3N5BA

The complex of pii and pipx from anabaena
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKVEIVVEDNQVDMVVDKIIAAARTGEIGDGKIFISPVEQVIRIRTGEKNTEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Nitrogen regulatory protein P-II
publication title Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
pubmed doi rcsb
source organism Nostoc
total genus 23
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n5bA00
1XK8A 4NYOA 4ZK7M 4C3LA 4NYPA 2J9DA 3GSDA 1PILA 4RLEA 3O8WA 4AFFA 4RX6A 4CO0A 3HLUA 2O67A 1VHFA 3OPKA 1UFLA 2GX8A 3L7PA 1QY7A 4OZNA 1UL3A 1O5JA 5D4OA 2XULA 5D4NA 4Y65A 2NUHA 4WK3A 5D4PA 2XBPA 1UKUA 2J9DE 1NAQA 4RWXA 3M05A 2JJ4D 3MHYA 4USIA 2ZOMA 1J2VA 2J9CA 3TA0A 2XG8A 4OZLA 2O66A 5L9NA 2E66A 4C3MA 3X3UA 3NCQA 3NCRA 4CO3A 4R25A 3TA1A 2VD3A 4WK1A 4Y6IA 1Q1KA 1VFJA 1V3SA 1KR4A 4YB6A 4E98A 3NCPA 2RD5C 1P1LA 2PIIA 2J9EA 3AA8A 3AH6A 3LF0A 2DCLA 4CNYA 4D3GA 4D3HA 1NH7A 4YB7A 1UMJA 4IYQA 1O51A 2Z0GA 4OZJA 3N5BA 2NS1B 1OSCA 4CO5A 4YB5A 4CO2A 1V6HA 3T9ZA 5DRKA 4CO1A 4USHA 2ZFHA 3AHPA 3CE8A 4RWWA 4USJC 5D4LA 1NZAA 1HWUA 2CZ4A 2NUUG 2XZWA 3AA9A 1V3RA 1H3DA 1NH8A 1V9OA 2EG2A 1GNKA 2GNKA 5DS7A 2EG1A 3TA2A 4C3KA 3O5TB 3BZQA 2V5HG 4CO4A 3DFEA 4CNZA 2GW8A
chains in the Genus database with same CATH superfamily
3OUYB 4HKQA 1FFWB 3QWPA 1I1GA 2ZDOA 1U4BA 4CH1A 4B3SF 4ZLJA 2XMAA 1KSPA 2MB0B 1NJWA 3VGTA 4C8NA 4W4MA 2XNQA 4EEYA 4NXNJ 3A8JA 3GYGA 3M6UA 3IBWA 2M7SA 2I1RA 2W9BB 3UNYA 2JC0A 2HHVA 1WC1A 1SL0A 4EU0A 3SI8A 5J2PB 1N5YB 4LVOP 2E5JA 4KGXB 5HBMA 2PMHA 2KHDA 5J2MB 3K5PA 2VG6A 4QW8A 3T5LA 2NS1B 2BE2A 2H5EA 2VFSA 2GO9A 2NPIA 4DUZJ 5HL7Q 1JNRB 2ZH3A 2YNHA 4CLKA 1FEEA 4NOHA 5DO2A 4HHUA 5IT9U 1YBUA 3D0GE 4NYPA 1RWUA 2J9DA 5A8RA 4R8UA 1RHUB 4EZ9A 3IRWP 2YBVA 2IY5B 3VQSA 1JLEB 2W2OP 1S72S 4MT1A 2BEFA 2XGPA 1FJGF 4PR6A 1IJEB 1LWCA 1YZ7A 2V34A 1KC8T 4N8OA 4CP5A 2MMYA 5T7LA 1N5VA 3RW6A 3HD1A 1XNQF 4MKVA 2R8KA 1U02A 4Y00A 4HT5A 2CQ0A 2DXFA 3TUPA 2AMCB 3EGNA 4B3TJ 1ROFA 3TW0A 5HAOA 2BMBA 3C15A 3MPUB 2DHSA 1VFJA 5FIIA 3NRBA 1QSSA 4NCGB 1KONA 4F25A 2VJVA 2V94A 1TP7A 2KU7A 5D15A 2MKHA 2A2CA 3UVJA 4P2FA 4C8LA 1MMDA 5A76A 5A6PA 2AJQA 4LBHA 1FVQA 3GCWP 2DK2A 2FVQA 4X62J 1T05B 4MIAA 4Q44A 1HHSA 5LMNF 1RTHB 4ZIWA 4PQUA 3OJSA 3T5KA 1H38A 3AY0A 5LL6d 4HT7A 4RO0A 1NJIT 5ITHA 4K4UA 3KLIB 3HULA 1HPZA 2KT3A 2BOAA 3EMTA 2NSCA 3ZTSA 2YKAA 1WC4A 4X66J 3HZEA 2DR6A 3NOCA 2WVEA 3J80Y 2IVYA 4WF9Q 3RTVA 2FYXA 5KT7A 1HHQA 1Z1ZA 3MMBA 2BVZA 1R6YA 1RTIA 3ZZRA 4Z7YA 3DLKA 1X4AA 3TNVA 3K89A 1M5KC 1FFGB 1XMOF 3E01A 2BANA 3KK1A 3ETOA 4L72B 2FD2A 3A1YG 3BH7B 3WC0A 4X65J 2Z56B 2PI4A 3RRKA 4UZCA 5CQGA 1FRIA 1IBKF 4Z7CA 4J9OA 1HWKA 3HF5A 1VLYA 4DQPA 4CH7A 2GMLA 4IFYA 4ID8A 2DNNA 4DZDA 1SV5B 4YUDA 4FVMA 1QAIA 2Q79A 3KXDA 3MMAB 4W98A 2EK1A 2E7XA 3M8QA 5J2NA 1ZTTA 4YY3J 3BR9A 1S9FA 2QL7B 4MKYA 5DQIA 2XBPA 1U6FA 2MKYA 4DUYJ 1J2VA 4EWTA 1F5BA 1H0HB 1DJ0A 2ZBIA 2ROGA 2FY8A 4JI6F 4L76A 1IJFB 3CSKA 2FVPA 4R25A 2D7SA 1IN0A 1M1HA 3SV4A 3G6ES 3W65A 5GMDA 3CJQA 4E98A 3PVXA 1XR5A 3BN4A 4A8SA 2AKWB 1VQPS 4OYAA 5HK4A 4NZ6A 4K0KF 3DDIA 1VQKS 2HQCA 1YVFA 3KLHB 4M5DB 3ZC4A 3V6DA 4RWWA 4B08A 2Y8WA 1VLOA 4U7UD 3WIVA 5HJYA 3PHTA 3KLGA 2FLNA 2Z30B 1WDDA 2R8GA 2EG1A 3G6VA 1ZM3A 3DFEA 2MGZB 2PFFB 2B6AB 2OSQA 2XCAA 3BF4A 1JJCB 3V5RA 4CO0A 5IM0A 3IS9A 2IPOB 2GVZB 2E5LF 3IM8A 3PRBA 2ASJA 1T9VA 1EHWA 2RKIB 5K20B 2N4DA 4ZJLA 5FLXY 4LBPA 1YRTA 1TKTB 2HVIA 2FUG9 5CXTA 4UOHA 1NK8A 3OFEA 2KKHA 2UUCJ 3CF5Q 4RU2A 1CPZA 3HHDA 2MQLA 1WKKA 3ENAA 2ROEA 2QLXA 5F8HA 1FKPB 4YB7A 5K9FA 2L41A 1DLOB 1TMMA 4LRCA 2LA6A 1UWBB 2LCWA 1JLCB 9RUBA 1Q79A 4GC6A 4CM2A 3GR1A 2ZD1A 4UOGA 1FD2A 1SCJB 2DXEA 1S9EB 5ETNA 4KJIA 2CQGA 4UOCA 1E6YB 3VAFA 5LOQA 3NOGA 1JMTA 1U2RA 2K2PA 2IDEA 3A12A 1F9HA 3PW7A 2WONA 3TX0A 3M7VA 3FQLA 2HNYA 2V8DA 4A8OA 2V2ZA 4FXVA 2AP6A 2V2KA 3TRGA 3LQVA 2H51B 3W64A 4DN9A 1WEXA 4C7QA 4ZMMA 4C11A 2NZ4A 4EGLA 2X3GA 4ER8A 4DR5F 1N34F 3AQPA 1H74A 1XERA 4YFUA 2PDAA 2K1RA 2DNPA 1HBUB 3ULHA 4ETXA 4IRDA 3ZZTA 1NXIA 3RJMB 2OH2A 4JI0F 3MDFA 2NUUG 1T3OA 1RAIB 4JV5J 2YX4A 2C2EA 4GKJF 4GO7X 4F3MA 3G4SS 3PO5A 4ED3A 5I42A 4NLQA 3C19A 2CAJA 3JQMA 3MR2A 2YX7A 5J1EA 3RB6A 1U2CA 3S1TA 3D28A 1EJ7L 2LXFA 4MJKA 2MHEA 2D3UA 3FEXB 1R6VA 2E1CA 5BR8J 3SQGB 4NRTA 3TEHB 3VAIA 2CDRB 2HRYA 2M70A 3DI6A 5HROB 3GV5B 1N32J 2CJBA 2KRBA 4B3MF 1SIWB 3DMJA 3I9ZA 1FESA 3SEOA 3JSRA 4OV6A 5B7WA 4WE1B 3CD6S 2IM0A 2XC9A 4Y2AA 4DS5A 2F3JA 5IC4B 1VQYA 2OPRA 1H7XA 3RG6A 4XAKA 4Y28C 1S1UA 2KO1A 2DY1A 3I55S 4DCOB 4C0OC 2XMVA 3M6VA 1FKAF 4CZCA 1PJ7A 3FVYA 2XLJA 4O4GA 3UNGC 2DT9A 2YY3A 2IJNA 4I2PB 2CA9A 4KGMA 5DG9A 2R7OA 3QYYA 4TNOA 1HWIA 4QYRA 4UZBA 4DR1J 4A47A 2W24A 2GVDB 3PZPA 1SL1A 4RW6B 1U26A 3IG1B 1WC6A 4MK9A 2J9DE 2EEYA 5J1NA 2YQ0A 2AGPA 4Y3CA 1UVMA 5AXNA 2XG8A 3K8VA 4DU8A 2UUAF 4X4TA 3TAPA 5KG2A 1RJJA 1T3NA 2ZEJA 1WOPA 1UETA 2IRYA 1ZM4A 3S6EA 4K4ZA 1U48A 4DQIA 4HACB 1S4FA 4YB1P 4QW9A 2FGCA 2AJFE 2OLWA 3MFHA 3W66A 3MOZA 4ZLPA 2CWKA 2HIQA 5H9EK 1ZYQA 1A0OB 2ASYA 3NS7B 3AODA 2MQQA 3OSPA 4GO5X 4KKOA 3OV7A 4HR2A 1YLXA 1RBOB 1U1RA 3ISNC 4ZVEA 4ZPWR 