1LWCB

Crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
423
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 117
structure length 402
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwcB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB03
4RW6A 4ZP6A 3H4DA 1EP4B 3KLGA 4YMEA 4H4MB 5KFTA 3QLHA 1RTIB 5C25B 4RNHA 3DI6A 5KG0A 3OSPA 1N48A 5J2NA 3GIKA 4MFBA 2W7OA 3C6TB 2YKMB 5KFSA 3HVAA 2RKIA 5L1JA 3LP2A 3SFUA 4WZQA 1FKOA 5EWGA 3PW0A 2IC3A 3NGDA 1SH2A 1VRUA 1ZTTA 5DGBA 1TL3A 4NLOA 4PUOA 4F4YA 4KE5A 5KFLA 3LANA 3MEEA 4ZVEA 5KT3A 2V4QA 3IG1B 4KKOB 4TQSA 2GIQA 2ASJA 1REVA 2YNHA 4F4XA 1LWCB 4MFBB 4PWDA 2IM1A 5I3UA 2AGQA 2R2TA 4O3OA 1NNDA 4LSNA 3KK1B 2D7SA 4ED8A 4EYHB 1TKTA 4I7FB 4RW7A 1VRUB 4QW8A 1C1CB 3E51A 5J2MA 2J6SA 2HNZA 3TVKA 5KFHA 5EWFA 3NKYA 4J9PA 4IFYB 3IS9B 2YNHB 2HNYA 2VA3A 2XC9A 2WOMB 3FFIA 3D5MA 4O4RA 1RTHB 2RDJA 5KFYA 2UUTA 3NAIA 5KT4A 1DTTB 1S1VA 3QYYA 4F4ZA 1S1TB 4X2BA 3KK2A 1TVRB 5D3GB 3KLHA 4F4WA 4EBEA 3IS9A 4G1QA 2JEFA 4EO6A 5KFRA 4I2QB 1TL1A 5KFBA 3CJ0A 5HBMA 1S1XB 1RTHA 3T5HA 2HNDB 2ZD1B 4U6PA 2ALZA 2JEJA 3DOKB 4ECZA 5KG6A 4ZHRB 4LQ9A 3QIDA 1JLGB 1KLMA 3N6LA 1S9GB 1QE1B 3KLIA 5J2MB 3SFGA 3OLAA 4K50A 5HLFB 3MEEB 4JV2A 1JLBB 1IKXB 1HQUA 1RTDB 2HWHA 2IAJA 1HARA 2V4RA 3KHHA 2WRMA 3KLVA 4YP3A 1LW0A 1HPZB 3Q8PB 4ED6A 4PQUB 4HKQA 1JLCA 3KMSA 1S6QB 3LP1B 4FBTA 5DQGA 3VQSA 1C1CA 3RBEA 4WFXA 4PUOB 4NLYA 2IC3B 1HQUB 4NLVA 5KFMA 5HLFA 2V9WA 3DM2A 1UWBB 1LWCA 1HYSA 5KT5A 2I5JA 4XPEA 1REVB 3MEDA 1W25A 3FQLA 2W8LA 4R8UA 4NLRA 2FJWA 4IFVB 3IN5A 4O4GB 2E9RX 3KLEA 2FJVA 2OPRA 3FDSA 3QZ7A 4WXOA 3GV7B 5KFPA 3T5KA 2AX1A 3MTKA 1HMVB 2XI3A 4I2QA 4IH6A 4G1QB 4EBDA 1TQLA 4O3RA 4YR3A 4IRCA 4ZPBA 4ZPDA 3MEDB 3BSAA 3IGVA 5KG3A 4ECVA 4KV8A 1WNEA 3DI6B 3GIMA 2WTFA 1DTTA 1SV5A 2YNGA 1QUVA 3KK3B 3G86A 5F8JA 1IKWB 4NLXA 4NLPA 4Q44A 4K4SA 4YR0A 3GILA 3V6HA 3E01A 3TAMA 2ASLA 2OPPA 4ZP8A 3OSNA 5I42B 1RYRA 1GX5A 4JV1A 5J1EB 1S6PB 4J9NA 3BQ2A 4RW9A 5K14A 1K1SA 2IJFA 2YNIB 3DLKB 2ILYA 3HHKA 5F9LA 5F8HA 3M8QB 4NRUA 4H4OA 1SH0A 4Q8EA 3RB4A 2FLLA 1S1WB 3BGRB 2AWZA 4ID5B 4MKBA 1S1WA 4RNFA 2ZE2A 3CIZA 3DRPA 1JKHA 1DTQA 4WFYA 2R8KA 4QWEA 3V6DB 1TL3B 2VG5A 3V6JA 1JXLA 4KBIA 3BREA 2R8HA 2RDIA 4TQRA 4O3QA 4RNOA 4ICLB 1N4LA 4TXSA 4Y3CA 3LP2B 3KMQA 2YKMA 2RF2A 2W9CA 3H5YA 4PQUA 3JYTA 4KAIA 1BQNA 5DLGA 1RT2A 1LW2A 5KFFA 1TVRA 2ASDA 5CYMA 1HQEB 2IM2A 5DLFA 1GX6A 3H2LA 2FLNA 4IH5A 5C5JA 1IKXA 1RTDA 4O44A 5HROA 2I1RA 4KO0B 3T19A 4ZVHA 4DL5A 2OH2A 5C24A 3CDEA 3ISND 4Q43A 3BSOA 2BQUA 2IM0A 2WOMA 1JLQA 4URQU 5KFUA 2C2RA 1EETB 3DLEB 4ECSA 4ZP7A 3DYAA 3PHEA 4ZPCA 4DEZA 3DLGA 1C0TA 4RZRA 3H4BA 2J6UA 4F50A 1S0NA 2BE2A 1T05A 5DG8A 3KLFA 5KFJA 2OPRB 2D3ZA 3IRXA 4I2PB 1T94A 3SI8A 1KHWA 1IKYA 4LSLB 1RT7B 1J5OA 2JC1A 1HQEA 4FS2A 4KFBA 4IRDA 3PZPA 3OL8A 4R5PA 3OLBA 4PWDB 3GV5B 5KT2A 1TKZB 3DMJB 1RT3A 1U09A 4Q8FA 1NHVA 3BQ0A 1XR7A 5F8MA 2R2UA 3LAMA 4EBCA 1JLFA 2R8GA 1C0UB 2VG7A 4ECWA 2IA6A 5KFCA 4Y34A 1HNIA 3I0SB 5J2QA 3V6KA 2R2RA 1FKOB 3H40A 2BANB 3H98A 4IR1A 3DRPB 1C2PA 2HNYB 2HWIA 4IKAA 3ICLA 3CJ5A 3IGNA 2E9TA 1N6QB 2HNZB 4R5PB 3MEGB 3D28A 4NZ0A 2IAJB 2B5JB 1S9EB 3HVWA 4RNMA 3BJYA 2FLPA 1D1UA 2FJXA 2WHOA 4LSNB 3DLKA 2J6TA 3DRRB 4NYZA 5JUMA 2R8IA 1MMLA 1JLEB 1ZTWA 1S48A 1KLMB 4IOBA 2DPIA 5C42A 5DGAA 3GQCA 3PR5B 1HNVB 3BQ1A 3ITHA 5KFAA 2CJQA 2B6AB 4Q45A 2JEGA 2HNDA 2ZD1A 3MFIA 4TY9A 3CJ3A 4ZVGA 4RW4B 1RA7A 3HKWA 1IKWA 1TL1B 2FVCA 1TKXA 4ECQA 4TYBA 2YKNA 5F9NA 2O5DA 2OPSA 4K4TA 3LP0A 3QIPB 1RT1B 1RTJB 2VG6A 1Z4UA 3LP0B 3QIPA 3JYTB 1RTJA 3V81A 4ZPAA 4EEYA 1S1TA 1VRTA 5CYQB 1JLAB 4J9LA 3I5BA 1FK9B 2B6AA 1XR6A 3FFIB 4RNNA 3I0RA 4K4ZA 4YR2A 4FBUA 2W8KA 1OS5A 4MIAA 3UR0A 1IKVB 4G3IA 3BGRA 1RT6A 4QWAA 1S0OA 4MK9A 1JX4A 1C1BA 3HVTB 2ATLA 4XO0A 3FQKA 4TY8A 5F8LA 3DRRA 2IM3A 2AQ4A 1S9FA 5J2PB 4DG1A 2F8EX 2UVRA 2EC0A 4KSEB 5KFEA 4IQXA 1DLOA 3V4IB 3GIIA 2CKWA 1N6QA 2WONB 5J1EA 2W9BB 2W9BA 4EYIB 4URSA 3RB0A 4RW8B 1HPZA 3M9NB 4NLWA 5FDLA 4XPCA 5DG7A 1HNIB 3I0SA 5J2QB 4WYWA 5EUHA 1C0UA 4DG1B 2QE5A 2VG7B 3G6VA 3T5LA 3CDWA 5J2PA 1JLFB 3JSMB 4JUZA 4TY8B 3KOAA 1VRTB 2ZE2B 2AGOA 1T03B 3PJWA 3T5JA 2WONA 4O3SA 5KFXA 3CO9A 1DLOB 1MU2A 1RTIA 4NCGB 5C25A 2FVSA 4KB7A 4WYLA 4H4OB 5T14A 4RUAA 3KHRA 4K4WA 3DRSA 2GC8A 4ZP9A 5HBMB 3DRSB 1FKPB 3FSIA 3KJVB 2W9AA 3RB3A 3KLEB 1T05B 3HVTA 3G6XA 4O4GA 3OHBA 4K4UA 4U7CA 5DQHA 3M8PA 4J9MA 1S1UA 3T1AA 1S1UB 3H59A 3ISNC 2IJNA 2OPPB 5KFZA 4WE1B 4QPXA 3KHLA 1K1QA 3KNAA 1UWBA 4IG0B 1KHVA 3MF5A 4Q0BB 2UVVA 3H5SA 1TKXB 1FK9A 3H5XA 4O44B 5HROB 3DOLA 3QO9A 4KO0A 3DOLB 3QO9B 2B5JA 1CSJA 3KK3A 3RAXA 2AX0A 3PW5A 3M9MB 1RT2B 4URGA 3V81B 5EDWA 1BQMB 1S10A 1XR5A 1RT1A 2VG6B 4WXWA 3M8PB 5C42B 3N6MA 4TN2A 5KT6A 2XCAA 4FS1A 2DPJA 4O3NA 4NLDA 1HMVA 2BQ3A 2JC0A 4ZVFA 3JSMA 2FVPA 5KFQA 4ED7A 1R0AB 2WCXA 4IG3B 4IDKB 4QWDA 3V6DA 5KFDA 2VG5B 1RT5B 3CWJA 3NAHA 4ED2A 4KHRA 1C1BB 5I3UB 1RT6B 3Q8QB 4DL2A 1QAIA 5KG5A 4M95A 2V0NA 2XGQA 1RYSA 1RT7A 2UUWA 4WZMA 4IG3A 4IDKA 3GYNA 4M94A 1R0AA 4RUCA 1JLAA 3PW2A 4DL4A 2IMWP 3G6YA 2HAIA 5KFOA 4MK7A 