3N5BA

The complex of pii and pipx from anabaena
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKVEIVVEDNQVDMVVDKIIAAARTGEIGDGKIFISPVEQVIRIRTGEKNTEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
pubmed doi rcsb
source organism Nostoc
molecule tags Transcription regulator
total genus 23
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n5bA00
3AHPA 2RD5C 4E98A 2O67A 2J9EA 5L9NA 1J2VA 3CE8A 4OZLA 4OZJA 3TA0A 2CZ4A 4WK3A 4WK1A 4YB5A 3NCQA 4CO4A 1O51A 4CNYA 2GW8A 3T9ZA 1HWUA 1V6HA 2DCLA 4CO2A 1O5JA 3NCRA 1NZAA 4CO3A 1P1LA 2E66A 2EG2A 4C3LA 4IYQA 2ZOMA 2O66A 4C3MA 4D3GA 2JJ4D 2J9DE 2VD3A 1QY7A 4OZNA 3AA8A 4CO0A 1NAQA 3TA2A 2XBPA 3M05A 5D4PA 4RX6A 1XK8A 3BZQA 3N5BA 2XZWA 2XULA 2XG8A 4NYPA 2PIIA 5DRKA 2GNKA 2NUUG 3DFEA 4R25A 1UL3A 2ZFHA 2Z0GA 2V5HG 3LF0A 4D3HA 1Q1KA 3O8WA 3L7PA 1PILA 2EG1A 1NH8A 1VHFA 3AH6A 3MHYA 4C3KA 5DS7A 5D4NA 4Y6IA 5D4LA 4USJC 1OSCA 4YB6A 4USHA 3X3UA 1H3DA 1KR4A 3HLUA 2J9CA 3NCPA 4RWWA 1V9OA 2GX8A 4CO5A 4CO1A 1V3RA 2J9DA 5D4OA 1GNKA 4RLEA 3AA9A 4YB7A 1VFJA 4ZK7M 4CNZA 1UFLA 4USIA 4AFFA 2NS1B 1NH7A 1V3SA 4Y65A 4RWXA 4NYOA 3GSDA 1UKUA 3TA1A 1UMJA 2NUHA 3OPKA 3O5TB
chains in the Genus database with same CATH superfamily
4DFJA 3E51A 4HH1A 1FKAF 3H90A 3NP5A 4DU7A 1HYSA 2N4CA 2W2MP 1UEVA 5EGYA 1SKWA 5F3ZA 3Q8UA 2QLFB 3OR2A 3ET6B 2XZTB 2FYXA 5FDLA 5KFPA 4FBTA 2BX6A 1NJIT 2WHOA 3SV3A 1UJ6A 1S0OA 1TKDA 3QWUA 1WF2A 4X62F 2YKQA 5IV4A 3L4BC 2FVCA 1CULB 3R5BA 3TAMB 5F9NA 3M30B 5KFOA 4ECZA 3CCVS 2HWHA 3DLBA 3H20A 3FEXB 4NCBA 2MQ8A 4Q0BA 2IHR1 2MSTA 1ZA2B 4ED2A 2L9NA 5F9LA 4FXWA 4ZJQA 5KFSA 3KG0A 1SPBP 2VG5B 1HI0P 2HLTA 1HPZA 1Q95G 3NG8A 3V6DB 3DMJA 1HQ2A 1VK3A 4PEOA 4OMFG 5GMKa 3D66A 1YTYA 3HPOA 1IBMF 2HBQB 4F2RA 1NSPA 1WC4A 1X4CA 4AL6A 3T9NA 2DNOA 1RWXB 3DLGA 3SSQA 5K8NA 1SI9A 1UPPA 1FO1A 1R8CA 1JJ2R 2RJZA 2NUUG 3IAS9 1YRUA 4IOBA 2Z0GA 3H4BA 4PPDA 4WYWA 4B3OA 1NLKL 4ICLA 4NCAA 3K0JA 1FDDA 1JIHA 4MK7A 3L95X 2FDNA 4O3QA 2LA4A 4GRSA 1IKWB 2FHJA 3FRYA 1X5SA 4BCAA 4M8LA 2YWFA 2CNNB 5ETKA 2YWEA 3I31A 1BMQB 4DV5J 2FVSA 1S79A 4A46A 2DO0A 3SDEA 1JMTA 3U7JA 4YHHJ 5DDOC 2HKEA 2VPYB 3PG9A 2G4BA 4LF7F 4WK1A 3P8BB 1JLQB 4PWDB 4Y3CA 3M4XA 2MQNA 2RUGA 5L46A 1QUPA 4P52A 3NGUA 3DLJA 2JEJA 2DEIA 2XMTA 5LMUF 4GO5X 2I5JA 1S76D 3LWMA 2U2FA 1YBAA 3ZTQA 5DGBA 5KOXA 1RAGB 1UFWA 2QFIA 2VPWB 3T41A 1VQ8S 1Z2ZA 2YWKA 4P74A 2MZ1A 5A6WA 5JJBA 1EZZB 3DHXA 2HBRB 1K73T 4L6V3 1PILA 3RG6A 1RCXB 2A1BA 1R89A 3S7RA 3T1AA 3FZ2A 1FJCA 4QJVA 2FHJD 4RZRA 3MEKA 4FNHA 1CQNA 1MSWD 2HNDA 4U7CA 3M8QA 3MM8B 1XR6A 2JSXA 1S1TB 4PXBA 1RT4A 3MOZA 4A4JA 2YNIB 5K8PA 3FCWA 1HL6A 2HFZA 1D3WA 1GXTA 1YWXA 5JMNA 4MT1A 4C8KA 2DRDA 3A8EA 3KHRA 1SL0A 1VIOA 2GA7A 4X65J 1CJVB 4O4GA 4NASA 4F0KA 2UXCF 3VALA 5KFHA 2QL7B 3ET6A 4BBYA 5JUMA 4P9SA 4F4WA 2IRYA 3SQOP 3A3OB 2FVPA 2G1DA 1RTDA 4UF4A 1H98A 2Y1LB 2DO4A 5KFNA 2FHKA 3I5BA 2DHSA 5T41A 8ATCB 2NYHA 1CULA 4ILLA 2NLWA 1PIEA 3TAMA 2QYGA 2KTQA 1GEHA 3M30A 4IDKB 1HNVA 1LW2B 1DQAA 4LRDA 3PO5A 2A6MA 1ZTWA 1T9WA 3IWNC 2HGMA 1RT2B 3K17A 8RUCA 4PXEA 2D3O1 1UFLA 2VG5A 2GIRA 3V6DA 3MI7X 3R1LA 3OL9A 1IBCB 4FF2A 2AYGA 4LFCJ 1X4EA 3RB3A 4JI3F 4OX9F 2UVRA 2M88A 3SSRA 4M94A 2I38A 2CQPA 3QSIA 4Z7YA 3LA0A 1S48A 1I5OB 2KZMA 1CVJA 4X64J 3KK2B 3ENVA 2A10A 2W2QP 1NDCA 5RUBA 4UOHA 2JJ4D 3BN4A 4JI4F 2FVRA 4CWBA 3OTCA 1R6YA 4K2XA 2HHSA 4QWAA 4NZ6A 1I3OB 5AT1B 1T3NA 4ALZA 1NJWA 4ED3A 2OJ3A 2Z57B 4B9UA 2QA4S 4KFBA 3P5TL 2KYZA 2MKYA 1IKWA 1X4AA 5IT9Y 4DCPB 1Y10A 3GTYX 2JLFA 2Y1IA 1N6QB 7AT1B 4YY3F 4WU3A 4ED4A 3D0GE 4LFAJ 4HHUA 1VQSA 2GX8A 1WELA 1NKBA 2XWYA 1S1XB 2OUGA 5A2QU 3KNAA 3WC2A 1RCOB 1JLQA 4PKDB 4E98A 5DETA 2BJEA 3DXBA 3W5ZA 1YJRA 4FNIA 4Y34A 5KFKA 1HWUA 1C0UB 2W9AA 2AYEA 2J5AA 4DR2J 4C8YA 3QGGA 4WE1A 2O66A 3CDWA 2FTRA 1XC9A 3W2WB 2YNHB 5E3PA 3AOCA 2XY6A 1UAWA 3RAMA 2EXUA 2CADA 4ZPAA 4K4TA 1D9FA 1OS5A 2BRLA 3KJQB 5BR8J 1WKJA 2VC1A 2HBZB 3P49B 1CJKB 5D4NA 5DS7A 3HSGA 2RDDA 3QRPA 3M1VB 4L73A 3W65A 1F60B 4ED0A 3MM8A 4MIWA 2VQEJ 3FBEA 3BO3A 4O4RA 2JL9A 2YNIA 2IM2A 2M52A 2I0XA 4FYYB 5DZ7A 3M9MB 5E3CA 3I82A 1TKTB 2CJAA 1NU4A 2FGCA 3DDKA 2AJQA 2I6WA 5CZVA 1L3UA 1WC6A 4PWWA 5I3UB 2AIRB 2VG7B 3F73A 1B7YB 5EWFA 2JX2A 1V5VA 5KFXA 1CJVA 4ILRA 4M5NA 2JC1A 4TLRA 1Q53A 2F5GA 4CO3A 1RTIB 3IXQA 4YDXA 5HAOA 4MKAA 2I9SA 3H98A 3M6UA 4HTJA 2O01C 5F8LA 5ETQA 4R5PB 3FQKA 3GCXP 4BWJA 1VBZA 2GNKA 1APSA 4YS2A 5C24B 2D3OR 1UEKA 4A48A 2JEGA 4JYAF 1WHYA 2FJVA 3BKFA 2F40A 1LWCB 4IDKA 1LW2A 2IMOA 2FVQA 4JI0J 3HSZA 2E1AA 4J9KA 4OJ1A 3Q8RB 2QA1A 2RAQA 5K9FA 3IFEA 3NCPA 4CP5A 2ERRA 4LR7A 1ZTTA 3MFIA 2V2VA 3LPYA 4AFFA 3JSMA 1UKUA 3MUTP 2NUHA 2YXLA 2VA3A 4F3QA 5C5JA 4RW8B 4NWBA 3BSAA 2ZKUA 1RAHB 2IJFA 4DPWA 3BBFA 1T8EA 1DY3A 2HQGA 3KK2A 1N4LA 5CYQA 1F5CA 2XYGB 4L3NA 3W1YC 2DVIA 1HA1A 3OR1B 1VC5A 4D3GA 5F3TA 1NAQA 2BW7A 3THVA 4B9LA 1XK8A 5L1KA 3ZTOA 3GV8B 2LECA 4PWUA 2M9KA 1HLWA 1T9TA 1YDLA 5H9EK 4ID8A 3HKZD 2HIQA 1DFDA 2UXBF 5JVHQ 2F65A 1Y3JA 2CPYA 3ONQA 4Y6IA 3GIMA 4WJBA 2PMZD 2HW3A 2CQGA 4DG1A 1S1XA 1CS4A 4U7UD 1Z2LA 3OXFA 5KFCA 2YTCA 4PQAA 2MLZA 4M5LA 3NAIA 3I9ZA 