1LWCB

Crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
423
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 117
structure length 402
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwcB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcB03
5J2NA 4IDKA 3PJXA 3C6UB 4IKAA 4GC6A 2HMIB 1HYSB 3MEDB 3KLIB 5EDWA 2I1RA 3GIKA 2R8IA 1DLOA 5KFOA 4KFBB 4MH8A 3V81A 5KFQA 1RT4A 1VRTA 1OS5A 3FQLA 4TY8A 4TYBA 5J2NB 5KFHA 2R2UA 3M9OB 4IFVA 3GIJA 2FVQA 2HWHA 2WOMA 3OHBA 1C1BB 2IAJA 3T19A 3OSPA 4IRKA 1C1CB 3RBEA 1XR5A 3MEGA 3BQ1A 4NLQA 4ZVEA 4Q44A 3QO9B 3LP0B 2HAIA 1RYSA 3H5XA 3DOKB 1JLBB 3KHLA 4KSEB 2JEJA 5KFUA 2FLPA 2CJQA 3SI8A 3BGRA 4KV8A 4XPCA 4IH7A 2B5JA 4IDKB 3CJ3A 4ZPAA 5EWFA 1GX6A 2J6SA 2BQUA 1ZETA 2WRMA 3KLEA 4OL8A 4PWDA 1XR7A 2BR0A 1LWFA 3H59A 4ZVGA 5KG0A 3GQCA 4EBCA 4IH5A 1LWEB 5I42B 3BJYA 1S0NA 3DI6B 3DRSA 2D3UA 4NRUA 4G3IA 4RW9B 3TAMB 3QGIA 2IM2A 2R8HA 4I2PA 4DL7A 1S1VA 2W9CB 1HNVB 2JC1A 2DPJA 3N6NA 5DGAA 1LWCB 1EETB 2OPRB 3M8QB 4O4GB 3N6LA 4JUZA 4YR3A 5HBMA 2VG5B 2GC8A 5KFRA 3KHHA 4M95A 3CDUA 1RT1A 4B3OA 5L1IA 4ECZA 3C6TB 3LP2B 1LW2B 2ZD1A 4I7FA 5T14A 3CDWA 3MTKA 4WE1B 2IC3B 3DRPB 2RKIB 1RT7A 2YKMA 1IKVA 1TV6B 1S1TA 1TL1A 4J9OA 3MR2A 3KLEB 3T5LA 3PHEA 1NHUA 2FVCA 4IR9A 4H54A 1TKTB 2IM0A 4U7CA 3T5HA 2OPPA 2AGOA 4EO6A 2QV6A 4MK9A 4MFBA 2HWIA 3UR0A 2W9CA 2AX0A 3G6VA 1TL1B 4ECSA 2D3ZA 1RT2B 5EWEA 3CJ4A 1IKXB 1S9EB 2IM3A 5KFZA 5L9XA 4IG0B 3PW2A 1RTIA 2IA6A 3LP2A 5F8LA 4JV2A 4KB7A 1K1SA 3T5JA 1YVFA 2UVVA 1LW0B 4TLRA 5HLFB 4WFXA 1FKPB 1KLMA 4YR2A 3V6JA 3DLEB 2DPIA 2RF2A 4ZP8A 3NKYA 4U6PA 4RW8B 3RB6A 3SFUA 2VA3A 3V4IB 2YNHA 1TKZA 3DYAB 4LQ9A 3G6YA 2FJVA 1D0EA 1C1CA 5KFFA 4DG1A 2J6TA 4H4OA 4ECUA 1HNIA 3MF5A 3DDKA 3QGHA 4RNFA 3T1AA 3QIDA 4IQXA 2AWZA 2XGQA 4URQU 3T5KA 3V81B 3VQSA 2YKNB 4DL5A 4LSNB 2XC9A 2YNHB 3DYAA 4MKBA 2OPSA 4KO0B 1RTJB 3KOAA 4R5PA 3KJVA 1S6PA 5CYQA 1N5YB 4NLDA 5C42B 3Q8PB 3C6UA 3OL7A 5KFEA 3QO9A 5KT5A 5J1EA 3CJ0A 3I5BA 4WYWA 4DL6A 4Y3CA 2YNFB 2C28A 1HQEA 1JX4A 5F8NA 2ZE2A 2XCAA 4NYZA 2BE2A 1HMVA 3NAIA 5KFBA 5C5JA 1RT2A 2ASLA 2VG7A 3DRRB 1T94A 4F4WA 1LWFB 5KFNA 1TP7A 1JLGA 3KLFB 1JKHA 1SH0A 5C25A 4MKAA 4IFYA 4GC7A 4F4ZA 3FRZA 4J9LA 4RNMA 4WXWA 2I5JB 2R2TA 5DG8A 1HARA 2HNDB 1SUQA 1N6QA 4YP3A 4K4SA 3E51A 5KFSA 4Q8FA 5HLFA 4IG3A 5C24B 1C0TB 5KT6A 4H4MB 1K1QA 3M9MB 4PQUB 4HYKA 2BQRA 1RTHB 3LAKA 4Q8EA 1DTTB 3HVAA 4NLXA 3CDEA 5I42A 1D1UA 3NMAA 1HQUB 3I0SA 2WOMB 3KLHB 2OH2A 4EBDA 5KFXA 4QWBA 4IRCA 3BSCA 3GIIA 1S1XB 3IN5A 1S9GB 3FFIA 3DOLB 2FLLA 2HNZA 3MEDA 3OLBA 4ID5A 3DM2A 1UWBA 4PUOB 5DQIA 3BSOA 5KFAA 1QUVA 1QE1B 2GIQA 2JLEA 4NCGB 4LQ3A 1T05B 3JSMB 1S6QA 5I3UB 4WYLA 3IGVA 5L1JA 4K4VA 1QAIA 4FBUA 4H4OB 2YNFA 4IR1A 1S9EA 2ALZA 4KFBA 2WCXA 1UWBB 4RW8A 4PQUA 3LANA 1JLQA 3KK3A 2XGPA 2WB4A 2IBKA 3H40A 2IC3A 1REVA 4YQWA 5KFKA 1SH2A 2D7SA 3CJ2A 4ECWA 2AU0A 2E9RX 2OPPB 5F8GA 3NGDA 1LW0A 1SH3A 4J9RA 4WZMA 4Q45A 2JEIA 5KG3A 2V9WA 5KFDA 4F50A 4LSLB 3KNAA 3HVTA 4ZVHA 4KE5A 4QPXA 4IFVB 1RTJA 3MFIA 2ILYA 2FVRA 4O3RA 1RT7B 2YKMB 5F9LA 1EP4B 3ITHA 1S49A 2RDJA 3EZUA 2YNIA 3OL8A 3CIZA 5HP1B 4NLYA 4PWDB 4K4ZA 4LSLA 4ECYA 2HNYA 2VG6B 1RAJA 2ASJA 5HROB 3FDSA 2BANA 3FQKA 4K4WA 1BQMA 1JLEB 5KFWA 1TKTA 1MU2A 2IMWP 5C25B 3NAHA 1S6PB 1IKWB 5CYQB 1RA6A 2ILZA 5KG7A 2UVRA 4NLPA 1WNEA 2W9BB 5HP1A 2C22A 1FK9A 2VG7B 3DRRA 2FLNA 2UVUA 1IKXA 3MEEB 3I0RA 3HHKA 4MIAA 4EYIB 1I6JA 2WHOA 3DI6A 3DRSB 4RNOA 3NBPA 4ZPDA 2WONB 3Q8RB 1SV5A 3M8PA 3N6MA 4R8UB 1N56A 3DLGB 1EETA 4O4GA 5KFTA 2R8GA 2B5JB 5HBMB 1JLCB 1JLGB 1LWCA 2OPRA 3M8QA 5KT3A 5DG7A 3IG1B 2HMIA 3DOKA 1CSJA 4NLVA 2RF2B 2IJNA 3CO9A 5J2QA 3CJ5A 2UVWA 1LWEA 1TVRA 5EUHA 3PR4A 5KT7A 4O3PA 3BSAA 2W8LA 4URSA 2ZD1B 4I7FB 3V6DA 2FJWA 2V0NA 4Y34A 4ED2A 5D3GB 2IAJB 4Q0BB 4J9PA 1S6QB 5I3UA 1S1TB 5KFVA 3KHGA 4ED8A 2ASDA 2VG5A 1S0OA 4ID5B 3KK2B 4NLOA 3G6XA 4PUOA 5F9NA 4QWCA 5DLFA 2AGPA 1DLOB 1JLBA 3H5UA 4R5PB 4I2PB 3H4BA 5CYMA 1BQNB 1VRUA 3KMQA 4MFBB 3PW7A 5KT2A 3RB3A 3E01B 5DLGA 4NZ0A 1DTQB 2HNYB 2VG6A 3KLGB 1JKHB 4WFYA 2BRKA 5F8IA 3DLKA 5J2PB 2E9ZA 1RT4B 1VRTB 2B6AB 2IJFA 3QZ7A 1BQNA 1VRUB 2R8JA 4RW9A 2HNDA 1W25A 3D28A 5KG2A 4TQRA 1C0UB 1JLFA 4KKOB 4O44B 5KFYA 3GIMA 3GV5B 3PJWA 1S1XA 3PZPA 2JC0A 5KFCA 4O4RA 3H5SA 2WONA 3I5CA 3IS9A 4G1QA 2XI2A 1TKXA 2W8KA 4ICLA 3CWJA 4IG0A 1S48A 3ISNC 4KKOA 1C0UA 1IKVB 1TV6A 2YNIB 1RT5B 5KG4A 4ECTA 1S1VB 2VA2A 2RKIA 3DRPA 2O5DA 2W9BA 1S97A 4X2BA 4IH6A 1HYSA 3PW5A 3RAXA 4RUCA 1MU2B 2R8KA 2YNGB 3DLKB 1TKXB 5J2PA 1JLAA 5KT4A 3BQ0A 2BRLA 3JYTB 1RTDB 4R0EA 4WFZA 4TY8B 2QE5A 4Q43A 4QWEA 2AX1A 3M8PB 4TXSA 4ZPCA 1S1UB 4MIBA 3IGNA 4ZHRA 1JLFB 4O44A 5KFIA 1RT6B 1TL3B 2R2RA 3Q8QB 1JLCA 1C2PA 2W9AA 3PW4A 3RB0A 5F8JA 4FS2A 1JLQB 3KK3B 3LP0A 3QLHB 3EPGA 4ZVFA 2W7OA 4WE1A 3RAQA 4K50A 2F8EX 4EBEA 4ECRA 1T05A 4DG1B 4J9SA 4ED1A 3E01A 1JXLA 1HNIB 1T03B 4TN2A 1S9FA 1HPZA 3KHRA 2EC0A 1C0TA 1J5OA 3UQSA 4QWAA 3SFGA 2C2EA 4YMEA 1IKYA 4RW6A 4KBIA 5KFPA 4ZPBA 4EEYA 4I2QB 2HNZB 4NLUA 3OL6A 1FKPA 1KLMB 4ED3A 3KK2A 3FSIA 2XWYA 3IRXB 3DLEA 4KO0A 3H5YA 2J6UA 1S0MA 