3MECA 3QZ8A 4GC6A 1RT3B 4NLUA 2VA2A 3C6TA 4Y2AA 3OL6A 5J2NB 1LW0B 1RAJA 1RDRA 1N56A 1IKYB 1J5OB 1I6JA 4B3OA 1LWEA 4QWBA 4I2PA 3OHAA 1LWEB 3KLFB 4DL7A 3C6UB 4RW6B 4IG0A 1LWFB 4Q0BA 4NLSA 4WE1A 3ITHB 5KFIA 1TKZA 3DMJA 3CJ4A 3EPIA 2AGPA 3EPGA 3RBDA 4K4XA 2YNFA 4IFYA 3I0RB 4KHMA 4JV0A 5DG9A 3GV8B 1TV6A 1FKPA 4IRKA 3Q8SB 1N5YA 3N6NA 1S49A 5F8IA 2ZKUA 2BE2B 4IR9A 1C0TB 3RB6A 2ILZA 1HNVA 4LQ3A 3H5UA 1T3NA 2HMIA 4QWCA 2JEIA 1T03A 5D3GA 1LWFA 3IG1A 4KKOA 2BANA 3OL9A 4ECUA 1ZETA 3OL7A 2B43A 1JIHA 4NRTA 1RT5A 1SUQB 5KG2A 4RW4A 3UQSA 1S9EA 3M8QA 4QW9A 3UPFA 4MIBA 4MH8A 5FDLB 3MEGA 1S0MA 2R8JA 5L1LA 4J9RA 4RU9A 4J9QA 4J9SA 2UVUA 4HYKA 5JXSA 2RKIB 2W7PA 4MKAA 2W9CB 1YVFA 4ECTA 1BQMA 4TYAA 4KFBB 5KFGA 1S4FA 3NL0A 3GIJA 4DL6A 1S97A 1EP4A 3KLGB 1SUQA 3UDLA 1JLBA 4J9OA 4K4YA 2UVWA 3FRZA 2YNIA 1SV5B 4H54A 3DLGB 1NHUA 5KFKA 1IKVA 3NMAA 4ID5A 3MR3A 2E9ZA 3LAKA 1JLGA 1TP7A 2WB4A 3DDKA 5DQIA 3E01B 3TAMB 2XWYA 4O3PA 5HP1B 3BSCA 2AU0A 2D3UA 3RAQA 4WFZA 2IBKA 5CYQA 2GIRA 3I5CA 2OPQA 2FVRA 4ZMMA 5K14B 4Y2CA 4EO8A 2YNFB 1MU2B 4NCGA 2BRKA 3TQ1A 4GC7A 3CDUA 1BQNB 2RF2B 2YKNB 2I5JB 2BRLA 2OPSB 1RT4A 3MR6A 3C6UA 2JLEA 3PJXA 2XI2A 1S1VB 4IH7A 5KFNA 2C2EA 3IRXB 4ED3A 3PVXA 4B3OB 5CYMB 5KT7A 3MR5A 5HP1A 1SH3A 4MK8A 4OL8A 1DTQB 1JKHB 4KV8B 3BR9A 2R2SA 3DLEA 1EETA 3MECB 1JLQB 3LALA 1QAJA 1HYSB 2C22A 4ICLA 4NLTA 3NBPB 3KJVA 3MR2A 5F8GA 2D41A 1TKTB 4I7FA 2QV6A 4RW7B 4J9KA 2BR0A 3KK1A 4NLGA 1LW2B 4RW9B 1S6PA 4ECXA 2XGPA 5I42A 3DM2B 5L1KA 2WK4A 3PW4A 5KFVA 3DOKA 4ECRA 4DL3A 3QGHA 4YQWA 3EZUA 5KG1A 4R0EA 4RW8A 3CVKA 3Q8RB 3LP1A 1S6QA 1RT4B 2BQRA 1JLCB 3CJ2A 1S9GA 3KLIB 3BSNA 2HMIB 3QGIA 2C2DA 3KLHB 3V4IA 5KFWA 4ECYA 3KK2B 4H4MA 4LSLA 3QLHB 3QGGA 4ED0A 2OPQB 4TLRA 4ED1A 5KG7A 2FVQA 1S1XA 2XCPA 3M9OB 1N5YB 3PW7A 5F8NA 2YNGB 1RA6A 1TV6B 3NBPA 3PR4A 3I5AA 1IM4A 1D0EA 4IFVA 1QE1A 3DYAB 5KG4A 3MFHA 4K4VA 5L9XA 4R8UB 5L1IA 5EWEA 3KHGA 2C28A 4ZHRA 1JLEA 4NLQA 5C24B
chains in the Genus database with same CATH superfamily
4RW6A 3U1MA 3MMCB 3AHPA 1WHWA 3SQOP 1RP5A 4WK3A 3VR1A 1U25A 2WAQD 1VC0A 3M2RB 2MLXA 3HFVA 1U0HA 2YWWA 1VQ4S 1RTIB 2CPXA 4USMA 5AXLA 1N48A 1GXTA 2HS3A 1JJ2R 2P9EA 3ILLA 5DJBA 3TA1A 3L09A 5LJ5Y 2MGZA 1YJ9S 1FKOA 5EWGA 3PW0A 2CG8A 3GSIA 2UUBJ 1GMWA 2DCUB 2IDLA 2BJDA 1TL3A 1SC3B 4NLOA 2Z58B 3PG9A 1VIOA 1Y5IB 5DRKA 2AMCB 1L3VA 3LANA 5KT3A 2GIQA 2XS7A 2CQ4A 1NK6A 1REVA 1FX4A 2DEIA 3UDVA 3HD2A 1RLDA 1NNDA 4LSNA 3KK1B 4CIOA 4OX9J 1RB0A 3CJKA 1TKTA 3NS7B 4F26A 2J0XA 4ERDA 4QW8A 3DHXA 3O5TB 1BD6A 2X1AA 1C1CB 3DOMB 3K8VA 3OD2A 4C0OC 2XB2D 3IWNC 2UXBF 4KHPF 1BC6A 2R3VA 4LR9A 5HANA 4IFYB 1IBKJ 2VA3A 2VUGA 2DNGA 2UXBJ 5HMWA 3D5MA 1A0OB 2MLYA 5GAEI 2XC9A 3MURP 1G4CA 1NH7A 4ETXA 2RRAA 1YRXA 3QRRA 2E1MC 1B7YB 1XNQJ 2VH7A 5IM0A 5HVHA 1FD8A 1DTTB 2B7BB 2FHKA 4J90A 1S1TB 1HNWJ 1YJUA 2R9LA 3M6XA 3KK2A 2V2ZA 4WJBA 5HJYA 4OMFG 4B3SJ 4YUDA 2H65B 4DV0J 2DY9A 2HBZB 3BGOP 3G8QA 4G1QA 5CD4H 2EXUA 4EO6A 2AYBA 4DUYJ 2AW0A 1K47A 3CJ0A 4ZLPA 3E8OA 2E5IA 3G6ES 3CMES 3EX7B 4TU9A 1T9YA 3ZZTA 1UETA 5GMEA 2HNDB 3AB4B 2LP4A 3GTYX 2JEJA 5KG6A 4CH0S 4DSEA 4DQPA 3IWLA 4M8LA 3TQEA 4LFAF 5EN1A 3N6LA 3PRDA 2J8SA 3RR8A 2B4PA 3EWGA 3CCJS 2D74B 3O44A 4WU2A 1HL6A 4ES1A 4JV2A 3T1HF 1B99A 1RTDB 3N5BA 2HWHA 3Q86A 3QAEA 3RJMB 1CC7A 4YDXA 3TA2A 4LF7J 2ZUAA 1HPZB 4ZN3A 3Q8PB 5ETLA 1T11A 2GMJA 2HVEA 2LU2A 2MQMA 2P2CB 3RYLA 2RU3A 1VMBA 4ED6A 2RS2A 2WSFC 4B3TJ 1RWNB 2EC2A 3FZ2A 4F3OA 4OI4A 5LMUF 4LVNP 4IUFA 5DQGA 4PXCA 1OJ4A 5CABA 4ELTA 5BYRA 4NLYA 1AUSL 1IN0A 1WC1A 4ED5A 3BDEA 2VDHA 5IWAJ 1YLXA 3IAM9 5HLFA 3MMCA 3OTBA 5K20B 2M3DA 2HHQA 2MPUA 4HACB 2BJ7A 1Z1ZA 2EI5A 5KT5A 1K8AT 3B78A 3MEDA 4U67Q 4CWBA 2FJWA 4IFVB 1RI7A 2JHEA 4HHUA 4I6WA 3QFWA 3KLEA 4P74A 3NLCA 3FDSA 3QZ7A 2VICA 4NMLA 3MR7A 4WXOA 3GV7B 4V19J 2BKOA 3TVYA 2QYCA 2PDAA 3FZBA 4ZLNA 5HQMA 3HHLD 1K0TA 4IH6A 4FN5A 2HGLA 4OYIA 3S7RA 4EBDA 5GAHI 4ZPDA 4KGMA 3IGVA 2GMLA 4ECVA 4KV8A 5HVFA 1CULB 3DI6B 3A8EA 2I38A 3GIMA 2WTFA 3G86A 1SV5A 1I51B 2YWEA 4OYPA 2O67A 4B3RF 1T9XA 3V2UC 5IM0B 5F8JA 1HBUB 3GZ7A 3AD7C 3OR1A 4DV1F 3PYFA 2QTWA 2HQIA 3HZGA 3SQGA 4AXIA 3CPWR 5GMKa 1UA0A 4OHWA 2BOPA 2OPPA 1NDCA 2BM1A 5I42B 1BQXA 1GX5A 1ZAWA 4OX6A 4WK1A 1WTFA 2U1AA 2DNZA 4DR6J 1K44A 5J1EB 1S6PB 4J9NA 1HNZF 4RW9A 3NCPA 1IUJA 2YNIB 2HG4A 2KRRA 4N8OA 4YDDB 1X4EA 3HHKA 3CCES 5JVHQ 4ZVQB 3UD3P 4AFFA 3BYPA 3CJKB 1GAOA 2X3DA 4DR3F 4AE5A 2XHWA 5L46A 2WBMA 1NUEA 3RB4A 1Q4RA 2FLLA 3H2VE 1S1WB 3BGRB 2DKOB 3G2XA 4ID5B 3TUIC 1S1WA 2F65A 2ZE2A 2HGNA 5E7OB 3PRBA 4RNFA 2R7QA 5E2QA 5L39A 4DR5F 3PEHA 5J1PA 2VG5A 1HNXJ 4FF2A 2D69A 5G4DA 3BREA 2DYAA 2HW3A 1NM2A 2VFUA 4PWUA 4TQRA 4O3QA 4EFAC 4P71A 2M52A 1S57A 3OW2R 1PGZA 3GR0A 3H5YA 4OV1A 3JYTA 3KG4A 4KAIA 2GHWA 5GMDA 2M8DB 3RR7A 1LW2A 3NOGA 3QT6A 1TVRA 1Q7LB 4D3HA 3UN5A 5CYMA 4BC7A 1QAXA 2IM2A 2PMHA 3H2LA 3W2VB 3JAMY 5C5JA 1U6ZA 5HROA 2I1RA 2DH9A 3T19A 3K5OA 5GAGU 3MAHA 1SQGA 3RTVA 3BPSP 3PV8A 3DU5A 2GQCA 3BSOA 2BQUA 1JNRB 1Q5VA 4LR7A 1HBMA 4OYZA 4URQU 4AQYJ 4KYZA 3EZ5A 3M8YA 3UE2A 2HBQB 1M1HA 4C3LA 4ECSA 1WKKA 