2FIUA

Crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
MAKGYWIAQVDVRDSERYKDYVSTAKPAFERFGANFLARGGSVTELEGTARARNVVIEFPSVQHAIDCYNSPEYQAAAKIRQEVADAEMMIVEGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal Structure of the Conserved Hypothetical Protein Atu0297 from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 30
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07045 DUF1330 Domain of unknown function (DUF1330)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fiuA00
4A48A 4OJGA 4Q2MA 1ULRA 2HLUA 3BR8A 4NPOA 3I9ZA 2KKHA 3FMBA 1SB6A 3HFKA 5T7LA 3MCSA 1KVJA 2K7JA 2QYCA 2OKQA 4OJHA 2ZDPA 1P6TA 3BM7A 2W4PA 1N5QA 2LDIA 1Q4RA 1TL5A 2BJDA 1N5VA 1CC7A 1APSA 3E8OA 3FRYA 2XMVA 1U7LA 2BJEA 2K1RB 5B09A 5B0EA 1TZ0A 2IYIA 1SI9A 2GCFA 3DCAA 2OD6A 2G9OA 4EFAC 4NL5A 5B08A 2IFXA 1X8DA 3TNVA 4DPOA 2W4CA 2FTRA 2QIFA 2ASYA 2GV1A 3BB5A 4FNIA 1KVIA 1KQKA 1WD6A 2GGPB 2K2PA 2HIQA 4DL0C 5A6PA 1AFIA 1MWYA 1YJTA 1X7VA 3QMQA 2ROEA 2KT3A 5B0GA 3DXSX 4ZA1A 3KG0A 2FB0A 2AP6A 2XMUA 2K7KA 5B0BA 4HH1A 1FVQA 1OQ3A 2BBEA 3BN7A 1X0PA 3LGMA 1SQEA 1Y9OA 1FEEA 2XMTA 3F44A 3LO3A 2HFNA 1FESA 2AW0A 2OFHX 2GA7A 5T7LB 2BYCA 3HF5A 3HHLD 4OIXA 3CJKA 1AFJA 1AW0A 3HDSA 1Y3KA 5A6WA 4HH0A 2W4DA 3BF4A 5F0UA 2JDJA 5B0FA 2RU9A 3TOQA 3HHLA 2GO8A 1YJUA 2EW9A 2XMKA 2ZDOA 3GZ7A 1JK9B 3HX9A 1FE4A 1FD8A 4Y2IA 2HQIA 4HI2A 1YG0A 3BGUA 1S6OA 2OAUA 4YDXA 1Y3JA 4OJ1A 1V3ZA 2FHMA 2HLTA 3FGVA 1XBWA 3QGPA 1IUJA 4F67A 2RILA 2CRLA 3LGNA 2LQBA 2N4CA 3K7RA 2VH7A 2HFOA 4Y2MA 1K0VA 1Q8BA 1S6UA 1CC8A 1Y0HA 2KYZA 1RJJA 3HHLC 5B0AA 4ZOSA 3T9NA 2AJ0A 1YJVA 1JWWA 4YEAA 2OD4A 2PD1A 3TRGA 1VQSA 1N5SA 1YJRA 2RMLA 1W2IA 1LQ9A 1P8GA 2ACYA 2XMMA 3KG1A 1TUVA 4HI1A 2KT2A 5KAKA 2LXFA 2ROPA 3VTIA 4A46A 1Q53A 1QUPA 4OJ3A 3UDCA 2RSQA 4FNHA 1GXUA 1FE0A 3IWXA 3MZIA 3CJKB 5IXUA 1CPZA 2GFFA 1FVSA 1OPZA 1R6YA 1YRXA 2K1RA 1URRA 4A4JA 4DN9A 1GXTA 2OMOA 2AJ1A 2Q3PA 2XMJA 2XMWA 3BDEA 2PGCA 2ROGA 3HHLB 1TL4A 1VQYA 5B0CA 2VV5A 4HL9A 2OP5A 2LQ9A 5B0DA 3IWLA 1Q8LA 3WDOA 3KKFA 1MWZA 5F0WA 4U9RA 5K9FA 2IYGA 3KNGA 2GGPA 4Y2KA 4A47A 2FIUA 2OFGX 2BUNA 2L3MA 4QOTA 1OQ6A 4Q2LA 2QLXA 1TR0A 1N5TA 2QLWA 2N7YA 2N4DA 1OSDA
chains in the Genus database with same CATH superfamily
3DU6A 4I67A 5KFUA 4FBTA 4K0KF 4C8LA 4L73A 3FK4A 3M8YA 4LT6A 1B0VA 1U2FA 1WDDA 2H5EA 3M8RA 3GLJA 2DISA 1VBYA 4ZIWA 5CYMB 3TA2A 3KLHB 1X8DA 2W4CA 3BH7B 2R7OA 3NWRA 1IKWB 3J80Y 4WKYA 1F3VA 1S9EB 3GJSB 2QA4S 3OHAA 3M8WA 3Q2TC 2R8HA 4EWTA 2QJ3A 3NGKA 3L7UA 3IP0A 4DV2J 3TOQA 2AEMA 4P73A 2IAJB 1YI2S 3FCVA 4DSEA 2FYXA 1K44A 3D1QA 2KFZA 2XZWA 2MJNA 4MTPA 3BJYA 2QSFA 3MGJA 4PEOA 3WX4A 5E7OB 2VUGA 2VFUA 2YNFA 3R5DA 3UR3C 3VAHA 4J9VA 1S1VB 3LALA 5DDOC 3KJVB 3JXOA 3G6VA 3G86A 5AJ3F 2VQFJ 1NUEA 2QLFB 4U67Q 2DR6A 2C42A 2R8GA 3DOLB 1QVGR 1U2CA 3M32B 2XGQA 5A0YA 2HSEB 4WU3A 2LECA 4HHUA 3KNAA 4ZVRB 2LP4A 1U1RA 3I31A 1N5QA 5H1SV 3DRXA 2OUGA 2R3VA 2XSFA 4EFAC 2VG5A 4F26A 5IM0A 4Y6IA 4DPYA 4J9KA 3MPWA 4YOEA 4NEYA 4JI8J 3OW2R 3C3LA 4K4ZA 3DLHA 3K2YA 5I3UB 2BYCA 4RW9A 2BM1A 2PSZA 2OJ3A 2BZ2A 4B3RJ 2C2ZB 2Y1LB 2YQ3A 1WEZA 2D74B 1M5OC 3IM9A 1HNZJ 4WFNQ 4IO9Q 1UTAA 3BPDA 2HS3A 4P74A 5JUMA 3SBMA 4ZVHA 2DNGA 1LWXA 1KP6A 3DYAA 1FNOA 5ETOA 3EGWB 4LRFA 2EC0A 1EIYB 3MDFA 5GVQA 4F36A 5KOWA 5GMKa 1XMOF 2HBYB 2N7YA 2ZBCA 1GEHA 4DZDA 3DNCA 3EZ5A 1LWCA 2WZ1A 2OPPB 3UNYA 2BA9A 4NL5A 4X4SA 1HKAA 1Q1KA 4ZJLA 3IM8A 3MM6A 4ILRA 5B0GA 4F25A 2VJUA 4GC6A 1HYSA 3DHWC 5DG8A 5CQGA 1XEZA 3D5MA 4FF1A 4TU7A 5AE3A 1HARA 3UI3A 5IWAJ 2IJRA 3ENQA 3D6TB 1QSYA 2BKPA 4YQWA 2FVRA 2RILA 3K7RA 5CABA 1SJ1A 2YX7A 2UUCF 3IGNA 1WF0A 4PZVA 4N56A 3CC4S 1N32F 3CD6S 2RQKA 3HT3A 1KBRA 2G4BA 4NCBA 3NRBA 5F0WA 2CQGA 3W1YC 3B82A 2IBOA 1U49A 2JEJA 2QLWA 3W7BA 3ISNC 2BQ3A 1RWKB 4M5IA 4WBFA 5FJ4A 2CPDA 2JJ4D 4LRAA 2M9KA 4CLPA 4K59A 3TA0A 3DM2B 4DPTA 3OVSA 3D0IE 5B0EA 3UN2A 3M2UB 1B70B 3KOAA 2ZH2A 2E5HA 5A6PA 4QIFA 4CO4A 2KXFA 1WC6A 4DL4A 2XZTB 1UVKA 1R3NA 4KB7A 3D28A 1Y9OA 2FHJD 2XG8A 3TZXA 4OHYA 4HI2A 2QL7B 5KG3A 1RWNB 1VOMA 2W1BA 4OZJA 3X1LB 2OPQA 4DL3A 2D41A 2R4FA 4QWBA 4CH7A 2KM8C 1YZ7A 3N9UC 4DXLA 3PV8A 2CNNB 3ET6B 3KLIA 2DEJA 2G1DA 2J5AA 1S1TA 1C4AA 5L1LA 3NL0A 3G8QA 5C42B 1PCAA 1VBKA 3CCZA 3KK2A 1TQLA 2D9OA 4OX6A 1X4AA 2ZZMA 3RW6A 3I9ZA 4H4KA 2OKQA 1OY9A 3GWCA 2ZHBA 2ZHOA 4MK7A 2XC9A 3TNVA 3LP0A 3JYTA 3UVJB 1RHKB 2WW4A 3C14A 1AT1B 2MKIA 4LBPA 1U26A 3DOKA 1MROB 2IPOB 4ED1A 1BY9A 5T7LB 1HBMA 3HHLD 3LP2A 1Y3KA 2W4DA 4A8MP 5ETTA 2LQ8A 3RB6A 5KG1A 1CJKA 4JV5F 1XERA 3CUNA 3SCLE 3W5YA 1X5OA 3RB3A 2J8SA 1W26A 3T1HF 5DDRC 1JQGA 1QY7A 4MKBA 3M1VB 1RBAA 1T9XA 4K4UA 2V8PA 3HHDA 4ZPVR 1YLXA 3MMCA 2H54B 4P7TA 3IMQJ 3C19A 2YNGA 3HKWA 4WP9A 1FFGB 1Q7YT 1Q8IA 1HWJA 3WBZA 4AL6A 2D3OR 2VG7B 1XJWB 3U02A 7FDRA 4QWAA 2L41A 2DGWA 2WVCA 3H4DA 4KGZB 2VL1A 3HFZB 3RW7A 3TVZA 2EKYA 2AEFA 2RVJA 1PILA 3W3SA 4ALZA 1F9FA 3GYNA 3BSCA 3FFIA 4F2RA 4DV6J 2FVQA 1WHWA 3ONQA 1DHMA 1FDBA 1YDLA 2G13A 4IDKB 3LANA 4I7FB 1P9YA 4ECRA 5F9NA 2ZH9A 3D6FB 3MURP 1C2PA 2YQ0A 4RZRA 1HBUA 3OTCA 1TKDA 1EQ0A 1EJ7L 1TUWA 3MI7X 2OAUA 4ENOA 1NKEA 2HLTA 4KY3A 1IKYA 1JLBA 4RPFA 