4ID8A

The crystal structure of a [3fe-4s] ferredoxin associated with cyp194a4 from r. palustris haa2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
LTIHVDQDKCQGHARCKALAPELFDLDDYGNAHEKGDGVVPADLIDKAWLAKSNCPENAIDITED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ferredoxin
publication title The structure of a novel electron-transfer ferredoxin from Rhodopseudomonas palustris HaA2 which contains a histidine residue in its iron-sulfur cluster-binding motif.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Electron transport
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13459 Fer4_15 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id8A00
2C3PA 1F5BA 3GYXB 2VPXB 1JB0C 1RGVA 1FRIA 1GTEA 2V4JA 4OMFG 3MM9B 2VPYB 1BQXA 5BYQA 2WB1D 2C3OA 1FCAA 1C4AA 1GTHA 1G3OA 1Y5NB 4XDCA 1DAXA 1FEHA 1IR0A 4KT0C 1FDBA 3C8YA 1BLUA 1DURA 1FDAA 3MM5A 4DHVA 2IVFB 1B0PA 3MMCB 3MM8A 1K0TA 2XSJA 4OV1A 1VJWA 1C4CA 3MM7A 6FDRA 1H7WA 3OR1A 1F5CA 1FRMA 2Z8QA 1IQZA 1Y5IB 2PDAA 3LW5C 1KQGB 1GAOA 1JNRB 3EGWB 2VPWB 2WSCC 3EXYA 5FD1A 1B0TA 2UZAA 1BC6A 1FTCA 5E7OB 2VKRA 2WSFC 2V4JB 3MM6A 3IR7B 2FJAB 1A6LA 3IR6B 1PC4A 4CI0B 1FRLA 1FRKA 2GMJA 1R27B 4L6V3 2C3UA 1SIWB 2GMHA 1AXQA 1FF2A 3OR2A 1B0VA 1BD6A 3MM5B 1FRHA 1Q16B 4ID8A 1D3WA 4RKUC 7FDRA 2ZVSA 3MM8B 2XSJB 2Y0SD 4AYBD 1FD2A 2FDNA 3MM7B 3MMBA 1CLFA 1FERA 4YDDB 2FGOA 3OR1B 1DFDA 5CHCB 5L8RC 3EUNA 1H98A 2FJBB 3MM9A 1JNZB 3MMBB 1G6BA 2FJEB 4Y28C 1Y4ZB 1FDNA 1F2GA 1FRXA 4XK8C 1FXDA 3MM6B 1FDDA 1FRJA 2WSEC 2V2KA 2PMZD 2FD2A 1HFEL 3MMAA 3HKZD 2VPZB 2WAQD 1GT8A 3IR5B 1PC5A 3MMCA 2FJDB 1SIZA 6FD1A 3OR2B 4XDDA 1H0HB 1BWEA 2C42A 1Y5LB 5BYSA 1H7XA 2C3MA 3MMAB 2O01C 5CH7B 1KQFB 5BYRA 1FXRA 1ROFA 3PNIA 1KEKA 1XERA 7FD1A 1WTFA 2PA8D 1SJ1A 2C3YA
chains in the Genus database with same CATH superfamily
3KLFA 2VQEF 2V4JA 2B51A 3KHGA 3OT9A 1NK4A 1SUQB 2JLFA 2QSWA 5JVGQ 1ZM3A 2DCLA 2EG2A 2ZD1B 2MZSA 1UVJA 2LEAA 2F4VJ 4DV7F 2G2OA 2MSTA 3QATA 4UTGA 3S6EA 2ILYA 4DR5J 2QT7A 3KJQB 5KFGA 1KS2A 1DQAA 4ED1A 2LQJA 4OLPA 4Q0BA 1YJVA 2O5DA 3SDEB 2VJUA 2YNIA 3HVRA 1T3NA 4YHHJ 4M5GA 1B0VA 1EQ0A 1YZ7A 3PDNA 3RW7A 4FF1A 5I3UA 2ERRA 3RU0A 1X0FA 1HLWA 5C5JA 3IBWA 3ZZTA 3QAUA 2Y9HA 2R8JA 1C1CA 4V19J 2HMIA 3IG1A 4KGKA 4RW8A 3LOUA 5AXKA 3I82A 4H54A 3IR5B 2KZZA 3OHAA 2NQPA 3BQ2A 2GHVC 5A8WA 1JLCB 1EAYC 4JI0F 4OHVA 2RIJA 2XMJA 3KJVB 2CPJA 4USUA 4QYZJ 3VWSA 1WD6A 5D0HA 2HQCA 1RWPB 4OI6A 1JLQB 3VVTA 1TU0B 4OV1A 1RU2A 1CULB 2NUUG 2E66A 3Q2TC 1Y5IB 1NKCA 4P2XA 2OPQB 2AGQA 4N76A 2BJ7A 3CUNA 1RZMA 2OD6A 5AXNA 1SL0A 2KFZA 3HXMA 3QPIA 3KHHA 1M5OC 2B4VA 1REVB 1S97A 2B0GA 3C15B 3CWJA 4GKKF 2VOPA 2DR5A 5LT5A 1IKWA 3W9JA 3CDAA 2V69A 1S1UA 4MAKA 3SQGA 4UT4A 4J9PA 1FNXH 4PAAA 1T05A 2D1CA 3D6TB 3AB2B 3RAMA 3DKDA 4R5PA 4RNHA 1FJGJ 1H2TZ 3D66A 3TZWA 4CDIA 4LJMA 3S01A 4CLYA 1XJWB 1LOUA 2J8AA 4DV4F 1RTHB 1KVIA 3Q8RB 1VQ9S 3T3FA 1WORA 1X9SA 3PFEA 4LBPA 2EC0A 5KG6A 5T7LA 3TEGA 1BQMB 1T9TA 2X3GA 3CC2S 1FKPA 1F5CA 5KFOA 2K8GA 3LP0B 2VIHA 2ZM6J 5H9EJ 4QYZK 4IO1A 4NLDA 4CO2A 3IWNC 2BABA 4X4SA 3AA9A 1RISA 2MHNA 5B7WA 5J2QB 2RKIB 1NDCA 1MLAA 4UQGA 1IBCB 3QFWA 5F3TA 1TV6B 2W9BA 3OJUA 3MWBA 1CPZA 3EYZA 3CJ3A 3E01A 2DNLA 2ZBCA 3D0HE 2LP4A 2BOAA 4DSKA 5LOQA 2CJYB 1YGYA 4ZN1A 1Y5LB 2V9KA 3J7YI 3ZTRA 4A8WA 1YIJS 4WE1B 4O3NA 5HK4A 2KG0A 3CT9A 3S7RA 4ZPBA 4EWTA 3H4BA 1SJFA 2DGVA 2R2SA 2ZUGA 2W2OP 2AYGA 5H9FJ 1TUGB 3JQKA 3CJTA 2F4FA 2ADBA 3BREA 3TUJC 2H54B 2QO3A 2UZAA 4RZRA 4JI4J 1I94J 5A8RB 1LK7A 1UCNA 4I2QB 4UOFA 2U2FA 4CLPA 3HVTB 2X3DA 2XSJB 4O44A 1XNQJ 4OX9F 4WP8A 2CZVC 3BKUA 5H9EK 2HQ3A 4KY3A 9RUBA 3TVKA 2VQEJ 3C3LA 3ZZPA 1QAYA 3D1QA 1H2UX 1LWCB 3FEXB 4NYZA 2V6AA 2H51B 1NPPA 3L09A 3VQSA 1HBMB 1VHFA 3HSGA 1FT8A 1VISA 3N5BA 7FD1A 4IOAQ 4OYWA 2ABYA 3SEOA 3QT8A 4ECVA 3CD5A 2NSCA 2H5IB 2HQIA 2HWHA 3Q8QB 3M6WA 1NHKL 4DPYA 1HI1A 2XMMA 4DV5J 5EWEA 2IVFB 2UUCF 3MECA 2XMUA 3OXLA 4LT6A 1TKXA 3HHKA 1S6QB 1V3RA 3Q83A 1NJXA 3T9ZA 2FVQA 3B4DA 2RJZA 2DNPA 2JDJA 3PX4A 2ZBPA 2BDPA 3VV2B 3GPAA 4K59A 5H9FK 2AIRB 4FKXA 1ZETA 2NPIA 3OR1B 3DCAA 4Y3CA 3NRBA 5CD4A 4JI0J 4IDKB 2GFFA 2V68A 4QR1A 1JX4A 1KTQA 1QVGR 1VBZA 3W2VA 2Y1IA 1HBNB 1WEYA 1NBEB 1OS5A 5DLFA 1TKZB 1GT8A 2FB0A 1S77D 2C2EA 3J81Y 2Z0GA 1LW0A 2B9EA 4F2SA 1VOMA 3C6UB 2BMBA 4ZVGA 5IS2A 5F8MA 2GW8A 1QD1A 2OSQA 3TAMB 4YR0A 2RHSB 4USMA 2V94A 4HH0A 3HF5A 1UA1A 5J2PB 4KFBA 2HNZB 3DN9A 2G2ZA 1Q79A 3LP2A 3PRDA 2WW4A 4WJBA 2B5JA 2ZE2A 4GKKJ 5GVQA 4HHUA 4X4QA 2B56A 2PI5A 4UUXA 1Y0HA 3RRKA 4BDPA 1NSQA 4CIOA 1F3VA 4Q43A 1VBXA 1VQYA 5D78A 3HD1A 4FXVA 3GIIA 1GXUA 4PWDB 1RT4A 2LQBA 4DFPA 1HBOB 4CM0A 1S1WA 1VBKA 3R1LA 3TRGA 4PXCA 4C0BA 2KB2A 2FLLA 4DV4J 3PY8A 2BW2A 4NCGB 4IYQA 2A6OA 5FDLB 2FJDB 4KKOA 3TYTA 4ZJQA 1B70B 1PSDA 1N0UA 1JLGA 4NLWA 3SYZA 1T9VA 3T41A 3OFGA 2QMUB 1IKVB 1YJTA 4PUOA 2MQMA 5CQGA 3G96A 5BYQA 4ZVOB 3M30A 3BDPA 3ICLA 1SB6A 1T0TV 3FSIA 3ZZYA 5FJ4A 5EX0A 1WC5A 2VFUA 4EK2A 4Y6IA 4OYAA 4K4ZA 4NXNJ 3X3UA 6FDRA 3BH7B 4Y2AA 3R5AA 4OV6A 3DDIA 2Z2MA 4DCOB 1FWKA 1MN9A 2DGTA 3UE2A 3Q24A 5DQHA 1S6OA 5CYQB 2NCKL 4GVLA 1CQNA 2CPXA 2AX0A 4YOEA 1FX2A 2BACA 3ONQA 