3DLGA 3TAMA 4IFYB 3HVWA 3ICLA 1T03A 3HKWA 5D3GA 4Q0BA 3V6HA 3QIPB 3M9NB 1C1BA 1GX5A 2ATLA 3JSMA 5DQGA 1DTQA 3KLGA 1RTHA 4RNHA 3MFHA 3GV8B 4NLTA 4TYAA 2WTFA 2BE2B 3OHAA 5DQHA 3KLVA 1REVB 1FK9B 3BREA 2OPQA 4RNNA 4ECVA 1RYRA 2UUTA 4YR0A 4ECXA 4ZP7A 1HPZB 2XI3A 2BANB 1IM4A 5KG1A 3TVKA 3RB4A 2YNGA 1FKOA 3NBPB 2FJXA 4KAIA 4TY9A 4NLSA 3MECA 1SV5B 5JUMA 5JXSA 4O3QA 1RTIB 4MK7A 4QW9A 5F8HA 2OPSB 3H4DA 3TQ1A 2RDIA 3D5MA 3ITHB 4F4XA 1R0AA 4F4YA 4IRDA 4WXOA 3PR5B 3IG1A 3GYNA 1S4FA 3HVTB 1NHVA 4ED6A 3FFIB 4DL4A 3IS9B 4G1QB 1RT3B 4O3NA 1HQEB 4B3OB 2FVSA 1JLEA 3BGRB 5DGBA 4NLRA 3V6KA 4ZMMA 4O3OA 4MK8A 5KG5A 3QZ8A 3QYYA 2D41A 4H4MA 4FS1A 4QW8A 1ZTWA 1S1WB 1JIHA 4KHMA 2YKNA 4IG3B 5C24A 3KMSA 1S10A 3RBDA 4LSNA 2ZKUA 2ZE2B 2C2DA 4Y2CA 4ICLB 3GILA 1IKWA 3V6DB 3C6TA 4NCGA 4RW7A 5J2MA 2UUWA 4NLWA 1U09A 4O3SA 4KHRA 4J9QA 2AQ4A 4KV8B 3KK1B 1TQLA 2R2SA 5C42A 2B43A 4K4TA 3KLFA 4JV0A 5F8MA 3DOLA 3I5AA 1IKYB 4RW6B 3UPFA 4I2QA 3PVXA 3LALA 3DMJB 1HMVB 4R8UA 3OLAA 3OL9A 3KK1A 3KLHA 2FVPA 4TQSA 3G86A 3GV7B 3MEGB 4JV1A 3QIPA 3UDLA 4EO8A 1NNDA 2W7PA 5L1KA 3H2LA 4J9MA 5J1EB 3MEEA 5J2QB 3MR5A 1S1WA 4EYHB 2WK4A 3BQ2A 3IRXA 2C2RA 5KFMA 3DM2B 5EWGA 4ZP6A 5FDLB 2GIRA 1XR6A 1LW2A 2JEFA 1Z4UA 1N48A 5DG9A 3H98A 4ZP9A 2I5JA 1S1UA 1J5OB 4DL2A 3ISND 4WZQA 3BR9A 1RA7A 2CKWA 4XPEA 1RT3A 2AGQA 4FBTA 1DTTA 1JLAB 1MMLA 1HQUA 3I0SB 3BSNA 1QAJA 3QGGA 4ECQA 1KHWA 2V4QA 3NL0A 1QE1A 3QLHA 1TVRB 1ZTTA 4Y2AA 3DMJA 1RDRA 4QWDA 3V4IA 3CVKA 5KG6A 3MR6A 5KFJA 2JEGA 4ZHRB 3LP1B 5K14B 3PW0A 1RT6A 1TL3A 4RW4A 3KLIA 1SUQB 1N6QB 2IM1A 2XCPA 1T3NA 1FKOB 1S9GA 5KFGA 4NLGA 3MECB 3Q8SB 2E9TA 5HROA 1KHVA 4ED7A 4K4YA 4XO0A 3JYTA 1BQMB 1RTDA 1TKZB 4RW7B 5CYMB 5J2MB 4IOBA 4HKQA 4RUAA 4RU9A 1N4LA 4DL3A 5FDLA 3LP1A 2OPQB 5K14A 1R0AB 4RW4B 1EP4A 3KJVB 1N5YA 4DEZA 1HNVA 3EPIA 1RT5A 4K4XA 3I0RB 4M94A 4RZRA 3MR3A 4NRTA 4J9NA 4J9KA 3LAMA 5KFLA 2B6AA 5L1LA 4ED0A 3OSNA 2BQ3A 1RT1B 4K4UA 4URGA 2V4RA
chains in the Genus database with same CATH superfamily
2YKQA 3ENAA 3I56S 1HNXF 5KOXA 2DO0A 1AB8A 3SCIE 4HDHA 4MTPA 2NUUG 5A8RB 1N32J 3GYGA 4KHPJ 2FZKB 1YDLA 2GNKA 3R5JB 4K59A 4X66F 4P52A 2RUGA 4KFBB 3I6PA 3HM9A 1OS5A 2X7IA 4CT9A 2I8EA 3CCMS 1CPZA 1C1BB 2IAJA 1J5EJ 4L72B 3KDNA 3TUIC 1XR5A 3RBEA 3SIPB 2EBEA 1B7FA 2OMLA 4NLQA 4L3KA 3QO9B 2IIHA 2J8SA 3NCQA 4ZLLA 4JI6F 1HHTP 4QU7A 2NQPA 2BOAA 1SIZA 2HQCA 3BF4A 2V9KA 1X0PA 2R7OA 4ATNA 2N7YA 2HIQA 3Q2TC 3GMGA 1ZM9A 4KV8A 2B5JA 4ZPAA 5EWFA 1WTBA 2VHGA 2KFYA 1PCAA 4S0MA 3BS9A 1QSSA 1IR0A 4WK3A 2DY9A 4UQGA 3H59A 1HW9A 2XO7A 5IWAF 5AXNA 4DSJA 3DRSA 1SBRA 4NRUA 4RW9B 3TAMB 2HGLA 2QTWA 3QGIA 4UY85 1FD2A 1HNZF 4DL7A 2CJYB 3DCAA 1LFWA 1TUWA 2Y1IA 3NGUA 3N6NA 2XZTB 1HWJA 3CJ8A 3PG9A 3M8QB 1EETB 4O4GB 1JNZB 2MTLA 1SC6A 1LK7A 2ZZTA 3N6LA 3WQPA 4OYBA 3KHHA 3GWCA 3T9NA 2GJIA 3MR7A 4LRDA 2DR8A 2KKHA 1KD1T 2HZVA 1S6OA 2V50A 1CJKA 1LW2B 4WE1B 2IC3B 2BE9B 1PBUA 3DU5A 2YKMA 2LVWA 1OPZA 4N7TA 1TUGB 3Q86A 2C3MA 4UOFA 1KOHA 2IRXA 2ZH5A 1S1TA 5CQGA 1TL1A 3K5NA 4DR3F 1FDBA 2XMVA 3MR2A 1NM2A 3KLEB 1FXDA 2UU9F 1OSDA 4FVMA 3GCWP 3GG1A 2X1FA 1NHUA 1H98A 2ZFHA 1TKTB 2IM0A 2J0WA 3A8JA 2XMMA 3KKFA 3O2IA 3MGJA 4KY3A 4U7CA 4OMFG 4LFCJ 2QT7A 4A8OA 3R7BB 3NOGA 3UR0A 2MZ1A 2X1BA 3K5MA 5HK4A 5CCMA 2OP5A 1IKXB 1Y3KA 2EPIA 2MGZB 4QCLA 2HHTA 2AJ0A 2IJRA 2QLWA 2VASA 3KJQB 3M2UA 5BXIA 2IMOA 1WWHA 3MWBA 1CJKB 1FRIA 2YPYA 2QA1A 3CCUS 4ZPWR 4DV5J 2HLUA 1YBTA 4RKUC 2PA8D 1YVFA 5DM6Q 4LF5J 2CPZA 4U9RA 3TOQA 5HLFB 3BBFA 1DFDA 4B9SA 2DPIA 4C97A 3CCZA 3NWRA 2E5LJ 3T6JA 4LQ9A 4NX9A 3TUZC 1H7XA 1C1CA 1X7VA 2J8AA 4H4OA 4ECUA 1HNIA 3MAQA 4ELVA 3DDKA 3T1AA 1EARA 3L7UA 2XGQA 2MPUA 4JYAF 2QEXS 3TQEA 1WUUA 2IVMA 3LWLA 1F3FA 2AZ1A 2YKNB 2FPHX 2H54B 2V8DA 2YQ1A 2YTCA 3VQSA 4X62F 4HI2A 1YRXA 4PABA 4ZCIA 2UZAA 3KOAA 2P8IA 2J0XA 2JWNA 4P10A 4OZ3A 3KJVA 2O3DA 1VBKA 5C42B 3TA2A 2FLOA 1RAIB 3DN9A 5T7LA 4X4RA 4DFJA 3I5BA 1TMJA 1WF2A 2YNFB 3PX0A 3D66A 3OXGA 3IMQJ 1HQEA 4DV6F 2QC3A 2ZE2A 3PIOQ 1KC8T 2APOA 2ZUGA 1I94F 1N0VC 2BE2A 5I3PA 1HMVA 3RYLA 2A6MA 2LQ5A 1UA0A 2DEJA 3JXOA 3TEGA 3RRHA 1F1BB 1O8BA 3L95X 2VG7A 1FNMA 4F4WA 5CYJA 9ATCB 2WVDA 5K8OA 3KLFB 3Q0AA 2QFIA 4WF9Q 3GYXB 2B8QA 4LFBF 2RJZA 1HNZJ 1RHJB 4J9LA 3U7JA 4RNMA 5ETPA 2I5JB 2HWTA 5DG8A 2XLJA 3O44A 3CCLS 1YHQS 1FEEA 3AB2B 5E33A 4V19J 5CD4H 5EGYA 2KZZA 5HLFA 1W2IA 2KHCA 5KT6A 3J81U 1HWLA 1K1QA 4PQUB 4JOUA 1Q82T 3LAKA 1U0SA 4ELUA 1RAGB 4Q8EA 4C2MA 2G1HA 1D1UA 4ERDA 4L75A 2K8GA 1FEHA 1CULA 4ITSA 4CH7A 4C7QA 4F25A 3TWZA 1SVDA 5KFXA 1OQ6A 2OI2A 4N8NA 2CPXA 1L3UA 1P1LA 3FUYA 3BSCA 5DDOC 3IN5A 3QRQA 3MUTP 2CQPA 2HHHJ 3D9BA 5IXUA 2C3UA 5GAHU 3ZFVA 4ID5A 2HHQA 1N34F 3W5YA 3IO1A 2Q43A 4DZDA 5K9FA 4I56A 5KFAA 2GIQA 1RBOB 1T05B 1U0HA 5I3UB 3AJDA 3P5TL 4WYLA 2IVFB 3A13A 2A6OA 5IT9Y 1T0TV 4LVNP 2XB2D 2YNFA 2YY3A 1QUPA 3NOCA 4J9UE 2Z30B 3GE9A 1VYAA 4KR0B 4AL6A 1IBKF 1KDNA 4M5IA 1UWBB 4OYZA 1KQKA 4RW8A 4PWUA 4PQUA 3O1LA 4K5SA 2ZHOA 4WP9A 4DPXA 1OPIA 1ZA1B 2XGPA 3H40A 1FWKA 2IC3A 3TRGA 5D0GA 5HQLA 1LXJA 1P6TA 1SH2A 2D7SA 3CJ2A 1SC3B 3MM9A 2AU0A 1H38A 