1LWCB

Crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
423
structure length
402
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 117
structure length 402
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwcB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB03
3H5UA 1S6PA 2IM2A 4K4WA 3Q8RB 5KFPA 3JSMB 3NMAA 1HQUA 1C0TA 1RT4A 2B6AA 4TN2A 4RNNA 3V6JA 5DG7A 4FS2A 1RYSA 3DRSB 5CYQB 3FFIB 3KK3B 2WOMB 3MTKA 3MR5A 2JEIA 2YNHB 1S9GB 1HPZA 3ITHA 1IM4A 1T94A 2YNFA 2RF2B 1RT6B 1LWCA 3LP1B 4FBTA 3DLGB 1JX4A 3CJ3A 4NRTA 3FQLA 4PQUB 4Y34A 5KFXA 2FJWA 3BGRB 1SH3A 4Q8EA 4DL4A 4RNFA 1SH0A 3V6HA 3H2LA 1RT1B 1C2PA 3PR5B 3NAIA 1S1TA 2OPQA 2ZE2B 5FDLA 4H4MA 1EP4B 1NHVA 3GV7B 4K4ZA 3H98A 1JLCA 3GIJA 5J2PA 3BJYA 4NLSA 3KHHA 4F50A 2CJQA 5KFCA 3RAXA 3LP2A 4O3PA 2OPRB 3BSCA 2BR0A 2OPSA 1N56A 1S0MA 1VRUB 4KKOA 1BQNB 3UPFA 2VG6A 5HP1B 3UQSA 1QE1B 3HHKA 1R0AB 1REVA 1S6QB 2XI3A 3QZ7A 4ICLB 4O44A 3N6MA 3PHEA 3FSIA 3KK2B 1S6PB 4K4XA 1IKVA 2I5JB 4ZVGA 1N5YA 3KLGA 4ZMMA 1RT5A 4NZ0A 4MKAA 4ED6A 1N48A 5DQGA 1OS5A 1RT4B 1C0TB 2B6AB 4F4WA 3MR6A 3DDKA 3I0SA 4NLOA 1JLGA 2BANA 4ID5A 5F8NA 4ZHRA 1HPZB 1SV5B 5C24A 4YR0A 3I0RB 2YNFB 3HKWA 4RNMA 4HYKA 4YMEA 3RB3A 4LSLB 1LWCB 4KO0B 3BR9A 5KFGA 5J2MA 3H4DA 3C6TB 4R5PA 4RW9A 1T05A 4R8UB 5T14A 1ZTTA 5KFSA 3KLEA 2ALZA 4NCGA 3HVWA 1LWFB 1JLAA 5KT5A 5L1JA 4Y2AA 1C1BA 2YKMA 2YKNB 3DRPA 4H4MB 4O4GB 2JEFA 3IGNA 3RBDA 4ECWA 3GYNA 5KFTA 5DGBA 5J2PB 3RBEA 3QO9B 1HNIA 5DLFA 2XC9A 3QGHA 4ED0A 4LSNA 4WE1B 4DEZA 5EWEA 3RAQA 4ZP8A 5KFQA 5KT2A 3GIMA 4MK8A 3IS9B 2VG6B 4RW6B 4K50A 1UWBB 1T03A 1J5OB 4QWDA 3GQCA 1REVB 1TV6A 2UVVA 5F9NA 4ZVHA 4O44B 3DMJA 3CDUA 4ZPDA 5JXSA 5KFYA 2W9CA 2D3UA 3D28A 1IKVB 3GV5B 4KAIA 2V9WA 4O3OA 5KFMA 3DLEA 1N5YB 5KG0A 3KLGB 2IM3A 1IKYB 1RT5B 3TQ1A 3PVXA 3KNAA 5HBMA 1KHVA 5HLFB 1KLMB 3I0SB 1HQEA 4IDKA 4TYAA 2WHOA 1JLGB 3MFHA 4EYIB 4RZRA 2AGQA 1XR5A 1HNVA 3TAMA 4O3NA 5F9LA 4U7CA 4J9QA 4ECUA 2BQUA 5KG1A 4ED8A 2RKIB 3MR3A 4GC6A 4H54A 5J2MB 3MEDA 4R5PB 1FKPA 2V4QA 4RW9B 1T05B 4YQWA 4F4XA 4DL2A 2XWYA 3CJ4A 4IFVB 1D0EA 3KLEB 1DTQB 4MKBA 3OSPA 4NCGB 1KHWA 3CDEA 4TQSA 5F8GA 4EYHB 1JXLA 1NNDA 3DRPB 3MEEA 5KT3A 3BQ2A 4ED1A 3DM2B 4ECTA 3T5KA 4K4TA 4MFBB 5F8LA 3QLHB 3EPIA 4PUOA 3QZ8A 1RDRA 3IRXB 4EBDA 1RT3A 4EEYA 3IG1B 2HWIA 1QAIA 3BREA 3H5YA 3G6YA 5KFNA 4PWDB 1U09A 5KFLA 3T19A 3T5JA 5DGAA 3NAHA 3LAKA 4Q45A 2R8HA 3LAMA 1LW2B 1RTDA 4GC7A 4EBCA 4KSEB 2C2EA 1VRTA 3D5MA 4RUCA 5DG9A 4ECZA 1S10A 2CKWA 2VA2A 3CWJA 4J9LA 1GX5A 4EO6A 5KFIA 4G1QA 3DLEB 3JYTA 3DI6A 1S1XA 5J1EA 2R2RA 4IH7A 4WYWA 5HBMB 1GX6A 4WZMA 2ZD1A 2HNZA 3KLFA 2WK4A 3M8QA 1HQEB 2HNDA 2YNGB 3C6UA 3TVKA 1RT7B 1HNVB 3TAMB 4IG0A 4RUAA 1LWEA 5KFUA 3PZPA 3MEGA 2HMIB 1TP7A 5KFAA 3VQSA 5EWGA 2J6SA 1CSJA 1TVRA 1TKXB 1DTTA 5J2QA 2IJNA 4IKAA 2ASJA 5K14A 5KT7A 4I2QB 4YR3A 5I42A 1JLQA 4U6PA 3V4IA 2IA6A 1JLEA 2ILYA 4ZVEA 2JC0A 2R2TA 4HKQA 2V0NA 4EO8A 1SH2A 1XR6A 3MF5A 3E01A 4ZPAA 1S0NA 4F4ZA 4PUOB 1ZETA 3BSNA 2VG7A 4KV8A 3V6DA 3BSAA 4IRCA 3M9OB 2IC3A 3QIPB 3G6VA 1EETB 2RDIA 4RW8A 3KLIB 2ASLA 2BQ3A 1HYSA 3RB6A 2YNIA 4J9MA 1MU2B 4MK7A 3BQ1A 4IR9A 4X2BA 3RB0A 2OH2A 5JUMA 1RTJA 4TY8A 4G1QB 2C2RA 1WNEA 4K4VA 4DG1A 3DI6B 1HQUB 5J1EB 1S48A 5KG7A 5F8HA 1N4LA 3M8QB 2HNDB 1MMLA 3C6UB 3N6NA 5KG6A 4O3RA 2WRMA 4IH5A 5KFEA 5KFFA 2FVPA 3ITHB 4IG0B 4KHMA 4Q8FA 3MEGB 5KG5A 3CJ0A 3KHRA 2IJFA 1TVRB 1K1QA 2XGQA 5J2QB 5L1IA 3UR0A 1JLFA 1C1CA 3FDSA 4JV0A 4B3OA 4K4UA 1RT2A 5I42B 3KMSA 3V4IB 1RTHA 4Q0BA 3PW7A 4NLXA 2FVSA 1JKHA 1S1VA 4WFXA 4O4RA 1QUVA 3GV8B 1S1TB 2OPQB 3DYAA 5FDLB 2D41A 1I6JA 4URSA 3I5CA 3DLKA 5C42A 4Q44A 2W9BA 3BQ0A 1JLCB 2VG5A 2WB4A 4J9NA 4K4SA 3KK1A 2JC1A 4ECVA 3LP2B 1QAJA 4NLPA 3GILA 3KOAA 2OPSB 3V6DB 4NLVA 1YVFA 2XI2A 4KKOB 4KFBA 3DOLA 4R0EA 5KFBA 4QWCA 3H59A 3KMQA 4RW8B 4XPEA 2R8IA 1RYRA 2FLPA 3MECA 1HYSB 2YNIB 1TKTA 3Q8QB 2AU0A 5L9XA 3I5AA 4ZP6A 1RTJB 4H4OA 1RTIA 2ILZA 4J9PA 3CDWA 4DG1B 3PW2A 1TL1A 2WTFA 4QW9A 3T1AA 1S4FA 2BANB 4ID5B 3G6XA 2FLLA 3KHLA 1RAJA 3KHGA 1S1UA 4ZHRB 5C24B 1BQMA 3KJVA 2W8KA 3QGGA 2IM0A 4MIAA 3HVTA 2HAIA 3V6KA 4NLYA 2IM1A 2J6TA 1C1CB 4IQXA 4QWBA 2IAJA 5EDWA 5KFJA 1RT2B 1JIHA 4QWEA 4DL7A 3Q8SB 4Q0BB 3JSMA 2R8JA 1JKHB 1JLAB 1S1VB 3KLHA 3QGIA 5F8MA 3H4BA 2J6UA 1C1BB 2YKMB 5L1KA 5F8IA 2C28A 3DLKB 3DRSA 3M8PA 2R2SA 1Z4UA 4YR2A 3FFIA 3KK3A 2VG5B 2ASDA 4M94A 2YNHA 2W7OA 2RDJA 3KK1B 1HNIB 1S9GA 3I5BA 3ISND 4LSNB 2HNYA 4JV2A 2RF2A 1HMVA 1RT6A 2V4RA 1LW0A 2GC8A 1T03B 1ZTWA 4IR1A 1TV6B 3PJXA 4DL3A 5DQIA 4JUZA 2AGPA 3DMJB 2UVRA 3MECB 3NKYA 4ZPCA 2W9CB 2DPIA 2I1RA 4NLTA 2ZKUA 4DL6A 3MFIA 4H4OB 2ZE2A 2AX1A 1RTIB 4WFYA 1EP4A 4NLGA 1TL3A 4MH8A 2AX0A 5KG3A 2VA3A 2F8EX 2XCPA 4I7FA 4IDKB 1RA6A 4NLDA 2OPRA 4FBUA 3LANA 1S1UB 1D1UA 1S49A 1VRUA 4NLRA 3KJVB 1IKXA 2OPPA 4J9OA 5HP1A 1QE1A 3OHBA 4MK9A 4Y2CA 1R0AA 2AQ4A 3HVTB 4URGA 2W8LA 1S6QA 2FVQA 3MEDB 5CYMA 4ICLA 4M95A 3PR4A 1FKPB 3FQKA 2AGOA 5L1LA 3QYYA 5KFDA 1SUQA 2I5JA 1IKWA 4MIBA 4TQRA 5EWFA 4J9SA 5KFWA 3KLHB 3UDLA 3MEEB 2HWHA 5KFHA 3BSOA 3M8PB 4TLRA 2FJVA 4G3IA 4QPXA 3ICLA 