1FVQA 1BQNA 4ED5A 4LSNB 4GC7A 1U1RA 2I38A 4LIRA 2CPHA 2CQ1A 5L1JA 3QIPA 3TI0A 3ILJA 1RWMB 3SFGA 4KV8B 2HVEA 3G8TA 3W2WA 1X4HA 3Q8SB 1TP7A 2V2QA 3AB4B 3FQLA 2WRMA 1ZYQA 1U8SA 3DM2B 4AL6A 1Q81T 3LO3A 2GVZA 2N7CA 4LMZA 1OIAA 2KJWA 1IM4A 4U96A 4USJC 2BW7A 3U1LA 3M05A 2MQQA 1G1XA 3IGVA 1KONA 4ZS6A 3HZEA 1S1VB 1S6UA 2HRYA 4TY8A 4KE5A 4DFJA 3R9LA 2M0GB 3L7PA 4PYDA 4YB7A 3ENWA 3O1LA 4UF4A 1PBUA 1TUVA 4FF4A 4QU7A 4OX9J 2WSCC 4DX8H 2QJ3A 2CJXB 4DUZF 4B3MJ 3DLJA 1UPPA 3GFXA 2K7JA 1R3NA 2BM1A 1Q82T 3BH6B 5KFLA 4IRDA 1PAEX 3FCWA 2DBBA 4TU7A 3MFIA 2B4OA 2N3OA 4R0JA 5IM0B 3MURP 4ZVEA 4N8OA 2UUCJ 2RDJA 3FMWA 1FKOA 3D3BJ 3PO4A 1HWIA 1N5SA 2JZ5A 3GG0A 1DARA 1YI2S 3ITHA 2R7TA 3S8SA 4GRSA 3RB4A 4LF7J 2NZCA 2BR0A 2VHGA 4O4GA 4DL3A 1WG5A 3M9OB 2GVDA 1YRUA 4JI2F 2R2UA 1KVJA 2LXIA 3QRPA 2E9TA 2BEFA 4YUDA 2V8PA 3GSDA 1KLMB 5GAEI 2VQFJ 3QZ8A 4DN9A 1N52B 1L3SA 2PIIA 1JKHA 1D8ZA 3CJRA 2FHJA 3M2VB 4IRKA 4RW4B 3EM1A 3D9BA 2CAJA 1RK8A 2FGOA 1RP5A 4PG5A 2V5HG 1VFJA 2Y1RI 1P1LA 4OI4A 3K17A 3NMAA 3EDRB 4CO5A 4M5DA 4FP9A 4X4VA 5KFXA 2A18A 1CSJA 5ADZA 4X65F 5SZTA 4ZPCA 1RCOB 1S59A 1RAAB 1L3VA 3DRYA 2W25A 4A8XA 3OVAA 2IA6A 1GTHA 1X8DA 2LFVA 4P7VA 1K73T 1IXKA 1WTBA 1R0BG 1LQ9A 3M2UA 2AGOA 2UVWA 1GMWD 4J5OA 4ZCMA 1RTIB 5EHHA 4WU3A 3B78A 2DT9A 3HO1A 4K4SA 3CB4A 1IBLF 2G1HA 3HLUA 3GFYA 3EZ5A 2W2NP 5K20B 2HEKA 3HHLA 1KLNA 2F8HA 2BE2B 1G4CA 1HMVA 3LQVA 2YH1A 1FERA 2RVJA 3HHEA 2BQ3A 4DX5A 4RNOA 2UUBF 1U49A 3JTPA 1YZ6A 3HDSA 4LF1A 1FVSA 2EKYA 4ED6A 3QYYA 4DPOA 5EX3A 2DY1A 2NYHA 4LRCA 4B9LA 4N41A 3BS9A 1U7LA 3KLHB 5KFEA 1RYSA 3KTQA 1RABB 1T3OA 5IV3A 3I0SB 3LGNA 2R2TA 4B9SA 1X4DA 4D3HA 3QT6A 2VA2A 3KHRA 4DR1F 4NLVA 2G0JA 3CE8A 2DD8S 3AD8C 4Y00A 4ALZA 1D0EA 4AXJA 2E1RA 2JHEA 2RNEA 3QO9A 3CJ5A 1PBAA 5KG3A 2YNGB 2PFDA 4JI5F 4YR3A 5B08A 4P2MA 2YTCA 4HT7A 4AQYF 3R2CJ 2WTFA 2PMHA 2HSEB 1SI9A 2CZ4A 1UFLA 5L8RC 2L9WA 2H1YA 1PYOB 3U1MA 4OZ2A 3V6DB 3OTDA 1YWXA 3P96A 3FBBA 1C0UA 1UWBA 3NS6A 2QLBB 4ID5A 4M5KA 4OZLA 3PR4A 1HQUB 3OUYA 5HVHA 3BV8A 1TL4A 3UNGC 3E3XA 2XB2D 4ED3A 2G4BA 1IKYB 1CJUA 2JFKA 2E5GA 2OPPA 2RDIA 4NASA 3OBIA 1G3OA 2F3JA 3ETMA 3OL7A 2W9CA 1VQOS 1RHMB 4KH1B 4F4ZA 3CJQA 3JTOA 4JYAF 3TO8A 2AZ1A 2VC0A 1HPZB 2VG5B 1V5IB 2H3EB 3N6NA 2DKOB 2JSXA 3R2DJ 3KLFB 2HFOA 3PIPQ 2V4JB 2V2ZA 3AAWB 1V3ZA 2IFXA 1FRKA 2LU2A 2F40A 4GO5X 1AXQA 1S9EA 4ZVTB 4QIEA 1SH2A 2VL1A 2GJIA 3BQ0A 4OZJA 2I1RA 5RUBA 4FYVB 5C7PA 3EUNA 4M5MA 1FX4A 4LF4J 4DF4A 2AKWB 3MMBB 4MKVA 4Q0BB 1PAUB 4ED7A 3LP1A 4WF9Q 1RWUA 5LXRA 2RT3A 3GTYX 3GB0A 2YNIB 2BKNA 3U27A 3WC0A 4C8NA 3KNGA 2KO1A 2UU9J 5I3UB 2GGPA 3DRPA 4WFXA 3MOZA 4JI2J 4DLEA 2AHOB 3G2XA 1C1CB 2EI5A 2BXJA 3ET6A 2C3OA 5DM6Q 2HMIB 1CQMA 1HWJA 3J7ZT 5D0RA 4X64F 3IG1B 4RW8B 1FDAA 4FZVA 2PI4A 4AUKA 1KN6A 4MK8A 2MYFA 1N5TA 1V3SA 5A8WB 4Q7AA 4NA2A 2ROEA 1FJCA 3CXCR 2CQPA 4F3OA 2RHQB 2LCWA 1F60B 4LFAF 1OYDA 5D77A 1IVZA 1FF2A 3GV7B 2ZUAA 2IDLA 4PQAA 1FRHA 2CQ2A 3MD3A 4OZ1A 4ID8A 1U26A 1IJEB 3KKFA 4G1PA 1M90T 4C9DA 4OFZA 2IJNA 1UVLA 1IM6A 2EK1A 3ISND 2EFNA 1UFKA 3NKYA 1U0SA 3PR5B 2GZOA 1UMJA 3KUGA 2KYXA 3DOKA 3NCRA 1N5YA 4ZLPA 2DEIA 4CLFA 3GLJA 3CJ8A 4QPXA 1IKWB 1R89A 3ZXWA 4CNZA 1S1UB 2RQKA 3SQGB 2JLEA 2K3KA 2FIUA 3GFZA 2F9JA 3R5CA 1T05B 3CDBA 4FS1A 1S12A 4NLSA 5D0GA 1AZSA 1K0TA 2OAUA 3FKBA 4B9MA 3KXDA 3BDEA 3HJFA 4A47A 2M8DB 4R5PB 1KQGB 3AJDA 1BC6A 1TL1A 5AXMA 3PW2A 2KT5A 1PCAA 4YFUA 3PW0A 1GMWA 4ZOSA 3OJSA 1KWMA 4X4OA 1UVKA 5T7LB 5ETSA 4OJ3A 1WDTA 1FKPB 2GMLA 4M1KA 2HWTA 7AT1B 1CJKA 3OVSA 4W98A 1FA0A 4NLOA 3PCOB 1WSVA 1QE1A 3BYRA 1I6JA 3ZZUA 2PGCA 1UVMA 3K5OA 4HACA 3VVUA 3MEDA 4H4KA 5M2UA 2DRBA 2JFDA 3E01B 2AP6A 3OQ2A 3GCWP 4ED2A 1YTYA 3KK2A 2F9DA 3FBEA 3KDOA 4TLQA 4WTYA 4CLZA 3N0VA 1WEZA 3NWRA 2WVBA 2APOA 4DV0F 3Q0AA 5F3ZA 4HVZA 2AQ4A 4C8LA 4ZJLA 2LQ8A 4J37A 1WC1A 2KHCA 1HYSA 4B3OA 1BD6A 4RW9A 3FVYA 4L73A 5D3GA 1YJ9S 2FVSA 3QGHA 1RTZA 2DPIA 4JI1F 1T9XA 2OJ3A 3MMJA 2WW8A 4YDDB 2HHWA 1RWNB 2SXLA 1N32F 2CADA 4HKQA 1JJHA 3SQOP 4DR3J 4LSZB 4Y2MA 1RT2A 1ZS6A 4FXWA 5HMZA 1BWVA 1SQFA 1W7WA 5IT0A 5J1NA 5GAEU 5BYSA 3H7HB 4HLBA 2HBRB 4O44B 4ANCA 1DZ5A 3R97A 3V6KA 1VK8A 2A10A 4ZVUB 3EVMA 4O3OA 4DZDA 1SVDA 2DO4A 1V9OA 2V4RA 1TMMA 2E9RX 2M9KA 4EO8A 2HHQA 1A9NB 2HS0A 2XYHB 1FFGB 4R8UA 2XI2A 4CI0B 4F0MA 3QAEA 2MJNA 4H4OA 2G9OA 1Q16B 4CT9A 5BR8F 4U7UD 2GIRA 3J81j 4FN5A 1YJ7A 3CMAS 3MECB 4TY9A 2XZWA 1TKXB 2EPIA 5GAHI 2QL9B 4WFYA 2MGZA 2M3DA 2QC3A 3NEKA 2WSEC 3C6TA 5A0YA 2ZITA 4ERDA 4O3QA 4X64J 4CT8A 1PC5A 2RQCA 1RT7B 4X66F 3ZFVA 5CH7B 3WIUA 4X4RA 2WONA 1HHQA 3VAGA 4OHWA 2R8HA 4IKAA 4FVCA 2POKA 2BJ9A 4A46A 3PZPA 2VDHA 3W2VB 4N7TA 4UOCA 2RMLA 2VODA 4TU8A 5IWAF 3PYDA 4DLGA 3SCIE 1A7GE 2XMVA 1XN9A 1LW0B 3IWLA 2F5GA 4OZ3A 3UD4P 5CZXA 4CTAA 3MM6A 3CC4S 3E2EA 3OL8A 3UQSA 2V8VA 1VRTA 3OR2A 1HNWJ 3CW2C 2IM1A 2RUSA 4NL5A 1QAXA 4KFBB 3HFVA 3T9NA 2VG6A 1M5KC 2YKOA 2DHGA 1YKWA 3N28A 4Z2XA 2B5JB 2ZE2B 2OPRA 4ZP7A 3UD5A 2B6AA 2DIUA 3DYAA 3QSIA 2DIVA 2PMZD 3IBCB 5JMNA 4QR2A 2BRLA 4UOHA 2ZHAA 1Z4UA 1RSCA 1VQ7S 1RT4B 1CS4A 4FNIA 5E0OA 5F0WA 3FEZA 2PA8D 2C3PA 4I68A 1KDNA 4RL1A 1NKEA 2V50A 1S1WB 2XYPB 3GV5B 2CDRB 1ZM9A 3FEYB 