1LWCB

Crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
423
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 117
structure length 402
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwcB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB03
3OSPA 3QO9B 5HP1A 1LW0B 4LQ3A 4TN2A 2XGPA 3EPGA 4I7FB 1S1TA 2JEGA 1RTJB 1GX6A 1LWCB 1TKXB 2JLEA 2GC8A 3BREA 5J2PB 3NBPB 5KFIA 1R0AB 3DM2A 1HNIA 1UWBB 5K14A 4J9KA 3RB6A 3JYTA 2OPRB 4PQUA 2BRKA 3CJ0A 5KFNA 2W8KA 1DLOB 2ZD1A 1S48A 1RT4B 4IFVA 2AX1A 2B5JA 1JLEB 5KFHA 4LSLA 5KFLA 1S1UA 5KT2A 3H59A 1MU2B 5I42B 4NLXA 5DLGA 4ZVEA 5KFMA 5L1IA 3TAMB 3IRXA 4DL6A 3DDKA 4FS2A 1HYSA 3M8QA 3MR3A 2ZE2A 4ICLA 4Q43A 5KG3A 2B6AA 2YNHB 4MFBB 1JLGB 5T14A 1JLQB 1VRTB 4IG0A 5DGBA 5J1EB 2IA6A 1RT5A 3MEEB 4B3OA 2D41A 3CJ5A 2AGOA 2UVRA 4WZMA 1S1XB 2R2SA 5DQGA 1NNDA 2XWYA 4NYZA 3IGNA 5J2NA 2YKMB 3LP2A 4RW9B 2HNZB 1HMVA 4EO6A 4TYAA 3ISNC 2VG7B 4I2PA 4O44A 4RNHA 3UR0A 3Q8QB 3RBEA 2IAJB 4R5PB 4RNFA 4O4GA 4ECZA 5F8MA 3CIZA 3KHRA 5HROB 4IDKA 4DL2A 1IKVA 1I6JA 5EWFA 1TP7A 2E9RX 3FRZA 5KFJA 3CDEA 5KT6A 3DI6B 2XC9A 2AU0A 4I2QA 2BQRA 3H5SA 1RT3B 2B43A 4EYHB 2WB4A 4DL3A 1S0NA 3IGVA 4WXOA 3V4IA 2FVSA 5C24A 1DTQA 3RB0A 4F4WA 5C42B 4TQRA 4K50A 3E01B 4PWDA 3DLEA 3V6DA 1S9EB 4NLWA 3QIPA 2VG5A 2HWIA 1CSJA 4MKAA 1HQEA 2JC1A 2UVVA 1QE1B 2BRLA 5I3UB 4QWDA 3MR2A 2CKWA 2HNYB 2W9BB 3KLHB 4ZVGA 1FKPB 5L1KA 4ZPDA 3BSOA 3M9NB 1S97A 1EP4A 4ZPBA 4J9NA 2BANB 3T1AA 4ZP9A 3RAQA 1S9FA 4H4MA 1S9GA 3C6TB 1LW2B 3BQ1A 3KLIB 4DL7A 5C25B 4JV2A 2W8LA 1TKZB 3DOLB 3MEGA 3CVKA 4KAIA 3GQCA 2UVUA 1BQNA 2E9ZA 2YKNB 2I5JA 2W9CA 4QWAA 4IR1A 1IKYB 2IC3B 2OPQA 3DRSA 1JLCA 2FVQA 3T5JA 1C1BB 1T03B 1C0UB 3MECA 3MFHA 5KFZA 3C6UB 4IFYB 4RW6B 5KG0A 3PW2A 4WFXA 1EETA 2XGQA 2XI2A 2BE2B 1LWFB 3QLHA 3NL0A 1QAIA 3LANA 4ECQA 5F8HA 3JSMA 5HP1B 5DQHA 1T3NA 3OL8A 4Y2AA 3DRPA 1J5OA 1K1QA 4R8UA 4IH7A 4Q8EA 4YR3A 4PUOA 3KLGA 3KJVA 4RW4A 3OL6A 3OLBA 3GIJA 1JLBA 3HVWA 5K14B 2IM0A 3HVAA 5KG4A 3JYTB 4ED0A 1LWEA 5EUHA 2ZD1B 5KFYA 4IFVB 5FDLB 4Q45A 3IS9B 4LSLB 4WYWA 3CO9A 3GV8B 1ZETA 4HYKA 3HVTB 1N5YB 4EYIB 3SFGA 4ID5A 1WNEA 2VG6B 5F8GA 4KE5A 2BQUA 2E9TA 1HYSB 1VRUB 2ZE2B 3IG1A 4ICLB 3BJYA 2B6AB 3KMSA 1S1VB 1HARA 2ASLA 2AX0A 2YNFA 3LP0A 3CJ4A 4K4VA 1TKTA 4KKOA 4H54A 4IG0B 4K4TA 4IH5A 3DRRB 4NLYA 4NLSA 4WFZA 4K4YA 1RT5B 4NLGA 4NLOA 3HKWA 2WTFA 4LSNA 3MEDB 1T05B 1C1CA 1JLAA 1S1WB 4WXWA 1DTTA 5EWGA 2HWHA 5EWEA 1S0OA 1HQUA 4NLVA 3V6HA 2YNIA 5HBMA 1TL3A 1HMVB 3KK2A 3H4DA 3DLGB 1C0TA 4I2PB 5HLFA 4J9LA 4Y34A 4F50A 4O3OA 2AWZA 4ZP7A 4O4GB 2IBKA 1RT1A 3CWJA 1FK9A 4NZ0A 3CDUA 3TQ1A 1TV6A 1HPZA 2RKIA 3M8PB 4KFBA 1ZTWA 3PW4A 2HMIA 3KOAA 3GV7B 5J2MB 5KFBA 1IKWA 1S0MA 4IG3A 4G3IA 3G86A 4OL8A 1TVRA 4X2BA 4H4OA 3ITHA 5KFCA 3G6VA 3V81B 2ILYA 3KLEB 5CYMB 1NHVA 4URGA 4ECSA 2YNGB 1SH0A 4RW8A 3ICLA 5F9NA 5KG2A 3DYAA 3V6DB 2WONB 2IJFA 4G1QA 2R8IA 1YVFA 1RT7A 4EO8A 4IRDA 5L9XA 3FSIA 4K4UA 5DQIA 1SV5A 1RDRA 1SH3A 5F8NA 1RTDB 4RNNA 3KHGA 2RF2A 3EZUA 3PR5B 4DG1A 4IR9A 4URSA 3KK3A 4GC7A 2VA3A 1QUVA 1KLMA 5KFUA 1RT2A 1EP4B 1S6PB 5KFAA 4H4MB 2RDJA 1S9GB 1HNVB 3DOKA 4O3PA 1RT6B 5J2QA 2FLPA 3MEGB 4KV8B 5KFGA 3BQ2A 4DL4A 2JEJA 1U09A 2IM2A 2OH2A 4ED1A 2OPQB 3DRSB 3N6MA 3UPFA 3BQ0A 3KMQA 3H5YA 3D28A 3CJ2A 5KFWA 1K1SA 2OPPA 3KHLA 4I7FA 1NHUA 4ED2A 4NLTA 1LWCA 1RAJA 1REVA 4ECTA 4FBTA 1UWBA 3DLKB 1J5OB 3SFUA 4R8UB 4XO0A 2OPRA 4O3QA 1DLOA 4QW8A 2C2RA 2IMWP 4O3RA 4PUOB 1JLEA 4KB7A 4ED3A 1JXLA 4J9RA 1T94A 2ILZA 1JLBB 3KLFA 3I5BA 5F9LA 4GC6A 3PJXA 1XR5A 5I42A 4NLUA 3I0SA 3LAKA 1GX5A 2C2EA 1KHVA 4ED6A 4J9SA 3KLVA 2GIQA 4RW7A 2FJXA 4ID5B 4ZVHA 1JLGA 4IKAA 3OHAA 2FLLA 2HNDA 5KG7A 4ECYA 3I0RB 2DPIA 1RA7A 2AGQA 2RDIA 3QGHA 3H4BA 1RTHA 3LP0B 4NLDA 3T5LA 3LAMA 2DPJA 2R8KA 4DEZA 2WOMA 4Q0BA 2AQ4A 2YKMA 3G6XA 4RW9A 2HNZA 5JUMA 4LSNB 2VG7A 4NRUA 1BQMA 4KHMA 3T5KA 3PZPA 1S1TB 2IAJA 1JLFA 2ALZA 3GV5B 3D5MA 5KFKA 3DMJA 1C0TB 5HLFB 1W25A 3GIIA 3DM2B 3PW7A 1HNIB 3IN5A 2IM1A 4PQUB 3QZ7A 3OLAA 2FVPA 4YP3A 3GIKA 4TQSA 4KO0A 3H2LA 4MKBA 2B5JB 2QE5A 4O3NA 3DI6A 4FS1A 1TV6B 1HPZB 4KFBB 1S1UB 4XPEA 4QWEA 1RT3A 5DG7A 1TVRB 4NLQA 3IRXB 5F8IA 2QV6A 3E01A 1RA6A 3M8QB 4QWCA 2D7SA 4JUZA 3NMAA 2BR0A 2J6UA 3E51A 1D1UA 4RW8B 3RB4A 3KHHA 3T19A 3T5HA 3MFIA 3DYAB 4F4XA 4G1QB 4B3OB 1JKHA 3V6JA 1RT7B 2W9BA 4Y3CA 2ZKUA 3LP1A 3HHKA 5J2NB 4MK9A 4J9QA 4RUCA 3EPIA 3KNAA 3LP2B 5D3GA 2F8EX 5DLFA 5L1JA 1RTIA 2RF2B 3RAXA 1N48A 1LW2A 4DG1B 3KLIA 3N6LA 4O44B 1OS5A 3QGIA 1SH2A 1TQLA 1TKZA 3DOLA 3KK1A 1RYRA 1MMLA 5KFDA 3PW0A 2YKNA 4IRCA 3G6YA 4J9PA 1IKYA 2IC3A 2AGPA 1TL1A 1C1BA 1T03A 4J9OA 4IDKB 4HKQA 4RW6A 3H40A 1IKVB 3QGGA 4RNOA 4K4WA 3H5XA 2GIRA 4M94A 2CJQA 1LWFA 1IKXA 2R2TA 2R8JA 2XCPA 4WYLA 4I2QB 2OPPB 4YR2A 2R8GA 1XR7A 4NRTA 2C28A 4MK8A 3I5AA 2OPSA 3V4IB 3NKYA 3FDSA 4U6PA 5C24B 1DTQB 1SUQA 5KG1A 4RUAA 3Q8SB 1REVB 1S6QA 4PWDB 3FFIA 3DLEB 4EBCA 2V9WA 2R2RA 3BR9A 3QIPB 4ZHRA 2VG5B 1S49A 4O4RA 4ZP6A 1KHWA 2FLNA 1HQEB 3PHEA 5FDLA 2J6SA 2O5DA 3IS9A 5DG8A 4RZRA 4YQWA 4DL5A 3KLFB 4JV1A 2BQ3A 5KG6A 3HVTA 1N5YA 4ZMMA 4ECRA 