3AD8C 4OV6A 2ZNZA 2VU5A 1C0UA 4DU8A 4URQU 3GCWP 3EZUA 3G8SA 1FE0A 3AODA 4WBFA 3W2WA 2YNHA 2E5GA 3TR5A 3D2WA 5KFTA 4RW7B 1LK5A 3P4UB 3V6KA 3OV7A 1N88A 2WVDA 2XNQA 1S97A 4WZMA 2E1MC 1SUQB 1HBMB 4ECYA 2UU9J 4TY9A 1UJ5A 1S12A 5IQ6A 1CJKA 1HMVB 2UVUA 2VBZA 1Q4RA 3CC2S 3M1VA 4XDCA 3ZNUA 4KGKA 4HTIA 4WXOA 4ZN3A 5HK4A 3SFGA 4M5KA 2XS7A 2AKWB 4EI2A 5HI7A 1TKTA 2OEKA 1GH8A 4RWWA 1V9OA 4MH8A 1WEZA 3QT8A 1OSDA 4A8YA 4H4OB 5I3UA 2VG7A 4H4KC 1S1WA 2OP5A 1T9VA 2FUG9 3EGNA 4B08A 1IN0A 4H4MB 4EU0A 2HSEB 1RTIA 2HPUA 3OHAA 3PYDA 1Y7PA 5HO4A 3OTEA 1O5JA 2FQQB 4LF8J 4NRUA 4R5PA 4HT5A 4WXWA 1U02A 2UV8A 4KHPF 4TKTA 2XCPA 4DLEA 3DOKB 1HW8A 2AEFA 2X51A 3L9ZA 3RR8A 4PG8A 5C24A 1BWVA 3MPYA 3TWZA 3RBEA 1LWCA 3GFHA 3VTIA 5A8WB 3GFXA 3LAKA 3HP6A 3LAMA 3MFHA 2HFOA 2V4JB 2DXFA 3UCUP 1Y5LB 1OIAA 4LT6A 2B9XA 4USHA 2R2RA 3KDOA 4LJMA 1M5PC 5F8JA 4PABA 1X9SA 3F41A 2VFRA 3R97A 4WYLA 3BDPA 1XMOJ 3R7SB 5JVGQ 1WOOA 3VGUA 3DDIA 2BE7D 3TARA 4RW8A 1DRZA 3I32A 2YNGB 1SJ4P 3LPEA 3CJ4A 4C2MA 2ZVIA 2PO4A 5K14B 2GQ2A 1RT7B 2XMMA 1AZSB 4DUTA 3UPFA 5KFMA 2GGPB 3OR1A 4ELVA 3PJXA 2JVOA 3CJKB 1IM4A 5HBMB 2ZITA 1RAOA 3BGFA 2VOPA 3AXKA 2KM8B 1FF2A 1SH3A 4I69A 3AA8A 3HCXA 4JUZA 2DHHA 2E5LF 1KP6A 4UZCA 3JSYA 3GB0A 1DBDA 1CQMA 1IJEB 3ETMA 3KMSA 2H4YB 5KG3A 3C2PA 1Q8IA 3DC2A 1ZM3A 3QRRA 2YQ1A 1M5HA 4A47A 4FKXA 3R2DJ 1WG4A 1A7GE 4CRJA 1KLMB 2YNFB 3R5GA 2VBWA 3BKUA 2GQCA 4OLOA 5KT2A 4UOCA 3KJVB 3K58A 2ZWOA 4DS4A 3K8VA 5HSPA 4KO0B 1UA0A 5GAEU 3HZEA 2GO9A 1UMJA 5L9XA 1HFEL 2CFXA 1VOMA 1U09A 4J9SA 3OFFA 3Q23A 1RBOB 1MMDA 1R7IA 5C42B 4N77A 1NJZA 2HBYB 4YFUA 4OX7A 4CLUA 3O6QA 1HNWF 1SCJB 1TVRB 3KKFA 1F1BB 4LVOP 1FVQA 3ICLA 3D4JA 3HSDA 1A9NB 1SUQA 1KEKA 1HBMA 2AGOA 1OYEA 1HMVA 4I67A 4DR5F 4K5SA 2W2NP 5EX0A 3OL7A 3NRBA 2FZGB 1WTFA 1MN7A 1NO8A 2LA6A 2DD8S 3R8YA 2WSFC 4GMKA 5KFYA 2AT1B 5CYMA 2FJAB 3KFWX 1DLOB 4DEZA 4H4OA 2DY9A 1N36F 3BGRA 4ECWA 3LANA 2MQPA 3RBDA 5KFGA 3CB4A 4ZPBA 2ZBQA 4H4MA 1VQNS 2H51B 1L3KA 1U8WA 2J0SD 4LF9J 2LXUA 3O1LA 1FWPA 4LFBJ 5J1EB 3CCLS 2IPOB 3WC0A 2WW8A 1KONA 1JLAB 2OPRB 1KFDA 4O3SA 2H5IB 3ISNC 3OXLA 3HI9A 1HD0A 4I64A 1J5OB 4OJHA 1XNRJ 3HX9A 2HHPA 1S1UB 1R43A 2WSEC 3QT5A 2IDLA 2CPFA 4AD6A 4Q5VA 2GJIA 4LRAA 4ZP6A 2BE9B 2BANB 4PG6A 4KHMA 4DR3F 4MK8A 2UUBF 2V4JA 1GXLA 3EX7B 2E7WA 3PW5A 3R5DA 1DJ0A 2N4DA 4X4UA 3LP1B 3PYGA 3BSOA 1RU2A 2V4QA 4WCEQ 1XEZA 3L7UA 4DPOA 2YKMB 2ZH8A 2YNGA 3J7ZT 2OHDA 4XAKA 2VA2A 2ACYA 1KQFB 1RT7A 2BBEA 4TQRA 3WX8A 1AZSA 2GGPA 4DV1J 2GJ2A 2FHOB 5DM6Q 2P9EA 5HBMA 1IM6A 1C1BA 2COLA 1N0UA 4C8MA 2JC0A 1G6BA 1RT6B 4DV2F 4GC6A 3JS9A 1UEUA 3IR6B 4DSJA 1QAXA 3DI6B 3GFZA 4NA3A 1JNRB 1FEHA 1M1GA 3AQPA 1HNZF 3H42A 2ZH5A 1FKPB 3DHWC 1N56A 3PO4A 1SIWB 1RTJB 3D5MA 3N5FA 4KGZB 1X9MA 2PC6A 1KLMA 4MKVA 1OO0B 4FYXB 2YNFA 4C0BA 1Q7LB 1IKVB 3S8SA 1OQ6A 5M2PA 5J2QB 1QUVA 4DV6F 1MG7A 3KJVA 1YJNS 1WHVA 3PX4A 1PYOB 1I51B 3SCJE 1IQTA 2IBOA 1FXDA 4HR2A 4ZK7M 4OYXA 3ILIA 5GAHI 5DJBA 3NOGA 4OI2A 5C42A 3CXCR 2AP6A 2BOAA 2RQKA 1OMSA 1TVRA 1U1PA 1U24A 3CDAA 3T1HJ 2M4MA 4J9MA 1X4GA 1HIYA 4DF4A 3GJTB 4YOEA 3CMES 3CJSA 4O44B 1S6PB 4KQZA 1SKSA 1FTRA 1TUGB 4CZCA 2IY5B 2P2CB 2J6UA 4NXMF 1K1QA 4Y2CA 2H5JB 2B4UA 2D3ZA 2HQCA 2BJDA 4IRDA 3FBFA 4FXVA 2B3TB 1G3OA 3AXMA 3X1LB 2XMAA 3IR5B 4HVZA 4L3KA 4DX5A 1T3OA 1X9WA 5IC6B 3FZBA 3FJ2A 3TQ1A 4CLPA 2DT9A 1ELOA 1YSJA 4G1PA 2OO4A 3ZC4A 4ZVPB 4CO1A 1RHKB 4R0JA 2W4PA 4JI7F 2AU0A 4DUZJ 3MAQA 3G8QA 3DU6A 5J1EA 4C0OC 2J9EA 1CC7A 3TA0A 1FXLA 3DLEA 3PW2A 2BQRA 2J6SA 4P2XA 1TL1B 5D77A 3I9V9 3GV7B 2GW8A 1U1MA 5H9FK 2OPRA 2KG0A 1HWJA 4LF8F 3VAKA 2AD9A 3RBZA 2APOA 3WDOA 1J5OA 2CQBA 4DN0A 3SI8A 1P8GA 3DLKB 1Q81T 4DV0F 1JLBB 3GZ7A 2HWIA 3BH6B 1X5OA 3S6EA 3HVTA 3LOUA 2BVZA 2V4RA 4X4TA 2BANA 3MPVA 2KFYA 3I6PA 2LKZA 2IBKA 1SKRA 1YJTA 3ZZTA 1A6LA 4R25A 3CUNA 4WP9A 4WKYA 1RHJB 2LDYA 2ZHOA 1NNDA 4OFZA 3LP1A 1FERA 2KT3A 4NYZA 3MUVP 3GYGA 1EQMA 4QWBA 4Y2IA 2RHSB 3LGMA 5ETPA 1B3TA 3GR1A 5GAEI 2DR7A 2OIHA 5HVHA 3PHTA 2ZZNA 4PG4A 2YKMA 4ZLNA 3M6WA 1BC6A 3MR2A 1NEEA 1V5IB 1JWWA 4NMXA 1J5EJ 1KFSA 3TA1A 2RQCA 3LP0B 2HHQA 4ATNA 3O3LA 1RT6A 2WONB 3W2VA 2HHWA 2KKHA 5HLFA 3IR7B 3DI6A 1NUEA 1QSSA 1TFWA 4ZHRB 1G2EA 4CTAB 4MKBA 4IH6A 1FKPA 4B9MA 1RTJA 4TYAA 4RUCA 2ADBA 1NSKL 1BD6A 1H73A 1HR0F 4NLRA 3A3PB 3CIZA 1LEOA 3JTOA 4P2MA 1D0EA 1IKVA 2W2PP 2OMOA 5J2QA 4D3HA 2RSQA 3BQ1A 3AH6A 4ES3A 2HNZA 3TUIC 2KT2A 5K8MA 3LW5C 3V6HA 4ANDA 2E1CA 3J7AN 3P5BP 2QX0A 1B64A 4P75A 2XYHB 2QO3A 2OSQA 3L7OA 1YK9A 1FE4A 3ZZOA 4YQWA 4CLTA 4LIRA 3MR7A 4PYAA 1D09B 4CH1A 4YB5A 4MYTA 1IWAA 4Q8EA 1KOHA 4X4SA 2WB4A 1S6PA 3OW2R 1FX4A 3SSSA 4CCHA 1HWKA 4RW6B 4QCLA 3EXYA 3BYRA 2VH7A 1RA6A 2HHTA 2V9WA 2PFDA 3G6VA 4HHJA 2A2DA 4U67Q 3PKYA 3G2XA 3J81U 2YX4A 4O0IA 5BJRA 2YWGA 4ED8A 3P3DA 4QR1A 2DIVA 4UQTA 1EIYB 5CHCB 1VYAA 3PX6A 1ZM2A 1H7WA 3DM2B 2WSCC 1GMWA 2QL5B 2NQPA 1EAYC 3TJAA 3NMAA 4B17A 2F4VF 1TL1A 1Y00A 4HH0A 1J2VA 1RYSA 1NK0A 2HWTA 2GIQA 2XHWA 4OZ3A 1CJTB 2BE2B 3DLKA 3A12A 1JLBA 3Q8PB 3QQCD 2C42A 3CJQA 2HAIA 5DG9A 3UFCX 2ZC4A 3SCIE 3BGUA 3JB9k 4TVAB 1S49A 2AEMA 3PDNA 1YZ6A 3GQCA 1TFYA 1YJUA 5EWGA 