3H59A 4ECUA 1OJ4A 4PQUA 2XNRA 1FCAA 3NNAA 4QIGA 2LU1A 3V4IA 2DPJA 3SV3A 1O0PA 1N4LA 1N36F 3FBCA 3MM5A 5ETKA 3I5CA 3GYGA 2W7PA 4KKOB 3DDKA 3RJMB 1HBUA 1NSKL 2QTWA 3AHPA 4FYDA 4BS2A 2XS5A 2DRDA 1O51A 4KAIA 5HMWA 4NMXA 2HFUA 3GJSB 3NGSA 1EETA 3M30B 1N33F 2W8LA 3TJ9A 3OL6A 2BM0A 8ATCB 7FDRA 2QIFA 5LMNF 3C46A 2E7XA 2DR9A 3QRQA 2BUNA 1SQGA 1JNZB 4ES3A 3D5MA 3KLGA 4DV2J 1NK6A 3M9NB 4ZPVR 3TAQA 3MCNA 3G82A 4C8MA 3KG1A 3PJWA 3POTA 4ATNA 4ECTA 3LANA 4I67A 2O67A 1OY8A 3GR0A 2MLZA 5KFMA 3AH6A 4DV0J 1N88A 3QIPB 4OZ0A 3T6JA 2YKNA 4L3KA 4PXEA 1RAEB 5AE2A 1YJRA 4F36A 2DGWA 5KT7A 1GMUA 3KFWX 5DDRC 1NNDA 2UXCF 2IHR1 5JJBA 3MR6A 3K5NA 2GVZB 1N32J 1L3UA 5FIIA 3UR0A 4ELUA 4C11A 1D9AA 2C3UA 1FEEA 2XNQA 3Q8UA 5T41A 2JEFA 4JI7F 4FYWB 3DU6A 5CYMA 4TY8B 1T9YA 3LPYA 2ILZA 4IG3A 4NEZA 2R7OA 2VZ9A 2V9WA 3VAKA 1T11A 3ZZZA 3A8IA 3FK4A 2YX1A 4F26A 3MCSA 4XDDA 1TL5A 1RHJB 3QIDA 2QLJB 4MIAA 2KT3A 3OHBA 5EUHA 1KFSA 4TXSA 1MU2A 3PHEA 3SI8A 2F8EX 4QWBA 4LIWA 2BVZA 3RBEA 3CD6S 4QWCA 2CQ3A 1RA6A 1C1BA 3DC2A 1HKAA 1J2VA 4PYAA 4A8YA 1B0PA 1S4FA 5KFSA 1QSSA 1MWQA 3HT3A 4CNYA 1ZTWA 1FKOB 1HQ2A 4DSLA 1RLCL 2QE5A 3HM9A 1NZ8A 4C3KA 5L1IA 5MLCV 1R31A 4MYUA 1UP1A 3ITHB 2HFSA 4W92B 4LF5F 3BGRA 4X66J 4ZVQB 4P75A 1BXNA 4JI8J 2GVDB 1L3KA 2QV6A 1R0AB 5F8IA 3PW5A 5KFBA 1DTTA 3CJ0A 2DNOA 2FJEB 4LVOP 3JSBA 2J6TA 2BKOA 4K0KF 3QJLA 3DU5A 3MPDA 4FKYA 1S1TA 1JK9B 1JKHB 3SCLE 3G8QA 4JI6F 1RKIA 2C1EB 3KLIA 3TARA 3EMTA 2D3O1 4WU2A 2K7KA 5HATA 5E3PA 1M5SA 4KB7A 1GEHA 2JEJA 3JQJA 4YS2A 4B3TJ 3OW2R 2ZJQQ 1ULRA 3H25A 2R42A 4LBHA 2GCFA 5KT5A 1NK9A 1IQZA 5DETA 1RKJA 3AJ2A 3AXKA 2Z2LA 4DR7F 1OMSA 5IT9Y 2KXHA 1KTVA 5GADU 2AD9A 5B0EA 1RCXB 2ZHOA 3V81A 2CDQA 4LR8A 2EBGA 3M2UB 4AE5A 3CTRA 4M63A 2YWHA 1RHUB 2J7KA 2P6SA 4OYBA 1AB8A 2L9NA 2QYGA 1FXDA 3AODA 5KOXA 3ENAA 1IBMJ 2R7VA 1U09A 2H5JB 3A12A 2UV8A 3HHLB 1N36J 2O1PA 3PYFA 1HMVB 4JV2A 4QYRA 4C2MA 2C2OB 2QMWA 3IO1A 2PC6A 4DS4A 3OXFA 2XCPA 2R8KA 1N5QA 3I9V9 3B82A 1U6FA 4S0MA 2I6WA 3KYLA 4DSJA 3THVA 5CYJA 5K14A 1RTJA 4U9RA 1NK8A 1U24A 3QWUA 1Z1ZA 2RB7A 4WP3A 5LMNJ 4RW6A 4B02A 5I3QA 3I32A 2CVEA 3K57A 3TANA 2XY7A 5DGAA 3EJMA 3WDOA 1NDKA 4OHYA 1U6BA 2LEPA 2VOOA 2Y8YA 5K5MA 3ENVA 1JLBA 4EGLA 2VASA 4O4RA 1CLFA 3T5JA 4X4PA 1B99A 1HNVA 3T6BA 5A76A 3MCMA 4EI2A 3PEHA 5HANA 4BWJA 3IM8A 3QO9B 2D3OR 1WF1A 1UJ4A 1X5TA 2AEJA 1BUXA 2W2QP 3G86A 1NK5A 2KXFA 3Q8YA 1YSJA 3I5AA 5C24A 3R5JB 2UXCJ 5J2MA 3T1HF 1N48A 1SH0A 1SKWA 3TOQA 5L9NA 5C25A 4WFAQ 4ZLNA 3I31A 5GAHU 2KTQA 4DQSA 4N5SA 4CZCA 1XMOJ 3IS9A 3CDUA 2OMLA 1C0UB 1UWBB 5KFDA 4ID5B 2ACYA 5DRKA 1U1MA 3KOAA 4I2PA 4OX6A 3I55S 4OLOA 3OUYB 2KDOA 3JAMY 2GO8A 5DO2A 1B0TA 3QZ7A 1XC9A 1CJUB 4KJIA 3D6FB 2OPPB 3IR7B 1ZM2A 4DV6F 2RE1A 1MSWD 2W9CB 5DDOC 2LA4A 4EEYA 1NK7A 4WWSA 3P5TL 2YWFA 3FSYA 3UCZP 2F1FA 4HT5A 2W2MP 1Q4RA 4WFZA 5M2RA 3MPYA 4FPIA 3V2UC 1KHVA 4F04B 1X4BA 2VICA 4PG8A 1L5UA 3R5GA 3KMQA 1S9EB 2IJRA 4YP3A 3FZ2A 2J5AA 1KOHA 2DGXA 4UOGA 3PFOA 3PYEA 3W1YC 2JJ4D 3NOCA 1YQHA 2U1AA 3PHTA 3R7BB 4H4MA 1K44A 3LP1B 3OLAA 2GAHC 4DR4J 1SQEA 3FUYA 4Z7CA 1UKUA 4YEAA 2F4VF 3A13A 3D7SB 2YY3A 4DR2J 1HHSA 5LMUJ 4JP8A 2GGPB 3DRPB 2J0XA 4DR5F 4QWDA 2E7VA 4DQIA 3DLBA 1W2BR 2H9ZA 4NZ7A 3EGWB 4OYIA 5KFUA 4ZDNA 1RWOB 4WYLA 1PG5B 4ECXA 1T94A 3ET6B 3DOLA 2A1BA 3K5MA 4ZITA 1VMBA 4YHHF 3WHIA 2FZGB 1VQ6S 2GO9A 1NO8A 4YR2A 1S10A 2G2YA 4TN2A 2CUYA 4JI6J 1NSPA 4Y0FA 1KD1T 4NOHA 3RRGA 3PTWA 4ECWA 1KR4A 2VD3A 3LF0A 1NDPA 3MMAA 2Z2YB 4KGVB 4DWIA 1N34J 2JX2A 1TFWA 2FZKB 3SIPB 2X1GA 1QAIA 5GMKa 2N4CA 4FDFA 4NLPA 3ISNC 2JRSA 2ATCB 2GQQA 2E5LJ 3V6JA 2PT0A 2NUHA 4OQJA 1WHWA 3EX7B 2C28A 2YNFA 3QJPA 3DOKB 3H2LA 2K3IA 1N5YB 3EZOA 2DNRA 1FE4A 4NZ6A 1X7VA 1JWWA 2HRUA 1SJQA 3I6PA 2GMJA 1OY6A 2OTLS 1VLYA 1Y9OA 4TKTA 1ICEB 1AZSB 2WBRA 2ZNZA 2HAFA 4P2FA 3TQEA 5IZHA 4NPOA 5ETQA 1DHMA 3FRYA 1TL1B 5F41A 2L3MA 3AD7C 1WNEA 1JQGA 3JSRA 3R7SB 1ZM4A 1TMJA 2C42A 3BO3A 2EFPA 1KQFB 2HGLA 3QJJA 4OI3A 3QMQA 4ZCIA 1H73A 2HHUA 1CJKB 4R25A 4NRUA 2DXDA 4J9RA 1QTNB 1QE1B 1RWXB 2HFVA 1WC4A 1S6PA 2V8HA 4NYOA 2KRBA 5E2QA 4HACB 1RADB 3D0IE 5G0RA 1NJYA 4LF8J 1APSA 3GFHA 3MEDB 2ACMA 2ZM6F 1HL6A 4Q8FA 2XS2A 1E6YA 4KIAA 4Q8EA 3KK2B 1SIWB 4IOBA 3B8HA 3D6HB 4P73A 2CPEA 2ZBRA 1KQKA 1QLNA 4CRJA 5KT3A 3TA0A 4UQTA 1KOOA 2E1MC 1LW2B 2KXNB 4OX7A 5D4PA 3A4TA 1H74A 5EWGA 2WVCA 1QSLA 1RT3A 3MAHA 1HYSB 1UZHA 2WAQD 1X9MA 5E3CA 4QQBA 4B3OB 4RW9B 3S1TA 4MKBA 3NY0A 5BYRA 5D3GB 5JXSA 1RAOA 4HYKA 3D1HA 2R7RA 2XO6A 4LSLA 2QFJA 4I6WA 5KG4A 4NWBA 1RT2B 4DQQA 2KVQE 4TLRA 4U6PA 4USWA 1S49A 2NYIA 2I0XA 4YB5A 4CO3A 4DV1J 5ITHA 1Q95G 4JI4F 3CDEA 4FF2A 4QW8A 2GIFA 3V5RA 2AJQA 3EWGA 3ILLA 3MD1A 3HI9A 4KGZB 2YWWA 2IIHA 2HYIB 2DXFA 4WYWA 1FD2A 4I4BA 1PJ7A 2NLWA 2HAIA 2QSFA 2MKHA 3HSZA 2ZH4A 5SUHA 1VS3A 4JB8B 1HNZJ 5HSPA 2B3TB 4R8UB 2VUGA 1K9MT 4WXOA 3NL0A 3H42A 2Z4PA 4H4OB 5U47A 2PN6A 3BQ1A 4A4JA 5HBMA 3ZTQA 6AT1B 2ZC4A 5IFMA 1TZ0A 3BJYA 2MLYA 9ATCB 4DQPA 1WACA 3QBCA 4CYUA 4GMKA 2W7AA 1YHQS 3R6LB 4D3GA 3U02A 3GR1A 2MGZB 5FLXU 4DV5F 3C6TB 5A0YB 1X9WA 3R5DA 2FJVA 2R7WA 3NAIA 2MQPA 4DSFA 2B4PA 3IXQA 4GKJJ 3MAAA 4P9SA 2WONB 4ED4A 1E6VA 2FJXA 5KFZA 