1DLOA 1SV5A 5KFVA 3I0RA 2HNYB 4NLQA 5KT6A 3IN5A 4O3SA 1HMVB 3DOKA 1RT3B 4LSLA 4ZVFA 4KO0A 3SFGA 4ECQA 1C0UA 4ZPBA 1LW0B 4ED7A 2E9RX 3V81A 1FK9A 1S9EA 3C6TA 2FVCA 1XR7A 2BE2A 1RTDB 4R8UA 4ED3A 1VRTB 4IOBA 4QW8A 4RNOA 5HROA 1RA7A 3OHAA 1LWFA 2GIRA 1S9FA 3JYTB 3CJ5A 4IG3A 2YKNA 4O4GA 2O5DA 4LQ9A 2GIQA 1S1XB 4URQU 2E9TA 3LP0A 1TL3B 5C25A 4O3QA 2XGPA 3KLVA 2R8KA 3OL9A 2ZD1B 2HNZB 3KLFB 4EBEA 2JLEA 4I7FB 3QO9A 5D3GA 4NRUA 5KFRA 5KFKA 2JEJA 2UVUA 4WE1A 3CIZA 1LWEB 4Q43A 3IS9A 4IRDA 1IKXB 2AWZA 2OPPB 2D7SA 4RW6A 1UWBA 3FRZA 1J5OA 1JLBA 1DTTB 2WONA 5CYMB 5K14B 2C22A 2FVRA 5I3UA 4KHRA 5KG2A 3SI8A 2EC0A 4ZP9A 4FS1A 1JLQB 2XCAA 1FKOA 4ECYA 2R8GA 1JLEB 1SUQB 1IKWB 4ZP7A 4ECRA 3EPGA 1IKYA 5J2NA 4J9KA 4K4YA 2B43A 5HLFA 1KLMA 3E01B 4XPCA 2WCXA 1HARA 4NLWA 3OSNA 4YP3A 4TXSA 4OL8A 3M9MB 2E9ZA 1DLOB 4RNHA 2VG7B 4KV8B 2FJXA 5DLGA 3CVKA 3DOKB 4RU9A 2IC3B 3IGVA 3NGDA 2RKIA 1C0UB 3NBPA 3V81B 1FK9B 1NHUA 1S9EB 3SFUA 5DG8A 3OL8A 4IFYA 3OL7A 2BQRA 2BE2B 3GIKA 3ISNC 3PW5A 4IFVA 1DTQA 3DRRA 5HROB 3NL0A 2W7PA 4RW4A 2UUWA 4TY8B 1S1WA 1S97A 4IG3B 4LQ3A 4IRKA 4WFZA 2W9AA 2QV6A 3LP0B 5C25B 3QIDA 3DM2A 3H5SA 2JEGA 1TKZA 2UUTA 4Y3CA 4MFBA 5D3GB 3QLHA 3T5HA 2C2DA 4XO0A 4RW7A 3G86A 3IRXA 2D3ZA 4TY9A 4J9RA 3IG1A 2B5JA 3T5LA 4PWDA 5KFZA 1S0OA 1N6QA 1JLBB 4I2PA 2QE5A 1JLFB 1LW2A 2WONB 5I3UB 3Q8PB 4B3OB 2FLNA 3GIIA 4WYLA 1FKOB 3CO9A 1RTHB 4NLUA 3MR2A 2UVWA 3DYAB 5J2NB 5C42B 3OLAA 5CYQA 3OL6A 2W9BB 4TYBA 2WOMA 2YNGA 3CJ2A 1RT7A 2DPJA 3M9NB 1T3NA 4WXOA 2HMIA 3H40A 3E51A 3LP1A 4KFBB 3DOLB 5KT4A 3DLGA 3RB4A 1TKXA 3NBPB 4PQUA 4IH6A 3H5XA 2BRLA 4KE5A 4I2QA 4NYZA 4IFYB 4QWAA 2IMWP 3BGRA 3HVAA 1TQLA 1TKTB 1W25A 3N6LA 3LALA 3DRRB 5KG4A 3OLBA 4DL5A 4WZQA 2R2UA 1RT1A 4WXWA 4RW4B 1S1WB 1K1SA 3PJWA 5KFOA 4F4YA 5EUHA 4ECSA 5F8JA 4ECXA 5DQHA 2BRKA 1TL1B 4KB7A 1TKZB 3EZUA 3PW0A 4RW7B 2IBKA 1BQMB 4ED2A 1BQNA 2ATLA 4JV1A 3QIPA 2B5JB 5C5JA 3PW4A 1EETA 1N6QB 4KBIA 4I2PB 3KLIA 2IAJB 3KK2A 1MU2A
chains in the Genus database with same CATH superfamily
3H5UA 2VQEJ 3UDVA 4UY85 1T9VA 1Q8KA 1WI8A 2L9NA 2V63A 1XMBA 2ZBQA 4NMLA 4YHHJ 1LWCA 2MKKA 4PZVA 4RNFA 4PYAA 1SKWA 5J2PA 2PO4A 2CJQA 3DGPA 3OUYB 4MJKA 5G0RA 4JI0J 3HHKA 2IFXA 1S6QB 4O44A 4K4XA 2I5JB 4ZMMA 4TNOA 3NY0A 2OJ3A 4ZVOB 1K44A 4UOFA 4YMEA 1T9TA 3K5PA 1LWFB 1BQXA 2MGZB 1YRUA 4ZDNA 4F2SA 1YJVA 2WW8A 5DLFA 1S6UA 3N9UC 3IS9B 1TK8A 1UWBB 2HVZA 3DLEA 2QEXS 3RZAA 2YQ0A 3TQ1A 4EYIB 1K8AT 5IT0A 1VCTA 2JVRA 4U7CA 2BQUA 2BE7D 2CZ9A 2OFHX 3UD4P 4B3TJ 4ETXA 4YQWA 1XK8A 4DV5J 3HX9A 2FD2A 5JMNA 4DX5A 4ED1A 4MFBB 3C15A 4NASA 4NXMF 3IG1B 3T5JA 4Q45A 4RUCA 4FYDA 3J7ZT 3ZZPA 4NWBA 1WOOA 2VQEF 2DNGA 5HQLA 1GX6A 1PJ5A 5HSPA 4RUAA 4DX7A 4DPYA 5J2QA 1O0PA 1ITPA 1QVFR 3N5FA 1KQGB 2ILYA 3GWCA 2A2CA 1FKAF 3I4PA 3TUZC 2HQ3A 3HM9A 1U6FA 2CAJA 2G2YA 3V6DA 4XIUA 5DM7Q 2MQLA 1NB7A 2RDIA 1VGYA 3BR8A 3HI9A 3UNGC 1U1NA 4MK7A 5D8HB 3TEHB 1WG1A 4B08A 5U47A 2HNDB 4B17A 1IWGA 1YGYA 3H7HB 3PEHA 2OEMA 1YK9A 4URSA 5C42A 3VVUA 1U0HA 3W64A 4AD6A 1KVJA 2PA3A 5K20B 4QWCA 3H20A 1B70B 1ICEB 2YNIB 2AU0A 9ATCB 3NS7B 3I5AA 1NJZA 5M2PA 3OD2A 1BQMA 2W8KA 4A8KA 3POTA 3HVTA 3OXLA 1VBXA 4QWBA 4DUTA 1RT2B 4ETZA 3Q86A 4QWEA 3JSBA 1M5SA 2JFKA 4C6AA 1CPZA 4IR1A 5KOWA 4NLTA 3R5JB 1VFJA 1TL3A 4JV5J 2HGMA 4CTAA 1AFJA 4DN9A 4NLRA 2HFZA 4J9OA 1R43A 3KJNB 3CJRA 3MEDB 4J90A 4KT0C 1U1KA 2EKYA 2AGOA 2VQFJ 4OHYA 4OI6A 4CO1A 1FWLA 3BSOA 4OYZA 2FJVA 1HMVB 3M32A 2AHOB 3C6TA 1RTZA 2ZOMA 2BE2A 1VRTB 4RNOA 2WSEC 2XY5A 2D3OR 4HTJA 3G8QA 2R8KA 4X4OA 2RHQB 1VJWA 4EGLA 5IC6B 4I7FB 3QO9A 2JEJA 2HVDA 4ES3A 3MMBA 3MWBA 1X0PA 4ZN3A 3IR5B 4ZP7A 2CQCA 1KLMA 3CCSS 4OL8A 3BN4A 1F60B 1ZAVA 2Z2YB 1UVLA 3M8WA 4IO9Q 2QV6A 2HKEA 3H5SA 1WC0A 1R8CA 4XO0A 2D3ZA 2NUHA 4DX6A 3KUEA 3T5LA 4QYRA 4WPAA 2C3OA 2YTCA 3Q0AA 4WU3A 1RAAB 4F0KA 2UVWA 4P2XA 5HK4A 3Q89A 3D2WA 1T9WA 2PT0A 2HMIA 4NEYA 2AP6A 4OZ1A 2F3JA 2QFIA 5AE1A 4S0MA 4L72B 1MLAA 2XSFA 2IHR1 2LYVA 3DNCA 3NGUA 4N7TA 2HYIB 4LR9A 1FRIA 2V8GA 4JV1A 4LF8F 3CCWA 4KBIA 2Y9HA 3NWRA 4OZNA 3CPWR 3H90A 2XYHB 1U1LA 5CYQB 5L38A 2HHHF 2FB0A 4HTIA 3V2UC 2R7QA 4DL0C 3LP1B 3LW5C 3W62A 1AFIA 4NCBA 3KFWX 3MD1A 3MMCA 1Q5VA 2YH0A 1S79A 4K4ZA 4X4VA 4WKYA 2BR0A 2AZ1A 2VG6A 4B3MF 1NDCA 4DFMA 2KVQE 2MSSA 2UZAA 1OS5A 3W61A 2B6AB 2Y1RI 3I0SA 2BANA 4X64F 4ERDA 5GAGI 3SDEB 4RNMA 3DLLQ 4LSLB 2B8QA 3DLHA 1XMQF 1UEUA 3L4BC 2ALZA 4OYOA 3W65A 5KT5A 1KOHA 4C11A 4CLFA 7AT1B 4LSNA 4DEZA 2KFYA 4ZP8A 5BXIA 3DMJA 4LT6A 3Q2SC 2W9CA 3K5OA 1IKYB 3TUJC 2DH9A 5HBMA 4V19J 3ETMA 2BJ9A 2BJ8A 3TW0A 2BX6A 1I5OB 3UI3A 4CLWA 1VQ9S 4XDDA 4H54A 4WBFA 1HNXF 1F2HA 2V34A 2VFVA 1PYOB 2V4QA 3O44A 4IFVB 4ZCMA 1D0EA 3CCRS 3GJRB 2AJQA 2V69A 4DV7J 3L09A 3DM2B 2MEWA 4K4TA 4EBDA 2ZH7A 2HQGA 4PWDB 2FUG9 5DGAA 2OLWA 3NAHA 1E6YB 3CCZA 2E66A 4QR1A 4LBIA 4KHPJ 2YKAA 2K3IA 2ZVSA 1UA1A 1LK7A 5AXNA 3MURP 2Y1LB 5ETNA 2ZNYA 4LBPA 1L5UA 1TVRA 4L74A 1UPPA 2B8PA 2R2TA 2V0NA 2F7VA 3LA0A 2XS2A 3CT9A 1IJFB 3M9OB 1KS2A 3N01A 1RWKB 1EETB 2A3JA 1EZZB 4X2BA 2MSTA 4WTYA 5J1EB 4I64A 3M8QB 1MMLA 3C6UB 5E7OB 5B0DA 4A8FA 1S0VA 