4J91A 2B51A 2W4PA 1XQIA 4M5GA 4ZPCA 3VV2B 1MWQA 4PWWA 3BM7A 5H9EJ 2LKZA 2E5LJ 1PKUA 2B3TB 2K2PA 2D3ZA 5SUHA 3VGTA 1RAGB 3SI8A 3AJ1A 3FBFA 1IKYA 1NH8A 2OEKA 3A1YG 2XHCA 4Y2MA 3N01A 4IRDA 1JJCB 1ZBTA 4R5PA 3GMGA 5I3PA 3GFYA 3O8WA 3OL8A 1U1MA 4OI0A 1NXIA 4ES3A 1RWOB 1RT3A 1U09A 1PO6A 2HURA 3PX6A 1DRZA 4A8QA 3BQ0A 4OYMA 1O51A 2ZITA 4M5JA 3LAMA 5FLXY 1JNZB 4YB7A 4ECWA 4LR8A 2IA6A 4Y34A 1HNIA 5J2QA 1N0VC 2CZ9A 1RK8A 3H40A 3ZO7A 1R7IA 4P73A 1C2PA 1NDKA 2MDAA 1M5OC 2HWIA 1L5UA 2CPDA 1YSJA 4DU7A 2DITA 2E9TA 1G7CB 2DHXA 2GO9A 1SIWB 4NZ0A 3B6BA 2OHDA 3C8YA 2B5JB 3HHDA 3L3CA 1NBEB 4AT1B 1RSCA 4RNMA 3JQKA 2E7XA 2J6TA 4B3SF 3DRRB 1Y10A 2F63A 2R8IA 1FJCA 1ZTWA 3J7YI 2Q6BA 4GVBB 2DPIA 4IOBA 1XMBA 4OYBA 4OI1A 3ZXWA 1HNVB 1HA1A 3M05A 4OX8A 5KFAA 1VQ5S 1N33F 2JEGA 2HNDA 3M8ZA 3ZZZA 4ZVGA 1WEXA 2C2NA 1RA7A 3A8IA 1IBMF 2FLOA 1CC8A 2ZH8A 4F2RA 1WC0A 1TKXA 4ECQA 1NB2A 2YKNA 1R0BG 5F9NA 4K4TA 2F9DA 2E7VA 4LSZB 2IY5B 1RT1B 4L76A 2F8HA 2R7WA 2VU5A 1S1TA 1VRTA 2GVDB 3BB5A 2ZJRQ 1JLAB 2BW7A 4RBUA 5LOQA 1WDTA 1WACA 2VHGA 2K8GA 1FK9B 2RS8A 3TX8A 4YR2A 2K3IA 4ITSA 4NA3A 4YOEA 2CQ1A 1FRHA 2CPFA 2A6MA 2ATLA 3QRQA 1AW0A 3IBWA 2X1BA 3OTOF 2UVRA 3PFOA 4Y6IA 2V2QA 4DFJA 2EC0A 3DXBA 4R25A 1DLOA 2ZJQQ 1OWXA 4LBIA 3BDPA 5EGYA 3HHLA 1EARA 3M9NB 1HPZA 2FJDB 2ROEA 2BEFA 4NLWA 4DSJA 2VFVA 3X3UA 4E0DA 2Z0GA 2EEYA 2VG7B 3CMQA 3IR7B 2E1PA 4CYUB 1TTHB 5F0WA 2GCFA 1ZZFA 4LF1A 2DHHA 1NKBA 5ADZA 4C2MA 5IWAF 1RISA 3S1TA 3ZZ0A 1RCXB 3THVA 5A76A 5GVQA 2DRDA 2MJNA 1HKAA 4N77A 2BZ2A 3CO9A 3P45B 4O0IA 1DLOB 1MU2A 1RTIA 2L41A 2BJ3A 4OYOA 3GG0A 4H4OB 4RUAA 3CMAS 3R97A 4K4WA 2DISA 4QPTA 4ZP9A 1PJ7A 5A6PA 3I56S 3DRSB 3FSIA 2CPZA 4CT8A 1AT1B 1H3DA 2MYFA 4Y65A 1S0VA 4O4GA 1VLYA 3I55S 2YXLA 2QGFB 4U7CA 4G65A 1S1UA 3T1AA 1WI6A 2DO0A 1WEZA 3EVWA 3OTCA 1LK7A 3H90A 2IJNA 4XDDA 4WE1B 1RQ0A 4A8MP 1K1QA 3EVMA 1UWBA 4IG0B 3IA0A 2UVVA 3VHQA 3H5SA 1H7XA 1TKXB 1FK9A 3H2UB 1U45A 3KG1A 5HROB 3DOLA 3QO9A 4KO0A 2AEJA 4DV2F 4DPXA 2HK2A 1CSJA 3KK3A 1EKSA 4DUTA 2CQGA 2AX0A 5A6WA 4C0BA 3R5BA 5C7PA 4URGA 1HD0A 3T9NA 4Q5VA 1RT1A 3PIOQ 3N6MA 4JI7J 5IFMA 2XCAA 2V5HG 4PCQA 4GVBA 3TOQA 2JLGA 4JI6J 1YBAA 1NK0A 3WX8A 3JSMA 3S8SA 1RU1A 1HNZJ 1KVIA 1UL3A 1UPMB 2AV5A 1U24A 2GJFA 2WCXA 4IDKB 4WP3A 1VBZA 1OQ6A 2CA9A 4EU0A 1UVNA 3AD8C 3P96A 4HDGA 1GQEA 3WHIA 1C1BB 4HH1A 4ZVRB 4C8YA 1VR6A 1S59A 2B9WA 2RHSB 1RU2A 2XTJP 3MM6A 1ACMB 1BUXA 1GXUA 2DGVA 1MMNA 2RD5C 2YWGA 4GRSA 4HI2A 2W2PP 1Y5NB 2HVDA 2KN4A 4ETZA 3QMQA 1Q7YT 2CPHA 2UXCF 1KBRA 5ETVA 4F04B 4M94A 4LUBA 4RUCA 2FGOA 2GV1A 2IMWP 3MHYA 1YBTA 1F9FA 2OMOA 3QZ8A 2NSBA 4MAKA 1RT3B 3PM9A 4NLUA 4GC6A 1VRQC 1AFIA 1LW0B 4S0MA 1UEKA 1DARA 3D3BJ 3LGHA 3LA0A 1IKYB 1I6JA 1FDAA 3I31A 5RUBA 1SIZA 3RGIA 1UP1A 4DL7A 4RW6B 1G3OA 4IG0A 3I87A 3GCXP 4WE1A 3ITHB 2PGCA 3TX0A 4DMZA 5KFIA 3MUVP 3CJ4A 3EPIA 2AGPA 1RHMB 2XLIA 1URRA 2YNFA 2I2YA 1X4DA 3GPAA 4JV5F 1OIAA 5DG9A 2DY1A 3Q8SB 1TZ0A 3N6NA 5HN0A 2YPZA 2ZOGA 3EJMA 3MXHP 2KZZA 2ZKUA 1J2VA 1P27B 2COLA 2NZCA 2HQ3A 5ETOA 4IOCQ 3H42A 4ELUA 4ZPWR 5AXNA 1T3NA 1ZOTA 4QWCA 5MAOA 2OTLS 2EFNA 1FT8A 4RBVA 3QSIA 4U8VA 1JIHA 3OFHA 1ZM2A 3Q89A 4NRTA 5KG2A 1S9EA 4AUKA 2IHR1 3QT5A 5AE1A 3GWCA 4JYAJ 3MEGA 3GG1A 1ZA2B 3MTJA 4P7VA 3HF5A 5L1LA 5DM7Q 3D6HB 4O0NA 1I94F 2UU9J 2JVOA 2UVUA 1UWAA 4MKAA 1YVFA 4M1KA 4DX6A 5IOLA 4DSLA 2GA7A 3Q2SC 3D1HA 3K5LA 4JI3J 3TZXA 5AJ3F 2XSFA 3IR5B 4MYUA 5FIIA 1FJGF 1EP4A 1SUQA 4J9OA 4CLZA 2FY8A 4C0HA 2YNIA 1Q5YA 1QUPA 3CW2C 5KFKA 2KT5A 3NMAA 4ID5A 4JP8A 3JB9k 2E9ZA 3LAKA 1M0SA 3OR2A 3WX4A 2AIRB 1TP7A 5CH7B 5DQIA 3C19A 4LRAA 4DHVA 3SQGB 1U49A 2MKHA 4PYAA 1UVJA 2MQNA 1KDNA 2GIRA 1IBKF 1PYSB 2OPQA 3FVYA 4QZVB 4ZMMA 2QEXS 2XSJB 1WWHA 4NCGA 2BJ8A 4BHQA 4HEA9 3W7BA 2YKNB 1Q16B 8RUCA 2I8EA 2KT3A 2QN6B 1Y11A 1EAYC 2C2EA 3QSYB 4OZ5A 1D3WA 2Z4PA 3K8WA 2J9CA 4HDHA 1N34J 4MK8A 4OL8A 1WF1A 1JKHB 4KV8B 5BJRA 2R2SA 3ILJA 4CLUA 3DLEA 1KLNA 3OTEA 4ZCLA 3LALA 3D1OA 1YZ6A 2KVIA 2LYVA 4ICLA 4IQMA 4DR6F 4CM2A 1SJ4P 3C14A 1RWWB 3KUHA 2UV8A 3RG6A 1TKTB 4RW7B 2CQBA 3KK1A 4NLGA 1FEHA 5K5MA 1R8BA 3TRGA 3VCDA 3W64A 4ZLLA 1FRXA 1Y5LB 2J0WA 2XEXA 3GYGA 3JQJA 2V67A 3SYZA 4XDCA 3A13A 4ECXA 3AQOA 1SC4B 3M8RA 2EK1A 2VQEJ 2ZNYA 4NZ6A 1B0PA 2PMWA 5GAHU 3GE9A 3GR1A 5MLCV 1WJ9A 1Q8LA 2P6SA 3MCNA 2VPWB 5HK4A 3DOKA 4QIGA 5D4OA 4DDFA 4ECRA 3QGHA 2X1GA 4DL3A 1RAIB 3EZUA 1QLNA 1FRKA 2CPYA 1VHIA 2YTCA 3DDNA 4PXBA 1ITPA 2B4VA 1MROB 1RT4B 1WKLA 3CIMA 4C8LA 1T9UA 2JFDA 3EXCX 1H73A 2CNKB 2HMIB 3QGIA 2NQPA 4ECYA 2W2QP 1X9MA 1P9QC 3R6LB 1RE1B 3ELHA 4ED0A 2J7WA 4TLRA 2HK3A 3D54A 5KG7A 5IT0A 3SCIE 4ZITA 1N5YB 4RKUC 3LO3A 5AJ3J 3PW7A 2J0QD 1TV6B 4DZDA 4DR4J 1QVFR 1D0EA 3AD9C 3OBIA 3DYAB 1HLWA 3Q8UA 4K5SA 4QIWD 3MFHA 4C9DA 2H54B 3M6VA 2PC6A 3W60A 5E3CA 3BN4A 4UQGA 3KHGA 5FD1A 5LMUJ 1JLEA 1UZDA 3L7UA 2B4UA 1O5JA 3W2VA 3H4DA 4M5IA 3KLGA 1VLOA 4BBYA 4YMEA 4C8NA 4YY3F 2CPEA 3W66A 4OHYA 4RNHA 1F6TA 2F4VF 4LFBF 2LEBA 3OSPA 5J2NA 2LU1A 4X62J 4MFBA 2W7OA 2FJBB 2P9CA 5KFSA 4ILMA 4USUA 3HVAA 2RKIA 1YHQS 3LP2A 3J81Y 1VS3A 1O6XA 4X4RA 2KVQE 2A2CA 4X4PA 