3P5TL

Cfim25-cfim68 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
76
Chain Sequence
LYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVSEASSKKLMDLLPKRELHGQNPVVTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Cleavage and polyadenylation specificity factor subunit 5
publication title Structural basis of pre-mRNA recognition by the human cleavage factor Im complex
rcsb
source organism Homo sapiens
total genus 14
structure length 76
sequence length 77
chains with identical sequence M, N, O, P, Q
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3p5tL00
2GHPA 4P6QA 3CPWR 3CCMS 2KXFA 4ED5A 1VQ4S 1RK8A 2N7CA 4BS2A 1M5VC 3VALA 4TU8A 2U2FA 1YI2S 3SXLA 2AYEA 2F9DA 1HD1A 2FPHX 3J7YU 1IQTA 2DNHA 5ITHA 1WI8A 1YIJS 1AUDA 1DHMA 2RQ4A 3BO4A 1W2BR 2PE8A 1YTYA 1X4FA 5CYJA 5HL7Q 3S8SA 2CQDA 2DNRA 3UWTA 2OIHA 2XSFA 2SXLA 4YOEA 2L08A 4J5OA 5HO4A 2DNKA 2KU7A 2QA4S 4QU6A 1S72S 4CQ1A 1KD1T 2OSRA 3R1HA 4RU2A 1UFWA 1K8AT 3G96A 3UCGA 3FEXB 3VAMA 1X4HA 2DGTA 3P6YC 2MZSA 1O0PA 2DHXA 2KH9A 3UE2A 2MQOA 2CQ2A 2HVZA 1WHYA 1KC8T 4CH1A 3UD3P 1P1TA 3TYTA 5GADU 3SDEB 2MKIA 3N9UC 3H2VE 1YJWS 5DDQC 2X1FA 2MKCA 1Q86T 4ERDA 2DHGA 2KM8B 1HD0A 2LEBA 3MUTP 2QFJA 2MQQA 2CQCA 2E5IA 2KG0A 2EVZA 1WHVA 1WELA 3UD4P 1U1RA 2MZTA 1U1PA 2LECA 1VBXA 1A7GE 3PIPQ 1R8HA 2FHOB 2B0GA 4F02A 2XS5A 2CQ3A 5BJRA 5JVGQ 2A3JA 2DNQA 2N82B 1SJ4P 2LA6A 1OWXA 2DGXA 1WHXA 1FNXH 1VQPS 2X1BA 2KFYA 2MQMA 2DK2A 3MURP 2LEAA 1WG4A 3MI7X 2KYXA 5LJ3Y 4A8XA 4CIOA 3SDEA 4IO9Q 2KG1A 3NNCA 1DZ5A 3VAFA 3CC7S 2MYFA 1ZH5A 3NNHA 1SJFA 1RKJA 1F9FA 2DHAA 4IOCQ 2MY7A 3PIOQ 5DM6Q 2QEXS 3CCJS 4IOAQ 2MGZB 5JVHQ 4WIIA 1VQKS 2CQ1A 3TO8A 5DDOC 5EN1A 4Z2XA 3CULA 2KM8C 2RUGA 2DNZA 3IRWP 2N3LA 2EK6A 5D77A 2XS7A 4PKDB 4C0OC 2MSTA 2EK1A 1VBZA 3J7ZT 2JX2A 4C4WA 1N8RT 2YTCA 2KXNB 2MJNA 3DXBA 2YH1A 1B7FA 2YWKA 2MKSA 3MDFA 1FJ7A 1X0FA 2OTLS 1VQ5S 1VQOS 3G6ES 4V19X 1YHQS 1U6FA 2O3DA 2N3OA 1X4CA 4W90B 2OTJS 2G1DA 2UP1A 3CTRA 3MUMP 2KVIA 2MPUA 2CQHA 3G8TA 2MGZA 3MD1A 1KOOA 2KHCA 3BO3A 1UW4A 2HGMA 2XS2A 1ZZNA 4F26A 5MLCV 3B4DA 1FHTA 2DHSA 1NU4A 1H2UX 1X4EA 2NLWA 2XB2D 4LIRA 1VQ6S 3THPA 3ZZYA 1WHWA 4IUFA 2D3OR 1KOHA 3BO2A 2BZ2A 2DNMA 2HYIB 2D9OA 2X1GA 3MUVP 1URNA 2JVRA 3NNAA 1D8ZA 1WF0A 3OW2R 1R8PA 2RS2A 2OSQA 1VC6A 3SMZA 2DNLA 3CC2S 2F9JA 2HGLA 3CC4S 1JJHA 2E44A 3HHNB 2AYGA 2DNPA 2DB1A 2CQ0A 3U1LA 1JJ2R 3G8SA 1VQNS 2CPZA 1WTBA 2JRSA 1WG5A 2CJKA 2MHNA 2CQ4A 4OZ0A 5D78A 5DDRC 3S7RA 4QQBA 1X4BA 2FC8A 1X5SA 3LPYA 1ZZFA 4UQTA 5GVQA 2ADBA 1M90T 3LQVA 1N88A 5LSOA 4Y00A 1WEZA 2HZCA 2KXHA 4WFAQ 1FJCA 2MZQA 2PEHA 1PGZA 1D9AA 1U1OA 5LXRA 2M70A 2DNOA 3ULHA 1SJRA 1U1QA 5CXTA 2XNQA 1WWHA 3P49B 2LXIA 1QM9A 5IQQA 2MJUA 2LQ5A 1U1KA 1Q7YT 4YB1P 1YWXA 2VOPA 1VQ7S 2HGNA 2CPXA 2CPJA 2LKZA 4ZKAA 3UCZP 2DISA 5LSLA 2LYVA 2DNGA 1VC5A 3R27A 4YUDA 2X1AA 3CCQS 1M5PC 2M52A 2DNYA 1DRZA 3G9CA 2M8HA 3EX7B 2MKJA 2ZJRQ 3S01A 2F3JA 3P3DA 1H6KX 2MZJA 2CPFA 3ZZZA 2YH0A 1SJ3P 3IWNC 1M5OC 2VOOA 2AYMA 2DIVA 2CPYA 4UY8T 1X5PA 2FC9A 1G2EA 2CQGA 1X4DA 2MXYA 2K8GA 2VONA 2FY1A 1HA1A 2MMYA 3EGZA 3RW6A 3G4SS 4TLQA 3VAHA 1K9MT 2MKHA 3B4MA 2NZ4A 2E5GA 4EGLA 1VQLS 1OO0B 2OJ3A 2RS8A 1X4GA 2J0SD 4LMZA 1YITS 1H2VZ 2DO4A 2LXUA 2CQPA 1VBYA 1H2TZ 2M7SA 3VAJA 2DNNA 2DGWA 3L3CA 2ZJPQ 4WFNQ 2U1AA 5IM0B 2GO9A 1NO8A 2JVOA 4PRFA 1FO1A 1UP1A 4F25A 3CMAS 3V4MA 2LCWA 1QVGR 2MSSA 4WCEQ 5GAEU 4C7QA 3MXHP 3CMES 5GAHU 3MD3A 1U1LA 2ADCA 2J8AA 1KQSR 1A9NB 5CA5A 3BS9A 3CCVS 3BEGB 3NS6A 2V94A 5DM7Q 1FT8A 2DGOA 4M5DB 2M9KA 3NMRA 3P5TL 2CPEA 3VAKA 2DGVA 2DGUA 2M4MA 2DGQA 1WI6A 2DITA 3H2UB 2ZJQQ 4PR6A 2MQLA 2G4BA 4U67Q 1VC0A 5IM0A 1U2FA 1NJIT 2MZ1A 2LA4A 3HI9A 1P27B 1VQ8S 4W92B 3THTA 2KRBA 1M5KC 1YJNS 3K0JA 2CQBA 3S6EA 2M8DB 2RU3A 1Q82T 1FXLA 1BY9A 2RNEA 1DBDA 2D9PA 2RT3A 2VODA 3CCLS 2DIUA 3VF0B 1VQ9S 2XNRA 1VQMS 2I2YA 4QU7A 3DLLQ 3JB9k 2L41A 5DETA 3CCSS 3I55S 2CPHA 1OPIA 2LMIA 1QVFR 2M0GB 3FEYB 2RRAA 4WF9Q 1N52B 1UAWA 4CH0S 3MOJB 2RQCA 1Q81T 2RRBA 3CCRS 2DGSA 1WEXA 1OIAA 2CPDA 2KI2A 1X4AA 4FXWA 1XN9A 5GMKa 3CUNA 5IFMA 2AD9A 2CQIA 3Q2TC 1S79A 2AYBA 2MQNA 1YJ9S 1PO6A 2CPIA 3G71S 1JJ4A 2JWNA 3I56S 5LXYA 1JMTA 3EGNA 2M88A 1CVJA 5LJ5Y 2DO0A 2WBRA 1K73T 1U6BA 1L3KA 4OZ1A 2DH7A 1X5TA 4FXVA 3U1MA 2L9WA 3CCES 2M2BA 4QPTA 3VAGA 5DDPC 2J76E 1M1KT 2E5JA 2J0QD 2MY8A 4Y0FA 4TU9A 5FJ4A 2G0CA 3US5A 4WKRA 2MZRA 3NS5A 2E5HA 2K3KA 1N54B 2DH9A 3TP2A 2KN4A 2Q79A 4WFBQ 5GAGU 1U1NA 5H1SV 2RVJA 3RW7A 1WG1A 3D2WA 3Q2SC 2MB0B 3CCUS 1U1MA 2DH8A 4TU7A 3CXCR 1SJQA 2MQPA 3R1LA 3UCUP 1SXLA 2ERRA 2KRRA 3CF5Q 1WF2A 1FJEB 2MKKA 2YKAA 2KT5A 4LJMA 3CD6S 2BOPA 1WEYA 1WF1A 1X5OA 2I38A 1HL6A 3VAIA
chains in the Genus database with same CATH superfamily
