA 3MM7B 1N56A 2X1FA 4X66J 2AJ4A 1SI9A 3C16B 4N77A 1S12A 3OR1B 4NEZA 2MYFA 4PWUA 1DZ5A 1P27B 3MMAA 1QVGR 1X4AA 1S0MA 5BJRA 4OI0A 1SH3A 3NGTA 4RW4B 4AXIA 3W5YA 2YX4A 2E7XA 2IRYA 1NRKA 2FJBB 3J80Y 3W9HA 2HNYA 5AXLA 2M5YA 3GIRA 4OV6A 4X84A 1SC4B 1HD1A 4ECTA 1M5KC 1N32J 3K5OA 2DNPA 2MLYA 3EVWA 1UEKA 2MMYA 1TL7A 3OR2A 1YKWA 3N4WA 2KH9A 2OEKA 3IMQJ 1FXLA 4Z37A 3UNGC 4DL6A 1UFKA 2YNHA 3CWJA 3MM9B 3C66A 3PX4A 1JJ2R 4M5HA 1RAOA 2X1BA 1RWXB 4OFZA 3NMRA 2WW4A 5A6WA 2OTJS 2DRBA 3AOAA 4R25A 2ZJPQ 3LPEA 4ZPVR 4CT9A 2C2MB 4N5SA 3KNAA 1KQKA 3ILLA 2Q79A 2H5IB 3MDFA 3T6JA 2EI5A 2M9KA 1S6UA 3A3PB 5FD1A 3HSGA 4ITSA 1EX8A 3HHDA 4ER8A 3UN3A 2E9TA 3NGSA 2E5GA 1ZTWA 1HHQA 4CT8A 3TA1A 2HLUA 4H4KA 1NZ8A 3MEDA 2V0NA 2LVWA 4OYBA 2MKKA 1SKSA 1NK5A 1RTDA 3JXOA 3H40A 5J1NA 4CO4A 1JLGA 3H42A 4L74A 4OV1A 2OPQA 5LL6d 2HQGA 1UWBB 5E0OA 1NUEA 2FZCB 4IDKA 3T1AA 4FBUA 2DNYA 2OPPB 3BPSP 1ZPVA 5B0BA 3C2PA 2M88A 1DTQB 3SFUA 1O8BA 3ZZZA 3GZ7A 2YKNB 1JQGA 3LP2B 1X9WA 3BDEA 3A3NB 3TARA 5HN0A 2G1HA 2CAJA 3W63A 2RDDA 1U48A 2AWZA 4C7QA 1JB0C 5DZ7A 3VGSA 1FD2A 2ZOGA 3GTYX 2XGQA 4LQ9A 4HDHA 5KFCA 3SQGB 5CYJA 3OL8A 4B3SF 3H2UB 2UUCJ 3EJMA 5KFHA 4A8OA 2XS2A 2XC9A 2PA3A 1VS3A 3M6UA 2DNHA 2FVQA 3OVBA 1B99A 2DNQA 1N5VA 4NLPA 2FDNA 4NLDA 1OSCA 5KFWA 1NB7A 2JH3A 4KHPF 1Q5YA 2BXJA 5J2NA 5ETPA 2X7IA 4LF8F 4O0NA 1HWKA 2JJ4D 4C4WA 5KG7A 2VKZG 3SCLE 2HVDA 3QSIA 4WPAA 5A8KA 4UOCA 5F8GA 1BHNA 2GMLA 2GHWA 3SCJE 3THVA 4J9VA 1SL1A 4R8UB 2VC1A 3A8KA 5GADI 2PGCA 3PJ9A 4KAIA 4Q2LA 3BS9A 3B4MA 2R7VA 1JKHB 4ED6A 4LSLB 4EBEA 5A8RA 3CCES 3E2EA 1U0HB 5C25B 1KLNA 2NPIA 4FKXA 3DN9A 2Y1IA 1JJHA 4KSEB 4YMEA 4W4MA 5ETTA 2XY5A 4X4PA 4X4NA 4B3SJ 2VG7B 3GIJA 4PCQA 2K3IA 2OEJA 3DLEA 4QW8A 1VRTA 2XHWA 2D41A 4AQYF 3POTA 3HULA 2UU9F 1MMDA 1KP6A 2ZD1A 3FBCA 2L9NA 5H9EK 4HT5A 1N33J 1Q81T 1ZAVA 1E6YB 1U47A 4YP3A 1GTEA 2Q6CA 2RF2A 4BWMA 2QSWA 4UQGA 1AUSL 3I5BA 3DM2B 3DLKA 4V19J 4USIA 5IFMA 1EZZB 1NAQA 1FEHA 2FTRA 2ZH9A 1ZM2A 2AX1A 3RR8A 1YDLA 3AD9C 3DLGB 2B8QA 2P9CA 4ZVOB 1S7HA 2ZH4A 5KFXA 2A2DA 1SIZA 3EYZA 2F9DA 5K5MA 2RNEA 4QYZJ 3HVRA 4RNFA 4WBFA 1WTBA 2DB1A 1RGVA 3W65A 4DV0F 5HMZA 2HHTA 2WVCA 1IXKA 5GAGU 2XNRA 2R8JA 1L3KA 4H4OA 4CLKA 4NZ6A 3SSQA 2XLIA 3J81U 1W2BR 4M5MA 3CMQA 2V8VA 4ES1A 1KC8T 2EPIA 1LW2B 1LV5A 1V9OA 4M5NA 4MMOA 4KGVB 2WBRA 2PT0A 4LF9F 3BDPA 1JLAB 2NZCA 2DH9A 2VPWB 1UTAA 2J7KA 4IFVA 4L3KA 2VFTA 5B0CA 1J5EF 1QLNA 4WFXA 4TQSA 2YQ1A 4JI0J 2DXDA 7FD1A 4OIXA 1CC7A 4U67Q 3DU6A 2HAFA 1MN7A 4DS5A 1GX5A 1X31C 3RUBL 1WKKA 1FJ7A 4X65J 3MGJA 1O5JA 2NYIA 4X4RA 4F0MA 1RBOB 3BSNA 2J9DE 4YR0A 3K57A 2QLFB 1RAEB 3JSMB 4RLEA 3HI9A 1WTFA 2B4VA 4J9NA 4GKKF 3V6DA 4I1TA 4KH1B 1T9XA 1U8SA 2KFNA 4DV0J 4HLBA 1X8DA 2EW9A 2C2EA 2E9RX 1FE0A 4CP5A 1ZETA 4BBYA 1LW0B 4DV5F 4J9QA 4QIVA 5KG1A 4ECYA 4LF9J 2HNZB 3G82B 1S49A 1TMJA 4X4SA 3TUZC 4N41A 1QUVA 1YBUA 1ZTTA 1NPRA 4O44B 2MB0B 3R27A 1O6XA 1S6QB 3D68A 2IMOA 3M9OB 1D3WA 4C11A 5M2RA 4K4XA 5EGYA 5DM7Q 4CTAA 4OJ1A 2GIFA 2B8PA 3I0RA 4ETXA 4X4OA 1VHFA 3G4SS 4KC5A 4QWCA 4F36A 2F8EX 4F8RA 1VQMS 3TYTA 4KHRA 4K4VA 4ZIWA 2IAJA 2HHUA 3ETMA 2K06A 3ILJA 1S1UA 4NA3A 2XS5A 1K1SA 4IUFA 4J9RA 4DR7J 1WDDA 4ZCMA 4GKKJ 1C4AA 4HTIA 4Z7YA 2D9PA 4TLQA 3PG9A 1D9DA 2CVEA 4KGZB 1VJQA 1UJ5A 1K1QA 1X60A 1KQGB 2AZ1A 2DGOA 4OX9F 4Y2AA 4I68A 4ICLA 3Q24A 1VR6A 1TELA 1YBAA 3PEHA 5FDLA 2HBZB 4I4BA 4OX6A 5F8MA 2ROGA 4ZN3A 2OSRA 3MM8B 1T05A 2HPUA 5B0DA 5L1JA 2C22A 4PEOA 1MWQA 1HLWA 4DZ6A 3W2VA 1FKAF 1VK3A 2RE1A 4RWWA 4DUTA 1N4LA 3CJ2A 4B17A 1R8AA 1FJGF 1JJ4A 