3H7HB

Crystal structure of the human transcription elongation factor dsif, hspt4/hspt5 (176-273)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
MDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription elongation factor SPT4
publication title Crystal structure of the human transcription elongation factor DSIF hSpt4 subunit in complex with the hSpt5 dimerization interface
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 3h7hB00
2EXUA 1NPRA 2XHCA 3LPEA 2LQ8A 4ZN1A 2OUGA 3EWGA 1M1HA 1M1GA 2K06A 3QQCD 4ZN3A 1NZ8A 1NPPA 3P8BB 3H7HB
chains in the Genus database with same CATH superfamily
3KJFB 1XNRF 4KB7A 4ED8A 4WU2A 5C25A 1NSQA 1VBKA 4LIRA 2DEJA 4NE9C 3K5PA 5CQGA 4OJGA 2Z2MA 2DGUA 2LDYA 4FVCA 1EARA 2GO9A 2P9EA 1S79A 2XMMA 2ASDA 2H48B 4IDKB 3HHLD 4KO0B 2VG6A 3AODA 3TO8A 4QPTA 2HNDA 4RR5A 5B7WA 2YNIA 3ZZPA 1XMQF 3M32B 3CJKB 2CZ9A 5LMNJ 1V5VA 4QYRA 3TZYA 5GAGU 4ECZA 2NCKL 4ED0A 4X4SA 1U0SA 5MLCV 2PSZA 1S1XB 3WC2A 4IH6A 5AT1B 2BW7A 1V5IB 1IBMF 3GMGA 3G4SS 3C6TA 2LDIA 1LXJA 5KFFA 4DUZF 1XNQF 3R3TA 1YJUA 4FXWA 5A8KA 1B64A 3I31A 4DXLA 1RT2A 4CLFA 4RPFA 4S0MA 1U1OA 3LPYA 3ZTQA 2IMOA 1NK6A 2QC3A 2WOMA 4KYZA 1X4BA 4JI8J 2ZM6J 2DISA 3W1YC 2EFPA 3KK3B 4TNOA 1ELOA 1L3UA 3OTOJ 3MMJA 4YQWA 3VAFA 4OZ1A 5JUMA 2IBKA 4O3PA 1UJ6A 2J9DE 3AA9A 2XY7A 3L7UA 3L7OA 1LK5A 1VK3A 4O3SA 5E3AA 5B0AA 2GNKA 4ZLPA 4P73A 4QIVA 1KLNA 1NRKA 1NK5A 3BGLA 4M5DB 3A13A 1AROP 2BANA 4LRDA 5L39A 3MR3A 3TUZC 1IKYA 3I82A 4YR2A 4M5KA 3MM7A 3DLEB 2ZZTA 1DTQB 4WIQA 3M2VA 2CADA 4YY3J 3MR6A 2X1BA 1HARA 3CJSA 3QFHA 2B8PA 1Q8BA 2HNZB 1PAUB 1BWEA 1AUSL 3GFXA 3LO3A 1A0OB 4C8KA 2FLOA 4LFCJ 1S1VA 4QPXA 1KEKA 2VIHA 4ZJOA 4JI7F 2KFNA 3K57A 