2WSEC 3HHLC 3US5A 4LF4F 3TRGA 4B9MA 5E2QA 2E9TA 5GAEI 1Q53A 3UDCA 2IVFB 4QBUA 4CNYA 2M88A 1NM2A 1CVJA 1VQPS 3AT1B 2V4JA 3MD3A 3DKDA 5KG5A 1TL3A 1S72S 3J81U 1OYDA 4LF8F 4PG7A 2J76E 1TR0A 3HHEA 2XMAA 4QYRA 5FDLA 3PXGa 2EFNA 3ZO7A 3PW5A 3G71S 1R8HA 8ATCB 3KLGA 4ILMA 4ECZA 1HI8A 5IC6B 1QLNA 4DV3J 2XZDB 4WFAQ 1DTTA 1YJNS 2A6MA 2DYAA 3JSYA 3OL6A 1TK5A 1WUUA 4EZ6A 3QSIA 3M6XA 3IBWA 3VAKA 2YBVA 2YNIA 3PX6A 2QZ8A 2WONB 3PEJA 2FJBB 4EMDA 4PXCA 4O23A 2XEXA 3THVA 3OSPA 2I0XA 4LF7J 3UCUP 2RQCA 2HFOA 5BYSA 3EUNA 4ZOSA 4F0HA 2PD1A 3VTIA 4A46A 1WORA 2NCKL 3J81Y 2PDAA 5C25B 3HSZA 7FD1A 2AZ3A 2EKNA 3DOMA 1N34F 4LRDA 3WDOA 2UXBJ 4J9NA 1U0HB 2M3DA 1BGXT 2DJWA 4PWDA 2BUNA 1OQ6A 4JI3J 4PABA 4P75A 2WK4A 4USIA 1T02A 3MCOA 1UFLA 5L1JA 1FRXA 2DXFA 2GQ2A 1NSKL 4M8LA 1JLAA 5D0GA 5IV3A 2ZEJA 4ZP7A 1B64A 2GV1A 3AOBA 2F9JA 4UQGA 4I56A 4WU2A 4RW8A 4LQ3A 2ZJRQ 2U1AA 4A8KA 2AIRB 1FVQA 3BN7A 1TL7B 1UEKA 4FXVA 2PA3A 5J2QB 1N52B 3BREA 4F04B 3CCTA 3MD1A 4KT0C 2QA1A 1KFDA 4UY85 2ZOGA 4X4VA 4U96A 5DQIA 1S4EA 3LP1A 1F5BA 2XS2A 3ILOA 3KMSA 1GXTA 2C1EB 2RS2A 2OSQA 2DH8A 4ER8A 5MLCV 1Q16B 2D1CA 3SZ2A 4B3OB 4ZCLA 4UY8T 1WF2A 3M6UA 3T1AA 2HVZA 1J5OB 3TAQA 2Y9HA 1S1VA 3GR1A 1T03A 3BB5A 2BANB 1IWGA 5KG7A 2VQEF 3QMQA 1NK5A 2D3O1 3K89A 3ZNUA 3C15A 4C48A 4OYPA 4LSNA 2FGCA 2F8EX 3GB0A 1O51A 1YJUA 2ALZA 2C3PA 3ZZ0A 3DLKB 2FHOB 2HQDA 2V8DA 2GVDA 4YY3J 1DQAA 2DB1A 3IBCB 5LMUJ 1RA6A 3NXZA 1OO0B 3M2RA 4FNHA 4OYBA 2GMHA 1G1XA 4G1QA 3MFHA 3D54A 4ITSA 2VA2A 2ILZA 3N28A 2OTJS 4OZ5A 2BJ8A 1HBOA 2R7VA 1D9AA 5HP1A 2E29A 1FKOA 4GC7A 4ZPCA 2M7SA 5I42A 1HQEB 3H5XA 2DHHA 3Q8QB 3VAGA 4MAKA 4M63A 1LK7A 4ES3A 4M5HA 1KVIA 4FNIA 1H72C 1RWMB 1JLGA 3KUHA 1MN9A 3ENAA 2MQ8A 1SC3B 1RABB 1IJEB 1I5OB 4J90A 1ZM4A 4ED8A 1VC0A 1UZDA 1JJCB 1UVJA 4G6VB 1YVFA 4OYMA 4V19X 2HQIA 2VPXB 1FF2A 1FJGJ 2UXDJ 3FEZA 2XYPB 2EFQA 2LEPA 1FRHA 4Y2CA 5HLFB 2VG6A 4DPUA 3M8PB 3PRDA 4U7UD 1D3WA 1ZTTA 3EICA 5FLXU 3BDEA 3DGPB 4NX9A 2E66A 4ZLNA 4J9PA 1HNWJ 1YRTA 4QPTA 5KG0A 2FHKA 4DUYJ 3OTOJ 3HCXA 4R0JA 1X5SA 1S0NA 3LA0A 1N56A 2Q6BA 3R3TA 2XS5A 2BX6A 2IYIA 2Z4PA 3I4HX 4M5DB 5HN0A 4WYWA 2FTRA 2ASYA 1SUQB 3MAQA 1Q0NA 1MWYA 1VIOA 5DM6Q 1UW4A 5M2PA 4JI4F 3D9BA 4M5MA 4P7VA 3CCLS 2YKNB 3AHPA 1NDLA 4EBEA 3DRPB 3M4XA 3ZXWA 1AZSA 1H0HB 2GJ2A 3HVTA 2UU9F 2HRTA 1U24A 3P6YC 2POKA 1HLWA 1RYRA 3U7JA 2YH0A 5FLXY 2NREA 1S10A 3IR5B 3D7SB 1YJVA 3UWTA 5IV4A 2PE8A 4MKAA 2DRBA 1OPZA 5T14A 1DRZA 1M5HA 5HBMB 4O44B 3G9CA 4I69A 2OIHA 1HW9A 3KNGA 2CPJA 3KHLA 3AA9A 3HZGA 3GYXB 1N5TA 4DV5J 1SV5B 4CO3A 5A8WA 3VHQA 4ELVA 2MQLA 1S76D 5E33A 5A8KA 3C66A 2GVZB 3E8OA 2HVDA 3TX0A 3OR1A 3SSSA 3TUZC 2CZ4A 2EBEA 1SI9A 2NXUA 1BQNB 3K0JA 5KT3A 3FDSA 5B08A 5CD4A 1BWEA 2Q6CA 4J9LA 5I3QA 4NLXA 1EP4A 4DX6A 2K3KA 1ZAXA 5SZTA 1NMEB 2DNZA 2OGUA 3P45B 6FDRA 3KLFA 1RT6A 3IO1A 4QPXA 2EG2A 1H73A 4Y2IA 3FGVA 3UN3A 2ABYA 1CJUB 2N3LA 3MR6A 5DO2A 2FLLA 5F8NA 1YWXA 5L46A 4DUTA 3RZAA 1GXUA 2QSWA 3MTJA 4GVBA 2HQFA 3GSDA 4NLYA 1IKVB 1T94A 2ASLA 3DU5A 3MECB 1KHWA 1RAFB 1C1BB 2Q43A 2VD3A 2HURA 1WHVA 4LFCJ 4KO0A 3W8GA 4C0HA 5IOLA 4F4XA 3MEGB 3QGGA 3I56S 3NNCA 5CA5A 1GX5A 4QU7A 3OTBA 1S97A 1TL1A 2HWHA 4OZNA 4OX9F 1LW0A 3RBDA 5I4MA 1RAJA 1JXVA 1TKXA 3BF4A 2P2CB 4ID8A 3K5NA 3EE3A 4BCAA 2P5VA 1SKWA 2FD2A 1S77D 1LFWA 3M2VA 1KOHA 3SFUA 1VRTB 2HMIB 2R7RA 1S1WA 2RAQA 5DQGA 2NYIA 2H4YB 2Z30B 3D67A 3MZIA 1QUVA 4DR5F 4M95A 2Y8WA 2B6AA 1R6VA 1GFWB 4MK9A 2M0GB 1KHVA 2XBPA 4DR3J 1RYSA 3H40A 1IBLF 5LSRA 1VQ5S 1PBUA 4DR6F 2ZJPQ 1JNRB 2C3MA 3SV4A 3WC2A 2GQQA 5AXKA 5L9XA 3I0RA 1VQ8S 1C1CB 4HT7A 4C8NA 1AXQA 3PJXA 3J7AN 1P1LA 4N7TA 1FJCA 4AUKA 2V69A 4NLOA 2MZJA 3A8KA 1JNZB 2Z2MA 1WNEA 2NLWA 2X1AA 1JXLA 4NMXA 2I2YA 4ED5A 1FD8A 4F7VA 3MEDB 2WVFA 2RU3A 2HHHJ 3BQ2A 1Q86T 3KG1A 3MR2A 1C0UA 1S0MA 1G6BA 2E7VA 1NZ8A 1RWWB 1RTHB 3QGHA 4ZVTB 4USMA 4X62F 4C98A 1TK0A 1IWAA 5E0OA 1T9WA 2IHR1 1S99A 3R27A 1BC6A 2KJWA 3JQKA 4H4MB 2LMIA 2BKOA 3UCZP 2HLUA 3N79A 5F3TA 1QSLA 1UWBA 2CJBA 2AT1B 2YNHA 2OLWA 2JVOA 2X3GA 4U8YA 3WZ0A 2DGTA 2AYBA 2NUHA 4G65A 1D9FA 2PMHA 4QW8A 1X7VA 3T19A 1U0SA 4CYUB 3BO2A 1AYEA 2LLZA 4TU9A 2MGZB 4YS2A 1RLCL 5J2PB 1HNVB 3CD7A 5KFJA 3GILA 2C2DA 4QYZJ 4PPZA 3GONA 4PYAA 1KKHA 3G8SA 3IC1A 3DRSA 1WC0A 2ZDOA 1MMLA 1WJ9A 3FEXB 3SYZA 5C24B 4V1Ak 1SXLA 1IUJA 3CJRA 3M8ZA 2HGNA 2N4CA 2J9DE 1NJZA 3IAS9 3IXQA 1UKUA 1CJVB 1ROFA 1QUPA 2KG0A 2UXCJ 3GFXA 4ETXA 5D77A 3IG1B 1FX4A 1NHKL 2UVRA 4LF9J 5KFYA 3ETOA 3V2UC 2B3TB 1R31A 3PIOQ 2LU2A 1FTRA 1UFKA 4ZHRA 4LBIA 2HQCA 4CLYA 1W25A 3SCJE 3EVOA 3EPGA 2A3JA 4TKTA 3JAMU 5LM7E 1IBCB 2ZH6A 2IA6A 3V81B 3V4IA 3OTDA 4ECVA 3MM8A 2W9CB 2KTQA 3LF0A 3MEEA 1P1TA 2IA0A 3A8EA 1XNQJ 1TKTB 1UA0A 4LREA 3HPOA 1LKZA 4KHPJ 2MPUA 3FKBA 4DFPA 4DCOB 1RI7A 1S6OA 4P2XA 4FYYB 4OLOA 4USWA 5H9FJ 1RP5A 1Y11A 2X1BA 2J9DA 4Y2MA 1K0VA 5EDWA 2MHEA 2HBRB 2MZQA 1FKAF 2IVMA 1W2IA 3EM1A 4ZPWR 1S9GB 3T9ZA 1WHXA 2DCUB 3RBXA 2ZVSA 1AUDA 3GU0A 1FDDA 1P27B 3R5GA 1IN0A 4DV1F 4HR2A 3PNIA 3M9OB 3GV5B 5E41A 2B5JB 2UUWA 1TVRB 5LMNJ 4PG5A 4DJBA 3JAMY 2WVEA 3O44A 1LW2A 3VAFA 2VIHA 4RW7B 3MM7B 6AT1B 3WIUA 5D0EA 2BKNA 2YXLA 3TAPA 