4U67Q 4KPCA 4DL5A 1XNQJ 2HFUA 5L46A 5JXSA 1YG0A 3QO9B 4HI2A 2FJXA 2ZKUA 1RT5A 4OJHA 3K58A 1XJWB 3K8WA 1X0PA 1Y9OA 1VHFA 2R8JA 4IRKA 1S59A 2FHKA 3LWLA 2DEIA 3BKTA 2DGWA 1Y4ZB 3DGPA 1UWAA 4DPYA 4YR3A 1RT1A 4PRFA 1L3KA 4C9DA 3V81B 2HRTA 2HAIA 2DGVA 3CJ2A 2BM1A 4CO3A 3E8OA 2ZJRQ 1PGZA 3A4TA 3MAAB 3G2XA 1KR4A 5KG3A 5KT4A 5GAEU 1RYSA 1Q95G 1LEOA 1RACB 4Y2CA 2LQJA 5IT9Y 1LW0A 5KFWA 4P2MA 1RWOB 2J7WA 2Q66A 3HHLB 2V69A 5LMNJ 3G71S 2RUSA 3N6MA 3THPA 1XC9A 3H59A 4WIIA 2RQKA 1IVZA 4M5JA 1XR7A 1X8DA 3TAMB 2HFVA 3TJ8A 1ZM2A 1YJRA 2DGSA 2OPQB 1RT2B 2BUNA 4O0IA 3VF0B 3EGVA 1K1SA 2ABYA 3VAHA 1TVRA 4ANCA 4IFVA 3FSXA 4LFCF 3CCSS 1NSQA 2KM8C 2BABA 1I6JA 5KFZA 4IR1A 3KK3B 4WP3A 4K2JA 2O01C 1HNIB 4JI1J 2FGOA 2GHPA 2RJZA 2QFJA 2VFTA 4F2RA 4OLOA 1JLGB 3ENVA 1DURA 1KQSR 1BD6A 3HSDA 2WVDA 5KFYA 4ZCKA 4Q45A 5CAAA 1RDRA 3MEKA 2WSEC 4KRWA 1GXLA 2A6OA 5F0WA 1NEEA 1WI6A 1U0HA 4K5RA 1G2EA 3UR3C 4RPFA 3OBIA 1GMUA 3FSIA 2GMHA 3CC2S 2OPPB 2CZ4A 1LFPA 2R3VA 1R31A 3W60A 2OEKA 5L39A 3TVKA 5H9EJ 2Y1JA 4RKUC 1VQOS 1PYTA 5E41A 4MMOA 3M8ZA 3POTB 2H3EB 4JI6J 1FA0A 2G13A 1U1KA 1JLBB 1WEZA 1IQZA 1TELA 4LSNB 2RB7A 1JLQA 6AT1B 2BJEA 2B9EA 2OP5A 2CJQA 2EI5A 5E0OA 2FQQB 2XI3A 1N8RT 3ENWA 4R5PB 1KFDA 1NK6A 4K0KJ 3BJYA 4KHMA 2XMMA 3I0RB 4N47A 2AW0A 2OEMA 1PBUA 2ZJQQ 1O8BA 3UO0A 3CJRA 1R8CA 1QJHA 3LF0A 2DCLA 1JKHB 4M5MA 3CWJA 3DRYA 3HMJG 4OHXA 4O3PA 2Z4PA 7FDRA 2JVOA 4XDCA 1VQ9S 4ZP6A 2PE8A 1XNRF 3CCRS 2E5LJ 5AJ3J 4RW8A 2Z2ZA 5HJXA 1VISA 2LQBA 2MQNA 4PYDA 1B0TA 2B56A 2R7TA 4FS2A 1F9FA 5DJBA 5BXIA 4RJVA 2YVSA 5J1PA 2ZVSA 1C0UB 1LWEB 3G87A 2NXCA 1WDTA 3RB4A 3R5DA 4LRBA 5HSPA 4QJVA 5KFEA 3H42A 1VBYA 2DNLA 4P74A 4NX9A 3GQCA 2D3ZA 2EXUA 2ZUGA 2M52A 1RTJA 1WOSA 5KFRA 1IKWA 3QFHA 4XIUA 4PPZA 3QMQA 4J9VA 2YWGA 3OVBA 3SSQA 4X4SA 2JLEA 4CYUA 4IH7A 1WHYA 3GIRA 3SDEA 1SJ4P 3TX8A 3DYAB 3C6TB 3N5BA 1RB0A 2EFPA 1BMQB 2G9OA 3DLJA 3MOJB 3ITHB 1KQFB 3D3BJ 1BQMA 1CJUB 3K59A 3ISND 3BZQA 3LWMA 1Q81T 2YPZA 2UUBJ 2WK4A 4M94A 2WRMA 3CCZA 3QGPA 1KOHA 3NAIA 5I3UB 3EJMA 2XB2D 1YJNS 1WG1A 3JSMA 3FBFA 1JLFA 2K06A 4DQQA 4DR5J 1N34J 4K7QA 2R2RA 3DRSB 3R5GA 5K8MA 5C2CA 5LM7E 5B0AA 2LU2A 3M2VB 1HIYA 3MAHA 4DFPA 4AQYJ 5J2QB 2RQMA 2W2QP 2LMIA 3QT5A 4MTPA 2CADA 4WU3A 1RT7A 2DH8A 5L9XA 3CD0A 2F8EX 1SC4B 3AB4B 4JI0J 3GLJA 1BUXA 4DF4A 2E7WA 2IBOA 4GKJJ 4R0EA 1UJ6A 1NH7A 3M2UA 4DZ6A 5IT4A 1FF2A 3H2LA 1UJ5A 4PYAA 3KG1A 1TUVA 3PJ9A 2HVEA 1IXKA 2DKOB 2GJIA 3SSSA 2CRLA 2QSWA 2ZE2B 2LQ8A 3VTIA 1GNKA 2WSFC 2KH9A 1Z4UA 1AT1B 1EARA 2IM3A 5A8KA 3GWCA 4GVBA 3KNGA 3LP0A 4FNIA 1NB2A 1RAEB 4RNNA 1MU2A 2CPEA 3T41A 4J9KA 1WF1A 4DX7A 3C16B 4AUKA 2D9OA 4CT9A 2BJ3A 3EVOA 3LH2S 3T5JA 4ZA1A 3LUYA 1RWKB 3GTYX 1IKXB 2HVHA 2CQIA 2FHOB 5GAGU 4M1KA 2VPZB 3FCHA 3LALA 4C0BA 4WCEQ 3DRRA 4Z2XA 2KJVA 3T3FA 3Q22A 4L75A 4IR9A 5CD4H 2ZNZA 5E3RA 1NK4A 2HFSA 3SQOP 1GXUA 4USWA 2DB1A 3MAQA 3T1YF 2K3KA 2PMZD 4IOCQ 1R27B 3DU5A 3M6WA 3NY0A 1BWEA 4C3KA 1X5TA 2DO0A 4J37A 3BPDA 2UUAJ 4O4RA 4J7CA 3MM6B 4ETZA 3Q0AA 4ED1A 1CULA 4NEYA 2PO4A 3FK4A 5LSLA 2PI5A 1OYDA 2CNOB 1FXDA 2CUYA 2K3IA 3R7NB 2CVIA 4C3MA 1ZPVA 1EKSA 4S0MA 3NGDA 3QT6A 3D5MA 1N5TA 1B7FA 2KB2A 2QA4S 2K7KA 1HD1A 4I4BA 1VRTA 3FUYA 4LIRA 3M9NB 1VR6A 2YX1A 2CQPA 4MFBA 3VCDA 2MZQA 4LVNP 4DV6F 3GMGA 2HS4A 1Q5VA 3TI0A 2UZAA 5ETSA 1HWLA 4EZ6A 3P49B 3OXFA 1I94F 5AT1B 3BDEA 1N5SA 4ELTA 2MYFA 3Q24A 4ANEA 4P2SA 4WFNQ 4NLWA 1IUJA 2W9BA 3ETMA 4JOUA 4OHVA 4X4VA 4U95A 1MWZA 3TUZC 1SKSA 3DU6A 2G2OA 3FEYB 1N5YA 3MWBA 3MD1A 2DHHA 2KTQA 3QIPB 4WJBA 1WC3A 3R2DJ 3PJWA 2FLPA 5B0GA 3MEDB 2B5JA 3HKZD 4ZCMA 5J2MA 3PX0A 2NREA 1FX2A 5AXMA 1A6LA 2GJFA 2OIHA 2W7AA 3BEGB 1S48A 3CCMS 1CS4B 3V6KA 1WJ9A 3PR4A 5KFTA 1T9XA 1IR1A 1CQNA 2J0WA 4WFZA 1IR2A 4BS2A 2IMWP 1UPPA 2DNYA 3MUVP 2YQ1A 4PWWA 2VJUA 2P9CA 5DLFA 4IOAQ 4URGA 4FYXB 1QD1A 3MR5A 1VS3A 4ZVSB 4LF6F 3MR6A 1JLEA 1AFIA 1HFEL 2OJ3A 3GZ7A 1B64A 2C42A 1R0AB 3KUEA 3R7BB 5KT2A 4RLEA 5JUMA 1N48A 3MCNA 3M6XA 5DQHA 4OX8A 1UFKA 3EM1A 2HS3A 4J5OA 1N6QB 2B7CB 3FFIB 1C1BB 1BGXT 4CLSA 1EX8A 2VUGA 4WFAQ 2Y0BB 4I56A 5CD4A 3GIKA 4CQ1A 1WNEA 3NWGA 2HRUA 2VL1A 3CMQA 2XLIA 4O3RA 3MM5A 1TFWA 4CM0A 1RT6B 2E29A 2HHQA 2E1MC 5KFVA 4IYQA 1IM6A 1UVIA 1NKBA 4F4YA 2DBBA 1T05A 4Q8EA 2OO4A 3CC7S 3KHGA 2FLOA 4JI5J 2ASDA 1S7IA 1FRKA 1RCXB 3TA2A 1S1XB 4AXIA 3PY8A 2L9WA 2YNGB 2LEPA 2W2PP 3T1HF 3R3TA 3DRPB 3KLIA 1RTZA 2RIJA 2AQ4A 4F02A 4DR6F 1ZZNA 1T03A 4A8YA 2MLXA 4PUOB 2J8SA 2D74B 5IOLA 2XO6A 3VWSA 3PIOQ 4M5GA 3BBCA 2IDLA 2BV3A 3HPOA 1FKOA 3G86A 3THTA 2YXLA 3JAMY 2OAUA 4OI4A 1N36F 2HNDB 2UVUA 4ED6A 3MPVA 5E2QA 1MSWD 2RDIA 4EFAC 2ERRA 5F8NA 1UMJA 4MYUA 4DPXA 1FCAA 1QAJA 3M1VA 1AUSL 2VBZA 5I3QA 1Z2LA 1QVGR 3BO3A 3D54A 2G1HA 3IWNC 2ZH8A 2B51A 2DR9A 5A0YB 4OX9F 4MK8A 1DQ8A 1BQNB 4ZP8A 4E0DA 1WELA 5DG7A 1FRMA 1SV5A 4LBIA 1PC5A 2GNKA 4DR2F 1U25A 4NLTA 2CWXA 3BSNA 2HZCA 2GW8A 1DFDA 1YQHA 3TZXA 2F40A 1FI4A 4ZHRB 1NNDA 5C42B 3V2UC 2QGFB 4G1PA 2CPJA 1N33J 2M0GB 1RHRB 4OZNA 3W8GA 4LFBF 1X60A 3ZZPA 2RRAA 2R2SA 5A2QY 3M32B 2H1YA 2HBRB 1RWWB 5MAOA 2V6AA 1VC0A 2CJXB 3HHNB 1TK5A 3KLFB 2UV8A 5KFJA 2EFVA 4M5DA 2I5JB 3DM2A 