3DYAB 2EFPA 4JI0J 3T5JA 4NL5A 1RK8A 2RKIA 1C4CA 1JLQA 3AOAA 5DGBA 1GAOA 3BO4A 2DR7A 2X51A 1GXTA 3D1OA 4DV4J 4YOEA 3TA0A 2HK2A 3DLBA 3MM9A 4OI4A 1O0PA 1NKCA 1NJWA 1HNXJ 5H9FK 4AYBD 5B0BA 3LAKA 3T6BA 1YJWS 4UUWA 3RRKA 3ILOA 1GK8A 5ETPA 3EVOA 4ZVOB 1CJKB 3QT8A 1R27B 3OR1A 2B8PA 1GFWB 4ANEA 2RF2A 1S0OA 4N47A 2WHOA 4PQAA 4H54A 4DZDA 2ALZA 1RT1B 1WG4A 1IBMJ 5SZTA 2VA3A 4YDDB 5IT4A 3FBFA 5M2UA 4DL3A 4HR2A 3NOCA 3QBCA 1HBOA 9ATCB 4Q0BA 4BBYA 5A8WA 2RILA 2MGZB 4RX6A 5DDOC 4DPYA 1NZAA 1NUEA 3QYYA 3ONQA 1N4LA 1N6QA 1NB7A 2D74B 3MM7B 4C4WA 4I56A 3K5OA 1U6FA 5IT9Y 3NAHA 3AJ1A 4CDIA 1FD2A 1KTQA 1NAQA 5KAKA 3G8TA 2KHCA 1IKXA 1ZZNA 2N4CA 4RBUA 1N34F 2RMLA 3NLCA 4LIRA 4QR0A 4CP5A 4IUFA 4RW4B 2HYIB 2EFNA 1EKRA 1URNA 2JVRA 4ZP8A 2A6OA 1FEEA 5ETVA 4QYZK 3HHNB 3FGVA 2MHNA 3UO0A 5HK4A 3WX8A 3N01A 3LALA 2P9GA 3VGTA 2BJ1A 4AQYF 2BA9A 1XR5A 4O3NA 1UZHA 3C2PA 2YNHB 2HS0A 4KHRA 3KTQA 3LP1A 1URRA 1Q5VA 3RUBL 1ZPWX 1RYRA 2Q6CA 4X66J 1GMUA 2BDPA 5I3PA 2CZ9A 4FDFA 1P6TA 4CLWA 4B3MJ 1TVRA 5EX3A 4ZKAA 2DISA 3J7Z5 3EUNA 2V2QA 4LF9F 1PCAA 2HHVA 2GIQA 2MZJA 2CPFA 1SJ3P 1JIHA 1CULA 3MR7A 3G2XA 5KFVA 4PABA 2RHQB 1X5PA 3PFOA 1YVFA 3K17A 4N76A 1X4DA 1TKZA 3DRSB 3MGJA 4UOCA 2IHR1 2XI2A 1OO0B 3D67A 2G13A 1H7XA 2M7SA 5E2QA 2XO7A 2ZJPQ 4OHVA 2D1CA 3LW5C 2Q1LA 4J9VA 2LU2A 2XI3A 1T05B 1Y11A 3NMRA 4JP8A 2DGVA 1ZAVA 4X4QA 2OPRA 4ZPTR 1DTTA 1ROFA 3HKWA 4DJBA 2JZ5A 5CABA 2UVVA 2QIFA 2FY8A 4Y2IA 4WFZA 3OTDA 1UETA 4CO0A 2ATCB 4EUVA 2RNEA 1RCOB 2QL9B 3H5UA 2I2YA 4KH0B 3MM5A 3TUIC 3DLLQ 1JLFB 4B9UA 4O4GB 3BSNA 3AHPA 3C6UB 1UVLA 1N5VA 3DOKB 4I6YA 4ZA1A 1NHUA 2YKNB 4CM0A 1FI4A 1UVKA 1Q81T 1YSJA 1HQEB 3CEDA 1K44A 2KI2A 1CLFA 4FYYB 3R8YA 5IFMA 2JWNA 4CM2A 1WD6A 5HMXA 2HQ3A 3PM9A 3KMQA 3M2VA 4F67A 1MSWD 2J6UA 3VAGA 1D8YA 2YX7A 1KBRA 5EWGA 1ZM3A 2AF6A 2RKIB 5ETSA 2DR9A 2KN4A 1Q8LA 2G0JA 5GAGU 2HBQB 1TR0A 1JLQB 2VFRA 3LGNA 2R7TA 2VASA 3ISZA 2D7SA 2MB0B 4QPXA 3WZ0A 1S12A 4ZS6A 5K5MA 5C7PA 5F8NA 3VAIA 3M2RA 3MM9B 3CPWR 4CO2A 3TZWA 3PW2A 2ZH3A 4PUOA 1SVDA 4C8LA 3LP2A 4K8RA 4KE5A 2RQ4A 1LK5A 2PN6A 2H4YB 3OR1B 2CYYA 1EIYB 3EXYA 2RF2B 4EI2A 3G96A 5L39A 4EK2A 4QIGA 3UE2A 2FLLA 1WHYA 1C2PA 4C9DA 2O1PA 3W5ZA 2MKCA 2QL5B 3BQ0A 4FYDA 3UD4P 1HBOB 4DSJA 1R8HA 4Q0BB 4HHJA 2FHOB 3A8KA 5A8WB 5IC6B 3SQOP 4KRWA 1N6QB 2A10A 2HHHF 3B78A 4KJIA 4TVAB 2DK2A 3HF5A 3D6HB 2DBBA 5AXMA 1REVA 3K5PA 3MCOA 2XSJA 2RQMA 2UZAA 2W7OA 2DHAA 1U49A 3RAQA 4PXDA 1IKXB 1EHWA 4KTQA 3KLGA 3IR7B 5D77A 4NZ0A 4KHPJ 1LW0A 4K4VA 2KXNB 4CLPA 4TY9A 1X0FA 1I94F 2OTLS 4FPRA 2WZ1A 4CLSA 3GCXP 4L73A 2CNNB 2R8JA 3HM9A 5C5JA 4ZVPB 5KFTA 2HG4A 4EZ9A 2V8VA 1HNZF 4J9RA 1S0MA 2V68A 3BO2A 1VISA 2DNMA 2YKQA 4JI7F 4N41A 3RTVA 4KPYA 3LP1B 3M9MB 1UWBA 2OSQA 3W5YA 1YG0A 4K4TA 2E44A 4IRCA 3HHLD 3TJAA 1AA1B 2HVIA 4LRCA 1TVRB 2FGCA 5DDRC 4NLWA 2F4VF 2VH7A 4WWSA 4E2FB 2ASDA 3HHDA 1CULB 5G0RA 1QSYA 4LF6J 4NWBA 1VYAA 1TKZB 1N5QA 1Q7YT 4EYIB 4DL2A 4QJVA 3CIZA 1TKDA 3QGHA 2VBWA 3BDPA 5M2PA 3BH6B 1KQFB 3AOCA 1NBEB 5D3GA 3J80U 2JLGA 2IVFB 1U09A 2CA9A 2WAQD 3JTNA 3CDBA 1RT7A 3B6BA 2H5EA 1RHQB 2CQGA 2K3IA 4RNFA 2LU1A 1NSKL 3OLAA 1R0AA 2CJXB 3IMQJ 4J37A 1ZETA 2UUBJ 2OPRB 2J5AA 5KOWA 4XO0A 2JEGA 3CE8A 4PRFA 2XMTA 1XNQJ 4YHHF 3THVA 1SQEA 1FFSB 4GRSA 3NS6A 2Y8YA 2VBXA 3PX4A 3RG6A 3H2LA 3J7AN 3MM5B 2XZWA 1FWLA 4H4OA 4Y2AA 3I82A 1IBLJ 2YWEA 1OSCA 3QFHA 2ZJQQ 4PR6A 2G4BA 4E98A 3DI6A 1UEVA 1IR0A 2Z2MA 4DV3F 1B0TA 2W2QP 2D9PA 3IBFB 3PXGa 1JX4A 3I87A 4I7FA 1MN9A 1FX4A 1LKZA 3M2VB 3GFHA 3TUPA 1HHTP 4NA2A 3Q8PB 1P8GA 4NZ7A 1FCAA 4ILMA 2J0XA 4RW7A 2HEKA 3CCRS 4F2RA 3DC2A 3Q2TC 3MEEA 2B56A 4IDKA 3GFXA 5DG8A 4K0KJ 4WXWA 2ZITA 4FXVA 3MFIA 1N5SA 4CNYA 1LQ9A 3R6LB 3M2RB 5DDPC 2F8MA 3R7SB 3US5A 1VDHA 4PUOB 2RIJA 2IMWP 4TLRA 1RWNB 3LP2B 2XLKA 2XYHB 1WSRA 2AJQA 1U1MA 1BUXA 1IKWA 3R1LA 2MQPA 3QATA 2E66A 3HHLA 5CH7B 4LJMA 4OV6A 3CD6S 1WF1A 3D6TB 3R2DJ 4P71A 5IV3A 3W2WA 3TAQA 2J9DE 4YR0A 3VCDA 4FBUA 4PXCA 2BOAA 2UV8A 2ZE2A 1WI8A 4ES1A 1W2BR 1S1VA 2DNRA 3UWTA 2OIHA 5HO4A 1HLWA 2GIFA 1LEOA 2NSCA 4LBHA 3TUJC 2VIHA 2HZAA 3OL8A 1REVB 3M8YA 4NCAA 4ANDA 4ERDA 3UI3A 2LEBA 2XSJB 3IR6B 1NDCA 4R8UA 1FRXA 4K5RA 3FFIA 2G2ZA 2EVZA 4DR2F 4DR7J 2O01C 1SI9A 4DR3F 4IG0A 4DV6F 1OWXA 3NP5A 3KLGB 4QWBA 2GC8A 2F7VA 1LW0B 2HNDA 4D3HA 4DI6A 5F0WA 4LFAJ 4ELUA 2UXBF 4JI8J 4USTA 3MOZA 1KRPA 3TO8A 4RW6A 3EWGA 1VHFA 4OHXA 5KT2A 1E6VA 4RR5A 4B3TJ 2E9TA 3D5MA 3HHEA 1SJ1A 1WJ9A 3PKYA 1N8RT 4ZP6A 4C3KA 5F0UA 1NHVA 1T02A 1ZBTA 4BLGA 4TYAA 5D4LA 4DR4J 2CFXA 1UWBB 1W25A 2YKOA 3QAUA 1FKAF 2AKWB 4FF3A 1K47A 1DLOA 5HVFA 4F26A 3CJTA 4UUXA 2DEIA 2WSFC 2AMCB 3KLEA 1X4EA 2ASJA 3I0SA 5HANA 2JLFA 2FHMA 3MUVP 5G0RB 4QWAA 2A1BA 3FCWA 2CJ9A 1YBTA 3RJMB 3NGTA 2YVSA 2P2CB 4ZVEA 3ZZUA 2AJ1A 4ECVA 1N88A 2VU5A 5D3GB 2KXHA 1FJCA 2GJFA 3NS7B 4G3IA 2XQCA 1BQNA 2AGPA 4G1IA 5HMYA 1RT7B 4DX5A 4JYAJ 1LWEA 1NK8A 2K2PA 1U1KA 5H9FJ 3CJKA 2VOPA 3NCQA 1R0AB 2V0NA 2HBZB 4O0IA 1I5OB 2B4PA 3GFYA 1IR1A 3S01A 3PW0A 4FYVB 2ZWOA 3GSIA 3GPAA 4K2XA 5B0GA 4UY8T 4RLEA 1G2EA 1FF2A 3L09A 1HYSA 1FEHA 3C3LA 3AODA 3BZQA 3L7PA 3R5JB 4H4OB 3M4XA 1XNRF 3KYLA 1HQ2A 2OD6A 4NI2A 4FN5A 3DI6B 1VLYA 2HFZA 1CC8A 4WP9A 4DXLA 4NE9C 4PG7A 3VWSA 3MM6A 1RGVA 1S10A 3HULA 4F3QA 2IM1A 2FZCB 1U1LA 1NKEA 3KG0A 4YR3A 2HLTA 5KG3A 4I7FB 4IOBA 4JI2J 1NDPA 4A47A 4TXSA 5DLGA 4ECTA 1R31A 7FD1A 4DS4A 4N56A 2QYCA 2VKZG 1F9HA 3H5XA 4RW7B 2F5GA 1XIQA 2AEJA 1U2FA 3K2YA 5K8PA 4W92B 3THTA 4IRDA 1YJNS 2CQBA 3MEEB 3QRPA 3AFGA 1D9DA 4IDKB 1GXLA 4MK7A 2IY5B 5C25A 3F41A 3CT9A 1RCXB 1OPIA 1G7CB 5E3PA 4ELVA 3HP6A 2KVQE 1OIAA 