3N5BA

The complex of pii and pipx from anabaena
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKVEIVVEDNQVDMVVDKIIAAARTGEIGDGKIFISPVEQVIRIRTGEKNTEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
pubmed doi rcsb
source organism Nostoc
molecule tags Transcription regulator
total genus 23
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n5bA00
1V3SA 3T9ZA 5D4OA 2PIIA 3CE8A 2NUUG 5D4PA 2J9DA 4C3MA 2E66A 4OZLA 4CO2A 2GNKA 2EG1A 4CO5A 4USIA 3NCQA 5D4NA 4C3LA 4USHA 4OZNA 4WK3A 2XULA 2XBPA 4RWXA 1HWUA 4RX6A 4CO0A 1Q1KA 1VHFA 2CZ4A 2EG2A 5L9NA 3NCRA 2NUHA 4NYOA 4AFFA 5DS7A 2GX8A 1O5JA 3X3UA 1P1LA 3LF0A 4YB6A 2ZFHA 1XK8A 3OPKA 4CNYA 4CO3A 2JJ4D 3AHPA 1V6HA 3HLUA 4YB5A 2VD3A 4RWWA 3TA2A 3N5BA 2J9CA 4WK1A 2O66A 2DCLA 3GSDA 4Y6IA 2GW8A 4NYPA 4RLEA 4D3HA 1NZAA 1NH7A 2XZWA 3TA0A 4ZK7M 4R25A 4CO1A 4E98A 1OSCA 3TA1A 1QY7A 1J2VA 2J9DE 4C3KA 3O5TB 3BZQA 1NH8A 4IYQA 2O67A 3AA8A 2V5HG 1O51A 1PILA 2ZOMA 2J9EA 3DFEA 5D4LA 3O8WA 4YB7A 3L7PA 4D3GA 1UKUA 2Z0GA 3NCPA 1VFJA 1H3DA 1V9OA 3AA9A 1NAQA 3AH6A 1V3RA 5DRKA 4USJC 1UFLA 1UL3A 2NS1B 1UMJA 2RD5C 2XG8A 4CO4A 1GNKA 1KR4A 4CNZA 4OZJA 4Y65A 3MHYA 3M05A
chains in the Genus database with same CATH superfamily
3KG4A 1GTHA 4GO7X 4DMZA 4CWBA 4KGKA 1YK9A 1M5OC 1BQXA 4B9SA 1DHMA 2AW0A 1YJUA 3UCZP 3HPOA 1FRLA 2LA6A 4NYZA 1S0MA 1X4EA 1HFEL 2CQGA 2D7SA 2C2RA 2V4RA 3K0JA 4KGXB 2R2TA 2QO3A 1M5SA 1W7WA 1A7GE 2Y1IA 3CMQA 4WZQA 4ZS6A 4Y6IA 2EC2A 1IKVB 3JXOA 5LJ3Y 1NHVA 2J7UA 3FQLA 1S9EA 4NXMJ 1SUQA 3IC1A 2Y8WA 1QM9A 4LF8J 1C0UB 1PJ7A 3P5BP 4O3PA 2QX0A 1SKSA 4C8KA 4C8ZA 3D28A 2K2PA 1CJVA 3TJAA 1Q8KA 2XM3A 3MPDA 5HVHA 4JB8B 1MU2B 4ZPBA 3TP2A 2MXYA 3E3XA 3W2WB 2V6AA 3CDUA 1H7WA 2CG4A 3C16A 3QJLA 4OZJA 5ADZA 1C0TA 1KR4A 4RW8A 2GAGC 1F2GA 2HNDB 1F9FA 3SCKE 4KJIA 4MKAA 4P72A 4X4RA 1FKOB 3ZZUA 2HLUA 3MOZA 3OL6A 1GAOA 2ZITA 1V3ZA 1HMVB 2X3DA 1WELA 1T05B 2ZFHA 2N3OA 3ULHA 1S1UA 5L39A 3JAMY 5HSPA 2DNZA 2E5LJ 2CPYA 4QIEA 1T9YA 1N48A 3EXCX 2ZC4A 2HHPA 1ZS6A 1NJYA 2L9WA 3RG6A 3RB6A 3ZFVA 4IG3A 2VL1A 1WOSA 3CIZA 1NK5A 1F0XA 1R31A 1KRPA 4LBPA 3R7NB 4OYBA 3ISZA 5ETSA 5A2QU 1E6VB 3M1VA 3TO8A 3CDBA 3BKFA 5C2CA 3LPYA 5F0UA 1XBWA 3AFGA 4BLGA 3MZIA 1DQ9A 2Y9HA 5K14B 2MQPA 4AE5A 1FKAF 3DMJB 4EK2A 3MEDA 5JUMA 3M6XA 2UVUA 3JB9k 4DQQA 4R5PB 4RWXA 5CYJA 1CULB 1YGYA 3GIRA 3IWXA 2AGQA 1Q1KA 3SDEA 2VJUA 2M2BA 4DUYJ 4QQBA 5DS7A 2FJVA 2JHEA 2HQGA 3A8KA 5E0OA 1IUJA 3HHLB 4PAAA 4WFYA 1H2TZ 5D0HA 3HLUA 4RWWA 4LRAA 3OW2R 3HVRA 4OZ2A 3NOCA 2DNNA 4KIAA 4DQSA 3UWTA 2YKMA 1JKHB 2F8HA 1FESA 2OPQB 4J9VA 3OUYA 3EVMA 3NL0A 3G82A 1UPMB 1S6PB 1VISA 3DRPA 1CLFA 1IJEB 2MZQA 4PABA 3AH6A 1U02A 4HT5A 2QJ3A 3LUYA 1BQNB 3R97A 2HIYA 4W92B 3ZTSA 4HVZA 4LF5F 1KVIA 3LANA 3S8SA 3W8PA 4Q0BA 4ZLJA 5AJ3J 2CNLB 3KLEB 5KFKA 4K2XA 1Y00A 1XNQJ 1U1MA 3RAMA 5CXTA 4QIGA 4DV5F 3D3BJ 1TUVA 2HFOA 1I51B 4RBUA 3AD8C 5A0YA 1V5VA 5ETQA 3V4IB 3VHQA 1UW9A 3RTVA 3I32A 3KK2B 4O4GB 4E8UA 1N5YA 1DQ8A 3FQKA 3W5ZA 3NG8A 3V6KA 2CPFA 3W62A 2Z2YB 1RU2A 3RR7A 4YEAA 1VK8A 1QAYA 3A3PB 1I1GA 5CHCB 4FS1A 4ILRA 2KM8B 4X84A 2HK3A 4NLYA 2CQHA 4NEZA 4URSA 1DURA 4OI2A 2DB1A 4A8FA 1OY9A 2BRKA 2LQBA 2EC0A 2IM2A 2CWKA 2D1CA 4FBUA 1BWEA 1HW8A 3DDIA 2RRBA 2W2NP 4YHHJ 2VC1A 5J2MA 1RHRB 2UZAA 4DLEA 4ZHRA 5K8PA 1Y7PA 3NAIA 1TL7A 4C3LA 3TUZC 1Y5IB 1X4CA 1XERA 1RHUB 4WFAQ 1VHFA 2FJDB 5CQGA 5KFFA 1RA7A 3PNIA 4FNIA 5I42A 5CYMB 1ACMB 2JEJA 4QCLA 3BYPA 1QAJA 1DBDA 5JVHQ 1RAEB 2IMWP 2JC0A 2FC8A 1ICEB 4WK1A 2ZM6J 1U24A 2GV1A 3C16B 1HW9A 1SQGA 1VIXA 3CDEA 1EARA 4RW8B 1U1PA 4I2PB 4I69A 1NXIA 3UW1A 1HI0P 2ROPA 4B3RJ 1AYEA 1V9OA 4NEYA 2CWXA 2ASDA 5C24A 3POTA 2HHSA 3O1LA 4DV3J 2R7QA 5G4DA 2IA0A 2B5JA 3M6UA 1LXJA 4OZ1A 4Y65A 2Z2LA 5E5NA 2C2EA 1VR6A 2WW8A 2D3ZA 2CG8A 3QSYB 2W8LA 1X4AA 2EFGA 3OSNA 1WDTA 1P9YA 3MPYA 5KG1A 3K5PA 1H7XA 2CZVC 2X1AA 3C66A 4CM0A 5L9NA 3H0PA 2VZ9A 3OXGA 2GVDA 1H38A 2JLGA 4BHQA 2MQNA 2ZD1B 4OX9F 3MM8B 4K59A 5F8MA 4NXNJ 1BGXT 1KOHA 2WVBA 4ETXA 4DR7F 4B3SF 4Y34A 2G1HA 3HK2A 2JDJA 4DOZA 2I38A 2BJDA 4ED7A 4F50A 5MLCV 3FRYA 2UVRA 3C2PA 3MFHA 1X9SA 1MROB 3I4PA 4A48A 3LTOA 4UY8T 3MEDB 4YP3A 2KDOA 1NM2A 2D74B 2ZBIA 3SDEB 2W8KA 5A8WB 2CQ2A 2OJ3A 5IC6B 1FFGB 1G2EA 1ZPWX 3H7HB 3PG9A 4O3SA 4LRCA 2IIHA 4ZPCA 3NP5A 3FFIA 1X4BA 2QC3A 5A76A 4HT7A 2OTJS 3A3NB 3MMJA 3ZZZA 3D4JA 3IWLA 4IFYB 2H5EA 1Y4ZB 2IM3A 2HQFA 3QRPA 4JI0F 2F8MA 4F3QA 4ZVQB 3ELHA 4NASA 4X4QA 2NCKL 1FJEB 3U7JA 3DRPB 3NY0A 2RMLA 2YVSA 4I6AA 1WEZA 2U1AA 3TRGA 4ZP6A 2PN6A 3VALA 2BE2A 4TLQA 2DHGA 3MMAB 2DGOA 4ZP8A 5DJBA 2ZE2B 3QIPB 2UVWA 3VAJA 4U7CA 1PJ5A 5HROB 4F2RA 3KLGA 3LP2B 1RT4A 1TL1B 4JI6J 2X7IA 5HVFA 3HJFA 2VOOA 3KXDA 2MZTA 2VONA 3OL9A 4K8RA 5B0FA 2COLA 5D8HB 1SQEA 1N5YB 3MF5A 3R5JB 3ITHA 2A6OA 1PYOB 1N34F 3KDNA 3NCRA 2QFJA 3AD7C 2JSXA 4JI2J 3K8WA 2RH3A 3GB0A 3CJ2A 1EB0A 2RQ4A 2ZUGA 2FGOA 3DLKA 3CC2S 4JI4F 1S49A 4DV2J 3ONQA 3ZZOA 2GIFA 4EO8A 2FZKB 3DRSA 3PFEA 5J2MB 4DPTA 1O51A 2WSEC 4YQWA 3DXSX 4J9MA 2RS2A 1S9FA 1WC4A 1V3RA 3GLJA 4BBYA 3UD3P 1X0FA 3PJ9A 3M9OB 3HDSA 3HVTA 3K2YA 5AE3A 3GPAA 3ILOA 2RU3A 4ECWA 1FFSB 4MFBA 3ADAC 