1RHQB 3ENVA 5M2UA 2EK6A 4PUOA 2XWXA 4HL9A 4C7QA 3L4BC 2PSZA 1EJ7L 4KE5A 5E5NA 3MEEA 4ZVEA 1U1NA 1T8EA 3IG1B 1H38A 2MMYA 4M5MA 4TQSA 3DLJA 4DUYF 1XMOJ 4A8WA 5DDPC 1R6VA 4AD6A 2IM1A 3CO0P 4QBUA 1Q1KA 2GX8A 1S99A 1R0CB 2C1EB 2H5EA 3SZ2A 1TU0B 1VISA 1HNWF 2Y1LB 2FY1A 2AT1B 5J2MA 2VQFJ 5EX0A 5KFHA 2DTJA 4B9MA 2DRAA 3NKYA 5ETKA 1N36J 3IS9B 1N33J 1SC6A 4QU6A 2DNLA 3SCJE 3W5YA 3J7Z5 3FFIA 5T41A 2MZQA 3MAAB 1S6OA 1U0HB 2HHHF 1RTHB 3BV8A 3G71S 5KFYA 3N28A 5HMYA 2UUAJ 3MCSA 2CPJA 1S1VA 5KT4A 4F4ZA 4X2BA 3TZWA 1FHTA 3O6QA 2XMUA 4OJ1A 2OAUA 1SJQA 2JNJA 2L9NA 5KFRA 2F3JA 4UY85 5KFBA 1TL1A 2OEMA 1VQOS 1Y3KA 1WHYA 3D68A 3JTNA 3M2RA 3QQCD 4YN3B 1RAAB 2DEJA 5HBMA 4ANCA 5B09A 1XWLA 4OZLA 2ZD1B 3T1YF 2ALZA 2PI4A 3J81U 4ECZA 2B4OA 2EKYA 1T7PA 1YRUA 2CDQA 4LQ9A 1QVGR 3QIDA 2EG2A 1JLGB 2J9EA 1RWPB 1KLMA 4CRJA 2CJKA 3KLIA 3TAQA 4KIAA 3NG8A 2HAFA 4J7CA 1F9EB 5HLFB 2QLJB 3SFGA 5H1SV 3TWZA 3K5NA 4DV2J 1S77D 2UZAA 2R7RA 3CTRA 3IBFB 4DXLA 4YEAA 1HD1A 1HARA 2A0FB 2OELA 2UUCJ 3MAAA 5CYJA 2W4DA 1KNZA 1LW0A 2K1RA 3M6UA 3NGKA 3SV4A 1H2UX 2RE1A 1UJ6A 1HFEL 2ACYA 3RBEA 3I96A 4RO0A 4B9VA 4WFXA 2F8MA 2VJVA 3A4TA 1VQKS 3TNVA 3DLLQ 2GMHA 2QLBB 2BJEA 5GAGI 2V9WA 2HIYA 4N41A 3KJQB 5D0GA 1CJTB 3SEOA 1J5EF 1NZ8A 3NCRA 2KH9A 1N52B 3TUZC 1W25A 3FSYA 1TUGB 2DXDA 2X3GA 3IRWP 4EZ9A 3IN5A 4QOTA 1HBNA 4DPYA 1AZSB 1GXLA 1TFWA 2FQQB 1RAFB 4ZLJA 2Y8WA 1YDLA 3NGTA 1YX2A 3MTKA 9ATCB 3P6YC 1WC4A 4G1QB 5HMZA 3ENAA 1V5VA 3KWMA 4F4KA 5KG3A 3BSAA 2ZWOA 1FTCA 2E1CA 2CQCA 2Y1IA 1SJ1A 1DTTA 1QUVA 5E41A 3KK3B 4HT7A 3OR1B 4NLPA 4Q44A 2EW9A 1VHFA 3BS9A 5F0UA 2LXFA 4K4SA 3OXFA 4I0WA 3AOCA 4H4KC 4YR0A 3GILA 3TI0A 3M2UA 2BW2A 3E01A 3TAMA 1WC5A 3CD5A 3UDCA 4FF4A 3GLJA 3O1LA 3GB0A 5AXKA 4WTOB 1GEHA 2R4FA 5K14A 3WDOA 2XMTA 1LFPA 5F9LA 2EFOA 1Y0HA 2V8DA 1FWLA 1X9WA 3M8QB 4OZ3A 4NRUA 4H4OA 3K7RA 5T7LA 3T3FA 4Q8EA 2GAHC 2YKAA 2GS8A 2PFFB 3MPWA 3N5FA 3ZTQA 2GVZA 5DDQC 1ROFA 1DFDA 3W1YC 2DNKA 4UQTA 1D9FA 1P9YA 3DRPA 4I56A 2IVYA 4OIXA 3DXSX 4OJGA 1TL3B 3FEXB 5IXUA 1JXLA 3I9ZA 1N5QA 4RUBA 3OPKA 2ZH7A 2EWHA 3TUPA 2CJXB 2FIUA 1NK7A 1SBRA 3OVSA 2W9CA 3SCLE 2KU7A 3CCQS 4NXMJ 1BQNA 1NSAA 4BC9A 5DLGA 3D2WA 2ZH3A 1BWVA 3TJAA 1RABB 2ASDA 1FDDA 5K8NA 1GX6A 2R42A 3G82B 4Z37A 2FLNA 4BDPA 3MWBA 1RTDA 2ACMA 4O44A 1CJKB 4DL5A 1YITS 1L3UA 4HLBA 5C24A 2GHVC 4Q43A 1KOHA 4P6QA 3ILIA 2IM0A 2WOMA 2N3LA 4UZCA 2M8HA 3JAMU 3DLEB 1Q8BA 2GQQA 4USHA 1I94J 3H20A 4ZP7A 2X51A 3PHEA 4FF1A 1C0TA 1E6VA 4P75A 4WFBQ 1S0NA 1AYEA 1T05A 4JI2F 5DG8A 4GKJF 5KFJA 2OPRB 3FC9A 3G8SA 1T94A 1KHWA 2HHVA 1J5OA 1RT7B 3A3NB 2ZUGA 5DS7A 1HQEA 1S12A 2RDDA 4YY3J 1CQNA 2CNLB 2XLKA 2M5YA 2UUCF 2RQCA 4PWDB 1AFJA 2DD8S 2CG4A 3A3OB 1TKZB 5KT2A 3ZTRA 2UP1A 3GU0A 1NHVA 2XSJA 4DPUA 1FNXH 1XR7A 4O23A 1U1QA 2R2UA 2VC0A 1O0PA 4QR2A 1JLFA 5L8RC 2R8GA 2XQCA 5KFCA 1X60A 2AKWB 3OV7A 4B17A 1M5HA 5D6GA 3M2VB 3FUYA 2R2RA 1R3NA 3QJPA 2VASA 2BANB 2PEHA 2Q79A 3H98A 1TMMA 2HPUA 3HX9A 5FLXU 1GK8A 1ZZNA 1Y00A 3NGUA 3K5MA 3ICLA 1IBCB 3LW5C 1QJHA 2XYGB 2W2OP 2ZM6J 3U02A 2MKKA 2LQ8A 3I4HX 2GIFA 2Y1RI 3C2PA 5DM6Q 1J27A 5E0OA 2FLPA 3ZTPA 2DH7A 4LSNB 3DLKA 2DR7A 5K8MA 4NYZA 1T3OA 3M1VB 2L48A 3JQMA 4I67A 1S48A 4ZCKA 2WB1D 2DNQA 3GQCA 4CO4A 4NCBA 3NNAA 5C2CA 2AJFE 3EGNA 4C8OA 4Q45A 4NPOA 2XO6A 3CJ3A 2FHOB 1Q82T 3CD0A 1IKWA 3HKWA 4KR0B 3B4MA 3KDNA 1RUSA 4TYBA 1Y3JA 3F0NA 5CAAA 2NYIA 2O5DA 2OPSA 2HSEB 4F0HA 4M5DB 1U2CA 3POTB 4JOUA 1IQZA 1RTJA 3V81A 1AXQA 2G2YA 4NEZA 3FCWA 2CWKA 2OD6A 5IQQA 4RL1A 1XNRJ 2PO4A 1D09B 2ROPA 4OLOA 4DN0A 1XMQF 3D67A 1VC6A 1NJXA 5ETQA 2VFSA 3U1LA 3QBCA 4OYWA 4DUZJ 1VOMA 1RAEB 5ETPA 1U6BA 1N32J 3BEGB 2HVHA 4USWA 4ED4A 3MPUB 4K4ZA 4MIWA 2W8KA 4FBUA 3VF0B 3UR0A 2GGPB 1IKVB 1F60B 5B7WA 3OQ2A 4PG6A 1RT6A 4QWAA 1CS4A 3FQKA 4TY8A 1PSDA 2IM3A 3SDEB 5F8LA 2AQ4A 1S9FA 5J2PB 1YG0A 1UAWA 3R1HA 3R27A 4B3RJ 1MWYA 4P10A 4KSEB 4ZK7M 4B02A 3AY0A 3QT7A 2XYPB 3DGPA 3KFWX 2XULA 3GIIA 1N6QA 1WHVA 3QATA 3RRHA 1KQSR 2A6OA 2W9BB 1RADB 5CZVA 4URSA 2XZWA 2QG9B 2BYCA 1S72S 4RW8B 5DZ7A 5FDLA 1PC4A 5DG7A 3I0SA 3NS6A 4WYWA 5EUHA 3VWSA 1C0UA 4DG1B 2HQFA 2QE5A 3T5LA 3CDWA 1T95A 2Q3PA 2C3UA 3IAS9 5D0RA 4WKYA 1NK8A 2ZE2B 2VBZA 1T03B 3T5JA 1WD6A 4LBPA 4O3SA 1R27B 5KFXA 4FPRA 1FO1A 4WYLA 5C25A 3LPYA 4JI3F 3MD1A 4ZOSA 2AEMA 2CNOB 3KHRA 1LFWA 4DU8A 3T41A 3RB3A 1SC1B 4L74A 2DR9A 2UU9F 4DV4J 3HVTA 4DQRA 2MZSA 4K4UA 3PCOB 1YJ7A 5DQHA 4J9MA 2RQKA 2V94A 2W1BA 2XMMA 1I1GA 2OPPB 3KTQA 2RRNA 2W2NP 2XMWA 3VTIA 4Q0BB 3H5XA 3BZQA 2MZRA 3DU6A 1F3VA 3QO9B 3DOLB 2NSCA 4PABA 1WG1A 2APOA 3H7HB 3ZFVA 3UO0A 2WVFA 5FJ4A 1FRMA 3PW5A 2JDJA 1RHJB 2YX4A 3MM5A 3NGSA 5EDWA 4F7VA 1KQKA 1UFWA 1ZPWX 3BKUA 1XR5A 2FHJD 3GP9A 3IC1A 3L9ZA 5C42B 3P49B 3FK4A 1NCLA 2KJWA 5KFQA 1IJEB 4EWTA 3NWRA 4ED7A 5H9EK 1R0AB 1Q0NA 4ZVSB 3RUBL 3V6DA 5KFDA 1VBXA 1UVLA 4WIQA 3CWJA 3CCSS 3BBCA 1FERA 1N34F 1N0UA 4M5LA 1X4FA 2BE7D 1EKRA 4DL2A 1SQEA 2Y0SD 5LM7E 1YIJS 1EIYB 4USIA 4W92B 4CO2A 3B82A 4LF9J 4CYUA 1WOSA 1RT7A 1XERA 2E7WA 1QTNB 2UUWA 4IG3A 2BA9A 2ZH9A 4X4UA 1RBAA 3AJ2A 2I9SA 3K5PA 4OZ1A 4QIVA 3G6YA 3CUNA 