4DCJB 4JI0F 1YK9A 3CUNA 4H4MA 2H65B 1IKWB 1YJ9S 2DXDA 4DN9A 5J2PA 3HHLB 3BGOP 1N0VC 2WBRA 4EO6A 1VR6A 2DH7A 4U95A 3U1MA 3TX8A 4X62F 2ZKTA 4QPTA 3TVZA 3GB0A 5EGYA 3W2WB 2FLPA 4DPXA 2VJVA 1N54B 4K2JA 4WFBQ 1U1NA 3OD2A 1M1GA 4ZPWR 2ZE2B 3ZTOA 4LF5F 2NXEA 3Q2SC 4B02A 1RADB 6FD1A 4IH6A 3R7NB 2R7VA 5KT6A 1S1VB 4WPAA 4MAKA 4WBFA 5HAOA 2W24A 1N5TA 3BN7A 3PEHA 4P6QA 2NUHA 1PILA 3JSRA 2HWHA 2NZCA 4I6AA 4P74A 2ZWPA 3L9ZA 2W9CA 3VALA 2LDYA 2F9DA 3GILA 5CYMA 4R8UB 4OI0A 3FFIB 2VZ9A 3R5AA 1Y0HA 4IG0B 3AQPA 2KZMA 2XULA 5J2QA 3EPIA 1MMLA 4DX6A 2HNDB 1TKXA 4C98A 2C42A 4C8NA 4MIBA 4A8KA 4OJHA 1BHNA 2LFVA 1KONA 2HHPA 4ANCA 1YJUA 3HJFA 4M5IA 3IGVA 4DL4A 5HVGA 4FF4A 4I67A 3QQCD 1XERA 4RW6B 2DGXA 4HKQA 1E6VB 3R5CA 5LJ3Y 3PYGA 2B4UA 2DT9A 4M8LA 3VAFA 4GKJJ 2FIUA 4Q2LA 2UUCJ 2V4JA 3BPSP 2RUSA 4IOAQ 3N28A 4Z2XA 5KOXA 2CJBA 2RUGA 2ZOGA 5D6GA 1DLOB 4ES3A 4ECWA 2GHWA 1G1XA 4CO4A 3KLEB 2AZ1A 4P9SA 5KFUA 1FVSA 2XS7A 4NYPA 1S7IA 1JJCB 3I0SB 3WIUA 2UVRA 4J91A 4B9SA 3SZ2A 3V4IA 1T0TV 4W90B 2FVRA 5FIIA 3W8PA 2HGMA 1FHTA 4CLUA 2XGQA 4MYTA 4X66F 4KQZA 4U7CA 1KHWA 3CIMA 4LSLA 3BKUA 1BQNB 2ROEA 4U96A 1LFPA 2LVWA 5IOLA 3OW2R 3AJDA 2OPPA 1WKLA 5KFWA 2YWFA 2JJ4D 1LWEB 1J5EJ 4URQU 2YNGA 1VQNS 3U1LA 2XCPA 2CPZA 1JJ2R 2JRSA 4AT1B 1RWWB 2C2DA 4Y2MA 3CJKB 4I2PA 2GQCA 5E5NA 4FNIA 5LSOA 2OI2A 2WSEC 2VUGA 4WFYA 1Y3JA 2M70A 2DNOA 5CXTA 1HNVA 2XMJA 2LXIA 3FEZA 3OSNA 1HKAA 1BD6A 1SIZA 2YXLA 1RAOA 1HYSB 1GTHA 3PR4A 5F8LA 2VJUA 1PYSB 5K9FA 1VQ7S 2B7BB 4NA3A 4ETZA 2XTJP 4V19J 2YKPA 1QAXA 4R5PA 4NI2B 2OUGA 3PACA 3MM6B 5I3QA 2L9DA 4TNOA 4FNHA 2CPYA 3MCMA 2WW8A 2HRTA 2FY1A 3RW6A 2R7SA 3SCJE 1XR7A 4B9LA 1IWGA 2L9NA 3IBWA 1H2VZ 4NMLA 4Q43A 2CQPA 3CJ2A 5HQMA 2P9EA 1YKWA 1S0VA 3IP0A 4LF7F 2DGWA 1VHIA 1EX8A 2WVCA 2XHWA 4HHUA 3OL6A 4JI6J 2BJDA 2ADCA 3B82A 3EZUA 3BEGB 4DCPB 2V94A 3GJSB 2ZNZA 5KFCA 2DHHA 5C25B 5HATA 3ZTQA 3T5KA 1WI6A 3RB3A 3OV7A 2NYHA 2C3PA 5A76A 4PG6A 3TVKA 4UOHA 1H73A 2FTRA 3UNYA 2D3O1 4H4MB 1T8EA 1AB8A 2RT3A 2XM3A 2VD3A 5J2PB 3EVMA 2PFFB 3X1LB 3JB9k 2PDAA 2OHDA 4ZP9A 4WIQA 4WU2A 4DV7F 3QGIA 2AX0A 1PAUB 4KBIA 3JAMY 2H9ZA 4HH1A 2BUNA 2BJ3A 2CPDA 1X4AA 2ZH9A 1P1LA 3NL0A 2C22A 3EGNA 3IR5B 1EP4A 3N5FA 3ZZRA 1YDLA 2J0QD 3GJQB 2E5HA 2W9CB 3V5RA 1C0UB 3MR5A 4WKYA 2MDAA 4DL6A 3TUZC 1PC4A 2DH8A 5CYMB 3RB6A 1EAYC 3UCUP 4G65A 4ED2A 4ILLA 1CBKA 1M0SA 2MKKA 3V81A 2YKAA 2Y1IA 3G87A 3H7HB 3SFGA 2IJRA 2GJIA 4USHA 5J2QB 3MECA 2BXJA 3FBEA 4BS2A 1TKXB 1TV6A 2U2FA 1XMOF 2QE5A 1HD1A 2W9BA 1IQTA 3V6DA 3DLGA 5GAGI 1YTYA 2QV6A 5B0DA 5CYJA 2OEKA 2H3EB 1HR0F 2DNKA 1KD1T 2DGTA 2AP6A 3Q8YA 3TNVA 2HVZA 8AT1B 1PIEA 4NYZA 3IWXA 4F0MA 3CJ0A 4DSLA 3D1QA 4DG1A 3M1VA 3F0NA 2E5IA 2Z2YB 3B54A 4L75A 2V4JB 4KFBA 4OHYA 2AEMA 4USIA 3BKFA 4B3SF 3HD2A 2L48A 2B0GA 2R8IA 5CZXA 2AZ3A 1SJ4P 2N82B 1GXUA 1S1UA 3KK1A 2LA6A 1FNXH 4PG8A 2YKMA 3MMJA 2KFYA 2ZVSA 1ZTWA 3JTOA 1U48A 3NKYA 4NLQA 1N34J 1KHVA 5D4PA 4A8XA 2POKA 4F0KA 3NAIA 3V4IB 5LSRA 3CC7S 3FNNA 3K5MA 4GKKF 4C8OA 3C6TA 4QBUA 1P9YA 3CULA 4CO5A 2HWTA 3PW5A 4RBTA 3CDEA 2GQ2A 2W25A 4LSLB 1LFWA 1QSSA 3J7ZT 1FDDA 1FDBA 1Z4UA 2HIYA 2V34A 3ITHA 4OI3A 3R6GB 1YBUA 3CO0P 1WC6A 2G1DA 2OPPB 3AXKA 4IR1A 3GP9A 4MKVA 4PG4A 3R5DA 3W65A 1RWPB 2YNGB 4URSA 1TL7A 1TELA 1EKSA 1NZ8A 4I2PB 2C3MA 2QJ3A 3HHKA 3AQOA 5F3ZA 2HHWA 5ETMA 2D9OA 4QYRA 4DR1F 3J81U 4LF9J 1VC6A 1TL1A 1HNVB 2MLYA 3OR2A 1DY3A 2AYGA 2CQ4A 2GIRA 3D0IE 4ED3A 1HHQA 1QE1A 2AEFA 4DV5J 4LR8A 2GA7A 1M90T 4KSEB 4R5PB 1YX2A 1T3NA 2PEHA 2V8HA 3ULHA 1U1QA 1F5CA 5IQ6A 2YQ3A 4A8MP 4MIWA 3HT3A 4J9MA 2LYVA 3VGUA 2IJFA 3FCHA 3H59A 3M8SA 3EX7B 1Q7LB 5DS7A 1FTRA 4WTYA 1TP7A 3M8RA 4DPUA 1M5OC 3Q8VA 1IM4A 4DFKA 4OX9J 1XMBA 3BREA 1NKBA 5BYSA 3VVTA 2FC9A 1WC5A 2C1EB 2VONA 3EGZA 3AD8C 3G8QA 1UA1A 4FYWB 8ATCB 2B3TB 4LMZA 1S1TA 1HW8A 2QO3A 2WRMA 1RZMA 3HSDA 2V2VA 2DNNA 1TL3A 3PY8A 3DM2A 4X2BA 2HSEB 3W2VA 1KN6A 1A9NB 2ZDPA 3CCVS 3DMJA 3TAPA 1RE1B 1DQ8A 1FT8A 2PGCA 3DOLA 4OZLA 4ZPDA 3O8WA 3JSMA 2L3MA 2PA3A 4QIWD 1T7PA 1ZM2A 1M5HA 2GV1A 2XMMA 5SUHA 2VC1A 4Y65A 5HBMA 2MZ1A 3HI9A 1VQ8S 3K0JA 1Q82T 4B9VA 1U45A 1Y00A 2VODA 1P9QC 3NBPA 4LF8F 2VQEF 4ECZA 1SKUB 4JB8B 2E1MC 1EP4B 1RLDA 4O4RA 5B0EA 2DCLA 1FNOA 1MWYA 3NEKA 4J9NA 3MPVA 3A3NB 2JL9A 1ELOA 1TAQA 2X3DA 2BR0A 3V81B 5LJ5Y 1Y5NB 2JEJA 1L3KA 3V2UC 3CCES 1PKUA 1ITPA 1SUQA 3MECB 4ELTA 3H5YA 2FLNA 1TV6B 4Q45A 1I1GA 5L1LA 3N6NA 2W9BB 2RVJA 4QW9A 2ZOMA 2ZH8A 3V6DB 3DLGB 1SXLA 1WF2A 3BF4A 3BR9A 1WEYA 4Y34A 3OL7A 4YY3J 4DR7F 2GHPA 3FCVA 2N7CA 2HHHJ 2FYXA 5HMZA 2AYEA 4USJC 5ITHA 2LP4A 4DG1B 1YIJS 3M1VB 3KHGA 3T5HA 2JEIA 1N33F 1JQGA 4PYAA 4KFBB 2CQDA 4CQ1A 4JI8F 4RU2A 1S1UB 3KK1B 4NRUA 1SB6A 2YKMB 3OXFA 1KC8T 1ZAWA 4IH5A 3A8EA 8RUCA 4CH1A 2EFGA 3RBXA 2HPUA 1KVIA 3KLFA 2MKIA 1RA7A 1GQEA 4YDXA 4WYWA 3CVKA 3ILLA 2QFJA 2Z30B 3O2IA 4X4RA 2IA0A 4EBDA 1I94J 1U1PA 3C6TB 2FJAB 4WYLA 1L3TA 4H4KC 4DR4F 4PZVA 2RB7A 1WC3A 4RO0A 4U8VA 4J9LA 2IFXA 3W5XA 4PEOA 3EMTA 2C28A 4UW2A 3EJMA 1HNZJ 3ITHB 1YQHA 2YWGA 2XEXA 3BGFA 3M05A 1Z2ZA 1IBCB 4OZNA 4OYBA 3LAMA 3BGLA 4IOCQ 4A8SA 4MKYA 4O3SA 1ZAXA 3TJ9A 1H74A 2KM8C 1TL7B 4ID8A 3IRWP 3M30A 1U0HA 1IKVA 1FKPA 