4OV1A 3GR1A 4PWWA 4CIOA 1HNZF 4RX6A 2DYAA 3SI8A 5HL7Q 4H4OB 1B3TA 2RJZA 4DEZA 2MKYA 2HWTA 4IO9Q 2XWYA 4WTOB 3ZC4A 3KJVB 1U0HB 4AD6A 1YJ7A 1SL2A 4O4RA 5J2NB 3DRRA 4OZ5A 1EQMA 2VDHA 4RLEA 3MM5A 5J1NA 2B5JB 2HYIB 4UY85 4NLWA 5HBMB 3VAKA 1T9TA 5KT3A 2XB2D 4J9RA 5KT7A 4ED1A 3CVKA 4LMZA 2O1PA 2DT9A 3JQJA 1TZ0A 1OWXA 1VFJA 2CRLA 1FRXA 1H2UX 3D3CJ 4TY9A 1YSJA 1LWFB 2GVDB 2KT5A 4KYZA 4LRFA 4M5DB 1R6VA 3M05A 4ZN3A 5ETMA 3W66A 3EDQB 2DPJA 3PKYA 3R5DA 4KFBA 2HFNA 2FJWA 3VR1A 3R6LB 4UOCA 2OMOA 2Y0BB 3H2LA 2ZWPA 4R8UA 2FC9A 4P9SA 3BSCA 4RNOA 4ZJOA 3X3UA 2B43A 1F9HA 3SCJE 2HMIB 3A1YG 3D5MA 5B7WA 3MR5A 3W5XA 1RTIB 1UVJA 3MR3A 4N5SA 3D6MB 5H9FK 1RP5A 3IN5A 2AYBA 4R25A 1S1WA 3PY8A 1RT5B 1Y5LB 2W4CA 3B8HA 3R5CA 4DR2F 1FXLA 1VRUA 1PILA 2VODA 5L8RC 1DRZA 4N47A 3WC2A 2LMIA 2IDLA 3ZZYA 5FLXY 3G6YA 5CA5A 3MTJA 2VPWB 3OSPA 2MHEA 1SJQA 3I0SA 4F67A 3EPIA 5ITHA 4LFAF 1VBYA 3CCLS 3M6WA 4LF6J 3UI3A 3PJWA 1CQMA 5B0CA 2DGWA 3V5RA 2DD8S 1EIYB 4OLOA 1M5PC 1RAGB 2XMVA 4C4WA 5MAOA 2YNGA 3N01A 3OFHA 4GKJJ 2RQMA 1JXEA 3EDRB 4CT9A 2W2PP 4QIVA 2YKQA 4OV6A 3IP0A 4FYDA 3OTCA 5F0WA 4QJVA 4MIWA 5DO2A 4LJMA 1U45A 4CLWA 4PG6A 2FIUA 1QSYA 2OTLS 3HM9A 2AYGA 1RTHA 2E1AA 4GMKA 3Q2SC 3W2VB 1N32F 2DK2A 4DXLA 4MK9A 3M8WA 3TYTA 4RNNA 3WC0A 4KSEB 2M88A 2DO4A 4LIRA 1WC0A 3EXYA 4NXMF 2QLJB 2BQ3A 4OI6A 1S0NA 1S48A 2IY5B 3R7BB 2J0SD 1R0BG 1Y11A 2NYIA 1H6KX 5IM0B 1PO6A 3MPUB 1ZM4A 3QWUA 1Q86T 1D0EA 2CNOB 2B6AA 3CJKA 3DRSB 3ZZRA 3PYFA 1HNVA 4ENOA 1D8ZA 2PSZA 2CQDA 4DV1J 2M9KA 2I2YA 4LR7A 4IOBA 4DV6F 3E51A 3TA2A 1U1LA 1GMVA 4TU9A 4FN5A 2J6SA 2JC1A 5EGYA 2YH1A 1OPIA 3M32B 4K5RA 1U1RA 5F8LA 3GE9A 1G4CA 1VLYA 4DI6A 2PA8D 3K7RA 2ZOMA 4K4YA 1SBRA 2E5LF 1JLBA 3FMWA 3TQEA 2OSQA 1NEEA 4WF9Q 3WZ0A 1PBAA 2GQQA 3EGVA 5F8IA 2WVCA 1HD1A 5F9NA 1R0CB 2B0GA 4EWTA 4J9OA 2Q6BA 2HG4A 2LP4A 4OYPA 2C2KB 3HKZD 5DG9A 2JL9A 2FPHX 3DRRB 1P8GA 3AODA 3MM5B 1O6XA 3S01A 1GXUA 1B0PA 5I4MA 4J9KA 4JI1F 1SJFA 2KJWA 2J0QD 1BE4A 4DCJB 4JI7J 3IRXB 3G8QA 3L95X 2BACA 4QIWD 1RWPB 1GMUA 4P73A 4PXCA 1S6UA 4DUYF 1KKHA 1DY3A 5A8KB 1FKPA 1CS4A 2JOQA 4Q2MA 1OMSA 3PIOQ 2WOMA 4CI0B 2HAFA 4JI5J 2BR0A 3MEKA 5CABA 2E5GA 2VICA 2L3MA 1X60A 1DTTA 2IJFA 1DLOB 3BPSP 1S6OA 1VI7A 2QL9B 1TFYA 1KOOA 4ZPTR 4A47A 2HS4A 1RBOB 2XI2A 4DCPB 3LGHA 3MAAA 4FYXB 2DIUA 3M2UA 4FS2A 3UR0A 2L9NA 5HMZA 4JI3J 1VBZA 5AJ3F 1GQEA 1VRUB 4I68A 3F0NA 3H8YA 3GWCA 4OIXA 4YR2A 1OYEA 1KSPA 2LDIA 3TQ1A 4YS2A 2DNYA 3CT9A 5ETOA 5GAHU 4DBQA 4EBEA 4ERDA 5A8RB 1SV5A 1UTAA 2BJ9A 1AUSL 2BYCA 1NZ8A 3SCLE 3MM7A 3R6GB 4A8YA 3PX6A 4DU7A 3SFGA 4DUZJ 3UR3C 4BS2A 1KFSA 3Q8RB 2CQ3A 2OLWA 2QRRA 4ZP7A 1NRKA 2FJBB 4FYVB 1U48A 2K7JA 2PDAA 3ET6B 2FVCA 2DH7A 3SQGB 3RBXA 3QGHA 2FZGB 2XBPA 1YQHA 2UXDJ 2R2RA 5J1EA 5E2QA 5J1PA 1KDNA 4OI3A 1HWLA 3FBCA 4L75A 4HDHA 1F9EB 1UJ4A 3P4UB 4CP5A 3AJ1A 4J9QA 2R8IA 3MECA 3W3SA 2XGQA 1N6QB 2WBRA 3VVTA 4ETZA 2ZVSA 2DGVA 5H9EK 5H1SV 3HD2A 2AEMA 3UD4P 4OHXA 2QA4G 2MHNA 1FF2A 1M5VC 2ZH7A 2MQQA 2DNQA 1OYDA 2I6WA 2Q79A 1XTZA 1U09A 2ADCA 1HL6A 3WBZA 4J9PA 1H98A 1R6YA 1Z4UA 4PCQA 4LF4J 2Z2MA 2GAHC 2F9DA 2O67A 2RAQA 4E2FB 1JK9B 2Q6CA 4DX7A 3T9NA 2HRYA 3R7SB 1RYSA 4DHVA 5IS2A 3DU6A 4QR0A 1JLGB 2ZM6F 3IO1A 3PO5A 1GNKA 4DR5J 4DL3A 1RISA 4CM2A 4DFKA 3GJTB 2HWHA 3QAUA 5BYRA 3DOLA 1HNVB 2Z2ZA 3T19A 2GNKA 3HHKA 4CLTA 4F26A 4WU3A 1UETA 1FXDA 3GYNA 4B3RF 3KLHB 3SSQA 5DQIA 2BW2A 2MLYA 1YIJS 3T3FA 2VG7A 4K2JA 4ID5B 4ED8A 2NREA 4P10A 5FIIA 3CW2C 2D3O1 2CPDA 1D9AA 4M94A 4C2MA 2IM0A 3V6DB 3BPDA 3SBMA 2XS5A 1JNZB 1SIWB 3LAKA 1TAUA 5HQ8A 1BY9A 1M1HA 1ZZFA 2KYZA 3IBFB 4ED2A 1XNRJ 1WSVA 2V8VA 1JLCB 2YKNB 1N5QA 3GIMA 3SSSA 4RW9B 9ATCB 2FD2A 2WRMA 2Q66A 1L3TA 4NLRA 2UUAJ 2VFUA 4JP8A 4I4BA 3EPGA 3U27A 3THTA 3FKBA 3TNVA 4Q43A 3HHLC 2MKHA 3MOJB 4ZLPA 2R2SA 4I1TA 4O3QA 2HVDA 2DITA 3L3CA 1TAQA 1FKPB 1CS4B 4NZ0A 3IAS9 2AX0A 5C7PA 4K50A 2PD1A 4NA3A 2KXNB 2QSWA 3LP0B 3BYRA 2CXEA 4LF2A 4QOTA 1YRTA 2QL5B 5F9LA 5E3RA 3QT8A 4NZ6A 3HFZB 2DGUA 1LFWA 4KC5A 3DYAA 3VVUA 2JLEA 3QFWA 3OL7A 4ED4A 3J7ZT 1BD6A 3IXQA 6FD1A 2HHUA 4CLLA 2A10A 3E8OA 5KG4A 3MAAB 4XAKA 4M5KA 4ES1A 1CJTA 5G0RB 4I2QA 1VC0A 4Q44A 3BR9A 1KHVA 3TVYA 5B0GA 1C4CA 2DH8A 2H5IB 1C1CB 3FVYA 4DV0J 4QWAA 1Y3KA 1TELA 1SJ4P 1QSLA 2KH9A 1OIAA 2GGPB 1U25A 4CDIA 3MI7X 3LWLA 3JTOA 1I3OB 1MSWD 3CCSS 2W25A 2CAJA 1NSKL 3J7YU 5FJ4A 5K9FA 1NDKA 3ILJA 3I5CA 3CCMS 4H4KC 3AB4B 2DPIA 2KTQA 4JI6F 4DR1J 3V6HA 4TNOA 4HR2A 2KM8C 4CNYA 1RT7A 3D1QA 2OMLA 3FCWA 3ZTRA 3FGVA 1NB2A 4YY3J 1RWNB 4CTAA 2BABA 4KV8B 2X3GA 3R3TA 4RW6B 2DNMA 3MR7A 3QLHB 3IRWP 3DDKA 2LU1A 3LA0A 2KU7A 4WIQA 2P2CB 4Y2KA 3OXFA 3QMQA 4WE1B 1W2IA 1GEHA 1S77D 2J6TA 4UOFA 3PW5A 4QWCA 2WTFA 4DV2F 2RT3A 1SL0A 2IPOB 2RDDA 2F4VJ 5IQ6A 2W2QP 3A8EA 3UVJA 1LV5A 1FDNA 1QD1A 2PE8A 2W9BB 3MECB 1U2RA 3V6JA 4L73A 2DXEA 1IXKA 2HVEA 2VG6A 3VAMA 4UTGA 2IFXA 1A9NB 3NNCA 5EWEA 3KG0A 3OFGA 4RW7A 1RT1A 1GMWA 2MZSA 2C3UA 2IBOA 1PAEX 2CJKA 3TR5A 1KLMB 2UUBJ 1VQMS 4ICLB 1FHTA 2C3PA 4DSLA 1HHTP 3CJ8A 3LO3A 2B9WA 5KFUA 1PJ6A 1RE1B 4ES3A 2YKPA 2CNNB 1RWKB 4N8OA 2VFTA 1EKSA 3E2EA 3NWRA 2E5HA 1C1BB 3MGJA 3RRKA 1FTRA 