3PKYA 2AYEA 3DRXA 4NMXA 5L46A 3PX6A 4K4SA 3KUGA 1FVQA 3DGPB 4F7VA 3ILIA 2BKOA 5GADI 4KGZB 1S7HA 3MECA 2MLYA 3VVTA 4ZP6A 1EHWA 2NPFA 2ZH3A 3A12A 1FRHA 4QW9A 4NL5A 3CMAS 4FYYB 2DR5A 1VQMS 2GA7A 2FJEB 4J37A 5KFJA 3EVOA 2N3LA 2UV8A 3FSYA 1XTZA 2KT5A 1Z4UA 2FHJA 3P3DA 4A8OA 4A8WA 4O23A 2YNHA 1HNWJ 3IWXA 4CYUB 1R3NA 2FQQB 1FEEA 3QJPA 3TP2A 4JUZA 2DNRA 1VJQA 4U95A 1S5ZA 2CQBA 3AD8C 4DL6A 3O2IA 1WC5A 3C66A 2DHXA 2CQIA 2V2KA 2AYBA 2O1PA 3LANA 1S1UB 1HD1A 2QYGA 2XSJA 3A4TA 1IKWA 4PABA 4H4KC 4WU2A 2N4DA 1TL5A 3BKTA 1DLOA 1N5VA 2E9RX 1P1TA 1L3VA 1FO1A 4IOBA 4CRJA 3A13A 2WBRA 2RILA 2UP1A 3ZZ0A 1HBNA 1ZH5A 3C16A 4FS1A 2CJBA 2NXUA 2CNOB 1U6ZA 1HWKA 3BBFA 1IR0A 1Q8BA 4YP3A 2BJ3A 4RNHA 2V68A 1CJUB 1WHVA 3CD7A 1B7FA 3KYLA 1I94J 2M0GB 2DH8A 2XO6A 1S97A 3T1HJ 2IRYA 5KFZA 1Q1KA 4G6VB 2EK6A 3T9ZA 1KQKA 3ZZUA 1RAIB 4CLPA 2KG1A 2XHCA 5C42B 1ZOTA 3N79A 4WXOA 3THTA 3RB4A 4BBYA 3I55S 3NBPB 3GMGA 4I2QA 3DXBA 2R2UA 4WP8A 3P45B 1U1RA 4YB7A 1TKZB 5E0OA 1F6TA 1IQTA 1BQMB 3VR1A 1T11A 3GP9A 3K89A 4TN2A 2I9SA 2I38A 2VB6A 2VU5A 2F4VJ 1LKZA 3JQMA 3A3OB 2QX0A 2RRAA 3BGRB 4ZJQA 4DL4A 1SH0A 3IM9A 1Y7PA 4H4MA 1RJJA 5GAEU 3H98A 4CTAB 4F50A 2DGUA 5IXUA 1K47A 3DDNA 2ZC4A 2BJEA 1C0TB 2YWWA 3HF5A 3W5XA 2DR7A 5C24A 2ZHAA 3BR9A 3BZQA 3M32B 2B4OA 3C6TB 4RW9A 1X5TA 2CADA 4FPRA 5LOQA 3KLEA 4K5RA 2U1AA 5HQ8A 5CZVA 4HL9A 5KFTA 5DGBA 3QO9B 2AV5A 4ED0A 4MK8A 3IMQJ 3CMQA 2GX8A 2KKHA 3FBEA 4ZPTR 1KLMB 2J8SA 1JLGB 1OJ4A 2VPYB 4Y2KA 5F9LA 1TFYA 4K0KF 3W3SA 4P52A 5BYRA 2VKZG 4NZ6A 4E0DA 4OV1A 3R6LB 1FJGF 3HVRA 3QQCD 3DRPB 3BV8A 4I0WA 1VDHA 3PIOQ 4PXEA 4Q2MA 4F4AA 1CS4B 5HJXA 1WG5A 1A9NB 3H8YA 3DI6A 2DNNA 4YDDB 1LXNA 3D0IE 2HMIB 2F4VF 3DRYA 2ZBCA 4DBQA 5KT7A 3AB4B 2XMJA 2C3MA 2UUCJ 3E2EA 1XN9A 2ZUGA 4PUOB 4DR4J 3HKZD 2P8IA 2KH9A 4J9MA 4C7QA 1RTJA 4PEOA 1MWQA 2P6TA 2M5YA 1Z2LA 2GJ2A 1NCLA 3DOMB 3UO0A 1KFSA 3MEGB 1SJ3P 2WVBA 4PG5A 3MMCB 3NCQA 2H5IB 4FKYA 2DNYA 1Q81T 3MM8A 1VYAA 2BJ7A 4I6YA 5IWAF 3HPOA 5KFBA 5EX0A 2HZAA 1RYRA 3ET6A 3FVYA 3CDWA 3ELHA 2MQQA 2WTFA 1GTEA 1S4FA 2BANB 4LIWA 1SIZA 3AXMA 4QQBA 1IR1A 5DZ7A 4YB5A 1PBUA 2AD9A 4Q0BB 1VR6A 2GHVC 2R2SA 3FFIA 2HHPA 3WC0A 3C2PA 3I5BA 4LSNB 3MDFA 2VJVA 2DHSA 4ANCA 3DMJB 2K1RB 3C19A 2W9CB 2VKRA 1DY3A 2ASYA 3CC2S 4NLGA 2DO4A 3U1MA 2HZVA 1UP1A 4R25A 1T02A 4MK9A 1PAUB 4CLLA 1NDKA 3HSJA 2J9EA 1WC4A 2Y1JA 2E7VA 2Y3YA 1GK8A 2LA6A 5J1NA 4CLUA 4X65J 4DR7F 4DUZF 1S57A 3I0RA 4NLQA 1FRKA 2DEIA 2M9KA 2CQGA 1S9EA 1VBKA 3H2UB 1Q95G 4DMZA 5D0RA 2PA8D 3J81j 4QJVA 4F26A 3KLVA 3MM5B 1A0OB 1S7IA 1FRJA 4KHRA 5ETRA 2EC0A 4CM2A 2DNHA 2VBZA 1KQFB 5J2NA 2VBWA 2UUBJ 1FD8A 3RR7A 4N76A 5DLGA 3DOKB 3R5BA 3GJSB 3D0GE 5HROB 3US5A 1RU1A 1NM2A 4JI3J 2Z4PA 2DRAA 1EIYB 3THVA 1F9EB 2E5GA 3GU0A 2DBBA 2WONB 1BXNA 2OSQA 2D9OA 2H5EA 4XTTA 2V4JB 5IC4B 3M6WA 3CJSA 3CJ2A 5KT4A 2HRTA 1YG0A 4Y2IA 4OX9J 2LQJA 5I3QA 2DY9A 3HVAA 3NCRA 1VI7A 1W25A 3OLBA 4HHJA 4OI4A 4Z7YA 5G4DA 4ECSA 2HFUA 5DQHA 3BB5A 4LR8A 2XS7A 1AXQA 2YWFA 3QIPA 4OYBA 1N6QB 1ZAXA 2B56A 1RACB 4PR6A 2M52A 2R7XA 2EG2A 4DCPB 1HQUA 4Z37A 4JI7F 4DLEA 1RYSA 4LF9F 2JEIA 4K8RA 2YNHB 1RXOB 2ZH6A 5F0UA 3DLGB 2BW2A 3LPYA 5A8RB 1RT1B 1MN7A 3EWGA 1U8WA 3GIJA 1N56A 4KKOA 2HIQA 1RB0A 2I6WA 2E5JA 2KRRA 2FJBB 3R2CJ 2ZH2A 2R7OA 1GEHA 1G6BA 1YI2S 4X4SA 4JI1J 2KN4A 2ROGA 2YNFB 1TL7B 1KC8T 1XMOF 4CO3A 3P6YC 5KFSA 3SQGA 2H4WB 1OQ3A 4ZLNA 1HBNB 4XK8C 3C16B 5IM0A 4RU2A 3GSIA 4OZ0A 4DI6A 2B4VA 3BPDA 3QRRA 3MM7B 2FYXA 1AROP 3FBBA 1V6HA 4R5PB 4DV4J 3UCUP 1FFWB 1QAYA 1QD1A 3UN2A 3AODA 4PQAA 1V5VA 4F67A 3BO3A 2X1BA 2PMZD 4DZDA 2DNPA 5CQGA 2R2RA 1R8PA 1WTFA 5KTQA 1HNVB 1GXUA 4OZLA 4OX8A 1EARA 3CDAA 2AIRB 4I2QB 2XZWA 3W5ZA 1Q86T 4HKQA 3M2RB 4YEAA 1VBYA 2I8EA 4KV8A 3W9IA 5CYJA 2N7CA 1X0FA 4DG1A 5KG7A 2MKYA 1UMJA 3M4XA 2ZC3A 3QMQA 5KFFA 1GMUA 4P10A 4QIFA 5I42B 4ZKAA 4NLXA 2LXIA 1S1VA 4WFXA 1S12A 3DYAA 1XQIA 2VG5A 2PEHA 1R27B 2OEKA 2WB1D 2MXYA 1N5TA 1L3UA 3OTBA 4CO5A 1UVMA 3H59A 4XPEA 5RUBA 2W2MP 4YY3F 3R3TA 1M5KC 3AJ1A 4H4OA 4RUBA 2H65B 3R7NB 4N8OA 5C24B 3IXQA 4I68A 3QGGA 1IUJA 1UPMB 3WX8A 3ZTOA 5HMYA 4DL7A 3JSMA 3F0NA 2FY8A 5F8IA 3DRSA 2NS1B 1S9GA 1IM6A 2C2OB 2HQIA 4E98A 2RDDA 4LFBJ 3UNYA 3PFEA 4C8YA 1BLUA 2RU3A 1RTIB 1YKWA 5IZHA 4J5OA 1D1UA 2OPPA 4OIXA 1YRXA 1RWWB 3PR4A 3HHLA 5L1LA 4WFNQ 3CJTA 4OZ5A 7FD1A 3M8PB 3W2VA 4L73A 3OTOJ 2VPXB 3ICLA 3AQOA 4NYOA 4ECQA 4ED7A 3V81A 1X9MA 4ZCLA 2A6OA 2X7IA 2DNKA 4QW8A 3OHAA 3CJ5A 2YKNA 4NRUA 1O6XA 1IKXB 1J5OA 1IXKA 2VODA 1HBUA 2LLZA 3M6XA 3V4MA 1SUQB 1R6VA 3JQKA 2B4UA 4JI8F 3SBMA 2QMWA 1RU2A 3IGVA 3BGOP 1C0UB 1FK9B 3F44A 2M8HA 3U7JA 3AH6A 5C7PA 3LP0B 4J9RA 4LSZB 1S0OA 1P8GA 5BR8J 1LW2A 5I3UB 4JI4F 3HXMA 1O5JA 1GXLA 4JI5J 2WOMA 2XMAA 1IBKJ 3MM8B 1YJWS 3H40A 3P96A 4KR0B 1TKXA 3GONA 4LF2A 1AA1B 4QWAA 3ET6B 3ZXWA 2GO8A 2BZ2A 4FZVA 2BOPA 5CCLA 2RS8A 4LVNP 5D4OA 3GJQB 2KM8C 1WDTA 2Z30B 1BQNA 4ENOA 1UVJA 2QFJA 1RAGB 4DV6J 1PJ6A 3ISZA 3CC7S 1X9WA 1WC3A 1Q0NA 3Q8RB 3VQTA 4DV3F 1RT4A 3FFIB 1GMWA 2HHXA 3OTOF 5B09A 1RGVA 3FUYA 2MKCA 3SQOP 4A8QA 2C42A 1Q16B 3IP0A 3B6BA 4O3PA 5DDQC 2GVDA 