2YKNB 4L3NA 3TR5A 4F2SA 5D0HA 3QJPA 2QT7A 3OHBA 3I5AA 2MGZA 3TAQA 1SQGA 1HNZJ 4QYZK 1WHWA 2WVBA 4DPWA 1M5PC 2B6AA 3UI3A 3KWMA 3EPGA 1W7WA 4Z37A 1XTZA 4J90A 3JB9k 2AX1A 5ADZA 4ZVPB 4OLPA 3DOLB 2HWTA 3TP2A 1PILA 5E3QA 1QDUB 3R1LA 3KUHA 2LQ9A 3M4XA 5D0EA 4NEZA 3N5FA 1M5SA 4LMZA 1IWGA 2H5JB 1S12A 3OL8A 1HQ2A 2DR5A 4IG3B 3HSJA 2V2VA 3BSCA 1FKPA 3J7YU 5KFAA 3PYGA 3QT8A 1RABB 3TWZA 1DLOA 3KK2B 1SH0A 2V9KA 1KFSA 3HFZB 3OL9A 2R9LA 2YKOA 3OQ2A 3FQKA 4KAIA 4PXDA 2BW2A 2PC6A 1TKXB 5KG5A 4BBYA 2KM8B 1QM9A 2VPWB 1F6TA 3FMWA 5D6GA 3ILJA 5HO4A 1K0TA 1LNQA 5AE3A 4O0NA 5I4MA 5KG0A 1TKZA 1X5OA 1ZA1B 4QCLA 5HMZA 3I0SA 4NE9C 3BH6B 4DX8H 4TKTA 3N28A 2XSJB 3MZIA 3HZGA 5HP1A 3MCMA 2Y3YA 4QPXA 2CZ9A 1S0VA 1SPBP 1UFLA 1PIEA 3CCJS 1D8ZA 4FVCA 4Y65A 3A8EA 1TMJA 3LAKA 4DG1B 2KZMA 3Q8VA 3QBCA 3D0HE 2A2DA 1G6BA 1NDPA 4KBIA 2CNNB 1CJVB 5RUBA 4M5HA 3T1YJ 1S10A 4I6YA 3UFCX 1MW7A 2CQBA 4DFJA 2LU1A 3CT9A 2QFIA 4RBVA 2EBGA 4P71A 1C4AA 3HHKA 2C2RA 2XQCA 2YKMA 2HW3A 3OR2A 3NNCA 5G4DA 2A3JA 4Q0BA 3UQSA 2KL8A 4KE5A 2YKQA 3EGZA 4B9SA 3C14B 1HI0P 1D9DA 4HYKA 4K4SA 4J9PA 5ETOA 5GVQA 1URNA 4IG0A 4QYZJ 3H98A 4HHHA 3MI7X 5DGAA 5HROA 2MXYA 2HGMA 2KXFA 3PFOA 3UR0A 5E33A 2R8HA 4NZ0A 1Q8LA 2HSEB 2EBEA 2CJKA 1Q8KA 3PO4A 3HD2A 2F9JA 3TJ9A 4F4AA 1Y7PA 5DDRC 1S57A 3GFZA 4LSLB 4YHHJ 4TY8B 4DLGA 1S1TB 4WE1A 4WPAA 3TVYA 5H9FJ 3GSIA 4CTAB 2HKEA 1JWWA 4F3QA 2FJWA 3J80U 1LK5A 4KB7A 3VGUA 3CTRA 4B3TF 3AJDA 3HJVA 4DV6J 2KDOA 4YDXA 4Q2LA 4OI1A 2A0FB 3H5YA 2HQIA 2DRDA 2W7OA 5M2UA 2QMWA 3CCES 5F8JA 5ETVA 1V6HA 4WXWA 2PFDA 5DZ6A 4X4NA 2BA9A 3DC2A 2CPYA 3NNHA 2QLFB 3NGKA 2R7VA 3Q8PB 2XY5A 3U1LA 3EZOA 2YNIB 2RF2B 4RUHA 4CLUA 3O2IA 2GVDA 5GADI 4HLBA 2DHAA 3IG1A 3S7RA 3LA0A 4ZVHA 1CSJA 1VIOA 4ZS6A 2VKRA 3GB0A 3IR5B 3W61A 1AZSA 3D68A 5T41A 2ZWOA 2HHTA 2XI2A 2HAFA 1S0NA 2IJFA 5D4PA 5KFOA 2FJDB 3EE3A 4X4RA 4NA3A 3UN5A 1FDAA 1LW2B 2H48B 3BN7A 4PG6A 4WFYA 3D6MB 4X66F 3SFUA 2HQFA 4HACA 4CIOA 5IS2A 4OYMA 1R7IA 1MLAA 3CPWR 4Y2IA 1UEKA 2NXNA 1S1WA 3L3CA 4OI0A 1OSCA 4CO5A 1M5HA 3MGJA 3PCOB 3NP5A 5C24B 1S0MA 4TQSA 1WHXA 2MKKA 2PGCA 5HBMB 4OZ3A 4P9SA 1VQ6S 1NK9A 4OYBA 3HFKA 3V81A 1P6TA 1KN6A 2OPSA 3QSIA 2MJUA 3KJQB 2V4QA 2YNHB 4Y34A 4YY3F 2ZOGA 3I5BA 2OHDA 2ATCB 1CJTB 1U1NA 3KTQA 4IO1A 2KFYA 4LFAF 4QR1A 5FDLB 4DV0J 5SZTA 4DPUA 1I3OB 4G3IA 4A8FA 5A8RB 4R8UB 2HGLA 3K0JA 5LSRA 4RW9A 3F44A 4BCAA 4WP9A 5CYQA 3TUJC 4FN5A 3KLEB 3TAMA 4UT4A 5T7LB 1K73T 4DFKA 4P7TA 4DR6J 3OHAA 3HVTB 2OUGA 4KH0B 2YQ3A 4UW2A 3EYZA 1ELOA 4ZPAA 4W92B 2BQ3A 4ECXA 2MQ8A 4M63A 4ZVFA 3C15B 5IQ6A 1HNVB 4QIWD 3L7OA 2IIHA 2FHJA 3M9MB 2KVQE 4NI2A 1S1VA 3KK3A 1N36J 5EWGA 4WTOB 1QTNB 1NO8A 2L48A 1QUVA 1HNIA 2NZCA 2ZZNA 1N54B 1TK8A 2WOMB 4CLLA 2B43A 1QY7A 1JLGA 2IA6A 2EFOA 4XDDA 2X1FA 1XBWA 2AWZA 5U47A 4BWMA 1UKUA 3IO1A 1TTHB 1GX5A 2PSZA 2HYIB 1R43A 2UUCF 3HXMA 2VD3A 3IR7B 1FRJA 2D69A 1AUDA 1WG4A 1RAOA 4DR4F 3QRPA 2M4MA 4EI2A 4DLEA 2OPPA 4DR2J 4A48A 5KFMA 2RS8A 1B0PA 3PX6A 4B3OB 1R8HA 3FGVA 2CPHA 3N79A 1RADB 2XMKA 3NWRA 3HHLC 2MPUA 5MLCV 4OHZA 4U96A 3POTA 3LGHA 2QO3A 3LGNA 3MMBB 2XTJP 2HLUA 1GTEA 4PG5A 2DR8A 1RTIB 5K8OA 3VV2B 1WHVA 4MH8A 2KI2A 1RU2A 1J5EJ 2G0IA 4BHQA 3MM9B 4RW7B 2AU0A 4JI8J 3HLUA 2CYYA 4R5PA 3E01B 1TU0B 1HR0J 4F4WA 1U8SA 2BM0A 3UPFA 2AYBA 2FPHX 5L1KA 1PC4A 4TYBA 4I68A 1UJ4A 5C25A 1VOMA 4ECWA 3HCXA 3UW1A 3QWUA 3SFGA 3IMQJ 5B08A 3T6BA 4FF1A 4OYIA 4PG8A 4USVA 2WAQD 5EDWA 4DEZA 1NPPA 1H6KX 1W2IA 2Z2YB 1KWMA 2FVSA 4PAAA 1FNMA 5BYQA 3GJQB 2J6UA 4RZRA 2MZJA 4DN0A 2ILZA 3B4MA 1X4HA 1LWEA 2BJ9A 4LIWA 1OWXA 2X1GA 3BKUA 1TKDA 3PYFA 4NMXA 1ZZFA 4X4QA 1PKUA 3G9CA 5EHHA 4FF3A 1RT4B 1JXLA 4ECZA 1YK9A 3CGIA 4LREA 3W2VA 3GJRB 1RLCL 2UP1A 3B6BA 4IDKB 5KFNA 1MN9A 1T9TA 1G1XA 2C3YA 3IGNA 3P5BP 3NS5A 3OXGA 3QGIA 2JHEA 2OSRA 4I1TA 2J5AA 3W9JA 1RHQB 3RZAA 3C6TA 1OSDA 2QEXS 3AJ2A 5LXYA 3SSRA 4ILMA 5IM0B 4OX6A 3W63A 2AYEA 1EB0A 1HBOA 3I31A 2VBXA 3ITHA 3AT1B 2IRXA 1CJUA 2ZFHA 4DR3F 3LP1A 4U7UK 1FVSA 2LDIA 1OO0B 4N56A 2XNRA 3CO0P 3NKYA 3EXYA 1NH8A 4M5KA 1X4BA 3M30B 4O3SA 5KFCA 4RNMA 4ECTA 1B70B 4YP3A 3MXHP 3DRSA 5G0RB 3WZ0A 1KP6A 1VK3A 3G8QA 1S6QA 2ZBCA 3DHWC 4O23A 2R8IA 4C8ZA 3OPKA 5KFXA 4Q2MA 4EBEA 3MCSA 4DR1F 1KOOA 5HVHA 2BQRA 2JEJA 3D6TB 4WK3A 4AE5A 2H5IB 3SCJE 2BZ2A 4QWEA 3MR7A 1TV6B 1HI8A 1VMBA 2O5DA 2IFXA 2XY7A 1MWQA 4DMZA 2J0XA 2KVIA 4LF5J 1T94A 3ZNJ1 1HMVB 2OTJS 3PHEA 4CNYA 1XMQJ 3ZTRA 1KQKA 3GIIA 4LF7J 5D3GB 2ZE2A 4I64A 3OL7A 3D3CJ 2RRNA 3B82A 1KTQA 5F8IA 1V5IB 4RNHA 4JBCA 4KV8B 4LRDA 1GX6A 2Y8YA 4FKXA 1NSPA 4PEOA 4MK7A 3GIJA 1IQTA 3IC1A 4NLYA 2LEBA 1CBKA 3VZIA 1FDNA 2FJEB 4DV2J 2WB1D 5DDPC 5I3PA 4K2XA 3J7Z5 2K1RB 1FNXH 2W2MP 1RZMA 5F8GA 1U1MA 2MKIA 1UL3A 3VGSA 2VA2A 3RW7A 1PYSB 1RHJB 4FDFA 2LLZA 3MHYA 5JMNA 4OZ0A 1QSYA 1TK0A 1PBAA 5I42B 2IYGA 1JQGA 5L9NA 1S49A 2DNZA 4JI4J 5F3ZA 4JYAJ 4WK1A 4ZIVA 3QQCD 2M2BA 2J7UA 4ES1A 2V4JB 3BBBA 1HNWF 1NJXA 3DI6B 1RUSA 2LA4A 4QWAA 4XO0A 4YB5A 1VC6A 2A6MA 5E5NA 2BR0A 1GK8A 1U1OA 2H4YB 1X4DA 1NDLA 3IR6B 1U8WA 4QWBA 2DYAA 3HHLD 5JVHQ 4DSLA 4OYWA 4FYVB 3DCAA 2E5IA 3PYDA 4DPOA 1PG5B 2DNOA 3MM6A 5DGBA 1ULRA 