4ID8A

The crystal structure of a [3fe-4s] ferredoxin associated with cyp194a4 from r. palustris haa2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
LTIHVDQDKCQGHARCKALAPELFDLDDYGNAHEKGDGVVPADLIDKAWLAKSNCPENAIDITED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Putative ferredoxin
publication title The structure of a novel electron-transfer ferredoxin from Rhodopseudomonas palustris HaA2 which contains a histidine residue in its iron-sulfur cluster-binding motif.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13459 Fer4_15 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4id8A00
1Y5IB 3MM8B 5FD1A 2WB1D 2UZAA 2C3YA 1FXDA 1FRMA 3MMCB 1F5CA 1JNRB 1BLUA 3HKZD 3OR1A 3IR7B 1BC6A 1C4CA 4Y28C 4YDDB 2O01C 1C4AA 2FGOA 1FXRA 1IQZA 2FJDB 1K0TA 1H0HB 1XERA 2FJAB 2VPXB 1GT8A 2C3OA 3MM7A 3MMBB 3MM6A 4OMFG 4XDDA 3IR6B 1SJ1A 2VPYB 2PMZD 1FDNA 1FTCA 3EGWB 1B0PA 2WSCC 1DURA 1FRKA 1FRIA 3MM8A 1FERA 1B0TA 1FRHA 1G6BA 1F2GA 3EXYA 2V4JB 3PNIA 2VPWB 3IR5B 1PC5A 3OR2B 1JNZB 4KT0C 4CI0B 3MM5A 3LW5C 1BQXA 1FDBA 1PC4A 2PA8D 3MM9A 1AXQA 6FDRA 1FRLA 3MMAA 4RKUC 4L6V3 1DFDA 7FDRA 2C3UA 1WTFA 2FDNA 2XSJA 1FCAA 4XDCA 2FJEB 1VJWA 1JB0C 1Q16B 2C3PA 2PDAA 1Y5LB 3OR1B 5BYQA 1KQGB 1IR0A 1D3WA 1Y4ZB 1GAOA 2GMHA 7FD1A 1H7WA 2GMJA 3MMCA 5E7OB 1FD2A 6FD1A 1H7XA 2WAQD 1FRJA 1HFEL 2C42A 3MM6B 1SIWB 3MM7B 1FEHA 1FDDA 4OV1A 1RGVA 1KEKA 1BD6A 2ZVSA 5L8RC 2Z8QA 5CHCB 5BYRA 1GTEA 2WSFC 1Y5NB 4AYBD 2VPZB 3MMBA 1BWEA 1DAXA 3MM5B 1G3OA 1SIZA 2C3MA 1B0VA 4ID8A 1A6LA 3MM9B 1CLFA 1GTHA 1ROFA 2IVFB 2V4JA 1R27B 3EUNA 3MMAB 2FD2A 5CH7B 4DHVA 3OR2A 3GYXB 1FDAA 2V2KA 2FJBB 2VKRA 4XK8C 2XSJB 5BYSA 1H98A 2Y0SD 3C8YA 2WSEC 1FF2A 1KQFB 1FRXA 1F5BA
chains in the Genus database with same CATH superfamily
4LF9F 4TU8A 3ZZZA 5K20B 1ZZFA 4J9VA 1J5OB 1XWLA 4WZQA 2YWGA 1R0AB 4N47A 3NEKA 3SSSA 1PAUB 1NB2A 3R7BB 4OYOA 4JV1A 3DMJB 4PYAA 1SH2A 1UMJA 2CQ2A 3EZOA 1SJRA 3N6MA 5IXUA 1IR2A 3RBXA 4R25A 2IM2A 2VUGA 3O1LA 4F4XA 1U0HA 3ONQA 4ZVUB 1WNEA 4M5IA 3FMWA 2W24A 2HWHA 2GC8A 3PO5A 2FYXA 3GFHA 2ADBA 1UEVA 1JXEA 3EDRB 2R7SA 2ROGA 3JYTB 5KFMA 4ETZA 1WEZA 3LH2S 2IVMA 3CUNA 4OZ0A 2CWKA 3GYXB 2FJBB 1H98A 1Y9OA 1U1KA 4EYIB 1F5BA 5FD1A 4WIQA 5E0OA 1SJQA 4OI6A 3LO3A 4DPUA 1T11A 3A1YG 4B9VA 1TU0B 3N28A 4M5GA 3VAJA 2VG7B 5F8JA 1N33F 2YKMB 3CD0A 1IBMJ 1WC3A 3M30B 1S0VA 1DURA 2BBEA 3KLVA 3LGNA 4JV5F 2UU9J 1NDCA 1WD6A 4LF8J 2VQFF 2PA8D 5D3GB 5AXLA 2YQ1A 4U67Q 4UQTA 1B7FA 1PJ6A 1AZSB 1S59A 4M5DB 2V8DA 3ENQA 3R7NB 2F63A 1CJUB 1U26A 2CPEA 1OY6A 1UVNA 4ZP7A 4RNNA 2W7AA 4KSEB 3IN5A 1HBUB 1HQEB 4JI4J 3R3TA 1A0OB 4HT7A 1ZA2B 1JQGA 1R27B 3MF5A 1VQ7S 3MAQA 3W61A 2ZD1B 3LANA 4O3NA 3CEDA 3L7PA 4DUZF 1JLCA 2WB1D 5J2MA 4PXDA 2BW2A 5ETPA 1NK9A 1RP5A 2DO0A 1FO1A 3CGIA 5EX3A 1BQNA 3IBFB 2C3OA 1RE1B 3DGPA 5EWEA 3H4DA 3NS5A 4K0KF 1RT4B 3W2WB 5HO4A 1VK8A 4DV0J 2R2RA 3BV8A 1SB6A 3C6TB 4KO0B 4JBCA 3QT6A 4RO0A 2C22A 1VLYA 1RT7B 2QTWA 3GYNA 1GH8A 1KR4A 1YBUA 1Y4ZB 2QMWA 1ZOTA 4CLZA 3FSIA 3M8WA 4NWBA 1UCNA 2RJZA 1S5ZA 3PM9A 2XMMA 5LMUF 4AYBD 2GW8A 2EKNA 4RW8B 3RRGA 5HMZA 2ZM6F 1HNXF 3MCNA 2DIUA 2IVFB 4K2XA 4DDFA 3UDVA 1FXLA 5F8IA 4ZCMA 2CAJA 3OHAA 5A0YB 4A47A 2CADA 2BEFA 3KUHA 2PD1A 3LF0A 5KFQA 1VS3A 1XK8A 1RT2B 3E01A 2QYGA 3RBEA 3ZO7A 3TOQA 1RWOB 4LR7A 3MWBA 2HQ3A 2UVWA 5THWA 1KTVA 1QY7A 1ZTTA 4M5NA 3RB6A 4OV6A 3MAAB 4GO7X 3G6YA 3H42A 1VQNS 5K8PA 4CI0B 1MSWD 3PW5A 4FDFA 4LF6F 1SJ3P 4FF1A 1QVFR 2J6SA 2K3KA 3PRBA 4AQYF 1X4AA 3Q83A 2C3UA 1SPBP 1YRTA 3BBBA 2YNFA 3DM2A 4N56A 2KRRA 2DBBA 2XCPA 2BE7D 4KHPJ 2QA2A 3K2YA 5CAAA 1N36F 4LF7J 1IKVA 4IFYA 1DLOA 1RK8A 4HHHA 5DO2A 1R8CA 3AQOA 3KJVB 1G7CB 4LSZB 4B9UA 1SKRA 3D0GE 1BY9A 5IM0A 2V4JA 1KKHA 3ISND 2X7IA 2JL9A 1K73T 3S01A 2E9TA 5JMNA 4KYZA 2DR9A 1C0UB 3QNWB 5ETOA 4FXVA 1PYTA 4LUBA 1HBNB 1UPPA 3OTOF 5DZ7A 2UXDF 2OPSA 5F41A 4FBTA 1RAEB 1S1TA 1T94A 1HD0A 1J2VA 2IIHA 3POTA 1XEZA 1E6VA 3D6MB 4C8KA 4QWCA 3PR5B 2YWFA 3DU5A 4RX6A 5DGAA 3IA0A 1OYEA 2ZHOA 2CG4A 1WTFA 1TL5A 1LEOA 2J0WA 4A48A 3JQMA 1SXLA 2VBZA 2GIFA 2V2VA 1K8AT 1J27A 3DCAA 3EE3A 3ZTPA 3QLHA 4J9QA 2HQCA 4UOHA 1O6XA 3HPOA 1RTJA 3QATA 1GX6A 2V2QA 4GVLA 4ED3A 4UF4A 4N5SA 4RW6B 2WRMA 2CXEA 1SBRA 2E1PA 2A6OA 2FD2A 3KTQA 2HMIA 3ICLA 2AJ2A 1IKYB 3A4TA 5H9EJ 5J1PA 2CQ4A 1EP4A 3JSRA 1QE1B 3TYTA 2PFDA 3DOKA 4KKOB 2M3DA 4J90A 1QAJA 2MB0B 1RTIA 3GSDA 3E51A 3MM6A 5HBMB 2HNZB 2WVDA 2EFOA 1XR7A 4IH6A 1F2GA 2XWXA 1NHUA 1FT8A 4NI2B 5BXIA 1QUVA 2YY3A 1Q78A 2D9OA 4EI2A 4L6V3 1S1VA 2LQBA 2D9PA 2ALYB 1VJWA 5KFNA 3M9OB 4DFKA 3I0RA 4NZ6A 3OTCA 1KLMB 5CCLA 1KD1T 1J5OA 2DPJA 3KLGB 1ZM4A 2IMOA 1TUVA 2JC0A 4FKXA 2XBPA 1R0AA 3PKMA 1HNWF 4ZVFA 3DLEB 5DGBA 3HM9A 2QFJA 4QWDA 3Q2TC 3JTNA 2WOMB 2B9EA 3DMJA 2E5HA 2LU1A 2IRYA 1IQTA 4LIWA 3KNAA 3LPEA 4JB8B 1OQ3A 1T02A 3IWXA 2IM3A 1NKBA 1PYOB 3D1OA 4Y28C 4B3MF 3H2VE 4MYTA 1WKLA 2DKOB 2DHHA 4DSEA 3RBDA 1U2RA 4DX5A 1PJ7A 1TL1B 4F0KA 4DL0C 1EX8A 3JYTA 4YMEA 2XGPA 1AYEA 2P9CA 4FXWA 4MMOA 1VGYA 2F9JA 2IAJB 3Q2SC 3HMJG 5A8WB 4K4YA 4EU0A 5DJBA 5B09A 2WAQD 3RAMA 4GKKJ 3Q8SB 2HS4A 4X4OA 3K8WA 4J9SA 2VG7A 2WB4A 2DY1A 2YKMA 1EQ0A 5IC4B 