2C2DA 3H5UA 2VG6A 3I0SB 3MR5A 2D3UA 4WE1A 3OSNA 1VRUA 4MK7A 2FJVA 5KT3A 4RW7B 5CYQA 3BGRA 2FVRA 1S4FA 1S1VA 3FQKA 4Q44A 4Q8FA 4LQ9A 3VQSA 4F4ZA 5F8LA 2HNDB 4WFYA 4YR0A 3OL9A 3DRRA 3SI8A 4NCGA 4TY9A 1BQNB 1JX4A 1N6QA 1FKOA 2I5JB 5C5JA 2W9CB 1JLCB 4TY8A 2R2UA 1RTHB 3MEDA 3MECB 1S1WA 3QO9A 1T05A 1LW0A 1JIHA 2WOMB 4Q0BB 4QW9A 4EEYA 1EETB 4R0EA 3QIDA 1RTJA 4WZQA 3QLHB 1TKXA 2JEIA 5J2PA 3DLGA 3NBPA 4TYBA 3JSMB 1BQMB 4QWBA 3I5CA 1R0AA 2J6TA 5KT4A 1JLFB 3DRPB 4IOBA 1S10A 3DMJB 1RT4A 4M95A 3KLGB 2WK4A 3KJVB 4RW4B 2XI3A 3CJ3A 3M8PA 3FQLA 5KFTA 5KFSA 3RBDA 3PW5A 3NAHA 5J2MA 1MU2A 1LWEB 3UQSA 1N56A 2W9AA 4KO0B 3MR6A 3TAMA 2W7PA 3V81A 1RYSA 3KLEA 5CYMA 3NGDA 4ZVFA 5KFXA 4KHRA 2YNHA 4EBDA 2YNGA 4MFBA 4K4SA 5KFRA 1JLQA 1VRTA 2D3ZA 4ECWA 2I1RA 1C2PA 3IG1B 4ZP8A 4FBUA 2WONA 5J1EA 3MEEA 4TLRA 2V0NA 4QPXA 3OL7A 1S1XA 2YNFB 4XPCA 2UUTA 1TKTB 4KKOB 3UDLA 4U7CA 1RTDA 1JKHB 4RNMA 1C1CB 1JLAB 3LP1B 1DTTB 1QAJA 2R8HA 5KT7A 1HQUB 1Z4UA 4YMEA 2VA2A 2YNIB 4R5PA 4ECVA 5HBMB 1TL3B 1S6PA 5D3GB 3MTKA 5KFOA 1RTIB 3KK2B 4ECXA 4K4ZA 1HNVA 4NLRA 1RT6A 4KSEB 5HROA 3KK1B 4KV8A 4MIAA 1ZTTA 2ASDA 3M9OB 3BSAA 1D0EA 3BSNA 4F4YA 2JEFA 1RT1B 1TL1B 2W7OA 3QYYA 1FK9B 5DG9A 4URQU 3N6NA 2RKIB 2IJNA 2UUWA 3Q8PB 4J9MA 5F8JA 2HMIB 3H98A 4IH6A 2C22A 1IKWB 4IG3B 4JV0A 4Y2CA 2ASJA 1IKXB 4ZPAA 4RU9A 3RB3A 4H4OB 5JXSA 3ITHB 5C42A 4NLPA 3BSCA 3CDWA 3OHBA 1S9EA 4MIBA 2XCAA 3DLKA 2OPSB 2ATLA 1SUQB 4IQXA 3NAIA 2WCXA 1S6QB 3ISND 2WHOA 3PVXA 3MF5A 3FFIB 1QE1A 3LALA 5I3UA 5DGAA 4ZHRB 3M9MB 4ECUA 4ED7A 2HNYA 4IRKA 3KLHA 1FKPA 4KBIA 5EDWA 2HAIA 2FVCA 5KFEA 1SV5B 2V4QA 5L1LA 2BANA 2FJWA 4K4XA 4O3SA 2IM3A 5KT5A 3C6TA 4EBEA 4MH8A 3GYNA 5C25A 5KG5A 3KK3B 3GILA 3Q8RB 4WE1B 1KLMB 3I0RA 1RT2B 1XR6A 4TXSA 3TVKA 2UVWA 3PJWA 5KFVA 5CYQB 3BGRB 3DOKB 4ED8A 2WRMA 5J2QB 1N4LA 1C0UA 1IM4A 5KFFA 2JC0A 3C6UA 4IFYA 5KFQA 5KFPA 2V4RA 4NCGB 3V6KA 2EC0A 4ZPCA 1N6QB 1FKOB 3GIMA 2BE2A 4TY8B 3QZ8A 3PR4A
chains in the Genus database with same CATH superfamily
2XS2A 1AXQA 1RWXB 4ATNA 4DR3F 3CB4A 1M5HA 2YXLA 1KFSA 4LSLA 3LUYA 4OYMA 1WEZA 4HVZA 2B6AA 1BUXA 4DUYJ 5J1EB 4PXBA 4WZMA 5DQGA 3IO1A 4KGXB 5KOXA 3BO2A 1S12A 2PO4A 2VG7B 2PEHA 4OI1A 2L3MA 2FJBB 3UDVA 2GQCA 1RT3B 1Y10A 3QT8A 3IGVA 4WXOA 3AODA 4P71A 1FDBA 2NXJA 3R5CA 3DLEA 2DNKA 3D1OA 4AE5A 3SDEA 2DXEA 3PX6A 3CJKB 3A8KA 1KOHA 5E3QA 4K59A 3BN7A 2MHEA 4C8ZA 2P8IA 4Y2IA 2VB6A 4DFJA 5H9FK 1GXLA 3V2UC 3MECA 3Q8YA 1QAIA 2KXNB 2CIMA 3GCWP 4AQYJ 3JSRA 1IR1A 5FJ4A 3SQGB 1FTRA 2RILA 3QNWB 3IS9B 4LSLB 3VAFA 4JI1J 4HT5A 4KYZA 4DQRA 1GQEA 2B6AB 2AX0A 4H54A 3PHTA 1Q7YT 2IDEA 3CTRA 4YFUA 2WTFA 2AEJA 1T9XA 5EWGA 4HHUA 4LFBJ 2LQ5A 4YUDA 1HKAA 1PSDA 2H5EA 1IJFB 3MAHA 1FK9A 3TAPA 1RAOA 4DV6F 2DCLA 3ELHA 2H51B 4ELVA 2J9DA 2HHPA 2YNGB 5KOWA 2GMJA 4PYDA 4B3RJ 4U67Q 1ZPWX 4USUA 1RT7A 3EWGA 2XMUA 3VV2B 2FD2A 1SH3A 2ALYB 3GJTB 3D67A 4GC7A 2YPYA 1U1NA 2G2ZA 2C3UA 1T02A 2IM2A 2KZZA 4ZJQA 2EW9A 1X7VA 3OFGA 1XQIA 3O1LA 2XMMA 4ECTA 3K5PA 3JSYA 4KB7A 2B9EA 1YTYA 4WFAQ 4GC6A 1RLDA 1SC3B 1KHVA 4P9SA 5HQMA 5JMNA 2PGCA 3LAMA 2CQPA 4QZVB 2YKMA 3EGZA 1SL1A 2VJVA 2RS2A 1KQSR 5FLXU 9RUBA 1BQMA 3PZPA 4NXNF 4HDHA 1S1TB 2WVFA 1VQ8S 2WVBA 3DMJA 3PO5A 2IM1A 2VKZG 3O5TB 3AT1B 2LVWA 2J76E 2ZZNA 1IXKA 3IRXB 1EQ0A 3TZYA 4FYYB 4F3OA 4JI0F 4USVA 3MCNA 2L9NA 4ZVOB 1RT7B 4QCLA 4FXVA 1VQLS 1RTIA 4IRCA 4J9PA 2IC3A 1FWKA 1RI7A 3TX8A 1CJTA 2DXFA 1FRHA 2AZ1A 4RO0A 2B3TB 2F4VF 3QAUA 1DBDA 2W7AA 4U6PA 1XNQJ 1SUQA 4JV1A 3IM9A 1VRQC 5GAGU 2EBGA 4EWTA 1TK0A 3FQKA 4P10A 1X4GA 1M5SA 1H0HB 4F4ZA 2PFFB 5F8LA 3C15A 5GAHU 3DRRA 2A6MA 2DNGA 4TY8A 1WUUA 1BQMB 3FJ2A 5E7OB 2J9EA 3M2UA 1PJ7A 4LF9F 3DMJB 3OTOJ 3O8WA 2DEJA 1BMQB 3FQLA 2MYFA 3GCXP 1LQ9A 2N7CA 1ICEB 3G96A 1M5VC 1WHVA 1B7YB 2OEMA 4X4OA 4N8OA 1MN7A 3PACA 1FNOA 2DGTA 4Y2MA 3W8GA 2RU3A 4J7CA 2VA2A 1RTIB 3IC1A 3W64A 1W2IA 3J81Y 2BJ9A 1X4FA 2QL5B 3BGLA 1M5PC 1S79A 1CJTB 3H98A 2C22A 1N32J 2MB0B 2BA9A 3BSCA 3OHBA 1V9OA 3MMJA 1SUQB 3C8YA 4LT6A 4JI2F 2V5HG 5F0WA 3GSIA 2M5YA 4BHQA 2BANA 3EVMA 2VFSA 2F9JA 2OEKA 2UVWA 1OY9A 2HBRB 1U1LA 2JC0A 3C66A 2YH0A 4TY8B 4LQ3A 4B17A 2N3LA 1LNQA 2Z0GA 3M2UB 4Q7AA 1S1UA 2UP1A 4CO5A 1N88A 1YBUA 4I69A 2ZE2A 3PYDA 4UW2A 5T14A 4HHJA 1RADB 1RT5A 2D41A 2W01A 4NYZA 6FD1A 3NCRA 2ZUGA 4IDKA 1SL0A 3IP0A 5KFJA 1NK7A 1ACMB 2CDRB 3CC7S 4PWDA 2WZ1A 2YKPA 3UDEA 3QIPA 2DR8A 2DK2A 2DKOB 1YJVA 1Q95G 4FNHA 3NOGA 2X7IA 2BANB 3BQ1A 2Q79A 3QSYB 2WW8A 1WTBA 1VQ9S 1LOUA 3MMCB 1EETA 2XI2A 3WX4A 5CYJA 1EAYC 1FI4A 3KJVA 4M5GA 3CDBA 3SYZA 2QFJA 1PYTA 2JVRA 1HR0J 2H54B 3UWTA 2VG6B 5F8GA 2ZE2B 2R7OA 2ASLA 2UV8G 3CEDA 4NLSA 2QL7B 1RT5B 4LIWA 3SCJE 1F5CA 4HH1A 1S0OA 3AHPA 3C14A 2V8DA 1I1GA 3MUMP 2RKIA 4HDGA 4IG3A 1VJWA 4EU0A 1GT8A 1NH8A 3JQMA 1KTQA 1VC5A 4TVAB 1OWXA 1VQ7S 3PRVA 3DHWC 5E5NA 3KK3A 1RT2A 1DQ9A 2FJDB 4GKJF 4A8YA 4U7UD 4B3MF 4IQMA 3U1LA 3OQ2A 2OPPA 2W2NP 1HBNA 1ZM3A 2HFUA 3ZTQA 2KDOA 1H73A 2H5JB 1N5VA 2IMWP 3BO4A 2P6TA 1YGYA 1K73T 3CSKA 2MGZA 4X65J 4OFZA 5ETTA 2NUUG 4IKAA 2AEFA 1YZ6A 2HNDA 4AT1B 3W1YC 5BXIA 4PYAA 2DITA 1N0UA 5M2RA 