4GKKF 2DNZA 4I2QB 3G82A 1DARA 3W3SA 2K1RB 2XHCA 1RWMB 2Q6CA 4ZPVR 2QEXS 2FZKB 1P6TA 4ED5A 3FRZA 3O8WA 2MKHA 3OFEA 2KZZA 4ID5B 1C0TB 1SL2A 1VRUB 4AUKA 2GMHA 3NNHA 1XNQJ 2XGQA 3PACA 1VRTA 2G2YA 5F8NA 2B9EA 1RISA 2L08A 5G0RB 3NGDA 1PO6A 3ZZYA 3PRDA 4I1TA 4ECSA 3CIMA 1FRKA 3BF4A 1KHVA 2MZTA 1PYSB 3V5RA 4E2FB 4JV5F 2WONA 3TVZA 1N33F 2Y0SD 4DV3J 2HMIB 1NJXA 2HK2A 4ZHRA 4LF1A 4FBUA 4CTAA 2ASJA 1NK4A 2GQQA 4QYZK 3R9LA 5DQIA 1FA0A 5LSRA 4KGXB 2N3OA 1R0BG 4L75A 3PIOQ 1HNXJ 3TA2A 4QIGA 5C25B 1NJYA 2UUCJ 1SB6A 2D7SA 1F3VA 5C2CA 5B0DA 2ZH3A 2QMWA 4DSLA 3MM9B 1S7IA 4RJVA 1M5OC 2HFNA 3IGVA 3OL8A 2B43A 1U45A 2DHXA 2HRTA 4A8FA 1BGXT 1RB0A 1GMVA 2CPEA 2VFTA 2Y8WA 1IKXB 3VR1A 4DUYF 1Q7YT 1VQ6S 2V8GA 1TP7A 4UOFA 2B8PA 1X8DA 4WFYA 3N6MA 5G4DA 2JOQA 4RU2A 4CM2A 1FRJA 3FNNA 3PVXA 2WVBA 3F56A 4ZKAA 2EW9A 1RU1A 4DX7A 2AJ1A 1WSVA 4PXCA 2CQ1A 2UUTA 3KUHA 2OGUA 1U1QA 3CJ8A 3OVSA 3BYPA 1RHMB 1KTQA 1KHWA 1O0PA 2HFSA 4RW6A 4L76A 5CA5A 5AJ3F 2J0QD 2R7OA 3KK3B 3M32A 4NX9A 1M1KT 5D0HA 3OJSA 2MB0B 4LR9A 2ASLA 2DGXA 3GWCA 3K2YA 4K0KJ 1MLAA 3W5YA 4CO0A 1U1NA 1RHQB 4ZVUB 1JKHB 4X66F 1QTMA 4RBTA 1YRXA 1DURA 3JQJA 3GJSB 2XMJA 1FHTA 3BSCA 3H2LA 1VR6A 2L41A 1FDBA 3PM9A 1PGZA 3SXLA 3AOBA 2ZJPQ 3PEJA 3K5MA 4B3RJ 3DM2A 3T5JA 3I96A 5ETMA 2WCXA 1XERA 2OAUA 4Z37A 4Q43A 3ISND 4NLVA 3IS9B 2YKNB 1T9XA 2QL9B 3WIUA 5DG7A 5IFMA 2DGUA 3U02A 4NMLA 2Z8QA 1NHVA 1KVIA 5KT6A 4QWDA 1CJTA 2LQJA 2BE2A 3MPUB 2W25A 1N5YB 1VBYA 3C66A 3KUEA 1FJ7A 4A8WA 5IT9U 3T5LA 3HHLC 3GMGA 1P1LA 4W4MA 3TANA 3DLLQ 4BC7A 4DCOB 2R2UA 5CABA 1KVJA 1XWLA 2H9ZA 5L1JA 1K47A 1WTBA 1SBRA 4IQXA 3KLGB 2K1RA 2E7XA 3N5BA 2MQQA 4ZLLA 4X62J 4IG3B 3NKYA 2W2OP 3GE9A 4RUBA 1TKXB 2CVIA 3OTOF 4ID5A 1C0TA 1T05A 1VRUA 3V6JA 2BJ7A 2YVSA 3M2RB 3P45B 4TU8A 2E5IA 3MURP 4UY8T 1Q5YA 5G0RA 2QSWA 3ETOA 5ETSA 3SV4A 4KJIA 3DKDA 1QTNB 2HIYA 2DGQA 4KC5A 2QGFB 5J2NB 2AWZA 3QFWA 2NSBA 2HMIA 2BJ8A 3C6UA 2V34A 1WSRA 1IBMJ 3VGVA 4UTGA 3IM9A 3G6ES 3RRKA 4EEYA 1FK9B 3OFGA 1H6KX 4RUHA 2ZEJA 4UW2A 2CPXA 2EPIA 3A1YG 1ICEB 4CLSA 2E1RA 5EWEA 4QIVA 2C2NA 2L48A 2RT3A 5IZHA 2M0GB 5GAGI 2MEWA 4NLPA 4ZITA 3RW6A 5L39A 4QOTA 3MM9A 3VV2B 4DFPA 5F8IA 1EP4B 3CF5Q 3CJ3A 1MWQA 2EC0A 3CO9A 2QV6A 2XSJA 4EK2A 1HARA 2VKZG 5KT4A 3PFOA 2DXDA 2NXNA 3I55S 5KFZA 1IVZA 5B0EA 1UVLA 5DGAA 5KFIA 3CCWA 2JNJA 2PFFB 4PG7A 2Q3PA 1FCAA 3IC1A 1GMUA 5LMUJ 4PRFA 5EN1A 5LOQA 5A8KA 4WPAA 3CCTA 3QJJA 1JLCB 3KK3A 2NZ4A 3JSRA 2RUSA 1SVDA 2QMUB 3WZ0A 4ZPTR 1T02A 3G8TA 2OPPB 3FVYA 1JKHA 3F0NA 2WTFA 1SJRA 4F3MA 5ETOA 4PR6A 2UVWA 4OHWA 3ADAC 4ZCKA 1IJFB 2PMWA 3QZ8A 1P1TA 3W66A 2R7WA 1G1XA 4ECVA 3I4PA 4XDDA 2CQ0A 3HT0A 4QPTA 3FSXA 4NLYA 2YQ0A 3QATA 5E2QA 1YKWA 4RU9A 2BA9A 1WKLA 4L72B 2HRUA 3IS9A 1YIJS 2YKNA 4M5JA 1PYTA 3K57A 1Z4UA 5SZTA 1H3DA 3CULA 2DNLA 4X4QA 2U1AA 2V2ZA 1WC5A 2CJQA 2FJBB 4NLWA 2R7QA 1N5YA 1WC3A 4KTQA 5HMYA 5B0FA 5ETNA 3M2VB 2IA6A 1AA1B 1VQMS 1KRPA 1LOUA 1LWFB 4HLBA 1JQGA 3D67A 4DWIA 4LBPA 4U95A 2YY3A 3NCRA 3Q8SB 2GC8A 3DLHA 5H1SV 4DL5A 3MGJA 4U8YA 4FKYA 1TZ0A 3K89A 2KJVA 3FEYB 4J90A 3EGZA 2NZCA 1P27B 4IG3A 5IT0A 2NXCA 1S9FA 3NMRA 3N01A 2RVJA 1RTHB 4QQBA 3N4WA 3JSBA 4NZ7A 9RUBA 3M2RA 2ZFHA 2UUAF 4ZA1A 5HMXA 2RF2A 3KLFB 4L74A 2AMCB 1WD6A 3MHYA 5CD4H 3NNAA 3PW4A 1FFWB 3KG4A 2O3DA 4Y00A 1XR5A 3MOJB 3H2VE 2YWWA 3I0SB 3ZTSA 2BABA 3IA0A 4LRCA 1VFJA 4JI3J 4OX9J 2JH3A 3HF5A 3V81A 2CJYB 4TY8B 3OPKA 4DSEA 2LLZA 1DTTB 2SXLA 3FCHA 2MY7A 4JI4J 1RAFB 3CDEA 3LO3A 5ADZA 2CXEA 3Q2SC 4K4ZA 2K8GA 1ZZNA 4JP8A 1RWNB 4XPCA 4HDHA 2L9WA 4DQRA 3UD5A 3CEDA 2OPSA 5ITHA 3KLIA 2BV3A 4LBIA 1EP4A 4TU7A 1AB8A 2NXJA 3AJDA 4YY3J 2ASDA 5DQHA 4ZJLA 2VQFF 2DNHA 5GVQA 3QSYB 3HSJA 5LM7E 3HHLB 1YBUA 3KJNB 1VRQC 4USJC 2WAQD 1EJ7L 4K5RA 2AGQA 3FSYA 3RB0A 2GHPA 3FK4A 1Q5VA 2EVZA 2RILA 1GT8A 4ZCLA 3E01B 2R7TA 4CDIA 4DR6F 4DR7F 3GSDA 4RNFA 3UDVA 1FRLA 4QPXA 4DPTA 1NDKA 4WK3A 1PJ7A 2OPPA 3C16B 4NXNF 2MYFA 5K8OA 3AFGA 4K4YA 1NKEA 2B4VA 3ELHA 5D0RA 1SC3B 3QFHA 4JI6J 3UQSA 3D68A 5B08A 2W7AA 1YITS 4N7TA 4MTPA 3R7NB 2KL8A 4YEAA 5LT5A 2V67A 1Q78A 3TZZA 2XEXA 1D9AA 1C1CB 4DR4F 2DXEA 3GG0A 2BXJA 4IFYB 3MMJA 2CQHA 3M8ZA 1WI8A 2RQ4A 1MWYA 5L8RC 1RYRA 1LQ9A 3NOCA 2X3GA 4CLKA 1N5QA 2G2ZA 1L3SA 1RTZA 2OKQA 2FY1A 2QSFA 3GJRB 4UQGA 3HHDA 1YG0A 4P7TA 3GP9A 2LMIA 3MCNA 2IRUA 3U1MA 3RTVA 5LJ3Y 3CMAS 3BO4A 2CQDA 3T3FA 2CVEA 4CO2A 3C6TB 4CLLA 3AD7C 4KYZA 4DL6A 1DTQB 2M70A 4YR3A 3QLHA 4KH1B 2R7VA 4JYAJ 2R8HA 1HBUB 1RTHA 2CJBA 1FNMA 2RU9A 3QAUA 3M8RA 3HT3A 4OYPA 3KLFA 4AT1B 2CJXB 1UCNA 2OELA 1ZZFA 4EZ9A 1FWLA 4ECXA 2FJDB 4RL1A 5MAOA 3I0SA 2PSZA 2JLGA 3NEKA 4DI6A 1VQ7S 2C3PA 4CQ1A 3NWGA 5K5MA 5F8GA 3MDFA 4TY8A 3FMBA 4DX6A 5HN0A 2CNOB 2VF3A 2JWNA 3BN7A 3GYXB 1SV5B 2BACA 4NEZA 2IFXA 2OFHX 3D0HE 4M5HA 1KBRA 4FVCA 2ATCB 4FYDA 1QVGR 5HROB 3OHBA 1RWOB 1H72C 2R4FA 5HJXA 2J6TA 3O2IA 5B0GA 2ZDPA 1W2BR 2C2MB 2IVFB 5KG4A 4C11B 5KT5A 2YH0A 1XQIA 2XZDB 3KHHA 3QAEA 4ZVRB 4JV1A 2UXBJ 2MKCA 1EARA 5AXKA 4FF3A 4DV4F 1K1SA 1VC0A 3MMAB 4EUVA 2VL1A 2M2BA 4F8RA 2XS2A 3HHLA 1YJ9S 3M7VA 3M9NB 3SEOA 1S9EA 4KY3A 2HLUA 1WOPA 1TMJA 1JLGA 1I94F 1R0AB 3KDNA 2DGVA 