3QIPB 1TMJA 3M30A 3LTOA 3TEHB 1Z1ZA 5IZHA 2DJWA 2OD6A 5D3GA 1DZ5A 4NXNJ 1FWPA 2D69A 1AZSA 1N6QB 3VCDA 2VBXA 4M5DA 2ZE2B 4W90B 4F8RA 3H8YA 3M8PB 2XS5A 2V94A 1CJUA 5GAGU 3NLCA 5KT3A 1O5JA 3OFEA 5KTQA 2NSCA 3THTA 1M5HA 2HHVA 3DLLQ 1B3TA 1FDNA 9ATCB 1HBOB 1HBUA 1HQEA 1KS2A 4HHUA 4P7VA 7AT1B 3SFUA 1HYSB 3NGDA 1T9XA 2ZD1A 1NSKL 3BM7A 1TAQA 1C1BB 3OVAA 3OR1B 1HL6A 3C3LA 1SQEA 3VF0B 1GNKA 1LWFB 4PG7A 3W7BA 3TZXA 1LWEB 2EPIA 2HK3A 2MKCA 2RILA 2CUYA 1HWIA 3ULHA 4DOZA 4YS2A 1RT4A 3W2WA 1YJUA 5J2QB 1HHQA 3MEEB 3C6TA 1IVZA 4KO0A 4MAKA 2Y0SD 3OL6A 1R31A 1RT7A 3CO0P 3UO0A 3MCOA 2ZJPQ 3FGVA 2CRLA 2HFSA 3T5KA 4ZCIA 1P6TA 2XMWA 1U1NA 2FLLA 2M88A 4EUVA 3QWPA 2VC0A 2AIRB 2HRYA 3EGVA 2QA1A 4RW8A 3QJLA 3OHBA 1N56A 2FB0A 6FDRA 1F3FA 2XMVA 3O8WA 3W3SA 4FF3A 3GYGA 2HGNA 5A0YA 2DGQA 2EG1A 2O66A 5LXYA 1D09B 4JI4F 3C46A 1N32F 3ZZYA 4Q45A 4W98A 4LRFA 1RT2A 4JYAF 3R27A 4DUTA 1YI2S 3DKDA 1RHQB 2AQ4A 2E5JA 1YDLA 4RUBA 1IBLJ 2FVRA 1BD6A 2E5GA 2UXCF 2PC6A 3MAAA 2XM3A 2I5JB 1Q8LA 2EFNA 3DHWC 2MGZB 4DV7F 4OYZA 1UAWA 2B51A 3TA1A 1URNA 4A8XA 4L72B 3GJQB 4ZDNA 4PXCA 3KKFA 2BV3A 1X4DA 5SUHA 3CPWR 4DSJA 1RU1A 1S0MA 4YB1P 3KJVA 4LF5F 1U1QA 3MM8A 4F0MA 4Q8EA 3H5YA 3RYLA 1YBTA 3OQ2A 2IRXA 1OYDA 4J7CA 2LCWA 3NNAA 1ZPWX 2XGQA 2OFHX 3R8YA 2ILYA 2AGOA 1C0UA 2VFTA 3T1HF 2UXBJ 2MQLA 1LV5A 1HBNA 4OV1A 4ZLNA 4C6AA 2ZVIA 1HI0P 5E3QA 1F5AA 2QRRA 4NRUA 4YDXA 1IKWB 1Q5VA 3J7YU 2FHJD 4DLEA 1UP1A 3VVTA 2V6AA 1RHKB 1W26A 2YKPA 3OJUA 2HVDA 5AT1B 2B4UA 4YR0A 5C42B 5EWGA 3T6JA 5AJ3F 3VTIA 1MROB 3I82A 2ZC3A 1I94J 4KPYA 2YXLA 4K5SA 5HQLA 3EXCX 4M5MA 3RR8A 3OT9A 1KBRA 3TAQA 3M4XA 2V9WA 4HI1A 1LK7A 2A10A 3HHNB 5EX0A 3CE8A 4RUAA 1HI8A 2DGTA 1N0UA 3GFZA 3H5XA 4OZLA 5HVFA 1X31C 1X4HA 3T41A 1VC0A 4RW6A 3UN5A 3QZ7A 3T9ZA 4TVAB 1IKYA 2OHDA 3AB4B 1P8GA 4A8SA 2HHWA 4ZIWA 1QE1A 4P2FA 1DHMA 2BRKA 4ZJOA 1KP6A 4KKOA 3G87A 1RYRA 2L3MA 2CPXA 2XQCA 2UUTA 4TLRA 3TRGA 5CHCB 2RSQA 2ZWPA 5HBMA 4CO2A 2HWTA 1BWEA 2QLWA 4NYOA 2HNZA 3MPYA 2L9WA 1T9YA 4B3TJ 2RHSB 4RJVA 1UW4A 1U8SA 4NI2A 2BE9B 1RT6B 2KG1A 4OI2A 3S6EA 1IBKF 3UVJB 2J6UA 5CYMB 3DRPB 2QA4S 3DLJA 2PMHA 4IYQA 4O44B 1TK5A 2E5LF 3KK3B 1A9NB 1UVLA 3D0IE 3PX4A 1KLMA 1BUXA 4I1TA 3AD9C 4DQQA 5DLFA 3KG4A 3KLGA 2UUAF 2RAQA 1KHWA 5IV3A 2W9AA 2FLNA 3T5HA 2JFDA 1QM9A 3DDKA 1B70B 4YR2A 2H5JB 3DLEA 4FYYB 1FERA 3ITHB 3IR5B 3ZTOA 3N01A 4PEOA 2WOMA 3W1YC 1Q7LB 4O23A 2OPQB 2RUSA 2IBKA 2Z2ZA 5HMYA 4MFBB 4TY9A 3U1MA 1FD2A 2ZEJA 5LT5A 4C3KA 4PQUB 3OXFA 1IM6A 4W4MA 1Y0HA 3G71S 2HHXA 5L9XA 4X64F 2CFXA 4OLOA 1VRUB 3U7JA 2ZHAA 4M1KA 5LSLA 4HL9A 3BJYA 1TL1A 2DNGA 2YTCA 2Y9HA 2BM1A 2FZCB 3KYLA 3V6JA 3O5TB 3FNNA 3H5UA 2IAJA 2AX1A 5A8WA 4GRSA 4OIXA 2IM0A 5KFYA 3R1HA 5ETNA 4OL8A 1T95A 2FPHX 3FRYA 2BZ2A 1DRZA 1LW2B 4BC9A 1QUPA 2GV1A 2CZ4A 3QIPA 1RTDB 3AD8C 1FDBA 1RHRB 2AD9A 4OZJA 3PJWA 1VOMA 1N5VA 1HW8A 2HZCA 4C3LA 4A8YA 3GIIA 3D67A 1Q82T 3MR3A 3HT0A 4K4ZA 1N6QA 1WOPA 5E7OB 1YRUA 2ZE2A 5D6GA 2HVHA 2XMUA 4UQGA 4DV3J 3M8PA 3A8JA 2UUCF 2VQEJ 1M90T 2B4OA 5KFCA 3GG1A 3BKTA 2JFKA 1TKTB 1KQKA 1RSCA 1HBOA 2DNPA 3GONA 4F04B 1M1KT 1ACMB 1SQFA 2IA6A 4ITSA 3UDCA 2AJQA 1L3KA 1MWYA 1HYSA 2R7XA 4F25A 4IOBA 1C1BA 3OR1A 2BW7A 2XI2A 2VB6A 1JX4A 1JJCB 5KFEA 1LWFA 2BQUA 4P10A 2OFGX 5IT0A 1B99A 3KMSA 1LWEA 3E2EA 2V50A 2V4QA 4WIIA 2WSCC 1ZS6A 2Z56B 1WDTA 3RR7A 2GAGC 2D3O1 4DEZA 5J2QA 1DFDA 3BSAA 2Z4PA 3MEEA 4F3QA 5HMWA 3T1YF 3W60A 5D4LA 3BS9A 1TL4A 1N88A 3CJTA 3AJ1A 4RNMA 4LF1A 2DNHA 3GIKA 4QBUA 4FPRA 3G8SA 4NXNF 5K8NA 3PYFA 1FFGB 3HVRA 5HATA 2I38A 1S6QB 4I64A 4ZPBA 3EUNA 2R8JA 4RNHA 1R6VA 2ROPA 4K4UA 4MYUA 1WHWA 4CO3A 1VQPS 2XSJB 3I5CA 1ZBTA 2WW4A 2CQHA 2EWHA 3RBZA 4QZVB 2DR5A 4RW7B 1OSDA 4YDDB 4NE9C 3GILA 3NBPB 4K4XA 4Q7AA 1KOHA 4L75A 4P7TA 3BF4A 3T19A 5KAKA 3NGTA 5B0FA 3IR6B 5KT7A 1ZAVA 3J81j 2CPIA 4LRAA 4QWBA 4J9RA 4KFBB 2DYAA 3QFWA 3NL0A 2V69A 3V6HA 1BQXA 5DDRC 4HDHA 2WCXA 3T3FA 1YX2A 2I5JA 4K4TA 4Y00A 3Q8QB 1GMWD 3S1TA 4YUDA 1Q16B 4G1QB 2D3OR 1KVJA 1UVMA 2VFUA 4OYBA 4ZPCA 2D7SA 2QJ3A 4WBFA 4ATNA 4ZN1A 4KIAA 1CC8A 1KHVA 4KPCA 3PKYA 1WHYA 1M5SA 2NXCA 3NG8A 5HL7Q 4WYLA 1UJ5A 5IFMA 2LQ8A 2HSEB 2ROEA 1RAOA 3LP2B 1PCAA 3T9NA 4L3KA 3MEKA 1R6YA 4MKAA 4OJHA 3W66A 4LQ9A 4JP8A 1OY8A 1Q53A 1FFWB 2MKJA 4M5LA 2RRNA 4C7QA 3P6YC 3PXGa 2B43A 5G4DA 3EXYA 1PC5A 1IKWA 3EM1A 1S10A 4EYHB 3D3CJ 5KG2A 3NAIA 2ZZMA 1VDHA 3MHYA 2VV5A 1U6BA 3K7RA 3DDNA 3SSQA 5C42A 4LFAJ 2AT1B 4UZCA 4OX8A 3HI9A 1XIQA 1MROA 2C42A 1FDDA 4UY85 3KHGA 3I0SB 3AAWB 4X2BA 4ZP8A 1SC6A 4ZK7M 1U1LA 3AT1B 2HGLA 1PJ5A 2VKZG 3G6XA 1U49A 2NYIA 1W2BR 5HQ8A 4KTQA 2JLEA 2CJKA 4DCOB 2XLJA 1UVJA 2LFVA 3MMCB 2F4FA 1YBAA 1WOSA 4WP3A 4CDIA 2G4BA 4C8NA 3M2RB 3GV7B 1NO8A 2ZNYA 3MCMA 3K5NA 4B9NA 2MEWA 2KZMA 2KN4A 4EGLA 2QIFA 5AE2A 3N6NA 1GEHA 2QFIA 2MKKA 1NDPA 1KONA 3AHPA 3OFHA 2F8EX 2CVIA 1F6TA 3U1NA 1RT6A 2BJ8A 3M8SA 3UVJA 3ZZTA 3V81B 4ED0A 5JVGQ 1FTRA 2P5VA 3DRPA 1GXLA 2GMHA 2LDIA 4O44A 4PG5A 2YKQA 3MPUB 3KK3A 1NB7A 2K2PA 1CEZA 5GAHU 4DQRA 4L3NA 1T7PA 4I0WA 4DBQA 3IFEA 2VDHA 4U8VA 2PFFB 4CM2A 2WSFC 2AP6A 4K50A 2HEKA 2VASA 1RWWB 1CSJA 1Q8KA 2DISA 3ITHA 5HQMA 1PSDA 4DU8A 3AD7C 1YKWA 3FDSA 