4PWDA 4DSIA 4ELVA 1T7PA 1NM2A 1VJWA 4I7FA 2MY7A 3VQTA 2HZAA 4WZQA 4F67A 4P10A 4ED4A 5KFSA 3RGIA 3CJ0A 1WEYA 5T14A 1S1UB 3BYPA 2YTCA 2F8MA 1AXQA 3JSBA 3DLGB 2OMOA 4UUWA 3DLBA 4EUVA 3LW5C 3DDKA 1XQIA 2MQMA 4FS1A 5LXRA 3EZ5A 4HHJA 3S01A 4DPTA 3P6YC 3HSGA 1RKIA 3I32A 3P96A 1X9WA 2MSTA 4JI1F 2GFFA 1NHKL 2JX2A 1U1LA 3JTNA 2FHJD 3UCUP 1WSRA 3C8YA 2O66A 4MAKA 2DH9A 3VAKA 2UVRA 4B3RF 2CVEA 2ACYA 5L1LA 2RSQA 3R5JB 3UCGA 5KFHA 1U6BA 3AQOA 2AGOA 4OYXA 5DLGA 2XWYA 1YI2S 3ZXWA 1NCLA 2I9SA 4HTIA 4YQWA 2ZH6A 2LYVA 3SYZA 3IWLA 2CFXA 4ATNA 4F26A 3L95X 2ZNYA 3CULA 1GMWD 1HQUB 4ED2A 2ROPA 2DHXA 3TUIC 4JP8A 4KSEB 1WF2A 2V4RA 2BW7A 3CXCR 4LFAJ 3DLEB 4ZLNA 3OTOF 2GGPA 3QIPA 2M88A 3BO4A 3MEDA 4ENOA 1FFSB 3VHQA 3I4HX 3IWXA 3OL6A 1YX2A 3DLHA 3RR7A 2PT0A 1CS4A 4Q7AA 2XZTB 3NCQA 2JZ5A 2VICA 1JLAB 5CYMB 1RT5B 3UDCA 2W25A 3UD3P 2GQ2A 1JJHA 1RAHB 2XMTA 2W4PA 5CCLA 3W2WA 1RT1B 3P8BB 4DV1J 3FC9A 2IHR1 3JXOA 2UXCJ 3B8HA 3FZ2A 2RH3A 2YH0A 4OI2A 3TZYA 1YJ9S 4I6AA 5AJ3F 2WBRA 2ZKTA 3H5SA 3I4PA 4DQRA 4ZPTR 1XWLA 2OD4A 3HVRA 1N6QA 4WIQA 2G1DA 2KN4A 3FFIA 4I69A 5IZHA 3O8WA 4ZLLA 3Q8SB 3RAMA 5LSOA 1BQXA 4XPCA 3FSYA 1LOUA 3W5YA 5F9LA 4NLVA 3R97A 3ET6B 4ECQA 4ALZA 4DR4J 3MPYA 2IA0A 3G82B 2GHWA 2C22A 4PXCA 1F60B 1K8AT 2RNEA 3D1QA 2Q1LA 1RT6A 1WD6A 3Q83A 3BSAA 3KJVB 2F63A 5K8NA 5EUHA 3W9IA 3CJ4A 4AXJA 2QRRA 4QWCA 3H2VE 2WTFA 7AT1B 3NCPA 4ZVRB 4UUXA 1MNEA 1CC8A 4NCAA 4KY3A 2H4WB 4NXMJ 1Q16B 1SIZA 4FF4A 1EQMA 4P73A 4K8RA 2NYHA 1S1XA 1G4CA 2BX6A 3T1AA 4A8QA 3PIPQ 2EG2A 2Q43A 1NKCA 5FJ4A 4N5SA 2XLKA 4Y2MA 8AT1B 3DXSX 1CJKB 3K5LA 4I6WA 4PUOA 1VC5A 4CLTA 2DJWA 1DHMA 4PXEA 4IO9Q 2CQ2A 2UUBF 3THVA 2D41A 2AX0A 2ZBPA 1Y00A 1WACA 2ZITA 2ZM6F 3ELHA 1FK9B 3DDNA 3CCWA 3BBFA 2IVMA 2EKNA 4K5SA 1IBLF 2ZDPA 5B0CA 2OKQA 1FJEB 1RHKB 4KH1B 4K4VA 4AQYF 2HMIB 2MQPA 1PYOB 4ZDNA 4ES2A 2CQHA 2ZBRA 3OR1B 2KFNA 2GAHC 5HMYA 1HWJA 2Z58B 1SUQA 2UU9F 2CKWA 4NPOA 1F3VA 1TL4A 4A8XA 1RTDB 3P5TL 4PKDB 3IRXB 2L9NA 1JLQB 4PXBA 1S7HA 1HQEA 2C3UA 2YNFB 3DLLQ 4H4KC 3CC4S 3F41A 4I0WA 1X5PA 3UWTA 4ZHRA 1YSJA 1V3RA 5C42A 3DOKB 1K44A 2XY6A 2C2NA 3US5A 3PDNA 1RWNB 3ENQA 3BGOP 4EYHB 4KGKA 3KMSA 1LXNA 1M5OC 3QJLA 2NUHA 2WVFA 2OI2A 3M05A 1UVNA 3WX8A 3R5BA 3L7UA 1RBAA 4GC7A 2D3O1 1IWAA 2I5JA 1S79A 2YKNA 2WVCA 4RU9A 4DR3J 2P8IA 8ATCB 4IH5A 4WYLA 2XHCA 4DJBA 1P1TA 5F9NA 3LPEA 4QPTA 1X4CA 1J27A 4GMKA 3IGVA 1X0FA 2P6TA 1BY9A 4O3NA 2MLYA 2R7QA 4WFBQ 3V4IA 2XZWA 2Q3PA 5LMUF 1KLMA 2IMOA 1FJ7A 3BB5A 1QE1A 2JFDA 1KVJA 1S6PB 3OD2A 2F8HA 4RW4B 3SDEB 3CIMA 4ZN1A 1K47A 2RU9A 4U8YA 2ZH2A 3N0VA 1GEHA 5D4OA 4M5LA 3DHXA 4ECSA 2P5VA 1NAQA 1Q53A 2CG8A 4M95A 1SH3A 3U1MA 1C0TB 2RU3A 3PW0A 3PM9A 4OIXA 1FRHA 4DDFA 1Q4RA 3H5UA 3U02A 4KGZB 3H4BA 5KTQA 1TKXA 3F73A 3JSMB 5JVGQ 2Z2MA 1F1BB 1VBKA 3GPAA 2Z0GA 2ZBQA 2NSBA 3CJKB 4ED8A 4ECRA 2BRKA 4TY9A 3PRVA 5F8LA 2VQFF 3AOBA 1CVJA 1NMEB 3CCVS 1RT7B 3P45B 1H3DA 2XSJA 1FD8A 2KJWA 1C1CB 1HARA 2BXJA 4CNZA 4FNHA 3ONQA 4LJMA 2VB6A 1D09B 2DR7A 2XMJA 3KG4A 3CDEA 3M2UB 4ZCIA 1FJCA 3E2EA 2VQEJ 1N0UA 1TQLA 3LAMA 5HQ8A 3PW4A 3PV8A 5F0UA 3GV8B 4C6AA 1OPZA 5C7PA 3C6UA 1FX4A 1WC5A 1FTCA 1BHNA 3FRYA 3RB3A 2JRSA 3SIPB 1HNWJ 5CZXA 1S5ZA 1NLKL 2BBEA 3SXLA 3QAUA 2CZVC 4GVBB 3H5XA 3W1YC 1RP5A 5HLFA 2QC3A 3V4MA 5KFUA 1RA6A 2V63A 2IRUA 1S0OA 4HEA9 1MU2B 3IXQA 4L3KA 3EWGA 4KHPF 1QSLA 1X7VA 1T9UA 3NGUA 4D3HA 3T19A 2HBZB 4K50A 2XO7A 2L9DA 3AXMA 2GO8A 3R2CJ 3C14A 4M5NA 2RRBA 2OGUA 5ETTA 1HI1A 4ZITA 1CLFA 4ZVTB 2QE5A 2JVRA 2PA3A 2ZH5A 3CCUS 3R6LB 4C98A 4FPIA 2ZH7A 2DNHA 4ZN3A 1U45A 3C66A 3DRRB 3MPWA 1AFJA 4WKYA 3C3LA 1H2UX 2XS2A 4AFFA 3A13A 2VOOA 3TQEA 4NLOA 4TXSA 4LSLA 1BLUA 3RRHA 2O1PA 3JQKA 4JI2F 4CTAA 1RQ0A 1I5OB 4B3RJ 4EO8A 2P2CB 1TAUA 1OY9A 4UY85 4QBUA 3JAMU 1PJ5A 1X4EA 2HURA 2FJBB 1U6ZA 2Z57B 3TOQA 3JTPA 3N6LA 3A8KA 5AXKA 3AH6A 4EO6A 4J9SA 1NDCA 1RT3B 4DV4J 1CULB 3NBPA 4QQBA 1J5OA 4PPDA 2MZ1A 4A8MP 5IC6B 2R7RA 3E3XA 2N3LA 4WBFA 1AB8A 3OTOJ 2FTRA 3L09A 1RXOB 4YS2A 4A4JA 4JI5F 2I8EA 4JB8B 4J9MA 2CDQA 1TL1A 2QV6A 2ZWPA 3QAEA 3H4DA 1N5QA 1R8BA 1LW2A 4DV7J 2DEJA 5CH7B 3KYLA 2MY8A 3M2RA 2NYIA 4P52A 2DPJA 1CG2A 1VRQC 1X9MA 4TN2A 5ETMA 4ZCLA 4TU7A 3M8PA 5A2QU 3MM7A 4NLGA 3K17A 2DIUA 2VOPA 2E1AA 9ATCB 3UDEA 4DV3F 1SB6A 2MZRA 5B0DA 2GMJA 2JFKA 1OPIA 2NXEA 3MM8B 5H1SV 1RU1A 4OYOA 2UV8G 4YOEA 4USTA 1RBLA 3RAXA 5C24A 3HM9A 2UVVA 3H0PA 1VJQA 2HK3A 1JJ4A 3BQ2A 1XN9A 2CQCA 3IBFB 3NL0A 1S77D 5GMKa 2JDJA 2B5JB 3ICLA 3FNNA 3UN2A 2JLGA 2V5HG 2GQQA 3LP2B 3KFWX 3UDLA 1B4SA 4DR7J 3OFFA 1CJTA 2AIRB 3PRDA 1RWVB 3IM9A 2VDIA 3G8SA 2B9XA 2C2OB 1RKJA 1EQ0A 1N33F 5FDLA 1O5JA 4TQRA 3OT9A 1DTTB 2MDAA 1WTFA 1RAGB 2HHHJ 1VQ5S 4ITSA 1LV5A 1ZPWX 3G6YA 1PAUB 5FD1A 3ZNUA 3AFGA 3O44A 1YZ6A 1NHVA 2DNMA 3KLEA 3GILA 2OMLA 1UW4A 2J0SD 3WX4A 2IC3A 4LQ3A 1RSCA 1FNOA 2DITA 4U6PA 3HVTA 4RNFA 1HHTP 4OZJA 2FVCA 1Y5IB 2P9GA 4CO2A 4DF8A 2HPUA 2Z8QA 4ZOSA 3CVKA 4YR0A 2V8GA 2DTJA 1HNVA 1FTRA 1D0EA 1HNZF 2ZM6J 3I96A 1VQMS 4FXDA 2ZH9A 3K7RA 5D78A 2KYXA 1IBLJ 3MM5B 2I2YA 4DL2A 2O3DA 2WOMA 1YJTA 3MEEB 3KNAA 2W8KA 4HDGA 2BKOA 1K9MT 3BGRB 1FXLA 5IQQA 2UU9J 1JNZB 2AYGA 1E6VA 