4ZVPB 1RT4A 1Q8KA 1VYAA 4YHHF 3PO4A 2NZCA 3OFHA 1UMJA 4N8OA 4GKKJ 5LJ5Y 4H4OB 2J0SD 2ROEA 2ASJA 3DDIA 1Q81T 2FB0A 3H42A 3LQVA 1OYEA 4OYXA 2XHCA 1NK7A 4BDPA 2QL9B 4DV4J 4P10A 3M7VA 4KJIA 3U27A 2O1PA 3KHGA 4LBHA 2KL8A 3A8IA 2CPFA 4P71A 4F67A 4ED2A 1S9FA 3L7PA 1RTDB 1FDAA 4NXMF 1I94J 2RMLA 4WPAA 4Q43A 2KT5A 3DRYA 4TY8B 2I9SA 4Q44A 3W2WA 1FD2A 2OMOA 4TQRA 5B0CA 1LWEA 4B3SF 2RQMA 4F0KA 1XN9A 3WHIA 2Q66A 4A48A 4DFKA 5CD4H 1R8AA 5HLFA 3HFKA 1KR4A 3BPSP 4ZVSB 2ZUGA 5AE1A 2HIYA 4JI7F 3TVKA 3DCAA 3CIMA 3MM5B 1M90T 4JYAJ 2RB7A 4M1KA 3IR7B 2KT3A 3NMRA 1WDTA 1X5TA 4FZVA 3VGTA 4HEA9 1Q5YA 3TZYA 4I0WA 4OIXA 4LFAF 2LYVA 1XQIA 2WOMA 4DR4J 1GAOA 1HWKA 2EXUA 3Q8SB 2DGSA 1DURA 4A8YA 1T7PA 4RR5A 2Q1LA 2V68A 4QU6A 2VBWA 1EAYC 2AYEA 2C28A 1SQFA 2HEKA 2D3UA 2CQ4A 2VU5A 1KC8T 2XMWA 5F8JA 3EVWA 4F0MA 4ZN1A 5B0DA 1RAAB 3M05A 4O3OA 5F8HA 1B99A 1VBZA 4I6YA 1OMSA 4MK8A 2LKZA 5CHCB 4C97A 3J7A1 2JLGA 3MAHA 1JLFB 3PYFA 2ZZNA 1EETA 4NCGB 1NSPA 4IG3B 4ID5A 2WBMA 4AQYJ 3KG0A 3RRKA 4DSLA 4HH1A 2ATLA 1DTQB 2ZFHA 2PFDA 5ITHA 2UZAA 1SC1B 2FC9A 1UFWA 2XMKA 2DITA 4ZDNA 3B8HA 3GJTB 2R7TA 4K50A 1BQNA 1L3VA 3JTOA 2NXJA 3UPFA 3QT5A 2XLJA 2Z0GA 4O3PA 1EHWA 1R6YA 1N88A 1HQUB 2VJVA 2HWTA 4LSLA 3C46A 2V67A 4K2XA 3N6NA 4AD6A 4Q8FA 2V50A 3GJRB 3QGIA 3KYLA 1JLCA 2LVWA 2V4RA 4TNOA 2LXIA 4ZCMA 4C8ZA 1NZAA 2B4OA 1DARA 4DV2F 3R7BB 2JEFA 2BABA 1REGX 4IFYB 2VFTA 1U7LA 4TXSA 2EFOA 3D1OA 4ICLB 3VWSA 1SJ4P 3PHEA 1N36F 1WC5A 5HJXA 5IS2A 4PQAA 1KWMA 3R8YA 1PGZA 2W2QP 3KJNB 2VQFF 1VS3A 2JDJA 2XI3A 3MEGA 2MTLA 3SCIE 4ED0A 2BJ7A 5AJ3J 1U4BA 2UV8A 4AFFA 3W9JA 3PFOA 1T05A 2JFDA 3NP5A 3P96A 3NS7B 2JRSA 1JJHA 2F3JA 5EWGA 1SJRA 4B9TA 2Y0SD 1CS4A 6FD1A 2RQ4A 1NH8A 1RUSA 5L8RC 4Q5VA 1VHIA 4CO2A 3R5BA 4YMEA 1V5IB 2BW2A 2R7SA 4N8NA 3SV3A 5L1IA 1EKSA 4I6WA 5D78A 1NJYA 2ZBRA 3KFWX 1ZETA 4WTOB 4B3RF 2XWXA 2ALYB 4M5KA 2KHCA 1YBUA 1MU2A 1RT2A 1TZ0A 1HNZF 3TJAA 4UTGA 3HSDA 4Y34A 4JI5F 2KU7A 1NRKA 2R9LA 3TO8A 5A0YB 1XC9A 4M5JA 4KGVB 5GAHU 4DFJA 2R7QA 3THPA 1MW7A 3UCGA 1C1CA 2C2OB 4K5RA 2I6WA 2VG5B 3JB9k 5IM0B 1RAEB 3POTA 3CCJS 3NEKA 2JH3A 1XMOJ 2XLKA 2JFKA 4MJKA 2KN4A 1UETA 3M8QA 2QEXS 1DAXA 1L5UA 1FO1A 1HIYA 2HGMA 3SXLA 4RW9B 3L7OA 3PO5A 4ES2A 1VRUA 2V2VA 2ADBA 1Z2LA 1UVNA 5KTQA 2DGUA 2AMCB 4U95A 2WSFC 2YWGA 2GHPA 2ZBQA 5KFNA 1HD1A 2N4DA 3RAQA 3QT7A 1IQTA 1S7IA 1NB2A 4ZVOB 3DYAB 5IWAF 3AD8C 2DR5A 1VQNS 1LXNA 2JWNA 1UVIA 4PKDB 2FGOA 1CQMA 2V8GA 2JOQA 2FLPA 2PMWA 2B56A 5D3GA 3I87A 4CDIA 5KFRA 2XMUA 2UUCJ 3I5BA 1JKHA 3UNGC 1FEEA 1T11A 1LWCB 2RNEA 3SQGA 3D68A 4ZVEA 1LWFA 3B6BA 2O3DA 4MFBB 2JLEA 2LQ5A 2JEIA 3QWUA 1XTZA 3D0HE 1N8RT 4XTTA 3Q2SC 1NDPA 3CEDA 4PWUA 4R5PA 4K4WA 3MM6B 2B4UA 4Q8EA 2HNZA 5DZ6A 3HI9A 4QJVA 1HYSB 1YJRA 4IUFA 4BS2A 3DRRA 2ZH4A 5J2PA 3HKZD 1UL3A 2WBRA 1IM4A 3G87A 2AJ1A 1S59A 2QX0A 2MKYA 3BV8A 2QL5B 3QIPA 2AZ1A 2H65B 4ZPBA 2DNYA 2F4FA 1NKCA 1FNXH 2XNQA 5D4LA 3W62A 1XNRJ 2DNKA 1QDUB 3CD5A 2H9ZA 3E51A 1HNXJ 3PY8A 4JI6J 1LV5A 3NY0A 1N5YA 2A18A 2EWHA 3OJUA 1D9DA 3FUYA 2HHSA 3T5LA 2A6OA 4B9UA 2FC8A 1RKIA 4IH6A 2M8HA 1FJEB 3Q86A 4MYTA 2ZKUA 1Z4UA 4OL8A 3HP6A 1NHVA 2VC1A 1H98A 1NBEB 3UQSA 5J1PA 2DHAA 2F8HA 3M30A 1RLDA 4PYDA 4YB7A 5HAOA 3HT0A 5U47A 1GX6A 2KO1A 5E3CA 3KK3A 4WYLA 1X4CA 4RUCA 4FDFA 1VR6A 4UUWA 1Q8BA 3T5HA 4TY9A 5ETLA 1FKPA 4M5NA 1FRLA 1HMVA 1F3FA 2MQQA 2HVIA 2CJXB 2CPZA 3ELHA 2OP5A 4XAKA 2BW7A 4DPWA 1UCNA 1Y5NB 1S12A 2OFGX 3IR6B 3H90A 1VI7A 3PVXA 4C8MA 1RWPB 4F4KA 2OH2A 2OPQB 2CVIA 4I2QB 1OY6A 3CPWR 3G6XA 3OD2A 3NBPA 4CLSA 2MKJA 1Z2ZA 1UEVA 3KLIB 3I0SA 3TW0A 1NPPA 1ZBTA 4WJBA 3KK2B 4PUOA 4KTQA 1OY8A 3L09A 3T1HJ 2W7AA 3RGIA 3RG6A 4LVOP 4C11A 2XQCA 3GYGA 2J6UA 1M1GA 1NO8A 3UFCX 3KHRA 2IIHA 3LP0B 5IQQA 3JYTB 1X9WA 1JXEA 4C3MA 3C14B 3GSIA 1WOOA 3R5CA 2W9BA 2IMWP 1K47A 3ZZUA 3DOKB 2AJFE 1CPZA 1HBMB 3PW4A 3LP2B 1RADB 2K06A 2KYXA 1RE1B 2E9RX 2QGFB 3W8PA 1KLMA 5AXNA 1CJKB 3O6QA 4E98A 3I9V9 4J37A 3RAMA 2E5GA 3KDOA 4LQ9A 5DLGA 1ULRA 2PO4A 3K59A 1H6KX 3LAMA 4DCPB 1DBDA 2AU0A 3QJLA 4DS4A 1N33F 4L3KA 1CSJA 1MWQA 1NKBA 3N5BA 3FCWA 2GCFA 3MMCB 4O4GA 2YNGB 2L48A 2LA4A 2O67A 3OVAA 2FZGB 3C16A 1ZYQA 3U1NA 2CQBA 3S1TA 1DFDA 1SL2A 4LF4J 1OSCA 4NRTA 2HQ3A 8RUCA 2R2UA 4TQSA 3PYGA 4U7UK 4Y28C 3FFIB 1VQKS 1S1XA 1Y3JA 2HHVA 1V3ZA 3BSNA 4NMLA 5E5NA 2WRMA 1YQHA 1RCOB 3WIVA 3MHYA 4DV3F 1F9HA 2W24A 1HBUB 1JJ4A 2F65A 2UUTA 1OJ4A 3FBBA 4TLQA 1WC4A 2CQPA 1FJ7A 4WK3A 3CJ5A 1MSWD 1IKYB 3R7SB 4RNHA 3QT6A 4JI2J 4NLGA 4J9QA 2QYCA 5JJBA 5ETPA 2GJIA 2M70A 1VQ6S 2ZNYA 2ZC3A 4LF7F 2W9AA 2V4JB 2UP1A 3A3PB 1TL3B 2OHDA 5KG4A 4YR2A 4PPDA 2RDIA 4ZPDA 5K14A 5FDLB 4GVLA 1X0PA 1GT8A 3O1LA 3RAXA 2CA9A 4EUVA 3KLGB 3Q8RB 4RNOA 4F4WA 4R8UA 1CLFA 1N34J 4FYWB 1JLFA 2OEJA 4JV2A 1DTTB 3HVRA 4IRCA 2GQCA 4DF8A 4QYZK 3LGNA 1L3SA 2C2KB 5L39A 4ZPTR 1B4SA 2HK2A 2XMMA 5RUBA 3OFGA 4KPYA 4L6V3 4PR6A 1VQOS 1V3SA 2F7VA 4LVNP 3QAUA 3VCDA 9RUBA 3CJTA 1Q8LA 2C22A 4NZ7A 3DXBA 4W92B 4RW4A 2GGPA 2C2RA 2B9XA 4KE5A 3ENVA 4NLUA 1C0TA 3H5SA 2E5JA 4C3LA 1BHNA 2LDIA 4PQUA 3J81j 2ZNZA 1X9SA 1YZ6A 3J80U 5D0RA 1N0UA 3DOMB 3OT9A 4QWEA 1TELA 4PWDB 3CE8A 5ETNA 2DKOB 2UVUA 