4RO0A 2HBZB 5KFTA 5CAAA 1RTJB 4UOGA 2DHHA 2C3YA 2RDJA 1UFLA 1OS5A 3KJNB 2NS1B 3DLGA 3OJUA 1RT6A 2ZH9A 3QT7A 1S97A 4DV7J 2YWEA 1I6JA 3FSXA 4BWMA 4WP9A 3DXBA 2FVSA 7FDRA 2XY6A 2FGCA 3CE8A 4YR3A 2PT0A 6FDRA 2DEJA 4KH1B 4IFVA 3L7OA 2QGFB 2E7XA 4AQYF 1PSDA 1HWJA 1L3SA 2XI3A 2HFZA 2QL7B 1K9MT 4B3MJ 3ENWA 1JX4A 2WSCC 4OZ3A 3D6HB 1JQGA 4A8MP 5I3UB 4CQ1A 3GFZA 3M8SA 2DR7A 3H4BA 4CO3A 3CDAA 4IDKB 3J7Z5 1VQNS 2GHWA 2X51A 2AJFE 2H48B 1J2VA 3M8QA 4N8NA 2QT7A 3IR6B 4A8WA 3QJPA 5JXSA 5CYQB 4B9NA 1WC6A 1JIHA 2CJAA 4ZLNA 2OPSB 3AJDA 5GMKa 5FDLA 3DLEB 1FX2A 1HNWJ 3RZAA 1X9WA 2VIHA 4B9MA 2ALZA 4DQIA 4MTPA 3TAPA 4AT1B 1JLQA 4UZBA 3UDEA 4NCGA 4BDPA 5D4PA 2MKIA 1R7IA 4HYKA 4U7UD 1SC6A 4KB7A 3PXGa 2UU9J 1HBMA 2G2YA 5KFPA 2P5VA 2CDRB 4OZNA 1TU0B 2R8JA 3KOAA 1I94J 2QSFA 3DYAB 1UA0A 3FDSA 3QT6A 4S0MA 1WC1A 1KD1T 3RGIA 1O5JA 3WQPA 2HQDA 2CJXB 1B7YB 3DCAA 2IJNA 2E9TA 4YDDB 2HHHJ 2YWGA 2V2ZA 4NA2A 1QLNA 4OJ3A 3FUYA 4WFBQ 2XZWA 2EPIA 3HHLD 2EVZA 3RRHA 3IBWA 3SEOA 1S1VB 2HURA 3NAHA 4GKJF 3MM6A 1ZH5A 4X66J 3W64A 3HP6A 1FEHA 4HACA 2V68A 1UWBB 2DXFA 4OL8A 2W7OA 1CJUB 2HS0A 1D9FA 4EO6A 1PYTA 3D67A 3KHLA 3V81A 1TV6A 2FY8A 2NSBA 3Q0AA 4ANDA 1UZHA 3M2VB 1J5OA 2J8SA 1RU1A 4OZLA 1YHQS 3PIPQ 2ZUAA 4ZPAA 5JMNA 3DRXA 1VGYA 4CCHA 1R0AA 2EEYA 1PGZA 1Q82T 4CTAB 5EWGA 4GVBA 1F5CA 1VC5A 1E6YB 3TZXA 2UUCJ 3I0RA 3GIKA 5FLXU 3G4SS 3BB5A 1PKUA 4JYAF 1XWLA 1SJ1A 5J2PB 3IBCB 2K1RB 3LGMA 3EJMA 1HNXJ 2H54B 4ELTA 3TZYA 3ZNUA 3QAEA 4X4PA 3OQ2A 4RBTA 2ZH4A 5KG3A 2IC3A 3AY0A 3A3OB 3KWMA 1X5SA 1T94A 4E98A 1XEZA 3PCOB 4B9UA 5KFOA 4L74A 1U0SA 4LSNB 3CMAS 4OX7A 5IC4B 2R42A 3J80Y 2XEXA 2VBWA 1FJGJ 2J5AA 2JNJA 3SCIE 3T6BA 2YXLA 4ECQA 1UJ5A 2VG6B 3DOMA 3JQMA 3JS9A 3CMES 4RW7B 2ATCB 1I5OB 2XLKA 1WSRA 4K4ZA 3VQSA 1DTQA 4M63A 3OBIA 3GZ7A 5IWAJ 3WIUA 3QQCD 5KFAA 2VBYA 3CCES 1RAOA 2ZZTA 2NXNA 4HH1A 5SUHA 1RBLA 2F65A 5LSLA 2RRNA 1KONA 4OI1A 2XMMA 3TAQA 4Y2MA 3V4MA 4B3OA 5EN1A 1LW2A 1LFPA 3NS6A 2IVYA 2ERRA 3L9ZA 2ADBA 2MMYA 2LCWA 1K1QA 1GK8A 3HVAA 4XDCA 3T5JA 1WG5A 3G86A 4Y2AA 1K73T 1FXRA 2RNEA 1VOMA 3DLGB 1RT6B 2DR6A 5EUHA 3DI6A 8ATCB 1PC4A 1OSCA 4W90B 3U1NA 1VQ4S 2YWWA 1M90T 2IYIA 1GX5A 3CCZA 4RBVA 5IQQA 1T03A 3GFHA 4JI7F 1YBUA 1KQKA 1B4SA 1M0SA 1X0PA 1Y3JA 1N5SA 3PRBA 2WAQD 1YJVA 1YRUA 1EAYC 1K0TA 3OTOJ 4OQJA 2OPPB 3VF0B 1QUPA 4EBCA 2DNRA 2KVQE 5D78A 3T6JA 1ZOTA 5D3GB 2AGPA 2WZ1A 4NLVA 3RR8A 1TL3A 3SV4A 3H25A 1HIYA 3QATA 4JI5F 4ALZA 4JOUA 2E1RA 2WONA 4DPXA 1RHJB 5C25A 1WEYA 1Q0NA 2ZH5A 2DXDA 4DR4J 1S7IA 2XCPA 4ECYA 4X4VA 3M8PA 4PUOA 1NPPA 2CJ9A 4FVCA 3F56A 1WOOA 2AGOA 2CUYA 2YX7A 5FDLB 3CJ3A 3UDCA 1S1XB 4RUCA 4O23A 1JNRB 2MYFA 3DM2A 1N5TA 4G3IA 3H2VE 2Z30B 3PW7A 4CLFA 5GMDA 4JI3F 2AQ4A 3IFEA 5B09A 5D4LA 2ZEJA 4D3GA 2I0XA 4MT1A 5DDOC 3LH2S 1UEUA 1R3NA 2GJ2A 4LIWA 1FFWB 3GQCA 2HSEB 4HH0A 4PR6A 2PC6A 3QSIA 1MN9A 2MSTA 2D9OA 3ZTPA 2DR5A 4X4NA 3TZZA 4H54A 1HI8A 2YQ0A 3DC2A 1JLFA 1ULRA 5EDWA 3RB4A 5T41A 3K8VA 3RAQA 3W9HA 5C2GA 3M7VA 2E1MC 2HZAA 4DUZF 2HFVA 2FLPA 4F36A 1T9VA 2P9CA 4ZDNA 3JYTB 3C14B 2BJ3A 2HHTA 3FCVA 2HFSA 1GXTA 4C0HA 1X7VA 3BJYA 3HT3A 4QYZK 2BM1A 4DFJA 1DQAA 3BGRA 1TL4A 3CD5A 2UXDF 2VDIA 4DR6F 3OVSA 1HHSA 1N52B 4C98A 3TEHB 2BQRA 2YNIA 1G1XA 4ZLLA 1T0TV 2RHSB 3EVWA 3HSJA 8AT1B 2V50A 4CLSA 3KMSA 3KK3A 2QMXA 2EK6A 5ETVA 2KHCA 1RAIB 3ICLA 3H4DA 4WXOA 5HO4A 4NE9C 2RD5C 1JMTA 1HNIB 1NJWA 1CJKB 5DETA 1HWIA 1H74A 3QT5A 4ILLA 5LXYA 4LF4F 1HBUB 2CADA 4PYDA 2CQBA 2B8PA 5D4NA 2ZH8A 2LQ9A 3NOGA 2X1GA 1NJZA 4WP8A 2IC3B 4DR5F 3ZTQA 5KFBA 4K4UA 4OHZA 2MJNA 4LR9A 4ZVSB 2GCFA 2U2FA 5KFHA 2VOPA 4OJ1A 3DOMB 2B56A 4IQXA 2J6UA 1HPZB 4FF1A 1MNEA 1LQ9A 4JV5J 2AKWB 1NKEA 1CG2A 3FZ2A 4KHMA 4NA1A 5AXKA 3IG1B 3M30B 2XSFA 2YX4A 2ASLA 5AT1B 3MMBA 4DR3F 1SC4B 2HQCA 1KVKA 3DFEA 3QNWB 1RWVB 3SFUA 4P71A 5DQGA 2HRUA 1UMJA 1WF2A 5GADU 1NB7A 3HXMA 3CJ4A 4CNZA 2FLLA 2AZ3A 4EUVA 1JJ4A 1IN0A 2LDYA 2GO8A 4PYAA 1TTHB 3T1YJ 2XMJA 1VQYA 3GR0A 3F44A 2YWHA 2YQ1A 3C6TB 2UUAF 1SH0A 3OLBA 1WOPA 2HBQB 4B3TJ 1RADB 2R7RA 2ZC3A 1KFDA 4QW9A 1JXVA 2FJXA 3DN9A 4ID8A 1HQEB 2RF2A 4LFBJ 3I56S 2HS3A 4EBDA 3LGNA 4NI2B 4AL5A 3K5NA 3O2IA 1LWCB 4MIAA 3DOKA 3FSIA 2B51A 4HL9A 3BSAA 3CDWA 3K57A 4WFZA 4I56A 2AMCB 2OI2A 3MAQA 5HQLA 4P7TA 3QO9B 3SV3A 3ETMA 2BMBA 2YH0A 2RKIA 1WHVA 3QYYA 1EZZB 1FJ7A 4MK8A 2Z56B 3CC7S 1K1SA 2A6MA 2P6TA 2BKPA 3OR1A 1NBEB 2DH9A 5DZ6A 1Z2LA 5IOLA 1V3SA 1FERA 2LEPA 2HHWA 1YZ6A 4WYWA 5E3QA 2H65B 3H5YA 4TXSA 4ZVRB 1FNOA 2KRBA 4HI2A 2QA2A 2XWXA 2BW7A 3CTRA 4DV0F 3I82A 4DL0C 1LW0B 3BQ2A 3TVKA 4IOCQ 5EX3A 3MR6A 2IHR1 1GFWB 4HHJA 4DN9A 4P2MA 2LXIA 1TKTB 2GMHA 1KC8T 2EKNA 5KT2A 3Q22A 2XTJP 3QPIA 5A2QY 3PV8A 3BR8A 2DVIA 4DSKA 2XMWA 4OJGA 2XNQA 3N6MA 3MAHA 3JSMA 2C3MA 4WFNQ 5BYQA 4RW4B 4U8VA 4DJBA 3UDLA 2AHOB 5D0GA 1FK9A 4M1KA 1J27A 4OMFG 3OVBA 4G1IA 4ECUA 4YY3F 1RKIA 2C42A 2QLWA 3RRGA 1UEVA 4O0IA 2G9OA 4ANCA 2ZDOA 2XMKA 1PBUA 3M9NB 2AU0A 4C9DA 1ELOA 4JI8J 3KKFA 4OYOA 2JH3A 3KLIA 1DARA 2LEBA 1AZSB 4LVOP 1DJ0A 2CIMA 1HWUA 2VASA 2DRDA 2MGZA 1IKXA 2G2ZA 1DZ5A 2BA9A 4CYUA 3QZ8A 1X8DA 1R8PA 5I3QA 2F4VF 5BJRA 2RSQA 1WDDA 2YNIB 1GX6A 