3P5TL

Cfim25-cfim68 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
76
Chain Sequence
LYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVSEASSKKLMDLLPKRELHGQNPVVTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of pre-mRNA recognition by the human cleavage factor Im complex
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Cleavage and polyadenylation specificity factor subunit 5
total genus 14
structure length 76
sequence length 77
chains with identical sequence M, N, O, P, Q
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3p5tL00
1P1TA 1VQPS 1HD0A 3DLLQ 2HGNA 1X5PA 2J0SD 3G71S 2LKZA 2MZQA 3G96A 4OZ1A 2AYEA 3G9CA 1DBDA 2DNLA 1WWHA 5GMKa 2DIVA 3VALA 2KT5A 3CCJS 2CPZA 2LEAA 2RU3A 3N9UC 2YH0A 2M8HA 3G8TA 2FY1A 4BS2A 2DB1A 3CCLS 2DNRA 4UQTA 3CCVS 2JWNA 3UD3P 2CQ2A 1R8PA 5DDRC 3BS9A 2NZ4A 1P27B 2RS8A 2MGZB 2OTJS 5IFMA 1F9FA 2MMYA 1U1PA 1G2EA 2ZJRQ 1SJ3P 2DNOA 2M70A 2DNZA 2DGVA 1FJEB 1Q86T 2M88A 2K3KA 1VC5A 2J76E 2E44A 1S72S 1UAWA 2VONA 3G6ES 2VOPA 5HL7Q 1K9MT 1OPIA 4IUFA 3U1MA 3VAHA 2L41A 1FJ7A 1JJ4A 2D9OA 2KFYA 1N52B 5GAEU 3VAMA 1X4GA 2ZJQQ 1H2VZ 2JX2A 2LQ5A 4WCEQ 4QPTA 1NU4A 3RW6A 1X4FA 1M5PC 2DGWA 2G0CA 2CQIA 2MHNA 5GADU 2KM8B 1PO6A 4W92B 1CVJA 2GO9A 1WEZA 1U1RA 2VOOA 1NO8A 1VQ5S 3HI9A 3TO8A 4RU2A 2MY8A 1OO0B 1UW4A 4PR6A 2RQCA 3MD3A 2MZ1A 1X4AA 3VF0B 2LA4A 4PKDB 1Q7YT 3VAGA 1FHTA 2J0QD 1SXLA 1ZH5A 5CA5A 1YTYA 2DGSA 2A3JA 1KOOA 2KYXA 5JVHQ 5GAHU 3CC4S 3NS5A 2G4BA 2XS2A 3CD6S 1WF2A 3SDEA 2ERRA 3J7YU 2DISA 2DH8A 2EVZA 2DNQA 3CCUS 4UY8T 2CQDA 2OJ3A 3R1HA 3CPWR 1B7FA 4LMZA 2JVRA 2E5HA 5IM0A 4CH1A 3UE2A 2MXYA 4IO9Q 3UWTA 3H2VE 1VBYA 5IM0B 3VAIA 2ADBA 1X4DA 3BEGB 3P49B 3NNCA 3LPYA 5JVGQ 4PRFA 1VQNS 2X1FA 4M5DB 3FEXB 1U6BA 3NMRA 1XN9A 2KXNB 1PGZA 2MKHA 2KRRA 4FXWA 2UP1A 4F02A 2KXFA 2HGMA 2KVIA 2QEXS 2DH7A 3EGNA 2LYVA 4TU8A 2KH9A 2X1GA 3MI7X 2SXLA 3JB9k 2PE8A 4QU6A 1JJ2R 1X5TA 1WHVA 4WIIA 2XS5A 2YTCA 5LJ5Y 1YHQS 2KXHA 1SJ4P 1VC6A 1VQLS 2BZ2A 1N54B 2K8GA 1VQMS 1U1KA 3MURP 3P3DA 3IRWP 3L3CA 2CPIA 2CPHA 4IOCQ 2QA4S 3B4DA 1KD1T 2M2BA 2DITA 3THPA 2DHXA 3NNAA 2OSRA 1U6FA 2F9DA 3K0JA 1N88A 3DXBA 5LSOA 1VQ4S 4C0OC 3BO2A 2MQPA 2MQOA 2DNKA 1YJWS 5CXTA 2E5JA 3R27A 5ITHA 3SXLA 1JJHA 1FT8A 3G8SA 4EGLA 2FPHX 3I55S 2F9JA 4OZ0A 3MUMP 3TP2A 2N3LA 5BJRA 1VQ8S 3CC7S 2KRBA 3CULA 1Q81T 2EK6A 1SJFA 1WHXA 3MOJB 2E5IA 2CQBA 5LSLA 2OIHA 2CPXA 3H2UB 2DO0A 2XSFA 3UCUP 3MD1A 1FNXH 3V4MA 1D9AA 1M1KT 1YWXA 2DHGA 1RK8A 3S8SA 5HO4A 1VQKS 2CPEA 3THTA 2MQMA 2MGZA 3UD4P 1WG1A 2MZJA 2MKCA 3ZZYA 3MUVP 2D9PA 2XNRA 1QVGR 1AUDA 2WBRA 2NLWA 4CH0S 3HHNB 2OSQA 3I56S 3EX7B 2DGQA 1QVFR 2U1AA 2CQ4A 3VAJA 1X5SA 1WHYA 4TU9A 4LIRA 3CMAS 1H2TZ 2I2YA 1VQOS 1VBXA 1FJCA 2MQLA 3CCMS 2LXIA 2RT3A 3SDEB 3CCES 3SMZA 4C4WA 4F25A 1YJ9S 2CPYA 4ED5A 4A8XA 3MDFA 1DRZA 3EGZA 5D77A 2RUGA 2DHSA 4ERDA 5GAGU 5EN1A 2DNPA 1KQSR 5LJ3Y 4Y0FA 3CMES 1VQ6S 1X4HA 3S7RA 1WG5A 1N8RT 1A9NB 4WKRA 4LJMA 2JVOA 2M8DB 2LA6A 4YUDA 1H2UX 2MJNA 2YH1A 5DM7Q 1M90T 2DNGA 1UP1A 2VODA 5LXYA 1Q82T 4WFBQ 1JMTA 1VQ7S 2CQ1A 2X1AA 2KI2A 3PIPQ 2N82B 2RQ4A 1ZZNA 2MSTA 3OW2R 2KN4A 3ULHA 3CXCR 3Q2SC 3CCQS 5DETA 2CQPA 1H6KX 2DNHA 2EK1A 4CIOA 2KU7A 3PIOQ 1K8AT 2MKIA 2LXUA 1OIAA 2DGOA 2DNYA 2FC9A 4WFAQ 1U1LA 3U1LA 2AYGA 2X1BA 2CQGA 2DHAA 4TLQA 2DGUA 2FC8A 1K73T 4CQ1A 1OWXA 2DK2A 2CQCA 3MXHP 4Y00A 2RVJA 5LXRA 1WEYA 3IWNC 2KHCA 2MYFA 2DIUA 2L9WA 1SJQA 2LMIA 2RS2A 3FEYB 1VBZA 4WF9Q 1YITS 1VC0A 2DH9A 2OTLS 2HGLA 2J8AA 2MQQA 4YOEA 1M5VC 2U2FA 3VAKA 1DZ5A 2CQ0A 1U1QA 1WEXA 2RRBA 2M9KA 1VQ9S 2MKJA 5IQQA 1X5OA 1FO1A 3S01A 1URNA 4J5OA 2HZCA 2D3OR 1O0PA 5CYJA 3NNHA 3CC2S 3R1LA 2ZJPQ 3TYTA 2CQHA 1HA1A 3CF5Q 2O3DA 2CPJA 1HL6A 1WELA 2KM8C 1L3KA 4IOAQ 5DDQC 3Q2TC 2MZRA 3CTRA 3US5A 3P5TL 3D2WA 2LEBA 1U1OA 5FJ4A 3CUNA 5MLCV 1U1MA 2AYBA 5DM6Q 2KG0A 4FXVA 2MZTA 2GHPA 1S79A 2CPFA 3CCRS 4QU7A 2KG1A 1WHWA 1KOHA 2LECA 1WF1A 1R8HA 4V19X 2DGXA 4Z2XA 1YJNS 1HD1A 5GVQA 1WF0A 2MQNA 2RRAA 2B0GA 1NJIT 1QM9A 5DDPC 4P6QA 2QFJA 2M0GB 2MKSA 2PEHA 3B4MA 2I38A 3BO3A 2M7SA 1DHMA 2DNNA 1BY9A 1X4BA 2CQ3A 2CPDA 2DNMA 3MUTP 2L08A 1M5KC 2MY7A 1D8ZA 5DDOC 4TU7A 1A7GE 3UCZP 1UFWA 1YIJS 3S6EA 4ZKAA 4W90B 2MZSA 2YKAA 2MSSA 2XS7A 2HYIB 1U1NA 2XNQA 1KC8T 2BOPA 1YI2S 2JRSA 1FXLA 2CJKA 2G1DA 3P6YC 3VAFA 1WTBA 2N7CA 2MPUA 3BO4A 2LCWA 3LQVA 3G4SS 4QQBA 1WI8A 2E5GA 3UCGA 2M4MA 3RW7A 3NS6A 5H1SV 2MB0B 1SJRA 4YB1P 2RNEA 1X4EA 4C7QA 3CCSS 2XB2D 1X0FA 1U2FA 2V94A 2FHOB 3ZZZA 1IQTA 2AYMA 2MKKA 1WI6A 2Q79A 2DGTA 5D78A 2YWKA 3J7ZT 2MJUA 2M52A 2F3JA 4U67Q 1WG4A 4F26A 2ADCA 2AD9A 2N3OA 1X4CA 1RKJA 1M5OC 2HVZA 1W2BR 4WFNQ 1ZZFA 2DO4A
chains in the Genus database with same CATH superfamily