4OHVA 1H72C 4NI2B 5KFOA 3MECA 2C3PA 3HZEA 1VQ9S 3W9HA 3HK2A 1BE4A 3OL6A 1RWKB 5ETRA 4RUHA 1RDRA 2F1FA 3HJVA 5G0RA 4OJ3A 4B3OA 2VJUA 4DS4A 2M0GB 3PKYA 2Q43A 2YY3A 5A8WA 4K0KF 1RWMB 3RZAA 2G2ZA 2HFVA 4DX5A 1LWFB 3NS5A 4NLSA 4LF4J 2X1FA 3DMJA 4G6VB 1ICEB 1X5OA 1PG5B 2PE8A 4J37A 3BO4A 2CRLA 4KHMA 2BJ9A 4TU8A 2V34A 3EICA 3CGIA 1V9OA 1FKPA 5A8RA 2RRBA 2QJ3A 5K8OA 1NB7A 1YJNS 3UW1A 2VONA 1GFWB 1TMJA 4Y28C 5D4NA 3BO2A 2M9KA 4Y2KA 2HFUA 4OZ0A 4KKOA 1VQ7S 3BF4A 2O1PA 3HHNB 1NZAA 2B43A 1VGYA 1L3TA 1OY6A 1HBOB 3O2IA 4QW9A 3M8QA 3B4DA 5BR8F 3FRYA 3SXLA 1FEEA 2PA8D 4ZKAA 4MH8A 3UN3A 3JTPA 4GKJJ 4J9RA 4J9QA 1PJ6A 1UFKA 2MKSA 4HHJA 4J9SA 1MLAA 3F73A 1QSYA 3LTOA 5JMNA 5IV3A 1WDDA 3MUMP 4ECTA 3ZZRA 1FRIA 1FESA 1F2GA 4AYBD 2CQDA 2DXEA 4KFBB 2ZC3A 3N9UC 4UF4A 4WPAA 1P1LA 3NL0A 2DGQA 1KTVA 3G96A 4DL6A 1S97A 2A1BA 3CCUS 2LQ5A 5A8KB 4X65F 2OMLA 2Z56B 4FKYA 1OPZA 2HWTA 4KH1B 2BDPA 2VFRA 3DLGB 3C15A 2G0JA 1YWXA 2QMXA 4P52A 1UA1A 1QD1A 1T9WA 2ZHBA 4F3QA 1F5AA 4FYDA 2XWYA 2ZBPA 4BWJA 3BSCA 2ADBA 3ZZOA 1UW4A 3WZ0A 2CZ4A 1S76D 2IBKA 4CLKA 2HQGA 2OI2A 1N36F 1CEZA 2G2OA 2FVRA 1BWEA 4X4NA 2CYYA 2NZ4A 3D7SB 4GC7A 3JSBA 3J80U 3NY0A 3MPVA 2RF2B 2BRLA 4MKVA 4FXDA 3EMTA 1YRTA 2VKZG 3MR6A 2RIJA 3QAUA 3C6UA 2JLEA 4YS2A 2KTQA 3C16B 4IH7A 4CT9A 3Q23A 1YGYA 4CDIA 3R7SB 5E33A 1BLUA 2H5JB 3FKBA 3TP2A 4KY3A 5KT7A 3CXCR 5HP1A 1RBLA 1SH3A 5KAKA 2NXJA 3ET6B 1DTQB 3BR9A 1C4CA 3L95X 4QU7A 4P9SA 1NKCA 1N54B 2G13A 2NS1B 2C2KB 2ZHAA 3F41A 4A8FA 1HYSB 5IZHA 2C22A 2HGMA 4NLTA 2V8PA 4KTQA 3KJVA 4HI1A 2MZ1A 3MR2A 3R6GB 2VPXB 2D41A 2QV6A 3MZIA 4J9KA 1KQFB 2ZH5A 3QNWB 4X64J 1WHXA 4E2FB 2IFXA 2RU9A 3OFEA 2MQPA 5HATA 4XAKA 1LW2B 2CQPA 3KG0A 1BXNA 1NSPA 2ZH2A 2C2OB 1BY9A 4N8NA 1XIQA 2OIHA 3PO5A 1F1BB 3DM2B 1NK5A 2LQBA 1HR0F 1KEKA 5L1KA 5KFVA 4JI4F 3D6TB 2E5GA 5H9FJ 1NPPA 2AZ1A 4DFPA 4JI0F 3W8GA 2W25A 3MMJA 3U7JA 2BQRA 4NXNJ 3BSNA 1SJFA 3TZYA 2HHSA 3POTA 2N4CA 2XM3A 4OZNA 1EHWA 3V4IA 3P5BP 5KFWA 1QSSA 4QR1A 4X4QA 2LQJA 3QLHB 2YKPA 1N5TA 4ED1A 4N47A 2DHSA 3MMBA 2FVQA 1S1XA 2QL5B 3GJQB 3Q8VA 2YNGB 1CJUB 1RXOB 1RZMA 1VJQA 1IM4A 3I5AA 4LF5F 1QE1A 2M88A 4DF8A 3W9IA 3MOZA 2I6WA 4L72B 4R8UB 4OYXA 3SSRA 3G4SS 2NREA 1ZH5A 1APSA 3U27A 3TR5A 4ZHRA 1K73T 2N4DA 4F4XA 5JJBA 2B0GA 2RH3A 1MMDA 1UW9A 1VK8A 3HDSA 4ZP6A 3RU0A 1Q53A 3CJTA 4CO1A 3HM9A 4C8ZA 2F5GA 3FMBA 4H4MB 3MUTP 3QLHA 1RAHB 3DI6A 2KO1A 4KJIA 2FZCB 3GIKA 3C6TB 4E98A 2YKMB 3TA0A 3CT9A 4JI1F 4JV5J 3SFUA 2D3OR 1Y9OA 4U96A 2IC3A 3M2VA 4CNZA 5CA5A 1SH2A 1VRUA 2P8IA 1ZTTA 2RT3A 2XMJA 3NGDA 5DGBA 2IYIA 4FXVA 1GT8A 4BWMA 3BR8A 3BPDA 5KFLA 1YI2S 2HLUA 4ZJQA 2V4QA 4KKOB 2ZNZA 2ZVSA 4DV5F 1AROP 2ASJA 2MQ8A 1CLFA 3JXOA 4DL0C 3PX4A 4MMOA 3OFGA 4PPZA 4MFBB 3VAMA 4PWDA 4PG4A 5I3UA 3LPEA 3NWGA 4RPFA 2IRUA 5D15A 5CCMA 3VAGA 2AGQA 4J5OA 5C2GA 2NR0A 2RNEA 2ZH6A 2KXNB 4EYHB 4I7FB 2FDNA 5K8PA 2UUAF 3HT3A 5A0YA 2RUGA 4YHHF 2J6SA 2PN6A 1JB0C 5D8HB 1Z2LA 4J9PA 3ZTOA 2YNHB 1OMSA 2FC8A 1URNA 1Q86T 3UVJA 2J7KA 4DR1F 2B7CB 3O3LA 3QJLA 2WOMB 2O3DA 4B9TA 1KFDA 5LJ3Y 3EVOA 4ANDA 1U47A 2KKHA 1ZM9A 2I0XA 2HS0A 2YPYA 3T6BA 1FE0A 4XK8C 2H4WB 4LBHA 3W8PA 4LF9F 3NAIA 5G0RB 2H1YA 4DJBA 2W2MP 3MM8B 1HI1A 1MN7A 2HVZA 5D3GB 2ZBQA 4ZIVA 2LEAA 4EBEA 1NJZA 1DQ8A 3AT1B 2JEFA 5HMXA 1KKHA 4M5HA 2KXHA 2A10A 6FD1A 1B3TA 3TW0A 4I2QB 2KFNA 2FZGB 2MY7A 4PR6A 4JI7F 2OTJS 3LOUA 4UOFA 4C4WA 1IQTA 1BHNA 1HHSA 1WI8A 1G6BA 4H4KA 3DOKB 5BYQA 1Q81T 2QIFA 2BABA 3T5HA 2NPIA 4ES2A 2R7XA 2AF6A 3UWTA 3FCVA 1SVDA 1S9GB 1WUUA 4MT1A 2GVZB 2VBYA 4NMXA 4CLTA 1F2HA 4L3NA 2MQQA 3UCUP 1TL5A 1JLBB 3THPA 1HQUA 1JXVA 2IAJA 1YTYA 3PEJA 3VGVA 2DNHA 4DX8H 3MCOA 3KLVA 3BKFA 1KONA 5ETNA 1X4CA 2ZVIA 3MM9A 4ENOA 5CZXA 4ZPTR 4HKQA 4WCEQ 2ZZNA 4LMZA 1JLCA 1S6QB 3LP1B 3W63A 2QT7A 2E5LF 1C1CA 3DOMA 5A2QU 2DNOA 2GNKA 1U0SA 2IC3B 1HQUB 2MSSA 4ID8A 4NLVA 5KFMA 4LRCA 4DV3F 4F50A 3NMRA 1DAXA 1RTZA 3W62A 1IXKA 5AE2A 8ATCB 4XPEA 1REVB 1NSQA 1KC8T 2W01A 2WBRA 2W8LA 4R8UA 1X8DA 1VI7A 1QDUB 1MG7A 4LT6A 5GADI 5IC6B 3LUYA 4P7TA 4U9RA 4A8OA 2FJVA 2F40A 2DGWA 3M32B 3L7OA 1NKEA 1HHTP 3T5KA 4DV6J 2AX1A 1E6YA 2XI3A 3NRBA 3IFEA 1XJWB 4I6AA 4I2QA 4FPIA 4L3KA 3UN2A 4PG8A 3CCMS 1TQLA 2MQLA 3AXKA 4YR3A 3K58A 1VQ6S 4PPDA 4Q2MA 3ADAC 4NA2A 2AYEA 2IVMA 3NCQA 3GFZA 3GFHA 1NHKL 3QT8A 2YNGA 3PJ9A 4USJC 3IMQJ 4ILLA 5A8WB 3CSKA 4J9VA 4LF6F 1M90T 3MM7B 4QR0A 3OFFA 3BBBA 3NP5A 3V6HA 2ASLA 3QWUA 3N0VA 1GTHA 4IYQA 1RYRA 4FYVB 5LXYA 1M1KT 3HT0A 4JV1A 1N32F 2JRSA 1NAQA 2ROGA 2AYMA 3DKDA 3D6MB 2DGUA 2CQHA 2IJFA 2JL9A 3M30B 1H2TZ 5F8HA 1GTEA 3R5AA 4UOGA 2QA4G 1OY9A 1SH0A 3PYDA 4X4TA 1SXLA 3J81j 2KYXA 4G1PA 4I68A 3NXZA 1IBMJ 4C97A 2AWZA 3RAMA 4CI0B 2BUNA 3W3SA 3ZZYA 3CIZA 2DGSA 3TUJC 4JI5J 1GNKA 1B7FA 1DTQA 4W98A 1RLCL 1CJVA 1UJ4A 1OPIA 2RDJA 3G9CA 2WVBA 4QWEA 3Q24A 1HHQA 3GJSB 4FP9A 1KFSA 4I69A 2ATCB 1FNOA 1T9VA 1DQ9A 1KD1T 4RNOA 3TYTA 4DLGA 1FWKA 4TXSA 4ZDNA 2N7YA 2YKQA 2RF2A 3KMQA 4PQUA 7AT1B 1W2BR 1RT2A 4U8YA 3CF5Q 2PD1A 2WSEC 1RJJA 1FJ7A 3G87A 2NUHA 3MM7A 1LWXA 3R7BB 4I6YA 3TVZA 4IH5A 4MYTA 1IKXA 2XG8A 1CBKA 4MTPA 4ZVPB 