3T5KA 2MJNA 1TZ0A 3T1YF 1RU1A 5DRKA 3OXFA 3FEXB 1U1MA 4PQUB 3QZ7A 4F36A 1S0VA 3QJLA 1QTMA 1XIQA 4MYTA 2QV6A 4QWCA 1WOSA 3SV4A 2DHGA 4C8LA 2VONA 2DGWA 1UW9A 3LP1A 1UW4A 4FF3A 4Q2MA 3KNAA 2ZOMA 1NM2A 1OS5A 2B4VA 4BLGA 1NRKA 1B0PA 1RWWB 1C1BA 1FRKA 5DM7Q 3GJRB 2X3DA 4ZIWA 3I82A 4I2QB 2OPPB 3FSYA 4HACB 5HJYA 5KG1A 3M30A 2AYEA 2AF6A 1NPPA 2R2RA 2WVEA 1HW8A 2M3DA 4O4RA 1GAOA 4CM2A 3HFZB 1PBAA 3HVTA 1N5YA 2KZMA 2XZTB 3B54A 3MD3A 2E7XA 4LFCF 2NS1B 4MK7A 5E3AA 3BM7A 2HNDB 4NZ6A 2R2UA 2RRBA 1U1QA 4DPTA 1VYAA 3Q8UA 1ZAXA 3C19A 3DLGA 3NBPA 2FLOA 3LH2S 1NJXA 3OTDA 4DDFA 1RSCA 2XI3A 5HQ8A 3CJ3A 1EB0A 1RAAB 1LWEB 1T9VA 2NUHA 3S8SA 1GTHA 4KHRA 3CCUS 2CWKA 2UUCF 4V1Ak 3KYLA 1RUSA 2EFOA 2GO9A 1TKTB 2IJRA 1CJVA 3LP1B 4FXDA 1Z4UA 2J0QD 2Y1IA 4DR2F 3DHXA 4R0JA 2VL1A 3CUNA 1ZTTA 2JHEA 3H90A 5LMUJ 4KC5A 1Y0HA 1MNEA 1B64A 4URQU 3Q8PB 4AYBD 1HLWA 1PJ5A 1KWMA 4ZPAA 5EGYA 4NA3A 1YIJS 4MIBA 3M30B 2Z2MA 1XERA 2FVCA 1SV5B 4DR6J 5L1LA 1U24A 3C6TA 1KLMB 4ZVSB 1FJEB 1BXNA 2MZ1A 2ZJRQ 2OEJA 2V67A 3D0GE 4LFAF 2F63A 5THWA 2CPIA 1UVIA 3NBPB 3KUEA 3R8YA 5H9EJ 1CC8A 2QEXS 2XBPA 1UWBB 3JYTA 2BRKA 3J80Y 3W2WA 2E44A 1F5BA 3B82A 5KT2A 2RQMA 1D8ZA 3DDKA 4FS2A 3P6YC 4U8VA 4K5RA 4IG0A 1FESA 2IA6A 2XWYA 2QMXA 1Q4RA 3QBCA 1URRA 4O44A 3UR0A 2HZCA 2NQPA 1VK8A 2M8HA 2C2NA 1NK8A 1IKVA 3IRWP 2Y8YA 4X66J 1S76D 3T6JA 2HVZA 4F4WA 4TQRA 4A48A 4ED5A 2IYGA 2M52A 1H2TZ 3OPKA 2JX2A 2ADCA 1K44A 1FTCA 4PWWA 3SMZA 1S9FA 4QYZJ 3C6TB 2M2BA 4KAIA 3NGTA 1XBWA 1UMJA 3T5JA 5KFZA 3M2RB 2MLXA 4UT4A 5F8HA 4P74A 4I68A 4X4NA 1J5OA 3FMWA 3NS5A 1VC0A 3JYTB 3W2WB 2XSFA 2QA4G 4FNIA 2HIYA 4NXMF 2RRAA 1S1VB 3N5BA 1FXDA 4KKOA 4IG0B 3EMTA 3OR2A 3ZTPA 1RU2A 1R31A 1O6XA 1OY8A 4Z7YA 1CJKA 5U47A 2MTLA 2AJ0A 4OQJA 3CWJA 3K5LA 3FKBA 1VQYA 4KFBA 3M8PB 2ZFHA 3IAM9 3GV7B 4X2BA 4HH0A 1WWHA 5F3ZA 1H3DA 2IVYA 5LJ3Y 5DO2A 5B0DA 3BPSP 2YWKA 4RBUA 5L9XA 3DXBA 1RTDB 1EZZB 1WG5A 4C98A 4OJ3A 4YHHF 1IBMF 3RBXA 2XZDB 2VA3A 8ATCB 2VOOA 5CD4A 2Q43A 4DV2J 4ZVRB 3GTYX 5KFGA 2PA8D 1MROA 4FN5A 4ED1A 2CG4A 2QO3A 3EGWB 2BJ8A 3CJ2A 2DNNA 4PKDB 3FCVA 4I56A 2AYGA 2VF3A 1UJ5A 4WKRA 2W2PP 1RHUB 4EZ6A 1J5OB 2PMWA 1SJ4P 4J9UE 3ZFVA 2RVJA 5IT9U 4O0NA 6FDRA 5I42A 1VC6A 5SUHA 1JLGA 1RACB 3OHAA 4FVMA 2ZHBA 3J7YU 1UEKA 1J5EF 1LFWA 2DPJA 2WOMA 4Q0BA 4OHVA 2XY6A 5A8WA 4F8RA 2YX4A 1CJKB 2P5VA 5D0RA 1D09B 4KFBB 5C7PA 4PG7A 5H1SV 3OFFA 3X3UA 2BJDA 5BR8J 3KG1A 2J6UA 3E51A 2ZUAA 5ETMA 1CQNA 4HTIA 2HS3A 2R4FA 1N48A 1YG0A 1OY6A 1YJ9S 1TL1A 3QGGA 4USTA 3H5XA 1MN9A 4OYIA 1NMEB 1WELA 3V4IB 3TR5A 3PIPQ 4DSJA 2PT0A 4EBCA 3O6QA 2APOA 3RR8A 4YQWA 3CCZA 3OR1B 1WHWA 2ROEA 4KGMA 1HIYA 1VRUA 2FJVA 1S4FA 2P2CB 4OX8A 3GPAA 4MAKA 4JYAF 3BKFA 2I5JB 4A46A 3A4TA 4LF9J 3SQOP 3A13A 2WOMB 4Q0BB 2HVEA 4DZ6A 4Z37A 3JB9k 1VS3A 4RW4B 2FZKB 3TA2A 5J2MA 3ONQA 3KNGA 4HL9A 2G0JA 3L3CA 4LJMA 2YNHA 1F3FA 2DR5A 3W5YA 4DV4F 3IG1B 5K8NA 2M4MA 4L76A 2UUTA 3R7NB 4A8MP 2C3MA 2KYZA 3KXDA 1DTTB 5DM6Q 2OD6A 2CQ2A 5A0YA 3PNIA 1TL5A 2HIQA 4KV8A 3T6BA 1TL1B 3CD0A 1SXLA 4Y2CA 2AIRB 1TMMA 1HFEL 3TNVA 4PRFA 5HVGA 3CCWA 3PVXA 1QE1A 3LALA 3M9MB 1S57A 3G9CA 2OTLS 4DLGA 5LOQA 3H42A 1U0SA 1R8AA 3TVKA 2R9LA 5J2QB 4OHYA 3M6WA 1NKCA 3A8JA 2RAQA 4W98A 4DN0A 3RB6A 4YN3B 3CJ0A 2ZD1A 2HZVA 1YRXA 2XO7A 3FVYA 2R7QA 1HYSA 5FD1A 4Q43A 2CUYA 5BYSA 2YNHB 1DRZA 1XK8A 1IJEB 3K89A 2Z2ZA 1WEXA 2CQ0A 3DOMA 4I2PA 4FYDA 3RBEA 3BDPA 2IAJB 4ECZA 4ZKAA 5A0YB 3DRXA 4DOZA 2B4PA 3FNNA 1TP7A 2K7KA 2Z2LA 2BQRA 1ZH5A 1DTQA 2H4WB 1BC6A 2GA7A 1O8BA 5HI7A 2UVVA 1QE1B 1PC5A 1EJ7L 2IYIA 3A3OB 2A6OA 1X5OA 4DL7A 2ZJPQ 1J2VA 3K5OA 2EVZA 1UFWA 2RHSB 3T1HF 2V2QA 4CQ1A 4LF1A 1N5QA 2UU9F 2DNYA 4ILRA 4CLLA 3ET6A 4DUTA 2ZD1B 4WYWA 4OYWA 2CRLA 4F4AA 1HYSB 4OHXA 2VQEF 1T05B 1C1CA 2CPZA 1VBYA 2YNIA 3JTOA 2M8DB 4I2PB 1TR0A 4HHHA 3KDOA 1HWLA 1ZTWA 3HVRA 1Q8IA 2HMIA 5HN0A 2CQHA 3HK2A 2EFQA 1PIEA 2QYCA 4N41A 4HI1A 2J8AA 4F2RA 2HFNA 2KJVA 2KTQA 2PMZD 2QLBB 2HVIA 1SIZA 2BVZA 2VBYA 1H6KX 3LF0A 2X51A 4KQZA 3GMGA 2K2PA 4DUZF 4K8RA 4E98A 3H5YA 4ED2A 5CH7B 3LQVA 2XM3A 1REVA 1QDUB 1UPPA 2OUGA 4ED3A 1JXLA 4J9RA 1T94A 4CLYA 3TWZA 3GU0A 1RZMA 3I0SA 4OI2A 1Q78A 4O0IA 2UUBJ 1WOOA 3I0RB 2IRXA 1RA7A 2CNNB 1RTHA 2D69A 1O51A 1ITPA 2AW0A 2GHPA 1HD1A 1N34F 3RBZA 3HHDA 1MW7A 1FRMA 3D5MA 3PEJA 2CZ4A 2YX1A 1OPZA 4FPRA 4FYWB 4DU8A 3DI6A 5HL7Q 1Q7LB 2CYYA 1RA6A 2D7SA 1Y11A 2NXUA 2QRRA 5EX3A 3MUTP 2O01C 5BJRA 3D2WA 3BH6B 1LW2A 2XLKA 1SC4B 3DOLA 1IN0A 1XNRF 4RW6A 1WHYA 4TU8A 4MT1A 2XCPA 4YR2A 2MKCA 3Q8SB 1REVB 4LFCJ 2MXYA 2L9WA 1JJCB 1VQ6S 1U2RA 1SKWA 3WDOA 5KG6A 3CD7A 3I0SB 1JJ4A 3ILIA 5D4NA 1WOPA 5KT3A 3BGRA 2GV1A 4DR4F 5DJBA 2BKOA 3RRKA 1RTHB 1BLUA 3AOAA 3ISZA 1NLKL 4R0EA 2SXLA 2E1MC 2KT2A 3JSMB 1R0AA 2UUCJ 1VISA 4M8LA 3GG1A 3SCIE 1TFWA 3TAMA 2ZBRA 5CYMA 2AJQA 2D3ZA 3RTVA 2HAFA 4Y6IA 4FBUA 2WONA 2YNFB 1I94F 4BDPA 1CLFA 1IVZA 3ZZUA 2QLJB 3FBCA 4ECVA 1ELOA 1MWQA 4OX9J 1HNVA 4KSEB 2C3PA 1TFYA 2VPYB 2PIIA 4J9MA 3VZIA 3KTQA 3OTCA 1CBKA 7FD1A 1S77D 2F4FA 4N5SA 3F44A 3SCLE 4CLZA 2MQPA 3K5MA 2DNHA 4USKA 2HNYA 5EDWA 3UE2A 3A8IA 4BBYA 4AFFA 5A6PA 