4KQZA 4AYBD 5I4MA 4WJBA 2ZD1A 4EYHB 4DFMA 2IC3A 2HGNA 5K9FA 1X5PA 3SZ2A 1CJKB 2CG8A 1V5IB 2FHKA 3CWJA 1RT2A 2P9GA 4RNOA 4LVOP 3SI8A 4E2FB 3D68A 4OZ1A 2ZBRA 3W2WB 1O51A 1T7PA 2RE1A 3G9CA 2ZH4A 4TQSA 3NAIA 2CWXA 5ETNA 1T8EA 3GFHA 3V2UC 5L46A 2KT5A 1DLOA 2N4DA 3RTVA 1BE4A 2XC9A 3DLGB 1K44A 1UFKA 2JZ5A 2RH3A 4UTGA 4WKYA 6FD1A 4Y2AA 1XIQA 2W8LA 2VBYA 4K4SA 2QLWA 1MNEA 1ZAXA 3FRZA 9ATCB 3CCLS 3DM2A 2YNGA 2W8KA 4JI1F 5D3GB 1S1XA 1RE1B 1T95A 1RTZA 5LL6d 5HJXA 3TAMA 2JLFA 3LP1B 3UR3C 4DG1A 4MIWA 2OHDA 1AT1B 4UQTA 5SUHA 3CCVS 3UD3P 2CQ2A 2HQCA 1M1HA 1R8PA 5DDRC 1P27B 1UEKA 1I3OB 4NCGB 3TRGA 3RB3A 1F9FA 4KTQA 1U1PA 3HSDA 2MEWA 3PRDA 3QBCA 4PXEA 2ZJRQ 2OMLA 3H0PA 4GO5X 4DR4J 2V2QA 4J9MA 2FVQA 2DGVA 4B08A 2DR7A 2K1RA 1Q86T 2E9RX 2K3KA 1HKAA 1QY7A 1R0BG 4FN5A 1VC5A 2VONA 1S72S 2KYZA 1I51B 2RB7A 5CZXA 2XYHB 3T5JA 7FDRA 3D54A 3DGPA 5A8KA 5B0CA 4NA1A 3V6DB 4ZP9A 3KHLA 2R2SA 4C6AA 3PW2A 2GA7A 2XM3A 2OPPB 2RQMA 5HVHA 1Q8IA 4DLGA 4M5GA 4RNHA 1XNRF 5GAEU 2ZH1A 3NOGA 5F3ZA 4O4RA 3I87A 1H2VZ 1WTFA 1HWJA 4FF3A 3LP0B 4IFYB 1C0TA 5BYSA 2JFKA 4DR3F 1CEZA 4G1QA 4PG5A 1NU4A 3BSAA 1UVKA 2K2PA 4IG3A 4U7CA 1NJYA 1M5PC 3RW6A 4NYPA 4GVBA 4ZN3A 1SKRA 2CQIA 2XGQA 2HBYB 2QA1A 4O3PA 1PO6A 2RHQB 1WEZA 4IR9A 1YRUA 3BSNA 3GFYA 2AGPA 3TO8A 4AQYF 4I1TA 4RU2A 2YNFB 1S1UB 3L95X 5HJYA 3MECB 2MY8A 2YBVA 3TVKA 2IHR1 2NPIA 1UW4A 2RQCA 2NYHA 3MD3A 2F4VF 2VPYB 1WSRA 3VF0B 2D3O1 2LA4A 1KVKA 3IC1A 2JFDA 3TX0A 3PW7A 2JEFA 4PKDB 1RWWB 3QIPB 1X9SA 4Y6IA 3ZZOA 4XDCA 4DV7F 3SIPB 3EUNA 3FGVA 2J0QD 1SXLA 4DZ6A 1ZM9A 3I0RB 3PACA 4DZDA 1QJHA 5DQIA 1HQUB 1W2IA 2VG7A 5F8LA 1S57A 5J2PB 5GAHU 1LWCA 2UV8A 2F5GA 3FBCA 2UUWA 4OX6A 4ZPCA 4O3NA 2V8PA 5DQHA 2ZH3A 2EKNA 5E3QA 3CJKB 4R5PA 1CJVB 4PWUA 3TAPA 4ZIWA 3FRYA 3UCZP 3RGIA 1JNRB 4LF8J 2CWKA 4B02A 2BDPA 1TKZA 4CLLA 1WC5A 5E2QA 1AUSL 4UY8T 2XMTA 3C66A 3GIKA 2ZH7A 2FVRA 2YKNB 4YY3F 3F0NA 2CZ4A 4LREA 2KZMA 2ZEJA 3R1HA 4GMKA 1P6TA 4KRWA 4NYZA 4I56A 4OYBA 3RRKA 3CPWR 2V5HG 4HR2A 4DR2J 3ENAA 1RWMB 2VFTA 3Q83A 4KH1B 5E5NA 1SC4B 4WYWA 2PMWA 2KFNA 2HQIA 3UWTA 2A6MA 3R5BA 4ZVRB 5B7WA 2ADBA 1XMBA 4Y2IA 4DXLA 2COLA 2DD8S 1WOOA 1TL1A 1ACMB 2AX0A 3BGOP 3KHRA 4FZVA 1B3TA 3P49B 3CEDA 5JVGQ 4PRFA 2YKNA 4DPUA 1BLUA 3GR1A 5IS2A 7FD1A 3TA1A 5CZVA 4NXMF 1XN9A 3MMJA 2KXNB 4FXWA 1TKZB 3TVYA 1RA6A 3ZFVA 4ZJQA 2UP1A 2MKYA 2YWWA 2DH7A 3OSPA 2UVRA 1CJVA 3CJKA 4R5PB 3SBMA 3Q8QB 1J5EJ 2X1GA 1V9OA 2X3DA 2L48A 3AJDA 3D3BJ 3DNCA 3EWGA 3JQMA 3K7RA 3NAHA 4HI2A 4Y34A 3NWGA 5E7OB 4QU6A 1TU0B 3SQOP 2LFVA 2M5YA 3ITHB 1JJ2R 2PMZD 5BYRA 1QE1B 1PAEX 2XS5A 2YTCA 2W2PP 2QYGA 5LJ5Y 1CQNA 3J7Z5 1KN6A 1KQFB 1BXNA 3TQEA 4ENOA 3G8QA 3IN5A 3KLIA 2B6AA 3BR8A 3T41A 1RT5A 4BC9A 1RTIB 4NLPA 1LV5A 4X64F 4JBCA 5KFNA 2ZHOA 3J81Y 4RUAA 3KNAA 1QUVA 3DLJA 3P3DA 3THVA 1JLQB 1R27B 3AY0A 3IRWP 4FKYA 3RBXA 4D3HA 3GU0A 3PR4A 4ECZA 4GKJJ 3MM9B 1IM4A 4URQU 4M5IA 2CNOB 3MFHA 2HAIA 1NH8A 4OHVA 3R9LA 4ZHRB 2C2MB 2DHXA 3PNIA 1NKCA 4G1QB 2HURA 3MM9A 2N7YA 1TFYA 1U6FA 4TXSA 1C0TB 2VQFF 3RBEA 4XPCA 3A13A 1D0EA 1YK9A 2DHHA 2MQPA 1KBRA 3R6LB 1T03B 4EZ6A 2RAQA 3BPSP 2F1FA 4DU8A 2E9TA 3CIZA 1FVQA 2ALYB 2EC2A 2OPSB 5ITHA 2ZM6J 1RT5B 2GMLA 5F8MA 1J5OA 3KLIB 2RKIB 2Z57B 4OYIA 1REVA 3V6DA 1R0CB 2FJDB 2POKA 3H2LA 1QE1A 2HLTA 3GJQB 3V5RA 2F4FA 4DX5A 4Y2KA 2ZDOA 5IOLA 5JXSA 2BX6A 1DURA 3NCRA 4MYUA 2OD6A 5EX0A 4AD6A 4E8UA 3T3FA 4ZVQB 1MN7A 4Q43A 2YWFA 1RCXB 3B54A 2OIHA 2KO1A 3J80U 4ED7A 1OY6A 1F5CA 2HVEA 4HLBA 1R6VA 2MHEA 5HLFB 3UCUP 1VK3A 4NZ7A 3VVUA 2ZUGA 4NE9C 5F9LA 3K5MA 1T05B 1QDUB 1HBNB 1YGYA 2F65A 1FRHA 2H5IB 1YWXA 2Z58B 3FMBA 3R3TA 2V2VA 2WVDA 3AXMA 3LGHA 4WYLA 3TNVA 3ZTPA 1YJRA 3THTA 2F7VA 1CULA 2MQMA 2MGZA 4NCGA 2OELA 1U45A 4A8MP 1O5JA 4YB5A 1UTAA 3ZZYA 3T1YJ 3BQ0A 5IQ6A 4EBDA 5CABA 2D9PA 1SI9A 2XNRA 3TUJC 1A6LA 1AA1B 5KFIA 4JV2A 4L75A 1UVMA 2OSQA 1S1XB 3TAMB 4ZJLA 1U48A 3BGFA 1QTNB 3O3LA 2DY9A 3DM2B 2YPZA 4X4OA 3EX7B 4DV0F 2U1AA 4XAKA 3M9NB 3LWLA 1TK0A 2CQ4A 3CCTA 2D7SA 4LQ9A 4R8UB 2ATLA 3UR0A 3MMBA 2HWHA 5DDPC 1WHYA 3HSJA 4YQWA 2YKOA 3VGTA 2FGCA 2HHHF 4FPIA 3Q23A 1REGX 3BKTA 2YNHB 4NLOA 1H2TZ 1AB8A 2C22A 2W24A 4DUYJ 5BR8J 5M2PA 2W01A 3NGKA 4KHMA 2QLFB 4Q2LA 4LFCJ 5HATA 5KFCA 1VGYA 1VBXA 3GQCA 2MQLA 4I0WA 5E0OA 3L4BC 5LMNF 1RT6B 3AODA 5IT9U 1FA0A 4X4PA 2IC3B 4ETXA 2QV6A 3CCES 1HYSA 3M6WA 2J7KA 1U09A 1LWCB 3C19A 2GJ2A 4OHWA 5LMNJ 2VG7B 3KLHB 2GX8A 4DV6F 2R8JA 3SSSA 4ZN1A 5D77A 4KFBA 2YXLA 3TZZA 4F3OA 2G0JA 1VI7A 2GS8A 5HVFA 5A8WA 2W9CB 5KFAA 1IKWA 1FXRA 1NSPA 4CZCA 1KQSR 1VMBA 1IVZA 5HQLA 3LUYA 4N77A 4YDXA 5HN0A 4DCOB 5HMYA 1A9NB 4CM2A 4WKRA 2A6OA 3V6KA 4TN2A 2HAFA 3BJYA 1IKXA 1S1WB 2LA6A 4KV8A 3GB0A 2GC8A 4YUDA 3GV7B 1WKJA 1UKUA 2R7TA 1YKWA 1HI1A 2BKOA 3I6PA 3HCXA 1SH0A 5KFPA 3CD5A 1RWOB 3MM6A 1M90T 5HP1B 1VBKA 3AT1B 1S1TB 4QR0A 3PKYA 5D0RA 2HMIA 2HNYA 4WFBQ 2HHUA 1J2VA 4GVBB 3HVWA 2HS0A 4U7UK 2DXFA 4ES1A 2X1AA 5U47A 2H9ZA 2NXUA 3BN7A 2N82B 1OSDA 3SFUA 3IM8A 3GG0A 2O01C 2RQ4A 4OX7A 5T7LA 3OLBA 1EQMA 1P8GA 2QLBB 3IRXB 3LP0A 4LIWA 1U2RA 4ZPVR 3HULA 4QWBA 1P9YA 3T6JA 4F7VA 3TZYA 4RPFA 3OSNA 4ALZA 5ETVA 3HJFA 4LF1A 3DRXA 4NLDA 2CDRB 1Q78A 3Q2SC 1X0PA 3FBBA 4CDIA 2CQPA 1H6KX 1IBMJ 3OL8A 2ZUAA 1N6QB 2BKNA 5KG0A 4EMDA 4P2MA 4UT4A 1IBKF 4IRDA 3CJ4A 3UVJA 1B0PA 4N7TA 1T11A 3D67A 5LOQA 1Q0NA 4WFAQ 5EGYA 1VRTA 5KT5A 4DWIA 4KPCA 2AJQA 2DGUA 2NXJA 3MOZA 1V3SA 4P2SA 4CQ1A 1K73T 1VJQA 4K4XA 2HS3A 3HSZA 2LQBA 1RWNB 3G86A 5LXRA 2K1RB 4CLWA 2R42A 3OL6A 3OVBA 4ATNA 4EZ9A 2FJWA 3CJQA 4N56A 2MYFA 3VZIA 1YZ6A 2DIUA 4IH6A 1VFJA 2LMIA 4WFYA 1HR0F 4PWWA 4URGA 1S6PA 1IBLF 