2FIUA

Crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
b'MAKGYWIAQVDVRDSERYKDYVSTAKPAFERFGANFLARGGSVTELEGTARARNVVIEFPSVQHAIDCYNSPEYQAAAKIRQEVADAEMMIVEGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
molecule tags Structural genomics, unknown function
source organism Agrobacterium tumefaciens str.
publication title Crystal Structure of the Conserved Hypothetical Protein Atu0297 from Agrobacterium tumefaciens
rcsb
total genus 30
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07045 DUF1330 Domain of unknown function (DUF1330)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fiuA00
3F44A 1IUJA 1OQ6A 1KVIA 3TOQA 4DN9A 2ZDOA 4ZA1A 1FE4A 2W4DA 1OSDA 1VQSA 1OPZA 2ROPA 1FE0A 4A47A 2G9OA 1X0PA 3HHLB 2QYCA 3MZIA 4EFAC 3KKFA 1K0VA 1YJVA 3E8OA 3HFKA 3LO3A 3LGNA 2AW0A 5B0EA 3KG0A 1AW0A 2AJ0A 4HH1A 3WDOA 1TL5A 2KT2A 1Y3KA 2K1RA 5B0FA 2Q3PA 2QIFA 1YJUA 2K1RB 2L3MA 3KG1A 3BDEA 2HFOA 2GA7A 4FNHA 3CJKB 1AFIA 1Q8BA 1Q53A 2LDIA 1VQYA 2PGCA 3UDCA 2XMMA 2BYCA 2GCFA 2EW9A 2IFXA 1N5TA 2BJEA 2LQ9A 2N4CA 3BM7A 2OKQA 2OD6A 2BJDA 1X7VA 1N5VA 2AP6A 2FB0A 1Y3JA 1RJJA 2IYGA 4U9RA 4HL9A 4YEAA 3CJKA 1LQ9A 4F67A 1S6OA 4FNIA 5B09A 2OFGX 4Q2LA 1Y0HA 5IXUA 2QLWA 3VTIA 1WD6A 5T7LA 1CC7A 4DL0C 5T7LB 2ACYA 3HDSA 1YG0A 4HH0A 4NL5A 5B0CA 1AFJA 1FVSA 2RILA 1QUPA 2VH7A 3HHLD 2LXFA 5B0AA 3HHLA 2FHMA 2FTRA 1KQKA 2GV1A 3MCSA 4ZOSA 2ROGA 4NPOA 2HLUA 2KYZA 2HIQA 2BBEA 4HI2A 4A4JA 2N7YA 4OJ3A 5A6PA 3IWLA 2OP5A 2OFHX 3FRYA 1YRXA 2IYIA 1XBWA 5A6WA 2RMLA 2PD1A 1TL4A 3QMQA 2K2PA 2QLXA 1FESA 1SB6A 1X8DA 2XMWA 3BGUA 1YJRA 3BR8A 1Q8LA 3QGPA 4Y2KA 4Y2MA 1Y9OA 2AJ1A 2HQIA 2LQBA 2OMOA 2JDJA 3KNGA 2KKHA 5F0WA 1FD8A 1TUVA 2XMTA 4YDXA 5K9FA 2GO8A 3HHLC 1Q4RA 1URRA 4QOTA 1CPZA 3LGMA 1JK9B 5B08A 2K7KA 2KT3A 1YJTA 2W4PA 2HFNA 5F0UA 1R6YA 3FGVA 3IWXA 1CC8A 2VV5A 1V3ZA 2W4CA 2RSQA 1N5SA 2ASYA 2XMKA 2GGPA 3BN7A 3DXSX 1W2IA 1ULRA 3K7RA 2RU9A 3BB5A 4OJGA 4Y2IA 4DPOA 2N4DA 4Q2MA 4OIXA 1SQEA 4OJ1A 3TRGA 2GGPB 3DCAA 1TZ0A 5B0BA 4A48A 1P6TA 1N5QA 1OQ3A 1P8GA 2K7JA 5KAKA 1KVJA 1JWWA 3HF5A 5B0DA 1S6UA 1U7LA 2OAUA 4A46A 2ZDPA 2XMUA 2CRLA 1FEEA 2XMJA 1MWYA 3T9NA 3FMBA 2HLTA 2OD4A 4OJHA 3TNVA 3HX9A 1SI9A 1TR0A 1FVQA 1GXUA 2GFFA 2ROEA 4HI1A 1APSA 2XMVA 3I9ZA 1MWZA 3GZ7A 5B0GA 1GXTA 2FIUA 3BF4A 2BUNA
chains in the Genus database with same CATH superfamily
2GAHC 3LOUA 3MM8B 2D1CA 1YKWA 3C14B 4DN9A 1HNIA 3CCTA 5ADZA 1WHVA 3MM5A 2QZ8A 9ATCB 5KFMA 5DGBA 2EG2A 4DU7A 3KJVB 3G71S 1ZTTA 4X4UA 5AJ3F 1XR7A 2G9OA 3C15A 4ID5B 2MSTA 3LO3A 2V4JA 2HQFA 4ZKAA 3KG0A 1RACB 1A0OB 3H90A 3D68A 4DV0J 1RWMB 4YB6A 5DDRC 2XS5A 4TN2A 5B7WA 1JNZB 3AXKA 4AXJA 3M9NB 3TAQA 3E01A 4LF7F 4B3RF 3NNCA 5D6GA 1WEXA 3CDEA 1W25A 2QN6B 1Q53A 1SV5A 2W7OA 1JLEA 1PJ5A 1S10A 5KFYA 2GCFA 3TWZA 1IKXA 3ZXWA 4M94A 1GK8A 4MK9A 5D78A 2BANB 3DOLA 4Q0BA 1U2RA 5GAEI 3M2UB 2GQCA 3POTA 2XCAA 4WKRA 4EMDA 3LTOA 1SL1A 1GMWA 2H4WB 4DV1J 1QUVA 3N6LA 5IV4A 3M6XA 5DG9A 2YWHA 3C46A 4QWCA 4B17A 3HSDA 1HBMB 2J9EA 4CLSA 3A3OB 3G6VA 3R27A 4ED5A 2ZJQQ 2MZRA 2RT3A 2QSFA 2YKNA 4YHHJ 4GKKF 2DR7A 2O1PA 2XGQA 3OR2B 2GS8A 1VRUB 5EUHA 3HHLA 1J2VA 1QAYA 3EZUA 1CJUB 2GJFA 2BEFA 1S9FA 1FO1A 1NJYA 2BE9B 1BY9A 2B7CB 2E29A 1U1MA 4C8LA 4OJ3A 4CLPA 5LSRA 3IWLA 1RHUB 2OP5A 3FEYB 3LAMA 5D4NA 1U02A 1HI0P 2PFFB 4EI2A 1IBLJ 3SZ2A 1UA1A 2MEWA 1WC4A 1ZM4A 2P6SA 2EG1A 2PSZA 3IS9B 1A9NB 2UXBJ 5ETKA 4FBTA 3KHHA 3GFXA 4DL7A 1Q8LA 4EO8A 3OUYA 1F3VA 2MHNA 3PEJA 2DK2A 2N7CA 3U1MA 4LF8J 4EWTA 1MMLA 3CCWA 4DUTA 3EJMA 3ISNC 3M6UA 4Z7YA 1HBNA 4M5HA 5L1IA 1WC5A 4HVZA 1RA6A 1LWFB 3CIMA 3CO0P 4AT1B 1EETA 4ZCIA 4DX7A 4X62F 3KJNB 3GV5B 4DR7J 3Q83A 2HW3A 2W4PA 4EEYA 2HFNA 3BYRA 2O5DA 2Z2ZA 4ED2A 2J0XA 2V6AA 2XWYA 4C98A 4DBQA 2W4CA 2W9CB 3DLLQ 4KYZA 3T1HF 2O3DA 2W1BA 4KC5A 1K47A 1U6ZA 2JHEA 4ECXA 1UA0A 2ZH8A 3I6PA 2NXCA 1SKRA 3R6GB 1R31A 1RAIB 1ULRA 4FVMA 4MIAA 1XN9A 5J1NA 3NLCA 4DR5J 1EX8A 2RKIB 3RW6A 2Q66A 3MOZA 1S76D 3Q89A 3DOMB 3IR6B 4ZK7M 4A8KA 2BQ3A 1PAUB 1FRHA 2E1MC 3KMSA 3CEDA 3VGSA 4ZCMA 3T1YJ 4NLGA 4P75A 4DL3A 1TU0B 1U4BA 1T03A 1FF2A 3ZZRA 3ICLA 5HO4A 2QX0A 3BO2A 3CSKA 5KFIA 1S6UA 3I55S 3GJTB 1LOUA 3NRBA 2XMUA 3NMRA 5KOWA 3TUJC 1N0VC 1PYSB 2VB6A 4DSEA 2HKEA 2CQIA 3DGPB 2J6TA 3W65A 1TK0A 1FFGB 2K8GA 3DGPA 2OD4A 4RUBA 3MR3A 2E7VA 2GHWA 2PC6A 3AAWB 3HX9A 2C3MA 2RB7A 4PWUA 2EXUA 4ED4A 2ROEA 2Z30B 3D3CJ 4NZ7A 4QW8A 1MWZA 4QWAA 2J0WA 1S0OA 3I56S 1IM6A 2PE8A 4CM2A 3WZ0A 1RWWB 1JLCB 1GX5A 3OLAA 3W3SA 1PYOB 3FMWA 3TOQA 1T02A 2HNZB 4NYOA 3L7UA 4ZMMA 2DO4A 3QNWB 5CYMB 4X64J 4FYVB 2VQFJ 2CWKA 1B99A 1I5OB 1YITS 3L7OA 2P9EA 4FPRA 3VZIA 5ETVA 4AYBD 5LMNJ 1F0XA 1UMJA 4ILLA 2J0SD 3ZTOA 3R97A 3Q0AA 3MMCB 4IR9A 2FPHX 3NCQA 2RDDA 5DO2A 2OPSB 2AYMA 2UV8A 5J1EB 3PYFA 4CYUB 2HBRB 5HL7Q 2XY5A 3R2CJ 4DV2F 4K0KJ 4P7VA 1VRQC 2GNKA 1FNMA 1WI6A 4BC9A 4IOBA 1Q8BA 5CD4A 3GIIA 5DGAA 3RRGA 2JC1A 1TFYA 4USTA 1N5YB 4WE1A 4I69A 3NKYA 1LW0B 3NOGA 1I94F 4ZLJA 3TVYA 4PPDA 1VIXA 4TYAA 4GKJJ 4DL6A 3RRKA 4JP8A 5EWGA 3Q8PB 3N5BA 2ZC3A 2VOPA 2UZAA 3HJFA 2OPQA 4G1QB 1AYEA 4I67A 2COLA 3G2XA 1R0AB 4IDKB 2RF2B 1U0SA 3SSRA 3W5ZA 1NRKA 5A0YA 3OJSA 