5LMUF 3JTPA 3N6MA 4FXDA 2O3DA 3UVJA 4Y0FA 4C8KA 2CQ1A 5EGYA 3I0RB 1DBDA 3MM6B 2HRUA 3B4DA 5LMNF 4NCGA 4NZ7A 3MUVP 2DD8S 4DR5J 1RADB 2QGFB 2EBGA 2JLFA 2FC9A 2NSCA 5THWA 4O3OA 5GMKa 3TAMA 4C3MA 4FNHA 2E1AA 2YXLA 3MR3A 4NI2A 5J2MB 2KL8A 2KFZA 4WIQA 5KT3A 3UCGA 4ECTA 4ZVRB 1YBTA 3LAKA 4EBCA 1JJCB 2EFPA 1SL1A 5DG9A 1S10A 3NMRA 6FD1A 2VA2A 2M8DB 1H73A 4WZMA 2ZD1A 4LFCJ 1U0SA 1HQEB 4B9LA 2AJ4A 1P27B 1RCXB 4UUXA 5K14A 3D66A 2B9WA 3NWGA 4MTPA 3U1NA 3AHPA 2ZM6F 4WTOB 3BSAA 1SVDA 3D68A 3QIPB 4WK3A 3J7AN 2ASLA 1UL3A 5J1PA 3PX0A 4C98A 1HQUB 4LVOP 2UUAF 1U1MA 2AMCB 3P5BP 1Q8IA 4IG0B 1RWOB 3FCHA 8RUCA 3HHDA 4DU7A 3Q83A 3BQ0A 2WB4A 1SC6A 3KK1A 4ECVA 4KKOB 3W9JA 3Q8QB 4CH0S 2F63A 4CCHA 3VAMA 3RJMB 4C0BA 2Q66A 4JI6J 4O0NA 3KLHA 3SQGB 3DLKB 1BHNA 1VISA 3CCLS 2HFNA 4RWWA 1YSJA 2VBXA 2B9EA 4IQMA 2BM1A 2WSFC 3MD3A 3KJVB 3OHBA 1KSPA 2OMLA 1M90T 2OELA 4HI1A 4DR6F 5KFHA 3SV4A 1U26A 2V2ZA 1SL2A 3IN5A 5D77A 4ZVFA 1NK4A 2HK3A 3GE9A 1DFDA 3D6TB 4KYZA 5T7LA 5C25A 3FGVA 2RB7A 1JWWA 1B0PA 4PWUA 2E5LF 2Y0SD 1AZSA 3KDOA 3SCJE 4OQJA 3BO4A 3GZ7A 3BKUA 2ZH8A 2RQMA 3VGSA 3U1LA 2LXUA 2B43A 5HLFA 4Y28C 4KV8B 2FJXA 2RKIA 2K8GA 2NYIA 1D9FA 4B9TA 4I67A 2G4BA 1V3ZA 3CUNA 4B9UA 4FPIA 4MKYA 1ZA2B 4RW7A 3HO1A 3NOCA 5HATA 4M5KA 4HI2A 3LPEA 3DC2A 1HQ2A 1U6BA 3DYAB 1RKIA 2RJZA 3KJQB 5B7WA 1GFWB 5HMXA 3AOBA 4C3KA 3VAGA 4ITSA 1Y5LB 3TNVA 3EVWA 4DL5A 1S1WB 3VGUA 4U7UD 1GT8A 4C97A 5DO2A 1FWPA 3FEXB 1MW7A 3DHXA 1PC4A 2XMUA 1FXDA 4XDCA 4QIWD 2CQ3A 1FDDA 1WOPA 1MU2A 3MPWA 5E5NA 5KFPA 3JSMB 3ONQA 2NPIA 3QJJA 2KVIA 2GVZA 2W2PP 3DRSB 3GFZA 3L7UA 1S9GB 1T94A 3TWZA 5D4NA 1WDDA 4FYXB 4DV2F 4LF7J 1NHVA 1SB6A 3GV7B 4L3NA 4OYPA 4DZ6A 3KHHA 4CIOA 2MQMA 1Y3JA 1Q4RA 3CCJS 3UPFA 1REVA 4I6AA 3ZTPA 3HHLB 4ZVGA 1TKDA 2FZGB 4ED6A 4UY8T 4Y2MA 3DDKA 3W2VB 2V8VA 1VC5A 1HPZB 3AD9C 3BYPA 3HZEA 3DCAA 2VFTA 1JLAA 1C1BA 1X4GA 2YKNB 3PO4A 1V5IB 5AT1B 3SV3A 5EWEA 5IQQA 5KFQA 5D78A 1J5OB 2XLIA 2E7WA 4DV0J 2DNLA 5BYSA 3G2XA 4KY3A 1Z2ZA 3P5TL 4NXNJ 3AA9A 4L3KA 3OFEA 1RE1B 3GR1A 4CLTA 4GC6A 3L9ZA 2JZ5A 2FHKA 4CM0A 3HK2A 3S7RA 4DQRA 3O3LA 2RHSB 5IS2A 1WTBA 4FVMA 4OJGA 4B3RJ 4HLBA 5KFNA 3R5GA 1JMTA 1KDNA 4C8NA 5AJ3F 1LW2B 4GC7A 1DHMA 3M7VA 4EO6A 4LFAF 2A2DA 1UWAA 1N36F 4Q2LA 2FDNA 1TKXB 1DTTA 1SKSA 3V5RA 3M8SA 3SEOA 5DDOC 3AD7C 2DGVA 4P2FA 4EO8A 3PYFA 5CH7B 1R8BA 2VG7A 4I4BA 4OZ3A 1RI7A 2CG4A 1HYSA 3RB6A 4G1QB 2C2RA 1WNEA 3D3CJ 1S48A 4ZVTB 4N47A 4BDPA 4O3RA 2ZJRQ 5MLCV 4LF5F 2NYHA 4Q8FA 2X3GA 4DU8A 2HBRB 1VLOA 3MEKA 4K4UA 3Q22A 1VOMA 3KMSA 1GQEA 3TX0A 1QVGR 1QAJA 2ZWOA 3KOAA 5L8RC 4CLYA 2DHAA 5HI7A 4LF6J 3G82A 1FE0A 3EGVA 4NXNF 3TJ8A 4P9SA 3UN5A 5GAEI 2FJAB 2E7XA 4IQXA 2OI2A 3TVYA 4ELVA 1JIHA 4RLEA 5D6GA 3PJ9A 2KO1A 2C28A 2O66A 4GO7X 2CIMA 2LFVA 4M5MA 2AJ2A 2I1RA 3PCOB 2ZKUA 4NLDA 4NI2B 2ZBRA 5M2UA 2VBYA 2XZTB 4PXCA 4TU7A 3JB9k 3EVMA 2BUNA 3MZIA 1MWYA 3PV8A 4IYQA 1H38A 4LQ9A 2GIQA 4K4VA 2XGPA 2ZD1B 1UEVA 4JYAF 5D3GA 3WIVA 4ILRA 3PDNA 3J80Y 3HLUA 1K9MT 1SI9A 1U7LA 2GAGC 4IO1A 4EI2A 5K14B 4OZJA 1S59A 2XTJP 3SMZA 1WSVA 4J9KA 4DFPA 2MY8A 4NLWA 5A2QU 2LQ8A 2GQ2A 4GKKJ 4X4QA 3OL8A 3ISNC 1B4SA 3HP6A 2UUWA 3A8IA 2ZH5A 3OFHA 2HPUA 5A8WA 1W2IA 3IRXA 4P75A 4A46A 3FEZA 4UQGA 2POKA 3Q8PB 2CJ9A 1UZHA 4BC9A 4IOCQ 2QN6B 2VFSA 4X4UA 2P2CB 2OIHA 4ANDA 1CJKB 4PQUA 3H5XA 5ETOA 1APSA 1U4BA 4F4YA 3Q8VA 4KB7A 2XY7A 1YDLA 2BEFA 4CH1A 1M1GA 2MYFA 3G9CA 1N5SA 2XB2D 3KK2A 1UEKA 2C3PA 3EGNA 4FXVA 1MMDA 3NMAA 3L7OA 5E3PA 2QC3A 1HD0A 1O51A 3CJ3A 5DJBA 4Y34A 4E2FB 1EKRA 4NA2A 1SJ4P 1J5EF 3CJKA 2DHGA 2J9DA 1B0VA 2Z8QA 3LP2A 1BUXA 4FDFA 3BSCA 2IJRA 2QLWA 4DPOA 4YR0A 2UXCJ 3IRWP 1NZAA 4OX7A 4AXIA 4GKKF 1LOUA 2F40A 1HBOA 4UOHA 1T9YA 5T7LB 1K0TA 2EBEA 3IBFB 4USJC 1VIOA 1AZSB 1CULA 3CB4A 1G2EA 1G3OA 3CDUA 4OV6A 1IKVB 4KAIA 2V9WA 1WACA 2PN6A 5HLFB 5H9FJ 1WI6A 3W9HA 1E6VA 5KG1A 2RKIB 3CE8A 3G8TA 2AJ1A 1W7WA 2XWYA 1VHIA 3T6BA 4X62J 2BABA 5LJ3Y 3GPAA 1VQPS 3BQ2A 1NJWA 3J7YU 2O67A 3QZ8A 1RHMB 3H5YA 4DPXA 2UXBF 4HH0A 5KFIA 3O6QA 1BD6A 3KLFA 2GV1A 2A1BA 3OVAA 3PZPA 1TP7A 5A8KA 1Q7LB 3IC1A 1UJ4A 2FTRA 1H0HB 4W98A 1SH2A 1XR6A 3E01A 1ZETA 1RK8A 4ZJOA 5K8OA 1TUGB 3NNCA 2B4PA 1H7XA 4UTGA 4RW8A 1MU2B 3BQ1A 4DHVA 3M2VA 3IWNC 2HS4A 3KG4A 3KXDA 3N6NA 4IH5A 2HGLA 4LREA 4CT9A 4USIA 2IJFA 3BPSP 2XS5A 3M2UA 3FJ2A 1C1CA 3FDSA 4F2RA 4DSEA 3QT6A 1BY9A 2DT9A 5DS7A 1LK5A 1F3VA 3EUNA 3GYGA 4KFBA 3DOLA 4CP5A 2XNRA 4YB1P 3OTCA 1TKTA 1N0UA 1SC3B 2CNLB 2DO0A 3P8BB 4YN3B 2X1GA 4UOGA 3Q8SB 3DLBA 1JLAB 5F8MA 4X62F 1C1BB 1AW0A 2KHDA 2KXFA 1P9YA 4GRSA 3ULHA 4JV2A 2GJIA 5HJYA 5JVGQ 4ZCKA 4OYXA 1FNXH 2OO4A 4OHWA 4M5IA 1X4DA 2COLA 1Y11A 4NXMJ 2G1HA 5HO4A 2W1BA 2IMOA 2ZJQQ 1HW9A 5FD1A 1NPPA 3CJ8A 1RLDA 2ZH9A 2VH7A 4TLRA 1NH8A 3KWMA 3MCSA 1SV5A 2G0JA 2IDEA 1BMQB 1LW0B 2M3DA 4TKTA 1CVJA 2OMOA 5AXKA 3GFHA 3SCIE 2ZKTA 4URQU 2JLEA 5KFRA 4WE1A 1YZ6A 2MHEA 2BOAA 1DTTB 2W24A 2LEBA 4DX8H 1FKOA 2XEXA 2LCWA 3CJQA 2RRBA 4UUWA 1R89A 1L3TA 3OXFA 1FWKA 4M5DA 2ABYA 3M9MB 2VG7B 3CVKA 4DFKA 4HR2A 1NHUA 4B9SA 1NZ8A 2DNOA 2H5JB 1FRMA 3D0HE 5ADZA 2NXJA 4RW4A 2HFOA 4LIRA 2V67A 