1L3VA 5L1JA 2HNDB 2D1CA 3RB0A 2QT7A 1WORA 1YZ7A 5JJBA 1NZ8A 1OY9A 4O3OA 4WF9Q 1YITS 3AQPA 1VC0A 4DSEA 2HGLA 3OBIA 2J8AA 2Z2YB 2MQQA 4P52A 4ELTA 2FLLA 4JI8J 1M5VC 5D3GA 4YOEA 2YNGB 3EZUA 3Q8SB 3KWMA 3VAKA 4JI0J 1DZ5A 1ZAVA 2OEMA 1WEXA 2IY5B 5ETOA 2RRBA 5B09A 4JI7F 4BDPA 4GVLA 4B3MJ 3KKFA 1XMOF 3CO0P 1FO1A 3E01A 2PIIA 4KJIA 3S01A 2HHWA 2BRLA 4OI6A 1MWYA 4FNHA 2RHSB 2HZCA 5KFTA 2YKQA 3DI6B 1KDNA 2CXEA 3NGSA 5CYJA 1RGVA 4R0JA 2D3OR 2Y1LB 5HO4A 5A8RA 4DQPA 2ZJPQ 3BGUA 4P74A 1U0SA 4LT6A 3MEKA 1SL2A 2D74B 3NWRA 1XR7A 4LF8F 4NZ6A 2C2DA 1NJWA 2E66A 1WELA 2KM8C 2RUSA 3R6GB 1L3KA 3N6LA 3T6BA 2FB0A 1HNIA 1N5QA 4YB7A 3KK2A 2VJVA 4LF6F 4FYDA 1S12A 4RW6B 3WC2A 4LSNA 3IS9A 5KG7A 2WOMB 2H3EB 2QC3A 1DQ8A 4I69A 1OS5A 4OV6A 3BGRA 5DLGA 3BB5A 3KDOA 1U1OA 1SIZA 2JHEA 3GJSB 5MLCV 4CLZA 3CUNA 4DV3F 5DM6Q 2KG0A 3W3SA 2G2ZA 3CGIA 4ZLNA 1S79A 4KHPF 4QU7A 2ZH2A 2XI3A 5HANA 1G7CB 1R8HA 2CG4A 4QR2A 4W92B 3OV7A 1VQMS 4KHPJ 4Z2XA 3MAAA 4FS2A 4NASA 3BKUA 3EXCX 4ZVUB 4DV0J 3M8QB 2ABYA 1NB7A 3KLFA 2HFUA 2V9KA 2XZDB 2MQNA 4G65A 1FNOA 2B0GA 2GVZA 1BUXA 4FPRA 4NLQA 3NOCA 4ICLA 2QFJA 1SUQA 2MKSA 3B4MA 4NPOA 4NLVA 2GGPA 4K59A 3SFGA 1S6QA 4DR6J 2M7SA 3BH7B 4RL1A 4A8YA 3UO0A 5SZTA 3NNHA 4NOHA 3W1YC 4AE5A 4CLSA 2YKMA 3W60A 4F3QA 3PM9A 4M5LA 1X4BA 3GYNA 1FRMA 3MCOA 2E5LF 1DFDA 5LMUJ 2DNMA 4KY3A 4JI2J 1BD6A 1LWFB 5AE2A 1RTHA 4DMZA 3EGVA 3MM5A 4M5MA 3FKBA 3C6UA 2VKZG 4N8NA 3N79A 1EJ7L 3HHLA 4FYYB 4PQAA 4ZKAA 2V4QA 2VJUA 4JI5J 2QZ8A 4EUVA 2MZSA 1FD8A 3VGSA 2R9LA 4DV7J 1M0SA 4F8RA 4W90B 2XS7A 1NAQA 3DOKA 2HYIB 4HYKA 3ONQA 5B0EA 4RWXA 2ALZA 4EEYA 1PBUA 2AJ2A 1KC8T 4OYAA 1RTHB 2JRSA 2HHHJ 4B9VA 1IQZA 3O2IA 3IMQJ 1NKEA 1IJFB 1NSAA 2BVZA 2YWHA 1UZDA 2CYYA 2QL7B 1TK8A 1SH3A 3MF5A 1RTDA 3HPOA 4LFBJ 1FEEA 2B9WA 1N36J 4NLUA 2EW9A 4ZITA 4WXWA 4NEYA 3GILA 4QQBA 3LWMA 3EM1A 1TL7B 4TKTA 2XLKA 2M4MA 5H1SV 4KGKA 4YB1P 3HK2A 1PG5B 2GVZB 5D0GA 1FXDA 2RRNA 2V94A 3PW5A 1X0FA 4IRCA 2IAJA 2CUYA 4O3QA 1GTHA 4WK1A 1KS2A 4O3RA 3B8HA 3SV3A 2IJNA 2OFHX 4OJ1A 2JDJA 2AZ3A 3JTOA 1GMVA 3NGRA 4C8NA 2EG1A 3CD0A 4KGVB 1RUSA 1AYEA 2EBEA 4C98A 1S76D 2MJUA 3FJ2A 3M9MB 2IBOA 3KJVB 4V1Ak 3QJPA 4ZJOA 3TQ1A 2AKWB 1U8WA 1JWWA 4U67Q 2BW7A 4C8MA 1PSDA 1H7XA 4ITSA 4F26A 1HHTP 4ZDNA 1JJCB 1JK9B 2FJEB 2CJXB 4FVMA 1CSJA 1Y3JA 1VJWA 3I4PA 3IS9B 3K5PA 2KKHA 2H54B 1UJ5A 1HNIB 4IO9Q 2XY7A 4ELUA 5EUHA 1F2GA 1NK6A 4LBIA 4XIUA 1VQPS 3DLLQ 2QMWA 1VRUB 1SQGA 2YQ1A 4U95A 5KG5A 3LOUA 2UUBJ 3PY8A 1KHVA 1R6YA 4C48A 2LKZA 3G96A 4CI0B 5L38A 3DCAA 4A8KA 4PPDA 5C24A 5A8RB 1XMQF 1EQ0A 5HMWA 2FJXA 2AYEA 3DOMB 3OHBA 1L3SA 1WWHA 4YEAA 5GMKa 1BQXA 2B4UA 3HXMA 2DY1A 1F9HA 3ISZA 3K2YA 3NCQA 2YH0A 4JI6J 3C3LA 4OYMA 3W9JA 4J9NA 2J9DA 4BS2A 2DB1A 2P8IA 3ENWA 1UPPA 1WC0A 3A3PB 1RAHB 2W9BB 2F8MA 4K4ZA 4WZMA 3Q8RB 2ACMA 1FFWB 3M8YA 4DPXA 1YBAA 1KSPA 2JWNA 3G82B 1IKYB 2OPQA 4FF4A 3AA9A 2NZ4A 3GIIA 3KNGA 1RAGB 1JLFA 1S1VB 1MMLA 2RS8A 4YY3J 3V4IB 2QTWA 1S6PB 1VIOA 3ZC4A 5I3UA 4LRFA 3GLJA 1Z4UA 3JTNA 1EZZB 1LFWA 9RUBA 1CLFA 2HBRB 3AQOA 4ANEA 1VYAA 2F63A 3M7VA 4I2QA 2HS4A 4YFUA 1F6TA 2VBZA 2H4WB 2V8HA 1FJEB 2UUCJ 2KT2A 2M88A 4XPEA 2H4YB 3TZWA 2OEJA 2GCFA 3TA0A 4WK3A 1UAWA 2V0NA 1RLCL 3HHKA 4HH0A 4IH5A 2UU9F 1EAYC 2VOPA 4WE1A 1JB0C 1VRTB 3DLEB 1K9MT 3A8IA 3AH6A 5KFMA 4EBCA 2HIYA 2FZCB 4MMOA 3RAMA 3U1MA 2GHVC 3O44A 4P75A 2IMOA 3M8PA 2JNJA 4PG4A 3VAHA 1NK0A 2V9WA 4N76A 1WC4A 1FJ7A 1S0NA 2D9OA 1HI0P 1FDDA 2E1MC 3AD8C 4HKQA 2GVDA 4C11B 2VICA 1N33F 2DPJA 1X7VA 2JEJA 1T9VA 1V6HA 2K3IA 2DKOB 4LF7F 1HI8A 3RU0A 3EVOA 1FF2A 1R89A 2ZNYA 1VDHA 1MWZA 2VBXA 4QPTA 3BBCA 4PAAA 1PBAA 1X4FA 2XMVA 2G0CA 2MHNA 3FDSA 5GADU 3K5OA 2KM8B 5GMDA 1CVJA 1S1TA 1YLXA 2B43A 1U1RA 2VOOA 2ROGA 1VQ5S 4TYAA 3HI9A 4E0DA 1KEKA 4E98A 3BQ2A 5L1IA 1JLCA 3I96A 1KQKA 4G3IA 4KV8B 3TZXA 3PFEA 3OJSA 2LQJA 1X4AA 1SJ1A 4UQGA 4LFBF 2QN6B 5HK4A 4HI1A 4CO1A 2LVWA 1Q7YT 1JNZB 3V6HA 4JP8A 1S59A 2PA3A 2QSFA 2QG9B 4A4JA 4ES2A 2XWYA 2W7AA 1QSYA 4PUOA 1FJGF 2HSEB 1ZH5A 5GAEI 1H98A 3BZQA 5CA5A 1RABB 4X84A 4EYIB 2Y1RI 4DR4F 4LF9J 2A3JA 2VQFJ 1Y5NB 2AMCB 4U96A 1GXTA 5FDLB 3KLHA 2UVUA 4RU9A 3CC4S 5FLXY 2G4BA 3CJTA 4S0MA 1V3RA 1LWEB 1SBRA 4Q8EA 3IP0A 2E5LJ 1XNQJ 1XBWA 5CD4A 3PYFA 1JLGB 4QR1A 1KONA 2CQDA 2GHWA 2R7WA 2OMOA 3PDNA 2V63A 2IPOB 4C0BA 3LF0A 1QAXA 1QSLA 3SCLE 4NCAA 2ASDA 2FZGB 1H73A 2IM1A 4R8UA 5IM0A 4CH1A 1FJGJ 2BOAA 4CO5A 4EO8A 3L7OA 2R7UA 1ULRA 3AHPA 4ZP6A 1FI4A 4DSKA 4YR0A 4ZVEA 1HNXF 2IMWP 1A0OB 4PZVA 1UVLA 4I2PB 3BEGB 3GIRA 4OI4A 4AT1B 1FDNA 4MK7A 3U7JA 1YBTA 4TY9A 3HKWA 4ANDA 3KTQA 2C2EA 2BW2A 2F40A 2XULA 5LM7E 3SQGA 3LPYA 1U25A 4IG0A 4C3KA 4DX6A 4OL8A 5KFVA 1XMQJ 2X1FA 2J9EA 3PXGa 3MXHP 3FEXB 5GAHI 4LF4J 3NMRA 2WSFC 1OMSA 4N47A 3PX0A 1N48A 3GJTB 2MKHA 4F02A 2UXDJ 2Y8WA 3OUYB 1ZA1B 3FC9A 4I68A 4LF2A 4TU8A 4LBHA 2KH9A 3K5NA 1RBAA 1RTJB 2BANA 1UPMB 2EXUA 4OYZA 4X4QA 4FBUA 5L8RC 2PD1A 3C16B 3MEGA 4X4SA 4IRKA 5F0UA 4TY8B 3FZBA 3T9ZA 3D9BA 4I6WA 1VS3A 4Z7CA 4QWAA 3NCPA 3KYLA 2AP6A 3O1LA 4CYUB 3DLKB 2DR9A 4HTIA 2OKQA 3M8ZA 1YHQS 2EEYA 2WVEA 4JYAJ 3N28A 2XMAA 4M8LA 4DR2F 2RKIA 1GT8A 1NXIA 1SVDA 4MAKA 4ZVHA 2ZHAA 1VC6A 1VQLS 