3QRPA 4QYZJ 1TUWA 3CDEA 3ISND 2HVIA 2DNNA 1JLQA 1H6KX 3AA9A 3UI3A 1NEEA 2B9EA 1EETB 2FJAB 2EPIA 1YJTA 2ZHOA 4WBFA 2C2RA 4HT5A 4DEZA 1HWKA 2WVCA 3DLGA 3C15B 1GMUA 1DBDA 1E6YB 1OO0B 3HSGA 2BE2A 4K2JA 3K89A 3H4BA 1YJRA 3KLFA 2YWKA 5DETA 1GMVA 4I2PB 3HD1A 4LSLB 2V68A 4FS2A 4KFBA 3PZPA 2Y0BB 2DH8A 1WF0A 3GV5B 1NRKA 2VBXA 4F4AA 3CCLS 1TAUA 3BN7A 4Q8FA 3HKZD 3KUGA 4Q7AA 1JMTA 4UT4A 2BXJA 4EBCA 5F3ZA 2V69A 2N7CA 2OUGA 2QL9B 1U4BA 2V4JA 3I0SB 2B8PA 3V6KA 3HO1A 1X5TA 3FBBA 5AE3A 2VODA 1VJWA 3D3CJ 2OGUA 2Z57B 3PRVA 1D8YA 2V9KA 3HHLC 4KGZB 2HNYB 4IKAA 4A4JA 2YH0A 4CH7A 3TARA 2BKNA 1H2VZ 3MD3A 1N6QB 2HNZB 5THWA 2PMZD 1SCJB 1ZA1B 3MMAA 4CM0A 1JJ4A 2IAJB 2RHQB 2V8GA 3HVWA 4U95A 3BJYA 4NXNF 1D1UA 1V3SA 2N82B 3NNHA 1JQGA 5JUMA 4DR7J 5J1NA 1JLEB 3LH2S 1SL1A 2HLTA 1SL0A 5DGAA 3PR5B 2HRUA 1VQLS 2CJQA 2B6AB 3PDNA 1RWUA 1ZAXA 3MFIA 2R7TA 3VAFA 4TY9A 1L3SA 4NA1A 4CO0A 3HP6A 5LSLA 2E29A 4B9NA 4N5SA 1U1OA 4CP5A 3DN9A 2QRRA 1KRPA 3RW6A 1WG5A 6FDRA 2K7KA 3EGZA 2GO8A 4X64F 3LP0A 3QIPB 1Z4UA 1RTJB 2VG6A 2FUG9 3LP0B 3QIPA 1TELA 3E3XA 3KNGA 4HR2A 1C4AA 4USTA 3W5XA 2NLWA 1UVIA 2Z8QA 4PXDA 1XTZA 3KKFA 5CYQB 4J9LA 4EMDA 2YBVA 4DS5A 2AJ0A 1O8BA 2B6AA 1VIXA 1PAEX 1U1RA 4RNNA 4M63A 1TK8A 2AEFA 1OS5A 4MIAA 1X9SA 2JZ5A 4HH0A 3AAWB 4JI6F 4V1Ak 3U1NA 5B0CA 2KZMA 1JX4A 2JH3A 3CCVS 3UD4P 2FHJA 2QA1A 1B64A 3LWLA 3EDQB 2F8EX 3AOBA 1SPBP 1W2IA 1IJFB 4ILRA 4HTIA 4PQAA 2E44A 1YKWA 2J5AA 1CPZA 1SJ3P 2CKWA 2VOOA 2WONB 4P2MA 4RWXA 2O01C 2VL1A 2YKOA 4EYIB 3RB0A 2X7IA 6AT1B 4PZVA 2RB7A 4LIWA 1T02A 5B0BA 3CD7A 4ZCIA 4DV7J 3FBEA 5KTQA 4ZN1A 3C3LA 1WELA 2AJQA 1JLFB 3BKTA 5D0HA 5KOWA 4JUZA 3FNNA 3UCZP 1VRTB 2GVDA 2CZVC 1MWZA 3KOAA 2C3OA 2L9DA 4ZVUB 3SBMA 1R31A 1S7HA 3PJWA 3UFCX 1J5EJ 2WONA 4PYDA 4OQJA 2VF3A 4C3KA 4G1IA 3D4JA 2FVSA 4NCGB 1KOOA 4KB7A 3BH6B 2FGCA 3P4UB 4CH1A 2HHUA 1Q78A 2J76E 1R89A 2CQ2A 2CDRB 2GC8A 2D1CA 2KYZA 2DBBA 3E2EA 2W9AA 1H98A 4GO7X 1T05B 4QQBA 3G6XA 1WORA 3TO8A 4FYXB 3M8PA 3OR2B 1FX2A 4FXWA 1F0XA 4M5NA 4CO3A 4EUVA 3ISNC 5KFZA 2CUYA 4DR2J 3KNAA 1FF2A 1CJTA 3M4XA 3MF5A 2F7VA 1R43A 1MNEA 5D77A 4NEYA 2CPIA 1DZ5A 3CD6S 4JI5F 3MMBB 2B5JA 1FRLA 3RAXA 1OY8A 3M9MB 2AP6A 4CLYA 4N7TA 1RT2B 4KT0C 2ZC4A 1S10A 2HKEA 5IT9Y 2PFDA 2VG6B 2DHGA 2YQ1A 4TN2A 3WIUA 4Y2IA 4FS1A 1PIEA 2KXFA 1ZAVA 3KDOA 1HMVA 3PYEA 4NLDA 4Z7CA 2BQ3A 2DPJA 3DRXA 3H8YA 3IP0A 2J8AA 2R7VA 3VAHA 4IG3B 2BV3A 1NMEB 1VQYA 2DGOA 3IO1A 4X66J 5L9NA 4CLWA 2ZH4A 1LEOA 3MMAB 2RSQA 3MEKA 4KHRA 2JVRA 4IO9Q 5I3UB 4Y0FA 1RT6B 3PNIA 4UOHA 1FA0A 1VFJA 2AZ3A 2NXUA 2GGPA 3IBCB 5E3PA 4FDFA 4LF6J 4M95A 2VKRA 3V5RA 4RZRA 1YJWS 2ZBRA 2FTRA 4I1TA 4UUWA 2XMAA 1FTRA 1V5IB 4QIFA 1N56A 3RRGA 2NCKL 4WZMA 1R0AA 1LXNA 5CXTA 1YJVA 2OSQA 2WW8A 4DL4A 2DGXA 3PW2A 4D3GA 4C8KA 1N5SA 2IJRA 2HAIA 4DV6F 2E5JA 3ZZUA 2FD2A 3C6TA 4KQZA 4M5DA 3P5TL 5ITHA 2VQFF 5CD4A 4FVCA 1KVJA 1RAJA 3FJ2A 2ZDOA 3R5GA 1UVMA 2V4JB 2IIHA 1SKUB 4N56A 2J7UA 4DQSA 4QWBA 2DT9A 2EBEA 3IR6B 3OHAA 4I2PA 1NLKL 3TAPA 1M5PC 4DR7F 1FDBA 1G2EA 4NZ7A 3KLFB 4GVLA 3C6UB 3DHWC 4CTAB 4Q0BA 2DCLA 4B9LA 2POKA 4DI6A 1S5ZA 2M70A 3D0IE 4WFAQ 4C3MA 2PIIA 3EPGA 3RBDA 4K4XA 2UUBF 3I0RB 3CB4A 1MN9A 1UFLA 4HTJA 3OJSA 3GV8B 5IT9U 4AXJA 5K9FA 4F02A 4JYAF 3M32A 1UPPA 4ANEA 4ALZA 2BE2B 2DNYA 2QO3A 3UNYA 2ILZA 3HCXA 2WZ1A 2QLXA 3KUEA 4PG5A 2JEIA 1T03A 1LK5A 3F44A 1HW8A 3FEZA 1VQSA 3LGNA 4USKA 3IG1A 4CTAA 2BANA 3T1HJ 4ECUA 4ELVA 3OL9A 3OL7A 3CC2S 2Z30B 4RW4A 2KM8C 5CCLA 2QFJA 3V4MA 3BH7B 3PACA 4DPWA 5D0EA 2R8JA 2KG1A 2J9DA 2HQDA 4P2XA 4RU9A 4HYKA 2LEPA 4LF2A 3T6JA 2RKIB 2C2ZB 1KR4A 2D3O1 4PAAA 1WSVA 1NK4A 4OI2A 2GJIA 2VB6A 2DO4A 3HJFA 3W9JA 3ILOA 3GIJA 2LECA 3KLGB 1WEYA 1HBOA 3NEKA 1JLBA 3UDLA 5BYSA 4DLEA 2UVWA 1SL2A 1CVJA 2J9DE 5U47A 3M30A 1SV5B 1GMWD 1KWMA 1N88A 1P6TA 1U7LA 2LXUA 2OEJA 1CS4B 1NHUA 2DXFA 1FNMA 2VPZB 3C66A 2MZJA 1I5OB 1JXEA 2BJ1A 2LCWA 4KH0B 1JLGA 3J7ZT 1XNQF 3A3PB 2WB4A 3DDKA 3R1LA 2DNRA 1WOPA 5GAEU 5HP1B 2AU0A 4LF4F 2D3UA 1U1KA 2DIUA 3PYGA 4F67A 5LSOA 3RAQA 4WFZA 4DR1J 4OHXA 5CYQA 3EGVA 2MKYA 4ZVOB 2QFIA 4KHPJ 1ZM4A 2R7OA 3W61A 2AJ2A 4EO8A 2XY7A 1MU2B 3CDUA 1BQNB 3DCAA 3CCZA 1VYAA 4M5KA 3UR3C 1X7VA 3TANA 1S0OA 1NJIT 2OPSB 1EQ0A 1RT4A 1EB0A 2M7SA 3PJXA 5KFNA 1S1VB 2QZ8A 1SJRA 2YX1A 3IRXB 4WWSA 5HAOA 4ED3A 4B3OB 3I82A 3PVXA 2ZZTA 2KL8A 2OP5A 4J9UE 4U7UD 3VGSA 3MR5A 2HHTA 3VAKA 2VOPA 2VC1A 3ZNUA 1L3KA 4UW2A 4TU7A 3OXGA 4KGXB 3GJRB 3MECB 4OFZA 2NPFA 5CQGA 2IBOA 3VGUA 8AT1B 5LSRA 3NBPB 2OLWA 2WW4A 4A8YA 2Q1LA 3J7A1 3AB2B 4WKRA 5F8GA 4F25A 4I7FA 2RJZA 5LT5A 1UJ5A 2F4VJ 2EBGA 4CLSA 1R8HA 2G0CA 2XZDB 3VQTA 3K0JA 4X4VA 1IR0A 2HS4A 3DLBA 2MQOA 1ELOA 4RX6A 1FFSB 1U8WA 3HFKA 2C3YA 2IPOB 3HLUA 2XZTB 5L38A 1A6LA 4RJVA 2WK4A 3PW4A 3HXMA 2XS2A 2RAQA 4OLPA 4YQWA 1NU4A 2R7UA 1VK3A 1UKUA 4YB1P 2XGQA 4LF5J 3Q8RB 3LP1A 1S6QA 2AJ1A 4X65J 2K7JA 4NYPA 1JLCB 1KVKA 3CJ2A 1S9GA 3CJSA 2MB0B 1REGX 2C2DA 1IWAA 2QX0A 1BMQB 2Z2MA 3GJTB 3KK2B 3JSRA 4H4MA 4PRFA 4LSLA 3W65A 1HI0P 2OPQB 1DJ0A 2E5HA 3T9ZA 3M9OB 2V6AA 2XCPA 4DV3J 1RA6A 2ZBCA 3UDEA 2BKPA 3NBPA 3LWMA 2Z2ZA 1E6VB 