3N5BA

The complex of pii and pipx from anabaena
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
b'MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKVEIVVEDNQVDMVVDKIIAAARTGEIGDGKIFISPVEQVIRIRTGEKNTEAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
pubmed doi rcsb
source organism Nostoc
molecule tags Transcription regulator
total genus 23
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n5bA00
2O66A 3TA1A 1P1LA 1V6HA 3AA8A 3NCRA 4OZJA 2DCLA 1Q1KA 1O5JA 2VD3A 2XZWA 3MHYA 2ZOMA 2RD5C 2J9EA 4WK1A 2O67A 2JJ4D 2XBPA 3CE8A 4RWXA 3NCPA 4CNZA 1XK8A 5D4NA 3AH6A 1NH7A 3NCQA 4RX6A 2Z0GA 4YB6A 1H3DA 1V3SA 1VFJA 3TA0A 4USJC 4AFFA 4NYOA 2J9DA 4R25A 3LF0A 3OPKA 4E98A 4CO3A 1KR4A 4CO0A 3TA2A 1PILA 4C3KA 4CNYA 3X3UA 4YB7A 3M05A 3DFEA 4USHA 2J9CA 2GW8A 1UFLA 2XULA 4CO2A 2CZ4A 3O8WA 4D3HA 2EG1A 1QY7A 2EG2A 3O5TB 4YB5A 1O51A 3L7PA 3N5BA 1UKUA 2ZFHA 2E66A 2PIIA 4RLEA 4CO5A 3BZQA 1VHFA 5DRKA 4OZNA 1HWUA 4C3MA 1UMJA 1V9OA 5D4LA 4CO1A 4Y6IA 4NYPA 5D4PA 2NUUG 2XG8A 4IYQA 4RWWA 4D3GA 1NH8A 3GSDA 1J2VA 3AA9A 5DS7A 4OZLA 3HLUA 1OSCA 2GNKA 2NS1B 1GNKA 1NAQA 4CO4A 1UL3A 2V5HG 5D4OA 2GX8A 3AHPA 3T9ZA 4C3LA 4ZK7M 5L9NA 4USIA 1V3RA 2J9DE 4Y65A 2NUHA 1NZAA 4WK3A
chains in the Genus database with same CATH superfamily
2NCKL 3Q24A 4B9SA 2YKNA 1ZA2B 2BABA 1F6TA 3T5LA 1FDDA 2VC0A 3N4WA 4Q0BB 3S6EA 4L72B 3OVSA 1S6QB 2P5VA 1RADB 4WK1A 3J7YU 4ZDNA 3FSXA 5IC4B 3F73A 4USMA 2W25A 2RHQB 4KGVB 3CWJA 2EXUA 2DB1A 3MEDA 1QSLA 2OPSB 2NZ4A 2E7VA 2IFXA 2F7VA 3T1YF 1FNOA 2VC1A 1DFDA 4A4JA 2ZH5A 4CM0A 3BBBA 3DLEA 1WSVA 2RSQA 5L1LA 2WZ1A 1U6ZA 1NUEA 2M88A 3F41A 3NS6A 2BE2B 4DI6A 2I6WA 3C6UB 2CZ9A 5B0FA 2ZJRQ 2QG9B 1S9GA 1L3SA 4LF7F 4K5RA 1PO6A 4F0MA 3B78A 2CQ1A 2ZWPA 2VB6A 1VRUB 4NXMJ 3CD0A 2C2NA 4DPOA 4PQUA 4FN5A 1CEZA 1YJUA 3A8JA 2X1FA 2DGTA 3QO9B 1N5YA 4ECTA 1GH8A 3GONA 3PNIA 3W9JA 2PA3A 3OR1B 2E5GA 2FVRA 2I38A 4ZLLA 4CYUA 2D69A 3R2CJ 4TY9A 4ED2A 2WK4A 1YRXA 1XNQJ 5DG8A 1XR6A 2Z30B 3M2VA 1RCXB 1ZTTA 2W7AA 1JXLA 4EI2A 4IG3A 1KEKA 1XNRF 3ENWA 5CD4H 1HBNB 4AL5A 1EQ0A 4ETXA 1X5OA 2MTLA 2RKIA 3PG9A 2AU0A 5IQQA 3TZZA 4B3TF 2QLBB 1RGVA 4UOHA 3FDSA 2MY8A 1N6QA 3T5JA 2WW4A 3W60A 2C2MB 3BYRA 5HN0A 3TUZC 3HSDA 1LOUA 3MUMP 2OTJS 2N3LA 3ISZA 3JSMB 3UDEA 4NZ0A 3GIRA 4WFYA 3ZTOA 4WP3A 2HK2A 3DDNA 2GX8A 5KFSA 2GIFA 2RQKA 4CLTA 2CIMA 4ECVA 2H5JB 3G6VA 2ZNZA 2CZVC 1UEKA 4X4QA 5DO2A 3KK3A 3PJXA 1R31A 3OJUA 3OTCA 1EKRA 2J9EA 3RTVA 1RBLA 3L9ZA 3QIPA 3FGVA 1JK9B 1C1BA 4O0IA 1H3DA 1FFWB 4OYZA 1R6VA 2QYGA 1TFWA 1RT1A 4LF1A 2J9CA 1S10A 1YDLA 4B9NA 1I94J 1FRXA 4TU7A 4HEA9 1RT2A 2LMIA 1BD6A 3BZQA 3OUYB 3W5ZA 4KAIA 3P45B 1C1CB 3P4UB 3L7OA 3MMBB 3TW0A 3GJRB 2G0JA 1UWBB 3U1NA 1H2UX 3BEGB 4X84A 2IYIA 3KJVA 3I5BA 2FY8A 2GHVC 1RHRB 1ZA1B 2RH3A 4Y0FA 3KYLA 5KFPA 4OMFG 1P6TA 5KFEA 3K8WA 2Q66A 2IM1A 3HZGA 2LU2A 4U67Q 4JV5F 1PBUA 4UUWA 4LF6J 2GA7A 2XB2D 4JI3J 2OFHX 1UVMA 3IA0A 2XLJA 2NXEA 4DFMA 1BXNA 1K1QA 3BPDA 4FVCA 4JOUA 3DI6A 5HO4A 2GVDB 1QTNB 2FDNA 3MCMA 5HVFA 4DXLA 1S1WA 4PUOA 2UXBF 1BQMA 3A3PB 3M8PB 2J8AA 3IS9A 2VG7A 2BJEA 3UQSA 4NXNF 2KU7A 1FESA 3LP1B 5CHCB 1LFWA 2J0QD 1IN0A 3W66A 3KHHA 3G8TA 2FLLA 1DQAA 4D3GA 5I42B 2CPJA 4CCHA 3EWGA 5A8KA 2M7SA 4F3OA 1CJVA 5E2QA 3LW5C 1KVIA 3H2VE 3LOUA 5L9NA 3TUIC 1X4CA 1B0PA 1S1VA 3T3FA 2YKAA 5FJ4A 5KFJA 3EDQB 5F9NA 3R5DA 2F4VJ 1BHNA 2W2QP 1RWVB 2GJFA 1K0TA 2ASDA 1HPZA 3KK1A 2HK3A 1S0VA 4DWIA 3JSYA 3PFEA 4AYBD 3L95X 1YQHA 2RS2A 3SZ2A 4QJVA 2CQ3A 2J7UA 4LRCA 3GPAA 3TZXA 4ED1A 5G0RA 3OLBA 1SQEA 3I6PA 1KBRA 2ZZNA 4DV1F 4QIGA 1WC0A 3SV4A 3N5BA 2ZWOA 2DH9A 4PCQA 5CH7B 3VQSA 3Q2SC 5ETQA 2LVWA 4B3RF 3GZ7A 5D15A 1GEHA 3KLGA 2KZZA 2HMIA 1Y5NB 2VPYB 4CLWA 5K14A 2AX0A 3ILOA 2E5LJ 4N5SA 3G2XA 3MPDA 2ZD1B 3ZTPA 2QC3A 1BMQB 4CIOA 4PPZA 3ELHA 4LF4J 4XK8C 3DYAB 5F8NA 2MGZA 3JQKA 2PSZA 4MKYA 2BOPA 1NSKL 4ZVSB 2BJ7A 4OQJA 1WC6A 3W65A 2BKOA 2I2YA 1UEVA 5GMKa 1SKUB 3TANA 1ICEB 4P75A 1R0CB 2LYVA 4G1PA 5FDLB 2FJWA 3PW5A 2EKYA 2KDOA 2YNFA 5HMXA 1BWEA 2P9CA 1NDPA 1H98A 3P8BB 4TU9A 5J2QA 1S1UA 2B9XA 2MSTA 5DDQC 1K73T 4U96A 3HSJA 4DF8A 4ICLB 4Y2KA 4Y6IA 4OV6A 5H9EJ 4YS2A 2MJUA 1X5PA 3BGLA 4USTA 2B5JB 1H2TZ 3OL7A 2OAUA 4Q2MA 5A2QY 4J37A 2XS7A 4DR7J 2YX7A 4A8QA 3LP0B 4DV7J 4ZMMA 2DEJA 2DJWA 2GZOA 4AT1B 1FFGB 2IBOA 1YZ6A 4YUDA 1MROB 2ZE2A 3H90A 2IY5B 1UPMB 2YH0A 1YSJA 2H4WB 2X1AA 4LRBA 4PXCA 4AXJA 4L75A 4ECRA 3AXKA 4PWDB 3MAAB 2HAIA 4XPCA 2GMHA 4JI5F 4KC5A 1Q16B 2IIHA 4URQU 2HQGA 4NLYA 4Q8EA 3T6BA 3H20A 5D3GA 3BB5A 1RBOB 3KLHB 4USHA 2HVEA 3Q2TC 1VLYA 2A0FB 2POKA 4C4WA 4ED4A 4DCPB 1IKYA 3W62A 3PW2A 1VC5A 2VPXB 3OXFA 1HYSA 3MUVP 4ED5A 2OFGX 3HMJG 2ZH7A 1SH2A 3W9IA 4LQ9A 3G8QA 1ITPA 2Q6BA 4L3KA 3CPWR 3NMAA 1QDUB 4NYPA 3FJ2A 4DU7A 4G1QA 3QGGA 3MDFA 1KKHA 3JYTB 2LDYA 3HCXA 4DF4A 3VAMA 1H7XA 3CUNA 1VC6A 3C3LA 3SCKE 2D3O1 2YWHA 1NB7A 1TMJA 3OFHA 2KJVA 3WIUA 1IKWA 2MZ1A 2UXDJ 3M2RA 2DHGA 4LF9J 5KAKA 1S79A 1S6PA 1NO8A 2HWIA 5I3UB 2VU5A 2XWYA 2WOMA 3M8QA 3MMCA 3WZ0A 3SDEA 1Q8BA 4K4WA 2HS0A 2GAHC 2K2PA 2YKNB 3HVTA 5A0YB 5IV4A 1LW2A 2HGLA 3HJVA 4DN9A 5FLXY 2M52A 3PYGA 3AQPA 2PEHA 2OD6A 