1J5OB 2OPSA 4PYAA 3ILIA 1AW0A 2RDDA 4YR2A 2EKYA 1U1KA 4JI3F 1CS4B 5EX3A 4ILMA 3MURP 5J1NA 2B3TB 3FQKA 2R2UA 3C14A 4Q0BB 2QA4S 4ZP8A 3OLAA 3T1HJ 3DLBA 4HACA 5KT6A 2WW8A 4PG8A 6FDRA 2DEIA 2CA9A 2V34A 4ZHRA 2C1EB 3THPA 1GTEA 5C42B 5IWAJ 4RO0A 2NXEA 2OSRA 1WC1A 2Z30B 2CZ9A 3UDCA 3DXBA 5E3AA 2KB2A 3GIMA 2W7OA 4F4XA 2VA2A 3MPUB 3N4WA 3U1NA 4C0OC 2HPUA 1DTTA 3BO2A 4KB7A 4ZCIA 3UI3A 3H5XA 1HBUB 5K20B 2MQOA 3ELHA 4NI2A 3KLEB 1RTIA 1NK8A 3MTJA 4XO0A 2B6AB 3DMJB 2I8EA 1JJHA 1FT8A 1RAEB 3H20A 5HSPA 2CJYB 2FPHX 4EGLA 2EFNA 3G8SA 3RB6A 4K0KF 2WSCC 1ZM4A 2V4JA 3TP2A 3T5HA 2N3LA 1HBMA 1RADB 2FDNA 1EP4B 2EG2A 3AJ2A 3D7SB 1JLEA 3GSIA 1VQ8S 1TL3A 1CJTB 3LP2A 1R8CA 1Y9OA 4DJBA 2KRBA 2VQEJ 3CD7A 4TVAB 2EK6A 2GO8A 1CQMA 1U24A 3M2UB 2C2ZB 2E5IA 4FYXB 2CQBA 4MJKA 3TARA 3OFGA 3SCIE 1E6VA 3IWXA 3MZIA 1MWQA 2CJQA 1JIHA 2AEJA 1Y5LB 1QD1A 4F3MA 1UWBB 1J27A 2W7PA 2QX0A 3PO4A 5D8HB 3W61A 4OX9J 2A0FB 1M1KT 5F8JA 2W1BA 4FF2A 5IT9Y 2AF6A 3P8BB 2CPEA 1VQKS 5IC4B 2FD2A 3WIUA 1I1GA 2KL8A 3ZTOA 4M5DA 2CVEA 2MZJA 5K8MA 4MKBA 1UVNA 1KR4A 3LO3A 4NRTA 5B0DA 1AUDA 1TL1B 4CRJA 4DX8H 2NLWA 3HHNB 2IYIA 3C6TA 1CJUA 1RHJB 4BWMA 4NLTA 2DRBA 1QVFR 1KFDA 5BYQA 1WACA 4F4ZA 1Y4ZB 3NS7B 1WKLA 3ZZRA 2NREA 3BH6B 2J7WA 2XGPA 4P2FA 2FVPA 3O8WA 3G71S 2B7CB 1LW0B 4MTPA 4C97A 5J1EA 2C2KB 1K1QA 1Y7PA 4HHHA 2ZH8A 3ETOA 4WP3A 2I2YA 2QMUB 1H74A 2B56A 3W5YA 2G13A 3TR5A 4ZVFA 5MAOA 1K1SA 2LXIA 1FJCA 4CLPA 4BLGA 3H4DA 2B7BB 3SDEB 2ASLA 4JV0A 2ACYA 3LANA 2CFXA 5HBMB 1QAJA 4ED5A 1HQUA 4IKAA 5J2PA 1RWKB 4W4MA 4A8XA 2GIFA 1ZS6A 1DRZA 3I0RA 1NHUA 2DHSA 1IUJA 4TLRA 5KT3A 5KOXA 3DU5A 4JI4J 4ERDA 3E8OA 2CNNB 4M5KA 4RW8A 3QWPA 2DNPA 4QPXA 3EPIA 4WP9A 3QAUA 2NXCA 3TJ8A 1BGXT 3CMES 4LSLA 3FCVA 4RNNA 2YNIB 4H4KA 1JLAB 1XR6A 3OXFA 4K8RA 2QA2A 1WG5A 3QIPA 4DV1F 4LJMA 2IVFB 1IBCB 1IBKJ 1FCAA 4A8OA 2JVOA 5E33A 2XHWA 5HROB 1W26A 3H25A 4RW4A 3D3CJ 4U7UD 3HFZB 1ZBTA 3H7HB 2NUHA 3PG9A 4RKUC 3EE3A 2ZITA 1TVRA 3R5DA 3HVRA 3LALA 1KP6A 2GAGC 2VODA 4DCJB 3GMGA 1VHFA 1Q82T 3ISNC 2PC6A 1N34F 1VQ7S 1T9TA 1HNVB 4ZPBA 1DARA 4IG3B 4JV5F 3HZGA 1LW2A 2C3YA 1F2HA 2KI2A 3C8YA 2VFSA 4L72B 1RT4B 3PV8A 2J0WA 1ZZNA 4IFYA 4CLTA 3PO5A 2RF2A 2KFZA 1P1LA 4NRUA 3FFIA 3GCWP 1MLAA 1S48A 4B9MA 2KN4A 3NGUA 5M2RA 3CXCR 2IM2A 1OJ4A 2XMJA 1C0UA 3OTBA 4LSZB 4DN9A 2VV5A 1NEEA 2QJ3A 2HHVA 1NDLA 3NBPB 1HBOA 4CIOA 5ETQA 2HFSA 5ETPA 1YQHA 2H5EA 1EHWA 1HQEB 1TV6A 4WBFA 2DNYA 4NLGA 4IH7A 4DF4A 3W2VB 1U1LA 1H0HB 2Z2MA 3U1LA 4B3TJ 5KFJA 4ILRA 3TUIC 1RWUA 2DHAA 3M2VA 3CDEA 2FC8A 4TLQA 3ZZUA 4CT9A 4USMA 4JOUA 1OWXA 1IBMF 5HMZA 2GIQA 2XLIA 4A8FA 2IRUA 4DV6J 1FEHA 1UL3A 5J2NA 1JXEA 3A3NB 3QT5A 4CP5A 1L3TA 1VLOA 3CO9A 2I9SA 2AW0A 2E29A 3KHGA 1HHQA 1Q7LB 2L9WA 1RAIB 2W9AA 4QW8A 4NCBA 1R43A 2JLEA 2KJVA 2CVIA 3RBZA 1HWLA 2XSJB 3GPAA 3T19A 1VBZA 3GWCA 1XWLA 3RBDA 5DZ7A 7AT1B 4HVZA 4ED1A 2I0XA 1XK8A 2Z8QA 3BREA 3NEKA 2AU0A 3DGVA 1SH2A 4M5HA 2DCLA 2XI2A 3DRPA 2HRYA 4FYWB 4DG1B 5F8HA 3OXGA 1FWPA 2E1PA 3E51A 3NKYA 2CQ0A 1EB0A 1HPZA 1U1QA 2DR5A 3MMCB 1C4AA 1ZAWA 3DLGA 3JTPA 1KTQA 2MKJA 2G2YA 4NZ0A 2JC0A 5IQQA 2V8VA 5THWA 3RB4A 3D28A 3RAQA 3OJUA 4UW2A 2BXJA 4J5OA 1SB6A 4JI0F 4JB8B 2HFZA 2YQ0A 2R8HA 4J9OA 3RR8A 3TYTA 3X3UA 4BHQA 2CQHA 1RT2B 4NLRA 5AJ3F 4DR1F 2OH2A 2LXFA 3NL0A 2IRYA 1SQEA 2FLOA 2J7UA 3TOQA 4C8LA 2MDAA 2EFOA 4PPZA 2ZD1B 1T3OA 5CYQB 2XWXA 5CCMA 3TW0A 1F60B 2AJ4A 3TUZC 2PFFB 4RX6A 4MIBA 4QIWD 4F4AA 4ECQA 3C2PA 4LF5F 4P7VA 3US5A 3X1LB 4ID5A 2CDQA 1Q1KA 5ETMA 4I67A 1H38A 2BJ1A 3M2RB 4NA3A 2KZZA 1S97A 2HHXA 4HDGA 5D0EA 5FJ4A 1QLNA 3HJVA 4WU3A 2ZZMA 4A48A 1FKAF 3CCRS 2CPFA 3TEGA 1GFWB 2B9XA 2QL5B 1HWUA 1WHWA 2OD4A 3PRVA 2KG1A 4DQIA 3W7BA 4V19X 5AXLA 3MMCA 4G6VB 4P73A 1PC4A 4WTOB 4X66F 1HPZB 4Q2MA 4ED3A 3HD1A 2WRMA 1B4SA 5C5JA 4USVA 1WF0A 3H98A 2K7KA 1FKOA 3DRPB 2RRAA 2Y1JA 4AUKA 1MROB 1QM9A 1UEUA 1ZM2A 3MM7A 1T9XA 2BE2A 2M0GB 4HT5A 4P6QA 4Z7YA 5RUBA 3HFKA 3PW4A 1FD2A 2XSJA 3GJRB 1DHMA 4HH1A 2J9CA 1YJ7A 2JSXA 1NDCA 4CLYA 2W2MP 3OTDA 4Y28C 2H1YA 4L74A 4DUZJ 1DJ0A 3I0SA 1PC5A 3ILJA 4K2JA 5DGAA 2H48B 5KG2A 1M5KC 4DR6F 4RW9A 2MY7A 3QLHB 2K06A 3IBWA 3M1VA 4USWA 5DDOC 4TU7A 1A7GE 3T5KA 2LP4A 4QZVB 3POTB 4O44A 1NPRA 1RHRB 2XCAA 2VF3A 4QW9A 2Z56B 3DC2A 4XTTA 2YKAA 2EI5A 1NHKL 3W62A 3D1QA 3UFCX 3CJ3A 1IR1A 3BKFA 1TV6B 3CT9A 4KBIA 5KT7A 3KUHA 1RT7B 1HBOB 4IUFA 4FYVB 4KGXB 4LUBA 4EK2A 3V81B 2BV3A 2D3UA 4C3MA 1FXLA 1BWEA 2G1DA 3SSRA 5K5MA 3VAFA 2YKPA 1GK8A 3DRSB 5DQGA 2N7CA 1LFPA 2MPUA 4RBTA 2GAHC 1APSA 1S7HA 1S9EA 3MEDA 3B78A 3KUGA 4UOHA 1W7WA 4A47A 2E5GA 2EPIA 2QMXA 5K14A 1HNVA 4L6V3 1UFLA 3NS6A 1N36F 5IC6B 3CIMA 4A46A 4UZBA 4WXOA 2MB0B 1NK5A 2RNEA 2R7OA 1X4EA 3UD5A 3VWSA 3ICLA 3G2XA 3GG1A 1HNXJ 3ZZZA 3HP6A 2XO6A 3MR2A 2E7VA 2G1HA 2ILZA 4CO3A 1U47A 4GO7X 4U8YA 1VIXA 4DR5F 1I6JA 2ZFHA 4RW4B 5A2QU 2Q79A 3WIVA 3CMQA 3MM8A 5HROA 2YWGA 1NPPA 1K0VA 3KG4A 2YWKA 3J7ZT 1N5TA 2D41A 4UUXA 3HMJG 3I31A 3ZZTA 1UA1A 2AIRB 2OLWA 3TVZA 5J1PA 4J9SA 4LSLB 1WG4A 3NGTA 2PMHA 2ADCA 4EBEA 3MTKA 3M32A 4F0MA 2ZWOA 2UU9J 2P9CA 5ETSA 4WWSA 1X4CA 4MKYA 4CH7A 4ECTA 2XYPB 2VFVA 4H4MA 4IYQA 3MR7A 2FLPA 3T1HF 4AL5A 3HDSA 4CM0A 