1H3DA 2A2DA 2AX1A 4F4WA 3FZBA 2F4VJ 4WK1A 1HWKA 1B99A 3UVJA 3GV7B 1TL1B 1FXDA 3W3SA 3OR2B 1OMSA 4LT6A 5KG4A 1IM6A 3R9LA 5IZHA 2JFKA 1QE1B 2Y9HA 1RACB 4ECYA 2QLXA 2VDIA 2H54B 1KOHA 1FTCA 4IKAA 1NSAA 4GO5X 4FBTA 2VA2A 5ETLA 4N8OA 1W26A 1RT5A 2DB1A 2C2NA 2V4RA 1WG5A 2R9LA 3CJ5A 2FC8A 1HWJA 2ADBA 4OX7A 4FF1A 4ZDNA 2WVEA 2H4WB 4CTAA 1U1OA 4P52A 2BKNA 3GMGA 2F63A 4F8RA 2J9EA 5IQQA 2MJUA 2J7KA 3ZNUA 2OP5A 1F60B 3K8VA 1S1TB 1TQLA 3H8YA 3DLHA 1M5PC 1TL3B 2DNYA 2VKRA 2MKJA 2CUYA 3P3DA 2RD5C 4M5MA 4ER8A 3BB5A 4UT4A 2F8HA 3DM2B 3W2VB 2OEMA 4HEA9 4ENOA 2K8GA 4KHMA 3DMJB 1UPPA 3QZ7A 1K9MT 2NZ4A 3DOLB 4A8OA 4WTOB 3JSMB 2XZDB 3P5BP 3ENAA 3L3CA 4F4YA 2GO9A 4JOUA 3MPUB 2KO1A 4BWJA 3V4MA 5HBMB 1NK7A 2VBZA 2BE2A 2A18A 4X4UA 5E0OA 1EB0A 2KHDA 3HJVA 1CG2A 2EBGA 4MT1A 3NBPB 3UQSA 3I32A 1RXOB 4UQGA 3H2UB 3W7BA 4DUZJ 2MQLA 3HVRA 2PMHA 4U67Q 3A3OB 5IM0A 5EWFA 4OZ5A 5KFDA 2UU9J 2IIHA 1TUWA 2LA4A 5IT9U 2JFDA 3D1HA 5L38A 5DO2A 1RA6A 2RU3A 2K06A 3IO1A 2XNRA 4O0NA 2CADA 2J9CA 1DQAA 3W8GA 4DQRA 3K5LA 4F2SA 1GX5A 1SUQB 3GLJA 1PYTA 3TEGA 2ZZTA 4C8ZA 3WC2A 3C8YA 2FJEB 1U25A 4O3QA 2BJ7A 5IWAF 5K14A 2HHXA 1IKYA 2XYPB 3I56S 1SL2A 2CG8A 1OY6A 4DL7A 2UXCF 2IVMA 1FFWB 2L9WA 4CWBA 2NXNA 1REGX 2CDRB 2QGFB 3D68A 3NS5A 3OJSA 5KG6A 2XZTB 4OLOA 1PYOB 2PI5A 1NCLA 1L3UA 2CAJA 2ZOFA 1SH3A 3D28A 3WIVA 2FD2A 4EFAC 4HH0A 5B0FA 4DR2J 3BN4A 2M3DA 2RU9A 4TQSA 3OSPA 3CCMS 3HFVA 4DV6J 3PKMA 1RAAB 2W2MP 1ZOTA 3VGSA 1KLNA 3MMCA 2XLIA 1Q4RA 3PW4A 1YI2S 4A4JA 4CRJA 1GTEA 4ZLLA 1FERA 3IA0A 1NNDA 1S76D 2UXBJ 5CYQA 1NSQA 3UCGA 3PV8A 2IBOA 3W1YC 2DHXA 4A46A 4Q8FA 4ECQA 3EICA 4F3OA 4LBPA 2DHGA 3G6YA 1D9FA 1FD8A 1BWEA 2MZTA 2OAUA 2NXJA 4HI1A 3D9BA 2A2CA 2NR0A 1QDUB 3M30B 1U0HB 1IKVB 5KG7A 1FKPB 2LEAA 1SH0A 3MI7X 4ICLA 3T3FA 1JWWA 2ZBRA 3Q8UA 5CAAA 4DV0F 2R7UA 3NNCA 3DLEA 5G4DA 5FDLA 3UVJB 2E7VA 3R7BB 1S6PA 3QPIA 2KFZA 2EW9A 3UR0A 5EDWA 2VB6A 4NLYA 1J5EF 1S48A 1F2GA 5F8IA 3CDUA 1Y9OA 2WONA 2XYGB 2VHGA 1VFJA 1FJ7A 1Y5IB 1PJ5A 3CTRA 4BDPA 1RT5B 4FVMA 3T19A 2R2UA 3ZXWA 1YRTA 5DQGA 4OYPA 3WBZA 4I1TA 3QRQA 2AJ4A 2DRBA 4I0WA 4CTAB 3KHLA 3WDOA 3AAWB 1R8PA 2QMUB 2YNIA 1K0TA 1RT2A 1H0HB 2ALYB 3SYZA 3IXQA 1Y3KA 3S7RA 4MMOA 3C15A 4LR7A 2HFNA 1ZZFA 3G82A 4OHZA 1WEZA 5I42A 1PGZA 4DQSA 5LXRA 2UXDJ 4XTTA 4LRFA 1B7YB 1T9VA 2V50A 3UR3C 3M9NB 4ZK7M 3PZPA 2FDNA 4YP3A 2J6TA 3UCZP 3E01A 3PX0A 2PO4A 4DLEA 2R8KA 1W2IA 2YX1A 4C0BA 3T1YF 4NLSA 2BE2B 3OHBA 3EM1A 4OX6A 3HVWA 3CJ8A 1S99A 2ILYA 2XGPA 3G4SS 1J5OA 2EG2A 3SSRA 6FDRA 5H9EK 3VZHA 4DPWA 1U47A 3GJRB 5IM0B 1NO8A 2R2RA 2WVBA 3U02A 2DR5A 2CNOB 3BS9A 4NCBA 2M9KA 1AFIA 5L9NA 1M1HA 1X0PA 1MN7A 2W2OP 2NXUA 2ZH6A 4X62J 2XMWA 1PBUA 1GX6A 2F65A 1I3OB 5AE1A 4ZN3A 2MEWA 1H7WA 1FXLA 5K14B 1IKYB 4LF5J 4J9QA 3FUYA 1VJWA 5IC4B 3ZZTA 2IAJA 2CDQA 4GC7A 4CI0B 1DQ9A 4JI3J 4FKXA 3MOJB 3M8WA 2W2NP 1VGYA 1BC6A 4UOGA 1JKHA 2E1AA 2RRBA 1B70B 3QT6A 1N32J 5DG7A 2R7WA 2J7WA 1BXNA 3G71S 1DARA 4FYXB 4JI4J 5F3TA 1GT8A 3R5GA 2QA4G 1X8DA 2DO0A 4L74A 3L7UA 1WKKA 2OMOA 3NCPA 3JQKA 1LWFB 3MAAA 4HVZA 1KQGB 3MMCB 2OFGX 5K8NA 1S97A 3RW7A 2HZVA 1F9EB 4P10A 3J81j 1FWKA 2KRRA 1A6LA 4M95A 5CYQB 5E3QA 4FXDA 2WVDA 2XO6A 4OLPA 3QWUA 4LRBA 4O23A 3SI8A 3MM8A 5DQIA 3T9NA 1RBLA 4N77A 4P2MA 1JXVA 1S7HA 2OFHX 1RWKB 1FE4A 3CCZA 4WP8A 3EGVA 2L08A 2FJWA 2DCUB 2BW2A 4CO3A 3HZEA 4NLXA 1UFWA 3NWGA 1UKUA 4TN2A 3VR1A 3M32A 1K8AT 2C3UA 2CQ2A 3MMAA 2I9SA 4ICLB 3NCRA 2BX6A 3BH7B 3DDKA 4ECUA 3K7RA 4LFCF 3MUTP 1EETA 3DLEB 5FDLB 2IM3A 4DFJA 3HSZA 1S6PB 1R8CA 3DCAA 5KFIA 2E9RX 2DNQA 5HROA 2EC0A 4HT5A 4LFBJ 2X1BA 3ETMA 5FD1A 1JLEA 1TTHB 2WONB 3SDEA 3UNGC 2JC1A 1D09B 1ZA1B 1B3TA 2BRLA 4L3KA 4PCQA 2CQ1A 5EN1A 2V69A 5D4NA 4C0OC 4F4ZA 1UTAA 1O6XA 3K58A 2RHSB 2V6AA 4DV5F 2ZVIA 4CCHA 4DDFA 2CG4A 1YHQS 1VLOA 1LWXA 4F7VA 1FNMA 1HWUA 3JQJA 2KJVA 2YNIB 1RT2B 1NPKA 3R3TA 1KOOA 1Q0NA 2BM0A 3Q89A 3QWPA 1H2UX 1HI0P 5F9LA 3C15B 3E3XA 3G82B 5KG2A 1V9OA 2BABA 1FFGB 5CHCB 1WHWA 4B3RF 3PJXA 4QW8A 1NK4A 1TUVA 5I42B 5E3RA 3F56A 4DR5F 4CH7A 5AE2A 4O3RA 2DEJA 2RS2A 5EX0A 2ZC4A 4RJVA 4RUHA 4CLLA 4JI1F 1R3NA 4OX9F 4OZ0A 4QQBA 1F6TA 3LPEA 4IR9A 1R8BA 1TMMA 3BV8A 1X5SA 3E01B 2XMAA 1FRMA 2VFSA 3OTCA 2HZCA 1OQ6A 4QZVB 1RT4A 1T94A 4EU0A 1NDKA 1SJRA 3POTA 4LF7J 3D6FB 3UN2A 1FRJA 3OXGA 2HWIA 2GMHA 2EKYA 4LVNP 5BR8F 1AUSL 1RTHA 1J5OB 2HGNA 2LKZA 4BC9A 3KUHA 2P6TA 2AV5A 3KK2A 1MU2A 5AXNA 1RTIA 2F3JA 4DFPA 2DVIA 2V67A 3AY0A 3IWNC 4WU3A 2VV5A 3A12A 4XK8C 1SQFA 2DJWA 3RAXA 4J7CA 1R43A 1HA1A 3QJLA 5KFYA 1ZTTA 2CKWA 4K59A 3KLVA 1U8SA 4KC5A 1YITS 2R4FA 4A8FA 5I3UA 4PXEA 4DV7J 2JVOA 3ILJA 1Q78A 3FQKA 3QIPA 4ZVHA 2B9YA 1LK7A 4FKYA 1WORA 3VTIA 2E9ZA 3I0RA 3FZ2A 1VRUA 2QZ8A 5DM7Q 2IAJB 4MFBA 2B4VA 2GNKA 4Y28C 2MTLA 1KTVA 3JXOA 2DGUA 2EPIA 2QLFB 1I6JA 2YPZA 1VC0A 1JKHB 4DPTA 4YS2A 3LUYA 3PG9A 2VPXB 9RUBA 3TEHB 1BY9A 1DBDA 2YX4A 1F3VA 1RBOB 3NRBA 1JK9B 2JDJA 1QTMA 2UVWA 3LWLA 5AJ3F 2XWYA 3CCSS 1U02A 1T95A 3AXMA 3RR8A 2LDIA 4DSFA 4RW9A 3MAAB 3IC1A 2EC2A 4YY3F 2HAFA 1S4EA 4FXWA 1TFYA 1J2VA 1XMOJ 1JJ4A 3RRHA 1KKHA 3TZXA 5LXYA 3IM8A 2Z57B 1HR0J 4U7UD 1FESA 3MCNA 2DKOB 1CPZA 1JNZB 3CD0A 3GV8B 2Y8WA 