2FIUA

Crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
MAKGYWIAQVDVRDSERYKDYVSTAKPAFERFGANFLARGGSVTELEGTARARNVVIEFPSVQHAIDCYNSPEYQAAAKIRQEVADAEMMIVEGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title Crystal Structure of the Conserved Hypothetical Protein Atu0297 from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
total genus 30
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07045 DUF1330 Domain of unknown function (DUF1330)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2fiuA00
1N5TA 1RJJA 2RSQA 1U7LA 2W4DA 5T7LB 4DN9A 2KT3A 1FD8A 3BDEA 5B0FA 1AFIA 2FB0A 1FEEA 1Q4RA 2AP6A 2AW0A 2OKQA 1P6TA 2ROEA 4HH0A 5B09A 2N4CA 4EFAC 2QYCA 3KG0A 2FTRA 1OQ3A 2W4CA 3FMBA 5T7LA 5A6PA 1TUVA 1KQKA 5A6WA 1TR0A 2GCFA 1SI9A 2OD4A 3BB5A 4Q2MA 1JK9B 5B0CA 2LQBA 2LQ9A 2VV5A 1YRXA 2XMWA 3UDCA 1XBWA 1CC8A 2OFHX 2XMUA 2G9OA 5B0GA 3KG1A 2PD1A 2RMLA 4DL0C 2K7KA 3IWLA 2EW9A 1YG0A 3HFKA 2OFGX 2BBEA 3F44A 2PGCA 1QUPA 1N5QA 3TRGA 4Y2KA 2K1RB 1Q53A 1S6UA 4Q2LA 2GGPB 4A4JA 3HDSA 1GXUA 2OP5A 5KAKA 2ZDPA 3TNVA 2VH7A 2Q3PA 1AFJA 1URRA 2HLTA 2FIUA 1FESA 4FNHA 1Y3JA 4OJ3A 1Y3KA 2CRLA 2OAUA 2IYGA 3QGPA 1SQEA 2ROPA 1P8GA 1KVJA 2ASYA 1FE4A 1CPZA 3HHLC 2AJ0A 3CJKB 5B0BA 4Y2MA 2OD6A 2W4PA 1FE0A 1W2IA 3MZIA 1GXTA 2IYIA 2IFXA 4DPOA 4Y2IA 3CJKA 4OJHA 2BJDA 5F0WA 3VTIA 2XMMA 1IUJA 1FVQA 2QIFA 3HHLB 1FVSA 1AW0A 2HLUA 4YEAA 4NPOA 1ULRA 3BF4A 2K2PA 3MCSA 2BYCA 2QLXA 1X7VA 1Q8LA 2GFFA 1Y9OA 1R6YA 1MWYA 2K1RA 2ACYA 2ROGA 4ZOSA 1OQ6A 2GGPA 1LQ9A 3HHLA 4ZA1A 2L3MA 1CC7A 2LDIA 2GO8A 3KNGA 1VQYA 4HH1A 2QLWA 2HIQA 2XMVA 5IXUA 2RU9A 2XMKA 4NL5A 3FRYA 1YJRA 5B0DA 1APSA 1OPZA 4A46A 1SB6A 2FHMA 3BGUA 1X8DA 3T9NA 2OMOA 4HI1A 1X0PA 4A48A 2N4DA 1TL5A 3KKFA 2GV1A 2ZDOA 1JWWA 2N7YA 4OJGA 5B0EA 2BJEA 2KT2A 3BN7A 3DCAA 1MWZA 1V3ZA 3LGNA 4OIXA 3HHLD 3HX9A 3IWXA 3BM7A 1YJTA 3K7RA 1KVIA 2GA7A 5B08A 3BR8A 1YJUA 2AJ1A 3I9ZA 1K0VA 4HL9A 2XMTA 1VQSA 4OJ1A 3WDOA 1TL4A 3FGVA 2XMJA 1S6OA 1YJVA 4HI2A 2KKHA 2BUNA 1Y0HA 3DXSX 2KYZA 3LO3A 1TZ0A 4U9RA 3HF5A 1OSDA 1Q8BA 3LGMA 4QOTA 5F0UA 5B0AA 1N5SA 4A47A 3QMQA 4YDXA 2HFOA 4FNIA 5K9FA 1WD6A 2HQIA 3TOQA 3E8OA 2K7JA 2HFNA 3GZ7A 2RILA 4F67A 2JDJA 1N5VA 2LXFA
chains in the Genus database with same CATH superfamily
4AE5A 4UW2A 5J2NB 2Z2YB 2DXDA 3M2RA 2IHR1 4RW4B 3KJQB 3HM9A 5AXLA 5BXIA 4J90A 4M5MA 1C1BB 5KT6A 3IWLA 4B9TA 3VAFA 2CPFA 1T9TA 3T1HJ 4O0NA 1HBUA 2DY1A 4ZDNA 3AD9C 4DX6A 2VF3A 2NSBA 2E9RX 2RF2A 2Q79A 3OFEA 1CPZA 4C8ZA 1H98A 1NBEB 3I0SB 3SDEA 3QYYA 3AA9A 1S9FA 4CLPA 1IBKF 3W64A 4GKKF 5HQMA 2HBRB 3M2UB 2MZ1A 2UV8G 4X4RA 5J2MB 4NL5A 2BDPA 4ZVEA 2GMJA 3KHLA 2BJEA 3DGVA 4MK7A 1V5IB 2UUCJ 3MMJA 4C8NA 1N0VC 3UWTA 4ZVFA 3PO5A 3NGRA 3HO1A 1DQAA 1RWPB 3M9MB 2V69A 2GNKA 1OYEA 4FXVA 2DVIA 1OMSA 2VV5A 4PXDA 5KFVA 1TMJA 3BH7B 3KLFA 2FPHX 2VG7B 1SKSA 1DTTA 3MAAA 3FNNA 3SZ2A 4JUZA 1HR0F 3OL8A 2GVDB 2QLBB 1Q95G 2CQ4A 1S1XB 3EVOA 3OL9A 3PNIA 1TV6B 4ZPWR 2ZBPA 3U27A 4C3MA 1VLYA 2J7KA 2JEFA 4TLQA 5RUBA 4EU0A 3NCPA 2UUBJ 1N5YA 5D3GB 2D9OA 3VAMA 4IOAQ 1RB0A 5HQ8A 4OIXA 5U47A 3CMQA 3QJPA 4DV7F 2XI2A 2MQLA 3G2XA 4DV0J 2F3JA 3FGVA 3O6QA 1RT7B 1C0UB 3L7PA 2BJ3A 5F0UA 2A18A 2RQMA 1MN7A 3BSAA 4C0HA 1FD8A 4NCGB 1TL7A 2XHCA 1ZAVA 4BWMA 3CDWA 4DUTA 2DJWA 1QE1A 2AX0A 3SV4A 2K1RB 4PXCA 4ECZA 1NPPA 4DL7A 2ZJQQ 1GH8A 4PG8A 2B43A 3E01B 3BN4A 4RUCA 3T1AA 4JYAJ 3FSYA 4AFFA 3D28A 2VBYA 3NOGA 3AT1B 5K14A 3NLCA 4ZITA 1ULRA 2HNYA 4MIWA 2QN6B 4DL5A 2FYXA 2Z2MA 5KFPA 3M8PB 2AHOB 3GJTB 3TUJC 3UCGA 1X4GA 4L3KA 4DV1F 4MT1A 2R3VA 4WBFA 3CJ2A 3PJ9A 3T41A 1V3RA 2IMWP 1S12A 1QD1A 3HSDA 3UD4P 4PUOB 1FKAF 3HZGA 2X3DA 3CIZA 3V4IA 1FRHA 2VJVA 1HFEL 3GLJA 5F9LA 3CE8A 3FUYA 1IKVA 4ES3A 2QA4G 4WP8A 4OYBA 1VBKA 4UT4A 3VAIA 4ZVPB 1JLFB 4F2SA 1CS4B 2IRUA 5ETPA 4RW6B 1FRIA 3ZC4A 4PRFA 1NLKL 4W4MA 1S1WA 3PJWA 4LSLA 4X66F 3C46A 2NR0A 4NA2A 4ED4A 2EFQA 4K4TA 3FCHA 2VG5A 2B9YA 2BJDA 3V81B 2CQHA 3DLEB 5KFRA 1J2VA 4YR2A 3HFZB 4YS2A 3MEGA 4RX6A 2MYFA 3DCAA 2HAFA 4DV3J 4QWEA 3ILLA 4JV5J 2HVZA 4ID5B 1G3OA 4MKBA 2VQEF 2NZCA 2VBXA 4LF6J 1JJHA 2CPEA 3T5JA 1WOPA 4KO0B 3KG0A 4XO0A 5CQGA 3KJVA 3HK2A 2L9NA 2UXDJ 2ZBQA 2RMLA 1U0HA 4I2QB 3D6MB 1Q53A 1S72S 4DV4F 3GFYA 4WKRA 4OX8A 1RTJA 2CJ9A 4IFVB 1PAEX 4QW8A 3E51A 1NB7A 4ILMA 4TLRA 4P7VA 1S0OA 4DL2A 2WOMB 2AJQA 2QRRA 1F3VA 1GTEA 4NLSA 2IYIA 4H4MA 5DGBA 3G71S 4GRSA 4DMZA 1HQEB 3WQPA 4YN3B 3C14A 2VPWB 3B4DA 1VFJA 2FGOA 4NXMJ 4B3OB 1BQNB 1S0NA 1QSSA 3CO0P 3IO1A 4R8UB 3WC0A 3KTQA 3GFXA 4IQXA 5EN1A 5LSLA 2RAQA 4FBTA 4WYWA 4X64F 1E6YB 3ZZYA 3IN5A 2XO7A 4OI4A 4IFYB 2C2ZB 1D9DA 4GKJF 3OR2A 3QMQA 1S1TA 4X4UA 4TY8B 4JV1A 1TMMA 2EKYA 1D8ZA 5DO2A 2YNHA 3JSMB 2KZMA 2QLFB 2QYCA 7FD1A 3DI6A 2XS2A 2BKNA 3WZ0A 1RLCL 1RTZA 2DISA 3KG1A 5IT0A 1T11A 1FXRA 3DMJA 1SJQA 3TZXA 1QDUB 2WW8A 3NAIA 5D4OA 2UUWA 5KG0A 4L76A 2JEIA 1FE4A 2B56A 1S59A 3H98A 2DNNA 1YX2A 4DV5J 3F73A 2XY7A 1EKSA 1W7WA 1RHQB 5BYQA 2PFDA 3LPYA 4C8MA 3CNQP 3LOUA 1NZ8A 2ZVSA 2WCXA 3VAGA 3LWMA 1L3SA 1XMOJ 2RJZA 1KLMB 3Q86A 2R7QA 1KR4A 3BO3A 2XEXA 1QTNB 2DIVA 2B9XA 3IP0A 1UWBA 5L39A 5AE1A 1B4SA 3CD5A 2BM1A 4ETZA 1YBAA 