2E9RX 3EM1A 4YB5A 2MZJA 3UWTA 1LW0A 1T9UA 1MWZA 2GQCA 5H1SV 4J90A 2GHPA 2B4VA 1UJ6A 4Q45A 2XMAA 4DR3J 4DSLA 2ZHBA 2JEIA 2GVZA 4LSLB 1N0UA 1X4EA 4F50A 2BUNA 4DHVA 3CMAS 1HNWF 1KVJA 2WZ1A 2CQDA 4IFVB 2HAFA 3CB4A 3M2UB 5M2RA 1ZZFA 2RIJA 1WG1A 3AOBA 1EP4B 3CEDA 1TL7A 1S49A 2CQGA 3VAFA 3ILOA 2GAGC 4B02A 1NLKL 4Q2LA 2VPZB 1U47A 2DH7A 2Q79A 2PEBA 2VC0A 2HNYA 1RAJA 2YWWA 2A18A 2BANA 5MLCV 5HI7A 6AT1B 1MU2A 1M1GA 2QA2A 3HFVA 3W2VA 2IMWP 3C46A 4B9VA 2BM1A 2VBXA 3M32B 3NAHA 3RG6A 1RA6A 4NLPA 5G4DA 2NUHA 3AA8A 3DLJA 2B3TB 3NGRA 4M5DA 4BWJA 2W9BB 3F73A 4LF9F 1IN0A 1IBLJ 1IKXA 2MGZA 3HHKA 5DRKA 4MIAA 2IA0A 4EYIB 2HPUA 3ET6A 4WFBQ 3NBPA 4NI2B 4RPFA 3R8YA 4A8QA 4JI1J 3MMAB 4YDXA 2B7BB 2MHNA 2HYIB 2OSQA 4N77A 2HQIA 3GR0A 5HL7Q 1Y9OA 4KYZA 4F8RA 2ZM6F 1TFYA 5HBMB 3DDIA 1JLCB 3I9V9 1OQ3A 1LWCA 5KT3A 1U24A 3SDEA 2MLYA 2HMIA 1CSJA 3CDAA 4LIWA 3NXZA 4ANEA 1PO6A 2X3GA 2UVWA 2RVJA 4W90B 1IQTA 2BDPA 1VC0A 3QJPA 3EMTA 5A8KA 2V0NA 5B0CA 2XY7A 3MM8B 2VQEJ 3O8WA 5B0FA 2L08A 1S12A 3MPVA 1JJHA 4ED8A 4JBCA 3AQOA 1WC4A 2DGVA 7FDRA 2QRRA 4ZK7M 4GO7X 3UDCA 1KVKA 2DNGA 1YJNS 3WBZA 3H5UA 3FRYA 3K58A 3GFHA 3PKMA 1VRUA 1FFSB 3CCJS 2YWKA 3IR6B 4J37A 1K0VA 2P9EA 3DLLQ 4OV6A 4OV1A 1E6YB 1WHVA 1SKWA 2R42A 2HNYB 2DYAA 1I5OB 4G65A 2BRKA 5F8IA 4F0MA 3UD4P 5J2PB 4PPDA 3IR7B 1UPMB 1FNXH 1B0VA 1WOOA 4B3SF 2XY5A 1ZA2B 3A8EA 3GSIA 2O66A 1NMEB 2QLFB 2M4MA 1VQLS 1HWIA 2HNDA 2V68A 4GVBB 3GV5B 1F9HA 3PJWA 2Y3YA 2Y0SD 2WSCC 3PZPA 1U1RA 2JFKA 5KFCA 4NXNF 4CO0A 4W4MA 2VPXB 2WONA 9RUBA 3IS9A 3PV8A 4OZNA 3CD0A 3KXDA 3CWJA 4HDGA 2DY1A 4AE5A 3ISNC 4KKOA 2VA2A 1IKVB 1CJUB 3UD3P 1VQSA 1KTQA 2D9PA 3C66A 1HBNA 3N9UC 3KDOA 3UDEA 4ZJOA 5CAAA 2OFHX 1UEVA 3PW5A 3SQOP 4JP8A 1WHYA 3POTB 1GAOA 1EX8A 2DNNA 3J7Z5 3DLKB 4IYQA 2R8KA 4LF6J 5KT4A 3ULHA 3ELHA 1AFJA 1O51A 3JYTB 3QAUA 3H0PA 2QA4G 2QE5A 2J7UA 3M8PB 1H74A 3OR1B 1R0BG 1S1UB 4LR7A 3W66A 1U6BA 2GA7A 2NCKL 4ZHRA 2FY1A 1X9SA 4M1KA 1P9YA 4JI7F 1RXOB 3AD7C 4WKRA 2KG1A 1IBCB 3NLCA 5G0RA 3ZTOA 4WBFA 1VDHA 4FS2A 4ZLNA 1S72S 3RR7A 3IAM9 3RAQA 1YRTA 3N01A 1T05A 3P8BB 3SV3A 4ED1A 5D78A 3E01A 4USKA 3MEKA 3BN7A 1HNIB 1IM6A 4DR1F 3HT0A 5DO2A 1JXLA 2ZBRA 3IBCB 2DR5A 5FLXU 2CJ9A 1EB0A 1C0TA 4C8MA 3UQSA 2XSJA 3SFGA 4OLOA 2C2EA 4YMEA 1D8YA 2Z56B 4KBIA 2ACMA 4ZPBA 2GGPA 3OL6A 1FKPA 2E29A 4ZOSA 3IRXB 1U8SA 3H5YA 1SJ4P 3UE2A 2JLGA 1Y3JA 3DLGA 3TAMA 5K8PA 4N76A 4DX5A 3IWNC 1T03A 2WVBA 2OJ3A 2RQ4A 5GAEU 5CXTA 2BX6A 3KFWX 4DV2J 3RTVA 2B4OA 2YWEA 4KGMA 1DTQA 1RTHA 1NDCA 2KL8A 1KFSA 3TYTA 2DNPA 3EZ5A 2DT9A 2BE2B 3LW5C 1FRHA 2WTFA 1JJ2R 1XNQJ 4JI3F 1X4DA 2F9DA 1REVB 4FKYA 2V8HA 3J7AN 3RJMB 2MQ8A 2PI5A 2ZJPQ 2CAJA 4W92B 4JI8J 2VKRA 4FZVA 3G71S 2LEBA 2QO3A 4ZP7A 2BANB 1IM4A 2GCFA 3QT6A 2DGWA 2Y1LB 5DM7Q 1PBAA 1HNXJ 3HFZB 4LBPA 1TK5A 1X31C 3OXFA 2W01A 1NCLA 3SSSA 4PYDA 5DDQC 2RS2A 1KQSR 4LFCF 1B64A 5DETA 2OPSB 3BH6B 3JTPA 4OZ2A 1XMOF 3TQ1A 1Q81T 3UN2A 4IRDA 2ZH2A 3IG1A 2WBRA 3GYNA 3LWMA 3FFIB 1CJTA 1ZPVA 1RT3B 4WCEQ 4DSKA 3HHLD 5H9FJ 3R2CJ 4O3NA 2XYGB 1F5BA 3BGRB 5L9NA 5LMUJ 3KG4A 3EXCX 3KUEA 5IT4A 1S76D 3M8YA 4ZMMA 5KG5A 3SEOA 1A9NB 2BV3A 2B56A 4FS1A 3MCMA 4QW8A 1JQGA 1U2FA 2EFQA 2L9NA 1BLUA 3TZXA 3M6WA 1RISA 4LSNA 3VGTA 3Q22A 3RBDA 3W5ZA 2OGUA 3QQCD 3SBMA 3GILA 4ZVUB 2F8HA 2YVSA 5THWA 1KNZA 3V6DB 3C6TA 1U6ZA 3K59A 5J2MA 1L3TA 1EIYB 2VFTA 2G1DA 3FEXB 1U2RA 4OFZA 4J9QA 1Q8IA 3KK1B 3D1HA 3T3FA 3R97A 1NKEA 2WVCA 3FJ2A 3BV8A 4I0WA 2KT3A 1UZDA 2FHJD 3DRYA 4JV0A 4O23A 3EWGA 4DX6A 1J27A 1QD1A 2RAQA 1F0XA 2YXLA 3I5AA 3KNGA 2HBYB 4U67Q 3M8SA 1V9OA 2VC1A 2CNOB 4DR1J 3G2XA 3MMJA 2YBVA 2F1FA 3TUJC 1MWYA 4HTIA 2ROEA 1ZS6A 4R8UA 3OUYA 2K1RA 1HL6A 2OUGA 5H9EJ 5B08A 2I9SA 2MXYA 3PX4A 3G86A 1VBXA 4JV1A 4UW2A 3QIPA 4EO8A 1NNDA 1H7WA 3MR5A 1TUVA 5J2QB 3P4UB 1S1WA 4OX8A 5GADI 4DQIA 4X4TA 1VS3A 2U2FA 2C2RA 4C4WA 3RAMA 1NKCA 2B9YA 4P73A 4U95A 4EGLA 1VCTA 5FDLB 1XR6A 1LW2A 1YLXA 2RT3A 2VL1A 2KVQE 2O67A 4LRFA 4RLEA 5A0YB 4X65F 1Y00A 2JRSA 2RU3A 1WF1A 1HBMA 4F04B 2GQ2A 3W5XA 2AGQA 4FBTA 1X4GA 4DSFA 2NPIA 2VV5A 4A4JA 3I0SB 3BSNA 2YKPA 3HDSA 2V4QA 1QE1A 1ZTTA 2EK1A 2G13A 3V4IA 4HR2A 2AJ4A 3HPOA 1U1NA 4ZHRB 2IRYA 3LP1B 5K14B 1SQGA 4I69A 4QIGA 4YFUA 4LF9J 2F5GA 4UQTA 2RNEA 1I51B 1T3NA 3Q8SB 4YOEA 2BKNA 3OFHA 5HROA 3W2VB 4ED7A 1VK3A 4K4YA 3JYTA 2BOPA 1BQMB 1KP6A 2HFSA 5J2MB 5CYMB 4RU9A 2MZRA 1PJ7A 3KUHA 1KOOA 2V4JA 2DB1A 3M4XA 4ZJQA 4DL3A 4TU7A 1OSCA 2G2ZA 4K4XA 4YY3J 2OTJS 1SL0A 3PFEA 3JS9A 3MI7X 3CC7S 2NZ4A 2KI2A 2MMYA 1YRUA 3NCPA 1ZM3A 2UUCF 1RAFB 2DGUA 2GHVC 4K4UA 2F63A 2MKHA 2GVDB 2VBYA 3VHQA 2G9OA 2M7SA 4IDKA 2EVZA 2CYYA 2RH3A 1NK9A 3PJXA 2ZVIA 1WC5A 4GVBA 4NCBA 1F2GA 2MSSA 4QBUA 2R9LA 1HYSB 3MEDB 1HLWA 3GIKA 4DV4J 1JWWA 3EJMA 1DLOA 5F0UA 5EN1A 2AEJA 1F60B 3UN5A 3DKDA 1TKDA 1GH8A 3FQLA 1HFEL 4TYBA 3T41A 2R2UA 2HHPA 4IFVA 3OTOF 2FVQA 1FTCA 2BW2A 2LXFA 3MM8A 2WOMA 4LF1A 3NNCA 2BBEA 4QIFA 3OHBA 1E6YA 5JMNA 4IRKA 3L09A 4DQQA 3MEGA 1HBMB 3N28A 4KIAA 1A0OB 4B3RF 3GG0A 4ZVSB 4Q44A 3BGUA 5A76A 3H5XA 2LKZA 1X9WA 3DOKB 3KHLA 1QAYA 2E5GA 4YN3B 3SCJE 1RYSA 1SIWB 1ZM2A 