4LQ3A 1NDLA 1C0UA 1RT7A 4DV1F 1HYSA 4TY8A 2YX1A 7AT1B 1RT4B 2EKYA 5L1LA 5SZTA 3RJMB 1D9FA 4DUYF 4M5JA 3PYEA 4AT1B 4U8YA 1QTNB 1RTJA 3KLEB 2DR5A 2R7WA 1HNVB 3O3LA 1WJ9A 1YQHA 2BM1A 3IS9B 4YR3A 1FHTA 1R31A 1HBOB 3KYLA 4JBCA 3U1NA 5DG9A 2EBGA 1IBKF 5L8RC 3DOLB 1I6JA 4XDCA 2DNKA 1HWJA 3AA8A 2CFXA 3I82A 3MZIA 1TKTA 2DHAA 1RT5A 2A2CA 3DGPB 2OHDA 4ZJLA 2RT3A 3C8YA 2OD6A 1T3OA 1M90T 1NB2A 2GQCA 2XSFA 2ZJQQ 1KRPA 5F3ZA 1QSYA 2HGLA 1UAWA 3CT9A 3JAMY 2HRUA 3KMQA 2BJ9A 5KFUA 2OTLS 1SUQB 3V81A 5J1EB 3UD5A 5E3QA 4ZVPB 4LREA 2DHGA 3VAHA 1KTVA 2PEHA 1FJGJ 3O1LA 4ES2A 5L1IA 1QSSA 5G0RB 2G2YA 3MEEA 2BBEA 1TUGB 3IRWP 2UUBJ 4ZMMA 1H73A 4ZLNA 5CYMB 4DLEA 2DPIA 2D7SA 4QPXA 3IWLA 3T5JA 2W4PA 4J9SA 4DL7A 4FKYA 2Q1LA 3OHAA 2LMIA 1LEOA 2RRAA 2HHPA 1IBKJ 4NI2A 1HKAA 1JLCB 5K8MA 4XK8C 1WEYA 5EX3A 1RLDA 4L6V3 3GJRB 1R43A 5DRKA 3T5KA 4ZPAA 4ECWA 4UOFA 2ASDA 4CQ1A 4RUCA 1BE4A 5D4OA 5C42B 4UF4A 3MMJA 2B6AA 1RWWB 2YNIB 1R7IA 5A2QY 3JSYA 3HP6A 3BJYA 1HPZA 1N6QB 1BQXA 1UL3A 4TLRA 1RT1A 5HVFA 1VGYA 2CJXB 1SL0A 3W1YC 3IR6B 1P1TA 2HURA 1JLBB 4KGKA 3JQKA 1JNZB 1LNQA 3HD2A 3KDNA 2XG8A 2P5VA 3GLJA 4CYUA 2KN4A 1R6VA 3RRKA 3HJFA 1AUDA 1S77D 4QIFA 2J76E 4CH1A 1KN6A 1G2EA 1HBNA 2JWNA 3MEGB 3OJSA 1QUPA 2FD2A 1JJCB 1VI7A 3CD5A 2AJFE 2P6TA 2RB7A 4U96A 4WP9A 2B9WA 1E6VA 5E7OB 2E1CA 1QAJA 3M32B 4KKOB 1CEZA 4DMZA 4ZP9A 1CULA 3TX8A 4N7TA 3BM7A 4L3NA 3AH6A 4ID5B 4JOUA 4NMXA 3OVSA 4KT0C 5I3QA 4JV5J 4DR1F 4RKUC 1P8GA 3RAMA 4WTOB 1GXLA 3BQ2A 4ECRA 1HNWF 2YKQA 1R27B 4C0BA 1LOUA 5ETNA 3G86A 1T7PA 2ASLA 2DGVA 2UV8A 1RHQB 5L9NA 3R6GB 2LQJA 2LLZA 2DISA 1H98A 4B9SA 1Q1KA 2GW8A 1P1LA 1Z2LA 2CQPA 4P7TA 2YX7A 3PO4A 2QL5B 1HQUB 4CLYA 3NNHA 3TRGA 5HROA 1VIXA 4ZDNA 5AE2A 2XMUA 4OHZA 4RW6A 2YWHA 1OWXA 1NSKL 4JB8B 3JTPA 3DOMB 4BHQA 1TKXB 2FHKA 2W9AA 2BACA 4HHJA 2M2BA 2OLWA 2OP5A 2GQ2A 3D1OA 2CZVC 3KK3B 3QT6A 1VQYA 1IWAA 1WSVA 3M8PA 2L3MA 1PKUA 4X4QA 1WF1A 2VL1A 4F2RA 4F3QA 1IKVA 4DR1J 4AD6A 3R2CJ 1XR5A 3NWRA 4I6AA 2IA6A 1MWYA 3GU0A 4J7CA 1HNZF 2IMWP 1HNWJ 2ZNZA 1S76D 2C2KB 1S9GB 3PR5B 2DGSA 3KLGA 3A3OB 2U1AA 3BSAA 2MZJA 5H9FJ 3H5SA 3H59A 5GAGI 3OTCA 3B54A 2RQ4A 4JI8J 2A0FB 1HR0F 1HL6A 1AZSB 4P7VA 3UQSA 3EVOA 4M5DA 3W9JA 5GMKa 1YJUA 3VF0B 5LSLA 4B3TF 2ZITA 1MSWD 5I4MA 1BWVA 2ERRA 1FTCA 1XNQF 2ABYA 4LRCA 2UUWA 1EKRA 3MCOA 4IR9A 3DI6A 2ZBRA 3T9NA 3KOAA 1YHQS 3WIVA 1RP5A 3V5RA 2BE9B 2A6OA 1WG1A 4B3RJ 1DBDA 4MYUA 1QJHA 2K2PA 3W60A 2AV5A 3CEDA 5KFRA 2JNJA 2QYCA 4NXMF 4I7FB 2WOMA 2HS4A 3CCSS 1HNZJ 5ETVA 1UZHA 4J9OA 5LMUF 2HBYB 1B7FA 1JLEA 4K0KF 3MMAB 2DKOB 1XNRF 4PXBA 1T9UA 1Y11A 1KBRA 1NJIT 4PQUA 2Y8WA 5EX0A 2QA4G 1YJNS 2ZOFA 3KFWX 5ETKA 2CPZA 2DY9A 4IO1A 3GIIA 4GVLA 5AXMA 2FYXA 2CQHA 1KONA 4OQJA 1OS5A 4CLUA 1XNQJ 1FRMA 3ELHA 4HL9A 4K4SA 3QQCD 3HF5A 3PNIA 2HNYB 4CWBA 4LF7F 1NBEB 2OKQA 3MAAA 3NG8A 3SDEA 5C2CA 5LXRA 1NZAA 4UOGA 1W25A 2G0IA 5HAOA 4JI2J 1S57A 1TL7B 3OR2B 3TQ1A 5E3PA 2IA0A 2HZCA 4KGXB 4KGMA 2HFOA 3UO0A 4N8NA 1GTHA 5HVGA 1SKUB 1GK8A 4B9LA 4O3NA 4EEYA 2HZVA 2XB2D 3JSRA 1SIWB 5LSOA 2BQ3A 2AJ0A 2CJAA 2C3UA 2B7BB 4OMFG 4NXMJ 1R3NA 2XHCA 1IN0A 2DNMA 4DV7F 1CPZA 4ALZA 2XGPA 2C28A 4TKTA 1V3ZA 2PMHA 1F5CA 3ZZ0A 5LMUJ 2QJ3A 1NKCA 2IVYA 4C8KA 3RZAA 3NGUA 4IQXA 2UUAF 2D9OA 1CG2A 2EK6A 1XNRJ 2B5JA 4YY3F 3CMAS 5CZXA 4RNMA 3G2XA 1SL2A 3BEGB 2MQ8A 2R42A 4MK7A 4G1PA 5FIIA 4CO0A 2WVDA 2F5GA 3TI0A 1NCLA 3RB6A 3EXCX 2JLFA 1KVJA 2CA9A 1XMBA 4J9UE 3MEDB 1WOOA 3MM5A 4LF7J 2W4CA 2E9ZA 4RPFA 1RTDB 5KG5A 2XYPB 1YJVA 2E5LF 2JVRA 1JLGB 1RACB 5KFOA 4OX7A 5D0RA 5B0AA 