3PO5A 3OVBA 2DY1A 2JEFA 3KG0A 2MQMA 3GR0A 3EGZA 4G65A 3M2UA 2HHHJ 3RU0A 3MEDB 4OHWA 4N8NA 1YJVA 4ILMA 4QR0A 2C3UA 2Z2MA 4UQGA 4IRDA 2YX4A 4CQ1A 2BQ3A 5DQGA 2JRSA 2HAFA 3DLEB 4QZVB 3VR1A 3MPVA 2CPYA 4WTYA 4DV0J 1TAUA 2BJ3A 4LVOP 3TNVA 1XR7A 3ZNJ1 1S7IA 1F9EB 4NLQA 1IKVA 2DIVA 4ZJQA 4RPFA 3AODA 3CULA 2XI3A 3QYYA 2PEBA 3VVUA 1RJJA 4LSLB 2VDHA 1VJQA 2QYCA 2XQCA 1CJUA 4CLKA 2OPRB 2WHOA 4DV2F 3CDWA 1ZS6A 4NMXA 2ROGA 4CYUB 4DR5F 3UWTA 3EGNA 3FRZA 5J2NA 2LEAA 1U1KA 4IG3B 4W92B 3RRHA 2XMVA 3CCVS 4ZK7M 3AHPA 3J7AN 2KHDA 5T14A 2PA8D 2RKIB 1HHSA 2C2OB 4LFCJ 3MR5A 1ULRA 4WYLA 2AYMA 4F02A 4WFXA 3J80Y 2YNIA 3P6YC 5LXRA 2C2RA 1WG5A 2DO4A 5C5JA 4RU2A 2CWKA 2A6OA 4I69A 2FVQA 2V50A 1IR2A 2EEYA 1RAAB 1FXDA 1TV6A 2XEXA 2CQCA 2IC3B 2RRAA 3KK3B 5IOLA 5K8PA 5KFVA 3NBPA 1M1KT 5GAGU 4RLEA 5C42B 2YBVA 3BKTA 3QIPB 5F0WA 1C1BB 4PEOA 3MD1A 1S0NA 5KFWA 1NH8A 3AD9C 2AJ1A 2ACMA 3KWMA 1RT1B 1NK9A 3KOAA 2WONA 1R27B 4CLPA 4IQXA 1JLGA 4V19X 3GCWP 3LUYA 5CXTA 2F1FA 4X4RA 3H2UB 2WB4A 2BBEA 4N41A 1U6FA 4C98A 1WNEA 1T03B 1DTQA 3MTKA 3KJVB 2IDEA 2QRRA 3HDSA 1DQ9A 2R7WA 3T1AA 2R4FA 3BPSP 2IJFA 2LQ9A 1XMQJ 1OQ3A 2RQMA 1HBOA 4FNIA 1S9EA 3X3UA 4OX8A 4ALZA 3FRYA 2J7WA 2XNRA 1YI2S 2AT1B 5CYQA 3QAUA 1U47A 2K1RB 3W1YC 3G82B 1BY9A 2W4CA 1RLCL 4TLQA 3FK4A 1T9VA 2KHCA 4LRAA 4H4OA 3DI6B 3MMAA 2ZM6J 2GQQA 2JC1A 1NSQA 1RK8A 1O0PA 4J9UE 2WTFA 4F7VA 2UUBJ 4FYXB 1HFEL 1X4EA 3JTNA 3WQPA 1BQMB 3IS9B 4AL7A 2VG7B 5SZTA 4RU9A 1YBAA 4DJBA 9ATCB 1T05A 1V6HA 3TWZA 2E1MC 4Y2IA 3DKDA 2YH1A 3R5AA 1AFJA 4ENOA 1HNVB 2JVOA 4ZVTB 1G1XA 5IV3A 1VQMS 1LWEA 1GK8A 4B9UA 1Y10A 1RHJB 5FD1A 2BACA 1S1VB 2NPFA 3V6KA 1XC9A 2QEXS 3FEYB 5A6WA 2YKOA 1HPZB 1YIJS 1A0OB 2FJEB 2QL5B 5F8GA 2DNHA 4OZNA 3SFGA 2CNLB 3EVOA 3SCJE 2AHOB 4OYAA 2WVFA 4N47A 3HHLD 5G0RB 3BM7A 2GNKA 4ANEA 2O5DA 2DRAA 2DITA 2R7SA 5A6PA 1KTVA 2OEMA 3BF4A 1FA0A 2EFGA 3AD7C 1Y0HA 2HNDA 1KQSR 3JXOA 4ES3A 1UZHA 4OZJA 2VQEJ 4WZQA 1W7WA 4C8LA 3EJMA 2OH2A 4ZIWA 4DR6J 2HMIB 3HZEA 1UVNA 5LMNF 5KFXA 4KV8A 4WP8A 2BANA 5AE3A 1FF2A 4UTGA 4K4XA 2JL9A 2XGQA 3KFWX 2UUAJ 4NL5A 2Y0SD 1RA6A 5HMZA 4DQRA 1M5HA 4FXDA 3ZZOA 2L08A 4YB5A 3MOZA 1VBKA 2V8VA 4URGA 2OPQA 3GV8B 1TKXA 1SJFA 3PIOQ 3A13A 2QN6B 3G4SS 5HQLA 2DO0A 1J2VA 3HHKA 3PEHA 2GO9A 4DR4J 3KTQA 2VV5A 4RJVA 2MDAA 2BJ8A 1SC3B 3J7Z5 5J2QB 3GYNA 2MZRA 1S1UB 1HWJA 1WELA 1X60A 2WVBA 3D3CJ 2DK2A 4XPEA 5I3QA 4YY3J 5LJ5Y 2DGXA 4DZDA 3M8WA 1BQXA 4X4TA 1RP5A 3UO0A 3D6MB 3V6DA 4FF4A 3QRQA 4B9VA 2CVEA 4RW6A 3CO0P 4J7CA 2MEWA 1SJ4P 3VHQA 1X8DA 4B3SF 4ELVA 5AJ3J 2LDIA 5B0GA 3IG1A 4X4SA 5L1KA 1OJ4A 1SXLA 2ZE2B 2HIYA 1VQ5S 1GMVA 1EARA 4X2BA 2AEFA 3EXYA 2B7BB 4Q44A 3EXCX 3AA9A 4U7CA 4MAKA 5ETRA 1S1TA 3U02A 1L3UA 1IKYB 4BBYA 3V2UC 3RBEA 4OI4A 1HYSB 4OLOA 2XZTB 1JJ2R 2GS8A 4TN2A 3MECB 1FE0A 2VFTA 7FDRA 2JC0A 1L3KA 4KE5A 2VJUA 1RTHA 2CQBA 2LQ8A 4G1QB 1OPZA 2MY7A 2B4VA 1G4CA 2MPUA 4DZ6A 1ZM2A 1PKUA 4P73A 5ETNA 2EK6A 4IR9A 5B0EA 2UUCF 2CQ0A 2CQ4A 5B0AA 2VASA 1YTYA 2ZBCA 4U8YA 3LF0A 2ZDOA 1RTZA 5K5MA 1IKWB 3KLVA 1FI4A 4A8OA 1JLCA 3KHRA 1Y3KA 4DL3A 3TAMA 2CFXA 4FBTA 3DLKA 3VGUA 3OQ2A 1S6PB 2Q3PA 4CLLA 1PAEX 2WOMB 3QT7A 5DRKA 3KHLA 4MFBB 3MMCB 3F44A 4ZVFA 3HPOA 1IUJA 3AJDA 2HIQA 2BOAA 3D0GE 5DS7A 3SDEB 3LQVA 3VAFA 3GR1A 1TR0A 2V5HG 3HVTB 2QE5A 1RT5A 1LW2B 2IPOB 4QIVA 1RT6A 4OV1A 2EW9A 3CJKA 3GSIA 3I5CA 4IFYA 4I7FA 8RUCA 3CIZA 2RNEA 3DN9A 4I2QA 3J7YI 1VLOA 5E3RA 3R7BB 3M32A 2NZCA 3M2UB 3NLCA 4P7TA 1X0FA 2X1BA 2UUTA 1GX6A 4YDDB 4NI2A 2RUGA 2DHHA 1X4BA 3QZ7A 4CDIA 1KN6A 5DJBA 1SIZA 5M2RA 4RUHA 3N9UC 3NAIA 1HNZF 4LFCF 2E1AA 2WRMA 2MLXA 3CC2S 1NEEA 4NRTA 2F9JA 2PMHA 2PGCA 5E0OA 1CBKA 2VDIA 1X5SA 3GSDA 4H4KA 1R8PA 3FCWA 1IKVB 6FD1A 1SB6A 1N0UA 2YXLA 2DEIA 3OSPA 2MMYA 3ICLA 3L7UA 1C0TA 2JFKA 4I67A 2QMWA 5L39A 3MM9B 3CJ0A 4ZHRA 2ZZMA 3BDPA 4A8XA 1O8BA 2NYHA 1RTJA 1UCNA 3Q8QB 2HW3A 1MMLA 4UY8T 1O5JA 1JX4A 4UF4A 4QIEA 2QSFA 4ECSA 2HGNA 3K58A 3FCVA 1YJNS 2OMLA 2HZCA 1S6UA 3NOGA 1PC4A 2CDQA 2HWHA 5F3TA 2B9EA 3ZZ0A 3K2YA 4CO0A 3IWNC 1WF0A 2P6SA 3VGTA 3ETMA 1GTHA 4NLGA 4OX9F 2AX1A 1HA1A 3PKMA 4LSZB 1GX5A 3QPIA 4PG5A 3FQKA 5BYQA 3BH7B 1RHQB 4OHVA 3CJ5A 3I96A 3TARA 4X4VA 3TZWA 3Q23A 4B02A 1UETA 3DRRA 1B7YB 2CG8A 5U47A 4OZLA 4IG0A 2GV1A 1NBEB 5E3QA 2VQFF 2QA4G 3HJFA 4IUFA 4NWBA 1TV6B 4WFAQ 4LBIA 2BYCA 4N8OA 4C9DA 3MOJB 4LSNA 4WK3A 4MIAA 3QLHA 3M1VA 3R6LB 5AXMA 2IA6A 4C8YA 2RF2A 1YWXA 3NGRA 2BZ2A 2W4DA 4X4PA 1OY6A 2WONB 2V2VA 2H5EA 3I82A 4KH0B 1CSJA 2H48B 4ATNA 5F3ZA 1U2CA 4PG6A 4N77A 3MFIA 5IT0A 1FO1A 4AUKA 1VBYA 1LV5A 2BRLA 4RW8A 3LGMA 3ISNC 1NJXA 1YJ9S 4X64J 4JV1A 1Q81T 3KXDA 4CH7A 5EHHA 4HR2A 2WSFC 3CDBA 2AQ4A 1HBOB 2DVIA 2K7KA 4DBQA 3BQ0A 2AW0A 2ZUAA 2Y8YA 2HLTA 2KI2A 1G6BA 4M63A 1JMTA 4K4YA 1TFYA 5CYQB 3M8YA 4Y2AA 1B0VA 5DETA 4IRKA 2BW7A 4DV3J 1V5VA 1N36F 3IR5B 3MMAB 1PCAA 5DQHA 3NXZA 3QJLA 3ZTSA 4DQIA 3OBIA 1FNXH 3R2DJ 4KO0A 1K1SA 3O2IA 4M5NA 1T05B 1TUGB 2CQPA 4OZ3A 2ZC3A 1U02A 3EDRB 3CDUA 1SI9A 5AT1B 1M5PC 3P49B 4BC7A 5HL7Q 3M8ZA 2VICA 1HI1A 4NA3A 2XMAA 1N52B 4OHXA 2AWZA 1F1BB 2ZH2A 5HAOA 4DG1A 2CPXA 4RR5A 4YHHJ 3M6UA 1HQEA 2UU9F 4B08A 2C22A 