3BSOA 3QGGA 3JSYA 1TAQA 3PX0A 1REVA 3KG4A 3R7NB 2AEFA 2AMCB 2MQOA 3G6XA 4NYPA 5DM7Q 4ZIVA 1CBKA 3DOMA 4KPYA 2Q66A 4F4KA 4F02A 4LF2A 2FJBB 4J9LA 1REGX 3MM6B 1NK0A 2Q3PA 3M1VA 4P71A 1RXOB 2ZKTA 5I42B 1VRTB 2Y3YA 2RU3A 3OR2B 1B7YB 2VG6B 1LWEA 1RU1A 4B9VA 3MEEA 3WQPA 5L39A 1RBAA 3MXHP 2OD4A 3KLEA 2DJWA 1QTMA 1WI6A 2KT2A 2MEWA 2OPRB 3VHQA 1Y00A 1SKSA 4IG0A 2B6AB 4IQXA 3DYAB 3O2IA 3AXMA 4ES2A 3GJTB 1KRPA 1R0CB 2IPOB 1LFPA 4CM2A 1AUSL 2J9DE 1CS4B 1Q53A 4IO9Q 4NA1A 4U7UK 5DZ6A 4A8MP 3A3NB 2BE7D 2GX8A 4E2FB 3B4MA 1UJ6A 3MUMP 4PQUB 1Z2LA 3KJNB 4NX9A 2AWZA 3V4IB 3IAS9 1W2IA 1VRUB 1KNZA 3K2YA 3MM5B 2ZH3A 5HP1A 2Y1JA 3HZGA 1VQNS 1HR0J 4L72B 5ETVA 3EPIA 2HHVA 2ZOGA 2N4DA 3UFCX 2PFFB 1EETB 3CC7S 1U1PA 2IDEA 2R3VA 3QLHA 2DEJA 2CQIA 2DISA 3F73A 2Q79A 1U02A 3KLGB 5JUMA 2HVDA 1HARA 1VRQC 4XTTA 3CCZA 3G82B 3W62A 1XBWA 3POTB 1WUUA 1RBLA 5CZVA 2MTLA 3MM7A 4NXNF 1NJWA 4P72A 3IA0A 3PACA 1PYSB 3MPVA 4EYHB 2J6SA 1RAFB 4NZ0A 4J9KA 2GHPA 4J9MA 4OJ1A 4QW9A 2E9ZA 4X2BA 2KYZA 4ER8A 2YKNB 1HI8A 2DTJA 3FNNA 2B9WA 1Q8KA 2WZ1A 2Y0BB 4IRCA 1U1OA 1CC7A 5HJYA 3IN5A 2DGSA 1RI7A 3WC2A 1VIXA 5AJ3J 2FGCA 5G4DA 2H5EA 5IOLA 4C11B 1UPMB 2HZCA 5CCMA 4WFBQ 5L46A 3MAQA 2WVEA 2ZBQA 5CYMB 4NXMJ 4CH0S 2ZFHA 3GYXB 1VQPS 4IG3B 2H48B 1TL7A 2XTJP 4J9UE 1VQ8S 2YXLA 4HDHA 5HQLA 2R7UA 1RHRB 3MM8A 2Z2ZA 5CXTA 4MH8A 1ZPWX 2K06A 1NSAA 1UJ5A 4DPWA 2R8IA 5J2NA 4RWWA 1Q7YT 3K8WA 2XO7A 1MU2B 8AT1B 3UW1A 3UDCA 1NJIT 1YX2A 2ZH2A 2EC2A 1AA1B 3FMBA 3ULHA 4LF9J 4RWXA 4B3MF 2HNYA 3IBFB 2N3LA 1IN0A 1C1BB 3Q8PB 3UVJB 3LAKA 3FSXA 4USKA 1NH7A 1HBNA 3VZHA 1FWLA 3G4SS 1JJ4A 2QRRA 1CJVA 1RHKB 4MK7A 3AT1B 5D4OA 2XGPA 4F50A 4MKYA 1EHWA 3TWZA 4NLQA 3HULA 3W3SA 4PCQA 2O3DA 2CJ9A 3BGRB 3O44A 3MR7A 2C2KB 4ILLA 3ZTPA 1VHIA 1DTTB 2FHJD 2JEIA 3CSKA 2DCUB 1SBRA 2XM3A 2AW0A 1V6HA 2ZH8A 5HJXA 2MZJA 4EMDA 2HRTA 3TZXA 4LF7F 4FF3A 1S1TB 2M8HA 1I51B 3UR3C 3NGTA 1TR0A 3FC9A 1VCTA 3MF5A 1FRMA 2W8KA 1XIQA 2FZCB 3TUIC 2IA0A 2E5JA 2W4CA 3Q23A 2MKCA 3EGNA 4K50A 2VQFF 2OSRA 1HBOA 1JLAA 1RTDA 1OQ3A 2KZMA 1AROP 1XWLA 3GCXP 2Z30B 2LYVA 3UI3A 3K5LA 3F0NA 4AFFA 3MM9A 4NCGA 4OHXA 2BZ2A 4KH0B 4QOTA 5IXUA 1HFEL 2HFZA 2DY9A 1RWKB 1QUPA 1F9HA 4QIWD 3FCHA 4A48A 2R9LA 2ZWOA 2HHSA 4PG4A 3V81B 2C2ZB 2GNKA 4L75A 1RGVA 3HHLD 3Q8VA 2CJBA 5KFKA 3QWPA 2WB1D 3HVWA 3PYGA 4NA3A 3H20A 3W63A 4XDCA 2RU9A 4K5SA 3NOGA 3THTA 4CLTA 4GVBA 1YJUA 3BBCA 2UXDJ 1S7IA 4CLLA 1YITS 4NI2A 1WEXA 4LF6J 1IWGA 3H90A 2HNDA 3A3OB 1PYTA 2CQ0A 1M5VC 1HNXJ 3IC1A 4HEA9 3MDFA 2VA3A 2ZEJA 1RTJB 2HLUA 3IRXA 5CHCB 5IT9U 3A8EA 3C16A 1TK5A 3PEJA 1VGYA 4DL0C 2OI2A 3RUBL 4AL7A 4RW6B 1J5EJ 1XNRJ 3V6HA 3SMZA 2RF2A 4BWMA 4PPZA 4CLUA 5HN0A 1SJ3P 2BKPA 2CG8A 1B4SA 1F9FA 3NCQA 4EUVA 3LGHA 1S0OA 1HD1A 5E5NA 1HNVB 3T1YJ 4OL8A 4F0KA 2DNNA 2YQ1A 2FPHX 1HQEA 1WSRA 5D4LA 2IVYA 1ZOTA 2J0WA 2WVFA 1X31C 3CCSS 3EVOA 5C24B 2Z8QA 2BX6A 4PR6A 4JUZA 2JH3A 1VC5A 2B8QA 1VDHA 1XR7A 4EBCA 1U1QA 1GH8A 3W64A 5C25B 3RAQA 1U0HA 4EBDA 2KRRA 2QLWA 1YBTA 3LWMA 3IS9B 3GWCA 3CD0A 4I2PB 4NEYA 2J8SA 1S76D 3ADAC 2XGQA 4YN3B 1VQLS 5A8KB 2ZH5A 2YQ0A 3ETOA 4Q2MA 4AXIA 3CULA 2FYXA 3CCTA 4XAKA 3CPWR 3M2RA 2XQCA 2F8MA 1YG0A 4M5HA 4X62F 3W61A 4RUAA 4DUYF 1R8AA 2ZZNA 2OP5A 3SCKE 3IWXA 1S0VA 2NXEA 1TUWA 3I87A 1DTQA 3CO9A 1Q78A 4EFAC 3CCJS 1VK3A 1BGXT 2Q6BA 4H4MB 3MEKA 3I96A 3JAMU 3FBFA 3T19A 5DG8A 2PE8A 1KQSR 2BJDA 1X4CA 3C66A 1WJ9A 1T8EA 2I8EA 1S5ZA 3IP0A 1IQTA 3D68A 4LF4F 3CNQP 3AFGA 3R6GB 4BHQA 3TUZC 2E44A 1W26A 2BQUA 1DQ9A 3H98A 5I3PA 1SJRA 2UU9F 1NH8A 1SC4B 2XLKA 2C2RA 2NR0A 1T03A 4F2RA 2DYAA 2YBVA 3BPDA 3D0GE 1K0VA 3GIKA 2GJ2A 3ISZA 4M5LA 2MY8A 2H65B 4V19X 2AZ3A 3DRSA 2UXBF 4QR0A 1WKKA 1G2EA 3FCVA 3MEGA 4RU2A 3MHYA 2XMWA 5B0BA 4HTJA 2B43A 4C4WA 4K4XA 1SV5A 2FVPA 4CP5A 1OO0B 5KG5A 3N5FA 4J9QA 3SBMA 5IV4A 3WX4A 1A6LA 2BRKA 2OUGA 2NPFA 3KG0A 5KTQA 3JYTA 5KFFA 1FWPA 3B6BA 3VQTA 1NJZA 2YKMA 2YNFB 5KFRA 2XMTA 2M4MA 5JVHQ 5KOWA 4OI0A 1SH3A 1JLEA 2MDAA 4LR7A 1J5OA 2P9CA 5B0CA 1RWVB 4FPRA 5C2CA 5F0UA 4HHJA 3IRWP 4QIFA 2RUGA 4P2SA 1ZBTA 2FTRA 3GIRA 3K0JA 3GE9A 2E1PA 5F9LA 1SC1B 1H72C 4DPTA 3J7YU 2LECA 3RBXA 2J0QD 3MR5A 1LK5A 3J7Z5 2XWXA 5IQ6A 4YDXA 3LTOA 5M2PA 2W4PA 2BE9B 3VTIA 3NCPA 2P8IA 2OPSA 3P3DA 2QL7B 1EQMA 1FNMA 2LVWA 3UDLA 2HK3A 1VC6A 4KO0B 1S6PB 3FDSA 3PKYA 3R27A 2JLGA 2DNKA 1KSPA 2HWIA 1RT5A 5THWA 5KFTA 5KG1A 1OPZA 3CMES 3BKFA 4WFNQ 1E6YB 1SKUB 3ELHA 2WHOA 2YNHA 1UA0A 2Z56B 3T1AA 2Y1LB 1D1UA 1ZA2B 1SIZA 1VI7A 3CIMA 1T9WA 5BJRA 1JXVA 2GA7A 3FQKA 4TYBA 1JB0C 4F4AA 1D9DA 2XI3A 1XR6A 1HHTP 2VPYB 5B0DA 4EYIB 1GK8A 3EXCX 1T02A 1HPZA 2VG5A 2I9SA 4KGMA 4XIUA 1RT3B 2AJFE 1N8RT 2DNMA 1YLXA 4A8QA 4OJHA 2MQ8A 3NGRA 4LFBJ 3DGVA 4DI6A 3G6ES 1TKDA 3M6XA 2FHKA 4Z37A 1IUJA 3CJSA 1N0VC 2RDDA 3UN5A 2KM8C 4RU9A 4LSLB 2E7WA 2OEMA 3RG6A 5HI7A 2VDIA 1D3WA 1EX8A 4DSIA 2IRXA 3MMBA 5AE1A 2YWEA 4TQRA 1H98A 3BGOP 3W5ZA 1AFIA 4NRTA 4K4VA 3VZIA 4DR3F 4WXWA 5E41A 3CCLS 5KFWA 4X62J 3L9ZA 4A8SA 2CQGA 1JJCB 4OYPA 4DUYJ 1RUSA 1HW8A 4M94A 5C42A 4NLRA 2E29A 2EEYA 5D4NA 2W9AA 1LWFA 1RACB 2XEXA 3OTEA 3DXSX 5HLFA 3TNVA 3E8OA 1EZZB 2MQLA 1VJWA 5HBMB 3CCES 3VALA 2RH3A 2ROPA 2AX1A 2EXUA 