1Q79A 2XYPB 3KK3B 4YB5A 2R2UA 1KN6A 5KT5A 3DGPB 3U1MA 4O0NA 2H4YB 2H5JB 1DAXA 3OHAA 1IR1A 1OY8A 4UQTA 3GFXA 1VBKA 2J9DE 2UUBF 1KTVA 1WNEA 1RAJA 3W5YA 3ZZPA 3O3LA 2DNLA 1XMQJ 2C28A 5E7OB 4JV2A 3E01A 2V2KA 1EETA 3MM9B 2UP1A 3CCRS 3G9CA 4KGVB 4QPTA 2OUGA 3SQOP 1LWEA 3GIJA 1WTFA 3CEDA 2UVVA 2CA9A 1MLAA 3DRYA 1IR2A 4L3NA 3D1OA 2JVRA 2FHMA 1N36J 5AE2A 3UO0A 4PQAA 1XMOJ 4XK8C 3UN3A 4DV7F 4DL6A 1F60B 4G1PA 2QV6A 3I55S 1C4AA 2I9SA 3TOQA 1RLCL 4ZPVR 2DBBA 3IM9A 2C2ZB 3NGUA 4LF9F 2IAJB 3PR5B 3BEGB 3LW5C 2CJBA 2CZ9A 1N0UA 3B78A 2DR8A 4KH0B 5IV3A 5GAGI 1KQSR 3CF5Q 3OR2A 1T11A 3R9LA 4NLUA 2OPRB 1H0HB 2ALYB 1HBOA 4RU9A 1YVFA 3LALA 1RHKB 2ZHBA 4B3MF 5AXLA 2DTJA 2NQPA 2JFKA 3HSDA 1HWKA 5KFSA 4WP3A 3OV7A 5HLFA 2E7VA 2CNKB 2GIQA 2O5DA 3CJSA 4LF5J 4USJC 3RYLA 5KG7A 4OI4A 4NLSA 3GV5B 3BBBA 4P74A 4Y00A 3OTEA 3S1TA 3LP1A 5GMEA 4N41A 5DZ7A 4DV5J 5HP1B 2RF2B 1L3KA 2B9EA 1BUXA 2DHSA 3C15A 4X4UA 4I7FA 4H4MA 2E5JA 1U1NA 4NLOA 5T7LA 1AROP 1S6QA 1G7CB 5BR8J 3OD2A 4IH6A 1B99A 2JVOA 4UZCA 3OPKA 5KFDA 1F3VA 1SJRA 1RACB 4KQZA 4I6WA 4ANEA 4MKYA 4LQ3A 4X4OA 2AP6A 1JJHA 5GAEI 3BS9A 3KLFA 1KHWA 2LFVA 5E41A 4FKXA 2YNFA 2V5HG 4C8LA 2RUGA 2HHHF 1GXLA 3QFHA 4HTIA 3O8WA 2C2MB 5HAOA 1X4HA 2RVJA 7FD1A 2CQ1A 2DNGA 2NZCA 4CLKA 2MEWA 2KJVA 3MCSA 4DN0A 2MKKA 2FQQB 4LSZB 4UW2A 1S9EB 4X66F 3T9ZA 4DPWA 1SUQB 3TAMA 4CO5A 3L09A 3W8GA 4K4XA 5L38A 2OP5A 4LR8A 1FRIA 1CJVB 3KUEA 3M8YA 5B0EA 2D3UA 3ENAA 2MQMA 2NUHA 3MUMP 3CJRA 1LWXA 4DL2A 4FF4A 2AIRB 3GYGA 1EQ0A 1MN7A 3W63A 4J90A 1C2PA 2V4JA 1C0TB 3Q23A 3M9MB 2F3JA 3P6YC 4Q7AA 3T5LA 2N7YA 2VJVA 2GW8A 3QRQA 3M2RA 2DNOA 3GU0A 3N5FA 2HRTA 1N4LA 1X9MA 3KJFB 4YB1P 4DX6A 1S1UB 3AQPA 3NCPA 3PX4A 3MEGA 2J8AA 2DNPA 2QA1A 2MGZB 4NRTA 3CPWR 4HHUA 2XYHB 3PR4A 1F3FA 2GMJA 1IKYA 1HR0F 1Q7LB 4IG3B 4IKAA 2DO0A 3KUHA 3I5AA 4C3MA 4ZVGA 3NMRA 1BQMA 1WTBA 3EM1A 1RYRA 3M1VB 2P9GA 3I31A 4KTQA 2EFOA 2RILA 4OX9J 2JLFA 4KAIA 1XR5A 4MK7A 5M2PA 2FTRA 4O44A 5IWAF 1XQIA 4UT4A 4M5GA 1EETB 1RWOB 4F0MA 1FT8A 2BANA 1QTNB 3Q2TC 1NSAA 3NS7B 2Z8QA 5KOXA 4OLPA 2V4QA 2I5JA 4DFMA 2J0XA 3H59A 1TMMA 3HZEA 1WC3A 1T3NA 1H3DA 3HFKA 3P45B 1VQPS 2CPXA 2YX1A 2B7CB 4QU7A 4TQSA 3HT0A 4C11A 3THVA 4NCBA 4ZOSA 2YKMB 3H98A 2W4DA 1EP4A 2NXUA 2J9DA 2D3OR 3OUYB 2FJEB 1FDDA 3G82B 3IS9A 3O6QA 3J80U 2ZHAA 3OR2B 5J2QA 4HDGA 1U6ZA 3KHHA 2VFVA 4Z37A 4CO0A 1S59A 2HNZA 1OSDA 3OTOF 4DCOB 1VRQC 2PO4A 4TY8A 2ZVIA 4P7VA 2Q3PA 3B82A 3D1HA 2Y1LB 4Q0BB 2GVZA 4ED0A 2ZBPA 2XMAA 2ZKUA 1Q8BA 1IBMJ 2XSJA 1SKRA 1RUSA 3PEJA 4A8KA 3BGLA 1AXQA 1RSCA 5IT9U 1JXLA 2PMZD 2MQOA 4K5SA 5A0YB 3UN2A 3PEHA 3EZOA 2CQ4A 3TEGA 4I7FB 4H4MB 5IXUA 3I9V9 3G96A 5CZXA 1VIOA 3M8ZA 1M5HA 2IYGA 2MZJA 2XC9A 3QRRA 2MLZA 1VC6A 3C19A 1XN9A 3RU0A 4KE5A 1N34J 1SL1A 4EEYA 4KY3A 4MIBA 3OJSA 2HAIA 1C0UA 3KLFB 1R8BA 1TK0A 4FKYA 1P1LA 3LF0A 1UWAA 5LMUJ 3MEEA 3H40A 2VPXB 5F8JA 1MU2A 4ZHRB 2CKWA 5EX0A 3H5UA 4PXDA 1NDCA 1TL7B 4C3KA 2HBRB 2HNDA 5D15A 2X1BA 5I42B 2RQCA 1Q16B 4DG1A 2CQIA 2Z4PA 4V1Ak 3D0HE 2PFFB 4AXIA 3A8JA 4OYIA 4UQGA 4RUHA 3MCNA 5H9FJ 2IVMA 3KHGA 3W7BA 2LU2A 1HMVA 1T05A 3NGRA 1FWPA 2DCUB 2JWNA 4PEOA 1PAUB 1Q53A 2V4JB 2V0NA 4IH5A 4DX8H 2QLBB 2RRAA 3J81U 4YDXA 1PCAA 2DGXA 3NCQA 1TK5A 4K4SA 4WK3A 4Y28C 3KK1A 4NLPA 4NLTA 1UCNA 4F04B 4USVA 4NYOA 4AFFA 5HMXA 3EYZA 1X4FA 4MYTA 5C24B 3BGFA 3POTB 3UNGC 1E6VA 4P2XA 1MMNA 1NSQA 2V2VA 2LXUA 1V6HA 2JX2A 4NZ7A 2O66A 4F25A 5K14A 4Y3CA 3CCQS 4ZITA 2MKSA 2Q43A 4J9NA 3DMJA 4AXJA 2GQ2A 4YN3B 2LXFA 2XO7A 4R5PA 4DQRA 1CULA 1BQMB 2AEJA 4IR1A 1G6BA 5E3PA 4ECSA 3D0GE 3OT9A 4QU6A 3KUGA 5LMNF 4WXWA 1SH2A 3HHLA 2C2OB 1ZAWA 3CUNA 2P8IA 4ECTA 1WUUA 4DSIA 4GC7A 4O44B 4P75A 4ZP9A 5HK4A 4E0DA 3KHRA 1U1OA 1JKHA 2QLXA 1QDUB 4RUAA 4M5HA 1YX2A 1M1KT 1PG5B 2OPQA 4RNMA 4N7TA 5KFYA 2F8EX 3HVWA 5CZVA 2I5JB 4C6AA 1MW7A 1YKWA 4WPAA 3AHPA 3T1YF 4NPOA 2R7SA 4XTTA 3CWJA 1BQNA 1QVGR 2DNKA 4DWIA 2C2NA 5E3CA 1FI4A 4N77A 1YJWS 1K8AT 4DR2J 4CT8A 3FFIB 3OTDA 4B3TF 3KLEA 4C11B 2KFZA 2CPIA 1Y9OA 1A0OB 2RUSA 3D7SB 2RS8A 4DDFA 4DL7A 4C0OC 2FHJA 2BDPA 2OD4A 4JBCA 2BOAA 2HWIA 2PGCA 3T1HJ 2H1YA 2W7PA 3BH7B 4F3MA 4USTA 1YBAA 5LSRA 3KK2A 2CPEA 4O4GA 2LEAA 2ZDPA 1YWXA 4L3KA 2BE2B 4L76A 3G6XA 2DKOB 3VAIA 4ZN1A 3TARA 2GVZB 4Q45A 2R7TA 1RHMB 3I5BA 3KLGB 4DS5A 1FRHA 3BKTA 3VTIA 1RT4B 4CLUA 1IBCB 4HHHA 1WHYA 4F0KA 3FSYA 1BXNA 1WWHA 4Q2LA 1NDPA 2VFSA 5ETLA 3K17A 3QZ7A 4B17A 4HTJA 4B02A 3TA0A 3TX8A 3ITHB 3TVZA 3FC9A 3GV7B 4CLYA 4ECRA 5B0DA 4USMA 3RB3A 1NJXA 1ZAXA 5KG6A 2L41A 2G0JA 1FDAA 1N32J 3HI9A 4LQ9A 4BWJA 2HFUA 4LF8F 3ENQA 4LFCJ 2MQ8A 4J9LA 1AB8A 3ENVA 1XJWB 1Q4RA 1U49A 2QTWA 3DLKB 5CYMA 2DISA 1TL5A 3NBPA 2HQ3A 5B0AA 2W9AA 3BN7A 1QTMA 2DEIA 5LM7E 2OELA 5CH7B 2PMWA 5HJXA 3MEEB 4ZVPB 1D8YA 1OY6A 5JJBA 3MUVP 3CB4A 2B4PA 1FD2A 3GG1A 5F8HA 2ASJA 3RBDA 3PHTA 1NLKL 2KYXA 3GTYX 4I2PA 1IWAA 2HGLA 4DV6J 2BXJA 4AUKA 4EYIB 4JI8F 3GJRB 4DG1B 4ZMMA 2V9WA 1L3UA 3HVTB 1TP7A 3CJ5A 3N5BA 1MWYA 2EW9A 4MFBB 1H73A 1F5AA 1ZTWA 2ZZNA 3S7RA 1RCXB 4R0JA 3P5TL 5KFZA 5KT6A 1S12A 1KWMA 3NGDA 3EVOA 1RWXB 5HJYA 2VBZA 2WCXA 5GAGU 2BKNA 4UF4A 1NK9A 1YLXA 3VGUA 