2HHPA 1SC3B 1SC6A 2G2ZA 1B3TA 2H54B 4TYAA 1VRUA 3I87A 4F3OA 3E51A 3CMAS 1RGVA 2VBWA 2Z2LA 4B3OA 2W4DA 2FJAB 2VF3A 4LF8J 4GKKF 2Y1IA 4XPEA 2V9WA 1T03B 2B4PA 5LJ3Y 3EGWB 1IM4A 2ZH1A 3D6HB 3Q89A 3MTJA 4FP9A 2VBYA 2FZCB 1FKOB 4ICLB 4QR0A 3AHPA 3PFEA 2KXNB 3AD8C 3CJSA 4L73A 1KNZA 3RBZA 3Q86A 3MM9A 4RW7A 1T95A 3T6JA 5KT3A 1UZHA 4LF2A 2LFVA 4H4OA 1EAYC 4KO0A 4DI6A 4ID5A 4JI7F 4AYBD 4I2QA 3O3LA 3PNIA 2HHXA 4ZPBA 2V8PA 4OJ3A 2R2TA 2UXBJ 1JXVA 3M1VB 3PG9A 1W25A 2BRLA 2MJNA 2WBMA 3FRZA 2GX8A 4U9RA 4N7TA 3Q8UA 2CPFA 3D66A 5EWEA 4CH0S 4U8VA 3QLHB 5L8RC 3GG1A 2QA2A 5AXLA 1X4FA 6FD1A 2DRBA 2AV5A 2EKYA 4IQXA 1U1PA 1Q86T 3AJ1A 4OZ2A 4AL6A 2QLBB 1KD1T 1MN7A 2AEMA 1T9YA 4YB6A 5LMUJ 2VPYB 1ZETA 2RDDA 2IAJA 2LXIA 5HMXA 3SZ2A 5HI7A 1EP4B 1YJWS 3DGVA 2BJDA 2ACMA 1M0SA 4KT0C 2DVIA 3VAJA 3FDSA 3KG0A 4C8KA 1RT4A 2BJ8A 2XS5A 1AROP 3GJTB 1S9GB 4QIVA 3DM2B 1SJFA 2CNLB 2QL9B 3AD7C 4IDKA 2ADCA 2HWIA 4EBCA 3OTBA 2VG7A 3QATA 4G1QB 4Y0FA 4A8WA 2NCKL 3EX7B 1Q8IA 1KTVA 4LQ9A 3MEGB 2JEIA 4CT8A 1DTQA 5DETA 3OLAA 2J6TA 1Y0HA 4YHHF 3KHLA 3CDAA 4DCJB 2B7BB 2EC2A 2EK6A 1R89A 5BYSA 5K5MA 2E44A 1DQ9A 3A8IA 3BREA 1YIJS 3PJXA 2RT3A 8RUCA 2E5HA 1U09A 4Y6IA 4DBQA 2VQFJ 4WYWA 1TUWA 4BC9A 3BGUA 3OUYA 3HHEA 3GJSB 3H7HB 4K4TA 3JTOA 2GAGC 3ZFVA 5KFPA 3M30A 3N01A 1PO6A 1IBMF 1WC0A 1VQSA 1B0VA 2VKZG 2IBKA 5HVGA 1OQ6A 2YPYA 5GADU 2VA3A 4TVAB 1IKVB 5G0RA 1NRKA 1HW9A 3PTWA 1TR0A 1VDHA 1FEHA 3TZZA 4WTYA 2GJ2A 3KJFB 1YRUA 4C3LA 5J2PA 3EICA 4PG7A 4FBTA 3GSDA 1L3SA 2CQ3A 5ETLA 4HDHA 1NBEB 1T8EA 1R3NA 1UTAA 3Q8YA 1QAXA 1TV6A 2OFGX 4UOFA 4P7VA 1MWYA 1SXLA 1ZS6A 4IOBA 3QT7A 4KHPJ 3SV3A 2MSSA 1TZ0A 2JEGA 2F4VF 2JH3A 2GCFA 5GAHI 4H4MB 1KVKA 4DV5F 2J9CA 1HMVA 2V8VA 3M8YA 3RAQA 4DWIA 3R8YA 1AYEA 1TUGB 1TKZB 5D3GA 3I0SB 2DO4A 3MMCB 1HNXF 1UCNA 1WORA 3R27A 2YWWA 3NEKA 5HP1B 2B3TB 3FBEA 1RISA 3CDWA 4UF4A 2OELA 4KV8A 1NZ8A 2AJ2A 3ZTOA 4CRJA 3OVSA 3T5HA 3KOAA 2EFGA 2HVDA 4B17A 3SCIE 3UD4P 3CE8A 3L9ZA 4C0HA 5KFQA 5B0EA 4JI2J 1VYAA 2ZUAA 5D77A 2DGQA 2LQ5A 2QZ8A 1NPKA 1Y3JA 1MMNA 4OJ1A 3TEGA 1FWPA 4NMLA 2XEXA 3ZZZA 2DIVA 2VFVA 2DGOA 3NNAA 4NCGA 2OTLS 2YKMB 2VU5A 3OR2B 4Q0BB 4N8NA 3BO2A 2XYPB 1IKYB 1TL7B 3G8TA 4CLFA 3M8RA 1APSA 3MECB 4USKA 1YITS 3B78A 2ZOFA 1JXEA 1O0PA 4ZPVR 2V4JA 1ZM9A 1H2VZ 2Y9HA 2DNRA 2DCUB 4IG0B 1KHWA 4DV0F 3I82A 3ZTQA 2HLTA 1HBMB 3NLCA 1RE1B 2PIIA 1RTHA 3D4JA 2ZC4A 4OMFG 2DGXA 2COLA 3QPIA 3TJAA 2FC8A 3Q8RB 1N0VC 4JI3J 4USHA 3NMAA 2MZTA 2RUGA 2ATLA 2R42A 2E7VA 4DL0C 5K8PA 3QRQA 3IAM9 4OI3A 3D1OA 1VQ4S 2HHWA 4CWBA 5IWAF 2VODA 2FZKB 2A10A 5KG1A 2QSFA 1YHQS 1QAYA 3DLGA 2HIYA 2IM2A 4FF2A 4B3SJ 1GAOA 1WUUA 4H54A 1N88A 4DV3J 4ES3A 3TARA 4HI1A 2K8GA 2XULA 2HQDA 1T0TV 1KEKA 3NGRA 2H65B 1FDDA 4J9NA 2UXDF 3BKFA 2AEFA 2BACA 1YBAA 3BGFA 2V68A 1SH2A 2XYGB 4HVZA 4K59A 1UP1A 4J9UE 1X31C 1UZDA 5A6WA 1WSVA 1OIAA 1SJRA 3MMAA 1AZSB 2XSFA 1HQUA 1REVB 3MCOA 4GRSA 5KFGA 5M2PA 4X64F 3MPDA 1JJ2R 4W90B 1GH8A 4N41A 4C8YA 1RWMB 5DDQC 2X1AA 3EZUA 2VG5B 2HBQB 3DLEA 1VQ8S 4NZ7A 4KR0B 4K4XA 3KKFA 4CO4A 1NKEA 5E3AA 4EK2A 5SUHA 2MKJA 2X7IA 1S1WB 1J5EF 1FJGJ 4JI8F 3SBMA 5E3PA 1PAEX 1C4CA 3RR8A 2PEHA 4K4YA 3GCXP 3HVAA 1NPRA 1HR0F 4EYIB 4ZJQA 3KLHA 3PW5A 4FZVA 1JLAA 5CYMA 3HDSA 1WOOA 3H8YA 3W8PA 2HEKA 1U1QA 3BSOA 4LT6A 1WI8A 1RAFB 2ZH4A 4P75A 5KFKA 3C46A 4KFBB 4GVLA 5DZ7A 4ZVOB 5B0BA 3OTDA 4WZMA 2JEFA 1F5AA 2HNZB 2OPSB 5E3CA 2GS8A 4LR9A 1WTBA 2ALZA 2GVZA 3T9ZA 3F56A 3V6HA 1RI7A 4J9RA 1WG5A 3AOAA 4O44B 4DQSA 2RKIA 2W9CB 4TU9A 1SKUB 4OHWA 3WHIA 1TKTA 2DNGA 3R7SB 3PYEA 3MUTP 3GFYA 2X3DA 1D1UA 5C5JA 1RWPB 2DPIA 3Q23A 1XK8A 3ET6A 4RW9B 4RUAA 5D0RA 2RS2A 3PKYA 3G82A 2R4FA 5CYQB 4NWBA 2BKPA 3KHHA 1L3TA 2F65A 2I38A 1QTMA 3L7PA 5BYRA 1SL2A 4DL3A 5KFDA 3LOUA 4GKKJ 4DOZA 3KJVA 1UWBA 5ETQA 1JLCA 3BQ1A 1HYSB 1XR6A 3CB4A 1BC6A 4URSA 3M8WA 1S9EA 3PACA 4DU7A 4RL1A 4B9NA 2XGQA 4NRUA 3NGSA 1E6YA 3P4UB 1GT8A 4C48A 4NI2B 1S1VB 4DSKA 4AT1B 2CPIA 4PCQA 4ERDA 1XMOJ 4F0KA 4E2FB 3N9UC 4ED7A 4JI7J 2OEJA 3RYLA 5L1IA 1R8AA 5GMEA 2RHSB 1CJKA 1G3OA 2YWEA 1Q8BA 1IBKJ 4TLRA 3EDRB 3GV7B 2FJVA 4MIBA 4QWDA 1FE0A 1X9SA 3O5TB 1TL3B 2Q6CA 3WC2A 1P27B 3HJFA 1FK9A 5THWA 4DL7A 1B7YB 2BKNA 1JIHA 2HGNA 4DSJA 4C4WA 1EETB 1N52B 3DOMB 3FMBA 2HMIA 1HBUA 4J91A 1D9FA 4FXWA 3R6GB 3OR1A 2AF6A 1SVDA 1CEZA 2ZOMA 4A8KA 1RTDA 4Q8FA 3IRXA 2H9ZA 1CQMA 2MQOA 3H2UB 2LECA 2YNFA 3BPSP 1IBCB 5CZVA 4KC5A 1M1KT 5K14B 4LF5F 3U27A 2RE1A 2RMLA 1P9QC 2RVJA 3JYTB 1MROB 2EWHA 2AD9A 2B9YA 3KMQA 1XMQF 4LF7F 4LUBA 4USUA 4YMEA 1LWFB 3SQGA 5C25B 4OJGA 3DOKA 2AYMA 2QL5B 2VC1A 4LF9F 4V19X 2QMXA 3QSYB 2NXJA 3VVTA 4QOTA 5DQGA 5KFIA 2JC1A 2IJRA 2N7CA 1DAXA 3U1NA 1ICEB 1REGX 4DV2F 1B99A 5ETPA 3OW2R 4B9VA 2DHGA 1DARA 3EUNA 1A7GE 3D1HA 2JNJA 2DGTA 2KXHA 2HS0A 1DQAA 4O3OA 4EMDA 3FZBA 1SKRA 4RWXA 3G6XA 1RHMB 2JJ4D 2Y1LB 1UFWA 5HQLA 3BS9A 1IBMJ 2RQ4A 3UN3A 1YKWA 1SKWA 4BLGA 5KFBA 4JI4F 4DHVA 4JYAF 2ZHAA 4V1Ak 2LEAA 2RD5C 3HT0A 4I2PA 5DM7Q 3EPIA 5EGYA 1ZAVA 3W2VB 1HW8A 2YWHA 1EKRA 4DSEA 4NLPA 1NDKA 4JV2A 3SMZA 2UVWA 4RW6A 2D1CA 4QR2A 4X4OA 3MFIA 1S6PA 5DG8A 3AA9A 4RW4A 3J7ZT 3K5MA 2W7PA 1HBNB 2AJ0A 