4OZ3A 3T1YJ 2QTWA 1VC0A 4TYAA 3DGPA 5K9FA 1LWFA 2XMJA 1CJTA 4OIXA 1RUSA 3PR5B 4LFAF 3BR8A 2V9WA 3VGTA 1FNOA 2VICA 1TVRB 3GB0A 1ZAVA 2GVZA 1J5EJ 1SXLA 2YWGA 3ENVA 3GIMA 5EWGA 3J7YU 1REVA 1AFJA 1U2RA 1Y3JA 3DRSB 2UVVA 3FFIA 4HHJA 3N4WA 1ZM2A 1RI7A 1S1UA 3RW6A 3PKYA 1TKXB 2VUGA 1U26A 2JOQA 1O6XA 1K0VA 4BHQA 4A46A 3DMJA 2M70A 4UW2A 1K8AT 2B4VA 1UFWA 3OR2A 5CXTA 4OHWA 1VQSA 3I5AA 5GMEA 3HHLA 4JI2F 2CNNB 4X4RA 4USJC 2GV1A 2XGPA 5CHCB 1MMLA 1FJCA 1R8CA 3UR0A 2HHTA 2GVDB 3HX9A 2NZCA 4K4WA 2VH7A 3FVYA 1UA0A 1BC6A 4JI3F 2RQ4A 4GRSA 1SJRA 2UUWA 3DOMB 1CULA 2CQ1A 1TFWA 3QZ7A 3GSIA 4I2PB 1S6PA 3K7RA 3C14A 3UCZP 1N5VA 4NLOA 5ETMA 1N36F 4FXDA 3KLEA 2BZ2A 1Q0NA 3WZ0A 4K4VA 1SQEA 2RNEA 3HHEA 2I0XA 2MLXA 3K58A 3V4IB 1OWXA 4WFXA 1RTDA 4GC7A 1W2IA 3H42A 1NPPA 2B6AB 4DR5J 3MI7X 3TVZA 2MKCA 2GIQA 2FYXA 2R8GA 1X4CA 2V34A 2Q6BA 2BACA 3P4UB 1SKRA 1ZAWA 1G7CB 2CQGA 3LAKA 1CQNA 1IBLJ 3PXGa 2CDQA 1HQUB 2QRRA 4A8YA 2HYIB 3IGVA 3W9HA 4H4KC 4A8SA 4NLYA 3OUYA 1RAOA 5ETPA 2VC1A 4USIA 5LMNF 2ACYA 4IG0A 3I5BA 2HHXA 1Q1KA 4EZ9A 1NMEB 2ZH4A 3QYYA 1S1WB 2BUNA 2VC0A 4O0NA 4NA1A 3UDLA 4CYUB 2RUSA 5EWFA 2CJXB 1PKUA 4J9OA 2P9GA 3CCTA 2AYEA 2HFUA 3L4BC 2IJFA 2GHWA 5K8OA 3ICLA 4ILMA 1URNA 2A6MA 1YRUA 4HTIA 3T1AA 1MROB 2IAJB 3MUVP 2PMHA 1H38A 4O0IA 3NOCA 2PDAA 4DU7A 2VPXB 4JI8F 2ZM6F 2ZVSA 1ZM3A 2R7TA 4I2QA 2HRUA 3OTOF 1MN7A 4LSLB 2RF2B 1YJ7A 2K1RB 2RSQA 2BXJA 3G6ES 1F5CA 5FLXY 3TAQA 3BKUA 4OQJA 2CAJA 4K8RA 2W9CA 2F9DA 2AQ4A 1PBAA 5I3UB 4OJ3A 3TWZA 5GVQA 1OYDA 5JMNA 3HFVA 4FVMA 1PG5B 1V9OA 3I5CA 4OX6A 4NASA 3PHTA 2V4QA 2R7UA 5HVHA 2Z2LA 3D6FB 2WBMA 1X5SA 1MW7A 3IWNC 4OI1A 1RTIA 3AT1B 5B08A 3DLLQ 2GA7A 2BDPA 3OT9A 4DPWA 4FF4A 2DGWA 4PRFA 