4EGLA 3LGNA 2OPQB 4LRBA 1XMOF 2KZZA 1FWLA 4PG7A 2IIHA 2Z2MA 5EHHA 4K59A 4IDKB 1DQ9A 5A8WA 2ZKTA 2MSSA 4C9DA 2M4MA 5B0GA 2A1BA 1HNIA 4LR9A 4PYAA 3OLAA 2EKNA 4DV7J 3OW2R 1XTZA 3OFGA 4F4YA 4I2QA 4FDFA 4WKRA 3JYTA 5KFQA 3KLVA 1FI4A 3N5FA 2O1PA 3I55S 1HNXF 2CG8A 3MCSA 4IG0A 2B56A 4ANCA 3DRPA 4F50A 2CYYA 2RU9A 2QIFA 1S5ZA 2UVVA 2QSFA 2DHSA 1M5HA 4NCBA 1IKXA 1T9TA 4NA2A 4USVA 1RHKB 4NYPA 3PKYA 3AQOA 4ZJOA 2CQBA 5KG6A 2VICA 3AQPA 3R5DA 5J2NB 2G1DA 5D77A 3ZZTA 3FCHA 4B02A 4ZOSA 3UD3P 2ZE2A 4ENOA 5M2PA 5A8KB 2F7VA 1Q4RA 1OYEA 4ZHRA 3W8GA 4F02A 2I1RA 1PJ5A 1H2VZ 1Q78A 4RNHA 1YX2A 2VPXB 3PX6A 1YJ9S 3MPWA 5A8RB 8AT1B 3N79A 1SJ4P 1CQNA 2DEIA 2Y0BB 4OI3A 4ZK7M 4K4YA 3MWBA 4QWEA 2QL7B 1T03A 4U7UD 2FB0A 4L76A 1HNXJ 2Y0SD 1OQ6A 1BQNA 4M1KA 2HRYA 4KV8A 4DS4A 1FFSB 2CNKB 1WACA 5H9EJ 5GAHU 3DLEB 3IBWA 1TQLA 1VRTB 1X9SA 2EC2A 4QW9A 3POTB 1FX4A 2JDJA 1NK4A 2ZD1B 2EG1A 2DGTA 3QSYB 4F26A 4LR8A 1XQIA 1RT6A 2RF2B 4MK9A 3VCDA 1FKPA 2M3DA 4R5PA 3GCXP 1U6FA 2J8AA 4DF4A 4DR6J 2HQDA 4NXNF 3TZYA 2D3UA 2J6UA 4DR4F 4CM0A 3BGUA 2NPFA 5KOWA 2ZH6A 1A7GE 4DPYA 2H51B 4XTTA 2CQ3A 3L7OA 1WOPA 1Q86T 2A18A 3IWNC 5KFSA 1N48A 2IBOA 1WKLA 3ZFVA 4X64F 2BKOA 1V6HA 2B9YA 2HFUA 2YQ3A 2UP1A 1IWGA 2LXFA 4H4MA 2RH3A 1V5IB 4DSJA 3CMES 4H4OB 4JI1J 4UY85 1FKOA 1XIQA 4ILRA 4M5IA 3UDVA 2OD4A 2IHR1 2QLBB 3MR2A 4C8ZA 3K0JA 1SB6A 4FVMA 5LMNF 3M6VA 2GFFA 4IFVB 3M8YA 1JLQA 1X4BA 4PG8A 2KM8B 3AB4B 1RADB 3HFKA 1U2FA 1QE1A 1ZAWA 1D0EA 1Q0NA 5CZVA 3T1YF 1ZYQA 1SKRA 5IT0A 2HS3A 3N28A 4CI0B 3BREA 5K8OA 3ICLA 2HHHJ 2AP6A 1M5OC 3DRXA 3I9ZA 2C2ZB 4WU2A 3D54A 3N6NA 2XMMA 5RUBA 3GILA 5CH7B 4FNIA 4P2MA 1S59A 5B0EA 4Y0FA 2ZOMA 4UUWA 1KNZA 1BUXA 1SQGA 3V6DB 2UVWA 2GIQA 2ZH2A 3S8SA 4ZIVA 1RKJA 1YRTA 1F5AA 4DWIA 1PYTA 2V9KA 2EFOA 4J91A 1NKEA 1C4CA 2VU5A 1RHJB 4K4TA 4AL7A 4DLGA 2RQCA 2KT2A 4WZQA 5KG2A 1YVFA 2R7QA 4DU7A 1AROP 4PAAA 4OI6A 3KHRA 2C3MA 4Q2MA 4USKA 4C11B 3QRPA 4NCGA 4DV3J 4QBUA 2BOAA 3T1YJ 4URQU 3EMTA 4D3HA 4CTAB 5B08A 3I0RB 7FDRA 4B9NA 2UUTA 4UW2A 2RKIA 2ALZA 4OHXA 4ZITA 2QMXA 1TK5A 3T41A 4I0WA 4OLPA 1J5OB 5DGBA 4ZVEA 2IAJB 1Q8BA 1S1UB 3JQMA 4DN0A 1VBZA 2ZZNA 2C2NA 3OT9A 4Q8FA 3PR4A 3PHEA 2YBVA 3CIZA 4LIRA 3CUNA 2VPYB 4PUOA 1GXUA 4A4JA 2XTJP 2ZEJA 4ZVHA 2NSBA 2QLXA 3PIPQ 1F2GA 2QMWA 4DFJA 1FXRA 1B64A 3CC4S 5E3RA 5EN1A 2ZC3A 4ATNA 3KK1A 2MQNA 5IXUA 2V2KA 4ICLB 5FDLB 2IJFA 2E1PA 3CIMA 3KG4A 3AODA 3PIOQ 3HZGA 4CCHA 4PPZA 2GMJA 2YNFA 1DJ0A 1T05B 1T95A 1UWAA 2RUSA 1WI6A 2BW7A 2DO0A 3T19A 2CPYA 4WP8A 3KJVA 3MUVP 3WBZA 3EZ5A 3R5BA 2I9SA 1F0XA 3W2VB 1RI7A 2HIYA 3AD7C 1UZDA 4I6WA 2CJYB 3OBIA 1FXDA 3OHBA 3PFOA 4CZCA 2NCKL 5J2MA 2XULA 3UD4P 5HK4A 1C0UB 1RT7B 3N01A 4OZLA 2R7SA 1HYSB 2KYZA 4TY8B 3LF0A 1FFGB 4G3IA 2YH0A 5IQ6A 1T9VA 1B0TA 4J90A 3THTA 4J9MA 3Q22A 1JXEA 1RTJB 2DD8S 1SJ3P 1C1BA 2YWWA 2GHVC 2RDIA 3DU5A 3MPDA 3RGIA 2HBRB 4QR1A 1L3SA 1PAUB 2PI4A 5A0YA 3TR5A 3HVAA 3N6MA 2YPZA 2W7OA 4QR2A 4DV6F 2RQKA 2WW8A 1S1TA 3IM8A 4WJBA 3KXDA 4MTPA 1TKTB 3GJQB 3OJUA 3OL7A 1RT5B 4IQMA 2VBZA 1S1XA 2M8DB 4DU8A 2EEYA 2IJRA 2Z2LA 4UTGA 1FFWB 5IWAF 4IRKA 3PTWA 2AX0A 2BX6A 1DAXA 1W7WA 3US5A 3V81B 4L72B 2F40A 2HZAA 2VB6A 3PV8A 3EDRB 5HBMA 2DEJA 1KD1T 3AHPA 2MLXA 3MM6A 3R7SB 3ZZRA 4ZKAA 3SYZA 1UCNA 1K8AT 3C19A 3MEEB 2LP4A 2M0GB 4RJVA 2PC6A 1NDKA 2R2SA 1FJCA 4YDDB 4DI6A 3MFHA 1G7CB 2E1MC 2VZ9A 4RWXA 1U49A 3J7YU 2IM1A 2IRUA 3R9LA 2PSZA 3U02A 1FRXA 3RTVA 1R8HA 4NI2B 3HFZB 3BSOA 3BKTA 1FCAA 1YI2S 4LF5J 1IBCB 3RBEA 3GV7B 6AT1B 1FRJA 1VLOA 4DXLA 4CO2A 5GVQA 4LSZB 3TVYA 