3SQGB 1WWHA 1CC8A 2ABYA 4NRTA 3SFUA 3E01A 3T19A 2O5DA 5DO2A 4DXLA 1U2FA 4USMA 3D0IE 4NLGA 4P73A 1UPMB 4I2PB 5THWA 3DOLB 4FXDA 5LXRA 1SJFA 2O67A 3C16A 4KIAA 1AUSL 2B56A 5KG1A 2YBVA 1NZ8A 4J9QA 4KPCA 2K7KA 3ZZUA 4KBIA 4ZIVA 5L1LA 5BYSA 3G6XA 1NZAA 2V8HA 3TW0A 2QMXA 2Y8YA 2IJRA 2YKPA 2HHXA 4M1KA 1T03B 1WC0A 3POTB 1NPPA 4ENOA 1YJWS 1M5SA 3BEGB 3KOAA 1LK7A 3NWRA 3FSIA 4ZIWA 2AX0A 7FD1A 2B0GA 4J9VA 1N5TA 1UVKA 5DZ6A 4QR2A 1C1CA 2VIHA 1E6VB 4LF2A 2P5VA 1U1RA 4C9DA 4IFYA 1F0XA 2C3UA 4EO6A 3C3LA 2LXFA 4B9TA 2F63A 3W5XA 2KVQE 1MROB 3T5HA 1JB0C 2E9RX 2NXEA 4EZ6A 3GLJA 3N6NA 1QAIA 4RPFA 1GNKA 2KHDA 4ED1A 3OL6A 2ZD1B 4ITSA 3UO0A 1DZ5A 2EBGA 5L9NA 4OZJA 1FJGF 4KHPJ 3EYZA 4V19J 3C6TA 2DNKA 3A4TA 5D0GA 4J7CA 1FDNA 1SH2A 4PPZA 2DCLA 2BM0A 1DTQA 1U8SA 3BQ2A 2X7IA 1HBUA 3AT1B 4IYQA 2ZOMA 4C3MA 2X3DA 2PA8D 4ZVGA 4EBEA 1Q16B 5T7LB 1FDAA 2HHVA 1KWMA 1QM9A 1NRKA 2DH9A 1FNOA 4K50A 4G1QB 4ILMA 3LF0A 2KXNB 2MQOA 2XQCA 1R3NA 2HURA 5IS2A 4ZCMA 3CD6S 2QA2A 4P6QA 4GKJF 1D1UA 1NKCA 2DPJA 4B9NA 4C98A 1SV5A 1U6FA 5A76A 1M0SA 2FHMA 3OVBA 2D9OA 3R2CJ 2AV5A 3EWGA 1SQEA 2XNRA 4NLSA 2HQIA 1S9GB 2LFVA 4UT4A 2E5LJ 1QAYA 3SCKE 1SQFA 4DOZA 4BHQA 1TL7B 4A8QA 4C11A 4IQMA 4U9RA 5A0YB 1OQ3A 2EBEA 4CLWA 2PA3A 3RBXA 2X1GA 1NMEB 3MMAA 4UZBA 3NLCA 1G7CB 3D6HB 1WI6A 2Q79A 2DBBA 1RP5A 1FEEA 3T1YF 2XC9A 3SQGA 3U27A 4ER8A 1TAQA 1ZS6A 2V63A 4PWDA 1PG5B 2C28A 2R7UA 4U7UK 2GMLA 5D6GA 1OJ4A 4I2PA 4MKYA 3DOLA 2DNGA 5GMDA 1T9UA 4AYBD 2GVZB 5SUHA 1HNWJ 4TN2A 4A8MP 2DNPA 3Q8VA 2BZ2A 2ZE2B 3J7YU 5C2GA 3TI0A 1BQXA 2VDIA 4ZVTB 1T03A 4J9LA 3KK1B 3POTA 4OI3A 4HDGA 3MR6A 5HP1B 4RUAA 1VISA 4DR5J 3T6BA 3QWPA 4JI6F 1RABB 2WVFA 3MXHP 3D54A 2GMJA 2MMYA 2IRXA 1JJHA 3M6XA 3H8YA 1E6VA 2KDOA 3IN5A 2KM8C 1S1TA 2HNYB 3ZZZA 4JV0A 2J0XA 1N36J 1Q1KA 3CCJS 4DF8A 1MROA 3MD1A 4A8KA 2E9TA 2GIFA 4YB6A 2IM3A 4OYOA 2LEAA 1BXNA 3D28A 4HACB 4WU2A 1K8AT 2E5HA 1PAUB 2ALZA 3N28A 4N8NA 1L5UA 2ZD1A 1RGVA 3EDRB 1EQ0A 3HO1A 3FBCA 4ANCA 4DL2A 3KUGA 4MYUA 1Y0HA 4G65A 2BJ9A 3NL0A 3IRWP 3K5NA 4UUWA 1O6XA 2E7VA 3MTJA 2B5JB 2LQ5A 1QD1A 4P10A 2XLJA 4I56A 2BRKA 2AJFE 3H2UB 1U48A 1RA7A 2KO1A 2IM1A 4DR3J 5AXMA 1QSLA 2UUBJ 2XWXA 4G1QA 2XULA 1PC5A 1H7XA 2CG4A 4Y28C 3LH2S 4B9VA 1RWKB 4LSZB 1RT2A 1VQ5S 5D15A 3IP0A 3VAMA 4DFMA 4CT8A 2H1YA 1M90T 4TLQA 4OJGA 3IM8A 2RHQB 1FD8A 1QE1B 4NLTA 2B9YA 5FIIA 3I5CA 1N34F 1QDUB 3UDLA 1VQKS 3G87A 1M5KC 3JQKA 1Q86T 1EKSA 1PKUA 4DSIA 4X4RA 2XY7A 3BJYA 1R31A 1KQSR 3C15B 4USKA 2RDIA 4DV2J 3OJUA 3Q22A 3I0RB 5J1NA 5D3GB 1S9GA 3CDBA 2C3MA 4QW9A 2R9LA 1TL7A 1AT1B 5IC4B 1BQMB 3PXGa 2MHEA 1HNZJ 5A0YA 4JI8F 2H5EA 3B8HA 3AOAA 1WC1A 1SJ3P 3MEGB 2QTWA 1RWUA 1MMLA 1N6QA 3K59A 2XI3A 3TUPA 5LMNF 4IRKA 4LF4F 2P9GA 2QLJB 4IRCA 4DV6J 4F04B 4LUBA 2CZVC 3LUYA 3MEEB 2Z2LA 2DNYA 3RU0A 1FNXH 3BPSP 5AXNA 1S57A 1WHXA 4N56A 2V8PA 2C22A 1X7VA 1BHNA 1NHUA 1N0VC 5FDLB 2N7YA 1SL1A 3TP2A 2VICA 1R8BA 3MPWA 2J9DA 2GVZA 2ZZMA 4F4YA 2B7BB 1UTAA 2VPXB 4DFKA 5HMWA 2ZE2A 2B9WA 1S4FA 3N6LA 3R7BB 3KK1A 4K4SA 1S0NA 1RAIB 5HP1A 2W24A 4HKQA 3BPDA 5IOLA 4NXMJ 1X4FA 4PUOB 4F4ZA 1KSPA 3R5AA 1GFWB 3NXZA 2MQMA 3GIJA 1FRHA 2UP1A 5I3PA 3WIVA 4NE9C 5IM0B 2VG6B 1HPZB 2HNYA 1N32F 1ULRA 2R3VA 1RWWB 1UVIA 4P71A 2VDHA 4HACA 1IBKF 4MJKA 2I1RA 2DISA 4JI7J 3HVAA 3DLGB 3PEHA 1WHWA 2RRAA 2DR5A 1MMNA 2IVYA 2ZM6J 1AW0A 5EX3A 4KR0B 3SBMA 1U47A 4AQYF 5E33A 1VCTA 3CJ0A 3U1NA 4ICLB 2F8MA 1ZAWA 3KLEB 3N9UC 2CDQA 3B4MA 1TR0A 4DV0J 5KT3A 2RH3A 2B5JA 3DRSB 4FF1A 3GYNA 1T94A 4TXSA 2OEMA 2XS5A 5FJ4A 3PR5B 3H4DA 3SDEB 2KYXA 1RBAA 3HZGA 3MMBB 2V2QA 5HQLA 4MK9A 1NSAA 1TV6B 2QZ8A 2Z58B 1DQ8A 4M5GA 4DN9A 1U6BA 1WORA 2DB1A 2M3DA 2PEBA 4OI4A 3IWLA 1QE1A 4DBQA 2J7WA 1IWGA 2I5JB 4J91A 4C48A 3KLHB 3MCSA 3BBBA 2ZZTA 2QLXA 1HNIB 1S6QB 3A8JA 5IWAF 3NS5A 4WFAQ 3EVMA 2MJNA 2EKYA 2BJ1A 1C4CA 5U47A 3UVJB 1JLEB 3EMTA 1Y11A 4DPYA 4FPRA 2PEHA 3J7YI 3CGIA 3I0RA 4U96A 5D3GA 3IMQJ 2FLLA 1BUXA 2RMLA 1VLOA 4B3MF 4OYZA 2YKOA 2RNEA 1AYEA 1BQMA 3Q8QB 3HJVA 2QC3A 2KT5A 3NCQA 1U49A 4LF6F 4DLGA 3M8WA 2Y0BB 3DRRB 2UV8G 3I5AA 2DKOB 3LGNA 1CLFA 1HR0J 3D1QA 1ZBTA 1RT4B 3EVWA 4NA2A 4HEA9 4FF4A 2CQ4A 1IR2A 2IDEA 2LEPA 4OIXA 2GZOA 4KHRA 1NHKL 1ROFA 3MEEA 2CQ2A 4O4GB 2DR6A 1NH8A 3HHKA 2MKIA 3D3CJ 3X3UA 4TU9A 1RTDB 5HATA 1RQ0A 1SC6A 4IUFA 2EFNA 4RW7A 1D8YA 4Q2MA 1YJ7A 3AB2B 2VFUA 2AJ4A 4YUDA 1HNVB 5CCMA 4Q44A 4PUOA 2LYVA 4G6VB 2LEBA 4GVLA 4B3TF 3UWTA 4B3SF 1QVFR 5IV3A 5IM0A 3J81Y 2VG6A 2OSRA 2DGOA 1XR7A 2HZCA 5AE1A 4F50A 2V6AA 3ZTRA 2XLIA 1FXRA 1RAEB 4KKOB 4PQUB 1SH0A 2CQCA 4RNOA 2BQ3A 3FBBA 1GTHA 2ZOGA 4K59A 3BREA 1M1HA 5F8MA 6FDRA 1PBUA 4ZPDA 2F4VJ 2OD6A 3KG1A 3QJLA 2FGOA 1B7FA 1ZAXA 2BOPA 4F0HA 3DRPB 1WF1A 5KG7A 1VI7A 2KFZA 4XIUA 1ZPVA 1NB7A 1YRTA 4KH0B 3KLEA 2MTLA 2HHHF 4USWA 2NS1B 4KFBB 3DRSA 3DOKA 3MEDB 4OZ2A 1RKIA 2MY8A 2ZOFA 4OYIA 5KFVA 3CCES 4RO0A 3J81j 1PAEX 5F0UA 5A8WA 1AFIA 4GKKJ 2B7CB 2XI2A 3MMBA 3QGIA 1TV6A 2C3YA 5DLFA 1E6YB 1F2GA 4YN3B 4FVMA 3RR7A 3MMCB 2V8VA 1X4DA 1CPZA 4N76A 3GJQB 2LU1A 3KLHA 4DR1J 1UL3A 4V19X 1F6TA 3PRVA 3OQ2A 5LXYA 1HNIA 1S6QA 4OYBA 2QYCA 4PYDA 1OY6A 3C19A 2MZJA 