2H3EB 5EWEA 1SJ1A 3PW0A 4OZJA 4WBFA 3EX7B 3LALA 2E1MC 1KNZA 2DBBA 4M5HA 4CLYA 4YY3F 3WHIA 5L9NA 2WW4A 2W2NP 2CNLB 3THPA 2MJNA 2FVPA 4LFCF 5IS2A 1N32J 5D15A 3O44A 3FZBA 3T1YF 2CG8A 2KT5A 3PACA 4Q8FA 3O8WA 4RNFA 3HVWA 4QZVB 1YHQS 3OVBA 4PWUA 3T9NA 1NK9A 3Q8RB 5KFQA 1H7WA 4C3KA 2I38A 2DXFA 2LYVA 5HQLA 2AYGA 1F5BA 4V19X 1J5EF 2CPXA 1NLKL 2JNJA 3U02A 2AGOA 2B7BB 1NH7A 1CVJA 1HNIA 1RAEB 4JI1J 4FP9A 4DZDA 2JVRA 1UETA 2EFOA 5A6WA 5E33A 3TAMB 1S9GA 2AMCB 4TU8A 1FRMA 4NX9A 1SIZA 1RSCA 2MY8A 5F9LA 1X31C 4WCEQ 3S6EA 4FPRA 1YLXA 3W65A 4MFBA 2QA4G 3I9V9 3JTOA 1HFEL 3WC0A 2KB2A 3CC2S 2RILA 1CBKA 3GV8B 2V8VA 2B4OA 1FRKA 2CQIA 4TKTA 2HK2A 3CULA 3M30B 4C3MA 3JQJA 3QPIA 4DPTA 3PG9A 4DLGA 2NS1B 5A0YA 4B3TJ 4IOAQ 5HBMB 3BKFA 2C3MA 4L75A 4OI3A 2N7CA 5IT9U 1UW4A 3IRXB 2QL9B 1EHWA 1S4FA 5KFOA 3CVKA 3CD0A 2MGZA 3MPUB 1FE4A 3GFYA 1XR7A 2XZWA 3GG0A 2N3LA 2JHEA 4L73A 1U6FA 4IFYB 3CCWA 4H4OB 1RZMA 3EXCX 3M8SA 2KM8C 3MTKA 4QIWD 1RT5B 2R7WA 4ZJQA 4PQAA 1FXLA 4LREA 3R2CJ 3P96A 4DR5F 1QE1A 3CJTA 1G2EA 1JLBB 3EJMA 4LF9J 2EVZA 4J9PA 3CUNA 1FJEB 3QT7A 2OMLA 1IBLF 3TYTA 3LP0A 3GIRA 5DLFA 2D69A 3HVTB 3SCIE 2FJBB 4LVNP 4C0OC 2MQQA 4Y6IA 5EX3A 1S57A 1LEOA 2CWKA 2PI5A 2EXUA 1HNVB 1RDRA 1PYOB 4GKKJ 4DL4A 3R1LA 4HHUA 4CNYA 1VRUB 3SDEB 2XSJB 4ANDA 1S49A 5F8HA 1Y4ZB 2XI3A 2FZCB 2HQCA 1GXLA 1PILA 2ZOMA 3TUPA 4A8FA 4OHYA 3NBPA 2DR6A 5D4OA 2FVQA 1REGX 4PYDA 4JI5J 1S9EB 4DV4J 5KOWA 4X62J 5HMYA 1KFDA 3TZXA 1B7YB 1PC5A 3WDOA 2JJ4D 2YKQA 5GMKa 1HWUA 1AYEA 1RKJA 4USKA 2VG5A 4CO0A 1EB0A 1S9FA 1WC5A 5FIIA 4ZVQB 1HPZB 1Y5NB 5DZ7A 4K7QA 1E6VB 3G2XA 3US5A 4BBYA 3E2EA 3CB4A 2HFZA 2OPQB 4ITSA 5DQIA 1WSVA 4K50A 3I0SA 4NLXA 2D7SA 2RMLA 3AD7C 4HDHA 2Z8QA 