4WFZA 2Z57B 2B5JA 1ROFA 1Q78A 1NMEB 5CXTA 2VIHA 4LF1A 2LECA 2YNGA 3TZZA 3N28A 1RWNB 4ZCIA 1PCAA 1WKLA 2C1EB 4NYZA 2HHWA 3UDCA 1FHTA 1RQ0A 4WXWA 1OY9A 3E8OA 3G82B 1RWPB 4ECXA 2BRKA 3NXZA 2YX4A 3LWMA 1D8YA 1S6PA 2PE8A 4PCQA 1S6OA 1U24A 3BEGB 4V19X 2JH3A 3SXLA 2BW7A 1AYEA 4FBTA 2NQPA 2GW8A 1IWAA 3FSXA 2YBVA 2UU9F 2XLJA 3GR0A 2DNZA 5A76A 2B3TB 4DR3J 4B02A 1SJFA 2HS3A 1N5YA 1QTMA 3KLGA 1N48A 4NZ0A 3WBZA 1CJVB 1FA0A 2CVIA 1NPRA 2Q6CA 3ZZYA 2LDYA 3C14A 3RB3A 3MCNA 2UV8G 2E5IA 3M6UA 3G71S 2HQFA 2BKNA 2L48A 2BM0A 4Y2AA 3NRBA 3MGJA 2XMMA 2XG8A 4DR2J 1Y10A 3KG0A 2UVVA 1TV6A 1G7CB 3GCWP 2EK1A 3W7BA 5KG0A 1RT5B 2DK2A 2DCLA 2AGQA 2NZCA 3D1QA 1AB8A 4J9QA 4ZOSA 1I51B 1NSAA 1GH8A 3Q8UA 1MN9A 2YQ3A 3O5TB 1T05B 3HD2A 1KHWA 2DGWA 5D0EA 3M8ZA 3CNQP 3QAUA 3TZXA 5CD4A 3IRXB 3GG0A 4RBVA 3G6YA 2GZOA 1RTDA 1PYSB 3D5MA 3W5YA 1S99A 4LF8J 4KJIA 1UAWA 2J6SA 4B3SF 3HT0A 2Q43A 1CQNA 2ZFHA 3WX4A 1P9QC 3MF5A 2HHHJ 2PD1A 3BSNA 2L9WA 2K7KA 2QLXA 4DR3F 4IR9A 5IFMA 4AXJA 2NCKL 3AFGA 3B4MA 4QIEA 1TUWA 5KFEA 2RNEA 4B3MJ 5L1IA 2G0IA 2Z2ZA 3UR0A 1JLFA 5H9FK 1NAQA 1Q8LA 3FBFA 5HANA 3V4IB 4DF8A 1HNZF 3PW7A 3CJKB 3W60A 4HEA9 2MKSA 2W9BA 4X64J 3LP2B 2XLKA 3VGTA 3O8WA 4DR2F 2KTQA 3L7PA 2YKOA 2VFRA 4A47A 2R8IA 1XMQJ 4DFJA 4C8MA 3HFZB 3PW2A 2HS0A 3KHLA 1UVIA 3KHGA 2J9DE 3V6KA 1RBAA 3ZC4A 4FF2A 1JKHB 4CNYA 4F4KA 4EUVA 5GVQA 4LRCA 1FRXA 2MZRA 2RF2A 3RRKA 2GC8A 4C2MA 1HNXJ 1KBRA 3T6JA 3FMBA 3NKYA 5B0AA 4C0HA 4QR0A 1QUPA 1URNA 2OPRA 4FBUA 3K5LA 1E6VB 5HP1A 1R0AA 2LXFA 2Y8YA 8ATCB 2QL9B 3VAFA 2HZCA 3D3BJ 1TU0B 3VCDA 3F41A 1NB2A 3BKFA 4K5SA 2VOOA 4I56A 2HNYB 1K73T 2KHCA 1Y3KA 2K2PA 4PG8A 2QG9B 1RLCL 2E9TA 1WKJA 3KLFB 2WVDA 4Z7CA 4NX9A 4Q7AA 1FJ7A 1RAOA 5FIIA 2AWZA 4KGVB 4UT4A 5CYMB 2C22A 3TA1A 4ECYA 4ECRA 3EPGA 3RBXA 1ULRA 4UZBA 3E01B 3D6MB 2ZWPA 2E9ZA 2LU1A 4FYWB 1PYTA 1HHSA 3DU5A 2IDLA 3SFUA 3DRRA 3OT9A 3M2VB 3UE2A 4IG3B 2V8HA 1NSQA 4WP3A 3QLHA 4B9VA 4TY9A 5C2GA 2FGCA 1HI0P 1MSWD 1JLBB 4I2PA 3M2UB 3GIIA 3RAMA 2HBZB 3MR2A 2NXCA 2X51A 1GAOA 4LRFA 1NEEA 3RUBL 1S72S 4OX6A 4KFBB 3DOLB 2IPOB 1LNQA 1F9FA 4IFYB 1TKTB 5KG4A 4WZQA 2CDQA 2IY5B 4DQSA 1NK0A 5F8JA 4U7UK 4L6V3 3F73A 1K0VA 4K59A 3OUYA 4OZ2A 3PW4A 4GKJJ 4W92B 4TYAA 1VQ8S 4ED8A 3AOAA 2KYXA 5HVHA 1QM9A 4HDHA 1QTNB 1PBAA 1OYDA 3MR5A 2PI5A 2UXDJ 2E1RA 2GHPA 4NRTA 2JL9A 3FCVA 2QSFA 3K2YA 3K8VA 3R6GB 3VAIA 2XO7A 3V6HA 2A10A 3H2LA 1U47A 5FDLA 3HFVA 4N5SA 1CC8A 1RAFB 1RWVB 2OPSA 4HACB 2Z0GA 5K8PA 2GMLA 1FCAA 2RUSA 3FNNA 4U96A 1KQSR 5DQGA 2VHGA 4F4WA 3BBCA 4CZCA 3MR6A 3M1VA 4ID5A 2HK2A 1QDUB 4AE5A 4DV1F 1SV5B 2I2YA 1OSDA 1LWCB 1HR0J 1U2FA 2NUUG 2DJWA 3H42A 1NKEA 3SSRA 3QAEA 2LKZA 3JXOA 1R8AA 5J2PB 3AY0A 4ZS6A 1AUDA 4WE1B 3GIMA 5G0RB 1T03A 1X4BA 4O44B 1NHKL 2X1FA 3OVSA 3RBZA 4M5DB 3HSZA 3OVBA 2WBMA 3NGRA 4D3GA 4DSLA 4M8LA 4DL2A 2U2FA 4F4XA 2JDJA 4ELUA 4ILLA 3GTYX 2ZBPA 4EYHB 2QL7B 3PRVA 2Z2MA 3ENAA 5F8LA 3EPIA 2W25A 1Y5NB 4AL6A 2HWIA 4F25A 3WC2A 4GKJF 2EFVA 3EZ5A 4P6QA 3DLEB 1VBZA 1FD2A 2AJFE 2HNZA 2HNDA 2YNGB 1NSKL 2W4PA 1NK7A 2UXDF 5EWGA 2IIHA 2W7AA 4QU7A 2J0XA 4ZVEA 3EZOA 1HHQA 2DRDA 2GJFA 4M5NA 3C15B 3VWSA 2GO9A 2QTWA 4TU8A 3M8RA 3BGFA 3E3XA 5IT9Y 2BQ3A 2YNIA 2ZVIA 1FT8A 2YKQA 2MLXA 4CNZA 1SKRA 5DETA 1N4LA 2FVPA 4DQIA 5J2QB 1HR0F 2EFGA 1RT2A 3P49B 3R97A 4TVAB 2H4YB 4WFBQ 2R4FA 1I6JA 4I1TA 3HT3A 4YS2A 3VGVA 2ROPA 3V6DB 3CC4S 1N34F 2AF6A 2W2QP 3NNAA 2GAHC 4MMOA 4J9PA 5HQMA 1X4FA 1DRZA 2K3KA 1RAJA 2OFGX 3M8YA 5ETMA 3C14B 1KVIA 3I9V9 2IM0A 1PC5A 1WJ9A 4DSJA 3F56A 1GMVA 3FEYB 2LP4A 2XQCA 5AXMA 1U0HB 2ASDA 1QSSA 2RDJA 2LU2A 4K0KJ 1HMVA 1RT6A 4RKUC 2IYGA 1TV6B 1MNEA 2RAQA 3R1HA 1FJGJ 3ENWA 3TR5A 1X4EA 2ZITA 2KT2A 1EP4A 1N52B 2H54B 2AX0A 4I7FA 4RUHA 4UZCA 2ZHOA 3MPUB 3POTB 3HVTB 4Z2XA 4ICLA 3K5MA 3M6VA 4TQRA 2HLTA 4M5JA 2M88A 1A7GE 1HKAA 1KNZA 3Q8YA 3HD1A 1C4AA 4QPXA 2QL5B 1F5AA 2SXLA 3PFOA 4HHUA 3TJ9A 1XR7A 2E29A 1RTDB 3EXCX 1S76D 1WWHA 1RA7A 2GIRA 2O5DA 4O4GA 1TL3B 2CJYB 2H9ZA 2D7SA 3AJ2A 4P73A 3BS9A 3QFHA 2FVRA 4DUYF 4ZP9A 4OHVA 3AT1B 5IOLA 1H6KX 3OSNA 4HDGA 4KQZA 2BQRA 3OL7A 2BE2B 2W7PA 2EFNA 2ZDOA 1FFGB 3QIDA 2VPWB 1UW9A 1RSCA 4KTQA 2GQQA 5E3AA 5IWAJ 3CXCR 3MMBB 4M63A 3G4SS 5F3TA 1JLFB 1RZMA 3W2WA 5CYQA 1F9HA 4RJVA 2W9BB 3QSIA 1RT7A 3N0VA 1TL4A 3M9NB 2QA1A 3TZWA 4JBCA 3E51A 3LP1A 3UWTA 1SPBP 2M2BA 5BYQA 3TQEA 1J2VA 4C3LA 1U02A 4DCOB 1XNQF 3EZUA 3MMAA 3HZGA 2MQNA 2IBKA 5C5JA 4W4MA 1WF1A 3JQJA 1SL0A 5EHHA 3VZHA 1T9UA 3I56S 4AQYF 2VASA 3H2VE 3KJFB 3FBCA 2CPIA 5DG7A 2B6AA 3MPYA 4FS2A 1JNRB 3SDEA 3L95X 2RF2B 1EQ0A 1OPIA 5CCMA 3B78A 4LRDA 4F36A 1VLYA 4DR7J 4DUZJ 2OPRB 1OWXA 2N82B 4X66J 1TMMA 5HP1B 1RHQB 1R0AB 4DR1J 3VHQA 3PHEA 3SCKE 3MCMA 3VTIA 3VV2B 4MKAA 4HHHA 5C2CA 2A18A 3PEJA 2HGNA 4PG4A 4DSIA 2EI5A 3MAQA 3FK4A 2JX2A 4WFAQ 3GYNA 4PRFA 1GXTA 2YH1A 2GCFA 4GVBA 1LXJA 4KGXB 3QATA 2VG6B 1RABB 4K50A 4LF4F 3HULA 1E6YA 4ZVHA 3GB0A 3JAMU 2WVCA 2PI4A 2YX1A 3EGZA 3I0SB 4IDKA 1NH7A 2CPJA 3WIUA 4BWMA 5GAHU 1XEZA 3KTQA 1XC9A 2E1CA 3CJ4A 1EJ7L 2IRXA 4C11B 1NNDA 3TRGA 1C4CA 2DB1A 4JI2J 3QLHB 1RDRA 2Y1IA 1RT3A 1FDNA 