4DV7F 4K5RA 4A8XA 2NXEA 4W4MA 3ETMA 5EWEA 3BYRA 5L1IA 2G4BA 5AT1B 2C28A 4Y00A 4JI4J 4NLQA 2HRYA 1NO8A 3MM8A 1RHUB 2B9YA 3TEHB 3S01A 1EP4B 1IR1A 2W24A 2P6TA 2XNQA 1X4GA 1VDHA 2ASYA 5C25B 1XBWA 2YX7A 3HFZB 5KFTA 2LVWA 5KG0A 4QIEA 2CNNB 2FB0A 2A2DA 4DN9A 3Q0AA 1OSCA 2CIMA 2H4YB 5L1JA 2MHEA 4QYZK 2CJBA 1X4BA 2NXCA 2O66A 5BXIA 4WZQA 4C48A 3GIRA 2PA3A 5A0YB 2AD9A 4ZVTB 4B9SA 3QJJA 5EHHA 3TZZA 4F4YA 2M4MA 2G0IA 2MY8A 4FKXA 2HZCA 4CCHA 2RMLA 4QJVA 1UMJA 2V2KA 3PHTA 4RU2A 1JJHA 4JI8F 1ZPVA 2YNHA 1VQMS 4LVOP 1LWCB 1TL4A 2K1RB 2ZDPA 5ETMA 3CULA 4LREA 1XNRF 2R2TA 2FYXA 4O3OA 2D7SA 5GADU 1FE4A 4ED8A 1U1PA 4GO5X 2H9ZA 4RW7A 1Q79A 5AXMA 1VRUB 5DDRC 3E51A 4OV6A 2HNZA 3TVKA 5I3QA 5EWFA 2FHMA 3K57A 1QM9A 2HNYA 1VBKA 5ETSA 4TKTA 2ZOMA 4B3MJ 2V50A 2V8VA 1CQMA 1F9HA 3AXMA 4O4RA 1H0HB 2ADCA 4IO1A 4YHHJ 1HWUA 3VVTA 2ABYA 2UUTA 1XC9A 3QYYA 2CJYB 1DQAA 1F5CA 1TVRB 4JI8J 2VD3A 2RVJA 3KLHA 3RBZA 2NYHA 2LXIA 2KFYA 4F4WA 1VQPS 2DRBA 3EZOA 2DHAA 3IS9A 4CLFA 3BGLA 5IT4A 2DR8A 4EI2A 4LFCJ 2JFKA 2V63A 3FSXA 1SQFA 4A8KA 1IR2A 3WQPA 2ZZMA 1P8GA 1KS2A 4JBCA 1S1XB 1RTHA 3D9BA 1X0PA 3ENQA 1PAUB 4NYOA 3A8JA 5D4LA 3RRKA 1HBNB 4U6PA 3R2DJ 2CJ9A 4ZHRB 2CAJA 4ATNA 5DDOC 4N76A 2EFVA 4WF9Q 2K3KA 4FZVA 1XK8A 2MLZA 2Z2LA 4CQ1A 3H25A 3CCTA 1TK5A 2OJ3A 4JI1J 4QCLA 3DRYA 1QE1B 2C42A 5J2MB 3OLAA 2Z2YB 4K50A 3MEEB 1NJYA 2BE9B 1GH8A 2E66A 4WP8A 1IKXB 4FNHA 4KGKA 1G1XA 2KM8B 5DZ6A 3US5A 4DX7A 2V4RA 3FBCA 3WC0A 3KHHA 2WRMA 1DURA 1U02A 1WC6A 1EQMA 2XBPA 3ISZA 4FYYB 4YP3A 1QSLA 4P2SA 4B08A 1OQ3A 1PC5A 2GAGC 4PQUB 4OI3A 1KSPA 4B9UA 3KMSA 1RHKB 5LMNJ 1FD2A 4FBTA 1RAOA 2HRTA 3VQSA 4AQYF 2HHWA 4PUOB 1SKWA 2BMBA 2IA0A 3CE8A 3NGRA 1IM6A 1ZM3A 2VIHA 2XMKA 2KT2A 2GQ2A 1CJVB 2MSTA 3D6FB 4NCAA 3DM2A 2WVEA 1UWBB 1LWCA 1HYSA 2I5JA 1RWXB 1NDPA 3PTWA 4F3MA 3ZTSA 1PYOB 3FQLA 4NLRA 2DB1A 4O4GB 3MPDA 2N3OA 4ZPVR 2E9RX 2UXDJ 2QSWA 4JI0J 4LRBA 1W7WA 3HSDA 2OPRA 4P72A 5HJXA 4A8SA 3PY8A 3SSQA 3DLHA 5KFPA 1VQNS 5H9FK 1HMVB 1HNXF 3NNCA 2Q66A 3WC2A 3I32A 2Y8YA 4DR5J 4O3RA 4IRCA 1PBUA 4ZPBA 3MEDB 1TK0A 2XNRA 1WNEA 2F4FA 2CQIA 1LQ9A 1IBLJ 1TAQA 4HACA 1WG4A 2HFOA 3OTOJ 1IKWB 2AJ4A 4NLXA 2IMOA 4HVZA 3P3DA 3C16A 2HZAA 1D8ZA 1KQGB 2JOQA 4ER8A 3G8TA 4ZP8A 1HWIA 4WTYA 3OSNA 4TNOA 1TL7A 2RQ4A 1RHRB 4RR5A 5D78A 1XMQJ 3FCHA 3HHLB 1PJ5A 3ZZPA 3BQ2A 1K1SA 1R8PA 3DLKB 1RBOB 2GFFA 2ILYA 5A8KA 2FC9A 1VBYA 3IM8A 2B56A 2D9OA 4U7UK 4Z2XA 4LIRA 1B0TA 4LJMA 4DV1J 1FCAA 4XTTA 5A2QY 3IXQA 3VALA 2LA4A 4OYAA 2L9WA 4MKBA 1LV5A 3SIPB 1S4EA 2SXLA 2CQ0A 3CCRS 1U2FA 1JKHA 4WFYA 2R8KA 1H74A 2VBWA 4B3MF 2V2VA 3M7VA 4K2XA 3V6DB 2EFPA 3R5JB 3AH6A 3CDBA 4PG7A 2P5VA 3V6JA 4KBIA 1IBLF 2VPYB 2R8HA 4DPOA 2RDIA 3R3TA 4ICLB 1N4LA 4TVAB 5B0GA 4F8RA 2RQMA 4Y3CA 3LP2B 2H3EB 2YKMA 3AOAA 4FYWB 4F2SA 3MM9B 3MM5B 1IWGA 2QC3A 1KTQA 3N4WA 3M2UB 5IQ6A 5KFFA 1UEUA 2LDYA 3VZHA 4CO5A 1HQEB 3HPOA 5DLFA 4ZJLA 3WBZA 2GHPA 2HHPA 4H54A 5B0EA 4F0MA 4ZVHA 4KO0B 2OH2A 1YQHA 3A8KA 5LL6d 5M2PA 2C3MA 1FVQA 3MDFA 3UD5A 3VZIA 5KFUA 2MHNA 4MKYA 4B3TF 3DYAA 1PYTA 2J6UA 3HHEA 2DGTA 1M1GA 4OZJA 1FI4A 7FDRA 3OJUA 1LKZA 3IRXA 1DHMA 5D4PA 3PIPQ 3OT9A 3G82A 4LF7F 2JC1A 5IC4B 3MOJB 3OLBA 2XYHB 3DMJB 1LXJA 2HEKA 2QSFA 2XO7A 2HHXA 1EX8A 2M2BA 3ETOA 2CVIA 4LFAJ 5F8MA 3SMZA 2YWHA 1U1LA 1C0UB 1QY7A 3K2YA 2VG7A 3S6EA 1AA1B 1VCTA 2MEWA 5SZTA 2L3MA 2HBYB 2LMIA 2FJEB 2KHDA 2OD4A 1XN9A 1FKOB 2HFNA 3CC7S 4IR1A 3R2CJ 4Q2LA 3KXDA 3UVJB 3DRPB 1W26A 2YWFA 4NE9C 5IS2A 2H48B 4WFNQ 4DUZF 4I64A 3PX0A 4NI2A 3CJ5A 3IGNA 4C8MA 2MKCA 4ZIWA 3DFEA 4DV0F 4R5PB 4UY8T 2HZVA 3MEGB 3D28A 2KG0A 1EZZB 5E3AA 5T7LB 1UZHA 1D9AA 2ALYB 2ZBIA 1S9EB 1U8SA 3D0GE 3THTA 2FJXA 2WHOA 4GKKJ 4PXEA 3J7AN 1UTAA 3M6WA 3C14B 4I4BA 4K0KJ 5B08A 4EGLA 1MMLA 1AUDA 1B0VA 4X84A 1VC5A 2QLFB 1KLMB 3AODA 5C42A 3ZNJ1 1A7GE 3BQ1A 4TLQA 4OHZA 2KJVA 3ITHA 3I9V9 4UTGA 4DF4A 2F9JA 1NK9A 2JSXA 2VFTA 2ZD1A 4LRFA 2DK2A 1T9TA 3ENWA 4RW4B 1RCOB 2XS5A 3KJFB 4OJHA 3FGVA 3R9LA 1TL1B 2FVCA 3MPYA 2ZKTA 4OX9F 3BGUA 4L6V3 2EFGA 3Q83A 3QGPA 4ZPAA 3TEGA 4A46A 3JYTB 2IRYA 3I6PA 4OI6A 4DFKA 2ZOFA 4EEYA 3UCGA 4USVA 4DOZA 1P1TA 2K06A 1F3FA 1TUVA 1HQ2A 4C6AA 7FD1A 3I5BA 3PKMA 3K59A 1S79A 4NASA 1XR6A 1HW9A 3FFIB 1QAYA 3I0RA 2CFXA 3GONA 3DNCA 1S7IA 2IVFB 2LDIA 2H51B 4NL5A 4YB5A 3CEDA 4FVMA 3W2WB 2KFZA 2DNPA 3BGRA 3ULHA 4G3IA 4CLLA 2JLFA 4L75A 2LQ9A 3M1VA 1C1BA 3HVTB 1U6FA 4XO0A 2OSRA 2QYGA 3D66A 3DRRA 3CNQP 4WU3A 4DFMA 4DCOB 1RACB 4BCAA 4DG1A 1S6UA 1FXRA 4X62F 3CJRA 2LA6A 5KFEA 1X0FA 1NSKL 3RW7A 2H5IB 2LLZA 3V4IB 2MTLA 3BO3A 4IQXA 1RKIA 5J1EA 3L7PA 3EDRB 3W2WA 2W9BA 2MKJA 2EG1A 2UXDF 4GKKF 4JI2J 1A9NB 2CWXA 3OXLA 3PFEA 4PKDB 1MSWD 3EUNA 4ZS6A 4XPCA 1B4SA 1ULRA 1HNIB 5J2QB 3BBFA 3FMWA 3OVAA 3G6VA 4DV4F 5HQLA 4LF8J 5J2PA 3JSMB 1FWPA 1WKJA 4ZJOA 5M2RA 4TY8B 3R5DA 3SDEA 3UNGC 5JVGQ 1TFYA 1F5BA 2ZJPQ 1CULA 5E3RA 1U2RA 2D9PA 2AGOA 1FJGJ 2BOAA 4CNYA 3QWPA 1YK9A 5HL7Q 2C2MB 2FPHX 4W90B 3KJNB 3PXGa 5T14A 3Q22A 1M5KC 3DRSA 4V19X 4LFBJ 2A3JA 5HBMB 3VVUA 1FKPB 5A8RB 3KJVB 2Y1JA 3KLEB 2VDIA 1X5SA 3OHBA 2QMUB 2XY6A 4BS2A 4DSKA 4AL5A 4EZ6A 