5AE3A 4WP3A 4CT8A 1R0CB 4DQRA 2DY1A 4CM0A 3K89A 2VPZB 2HGLA 2ZH8A 4OV6A 1JLFA 1SUQA 3NCRA 2OJ3A 3UVJA 3QO9B 4CLLA 1VJQA 3A3OB 5KFCA 3V2UC 4E8UA 4KJIA 1U1RA 4NZ7A 3HSGA 3CGIA 5JVHQ 4PUOA 1RT1B 3D1OA 3FQKA 1VLYA 4KFBB 1TKTA 1Q5VA 4ATNA 2DNHA 4DX5A 2X3DA 2FHJD 2F65A 1X9SA 4DUTA 3HCXA 4TY8A 3LOUA 2A2DA 3SZ2A 4NLUA 1XBWA 1VHFA 2HW3A 1N32F 2BM0A 3VV2B 3IR5B 3W2VA 1AT1B 1K9MT 2KXNB 2ZBCA 4F0HA 4H4MB 2J0WA 2IM3A 2OPRB 3MCMA 4P2XA 2BKNA 1WOPA 3DLJA 1B4SA 4WYLA 1KHWA 2EI5A 1RT4B 4G6VB 4IRCA 5J2PA 1N4LA 2HNYB 3V4MA 1VHIA 2DNQA 4WJBA 2JEGA 3QRRA 2XWYA 1YJWS 2YXLA 3AD9C 4CWBA 2HWTA 1JXLA 4ZS6A 2D1CA 4JI1F 1F6TA 1RWNB 4O3NA 2F8HA 2KJWA 4FKYA 1KRPA 1LQ9A 4YR3A 4X4OA 2YPYA 5KFAA 1NH8A 2AGQA 2R2SA 4LFBJ 1YJVA 3JB9k 2QJ3A 5B09A 1O51A 2BM1A 1EKSA 2F5GA 1H2VZ 1VYAA 4DL2A 2OFHX 2YKNA 1FEHA 2AEFA 4YDXA 4JI0J 2E7XA 2HQ3A 2I1RA 3S01A 4QU6A 1S7IA 2P9CA 3PM9A 1NDKA 4ED4A 4O3QA 1NJYA 1RT6B 2J6TA 1FNMA 3DOLA 3A8KA 4B3TF 2BJ1A 1UA1A 3U1MA 2UXDJ 3KJVB 1EP4A 3CDBA 2OPPB 2LXUA 3ZFVA 3NAIA 4RW9A 4NEYA 3CCQS 3P3DA 3PYFA 1GNKA 2UVWA 2FVCA 4WE1A 1CC7A 5ETRA 5LXYA 3FUYA 3A12A 2KM8B 4NPOA 2BYCA 1Y5IB 1KLMA 1BQNA 5HN0A 4P10A 1RBLA 5L38A 3PEHA 4CDIA 4LF9F 3QGGA 3KXDA 1FCAA 4DJBA 4P7VA 2XHCA 3DGVA 1SL1A 4DFKA 2FTRA 3IFEA 1F3VA 2NQPA 4Q2MA 3PYDA 2F7VA 4FXVA 1Q81T 1F5AA 3AJDA 4X64J 2YNFB 1XWLA 1HI8A 2OD4A 2VKRA 1X5OA 2ZBPA 4K5RA 3TQEA 2QA1A 1LW0B 2G1HA 2ZWPA 3G71S 2AEJA 4GKKF 2C2KB 3TRGA 1YBTA 5CA5A 2HQFA 3IMQJ 4NLRA 3DI6A 5T7LB 3HHDA 2F8EX 1CJUB 4ZP8A 5J1NA 4XIUA 1H73A 2VODA 1LWEB 4JI5F 2CJKA 1SC1B 2BQRA 4DV4F 2WCXA 2R7XA 3QSIA 1RWMB 1WG5A 2FHJA 2IVMA 5HJYA 4X62F 3F73A 4YOEA 1T05A 5KT2A 4X4VA 2B56A 1ZM9A 4ZVUB 2CIMA 1TL1A 2XZDB 1Q8KA 3LP2A 