3VVUA 5IWAJ 5T14A 1HIYA 2B6AB 4AYBD 3LWMA 2J6TA 1R8CA 1HPZB 3CD7A 1Q53A 1RT1B 2I0XA 4Y34A 4B3OA 4ZPDA 5EUHA 5JXSA 2NLWA 2EFGA 3PW5A 1FESA 1U25A 5KG4A 3BZQA 5F8JA 5KT5A 2BW2A 4PPDA 3T3FA 1MG7A 4WZMA 2FLNA 4BDPA 4DOZA 4ZCIA 3L3CA 3LOUA 1OMSA 3QRRA 2ASYA 3HT0A 3V4MA 5KG3A 1HBNB 4I67A 3GONA 4FPRA 2C2DA 1TU0B 1PBAA 2CNNB 1KFDA 3NCRA 4Y6IA 2F4FA 4ED4A 4ILMA 1A6LA 4P10A 1E6VB 4F67A 3FRZA 3O6QA 3G6YA 1I3OB 3CJ4A 2XM3A 1CULB 2F8HA 1XERA 3HCXA 2J6SA 5HLFB 2QA4S 5LT5A 2LQ9A 1C0TA 2GNKA 1FNXH 1Y0HA 2I6WA 2M70A 3N9UC 3DOKA 3HLUA 1IKYA 5EDWA 2F4VF 1RWPB 4DL0C 4IH7A 2C3YA 4U6PA 5ADZA 2CPXA 4LF6F 2Z0GA 1B0VA 3NY0A 4NRUA 2FLPA 4DCPB 1FTRA 5GAHI 2H4WB 2Y1RI 4I2PA 3M8SA 1Y5NB 3D1HA 3R8YA 3AOBA 1QDUB 1WELA 2RU3A 5HROB 1RUSA 1MWZA 3RBXA 1U4BA 4JI6F 3R6LB 3MECA 1SH0A 3UCGA 1Y3JA 3K7RA 4RW6B 4DSEA 5EWEA 2ZKUA 3NNCA 1HQ2A 1NNDA 4DCOB 2V67A 3CULA 2LEBA 2HWHA 2I8EA 1NJZA 2DGUA 5ETMA 2B9XA 2W24A 3GV8B 3LANA 2HSEB 1U24A 2VONA 3BYPA 3M8PB 1OQ3A 4HHHA 1IR0A 4BWJA 4ED7A 3D3BJ 2CXEA 1TKZA 4DQPA 3TP2A 1IKVB 1RQ0A 3NGKA 1UW9A 1X9MA 3CJTA 3KLHA 2BRLA 3KLGB 4NL5A 3FQLA 3F0NA 2MTLA 2VKRA 2CPJA 4ELVA 1NK9A 3M30A 2BKPA 2YH1A 4LF6J 2ZHBA 4F3MA 1PYOB 4B08A 5KFJA 1N34J 3TZXA 2BM0A 2MDAA 4LRFA 4M5DB 2K1RA 3A1YG 3PHTA 4JI6J 2LFVA 3NAIA 4PWWA 4DV2F 3PKMA 2DH8A 3D9BA 4AL6A 2W9BB 2W2NP 1TVRA 3K2YA 5F8HA 3DI6B 2DNGA 2KRBA 2JL9A 2VDHA 3I9V9 2QA2A 3I31A 1B3TA 5CXTA 4TU8A 4DSKA 4WFBQ 1HHSA 1VCTA 4EK2A 4BC7A 2WOMB 4A8FA 4ED1A 1RAHB 2UXDJ 4DZDA 5LJ5Y 5J2PA 1N36F 8RUCA 1ZS6A 3HK2A 4J9PA 2BZ2A 1QAIA 4EYHB 2N3LA 1U26A 3MOZA 3ITHA 1HBUA 3QBCA 3PO5A 1JLEB 2GJFA 3BGFA 4JI7J 2WB4A 1YJTA 3OUYA 4USMA 4CLTA 4O3RA 4PQUB 3CNQP 1X4GA 3EZUA 3M9MB 3FGVA 2H4YB 2ZUGA 3KNGA 3I6PA 5IM0A 5ETOA 3M8ZA 3D0HE 5D4PA 3KDOA 1RA6A 4B9MA 2BYCA 4DUZF 3CCRS 3MAAB 3IP0A 2ZVIA 3M6XA 4FS2A 5ETLA 3SDEB 3UNYA 4TN2A 2RD5C 3LH2S 4WFYA 1OPIA 5JMNA 2DXFA 2WK4A 1VQ8S 4KHMA 2R2UA 2FZGB 2CPHA 3QT5A 3ZTQA 2AF6A 2AZ3A 2EFNA 3OSNA 1CJVA 1HW9A 1WUUA 1YZ7A 4KO0A 4OZJA 1SKWA 2CDRB 4BLGA 5B7WA 4JV0A 3MPVA 2C2RA 2CG4A 4I64A 2YVSA 3W7BA 3FEYB 1N36J 3WC2A 3EE3A 2LU2A 1HARA 3NBPA 4PXDA 4ZPTR 4ES3A 2RVJA 4B3MF 4DL5A 1VQNS 2YKPA 3FZBA 2J9EA 1FF2A 4MAKA 3EXYA 2B5JB 3CO0P 3Q8RB 2B4PA 1X0FA 4X66F 2MKYA 4YHHF 1S7IA 4MIWA 3OXFA 1Y00A 2JEJA 2JZ5A 4GKJJ 4QR0A 3QZ7A 1DFDA 3QT7A 4LRAA 4F2SA 3L4BC 3CDWA 4YB7A 1T0TV 2CJKA 3MM5B 4DUZJ 1OY6A 2MLZA 1YBTA 3CGIA 2AGQA 2W9CA 3L9ZA 2ZUAA 1NK8A 2O66A 3M2VA 1TFWA 1RXOB 2MKSA 2PMWA 2YPYA 4G1IA 4NZ0A 4M5LA 3O5TB 2JEIA 4P2SA 4IRDA 2F65A 5DZ6A 5A8WB 1WI8A 1N32F 3MCMA 2ALYB 2J7WA 1HNIB 1RAGB 1SJ1A 1WEZA 2L9WA 3WDOA 1X0PA 1LXJA 4JI3J 2ZWPA 1HBMA 1SJQA 2L41A 1RCXB 4UY8T 4I2QB 5BYQA 3K5NA 3DDIA 2VBYA 1FA0A 3J7AN 3JYTB 3CCJS 3MTJA 2HG4A 1CJKA 3IO1A 4YHHJ 2VFRA 4KB7A 4PG6A 3DRPB 4X2BA 1NHUA 1UVJA 1RWOB 3LW5C 2J0WA 1HQEA 2Q6BA 4S0MA 3LQVA 3TVZA 1IKXB 2QTWA 1RWNB 2WTFA 1S0OA 3PFEA 3EUNA 3UVJA 3PDNA 1OSDA 4RW8A 3PW7A 2D3ZA 2W2MP 4WYLA 3GP9A 4AL5A 2ZE2B 2VA2A 5D4NA 1ROFA 3BKUA 1Z2ZA 2PA8D 4ZHRB 3M1VA 3HVWA 3QGPA 1X5PA 2OFHX 3O44A 1EAYC 3VGVA 4ZVUB 2ZH5A 4DJBA 3BB5A 2D74B 1EQMA 2E1RA 3J7YI 4C8OA 1N8RT 2POKA 3NS6A 5HQMA 3BQ1A 2Z4PA 1HW8A 1RDRA 3GG1A 1T03B 2DHHA 3KTQA 3EPGA 1BQNB 1TL3A 4KV8B 2WRMA 2G2ZA 2HFZA 2C1EB 2HEKA 3SQOP 1HI0P 3DLJA 4DX8H 4USHA 2CQIA 4DV4F 1JLFA 1RJJA 1B4SA 4WE1A 2KT3A 2KU7A 2BUNA 5I3PA 2KFZA 3X1LB 2EXUA 4ERDA 2UUCF 5E33A 4W98A 4TVAB 1M1KT 4IFYA 3DHXA 3DLBA 1BD6A 3M9NB 4EUVA 3GWCA 3HHLC 2OI2A 4P73A 4RZRA 2IY5B 3GR0A 1RT6B 5J1PA 5F9NA 4TU7A 2CPFA 