3P5TL

Cfim25-cfim68 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
76
Chain Sequence
LYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVSEASSKKLMDLLPKRELHGQNPVVTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of pre-mRNA recognition by the human cleavage factor Im complex
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Cleavage and polyadenylation specificity factor subunit 5
total genus 14
structure length 76
sequence length 77
chains with identical sequence M, N, O, P, Q
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3p5tL00
3V4MA 3CCES 2AYBA 3LPYA 1H6KX 4TU7A 1U1KA 2HGLA 3SXLA 3VAGA 3B4DA 2O3DA 1U6FA 1DBDA 2LXIA 4Y0FA 3CTRA 1NJIT 3UCGA 1KC8T 2CQHA 2U2FA 4C4WA 3H2UB 3NNHA 1FT8A 3H2VE 3US5A 5DDPC 1WF0A 2FC9A 2ADBA 1FNXH 2DHGA 1ZZFA 1X4DA 1AUDA 1P1TA 1VQKS 2CPIA 3NNAA 1PO6A 1M90T 3CC2S 2LKZA 1YJ9S 3NMRA 1W2BR 2DIVA 1U2FA 3TP2A 2N7CA 2MGZA 1OWXA 3G71S 4OZ1A 1KOOA 2RQCA 2RS8A 2CPJA 2MSTA 1M5KC 1DZ5A 2KG1A 4BS2A 2AYMA 3SDEA 1Q81T 5CXTA 4WKRA 2ZJRQ 1KOHA 1WHWA 5DM7Q 2SXLA 1SJ4P 2J8AA 3UCZP 2KXFA 1WHYA 3CCVS 3BO4A 2KU7A 2LA6A 1WF1A 5CYJA 1VC5A 2MKHA 1VQMS 2VODA 5GAGU 3ZZYA 2M7SA 3MXHP 4F26A 1U1MA 2RS2A 1WF2A 3UE2A 1VQ4S 1X5PA 3G8TA 1SXLA 1HD0A 3EGNA 1VBYA 3RW7A 2M4MA 5DDRC 3U1LA 2N82B 5LSLA 4FXVA 2LXUA 3JB9k 2KT5A 2LMIA 2CPYA 1F9FA 4TU8A 2M9KA 2MZJA 3DLLQ 2OSRA 3LQVA 2RRBA 5FJ4A 2EK6A 1BY9A 4YB1P 4WFNQ 4V19X 1URNA 3S01A 1IQTA 4WF9Q 4LIRA 3I55S 1PGZA 1VQ7S 1VQ5S 2CQCA 1UAWA 5IM0A 5DM6Q 3ZZZA 4W90B 1YI2S 5GADU 3B4MA 5CA5A 1YJNS 1ZH5A 2V94A 2KM8B 1U6BA 2I38A 1U1QA 1X4EA 2DNLA 1ZZNA 1WWHA 2LEBA 5IQQA 2E5IA 1H2TZ 2LEAA 5EN1A 2MHNA 2OTJS 1X0FA 2CQ3A 2ZJQQ 2GO9A 2XS5A 1OO0B 2ERRA 4QU7A 2DGQA 2RUGA 2CPEA 1FJEB 5MLCV 4PR6A 4UQTA 2K3KA 2CPFA 1VBZA 1R8HA 1SJQA 4UY8T 5LJ3Y 3CC7S 2KN4A 4TU9A 4CQ1A 2KXNB 5JVHQ 2J0SD 3CUNA 3MUMP 2X1FA 2DISA 2DH7A 5GAHU 1D9AA 2MZSA 3BS9A 4M5DB 2KRRA 2AYEA 3UD3P 4IUFA 3VAHA 2FC8A 3I56S 1A7GE 2JVRA 4U67Q 4LMZA 1JJHA 1N54B 1UFWA 2DGXA 1Q82T 1S79A 1Q86T 2L41A 2XS2A 2HGNA 1X5OA 2DIUA 1X4CA 2MQMA 2DNGA 5DETA 2MJNA 2DNMA 1X4HA 2MQNA 2RT3A 1N8RT 3Q2SC 2DNZA 3IWNC 1WG5A 2CQ4A 2KFYA 3IRWP 1G2EA 3NS6A 1VQ8S 3NS5A 1DRZA 4J5OA 4WIIA 2ZJPQ 3PIOQ 3J7ZT 3THPA 2BOPA 1X5TA 1YIJS 2D9OA 1JJ4A 4QPTA 2MQPA 3BO2A 3MOJB 1UP1A 4RU2A 2N3LA 5DDOC 2YWKA 2DH8A 4C0OC 3MDFA 4LJMA 2YH1A 3CCRS 3D2WA 2E5GA 3VF0B 1QVFR 3CXCR 2QEXS 2PEHA 2M8DB 2X1GA 3CPWR 2RU3A 4ED5A 4FXWA 3RW6A 3SDEB 1WTBA 1WG1A 2YTCA 3ULHA 3HHNB 1X4GA 2X1BA 1S72S 1HD1A 1X4AA 2DK2A 5HL7Q 4CIOA 4PRFA 1N52B 1L3KA 3CMES 1VQ6S 5GVQA 2M8HA 2J76E 1WI6A 2VONA 4YUDA 2XSFA 3THTA 2A3JA 2DNNA 5IM0B 3TYTA 3NNCA 4IOAQ 2DITA 2KXHA 2RQ4A 2EK1A 1WI8A 2DHSA 2CJKA 1H2VZ 5LXYA 2XNRA 5LJ5Y 1SJRA 2X1AA 3G6ES 3SMZA 2PE8A 1WG4A 5D78A 1OPIA 2RNEA 1H2UX 2DHXA 3OW2R 3UD4P 1U1LA 1VQLS 3BEGB 1N88A 2GHPA 1U1NA 2JWNA 3CC4S 3G9CA 2DNYA 3MUTP 2DNPA 2HGMA 3VAFA 2Q79A 2MQOA 2BZ2A 2MKCA 1VQNS 1FJ7A 1U1RA 2M52A 4ERDA 2XB2D 2DH9A 1RK8A 4WCEQ 2OIHA 2AYGA 2CPHA 3P3DA 3UCUP 3P5TL 1WHXA 3Q2TC 2XNQA 2M88A 1VQPS 2NZ4A 2N3OA 1B7FA 2M0GB 2F9DA 2DGUA 2RRAA 3CCMS 2MXYA 2LCWA 3BO3A 2LECA 3CCQS 2QA4S 3CCJS 2MZQA 3S6EA 2G4BA 2KRBA 1K9MT 4IO9Q 2LYVA 3MURP 3CCSS 3PIPQ 3EX7B 2KHCA 2D3OR 2CQBA 3R1HA 2CQ1A 2XS7A 3G8SA 3FEXB 2DGWA 5IFMA 3U1MA 2KI2A 2UP1A 2VOOA 1YJWS 5H1SV 4Y00A 2D9PA 1VBXA 3P49B 1O0PA 3CULA 1X4FA 2U1AA 2MKKA 4WFAQ 1A9NB 4WFBQ 2RVJA 2MY7A 1JMTA 1D8ZA 2KH9A 4QQBA 1QM9A 2MZ1A 1VQ9S 3EGZA 4TLQA 5DDQC 3HI9A 3MI7X 2MGZB 2KVIA 1NU4A 2MQQA 5LSOA 1U1PA 2LQ5A 2DGVA 2DNOA 4IOCQ 1M5OC 1Q7YT 2L08A 1KQSR 2JVOA 5LXRA 3R1LA 2LA4A 1HA1A 1VC6A 2CQDA 1YITS 3S7RA 1X5SA 3K0JA 3J7YU 1XN9A 4CH1A 4W92B 3CD6S 2CPDA 2J0QD 2M70A 1FHTA 3MUVP 2MKJA 2QFJA 2G0CA 2MYFA 2DO0A 2MB0B 1X4BA 4CH0S 4Z2XA 2NLWA 3TO8A 2B0GA 1QVGR 1WHVA 1U1OA 2MMYA 2MSSA 2MPUA 1R8PA 3R27A 2MKSA 4EGLA 2KM8C 4OZ0A 5HO4A 2DNKA 2K8GA 1CVJA 1NO8A 2DO4A 1RKJA 1OIAA 4YOEA 2DNHA 1FO1A 1P27B 3VAMA 2F9JA 1FXLA 4A8XA 2OSQA 2MZRA 5JVGQ 4ZKAA 3VAKA 2DGTA 3DXBA 3CF5Q 1KD1T 2E44A 1M5VC 2OTLS 1WEXA 5GAEU 2DGSA 2VOPA 4PKDB 3MD3A 2DNRA 2CQ0A 2FHOB 2JRSA 1WEZA 3FEYB 2CPZA 3G4SS 2G1DA 2YH0A 3CMAS 1WELA 3CCLS 1YHQS 2DGOA 2E5JA 2MKIA 2KYXA 3MD1A 3L3CA 3VALA 3VAIA 2KG0A 5ITHA 2MQLA 1YTYA 1VQOS 2OJ3A 2FY1A 2CQIA 1K8AT 2CPXA 2L9WA 2CQGA 2M2BA 2ADCA 5BJRA 2DNQA 1SJFA 1WEYA 2CQPA 3VAJA 4F02A 1UW4A 2HZCA 1FJCA 2WBRA 2CQ2A 5D77A 4C7QA 1M1KT 3N9UC 1SJ3P 2DB1A 2YKAA 2EVZA 3G96A 4QU6A 1K73T 2F3JA 3CCUS 4F25A 2MZTA 1VC0A 2JX2A 2DHAA 2AD9A 2HVZA 1M5PC 2E5HA 1HL6A 2MJUA 1JJ2R 1DHMA 2FPHX 5GMKa 3S8SA 2MY8A 3UWTA 1YWXA 4P6QA 2HYIB 2I2YA 3P6YC
chains in the Genus database with same CATH superfamily