3CCUS 1N5VA 2HAIA 4F4XA 1T05A 5KFJA 3DLLQ 5I3UB 2H1YA 4K8RA 1U1OA 5I42B 2XYGB 4WXWA 5A0YB 4QCLA 2G2OA 5EHHA 1GXUA 4ILRA 1U6ZA 1FRMA 3K5MA 2AU0A 4M8LA 4ED2A 4BCAA 3FQLA 1HQUB 3HD2A 2VPYB 5L46A 1ZAWA 2M70A 3VZIA 4WCEQ 4USUA 1Y4ZB 8AT1B 4JI3J 2CDRB 3M7VA 1W25A 1WC4A 5FD1A 4O3SA 1P9QC 2NXNA 2M7SA 4DR4J 1XNRJ 3BGUA 2J6TA 1WEZA 5J2MA 2BKPA 4ATNA 1B70B 2DHXA 4P73A 5K8MA 1KVIA 3A8IA 4LMZA 2IRYA 3SCLE 3GV8B 3Q24A 3D3CJ 5M2RA 2JC1A 3D54A 3QGGA 2KG1A 5LMNJ 1L3TA 3PIPQ 2RNEA 4DS5A 2WSFC 3QSIA 4KGMA 3CMES 2C2KB 2A1BA 2B4VA 2X1FA 1FTRA 1ZZNA 4DQPA 5AJ3F 1HNVA 3TVZA 3GG1A 1Q16B 3MPDA 2E5JA 1GX5A 1WELA 1VRTB 2DNMA 4A4JA 2OP5A 1MU2B 1B0VA 2D3OR 2HLTA 2VG7A 4CI0B 4DV2F 4NASA 2ZOGA 2E1AA 1KVJA 3C16B 4MIAA 2UVRA 1FEHA 2ZWOA 2I9SA 3FDSA 2BJ1A 3UE2A 3FBEA 2K3KA 4IRCA 3H5XA 2F7VA 4DUYF 2HNDA 3WHIA 4LF9J 3QIDA 2VB6A 4IG3B 3TX0A 1FRLA 5D3GA 2EPIA 3TX8A 1KN6A 4F36A 3R5AA 4ZVOB 1RT1A 1RT7A 1C0UA 1UW9A 1HA1A 3DLJA 2AIRB 4J9SA 1Q4RA 1HNXJ 4H4KA 3CDAA 2LQ9A 1S1UB 3SFGA 4CQ1A 3AY0A 3G8SA 3KLIB 1S6UA 1U8WA 2J0XA 3OVBA 4QYRA 5KFNA 3H5SA 3WX4A 4ED3A 4PAAA 3DXBA 3E01A 3A8EA 1I94J 3NBPB 1VYAA 2OH2A 2V5HG 2LEPA 3NP5A 4HYKA 5KFEA 3DN9A 4ANEA 2C22A 2ROGA 4WFNQ 1CC7A 2AYGA 2YKMB 4F25A 2E29A 3BO4A 1M1HA 4K0KJ 1FA0A 1H0HB 3D4JA 2DY9A 2XBPA 4UF4A 2VC1A 3CJSA 3FMWA 1SV5A 3M8YA 2Y1RI 5CD4H 4NLRA 2ATLA 4PUOA 3LP0B 2Z58B 1NSPA 2JLGA 4OYPA 2BQRA 2Z0GA 5IT9U 1PIEA 1PGZA 4CIOA 1J5EJ 2HEKA 1J5OB 4NLTA 3L4BC 3PW5A 2OMLA 2MKCA 5D4LA 3FCWA 1N56A 4JI4J 4WPAA 3HHEA 1JLFA 1CS4A 5HANA 1VMBA 3OTDA 4RW6A 1EAYC 2YWWA 4OZ0A 4F4WA 3KHHA 3G87A 4TNOA 3G9CA 3W2VB 5HMXA 2CYYA 5H1SV 4FBUA 1ZM4A 2F40A 3D6TB 4YEAA 4WJBA 2K2PA 1H2TZ 1N32F 1F9FA 2HS4A 2FGCA 3DLEA 5FDLB 3K17A 2DGUA 2SXLA 1YJRA 3TP2A 4FF2A 1TL5A 2QV6A 1WI8A 2ZNZA 1DZ5A 3JSBA 3AB2B 4BBYA 2NLWA 4YHHF 3I0RB 1HBOB 4H4KC 1DQ8A 4CZCA 9ATCB 1WG4A 4N8OA 1RHMB 3CF5Q 1N5TA 4ZS6A 4ID5A 3A1YG 1RSCA 5CAAA 4LFAJ 1FTCA 2N4CA 2CJBA 5ETRA 3MR2A 4JI2F 4M1KA 1NKEA 1B0TA 4KO0A 1AZSA 1UEVA 2AYBA 1IBKJ 2BZ2A 3M6XA 3PM9A 2IAJA 4OYOA 2R7UA 4EYIB 4X2BA 2HGLA 1H3DA 2OAUA 5A2QY 4FVCA 1XEZA 2DNLA 4GC6A 4DV6J 5KFFA 3JYTB 1DFDA 2LCWA 4C3LA 2VASA 4EI2A 4NMLA 2YXLA 4QYZK 4CM0A 4Y6IA 1U1LA 5H9FJ 1UP1A 2WOMA 5F0WA 3HHLB 4F50A 1AW0A 2CPIA 1NZAA 1IR0A 3L7UA 4B3RJ 2E5IA 2COLA 5KOXA 2J76E 4PG4A 1FJEB 3OTEA 1TKXB 5K8NA 4B3OA 2CQ0A 3HVWA 1BQNA 2GO9A 4Z37A 3TARA 2CZ9A 4R8UA 4LF1A 3SQOP 4NLDA 1E6YA 2BVZA 2RRBA 2KL8A 3OL6A 4IFYA 5B7WA 1K9MT 1UJ6A 3ZZRA 2MLZA 4JI8J 4KH0B 1U47A 3NY0A 3R8YA 4DG1B 1RT5B 2IJRA 1NB2A 2KXFA 2XMAA 4YB6A 3MPYA 3Q8VA 2KM8B 2MSTA 1JNZB 3HFKA 1NKCA 3TNVA 3MEDB 2QTWA 4Q0BB 5B0BA 2GAGC 1DURA 1SKUB 4UUXA 2PI5A 5L38A 1ZH5A 5FLXU 2BA9A 3G82B 1D09B 3QWUA 1RTDB 2M3DA 1D9FA 3Q8SB 3HT3A 1N0UA 1EP4B 2AJ1A 5L9NA 1KLMA 2RDDA 4UOCA 4HACB 3M9NB 3R1HA 3OPKA 3OT9A 5E2QA 3N9UC 2EG2A 1OSDA 3RZAA 2JFKA 2EFOA 5A8KB 3FSXA 4X62J 5THWA 2FB0A 3OR1A 4I2PB 3EMTA 3OW2R 2A3JA 2V94A 3BQ1A 2BE2A 2WVFA 4DU7A 4TYAA 1RTHA 1RKJA 4DL0C 1DTQB 5HLFB 2HQGA 2UXCF 1U8SA 1CJTB 5A0YA 2GHPA 2D7SA 3AXKA 2IM0A 1YVFA 5T14A 1M5PC 1RT4B 3P5TL 1JLCA 1UL3A 4N41A 3QGPA 3UI3A 1CEZA 2B5JA 1NJWA 2XQCA 2Y1LB 1LWFB 1JLGB 1HQUA 1VIOA 2HQ3A 3HFVA 2BYCA 2V0NA 4B9UA 2V8PA 1TVRB 3T9NA 1X0FA 3ZTSA 3WC2A 5F8IA 3MMAB 3B4MA 1VQPS 3MCNA 3NAHA 5AXMA 4HI2A 5HJYA 2KRRA 4NZ6A 4YDXA 1U48A 3AHPA 1RWWB 2W4DA 4OHYA 2OKQA 5HL7Q 3HHDA 1KQKA 4K59A 1RHRB 1M5HA 1NK8A 3JQKA 2V2VA 1WUUA 4PWDB 4F3MA 2FDNA 1UEKA 3MMCB 3Q83A 1T9XA 1N5QA 2FC8A 2GVZA 5HP1B 3C3LA 3PFOA 3NXZA 1FESA 4F3OA 4M5IA 5KFZA 2YX4A 5D0RA 4BC7A 2QG9B 3W5XA 5CH7B 1HWIA 4UOFA 1XMQJ 3T19A 3K59A 2DRDA 3C16A 2OPSB 4IQMA 3FBBA 2VQEJ 4F0HA 2ACYA 2NXJA 1YK9A 1PCAA 4ZVTB 4QPXA 5KT3A 4F4AA 2XMVA 2DNPA 3GPAA 2NCKL 2HVEA 3LGNA 3HX9A 2UVWA 4CLSA 2HNZA 4LT6A 2MPUA 1NK4A 4ER8A 3DDNA 3M30B 3MM6B 2DRAA 2KTQA 2CIMA 1BQXA 4IH7A 4XDDA 3MCMA 2W1BA 2HFOA 1VK3A 2CDQA 1NDLA 2DHAA 2JRSA 1F60B 4IKAA 4DF4A 2DRBA 1SI9A 2OD4A 3GQCA 2C3UA 1S0VA 2HW3A 1AB8A 1FRXA 3MMBA 1XTZA 4P2MA 1NNDA 1S1UA 1XERA 1ZOTA 3MM9B 1A0OB 1K8AT 2ZEJA 1U24A 4C98A 3KLIA 3DRPB 4ZPBA 1JJ4A 1VBXA 4LSNA 2AJFE 3I56S 2HFSA 3IR5B 1B7FA 5ADZA 1O0PA 3SSSA 4JV2A 1IBMF 4N77A 3A8JA 1FVQA 1FVSA 1CQNA 1XMBA 1Q8KA 1T03A 3NBPA 2OSQA 3ONQA 4O3PA 3VR1A 2ZZNA 2C42A 2IMOA 2FC9A 4DWIA 3QAUA 1WF1A 4TXSA 3A3PB 4JI6J 4WFZA 2IM2A 4K2JA 4M63A 3KLHB 4KRWA 2M8DB 2V6AA 1RHUB 2QFJA 1CG2A 3TUIC 2KZZA 1CLFA 3NWRA 3HPOA 1RTIB 3LP0A 2XLIA 3AQOA 5KFTA 1J5OA 2LA4A 3U1LA 4J9KA 4NX9A 4A8WA 2QO3A 2V4JA 4MFBA 4WYLA 2VDHA 1JNRB 2W4PA 5EX0A 4CLWA 3OTCA 5SZTA 4OYXA 3ET6B 1CJVB 2F4VF 4F2RA 3CWJA 4U96A 2C2OB 3I31A 4FYWB 3KKFA 4DBQA 5B0EA 5CA5A 1ICEB 1WOSA 3HJVA 3W60A 1RYSA 4DL3A 4TU9A 1OJ4A 3GV5B 3JQJA 1F0XA 3BBFA 3JSRA 3TOQA 1HBOA 4PYDA 3FBFA 1H7XA 2RSQA 1AFIA 3RAQA 3A3OB 1F5CA 2DGTA 1RADB 5B09A 3Q23A 3CC7S 4EFAC 1HPZB 2K06A 4C9DA 5KFCA 4KYZA 1TUGB 1DJ0A 1K1QA 1WTBA 3GG0A 2CA9A 3CJ8A 2OFGX 2BMBA 3FZ2A 3G6ES 5DQIA 1KS2A 1VQOS 3W3SA 2C2RA 3ETOA 4B3TJ 3QGHA 4FXDA 2OPRB 3KYLA 3G8TA 1T9VA 4IO1A 2GMHA 1UFKA 4DQIA 3M1VA 4URSA 3R2CJ 3HJFA 3JYTA 2RHQB 3BKUA 2ASDA 1UEUA 4AXIA 2GW8A 