4WE1B 2DGSA 4I6YA 1UWAA 4EO8A 2HZAA 4OHZA 1Y5NB 3UVJA 1JLEA 5K14A 3R3TA 4JV5J 5KTQA 4X2BA 1H2TZ 4BDPA 1N33J 1TL3B 4ZLJA 1HBNB 3HFZB 4NLOA 1WNEA 3CJKA 1CG2A 3TAPA 2J8SA 3RGIA 4IG0B 4ZN1A 1F9HA 1YZ7A 4JI5F 2BM1A 3S1TA 1R27B 3EXCX 4M63A 4U8VA 1B70B 3RB6A 2AF6A 1U6ZA 3HFVA 3Q86A 3PTWA 4GVBB 3DRRA 4QIEA 4ZVEA 3W9HA 4J9UE 2XMVA 3BS9A 2UUWA 4OHYA 3BGOP 4UUXA 2DR8A 5CZXA 4C97A 1NK5A 2K3IA 6AT1B 3NNCA 2DCUB 1RI7A 2HS4A 4G3IA 4GC7A 4N5SA 1KVKA 5B0AA 3JTPA 1UW4A 2BR0A 3H5XA 4J9PA 4DUYJ 3ISZA 4G1IA 3AAWB 4KO0A 3H40A 4YR2A 2MSSA 2ROPA 2DK2A 3EGWB 2LQ9A 1PJ5A 1Q8BA 2A3JA 1OSCA 1TAUA 1J27A 2QE5A 3EZOA 1R8AA 2XCAA 3SYZA 3UI3A 2RE1A 2GFFA 3BSNA 2A6OA 2W8LA 1VQ9S 3VZIA 1XTZA 1Y9OA 1P9YA 2JFDA 5AJ3J 1OY8A 1YI2S 2JEFA 4K4XA 2IYIA 2KXHA 2CZ4A 2PT0A 3OTBA 2VC0A 4CIOA 2PN6A 2Q66A 4K8RA 5FLXU 4X66J 4QWCA 2ZH6A 4NLQA 1IUJA 2CQ3A 1H2UX 1QSYA 2PD1A 1XN9A 3K5PA 3VAJA 3D6MB 1WEXA 2WZ1A 1RSCA 1N5VA 3JSMB 1N5SA 3S01A 2YX7A 5M2RA 1JX4A 3C14B 1DLOA 4KKOA 4XPEA 3ENAA 4PQUA 5L38A 1MN9A 4UOGA 3RW7A 1TK8A 2MZQA 2HVHA 5K20B 5GADU 5KFBA 2AYBA 4ECQA 5CYQB 3C8YA 2OFGX 4ZCIA 3BV8A 4QWEA 4JI1F 5EHHA 4EMDA 4OL8A 3BR9A 2EG1A 1FKOB 3A8KA 3OSNA 1SC4B 2CYYA 3DRPA 3E3XA 1XJWB 4YDDB 2XYPB 3CDUA 2Y9HA 2ZM6F 2EWHA 4LRFA 1JLAA 3MEDA 2PI4A 3SCLE 2LQ8A 3MF5A 1NH7A 2F7VA 3MM6B 4NLXA 4BS2A 4I0WA 2RIJA 1S1UA 2RD5C 4Y0FA 1XMQF 2DTJA 3TUZC 4QZVB 2CPDA 4OQJA 3DRYA 2KJWA 2HHUA 1FTCA 4DG1B 1UA1A 4R8UB 1CS4B 4DV7F 1E6YA 1JXLA 3IWXA 2FLNA 5IXUA 2EG2A 3A8IA 5KFUA 3PJ9A 4XO0A 2MGZB 2WRMA 3OTOJ 2DGTA 1HD1A 3MMCA 5I3QA 1WACA 3QT7A 3BZQA 3OUYB 3G4SS 2C1EB 5HQ8A 3UDEA 2GHWA 3HVRA 1X5PA 3V4MA 2B4PA 2KG1A 1DAXA 3N0VA 2BKOA 3TO8A 3D9BA 3G86A 3KMQA 2W9BB 4IOAQ 1TL3A 2ADCA 1HBNA 1NDLA 4WIIA 3OLAA 2DNRA 3VGTA 4ZMMA 4IG0A 3OSPA 2UXDF 1OPIA 2I8EA 3QO9B 1ZA1B 4MFBB 1IBLF 4ECRA 3EGVA 2OH2A 3VGSA 1IR1A 4RWXA 4GVBA 2FD2A 2VPZB 1HI8A 1URRA 2BQUA 2W01A 2P8IA 1DHMA 5LL6d 3LTOA 1RJJA 1Q82T 4FS2A 1AUDA 3K5OA 1T0TV 3I87A 4ERDA 3W8PA 2GVDB 4X4VA 4C0HA 2OTJS 5JXSA 1U25A 4AXIA 1S1WB 2V2KA 4CI0B 4ED7A 2ILZA 3QRQA 1RXOB 4DSFA 3Q8YA 2E5JA 1HHSA 2YKAA 3H5SA 3PRBA 4H54A 3TVKA 2DY1A 2IVMA 3N79A 2HGLA 3FFIB 1HHTP 5H9EJ 2ZJQQ 3ULHA 5BXIA 3PYFA 3Q0AA 4J9NA 3CJTA 4AL5A 2V5HG 3GIRA 2VONA 3UR0A 2GHVC 4CH0S 1JLFB 2MZRA 4AL7A 2ASYA 2QN6B 4Y2AA 2VKRA 1S0MA 2B4OA 3C46A 4OYWA 1RUSA 2AEJA 2XLKA 2J76E 2F9DA 4W90B 2HGNA 2K2PA 1REGX 5B7WA 5DDPC 1VJQA 4O44A 3PW0A 4LF5J 1U7LA 1HQEB 2HVZA 2CPIA 3PFEA 4USVA 3CTRA 4DZDA 2D41A 4RW9B 2LXIA 4OZLA 4FP9A 1WDTA 3J80Y 2V8DA 3ZZRA 1FFSB 1K9MT 4ETZA 3BO2A 3C14A 2NPIA 2XB2D 3DDNA 1EX8A 5GMEA 2C2RA 1TKZB 5D4PA 2WBMA 3OLBA 5J2PB 1VQOS 3LGHA 1GX6A 3TZXA 1T11A 4F4KA 4C7QA 3MTKA 4IOCQ 3W8GA 1HBOB 2ZUGA 3NGTA 1FKOA 3GU0A 3R5CA 1LXJA 4ZVOB 5FD1A 3FKBA 3PKMA 1YBTA 3ZZ0A 2NSCA 2EK1A 3DRXA 1NBEB 2R7RA 1S77D 3Q83A 2PMHA 4DPXA 4WFXA 3DNCA 3MCOA 5B09A 3MM6A 4RLEA 2ALYB 4CNZA 1HQUB 2F9JA 3CMQA 3PJWA 2WK4A 3PZPA 4LVNP 4DV5F 4R8UA 4F26A 3QBCA 4N47A 1FX2A 3DYAB 3CW2C 1QAJA 2MGZA 4YHHF 3TZYA 3VHQA 5F41A 2AGPA 1YLXA 3OUYA 2UUAJ 4ELTA 1YX2A 4IO9Q 4RNMA 3TQEA 4QU7A 4C4WA 4DQQA 2R7SA 4LSNB 5AE3A 2IYGA 2HQFA 5KOWA 3PHEA 1UP1A 4J9OA 4DR1F 1GMWD 2D1CA 1NSQA 2CJ9A 4PAAA 2HEKA 3NGKA 4USTA 1SQGA 2W9BA 3VQTA 1RT1B 3LP0A 1VHFA 1NDPA 2KVIA 1TMMA 4YP3A 1FT8A 3QO9A 4JBCA 1HHQA 2LP4A 3J7Z5 1LV5A 2NR0A 4MFBA 3MM5B 3CC4S 3OTDA 5D4OA 1DQ9A 4FDFA 2WB1D 5A8RB 3CCMS 3SIPB 2CRLA 2R7XA 2E9ZA 2I2YA 3T6JA 2J7KA 2XMKA 3EVOA 4HL9A 3FQLA 4FPIA 4ZP7A 1P9QC 1GTEA 5CYMB 1RT5B 2GVDA 4J5OA 2R8GA 4WP3A 4W92B 2ACMA 3BGRB 4XK8C 4CLYA 4TYBA 1RAAB 4C3LA 1WG1A 1RDRA 3VVTA 1ZPWX 3W7BA 4C8OA 4ZP8A 3T5KA 4I7FB 5GADI 3TRGA 1VQ4S 3MWBA 4LBHA 2VQFJ 2QG9B 5E7OB 5D78A 3FFIA 1GK8A 2IA0A 4PZVA 5GAHU 4X65F 5HL7Q 1OWXA 4I6WA 1X0FA 1GXUA 1RWPB 2VBYA 1ZOTA 1JLFA 2DNQA 2MLXA 1UZDA 1A0OB 3UW1A 1WDDA 4CH7A 1RT3B 1Z1ZA 3VQSA 3B78A 3SZ2A 3QJPA 3MAHA 5KT7A 2H3EB 4C3KA 1VIXA 3ILJA 2FC8A 3K5LA 2YH1A 4DR6J 2CWKA 4DR7J 3A3NB 3JAMY 3RAQA 2W9CB 2LVWA 2L3MA 1RE1B 1S6OA 2GO8A 3HXMA 1HQEA 2R8KA 4DL7A 4RW9A 1RLDA 4NXNJ 5KFQA 3CD7A 2GJFA 1KD1T 2NYIA 3QGPA 4WZQA 1FI4A 4JOUA 3EPIA 2CIMA 5CH7B 3IO1A 1Y5IB 4LQ3A 3T9ZA 2NXUA 5KFFA 3CD5A 2AX1A 3DGVA 2W7PA 1EHWA 2ROGA 1TKZA 3Q89A 1VDHA 3VVUA 5J2PA 2C2EA 1KDNA 3GV5B 3LP2B 4NI2B 4LFCF 4RBUA 4ZDNA 4X4OA 3CT9A 4QIWD 1EB0A 1VBXA 2LU2A 3MCMA 3TOQA 5CAAA 3TX8A 2JEIA 1LNQA 3H0PA 4CYUB 3ILOA 2ILYA 3V2UC 1HBOA 4RR5A 1M5VC 2AQ4A 4DR4J 1RWVB 1TU0B 4AE5A 4X64F 1MWZA 1C1BB 3LWLA 4B02A 3WQPA 2RKIB 4MIAA 3B6BA 3BGLA 3BR8A 3P96A 3B54A 2EFVA 1BLUA 1FESA 2IMWP 4NA1A 1HQUA 2HFVA 2DYAA 2H48B 2BJ3A 2XO6A 1N48A 2XO7A 2FB0A 3L09A 2CG8A 3HD1A 2RU3A 4LFAF 4FS1A 3DYAA 1HI1A 2V69A 5D0EA 4I2QA 2D69A 2EFQA 5KFAA 5DLGA 1HWLA 1V6HA 5ETRA 3UN2A 1KOOA 4URGA 1BY9A 3TZWA 3KXDA 4KAIA 2VD3A 4LSNA 4TQSA 4ZS6A 3RYLA 3TEHB 4O0NA 4DR2F 1Q8KA 3SMZA 2N3LA 3CCZA 4DJBA 2XSFA 1FFGB 1RT1A 1UW9A 3NBPB 4ZOSA 3VCDA 4EYIB 2GAGC 4RW4B 2FJXA 3HFKA 4FYWB 4OX8A 3PCOB 3NY0A 1D9DA 4IR1A 2EFGA 8AT1B 3MM5A 5A8RA 3UN3A 5BR8F 1I1GA 3AA9A 4YB7A 4KT0C 6FD1A 3R1HA 1RADB 4OHXA 1V3SA 3KTQA 5E5NA 1RT5A 