1U45A 4M94A 3PJWA 2H1YA 1MSWD 2DNQA 1RU1A 3R8YA 1U1MA 4LR9A 2LEBA 2HHVA 3RG6A 1FJCA 4QYRA 4OI0A 2OTLS 2OUGA 1SUQB 4AE5A 4FPRA 1CULA 1N5SA 1WF2A 1Q53A 4DMZA 1SCJB 4JI8J 4QWDA 3BV8A 3PX0A 3R5JB 2WBMA 2CYYA 3O44A 5J1PA 4TY8A 3QGPA 1S4EA 2CPFA 1U26A 3TJAA 1ZAVA 5CCMA 3BN7A 2W2PP 1DHMA 1KLNA 1HW8A 2R3VA 2VBZA 4ZJLA 1KQGB 1WEZA 3D0HE 3GYXB 3K5OA 4PXBA 5C25A 5IFMA 2IJRA 3IR6B 2E66A 2OPPA 4TQSA 3UDVA 2ZBIA 4KV8B 5ETVA 1T8EA 2BANB 2YWWA 3IN5A 2I5JB 1BQNB 1DTTA 2FJDB 2NXJA 3GP9A 1Q82T 3PZPA 3GB0A 2CKWA 3LO3A 2W24A 3CMAS 5DQIA 2CPEA 3R5CA 4C7QA 4PYDA 4RNOA 2JWNA 2R7XA 2RU3A 1OO0B 3UW1A 5LMUF 1CLFA 1UW4A 4ZPDA 4PWWA 1TKXB 1HKAA 2BE2A 2VG6B 4JI6F 4EUVA 1F0XA 2HFSA 3H40A 4NA1A 2AKWB 1HQ2A 4ZVRB 8AT1B 4USKA 5L38A 2JEJA 4CLYA 3SFUA 4NLSA 3GILA 1UFWA 3PKYA 2MXYA 3GMGA 3NWRA 1XJWB 1RXOB 2XCAA 3MM6A 3OV7A 1R0AB 4PG7A 4QWEA 3IWLA 5A2QU 4DCJB 3CCRS 4OYIA 3G71S 3PV8A 1JLAA 3DXSX 4OJGA 4LF5F 5KFYA 3V4IA 3T1YJ 4ERDA 2DBBA 3EX7B 3V6DB 4P72A 2B8PA 4RW6B 1IXKA 2PO4A 2D7SA 2K7JA 4DQSA 2VFRA 5MAOA 3GJTB 1WTFA 2CJXB 4OFZA 4KQZA 1D9AA 3Q83A 1P8GA 3P5TL 4TNOA 4LF7J 2ZEJA 1VIOA 2F5GA 3NNHA 2VL1A 3UDLA 1EZZB 1W26A 5ITHA 1SKRA 2KN4A 1FEEA 3AY0A 2KTQA 4CRJA 3MMJA 1S1TB 4RX6A 5HMYA 3D7SB 2QL7B 4O3OA 3HO1A 2Z57B 1T0TV 1GMWD 1YJ7A 4WTOB 1N56A 5FIIA 3D9BA 3BSNA 1NCLA 2H65B 2K3KA 4DX6A 2PI5A 3M05A 1MN9A 1RE1B 3O8WA 1WORA 3FKBA 1U09A 2HRUA 2FGCA 3VAKA 4AXIA 1RTHB 1XNRJ 2BMBA 4NLXA 4DX8H 1NHKL 1NRKA 1FHTA 1MWYA 2DR5A 1FDAA 2E7XA 5KT7A 4B3TJ 1VYAA 3TVYA 3KJFB 4KPYA 4ECUA 3A8EA 1G2EA 5CYMA 2QFIA 4QCLA 2V4RA 4WF9Q 4F26A 2V8PA 1JLCB 2BE7D 2R2UA 2XY6A 1S76D 3TAMB 3AJ1A 3OUYA 4K59A 5C2GA 1HWLA 4IH7A 4QU7A 4UOFA 4XAKA 3BQ2A 1LWXA 1UJ5A 4FYVB 1RABB 3S1TA 4KR0B 2ZUGA 1LWCB 1XR5A 4QR1A 2IVFB 2V8HA 3B82A 4PAAA 1B7FA 5D0EA 5EWFA 2GHWA 1RT6B 5ETPA 5BR8F 2W8LA 3CJKB 2BDPA 2LKZA 4IFYB 5E5NA 3CEDA 3SSRA 2AZ3A 2QLJB 1D0EA 3IBCB 2VOOA 4I2QB 2LQJA 2CUYA 2E9RX 2DH7A 3M32B 3FEXB 3H5SA 2HFUA 5J2MB 1AROP 1JWWA 1PBAA 2HHQA 4ZVUB 3AOBA 2XC9A 1VK3A 3CC4S 3AXMA 3K5NA 1SJRA 4L76A 3UR0A 3HLUA 2AGOA 4ZA1A 2FJXA 2HQDA 4P71A 4O0NA 2R7OA 5CCLA 3D5MA 5LSOA 1WKLA 5HBMA 1EHWA 4RZRA 3MGJA 5BJRA 2BEFA 5IQ6A 3MHYA 4JV5J 1QTMA 2HYIB 2HNYB 2H51B 5ETMA 3M7VA 3HHDA 4MIBA 3B4DA 1RHUB 1TL1A 2XSFA 1C0TB 1JNRB 3TA2A 4NLWA 2GQCA 1REVA 4C8NA 4JI0F 1KHVA 2LXUA 3Q8VA 4CT9A 4A8MP 2YPZA 1WHWA 1UJ6A 1Z2LA 4CH0S 2V9WA 2A18A 3D1OA 3EGVA 1Y4ZB 3KG4A 2UXBJ 2QA2A 1HWUA 1U2FA 5DDRC 1F2HA 1HD0A 4EWTA 3KLFB 2C1EB 1VI7A 4NXNJ 1T9TA 1QAIA 4DCOB 2ASLA 2OELA 3J80U 3G96A 2KT5A 4JB8B 1NAQA 2GO8A 1RWPB 4OI3A 2J9DE 2VKZG 2C42A 2YWEA 2JFDA 4KT0C 2JNJA 4NLDA 3W7BA 3HHNB 5IZHA 3VV2B 2HWTA 4M5KA 1RTIA 3OD2A 1XN9A 4ZVGA 3TR5A 1J5EF 3D3BJ 2CPDA 2K8GA 2D9PA 3DRRB 4PXEA 4B9TA 3I4HX 2A2CA 2EFNA 3DYAA 4P9SA 4X64F 4P74A 1JLFA 2EC0A 2HBQB 3J7A1 2EI5A 4LSNB 4ILRA 5H9FJ 3QLHB 3M1VB 2PMZD 2JLEA 4ZP7A 1MW7A 5GAGI 4IOCQ 2RF2B 2XS5A 2YKPA 3FFIA 5B09A 5FDLA 4EO6A 4DV1J 1KP6A 1VRTA 3M6WA 1M0SA 3QIDA 3MURP 1UMJA 4JYAJ 2HFVA 2B3TB 1B4SA 2QSWA 2DNRA 2VODA 4YP3A 4B3RJ 2CQIA 4EMDA 4Z2XA 2DXDA 5ETKA 3OFEA 1CC7A 2Z58B 4HT5A 4K0KF 1B99A 3C14B 3L3CA 2IJNA 4RW8B 3PR5B 4DV4F 3N6NA 4NMLA 3MD3A 1M5VC 4I6WA 4A8WA 3VAHA 2HHUA 4J9MA 2M5YA 4DUZF 2FZCB 5HSPA 3CE8A 1XK8A 1HBUA 4O3NA 3CTRA 3AT1B 5HVHA 3D2WA 4Q8FA 5IM0B 4M5IA 2G2OA 4TLRA 3CJ2A 3TO8A 1SC1B 4KGMA 4X62F 3Q8UA 1M1HA 1S1XA 4MK8A 5THWA 2J6UA 1X7VA 3JSBA 4WXOA 1QY7A 3L7PA 3TJ8A 4Y34A 4NE9C 3QRPA 4ECYA 1QSYA 2UVVA 4OYOA 4MKBA 1LKZA 3IM9A 1YRUA 2JH3A 3KLHA 3VWSA 3RB6A 3KDOA 4U9RA 2HVHA 1OYEA 4KO0B 1YLXA 5LXYA 1D8YA 4DSIA 3TAQA 5KFLA 4A8YA 3D6TB 2IYGA 3IP0A 3W63A 1JJHA 3Q86A 4RNFA 2FGOA 3CJQA 1OMSA 3ZZPA 1ZM3A 3DGPA 2D3UA 2J5AA 3A3OB 3GG1A 4U6PA 3A4TA 4DG1B 1Q86T 2NXUA 1HQEB 3CJRA 1U4BA 4ZJOA 2MLZA 1CJKA 1FD2A 3PRVA 1MMDA 1SKWA 2ATCB 4F4YA 4F67A 2JEGA 4AFFA 2Y9HA 2FLPA 2ZNYA 2XMWA 3VVTA 4KGXB 5LSRA 4K2XA 3B4MA 1SH3A 3V6HA 1CULB 4NCAA 1XIQA 1NLKL 1NDCA 1WD6A 3CD5A 3EICA 1H73A 4M5DA 1PC5A 4TY8B 4YQWA 1OYDA 2BM0A 3EZOA 1K47A 4O23A 2HHXA 2CA9A 3CCMS 5D6GA 1EP4A 2RQ4A 3IM8A 4XDDA 5A0YA 1C4AA 4DR1F 3OSNA 3ONQA 2K3IA 3DMJB 3CCZA 3K5MA 4OJ1A 2AIRB 4UOGA 5HMWA 2JOQA 4RW7A 2I1RA 3HVWA 3SBMA 5H9FK 1S72S 5C25B 2OLWA 4ZLPA 2OPPB 2RMLA 1TL3B 5DGBA 5KT3A 4H4KC 3GJQB 2BJ9A 1DTTB 5MLCV 3JS9A 4FYYB 2IVMA 4JP8A 3OHAA 4Q43A 4C11B 4ANDA 2RRNA 2IBKA 4CTAB 4I0WA 4RUAA 4DQPA 1JXVA 2ACYA 3BSAA 2V63A 3PHTA 3JSRA 3EPGA 2ZJQQ 3D66A 4YB7A 2OD4A 1FT8A 4ZPBA 3THTA 4B9LA 1U0HA 1T95A 1KQFB 2AV5A 3O5TB 2CXEA 4WBFA 3MZIA 1M1GA 2FHMA 4BWJA 4GKJF 4DX5A 1A7GE 4C3MA 3C2PA 2J8SA 5AXKA 3MEKA 4LSLA 1X9WA 3SSQA 3MM6B 1U1LA 4KRWA 2Y1RI 1VQSA 1WKKA 2OPRA 3RAMA 4ETZA 1FNMA 3NG8A 5GMEA 5C24B 1JLAB 2Z8QA 2GGPA 2Q6CA 3D68A 3V4IB 4MIWA 4ZCIA 4F4ZA 3CCUS 2OSRA 1DBDA 3KK2A 5F8HA 4I2PA 5HANA 3G87A 3PW0A 3H4DA 3UCUP 2BKNA 2FTRA 5LJ3Y 3RB3A 3TJ9A 2RB7A 2WSEC 1CJTA 5B0BA 4AQYF 2BRKA 2I0XA 3NMRA 2M4MA 1VQ6S 4EZ9A 4R8UA 2UVRA 3PR4A 2JEIA 3LPEA 4DN0A 1YJTA 4G3IA 3LANA 1FDBA 5EWGA 1KOOA 4WIQA 4HTJA 4DV2J 2DHXA 1N33F 2IC3A 1YRTA 4DR5J 4RUBA 2RQCA 3NS7B 3G9CA 2J6SA 5C42A 