2HBZB 1GT8A 2AZ3A 3MEGB 2Y1RI 4RUAA 1H7XA 4KTQA 3A8KA 1BQMB 2OMLA 2HGLA 2XI3A 3BF4A 3SXLA 2GHWA 4ZLJA 1NHKL 1R6VA 2O3DA 5KT5A 4JV5F 1YZ7A 2FUG9 2QMWA 1KHWA 3GR0A 1UVMA 1S6QB 2ILZA 2KT3A 3CJSA 3DRPB 3NP5A 4TN2A 4BWMA 2U2FA 4C4WA 1N33F 4MMOA 3ITHB 2HHUA 3I31A 2A6MA 3RJMB 1ZPWX 2YNHA 5CYMB 2AIRB 3H2VE 4I2PA 2NZCA 3AA8A 1N6QA 3UNGC 1U26A 4X65F 1LW0B 4GKJJ 4DEZA 2CFXA 3DGVA 1P1TA 3HXMA 2VA3A 3E8OA 4WK1A 1XK8A 4ZJOA 4IKAA 2NS1B 1PO6A 4XO0A 3DRRB 1KS2A 1DTTA 2LKZA 2PO4A 3AHPA 2A1BA 3KLIB 4JV0A 2DIVA 1U2FA 1W2BR 1S1XA 3U27A 4FKXA 1RT7B 4ECWA 1HBOA 1OWXA 2HBYB 5A8RB 7FDRA 1NJYA 1KOOA 3VR1A 3KDNA 2GVZB 1IWGA 2YXLA 3RRKA 2OELA 2UUAF 1DZ5A 2KG1A 2AYMA 4DR2F 1IKXB 1M0SA 1ZM3A 4DFMA 2BMBA 3ENVA 4IRDA 3FGVA 4PWDA 2K1RA 2WSFC 1B99A 4ID8A 4MT1A 5DM7Q 1SI9A 2V63A 1VGYA 2G9OA 2GMJA 2ZC3A 5EUHA 2Z4PA 1RTHA 3CSKA 1GAOA 2MLXA 2GW8A 3J81Y 3TJ8A 1SC4B 1WHYA 2FJWA 1WNEA 2LA6A 3DYAA 3MMBA 3QRRA 3TOQA 1PKUA 4LVNP 2MKHA 4JI1F 5IT0A 4CLLA 1SKSA 4C8LA 1E6VB 5GAGU 3HHEA 2L9DA 4XPCA 2D3O1 3DCAA 1KRPA 1NKEA 2R2TA 2P2CB 3H20A 2QIFA 2VJVA 3CDAA 4F4WA 2BJ7A 3DDKA 1WF2A 3R5BA 1VQ4S 1X5PA 1V3RA 1WC5A 1Y00A 2BBEA 4X66J 5LOQA 3RBEA 1VBYA 1VIXA 3DLHA 1FJGF 1CQNA 1RHUB 2M4MA 5DDRC 1RHJB 1TL3B 2C3PA 2IAJB 2QLBB 3BSAA 4RW6B 3U1LA 4FXVA 4AUKA 5KFCA 2QA4G 2BJ1A 2I6WA 5GMDA 1L3TA 2P6SA 1F9FA 3EPGA 1SKUB 3ET6B 3V6HA 5HLFA 3RTVA 3TUPA 3CVKA 3H5SA 3P5BP 3EUNA 1ITPA 2F5GA 3KMSA 3OLBA 2FLLA 5KFHA 3HVTB 2M3DA 3N5FA 4O44B 1FJGJ 4KSEB 3UN5A 3W5YA 1IQTA 1LQ9A 1T9VA 2FTRA 3E3XA 3J81j 4LIRA 3MR6A 4ED4A 1EP4A 3HLUA 1MMDA 8RUCA 4QIGA 1V3ZA 3O1LA 4WE1B 2F63A 4Q8FA 1X0PA 2EBEA 5DM6Q 3ZZZA 2J6UA 3I0RA 4HTIA 3M8PB 5I3UB 3PKMA 2W2MP 5CA5A 2QT7A 1T9XA 3M2VA 2V94A 4I6WA 2OFHX 3UVJA 3T5JA 4ED2A 4MFBA 3TA2A 1FRXA 2W4DA 4OZ2A 4O3RA 2CAJA 4GRSA 2AX0A 2E7WA 2QRRA 3ETMA 1RI7A 1Z4UA 4MH8A 4CLFA 5FLXY 4K4TA 1PYTA 1Q5VA 1YVFA 2Z58B 1TUVA 4DV4J 2HVEA 1H2TZ 2LEAA 2IFXA 3B82A 4GVBB 2OTJS 1FK9A 4LRFA 4R0EA 4NYPA 2V8PA 3W65A 1F0XA 1OYEA 2Z57B 2DCUB 2KJWA 4I6YA 1YJTA 4I7FB 4FYDA 5CZVA 3R5CA 4OX7A 4RNFA 4LBHA 1H98A 3FSYA 5D0GA 4UOHA 4LFAJ 4NMLA 3OL7A 2HLUA 1UWAA 5L8RC 1AYEA 3QYYA 1URRA 2PI4A 1SJ1A 2D3UA 3HVWA 3PTWA 2R8IA 2EEYA 5AXLA 1GX5A 5JVHQ 4NXNF 2J0SD 4ZHRB 1UFLA 4RO0A 4JUZA 4NXMJ 1D09B 3K5OA 4Y28C 2R8KA 1BUXA 2RIJA 4KB7A 3GJTB 3RB0A 1UJ5A 3LF0A 3KHGA 3GFXA 3RAQA 4XTTA 3A8EA 3PW0A 4H4OB 4H4KC 5GAHU 1D9AA 2ALZA 1RT4B 3GCXP 4M5LA 3IBFB 2KRRA 4ECQA 1NB7A 4QIFA 3PX6A 5J2PB 2XYHB 4H4OA 5I3PA 1KSPA 1GMUA 1WJ9A 2R7OA 4KY3A 4LIWA 2JHEA 3QO9B 5CD4A 4A8KA 3EM1A 8ATCB 1P1LA 3LA0A 1MROA 4NLDA 4KKOA 1Q82T 1UFKA 1MG7A 4JI4F 3M4XA 5LMNJ 1FNOA 2Y8WA 1TQLA 1LK7A 1PCAA 3KJNB 4DCOB 4X64J 2ZDOA 1M1HA 4PG5A 1HBUB 4WTOB 1ZETA 3QO9A 5DETA 3M8SA 1TELA 2ZNYA 2IM3A 1ZOTA 2VFTA 1UWBA 3I4PA 3NY0A 3QRPA 3KUGA 3PW4A 1REGX 3DI6A 3BSNA 1LEOA 4ANEA 2XCAA 1Q5YA 1QE1B 1FI4A 4ZCMA 3NS6A 4NX9A 2QLFB 1SL1A 1VQ8S 1TUGB 4PWWA 4U7UK 3NS5A 1RAFB 4J37A 3IG1A 4DF8A 2RDDA 3FRZA 1YLXA 3KUEA 3R5AA 2BOPA 2NSBA 4IFYA 1FFSB 5IWAF 3W3SA 5J2QB 4NASA 4CZCA 3PCOB 2V2QA 1XMOF 2CVIA 1NK8A 3QNWB 2MQPA 3BO2A 5KTQA 4Q8EA 2V8GA 4ZDNA 4RBTA 3P8BB 5CABA 3KJVA 1DLOB 2ZH3A 4WK3A 4RU2A 4RUCA 5DDOC 2RKIA 2YQ3A 4WE1A 3MDFA 4OI3A 4U7UD 4DN0A 2C2KB 2Z2YB 4OZ5A 5AE2A 4B3RJ 3CCRS 3D2WA 4O0NA 3KKFA 2AV5A 3DM2A 3MPWA 1QVFR 3GONA 4LR7A 2LXFA 4MKBA 1T3OA 4NLQA 4Y2MA 4K7QA 3CPWR 4X66F 3VAJA 1HR0F 3MAQA 3D0IE 4UZBA 2R7RA 4QPXA 3CDEA 1KQFB 3SDEB 2GFFA 3D68A 4OMFG 2F1FA 3IA0A 4NLRA 2NPFA 3UR3C 3H4BA 1WTBA 1PC5A 3D5MA 3PG9A 2X1BA 4RX6A 4Y3CA 2HEKA 3A3NB 4ETXA 1S72S 1CS4B 1MN9A 2UUCF 1HD1A 3GIKA 1S12A 2DK2A 3DOLB 5HL7Q 2C2RA 5A8WA 3UR0A 2ZH9A 3JSBA 1VQ6S 5CH7B 1RXOB 1SVDA 1VLYA 1C2PA 2ZUGA 3OR1A 4M5DA 1PYSB 1F5CA 4C3MA 1ACMB 5ETPA 2V5HG 5B0EA 2VBZA 5E3AA 4XIUA 2DNNA 1MNEA 1UZDA 1FVQA 1HI0P 4CO0A 4NWBA 4DR7J 3ZNJ1 4EUVA 1T8EA 4OYXA 1EP4B 1ELOA 2KXHA 3AH6A 4F4KA 1LWFA 4AD6A 3AFGA 1QTNB 2WW8A 2ZDPA 4A48A 2RDJA 2HIYA 3DLEA 4ID5B 3OVAA 2CJKA 2JLEA 1H2VZ 1JLAA 2XZTB 5LL6d 3HHLB 2VHGA 3BN7A 2F40A 3FBFA 5D78A 3OXGA 3QPIA 2KB2A 4J7CA 4WU3A 2FY8A 2YNFA 4J9QA 4TXSA 3K58A 5HLFB 2FHKA 5HMYA 2ZWPA 3HHKA 4EZ9A 1U48A 1WC0A 3OBIA 5A8KB 3OW2R 1LFWA 4MK7A 4RW6A 2H5EA 2VQFF 5IT9Y 1NZ8A 3IXQA 4B17A 1U1LA 1VQLS 3BDPA 4UQGA 2R3VA 5F41A 3CC4S 1SKWA 2HGMA 4M5HA 3NL0A 4DG1B 1S0OA 3VAFA 2JOQA 3FKBA 3LPEA 5KT2A 4OIXA 5FDLB 5F8LA 5DLGA 4J9SA 5KFOA 3HPOA 1Q78A 2V8HA 3BGOP 3TAQA 2MLZA 1S7IA 5B0CA 4E0DA 3BGRB 1CJTB 3C19A 2DH9A 4KO0A 4WCEQ 2HIQA 4DV2F 1TK8A 3UCUP 4M94A 5D4LA 3RR8A 4B9LA 3P5TL 1WHXA 3Q2TC 2M88A 3CJTA 4RUHA 2QFIA 3ZFVA 1TUWA 1LW0A 1C0TA 1NRKA 1SKRA 1B7FA 5AJ3F 2HNYA 3M8WA 3KHLA 1B64A 2XTJP 3JQMA 2LECA 3HD1A 3SFUA 4AL7A 4CNYA 1QAXA 4NCBA 3IGNA 1VQNS 2MZQA 3ZZUA 4DZ6A 5K8NA 1CLFA 1XERA 1KWMA 2Y1IA 5F9LA 1FX4A 2ZKUA 1UMJA 3T1YJ 1SQEA 2K3IA 4DL6A 4MIAA 2UXDJ 4ILMA 1RAJA 4RWWA 5SZTA 4JV1A 4NLYA 1NLKL 4IO9Q 5K8MA 3QQCD 1GXLA 3M32B 3HHLD 2QG9B 1HBNB 5LMNF 2HBRB 4USVA 1XWLA 5F0UA 5B0FA 4USHA 3SEOA 3T1AA 3PIPQ 3AJ1A 2XLIA 4OYOA 3IWLA 9ATCB 2B8QA 1FKAF 2KHCA 3NAIA 5C2CA 2Y3YA 1MU2A 1RTJA 2F8MA 2EFNA 2CQBA 3SBMA 1LNQA 5JJBA 4I67A 1YJVA 4Q2MA 1R0CB 2AKWB 1SL2A 1NK5A 4MK9A 5D15A 3SSSA 3PHTA 4U9RA 4EK2A 2XLJA 3AA9A 3FEXB 4ECUA 2V34A 3DLGA 3HMJG 2ZOFA 5IFMA 1KN6A 3NKYA 1RLDA 5KFAA 3U02A 1YJWS 2VZ9A 4L74A 5H1SV 3X1LB 4N77A 2D9PA 2IRUA 4Q7AA 1VBXA 4F2RA 2AJQA 3GG1A 2V50A 1FXRA 3M8RA 4HI2A 3DGPA 3V2UC 4ER8A 1EHWA 2LP4A 1QSYA 2RB7A 3I5BA 4KGZB 5G4DA 2RDIA 4WFBQ 3TQEA 2AJ0A 4QWEA 2HW3A 2RVJA 2WONA 3MM5A 1SQFA 2C22A 3IRXA 1R0AB 3RB6A 2G1HA 4U7CA 3NMAA 