3JS9A

Crystal structure of nucleoside diphosphate kinase family protein from babesia bovis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
148
structure length
148
Chain Sequence
MERTYIMVKPDGVQRGLIGEILKRFEMKGLKLIAAKFEHPTMDVVAQHYCEHKDKPFFKDLCDFISHGPVFCMIWEGPEAIKIGRNLVGLTSPVESAAGTIRGDFGVVKNFNIVHASSSAEDAARECALWFTPEQLVTWERSVGGWIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase family protein
publication title Crystal structure of nucleoside diphosphate kinase family protein from Babesia bovis
rcsb
source organism Babesia bovis
total genus 41
structure length 148
sequence length 148
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3js9A00
3EICA 1XIQA 4UOGA 3L7UA 2NCKL 3BBFA 4F36A 3ZTPA 3EM1A 3VGSA 5CAAA 3Q83A 3FBCA 1PKUA 1LWXA 3VGTA 3BH7B 1NDKA 1NSPA 1WKLA 1ZS6A 2HURA 3Q8UA 3ENAA 1LEOA 3Q86A 4KPCA 3WX8A 3FCWA 3MPDA 1S59A 1B99A 4DI6A 3PJ9A 1NB2A 4UOFA 1NCLA 3GP9A 2AZ1A 1BUXA 5BXIA 3ZTRA 1MN9A 1HIYA 1NHKL 3ETMA 3Q8VA 3EJMA 3BBCA 3BBBA 1NLKL 4DUTA 1NSKL 2BX6A 2CWKA 1S5ZA 1WKKA 5IOLA 3FKBA 3Q89A 1F3FA 1KDNA 1NPKA 2HVDA 2ZUAA 5C7PA 3VVUA 2B8QA 1UCNA 2VU5A 1HLWA 3VVTA 1K44A 1XQIA 3EMTA 3FBEA 1BHNA 1NUEA 2DYAA 3ZTSA 2DXFA 3NGSA 1WKJA 1NDLA 4HR2A 1NDCA 3ZTOA 3NGRA 3BH6B 3DDIA 3EVWA 3EVOA 1PAEX 3FBFA 4ANCA 3EE3A 4ENOA 4FKXA 3B6BA 2DXEA 1F6TA 4DZ6A 3NGTA 4O0NA 4CP5A 1EHWA 2AZ3A 4S0MA 3R9LA 1HHQA 2DXDA 3ELHA 1NSQA 4EK2A 1JXVA 3VGVA 3NGUA 4WBFA 3G2XA 1VYAA 2B8PA 3GPAA 1W7WA 2BEFA 1BE4A 3JS9A 1MN7A 4FKYA 3PRVA 1S57A 2HVEA 4F4AA 4ANEA 2DY9A 3ZTQA 3FBBA 4W98A 3FCVA 1NDPA 5CABA 4ANDA 3Q8YA 4C6AA 3EVMA 1B4SA 3FC9A 1U8WA 3DKDA 3B54A 4UOHA 3VGUA
chains in the Genus database with same CATH superfamily
2EKYA 3OTEA 4I64A 2W9CA 3D6HB 1FDAA 1RTDA 1RWKB 1X4GA 1HNIB 4UY85 3VF0B 4F04B 4NA3A 2M3DA 1VI7A 2EC2A 2J6TA 4JI6F 3EZOA 1RWVB 2HBZB 4WP8A 2BW2A 3Q2SC 3C14B 5HJYA 2XI3A 3T5KA 2CPHA 1U1MA 5FIIA 3KK1A 1WKJA 2QL7B 4C3LA 2GX8A 5B0AA 2OP5A 4G1QA 3SBMA 3TARA 2DPJA 3P49B 2M5YA 2R4FA 4DN9A 5CD4H 3UN5A 1WC6A 1KVKA 3MCNA 1SB6A 2QLFB 2QRRA 4J9SA 3SIPB 4J7CA 4B3RF 2IHR1 5HI7A 4YB5A 2VQFJ 2B9WA 3UCGA 4NLSA 3R6LB 3L7PA 2DRAA 1F1BB 3K5NA 2LQ9A 1SKUB 1QJHA 4DQIA 2LDYA 2OEKA 2AZ1A 1Y0HA 2KKHA 2WHOA 4ZP9A 1H6KX 2FJAB 1UVKA 3LP1B 1FXRA 1HBOB 1LWFA 4MH8A 3TZWA 3A12A 2MHEA 1RTHA 1YZ6A 5JVGQ 2GO9A 3KYLA 1N5YB 1DLOA 4ED2A 5HVFA 5JUMA 1U0SA 3EZUA 1TAQA 2BANA 3UN3A 3OTDA 4RNOA 3FQKA 2XWYA 1K9MT 2ZFHA 4NZ6A 2GQQA 1JXEA 2DITA 2DR8A 2G2ZA 3ZFVA 3TVYA 1U0HA 3QO9B 4L3KA 5KFUA 5C42A 5D78A 5HVGA 3QIDA 3CJ3A 5K8OA 4QR1A 3UW1A 4ZP7A 1X4DA 5LT5A 1LW0A 4KT0C 1SIWB 3S7RA 2YPZA 4F50A 2C3MA 2MZRA 1W25A 2POKA 1NKCA 3GMGA 3NCQA 3A8KA 2KB2A 3H25A 1J5OA 5IT9U 4PYAA 1SJRA 2B5JB 2DGUA 4K4WA 4D3GA 2R42A 4Z2XA 1FEEA 1RT4A 1SXLA 3M2RA 1W26A 1OO0B 2OH2A 3JSRA 1W2IA 4LRDA 4CM0A 2WTFA 5D77A 1DRZA 3OFGA 4DSEA 4A48A 4ANCA 1SJ4P 1N34J 1D8ZA 1OY9A 1TFWA 1S0NA 4PWDA 3K0JA 2F65A 4O3NA 2AGOA 2BJ9A 2JJ4D 1L3KA 2YQ0A 2AYEA 3H4DA 4DV6F 1XN9A 3H40A 1S49A 2OEMA 2UUCF 2E66A 4WE1A 1H2TZ 1TZ0A 1KLMA 1TKTB 4QWAA 4C8LA 4JI4J 1EAYC 1KS2A 5JVHQ 3US5A 3NL0A 1RU1A 4NLRA 2NYHA 3D1QA 4URQU 3S6EA 4ZVHA 4DX7A 2Z30B 2MKJA 2WBMA 1RHJB 1QSLA 2KJWA 3G9CA 3V6DA 2W2QP 2GMHA 2RILA 4LQ3A 1T03A 4ZPVR 2BQ3A 2MJNA 4OLOA 1UZHA 4ZCIA 1AFIA 2KXFA 5KAKA 4FXDA 4TLRA 1H98A 2FHOB 2RF2A 2A6MA 2ZNZA 5F8LA 1NJXA 4FF3A 2W9BA 5H9EK 2KVQE 3V6JA 3UVJB 2IA0A 2NXUA 5LXRA 1UPPA 4URSA 3AD7C 5AE3A 5T14A 4F25A 5LJ5Y 3I5AA 2PN6A 3LP0B 4O0IA 3GG1A 2P8IA 2HNDA 2JFDA 5D3GA 4F8RA 3U27A 3OBIA 3OXLA 4J9VA 2R7QA 2Y1RI 1UVIA 1IR0A 1TFYA 3TW0A 2UVWA 2LFVA 3OR2A 1G1XA 3OLBA 1NHVA 1YJNS 2XHCA 1B64A 4J9QA 3PX0A 2G9OA 3ENAA 2F1FA 1TVRB 2ACMA 3O8WA 4JP8A 1CJVB 2P6SA 2QG9B 4DG1B 2OPPA 4JV0A 2CQ4A 3W9JA 3CCZA 1HIYA 4ZVOB 2K1RB 5HROB 3LP2A 2EG1A 5J2MA 5T7LB 2GJ2A 4UQGA 1HR0F 2IVMA 1FRIA 4NPOA 2H9ZA 2K3IA 1VJQA 3DGVA 4PKDB 5H9EJ 1QM9A 1WEZA 4KR0B 3DOKA 3CMQA 2DD8S 4LQ9A 2X1FA 1TKXB 3AJ2A 1PC4A 1JLAB 1PJ5A 4IFVA 3HP6A 1VBXA 2D74B 2HZAA 2HHPA 3IWXA 2QV6A 2ZJQQ 4DV4J 1KHVA 5J2QB 2I1RA 5DZ7A 2XO7A 4WU3A 3VAIA 1BQXA 1TU0B 2UUWA 4HTIA 2BA9A 1Q53A 3SCLE 5IM0A 3M6WA 2UUAJ 3BGRB 3BZQA 1HWUA 1IBLF 4IOAQ 1YITS 4I2QA 3L4BC 4IR9A 1R89A 3M8RA 4Y00A 5J2PA 4B17A 1IKXA 4HHJA 5KG3A 1C2PA 2Y8YA 3CE8A 5B0BA 1JLFA 1BGXT 2A2DA 1GAOA 3RB3A 3ZZZA 3BSNA 1FWKA 4N8OA 1FI4A 1K44A 1VQ5S 1MU2A 2YNIA 1M5OC 5HN0A 2QMUB 3P6YC 3V6HA 1G4CA 4K8RA 3ENQA 5I3PA 3N79A 2OEJA 1NKBA 1FRXA 1AYEA 4HEA9 2PMZD 3GPAA 1HBUB 1WEXA 2VICA 3VAFA 4DCJB 3G8SA 4TYAA 1RI7A 2YWEA 3I4HX 1T95A 1LW2B 3Q8YA 1HI1A 4UOHA 1TKZB 2GZOA 2E1PA 3GSIA 5DDPC 3HZGA 2RQCA 4ECTA 2G2YA 1NDKA 5A0YA 2HURA 2AYMA 1LEOA 5EX3A 3UE2A 2ROPA 3R7SB 1RA6A 3TAPA 4U7CA 2ZHAA 2RUSA 3C14A 2KYZA 2C2OB 2CNLB 3NY0A 1SV5A 1VFJA 4IG0B 4X4TA 1PJ7A 4PWUA 4HT7A 3PG9A 3QNWB 5GADI 2DYAA 1S1VB 4HLBA 5GMKa 3R7BB 3OUYA 3OTBA 4ZPTR 5KFWA 4DR4F 1GQEA 1HNZF 1A0OB 1VRTB 4O0NA 3ZNUA 5D0EA 4ECRA 2DGSA 5E3AA 1IKWA 1VR6A 1VYAA 4DCOB 2WBRA 1W7WA 2KM8C 4DCPB 1PYSB 1PYOB 2OPRA 1Y4ZB 2HRYA 1GXLA 4O3SA 4LSNB 2EI5A 1F5BA 2G0CA 3MEKA 3IAS9 4E98A 5HMZA 1F2HA 2FPHX 1YJ9S 3IS9B 2DGQA 1FJGJ 4ZLLA 4LF5F 2DHXA 3T1YJ 1U1PA 4DV7J 2EK6A 3PACA 1YDLA 2R7TA 3FMWA 1WNEA 2CVEA 4I7FA 2OFGX 2QYCA 2HFOA 5DDOC 3T9ZA 3V2UC 3ZTRA 3H42A 1GMWD 4NL5A 1JLBB 2EK1A 2ASJA 2ZEJA 4KQZA 2XLKA 2QA1A 2K2PA 3TI0A 1HBOA 4WXOA 2VD3A 1SUQA 5L9XA 5EHHA 2DNPA 5IC4B 3V5RA 3ENVA 3MM6B 3AFGA 1FFSB 3RB6A 1R6YA 2DNKA 3DMJA 2D7SA 3GJQB 4ZMMA 3HHDA 1VHFA 3K5MA 2OLWA 4QJVA 5BYSA 1T7PA 5GAEU 2B0GA 1VMBA 2MQ8A 2DO4A 1DBDA 4OYXA 3D5MA 3Q0AA 1F9HA 3BYRA 5LM7E 1N88A 4R0JA 1U1OA 3RGIA 2RS8A 5CD4A 5IS2A 1WACA 3ISZA 4CNZA 4OX9J 4CRJA 3W2VA 1I3OB 3QLHA 4IO9Q 2G13A 2HPUA 1UWAA 4ZN3A 5GMDA 4GKJF 4IRDA 1ZA1B 2K7JA 3QGHA 2WAQD 4GMKA 2MHNA 3MI7X 1AT1B 2J0SD 3CVKA 5L1LA 3H5YA 2YKPA 1VQKS 3I87A 1XQIA 1FK9B 5C25A 3IRXB 4JUZA 2ZWOA 2VKRA 3D1OA 4JI6J 4K4SA 4UOCA 5CYMB 1EETB 4KY3A 5KG5A 2IBOA 4UUWA 4F4YA 2VPYB 2ZJPQ 1OQ3A 1AROP 2EFOA 3M8QA 4ZLPA 2MKSA 3FCVA 4MKAA 3QT5A 2QA2A 4M8LA 5KFOA 1IQZA 3GFXA 4DMZA 3P96A 4ZJLA 2KZMA 2XULA 4M5KA 4J9LA 4RW6B 1U49A 3KHLA 2CQBA 4ED3A 2DNNA 4ZVSB 3DHWC 1RTIB 2HNYA 4RWWA 4YY3F 1SKRA 2HQCA 3CJ2A 2K7KA 4ZK7M 4L3NA 4LSLB 4DV0J 2NPFA 4B3RJ 1MMNA 1SQGA 2BKPA 3UVJA 4KRWA 1ZAXA 2BJDA 2HVDA 4QIWD 3N0VA 1HI8A 4EO6A 5LSOA 2HBRB 2YX1A 1RUSA 1KRPA 2XGQA 2KL8A 1T05B 3KLIB 2EVZA 5A8WA 5GMEA 3LP0A 2RRBA 2DXEA 2HK2A 4CO0A 3ELHA 3F56A 5LSLA 2B8PA 2E5GA 3OL7A 1EARA 3PRBA 4G1PA 2VHGA 1T3OA 3TJAA 2MKKA 2LQJA 3MAQA 4F26A 1LWEB 3KUGA 1D09B 2W7PA 1YTYA 1ZETA 1GMUA 4PQUB 1KD1T 4W90B 3R1HA 3TA2A 3MCSA 3NXZA 1Z2ZA 2XEXA 4R5PB 4P2MA 4UZBA 3CGIA 1D8YA 4IDKB 3FSIA 1VRQC 4DR6J 4ZIWA 3M9OB 1UVLA 3CD6S 1SKWA 1GXTA 1YZ7A 3AD9C 4C0HA 2QA4S 1TKXA 3MM8A 1FWLA 4LRCA 1XMOF 1QY7A 1NHUA 4AFFA 1X7VA 1PSDA 2LA6A 3R2CJ 4QR0A 2VPZB 3SFUA 5KG4A 1VLOA 2V8GA 2UV8A 3G96A 4G3IA 4IFYA 4OYOA 3BGRA 4NZ0A 1S10A 4NMXA 2RNEA 3IR5B 3M2VB 4HH1A 3NMAA 2W8LA 1XNQF 3T1AA 1BC6A 1PG5B 2E5LJ 3CUNA 1OQ6A 1S0VA 3DCAA 1TL3A 4XPEA 1X4BA 3OLAA 3KDOA 4HYKA 2VBXA 1HNXF 5DQHA 3WHIA 4P73A 2EFVA 2I2YA 2UXDF 2BJ3A 1HPZB 1NK5A 2FLLA 1XNRF 3IRWP 3KJVA 5KFLA 4N47A 4I6WA 2OMOA 3PJXA 3BSAA 1EQMA 4ZVGA 1IBMF 5B0FA 5HMXA 2GNKA 1WHWA 2B6AB 2ZDOA 2FYXA 3JQKA 3PX4A 1WF1A 2VDIA 1VQ6S 4MKYA 2LKZA 1VRUA 4KB7A 1J27A 3BGLA 1NK8A 4I67A 4AXIA 4H4KC 5KG6A 4DV5F 4FF1A 2V69A 3C19A 3EGWB 4CQ1A 4F36A 4WPAA 4Z7YA 4ED6A 4FBUA 2GGPA 4Q5VA 3V6KA 4TY8A 4IG3B 5DG8A 2EFPA 3SQOP 4USIA 5KFJA 1TQLA 3ZZPA 1TV6A 3PZPA 1SH2A 3HHEA 3U1MA 4TN2A 1N4LA 1DFDA 4Q0BA 2FIUA 5C24B 4R8UA 2WCXA 1UAWA 1JMTA 1RE1B 1L3UA 2ZOMA 4TXSA 1FXLA 1S1VA 4CZCA 3HKWA 4OX8A 2OKQA 4WKRA 1GK8A 2RVJA 1PBAA 3MPYA 3PVXA 1P9QC 1R31A 2J9DE 3GYGA 3HVAA 1HR0J 2MZJA 1TK0A 1R8AA 2FZCB 3PHTA 1EIYB 4EUVA 4NLYA 5K20B 3N6MA 3O1LA 3S8SA 3TJ9A 3W63A 1Y11A 3CCUS 5B7WA 3M30A 1WC5A 4ID5B 1TUVA 4RUBA 2HVZA 1U8SA 4NA2A 1L5UA 2R9LA 4DL5A 3FZ2A 2D3UA 2H5EA 4P74A 2IRUA 2M9KA 3CXCR 2QIFA 2DNLA 2W7AA 3BBCA 1MG7A 3FSYA 1KTVA 1WF0A 4LF1A 5BYQA 2CWKA 2BE2B 4MKVA 3N5BA 1F3FA 1ZM3A 3N6NA 2M0GB 2H5IB 3MDFA 1IBLJ 4A8KA 3NWGA 2Z0GA 1HLWA 2WVCA 2W7OA 2Z58B 3NWRA 4HR2A 2MMYA 5EGYA 4RU2A 2QLXA 2WRMA 1IKVA 4O44B 3IBCB 1KOOA 4K2JA 2R7WA 4QBUA 4I6AA 2LP4A 1GFWB 4AD6A 3LUYA 1RTJB 3SCJE 2D9PA 1MWZA 2XS7A 4RNHA 5HSPA 4M5DB 5B08A 3OTOF 2PI4A 2W8KA 2JX2A 4K4ZA 4GKKF 3OFEA 3D54A 3RYLA 1XMQF 2HG4A 5B0CA 1LOUA 2DPIA 2V9KA 4ED1A 1UEKA 4OZNA 2VFUA 2RQKA 3BM7A 1MNEA 3G8TA 3LANA 3KMQA 2W4CA 2XCAA 4ECWA 3O2IA 3PJ9A 1MROB 1S76D 4B9UA 4KKOB 2U1AA 5LSRA 4DSIA 1X5TA 1JJ2R 2XSJB 2Y1LB 3GR1A 3PR5B 3BS9A 3EWGA 1UKUA 3Q89A 3GILA 5C7PA 4GVBB 1RA7A 3UDEA 2CRLA 5E3CA 2EFQA 3NCPA 4P72A 3C46A 4HDHA 1GT8A 3MUTP 3UR3C 5H9FJ 1JWWA 1T9VA 1Q95G 2FC8A 3OJSA 1U6ZA 2ZH2A 3ZZYA 1OWXA 1JIHA 1LKZA 4WU2A 3RW7A 1SKSA 4A8WA 4LR8A 4ANEA 4KV8A 2MGZA 3UWTA 4X4NA 2AEFA 2YQ3A 3CDWA 4DR4J 2H3EB 2OPSA 1HNZJ 4RW6A 3H7HB 3Q83A 4RNFA 3PKMA 9ATCB 2HHWA 2WOMB 2W4DA 1X4CA 3MFHA 1UZDA 4PRFA 1RTIA 4ALZA 3GTYX 5F8GA 3IC1A 3C16B 2MYFA 2R7RA 3W5ZA 4C3MA 4LSLA 3BB5A 3MR3A 3OHBA 2GJIA 1XR5A 4BLGA 1T9YA 1UVNA 2EBGA 3KTQA 4LF5J 3JSBA 3BN4A 1RAIB 3BPSP 2L08A 2X51A 3EDQB 3DM2B 4LVNP 2J6SA 3ZTOA 1UA0A 2LXIA 1PAEX 4JOUA 4ED5A 3FEZA 4LF2A 4CP5A 1OPIA 1V5IB 3RR8A 1S1XB 2DR9A 1CG2A 5HMYA 3MHYA 2J0XA 1LWEA 4FBTA 1CJKB 3CJKB 4JI8F 4EMDA 1V3RA 1TMJA 1U47A 3K5OA 1TR0A 3O6QA 2ZVSA 4DR7F 3AD8C 3F0NA 1B7FA 3BEGB 3B78A 4PQUA 3SQGB 3HSZA 5HLFB 5KG1A 1V3SA 4OHXA 4OI4A 4XO0A 2UXBF 4R5PA 4OMFG 6FD1A 4X2BA 1UW9A 1S9EB 5F3ZA 2G0IA 3JTNA 4ITSA 4IDKA 4O4GA 3ET6B 3I82A 4CI0B 1NJYA 3BBBA 1JLCB 1YJUA 3M8YA 2JEGA 2RHQB 2IPOB 4YB1P 3RZAA 4HH0A 1PGZA 1RISA 1YIJS 2NXJA 4DL2A 5DS7A 5EWEA 3CJ8A 4LBHA 4MK7A 2N7CA 2JEFA 1XR6A 3GV5B 4DLEA 2XMUA 4AE5A 2E9TA 4ENOA 1YX2A 2JLGA 2W9AA 1N5SA 1S99A 4TNOA 2DR5A 4X84A 5A8KB 3G2XA 4IOBA 4MTPA 1FE4A 2PMHA 2Z2YB 1XBWA 1P1TA 3DDKA 3RAMA 1RU2A 4J9KA 1URRA 2I0XA 4OI3A 3M2VA 1RB0A 1S1WA 1LNQA 5KOXA 2CPYA 5LJ3Y 3JAMU 1RWNB 3FQLA 2E9ZA 4IQXA 3J7YI 3L95X 1SJ3P 1QAJA 3DN9A 1BWVA 4XK8C 2Z2ZA 5ETNA 2Q79A 5HANA 1N5VA 1BUXA 3MAAB 3SI8A 3BYPA 1J5EJ 3T6BA 2BW7A 2VG7B 3KG1A 3MM7B 3MMAB 2JC0A 1FRJA 5CZXA 3VVUA 3PIOQ 3OVSA 3MWBA 4XIUA 5HBMB 1Q8IA 1RHUB 4YY3J 4CIOA 4ELVA 2OGUA 3T19A 3RW6A 4KO0B 3TAMB 4J9NA 3FJ2A 1FWPA 4OJHA 5ITHA 2HSEB 3FEXB 5A6PA 3LPEA 1FCAA 4KJIA 1GNKA 2RUGA 6AT1B 1HQEA 1HI0P 4U8YA 5F8HA 4W98A 2WSEC 3VHQA 3UD4P 2RT3A 2ASYA 3SSRA 4RBUA 2OPQA 3HULA 4FP9A 1E6YA 3OPKA 1YLXA 3W9HA 4LVOP 1CQNA 2HMIB 1RT2B 2XZWA 4P6QA 3NNAA 1CVJA 4O3RA 3WDOA 1C1BB 3NOGA 2PT0A 5DLFA 5C24A 4DX5A 3LALA 2PFFB 3MR7A 