4U8VA 3I55S 4DR2F 2GMJA 1M5SA 2ERRA 3WHIA 1UFKA 1G3OA 4LIRA 4NZ7A 4NYZA 2XLIA 3RJMB 3ILJA 5CYMB 4PPDA 4YB6A 1ZZFA 1TAQA 4ZP8A 4UQTA 4KGZB 4ZCLA 2HRYA 2N7CA 3TP2A 5IT4A 4K4UA 3DXBA 1AA1B 4ES2A 1RAFB 2IM3A 3DOKA 1T03A 2MZQA 1MU2B 4LFAJ 1TK5A 1LXNA 1NPKA 2V8GA 2ASJA 5D4PA 3R1LA 2IMOA 4NLRA 3OL8A 1S12A 1HW9A 2VZ9A 2AJFE 4MYTA 3RR8A 1IKXB 1K9MT 1F9HA 2HBYB 3T19A 5KFKA 4C8OA 4UOCA 1TZ0A 2OP5A 4OZ5A 2K1RA 4YR0A 3G82A 4F2SA 4I4BA 1OSDA 3RUBL 1V5IB 1KVKA 2LLZA 2FJAB 3UD3P 5DGAA 3DOLA 3H4BA 5B08A 2I8EA 3LGNA 3GJSB 4DL5A 3RB4A 2XZWA 3OR2A 4KHRA 4RWXA 1WKJA 4ZP6A 3K5PA 2HQIA 1RACB 2FY1A 2QA4S 5E3PA 1YKWA 1SV5A 1FVQA 1KR4A 1WDTA 2XMTA 4HHUA 5HBMB 1KRPA 2N82B 5KG4A 1U8WA 1VK8A 1YZ7A 3DDKA 5KT2A 1T94A 1HNVA 2RS8A 3IFEA 4LF8F 4YMEA 1KLMA 4HH1A 4F3QA 2L3MA 3PFOA 2GCFA 4Z37A 3SIPB 2AMCB 4LRDA 2XYPB 5A8RA 3T9NA 2VF3A 2DPIA 1FDNA 3FUYA 2HSEB 3EPIA 1TL1B 5GMDA 2VONA 2KO1A 1VR6A 1NB2A 2DNPA 2ZHOA 3DC2A 2W2MP 1REVB 1FJGF 4WXWA 2Q1LA 3T5KA 1PJ7A 3I87A 2K06A 4C3LA 4ZLJA 3P3DA 2KM8B 1KFSA 4RW4A 3MCNA 2APOA 3GCXP 3U27A 1Q4RA 2BX6A 2ILYA 2P6TA 2J0WA 4DHVA 1S57A 4PABA 3VQTA 4W4MA 1DARA 1HR0F 5E33A 3HHLA 2A1BA 3V4MA 2XMJA 3UFCX 5AE2A 1NH7A 2BXJA 1WF1A 2CJQA 4ZN3A 2PD1A 2U2FA 4JYAF 3FCHA 3HT3A 2FQQB 1K8AT 3DGVA 4OJ3A 2HFOA 4GRSA 1TVRA 3HKWA 4CO2A 2H5IB 1IBLF 2QMUB 1RTIB 3ILIA 1TUVA 3KLIB 3HVAA 4F25A 5F9LA 4CP5A 4DUYF 4MJKA 1R0BG 2QMXA 3E2EA 2LECA 1MWZA 1JLFB 3BJYA 2BVZA 2VBWA 4LREA 3IBFB 5D4OA 4X4OA 3HKZD 2OIHA 3K59A 3FFIB 5BYRA 1Q0NA 6AT1B 1RA7A 4GKKJ 1VRTB 4WCEQ 4MK7A 4NPOA 4PXDA 4OHZA 3LH2S 2M8HA 3LWMA 4CWBA 2FYXA 2PI4A 1N5QA 2NREA 3H98A 5ETTA 2P8IA 2QLWA 1KWMA 3GQCA 3UNGC 4F04B 2ZOGA 4IRCA 4F0HA 5LMNJ 4NZ6A 2W01A 3BQ1A 3THPA 3Q8YA 4DL0C 2GW8A 2YNHA 2COLA 1N32F 2HBZB 1URNA 4Q45A 2KT3A 5KOXA 2NXCA 1W2IA 4KB7A 4FYDA 3JQMA 3PW7A 3W5XA 5KFMA 1HBUB 2LA4A 3LAKA 4NLOA 2RUSA 4FKYA 3PW4A 1S99A 3ILLA 4LFBF 5JMNA 2M0GB 3VF0B 2B43A 1S1XB 1MNEA 1UZDA 1RAHB 4B17A 3UN5A 4UT4A 4F3MA 2L9NA 4JI1F 3H0PA 1G7CB 1X4HA 3C16A 1UA1A 1SC4B 3NCPA 4DEZA 1M5KC 1VQPS 2OJ3A 2B9YA 2KYXA 2VKRA 3PEJA 1F5BA 3W9HA 1WSRA 3MECA 1ZOTA 4G1IA 2Z2ZA 2QFJA 1TKDA 2PDAA 3CF5Q 5J1NA 1IBKF 3UDCA 3UN3A 3DGPB 3A8KA 2E5HA 5J1EA 2EG2A 3QNWB 4ZPAA 4B3SJ 3ZXWA 3WX8A 2VA3A 4DLEA 3K0JA 2WVCA 1NNDA 3N01A 1HI8A 1CJKB 2MZTA 3UE2A 1ELOA 1APSA 5F8LA 1PAUB 4JI4F 1IJFB 2XO6A 4DPXA 2P9GA 4CT8A 2D74B 2F63A 4LJMA 4TVAB 3C15B 4MFBA 5JJBA 1FKOB 4M5DB 2RE1A 2VHGA 3QZ8A 3C19A 1R8HA 1NJZA 1EP4B 3L09A 1ZPVA 2HVZA 3V81A 4B3MF 1CQNA 5IS2A 2HZVA 3BO4A 3EYZA 1HNIA 1XTZA 2MYFA 3D28A 4K4ZA 4RW7B 2J9DA 2BE9B 3W2VA 3IBWA 2VJVA 1MG7A 1Q78A 3RRGA 4CNYA 2UUCJ 2G1HA 4ZVPB 1U0SA 4WFBQ 1UFLA 2VBYA 1HQUA 2Y1IA 1X9MA 2EG1A 3UNYA 2DNOA 5DZ7A 1IR1A 4OYXA 4F4AA 1SQGA 3SSSA 3MXHP 4CO1A 3QSIA 4RWWA 2RRBA 3LALA 4LUBA 2XY5A 3N6LA 5KOWA 1KTQA 2VFVA 2MZJA 1WC3A 2RDDA 2DXEA 2RIJA 2KM8C 4DSEA 2U1AA 2OO4A 4EBEA 1I5OB 3R9LA 2W7PA 3SV3A 3BKUA 1NK8A 1U0HB 1UWAA 3OT9A 2D9OA 4PZVA 2MQPA 5H9EK 4F2RA 3GFZA 5GADU 1OY8A 4LMZA 3OTBA 3A12A 1JLEA 2D3ZA 3KLEA 2FIUA 4M8LA 2ADCA 3MM9A 3JQJA 2QV6A 7AT1B 2FVPA 5CZXA 1DJ0A 3RBXA 3A3NB 4C97A 4CO3A 1Z4UA 4JBCA 3L4BC 3N6MA 1Q8IA 1VCTA 5KFAA 4C6AA 2OEJA 4BS2A 2GGPB 2NXNA 3W2WB 3DLJA 2JVRA 1FKPB 4UZCA 1O51A 3I32A 3G8SA 1WHXA 3KK2B 5DLGA 2F3JA 4I2PB 5HK4A 4K4SA 2EFOA 3NAHA 1HNZJ 2J6TA 3MCSA 1F60B 2XTJP 4OX6A 1N34F 2BA9A 2FLOA 1E6YA 1CJTB 1FX2A 4X65F 2C2EA 1U7LA 4I1TA 2DGQA 4R8UB 3D6HB 4O3PA 2EBEA 1NKCA 4LFAF 5L1JA 3HP6A 1RWKB 1Y7PA 5D4NA 1RDRA 3MTJA 1SH0A 1MMNA 3VZIA 4IDKB 3TA0A 4NLVA 2CPZA 4E2FB 3E01A 4H54A 2R8JA 3IGVA 1DLOA 5M2PA 1NDKA 2HQ3A 2V69A 4EYIB 3QFWA 4OX9J 4HI1A 5K20B 4C48A 2D3OR 1HLWA 4WU2A 1ZAWA 1H2VZ 4QWAA 1Y9OA 3SCLE 1UJ4A 2R8IA 1N48A 3DOKB 1WHYA 1XEZA 1F3FA 3CVKA 4FXWA 4OI2A 1CS4B 2VQFJ 3MEGA 4F36A 3PO4A 1I1GA 5GAHU 2KFNA 4LR7A 1SL0A 1QUPA 4KHPF 1OWXA 3NNCA 3KUGA 4IFVA 3D1HA 2XM3A 4XDCA 2IHR1 4XTTA 2OMOA 1LW0A 3AH6A 3CCJS 3TOQA 2BM1A 2KH9A 1M5OC 3H5UA 2GIRA 2X51A 3BR9A 3H5XA 2FHOB 2LXIA 2D41A 2V4QA 3DOLB 3PX6A 2ZITA 4MMOA 3OR2B 1GTEA 2YQ3A 1GQEA 4J91A 1HMVB 5LT5A 4YOEA 3CJ8A 1Y00A 5JVGQ 3ULHA 3E3XA 3TAPA 4GVLA 1IM4A 1SV5B 1HNWF 3CDEA 1FJ7A 3CJSA 1KLMB 4FVMA 5HVGA 1X0PA 2AJ0A 3PM9A 4MT1A 4F4KA 1YVFA 3QSYB 2EPIA 5HLFA 2DPJA 1QSSA 3DU5A 3TUPA 1FKAF 3TX8A 2WW8A 4EU0A 1UAWA 3M8RA 5A8RB 1VQYA 1RI7A 1B0TA 1WUUA 3OXGA 4A8FA 4K4TA 4OZ0A 3VZHA 5D0RA 4EO8A 4O44A 4RBUA 2HHSA 3O1LA 3W8GA 1N36J 1SUQA 2DHSA 3GIMA 3DLGA 4RW4B 1CPZA 1NHVA 4E98A 3TEGA 1VS3A 2ILZA 2AYGA 1D1UA 1I6JA 2R7UA 4ES1A 4WFNQ 2AYBA 4WIIA 1BC6A 3HHLB 3QBCA 2V0NA 3UR3C 4GKKF 2CJ9A 2AJ4A 1SJ3P 3CCTA 1VDHA 4WP9A 3M9NB 3IXQA 4DUTA 1KS2A 2XHCA 2F8MA 2KL8A 5F8MA 3BN4A 5KFGA 1OSCA 3R5BA 4L74A 2OEKA 2UU9J 4J5OA 1TVRB 4EYHB 5HJYA 1UP1A 3Q8RB 3OVAA 1MWQA 5HROA 2MKKA 4R5PA 4HKQA 2I5JA 1BQNA 5KFRA 1KDNA 4LBPA 2V2KA 3IO1A 2VD3A 3N79A 3H59A 1AFIA 4OX7A 4MH8A 1NK4A 2CJBA 2KVQE 4M5MA 1WACA 3PJ9A 2ALYB 1LQ9A 4HL9A 1CG2A 1IWGA 2CRLA 3HFVA 4YFUA 1IQZA 4P52A 2VG6A 1FK9B 1YJRA 2GVZB 3VAJA 2DY9A 4OI1A 5LOQA 1L3VA 5HQ8A 2ZH6A 4URSA 2AJQA 3CCWA 1Y5LB 1W25A 4IOAQ 4ID5B 2FVSA 