1FKPB 4Q8EA 2HKEA 4R5PB 4OI2A 4K5RA 3S6EA 3RBZA 4EWTA 1VRQC 2VFVA 2F63A 1IM4A 3N0VA 3IG1A 4A8XA 3QFWA 4NWBA 2KKHA 3FCVA 2Z2ZA 4KR0B 3AAWB 2ZVSA 3E8OA 1NDCA 4ZLPA 1YWXA 3DYAA 2MXYA 3JB9k 2NXJA 5MAOA 3F56A 3O8WA 4MIAA 3GYGA 4LFCJ 2WHOA 3BKFA 2D69A 3AFGA 4L75A 2XI2A 2AYGA 3W2WA 4DQIA 2XMVA 1FKOB 3AY0A 4OL8A 4DV4J 4Z2XA 3H2VE 4ZLJA 5IV3A 1RE1B 3BSCA 1U02A 2EBEA 3K5PA 4USTA 3MAQA 3NNAA 1WORA 5KFBA 1JLQB 2FC8A 1T94A 3TANA 2LEAA 4WIIA 5AJ3F 5ETSA 1SBRA 4OZ1A 1QE1B 4CO5A 3TAMA 2BABA 4F7VA 2MZ1A 4LBIA 2KL8A 5BYRA 4ID8A 4MKBA 2YKOA 1SQFA 1MU2A 4NLVA 1N33F 2YNGA 4F0HA 2ZDOA 4C8YA 4O3OA 2V50A 2N3OA 4QYZK 2UZAA 2AJ1A 1DLOA 2FY1A 3TAQA 2RHQB 2Y8YA 1WNEA 3RG6A 2XMTA 2K7JA 4Y2IA 1IJFB 2FHOB 3SCIE 3QJJA 1I51B 3DXBA 3BF4A 2CQ1A 5I42A 2B4UA 5KOXA 3RB3A 2E5HA 4KH0B 4XDDA 1HA1A 5DS7A 2B4OA 1XR7A 3UN2A 1FD8A 2CQCA 2G13A 3BGLA 3P6YC 4C3LA 2PFDA 5EWGA 4PRFA 2MHNA 3U7JA 3A13A 3F41A 3P4UB 2KG0A 1SC6A 3FSYA 5AJ3J 2V69A 3PX0A 4NCGB 2G4BA 2B7CB 3M4XA 4LT6A 4PQAA 4DX6A 4DQRA 2BKNA 5D0HA 4JI0F 2X51A 2HVEA 4KFBA 2OIHA 4FF1A 2RKIB 2XSJA 1QSLA 4Z7CA 1VDHA 4H54A 3PVXA 2LEPA 4FBTA 2AJQA 2B43A 2O01C 1DTTA 3Q8UA 4K8RA 4I69A 4V19X 2KG1A 3CCUS 2PFFB 4X65F 3SI8A 2CQ2A 4JI4F 2MZRA 3M8QA 4PUOB 3R5JB 2CQ4A 2BJEA 4HH0A 2AMCB 3S7RA 4NEYA 5KT7A 5EWFA 3KK1B 3CJ3A 3Q8VA 4WKYA 1RT2A 4TYAA 2BA9A 2LU1A 4Q0BA 3I32A 2YNFB 1R0AA 2OMLA 3GFYA 3UDLA 4CDIA 3ISND 3SCKE 3D66A 2OAUA 3KJVB 2HMIA 2JEFA 2WB1D 2ZFHA 5D4LA 3P49B 2W2PP 3TVKA 1FT8A 4RU9A 1KR4A 2OGUA 4RL1A 2DGWA 4O3QA 2HS0A 1XJWB 2L08A 5J2MB 4J9LA 3KKFA 4ZA1A 5L39A 1PAEX 2K3KA 2DR8A 3MEKA 4E8UA 1DHMA 1VBYA 2VH7A 4N76A 1HI1A 2NREA 1C2PA 1C1BB 1TL4A 3TJ8A 4ELUA 4A8SA 5K9FA 4ZP7A 4JI4J 4O23A 4O0IA 2DXEA 2V4JA 2HK2A 5KFNA 5HVHA 2OELA 5A0YB 3IBCB 5E5NA 2W25A 2VQFF 3B4DA 2C2OB 3F44A 3CJRA 4DR7F 5ETQA 1S1TB 3D2WA 4QIEA 2B9EA 3OFFA 4P72A 5H1SV 2RIJA 1LXNA 1S1XB 5CAAA 1X4HA 3R5GA 2QZ8A 2R3VA 1YK9A 3K8VA 3SXLA 4NOHA 2ACYA 2KXFA 3R1HA 1O51A 3NCPA 1U1OA 5HBMB 2HVHA 1G6BA 3FC9A 4OYMA 2V8DA 1OYDA 3MM6B 2JVOA 4DL3A 2R7OA 4FYDA 1FDBA 4OZ0A 3QO9A 3LWLA 3JSBA 4OYPA 5L46A 3E51A 1PYSB 3BH7B 3DFEA 3W5XA 4F3OA 4QWDA 3FFIA 4M94A 2N7CA 4K4ZA 4QYRA 1L3TA 1TR0A 3Q8PB 2AEMA 1PC4A 2PE8A 4FYYB 2KXNB 1AT1B 2MHEA 4FXVA 2HQFA 1NJXA 4RW7A 4RU2A 2F1FA 3QYYA 1VOMA 2VQFJ 4LJMA 1TKDA 4Y2MA 2YWEA 2R7UA 2XWXA 4ECQA 2F8MA 1UETA 2FJAB 4EMDA 5DM6Q 3GFHA 2L48A 3M7VA 4NLYA 2Z30B 3LP1A 1FDDA 1GNKA 3K5LA 2AGOA 4DSFA 3HJVA 3CCLS 3TOQA 3PRVA 5IQQA 1XMQJ 3GG0A 1BY9A 2HHXA 4B3OB 1F9FA 3V4IB 4IO9Q 4PABA 1F9HA 3A4TA 4DR3F 4D3GA 3D0GE 4C2MA 4M5KA 1PCAA 4X62J 4FXWA 1RT3A 1NH7A 3AJDA 5E3CA 2ROEA 2Z57B 4PR6A 1LFPA 2QMUB 3UWTA 1EARA 4K50A 2ZBIA 1OY9A 2RRNA 3BQ0A 4FS1A 5HQ8A 2NUUG 2UUBF 3W61A 3CXCR 5D15A 1H6KX 2ZZMA 1J2VA 4J9KA 4TY9A 1ZA1B 3G6VA 1WHVA 1VQSA 3Q2SC 3CJ8A 1CJTA 2XEXA 1KQSR 2DBBA 3TEHB 2WVEA 1C0TB 3G6XA 1XEZA 1OY8A 1D8ZA 3IBFB 2EFQA 3VAIA 3MMBA 2PD1A 1Y5IB 2D1CA 1TK0A 1T8EA 3A8EA 3DOKB 1IKYB 4YR2A 4DR3J 2HQ3A 1S0VA 5IOLA 3OFHA 4USWA 2NQPA 3CC7S 3PM9A 1FEEA 3MMCA 3W9IA 1HWLA 1S9EA 2A10A 2GIRA 4I2PB 5HMWA 3ENAA 1UPMB 1GMWA 1L5UA 2LDIA 2V9WA 3QGIA 4M5GA 1DRZA 1RA7A 3J81j 3MXHP 2X3GA 1EB0A 2FJXA 3D5MA 4ZJQA 2F9JA 1AYEA 2KYXA 3MECB 4URSA 4A8YA 4UQTA 2BJ8A 4LUBA 2R8KA 2XZTB 1JIHA 4ANEA 4NLTA 1KTQA 1DQ8A 3R97A 2LA6A 1X4DA 2XMKA 1GMUA 2LCWA 3TJ9A 2XZDB 1RCOB 4TNOA 1MMLA 3B6BA 2VBXA 2KXHA 1NXIA 1S79A 1BLUA 4RW9A 4DPUA 2FLOA 1NO8A 1TKZB 3VZIA 4Q44A 3ILIA 2IYGA 4LF1A 4HR2A 1YJRA 1K9MT 4A8QA 1VQ5S 2IDLA 3KLHB 3VGUA 2ATCB 3H5UA 