5U47A 3SDEA 2BQUA 4ZITA 2B4OA 4CLTA 4ED7A 2RILA 3HVTA 5BYQA 4ID8A 4NEYA 4UQTA 2RUGA 2GV1A 2AZ3A 3EE3A 5LMUF 2NCKL 1BQMA 1NK0A 3T5HA 1IKYB 1CJTB 3SIPB 3D66A 2RQCA 2VODA 4DR3J 4O23A 2HHXA 1K73T 1YK9A 1BHNA 2RMLA 5T41A 1FDAA 1H3DA 5JXSA 4NCGB 2I9SA 1HNWJ 4RW6A 4UOHA 4Y2KA 1JNRB 1RADB 1WG4A 4ITSA 2AJ1A 3PW0A 3KNGA 3C19A 1PBAA 2JDJA 2L9DA 3MFIA 1FDDA 1C0UA 2J0QD 2MQQA 5AE1A 2HRTA 3SBMA 3UN3A 2GZOA 4F4AA 3D54A 2OTJS 2KB2A 4PZVA 1HBMA 1RWVB 2XYGB 4K4WA 2OSQA 3KYLA 4XDCA 3DMJA 1CJTA 3CNQP 4L72B 4A8XA 1KLMA 4OV1A 3PXGa 5I4MA 4MKAA 3GSIA 4HT5A 4Q5VA 1LWXA 2M8DB 3PJXA 5EDWA 4JI1F 4JI2F 4EZ9A 1SC1B 4OYMA 3KMQA 1U49A 4NZ6A 4NLSA 5A2QY 1J5OB 5EGYA 4W92B 4H4KA 4ID5A 3GR1A 3MUMP 3CD7A 4N7TA 4O3RA 2DR6A 3IRXA 1CJVA 3RZAA 1T3OA 1TZ0A 5J2MA 1U0HB 3TAPA 3BPSP 3T5LA 2RUSA 2CZ9A 2BRLA 3N79A 1P6TA 2E44A 4WK3A 2W7PA 2I1RA 4IG3B 2K7JA 2UXDJ 1BC6A 3CXCR 1U1RA 2PDAA 1VFJA 2HVEA 1HL6A 2W8KA 2LQJA 2FQQB 4BWMA 3DHXA 4GC6A 4NE9C 1OSCA 3EGNA 2YWGA 4IH7A 2KHCA 2X7IA 3R5BA 3QPIA 1M5VC 1XMQJ 3LH2S 3BPDA 3QIPA 1G1XA 5KFTA 4A8FA 2GVDA 4F2RA 4C3MA 2DJWA 3MM9B 2MKYA 5J2PB 4F4ZA 2CPHA 2F4FA 2ZOGA 4KKOB 1KHWA 4UT4A 3D67A 4K4ZA 1NHVA 3HZEA 2M52A 4I2PB 1Y10A 1Y4ZB 4ZPTR 2A3JA 3MAAB 2ATLA 2ZEJA 2AZ1A 3N28A 2R7SA 4X65J 4CQ1A 1O8BA 2YWWA 2KXFA 3OFEA 3TZWA 3TX8A 4QWEA 1HQEB 1IVZA 3M05A 2BJ1A 4IYQA 1S9EB 1SIWB 2JC0A 1IR2A 3BGOP 3PJ9A 1YRUA 3GSDA 3PZPA 4HHJA 4PWWA 5CABA 2J9CA 5DS7A 4DOZA 2IDEA 1C1CA 1D9AA 4IOCQ 2XSFA 2YH0A 1RI7A 2YQ0A 2XO6A 3SV3A 3OVBA 4M5KA 4QU7A 2N3OA 2IAJA 3JQKA 3FKBA 4DFKA 2OJ3A 2LDIA 3UR3C 2E9RX 3NGRA 4H4OB 3FFIB 2EW9A 4ECRA 4OI3A 4OMFG 5F8JA 1ZA1B 3JTOA 2ADBA 1WF1A 3TQ1A 2YVSA 2IYGA 4HL9A 3LW5C 2X3GA 3I4PA 1S6OA 4F26A 4RW9B 5IQ6A 1QE1B 3M9OB 2R8KA 1J27A 2DXEA 4CNZA 3GIRA 4MIBA 4RWXA 1GEHA 3FVYA 2CQ3A 1E6VB 2HQCA 3GV8B 5L38A 5F8LA 3KTQA 2JVOA 3MDFA 4TXSA 2HWHA 4Y28C 2PMHA 4DQRA 2AU0A 4O0NA 2W25A 4B9TA 3DI6B 3Q2TC 3CGIA 4NLDA 4JI6J 1TAQA 1AB8A 1T11A 2FHMA 3DRPA 4O44A 2XY7A 2GIRA 2ROGA 4NPOA 2LU1A 2W9BB 3PW4A 4W4MA 3DRSB 2M2BA 3QGGA 3C66A 1XMBA 2YPZA 4MYUA 1GH8A 3CJ3A 1H2TZ 3T19A 2GQQA 5KG1A 3CJ4A 5HBMA 3V6DB 1RYSA 3KLHA 2O67A 2Z0GA 2G2ZA 5HI7A 1IR1A 1HNXF 3MM7A 1NM2A 4Z2XA 4NXMJ 1N33J 3ZZUA 2VFTA 5KT3A 4DUYJ 1RT4B 1X4FA 2CJBA 3QRRA 2DH9A 2LEBA 4DX8H 2FJWA 1DARA 4OQJA 1LK7A 2BE7D 3ET6A 2EVZA 4FYXB 4QOTA 2OGUA 2ZM6F 2JNJA 3MEEB 2R7XA 4RJVA 3OL7A 1FKOB 1WEZA 4ZVQB 3H4DA 3C6TB 2QA4S 2XHWA 3W63A 1UETA 2G1HA 4AL6A 3BQ2A 4L74A 4ZCLA 1N33F 3UD4P 1B7YB 4PR6A 3FK4A 3NS5A 3KDOA 3OUYB 4P10A 3QJPA 2RNEA 3PW2A 1BLUA 2GIQA 4M8LA 3R1LA 3HHNB 1N88A 1UP1A 3DXSX 3EUNA 1QY7A 4LF1A 3IAM9 4Y2IA 4AD6A 4DG1A 4ED1A 2IVFB 4DR6F 3RB0A 2N4DA 5D4LA 4FF1A 4RW6B 2R7RA 2HIYA 1RYRA 1D8ZA 3CD6S 3F56A 3MM5B 1NAQA 3HT3A 4ZVEA 3KJVA 4A8YA 3M2UA 4FKXA 4H54A 1WF0A 1P9QC 1U25A 1IJFB 2ILZA 5B0DA 2RVJA 1NKEA 2ZDPA 3IFEA 3V4IA 2C42A 3GYGA 4J9SA 4QZVB 3PO4A 4JV0A 3FQLA 3R9LA 3EDRB 4KR0B 3W9JA 5A8RB 4XPEA 4OJHA 3PVXA 2YNIB 2CJKA 1UL3A 5F8GA 2F63A 2V4RA 2WCXA 4ER8A 3A8IA 1NJIT 2UXDF 4DLEA 3GMGA 2V2KA 1REVA 2ERRA 2HK3A 4X4TA 5DDOC 3MPVA 2BANA 1LFPA 2VKRA 2QL7B 3DOLB 3H2VE 3HI9A 3CCES 4J9OA 1IUJA 1OQ6A 4B3SJ 1KR4A 4K0KF 5BXIA 2GMHA 1DURA 4J9KA 3UI3A 2C2EA 1OSDA 1VQSA 1RWUA 2QLJB 4P7TA 1J5OA 2ZH3A 3LA0A 3JXOA 3NOCA 4CIOA 2KZMA 1JXEA 2XS2A 2W7AA 2A2DA 4OZ5A 2B43A 4HH1A 3CTRA 1JB0C 1DLOA 2QA2A 1UTAA 1Y3KA 3CT9A 1AROP 2QMWA 3EMTA 3ETMA 3OR2A 3VHQA 1YJUA 1HR0F 5FJ4A 4KE5A 3BDEA 4ALZA 3TR5A 2YKPA 4ZVOB 3D4JA 4NCGA 1S9EA 2FD2A 4DQPA 3D6FB 4V19X 3PHTA 3J81Y 2CQBA 3DLKB 5LT5A 2V2ZA 1HBOB 3SCKE 3E2EA 1FEHA 3ZTRA 1XMQF 2I5JB 3CD5A 2M5YA 3D6HB 1N32F 1Q79A 2EK1A 1X7VA 4KT0C 1QD1A 2Z58B 1TK8A 3PEHA 4C9DA 1HFEL 1ZAVA 2XTJP 1SL0A 1T05A 2YTCA 4KIAA 2C2DA 3H7HB 1TKXA 3QT7A 1D1UA 2FLPA 3MEDB 3R5DA 1HNVA 4Q43A 5E0OA 2EFVA 2HHHF 2DRAA 3NEKA 3QBCA 4NI2A 2D74B 3U1LA 1TUGB 3ILJA 3UD3P 1H0HB 1VGYA 3OFGA 5KG0A 1KDNA 3QT5A 4O3QA 3KUGA 3A4TA 5KTQA 1JJ4A 4WP8A 4NOHA 1C1CB 3JSYA 5BYSA 1VR6A 2VH7A 1TP7A 4C48A 1LW2B 4X84A 4E0DA 1WC0A 1KQKA 4ZHRB 4F4YA 4TQRA 1RLDA 2G4BA 1UEKA 3BQ1A 3KJFB 1G6BA 1VCTA 3C14A 1URNA 4LF6F 3R7SB 3CJTA 4EGLA 1RP5A 3CB4A 3PFOA 5HQMA 3CMES 1NJWA 2JEFA 3EVWA 5J2QA 5J2MB 2AQ4A 2FY1A 1VC0A 2IRXA 5E2QA 3CCJS 1WF2A 2NREA 1SUQA 4NA3A 2P9GA 3FSYA 4ZP7A 1GX6A 1HI8A 3RB6A 3T3FA 3CJ5A 1WHXA 5DDPC 1TELA 3HLUA 2Y3YA 4ZS6A 3SSQA 2MDAA 3X3UA 4DHVA 1OO0B 3K5LA 1K9MT 2LLZA 3TUIC 1H74A 1U6FA 1N36J 2VG6A 2EKYA 4TYBA 2YKAA 1CJKA 2KT3A 2VG7B 2FJBB 3OFFA 4DL4A 5IV3A 4WKYA 1R89A 1S6QB 4QPTA 1FCAA 1Z2LA 1DY3A 4FXVA 3T5KA 3GV7B 1QAIA 1R8HA 4AL5A 4EBEA 1R27B 3VAHA 3EVMA 1RTJA 2OPPB 3V6DA 4OLPA 4F50A 2HPUA 3WX4A 5F9NA 1UEVA 3PO5A 1S1TB 2HAFA 4NRTA 3E3XA 3GFYA 2Z2YB 4HTJA 5KFZA 3ZZ0A 2J9DE 2ZUGA 1KEKA 3MUVP 5HLFB 4QIEA 2Q1LA 3I9V9 2LEAA 1CJKB 2VG7A 2WVFA 1RT3A 3NGKA 2M7SA 4PG4A 4CZCA 1LWFA 1WEYA 4AUKA 4OX6A 3TJ9A 3MMJA 5KAKA 2VBZA 4K7QA 3QGHA 1N54B 2IJNA 2RS8A 5K8PA 4UW2A 2OAUA 4ES3A 1WUUA 1FEEA 2W2QP 3BBBA 3PCOB 4MT1A 3QSYB 2Q6CA 4WP3A 1Q7YT 4KO0B 1GXUA 2BW7A 2HHPA 3Q8QB 4A8SA 1HKAA 4RLEA 3ISZA 3ZZYA 2NZ4A 2ZBPA 2JRSA 1KOOA 4N8OA 4P9SA 2ZHBA 5E7OB 2XM3A 