1S49A 3R1HA 4HDGA 1EIYB 5I4MA 2R8KA 2VH7A 1V9OA 2IM2A 2ZBRA 2C3MA 2M8DB 1R0AA 1U1RA 4IQMA 3LPYA 2CJAA 2B56A 4P2MA 3MR6A 2KFZA 2FPHX 3ENQA 3QATA 2MQLA 5CD4A 2EVZA 2MKHA 2IVYA 4DFKA 4PQAA 2YNHB 1TMMA 5E3AA 3CCSS 4B3OA 1U24A 1S4FA 2MHNA 3F56A 3US5A 1K44A 4N7TA 1IJEB 2F40A 2PFDA 4ZCKA 1H7WA 5LMUJ 2KRBA 3MPWA 3MR3A 1EQMA 3W8PA 5M2UA 4NOHA 3W64A 3KJNB 1OY9A 4JI6J 1DY3A 4WKYA 4BC9A 3J81U 4IO1A 1LFPA 4H4MA 3BGUA 4TU8A 4DFJA 1F2GA 1QD1A 3I5AA 3MR2A 4YEAA 2NPIA 4DFPA 2LA6A 2ZC4A 4ZCMA 5LSLA 1LK5A 4FS2A 1KOHA 5H1SV 2MKSA 5IWAF 4NLTA 1P9QC 2XWXA 4FF1A 3SMZA 3C16B 2R2TA 3DRPA 4V1Ak 4A8KA 3DHXA 3G6YA 1NJYA 2V4JA 4GMKA 3BDEA 2KJWA 2N3OA 5DLFA 4LF5J 3VGSA 1GMWA 2HHWA 3LAMA 3DLBA 1D3WA 4KYZA 3U1MA 1AZSA 2QA1A 1GFWB 3Q0AA 2EK1A 1R3NA 1FWKA 3I0SA 5J1EB 3M9MB 1HNXF 5KG5A 4QWBA 1VJWA 2ATLA 2V2ZA 2NSCA 4ZVOB 1R7IA 1YITS 1ZH5A 3CD7A 1LEOA 1BLUA 2Z0GA 2FHJD 2Q79A 2HVDA 3GFHA 1TK0A 1QLNA 3R7SB 2B51A 1FERA 3QWPA 5IC6B 2C2KB 3EZ5A 4XO0A 3FBFA 2LCWA 2JHEA 4HACA 2EBGA 1LWCA 4ED6A 2A3JA 3B54A 3W61A 1UKUA 2QX0A 3N0VA 4M5GA 3V81B 1L3TA 1HNIB 3C66A 3LWLA 4OL8A 1B3TA 2XYGB 2R7QA 4QPXA 3ITHA 3WC0A 1RWMB 3BH6B 3W2VB 4L6V3 2B7CB 2EWHA 3THVA 1HQUB 3NY0A 4Y00A 2RAQA 5J2MA 4QBUA 4JI2F 1F9FA 2HS3A 3GV5B 5KFNA 3GFYA 1OS5A 2V8DA 4CLUA 1S9FA 5F8JA 1NSPA 1HHTP 2VPZB 4I56A 3GYGA 2QZ8A 4WZMA 1DRZA 4KFBA 3MF5A 1NK6A 3PHEA 2JZ5A 2R8GA 1BE4A 4FNHA 2VA2A 3TYTA 4PKDB 3JTPA 4FF2A 4YR3A 3OTEA 1UPPA 2N4DA 2V2QA 1BUXA 5KFFA 3D1QA 3H25A 1NJWA 4JI7F 2XMUA 2HNYA 4KPCA 3Q22A 5BR8J 1YX2A 3HHLC 2B6AA 1VOMA 4KIAA 3V6JA 4ZOSA 2ALZA 2CADA 1JLEB 2Z2YB 2R8HA 4OYPA 3ZC4A 3OHBA 3GIJA 2EFPA 3KLEB 4AD6A 1IBMF 5K9FA 1J27A 1FXRA 1RAJA 4ILLA 2CVIA 4WU3A 3P96A 1R89A 1S5ZA 1U25A 4DV5F 2MJNA 3KNGA 2UXCJ 4TQRA 1X5TA 1NKEA 5LL6d 2LFVA 4USUA 1GT8A 1X4FA 5BYSA 4MKVA 5CZVA 4HVZA 3EE3A 1Q5YA 4J9NA 5L8RC 3KLFA 4U95A 5HI7A 1WJ9A 5JVHQ 3EVMA 2SXLA 4FKXA 2HQCA 4LVNP 1E6YB 4ER8A 3W3SA 4BCAA 2ZBPA 1SQFA 4OZ2A 3SI8A 4DR3F 5GAEU 4O4GB 1SJ1A 1FWLA 1URRA 2D1CA 1OQ6A 3IAS9 4M1KA 4ZITA 2HKEA 2WVEA 4JI0J 1VQKS 2ZFHA 2ZJPQ 3CC7S 4K5SA 5C7PA 5KTQA 4R0JA 1N5VA 1FWPA 3AFGA 2YWKA 3QFHA 1XMOF 1F5CA 3MM8B 1T7PA 3T1HF 1UVJA 2IAJA 3E01B 3BREA 4A46A 1RQ0A 1DLOB 3TVKA 2C28A 1R43A 2JSXA 5ETLA 2QGFB 2FHKA 4RUCA 2DGVA 1TKTB 3RBDA 2HQFA 4ED0A 3CCES 4ED7A 3NGKA 2VIHA 2FZKB 2GHPA 3FNNA 2M2BA 3H2LA 2DR7A 2BJ1A 1J5EJ 3C14A 1JB0C 4KKOA 1NK5A 1H6KX 2B9WA 1N5TA 3MEGB 2Z56B 1VHIA 3UCZP 4NASA 2GIQA 4IO9Q 1HWIA 3DRSA 4WJBA 2OI2A 2DR6A 4Y2MA 2X3GA 4F4WA 3I0RA 4RO0A 4IFVB 5EGYA 3MPYA 2W2OP 5IM0A 1LW0B 2MKYA 4K2JA 2L48A 1M90T 4UUXA 1QAYA 1Y3JA 1RISA 3BO2A 3SYZA 1JKHA 4EZ6A 4UY85 4NXMF 1VISA 3MCOA 1Q7YT 4YB1P 4QIFA 1Q5VA 2NUHA 1WEXA 1X4GA 1BWVA 5KFCA 2CQGA 2ZVIA 3M6VA 3DCAA 3ENVA 3MFHA 5D0GA 3A1YG 2W9BA 2WB1D 1NKBA 3KKFA 4K0KJ 2LQ5A 1RCOB 2KB2A 4DV4J 1XNQF 3TX0A 3ZFVA 4CLZA 4CNZA 1EKSA 3NCQA 4NLPA 2C3PA 3JTOA 4DUZJ 4IOBA 3RRKA 2H54B 1U8SA 1BGXT 1J5OA 4IH5A 5L1IA 4AL6A 4HHHA 5HLFB 1WOSA 5AXLA 4RW9A 2XS2A 4W90B 3BBFA 1S9GB 1N8RT 2N4CA 4O44B 4C2MA 4X62J 1TP7A 4IR1A 1FXLA 1VQ4S 2B4OA 3KHGA 1FRKA 4PQUB 4ECXA 3K17A 3DLGB 4WWSA 2DGSA 3AB4B 4FXVA 4R0EA 1N5YB 1UTAA 3NP5A 1KC8T 3BKFA 1TL7A 5EX3A 5DM6Q 3POTA 4OHYA 3C6TA 1NK7A 2I9SA 3B8HA 2CNOB 5KFUA 1RAIB 3RW6A 2XSJA 2C3YA 1KHWA 2HGMA 1RYRA 3FBCA 3M2VB 1RSCA 3UD5A 1NSAA 5IT9U 1AW0A 3MI7X 3DMJA 3K5LA 3AB2B 3SEOA 2CJYB 4E0DA 1PJ5A 4J90A 2L41A 1WDDA 2HPUA 4QOTA 1ZYQA 1SL1A 4C8MA 1N6QB 4LQ3A 1TL3A 1I94F 4CLSA 1RWUA 5HROB 2HFZA 3HX9A 2QLXA 4R5PB 3R7NB 4Y28C 3ZZZA 2XULA 2A6MA 2CPHA 3EVWA 5KFHA 3HI9A 5F8IA 1T9XA 4DS4A 3X1LB 4PYAA 2DNYA 4C11A 3MUTP 4CTAA 2PT0A 3FMBA 1JLQA 2NQPA 3HSGA 4MTPA 1KNZA 4ZVQB 2G13A 4DR1J 2EC2A 4LF6F 2DNNA 1DZ5A 1YG0A 4DSLA 3ZZTA 5AXNA 3OXLA 3O6QA 4JI3F 1MN7A 4X4UA 1FTCA 1QJHA 3PXGa 1JIHA 3NGDA 2M3DA 2W8KA 3UVJA 2E9TA 2QO3A 3M4XA 3ZZYA 1RT2B 2YWFA 2PMWA 4Y2CA 5C24A 1YBTA 3ENAA 1ZPWX 4I6AA 4B3OB 4KJIA 1SKSA 1NMEB 1HARA 1FX4A 3ZNUA 1RT4A 2VFUA 3IMQJ 3D6FB 3MM5A 3LP2A 1Q79A 1U2RA 1FTRA 2AEJA 2GJ2A 1T3OA 3DOMA 2W1BA 1KVJA 5B0DA 1WI8A 3SQGA 3FBBA 1T9YA 2C2DA 1RT3A 1EAYC 3H7HB 2KVIA 4H4MB 1F5AA 4HI2A 4LT6A 4GKJJ 2CNKB 3MEEA 4ZKAA 2V34A 2XLKA 2KXFA 1FRJA 2F4VF 1VRQC 1TKZA 5D77A 3DRPB 4CI0B 2N7YA 1EETA 2H9ZA 2CG4A 3QGHA 4OLPA 2MHEA 4ZVEA 1S1WB 2V4JB 5DDPC 3M30A 2CQHA 4PUOB 3J7ZT 1NDLA 5KFQA 4Z7CA 2IRUA 2QL9B 5HJXA 4DV6J 2FVCA 1AZSB 4EFAC 5CA5A 3IR7B 4GO7X 2VUGA 4BWMA 3QJPA 2FC9A 2FUG9 3AD8C 3I0SB 1CC8A 2W2NP 2YPYA 4J9PA 4PRFA 1XBWA 1RWOB 3IAM9 4PG4A 3I56S 3AQOA 5A8KB 1CJVB 3JAMY 3PRDA 4AQYJ 2ZKUA 3KMSA 4KGKA 5KFTA 2OGUA 4WYWA 3K57A 3EZUA 2F9DA 2E5LF 1RBAA 2YNGA 5ETOA 2GMLA 2Y1LB 4LF4F 1UVLA 1F3VA 2NS1B 3CIMA 1ROFA 3KK1B 1MU2A 4USIA 4O4RA 1FCAA 3PX4A 1N33J 1FRHA 2V67A 2GAGC 2ZH9A 4HACB 1DQ8A 4OZ1A 2CDRB 3C8YA 1ZM4A 4IKAA 3BGOP 4IH6A 1HBMA 2O1PA 1Q1KA 2UVUA 4DR2J 1RAEB 2DR8A 5GVQA 3ITHB 2AJ2A 2Z4PA 1IKXA 4J9LA 2NR0A 3DHWC 4J9VA 2JJ4D 2A10A 2IMWP 1RWWB 3WC2A 1YBUA 1OIAA 3WBZA 3T5HA 2XGPA 2LEPA 4M95A 2MQQA 3HF5A 2FJBB 2UZAA 1B64A 3KLGB 3PRBA 2UXCF 3MWBA 3MM7A 5K14B 2UUWA 5T7LA 4D3HA 4KFBB 3AOAA 3GU0A 