1M90T 1FX4A 2NR0A 2FB0A 1Q5VA 2E5IA 1GXUA 2MKJA 3K5LA 1ZETA 2BQUA 2J6SA 1N33F 3TZYA 5IT9U 1VC5A 4CT8A 4PWDA 3W1YC 2B4PA 1T9XA 2COLA 3I96A 1X4BA 3BJYA 3D3BJ 3DI6B 2Z4PA 2CWKA 4OX6A 1S0NA 4G3IA 4RL1A 3QJLA 2IM2A 2X51A 4CTAA 4MT1A 2RQMA 2R8HA 4I2PA 2B9EA 1ZAVA 2E66A 1RCXB 2JC1A 2XZWA 1UEUA 2DPJA 3J81Y 4ED2A 4JUZA 4BCAA 3D0HE 5HBMA 1TU0B 2GC8A 3PFOA 5B0AA 5KFRA 2VB6A 3FSXA 4QPTA 4RX6A 4B3OA 1UW4A 2P5VA 3ET6B 3C6TB 4G1PA 3D6MB 3LP2B 1FFWB 2L3MA 4I7FA 4NI2A 5T14A 4X4SA 1Y5NB 2XMKA 5ETTA 3WHIA 4RBVA 1RT7A 3R27A 3TJ9A 1AW0A 4YB6A 1TV6B 3M8WA 2KVIA 2DNYA 2VPYB 3KWMA 4P2FA 4A8XA 3D6FB 3AFGA 4J9OA 4JV5F 3R9LA 2JZ5A 2J0SD 3M30B 5CH7B 3I9ZA 2CADA 3MPYA 4LF4F 1AZSA 5IS2A 2OPPA 3T5HA 4KC5A 3A8IA 2QV6A 4Y2MA 4MK9A 2HWIA 4EI2A 3A12A 3PXGa 2Z2ZA 2D3ZA 3MCSA 1RT2B 3OFGA 5EWEA 3Q8YA 2DEIA 1QVGR 2NLWA 2EG1A 4PG7A 1MG7A 4ZLJA 3EYZA 3LPYA 3OT9A 1GTHA 1GMWD 1HQ2A 3PM9A 1OYEA 4F0KA 3OVAA 3FKBA 3H25A 2IA6A 4JV2A 4IO9Q 2AIRB 1WG4A 2G0CA 1T9VA 1K1SA 3FK4A 3ZZTA 5AXMA 1FRXA 3OJSA 4ETZA 2DKOB 4B3SJ 2A10A 1LW0B 2UVVA 4UZBA 2AD9A 3VR1A 3GJSB 4NA1A 2LA6A 3I87A 4YR2A 3V6JA 3BDPA 3DLEB 2YQ0A 3IBFB 4ZP8A 1Q79A 4OHWA 4RW8B 1SKUB 3CCVS 4IUFA 3V4IB 1PG5B 2E7WA 1JK9B 2J9DE 2HVIA 4DG1A 3G4SS 4LF7J 4R25A 4AXJA 3MF5A 4DPWA 1HR0F 4RNFA 4IQXA 3UR3C 1BGXT 1RHRB 2AWZA 2V2ZA 4I1TA 4DL5A 3V81B 3MDFA 4LSNB 1R8PA 4LSZB 4DR2J 2OPSA 1Y4ZB 4L6V3 4LFBJ 1S6PA 1U26A 1YK9A 2B0GA 2OIHA 1RGVA 3RBZA 3Q8PB 3C6UA 4AUKA 2C3PA 3UCZP 4ELTA 1FRJA 3W65A 1XMQJ 2XYPB 5KT5A 2UXBJ 4Q5VA 4NL5A 3LQVA 4Y3CA 2ZKTA 2N3LA 4PXEA 4DL6A 4AXIA 2C28A 1SL1A 1Q78A 5GAGI 3K0JA 1JX4A 5F8NA 3JTNA 4DR7J 4HACB 3QJJA 2J9DA 4LFAF 3IR5B 2JNJA 2PGCA 1N8RT 1RAEB 5ETKA 3IXQA 1U25A 2E7XA 2VBWA 3DRRB 1W26A 3BGFA 3R5AA 1V3SA 1LWFB 4NZ6A 4AT1B 5KFNA 4GRSA 4UOCA 1JKHA 1Q8BA 2MQMA 1O0PA 2JVOA 2GMHA 1SH0A 5C25A 1DBDA 1XEZA 5ETSA 4C8NA 3L9ZA 4BS2A 3VGVA 5LSRA 3DXBA 3D0IE 4USJC 2EBGA 2GFFA 3OUYB 1FJGF 1UVLA 2HFUA 4OZ0A 2R2TA 1HARA 1JXEA 4WP3A 5A0YA 4FYDA 2DCLA 1RAAB 4K4SA 4KRWA 1UFWA 2DGQA 1Q8KA 1C0TB 1BUXA 4H4MB 4YDDB 5B7WA 4HYKA 2OHDA 1RWUA 2DIUA 1UFLA 5JVHQ 5BYSA 2XS5A 3CDBA 3AH6A 2WOMB 3G82A 4HACA 4HEA9 2XYHB 4OHVA 1KRPA 1YBUA 3CW2C 2OH2A 4X84A 1HNWJ 1RADB 1RP5A 1UVKA 2KU7A 1S9GB 3LTOA 2G2OA 1DZ5A 1R7IA 1W2BR 2VODA 2HNZA 4DR6F 1VJWA 5RUBA 2DR7A 2K7KA 3DM2A 1UWBA 1XJWB 1XMBA 4PUOB 5DQIA 3FBCA 4AD6A 2H51B 1U49A 2PMHA 1F9EB 1V3ZA 2DNRA 2P2CB 5C7PA 1S6QA 4PG8A 5L1JA 3IGVA 2HQGA 2ZNYA 4M63A 4OYMA 2V2QA 4H4OB 5DZ7A 3W61A 1UVIA 1YJRA 2VU5A 4C0HA 3AXMA 4KFBA 2YKAA 2WCXA 5I4MA 5SZTA 4TNOA 4HTJA 4DLGA 1NAQA 1Y10A 1NH7A 2DD8S 2WB4A 2CJXB 5CHCB 4A8WA 1REGX 1REVA 2RRBA 4L74A 5KFKA 3AB4B 5B0GA 1RKJA 3I4HX 2OPPB 2BXJA 3DGVA 4NEYA 2UU9J 3G9CA 1R3NA 1SH3A 4OZLA 4J9RA 4Y2KA 2DISA 3EGWB 2L9DA 4Y00A 4D3HA 5KG2A 1WSRA 4U8YA 2ZM6J 4QQBA 1NK7A 3KNAA 1FO1A 2FQQB 1UJ5A 3P5BP 1X5SA 4QPXA 1MN9A 2ILYA 2ZJQQ 2QL5B 3PRDA 4ZVQB 1RT7B 1KFDA 3GFZA 3QMQA 4DCOB 4O3RA 4X4UA 2RDJA 3CUNA 2LXUA 3EZUA 1CJUA 3UNYA 3CIZA 3HP6A 1IBMJ 2QYCA 3GU0A 3AHPA 1OY9A 2ASJA 4K4WA 2GV1A 1H2UX 1BQMA 1SC1B 5K5MA 4IR1A 1UVJA 3S7RA 5E7OB 5CYQB 1IKWB 3OFEA 1WNEA 4LF4J 5HP1A 3W9JA 1R6VA 4Y2IA 4BWMA 2FLNA 2RDDA 3OTEA 3I0RA 5HN0A 3CCSS 1I6JA 2V2VA 2RD5C 1YWXA 5ETQA 4RNOA 4ZPDA 2JH3A 4C3MA 3M32A 1SV5A 1KN6A 3M8PA 3OR1A 1VLOA 3FSYA 1NPRA 2FC9A 4R8UB 3DLGB 1EETA 4O4GA 4TU9A 3HZEA 5MAOA 4DV6J 1YQHA 5ITHA 2J76E 4M5MA 5DG7A 1SKSA 3DOKA 4NCAA 3ADAC 3MMCA 2RF2B 3U27A 5HQMA 3M2VB 1L3VA 4DCPB 1RBAA 2WAQD 3MM5A 4N41A 1TVRA 1RWWB 1EHWA 5IM0A 2W8LA 3O3LA 1VQPS 1XNRJ 4URSA 2FJWA 3JQKA 4DOZA 2NS1B 2CXEA 2IDEA 2QX0A 2ZOGA 3ILIA 4H4KC 2QA4S 5A2QU 3SXLA 2Z8QA 2XEXA 3NWGA 3VQTA 3QRPA 1S1TB 2AEFA 2C3OA 5KFVA 2H5JB 4N47A 3KHGA 4KHPF 1S0OA 2FHKA 2AHOB 3B78A 4YHHJ 2BMBA 4QWCA 5F9NA 2DHXA 3G6XA 4CP5A 1PJ6A 1OWXA 3DXSX 2QIFA 2F8MA 3H4BA 3C8YA 3KMQA 4MFBB 2GO9A 2HVDA 4Z7YA 3R7NB 4KPYA 3B4DA 2MKSA 5A8WA 5H9FK 5ETLA 3US5A 3MM7A 4QZVB 4KT0C 4UTGA 4CO5A 2YH1A 3TANA 2VOPA 2BZ2A 2UXDJ 2DGOA 5BR8J 2IJFA 3MM5B 1VRUB 4FYXB 5HVGA 4RW9A 2GAHC 4P71A 1U1LA 2R8JA 4P6QA 4I6AA 1RCOB 1MW7A 1W25A 1B4SA 2CRLA 4KKOB 1JLFA 2IHR1 2YWFA 3D28A 3DC2A 5A8RA 4ANCA 3GIMA 3PY8A 3VF0B 4LRAA 3GIRA 1S59A 1NB2A 2L48A 2OFGX 1B70B 3IBWA 2ZC4A 3CF5Q 3UDVA 4FXWA 5CD4A 2AJ2A 3KJNB 2V67A 1LNQA 2XMWA 2XI2A 3MM9B 4ICLA 4IG0A 1S48A 1WI8A 4HHJA 1TV6A 3MXHP 4K4ZA 1RT5B 1HW8A 3MPWA 1S1VB 3WIUA 4C3KA 2W9BA 2CQCA 1U45A 1R8CA 1TELA 2VDHA 2XG8A 2UUAJ 1XIQA 4ES3A 1MU2B 2D69A 2YNGB 4P7VA 1TKXB 1P9QC 1JLAA 2BACA 2FY8A 4ZVTB 3BQ0A 4C9DA 2BRLA 2CJKA 1VLYA 1BC6A 3AODA 4Q43A 5IZHA 3R6LB 4X4VA 4ZPCA 5L46A 4MIBA 3IGNA 1FVQA 1NK5A 2ROPA 4DQSA 5D4PA 3RB0A 4BHQA 2R2RA 3ENQA 1JLCA 1C2PA 4U8VA 3G8QA 1TK8A 2XSJB 1UKUA 2LEPA 1VQ4S 3RW6A 1N5QA 2XMUA 3QLHB 1XERA 2EFGA 4K4TA 4WE1A 2KJVA 2DHHA 1FDDA 1SJ3P 2ZWOA 1M5HA 2AYEA 2C2NA 4EBEA 4K50A 4DG1B 3SQGA 5A8KB 4J9SA 2W4DA 1WI6A 2HK2A 1UA1A 4OYXA 3VGUA 1S9FA 2N3OA 3NNAA 2DR9A 1M5KC 3FNNA 3PCOB 1BE4A 3D6HB 1EKRA 5IC4B 3W7BA 3S8SA 2XLKA 4EEYA 4LF7F 4C0BA 1UFKA 4DR4J 2B9XA 1KLMB 3VAHA 3KK2A 3DHWC 