1XIQA 3AB2B 2KU7A 2LYVA 2HNYA 5K20B 5E41A 4OHWA 5IC6B 3PHEA 4DF8A 2V63A 4DV0F 2R4FA 2MGZB 2XLKA 2IBKA 2VG5A 3KKFA 2RD5C 2J8AA 1YGYA 3OFHA 2VD3A 3C8YA 3HFKA 4F0KA 3LWLA 2YPYA 3G6XA 2C22A 5C24B 3EM1A 4HACB 2KH9A 1D9FA 2PI4A 2VASA 5ETRA 5DQHA 2XO7A 1OJ4A 3IA0A 1H2VZ 3GCWP 2E7XA 2OI2A 1NKBA 2UUCF 4GMKA 1MLAA 4FNHA 2GA7A 1DFDA 4J7CA 5IM0A 1WOSA 4NEZA 4ZN3A 4YHHF 1F5CA 2ASDA 4F4XA 2IFXA 1IKXB 2BJEA 3HVAA 1HMVA 3EDQB 1HA1A 3ENQA 2AP6A 3PW7A 1V9OA 4F7VA 4TU9A 2FVPA 2C2NA 4FF3A 2B0GA 3PG9A 3Q2SC 2R2SA 4OYXA 1YIJS 3QATA 3QQCD 1FI4A 1GMUA 2V69A 2CUYA 3SCIE 3MCMA 4O3SA 1JKHA 1S1XB 2FGOA 1N48A 1QDUB 4X4VA 4FPIA 1DHMA 2AX1A 2Y8YA 5E5NA 1Q78A 3AY0A 1HW8A 3LALA 3ZO7A 4J9PA 1PC5A 3D0IE 3QT6A 1X4GA 2PT0A 4DSFA 2HMIA 3LP0A 1LFWA 1TL1B 2LQ8A 4HI2A 2I6WA 4A4JA 5C42A 1F2HA 3VAKA 3HK2A 2DNLA 2ZBIA 3I31A 3PRDA 1PILA 4DX5A 1PSDA 1HBOA 5A6WA 1TKTB 2PD1A 3E51A 5HANA 1L3KA 5E33A 5A2QU 2QLXA 2AYBA 4JUZA 1SB6A 2VFRA 3QRPA 3PFEA 1VS3A 2HGLA 2V2VA 1RT5B 4KV8A 2CJXB 4ZP9A 2BJ8A 2MY8A 3MEDA 1RT5A 1WTFA 1YBUA 1TL3A 2W2OP 3MMCA 4H4MB 1VDHA 3FZ2A 5GAEU 3L3CA 1Q8KA 3CMAS 1YJ9S 4WF9Q 3R7NB 3PNIA 2NSBA 3KLEB 3WIUA 5KFEA 1WC3A 2VBWA 1CS4B 2WVBA 2HHWA 2HHHJ 4TLRA 2WB1D 4IG3A 2V9KA 3MAQA 3H20A 3LQVA 3I5BA 2XYHB 2F8MA 3ULHA 5K14A 3K5MA 2KL8A 3DKDA 4NMXA 3I87A 4LREA 3UO0A 3JSRA 4F3MA 4YFUA 3FSIA 1KFDA 4IFVA 3RB4A 3P6YC 1CC8A 1WI8A 4HDHA 2VOOA 3TO8A 4QR2A 1ZM9A 4ELUA 4NYZA 3QWUA 1OY8A 3K59A 3X1LB 1Q5YA 1VI7A 1NDPA 5GADI 2DISA 2IVYA 1WDTA 3H5XA 2XHCA 1HI1A 3RBXA 3UD5A 4A8OA 3CCUS 2Z8QA 2QV6A 2DT9A 4B3MF 2R3VA 2RKIA 1TMMA 1R8PA 2DB1A 3I96A 3BGRB 4QIVA 5D4PA 2BOPA 2B5JB 1NDCA 3DRRB 5THWA 4KAIA 2EKNA 2QE5A 4C8NA 2RDJA 1YSJA 3BO4A 4GKKJ 3PTWA 3G8QA 4WTOB 3SXLA 3O8WA 4PYAA 1VBYA 3DLKA 5GAGU 1PO6A 3N01A 4WP9A 4CT9A 5JUMA 2Z56B 2ZVSA 3RBDA 4LQ3A 1XERA 1X0FA 1S97A 3P3DA 5EX3A 3SQGB 1K0TA 3CF5Q 3K5NA 5ETTA 3ISND 3FMBA 2HLTA 2VPXB 4DV6F 4ZLPA 1S48A 2E5JA 4NXNF 2IAJB 2NLWA 4TNOA 2MJNA 4F25A 2YX1A 3K17A 4DPWA 2BE2A 1QVFR 4PWDB 5EN1A 3QO9B 2KJWA 2QL9B 4IFYB 5BR8J 2B4VA 2MZ1A 2LEPA 1RE1B 3SCJE 3BJYA 3N9UC 3VALA 1OPIA 1RAFB 2IM3A 1FHTA 2RQKA 1RTDA 1HR0J 2D3ZA 3M1VB 2DEJA 5L1KA 1ITPA 4I2QB 2ZE2A 3PM9A 1X9SA 3TUPA 3E8OA 4WZQA 4LF2A 5CXTA 1E6VA 2D9OA 2R8IA 3MTKA 2CIMA 1OY9A 1BE4A 1MU2A 5G0RB 1FRIA 1GXLA 1MU2B 3QO9A 1B0PA 4K5RA 2HEKA 4N8NA 4USVA 4OI2A 4IDKA 1HLWA 4ZJOA 4YY3F 4O3OA 2J76E 3QIPB 5C24A 3CC2S 4ZP6A 5A8WA 1NLKL 5DM7Q 4UY85 3AJDA 3C6TA 2XMMA 4IKAA 5HBMB 4CNYA 2CQPA 2RIJA 1N5TA 3BM7A 5KFSA 3THTA 3KLGA 3KK3A 4M5DA 1N5VA 5DJBA 3IN5A 1UW4A 1FA0A 3HKZD 4I7FB 4U96A 3DMJB 3OVAA 2Y0BB 4LVOP 4Q2LA 4LF9F 2YNFB 4RW7A 1FRJA 3EGVA 3PIPQ 1UEUA 2CQDA 3NXZA 3R5AA 3UVJB 3W64A 1CG2A 3MR5A 1NCLA 2KO1A 2OEKA 1T9TA 4J9RA 5E3AA 1IKWB 1IN0A 4B3OB 1RWNB 1JXVA 3QJJA 5LOQA 2JLEA 4DR4F 4UUXA 3DLEA 4FS2A 5LSLA 2F4VJ 2HLUA 1ICEB 3QZ7A 2KYZA 3QZ8A 1VQKS 4C6AA 3W8GA 3M2RA 1XC9A 2XSJB 4U6PA 7FDRA 3OL9A 2AEMA 2QA1A 4NWBA 1AXQA 3QJLA 1RDRA 3IBFB 3UCZP 2K2PA 4OYPA 2FZGB 3BGUA 2MXYA 1JXLA 2P5VA 4CM0A 2CPJA 1S9GB 2HNDB 4NX9A 3ITHA 5H9FJ 1K8AT 4MH8A 1FXLA 1MN7A 3LF0A 2DH8A 1SKUB 4P6QA 1QSYA 1N32J 1RTZA 4ZJLA 3EX7B 4WCEQ 2XMTA 3MF5A 4WFYA 2EI5A 4YDDB 2AGQA 4N76A 2F65A 5D3GA 2MKKA 4NASA 2DGWA 2NYIA 3V4MA 2CG4A 3HHKA 2R7OA 1TKXB 3M2RB 4NA2A 4Y34A 2YWEA 1U0HA 2H65B 4P74A 4DCJB 1XNQJ 1R0BG 1JLBB 2DHGA 1FFWB 3HKWA 2MKSA 4DUYF 1T9YA 2CQ4A 3B8HA 4YR2A 2GJIA 4ED3A 4OX7A 4QWBA 4X4PA 1F3FA 5IWAJ 3OTOF 2XC9A 1OS5A 3H25A 1R6VA 1RHMB 3BB5A 3PR5B 4DR1F 3H2LA 2BRKA 4DPOA 3UPFA 4N56A 5KFGA 5E3CA 3QLHA 5CYMA 2DKOB 3NL0A 1SJFA 4DR6J 2CPIA 3ADAC 5E3PA 4IOAQ 3DDKA 1ACMB 1RB0A 3NNAA 1M5PC 2VU5A 1WDDA 1S79A 2VPZB 2KM8B 4DSKA 2WBMA 3OTBA 3GIKA 1S1VB 5KT5A 1IBMF 2WOMA 3I5CA 4PYDA 3KUHA 2RRBA 2ZH9A 4JYAF 2CRLA 1CULA 3FBBA 3GQCA 3O6QA 4USHA 3EZOA 3G86A 3BSNA 2HHVA 3QWPA 2IVMA 1ZA2B 4F4KA 1YDLA 2HZAA 1CVJA 2H51B 3H0PA 4TKTA 2QJ3A 2ZBQA 2BZ2A 4KH1B 4K2XA 2ZM6J 3KHLA 1ELOA 4MFBA 1APSA 1UVNA 5AT1B 3BF4A 2BUNA 3ZZPA 1C0TA 4KV8B 4DV5F 2AIRB 3AQOA 1NPKA 3DLBA 2H4YB 2ZDOA 5KFKA 1U1PA 3MFHA 3FSXA 2F8EX 2W4DA 4PG6A 8AT1B 1XQIA 2YX4A 4DUZJ 2WONA 3A13A 1OPZA 2GHPA 1FE0A 3GIJA 1L3SA 1IKVA 4LSLA 1NPRA 1K1QA 2DGTA 3MZIA 3OTCA 3UDEA 3VGUA 4C2MA 4M5NA 5A0YB 1KS2A 3D9BA 3LP0B 4URSA 4L3NA 2V4JB 2L41A 2B7BB 2AJ0A 1TL5A 1VQ7S 5KFLA 1NK6A 2ZHAA 4I2QA 2QIFA 6AT1B 1M1HA 1VIOA 4P72A 4MJKA 2ZBRA 3FCHA 2C1EB 2C3PA 3ELHA 2PFDA 4W90B 2MKIA 3VAMA 5L9XA 2OSRA 1FRXA 3D1HA 5D15A 3H5YA 1HD1A 2YQ1A 2QG9B 2HRYA 4C4WA 1LQ9A 4MYTA 4ZVUB 4F67A 1RT7B 3Q23A 1FKOA 2W2NP 2Y1JA 3HVTB 2E66A 2MKCA 1HHQA 1RAEB 1Y0HA 1Y00A 1HNXJ 1CLFA 2EWHA 5SUHA 3RRHA 4NZ0A 4P2SA 3NS6A 3HDSA 2R2RA 5G0RA 2OPQB 4K4SA 3SEOA 2LXFA 3LPYA 4PKDB 5KG5A 1SBRA 4ILRA 2CNLB 4NLTA 3C2PA 1KVKA 4PAAA 1KONA 2CJYB 3MD1A 3M8QA 4WXOA 4WK1A 2MZSA 3GYXB 1JJCB 4YB5A 4TY8B 3TI0A 2U2FA 4F4WA 2FZKB 1U1QA 1BQNA 1H6KX 4GVLA 2QMUB 3M30A 1JKHB 1JJ2R 5KFPA 1YJRA 1K44A 3D7SB 4NA1A 1NH8A 5HROA 4YB7A 3AB4B 2M0GB 1B0TA 2G0CA 3AHPA 1NK5A 2ZWPA 3OW2R 2F7VA 4LF5F 1B7FA 3IO1A 1M0SA 2ZH6A 2EBGA 1BWEA 2CFXA 1U26A 2DNHA 2FGCA 3JTNA 1Q7LB 5F0UA 2UVRA 2ZH7A 2UXCF 