3GQCA 4TNOA 4J9UE 3QSYB 4QWDA 4KFBA 1XMQJ 1A0OB 1S6UA 3HI9A 3IO1A 3MI7X 4Y2CA 5B0DA 1FRLA 5KFQA 2MQQA 5F3TA 2XMVA 3NGUA 4X4PA 2UU9J 2ATCB 2DNOA 4OQJA 1XMQF 2C3UA 1TL5A 1XR5A 2IRYA 1H73A 4J9MA 1R31A 3NCQA 4ZPCA 1KQSR 2JVOA 2QO3A 3GP9A 2AEFA 3M2UA 3OT9A 2ZH7A 3L7OA 4EI2A 1HA1A 3J81U 3FC9A 2UUAJ 3ISZA 4MKYA 2G4BA 3J7A1 4ZVTB 3S7RA 3RRGA 4F67A 2QL9B 1SH3A 4L72B 4EO6A 2R2SA 1IKYB 2AT1B 2HVIA 4K5SA 3TUJC 1PJ6A 3A1YG 3MM9A 4CRJA 2FLPA 5IC6B 4ZP6A 4YB7A 5F0WA 4DPYA 1MSWD 2DD8S 3MUVP 4QWBA 1S1WA 1RHQB 2PFDA 3NGKA 1PAEX 3OD2A 1VR6A 2CWXA 2FVCA 4EU0A 3MM9B 2MB0B 1OSCA 1QVGR 1IKYA 1E6YA 4RNNA 4WJBA 4DLGA 3H5XA 5KT6A 2R7XA 4ECRA 3MR5A 1NKCA 2MMYA 2MSSA 5DQIA 1R8PA 3BYRA 3EDQB 3ETOA 3I5AA 2VFSA 1HPZB 5KOXA 2HMIA 3B6BA 1CVJA 1N33J 3DHXA 3N01A 4JI8F 4NXNJ 3KXDA 4OX9F 1IR1A 2R4FA 2NQPA 2ZZTA 2V68A 1T05A 5KFNA 4JI2F 4Z37A 5J1PA 1O6XA 2BM1A 4NZ0A 5CYQA 1ZPVA 2A2CA 3KK1B 2CA9A 4J9NA 4B9MA 3QT6A 2OSQA 4P9SA 1EX8A 1OY8A 3PFOA 4N76A 4TLRA 3WQPA 4DZDA 5JVGQ 3CD0A 3HHDA 5L1LA 1H74A 1TKXB 2DGTA 3DXBA 3CF5Q 3CJ5A 4XDDA 2YKPA 3MM6B 5KG6A 1M5VC 2XO7A 2GMLA 4M5MA 5LMUF 4C11A 3AJDA 1R3NA 3T5HA 1KHVA 2CQ0A 5E41A 1T95A 2QSFA 3GFHA 2W9BB 2R7UA 1ZM2A 4LSZB 4DFKA 3PYDA 1RWVB 3IS9A 5B09A 3K89A 2R7SA 2CPZA 2QL5B 4ES3A 3G4SS 2W1BA 4ZLPA 1KEKA 2V8VA 3CMAS 3CCLS 1UW9A 2VFUA 1S0MA 1Z2LA 2W7AA 1QUPA 2EWHA 4NPOA 3T9NA 2MKIA 4QYZJ 1RABB 4J91A 3WZ0A 3VALA 1JLCB 3KK2A 4DV5J 1X9SA 2MQLA 3CNQP 1RT3B 3DRSB 3I82A 3QIDA 4DJBA 4OX6A 2HWTA 2FD2A 2OO4A 3BBBA 1N5YA 1MU2B 2C2EA 3QGPA 4ZVEA 1VJWA 1V5VA 4PPZA 4ATNA 1RJJA 1T03B 2FZKB 5ETVA 4TY8B 1HNZF 2IM0A 1F60B 1K1SA 2DNQA 1RT3A 2HQDA 5BJRA 3EYZA 2WCXA 3OJSA 1HBNA 4FF1A 2UXCJ 1FNXH 2KT2A 3SV3A 2JEFA 4LF4J 1WEYA 2CQPA 3QT7A 3PXGa 4LF1A 1UW4A 1SV5B 4HEA9 3TUZC 5KFMA 2V4RA 4PQUA 4JI7J 3LOUA 2CQ2A 3TW0A 3W2WA 2IPOB 4XPEA 2A10A 4PXEA 1HNZJ 2RE1A 2HHSA 5ETRA 1VHIA 2BJ3A 4NYOA 2X7IA 3FQKA 4C8KA 3NEKA 1JLFB 2GHVC 1M1KT 1DQAA 3AODA 2GAGC 2OEKA 1U0HB 4LF6F 2Q6CA 3KFWX 4FNHA 2YKAA 3LW5C 4K5RA 2D69A 2ZH8A 2XI2A 1WDTA 3M1VB 3CCUS 4OI4A 5IC4B 2ZH5A 3TA0A 4DX8H 2ALYB 3MAHA 3ZTOA 3T1HF 1AT1B 4QOTA 3WHIA 3BJYA 1CJVB 2AD9A 1LWEB 1M5PC 3ISND 3PVXA 4A8FA 1TL4A 4D3HA 3UFCX 1AZSA 3MFHA 4OI0A 2FGOA 2J0WA 3NRBA 2EFVA 2FPHX 4P2MA 7AT1B 2HKEA 5HATA 5D4PA 2LLZA 1JLEA 2XMJA 3LAKA 3MMJA 3S8SA 2C2NA 2MY8A 3HSJA 3MM8A 4OZLA 2HMIB 3P4UB 5FDLA 1QJHA 4ITSA 2CQ3A 4P6QA 3MURP 1RT2A 1NHVA 2OPRA 2RH3A 4CO1A 3P6YC 2IVMA 4LFBF 3CCES 3OFHA 3WIVA 1T9YA 4P2XA 4F3QA 1E6YB 1G7CB 2QA1A 5AXMA 4KT0C 3PO5A 4I2QB 1U1KA 1T3NA 2PD1A 1DTQB 4DV5F 1O51A 3B4DA 3C15A 1CJUA 1RU1A 2LXIA 4C8NA 4J90A 5E3CA 3CTRA 5K5MA 4Y0FA 1NJIT 3A8JA 1N5TA 1EQMA 3ISNC 4K8RA 4OYPA 3UCGA 2AHOB 4NZ6A 4DX5A 3CB4A 4X62F 1NBEB 1HQUB 3P96A 3M9NB 4NL5A 1FRHA 3HHLA 1SB6A 2ZFHA 4PWUA 5HI7A 1HARA 2H9ZA 1RTIB 5CHCB 1RZMA 3VGSA 1Q0NA 4DPXA 4PG8A 1DAXA 5KG5A 3QMQA 1JXEA 2V67A 1LWFB 3A3PB 4DX7A 4DQRA 2HFUA 4IH6A 1GXTA 3M2UB 2ZD1A 4DSIA 1WSVA 4J9KA 5E2QA 2UUTA 2A6OA 4HHJA 4ZVUB 2ZBCA 3BZQA 1RTDA 3JAMU 2P9GA 3IMQJ 1IBLJ 4DV3F 2MGZA 1VRUA 2YWWA 4PUOB 3G71S 2RF2A 1H3DA 4B9UA 4DQPA 2RS8A 1RWUA 2CPJA 2OKQA 2ZBPA 1M5KC 2KL8A 1F5AA 2CJBA 2LQBA 3HF5A 2IBOA 4NCGB 1UEVA 5KFKA 3SDEA 2WONB 1NMEB 4UZCA 3VWSA 1H38A 5CXTA 2BRKA 1BXNA 1FDBA 4U95A 4B3TJ 4F0MA 1WHWA 1LW2A 1YGYA 4ICLA 5ETNA 3RG6A 4DFPA 2LU1A 2CG8A 2QYGA 2SXLA 3DGPB 2J8AA 1VDHA 3LGHA 2ROGA 1YBAA 2Y0BB 1N56A 2V0NA 3MHYA 2KXFA 2PA8D 2HRYA 3QGHA 4BWJA 3BO4A 2KU7A 1RCXB 4A8SA 3G6VA 1VC5A 2E9RX 1RAGB 2CJYB 3MEEA 5KFDA 2AQ4A 4LR9A 4K4XA 4M5NA 4URSA 4YR3A 5LMUJ 2AU0A 4LQ3A 5M2UA 1U1MA 3MAAB 3GYNA 3KJQB 3HZGA 4QWAA 4UF4A 1TL1B 3R97A 1HD0A 3NBPA 3BGUA 3PM9A 4KAIA 3RW7A 3KLGB 3G82B 1RKIA 4OYIA 1ULRA 2HHPA 2N82B 1P8GA 1RGVA 1FVSA 2LMIA 2GVDB 3IP0A 5LT5A 2P5VA 5DJBA 4IDKA 2M9KA 3DLKA 3SSRA 4EMDA 2MZJA 2OSRA 3LQVA 1FKPB 2RRBA 3BR9A 3C6UA 3QBCA 4I56A 5E3QA 4YY3F 5FJ4A 5ETLA 1URNA 1FEEA 2V4JB 3D28A 3OFFA 4L3KA 3S01A 3FMBA 4ZVOB 1TVRB 2E1CA 2PDAA 4KPYA 4CLYA 1C0TB 3GJRB 4DU7A 5EHHA 5BR8F 3ICLA 4L76A 1L3VA 2K06A 4OV6A 1WKKA 4R0JA 2WOMA 1RWKB 3EPIA 2YNGB 2HWIA 3LAMA 4A8YA 1OSDA 3LP1A 2X51A 1HFEL 4W90B 2VBYA 2B4PA 5GADU 2J5AA 4ZJQA 2JH3A 2FJBB 3QAUA 4FYXB 1ZH5A 3BGRA 3D9BA 1RT4A 2KM8B 2F8EX 4NLUA 1HW8A 1EAYC 1QD1A 2ROEA 2ZE2A 4BC7A 5HQMA 3T3FA 4DLEA 3HD2A 4UY85 4DV6F 5KG2A 2YQ0A 4KV8A 3W5XA 1WWHA 2EG1A 2ZVIA 2LEBA 1NM2A 2XSJA 4ZN3A 1VRTB 4C3KA 4RNMA 5DGAA 5EN1A 4JI0F 1ROFA 2VFRA 3JQKA 4M5IA 1NDCA 4DSEA 1X0FA 3KLHA 1OQ6A 3M8QB 1SC1B 3Q8VA 4OHZA 5A8KA 4N5SA 2XS5A 3W1YC 5HSPA 2IBKA 2DGQA 2RUGA 1FJEB 1UL3A 2B9EA 1CJKB 2XULA 3E51A 2DR9A 2XWXA 2CPFA 4HDHA 3MEDB 3JSRA 4O3OA 1SJQA 4F8RA 3BKFA 1GEHA 4RZRA 3K5MA 3E01B 5MAOA 4KHPF 5DS7A 2KXNB 5JUMA 4GVBA 1LKZA 1U02A 1BWVA 5JMNA 3SZ2A 4R25A 5K14B 1FCAA 1GK8A 4QW9A 1RWPB 4J9LA 4O3NA 3MUMP 1D9FA 3JSMB 1G6BA 1PBAA 4G1QA 1FD8A 5T7LB 4IRCA 1RAIB 2DT9A 3AD8C 4LFAF 2DISA 1M1GA 2BYCA 3OR1B 2MZSA 2Q43A 1S97A 3I0SB 3D3CJ 3LGNA 4CLSA 4URQU 5KFBA 4FNIA 3DOLA 2YPZA 3UD3P 2V2VA 4IUFA 5T7LA 2H48B 1GTEA 3S1TA 4HACA 3JSMA 4DR3F 4H4MB 2FLNA 5J2MB 3CJ3A 4LQ9A 5SUHA 1Q8KA 3GTYX 5ETQA 3AB4B 3ENWA 