1T0TV 2KZZA 4RO0A 3SSRA 5DDQC 1H2UX 2RT3A 3SIPB 1JLAB 5IFMA 3NGSA 3KLEA 2BE7D 3IA0A 2YH1A 2UUAF 1IBMJ 4DF4A 2UUBJ 2B7CB 3QIDA 1TKZA 5CCMA 1SKUB 4RW8B 2DO4A 4Y65A 4NXNJ 1VC6A 2GAHC 5H9FK 1U2RA 3AY0A 3TQ1A 3ZTSA 1G4CA 2B4PA 5J2NA 3P5BP 1CEZA 1S0VA 2IJFA 4ED4A 2U2FA 3DMJA 3AH6A 2AJ4A 1SJFA 2K7JA 4O4RA 3OXGA 3LP1B 3BEGB 2CPYA 3V5RA 4OHWA 3FCHA 2MZTA 4CLLA 3RRGA 3K8WA 2YWFA 4YY3F 2DO0A 5LMUF 2IRYA 4EO6A 3DXSX 4ZA1A 4KKOA 4MH8A 2AD9A 2QFJA 2ZJQQ 1RHQB 2K7KA 1Z1ZA 2J6SA 4DU7A 4KGKA 5FIIA 3BH6B 3GZ7A 4GKJJ 5KT2A 4RKUC 5GMDA 1T03B 3Q8PB 4KYZA 3QFHA 2V8VA 2L9NA 4XK8C 1S6UA 3TEGA 4X65J 1CG2A 1SBRA 4CM0A 3BBBA 1FRKA 3C15B 2BE2B 5AXMA 3V6KA 1CJTA 1OIAA 1UJ6A 5F41A 2W7OA 2MZRA 2ZE2A 5F9LA 1TP7A 4LSNB 1D1UA 2N82B 2CPEA 4DLGA 3QRQA 3V6DA 3GE9A 2KXHA 3RU0A 3W9IA 4F3MA 4ZITA 3ILLA 3R6GB 4A8OA 1FHTA 1Y5IB 2GVDB 1QAJA 4X4TA 2HBQB 4KBIA 1N6QA 4NLDA 2MQMA 2Z57B 3AFGA 3M2RB 4C9DA 3BBFA 3CCUS 4G1QB 2DHSA 4LIRA 2UXDF 5KFEA 4LRCA 2MJUA 1S79A 3LWLA 1HBOB 5HP1B 1FKOB 3H25A 4JUZA 3K5MA 1NJXA 5GADU 4O3RA 3F44A 5I42B 2HK3A 1HQ2A 2K8GA 1S5ZA 2HFNA 3WC0A 5B0FA 2BRKA 1NDKA 2R8KA 4C8KA 3EJMA 4G1PA 3S7RA 2QLJB 4KV8A 4DUYF 3OTOF 1JLGB 1X4EA 3TUIC 4FF3A 4U7CA 2HFUA 2C2EA 2VDHA 5GMEA 4HLBA 4CIOA 4DG1A 2VPYB 5J1EA 4A4JA 1DLOB 4MFBA 4FF4A 3W65A 3PR5B 3PRBA 4FPIA 1EZZB 5HO4A 4KRWA 2AGPA 2F5GA 2VG6B 4IOBA 4URGA 2VKRA 3KG4A 4R0EA 4NLPA 1WACA 4O0NA 3M9NB 2DXEA 3PKMA 5F8GA 2QIFA 2ASDA 3MM9A 1ZAVA 2OEMA 3GV8B 5J1NA 4ELTA 2A0FB 4IQMA 1VMBA 2DH7A 4BLGA 2NPFA 1RBLA 4OYIA 2YKAA 2W8LA 4OZLA 2AYMA 2Y1JA 1PIEA 5HMYA 4QIEA 5BYQA 3TQEA 2FHMA 1E6YA 4KHRA 3GQCA 2KYZA 3NS5A 3MUTP 1BQMA 1B3TA 2HNDA 2AJ0A 2J7WA 5GADI 2ERRA 2RS8A 2V9WA 3F56A 2XO7A 3C6UA 3BQ1A 1AZSB 3PW0A 2BEFA 2CQ1A 2K3IA 4QW9A 3QO9B 1KOOA 3HVTB 1R0AA 4RBVA 2G2YA 5BR8J 3G96A 7AT1B 1HHSA 1R7IA 3BR8A 3DHXA 4NPOA 1T9YA 3E01A 2QG9B 3GFYA 3CCSS 2MY7A 1NAQA 3ZC4A 2JNJA 4AE5A 2EG1A 3TWZA 3IBFB 2GX8A 4DL2A 2XSJA 3N01A 2DNRA 2IM3A 1ZA2B 2CNLB 5HI7A 2DGVA 3D2WA 3KK1A 3G2XA 4P6QA 5A8WB 2QA4G 2NPIA 4CNZA 2AW0A 4FVMA 3CJKA 4I2QA 1VHFA 3Q89A 4ED7A 1Y00A 5A8KB 1RAIB 5DM7Q 3PX0A 1UJ4A 2MQNA 2VBZA 3OR1B 4W4MA 2W8KA 3CDAA 3TYTA 3MUVP 4P2SA 3H20A 1YKWA 4USJC 1SL1A 3BGRA 1EP4B 2HVHA 1CC8A 1R43A 4W98A 4WK1A 2WTFA 5HMWA 1VQSA 4ATNA 2KT2A 4IKAA 2ZOFA 1U45A 3E3XA 1R0BG 2VZ9A 4WFYA 3FBCA 3KLFB 1RT6B 1U1LA 4AYBD 3FSIA 2HHWA 1QE1A 4OX9J 3T1YF 3TX8A 4MT1A 1BWVA 4IFVA 4PCQA 3F41A 2RHSB 4ZJOA 5EUHA 4GVBB 4UZCA 1SKRA 4K2JA 3KMQA 2XS7A 4WE1A 3PW7A 4ELUA 3P5TL 4LR7A 1JLQA 3K5PA 1AFIA 2P6TA 4B9VA 1WG4A 4KO0B 4UOCA 2QMWA 2BOAA 2YPZA 2RIJA 4ZPAA 3ITHA 2CDQA 3QAEA 2WSCC 4ZVUB 4DQPA 1HPZA 1KQGB 4X4UA 1JMTA 1XBWA 1TL1B 3JQJA 4HACA 1IBLJ 1LW0B 4YEAA 4DR6J 2NSBA 3IN5A 1LQ9A 2ZBPA 4Q7AA 4M5GA 5F8IA 2B8PA 3MMJA 3BBCA 5LSOA 1TKXB 4RUHA 3KJFB 2Q3PA 3LPEA 1S4FA 1M1HA 4UW2A 3BSAA 1EB0A 1WWHA 3H7HB 3M2VB 4ZP8A 2ZH5A 1S1WB 1YJWS 3K8VA 5L9NA 2XY6A 4FKXA 1PYTA 3S8SA 2B6AB 4USVA 2LCWA 2KVIA 3D0GE 3F73A 4CT8A 1RTZA 2NXEA 3ILIA 1Q82T 3CJ3A 3P8BB 2VPZB 2X1GA 4FYDA 1O8BA 1NU4A 4J9MA 3A13A 3ICLA 1TFYA 3HF5A 4DL5A 1HW8A 3SDEA 3PG9A 1S0OA 3I0RB 5M2UA 4WXOA 3HX9A 3GFHA 3HZEA 1FE4A 3B4DA 1KN6A 4LF2A 3LW5C 4DLEA 2AEJA 4RNFA 2IM1A 3ZZOA 2QMXA 5HVHA 3AB2B 3SI8A 2FVCA 4DN9A 3CTRA 3R5JB 2M8DB 4A8FA 5BJRA 4ECSA 1T3OA 2DEIA 2FIUA 2GMLA 1QVFR 2FJWA 3MEKA 3VGUA 2QLXA 4NA2A 1AUSL 3CDBA 3DC2A 1C0UB 1KONA 3TANA 2GMJA 1BUXA 4Z7YA 3FQKA 5DRKA 3HVWA 4J9SA 5ETMA 1E6VA 2IFXA 1RWUA 2CQDA 2HPUA 3PJWA 3LAKA 5KFVA 4OX8A 4XO0A 3IRXA 1NPKA 2D7SA 1X31C 2EFVA 2VODA 1UWBB 4CH1A 1OS5A 3H0PA 4URSA 2YNHB 3MMAB 4O3QA 2PI4A 2QC3A 3SFGA 3AD7C 4YDXA 2LFVA 3MPYA 1FERA 2YKMB 1NK8A 1NK9A 2MKSA 2AGQA 3VVUA 2J7UA 3W2VA 3MR7A 4C0OC 2H51B 3UDEA 1YRXA 2HS4A 1J5EJ 5CYQA 3JSMB 2QMUB 3OR2A 3DRSB 4ZJQA 1YIJS 5D4NA 1U1PA 4F3OA 3UD5A 1S6PA 3EXYA 2VF3A 1VQ9S 2C3OA 1KEKA 3RB4A 3FZBA 2CKWA 4KHPF 1QAIA 3AJDA 4XPEA 3OL7A 3I82A 4DUZJ 2XULA 3EX7B 3H8YA 1TUGB 4WP3A 2WVDA 4FS1A 1YBAA 4DQRA 3SMZA 1YJTA 1TMJA 5KFSA 3GPAA 2F4VF 2YWEA 1V3RA 3IRWP 2DNQA 4J7CA 4LSZB 4ZHRB 5DGAA 4AXJA 2PEBA 3A1YG 1AFJA 2I5JA 1H2VZ 2R7WA 3ISZA 2BOPA 1O0PA 3TA1A 1RT3A 1VDHA 3IS9A 4DV1J 4NA1A 5LMNF 2PEHA 4DR1J 3V4IB 3ENWA 2LQJA 5AT1B 1P8GA 5KAKA 3MM8B 2AF6A 3MEEB 4I64A 1URNA 1X4DA 3ZTRA 5GAGU 2OTLS 5C5JA 2DNPA 4GKKF 2MKCA 4U9RA 3CGIA 5CYJA 4Y2KA 4L74A 4Q2LA 3K17A 2B43A 4P52A 2DR7A 1JB0C 5J2MA 2EEYA 4DV4F 3J7YU 1D8YA 4BWJA 3G6YA 5LXYA 2BE2A 4DX5A 2E5LF 3G82B 4WP8A 2H3EB 1T3NA 3MR5A 3OXFA 4CP5A 2NQPA 3LH2S 4ZK7M 4LFBF 1FNMA 2ZD1A 1LW2B 4KQZA 2LDYA 1M1KT 4B3MJ 1ZZFA 4DS5A 1KQSR 3CJ2A 1RT4B 1YGYA 2FJDB 4B3SJ 3BS9A 2OPSA 4HKQA 1RISA 2DNOA 1A7GE 1V9OA 1QTMA 4MIBA 3AOAA 2GO9A 4DSFA 2YPYA 3QLHA 3W5XA 4K4YA 2WHOA 4K4SA 4OHVA 3H59A 5LOQA 2HBZB 4DPXA 3TI0A 3LPYA 4JI7J 2V5HG 4DHVA 2GW8A 1KTVA 2XCAA 4JI0F 1NK0A 4QIWD 1HR0F 4Z2XA 4ECTA 4X2BA 4YR3A 4DR4F 2RRBA 1NXIA 4LFAJ 4BBYA 3GMGA 3GIIA 3W2WB 1BMQB 2X7IA 1SC6A 2DNLA 1LWEB 3RUBL 1DLOA 2ZH7A 4DR7J 2W2MP 3NKYA 5ETSA 3HHKA 5B0BA 3C2PA 5KFPA 1MG7A 3PYDA 2M5YA 5EWEA 3HHLA 2HVEA 5KFZA 3HXMA 3S6EA 2I38A 4D3GA 2IC3A 1IBKJ 1EX8A 2AKWB 3U1LA 