1YRTA 1R6YA 5L46A 1QTNB 2ZD1B 3AFGA 1JX4A 2KXHA 2YNHB 1HWKA 3LGHA 5JVGQ 1H7XA 2RSQA 4TU8A 4OYWA 2JEJA 2CQ0A 2XZDB 2ASYA 5LSOA 1A6LA 4DPUA 3LPEA 3CIZA 4IRDA 2G2YA 5KFRA 2RU9A 5J2NA 5F8MA 1EQ0A 3AD8C 3P5TL 2V4QA 1SJ3P 1Q95G 4LJMA 1AUSL 1GT8A 2AT1B 2GHVC 4NLOA 4OJ1A 5GAGI 2BJ3A 2QA4G 1N0UA 2D3OR 4R8UB 4A48A 1HQEA 5LXRA 2HYIB 1DTQB 4RR5A 3OT9A 2ZWOA 3FBCA 1QJHA 1DTQA 3QRQA 2CDQA 1PJ7A 4KQZA 2LU2A 4Q44A 3QIDA 3NGSA 1WKKA 5A8WB 4Q45A 5JJBA 4UF4A 1CJVB 2FHJA 3FBFA 5KFQA 3G82A 2ZH5A 2LA6A 2FY8A 3DLEB 3SFUA 4X4NA 1U47A 2G2OA 4DU8A 2ZNYA 2E9ZA 2A1BA 3T9NA 2J8SA 4WIQA 2CG8A 1X5OA 2QL5B 5F8HA 1MWQA 1H7WA 5GAHI 5FDLA 3ENWA 2NXUA 4C8OA 2YNIA 4NRUA 5E3RA 4ECWA 3J81j 2NPFA 5GMEA 3AQPA 3HZGA 1H38A 1NUEA 5LL6d 2R7WA 1AT1B 5KT7A 4B9NA 1QM9A 1M5KC 2IRYA 4DV2J 1VBZA 3C6UA 2W8LA 5HLFA 2RAQA 2CAJA 1ZOTA 2XLJA 4CRJA 2ROPA 4PXEA 2IHR1 4NLXA 1RZMA 4KRWA 4CLKA 1NZ8A 1YJVA 4ICLB 4EFAC 5HP1A 2BM1A 5D3GB 1HHTP 3PYEA 3LGNA 3NGUA 4CO1A 5BJRA 2JOQA 2VC1A 2OLWA 5HVHA 4C11A 2H3EB 3OHBA 4LRAA 2KG1A 4DUZF 3OXFA 4ZLLA 5LMUJ 1O0PA 1DLOB 2FVQA 5EWEA 2RQMA 4OYOA 1SPBP 1V3SA 1T9XA 3MECA 4DV5J 1QSSA 4N41A 2CPEA 1RU1A 2WW4A 2BDPA 1FK9B 1M5HA 3S01A 3WC0A 4USWA 4PXCA 4ZPAA 2ZOFA 5KFNA 3L95X 4KFBB 3PR4A 2WSFC 2LQ9A 4DSJA 4IRKA 3R8YA 3KNAA 4LF9J 2HFZA 1UAWA 2GVZA 1SQFA 1Y3JA 4ZVGA 4DQQA 1ZETA 3FDSA 3D2WA 1YBTA 1RHQB 1FTRA 4I56A 6FD1A 2LECA 4LVNP 2RE1A 5B09A 5IXUA 4ENOA 3ET6B 4DS5A 4V1Ak 3VTIA 1WD6A 2A10A 2RF2A 1RTHB 1HWLA 2DXFA 3J81U 4I4BA 1UWAA 5KFXA 1AFJA 2GJ2A 4L6V3 3GONA 5I42B 5I3UA 2HSEB 1IQTA 2GMLA 3HHLD 4TVAB 5HQ8A 1LKZA 4CO4A 3CULA 4WU3A 3ETOA 3CCVS 2ZH2A 3CDWA 4QYZK 3K58A 1SL2A 4M95A 3M8PA 1D9DA 4DJBA 1S1TA 2X1GA 3ZC4A 2DGQA 2RHQB 2YQ3A 3FRYA 4RW4A 4JI2J 4PUOA 5KFVA 4C8ZA 1NNDA 1RTHA 1WWHA 1X8DA 3GB0A 2BM0A 3QGPA 4X4OA 1XNQF 2CWXA 2W9AA 2Y8WA 3AOBA 1Y9OA 5CYJA 1WKLA 1U8WA 2L48A 3B54A 4LBHA 2WTFA 3AA9A 1WC1A 3NS7B 3M7VA 5KFWA 5BR8F 4J9LA 4CO5A 4OZNA 3D1OA 1MMNA 5D4OA 3ZTSA 1WTBA 2HFSA 1JLAB 2DR9A 3P49B 1JK9B 2HWTA 3GG0A 3M1VA 5DLGA 1TKDA 4PUOB 3LAKA 1S0NA 2CPYA 4OI0A 2FVCA 3MEEA 2MLXA 4DV3F 4ANEA 2UU9J 3MCOA 4MAKA 4PWDA 4URGA 4DV4F 5ETOA 4WIIA 3TW0A 2Z2LA 1W2IA 4Y6IA 2JSXA 2XZWA 4MKVA 1UJ4A 4OJGA 4QJVA 2CA9A 2ZVIA 3IAS9 3R6LB 3RUBL 4H4MA 1FRLA 3A3PB 5IT4A 3J7YI 4LFAJ 3TANA 3C16B 1RCXB 4ZDNA 2MKJA 4PG7A 3UE2A 7FD1A 3O44A 4RKUC 2CDRB 2MY7A 1T9WA 2KVQE 4FDFA 3W60A 5GVQA 5LXYA 1RSCA 4JI7F 4WBFA 2JVRA 4ZPWR 1UVJA 3IBWA 1L5UA 2E1CA 2MSSA 4I68A 3M4XA 1DZ5A 2OUGA 3TAMB 4YS2A 4M1KA 4GKJF 1G2EA 2FLLA 2D9PA 2EC2A 1KTQA 3FRZA 4HACA 2CZ4A 2X51A 8ATCB 3TP2A 3HVWA 3G82B 4UOCA 4X62J 2B3TB 2AJFE 2VDIA 3HFZB 3TJAA 3VV2B 2B6AA 5HN0A 3HXMA 3H40A 3AD9C 1WHYA 3MPWA 4MIWA 5FLXU 1ZS6A 3K5PA 3SQOP 2KFYA 1QVGR 4P71A 2B9XA 4O3PA 4YY3J 5KT4A 2UUCJ 2NR0A 4OZJA 3JS9A 3V2UC 4QIFA 4B3MJ 2M3DA 3JAMY 1XR5A 4L75A 4FXDA 2E1RA 5D0EA 4KGMA 4OHYA 2M88A 5CZXA 3JSBA 2CQGA 3DLGB 2OEMA 2XEXA 1GMWD 3MPYA 1HBUB 2ABYA 4NLWA 5K5MA 3PX0A 2W24A 3ONQA 1NSAA 1WELA 4L73A 2XNRA 2Q3PA 2W2MP 1DQ9A 4OHXA 3UN5A 1MROB 5IZHA 4RNMA 2YNHA 2YXLA 3K0JA 4R25A 3IS9A 2HFOA 3Q8VA 4ZVTB 2ATCB 3U1NA 2FJVA 4DR7F 4JI3J 1LXNA 1VQYA 1SH3A 2A0FB 3KUEA 1T3NA 4F2SA 1KN6A 2XSJA 1S0MA 4HKQA 3UWTA 1LWCB 3GE9A 4GO7X 4RO0A 4OX9F 3G8SA 2CZVC 1T03B 3G96A 4DLGA 3DRXA 3CJKA 1UVMA 2ASLA 1F60B 2FDNA 3DYAB 3I5AA 3RW7A 4KGVB 4ANDA 2IMWP 4QR1A 4CO2A 3R7BB 3T9ZA 4EO6A 3BDPA 1HW9A 3DLJA 1AZSA 3R5JB 4QR0A 4DL0C 2KXNB 4ECUA 4DFPA 1S1XA 1XWLA 3ZZOA 4EU0A 5KT2A 3CCRS 1V5IB 4JV2A 1H72C 4QU6A 1PYTA 1RT1A 3IM8A 3T1YF 2Y0SD 2D41A 1M90T 2I2YA 3IXQA 2V9WA 3MXHP 1G3OA 1RGVA 2DGVA 2W9BA 4UY8T 3OPKA 4DR5F 1GTHA 3W66A 4PG5A 1VRTA 4H4KC 2ASJA 3CCZA 5D0RA 4CTAB 4F02A 2QMXA 3O5TB 5CCMA 3MURP 4DR2J 4IUFA 2QTWA 1IBKF 4RBTA 2U1AA 2MJUA 4DWIA 1FNOA 3QMQA 4XO0A 2DNQA 5DLFA 2LXIA 4LBPA 5GMKa 2ZJRQ 4DV1F 2Q6BA 1HYSB 2VL1A 1F2GA 2IIHA 2CQ2A 4K4XA 2B51A 1WG1A 3FQKA 3O3LA 4DN0A 3TA0A 3G6ES 4ZVRB 4ECZA 3HHLC 1Q4RA 2C2KB 4BHQA 2HVIA 4IFVB 2VDHA 2JFKA 1RT7A 2L9WA 3KWMA 4Y65A 4ZVFA 2DR5A 2R8JA 4I6WA 5ETPA 4C7QA 4IR1A 1CEZA 5K14B 2E1PA 1BQNB 3MECB 2X1AA 4PG8A 2VV5A 2UXBF 5LJ3Y 2OO4A 2CJAA 2SXLA 1PCAA 3MM6A 5HATA 4I0WA 5AJ3J 1RWPB 5LJ5Y 3M32B 4Q2MA 1SQEA 4W98A 1PJ6A 2DNKA 2VFVA 4UTGA 1U1LA 1OYEA 1U2CA 3HHEA 5GADU 4BCAA 2QEXS 5KFJA 1HWIA 1VLYA 3M8WA 4P2XA 4LSZB 4WYWA 5M2PA 1DAXA 2DGXA 3HF5A 2UU9F 4CT8A 4QCLA 1FK9A 4ECQA 5F3TA 2GC8A 1VOMA 1NPPA 3E01B 5FD1A 1UCNA 1YZ6A 3TARA 3PYGA 4FS1A 1FKPB 2YNGB 4G6VB 2AYEA 2H48B 3KK1B 4JI7J 1TR0A 2J7WA 1P1TA 2YWFA 3WHIA 1W7WA 2IBOA 3MMBB 3PACA 2ALZA 1C0UB 3N0VA 2XMVA 1VK8A 3F44A 4WFZA 4YR0A 2QGFB 3WC2A 4FYYB 3POTB 1YTYA 1Q8IA 1JLFB 2WW8A 5G4DA 4ZVHA 4O4GB 1Y7PA 4A47A 4KKOA 3TEGA 5K8NA 2JX2A 1KBRA 5J2NB 1JMTA 4JOUA 1I3OB 3KFWX 2PA3A 4B3TJ 2C3UA 4KH0B 3W2VB 4QYRA 4DV3J 3PW5A 4KPYA 4PQUA 1AW0A 1FJ7A 1ZM3A 2MTLA 2Q43A 2AMCB 4PABA 4ANCA 2YNFA 3IG1B 2LDYA 3K89A 4RW7B 4OYBA 5B0FA 4ES1A 3BEGB 1RHKB 2DNGA 4EYIB 2KYXA 4NLYA 1MNEA 5I3PA 5AXNA 5HVFA 2XMAA 3F73A 4USIA 2BYCA 3R5CA 2I5JA 1D0EA 2DBBA 2V8DA 4OYIA 5CA5A 5J2PA 3PV8A 3BSCA 3RBZA 1KSPA 2HQGA 3VVUA 3KK3B 2WVCA 4XPCA 3C16A 2VQEJ 