2VQEF 5C25A 1PC4A 1RAJA 3VAFA 3HHNB 4HHHA 1OYDA 2WOMB 4CNYA 1LWXA 5HJYA 1U1LA 4J37A 2DNMA 1X60A 2HRYA 1NK6A 1X31C 4F4AA 4I7FA 4DV4J 1LFWA 3V4IB 1FD2A 1IKXA 2EI5A 2LDIA 4EWTA 2DNNA 1I94J 3DLEB 4CLFA 4NYPA 1RT3A 2PI5A 4OZ0A 5DRKA 5E3RA 2KXFA 4USUA 1KQKA 2MLYA 4HT7A 4OZ1A 1RK8A 4OZ5A 1B0PA 4ELUA 2W9CA 4ZP9A 1X4BA 2VV5A 1L3TA 3HVTB 2BYCA 2GV1A 5EUHA 4KSEB 2JVRA 3EUNA 2ZUAA 5HMZA 4WFBQ 2DR9A 4LF5F 1UVNA 1X5TA 4JI0F 3HK2A 2M5YA 4V1Ak 2BW2A 2CNKB 3TEGA 1U0SA 1Q0NA 3F44A 4F4XA 2ZKTA 4K4WA 3VZHA 1S4EA 2C3OA 1RKJA 5HANA 3EICA 3AY0A 5KFEA 3LP2A 4NI2A 4ZPCA 2A2CA 2ZH4A 1S7HA 4CYUA 2E1PA 2YX1A 4RNHA 1IKYB 1GAOA 4ZJOA 2A0FB 2VBXA 4DPUA 3H25A 2FZCB 3D3BJ 3NGSA 5KG0A 4BLGA 1D8ZA 2Z2YB 2HAFA 2RKIA 3W2VB 4EYHB 7FDRA 4U6PA 5HLFB 2F1FA 2Q6BA 1BQNB 2AJ2A 2R2TA 1FVSA 4OI6A 3VAHA 4F25A 4KV8B 1AXQA 2W4DA 2Z2ZA 1KR4A 5ETLA 3CSKA 5T14A 3TX0A 3TAQA 2PE8A 2HVDA 1X0PA 1FJGJ 3M9OB 1RBLA 2EC2A 1TUVA 5EDWA 2F3JA 3GILA 5I42B 1NXIA 2GS8A 1FRIA 2F8HA 1W2IA 1EKRA 3O5TB 3DGPB 3W9JA 3KLGA 2ZHAA 2HNZB 3CCRS 3KJFB 4NLUA 4FN5A 5H9FJ 1Q79A 1C2PA 1TKXA 4YB1P 3OBIA 3AQOA 3H5UA 4ZVFA 3PNIA 1NM2A 2M7SA 2FIUA 1U2RA 3FUYA 3NBPA 3UNYA 3MECB 1VLYA 4DZ6A 4RW4A 4GKJJ 5J2NA 2CUYA 4NZ0A 1LW0B 4HI2A 4W98A 4PCQA 1UJ4A 2VJVA 2YPYA 2RQMA 4PXDA 3ZFVA 2CPZA 5E3AA 1XIQA 4RNNA 2UU9F 4CM0A 1FK9A 1N54B 1WF0A 5CXTA 3HVWA 5C7PA 4C8NA 3TJ8A 2G1HA 2MDAA 4DQSA 2O1PA 2CAJA 2VUGA 3H59A 4ES1A 2P9CA 3O44A 2ZWPA 4LRBA 5KFLA 3QPIA 2WOMA 4IFVB 3ZZPA 1K0TA 3UNGC 3WHIA 2QT7A 1REVB 5KFWA 5HVFA 5CQGA 3DOMB 5BYRA 5HQMA 3V4IA 1S99A 2MPUA 3QMQA 1Y4ZB 2Z2MA 3TUJC 5J2MB 1VJWA 3W9IA 3R6LB 1WKKA 3T1YJ 2ZH7A 2G0CA 5A2QY 3R5JB 3BDEA 3M6VA 3MR3A 5DM7Q 3G71S 1H0HB 3LQVA 1PBAA 2NREA 4KGMA 1KLNA 4J9RA 2H4WB 3W64A 1F9FA 2CPHA 3NAHA 3FEZA 1JLCA 3PR4A 3H5YA 4LR8A 2OEJA 2AHOB 2WVEA 5LJ5Y 2E29A 2IC3B 3G82B 5IQQA 3A13A 5KFDA 3JTNA 2G13A 2JZ5A 4O3OA 3BKTA 1GX5A 1RHRB 3K7RA 4LSLB 1XMOF 1SC1B 1S72S 3H7HB 1VRTB 2WBRA 3QZ7A 1JJ4A 5B0CA 3UDCA 2VFSA 5CD4A 1IKYA 1S59A 4FYVB 1JK9B 5F8HA 4NCGB 2MKKA 1YQHA 2V50A 2N7CA 3KNGA 2AJ0A 2ZH9A 3M8SA 4KRWA 1WJ9A 2DRAA 2W7OA 1BQNA 2P6TA 4H4KA 1VQPS 4KV8A 4HI1A 1XMBA 4PG5A 5D4LA 4Q45A 3M2VA 1ZM4A 1HKAA 3AD9C 4Z2XA 4NOHA 1V3ZA 1LWFA 2AW0A 2AYMA 4KPYA 3PIPQ 5I42A 5E0OA 5DDRC 1S0VA 3DGPA 2CPJA 4X84A 3MZIA 3IBCB 1NK9A 4EBCA 2BDPA 2VOOA 2H54B 3CJ5A 3BH7B 1F2HA 4WFZA 3L3CA 2MQLA 1T7PA 4MAKA 3NS6A 2EKNA 2GCFA 5KG5A 3QIDA 3W62A 1S10A 5M2UA 2VHGA 2H65B 1UZHA 4Q7AA 3MECA 2KFNA 3FDSA 2KRBA 1RACB 2WW4A 2WVCA 3MM7B 4LIWA 1KN6A 2KRRA 3UR3C 1N34J 1LW0A 2J8AA 3KYLA 3M32B 4M95A 4FZVA 4DDFA 2FC9A 3VAGA 4UY85 1NK8A 3TNVA 2W8KA 2OD4A 1SKUB 4A8OA 4WIQA 2NCKL 2R42A 1DTTA 2JHEA 4WKRA 2ROEA 1YVFA 1LFPA 2OI2A 5GAGU 2ATLA 1VC6A 1S6UA 2FLOA 4ZPWR 2ZJRQ 4QIFA 1R8HA 2DJWA 2JFKA 4IFVA 4JI8J 1ZYQA 1REVA 1F5AA 4E8UA 2C2ZB 3DOMA 3W60A 1VHIA 3QIPB 2QIFA 2GAHC 2B6AB 5LMNJ 5J2MA 2CWXA 4LF4J 1U2CA 4QYZJ 3HD2A 2F4FA 4YR0A 3M8YA 4LF9F 2KHCA 4IKAA 2HVIA 3D1HA 3GFYA 4LFBF 2EFPA 1AROP 4B9SA 4NLDA 1W26A 3ENWA 1WEYA 4MMOA 1U26A 5LSLA 3E2EA 2ZNYA 5IT4A 2XTJP 4DX8H 4IR9A 3ZTPA 1FJEB 3US5A 1XNRF 3CO0P 4DL4A 2XM3A 1UETA 3L7PA 4DMZA 2HG4A 3QYYA 1Y3KA 2K3KA 1UFKA 5F0WA 4QR0A 2IC3A 2ZDOA 1ACMB 4X4PA 3EJMA 2Z56B 4DS5A 1RZMA 3CNQP 4F2SA 1T05B 4LSLA 5CCLA 2N82B 3CCSS 3B4DA 4QYRA 4WTOB 4OJ3A 3IG1B 1B0TA 1UWBB 1RLCL 4K4VA 1N8RT 4K2JA 4NCGA 1N32J 4LQ9A 4F36A 2CA9A 4DV1F 1CSJA 2J9DE 1N52B 3HHLD 3HKWA 3C6UB 1K0VA 3UCZP 1KS2A 3RJMB 1IBKJ 1YGYA 3TVYA 3D7SB 3OT9A 3WBZA 2VFVA 3UE2A 3ITHB 1QJHA 1CJUB 2D3UA 1ZAVA 1U1KA 3IGNA 4ECTA 4O3PA 2D74B 4AQYJ 3GPAA 3CWJA 4R0EA 2P6SA 3RAXA 4A8SA 4N8OA 1PJ6A 3GSIA 4ZLPA 2G9OA 5E41A 2ZC3A 4ES2A 2VZ9A 4WTYA 2G0IA 2VJUA 4Y65A 1NB2A 3G9CA 2XSJB 5J1PA 2X1FA 2ZH1A 1TL4A 1VQLS 2BUNA 4MIBA 3BQ0A 2R2SA 2OTLS 1LXNA 2IM0A 2ZH2A 1PCAA 3KHLA 3MM7A 3T1HF 3I4HX 2XBPA 5A8KB 5AE2A 5DDQC 4IH7A 3EE3A 4IH5A 1S1VB 2DRBA 5IWAJ 3FCVA 4Q8FA 2EK6A 1R0CB 5I4MA 4S0MA 1MU2B 2D9PA 2X1BA 2KH9A 1EETB 2UZAA 2Z4PA 1CBKA 1VQYA 2KI2A 4F0MA 2R8JA 5L1IA 2RDJA 4B3MJ 1JJCB 5HROA 2QJ3A 2A18A 2XMUA 4JI2J 2DH7A 4LF6J 3DU5A 3QIPA 1GQEA 2FY8A 3QNWB 5KG2A 1YJVA 4O3NA 5CYJA 2CNLB 2DEJA 3D6FB 2B6AA 4QW8A 3EM1A 2FJWA 3E8OA 4XTTA 3AJ2A 3TYTA 2DIUA 2EFOA 4P7VA 4YMEA 9ATCB 4DUZF 2MZSA 1NPRA 1R6VA 1FWKA 4LMZA 2DHAA 1R0AA 3D1OA 1I6JA 2K7JA 4NPOA 1B4SA 1OPZA 1TELA 2FPHX 1VK8A 4ZVSB 1NCLA 3PW7A 4LREA 3EZ5A 4JB8B 4P2SA 2YWHA 4OX6A 3Q24A 2HS3A 2J7UA 2F8EX 2V68A 2MJUA 5ETVA 3UCGA 1TK0A 4WF9Q 2ZBIA 2X1AA 3M8PB 3CD0A 2M8DB 1ZETA 3CJ2A 4AXJA 2IAJB 1PSDA 2M8HA 2QRRA 2HFUA 1KTVA 5AXLA 2RB7A 1VBKA 2YPZA 2NPFA 1T95A 2RF2B 1BE4A 3OVAA 3IG1A 3HM9A 1WUUA 1F9EB 2V94A 4B3TJ 4B3SJ 3U1LA 4DHVA 2BKNA 1UWBA 5KG6A 2ZBRA 1IQZA 1QLNA 1J5EF 2XGPA 1VMBA 4M5MA 3NGRA 4I6AA 4OI0A 3VF0B 2EEYA 3V81B 4OZNA 4DQIA 1U0HB 3DN9A 3UD4P 3PYEA 2G2OA 4RX6A 3MD3A 2POKA 5HVGA 4I68A 3M2UB 3ITHA 3P6YC 2AZ1A 2IJNA 1CJUA 4OLPA 1KC8T 3ZO7A 1JXVA 2OPSB 4EBDA 2HK3A 1IXKA 3HULA 3VWSA 3KLIB 2HHHJ 1LKZA 2J9CA 5LSOA 1K44A 3W61A 4RKUC 2G0JA 1KQGB 2K06A 1TQLA 2KU7A 4NL5A 3G96A 1JXEA 2JLEA 4KE5A 4X4NA 2ZBCA 3RB4A 