4K59A 3Q8YA 4RBTA 4NEYA 3T1AA 3H2LA 2OPQA 1XNRF 1PG5B 1TV6B 3O3LA 3BBFA 1TK0A 1C4AA 4MFBA 1BQMB 3LWLA 3EX7B 2H54B 4XPEA 4PQUA 2D3ZA 5KFFA 2J9EA 4N7TA 2Y8YA 1FKOB 4IQXA 2LXIA 2YNHB 2HPUA 4QYRA 1GXTA 1RAFB 2MZ1A 5KG5A 4QW9A 4IOCQ 1P9QC 2KZZA 3NS7B 1VIOA 3MEDB 2BDPA 4F3OA 4A8WA 1TQLA 1S48A 1RT1B 1FVQA 3M6WA 3ZZRA 2YWEA 1N54B 4J9KA 2P2CB 3DI6B 2ASYA 4RZRA 2EC0A 3J7Z5 2Q1LA 1LW2A 2A3JA 4ID8A 2PO4A 4DV4J 3PIOQ 3AB2B 1RTDA 2V2KA 5FDLB 3P49B 3T5JA 2W4CA 5KFOA 3P8BB 2V63A 4P2SA 4DR5J 5B0DA 1S7HA 3SCLE 1G4CA 2KHDA 2CQDA 1RLDA 1UFWA 1N5SA 1LXNA 4NLYA 1V9OA 3FQKA 1TKTA 4ZHRB 4J91A 2ZDPA 1CS4B 2E1RA 4WTYA 1VJQA 3BQ1A 4NA3A 2VD3A 2BE2B 3R5BA 3JQKA 2E7XA 1H38A 2IYGA 4Q0BB 2KXHA 2B4PA 3PR4A 5KT6A 3CJ3A 4X62J 4UTGA 3BYRA 1NRKA 1ZZNA 2VG6B 4J5OA 2JEFA 4W92B 1GTHA 1U24A 2GNKA 3KWMA 3PCOB 4ED7A 3OXLA 2L9DA 4B3RJ 2ZBIA 3NWGA 1ZTWA 2UUBJ 2HKEA 3CC2S 3CCES 1WG1A 5F3ZA 1D9FA 1GX5A 1NSQA 4NLGA 4CO5A 4R8UB 4YOEA 3IP0A 2J76E 2W8KA 4OHZA 5GAEI 2WVBA 3R6LB 2X1FA 2FZKB 3J81U 3EZ5A 5D0RA 2XC9A 1S6QA 1FRLA 2MLYA 1IM4A 4PUOB 4BC7A 5CABA 2XSJA 3O6QA 5L39A 2R4FA 3R97A 1U25A 1SUQB 1TMMA 4RW7A 5GADI 1C0TB 3TQ1A 3CCVS 4A4JA 2QMXA 3NBPA 1U6FA 1RGVA 1KEKA 5L9NA 1RU2A 3GIJA 4DL2A 3DC2A 3PHEA 3BDPA 2XHWA 3W8PA 3QFHA 4F50A 4DR7F 1WJ9A 2V2ZA 4WKRA 5H1SV 1URRA 4KFBA 4OX9F 4LF4F 1WC5A 4G1IA 1WHXA 4DL6A 3FSXA 2ZBCA 3QAUA 4LF9J 3I32A 4DR1F 3Q23A 4G1QA 1W2IA 2PMWA 2AJFE 3GLJA 3BZQA 3VAMA 2GHPA 4N8NA 4DV1J 2QZ8A 4LR9A 2OEJA 1O51A 1JWWA 3F56A 2O5DA 3QIDA 2HWIA 5KOXA 2QX0A 3AH6A 1ZA1B 4NLRA 2E7WA 4F0HA 3TO8A 1K1SA 3DLGB 2ERRA 3LP2A 6AT1B 4JV2A 4TLQA 1H7WA 1QAYA 2IPOB 6FD1A 2UUWA 3HFKA 2HRUA 1IWAA 1F3VA 4P52A 1NZAA 1DBDA 3IGVA 4FYDA 2B56A 3NGRA 1S77D 4I7FB 4I56A 2NS1B 1W7WA 2BJ9A 2R8GA 4N8OA 1RBAA 4PWWA 4ECQA 2LKZA 2M7SA 3DHXA 2J9CA 2N4CA 3KDOA 1HARA 4C8MA 3VGTA 2HHHJ 3TUJC 1RWPB 5F0WA 1C4CA 3TA0A 1N33J 1F60B 2LXFA 4YP3A 4H4OB 3CCZA 3L9ZA 3WC0A 4QU6A 4ECYA 2YNIB 4JI1F 4B3SF 3I0SA 1R89A 2E1CA 4JV5J 5DQGA 2DY9A 1KTQA 3AODA 3FKBA 2VQFJ 1YJNS 4NCGB 3ILIA 4O3QA 4IO1A 1G2EA 1QD1A 2MQMA 3FBFA 3WBZA 2GX8A 3HLUA 2IBOA 3GR0A 5E2QA 3MMCA 2CDRB 1UTAA 1SIWB 3EGZA 3EVWA 3FCWA 3M2RA 4GKJF 4CNYA 1M1GA 1RAJA 3IRXB 4LFCF 1DAXA 3ZNUA 1Q0NA 3J81Y 4ZCLA 4BWMA 2BOAA 3ZXWA 2BJEA 1RLCL 3CW2C 4DUZJ 2WVEA 2RB7A 1L3UA 1H73A 2DNKA 4UOGA 3NGUA 3V81A 5B0EA 5K9FA 5A8RB 3KK1B 2KVQE 1OS5A 2GO8A 1H0HB 1YJTA 2IYIA 1HWUA 1X4BA 4K0KJ 2LU2A 3OJSA 2RQ4A 3BGLA 1H72C 2B7BB 3OR2B 1QLNA 1AXQA 3N4WA 3PTWA 2DK2A 1X4FA 2XLIA 1I6JA 3N79A 2DH8A 1TV6A 1VFJA 3SV4A 1RQ0A 2XWYA 4F4WA 5LMUJ 1BQMA 3R1LA 2ZM6J 2GJIA 4C8ZA 1HNXJ 2WONB 1F9HA 3L3CA 5B08A 3TVZA 3RW6A 4Z7CA 1VIXA 3NGSA 1FKOA 2M9KA 4DZ6A 2YNHA 3WX8A 2NSBA 4P9SA 2QA4G 4WTOB 1OY9A 1S4EA 2CYYA 1N0VC 3I4HX 5EWFA 3MEDA 3PFOA 4DR6F 2IMWP 4P74A 3CULA 3MR5A 2OTLS 1RT1A 4ED1A 1APSA 2KXFA 4FF4A 4LF6J 1X9SA 4DQPA 3GMGA 1Q4RA 3DGVA 1UETA 4JUZA 4QWEA 1RZMA 2OAUA 5FDLA 3A3PB 3UR3C 1NZ8A 2ZZNA 5M2RA 1T9VA 3GV8B 2R7TA 1WC6A 4CM0A 2G1HA 3QJPA 1DY3A 2CIMA 3AOCA 3HFVA 4NLSA 2HFZA 1VMBA 2B5JB 2CZVC 2RUGA 1T0TV 3I5BA 2UVVA 2C3MA 2IFXA 2CJQA 4DXLA 2YPZA 1NHVA 2F1FA 4OJGA 4ZHRA 4YR3A 2O3DA 1CQNA 4ECXA 3GFXA 4B02A 2DNQA 3CO9A 2PGCA 1GK8A 5FLXU 1CS4A 3KLHB 4OYWA 2UXDJ 2JDJA 1JIHA 4C0BA 1DJ0A 3V6DB 2XO6A 4CWBA 4JI0F 5HLFB 1NSPA 2CQ1A 4FP9A 1WI8A 4JI7F 3D28A 2VG6A 3ZTRA 3FFIB 3PW2A 4F2SA 3WDOA 3W62A 3UPFA 4ZVTB 1HMVB 3KG1A 3CMQA 2PDAA 4PG4A 2MSTA 3M8QB 3RB4A 7FD1A 1N8RT 1NJZA 3SI8A 4DV4F 1UFKA 3F73A 3KJNB 3EZUA 4AXJA 3JSMB 1HWLA 3VR1A 4R8UA 3ZZ0A 1RUSA 3GJRB 5KG3A 4IFVB 1SKSA 4XIUA 5KG0A 3BQ2A 1B0VA 2I6WA 3UN3A 4RLEA 4HT5A 3R7SB 2KFNA 1SVDA 1JKHB 3RAQA 2NXUA 1K0VA 4PUOA 5FIIA 3QT5A 1TUGB 3K89A 3RJMB 1IKXB 3D1QA 4PWUA 1SUQA 2YWKA 3LALA 1YJWS 3RGIA 2QC3A 4O0NA 3G96A 4FYXB 1SL2A 2FJVA 5ETMA 3MDFA 2CG8A 1O8BA 2LQ5A 2F7VA 2GQ2A 3QGIA 5B7WA 2VIHA 2MKIA 2OMOA 3DDIA 4X62F 1EARA 3I4PA 3BR9A 4ED8A 1VQMS 4X66F 3UDEA 4C0OC 1SJFA 3V6KA 1XR5A 1FA0A 2Y1RI 1HNWJ 1RWNB 1YSJA 4MIBA 1LWCB 1QSYA 1R0BG 2OELA 3K58A 4B3RF 4DV5F 4L76A 3MM5B 1G3OA 3TP2A 3W9HA 1MG7A 1SC4B 2Q6CA 2R7RA 4O3SA 3ENWA 2ZH4A 4M94A 3P96A 2UZAA 5DDOC 2EI5A 3HHLD 5HP1B 3DLGA 3R5AA 1QJHA 4ZOSA 3QSIA 2FVSA 5BR8F 3MMBB 3UR0A 1BXNA 3CC4S 2RDIA 1B0PA 2XY6A 3CJ4A 2AEJA 2RS8A 4I7FA 2V5HG 1J5EJ 1MU2A 2C2RA 2HFNA 2BJ7A 4NLWA 1XC9A 4TXSA 3MMJA 1RWVB 4XDCA 1MMLA 8AT1B 3CCWA 4A8FA 5FLXY 2AYEA 2H1YA 4WJBA 5A8KB 2ZOFA 2E7VA 1RKIA 5IV4A 4H4OA 2F3JA 5DQHA 2DPIA 3KFWX 2W2OP 2YNIA 2XZTB 4K4VA 1QAIA 3B54A 4IH7A 5CYQB 4FN5A 1I1GA 4UY8T 3ILJA 4USIA 1NK5A 3D54A 4NCGA 2KI2A 1R8BA 4DV1F 4TQSA 1VBKA 2B9XA 4CO1A 2XHCA 4K5RA 1TKZB 2BVZA 2GIQA 1NH8A 5KFKA 2EG2A 1ELOA 4USUA 1X5OA 2FJDB 4XTTA 4LF2A 4M8LA 1XTZA 4GO5X 4OMFG 1DTQB 2PEHA 2B6AB 1FWLA 5F8MA 2XSFA 3IRXA 1KFSA 5C2GA 1KLNA 5F8NA 4LJMA 3MTJA 1D8YA 2ZH5A 5IC6B 2Z0GA 2CQPA 4CLTA 4Y2AA 1D3WA 3OL8A 1TK8A 4H4KA 2DNMA 4Z7YA 1HW9A 4S0MA 4RBUA 4U7UD 4HHJA 5A8RA 2SXLA 2G0JA 3KK1A 2ZJQQ 1WF1A 2QT7A 1Q95G 2JOQA 5CXTA 1WG5A 3QYYA 4ZVQB 4DL3A 4F02A 3FMBA 1OPZA 4LREA 4QW8A 3BBCA 1K9MT 2CJYB 2JWNA 2HHHF 4DHVA 3OR2A 4A8KA 1HR0F 3CJQA 4NL5A 4PPZA 4LFBF 4O4GB 