4I68A 2ILYA 3HHLA 3PY8A 3TZWA 2NZ4A 1JJ2R 4PXBA 3N6LA 3ILOA 2ZDOA 5J1PA 4M5NA 1TKXA 2XMTA 3ZZPA 4I6AA 2X1AA 2AEFA 3HF5A 2OSRA 1F2HA 3I5BA 3QFWA 2FLOA 4IDKB 3EX7B 2VUGA 2GHWA 5CCMA 2RDJA 1NJIT 4KKOB 2AP6A 4ZJQA 4TKTA 1T95A 4PXEA 1VQ9S 1T7PA 4DG1A 2ZHBA 2XLKA 1UZHA 2BM0A 3IC1A 2ZC3A 3RGIA 4DUYJ 1RAIB 2JH3A 3AOBA 1A9NB 2ZH9A 4NRTA 3OTBA 1RKIA 5I3QA 4KHPJ 1PBAA 3MUVP 3MEDA 1WHYA 2I8EA 4QQBA 1N36F 4F4KA 2H48B 2HBQB 2FJBB 2CQ2A 3KHRA 2D74B 4NRUA 4IO9Q 2PDAA 1YZ7A 2HFZA 1KBRA 3LGHA 3PRVA 4ZK7M 2CVIA 1VQ5S 3B54A 4DXLA 1S79A 3QZ8A 3D6HB 1RTDA 1SC3B 3RBDA 2JVOA 5CZXA 4DR5F 5KFAA 4L72B 1EP4A 3NGKA 3H40A 1NUEA 3LTOA 4HACA 2HQIA 3DU5A 4ELUA 4KR0B 2ILZA 2ABYA 2CPYA 3GFZA 3VCDA 3S7RA 4W90B 2VG6B 3BYPA 3ZO7A 2ZKUA 1UPMB 3ICLA 4LR7A 2WBMA 2V4RA 4CO4A 1DTQA 5HLFA 2BXJA 2QSWA 1KRPA 4DZ6A 2XY6A 2MB0B 5DDPC 3DGPA 4B9LA 3HHLC 5BR8J 2K3IA 2IC3A 2YH1A 1TTHB 3QIPB 3MZIA 4JI7J 3R6LB 3ULHA 1JLGA 5JVGQ 5J2QB 1EB0A 3VGTA 2GO8A 3MCOA 3KNGA 3BKFA 4CH7A 4QYZJ 2DCLA 3JTOA 1KTVA 2XHWA 1HHQA 5KFGA 1OS5A 2E1MC 4MKVA 3MMAA 4MIBA 2H9ZA 2D3O1 2FUG9 3O2IA 1F2GA 2OO4A 2O1PA 3E8OA 2MZJA 2E1CA 2V63A 2YX1A 3I55S 1JX4A 1RAAB 2BQ3A 2KM8C 2H5EA 5D77A 2AF6A 3GWCA 5C25B 1VQ6S 1LW0A 3QZ7A 4DFKA 4LREA 1FWKA 3CCTA 4ZLPA 1N32J 2DNOA 3G8QA 4RW7A 3KUGA 1UA1A 2CJAA 4ECWA 5HP1A 4KGKA 3JAMY 3LANA 2Y9HA 3SV3A 1CULB 4YHHJ 3HI9A 2CQDA 4LJMA 2U1AA 3MM7B 5KTQA 4MMOA 2E44A 1ZTTA 4V19J 1FXDA 2FD2A 2EFGA 3C15B 1ZTWA 3TZYA 3TA1A 1RABB 3EXYA 3TVKA 3NCQA 2HGMA 3GYNA 4OHWA 4O3NA 1F5AA 2I38A 3EGWB 4Q8FA 1P9YA 4DZDA 4DU8A 2MZTA 4C8YA 1WG1A 5EWFA 3PW0A 1XNQF 1ZZFA 1Q1KA 5K9FA 2RUSA 2MQMA 1GMUA 1K47A 2JDJA 3O44A 4IRKA 1HD1A 2BRLA 2P5VA 3R5GA 1RWMB 1RAEB 3KG4A 5H9EJ 4H4OB 2KJWA 5A6WA 1LKZA 1SPBP 1YRXA 2ZZMA 2MQ8A 4NZ0A 3UDVA 4ZPDA 4C97A 2J5AA 3MM9A 1U1RA 1JIHA 2BJ7A 2CJQA 3KMQA 3CJTA 3DRPA 4LFBJ 3BKTA 4ZP7A 2UUAF 3FKBA 4I6WA 1GMWD 2VBZA 5M2PA 3RB3A 2F4FA 4U7UK 3BPSP 1DBDA 4ZVHA 2VOOA 3AQPA 2M4MA 2DD8S 1LOUA 3AFGA 1MWYA 1FI4A 3MTJA 1QAXA 2GIRA 5LL6d 4F3QA 4IUFA 1OPZA 4XDCA 4JI1F 3JQMA 2APOA 3M2RB 3SBMA 1M0SA 3TEGA 2NYIA 2QT7A 3CJ0A 3CCWA 4LF5J 4X65J 1N54B 1UVKA 2BUNA 2AJ2A 5GAHU 4KH1B 3THTA 4AUKA 4MAKA 1HBUB 1VBZA 1MROB 3QATA 4LBIA 4HTIA 3OSNA 3KLHA 2RF2B 4J91A 5AE2A 2ROEA 2R8KA 4DR3F 2FJXA 2DNKA 3K0JA 2KJVA 3WIUA 4UZBA 2Y0SD 3GYXB 2GQQA 2PA8D 2HQCA 2CQPA 4QJVA 4X4OA 2CZ4A 2BBEA 4QWCA 4M5HA 3FBCA 2AD9A 3H59A 3DLHA 4QR1A 1M1GA 3EJMA 4RKUC 2IPOB 2JC0A 1KC8T 1REGX 2B0GA 3HD1A 4MK8A 1NSKL 2LU2A 1CJKA 4M95A 4Y2IA 1WOOA 4FS1A 3PZPA 2HQFA 2KXHA 2YQ1A 4KPCA 1PJ6A 2LDIA 2OUGA 2QLWA 2WHOA 4I64A 2RRAA 2Y1IA 1R7IA 4HHHA 5KFLA 3BM7A 4CT9A 3PFEA 4M5GA 2XYHB 3ELHA 4C0BA 4LFCJ 2UXCJ 1IKWB 2B4PA 3KLFB 1D3WA 1UFLA 1UKUA 5DQGA 2FZCB 4CLLA 4PQUB 1VQMS 1I6JA 4L74A 3FFIA 2E1RA 3K5LA 2ASLA 3CGIA 3GP9A 4L73A 2V50A 4USMA 1RAJA 3OHAA 1CJUB 2G0IA 2ZH2A 2LKZA 4ELTA 5KG5A 5C42B 1N5YB 3FJ2A 4OJ3A 7FDRA 5LSRA 2J0SD 3M4XA 4E0DA 4ED8A 1VBYA 1S5ZA 1E6VB 1OPIA 3DC2A 4YR3A 2Y8WA 1C0TA 3MR5A 2YWKA 4ENOA 4HH1A 4OFZA 2OHDA 1KEKA 4U7UD 3B6BA 3V4MA 2Y3YA 3IAS9 1C4CA 2YWFA 3BS9A 3J7YI 3BPDA 2MKJA 5DLFA 2LLZA 5E3CA 2OIHA 2P8IA 4CLFA 3MOZA 4C2MA 2V9WA 2LVWA 3PX6A 3DDIA 3H5UA 4OHZA 4UQTA 1HNZF 3EZUA 3M6WA 2CJKA 2UZAA 4F02A 4DN9A 1U7LA 4RU2A 4ETXA 3PKYA 3L09A 3NS5A 4IDKA 3R2DJ 2G0CA 3PJXA 1OQ3A 4KKOA 1S6QB 2GQ2A 4USJC 3ZTPA 4HDGA 4ZVSB 4J9RA 5K14B 5LM7E 3KDNA 2FVQA 3VQTA 4Z7CA 3MFIA 1YJWS 3T5HA 5E3RA 1URRA 2RT3A 4Z2XA 5K20B 3RBZA 4EZ9A 3HLUA 5LXRA 2X51A 2N3OA 3TANA 3MUMP 3AOCA 2IJNA 3ETMA 4TQSA 1XJWB 3CXCR 5KG2A 1S1VA 1NHVA 1JLQB 2KHCA 2M2BA 1HW8A 3V4IB 4CO3A 3LAMA 3H0PA 3Q8UA 4NYZA 4ALZA 1EHWA 1GAOA 5IQ6A 3D2WA 4C8KA 4NEYA 2R8IA 4YMEA 3Q8QB 4OX9F 4DN0A 3PVXA 3DXSX 1YWXA 4PPZA 4A47A 1REVB 4ZVQB 3TA2A 4USVA 2BOAA 4LSLB 3CJ4A 3MR7A 1RBAA 1WDDA 4NLVA 2EEYA 2YQ0A 4NYPA 4DJBA 3X1LB 3EGNA 1U6FA 2DNRA 3ENAA 2X7IA 3W66A 2HBYB 5HO4A 4NZ7A 5D0HA 3BSNA 3MEGB 2DB1A 5ETOA 1Y00A 3UNGC 2DTJA 2CUYA 3B8HA 4DEZA 4A8FA 3QRPA 2FY1A 3SEOA 2H65B 2QE5A 3P6YC 3H90A 3NGDA 3A8KA 2QFIA 2BW2A 1QVGR 3P5BP 4J7CA 2E1PA 5C5JA 3BGFA 3OTOF 4P6QA 3HMJG 2A6OA 2W2QP 2NREA 3R6GB 1IBCB 4NMXA 4FYXB 1U0HB 2NS1B 1IKXB 2J9CA 1Q8BA 2EI5A 3M8QB 1IR2A 2DGSA 3W61A 2HRYA 2XO6A 4CNZA 2RD5C 5FJ4A 2CQGA 1XR6A 2IVFB 2E9ZA 4OX7A 4H4MB 1EX8A 5KT2A 5B0GA 2Q1LA 4OYZA 3K2YA 2A0FB 5C25A 2UV8A 3LA0A 4HDHA 1ZBTA 1FD2A 3M8SA 1HHSA 3CULA 2R42A 1MG7A 4I69A 3V5RA 3H4DA 1EQ0A 4YB7A 1XR7A 1RDRA 1NU4A 4DCPB 5HMZA 2VA2A 1RWXB 5DRKA 2WB4A 3OR2B 2QLXA 3QQCD 2YNHB 3C15A 3IAM9 1R8BA 3DI6B 1WI6A 4QIFA 1O51A 4N8NA 2LQ5A 2EVZA 1KNZA 4FPIA 2F8MA 5A8RA 2DHHA 2QL7B 1GQEA 1B0PA 1R0CB 4DOZA 2CG4A 2VQFJ 2ZBIA 1TKTB 2ZH1A 2EKNA 2MDAA 4GMKA 4URGA 3AA8A 4H4OA 5KFXA 1OSCA 1JXLA 1R8HA 3RU0A 2XNQA 1IJFB 4ED1A 1HMVB 3GSDA 1KD1T 1AFJA 3NOCA 3GIRA 3RRKA 1P8GA 1MW7A 1W2IA 3GU0A 1FKOB 4O3RA 1UWBB 3NCRA 3VGSA 2MZQA 2MQOA 1NK0A 2B51A 2GMLA 2VFVA 3EVMA 3T1YJ 4K7QA 3JSYA 4AL5A 1X5OA 2A2CA 3F41A 4DSEA 3NL0A 4LRBA 4DHVA 1N52B 4K4SA 2QA4S 5IV3A 5GMEA 4WE1B 1PO6A 5G0RB 4PG6A 4U9RA 2LFVA 1N33J 1O8BA 1WSVA 2ZNYA 2MGZB 2DK2A 2ZZTA 1VC6A 2EFNA 3DYAA 1MROA 