3GYNA 3ZTRA 2IMOA 2R7SA 1FVSA 3BGRB 4X4QA 1LFPA 1IM4A 3UFCX 3E8OA 5HMXA 2EC0A 5ADZA 2F3JA 1AFIA 1APSA 2FHJD 3TI0A 1R0AB 2H5IB 1SKUB 2D3O1 1VIXA 4IFVA 1JLEB 1KS2A 2YQ3A 3MM8A 5KFMA 3NMRA 3TAMB 3MXHP 2MZTA 4D3HA 2HHSA 4PXDA 7FDRA 4IO1A 2B56A 2FC9A 1G1XA 2ATCB 1H2UX 3I31A 5J2NA 3ZZ0A 3ISNC 2V4JB 1WEYA 4DR5F 3H7HB 3Q86A 4KGVB 1QSLA 4QR2A 3UR3C 2XC9A 3BBCA 3BF4A 3H0PA 4YDXA 3RR7A 2MZRA 4KRWA 2M88A 3NEKA 2JFDA 3HD2A 4B02A 2HNYB 1YJ7A 4OI3A 1U49A 3BSOA 3S6EA 2VFUA 4YOEA 2UXDF 1AUDA 4YB7A 3CVKA 1VDHA 4EMDA 4ZPWR 4A8QA 3CMAS 2XSJB 1T03B 1HNZJ 1B3TA 3PW2A 3LWLA 3EXYA 1T3NA 3HKZD 3R6LB 1NDKA 4PUOA 3OL6A 2HHQA 3HVAA 2HHTA 4IFVB 1AZSA 3MM8B 3PIOQ 1S7HA 2VDIA 3ILJA 3P8BB 3M8YA 1RHRB 1XEZA 1X9WA 1HBMA 2DRBA 4LSNA 1S1WB 1NK0A 1WJ9A 1MMNA 4ZP7A 1L3TA 2QTWA 1U47A 3DU5A 2FHKA 1TV6A 3A3PB 1IKWA 1MLAA 4OL8A 3TP2A 3PYEA 3BGOP 4DPOA 3MZIA 1PC4A 2FHOB 1MSWD 1MWZA 2XS5A 4CO3A 3EZUA 3PR5B 2ZVSA 2VBZA 3Q22A 5KFUA 2UXBF 2DR9A 2FLPA 3TEHB 2JEJA 4CLFA 1AA1B 4P6QA 1UJ4A 5GADU 1R8HA 4C3KA 4NLTA 3D0IE 3K57A 2ZH1A 2HHWA 4GMKA 1OQ3A 2E7WA 4PUOB 3AY0A 3CCJS 3DC2A 1H72C 5DDOC 2B4UA 1YJUA 4DV5J 1U4BA 1VBZA 1YKWA 4NLDA 2JLFA 5L38A 1N33F 1HBMB 4DV0F 4LSNB 5LM7E 1FRLA 4OZ2A 2G0IA 1W25A 1T8EA 1HNIB 3N79A 2DHSA 3OLAA 3MPWA 3TARA 2B5JB 1TV6B 2XO6A 2KYXA 1KR4A 1JJ2R 5ETLA 3NMAA 3FGVA 3H20A 2BR0A 3BH7B 2HURA 4ZJOA 1X31C 1ZOTA 1JKHA 5ITHA 3EICA 4J9QA 3N6LA 1TKZA 4MMOA 1LWXA 3AFGA 2UZAA 1YJWS 3H40A 4RNOA 2GQQA 3UDCA 5L9NA 2CPEA 1JK9B 1D3WA 4B08A 3LW5C 2GVDB 4M5NA 4LUBA 3FBBA 3UNYA 1S49A 4ZP6A 1KHWA 2O5DA 4Z7CA 4KIAA 2IVMA 4WIQA 4ECRA 4DSEA 4DQIA 4LF2A 5J1PA 1AW0A 2VASA 2K8GA 4Q44A 1HA1A 3CD5A 4NI2B 1JLCB 4PG8A 2Y3YA 4BS2A 2DB1A 1RHKB 5GAEU 4B9SA 1YJTA 5K8OA 2CVIA 2NCKL 1L3VA 5J2PA 4TYBA 3I5CA 4DUYF 2OMLA 3K17A 2BV3A 2GMLA 2QT7A 5KFSA 3BS9A 2ZITA 3THVA 1Q79A 2QGFB 3NGDA 5KFXA 3NGUA 2BDPA 3M2VA 5D4PA 2CQIA 4ZVUB 2HHUA 4U7CA 1JKHB 3AA8A 1HQUB 5HATA 4YB1P 2HEKA 4CT8A 1QUPA 3BSAA 1RWNB 3TZWA 1IBCB 5E2QA 1BWVA 3RB3A 5ETNA 4H4OB 4G1PA 3Q24A 2ZC3A 3SZ2A 2P6SA 2YH1A 4NEZA 1EARA 2W24A 2HWTA 1JNRB 2FJWA 4A47A 4O3SA 5KT5A 5KG5A 1U26A 3DOKB 2XMVA 2E5GA 1S0NA 3PR4A 4JI1F 4XK8C 5J2PB 3P4UB 4RL1A 2X1BA 3QT5A 2ZH7A 3I56S 5IC4B 4ICLA 2GAHC 2HS0A 3X1LB 3M2VB 2WBRA 2R2SA 3C16A 3G71S 1KN6A 3TJ9A 4DSKA 3P49B 3GB0A 4K2JA 4RNHA 2DTJA 4NASA 3QJJA 2DGOA 4WTOB 1D9DA 4WFBQ 4ZCLA 4DL3A 3MMBB 4RKUC 3E01B 2IBOA 4MKAA 1RAEB 1TUVA 3MM7A 4P2MA 3T1HJ 4ZPDA 4K7QA 2BMBA 3R9LA 1MWYA 2UU9J 1NU4A 1IKYB 2JLGA 2GCFA 4IOCQ 3EGNA 1V6HA 4PABA 4ECQA 5DQHA 3Q0AA 3TYTA 1KP6A 2AP6A 5D77A 5KG4A 1U1KA 3LOUA 1IR2A 2BQUA 4CP5A 4ICLB 5E33A 3BJYA 2GVZA 1TL3A 2QJ3A 5HLFA 1ZA2B 1HPZA 2G13A 2OI2A 4WWSA 4QIEA 3HT0A 3BBBA 1HWIA 2M0GB 2V2VA 3OXLA 4UOCA 3WC2A 2VPZB 3QT7A 3JXOA 1YVFA 4C0OC 4K4UA 3MM7B 2F7VA 4IR9A 1CULA 1XNQF 1WTFA 1G7CB 4O3PA 3SXLA 2CPDA 3KMQA 1Y5LB 4ETXA 2E29A 2BOAA 1R0CB 3DKDA 1RAJA 1Y4ZB 4ZLNA 1VHIA 3SFUA 2JDJA 2QC3A 3GG0A 2C2RA 4I6YA 3ETMA 4LRFA 1DQ8A 3GLJA 5GMEA 1RK8A 2LCWA 2J7WA 1V3SA 3IFEA 1K8AT 1DZ5A 3JSBA 1VBKA 5JUMA 3U02A 2MHNA 3GFZA 1F1BB 5HLFB 4A8KA 1VLYA 3ADAC 1RLCL 4KO0A 1HPZB 3EE3A 2V2KA 4LVNP 1F5AA 4RWWA 3NS7B 3DN9A 1UWAA 5CCLA 1YSJA 3D3CJ 3RB4A 1RWMB 3U27A 4B3OB 3G8TA 1KQKA 4GVBA 1N32F 1IUJA 2KVQE 4WKYA 3IM8A 2HGMA 3ZZPA 3G6YA 3BEGB 1YBAA 1HNWJ 2L9DA 2FQQB 4L3KA 2CQDA 1W26A 3KJFB 5AJ3J 3I5AA 1DFDA 4ELUA 5C24B 3KJNB 2VG5B 3M7VA 1RXOB 3PHEA 1NSAA 3G4SS 4DS4A 4A8SA 3GP9A 3R7BB 2D3UA 4N56A 1JX4A 1SJQA 2W9CB 5LMNJ 3V5RA 2XZWA 2CA9A 3NCQA 4ZA1A 3FRYA 2XS7A 1Y5IB 1WI6A 1QVFR 4IOBA 3GYGA 1RAGB 3KLGB 2EFGA 2EWHA 1R0BG 2IA0A 2RS8A 2ZH4A 4KO0B 3MHYA 3KLEA 1IBLF 3DGPB 4F0KA 3MPDA 4WP3A 1K0TA 3UCZP 2WBMA 4JB8B 4QPXA 1L5UA 2WSEC 1U6ZA 2ZDPA 1F6TA 4GVBB 3CJQA 1QAJA 4E2FB 4K4ZA 3KK2B 2LA6A 1O5JA 4N47A 2UUAJ 3OT9A 3EX7B 2MKHA 2OLWA 5DG9A 4CCHA 5ETSA 5F8JA 4ES1A 4XIUA 3ITHB 5C42A 4IQXA 5DGAA 4F04B 2FIUA 1V3RA 1N8RT 1B70B 4ZS6A 3WBZA 1RQ0A 2P9GA 2ZH2A 4MH8A 1R7IA 5SZTA 2LA4A 3R7SB 4BC9A 3PM9A 4IFYA 1L3SA 3QFWA 1HR0F 1G3OA 3ZNJ1 3EPGA 1R8CA 1NSKL 3VAJA 4HTJA 2MEWA 3B4DA 2OPRB 3C3LA 5K5MA 4DX8H 4PPZA 3KDNA 4LVOP 1CC7A 1CS4B 3MR3A 2Z57B 5IT9Y 2ZM6J 4DR5J 1KQGB 2CG8A 3TX0A 2QA1A 1PGZA 3RGIA 3P45B 5ETQA 3Q8QB 4KHPJ 1SBRA 1RE1B 3GZ7A 3MCMA 1LV5A 3AH6A 4GVLA 2DCUB 2B9YA 2AU0A 1P27B 3EZ5A 4RWXA 2V8HA 5C42B 1GMWD 1K9MT 4QQBA 3SSQA 2W9BB 2O1PA 3TJ8A 4FKYA 4ZIVA 2QSWA 2FJEB 3KLIB 4DPYA 4LF4J 1VBXA 3DRSA 1B0TA 2DVIA 3MFHA 4IFYB 3JQKA 4X65F 2XGQA 1LWFB 3OW2R 1UAWA 3OL8A 3LWMA 1K1QA 3BGUA 3ZZYA 1P1TA 1KNZA 1JLBA 1S6UA 5FDLB 4HYKA 1JB0C 3UO0A 3W62A 1X4AA 3CF5Q 3BBFA 4NLYA 4K4YA 2RUGA 2C3YA 3MEDB 4DR7J 2HWHA 4ITSA 4NLVA 4M5DA 3FEYB 2LKZA 3FCHA 2KI2A 3QJPA 2LMIA 3I55S 1BY9A 3AOBA 1QLNA 5KFBA 2Q3PA 4LF7J 1MG7A 2C2OB 3DXSX 1SH0A 3BKUA 3BKTA 1FDDA 2Z8QA 2R8IA 2OMOA 2QN6B 3NGKA 4OZLA 1VLOA 2XMJA 1P9QC 2BJ7A 2ACYA 3ENQA 3NWRA 2EKYA 1KDNA 3DRSB 1ZS6A 1SQEA 4ETZA 4X84A 2ZC4A 1NZAA 4B3TJ 3DLKB 4O3QA 3RG6A 3EVOA 1JLBB 1M5OC 5E41A 2JNJA 4G6VB 1A9NB 1N33J 2G2YA 4KH1B 1R43A 2ZH3A 2XLIA 2GW8A 4ECYA 5T7LB 2DPIA 