2BJEA 1GH8A 1RWMB 5AXMA 2GZOA 2D41A 2R8HA 3MFIA 3KK1B 2LYVA 2KL8A 1HHQA 2ZD1A 3HKWA 3MM8A 4I6YA 3MUTP 3IMQJ 3CCWA 2PFDA 1O0PA 1RK8A 3N28A 4ZA1A 4DZDA 2PA3A 1VHIA 3MD3A 3CD6S 4XPCA 4QBUA 4XPEA 1XMQF 1D09B 1GTEA 3PRVA 3HHEA 5M2RA 1SIZA 1MROA 2XO6A 5KG2A 2F5GA 4JI1J 3MCMA 4ZCMA 2DR9A 1VQLS 4KT0C 2RB7A 3K5LA 2KI2A 1U7LA 1SPBP 4OHYA 2KHDA 4Q8EA 2M0GB 2ZJPQ 2CVEA 5A8WA 1N36F 4KFBB 4YOEA 1JLEA 5KFQA 3B4MA 1CVJA 1XMOF 3JAMU 4KBIA 2V63A 3GCXP 1AFIA 3D2WA 2FY1A 2DY9A 5BXIA 4R8UB 3R5BA 1S76D 1FRJA 2KN4A 3BGOP 2DGSA 3VQTA 5H9EJ 4BC7A 4IO1A 3UE2A 3VAHA 1L5UA 4NX9A 5GAEU 4IFYA 2YNHA 4J91A 1XC9A 2RQKA 3TANA 4DV4J 4ZVHA 3U02A 1S1WB 1GMWD 1FWKA 4USIA 3HSGA 1XNQF 1TQLA 2XULA 1WI8A 1VQKS 1TFWA 4X62J 4U8YA 2ZH2A 1W26A 4YR0A 1URRA 3MMAA 3EUNA 3DLHA 4QWEA 2ZE2A 3QIPA 4OHVA 1WJ9A 4IRKA 5HROA 3I0SB 2I8EA 4YMEA 2BOPA 3LP2A 1IQTA 5KAKA 4X64J 1TL1A 5L9XA 3J7AN 2WVEA 2VD3A 1QSSA 2XHWA 3LWMA 2L9DA 3W9IA 3I96A 3X1LB 2V34A 3NRBA 1O8BA 4WCEQ 1S1TA 4EYHB 5BR8F 3TA1A 2YWKA 1FVSA 3EICA 4FP9A 4G1QA 3VWSA 2YNGB 5L1IA 2V2QA 4OYXA 1VBXA 5E3AA 1WG4A 2HZCA 5SZTA 1CC8A 1FJCA 3DLBA 2NPIA 4A4JA 2XMUA 2R4FA 3VV2B 5DG8A 2W7AA 2DRAA 1IM4A 4OHWA 4A8QA 3GV8B 4YHHF 3EMTA 2E1CA 2XY5A 4MJKA 5FD1A 1XR6A 1S10A 1RTHB 5L1KA 2E9RX 2ROGA 4YFUA 5D77A 3CD7A 1HARA 3AOAA 2SXLA 2UXBJ 2B4VA 4MAKA 3NWGA 3TUPA 4DPOA 3RBEA 3HX9A 3AXKA 4EZ9A 4CLZA 1WHWA 1U2CA 1N54B 1RT2A 4M5NA 4NCAA 1ZAVA 5GAHI 2QYGA 3NBPB 3OHBA 2MY7A 5L46A 2B6AB 3CJKB 2AEFA 2CQ0A 2ABYA 1SB6A 2H3EB 3TWZA 5KG0A 1N33J 2XZDB 2DNHA 3SYZA 2F9JA 1N56A 4H4OA 3ILIA 3GYXB 3AT1B 3RW6A 3H20A 4URQU 5ETPA 4CO4A 3PO4A 4DV3F 3DHXA 3KJVA 1U0HA 4Y2IA 2FB0A 2FDNA 1RGVA 3FEZA 5J2NA 2EKYA 3OL8A 2HQIA 1OJ4A 2L08A 2VV5A 1JLBB 2VQEJ 2GA7A 5HBMA 2OGUA 2MQLA 1KEKA 2BM0A 2W2OP 4J5OA 3HHNB 4XIUA 3DKDA 2R7VA 2IVFB 3Q86A 5I3PA 1IBLJ 2ZWOA 4NXNF 1LWFA 4P6QA 2C22A 4M5DA 2WB4A 3IGVA 2HPUA 1KVJA 3I4HX 5EHHA 1LNQA 3O5TB 2KT3A 4ER8A 2GJFA 2QN6B 4J7CA 2C1EB 3GIIA 3F73A 3CULA 3QWPA 3ZZTA 2H51B 3W9JA 2ROEA 4KKOA 3BBCA 1HKAA 3FBEA 4AL6A 4LBHA 3GSIA 4USUA 3IWNC 3KJQB 2MZ1A 4L72B 2HMIA 3BGUA 5T14A 1X4DA 3AD9C 2MLXA 2LQJA 1FEEA 4J37A 3NGTA 1NK0A 1WF1A 1RTIA 2R7OA 3L4BC 5ETNA 2NSCA 4NLGA 5DM6Q 2EBGA 1RT3A 3G8SA 1RAAB 2WOMB 1JLEB 3PJXA 1RT5A 3MR2A 5D0RA 2WSFC 2CQCA 4EZ6A 2B8QA 3GILA 1DTTB 1XIQA 2VPZB 2OFHX 2A0FB 1OQ6A 2ZZMA 2H9ZA 2DY1A 1IJFB 2AX1A 3G8TA 1NJIT 1S7HA 3WIVA 2G4BA 3GCWP 3M2UB 2YNHB 1MMLA 1FNMA 4EU0A 3DLJA 2E5IA 1JB0C 3GFYA 2XLJA 1EJ7L 1H72C 2CPJA 1IBMF 3Q8SB 2GQCA 1BC6A 1RI7A 2NXEA 2E29A 4F4AA 2ZBRA 1ZYQA 5D4OA 1SV5B 2E66A 1F6TA 5LT5A 5HVGA 4X2BA 5KFCA 2V94A 2JEGA 5L1JA 3B4DA 3MM7B 4TVAB 1S1TB 2KFYA 4U67Q 2V8HA 5U47A 2IRUA 5D6GA 5DM7Q 4G1QB 3W2VA 4ECVA 1EHWA 4JI2F 1KLNA 2G1DA 2DRBA 4XDDA 2B3TB 1FDBA 4K4VA 1WKKA 1YJ9S 2CVIA 1RBAA 2HLTA 3HFVA 1R8AA 2HHVA 2G0IA 5J1EB 5IM0A 2NR0A 5LMUF 5K8NA 1FTCA 4U96A 4K0KJ 1IKWA 1U1KA 2D9PA 3N6LA 5DDQC 2W24A 3FZBA 1ITPA 2ZNZA 4ECZA 2XGPA 2KG1A 2HIQA 3CSKA 1REGX 3TX0A 5F8GA 2FLOA 4OZ0A 2E44A 4ZCIA 2HZVA 3J7YI 3ISNC 2LQ8A 4I64A 1UVMA 1RT2B 3M32A 2ILYA 1T8EA 2KB2A 3BO3A 3H2UB 1T9UA 4ZJLA 4B9LA 1SH3A 3RAXA 3I87A 4MKVA 2W4PA 4X65J 3N6NA 3BBFA 1LKZA 3DOLB 1VCTA 5AE1A 5KFNA 2HBYB 2W01A 1WI6A 1S79A 5DDRC 3GJQB 2FVRA 2QE5A 2W9CA 1QAIA 1NH8A 3AB2B 2VG7B 4MYUA 2M4MA 2XLIA 4C48A 1UAWA 4B9VA 2EFQA 1W25A 4PXBA 3BV8A 1F1BB 2KFNA 2FVPA 1RJJA 3CJ0A 3Q8QB 3PFOA 1SCJB 4FBTA 2DHXA 2RIJA 1SC1B 4NRUA 1T95A 5CCMA 1WHXA 2CPZA 1K47A 3IRXA 5F3ZA 4AQYJ 2NZ4A 2AYMA 4U95A 2AT1B 2CYYA 3C46A 3CXCR 2ZJQQ 5A8KA 4DF4A 2HVHA 4O3NA 3GJSB 4HI1A 2R9LA 1BMQB 1RQ0A 1FWLA 2UV8A 2VFRA 4KKOB 1DLOA 5KG5A 2LQ5A 3HCXA 2M8HA 2VF3A 1ZM2A 2ZOFA 4XO0A 1HQUA 4TYBA 2HEKA 3FJ2A 3OLAA 2MSSA 2J9EA 1MWQA 3JSBA 3D6FB 1REVA 1RT3B 1T9WA 3VGSA 4WTYA 5DLFA 4CH7A 2JRSA 2XYGB 1YJRA 2RHQB 4ED5A 3VCDA 3B54A 4FYWB 1X5PA 4IQMA 2A3JA 1NHKL 4QWDA 2VKZG 4LF6F 4PZVA 3G6VA 4Y0FA 4U6PA 1LK5A 1CJTB 3T1HF 4ES2A 5A8RA 4AL7A 4I2QB 2N4CA 4ED3A 3K5MA 4YB6A 2BX6A 1VQ8S 3CJQA 3Q89A 1ZA1B 2ACYA 2AD9A 3D54A 3MXHP 2FZCB 4O3RA 1PIEA 2VC0A 1D1UA 3BF4A 3QIDA 4GVLA 2W2MP 4JV0A 1MWZA 1BHNA 1T7PA 3ET6A 1TUWA 1VDHA 1Y10A 3SQGA 3RJMB 5RUBA 1VMBA 1XMBA 4RJVA 2MDAA 1RT7B 3D66A 3BDPA 3SSRA 1TVRA 2DGQA 3NXZA 3HO1A 3R2CJ 3KTQA 3MHYA 2R8KA 4IG0A 4EFAC 1N6QA 2PIIA 3SIPB 4LRDA 2XS2A 1UFWA 3M6VA 4LFCF 4ELVA 2B4UA 2K3KA 4OYMA 4URGA 4LSLA 1Y5NB 5DDPC 3LOUA 2IBKA 2BEFA 1KNZA 2AV5A 4JYAJ 5B08A 2BVZA 2ZJRQ 1WG1A 1VJQA 4RZRA 4F4YA 3CCJS 3UVJB 2CPHA 4NLDA 4DV1F 2LA4A 1IKWB 3BDEA 5F8NA 1JLGA 2KVIA 1TKDA 1IBKJ 4C8YA 4USKA 1NZAA 1YITS 3VZIA 2ZBQA 4GKKJ 1RT1B 2X1FA 3KMQA 1VQOS 4KHPJ 3AOBA 1K0VA 4MH8A 3EWGA 4C0BA 2XHCA 3KLHA 8RUCA 1ZZNA 2G0CA 1S57A 1FO1A 3MURP 1FVQA 2HVZA 1VJWA 4ID5A 4Z7YA 3V2UC 1NK7A 2GJIA 1CQNA 1EX8A 3FRZA 2V69A 1Z1ZA 4DSJA 3BN4A 1A6LA 3V6DA 4IOAQ 2N7CA 3G87A 1ROFA 4PQUA 4NMXA 4OYWA 3VAFA 1RAHB 2YPYA 5DGBA 4UOHA 2KKHA 1B7FA 2W9CB 2V8GA 4M95A 1JLCA 2YKNA 2A2CA 2AZ1A 3MWBA 2V67A 3LQVA 4RW9A 2FVQA 1TK8A 4FF2A 4IFVB 4DU8A 1Q81T 4G65A 1XR7A 1P27B 2BKOA 2RDIA 2QA4S 2WHOA 3ISND 3PW4A 1S4EA 3BZQA 3HULA 1FE0A 2UXCJ 