1WUUA 2Q66A 4LF9F 4JV5J 1HD0A 5ETTA 4MFBA 2J0SD 1RSCA 5ETLA 3KDNA 3GIJA 1Q16B 4ZVGA 4B9SA 4X4VA 3VTIA 1B70B 3MMAA 2EFGA 1OY8A 4HT7A 3IFEA 4K7QA 3H5UA 3PJ9A 5HI7A 4OHXA 1HR0J 5J1EB 2DNLA 2AV5A 1GNKA 1O6XA 4USTA 1UA0A 3M30A 4ED4A 4OLOA 1FRJA 3PEHA 2NPFA 4F4WA 2CPZA 3VQSA 4C0HA 5J2QA 3N9UC 2M8HA 2Y0BB 2R8KA 1F9EB 2UUAJ 4CT8A 1SV5A 4USJC 2CIMA 2DVIA 3ILLA 4EU0A 2FJVA 1CJUB 2FJBB 2E1AA 1VISA 2DNRA 3I4HX 1EETA 1D3WA 2YWEA 3BPDA 3QRQA 2XMMA 3BS9A 3BDPA 4KHRA 4NLWA 2HIQA 1TKXB 4J9RA 2VL1A 2QYCA 5IFMA 1X60A 2MMYA 1KKHA 1G2EA 3R5GA 4RBUA 2OAUA 4B3RJ 1NDKA 2DNOA 2HWTA 3W63A 2UXCF 2AJ0A 4G1IA 4DF8A 3BYRA 3TX8A 1N34J 1RYSA 4ZOSA 4RNFA 2J6TA 3JSRA 3C46A 3KHHA 2XY6A 3HVTA 1C1CA 2R8IA 2GQCA 3KXDA 3VVTA 3VQTA 2J76E 2E44A 2RIJA 4KKOB 4NMXA 4CO0A 2Z4PA 1CJTA 1RU1A 3D4JA 3G6ES 4B3MF 1JLEB 1EP4A 2VPXB 3IXQA 5A0YB 1OPIA 3MEEA 1HWIA 2A2CA 4YHHF 2Y1IA 4ELVA 1MU2A 3VGVA 3H90A 4OMFG 2NR0A 2L41A 5CYMA 5EWGA 1EKSA 1S99A 3DMJA 5H9FJ 1NJZA 2P6SA 4F4KA 3VV2B 1N52B 2LEPA 1PILA 3KLEA 2EFQA 3JAMY 5F3TA 4DUZF 4U6PA 1T9UA 1X4GA 2ZJQQ 5AXMA 2HHQA 1DTTB 2JX2A 3QJJA 1JKHA 1M5SA 3GZ7A 3O5TB 2NCKL 2HNZB 3IR6B 4WCEQ 2OUGA 4UUWA 1FDBA 2C3UA 2DPIA 2DGWA 2GW8A 1YVFA 2GZOA 3M8WA 3UW1A 4J9KA 5H9FK 3C14B 1CG2A 4G1PA 4LR8A 4Q0BA 4MH8A 4CLKA 1TKTA 1NO8A 4ANCA 1FX4A 1KNZA 1RCOB 2VFRA 4XDDA 3PW0A 3CVKA 1OYDA 2V2KA 1OO0B 2BA9A 3IR7B 3JQJA 4PR6A 3R7SB 1BQMB 2MZ1A 2XCPA 4ECSA 1B7YB 2B4OA 2V69A 2ZWPA 4DL5A 3KK3B 1YBUA 3MR3A 3TANA 3RRGA 3GYGA 1S49A 4N41A 3W66A 3TUPA 3QATA 3ZNUA 4DSJA 2BJ7A 1FTRA 4ID8A 4M1KA 2ZH9A 2OPRB 1WDTA 2XQCA 1T3NA 3DLKA 2B8QA 2BE9B 1FX2A 4X64J 1OSCA 4X4TA 3MWBA 1YTYA 2DGSA 2KYXA 3M6XA 5K8OA 5JVHQ 3IG1B 3LAKA 3EYZA 4ZVSB 4TNOA 3RG6A 4DV5J 2XS2A 3CD6S 1V5VA 1WF2A 2FYXA 1RI7A 2ERRA 3CW2C 2VA3A 2HK3A 5GADI 3CJRA 1UMJA 2DH8A 2EVZA 2DNQA 3BBBA 4O0NA 3ZZPA 3GV8B 4KC5A 4IG0B 4ECXA 3Q24A 4MK8A 2EC0A 3IAM9 1IR0A 2EWHA 4LMZA 2JVRA 1S9GA 3QQCD 2H5JB 3WZ0A 2RILA 2E5HA 3EJMA 1TUWA 3ENVA 3PJXA 2R2RA 2V2ZA 2I5JA 2VG6A 3JYTA 2I5JB 2J8SA 2VG6B 3GE9A 4Y2CA 1VBYA 4J37A 5IM0B 3VAIA 1B7FA 3KJFB 5AXNA 2RD5C 1YX2A 4K4WA 4V19J 3DRYA 3ET6A 2IM0A 3R8YA 2ZH5A 3PEJA 1J5EF 4OJ3A 3OPKA 3EXYA 1VQNS 1LKZA 3LGMA 4DV4J 5E3CA 3U27A 5A76A 1VLYA 2C2RA 3QSIA 1U6BA 2HW3A 4DDFA 1PGZA 1DQAA 2KRRA 3FSXA 4I7FA 4U9RA 5C2CA 3J80Y 3MR5A 2HGMA 4F50A 4PQUA 4GKKJ 4LF6J 2HZVA 4M94A 2IA0A 3MI7X 1IXKA 3MGJA 4ZVPB 1F0XA 2B9EA 4DR3J 3R2CJ 5IV3A 5KT2A 4PWDA 2PE8A 4KSEB 3WX4A 2OO4A 4KT0C 4AL7A 1RT1B 3EDRB 1UETA 4OX8A 4YMEA 4WIIA 4PUOB 1OPZA 1GMWD 3FCHA 1AFJA 2KXHA 2AWZA 2W25A 5FIIA 4NL5A 1JXLA 2VHGA 1SJ4P 3ZNJ1 3R5JB 2BZ2A 1WSVA 3K17A 1N54B 1RZMA 3R2DJ 3GONA 1VOMA 4ZK7M 2K8GA 5I42B 1NSQA 4YR3A 2RJZA 1FFSB 2VG5A 1TKTB 1XNQF 2VC1A 2CPHA 2W2NP 4IOCQ 4DQRA 4JI4F 1U8SA 4DBQA 4M5JA 2I1RA 2C2OB 3B4DA 3D5MA 4OQJA 4I6YA 1Y10A 4CTAA 1LQ9A 3D6MB 4USHA 1S6UA 2DR8A 1SC1B 5F0WA 3ZXWA 2ZHBA 4HL9A 1CPZA 2HNZA 3J81U 2MLXA 5LSOA 1WC3A 1JKHB 2VG5B 4QOTA 1VQ4S 1RJJA 3T1AA 1MN9A 2PGCA 2IA6A 4USUA 4ER8A 2QGFB 2DNKA 4C11A 2RQKA 1X9MA 1YJWS 5CXTA 2E5JA 3SXLA 3EDQB 5C7PA 3NRBA 2QO3A 2F4VJ 3D6TB 2GQQA 1KFSA 4C8OA 4X65J 4OZ0A 3MUMP 1ZTTA 2C3OA 5A0YA 2FTRA 1RT1A 2IYGA 2B4PA 3DLEA 5BJRA 2DBBA 4WE1B 4WIQA 5T41A 4PEOA 4BBYA 4DPOA 4J9PA 1JXVA 2HFOA 3CULA 1ELOA 3PR5B 2CJAA 1Q81T 4DN0A 5KFGA 2D3ZA 2RU9A 3SV4A 1SJFA 3MOJB 4YDDB 5KFBA 1NK7A 1Z2LA 4PWDB 5LSLA 3Q22A 2DO0A 1BMQB 3AOBA 3L7PA 1FRLA 2AJ1A 3JSMA 4P10A 3MD1A 1N56A 2XTJP 1FNXH 4K5RA 3UN3A 2HRUA 3UQSA 4I7FB 4DOZA 2DHGA 1RK8A 3S8SA 5I3UB 4PQUB 1ITPA 5T14A 5CH7B 3CCWA 1TKXA 1JLFB 4OZNA 1WG1A 3H42A 3UD4P 1GX6A 2OPQB 3K8WA 3OT9A 3P4UB 2YX1A 1NJXA 1QVGR 1FKPA 4MKAA 4ZVTB 4CH0S 5KFFA 3HO1A 2BJEA 4DV2J 3M05A 4ETZA 3M9OB 1EX8A 3NY0A 1NHVA 1SV5B 3KG1A 2DGQA 1Q5YA 4KGZB 3TI0A 2NQPA 2RMLA 4RR5A 3Q0AA 1XQIA 4L73A 1NM2A 1LXNA 1FNMA 4LIRA 4QWEA 3CDBA 1F1BB 3IM9A 4J9QA 2AGOA 2UUCF 2L3MA 1FVSA 1H72C 1Q5VA 4UOGA 2A10A 2VC0A 5C25A 2HBZB 5C24B 3GSDA 4NXNF 3A8JA 3MMAB 3FCWA 4DX7A 1VQOS 1TKDA 1TFWA 3CCMS 2E7WA 1S0VA 4ZCKA 4OZJA 4C3LA 1PCAA 2RT3A 3QO9B 3SMZA 5L9XA 1YJ9S 4B9UA 5D4OA 3KLGA 2BQRA 5IWAF 2BACA 1N0UA 4YS2A 3EGZA 4BC7A 4LFCF 2DYAA 5BR8F 3M4XA 3QRRA 2R3VA 1Q4RA 2YX7A 5KG6A 4C8KA 1N33J 5EN1A 2OPRA 4U8VA 5DS7A 4RUCA 4DL6A 3ISND 2W4DA 3ILOA 2HLUA 1U2CA 1YJTA 3AFGA 3MAHA 1VQ6S 2HKEA 3S7RA 4Q44A 1WDDA 1N8RT 3EZOA 3BBFA 1RHQB 2ZBPA 3LGNA 4ZLJA 3KK3A 1N4LA 1BQMA 5ETKA 4ZVOB 1QAIA 1VQYA 4F0HA 1GX5A 2HQDA 3P96A 3OQ2A 2GMHA 1LEOA 4FVCA 4PG7A 4B3SF 1UW9A 2MJNA 1IJEB 5DM7Q 5KFHA 2IAJB 1AROP 3R5CA 1UP1A 4OIXA 3PJWA 4ZP7A 1QTMA 4Q45A 2P9EA 1DAXA 5DO2A 5DZ6A 1PAUB 5K14B 4AXJA 2CQ1A 3DLHA 4B3SJ 1L3UA 4B17A 3R7NB 5JMNA 1VQSA 2WSEC 4LR7A 4LRBA 4USKA 3MCMA 2BQUA 3Q8UA 1JQGA 1U26A 4KH0B 3LAMA 4M5NA 5ETRA 1MG7A 3OVAA 3NLCA 3J7AN 2O1PA 3CCQS 5DETA 4CLUA 3TAQA 1XERA 1RAAB 3QGHA 4PXCA 2X3GA 2FVSA 3QIDA 1LK5A 4IO1A 4ZCMA 2IRXA 3MR6A 1K8AT 1MU2B 1S4EA 2LXUA 5B0AA 2DGOA 3DOKB 4OZ2A 2ZKUA 3AOCA 3SCJE 4ZMMA 3QJLA 1JLBB 2WB4A 5A6WA 3ZZ0A 1GXUA 2QSWA 2X1BA 2CQGA 3NXZA 4KKOA 4ZLLA 5KFZA 1S0OA 3QFWA 4OZLA 2DK2A 1RT3A 3CB4A 3HVTB 1FERA 1LWFA 1TL4A 3AAWB 2BKPA 