3H7HB 4S0MA 1R6YA 2H5IB 3QLHB 4M5KA 3UO0A 4DS5A 1Q86T 1MN7A 1X5OA 2NXNA 2PN6A 5HJXA 3H5YA 4J9RA 1TV6A 2DNGA 1TK0A 5J2MA 2KZZA 3LTOA 2RHQB 3MEDA 2MJNA 1N8RT 5C42A 4I6AA 4IG3A 2BJDA 2HG4A 2IDLA 1HWLA 1RUSA 2J9DE 2LU2A 2YNIA 3IFEA 4P10A 3K7RA 1RBAA 5L1JA 3NGDA 2VICA 2QYCA 3IWNC 3IRWP 3R2DJ 1HW9A 1B4SA 1NH7A 1NSPA 1HLWA 1W26A 2JC0A 3TWZA 4ECZA 1RT5B 2AWZA 2CZ9A 2VBWA 1N32F 1DRZA 2V69A 2HFNA 3M2RB 4N8OA 4J5OA 1S6PA 1YRTA 4IFYB 3THPA 4KV8B 5BR8J 2CJ9A 3VVTA 1WDDA 4WXOA 1YIJS 4RJVA 2D9OA 1NZAA 4Y6IA 2P6TA 4CTAA 5EWGA 4QPTA 2Y8YA 5E3PA 2WHOA 3CJKB 3PR5B 1FESA 1PJ7A 3DI6B 3GCWP 3NWRA 4CO3A 2AEJA 3H25A 1RACB 1S1UB 2YWKA 3AXKA 1TL7B 4RW9B 2DH8A 4C2MA 1ZTTA 2UVRA 2NUUG 3CMQA 4JV5J 2G0JA 2R42A 2WVBA 3EVMA 1HBUA 3FBEA 4Q43A 3VF0B 3W7BA 5IWAJ 4UUWA 5ETKA 5D6GA 3CXCR 3M9OB 2V2ZA 4LSLA 4Q5VA 2W9CA 3HFVA 2X1GA 4F04B 2DPJA 1SH0A 4GO7X 3SCIE 2RU3A 1DARA 2YWEA 2YWHA 4HHHA 2H3EB 2H4YB 3I6PA 3IGVA 4DWIA 4ED5A 3I5CA 3RW6A 1IKXA 2DKOB 2UZAA 5KFPA 5J2NA 2F4VJ 4GKJF 4B3MF 1PC4A 1YRUA 3HJFA 4L73A 2GVDA 3EVOA 1XMBA 5J2PA 3PKYA 4DFJA 2PT0A 3MPVA 2ZH6A 2A18A 2E66A 2FJAB 2M8HA 2WB4A 1WI6A 5A6PA 2YBVA 4GO5X 4X4NA 1TL1A 4ED8A 3I4HX 3LP1B 1LWXA 4E2FB 1S9FA 1X9WA 3TYTA 3CIZA 3DU5A 1C1CB 3MAAA 1VYAA 1A6LA 1B70B 3CJQA 4QJVA 3W9HA 1Q16B 1TVRA 4K4SA 2P9CA 3HDSA 2XNRA 1NPKA 5LXYA 2XY6A 3MCNA 4CNZA 1TP7A 2WAQD 1BQNA 3EJMA 1WG4A 3DRPA 2R8JA 3C6TB 2VD3A 4USMA 3D3BJ 2Z30B 3B54A 2QLWA 4YN3B 2F7VA 2VG5A 3R5DA 4PYAA 1NCLA 3R9LA 2KHDA 1ICEB 4JI2J 1IWAA 3AJ2A 4X4RA 3WC2A 4USUA 2BKPA 2QA2A 2WVCA 4WFYA 1U1NA 4O4GB 1FRMA 4NCGA 4B08A 3PW5A 2I8EA 2Q79A 4G65A 4LRAA 5CZXA 4ZVPB 1IKWB 3T41A 2MQOA 5L9XA 3OSPA 4ED1A 4NLGA 3LH2S 2QZ8A 3OR2B 5BYRA 3OL6A 2W9AA 3WBZA 2AGPA 4FZVA 1U6ZA 3A13A 3T19A 1U1RA 1J5OA 2M52A 2YWGA 2R7QA 4YR2A 3C16B 3M8PA 3FNNA 3I0RB 5I3UA 1RK8A 1UPPA 2WVFA 4QIVA 1HIYA 3P3DA 2GJFA 3PJWA 4JI7F 4MYTA 2IMWP 4CLUA 3NGRA 3EXCX 4LFCJ 4JYAF 1R89A 4B3SJ 4G1IA 1D8YA 3I9ZA 1SH2A 3O3LA 2M0GB 2F9DA 2RRAA 3V4IB 1Q79A 2QC3A 2LCWA 1AROP 3CCQS 1UPMB 4PZVA 2QA4S 3BR8A 4B9VA 3EE3A 3CW2C 3KLEA 2VDHA 2XWYA 3WC0A 4CM2A 1N34J 1IBMF 1H0HB 4I68A 4ZPVR 2BABA 5DG9A 1TKZA 4C0HA 1CJUB 2XMKA 5ETOA 1Z1ZA 2Q6BA 3ILLA 4CLTA 3A8IA 3OTDA 3Q24A 3BSOA 1K9MT 1UVLA 1TL3A 2CDRB 2IM2A 3DN9A 4ZN1A 2YX7A 1AUSL 4Q45A 2BQ3A 3FFIA 3RBDA 1RWXB 4IG0B 4K0KF 2DRAA 3R7BB 4HT7A 2JNJA 3L7PA 2OPRB 3RBXA 3MF5A 4UOFA 2HS3A 2O01C 2ZD1B 4NA1A 1OY6A 3R6GB 3EX7B 1H7WA 3F44A 4LRDA 3SYZA 2C3MA 2YKQA 2JEIA 2XS7A 3ENQA 4CI0B 2CNKB 1CEZA 2R9LA 4CCHA 4DOZA 4QIWD 1MW7A 1HQUA 4E98A 1S0VA 2BV3A 2AZ1A 4F4YA 4NLPA 4P74A 4Y00A 2DYAA 2GGPA 2HS4A 3P49B 1WOPA 1O0PA 1R27B 3L4BC 3OXLA 4M63A 3TRGA 1TU0B 1A9NB 2AGQA 1LXJA 4I2QA 2WSEC 3MPDA 2HHTA 5KFIA 2NXEA 4RNHA 4PWDB 5KFWA 4KH0B 4K59A 5DLFA 1D8ZA 4CLWA 1XC9A 1FRJA 4QR0A 2BQUA 1F6TA 1FWPA 2AP6A 2GVZA 2J8SA 1JLEB 1UEUA 3DNCA 3UD5A 1HNIA 2MDAA 4DCPB 2MZ1A 1TKDA 2E9TA 1HBOB 3L7UA 5DDQC 2HHXA 4QR2A 1MMNA 1S1XB 1AZSB 5IQ6A 5LSOA 2E7VA 3Q22A 1DTTB 3PJXA 4WIQA 4ZIWA 5KG4A 1CJVA 4BHQA 2HHQA 2CZ4A 4IOCQ 2V2KA 3H4DA 1SC3B 3DDNA 2B6AA 2CIMA 5HMWA 1RCOB 2NXCA 4FVCA 3W64A 2CQDA 1KDNA 2M5YA 2BR0A 1B0TA 5KG1A 4DV6J 2XGQA 1TFWA 3MTKA 4LBIA 4LF2A 2YNHB 4CH1A 3W60A 4K2JA 2CPDA 1U49A 2HRUA 3ITHA 4JI6F 3BBFA 4IOBA 1LV5A 3UDEA 1S6QA 3F73A 1P9QC 3KLFA 1FXDA 4KR0B 1FHTA 1FRKA 4OI2A 1TMMA 4YFUA 5KAKA 2MKJA 4DU8A 1L3UA 3KLFB 2QJ3A 1TZ0A 1PYOB 2ZITA 2DO0A 5KOWA 4CH0S 4Z2XA 4USJC 1NAQA 5F8NA 3V81A 2JFKA 3A4TA 4CWBA 4YDDB 4FBTA 2HQ3A 2E5LJ 4DSKA 1G4CA 3AT1B 1IBCB 3EMTA 5HO4A 3MWBA 2IA6A 2HVDA 3TA1A 2XEXA 3F41A 1I3OB 2ZBIA 2IRXA 5J1EB 1RA7A 4IFVA 3W9JA 5B0AA 5CYQB 4X4OA 5IS2A 5LM7E 4ECSA 4FF3A 1M5HA 1IXKA 4ZOSA 1T05B 1YBTA 1QUVA 2OH2A 1M5SA 1RT1A 2MZRA 3DOKA 2H4WB 3GSIA 3Q86A 4XDCA 2AF6A 4FYYB 3BDEA 4HR2A 3IS9B 3WIUA 4O3SA 4MIBA 5IT9U 1KD1T 2E44A 3NCPA 4LF7F 1KVKA 2LEPA 2W9BA 5GAEU 3G87A 1ZYQA 3QATA 3ILIA 1NEEA 1UZHA 3EDRB 4PKDB 4NI2B 4NOHA 1HWKA 2FHOB 1DJ0A 1FTRA 3Q23A 1D9DA 3M05A 4JI1J 1RQ0A 1S0NA 1WEZA 2HYIB 3KOAA 3ZTRA 1RYRA 4K4UA 2ABYA 1YHQS 2YH0A 1VCTA 2XQCA 3MPYA 2B8PA 1N5SA 2CG4A 2GCFA 3L3CA 5KFEA 1YJRA 3KK1A 2ATLA 5L1IA 3VAIA 1ZAWA 2B7BB 2UXDF 3FK4A 2NYHA 1WD6A 3CIMA 1HYSA 4OJ3A 4LF8J 2OPQB 1LWCB 3QSIA 2ZOMA 5D0EA 3UDCA 3VTIA 4DR2J 2YKNA 1DURA 1XBWA 3TAMB 1HHTP 4NLSA 2V8DA 1NDKA 2VBXA 2CQGA 2O1PA 3LWLA 2BW2A 4JI5F 4WYWA 1VI7A 1MMLA 2D1CA 2HLTA 4IG0A 4DV7F 2N4CA 4B9SA 3MPUB 5CAAA 1KBRA 1B0PA 2ZH1A 3W62A 4A8MP 2VJUA 2WZ1A 4DUYF 3POTA 2HZCA 3PNIA 4ENOA 1NK0A 2FB0A 1TKZB 1S1WB 2HSEB 3CJ8A 3C8YA 3DU6A 2B4OA 5CD4H 2PSZA 2E1AA 4C7QA 2VKZG 3PR4A 2RMLA 4ZVSB 2BJEA 1N0VC 3M8YA 3MM5B 4WP8A 3H98A 4OJGA 4OL8A 3G8QA 2ZBRA 5JXSA 1QTMA 3AOAA 1XTZA 4HI1A 2IYGA 3N9UC 3VQTA 4LF5J 3DOMB 3C14A 1KNZA 4DPWA 2DB1A 3G96A 2HNZB 4QU6A 1AFIA 2G2ZA 2G0IA 1Y3KA 2ZZNA 1TKTA 1SUQB 4F25A 4DS4A 1CC8A 4O3QA 1VC0A 4C48A 2DHAA 3M30B 3NOGA 4ZVGA 4CO4A 4DQQA 2HFSA 4I0WA 1HL6A 3C16A 5HROA 2BQRA 1S10A 1IKVA 4BC9A 2MJUA 4GVLA 3WX8A 4NMXA 5KFFA 4EBDA 3RB4A 1DHMA 2PEBA 3OTOJ 1J5OB 2AJ4A 3M6UA 4F3MA 2CDQA 1ZBTA 2IM1A 2IY5B 4Y65A 4FKYA 3DFEA 4LVOP 4A8WA 2JEGA 2VG7B 2C3YA 2PI5A 5BXIA 