3PIPQ 3FVYA 4X66J 4PG8A 4NE9C 4E2FB 3MPVA 4OYOA 3QJPA 3D4JA 2BR0A 2XY7A 4IR1A 2DGXA 2PGCA 2WOMB 4UQTA 4AQYF 4OI3A 1KD1T 3N6MA 2V2QA 1RSCA 4ED6A 2C2MB 2VPWB 4LIWA 1SCJB 2Y8YA 4O0IA 1KVJA 3AOCA 4K5SA 3CDWA 2RUSA 4WXWA 2YWKA 1APSA 3AJ1A 2B51A 1KQFB 2XNRA 4IH5A 3QO9A 4H4KC 5AE2A 5CH7B 1KRPA 1CULA 5HK4A 4FVCA 2KXNB 1GXLA 2G2OA 3QZ7A 2RF2A 2B9EA 1EARA 2CJYB 1H3DA 2DY1A 4NYZA 2VDIA 4AL5A 2PA8D 1ICEB 2J9CA 1EETB 1UW9A 4ID5B 3NGRA 2LQBA 2YWWA 1RTIA 3RB0A 4RU9A 1AB8A 3O3LA 3ZFVA 3BGOP 1ZM9A 3NMAA 2CQCA 4HTJA 1IKXA 2XMJA 4OZ2A 3AAWB 3UN5A 4DV0F 5DG7A 4A47A 1N36J 2GNKA 2CJ9A 3VGVA 4DQIA 2QA2A 3DFEA 5G0RA 3OLAA 1RHUB 2ZWOA 2EVZA 3MAAA 4OYAA 1GQEA 2HFVA 2VFRA 2CFXA 3R5AA 4DMZA 3D3CJ 4LSLB 1VC5A 4I1TA 1TV6A 3BYPA 4CZCA 1XIQA 4IO1A 1JLCB 4DBQA 1XWLA 5IT9U 4LRBA 1VCTA 4QZVB 2MHNA 1VIXA 2CIMA 1A0OB 3Q24A 4DFMA 1R8PA 1PG5B 4B3TJ 4WIIA 3AODA 1LOUA 4L76A 1FK9A 4HI1A 1H7XA 1G2EA 3A12A 3EZOA 1FWLA 3D66A 3EXCX 2EC2A 4FBUA 2LQ9A 1NH7A 4P2MA 3PKYA 4QOTA 4JI5J 1T05B 2C3YA 4X4PA 2R2TA 1SJ3P 3ISND 2V63A 2XYGB 1TK8A 1YJ9S 1R27B 4TYBA 2V6AA 2XMVA 4NLWA 1CS4B 4K8RA 4KGMA 2G9OA 5IT9Y 2VA3A 2RE1A 3MMBA 3NLCA 1I3OB 3CIZA 3B78A 3W61A 1ZOTA 2A10A 4Q0BA 3PZPA 2DIVA 1WG1A 2EI5A 4FF2A 3DDNA 3GIJA 3A4TA 1T95A 1MU2B 1DJ0A 1RT2B 4CLKA 4DI6A 5HQ8A 3R1HA 2HZVA 3NNHA 9ATCB 5HQMA 2UVWA 5IC4B 4YB1P 3HHNB 1WSRA 3G4SS 3NWGA 4HHJA 2XGPA 1MMDA 3ILJA 1FDNA 4OJ3A 1VJQA 1K9MT 3N0VA 2FJVA 3CJ8A 3K57A 1IVZA 2ZM6J 3K58A 4U8VA 2FUG9 1JLEA 1N0VC 4TLRA 1HNIA 1V6HA 1QAXA 3POTB 2RRAA 2V34A 4X64F 3CCRS 1UAWA 2AYGA 2BM0A 1D8ZA 3R9LA 3M8QB 1R8BA 1G3OA 4DL7A 2VFVA 2O66A 2X51A 2NR0A 4KIAA 1BE4A 2H48B 1VRUB 2EK6A 1KQKA 3Q8YA 2AJQA 1B0PA 1RT7A 2OPRA 1WI8A 4J5OA 5ADZA 4NZ0A 4DR2J 1GMUA 1L3UA 1VGYA 4JI1F 4EYHB 5BXIA 3DDKA 2V2KA 3DLEA 2EW9A 3BO4A 1RU2A 3FSXA 2IDEA 1YITS 1YTYA 4RBUA 2VICA 1ZPVA 5D3GB 1J2VA 2BV3A 2FPHX 1UZHA 1XNRF 2Z2YB 4D3HA 1N5SA 1JKHB 4IH7A 4HHHA 3KUGA 2LXFA 3FRZA 1HNXF 2IBKA 4CO1A 3SQGB 2ZVIA 4WZQA 4JI6F 1LWFB 1RQ0A 3MMAA 1TL4A 4DV7F 3QZ8A 1ZTWA 2R2SA 1MWZA 3EGZA 2IRXA 3VGSA 4KR0B 3MOJB 4ED3A 2DK2A 5D0HA 2AX1A 4R5PB 4PXDA 2HNZB 2YKMA 5D4PA 1TFWA 1XR5A 3EVMA 3L4BC 3VQSA 3DRRB 4JBCA 1RACB 3A8JA 4WFXA 2Q79A 5H9EJ 3CSKA 3JSMA 4MKVA 2DT9A 3B54A 1QSSA 3QIPB 4NRUA 2DNHA 2YVSA 2ATCB 2ZHAA 3UE2A 2QT7A 3CB4A 1UPPA 5CZVA 4NLTA 4I68A 4N76A 3DI6A 4RU2A 2ZC4A 3PDNA 3KJQB 2C2NA 3MXHP 4I2PB 2MKHA 3DLGA 1KDNA 1N5YB 4ZS6A 4DQSA 2CZ9A 1RT5A 2R2RA 2E1RA 4OZ1A 5GAEU 1I6JA 4ZVGA 5KOXA 4LF5J 3CC2S 2RSQA 4WWSA 2GFFA 2K1RA 3G8TA 4OI0A 1TAQA 3M30B 4ZIVA 2DGOA 3MF5A 2MSTA 3VZIA 2ZH3A 1FXLA 1D0EA 4QIVA 1REVA 2NS1B 4WIQA 1KSPA 3KK3B 4LF1A 3W9HA 2HRYA 3UR0A 4F2SA 1S6QA 4C4WA 1UWAA 2FZCB 3HVAA 4CTAA 1FKPB 2BQUA 2I8EA 1HMVB 4E8UA 3PM9A 1U8SA 2BACA 3NOCA 5K8NA 3OV7A 5HROA 2SXLA 2WCXA 3OXLA 5F8LA 1RKJA 3ZZRA 1OQ3A 5CAAA 3HDSA 3NBPB 5F0UA 2B8QA 3OL8A 2VHGA 2V8HA 4YB6A 3I0SB 3TAMA 2F63A 2HFZA 1NJWA 3G82A 1FWKA 3NS6A 4W90B 3ZZTA 4PUOB 3C6TA 1Q79A 3H4BA 4GO7X 1S1UA 2NZ4A 3R1LA 1YJ7A 1PAEX 3CXCR 1N33J 5DLFA 1RTJB 1SIZA 5D8HB 2HNYA 4L72B 4C11B 3BKUA 2CYYA 1RAHB 2CQ3A 5E3AA 1UPMB 1NB7A 1GMVA 4DX7A 1KFSA 1WOPA 2PT0A 2W9BB 5JXSA 2WB4A 1TL5A 4NASA 2KFYA 2MZ1A 1ZA1B 5A8RA 1PC4A 2LXUA 3M6VA 3T5KA 1FT8A 1KLMB 4KC5A 5ETRA 2AP6A 4EO8A 3LOUA 4DN0A 2XHWA 5E3RA 4ECXA 2OFHX 1IQZA 1HI0P 1WKKA 4FPRA 4RUBA 4CT9A 1Y10A 3D6HB 4RW6A 4O4GB 4NI2A 3C16B 4JI2F 2J0XA 1BQXA 3MR3A 2XYHB 2B7BB 5ETQA 4ZLPA 4CLFA 1F5CA 1S57A 1Q78A 2KG1A 4KHMA 2FJAB 3JTNA 4E0DA 4LR9A 1S1XB 2J0WA 4X4OA 4RL1A 1RT1A 4OJHA 4ZKAA 3A3OB 1LXJA 3CCQS 2A1BA 4OV1A 2K2PA 2KDOA 3J7Z5 4USKA 2NXNA 5AXLA 1GNKA 4J9UE 2H4WB 2HRUA 3BR9A 1VJWA 2DD8S 2ZH8A 3IAM9 2CJQA 2RUGA 3OBIA 3A3NB 3DLLQ 2PN6A 1PC5A 1B7YB 2A2DA 3BGUA 5DS7A 4OJ1A 5F8MA 5LSLA 1Y4ZB 3J7ZT 3AB4B 1HBNB 2COLA 5K14B 3HLUA 1X5PA 3GIRA 2ACYA 1TUVA 1U1OA 5EX0A 2WAQD 1PJ6A 4ANEA 2B4VA 2CQHA 5CYMA 2BJ1A 4R8UB 3KLHA 3IWLA 4YB5A 4IRKA 2D69A 1IKWA 3BKTA 1I1GA 1S9EA 3QRRA 1XMQJ 1J27A 2MSSA 4K4XA 2DR8A 1U1QA 1UA1A 2MY8A 2IAJA 4Z7CA 2DY9A 1IBMF 2UUBF 1RWOB 3QPIA 2PI5A 4LF6J 3M6WA 2Y1RI 4RW4B 2GGPB 2UUAJ 4RNNA 5DGBA 4NXNF 5KFQA 2D9PA 1H7WA 1BLUA 4XDDA 2YKQA 3V6JA 1F60B 1C0TB 3R2CJ 4WF9Q 2MXYA 2XTJP 4TYAA 3KJVA 4PQUB 3O8WA 4K0KJ 1WHYA 2QRRA 2XCPA 2R8JA 1T8EA 3TUJC 1EQMA 4IYQA 3TVYA 3DOLA 3RBZA 3M32A 1Q7LB 2E9ZA 2BXJA 3PYEA 1BD6A 4X4RA 1NK4A 5MAOA 2OD4A 2R8IA 3R97A 5DJBA 5IXUA 2P6SA 3CT9A 5K8OA 3KLEB 4AXIA 4OI4A 3HMJG 4CM2A 5LT5A 3N4WA 1L3KA 1TKZB 4PG6A 4X4QA 3S01A 5I3UA 2VONA 2YTCA 5C2GA 2ZWPA 2G0IA 2BJEA 4GKJF 1ZM2A 4OZ0A 4OHXA 3MWBA 5J2NB 4X65F 3DMJB 2CPIA 1PJ5A 2HZCA 1AW0A 1TU0B 1FI4A 3IFEA 2MQOA 2E1AA 4ECUA 1M5SA 2KH9A 1SPBP 4LR8A 3GFZA 1UP1A 3CC7S 2J9EA 4JI8F 4KKOB 1GTHA 2P9EA 3CVKA 2OPPA 3H2UB 1HL6A 4IG0B 2RHQB 1XMBA 4NZ6A 4KPCA 3JTPA 4P2FA 2QO3A 2ZZTA 1PJ7A 2OMLA 2J7KA 4QR1A 3MCSA 2E1MC 2W4PA 3TR5A 1CJTB 3FRYA 2ZE2B 4YR0A 1GH8A 4LJMA 4ECYA 2VB6A 3V6DB 1GMWA 4CWBA 3DN9A 2J6TA 1ELOA 4F50A 1WKLA 3W66A 2RJZA 3MFIA 3R2DJ 1B7FA 1N6QB 5CZXA 2RD5C 2GA7A 2MLXA 3ZNJ1 2IM0A 2W25A 4FP9A 1F9EB 5DETA 5JVGQ 4EI2A 1VFJA 4PXEA 3D1HA 2VFSA 4Y2AA 