3KYLA 1S1UB 3H59A 2DJWA 2RUSA 2RILA 2ZEJA 4DCPB 3HSZA 3ET6A 4QPXA 3KHLA 1KHVA 3JTOA 1NPKA 1NPRA 1OYDA 2BM0A 1WF2A 2ZH1A 3Q2TC 4IOAQ 5B0FA 4O44B 1CJKA 1IVZA 2GZOA 2Y3YA 3MCMA 1PBAA 3DC2A 1CG2A 3EYZA 2E1RA 3Q8YA 2QA4S 2YVSA 1U48A 2YH1A 3C46A 3M8SA 1RWVB 2DR5A 2A18A 3V81B 3R7NB 3EXYA 1BQMB 1FVSA 2U2FA 2UV8G 4WXWA 3M8PB 5KT6A 1MROA 2ZFHA 4O3NA 4C11B 5KOXA 3CJQA 2JC0A 4ZVFA 2FVPA 1HWJA 4DWIA 4LFCF 1FDNA 4QWDA 3JSYA 2VG5B 2Q6CA 1RT5B 3NAHA 4ED2A 2BVZA 3I4PA 1FXLA 4KC5A 2XMVA 4XIUA 2CQ3A 5CHCB 3SSSA 2G9OA 4GMKA 3Q8QB 5HSPA 3WIVA 1QAIA 3MM6B 3HMJG 3DDIA 5EX3A 5KG5A 2HHHJ 2V0NA 3GYXB 2HFSA 4C98A 2MKIA 1RYSA 3PO4A 3LGMA 4IDKA 3GYNA 4Z7YA 1JLAA 2YQ0A 3AFGA 3BGFA 4FNIA 3P8BB 2W4CA 4KGVB 4UUXA 1V3RA 3FEYB 4UZBA 4MK7A 3GFXA 2VA2A 1ZS6A 2JJ4D 2MZTA 4RLEA 4Y2AA 1SKRA 3EM1A 2UXCJ 1XEZA 5J2NB 2DVIA 1FXDA 2J0SD 1BGXT 3GSDA 1J5OB 2QMWA 4DQQA 1JWWA 1LWEA 1KN6A 1HBUA 1LWEB 4KPCA 2E1AA 1FFWB 3IWXA 3OTDA 1HWLA 2B8QA 4OZ2A 1RGVA 3TJ9A 1TKZA 4DV5J 2XY5A 2ZM6F 4IFYA 3IM9A 1I3OB 1AB8A 2EVZA 4MK9A 4OX7A 3CCWA 4JV0A 2R7SA 3AQPA 1QTMA 1TV6A 4IRKA 2NUUG 5LMNF 1N5YA 3MI7X 1N5VA 1S49A 5IV4A 4BLGA 1V6HA 1M5SA 5F3TA 5F8IA 4K7QA 1UVKA 4A47A 5B0AA 3D0HE 5BR8J 1FKAF 1C0TB 2V8HA 3J7YU 3RB6A 2YQ3A 2LFVA 4AL7A 4IR9A 1HNVA 3AJDA 5HO4A 4LQ3A 1R6YA 2P9GA 3H5UA 2HMIA 2B9XA 3TJ8A 4DPTA 5D3GA 4RBTA 1Y7PA 1LWFA 1HI8A 3CDAA 3EE3A 1DY3A 1R8CA 2GJ2A 1V3ZA 1WC3A 4P2FA 1ZETA 1RT5A 1SUQB 2IYGA 3UQSA 4DR2F 3MAQA 4ZCMA 3UPFA 2XLJA 1X5PA 4MIBA 4WIIA 5FDLB 9RUBA 3ZC4A 1NJWA 2GW8A 2MXYA 1X4HA 2ZWPA 2CVEA 5JXSA 4F0KA 2MGZB 2W7PA 3T1YJ 2W9CB 2KI2A 1TL7B 1BQMA 2HFZA 1UEVA 2MJUA 2VV5A 4TYAA 1N8RT 2OFGX 4NWBA 1K0VA 5KFGA 1S4FA 2CADA 3HVRA 1YZ7A 2OO4A 4QYRA 1T0TV 2VZ9A 3HI9A 4K4YA 4MJKA 2IDEA 4F36A 4CZCA 4K8RA 3FRZA 3AA8A 2JX2A 1SI9A 1YBUA 1OYEA 3CJ8A 3EGWB 2OKQA 4R0JA 3RBXA 2CJAA 1IKVA 4JB8B 4X4SA 3MR3A 3F56A 4ZA1A 1M5VC 4K4VA 1PCAA 1H7WA 3E01B 3TAMB 3H0PA 4O3PA 5ETTA 4NXMF 4L73A 2VQEF 5I4MA 2EFQA 3QFHA 3J80Y 4HHHA 1HR0J 3R5CA 3I5CA 3VAJA 5K14B 2KHCA 4DSIA 4Y2CA 1B70B 3ONQA 2FZKB 3NOCA 2YNFB 2BRKA 3TQ1A 3HULA 3W5ZA 3D1QA 2G1HA 1HBMB 1HIYA 1WOOA 2L08A 4A48A 4YFUA 2I5JB 2HYIB 4DR3J 4CLPA 2W7AA 4PEOA 1K9MT 5B0DA 2DR6A 2XI2A 2QLWA 2NXNA 1XMOF 2AHOB 5CYMB 5HVGA 1SKSA 3B54A 2G1DA 4RWWA 1Y4ZB 4KRWA 3M8WA 1FRJA 1EETA 1FFGB 4X66F 2OFHX 1JLQB 4C11A 2QA2A 4WP9A 1QAJA 5HQ8A 4NX9A 2AYGA 1WSRA 1CJUA 2HBRB 1RKJA 4DZ6A 2Y9HA 3OUYB 1AZSA 2BR0A 1LNQA 2KB2A 3OUYA 3OVBA 1Q8KA 4AL6A 4RW9B 2BBEA 1UCNA 1S6PA 5LXRA 3X1LB 1VQ8S 3MGJA 4LRDA 5HI7A 3SV3A 2ERRA 2XGPA 1FJEB 3LQVA 5I42A 4YB6A 5DO2A 3A12A 5F41A 1TR0A 3R8YA 1OSDA 3HSJA 1ZYQA 1PILA 3JS9A 1WTBA 4KPYA 2JWNA 1KP6A 2HIQA 3B8HA 3GCWP 5KG1A 1LOUA 1U26A 3DGVA 4R0EA 1MW7A 4RW8A 2DNMA 2KDOA 3CVKA 3K17A 1X4AA 4FF3A 1SB6A 1Q95G 4DR4F 2HQCA 3KLIB 4K59A 2WVDA 2BACA 2IRXA 3LF0A 3KLHB 3DGPB 3CC4S 2WSCC 1JK9B 2PEBA 2BX6A 2PT0A 2QL7B 3QGGA 4EK2A 1Z2ZA 4DBQA 1NDLA 3SCKE 2KRBA 4DSFA 1TKDA 1D9DA 4UOCA 2EKNA 4X4OA 3N79A 5F8NA 2CXEA 3QPIA 3PR4A 4LF8F 4NOHA 4IFVA 5KG4A 4DCJB 2PI5A 2DIVA 5L9XA 1X31C 1S0MA 1Q8IA 1R8AA 4E8UA 3VAIA 5E3QA 4DQIA 5C24B
chains in the Genus database with same CATH topology
4RW6A 3U1MA 3MMCB 3AHPA 1WHWA 1RP5A 4WK3A 3VR1A 1U25A 2WAQD 1VC0A 3M2RB 1VQ4S 1RTIB 2CPXA 5AXLA 1N48A 1GXTA 2HS3A 1JJ2R 2P9EA 3TA1A 3L09A 5LJ5Y 2MGZA 1YJ9S 1FKOA 5EWGA 3PW0A 2DCUB 2BJDA 1TL3A 4NLOA 1VIOA 1Y5IB 5DRKA 1L3VA 3LANA 5KT3A 2GIQA 2XS7A 2CQ4A 1NK6A 1REVA 1NNDA 4LSNA 3KK1B 4CIOA 3CJKA 1TKTA 4F26A 2J0XA 4ERDA 4QW8A 3DHXA 3O5TB 1BD6A 2X1AA 1C1CB 3K8VA 2UXBF 2XB2D 4C0OC 3IWNC 4KHPF 1BC6A 4IFYB 2VA3A 2VUGA 2DNGA 5HMWA 3D5MA 5GAEI 2XC9A 3MURP 1NH7A 4ETXA 2RRAA 1YRXA 2E1MC 2VH7A 5IM0A 1FD8A 1DTTB 2B7BB 2FHKA 1S1TB 1YJUA 2R9LA 3M6XA 3KK2A 4WJBA 4OMFG 4YUDA 3G8QA 4G1QA 5CD4H 4EO6A 2AYBA 2AW0A 3CJ0A 4ZLPA 3E8OA 2E5IA 3G6ES 3CMES 3EX7B 4TU9A 3ZZTA 1UETA 2HNDB 3AB4B 2JEJA 5KG6A 4CH0S 4DSEA 4DQPA 3IWLA 4M8LA 4LFAF 5EN1A 3N6LA 3PRDA 3RR8A 2B4PA 3CCJS 2D74B 3O44A 4WU2A 1HL6A 4ES1A 4JV2A 3T1HF 1RTDB 3N5BA 2HWHA 3QAEA 1CC7A 4YDXA 3TA2A 1HPZB 3Q8PB 2GMJA 2LU2A 2MQMA 3RYLA 2RU3A 4ED6A 2RS2A 1VMBA 2WSFC 3FZ2A 4IUFA 4F3OA 4OI4A 5LMUF 4LVNP 5DQGA 4PXCA 4ELTA 5BYRA 4NLYA 1IN0A 4ED5A 3BDEA 3OTBA 3IAM9 5HLFA 3MMCA 2M3DA 2HHQA 2MPUA 2EI5A 1Z1ZA 5KT5A 1K8AT 3B78A 3MEDA 4U67Q 2FJWA 4IFVB 1RI7A 2JHEA 4I6WA 3KLEA 3NLCA 3FDSA 3QZ7A 4NMLA 4WXOA 4V19J 3GV7B 3TVYA 2QYCA 2PDAA 3FZBA 1K0TA 3HHLD 4IH6A 4FN5A 2HGLA 3S7RA 4EBDA 5GAHI 4ZPDA 4KGMA 3IGVA 2GMLA 4ECVA 4KV8A 3A8EA 3DI6B 2I38A 3GIMA 2WTFA 3G86A 1SV5A 4B3RF 2YWEA 5F8JA 2O67A 3V2UC 5IM0B 1HBUB 3GZ7A 3OR1A 4DV1F 2HQIA 3HZGA 3SQGA 4AXIA 3CPWR 5GMKa 1UA0A 4OHWA 2BOPA 2OPPA 2BM1A 4WK1A 5I42B 1BQXA 1GX5A 1ZAWA 4OX6A 1WTFA 2U1AA 2DNZA 5J1EB 1S6PB 4J9NA 1HNZF 4RW9A 3NCPA 1IUJA 2KRRA 2YNIB 2HG4A 4N8OA 4YDDB 1X4EA 3HHKA 3CCES 5JVHQ 3UD3P 4AFFA 3CJKB 1GAOA 4DR3F 4AE5A 2XHWA 2WBMA 3RB4A 1Q4RA 2FLLA 3H2VE 1S1WB 3BGRB 4ID5B 3TUIC 1S1WA 4RNFA 2ZE2A 2HGNA 5E7OB 3PRBA 2R7QA 5E2QA 5L39A 4DR5F 3PEHA 5J1PA 2VG5A 4FF2A 5G4DA 3BREA 2VFUA