2CRLA 2JSXA 3IRXB 3H5UA 3PACA 2I2YA 3V4MA 1R0BG 3K5PA 4O4GA 5KG0A 2KVQE 1HNWJ 1H6KX 3MM7A 1X60A 4TU7A 1S48A 4L6V3 4B3OA 3DKDA 3ZTPA 4N41A 1SL0A 1U6FA 1UVIA 4EWTA 2Y9HA 3CCWA 5L46A 3HVRA 3MXHP 4X2BA 4OHYA 1HI1A 4F4ZA 2BVZA 1KQKA 3LP2B 1JB0C 3W63A 5DDPC 4ECYA 5KFTA 1KKHA 2RD5C 3GU0A 4HH1A 4LR8A 2J7UA 5C24A 2XZWA 2DHGA 4Q2LA 2ADBA 1EKRA 1RTJB 1X4DA 4OLPA 4U96A 4CLZA 3GIMA 1MWZA 3V5RA 3M6VA 1YX2A 3L9ZA 2B6AB 3HZEA 1VQKS 1FNMA 2CPIA 4YS2A 4DR7F 4DSFA 4KO0B 2L48A 5KFGA 4OX8A 2OLWA 3BPDA 1WSRA 3CC2S 1FX2A 1YJ9S 2FLOA 5F8GA 2N7CA 4WTYA 2IA0A 2IJNA 2OI2A 2OP5A 1R43A 3W61A 1HNXJ 2UUBF 2Z0GA 3BGFA 3PHEA 4OZ1A 1EKSA 1HNIB 2HBQB 2RQCA 4ELVA 3PO4A 4RL1A 1V5IB 1BGXT 2GA7A 3RYLA 4P7TA 4OFZA 3TVKA 5J2NB 7FD1A 4CT8A 4BS2A 1ZS6A 3DMJB 3VVUA 1Q81T 3I87A 4DR1J 1ZTWA 3HSDA 1RLCL 1UVKA 4X84A 1JKHA 2EFOA 1R7IA 4DCJB 1KOHA 3BREA 3T9ZA 1JLBA 1N48A 2R7VA 4LSLB 1JLGB 2PGCA 4OHVA 5M2PA 5DGBA 2ZM6J 1SJ4P 1S77D 2E1MC 4ZVQB 1RYSA 2VQEF 2YNFB 2W2NP 1R8AA 3CCVS 3QT8A 1J27A 1LK5A 1TL7A 4DF4A 1XR6A 1N34F 1WF1A 2XHCA 5CYJA 5K8OA 4P52A 1REVB 4UW2A 3GILA 5I42B 4I64A 4CTAB 2UUCJ 4LSNB 1SC6A 1NPRA 2M7SA 5BYQA 2YVSA 3ILOA 3OXFA 4FDFA 3X3UA 5KFRA 1Q53A 3VGVA 1RT6A 4F26A 5EDWA 2RS2A 4NCAA 4KH1B 4NRTA 4CO2A 3N6LA 1SXLA 1S9GA 1YQHA 2BE7D 1Y9OA 2BANA 3BKTA 4PABA 3GZ7A 3BN4A 1FD2A 6FDRA 4B3RF 5LSLA 4X4QA 1S5ZA 4DV1J 3JB9k 2KT5A 4DR3J 3CGIA 1UEKA 2VL1A 3W2VA 2YNIB 5AXNA 1HI8A 4DR4F 1RBLA 4ZPTR 4F0HA 1NK9A 1S9EB 2W2QP 2HK2A 1JNRB 2C2ZB 1SQGA 1VFJA 4P72A 3T6JA 4DV1F 2RSQA 5D0HA 2RJZA 2IC3A 2ZVSA 3JXOA 3V4IA 3SQGB 3GFZA 4ZLNA 3LP0A 3UNYA 2ZBQA 3QLHA 4PCQA 3SV4A 4WF9Q 3BM7A 3EGWB 3I55S 3MCMA 4NA3A 1VQ7S 1GNKA 1XEZA 1PGZA 4FP9A 1WUUA 2JLGA 4FN5A 4KBIA 1P6TA 1UAWA 1F3VA 3EICA 1SIZA 4KHPJ 3UI3A 2OAUA 3B4MA 1DLOA 4AT1B 1IR0A 1YKWA 2OPPB 1PSDA 4OYAA 3PRBA 4JI6J 2XMUA 3QJLA 4DUZF 3OR2A 1U6BA 1NPPA 2HFZA 2I38A 2BRLA 1X4EA 1U1QA 3BKUA 1N5QA 3R5JB 2W8KA 2KFNA 5HVFA 1IKWA 2BXJA 4ZITA 5I3QA 1ZZNA 4B3SF 4KPCA 4BBYA 2BJ9A 3MOZA 4IYQA 3IG1B 3QWPA 3AAWB 4Y2IA 4BCAA 1IM6A 2MHNA 2VA2A 5B0BA 4B3TF 1UJ6A 3F0NA 1QE1A 1W2IA 4EFAC 1FKOA 4ZS6A 3TAPA 2Z2MA 2LQJA 2VF3A 4DBQA 3PEHA 2DEJA 1RA6A 1GX6A 1TFYA 5MLCV 4UQTA 4JP8A 2K3KA 3UW1A 1KR4A 4Y2AA 3MMAA 5LJ3Y 1Y0HA 2C42A 2Q3PA 4N47A 3N6NA 3RUBL 4TU9A 4Y34A 5RUBA 1UVNA 2VFVA 4EO8A 5F9NA 1NKBA 3J80U 5DO2A 3OHBA 3CUNA 5D3GB 2VIHA 4HTJA 1CBKA 4WP3A 4J9PA 5E33A 3FVYA 4KGKA 3OFEA 4X65J 2ZE2B 2FIUA 3EVWA 1QY7A 2HWHA 3IAS9 4U8VA 3BS9A 3T5KA 2OD6A 4WXWA 2L3MA 2C2DA 4XK8C 4ED7A 2AYEA 1ZA2B 1UWBB 2W01A 4MTPA 3VAHA 2VDIA 3I56S 3NXZA 2BE2A 1A7GE 1EJ7L 2CVEA 2JVRA 2P8IA 2YNGA 4U67Q 1JJHA 2HURA 4K4YA 2HHHJ 3G2XA 2E5LF 3AY0A 2B3TB 2V6AA 2ZUAA 2XS2A 4LFBJ 4P2FA 1S76D 4DV4F 3PX4A 3V6DB 4KKOB 3OVSA 3KYLA 4WZQA 2VQFJ 2FGCA 1VQSA 3HFZB 3TX8A 2J6SA 1X31C 3HSGA 3Q2SC 4EYHB 1T9UA 3FSXA 3W8PA 3OTOF 4ALZA 2EW9A 3BB5A 2CQ4A 3KWMA 3DLJA 4EBEA 2YQ1A 2FJXA 2UVVA 1NDLA 2JZ5A 3AQOA 3G82A 3CJKA 2QV6A 2UUWA 4ZCKA 3JSYA 1FTCA 3JTOA 4NLTA 5ETTA 1HWUA 2B5JB 2V4QA 1XNQJ 5E7OB 3FCHA 4RW7B 2ZJPQ 5AXKA 3PIOQ 5FLXU 1GFWB 1S7HA 5D3GA 3GPAA 3M2RA 2XY5A 1D0EA 3D4JA 4C3LA 1F9EB 4BDPA 1JJ4A 4P73A 2DXFA 2J9CA 3QAEA 1RT5A 1QLNA 2RHSB 1BE4A 5L1KA 1T7PA 3MOJB 3H2LA 4URGA 3MGJA 2OPPA 2JEJA 4YHHF 3V6KA 2CNLB 3IC1A 4KQZA 3JS9A 1BLUA 2N3LA 4PPDA 4A8OA 4TYAA 4DMZA 1Q1KA 3CJRA 3OL9A 4IG3B 4LJMA 4C0BA 1ZA1B 2I9SA 2YH1A 1RHMB 4YMEA 2E5GA 3N28A 3TVZA 2ZH4A 1NSQA 2QEXS 2PEHA 3M8ZA 3UQSA 2BOAA 3LP0B 2WSCC 1RWNB 5HMZA 4XAKA 2D3ZA 2N4DA 4FXWA 3KHHA 5F3ZA 4LF9F 1N32J 4J9OA 4MAKA 2F8HA 3Q83A 1UJ4A 3VQSA 1WG1A 2YTCA 3ULHA 3QRQA 1X4GA 1BHNA 2EKYA 3EZUA 5C2GA 3ET6A 2Y0SD 2BJ8A 4CIOA 4PRFA 1N52B 2DTJA 1L3KA 3UVJB 1H72C 1U8WA 3HULA 5H9EK 3CMES 3B8HA 1AFJA 5GVQA 4YUDA 2YKMA 4CYUB 3T1HJ 2IJFA 3D1HA 4G1QB 1Q95G 3GYGA 3CJ0A 2IDEA 3O2IA 1NK7A 4IOAQ 3GV7B 3O44A 2DITA 2Q66A 2EK1A 3PW2A 3GR1A 3C2PA 2FVRA 4ZP8A 3SQGA 4AXJA 5HVHA 3PZPA 3T6BA 5GMEA 2J7KA 4C8MA 3O5TB 1WKLA 3HVTA 3DYAB 2X1AA 3SMZA 2NCKL 1K1QA 5AE3A 1CJKA 2E29A 2KKHA 3HM9A 3QZ8A 3BYPA 3FSIA 1HNXF 2UUBJ 4DSJA 3ZZRA 1H2UX 2DHXA 3GFYA 3M8QA 3UD4P 5H9FK 1G1XA 4P75A 4LF9J 3BEGB 3O8WA 1I94F 3TZZA 1N88A 5AE1A 2HQCA 1IBKF 1BQXA 2JWNA 3G6YA 3G9CA 1F9HA 2DNYA 1U09A 1YBUA 2DNPA 4OHWA 4ZLLA 4RBVA 2JDJA 3D0GE 4ZVRB 4M95A 1XNRF 4RWXA 4DR6F 4AQYF 3MM8B 3ADAC 4LSNA 4CDIA 5I42A 4Q0BB 1FJ7A 1FERA 4ZK7M 1G3OA 4DR4J 1HNVB 3Q8RB 2DVIA 4ERDA 2D41A 5HK4A 4R5PB 5G0RA 3U7JA 4AXIA 1F2HA 1YDLA 2AYGA 3FCWA 3KMQA 2C3OA 3D7SB 4KIAA 5K20B 3JTPA 4ES2A 1LFPA 2XNQA 1VQPS 2EXUA 2NZ4A 1JLGA 4LF4F 1WC3A 1U0HA 3M6XA 5KFXA 2CADA 3LUYA 3LP2A 3N5BA 3N79A 2AJ2A 4Z7CA 2V4JA 4USTA 3BO3A 4A8QA 1F3FA 2XO6A 4EYIB 4LF8F 3CCJS 3DMJA 3S6EA 2CUYA 1WORA 2WBMA 3PEJA 4NYZA 1FKPA 3C6UB 5B0GA 2DJWA 2GX8A 5CCLA 2QGFB 4DR5F 3GG0A 2J7WA 3JTNA 4DN9A 2XM3A 3RB3A 4DL3A 4DX6A 2HZVA 1JXLA 5A8RA 5DZ7A 2ZHOA 2VQEJ 4ED0A 2UU9F 3W5ZA 3KNAA 3TZYA 2HAFA 2RRNA 1RAOA 2OPSA 5KG7A 3NBPB 3CCSS 3KDOA 5A2QY 4RW4A 2F65A 4TY8A 5H9EJ 1KFSA 2W2OP 3VZIA 5B08A 1NH8A 4C9DA 3CO9A 3R1HA 2PMHA 2V9KA 4ECXA 4H4KA 3MEEB 3DRSA 1I51B 3VZHA 3MCSA 4P2SA 4USWA 3G8SA 2DGWA 4EEYA 2VB6A 