5CCMA 3QGHA 3H4BA 2H65B 1RHJB 1D9AA 2ZVIA 3HX9A 5JVHQ 2VG7A 1U8WA 3JS9A 4KHMA 4JI8J 5A8RA 2YTCA 1CQMA 3M8WA 4OIXA 5HVFA 2ZBPA 3NNCA 3UD3P 4PCQA 1RT3A 4EI2A 3W5XA 1Q1KA 5LMUF 1H2VZ 2DH9A 3U1NA 2AZ3A 3CJKA 1P1LA 2EEYA 5CD4H 3D9BA 2M9KA 2RJZA 5E3PA 3IWXA 4C8OA 3LP2B 1FFSB 2MKKA 3NNHA 3THPA 2ZZMA 2K1RB 4DV1J 2RUSA 4RUBA 2OGUA 3CCRS 4DR6F 4P73A 1WC6A 3PG9A 5HQLA 3IAS9 4NRTA 2GGPB 2VODA 4LIRA 4DPWA 4ENOA 3SQGA 3IS9A 4ZMMA 2KHDA 3QRQA 2CNKB 3HULA 3IR7B 3M32B 2HLTA 4TY9A 1BQNB 4IOAQ 3M1VB 2WSCC 1VMBA 3QLHB 1U1OA 4QWBA 2EFPA 5A8RB 3DRPB 4M5JA 1ZM4A 4M95A 4ZCIA 1KLNA 3NAHA 1WDTA 2LFVA 4HLBA 1Y3KA 4UQTA 3ENVA 4ZLLA 4ZVFA 3EXCX 2YNGA 5GAGI 1KKHA 1ZM9A 2DNLA 2J9CA 2ZBCA 1K0VA 5GAHI 4X66F 3KJQB 2LXIA 1R89A 2OFGX 4R5PA 5D78A 5A8KA 1H74A 5CABA 3BV8A 4CO4A 4RU9A 1S9EA 2HS4A 2MKJA 3U1MA 2H3EB 1YZ7A 3KLHA 1UFKA 1JWWA 4Q5VA 4KJIA 3Q8RB 2F65A 1XR6A 4JI3J 1LXNA 8AT1B 1SQGA 3ZNUA 3AQPA 4FP9A 2F8MA 4DHVA 5MAOA 1S1TA 1GX6A 1LWCB 1UVNA 4P72A 3TUPA 5HJXA 1DLOB 1VOMA 3EM1A 1RWPB 3PDNA 3IRXA 4YB6A 1SIWB 4ZN3A 2AJFE 4KH0B 1U25A 2J8SA 5D8HB 1L3UA 2CZ9A 4DXLA 4TYAA 4NWBA 1RWUA 3PV8A 1VQOS 4R5PB 1VQMS 1SJFA 3O2IA 3CIZA 3MUVP 5A8KB 2DGXA 1CPZA 1U2CA 2B43A 4K50A 3VCDA 4DV2F 1S9EB 2WSFC 2V68A 3HLUA 2ZBIA 4NCAA 1M90T 8RUCA 1ZM2A 2I0XA 4PPDA 3KLHB 5L1KA 2DRAA 2BOPA 4H4MA 4JP8A 2C3OA 2BZ2A 2MQMA 1NB2A 2VV5A 2LQBA 1R8BA 2WVDA 2HVHA 1UEVA 2NSBA 4M5MA 4DSIA 1EKRA 4I6WA 4DLEA 1WI8A 2DXDA 4Q8EA 3GIJA 2O66A 1B0VA 1AFJA 3QT6A 2ZHOA 5KFYA 4ZDNA 4Q45A 3SV3A 3VAIA 3SFGA 1FEHA 4J91A 1QVGR 4MYUA 4WU3A 3GWCA 1HARA 1F9HA 3US5A 1VI7A 1XMOF 3HKWA 2BJEA 3V6HA 2LEPA 5BR8F 3W8PA 4F50A 4O3OA 2AWZA 2DRDA 3AJ1A 5DS7A 2EFVA 3G6VA 1Q0NA 3OVSA 1NHVA 5IWAF 4WBFA 3LTOA 5F9NA 1G4CA 3GYXB 5E0OA 2E5HA 3TRGA 4G1QA 2OAUA 3HFVA 4UOFA 4IRDA 2M70A 1H7XA 4CLPA 1HBUB 3OXGA 2R42A 3T9ZA 1TAUA 1JMTA 4H4MB 2RDJA 2EPIA 4DL4A 1Q16B 3N6MA 2FZCB 2KU7A 3BPDA 1X8DA 2ZJQQ 4QW8A 2Q6CA 3EZOA 4L73A 2YWEA 4ZVHA 4Q2LA 4RJVA 2JVOA 5HK4A 1OSCA 1A6LA 5IOLA 2AHOB 3NG8A 4OYOA 2HQ3A 3EGVA 2AMCB 3CULA 2XNQA 3DM2B 3IN5A 2Y1JA 4PEOA 2L41A 3FK4A 3B8HA 3MM6A 3M8QB 1Y3JA 4H4KC 4G1QB 3V6JA 1FO1A 4N76A 2YBVA 4UF4A 2HFSA 3MMCA 1PILA 1SKSA 4G65A 4K4WA 4JI6F 4CLWA 5B08A 3NKYA 3FDSA 4ERDA 3FFIA 5DDPC 3BR9A 1HQEB 1PBUA 2XYHB 2Y0SD 2J6SA 4C2MA 4KPCA 3S1TA 2ASYA 2VG6A 2MKSA 1SKRA 2VHGA 2HYIB 3GSDA 3D6HB 4LQ9A 4BWJA 3I87A 3VF0B 1SJRA 4OJ1A 1WKLA 1TKXA 4NMXA 3UD5A 3CCSS 1IBLJ 3UQSA 3AJ2A 2DHXA 2E5LJ 1SJ3P 1VRTA 2I1RA 3MM6B 4DCJB 2GJFA 4P2XA 2BXJA 2YKQA 3UDLA 3W9JA 4NE9C 1PAEX 3HO1A 3D1HA 4JOUA 5KFOA 1UVLA 2EKNA 3NXZA 5HROA 2ASDA 3SIPB 2QZ8A 1VK3A 4AL7A 5JXSA 3HZEA 4CZCA 1UTAA 3RAMA 3ISND 3FFIB 2ROGA 4DQPA 2DGUA 3MCOA 5DZ6A 4ED7A 3BO3A 3GONA 4B9VA 3GJQB 2IM3A 4C97A 1KOOA 2V50A 3K58A 1IR0A 3C6UA 3CCLS 4WF9Q 4ZN1A 2BE2A 3QZ8A 2XEXA 5HP1A 2XGPA 4I1TA 1TKXB 2HQCA 4X64J 4OJGA 4PQUA 2MDAA 2IVFB 1RAHB 3D68A 1SC6A 3ILLA 5K20B 1KFDA 1VRTB 2GHWA 3QWPA 4LRAA 2FHJA 4RW9B 4EO6A 4GKKJ 2HFVA 2J9DE 1FHTA 3FBFA 3QSIA 3KHRA 5HROB 2XLJA 4HI2A 2CPHA 2Y9HA 4I2QA 4HACA 2RNEA 3RB0A 3W2VB 2FB0A 2VQFF 3EUNA 4NLWA 3R1LA 1CSJA 1IBKJ 1GH8A 1JXEA 3KUGA 1N36F 1PO6A 3SEOA 4QIGA 5IV3A 2N4CA 2HKEA 5M2PA 1TU0B 2W2MP 4JV2A 3AD7C 4M5LA 2VC1A 2RB7A 3J7Z5 3C6UB 3IBCB 2BE2B 1I5OB 1ZZFA 2UUBF 3CO0P 5HP1B 3Q2TC 3RU0A 4IH7A 4YR3A 2HRUA 1NK5A 2RE1A 2ACMA 2MLYA 1LWEA 1ZETA 2Z56B 1IWAA 4USIA 2HGLA 3CDAA 3R97A 2XMWA 4Y00A 1TKTA 4WXWA 2QA4S 5EWEA 1UL3A 3E3XA 2R3VA 3GFYA 2AYMA 4B9MA 3BGFA 1HWKA 3CDUA 1TKDA 2V94A 3V81B 4OZ3A 3AJDA 4F3QA 3HT3A 4M5KA 3OJSA 2NXNA 4TNOA 4ED4A 5DQIA 1SV5A 4CDIA 3AB4B 2DGVA 3D66A 4URSA 1KLMA 2DJWA 2HGNA 4LF6J 3HSZA 1U6FA 3M4XA 5JVGQ 1WACA 3ZZTA 1FFGB 4OI4A 3VVUA 4FF2A 3W60A 1DAXA 1UWBA 2DNPA 1F9EB 5RUBA 2ILZA 4LSZB 1WC5A 3CCES 1SB6A 2JRSA 3CT9A 1HHQA 3O44A 2V34A 2GJIA 2GFFA 2N3OA 3NP5A 1DQAA 4S0MA 2R7WA 4UZBA 2HZAA 5HMWA 3PFOA 4OHZA 1YJNS 4YEAA 1FERA 4OYXA 3KUHA 2N4DA 3TVZA 3IR5B 1VQKS 1YRUA 5DG7A 4JI5J 4OX9F 5B09A 5K9FA 1RWOB 1D1UA 3MFIA 4F4XA 4L72B 3J7YI 1U7LA 1XN9A 4USWA 2RRNA 2ZBQA 4P2SA 1N5SA 5CHCB 3KK1A 5ETKA 2NR0A 2XYPB 1T11A 1Z2LA 5CQGA 3M2RA 2G2OA 2R2TA 2R8JA 3TAQA 2A3JA 3N4WA 1HHSA 4XAKA 1SQFA 5IT4A 4ZHRA 1LKZA 2C2KB 3NGRA 3RUBL 5F3TA 1HW9A 1U02A 1YJRA 3LGNA 4WE1A 4X4SA 1TUGB 4EUVA 3POTA 2HQFA 1AB8A 1S1VA 2HQGA 1NDCA 3WIUA 4WZQA 2V2ZA 3P96A 5IV4A 2V8PA 2VFTA 1X4HA 3PEHA 1UCNA 4AXJA 4ANCA 3DLJA 3M8PA 2W9AA 4DCOB 3RRGA 4Y28C 3R2DJ 4GO5X 4B9TA 2VBWA 4TLRA 2V0NA 1P6TA 4N8NA 1RTDA 3R5DA 4UOHA 1JLAB 1QD1A 1LXJA 5HBMB 2Y8WA 3QRPA 3KK1B 1RT1B 3IBWA 1DHMA 2IRYA 2E1CA 3Q89A 4IH6A 2LEAA 2BABA 3VGSA 4EK2A 4F25A 4C6AA 3BZQA 1RAIB 2NLWA 1HNZF 4ZHRB 2MQ8A 1FKPA 1FE4A 3TJAA 2HHVA 3GILA 4HT7A 4WE1B 1X60A 3POTB 3W65A 3VGUA 1S4EA 2FY1A 3R2CJ 2BJ3A 1BHNA 4I7FB 3RW6A 5AE2A 2GC8A 3BREA 3R5GA 2NZCA 3N9UC 4WU2A 2G1DA 3IMQJ 2AX1A 1OJ4A 3PCOB 6AT1B 2LDIA 2BBEA 4I0WA 2KRBA 3SBMA 1B4SA 2J0SD 1FD2A 5D0GA 1YHQS 5BYRA 1KVIA 4KPYA 2HNZB 3CJSA 2VD3A 3IA0A 4RNFA 4O4GA 5F8MA 3L7PA 5CA5A 1I6JA 2AJ4A 3HSGA 2WVCA 4DL0C 3H2VE 3V4IA 5LSOA 2DYAA 1U45A 