1UWAA 4PWWA 2QLWA 3DRYA 4WXOA 1X7VA 4NLUA 3MM8B 4ED7A 1WSVA 4UZBA 1K1QA 2FVCA 4CNZA 5H1SV 3GIKA 1V3ZA 4TU7A 3EYZA 2A0FB 3L4BC 5K8MA 2HQIA 2KT5A 1HL6A 4B3SJ 3M32B 1C4AA 2GAHC 1F5AA 4ZVSB 3DHWC 3QT5A 2GAGC 4RZRA 1CQNA 3MMAB 1F1BB 4F4XA 3FMBA 2UUWA 3DDNA 1DHMA 2HNYA 1EETB 4B9TA 3KKFA 5HLFA 3PYFA 4GKKJ 3R1HA 2HLUA 5HROB 3J7A1 1RT3A 1UW9A 2MQOA 4L6V3 3E2EA 3QRRA 5AXKA 3KJQB 4ITSA 1JLEB 1VRTA 2IRYA 3SDEB 3ZTSA 3LWMA 3MPWA 1RAFB 2O66A 1HD0A 1D3WA 1RTZA 1S6QA 5AXLA 1HHSA 1U1RA 4ZN1A 2CQ3A 3TQ1A 1VS3A 5CD4A 4DR6J 4XAKA 1NHKL 2ROGA 1HBMA 2DY1A 1UVIA 3Q86A 3MR2A 2AWZA 1AYEA 3MURP 4QCLA 1SL1A 1YRXA 3TJ8A 1UVJA 2BMBA 4F3MA 4IQXA 3H4DA 1SJFA 1RHKB 1U2CA 2OPSA 4DR1J 1UMJA 5JVHQ 2R2SA 1BQXA 2E1RA 1LWCA 3I5CA 3M2UA 4X4VA 2V8DA 3ENVA 2W01A 4YB7A 3FMWA 1O8BA 2PD1A 1X9SA 4ZVUB 5D8HB 3DXSX 3CJSA 4DS5A 4ZJOA 5KFZA 4ZJLA 2IDLA 1V6HA 2UUAJ 4A8YA 3OTOF 1OQ3A 4NXMJ 1RHRB 3CW2C 3OXLA 2UP1A 3FBCA 1DTTB 3DRPA 3ELHA 5KG0A 1EARA 4M5JA 2I5JA 3TOQA 1S9GA 3JS9A 3VZIA 1ZA2B 1RT4B 2X1GA 4K4XA 2HBYB 3ETOA 3POTB 3JTPA 2DNLA 2GJ2A 2F9JA 3IBCB 1X60A 3W63A 5KTQA 1UEUA 4JV2A 1KVJA 4NEYA 2CJKA 1RTHB 2HW3A 5D78A 4I64A 4M5NA 4K50A 4JBCA 1UVNA 4O3PA 3KK2B 1MU2B 3K89A 4IFYA 1RTIB 1D9AA 2QT7A 1IJEB 3P49B 2LQ5A 4YB1P 2FB0A 1IR2A 1UA0A 2PIIA 4X64F 2V2KA 5F9NA 2KJWA 3IWLA 3GYNA 5KFBA 3CD7A 2X1AA 1R0BG 4Y2CA 3DU6A 5I3UB 1DRZA 2K7KA 1NK0A 1H6KX 3UDCA 2Y1RI 4DUZF 2AYMA 3QIPB 2HAIA 2UU9F 3I0RB 1VRUB 4I2QA 4MFBB 4OJ3A 1HFEL 3GSDA 2DXFA 5F8JA 2DO4A 4LF8J 2VQEJ 4CLZA 2XY7A 1H2TZ 4ZOSA 5KG1A 3QNWB 1ZS6A 1FO1A 2N4DA 2R8GA 4YQWA 4UOFA 2MSSA 2W4DA 3M9OB 3MFHA 2BKOA 4ZPVR 1F5BA 5GAHU 4ED6A 1HARA 1RP5A 5J2MA 3DNCA 1TUGB 4KR0B 2IVYA 3VAKA 2UVUA 4AL7A 1WKJA 3OFFA 2FVSA 3OJUA 4RW9B 2W7AA 3HZGA 3D4JA 1PC5A 4CYUA 3CDWA 3TANA 4ZLJA 4DX8H 2IBKA 5A2QY 3TARA 5B09A 3M6XA 2HQFA 1QSLA 1HIYA 1ZYQA 3OVAA 3HK2A 2E1CA 2L41A 3ZZ0A 1XWLA 4ZPAA 1RU1A 1NK9A 2ZFHA 1VIOA 3Q8QB 2B9EA 4X4NA 4NLVA 1WEXA 4DSEA 4XPCA 5E41A 2V5HG 5LL6d 3PTWA 1GMVA 2AT1B 4MTPA 1N56A 1N33J 5A0YA 1U6BA 2NS1B 4OZ1A 3TQEA 3QZ8A 2BACA 1Q16B 1TL5A 2G0CA 4FZVA 4OYZA 3FRZA 5D15A 2G0IA 3M8PA 1IUJA 4KPCA 1U7LA 3D2WA 2D3UA 2HNYB 2NREA 4MYUA 3QJJA 3CF5Q 5F8GA 4OYMA 3PCOB 2X3GA 5HLFB 1MLAA 1X5OA 1OYEA 3D0GE 1ULRA 2OGUA 1YBAA 1RT3B 1R8AA 5T14A 3UDEA 1KQKA 1FX2A 4NLOA 5L8RC 1Y4ZB 3RGIA 1VRTB 1QUPA 1YZ7A 4OI2A 3O1LA 1NPPA 1Z2LA 3UPFA 3J7YU 1HNWJ 1SC3B 2EKNA 3FK4A 2V8GA 1S6QB 3GIMA 4K4SA 4GVBA 4K4ZA 3HX9A 1RKIA 2H1YA 3QGGA 5T41A 2KU7A 5T7LA 3TVYA 1NSPA 2EG1A 2OSRA 2VG7A 2PMZD 1HBMB 3P6YC 1NJZA 4AUKA 3I31A 3GQCA 3FDSA 4LRAA 5F41A 3SBMA 3TYTA 1AZSA 2BJ8A 4H4KA 3BBCA 2X1FA 2BJ9A 2PT0A 2ACMA 2CQCA 2KG0A 3K5NA 1QAJA 1WHVA 4RNNA 1Q8KA 4RU9A 1N5YA 1HMVA 1SV5A 4YMEA 2OPSB 4NLGA 1KEKA 5JVGQ 2VC0A 1V3SA 3AB2B 1LWCB 3M2UB 3DDIA 2YQ1A 3OVSA 4IFVA 3BR8A 1AFJA 4DUTA 5KFFA 5KFMA 2B9XA 2BQUA 2OH2A 2Z2ZA 1AT1B 3OLBA 2VG6A 4QWCA 2EWHA 3EE3A 3D7SB 3DRPB 3PIOQ 4HHHA 3CCJS 1SBRA 4WIIA 2MQ8A 5EUHA 3MWBA 3T5LA 3IGNA 1Q95G 4X4TA 4KB7A 1IJFB 2I5JB 3VVUA 4PKDB 1S9GB 2BV3A 2JX2A 3JAMU 2MKSA 3MDFA 2UV8G 3NGRA 3SQGA 2O3DA 2N3OA 1RABB 1BGXT 3SV4A 4ILRA 4G6VB 4RNMA 2UXDF 4EMDA 2Y3YA 5MLCV 2PFDA 3BJYA 1NU4A 5FLXY 1XEZA 4TYBA 1VQ6S 4IFYB 4OFZA 1CS4A 2ZH5A 5LOQA 3SMZA 3F73A 2HGLA 3G6XA 2AQ4A 2I6WA 1MWQA 1QLNA 2RRNA 1X31C 3PEJA 5L1JA 2GS8A 1G6BA 3A3PB 3QLHA 2FHKA 5DZ7A 4JV1A 3CCTA 3KLHA 4QOTA 4OQJA 3WX4A 1WWHA 3AB4B 3QO9A 1QM9A 4PXBA 4NXNJ 1NM2A 4QYZJ 4C3MA 4I2QB 1GMWD 4NLTA 4P75A 3D3CJ 4Y3CA 1MROA 2XLJA 3D3BJ 1YJTA 3N5BA 3R27A 4YUDA 7FDRA 2M52A 5L1KA 3CB4A 3KG1A 1DAXA 3G9CA 1UEKA 4ED4A 4C48A 5DRKA 1NK6A 1VQSA 2QFIA 3CCWA 5J2MB 2NSBA 3B4MA 1T11A 2FZKB 3MEDA 2E5GA 4EGLA 3KJNB 1VQLS 4KY3A 2LXUA 2DPJA 1KFSA 3VAJA 4OYWA 2WB1D 2Q6BA 1LW2A 4CYUB 2FZGB 4JI3F 3G86A 3KHHA 1SPBP 3C19A 4DV2F 3CD5A 2CNKB 3H5SA 4EBEA 4R0JA 1N32F 2R42A 4DUYJ 5IWAJ 5ETNA 2ATLA 4JI4F 2M4MA 1RT6A 1Z1ZA 4JI5F 4DL0C 3H25A 2UXCJ 4ID5A 4W4MA 3UN5A 1CEZA 3W9HA 1NPRA 2BEFA 2IC3A 3A13A 3S6EA 3M8QA 2QYGA 3CCLS 1PAEX 3DU5A 1VQ9S 1XC9A 5A0YB 2EFVA 1FK9A 2CZVC 4QIFA 1WUUA 2M0GB 3CDAA 2BQRA 2P5VA 3GG0A 2HVEA 2BYCA 2VG5A 3M8PB 2N7YA 1WC1A 1PO6A 2EFOA 2Q43A 2CPIA 5KFNA 1HI1A 4J9UE 3KK3A 3T6JA 4ZVGA 3IFEA 4Y2KA 2M2BA 2R7OA 4FS2A 2M5YA 3EDRB 5EHHA 2W2PP 2DH9A 3QGPA 2E1PA 2IA6A 5KFLA 4BWMA 4ED1A 3TA2A 2ERRA 4GVBB 5HQLA 1PSDA 1V5IB 4ZP7A 4MK9A 2DTJA 5T7LB 3DHXA 1EQMA 3FBBA 2VG7B 1B4SA 1MWZA 5LMNF 4U8YA 3IG1A 5MAOA 3RRGA 1VQ4S 2XG8A 2IMOA 3ILIA 4TU8A 4PWDA 2IM2A 3BSOA 4LFBF 1AZSB 3HCXA 3SXLA 4OJGA 2VPZB 1YJVA 3SCLE 4DV0J 2YBVA 1N5YB 1HMVB 1SV5B 5KFEA 5C24A 2P9CA 2NPIA 1GMWA 2QA4S 3OL9A 4NMXA 3FEXB 2EI5A 4IFVB 2APOA 2J0WA 5DQHA 4DMZA 2BE7D 3AA8A 2IYGA 1IWAA 4DSKA 4AL6A 3C46A 3N9UC 1V3RA 2KM8B 1SL0A 3NGSA 2VG6B 4LIWA 3BDEA 3TX0A 1T3OA 1UFKA 4N8NA 3LF0A 4USVA 1JXEA 2VPYB 2ACYA 4C8KA 4NASA 3FJ2A 3HVAA 5KFPA 1RJJA 1RUSA 1K0VA 2D69A 3JSBA 4IQMA 1U24A 3SQGB 4ZPCA 3I5BA 4EEYA 3ZFVA 1ZH5A 1QJHA 3BYRA 3DFEA 4P72A 2OD4A 3NWRA 5CZVA 2N3LA 1UVMA 2EK6A 3CNQP 3BPDA 2ZBQA 2CVIA 3W64A 2YWHA 2E5LF 2YPYA 1RI7A 2OELA 1B7FA 1VQ5S 4NZ6A 1CS4B 1MW7A 4MJKA 1FJGJ 2R3VA 2CWXA 1MMDA 1NH8A 