4NYOA 2KB2A 2B51A 2V9KA 1U1OA 5T7LA 3TJ9A 3CE8A 4O3RA 3R27A 4LF7J 1O51A 1OY9A 3JQMA 4C6AA 3THPA 1VS3A 1C4AA 3GIIA 2QLBB 2E66A 3CCUS 4QBUA 3MPDA 4Q2LA 4WWSA 1S1VA 2DH8A 2RRNA 2MKSA 1SXLA 3BBCA 4M5DB 3M05A 4OV1A 4M5IA 1MW7A 2XG8A 1MU2A 1TTHB 1S5ZA 1URNA 4DCJB 1EETA 3DFEA 4K4UA 3J80U 4ED6A 1WG5A 4DQPA 1R8PA 4OYAA 4NEYA 1KKHA 1CEZA 5D8HB 2Y3YA 3OD2A 4Y2MA 3FGVA 4F67A 4JI5J 4ANEA 1SJQA 1LWEB 2FJEB 3BB5A 3MAAB 1RHUB 3IAM9 2AZ3A 4IO1A 2Y1RI 1V3RA 4A8XA 1ZM9A 1MNEA 3IRXB 2OPQB 4F02A 2B8QA 2CZ9A 3D6TB 2MXYA 1F5BA 4USIA 4URSA 5KAKA 2XMWA 4F7VA 3JYTB 3Q2TC 3AHPA 1X4HA 1Q8LA 4GO7X 2YQ3A 3MUMP 4BWMA 3OFHA 3ILLA 4DSKA 3GIKA 2CDRB 3KWMA 3I56S 1UVMA 2W1BA 3RRGA 3HHEA 2DITA 2W4CA 3DCAA 4N41A 3CJRA 2QLWA 2UXCJ 1JNZB 3FC9A 4Y2KA 4ZVHA 1HYSB 2BEFA 3BM7A 3HMJG 3KHGA 1KNZA 2XZWA 4KGVB 1G4CA 5KFJA 2DGWA 1H38A 2PIIA 4RBVA 4KB7A 3OR2B 4ZVQB 4EFAC 3VAIA 2KN4A 3DXSX 5KFRA 4K7QA 5BYQA 4E0DA 3RZAA 3AJ1A 2Q43A 3EPGA 3IBFB 3M8PA 3NS7B 2MKJA 3K8WA 1AFJA 5A6PA 3W63A 3QLHB 2IAJA 2DHGA 4ECUA 4JV2A 5DQGA 1NPKA 4CLZA 3OXGA 2HQDA 2E44A 3G6YA 2QFJA 2VASA 2HS0A 1H2VZ 2UVVA 2LQBA 3GONA 5FLXY 1XNQF 2ZVSA 1YHQS 1U4BA 3PX0A 5DG8A 4Q0BB 1ZH5A 4CT9A 2C2DA 3QT6A 2Q1LA 2V0NA 2OLWA 4OI1A 1TUWA 2QA4G 1NK7A 4C8ZA 3DMJB 1U0HA 3J7A1 2JRSA 2ZHBA 1F3FA 3AB4B 4DV3F 1TL5A 2BKPA 3THTA 5E3QA 4JI1J 1O8BA 3M2UA 3CC7S 1H74A 1W25A 2C2KB 2CJKA 3ZXWA 4P2FA 4P72A 3IBWA 4C8LA 1HNXF 2CQIA 3CVKA 2UUCF 4WP8A 3JXOA 3B82A 4EGLA 3RUBL 3GG1A 4B3OB 1XBWA 2JDJA 3QGHA 1BWEA 3CPWR 3GR0A 3MR5A 4F3OA 3HLUA 3R6GB 1FRXA 4I4BA 4Z7CA 1ITPA 2CKWA 1XMQJ 3LALA 2PGCA 1WOSA 4DV7J 2VB6A 1B99A 2FLPA 1S9EB 2Z30B 1JLGB 3RRHA 4OHVA 2VODA 2R8IA 4BC9A 4CO4A 3HJFA 2OMLA 1SJ1A 2ZBPA 3JAMU 2RRBA 4ETXA 4M5DA 1L3VA 2HZVA 4O23A 2RS2A 5MLCV 1QY7A 2HQ3A 3ENQA 3PY8A 2C2OB 1SIZA 2LCWA 3EDQB 3WX4A 3KLVA 4HYKA 1UVJA 3UD3P 1W7WA 3C15A 2L9DA 4K0KF 3PV8A 1VGYA 2UXDJ 4QU6A 2IIHA 3FMWA 2HYIB 1LWEA 3MAAA 4TNOA 4WFNQ 3UN5A 2XY5A 2DPIA 1IR0A 2HVEA 1IBLJ 3ZNJ1 4DL3A 4DL0C 2BMBA 3IRXA 3CCQS 2OPQA 4B3RF 4JI2F 4CO5A 5ETTA 2MHNA 2PDAA 1HW9A 1HWIA 3JYTA 2Y1JA 1TK5A 1FRMA 5B0BA 2J0WA 4OYMA 1T9YA 1B0VA 2HNDB 3MEGA 3M8QB 3HDSA 2RS8A
chains in the Genus database with same CATH topology
4ATNA 4DFJA 3DYAA 3E51A 1HI1A 3O3LA 4HH1A 2ZE2B 1FKAF 1RT6A 3J7YU 2WONB 4I2QA 3TI0A 1BQXA 2EFQA 5KFAA 3W2VA 3NP5A 2HHWA 5DLGA 1T03A 1HWLA 1V6HA 3KK1B 4J9LA 3POTA 4OI3A 2KKHA 4HDGA 1KOOA 4URGA 5HLFA 3IR7B 3MR6A 1BY9A 3DI6A 5HP1B 1QSSA 1HYSA 2N4CA 4RUAA 1TFWA 4ZHRB 4KAIA 1G2EA 4CTAB 3T6BA 1UEVA 5EGYA 2VD3A 3QWPA 4LSNA 4MKBA 4JI6F 1SKWA 4TQSA 4IH6A 1FKPA 5F3ZA 4B9MA 1RTJA 4TYAA 4RUCA 3MXHP 3D54A 2GMJA 2MMYA 2IRXA 4ZS6A 1JJHA 2ADBA 3OR2A 3RYLA 3M6XA 4DR2F 3SMZA 1BD6A 2N3LA 3CCZA 3H8YA 5FDLA 4DJBA 5KFPA 1HR0F 1E6VA 4NLRA 2XSFA 4FBTA 2KDOA 3CIZA 3IN5A 1RT1A 3JTOA 2KM8C 1S1TA 1D0EA 1IKVA 3NBPB 4ZOSA 2HNYB 1NJIT 2OMOA 3VCDA 2WHOA 3ZZZA 4EYIB 5J2QA 4JV0A 3SV3A 2J0XA 4D3HA 1Q1KA 4RW4B 3CCJS 4DF8A 1UJ6A 1MROA 2RSQA 3BQ1A 1S0OA 3MD1A 3AH6A 2FJXA 1TKDA 3HFKA 4A8KA 4OX8A 2E9TA 3QWUA 1WF2A 4X62F 1D9DA 4ES3A 4IR1A 4YB6A 2HNZA 2IM3A 2EFGA 2YKQA 3TUIC 2KT2A 2LEAA 3D28A 3MM5A 5K8MA 4WU2A 1K8AT 2FVCA 3LW5C 2E5HA 3V6HA 3R5BA 3TAMB 5F9NA 3M30B 5A8RA 2ALZA 2E1CA 5KFOA 3N28A 4ECZA 5BR8F 4N8NA 1L5UA 1B64A 3CCVS 2HWHA 1I1GA 1RGVA 2ZD1A 3AA9A 3DLBA 3H20A 3FEXB 4YB7A 4NCBA 3HO1A 2QO3A 2OSQA 4Q0BA 3L7OA 2IHR1 4KT0C 6FD1A 2MSTA 3R1HA 4OHXA 4ED2A 1V3SA 2L9NA 1FE4A 3ZZOA 5F9LA 4FXWA 4YQWA 4DL2A 4LIRA 5KFSA 3KTQA 3KG0A 1RT5A 5E5NA 2VQEF 4MYUA 5C25A 2VG5B 1PC4A 4CH1A 1HI0P 1Y0HA 3NL0A 2HLTA 1HPZA 4YB5A 3IRWP 1RAJA 3K5NA 4MYTA 3VAFA 3HHNB 3NG8A 2WOMB 4CNYA 4UUWA 3V6DB 3DMJA 4Q8EA 1U1LA 4J37A 1KOHA 4X4SA 2DNMA 1VK3A 2WB4A 1S6PA 3OW2R 2HRYA 1NK6A 3MTJA 2B5JB 3SSSA 2LQ5A 4CCHA 1HWKA 4OMFG 4I7FA 4RW6B 5GMKa 1LFWA 1YTYA 2XLJA 3HPOA 4I56A 1IBMF 4QCLA 2BRKA 2AJFE 3H2UB 3EXYA 1U48A 4F2RA 3V4IB 1RA7A 2KO1A 2IM1A 1X4CA 1FD2A 2VH7A 1IKXA 1RA6A 5AXMA 1QSLA 2HHTA 2EI5A 4AL6A 2LDIA 2DNOA 3T9NA 2XWXA 3DLGA 2V9WA 3SSQA 4EWTA 5K8NA 2DNNA 1SI9A 3DLEB 3G6VA 4HHJA 4G1QA 2XULA 1PC5A 1H7XA 2A2DA 2CG4A 4Y28C 3LH2S 4U67Q 1FO1A 3PKYA 4B9VA 4NYPA 1R8CA 1RT3A 2PI5A 4OZ0A 5DRKA 1JJ2R 2RJZA 5E3RA 2NUUG 2KXFA 2YX4A 1RT2A 3IAS9 1VQ5S 4O0IA 1KQKA 5BJRA 2YWGA 4ED8A 3P3DA 4QR1A 3VAMA 1YRUA 4IOBA 2DIVA 2Z0GA 3H4BA 4UQTA 4DFMA 4PPDA 4CT8A 4WYWA 4B3OA 1M90T 4ICLA 4HT7A 4OZ1A 5CHCB 1RK8A 4TLQA 4OJGA 4NCAA 4OZ5A 3PX6A 1B0PA 4ELUA 3K0JA 1FDDA 1JIHA 4MK7A 1FD8A 1ZM2A 1H7WA 1QE1B 3L95X 2W9CA 4NLTA 3DM2B 2FDNA 2B9YA 5FIIA 3I5CA 4ZP9A 1N34F 1X4BA 2WSCC 4O3QA 2VV5A 1L3TA 2LA4A 3HVTB 1IKWB 2BYCA 2FHJA 2GV1A 3FRYA 1X5SA 5EUHA 3UDLA 4BCAA 4KSEB 2JVRA 4M8LA 1VQKS 2YWFA 1M5KC 1Q86T 2NQPA 3EUNA 2YWEA 3I31A 2FVSA 4DSIA 5HMZA 4WFBQ 4X4RA 2XY7A 3BJYA 1S79A 1R31A 2DR9A 1KQSR 4LF5F 1UVNA 1X5TA 4JI0F 3NMAA 3HK2A 2RDIA 4B17A 2M5YA 4A46A 2DO0A 3SDEA 2F4VF 2BW2A 1JMTA 3U7JA 5DDOC 3OJUA 1TL1A 1Y00A 2VPYB 3Q22A 3F44A 4HH0A 4LFCF 3I0RB 5J1NA 5D3GB 1S9GA 1J2VA 1RYSA 2G4BA 4LF7F 4WK1A 3CDBA 4F4XA 2C3MA 1JLQB 2ZKTA 4QW9A 4Y3CA 4K4WA 3VZHA 1NK0A 4PWDB 3ZFVA 