4HEA9 4QWAA 1LWXA 4NXNF 1N36J 3LWLA 4U7CA 4Q2MA 4PQAA 5KT5A 1Y5LB 3C6TB 4HTJA 1HI8A 4DUZJ 1WTFA 4JP8A 1R8CA 3M8WA 3R7SB 3GFHA 1NJXA 3AH6A 2VODA 4V19X 1CBKA 2KU7A 4OHXA 5AXKA 3CJ3A 2AGQA 4RBVA 3MF5A 4TU7A 2YPZA 4ZN3A 2HVIA 4LF8F 1IBLJ 4Q7AA 1PYOB 3PDNA 1TAUA 4M5LA 2LEBA 3H25A 1WF0A 1HW9A 5A76A 5F41A 3C66A 1VCTA 5E41A 2MMYA 4OJGA 1GK8A 2XLJA 1WSRA 2H4YB 4H54A 4ZJLA 1DAXA 1HNVB 2YVSA 3JS9A 4X4NA 1L5UA 2PIIA 4KT0C 3LO3A 3T1HF 3LGMA 2CAJA 1IKWA 4UOHA 4RW8B 1RJJA 3I4HX 4PQUA 2BR0A 3D67A 2VZ9A 3D0IE 3EUNA 3SSRA 3TJAA 1UJ4A 2NSCA 4MTPA 2ZWPA 1HQ2A 3QSYB 1UA0A 2IRXA 2W9BB 1H72C 2MZSA 1CJUA 2HNDB 1H6KX 2QX0A 6FD1A 1UPPA 5HATA 2DH9A 3CCMS 5C42A 5DLGA 2NQPA 3MEKA 5KOWA 3VWSA 4P75A 1VLOA 3CDUA 1RT1B 1SVDA 2FHJD 1S10A 4OI1A 4QR0A 4DL6A 1VRUB 1E6VA 3OFGA 1CSJA 3DHXA 1NHKL 1LNQA 2N82B 5IFMA 2LQJA 1MWZA 4LF4J 1XQIA 5HVGA 2HK2A 4M5KA 5IOLA 4FPRA 3W8PA 3GR0A 5ETSA 2CQIA 2IDEA 2JLFA 4RNMA 2RS2A 4LF7F 3R27A 3TQEA 3NNHA 2G0JA 4KJIA 1FRKA 5DG9A 5H9FK 2C3PA 3SMZA 4Q8EA 4DR1F 2V68A 1WG5A 3VVTA 3SYZA 1S6QA 4U67Q 3MM5B 2IVYA 3NNCA 5E7OB 4MKYA 2YWHA 4WK3A 2FJDB 4JB8B 4N47A 3UPFA 2VL1A 5GAEU 5EWEA 5F3ZA 1KTQA 1Y3JA 2UUBF 3Q8RB 5DZ6A 2HZAA 3UDLA 3P3DA 1ROFA 4RW9B 3KLVA 1SV5B 3PR4A 2IM3A 4I4BA 3J7AN 3BBCA 1JLQA 1Z2LA 1Q5VA 2WRMA 2YKNB 4OLOA 3MPUB 2VPZB 2F5GA 4YB5A 3MURP 2D3ZA 2C1EB 1YSJA 1RBLA 1WKJA 1NPRA 2B6AB 2GJ2A 1S77D 2HVDA 4NLQA 2CNKB 1JKHA 3UR0A 2XS5A 1FFGB 1REVA 3G4SS 4FS2A 2PMHA 1UMJA 4JYAF 2UUAJ 3RAMA 4MK9A 4CLYA 4Q45A 2PEHA 1Q7LB 4ZVUB 2YWEA 3RB4A 1VI7A 3MI7X 2UUTA 2RVJA 4Y28C 3OXLA 5JVHQ 2E7WA 4ECRA 1XR5A 3J7YU 2UVUA 5K5MA 1UFWA 3QT8A 2DGVA 2ERRA 2AJ4A 1BWVA 2ZD1B 3JTNA 3GTYX 4JI0F 2OD6A 2XSJB 3A4TA 2ACMA 2PE8A 3T6BA 3KK3A 1XK8A 1MMLA 4E2FB 4KAIA 2GC8A 4I7FB 5E3PA 1IQZA 3CD6S 1LWCB 2X1BA 3ZTOA 1LXJA 3ADAC 4WTOB 1JWWA 2N7YA 1LFPA 1H73A 4J9QA 1SUQB 3BJYA 3N0VA 3D7SB 1AZSB 4X4VA 1S49A 4TVAB 1UVNA 1MMDA 1U02A 3JTPA 2BANA 2IAJB 2R8JA 3DLBA 1PG5B 1IKXA 1IM6A 1C2PA 2XCPA 3M8QA 5GADI 1LV5A 2HG4A 3EVWA 1RWKB 2RUGA 5ITHA 2YWGA 4DS4A 2EFVA 3OUYB 3AJ2A 1M5SA 2CADA 2LXUA 1FJCA 4WP9A 2EW9A 2VDIA 1LK7A 5KG4A 5LJ3Y 3M6VA 2ZH7A 2M8HA 4NLPA 1Y7PA 5DDRC 2V2KA 3Q22A 1QUVA 5J2PB 2J8SA 3RW7A 3RBXA 3H2VE 1G7CB 4EBDA 3T5KA 4DV3F 3W62A 3H20A 3OFHA 3UN2A 2R8HA 5DS7A 4RL1A 5HQLA 2F8HA 1TFYA 4OX6A 4LF6F 4M5JA 1QSYA 1YBUA 1NK7A 1QM9A 1RAGB 3GSIA 4G65A 4CTAA 2QMXA 1SC4B 2DPIA 2POKA 3LAKA 2DCUB 1TK0A 2R2SA 3WDOA 4ECSA 2KT5A 4U8VA 1TZ0A 1IM4A 3A3NB 2KRBA 3JAMU 5J1EB 3H4BA 4O44B 4URQU 4B3SJ 2EXUA 3FMBA 3IBWA 5A6PA 2ATCB 4CLZA 5F8HA 1TKTA 2L48A 2QMUB 3PG9A 2J0WA 3NG8A 2OEKA 1VQKS 5A8WB 4OZ5A 5EGYA 4PR6A 4USTA 5D78A 3HT0A 4KHRA 4NXMF 1V5VA 1YDLA 4C3KA 3WX8A 2CWXA 4S0MA 2AWZA 1HMVA 1BQMA 1EZZB 1UWAA 1FX2A 3RB0A 1AYEA 4WZMA 2WTFA 1HL6A 3R7BB 2QA1A 5CABA 2EK6A 2KN4A 4DPUA 3UQSA 1FKOA 3NGSA 2QC3A 1RHKB 2VOPA 1UZDA 3OR1B 4FN5A 2BEFA 5ETVA 4J9OA 4YUDA 2Z30B 2DPJA 2G1HA 4DQRA 2BE2B 4CRJA 1RTHB 3PYGA 1Q8IA 3BYRA 2GJFA 3FEYB 1HYSA 3QT6A 1ZPVA 4WE1A 2MQQA 4LRAA 2GAHC 5G0RA 1JLCB 4DQQA 3EE3A 3W9HA 1X5SA 1FK9B 5C7PA 2QYGA 4IH5A 2MGZA 3IBCB 2LU1A 3ILJA 2B5JB 4X84A 4JOUA 4DV5F 4NYOA 1YIJS 1NHUA 1W26A 3W2WB 2RQCA 2YNIA 4CH1A 2V8DA 4DDFA 3C6TA 4Y2KA 3N6NA 3W5ZA 1HNWJ 2UU9F 5GMDA 3HDSA 3N4WA 4V1Ak 4Z7YA 3TA0A 1VR6A 5HROA 2Q43A 2VBWA 4OX9J 3V2UC 2XMMA 4RUBA 3VGVA 1FDDA 2XCAA 4RNFA 2O66A 2LEAA 3CCQS 1WJ9A 4PCQA 2RU9A 2AZ3A 4M94A 3TQ1A 3QJJA 2V8HA 5IT9Y 1KVKA 3G96A 2CPDA 1J27A 1T8EA 5KG1A 3DM2B 1VQSA 1SJRA 2B9EA 4LQ3A 2P9GA 3MD3A 4OI2A 3M9OB 1HD0A 1IXKA 2XM3A 2GVZB 2ADBA 3D1QA 1A6LA 4J37A 1R8AA 5GMKa 1I1GA 3CW2C 2RHSB 5IZHA 4F4YA 3S01A 4RW8A 2VPXB 3O8WA 1KFDA 2XB2D 1U4BA 4OV1A 5BYSA 2Z2LA 1IWGA 1YG0A 4JI3F 2MQNA 2KFZA 5LMUJ 2ZJRQ 4EO6A 3BBBA 2HWTA 2W9BA 1RWOB 4DR4F 1XNRF 1NKBA 2W25A 3UD5A 5D4PA 1IR1A 4ZPVR 4GC7A 2HNZB 1Q82T 4J9UE 2VHGA 3UCUP 4GVBB 3KLGB 1KLNA 5DZ7A 2MY7A 2HLUA 4K4UA 5JUMA 5LMNF 2VFSA 1OQ6A 3GONA 3HVAA 5FIIA 5DDOC 1VRUA 4AYBD 4DL4A 2KDOA 3ZTRA 1IWAA 2G13A 1QLNA 1GX6A 2RKIB 5D0GA 5G4DA 3MMBB 1WACA 5L1LA 1YRTA 1LWEB 2B7BB 5EUHA 3RRGA 3RR7A 3BSCA 2L08A 1S4FA 3LF0A 2DGWA 1NJZA 2ADCA 1Y10A 4ED7A 2MKYA 4HH0A 4LSNB 2IM1A 1NDKA 5IC4B 2HYIB 1LW2A 4FVMA 4QIWD 3PCOB 4ZKAA 2HS0A 3CD0A 1T03B 3KWMA 2D3UA 2W2PP 3MM5A 2Q3PA 5E3QA 3NEKA 4LF9F 3CMAS 1SQGA 3M2VA 2DO0A 3RYLA 3J81Y 1UVLA 4P2SA 4OQJA 1K44A 2E66A 3E3XA 5ETQA 4RW9A 2P2CB 5HAOA 2F1FA 2VONA 2QL9B 2M88A 1V3ZA 4HHUA 3IS9B 2YKNA 2VFRA 1ZM2A 2G2ZA 1F3FA 1Y11A 1K73T 1GMVA 4U6PA 1KP6A 4HT7A 1Y5NB 3KFWX 4ZP8A 2B6AA 2I0XA 4K4YA 2CWKA 2V4JB 3D9BA 2HHUA 4Y00A 3CEDA 4MFBB 1NK5A 3O1LA 4J5OA 5HMWA 4KFBA 2XMWA 4B3MJ 3L95X 2BABA 2O01C 5DM6Q 3BZQA 3F44A 4USKA 2YTCA 3NMAA 3MPWA 5FLXY 3CCJS 4QWBA 1S0MA 3CJ5A 2P9CA 5ETLA 3OVAA 4K0KF 1VQ4S 3P8BB 2CNOB 4ZVGA 5AE3A 2I2YA 1S76D 2C2DA 2YQ3A 4N5SA 2ZD1A 4O3OA 3DRRA 2XSJA 3RBEA 3FZBA 1NSQA 3HVTA 2Y8YA 2D1CA 4NCBA 1FT8A 1SJ3P 2K8GA 1T94A 4I7FA 2HHQA 3J7Z5 1Z2ZA 4WFYA 3THPA 3KJFB 3K58A 3NKYA 1B3TA 1X4HA 1LWCA 3TUPA 1J5EF 2VU5A 2FVPA 1SUQA 3J80U 4YY3F 4GKKJ 2OEMA 4LBHA 2PC6A 4JI4F 2LXFA 5T7LB 4OYWA 4YQWA 1TK5A 1VHFA 3AJ1A 3M1VB 