4HEA9 4A46A 3NS5A 2VH7A 1S99A 4QYZJ 4FF3A 2E7WA 1RTDA 1CBKA 3AA9A 1Q8IA 5ETTA 4RNFA 3MPVA 4PKDB 2XG8A 1KP6A 1CPZA 3LP0A 1HBNA 4DSEA 4LVNP 3M8QB 2VA2A 2ZBCA 2KXHA 1VYAA 3NNHA 3KNGA 3OVAA 1U26A 1J5EJ 4F2SA 3MD1A 4DV4F 5G0RA 1HQUB 4R0EA 1JLQB 2PMHA 1YBTA 1Z2ZA 3FCHA 4NCGB 3VAGA 2EFPA 3PW0A 2IRYA 4Z2XA 4RPFA 1REVB 4DPUA 4X62F 3CCUS 1C1CA 3DDNA 2N4DA 1HBMB 1F5BA 3MCOA 4K4WA 1LK7A 5JVGQ 1BWVA 2GGPA 1JJCB 6AT1B 5KFEA 3PKMA 1ZTTA 4P2SA 1FD8A 2GS8A 3AJ2A 3IA0A 2LVWA 1ZM9A 4X64F 1WACA 1HI1A 4ZIWA 3KLVA 1SXLA 5M2UA 2VQFJ 2Z58B 1W2BR 2V8PA 3PX0A 1QE1A 2BE7D 1P6TA 1OO0B 3WHIA 1FNXH 4WYLA 3MM6B 2YPZA 4KV8A 4HACB 4J9SA 4RW6A 3QLHA 2N3LA 3HD1A 4JUZA 1FE4A 2OHDA 3IGNA 4ZJQA 2J0WA 2GX8A 5LOQA 4ZPWR 1TV6B 3V81B 5HMWA 4WE1A 3PACA 1U1QA 3HMJG 1VLOA 1J5OB 4OX8A 4DFPA 1HQ2A 5LXRA 5EWFA 4DR6J 3GSDA 2OFGX 3GP9A 3Q24A 1NH7A 4ATNA 1R0AB 2JEIA 1Q5YA 5THWA 1TVRB 4V19X 2NLWA 2UXBF 3NKYA 4ZCLA 4GVBB 4C97A 9RUBA 2W9BA 2B9XA 3I0RB 2XCAA 4IG0B 1YRXA 3NGSA 2K8GA 4ILMA 3D0IE 4F02A 4ZVOB 1S4FA 3SMZA 2N82B 3U1LA 4C8MA 1KLMA 2HVIA 4LF1A 4ICLA 4LSLB 2MKJA 1P9QC 1NCLA 4ECXA 3MPWA 3N4WA 3D6TB 1RXOB 3OTBA 1S5ZA 4KPYA 4ED6A 2XNRA 3CJTA 1TKXA 2JEFA 2KO1A 3G71S 4USHA 2G2OA 5IZHA 1VRTA 1NKBA 1VK3A 4A8XA 3PDNA 3FNNA 1N33F 4K7QA 4TU8A 1C1BA 1UPPA 4LUBA 1RWWB 1LXNA 2EG2A 3JQKA 3FEXB 5B0BA 1WORA 4BCAA 3PTWA 2EFNA 1SJ3P 2DHAA 5DLGA 1DTQB 1RTJA 1VQ6S 4N56A 1X5TA 2RU9A 1VQ5S 2A2DA 3C8YA 1DFDA 2R8GA 2XMTA 4MKBA 1NO8A 2VQEF 4FPIA 4GC6A 2VPYB 2VA3A 4WKRA 5BYSA 1H2VZ 4DR3J 4B3OB 1LW2B 5CCLA 2WVDA 2OEMA 1LOUA 3BKUA 2RE1A 2MTLA 3UDVA 3N0VA 1IBLF 1XNRF 4FPRA 3K89A 4PQUB 4F4XA 3J7A1 1WC5A 3TZWA 5I3UA 3T1AA 2HHXA 2WW4A 2APOA 2IA6A 3DI6B 2ASYA 4IDKA 2FUG9 2OAUA 2NUUG 2Q1LA 2UV8G 4F8RA 4USWA 5LL6d 3NGKA 4FZVA 5DGAA 1T03B 1NU4A 3QJJA 5AXNA 1KBRA 3PYEA 5CYQA 1N8RT 3S6EA 2KZZA 3CIMA 3HSZA 2M3DA 4L6V3 3NNAA 2OPSA 1WF0A 3R2DJ 3JTNA 3DLEA 4DL5A 4LF7J 4OI0A 1X31C 2YY3A 1N88A 2HW3A 1RTDB 1TL3B 2AWZA 2ACMA 2HNYA 2J7WA 5A6PA 4IRDA 2DGTA 1UEKA 3ILLA 2WONB 2M70A 1NPRA 2K3IA 5C25B 2QMUB 1HBNB 4LRBA 4HLBA 3O44A 4QW8A 1BLUA 4RKUC 4U9RA 4BC9A 5C42A 1P1TA 3M8PB 4PUOB 5HN0A 1AUDA 1OQ3A 2FHOB 4CRJA 2OH2A 3H5SA 5GADI 2V9KA 3Q8PB 2C3OA 1L3VA 3DM2B 3CCTA 4ELUA 1G3OA 3DLLQ 1CEZA 2B4OA 4Q8FA 2F1FA 3P49B 1AW0A 4NMLA 4DQPA 3H90A 2W1BA 2E9ZA 3EZUA 1S1VA 2MPUA 3A12A 1URNA 1GT8A 4U7UK 2VUGA 1HD0A 3DU5A 2FYXA 4OX6A 1UWBA 2NXCA 1FCAA 4DR1F 5IV4A 1CJUA 1Q5VA 4RNHA 2FLNA 2LECA 1HYSA 1JLFB 3SXLA 4DSFA 2MB0B 5HMYA 4PG4A 3R5GA 4ZK7M 3M2VA 1NPKA 2VU5A 1QE1B 4F7VA 2EXUA 2GFFA 4P2FA 1VS3A 3P8BB 3KG1A 2F40A 2Y1RI 2GMLA 3JTPA 5GVQA 1RCOB 1E6YA 1NAQA 1FA0A 3QBCA 3A13A 3BGRB 2I1RA 2ZKTA 4M5IA 3N79A 2R7WA 2A1BA 5J2PA 2FJAB 2K1RA 5KFVA 2XQCA 2ZOGA 2OKQA 4CH1A 2K7KA 4K0KF 4PG8A 1RTZA 4LSNA 1B70B 4F4WA 1HLWA 1RAFB 2H4WB 5ETKA 2F7VA 2BZ2A 5K8MA 3DGVA 4CLPA 4WWSA 5KFMA 3I6PA 4HKQA 2WK4A 1OPZA 2HKEA 4RL1A 3CD0A 1NK4A 3FK4A 1S9GA 3EX7B 1Q95G 4X65F 4KR0B 1QVFR 2WBMA 2JZ5A 2IDEA 1WEXA 4FDFA 2XZTB 1NKCA 3BQ1A 1TKXB 3EE3A 3L7PA 1U8WA 3N9UC 3JSYA 1VRTB 2DIVA 4PPZA 3GMGA 2R7XA 1AFJA 1UL3A 1X4GA 1NDLA 2ZH1A 1V5IB 5KFIA 2UUWA 1ZETA 4ZCKA 5LJ5Y 3UCUP 1TKZA 5IT0A 2POKA 4QR1A 5KFGA 3RB0A 2PEHA 1WKLA 2CJQA 4M5MA 2MY8A 2M5YA 3MMBB 2AJ0A 3R1LA 1S0VA 2CJYB 2M8DB 4QWBA 3CGIA 2HGNA 1U47A 4LF9J 1T02A 5KFRA 2HHQA 3C6UA 1U8SA 1RHQB 3UQSA 1VQ7S 2Y8YA 5KFLA 3US5A 1KQFB 3PYGA 4TKTA 4F4KA 4A8OA 5IT4A 2OPPA 1SKUB 1B64A 3OFEA 4TLRA 1T9XA 3TI0A 4NWBA 3QGIA 3WDOA 4FVMA 5D3GA 3R27A 5HI7A 2EWHA 4ZPDA 1IQZA 4KHRA 3C3LA 1AA1B 4IYQA 4CH0S 2EBEA 4OYAA 1YTYA 3AA8A 1PC5A 1SC3B 3AOCA 3TJ9A 3CCVS 1FRKA 3BSOA 3TUIC 2Z0GA 1FRMA 1U6BA 4IRCA 3L7UA 4IH7A 1UVNA 5DRKA 5L1LA 3ZZ0A 1HNWF 4RU2A 1KTQA 2AJQA 2P6SA 1YG0A 4GRSA 1S72S 3DOKB 1Q7YT 3EZ5A 1SI9A 3PHEA 4WFXA 4NOHA 4ZKAA 4PRFA 3KNAA 2VG5A 1F2HA 1S1XA 3BH6B 4ZVFA 4WU2A 3NLCA 3MMCA 3KYLA 3BM7A 3EGNA 4ZVUB 2HNYB 4WBFA 2CZ4A 2UU9F 2RKIB 2WVFA 2LLZA 1I94F 3GG0A 2QLFB 2AJ2A 2OSRA 3OR1B 4W4MA 2K06A 3R5AA 5C42B 3ZO7A 4WJBA 3GONA 2J9CA 4TQRA 2Y0SD 1RZMA 1MMDA 2CFXA 1RKJA 1R8CA 4F4ZA 4JV1A 3BQ0A 1RLDA 2YQ3A 3D9BA 1UZDA 2NYHA 2B9YA 3BO4A 4KPCA 2GO9A 4RUBA 3FMBA 3EGWB 1R27B 4QIFA 3JYTA 4C8NA 4MMOA 3C14A 3CNQP 1X5OA 3CO9A 1TMJA 3Q8VA 4KGZB 4QR2A 5K20B 3JSMB 1HYSB 4WZMA 5F41A 1ZPVA 4DZ6A 4M8LA 3RUBL 1AT1B 4NL5A 1M5KC 1FK9B 4KRWA 1NMEB 4LBIA 3IR5B 1UA1A 5CD4A 4WIIA 2E1PA 2UUCF 2DJWA 1NHUA 2BJ8A 4X4SA 4EGLA 1Y0HA 3I9ZA 4F3OA 1IR0A 1WD6A 1UVIA 2YKAA 4X4TA 4LT6A 1HNIA 1YJTA 1CJKA 3KLIB 4AYBD 1VQ9S 2VKRA 1UFKA 1HNXF 2EI5A 1UP1A 1IKXB 1HBUA 4PWUA 4KO0A 3FBFA 1IWGA 1NNDA 4Y2CA 2EK1A 4CYUB 2FHJD 2BJ1A 4N76A 4V19J 2F4FA 5KFWA 1K44A 2GHVC 3R1HA 4F0HA 1FJGF 3F41A 5F3TA 1IBKF 1HR0J 5DQHA 2HK2A 3ZTOA 2ILZA 4GKKF 2IMOA 5ETRA 3A4TA 2G13A 4KHPF 4DL4A 2BUNA 3W1YC 5K8OA 3KFWX 4CO2A 1R89A 2KG0A 4DF8A 4DR7J 4B3SJ 1HPZA 5D0EA 3E01B 5IFMA 2QFIA 3IG1A 3M30A 4ZVEA 3ZNJ1 4FXWA 2B7BB 2GHPA 1WKJA 3Q83A 1S9GB 5E33A 1JJ2R 3A8IA 1LWEB 4PWDA 2IRXA 5KFXA 1TR0A 2J7KA 3ETOA 5IT9Y 2BQUA 3B6BA 4DS4A 1JLAA 1IM6A 2CDQA 3MTKA 5A6WA 4NYPA 4D3HA 1RB0A 4WKYA 5KOWA 2KT2A 