3DRSB 3NCRA 2J0SD 4KHRA 1TTHB 1YJRA 1I5OB 2DEJA 1JNRB 3FVYA 3H2UB 2NLWA 5KG7A 1FESA 5IWAF 3AOBA 4Q44A 3HFZB 2B8PA 3DOLB 4ZPAA 3SSRA 3BH6B 3CJ5A 1ICEB 4ECSA 2DXDA 2VF3A 4DI6A 3ENVA 1CJVB 3DN9A 4F26A 2LLZA 4AXIA 3UNYA 2MMYA 4D3HA 3ZFVA 2EBEA 2DGOA 3NWRA 2F40A 3I87A 1N52B 1N32J 1IR1A 1OPIA 2HS0A 4JYAJ 1FE0A 2R2TA 2KXNB 1Y10A 3OUYB 4X4RA 2UXCJ 2APOA 2J0QD 2VG5B 2EFGA 4WXWA 3M9NB 4NPOA 2DEIA 4OHVA 4PWDB 1S99A 3A12A 4PRFA 5EDWA 3DNCA 2AV5A 3J7ZT 1KFDA 5DLGA 4DV7J 2N82B 4C0HA 3RG6A 4ZVEA 2V8PA 5KFTA 1BGXT 1TKDA 2V8VA 1WC1A 4OYPA 2O01C 3VQSA 4OHXA 1K0TA 5DZ6A 2ZUGA 2ZC4A 4LF5J 2WZ1A 2ILZA 1ZPVA 1QTMA 3EGWB 1X5TA 3AY0A 3FZ2A 3EYZA 2B5JA 3L7UA 3HXMA 5B0AA 3BN7A 1F9FA 4NLXA 2MKHA 1WEYA 3QGGA 2K7JA 3NAHA 3TAMB 5KFLA 1X9WA 4OX6A 3NGKA 4MKVA 4USHA 3K5OA 5KT4A 2Q6BA 4I2PB 3UCZP 5C7PA 3T1HJ 1GMWA 3FJ2A 3KLHA 3IAM9 1FEHA 2QN6B 2HHQA 4OZ1A 4X65F 2QO3A 3V6DA 1NJIT 3Q8VA 4MTPA 1OO0B 5HLFA 5DRKA 1FK9B 5CH7B 4OI4A 2KG0A 1VISA 2FHMA 3M32B 1S6PB 2FZGB 2GJ2A 3FFIA 3SQOP 4YY3J 4P73A 1WHVA 2KB2A 2J7KA 4PG8A 2J8SA 1HMVA 5AJ3J 1NNDA 2C2KB 3OLAA 1CQMA 2N7YA 2IJNA 3M8QA 3CCLS 2EC2A 3SDEB 2J7WA 3JSMA 2F5GA 5LL6d 1JLBB 5CD4H 2R9LA 1FRIA 2HLUA 3NMAA 3CDEA 3BGUA 4IFVA 2PSZA 2A2DA 4JI6F 2FY8A 1TR0A 3MFHA 4CLKA 3MD1A 2DGXA 3G4SS 1X9MA 2NPFA 5D0HA 4ED4A 1Y3KA 3HO1A 3PRVA 1JKHA 1D8ZA 1R8PA 3HHEA 2DGSA 2OJ3A 1EB0A 1N5TA 1IR0A 4USMA 3LGMA 4ZITA 2KVIA 2ZNZA 3PVXA 2YNGB 5F9NA 4Y34A 4DN0A 3MR6A 1AFIA 1IKXA 4WP8A 3O44A 3H59A 3BR8A 5F9LA 4PXEA 2C2OB 5LOQA 3GV5B 4KGKA 3G82B 4J9OA 4Z2XA 2VICA 4F4YA 2GO9A 3NS6A 1IBKJ 4NZ7A 3WQPA 4IRKA 4DSIA 4BBYA 2G2OA 3Q8PB 2QV6A 2DCLA 2X3GA 2E5LJ 1FRMA 1F5CA 4JI8J 3UWTA 1HHTP 2UUAJ 1IUJA 3FCVA 4HTJA 2MQNA 5E5NA 1WSVA 5F3TA 2NZ4A 1FD8A 3M6XA 3DXBA 1NEEA 4U6PA 1WG4A 4UOCA 1LWCA 1XMQF 1G6BA 2HHUA 3MM5A 4TYBA 2NR0A 4DV2F 1T8EA 3H98A 2DITA 4KGMA 1YITS 4FNIA 1FJGF 3QAEA 2HNDB 5KFHA 4DR4F 4ZJQA 5HP1A 1RT3B 4F2RA 4NLOA 4QJVA 4X64J 2C2EA 4EO6A 3MMBA 1EIYB 3D7SB 2DHAA 1DQAA 4C11B 4FS1A 4OZ2A 2MZQA 2YKNB 2W4DA 3LGHA 1S1WB 4CT8A 2HIQA 4Y2MA 1JXVA 3D1HA 4OYMA 4ZPWR 1U7LA 4XO0A 3IR7B 3OFFA 4IOAQ 3IWLA 1IQZA 1T03A 1S6UA 5A8KA 4CLFA 3IRWP 2NYHA 3G6ES 3M6VA 5C5JA 4C97A 3MTKA 3JB9k 4DG1B 5CYQA 3CJ2A 3IGNA 1S9EB 4G1PA 4USJC 2W7OA 3TW0A 2CQ0A 1PO6A 1PILA 5MLCV 3M8RA 1P1LA 2KU7A 1YVFA 2CPFA 4IH5A 1TKZA 2YKAA 2UUCJ 4IRDA 4X4NA 4MIAA 3X1LB 2ZWOA 3EPGA 1DTQA 1TUWA 3HT3A 3EPIA 1X4GA 5T7LB 2B6AA 3TARA 4KGVB 1KC8T 1LFPA 4WKYA 3H40A 4USTA 3TVKA 3HSDA 1WC0A 3D6TB 3CJRA 1BLUA 2MKSA 3UI3A 4JI3F 4ZMMA 2P8IA 5LJ3Y 2FGOA 1J5EF 3OSPA 2W2MP 2W01A 3JTPA 2PMZD 4J9NA 2OH2A 5HVHA 5ETKA 2GGPB 2NZCA 5A2QU 3ELHA 1TZ0A 1YHQS 1NJYA 5L1IA 4DU7A 3T5LA 3PW7A 2ATCB 4YFUA 1FX2A 3T1YJ 2I0XA 4OX7A 1P1TA 5J1EB 3J80U 2BQRA 4JOUA 4O4GA 3HHKA 5KT2A 3DRSA 3PEHA 4Q2LA 3NNHA 5G0RB 1H7XA 2LMIA 3I31A 4DFPA 4C3MA 3KJFB 1N5YB 3PFEA 3DOLA 2Z2MA 1DTTB 4CYUB 2QL9B 1GFWB 1V5VA 3G86A 1CJVA 3MM9B 4QOTA 2VJUA 2B9WA 1OWXA 3E8OA 2VFVA 2N4DA 2WTFA 4H4MB 3BH7B 3VZHA 3VAKA 2Z58B 2CZ9A 2GA7A 2MZJA 4RW4B 5D4NA 4U9RA 3TZWA 1TELA 3QRRA 4NLTA 1VHFA 4NMXA 1BC6A 2OP5A 4NEZA 3SQGB 1S0NA 2QLFB 2RF2B 3OUYA 4ZLJA 4MJKA 1S4FA 4X4UA 1JJ2R 3VHQA 2IDEA 1HI1A 2VG5A 4KC5A 2E44A 4PWDA 4H54A 1KQSR 2W8LA 1T3NA 2HURA 4EEYA 1IBCB 2OEKA 8ATCB 3V4IB 2P6TA 2CPYA 4G65A 2B9YA 2ZOGA 5RUBA 4CLYA 1RHJB 1V3SA 2RT3A 2QMUB 4DR2F 2X51A 1A7GE 1A6LA 5T14A 3W5XA 1BHNA 3TJAA 4DSFA 2XTJP 4RBVA 2PA3A 3BDEA 3W63A 2OMLA 2CPZA 4F67A 3TAMA 3CSKA 1IJEB 1X5SA 2FVQA 3NCPA 1HA1A 1LNQA 5I4MA 1QVGR 3BGOP 1SKUB 2LEPA 3D68A 4I2PA 4PQAA 1KSPA 2J7UA 4IUFA 3VVUA 2Z2YB 2K3IA 2RU3A 1WUUA 2HHPA 1FNMA 3A8IA 4DF8A 5A6PA 4ER8A 4CH0S 4NLDA 3I55S 1FX4A 2FLPA 2FUG9 2HFUA 5JVHQ 2DH9A 1FK9A 3H7HB 3IWNC 3WIUA 2KJWA 2ZBQA 3HKWA 3M32A 1S6PA 4OLPA 1U1MA 2PI4A 4R0EA 5ETQA 3MAHA 1HPZB 4DL4A 5KFBA 1FRJA 2HNYB 2G0CA 3HHLB 4UOFA 1T9UA 4AD6A 2GHWA 1RKJA 2ZBPA 1T3OA 3SDEA 4RWXA 3UCGA 4ZVHA 1JLBA 3SCIE 5A2QY 3J7AN 1NCLA 1W25A 5L38A 1S1XB 3GP9A 3THPA 1ZH5A 4MK7A 4K4SA 5F8HA 2HIYA 3FBCA 3J80Y 1S57A 3PYGA 2IJFA 3L7OA 4BDPA 4WWSA 1LFWA 2QSFA 5HJXA 2YNGA 2PI5A 5F0UA 1HWJA 3UW1A 4CH1A 1PAEX 1M0SA 2VHGA 2MSSA 3I9ZA 2I9SA 3R5DA 4AFFA 3G82A 2G2ZA 2D3UA 3RW7A 1DQ8A 3MPVA 2W7PA 1L3VA 4LIRA 1WF2A 1YRXA 3NXZA 2C3PA 2OUGA 3IXQA 1KOOA 4TN2A 3H20A 3WX4A 2I1RA 2EW9A 4I6WA 4QYZK 3UCUP 1FKAF 1YLXA 2ZH6A 3ZZPA 4ILRA 1RXOB 5D77A 2XNRA 4YY3F 3BGRB 4GVBB 1SH3A 3VAFA 3DOKB 3TUIC 4P2XA 1XMBA 3PJ9A 5LXRA 2I8EA 2AF6A 1RHUB 1RWMB 3KOAA 1FDAA 1REVB 3CCTA 2JVOA 1XNRJ 2LECA 2ZOMA 1MLAA 4USWA 3MOJB 1T05B 4PABA 3SEOA 3OD2A 2HNDA 4C8OA 1X4EA 1Y3JA 2V0NA 1RHMB 5JJBA 2ZH8A 1M5OC 3FK4A 1RAGB 1RT3A 2PIIA 2DB1A 4K7QA 2E5IA 2XO7A 2DHGA 3M2UB 4DFMA 1R8AA 4FPIA 3G9CA 2C2DA 1PYSB 2RIJA 1R3NA 3EJMA 1R7IA 4URQU 4L74A 4C11A 3HHDA 3KLIB 2ZITA 3RTVA 2YKNA 7FDRA 1REGX 3JTOA 1S1WA 1U2FA 4URGA 5CQGA 2RHQB 2H9ZA 2NXJA 2DH7A 1RCXB 1CC7A 5HN0A 4Y6IA 5GMKa 1S0OA 4Q43A 2W1BA 3CJSA 4FBUA 3AJDA 1HNIB 3CWJA 1SL0A 5M2UA 4FS2A 3I9V9 1VQLS 4JI8F 3JSYA 2YH0A 1ROFA 3PX6A 2C28A 4QIVA 3CVKA 4LSLB 4DG1A 2BKPA 1S9EA 3Q8UA 3OLBA 4O0IA 2M70A 3HSJA 2KM8B 1HNVB 2RU9A 1XR6A 