4LBHA 1HYSA 4XPCA 4FN5A 5IWAJ 2ATCB 2YQ3A 2AHOB 3CE8A 2NR0A 1Y0HA 1C1BB 3KLGA 1U0HA 2A2CA 3TNVA 2NUHA 2NYIA 2Q79A 5JXSA 4KE5A 3KUGA 3PFEA 2HAIA 2DCLA 1MU2B 3QT6A 4HI2A 6FD1A 2V8HA 4PQUA 1TP7A 1B0TA 3NLCA 4B9SA 1IKVB 2D3OR 2QN6B 3K0JA 1FI4A 3K8VA 4MAKA 4DN9A 4MJKA 3CWJA 5HVFA 4OX7A 4OX8A 2HMIB 4KO0A 3TA0A 4U96A 2CPDA 1DRZA 3DRRB 4U67Q 3MXHP 3OTEA 3QGHA 3CJKA 1TL5A 5D78A 1BXNA 1P1TA 3ZTSA 2NXNA 3C19A 4Y28C 3CEDA 3RBEA 2EKYA 3TEHB 2J8AA 1PBUA 1KOOA 1S1XA 2C2DA 1DARA 2UP1A 1FVQA 4ZPDA 4J7CA 4N5SA 5H1SV 4L74A 5BR8J 2MHNA 3BPSP 1SKUB 1SV5B 3IBFB 3BO2A 4HL9A 3DDNA 2HGMA 3PJXA 4OYOA 2AT1B 2E44A 1PGZA 3TJ8A 5LM7E 2ROEA 1H2TZ 2KO1A 4NEZA 5HAOA 2R2TA 1O8BA 3FZ2A 3MM6B 3KK3A 2CJAA 3BGOP 3G87A 1PJ6A 1UAWA 1VR6A 3VQSA 1MWZA 3MF5A 4LFBF 4KHMA 3IR7B 1RJJA 3EGVA 2Y8WA 4I64A 2Q3PA 1QUPA 2B3TB 4CLTA 2JC0A 1IM6A 3MEEB 3CPWR 2HS4A 2OEJA 4RO0A 4JI0F 1JLEB 2MQPA 1SH2A 3HZEA 4W90B 2W9BA 3QIDA 4JOUA 2R2RA 1I5OB 3CMES 2VKZG 3IM8A 4PXCA 2HQDA 1RWKB 4M5DA 2M88A 4HTJA 1D8YA 4TU7A 4ED7A 3V81A 2UXDF 1FT8A 4DBQA 5DGAA 4EBEA 5HSPA 5G0RA 1SL0A 1E6YA 2R8KA 1FXRA 3DLEA 4PABA 5KFYA 3IGNA 2ZHOA 1RISA 2EG2A 2J7WA 1N6QB 4J90A 1S0NA 1R27B 2ZE2A 1X8DA 3BPDA 2WVFA 4Q0BA 1XC9A 2H5EA 1LXNA 3JQKA 3BBFA 4CO2A 4JV5J 3JSBA 1HI1A 2DD8S 5D4LA 3KG1A 4QWAA 1D9FA 3D6TB 2DO4A 5IOLA 3MWBA 2DNMA 4C9DA 1N0UA 3GPAA 2FQQB 2DGTA 1Q79A 5J2MB 3W60A 1YK9A 1TVRA 2OPSB 2P6TA 4X64F 1NKEA 3O3LA 2BX6A 3NP5A 4Q43A 2V2VA 5ADZA 4Y34A 1WF1A 3EM1A 1GK8A 1TL3A 5I3PA 1WHXA 2DRBA 2VFUA 4ZP7A 1I3OB 3K59A 3W9IA 4GVLA 4DR2J 2WVCA 4HLBA 2ZDOA 3H5UA 5KFDA 1TKXA 3EZOA 5J1EA 1JX4A 1NO8A 2PA8D 1NEEA 4KKOB 4J9LA 3BN4A 3OR1B 2IYGA 3QT5A 3VAGA 2J0SD 2AU0A 7FDRA 3GV5B 3E51A 5KG0A 