3QJJA 4NYZA 4LF4F 3IBCB 2EC0A 2KRRA 2F4VJ 3CUNA 4NYOA 5A8WB 2G2YA 4DV5J 4FYWB 5HVFA 1F9EB 1HBOB 1HLWA 3BM7A 1RAAB 7FD1A 1VIXA 1HNXJ 1YRXA 3LP1B 4CI0B 1C0TA 3ZZOA 3CCLS 3OTCA 1NK7A 2GZOA 1KS2A 3LPYA 5L1JA 2WW4A 3GFXA 4XTTA 3W9HA 4F36A 3DNCA 4F0MA 4C8OA 4KIAA 3TA1A 3CJKA 1Y5LB 1S6QB 2CJ9A 2BJ7A 5EN1A 2A18A 3QO9A 4OYPA 5IXUA 2LDYA 5HANA 6FDRA 3FBCA 2MTLA 3BR8A 1SJQA 3PX4A 2C3OA 2CQ1A 1C1CA 3J81U 4YDDB 2VG6B 5D4LA 3H25A 1RCOB 2XCPA 1SJ3P 2BE2B 2BYCA 2C3PA 1H7WA 4CCHA 4B9LA 4HTJA 5ETRA 2C2KB 3GYXB 5F3TA 5D0GA 1FHTA 5CA5A 2ZC3A 3MAAA 4PZVA 1IR0A 5M2RA 5CHCB 1VGYA 5KOWA 4WU2A 3HHLA 3PEHA 1DY3A 4MKBA 2HQGA 4B3MJ 2D9PA 3VR1A 3VAGA 1V5VA 1Q7LB 4USIA 2IVFB 1LWCB 4OZLA 3ZZYA 2VASA 2C2MB 2E1PA 2VFRA 2MLZA 2W01A 1NHUA 1NSAA 4OYZA 1ZOTA 2QMUB 3OSNA 2J7KA 4DL4A 4KPYA 2OPQA 1RT2A 4F04B 1XIQA 1F2HA 5IWAJ 3TO8A 4NCBA 4QZVB 4RUCA 4DV1F 1UVLA 3VGVA 4B9UA 5EX3A 1NZAA 1YGYA 2UXCF 1DRZA 3T9NA 3CJ3A 1D9AA 4AL7A 3QZ8A 1KHVA 1BE4A 3UVJB 2E9RX 4RBTA 4NA2A 5HMWA 2O67A 2OD6A 2UXDJ 4OI6A 4CDIA 1VQLS 2POKA 2GHVC 2BDPA 3BDPA 2DISA 1GMWA 4OV1A 3RBXA 3WBZA 4PQUB 3NGTA 2GA7A 3L4BC 3MF5A 4OFZA 3J7AN 3D67A 3TZWA 3MD3A 3GE9A 1FWLA 2WSCC 4PWDB 2E66A 1HPZB 1RT3A 4G1IA 2XS7A 4I7FB 4BDPA 3DN9A 5AE1A 1M90T 4X64J 2Q6BA 4M5IA 3NS6A 3VAMA 4X4UA 2VHGA 4NL5A 2WB4A 1VBXA 2R7UA 3MR3A 1JLBA 1VCTA 4NXMF 4LSNA 3HX9A 1Y10A 3DLKB 4ZPDA 2V67A 4DFMA 2HFOA 1XEZA 2DRAA 1OS5A 2BANB 2N82B 3CD5A 3KK1B 4QU7A 2EFNA 1VBZA 2DY9A 1S76D 2A1BA 3CEDA 3I0RA 3JS9A 1FWKA 2DD8S 4K4WA 3OFHA 4QIGA 1OQ3A 1JKHA 1U47A 3I56S 4IFYB 5C2GA 1LQ9A 1MG7A 4DUTA 1GTHA 1WWHA 4CLYA 2UUTA 1UW9A 2W1BA 1SJ1A 3M8QB 5J2NB 2AGQA 3GONA 3MM8A 5IFMA 5KFLA 1TAQA 3CNQP 1WKLA 3FJ2A 1DBDA 4P72A 1N4LA 2KG0A 1YDLA 2GGPB 1C0UA 1RWXB 3D9BA 5GAEI 4NLDA 2KG1A 3RBEA 5HQMA 3OVAA 3LP2A 4YN3B 3FEZA 1FRLA 3J81j 1JK9B 3QIDA 4Y2KA 3W62A 2XMUA 1V9OA 4IQMA 2BE7D 4F8RA 5F41A 3V6DB 1BXNA 1ZTWA 2V0NA 3KLGB 1QUPA 1UEUA 1DTTA 4F0HA 3W2WB 3WIUA 3WQPA 2QG9B 4LFCJ 3DYAA 4ILLA 3B4DA 4F7VA 3BQ0A 1ZAXA 4WXOA 3OFGA 1AA1B 2ZZMA 1F0XA 4UTGA 3Q2SC 3IS9B 2FC9A 1K0VA 3IN5A 1PSDA 3ISZA 2VONA 4ILRA 4B02A 2HBYB 4NLRA 4D3GA 5I3UA 3IFEA 1Y5NB 3GIMA 1H2TZ 2YWFA 2QTWA 1T02A 5IV4A 4CO1A 2D3OR 2MKCA 5L38A 1KKHA 2IYIA 3FKBA 4F50A 1OY6A 2FZGB 2KZZA 2LVWA 2R2UA 4F4ZA 2LKZA 3M2VA 3MEEA 1HD0A 5J2QA 2W4CA 2VPXB 2CG4A 1S4EA 4M8LA 3BGRA 2PN6A 3ILIA 5E7OB 2ZD1B 3IA0A 3Q8QB 2B8QA 4B9TA 3CJ8A 1UEVA 4RX6A 2KT5A 3QZ7A 3JSYA 2X51A 4BC7A 5B09A 3DXBA 2FLLA 1F3FA 4KHRA 2C1EB 2NR0A 3Q2TC 2YH1A 4NASA 3TANA 3OJUA 2WONB 3K57A 4J9QA 1EZZB 2HNYB 3TA0A 4ZPCA 4QIFA 3X3UA 3BYRA 1FXRA 2AHOB 4WWSA 4LF9J 3CJTA 4TLQA 4HH1A 2PMWA 5F8MA 3DKDA 4ICLA 3HFVA 2B4OA 2C28A 1GXTA 4C11B 4OX7A 1F5CA 3C16A 3QGHA 1XNRJ 3N6NA 4USJC 2WZ1A 3HSZA 2FHMA 1Y11A 1DZ5A 3K2YA 1H72C 4XK8C 4YR2A 1SUQB 2NLWA 2VIHA 1IKXA 2PD1A 4OZ1A 1ZA2B 5KG4A 3PR5B 3QLHA 3S8SA 4BWJA 4NLXA 1HQEB 2VQEF 1UAWA 5AE2A 2WHOA 5J1EB 3QNWB 3D7SB 2C2DA 2F7VA 1OY8A 4IH6A 1U2FA 5JJBA 3RRGA 2ZZTA 1KVIA 1EP4A 4OHYA 1UVKA 4N76A 4P2XA 3DMJB 3AA8A 5BJRA 4OZ5A 1FERA 2AJ4A 4LF4J 5KG7A 4DS4A 2F5GA 1NK5A 1Q78A 4CLPA 2MKSA 2RDJA 1UVJA 2FY1A 1S9GA 2OPRB 2K7JA 3M9OB 2HFZA 3G96A 4G1QA 4FYDA 3N4WA 2R7XA 2JWNA 4ZK7M 3GP9A 1QLNA 3PXGa 1L3VA 1JB0C 3ILLA 3MEGA 1SI9A 1UPMB 4O4GB 4V19J 1GFWB 2IM1A 2ADBA 2MHNA 3V4IB 3TQ1A 3CMES 3BV8A 1V3ZA 1KBRA 4DCPB 2DXDA 2V8HA 1L3UA 1KLMB 1QE1B 2FB0A 5H9FK 1ITPA 2E9TA 1YTYA 2M3DA 1MMLA 1RAJA 2FVRA 4LRFA 3F0NA 4LR7A 1Z2ZA 1S99A 4DV4F 1IKVA 3LGMA 3CD7A 2N3OA 2B0GA 3EVMA 3VZHA 2XMWA 4C8MA 2EFQA 2J0QD 2L3MA 3LO3A 2XZDB 1C2PA 1M1GA 3GG0A 5KG6A 4JV1A 2B4VA 2KHCA 2M8HA 4MIWA 3SCKE 1VQNS 2XHWA 2YWKA 1Q0NA 3C2PA 4KKOB 3FCWA 1CC7A 3WDOA 4L6V3 3UDVA 2U1AA 3D6FB 4URQU 1VQ7S 4UY8T 4QIEA 4H4MA 3FCVA 2U2FA 4JV0A 4DV7F 4WKRA 4LRAA 4I67A 3U7JA 3MMCA 3OXLA 4CLWA 2AJ1A 3PEJA 3ZO7A 3PW2A 3DGPB 2GIRA 3HVWA 2M8DB 5IV3A 2QA1A 2AZ1A 2CJAA 2B9WA 2APOA 4HL9A 3J81Y 2DH7A 2QYGA 1LKZA 3O6QA 4KTQA 1G7CB 1R0AA 4PQAA 2SXLA 2KYZA 3KJNB 4NXNF 4RBUA 5GAGI 2ZVIA 2F4FA 4A46A 2JLFA 4ECUA 3C6UB 3DRXA 3PKMA 3R1HA 1C1BA 2BOPA 4HH0A 2XYHB 4ZVGA 1LW0B 3UCZP 2HK2A 2W9AA 4CLZA 3R5AA 5DS7A 1R0BG 3IP0A 5HLFB 1RK8A 4JUZA 1PCAA 1OYEA 4FYYB 1GMVA 4DUZF 4Q5VA 4X2BA 3I5CA 3EVWA 1VHIA 4DX6A 4DR7F 1IKYA 1TL7A 1KLNA 4H4KA 2NXUA 3OTEA 3MECA 2JSXA 1FRXA 5HN0A 2N4CA 1HKAA 2WW8A 3K5OA 1X4GA 2RQCA 2MEWA 1TVRB 4IFVB 1YBTA 4KQZA 2HHHF 1HBMA 2BE9B 3NG8A 3UD5A 3RU0A 4ZP9A 2CJYB 4RNOA 3ADAC 4RUBA 2FDNA 3CJ5A 2YNGA 1ZBTA 1NB7A 3X1LB 2ILYA 3DRPA 2UUWA 2RILA 3ZTPA 1AW0A 3W7BA 3HP6A 3I6PA 3LANA 2HWHA 3GU0A 2EW9A 2NPFA 3R9LA 1XMBA 3CCTA 1ACMB 5EX0A 1M5VC 1U0HB 2GIQA 1LFWA 1Q7YT 4KYZA 1SQFA 2HNDA 1I94J 1P9YA 1ZAWA 1YWXA 3MMJA 1HL6A 3NBPB 1O6XA 5KT5A 1J5OB 3BGLA 3A3PB 1NUEA 2GQCA 4L74A 1HA1A 1U24A 2VDHA 4IRCA 4RR5A 2RAQA 4X62F 1Q82T 2X1BA 4ELUA 5A0YA 1YJVA 1LWXA 1FT8A 1BQNA 2XM3A 2G0CA 4ECVA 2Y1RI 3AD9C 5EWFA 1TL1B 2AZ3A 2GC8A 3ZZUA 4ED0A 1REVA 1S97A 5CYJA 2F9DA 2J9EA 4LF8F 1L5UA 2G4BA 3J7A1 5LT5A 4ZP7A 3H20A 2B8PA 1O51A 4PABA 2VG5A 4AD6A 3M2RB 3EXCX 4E8UA 2HHUA 5DRKA 4X84A 4FKYA 3RBDA 4TU8A 4UQTA 3M8PB 