1Y0HA 5B0AA 4NYPA 3CCWA 1R8CA 1S48A 2YY3A 2BJ9A 3DM2A 1W2BR 1RHRB 4KH1B 2LEBA 1URRA 3PCOB 2J0QD 3M2UA 1ZPWX 3FBEA 4UOFA 4HDHA 3CWJA 3VAJA 1RA7A 2M4MA 4KV8B 1B0TA 2VASA 3TJ9A 3FMBA 4IR9A 1IR2A 2MDAA 2KI2A 4GRSA 2BJDA 4DG1B 5B7WA 4IRDA 4EU0A 4J91A 2ZOMA 5J1EB 4PWWA 3AQPA 1N32J 1FWPA 2MLZA 3NGUA 3V4MA 3F0NA 2VBXA 4C8OA 4FKYA 4C2MA 4B17A 4RJVA 3HK2A 5HMZA 5KT5A 4AL7A 2AQ4A 3P49B 3ET6A 3H5YA 2RH3A 3CCVS 5GAHI 2Z2ZA 4HH0A 5KT4A 3FC9A 5BR8F 4DCJB 2HYIB 5C42A 4DZ6A 1ITPA 4ANCA 5E3QA 3MM9B 3VZHA 4X84A 3RR7A 2JSXA 5A2QU 2E1PA 5L1KA 1FFSB 2EFPA 3T6BA 4KGXB 1TAUA 2Z2LA 2I1RA 2IVYA 2CWKA 2ILYA 3UVJA 1S49A 2VOPA 4I2PA 1E6YB 1IXKA 1OPIA 1LNQA 2PMZD 1BQMB 2HNDB 1MROA 4C3KA 3TZZA 5T7LA 4TVAB 2NXCA 1RAGB 4ZVFA 3Q8UA 5KG2A 2LU1A 3C6UB 1NNDA 3O5TB 4TN2A 5KFIA 1R0AB 4F8RA 5KFKA 4J9RA 4NCAA 3EWGA 4USTA 3CDEA 2DHGA 2D3ZA 1U02A 4C6AA 2FDNA 1WSVA 3E01B 3M1VA 1K1QA 5D15A 1K73T 5HQLA 2DCLA 3MOZA 5A2QY 4Y0FA 3WX8A 2CQ2A 4RWXA 3UW1A 2CDRB 1SKSA 2BJ3A 2VG7A 2XSJB 2VH7A 1SH3A 3T1YJ 3W63A 4FXDA 4JP8A 2OI2A 3BZQA 3KK1B 2DBBA 3UD3P 5EHHA 2AJ2A 3CJKB 4MMOA 4OYWA 3QGPA 2GIFA 1RHJB 1VISA 5KFXA 4IDKA 4JV5J 4I7FA 4IOAQ 3QT8A 3BGRB 4OI1A 2UVVA 1VQLS 5KFWA 1NCLA 4OZ3A 2ZBIA 4DOZA 3EDQB 1RTJA 3PJ9A 2Y3YA 3MPUB 5LL6d 1ZAWA 2Y1IA 4YDDB 3HSGA 1PYSB 1RHMB 3OFFA 3ZZZA 1MNEA 4OQJA 1F6TA 1QE1B 3GTYX 3VAIA 1M5KC 1X60A 4QR2A 3WQPA 4IFVB 3CCMS 1SH0A 2UV8G 5C7PA 4RWWA 1K8AT 1RGVA 1FRJA 4WE1B 4DV6F 4S0MA 1JLQB 1R89A 3NNAA 1XR7A 2BRLA 4DU8A 3UDLA 5EGYA 1S7HA 2DHXA 3UO0A 3M9MB 3GR0A 3ITHB 2VV5A 3RYLA 4IOCQ 3BGFA 3FJ2A 1HPZB 5DDPC 4EBCA 1NDCA 2W01A 4HACB 2GIQA 3RTVA 1SIWB 2NYHA 2WONA 1VQ7S 2G0CA 3AD9C 1ZS6A 2J8AA 2AGOA 2H5IB 4NLQA 2XB2D 1WD6A 1A9NB 2WW8A 4K4TA 4LF8J 1XK8A 4N77A 2E1CA 2DRAA 5C25A 3VQTA 4NA3A 1UEUA 3T5JA 2YX1A 2H1YA 1U0HA 2QYGA 4OYZA 4MIAA 2JHEA 2FQQB 5EX3A 1RK8A 3EPIA 3TJ8A 3SDEB 1Q95G 1FXDA 2IRUA 4MIWA 5DZ7A 2AX0A 5DG9A 4KFBB 4I6AA 5M2RA 4CRJA 1X4HA 2JC0A 1KLNA 2DPIA 2LA6A 1TL7A 1HBNA 2CQIA 5J2QA 3G6ES 1PO6A 4ZMMA 3Q8VA 3TZWA 2N7CA 3Q22A 4OI2A 4Y3CA 4CLWA 4ZVQB 4HYKA 2F9DA 3SEOA 2UXBF 1WC1A 3NAHA 3Q23A 5K5MA 4JI3F 5IZHA 1M5PC 4GMKA 3H2VE 1WEYA 2JVRA 3PTWA 2BVZA 3HO1A 2GIRA 3LGMA 4LUBA 3NCRA 5H9EK 1J5EF 3TEHB 1GMWD 1WI6A 4ES1A 4UOHA 8AT1B 1YBTA 2CUYA 1E6VB 3FEYB 4ECQA 3MUMP 1MMNA 2XLIA 1IR1A 2FVSA 4OV6A 1LEOA 2X3DA 2ZITA 4YFUA 3IRXB 4B3OA 2EK1A 2IMOA 1V5VA 2V4QA 4DUZF 2Z56B 4XDCA 1J5OA 5FD1A 4DDFA 4EYIB 4OLPA 3QQCD 1FTCA 2GS8A 2KRBA 3JSBA 1SVDA 2BANA 1HWUA 3HJVA 2IYGA 3AXKA 2O5DA 3OLBA 3Q0AA 1IR0A 3GV7B 2FY8A 2F4VJ 2XO6A 3W2VB 1WF1A 1SL0A 2YWHA 4OMFG 1N5VA 5KFGA 1I51B 2DNMA 4NYOA 1FCAA 4BWMA 4G1IA 2GJFA 4BC9A 5DQHA 5CYQB 1F2HA 2V2ZA 4DR1F 3H2LA 3OR2B 3DLKA 4OHZA 4QWDA 1S6PB 4A8WA 2WVBA 4F4AA 1X4BA 4RLEA 5KFTA 4ILLA 1PSDA 2CXEA 3IGVA 2EPIA 1FESA 4G3IA 3PX4A 5HSPA 4ZLLA 1EKRA 2GO8A 4O3NA 2GAGC 2CQ0A 2FLOA 4R25A 4F4YA 4URQU 5JMNA 2N3OA 4C0BA 1WG5A 5D6GA 1CQNA 2CJAA 2VQEJ 1HWIA 1HQEA 3L3CA 3KDNA 1A6LA 2QE5A 2I5JB 3W64A 2OELA 3QJJA 2E5LJ 2KM8B 4JV1A 5LXRA 3FSYA 1RT3B 3TARA 1QJHA 3IS9B 3GG0A 2XM3A 5D4OA 2L9DA 2B9WA 4UZBA 1N48A 4CO5A 2QTWA 3ETMA 4X4NA 3B4MA 2E44A 2CNKB 3NCQA 3QBCA 3FNNA 1K1SA 4B3MF 4LFBJ 2FJEB 3PRVA 4HT5A 1FX2A 3H98A 2FLNA 5KFMA 5KFBA 3E2EA 1HHQA 3FMWA 4IG0A 2R7UA 3PEHA 2HHUA 4ZCIA 2YKOA 2MMYA 3SSQA 1HFEL 4PAAA 2RKIB 2VC0A 5J2MB 2VOOA 3M8PA 5JVHQ 3CDUA 5HL7Q 1QM9A 2CZVC 2XI2A 5ETKA 4NWBA 3DGPA 3HFVA 1N4LA 3T3FA 1JK9B 1YRUA 5KT6A 1YG0A 2IJNA 4DSJA 3CJQA 1ZM3A 3CMES 3CMAS 2XY5A 4JI0J 1HR0J 3NAIA 4DSIA 3UDVA 2ZD1B 4UF4A 5T41A 4DR7F 1VQYA 4M5DA 3KKFA 1RU1A 1SUQA 2W7PA 1FJGF 4KH0B 2OPSB 4USUA 2DIUA 5EN1A 1OSDA 2RDJA 1U1KA 2YKNA 4CH0S 2Z8QA 3EZUA 3MTKA 3BSOA 3DRPA 4B08A 3CO9A 2CADA 3QLHB 4Z37A 5KFLA 1Q4RA 3PHTA 4B02A 3AA8A 1AROP 1IBKF 1DQ9A 1M5VC 3VALA 4K7QA 4X66F 1HNWF 3K5OA 4EGLA 4K4VA 3KXDA 4UT4A 1NEEA 4ANDA 1W7WA 4M5LA 4QWCA 2E7XA 4ETZA 1HI1A 4AT1B 1WOSA 3OUYB 5HBMA 4O44A 1LK5A 2IM2A 3LUYA 2KRRA 2L08A 3NCPA 2HHXA 3R7NB 3MCNA 1NSQA 4I4BA 3JS9A 2CG4A 2CRLA 4ZP9A 1SV5A 3GP9A 4N41A 1ZZNA 1JWWA 2L9WA 2CWXA 4JI4J 4V19J 2DR9A 2GVZA 1FVSA 3I5CA 3HHLB 1WEXA 2BDPA 1RDRA 1DY3A 2IC3B 5K9FA 2UU9J 4F3QA 4NEZA 2HG4A 4B9SA 2HHTA 5IT4A 4TU8A 1SQGA 4ZP6A 1JX4A 4OFZA 3W60A 4B9LA 1WTBA 2IY5B 1H38A 1K0TA 5SUHA 3KWMA 1F0XA 4KSEB 4ECWA 2QV6A 4Q45A 1CJUA 4F4ZA 4DV5F 4ZN3A 2HZAA 4GO5X 2HAIA 3OJSA 1X0FA 1FXRA 5A6WA 1YX2A 4EEYA 1IKVA 1N54B 1O6XA 3MECA 2MQPA 3GCXP 4DV0J 3JQMA 1C1BA 4CLUA 2JEGA 5KFOA 2GHWA 1CULB 5I3PA 1RJJA 3LTOA 3AQOA 4DSKA 2RF2B 4PXBA 2RDDA 1LFPA 3LGHA 1HHTP 5K8PA 3BKFA 1QD1A 2ROGA 3CO0P 4FS2A 1UJ5A 2QFIA 4DL6A 3U1MA 1HA1A 2MEWA 5F3ZA 3GIKA 2CJKA 1RTIB 2MZSA 3ZZPA 3GIMA 4BHQA 1IKXB 2RRNA 2HHPA 2DNNA 3DGVA 5HATA 3OTEA 1RB0A 4B3TF 5A76A 5ETVA 3SQOP 1VRTA 4YP3A 2HMIA 3CNQP 5HJYA 3H5UA 5G0RB 2GHVC 1RAOA 2OEKA 4LFCF 2YNFB 4RBTA 5C2CA 3LO3A 2HW3A 3MAAB 3RJMB 4DX8H 5K20B 2CG8A 3ZTQA 3THTA 1SJQA 4RUAA 1ACMB 3PACA 2O01C 4ERDA 4YN3B 1VQ4S 3DLJA 5CXTA 1NK6A 2KHDA 3BQ0A 4CLTA 1TV6B 1TTHB 3QFWA 3T9NA 2ZKTA 1X4GA 4CO0A 2A2CA 3NGTA 3IWXA 2JLFA 2VBYA 3CJSA 4U6PA 4OI6A 2AV5A 1PAUB 1RWVB 