3RU0A 3LAMA 3D1HA 3QFWA 2CKWA 3JYTA 4GO5X 5J1EA 5HBMB 3HCXA 1IBLF 3M8QA 2CPDA 3C6UA 4BC7A 3IR7B 1F0XA 1CSJA 1IBMF 4OHXA 2IA6A 5B0FA 1FVSA 4I69A 3A3PB 4JI7J 1NJIT 4LF9J 2MZJA 3K0JA 3EX7B 1S0NA 4F4ZA 4X66F 1PIEA 3LO3A 3G6VA 4DR1F 2R9LA 3RB0A 5JUMA 2HFVA 4PXBA 5CHCB 4RWXA 2DGTA 1KOOA 2IYIA 2RE1A 5H1SV 3QPIA 4V1Ak 2DR9A 1TVRB 2XGQA 3TO8A 4JV0A 2GS8A 5FDLB 2CDRB 2MB0B 3FC9A 2VUGA 2OPSB 4CYUA 2C3UA 2XI2A 1U1PA 1XMOJ 2MTLA 1WEYA 3J81U 5LSLA 3A8EA 3UD5A 2D3O1 2D1CA 3JTNA 4X4PA 3UN3A 4NYPA 3M1VB 1X4HA 4ID5B 1S1UA 3A8KA 3QRQA 3IR6B 4PAAA 2MLZA 2LQBA 3AXKA 2G0CA 2J7KA 1RWXB 2FIUA 3R1LA 3NS5A 4NE9C 3TUPA 2QA4G 1AT1B 2V2QA 4JI2F 2DY1A 3ISND 2LMIA 3HSDA 3CCTA 1T03B 4TU9A 3UCZP 3HJVA 3PJXA 1JQGA 2AGPA 2UVRA 3MECB 2RD5C 1EQMA 2EEYA 4WFYA 4MH8A 2F1FA 4YHHF 1YTYA 1SJ1A 3VF0B 2CPZA 2PFFB 3CSKA 2X1AA 1V9OA 4J9SA 3UDLA 5CABA 1KR4A 1QAXA 2IBOA 2K7JA 1CJUA 4O3SA 3B54A 4UQTA 2FPHX 4KO0A 4JI0F 1WEZA 1KLNA 2ADBA 5ETTA 5GMDA 3MHYA 3OL9A 2HNZB 5KFKA 3THPA 3J7YI 4RW6A 4P71A 3CIMA 2EG1A 3UW1A 2XSJB 3I31A 1IKWB 4EU0A 1NK6A 1WG4A 1RISA 1LV5A 1DLOB 3IWLA 3A3NB 2KJVA 3NBPA 3PKMA 1P6TA 3PW5A 1NDPA 4NA3A 2R7UA 1D3WA 5A2QY 1TKZA 3T5HA 4WWSA 3G86A 4YY3J 4B3TF 3IBCB 3CO9A 4DV5F 4DWIA 3SIPB 1VQ7S 2MZ1A 3OLAA 3HHLD 3TZYA 1ZM3A 4HH1A 3BGRA 1T7PA 2DGOA 2GNKA 1KONA 1VRQC 2CVEA 1FNOA 3KLIA 4ILMA 1B7YB 4OJHA 1RAEB 1QJHA 3LGHA 3VZIA 3V6JA 1C0TA 4F3QA 2F65A 1RT6B 3MUTP 3FQLA 1HIYA 4GVLA 4ZPWR 2FJWA 3ZO7A 3T3FA 4NEZA 2J7UA 2XULA 2RSQA 4ZLJA 1EP4B 3NGSA 4CI0B 1AUSL 4MKVA 3L3CA 4ICLB 3FSIA 2GIFA 3IO1A 3SCLE 5GMEA 2C2ZB 4F8RA 1M5PC 1VQ5S 4DQPA 4B9NA 4NLOA 1JLGA 2CQDA 4ZHRA 5K5MA 3G87A 2AKWB 2YKPA 3BGLA 4QYZJ 4DDFA 4QBUA 2AYMA 5D4PA 1FE4A 1W26A 1Q82T 3HVWA 5EX3A 4ER8A 1PGZA 3BF4A 3DRPA 4O4GB 4H4MB 2FJDB 3O1LA 4JI8J 4C8ZA 4KRWA 3RBEA 1HNIA 2CZ4A 5I3PA 3GQCA 4QWDA 1CS4A 5JXSA 4G65A 4J9UE 2DGSA 3R7SB 3D28A 4G1IA 1NUEA 3KNAA 1KHVA 1FESA 2D69A 2WHOA 2CJAA 3AOCA 1TK0A 1DJ0A 4IOAQ 1GMWD 4JI4J 4RW9B 4MKBA 3KLEB 1DARA 4JV5F 2HG4A 2VONA 4LRAA 4PUOA 4WJBA 4U9RA 4FKXA 3BREA 5KFLA 4HVZA 4WCEQ 1UVNA 3ZTQA 2VQFF 3CWJA 3W2WB 2G9OA 1S1XA 4ZK7M 2MHNA 3DOMA 3TVKA 1RT7B 3MEGA 5KFAA 2ASJA 2PMHA 5B08A 4HT7A 4DV3J 4YFUA 2D74B 3CTRA 3BDPA 1QSLA 4ZPAA 3ZNJ1 2OD6A 3MMAB 3HHNB 4A4JA 4L76A 2H3EB 2CA9A 1M5HA 3DDIA 3DI6B 1YQHA 2NR0A 5F8HA 3IM8A 2WRMA 4USVA 2GMJA 4DF4A 3TVZA 3QJLA 1HHTP 1H2UX 5LMUJ 1Y9OA 5HVGA 4A8SA 3CULA 4Q0BA 6FDRA 2RQKA 3GV8B 2QIFA 1PJ7A 3EE3A 2XMWA 1R6YA 2XBPA 5F0WA 3CEDA 3W63A 1GNKA 2A6MA 2QLJB 3M05A 5LMNJ 2K1RA 3R5CA 1I3OB 1RTJB 2MZTA 3SSSA 3PACA 2YWGA 1WOSA 2J8AA 2HAIA 2IM1A 2J5AA 1CG2A 2IAJA 2QMXA 2M4MA 2R8JA 5L1KA 3VAJA 1D9DA 4YR2A 3TARA 3KK3A 4GVBB 2LEAA 4AYBD 1SCJB 1KEKA 2AX1A 2ZE2A 3MPDA 3MM5A 2BDPA 4RBUA 4IDKB 2HVEA 2R7SA 2EFQA 1VRUA 2EPIA 5B0EA 2HHTA 4L75A 3LF0A 1R8HA 2J0WA 1IN0A 5EWFA 5FLXY 1VQKS 4M5HA 1ELOA 4G3IA 3RW6A 1FFSB 3DOKA 1JXVA 1RT3B 3SFGA 2DYAA 4R8UA 3K8WA 5HROA 1R0CB 3JYTB 2B9YA 2ZM6J 2ZZMA 3BO2A 4FN5A 1VMBA 4IRDA 2OUGA 1SXLA 2MQOA 5D15A 2WONA 1B99A 5KG2A 2XCAA 2G2ZA 2KJWA 2VOPA 1N8RT 2V4JA 2UUAJ 3PYEA 2WCXA 4EZ9A 4DN0A 2LDIA 1L3SA 1S9EB 1RHRB 1HW8A 4F3MA 1SIWB 1JJ4A 4RR5A 1Y5IB 2RU9A 3GCXP 2JEGA 4Y3CA 3IFEA 4FXWA 3PYGA 3K17A 4YUDA 3QBCA 1N6QA 5LL6d 1PKUA 2HRYA 2FLNA 2GHWA 4ZVPB 1G4CA 2J0QD 4DV7F 1HBMA 5J2NB 3RG6A 3I4HX 3OL6A 3DGVA 4TYBA 5T41A 2CRLA 1HFEL 3DLGA 2J76E 4ZITA 3RRHA 2ZBIA 4IH6A 3RYLA 2E1MC 5A8RA 1RT1A 4OYAA 4KHPF 1R7IA 2ZDPA 1V3SA 2C3YA 4C8OA 2DTJA 3OXGA 5JVHQ 1H3DA 1FF2A 3PYDA 2J9CA 3GLJA 1OPZA 4PXDA 1VQYA 1LEOA 3K58A 2CQ2A 2LEPA 3MTKA 4FP9A 2YNFA 4Y65A 1TL7A 3J80U 3R7BB 5KFXA 2Q79A 1Y4ZB 4DOZA 4B9MA 4DR6J 1S1TA 2CQPA 4QZVB 2OTLS 4WP9A 2NSBA 4EFAC 1RCOB 2KXHA 3S8SA 4OLOA 4C9DA 4USTA 2XI3A 2DHHA 4DCJB 3G96A 2QT7A 2HLUA 2HSEB 5B0CA 5FJ4A 3MM7A 4NCAA 4P74A 2E5LJ 1PSDA 4UF4A 2FLPA 2YWKA 4ZLPA 4KO0B 3JSYA 4R5PA 3I96A 3PNIA 3RBDA 1U2RA 4RW6B 3HHEA 3J7Z5 2MZQA 3OTDA 5KFYA 2QLFB 3VAKA 4QOTA 1YJRA 2HBYB 1EB0A 2XM3A 3B8HA 1NBEB 2J7WA 4KPYA 1HNVA 1HNWF 3MOJB 1YJUA 2ZNZA 2FZCB 3Q2TC 3OSPA 3M2RA 1JXLA 2DXFA 3ZNUA 1YRTA 4EEYA 1UVKA 3UR3C 3EJMA 4USHA 1ZZFA 5IM0B 4J9LA 4LUBA 2QJ3A 1FNMA 1WC1A 2JVOA 5KFUA 4KC5A 1JB0C 3X3UA 2MJNA 2IJNA 3MAHA 5I42A 1JLQA 3JTOA 1ACMB 1JLEA 4QYZK 1CLFA 4FF4A 2RH3A 2XHWA 1HL6A 4BCAA 1TFWA 1CJTA 1M1HA 3C8YA 1VK8A 3ZZOA 2ZH1A 2DH7A 3C3LA 3KLIB 2MPUA 1WHWA 2OH2A 4DV2J 4MT1A 1H2VZ 1ZA1B 3G8SA 2HBQB 5IT4A 3I87A 5LSOA 2LVWA 1ZPVA 2KZMA 2MMYA 2W01A 3W8PA 1I94F 2CQ4A 3RRGA 3QT7A 2NZ4A 2F8HA 3AJDA 3C46A 4ID8A 2CPEA 2JC1A 3T1HF 4NLVA 4DPTA 2IVFB 5F3ZA 1T3OA 4X4NA 2KU7A 1ZPWX 3EGWB 1RTIA 3WDOA 1YX2A 4DG1B 1NLKL 3TUIC 3CD5A 4ZHRB 1LFWA 5EDWA 3K7RA 1S1VB 2AW0A 4OYWA 4RPFA 5K9FA 1S4EA 3M8PA 3DFEA 2VG5B 1HNIB 1BE4A 4U8VA 4USWA 2RQ4A 9RUBA 3OJUA 2DISA 2DXDA 4EK2A 3MFIA 4H4OB 6AT1B 5F41A 1SC4B 3GSDA 5KG3A 2F8EX 1RA6A 1IKXA 2YY3A 1PAEX 4Y2CA 4DJBA 5AJ3J 1S77D 3HFKA 3K57A 4CLKA 2BACA 3QYYA 1SUQA 4LFAJ 5HL7Q 1N36J 1TK5A 2CUYA 1BGXT 3A8JA 5L39A 1C0UA 1FK9A 2JOQA 3W66A 4OJ1A 3BH6B 3QSYB 3U27A 1S1XB 3LP0A 4EBEA 2NREA 3QNWB 2VFUA 