4KV8A 2GCFA 4OHVA 4O23A 3TI0A 3VAHA 1T0TV 5KFOA 4IG0A 3R9LA 9RUBA 3M32B 3OUYA 4HR2A 6AT1B 2O67A 2YKPA 1RQ0A 1RP5A 2MQPA 3T3FA 2UXBF 2OPPA 5D6GA 3DOMB 2DR8A 1BMQB 1U0SA 3QO9A 4KHMA 3G6VA 2CPHA 1EIYB 2N7CA 2JHEA 5J2PA 1BUXA 1YBTA 3TEHB 1SIWB 1UTAA 3GV7B 2BX6A 4WIQA 4ECXA 3EWGA 3QRRA 4AQYF 3DFEA 1HR0J 5B0DA 1MLAA 5F8NA 4LFAF 1X0PA 4DSJA 3BN7A 5F8JA 3PW7A 2WVDA 2OTJS 3SCKE 5IT4A 1AT1B 2KG0A 1RT3A 2FZGB 3TAPA 1YJVA 2XC9A 3SIPB 3OVSA 3R7NB 4NEZA 4OZ2A 5JMNA 3JB9k 4ED6A 2L9WA 1KWMA 5F9NA 4R5PA 2HRTA 2WSCC 2OLWA 3CJQA 5J1EA 4DV6F 3C6UB 4XK8C 2W4CA 2V67A 4O44A 5KFMA 1KHWA 4O3QA 4DV7J 2AZ1A 1HLWA 2J9DE 5JXSA 4USIA 4Y0FA 2K7KA 3LP1A 5KFQA 1PJ7A 2ZH3A 4ZPTR 2CNLB 4ECUA 5A8WA 4B3RF 4XTTA 4BWJA 2XS7A 1GMWA 5KFBA 1YI2S 4N7TA 1R89A 3T5LA 4LIRA 1U1MA 3BGRB 4DSKA 4LF7J 4OJHA 1FDNA 3DLGB 3IWNC 1N8RT 1X7VA 5GADU 5H9EK 3OV7A 2OGUA 4QIGA 2L3MA 5ETNA 2F9DA 4CCHA 2OELA 1NSAA 1U09A 4ED5A 2YNGA 3FRYA 4NLYA 4U8YA 4JI8F 4DR1J 3EICA 1KKHA 3UO0A 1HI0P 3OSPA 2JZ5A 3I9ZA 3GIJA 3LH2S 1N5SA 2FJVA 1D1UA 2AV5A 2YY3A 4Y3CA 1XWLA 3WIVA 4HHJA 3C8YA 2DNQA 2KT3A 1F5BA 3DGPB 2ZHAA 2HWHA 2I5JA 2CG8A 1SH0A 4DV1J 4EZ6A 1FK9A 2IC3B 2RRNA 3R97A 1X31C 1FERA 1X4FA 3W2WA 3DRXA 3L9ZA 4BHQA 5HBMB 4NLUA 4FYVB 3HSGA 2IYGA 3TJ8A 2FHKA 1SIZA 2W7PA 1ZA2B 5KG6A 3EZ5A 3TAQA 1YZ6A 2CNNB 1HKAA 2IDLA 3R5CA 1S9GA 1Y9OA 3HSZA 3DRSA 2R7SA 3K8VA 1TKZB 3VHQA 4X62F 2XG8A 5IV4A 1RT6B 3GIKA 1NEEA 4X66J 2HZCA 5IS2A 1YJUA 5JJBA 1JQGA 1LW0B 3VAJA 2WK4A 4OJ1A 3DOLA 2O3DA 2PO4A 3DM2A 4QOTA 1X4BA 3CVKA 4RW7B 3SSQA 2J6SA 1AUDA 2HBZB 3BV8A 4WU3A 5B0FA 5GAHI 1FKPA 2CQ1A 1SH2A 4JI0J 2FJEB 1SL1A 3ISNC 3OFFA 1SJ4P 1KOHA 4FP9A 1G4CA 2V2QA 2AKWB 2W2NP 2ZUAA 1NRKA 3K5NA 3G6XA 2R7OA 1UW4A 1GT8A 1A7GE 3HXMA 2QEXS 1XN9A 3CCES 2W7OA 4OI0A 2YKAA 3CTRA 5HMYA 1VISA 3CD7A 1U2FA 2A10A 4WFAQ 3TR5A 1KQGB 4GVBA 3KLGA 4N56A 3MCSA 2GHVC 4UOGA 3US5A 4P72A 3HKZD 1DLOB 2W01A 5EX3A 4DV4J 2C3MA 3V6DA 1FFWB 2LDYA 2X1GA 2R2UA 4ECVA 3VAKA 1TUWA 2JJ4D 2IY5B 3GJRB 3A13A 3SXLA 1Y0HA 4EUVA 2RKIA 4CLTA 2Q6CA 1LWEA 1U1PA 1ACMB 5D0EA 1CVJA 2MZRA 1G6BA 3CIMA 2LYVA 4X64J 1XMQF 3SCJE 2G9OA 2KVIA 4GKJJ 4KPYA 4DPTA 4Q2LA 2FLPA 1WHWA 2CJYB 2AGPA 1R8PA 1KSPA 2G4BA 1SBRA 2YNFA 2H3EB 2PFFB 3Q2TC 4CLKA 2H4WB 2H54B 3P45B 2HURA 4A8XA 4WWSA 3BR9A 4FF3A 4BS2A 1N6QB 1Q7YT 1X5PA 2DEIA 5DG7A 5L1KA 1S99A 3QT7A 3IGNA 3ENWA 4OYAA 3I5CA 4WZQA 2DIUA 3IS9A 4K5RA 2HVHA 2WVBA 4ZIWA 1JLAB 3TZZA 2HMIA 3UN5A 3I96A 2BOPA 2RILA 2LA6A 2W2OP 2VFUA 4A8QA 1ZS6A 3AODA 1SKWA 4ITSA 1PC4A 3SFUA 4RWWA 4L6V3 1CJKB 1NDCA 2MLYA 1VQ8S 4ILLA 1FF2A 2PGCA 2MLXA 1QTMA 2V8GA 4KSEB 2DH7A 4G1QB 5C24B 2PA3A 1FCAA 3EPIA 3U1NA 2EFPA 3D68A 4PPDA 4CO2A 3CJKB 1VGYA 1PYTA 3ZZOA 4JI6F 4CP5A 1RZMA 4B02A 1R31A 4USHA 2GGPA 1N48A 3DDKA 3HKWA 3FFIB 4CNYA 5DQHA 4EBEA 1X9MA 3RTVA 4R0EA 5GVQA 1ZA1B 1ZM3A 1SJFA 2CPJA 4LQ9A 3IXQA 2HPUA 2UU9J 3GB0A 2DR9A 2OPQA 3LUYA 1WHVA 3F0NA 3TW0A 1FWLA 3H2LA 1MN9A 2LQ8A 1ITPA 4RU9A 2HSEB 5T7LA 2R4FA 2B4OA 5HI7A 4C11A 1G1XA 3QRQA 3K8WA 5HJXA 1QUPA 5CZVA 5HSPA 1C0TB 4NA1A 1R43A 3IGVA 5KAKA 4XIUA 3M32A 1RLDA 4ICLB 3DOMA 3GCXP 1R0AB 1OY9A 4A8SA 5J2NA 1M5OC 2DH8A 1YJ9S 1L3UA 3C2PA 1GXTA 4RW4A 4LSZB 2AYMA 4DPOA 5AJ3J 1JB0C 4FZVA 3CSKA 1C1BA 1RA7A 2XZTB 1DRZA 3OJSA 1HWUA 3J7ZT 4ERDA 2R8GA 4YB1P 5F8LA 4DV2J 4JV0A 4YDDB 2IIHA 3MM8B 5ETMA 1LEOA 4B08A 3GIIA 2A6MA 2YH0A 3I0SA 1K0VA 2GIFA 3QPIA 2KFYA 3MAQA 4ZP6A 3K89A 1R6VA 4FNIA 3M2UA 1NAQA 4LR9A 1BC6A 2DYAA 4B3TF 3CCZA 5AXNA 1VRQC 4Y2CA 3OD2A 1X9WA 2LXIA 1Q5YA 1TL1B 2MY8A 1MMNA 3C6UA 4G3IA 2XMUA 1RWVB 3LW5C 1S1VB 1UJ5A 4C8LA 2IA0A 2HQDA 2BV3A 3LPEA 1RAFB 2M5YA 1JXEA 1Y3KA 4NLGA 1QSLA 1LK5A 2E5LF 2XI3A 1T9YA 4J9VA 1ZETA 3QFHA 2CJXB 4EEYA 1GEHA 4TQRA 3A12A 3I82A 3MTKA 2BE7D 2E5HA 3UFCX 3BGRA 1SC1B 1VJWA 1BD6A 3K5PA 1SKRA 1P27B 4E8UA 3DLGA 3TUZC 2U2FA 3ZNUA 3K5OA 2GVDA 3ZXWA 1WC5A 3F56A 2R7VA 4UUWA 3IWXA 4K4XA 3PR5B 4JI5F 4I6YA 3HSJA 1S1XA 4K4WA 2ALZA 1S6OA 3MWBA 4J9MA 2BE9B 1TV6A 5IC6B 3NGUA 2V34A 4G1PA 1GXLA 4KHPF 1RISA 3GJSB 3RRHA 1VQLS 4WKYA 5IM0B 1IQTA 4M5DB 1S6PB 3P49B 4LF2A 4AD6A 2HHHF 4QWDA 2QLJB 1JLBB 3UN3A 1WORA 3GJQB 1RAHB 2AQ4A 1SL0A 4FKYA 3CCVS 3LP2B 4NCGA 2OI2A 3RW6A 2HZVA 5HBMA 5CYMB 1X4DA 3EYZA 3KUEA 3KMSA 1U49A 4J9LA 4X4SA 4UQGA 3V6HA 4X4QA 3MUTP 2K1RA 2DO4A 2QL5B 2DNGA 1RCOB 1APSA 2FHMA 5ETKA 5EWGA 1TKZA 2AEMA 2CQBA 4ZCLA 4WFBQ 1PJ5A 4EK2A 5B08A 1RT6A 3W1YC 4QU6A 2KFNA 2GQCA 3RR8A 1TL4A 5I3PA 1T02A 4RUAA 4C7QA 4CYUB 2KO1A 3M8RA 1UVJA 2NPIA 4F67A 3THVA 3D1HA 4BLGA 2HIYA 3M8PA 4NWBA 3QBCA 5C2GA 2AW0A 2XGPA 3Q8YA 1B64A 3H5YA 5BR8F 1TUVA 5T41A 4JI7F 1U25A 3D0GE 1ELOA 2W8KA 1R27B 2M9KA 1OO0B 4EGLA 4G6VB 3PYDA 1URNA 2JEJA 5IWAF 5KFUA 4RNNA 1WC1A 2ZC4A 1QAYA 4JI2J 2FHJA 4QBUA 1S7HA 1XC9A 1FO1A 4YY3J 2EBGA 4ZP9A 2PSZA 2DEJA 1S7IA 1Q78A 4NPOA 1PILA 1U1QA 1N4LA 1R0BG 3TO8A 5A8RB 1RACB 3Q0AA 4ZHRB 2DNZA 1M1KT 4K4VA 1X8DA 1DLOA 1VJQA 2XY5A 2XWYA 4Q43A 1U45A 1BHNA 4LVNP 3CUNA 1OYDA 2NYHA 1WKKA 3R3TA 2DT9A 1TELA 3V81A 2UXBJ 5B0AA 4PEOA 1TP7A 4KQZA 3MR6A 3LALA 1NH7A 3PX0A 3SI8A 1FRJA 3GMGA 1O5JA 3VVUA 4ZMMA 3P96A 2B4UA 1Y5IB 2Y1JA 