1KQKA 2O01C 1B70B 2MGZB 4L3NA 1SBRA 4DQQA 3CJ4A 3IRXA 2B0GA 2CNNB 2HBRB 4DR7F 1H74A 3PACA 4DV7F 1V3RA 2IRXA 1VQ8S 1NM2A 4OJHA 2KKHA 1SIWB 5KG0A 2B6AB 5GADI 2KZMA 3T6JA 5K8OA 2ZDPA 1LK7A 2YNFB 5DM7Q 1QAJA 3FSIA 2GJIA 2G0IA 1FEHA 3RW7A 6FDRA 2CAJA 3EMTA 3EUNA 3R6GB 2O67A 2Y1JA 3DLLQ 2CWXA 2RHSB 3HT0A 1Z2ZA 2G9OA 1IVZA 4NYOA 4G6VB 1EB0A 4KTQA 1JJCB 1JQGA 3KMQA 1WC1A 3QT8A 3HULA 3FC9A 4Z7YA 3BGRA 4M5LA 1RLDA 2HS4A 2DCUB 3RYLA 4F50A 4FP9A 4LF8J 3MAHA 4OI6A 2G2ZA 4EEYA 2BW2A 2MQOA 2A2DA 2LQBA 3ISND 2UXDF 3KLIA 5E41A 2UVWA 1JLBA 1WHVA 2LXFA 4QQBA 4LF9F 1IBCB 1FJGJ 3FBEA 3NNAA 2W4PA 2DCLA 5JXSA 5D3GB 3VGVA 3KUEA 1JXEA 3F0NA 1VC0A 2PFFB 1U1NA 3ET6A 2IAJB 3RB0A 3BSOA 5IXUA 1HR0J 2M70A 1VFJA 3VCDA 3OPKA 2DYAA 2MKIA 1GXLA 7FD1A 5KFBA 4GVBA 4F8RA 2M9KA 1WEYA 5KFOA 4USVA 2DRBA 5C2CA 3PYDA 4ZPCA 2AZ1A 2R2SA 1RWXB 2DISA 1PIEA 2HHHF 1IBLJ 1KONA 1FD8A 5L9XA 3FZ2A 2YQ1A 2R2RA 3TVZA 3M2RB 2YKMA 4IYQA 4MK9A 1SJQA 4KKOB 4DUYJ 3QRRA 4YN3B 2IDLA 5CAAA 4LIWA 4C8KA 1S97A 1T9WA 3DRSB 5GAHI 3M8QB 5JUMA 5B7WA 3I0RB 1H0HB 1RT7A 1LNQA 4I68A 5EX0A 4HH0A 1XQIA 5D0HA 5KG2A 2O3DA 4DV0F 2AD9A 4K4VA 1XWLA 3AAWB 1FVSA 2G1DA 4HYKA 2HVIA 3WDOA 1VQOS 4WKRA 4RBVA 3K8VA 4FPIA 4Q5VA 1S77D 1JKHB 1X9SA 4NCGA 1R8CA 2X1GA 3TEHB 2FC8A 2AYEA 4F0KA 3H42A 3J81Y 2C2ZB 4RBTA 2HNZA 2H3EB 2W9BB 1X4DA 2B4PA 1ZBTA 4JV2A 3DU6A 4ZS6A 1RUSA 1RKJA 4DPWA 1N32J 1FFSB 1Q7LB 1FRLA 4QR2A 4GC7A 2LU1A 1U1QA 4EBCA 2V68A 5I3PA 1J5OB 2YX1A 4WE1A 4M5JA 2XMMA 2BQUA 4RW9B 9RUBA 3MAQA 1I51B 3QT6A 1IM6A 1PYOB 1P1LA 4LFBJ 3DLHA 2UV8A 3GLJA 1VQLS 3QT5A 2NSBA 3BYPA 1GXTA 4JUZA 2IRYA 4RL1A 2GFFA 3DM2A 3UI3A 4J9KA 4PG8A 2BQRA 4DPYA 4JI1J 3H8YA 3C46A 3B6BA 2DIUA 1CJUB 2DNZA 1TL7B 2B4UA 3POTB 3C15A 1SL2A 3UPFA 3C6TB 3O3LA 1FKOA 4ZPTR 4R25A 3NEKA 2ROEA 3ZZUA 2PC6A 2E5JA 4DU8A 2XSJB 5LM7E 1WC5A 3NS5A 1PILA 2RDJA 4NEYA 4X4NA 5KT6A 2LP4A 5J2NB 2W9CA 5HQMA 4WFZA 2ZKTA 4UZBA 1IBKJ 4ELUA 3W5YA 2DGWA 4J9QA 1CQMA 4O3RA 4ZP9A 1RHMB 3R27A 4DOZA 1QE1A 2Y0BB 1TU0B 4C0OC 1QM9A 4P2XA 4JI4J 2YNIB 3CCQS 1LWFA 1O6XA 4K50A 3RAQA 3OLAA 1C0UA 3KJQB 4DSJA 4L73A 3AA8A 2QT7A 2ROPA 5L46A 2ZHAA 1JLQB 1V3ZA 2R9LA 2CJKA 2XHWA 2HLUA 3RAXA 2RILA 5A8WA 1TK8A 5F41A 1PYSB 4USWA 1XMQF 2HURA 2GC8A 5D8HB 2VG5A 2R7TA 5E7OB 3NBPB 1AUSL 1TTHB 5EWEA 3A8IA 4RNNA 2RU9A 3RBZA 1E6VA 2AP6A 4B3MJ 4MYUA 3JB9k 4C3KA 4QPTA 3HXMA 3ZTRA 2EFQA 4ZPWR 4DX7A 3UVJB 1JLGB 2H4YB 2ZM6F 2FZGB 3G86A 2YQ0A 1YK9A 2QIFA 2IM0A 3AJ2A 3S01A 4ZPVR 2L9DA 2UUBF 3S7RA 5CQGA 1T3NA 3W2WA 2MB0B 1RTDA 1FKPA 1S0MA 3IGNA 4CO4A 2E29A 1UL3A 4DV6F 3T9ZA 1RU2A 2ABYA 1RT4B 2PN6A 3CDAA 1DTQB 4LF2A 3Q89A 1NZAA 2DNGA 2X7IA 2CQ2A 1D8ZA 4TXSA 3MM5B 1WC4A 2WBRA 3ETOA 4FBUA 2G2YA 2W9AA 3LP2B 3DOMB 3OJSA 1QAXA 3EGWB 3SQGB 1H72C 1FJEB 1S9EB 1RT3B 1RZMA 2YKQA 2ZOMA 1I3OB 4QW9A 4NLUA 2ZOFA 4FS1A 3MEEB 4S0MA 3CMQA 2KXNB 1NHUA 2Y8WA 1NK0A 3J81j 2L9WA 5ADZA 1NJIT 4Y3CA 2E9ZA 1TKZB 2G0CA 4I6YA 2DRDA 4H4OB 3BS9A 1EETB 3CJ3A 3QWUA 1SPBP 5K8NA 3M30B 3FSYA 2YTCA 3FMWA 3UN2A 4IDKA 4X66J 2CQDA 3NGSA 5CABA 3M8SA 3R3TA 3U1LA 2ZHBA 4ZN1A 5HP1A 2J0XA 1VGYA 2FLNA 1IWAA 2WSCC 3QAEA 1LWEB 1N34J 2VQEF 2QJ3A 4W98A 4ZIVA 4X65J 4DR6F 2JLFA 2P2CB 5E3CA 2FD2A 2BV3A 2YNGB 2RD5C 1P9YA 1GAOA 4ECZA 2KG0A 3HFKA 3NGTA 3VALA 4ED3A 1T02A 2UUAF 1S48A 1CS4A 3E51A 4USJC 3D54A 3FEZA 4ELTA 1JNZB 1RKIA 3DFEA 2V6AA 4DL2A 5J2PA 1HBMB 3IWXA 3PDNA 2ZZTA 3V5RA 3DNCA 4HLBA 2PIIA 2JX2A 2HNDB 4DR4F 4Q0BA 2AEMA 1VIXA 3MPUB 2VPWB 1S6QA 1OPIA 3D0IE 4OYBA 4ITSA 3BSCA 2RJZA 4KH1B 3RZAA 4OYWA 2E1RA 4J9OA 3MM7B 1N88A 5T7LB 4YY3F 4ED8A 4K7QA 1HMVA 2VBXA 2OPSA 2EFVA 4EBDA 3I9V9 1REGX 2HZAA 3GE9A 2HHTA 4HDHA 3IRXB 2XY7A 1VBZA 2NLWA 2XBPA 3BBCA 2OKQA 3D4JA 4YR2A 4RNHA 4NX9A 2BKPA 3OTOJ 1HD1A 2V9KA 2HFNA 4KHPJ 1PG5B 2E1CA 5AJ3F 1NPRA 2OPQB 3FQLA 2B8QA 4P6QA 3D67A 3C6UA 4GC6A 1T9UA 2FB0A 3GIKA 1GXUA 4NA2A 1Y5IB 1WOOA 1XMBA 4DL6A 4J9SA 3PVXA 1VRUA 1UEUA 2QLFB 5B0CA 1HIYA 2XI2A 1RYSA 3TZYA 4CO5A 5AE1A 3OFGA 3H5YA 1LXJA 3FVYA 3PCOB 4QWCA 3QO9A 4PR6A 2KG1A 2J0SD 1P27B 1QUVA 1U49A 3HSZA 3OR1A 2G4BA 2RT3A 1QVFR 2WCXA 3KUHA 4DLGA 1TUWA 2Q43A 2Y3YA 1U1OA 3PTWA 3BGRB 2YY3A 3DRXA 1Q8KA 1HNWJ 4FF3A 2UV8G 1D09B 2CPIA 1HBNA 4Q2LA 2ZH4A 3OL9A 2KYZA 3GG0A 2BUNA 3IG1B 1Y11A 2KRRA 5SUHA 5IT9Y 1TELA 1X4AA 1A9NB 3I31A 2DXFA 3TQEA 2OSQA 4FYWB 4C0HA 3ADAC 5GAEI 1RB0A 3JSMA 5BXIA 2X3DA 4B9MA 1JLBB 2DNMA 3GTYX 5KFIA 2VOPA 2ASYA 3WIVA 1AT1B 4P2FA 3K7RA 3KG1A 1NXIA 3GWCA 4HHJA 2XCPA 3CSKA 3DRYA 3IC1A 5EUHA 4K8RA 3ET6B 1VHFA 1AUDA 2DKOB 2ZBQA 4BDPA 1AXQA 4NRUA 3MR7A 2ADBA 4U7UD 5D4LA 4I64A 1ZZNA 3CCLS 1FK9A 4OIXA 4DDFA 2GVZA 3N28A 3VTIA 4E8UA 1YHQS 4CLFA 1X31C 4QYZJ 4HT7A 4GVBB 4TYAA 4ID5A 1U48A 1CVJA 2O66A 3CMES 3TA1A 2MQ8A 2P9EA 4N76A 4ZVHA 2HHPA 3P5BP 3ZTQA 5HATA 1WI6A 1FRIA 5KG6A 3HFZB 3QJJA 1P1TA 1PJ6A 1RAGB 4ZLNA 2YKMB 2KXHA 4U7UK 2J76E 4FDFA 3DLKB 5CYJA 3IRWP 4DL4A 1KSPA 4O3QA 1UA0A 1C1CA 2XYHB 3MMBA 3WX4A 3GFXA 4N56A 4QU6A 1UWBA 3GV7B 3NGUA 1RT7B 4C8ZA 2FJVA 1KD1T 4KHMA 5FLXU 1VQ9S 4BLGA 1HL6A 1N4LA 5EDWA 3TQ1A 2E5IA 1RT5B 4YDXA 4NCGB 5KFDA 4I7FB 1RWNB 2YVSA 2AF6A 3CB4A 