2RVJA 2YX4A 3DHXA 2UV8G 3QYYA 3K58A 2VZ9A 3IWNC 3GFXA 3N6NA 4EI2A 1T02A 3BR9A 5CD4H 2HHTA 2YKMB 1WOPA 5KFXA 2WTFA 3FEYB 4OJGA 1S6QB 1KLMB 4UF4A 4R25A 2PT0A 2JEIA 1SUQB 2BEFA 2ZC3A 5B08A 1IWAA 2AX1A 2Q3PA 4N8OA 4DV4F 1EETB 2IDEA 1NZAA 1BWVA 2DH9A 2JOQA 2CJBA 2ZNZA 3FEZA 3MPDA 1EKRA 5KFUA 2B4VA 2U2FA 3IWLA 2AHOB 2UUTA 1B0TA 2IVYA 2O5DA 2Y9HA 5KAKA 4WFZA 1T9YA 2M9KA 4JI3J 3OR1A 4QIVA 1U0HB 2I6WA 4CNYA 3I9ZA 4N5SA 4QCLA 2RSQA 4H4OB 2QIFA 4PXDA 1X31C 2H65B 2A2DA 3JS9A 1URNA 2KDOA 1FESA 2ZBIA 4Q8FA 5AE3A 4K4VA 2CRLA 3EVMA 4NLXA 5DLFA 2DXDA 3M2RA 1TL5A 1ZPWX 3BGRB 3C15A 2ROEA 4L76A 3OD2A 5E41A 4DL0C 3R1LA 3CF5Q 2VPWB 2UXCJ 4JUZA 1RYRA 2C3PA 1RA7A 4QIFA 2O3DA 3VZHA 2CPJA 1TP7A 1HL6A 3RUBL 2HZAA 4NX9A 4FS1A 1HNWJ 1RHMB 4OI1A 4DUTA 2QE5A 1G6BA 4RW7B 2HHSA 4OLPA 5DDQC 1RDRA 3CTRA 1C2PA 5HVGA 2B5JB 3P5TL 4IFVB 3OR2B 3QZ7A 3KK1B 2WAQD 1DY3A 1NDPA 1O8BA 3M32B 3R7BB 3TWZA 4X65F 3DI6A 3G6XA 3A8KA 3OTOF 3GV5B 1U1MA 4DL2A 1S4FA 4FXVA 3UNGC 2GHPA 1BHNA 3H4BA 1KOHA 2WCXA 4C9DA 2LECA 1WF1A 3W5XA 2B9YA 1EIYB 4X4UA 1FK9A 2LQ8A 3MM8B 4DPWA 4ZIVA 3FVYA 2WW4A 3OTOJ 1H7WA 3L9ZA 3W8GA 4DV3J 5E3PA 1MW7A 2NZCA 4HHUA 3HHDA 4FP9A 2JH3A 1KHWA 4FNIA 1LWXA 2RDIA 5LSRA 1ZTWA 4DCPB 4F4YA 1KRPA 2I38A 2HNDA 1HNWF 4DR1J 3N5BA 1HW9A 1S9EB 2E1RA 5G4DA 2LU1A 3VCDA 2UXBF 3QT6A 1B99A 1S6OA 2ZE2B 4MYTA 1NLKL 2CPDA 2L08A 3A12A 2HWIA 1T94A 3CDUA 1HMVB 2ZZTA 3MPWA 4P72A 2VQEF 2F8EX 1RT7A 1UFWA 1ZOTA 4FDFA 2XEXA 4DPTA 1TMJA 3AB4B 5FLXU 3ADAC 3ZO7A 1RQ0A 5ADZA 1Z2ZA 2VASA 4K2XA 4UOCA 5H9EJ 3PFOA 1N32F 3QT7A 2BJ8A 3MCNA 4OV1A 2BBEA 1SL0A 3UDVA 3POTA 4O44B 3UVJB 4HDHA 4X66J 4RZRA 2XNQA 3CNQP 2VFUA 4F0KA 1N6QA 2BOPA 3NBPA 2J6UA 2DRAA 3M1VB 1HMVA 2W2QP 4H54A 4RW9B 5B0BA 1R0AA 1YJVA 3PYDA 3I0SB 2ZE2A 5A6PA 3QZ8A 2VB6A 3GP9A 3G6VA 3W8PA 3M8SA 3FFIB 3FUYA 4IQXA 4MT1A 5B0GA 3LQVA 4C8YA 4DS5A 3FZ2A 3UN5A 2ASJA 1RT4A 2Q6BA 1R0AB 3IR5B 1LW2B 5DG8A 4OZ5A 2ZDPA 3HHLD 2KT3A 2HQFA 3RW7A 1R31A 1SJRA 2HNYB 3MM7B 4A8QA 2HMIB 3F56A 3CCSS 2XB2D 3PCOB 4ZPTR 4OHZA 1LOUA 2FHOB 1PYSB 1RP5A 1OQ3A 1TVRB 5HP1A 3MM6B 1FFGB 2NXNA 3HT0A 3M6UA 5KFOA 4B9NA 2XG8A 2O67A 3KJQB 4KR0B 2DT9A 1WI6A 3CCZA 4QIGA 5CHCB 1SQFA 4USIA 1X9WA 1XNRJ 1KVJA 2Q1LA 1FK9B 2VPZB 3HHLC 1IKXB 1S1WA 1NSKL 1Y00A 2DGTA 2VDIA 3H59A 5D78A 5B0FA 3SSQA 3F73A 3PYEA 2WBMA 1U6ZA 5CCLA 1H3DA 3N0VA 1HHSA 1JLAA 2F3JA 5KFYA 4Y2MA 3UPFA 4K4TA 2HG4A 3D66A 1KLNA 2R8GA 2AD9A 4FKXA 3OR2A 3NGDA 3KK1A 2B5JA 4IFVA 5A8WB 4ID5B 4O0IA 2W9CA 4DFJA 3HLUA 1M5OC 2HVZA 3Q8PB 2YPYA 1W2BR 4CLFA 3KOAA 1GH8A 4RW7A 2DO4A 3CJ2A 2NUUG 4J7CA 1UCNA 5CYQA 1P1TA 5F41A 2HQ3A 4QWDA 1HYSB 2BJDA 4OYPA 1TUVA 3K57A 3I5AA 3NG8A 3PX4A 1RT6A 4B3RF 3R5AA 4ED2A 1F5AA 5GMEA 3UNYA 2WB1D 1R3NA 2MZQA 4J9LA 3QSYB 4LF4F 2Z2LA 4MK9A 4X4NA 3MCSA 3C15B 1YJUA 4Y3CA 1UEVA 3UDLA 4ECYA 1X8DA 4TYBA 4CWBA 1DBDA 2YNHA 1LW0A 4X62J 3EZ5A 4OI0A 3CJSA 3LTOA 4WTYA 3DN9A 2DIVA 1ZPVA 3FBFA 3VALA 5F8GA 4RNMA 1PKUA 2IFXA 4H4OA 3CCJS 3MMBB 2KTQA 1U0HA 2LEAA 2QLJB 3OR1B 2RU3A 4X2BA 3G8TA 4LBPA 3J81j 3KMQA 1Q8KA 2FY1A 4MIAA 4M95A 3DHWC 5F9NA 1TTHB 1VRQC 4QBUA 5BXIA 1WC6A 1SIWB 5D4PA 3C6TB 3FNNA 3HHEA 4QYZJ 1NPKA 2PDAA 1RHUB 1Q53A 1UJ4A 3B6BA 2EFVA 3T9NA 4GRSA 3V6JA 3ZTSA 1TAUA 3EICA 5HAOA 1RBOB 3NP5A 3CDWA 3HD2A 3I82A 5HQMA 3DDIA 4DEZA 5AE1A 1KLMA 4JV1A 1CULB 4Y65A 2MGZB 2OTJS 5JUMA 2CKWA 2DEJA 1N5YA 4NXMJ 5M2UA 1SJ3P 2UXBJ 1HBNA 2M70A 3PHTA 4CO2A 1UWBA 1Y5IB 4ZPAA 1T05A 2O66A 2DNZA 5HLFA 1T9WA 3Q8VA 4KE5A 5J2NB 3RZAA 4QYZK 4EO6A 1GMUA 3M2UA 1N5SA 1RT3B 1U7LA 4QWCA 5EWEA 3M2VB 2PI4A 1I94J 5D4LA 2ZVSA 4DI6A 5HL7Q 1JLBA 1HBMB 2Z2ZA 3W2VA 2WVCA 4P71A 2LU2A 2XBPA 1HQEA 3QPIA 1REVB 1K0TA 1ICEB 4O3SA 2GQ2A 1HFEL 1HLWA 3QGPA 1NKBA 1I94F 1VR6A 1JJ4A 2KFYA 4ED0A 1RLDA 1SPBP 1C0UB 2HFNA 2J5AA 3BN4A 4NI2B 2Y8YA 2R7VA 2H51B 3VAMA 4ZS6A 5KFWA 1T03A 3A1YG 1Y11A 2RF2B 4RBVA 1TK5A 2LQ5A 2JL9A 4AQYJ 3PKMA 5F8IA 4UOFA 1SKSA 2UVVA 1R7IA 3L09A 5KFQA 1PYOB 1R8AA 3CJ0A 4HACB 4I64A 4OYXA 2AEMA 2GO9A 5I3QA 4CCHA 3MAQA 3DU6A 3S1TA 1L5UA 3U02A 5KFDA 1JLQA 8RUCA 2PA8D 3A3OB 4DS4A 1CS4A 4JI2F 4KGMA 1TZ0A 1VHIA 2GV1A 2ZVIA 5EDWA 4DSFA 3BDEA 3AJ1A 1MMDA 1WOSA 2FHMA 2JJ4D 2YNIA 3I32A 3VAGA 1FHTA 2V8GA 2ZOFA 1S9FA 1YDLA 4EFAC 1SCJB 3M8RA 4RW8B 5K8PA 3KMSA 2F8HA 2HQGA 3JXOA 4JI7J 3E2EA 4CYUA 3ITHA 3CJ5A 3OFEA 4ED8A 1N32J 2DR6A 1YRXA 4F04B 4TY8A 3QNWB 1T0TV 1KOOA 5CQGA 1R8BA 3C16A 3MEGB 3KLGB 5HBMA 3NS5A 4KYZA 3K89A 4LR9A 2FJAB 3QO9A 3SDEA 5L1KA 1NNDA 3J7YU 2CAJA 2BRKA 1GMWA 1FRIA 2A1BA 2XMUA 2FIUA 5C2GA 2DISA 1S10A 1JX4A 5C25B 4LFAF 2C3MA 3WC0A 3CCUS 1UVIA 4K50A 4LVNP 2OJ3A 3D1OA 1KQGB 2DRDA 3BSCA 3TEHB 3HM9A 2UZAA 5A2QY 3PX6A 3HF5A 1IR2A 2V4RA 4I2PA 3SEOA 1FDAA 2DJWA 2VU5A 1XEZA 3N5FA 1S77D 4FXDA 1RAFB 4RUBA 3UE2A 2J0XA 2MXYA 3TA2A 2HVIA 2VBWA 3H2VE 1VCTA 4XK8C 4D3GA 4ECVA 4H4KC 1X4DA 5KTQA 2PN6A 4DR7F 2DCUB 2ZKTA 2ZM6F 1AXQA 1FKPB 1HQ2A 3GYXB 2XMWA 3EVWA 2CNLB 3NNCA 4BWJA 3QRPA 2ZBCA 3VGUA 4M5DB 2BABA 1EARA 3NMAA 3GTYX 3Q8YA 1URRA 5E3RA 2FQQB 2KXFA 2QEXS 2KVIA 4AXIA 3EGNA 5DRKA 4X4RA 4L3KA 3J7YI 2LYVA 3JSMB 3AXKA 1CBKA 3OL7A 1E6VB 4DU7A 5KOWA 2AJFE 2GIRA 1OQ6A 1PIEA 