3EGVA 2QGFB 1HI1A 4C4WA 3ISND 2FY8A 3OJUA 2V8VA 4AQYJ 4PG7A 4WTYA 2XSFA 1X4EA 1YLXA 4LRDA 4ECYA 3ITHB 2DR6A 3KK2B 4QIVA 3QT5A 3V6KA 1JLEB 4EYHB 2NXCA 4C0OC 3OL7A 3LQVA 4I2QA 1M90T 2JVRA 1PC5A 3QWPA 1VOMA 2QZ8A 3DYAB 3MGJA 3B82A 4A46A 5HVHA 4IFVA 2N4DA 4CM2A 2JWNA 3K7RA 1N6QA 4L3NA 1EETB 2HS3A 2BJ8A 2HHVA 1RUSA 1QJHA 3NMRA 4C8OA 1RI7A 2BKOA 1HQEA 2D9PA 2V9KA 3AD7C 2M0GB 4NA3A 1JLAA 3J81U 4ED0A 3MHYA 5E5NA 2DXEA 4LFBF 4Y34A 3HULA 4Y65A 2FZKB 4L75A 4YFUA 1WKLA 1T3NA 2FJAB 3I32A 4KIAA 5L9XA 3IR6B 2GZOA 2J0QD 4O4GB 4DX7A 2MXYA 2W9CB 2C28A 1FNXH 3Q8PB 4DR7F 4TY8A 1RA6A 3JSMA 3OHBA 4TY9A 4G1QA 1SQEA 4DCOB 2XGQA 3C19A 5C24A 5KT7A 1F9EB 1Q81T 5GAEI 3N5BA 3IM8A 2F65A 4LF5F 4X65F 3PW2A 4NI2B 3CJKA 3I9V9 2HRUA 1GNKA 2EBEA 4I56A 4DPYA 1R6YA 3EM1A 4MJKA 4PWWA 4K2XA 3NS6A 3T9ZA 4ECTA 2PEBA 4DR6F 1BGXT 2PMWA 4RR5A 4MH8A 4LRCA 2R7RA 2F9JA 4HL9A 4FYYB 3M8ZA 4UY85 2R7WA 2ZH4A 1Z1ZA 2V2ZA 3N28A 1NMEB 3VGUA 3L3CA 1FXLA 2BRKA 3W5YA 2RDIA 1C4AA 3CC4S 1G2EA 4ZPCA 2HGNA 2CVEA 5K8OA 2B8QA 3KK1B 2DR5A 1MWQA 3EDQB 4HT5A 3BGOP 4D3GA 5HN0A 2CQ3A 1YTYA 1YQHA 2FIUA 3KXDA 3O3LA 2GX8A 2DR7A 1HBNB 3KOAA 4FXWA 5I3UA 2MKSA 4ICLA 4LFCF 5I42A 2V4QA 1R0AA 5MLCV 1T9WA 1L3KA 3BGLA 2G2YA 3RB6A 3O5TB 2RIJA 2DGQA 4HKQA 4OI6A 3U02A 3ZTQA 2XMKA 1OWXA 2HHWA 5A2QU 2L41A 2DHGA 2Q66A 1PKUA 4BC9A 2R2TA 3MM8A 1U2RA 2MHNA 2XMJA 4P10A 2R2RA 2BQUA 3CDEA 3GILA 3DHWC 1SCJB 4B9MA 3FEXB 2CXEA 2RB7A 1WC0A 3L7OA 2EC2A 1BLUA 1HWKA 5L8RC 2PD1A 1TL1A 5BJRA 2DGOA 1NO8A 4FDFA 4DCJB 4FKXA 2ZM6F 1QAJA 3H42A 3DRYA 2W24A 1KHVA 2WSEC 2ROPA 4CO1A 4AL6A 2HFUA 4NCAA 2GJIA 1TL3B 4P74A 3IRWP 2YKOA 3NNAA 2LECA 1VRTA 4ZOSA 1JKHB 1MU2A 1FDBA 3FC9A 4ES1A 4Q44A 2BJ9A 2ASJA 3BR8A 2ZOFA 3OLBA 3U7JA 1KQFB 1IBMJ 1S4EA 2EC0A 3VZHA 2H5JB 5DJBA 5HK4A 3ZZUA 3G6YA 2HKEA 5E3AA 3P4UB 4ZLJA 2JL9A 4DR2F 1EARA 3ZNJ1 4IG3A 1Z4UA 4W92B 3KK3B 2LQBA 1XIQA 5IM0A 4M5DA 1S6PA 2ZH8A 5C2CA 3UVJB 1U26A 2J7WA 2MKKA 1JLBA 1HIYA 5KFWA 1VDHA 3B78A 2XWXA 1FDAA 2ASYA 3PX4A 4MKAA 3LP2A 4B17A 4Y2MA 2P6SA 2HHPA 3DNCA 2JOQA 5CYMA 2Q6BA 2KYXA 2HHXA 5KFSA 2BANB 4X4PA 1Q8LA 4RNHA 4F0MA 2IBKA 3W9JA 2NXUA 2ZVIA 3VALA 5LT5A 1Q0NA 4K5SA 3MDFA 4IOCQ 5ETTA 4TN2A 3RG6A 2MKHA 5BYRA 3IR7B 3AOAA 2MTLA 5CYJA 1QY7A 3TAMB 4KGVB 1HHTP 2F4VJ 1JXVA 2ZUGA 1RGVA 2JLEA 4CYUA 4A8OA 2YKMA 4MYTA 1C1CB 3MXHP 2VD3A 3CCLS 3OBIA 1PSDA 1EQMA 3BDPA 1RE1B 1NK9A 3EZOA 3ZFVA 1N34F 2F8EX 2VKZG 5DM7Q 2B7CB 3VQSA 2UP1A 3EDRB 5CXTA 3HZEA 1H2UX 4LRFA 2VA3A 2KXNB 4CTAB 3ISZA 4LVOP 1TU0B 3IMQJ 2KI2A 3MAHA 3S8SA 2DGXA 4IR1A 3MFHA 2FJWA 2G1DA 3PRBA 4PABA 2DNYA 1SQFA 3UR3C 4ZHRA 4KGXB 3W2VA 4WFXA 4QU7A 2PMZD 3ENVA 4DPWA 4EBCA 4YOEA 4J9PA 1SXLA 1U2CA 3QLHB 1D0EA 4OZNA 3N6MA 1HBMB 5D15A 5FDLA 5KFIA 1YJ7A 5KT4A 1RHJB 3BQ2A 1BQMB 3EPGA 3OQ2A 1K0TA 1SL2A 1YHQS 1KONA 1IVZA 2EG1A 1XBWA 1VQ7S 3I0RA 8RUCA 4OZ1A 3BEGB 1PBUA 2YKQA 4DSFA 3SCIE 2ZOMA 2ZDPA 1FNOA 1JMTA 5EDWA 3POTB 1RT2B 2VICA 2GIQA 2W7AA 3DOKB 3CCSS 1HYSB 3ITHA 5F3TA 2J9DA 5CCLA 4DX8H 3KK2A 3OLAA 2IJFA 1JLEA 1HNIB 4AL7A 3N79A 2CPZA 3RAXA 2VQFF 4DSLA 3PEHA 5K8PA 2GV1A 3GCWP 1FFSB 3AD8C 1O6XA 2OJ3A 3FCVA 4DI6A 1DQ9A 2I1RA 3KHGA 2YNIB 1T3OA 4PG5A 3FSIA 4IYQA 1EETA 2JSXA 3Q2SC 2RQKA 2JEGA 1SJ1A 2DNHA 1M5VC 4GO7X 3H8YA 3GE9A 2AGOA 4ELVA 1HARA 2IVMA 2E5LJ 1KFSA 1MSWD 3M05A 1FJGF 5HROB 5E33A 2WZ1A 4A8YA 3BB5A 1CC8A 1GFWB 3ENQA 1PAUB 3KNAA 1IN0A 4OL8A 4DR5J 4CT8A 2WW4A 3T1YF 1YGYA 1WWHA 4O4GA 2OEJA 2BACA 2W9CA 2UVVA 4JI5J 2H5IB 3SQGB 3K57A 1RT5A 3PACA 4WK1A 4IOBA 4O4RA 3N01A 2D41A 3J7A1 4XPCA 2QIFA 2FLLA 2L9DA 2RU3A 4JBCA 1N33F 3HCXA 2GFFA 3IG1B 4ZCKA 1V9OA 4NI2A 4ZA1A 3GIMA 2HIQA 4D3HA 4K4ZA 5LOQA 5CYQB 4Q0BA 4FF1A 5KG7A 2ZBCA 5GAGI 2HHHJ 4O0IA 4QR2A 4DUZF 3G86A 4KTQA 2HFVA 1S9EB 2XTJP 3UD3P 1BE4A 1H2VZ 3G82A 4HI1A 2W8LA 1H7WA 1IKYB 2ZITA 2FTRA 4QPTA 2LMIA 3RUBL 4ZPAA 5I4MA 4EMDA 2UUCF 1RAOA 1IBLF 3DU6A 4R0JA 1P1LA 1VS3A 3MD1A 4W98A 4NE9C 4DFJA 4WF9Q 1S97A 1SC6A 3KK1A 5A8KA 3AAWB 4F04B 2FVCA 4I2PA 2Z57B 3MEEB 4K50A 2KVQE 5IQQA 1X60A 2AJ0A 3ZZTA 1HBNA 4NLWA 2HK3A 3VTIA 4HLBA 4LBPA 2JFDA 1CJTA 1KOOA 3MECB 2DHSA 1RT4A 4EO8A 4R25A 1LW2B 5HVFA 4KGZB 1RU1A 4QW9A 3R5JB 4UY8T 1LWFA 2C2NA 2KKHA 1YRUA 2KYZA 2WVCA 1OY8A 2RE1A 4PKDB 3W63A 2NUHA 2J6UA 5IWAJ 4Q5VA 4Y2AA 3KUHA 3M2VB 1TVRA 5KFHA 2M52A 1UVIA 2H51B 2KB2A 2VFTA 3DKDA 4OYIA 3CCRS 3NRBA 1RXOB 2AYEA 4DV0F 1MNEA 2C3OA 4RLEA 1XNQJ 4ZCIA 1X4CA 1RBOB 3OXGA 3PKMA 4RZRA 2XYPB 1UETA 2ZH5A 4RWXA 4E98A 1RCXB 4ZIVA 2MJUA 4OZ3A 2CRLA 1RYRA 2LP4A 4LF4F 3PXGa 5L1IA 5DG8A 1TFWA 4PWDA 2E9TA 3MMCA 1HWLA 1TL3A 4UTGA 5SUHA 1VK8A 3KJNB 1FWPA 1RK8A 2Z4PA 5F8MA 2MSSA 3JXOA 1NDPA 4ANDA 3DLKB 1OIAA 4EWTA 4KFBB 1S57A 4OZJA 1TK8A 2MJNA 2FQQB 4CWBA 3IM9A 4OLPA 2OPSA 3H2UB 3KDOA 4GO5X 2HFNA 4WP3A 5DGAA 3BDEA 4DQSA 2AEJA 4JI1J 3UCZP 2DKOB 4TU8A 3KLEB 1JK9B 3AB4B 3CT9A 4PYAA 3UDCA 3M30A 4C48A 2ZKTA 3MM6A 4I1TA 2OFHX 3DRRB 4FF4A 5KFKA 3HVTB 2HHSA 2WONB 2A2DA 3MR3A 4P2FA 1QVFR 4RUHA 3IRXB 4DPXA 3UVJA 1YJNS 3E2EA 2GS8A 3IA0A 1WF2A 1D9AA 4NOHA 1VC0A 2B9WA 4DR3J 2C2EA 3PHEA 1WEYA 3QAEA 2AX1A 2NUUG 4F8RA 2ZE2B 2ZBRA 2HWIA 3CPWR 1TKDA 