3IXQA 4QWCA 1WDDA 3J80U 4WTYA 2N4CA 2CPYA 1VRTB 3M1VB 4JB8B 2FLNA 2GVDA 2N7YA 4P2FA 2GJFA 4KBIA 4OYAA 1SH3A 3J81Y 2FHOB 5IWAF 3DOMA 2XYHB 4JI4J 3PRVA 1VCTA 3THTA 2W25A 3CSKA 3M7VA 4O3RA 4C8OA 4RNNA 4F2RA 1YJ9S 3K5LA 2FUG9 3RR7A 1R0BG 5CCLA 1QY7A 5K8PA 3HDSA 2H65B 2O66A 2I8EA 3UN5A 2H4YB 1U48A 2MXYA 1PC4A 2B6AA 1LKZA 3OFHA 3T19A 1XMBA 3ZZZA 5GAEI 3OL9A 4PWDB 1CC8A 2W2QP 2E9TA 1X0PA 2MPUA 1N8RT 2UUTA 1TELA 3GP9A 4BWJA 1HQUA 1X0FA 2G0IA 3VF0B 2GFFA 1XR5A 1RWXB 4NLQA 4C2MA 2BKOA 3VHQA 2MLZA 4F4YA 1Z2ZA 1W2BR 4A8KA 4DR6J 3DHWC 1JXVA 1NJIT 4KRWA 4W4MA 2V8PA 3Q8PB 3QJLA 2AJQA 3ETMA 4CYUA 3MFIA 5IV4A 1ZTTA 1NJXA 1HHTP 1KR4A 2BJ9A 2V4JA 5KFGA 3BSNA 2RKIA 4OZLA 4V1Ak 2UUAJ 5BR8F 3AHPA 1F9EB 5DQGA 3JTPA 1D9DA 2NXCA 5MAOA 2FC8A 1MROA 2OFGX 4ED2A 2IAJA 4K4TA 3DFEA 4ELUA 5CABA 3CC7S 2BJEA 2AP6A 3NWRA 2MLYA 4DDFA 3IBCB 3D1QA 3D0GE 2KRRA 4J9MA 5H9EK 3GONA 3FSXA 4LSLA 2RF2A 2IY5B 1ICEB 2YQ0A 3ISZA 4A4JA 3TX0A 5KFWA 4A8XA 1S5ZA 1ZA2B 1R43A 2QLJB 3ILIA 1XERA 3KJNB 2QV6A 5I3UA 3POTA 1SC4B 4ZVRB 4LF6J 2RVJA 2HVEA 1GFWB 1DQ9A 4F50A 1NJWA 3I0RB 1HBMB 3PNIA 4IFVB 3M9OB 2VU5A 4TY9A 1VJWA 3N0VA 2O01C 1U8WA 2ZHBA 3AA8A 1ZETA 3DRPB 5I4MA 3G6XA 1YG0A 1FESA 3CJ4A 5ETQA 4X84A 1YDLA 2GO8A 3M8QB 4RWWA 1UL3A 3C16B 4CLKA 1ZA1B 4Y2AA 5F41A 2AJ0A 4J9SA 4CTAA 2GQCA 1HQ2A 4ZA1A 5J2NB 2HRTA 4MK7A 2ZNZA 4C0BA 4JV5F 3HVAA 3BO4A 2CG4A 2LVWA 2R8HA 2GW8A 2EK1A 3FSIA 3MUMP 1PYSB 3BQ1A 4MK9A 4X4TA 3KHGA 2C1EB 2YBVA 2PEBA 3LQVA 2OEKA 4W92B 4O4GB 4K2JA 3KG0A 5KFVA 1IN0A 1JNZB 4DPYA 2M3DA 5DG7A 1K47A 3UFCX 2WSFC 3ZTPA 3MAAA 2RDJA 4C98A 1F0XA 3H8YA 2DH9A 2HQGA 1QJHA 4ZN3A 3MEKA 4DR2F 2KZZA 1VQ5S 2W2OP 5CYJA 2RS8A 3TAMA 2W2PP 1GMUA 4U8VA 3I4HX 