3GSDA 2CIMA 4N76A 5KG2A 4LUBA 2CQ1A 2LU2A 3I4PA 4NYPA 5J2NB 4PUOA 2HBQB 5G0RB 3BQ2A 1VQLS 2ZHBA 3QJPA 1U1QA 1KP6A 4ECVA 2ROEA 4GC7A 2IAJA 2BRLA 1U7LA 3D6FB 1QUVA 2E7WA 3W3SA 1DTTB 3R9LA 5JMNA 3CC7S 2BZ2A 3FZBA 3MOZA 4PG5A 3H20A 3D67A 3I0RB 2IYGA 3ADAC 4F0HA 4IO1A 3KDNA 2D69A 1O0PA 1LK5A 2C3PA 1RWWB 1NRKA 3BGOP 1XMOJ 4JI0F 2XS5A 4KYZA 3BR9A 4ID5A 4K2XA 3KK2A 3H4BA 3DHXA 3AXMA 4ELUA 3X3UA 2VFSA 5IWAF 3EDRB 2HAFA 2QO3A 4MK8A 2A1BA 2DHAA 4O3OA 3GIIA 1RLDA 1RAGB 4C3KA 1HKAA 3LGNA 4RUCA 3VQSA 2B43A 3V4IB 1WELA 4C8MA 3FCHA 4L6V3 2VC0A 2WONA 3IP0A 2KJVA 4NASA 5G4DA 3M2UA 5DQIA 1ZZNA 2QSWA 4FYWB 2VG6B 1HNXJ 2AW0A 2D41A 3F41A 1CULB 2HS3A 1F3VA 2QEXS 4W92B 3SDEA 4M5DA 1S4FA 4ZITA 1K1QA 5IQ6A 5DGBA 3C2PA 4YDDB 2HIQA 4NEYA 1K8AT 3JYTA 4LF8J 2HWHA 4LR7A 5CZVA 2GHPA 3QZ8A 4X62F 1H72C 1IBMJ 1UFWA 4TY9A 3Q8PB 1JLQA 4X4VA 4U6PA 3POTB 2DY1A 4X4QA 1MMLA 1S59A 2OAUA 2IYIA 1RT6A 3QRRA 2R7OA 1U1KA 1GEHA 1NHKL 4M5GA 4DV5J 1N33F 1RYSA 4Q8EA 4JV5F 3EGVA 3DGPB 2O67A 4ECUA 3QFHA 4LRFA 1D9AA 3HCXA 1S6QB 1SQFA 1X8DA 3ZC4A 4ZCMA 4ZHRA 3W2WA 2R8HA 4E8UA 3ONQA 3OD2A 4RNNA 1S12A 5RUBA 3R97A 4PPDA 3GWCA 2KT2A 1BD6A 1RT1A 2QMWA 2CWXA 1WHVA 1Q4RA 1MN7A 2W9CB 5M2RA 5LOQA 1UJ6A 3MTKA 3HSGA 1FVSA 3DOMA 3KJQB 3VGUA 1BQMA 2IY5B 1I6JA 1FKPB 5KFEA 5U47A 1WDTA 1JLEA 3BO2A 2XLIA 3C16A 1RJJA 1FKOA 4KPCA 5J1NA 2HHSA 3TAQA 2VZ9A 5JJBA 2ZBPA 5KFZA 1P8GA 2Q1LA 3C6TA 1CS4A 2BJEA 3KK1B 4X4RA 2CZVC 2YNFB 3BSCA 2ZUAA 4G1QB 4K59A 2BOPA 2XMAA 4DPOA 3DM2A 3PW4A 3GIMA 1YRUA 1HMVB 1DQAA 3L7OA 3FFIB 2E1CA 2H5JB 1C0UA 4ERDA 3CJ0A 1NJIT 5AE1A 5ETOA 3TUZC 2ZZMA 2NZCA 1EHWA 2DXDA 2R7XA 1ICEB 4TU8A 5I42A 1L3TA 3U7JA 1CJKA 1KONA 4F3OA 5HL7Q 4DSFA 1WJ9A 2GMLA 3SQGA 2LA4A 2ZC3A 3TX8A 1PBUA 3D2WA 4X4OA 3P3DA 5HLFA 2KZZA 1WHXA 1AFJA 2MZTA 1U48A 3R8YA 4B9NA 5F0WA 1S9EA 5L9NA 2BE9B 2B7CB 2NQPA 3HVTA 3OTOJ 5L1IA 2HWIA 1LWCB 1JNZB 1XMQJ 3P5BP 2ZNYA 4RW9A 2QFIA 1RTHB 4FYXB 3A8EA 3CD5A 4P9SA 1ZTWA 4I6YA 5HP1A 2VIHA 4RKUC 2ASLA 2BANB 3LAKA 2E29A 1NUEA 4ZKAA 2F4VF 5DM7Q 1M1GA 4E2FB 3ZZRA 2KU7A 2C1EB 1U0HB 1XEZA 2ATLA 2ZOGA 4OYMA 4EU0A 3KLGB 3NGUA 2HFNA 1TUGB 5D15A 5C42B 5M2PA 1SL2A 2EEYA 1FESA 1HA1A 1HNVA 3RAQA 3GYXB 2W4PA 1RHRB 3VAHA 2VFRA 4KGKA 2FJWA 3AB2B 4HI1A 3OQ2A 1ZS6A 4OZ1A 3MEGA 2XY5A 2UVUA 2DGWA 1Q86T 4K4UA 3KHHA 3AA8A 3RRKA 2J8SA 1RT4B 3MM7A 3U1NA 4KFBA 2M52A 1Y10A 3M2RB 1NK6A 5KTQA 1I94F 3PHEA 2IM0A 2V4JB 1KNZA 4A8XA 5KT2A 3C6UB 2J7UA 5HBMA 1ZAVA 5KFIA 4PWDB 4PPZA 2VDHA 5KT6A 1FE0A 5EWFA 4PABA 5IT4A 1SI9A 1NSAA 1BMQB 1RSCA 4BDPA 2J9CA 1BLUA 3BREA 4Y2AA 5AJ3F 4ETZA 4IUFA 2CJKA 5DM6Q 2E1AA 3ZXWA 4TYBA 1VIOA 2A10A 5DG7A 4F2RA 5DZ6A 2RRAA 2VONA 1F5AA 3R5JB 4IH6A 1HWKA 1S72S 1NKEA 3V6DB 3G4SS 3L7UA 1G6BA 1GMWA 2HMIA 4I4BA 2HHVA 1RT2A 2VA3A 3P5TL 1T03B 4F2SA 1KQSR 4YMEA 4OHYA 4OIXA 4P2XA 2RF2B 2J0WA 4EBDA 1K47A 2W9BB 4WIIA 1Q5VA 1YJTA 2QLWA 4JI8J 3W65A 2JSXA 1VQMS 2DNGA 1YVFA 3IBFB 4TVAB 1T9UA 2GW8A 4JYAF 4DR7J 4AL6A 5ETMA 4C97A 2HFSA 5D4NA 2N7YA 4CM2A 2XYGB 2UXBJ 4ELTA 1U6BA 2CPZA 4RUAA 1ZAWA 2HNDB 1VK8A 1DTTA 2UVVA 4IH5A 2CZ9A 2DNOA 1U2CA 1L3VA 2MY7A 1SC1B 4AUKA 3OHAA 1DQ8A 5B0DA 3ZZ0A 2JFKA 1S77D 3I0RA 2V4RA 1LFWA 3ISNC 5FDLA 1YBUA 1RBAA 2OD6A 4Q8FA 2DY9A 1S6PA 3IFEA 4FNIA 1RP5A 2VUGA 1FRLA 3A3NB 2VJVA 2YKAA 4FS2A 5CAAA 3C15A 2MLXA 2OPPB 3GFYA 2CPIA 4NLVA 3ITHA 2CQ3A 4CDIA 2CNNB 2L9DA 3M05A 2RHSB 2LQ8A 4EGLA 2CJBA 5J2MB 1S6UA 4C11A 2Q66A 3V4IA 3WC2A 4ZPCA 2JLEA 5ETQA 5F9NA 4DX6A 2P9EA 4B3MJ 3DOKB 1M0SA 1VCTA 4DOZA 1JJHA 2VPXB 1TKDA 1QD1A 1HYSA 4MIAA 1VHIA 2BDPA 2CG4A 1RAFB 3ULHA 4IFVB 2WVFA 3B82A 2ZH9A 1VBZA 4UT4A 1CULA 7FD1A 2GMJA 4QZVB 4HT5A 5IZHA 2JH3A 3E51A 1NEEA 1UP1A 4M95A 4HHUA 1GX6A 2Q43A 3OXFA 1AB8A 1WC1A 2H48B 4QWCA 4I2QB 2H54B 8RUCA 2BQRA 4N7TA 3EUNA 4FDFA 4WCEQ 4ZDNA 4DR5F 3POTA 2CPEA 2E5HA 4U7UK 5J2PB 2JNJA 4PQAA 1X4EA 1IKXB 2Z4PA 3G71S 1JLFB 4YHHF 4R25A 4JI3F 5KFRA 1AZSA 2HLTA 2QMXA 3VR1A 2KTQA 4U8VA 3AJ1A 1NLKL 3IR7B 1MU2B 1BQNB 1NSKL 2KFYA 1X5OA 4KGZB 4NEZA 4ES2A 5A2QU 2VBYA 5FLXU 2Z57B 4WFYA 3MM5A 2RQMA 2V2KA 3SXLA 4CYUB 2V8DA 3DI6A 3MCOA 1PAUB 3BDEA 5LMUJ 3HD2A 1I5OB 1HQUA 4AL7A 2DRBA 3GQCA 2IDLA 4RZRA 1MSWD 1UFKA 4UZCA 3NOCA 4EYHB 3E3XA 4IKAA 1V6HA 1T3NA 2XMJA 1RKIA 4QYZK 3K17A 1FFWB 2E1MC 2OTLS 4LRBA 4RBTA 2F8HA 5A0YB 2JLFA 3SV4A 4N77A 4B9MA 3T5HA 1FKPA 3RTVA 3CCQS 2UU9F 5MLCV 5JXSA 5AXLA 1RAEB 2RD5C 2AD9A 1T11A 2JDJA 1WEYA 1KLNA 1FTCA 3UD5A 1IR1A 2MLYA 3DLLQ 1SV5B 4DZDA 1X4FA 4KSEB 4CLSA 4N56A 3JTPA 2HBYB 4MMOA 1TL7A 4LF7F 1HBMA 2J6UA 2YNFA 4RPFA 2R3VA 4NZ7A 4QW9A 3HVWA 1UPMB 3A1YG 3OUYB 2ZD1B 4LBIA 3HM9A 1M1HA 1HMVA 2P2CB 1YSJA 3FFIA 1IKWB 1WUUA 5E7OB 3HJVA 1YJ7A 2OPRB 2GV1A 3OFHA 2N82B 2D9OA 3W66A 3SCKE 2MQMA 3OR1A 3A3OB 3EXCX 3PRVA 4DPUA 2IM2A 1FTRA 2FJBB 4QYZJ 5GAHI 3K57A 4AXJA 5DDRC 4F7VA 1DARA 4PG6A 4I7FB 4C4WA 2W2MP 4DL4A 5BJRA 4RJVA 2IM3A 1U1NA 1Y00A 2HVHA 4K7QA 2P9GA 3BO4A 1EKSA 2X3GA 3KLEA 4UOFA 3G82A 1LWCA 4DL7A 5KFFA 4WYLA 3AOAA 1SUQB 5DQGA 3CMES 1LV5A 1YBTA 1IKYA 4PCQA 1RCXB 2B8QA 3KUHA 1RXOB 3DMJB 4LFBF 5IV3A 1C0TA 3B4MA 2CQCA 3EVWA 1VQSA 2OO4A 3KLGA 1EP4B 2ZC4A 2NPIA 3T1HJ 2IJNA 5I3QA 4JV5J 1ZPVA 3PO5A 5KFBA 1TK5A 3H5UA 4DUYF 2KFZA 1M5PC 4K4VA 4PEOA 2IRXA 2P9CA 3N5FA 5IC6B 4NX9A 2LU1A 2DNMA 1U6FA 2VB6A 5AXKA 3QWUA 2CQHA 4DJBA 2L48A 4ECSA 2FJVA 1Q78A 2DNHA 1D3WA 3FNNA 4DBQA 3W2VB 3QLHB 3HX9A 3GFZA 2FJEB 2G1HA 4DV3F 2BMBA 4Y34A 4ZVUB 2AU0A 3TQEA 3PW0A 1AUDA 1Q1KA 1G2EA 3DLGA 1FERA 1I51B 1NZAA 2A3JA 1G7CB 2V4JA 1YJWS 3R3TA 5C25B 3W9IA 3C6UA 3DLEA 4I69A 4ICLB 1VOMA 3MUMP 1QDUB 1N48A 1WOOA 4U96A 5DO2A 2LEAA 4ES1A 1QAIA 2Y0SD 5CH7B 1N5TA 1PILA 2DT9A 2YNGB 3QT8A 3NGSA 5D0HA 4HHHA 4AL5A 1JQGA 7FDRA 4X65F 1QTNB 3QMQA 4LBPA 3UI3A 2Z56B 2ILZA 3M8QB 2ROGA 1R0CB 3MEEB 2VQEF 3V4MA 2CQ0A 3CEDA 4Y6IA 1X60A 1N5QA 2QGFB 4A8OA 2YWFA 5ETKA 1VQOS 3TYTA 2HEKA 1FNMA 1HW9A 2BYCA 3EICA 3R5DA 2QLJB 2HNYB 1M5VC 1ZTTA 1Y5LB 5D4LA 4B08A 4YDXA 3WX8A 4WFXA 3IO1A 3D6TB 1B7YB 3JSYA 1FRHA 1R43A 1R0BG 1RDRA 3KK3B 2GC8A 1RWXB 3HF5A 2Z8QA 2XS2A 1WOPA 1SJQA 3HHKA 5A8WB 1TELA 1HNWF 3GB0A 4NYOA 1HHSA 1B0TA 3NAHA 3M1VA 1QTMA 3BH6B 2AEMA 1PIEA 4DEZA 1AA1B 3T6JA 5IV4A 1RCOB 2B4UA 4YR2A 3NS5A 4F3QA 4NLDA 3TZYA 5EX0A 2B4VA 1KFDA 3A3PB 3WX4A 1HFEL 4B02A 1IBCB 1IQTA 1RGVA 4G6VB 3W1YC 2F4VJ 4Y28C 1S4EA 1E6VB 3JB9k 2F8EX 2MKHA 3KMSA 5CA5A 2X1BA 2DVIA 1P1LA 4B9LA 2MQQA 1FKAF 2IA6A 3Q8UA 2L9NA 1XTZA 2CPXA 1NK4A 3H2LA 3T41A 1RYRA 2FDNA 5K8MA 3MECB 2W24A 2B3TB 2VG5B 3VAGA 4YR0A 3CCMS 4TQRA 2HK3A 1U45A 4Z37A 2VOPA 5IFMA 5HMWA 2I5JA 1UFLA 3MM8B 3EPGA 3AA9A 4F4XA 1WC3A 1RT5A 3KLHA 2BRKA 1Q7YT 3KJFB 3BR8A 3CCSS 2UP1A 2HGNA 1S7HA 1JNRB 3FBFA 1GXUA 1QAYA 2F7VA 3IAM9 4CO1A 5GAEI 3SZ2A 3DXSX 4X4PA 2AZ3A 4IFYB 4B3SF 1VBYA 3CDUA 4U67Q 1HL6A 2C3UA 1WHYA 3PDNA 3TEGA 1HWLA 1TL3B 5A8RA 3AOCA 1ZM9A 2A18A 1WDDA 2YH0A 5AJ3J 4NYZA 3IWNC 3G6VA 1BY9A 2CJ9A 1WWHA 1NBEB 2AJ0A 3FEYB 4OI0A 2DBBA 2DEJA 1O5JA 1Z2LA 4C0BA 3SFGA 4ER8A 1H2VZ 3H98A 1JJ4A 1BQNA 4ED7A 3KJVB 4CLUA 2V50A 1S79A 2GVZA 2HHTA 1EZZB 2IFXA 2W2NP 1Y3JA 4CYUA 1NNDA 3D0GE 4GRSA 1D9FA 2ERRA 2GQCA 2J9DA 5L1KA 1XR7A 1RWPB 4CCHA 1JXLA 1NO8A 1LK7A 2C2EA 4DXLA 4JI2F 3H90A 4QYRA 2QT7A 3AT1B 4Y2MA 1VRUB 4JYAJ 2GHVC 2AGQA 4YB6A 1ZH5A 2FZGB 2HIYA 2YX4A 2JEIA 3WIUA 1GX5A 4RW4A 8AT1B 3DLJA 2GGPB 2HFUA 4TY8B 2BJ1A 3ZZTA 2PFDA 3WQPA 2IBKA 1TV6B 3EM1A 3QJJA 3N28A 2LVWA 2FLOA 2EPIA 3PXGa 4Q0BB 4IYQA 5CXTA 2HHUA 4R8UB 1KKHA 1NZ8A 3QGIA 1O6XA 2ACYA 2CQIA 2BKNA 5BYRA 4NRTA 3GIKA 4C48A 2Y3YA 4PWWA 1IJFB 2ZD1A 2RS2A 2F9DA 3FKBA 2Z2MA 3K8VA 2AJ1A 1X9MA 5ETLA 4OHWA 3PYEA 2FVPA 2WVBA 1NPRA 2JRSA 1NDCA 3KNGA 3MEDA 2V2VA 4L75A 2HQIA 2WSCC 3WZ0A 3BDPA 5ETVA 3DRSA 3A4TA 1Z4UA 2V67A 4WBFA 2N4CA 3CJTA 3HT0A 4DFMA 5KFTA 2FY8A 2V2QA 3M30B 4B3OB 4DPYA 3NP5A 4CLPA 3MXHP 3VZHA 3GYNA 4FXWA 2PI5A 1JK9B 4N8NA 2E7XA 2LLZA 2D3O1 1O51A 5AE2A 5I3UA 1U1LA 5E0OA 1NCLA 3M32B 1CJTA 1PC5A 3DOLA 3AHPA 1N6QB 1QUPA 4NI2B 2NXEA 4MAKA 5KT3A 1YJVA 5CCLA 3R5AA 1FXDA 4DR5J 1N54B 2ZZTA 2B7BB 1IKVB 3NCRA 3KFWX 1KQKA 4OX6A 4BS2A 4JI3J 3HFZB 2Y8WA 1EP4A 2ZVIA 2UUBF 2DR6A 1CSJA 1RADB 4BBYA 3WBZA 3KHGA 4RO0A 2M2BA 4K50A 4NRUA 1M90T 4BWJA 2HVIA 4MKBA 5IXUA 1S1UB 4OYBA 3K2YA 1F0XA 1RKJA 1ZA2B 2LEPA 2IC3A 3IA0A 1X5SA 2PO4A 1S48A 3CO0P 2PA3A 2UZAA 3AJDA 2CJXB 2ASDA 3AQPA 2MLZA 1ACMB 3KWMA 4USJC 1ZZFA 4ZIVA 1OYEA 5D0GA 4ICLA 1R8HA 4ZN1A 2AV5A 4ZS6A 4LF9F 5L38A 3O5TB 5K9FA 5HO4A 4O23A 2QSFA 4PG8A 1SJ1A 3A8IA 2YNGA 4FVCA 3OJUA 1FNOA 2EKNA 3CB4A 4F4ZA 2B56A 3G6XA 2AJ4A 3H2UB 3DDIA 3MEEA 1N8RT 1X5PA 2PIIA 1WOSA 2RQ4A 3D3BJ 4FYVB 1HW8A 4KV8B 2MGZB 3KG0A 2OJ3A 3TQ1A 4C9DA 4NXNF 2OPSB 4CTAA 1NH7A 3BKUA 1H2UX 5ADZA 2NUHA 5CABA 1R0AB 1RTZA 2I8EA 4MYUA 1CQMA 3TJ8A 3DYAA 2K8GA 2PSZA 3NBPB 4ZJQA 3W8GA 3KLFA 1LXNA 3GR0A 2B9EA 3Q24A 2IRYA 3W61A 4M1KA 2M8DB 3KK3A 4IOCQ 3K5LA 2C2KB 2ZH5A 3HSDA 4H4MA 2BKOA 5D6GA 2CJAA 1WG4A 1V9OA 4NLXA 3PFEA 2CQGA 1S97A 4A8YA 3KUEA 1X9WA 2HKEA 3RBEA 4ZLNA 3UD3P 5A2QY 5FLXY 2X1AA 2V6AA 3WIVA 2VFTA 4RW8B 5KFKA 2XMKA 2RDIA 3KXDA 2OELA 3CPWR 1RK8A 1H74A 3LQVA 2ADBA 4OHVA 2JOQA 1E6VA 3W5YA 1U8WA 5EUHA 4CO5A 3BKTA 1HBNA 2MPUA 2V0NA 1XERA 2YVSA 3MTJA 4ZVQB 4O4GB 3MECA 3UN2A 2OIHA 3C3LA 4DR2F 1YRTA 3BPDA 2KM8B 2VKZG 2VG5A 2FZKB 5J1PA 4ZVFA 1OMSA 4G1IA 2IDEA 2R7VA 2DHHA 2G4BA 2DO0A 4WKYA 3I56S 1TAUA 3DRPA 2KRRA 4BC7A 2GIRA 3GG0A 2V5HG 4B3TF 3MMCB 3CCJS 1QE1A 4HACA 2EW9A 3L9ZA 5K8NA 3QJLA 4DV3J 4QU7A 4PAAA 3Q22A 2FQQB 3AXKA 1CBKA 1RT3B 4FYDA 1EJ7L 3HZEA 2ZH3A 3GIRA 2DKOB 4ZP6A 1Q5YA 1QLNA 1TTHB 4GO7X 4BCAA 1S1WB 2N4DA 3LAMA 2YKMB 1HWJA 4B9TA 1YBAA 5DRKA 2FVCA 2GFFA 4WTOB 3MMBB 4P10A 4DV6J 2A6OA 2MB0B 2UUCJ 4X65J 1YHQS 3BSOA 4DF8A 1FFGB 4DUZF 3TRGA 5GAGU 2VQEJ 3THPA 2CJQA 2PEBA 3ILJA 1Z1ZA 2XY6A 4WXWA 3ZNJ1 2YWGA 4OZJA 1UVJA 1EB0A 1RT7A 4DV0F 2BQUA 2O1PA 4YN3B 4D3HA 3QWPA 2LXUA 4RBVA 2AT1B 3E01A 2DHGA 2XMMA 3I32A 3VWSA 5K14B 2QTWA 2LQ5A 2NSBA 2JWNA 5D4OA 2QFJA 4OZ5A 2ZBIA 4M5NA 2NR0A 2DGVA 1U24A 2XLJA 3PYFA 1HQEB 4LRAA 2CPJA 4X64F 4I1TA 4ATNA 2ABYA 2ZKTA 3NS6A 3V81A 4FPRA 2KT3A 3RB0A 4ZVEA 3MPVA 2GVDB 2BACA 2V34A 4MFBA 3JS9A 4QWBA 1HNWJ 2OPQB 2LEBA 3PTWA 1E6YB 3GCXP 4KBIA 2ZH7A 1WORA 3FC9A 1M5HA 3EYZA 4UOGA 3N4WA 2ALZA 1REGX 3DRXA 3HDSA 4RUHA 3TO8A 3PW5A 2DJWA 2XGPA 3I5BA 3MPUB 2J9EA 5F0UA 1IN0A 5IT9Y 3MFIA 4EFAC 2DHSA 3FMBA 4PUOB 3ILLA 3JXOA 1HARA 4DR6F 3M8PA 1CPZA 4NOHA 2IAJB 1S9FA 1C1CA 1LQ9A 3MGJA 4PXDA 1J2VA 4NLUA 4C8YA 4M63A 3IMQJ 3AY0A 3KOAA 2Q3PA 3BGFA 4OYPA 2MQNA 3HKZD 3OV7A 4KGXB 3M8ZA 4K4XA 4B3OA 2RAQA 2JEJA 2C22A 4Q45A 3KK2B 5THWA 4OZ0A 3VALA 3DLKA 3TUPA 2MZ1A 1GMVA 1HD1A 