3U1MA 1Q8IA 1FDDA 1JWWA 4QCLA 2HNDA 3H8YA 1Z2ZA 4P71A 4ECTA 4ZA1A 1QDUB 3KHRA 3NGSA 3BBCA 3DC2A 1BC6A 3CULA 2ZH2A 1X4FA 1O5JA 2U1AA 3IAM9 4R8UA 3TJAA 1LW2B 4ICLB 3ZNUA 3K5NA 2FHJA 1C4AA 1BD6A 2RAQA 3MEGA 1WC6A 2H5JB 4N7TA 4Q44A 4JI8J 4WZMA 1KLMA 2CKWA 1LXNA 2MY7A 3GSDA 1OS5A 4DL5A 1JMTA 2CJQA 3CCZA 3RR7A 3ENAA 1VQYA 2VG7A 2O66A 3OJUA 2XMTA 3C66A 2VG6A 2KH9A 1T9WA 1QM9A 3KG0A 2I5JB 4JOUA 4KHMA 3W66A 5GAEI 3OTEA 1VQ9S 4FXDA 2FQQB 2QSWA 3POTB 2MGZB 2KVIA 1NU4A 2N7YA 4PUOA 4G1PA 2CNNB 4P7VA 5HN0A 3TX0A 4DV0J 3UDVA 3ZTQA 1U1PA 3GMGA 3OUYA 1AW0A 2IYIA 1ZAXA 1FRIA 2AEMA 2DGVA 2FYXA 2XZDB 1R8CA 3M30A 4PYDA 3LWMA 1M5OC 1RTDB 2ZZMA 4WU2A 3OVBA 2W4CA 3JQJA 3LO3A 1TKTB 1KONA 2GIQA 2L08A 3WDOA 4RBUA 4ZIVA 2UV8G 3TAMA 3VCDA 2LA4A 3KTQA 4IR9A 1RB0A 3MECB 5HP1B 4WWSA 4QZVB 2ZC4A 4KGMA 4M5GA 2B7CB 1CG2A 4RPFA 2VV5A 1RTIA 2UVUA 1CPZA 2QMUB 3FCVA 2FVQA 3CD6S 2OHDA 2VPYB 3H90A 4C8YA 3NOCA 2JFDA 2IIHA 4WYLA 2UXBF 4GC7A 4F2SA 3PYGA 2XG8A 4MKVA 2ROPA 3C15B 1N0UA 2QFJA 1JJCB 1NXIA 2HQFA 2G0CA 3FRYA 3PW7A 4ZMMA 2ZHBA 3IM8A 1X4BA 2GAHC 1SPBP 2NLWA 2NXJA 2YKOA 4NI2A 3TO8A 1U1OA 2XLKA 1RE1B 4FPIA 2FHJD 3K17A 5KT4A 4EGLA 2DNKA 1NO8A 1P9YA 1IN0A 2DO4A 4GMKA 4N56A 1RKJA 4YOEA 1LWCA 2VU5A 1HYSB 4LRBA 5M2RA 4DQSA 5A76A 2JL9A 2VKRA 2H1YA 3IR5B 1MWQA 2F9JA 1LWEA 2Z56B 4IFVB 4WP9A 2W25A 4DUTA 1BWEA 3PY8A 3RAXA 1NUEA 3EZOA 1IBMJ 4H54A 4KFBB 1UA1A 4ZKAA 4I1TA 4JI5J 4OV1A 1KQGB 3M1VA 1X7VA 2VG6B 4ZPBA 1GTHA 2ASJA 4M1KA 2DGSA 2L9NA 4AFFA 4ANDA 2FZCB 4ZCIA 1UCNA 5EWEA 3QJPA 3MD3A 1VK3A 4U8YA 3ZZOA 1JLFA 1HWJA 2DNRA 1EETB 4NEYA 2JRSA 2PMZD 3KG4A 4R8UB 1C0UA 2K2PA 5AT1B 3JYTB 3FEYB 3R7NB 4YR0A 5ADZA 1RT1B 2G1DA 3RBZA 1L3SA 1Y11A 3HP6A 3MD1A 1NNDA 3FMWA 2KG0A 4EZ6A 1S57A 1YTYA 2OJ3A 2IVYA 4YDXA 4X4SA 1C4CA 1RHKB 2DXEA 1WACA 5J1EA 3MR2A 2QE5A 4JI3F 2CQIA 1K8AT 2E9ZA 1Q7LB 3KNGA 4ANCA 1FA0A 4ZPWR 2M2BA 4OJ1A 2HVHA 5EX0A 4ELTA 3TEGA 4RR5A 3E2EA 2OPSB 1JLCA 1XR7A 3H42A 5F8MA 5KFJA 3KK2B 1SJFA 1PJ5A 2HQIA 2E1RA 2EI5A 5EGYA 2HS0A 4L75A 4YEAA 2VC0A 1MLAA 1YJ7A 2BKNA 4WPAA 2LQ9A 4HHUA 4F7VA 3R8YA 6AT1B 3M6WA 4X4UA 1UTAA 5D77A 2C1EB 3D66A 4C8ZA 1C0UB 2EFQA 1WOOA 3OHAA 4RW8B 4UOCA 4DL2A 4DPTA 3AOBA 4QWCA 2B9WA 4DDFA 1EETA 4N8NA 1ZM9A 3D67A 3FBBA 1F2GA 5HJYA 2B56A 4LF6J 1WKJA 3N0VA 1SJ3P 4DL7A 3ZZ0A 5A6WA 1K47A 4O4RA 2EVZA 3UDLA 3Q8SB 2R2UA 1XNRJ 4HT5A 5KFZA 4PAAA 1SCJB 2W7PA 1S4FA 2JX2A 1QAYA 2ZEJA 1F5BA 3DHWC 3HT0A 2HVZA 4LREA 2E5HA 3VV2B 5G0RB 2R7WA 1X9MA 2MKYA 1N36J 3CDUA 3VGTA 1HNVA 1RTZA 2GQQA 1JJ2R 4CT9A 2DY1A 3CJ4A 5GMKa 4KRWA 4Q0BA 2EFPA 1HWIA 1RHRB 2OUGA 4PXDA 3CCTA 2BDPA 1YK9A 1V3SA 1YWXA 4PG7A 1HPZA 2ZOGA 2GQCA 3GLJA 1YJUA 4LF7J 1FWLA 4DG1A 1VJQA 4FS1A 4FF4A 4AYBD 5CCMA 2AYBA 3N6MA 3LPYA 4MKAA 4DHVA 4NEZA 3FZ2A 3K5LA 1RBOB 5J1NA 3DLBA 3FUYA 3SCJE 1NSKL 3VAGA 3FZBA 4F50A 3HCXA 1DBDA 2YPYA 2MHEA 2GGPB 2GIRA 4IR1A 3ONQA 3A3OB 3MMCA 3JAMY 1I5OB 1KC8T 2CQHA 3KLEB 4ZP9A 1S99A 3QIPA 2DBBA 3OV7A 1YG0A 2KYZA 2BW7A 3H2UB 1JLAB 3NNHA 3KJFB 3PRDA 1FT8A 2MEWA 3US5A 1JX4A 1WF0A 2EG2A 2FC9A 2B9XA 1OQ3A 1GMWA 1Y10A 4K4ZA 3MECA 1ZZFA 2OMOA 1AUDA 3RGIA 2VPXB 3NAHA 4LUBA 1RISA 1QSLA 1O8BA 1Y7PA 1GH8A 4WFXA 4UUXA 1XNQF 3NNAA 1CULA 3Q0AA 3QZ7A 2RU9A 2NREA 3OUYB 1M90T 3UPFA 3IBCB 3NMRA 2PIIA 3PDNA 4RLEA 3TP2A 2DY9A 5L39A 4QW8A 1J5EF 4DPUA 2XYPB 3D1QA 4OX9J 2MSTA 4ZVHA 3MFIA 3D6MB 3KK3A 4TQSA 1KLMB 2GO8A 4KGXB 4X64F 1JQGA 3GIRA 5EX3A 4AE5A 5F8IA 5HQLA 4MK8A 2Y1LB 4WKRA 2BACA 1XMOJ 3BH7B 3MZIA 2ZJRQ 4K0KJ 1HHQA 3QT5A 5KFLA 2HHWA 5T41A 1OY9A 4DV0F 3EZ5A 4MYUA 4G6VB 1RWWB 1KLNA 2B51A 3UCZP 1HQ2A 2GQ2A 5HBMA 1RAHB 1B7YB 3PRVA 5H9FJ 2R8HA 3VGUA 4ZCLA 3G6XA 5HANA 1YSJA 3DLGB 1VISA 2E1PA 3C46A 4QYZK 1VQMS 2VODA 5IT4A 2VPWB 3ZZYA 4KHRA 1WOSA 4PXCA 4B3MJ 1Q7YT 1I1GA 1DQ8A 1NB2A 1HMVA 2WTFA 3BV8A 4ETZA 3UE2A 4DPOA 4CLKA 3G8TA 4CO5A 3EGNA 2B5JA 4AL5A 3M32A 3A12A 5KT7A 2AGOA 2CYYA 3CE8A 4W98A 5IXUA 1XJWB 1F1BB 4ZPAA 2QLXA 2LXUA 2VG5B 1Y5LB 2J9EA 1IJEB 2OGUA 3FQLA 2CPYA 5D4NA 5B7WA 4TU8A 3C6TA 4YQWA 5D8HB 3DLLQ 4J9VA 4YHHJ 1BQNB 2EK6A 3I96A 1NDPA 2A2DA 1HQEA 3SCLE 1BY9A 2W4PA 4YB1P 2X3DA 4WFNQ 2R2RA 3T5LA 5C7PA 3NCRA 3AQPA 2DXDA 4V19X 2LDIA 2HNYB 3HVAA 1NSAA 1V9OA 2OEJA 2W9CB 4FS2A 1I94J 1IBKJ 3RAMA 1VQ5S 4OI6A 1Y5NB 2O5DA 2CQCA 1C1CA 4NLXA 4OHXA 4NXMF 1PAUB 1APSA 2BE2B 3HKZD 5IM0A 2POKA 1S1UA 3ZZTA 2UXBJ 3Q8PB 1YI2S 4TKTA 2C28A 4R5PA 1FF2A 1YJNS 2DRBA 1CJTA 4HL9A 5E5NA 2AX1A 5DG8A 2WW4A 1SBRA 3BPSP 3IBWA 3OSNA 2H54B 2BUNA 3CJ2A 2DNLA 4NE9C 5AJ3J 3PJ9A 2XY7A 3H40A 5HQ8A 4ZJLA 1VBKA 3Q8UA 5GAHI 1TAUA 1S1TA 1AA1B 3BQ2A 1S6PB 5K9FA 2ZM6F 2E5IA 1TR0A 1TAQA 1Q4RA 2A0FB 2VASA 1ZAVA 3EWGA 5IQQA 5DG7A 1K0TA 3PV8A 4FBUA 2QN6B 3R6LB 3KG1A 1BMQB 3CEDA 1OYDA 2ZJQQ 3BQ0A 2KZMA 1U0SA 2GO9A 3ILJA 1OO0B 2ERRA 4LT6A 4QU7A 1AB8A 3BH6B 2CPEA 4PR6A 4RW9A 4DUZJ 1VBZA 1RDRA 2BA9A 3K57A 2FVSA 1R8HA 1TV6B 1HHSA 2RQKA 4DR5J 1NK6A 4UY8T 3CC7S 2F4VF 1FKOB 1CQMA 1B0VA 1VIOA 3DLEB 2KN4A 3HX9A 4ID5A 4ES1A 2BEFA 2BM0A 1AXQA 2DR6A 2ILYA 4CQ1A 2EC2A 2ZNZA 1VS3A 3K2YA 4RU9A 3SCKE 2G2OA 1HR0J 3TVYA 2PA3A 4FF2A 4H4MA 5ETMA 4DQIA 2X1FA 2YKMB 4CYUA 1U47A 4MFBB 2DH7A 