3JSYA 2SXLA 5FDLA 3KJNB 5D0HA 4DHVA 4WZQA 5D4NA 3JB9k 3K59A 3IGVA 3PHEA 1TL3B 3LP2B 2UUAF 3EPGA 2C42A 1X5TA 1B64A 5HMXA 4F67A 3A4TA 2GNKA 2KJWA 1WHVA 2BJ3A 3F44A 5H9EK 2V4JB 2YVSA 3QT8A 4NLYA 3SCKE 3D0IE 2R4FA 2QFIA 1S0MA 2R7XA 2R2TA 3CDAA 1SKWA 5AT1B 1FTCA 1HBUA 1RACB 3HSGA 1RISA 1YSJA 3MECA 1JLCB 4NEZA 1S1UA 2V68A 2YNFA 5F8NA 1WKKA 2JLGA 8AT1B 3OFHA 3IGNA 3RJMB 3N01A 2CPIA 3AA8A 3PRBA 3L3CA 4K4UA 3IBFB 2CZVC 3EMTA 2N4CA 2QL9B 2XY5A 4LQ3A 1UWAA 1GAOA 2OFGX 6AT1B 5C42A 1KD1T 2R7SA 2M2BA 4UY85 2DITA 4CTAB 2Q6CA 1N0VC 3TJ9A 3KFWX 2V6AA 2BYCA 2B51A 3D0HE 3FK4A 4PABA 4DV5F 3QMQA 3WHIA 3NNAA 2F9DA 4GKKF 2HHPA 2WVBA 2LQ9A 1N88A 1ZA2B 2R7RA 3K0JA 1U4BA 4IOBA 2HBQB 2LDYA 3I5CA 2BJ9A 5I42A 2GJIA 2W2OP 4K5SA 4ECUA 5IT0A 3D6HB 1F3VA 2CNKB 3R27A 4WFXA 1FRXA 1RWVB 1XTZA 3OTCA 2OPPA 3HT3A 2HVDA 1Q8LA 4HHJA 4LRAA 3I55S 2F9JA 2DTJA 3IBCB 2IBKA 4B3TF 4OHYA 4DR5J 5A8KB 1HWKA 3DGPB 4O23A 3F41A 3CC7S 4GC6A 2BM0A 3B82A 1TAQA 2E9ZA 4B9TA 2PFDA 2W4PA 2XYGB 2MQ8A 4FF1A 1WHXA 4X62F 3PVXA 5KFRA 3SYZA 1RTJA 2BANB 2CPXA 2FY8A 3H2UB 1ZETA 1HNZJ 4I2QB 1UVJA 2XSFA 1TELA 2OP5A 4R0EA 3G87A 3V4MA 1D9AA 3D6FB 4DSLA 4URSA 3BV8A 2E1CA 2IIHA 1S1VA 1U49A 1HW8A 1KWMA 2MKCA 1NUEA 3AD7C 2VDHA 4OX9F 3OVSA 2P5VA 3SQGB 3G82A 3JQKA 3MUVP 3VR1A 3ET6B 1KVIA 4B9LA 1D09B 2WBRA 3LP1A 3Q86A 3P5BP 5LT5A 4OZ3A 3I56S 1UZHA 2W4CA 2G2OA 4RWWA 2W9BA 3JYTB 1BC6A 3MFIA 4DV2F 2E7XA 1Q95G 3DXSX 3VAJA 1SL1A 1S9GB 3I9V9 1N5YB 3HFVA 3BSOA 1SC3B 1X5SA 2A18A 1DLOB 2WVFA 2P2CB 4C2MA 4TU9A 2GJFA 4ZA1A 3CMAS 3MHYA 5KG4A 5L9NA 4K4YA 1JLGA 1RWXB 2PI5A 3I5BA 1M1GA 3D1HA 2L9NA 3W2WA 2ZOGA 1S7IA 3H5SA 4HEA9 1CJKA 2Y0SD 1VRUA 4DFKA 1LWEA 2UVWA 2UXDF 3RAXA 4C4WA 2KVQE 1UJ6A 4F25A 4KIAA 2CPYA 3OXLA 1FE4A 1XR5A 2YY3A 2V50A 3KUEA 4J91A 4EWTA 2J6SA 3IG1A 2GFFA 1YRTA 3MDFA 1RB0A 2RUGA 3BYPA 4M63A 3WBZA 4BCAA 4O4GB 2Y3YA 4JI6F 5GAGU 4DQQA 5DG7A 4OYOA 4JI1J 2WONA 5LJ3Y 4FBTA 2XHCA 2EFPA 4Y0FA 2X7IA 2V67A 2ASYA 4LF7J 3HX9A 3OFFA 4NXNJ 1X4HA 3JSBA 5KFEA 2BM1A 4J9VA 1ZM3A 2VIHA 2C28A 2FHJD 1LNQA 4DFPA 2M8DB 1FWLA 4Q5VA 4PXBA 1E6YA 4NWBA 2RDJA 2PEBA 1H2UX 3FSYA 4QJVA 3DOLA 5IV4A 2YH1A 2JC1A 4LF5J 3DDKA 2DNGA 5DJBA 1CC8A 4ZLPA 5LXYA 3MPVA 4UZCA 2ATCB 2NSBA 1JMTA 3MPYA 1IBLJ 2FGOA 3FMWA 4ZPWR 3DRRB 2AQ4A 2IJFA 4W98A 1RHKB 1LXJA 3A8EA 3W5ZA 1G1XA 4GKJF 3PIPQ 3FSIA 1GXLA 4PG6A 4OYWA 3UN2A 4IDKA 3JAMU 2MSTA 3OW2R 5L1LA 2QA4G 4DL7A 1IN0A 2VD3A 4P2XA 3UDEA 1RTDB 4Z37A 1D8YA 4C8ZA 3ULHA 5G0RA 1XC9A 1NK4A 2XLJA 3BQ1A 2GVDB 3H8YA 2P6TA 5GAGI 1FWKA 1QUPA 2DNHA 2AT1B 2EK1A 5CYMB 5AXKA 4DLEA 2KU7A 2L9DA 3M8PB 5D6GA 4CO4A 4QYRA 3PIOQ 1SKUB 1WNEA 4RLEA 4KO0B 2MKIA 1OIAA 2FC9A 3MEEB 2NSCA 1D1UA 4J9UE 2AYGA 2FZKB 3LW5C 5KFKA 1NBEB 1I5OB 4J90A 1PJ5A 3GCXP 3MM5B 4NYOA 4OJHA 1C1CB 2CQCA 2Q43A 4AFFA 1M5HA 4Y00A 4B3OA 2IM3A 3EGWB 4OI3A 1WEYA 2WK4A 1Q79A 4YP3A 2BE7D 4ILLA 2KHCA 3BM7A 4ZPDA 1NB2A 5CAAA 1SJQA 1G4CA 2FVCA 2YQ3A 2FUG9 5FD1A 5KG3A 5K8NA 1AZSB 2XZTB 3DYAB 5EWFA 2RS2A 3V4IA 4DSIA 3WQPA 1DTQA 2GGPB 1HARA 1N5VA 1QAYA 4DUYF 2PO4A 1IKYA 2KHDA 4ICLB 5DG9A 2QLXA 3D0GE 1TQLA 2OTLS 3IAS9 2BUNA 2EBGA 3KLFB 2PSZA 3M8QA 4IQMA 1ZYQA 1QSSA 2NYIA 3RRHA 3IO1A 2G0IA 3VHQA 3MAAB 4GC7A 4B3OB 1VK8A 1BQNA 5J2QB 3W64A 3IA0A 1VQ9S 2APOA 5EHHA 2BQ3A 3ENQA 1X5OA 2Z0GA 1IM6A 3AOAA 3M30B 3OTEA 5D15A 3ETMA 3T5LA 2CADA 4DV1J 3CE8A 3OL9A 5J2MA 1D9FA 1O0PA 1RWPB 3TJAA 3DOMA 2XO7A 1WJ9A 3T1YF 4JI8F 8ATCB 2ROPA 2AEFA 1C1BA 5KT4A 3CC2S 1IKVB 1NH7A 2BMBA 2VKRA 1HA1A 3QAEA 1W25A 1D9DA 4LSNB 2LLZA 2ZH6A 4RW6A 1DQ9A 1AFIA 3OHAA 4MFBB 2IDLA 3KK2B 1ROFA 2MTLA 1F3FA 2K7JA 3DDNA 5IXUA 3HZEA 3AB2B 3LPEA 2HEKA 4IOAQ 4H4MB 4DQSA 3CJ8A 4A8SA 4F2SA 2IVMA 5KFLA 3Q2TC 2MZRA 4TQRA 2D69A 2V8DA 3CSKA 3RYLA 1IKVA 1C1BB 1MSWD 3FBEA 4NLSA 3D2WA 1NRKA 1RKIA 2LEBA 2ZBQA 2HFVA 2AYBA 3O6QA 3M6VA 3W9HA 5J2MB 4NMLA 1PJ6A 2MZTA 2ZC4A 3DFEA 3N6MA 4A8WA 3E01B 5I3PA 3KJVA 4RJVA 1BQNB 4DR7J 3GR0A 1NMEB 2DGXA 2BR0A 3FQLA 3G6YA 1F5BA 3BGLA 1YJNS 1HD1A 5GVQA 4RUHA 2DXEA 2B8PA 2VUGA 2WHOA 3W65A 3WDOA 2UUBF 5HQ8A 1NJIT 4KPYA 3K5LA 1TUGB 1FRKA 2FHJA 2M3DA 2PEHA 4P7TA 3E3XA 1DTQB 2AZ1A 3BO3A 1TL7A 3GFZA 3LA0A 2DNNA 4WPAA 1XMOJ 1AZSA 3DYAA 3MEDB 4PCQA 4WU2A 1BY9A 3WX8A 5LMUF 1S5ZA 4ECWA 4DL3A 4ECRA 2G9OA 4KAIA 1U02A 3QGIA 1NCLA 1OYEA 1PYTA 3K8VA 3QWUA 1Y3KA 2CQ3A 3DRSA 3QGGA 3MUTP 2FLNA 1MMNA 2XZWA 3HVAA 3J7A1 1D8ZA 1LK7A 3V81A 4WP8A 1RBLA 3PTWA 2ZZNA 4JYAF 3HKZD 4L3NA 2J9DE 1YIJS 3S6EA 2OEKA 4YHHJ 2C2NA 4MKVA 2OGUA 4IR1A 1TR0A 1WD6A 2MSSA 3PZPA 1TMMA 1RAOA 1G3OA 3HHLB 4KO0A 1U1NA 5KFSA 2JEGA 3C6UB 4YB6A 1K47A 1HIYA 1Q8BA 5KG1A 2HK2A 1YI2S 3PYGA 1RU2A 4K0KJ 3H5YA 3QLHA 2X51A 1SC6A 3L7UA 2CJKA 2CJ9A 3H40A 1WTBA 5G0RB 3P6YC 4OFZA 4P9SA 3BO4A 4ZCLA 3IRXA 2LCWA 3OUYA 4IDKB 3R97A 4NA2A 2OI2A 3G4SS 1RAJA 5T7LB 2ILYA 3P45B 1RXOB 2MLYA 4HTJA 1V3ZA 3Q89A 4ED6A 4DL4A 1Y0HA 1WI8A 1HNZF 2WZ1A 3BF4A 3DRRA 3UCGA 4DPYA 1C4CA 2BE2B 1PJ7A 4I4BA 4Q7AA 2QRRA 4C7QA 1MROA 2HRTA 2HVHA 1XJWB 1U2FA 3LH2S 4QIEA 3ZTQA 1IWGA 1FKOB 1B0VA 5AJ3J 4PYDA 4F2RA 4JI5F 1KTVA 3DOLB 1IQTA 2AYMA 3KG0A 4CNZA 4AL6A 2MKKA 1NK9A 1FE0A 1P9QC 1Z1ZA 2R7QA 3QFHA 5DGBA 1E6YB 3ZTRA 2XMKA 3W9IA 2AGQA 1CC7A 2MLZA 2M52A 2NS1B 2IJRA 3DKDA 2GMJA 3KLVA 4LRCA 3RR7A 2ZOMA 4I6AA 4OI2A 2WONB 4YN3B 1IKWB 1GQEA 3AD9C 4LFAJ 4F36A 5IT4A 5L39A 2N3OA 1GEHA 2VH7A 4O4GA 4ES3A 4LRDA 2WOMA 1RKJA 1YG0A 4KFBB 5IZHA 4WFNQ 1ZZFA 2LDIA