2ZITA 2E5LF 2XSFA 3THVA 4CH7A 2DNRA 4B3SJ 4YUDA 3M32A 5HATA 3G6ES 5KFGA 3W60A 1N6QA 2BR0A 4I56A 3D0HE 3M9NB 4NI2A 2WONB 2EXUA 2KH9A 1TL1B 3J7ZT 4OQJA 4E0DA 1KQGB 2ZM6F 4L72B 3GZ7A 4PXEA 1B70B 4DV1F 3M2UB 3CSKA 4KTQA 4DN0A 1YWXA 5A6WA 2QJ3A 4OYWA 4OFZA 5IOLA 2XC9A 3AB4B 3QIPA 3RU0A 2DIUA 1S0OA 2LMIA 4MIBA 4CLWA 3J80U 3SDEB 3VQTA 2BM1A 5D4PA 3U02A 1VQ4S 1Q81T 4ZVPB 3OT9A 2YKNA 1RHMB 1VK3A 2YKOA 3BJYA 4KHRA 2ZHOA 1NK9A 3CO9A 4NE9C 3JYTB 4XTTA 3RBXA 1RWUA 3J81U 2KXNB 5ETRA 1S1UA 4C2MA 1FVQA 5GVQA 2A2CA 4F0KA 2BV3A 1JLQB 2HYIB 4KHPF 3OW2R 3EVMA 2ILYA 2V8VA 2D3ZA 1DURA 4JI2J 1RLCL 3CCTA 4M5LA 5B0GA 5LMNF 5HK4A 1TK8A 1RT6B 4IR1A 4KGMA 3CIMA 4LFAF 4ED0A 4C8ZA 4F02A 3FCWA 1RAJA 1RAHB 3G6YA 1VGYA 1TUWA 1NK7A 1WF2A 2DGTA 3I0SB 1IVZA 1Q8LA 1T8EA 1REVB 2NYIA 3MUVP 2B51A 1OJ4A 4YFUA 3FGVA 3PRDA 4ZHRB 5GAHU 1T0TV 3W2WB 2HZCA 3I96A 4RW7A 4ZPDA 3PY8A 4MK9A 2J5AA 2MEWA 3UQSA 5KFXA 2CQ2A 2XI2A 5KG7A 4DLGA 4C8KA 1RT1B 2DXFA 1ITPA 4CLZA 3TP2A 2Q6BA 4ED8A 4Y65A 5DG9A 2MQPA 1DJ0A 1YRXA 2OI2A 3GE9A 3DOMB 1BQMB 2BBEA 4QWDA 2MQLA 2WB1D 1D1UA 4UY8T 4CH1A 5HQLA 5LL6d 5KFVA 1R0AA 3GV7B 5ETPA 2V4QA 4J37A 1JLEB 1FKOB 4OZLA 3NBPA 3MM9A 2RJZA 1KN6A 3BBFA 4LF6F 2IIHA 1WI6A 1QSYA 5KT4A 4YS2A 1JJCB 3C6TB 3SMZA 4OX7A 1CS4B 4TQSA 1UW4A 3CCVS 4Y0FA 1Q8BA 3R1LA 5SUHA 1VLYA 2H65B 1W2BR 2D1CA 3VV2B 4BHQA 2HLUA 4LIRA 4FS1A 2F3JA 3BO3A 1RAOA 3I31A 3TANA 4I2PA 4EZ6A 5KOWA 2F4FA 3LH2S 4IQMA 4ECXA 1UEUA 2NS1B 1UCNA 1Q8KA 1C0UB 2R2TA 2KG1A 3JQMA 3FBEA 4XDDA 3G87A 3UNYA 2ZH6A 1H7XA 3SYZA 5I42B 4RW8A 2I9SA 2FVQA 3CNQP 3CIZA 2OTJS 1P6TA 4NLWA 3D4JA 3JQJA 4NLTA 2F9JA 4MIWA 2DCUB 2YNHA 1JLGA 1B4SA 1RWMB 2UUBJ 5AT1B 4Q44A 4IRKA 2C3YA 3HVTB 3KLVA 4WJBA 2MSSA 4L73A 2MTLA 2BOAA 2DNZA 4NLPA 4RW9B 3ILIA 4YOEA 2HGMA 1HNIA 2IVYA 5HP1B 3HSJA 3MMCA 3QZ7A 2FHJD 3T3FA 4AQYF 2KHDA 2VH7A 2ZBRA 1TP7A 2XQCA 2HHHF 3WC0A 4EZ9A 3SSQA 3FRYA 4YR3A 4GKJJ 1RT3A 3LGHA 1VJWA 3TZZA 1OSCA 4Q7AA 1JKHB 1IXKA 3KHRA 3HXMA 3IGNA 2COLA 1QSSA 3PYDA 4FKXA 1HNVB 2E1RA 4M5IA 3H0PA 3DLHA 2FGOA 2O01C 2V68A 4S0MA 4LF9J 2YKMA 1SPBP 3CCES 5DLGA 1H0HB 2GAGC 3MMBA 1Y5IB 1KHWA 1NJZA 4ANDA 1U25A 4RLEA 2CKWA 1B3TA 4DR3F 3MEGB 2P6TA 1VQPS 1XIQA 4OJGA 1ZM2A 1XJWB 3PNIA 2K06A 2WW4A 3W64A 5KFDA 4KFBB 3MD1A 4NXNJ 4USWA 3FSXA 4ECYA 4CO2A 1LXJA 2AKWB 5K14A 4O3PA 4USVA 2DTJA 2YTCA 3ISND 5CYJA 3FUYA 2ZZNA 2DGOA 1F9EB 4O4RA 4BWMA 5SZTA 1FHTA 2CYYA 4FVMA 1FF2A 5ETTA 2WW8A 4F67A 1SH0A 3LP1A 4C98A 3NNCA 2GVDA 3GJSB 4JB8B 1UEVA 2HFVA 2BEFA 2VFVA 1N5YA 2YPYA 2HQ3A 2Y1JA 3QYYA 5KT7A 5B09A 1R3NA 4XDCA 3ZZUA 4EO8A 2DK2A 3ETOA 4JI5F 4OI2A 2HS4A 1M5SA 3NGKA 2W1BA 3P8BB 3VGSA 1P9YA 1KQFB 2E5IA 1SJFA 3LO3A 3QO9A 3HO1A 4RWXA 1KSPA 5E2QA 3HHLD 2AYBA 3I55S 3MR6A 1B0VA 2VBZA 4F4KA 3CWJA 3IXQA 2QLBB 4DQRA 2F63A 1FD8A 1VQ9S 4C0OC 1F60B 2HW3A 2XWXA 4V19X 4PG7A 4CT9A 2R8KA 4DR2J 3D28A 4KIAA 3CCWA 3IM8A 4J90A 4Z7CA 2B5JA 3MZIA 2GIQA 5FDLB 4OV6A 4I0WA 1PCAA 3EE3A 5F8NA 1S6PB 1RACB 4P2SA 1LFPA 1DY3A 2ZH4A 3I9V9 5KFCA 4B3TJ 2I6WA 5BR8F 1FDBA 5LXYA 4FKYA 3C15B 1UVMA 3ZTQA 2DNYA 3ITHB 3VAMA 2GS8A 3DKDA 4GO5X 4K4YA 1MMDA 5K8PA 2CFXA 2OSRA 3OFFA 1VC0A 4C11B 3R27A 3Q23A 3IBWA 1Q7LB 3QSIA 3C66A 4CWBA 1R7IA 1TKTA 3EZ5A 1XNQJ 4GC6A 1TL1A 2YBVA 4Q2LA 3OSPA 3UDVA 1PJ6A 1J5EF 3RB4A 1CC8A 1KOHA 3KJNB 4JV1A 1HYSB 3HFKA 4CLTA 2O3DA 4KE5A 5CYQB 3HMJG 4DUZJ 1R6VA 2ZBCA 4NMLA 1SQEA 2UXDJ 2AGPA 3JSMB 4ZVRB 1XNRJ 3F73A 2HQDA 2M8HA 5MAOA 3NGRA 4ECZA 3QFWA 3MOJB 3QGPA 3S01A 1VDHA 2GO8A 4K5SA 1IBKF 5F41A 3CJ4A 2J76E 5HJXA 5GADU 1X4HA 4DR1F 3M4XA 2HAIA 3QGGA 2RSQA 3QT6A 1DTQB 5E3PA 2YQ1A 3D1HA 4X64J 5DJBA 1AZSB 2EWHA 2FVRA 4K4TA 2R8JA 4DI6A 4DQSA 3I0SA 1REVA 3M6UA 1URNA 3PYGA 2J7KA 1S1TB 3MM5B 1TVRA 1D9DA 3DI6B 1RABB 4UUXA 3T9NA 1K0VA 3EGZA 1CJVA 1HQUB 3D68A 4AYBD 5T41A 3DFEA 4PXBA 1WKKA 4DG1A 1TL4A 5C2CA 4WZQA 2DGXA 2K1RA 5HROA 1U26A 2M88A 5FJ4A 1FO1A 1KVJA 3VAJA 5T7LA 1AUSL 1BXNA 2IMWP 1BWEA 2FC9A 3PO4A 3B6BA 4Q2MA 4F3MA 3HVRA 5I4MA 4K0KF 4C8OA 3CC4S 3LWLA 2OMLA 4JBCA 4X4UA 2HVEA 2GIFA 2F40A 2PD1A 1SC4B 2AQ4A 1JLAA 3LGMA 2KT5A 2M4MA 3QRPA 2ZKUA 1U4BA 3O44A 1VQ7S 5J2QA 2QA4G 1NSPA 3DRRB 3LW5C 1TL7B 2FB0A 4TLQA 1HBMB 4P2FA 1Y7PA 3HT3A 2F8MA 2ZE2B 1UA1A 3CCRS 1UL3A 2RKIB 4LF4F 4H4KA 3UDLA 3RJMB 2MXYA 4P71A 3MD3A 5CCMA 3A13A 2NXCA 4J9RA 2JVOA 3RUBL 3R6GB 2Y0BB 2XMVA 3HD1A 4FYYB 4OI1A 1Q16B 2KYXA 1YK9A 2RRNA 3TA1A 3OR1B 5KFNA 1KC8T 4NCGB 2ZM6J 5HQMA 4DV1J 3D3CJ 3N6LA 1GH8A 2KI2A 4PYDA 5J1EB 1HHQA 1Y5NB 3VGVA 4IRCA 4QIGA 5D8HB 3RG6A 3BF4A 2C2ZB 4LF8F 2YY3A 4FXVA 2XCPA 2FHMA 3KLEB 1H7WA 1HBUA 2J8AA 4X4SA 3G82B 4GKKJ 4WP3A 3HJFA 1WKLA 3IGVA 1KBRA 2CDQA 1LW2A 1KTQA 1TKZA 2XYHB 3RRGA 4YP3A 3W7BA 2XB2D 1NB2A 1T94A 1IKYB 4KHPJ 2ZH1A 4DU8A 2KN4A 4QPXA 5KFYA 5LMNJ 3TOQA 2R8GA 1C0TB 1S7IA 3PEJA 1M1KT 4LFAJ 4DPXA 2PDAA 2OUGA 1JKHA 1S9GB 4NWBA 1YI2S 1B0PA 1YJRA 2QX0A 2VL1A 1VISA 5C2GA 2ZWPA 2C2DA 4IG0A 2MY8A 2DH8A 1A9NB 2AEJA 2FJXA 2UXCF 3TVKA 2J0QD 4WYWA 2Y9HA 3TWZA 4M94A 1NJWA 1VRTA 2HGLA 5KFAA 2JL9A 2GHWA 3PEHA 4WK3A 1RAAB 4M5JA 3EPIA 3CDBA 3DLGB 2W01A 2JHEA 2QE5A 2FHKA 4LSNA 3R7NB 4N41A 4UQTA 2RE1A 4TU9A 3K59A 3ICLA 3G8QA 3Q8RB 3DLEB 4KAIA 2VV5A 4OLPA 3IS9A 3RR7A 3ETMA 4ZPWR 2DNQA 5HAOA 2BX6A 4LF6J 4HI2A 2EFGA 4WP9A 2XHWA 1DZ5A 4CO3A 3K8WA 3K89A 1JLBA 3O3LA 3TR5A 4F0MA 2XTJP 2DEIA 1S0MA 2QN6B 4WK1A 4CT8A 2XBPA 3J80Y 2YWHA 1IM6A 5H9FK 3GONA 3HPOA 3BQ1A 3MM6A 1VIXA 2DIVA 2HHXA 4QPTA 3PR4A 3W62A 3PW7A 3J81Y 4KH1B 4DSJA 1WI8A 2WK4A 3B54A 1X0FA 4YQWA 2ZDPA 3HLUA 3FBCA 4M5MA 1KR4A 2I38A 4UF4A 2KHCA 2FY1A 2KVIA 5IQQA 3H2VE 3QSYB 2CUYA 5E41A 4WFNQ 1RWOB 1X9SA 4DHVA 3EJMA 4ZPAA 2R2SA 3M1VB 4KGVB 3NEKA 1NM2A 1OPZA 2C42A 3VZIA 3FK4A 1FX4A 4H4OB 1D0EA 3VVTA 2RB7A 3J81j 2RDDA 3MF5A 1NK0A 3RBZA 3EVOA 4QIVA 1FEHA 3AODA 2GCFA 4AQYJ 1F2GA 1FK9A 1FRKA 1FNXH 3SV3A 2IM1A 4URGA 3IRXA 2HHHJ 2G2OA 3M6XA 2Z2LA 1HQ2A 2PEHA 2Y1IA 3N9UC 5KFHA 3D0IE 1UWBB 5CYMA 1EETA 1FX2A 2B9XA 2EC0A 5L8RC 1EQ0A 2R2UA 2LDIA 3ZTPA 1TMMA 4A4JA 4JI1F 3JTOA 2V63A 1RZMA 1XK8A 2VBWA 3K7RA 3TUJC 3DU6A 4JI7F 4EBCA 3PX6A 2I5JB 2ADCA 1SL1A 4NA1A 2C3OA 3CT9A 4ZPBA 4DR3J 3CDAA 3KLHB 1RT5B 5CYQA 3M6VA 2E5JA 3AAWB 3GCWP 1K73T 1PYTA 1V5VA 3JSMA 2O66A 1NXIA 2VU5A 4OYZA 2AF6A 2AHOB 4R0EA 2EFNA 3IM9A 3TUIC 2V94A 2RU9A 1WC0A 3VAKA 4X66F 1MWQA 1F6TA 1VQYA 3NS7B 1APSA 1V3ZA 3CF5Q 1T05A 3KLIA 5A8RB 3AOBA 4OJ3A 1DTQA 2CXEA 2A0FB 5DDQC 2HHQA 3E8OA 1A6LA 4FPIA 3QPIA 1XC9A 3PM9A 1B99A 2GVZB 1S1TA 2NZ4A 4QU6A 2LXFA 4JI5J 1IJEB 3FVYA 2W25A 3H5SA 4YB7A 1QVFR 3J7AN 2DH7A 3PV8A 1XMBA 4LR9A 4V1Ak 4KPYA 2B4PA 5C5JA 1KDNA 1VS3A 4LSZB 3Q8QB 4A46A 1FJ7A 3B4DA 1Q0NA 3GV8B 1RHKB 4HKQA 1CEZA 4I68A 1WTBA 4RW4B 2QL5B 2IVFB 2DB1A 3HHNB 4DFJA 1SCJB 4KHMA 4RX6A 4HL9A 4Y2IA 4NCAA 3DDNA 3UDCA 2NUUG 3JAMY 4N5SA 2WSFC 3RRHA 3GJRB 2FTRA 4WF9Q 2Q6CA 2E9RX 3QQCD 3DRRA 4LFCF 2AWZA 3CW2C 2RDJA 1PKUA 4ECQA 2ZE2A 4USUA 4JI0J 5F9LA 1F9FA 3R2DJ 4A8QA 2PC6A 2RKIA 5BR8J 4KC5A 1R8PA 3MPDA 2RIJA 5D0RA 4DFPA 3GJTB 2C2RA 4NXMF 2IJFA 2XO6A 2AX1A 1MWYA 5IWAJ 3QAUA 1DQ9A 1WG1A 3H59A 4OV1A 4B3MF 4PG4A 4IH7A 1OY6A 5L46A 3MEDB 3MR5A 2OHDA 3RAXA 1GTEA 3L3CA 1MLAA 3CDEA 4NCGA 3DRSB 1BHNA 5K5MA 4NLGA 4DU7A 2R7SA 1HPZA 1KVIA 5J1EA 4P7VA 1FA0A 2CJYB 3EXYA 3TNVA 3OTCA 4P52A 2V2ZA 2SXLA 4DL6A 2B6AA 3M9MB 1WSVA 5I3UB 1N32F 3ENWA 3MURP 1CJTB 1H73A 4CLLA 3DOLB 3OL9A 1IBKJ 2EG2A 4X62J 2R7UA 3LA0A 2H51B 5L39A 4OI6A 2MJUA 4DR1J 1T02A 2CAJA 2J7WA 2HQFA 2JVRA 1YQHA 4IG3A 4OYIA 5E33A 1O8BA 3LF0A 4EYIB 1UETA 5ETSA 5AXNA 4NCBA 3LPYA 7AT1B 1S9GA 5LMUF 1N33J 1SC3B 3D66A 4DV2F 2DRDA 2QYGA 4PR6A 1SIZA 1NU4A 3IG1B 1SC6A 2AJQA 1WD6A 2B9YA 3BV8A 1N36F 4RL1A 3CCLS 1IM4A 4Q43A 4ILRA 1GTHA 2MSTA 2V9WA 2MKIA 4JV2A 2GQ2A 1VBKA 2LCWA 2MKCA 3NG8A 2YWKA 1NSQA 2VASA 4ZLJA 3NMRA 1BE4A 2IC3B 2QZ8A 4DL0C 4XAKA 3A8JA 1Q79A 5KFPA 3DRYA 1CJUB 4RR5A 4C6AA 2X7IA 2XNQA 3HHLB 3TA0A 2V8HA 4USMA 3OVBA 4CH0S 2HQGA 2WZ1A 3QAEA 4K0KJ 4DDFA 5E3QA 3ZZOA 3T5JA 1CC7A 1FDNA 1Y9OA 2XG8A 4DPTA 5BXIA 2L41A 3PFOA 3CD7A 2FLNA 4CNYA 1HHTP 3GIJA 2R8IA 2DISA 4J9OA 1Q82T 4WTYA 2AP6A 3UFCX 2PE8A 3CULA 1ELOA 4OZ3A 4G65A 5L1JA 2X3DA 3IR6B 3MR2A 3EMTA 3CTRA 2HS0A 4LF4J 3EX7B 4FN5A 2BE2A 2MDAA 2AJ2A 3UR0A 1K0TA 4HVZA 4PXCA 3B8HA 4CTAB 2LQBA 2VQFF 2CVIA 4CLYA 5KFMA 3R5BA 3NGTA 1NAQA 3H5XA 3K58A 4EK2A 1KFSA 3SEOA 2CA9A 2ALYB 1FJCA 4RU9A 3DYAB 4O44A 2GJFA 1UTAA 4USHA 1TL5A 1YGYA 1NDPA 5EDWA 3HK2A 2XMWA 4OJ1A 1ZOTA 3KLFB 3BN7A 4J9PA 1RTJA 3E2EA 2VPWB 4QWEA 2NCKL 2KG0A 2NSCA 3DXBA 1H38A 2IJRA 3VGTA 3NLCA 2G0JA 2L9WA 1AW0A 3M8WA 4H4MB 1C4CA 2CPDA 2XZTB 3IWLA 3LWMA 4A8SA 4MT1A 2KO1A 4DSLA 3W5XA 4ZCKA 4FNHA 3J7YU 4ZOSA 4Y3CA 2CADA 2YXLA 1MROA 1U1RA 2HNZB 4KKOA 2ZH8A 3THTA 4H4OA 4DL3A 1NPKA 2BABA 4ILMA 1R8BA 2XSJA 4TKTA 1N0UA 2CZ4A 3T1HF 2FD2A 4GVBA 3U1LA 6FDRA 4DF4A 4HTJA 4U95A 2JC1A 2C2NA 2FGCA 2C28A 3Q8SB 1RBOB 2KFNA 1YG0A 1HBNB 1VQ8S 3QT7A 4F4WA 1UWBA 2OFHX 1SH3A 2VF3A 3NAIA 1S57A 4Y2KA 3FBBA 3KKFA 1CLFA 4YEAA 4OZ2A 2ATCB 4V19J 4WFZA 4DFKA 5A76A 2OSQA 4ZCLA 1LWXA 2K3KA 1VC6A 2KDOA 3DRPB 1RTDB 2UXCJ 4OYAA 1ULRA 5CQGA 5F8MA 1G3OA 3D7SB 1N52B 4Y2CA 4U9RA 1QE1B 4HACB 2WOMA 4MJKA 2E44A 3S1TA 1N34F 3M8SA 3Q8VA 4QCLA 3AQOA 4P75A 4USKA 1OIAA 1YKWA 4NLQA 1UJ4A 3Q2TC 1N0VC 2XNRA 1H3DA 1I94J 3SCIE 3FRZA 2BXJA 1Y3KA 4DX8H 5KT5A 1SVDA 4JI4F 3MCMA 2UUTA 1VQNS 2KXHA 2CQDA 1RQ0A 2BJ7A 4EI2A 2HRTA 4LREA 4CLKA 2MKYA 4C7QA 3UCZP 1WG5A 2DH9A 4ID8A 4C8NA 4ILLA 1FD2A 2PGCA 5F8JA 5HVHA 1NB7A 2NLWA 2H1YA 1QVGR 4P7TA 2NXNA 1S1XA 2N3LA 3BGUA 1RT7B 1SBRA 1UMJA 2APOA 3LTOA 5EWGA 5EN1A 2YX7A 1DHMA 3BH7B 2YH1A 3CJKA 3Q86A 4ZJOA 5DETA 1VC5A 3HI9A 3E01B 4WWSA 2PA8D 5M2UA 1KEKA 3GP9A 2HRUA 4QR2A 2B4OA 5KFSA 2AIRB 4DPWA 1MN9A 3AH6A 3UNGC 1A7GE 1C4AA 4DUTA 3F44A 3QBCA 4ZA1A 3I5CA 1FRMA 4H54A 4LJMA 3ET6A 3T5LA 1MW7A 1JLCA 2E7VA 4WIQA 3V81B 2YWWA 2WVDA 2RH3A 1LWFB 2WVEA 4MFBB 8ATCB 3D6MB 1U09A 5KFQA 1DLOB 2MZSA 2XZDB 4OHZA 3DC2A 4QW8A 4WZMA 2FVSA 3NRBA 3K5PA 3NNHA 2F5GA 4ZP8A 3IN5A 2GAHC 5A8KA 4A8MP 2XY7A 2FHJA 3W8PA 3BQ0A 2XYPB 4WFBQ 1FDDA 5FD1A 1UJ5A 2OD4A 4KH0B 4ZVTB 4NLOA 3CJQA 3M8PB 2N3OA 4UW2A 3PJWA 1LW0B 1T9WA 3TX0A 1C1CB 1FJEB 2CNKB 1NPPA 3OL6A 3D9BA 2V8PA 1L3SA 4QIFA 4JI1J 1J5OB 4FZVA 1HWIA 3MAAA 3H8YA 3PCOB 2BJ8A 4DV4F 2DR7A 2P5VA 2VJUA 3KNAA 2CG8A 4JI7J 2U2FA 3N01A 2VG7A 3TEHB 2L3MA 3SSSA 1T9XA 3MMAA 3C8YA 1EX8A 3CMAS 2C2MB 5KG0A 2O5DA 2UUAF 3CJRA 3DLBA 3UPFA 3DLKB 2ZBQA 2H4YB 4B9VA 4F4AA 2M7SA 4KO0A 2G1DA 3X1LB 3TAMA 3I9ZA 2HWTA 1I1GA 2PMWA 2RU3A 3UCUP 4X66J 4WE1B 1KLMB 5E3RA 2AJFE 1X31C 1JB0C 1QAXA 1F5CA 3QIPB 2LECA 1JX4A 4YHHJ 1RBLA 4B9SA 3TZXA 4EEYA 4AT1B 3OL8A 4L74A 2UV8G 4USTA 1DAXA 2VOOA 3CJ5A 3PW2A 1R27B 1C1BA 1NMEB 5CHCB 3OSNA 4FF2A 3IG1A 2YKNB 2FUG9 4BC9A 3KG4A 3PKYA 1PO6A 3ZTSA 1NDLA 4WFAQ 1ZBTA 4DQPA 5J2NA 4K5RA 4ED4A 4XPCA 1IUJA 5G0RA 1HD0A 2BUNA 1IWAA 3RBDA 3CJSA 1ROFA 4HDGA 5GAGI 5E5NA 4DQQA 2R2RA 2AYGA 1CJUA 2GA7A 5D3GB 3HHLA 4EBEA 1WC4A 1IR2A 1T9TA 2ZJRQ 1P27B 4QOTA 5B0EA 4DS4A 3OR2B 1ZPWX 2UU9J 1WTFA 2BVZA 3P45B 1X4AA 2YKQA 3MPWA 4MYTA 4A8FA 5DGAA 3QRQA 3G86A 4J5OA 3I6PA 2NREA 4RW7B 3L09A 4ETXA 2AMCB 1FT8A 4U7UD 4W4MA 1EKRA 2VC1A 4LFCJ 4LF7J 3LP2B 4J91A 5F3TA 1U02A 2HZVA 4CO4A 3UO0A 3LOUA 3J7Z5 4UTGA 2BE7D 4NXMJ 3CC2S 4J9MA 1X0PA 4PZVA 4ES3A 1S6OA 2ZUGA 3NKYA 3EGNA 1AXQA 1ZM4A 2MZQA 3BKFA 2LYVA 4DWIA 4OL8A 4A47A 4O3QA 3ZO7A 4DZ6A 2ZOFA 1FJGF 3R5CA 4LIWA 2VG6A 3MM9B 3DU5A 3T1YF 2CNOB 1OY8A 4DV7F 4EWTA 1WSRA 2EBEA 1M5KC 2W2OP 3MMJA 1R8CA 4TU7A 4LMZA 3HHLC 5F8IA 2KRBA 4RNMA 5HQ8A 3PIPQ 3NGDA 2FJDB 3VCDA 4LT6A 2H4WB 3R5GA 2UVRA 1U2FA 5H1SV 3VTIA 5IM0B 3QATA 4L76A 2W2PP 2D3OR 4I2PB 2HFZA 3DNCA 4QQBA 2X1GA 2XM3A 3OXGA 1OYDA 4FF4A 3ILOA 2DCLA 3GFHA 4GVLA 2HNZA 1N32J 5AXMA 4J9UE 2XMTA 2RMLA 2JZ5A 3J7A1 4DSKA 1S5ZA 3GLJA 3M7VA 2M70A 2AX0A 1OS5A 1RHQB 5IT0A 1N56A 1IWGA 1NH8A 2VA2A 2BM0A 4QIEA 3TVZA 3OVAA 3MAHA 3DGPA 3FDSA 1K1SA 2YNIB 4LFBJ 2CQPA 2WB4A 9RUBA 1S6QA 2YNHB 1JLGB 2IMOA 4M5HA 3HFVA 1XWLA 1JXVA 2VODA 3CD0A 3P4UB 1OSDA 1U2RA 2CPFA 4DV2J 4DS5A 4CLFA 2QL9B 2CDRB 4OX9F 2QC3A 4DUYJ 1ZYQA 2MQOA 3GU0A 1KWMA 1SL0A 1N36J 2FLPA