2XWYA 2P9CA 4ED3A 2W2PP 3PO4A 3KUGA 1S0MA 1RWOB 2A2CA 1DQ9A 2G0JA 4N8OA 2E5LF 4IFYB 3ICLA 4LRCA 1KKHA 5LJ3Y 2X1GA 5D3GA 4Q0BA 1SI9A 1Z1ZA 3HKWA 3D0GE 2NREA 5AXKA 1C1BA 4LVOP 2ATLA 1U0HB 4DS5A 4JI6J 2I2YA 1U48A 5DQGA 3P3DA 1WKKA 3KLGA 3Q8UA 1UW9A 3MFHA 1FCAA 5HQ8A 4NLTA 2E5HA 5IQ6A 2B8PA 3JQJA 4PPZA 3CD7A 4ES2A 2CPHA 2ZH7A 5E3PA 5DQHA 3BKFA 3KLVA 1KBRA 3BREA 3M6UA 3DLHA 3C14A 1F5CA 1RQ0A 3TA1A 2I0XA 2JLFA 4LF6F 2UUTA 4ZCKA 4ECXA 1WC1A 3QWUA 4FF3A 3MM6A 5J1NA 5KG1A 2F7VA 3RB4A 1KS2A 3OXLA 4NLSA 3MECA 2CPIA 4PEOA 4O3QA 1EKSA 3CJRA 2BW7A 4MK7A 3D1OA 1PJ5A 4QW9A 2D1CA 2QJ3A 3L7PA 5LSLA 3OTDA 3D5MA 4CLYA 3D67A 3FC9A 1UZHA 2EI5A 3NCRA 4WXOA 2ZH6A 3UCUP 4NE9C 3BDEA 1YTYA 2PMWA 2W1BA 2KFNA 3PNIA 4OLPA 4L76A 4G1QB 3NGSA 3D3CJ 2FZCB 4EWTA 1TK0A 2CDRB 4OX9J 1HQEB 4DR5F 3P49B 4JI3J 1JLEA 1WELA 4DFMA 1T8EA 1KWMA 3V6KA 3TUPA 2BABA 4RU2A 2RS8A 4O3OA 4DL0C 2LA4A 2E44A 3QYYA 2D41A 2NSCA 2E1MC 4H4MA 3GFXA 4ZCLA 4DV2F 1JIHA 3ZZYA 2HKEA 2HRTA 1UCNA 2ZKUA 2ZE2B 4U7UK 3NEKA 1FXRA 1WC6A 3MD1A 1VBZA 2AYBA 3DOMB 4NCGA 1U09A 3JSBA 2CIMA 5DDRC 1FWLA 1D8ZA 3TAPA 2B43A 4DX8H 3KLFA 4DMZA 4DLEA 3W3SA 3HVRA 1XC9A 4CLTA 1P8GA 4RBUA 1QY7A 3W9HA 4ILLA 2HW3A 2GGPB 3PVXA 4FPRA 2X3DA 2DRAA 4EFAC 5DDPC 1HMVB 2Z2MA 1Q8LA 3KG0A 1V6HA 4LUBA 5IT0A 1RBLA 3AAWB 4DV3F 1F6TA 4TQSA 1QVFR 2BJ9A 3K17A 4FP9A 2M5YA 2F9JA 2ZZNA 3BN4A 1N52B 5LL6d 2ZZMA 2W7PA 1NPKA 3BKTA 3LGNA 4FPIA 4FYVB 3BPSP 3HHDA 2DHAA 3R3TA 1RHKB 2PA3A 4YS2A 1UEKA 1TFWA 2JEFA 4GKJF 1MMNA 1RHUB 3ENVA 5DG9A 2KRBA 4ZP9A 4BC9A 3SZ2A 4V1Ak 3IM9A 1P27B 1WORA 2HQDA 1RA7A 5E2QA 2FYXA 4WP8A 1WEXA 4DBQA 4B9UA 1DTTA 1JLAB 1H2TZ 2CA9A 2OMOA 4UOHA 1HQUA 2JVRA 3PYEA 4B9NA 1KHWA 3M1VA 3MTJA 3DU6A 1SJQA 4CLPA 4Y2AA 3QAEA 4QWDA 4YB1P 3D54A 3UFCX 1HHQA 2JEGA 4WWSA 3G8TA 2V4JB 5ADZA 3IRWP 3SSQA 3BO2A 3PW0A 2VICA 4RW4A 2O1PA 4QU6A 3WDOA 2NZCA 3FMBA 1FKAF 1V3RA 1S9GA 4YY3F 1FRMA 1BD6A 2KJWA 2C2KB 1KHVA 1RTDA 1S7IA 2BKOA 1F5AA 1FFGB 2P6SA 2YX4A 5HJXA 3R7SB 2ACYA 4F4AA 4IOBA 2DO4A 4RUAA 1VQ8S 4Z7CA 1EZZB 1OY6A 3LP1A 2OPQB 5K14A 2G2YA 5FD1A 2F4VJ 4WFAQ 2VFRA 4DR5J 3KJVB 2ABYA 3DRXA 4AQYJ 4IR9A 2BJ3A 3H90A 3RBXA 4RZRA 1AUDA 2HVHA 2J7WA 2QSFA 2Z2LA 4J9KA 1S5ZA 1RKIA 5A2QY 3BH7B 4P7TA 2MKIA 3S01A 1VHFA 4DF4A 2HHXA 3R1LA 1HD1A 2OSRA 3AD9C 3T1HF 2ERRA 1LOUA 2VFUA 4IKAA 5BJRA 1RACB 1CC7A 4DV1J 4GC6A 1GFWB 2R7VA 2XNQA 3W8GA 5D15A 2I1RA 2XHCA 2LU2A 1U1MA 4EZ6A 2OKQA 5HATA 2V2KA 3F44A 3M7VA 2R8IA 5KFOA 4MH8A 3V81A 4WU3A 1VRTA 3D4JA 2GZOA 4TY8A 4PCQA 5KFHA 5J2NB 1N5TA 2N82B 4MYTA 7FD1A 3WC0A 1RWPB 2BM0A 1CULB 3K8VA 1NDPA 2HFNA 3UVJA 4ALZA 2KT2A 4GO5X 3T19A 1N34J 1FESA 5GMDA 3CO0P 4D3GA 2ZH4A 3BQ1A 2V8VA 2A3JA 4K7QA 5G0RB 1F9FA 4X4PA 3LP0B 2HAIA 3LA0A 2RRNA 2NYIA 2C1EB 3CD5A 4KSEB 3C3LA 5KFUA 4ETXA 2RE1A 2FLPA 1RTZA 2K06A 2KXHA 3Q2SC 1NEEA 4NEZA 4QR2A 3SI8A 4I4BA 2XLIA 4IH7A 2H9ZA 3LUYA 1UETA 2CNNB 1R43A 2HEKA 4MMOA 5SUHA 3MHYA 4DPYA 3EICA 4DR4F 1B0PA 4YEAA 4HT5A 2WRMA 1Q7LB 3KLEA 4OL8A 1XR7A 1SL2A 1LWFA 1NSPA 4ZVGA 1AYEA 4I6YA 1TL5A 1LQ9A 1LWEB 4EBCA 3D68A 2MKCA 2V8PA 5E0OA 4OIXA 4ZLPA 2D74B 2F65A 3GONA 3N5BA 1T9TA 2UUCJ 1S1VA 2W9CB 1HNVB 1T7PA 2R7TA 4KGVB 1LWCB 2C2DA 5CA5A 4YR3A 1XBWA 2VG5B 2WW8A 3D2WA 1G2EA 1VQ5S 1RWMB 1XQIA 4C8ZA 4M95A 3CDUA 2D9OA 3W9IA 4FXDA 2KYZA 1RT1A 3OBIA 5L1IA 5EX0A 1S6UA 1ULRA 3V5RA 1NKBA 3PJ9A 4A8KA 2ZD1A 2D3OR 4USVA 4OI4A 4KPCA 3DRPB 2RKIB 2N7CA 3KTQA 2EXUA 1IKVA 4P9SA 1APSA 1RSCA 3EGVA 3PRBA 1S79A 3BGLA 4M5LA 3W60A 2HRUA 4OI6A 3T5LA 1T9WA 1HBUB 4NYPA 2B4UA 2PIIA 1QAXA 1RZMA 2K3IA 4UUXA 2QMWA 4JI5F 2KFZA 2AGOA 4EO6A 3BO3A 1WC0A 3R5BA 4K2XA 4ER8A 4MFBA 2W9CA 1CQMA 3C14B 3HSZA 3G6VA 3FMWA 3RGIA 3GJRB 5CZXA 2CPYA 4JI8F 1KONA 2R7QA 1HR0J 1D3WA 2IM3A 5KFZA 4JI0J 2FDNA 3I32A 2LLZA 3MMBB 4QR0A 4CNZA 1RTIA 4C6AA 3VAMA 2XY6A 3PW2A 1SJRA 4PR6A 4KB7A 3WZ0A 1VISA 1PYOB 3MPDA 5LMNJ 3H2VE 4DUZJ 3CJQA 1PYSB 1PC4A 2WSFC 7AT1B 3U1LA 2LDIA 1UAWA 2DGTA 4GVLA 2FZGB 3KJFB 4DF8A 4LF5F 1KLMA 1XWLA 1U7LA 1CG2A 1N36J 3RB6A 2ATCB 1FI4A 2BJ8A 3NRBA 3SFUA 4B3TJ 2YNHA 3DYAB 2JHEA 3G6YA 4RUBA 3HO1A 1D0EA 2JOQA 1HIYA 2YWGA 4OZ1A 4JI0F 5KFFA 4ENOA 3J81j 2J6TA 4CO1A 2MQLA 3PDNA 5JVGQ 2CG8A 1VHIA 1X4FA 1YG0A 3QIDA 3PYFA 4KH1B 4M5NA 5GVQA 4URQU 4DUYJ 2ASYA 3T5KA 1Y5IB 2JFDA 3EVMA 4YUDA 4BC7A 5GMKa 1N88A 2XC9A 3SYZA 2XZDB 1FJEB 2XSFA 1RTJB 1AA1B 4R5PA 3IM8A 3M05A 3U02A 3CXCR 1FHTA 1N5YB 5CYQA 4FXVA 4NLDA 1C4AA 4X64J 4OYIA 1R8BA 3RR8A 3NP5A 2LCWA 5KFEA 1JMTA 3Q8VA 3CJ0A 3A3PB 4F0HA 1DRZA 4JV5J 4C0OC 1YITS 1ZH5A 4OHZA 3X3UA 5HMYA 1WEYA 2HQFA 1EAYC 5CCLA 2XCAA 1SQFA 1WTFA 2RU9A 2XBPA 4LJMA 4NYZA 3NAIA 2Y1RI 2KDOA 1S7HA 1YKWA 2Q66A 4DPTA 5C5JA 1T94A 5ETOA 2ZWPA 2IBOA 1JLGA 3MAAB 4IOCQ 1VQYA 2DXEA 4CIOA 1CJVA 4CQ1A 2LEAA 4RWXA 1V5VA 1TR0A 1TAQA 4GC7A 3HHLA 3B4MA 1HBOA 2VDIA 4F4ZA 1RLDA 3G82B 1MNEA 3HCXA 3S1TA 4DU7A 4ZIWA 1NZ8A 2HNDB 3JB9k 1SUQA 1N6QA 1TL7B 3HULA 4DSEA 3J7A1 3THVA 3VALA 2I6WA 2VH7A 1VIOA 3M9MB 1PIEA 1M0SA 2Z0GA 3AA9A 2MDAA 3TX8A 2LFVA 1DTTB 3HVAA 4NLXA 3CDEA 1HQUB 3UNGC 2OEMA 3DNCA 1OY8A 5BR8F 4QIEA 4FKXA 