5HO4A 3WZ0A 1T3OA 3V6DA 3EYZA 2DIUA 2BRLA 3OR1A 3CNQP 1WF2A 1WORA 1FKPB 2W4DA 1EP4A 3T1AA 4P2FA 2J0XA 3ZC4A 2E9ZA 2YKNB 2I5JA 2DR6A 3DRYA 2EG2A 1KBRA 4A4JA 4DV5F 4J9VA 4RW4A 4MIWA 4USMA 4UUWA 4J90A 3CO9A 1XMOJ 1NHKL 4EYIB 1WNEA 4OLPA 1NDPA 4NZ7A 4USHA 3IG1A 2XMKA 3R5AA 4C11A 4WFZA 3SSSA 1DTTA 4ZCKA 4QPTA 1JXVA 1C0TA 4DFPA 2QMUB 2MY7A 4O4GB 1RBOB 5IWAJ 2IBKA 3ZTOA 1QTNB 2LP4A 4ZPVR 1P8GA 2IPOB 2GIFA 1X4EA 2G1HA 4ECSA 2I2YA 4JI4J 4PXEA 5KG2A 2IY5B 3V6DB 4UUXA 2HK2A 3QQCD 1ZPVA 5F8NA 3WQPA 1EP4B 2YY3A 1S6PB 4DFMA 2J5AA 1QJHA 1RT6B 5J2QA 1XMQJ 1QSSA 3R1HA 2L48A 4QIWD 5KFWA 1E6VB 4B9NA 3O3LA 2JOQA 4HEA9 4CTAB 4DR1F 4M1KA 3HMJG 1QAXA 5F9LA 3KLFA 3J81j 3HP6A 3CXCR 1AUSL 2KRRA 1FJ7A 4J9SA 4C0HA 1VIOA 4C11B 2YPZA 3UCUP 2WAQD 4WP9A 2IHR1 4F4KA 4C8KA 2CZVC 1TELA 2IAJA 4C3MA 1C0TB 3VVTA 1BGXT 1VQSA 4LRBA 1LK7A 4XPEA 2ZZTA 4M5IA 1UA0A 1KTVA 4LF5J 2RU9A 3T5HA 1I3OB 2ZKUA 3V4MA 5IS2A 5D3GA 5L1JA 4JI6J 2Z30B 3WHIA 3PW0A 2AGPA 1HI8A 1YQHA 3BB5A 2KO1A 2O67A 4WYLA 1WC4A 1Q82T 1FVQA 4YY3J 3DLEB 1KVKA 2DD8S 3SDEB 2FLNA 1RCXB 5DG8A 4DL5A 3KLFB 2VJUA 4LMZA 2ZDOA 2LXUA 4LRCA 4U96A 3LPEA 2FVRA 2XHCA 2BJ1A 3J7A1 3MECB 1T05A 2PI4A 3DLLQ 1Q5YA 1SJ1A 3KG4A 5AXMA 3ULHA 2D1CA 1TTHB 1S10A 1D8YA 2EI5A 1M1KT 1FT8A 3K8VA 1NK4A 3G82A 1R6YA 3PRDA 3WIVA 2B7CB 1FJCA 3J7AN 3MEEA 4XPCA 5L39A 4PZVA 1UVJA 1NEEA 5FIIA 2MKIA 2DT9A 5D3GB 2HQDA 2NZ4A 3JAMY 2Y1RI 1FK9B 3PJ9A 4JV0A 1Q81T 1K47A 4E0DA 4AUKA 3EJMA 2MZSA 4ECUA 4IRKA 4B9UA 3HHEA 2PMHA 2ZEJA 2VC0A 1KVJA 2A2DA 3I0RA 5E3CA 4LR9A 1YITS 2N82B 3PJWA 5KFVA 1NXIA 1C0UA 2EFNA 4JI7F 2KB2A 3W9IA 3NOCA 3GIMA 1BD6A 1C4AA 2JLEA 5AE1A 3E2EA 2RIJA 4NEYA 4DJBA 1XTZA 3OBIA 3RJMB 5A76A 3G82B 2A1BA 1EIYB 2HSEB 4ZOSA 5DGBA 3MEEB 2BW7A 3LA0A 2YKMB 1UVKA 1DURA 2ZKTA 1U2FA 4ANDA 4CT9A 2VQFJ 2CAJA 4CH7A 4G1IA 1N36J 2Y1LB 3GE9A 3PXGa 3H5SA 2OHDA 2HWIA 2JC1A 1HI0P 3VTIA 1RBLA 3K7RA 2CJ9A 3W3SA 2DNQA 4ZP9A 5H9FJ 2OELA 4CYUA 4DPXA 4DV7J 2IC3B 2ZH8A 1C0UB 1GMWA 4F02A 2B8PA 2BKNA 3MWBA 4OYBA 3JSMA 4KGKA 4B3SF 2L08A 3KWMA 2X1FA 2VDHA 3S01A 2EG1A 4OZJA 3VGTA 1Z1ZA 3D6FB 4I64A 1QAYA 2XMAA 2YNFA 3LP0A 4YS2A 3C15B 1BWEA 3DRRB 5GMKa 4NLGA 2X1GA 1UA1A 2J0WA 2P9CA 3H4DA 2OO4A 4J9LA 4Y34A 1S72S 4O23A 3CD6S 1WF1A 1S0MA 3MAQA 2VPXB 2E1RA 4RW8A 1HNWF 4PWUA 2LQJA 1FRIA 2R7UA 5HMYA 5AJ3F 2RF2A 3ENWA 1TK5A 2CQCA 1QUVA 4F7VA 3HSJA 4CYUB 4EFAC 5LL6d 2Y0BB 2U1AA 1ZBTA 3GIRA 3DCAA 1ZA1B 5B0FA 4OI6A 5LMNF 1JLEA 2F5GA 4A8OA 1GX5A 2C2EA 3QPIA 1FJGJ 3BYRA 4ZPTR 3LP0B 2MLZA 2AQ4A 4OZ1A 3CJ8A 2V4JA 5GADI 2M7SA 1FXRA 3OFHA 1X9SA 4DU7A 2ALZA 3GV5B 4WIIA 2HLUA 2CQ3A 1RKIA 4MKBA 1S1UB 1H7WA 1KEKA 5IQ6A 1Y00A 2UUAF 4RW8B 2B9XA 4P52A 4DV3J 1NCLA 1S6OA 2FDNA 1HNXF 3JQJA 3W61A 5DLFA 2RF2B 1CVJA 3TEGA 3HHLC 3BDEA 3KFWX 2I9SA 2XSJA 1T03A 4LREA 4J9OA 4IDKB 4NYOA 3RRHA 1H38A 1WKJA 4L74A 4ALZA 4PWDB 2V9WA 3QIPB 3RW7A 1LEOA 2G0CA 2W1BA 1ZAWA 1RISA 4WFYA 3OL9A 1WC3A 4NCGA 4ZLPA 1S1WA 3QO9A 3NWGA 2MJUA 1EETB 4ZK7M 3QIDA 2JEIA 2ZM6F 2AV5A 2C2MB 3P5BP 1RT4A 4CO2A 3VWSA 3KJVB 5C2GA 1HWUA 4K0KJ 1N56A 2ZNZA 1JNZB 4CI0B 4KHPF 2HHHJ 9ATCB 2KXHA 3MGJA 4P7TA 4JV5J 2YWFA 4RNMA 3MPUB 3PYFA 4YMEA 3C14B 2CXEA 5GAEI 2UXCF 5EN1A 3VAKA 4MIAA 1Q53A 3HSDA 2XG8A 2CVEA 2KXFA 2RKIB 4UY85 4RBVA 4IG3B 1J27A 3UW1A 3PKYA 3QATA 4LF4F 3CDWA 3K2YA 4F3MA 3W66A 1N0VC 2ZH9A 3MF5A 1NPKA 5KFEA 1PYSB 1HI1A 2MSTA 3KK3B 3DLHA 3MR7A 1RT2B 2CQ4A 1UP1A 3A12A 2DO4A 4RU2A 4NCGB 4A8WA 3ZO7A 3OSPA 3QO9B 3CPWR 3D6MB 4TN2A 1F60B 2XMTA 1HBNB 3MM9A 5F41A 2I6WA 3GFHA 1AT1B 1HNIA 1OYEA 5K14A 2AEMA 1RT4B 2HBQB 3QWUA 2B5JA 3HHNB 4DR7F 3ZZZA 4NLXA 2MGZB 3NGSA 2CJKA 1O0PA 5KG3A 2CNOB 4OHWA 5IZHA 2A18A 3W63A 3FCWA 4LF7F 2FC8A 1CEZA 1BE4A 5IC6B 5L46A 3FMBA 5EX0A 4RBTA 5I3PA 5C2CA 2OSRA 4UTGA 2CDQA 5EWFA 4KTQA 1R27B 3OUYA 3WX8A 2KG0A 4LBPA 2GVDA 2V8GA 3FEZA 2R7XA 2VIHA 3I4HX 1UKUA 2ZWOA 4QWDA 3KKFA 3EDRB 3M9NB 4ZPBA 4B3TF 1M1GA 4NI2A 2MKYA 1JLCA 1C1BB 5KG0A 4WFXA 4WFNQ 4DF4A 3MM9B 4CLSA 3MCSA 5K14B 3VHQA 2MZJA 3F41A 2H9ZA 3HVTB 1N5YB 4JI8F 4QBUA 4ID5A 4DR3J 2CQ1A 3R27A 2E9TA 1URNA 3AAWB 2AJ1A 3L4BC 2COLA 4DZDA 1FRXA 1T9WA 2DNZA 4DBQA 1HQUA 3D54A 2RMLA 4NYPA 3W7BA 2LQ8A 3HCXA 3DLGB 1B99A 2X1AA 1N54B 1S5ZA 3D6TB 4OYPA 3L09A 4NZ0A 2VH7A 3KOAA 2LU1A 1X9MA 4C3LA 1SI9A 1X0PA 1FWPA 4H4OA 5KFCA 3OUYB 1TK8A 4DV1F 4B9LA 4TLQA 3FSIA 1XC9A 2N7YA 1RDRA 4ER8A 1CJVB 3KHGA 2LYVA 2H1YA 4J5OA 3MTJA 4OZNA 3DOKA 2B9WA 3BQ2A 4DR1J 3UPFA 2QSFA 4FYVB 2FHMA 2ZH6A 2R7TA 2E1PA 5D4LA 1GMVA 4FBTA 3CW2C 2W25A 3MAAA 1RP5A 2HBZB 4MKVA 1BQXA 3R5JB 3LAKA 3G8QA 5B0GA 2GIQA 4RW7A 4ID5B 2W4CA 4QR1A 3CCQS 3HM9A 1S7IA 2FJAB 4DQSA 3NLCA 4DEZA 2B7BB 4WK3A 4OI0A 2D9PA 3G6XA 2XQCA 1Q5VA 1X5PA 2AKWB 4X4RA 2MQOA 1VQPS 3HD1A 4M63A 4LR7A 2OFHX 1U6BA 4TQSA 3H2LA 2LECA 3MMBA 1NK9A 3E01A 3MURP 3T19A 2VZ9A 2ERRA 1YX2A 4MKYA 1C4CA 4DV6J 5HANA 3EPIA 4O44B 5D0HA 3QMQA 1RYRA 3PRBA 2R7VA 1IKYA 1IKVB 4USJC 2GX8A 1XR7A 3EDQB 2NSCA 1WSRA 4JI3F 1V3ZA 4ELTA 2RD5C 1A7GE 3MAAB 2QFIA 4NL5A 4OYAA 4RW7B 1PCAA 4P75A 2HK3A 2V69A 1N6QA 2IDLA 4KGZB 4TU9A 4ILLA 4V19X 