chains in the Genus database with same CATH topology
4KQZA 4AYBD 5I4MA 4WJBA 2ZD1A 4EYHB 4DFMA 2IC3A 2HGNA 5K9FA 1X5PA 3SZ2A 2FHKA 3CWJA 3SI8A 1RT2A 2P9GA 4RNOA 4LVOP 1T7PA 4OZ1A 3W2WB 1O51A 2RE1A 3G9CA 2ZH4A 4TQSA 3NAIA 1T8EA 3GFHA 3V2UC 2KT5A 1DLOA 2N4DA 3RTVA 2XC9A 3DLGB 2RH3A 2JZ5A 4WKYA 6FD1A 4K4SA 4Y2AA 2W8LA 2VBYA 2QLWA 1MNEA 1ZAXA 3FRZA 3CCLS 3DM2A 2YNGA 2W8KA 4JI1F 5D3GB 1S1XA 1T95A 5LL6d 3TAMA 3UR3C 4DG1A 2JLFA 3LP1B 4MIWA 4UQTA 5SUHA 3CCVS 3UD3P 2CQ2A 1R8PA 5DDRC 1P27B 3TRGA 4NCGB 3RB3A 1F9FA 4KTQA 1U1PA 3PRDA 4PXEA 2ZJRQ 2OMLA 4GO5X 4J9MA 2FVQA 2DGVA 4B08A 2DR7A 2K1RA 1Q86T 2E9RX 2K3KA 1QY7A 4FN5A 1VC5A 2VONA 1S72S 2KYZA 2RB7A 5CZXA 3T5JA 7FDRA 3D54A 3DGPA 5A8KA 5B0CA 4NA1A 3V6DB 4ZP9A 3KHLA 2R2SA 3PW2A 2GA7A 2OPPB 2RQMA 4DLGA 1Q8IA 4RNHA 1XNRF 5GAEU 2ZH1A 5F3ZA 4O4RA 3I87A 1H2VZ 1WTFA 1HWJA 4FF3A 3LP0B 4IFYB 1C0TA 5BYSA 2JFKA 4DR3F 1CEZA 4G1QA 4PG5A 1NU4A 3BSAA 1UVKA 2K2PA 4IG3A 4U7CA 1NJYA 1M5PC 3RW6A 4NYPA 1SKRA 2CQIA 2XGQA 2QA1A 4O3PA 1PO6A 1WEZA 4IR9A 1YRUA 3BSNA 3GFYA 2AGPA 3TO8A 4AQYF 4I1TA 4RU2A 2YNFB 1S1UB 3L95X 3MECB 2MY8A 3TVKA 2IHR1 2NPIA 1UW4A 2RQCA 2F4VF 3MD3A 2VPYB 3VF0B 2JEFA 2LA4A 3IC1A 3PW7A 2JFDA 4PKDB 3QIPB 1X9SA 4Y6IA 3ZZOA 4XDCA 4DV7F 3EUNA 3FGVA 2J0QD 1SXLA 1ZM9A 3I0RB 3PACA 1QJHA 5DQIA 1HQUB 1W2IA 2VG7A 5F8LA 5J2PB 5GAHU 3OHBA 1LWCA 2UV8A 4ZPCA 5DQHA 2UUWA 4OX6A 4O3NA 2ZH3A 3CJKB 5E3QA 4R5PA 4PWUA 3TAPA 3FRYA 1JNRB 4B02A 2BDPA 1TKZA 5E2QA 4UY8T 2XMTA 3C66A 3GIKA 2ZH7A 2FVRA 2YKNB 4YY3F 2CZ4A 2KZMA 3R1HA 4GMKA 1P6TA 4KRWA 4NYZA 4I56A 3RRKA 3CPWR 2V5HG 2VFTA 5E5NA 4WYWA 2KFNA 2HQIA 3UWTA 3R5BA 5B7WA 2ADBA 1XMBA 4Y2IA 2COLA 2DD8S 1TL1A 2AX0A 3P49B 3KHRA 4FZVA 3CEDA 5JVGQ 4PRFA 2YKNA 1BLUA 3GR1A 5IS2A 7FD1A 3TA1A 5CZVA 4NXMF 1XN9A 3MMJA 2KXNB 4FXWA 1TKZB 3TVYA 1RA6A 3ZFVA 2UP1A 3OSPA 2DH7A 2UVRA 3CJKA 4R5PB 3Q8QB 2X1GA 1V9OA 2L48A 3DNCA 3K7RA 3NAHA 4HI2A 4Y34A 3NWGA 5E7OB 4QU6A 2M5YA 3ITHB 1JJ2R 2PMZD 5BYRA 1QE1B 2XS5A 2YTCA 3J7Z5 5LJ5Y 1CQNA 1KN6A 1KQFB 3G8QA 3IN5A 3KLIA 2B6AA 3BR8A 4BC9A 1RT5A 1RTIB 4NLPA 1LV5A 4X64F 4JBCA 5KFNA 2ZHOA 3J81Y 4RUAA 3KNAA 1QUVA 3DLJA 3P3DA 3THVA 1JLQB 1R27B 3AY0A 3IRWP 4D3HA 4ECZA 3PR4A 3MM9B 1IM4A 4URQU 3MFHA 2HAIA 1NH8A 4OHVA 4ZHRB 2DHXA 3PNIA 1NKCA 4G1QB 1TFYA 3MM9A 2N7YA 1U6FA 4TXSA 1C0TB 2VQFF 3RBEA 4XPCA 1D0EA 2MQPA 1T03B 4EZ6A 2F1FA 3CIZA 1FVQA 2OPSB 5ITHA 1J5OA 1RT5B 2GMLA 5F8MA 3KLIB 2RKIB 1REVA 3V6DA 2FJDB 2POKA 3H2LA 1QE1A 2HLTA 3V5RA 4Y2KA 2ZDOA 5JXSA 3NCRA 1DURA 4MYUA 5EX0A 2OD6A 4E8UA 3T3FA 4Q43A 2YWFA 2OIHA 2KO1A 4ED7A 1F5CA 4HLBA 2MHEA 5HLFB 3UCUP 1VK3A 4NZ7A 1T05B 2ZUGA 5F9LA 3K5MA 3FMBA 1HBNB 1YGYA 1XMOF 1FRHA 4AXJA 1YWXA 3R3TA 5HO4A 4F4KA 1N5YB 2R7SA 4WYLA 3TNVA 1YJRA 3THTA 2F7VA 2MQMA 2MGZA 4NCGA 1U45A 1O5JA 4YB5A 3ZZYA 3BQ0A 5IQ6A 4EBDA 2D9PA 1SI9A 2XNRA 3TUJC 1A6LA 5KFIA 4JV2A 2OSQA 1S1XB 3TAMB 1U48A 3BGFA 3O3LA 4X4OA 3DM2B 3EX7B 4DV0F 2U1AA 4XAKA 3M9NB 3LWLA 1TK0A 2CQ4A 3CCTA 2D7SA 4LQ9A 4R8UB 2ATLA 3UR0A 3MMBA 2HWHA 1WHYA 4YQWA 2YKOA 2FGCA 3Q23A 2YNHB 4NLOA 1H2TZ 3E2EA 2C22A 2W24A 5M2PA 3NGKA 4KHMA 4Q2LA 5KFCA 1VGYA 1VBXA 3GQCA 2MQLA 4I0WA 5E0OA 5LMNF 1RT6B 1FA0A 4X4PA 2IC3B 4ETXA 2QV6A 3CCES 1HYSA 3M6WA 2J7KA 1U09A 1LWCB 2GJ2A 4OHWA 2VG7B 3KLHB 2GX8A 4DV6F 2R8JA 3SSSA 5D77A 4KFBA 4F3OA 1VI7A 5A8WA 2W9CB 5KFAA 1IKWA 1FXRA 1KQSR 4CZCA 1VMBA 3LUYA 4N77A 4YDXA 5HN0A 5HMYA 1A9NB 4WKRA 3V6KA 4TN2A 3BJYA 1IKXA 1S1WB 2LA6A 4KV8A 3GB0A 2GC8A 4YUDA 3GV7B 1UKUA 2R7TA 1HI1A 3I6PA 1SH0A 5KFPA 3CD5A 3MM6A 1M90T 5HP1B 1S1TB 4QR0A 3PKYA 2HMIA 2HNYA 4WFBQ 2HHUA 1J2VA 3HVWA 2HS0A 4U7UK 4ES1A 2X1AA 5U47A 2H9ZA 2NXUA 3BN7A 2N82B 1OSDA 3SFUA 4OX7A 3GG0A 2O01C 2RQ4A 5T7LA 3OLBA 1R0AA 1KEKA 1P8GA 4QWBA 3IRXB 3LP0A 4LIWA 1U2RA 4ZPVR 3T6JA 3OUYB 3OSNA 3HJFA 4ALZA 3DRXA 4NLDA 3Q2SC 1Q78A 1X0PA 2CQPA 1H6KX 3OL8A 1N6QB 5KG0A 4IRDA 1IBKF 3CJ4A 1B0PA 4WFAQ 5EGYA 1VRTA 5KT5A 4DWIA 2AJQA 2DGUA 3MOZA 4P2SA 1V3SA 4CQ1A 1K73T 4K4XA 2HS3A 3MXHP 2LQBA 3G86A 5LXRA 2K1RB 3OL6A 3OVBA 4ATNA 4EZ9A 2FJWA 4N56A 2MYFA 3VZIA 4IH6A 2DIUA 1VFJA 2LMIA 4WFYA 1HR0F 4URGA 1S6PA 1IBLF 1L3VA 5L1JA 2HNDB 2D1CA 3RB0A 2QT7A 5JJBA 4O3OA 4WF9Q 1YITS 3AQPA 1VC0A 4DSEA 2HGLA 3OBIA 2J8AA 2MQQA 4ELTA 4AL5A 5D3GA 2FLLA 4YOEA 1M5VC 2YNGB 3EZUA 3Q8SB 3KWMA 3VAKA 1DZ5A 1ZAVA 1WEXA 2RRBA 5B09A 4JI7F 4BDPA 3KKFA 3E01A 1FO1A 4KJIA 2PIIA 2HHWA 3S01A 2BRLA 4OI6A 1MWYA 4FNHA 2HZCA 5KFTA 2YKQA 3DI6B 2D3OR 5CYJA 1RGVA 4R0JA 5A8RA 4DQPA 2ZJPQ 3BGUA 4LT6A 3MEKA 1SL2A 2D74B 1XR7A 4LF8F 4NZ6A 2C2DA 1NJWA 2E66A 1WELA 2KM8C 1L3KA 3N6LA 3T6BA 2FB0A 1HNIA 1N5QA 4YB7A 3KK2A 4LF6F 4FYDA 4RW6B 3WC2A 4LSNA 3IS9A 5KG7A 2WOMB 1DQ8A 4I69A 1OS5A 3BGRA 5DLGA 3BB5A 1U1OA 1SIZA 2JHEA 3CUNA 5MLCV 4DV3F 5DM6Q 2KG0A 3W3SA 3CGIA 1S79A 4KHPF 4QU7A 2ZH2A 2XI3A 1G7CB 1R8HA 2CG4A 4QR2A 3OV7A 4Z2XA 4FS2A 3EXCX 3M8QB