4EBDA 2VKZG 1YBAA 1RUSA 4QWBA 3F56A 1UL3A 4IRCA 3THTA 4UT4A 3GIIA 3FFIA 2XULA 3MMCB 1M1KT 3DOLB 4DQRA 4Y28C 3MEDA 3UO0A 2HVZA 1X4CA 4UF4A 3OLBA 3BBBA 1Q95G 5FIIA 3BSOA 2FGOA 4ILRA 3MURP 4CH1A 1FRLA 1QUVA 2Q6BA 5KAKA 2GJ2A 2QLXA 4LQ3A 4DR2F 3JSMB 4K4VA 4RR5A 4PXCA 1QAIA 4F2RA 3GSDA 3M6XA 4P72A 2FJAB 1JJ4A 2UXCJ 4LF8F 1IBKJ 4DV4F 1S9EA 2YH0A 2F40A 1YJ9S 2M9KA 3L7OA 4V19X 3NGTA 4OHXA 3LANA 5GAEI 1JLQA 3KK3A 2CQBA 1GTEA 5AE1A 3NY0A 2CG4A 1M1HA 4CLLA 4ECWA 4HHHA 1PYTA 3CD6S 2X1AA 5F8GA 3NGDA 2HURA 3CCQS 4DR6J 2HBRB 1PILA 1YGYA 5KFDA 5B09A 3HVTA 3FEZA 1OO0B 1M5PC 4MKVA 4WPAA 2CVIA 1WHXA 3K2YA 3L4BC 4C3LA 2M8HA 2K1RB 2QFJA 1ITPA 5JJBA 3ZNUA 2FVRA 4X4OA 4DSIA 2YKMB 2H5EA 5F9LA 3NMRA 3MUMP 1WACA 1R0CB 2V6AA 8AT1B 3EDQB 3OL8A 5HP1B 3SDEB 5BYQA 4PWDB 3TA0A 2KM8B 1MLAA 5F3TA 2VG6B 4XDCA 2KZMA 3PKYA 3FDSA 2DRDA 3FQKA 3RW7A 4M5GA 1Q53A 1JLEB 2U1AA 5KFWA 1TKTA 5C25B 1HWUA 1S6PB 2ILZA 2VF3A 2UVRA 5M2PA 3G6ES 4J7CA 4OI0A 3M2RA 1BWVA 3DRRA 3ZC4A 4CYUB 4RWWA 3RZAA 2VQFJ 2B51A 2DNQA 1ELOA 1B3TA 1IBMF 4PXDA 2WHOA 4Q2MA 3DI6A 3W8PA 3PEHA 2WONB 2VFSA 3GP9A 2KT5A 3T1YJ 4GKKJ 3N6MA 1W7WA 2GX8A 2Q3PA 3QT5A 3TO8A 5BYRA 2L41A 4B9MA 2HFVA 3FZBA 3GJQB 5KFTA 2R8GA 3TNVA 2B5JB 2E1PA 2V94A 4CLFA 3AY0A 4K2JA 5F41A 3M8QA 1RU1A 2W4CA 1NK0A 4QYZJ 3IG1B 4NLVA 4AL5A 1OJ4A 3A3OB 3CE8A 5IOLA 1J5EF 2CQ0A 3CJ5A 1LWEA 1FVSA 2WBMA 2CJAA 3PR4A 5EX3A 5KT7A 4F4KA 3M1VB 2GMJA 2QMUB 3AD8C 2E1AA 2IFXA 2ZD1B 3V6DA 5KOWA 5AJ3F 1NK4A 4FF4A 4IOAQ 1HI8A 1NPPA 5D3GB 4Q0BB 1S6QB 2DNZA 2MLZA 4Q7AA 3QFHA 3S6EA 3HSGA 2KXNB 2KG0A 4A48A 4DUYF 2ASDA 2MY7A 4C8KA 3M2VA 2VG5A 1WHWA 2GHWA 4J91A 2NSBA 3KK2B 3FBFA 4NLOA 3CC2S 4PUOA 5H9EK 2AGPA 1PGZA 1DLOB 1JLBA 3B6BA 4R5PB 2DH8A 2DR6A 1BQNB 1I3OB 3HHLB 3LO3A 5LOQA 2HGNA 4JI4J 1FJCA 3P96A 3E01B 1N36F 3B82A 2FJEB 4NZ0A 2K3KA 3KLGB 2VG6A 4PG5A 4LMZA 3BM7A 3LGMA 2PDAA 3HSDA 4OI1A 3DLKA 4ZDNA 2A1BA 3OVBA 3PTWA 1RT4B 5AE2A 2E9ZA 3MZIA 2PFFB 1K8AT 2B6AB 5D77A 2YKOA 2LMIA 3QZ7A 1HHSA 2PSZA 4CO3A 3TVYA 3QATA 2V8GA 1YZ7A 4TQRA 2FHJA 1C0UB 4O44B 5KFYA 2BR0A 2W4PA 1VIXA 2DK2A 1YJ7A 5D4LA 3DGPA 2KRRA 2MKKA 4O4RA 1NH8A 2DHGA 2HIYA 4G1QA 2NXUA 3O6QA 2KN4A 5F3ZA 3MMAA 3VWSA 1A6LA 2HS3A 3HJVA 1TKXA 6FDRA 1XMOJ 4ZPTR 4HLBA 2Z2YB 3MMBA 4JI5J 2JSXA 3PYGA 4PYAA 1ZAWA 2YNIB 4ECTA 2W2NP 3K5OA 1M5OC 4TVAB 5D0HA 4X2BA 3CJTA 3GPAA 4USTA 4IH6A 5HO4A 2MKYA 1Q16B 3N5FA 4DCJB 3JTOA 2HRYA 1G6BA 3RAXA 2VOOA 4B9LA 3BEGB 4A8SA 4EK2A 4X65J 5J2PA 1EQ0A 3DDNA 3R2DJ 1FXLA 4DDFA 4GKJJ 2AQ4A 4R0EA 4WFZA 4TY8B 2Y0BB 4NMXA 4LFAJ 2AX1A 4TXSA 3O5TB 3TX0A 3W64A 4QWEA 2ADBA 1VBYA 4DR7F 1IWGA 2C2OB 2Q6CA 3TJAA 3N0VA 4ZN1A 4N5SA 1B7YB 4O44A 5KFIA 4DPOA 1RT6B 1TL3B 2A0FB 2LDYA 3Q8QB 3PW4A 5HJYA 3OJUA 1X9MA 3GR1A 6FD1A 1VQKS 1JLQB 3KK3B 2J5AA 2PI4A 3F0NA 3LP0A 1WOPA 5L38A 1WDTA 2BJ7A 4ZVFA 1NSKL 3WIVA 1LFPA 3C15A 5U47A 4A47A 3HHLC 1QSYA 3CSKA 2F8EX 4H4KA 4ECRA 4CCHA 3WX8A 4MYUA 1YJTA 2EFNA 4X62J 2M8DB 3X1LB 2VJUA 3CT9A 5IWAJ 1HPZA 3VAIA 4QWAA 1J5OA 2W2QP 1NJYA 2LQJA 2MJUA 4UZCA 5T7LB 4RW6A 1EJ7L 1FT8A 4WIIA 1Q1KA 2AMCB 2FD2A 3HI9A 2HNZB 4FN5A 3OL9A 2FIUA 2XM3A 3FSIA 1LXNA 3DLEA 2IDLA 3FBEA 3RUBL 3TP2A 2J6UA 2ZBQA 4B3TF 4CNYA 3RRGA 2NXJA 4EZ9A 1RWNB 3NS5A 4LBIA 1EQMA 2PFDA 1FA0A 4W98A 2WSEC 3AJ1A 3JAMY 2K7JA 3M9NB 2IRUA 3V6HA 1U1OA 1BY9A 2HQ3A 3TZWA 3JAMU 4J5OA 3QSIA 1C4CA 2CQ3A 2GVZB 3C19A 3MM7B 4X4QA 2V5HG 3HD1A 3M8ZA 4JB8B 1QLNA 1KQGB 3GV8B 2ALYB 3A3NB 1XTZA 4OZJA 4Z37A 2XNRA 1ZM4A 2G4BA 4USWA 1IUJA 4OX9F 3LH2S 4K0KF 2OPQA 1DQAA 4ECVA 1RYRA 1R8HA 4USIA 2B9WA 2ZNZA 4USHA 5DGAA 1HPZB 2CWXA 2XI3A 1U1PA 2ZBPA 1CJVB 1N32F 3NBPB 1RLCL 4KAIA 2B7CB 2HZCA 3CCTA 5B0BA 5JUMA 2NXNA 5JXSA 3TZZA 3K57A 2Y1JA 2Z57B 3W2WB 3T1HJ 4WIQA 2CZ4A 3NNHA 3H4DA 2AP6A 4IO1A 4DU8A 5IV3A 2RDIA 3PYDA 3ITHB 2QZ8A 1R0AA 1DHMA 1CQNA 2HK3A 1WF0A 3J80Y 1S4FA 1VK8A 1NHVA 5L39A 4ED6A 2KM8C 1SC4B 2N4DA 1A7GE 3ZZPA 1YJUA 4B3OB 4NA2A 3R1HA 2RQKA 4OZ5A 1SPBP 5DGBA 2QN6B 3CIMA 1YZ6A 3DOMA 4NLRA 4HH1A 3SCKE 3U1MA 1KEKA 1SCJB 4NWBA 3E3XA 1NSAA 1X8DA 4MK8A 4NMLA 3UD5A 2OAUA 2NXCA 3QZ8A 1Q7YT 2ZITA 2MB0B 2XS2A 4XAKA 3KMSA 1S1WB 1HA1A 4WK1A 2BJEA 4IG3B 5C24A 5KTQA 2LECA 3BR8A 4I67A 2JDJA 3KYLA 2UV8A 3T6BA 4PWWA 4A8YA 4ICLB 4HI1A 1UP1A 1IKWA 2XHWA 4RW7A 1WSVA 2VFVA 4O3SA 3EE3A 5E5NA 4NYOA 4KV8B 1TQLA 2CFXA 4HH0A 5HMXA 5C42A 3HF5A 3VV2B 1H0HB 1BMQB 2CQ1A 4TLQA 2OO4A 5F8MA 3H42A 4LR8A 4A8FA 4M8LA 1IKYB 2E5JA 4G1IA 4I2QA 4ZN3A 1VJQA 4P2XA 1NK6A 2MSTA 3DMJB 1R31A 2CQ2A 3OLAA 1L5UA 2BA9A 2HG4A 2FVPA 3KLHA 3UCGA 1CS4A 3GV7B 4E98A 3GFYA 4NXMJ 2MHEA 3UDLA 2ZH3A 1VRQC 4UUWA 5LM7E 3OTCA 2Y8WA 1HBNB 4AL7A 5HAOA 1S0VA 4EYHB 2EK6A 2WK4A 3BQ2A 2BE7D 3IA0A 4DN9A 1WOSA 2F3JA 3DM2B 1NDLA 3OTOJ 4ZP6A 1D9AA 5HVFA 5HVHA 2POKA 1UTAA 2HHUA 2QSWA 1Z4UA 1YJWS 1HBOB 1WKLA 3H98A 2I5JA 1T02A 2OD4A 1S1UA 3OPKA 4N56A 3ISND 4DL2A 3BR9A 2CKWA 1DQ8A 3E8OA 4XPEA 2HS0A 1RT3A 1RWXB 2QLJB 3ISZA 4DV1F 1U4BA 2VQFF 3QT7A 4XDDA 1MMLA 3F41A 2EFOA 4CZCA 2ZH8A 2DVIA 1HBUA 5IM0B 2KH9A 1WD6A 3PACA 3DMJA 3CNQP 3CVKA 2HBZB 1FE4A 5A6WA 5KG6A 2DH9A 