3V81B 1S5ZA 2BKPA 3IRXB 3HCXA 2ZH4A 2BMBA 3FFIA 2X1BA 3QSIA 3G8TA 2VC0A 3AA8A 4LFBJ 2HQDA 2AJ4A 4AE5A 4DG1B 1GQEA 4ED8A 5F9LA 4DSLA 5T7LB 4DSIA 1H73A 4NI2B 4RX6A 1MW7A 2P6TA 4ZPCA 2VUGA 3K8VA 3OVSA 2VJUA 4O3NA 5BYRA 4DCOB 2UUAJ 1QUPA 1RT6B 3EXYA 2ZNZA 1GTEA 3THVA 3JYTB 2J6SA 3S8SA 1TL7B 1EAYC 1X4CA 3DDIA 2QO3A 2FVSA 1LK5A 3VAGA 4JI4J 2BBEA 3N4WA 2QRRA 3W2WA 2DPJA 2XLIA 1KQGB 2WK4A 5CH7B 1JLBA 3ILIA 1RT2B 2DO0A 2HMIB 3MAHA 4IRCA 5AXMA 5M2UA 2XMWA 1OMSA 3BR8A 3CJ0A 3DOMA 3DDNA 1JLCA 3I0RA 3H2UB 4GVBB 4NLQA 1WOPA 4RU2A 4GVBA 1Q86T 1FXRA 1MN9A 5H9FK 2DHSA 4WFNQ 3JAMU 2H9ZA 2F9JA 4LR9A 5K9FA 1N36F 5KFBA 4CI0B 2GO8A 3EGZA 3I4HX 4LMZA 1UVIA 1E6YA 1G4CA 2FZCB 3PY8A 1CPZA 3BH6B 4DV7J 1JLQA 3RTVA 3LGMA 4CLFA 1UW9A 3Q24A 1VMBA 1W26A 1Y5NB 5GAHU 3KLEA 4A8MP 2R2UA 4AQYJ 1C4CA 2QLFB 1HIYA 3MMAA 3W1YC 1V3ZA 2MYFA 2K3KA 2AEFA 2VHGA 2OH2A 4K4UA 5I3UB 3NGDA 3P5BP 2DNZA 5I42A 2HBQB 4RPFA 3OXGA 4HYKA 1U48A 1IM4A 2RQ4A 2VKZG 1NK8A 1RWXB 1U6BA 5EX0A 2IA6A 5L9NA 1HYSA 3A1YG 1FTCA 4LRFA 3FJ2A 3GFHA 4OIXA 2XS7A 1FJCA 2NYHA 4PPZA 3ZZTA 2FYXA 4RW8A 2IM2A 4IG0A 3HHDA 5KG7A 4RNHA 2ZE2B 5KFDA 2RRAA 1XMOJ 3BYPA 1C0TB 1VBXA 1F1BB 4DQIA 3HD2A 5L39A 1S6QA 4TY9A 1KVJA 5A76A 3EXCX 2AF6A 3MEKA 4A46A 3OSPA 1RKJA 1EQMA 2HQ3A 5AXLA 5F41A 3KLFA 2YBVA 1LWCA 4IFYA 2UXCJ 4CYUA 2AGOA 2FJEB 3NCPA 2HS4A 4M5GA 5KG4A 2YKMB 4RNFA 2DNRA 1WOOA 3R5GA 3M8ZA 1RCOB 1SJ4P 3J7A1 1VQMS 3OL6A 5JVHQ 4YOEA 3H5UA 5IFMA 2HAIA 4OZ3A 1KVIA 1D8YA 4YMEA 2BABA 4ZA1A 5HAOA 1HPZA 3CCLS 1KWMA 3FC9A 3EGWB 2Q79A 2DHHA 4HR2A 1VK3A 2XCPA 4Q0BB 4WZMA 2YWKA 2QYCA 4PCQA 3W8PA 2ZZMA 1K0VA 2B4PA 4YN3B 3B4DA 2E5LF 3QGIA 2H5IB 3SMZA 2ZFHA 5D0GA 4JBCA 4NLRA 2B4UA 2K1RA 3CMQA 3BN4A 3BZQA 4F36A 2P8IA 2RHSB 4UZCA 2K1RB 1FX2A 1S4EA 1U2FA 2C3YA 4YP3A 2N3LA 2KDOA 1P27B 3M30B 3W61A 2XI2A 4F8RA 1TV6B 3LUYA 3UN2A 3CJSA 3UDCA 4QYZJ 1VJWA 3IMQJ 3PRVA 4LF5J 2VF3A 1HMVB 1FJGJ 2EFOA 3TAMA 2CQCA 4R8UA 3UCUP 4A8QA 1KOHA 4U9RA 2IC3A 1PGZA 4P2FA 1C1BB 3NBPA 5DETA 3C3LA 1YJNS 1O6XA 5HJXA 1KFSA 1O5JA 2B6AB 4PQAA 1IBMJ 2DNMA 5L1LA 1DQAA 3DOKB 3VCDA 1CC7A 2KJVA 4PXBA 5FIIA 4C3KA 4PQUB 2DHXA 1KQFB 1FVSA 1F6TA 1UWBA 1UZDA 2DNPA 1NMEB 2DIVA 3L09A 1TK5A 4JI0F 4ZPBA 2MQPA 1RAOA 3DC2A 3F0NA 4KHPJ 3PJWA 1B4SA 1TL1A 1UKUA 3S6EA 1CJUA 1S4FA 3P45B 3UNGC 3GJRB 4GC7A 3QFHA 2R7UA 2HBZB 3MR2A 2IDLA 1RWOB 5C42B 3MR7A 4CLZA 4X4QA 1N8RT 1FD2A 4V19J 4TLQA 2HURA 4OYAA 1PBUA 3MD3A 3MTJA 5DQGA 2C28A 1FESA 2FLOA 3VR1A 4KO0A 5LM7E 3DFEA 3RG6A 1NSQA 1WORA 1WSRA 2LQBA 4EZ6A 2CPFA 4KJIA 3K57A 3MEGB 1FWPA 1FD8A 4FKYA 2B8PA 2CJQA 4NCAA 1RT2A 2FVRA 1VQNS 1FX4A 1X4EA 3LP1B 1URRA 1FKPA 2F3JA 2YNGA 3BSAA 4FBUA 4CO3A 1F9FA 4I64A 4IO9Q 1S0VA 1YLXA 4KGKA 4ZVSB 1WG5A 4J9QA 4UZBA 2VONA 1UPPA 1YJTA 1TL7A 2JWNA 1IQZA 2LMIA 4CH1A 3H5SA 3BSOA 2IY5B 1MROA 4CH0S 3CPWR 5IT0A 1TVRB 5J2QB 1JLQB 2E5LJ 1N5SA 1DBDA 4KY3A 2MZTA 4ZN1A 1TUWA 4O4RA 4DX6A 2PI5A 1R0CB 3MM9A 2GGPA 2JEGA 4X65F 1XMOF 2GQ2A 3VQSA 4RUAA 1HQUA 4OI4A 4ICLA 3FEXB 1ZZFA 4RU9A 3GP9A 4CTAA 5A8KA 5CHCB 2E9TA 4X2BA 2UUAF 3MHYA 2P2CB 2V68A 1RTIB 3GFZA 1BUXA 1ZYQA 5ETQA 1RTIA 4OZ2A 4AFFA 2F1FA 1E6YB 3M8PB 1IKYA 4YQWA 2FJXA 1JWWA 5AE3A 1Z1ZA 1SKSA 3KXDA 1G7CB 4IG0B 4JI1J 4DPXA 4LFBF 2VG6B 3M8SA 2GIFA 2XMJA 3GJSB 3SCLE 1MWYA 2OHDA 3OHAA 2XZTB 1NHUA 1HQUB 3IP0A 1NJZA 5AE2A 3S1TA 2HG4A 4TQSA 2CPZA 3PKMA 2GFFA 1VQ6S 1YX2A 3OJUA 2XG8A 3AODA 4J9NA 5DG7A 2GMJA 1FXDA 1RA7A 1DRZA 2WSCC 4WFXA 1HARA 1VRTB 1RXOB 3M6VA 3MGJA 3MM7B 2BV3A 4OHVA 4WYLA 4C0HA 5D8HB 2KN4A 4K2JA 1LW2A 4USJC 2DY9A 2VFSA 1U45A 4FYDA 1KNZA 1HWUA 2FC9A 4C8MA 2FHJD 1S6PB 4WTYA 3M8RA 2KFZA 3MPUB 3KK1A 4ELTA 3F41A 3DRPB 4O44B 2CNKB 4G1QA 3IR5B 2KZZA 3OXLA 2OPSA 4M5MA 4NMLA 1AA1B 2NUUG 4MMOA 2IRUA 2ZD1A 3TJ8A 2ZZNA 2DNYA 2CPXA 4LQ9A 1S72S 1S7IA 4KPCA 1SVDA 2LCWA 4RZRA 2XY6A 1LW0A 5IOLA 1PG5B 1RBOB 3AXMA 2HS0A 4NLVA 1JLGB 3FCWA 3HJVA 3T6JA 3NGTA 3CDAA 1BQMB 4YEAA 7AT1B 1D3WA 1IBCB 4ED6A 2YKOA 3NNHA 5CD4H 1EKRA 2VQEF 2I8EA 4IH6A 3DI6A 3OR1A 4JB8B 4QIWD 5CAAA 4AL7A 4RL1A 3RJMB 2JJ4D 2KM8C 2XGPA 3V6KA 1LNQA 2AD9A 2ACYA 3I0SA 4IH5A 2WHOA 1Y5IB 5KFFA 4O0IA 4JI4F 2VIHA 4TY8A 3KLFB 3KHGA 1U1KA 4KB7A 1RTJB 1ZPVA 3JQMA 3FZBA 4M5DB 1NSPA 2LXUA 3I32A 1LXJA 4JI8F 5KFHA 3JB9k 1VBKA 2NXEA 2W2PP 2V0NA 3B6BA 4ZCKA 1FFSB 5A6PA 1YRXA 3Q86A 2IYIA 3P4UB 4DZ6A 5T14A 3A12A 3K5OA 1PAEX 2MQNA 1QLNA 1TL4A 1RBLA 3RU0A 4K4TA 4Y2MA 3MWBA 4KGZB 2UVUA 3OL8A 1S9GA 2CVIA 2B9WA 2HNDA 2NPIA 1CQMA 1KP6A 1YHQS 1P9YA 1VQ9S 1TAUA 4LRDA 4YDXA 4QW9A 5H9EK 3ENVA 1T8EA 1J5EJ 4B9LA 3P96A 2BJ7A 3HP6A 2JEIA 5KOXA 3B4MA 1XTZA 1UFLA 3BR9A 4DXLA 2V2QA 2BXJA 3HSGA 5DRKA 4BC7A 4O4GA 2M9KA 2CNOB 2NS1B 2FUG9 4J91A 3GILA 4LRCA 3UR0A 4ETZA 2R9LA 1KD1T 1HNWF 1LEOA 2E5IA 3BBCA 2F9DA 1FNXH 3G4SS 4DQSA 4JV1A 1VLOA 2UV8G 1TKZB 3IGVA 4IO1A 3W5YA 1VQLS 1TKZA 4ZHRA 2C2RA 3UW1A 4X4SA 1OWXA 1DTTB 2VG5B 2RDIA 4E8UA 5FLXY 2YKQA 2EFNA 4TU7A 1VJQA 1BWVA 2VBXA 3ZNUA 3TUZC 2CXEA 1Q16B 3RR7A 2RS2A 4MK7A 1Z2ZA 4HHHA 1HNZJ 3CC7S 1HNVB 2PA8D 4J37A 5K8OA 1N5QA 2DR8A 4B9SA 3EPIA 1T05B 1U7LA 1U1NA 3BGRA 4XAKA 5E3QA 3Q8SB 3TA1A 4OI6A 4WPAA 2ZITA 2XQCA 2UP1A 