3N6LA 4HL9A 3W66A 5D0HA 1SQGA 5C42A 1UW4A 1MG7A 2JH3A 4ZIWA 2XS2A 5J2NA 1ICEB 2Y1JA 4EWTA 2LEPA 3M8ZA 5IXUA 1T03A 1GH8A 3QLHB 5HVHA 3Q24A 4RUCA 3W9JA 3KLHB 4CLFA 3QSYB 1KP6A 4DN0A 3QO9B 1JJHA 5HN0A 3ISNC 3QJPA 2DNPA 3T1YJ 4ECXA 3PRVA 1X4BA 3TWZA 4RUAA 4C6AA 1C1CA 1A0OB 1MROB 4PQUA 4KGZB 1N36F 2MZQA 3SEOA 3BYPA 5HSPA 2OPQA 2BANA 2JEFA 4KH1B 2HVHA 3MTKA 1RHJB 1O5JA 3GYXB 3RZAA 1YJRA 1R6YA 4Q8EA 1YWXA 4PG5A 2AGOA 3I6PA 3MEDB 2CPJA 3KWMA 2I8EA 1RAHB 4A8WA 2VBYA 4YFUA 2M8HA 1LW2B 2ZJRQ 3VQSA 2LQJA 2YH0A 4NX9A 3K57A 2CNLB 2E29A 2DIVA 5L46A 4PPZA 1JLCA 1XQIA 1NEEA 2OO4A 2MXYA 1CJVA 4AD6A 2HHTA 5KFXA 4RBVA 3PRDA 1FRIA 2MKHA 3SCKE 2AIRB 1RT6B 4DL5A 4ID5B 4QIVA 4IH7A 3UD5A 3PYDA 1ZPVA 2OKQA 3BGRA 2IC3B 2X7IA 3M8QB 2J8AA 4P2XA 2NQPA 3CWJA 4N5SA 1BLUA 3P5TL 4C8YA 1FK9B 2HS4A 3PO4A 2VQFF 3E51A 4C97A 3FC9A 1WC0A 2GCFA 2HRUA 2VG5B 3BQ1A 1WDDA 1HPZA 3H98A 1TK0A 3VF0B 3KK3B 1VQMS 4X84A 1UFLA 3AH6A 3FEYB 2HK3A 4MIAA 1RWXB 2EBEA 4DLGA 1G3OA 2B7CB 1AW0A 3GV5B 4WJBA 2LLZA 4OL8A 1KWMA 1BMQB 1S79A 4LUBA 1FDAA 3BSAA 1BE4A 3V6HA 2WSCC 4ZVTB 4LF4J 3W61A 1UL3A 4M1KA 3IG1B 3KHRA 2KDOA 4B9MA 4PWDB 3O3LA 1SCJB 5M2RA 4USWA 4I4BA 2GVDA 5F8HA 4LFCJ 4WZQA 3PHEA 2HQDA 1S4FA 5C24B 4YR2A 2HFOA 2CWKA 3NGKA 3UN3A 2B9WA 3AT1B 1EJ7L 2KXFA 4ED5A 4ZCLA 4LREA 1VJQA 1M5VC 4DR6F 3GCWP 2D41A 2OLWA 3FQLA 3LO3A 5DZ6A 1Q53A 2DNHA 2NYIA 3O5TB 1AUDA 2KFNA 3FRYA 3PNIA 2R7RA 3C16A 4W98A 1YLXA 5JJBA 1JLBA 2BJEA 2SXLA 4J5OA 2EXUA 2V4QA 2KH9A 4DF8A 4YB5A 5CCMA 5CD4H 1Q8IA 2V9WA 2GFFA 2XWXA 2MQQA 5HQ8A 3C14A 2UUAF 2Z4PA 3PIPQ 5BJRA 2A3JA 4NXMF 3HKZD 3KDNA 1WHXA 1IN0A 4FS1A 4OI1A 4IO1A 4P2FA 4IO9Q 2KG1A 3ZO7A 2FQQB 4L76A 4B3RJ 3D0HE 3PO5A 4ZLNA 2MYFA 4DR5J 4OYXA 4X65F 1HBNA 1C0TA 2C2OB 4AE5A 3TZZA 5C42B 5J2NB 2FJXA 4JI1J 2C2KB 3ZZOA 1VOMA 1T03B 1Q5YA 2YTCA 2ZBIA 2H48B 2ASLA 2YH1A 2EEYA 3P96A 4EO8A 1MMNA 1KDNA 3U7JA 2OTJS 3MUMP 2XMUA 3NOGA 3LTOA 2JOQA 2Z0GA 3B8HA 5ETTA 3WHIA 5BR8J 2QSFA 1IBKF 2NLWA 2XB2D 1C1CB 4PQUB 2D3OR 2W4CA 4UF4A 2OPQB 2BANB 5HMWA 1S1XA 2HHSA 4KGXB 2HFSA 2PSZA 3GE9A 1Y7PA 2KT2A 4M5KA 2C2ZB 1XTZA 4B3OA 4NA1A 4HDHA 4JV5F 4DV1J 4USKA 2W8LA 1U2RA 1BQMA 1JLCB 4BC7A 1WNEA 1CJVB 1U26A 5ETOA 7AT1B 5KFRA 5GADI 2HHUA 1X9WA 1RISA 3KNAA 3BBFA 2DRDA 4NPOA 3UFCX 4FP9A 4KIAA 5E7OB 2IYIA 3BGRB 1AXQA 3H4BA 3MEKA 3DGPA 2OMLA 4NRTA 4U9RA 5A8RA 1FRKA 4DSIA 2MMYA 3DKDA 3VAHA 5F8MA 2OJ3A 1UJ5A 4ECRA 5AJ3J 3MPDA 4R25A 2G1HA 1TMJA 2U1AA 3FSYA 3D54A 1QVGR 3FKBA 4KYZA 4WCEQ 1RYSA 4C7QA 1HPZB 3KUGA 3G6VA 3H0PA 3QT7A 4MK8A 2GHVC 4KT0C 2DGOA 2CPEA 3N0VA 3Q83A 1QTNB 1FE0A 2KYZA 4NLDA 2QG9B 2DITA 1RLCL 3DOMA 4OYAA 4ZIVA 2CJAA 3HXMA 3T1AA 3LA0A 2GX8A 1M5KC 3IAS9 4YEAA 3MCSA 4P2SA 2ZD1A 5GAHI 5BXIA 3DGVA 1R7IA 5DETA 5DJBA 3I55S 1RWVB 2LMIA 3MHYA 1UAWA 3OPKA 4CH0S 2J9DA 1SIWB 3TAMA 3DLJA 3KUEA 1HBUA 2FJDB 2RJZA 2CIMA 1LXJA 2AD9A 2GVDB 2AYBA 2ZBPA 4Q44A 1S9EA 1HNWF 5A8KA 3GZ7A 3FSIA 4ES2A 1JXLA 3NGDA 1RTJA 3AD7C 2HQCA 1RQ0A 3GJTB 4ZCMA 2BQ3A 3AJ2A 3H40A 1HI8A 2HMIA 4P7TA 3K59A 3C16B 1JLBB 2R7QA 4QR1A 1RDRA 2Y0BB 3HFZB 3T1HF 1TAUA 4U7UK 1DURA 3IAM9 4ZMMA 4AXIA 1RSCA 4XIUA 2LQ9A 2B51A 1T9TA 2PE8A 4AXJA 4NOHA 5BYRA 1AROP 3TRGA 1NJXA 3C14B 2UUTA 1LXNA 4ZVFA 1JNRB 5LMUJ 1TFWA 3HVTA 3CMQA 3VHQA 4OHWA 2AJ2A 4WP3A 1VCTA 2JHEA 4UTGA 3J80Y 2BE9B 3H2VE 2IDEA 5DDQC 5B7WA 1CSJA 3PVXA 3N6MA 1XMQF 5C2CA 2Z56B 4RKUC 1HBNB 3HD1A 3J7YI 2LECA 1C0TB 1A7GE 2RE1A 1Y5LB 3OTOJ 2ZZNA 4OJ1A 4EYHB 2HRYA 2Z58B 3MMBA 2B8QA 1DFDA 1UZDA 2MQMA 3RU0A 1CJTA 3CJRA 4YB6A 2C2EA 5IV4A 5ADZA 4YN3B 1HNIA 4DV4F 2BRKA 2MY7A 2ZBCA 3CSKA 1HNXF 1G4CA 5IT0A 1TL4A 2ZKUA 1W7WA 4RWWA 2CJYB 5J1NA 1KNZA 4RPFA 2MLZA 2O67A 2AJ0A 4DCOB 3D66A 1KSPA 4LR9A 4V19X 3Q22A 2C3YA 3R2CJ 1S1XB 4GMKA 4NEZA 2FVQA 3QAEA 3ZZPA 1JB0C 3MZIA 2MPUA 4RW8A 3MD1A 2RAQA 4KGKA 5JXSA 2V63A 4Q7AA 5D0GA 2K7JA 1E6YA 1C0UA 5KFOA 2HURA 1IBMF 4NXNF 5HJXA 4X64J 4B3OB 2BZ2A 5D4OA 4HLBA 3GIIA 1N48A 2HHQA 3A1YG 2W4PA 1H72C 4USMA 3U27A 1WC4A 1D8ZA 5CCLA 2XY6A 3CC4S 1BQMB 2ZUAA 2CQ0A 4DHVA 1WTBA 2B5JA 2NPFA 1RBAA 1B0VA 4B08A 3JQMA 4M5HA 2QLJB 1Q8BA 1OJ4A 5J1EA 3KOAA 1B0PA 2QMXA 1S49A 3ZNJ1 3DGPB 2J7UA 1NLKL 4K5SA 5A8RB 4ZHRA 1SKRA 3AA9A 4ETXA 1C1BA 3QSIA 2GGPA 2BKPA 2CPXA 4DUYF 4WZMA 4OMFG 2WTFA 2DNGA 5JMNA 4OZ3A 3X3UA 1F0XA 3MR3A 4GO7X 2HNZA 2WB4A 3ZZZA 2WVFA 2F40A 4K7QA 1IXKA 3E8OA 5A6PA 3W60A 2XY5A 4DEZA 1M5SA 1JLGA 1X9MA 1SC1B 1XK8A 5KT7A 1WOOA 1VBYA 2FHJD 3PW7A 3DOMB 3A8IA 3QIDA 1WOSA 4HACA 4WFNQ 2CXEA 4F25A 5BYQA 2LCWA 5B08A 3PR5B 5GAEU 2ROPA 4B3MF 1VK3A 3HSGA 3H42A 1OS5A 3JYTA 2ZD1B 4PAAA 3KLFB 3RB4A 3SIPB 4JUZA 1KLMA 4Z7YA 3LOUA 2VFVA 1SKWA 3EXCX 2IJNA 2XBPA 3PHTA 3TAMB 2C3OA 1HBUB 4LSNA 2M8DB 2VPWB 1S9EB 3I9V9 4K4WA 3IM9A 5A8KB 3MAQA 3R97A 5D0RA 2IRXA 4OYOA 3M6WA 1RTJB 2AHOB 2B4OA 4KO0A 3NXZA 4ZCIA 1XN9A 3V6KA 1Q1KA 2HMIB 3BGUA 3ZTRA 3PX6A 4ALZA 2MLXA 2FGOA 1M1KT 2E5JA 3GONA 5FJ4A 3GIRA 1FA0A 2K3KA 3FSXA 4PYDA 2ZM6J 3TI0A 1WG1A 3F44A 1OYDA 2I38A 5KG5A 1YZ6A 3I5AA 2DYAA 3HVTB 4LF1A 4DQPA 2CVEA 2H51B 1S59A 1NRKA 3KG4A 4J9PA 4CZCA 3A8JA 1RB0A 2R2TA 5LT5A 2IM0A 4CT8A 2CRLA 1APSA 3S8SA 2RDDA 4XDDA 4TY8A 4F36A 