2FHJA 4JV5F 3MD3A 3M30B 1RB0A 1RTIA 1NM2A 4F4XA 3FMBA 3CDUA 1KLMA 3S01A 1AFJA 1RU1A 3MPUB 1U1NA 3E01A 3NOCA 3KK3A 1WC0A 3ZTPA 4DPXA 4OJGA 3ZZUA 2K1RB 3J7ZT 4YOEA 2ADBA 4LF2A 4B9UA 4RBVA 2EG2A 4TYBA 1H2TZ 3FJ2A 5KFAA 2LQ8A 2ZJRQ 2DPJA 1VQKS 2HYIB 1T11A 4NLOA 1TVRB 3NAHA 3G9CA 4EO6A 3I96A 2OPRB 2BJ1A 3AA9A 3C6UA 3GFXA 5DG8A 2H3EB 2NZ4A 3I4PA 3ADAC 2MQPA 1R89A 3HDSA 3UFCX 4DEZA 2J9DA 1M5VC 1A9NB 4AXJA 3HHKA 2V8GA 3MTKA 3OPKA 2Y1JA 2FQQB 4IYQA 4QJVA 3C15A 4HTJA 4MK8A 4WCEQ 2KHDA 5J2PB 3DCAA 2ZBPA 3EGNA 4KQZA 3D3CJ 3ITHB 3NEKA 1HBUB 1U6ZA 4M63A 5KFEA 1YRXA 4G1QA 4ZLLA 3MD1A 3OUYB 2RILA 1C1CA 2OJ3A 1MROA 4C3MA 5JJBA 3H20A 5BXIA 4NZ7A 4CRJA 2FHMA 2IYIA 4ZVGA 1REGX 5G4DA 4YUDA 3M2UA 3IWXA 4Y2KA 1ZPWX 3CDBA 3R2DJ 4CLSA 4JI8F 4LR7A 2LQBA 5DLFA 2BJ7A 1HWUA 3ONQA 3H7HB 3D6FB 1ICEB 5DDOC 4NCAA 2N82B 4DR5J 3CW2C 1QAXA 2AU0A 4C6AA 2WBMA 4IOBA 3MURP 2BE7D 1G3OA 4KE5A 1CJVB 1HMVA 4KO0B 5K14A 1GMWD 4XO0A 1WG5A 3ZZOA 5T7LA 4M8LA 5LJ3Y 3GV5B 3RW6A 5IC4B 4B3RF 5F8IA 4QIWD 1YSJA 4CLFA 1XN9A 4K7QA 3NBPB 3TWZA 4EO8A 1PILA 2HHQA 4KPCA 1CJUA 2B3TB 2V2VA 4EU0A 4C8MA 4X4UA 3QIDA 1UPPA 3FZ2A 3F73A 2RRBA 2N4DA 3I0SB 3GIKA 1I5OB 2IFXA 3ENVA 4F4AA 4URGA 1UMJA 1LWCA 4DPTA 2FZKB 1YITS 3CTRA 3DRYA 1VMBA 4P74A 2NXCA 3KLIA 2RQMA 1UVNA 2W9CB 4OJ3A 1S10A 4E0DA 3M2VB 4GC7A 1KWMA 3OV7A 1X5TA 1CBKA 2FHJD 3CF5Q 1T3NA 3KJFB 4DL2A 2P9EA 4AFFA 1REVA 2WZ1A 2ZBCA 5KFIA 3JQJA 1WKJA 2FJDB 1VC0A 5IT9U 2DTJA 2OH2A 3V6KA 3FVYA 4JI2F 3T9ZA 3BO3A 3VQSA 1HBMB 1RTHA 2VHGA 3NGDA 3OSPA 2IRXA 4A48A 2YWFA 1F6TA 1O0PA 3FUYA 1VQ4S 5I3UA 1CJKB 1RU2A 3W8PA 4OHYA 2XYHB 4P75A 1X7VA 1RLCL 2COLA 4GVBA 4MIBA 4YDXA 1HQEB 3G71S 2CUYA 4QU7A 4QU6A 4IKAA 3HT3A 2E66A 3KLFA 1D9AA 1QAYA 2MZSA 2KVIA 2H65B 2YTCA 1RHUB 3UVJB 2GVDA 5KFVA 2OO4A 2AIRB 4RW8B 2E5JA 1Z4UA 1K73T 5CYQA 1J27A 2HQCA 1ZM9A 1S4EA 2HQIA 2RS2A 4DFKA 3M1VB 2ATLA 3OL6A 2K8GA 2J7UA 3NMAA 3NP5A 4HHUA 2DJWA 5ITHA 1NHVA 1EKSA 2V4QA 2YNHB 3R7BB 2CNOB 3EM1A 3Q8QB 1B70B 1WOSA 5KT2A 1M1GA 3R3TA 3D6MB 2EFPA 2CADA 1FK9A 2WVBA 3HM9A 1S1WA 4C8LA 1TL3B 8ATCB 3AOCA 4ED2A 4RUBA
chains in the Genus database with same CATH topology
3PW0A 2XLJA 2DHGA 3VAHA 4ZPWR 2MQOA 3SV4A 1KTVA 2DNGA 2PEHA 2DT9A 2KRBA 3O1LA 3UPFA 3CD6S 4ES2A 5L1IA 1QSSA 4LF4F 4FXDA 5G0RB 2DNRA 2JL9A 4Q45A 1R8PA 4FZVA 3I9V9 1RISA 1JLFB 3CJ0A 2QA2A 4BC9A 4WE1B 5HMYA 2GQQA 3I31A 3MEEA 4AUKA 2BBEA 5CXTA 2MKHA 4TU8A 3IGNA 2FVPA 4DSKA 1Y3KA 3MUMP 4ED3A 4I6YA 4WFBQ 2ZHAA 3P5TL 4GO7X 1HHSA 2XY6A 3IRWP 3RAQA 3MR3A 1IKWB 3DDKA 4ZMMA 3FNNA 1S9FA 4BC7A 1R8BA 2WOMB 1T02A 3I87A 4ED1A 4A8FA 4IFYB 1LW2A 5CYMB 4RUHA 4DSIA 4PWDA 1TAUA 4DLEA 2DPIA 5LJ5Y 2GO9A 3RYLA 5FLXY 2D7SA 5J2PA 1N36F 4QPXA 3IWLA 3HK2A 2HFNA 1KHVA 3T5JA 1N88A 4J9PA 2BZ2A 1QAIA 1NU4A 4WFNQ 2J0QD 3L95X 1JLAA 4EYHB 1QVFR 2N3LA 2W4PA 3MI7X 4J9SA 4DL7A 1U26A 3IRXB 4WK3A 3MOZA 2Q1LA 3OHAA 3ITHA 2DH7A 2LMIA 4C98A 1HBUA 1VRUB 3CVKA 1VIOA 2GMHA 3PO5A 5KAKA 1JLEB 3BGFA 2RRAA 2DGXA 2HHPA 2WB4A 3U1MA 1YJTA 3OUYA 3C3LA 3CCVS 3G8SA 5L9XA 2M52A 2Q3PA 4O4RA 4WTYA 4O3RA 4NLQA 1JLCB 5K8MA 2Q66A 4XK8C 1WEYA 4PQUB 5EX3A 5J2QA 5F0WA 4L6V3 1X4GA 3EZUA 1R43A 5DRKA 3M9MB 3FGVA 1HHTP 4QPTA 3RB4A 3T5KA 4ZPAA 4ECWA 2ASDA 1DQAA 1FDAA 4CQ1A 4RUCA 2ZUGA 3IG1B 4PXEA 2JRSA 1URRA 4LVNP 1YG0A 5IS2A 3RB0A 3PACA 2J0SD 3MPYA 1VQ9S 5HL7Q 5D4OA 2EFVA 3KNGA 1CQMA 2HLTA 3I6PA 4HI1A 5C42B 5IM0A 1X4EA 1LWEB 3MMJA 2YKAA 3L7PA 2B6AA 3D0HE 5D4PA 3WC0A 2MGZA 1RA6A 1P6TA 4ZS6A 2YNIB 4B9MA 2BYCA 1R7IA 4DUZF 5A2QY 3JSYA 4DG1B 3CCRS 