2J9DA 3CJ8A 4DFMA 3RYLA 2RU3A 2JZ5A 2PMZD 4Y0FA 1F9HA 2IJRA 1N4LA 2D7SA 4FZVA 2Y1IA 4KSEB 3PX6A 3BH7B 4RNOA 1TQLA 2EFGA 2GVDB 2DY1A 3DRYA 1NB2A 2H5JB 2OELA 3QT8A 5C2GA 5KG3A 3HSZA 4LRBA 4N77A 3GZ7A 4RW4B 5B0GA 4DDFA 5EHHA 1YWXA 5B0CA 3QYYA 3V81A 1T7PA 3NG8A 2PMWA 3H98A 4B02A 3MI7X 1TTHB 1B64A 2IM1A 4RBUA 4R0JA 1S1VA 3U27A 3GLJA 3K2YA 4USKA 5F8IA 2DYAA 5A8KB 4B3TF 4K50A 3PYDA 4KHMA 2P9CA 2IJFA 4QBUA 4X66J 1IBKJ 1OY6A 4DR2F 4ED0A 1IBLF 2UUBJ 5F8NA 3R2DJ 2BR0A 1I1GA 1RHJB 1F5AA 1VQPS 1S12A 2JLGA 1R8BA 2KT2A 3L9ZA 2RH3A 1XNRF 1NBEB 4DEZA 3IWNC 5K8MA 5MAOA 1R3NA 1MG7A 2KRRA 4DPTA 3NWRA 4ZPVR 4DL5A 2PN6A 2OPRB 4NXNJ 1B0VA 2VZ9A 3MMAB 3N6NA 4DV6J 3J7AN 2FB0A 4FVCA 1MMDA 4K8RA 2DGUA 3HT0A 3WQPA 2WVEA 2KG0A 2QFIA 5F3ZA 1N5YA 4FF4A 2C3OA 3ZTQA 3KK2B 2KTQA 1S7HA 4ZIWA 1JQGA 1GMVA 4LSNB 1SH0A 2WBRA 2Y1LB 3M6WA 1IWAA 2C2MB 2HZCA 4CH7A 1AZSB 1S6PA 4ETXA 2NSCA 2HWIA 1RT4A 4XK8C 4JI3F 2B9EA 4MKYA 1JIHA 2MKHA 3IG1A 3PRBA 1L3UA 1NH7A 3AH6A 3SQGA 4QWDA 1FDNA 3M8QB 4OZ1A 2DGSA 1XR6A 3DRSA 3CWJA 3HM9A 2HFVA 4Z37A 3HO1A 5HK4A 2HHSA 3DM2A 2AV5A 1FRKA 1S1WA 1X4HA 3R1HA 4F3OA 3BV8A 5H1SV 3IGNA 4F0MA 3SSSA 1ZTWA 1NK7A 3U7JA 1M5SA 1U8SA 3SV4A 4DFJA 1NU4A 1NHKL 1Q1KA 2HGMA 2KVIA 3GR0A 3CVKA 2EEYA 3JQJA 1R8CA 3JTPA 1C2PA 1IWGA 3KLVA 2L9NA 2O01C 3OR1B 1UWBB 3TVZA 3G9CA 5CZVA 5HROB 3AOCA 4C8YA 4ECYA 4OX9J 4C0OC 1S1UA 2UVVA 4EBDA 3IM9A 3KDNA 4G3IA 2IC3B 1X4AA 5HJYA 4Y2CA 3ITHB 5KG6A 4C0BA 3HMJG 2I38A 2Z2MA 3BKTA 4B3RJ 1X9WA 4LUBA 4S0MA 2FC8A 2UVWA 1KLNA 2NXJA 2HBYB 2WVDA 3B82A 4J9MA 2FJAB 1NEEA 1Y5LB 2CADA 4YB1P 1EIYB 2CQHA 3ILOA 3J80U 4KTQA 1TV6A 4X66F 1YJ7A 1ZAWA 4Z7CA 1VISA 4K4YA 4DS4A 3AJ1A 3ZNJ1 2M4MA 3T5JA 4ZLNA 1WC6A 4UOFA 1F5BA 5A8RA 4I6AA 3V5RA 4P73A 1XJWB 3M32A 5D0HA 2FHKA 3NAHA 4R5PB 2V34A 9RUBA 1RAHB 2E1AA 3TRGA 3DCAA 1HPZB 1T9VA 2NUHA 3IC1A 3UVJA 4G65A 3JYTA 4PRFA 4URQU 2EBEA 4FF2A 4DV4J 2W9CA 4JV5J 3LP2A 1C1BA 2DH7A 3NBPB 4LF4J 2MLYA 2LKZA 1JLFA 4U8YA 2AHOB 4WJBA 2VA2A 3WBZA 1CBKA 3TZYA 2MZQA 1O51A 3BGFA 2ZOMA 3W9HA 3KLGB 3ILLA 1NKCA 1SC4B 2HGNA 1YJWS 3BKUA 3O2IA 2AYGA 2YKNB 1FKAF 1ZPWX 1PIEA 1X31C 2MLZA 1VHFA 2LQ5A 1W2BR 2AJ2A 2D3UA 5HMYA 4U7UD 1TMJA 2XYPB 3VZHA 4CDIA 3I9ZA 3NCRA 2BOAA 1IXKA 3V6HA 1RAJA 2DVIA 1I51B 3VGVA 4LF7J 4QPXA 4OX8A 1XNRJ 1ROFA 1X60A 4BS2A 1EARA 1FE4A 3ZTPA 1KRPA 5IT9U 1X4BA 1I6JA 1X0PA 2QLBB 2UUBF 1HQ2A 1FRMA 2ADCA 2JH3A 4IQXA 1X5SA 2D3O1 3LP1A 4ATNA 2O66A 2BX6A 4I2PA 5B0EA 4DF4A 5FDLB 3T41A 4Q8EA 5DZ6A 4ZIVA 4BBYA 3MEGA 3M8YA 1VRUA 1IKVB 1VYAA 4LSLB 2V8HA 3KG1A 5CQGA 1L3VA 4B3SF 1T9UA 4HTIA 1KHVA 5HVGA 3DLGA 1S77D 5HMZA 2Y9HA 4U67Q 2B9YA 2HNZA 2EFQA 3EVOA 1IR0A 2PO4A 3RGIA 4M63A 1B3TA 2J6UA 3W7BA 2MPUA 3ZZZA 1F9EB 2XNQA 1EZZB 1RT3B 2F8HA 2QSWA 1BGXT 2BJDA 2A18A 2BVZA 2J5AA 3HFVA 1HNIB 3NAIA 3MUTP 5IC4B 2OTLS 2DRDA 4ELVA 2W01A 2G13A 4GO5X 4R0EA 1UZHA 5KFAA 2VICA 4FNIA 1RT1B 4B9MA 4CCHA 4RUCA 3DXBA 3GYNA 4EYHB 1CULB 3OBIA 2QLWA 2B5JA 4EUVA 1QSLA 5L8RC 1SJQA 2PEBA 3VAJA 3D0HE 1YG0A 4JI8J 1HNZF 1R7IA 2A2CA 3D6MB 3THPA 3WX8A 4LFAF 4DL2A 2EPIA 2VJVA 1X9MA 2BW2A 1U24A 2FTRA 2YY3A 5IQQA 4BLGA 1SJRA 3RR8A 5DZ7A 3NY0A 5CCLA 1WHWA 3GTYX 3OQ2A 4E98A 1U09A 2HIQA 1GNKA 1KQSR 2OFHX 3A8JA 4FXWA 1JLEB 4KHRA 5ETSA 4OLOA 3H4BA 5C7PA 2GAGC 5ETNA 1R8AA 4C3LA 5IT9Y 2V8GA 2RJZA 2R8HA 4WU2A 4MTPA 1NK9A 3OSNA 2E5HA 3M2VB 2AX0A 2KT5A 3SDEB 5C25B 3KK2A 4OZLA 1NJXA 3IBCB 3LANA 2BE2B 2XBPA 3D1QA 1VHIA 2MQ8A 2F5GA 1SJ1A 4K5SA 1N34J 2XULA 1NB7A 2HHUA 2DNNA 1SXLA 1J5EF 2Z57B 4FYWB 2AGPA 4OL8A 4WWSA 1WACA 3BREA 3EZ5A 4UQGA 3VVTA 3KG4A 2MQLA 3RAMA 4LR7A 4MKBA 2L08A 4ZP8A 3FGVA 1RKIA 3GWCA 3BO3A 3OTEA 2ALYB 2ZZTA 3IRWP 4NXMF 5HSPA 5MLCV 5IS2A 3QAEA 1SC3B 4J9UE 2R42A 5D77A 5HQLA 2XMKA 4RBVA 3UQSA 3L7PA 4NYPA 3Q22A 4LF6J 1RLCL 3W62A 3MR6A 5DG8A 3DOKA 1RAAB 4P52A 2LA4A 1M1GA 5JMNA 1A7GE 1QE1A 2AWZA 3CJ2A 2ZHOA 3D28A 2DPIA 1RBAA 4KHPF 4LFCJ 1KLMB 4LSNA 4ZPDA 5B0BA 3DU6A 1H2UX 1SCJB 4UOGA 1Q82T 2VBYA 1V3RA 3UNYA 4JI5J 3OV7A 1OQ3A 3QAUA 3P8BB 1SIZA 4L76A 1RWKB 2HNYB 2XB2D 1OYDA 3LWMA 4KGXB 2C2ZB 3MMBA 3FNNA 1Y11A 4NLPA 4WXWA 3I82A 4PEOA 4EBCA 1QAXA 3TNVA 3ZFVA 1FVQA 2HHTA 2GO9A 2DNOA 2G1DA 3TX0A 1YVFA 5EWFA 1FWLA 3W2WB 2DEIA 2H54B 1GXTA 5DM6Q 2FIUA 1T94A 2DXDA 1RUSA 3BS9A 3S7RA 2HVHA 4DZDA 4AXIA 2LFVA 3BKFA 3EYZA 3UDLA 4PXDA 1SV5B 4CLWA 2ZH1A 3W2VA 1VQ5S 1QTMA 1N56A 3T1AA 5ITHA 2DCLA 3EWGA 3HHLB 4CLYA 1GFWB 2BA9A 2MGZA 3W9IA 2X3DA 3JSMA 1IKWA 4B3OA 4K4VA 1HBUA 1SC6A 1EJ7L 1R0AA 2KI2A 2CYYA 1Q0NA 3FUYA 3J80Y 2WZ1A 1V6HA 3RB3A 4ECSA 1BMQB 1S49A 2L3MA 4Y00A 3AD7C 3V4IB 2YH1A 2EFPA 1H98A 2LP4A 2XWXA 3R3TA 4JI6F 3RAXA 1LV5A 1AFIA 4I7FA 1Q5VA 1M1KT 2PIIA 2AKWB 2PGCA 3T6BA 2YX7A 4HDGA 1T0TV 3GCXP 2N4CA 2BKNA 2JLFA 2LVWA 3U02A 1FJEB 2OD6A 3CJKB 4GRSA 1HBNB 3C6UB 3DN9A 1CSJA 1QAJA 2G0IA 1EETB 2OEJA 3FBEA 5M2RA 2EC0A 3HULA 1UFWA 1FDBA 1RT6A 4KFBA 2FHOB 1KTVA 1S99A 1X4DA 4MFBB 5KT6A 3HVRA 1LWEB 2UUWA 4UUWA 1ZM2A 3KJQB 2N82B 2B8QA 3Q8UA 4USUA 3D6TB 4M5JA 4J5OA 3GJQB 3HPOA 2WB4A 4K59A 3AOAA 3D3BJ 4U95A 3CC4S 4LFCF 1CQNA 2IA0A 4CP5A 3MCSA 5SZTA 4DR1J 4B9UA 4ES2A 2HZVA 2I0XA 1NDLA 4Y2AA 