4C8OA 3UNYA 1TKZB 3QGPA 4DUTA 3HZGA 2OO4A 3PM9A 2XS7A 2Z57B 1RDRA 3AQOA 1MG7A 3C6TA 2P9EA 2KXFA 3T41A 1B0TA 2R7UA 4DPYA 2KZMA 3CO0P 1CC7A 1HBOB 3CC4S 1HQEA 3C6UB 2UXCF 4JI0J 4NI2A 1NUEA 2M7SA 3DHWC 2LKZA 1LWCA 2QIFA 2AYEA 3RW7A 2OD6A 5HLFB 2OIHA 2O3DA 3FEYB 2NPFA 4UUWA 4ZVTB 4DR4F 1Q8LA 3QO9A 1RWUA 1XK8A 3UPFA 2BE9B 3LP1B 2OEJA 3M4XA 2ZH6A 1IVZA 2QZ8A 2YKOA 2DCLA 2L48A 3SZ2A 1U4BA 1UJ6A 3UCGA 3K5OA 3BREA 3C15B 4P52A 5DG7A 5K5MA 4CO1A 3W61A 1J5EF 3K58A 1LEOA 7AT1B 3IAM9 1N5VA 3BSNA 4PXEA 5KT4A 5T7LB 3T5KA 1S6QB 4FYYB 2AJ1A 2ZNYA 4EMDA 3H5XA 4A8SA 2VG5B 3G2XA 1SQFA 3MMCB 3AXMA 2BJ7A 4J9UE 1IKVA 3VGVA 1VQSA 3J81j 3J81Y 1UVLA 2IM1A 3LAMA 2QEXS 2AF6A 4NLQA 1LW0A 4Q5VA 4C7QA 3G6ES 5HQMA 2VB6A 1PYSB 2HGMA 3QGGA 2D69A 2YNFB 4TYAA 2QG9B 1D3WA 1TKTA 2EG1A 1APSA 3TJ8A 4JI4J 1EKRA 2GIRA 2VHGA 1YJNS 2F63A 1KQGB 2VQFF 5C5JA 1KS2A 2CQPA 3W2WA 2Y1JA 1U2FA 1QJHA 4RW4A 4W98A 3WX8A 4OJHA 3IR7B 5LSOA 4LREA 3Q8YA 3HF5A 4FNHA 2JJ4D 4OFZA 3TAMB 3PYDA 4B9TA 4OYZA 1FKOA 1SKWA 2QYCA 4RR5A 3RBZA 3ZXWA 4CZCA 2XY7A 2PI5A 4UUXA 1AZSA 3BO2A 1QAXA 4TN2A 2BRLA 4YB7A 4QYRA 4FXVA 4QPXA 1HNZJ 1TUGB 3HHDA 5KTQA 3Q8UA 3THPA 2AJ4A 3W60A 3K59A 1HA1A 3M2RB 1CSJA 4PG5A 2Y3YA 3VZHA 4GO5X 3DGPA 4K4TA 5KFJA 4IUFA 3PRDA 4I67A 1UW4A 3D68A 2BV3A 3EGZA 1YZ7A 3MEGB 3UFCX 1ZBTA 3KDOA 4O3OA 4M5LA 1RABB 4KO0B 4DLGA 2QMWA 3W65A 1IKYB 1ZA2B 1M1GA 1R43A 3OFFA 4FXDA 2WB1D 3MM9A 2O01C 3T5HA 3PZPA 3P3DA 4YUDA 2M52A 1Q78A 5CD4H 5HATA 3JSRA 1SVDA 2IJRA 4ZIVA 2R3VA 2NXJA 2KRRA 1YDLA 2ATLA 4JV5F 3UD5A 2GC8A 1RA6A 1ZM3A 2BBEA 1U6FA 4IR9A 1UKUA 2JFDA 3MDFA 2C2DA 3TW0A 5LMNJ 3DNCA 3HJVA 2BANB 2IAJA 1D9DA 2J76E 3AAWB 3UN5A 2YWFA 3TUJC 4PPDA 2OEKA 3NEKA 4ITSA 2FHKA 2UUTA 2ZH3A 3M8RA 4PWDB 1JWWA 2MZRA 3LPEA 1S6PA 2OPRA 1YI2S 3PW2A 1JLAB 3WX4A 4I0WA 1NSPA 3R8YA 3FBBA 4QZVB 2PEBA 1R8HA 3VGTA 2MJUA 5HANA 2VBXA 1N0VC 2ZHOA 3P96A 2YBVA 1UVKA 4EI2A 1EP4B 3NMAA 3PVXA 1NK8A 4LFBF 4KGMA 3OXLA 3IS9B 1NK6A 4M5JA 5J2QB 1S0OA 1QY7A 2HNZB 4LFAJ 3V4IA 5HP1A 1QUVA 1T3OA 4TY8B 1B0VA 2PI4A 1FX4A 4Z7CA 2MKCA 4PG7A 3H42A 4LF7F 3IM8A 4G6VB 2A18A 4B08A 4H4KA 2YTCA 4DX5A 4NLXA 4TU7A 2EFVA 2XSJB 2V8DA
chains in the Genus database with same CATH topology
3KG4A 1Q7LB 2R8KA 3TNVA 4IG3B 1GTHA 4Q43A 4GO7X 4IG0A 4IKAA 4DMZA 4EFAC 1N6QA 2DO0A 2PIIA 4KGKA 3HHLC 2MKHA 3MOJB 4ZLPA 3I5AA 4C3MA 2R2SA 1M5OC 4ZVGA 3NMRA 2XS2A 1BQXA 1UFWA 1BQMA 4B9SA 1DHMA 4I1TA 2AW0A 1YJUA 4O3QA 3M6VA 1WTBA 4LFCF 4ELVA 2B4UA 1RYRA 2K3KA 3UCZP 3M1VB 2P9GA 4URGA 3HPOA 2DITA 1FRLA 3I31A 4LSLA 4KTQA 1Y5NB 2EFOA 2RILA 5DDPC 2LA6A 3LOUA 4NYZA 1S0MA 1X4EA 1HFEL 2JLFA 4KAIA 2IBKA 3L3CA 1XR5A 2CQGA 4MK7A 1TAQA 2AV5A 1KNZA 1FKPB 2D7SA 2C2RA 5B08A 4NZ0A 3IAS9 2AX0A 5M2PA 2BVZA 2V4RA 4K50A 3K0JA 2PD1A 4NA3A 2KXNB 2ZJRQ 1WG1A 2QSWA 3LP0B 4RZRA 4F4YA 2FTRA 2R2TA 3CCJS 4O44A 2QO3A 1M5SA 5IWAF 2CPHA 4NLDA 4QOTA 1YRTA 1A7GE 5E3RA 5F9LA 4DV1F 2Y1IA 1EETB 4NZ6A 2LA4A 1IKWB 3BDEA 2DGUA 1JLGA 2KVIA 1FT8A 4WZQA 1LFWA 2BANA 5F8NA 4ZS6A 1TKDA 4Y6IA 4KC5A 3DYAA 4C8YA 2JLEA 1IKVB 3OL7A 3Q2TC 1NZAA 5LJ3Y 3J7ZT 1YITS 1NHVA 1BD6A 2J7UA 3VZIA 3FQLA 1S9EA 3IXQA 1RT1B 2X1FA 3KMQA 6FD1A 1SUQA 1VQOS 3IC1A 2HHUA 1QM9A 2Z8QA 2A10A 1K0VA 3E8OA 1C0UB 5KG4A 5KOXA 4OLPA 4MH8A 2V4QA 2I5JA 4O3PA 4DFMA 1SKSA 4C8KA 4C0BA 2J0XA 4XAKA 3H59A 4C8ZA 3D28A 4ES1A 3KLHA 5G0RB 3HZEA 2K2PA 1ZZNA 2G0CA 1T3NA 1H3DA 1FO1A 3MURP 4I2QA 3HFKA 1VC0A 1FVQA 4Q44A 1VQPS 3BR9A 2HVZA 1MU2B 1KHVA 4ZPBA 1VJWA 2CPXA 5B0GA 3TVYA 2YX1A 2B7CB 4ID5A 3TP2A 1C4CA 3V2UC 2MXYA 4QU7A 1NK7A 3E3XA 3W2WB 3CDUA 1H7WA 2CG4A 2DH8A 2GJIA 4TQSA 3QJLA 4C11A 3THVA 4OZJA 1C1CB 3FVYA 1C0TA 5ADZA 1Y3KA 4QWAA 1KR4A 1CQNA 4ZOSA 4NCBA 2YKMB 3H98A 1SJ4P 1QSLA 2KH9A 1OIAA 4RW8A 2W4DA 1EP4A 2GGPB 1U25A 2NXUA 3FRZA 3MI7X 3LWLA 1F2GA 2HNDB 2J9DA 2D3OR 3JTOA 1MSWD 3OUYB 3CCSS 2W25A 2FJEB 1FDDA 1Z1ZA 1F9FA 3J7YU 4DSJA 5FJ4A 3BN4A 1A6LA 5K9FA 3IS9A 3SCKE 3V6DA 4IOAQ 3O6QA 4KJIA 2ZHAA 2N7CA 3OR2B 5J2QA 1ROFA 4PQUA 4HDGA 1U6ZA 3I5CA 3KHHA 2VFVA 4H4KC 4CO0A 4Z37A 3CCMS 3VAFA 2HNZA 3AB4B 1OSDA 3OTOF 2DPIA 4MKAA 5DGBA 2KTQA 2PO4A 4TY8A 4X4RA 2KKHA 4P7VA 1FKOB 3ZZUA 4JI6F 2HLUA 1B7FA 3MOZA 2W9CB 3OL6A 1GAOA 2V8GA 2ZITA 2Q3PA 1V3ZA 1HMVB 3B82A 3V6HA 1JLCA 1WELA 1T05B 2ZFHA 4M95A 2YKNA 2A2CA 4TNOA 2N3OA 3MWBA 2KM8C 3D1HA 4CNYA 3ULHA 3LQVA 1S1UA 5L39A 3JAMY 4RW9A 1RT7A 2FVQA 4Q0BB 3D1QA 1TK8A 2DNZA 2CPYA 2OMLA 4QIEA 3FGVA 4FF2A 4ED0A 2ZKUA 1Q8BA 1N48A 4IFVB 1Q81T 3EXCX 1XR7A 2XSJA 2ZC4A 1SKRA 3PEJA 4CTAA 2HHPA 4A8KA 1NJYA 1P27B 2L9WA 2BABA 2RDIA 3BGLA 2X3GA 2WHOA 4KV8B 3ZFVA 2QA4S 3R3TA 4IG3A 3RB6A 1AXQA 3ISND 2VL1A 3PW4A 3CIZA 4RW6B 2DNMA 3QLHB 3IRWP 1JXLA 3BZQA 2PMZD 1FE0A 2MQOA 1NK5A 1F0XA 1R31A 3DDKA 1KRPA 4HEA9 4K5SA 2LU1A 4A46A 3NS5A 5A0YB 2VH7A 3ISZA 2KU7A 1S99A 4Y2KA 3OXFA 3QMQA 1E6VB 4WE1B 4QYZJ 3M1VA 3TO8A 3CDBA 4FF3A 2E7WA 3PEHA 1RTDA 1W2IA 1S77D 3LPYA 2CQ4A 3AA9A 2J6TA 5F0UA 1Q8IA 3PW5A 1XBWA 4QWCA 2WTFA 4I7FB 4H4MB 3MPVA 4RNFA 5IXUA 2RT3A 4DV2F 1SL0A 4PKDB 3I9V9 3MZIA 1DQ9A 2XG8A 3G96A 1CPZA 5IQ6A 5CZXA 3LP0A 3A8EA 5K14B 2MQPA 1HBNA 