chains in the Genus database with same CATH topology
3EICA 1XIQA 4UOGA 3L7UA 2NCKL 3BBFA 4F36A 3ZTPA 3EM1A 3VGSA 5CAAA 3Q83A 3FBCA 1PKUA 1LWXA 3VGTA 3BH7B 1NDKA 1NSPA 1WKLA 1ZS6A 2HURA 3Q8UA 3ENAA 1LEOA 3Q86A 4KPCA 3WX8A 3FCWA 3MPDA 1S59A 1B99A 4DI6A 3PJ9A 1NB2A 4UOFA 1NCLA 3GP9A 2AZ1A 1BUXA 5BXIA 3ZTRA 1MN9A 1HIYA 1NHKL 3ETMA 3Q8VA 3EJMA 3BBCA 3BBBA 1NLKL 4DUTA 1NSKL 2BX6A 2CWKA 1S5ZA 1WKKA 5IOLA 3FKBA 3Q89A 1F3FA 1KDNA 1NPKA 2HVDA 2ZUAA 5C7PA 3VVUA 2B8QA 1UCNA 2VU5A 1HLWA 3VVTA 1K44A 1XQIA 3EMTA 3FBEA 1BHNA 1NUEA 2DYAA 3ZTSA 2DXFA 3NGSA 1WKJA 1NDLA 4HR2A 1NDCA 3ZTOA 3NGRA 3BH6B 3DDIA 3EVWA 3EVOA 1PAEX 3FBFA 4ANCA 3EE3A 4ENOA 4FKXA 3B6BA 2DXEA 1F6TA 4DZ6A 3NGTA 4O0NA 4CP5A 1EHWA 2AZ3A 4S0MA 3R9LA 1HHQA 2DXDA 3ELHA 1NSQA 4EK2A 1JXVA 3VGVA 3NGUA 4WBFA 3G2XA 1VYAA 2B8PA 3GPAA 1W7WA 2BEFA 1BE4A 3JS9A 1MN7A 4FKYA 3PRVA 1S57A 2HVEA 4F4AA 4ANEA 2DY9A 3ZTQA 3FBBA 4W98A 3FCVA 1NDPA 5CABA 4ANDA 3Q8YA 4C6AA 3EVMA 1B4SA 3FC9A 1U8WA 3DKDA 3B54A 4UOHA 3VGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIC A;  1XIQ A;  4UOG A;  3L7U A;  2NCK L;  3BBF A;  4F36 A;  3ZTP A;  3EM1 A;  3VGS A;  5CAA A;  3Q83 A;  3FBC A;  1PKU A;  1LWX A;  3VGT A;  3BH7 B;  1NDK A;  1NSP A;  1WKL A;  1ZS6 A;  2HUR A;  3Q8U A;  3ENA A;  1LEO A;  3Q86 A;  4KPC A;  3WX8 A;  3FCW A;  3MPD A;  1S59 A;  1B99 A;  4DI6 A;  3PJ9 A;  1NB2 A;  4UOF A;  1NCL A;  3GP9 A;  2AZ1 A;  1BUX A;  5BXI A;  3ZTR A;  1MN9 A;  1HIY A;  1NHK L;  3ETM A;  3Q8V A;  3EJM A;  3BBC A;  3BBB A;  1NLK L;  4DUT A;  1NSK L;  2BX6 A;  2CWK A;  1S5Z A;  1WKK A;  5IOL A;  3FKB A;  3Q89 A;  1F3F A;  1KDN A;  1NPK A;  2HVD A;  2ZUA A;  5C7P A;  3VVU A;  2B8Q A;  1UCN A;  2VU5 A;  1HLW A;  3VVT A;  1K44 A;  1XQI A;  3EMT A;  3FBE A;  1BHN A;  1NUE A;  2DYA A;  3ZTS A;  2DXF A;  3NGS A;  1WKJ A;  1NDL A;  4HR2 A;  1NDC A;  3ZTO A;  3NGR A;  3BH6 B;  3DDI A;  3EVW A;  3EVO A;  1PAE X;  3FBF A;  4ANC A;  3EE3 A;  4ENO A;  4FKX A;  3B6B A;  2DXE A;  1F6T A;  4DZ6 A;  3NGT A;  4O0N A;  4CP5 A;  1EHW A;  2AZ3 A;  4S0M A;  3R9L A;  1HHQ A;  2DXD A;  3ELH A;  1NSQ A;  4EK2 A;  1JXV A;  3VGV A;  3NGU A;  4WBF A;  3G2X A;  1VYA A;  2B8P A;  3GPA A;  1W7W A;  2BEF A;  1BE4 A;  3JS9 A;  1MN7 A;  4FKY A;  3PRV A;  1S57 A;  2HVE A;  4F4A A;  4ANE A;  2DY9 A;  3ZTQ A;  3FBB A;  4W98 A;  3FCV A;  1NDP A;  5CAB A;  4AND A;  3Q8Y A;  4C6A A;  3EVM A;  1B4S A;  3FC9 A;  1U8W A;  3DKD A;  3B54 A;  4UOH A;  3VGU A; 
#chains in the Genus database with same CATH topology
 2EKY A;  3OTE A;  4I64 A;  2W9C A;  3D6H B;  1FDA A;  1RTD A;  1RWK B;  1X4G A;  1HNI B;  4UY8 5;  3VF0 B;  4F04 B;  4NA3 A;  2M3D A;  1VI7 A;  2EC2 A;  2J6T A;  4JI6 F;  3EZO A;  1RWV B;  2HBZ B;  4WP8 A;  2BW2 A;  3Q2S C;  3C14 B;  5HJY A;  2XI3 A;  3T5K A;  2CPH A;  1U1M A;  5FII A;  3KK1 A;  1WKJ A;  2QL7 B;  4C3L A;  2GX8 A;  5B0A A;  2OP5 A;  4G1Q A;  3SBM A;  3TAR A;  2DPJ A;  3P49 B;  2M5Y A;  2R4F A;  4DN9 A;  5CD4 H;  3UN5 A;  1WC6 A;  1KVK A;  3MCN A;  1SB6 A;  2QLF B;  2QRR A;  4J9S A;  3SIP B;  4J7C A;  4B3R F;  2IHR 1;  5HI7 A;  4YB5 A;  2VQF J;  2B9W A;  3UCG A;  4NLS A;  3R6L B;  3L7P A;  2DRA A;  1F1B B;  3K5N A;  2LQ9 A;  1SKU B;  1QJH A;  4DQI A;  2LDY A;  2OEK A;  2AZ1 A;  1Y0H A;  2KKH A;  2WHO A;  4ZP9 A;  1H6K X;  2FJA B;  1UVK A;  3LP1 B;  1FXR A;  1HBO B;  1LWF A;  4MH8 A;  3TZW A;  3A12 A;  2MHE A;  1RTH A;  1YZ6 A;  5JVG Q;  2GO9 A;  3KYL A;  1N5Y B;  1DLO A;  4ED2 A;  5HVF A;  5JUM A;  1U0S A;  3EZU A;  1TAQ A;  2BAN A;  3UN3 A;  3OTD A;  4RNO A;  3FQK A;  2XWY A;  1K9M T;  2ZFH A;  4NZ6 A;  2GQQ A;  1JXE A;  2DIT A;  2DR8 A;  2G2Z A;  3ZFV A;  3TVY A;  1U0H A;  3QO9 B;  4L3K A;  5KFU A;  5C42 A;  5D78 A;  5HVG A;  3QID A;  3CJ3 A;  5K8O A;  4QR1 A;  3UW1 A;  4ZP7 A;  1X4D A;  5LT5 A;  1LW0 A;  4KT0 C;  1SIW B;  3S7R A;  2YPZ A;  4F50 A;  2C3M A;  2MZR A;  1W25 A;  2POK A;  1NKC A;  3GMG A;  3NCQ A;  3A8K A;  2KB2 A;  3H25 A;  1J5O A;  5IT9 U;  4PYA A;  1SJR A;  2B5J B;  2DGU A;  4K4W A;  4D3G A;  2R42 A;  4Z2X A;  1FEE A;  1RT4 A;  1SXL A;  3M2R A;  1W26 A;  1OO0 B;  2OH2 A;  3JSR A;  1W2I A;  4LRD A;  4CM0 A;  2WTF A;  5D77 A;  1DRZ A;  3OFG A;  4DSE A;  4A48 A;  4ANC A;  1SJ4 P;  1N34 J;  1D8Z A;  1OY9 A;  1TFW A;  1S0N A;  4PWD A;  3K0J A;  2F65 A;  4O3N A;  2AGO A;  2BJ9 A;  2JJ4 D;  1L3K A;  2YQ0 A;  2AYE A;  3H4D A;  4DV6 F;  1XN9 A;  3H40 A;  1S49 A;  2OEM A;  2UUC F;  2E66 A;  4WE1 A;  1H2T Z;  1TZ0 A;  1KLM A;  1TKT B;  4QWA A;  4C8L A;  4JI4 J;  1EAY C;  1KS2 A;  5JVH Q;  3US5 A;  3NL0 A;  1RU1 A;  4NLR A;  2NYH A;  3D1Q A;  4URQ U;  3S6E A;  4ZVH A;  4DX7 A;  2Z30 B;  2MKJ A;  2WBM A;  1RHJ B;  1QSL A;  2KJW A;  3G9C A;  3V6D A;  2W2Q P;  2GMH A;  2RIL A;  4LQ3 A;  1T03 A;  4ZPV R;  2BQ3 A;  2MJN A;  4OLO A;  1UZH A;  4ZCI A;  1AFI A;  2KXF A;  5KAK A;  4FXD A;  4TLR A;  1H98 A;  2FHO B;  2RF2 A;  2A6M A;  2ZNZ A;  5F8L A;  1NJX A;  4FF3 A;  2W9B A;  5H9E K;  2KVQ E;  3V6J A;  3UVJ B;  2IA0 A;  2NXU A;  5LXR A;  1UPP A;  4URS A;  3AD7 C;  5AE3 A;  5T14 A;  4F25 A;  5LJ5 Y;  3I5A A;  2PN6 A;  3LP0 B;  4O0I A;  3GG1 A;  2P8I A;  2HND A;  2JFD A;  5D3G A;  4F8R A;  3U27 A;  3OBI A;  3OXL A;  4J9V A;  2R7Q A;  2Y1R I;  1UVI A;  1IR0 A;  1TFY A;  3TW0 A;  2UVW A;  2LFV A;  3OR2 A;  1G1X A;  3OLB A;  1NHV A;  1YJN S;  2XHC A;  1B64 A;  4J9Q A;  3PX0 A;  2G9O A;  3ENA A;  2F1F A;  1TVR B;  2ACM A;  3O8W A;  4JP8 A;  1CJV B;  2P6S A;  2QG9 B;  4DG1 B;  2OPP A;  4JV0 A;  2CQ4 A;  3W9J A;  3CCZ A;  1HIY A;  4ZVO B;  2K1R B;  5HRO B;  3LP2 A;  2EG1 A;  5J2M A;  5T7L B;  2GJ2 A;  4UQG A;  1HR0 F;  2IVM A;  1FRI A;  4NPO A;  2H9Z A;  2K3I A;  1VJQ A;  3DGV A;  4PKD B;  5H9E J;  1QM9 A;  1WEZ A;  4KR0 B;  3DOK A;  3CMQ A;  2DD8 S;  4LQ9 A;  2X1F A;  1TKX B;  3AJ2 A;  1PC4 A;  1JLA B;  1PJ5 A;  4IFV A;  3HP6 A;  1VBX A;  2D74 B;  2HZA A;  2HHP A;  3IWX A;  2QV6 A;  2ZJQ Q;  4DV4 J;  1KHV A;  5J2Q B;  2I1R A;  5DZ7 A;  2XO7 A;  4WU3 A;  3VAI A;  1BQX A;  1TU0 B;  2UUW A;  4HTI A;  2BA9 A;  1Q53 A;  3SCL E;  5IM0 A;  3M6W A;  2UUA J;  3BGR B;  3BZQ A;  1HWU A;  1IBL F;  4IOA Q;  1YIT S;  4I2Q A;  3L4B C;  4IR9 A;  1R89 A;  3M8R A;  4Y00 A;  5J2P A;  4B17 A;  1IKX A;  4HHJ A;  5KG3 A;  1C2P A;  2Y8Y A;  3CE8 A;  5B0B A;  1JLF A;  1BGX T;  2A2D A;  1GAO A;  3RB3 A;  3ZZZ A;  3BSN A;  1FWK A;  4N8O A;  1FI4 A;  1K44 A;  1VQ5 S;  1MU2 A;  2YNI A;  1M5O C;  5HN0 A;  2QMU B;  3P6Y C;  3V6H A;  1G4C A;  4K8R A;  3ENQ A;  5I3P A;  3N79 A;  2OEJ A;  1NKB A;  1FRX A;  1AYE A;  4HEA 9;  2PMZ D;  3GPA A;  1HBU B;  1WEX A;  2VIC A;  3VAF A;  4DCJ B;  3G8S A;  4TYA A;  1RI7 A;  2YWE A;  3I4H X;  1T95 A;  1LW2 B;  3Q8Y A;  1HI1 A;  4UOH A;  1TKZ B;  2GZO A;  2E1P A;  3GSI A;  5DDP C;  3HZG A;  2RQC A;  4ECT A;  2G2Y A;  1NDK A;  5A0Y A;  2HUR A;  2AYM A;  1LEO A;  5EX3 A;  3UE2 A;  2ROP A;  3R7S B;  1RA6 A;  3TAP A;  4U7C A;  2ZHA A;  2RUS A;  3C14 A;  2KYZ A;  2C2O B;  2CNL B;  3NY0 A;  1SV5 A;  1VFJ A;  4IG0 B;  4X4T A;  1PJ7 A;  4PWU A;  4HT7 A;  3PG9 A;  3QNW B;  5GAD I;  2DYA A;  1S1V B;  4HLB A;  5GMK a;  3R7B B;  3OUY A;  3OTB A;  4ZPT R;  5KFW A;  4DR4 F;  1GQE A;  1HNZ F;  1A0O B;  1VRT B;  4O0N A;  3ZNU A;  5D0E A;  4ECR A;  2DGS A;  5E3A A;  1IKW A;  1VR6 A;  1VYA A;  4DCO B;  2WBR A;  1W7W A;  2KM8 C;  4DCP B;  1PYS B;  1PYO B;  2OPR A;  1Y4Z B;  2HRY A;  1GXL A;  4O3S A;  4LSN B;  2EI5 A;  1F5B A;  2G0C A;  3MEK A;  3IAS 9;  4E98 A;  5HMZ A;  1F2H A;  2FPH X;  1YJ9 S;  3IS9 B;  2DGQ A;  1FJG J;  4ZLL A;  4LF5 F;  2DHX A;  3T1Y J;  1U1P A;  4DV7 J;  2EK6 A;  3PAC A;  1YDL A;  2R7T A;  3FMW A;  1WNE A;  2CVE A;  4I7F A;  2OFG X;  2QYC A;  2HFO A;  5DDO C;  3T9Z A;  3V2U C;  3ZTR A;  3H42 A;  1GMW D;  4NL5 A;  1JLB B;  2EK1 A;  2ASJ A;  2ZEJ A;  4KQZ A;  2XLK A;  2QA1 A;  2K2P A;  3TI0 A;  1HBO A;  4WXO A;  2VD3 A;  1SUQ A;  5L9X A;  5EHH A;  2DNP A;  5IC4 B;  3V5R A;  3ENV A;  3MM6 B;  3AFG A;  1FFS B;  3RB6 A;  1R6Y A;  2DNK A;  3DMJ A;  2D7S A;  3GJQ B;  4ZMM A;  3HHD A;  1VHF A;  3K5M A;  2OLW A;  4QJV A;  5BYS A;  1T7P A;  5GAE U;  2B0G A;  1VMB A;  2MQ8 A;  2DO4 A;  1DBD A;  4OYX A;  3D5M A;  3Q0A A;  1F9H A;  3BYR A;  5LM7 E;  1N88 A;  4R0J A;  1U1O A;  3RGI A;  2RS8 A;  5CD4 A;  5IS2 A;  1WAC A;  3ISZ A;  4CNZ A;  4OX9 J;  4CRJ A;  3W2V A;  1I3O B;  3QLH A;  4IO9 Q;  2G13 A;  2HPU A;  1UWA A;  4ZN3 A;  5GMD A;  4GKJ F;  4IRD A;  1ZA1 B;  2K7J A;  3QGH A;  2WAQ D;  4GMK A;  2MHN A;  3MI7 X;  1AT1 B;  2J0S D;  3CVK A;  5L1L A;  3H5Y A;  2YKP A;  1VQK S;  3I87 A;  1XQI A;  1FK9 B;  5C25 A;  3IRX B;  4JUZ A;  2ZWO A;  2VKR A;  3D1O A;  4JI6 J;  4K4S A;  4UOC A;  5CYM B;  1EET B;  4KY3 A;  5KG5 A;  2IBO A;  4UUW A;  4F4Y A;  2VPY B;  2ZJP Q;  1OQ3 A;  1ARO P;  2EFO A;  3M8Q A;  4ZLP A;  2MKS A;  3FCV A;  4MKA A;  3QT5 A;  2QA2 A;  4M8L A;  5KFO A;  1IQZ A;  3GFX A;  4DMZ A;  3P96 A;  4ZJL A;  2KZM