4WE1B 3H8YA 5DQIA 3KOAA 1YI2S 3CJQA 1XBWA 2V67A 5DDQC 1IJEB 5I3QA 5IWAF 3SYZA 3TVKA 1VC6A 2CPDA 2VPYB 1NXIA 3DU5A 3SFGA 3QLHB 2MMYA 2ZC4A 4LBIA 1TL3B 3OTOJ 1M5OC 2HQIA 2OMOA 3A8EA 3N6MA 5HMWA 2KKHA 4C11B 1UVKA 1YZ7A 5C5JA 3SI8A 2HFUA 3Q8RB 1FJGF 5HP1B 4DPYA 1X5TA 1RQ0A 3FEZA 4ERDA 3PIOQ 2E5GA 3OD2A 4U7CA 3G6YA 3VAFA 1Q81T 1S1WB 1SQGA 3MAAA 3A3NB 4HEA9 2WONB 4D3GA 4P2MA 5B08A 2K7KA 2VPWB 3DRRA 4KBIA 3W5XA 4USMA 2NQPA 5J1PA 1FWKA 1REGX 2MZJA 3IWXA 4JYAJ 3FCVA 2WRMA 5AXKA 2CKWA 2CNNB 4F0HA 5KFCA 1N6QB 3OLBA 3EICA 2KHDA 2IPOB 2PEHA 4G1IA 1L3TA 1PKUA 4JI5F 1HD0A 4J9VA 4OV6A 3NP5A 3O1LA 4ECVA 3CUNA 2MB0B 2F4VF 3M2VA 3N5FA 3H42A 5C25A 3MPDA 1SUQB 1X5PA 2JL9A 4RNNA 4JI0J 5KFOA 2C2OB 2WOMB 1RU2A 4CLUA 3KLHB 1ZBTA 3C15B 3CCMS 1T95A 2HS3A 3L4BC 2IM0A 1P8GA 1JLAA 2V5HG 1JJHA 3TQEA 4E2FB 4DCPB 4ILMA 2QYGA 1VQ8S 4RW8B 5HMXA 1ZAXA 1S1UB 3H59A 4OI1A 4OHZA 1VC5A 2FLNA 2ACMA 4YUDA 3J7ZT 4CWBA 4G1PA 2NXNA 4B08A 1SI9A 2HVZA 2R7TA 2V50A 3VQTA 4DV7F 2ZKUA 3CD0A 2H1YA 3CDBA 4HI1A 4MK8A 4X4RA 3V6JA 4QQBA 2MHEA 2OPRA 1EKSA 1WSVA 4LT6A 1N34F 1KKHA 1S57A 2A6MA 4QIGA 1EHWA 3DM2B 3AT1B 1YQHA 2HRUA 4Q7AA 1RTDB 3MOJB 1YBAA 2EK6A 3QFWA 1B70B 4FN5A 2G0JA 4LIWA 3UDVA 2MQOA 2QFJA 3BQ0A 4XTTA 1ZZNA 2XI3A 1UJ5A 1FT8A 4NCBA 3NMAA 5LMNF 4C97A 2DIUA 3WIVA 4M5IA 1VQ4S 2AW0A 1R43A 3G87A 4OYZA 1BQXA 3CJRA 1FERA 4X64F 3WDOA 2VA3A 2M8HA 1NDKA 4AQYF 1RABB 3CCQS 2CVEA 2B56A 2QT7A 5GMDA 2V94A 2BKOA 3I0SB 3B78A 4I1TA 3KHRA 4XIUA 1AUDA 2DRBA 2R7QA 4ZJQA 3PKYA 5CYQB 1WNEA 3DGVA 4DI6A 4FP9A 2OKQA 5CYQA 3UFCX 5RUBA 1NO8A 1RJJA 3GU0A 5KFUA 4J90A 3EPGA 4LR8A 2CQ1A 3CE8A 3D0GE 1GAOA 5IM0B 3PX4A 2FJDB 2HVDA 2MQMA 4N5SA 4IQMA 1RISA 2AEJA 3TEHB 4WFAQ 1REVB 2OFGX 1S59A 4BDPA 1D09B 1RHRB 1TFWA 2GW8A 1UPMB 5T7LA 1I94J 4JV5F 4DR3F 4HLBA 5ETMA 2IMOA 4NL5A 2Z4PA 4HH0A 4ZVPB 2DGOA 4ECTA 3VF0B 3A8KA 3TYTA 4WFBQ 2CJ9A 2ZUAA 2J7KA 5B0AA 2DITA 2V8PA 1U1OA 4B9VA 4Y3CA 4RWWA 4N47A 1WJ9A 4NLUA 3KLIB 2R2TA 3CCSS 3KLIA 2DHAA 3K8WA 2Y1RI 4M5LA 5C2CA 3NWGA 2N7YA 3CDUA 5ETLA 8RUCA 3DLHA 2KFNA 3HSJA 3OTDA 4L3KA 6FDRA 3BBFA 1NZAA 3CO9A 3GIMA 2VQFF 3AJ2A 1K1SA 2WAQD 3VGTA 4R5PA 4U8VA 4C8KA 1NSKL 3DHWC 3I0RB 5F0WA 3DYAA 4U7UK 4RW9A 5H9EJ 1EP4A 1RK8A 1TUVA 2D69A 2DD8S 3RBEA 2K3IA 2OMLA 1EP4B 3JSMB 2GVZB 1LWEA 3DNCA 3LP2B 3CW2C 4CO0A 1TVRA 2ZJPQ 4Q8FA 3RAQA 4OZ0A 1VQOS 1V5VA 1WKJA 2ZBCA 4H4OA 4LIRA 4LF8F 4XDDA 1DJ0A 2F40A 3US5A 2BQRA 1BD6A 1PC4A 2DTJA 2BACA 1UVLA 2M70A 4D3HA 1ZH5A 1SKWA 1DQ8A 1XEZA 5L1JA 5KG2A 4DMZA 1UJ6A 4CLLA 2WSEC 3VWSA 1SH2A 2OPPA 2GX8A 1HHSA 2ZKTA 2V8VA 2J7UA 1N52B 3BN7A 3GPAA 2H5EA 3K7RA 4I6YA 2VFUA 3M9MB 4A8WA 2R8GA 1DTTA 3ENAA 4F04B 1N6QA 4EK2A 4BWJA 1EB0A 3GG1A 4YR3A 3J7Z5 2HHQA 1XK8A 2X1FA 2BJ9A 4DR4J 2OIHA 2GGPB 3TZZA 2ILYA 3MCNA 1KC8T 2APOA 4F3QA 3MM8A 2RRNA 4OFZA 4RUHA 3Q8YA 3J7YU 1CS4A 1UFKA 3T1HJ 1HWJA 2HK2A 2POKA 1OIAA 1RAGB 2A6OA 2QC3A 1BXNA 3IR7B 2AJQA 1Z4UA 4HHUA 5J1EA 3TA2A 2KRBA 3D5MA 3VAIA 2K06A 2JFDA 2E7WA 3BGLA 3UCGA 4LF4F 1C4AA 1P1LA 2DCUB 2UUTA 2YKMA 2NZCA 3HD1A 3MM6B 1TKTA 4HT7A 1MSWD 2R7VA 1JLGA 3TZXA 3PDNA 1NK4A 4ZOSA
chains in the Genus database with same CATH topology
3LOUA 3MM8B 2D1CA 4DN9A 1HNIA 3CCTA 5ADZA 1WHVA 3MM5A 2QZ8A 5KFMA 5DGBA 3KJVB 2EG2A 3G71S 1ZTTA 5AJ3F 1XR7A 2G9OA 4ID5B 2MSTA 3LO3A 2V4JA 4ZKAA 3KG0A 4YB6A 5DDRC 2XS5A 4TN2A 5B7WA 1JNZB 4AXJA 3M9NB 3TAQA 4B3RF 3E01A 4LF7F 3NNCA 5D6GA 1WEXA 3CDEA 1W25A 1Q53A 1SV5A 2W7OA 1JLEA 1S10A 5KFYA 2GCFA 4M94A 1IKXA 4MK9A 5D78A 2BANB 3DOLA 4Q0BA 1U2RA 5GAEI 3M2UB 2GQCA 3POTA 2XCAA 4WKRA 1SL1A 1QUVA 3N6LA 3M6XA 5DG9A 2YWHA 3C46A 4QWCA 4B17A 3G6VA 1HBMB 2J9EA 4ED5A 3R27A 2ZJQQ 2MZRA 2RT3A 2QSFA 2YKNA 4GKKF 2DR7A 2O1PA 2XGQA 3OR2B 5EUHA 1VRUB 3HHLA 1J2VA 1QAYA 3EZUA 1S9FA 1FO1A 1NJYA 1BY9A 2B7CB 2E29A 1U1MA 4C8LA 4OJ3A 5LSRA 3IWLA 3FEYB 2OP5A 3LAMA 5D4NA 1HI0P 2PFFB 1UA1A 1ZM4A 2P6SA 2EG1A 2PSZA 3IS9B 1A9NB 4FBTA 3KHHA 3GFXA 4DL7A 1Q8LA 4EO8A 3OUYA 2MHNA 3PEJA 2DK2A 2N7CA 3U1MA 4EWTA 1MMLA 3CCWA 3ISNC 3M6UA 1HBNA 5L1IA 4HVZA 1RA6A 1LWFB 3CIMA 4ZCIA 4X62F 1EETA 3GV5B 2HW3A 2W4PA 4EEYA 2HFNA 2O5DA 4ED2A 2J0XA 2XWYA 3DLLQ 4C98A 4DBQA 2W4CA 2W9CB 3T1HF 2O3DA 4KC5A 1U6ZA 2JHEA 4ECXA 1UA0A 2ZH8A 3I6PA 1SKRA 1R31A 4MIAA 1ULRA 4FVMA 5J1NA 1XN9A 3RW6A 3NLCA 2RKIB 2Q66A 3MOZA 1S76D 3IR6B 4ZK7M 4A8KA 2BQ3A 2E1MC 1FRHA 3KMSA 3CEDA 4ZCMA 4NLGA 4DL3A 1U4BA 1T03A 1FF2A 3ZZRA 3ICLA 5HO4A 3BO2A 3CSKA 5KFIA 1S6UA 3I55S 1LOUA 3NRBA 2XMUA 3NMRA 5KOWA 3TUJC 1N0VC 4DSEA 2VB6A 2J6TA 2CQIA 1TK0A 2K8GA 3DGPA 2OD4A 3MR3A 4K4UA 3AAWB 2GHWA 2PC6A 3HX9A 2C3MA 2RB7A 4PWUA 2ROEA 4NZ7A 4QW8A 1MWZA 4QWAA 2J0WA 1S0OA 3I56S 2PE8A 3WZ0A 1JLCB 1GX5A 3OLAA 3W3SA 3FMWA 3TOQA 1T02A 2HNZB 4NYOA 4ZMMA 2DO4A 5CYMB 1YITS 3L7OA 2P9EA 4FPRA 3VZIA 4AYBD 1F0XA 1UMJA 4ILLA 2J0SD 3Q0AA 3MMCB 4IR9A 2FPHX 3NCQA 5DO2A 2OPSB 2AYMA 2UV8A 5J1EB 5HL7Q 2XY5A 4DV2F 4P7VA 2GNKA 1FNMA 1WI6A 4BC9A 4IOBA 1Q8BA 3GIIA 3RRGA 5DGAA 2JC1A 1TFYA 1N5YB 4WE1A 4I69A 3NKYA 1LW0B 1I94F 3TVYA 4PPDA 1VIXA 4TYAA 4DL6A 3RRKA 5EWGA 3Q8PB 3N5BA 2ZC3A 2VOPA 2UZAA 3HJFA 2OPQA 4G1QB 4I67A 2COLA 1R0AB 4IDKB 2RF2B 