4A8SA 1FRMA 2F1FA 4PRFA 1FK9B 2KKHA 2OSRA 1P6TA 5KFFA 1QTNB 2X1FA 2F8MA 4NLSA 1U6BA 3FZ2A 4DR5J 3OHBA 4ZLJA 3MEDA 1VLYA 4DL0C 4DR3F 3M8SA 2ZM6F 3HJFA 3CD0A 5HVGA 3EGNA 3PFEA 1U48A 1G7CB 4A8QA 3P3DA 4USHA 2RU9A 1RTHA 2DXDA 3P4UB 4N47A 2HAFA 3HM9A 3BN4A 2M52A 1VBXA 2JX2A 5KFDA 1P9QC 3MMBB 3QWPA 3QNWB 4N5SA 2QN6B 2NUUG 2KJVA 2W2OP 4H4MA 4X64J 3I5AA 4Q0BB 2DPJA 1NLKL 3TP2A 5BYRA 3CMQA 2HWIA 5EWFA 3HD2A 3BO3A 3RRHA 1KTQA 3EDRB 2V0NA 2AWZA 4NLRA 2KB2A 3O2IA 4CYUA 5KFHA 2HHHF 3L95X 3NG8A 2MGZA 4DR2F 1HNVA 1U6ZA 4Q2MA 5KT7A 1WTFA 1SB6A 3ZTPA 4JI1J 3NGDA 2KVQE 1CC7A 3AXMA 1FFWB 3VV2B 3OSNA 2OD6A 2W2NP 4A8XA 1JLEB 1U1MA 5C24A 2HS0A 2GC8A 3BYRA 1HNIB 4MKYA 3QATA 3HD1A 4KFBA 1SC4B 4X62J 1BXNA 1F1BB 2P9GA 3VVTA 5KFCA 1CJVA 2FVPA 5THWA 4DV7J 3IG1A 3T6JA 1U1NA 2HHQA 4UOGA 3VF0B 4QQBA 2M2BA 2LEAA 1R0CB 3N6LA 2VKZG 4RX6A 4WFBQ 1RT7B 1X4FA 1UVMA 2OPRB 4HDGA 1L3TA 1TMMA 2PC6A 5G4DA 5K8MA 3LWMA 4MYUA 3VR1A 4P9SA 5HMXA 3QSYB 4CI0B 2B9YA 1MLAA 2YX4A 4JV0A 3I32A 2G1HA 3DLEB 4EK2A 4EBDA 3OQ2A 2Z58B 3X3UA 4L3NA 1SH2A 4CLZA 3V81A 2HKEA 2KFNA 4FXWA 3I4PA 3HULA 1D09B 3L9ZA 4C8YA 3MCMA 1NSAA 2YQ1A 2KZMA 3KUEA 2FZKB 2W9CA 4JB8B 1KVKA 3OVBA 2JC1A 3OFEA 2UXCF 1TKTA 3PW2A 1NHUA 1NPRA 4DPOA 3KLVA 4LF9F 1FEHA 3EYZA 3OL9A 1XR6A 2HIQA 1OWXA 4LF5F 4CQ1A 5KG6A 4JOUA 2BBEA 1S9GA 4KAIA 4ZCKA 2DGQA 1U47A 2CNOB 1S1TB 3EMTA 4QCLA 2GZOA 3FQLA 2MKKA 2ACMA 1IJFB 3AJ2A 3EGVA 1CBKA 2B5JA 4EZ9A 3R6LB 1TVRA 1RZMA 1RXOB 3CCES 4BC7A 2JL9A 4RW7A 1WKJA 3MM7A 1VK3A 4FYXB 5IT0A 1XNQF 5IQ6A 4LMZA 3DI6B 2B0GA 4HL9A 1JIHA 1GK8A 2PIIA 2P9CA 2MB0B 2Y0BB 4UUXA 3CJ0A 4M94A 1DQ8A 3DLGB 4H4OA 5HANA 3BDPA 4QIGA 1RT5B 5E3PA 2EBGA 3JSRA 4HVZA 1JJ2R 1U6FA 5LJ3Y 2OO4A 3N5FA 2ZDPA 2ZUAA 4Y00A 3CF5Q 2R7XA 2DH9A 2K1RB 3HSJA 5HVFA 4NOHA 3K5LA 3QRPA 1YHQS 1REVB 1RWXB 1MN7A 2BMBA 1RTDA 2V9KA 4DWIA 1S6QB 2E7WA 1U25A 3RBEA 3CJ4A 4TY8A 4CTAB 4IQXA 3D3BJ 2PFFB 1VK8A 1FA0A 1F2GA 3RR8A 2XWYA 5HROB 2HFSA 4YHHJ 1WELA 1WC3A 4WTYA 2YKPA 3QYYA 1PKUA 4J9OA 1RBOB 2RKIA 4WZMA 4NLVA 2BQRA 2FY1A 2EFGA 3MM5A 1T9UA 3TAMB 3PR4A 2L3MA 4O3SA 3V6HA 4FN5A 1GTEA 3ZTOA 3C6TB 1I94F 3GG1A 1YK9A 1S1UB 2BE9B 2R42A 1H74A 3BM7A 4NXMJ 2QLBB 2HNYB 5B09A 1VRQC 4DQQA 2H5JB 3I6PA 1JLBB 2FHJA 4QR0A 5CCLA 4P72A 3KTQA 1VQMS 1IM6A 3KHHA 1T9TA 3TUPA 2DRDA 2W2PP 3CULA 4L75A 2AHOB 2DTJA 4HTIA 4FYVB 5A8RB 3I55S 4JYAF 1AA1B 1X9MA 1Y5LB 1O5JA 3UD4P 3NOGA 1NJIT 4F02A 3CW2C 1FRIA 2WB1D 4RNMA 1H2TZ 1Q5VA 4OX7A 2ROPA 3OPKA 2DVIA 1FE0A 2NSCA 1C4CA 1KS2A 3D6MB 3IWNC 4NCGA 3OUYA 4RW6B 5GAGI 4IG3A 4CCHA 1PYOB 3DLBA 4NI2B 3ADAC 2G0JA 4C7QA 1PBAA 2YNIB 2FJXA 4OJGA 1ZH5A 1DTQA 4WKRA 2MYFA 2CVEA 2HGLA 3ULHA 3J7YI 2HQGA 2CPHA 3T41A 1KNZA 4XPCA 1QAYA 1RCXB 2MLYA 2JZ5A 2P8IA 2ADCA 1U8WA 1F5AA 2CAJA 1HD0A 1U09A 1SQEA 2XMTA 3BGLA 2F40A 1RT1B 4PG4A 2ZH1A 3I96A 1Y7PA 1HQUA 4YUDA 2V94A 2G2ZA 1T9VA 3VAMA 1XMQF 1UVLA 5L38A 3GCWP 1VLOA 4DEZA 1YSJA 3SCKE 4B9NA 1HWLA 3W5ZA 1DZ5A 3Q83A 5KFAA 2E5IA 4IFYA 2IDLA 4WFZA 3C8YA 2CPXA 4LF6F 2C3UA 2APOA 3ZZYA 4WCEQ 4H54A 4ICLA 3MPDA 3GJQB 1M0SA 3FBFA 4XIUA
chains in the Genus database with same CATH topology
1S1WB 4PG5A 4DJBA 3DU6A 3JAMY 1YJWS 4I67A 3FMBA 3K8VA 5KFUA 3O44A 1LW2A 3VAFA 4FBTA 4IR9A 4K0KF 4RW7B 4C8LA 5L9NA 3MM7B 2XY6A 2MDAA 2KI2A 2BJDA 4LT6A 4DG1B 5B7WA 1B0VA 1U2FA 4EU0A 4IRDA 2ZOMA 2H5EA 3M8RA 5J1EB 3TAPA 3S8SA 2B6AB 2DISA 1RT4A 3AQPA 1VBYA 5CYMB 3TA2A 2LCWA 4YHHF 3KLHB 3PO4A 2KVIA 3V4MA 1X8DA 3OFHA 1UMJA 2W4CA 2VBXA 4N8OA 4C8OA 2R7OA 3D0GE 3F73A 4CT8A 5LJ5Y 1IKWB 4H4OB 2J0SD 2ROEA 4C2MA 3J80Y 2ASJA 4B17A 4WKYA 1Q81T 3HK2A 1Q82T 3CJ3A 1S9EB 2QA4S 2FB0A 5HMZA 2VPZB 2X1GA 5KT5A 3OHAA 4AL7A 2AQ4A 3P49B 4FYDA 3Q2TC 3LQVA 1O8BA 1NU4A 2R8HA 4BDPA 1NK7A 4EWTA 4J9MA 3NGKA 3ICLA 3H5YA 2RH3A 1TFYA 3HF5A 3CCVS 5GAHI 4DL5A 4HH0A 1HW8A 3SDEA 5KT4A 3TOQA 1S0OA 3I0RB 2IAJB 4KJIA 1YI2S 5BR8F 3U27A 2O1PA 5M2UA 3KHGA 4WXOA 3HX9A 3GFHA 4DSEA 3HZEA 5C42A 2HYIB 1FE4A 3B4DA 1KN6A 5E3QA 2CPFA 3LW5C 3D1QA 3MM9B 3VZHA 2KFZA 4DLEA 4X84A 4F67A 4ED2A 4RNFA 1S9FA 2XZWA 2MJNA 2IM1A 3RR7A 2JSXA 4MTPA 3BJYA 3L7PA 1RTDB 2QSFA 3MGJA 1FDAA 4NXMF 3WX4A 5L1KA 3ZZOA 2QMXA 2RMLA 3AB2B 5E7OB 2VUGA 2VFUA 4Q43A 2EFPA 2YNFA 3R5DA 2KT5A 3UR3C 3VAHA 3DRYA 4TY8B 3T6BA 2I9SA 4Q44A 3SI8A 3W2WA 1FD2A 1S1VB 2FVCA 3LALA 4DN9A 5DDOC 2OMOA 3KJVB 1TAUA 4TQRA 3CTRA 3G6VA 3G86A 5B0CA 5AJ3F 2M8DB 1LWEA 2Z2LA 4A8FA 5BJRA 2I1RA 2IVYA 4U67Q 4B3SF 4ECSA 2ILYA 1T3OA 1S49A 2VOPA 2FIUA 2C42A 1XN9A 2GMLA 2RQMA 2R8GA 1QVFR 3DOLB 1QVGR 4I2PA 2FJWA 1E6YB 3MEKA 3M32B 2QLXA 2XGQA 5A0YA 1IXKA 2Q66A 1OPIA 2PMZD 4NA2A 4WU3A 4A48A 4DFKA 2LECA 1BQMB 3CDBA 2HNDB 5CD4H 1R8AA 3KNAA 1MROA 4C3KA 5HLFA 3HFKA 3DC2A 1KR4A 5T7LA 1C0UB 1KONA 4ZVFA 3I31A 1N5QA 1U1RA 5H1SV 3DRXA 3TANA 2ZUGA 2GMJA 5AE1A 2LU1A 5KG2A 3C6UB 3FQKA 5DRKA 1NNDA 3O5TB 3HVWA 2XSFA 4JI7F 4TN2A 3TVKA 3DCAA 3CIMA 2VG5A 4EFAC 4J9SA 1E6VA 2IFXA 5KFIA 1R0AB 3MM5B 1M90T 4F8RA 4F26A 5IM0A 2RB7A 4M1KA 5KFKA 4Y6IA 4J9RA 1RWUA 2CQDA 2HPUA 3IR7B 4J9KA 3PJWA 3MPWA 4YOEA 3LAKA 4NCAA 5KFVA 4OX8A 2KT3A 4XO0A 3NMRA 3IRXA 1X5TA 2D7SA 3CDEA 3OW2R 3C3LA 