5GAGU 5KFJA 3D6TB 3PIPQ 3MR6A 2CPEA 3VGSA 3BPDA 1RT6A 1TL3A 1KR4A 3KLIA 2C2MB 1SUQB 1N6QB 2JX2A 2XTJP 4OYWA 3SMZA 4DJBA 2I38A 1FKOB 2ZHAA 4DFPA 4F02A 1U2CA 3MECB 4WTOB 1RWKB 2E9TA 4BDPA 4XO0A 1RABB 1TKZB 1IJFB 4RW7B 1JB0C 4G6VB 5CABA 5LMUF 4HKQA 2DHSA 2W2MP 1N4LA 4PG4A 5FDLA 1ZZNA 4BLGA 2UXDF 3BB5A 2PO4A 1VOMA 1QTNB 1OYDA 4RW4B 3HD2A 1H2VZ 1NHKL 3IP0A 1RT5A 3M6VA 5D4OA 4O0NA 1AXQA 3EPIA 2YPZA 1F2HA 4NRTA 2EKYA 3MOZA 4WU2A 2NYHA 1MROB 2EG2A 3FCWA 5KFLA 1M5VC 4C8YA 2H4YB 2BQ3A 3OSNA 2R3VA 3OV7A 5DLGA 3MPUB 2DNOA 5ETRA 1HI0P 4KJIA 5J2NA 4KH0B 4F36A 2PEHA 3THPA 3C6UB 3ZTPA 1U1QA 4CM2A 3EZOA 2LYVA 5LMNF 3G87A 2HMIB 3C2PA 3KLIB 3IC1A 5EDWA 2UXCF 2NPFA 1R6YA 4OJ3A 1YI2S 3BYPA 1PKUA 2QGFB 2VQEF 4CLKA 5KFQA 1RT4A 5DS7A 2H5IB 4DV0J 2HZAA 1SQEA 3GIJA 3M9OB 3G96A 2FJBB 3R6GB 2HWHA 2H4WB 3W2WA 5M2UA 3Q23A 3EGZA 1P1TA 4OI3A 3WX4A 1VC6A 3OSPA 3SQGB 1C1CB 5IC6B 1D09B 4PQAA 2Y9HA 1WC3A 1G3OA 2Z58B 3ETMA 4ZVEA 2RILA 3BBCA 4M5HA 1JLBB 1U8WA 2JEJA 4DV3J 1RI7A 4CDIA 3CCES 1NO8A 2JL9A 2CJQA 2DGXA 5K8MA 3AQPA 3BGRA 2MZSA 4XPCA 3OTBA 4DV0F 3CJ3A 4IDKB 1GX6A 3HSJA 4CO2A 4TKTA 8ATCB 3VVTA 4HVZA 1CJTB 1IBLF 1TMMA 2H65B 2L9WA 3ZTQA 3PO5A 3GQCA 5KG0A 4IH5A 4LREA 5I42B 2AJ1A 4GMKA 3EX7B 4P75A 1G7CB 2D3UA 3BO4A 4RJVA 2F4FA 3NG8A 2KYXA 3W63A 3QGPA 4L3NA 3TR5A 3UN3A 4B17A 1ZPWX 5K20B 3NS7B 5T41A 2WB1D 3ZTRA 1L3KA 2CQHA 2FC8A 5EHHA 1H3DA 2WVFA 5LSOA 2OPRB 1GT8A 2CPJA 1UVNA 4MAKA 1RWVB 3GTYX 5DJBA 4JI7J 2M0GB 2G0IA 4Y6IA 1MN7A 1K9MT 3SSRA 3FBBA 4ECZA 2HFZA 2GVDA 4OYPA 3CDWA 3MTKA 3C15B 3BGOP 5IV4A 1XK8A 1RHQB 1XN9A 4IQMA 4OYOA 1GXLA 4CYUA 1B99A 1R27B 3H7HB 4EUVA 3VCDA 5HMZA 1FWPA 2OD6A 3HK2A 4J9VA 4O0IA 2N4CA 5HANA 3K8WA 3OFFA 3KG1A 3PHEA 5F0WA 2AZ3A 2EFPA 3ZTSA 1QM9A 3HXMA 2FVCA 2QMXA 2OELA 3AT1B 4H54A 3CTRA 2EEYA 2H1YA 4WTYA 4U96A 4B3MJ 3T9ZA 4B08A 3N4WA 1T9YA 1MSWD 3W62A 1K47A 2AX0A 4OJHA 1Y5LB 1TL1B 4ECSA 3TI0A 1IJEB 4NXNJ 4JYAJ 1WJ9A 2ZBCA 3CJ4A 1RB0A 2DNMA 2E1CA 2QL9B 1S9EB 1DURA 4M5KA 1KQFB 4A8MP 3PX6A 4PZVA 1F3VA 3CULA 3GLJA 2ROGA 4IG0B 1IR1A 5L9XA 3LP2A 3ZZRA 2CJBA 5F8LA 3K5PA 3ZZZA 3J7YU 3QSYB 3ZO7A 3T5JA 1SXLA 3HX9A 3AXKA 3TJ8A 4TLRA 4KQZA 5IQQA 4C8OA 2MYFA 4WFXA 1FKPB 2AT1B 3Q89A 2CVEA 1X4AA 1VFJA 1T3OA 1S57A 3FVYA 2RF2A 5E3CA 3NKYA 3BZQA 3DFEA 4U6PA 4JI4F 1CEZA 2VA3A 1TKZA 1NZAA 2FJVA 1QJHA 3EUNA 4JI2J 1URRA 5HSPA 2AJQA 3C16B 1CBKA 4YHHF 4DZ6A 3QGHA 2P9GA 3HLUA 4ZCMA 1NU4A 2AKWB 1K73T 2LQ9A 1AROP 2KO1A 2YNHB 3DYAA 2M3DA 4MKBA 1G1XA 1RAOA 4KO0B 1PAUB 1VR6A 4PKDB 3QPIA 4Y65A 3OL7A 2ZC3A 4USUA 4OJGA 3QO9A 2EFVA 4XIUA 5J1EA 4PAAA 4ZVRB 2IPOB 2DITA 4WYWA 3A8KA 5AT1B 3SV4A 4AFFA 3DLBA 5A6PA 4UY8T 1JNRB 3EGNA 2PT0A 1YJVA 2YWHA 2QL7B 4JI1F 4FYYB 2RRAA 2DNHA 5ETVA 3T1YF 2FHOB 1GNKA 3PHTA 5DZ6A 4ES1A 5KFBA 2KHDA 4ZA1A 1RT2A 5L8RC 4M5DB 1JJCB 2MQNA 1TP7A 2R4FA 2XO6A 4DWIA 2IVYA 4P2MA 1X4HA 3OD2A 4MKAA 2HS4A 2PD1A 4IFYA 2FTRA 1Y0HA 3FRZA 4EMDA 3MCOA 4WXWA 1ROFA 1DJ0A 3ONQA 1YX2A 4ZVPB 2AJFE 4YP3A 3VAGA 3E51A 2XMTA 5KFSA 4F3OA 1KLNA 4Q8FA 4IG3A 5C24B 1UMJA 3TAQA 2PC6A 2BQRA 2HSEB 1RTHB 3NS6A 4DN0A 1L3SA 1N33J 2O01C 3V4MA 1YIJS 5I42A 2K2PA 4FYWB 3I0SA 2J0QD 3NMAA 4QR1A 3KLHB 2C2ZB 3VZIA 2MQOA 2MY8A 2J7KA 1H73A 1DY3A 3CGIA 1J2VA 2A2DA 1S1XB 1LEOA 3GZ7A 3ETOA 4OJ1A 1AUSL 3HFKA 4F3MA 2FLLA 4KGZB 1V5IB 3TW0A 4B3RJ 2VZ9A 1HI1A 3EVWA 2MQQA 1IR2A 3CJKB 2CZ9A 3ZNJ1 1NJXA 3CCWA 1QE1B 3QRRA 3V2UC 2JLEA 4NCGB 1GK8A 2QYGA 3UVJB 5D0EA 1GMUA 1X60A 4X66J 1SJ1A 1U02A 2ZUAA 3MOJB 4FBUA 4DV7J 3QT8A 2CPDA 2P6TA 4DV7F 2ALZA 2RSQA 1CC8A 4C11A 3OQ2A 2UP1A 1FNOA 5AJ3J 2OTLS 2DNLA 2IBKA 4XK8C 1XNRF 4FF1A 4YQWA 2GQQA 2W25A 3CPWR 3OVSA 4DXLA 1T11A 2UV8G 5ETMA 2DNKA 3QFWA 4WZMA 1E6VB 5KG3A 1WG5A 4B9TA 3DGPB 4F7VA 1QSLA 2V9WA 1UWAA 4ZVHA 3BKUA 4KE5A 3SCLE 2XWXA 4X4NA 3EVOA 4Z2XA 1RTJA 1DAXA 3MFIA 2AYGA 1AFIA 5FJ4A 1IWAA 3IAS9 3FEYB 1S77D 3ITHA 1O6XA 3WC2A 2CDQA 1HD0A 2YNIA 4I68A 4E2FB 3LOUA 4NLYA 4LSLA 2FUG9 5GADU 3OW2R 4ECYA 4RUHA 5HROB 3MM6B 4USMA 1PAEX 1RE1B 3N79A 1RU2A 4RBTA 3UI3A 2BKPA 4LBHA 2LP4A 5K8NA 2IYGA 4WFNQ 2C42A 2IYIA 2MZTA 1ZOTA 3I31A 5KG7A 3P45B 1NJIT 3G8SA 2C22A 1FK9A 2VG7B 1FTRA 2BYCA 4C48A 1FJ7A 2UVUA 1RK8A 3MEEB 4WJBA 4ZPVR 4OI2A 1UJ4A 5ETNA 2AW0A 8RUCA 3H20A 3DRSB 1NJWA 2UUBF 2OEKA 2VIHA 1QTMA 3Q8RB 1LKZA 4FVCA 2W24A 2FGCA 4M5JA 3RRKA 3I55S 5A8WB 1N56A 2HVEA 1I94J 5I3QA 1VI7A 3H2UB 1FD8A 1NB7A 1JLGB 3MAAA 2OPRA 5C2GA 2ZH1A 3ILLA 3ZZUA 1GXTA 1KTVA 1KVIA 4C11B 2VONA 2IJNA 3CO9A 5J2QA 4DUTA 4X64F 5EUHA 3J7ZT 1NUEA 3CMQA 4FNIA 4O3PA 3BSAA 5LJ5Y 1VMBA 4I7FB 2XS7A 4Y34A 1U6FA 1WDDA 3C16A 4RO0A 2IAJB 1GMWA 1N5SA 5I3UA 3MD3A 3Q24A 4J9PA 1N5VA 2GO8A 1S4EA 3U1NA 3FGVA 3IWXA 4ID5B 4ZJLA 1VQNS 5DLFA 1X5PA 1VQOS 2GW8A 2H48B 3DHXA 4JI2F 5IFMA 2CUYA 2DXFA 4I2PB 3I4PA 3J7YI 1AT1B 5CYMA 1WEZA 2OEJA 2QG9B 4MJKA 4NZ7A 1HWKA 2RHQB 3J80U 3HT3A 4P74A 1QDUB 5KT2A 5E41A 3R5CA 5B0DA 3PW7A 3RB3A 2ZBIA 2MLXA 2PMZD 1DTQB 2HHHF 4LRBA 1JKHB 4WFYA 3RU0A 3D1QA 1D9FA 1LK5A 3PRVA 2LQBA 1OIAA 2CPFA 2HHWA 4QYRA 4NOHA 1VRTB 2IY5B 2ZEJA 4OYAA 4FNHA 1K0TA 4QIVA 4CTAB 