2KFYA 3HM9A 2BJDA 3ZZRA 5DZ6A 1TQLA 1MLAA 1ZM9A 1K0VA 3SCIE 4LBHA 2HNZB 1L5UA 4KY3A 4J9RA 2GVDA 1RAOA 2MKJA 3CT9A 4NI2B 3HD1A 1VBXA 2ZVSA 3M8PA 2DGOA 1EX8A 2DT9A 1TL5A 5RUBA 3LP1A 4WE1B 3R97A 3VAGA 3Q8SB 4DS5A 4O3SA 4CH1A 5I42A 3PYFA 1Q95G 2R7RA 2VFSA 2F4FA 1S59A 2DNLA 4HTIA 4V19J 3CGIA 3N5FA 1NU4A 4DPTA 2C3OA 2RDIA 1Z1ZA 3UCGA 1IR0A 3M6XA 4WPAA 3DM2B 3OL6A 2OHDA 3BR8A 4Q7AA 3NWGA 5DG7A 3NOCA 3LA0A 4TYBA 4A48A 5F0UA 2Z2LA 4RKUC 5IWAJ 4ZHRB 2R7VA 2E1PA 1FE4A 1JJ4A 3BO3A 2FHJA 1A6LA 4A47A 1PGZA 2NUUG 1AYEA 1RTJB 4DPUA 5KT5A 5A76A 1NPPA 1Q8LA 3G6ES 1U6BA 5KG3A 4XIUA 2W9CB 1SC6A 3OFFA 4Y65A 3KNAA 2MZSA 1ZAXA 2EKNA 3CO9A 4C0BA 3TRGA 2KT2A 4P10A 2MKCA 4NEZA 1KFDA 3FZBA 2ZH3A 1PYTA 1VQNS 1HNXJ 3U7JA 1UVKA 1T11A 2ZH8A 1QE1B 1FRMA 5KFZA 2R42A 4EGLA 4RNMA 1V3SA 1RHKB 2HG4A 4M5HA 1LWFB 1R6YA 2JDJA 2AGQA 3E8OA 4QYZK 1C0UB 1S0OA 4CZCA 2ZD1A 3KDNA 1D9DA 3EM1A 4F4XA 4UW2A 3R5GA 4IG0B 4DL7A 3QQCD 4A8SA 2MSSA 1WWHA 2F8EX 2F8HA 5K8MA 4NCBA 2ZH1A 8ATCB 2DGUA 5A8WB 3VAIA 3QGIA 2VG5B 2E44A 2XO7A 2XG8A 3CJTA 2RVJA 1N54B 4LRFA 3RR7A 1E6VB 3I9ZA 4OYMA 1ZTWA 1U1PA 3I4PA 3PIPQ 1D9FA 3CNQP 4DV3F 5DG9A 3NCRA 3S8SA 4JI2J 4DSFA 2QTWA 1WG4A 3OW2R 3M9OB 3QMQA 5T41A 4ICLA 1ACMB 4X66F 2BR0A 2E7WA 1RTDB 3RGIA 2XNQA 2HRTA 1N0VC 3HHEA 3BGFA 3LGHA 2YWGA 4KBIA 5D78A 2B5JA 4LR8A 3HD2A 4DSKA 3LTOA 3TI0A 2XZDB 3T41A 2DD8S 1WOPA 1XERA 2NYIA 2IA0A 1IQTA 1HWKA 4FZVA 4JV0A 4YHHF 1WG1A 3LP0A 4ECWA 2J7KA 1C4CA 1HI0P 4TKTA 5EN1A 3PY8A 5KG1A 1TL4A 4JI7J 3UD4P 4QW8A 1EJ7L 5G4DA 1MROA 2DHAA 3CXCR 3DDIA 5KG7A 2DR9A 4O4GA 2DTJA 2WVDA 2MQNA 1GNKA 1DURA 1R8BA 4PWDA 3MAAA 1AB8A 1IBMJ 2DH8A 3NKYA 1UVIA 3CW2C 4DV5J 4EK2A 1HHQA 3HK2A 1NZ8A 1YGYA 1WTBA 2JLGA 3MM8A 4JI8F 4ECQA 1ZETA 1VQ7S 4GO5X 3SQOP 2PE8A 4ID8A 3GIIA 1S6OA 3JAMU 3SXLA 3NL0A 1SVDA 3CD6S 5HP1B 2HEKA 3ZO7A 1C2PA 2XMKA 2W7OA 3G6XA 3HVRA 2AGPA 3K89A 3OTDA 4KSEB 1TKTA 4P2SA 1VMBA 4MKAA 3JYTA 1H38A 1QVGR 2DNKA 3PYEA 1R8AA 2GQ2A 1PSDA 2MLYA 2CZ4A 4CM2A 1GMUA 4DR3J 1UW9A 1S7HA 3TUJC 4ANCA 2WAQD 1DAXA 4QIWD 1W2BR 4JI5J 3Q8PB 4P7VA 4BHQA 5I3UA 3AOCA 2F65A 4PWUA 1YJWS 1XMOJ 3OTOF 2UP1A 5KT4A 2V94A 3T1HJ 5J2PB 5DDOC 3NRBA 5ETSA
chains in the Genus database with same CATH topology
3CJ0A 1TKZA 4ZHRA 5D77A 3K59A 3BDPA 2ZZMA 3Q24A 4A8XA 3FFIB 4B9SA 1O8BA 5BYRA 1RA7A 2YKNA 3DRPB 4CI0B 2N7YA 1EETA 2H9ZA 2BABA 1VRTB 2CG4A 3QGHA 1RTJA 4OLPA 2MHEA 1FDDA 2VC0A 4ZVEA 4WCEQ 3T5LA 3Q8QB 4MK7A 1S1WB 2V4JB 4NPOA 3N4WA 1MMLA 3M30A 5DDPC 4UY8T 2HW3A 1O5JA 4Q0BB 3S6EA 2CQHA 4PXDA 4PUOB 4OHZA 3LH2S 2M8HA 3J7ZT 3LWMA 4L72B 5KFQA 3OVSA 1S6QB 1JX4A 2P5VA 2IRUA 4WK1A 4QIEA 2PI4A 2QSFA 4ECSA 3J7YU 4ZDNA 1N5QA 2HGNA 3K58A 3FSXA 2NREA 1YJNS 2OMLA 3F73A 2HZCA 1S6UA 2FVCA 3H98A 1PC4A 2CDQA 4EFAC 5CA5A 2QLWA 2W25A 3IR7B 4GO7X 2VUGA 2HWHA 5F3TA 3CWJA 3ZZ0A 3K2YA 3GQCA 2DB1A 4BWMA 3QJPA 3MEDA 3UNGC 2ZOGA 2FC9A 4IRCA 2FUG9 1QSLA 4CO0A 3IWNC 1WF0A 2OPSB 2P6SA 3I0SB 2NZ4A 4NZ6A 4NLGA 1GTHA 4OX9F 2AX1A 1CC8A 3BQ1A 3THPA 4J9PA 4PRFA 4DL0C 1HA1A 1XBWA 3IAM9 4PG4A 3I56S 3AQOA 2IFXA 5A8KB 3PKMA 2GW8A 1GX5A 2YNHA 2COLA 2F7VA 3T1YF 1FNOA 1N32F 3JAMY 3QPIA 1URNA 2VC1A 4PG5A 4Q45A 3PRDA 3FQKA 1DFDA 4A4JA 2KT3A 5BYQA 2ZKUA 5KOXA 3KMSA 2ZH5A 4KGKA 4OHVA 3CJ5A 3I96A 3TARA 5KFTA 3DLEA 2RSQA 4X4VA 4WYWA 3K57A 3EZUA 3Q23A 1W2IA 2F9DA 4B02A 5L1LA 4KB7A 2E5LF 4FYDA 1U6ZA 3PW7A 2M88A 5KFMA 1HBUB 2YNGA 3F41A 2LA4A 3LAKA 4NLOA 2GMLA 1UETA 3NS6A 4LF4F 2BE2B 3DRRA 1UVLA 5U47A 3PW4A 1S99A 4OZLA 3C6UB 4IG0A 2GV1A 2VQFF 5E3QA 5B0FA 2ZJRQ 2NS1B 1S9GA 3CIMA 2QA4G 1L3SA 4LF7F 3HJFA 4IUFA 4LFBF 1ROFA 4K5RA 3KK1B 2M0GB 1TV6B 4NWBA 1MU2A 4WFAQ 3B78A 1PO6A 2BYCA 4N8OA 3VF0B 4USIA 4O4RA 1FCAA 4C9DA 3PX4A 3MOJB 2B43A 4LSNA 1FRHA 1S1XB 1MNEA 4WK3A 2CQ1A 2ZH9A 2VB6A 1VRUB 4B17A 1DQ8A 4MIAA 4OZ1A 3QLHA 3M1VA 3CD0A 3C8YA 4F3MA 4DPOA 4PQUA 1ZM4A 2L9NA 4FN5A 4IKAA 5AXMA 4IH6A 2IA6A 1CEZA 1HBMA 4JI1F 2O1PA 1Q1KA 1YJUA 4C8YA 2RF2A 2UVUA 1YWXA 2DGTA 1G7CB 2X1FA 3QO9B 1N5YA 1X4HA 2BZ2A 2DR8A 4ECTA 5GVQA 1GH8A 3ITHB 2Z4PA 3PNIA 1IKXA 2PA3A 3OR1B 1UA1A 2E5GA 4J9LA 3DHWC 2FVRA 2NR0A 2W4DA 4X4PA 2I38A 2JJ4D 2A10A 2IMWP 3NCPA 3WC2A 4DEZA 1OIAA 1M5KC 1VQPS 3WBZA 2B9YA 2KYXA 2WONB 2VKRA 3T5HA 2OJ3A 4TY9A 4ED2A 3PEJA 1F5BA 2XGPA 2LEPA 2WK4A 1YRXA 4M95A 2MQQA 3HF5A 3MECA 5DG8A 1XR6A 2H5EA 1ZOTA 3I82A 3M2VA 1ZTTA 2FJBB 2W7AA 4G1IA 1CSJA 1JXLA 2UZAA 4IG3A 4ATNA 5F3ZA 2QFJA 3KLGB 2PDAA 1TKDA 4PG6A 1KEKA 1XNRF 4N77A 1B64A 3CF5Q 3ENWA 3PRBA 5J1NA 5CD4H 1HBNB 3UDCA 1IBKF 2UXCF 3MWBA 3MM7A 5K14B 3MFIA 4AL5A 5IT0A 2UUWA 5T7LA 4ETXA 1X5OA 4D3HA 1FO1A 4AUKA 2E5HA 2RKIA 2AU0A 4KFBB 5IQQA 2EG2A 5J1EA 1VBYA 4ZPAA 1LV5A 2BRLA 4B3TF 1RGVA 2VA3A 4DLEA 3K0JA 4RW8A 3FDSA 3LGMA 3ISNC 1NJXA 1KQKA 2MY8A 2O01C 1NNDA 3N01A 2MGZB 1YJ9S 1N6QA 1HI8A 4L3NA 3T5JA 1SBRA 2MZTA 3UE2A 5HN0A 3TUZC 4JV1A 1ELOA 4DQQA 1LOUA 1Q81T 3MUMP 2OTJS 1APSA 5F8LA 3CJ4A 3IRXA 2N3LA 2B0GA 3ISZA 4CH7A 3JSMB 4JI4F 1IJFB 4NZ0A 5EHHA 2WSFC 3CDBA 4WFYA 2P9GA 4CT8A 4DR7F 2AQ4A 1HBOB 2DVIA 3PACA 4DV7F 2D74B 2K7KA 3DDNA 4DBQA 2GX8A 3BQ0A 5KFSA 1V3RA 2IRXA 2AW0A 