1DY3A 2IA6A 2RH3A 2JX2A 3HHKA 3PW4A 1LQ9A 4XAKA 2P6TA 3ZZ0A 1B99A 1AROP 4DLGA 1RWNB 2R9LA 1SB6A 2N3LA 1YITS 2C3YA 2KT2A 4KV8B 3R5BA 3J81j 1ZM9A 1RWUA 4IG0B 3EXCX 4DR7J 4OV6A 2OPPB 2K7JA 3GZ7A 3TAMA 1FHTA 3NS7B 3QO9B 5KFDA 3IBFB 1C1CA 5B0CA 1L3VA 4LUBA 4KE5A 3W8GA 4CLUA 2WVEA 4P9SA 5F8GA 3CJRA 1WNEA 4JV5F 4CDIA 3S1TA 5LJ5Y 4DR6J 1WHXA 2R7TA 2MKIA 3BSOA 3SDEB 3U1MA 1U1NA 8ATCB 5L1JA 1Q86T 4OZLA 5KG3A 3VV2B 1RTIA 2Z56B 1RT3B 4F4ZA 2J8AA 4OMFG 2IFXA 2KHDA 1EJ7L 4YR0A 2B3TB 3BF4A 1NJYA 2UXDF 4QIEA 2VC0A 2VIHA 2Y0BB 1X4AA 1F1BB 2QA2A 1I51B 5IXUA 2NXEA 4R5PB 4ZJOA 4A48A 3PRDA 1F9HA 1NXIA 3R5DA 1S48A 3PYEA 3FEZA 2QJ3A 1P1TA 4GVLA 3LP1B 4KY3A 4USWA 2NPFA 2XZWA 3ET6A 3HVRA 1CJVA 3MPVA 4RPFA 6FDRA 2YPYA 2YX7A 3QLHA 1U1KA 1HBMA 1NCLA 3GR1A 1B7YB 2CQCA 2PI4A 4XPEA 3QNWB 3M6UA 2CFXA 1WEXA 1DTTB 3MAAB 3Q89A 3VF0B 4WXOA 1K1SA 1H38A 1HNZJ 1YKWA 2HHTA 3BO2A 1NM2A 3PHTA 2YNGB 4X4TA 4OYMA 4MYUA 4IRDA 1HPZA 3POTA 1I5OB 4U95A 2WBRA 1RT2A 3BQ0A 3I87A 3DOKA 4KBIA 3N5FA 2DBBA 4A8KA 3S6EA 3CC2S 1X5TA 1VQYA 3MOJB 4WIIA 1RU2A 5LSOA 4B3SF 1HNIA 2I5JB 2OPRA 4ZCMA 4WU2A 3I5AA 4P52A 1YJTA 1IJEB 1KQSR 4ZLNA 2C2MB 4TYBA 4RBTA 1QAIA 1N88A 2ZM6J 1AXQA 1BY9A 3D5MA 4PZVA 1TL7B 4ZN1A 1TAQA 1FEEA 5LXYA 1P6TA 2PT0A 2CZVC 4YP3A 1XMOF 4IR9A 1LFWA 4A8MP 1QE1B 1CQMA 2E7XA 1DARA 1S9GB 3PTWA 3DRSB 2XULA 2O5DA 2QMWA 2VH7A 1T9UA 4FNHA 2PN6A 4CO0A 1HWJA 3T6JA 4NLXA 3CO9A 4NLOA 3W7BA 1FE0A 1ZAXA 2HNYB 1X9SA 3DOLB 1JJCB 3SQGA 1U6BA 1IUJA 3TVYA 3NGTA 4DR2J 2MHEA 3IG1A 1FKPB 3H7HB 3ILIA 2BW7A 1V6HA 4C6AA 2GA7A 2ZFHA 2CPXA 5CYQA 2CKWA 3D3BJ 3D6FB 3OXFA 4B9SA 1AA1B 3R1LA 3EGZA 1AUSL 1HNWF 3CDBA 3PEJA 2RQ4A 3NWGA 1H74A 1S9EA 1VIXA 4LIWA 3OTOJ 4P2XA 1IKVB 1TR0A 1IKYA 5AT1B 3TJ9A 2F63A 4RBUA 3W9IA 4RNOA 2Z2ZA 2E5GA 5D8HB 2J9EA 4P7TA 2FVSA 4B9VA 1S1WB 3V6DB 4DF8A 4DFPA 2VG5B 1VHIA 3D66A 2WB1D 4IH6A 2WAQD 3MEEA 2VG6A 5DETA 3J80Y 1FJ7A 2XZDB 1BWEA 1V3SA 2VKRA 4KB7A 2EK1A 2QSFA 3AJDA 1NPKA 1NH8A 1R3NA 2OMOA 3MECA 1SH3A 2IBOA 5J1NA 1N34J 4ZVRB 4DSIA 3QIPA 3I4PA 3GYGA 4ANCA 4FYDA 4N76A 4RJVA 4DX5A 5LMUF 2JNJA 2X3GA 3PIOQ 5J2QA 5KFYA 3FQKA 4G1IA 4P71A 3KJVB 2DXFA 1VQNS 1BXNA 4QZVB 3FRZA 4F7VA 3BREA 1WDTA 2AT1B 4CO5A 2YNFB 4LR8A 2R7XA 5M2UA 2I6WA 1RTJB 3QJLA 1FNMA 4AT1B 3UW1A 4RO0A 3PYFA 1F6TA 2VJUA 1WC6A 5E0OA 3IFEA 5GAGU 4AXJA 4F0KA 3I6PA 1HNXF 3UDEA 2RS8A 2ALYB 3C14B 1Q79A 2XNRA 1I3OB 4J9NA 3CB4A 2HMIB 5CD4A 2YBVA 3TWZA 2MEWA 1DHMA 4ECQA 3UNYA 3FK4A 2ZH6A 3ZZZA 3HHLD 1NK6A 1WC3A 2AMCB 1CULA 4F26A 1PYSB 3MM7A 5DDQC 3DLKA 1S1TB 1I94F 3D0HE 2DITA 1GTHA 2W9AA 3HHNB 1ZPWX 2FVRA 2P9EA 2ZJPQ 2KH9A 2OTLS 1VC5A 3AXMA 4ES2A 3DMJB 4OI3A 2FLNA 5D4NA 3D1OA 1OY6A 7AT1B 3KLEA 4B9NA 3TRGA 4ZLLA 2GGPB 3FVYA 3BH6B 3V6JA 5MAOA 2WONA 4I67A 4ID8A 3TYTA 3IRXA 4NXNJ 2Z8QA 1TQLA 4I0WA 1FX4A 1EKRA 4UZCA 3QGIA 4DLEA 1ZYQA 4HVZA 2OPQB 2EWHA 1M5KC 5CHCB 3HP6A 1KDNA 1UAWA 1UCNA 2ZE2A 2D69A 1FJGJ 1D8YA 2B8PA 2FHOB 2W2MP 4C11B 4B3MF 1W2BR 4LF8J 4DFMA 2ZHOA 3PO4A 2E7VA 4KC5A 3X3UA 3WBZA 3RJMB 4CH0S 1T05B 1WD6A 2J7UA 3PV8A 4BDPA 1UVMA 3W65A 4PWUA 1LXNA
chains in the Genus database with same CATH topology
1H7XA 2M0GB 2RSQA 1JLAA 4NA3A 4UW2A 4AE5A 1AFIA 3RAQA 4ED0A 4O44B 4URQU 1F5CA 2DGTA 3Q23A 3MHYA 5B09A 3CC7S 4EFAC 5E5NA 1HPZB 5J2NB 4LFBF 4Y34A 3FMBA 3IBWA 4Y65A 4C9DA 5A6PA 3M2RA 5F8HA 2IHR1 1TKTA 2L48A 2J0WA 4YFUA 3NG8A 4RW4B 5KFCA 3HM9A 5AXLA 1T3NA 2FJAB 1DJ0A 1K1QA 3I32A 1C1BB 1VQKS 5KT6A 1WTBA 3GG0A 3IWLA 4KIAA 5A8WB 4OZ5A 2OFGX 4B9TA 5L9XA 3VAFA 3FZ2A 3IR6B 2CPFA 3G6ES 2J0QD 4O4GB 1KS2A 5EGYA 5DQIA 4PR6A 1VQOS 1HBUA 5D78A 3W3SA 2MXYA 2C2RA 2W9CB 2C28A 4KHRA 1FNXH 4ZDNA 3Q8PB 3ETOA 4DR7F 4NXMF 3QGHA 4TY8A 2NSBA 1RA6A 4C3KA 2E9RX 4FXDA 2OPRB 2RF2A 2Q79A 3OFEA 3JSMA 3KYLA 2AWZA 3OHBA 1HMVA 1BQMA 4TY9A 3G8TA 4G1QA 1SQEA 3RB0A 2XGQA 1CPZA 4IO1A 1H98A 2GMHA 4DQIA 4C8ZA 4WZMA 3M1VA 3I0SB 4URSA 5C24A 5KT7A 2WTFA 1HL6A 3SDEA 1Q81T 5GAEI 3HJFA 2QA1A 3N5BA 3AA9A 3QYYA 1S9FA 3JYTA 4LF5F 4X65F 2ASDA 3PW2A 3CJKA 2EK6A 1UEUA 3I9V9 4AXIA 1IBKF 2GW8A 2KN4A 4GKKF 2HRUA 1GNKA 3UQSA 2EBEA 4I68A 3M2UB 1FKOA 2UV8G 2MZ1A 4I56A 4X4RA 1R6YA 2ILYA 3HHLA 3PY8A 2VOPA 4MJKA 2NZ4A 1JJ2R 4PXBA 5J2MB 3OR1B 4NL5A 4FN5A 4J9OA 4K2XA 3N6LA 4YUDA 2BDPA 3NS6A 3T9ZA 2ZDOA 4ZVEA 4ECTA 2GMJA 3KHLA 4DR6F 2BJEA 2DPJA 4MK7A 1BGXT 4DQRA 2BE2B 3MMJA 4MH8A 5J1PA 4C8NA 2R7RA 1RTHB 2F9JA 1TKXA 4HL9A 2XMTA 1N0VC 1Q8IA 3ZZPA 4UY85 4I6AA 3FEYB 1HYSA 3UWTA 2X1AA 2R7WA 2ZH4A 4ZVFA 1Z1ZA 1ZPVA 3HF5A 4WE1A 2MQQA 2OSRA 3I5BA 3PO5A 5G0RA 3N28A 2FLOA 4IDKB 3L3CA 3EX7B 1FXLA 2VUGA 2GHWA 5CCMA 3HO1A 2RDJA 1JLCB 4DQQA 1NJIT 1DQAA 1X5SA 4KKOB 1FK9B 2AP6A 4IH5A 2BRKA 2MGZA 2RDIA 3M9MB 4TKTA 1T95A 2GNKA 1C4AA 3CC4S 2LU1A 4FXVA 1G2EA 4ZPCA 4PXEA 2DVIA 1VQ9S 2B5JB 4X84A 4JOUA 2HGNA 4DV5F 4NYOA 1T7PA 2CVEA 2VV5A 5K8OA 4PXDA 1NHUA 1YIJS 5KFVA 4DG1A 3W2WB 2RQCA 2ZHBA 2YNIA 2XLKA 3KK1B 4CH1A 2BM0A 3IC1A 2DR5A 2ZC3A 2V8DA 3KLFA 2FPHX 4DDFA 3C6TA 4HT5A 2VG7B 3N6NA 4Y2KA 1SKSA 2JH3A 2UU9F 1DTTA 1A9NB 3HDSA 2ZH9A 4D3GA 5HN0A 4NRTA 3OTBA 3N4WA 3FNNA 1RKIA 3SZ2A 2CQ3A 5I3QA 1YTYA 1YQHA 4JUZA 1HR0F 