4JV0A 4BS2A 1JJ4A 5I42B 2ADCA 3M05A 3ILOA 4LVNP 4DN9A 4FVMA 2CVEA 4AE5A 2PEBA 4KGZB 2KKHA 3TX0A 2H3EB 5T7LA 4ZVGA 3EICA 4C4WA 4OYAA 2HYIB 3HDSA 1P27B 4DUYF 2XZDB 4Y3CA 4JI2F 1NPKA 3LA0A 3EWGA 4LBPA 2YWWA 3CDBA 2F4VF 1KNZA 4HVZA 1ZM9A 5C24B 2RKIB 2KHCA 4DCPB 4ZJLA 1MMNA 3FBBA 4DSLA 2GGPA 3B82A 1LQ9A 2AWZA 2OLWA 4CCHA 4WXOA 3SCKE 3P3DA 5ETSA 1RDRA 1D9DA 3GIMA 4IRCA 5J1EA 3WZ0A 5HROB 3W64A 1I51B 1NDKA 4UZBA 2ASDA 5CA5A 2GVZB 1RABB 1CJKB 3DLKB 5G0RA 3ETOA 4OYXA 1P9YA 1GT8A 1N5YA 4GC6A 2EK1A 3D66A 1U1RA 2FHOB 4KY3A 1JLEB 5KFUA 1FRKA 1DTTA 3KHLA 1JK9B 4CYUA 2LQ9A 1JNZB 5MAOA 5HVGA 3MM9A 1RB0A 1RAIB 3NP5A 3LUYA 1N48A 1UWAA 1OJ4A 3TZYA 4H4MA 2RVJA 3C14B 4NXMF 4RW4A 1NK7A 1U45A 5LMNF 5F8LA 4X4TA 4JI5J 3GZ7A 1D9AA 2A1BA 1K1QA 4DZDA 2FVCA 3SQGA 5L1LA 1VC5A 4DR7J 2RF2A 3AXMA 1PGZA 5DS7A 2GVDB 4U7UK 3CC7S 4OX9J 4LF4J 3BGFA 2F8MA 2M52A 3MURP 3GE9A 3G8QA 3QJJA 5J2PB 3A3NB 4DPTA 4CTAB 2OSQA 2HBZB 2MJNA 4IG3B 2Y3YA 3DXSX 3D9BA 4DR1J 3K0JA 2H5EA 4ZIVA 2W25A 4MT1A 4IR1A 1NAQA 3AFGA 3KDNA 4ID5B 5IT4A 1Q81T 3V4IA 2RRAA 1VBXA 4RNFA 2W9BB 3PEJA 2GQQA 1NJWA 5L46A 4KGXB 3KUEA 1AUDA 2MQOA 2J5AA 1NK6A 2X1BA 2AYGA 4RL1A 4NLVA 1HNZJ 2FJXA 1N34J 3CCMS 2MTLA 4ZVOB 5KT5A 4E8UA 1HD1A 4YQWA 3RRHA 2ZZTA 4WPAA 1UFLA 4U96A 2BR0A 1VQ9S 2CNNB 3M8ZA 4FYWB 2BABA 1UEUA 3IMQJ 3V5RA 2GFFA 3M1VB 3NMRA 4DJBA 4LVOP 2M8HA 4M5KA 1XMOF 3LAMA 4ILLA 1Z2LA 2VA3A 3K17A 1XJWB 4X4PA 3FC9A 1Y5IB 3PYDA 4OI0A 3MM8B 2KTQA 5GAGI 4FF2A 1M5VC 5FJ4A 1U2CA 4E98A 1VQKS 4B17A 1Q8IA 2Y1LB 4ETXA 1FXRA 1HPZA 3DRXA 2LA4A 4JI1J 4YHHF 4B3SJ 2HNYA 3HHLA 2R7WA 3C16B 1YJ7A 4FKYA 2MGZA 1FTCA 2E29A 3CB4A 3UD5A 4ES1A 4ES2A 5L1KA 3KLEB 2JLGA 3QMQA 2MPUA 3Q0AA 3AA8A 3FEZA 1S1XA 2CQ3A 2ABYA 2J9DA 5KFSA 4KR0B 1TKXB 2FC9A 5BYQA 4LQ3A 1VQ6S 4UT4A 2J9DE 1XNQF 2WW8A 1X5PA 4GKJJ 2RQKA 2NXEA 4P75A 5IQQA 2CNOB 3PW0A 1KRPA 4LFCJ 4ZPVR 2KDOA 2XMTA 3BSNA 1NMEB 2LDYA 2HBYB 2QEXS 4IQMA 3ADAC 2IM1A 1S72S 2J6TA 2UP1A 5KFGA 2B7CB 1ZM3A 4TYAA 5JXSA 4USVA 3JS9A 1IWGA 1PIEA 4RUHA 2WK4A 2HQIA 5ETRA 2ASLA 1NPRA 3BB5A 3MOZA 4HACB 4NRTA 2L9NA 3BGRA 4GVBA 4I69A 2HBRB 3P5TL 1S97A 1FE4A 3HSZA 3BSCA 4Z37A 2OPRB 1REVA 1LW0B 5IQ6A 4KAIA 4DR3F 2B8QA 5ETVA 8RUCA 2WBRA 2CNKB 3WC2A 4O3OA 1T05A 2KFZA 5D0EA 3MM7B 3QGHA 3DLBA 3G2XA 1KN6A 1TL3B 5DG8A 2DHXA 3RUBL 3SBMA 3PZPA 3M2UA 3EVMA 1VQYA 1YIJS 5KFXA 3OL9A 1RISA 4WYWA 1MMDA 2EXUA 5AE1A 4QR0A 4BWJA 3MR7A 4WP9A 3THVA 3KLIA 4NCBA 1Q8BA 4LMZA 4LBHA 3HKZD 2G2YA 4OYIA 5HI7A 2YX1A 2KL8A 4L73A 4FZVA 4DR6J 1VQ4S 5KG4A 2ZH7A 2BMBA 1LOUA 1H2VZ 2WBMA 2CDQA 2BQ3A 3US5A 2HLTA 1EHWA 5CYMA 1QTNB 2JVRA 3OPKA 1HNIA 2R42A 1WDDA 1HIYA 2XG8A 3AJ2A 1YQHA 1QAXA 5M2PA 2RDDA 1MNEA 1VBZA 2IY5B 5EGYA 4LSLA 2FLOA 4DS5A 2NREA 4C2MA 1BMQB 2G1DA 4KQZA 4ZVSB 1HNVA 4PZVA 4DQSA 1XQIA 4FNHA 5U47A 5LSRA 1UVKA 4HEA9 2E1AA 4HH0A 3J7YI 2DCUB 2Z8QA 2V8HA 5I42A 2IA0A 3K5MA 3IC1A 4WU2A 1CPZA 3BYPA 1UL3A 3QWUA 1WI6A 4RWWA 4P71A 2E9ZA 4DV6J 2BJ3A 3HHLC 2ZH3A 2M4MA 3O2IA 2QLXA 2XS7A 1VRUA 4DX8H 2XMKA 2EKYA 4TU7A 3WHIA 1VI7A 2V9KA 2HHTA 2VH7A 2X3DA 3TQEA 2CQIA 3K5LA 2AGQA 4JI0J 2ZDOA 1H2TZ 4BLGA 5C24A 2RKIA 1C2PA 4JI7J 3ZZUA 2ACYA 2AJ1A 3U1LA 1EJ7L 3I5AA 1EZZB 1Y00A 4YN3B 2JEIA 1F0XA 1U8WA 2RMLA 1UZHA 1WSRA 5HROA 2HAIA 5H9FJ 4IG0B 2C1EB 2RQCA 1HFEL 2GVZA 3A3OB 4Y2IA 1CJKA 3DLKA 3MECB 2DR6A 1U47A 2AEMA 3VGSA 4EBDA 1Y5NB 5KFAA 2KT3A 5I3PA 2HVIA 1LXJA 3VGVA 4C9DA 1JLEA 1WTBA 4AL7A 2DNRA 5AXMA 3AXKA 1X7VA 5F8GA 2RDJA 2WVCA 3SFGA 3P45B 1NDLA 2FIUA 3SCJE 3KLFB 2GJFA 1FXDA 3ZZOA 3A13A 3D2WA 3PRDA 3C14A 4N77A 1AROP 1GMUA 3SXLA 4CO4A 2U2FA 3SV3A 4ANDA 4HYKA 2ALZA 1NUEA 5E3AA 1UZDA 3Q22A 1IBMF 4A8QA 3JSBA 2UVRA 1FNXH 4X4QA 2GVDA 2UU9F 2YQ0A 3W9JA 2H4YB 4LF8F 4YB7A 5J2PA 4CTAA 2V8GA 3GWCA 2HZVA 1TFWA 2Q3PA 4NA1A 4IG3A 1VQSA 4RPFA 3QQCD 3HVAA 1GAOA 4X66J 4QPXA 1EAYC 4C8LA 4MKBA 1BE4A 4FVCA 1HWKA 2YX7A 2Y1JA 1NHKL 5D78A 4M5JA 1JLGB 3IS9B 2KO1A 4DV5J 4ID5A 4CLLA 2XY7A 1EKRA 3BKUA 2W9BA 2DNNA 5BJRA 3C19A 3IBCB 1XBWA 1NKCA 3TZZA 4OJ1A 3P5BP 5ETLA 4A46A 2A0FB 2Z2LA 2V68A 2IHR1 3OTEA 4XK8C 4PKDB 3ETMA 3MUMP 2HVZA 1KQFB 2LQJA 5EUHA 2HVEA 1Q79A 2MXYA 2LA6A 2MZSA 3QRPA 4J9MA 5K14B 5BR8J 3CJ0A 4ANCA 5KFZA 5E3CA 2C2NA 4PYDA 1L3TA 4WFZA 2MLZA 4WK1A 2E66A 3M1VA 4DV0F 2EVZA 2OIHA 3C6UB 2KM8C 4Y65A 5GMDA 2VZ9A 4JI5F 1NK0A 4GC7A 1S12A 3RZAA 3J7A1 2ZH1A 3B4MA 3M6UA 2VFSA 4ZS6A 4QYZJ 4HTIA 1RWUA 1SL1A 2R7QA 4TY8B 4NA2A 4WZMA 3C16A 4E2FB 1Z4UA 2DVIA 4ECRA 3UFCX 2F9DA 3KLEA 1UWBB 3W2VB 2XCAA 2A2CA 2ZHBA 2YWHA 2OEMA 2J0XA 2XLKA 3L4BC 1TKXA 3DFEA 2GQCA 4OHYA 1Y11A 2JZ5A 1VQOS 3IAS9 2OGUA 2HQGA 1U6ZA 1RTZA 5CZXA 1HNZF 1KVIA 2KT2A 3TX8A 1N34F 4EZ9A 4EFAC 2D1CA 2VPWB 1RWXB 1VK3A 4EMDA 2RD5C 3A8KA 2VC1A 2KRBA 3VAHA 3QSYB 3OV7A 1NKEA 3IBWA 3B6BA 4YEAA 2A18A 3BO4A 3I96A 4X84A 3B4DA 1GMVA 2GZOA 1B4SA 4KHPF 4LF7F 3LOUA 3V2UC 3MCSA 2DR7A 4HACA 1TVRB 1EKSA 2VA2A 1HR0J 2AHOB 2JC1A 1NK4A 4LFBJ 3R5JB 1HKAA 5BYSA 2QGFB 3CJKB 2OPRA 3CCRS 1LW0A 2XYHB 4BCAA 5IWAJ 2EFPA 4F4KA 3IG1B 1S9FA 3C15B 3MM7A 4C98A 2DRAA 2BANB 4HR2A 4OZ3A 2FY1A 4MIWA 3CCUS 1TL3A 4AT1B 4QR2A 5DM7Q 1RA7A 4AUKA 2PE8A 5ADZA 2H51B 2Q66A 1PBUA 3RRKA 4CT9A 2DGUA 3W8GA 1EETB 2R8HA 1WC4A 3ISNC 4CP5A 1NJXA 1FKPB 2VDIA 4ALZA 2VU5A 3PHTA 3MXHP 2JH3A 1SJ4P 1LKZA 2N7CA 2HFVA 1T9TA 5C2CA 4OQJA 1ULRA 3IO1A 3OFGA 4KE5A 3ISZA 2W4PA 5CYJA 1YTYA 1OSCA 3F41A 2N3LA 4ZP9A 3LWMA 3NOCA 3RB3A 4GMKA 1CJTB 2IRUA 3PV8A 3G6VA 4IDKB 2IJRA 2VBWA 2RE1A 3HZGA 2F8HA 4CIOA 4ECUA 4WCEQ 4DPXA 1UJ4A 4AL6A 5KFVA 3K57A 1OMSA 4B9SA 1UA1A 2PN6A 1RCOB 2KYZA 4WFXA 1YGYA 1MWQA 1F9EB 5GAEU 1N5QA 4G3IA 4DPWA 4LT6A 5SZTA 4OI3A 3ZC4A 1WEXA 3OVSA 4UW2A 1Y5LB 1SC1B 2H5IB 4J9UE 2XEXA 2FJWA 3OTDA 5AE3A 3GB0A 3GG0A 4QIWD 5KFIA 1HLWA 1TP7A 4ENOA 4X65J 2YKOA 1NXIA 2G0IA 1IJFB 2AGPA 3R9LA 5C25B 5GADU 3OSNA 4NASA 4V19J 2R2SA 3BEGB 4CLUA 2DNLA 1S9GB 2L08A 3N6LA 2IVYA 3CDAA 3FBEA 4RU2A 3DI6A 4URSA 3MR2A 3H0PA 3U27A 3W65A 2AJ4A 4B3OB 3K5PA 1FFSB 1YJVA 2NUHA 4IG0A 4XAKA 3M2VB 4C48A 4ZLLA 3CIMA 3GR1A 4NYZA 2CJBA 2VPYB 5K8OA 3GJTB 3MECA 4QIEA 1X0FA 4JI6J 3HJFA 2BUNA 2BA9A 3MZIA 3TI0A 3CD7A 3LW5C 4Y2CA 2W2NP 4RKUC 4ZP6A 4B08A 4ELTA 3SMZA 2FDNA 1MN7A 2DNYA 1FJCA 1L3SA 5GAHI 4ELUA 1NU4A 3KLFA 4U95A 5IT9U 2MHEA 4WFYA 2RRBA 1S1UB 4GKKF 4PXBA 4DV6F 3CMES 2B4VA 4WFAQ 2DTJA 3Q86A 1QSLA 3HD2A 2ASJA 2NQPA 2AZ3A 3RB0A 2MQQA 2BE2A 3FEXB 4LRDA 4WU3A 4K8RA 5ITHA 3PY8A 4Q0BA 2DD8S 3H90A 3VQTA 5AXNA 5T41A 2DT9A 2MY7A 5D4OA 1NK8A 2OI2A 5B0BA 1HHSA 2YBVA 4LSNB 1XMQJ 4KH0B 2XNQA 1JLGA 2K7KA 3IS9A 3PG9A 2CJ9A 1FRHA 4ICLB 4DV2J 2RS2A 1OQ6A 4CZCA 3Q24A 1JLFB 3HD1A 4DCJB 1UPMB 1RT5B 4CLSA 4UUWA 3TVYA 4ZCKA 2R3VA 1FJGJ 3KG0A 1JXLA 4DR4J 5GVQA 3R5GA 2OKQA 1Q5YA 3GCXP 2FVPA 3AOAA 3Q89A 4CQ1A 4ED5A 1H3DA 4DPOA 2R7OA 5K14A 5EN1A 5E33A 3MEGB 4KV8B 2FHJA 4C8YA 3N0VA 3DRRB 1SIZA 4ANEA 5E3RA 1NSAA 3FCHA 2YX4A 3N5FA 5A6WA 3JXOA 4NLUA 2MQPA 4NMLA 4EZ6A 1VCTA 4A8OA 5CZVA 1C0TA 2VL1A 3C6UA 1SH0A 2HK2A 2JRSA 3HVWA 2DNOA 2XZWA 1X8DA 3OL7A 4PG6A 5HK4A 1FJ7A 1JMTA 2XI3A 2ZKTA 4XDDA 1KDNA 4A8MP 3PO4A 2DGWA 3HJVA 3CCQS 4TY8A 3GIRA 1RTHB 2CQBA 4YB5A 2OPPB 3KUGA 4OZNA 1PC4A 2CNLB 3FRZA 4Y0FA 4WE1B 2WVFA 1UWBA 3W2VA 3N9UC 4QPTA 5IOLA 1RJJA 3S7RA 2VODA 3CD5A 3D6FB 3PX0A 3K8VA 2AU0A 1IBLF 1U1PA 1CULB 5HJYA 2DRBA 2X1GA 1R0CB 5J1NA 2E9RX 4OI1A 2AEFA 2IC3B 1I3OB 2KJVA 2R7UA 3WIVA 4I6YA 2C3YA 4FYVB 4JI3J 3CCJS 4TKTA 2DIVA 1MW7A 2W9CB 2QG9B 4ZKAA 5IT9Y 1UA0A 2QSWA 1R43A 1FEEA 2Z30B 5HSPA 3PACA 1TL7B 2HZAA 1B0TA 4ECVA 4Y2KA 3OBIA 3JQJA 3X3UA 3KK2B 2ZH2A 2KT5A 1TVRA 4PCQA 1L5UA 2QLBB 2I2YA 1WKJA 2XMJA 4QU7A 3CIZA 2MZTA 5KFWA 3CJKA 2HGMA 2XS2A 4ILMA 1WELA 3MUTP 2GMJA 5DDPC 2HAFA 3IG1A 4F4ZA 1QDUB 2BOPA 5ETTA 2UXBF 3C15A 5A76A 2QLJB 5I3UB 4I2QB 2VPZB 2BKOA 2BX6A 3CNQP 2BANA 3SZ2A 4HH1A 2CQCA 2K8GA 3I56S 2XY5A 4NZ0A 3B8HA 1RI7A 1FF2A 4K2JA 2G9OA 3IM9A 2C2MB 4XPCA 5DQIA 3M9MB 5LJ5Y 2V34A 1JLAB 1EETA 2DNZA 2CPDA 1XERA 1I94F 3PIPQ 1FKPA 2P9EA 2UVUA 1U09A 2HBQB 1UKUA 1HBMB 4ED2A 1HQUB 4HI2A 1B7YB 1RBLA 4P2MA 1KVKA 2LEBA 3VV2B 3C2PA 1FHTA 2FJEB 3FUYA 2R7VA 2AYBA 4I67A 1RYSA 2M2BA 5LSOA 2MQ8A 2X1AA 2NXNA 1U02A 2HFOA 3MFIA 2BJDA 4DS4A 1VQ8S 1CJTA 2POKA 3HVTB 4IDKA 1GTEA 3KXDA 4DR2J 4QIFA 3CDWA 2EFVA 3F44A 3HX9A 1OIAA 2FQQB 4RW9B 4ECZA 4EBCA 3SIPB 3MMAB 4B3TF 3CD6S 1SI9A 1UW9A 1V3ZA 1LK5A 1C1CB 2JLFA 3HULA 4IR9A 4YB6A 3TUPA 3VWSA 1JLQB 2WONA 2OD4A 2ATLA 2MZRA 2DXEA 2ZFHA 2LYVA 2HRTA 4X4VA 1RACB 2P6SA 1S7IA 4CH7A 3RAXA 5C25A 3EGNA 1YZ7A 2D41A 4TQRA 5DETA 4DLGA 2VFRA 1S9GA 2YVSA 3HP6A 3RU0A 1RA6A 2CJXB 1FCAA 2KH9A 1S76D 1KQGB 2DHSA 1AFJA 3OW2R 3ZTQA 3LP1B 4B3OA 2ZUAA 4R5PB 2MLXA 1SKWA 4ES3A 1QSSA 3LQVA 5KG1A 4QCLA 2COLA 2Y1IA 3M2VA 3ENAA 2EBGA 1NH7A 2HQFA 4V1Ak 3KHHA 5B0GA 1CVJA 3GCWP 1FJEB 1VYAA 1ZAWA 5K5MA 1TAUA 2BM0A 3UD4P 1V3RA 1VRTB 2PT0A 3PDNA 5KFRA 3D4JA 3TAPA 1GXUA 1DQ9A 4ZN3A 4DQIA 1FWKA 4OJ3A 2VOOA 5CD4A 1IXKA 3R6GB 3ET6B 4MK8A 1VQ5S 3BQ0A 4WFBQ 2B0GA 4NYPA 2LEAA 1E6YB 1NM2A 5HMXA 5DM6Q 4I6AA 3QGPA 3BPSP 1S1UA 3TANA 1CBKA 2H65B 2UV8G 1H2UX 3GQCA 3D5MA 2DR8A 2VOPA 3DOMB 1WKKA 2CPJA 2JJ4D 3QT8A 3VAIA 4Q8FA 4J9PA 1WF0A 2Z57B 2V4RA 4K4WA 4PR6A 1ZYQA 4TNOA 1SV5B 3UNGC 2RH3A 3V4MA 1PBAA 2KYXA 3CJ8A 2K1RB 4DV3F 2UV8A 5BYRA 4LSNA 2VQEF 4X4SA 4HLBA 2XB2D 4DX6A 3VGUA 5DG7A 4ICLA 2DO4A 4M63A 2YH1A 1JLFA 2GCFA 4KHMA 4Q2MA 4O3RA 4OZ5A 1RT5A 2A6MA 4F4AA 3C8YA 3CXCR 4QR1A 4DL7A 4WK3A 2MDAA 5D0GA 1BWVA 1AB8A 2MKYA 3L95X 4H4KC 2OSRA 3FSYA 4DPYA 3MEGA 5J2NB 4KV8A 3CTRA 5AXKA 1U0SA 2EFQA 3QO9B 1WOOA 4LRBA 1NLKL 3HSGA 1CG2A 3DRRA 2YQ3A 3MPDA 2XULA 3LP0B 2YPYA 1XN9A 2MHNA 4P6QA 4LBIA 2AW0A 3BREA 3D3BJ 2ZVSA 1RWKB 4NX9A 5E3PA 4TU9A 2FC8A 2BRLA 4RU9A 3DYAB 4ZLPA 1FNOA 2XYGB 3N5BA 4HDGA 1RTHA 3QZ8A 1Q1KA 2OPPA 4B9TA 4CLPA 1FRXA 1SQGA 1YK9A 3SYZA 4WE1A 3S8SA 3UQSA 3EMTA 3TEGA 1MU2B 1X60A 1WWHA 2LP4A 1S79A 2Q79A 3R5CA 2JX2A 4G6VB 4I68A 2RNEA 4P72A 1JJHA 4EWTA 1V5IB 4RR5A 4D3GA 4DX7A 3PW4A 5KFPA 4KJIA 3EVOA 3G8TA 3M8YA 3MGJA 1CULA 2ZJRQ 2FGCA 3FEYB 5DDQC 9RUBA 4DUYJ 3OTBA 1Z2ZA 1SCJB 4U8YA 1YZ6A 2IC3A 3UE2A 4NOHA 4JI2J 4CNZA 4NLQA 2ZBRA 2R8KA 1ITPA 2F4VJ 2W9CA 3NKYA 2BACA 4IO9Q 2JEGA 2QL5B 4NCAA 3BO3A 1M5KC 5L8RC 5KFDA 2AJ0A 2VONA 1TL7A 3BSOA 1WACA 1O0PA 2AX0A 3ILLA 3KK2A 1U0HB 2CPHA 1N4LA 2WHOA 5H9EK 3CDUA 2WSEC 