4CYUB 1K1QA 2MPUA 3G9CA 2GMHA 4ZP6A 1ZAWA 1Q7LB 1J27A 2RQ4A 3CCMS 2EBEA 1FJEB 4IOCQ 2QA4S 2K2PA 4ES1A 1N54B 1I1GA 3MAAB 4DU8A 1R8HA 3VAFA 1M0SA 1E6VB 5HQ8A 4ZVFA 5K9FA 4XPEA 1RAIB 3PJ9A 2V2KA 4I1TA 1JLFA 3EE3A 2UXBJ 2HS4A 2ZHBA 3UDEA 3DOMB 4N56A 2ADCA 3I4HX 1U6ZA 2OIHA 1FRIA 2XG8A 5E3QA 2BJ3A 2HGNA 2COLA 4UY85 2BA9A 1UEUA 2YQ3A 3QRRA 2HW3A 4Q2LA 3G6VA 3UO0A 5D6GA 3JSMA 3NGUA 3M1VB 3BGFA 1KVKA 1P6TA 1VYAA 4OYOA 3DI6A 1VJQA 3HMJG 3RYLA 1CG2A 4MFBA 2VJVA 2VONA 1LWEB 2IM3A 2Z58B 3MEEB 2VPWB 3KLEB 3P45B 1NEEA 3DLKA 1M1GA 2HZAA 3GIJA 3NMRA 3JTNA 3BR8A 4IG0B 2HQDA 4DZ6A 3CJ2A 2PEBA 2A6MA 4U8VA 1HNWF 1MMLA 1O8BA 2QGFB 4ZPAA 1A0OB 4C8ZA 4V1Ak 2MKYA 3DGPA 5KG2A 1URNA 3TAPA 4P6QA 4I6AA 1U47A 1U48A 3N79A 2YVSA 3US5A 4X4UA 5CAAA 1OSCA 2H4YB 2L08A 1JMTA 1RT6A 4QJVA 1NHVA 2ZH6A 4F0HA 5HP1B 2O01C 1P1TA 1XEZA 3MI7X 4EBEA 1UL3A 1S0MA 1F5BA 5DS7A 1R8PA 4O0IA 4RUCA 1LKZA 4O3PA 4RJVA 2VB6A 3DDNA 1H38A 8RUCA 3KK3A 4AD6A 2JVOA 3C8YA 2DHSA 2UP1A 2JEGA 3W66A 3TQ1A 3CCUS 3TVYA 1S48A 1U2CA 3QLHB 1YJNS 1RT1A 2QLXA 3OFHA 3UDVA 5KFPA 4DV3J 1DJ0A 3ZNJ1 5IC4B 3P5BP 1FRLA 3C14A 4QBUA 2NXCA 2KG1A 2MZQA 3IM9A 4LRAA 1WDDA 3BR9A 1IWAA 2DNYA 1MMDA 3MM7B 2XBPA 3A8JA 1H6KX 2DH7A 2W9BB 4ZVRB 3NAHA 1XK8A 4DV2F 1FRXA 2HFNA 1OY9A 3EDQB 1WWHA 4F8RA 2EWHA 2D7SA 1WI8A 2PMWA 3WX8A 1IR1A 4CO1A 4K5RA 2B7CB 4PRFA 3GJQB 4DFKA 5IT4A 4R0EA 2DGQA 2OKQA 1PKUA 2J7UA 2IM0A 4A8FA 2YPZA 2HK2A 2ZOFA 4DV7J 4DCJB 2I2YA 2B7BB 3M32A 3CJ4A 3W9IA 2LDIA 3GMGA 4RBTA 1TL7B 4NCBA 4ETXA 1Y3KA 5L1LA 3HCXA 2ZDOA 1Q8BA 4N77A 2K1RA 3AA8A 4QIVA 3W8GA 3EGZA 3MM8B 5GMEA 2MY7A 2GAGC 5J2NB 2CPIA 4K2XA 2KM8B 4NLYA 3DLHA 1TQLA 3MUTP 2IM2A 2CIMA 1RT7A 1EIYB 2PD1A 5D8HB 1C0TA 2HNYB 3I9ZA 4FBUA 1MN7A 3DRXA 1ROFA 1XERA 3PJXA 2IMWP 2DR7A 2ZH7A 4LQ9A 2FUG9 2V0NA 3HP6A 1Y5NB 1NHUA 1CJVB 2V63A 1X0PA 2VH7A 2HBYB 3BEGB 5F8NA 3DHWC 5E33A 4ITSA 5AE3A 2UV8G 4ZPWR 5KFAA 4PWWA 2M5YA 5LXYA 4IFYA 4OZ5A 3A3PB 3I0RA 1S9FA 2UUAF 3CCWA 3LGMA 2ASJA 2FC9A 1FE0A 2XMKA 5E3AA 1EKSA 5HQMA 4AYBD 1OYEA 3VAMA 4JI8F 3J80Y 3RW6A 1D8YA 4AT1B 3RR7A 3DXBA 3BO4A 1EB0A 3KUHA 1ZH5A 4A8OA 3K5PA 3RGIA 2CKWA 1RAHB 5L1KA 3CCRS 4YMEA 3FRZA 3MUVP 4DPUA 1SL1A 1JLAB 5K8OA 1V5VA 2XY5A 3UN3A 3LALA 1F1BB 1RTDB 2DVIA 2VFSA 2CQHA 2C3YA 2E5HA 3DLGA 4M5NA 3CIZA 5B0GA 5AXLA 3MM9B 2WOMA 3M8QA 1IKXA 4JV1A 1R8CA 4KR0B 1NB2A 1RWWB 1JXLA 2CRLA 5AT1B 4B3TF 4FNHA 3UPFA 4XO0A 2FVRA 1C2PA 2XYGB 2LMIA 1H7WA 3OFFA 2RSQA 2PDAA 4RLEA 3W9HA 2F63A 3H8YA 3HHLC 3LP2B 2VV5A 2AGPA 3RBDA 3V4MA 4F25A 2ASYA 2E5IA 5A2QY 4GVBB 3P49B 2ZBIA 1WF2A 4CO0A 4KSEB 4IUFA 3W5XA 4U8YA 5F9NA 5F8HA 1X5OA 1N56A 4NI2B 2FHMA 1RJJA 2FC8A 3PG9A 2DNHA 4KHMA 2HNDB 3DLLQ 1ZAXA 2PSZA 3O3LA 2RD5C 3TZYA 1IBMF 1RYRA 3J81U 3M6UA 5KT4A 1RBOB 3TZZA 3VR1A 5ETPA 3MPUB 3QT5A 2D3UA 2MZ1A 1B7FA 4O0NA 2CXEA 4ECYA 3IRXB 1JLGB 3C16B 2ZKUA 2OELA 3D28A 3D6MB 1P27B 3ZC4A 1I5OB 5LSOA 3AJ1A 1U4BA 3C2PA 2RF2B 4PUOB 1K47A 3L7OA 5B0FA 5LSRA 2W2PP 1HNIA 2OLWA 2J9CA 2W01A 2HIYA 1TKTA 4FYYB 1HQEB 1OPIA 4ZMMA 4YY3F 2BANA 4C3LA 4OI1A 3Q86A 1U45A 1UAWA 2BQRA 1BQNB 1EP4A 1WF0A 1NUEA 2RS2A 2QFIA 4TYAA 3W8PA 4O3SA 2J9DA 4NE9C 4DR6F 3ILIA 4L74A 3DNCA 2I5JA 1ZPVA 1GNKA 2NXUA 1U0HB 2J7WA 1DRZA 2MB0B 4W90B 3I4PA 1PGZA 2R2RA 2WB4A 3N01A 3W2WB 2CYYA 4USIA 1Y10A 5HL7Q 2DB1A 5BXIA 5C2GA 2JNJA 1VR6A 2CPYA 4DX6A 2IYGA 1UW9A 1N6QA 3MCOA 2Q1LA 1C4AA 1IR0A 1EKRA 1QSYA 1XMOF 3DMJA 3F41A 3FGVA 2G1DA 1GX5A 2HBQB 3ZZRA 1BY9A 4WKRA 2GIQA 1FXLA 3H5XA 4DCPB 5CCLA 4C3MA 4ILRA 3M2RB 2HVIA 4N8NA 2WSFC 5LJ3Y 1GMVA 3H40A 4ICLA 5HMXA 3G8SA 1FK9A 1MWZA 3G6YA 4HHHA 4ETZA 1R0AA 2L9DA 3L4BC 3VGUA 2VG7A 2DO0A 1NKBA 4LUBA 4BBYA 1ITPA 1VLOA 3SSSA 2D9OA 1DTQB 4J91A 3HT0A 4CQ1A 4UUWA 3BZQA 1G6BA 4CLSA 2CZ9A 1M1KT 4WK3A 4UZBA 2BYCA 2CPDA 3OTCA 3N6MA 2HHTA 1EARA 1SKRA 1EJ7L 5F8JA 5KFVA 1TL3A 5HVFA 2ZH9A 2CPZA 2VBXA 1X5PA 1TAUA 1S4EA 2VPXB 4DF8A 1MROA 2HVZA 2DNQA 3CJKA 1H2VZ 3NGDA 2UUAJ 3BYPA 4J9SA 1FJ7A 3JXOA 4DR4F 2NREA 4ILMA 4DR2F 2X7IA 3TJAA 5LMUF 2CNKB 4O4GB 1QVFR 5FD1A 3D67A 4USTA 1T03B 4LREA 4CO4A 3BSAA 1UZDA 4RW7A 1O5JA 4KHPF 3IR6B 2CQDA 3RB6A 4ZLJA 3O8WA 3SCJE 3DRSB 4Y2IA 4F7VA 4B17A 2DGOA 3MEGB 2GJFA 2D3ZA 2DK2A 3KK1A 1WG4A 1DFDA 5F8GA 1SV5B 1RB0A 2IRUA 4WIIA 4N47A 4J90A 2IAJA 1NPRA 2B4UA 4ECQA 1B3TA 1B64A 4B9TA 2Y8WA 3JYTB 2G0CA 4OI2A 4M5IA 5DQGA 2C3MA 3B54A 2YKMB 1N34F 1GX6A 4M5DB 5DG7A 3KDNA 1FESA 1JLEB 2EFGA 1J5OB 5ETTA 4ED8A 2E5LF 2MKKA 1FEHA 1JJ2R 4C8YA 2FY1A 4WPAA 3AY0A 3K58A 3W7BA 5CD4H 1MG7A 3KLVA 1S1XA 3EZUA 4MYTA 2QA1A 1H3DA 2R8GA 1U8WA 2V8GA 3PRBA 5KT2A 3NBPA 1GXLA 5KG7A 2J6UA 1WC0A 4I6YA 3IAM9 1HWUA 2BV3A 3HFKA 4LQ3A 2C2NA 3BBFA 2AYMA 2C2MB 2ZWPA 4I0WA 1Q5YA 4HDGA 2BJ1A 3O6QA 2ZNYA 4B3SF 1P9YA 5GAGI 3P4UB 4ED0A 1Z2ZA 5DG9A 2OFGX 2XZDB 2NS1B 1LV5A 2OPSB 2CNLB 2V4QA 4H4KC 3PRVA 1TK8A 1GXTA 4P74A 3D54A 5EDWA 3T5LA 2VFRA 4ZHRA 3PW4A 3HSDA 1RT5B 2AYEA 3NNHA 2DR6A 2R4FA 1BQXA 3LH2S 3BSNA 1I3OB 3FZBA 3RB3A 1S72S 3BGLA 4NMLA 3D3CJ 1U2RA 2YNHB 1DURA 1NM2A 1S79A 3R1HA 3MTKA 3ZTSA 1YJWS 4YY3J 4DEZA 3ZTOA 2V67A 3I56S 4LF8F 4RUBA 4B9UA 4C8KA 1ZAVA 3KJFB 5KT6A 1F6TA 2QA2A 2ALZA 4DUZJ 4DR6J 