3DYAB 3HP6A 3BJYA 1HPZA 3KK2A 1N6QB 2VG6B 3DRRA 1H38A 1BQXA 3HVTA 1X4CA 2W7AA 3M6XA 1UL3A 4TLRA 4FS2A 3SDEB 1RT1A 3FSXA 1TAQA 4TN2A 5KFYA 2MKJA 2RD5C 3LH2S 2OPSB 3JSMA 1VGYA 1H7WA 1HWIA 1OPIA 4WFYA 1U1QA 2BJDA 1SL0A 3K59A 2WSFC 3IR6B 1P1TA 3W2WB 2WK4A 1VQ8S 4KHMA 1JLBB 3MR6A 5F8LA 5D78A 4KGKA 5HMXA 2X1AA 2R2UA 2CPHA 3QLHA 1JNZB 3OQ2A 2BV3A 4USJC 2XG8A 2AF6A 5KT4A 2EFNA 5F0UA 1HW9A 3OSNA 3RRGA 3C6TB 2P5VA 1N5YB 1WWHA 4KO0A 2BANB 4OZJA 1SKWA 2KN4A 3CCQS 5B7WA 5KT6A 3CDAA 3VALA 3RRKA 4JV0A 4N56A 3HJFA 3MPVA 3MUTP 4IOCQ 3OTDA 1TL1A 2LA4A 5HP1B 1LW0A 1AUDA 3LGMA 3KMSA 4U7UK 2C2RA 2CG4A 4I64A 5MLCV 1S77D 2JHEA 1WHXA 2YVSA 4QIFA 2WSCC 2J76E 3W7BA 3FEYB 3TA0A 4E98A 4CH1A 1KN6A 3QAEA 4YEAA 2HNZA 2PO4A 1G2EA 1HBNA 1HFEL 4NX9A 2JWNA 1V3SA 4LVOP 3WC2A 1KOHA 2VOPA 3PRBA 2LU2A 3QZ8A 1HARA 3TAMB 3NBPA 4PXDA 4ZPTR 4ES3A 2RVJA 2XCPA 4B3MF 3MEGB 1MMNA 2FJVA 4DL5A 3OJSA 2KB2A 1QUPA 3CPWR 1VQNS 2YKPA 3FZBA 2J9EA 1FF2A 2FD2A 4J37A 3BN4A 3EXYA 2B5JB 4MAKA 4OHVA 1SV5A 4O44A 3UE2A 3Q8RB 2B4PA 1EP4B 1MU2B 1VI7A 2IM2A 4DN9A 1X0FA 2YNGB 2AJFE 1S6QA 3CD5A 2FVSA 2P6TA 3CDEA 2RB7A 4OZNA 4ZCLA 2JLEA 4NLSA 4X66F 4YHHF 2ZM6F 2B9WA 3UI3A 1EETA 1Y5LB 4PXCA 1QM9A 4YQWA 3KHHA 1E6VA 1FVSA 4MIWA 5E7OB 1RK8A 2ZH1A 1SJFA 2E1CA 2GGPB 1W2IA 3OXFA 4RBTA 3G8TA 1QAJA 2J9CA 4MYTA 3M32B 2BR0A 4ZPCA 4F4WA 1Y00A 1DLOB 1CC8A 1YGYA 4ECUA 4KKOB 1CEZA 2JEJA 4NYOA 5KFZA 2JZ5A 3SEOA 4DMZA 4ZP9A 4QR0A 2O3DA 4HYKA 3LP0A 3TX8A 4DR6F 3BM7A 3QZ7A 1DFDA 4L3NA 4F2SA 1LK7A 5C24A 3AH6A 2MSTA 2NUHA 3CDWA 4ID5B 4YB7A 3CCMS 4JOUA 3T1HF 1G1XA 3CJ5A 4DQSA 3OVSA 3ENQA 4KT0C 2CJKA 3MM5B 5I3QA 2PI5A 2CPEA 4DR1F 1U1LA 4LMZA 3CGIA 1P8GA 4RKUC 2AGQA 3RAMA 2W9CA 5M2UA 1B0PA 1NK8A 1GXLA 3H8YA 2O66A 3M2VA 5I42B 4ETZA 3BQ2A 4EYIB 1TFWA 4IH5A 4ECRA 2MKSA 4K4UA 1HNWF 4G1IA 2YKQA 1R27B 2JOQA 4KJIA 1ZM3A 2I5JA 2RJZA 4NZ0A 4C0BA 3WX4A 1LOUA 3O5TB 3G86A 4CO1A 3SFGA 1T7PA 5BR8F 2ASLA 2DGVA 2CJ9A 2JEIA 1Q82T 2XS7A 4P2SA 1BGXT 4IRDA 5B09A 5A8WB 3CC2S 2IC3A 4DBQA 1TP7A 2UV8A 1WI8A 3IR5B 2FUG9 5L9NA 2XCAA 2R4FA 1N32F 1UA1A 3S1TA 2LQJA 2LLZA 2VG5B 2DISA 1H98A 4OHWA 2J7WA 4B9SA 1HNIB 1SJ1A 1WEZA 1M0SA 1Q1KA 2GW8A 2HWTA 1Z1ZA 2L9WA 1YIJS 4JI1F 1I94F 2C3PA 1P1LA 1Z2LA 3DRSB 4IOAQ 4IRCA 3WDOA 3BGRB 1X0PA 2CQPA 2M8HA 1X5SA 2DR7A 1LXJA 1VQPS 4P7TA 4DF8A 2GA7A 2YX7A 3PO4A 1HBMA 1HQUB 1JMTA 1SJQA 2L41A 3HHNB 4UY8T 3NNHA 3TRGA 5HROA 5LXYA 4I2QB 3GB0A 1VIXA 5BYQA 2NR0A 2CDQA 3Q23A 3K5NA 3MM8A 4ZDNA 3VAFA 3V4IA 1N5QA 3OXLA 4IG3A 2BE2B 5AE2A 4N8OA 2XMUA 1IQTA 3DMJB 5JUMA 2VBYA 4OHZA 1FA0A 3EGWB 2DVIA 4P6QA 4FN5A 3JYTB 4RW6A 2YWHA 1WEXA 1OWXA 5KFDA 3CCJS 3B8HA 2YY3A 3MTJA 2HG4A 4KFBB 5CCLA 3JTPA 3RBDA 1LKZA 4BHQA 2MKIA 1TKXB 2FHKA 3Q2TC 2EVZA 3IO1A 2VFRA 2XSJB 3EPIA 1N52B 2W9AA 2BACA 4N47A 4KB7A 4HHJA 2M2BA 2KT5A 3Q8SB 2AYBA 4MFBA 1WF0A 4PG6A 2OLWA 2NSCA 1U1PA 3DRPB 2OP5A 4X2BA 2GQ2A 1NHUA 3D1OA 2CZVC 3KK3B 1UVJA 1F60B 3LW5C 1VQYA 3HO1A 2ZH3A 2J0WA 1DTTB 3N5BA 2VBWA 3V6JA 4O4GB 1HQEA 5D8HB 2Q6BA 3DLKB 3LQVA 3M8PA 4NA1A 4Y2CA 2XY7A 3TVZA 1IKXB 2L3MA 4IR1A 4JI5F 2KFYA 2HHHF 1RT4A 4DR2F 2CQ0A 3OTOF 2PN6A 1WF1A 4X4QA 1IQZA 1X5OA 2LQ5A 2VL1A 2WTFA 4F2RA 2H5EA 1VJWA 3LPYA 3M2RB 3M8QB 1UVMA 4F3QA 3GQCA 1IKVA 1ZBTA 1S0OA 3UR3C 1XR5A 1KEKA 4WFAQ 1UW4A 2BVZA 4I6AA 3PFEA 3EUNA 2IA6A 1MWYA 5KFMA 1XMQF 1HNZF 2IMWP 3HZEA 2AYEA 2ZNZA 1S76D 4QCLA 3PDNA 1S9GB 1OSDA 3PR5B 3KLEA 4RW8A 3PW7A 2DGSA 2D3ZA 4EBCA 2YWKA 1HNVA 4WYLA 1S6PA 3KLGA 2LXIA 2U1AA 3IS9A 3BSAA 3QIPA 3SV3A 2ZE2B 1XC9A 4AL5A 1XR6A 