3THVA 5HAOA 3KLVA 4M5DB 2WRMA 2R8GA 2W8LA 1EB0A 2IMOA 1VHFA 4K2XA 5A8WB 1I6JA 4NZ7A 1JXVA 3WX4A 1CS4A 4OZ3A 5E3RA 5A0YA 2FC8A 2ACMA 3TQ1A 3HO1A 5C42B 4LMZA 3NLCA 3VHQA 1J2VA 2EPIA 3NG8A 5K14A 1N54B 1UFWA 1N5VA 2DGXA 3FJ2A 3HJVA 1JLQB 4WKYA 2XC9A 1S79A 2CXEA 2B4UA 4X4TA 1ZM4A 4B9TA 1YZ6A 2H65B 3HSZA 4FYWB 2L41A 1RWMB 2HGNA 2DIUA 1JLQA 1VOMA 1K44A 2J0XA 2IC3B 3DM2B 1RWOB 1VLOA 1X4CA 2HFOA 2MQMA 4KYZA 2YWFA 1S9EA 4NLVA 2RQMA 2RT3A 2DNMA 1X4HA 2MQNA 3KUHA 4HACB 8AT1B 5A0YB 2K7JA 2RKIB 1GMWD 2DNZA 3PYFA 2KTQA 2NR0A 1WG5A 2OEMA 2KFYA 3KJVB 1XIQA 1N4LA 2EC0A 1G2EA 3I0SA 1X8DA 3DRYA 4GKKJ 2HPUA 2C2MB 4C8OA 4HH0A 2I0XA 3HK2A 2BANB 2COLA 1Y4ZB 3L09A 3OFGA 1PG5B 3TJ9A 4CP5A 1DQ9A 1VRTA 4KC5A 1FEHA 1VRQC 2MTLA 4WIIA 4DXLA 4ED3A 3J7ZT 5J2QA 2WB1D 4JI4J 1X5TA 3QJJA 1S1TB 1RT6B 4RW7A 2KFZA 3ELHA 1RSCA 4I69A 2AW0A 1W7WA 4PG4A 2WVDA 3MTJA 1K0VA 2BX6A 3E01A 1KTQA 4TY9A 2HQGA 3TZXA 1UP1A 1U2RA 1Y5IB 2NPIA 3BGLA 5GAGI 4FVMA 5D4OA 3M7VA 4C0OC 2FJDB 2HRTA 1RTHB 3IR7B 4PEOA 4DUYJ 4AQYJ 4AL6A 2EKNA 2JC1A 2WVEA 3V6DA 1IQZA 3KLHB 1NJWA 2M8DB 1JLBB 1T94A 2DHHA 2K1RB 2HZAA 1U8SA 1WTFA 3OPKA 4K4WA 2DEIA 3Q89A 1MROB 1HQEB 2XSJB 2XHWA 3MCOA 5D0RA 4O3PA 2PFFB 5E0OA 2ASLA 2LQ8A 3PFEA 4ZPDA 3HHNB 4IDKB 1KP6A 1X4AA 5KFYA 2FDNA 3W8GA 3GYXB 2OFGX 2UVWA 3FBCA 1RT7A 5F8JA 3CDBA 4BLGA 1RAEB 3R5GA 1TMJA 1VK8A 1EZZB 2ZWOA 3KLIA 2HK3A 4QIEA 4G3IA 2J76E 3DRRA 1RU2A 4IQMA 1PILA 2XSFA 2FJVA 3THTA 2VONA 4NLWA 2W7OA 2A3JA 5IM0B 3HHLC 4JV2A 1WC1A 2KJVA 4RKUC 2GS8A 1PIEA 5DZ6A 1R8BA 2WOMB 3B78A 3L95X 1HMVB 4ZHRA 3NNCA 2RQ4A 1T9TA 4OZJA 4A4JA 3G86A 4KE5A 1PBUA 4ILRA 5KT3A 2NUHA 1WI8A 1GXUA 2DHSA 2VH7A 4I2PB 2X3GA 3MMAB 4TYBA 4O23A 1D3WA 5LJ5Y 1SJRA 4Z7YA 4GKKF 3G6ES 2PE8A 2XGPA 1OPIA 5HBMB 3DLKB 2RNEA 3AB2B 3PYEA 3TR5A 4I7FA 1U45A 2AJ1A 3SIPB 3GV8B 1N36F 2GNKA 4B3OB 1JNZB 3FDSA 4GC6A 1UVJA 3KLGA 1FK9B 2GHPA 3D0HE 3DRXA 5LSRA 5FIIA 3MUTP 2O67A 3EGVA 4M8LA 1IM4A 3TANA 5HMXA 4F4AA 2BZ2A 2MKCA 3BSCA 2RF2B 4MIWA 3CT9A 5GADI 3C3LA 4K4VA 1S4EA 3SSQA 1VRUB 2D7SA 5CQGA 3M2VB 1U7LA 1IKVB 1L5UA 5KFSA 2XB2D 3D6FB 4EBCA 2CWKA 3I32A 5FD1A 1CULB 2OIHA 2CPHA 3OTCA 2HHVA 4K50A 4ZP7A 1SUQA 3N4WA 4A47A 2PMWA 3AXMA 3K8VA 5L9NA 4YP3A 2XMMA 1RAAB 5C5JA 2F4FA 2N3OA 2G2YA 3C14B 3IWXA 4ILLA 2DGUA 3CCMS 2MXYA 2NSCA 4E8UA 3EXYA 4O44A 3PX0A 1KFDA 1TK5A 1QAIA 3KK3B 3QIPB 3QFHA 3SI8A 1NK4A 3IR6B 3MMCB 4DL0C 5KFUA 3U1NA 2C2OB 3AD7C 2B9YA 4PG6A 2LDYA 2KRBA 3W2VB 1U4BA 2B4VA 5IV4A 4PXBA 2W24A 1WC4A 2IAJA 3FEZA 2LYVA 4Y2KA 1S1VB 2APOA 4IH7A 4ZVFA 2B43A 1S9GB 4HYKA 2Z2ZA 4HVZA 4C97A 4OYWA 2MQ8A 1Q8LA 1FE4A 2GMHA 2HHHF 2CJXB 5K8PA 5DQHA 2J9DA 2D3OR 2FJEB 3LGMA 5ETSA 2IVFB 4YY3J 2DR7A 1D1UA 4C98A 1IUJA 2ACYA 4RUBA 2OPQA 1REVA 2CQ1A 3GIJA 3QGIA 1E6VA 1TTHB 2GV1A 5L38A 1OJ4A 3LANA 1HBMA 2RILA 4CH7A 4O0IA 3ZO7A 3OL8A 4HKQA 3P45B 2GJIA 2KI2A 2YX4A 3MMBB 4DV3J 2UP1A 2CJAA 2VOOA 3GB0A 2VUGA 3ZC4A 5F8HA 2NXUA 2FVPA 1JK9B 3O6QA 5IZHA 3BQ1A 2CNOB 1VMBA 4JB8B 1DTQA 3LALA 3QWUA 2XMWA 4WFAQ 2MKKA 3I9V9 1KVIA 1JKHB 4FYVB 3QFWA 2Y1JA 1RT2B 1UKUA 2Q1LA 3AD9C 4YB6A 2KO1A 3R3TA 1U24A 5I4MA 3OTBA 4QQBA 1QAJA 1Q8BA 3W2WB 4CM0A 2BE9B 4IH5A 3D6HB 4USIA 5BYSA 3EGZA 3TEHB 3MEKA 4TLQA 4PQUB 1U2CA 5DRKA 2UV8A 2DCLA 3TI0A 4I4BA 2LQ5A 3J80Y 2EBGA 3AOCA 3GV5B 3T1YF 2V9WA 4JI0J 2W2PP 2OD4A 1KVJA 3H59A 5LXRA 3R1LA 1T03A 2NYIA 3RRHA 1VC6A 1N5YB 3NGTA 4F3OA 1JIHA 5C24B 2QX0A 1YITS 1X5SA 1N6QB 1NJZA 1FE0A 1MWYA 5CYMA 1XN9A 1FDNA 3J7YU 3V6JA 3NWGA 3V81B 4W92B 3K0JA 2GIFA 2Z8QA 2ASYA 2EFGA 2ZHAA 4RW8A 4QBUA 2J0QD 3R2CJ 1EARA 2M70A 3CDWA 4TQRA 1GMVA 3JYTA 1DY3A 3GJSB 2HAIA 1CC7A 1SV5A 2LFVA 3D54A 4F36A 2MYFA 2YY3A 1QSSA 1BQMA 2QTWA 3MM7B 1EIYB 2B0GA 1T02A 1WHVA 2GJ2A 3HT3A 3TUIC 4LF5F 4C11B 2MPUA 3R27A 4U6PA 4A46A 2G13A 2MKSA 3OLAA 2K7KA 2KM8C 1EQ0A 4OZ0A 3ZZPA 5KG3A 4KGVB 1HKAA 2IJRA 2K8GA 3J7YI 3D6TB 1B3TA 4IQXA 3MR3A 4DL4A 1TKXA 1OIAA 4IO1A 2PC6A 4C6AA 2DNHA 2GC8A 3OQ2A 3UN3A 4D3GA 5EWFA 1T11A 1FO1A 1SIWB 4ED6A 1P27B 2DR5A 3VAMA 2HFVA 3F56A 1S49A 1UETA 3D1OA 4ELUA 1FXLA 4V1Ak 5U47A 4A8XA 5HROB 3GIIA 2AMCB 3J7AN 3CO0P 3CD7A 4UT4A 4WBFA 4F4XA 3HFKA 1S59A 4JBCA 4NA2A 3VAKA 4HLBA 2HNZA 4B9NA 2P9EA 2OTLS 4V19J 4RNOA 1WEXA 2YX1A 3DOMA 4OJHA 2VOPA 4X4VA 5DQGA 5KFVA 4QYRA 3IM9A 1U25A 1IJFB 3SFGA 4M5JA 2D74B 3HKWA 3MR7A 3MM6A 3NS7B 4LFCF 4JYAJ 2DPIA 3DXSX 4LBPA 2R7TA 2JJ4D 3R7SB 4W4MA 3RZAA 4X62J 1FWKA 1NHUA 1Y3JA 4OYMA 5C25A 1WELA 5A2QU 1W25A 2DR8A 2DGOA 2E5JA 2XCPA 1FFGB 2J6TA 2KYXA 2WK4A 4OYZA 2QMXA 4CLPA 1OMSA 4KJIA 1HBMB 5ITHA 1VQOS 2FHMA 1CSJA 3IN5A 2Z2LA 2CZVC 4PQAA 3RU0A 1HNWF 1C1BB 4L3NA 3ZXWA 5THWA 4DR1F 2FY1A 1IVZA 2YKNB 2CPXA 3GWCA 4ECVA 2DRDA 1C1BA 4USKA 5HVGA 2L9WA 3QGGA 1DFDA 2ADCA 3TNVA 1S6OA 4HDGA 1RADB 4QR1A 3TZWA 2BKOA 4B02A 1V6HA 2MLYA 4OZNA 1J5EJ 3FFIB 1S1VA 1IBLF 4NLOA 4DI6A 2JLFA 4F02A 4DV7J 1FJCA 4IRKA 2WBRA 5C25B 2ASDA 4DV2J 2H51B 4OI1A 1LOUA 4LRCA 1FDAA 4MJKA 3ZTSA 2E7XA 4YB5A 4JI3J 4FPRA 4F0KA 3K59A 1GQEA 1IR2A 9RUBA 3SQOP 2XYGB 1T0TV 2XBPA 4WFZA 4UTGA 5HP1A 3M9MB 1KTVA 1K73T 3K8WA 2F3JA 3Q8QB 1YRXA 2QLJB 2QL7B 5IV3A 2IHR1 4DR6J 2MZTA 3DOKB 2LVWA 4NRUA 3H0PA 3Q8YA 3W9IA 1XQIA 4DSLA 2HNDB 1NJXA 3CWJA 2FZGB 4TVAB 2AJFE 3J7Z5 6FD1A 4OYBA 1RP5A 3GE9A 5T14A 2RUSA 3DDIA 3TARA 1UA0A 2I1RA 2GZOA 2UXCF 1FFWB 4UOGA 2I5JA 2XMAA 2VPZB 3UWTA 1OPZA 2ZKTA 2KDOA 3GJQB 4OLOA 1R0AA 4RW4B 5IOLA 2VC1A 3CD5A 3UN2A