3H4DA 4NLGA 2CWKA 4RNFA 3KNAA 3PW7A 1WC3A 2LXUA 3HSJA 4U95A 4FBTA 5LL6d 2FY8A 2KL8A 4J7CA 3RB0A 4YQWA 5HROA 4URSA 1SPBP 3GP9A 3M4XA 2IC3A 4JI3F 2UVRA 4B08A 2N7YA 5DJBA 1ELOA 4QWEA 4OMFG 2VFTA 5L9XA 1U25A 3M8RA 4CLWA 3TJ8A 5J1EA 4URQU 4Q44A 4WK1A 5EWFA 5IC6B 3M9MB 3BGUA 3M8PA 4DS5A 1R7IA 3K7RA 4P10A 4I7FA 4DL7A 5C42B 2MZRA 4K4WA 4OYXA 4DV1F 1NCLA 2IRYA 4ZK7M 1LWFB 1PC4A 4L6V3 3TA2A 1L3TA 3LWLA 2DHAA 2ALYB 4NLTA 5HLFB 2FHOB 1WC6A 2LQ9A 1PJ6A 3OTOF 3TA1A 2DH9A 3BN7A 3QQCD 4BCAA 2DRAA 4EZ9A 1S9GA 1DY3A 1FTRA 4DSEA 2IJFA 4RX6A 3SSRA 2OHDA 3M8ZA 4K7QA 3CF5Q 3QGIA 1HNZF 1FRJA 1LWXA 2O66A 3OTBA 3GG1A 2QMXA 3Q89A 1MWYA 1SJ4P 1UTAA 4IFVA 3VAHA 4X65J 1KEKA 1WELA 2BBEA 2DNGA 4G1QA 3OV7A 3RRHA 2X51A 3GQCA 4C97A 2XULA 4DL2A 3DLEA 3HJVA 4KHPJ 1JLFB 2J76E 4Y34A 4YB1P 4I64A 3PVXA 4ECZA 2EVZA 3R8YA 4GKJF 1Y11A 2QZ8A 3D1OA 1PJ5A 3FFIA 3WZ0A 1LXJA 3MZIA 2VKRA 1NAQA 1SC6A 1IBLJ 2MHEA 3HD2A 1R8BA 3IMQJ 3CCVS 2LDYA 4RUHA 1T9UA 3JSMB 2R7XA 4Q5VA 1PIEA 3PX6A 4PEOA 4B9NA 1KKHA 5B09A 3DI6B 4ZIWA 4IH7A 2VC1A 4RO0A 4MFBB 2ASLA 2UUBJ 3J7A1 4KBIA 3QSYB 3HPOA 3BKTA 2WBMA 4GO7X 1WHVA 1F2GA 3DLKB 5LJ5Y 3BPSP 3EPGA 2P2CB 4Y2KA 4LRBA 3QNWB 1FXRA 4HI2A 4W4MA 3W65A 1UVNA 5K8NA 4G1IA 2AJ0A 3DGPB 3UCGA 2ZDPA 4DL6A 4JV0A 3GJRB 4WZMA 3DFEA 4DR1J 4LFCF 3TVZA 2VBYA 1NXIA 2UUWA 3PM9A 3R5BA 1RA7A 3NLCA 1RT6B 2OGUA 2GV1A 3KMSA 3O5TB 5GADI 1FFSB 4B3SJ 1FFWB 4OZNA 3K59A 4DBQA 3KK3B 1IR2A 2W4DA 4JI5J 1FD8A 1CJTA 2YWGA 5DZ7A 4AQYJ 3HHNB 5ETNA 1ACMB 1U1KA 3LA0A 1LW2A 4K2JA 1GQEA 2LA6A 1Q5VA 2MJUA 2OO4A 4PPDA 2FVCA 1RT1B 2HZVA 3AD9C 1HR0F 1VQ4S 1DLOA 1VBYA 5IQQA 1N5VA 3EVWA 3ZZOA 2ZZTA 3CEDA 4ZP9A 1HW9A 4ECSA 3C14B 2EG1A 3MR3A 5CA5A 2ZVIA 3MMCA 4ANDA 6FD1A 3BF4A 2CNNB 4C0HA 3E51A 4IH5A 2KJVA 3N4WA 2ZOMA 2IY5B 1FNOA 2QN6B 4C48A 2QX0A 3AOCA 4ZVHA 2IMOA 3MOJB 3RTVA 2HBZB 1VQKS 3U7JA 4LVNP 2FLNA 1NDLA 1FDBA 4JYAJ 5FLXY 4DHVA 2CPFA 2EFVA 4UY8T 3FJ2A 1TVRA 3H2VE 4DL4A 3TEHB 3UN2A 2HS3A 1JXEA 4DG1A 2CFXA 2V34A 4ZVSB 3DRRA 2A2CA 1R27B 1YRTA 3VF0B 1JIHA 1W25A 1WOOA 5HO4A 4RKUC 3SSQA 4JI3J 3M32B 2ZZMA 3KWMA 4I56A 2CWXA 1RE1B 1R6VA 3I5BA 3A1YG 2R7QA 1BMQB 2AJ4A 1SUQA 2A3JA 4DJBA 5AJ3F 3AQOA 2ZD1A 4M95A 4KPCA 1LFWA 1WHYA 3QT7A 5LSLA 2K1RB 1SXLA 3H2UB 3IGNA 4PKDB 5DQIA 4NXMF 5DGBA 3M6VA 2XY6A 3HKWA 1GTEA 1Q8LA 3SDEA 2EKNA 1NU4A 2JL9A 1XMQF 1NZAA 5KFYA 3W5YA 1FHTA 1C0TB 4C98A 4A8KA 5HVGA 4OJGA 2HHHF 4L76A 3OTOJ 5J1PA 4G3IA 3NS7B 2M2BA 1AUDA 1P8GA 1DQ8A 2CJQA 4ANEA 1VIOA 2M7SA 3K8VA 4ZCKA 4LFAJ 4LF9F 4WIQA 2AYBA 2HIQA 4ZP8A 2UVVA 1S7HA 1JLCA 2OMOA 2Y0SD 2N82B 3KUEA 3KJVA 4TNOA 5K8PA 4RBUA 4ZA1A 2G0IA 4MIBA 4NCAA 4IFYB 5I42A 1Y4ZB 1UETA 4JOUA 3I0RB 1JLQA 3H5SA 4DN0A 2E1AA 2CVIA 2RRBA 2P6TA 2X1FA 1CULA 3RR8A 1S57A 4BLGA 2OPQA 4MT1A 2HG4A 4FYXB 1D09B 3OSPA 5KFIA 4F4YA 1X60A 5GAGU 3M8WA 2MKIA 1U1LA 2YPYA 1U2FA 2B9YA 3PV8A 4DDFA 4HTIA 2DITA 3C15A 2QLFB 3ZNUA 2J9EA 3EXYA 3DLGB 3GSIA 1YBAA 4J9VA 4BC9A 2MZTA 2YWKA 5I4MA 2WOMB 1VRUA 3M8QB 2AF6A 3SXLA 4JV5F 1IKXB 3MR2A 1F2HA 4CTAB 2YKAA 3OD2A 4ENOA 2L48A 4CH1A 2HPUA 3CDWA 2F7VA 3ENQA 2XHWA 3DHXA 2UVUA 4X84A 4C0OC 2OEKA 1QY7A 3H0PA 4KQZA 2Q6CA 2J0SD 1RTHA 2H4WB 4C7QA 2ZH1A 4ZN3A 2FLPA 4LFCJ 1F3FA 1BQMA 3J80U 1VQSA 2HQGA 5K8MA 1S0NA 2P9EA 4MK9A 1QM9A 1TK0A 3LP0A 2JC0A 1Y7PA 3BBBA 5KAKA 4LRFA 2VF3A 1WOSA 4PABA 3VAIA 4FS2A 5J2QA 2E1CA 3P6YC 4IH6A 2RKIA 2B8PA 3GYNA 3OVBA 3JB9k 1NPKA 1BLUA 1AT1B 1TV6A 3M8YA 3G71S 2AJ2A 2UXDF 3GZ7A 4UZCA 4PWUA 3GIMA 1GAOA 1LEOA 4MMOA 2CQBA 4LF6F 2OH2A 1HBUB 5KFNA 1HIYA 1LNQA 3PIOQ 1WOPA 3VAJA 4LR9A 2V2VA 1AFJA 1HNXF 2ATLA 1WKJA 4JI1J 2XWYA 4IQMA 4WE1A 4J9OA 4X4TA 1HNIB 2GHWA 3NWGA 2CNOB 1KC8T 4HR2A 2RQMA 2MQNA 3ILOA 4QCLA 3OSNA 4F4XA 1J5EF 1XNRF 1OQ6A 5A2QU 1NB7A 1TKTB 3OLBA 1O6XA 2EFQA 4BC7A 1F9EB 3BO2A 1BWEA 5KFJA 2YKQA 2DHHA 2BANB 2HURA 2XZTB 4G6VB 3BN4A 4EU0A 1X4EA 4F3QA 1EP4B 2LEBA 3A8KA 4KC5A 3T1YF 4OYMA 2M88A 1Q8IA 4ZCLA 1Q0NA 2HKEA 4PG7A 2AT1B 5A8RA 2UUTA 2I5JB 4KT0C 4DOZA 1X4AA 4I2QA 1HD0A 3G87A 3U1NA 4KGXB 2MKSA 3HVTA 2XSJA 3D4JA 1C4CA 2RRAA 3F44A 3W60A 1UW4A 5H1SV 1FTCA 2HHPA 1SCJB 3TW0A 2CJAA 5D0EA 1LWCA 1QAJA 1N6QB 3OFEA 2OTJS 1UFWA 3PKMA 2C2DA 4O3RA 3UVJA 2LQ5A 1U1NA 1IBKF 4K4YA 1WHXA 2RAQA 1HBMA 5BR8J 4URGA 2IYIA 2WCXA 3DMJB 2YH0A 4B3RF 1P9QC 1K1SA 2D69A 3UCUP 1CVJA 2P5VA 2QEXS 3H5YA 3JS9A 4K4TA 3MTJA 4F67A 1UWAA 2FD2A 4NLUA 2DGUA 2AU0A 2OFHX 4ICLB 2YKPA 1RAJA 1FK9B 2Q43A 1KP6A 1XMQJ 3HK2A 3OL9A 2W7OA 4RPFA 1XMBA 1S6QA 1WTFA 2VG7B 2HHHJ 4QU6A 2RS8A 1KFDA 4OX8A 3MPWA 5F8LA 1M5PC 3NGKA 5KFHA 4Q45A 3MGJA 1X4GA 2KFYA 2HQFA 1XTZA 1G7CB 3TX0A 4CWBA 5EGYA 5A6PA 4IR9A 5IWAJ 4AL5A 2CQCA 3TUPA 3HFZB 5GMDA 3KHLA 3L95X 3OR1A 2MKJA 1MMNA 1TL3B 1FKAF 4IDKA 2QA4G 4I69A 4HL9A 2LKZA 3HVAA 4E8UA 1MROB 2MSSA 4KRWA 3CJKB 4OYZA 4MTPA 3GV8B 2EW9A 1TKZA 4TVAB 2KU7A 3OPKA 1WKLA 3PXGa 3C6UA 2V8DA 3Q2SC 2YX7A 4DFMA 3TAMA 2XHCA 4FXDA 2VFVA 1FDNA 2CG4A 4RW7B 3TX8A 3HKZD 2X1AA 5J2PA 1YBUA 2HNZA 2WK4A 4USVA 4E0DA 1MNEA 1TFYA 1X5SA 3NP5A 3KK1B 3D2WA 2FLOA 2CQ4A 3GONA 3T5HA 3KLIB 5KFQA 2D9PA 2IAJB 5KG0A 3VCDA 4PWDA 4JV5J 4RR5A 3M7VA 4MKAA 3H5UA 1DBDA 4CCHA 2VBWA 2HVHA 