2JEJA 2QYCA 3UN2A 1ZAXA 1KWMA 2D74B 5D4PA 3ZTSA 4B9MA 4QIGA 1HQ2A 1SC3B 1YWXA 1AA1B 2G13A 3H4BA 2VBYA 4CLWA 4LR8A 2U1AA 3HCXA 2BYCA 5I3UA 4MKYA 2W2QP 2CWXA 4I2QA 2M5YA 2AYMA 2Y0BB 1U48A 4NLPA 4PPDA 2B3TB 1U4BA 4ZVPB 2J8AA 4EO8A 2JHEA 4M5HA 3KMQA 2K06A 4ECTA 2ZH9A 2QL7B 1JB0C 4NXMJ 3NRBA 1VHIA 4DSKA 3U02A 5D8HB 5LMNJ 5EHHA 1IN0A 5HANA 1JLAA 1D0EA 1EQMA 4LFAF 3BO2A 2F65A 2XYPB 4ZPDA 3DLHA 4R0JA 1H74A 4HKQA 4U7CA 2DRDA 1HBMA 2VJVA 1B64A 1S6OA 2HG4A 1HQUA 1AW0A 2DXFA 5L1JA 2NCKL 2L41A 5IS2A 3R2DJ 3M7VA 1V6HA 1TFYA 2OO4A 3W5ZA 2GIRA 3GFYA 2P9GA 1AT1B 2QE5A 2FJAB 4M95A 1SJ1A 3GU0A 3AQPA 2RQMA 3HVTA 4KBIA 4E0DA 3K59A 3HF5A 3TUZC 2CQGA 1ZETA 2DGVA 3MPWA 4LRCA 2MYFA 4RW9A 2BJ1A 3MMAA 2XMAA 2CA9A 3MI7X 5I3QA 3VAGA 3QT7A 1JLCB 5CCMA 1UVIA 5J2MB 1C1CA 3VALA 3H25A 2W2PP 5D15A 2R8IA 1BQNB 2MY8A 1JLQA 4ERDA 2BXJA 2AZ1A 4AQYJ 3TNVA 3UD3P 3CT9A 2M0GB 3DGPB 3L09A 4USKA 5HAOA 2O1PA 3LAKA 1MWZA 4RUCA 2FHKA 3B78A 4RNOA 4DMZA 2EK6A 1XMOJ 2GS8A 1N36J 1G1XA 1YG0A 4AL5A 4V19X 3MD3A 4EBEA 2CKWA 1UEKA 2VKRA 2NUUG 1YJ9S 1H6KX 3TJ9A 3EDQB 4ZPTR 2E1MC 3GSIA 2GHVC 4J9LA 3NCQA 4I4BA 1RAHB 3QRQA 2OTJS 3JAMU 4YHHJ 3VZIA 3LP1A 4CO0A 4R5PA 4WF9Q 2VPXB 1M1HA 3ZNJ1 1R8HA 4DWIA 2FTRA 3UDLA 1FI4A 2HS3A 2CJAA 2H4WB 3BN4A 3OTOJ 5H9FK 2ZKUA 2GMLA 3W9IA 3OVBA 5LM7E 1VRTA 2HW3A 1Y7PA 5KG6A 3FZBA 1VBYA 1RAAB 3QBCA 3E01B 5K8MA 1RBOB 1DARA 1XNQJ 3ET6A 4BHQA 2LVWA 3GTYX 4ECWA 1U1OA 4O4RA 4IKAA 4F7VA 2H48B 1VR6A 4F3MA 1E6YA 4QWAA 1Q86T 3QPIA 3CCSS 1T9WA 2R2UA 4OHWA 1CLFA 3C66A 4KH1B 4ZA1A 3TWZA 3CMAS 4KB7A 3DOMA 2YNFB 4WFNQ 4MH8A 3DM2B 5KOWA 5B0CA 1Q7YT 3A8EA 1LWXA 2GAHC 1IKVB 4B9LA 4IFYB 1DLOB 3PYEA 1SV5A 1K44A 4DR5F 3NOGA 3TJ8A 3I6PA 1X0PA 4ZVRB 3NNCA 3FQLA 2K1RA 3TA2A 4O3PA 2IDLA 2L48A 5IM0B 2V4JB 3PNIA 4KT0C 1WORA 3NY0A 1GQEA 2HHSA 3HK2A 4DR3J 3MUVP 4DL5A 2N3OA 1UJ6A 3HZEA 3D0HE 1VRQC 1M5PC 2OPSB 1NBEB 3KNGA 3W5YA 4PAAA 1S1TB 3P4UB 1VLOA 2C2ZB 3GJSB 5JUMA 3Q8RB 4FXDA 3POTB 2NPIA 2JSXA 1E6VB 4ED6A 1PKUA 3OXGA 4F36A 4N76A 5J2NA 3QO9A 2EEYA 3LP0A 4ELVA 3GPAA 4J37A 2Y8WA 3PJXA 2HQDA 2UUBF 4Q5VA 4DFJA 3T6BA 2AKWB 3QLHB 1X4CA 1F2HA 1RTJB 1NPPA 3CF5Q 4CRJA 1K47A 1VC6A 5KFJA 4N41A 3TR5A 5E41A 4B3MJ 3LPYA 2AMCB 4EK2A 2HMIB 3DYAA 3KHRA 3H5SA 1EP4B 1D1UA 2KFYA 2LXUA 4KRWA 3DRYA 2Q43A 1S49A 3F0NA 2M8DB 2V67A 3D6HB 5DG9A 1RADB 1RTIB 3DU6A 3KJQB 3R2CJ 5GMEA 2ACMA 3JAMY 3MM6B 2O67A 1AUSL 4DF4A 4MK9A 3AA9A 1MN9A 4UUXA 1FVSA 1ZM2A 3BKFA 2BKNA 1T03B 2MJUA 3IM8A 3BPDA 1S1VB 3E3XA 1F1BB 4OFZA 3I0RB 2JNJA 4QQBA
chains in the Genus database with same CATH topology
2OPRA 1U7LA 3CCRS 4TU8A 3ZZZA 4LF9F 1LW0A 1ZZFA 3MMCB 4BCAA 1J5OB 2EFPA 1YBAA 4F4KA 4XO0A 1XWLA 3IG1B 4WZQA 3IR7B 3OFFA 1S9FA 4IOAQ 2YWGA 3IWLA 1IQZA 1R0AB 2G4BA 1T03A 1S6UA 4C8NA 4N47A 5A8KA 3M2RB 3GV7B 1NO8A 3SSSA 3IRWP 3MM7A 2ZNYA 4C98A 2DRAA 2BANB 3G6ES 3K5NA 3M6VA 4B9NA 2FY1A 3DMJB 4JV1A 2KZMA 2KN4A 4MIWA 3CCUS 1TL3A 4EGLA 5C5JA 1SH2A 4C97A 1UMJA 2QIFA 5AE2A 3N6NA 2CQ2A 1SJRA 3MTKA 3JB9k 4QR2A 2MKKA 4DG1B 3N6MA 5CYQA 5IXUA 1KONA 4R25A 5DM7Q 2IM2A 3CJ2A 2VUGA 1RA7A 3IGNA 1S9EB 3AHPA 3O1LA 3OFHA 4AUKA 2F8EX 4G1PA 2CVIA 4USJC 3U1NA 1RT6A 2W7OA 2PE8A 4F4XA 3TW0A 5ADZA 2CQ0A 3ONQA 1WNEA 3M8SA 1PO6A 1PILA 5MLCV 2Q66A 3FMWA 3ZZTA 3M8RA 3V81B 4ED0A 3RRKA 5JVGQ 1P1LA 2DGUA 2KU7A 4CT9A 1FTRA 2P5VA 3DRPA 1EETB 1GXLA 1YVFA 2W24A 2HWHA 2GMHA 2CPFA 2LDIA 4O44A 2GC8A 2R8HA 3ISNC 4IH5A 1TKZA 4PG5A 3PO5A 2YKQA 3KK3A 1NJXA 1NB7A 2YKAA 1FKPB 4IRDA 2K2PA 3GFHA 4X4NA 1CEZA 5GAHU 4DQRA 4ALZA 4MIAA 2ADBA 4L3NA 1T7PA 4I0WA 1UEVA 4DBQA 3IFEA 3MXHP 2PFFB 3X1LB 2WSFC 1JXEA 2AP6A 3EPGA 2JH3A 1SJ4P 4K50A 1LKZA 1DTQA 2R7SA 2N7CA 2ROGA 2VASA 3HT3A 3JYTB 3EPIA 1X4GA 1CSJA 5T7LB 2B6AA 5KFMA 4ETZA 1WEZA 3LH2S 2IVMA 3CUNA 3TARA 2DISA 3ITHA 4OZ0A 1ULRA 4OQJA 3IO1A 3OFGA 1KC8T 1LFPA 3GYXB 1PSDA 4WKYA 2FJBB 4KE5A 3H40A 3ISZA 2W4PA 5CYJA 3FDSA 1H98A 1Y9OA 4K59A 4RBTA 1U1KA 4EYIB 1YTYA 1F5BA 5FD1A 3TVKA 5E0OA 1SJQA 4OI6A 3LO3A 3T1AA 3H2LA 2OPQA 1XNRF 1OSCA 3A1YG 1TV6B 1BLUA 2MKSA 3F41A 4B9VA 2N3LA 4ZP9A 3LWMA 3O3LA 3UI3A 4JI3F 4ZMMA 3RB3A 1TK0A 1C4AA 3N28A 5LJ3Y 2FGOA 4GMKA 1B64A 4MFBA 1BQMB 3VAJA 3LWLA 1J5EF 2VG7B 5F8JA 3OSPA 3EX7B 1N33F 2IRUA 3PV8A 3G6VA 4IDKB 4XPEA 3JTPA 4PQUA 2D3ZA 2VBWA 2RE1A 2YKMB 3HZGA 3CD0A 2F8HA 2PMZD 4J9NA 4CIOA 2OH2A 3M30B 2GGPB 5KFFA 4ECUA 1S0VA 2J9EA 4WCEQ 1DURA 1UJ4A 4AL6A 5KFVA 2BBEA 3K57A 1TZ0A 3LGNA 3KLVA 5L1IA 3T5LA 1YHQS 1UA1A 1NJYA 4B9SA 2PN6A 4JV5F 3PW7A 1WD6A 2KYZA 4WFXA 1FKOB 1YGYA 4IQXA 2LXIA 2YNHB 2VQFF 5GAEU 2PA8D 4YFUA 5D3GB 5AXLA 1N5QA 4U67Q 4UQTA 1B7FA 4G3IA 2HPUA 2I0XA 4OX7A 4QYRA 1P1TA 5J1EB 1GXTA 4LT6A 2MZ1A 5SZTA 4OI3A 3ZC4A 1WEXA 5KG5A 4M5DB 4JOUA 4O4GA 4UW2A 3OVSA 2BQRA 1Y5LB 3HHKA 5KT2A 4QW9A 3DRSA 2V8DA 1P9QC 4IOCQ 2KZZA 3PEHA 2XEXA 3ENQA 1VIOA 2FJWA 3OTDA 5AE3A 4Q2LA 3MEDB 1U26A 2CPEA 2BDPA 3NNHA 4F3OA 5G0RB 1UVNA 3GB0A 4A8WA 3GG0A 4QIWD 1H7XA 1TQLA 5KFIA 4ZP7A 2LMIA 1TP7A 1S48A 1RT1B 1FVQA 3I31A 3M6WA 4C3MA 4DFPA 1N5YB 3ZZRA 2YWEA 1N54B 4RNNA 3PFEA 2YKOA 2W7AA 4J9KA 4KSEB 3DI6B 3DOLA 1IJFB 2ASYA 4RZRA 2EC0A 3IN5A 2Z2MA 1DTTB 2AGPA 