2R9LA 3M4XA 2HWTA 2GIQA 2MQNA 2RUGA 2XHWA 1BQMB 1QUPA 3PXGa 2C3OA 2MHEA 1RKJA 2BE2B 5A0YA 3DLKA 1JLBA 3Q8PB 3DLJA 3AY0A 5KFEA 2JEJA 2XMTA 4JI8F 5LMUF 3LP2A 2C42A 2H5EA 4GO5X 2HAIA 5DG9A 2I5JA 4ZPCA 3B8HA 2A2CA 3UFCX 2ZC4A 3SCIE 1S76D 3BGUA 3JB9k 3LWMA 2U2FA 2ZH4A 1S7HA 1YBAA 1SJ3P 3MEGB 2YX1A 1S49A 4RNHA 1IKYB 1GAOA 1RWUA 3PDNA 1MMLA 1N6QA 5DGBA 3K59A 5KOXA 2XI3A 2VBXA 3H25A 3GQCA 5LMNF 1UFWA 4IRKA 1TFYA 4LF4F 1YJUA 5EWGA 4GKKF 2VPWB 2DNZA 2P9GA 4I2QB 5KG0A 4IRCA 1D8ZA 2RKIA 1DARA 3W2VB 3W3SA 1VQ8S 1Z2ZA 2K1RB 2YWKA 4EYHB 2Q6CA 4LUBA 2MZ1A 5A6WA 4ZPVR 5JJBA 2QEXS 2CZVC 7FDRA 3LUYA 4U6PA 5HLFB 3DHXA 2F1FA 1P6TA 4ED5A 1K73T 3FRZA 3O8WA 4L6V3 1PILA 2MKHA 2Q6BA 2Z2LA 3MEEB 2DNYA 3RU0A 1FNXH 3OFEA 5AXNA 2KZZA 4ID5B 1C0TB 1WHXA 1SL2A 4N56A 2A1BA 1BQNB 1R89A 1VRUB 2R2TA 4AUKA 1FVSA 4OI6A 2GMHA 3VAHA 3S7RA 4KV8B 4F25A 1AXQA 3NNHA 3T1AA 2XGQA 3FZ2A 2W4DA 2C22A 1FJCA 4QJVA 1X7VA 3PACA 1KR4A 2FHJD 1VRTA 4RZRA 3CSKA 3MEKA 5T14A 5F8NA 3TAQA 2PE8A 1RISA 1NHUA 1N0VC 4FNHA 5FDLB 1CQNA 1X0PA 2N7YA 1SL1A 1MSWD 3TP2A 2ZZMA 1R8BA 2L08A 2J9DA 2HNDA 3MPWA 4U7CA 5G0RB 3NGDA 3M9OB 3M8QA 3MM8B 1XR6A 2JSXA 3ZZYA 1PO6A 2KTQA 1TUVA 4F4YA 1S1TB 2B7BB 4PXBA 5EDWA 3PRDA 4I1TA 1RT4A 2F3JA 3MOZA 4A4JA 3CIMA 3GILA 4ECSA 2YNIB 5I42B 1FRKA 1FRIA 2VPXB 2F8HA 3BF4A 5K8PA 4DFKA 5HMWA 1KHVA 1W2IA 2ZE2A 2MZTA 1HL6A 2B9WA 3V5RA 2HFZA 4JV5F 2WONA 1D3WA 3O5TB 1GXTA 1S4FA 3TVZA 1N33F 2Y0SD 3N6LA 3KLGA 2ZHAA 2HMIB 1YWXA 2HNZB 3KK1A 1NJXA 3CCRS 4NLUA 4K4SA 4FN5A 5H9FJ 1S0NA 4C8KA 5HP1A 2W24A 1Q79A 3A8EA 4HKQA 3KHRA 4ZHRA 1SL0A 1C2PA 1TKXA 4FBUA 4YB1P 4CTAA 1X4FA 3OBIA 1VIOA 2ASJA 2GA7A 4PUOB 4F4ZA 1NK4A 4O4GA 2GQQA 3AQOA 5DQIA 1FA0A 2UXCF 3VALA 5KFHA 1KSPA 3R5AA 3H5UA 5LSRA 4ZVFA 2MQMA 2N3OA 3PNIA 4BBYA 3GIJA 5JUMA 1FRHA 2M7SA 3PIOQ 2UP1A 5I3PA 3TA2A 4F4WA 2FIUA 4QIGA 5C25B 1U2RA 5IM0B 1NJYA 2IRYA 1SB6A 2VG6B 2D7SA 1HPZB 3NBPA 2FVPA 2HNYA 2G1DA 3MECB 1RTDA 1H98A 1N32F 5B0DA 2DO4A 1VLYA 5KFNA 2ZH3A 4RW4A 2QMWA 2FHKA 1ULRA 4DSLA 3I5BA 2DHSA 3MM9B 5T41A 1M5OC 2HFNA 3IGVA 3OL8A 5J2NA 1UVIA 2EC0A 4NZ0A 1LW0B 4HI2A 2B43A 1U45A 2DHXA 4PCQA 1IBKF 1UJ4A 4A8FA 1BGXT 4ILLA 2NLWA 2RQMA 4MJKA 2CPEA 2I1RA 4PXDA 2VFTA 3TAMA 3M30A 4IDKB 1IKXB 1HNVA 2CPZA 2DISA 1LW2B 5E3AA 3VR1A 4DUYF 1Q7YT 4RNNA 2UU9F 3HVAA 1VQ6S 3DLGB 2V8GA 3PEHA 1WHWA 1FK9A 1N54B 1TP7A 1WF0A 1DQAA 2RRAA 5CXTA 2DR5A 3HVWA 3PO5A 1MMNA 1X8DA 2IVYA 4C8NA 4WFYA 3N6MA 5G4DA 2MDAA 4DQSA 1ZTWA 2O1PA 2JOQA 4RU2A 3IWNC 2HGMA 2VUGA 1RT2B 1AW0A 5EX3A 4KR0B 1FRJA 3H59A 3FNNA 4ES1A 4PXEA 1U47A 1UFLA 2P9CA 4AQYF 5E33A 2VG5A 3CJ0A 3O44A 3PVXA 3F56A 3U1NA 4ICLB 4ZKAA 2F8MA 2EW9A 5KFLA 1ZAWA 2AJ1A 2GIRA 3QPIA 4PXCA 2ASLA 3KLEB 2WOMA 2CQ1A 2CDQA 2UUTA 3B4MA 3MI7X 3N9UC 3V6DA 3R1LA 1U1QA 3OL9A 3OVSA 1TR0A 5KT3A 4IFVB 3ZZPA 2RH3A 4FF2A 2AYGA 1K0TA 1KTQA 1KHWA 1O0PA 2B5JA 1X4EA 3UNGC 3RB3A 3DRSB 2QT7A 1REVB 4RW6A 5KFWA 5AJ3F 5CA5A 4FF1A 5CQGA 2J0QD 4JI3F 4OX9F 2R7OA 2UVRA 3KK3B 5BYRA 3GYNA 3M32A 4NX9A 1M1KT 2M88A 3SSRA 4M94A 3OJSA 3V4IA 2I38A 1T94A 1S99A 2CQPA 4TXSA 1S48A 2MPUA 3QMQA 2XS5A 2KZMA 5FJ4A 3PR5B 2MB0B 1Y4ZB 3H4DA 1CVJA 3SDEB 2DGXA 2Z2MA 2KYXA 3ENVA 2A10A 3TUJC 5J2MB 1VJWA 3GWCA 3K2YA 2JJ4D 3BN4A 4CO0A 3HZGA 3MMBB 1U1NA 1JKHB 4MK9A 1TV6B 4JI4F 4X66F 2QZ8A 2FVRA 1DQ8A 2ZH7A 3OTCA 1QTMA 4RBTA 1YRXA 2G0CA 5A2QY 3BDEA 1DURA 1R6YA 3M6VA 4K2XA 2HHSA 4QWAA 3MR3A 4DN9A 4NZ6A 1U6BA 5DM7Q 3G71S 2XMJA 1H0HB 3LQVA 1T3NA 1FHTA 3BSCA 4ALZA 1NJWA 4KGMA 3H2LA 2NREA 2L41A 2DB1A 2M3DA 4ED3A 1KLNA 2OJ3A 1FDBA 4OI4A 3PM9A 4J9RA 1PGZA 3SXLA 3IWLA 1QE1A 4DBQA 2J7WA 3PEJA 3K5MA 2ZJPQ 4B9UA 3DM2A 2QA4S 3T5JA 2I5JB 4KFBA 3P5TL 3KLHB 2KYZA 3MCSA 1F9FA 2CPHA 3I96A 3NAHA 1IKWA 2QLXA 3FEZA 1X4AA 5IT9Y 1JLCA 1HNIB 3PR4A 1S6QB 2WCXA 1XERA 2JLFA 3H5YA 2OAUA 2Y1IA 5IWAF 3NS5A 4Z37A 4Q43A 4WFAQ 3ISND 1N6QB 2MJNA 4YY3F 4WU3A 4NLVA 3D0GE 2EKYA 1VQSA 1C4CA 5LJ5Y 3IS9B 5U47A 2E29A 1JLEB 2GX8A 2IC3B 1WELA 2YKNB 1NKBA 5IQQA 4FPRA 2PEHA 2XWYA 1S1XB 5DG7A 3KNAA 5IFMA 2DGUA 5KFDA 3J7YI 3JTNA 3U02A 3CGIA 3WC2A 3I0RA 4NMLA 5D3GA 2G13A 2JZ5A 4O3OA 2Z8QA 2FLLA 1JLQA 2RMLA 4PKDB 4B3MF 1NHVA 1GX5A 2YKOA 5KT6A 2RNEA 1KVIA 4E98A 5DETA 4QWDA 3K7RA 1BQMA 2BJEA 2LQJA 3Q8QB 4LSLB 3DXBA 2BE2A 2W25A 2KT5A 3NCQA 1XMOF 1N5YB 1U49A 4LF6F 1VBYA 1YJRA 4FNIA 4Y34A 1S72S 3C66A 1FJ7A 5KFKA 4A8WA 1VRTB 4DLGA 2WBRA 3QZ7A 3T5LA 1HWUA 3HHLC 3GMGA 1JJ4A 1C0UB 2W9AA 2AYEA 2J5AA 5B0CA 3UDCA 4C8YA 3DRRB 2UV8G 3I5AA 3LGNA 2VFSA 1P1LA 3QGGA 1CLFA 1IKYA 4WE1A 3D1QA 3TANA 1ZBTA 1RT4B 3DLLQ 4NA2A 4BC7A 2O66A 1JK9B 4HEA9 3CDWA 4FF4A 2FTRA 1XC9A 5F8HA 2R2UA 4NCGB 1KVJA 2CQ4A 1XWLA 2MKKA 3W2WB 2YNHB 1YQHA 2H9ZA 5L1JA 1WTBA 1SBRA 2N7CA 4IQXA 5E3PA 3KLGB 2K1RA 2E7XA 3N5BA 3KNGA 2XY6A 2MQQA 2LEPA 2AJ0A 1UAWA 4OIXA 3RAMA 4ZPAA 4KHRA 4IG3B 4K4TA 1ROFA 2ZH9A 3NKYA 3GE9A 3MEEA 3M8SA 1D9FA 1OS5A 2CQ2A 1TKXB 2CVIA 3OTOF 4ID5A 1C0TA 1T05A 4KRWA 2DRAA 2W7OA 1BQNA 1VRUA 2P6TA 4H4KA 1VQPS 3V6JA 2BRLA 4O4GB 2YVSA 4KV8A 3M2RB 4HI1A 1NH8A 1XMBA 4PG5A 2VC1A 3HHKA 3P49B 4TU8A 5DS7A 5D4NA 5D4LA 2E5IA 4Q45A 3M2VA 1ZM4A