3LW5C 1JNRB 2DXEA 4XPCA 1CC8A 4ZVPB 2AJ1A 5E7OB 1HWKA 2VU5A 3CVKA 4DX7A 2D74B 1N33J 5FDLA 4JBCA 2DHXA 5HAOA 2DH8A 5L38A 2IVMA 3GILA 2A2DA 1UVIA 2JWNA 4EO6A 2R7SA 1S1XB 4FVMA 1IKVA 3NBPB 2MMYA 4E98A 4KTQA 5A6WA 4Y2CA 3K89A 2PA3A 2XSFA 1PO6A 2XLJA 4MJKA 2EFOA 1VC0A 5ETLA 2M52A 1H0HB 4P52A 1H7XA 1SL2A 1K8AT 1ZA1B 4DL5A 3EICA 4HI1A 1TELA 1Y3JA 3ZO7A 4LRDA 1AYEA 5CYQA 2CJKA 2OEJA 3HX9A 2QL5B 4LSNA 2Z57B 3OXGA 2L41A 4PZVA 2DNZA 3UWTA 3RBZA 3NNCA 5EN1A 4QZVB 5K14B 1LXNA 2NZ4A 4KV8A 4ZHRB 5B0AA 1D9FA 3AOAA 4DPXA 2MXYA 1RHQB 2C22A 4JI7J 4G65A 4OIXA 3GU0A 3DM2A 3RZAA 3L3CA 1JLBB 5A8KA 2F65A 5LM7E 4C8OA 2GC8A 4NLXA 5CABA 5D15A 4XK8C 1FDDA 4U67Q 1S1VA 2ZJRQ 3NG8A 3ZZ0A 4ZLLA 2GQCA 5ETMA 4K4UA 2EK6A 3CMQA 1SJ1A 4C6AA 1SC3B 4J9NA 2HGMA 5J2MB 1WG1A 3CCQS 5HROB 1URRA 1DAXA 4ZJOA 3N9UC 2HHXA 1IBKJ 1ZTTA 2ROGA 2IC3B 2XS7A 4OHZA 4LFBF 4F4WA 4M8LA 4MIWA 2NSBA 1PILA 4B3RJ 2LXFA 1YVFA 3LAMA 2HLTA 1XQIA 1OSDA 4Y65A 5IM0A 1TTHB 4KHRA 4Z7YA 2KI2A 1AW0A 4LF5J 5J1EB 3AQPA 2WVDA 3BM7A 2JOQA 3C19A 3NXZA 2XMAA 2FDNA 3M8PB 4YB6A 4I7FB 2YX4A 2XLIA 3PO5A 1YRXA 4K0KJ 3VGSA 3QFHA 4DMZA 4DU7A 4EZ6A 3PNIA 2AV5A 1S9GB 4DUTA 5E3RA 1X4FA 2VKZG 4RNNA 1KLMA 1Q86T 1R43A 3UNYA 1QDUB 1HI0P 3M2VA 1CEZA 3BSCA 4RW4A 4WKYA 4IFVB 2FJWA 4ELTA 3J7AN 3JQMA 3X1LB 1Q1KA 2D41A 4G1QB 2A0FB 4DR7J 3R3TA 4PXDA 3THPA 2FJAB 4CLKA 4WZQA 2JC1A 3DLEB 1GFWB 3SZ2A 1F0XA 3DOLB 2M70A 3LPEA 4RBVA 2IBOA 2NXJA 2QG9B 1RQ0A 2IBKA 4USHA 4KYZA 1VQMS 4CH7A 3FFIB 4X4NA 3MFHA 5DDPC 1FO1A 5DDQC 2ZJPQ 5MAOA 2LLZA 3AOBA 1ZZNA 4DXLA 3T5KA 2W1BA 4WTOB 1IJFB 3P8BB 3MMAB 4QWAA 2GQ2A 2W24A 4LBIA 1S99A 3TR5A 3NS5A 4TU9A 1RTIA 2KVIA 2FQQB 3UD3P 3RAXA 4HH1A 2MLXA 2X1BA 2RILA 4ZPDA 1VQ5S 4P7TA 3LUYA 4F3MA 2KN4A 1RAGB 2BE2A 2VBZA 1YK9A 1HA1A 4WCEQ 1FJGF 2GS8A 1YDLA 4TQSA 2KH9A 5ETRA 3CO0P 2BJEA 4KO0A 1R6YA 4ZKAA 2XCAA 3HHDA 3KLHA 1M5HA 4K8RA 4WBFA 4O23A 2ZVSA 4PG6A 3I0SA 3EGVA 1RLDA 2RRNA 2DR8A 1RDRA 2B9XA 4QPTA 2PEHA 4L3NA 1UEVA 3F56A 2KHDA 1NMEB 2VPZB 1XR5A 3VGTA 1CJTB 4ELVA 1BHNA 1NRKA 4M5JA 3L7UA 4UW2A 3CGIA 3T1HJ 4ZPTR 4RNMA 4GC6A 5DLGA 1M1HA 5HMYA 1DLOB 1QJHA 2YNGA 1T7PA 1T95A 2KKHA 2PO4A 1FI4A 2BJ8A 3MMCB 2G13A 3Q22A 1KHWA 2BOPA 3TP2A 1UEKA 3M8SA 3WIVA 4WP9A 1BE4A 1OWXA 1MW7A 5KFCA 5G0RB 4DV3F 3V6DA 4DV6J 3WBZA 3SFUA 4DQRA 2ASDA 3QGPA 1HQUA 1HWLA 2P9GA 3VGVA 4ECRA 2ZC3A 1IKYA 3N6LA 1F5AA 1TVRB 3BB5A 1QUVA 3CD7A 4IR1A 2NXNA 2QYCA 4U7CA 5T14A 4Y28C 2XC9A 1ZZFA 4DG1B 1I94F 3DRRB 2JVRA 2AEMA 5ETOA 1KBRA 1NLKL 2KFNA 3SV4A 1XNQF 2CA9A 3IFEA 4PXBA
chains in the Genus database with same CATH topology
3KLFA 2VQEF 3T5LA 1RGVA 2VFRA 3HHLD 4IKAA 4FVCA 4ZHRA 3PW4A 2POKA 2V4JA 1RT5B 2CJBA 2AYEA 5KFKA 3NNHA 3QWPA 2R4FA 1BQXA 3LH2S 2B51A 3BSNA 2WB1D 3HVWA 4A46A 3FZBA 3KHGA 1NK4A 1SUQB 3RB3A 2JLFA 2QSWA 3H20A 4NA3A 5JVGQ 3PZPA 4XDCA 1ZM3A 2DCLA 1S72S 3BGLA 3W2VB 4NMLA 2RU9A 4UOCA 1U2RA 2YNHB 2EG2A 2RMLA 2ZD1B 1DURA 4K5SA 2MZSA 2VODA 4TU8A 1UVJA 2LEAA 5IWAF 3THTA 1S79A 4DV7F 3R1HA 2MSTA 4DLGA 1YJUA 3MTKA 3SCIE 1A7GE 1YJWS 3S6EA 2ILYA 2XMVA 4DEZA 1YITS 1XN9A 2QT7A 1LW0B 3IWLA 3I56S 4LF8F 1WEXA 5KFGA 1KS2A 1DQAA 4ED1A 4B9UA 2LQJA 4OLPA 4C8KA 1YJVA 1ZAVA 4Q0BA 3UD4P 5CZXA 2O5DA 4CTAA 3SDEB 5KT6A 2ALZA 2QA2A 3MM6A 3CC4S 2HNDA 3H4DA 4NLGA 3E2EA 4RNFA 2CQ0A 3OL8A 2YNIA 3KNAA 3UQSA 3PW7A 3HVRA 1M5VC 2V8VA 1T3NA 1VRTA 3OR2A 1B0VA 3IC1A 2IM1A 3PDNA 3RW7A 4FF1A 5I3UA 2LXUA 4NL5A 2ERRA 3RU0A 4HEA9 1QAXA 4KFBB 3MDFA 4FBTA 5LL6d 3T9NA 1X0FA 2VG6A 1M5KC 2YKOA 5C5JA 3IBWA 2DHGA 2VA3A 3ZZTA 1RTJB 2HLUA 3QAUA 3IRXA 2R8JA 3N28A 4Z2XA 5CHCB 3A8EA 1TK5A 3PEJA 1C1CA 1VGYA 2B5JB 4DL0C 2ZE2B 3RB0A 4AL7A 4RW6B 4YQWA 4V19J 2OPRA 4ZP7A 2HMIA 5HROA 2B6AA 2DIUA 3V6HA 3DYAA 3IG1A 3SMZA 2RF2A 4URSA 2DIVA 4BWMA 4KGKA 2PMZD 4RW8A 4PPZA 3LOUA 4QR2A 5AXKA 2BRLA 3I82A 4H54A 5HN0A 2ZHAA 1SJ3P 3IR5B 1Z4UA 1VQ7S 1RT4B 3M4XA 2IC3A 4JI3F 2KZZA 3OHAA 1F9FA 2NQPA 3NCQA 3BQ2A 4EUVA 2UVRA 2GHVC 4FNIA 4B08A 5A8WA 5E0OA 1JLCB 1S0OA 5F0WA 2N7YA 3FEZA 2PA8D 2RIJA 4OHVA 4JI0F 1HD1A 5E5NA 2XMJA 3KJVB 1HNVB 2C3PA 4I68A 5DJBA 2CPJA 1NKEA 4OL8A 4QYZJ 1ELOA 4QWEA 1S1WB 3GV5B 2DNNA 1ZM9A 4OMFG 3FEYB 3H59A 4ECUA 2VFTA 4PQUA 3VWSA 1WD6A 5L9XA 2FPHX 1FCAA 1U25A 2XNRA 3M8RA 3NNAA 4QIGA 1HQEA 2LU1A 4OI6A 1JLQB 3V4IA 2DPJA 5D4LA 3SV3A 1O0PA 1N4LA 1N36F 3MM5A 5J1EA 4URQU 4Q44A 2IVYA 1ZOTA 4WK1A 2J0WA 3I5CA 2W7PA 4KKOB 5EWFA 4OV1A 3M9MB 3DDKA 2NUUG 2E66A 3BGUA 3M8PA 4DS5A 1R7IA 3K7RA 4I7FA 3CCSS 4DL7A 5C42B 1HBUA 5C24B 3Q2TC 2Z8QA 1Y5IB 1NKCA 4PR6A 2MZRA 4JUZA 4K4WA 2OPQB 2JH3A 4DV1F 3AHPA 2AGQA 4BS2A 4N76A 2XS5A 4FYDA 1O51A 4KAIA 5HMWA 1VC5A 3CUNA 2IRYA 1XR7A 4ZK7M 4EBCA 1LWFB 1U1QA 1GH8A 2OD6A 1PC4A 5AXNA 4L6V3 3TA2A 5C25B 1SL0A 1L3TA 3LWLA 2DHAA 1EETA 3RAQA 3M30B 4NLTA 1N33F 2KFZA 2W8LA 5HLFB 3HXMA 3QPIA 3KHHA 2FHOB 4EBDA 2KRRA 3OL6A 1M5OC 2B4VA 2BM0A 2QLWA 3LWMA 2LQ9A 3OTOF 3TA1A 2DH9A 1REVB 3BN7A 3GWCA 3IS9B 4BCAA 7FDRA 2DRAA 4EZ9A 1S97A 1S9GA 2B0GA 2QIFA 5LMNF 3CWJA 3CD0A 1FTRA 3C46A 4GKKF 4I2PB 2DR5A 2VOPA 5LT5A 1IKWA 2E7XA 2DR9A 4DSEA 1S76D 3CDAA 2IJFA 2BUNA 1S1UA 1JNZB 4ES3A 3D5MA 4MAKA 4RX6A 3SQGA 3SSRA 