chains in the Genus database with same CATH topology
1GT8A 3MEGB 2Y1RI 4RUAA 1H7XA 4KTQA 1BQMB 2OMLA 2HGLA 2XI3A 3BF4A 3SXLA 2GHWA 5KT5A 4JV5F 2O3DA 2FUG9 2QMWA 1KHWA 3GR0A 1UVMA 1S6QB 2ILZA 2KT3A 3DRPB 3NP5A 4TN2A 4BWMA 1N33F 2U2FA 4C4WA 4MMOA 3ITHB 2HHUA 3I31A 1ZPWX 2YNHA 5CYMB 4I2PA 3H2VE 3AA8A 1N6QA 3UNGC 1U26A 4X65F 1LW0B 4DEZA 2CFXA 1P1TA 3HXMA 2VA3A 3E8OA 4WK1A 1XK8A 4IKAA 2NS1B 1PO6A 3DRRB 1KS2A 1DTTA 2LKZA 2PO4A 3AHPA 2A1BA 3KLIB 4JV0A 2DIVA 1U2FA 1W2BR 1S1XA 3U27A 4ECWA 1RT7B 1HBOA 1OWXA 5A8RB 7FDRA 1NJYA 1KOOA 3VR1A 3RRKA 2UUAF 1DZ5A 2KG1A 2AYMA 4DR2F 1IKXB 1M0SA 1ZM3A 4DFMA 3ENVA 4IRDA 4PWDA 3FGVA 2K1RA 2WSFC 4ID8A 5DM7Q 1SI9A 5EUHA 1VGYA 2G9OA 2GMJA 2ZC3A 2Z4PA 1RTHA 3CSKA 1GAOA 2GW8A 3J81Y 1WHYA 2FJWA 1WNEA 2LA6A 3DYAA 3MMBA 3TOQA 4LVNP 2MKHA 4JI1F 5IT0A 1SKSA 1E6VB 5GAGU 3HHEA 2L9DA 4XPCA 3DCAA 1KRPA 1NKEA 2R2TA 3H20A 2QIFA 3CDAA 4F4WA 3DDKA 1WF2A 3R5BA 1VQ4S 1X5PA 1V3RA 1Y00A 3RBEA 2BBEA 1VBYA 1VIXA 3DLHA 1FJGF 1CQNA 2M4MA 5DDRC 1TL3B 3BSAA 2C3PA 2IAJB 4RW6B 3U1LA 2QA4G 5DLFA 4FXVA 4AUKA 5KFCA 1L3TA 2P6SA 1F9FA 3EPGA 3V6HA 5HLFA 3RTVA 3CVKA 3H5SA 3EUNA 3KMSA 3OLBA 2FLLA 5KFHA 3HVTB 2M3DA 3N5FA 4O44B 4KSEB 1IQTA 1LQ9A 2FTRA 3E3XA 4LIRA 3MR6A 1EP4A 3HLUA 1MMDA 4QIGA 1V3ZA 3O1LA 4WE1B 4Q8FA 1X0PA 2EBEA 5DM6Q 3ZZZA 3I0RA 4HTIA 3M8PB 5I3UB 3PKMA 5CA5A 2QT7A 3M2VA 2V94A 4I6WA 2OFHX 3T5JA 4ED2A 4MFBA 3TA2A 1FRXA 2W4DA 4O3RA 2AX0A 2E7WA 2QRRA 1RI7A 1Z4UA 4MH8A 4K4TA 5FLXY 1YVFA 1TUVA 1H2TZ 2LEAA 2IFXA 3B82A 2OTJS 1FK9A 4R0EA 4NYPA 1F0XA 2DCUB 2KJWA 4I6YA 1YJTA 4I7FB 4FYDA 5CZVA 3R5CA 4OX7A 4RNFA 1H98A 3FSYA 4NMLA 3OL7A 2HLUA 5L8RC 3QYYA 1URRA 2PI4A 1SJ1A 2D3UA 3HVWA 2R8IA 5AXLA 1GX5A 5JVHQ 2J0SD 4ZHRB 1UFLA 4JUZA 3K5OA 4Y28C 2R8KA 2RIJA 4KB7A 3RB0A 1UJ5A 3LF0A 3KHGA 3GFXA 3RAQA 3A8EA 3PW0A 4H4OB 4H4KC 5GAHU 1D9AA 2ALZA 1RT4B 4ECQA 2KRRA 1NB7A 4QIFA 3PX6A 5J2PB 4H4OA 5I3PA 1KSPA 2R7OA 4LIWA 2JHEA 3QO9B 4A8KA 1P1LA 1MROA 4NLDA 4KKOA 1Q82T 4JI4F 3M4XA 1FNOA 1TQLA 1LK7A 2ZDOA 4PG5A 1HBUB 1ZETA 3QO9A 5DETA 3M8SA 2ZNYA 2IM3A 1ZOTA 2VFTA 1UWBA 3I4PA 3PW4A 3DI6A 2XCAA 1QE1B 4ZCMA 1SL1A 3NS6A 4NX9A 1VQ8S 4U7UK 3NS5A 4DF8A 4J37A 3IG1A 3FRZA 3R5AA 2BOPA 2NSBA 4IFYA 5IWAF 3W3SA 5J2QB 4CZCA 1XMOF 2CVIA 1NK8A 2MQPA 3BO2A 5KTQA 4Q8EA 2V8GA 4ZDNA 4RBTA 3KJVA 1DLOB 2ZH3A 4WK3A 4RU2A 4RUCA 5DDOC 2RKIA 2YQ3A 4WE1A 3MDFA 4OI3A 4DN0A 4OZ5A 5AE2A 3CCRS 3D2WA 3KKFA 2AV5A 3DM2A 3MPWA 1QVFR 2LXFA 4MKBA 1T3OA 4NLQA 4Y2MA 3CPWR 4X66F 1HR0F 3MAQA 3D0IE 2R7RA 4QPXA 3CDEA 1KQFB 3SDEB 2GFFA 4OMFG 3UR3C 2F1FA 3IA0A 4NLRA 2NPFA 3H4BA 1WTBA 1PC5A 3D5MA 4RX6A 2X1BA 4Y3CA 4ETXA 1S72S 2UUCF 1HD1A 3GIKA 2DK2A 3DOLB 5HL7Q 2C2RA 5A8WA 3UR0A 2ZH9A 3JSBA 1VQ6S 5CH7B 1VLYA 4M5DA 1C2PA 2ZUGA 3OR1A 1F5CA 4C3MA 2V5HG 5B0EA 2VBZA 5E3AA 4XIUA 2DNNA 1MNEA 1FVQA 1HI0P 4NWBA 4EUVA 1T8EA 1EP4B 1ELOA 2KXHA 3AH6A 4F4KA 1LWFA 2WW8A 2ZDPA 4A48A 2RDJA 3DLEA 4ID5B 3OVAA 2CJKA 2JLEA 1H2VZ 1JLAA 5LL6d 3HHLB 3BN7A 2F40A 5D78A 3OXGA 3QPIA 2KB2A 4WU3A 2YNFA 4J9QA 4TXSA 3K58A 5HLFB 2FHKA 5HMYA 4EZ9A 3HHKA 1U48A 3OBIA 5A8KB 3OW2R 1LFWA 4MK7A 4RW6A 2H5EA 2VQFF 3IXQA 1U1LA 4B17A 1VQLS 3BDPA 4UQGA 5F41A 3CC4S 1SKWA 2HGMA 3NL0A 4DG1B 1S0OA 3VAFA 2JOQA 5KT2A 4OIXA 5FDLB 5F8LA 5DLGA 4J9SA 5KFOA 3HPOA 1Q78A 2V8HA 3TAQA 5B0CA 4E0DA 3BGRB 2DH9A 4KO0A 4WCEQ 2HIQA 4DV2F 1TK8A 3UCUP 4M94A 5D4LA 3RR8A 4B9LA 3P5TL 1WHXA 3Q2TC 2M88A 4RUHA 3ZFVA 1LW0A 1C0TA 1NRKA 1B7FA 5AJ3F 2HNYA 3KHLA 1B64A 2LECA 3SFUA 4AL7A 4CNYA 1QAXA 4NCBA 3IGNA 1VQNS 2MZQA 3ZZUA 5K8NA 1CLFA 1XERA 2Y1IA 5F9LA 2ZKUA 1UMJA 1SQEA 2K3IA 4DL6A 4MIAA 4ILMA 1RAJA 4RWWA 5SZTA 4JV1A 4NLYA 4IO9Q 5K8MA 1GXLA 3M32B 3HHLD 1HBNB 5LMNF 5F0UA 1XWLA 5B0FA 3SEOA 4USHA 3T1AA 3PIPQ 3AJ1A 2XLIA 3IWLA 1FKAF 2KHCA 3NAIA 1MU2A 1RTJA 2F8MA 2EFNA 2CQBA 4I67A 5JJBA 1YJVA 4Q2MA 1SL2A 1NK5A 4MK9A 3SSSA 4U9RA 2XLJA 4ECUA 3AA9A 3FEXB 3DLGA 3HMJG 2ZOFA 5IFMA 1KN6A 3NKYA 5KFAA 3U02A 1YJWS 2VZ9A 5H1SV 3X1LB 4N77A 2D9PA 2IRUA 4Q7AA 1VBXA 4F2RA 2AJQA 3GG1A 1FXRA 3M8RA 4HI2A 3DGPA 3V2UC 1QSYA 2RB7A 3I5BA 5G4DA 2RDIA 4WFBQ 2AJ0A 4QWEA 2HW3A 2RVJA 2WONA 3MM5A 2C22A 1R0AB 3IRXA 3RB6A 4U7CA 3NMAA 3GQCA 4TNOA 4QWDA 4KFBA 3HI9A 1S6UA 3IO1A 3MI7X 4Y2CA 5B0DA 5KFQA 1FRLA 2MQQA 5F3TA 2XMVA 4X4PA 2DNOA 4OQJA 1XMQF 2C3UA 1TL5A 1XR5A 2IRYA 4J9MA 1R31A 3NCQA 4ZPCA 1KQSR 2JVOA 2QO3A 2ZH7A 3M2UA 3L7OA 4MKYA 1HA1A 3J7A1 3ISZA 3S7RA 3RRGA 4F67A 4L72B 1SH3A 4EO6A 2R2SA 1IKYB 2HVIA 4K5SA 3TUJC 3MM9A 3A1YG 2FLPA 4ZP6A 4YB7A 5F0WA 1MSWD 2DD8S 3MUVP 4QWBA 1S1WA 3NGKA 2FVCA 4EU0A 3MM9B 2MB0B 1OSCA 1QVGR 1IKYA 1E6YA 4RNNA 4WJBA 4DLGA 3H5XA 5KT6A 2R7XA 4ECRA 3MR5A 1NKCA 2MMYA 2MSSA 5DQIA 1R8PA 3ETOA 3I5AA 5KOXA 2VFSA 1HPZB 2HMIA 1CVJA 3DHXA 3N01A 4JI8F 2NQPA 4OX9F 2R4FA 1T05A 5KFNA 4JI2F 4Z37A 5J1PA 2BM1A 4NZ0A 5CYQA 3KK1B 1ZPVA 2A2CA 4J9NA 4B9MA 2OSQA 3PFOA 4N76A