A;  2XUL A;  4M5K A;  4J9L A;  4RW6 B;  1U49 A;  3KHL A;  2CQB A;  4ED3 A;  2DNN A;  4ZVS B;  3DHW C;  1RTI B;  2HNY A;  4RWW A;  4YY3 F;  1SKR A;  2HQC A;  3CJ2 A;  2K7K A;  4ZK7 M;  4L3N A;  4LSL B;  4DV0 J;  2NPF A;  4B3R J;  1MMN A;  1SQG A;  2BKP A;  3UVJ A;  4KRW A;  1ZAX A;  2BJD A;  2HVD A;  4QIW D;  3N0V A;  1HI8 A;  4EO6 A;  5LSO A;  2HBR B;  2YX1 A;  1RUS A;  1KRP A;  2XGQ A;  2KL8 A;  1T05 B;  3KLI B;  2EVZ A;  5A8W A;  5GME A;  3LP0 A;  2RRB A;  2DXE A;  2HK2 A;  4CO0 A;  3ELH A;  3F56 A;  5LSL A;  2B8P A;  2E5G A;  3OL7 A;  1EAR A;  3PRB A;  4G1P A;  2VHG A;  1T3O A;  3TJA A;  2MKK A;  2LQJ A;  3MAQ A;  4F26 A;  1LWE B;  3KUG A;  1D09 B;  2W7P A;  1YTY A;  1ZET A;  1GMU A;  4PQU B;  1KD1 T;  4W90 B;  3R1H A;  3TA2 A;  3MCS A;  3NXZ A;  1Z2Z A;  2XEX A;  4R5P B;  4P2M A;  4UZB A;  3CGI A;  1D8Y A;  4IDK B;  3FSI A;  1VRQ C;  4DR6 J;  4ZIW A;  3M9O B;  1UVL A;  3CD6 S;  1SKW A;  1GXT A;  1YZ7 A;  3AD9 C;  4C0H A;  2QA4 S;  1TKX A;  3MM8 A;  1FWL A;  4LRC A;  1XMO F;  1QY7 A;  1NHU A;  4AFF A;  1X7V A;  1PSD A;  2LA6 A;  3R2C J;  4QR0 A;  2VPZ B;  3SFU A;  5KG4 A;  1VLO A;  2V8G A;  2UV8 A;  3G96 A;  4G3I A;  4IFY A;  4OYO A;  3BGR A;  4NZ0 A;  1S10 A;  4NMX A;  2RNE A;  3IR5 B;  3M2V B;  4HH1 A;  3NMA A;  2W8L A;  1XNQ F;  3T1A A;  1BC6 A;  1PG5 B;  2E5L J;  3CUN A;  1OQ6 A;  1S0V A;  3DCA A;  1TL3 A;  4XPE A;  1X4B A;  3OLA A;  3KDO A;  4HYK A;  2VBX A;  1HNX F;  5DQH A;  3WHI A;  4P73 A;  2EFV A;  2I2Y A;  2UXD F;  2BJ3 A;  1HPZ B;  1NK5 A;  2FLL A;  1XNR F;  3IRW P;  3KJV A;  5KFL A;  4N47 A;  4I6W A;  2OMO A;  3PJX A;  3BSA A;  1EQM A;  4ZVG A;  1IBM F;  5B0F A;  5HMX A;  2GNK A;  1WHW A;  2B6A B;  2ZDO A;  2FYX A;  3JQK A;  3PX4 A;  1WF1 A;  2VDI A;  1VQ6 S;  4MKY A;  2LKZ A;  1VRU A;  4KB7 A;  1J27 A;  3BGL A;  1NK8 A;  4I67 A;  4AXI A;  4H4K C;  5KG6 A;  4DV5 F;  4FF1 A;  2V69 A;  3C19 A;  3EGW B;  4CQ1 A;  4F36 A;  4WPA A;  4Z7Y A;  4ED6 A;  4FBU A;  2GGP A;  4Q5V A;  3V6K A;  4TY8 A;  4IG3 B;  5DG8 A;  2EFP A;  3SQO P;  4USI A;  5KFJ A;  1TQL A;  3ZZP A;  1TV6 A;  3PZP A;  1SH2 A;  3HHE A;  3U1M A;  4TN2 A;  1N4L A;  1DFD A;  4Q0B A;  2FIU A;  5C24 B;  4R8U A;  2WCX A;  1UAW A;  1JMT A;  1RE1 B;  1L3U A;  2ZOM A;  4TXS A;  1FXL A;  1S1V A;  4CZC A;  3HKW A;  4OX8 A;  2OKQ A;  4WKR A;  1GK8 A;  2RVJ A;  1PBA A;  3MPY A;  3PVX A;  1P9Q C;  1R31 A;  2J9D E;  3GYG A;  3HVA A;  1HR0 J;  2MZJ A;  1TK0 A;  1R8A A;  2FZC B;  3PHT A;  1EIY B;  4EUV A;  4NLY A;  5K20 B;  3N6M A;  3O1L A;  3S8S A;  3TJ9 A;  3W63 A;  1Y11 A;  3CCU S;  5B7W A;  3M30 A;  1WC5 A;  4ID5 B;  1TUV A;  4RUB A;  2HVZ A;  1U8S A;  4NA2 A;  1L5U A;  2R9L A;  4DL5 A;  3FZ2 A;  2D3U A;  2H5E A;  4P74 A;  2IRU A;  2M9K A;  3CXC R;  2QIF A;  2DNL A;  2W7A A;  3BBC A;  1MG7 A;  3FSY A;  1KTV A;  1WF0 A;  4LF1 A;  5BYQ A;  2CWK A;  2BE2 B;  4MKV A;  3N5B A;  1F3F A;  1ZM3 A;  3N6N A;  2M0G B;  2H5I B;  3MDF A;  1IBL J;  4A8K A;  3NWG A;  2Z0G A;  1HLW A;  2WVC A;  2W7O A;  2Z58 B;  3NWR A;  4HR2 A;  2MMY A;  5EGY A;  4RU2 A;  2QLX A;  2WRM A;  1IKV A;  4O44 B;  3IBC B;  1KOO A;  4K2J A;  2R7W A;  4QBU A;  4I6A A;  2LP4 A;  1GFW B;  4AD6 A;  3LUY A;  1RTJ B;  3SCJ E;  2D9P A;  1MWZ A;  2XS7 A;  4RNH A;  5HSP A;  4M5D B;  5B08 A;  3OTO F;  2PI4 A;  2W8K A;  2JX2 A;  4K4Z A;  4GKK F;  3OFE A;  3D54 A;  3RYL A;  1XMQ F;  2HG4 A;  5B0C A;  1LOU A;  2DPI A;  2V9K A;  4ED1 A;  1UEK A;  4OZN A;  2VFU A;  2RQK A;  3BM7 A;  1MNE A;  3G8T A;  3LAN A;  3KMQ A;  2W4C A;  2XCA A;  4ECW A;  3O2I A;  3PJ9 A;  1MRO B;  1S76 D;  4B9U A;  4KKO B;  2U1A A;  5LSR A;  4DSI A;  1X5T A;  1JJ2 R;  2XSJ B;  2Y1L B;  3GR1 A;  3PR5 B;  3BS9 A;  3EWG A;  1UKU A;  3Q89 A;  3GIL A;  5C7P A;  4GVB B;  1RA7 A;  3UDE A;  2CRL A;  5E3C A;  2EFQ A;  3NCP A;  4P72 A;  3C46 A;  4HDH A;  1GT8 A;  3MUT P;  3UR3 C;  5H9F J;  1JWW A;  1T9V A;  1Q95 G;  2FC8 A;  3OJS A;  1U6Z A;  2ZH2 A;  3ZZY A;  1OWX A;  1JIH A;  1LKZ A;  4WU2 A;  3RW7 A;  1SKS A;  4A8W A;  4LR8 A;  4ANE A;  4KV8 A;  2MGZ A;  3UWT A;  4X4N A;  2AEF A;  2YQ3 A;  3CDW A;  4DR4 J;  2H3E B;  2OPS A;  1HNZ J;  4RW6 A;  3H7H B;  3Q83 A;  4RNF A;  3PKM A;  9ATC B;  2HHW A;  2WOM B;  2W4D A;  1X4C A;  3MFH A;  1UZD A;  4PRF A;  1RTI A;  4ALZ A;  3GTY X;  5F8G A;  3IC1 A;  3C16 B;  2MYF A;  2R7R A;  3W5Z A;  4C3M A;  4LSL A;  3BB5 A;  3MR3 A;  3OHB A;  2GJI A;  1XR5 A;  4BLG A;  1T9Y A;  1UVN A;  2EBG A;  3KTQ A;  4LF5 J;  3JSB A;  3BN4 A;  1RAI B;  3BPS P;  2L08 A;  2X51 A;  3EDQ B;  3DM2 B;  4LVN P;  2J6S A;  3ZTO A;  1UA0 A;  2LXI A;  1PAE X;  4JOU A;  4ED5 A;  3FEZ A;  4LF2 A;  4CP5 A;  1OPI A;  1V5I B;  3RR8 A;  1S1X B;  2DR9 A;  1CG2 A;  5HMY A;  3MHY A;  2J0X A;  1LWE A;  4FBT A;  1CJK B;  3CJK B;  4JI8 F;  4EMD A;  1V3R A;  1TMJ A;  1U47 A;  3K5O A;  1TR0 A;  3O6Q A;  2ZVS A;  4DR7 F;  3AD8 C;  3F0N A;  1B7F A;  3BEG B;  3B78 A;  4PQU A;  3SQG B;  3HSZ A;  5HLF B;  5KG1 A;  1V3S A;  4OHX A;  4OI4 A;  4XO0 A;  2UXB F;  4R5P A;  4OMF G;  6FD1 A;  4X2B A;  1UW9 A;  1S9E B;  5F3Z A;  2G0I A;  3JTN A;  4ITS A;  4IDK A;  4O4G A;  3ET6 B;  3I82 A;  4CI0 B;  1NJY A;  3BBB A;  1JLC B;  1YJU A;  3M8Y A;  2JEG A;  2RHQ B;  2IPO B;  4YB1 P;  3RZA A;  4HH0 A;  1PGZ A;  1RIS A;  1YIJ S;  2NXJ A;  4DL2 A;  5DS7 A;  5EWE A;  3CJ8 A;  4LBH A;  4MK7 A;  2N7C A;  2JEF A;  1XR6 A;  3GV5 B;  4DLE A;  2XMU A;  4AE5 A;  2E9T A;  4ENO A;  1YX2 A;  2JLG A;  2W9A A;  1N5S A;  1S99 A;  4TNO A;  2DR5 A;  4X84 A;  5A8K B;  3G2X A;  4IOB A;  4MTP A;  1FE4 A;  2PMH A;  2Z2Y B;  1XBW A;  1P1T A;  3DDK A;  3RAM A;  1RU2 A;  4J9K A;  1URR A;  2I0X A;  4OI3 A;  3M2V A;  1RB0 A;  1S1W A;  1LNQ A;  5KOX A;  2CPY A;  5LJ3 Y;  3JAM U;  1RWN B;  3FQL A;  2E9Z A;  4IQX A;  3J7Y I;  3L95 X;  1SJ3 P;  1QAJ A;  3DN9 A;  1BWV A;  4XK8 C;  2Z2Z A;  5ETN A;  2Q79 A;  5HAN A;  1N5V A;  1BUX A;  3MAA B;  3SI8 A;  3BYP A;  1J5E J;  3T6B A;  2BW7 A;  2VG7 B;  3KG1 A;  3MM7 B;  3MMA B;  2JC0 A;  1FRJ A;  5CZX A;  3VVU A;  3PIO Q;  3OVS A;  3MWB A;  4XIU A;  5HBM B;  1Q8I A;  1RHU B;  4YY3 J;  4CIO A;  4ELV A;  2OGU A;  3T19 A;  3RW6 A;  4KO0 B;  3TAM B;  4J9N A;  3FJ2 A;  1FWP A;  4OJH A;  5ITH A;  2HSE B;  3FEX B;  5A6P A;  3LPE A;  1FCA A;  4KJI A;  1GNK A;  2RUG A;  6AT1 B;  1HQE A;  1HI0 P;  4U8Y A;  5F8H A;  4W98 A;  2WSE C;  3VHQ A;  3UD4 P;  2RT3 A;  2ASY A;  3SSR A;  4RBU A;  2OPQ A;  3HUL A;  4FP9 A;  1E6Y A;  3OPK A;  1YLX A;  3W9H A;  4LVO P;  1CQN A;  2HMI B;  1RT2 B;  2XZW A;  4P6Q A;  3NNA A;  1CVJ A;  4O3R A;  3WDO A;  1C1B B;  3NOG A;  2PT0 A;  5DLF A;  5C24 A;  4DX5 A;  3LAL A;  2PFF B;  3MR7 A;  3GSD A;  2CIM A;  4N76 A;  5KG2 A;  4LUB A;  2CQ1 A;  2LU2 A;  3I4P A;  4NYP A;  5J2N B;  4PUO A;  2HBQ B;  5G0R B;  3BQ2 A;  1VQL S;  2ZHB A;  3QJP A;  1U1Q A;  1KP6 A;  4ECV A;  2ROE A;  4GC7 A;  2IAJ A;  2BRL A;  1U7L A;  3D6F B;  1QUV A;  2E7W A;  3W3S A;  1DTT B;  3R9L A;  5JMN A;  3CC7 S;  2BZ2 A;  3FZB A;  3MOZ A;  4PG5 A;  3H20 A;  3D67 A;  3I0R B;  2IYG A;  3ADA C;  4F0H A;  4IO1 A;  3KDN A;  2D69 A;  1O0P A;  1LK5 A;  2C3P A;  1RWW B;  1NRK A;  3BGO P;  1XMO J;  4JI0 F;  2XS5 A;  4KYZ A;  3BR9 A;  4ID5 A;  4K2X A;  3KK2 A;  3H4B A;  3DHX A;  3AXM A;  4ELU A;  3X3U A;  2VFS A;  5IWA F;  3EDR B;  2HAF A;  2QO3 A;  4MK8 A;  2A1B A;  2DHA A;  4O3O A;  3GII A;  1RLD A;  1RAG B;  4C3K A;  1HKA A;  3LGN A;  4RUC A;  3VQS A;  2B43 A;  3V4I B;  1WEL A;  4C8M A;  3FCH A;  4L6V 3;  2VC0 A;  2WON A;  3IP0 A;  2KJV A;  4NAS A;  5G4D A;  3M2U A;  5DQI A;  1ZZN A;  2QSW A;  4FYW B;  2VG6 B;  1HNX J;  2AW0 A;  2D41 A;  3F41 A;  1CUL B;  2HS3 A;  1F3V A;  2QEX S;  4W92 B;  3SDE A;  4M5D A;  1S4F A;  4ZIT A;  1K1Q A;  5IQ6 A;  5DGB A;  3C2P A;  4YDD B;  2HIQ A;  4NEY A;  1K8A T;  3JYT A;  4LF8 J;  2HWH A;  4LR7 A;  5CZV A;  2GHP A;  3QZ8 A;  4X62 F;  1H72 C;  1IBM J;  1UFW A;  4TY9 A;  3Q8P B;  1JLQ A;  4X4V A;  4U6P A;  3POT B;  2DY1 A;  4X4Q A;  1MML A;  1S59 A;  2OAU A;  2IYI A;  1RT6 A;  3QRR A;  2R7O A;  1U1K A;  1GEH A;  1NHK L;  4M5G A;  4DV5 J;  1N33 F;  1RYS A;  4Q8E A;  4JV5 F;  3EGV A;  3DGP B;  2O67 A;  4ECU A;  3QFH A;  4LRF A;  1D9A A;  3HCX A;  1S6Q B;  1SQF A;  1X8D A;  3ZC4 A;  4ZCM A;  4ZHR A;  3W2W A;  2R8H A;  4E8U A;  3ONQ A;  3OD2 A;  4RNN A;  1S12 A;  5RUB A;  3R97 A;  4PPD A;  3GWC A;  2KT2 A;  1BD6 A;  1RT1 A;  2QMW A;  2CWX A;  1WHV A;  1Q4R A;  1MN7 A;  2W9C B;  5M2R A;  5LOQ A;  1UJ6 A;  3MTK A;  3HSG A;  1FVS A;  3DOM A;  3KJQ B;  3VGU A;  1BQM A;  2IY5 B;  1I6J A;  1FKP B;  5KFE A;  5U47 A;  1WDT A;  1JLE A;  3BO2 A;  2XLI A;  3C16 A;  1RJJ A;  1FKO A;  4KPC A;  5J1N A;  2HHS A;  3TAQ A;  2VZ9 A;  5JJB A;  2ZBP A;  5KFZ A;  1P8G A;  2Q1L A;  3C6T A;  1CS4 A;  2BJE A;  3KK1 B;  4X4R A;  2CZV C;  2YNF B;  3BSC A;  2ZUA A;  4G1Q B;  4K59 A;  2BOP A;  2XMA A;  4DPO A;  3DM2 A;  3PW4 A;  3GIM A;  1YRU A;  1HMV B;  1DQA A;  3L7O A;  3FFI B;  2E1C A;  2H5J B;  1C0U A;  4ERD A;  3CJ0 A;  1NJI T;  5AE1 A;  5ETO A;  3TUZ C;  2ZZM A;  2NZC A;  1EHW A;  2DXD A;  2R7X A;  1ICE B;  4TU8 A;  5I42 A;  1L3T A;  3U7J A;  1CJK A;  1KON A;  4F3O A;  5HL7 Q;  4DSF A;  1WJ9 A;  2GML A;  3SQG A;  2LA4 A;  2ZC3 A;  3TX8 A;  1PBU A;  3D2W A;  4X4O A;  3P3D A;  5HLF A;  2KZZ A;  1WHX A;  1AFJ A;  2MZT A;  1U48 A;  3R8Y A;  4B9N A;  5F0W A;  1S9E A;  5L9N A;  2BE9 B;  2B7C B;  2NQP A;  3HVT A;  3OTO J;  5L1I A;  2HWI A;  1LWC B;  1JNZ B;  1XMQ J;  3P5B P;  2ZNY A;  4RW9 A;  2QFI A;  1RTH B;  4FYX B;  3A8E A;  3CD5 A;  4P9S A;  1ZTW A;  4I6Y A;  5HP1 A;  2VIH A;  4RKU C;  2ASL A;  2BAN B;  3LAK A;  2E29 A;  1NUE A;  4ZKA A;  2F4V F;  5DM7 Q;  1M1G A;  4E2F B;  3ZZR A;  2KU7 A;  2C1E B;  1U0H B;  1XEZ A;  2ATL A;  2ZOG A;  4OYM A;  4EU0 A;  3KLG B;  3NGU A;  2HFN A;  1TUG B;  5D15 A;  5C42 B;  5M2P A;  1SL2 A;  2EEY A;  1FES A;  1HA1 A;  1HNV A;  3RAQ A;  3GYX B;  2W4P A;  1RHR B;  3VAH A;  2VFR A;  4KGK A;  2FJW A;  3AB2 B;  4HI1 A;  3OQ2 A;  1ZS6 A;  4OZ1 A;  3MEG A;  2XY5 A;  2UVU A;  2DGW A;  1Q86 T;  4K4U A;  3KHH A;  3AA8 A;  3RRK A;  2J8S A;  1RT4 B;  3MM7 A;  3U1N A;  4KFB A;  2M52 A;  1Y10 A;  3M2R B;  1NK6 A;  5KTQ A;  1I94 F;  3PHE A;  2IM0 A;  2V4J B;  1KNZ A;  4A8X A;  5KT2 A;  3C6U B;  2J7U A;  5HBM A;  1ZAV A;  5KFI A;  4PWD B;  4PPZ A;  2VDH A;  5KT6 A;  1FE0 A;  5EWF A;  4PAB A;  5IT4 A;  1SI9 A;  1NSA A;  1BMQ B;  1RSC A;  4BDP A;  2J9C A;  1BLU A;  3BRE A;  4Y2A A;  5AJ3 F;  4ETZ A;  4IUF A;  2CJK A;  5DM6 Q;  2E1A A;  3ZXW A;  4TYB A;  1VIO A;  2A10 A;  5DG7 A;  4F2R A;  5DZ6 A;  2RRA A;  2VON A;  1F5A A;  3R5J B;  4IH6 A;  1HWK A;  1S72 S;  1NKE A;  3V6D B;  3G4S S;  3L7U A;  1G6B A;  1GMW A;  2HMI A;  4I4B A;  2HHV A;  1RT2 A;  2VA3 A;  3P5T L;  1T03 B;  4F2S A;  1KQS R;  4YME A;  4OHY A;  4OIX A;  4P2X A;  2RF2 B;  2J0W A;  4EBD A;  1K47 A;  2W9B B;  4WII A;  1Q5V A;  1YJT A;  2QLW A;  4JI8 J;  3W65 A;  2JSX A;  1VQM S;  2DNG A;  1YVF A;  3IBF B;  4TVA B;  1T9U A;  2GW8 A;  4JYA F;  4DR7 J;  4AL6 A;  5ETM A;  4C97 A;  2HFS A;  5D4N A;  2N7Y A;  4CM2 A;  2XYG B;  2UXB J;  4ELT A;  1U6B A;  2CPZ A;  4RUA A;  1ZAW A;  2HND B;  1VK8 A;  1DTT A;  2UVV A;  4IH5 A;  2CZ9 A;  2DNO A;  1U2C A;  1L3V A;  2MY7 A;  1SC1 B;  4AUK A;  3OHA A;  1DQ8 A;  5B0D A;  3ZZ0 A;  2JFK A;  1S77 D;  3I0R A;  2V4R A;  1LFW A;  3ISN C;  5FDL A;  1YBU A;  1RBA A;  2OD6 A;  4Q8F A;  2DY9 A;  1S6P A;  3IFE A;  4FNI A;  1RP5 A;  2VUG A;  1FRL A;  3A3N B;  2VJV A;  2YKA A;  4FS2 A;  5CAA A;  3C15 A;  2MLX A;  2OPP B;  3GFY A;  2CPI A;  4NLV A;  3ITH A;  2CQ3 A;  4CDI A;  2CNN B;  2L9D A;  3M05 A;  2RHS B;  2LQ8 A;  4EGL A;  2CJB A;  5J2M B;  1S6U A;  4C11 A;  2Q66 A;  3V4I A;  3WC2 A;  4ZPC A;  2JLE A;  5ETQ A;  5F9N A;  4DX6 A;  2P9E A;  4B3M J;  3DOK B;  1M0S A;  1VCT A;  4DOZ A;  1JJH A;  2VPX B;  1TKD A;  1QD1 A;  1HYS A;  4MIA A;  1VHI A;  2BDP A;  2CG4 A;  1RAF B;  3ULH A;  4IFV B;  2WVF A;  3B82 A;  2ZH9 A;  1VBZ A;  4UT4 A;  1CUL A;  7FD1 A;  2GMJ A;  4QZV B;  4HT5 A;  5IZH A;  2JH3 A;  3E51 A;  1NEE A;  1UP1 A;  4M95 A;  4HHU A;  1GX6 A;  2Q43 A;  3OXF A;  1AB8 A;  1WC1 A;  2H48 B;  4QWC A;  4I2Q B;  2H54 B;  8RUC A;  2BQR A;  4N7T A;  3EUN A;  4FDF A;  4WCE Q;  4ZDN A;  4DR5 F;  3POT A;  2CPE A;  2E5H A;  4U7U K;  5J2P B;  2JNJ A;  4PQA A;  1X4E A;  1IKX B;  2Z4P A;  3G71 S;  1JLF B;  4YHH F;  4R25 A;  4JI3 F;  5KFR A;  1AZS A;  2HLT A;  2QMX A;  3VR1 A;  2KTQ A;  4U8V A;  3AJ1 A;  1NLK L;  3IR7 B;  1MU2 B;  1BQN B;  1NSK L;  2KFY A;  1X5O A;  4KGZ B;  4NEZ A;  4ES2 A;  5A2Q U;  2VBY A;  5FLX U;  2Z57 B;  4WFY A;  3MM5 A;  2RQM A;  2V2K A;  3SXL A;  4CYU B;  2V8D A;  3DI6 A;  3MCO A;  1PAU B;  3BDE A;  5LMU J;  3HD2 A;  1I5O B;  1HQU A;  4AL7 A;  2DRB A;  3GQC A;  2IDL A;  4RZR A;  1MSW D;  1UFK A;  4UZC A;  3NOC A;  4EYH B;  3E3X A;  4IKA A;  1V6H A;  1T3N A;  2XMJ A;  1RKI A;  4QYZ K;  3K17 A;  1FFW B;  2E1M C;  2OTL S;  4LRB A;  4RBT A;  2F8H A;  5A0Y B;  2JLF A;  3SV4 A;  4N77 A;  4B9M A;  3T5H A;  1FKP A;  3RTV A;  3CCQ S;  2UU9 F;  5MLC V;  5JXS A;  5AXL A;  1RAE B;  2RD5 C;  2AD9 A;  1T11 A;  2JDJ A;  1WEY A;  1KLN A;  1FTC A;  3UD5 A;  1IR1 A;  2MLY A;  3DLL Q;  1SV5 B;  4DZD A;  1X4F A;  4KSE B;  4CLS A;  4N56 A;  3JTP A;  2HBY B;  4MMO A;  1TL7 A;  4LF7 F;  1HBM A;  2J6U A;  2YNF A;  4RPF A;  2R3V A;  4NZ7 A;  4QW9 A;  3HVW A;  1UPM B;  3A1Y G;  3OUY B;  2ZD1 B;  4LBI A;  3HM9 A;  1M1H A;  1HMV A;  2P2C B;  1YSJ A;  3FFI A;  1IKW B;  1WUU A;  5E7O B;  3HJV A;  1YJ7 A;  2OPR B;  2GV1 A;  3OFH A;  2N82 B;  2D9O A;  3W66 A;  3SCK E;  2MQM A;  3OR1 A;  3A3O B;  3EXC X;  3PRV A;  4DPU A;  2IM2 A;  1FTR A;  2FJB B;  4QYZ J;  5GAH I;  3K57 A;  4AXJ A;  5DDR C;  4F7V A;  1DAR A;  4PG6 A;  4I7F B;  4C4W A;  2W2M P;  4DL4 A;  5BJR A;  4RJV A;  2IM3 A;  1U1N A;  1Y00 A;  2HVH A;  4K7Q A;  2P9G A;  3BO4 A;  1EKS A;  2X3G A;  3KLE A;  4UOF A;  3G82 A;  1LWC A;  4DL7 A;  5KFF A;  4WYL A;  3AOA A;  1SUQ B;  5DQG A;  3CME S;  1LV5 A;  1YBT A;  1IKY A;  4PCQ A;  1RCX B;  2B8Q A;  3KUH A;  1RXO B;  3DMJ B;  4LFB F;  5IV3 A;  1C0T A;  3B4M A;  2CQC A;  3EVW A;  1VQS A;  2OO4 A;  3KLG A;  1EP4 B;  2ZC4 A;  2NPI A;  3T1H J;  2IJN A;  5I3Q A;  4JV5 J;  1ZPV A;  3PO5 A;  5KFB A;  1TK5 A;  3H5U A;  4DUY F;  2KFZ A;  1M5P C;  4K4V A;  4PEO A;  2IRX A;  2P9C A;  3N5F A;  5IC6 B;  4NX9 A;  2LU1 A;  2DNM A;  1U6F A;  2VB6 A;  5AXK A;  3QWU A;  2CQH A;  4DJB A;  2L48 A;  4ECS A;  2FJV A;  1Q78 A;  2DNH A;  1D3W A;  3FNN A;  4DBQ A;  3W2V B;  3QLH B;  3HX9 A;  3GFZ A;  2FJE B;  2G1H A;  4DV3 F;  2BMB A;  4Y34 A;  4ZVU B;  2AU0 A;  3TQE A;  3PW0 A;  1AUD A;  1Q1K A;  1G2E A;  3DLG A;  1FER A;  1I51 B;  1NZA A;  2A3J A;  1G7C B;  2V4J A;  1YJW S;  3R3T A;  5C25 B;  3W9I A;  3C6U A;  3DLE A;  4I69 A;  4ICL B;  1VOM A;  3MUM P;  1QDU B;  1N48 A;  1WOO A;  4U96 A;  5DO2 A;  2LEA A;  4ES1 A;  1QAI A;  2Y0S D;  5CH7 B;  1N5T A;  1PIL A;  2DT9 A;  2YNG B;  3QT8 A;  3NGS A;  5D0H A;  4HHH A;  4AL5 A;  1JQG A;  7FDR A;  4X65 F;  1QTN B;  3QMQ A;  4LBP A;  3UI3 A;  2Z56 B;  2ILZ A;  3M8Q B;  2ROG A;  1R0C B;  3MEE B;  2VQE F;  3V4M A;  2CQ0 A;  3CED A;  4Y6I A;  1X60 A;  1N5Q A;  2QGF B;  4A8O A;  2YWF A;  5ETK A;  1VQO S;  3TYT A;  2HEK A;  1FNM A;  1HW9 A;  2BYC A;  3EIC A;  3R5D A;  2QLJ B;  2HNY B;  1M5V C;  1ZTT A;  1Y5L B;  5D4L A;  4B08 A;  4YDX A;  3WX8 A;  4WFX A;  3IO1 A;  3D6T B;  1B7Y B;  3JSY A;  1FRH A;  1R43 A;  1R0B G;  1RDR A;  3KK3 B;  2GC8 A;  1RWX B;  3HF5 A;  2Z8Q A;  2XS2 A;  1WOP A;  1SJQ A;  3HHK A;  5A8W B;  1TEL A;  1HNW F;  3GB0 A;  4NYO A;  1HHS A;  1B0T A;  3NAH A;  3M1V A;  1QTM A;  3BH6 B;  2AEM A;  1PIE A;  4DEZ A;  1AA1 B;  3T6J A;  5IV4 A;  1RCO B;  2B4U A;  4YR2 A;  3NS5 A;  4F3Q A;  4NLD A;  3TZY A;  5EX0 A;  2B4V A;  1KFD A;  3A3P B;  3WX4 A;  1HFE L;  4B02 A;  1IBC B;  1IQT A;  1RGV A;  4G6V B;  3W1Y C;  2F4V J;  4Y28 C;  1S4E A;  1E6V B;  3JB9 k;  2F8E X;  2MKH A;  3KMS A;  5CA5 A;  2X1B A;  2DVI A;  1P1L A;  4B9L A;  2MQQ A;  1FKA F;  2IA6 A;  3Q8U A;  2L9N A;  1XTZ A;  2CPX A;  1NK4 A;  3H2L A;  3T41 A;  1RYR A;  2FDN A;  5K8M A;  3MEC B;  2W24 A;  2B3T B;  2VG5 B;  3VAG A;  4YR0 A;  3CCM S;  4TQR A;  2HK3 A;  1U45 A;  4Z37 A;  2VOP A;  5IFM A;  5HMW A;  2I5J A;  1UFL A;  3MM8 B;  3EPG A;  3AA9 A;  4F4X A;  1WC3 A;  1RT5 A;  3KLH A;  2BRK A;  1Q7Y T;  3KJF B;  3BR8 A;  3CCS S;  2UP1 A;  2HGN A;  1S7H A;  1JNR B;  3FBF A;  1GXU A;  1QAY A;  2F7V A;  3IAM 9;  4CO1 A;  5GAE I;  3SZ2 A;  3DXS X;  4X4P A;  2AZ3 A;  4IFY B;  4B3S F;  1VBY A;  3CDU A;  4U67 Q;  1HL6 A;  2C3U A;  1WHY A;  3PDN A;  3TEG A;  1HWL A;  1TL3 B;  5A8R A;  3AOC A;  1ZM9 A;  2A18 A;  1WDD A;  2YH0 A;  5AJ3 J;  4NYZ A;  3IWN C;  3G6V A;  1BY9 A;  2CJ9 A;  1WWH A;  1NBE B;  2AJ0 A;  3FEY B;  4OI0 A;  2DBB A;  2DEJ A;  1O5J A;  1Z2L A;  4C0B A;  3SFG A;  4ER8 A;  1H2V Z;  3H98 A;  1JJ4 A;  1BQN A;  4ED7 A;  3KJV B;  4CLU A;  2V50 A;  1S79 A;  2GVZ A;  2HHT A;  1EZZ B;  2IFX A;  2W2N P;  1Y3J A;  4CYU A;  1NND A;  3D0G E;  4GRS A;  1D9F A;  2ERR A;  2GQC A;  2J9D A;  5L1K A;  1XR7 A;  1RWP B;  4CCH A;  1JXL A;  1NO8 A;  1LK7 A;  2C2E A;  4DXL A;  4JI2 F;  3H90 A;  4QYR A;  2QT7 A;  3AT1 B;  4Y2M A;  1VRU B;  4JYA J;  2GHV C;  2AGQ A;  4YB6 A;  1ZH5 A;  2FZG B;  2HIY A;  2YX4 A;  2JEI A;  3WIU A;  1GX5 A;  4RW4 A;  8AT1 B;  3DLJ A;  2GGP B;  2HFU A;  4TY8 B;  2BJ1 A;  3ZZT A;  2PFD A;  3WQP A;  2IBK A;  1TV6 B;  3EM1 A;  3QJJ A;  3N28 A;  2LVW A;  2FLO A;  2EPI A;  3PXG a;  4Q0B B;  4IYQ A;  5CXT A;  2HHU A;  4R8U B;  1KKH A;  1NZ8 A;  3QGI A;  1O6X A;  2ACY A;  2CQI A;  2BKN A;  5BYR A;  4NRT A;  3GIK A;  4C48 A;  2Y3Y A;  4PWW A;  1IJF B;  2ZD1 A;  2RS2 A;  2F9D A;  3FKB A;  2Z2M A;  3K8V A;  2AJ1 A;  1X9M A;  5ETL A;  4OHW A;  3PYE A;  2FVP A;  2WVB A;  1NPR A;  2JRS A;  1NDC A;  3KNG A;  3MED A;  2V2V A;  4L75 A;  2HQI A;  2WSC C;  3WZ0 A;  3BDP A;  5ETV A;  3DRS A;  3A4T A;  1Z4U A;  2V67 A;  4WBF A;  2N4C A;  3CJT A;  3HT0 A;  4DFM A;  5KFT A;  2FY8 A;  2V2Q A;  3M30 B;  4B3O B;  4DPY A;  3NP5 A;  4CLP A;  3MXH P;  3VZH A;  3GYN A;  4FXW A;  2PI5 A;  1JK9 B;  4N8N A;  2E7X A;  2LLZ A;  2D3O 1;  1O51 A;  5AE2 A;  5I3U A;  1U1L A;  5E0O A;  1NCL A;  3M32 B;  1CJT A;  1PC5 A;  3DOL A;  3AHP A;  1N6Q B;  1QUP A;  4NI2 B;  2NXE A;  4MAK A;  5KT3 A;  1YJV A;  5CCL A;  3R5A A;  1FXD A;  4DR5 J;  1N54 B;  2ZZT A;  2B7B B;  1IKV B;  3NCR A;  3KFW X;  1KQK A;  4OX6 A;  4BS2 A;  4JI3 J;  3HFZ B;  2Y8W A;  1EP4 A;  2ZVI A;  2UUB F;  2DR6 A;  1CSJ A;  1RAD B;  4BBY A;  3WBZ A;  3KHG A;  4RO0 A;  2M2B A;  4K50 A;  4NRU A;  1M90 T;  4BWJ A;  2HVI A;  4MKB A;  5IXU A;  1S1U B;  4OYB A;  3K2Y A;  1F0X A;  1RKJ A;  1ZA2 B;  2LEP A;  2IC3 A;  3IA0 A;  1X5S A;  2PO4 A;  1S48 A;  3CO0 P;  2PA3 A;  2UZA A;  3AJD A;  2CJX B;  2ASD A;  3AQP A;  2MLZ A;  1ACM B;  3KWM A;  4USJ C;  1ZZF A;  4ZIV A;  1OYE A;  5D0G A;  4ICL A;  1R8H A;  4ZN1 A;  2AV5 A;  4ZS6 A;  4LF9 F;  5L38 A;  3O5T B;  5K9F A;  5HO4 A;  4O23 A;  2QSF A;  4PG8 A;  1SJ1 A;  3A8I A;  2YNG A;  4FVC A;  3OJU A;  1FNO A;  2EKN A;  3CB4 A;  4F4Z A;  2B56 A;  3G6X A;  2AJ4 A;  3H2U B;  3DDI A;  3MEE A;  1N8R T;  1X5P A;  2PII A;  1WOS A;  2RQ4 A;  3D3B J;  4FYV B;  1HW8 A;  4KV8 B;  2MGZ B;  3KG0 A;  2OJ3 A;  3TQ1 A;  4C9D A;  4NXN F;  2OPS B;  4CTA A;  1NH7 A;  3BKU A;  1H2U X;  5ADZ A;  2NUH A;  5CAB A;  1R0A B;  1RTZ A;  2I8E A;  4MYU A;  1CQM A;  3TJ8 A;  3DYA A;  2K8G A;  2PSZ A;  3NBP B;  4ZJQ A;  3W8G A;  3KLF A;  1LXN A;  3GR0 A;  2B9E A;  3Q24 A;  2IRY A;  3W61 A;  4M1K A;  2M8D B;  3KK3 A;  4IOC Q;  3K5L A;  2C2K B;  2ZH5 A;  3HSD A;  4H4M A;  2BKO A;  5D6G A;  2CJA A;  1WG4 A;  1V9O A;  4NLX A;  3PFE A;  2CQG A;  1S97 A;  4A8Y A;  3KUE A;  1X9W A;  2HKE A;  3RBE A;  4ZLN A;  3UD3 P;  5A2Q Y;  5FLX Y;  2X1A A;  2V6A A;  3WIV A;  2VFT A;  4RW8 B;  5KFK A;  2XMK A;  2RDI A;  3KXD A;  2OEL A;  3CPW R;  1RK8 A;  1H74 A;  3LQV A;  2ADB A;  4OHV A;  2JOQ A;  1E6V A;  3W5Y A;  1U8W A;  5EUH A;  4CO5 A;  3BKT A;  1HBN A;  2MPU A;  2V0N A;  1XER A;  2YVS A;  3MTJ A;  4ZVQ B;  4O4G B;  3MEC A;  3UN2 A;  2OIH A;  3C3L A;  4DR2 F;  1YRT A;  3BPD A;  2KM8 B;  2VKZ G;  2VG5 A;  2FZK B;  5J1P A;  4ZVF A;  1OMS A;  4G1I A;  2IDE A;  2R7V A;  2DHH A;  2G4B A;  2DO0 A;  4WKY A;  3I56 S;  1TAU A;  3DRP A;  2KRR A;  4BC7 A;  2GIR A;  3GG0 A;  2V5H G;  4B3T F;  3MMC B;  3CCJ S;  1QE1 A;  4HAC A;  2EW9 A;  3L9Z A;  5K8N A;  3QJL A;  4DV3 J;  4QU7 A;  4PAA A;  3Q22 A;  2FQQ B;  3AXK A;  1CBK A;  1RT3 B;  4FYD A;  1EJ7 L;  3HZE A;  2ZH3 A;  3GIR A;  2DKO B;  4ZP6 A;  1Q5Y A;  1QLN A;  1TTH B;  4GO7 X;  4BCA A;  1S1W B;  2N4D A;  3LAM A;  2YKM B;  1HWJ A;  4B9T A;  1YBA A;  5DRK A;  2FVC A;  2GFF A;  