2FIUA 3OL8A 3MUVP 3O3LA 3MEDA 1WHYA 2GX8A 2I8EA 3TA0A 2DR7A 4QQBA 1HBNB 3KOAA 4FXWA 5I3UA 5HROA 2CQ4A 2MKSA 1S1XB 4ICLA 1N36F 3OL9A 2Q43A 2VBWA 4F4KA 4LFCF 5I42A 2V4QA 1R0AA 3V2UC 5MLCV 1L3KA 3PNIA 2FJBB 2CQ2A 2XMMA 3BGLA 3KHRA 2D74B 4NRUA 1TV6B 4IO9Q 3RB6A 4ZPWR 2PDAA 3O5TB 2HFZA 2RIJA 3U27A 1FDDA 2DGQA 4C3MA 1VLYA 2J7KA 2JEFA 2XCAA 4TLQA 4RNFA 2O66A 4HKQA 2LEAA 4EU0A 4OI6A 4ZK7M 3CCQS 3NCPA 4PCQA 3U02A 2CVIA 2RU9A 2XMKA 1VQ5S 1N5YA 1OWXA 2HHWA 5D3GB 2D9OA 3VAMA 4M94A 2L41A 3TQ1A 2V8HA 3QJJA 4IOAQ 5IT9Y 3G96A 5HQ8A 1S79A 4OIXA 3QZ8A 2DHGA 5U47A 2Q66A 2CPDA 4BC9A 2R2TA 3QJPA 3MM8A 1T8EA 5KG1A 4DV7F 1U2RA 3DM2B 2XI2A 2MQLA 1RTDA 1VQSA 2F3JA 1SJRA 2MHNA 2JVOA 3FGVA 3O6QA 3RBDA 2XMJA 1RT7B 5CZXA 1C0UB 4LQ3A 2P9GA 3MD3A 4OI2A 3M9OB 5KFAA 4DR5F 3L7PA 4L72B 1EP4A 1HD0A 1IXKA 3NGKA 5F0UA 3H40A 2A18A 2ADBA 3D1QA 2R2RA 2BQUA 1A6LA 4J37A 3CDEA 1R8AA 2RQMA 2HQIA 3GILA 5GMKa 3DHWC 1I1GA 3DU5A 3BSAA 4C0HA 4ELUA 4B9MA 3FEXB 4KR0B 2ILZA 1FD8A 2RB7A 4NCGB 2ABYA 5IZHA 4F4YA 3S01A 4RW8A 2VPXB 2CPYA 3GFZA 1ZAVA 4BWMA 3VCDA 3CDWA 3S7RA 3O8WA 1KFDA 2XB2D 1U4BA 3L7OA 4W90B 2VG6B 4OV1A 5BYSA 2Z2LA 2ZKUA 1BLUA 1HWKA 5L8RC 3ICLA 2PD1A 2DJWA 1TL1A 1YG0A 5BJRA 2DGOA 4JI3F 1QE1A 1NO8A 2MQNA 2KFZA 2WBMA 2AX0A 2V4RA 3SV4A 2ZJRQ 2K1RB 4PXCA 4CO4A 4ECZA 4DL7A 4EO6A 1DTQA 2ZJQQ 1GH8A 2HWTA 2W9BA 4PG8A 2ZM6F 5HLFA 2BXJA 2QSWA 1QAJA 1KRPA 1XNRF 4DR4F 2B43A 1NKBA 3E01B 3DRYA 2W25A 2XY6A 2W24A 5D4PA 5DDPC 2MB0B 3BN4A 1KHVA 2WSEC 3T1AA 4RUCA 3DGPA 4ZPVR 2ROPA 4CO1A 4B9LA 4AL6A 4GC7A 2HNZB 3HHLC 3FSYA 4AFFA 1Q82T 2K3IA 2IC3A 3UCUP 3D28A 2YH1A 3QIPB 3KLGB 2VBYA 3MZIA 4NCAA 1KLNA 2GJIA 1TL3B 5K14A 3NLCA 2MY7A 3IRWP 2YKOA 3NNAA 3ULHA 2HLUA 4K4UA 1ULRA 2HNYA 4MIWA 2LECA 1VRTA 5JUMA 4DL5A 1JLGA 5JVGQ 5LMNF 5J2QB 2VFSA 2Z2MA 4ZOSA 1OQ6A 5KFPA 1JKHB 1MU2A 2GO8A 3KNGA 3M8PB 1FDBA 4CH7A 3HVAA 3TUJC 4QYZJ 5FIIA 4ES1A 5DDOC 2DCLA 3UCGA 3JTOA 1VRUA 1KTVA 2XHWA 1X4GA 4AYBD 4Q44A 2KDOA 4DV1F 4DL4A 5KFGA 2ASJA 3BR8A 1OS5A 3CJ2A 2ZOFA 2E1MC 2G13A 1QLNA 3OLBA 1GX6A 2RKIB 3U7JA 1V3RA 2IMWP 5G4DA 3MMBB 1WACA 3MMAA 1KQFB 5L1LA 4MIBA 1YRTA 2H9ZA 2EC0A 1LWEB 2B7BB 3VZHA 2FUG9 5DJBA 3UD4P 4PUOB 3ZZUA 5EUHA 3O2IA 1F2GA 3G6YA 2OO4A 3RRGA 2O1PA 3E8OA 3RR7A 3BSCA 2L08A 2MZJA 2E1CA 1S4FA 3LF0A 5E3AA 2DGWA 2YX1A 1NJZA 1FKAF 2ADCA 3HZGA 3I55S 4ED7A 1JX4A 4HH0A 3CIZA 4LSNB 2IM1A 2JL9A 4DR2F 3V4IA 2HYIB 1FRHA 2BQ3A 2KM8C 1HFEL 1LW2A 2H5EA 4FVMA 5D77A 4IG3A 5F9LA 2AF6A 3GWCA 5C25B 1Z4UA 1VQ6S 4W92B 3CE8A 2LQBA 3KK3B 1LW0A 3QZ7A 4DFKA 1IKVA 4QIWD 4ES3A 4ZKAA 5IM0A 2QA4G 2HS0A 3CCTA 4M5DA 3CD0A 4ZLPA 1S6PA 2ZH8A 1T03B 3VAIA 3KWMA 2D3UA 1U26A 2DNOA 2J7WA 3G8QA 4RW7A 1JLFB 2MKKA 1UA1A 4F2SA 3MM5A 2IRUA 1JLBA 2CJAA 4ECWA 4RW6B 2Q3PA 1FRIA 5KFWA 5HP1A 4KGKA 5E3QA 3B78A 4LF9F 3CMAS 2XWXA 3ZC4A 3M2VA 3JAMY 4PRFA 2DO0A 3LANA 3RYLA 1S1WA 3PJWA 4LSLA 4X66F 1FDAA 3J81Y 2ASYA 3SV3A 3PX4A 4MKAA 3LP2A 4B17A 3HI9A 4Y2MA 3C46A 2CQDA 2NR0A 1UVLA 4NA2A 2P6SA 2EFQA 2HHPA 4K4TA 4LJMA 2U1AA 3MM7B 3DNCA 2VG5A 2B9YA 2JOQA 3FCHA 4MMOA 5KTQA 4P2SA 4OQJA 2E44A 1ZTTA 2E66A 5CYMA 4V19J 2BJDA 3V81B 2CQHA 1FXDA 2Q6BA 3DLEB 2KYXA 3E3XA 2HHXA 5KFSA 2BANB 5KFRA 4X4PA 2FD2A 2EFGA 1Q8LA 1J2VA 1ZTWA 4RNHA 4RW9A 3TA1A 4YR2A 2IBKA 3EXYA 3TVKA 2NXUA 3VALA 3NCQA 5LT5A 2HGMA 2F1FA 3GYNA 4OHWA 2VONA 3MEGA 4RX6A 2MYFA 2M88A 4K5SA 1F5AA 4O3NA 3DCAA 3MDFA 1V3ZA 4IOCQ 2I38A 3EGWB 3IS9B 4Q8FA 2YKNA 2VFRA 1ZM2A 2MZTA 4C8YA 4TN2A 1K73T 2MKHA 5BYRA 1WG1A 5EWFA 3IR7B 4U6PA 4QWEA 3PW0A 5CYJA 4HT7A 1QY7A 3TAMB 1Y5NB 3KFWX 1XNQF 1ZZFA 1HHTP 2HVZA 4ZP8A 1Q1KA 4ID5B 1G3OA 5K9FA 2B6AA 2I0XA 2MQMA 4K4YA 4MKBA 2VQEF 2ZUGA 2JDJA 2VBXA 2V4JB 1RGVA 2JLEA 2HHUA 1JJHA 2CPEA 3O44A 4A8OA 2YKMA 4Y00A 4IRKA 3CEDA 1HD1A 2BRLA 4MYTA 3T5JA 1C1CB 2P5VA 4MFBB 1NK5A 3MXHP 2VD3A 4KO0B 3CCLS 3OBIA 1PSDA 3KG4A 3O1LA 3KG0A 4J5OA 4XO0A 3BDPA 5H9EJ 4H4OB 2KJWA 1NK9A 5A6WA 1LKZA 5CQGA 5HMWA 3KJVA 3HK2A 4KFBA 1YRXA 2XMWA 3ZFVA 2ZZMA 1N34F 3L95X 2BABA 2L9NA 2F8EX 2VKZG 5DM7Q 2O01C 2RMLA 5DM6Q 3BZQA 3F44A 2B7CB 3VQSA 4I2QB 4NZ0A 1S72S 1Q53A 2UP1A 4ZPDA 4DV4F 2YTCA 3GFYA 3MPWA 3NMAA 5FLXY 3HZEA 1H2UX 5CXTA 4WKRA 3CCJS 4QWBA 4OX8A 2J5AA 4C97A 1RTJA 2CJ9A 3MM9A 1U1RA 1JIHA 4IFVB 2CJQA 4QW8A 2VA3A 1S0MA 3CJ5A 2KXNB 3E51A 1NB7A 4ILMA 2P9CA 4TLRA 4P7VA 1S0OA 3OVAA 3KMQA 4CTAB 3ISZA 3DRPA 4LVOP 4K0KF 4DL2A 1VQ4S 2WOMB 4ZP7A 2UUAF 4ZVGA 4I6WA 2AJQA 2QRRA 2VBZA 5AE3A 2I2YA 1GTEA 5M2PA 3RB3A 1S76D 2C2DA 2YQ3A 2KI2A 4NLSA 2IYIA 4U7UK 4H4MA 4N5SA 2ZD1A 4O3OA 1DBDA 3DRRA 4ZVHA 5DGBA 2VOOA 2XSJA 3AQPA 3RBEA 2M4MA 2DD8S 3MAHA 3S8SA 2DGXA 3FZBA 3G71S 3HVTA 4DMZA 4IR1A 1HQEB 1LOUA 2D1CA 3MFHA 1MWYA 2VPWB 3B4DA 4NCBA 3MTJA 1FT8A 1VFJA 1QAXA 2GIRA 1SJ3P 2FJWA 5LL6d 2FGOA 4F3QA 2G1DA 1T94A 2K8GA 4I7FA 4B3OB 2HHQA 3J7Z5 1Z2ZA 4IUFA 1BQNB 1OPZA 3PRBA 4WFYA 3THPA 1S0NA 2DNYA 1QSSA 3IO1A 3K58A 3NKYA 4R8UB 4XDCA 4JI1F 3UR3C 1X4HA 3WC0A 4ZHRA 1LWCA 3KTQA 3GFXA 2APOA 1J5EF 3M2RB 4IQXA 5EN1A 5LSLA 4FBTA 4WYWA 1M0SA 4X64F 3W2VA 4WFXA 1E6YB 4QU7A 2NYIA 2QT7A 2PMZD 3ZZYA 3CJ0A 3IN5A 2XO7A 3CCWA 3ENVA 2FVPA 4EBCA 4OI4A