2F4FA 2RSQA 3VAMA 2MZSA 1F2HA 3MMBB 3QFWA 1EZZB 1DJ0A 1VRQC 1CJTB 2CZ4A 4X4PA 3AD9C 5IS2A 2C2MB 1HNIB 4V1Ak 1F3FA 3IN5A 1HWIA 1RAEB 1T9XA 1FJGF 1RHUB 3HDSA 1NK5A 3IS9A 4X4SA 1VQPS 4DBQA 2FHJA 3GTYX 2A6MA 4Q2MA 1S6UA 3HT0A 2JLEA 2P8IA 2FUG9 1DZ5A 2B6AA 1RAJA 3NNHA 1RKJA 1F9FA 2QEXS 5I4MA 2Y1LB 4RW8B 3PJ9A 2PI4A 1L5UA 1E6YB 2MKYA 1VQYA 2B43A 2C2RA 1VBZA 5GMDA 2ZHOA 1LNQA 1RWUA 3ET6A 2YWKA 2E7WA 4CO1A 2D3ZA 1S77D 1LOUA 4DOZA 4KV8A 2GQQA 2ZH4A 4XPEA 1S6OA 4TKTA 4C0HA 2FJVA 2Z2LA 2KVIA 1QAIA 2IPOB 1LV5A 5B0CA 3M6UA 2PA8D 2B5JB 2XHCA 3L95X 2PEBA 2V9KA 1FDNA 5J1EB 4HTIA 3NNAA 3EZOA 2PMWA 3NMAA 3CC2S 3PFEA 3P4UB 1VMBA 2W7PA 3TA1A 4ZHRB 3Q8SB 1WOPA 4KHPF 1C1BB 1IVZA 2GGPB 3LPYA 1QUVA 2QX0A 3LQVA 4Y00A 3KLIA 4OZ2A 4G1PA 2HNZB 3SSQA 4ZVQB 3N4WA 2ASYA 3EZ5A 4G1QA 2DR6A 1JLGB 1VK8A 4DV2J 2WCXA 2COLA 2ZNYA 3T9ZA 1VC5A 2LQBA 4Q5VA 4HACB 4JI5J 2KB2A 4DQQA 2AJFE 2XMVA 3DRXA 3GG1A 2NXCA 1SKSA 2VOOA 4E0DA 3MAHA 4FVCA 4AQYJ 4LBIA 3JYTB 4NLPA 2J0SD 5ETRA 1KLMB 3OUYA 1S1WA 5DLFA 1UP1A 4LF6F 2Y0SD 2DY9A 3O6QA 4LSNB 4L3NA 1KQSR 4KAIA 5CA5A 1T9UA 1CQMA 1NJYA 4P7VA 1FVQA 2R8HA 3WC0A 2GZOA 1S0NA 5AT1B 1MNEA 4LF4F 2ABYA 2Q3PA 3HLUA 3OQ2A 3OT9A 4KO0B 4RNHA 3ZTPA 5HI7A 2KRBA 3HMJG 3A4TA 3RB0A 3SV3A 2UUBF 3VGVA 2VFTA 2V2ZA 1XNQF 4TQRA 1N52B 1T9YA 5LMNJ 3ISND 2DGSA 3WQPA 3H20A 1SH2A 2YNFA 2HIQA 1XBWA 2CQIA 2MQNA 4HTJA 3PDNA 3RYLA 1JMTA 4LF2A 1K73T 4NLRA 1IBLF 2CJQA 1R89A 4CLTA 4J9SA 2J76E 2MY8A 3HSJA 2P6SA 1FKOA 4WKRA 3TP2A 3MEGA 4CLYA 1QY7A 3CO9A 1UJ6A 3CCUS 5K20B 4F04B 4QIEA 2K1RA 1XJWB 1FJEB 4BCAA 1B64A 2IRUA 4TY8B 1L3SA 2QMWA 3SCIE 4K4YA 2BVZA 3GU0A 3HHLC 1RTDA 1TK8A 3Q0AA 1IQZA 2FPHX 4Z37A 4K0KF 1X4FA 2LQ8A 5HL7Q 5KT3A 1WTFA 3FVYA 2XSFA 3OTEA 3EPGA 3RR7A 4DPOA 1YRUA 3IS9B 4EZ6A 1X4HA 2HQGA 3ADAC 4Z7CA 2DXEA 1TKTA 4RUBA 1SC6A 4OX8A 4LSZB 5C2GA 3OFGA 1OY9A 2E5LJ 4O44A 3KDOA 3EVWA 2B6AB 1WELA 1YGYA 1VBXA 2AGQA 4F02A 2XS5A 3GFZA 3M7VA 4M5LA 4OYIA 4RL1A 3TR5A 5B0AA 1RWMB 5K8OA 4HT7A 2MHEA 4CIOA 3ET6B 2VDHA 1RU2A 3TW0A 4KV8B 3LGHA 4ED8A 2GVZA 5A2QU 2H5IB 4M94A 1BWVA 4KKOA 1NDLA 4KGMA 3W62A 3MF5A 3RBDA 1VQKS 2WOMA 3GYGA 4ED0A 1U4BA 2EFQA 2ZH7A 3N79A 4CT9A 3HPOA 5L9XA 2MJNA 3I4HX 1VQOS 1Q79A 1JLAA 1O51A 1N36J 4DV1F 1L3VA 2CQHA 3DLKA 3GR0A 3BO3A 4AFFA 3EDQB 2ZEJA 3LGMA 3B4DA 4OZJA 3LP0A 1WDTA 3NGUA 2VL1A 3RBEA 4LFAF 4HDGA 3MR6A 3OVBA 3OHAA 3SSSA 3KLIB 4X4OA 5EWEA 1RWOB 3LH2S 4AL5A 1NMEB 3KJVA 4QWEA 3K8WA 3IRXA 4G1QB 1HW9A 1PBAA 2W8KA 3G8SA 4B3TF 3KXDA 1QD1A 3S1TA 1UCNA 2G9OA 3PYEA 4UQTA 1KFDA 4LQ9A 3KJFB 3C66A 4IG3A 3MTJA 2LXFA 3OBIA 1QAYA 5DG9A 4NCGA 1U0SA 1NXIA 2GW8A 3Q23A 4FPIA 1H38A 5HP1A 3L7OA 4JI7J 2ZC3A 3CCQS 3ZC4A 3OUYB 1S1WB 3P8BB 1K1SA 2VQFJ 4BHQA 3DRRA 2F1FA 2KTQA 3BSCA 4A8QA 1V5VA 1HWLA 3T41A 3UDLA 1R6VA 2KL8A 5E3AA 3CJQA 4F4AA 2J8SA 4XDCA 1KS2A 4WE1A 4FF2A 1S5ZA 2QN6B 4JYAF 2ZDOA 4C3LA 3CMAS 1VBKA 2F8EX 3MD3A 4J9OA 1NH7A 2HS3A 2QA1A 2I0XA 1UPMB 4CLKA 1NB2A 2DGQA 1N0UA 3BQ2A 4NYOA 2BBEA 2GMLA 1T9WA 2G2YA 5JUMA 1NJIT 5KFAA 1P27B 3TZYA 2YNFB 2XCAA 4DWIA 4B9NA 2DRAA 2V8PA 2QL7B 3RAMA 3BBBA 4M5DA 1I51B 4RWXA 3UW1A 4LRDA 5FLXU 1H98A 1QVFR 1GNKA 4WF9Q 4YHHJ 2G2OA 1FKOB 1PJ7A 2RQCA 4IRKA 3MEGB 4WFXA 3W9IA 2HFVA 3ENQA 2RDIA 1OPZA 4S0MA 4UY85 4JI2F 4OV1A 4UZCA 3H90A 1CC7A 2K1RB 1FXRA 5D0EA 1KR4A 1CVJA 1ZM9A 5E3CA 4E8UA 4PPDA 4WK3A 1X5TA 3CJ4A 3HFKA 5ETKA 4OIXA 3BKTA 2WW4A 5KFHA 1RTDB 2MZRA 5LMUF 1RAIB 4DV3J 4O3OA 4F4KA 1DTQA 4DX7A 4I6WA 4ECSA 3UDVA 3J81Y 3CXCR 2OEJA 5ETQA 3QMQA 2H5JB 2E7XA 4J9KA 4RNOA 2JSXA 1HQUA 1OSDA 1TKTB 3GIJA 4IYQA 1Y10A 4I68A 4O44B 4C11A 1CJUA 2RH3A 3P45B 4D3GA 4QU6A 4X65J 3OFEA 1S72S 4M63A 3DYAA 2QTWA 2HFUA 1VIXA 2KT3A 3EGWB 4U6PA 3UD3P 4K4UA 1P1TA 5L1IA 5GADU 4QR2A 1Q86T 3LANA 3PJWA 2ZUGA 1FWPA 4KGVB 2GVZB 4KKOB 2WK4A 2GO8A 2VF3A 2WOMB 4DF4A 4B17A 4OI6A 3ENWA 2QA2A 4HI2A 2KYXA 4DU8A 2QSWA 4I69A 4EBCA 1IBKJ 1JLAB 2I1RA 1CJKA 1ZM4A 4A48A 4M5GA 5DM6Q 2DPIA 3DLKB 4ATNA 2O5DA 4N7TA 4QWDA 2DNZA 1S9FA 3LP0B 2NUUG 3Q8RB 1RT1A 2MSTA 2EK1A 5KFKA 3DXBA 4C2MA 2HKEA 2DR8A 2ZZMA 1VI7A 1D0EA 3G6ES 3CJ3A 4JV5J 5KFQA 3KJVB 1PJ6A 1X4CA 4DR3J 5J1PA 2WBMA 2BM1A 5AE3A 3ICLA 2FLOA 1LWFA 2JC0A 3IRXB 2MGZA 3GWCA 3VV2B 2DHSA 3I9ZA 2W1BA 4URGA 3MM7A 3THPA 3ZZYA 2AU0A 1SC4B 4GKJF 3D6MB 2VICA 2UUCF 4MKAA 1WF0A 4IG3B 4P73A 4HYKA 4ZITA 4F50A 1U6ZA 5U47A 4NCGB 4LVOP 2PC6A 3MPYA 5GVQA 5HP1B 2GMJA 5GMEA 3JSYA 4WFAQ 2W9AA 1FRLA 3DN9A 4RW4A 1XR6A 4MH8A 4ZLPA 2XNQA 2JNJA 1S57A 3DRRB 2ZHAA 3M6VA 1PG5B 5LM7E 1WACA 2YY3A 2HVDA 5LSLA 2AW0A 4WE1B 4GVLA 1UJ4A 4DU7A 2YNHA 4MKBA 4ZPBA 1EQ0A 2RDJA 2QRRA 4DQIA 2FJBB 1TK5A 2ZHBA 3AOBA 4TLQA 2RS8A 1X4GA 2KZZA 4DZ6A 3KNGA 3RBZA 5KFGA 2YQ0A 4GC6A 5KT4A 4F0HA 3MXHP 4PWUA 2QC3A 3CMES 1TU0B 4L72B 1YJ7A 4J90A 3CGIA 3DRSA 2KKHA 4M5DB 2R7XA 3I96A 1RAGB 1TZ0A 2NCKL 5H9EJ 1ACMB 1R0CB 5KFSA 1D1UA 3GR1A 3BM7A 3NG8A 2RQKA 2ZM6F 1XNRJ 2DIUA 3OTBA 1T05A 5GAEI 4QU7A 2DD8S 5E33A 3KMSA 4Y6IA 2Q66A 2CPHA 2Z8QA 2RRAA 4DFMA 4C8MA 6AT1B 3U1NA 3T1HJ 5KFJA 1DTQB 1U8WA 5THWA 4ZJQA 1FRHA 4JI6F 2BW7A 3O44A 5GMKa 1GEHA 1KVKA 2ILZA 3HO1A 2YWWA 2QLBB 3KFWX 5A6WA 5DGAA 2M88A 2HBRB 2J6SA 1JLFA 4O4GA 4LQ3A 1HQUB 3C6UA 2VFUA 1OY8A 3OFHA 3DOKA 3I4PA 2YKNA 4Y0FA 3SFUA 4TU9A 3V6JA 2ZH2A 4JV0A 4ZVRB 1HQEA 5RUBA 2Q79A 2XC9A 3NY0A 2FVPA 2ZH1A 4R0EA 1J27A 4USUA 2XMKA 1SJQA 4C11B 1CJUB 4ZCKA 3R5BA 5KT5A 2BOPA 1XMQJ 5HJYA 5CQGA 3VQTA 3PRBA 1RHMB