3SSRA 1NRKA 5A0YA 3OJSA 5U47A 3SDEA 2BQUA 2B4OA 4ED7A 2RILA 3HVTA 5BYQA 4ID8A 4UQTA 2RUGA 2GV1A 5LMUF 1BQMA 1NK0A 3T5HA 1IKYB 2VODA 2RQCA 4O23A 2HHXA 1K73T 2RMLA 5T41A 1FDAA 1H3DA 5JXSA 4NCGB 2I9SA 4RW6A 4Y2KA 1JNRB 1WG4A 4ITSA 2AJ1A 3PW0A 3KNGA 3MFIA 2L9DA 2JDJA 2J0QD 1FDDA 1C0UA 2MQQA 5AE1A 3D54A 2OTJS 2KB2A 1HBMA 4K4WA 2OSQA 3KYLA 4XDCA 3DMJA 4L72B 4A8XA 1KLMA 4OV1A 3PXGa 5I4MA 4MKAA 4HT5A 4Q5VA 2M8DB 3PJXA 5EDWA 4JI1F 4JI2F 4EZ9A 3KMQA 1U49A 4NZ6A 4NLSA 5A2QY 5EGYA 4W92B 4H4KA 4ID5A 3GR1A 3MUMP 3CD7A 4O3RA 3IRXA 3RZAA 1T3OA 1TZ0A 5J2MA 3TAPA 3T5LA 2BRLA 3N79A 1P6TA 2E44A 4WK3A 2W7PA 2I1RA 4IG3B 2K7JA 1BC6A 3CXCR 1U1RA 2PDAA 1VFJA 2W8KA 1HL6A 2LQJA 4BWMA 3DHXA 4GC6A 1OSCA 3EGNA 2YWGA 4IH7A 2KHCA 3R5BA 3QPIA 1M5VC 3LH2S 3QIPA 1G1XA 5KFTA 4A8FA 4F2RA 4C3MA 2DJWA 3MM9B 5J2PB 4F4ZA 2CPHA 2ZOGA 4KKOB 1KHWA 4K4ZA 1NHVA 3HZEA 2M52A 4I2PB 1Y4ZB 4ZPTR 2A3JA 2ATLA 3N28A 2R7SA 4CQ1A 1O8BA 2KXFA 3OFEA 4QWEA 3TX8A 1HQEB 3M05A 4IYQA 1S9EB 1SIWB 2JC0A 3PZPA 1YRUA 3GSDA 4HHJA 2J9CA 5DS7A 4DOZA 1C1CA 1D9AA 4IOCQ 2XSFA 2YH0A 1RI7A 3SV3A 3OVBA 4QU7A 2N3OA 2IAJA 4DFKA 2OJ3A 2LDIA 3UR3C 2E9RX 4H4OB 3FFIB 2EW9A 4ECRA 4OI3A 4OMFG 5F8JA 3JTOA 2ADBA 1WF1A 3TQ1A 2YVSA 2IYGA 4HL9A 3LW5C 2X3GA 3I4PA 1S6OA 4F26A 4RW9B 5IQ6A 1QE1B 3M9OB 2R8KA 4CNZA 4MIBA 4RWXA 3FVYA 2CQ3A 1E6VB 3GV8B 5L38A 5F8LA 3KTQA 2JVOA 3MDFA 4TXSA 2HWHA 4Y28C 2PMHA 4DQRA 2AU0A 4B9TA 2W25A 3Q2TC 3DI6B 3CGIA 4NLDA 1TAQA 2FHMA 3DRPA 4O44A 2XY7A 2GIRA 2ROGA 4NPOA 2LU1A 2W9BB 3PW4A 3DRSB 2M2BA 3QGGA 3C66A 1XMBA 1GH8A 4MYUA 3CJ3A 1H2TZ 3T19A 2GQQA 5KG1A 3CJ4A 5HBMA 3V6DB 1RYSA 3KLHA 2O67A 2Z0GA 5HI7A 1HNXF 3MM7A 4Z2XA 3ZZUA 2VFTA 5KT3A 1RT4B 1X4FA 2CJBA 2DH9A 2LEBA 4DX8H 2FJWA 1DARA 4OQJA 1LK7A 2EVZA 4QOTA 2ZM6F 3MEEB 2R7XA 3OL7A 1FKOB 1WEZA 3H4DA 2QA4S 3C6TB 2XHWA 1UETA 4AL6A 3BQ2A 4ZCLA 1N33F 3UD4P 4PR6A 3NS5A 3OUYB 2RNEA 3PW2A 1BLUA 2GIQA 4M8LA 3R1LA 1N88A 1UP1A 3DXSX 3EUNA 1QY7A 4DG1A 3IAM9 4Y2IA 4ED1A 2IVFB 4DR6F 3RB0A 2N4DA 5D4LA 4FF1A 4RW6B 2R7RA 1D8ZA 3CD6S 3F56A 3MM5B 1NAQA 3HT3A 4ZVEA 3KJVA 4A8YA 3M2UA 4H54A 1WF0A 1P9QC 1U25A 1IJFB 2ILZA 5B0DA 2RVJA 1NKEA 2ZDPA 3IFEA 3V4IA 2C42A 4J9SA 4QZVB 4JV0A 3FQLA 4XPEA 5A8RB 4KR0B 3PVXA 4OJHA 2CJKA 2YNIB 1UL3A 5F8GA 2V4RA 2UXDF 2WCXA 1NJIT 4DLEA 3GMGA 2V2KA 1REVA 2ERRA 4X4TA 5DDOC 3MPVA 2BANA 1LFPA 2VKRA 3DOLB 3H2VE 3HI9A 3CCES 4J9OA 1IUJA 1OQ6A 1KR4A 4K0KF 2GMHA 1DURA 4J9KA 3UI3A 2C2EA 1OSDA 1VQSA 1RWUA 4P7TA 1J5OA 2ZH3A 4CIOA 2KZMA 1JXEA 2XS2A 2W7AA 2A2DA 4OZ5A 2B43A 4HH1A 3CTRA 1JB0C 1DLOA 2QA2A 3CT9A 1Y3KA 3OR2A 1AROP 2QMWA 4F50A 3TANA 1HR0F 1YJUA 5FJ4A 4KE5A 3BDEA 4ALZA 3TR5A 2YKPA 4NCGA 4DQPA 1S9EA 2FD2A 4V19X 3J81Y 2CQBA 3DLKB 5LT5A 1HBOB 3SCKE 3E2EA 1FEHA 1XMQF 2I5JB 3CD5A 2M5YA 1N32F 1Q79A 1X7VA 2EK1A 4KT0C 1TK8A 3PEHA 4C9DA 1HFEL 1ZAVA 1SL0A 1T05A 2YTCA 4KIAA 2C2DA 1TKXA 1D1UA 2FLPA 3MEDB 3R5DA 1HNVA 4Q43A 5E0OA 2EFVA 2HHHF 2DRAA 2D74B 3U1LA 3UD3P 1H0HB 1VGYA 3OFGA 5KG0A 1JJ4A 4O3QA 5KTQA 4NOHA 1C1CB 3JSYA 5BYSA 2VH7A 4E0DA 1TP7A 1LW2B 4X84A 1KQKA 4ZHRB 4F4YA 4TQRA 2G4BA 3BQ1A 1G6BA 1URNA 4LF6F 4EGLA 1RP5A 3CB4A 3PFOA 3CMES 1NJWA 2JEFA 5J2QA 5J2MB 2AQ4A 2FY1A 1VC0A 2IRXA 5E2QA 3CCJS 1WF2A 2NREA 1SUQA 4NA3A 2P9GA 3FSYA 4ZP7A 1GX6A 1HI8A 3RB6A 3T3FA 3CJ5A 1WHXA 5DDPC 3HLUA 4ZS6A 3SSQA 2MDAA 3X3UA 4DHVA 1OO0B 3K5LA 1K9MT 2LLZA 3TUIC 1U6FA 2VG6A 2EKYA 4TYBA 2YKAA 2VG7B 2KT3A 2FJBB 3OFFA 4DL4A 4WKYA 1R89A 1S6QB 4QPTA 1FCAA 1Z2LA 4FXVA 1QAIA 3T5KA 3GV7B 1R8HA 4AL5A 4EBEA 1R27B 3VAHA 1RTJA 2OPPB 3V6DA 4OLPA 2HPUA 3WX4A 5F9NA 1UEVA 3PO5A 1S1TB 3ZZ0A 4NRTA 3E3XA 3GFYA 4HTJA 5KFZA 3SZ2A 2J9DE 2ZUGA 1KEKA 3MUVP 5HLFB 4QIEA 2Q1LA 3I9V9 2LEAA 2VG7A 1RT3A 3NGKA 2M7SA 4PG4A 4CZCA 1LWFA 1WEYA 4AUKA 4OX6A 5K8PA 3MMJA 5KAKA 2VBZA 4Q44A 3QGHA 1N54B 2IJNA 2RS8A 4UW2A 2OAUA 4ES3A 1FEEA 2Q6CA 1Q7YT 4KO0B 1GXUA 2HHPA 3Q8QB 4A8SA 4RLEA 3ISZA 3ZZYA 2NZ4A 2JRSA 1KOOA 4N8OA 2ZHBA 5E7OB 3AB2B 2KU7A 2LYVA 2HNYA 5E41A 4DF8A 4OHWA 3PHEA 4DV0F 2R4FA 2MGZB 2XLKA 2IBKA 2VG5A 3KKFA 2RD5C 2J8AA 1YGYA 3OFHA 2VD3A 3C8YA 3HFKA 3LWLA 3G6XA 2C22A 5C24B 1D9FA 2PI4A 2VASA 5DQHA 2XO7A 3IA0A 1H2VZ 1NKBA 2E7XA 2UUCF 4GMKA 4FNHA 2GA7A 1DFDA 5IM0A 4YHHF 1F5CA 2ASDA 4F4XA 2IFXA 1IKXB 2BJEA 3HVAA 1HMVA 1HA1A 3ENQA 2AP6A 3PW7A 1V9OA 2FVPA 4TU9A 4FF3A 2B0GA 3Q2SC 2R2SA 1YIJS 3SCIE 4O3SA 1JKHA 1S1XB 2FGOA 1N48A 4X4VA 1DHMA 2AX1A 5E5NA 1Q78A 3AY0A 1HW8A 3LALA 4J9PA 1PC5A 3D0IE 1X4GA 2PT0A 4DSFA 2HMIA 3LP0A 1LFWA 1TL1B 4HI2A 4A4JA 5C42A 3VAKA 3HK2A 2DNLA 2ZBIA 3I31A 3PRDA 1PILA 1PSDA 1HBOA 5A6WA 1TKTB 2PD1A 3E51A 1L3KA 5E33A 2QLXA 2AYBA 4JUZA 1SB6A 2VFRA 3PFEA 1VS3A 2HGLA 4KV8A 1RT5B 4ZP9A 4H4MB 2MY8A 3MEDA 1RT5A 1WTFA 5GAEU 1TL3A 3MMCA 1YJ9S 3FZ2A 3CMAS 3L3CA 4WF9Q 3PNIA 2NSBA 3KLEB 5KFEA 2VBWA 2HHWA 4TLRA 2WB1D 4IG3A 2V9KA 3MAQA 3H20A 3LQVA 3I5BA 2F8MA 3ULHA 5K14A 3K5MA 3I87A 4F3MA 3JSRA 4YFUA 3FSIA 1KFDA 4IFVA 3RB4A 3P6YC 1CC8A 1WI8A 4HDHA 2VOOA 3TO8A 4QR2A 1ZM9A 4ELUA 4NYZA 3QWUA 3K59A 3X1LB 1VI7A 5GADI 2DISA 2IVYA 3H5XA 3CCUS 1HI1A 4A8OA 2Z8QA 2QV6A 2DT9A 4B3MF 2RKIA 1R8PA 2DB1A 3I96A 3BGRB 4QIVA