4K4ZA 2DHGA 2D3ZA 3DLHA 4FZVA 2EFVA 2FDNA 2VODA 3K2YA 4HEA9 1UWBB 5I3UB 4I0WA 3E01B 3M1VA 4CH1A 1OS5A 2BYCA 1K1QA 4OIXA 4RW9A 4URSA 2YNHB 3MMAB 4LFAF 2LYVA 2BM1A 1K73T 4O3QA 2PI4A 2PSZA 2WOMA 2OJ3A 1GAOA 1HWKA 2BZ2A 2DCLA 3SFGA 3MOZA 5A2QY 4Y0FA 2DGSA 3Q8SB 2YQ3A 1WEZA 2CQ2A 2D74B 1M5OC 1DURA 4A8YA 4RWXA 1T7PA 4YDXA 3MPYA 3UW1A 1FERA 4WFNQ 1SKSA 2VG7A 2YKMB 4IO9Q 2XSJB 2VH7A 2Q1LA 2HS3A 1NK8A 1SH3A 1NK9A 2MKSA 4QU6A 2VBWA 2AGQA 2J7UA 5JUMA 3W2VA 4FXDA 2AYEA 4ZVHA 3BZQA 2DNGA 3KK1B 2DBBA 2C28A 4C0OC 3UD3P 5EHHA 3CJKB 3DYAA 2D3UA 4MMOA 2CQ4A 1YRXA 1FNOA 1KC8T 3QGPA 2HS4A 2XMWA 3EGWB 5CYQA 3JSMB 5F8JA 2EC0A 3OR2A 3DRSB 5B0DA 1YIJS 3MDFA 5D4NA 5GVQA 1U1PA 4F3OA 3M05A 1S6PA 4O3OA 5F8HA 5KOWA 5KFXA 1M0SA 3EXYA 4IDKA 5GMKa 4I7FA 1XMOF 4IOAQ 2N7YA 3BGRB 4OI1A 1VQ9S 2UVVA 1VBZA 2C3OA 4I6YA 2ZBCA 1KEKA 4MK8A 3DNCA 3EZ5A 1VQLS 2LKZA 1LWCA 3RB4A 5CHCB 5KFWA 4C97A 3FZBA 2CKWA 4KHPF 2OPPB 1QAIA 3J7A1 2ZBIA 2BA9A 3MAHA 2JLGA 4DOZA 4XPEA 3OL7A 3I82A 1JLFB 1RTJA 2XULA 2ZZNA 1EETA 3H8YA 4NCGB 3EX7B 4NL5A 4X4SA 4FS1A 1Q1KA 1YBAA 5LL6d 1ZAWA 4IG3B 2Y1IA 4ID5A 2WBMA 4YDDB 3MM6A 4DQRA 4ILRA 3SMZA 1YJTA 3OFFA 3ZZZA 1MNEA 5B0GA 4OQJA 5KFSA 1QE1B 4F25A 3KG0A 3VAIA 1M5KC 3RRKA 2F4VF 2YWEA 4GC6A 4DSLA 1V3RA 1HYSA 3IRWP 2DNQA 4HH1A 3DHWC 4QR2A 5DG8A 4ZHRB 2ATLA 5CQGA 1DTQB 5DGAA 4AXJA 2ZFHA 4IFVB 1XEZA 3D5MA 3A1YG 3CCMS 4FF1A 5ITHA 2UZAA 1AFJA 1SH0A 4TU7A 5AE3A 2I5JA 1H2VZ 2UV8G 2R7WA 3ISZA 2BOPA 1O0PA 4RWWA 2FC9A 1HARA 2XMKA 1UFWA 3TA1A 1RT3A 3UI3A 2DITA 1K8AT 1RGVA 1FRJA 4ZDNA 3B8HA 3IS9A 3ENQA 2R7TA 4WE1B 4DV6F 4K50A 1QSYA 1BQNA 4NA1A 4YQWA 1JLQB 5LMNF 1L3VA 2FVRA 2PEHA 2RILA 3V4IB 1R89A 3ENWA 3K7RA 3JTOA 1SJ1A 2YX7A 2LQJA 2UUCF 3UPFA 3NNAA 3IGNA 1XR7A 2BRLA 2XLJA 1P8GA 3UDLA 5EGYA 5KAKA 1S7HA 2DHXA 1WF0A 3MM8B 3M9MB 2AF6A 2Z0GA 4N56A 3MEEB 4I64A 4O3PA 1X4DA 3CC4S 1URNA 3CD6S 1N32F 5GAGU 1R6YA 2OTLS 2RQKA 1N88A 1HQUB 3GR0A 3ITHB 3HT3A 5C5JA 2DNPA 2VV5A 3RYLA 2G4BA 4NCBA 2HWTA 3NRBA 4GKKF 4LSLA 4IOCQ 3BGFA 3FJ2A 3C46A 5F0WA 2MKCA 4U9RA 3CGIA 1HPZB 5CYJA 4K2XA 2CQGA 4Y2KA 3N6NA 5DDPC 4Q8FA 3B82A 4Q2LA 2B43A 2DR7A 4EBCA 2IBOA 1U49A 3QGIA 3KYLA 2JEJA 2QLWA 1JB0C 1JLCA 3W7BA 2LVWA 2V4RA 5J2MA 2GIQA 3ISNC 4TNOA 3RTVA 2BQ3A 2LXIA 4DV4F 4ZCMA 3J7YU 1SIWB 1D8YA 4C8ZA 4BWJA 1NZAA 2B4OA 1DARA 3G6YA 5LXYA 2CPDA 4DV2F 2JJ4D 5FJ4A 2M9KA 2JEFA 2BABA 4K59A 2WONA 3TA0A 4IFYB 2VFTA 3DM2B 2BE2A 1VQ7S 2G0CA 1U7LA 3OVSA 4TXSA 3D0IE 2J8AA 5B0EA 2EFOA 2E5LF 3M2UB 2AGOA 4NLQA 3KOAA 2XB2D 1T3NA 3D1OA 4ICLB 3VWSA 1SJ4P 2ZH2A 3PHEA 2E5HA 3MR5A 1N36F 1WD6A 5A6PA 3OXFA 2NQPA 1A9NB 2WW8A 4K4TA 4QIFA 4CO4A 2KXFA 5IS2A 4PQAA 4DL4A 1UVKA 1R3NA 4KB7A 1XK8A 3LH2S 1PGZA 3D28A 4ZK7M 1Y9OA 4LFBF 1FNMA 2ZD1A 4N77A 1LW2B 2E1CA 4KQZA 2DRAA 2LDYA 5C25A 1M1KT 2VQFF 3VQTA 1VS3A 2FHJD 4NA3A 2JDJA 1ZZFA 2XI3A 3MEGA 2XG8A 4DS5A 1UEUA 3T5JA 3SCIE 4OHYA 4ED0A 2YX1A 3CJ2A 1KQSR 1RT4B 1YGYA 2FJDB 1U4BA 2UV8A 4HI2A 4AFFA 5KG3A 3BS9A 2OPSA 4MIAA 2JHEA 1RISA 1VOMA 4HKQA 2DNOA 1A7GE 1V9OA 3PFOA 3V6KA 1T05A 4OZJA 5EX3A 2JFDA 3X1LB 2OPQA 3NP5A 4DL3A 1RK8A 1QTMA 2D41A 4MIBA 2R4FA 2GO9A 4QWBA 3P96A 4CH7A 4DSFA 2KM8C 3N9UC 2JRSA 3QLHA 3EPIA 1JJHA 3PV8A 4K4YA 2WHOA 4K4SA 4OHVA 2F3JA 3H59A 3KLIA 1SJRA 5EWGA 3SDEB 2Y0SD 4B9TA 2G1DA 6FD1A 2RQ4A 1NH8A 2J5AA 3TI0A 1S1TA 5L8RC 1C4AA 3LPYA 4Q5VA 1FXDA 2IRUA 2V5HG 5L1LA 4MIWA 3NL0A 3G8QA 5C42B 2AX0A 4DHVA 5DG9A 4CO2A 3CCZA 4I6AA 2GW8A 4KFBB 5M2RA 3KK2A 1X4HA 2JC0A 3R5BA 1KLNA 4YMEA 1KTVA 2BW2A 1TQLA 2XCAA 2DPIA 2R7SA 4N8NA 3SV3A 2D9OA 5L1IA 2LA6A 4JI0F 4I6WA 1NK0A 4OX6A 1X4AA 4QIWD 5D78A 1HR0F 4Z2XA 4ECTA 1HBNA 3I9ZA 1NJYA 2ZZMA 3RW6A 3KFWX 4X2BA 4YR3A 4H4KA 1ZETA 2CQIA 4DR4F 2OKQA 4B3RF 5J2QA 2XWXA 3G6ES 2RRBA 4BBYA 1PO6A 2KHCA 3GMGA 4ZMMA 3GWCA 3GIIA 2ZHBA 2N7CA 3Q22A 3W2WB 1MU2A 1RT2A 4OI2A 4Y3CA 2ZHOA 1TZ0A 4HYKA 2F9DA 1SC6A 4MK7A 2XC9A 1HNZF 3SEOA 2UXBF 2DNLA 1LWEB 3NAHA 1DLOA 3TNVA 4Y34A 3Q23A 3LP0A 5K5MA 3JYTA 2ZH7A 4JI3F 5IZHA 1M5PC 3NKYA 4JI5F 4GMKA 3H2VE 2KU7A 2MKIA 1WEYA 1NRKA 2JVRA 2R9LA 3TO8A 2BVZA 5A0YB 1XC9A 3HHKA 3HO1A 5B0BA 3C2PA 2GIRA 3LGMA 5GAHU 1U26A 5KFPA 4LUBA 3DOKA 1MROB 3NCRA 4ED1A 4DFJA 1BY9A 5T7LB 1J5EF 1HBMA 2R7QA 3HHLD 3THPA 2M5YA 3LP2A 1WI6A 1Y3KA 2W4DA 5EWEA 4A8MP 3HHLA 5KFZA 3RB6A 1MW7A 4ES1A 3HXMA 3UCGA 3S6EA 5KG1A 1C1CA 2I38A 4D3GA 4K5RA 2IC3A 4JV5F 1XERA 2VG5B 3CUNA 1E6VB 3FEYB 3JB9k 4ECQA 3SCLE 5IM0B 3MUMP 1X5OA 3U1LA 3PIPQ 1MMNA 3FVYA 2XLIA 3POTA 3CCJS 3RB3A 2FVSA 4PG8A 2JH3A 2XLKA 2ZITA 3MPVA 2JFKA 3IRXB 4YFUA 4B3OA 2EK1A 2IMOA 3T1HF 4MJKA 2KN4A 2V4QA 5DDRC 1UETA 3QJPA 3M8QA 4DUZF 1QY7A 2QEXS 4MKBA 1DAXA 4XDCA 3M1VB 2BR0A 1L5UA 1J5OA 1FO1A 2HGMA 3SXLA 5FD1A 4RW9B 4DDFA 4EYIB 3HHDA 4ZPVR 4K4UA 2XY7A 4OLPA 3L7OA 3PO5A 4IR1A 2DGXA 2PGCA 2WOMB 3MMCA 4UQTA 4ES2A 4P7TA 1FTCA 2KRBA 1VRUA 4AQYF 2YNGA 3JSBA 2BANA 3HKWA 1HWUA 4OI3A 1KD1T 3N6MA 2ADBA 1Z2LA 2IYGA 1UVNA 1Q7YT 2O5DA 5KTQA 3OLBA 2DGUA 3Q0AA 2WSFC 4ED6A 1Q8IA 1HWJA 3WBZA 2YWGA 1IR0A 3GV7B 4AL6A 2D3OR 2VG7B 2GHPA 5KFNA 1HD1A 2N4DA 3RAQA 3U02A 1IQTA 2VPWB 4LIWA 7FDRA 4QWAA 2L41A 2DGWA