chains in the Genus database with same CATH topology
1F5AA 5J2QB 3T1HF 1TAUA 3DHWC 3DYAB 4U7UK 1DURA 2EFPA 3MECA 4RZRA 3IAM9 2BXJA 1RK8A 2RKIA 4NL5A 3T5JA 1CQNA 4ZMMA 3MMAB 4BS2A 1TKXB 1C4CA 1TV6A 4F4XA 2U2FA 1JLQA 4AXIA 1XMOF 3FMBA 2QE5A 1HD1A 2UUWA 5DGBA 4XIUA 2W9BA 1IQTA 3DDNA 1GAOA 1DHMA 3V6DA 3DLGA 2HNYA 3BO4A 2LQ9A 2B51A 5GAGI 2DR7A 1EETB 2PE8A 1YTYA 2QV6A 4AXJA 5B0DA 2X51A 4NOHA 5BYRA 5CYJA 4B9TA 1AROP 1GXTA 3KKFA 3TRGA 1NJXA 1HR0F 3D1OA 5HLFA 4YOEA 2DNKA 2UUTA 1KD1T 1LXNA 3R1HA 2HLUA 1JNRB 4ZVFA 5HROB 3J7A1 3TA0A 1TFWA 3HVTA 3DLBA 3MM9A 2DGTA 4OI4A 1RT3A 2AP6A 1O0PA 4OHWA 2MQOA 4L6V3 3E2EA 3TNVA 2HVZA 1NKCA 2JHEA 1NJWA 5AXKA 4AYBD 4ITSA 1JLEB 1VRTA 3LAKA 5B0BA 3J80Y 2IRYA 4NYZA 3SDEB 3IWXA 3H2VE 3T6BA 1YJWS 4UUWA 3RRKA 3CJ0A 5DDQC 4DSLA 3D1QA 3MPWA 5B7WA 3LWMA 4DG1A 2O66A 3M1VA 1CSJA 1HD0A 3PVXA 1D3WA 3N6MA 1S6QA 5AXLA 1XMQF 2E5IA 1HHSA 1R27B 1U1RA 4RKUC 1HBNB 3J7YI 3OR1A 2V4JB 4KFBA 2LECA 1C0TB 4OHYA 1A7GE 4USIA 2RE1A 4B3SF 2L48A 1Y5LB 2B0GA 2CQ3A 5CZXA 2R8IA 3TQ1A 2RF2A 1VS3A 2ZZNA 1SJ4P 2N82B 1GXUA 1S1UA 4OJ1A 2LA6A 3KK1A 4XAKA 2ROGA 1HBMA 1S0OA 4N47A 2WHOA 4EYHB 2HRYA 1FNXH 4PG8A 2YKMA 3MMJA 4PQAA 3MMBA 2KFYA 1UVIA 2ZVSA 4H54A 2ALZA 3JTOA 1ZTWA 1DFDA 2MQMA 3MR2A 1RT1B 2AWZA 1U48A 3RU0A 3NKYA 3MURP 4NLQA 1WG4A 4QCLA 5SZTA 1KHVA 5D4PA 4YB6A 1SL1A 4A8XA 2VA3A 2C2EA 1YRXA 1UVJA 4YDDB 5IT4A 2POKA 4F3MA 3NAIA 3V4IB 5LSRA 5ADZA 1HNIA 5M2UA 3CC7S 3FNNA 3K5MA 4DV4F 4DL3A 4IQXA 3H4DA 1SJFA 2BRKA 4GKKF 4C8OA 2MY7A 3C6TA 4QBUA 1HBOA 2OPSA 1UMJA 2ZBCA 4Q0BA 4BBYA 5A8WA 2RILA 2MGZB 3CSKA 4RX6A 5JVHQ 5DDOC 2R2SA 1BQXA 1NZAA 3CULA 2E1RA 1LWCA 3I5CA 3M2UA 3QYYA 4CO5A 3ONQA 4X4VA 2V8DA 3ENVA 1N4LA 1HNXF 1N6QA 5IT0A 2HWTA 3PW5A 4YB7A 1TL4A 2ZKUA 1NB7A 3FMWA 3CDEA 4RBTA 2D74B 2GQ2A 4RWWA 3MM7B 2W25A 4LSLB 1O8BA 5J1NA 1LFWA 1KNZA 1QSSA 2PD1A 3J7ZT 1X9SA 1FDDA 4C4WA 5D8HB 1FDBA 3DXSX 1Z4UA 4I56A 4DS5A 5KFZA 2O67A 3ITHA 4OI3A 2AJ0A 1V6HA 3K5OA 1KSPA 4V19X 1U6FA 3Q22A 2C3YA 4A8YA 3NAHA 5IT9Y 3AJ1A 1S1XB 2G1DA 2OPPB 4GMKA 1OQ3A 3OTOF 2UP1A 1FD2A 3OXLA 2FVQA 4IR1A 3QAEA 1DTTB 3ZZPA 1JB0C 3MZIA 1KTQA 3DRPA 4PG4A 3R5DA 1NAQA 5KG0A 5KAKA 2MPUA 4RW8A 3G8TA 3MD1A 4KGKA 2KHCA 2YNGB 5JXSA 4URSA 1IKXA 4Q7AA 1ZZNA 2N4CA 2K7JA 1E6YA 1C0UA 5KFOA 4RBUA 1N34F 1IBMF 2RMLA 3NLCA 4I2PB 2C3MA 2I5JA 4NXNF 3TOQA 1S9GA 4LIRA 4B3OB 4QR0A 3HHKA 4IUFA 3AQOA 5F3ZA 2HHWA 2BZ2A 5D4OA 3VZIA 4HLBA 4RW4B 3GIIA 1RT4B 2D9OA 2W4PA 3A1YG 2X1GA 1N48A 2HYIB 2HHQA 2EFNA 1URNA 4K4XA 2JVRA 3U27A 4QYRA 4ZP8A 1D8ZA 4DR1F 3ETOA 3POTB 3JTPA 1VC6A 5CCLA 2DNLA 1FEEA 2GJ2A 1TL1A 2F9JA 1HNVB 2XY6A 3CC4S 3OR2A 1BQMB 5KTQA 3HHNB 2AYGA 1UEUA 2CQ0A 3FGVA 4JV2A 1KVJA 4DHVA 1WTBA 2CJKA 1RTHB 2HW3A 2MHNA 2CQ4A 2GIRA 3D0IE 4ED3A 5D78A 4I64A 3N01A 1QE1A 3LALA 2P9GA 2B5JA 4K50A 2NPFA 4AQYF 2BA9A 1XR5A 4O3NA 4JBCA 1UVNA 1B0VA 4B08A 3C2PA 2GA7A 1M90T 4KSEB 4R5PB 1T3NA 4O3PA 3KK2B 1MU2B 1Q8BA 4IFYA 2PEHA 5J1EA 3KOAA 1RTIB 1B0PA 2YNHB 2HS0A 2V8HA 1D9AA 2QMXA 3ULHA 1U1QA 4KHRA 3KTQA 1S49A 3LP1A 1URRA 2QT7A 1ZPWX 1RYRA 1IJEB 3P49B 1F5CA 2Q6CA 2LQ5A 2J7UA 5IQ6A 2BDPA 4K5SA 5I3PA 5A8RB 4YB1P 4ZHRA 2FB0A 1P6TA 2YQ3A 1SKRA 3AA9A 1UA0A 4ETXA 2PIIA 1TVRA 4X64F 2V2KA 1C1BA 5F9NA 5EX3A 4A8MP 2GGPA 4MIWA 2CPXA 4ZKAA 4DUYF 2KJWA 4WZMA 2DISA 3IWLA 4OMFG 3HT3A 4J9MA 2WTFA 2LYVA 2DNGA 3J7Z5 3GYNA 5KFBA 3EUNA 3CD7A 2X1AA 2IJFA 4Y2CA 3DU6A 3X3UA 5I3UB 3FCHA 3H59A 3M8SA 1DRZA 3EX7B 2K7KA 4LF9F 1F0XA 1Q7LB 3MR3A 2HHVA 4GO7X 5DS7A 1NK0A 1FTRA 1H6KX 2GIQA 2HNZA 2CPFA 1TP7A 2MZJA 2WB4A 4WTYA 3UDCA 3ZZZA 2Y1RI 3M8RA 2F40A 1SJ3P 1JIHA 1M5OC 1IM4A 1IXKA 4DFKA 3E8OA 4DUZF 2AYMA 3QIPB 1XMBA 3BREA 5KFVA 5A6PA 1NKBA 2HAIA 5BYSA 1X5PA 3PFOA 2FC9A 1YVFA 2XY5A 4N76A 2UU9F 1X4DA 1TKZA 3I0RB 1M5SA 4DEZA 2VONA 1JLGA 1VRUB 3EGZA 4I2QA 4MFBB 3DRSB 3MGJA 4UOCA 1X9MA 4OJ3A 3G8QA 1HFEL 3GSDA 1XK8A 1UA1A 2IHR1 2XI2A 1OO0B 2B3TB 4LMZA 1S1TA 2G13A 5KT7A 2DO4A 1HW8A 2QO3A 5F8JA 1H7XA 2WRMA 1VBYA 2FHJD 1H2TZ 4ZOSA 2XY7A 2M7SA 5E2QA 3PW7A 2DNNA 1TL3A 3QIDA 5KG1A 2XO7A 2ZJPQ 4WFNQ 4OHVA 2D1CA 1FO1A 2N4DA 4F25A 2R8GA 3LW5C 5BYQA 4YQWA 2LCWA 3PY8A 2Q1LA 5B08A 2MSSA 3PR5B 2W4DA 3M9OB 3MFHA 3DM2A 2LU2A 4ZPVR 1F5BA 5GAEU 2ROPA 2XI3A 5GAHU 4ED6A 4X2BA 4B3MF 3W2VA 1KN6A 1A9NB 1VK3A 1HARA 2ZDPA 3CCVS 1OS5A 3DMJA 1RP5A 5J2MA 3TAPA 3JYTA 2ZD1B 1T05B 3DNCA 1DQ8A 1FT8A 3KLFB 4KR0B 2PGCA 2IVYA 3NMRA 3DOLA 3RB4A 3VAKA 2UVUA 4OZLA 4ZPDA 2DGVA 4AL7A 1ZAVA 4X4QA 2OPRA 3O8WA 3JSMA 4ZPTR 2L3MA 1DTTA 1ROFA 2PA3A 3HKWA 4QIWD 1T7PA 3OFFA 4JUZA 1ZM2A 2FVSA 1KLMA 3OJUA 3LOUA 2JZ5A 4RW9B 4DJBA 2VFVA 2W7AA 2UVVA 2QIFA 1M5HA 1SKWA 3HZGA 3EXCX 1PC5A 2GV1A 2IJNA 3CDWA 4Y2IA 3TANA 2XBPA 2XMMA 5SUHA 3TAMB 4DX8H 2C3OA 2VC1A 4Y65A 5HBMA 4WFZA 3OTDA 1HBUB 2IBKA 1UETA 4CO0A 3HI9A 2MZ1A 1VQ8S 4EUVA 4LSNA 3K0JA 5A2QY 2M8DB 1Q82T 3TARA 2RNEA 4B9VA 5B09A 1U45A