2PA8D 3H90A 1HWUA 3MUMP 3MM7B 1NJZA 1A9NB 5DDOC 3M32A 4LF6J 4ECYA 1S6OA 1U49A 2QLWA 4YEAA 3IAS9 1KQGB 3CCQS 2JL9A 2PEBA 4F4KA 1UA0A 3KLFA 3FBBA 4RW8B 1VI7A 2E1RA 2VFUA 1T9WA 4DX5A 3UE2A 2VH7A 2M9KA 4X65F 2UXBF 2CPDA 2CNKB 1NU4A 2HG4A 1N56A 1NJYA 3HKWA 3W5XA 2WCXA 2CPXA 4LR8A 2ZHOA 4ANDA 3CDUA 1RA7A 1FE4A 2ASLA 4KFBA 1RYRA 3B54A 4G65A 3TYTA 2VV5A 4N77A 5KOXA 4LSZB 2W2NP 2HNZA 4U7CA 3QFWA 3ZZ0A 2W8LA 4NLSA 2R7SA 1RTJB 3VALA 4IUFA 1IKWB 1VK8A 2AT1B 3DOLA 2L08A 3EDQB 5FLXU 1NSKL 4O44A 4PWUA 3TVZA 2W9CA 1R8PA 3AXKA 5B0FA 4DUYF 4P6QA 2CIMA 4CYUB 2P6SA 3CIZA 2E9ZA 2CPZA 2I6WA 3V6JA 1S6UA 4C2MA 1SC1B 4NLUA 5CCMA 1WF0A 4IG3A 2CQ4A 4OQJA 4NA1A 3T1HJ 1R0CB 2GIFA 4Q43A 2B4UA 2OFHX 2IC3B 4ZJOA 3D0IE 1BQMB 2ALYB 3KK2A 1SBRA 2C3MA 3K5NA 1HYSA 1FO1A 2BJ1A 2N7YA 2QIFA 4O3QA 2EVZA 2NQPA 2GV1A 1Y3KA 1URRA 1SQEA 3A3NB 4X4PA 1W2BR 5KT6A 1JLFB 3JQJA 3H40A 2QYCA 2LP4A 3KHRA 3W3SA 3NCRA 4F4XA 1W26A 3M8SA 1V3SA 1F2GA 2HHSA 3QGGA 1P1LA 1TL5A 1TFYA 3GR0A 3W5ZA 4USMA 1D8YA 1H98A 2DGUA 2QA4G 1E6VB 1BWVA 4OX9J 4DL6A 1VRUB 2ZHBA 1TL3A 4B9MA 4IKAA 1H73A 1UA1A 4DG1A 4J9LA 2MZSA 4LF1A 3OLBA 2KT2A 3GYNA 2J6SA 1CJVA 1EETA 2P9EA 3RB0A 3DOMA 1T11A 3KUGA 1FDBA 1RLDA 1U0SA 4DXLA 3D2WA 4LFBJ 1X5SA 5A8KB 5GAHU 1EIYB 3LP0B 4OL8A 3KLVA 2QLJB 3GFHA 5D4NA 1JX4A 5HATA 2I0XA 3AB2B 1I51B 5K14A 4H4OB 2M5YA 4KO0B 4AL5A 4ZKAA 3JYTA 4ID5B 3AAWB 1MROA 3MTKA 4I2QB 3CW2C 3HK2A 1YJUA 3QRRA 3MURP 4UQGA 1Q1KA 1KDNA 2ZJPQ 2Y0SD 2FIUA 1LWFA 4FBUA 1ZH5A 4FPRA 4EBDA 1PJ6A 3RUBL 2QJ3A 4WFXA 1Q5YA 2KFZA 3O1LA 2HQ3A 4PG4A 2HZVA 2R7WA 1LXJA 4TY8A 4R0JA 2V50A 1S1TA 2AEJA 2BQUA 2CQDA 1YJ7A 2E5GA 2J8AA 4ZVUB 2V2QA 3SCLE 2VZ9A 2HFNA 4ZVQB 5D8HB 1P8GA 2IAJB 3NAHA 2C2ZB 4MKAA 5KAKA 1NK0A 2DNQA 4JV5F 1K1QA 2G0JA 5DM6Q 5IT0A 3AOCA 2RHQB 3KDOA 4WP8A 2QX0A 3R5CA 1U7LA 3HO1A 2J76E 4QU6A 5CABA 3ILOA 2DNKA 1OJ4A 3I9V9 3CO9A 2HVZA 1LK7A 2QN6B 2YNIA 2RF2A 3CDBA 4C97A 1KRPA 5BR8F 5KFFA 3LTOA 3NXZA 1WKJA 4MYTA 2VC0A 1N32F 2VG7B 5ETKA 3J7YI 2EPIA 4DSFA 5LJ5Y 3VVUA 2CXEA 1D3WA 1HBNA 3P3DA 2XWXA 1OMSA 1DTQB 2YKPA 4G6VB 4JI3F 2F1FA 3A3OB 1QVFR 4ED5A 5A8WA 3HT3A 1VRTB 2JOQA 2LXUA 3NMRA 3HI9A 4KGVB 1GQEA 4MFBB 3KDNA
chains in the Genus database with same CATH topology
1HFEL 2DJWA 3GZ7A 2OJ3A 3OUYB 1DHMA 4HKQA 1B64A 2C42A 1R0AB 4PXEA 4IO9Q 2CQ2A 2N7CA 5KT2A 2UUBF 3THVA 3QWPA 1DAXA 3U1NA 1I1GA 2ZDOA 4RLEA 5JUMA 1U4BA 4DV2F 2D41A 1N48A 3M6XA 2AX0A 5DQHA 4OX8A 3OW2R 4CH1A 4B3SF 1Y00A 4B9VA 2DHGA 1DARA 1WACA 1KSPA 2HS3A 3EUNA 2ZITA 4J5OA 2MB0B 1A7GE 3D1HA 1NJWA 2ZM6F 1N6QB 2B7CB 2DGTA 1FK9B 3FFIB 1C1BB 3DDNA 2KXHA 1BGXT 2IVMA 3CCWA 2HS0A 1DQAA 4O3OA 2VUGA 4K5SA 4C8NA 1IBLF 2XNQA 4WFAQ 4EEYA 2ZDPA 5B0CA 3FZBA 2OKQA 1SKRA 4I56A 4RWXA 3G6XA 3M6UA 1FJEB 2JJ4D 3IBWA 2M7SA 4CQ1A 3GIKA 1UFWA 1WNEA 2I1RA 3NWGA 2HRUA 2W9BB 4K4VA 2VL1A 4AQYF 2HMIB 2JC0A 2MQPA 2XLIA 2HHVA 3BS9A 4O3RA 1SL0A 2RQ4A 4ZDNA 4ES2A 2CQHA 4EU0A 3SI8A 5J2PB 1N5YB 3OR1B 1SKWA 2KFNA 3MM5A 4LVOP 5HMYA 1HWJA 2E5JA 1SUQA 2UU9F 2CKWA 4NPOA 5KFBA 4JI4F 4DHVA 4JYAF 1TL4A 2ZHAA 1TFWA 5HBMA 4A8XA 1RTDB 2PMHA 2LEAA 2RD5C 3P5TL 1RT6B 2E29A 4PKDB 3IRXB 4I2PA 2HHQA 5DM7Q 2L9NA 2KHDA 2E1MC 3K5PA 5J2MB 2VG6A 4IYQA 1JLQB 4PXBA 5KFVA 5EGYA 3EPIA 1ZAVA 1S7HA 4QW8A 3W2VB 3T5LA 1UVIA 1HQEA 1HW8A 2YWHA 2C3UA 1NKBA 2NS1B 4DSEA 2BE2A 4NLPA 2YNFB 3DLLQ 2H5EA 2VFSA 4F4YA 2GO9A 2NPIA 5HL7Q 4JV2A 4H4KC 3SMZA 2UVWA 4RW6A 1JNRB 2D1CA 4QR2A 2DBBA 2ZH3A 2YNHA 3CC4S 4X4OA 1T05A 1FEEA 3F41A 4Q8EA 4I0WA 4NOHA 3MFIA 2OO4A 1S6PA 1X5PA 5DG8A 3CC7S 3UWTA 3KHGA 4ZHRA 3AA9A 4RW4A 1YSJA 3J7ZT 1V3RA 3K5MA 2FLOA 2W7PA 5DO2A 2ASDA 1HBNB 2AJ0A 1FRKA 4NYZA 3QJJA 5C42A 4LF4F 3TA2A 2EC0A 1S1XB 2KRRA 4AXIA 3CUNA 3D0GE 3PY8A 3DOKB 2L9WA 4NYOA 2YNGB 5A8WB 2LEPA 2XY6A 3T1HF 3R3TA 3US5A 3DRPB 3PDNA 4NYPA 1RWUA 2J9DA 3KLIA 5A8RA 4R8UA 3ENQA 4EZ9A 2RIJA 4EYHB 2AQ4A 4F02A 3IRWP 4DR6F 3VQSA 1HBOB 1ZZNA 1T03A 4KGKA 4A8YA 1JLEB 3BM7A 1S72S 4PUOB 7FD1A 2XGPA 1FJGF 1VIXA 4PR6A 3KMSA 1IJEB 1LXNA 1YRXA 2D74B 1M5OC 1LWCA 3LP1B 4CI0B 3VWSA 1C0TA 1KC8T 3QJLA 3ZZOA 4N8OA 3CCLS 2MMYA 3PIOQ 5T7LA 3OTCA 2NUHA 1NK7A 1N5VA 2BV3A 3HPOA 3RW6A 1KS2A 3LPYA 1XNQF 1FKOA 3G86A 2R8KA 3M05A 5L1JA 1UVNA 3THTA 3JAMY 2OAUA 4OI4A 3GFXA 4Y00A 3R5BA 1N36F 4GC7A 2HNDB 4HT5A 2CQ0A 3DNCA 2I5JA 1S79A 2YKNA 2UVUA 4ED6A 4KIAA 4C8OA 4RU9A 3EGNA 1ROFA 3TW0A 3TA1A 4IH5A 3MPVA 4WYLA 5E2QA 3CJKA 4DJBA 2DHSA 1P1TA 1Y5LB 1VFJA 5FIIA 1MSWD 3NRBA 1QSSA 5F9NA 1S6QB 2RDIA 2CJ9A 5EN1A 4EFAC 2ERRA 4NCGB 2A18A 3QO9A 5F8NA 1KONA 5IXUA 4QPTA 1UMJA 1X4CA 2LDYA 4MYUA 1FCAA 4F25A 1QAJA 3M1VA 2VBZA 6FDRA 2V94A 4GMKA 3BR8A 5I3QA 1Z2LA 1SJQA 1TP7A 2C3OA 3IGVA 3D54A 2KU7A 3BO3A 3PX4A 1X0FA 3IWNC 2MKHA 2P6TA 2ZH8A 2A2CA 2CQ1A 1BY9A 1C1CA 2B51A 2DR9A 5A0YB 4O3NA 4OX9F 4MK8A 4C8LA 4YDDB 1DQ8A 2VG6B 1BQNB 1MMDA 2R7QA 5D4LA 4WFBQ 3H25A 4ZP8A 3V4IA 4E0DA 1WELA 5DG7A 1FRMA 2XZWA 2XCPA 1SJ3P 2BE2B 5A6PA 1SV5A 2AJQA 2Q3PA 5LMUF 1FVQA 1PC5A 2GNKA 1KLMA 2IMOA 1FJ7A 3BB5A 4DR2F 2BYCA 2C3PA 1H7WA 1QE1A 1U25A 4CCHA 4NLTA 2DK2A 3BSNA 2FVQA 2JFDA 4B9LA 4HTJA 2HZCA 1T05B 3GYXB 2GW8A 