2ZZNA 4P2MA 1X7VA 2OPPB 2FY1A 2I0XA 5K8MA 2OKQA 1BC6A 5I3UA 3SI8A 2QA4S 4C48A 3D9BA 2Y8WA 2R3VA 4WKRA 2V50A 2CPYA 1X5OA 2L41A 2R7TA 3GIRA 1XERA 4OI1A 3IA0A 4LF5J 4LMZA 4RU9A 1XNRJ 1LQ9A 3V81B 2BJ1A 3RW7A 2V8DA 5E3RA 3G6ES 2W9AA 2GGPA 1VC6A 5IQ6A 2VC1A 3U02A 3CCQS 3K5NA 1M0SA 5DZ6A 3ETOA 1HBUB 3LQVA 2B7BB 4P2SA 1DQAA 1N5QA 5H9EJ 1KD1T 1T3NA 4UOCA 4FF1A 4M5LA 3N6LA 1LWXA 5EUHA 2OTJS 3TX8A 2APOA 3MUMP 2EVZA 3PW0A 2RUGA 2H48B 3GJTB 4K7QA 3ZZRA 2ZOGA 2IAJB 2VD3A 4BWJA 2MDAA 2UUCF 4RNNA 2CNKB 4YOEA 3ILOA 5LSRA 3KK3B 2WOMB 4PWWA 1IM4A 3NLCA 4DR4F 3MM6A 2RS2A 4ES1A 5M2RA 1FTCA 2ROEA 4Q8EA 2C2KB 1NJYA 2ZE2B 1MMNA 4NLSA 3RAXA 2XNQA 2JSXA 5ETPA 1VRUB 1BQNB 1HA1A 4J9VA 4OMFG 3QZ7A 2JLGA 1NPKA 1Q79A 4RL1A 4CO2A 3Q23A 1RT4B 2KI2A 4JYAJ 1VIXA 2HHUA 4C4WA 1XNRF 5J2MA 3H4DA 3OW2R 4R8UB 2HEKA 3QRPA 2JEFA 1JJHA 4ECWA 3TOQA 1SJRA 1MG7A 5L9NA 5ITHA 2VC0A 2GVDB 1EX8A 5DM6Q 3PG9A 3ZZZA 4A8XA 3A1YG 3UVJB 1HQEA 2BVZA 4RZRA 2KM8B 1T95A 4N77A 4ECUA 5A6PA 3CMES 1FKPA 4NCGB 3TA2A 3MEEA 4CT8A 3MOZA 1UJ5A 4KSEB 1F1BB 4ZVSB 2C2EA 2N7YA 3R5AA 1HBMB 2IVYA 2WK4A 4X65F 2VZ9A 3TAMB 4IG0A 1LWEA 4PKDB 2KZZA 1RWUA 4IKAA 2HVHA 3HMJG 1WORA 2K06A 1W2BR 3CW2C 4MYUA 2JC0A 3PHTA 4FNIA 3CO0P 1KP6A 3I32A 3AAWB 2AEMA 2HFSA 2HHSA 2IC3A 2L08A 1J5EJ 1FI4A 3OQ2A 4TY8A 2NXEA 5KG6A 2UUBF 3TANA 3CJ0A 4FVCA 3H25A 1RTHA 4UW2A 2FVSA 2CWXA 1S1TB 2D41A 1UKUA 3WHIA 3DLKA 4LJMA 4Q44A 2OHDA 4JI3F 4J9NA 1KRPA 3CD0A 2B0GA 4OJ3A 5ETLA 3MCOA 1TAUA 2ZZTA 2YQ1A 3IAS9 1YBUA 4M1KA 3MMJA 1FX2A 2CJKA 4WIIA 2M7SA 3KJVA 1YHQS 4KIAA 2VL1A 4OX9F 1OYEA 3QGIA 3H4BA 1X31C 4F04B 1WF0A 3KK1B 1OY6A 2V9KA 2V4RA 2F9DA 3ADAC 3SYZA 3NS6A 2DPIA 1R31A 3HSGA 1WUUA 1X4AA 1QLNA 2Q3PA 2QMUB 1FJCA 3OFGA 4QIGA 2W8LA 5HMZA 2UXBJ 2V6AA 2H51B 3KLHB 1B0TA 1DURA 5IV4A 5KFVA 5B0BA 1B3TA 4ZPBA 1URRA 5GAHI 5E3CA 3MR7A 3S01A 1KKHA 2DVIA 2XMVA 1S9FA 2OD4A 5HVFA 1NJXA 4JI1F 5LJ5Y 2BJDA 3BDEA 4Q43A 4J91A 1YJTA 2MQ8A 1YWXA 3NCPA 2FLOA 1JLQB 2PGCA 2R8GA 1JLEB 3LH2S 3Q24A 1UTAA 3EMTA 5LM7E 1DQ9A 2ZJPQ 4XPCA 1CJTB 1H2TZ 3NGDA 3HHLC 1X60A 2HQCA 3NL0A 2VPZB 1H98A 2KFNA 1OIAA 2CQHA 1S1WA 4F0HA 5C25B 4NPOA 4EZ6A 4NA1A 1RHUB 1UZDA 2RIJA 1UCNA 1ZM4A 4ANEA 1F5CA 3M30A 1TUVA 4DV4F 4E8UA 1TAQA 1VS3A 4AT1B 2DCUB 2DPJA 2ATCB 2KDOA 4KH1B 1ZM2A 4EMDA 1KN6A 5DDRC 1U25A 3LALA 4ELTA 4ZLLA 5KFOA 1V3RA 4LBHA 1A6LA 4JB8B 5HN0A 4RW7B 3FRYA 3W1YC 4G1PA 1RAHB 1FDAA 1ZAWA 2P9GA 4IUFA 3RGIA 1Z1ZA 3W8GA 1FERA 4CO4A 1CEZA 5LT5A 4AUKA 2J0SD 3SZ2A 1HPZA 5CAAA 1MWZA 2VICA 1YZ7A 3EDQB 1DAXA 2W2OP 2BBEA 4KPCA 1X5PA 3KKFA 1XWLA 2DITA 3BYRA 2PEBA 3X1LB 3T9NA 1P1LA 1RHJB 1TR0A 2OSRA 3OBIA 4OYIA 2GVZB 2DIVA 4OFZA 4YDXA 2FHOB 4OYMA 2Y0BB 3QT8A 1U8SA 5H9EK 4EWTA 2YVSA 5T14A 3ZTSA 3KG1A 3ENVA 2YKMA 1MROA 2NXNA 3KDNA 2V8PA 3QGHA 5KT2A 4W90B 1REVB 1Q5YA 3FZ2A 1ZM9A 2HQDA 4OHZA 1OO0B 1HWJA 5KFMA 4Q5VA 3PVXA 1PO6A 3D7SB 3EDRB 1EKSA 3MFHA 2PIIA 5ETSA 1J27A 3JAMY 1KFDA 2EWHA 4LFBF 1VQLS 2MKIA 5F8GA 1SBRA 2LA4A 3MM9A 4HT5A 7FDRA 2LQ9A 2GGPB 3T5KA 3LGNA 2VF3A 2FGOA 4ZJLA 3T19A 2R8HA 5B0GA 1D9AA 4G1QA 2YPZA 3OTEA 2AYGA 2ERRA 1EAYC 2P6SA 4ZIWA 3VQSA 4MIWA 1BWVA 1D09B 4U6PA 2HHQA 2ZUAA 5AE3A 1VQ4S 1CC7A 2GFFA 4IRCA 2KXNB 1NKBA 2ZOFA 3OFFA 2CXEA 2QA2A 3CCES 4A8MP 2UU9J 2ACYA 2MJUA 4M5GA 1T8EA 4KHMA 1IQZA 1K1QA 4BLGA 4P7VA 2AEJA 1QUVA 3NGKA 1U48A 3B82A 2P9EA 2F9JA 4F02A 1XBWA 3IBWA 4QR2A 1SQGA 4DXLA 5BR8F 1HYSB 5L9XA 5JJBA 3I6PA 1NO8A 1TL1A 2WSCC 4JI5F 3EICA 3PRDA 2FLLA 1IBKF 4RO0A 3CD6S 3BBBA 3J81Y 4MIAA 4NLYA 2J6TA 3D1OA 2PSZA 2YWHA 3AB2B 4M94A 2W7OA 3DXSX 1WSRA 1HWUA 5DQIA 4DV6F 2HW3A 3KUHA 4ZPCA 2DEJA 5GAGU 1M1KT 3PM9A 2PMWA 5HAOA 4USKA 1QE1A 5E33A 4KH0B 4URGA 2FVQA 1JNZB 1FKPB 3FQKA 1IJEB 2O01C 5KFDA 4AFFA 5IT9U 4MIBA 5A0YA 3MEEB 4DSKA 2IRUA 1ZBTA 4B3SJ 2Q1LA 5KAKA 2KB2A 2H1YA 1HWLA 1SQEA 3MTJA 3N4WA 4PPDA 1LWEB 3JSRA 3LWLA 3FRZA 2FC8A 1FEHA 3OV7A 4BS2A 1YJNS 4Y6IA 2CNNB 2BV3A 4DR5F 2CPXA 2KRBA 1U2CA 1ZZNA 4DLGA 5D4LA 2IC3B 1VQ6S 1CJKA 2AJ0A 2IVMA 3N5BA 1YJ9S 3GIKA 1M5OC 1DTQA 1HNZJ 2ZH4A 1TELA 2CFXA 4TY8B 3TJAA 5E2QA 4LQ3A 4IRKA 4QU6A 4MAKA 5D3GB 4FYVB 2F4FA 4X4TA 4CLZA 2JFDA 1WD6A 2QE5A 2N4CA 5AXLA 2LQ5A 1VQSA 3EM1A 4LR7A 4WYLA 2MQPA 1RTHB 1VC0A 2E1PA 1VK3A 3R27A 4ES2A 3NOGA 5DRKA 2W2NP 2IMWP 2XY6A 1RWMB 1NU4A 2V94A 3I9ZA 2BE9B 2YX7A 4LFCF 3MI7X 4OI3A 3VALA 5A8WB 4FF3A 4ZVQB 4NOHA 2EW9A 1RUSA 3PX4A 2CYYA 1X5SA 4K4WA 1KWMA 2QLBB 1X9SA 2Q6BA 2XYPB 3BM7A 5GADU 1NK9A 3ITHA 1UA0A 3GYXB 1SQFA 2KYZA 3R2DJ 1JX4A 1ZYQA 4PQUB 1SH3A 1Y00A 3J7A1 2A0FB 3PR5B 2OPQA 3GFXA 2WVFA 2IA0A 3PO5A 1JLCA 3BJYA 4R0JA 5KFCA 1NK5A 2E5HA 1S0MA 1U1OA 1TMJA 3UQSA 4CDIA 3KK2B 1IKVA 1YJ7A 2R7VA 3FZBA 3RR8A 3CDBA 2RMLA 2BMBA 3PY8A 4F0MA 5KFGA 2DGQA 3DKDA 1ZTTA 4PPZA 5L1JA 2FHMA 3IGNA 3MAAA 4J7CA 2XMTA 1NDLA 3RAQA 5F9NA 4ZPVR 2VV5A 4ZPDA 2HIYA 2D3UA 3GV5B 4JI6F 1N32J 4Y00A 3PIPQ 1KTVA 1XR5A 4JP8A 1U49A 3IAM9 3P4UB 2DNQA 3D6FB 1D8ZA 1HBOB 3CDEA 1F5BA 4ED4A 1FTRA 3VAHA 2MKHA 3TA0A 2ADCA 1U09A 3OJSA 1CULB 1FXRA 2W4CA 3M30B 4ECZA 4DPWA 1RBOB 1GX5A 3OR1A 3S1TA 5IV3A 2EC2A 2JRSA 