4LFBF 2VA2A 3AJ1A 1RT2B 5D4NA 2MZJA 5H9FJ 1KS2A 1SJRA 1HBOA 3H5SA 1KVIA 4RX6A 3H59A 1ROFA 1TZ0A 2KDOA 5GAGI 1XWLA 3OTCA 2AQ4A 3RR7A 4Q0BB 1Z2ZA 3CSKA 2PA8D 1U45A 1Y9OA 2HGNA 4ZHRB 1VFJA 3M1VA 1R0AB 2RQ4A 3HVWA 3QGPA 3DOLA 4X62F 1X5PA 1TV6B 1HR0F 1HL6A 1AXQA 2OFHX 4NMLA 4XPEA 4P7VA 3PW4A 1UFWA 3O44A 3UQSA 1J5OA 4M5DA 5GMKa 1UJ4A 4JUZA 2R8IA 2ZH5A 4NLGA 1YJUA 4ELTA 3VF0B 2HMIB 5LSLA 4B3TF 2ZITA 1PSDA 4Y3CA 1MSWD 2YKMA 3DGPA 4DJBA 5I4MA 3R1LA 3UW1A 3BB5A 2D74B 2FGOA 1F5BA 1CLFA 2E1RA 2ERRA 1FTCA 3J7YI 4C8OA 1XNQF 1N8RT 2ROPA 2HHVA 4NPOA 2K7KA 2POKA 3OVAA 1VC5A 3VTIA 3NS6A 3BQ1A 2AGPA 2N4CA 2ABYA 4GMKA 1L3VA 2Z4PA 2UUWA 1HW8A 2W7PA 3UCZP 1RDRA 3GG1A 1T03B 4IR9A 3DHWC 1SUQA 4CIOA 3KTQA 5J1EA 4R0JA 1I1GA 3EPGA 4DPOA 3VWSA 1BQNB 3FEXB 2HVIA 1TL3A 1JK9B 4EZ6A 4KV8B 2WRMA 3DI6A 3GYXB 1ZAXA 3I4HX 2V94A 1TK8A 3T9NA 2HFZA 1U1MA 1HI0P 3DLJA 4DV3F 3KOAA 4QIGA 4DX8H 4USHA 1HI8A 5G0RA 2CQIA 4DV4F 1YHQS 1JLFA 1RJJA 4WE1A 2UVUA 1RP5A 4QWBA 3V5RA 2OFGX 4Q43A 2Q43A 2KTQA 1WG1A 2KT3A 1DBDA 4MYUA 4JYAF 1QJHA 4TXSA 2KU7A 2BUNA 2K2PA 2EC0A 4LIWA 3E3XA 5I3PA 3X1LB 2KFZA 1FERA 3IN5A 2AV5A 3CEDA 4ERDA 5KFRA 1IKWA 3JTNA 2VQEF 1U1RA 2UUCF 2XWYA 2V4JB 2A3JA 2QYCA 5E33A 5GADU 1GX6A 4NXMF 4X4VA 4I7FB 2WOMA 1M1KT 3EGZA 3HKWA 4IFYA 5CYMA 3DHXA 2HS4A 3CCSS 3DLBA 5D6GA 1BD6A 4RNNA 3M9NB 3FRYA 3G6ES 4EUVA 2GHPA 1PO6A 4RNOA 1CVJA 3GWCA 4J9OA 3HHLC 4HVZA 5LMUF 4RZRA 3VAMA 3VAKA 2DK2A 4NLWA 3IRXA 3GR0A 2QV6A 1RT6B 1X4FA 2FJEB 5J1PA 1B7FA 5F9NA 4TU7A 3ETOA 1YTYA 2CPFA 1VRUA 2XMWA 4NLUA 4F25A 1FKPB 4Q8EA 1JLEA 4R5PB 4K0KF 4GO5X 2QLWA 4ED8A 3MMAB 4OI2A 2VPZB 4K5RA 3S6EA 2VA3A 2CPDA 1XNRF 1TUVA 4PXBA 4DQQA 4EWTA 4ZCKA 1NJIT 1JLCA 4PQUA 1GH8A 5EX0A 2VFVA 2QA4G 2XMJA 3OLBA 4AE5A 4B9TA 1FNMA 4TU9A 2FVRA 2FC9A 1IM4A 1YJNS 2ZOFA 3KFWX 4OI4A 2CPZA 3N0VA 3P96A 4IO1A 2DCLA 3GIIA 2IVMA 3IG1A 4A8XA 5AXMA 2PIIA 2CQHA 2WSEC 1KONA 2FPHX 3JTOA 4NWBA 4OQJA 5SUHA 5L38A 2EWHA 2KKHA 1VQLS 1OS5A 3CD0A 3DNCA 1FRMA 5C42A 4KR0B 4HL9A 1N5TA 3AAWB 2ZVSA 4K4SA 4Y00A 1LWEA 3E8OA 3X3UA 3HF5A 3PNIA 1JNRB 2HNYB 4ZLPA 4FVCA 4LF7F 2NXUA 2YNIA 2OKQA 3B82A 1YWXA 4DG1A 3DYAA 4NLRA 2MXYA 3JB9k 4H4KC 1N6QA 2VG6A 4WK1A 4NLXA 1VK8A 3NG8A 5MAOA 5KFFA 3SDEA 3U27A 3F56A 3O8WA 4MIAA 3TNVA 5LXRA 1NZAA 2N7YA 2WHOA 3QO9B 2OPSA 1W25A 3EX7B 1RYRA 1S1VB 2XI2A 2AYGA 4O3SA 3W2WA 4DQIA 4UUXA 3HXMA 1JLBA 2XMVA 3OR2B 3KHLA 5E3PA 3TQ1A 2IBKA 2FIUA 1FKOB 3AY0A 4CH0S 4DFMA 4OL8A 2IA0A 2VODA 2UV8G 4EZ9A 1KHWA 2HZCA 3FFIB 4KGMA 4KPYA 3LAKA 4Z2XA 3H2VE 4ZPBA 2E29A 2HFOA 2HHSA 4N8NA 2L9DA 3C6TA 1GTHA 1N5YA 1FVQA 5E3AA 3BSCA 2BANA 3MR5A 4B9LA 4O3NA 2EBEA 2HHWA 4EEYA 4MKAA 3JSRA 1SIWB 3ISNC 1UVIA 2XB2D 3K5PA 1S48A 3MAQA 3NNAA 5LSOA 5DDQC 2AJ0A 2GV1A 2BQ3A 4XPCA 2CJAA 3HHLB 3U1LA 5KFBA 5KT3A 3CJKB 4DHVA 2B7BB 2C3UA 1JLQB 4OMFG 5HP1A 1R3NA 1WF2A 4HDGA 1IN0A 2DNMA 4DV7F 2FC8A 1T94A 4RW7B 4BS2A 1CPZA 3TANA 4ALZA 4HKQA 3J7A1 3DLHA 2XGPA 2C28A 5F8NA 4TKTA 1V3ZA 2LEAA 4WIIA 2BOPA 5AJ3F 4DDFA 2PMHA 1F5CA 3ZZ0A 2IVFB 3Q0AA 1SBRA 1NKCA 3FMWA 4OZ1A 1QE1B 2DIUA 2IVYA 3TAMA 4CO5A 2OPRA 2BABA 3NCQA 2CZ4A 2GO8A 2QO3A 4O3PA 2MZ1A 1URNA 4C8KA 4F4ZA 1LFWA 5BYRA 3RZAA 3MEGA 1UJ6A 2CQGA 1S99A 3CCTA 3CB4A 4ID8A 1S6OA 4MKBA 3H4DA 5JVGQ 4IQXA 2YKOA 2UUAF 5F41A 2D9OA 1CG2A 2EK6A 3LO3A 2B5JA 3KWMA 4YY3F 3CMAS 2MY7A 1MW7A 5CZXA 1EP4A 1MU2A 4NLVA 1H3DA 2YNGA 4YB5A 1N33F 2C3OA 4RNMA 5DQHA 2ZDOA 4C8YA 4O3OA 1SL2A 1Q79A 3GSDA 2N3OA 1RAJA 2UZAA 3BEGB 3LP1B 4MK7A 2YWGA 4G1PA 5FIIA 2GGPA 1R6YA 3GFZA 2AJ1A <