1VIOA 4AE5A 1FKAF 1M5HA 4DSEA 3DMJB 4LVNP 1LV5A 1FDNA 3M8QB 3MEDA 5JUMA 3M6XA 2IYGA 2MZJA 2PE8A 2ZBCA 2XC9A 2VA2A 2KXHA 3MECB 2W9BB 1U2RA 1VC6A 1XN9A 3V6JA 3RU0A 1IXKA 2VG6A 2UVUA 4KE5A 3NNHA 3JB9k 3VAMA 1A9NB 2IFXA 3KNGA 4DQQA 3NNCA 5EWEA 4R5PB 4RWXA 1SL1A 3KG0A 3OFGA 5CYJA 4EEYA 1YGYA 4RW7A 3IWXA 1RT1A 2AGQA 1Q1KA 3SDEA 2MZSA 2C3UA 2IBOA 3OVAA 1U26A 4MIBA 3OJSA 2CJKA 2M2BA 3TR5A 4QQBA 2HAIA 1C0UA 1KLMB 3KLFB 5DS7A 1R8BA 1VQMS 4ICLB 4F2SA 1TK0A 1FHTA 1P1LA 3LF0A 2FJVA 2C3PA 2JHEA 4DSLA 1HHTP 5E0OA 3MD1A 3LO3A 4DV4F 2B9WA 5G0RA 1HQUB 5KFUA 4R0EA 1IUJA 1JLQB 2PMHA 3HHLB 4WFYA 4ES3A 3MEEA 3H40A 1H2TZ 2VPXB 1Z2ZA 3FCHA 2YKPA 5F8JA 3HLUA 1MU2A 4NCGB 3VAGA 2EFPA 4RWWA 4ZHRB 3PW0A 4N8OA 2VFTA 2IRYA 2CKWA 3OW2R 5EX0A 4Z2XA 3HVRA 3H5UA 3E2EA 1REVB 4PXDA 4X62F 3CCUS 2DNNA 1C1CA 3DDNA 4KIAA 3UWTA 4DQSA 2N4DA 1HBMB 2YKMA 1F5BA 1JKHB 4K4WA 1LK7A 2E5HA 2F8HA 5JVGQ 1C1BB 3MGJA 2GGPA 4C3KA 1FESA 2HNDA 2OPQB 3RRKA 3OUYA 5KFEA 2X1BA 3PKMA 1FTRA 1ZTTA 4P2SA 5I42B 2RQCA 1FD8A 1Q16B 4DG1A 2CQIA 3NL0A 3AJ2A 2Z4PA 3IA0A 3D0HE 5KFTA 2LVWA 1ZM9A 4X64F 1S6PB 2PFFB 4AXIA 3DRPA 1RTJB 1WACA 4UQGA 1CLFA 1HI1A 1IJEB 2MZQA 4RUHA 3KLVA 5H9FJ 3AH6A 2C3YA 1SXLA 2IVMA 5M2UA 2RDJA 3KHGA 4HT5A 3LUYA 3W7BA 1UFLA 1OS5A 2LU2A 2NS1B 3DLGA 3OJUA 1RT6A 2ZH9A 1BQNB 1S97A 1W2BR 4W92B 1HMVA 4HVZA 1T05A 4LF5F 3PX0A 1QE1A 2YWEA 3LANA 3S8SA 1KVIA 1I6JA 3FSXA 1P6TA 4BWMA 2DCUB 4Q0BA 1OO0B 3DXBA 2FVSA 2JWNA 7FDRA 1Q53A 2V4JB 2XY6A 2V0NA 4IH5A 4DX8H 3KLEB 2RRAA 2FGCA 1FNXH 5KFKA 4K2XA 1Y00A 3CE8A 4WYLA 2PT0A 6FDRA 4YR3A 1U1MA 3RAMA 4IFVA 3L7OA 3MM6B 5CXTA 4QIGA 4YDXA 2DGXA 3NCQA 2E7XA 4AQYF 4DV5F 1TK5A 4KV8A 4K4SA 1TUVA 4WK3A 4J9SA 2HFOA 1PSDA 4RW6A 1HWJA 3QLHA 2N3LA 4Y28C 4JUZA 3KK1A 4NLPA 1L3SA 4NLTA 2XI3A 1FE4A 2HFZA 1K9MT 3IGNA 4NYOA 4AFFA 5HMXA 3EYZA 4RBUA 3ENWA 1X4FA 4MYTA 5C24B 1JX4A 3BGFA 2J0WA 2GX8A 3POTB 5A0YA 3UNGC 4ZPWR 1TV6B 3V81B 2WSCC 5HMWA 4WE1A 1E6VA 3V4IB 3PACA 1MMNA 4A8MP 5I3UB 4CQ1A 3GFZA 3RTVA 3I32A 1U1QA 3KK2B 3M8SA 2DR7A 4O4GB 4E8UA 3HMJG 3H4BA 1N5YA 4CO3A 1DQ8A 2LXUA 3FQKA 1J5OB 3CDAA 4OX8A 1V6HA 4IDKB 4DFPA 5LXRA 2JX2A 5EWFA 3J7Z5 3NG8A 3V6KA 2CPFA 4NZ7A 2O66A 1VQNS 3GSDA 2GHWA 2OFGX 4F25A 3RR7A 2X51A 4YEAA 5K14A 4Y3CA 1VK8A 1NH7A 3Q24A 4ATNA 3CCQS 1R0AB 2MKSA 2JEIA 1QAYA 5THWA 2Q43A 1TVRB 2AJFE 4J9NA 1I1GA 4V19X 2NLWA 2UXBF 3DMJA 4AXJA 3NKYA 1J2VA 3M8QA 4N8NA 4ZCLA 5CHCB 2QT7A 3IR6B 4FS1A 4A8WA 3QJPA 4C97A 2GQ2A 5JXSA 4ILRA 5CYQB 2W9BA 2B9XA 4B9NA 3I0RB 2KM8B 4X84A 2XCAA 4IG0B 1YRXA 4NLYA 2CQHA 4URSA 2LXFA 1JIHA 1DURA 4OI2A 2CJAA 2DB1A 2K8GA 2XO7A 4A8FA 4R5PA 4ILMA 4DQRA 3D0IE 2BRKA 2OPSB 4F02A 2LQBA 2EC0A 5GMKa 1BQMB 2IM2A 1S4FA 3SMZA 2N82B 4IR1A 5FDLA 3DLEB 3U1LA 1G6BA 5E3PA 4ECSA 2D1CA 3RZAA 4C8MA 1KLMA 3D0GE 4QU6A 2HVIA 1X9WA 4FBUA 4ICLA 4LSLB 4B9MA 1BWEA 1HW8A 2ALZA 4DQIA 2MKJA 4MTPA 1P9QC 2RRBA 4ECXA 3MPWA 3TAPA 5LMNF 3N4WA 1JLQA 1SH2A 3HHLA 4WXWA 3CUNA 1ZAWA 4ECTA 2VC1A 5J2MA 3OTBA 2UZAA 4NCGA 4BDPA 4DLEA 4ZHRA 4DSIA 5D4PA 2MKIA 1R7IA 4HYKA 4O44B 5K8PA 4GC7A 4ED6A 4KPYA 2XNRA 1Y7PA 1TKXA 4ZP9A 3NAIA 2JEFA 4E0DA 1SC6A 4KB7A 2KO1A 4C3LA 3TUZC 4USHA 3PXGa 3G71S 5IZHA 1VRTA 1HBMA 1VK3A 1Y5IB 1X4CA 3FNNA 3PDNA 2P5VA 4OZNA 1JKHA 4A8XA 5KFPA 1U1OA 2QLXA 2R8JA 3KOAA 1N33F 1XERA 4TU8A 4RUAA 1C1BA 2QSFA 4WFAQ 3DYAB 4LUBA 1VHFA 1M1KT 1LXNA 2FJDB 5CQGA 5KFFA 2EG2A 1UA0A 2OPQA 1RA7A 3FEXB 3FDSA 3PNIA 4FNIA 5B0BA 4RNMA 1KD1T 4BCAA 5I42A 2EFNA 1O5JA 5CYMB 5KFYA 2JEJA 4QCLA 2F8EX 3DCAA 1SJ3P 3HVWA 2IJNA 5CZVA 2E9TA 1QAJA 1DBDA 2DHAA 5DLGA 5JVHQ 1DTQB 1RTJA 2I5JB 1MW7A 4YDDB 1NKBA 4N56A 1VQ6S 2IMWP 2YWGA 3AHPA 2JC0A 4NPOA 1X5TA 2FC8A 2RU9A 3CWJA 3T1YF 2R7SA 1BQNA 4NA2A 1QVGR 2DNKA 4WK1A 1QLNA 4OJ3A 4DWIA 1VQ5S 2A2DA 3C8YA 1DFDA 2R8GA 2XMTA 4MKBA 4WFBQ 1NO8A 2VQEF 5E3CA 2XZWA 2EPIA 4GC6A 2VPYB 3HHLD 4N77A 2EVZA 1YJWS 3RRHA 1K8AT 1U24A 2GV1A 3IBWA 2VA3A 4CT8A 4WKRA 1HW9A 3FFIB 1S1VB 3OTDA 3SEOA 4C11B 5BYSA 1H2VZ 3KLEA 3NAHA 4B3TF 4GKJF 1VIXA 3CDEA 3MM6A 1ZH5A 4B3OB 2KFZA 2CPIA 4RW8B 1Y9OA 1LW2B 1U1PA 3HP6A 4I2PB 1FEHA 4I69A 5CCLA 1UWBB 4OL8A 2W7OA 3UW1A 2RS8A 4DDFA 4DL7A 1HI0P 4C0OC 2ROPA 2FHJA 1LOUA 2RE1A 2BDPA 2OD4A 4JBCA 2HS0A 3N0VA 1IBLF 1D9FA 1XNRF 1V9OA 4EO6A 4FPRA 4PQUB 2ASDA 2HWIA 2PGCA 5C24A 3POTA 4F4XA 2HHSA 3KHLA 1TV6A 3O1LA 2R7QA 2W7PA 3V81A 4F3MA 2NSBA 3J7A1 5G4DA 2IA0A 3Q0AA 2B5JA 3M6UA 1LXJA 1YBAA 4OZ1A 5I3UA 4Y65A 2Z2LA 3T1AA 5LSRA 5E5NA 3KK2A 2HHXA 2APOA 2C2EA 2CPEA 4O4GA 2LEAA 2WW8A 2IA6A 2D3ZA 2ZDPA 3DI6B 1YWXA 2ASYA 3M2VB 1J5OA 4IDKA 2BE2B 2FUG9 2OAUA 2W8LA 1X4AA 2NUUG 3G6XA 4OZLA 3VAIA 1YHQS 2EFGA 2Q1LA 3PIPQ 4ZPAA 2UV8G 3OSNA 4F8RA 3TARA 3DRXA 5LL6d 3MPYA 1VGYA 3NGKA 5KG1A 4Q45A 4FZVA 5DGAA 4CCHA 1R0AA 2R7TA 3K5PA 1H7XA 2CZVC 2X1AA 1PGZA 1T03B 1NU4A 3I5BA 5AXNA 3C66A 3QJJA 1Q82T 3KLGB 4DS5A 4CTAB 1FRHA 5EWGA 5L9NA 2VZ9A 1F5CA 3OXGA 3VTIA 1VC5A 1RT4B 1E6YB 1H38A 5CYQA 2JLGA 3S6EA 1N8RT 3I0RA 4BHQA 3GIKA 2KZZA 2MQNA 3CIMA 2M3DA 4L6V3 3G4SS 3NNAA 2OPSA 2ZD1B 3MM8B 4K59A 3BB5A 4OX9F 1WHYA 3FSYA 1WF0A 4JYAF 5F8MA 3JTNA 3DLEA 4DL5A 1XWLA