4IH7A 4WYWA 3PTWA 2XZDB 1UFLA 1X8DA 1BWEA 1RHKB 1NKCA 3NNHA 1DQ8A 2L3MA 3CCMS 1N88A 2QZ8A 4U8YA 1M5VC 2NLWA 2CWKA 1RKJA 4K2JA 4PG7A 2OEJA 2HAFA 3ILLA 1KTQA 2R7RA 3SSQA 1HLWA 3CF5Q 2F8MA 1DZ5A 4AL5A 4WK1A 5A6WA 3R5DA 1ZS6A 3WZ0A 1XJWB 2YPYA 4B3OA 5A8KB 2QRRA 5LXRA 2AT1B 2EKNA 4O4RA 3I5CA 3OR2A 4DV1J 4NLPA 3GILA 4R0EA 2FHJD 3KMQA 4AL7A 4RW8B 1I1GA 3QWUA 2AEFA 2ILZA 5EN1A 1N32F 4QPTA 4A8YA 3T1AA 1HI1A 2P5VA 2DR6A 2OAUA 2B9XA 3CCUS 1C1CB 4ED5A 1QSYA 4X4RA 2PFDA 2J6UA 5CA5A 2YKMB 1MROB 1RP5A 4QIVA 3EXYA 4CO0A 3LTOA 4ZVUB 3I82A 1LW0A 2E44A 4DL3A 1VQNS 3NGTA 2WAQD 2YWEA 1LFPA 1UJ6A 2XCPA 2B7CB 2BA9A 3RTVA 1S49A 3LOUA 3DLJA 1S6QA 2DIUA 3CGIA 2I5JA 2OP5A 3MM9B 4CH7A 1FJEB 1YLXA 2HWHA 4LF7F 5KT6A 1KVKA 2F5GA 1NXIA 1PG5B 4MYTA 4ED3A 3WQPA 3BN7A 1LWFA 4DPUA 1IVZA 2MGZA 3R8YA 2JJ4D 2P9CA 4O3QA 2W4DA 4A48A 2UVUA 3D6HB 3IS9A 1CQMA 1UWBA 5BJRA 3FMWA 2JNJA 3OPKA 3H0PA 1YITS 1JXEA 1JJ2R 4K2XA 1WHXA 1F3FA 1WEXA 4ALZA 1HARA 2MZSA 1FX4A 4DS5A 4DV0F 1IR2A 1WKKA 3ILJA 1X4CA 4C0OC 5K8NA 3ZFVA 1YBAA 4MFBA 1FDBA 2QO3A 2RRNA 1YIJS 2C2DA 1N34J 3BH7B 3IG1A 2HVIA 3FKBA 1HI8A 2DGXA 1FKOB 1UETA 4NLUA 1R0BG 2CQ0A 4OLPA 4B3RF 4KE5A 5E3QA 1TQLA 1PILA 4RW4B 3ZZTA 1K1SA 1TL1B 1SJQA 2BYCA 2ATLA 2B5JB 1SKUB 2VJUA 1N0VC 3EYZA 3PRBA 2HHVA 2IM2A 4CWBA 2HURA 3R9LA 1CJVA 4OI2A 1FXLA 2CG8A 4CQ1A 2DRBA 4ZIVA 5ETQA 3JS9A 3K59A 1TTHB 2ZHBA 2AZ3A 3ZTRA 1C2PA 3NAIA 1WF2A 4YB6A 2PC6A 3QGPA 3NEKA 2FZKB 4DS4A 2Z2LA 1QE1B 3AQPA 1O8BA 4USUA 2WW4A 1S6PB 5A0YB 4RX6A 1RT5A 1H72C 3TAPA 2CPHA 5F8NA 2X3DA 1VQOS 5DDPC 4N8NA 4HYKA 3HKWA 4DUYJ 4LF6F 2WZ1A 1T05A 4P7TA 4KGKA 4ZA1A 3DN9A 4F3OA 2V2VA 3QT5A 2CZVC 2KG0A 2C2NA 1WELA 2V5HG 2XC9A 4ATNA 3ENQA 3DU6A 2R7WA 2EXUA 2CPFA 3MPVA 2M70A 3TAQA 1N5YB 3KLGB 2IM3A 2L9DA 1OQ6A 4U67Q 4H4KA 4O3NA 1NRKA 2DXEA 3MEDA 2EFOA 1Y0HA 3LGMA 1DTQB 4TQSA 4BHQA 2MKJA 2RQCA 1GTHA 1QAIA 1L3KA 2G13A 4PG6A 1VRTA 4N41A 1RBLA 2C2MB 3LUYA 1QY7A 1XNQJ 1VHFA 1WHYA 3PXGa 1B64A 2WVEA 4YR3A 4AQYJ 1SC1B 5SZTA 3V4IA 4LRBA 5D0GA 4I6WA 2B51A 5CD4H 2XYGB 4USMA 2XWXA 2DNMA 1T0TV 1UW4A 2GMHA 3D4JA 2RVJA 3FCWA 1HWIA 8AT1B 1FRLA 4DSFA 2Z58B 4DQQA 3ITHB 5KG5A 3KHRA 1IBCB 3NP5A 3D54A 1JKHA 5AE2A 4WF9Q 1H74A 5ETKA 2OPQB 4D3HA 1JLCB 3UFCX 2R42A 1UFKA 4C8LA 1YVFA 1T9XA 1NSPA 3GG1A 2QYCA 3TYTA 5LXYA 5HMWA 3G6XA 2ACMA 4LF4J 5ETVA 1N54B 1F2GA 4CLSA 4OI0A 1TZ0A 4O0IA 3S6EA 3QWPA 3D67A 5SUHA 4N56A 2OGUA 2DKOB 3MAAB 1Q7YT 4XAKA 2HNYA 1H7WA 4ZN1A 5I4MA 3UD3P 1ZTWA 4PYDA 4KGMA 2RT3A 1N33J 1WC6A 1OSCA 3T1YJ 2G2OA 2VA3A 2N3OA 2AQ4A 5CYMA 4M95A 3GFYA 1OMSA 1REGX 5KOXA 5KFWA 3HDSA 1IBLJ 3MXHP 1NK8A 3TEGA 1U1QA 2VDHA 4LSLA 2ZEJA 4TLQA 1IBMJ 5D0HA 2FVCA 4P72A 2QSWA 3OR1B 4IG3A 2HWTA 3HJFA 3BGUA 2DR8A 5E41A 3CIZA 2UXCF 1Q53A 2ALYB 3NG8A 2MY7A 1JLBA 4X84A 3TI0A 2VDIA 2D9PA 2BXJA 2JWNA 2PDAA 1XIQA 1IKYA 4K4YA 1G1XA 4TXSA 2G1DA 4JOUA 2BKPA 1OY8A 4GMKA 4QCLA 5DG8A 4IFYA 4IFVA 2CJXB 3T41A 3DM2A 2UUTA 4PWDA 5MAOA 2JHEA 4B3OB 5CZXA 3KNGA 2KT3A 3OR2B 1U45A 3UDEA 2XMKA 2BRLA 3CCVS 3DRRB 1N33F 3PJWA 4RBTA 5FLXU 3T1YF 1CBKA 2Z56B 4ED2A 4HACA 3AA8A 1EETA 2GQCA 4I2PB 3DHWC 1UFWA 1JK9B
chains in the Genus database with same CATH topology
1X9WA 3H5UA 2VD3A 2KYXA 4BWJA 3Q8RB 4UY85 2MDAA 1QM9A 2UUCF 4HDHA 3VQTA 4DV3F 1RT4A 4RNNA 4YOEA 5LSRA 3FFIB 3KK3B 2WOMB 3MR5A 1WI8A 2HHXA 2L9NA 1IM4A 2PI5A 3OTOF 3NLCA 5B09A 4DR4F 1XMBA 1RGVA 4NMLA 1LWCA 2E1RA 2GHPA 3MM6A 2RS2A 4NRTA 2MKCA 2MKKA 4ES1A 5M2RA 4A8QA 2JL9A 2C42A 1FTCA 2ROEA 2QSFA 4Q8EA 1Q16B 3K2YA 3K8VA 4RNFA 2XO7A 3VAIA 2A10A 3V6HA 3H2LA 1U47A 1NJYA 5FDLA 2ZE2B 4N5SA 1MMNA 1SKWA 1CC8A 5J2PA 2PO4A 4NLSA 3RAXA 2CJQA 2XNQA 4O3PA 5DDQC 3DGPA 2OPSA 2JSXA 1VRUB 3OUYB 4MJKA 1BQNB 1HA1A 5G0RA 3HHKA 5LMUF 2Z0GA 2IFXA 3JTPA 4OMFG 1S6QB 3QZ7A 4O44A 5K8PA 2GMLA 3N6MA 2JLGA 4FXDA 4K4XA 2I5JB 1Q79A 1FCAA 4ZMMA 3FNNA 4TNOA 3CC7S 4CO2A 5DQGA 3Q23A 1RT4B 4F4WA 2KI2A 4CZCA 3MR6A 2O3DA 1VIXA 2OJ3A 4Y0FA 4C8KA 3M1VA 4ID5A 4AE5A 2CQ1A 4DV1F 5EGYA 2HHUA 1SV5B 3I0RB 2I2YA 1DBDA 4YMEA 1OSDA 1LWCB 4C4WA 1XNRF 3MM6B 5J2MA 1U2FA 2NUUG 2HRUA 2DJWA 3H4DA 3OW2R 1NKEA 3B4DA 4R8UB 5LMNF 3SSRA 3QAEA 3K5PA 4NCGA 1LWFB 1BQXA 4NZ7A 2MGZB 3MUVP 2LKZA 2DD8S 2JEFA 1YRUA 1R8AA 1JJHA 4ZDNA 4ECWA 3TOQA 4F2SA 1SJRA 1YJVA 5J2PB 3AY0A 5L9NA 4ZS6A 1AUDA 2WW8A 5DLFA 5ITHA 1S6UA 4WE1B 3N9UC 2VC0A 3GIMA 3IS9B 5G0RB 1TK8A 2EBGA 1UWBB 1T03A 2HVZA 1X4BA 2JLFA 4O44B 5DM6Q 2FC9A 2NSCA 3ZZZA 2X1FA 5THWA 4A8XA 3OVSA 4O3OA 3DLEA 2QEXS 3RZAA 3A1YG 3TQ1A 5GMKa 4EYIB 1HQEA 4M5DB 2BVZA 5IT0A 1K8AT 4RZRA 2JVRA 3TAMA 1VQ8S 4U7CA 2KM8B 1T95A 4N77A 4C3MA 4ECUA 2BQUA 2WBMA 4FNHA 5A6PA 2E1AA 3OVBA 3MR3A 5J2MB 4D3GA 4DSLA 2OFHX 3UD4P 3CMES 1FKPA 4M8LA 4ETXA 4YQWA 2U2FA 4F4XA 4DL2A 1XK8A 2JDJA 4ELUA 4ILLA 2KFZA 4NCGB 3TA2A 3HX9A 2FD2A 4EYHB 5KT3A 3MEEA 4ED1A 3UCGA 2Z2MA 4CT8A 3MOZA 4ECTA 4MFBB 5F8LA 3EPIA 2W25A 1Y5NB 4AL6A 4NXMF 3IG1B 2HWIA 4F25A 3T5JA 3WC2A 3LAKA 4Q45A 1UJ5A 4GKJF 4EBCA 4KSEB 2EFVA 4RUCA 2EFPA 2C2EA 1SL1A 5DG9A 3J7ZT 4FYDA 3ZZPA 4NWBA 3EZ5A 1S10A 3NMRA 6FD1A 2VA2A 2M8DB 2VQEF 4P6QA