1NBEB 1BQNA 1TAUA 1BXNA 1Q5YA 4I6WA 2XQCA 1G4CA 2HLTA 4YB7A 2FJDB 4CLWA 2ZDPA 2M70A 2AF6A 1S1XA 2JC0A 1GQEA 2AEMA 3P6YC 3R5DA 3H5SA 1BQXA 4MIWA 4PRFA 3I5CA 4E0DA 2R7RA 3POTA 2LQ8A 1D9DA 2W8KA 1FJGJ 2ZH9A 4DI6A 4PG6A 2VPWB 2BEFA 3CCRS 4B3MF 2AYMA 1C0UA 2CNKB 3QBCA 5KG4A 2RKIA 3DRPA 2O5DA 3IWLA 3M2RB 3OR2A 5B0EA 3UW1A 1S97A 1CVJA 2J9EA 1RHMB 1U1KA 1HYSA 2NXEA 4ZS6A 3TVZA 4OX7A 4RUCA 3D7SB 4ZKAA 5AE3A 4K0KJ 1PSDA 2ZDOA 4CRJA 1AZSB 1RTDB 1PC5A 4GKKF 2GMLA 3B54A 3HHEA 1Z2LA 2RUSA 2KXFA 4AYBD 3ZZ0A 1JLFB 3BYRA 3K7RA 4NASA 2W9AA 4ED5A 1Q86T 1XMQF 5F8JA 2R7WA 4DQPA 2DIVA 1IVZA 2M2BA 4TU8A 4NXMF 1LWXA 2W7OA 2V69A 5CZVA 1ZAXA 1SJFA 4F26A 3HJFA 2M88A 4MKYA 3EXYA 2J9CA 2EW9A 2Q1LA 4LIRA 1T03B 4TN2A 2DCUB 4F3QA 1CS4B 1E6VA 2HBQB 5LT5A 3KHRA 2EC0A 2RQCA 3TARA 1GMVA 3VZHA 4LF8J 3ZZOA 2UXBF 2E7VA 1IKYA 1FRKA 4XTTA 5KFPA 2MEWA 1VQ9S 2XMJA 4I2QB 2GIFA 3QWPA 1OMSA 4NLUA 2CZVC 4KO0A 4CWBA 2DBBA 1R8AA 2OLWA 2E1RA 3HVWA 4CLZA 2Y8YA 2YX7A 5LXYA 1VQ6S 2MQPA 3QIPB 2AV5A 1Q0NA 5E3RA 1GX5A 3GCXP 3JSMA 1NXIA 3A1YG 3LGHA 1H72C 1WKJA 2DJWA 3ENWA 3GB0A 4RNHA 4DUZF 4KGKA 2RB7A 1M5SA 4DV5F 2EC2A 3K89A 2HFOA 1R89A 3FZ2A 3MCNA 4TYAA 1KSPA 1UVMA 3QNWB 4CM0A 3OHAA 4OHYA 1ZYQA 4DPUA 1FK9B 1FX2A 1Z2ZA 2PN6A 3B8HA 4I64A 2HHSA 3CC4S 4RNNA 1FDAA 5D6GA 2M52A 2PE8A 2BJ1A 4YR0A 4DX7A 3TVKA 4E8UA 5LXRA 2YNGA 2HGMA 1FKOA 2FJXA 4TY9A 2FHMA 4Y0FA 1SV5B 1MROA 3Q83A 3FCVA 5E3QA 1RTIB 4QOTA 4A46A 1GEHA 2LXIA 5F8HA 1ICEB 4EU0A 1N54B 1FE0A 2LU1A 3EDRB 4F4XA 4F4YA 4ILMA 4ZVOB 1RAHB 2BJDA 3PR5B 2MZQA 4CLSA 2R7XA 3HVTB 2V63A 3JSYA 3LPEA 4DL4A 4P2SA 3IS9B 2ADCA 4DFKA 3I82A 2HHVA 4PXBA 2R7UA 3VAJA 4R0JA 5D8HB 2F4VF 2FVSA 1H6KX 2QLBB 2VUGA 1XNQF 2H3EB 1K44A 1NSQA 3CJKA 4DS4A 3HHNB 1LV5A 1I1GA 1BHNA 2ZVSA 3LF0A 2DXDA 4C98A 1T95A 3CJSA 1ZTWA 4KHMA 2YKNA 1IXKA 3ILJA 1NDKA 3JQMA 2ZJRQ 1S10A 3R5GA 3JSRA 4UOGA 1NRKA 2DTJA 2GJFA 4L73A 4LF2A 2VBZA 2JJ4D 4Y2CA 1Q4RA 2WVEA 3MAHA 2DRBA 1IQZA 2C3YA 2UUWA 2V34A 4KGXB 3AOAA 4NLWA 1FDNA 2ZOMA 3AJ2A 4KHRA 1TZ0A 2W7AA 5GAHI 2RHSB 3VAKA 4C8LA 2R2SA 1DARA 2GS8A 1Y7PA 1NJZA 4NPOA 4U7UD 4QJVA 3DOLA 2EKNA 4K8RA 4RW6B 1ZBTA 1SKRA 3UPFA 2R7SA 1X0FA 1CLFA 3LALA 3H8YA 4CLUA 4LT6A 1X5OA 3KK1A 5D4NA 5E3AA 3MEGB 4ED4A 1VQ7S 5L1KA 1SB6A 3H2LA 3FCHA 4J9MA 5J1EB 3MEEA 4QYZK 3IRXA 5C2CA 3GJTB 4WKYA 1RJJA 5KFMA 1NK8A 3IFEA 2RMLA 5EWGA 1TTHB 2KB2A 2GIRA 2YQ3A 1FERA 3HKZD 3AOCA 5HMWA 1N48A 1ACMB 1HKAA 2VD3A 1URNA 3E2EA 1BWEA 3HZGA 2UUBJ 1J5OB 2SXLA 3A4TA 2UUAF 3NGKA 4NA3A 4WZQA 1UPPA 5J1PA 4KTQA 4LR9A 2KTQA 3TEHB 2MJNA 3NL0A 2BVZA 1TL4A 1QAJA 3M30A 3PEJA 3QGGA 4FDFA 2CQIA 4BBYA 3L3CA 3QLHA 1Y11A 4ECQA 1TVRB 3EPGA 1RDRA 3ZXWA 4CH0S 2D3O1 3OR2B 3CMES 2WW4A 4HL9A 3HMJG 4F67A 4QIWD 1VGYA 4ZITA 1X5TA 4HT7A 2IM1A 2XCPA 5KFGA 3VTIA 4NLGA 1B0TA 3MUVP 1FF2A 1YSJA 4AQYF 2CNLB 5FLXY 2YX1A 4ID8A 5D0RA 1O5JA 5GMEA 4CO4A 4HHUA 4K5RA 2EWHA 4ANDA 2W2OP 2VJVA 1R0AB 4OQJA 3VVUA 4CI0B 4DEZA 1EP4A 1N5YA 1MMDA 4FF2A 1HNVA 3I0RB 4M94A 2DGSA 3MR3A 1JXVA 1MWQA 4ZIVA 3LAMA 4J9NA 3M8RA 2B6AA 1VQMS 5AXLA 5L1LA 4ED0A 1RT1B 1S99A 2ZOFA 4F2SA 4URGA 2ASLA 2V4RA 2CQ4A
chains in the Genus database with same CATH topology
2YKQA 3I56S 1HNXF 5KOXA 2DO0A 3SCIE 5A8RB 4HDHA 4MTPA 2NUUG 2GNKA 4K59A 4X66F 2RUGA 4KFBB 3I6PA 3HM9A 1OS5A 4CT9A 2I8EA 3CCMS 1CPZA 1C1BB 2IAJA 4L72B 3TUIC 3RBEA 1XR5A 2EBEA 1B7FA 2OMLA 4NLQA 3QO9B 3NCQA 4JI6F 1HHTP 4QU7A 2NQPA 1SIZA 3BF4A 2V9KA 1X0PA 2R7OA 4ATNA 2N7YA 2HIQA 3Q2TC 3GMGA 1ZM9A 4KV8A 2B5JA 4ZPAA 5EWFA 1WTBA 2KFYA 3BS9A 1QSSA 1IR0A 4WK3A 4UQGA 3H59A 1HW9A 2XO7A 5IWAF 5AXNA 4DSJA 3DRSA 1SBRA 4NRUA 4RW9B 3TAMB 2HGLA 3QGIA 4UY85 1FD2A 1HNZF 4DL7A 3DCAA 1LFWA 2Y1IA 3N6NA 1HWJA 5DGAA 3M8QB 1EETB 4O4GB 1JNZB 3N6LA 1SC6A 1LK7A 4J9OA 1U1MA 3KHHA 3GWCA 3T9NA 2GJIA 2DR8A 2KKHA 1KD1T 1S6OA 1LW2B 4WE1B 2IC3B 2YKMA 3DU5A 2LVWA 1OPZA 2C3MA 1KOHA 2IRXA 2ZH5A 1S1TA 5CQGA 1TL1A 3K5NA 4DR3F 1FDBA 2XMVA 3MR2A 3PO5A 3KLEB 1FXDA 2UU9F 1OSDA 4FVMA 3GG1A 2X1FA 1NHUA 1H98A 2ZFHA 1TKTB 2IM0A 2J0WA 3KKFA 2XMMA 3O2IA 4U7CA 3MGJA 4OMFG 2QT7A 4A8OA 3UR0A 2MZ1A 2X1BA 3K5MA 5CCMA 2OP5A 1IKXB 1Y3KA 2EPIA 2MGZB 4QCLA 2AJ0A 2QLWA 2VASA 3M2UA 2IMOA 1WWHA 3MWBA 1FRIA 2QA1A 3CCUS 4ZPWR 2HLUA 4RKUC 2PA8D 1YVFA 5DM6Q 2CPZA 4U9RA 3TOQA 5HLFB 1DFDA 4B9SA 2DPIA 4C97A 3CCZA 3T6JA 4LQ9A 4NX9A 3TUZC 1H7XA 1C1CA 1X7VA 2J8AA 4H4OA 4ECUA 1HNIA 3MAQA 4ELVA 3DDKA 3T1AA 2XGQA 2MPUA 4JYAF 2QEXS 2IVMA 3LWLA 1UA1A 3VQSA 2YKNB 2FPHX 2V8DA 2YTCA 4X62F 4HI2A 1YRXA 4ZCIA 2UZAA 3KOAA 2J0XA 2JWNA 3KJVA 2O3DA 5C42B 3TA2A 2FLOA 3DN9A 5T7LA 4X4RA 4DFJA 3I5BA 1WF2A 2YNFB 3PX0A 3OXGA 4DV6F 1HQEA 2ZE2A 3PIOQ 1KC8T 2APOA 2ZUGA 1I94F 1N0VC 2BE2A 5I3PA 1HMVA 3RYLA 2LQ5A 1UA0A 3RRHA 3L95X 1O8BA 2VG7A 1FNMA 4F4WA 5CYJA 5K8OA 3Q0AA 3KLFB 4WF9Q 3GYXB 4LFBF 2RJZA 4J9LA 3U7JA 4RNMA 2YH1A 2I5JB 2HWTA 5DG8A 2XLJA 3O44A 3CCLS 1YHQS 1FEEA 3AB2B 5E33A 4V19J 5CD4H 5EGYA 2KZZA 5HLFA 1W2IA 2KHCA 5KT6A 1HWLA 1K1QA 4PQUB 4JOUA 1Q82T 3LAKA 4Q8EA 4ELUA 4C2MA 1D1UA 4ERDA 2K8GA 1FEHA 4ITSA 4CH7A 4C7QA 4F25A 5A2QY 2R7SA