4QW9A 3ILOA 4IO9Q 1JJHA 5KT4A 4DX6A 4ID8A 2IFXA 1R6VA 2DNOA 3CCTA 4PG5A 3VAHA 2KN4A 1SCJB 4EBDA 4W4MA 2C42A 2QLXA 1VJQA 1U0HA 3TVYA 4K4SA 4NXNJ 1X4DA 1FXLA 4KKOB 3OR2B 5K8PA 2QIFA 3HHLA 4NCBA 3QAEA 4OV1A 3MI7X 4OX7A 4OLOA 3M9OB 4JI0J 1FNMA 2ASJA 2QL9B 2NYIA 3PTWA 5LXRA 4DX7A 4HR2A 2G9OA 2KT5A 5I3UA 4V19J 4JI7J 3TANA 2HAIA 2B4OA 2V4QA 2PD1A 2ZOFA 4EBEA 2F4VJ 1UETA 1N4LA 3TZXA 5KFPA 2V4RA 4QU6A 4ZPCA 1N6QB 1MROB 3CMES 1Q8KA 3CCMS 4NA1A 2H4YB 1NUEA 4FYXB 2LU2A 1M1HA 5KFNA 5KFHA 4CH0S 3IR6B 4U7UK 2CWXA 5I42B 2E7VA 4QIVA 4DL6A 3F73A 1JLGB 1U0HB 4ZJLA 3CJ5A 4B3OA 1VQ5S 3IGNA 2V63A 3HHLB 5A8WB 4ZLJA 1NJWA 4X62F 4KR0B 3OVAA 2XB2D 1VHFA 2KFZA 2XNRA 2WB4A 5C24A 2LLZA 5B0EA 4FKXA 2A2CA 2VG5A 2GZOA 3Q23A 2HRTA 5I3UB 5A2QU 3MR2A 2CQBA 3UCGA 2BKPA 4J9NA 3A3NB 2YWHA 4LBHA 2VUGA 3G6ES 3MEGA 4B3SJ 1LK5A 1R3NA 2W9CA 1X4BA 4JI2J 2X3GA 2O3DA 1EQMA 2U2FA 4R8UA 1FNXH 3KLGA 1FFWB 3OTBA 2DO0A 4X4VA 5IQQA 3DGPA 1S59A 4KE5A 1VRUB 4K4VA 4D3GA 2JL9A 3I9ZA 1ULRA 3KK2A 5HAOA 2K3KA 2YWWA 1YRTA 1DJ0A 1F9FA 2WB1D 3UN2A 3I32A 5J2MB 3ITHA 1XJWB 4QR0A 1M0SA 1KONA 5DDQC 3DYAA 4EO8A 2DHAA 3LPYA 4L6V3 4I4BA 5B0CA 3GR0A 3NS6A 3AD8C 1X4CA 4OJHA 3MEGB 4KV8B 2MSSA 3JTNA 4OZ5A 2QA2A 5DETA 1EX8A 2LDYA 4R8UB 2OPRA 2B8QA 3DNCA 3I5BA 4NLUA 2YKOA 4ED6A 1CS4A 2FLLA 2Q6BA 3DFEA 3RYLA 4CWBA 3T5LA 3D7SB 4F0MA 5EHHA 2RQCA 2E5LF 2BEFA 3Q83A 3TO8A 3CC4S 1PG5B 3UI3A 2CQGA 3PKMA 4XDCA 4FS1A 2QE5A 1A0OB 1HNXJ 5F8IA 4RPFA 1U1PA 1T7PA 5LJ5Y 2NXEA 1FE0A 3DYAB 3SSRA 2W9BA 3KLIA 1PAUB 3DOMB 1SH2A 4JBCA 3H8YA 2GIRA 1LWFA 4F0HA 1I51B 2R8GA 1OYDA 2C28A 4MK8A 4RUAA 1DTQB 1NZ8A 2EBEA 1YWXA 4DWIA 3TUZC 5FDLA 2MZQA 4GKJJ 4RZRA 4B3MJ 3MR5A 1NK6A 3FUYA 3OSNA 4C48A 4X64F 2EXUA 3N28A 4CNZA 2PFDA 4Q8FA 1U48A 1U8SA 4YR0A 3SI8A 1F2HA 3L95X 1MMDA 2D3OR 3MEDA 1LW0A 2DH8A 2VKRA 4MTPA 5G4DA 1F2GA 2VICA 1GNKA 2QYGA 1VR6A 3N01A 1X0FA 3ET6B 1Q8LA 4CLKA 1MU2A 2E5JA 3AB2B 2YVSA 2W7PA 4AXIA 4GKKF 4MFBA 3HPOA 5ETRA 5JJBA 1JLQA 2KL8A 2V8VA 2UXCJ 2XY5A 1C2PA 3T1YJ 2FGOA 2KT3A 4NPOA 1NB7A 3HF5A 1C1CB 3R5BA 2DISA 3M8RA 2YNIB 3MTKA 4NLRA 1IBKF 2JFKA 3TUJC 3QYYA 4CLTA 2UUWA 2HMIB 1WSVA 3NNAA 3DLKA 3PO4A 2WCXA 2AD9A 1OIAA 1NJYA 2DEIA 2MQNA 5C25A 5T7LA 4DCPB 2P9EA 1FF2A 2OD4A 2AT1B 1S99A 1LW0B 5KFIA 3JAMU 1TUWA 4ES3A 4NX9A 2ADBA 1MU2B 1D9FA 5L1IA 1X5TA 2W4PA 4MFBB 3K5NA 2CPXA 1JLQB 2MQLA 1ZAVA 1T0TV 3LP2A 1HMVA 1REGX 2D74B 4Y2KA 1FD8A 4DN9A 2XULA 2K1RA 1HD0A 5D15A 3AXKA 4DL2A 3TUIC 2E9RX 3CDEA 3DI6B 4EYHB 2GGPA 1RJJA 4LF6F 1FX2A 2KFYA 3M8ZA 4DR2J 1NPRA 3TQEA 1UZDA 1S97A 4LF8F 1S9GA 3CMQA 1LW2B 5C25B 3W9HA 3M32A 3GQCA 3DOLB 1BQNA 4XDDA 3T41A 3J7ZT 5T41A 1HWJA 1OSDA 3M1VA 4RW6B 3QLHA 2UV8A 4C7QA 2W2QP 5GVQA 3DRPA 2RH3A 2H48B 2HBYB 3HVWA 3GFXA 1HL6A 2IM0A 1FDNA 5AT1B 5K8MA 1QM9A 1GK8A 3M8SA 1GEHA 4LFAJ 4YB5A 3VQTA 2OKQA 3CJTA 1EKSA 2KHCA 2EC2A 1N52B 3IWNC 4IH5A 3LGMA 4NLOA 3PY8A 3J81U 4JI5F 3GR1A 2BACA 1HMVB 4LR8A 3OVBA 1ROFA 2HFZA 2PE8A 2GJ2A 5AXKA 4DSFA 2KM8C 4G3IA 3N0VA 3VZHA 2E66A 2ILYA 5CYMB 4RUHA 4N7TA 1W2BR 4I67A 2Z58B 2OSQA 2XYGB 2WONB 1FX4A 2IJFA 2CJAA 1RGVA 2OTJS 1YLXA 2HG4A 1KRPA 1S9GB 2FY8A 1HNVB 5A6WA 5FLXY 1CG2A 3U7JA 1U09A 1K1SA 3KHLA 1LWCA 3DDIA 4RR5A 3Q2SC 4A8FA 2Q1LA 4BCAA 1KD1T 1DLOA 1GMUA 3AOCA 2NXCA 4E8UA 4CLUA 1XR5A 2Z4PA 2CPYA 3AD9C 4FF4A 3LO3A 4ZVQB 1QSYA 1AROP 3MM5A 2DY1A 2KVIA 2R8KA 3I96A 5LSLA 1RB0A 5KFKA 4NXMJ 2QG9B 1PJ6A 2FVPA 1FWLA 4CH1A 3GIKA 2GHVC 2HHXA 4WPAA 3UVJA 4NLQA 2HRYA 3I6PA 4JUZA 2GMHA 2XHWA 2PC6A 3FSXA 3Q8VA 1L3KA 5HVHA 1VGYA 2DNMA 3KHHA 2A0FB 2HPUA 1SPBP 3NY0A 3HHKA 2OP5A 5J2NB 1Q86T 1UFLA 2ABYA 4RLEA 5KTQA 3RAXA 5BYQA 3QGIA 5KFDA 1YDLA 4C8YA 3HXMA 2K7JA 5LXYA 4YHHJ 1IBMJ 1S6QA 5ETOA 4QJVA 1IQTA 4K5SA 4NOHA 3CJRA 1VFJA 2CNLB 2BQ3A 3T3FA 5CYQA 1T9YA 1VQ4S 3MM5B 1FKOA 4L75A 1V5VA 1H98A 1JIHA 2HQIA 1RTJA 3S7RA 3D1QA 5F0UA 3FZ2A 4IUFA 1J5EJ 5MLCV 1F3VA 1AZSB 2DIVA 3UVJB 2ZOGA 4FXWA 4DMZA 2PDAA 5AXLA 1S1XA 2HW3A 1HBUA 2BYCA 2CFXA 4ECXA 1DARA 3BN4A 2IRUA 2RHQB 4J37A 1D0EA 3N6NA 2IJNA 4CNYA 1IKWB 5M2UA 1OQ6A 3MEKA 3B78A 1DY3A 3M6XA 4DSLA 2XCAA 1WC0A 1S6QB 2WHOA 1NJZA 2OJ3A 4DF8A 2IIHA 1G6BA 2GNKA 5CYQB 4QOTA 4WP8A 3VR1A 5KFFA 2RDDA 3HJFA 3V6KA 1FKOB 4MJKA 2C2ZB 4CRJA 5HMZA 1IWGA 1RTJB 2HVDA 3D0HE 1KQFB 1P9YA 3DM2A 2WW4A 4J9KA 2I38A 4JYAJ 1FDAA 3NRBA 1S48A 2RQ4A 3FZBA 4ES2A 2DY9A 5D0EA 5IXUA 5DLGA 4ZVEA 5HSPA 3R6GB 1GFWB 4OMFG 3M8QA 3A1YG 3WC0A 1NH7A 4PR6A 3D4JA 4EZ9A 4X62J 2UVRA 1S1XB 1NNDA 1NAQA 1KSPA 1HHTP 2CJXB 2YKAA 4ANEA 1F0XA 4JI4F 3C2PA 1GXTA 4DV4J 3K0JA 4Z2XA 1SVDA 3ZTSA 3FRZA 5KT6A 2DHHA 2NPIA 1YK9A 4ZITA 2FVSA 1XMQF 2DGQA 1Z2ZA 2BE7D 1HQEA 3GJSB 2JWNA 3OTEA 3TW0A 1WG4A 3HDSA 2YQ0A 1TKZB 2UVUA 4A8XA 2MMYA 1RWVB 4IR1A 4QWAA 3H2UB 4F2SA 1RAFB 2JSXA 1E6YA 1OPIA 3EVWA 4PG6A 2AYBA 4Y2AA 1RCOB 2LEBA 5B0BA 3A8EA 3BYPA 1NSPA 3OLBA 3MDFA 4ED0A 5EUHA 3M05A 2DR7A 1YBTA 3GV8B 5DZ7A 4AQYF 3VGVA 3I4PA 4P7VA 3QGPA 2ZNYA 3KMSA 4K4TA 3VAGA 2R7RA 4LBIA 5L8RC 3ZZRA 4ZCMA 2K06A 4LF5F 2QX0A 5KAKA 2PSZA 2QLWA 1TVRA 4LFBF 2CADA 3UD4P 1X5SA 5B7WA 2KH9A 4DPUA 1ZZNA 