2XGQA 3KLGA 4J9PA 5A8KB 2ZH5A 1NK6A 1VQLS 3M9NB 3CF5Q 1FNXH 3ETOA 3QGIA 4ZPVR 3TAQA 1HNZF 1FRJA 2O66A 3OTBA 3GG1A 1T05A 2QMXA 4C8MA 2D1CA 1MWYA 1SJ4P 4Q2MA 3KG1A 4AXIA 3PJWA 3POTA 3CULA 3AB2B 4ATNA 4ECTA 4IFVA 3LANA 3VAHA 3CCTA 4I67A 3RAMA 4XAKA 2O67A 1KEKA 3CPWR 1WELA 3GR0A 4R5PA 2BBEA 5KFMA 4RNHA 2DNGA 3M2RA 4G1QA 3OV7A 3AH6A 3RRHA 1H2TZ 2F8MA 2X51A 3GQCA 4C97A 2XULA 4LJMA 3S01A 1N88A 3QIPB 4DL2A 4OZ0A 1YG0A 3T6JA 4X62F 2YKNA 1LOUA 2J8AA 3DLEA 4PXEA 4DV4F 1RTHB 1KVIA 3Q8RB 1VQ9S 5AE2A 4RUAA 1YJRA 3T3FA 4DUYF 1R8AA 2ZZNA 2OP5A 3SCKE 3IWXA 1X9SA 2DGWA 1JLFB 3PFEA 5KT7A 2J76E 2EC0A 5KG6A 5T7LA 4Y34A 3KFWX 4YB1P 5DDRC 1BQMB 4I64A 1S0VA 3PVXA 1NNDA 2X3GA 2UXCF 3CC2S 1FKPA 2IHR1 4ECZA 1F5CA 5JJBA 3I87A 5KFOA 3MR6A 2K8GA 1DTQA 3LP0B 3K5NA 2EVZA 4GKJF 3CO9A 1Q78A 2QZ8A 3D1OA 3FFIA 3WZ0A 1LXJA 3MZIA 4EFAC 5H9EJ 3CCJS 4IO1A 1VK3A 4NLDA 1BGXT 2VKRA 1NAQA 4CO2A 3IWNC 2BABA 1SC6A 4X4SA 2Q6BA 1L3UA 2MHEA 5FIIA 3AA9A 3UR0A 1R8BA 1RISA 4ELUA 4C11A 1D9AA 2MHNA 2C3UA 4H4MB 5B7WA 5J2QB 1FEEA 2RKIB 2XNQA 3MEKA 2LDYA 5T41A 4RUHA 3I96A 3CCVS 2JEFA 3JSMB 2R7XA 4UQGA 4Q5VA 3T19A 3PX6A 4JI7F 5DG8A 4B9NA 3DU6A 2PE8A 5B09A 5CYMA 5F3TA 1TV6B 3DI6B 1KQSR 2BJDA 1X4CA 4IH7A 4TY8B 3OJUA 2W9BA 3MWBA 3LPYA 3C66A 2VC1A 1T8EA 2I8EA 1CPZA 3EYZA 3CJ3A 2ILZA 4IG3A 3E01A 4MFBB 2DNLA 1IQTA 2ASLA 2R7OA 3J7A1 2VZ9A 4KBIA 3HPOA 4LF4F 2ZBCA 3D0HE 2WBMA 4GO7X 1WHVA 2V9WA 1F2GA 3VAKA 4BHQA 3DLKB 3TUZC 2E44A 3ZZZA 5LJ5Y 3EPGA 2YX1A 4F26A 3MCSA 2BQUA 4DSKA 1DQ9A 1YGYA 3H98A 4Y2KA 4XDDA 5I3PA 1TL5A 1Y5LB 2V9KA 3J7YI 3QIDA 1SJRA 2UU9F 4A8WA 1FXRA 4HI2A 4MIAA 1YIJS 4WE1B 1NH8A 4O3NA 2KT3A 2XLKA 2KG0A 2C2RA 1UVNA 5K8NA 3OHBA 4G1IA 5EUHA 2AJ0A 1KFSA 4TXSA 1T03A 2NR0A 1MU2A 3UCGA 4F2RA 2ZDPA 3PHEA 3SI8A 3CT9A 3S7RA 4DL6A 4ZPBA 2F8EX 4JV0A 4QWBA 4LIWA 3D0GE 1K0VA 4EWTA 3H4BA 2BVZA 3RBEA 1SJFA 3GIKA 2GJ2A 3ISZA 4WZMA 3CD6S 2MY8A 3DFEA 2DGVA 4V19X 4QWCA 2R2SA 2ZUGA 4LFCF 3TVZA 2CQ3A 1RA6A 3DRSA 2VBYA 2UXBF 4QR0A 1C1BA 2UUWA 3DC2A 3PM9A 1G2EA 2AYGA 5H9FJ 1J2VA 1RA7A 3MEGA 3R5BA 4A8YA 4RU2A 1B0PA 1S4FA 3MHYA 2XMWA 3NLCA 5KFSA 1RT6B 5B0BA 1QSSA 2GV1A 3KMSA 4HTJA 2B43A 3O5TB 4C4WA 5GADI 3HT3A 4K4XA 1SV5A 2FVPA 4CNYA 2ADBA 3BREA 1ZTWA 1FKOB 3TUJC 1OO0B 2QO3A 2UZAA 4RZRA 5KG5A 4DSLA 4OZNA 3K59A 3N5FA 4J9QA 2QE5A 3HM9A 3WX4A 4DBQA 4C3KA 5L1IA 5MLCV 1A6LA 1R31A 2BRKA 4MYUA 1UP1A 3KK3B 3ITHB 2W4DA 2NPFA 5A8RB 1LK7A 1FD8A 3KG0A 5KTQA 5KFFA 3JYTA 4W92B 3VQTA 2YWGA 4I2QB 1NJZA 3HHNB 2YKMA 2U2FA 2YNFB 4LF5F 3BGRA 3HVTB 1U1KA 2XSJB 1LW2A 4O44A 1GQEA 5KFRA 2LA6A 2XMTA 2M4MA 5JVHQ 2MJUA 5KOWA 1L3KA 2QV6A 4OX9F 2OO4A 4OI0A 1SH3A 4PPDA 2FVCA 2CZVC 1RT1B 5F8IA 1JLEA 5KFBA 3PW5A 1R0AB 2MDAA 1J5OA 1HR0F 1VQ4S 2HQ3A 1DTTA 2P9CA 5B0CA 3TVKA 1DLOA 3CJ0A 3C3LA 2DNOA 2FJEB 4LVOP 5IQQA 1N5VA 3ZZPA 1VBYA 1QAYA 3D1QA 1H2UX 1LWCB 3FEXB 4FPRA 3ZZOA 3JSBA 3CEDA 4ZP9A 2J6TA 4NYZA 1HW9A 5F0UA 4K0KF 3QJLA 4ECSA 2EG1A 3MR3A 4HHJA 3DU5A 5CA5A 3MMCA 3L09A 3IRWP 6FD1A 3BF4A 1S1TA 2RUGA 1JK9B 4QIFA 4P2SA 3VQSA 1HBMB 1VHFA 1JKHB 3SCLE 3G8QA 1ZBTA 4C0HA 3E51A 4JI6F 4IH5A 1FT8A 1RKIA 3N5BA 7FD1A 2FTRA 4IOAQ 3KLIA 3K0JA 3TARA 2ABYA 3GE9A 2KJVA 3N4WA 3SEOA 4WU2A 2K7KA 2ZOMA 4ECVA 1FNOA 2NSCA 3CD5A 5E3PA 4ZVHA 5F9LA 2IMOA 2HQIA 3MOJB 3RTVA 1M5SA 4KB7A 2HWHA 3Q8QB 3M6WA 3J7YU 1VQKS 2LECA 1HI1A 3U7JA 2JEJA 2XMMA 4LVNP 2FLNA 2J0QD 1FDBA 3MR5A 3OW2R 5FLXY 1LK5A 4DHVA 2ZJQQ 1ULRA 3H25A 5EWEA 3J7Z5 2XWXA 2IVFB 2CPFA 2UUCF 2GCFA 3MECA 5KT5A 1NK9A 2EFVA 5IQ6A 4UY8T 4YDXA 2XMUA 3FJ2A 3OXLA 4LT6A 1TVRA 1TKXA 3H2VE 3HHKA 1S6QB 1V3RA 4DL4A 1IQZA 5DETA 5M2PA 1RKJA 3AJ2A 2W4PA 1NJXA 3T9ZA 2FVQA 3B4DA 3VTIA 2HS3A 2RJZA 3NCPA 1JXEA 2Z2LA 4DG1A 2CFXA 4DR7F 2DNPA 1SL2A 2JDJA 2OPSA 5IT9Y 2KXHA 3P3DA 3DRRA 3PX4A 2A2CA 1R27B 1YRTA 2BDPA 1KTVA 3VF0B 1JIHA 1FNMA 1W25A 2LVWA 5GADU 3UDLA 2AD9A 5HO4A 1VC6A 5B0EA 4K59A 4KO0B 1S6PB 2ZHOA 4RKUC 3FDSA 3SSQA 3PKYA 3R27A 3V81A 2CDQA 2EBGA 3M2UB 3M32B 4AE5A 3CTRA 4M63A 2ZZMA 1ZETA 2NPIA 3OR1B 2YWHA 3DCAA 3KWMA 4Y3CA 2JLGA 2J7KA 4I56A 2P6SA 3NRBA 2DNKA 1KSPA 2HWIA 1RT5A 4IDKB 3I5BA 3A1YG 5THWA 5KFTA 5KG1A 2GFFA 4QR1A 2R7QA 1JX4A 2AJ4A 1OPZA 1SUQA 1KTQA 2L9NA 2A3JA 4DJBA 3CMES 1FXDA 1QVGR 4WFNQ 1E6YB 1VBZA 3W2VA 5KOXA 5AJ3F 2Y1IA 3AQOA 2WHOA 1HBNB 1WEYA 2YNHA 1UA0A 2ZD1A 1OS5A 5DLFA 2R7VA 4M95A 3T1AA 1U09A 2UV8A 1TKZB 1D1UA 1GT8A 2FB0A 1LFWA 1SIZA 3HHLB 2O1PA 1WHYA 1S77D 2C2EA 5LSLA 2K1RB 1SXLA 3H2UB 3IGNA 4PKDB 5DQIA 1VI7A 2Z0GA 3J81Y 3CIMA 1HMVB 1LW0A 4JV2A 5BJRA 4QYRA 4C2MA 4F2SA 4NXMF 5DGBA 3M6VA 2XY6A 1VOMA 2QMWA 3C6UB 3IO1A 2GA7A 3FQKA 4ZVGA 5IS2A 4TYBA 1JB0C 5F8MA 3HKWA 2GW8A 1D9DA 2XI3A 1GTEA 1Q8LA 1XR6A 2OSQA 3TAMB 4YR0A 3SDEA 2PC6A 4DS4A 1HHTP 2VPYB 3OXFA 2XCPA 2R8KA 1NU4A 5B0DA 4EYIB 3EXCX 1T02A 1N5QA 2JL9A 2V94A 1HPZA 4HH0A 3HF5A 2VG5A 3I9V9 2I9SA 4KGMA 4XIUA 3B82A 1RT3B 1UA1A 2AJFE 1U6FA 1XMQF 1NZAA 5J2PB 4KFBA 5KFYA 1FHTA 3KYLA 1C0TB 4C98A 2HNZB 4A8KA 1N8RT 4DSJA 2DNMA 3THVA 4A8QA 5CYJA 4OJHA 3DN9A 5K14A 1RTJA 4U9RA 1NK8A 4OJGA 2HHHF 1Q79A 1U24A 3QWUA 1Z1ZA 2RB7A 5J1PA 3LP2A 3PRDA 3G6ES 4G3IA 4WJBA 2B5JA 2ZE2A 1TKDA 3M6XA