4WTO B;  3MMB B;  4P10 A;  4DV6 J;  2A6O A;  2MB0 B;  2UUC J;  4X65 J;  1YHQ S;  3BSO A;  4DF8 A;  1FFG B;  4DUZ F;  3TRG A;  5GAG U;  2VQE J;  3THP A;  2CJQ A;  2PEB A;  3ILJ A;  1Z1Z A;  2XY6 A;  4WXW A;  3ZNJ 1;  2YWG A;  4OZJ A;  1UVJ A;  1EB0 A;  1RT7 A;  4DV0 F;  2BQU A;  2O1P A;  4YN3 B;  4D3H A;  3QWP A;  2LXU A;  4RBV A;  2AT1 B;  3E01 A;  2DHG A;  2XMM A;  3I32 A;  3VWS A;  5K14 B;  2QTW A;  2LQ5 A;  2NSB A;  2JWN A;  5D4O A;  2QFJ A;  4OZ5 A;  2ZBI A;  4M5N A;  2NR0 A;  2DGV A;  1U24 A;  2XLJ A;  3PYF A;  1HQE B;  4LRA A;  2CPJ A;  4X64 F;  4I1T A;  4ATN A;  2ABY A;  2ZKT A;  3NS6 A;  3V81 A;  4FPR A;  2KT3 A;  3RB0 A;  4ZVE A;  3MPV A;  2GVD B;  2BAC A;  2V34 A;  4MFB A;  3JS9 A;  4QWB A;  1HNW J;  2OPQ B;  2LEB A;  3PTW A;  1E6Y B;  3GCX P;  4KBI A;  2ZH7 A;  1WOR A;  3FC9 A;  1M5H A;  3EYZ A;  4UOG A;  3N4W A;  2ALZ A;  1REG X;  3DRX A;  3HDS A;  4RUH A;  3TO8 A;  3PW5 A;  2DJW A;  2XGP A;  3I5B A;  3MPU B;  2J9E A;  5F0U A;  1IN0 A;  5IT9 Y;  3MFI A;  4EFA C;  2DHS A;  3FMB A;  4PUO B;  3ILL A;  3JXO A;  1HAR A;  4DR6 F;  3M8P A;  1CPZ A;  4NOH A;  2IAJ B;  1S9F A;  1C1C A;  1LQ9 A;  3MGJ A;  4PXD A;  1J2V A;  4NLU A;  4C8Y A;  4M63 A;  3IMQ J;  3AY0 A;  3KOA A;  2Q3P A;  3BGF A;  4OYP A;  2MQN A;  3HKZ D;  3OV7 A;  4KGX B;  3M8Z A;  4K4X A;  4B3O A;  2RAQ A;  2JEJ A;  2C22 A;  4Q45 A;  3KK2 B;  5THW A;  4OZ0 A;  3VAL A;  3DLK A;  3TUP A;  2MZ1 A;  1GMV A;  1HD1 A;  2ZIT A;  2E5L F;  2XSF A;  3THV A;  4CH7 A;  2DNR A;  4B3S J;  4YUD A;  3M32 A;  5HAT A;  3G6E S;  5KFG A;  3W60 A;  1N6Q A;  2BR0 A;  4I56 A;  3D0H E;  3M9N B;  4NI2 A;  2WON B;  2EXU A;  2KH9 A;  1TL1 B;  3J7Z T;  4OQJ A;  4E0D A;  1KQG B;  2ZM6 F;  4L72 B;  3GZ7 A;  4PXE A;  1B70 B;  4DV1 F;  3M2U B;  3CSK A;  4KTQ A;  4DN0 A;  1YWX A;  5A6W A;  2QJ3 A;  4OYW A;  4OFZ A;  5IOL A;  2XC9 A;  3AB4 B;  3QIP A;  3RU0 A;  2DIU A;  1S0O A;  2LMI A;  4MIB A;  4CLW A;  3J80 U;  3SDE B;  3VQT A;  2BM1 A;  5D4P A;  3U02 A;  1VQ4 S;  1Q81 T;  4ZVP B;  3OT9 A;  2YKN A;  1RHM B;  1VK3 A;  2YKO A;  3BJY A;  4KHR A;  2ZHO A;  1NK9 A;  3CO9 A;  4NE9 C;  3JYT B;  4XTT A;  3RBX A;  1RWU A;  3J81 U;  2KXN B;  5ETR A;  1S1U A;  4C2M A;  1FVQ A;  5GVQ A;  2A2C A;  4F0K A;  2BV3 A;  1JLQ B;  2HYI B;  4KHP F;  3OW2 R;  3EVM A;  2ILY A;  2V8V A;  2D3Z A;  1DUR A;  4JI2 J;  1RLC L;  3CCT A;  4M5L A;  5B0G A;  5LMN F;  5HK4 A;  1TK8 A;  1RT6 B;  4IR1 A;  4KGM A;  3CIM A;  4LFA F;  4ED0 A;  4C8Z A;  4F02 A;  3FCW A;  1RAJ A;  1RAH B;  3G6Y A;  1VGY A;  1TUW A;  1NK7 A;  1WF2 A;  2DGT A;  3I0S B;  1IVZ A;  1Q8L A;  1T8E A;  1REV B;  2NYI A;  3MUV P;  2B51 A;  1OJ4 A;  4YFU A;  3FGV A;  3PRD A;  4ZHR B;  5GAH U;  1T0T V;  3W2W B;  2HZC A;  3I96 A;  4RW7 A;  4ZPD A;  3PY8 A;  4MK9 A;  2J5A A;  2MEW A;  3UQS A;  5KFX A;  2CQ2 A;  2XI2 A;  5KG7 A;  4DLG A;  4C8K A;  1RT1 B;  2DXF A;  1ITP A;  4CLZ A;  3TP2 A;  2Q6B A;  4ED8 A;  4Y65 A;  5DG9 A;  2MQP A;  1DJ0 A;  1YRX A;  2OI2 A;  3GE9 A;  3DOM B;  1BQM B;  2BBE A;  4QWD A;  2MQL A;  2WB1 D;  1D1U A;  4UY8 T;  4CH1 A;  5HQL A;  5LL6 d;  5KFV A;  1R0A A;  3GV7 B;  5ETP A;  2V4Q A;  4J37 A;  1JLE B;  1FKO B;  4OZL A;  3NBP A;  3MM9 A;  2RJZ A;  1KN6 A;  3BBF A;  4LF6 F;  2IIH A;  1WI6 A;  1QSY A;  5KT4 A;  4YS2 A;  1JJC B;  3C6T B;  3SMZ A;  4OX7 A;  1CS4 B;  4TQS A;  1UW4 A;  3CCV S;  4Y0F A;  1Q8B A;  3R1L A;  5SUH A;  1VLY A;  2H65 B;  1W2B R;  2D1C A;  3VV2 B;  4BHQ A;  2HLU A;  4LIR A;  4FS1 A;  2F3J A;  3BO3 A;  1RAO A;  3I31 A;  3TAN A;  4I2P A;  4EZ6 A;  5KOW A;  2F4F A;  3LH2 S;  4IQM A;  4ECX A;  1UEU A;  2NS1 B;  1UCN A;  1Q8K A;  1C0U B;  2R2T A;  2KG1 A;  3JQM A;  3FBE A;  4XDD A;  3G87 A;  3UNY A;  2ZH6 A;  1H7X A;  3SYZ A;  5I42 B;  4RW8 A;  2I9S A;  2FVQ A;  3CNQ P;  3CIZ A;  2OTJ S;  1P6T A;  4NLW A;  3D4J A;  3JQJ A;  4NLT A;  2F9J A;  4MIW A;  2DCU B;  2YNH A;  1JLG A;  1B4S A;  1RWM B;  2UUB J;  5AT1 B;  4Q44 A;  4IRK A;  2C3Y A;  3HVT B;  3KLV A;  4WJB A;  2MSS A;  4L73 A;  2MTL A;  2BOA A;  2DNZ A;  4NLP A;  4RW9 B;  3ILI A;  4YOE A;  2HGM A;  1HNI A;  2IVY A;  5HP1 B;  3HSJ A;  3MMC A;  3QZ7 A;  2FHJ D;  3T3F A;  4AQY F;  2KHD A;  2VH7 A;  2ZBR A;  1TP7 A;  2XQC A;  2HHH F;  3WC0 A;  4EZ9 A;  3SSQ A;  3FRY A;  4YR3 A;  4GKJ J;  1RT3 A;  3LGH A;  1VJW A;  3TZZ A;  1OSC A;  4Q7A A;  1JKH B;  1IXK A;  3KHR A;  3HXM A;  3IGN A;  2COL A;  1QSS A;  3PYD A;  4FKX A;  1HNV B;  2E1R A;  4M5I A;  3H0P A;  3DLH A;  2FGO A;  2O01 C;  2V68 A;  4S0M A;  4LF9 J;  2YKM A;  1SPB P;  3CCE S;  5DLG A;  1H0H B;  2GAG C;  3MMB A;  1Y5I B;  1KHW A;  1NJZ A;  4AND A;  1U25 A;  4RLE A;  2CKW A;  1B3T A;  4DR3 F;  3MEG B;  2P6T A;  1VQP S;  1XIQ A;  4OJG A;  1ZM2 A;  1XJW B;  3PNI A;  2K06 A;  2WW4 A;  3W64 A;  5KFD A;  4KFB B;  3MD1 A;  4NXN J;  4USW A;  3FSX A;  4ECY A;  4CO2 A;  1LXJ A;  2AKW B;  5K14 A;  4O3P A;  4USV A;  2DTJ A;  2YTC A;  3ISN D;  5CYJ A;  3FUY A;  2ZZN A;  2DGO A;  1F9E B;  4O4R A;  4BWM A;  5SZT A;  1FHT A;  2CYY A;  4FVM A;  1FF2 A;  5ETT A;  2WW8 A;  4F67 A;  1SH0 A;  3LP1 A;  4C98 A;  3NNC A;  2GVD A;  3GJS B;  4JB8 B;  1UEV A;  2HFV A;  2BEF A;  2VFV A;  1N5Y A;  2YPY A;  2HQ3 A;  2Y1J A;  3QYY A;  5KT7 A;  5B09 A;  1R3N A;  4XDC A;  3ZZU A;  4EO8 A;  2DK2 A;  3ETO A;  4JI5 F;  4OI2 A;  2HS4 A;  1M5S A;  3NGK A;  2W1B A;  3P8B B;  3VGS A;  1P9Y A;  1KQF B;  2E5I A;  1SJF A;  3LO3 A;  3QO9 A;  3HO1 A;  4RWX A;  1KSP A;  5E2Q A;  3HHL D;  2AYB A;  3I55 S;  3MR6 A;  1B0V A;  2VBZ A;  4F4K A;  3CWJ A;  3IXQ A;  2QLB B;  4DQR A;  2F63 A;  1FD8 A;  1VQ9 S;  4C0O C;  1F60 B;  2HW3 A;  2XWX A;  4V19 X;  4PG7 A;  4CT9 A;  2R8K A;  4DR2 J;  3D28 A;  4KIA A;  3CCW A;  3IM8 A;  4J90 A;  4Z7C A;  2B5J A;  3MZI A;  2GIQ A;  5FDL B;  4OV6 A;  4I0W A;  1PCA A;  3EE3 A;  5F8N A;  1S6P B;  1RAC B;  4P2S A;  1LFP A;  1DY3 A;  2ZH4 A;  3I9V 9;  5KFC A;  4B3T J;  2I6W A;  5BR8 F;  1FDB A;  5LXY A;  4FKY A;  3C15 B;  1UVM A;  3ZTQ A;  2DNY A;  3ITH B;  3VAM A;  2GS8 A;  3DKD A;  4GO5 X;  4K4Y A;  1MMD A;  5K8P A;  2CFX A;  2OSR A;  3OFF A;  1VC0 A;  4C11 B;  3R27 A;  3Q23 A;  3IBW A;  1Q7L B;  3QSI A;  3C66 A;  4CWB A;  1R7I A;  1TKT A;  3EZ5 A;  1XNQ J;  4GC6 A;  1TL1 A;  2YBV A;  4Q2L A;  3OSP A;  3UDV A;  1PJ6 A;  1J5E F;  3RB4 A;  1CC8 A;  1KOH A;  3KJN B;  4JV1 A;  1HYS B;  3HFK A;  4CLT A;  2O3D A;  4KE5 A;  5CYQ B;  3HMJ G;  4DUZ J;  1R6V A;  2ZBC A;  4NML A;  1SQE A;  2UXD J;  2AGP A;  3JSM B;  4ZVR B;  1XNR J;  3F73 A;  2HQD A;  2M8H A;  5MAO A;  3NGR A;  4ECZ A;  3QFW A;  3MOJ B;  3QGP A;  3S01 A;  1VDH A;  2GO8 A;  4K5S A;  1IBK F;  5F41 A;  3CJ4 A;  2J76 E;  5HJX A;  5GAD U;  1X4H A;  4DR1 F;  3M4X A;  2HAI A;  3QGG A;  2RSQ A;  3QT6 A;  1DTQ B;  5E3P A;  2YQ1 A;  3D1H A;  4X64 J;  5DJB A;  1AZS B;  2EWH A;  2FVR A;  4K4T A;  2R8J A;  4DI6 A;  4DQS A;  3I0S A;  1REV A;  3M6U A;  1URN A;  3PYG A;  2J7K A;  1S1T B;  3MM5 B;  1TVR A;  1D9D A;  3DI6 B;  1RAB B;  4UUX A;  3T9N A;  1K0V A;  3EGZ A;  1CJV A;  1HQU B;  3D68 A;  4AYB D;  5T41 A;  3DFE A;  4PXB A;  1WKK A;  4DG1 A;  1TL4 A;  5C2C A;  4WZQ A;  2DGX A;  2K1R A;  5HRO A;  1U26 A;  2M88 A;  5FJ4 A;  1FO1 A;  1KVJ A;  3VAJ A;  5T7L A;  1AUS L;  1BXN A;  2IMW P;  1BWE A;  2FC9 A;  3PO4 A;  3B6B A;  4Q2M A;  4F3M A;  3HVR A;  5I4M A;  4K0K F;  4C8O A;  3CC4 S;  3LWL A;  2OML A;  4JBC A;  4X4U A;  2HVE A;  2GIF A;  2F40 A;  2PD1 A;  1SC4 B;  2AQ4 A;  1JLA A;  3LGM A;  2KT5 A;  2M4M A;  3QRP A;  2ZKU A;  1U4B A;  3O44 A;  1VQ7 S;  5J2Q A;  2QA4 G;  1NSP A;  3DRR B;  3LW5 C;  1TL7 B;  2FB0 A;  4TLQ A;  1HBM B;  4P2F A;  1Y7P A;  3HT3 A;  2F8M A;  2ZE2 B;  1UA1 A;  3CCR S;  1UL3 A;  2RKI B;  4LF4 F;  4H4K A;  3UDL A;  3RJM B;  2MXY A;  4P71 A;  3MD3 A;  5CCM A;  3A13 A;  2NXC A;  4J9R A;  2JVO A;  3RUB L;  3R6G B;  2Y0B B;  2XMV A;  3HD1 A;  4FYY B;  4OI1 A;  1Q16 B;  2KYX A;  1YK9 A;  2RRN A;  3TA1 A;  3OR1 B;  5KFN A;  1KC8 T;  4NCG B;  2ZM6 J;  5HQM A;  4DV1 J;  3D3C J;  3N6L A;  1GH8 A;  2KI2 A;  4PYD A;  5J1E B;  1HHQ A;  1Y5N B;  3VGV A;  4IRC A;  4QIG A;  5D8H B;  3RG6 A;  3BF4 A;  2C2Z B;  4LF8 F;  2YY3 A;  4FXV A;  2XCP A;  2FHM A;  3KLE B;  1H7W A;  1HBU A;  2J8A A;  4X4S A;  3G82 B;  4GKK J;  4WP3 A;  3HJF A;  1WKL A;  3IGV A;  1KBR A;  2CDQ A;  1LW2 A;  1KTQ A;  1TKZ A;  2XYH B;  3RRG A;  4YP3 A;  3W7B A;  2XB2 D;  1NB2 A;  1T94 A;  1IKY B;  4KHP J;  2ZH1 A;  4DU8 A;  2KN4 A;  4QPX A;  5KFY A;  5LMN J;  3TOQ A;  2R8G A;  1C0T B;  1S7I A;  3PEJ A;  1M1K T;  4LFA J;  4DPX A;  2PDA A;  2OUG A;  1JKH A;  1S9G B;  4NWB A;  1YI2 S;  1B0P A;  1YJR A;  2QX0 A;  2VL1 A;  1VIS A;  5C2G A;  2ZWP A;  2C2D A;  4IG0 A;  2MY8 A;  2DH8 A;  1A9N B;  2AEJ A;  2FJX A;  2UXC F;  3TVK A;  2J0Q D;  4WYW A;  2Y9H A;  3TWZ A;  4M94 A;  1NJW A;  1VRT A;  2HGL A;  5KFA A;  2JL9 A;  2GHW A;  3PEH A;  4WK3 A;  1RAA B;  4M5J A;  3EPI A;  3CDB A;  3DLG B;  2W01 A;  2JHE A;  2QE5 A;  2FHK A;  4LSN A;  3R7N B;  4N41 A;  4UQT A;  2RE1 A;  4TU9 A;  3K59 A;  3ICL A;  3G8Q A;  3Q8R B;  3DLE B;  4KAI A;  2VV5 A;  4OLP A;  3IS9 A;  3RR7 A;  3ETM A;  4ZPW R;  2DNQ A;  5HAO A;  2BX6 A;  4LF6 J;  4HI2 A;  2EFG A;  4WP9 A;  2XHW A;  1DZ5 A;  4CO3 A;  3K8W A;  3K89 A;  1JLB A;  3O3L A;  3TR5 A;  4F0M A;  2XTJ P;  2DEI A;  1S0M A;  2QN6 B;  4WK1 A;  4CT8 A;  2XBP A;  3J80 Y;  2YWH A;  1IM6 A;  5H9F K;  3GON A;  3HPO A;  3BQ1 A;  3MM6 A;  1VIX A;  2DIV A;  2HHX A;  4QPT A;  3PR4 A;  3W62 A;  3PW7 A;  3J81 Y;  4KH1 B;  4DSJ A;  1WI8 A;  2WK4 A;  3B54 A;  1X0F A;  4YQW A;  2ZDP A;  3HLU A;  3FBC A;  4M5M A;  1KR4 A;  2I38 A;  4UF4 A;  2KHC A;  2FY1 A;  2KVI A;  5IQQ A;  3H2V E;  3QSY B;  2CUY A;  5E41 A;  4WFN Q;  1RWO B;  1X9S A;  4DHV A;  3EJM A;  4ZPA A;  2R2S A;  3M1V B;  4KGV B;  3NEK A;  1NM2 A;  1OPZ A;  2C42 A;  3VZI A;  3FK4 A;  1FX4 A;  4H4O B;  1D0E A;  3VVT A;  2RB7 A;  3J81 j;  2RDD A;  3MF5 A;  1NK0 A;  3RBZ A;  3EVO A;  4QIV A;  1FEH A;  3AOD A;  2GCF A;  4AQY J;  1F2G A;  1FK9 A;  1FRK A;  1FNX H;  3SV3 A;  2IM1 A;  4URG A;  3IRX A;  2HHH J;  2G2O A;  3M6X A;  2Z2L A;  1HQ2 A;  2PEH A;  2Y1I A;  3N9U C;  5KFH A;  3D0I E;  1UWB B;  5CYM A;  1EET A;  1FX2 A;  2B9X A;  2EC0 A;  5L8R C;  1EQ0 A;  2R2U A;  2LDI A;  3ZTP A;  1TMM A;  4A4J A;  4JI1 F;  3JTO A;  2V63 A;  1RZM A;  1XK8 A;  2VBW A;  3K7R A;  3TUJ C;  3DU6 A;  4JI7 F;  4EBC A;  3PX6 A;  