3ICLA 2V6AA 2EK1A 2AJ2A 3THTA 2BW2A 4UOGA 1IM6A 4DG1A 3FBEA 4B3RF 4YY3F 5J1NA 2NREA 1XWLA 1RHMB 1TMJA 2OH2A 1TL4A 3D28A 1E6YB 4C9DA 2VOPA 4C8MA 3J80U 3N5FA 1UJ6A 4O3RA 3HHLD 2NPFA 2LQ9A 3PJXA 1Y5NB 3JTPA 1SC1B 3KLVA 1NBEB 2FJXA 3TA0A 1HQ2A 2AGQA 3DU6A 3HZGA 1GTEA 4RW9A 2XTJP 3VAMA 3UN5A 2JJ4D 4UQGA 4N77A 3GIIA 2Z2YB 4YP3A 2VQEJ 2F8HA 1TVRB 3W2VA 3T9NA 1WDDA 2KKHA 1B7FA 3C16B 3H25A 2KG1A 3ZZOA 1TL7A 4MK9A 2GS8A 4RUCA 2F8EX 2VU5A 4DG1B 1TQLA 4L3NA 4UZCA 4PAAA 3TZZA 5IT0A 4HKQA 2F9DA 4FDFA 4M94A 3DLBA 2CJQA 2POKA 2MY8A 2OPSA 3AA9A 3HI9A 2MPUA 3TOQA 4QIFA 5H9EK 3B4MA 4DUZJ 1W7WA 3W5ZA 2FUG9 2NYHA 3CIMA 3B6BA 5C5JA 2VFRA 2F40A 4EEYA 3IBFB 1FA0A 3MMAA 1OMSA 5I3QA 4KY3A 2WK4A 2XWXA 2KM8B 4WCEQ 3MD1A 3V81A 1FEEA 3OTOF 1T95A 1N34J 4WK1A 2Q66A 3OL7A 3P3DA 7AT1B 2GVZB 4X4PA 2R8HA 4AL5A 5KT7A 1TL7B 3CGIA 1TL3B 4W90B 4M5HA 1UZHA 3D3BJ 2LXFA 2D9OA 3BSNA 4F4YA 4QYZK 4GO7X 2W7OA 1NDLA 4EGLA 2VPWB 2FPHX 3I9V9 2I8EA 4W92B 1GXUA 2BUNA 2BM0A 3ETOA 4LRDA 2OPSB 4DV7F 2ATLA 2PA3A 2YWGA 1XNRJ 1PKUA 2B51A 3LGHA 4FF1A 1OO0B 4K4XA 3G2XA 1CULB 2DH7A 4TXSA 4PXCA 2WRMA 1U1RA 5AE3A 4XTTA 5KFQA 1WKKA 2CPJA 4DQQA 3DGVA 2JEGA 3DDNA 3MMAB 5CZVA 3K8WA 2F1FA 2W8KA 3QRRA 4DR4J 5KFLA 3H59A 5ETPA 3OV7A 2ZH5A 4U9RA 3ENAA 4DS5A 2JH3A 4CO1A 3M6UA 1TAQA 2PEBA 3MPYA 2AGOA 4TU7A 4YDDB 2A10A 3UNGC 3C46A 4RX6A 4TKTA 1R8PA 1N5TA 2B0GA 2GAGC 1V5IB 5DDRC 1FCAA 3HFKA 2CJYB 4BWMA 4X4UA 3KG0A 1I94J 4OYZA 3NCPA 3R3TA 1RWKB 2C1EB 2DNRA 3UN3A 4LF8J 4U95A 2ROPA 5E3RA 2W2OP 2J7KA 2CKWA 4ZVGA 5IM0A 3RAQA 2YQ1A 3G8SA 4PQAA 2W8LA 4PG4A 2OPQA 2FVQA 1XMBA 3NL0A 1FJGF 3LANA 1Q8BA 1NKEA 1QY7A 3HJVA 1SL2A 3MOZA 4WTYA 3CJ4A 3VALA 5D4OA 1RTZA 4I6AA 1JLAA 4CIOA 3IXQA 1T9UA 1RKJA 3ZXWA 5HBMA 4K2XA 1VCTA 3AXMA 1UEUA 1NKBA 4ZVTB 4WJBA 1RT1A 4DV3F 1WG1A 3TQ1A 3PW4A 4QU7A 3CE8A 3MPVA 3G86A 3PX4A 3KLEB 4URGA 5G0RA 3TA1A 1Y9OA 4CO0A 2E1AA 1AYEA 4RNNA 5IM0B 3PFEA 1EHWA 5KFAA 4KT0C 4C4WA 4OZ0A 4DFKA 2DBBA 2OPQB 3BQ0A 3G87A 4I7FA 1NHUA 4FZVA 3RZAA 3L7UA 1PYOB 2MQQA 4R25A 4DX5A 2UXDJ 4XO0A 2RQKA 5IFMA 2QLFB 1CJUA 2J7UA 4AL6A 1YI2S 4H4KA 5AXNA 3P5TL 3SCKE 5KG7A 3L9ZA 2RDIA 2CPFA 3FC9A 4K0KF 2HNZA 4IYQA 2PI5A 4NRUA 2HHHF 5CXTA 1JLFA 3K59A 1HBOA 2GO8A 4JV5F 3PW7A 1UVMA 4O3NA 3L7OA 4QWEA 2V9KA 4OX6A 5CAAA 2ZWPA 1RBAA 5G0RB 5I4MA 4Y3CA 1WD6A 4DI6A 4BC7A 4FVCA 4NA2A 2FYXA 1MMLA 3OD2A 2YKNA 3OFEA 1UPMB 1ZYQA 3OJUA 2RSQA 4C0BA 2HFOA 1IKXA 1WHXA 5D6GA 1RHQB 2JZ5A 2EK6A 2UXBJ 3AQOA 3QFHA 4F67A 1FRJA 2FZGB 1WF0A 3F56A 2C2DA 3H5UA 1CJUB 3CCVS 5A2QY 1NSQA 2VBXA 4FPIA 4QYRA 3VQSA 1Y7PA 2KFNA 1NJIT 2K3IA 1NO8A 2FGCA 1M5KC 3BR8A 2BX6A 2J6TA 1JLFB 1T9TA 1HBOB 5LT5A 3M6VA 1VQNS 5KFTA 3RBDA 5CZXA 3MOJB 3PW5A 3MR6A 2ZHAA 4AD6A 1RYSA 4DV0J 1RABB 5KFRA 4GRSA 4Y65A 4ECWA 2VFVA 4ZP8A 5J1EA 3PYGA 2DGSA 4ILMA 4F26A 4NMLA 5LSRA 4X4TA 2KJWA 2BM1A 3CC2S 2G4BA 4M5DB 1S6PA 2FTRA 1RT6A 3PX0A 2JEFA 4UY8T 2CJBA 2PN6A 2RT3A 1E6VA 1G2EA 4OV6A 1IKXB 2XY7A 4NLPA 4Y0FA 1IQZA 4CTAA 2GQ2A 4U8YA 3NAIA 2OIHA 2BE9B 4CM0A 4KBIA 3F0NA 4C8NA 5GMDA 1WC1A 5B0AA 5ETVA 1JQGA 4ED8A 2E5IA 2QMWA 1KC8T 3IWLA 4ZVPB 2YX7A 1FKAF
chains in the Genus database with same CATH topology
2XEXA 3CCMS 2XS2A 5HP1A 2F3JA 1AXQA 4NA1A 2XGPA 4ATNA 4I1TA 4DR3F 3CB4A 1M5HA 1AFIA 1TKXB 1APSA 2FHJD 3TI0A 1KFSA 1R0AB 2LU2A 4OJGA 4PQUA 5KFNA 2MDAA 1VIXA 4IFVA 1JLEB 5KFHA 2IVFB 4LSLA 4CH0S 1KS2A 2YQ3A 3LUYA 3IR6B 3MM8A 4U7UK 5I42B 5KFMA 3NMRA 4QIVA 3TAMB 1WEZA 3MXHP 2MZTA 3F73A 4DL6A 1SC6A 4D3HA 4HVZA 2B6AA 1JLGB 2HHSA 1KFDA 4PXDA 1VRTB 2GHWA 3QWPA 7FDRA 5J1EB 4IO1A 3CJ5A 4B3OA 2B56A 2FHJA 4PXBA 4WZMA 5DQGA 2FC9A 3IO1A 1G1XA 1VQ5S 1H2UX 3IGNA 3I31A 5J2NA 5KOXA 3BO2A 4RW9B 3ZZ0A 4EO6A 3ISNC 2V4JB 2PO4A 2VG7B 1WEYA 3HHLB 5A8WB 4DR5F 2PEHA 4OI1A 1NJWA 2L3MA 2FJBB 2J9DE 4X62F 1FHTA 3KHRA 4KR0B 5HROB 3OVAA 1QSLA 2XLJA 4HI2A 2CPHA 1VHFA 2XB2D 4QR2A 3UR3C 2XC9A 2KFZA 4I2QA 2GQCA 3BF4A 1RT3B 2XNRA 2WB4A 2RNEA 3IGVA 4WXOA 5C24A 3RB0A 2LLZA 1FDBA 4YDXA 3W2VB 3RR7A 5B0EA 2MZRA 3R5CA 2A2CA 3DLEA 4KRWA 2DNKA 2FB0A 3EUNA 4NLWA 2VQFF 3D1OA 3R1LA 4AE5A 2VG5A 1CSJA 3SDEA 2M88A 3PX6A 1GH8A 3Q23A 1JXEA 1N36F 5I3UB 2JFDA 4B02A 3CJKB 3MR2A 1PO6A 2CQBA 3SEOA 2HNYB 3UCGA 4QIGA 1U49A 2N4CA 4OI3A 3BSOA 5M2PA 1KOHA 4J9NA 5E3QA 3S6EA 2YWHA 4K59A 2VFUA 2VUGA 4JV2A 3G6ES 3BN7A 1AUDA 2MHEA 2UXDF 4C8ZA 4YB7A 3CVKA 3MEGA 4Y2IA 1LK5A 1R3NA 2VB6A 4DFJA 2W9CA 1GXLA 4ZPWR 2VC1A 2RB7A 2XSJB 1T03B 1X4BA 3V2UC 3MECA 3J7Z5 3CMAS 4A8QA 3PW2A 3C6UB 2X3GA 3LWLA 2BE2B 3EXYA 2O3DA 1QAIA 2KXNB 1ZZFA 2UUBF 5HP1B 3Q2TC 2U2FA 3RU0A 1T3NA 3HKZD 2CIMA 4R8UA 4IH7A 1FNXH 4YR3A 4PUOA 3KLGA 2HRUA 3JSRA 3OL6A 1NK5A 2HHQA 5FJ4A 3HVAA 2RE1A 1LWEA 3SQGB 3OTBA 2HHTA 4IFVB 1FTRA 2RILA 3IS9B 4LSLB 2DO0A 1ZETA 3MM8B 4X4VA 3PIOQ 5IQQA 3VAFA 1S7HA 4USIA 3DGPA 4HT5A 2HGLA 3CDAA 2XMWA 4KE5A 4Y00A 4DQRA 1VRUB 1GQEA 2B6AB 2AX0A 4K4VA 4D3GA 1TKTA 4H54A 1Q7YT 2JL9A 1XEZA 1X9WA 1HBMA 2DRBA 3CTRA 4YFUA 4LSNA 2WTFA 1S1WB 4WXWA 1NK0A 5EWGA 2QA4S 5EWEA 3I9ZA 1UL3A 3E3XA 1ULRA 3KK2A 3GFYA 2AYMA 4B9MA 3BGFA 1MMNA 2LQ5A