1HBUB 3J7Z5 5C25B 1HQEB 5GADU 2Q1LA 3OSNA 4V19J 3R3TA 2R2SA 1LW2A 2A3JA 3G86A 3BEGB 4HT7A 4ID8A 2PO4A 2DNLA 3MM9B 1S9GB 4QOTA 3PIOQ 1R27B 2B9WA 3AB2B 1OWXA 3E8OA 3MF5A 1RTDA 2V2KA 1VQ7S 5FDLB 2VFVA 3MAQA 2L08A 3N6LA 2N4DA 2IVYA 2ZD1B 3P49B 3LANA 4O3NA 3T5JA 2WTFA 2W4CA 4H4MB 3VZHA 3CDAA 3VAKA 4RU2A 3CEDA 5KFOA 3DI6A 4URSA 3L7PA 2GA7A 2MZJA 4RW4B 1JLCA 3MR2A 2WB1D 4DUZF 3U27A 2AJ4A 5D4NA 4U9RA 3K5PA 4B3OB 5J2MA 4PXDA 2BW2A 4P2SA 1NK9A 1RP5A 1YJVA 4NLTA 1VHFA 2DO0A 1BC6A 1FO1A 5B0DA 1S7HA 3CGIA 5EX3A 1BQNA 2NUHA 3SCLE 2OP5A 4IG0A 4XAKA 3M2VB 3SQGB 2KHDA 2CQDA 1S0NA 3CIMA 3GR1A 2C3OA 2RF2B 1UFWA 3OUYA 4NYZA 2CJBA 1N5SA 1LXNA 3DGPA 5EWEA 4NLYA 2VPYB 3H4DA 4MJKA 5K8OA 3MECA 4QIEA 1V9OA 1S4FA 4X4UA 3NS5A 1X0FA 1JJ2R 1RT4B 3W2WB 3HJFA 4K0KF 2BUNA 5HO4A 1VK8A 2BA9A 2R2RA 1HI1A 2VG5A 3FQKA 3MZIA 1TKTA 3TI0A 4ZHRB 4KC5A 3CD7A 3LW5C 1SB6A 3C6TB 4Y2CA 2E44A 4KO0B 4JBCA 4PWDA 2C22A 4RKUC 1VLYA 2ZDPA 4H54A 1RT7B 4ZP6A 4B08A 4ELTA 3GYNA 3SMZA 2W8LA 2FDNA 1KQSR 1T3NA 2DNYA 1GH8A 2E1RA 4WTYA 3BQ1A 4EEYA 1L3SA 1FJCA 1KR4A 4NA3A 5GAHI 1NU4A 4ELUA 2VD3A 1Y4ZB 2BE2B 3KLFA 2QMWA 3R5BA 1ZOTA 3FSIA 2E7XA 2MHEA 4NWBA 1H38A 2IYGA 4Q0BB 2KXHA 4WFYA 3V4IB 2P6TA 2B4PA 2CPYA 3PR4A 2B9YA 2RJZA 2RRBA 2ZOGA 5KT6A 1S1UB 3CJ3A 4GKKF 3PM9A 2XMMA 5LMUF 4PXBA 2RT3A 1V3SA 4AYBD 1NRKA 2GW8A 4DV6F 3CMES 2B4VA 4RW8B 4WFAQ 2DTJA 2VG6B 1ZZNA 1QSLA 4J5OA 2ASJA 3RRGA 4DR2F 2X51A 1A7GE 5HMZA 2ZM6F 2NQPA 1HNXF 3RB0A 2JEFA 1A6LA 5T14A 4W92B 2MQQA 1GTHA 2BE2A 2DIUA 1U24A 2IVFB 4K2XA 2GNKA 3FEXB 3KWMA 4WU3A 4DSFA 4RBVA 4DDFA 2PA3A 3BDEA 2OMLA 5ITHA 4ED7A 3PY8A 4Q0BA 1FXLA 2DD8S 3OXLA 5F8IA 2CPZA 2L9DA 4ZCMA 2ZBIA 3VQTA 3NWGA 5AXNA 3OHAA 5A0YB 1ZTWA 4F67A 4A47A 3TAMA 3CSKA 5T41A 2PD1A 3LF0A 5KFQA 1IJEB 1X5SA 3CC2S 2FVQA 3CCES 3NCPA 1WG1A 1HA1A 2DT9A 2MY7A 5D4OA 5F3ZA 5I4MA 1QVGR 1VS3A 1D9FA 1XK8A 1RT2B 3E01A 3RBEA 1NK8A 1GX5A 3TOQA 2LEPA 3MWBA 4NLGA 4I2PA 4CO5A 4R8UB 4YOEA 5B0BA 4PQAA 1KSPA 2HQ3A 2J7UA 1HHSA 2UVWA 4LSNB 4IUFA 5THWA 1KTVA 2J76E 2K3IA 2RU3A 2W8KA 1QY7A 4OHZA 1ZTTA 2HHPA 2XNQA 1JLGA 3RB6A 2K7KA 3IS9A 5GAEI 1FNMA 2CJ9A 1FRHA 4GO7X 4ICLB 3G6YA 2RS2A 4DF8A 1OQ6A 4CZCA 1VQNS 2X1FA 5K8PA 5A6PA 4CI0B 3Q24A 4CH0S 1MSWD 1JLFB 3EZ5A 4NLDA 2XC9A 3PW5A 4LF6F 1SJ3P 4FF1A 1QVFR 3I55S 1RT5B 1S6QA 2FLPA 2FUG9 5JVHQ 1FRLA 2DH9A 2J6SA 1FK9A 1IM4A 4UUWA 2K3KA 3PRBA 4AQYF 4BC7A 4PUOB 3TVYA 3IWNC 4ZCKA 2KJWA 1X4AA 2C3UA 3KG0A 1YRTA 3HKWA 2YNFA 2XSJA 3M32A 1JXLA 1S6PA 3O6QA 5L39A 3DM2A 4OLPA 1U1MA 4N56A 2R4FA 2PI4A 5GVQA 2KRRA 4R0EA 2OKQA 2DBBA 2XCPA 3MAHA 1HPZB 2QA2A 1U25A 3K2YA 1SUQB 1N36F 4DL4A 5KFBA 1IKVA 2FVPA 4IFYA 1DLOA 1FRJA 4RW7A 5GADI 2HNYB 2G0CA 1C0TB 1H3DA 1RK8A 3HHLB 1R8CA 5DO2A 4CQ1A 4A4JA 4DPOA 2R7OA 5K14A 2QMXA 3AQOA 5E33A 3NBPA 3CCVS 5EN1A 1U6FA 2GHWA 1RGVA 1KEKA 3MEGB 1RKJA 4KV8B 3KJVB 5L9NA 4DL2A 2FHJA 3GIJA 3DC2A 1T3OA 3SDEA 3PHEA 4RWXA 1G7CB 3UCGA 3BDPA 4C8YA 3N0VA 2XHWA 4ZVHA 3DRRB 4B9UA 1SKRA 4F50A 1SIZA 3D0GE 1JLBA 3SCIE 4DR7F 1BY9A 5A2QY 5E3RA 1W25A 5L38A 3FCHA 2YX4A 4WKRA 3N5FA 5A6WA 1S1XB 1URRA 5IM0A 5H1SV 2V4JA 3THPA 4KFBA 4NLUA 4OX9F 2MQPA 4NMLA 4LF4F 4ED5A 4EZ6A 4A8OA 4G1IA 1ZH5A 4MK7A 1WHXA 4DL6A 4K4SA 3ISND 5CZVA 1C0TA 5F8HA 3FSXA 2VL1A 2JL9A 2ZBCA 3QAUA 1K73T 3C6UA 3I32A 3J80Y 1SH0A 3S01A 2IJFA 2JRSA 3HVWA 3L7OA 4DR1F 2E9TA 3Q23A 2DNOA 2DR9A 2XZWA 1C0UB 1W2IA 4G1QA 4BDPA 1X8DA 1LFWA 3OL7A 4PG6A 2AJFE 2QSFA 4FXVA 4LUBA 1HBNB 3OTOF 2UXDF 2OPSA 3BZQA 2YNGA 1FJ7A 1JMTA 2PI5A 2XI3A 2ZKTA 5F41A 3VAMA 4FBTA 2GHPA 1S1TA 1T94A 4N8NA 4XDDA 5F0UA 1HD0A 1HWJA 1J2VA 4A8MP 3PO4A 2DGWA 3UW1A 2QZ8A 3CCQS 3POTA 4CH1A 1XEZA 4TY8A 1E6VA 4C8KA 1M0SA 1O51A 2MSSA 4QWCA 3I9ZA 3PR5B 2I9SA 2YWFA 3DU5A 3R5DA 4AFFA 1JWWA 1RTHB 2CQBA 3F56A 4RX6A 4YB5A 2OPPB 2D3UA 2O5DA 5DGAA 4OZNA 1PC4A 3QIDA 3RW7A 2HWIA 3FRZA 3IA0A 1DQ8A 5KOXA 2ZHOA 3MPVA 4Y0FA 2W7PA 2CG4A 4WE1B 1L3VA 4LIRA 3AH6A 1WTFA 1UWBA 1WF2A 3W2VA 1YRXA 4NLRA 1TL5A 2E7WA 3N9UC 4QPTA 2J0WA 3TO8A 2C3PA 4A48A 1SXLA 2VBZA 1K1SA 3DLGB 3IXQA 2ERRA 1KOOA 3LP2A 4TN2A 3H20A 4JV2A 1K8AT 4TLQA 1H7WA 3WX4A 2I1RA 3DCAA 1QAYA 2EW9A 4I6WA 3UCUP 6FD1A 2UUWA 1FKAF 1RJJA 3HFKA 2HRUA 3S7RA 2ZH6A 2VODA 3ZZPA 4ILRA 3CD5A 3QLHA 3PX0A 3K8VA 4J9QA 5D77A 2XNRA 2AU0A 3HPOA 1IBLF 4YY3F 1U1PA 1RTJA 1NZAA 3BGRB 1DBDA 3IGVA 4FYDA 2B56A 1GX6A 1SH3A 3VAFA 4I7FB 3DOKB 3TUIC 1S77D 2DRBA 4I56A 1XMBA 4ED3A 2X1GA 2NS1B 4N5SA 5J1NA 5LXRA 4RW6B 2WRMA 2I8EA 2AF6A 1SBRA 2E9RX 3KTQA 2FD2A 3KOAA 2R8GA 4N8OA 4OI1A 1FDAA 1REVB 3CCTA 2HMIA 3ICLA 4ECQA 2JVOA 2LKZA 3TQ1A 2IC3B 2M7SA 1IKYB 3DHXA 5H9EJ 2J9CA 2N4CA 2KJVA 5J1PA 2CQ4A 1EP4A 2LECA 2R7UA 3JSRA 2ZOMA 1QE1B 3TYTA 4I6YA 2C3YA 3MOJB 1T05B 3CCJS 1HARA 2DIVA 4TKTA 4C8MA 3SEOA 1MW7A 2HNDA 3DOKA 3TUJC 4KKOB 5F0WA 4ZKAA 1C4CA 2M3DA 2W9CB 3TA0A 5IT9Y 1UA0A 4C8OA 1F60B 2QSWA 1X4EA 1R43A 1QAJA 1Y3JA 2V0NA 2LXFA 4YP3A 4H4OB 3CCZA 1FEEA 1RTIA 5JJBA 2ZH8A 2MB0B 3WC0A 1M5OC 3GSDA 4QU6A 4ECYA 3E51A 2YNIB 1RT3A 2PIIA 3MM6A 5HBMB 2DB1A 4JI1F 3PACA 4B3SF 2E5IA 2XO7A 2HNZB 2DHGA 3M2UB 3I0SA 1R89A 2EFOA 2E1CA 4DFMA 1XR7A 4IH6A 1R8AA 5DQGA 3G9CA 1B0TA