1VQ8S 2HLTA 4OJHA 2KKHA 1SIWB 5KG0A 2RQKA 2KI2A 2CIMA 4ECVA 1G6BA 2B6AB 4LJMA 5GADI 4M63A 2KZMA 1JMTA 3T6JA 4K4YA 4MFBA 3G6VA 5K8OA 5JJBA 2ZNZA 1TFYA 2ZDPA 1LK7A 2YNFB 1FKOB 5CYQB 2CZVC 5DM7Q 4X4QA 5DO2A 4M5DB 4Y2AA 2RE1A 1B0VA 3KK3A 5DETA 1QAJA 3QZ8A 3FSIA 2GJIA 3PJXA 4IRKA 1R8HA 1R31A 3OJUA 1NJZA 1N36F 1FEHA 1EP4B 3RW7A 3OTCA 6FDRA 3IR5B 3EUNA 3L09A 2J9EA 1ZPVA 3MMAB 3RTVA 2HVZA 2O67A 5DQHA 2Y1JA 3V81A 4B3MF 1CQNA 5IS2A 3DLLQ 3BO4A 3EYZA 3QJLA 3QIPA 3FGVA 1JK9B 1HNIA 1XTZA 1C1BA 2MYFA 1Z2ZA 3D28A 4O0IA 1H3DA 2G9OA 4DQIA 3OBIA 4K4ZA 4RW7B 4NYOA 2J9DA 4G6VB 1FNXH 3W2VA 1TFWA 4KTQA 3IBWA 1RT1A 1Q78A 3RRGA 4KO0A 4CNYA 1K1SA 3O2IA 1T05B 2CQPA 2J9CA 4WFBQ 1S10A 2ZC3A 3KMQA 1UFLA 2VBYA 1HQUA 2Y1IA 1X9MA 3BGRA 3CDUA 4B9NA 2EG1A 1SI9A 2HS4A 1M5PC 2DCUB 3P49B 3RYLA 4BC7A 4F50A 1FRXA 4TU7A 2DNOA 4HEA9 5HL7Q 1RT2A 2LMIA 4FP9A 1HI1A 4NA3A 1BD6A 1N52B 3BZQA 4OHXA 2AWZA 3OUYB 3MAHA 4OI6A 3SSSA 2ZH2A 3MXHP 4KAIA 4CO1A 4DG1A 2CPXA 1C1CB 3M6UA 4EEYA 1HQEA 2UU9F 4RWWA 3L7OA 3MMBB 3TW0A 2RRBA 3LALA 4B08A 2BW2A 4LUBA 2XY5A 2C22A 1UWBB 3N6LA 5KOWA 1KTQA 2A2DA 2VFVA 3U1NA 2MQOA 1U45A 2MZJA 1H2UX 3BEGB 4X84A 2IYIA 4M94A 3PJWA 2LQBA 3KJVA 1MSWD 2DNQA 3I5BA 2RIJA 2KM8C 2GHVC 4DSEA 1U1MA 3ISND 2LEBA 2U1AA 2OO4A 2RH3A 4EBEA 2UXDF 3KLIA 2HHVA 5E41A 2W7PA 3SV3A 4Y0FA 3KYLA 1FJCA 4QYRA 5KFPA 4OMFG 1NK8A 2UVWA 1P6TA 5KFEA 3K8WA 1JLBA 1WHVA 2LXFA 2Q66A 4QQBA 4OI0A 2OTLS 4LF9F 2IM1A 3HZGA 1SUQB 3NNAA 2LU2A 4U67Q 4JV5F 2D9OA 2MQPA 4AE5A 2W4PA 2DCLA 4FPRA 4F2RA 3KHRA 1N5SA 3GFZA 5JXSA 1WF2A 4UUWA 5D3GB 1Q53A 5GADU 2GA7A 4LMZA 4DMZA 3OTBA 2XB2D 1JXEA 1VC0A 2PFFB 1U1NA 1JLEA 4QWDA 3PX0A 2IAJB 2OFHX 2WBMA 1UVMA 3RB0A 2D3ZA 3IA0A 2CYYA 2FIUA 4M8LA 3KLEA 3O44A 5J1PA 2XLJA 3BSOA 2ADCA 4TY8A 3MM9A 4DFMA 5IXUA 2QV6A 1K1QA 2M70A 2FVPA 5CZXA 4FVCA 1VFJA 3QGPA 4JOUA 1DJ0A 2CPFA 1U26A 3DI6A 3VCDA 5HO4A 1ZAVA 3OPKA 4C97A 4CO3A 5CCMA 2MKIA 1Z4UA 4JBCA 1GXLA 2FDNA 3BN7A 7FD1A 1S1WA 3N6MA 1Q8IA 5KFBA 5KFAA 1DHMA 1KLNA 1HW8A 4F8RA 2M9KA 1WEYA 5KFOA 4PUOA 2DRBA 4BS2A 2GGPB 2VBZA 3W2WB 3DLJA 4ZPCA 2R2SA 1KQGB 1WEZA 2JVRA 2UXBF 3D0HE 3GYXB 1FKPB 1BQMA 3K5OA 3M8PB 2J8AA 3IS9A 4PXBA 2VG7A 5C25A 1O51A 5IFMA 3I32A 2BJEA 3IR6B 3UQSA 4NXNF 3G8SA 2E66A 2DISA 2OPPA 2HHHF 2KU7A 1FESA 1WHXA 3KK2B 1KONA 5DLGA 1FD8A 2F3JA 4TQSA 4I2PB 5L9XA 4K4SA 3LP1B 3FZ2A 5CHCB 2R2RA 1LFWA 2EFOA 2ZBIA 3TVZA 2J0QD 4KV8B 3NAHA 1T8EA 3M2RB 1IN0A 2BANB 3IN5A 2YKMA 2I5JB 4IYQA 3KHHA 3G8TA 1BQNB 1DQAA 4MK9A 2FLLA 2J6TA 4D3GA 1SJQA 4KKOB 3MCSA 5I42B 1DTTA 1F60B 2FJDB 2CPJA 4OX6A 4CCHA 5A8KA 1Q82T 2M7SA 3PZPA 1N34F 2BA9A 2FLOA 1E6YA 4F3OA 5E2QA 3GB0A 2CKWA 3LW5C 1KVIA 3LO3A 4LIWA 2W24A 3H2VE 3LOUA 4X65F 3CMAS 4C8KA 5L9NA 1S97A 3TUIC 5DQIA 2CPEA 3DRSB 1X4CA 3R5CA 5GAHI 2C2EA 4C7QA 3M8QB 1U7LA 4I1TA 4RNOA 5JUMA 5B7WA 2JWNA 2DGQA 2R7XA 4R8UB 1B0PA 3I0RB 2RU3A 1H0HB 1OO0B 1RT7A 3UW1A 1S1VA 5LMUF 3T3FA 4I68A 5EX0A 4HH0A 4O3PA 1CLFA 2YKAA 1UW4A 5FJ4A 5KFJA 2EBEA 4ZPDA 5KG2A 2O3DA 1TKXB 4DV0F 2BE2A 3R5DA 5F9NA 2AD9A 1XWLA 4K4VA 3AAWB 2VG6B 1FVSA 1K0TA 4JI6F 2ASDA 4EUVA 1F0XA 2G1DA 4HYKA 1NKCA 2HVIA 3WDOA 3H40A 5L1JA 1VQOS 4LFAF 3HP6A 1HPZA 3KK1A 4WKRA 4RBVA 3K8VA 1S0VA 4DWIA 3JSYA 4Q5VA 3PFEA 4NA1A 1S77D 1JKHB 4AYBD 3L95X 1YQHA 2RS2A 3SZ2A 1X9SA 4NCGA 4QJVA 1Y7PA 5D4NA 1RDRA 3MTJA 5L38A 2JEJA 1SH0A 2CQ3A 1MMNA 2J7UA 3SFUA 4NLSA 3VZIA 3GILA 1R8CA 4IDKB 2X1GA 3TA0A 4NLVA 1UFWA 3PKYA 2CPZA 2FC8A 3E01A 2MXYA 3GMGA 2AYEA 4ED1A 5G0RA 2XCAA 4H54A 3OLBA 3MM6A 2R8JA 1SQEA 3I6PA 3IGVA 1DLOA 3OV7A 1R0AB 5M2PA 2ZZNA 3J81Y 4PG7A 4DV1F 4RBTA 2HNZA 4QWEA 4QIGA 2HQ3A 3IWLA 2W9BB 1X4DA 2B4PA 1ZBTA 4EYIB 3SV4A 3CCRS 4JV2A 3G71S 3DU6A 3PV8A 3N5BA 1JLAA 4ZS6A 3DXSX 4OJGA 4LF5F 2DH9A 4HI1A 5KFYA 4PCQA 3V4IA 1RKJA 4ERDA 5CH7B 2DBBA 3VQSA 3Q2SC 1Q7LB 3EX7B 2LVWA 3V6DB 4B3RF 3GZ7A 2D3OR 1FRLA 4QR2A 4RW6B 1IXKA 3KLGA 4GC7A 2KZZA 2HMIA 1Y5NB 2LU1A 1U1QA 4EBCA 2VPYB 4WU2A 5I3PA 5K14A 2AX0A 1ZAWA 2PO4A 2D7SA 2K7JA 1J5OB 2YX1A 4DQSA 1H2VZ 2VFRA 4WE1A 4N5SA 2XMMA 5MAOA 2ZD1B 4QWAA 1WTFA 4CIOA 4PPZA 1Y9OA 2BQUA 4RW9B 3SCLE 3MAQA 1UJ4A 4OFZA 4KQZA 2R8IA 4XK8C 3DOKB 1D9AA 1WHYA 1XEZA 3CVKA 3DYAB 4FXWA 1P8GA 4OI2A 1N48A 5F8NA 3P5TL 3MEGA 4TNOA 2MGZA 2PSZA 3PO4A 1P1LA 4MKYA 2BOPA 1VIOA 3NNHA 2VL1A 3UDLA 1I1GA 4OQJA 5GAHU 5ITHA 3DLHA 2UV8A 1SKRA 1VQLS 2KFNA 2NSBA 1GXTA 2KN4A 4JUZA 2I2YA 1SL0A 1QUPA 4KHPF 1FEEA 1OWXA 2IRYA 2GFFA 1UEVA 3DM2A 3NNCA 3AY0A 3UI3A 4J9KA 5GMKa 2KTQA 4PG8A 3TANA 4IFVA 2BQRA 3D1HA 3H8YA 3C46A 4XDCA 2DIUA 2IHR1 3MMJA 1S1TB 1LW0A 2LYVA 2OMOA 3AH6A 3CCJS 4G1PA 2DNZA 4RX6A 5FDLB 2B4UA 3TOQA 3PW5A 2FJWA 5HMYA 2BM1A 2EKYA 3POTB 2KDOA 1SL2A 2KH9A 1M5OC 3UPFA 3H5UA 3C6TB 3O3LA 2YNFA 4O3OA 1FKOA 4ZPTR 4R25A 5HMXA 3HO1A 1BWEA 2ROEA 3ZZUA 2PC6A 2GIRA 2E5JA 2XSJB 2X51A 3BR9A 2P9CA 3NS5A 1PILA 2RDJA 1N56A 5FIIA 3H5XA 3BSNA 2FHOB 4X4NA 2K3KA 5KT6A 1H98A 2LXIA 2D41A 2PI5A 3M05A 4TU9A 5J2QA 2V4QA 1S1UA 5J2NB 2W9CA 3DOLB 3O8WA 4WFZA 1U09A 2B9XA 2HRUA 2MSTA 3PX6A 2FGCA 2ZKTA 5DDQC 3VAKA 2ZITA 4MMOA 4AXIA 3OR2B 1RTHB 1GTEA 2YQ3A 1K73T 4NLXA 4DX8H 4