2I5J B;  2ADC A;  1SL1 A;  4NA1 A;  2C3O A;  3CT9 A;  4ZPB A;  4DR3 J;  3CDA A;  3KLH B;  1RT5 B;  5CYQ A;  3M6V A;  2E5J A;  3AAW B;  3GCW P;  1K73 T;  1PYT A;  1V5V A;  3JSM A;  2O66 A;  1NXI A;  2VU5 A;  4OYZ A;  2AF6 A;  2AHO B;  4R0E A;  2EFN A;  3IM9 A;  3TUI C;  2V94 A;  2RU9 A;  1WC0 A;  3VAK A;  4X66 F;  1MWQ A;  1F6T A;  1VQY A;  3NS7 B;  1APS A;  1V3Z A;  3CF5 Q;  1T05 A;  3KLI A;  5A8R B;  3AOB A;  4OJ3 A;  1DTQ A;  2CXE A;  2A0F B;  5DDQ C;  2HHQ A;  3E8O A;  1A6L A;  4FPI A;  3QPI A;  1XC9 A;  3PM9 A;  1B99 A;  2GVZ B;  1S1T A;  2NZ4 A;  4QU6 A;  2LXF A;  4JI5 J;  1IJE B;  3FVY A;  2W25 A;  3H5S A;  4YB7 A;  1QVF R;  3J7A N;  2DH7 A;  3PV8 A;  1XMB A;  4LR9 A;  4V1A k;  4KPY A;  2B4P A;  5C5J A;  1KDN A;  1VS3 A;  4LSZ B;  3Q8Q B;  4A46 A;  1FJ7 A;  3B4D A;  1Q0N A;  3GV8 B;  1RHK B;  4HKQ A;  1CEZ A;  4I68 A;  1WTB A;  4RW4 B;  2QL5 B;  2IVF B;  2DB1 A;  3HHN B;  4DFJ A;  1SCJ B;  4KHM A;  4RX6 A;  4HL9 A;  4Y2I A;  4NCA A;  3DDN A;  3UDC A;  2NUU G;  3JAM Y;  4N5S A;  2WSF C;  3RRH A;  3GJR B;  2FTR A;  4WF9 Q;  2Q6C A;  2E9R X;  3QQC D;  3DRR A;  4LFC F;  2AWZ A;  3CW2 C;  2RDJ A;  1PKU A;  4ECQ A;  2ZE2 A;  4USU A;  4JI0 J;  5F9L A;  1F9F A;  3R2D J;  4A8Q A;  2PC6 A;  2RKI A;  5BR8 J;  4KC5 A;  1R8P A;  3MPD A;  2RIJ A;  5D0R A;  4DFP A;  3GJT B;  2C2R A;  4NXM F;  2IJF A;  2XO6 A;  2AX1 A;  1MWY A;  5IWA J;  3QAU A;  1DQ9 A;  1WG1 A;  3H59 A;  4OV1 A;  4B3M F;  4PG4 A;  4IH7 A;  1OY6 A;  5L46 A;  3MED B;  3MR5 A;  2OHD A;  3RAX A;  1GTE A;  3L3C A;  1MLA A;  3CDE A;  4NCG A;  3DRS B;  1BHN A;  5K5M A;  4NLG A;  4DU7 A;  2R7S A;  1HPZ A;  1KVI A;  5J1E A;  4P7V A;  1FA0 A;  2CJY B;  3EXY A;  3TNV A;  3OTC A;  4P52 A;  2V2Z A;  2SXL A;  4DL6 A;  2B6A A;  3M9M B;  1WSV A;  5I3U B;  1N32 F;  3ENW A;  3MUR P;  1CJT B;  1H73 A;  4CLL A;  3DOL B;  3OL9 A;  1IBK J;  2EG2 A;  4X62 J;  2R7U A;  3LA0 A;  2H51 B;  5L39 A;  4OI6 A;  2MJU A;  4DR1 J;  1T02 A;  2CAJ A;  2J7W A;  2HQF A;  2JVR A;  1YQH A;  4IG3 A;  4OYI A;  5E33 A;  1O8B A;  3LF0 A;  4EYI B;  1UET A;  5ETS A;  5AXN A;  4NCB A;  3LPY A;  7AT1 B;  1S9G A;  5LMU F;  1N33 J;  1SC3 B;  3D66 A;  4DV2 F;  2DRD A;  2QYG A;  4PR6 A;  1SIZ A;  1NU4 A;  3IG1 B;  1SC6 A;  2AJQ A;  1WD6 A;  2B9Y A;  3BV8 A;  1N36 F;  4RL1 A;  3CCL S;  1IM4 A;  4Q43 A;  4ILR A;  1GTH A;  2MST A;  2V9W A;  2MKI A;  4JV2 A;  2GQ2 A;  1VBK A;  2LCW A;  2MKC A;  3NG8 A;  2YWK A;  1NSQ A;  2VAS A;  4ZLJ A;  3NMR A;  1BE4 A;  2IC3 B;  2QZ8 A;  4DL0 C;  4XAK A;  3A8J A;  1Q79 A;  5KFP A;  3DRY A;  1CJU B;  4RR5 A;  4C6A A;  2X7I A;  2XNQ A;  3HHL B;  3TA0 A;  2V8H A;  4USM A;  3OVB A;  4CH0 S;  2HQG A;  2WZ1 A;  3QAE A;  4K0K J;  4DDF A;  5E3Q A;  3ZZO A;  3T5J A;  1CC7 A;  1FDN A;  1Y9O A;  2XG8 A;  4DPT A;  5BXI A;  2L41 A;  3PFO A;  3CD7 A;  2FLN A;  4CNY A;  1HHT P;  3GIJ A;  2R8I A;  2DIS A;  4J9O A;  1Q82 T;  4WTY A;  2AP6 A;  3UFC X;  2PE8 A;  3CUL A;  1ELO A;  4OZ3 A;  4G65 A;  5L1J A;  2X3D A;  3IR6 B;  3MR2 A;  3EMT A;  3CTR A;  2HS0 A;  4LF4 J;  3EX7 B;  4FN5 A;  2BE2 A;  2MDA A;  2AJ2 A;  3UR0 A;  1K0T A;  4HVZ A;  4PXC A;  3B8H A;  4CTA B;  2LQB A;  2VQF F;  2CVI A;  4CLY A;  5KFM A;  3R5B A;  3NGT A;  1NAQ A;  3H5X A;  3K58 A;  4EK2 A;  1KFS A;  3SEO A;  2CA9 A;  2ALY B;  1FJC A;  4RU9 A;  3DYA B;  4O44 A;  2GJF A;  1UTA A;  4USH A;  1TL5 A;  1YGY A;  1NDP A;  5EDW A;  3HK2 A;  2XMW A;  4OJ1 A;  1ZOT A;  3KLF B;  3BN7 A;  4J9P A;  1RTJ A;  3E2E A;  2VPW B;  4QWE A;  2NCK L;  2KG0 A;  2NSC A;  3DXB A;  1H38 A;  2IJR A;  3VGT A;  3NLC A;  2G0J A;  2L9W A;  1AW0 A;  3M8W A;  4H4M B;  1C4C A;  2CPD A;  2XZT B;  3IWL A;  3LWM A;  4A8S A;  4MT1 A;  2KO1 A;  4DSL A;  3W5X A;  4ZCK A;  4FNH A;  3J7Y U;  4ZOS A;  4Y3C A;  2CAD A;  2YXL A;  1MRO A;  1U1R A;  2HNZ B;  4KKO A;  2ZH8 A;  3THT A;  4H4O A;  4DL3 A;  1NPK A;  2BAB A;  4ILM A;  1R8B A;  2XSJ A;  4TKT A;  1N0U A;  2CZ4 A;  3T1H F;  2FD2 A;  4GVB A;  3U1L A;  6FDR A;  4DF4 A;  4HTJ A;  4U95 A;  2JC1 A;  2C2N A;  2FGC A;  2C28 A;  3Q8S B;  1RBO B;  2KFN A;  1YG0 A;  1HBN B;  1VQ8 S;  3QT7 A;  4F4W A;  1UWB A;  2OFH X;  1SH3 A;  2VF3 A;  3NAI A;  1S57 A;  4Y2K A;  3FBB A;  3KKF A;  1CLF A;  4YEA A;  4OZ2 A;  2ATC B;  4V19 J;  4WFZ A;  4DFK A;  5A76 A;  2OSQ A;  4ZCL A;  1LWX A;  2K3K A;  1VC6 A;  2KDO A;  3DRP B;  1RTD B;  2UXC J;  4OYA A;  1ULR A;  5CQG A;  5F8M A;  1G3O A;  3D7S B;  1N52 B;  4Y2C A;  4U9R A;  1QE1 B;  4HAC B;  2WOM A;  4MJK A;  2E44 A;  3S1T A;  1N34 F;  3M8S A;  3Q8V A;  4QCL A;  3AQO A;  4P75 A;  4USK A;  1OIA A;  1YKW A;  4NLQ A;  1UJ4 A;  3Q2T C;  1N0V C;  2XNR A;  1H3D A;  1I94 J;  3SCI E;  3FRZ A;  2BXJ A;  1Y3K A;  4DX8 H;  5KT5 A;  1SVD A;  4JI4 F;  3MCM A;  2UUT A;  1VQN S;  2KXH A;  2CQD A;  1RQ0 A;  2BJ7 A;  4EI2 A;  2HRT A;  4LRE A;  4CLK A;  2MKY A;  4C7Q A;  3UCZ P;  1WG5 A;  2DH9 A;  4ID8 A;  4C8N A;  4ILL A;  1FD2 A;  2PGC A;  5F8J A;  5HVH A;  1NB7 A;  2NLW A;  2H1Y A;  1QVG R;  4P7T A;  2NXN A;  1S1X A;  2N3L A;  3BGU A;  1RT7 B;  1SBR A;  1UMJ A;  2APO A;  3LTO A;  5EWG A;  5EN1 A;  2YX7 A;  1DHM A;  3BH7 B;  2YH1 A;  3CJK A;  3Q86 A;  4ZJO A;  5DET A;  1VC5 A;  3HI9 A;  3E01 B;  4WWS A;  2PA8 D;  5M2U A;  1KEK A;  3GP9 A;  2HRU A;  4QR2 A;  2B4O A;  5KFS A;  2AIR B;  4DPW A;  1MN9 A;  3AH6 A;  3UNG C;  1A7G E;  1C4A A;  4DUT A;  3F44 A;  3QBC A;  4ZA1 A;  3I5C A;  1FRM A;  4H54 A;  4LJM A;  3ET6 A;  3T5L A;  1MW7 A;  1JLC A;  2E7V A;  4WIQ A;  3V81 B;  2YWW A;  2WVD A;  2RH3 A;  1LWF B;  2WVE A;  4MFB B;  8ATC B;  3D6M B;  1U09 A;  5KFQ A;  1DLO B;  2MZS A;  2XZD B;  4OHZ A;  3DC2 A;  4QW8 A;  4WZM A;  2FVS A;  3NRB A;  3K5P A;  3NNH A;  2F5G A;  4ZP8 A;  3IN5 A;  2GAH C;  5A8K A;  4A8M P;  2XY7 A;  2FHJ A;  3W8P A;  3BQ0 A;  2XYP B;  4WFB Q;  1FDD A;  5FD1 A;  1UJ5 A;  2OD4 A;  4KH0 B;  4ZVT B;  4NLO A;  3CJQ A;  3M8P B;  2N3O A;  4UW2 A;  3PJW A;  1LW0 B;  1T9W A;  3TX0 A;  1C1C B;  1FJE B;  2CNK B;  1NPP A;  3OL6 A;  3D9B A;  2V8P A;  1L3S A;  4QIF A;  4JI1 J;  1J5O B;  4FZV A;  1HWI A;  3MAA A;  3H8Y A;  3PCO B;  2BJ8 A;  4DV4 F;  2DR7 A;  2P5V A;  2VJU A;  3KNA A;  2CG8 A;  4JI7 J;  2U2F A;  3N01 A;  2VG7 A;  3TEH B;  2L3M A;  3SSS A;  1T9X A;  3MMA A;  3C8Y A;  1EX8 A;  3CMA S;  2C2M B;  5KG0 A;  2O5D A;  2UUA F;  3CJR A;  3DLB A;  3UPF A;  3DLK B;  2ZBQ A;  2H4Y B;  4B9V A;  4F4A A;  2M7S A;  4KO0 A;  2G1D A;  3X1L B;  3TAM A;  3I9Z A;  2HWT A;  1I1G A;  2PMW A;  2RU3 A;  3UCU P;  4X66 J;  4WE1 B;  1KLM B;  5E3R A;  2AJF E;  1X31 C;  1JB0 C;  1QAX A;  1F5C A;  3QIP B;  2LEC A;  1JX4 A;  4YHH J;  1RBL A;  4B9S A;  3TZX A;  4EEY A;  4AT1 B;  3OL8 A;  4L74 A;  2UV8 G;  4UST A;  1DAX A;  2VOO A;  3CJ5 A;  3PW2 A;  1R27 B;  1C1B A;  1NME B;  5CHC B;  3OSN A;  4FF2 A;  3IG1 A;  2YKN B;  2FUG 9;  4BC9 A;  3KG4 A;  3PKY A;  1PO6 A;  3ZTS A;  1NDL A;  4WFA Q;  1ZBT A;  4DQP A;  5J2N A;  4K5R A;  4ED4 A;  4XPC A;  1IUJ A;  5G0R A;  1HD0 A;  2BUN A;  1IWA A;  3RBD A;  3CJS A;  1ROF A;  4HDG A;  5GAG I;  5E5N A;  4DQQ A;  2R2R A;  2AYG A;  1CJU A;  2GA7 A;  5D3G B;  3HHL A;  4EBE A;  1WC4 A;  1IR2 A;  1T9T A;  2ZJR Q;  1P27 B;  4QOT A;  5B0E A;  4DS4 A;  3OR2 B;  1ZPW X;  2UU9 J;  1WTF A;  2BVZ A;  3P45 B;  1X4A A;  2YKQ A;  3MPW A;  4MYT A;  4A8F A;  5DGA A;  3QRQ A;  3G86 A;  4J5O A;  3I6P A;  2NRE A;  4RW7 B;  3L09 A;  4ETX A;  2AMC B;  1FT8 A;  4U7U D;  4W4M A;  1EKR A;  2VC1 A;  4LFC J;  4LF7 J;  3LP2 B;  4J91 A;  5F3T A;  1U02 A;  2HZV A;  4CO4 A;  3UO0 A;  3LOU A;  3J7Z 5;  4UTG A;  2BE7 D;  4NXM J;  3CC2 S;  4J9M A;  1X0P A;  4PZV A;  4ES3 A;  1S6O A;  2ZUG A;  3NKY A;  3EGN A;  1AXQ A;  1ZM4 A;  2MZQ A;  3BKF A;  2LYV A;  4DWI A;  4OL8 A;  4A47 A;  4O3Q A;  3ZO7 A;  4DZ6 A;  2ZOF A;  1FJG F;  3R5C A;  4LIW A;  2VG6 A;  3MM9 B;  3DU5 A;  3T1Y F;  2CNO B;  1OY8 A;  4DV7 F;  4EWT A;  1WSR A;  2EBE A;  1M5K C;  2W2O P;  3MMJ A;  1R8C A;  4TU7 A;  4LMZ A;  3HHL C;  5F8I A;  2KRB A;  4RNM A;  5HQ8 A;  3PIP Q;  3NGD A;  2FJD B;  3VCD A;  4LT6 A;  2H4W B;  3R5G A;  2UVR A;  1U2F A;  5H1S V;  3VTI A;  5IM0 B;  3QAT A;  4L76 A;  2W2P P;  2D3O R;  4I2P B;  2HFZ A;  3DNC A;  4QQB A;  2X1G A;  2XM3 A;  3OXG A;  1OYD A;  4FF4 A;  3ILO A;  2DCL A;  3GFH A;  4GVL A;  2HNZ A;  1N32 J;  5AXM A;  4J9U E;  2XMT A;  2RML A;  2JZ5 A;  3J7A 1;  4DSK A;  1S5Z A;  3GLJ A;  3M7V A;  2M70 A;  2AX0 A;  1OS5 A;  1RHQ B;  5IT0 A;  1N56 A;  1IWG A;  1NH8 A;  2VA2 A;  2BM0 A;  4QIE A;  3TVZ A;  3OVA A;  3MAH A;  3DGP A;  3FDS A;  1K1S A;  2YNI B;  4LFB J;  2CQP A;  2WB4 A;  9RUB A;  1S6Q A;  2YNH B;  1JLG B;  2IMO A;  4M5H A;  3HFV A;  1XWL A;  1JXV A;  2VOD A;  3CD0 A;  3P4U B;  1OSD A;  1U2R A;  2CPF A;  4DV2 J;  4DS5 A;  4CLF A;  2QL9 B;  2CDR B;  4OX9 F;  2QC3 A;  4DUY J;  1ZYQ A;  2MQO A;  3GU0 A;  1KWM A;  1SL0 A;  1N36 J;  2FLP A; 
#chains in the Genus database with same CATH homology
 3EIC A;  1XIQ A;  4UOG A;  3L7U A;  2NCK L;  3BBF A;  4F36 A;  3ZTP A;  3EM1 A;  3VGS A;  5CAA A;  3Q83 A;  3FBC A;  1PKU A;  1LWX A;  3VGT A;  3BH7 B;  1NDK A;  1NSP A;  1WKL A;  1ZS6 A;  2HUR A;  3Q8U A;  3ENA A;  1LEO A;  3Q86 A;  4KPC A;  3WX8 A;  3FCW A;  3MPD A;  1S59 A;  1B99 A;  4DI6 A;  3PJ9 A;  1NB2 A;  4UOF A;  1NCL A;  3GP9 A;  2AZ1 A;  1BUX A;  5BXI A;  3ZTR A;  1MN9 A;  1HIY A;  1NHK L;  3ETM A;  3Q8V A;  3EJM A;  3BBC A;  3BBB A;  1NLK L;  4DUT A;  1NSK L;  2BX6 A;  2CWK A;  1S5Z A;  1WKK A;  5IOL A;  3FKB A;  3Q89 A;  1F3F A;  1KDN A;  1NPK A;  2HVD A;  2ZUA A;  5C7P A;  3VVU A;  2B8Q A;  1UCN A;  2VU5 A;  1HLW A;  3VVT A;  1K44 A;  1XQI A;  3EMT A;  3FBE A;  1BHN A;  1NUE A;  2DYA A;  3ZTS A;  2DXF A;  3NGS A;  1WKJ A;  1NDL A;  4HR2 A;  1NDC A;  3ZTO A;  3NGR A;  3BH6 B;  3DDI A;  3EVW A;  3EVO A;  1PAE X;  3FBF A;  4ANC A;  3EE3 A;  4ENO A;  4FKX A;  3B6B A;  2DXE A;  1F6T A;  4DZ6 A;  3NGT A;  4O0N A;  4CP5 A;  1EHW A;  2AZ3 A;  4S0M A;  3R9L A;  1HHQ A;  2DXD A;  3ELH A;  1NSQ A;  4EK2 A;  1JXV A;  3VGV A;  3NGU A;  4WBF A;  3G2X A;  1VYA A;  2B8P A;  3GPA A;  1W7W A;  2BEF A;  1BE4 A;  3JS9 A;  1MN7 A;  4FKY A;  3PRV A;  1S57 A;  2HVE A;  4F4A A;  4ANE A;  2DY9 A;  3ZTQ A;  3FBB A;  4W98 A;  3FCV A;  1NDP A;  5CAB A;  4AND A;  3Q8Y A;  4C6A A;  3EVM A;  1B4S A;  3FC9 A;  1U8W A;  3DKD A;  3B54 A;  4UOH A;  3VGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...