1DFDA 1KVJA 1YQHA 1S6PB 2F40A 4MIAA 4Q44A 1HHSA 5LMNF 5F3TA 4ZHRB 2F8HA 4RW4B 1RTHB 3SDEB 3CIMA 1NNDA 5CA5A 1FHTA 2ZC3A 5C42B 4PQUA 3OJSA 3V2UC 3T5KA 1H38A 4G1PA 3AY0A 5LL6d 1IR0A 2RU9A 5M2RA 2CPJA 2M0GB 4HT7A 4OZNA 5CHCB 1VGYA 5KOWA 1NJIT 4LFBF 5ITHA 4K4UA 4WU2A 2ZH2A 3KLIB 3ZZPA 3HHLA 3N0VA 3PEHA 4MKBA 5D4OA 1HPZA 2RRAA 2D9PA 3DHXA 4ECSA 2KT3A 2P5VA 1NAQA 2R2SA 2NSCA 3VR1A 3VAGA 5A2QY 3M32B 2YKAA 1Q7LB 4USIA 2IVFB 1Q53A 4M95A 5MAOA 3HZEA 1SH3A 1LWCB 3U1MA 3J80Y 1VC0A 1C0TB 2IVYA 4OZLA 3ZZYA 2RU3A 3PM9A 3PW0A 4WF9Q 3RTVA 4OIXA 5KT7A 2VASA 1FRHA 4DDFA 3HHNB 1Q4RA 1Z1ZA 2VFRA 3MMBA 1TK5A 1NHUA 3H5UA 2BVZA 2UV8A 3U02A 3KLFB 5KFJA 3H4BA 1R6YA 1ZOTA 2EFVA 3OSNA 5KTQA 4M5DA 1RTIA 2J7KA 3ZZRA 1TKXA 3F73A 4DL4A 4KPYA 3JSMB 5JVGQ 2Z2MA 2OPQA 1RT2A 2I5JB 3V6KA 3DLKA 3DM2A 2YKNB 4L3NA 1X4AA 3TR5A 3TNVA 2Z0GA 1M5KC 4F2SA 3TO8A 4NCBA 2NSBA 3CJKB 1XMOF 4QZVB 3E01A 3QJPA 2BANA 4ECRA 2BRKA 3KK1A 4ED8A 2QT7A 4RUCA 4TY9A 4DV1F 3ETOA 3OHBA 1UVLA 4L72B 2FD2A 3A1YG 3I5AA 2MGZA 3TAQA 5F8LA 4B9UA 5EX3A 1NZAA 1YGYA 3WC0A 2VQFF 2UXCF 1WHWA 1DRZA 2PI4A 1CVJA 3CCVS 3RRKA 3T9NA 1M5PC 3CJ3A 1D9AA 1RT7B 2B6AA 5CQGA 1FRIA 3UI3A 1H3DA 4AL7A 3KWMA 3QZ8A 3EPGA 1KHVA 4Z37A 1XTZA 1IBKF 2XSJA 1FD8A 2KJWA 3JB9k 1C1CB 4J9OA 1HARA 2BXJA 2AX1A 1HWKA 5ADZA 4CNZA 4FNHA 4OLPA 2E9RX 3DOLB 3HF5A 3ONQA 4LJMA 1VLYA 2HWTA 3TP2A 2VB6A 4DQPA 2DR7A 4CH7A 2XMJA 2GMLA 3KG4A 4IFYA 1PILA 5E3QA 3CDEA 4ID8A 2DNNA 4RBTA 3R1LA 1SV5B 3M2UB 4ZCIA 3E2EA 1FJCA 4YUDA 4FVMA 4NA2A 1N0UA 1TQLA 2LQ9A 3M4XA 2Q79A 2O67A 2OD6A 3LAMA 3MMAB 5HMWA 1QAIA 5HQ8A 2EK1A 1QVGR 2E7XA 3M8QA 4OI6A 5J2NA 1ZTTA 3N5FA 3PW4A 3PV8A 1M5SA 1VQLS 5F0UA 3GV8B 3BR9A 1S9FA 4LMZA 1OPZA 4MKYA 2POKA 2GHVC 3C6UA 2BDPA 3BDPA 2DISA 1FTCA 5DQIA 3FRYA 4OV1A 3RB3A 2XBPA 2JRSA 3WBZA 3OL8A 4PQUB 2GA7A 1U6FA 3MF5A 4OFZA 2DR5A 5CZXA 1J2VA 4EWTA 1F5BA 4IG3B 1H0HB 1DJ0A 2ZBIA 3MD3A 2ROGA 3GE9A 2BBEA 3BSCA 1FKPA 4JI6F 2WSCC 4PWDB 3SXLA 2E66A 3J7YU 1HPZB 1RT3A 2CZVC 3QAUA 1IJFB 3CSKA 4G1IA 3DN9A 4I7FB 5KFAA 5AE1A 1M90T 2FVPA 4BDPA 4R25A 3H5XA 2D7SA 1DLOA 1IN0A 1RP5A 2Q6BA 3V4MA 5HLFA 3SV4A 5KFUA 3G6ES 3NS6A 3VAMA 1RA6A 4X4UA 2IRUA 1S0OA 4HEA9 1MU2B 3IXQA 3KK2B 4NL5A 4E98A 1SH0A 2V9KA 3PVXA 1QSLA 1KFSA 4KHPF 1X7VA 3OL9A 1XR5A 3BN4A 2R9LA 2YKOA 4A8SA 2WB4A 1VBXA 4D3HA 2R7UA 3OQ2A 1VQPS 3T19A 3MR3A 3FQKA 1JLBA 4NZ6A 4KAIA 2XO7A 4K50A 2L9DA 4PXDA 4NXMF 2GO8A 4K0KF 2BW2A 4LSNA 1VQKS 1YVFA 2PC6A 3KLHB 4M5DB 3ZC4A 1TKXB 3HX9A 3V6DA 5KG5A 4RWWA 4B08A 3DLKB 2RRBA 4BBYA 4ZPDA 2KM8B 1HI1A 1QM9A 2VPWB 3FMWA 4DFMA 1CLFA 5D6GA 2HFOA 2QE5A 3KLGA 1XEZA 2JVRA 2PA3A 2ZH5A 3CCUS 2DRAA 1OS5A 2FLNA 2BANB 5HO4A 2N82B 3CD5A 3KK1B 2R8GA 1K0TA 2EG1A 4QU7A 3G6VA 2EFNA 4C98A 5AE3A 1VBZA 1ZM3A 2ZH7A 2DNHA 3DFEA 5I4MA 1S76D 2A1BA 2MGZB 3CEDA 3I0RA 1U45A 5KG0A 1TKZA 1X5OA 3C66A 2PFFB 3DRRB 4QCLA 5HMZA 3MPWA 1AFJA 3I0SA 4WKYA 3C3LA 2DD8S 1H2UX 2B6AB 2XS2A 2OSQA 2XCAA 3BF4A 4AFFA 4K4WA 2VOOA 3V5RA 4DX8H 3OFHA 4NLOA 4TKTA 4QIGA 4TXSA 4LSLA 4CO0A 3N28A 5IM0A 2XSJB 3MZIA 3HZGA 5HP1A 1BLUA 1OQ3A 3RRHA 3IS9A 4QPXA 1S0VA 2O1PA 1JKHA 4JI2F 1UFLA 4CTAA 2E5LF 1RQ0A 3PRBA 2ASJA 1U47A 3I56S 3CCJS 4IFYB 4EO8A 1LQ9A 2RKIB 2N4DA 1D8ZA 5FLXY 4FVCA 4Y65A 3A8EA 1YRTA 1TAUA 1TKTB 1GTHA 3LAKA 4DG1B 2HVIA 2FUG9 1WWHA 5CXTA 2KZMA 2UUTA 3M8QB 5J2NB 1SJ1A 2AGQA 1NK8A 3OFEA 4UY85 2KKHA 4QBUA 3D0HE 2A2DA 1X4EA 1G6BA 4KBIA 3CF5Q 4RU2A 1CPZA 3MM8A 5IFMA 3HHDA 2FJBB 1U6ZA 5KFLA 2MQLA 3TOQA 1S10A 4I6YA 3UFCX 1TAQA 1MW7A 2CQBA 2ROEA 3FJ2A 2QLXA 3JTPA 4DFJA 5F8HA 3N6LA 2LU1A 3CT9A 1DBDA 5AXKA 1N4LA 3AH6A 1FKPB 2KG0A 4EO6A 4RBVA 2GGPB 4YB7A 4J9SA 1RT3B 2EBGA 5K9FA 1C0UA 2L41A 3NBPA 4QQBA 1DLOB 1J5OA 4PPDA 2MZ1A 1C4AA 4A8MP 3HHKA 2LA6A 5GAEI 1UWBB 4NLDA 2LCWA 2KG1A 3RBEA 2C2RA 1JLCB 2YKMA 2HW3A 3OVAA 3OR2A 3LP2A 3NNCA 1Q79A 5G4DA 4GC6A 2R7RA 3GR1A 3E3XA 2N3LA 2ZD1A 3FEZA 1FRLA 1JK9B 3QIDA 2A3JA 4Y2KA 4Q0BA 1FD2A 2FTRA 2XMUA 3UQSA 1S9EB 4KE5A 1V9OA 2YKQA 3L09A 4KJIA 3EGZA 2CQGA 4IQMA 4UOCA 4B9SA 4F8RA 4A4JA 5F41A 4JI5F 1E6YB 2I8EA 3VAFA 3V6DB 1HI0P 1D9DA 4HYKA 4K4SA 4J9PA 5GVQA 1JMTA 2CDQA 4IG0A 4J9MA 1TL1A 1ZTWA 1URNA 3H98A 4QYZJ 2V0NA 1U2RA 2K2PA 3MI7X 5DGAA 2QV6A 3KLGB 3PW7A 1QUPA 2MXYA 1UEUA 1DTTA 2HGMA 5HROA 3QAEA 2KXFA 3H4DA 3W2WB 1N5QA 3PFOA 3UR0A 5E33A 1R8BA 2R8HA 4NZ0A 1Q8LA 2WONA 2EBEA 1LW2A 3FQLA 2CJKA 2HNYA 3DYAA 3PO4A 4ILLA 2V8DA 3B4DA 5CH7B 3KYLA 3BQ0A 2F9JA 2MY8A 1Y7PA 4A8OA 1ZAXA 3M2RA 5DDRC 4WXOA 3GFZA 2NYIA 3OFGA 4FXVA 2AP6A 4LSLB 1CG2A 2DPJA 1F0XA 2ZZMA 2V2KA 4TY8B 3Q2SC 3TRGA 4TN2A 1X9MA 3IS9B 3LQVA 4DLGA 1S1TB 4WE1A 3TVYA 2FC9A 4ZCLA 5H9FJ 4CTAB 4TU7A 3M8PA 4DN9A 1JWWA 3MM7A 1WEXA 4F3QA 4C7QA 4ZMMA 4NLGA 2DIUA 2VOPA 2E1AA 1K0VA 2FJWA 3IN5A 1PSDA 1LK5A 3ISZA 4C11A 2NZ4A 4KB7A 4DV3F 4EGLA 2X3GA 3CTRA 2VONA 4B3TF 4ILRA 1SB6A 2MZRA 2KDOA 4B02A 4DR5F 4YDXA 1N34F 4Q2LA 4OI1A 5B0DA 3H5YA 2GMJA 3AQPA 2JFKA 2HQIA 1XERA 4NLRA 4D3GA 4YFUA 5I3UA 1OPIA 2PDAA 3MM8B 5H1SV 3IFEA 1Y5NB 3GIMA 2W7OA 1H2TZ 2YWFA 2K1RA 2DNPA 5M2UA 1HBUB 2QMWA 3ULHA 2UV8G 3CCES 5F8JA 4ETXA 4YOEA 1V6HA 4WXWA 1T02A