4OMFG 4U9RA 4DZ6A 4DHVA 4IOBA 3RBXA 1D1UA 3RB6A 3A1YG 3M9MB 4PG7A 1RA6A 2IM2A 1BGXT 2VZ9A 2EG1A 2E29A 3M30A 4ER8A 3J7YI 2VPWB 1XIQA 3A8IA 5HBMA 1SI9A 3W64A 4JI4F 3AH6A 3IRXA 5D0EA 4DG1B 1ZS6A 4E98A 2PC6A 2LQ5A 3MMCB 2FJVA 4Y3CA 4ECRA 1S77D 3G9CA 2A0FB 3BBCA 4IFYA 4KGMA 2NUUG 4H4OA 1OPZA 2G4BA 1Q86T 1HNWJ 1KS2A 1JLQA 4UY85 1RT5A 2B9WA 1DLOB 2MZTA 3CXCR 2HS3A 5KOXA 3FMWA 1DTTB 3KMQA 5CD4H 4C11B 3VCDA 1OSCA 2HBYB 5KT4A 4ED1A 1WI6A 2RQCA 4B3RJ 2W9AA 1UVLA 2XB2D 1N5SA 5DQHA 2R42A 2XGQA 3CCUS 5D4NA 4GO7X 2DHGA 4LF5J 3MPYA 3VZIA 3D67A 4UOGA 2LLZA 1Q53A 3HSJA 3A4TA 1WEZA 3CCVS 4DR6F 4F2SA 2J5AA 3HT3A 1S1TA 1VLOA 3PO4A 3L09A 4OI2A 3R5GA 1F1BB 2M0GB 1HNVA 1YI2S 1N5YB 5KT3A 1AZSB 2HFOA 2LP4A 4B17A 1WHYA 1VRUA 1KHVA 3SDEA 2WVBA 3EWGA 5IM0B 2UUAF 1WI8A 1YVFA 1DBDA 4WXWA 3LF0A 4HH0A 3R5JB 3IBWA 3J7Z5 1FERA 1GMWD 3M4XA 1S9EA 4YS2A 4RL1A 1VQNS 5KFLA 4RUBA 1YX2A 1JLGB 3UCUP 4NL5A 3ILOA 2B9XA 1TAUA 4DR1J 2XULA 3AQPA 2V94A 5KFBA 1HPZA 1FWKA 3CO0P 2Z57B 4ZOSA 3Q0AA 5A2QU 2ADBA 4WXOA 1E6VA 1KFSA 2I2YA 2GJ2A 2EFGA 5KFXA 3C2PA 3FNNA 4LF6F 2IRYA 1C4CA 3DHXA 1U4BA 3F44A 2O3DA 2QLFB 3GE9A 1UWBB 2QO3A 3LGNA 5E0OA 3W5XA 4FPIA 1L5UA 4OLPA 3UDCA 3TUIC 3UD4P 3JSRA 2V8DA 3UCGA 4MKYA 1KC8T 1ZH5A 2MQLA 1S12A 1PCAA 4Q8EA 1LFWA 5D3GB 3I9ZA 2VFTA 2HFNA 4IO9Q 3GFZA 4J9NA 2DPIA 1MMDA 3D1HA 3JAMU 1RT1A 2DHSA 5KG2A 2G0CA 2ZJPQ 2YNHB 2LMIA 4OI4A 1HNZJ 4KFBA 2ZBQA 5KT5A 1IBKJ 1D9AA 5C7PA 4P2MA 1EAYC 3PFOA 4AXJA 2MKKA 1GQEA 2E1RA 1VBXA 2OSRA 3WX4A 4Z37A 4WU3A 3ITHB 1RT3B 4K4UA 3RG6A 2ZKUA 2OPRA 1UCNA 4NZ0A 5C42B 4JV1A 3FEZA 5IT9Y 2PE8A 3WIVA 1RAIB 1RU1A 1R8BA 2VA3A 1WKJA 1U6BA 1BY9A 2HNYA 3OXFA 2DR9A 1RHRB 1UJ5A 1M0SA 2UXCJ 1RAAB 3PY8A 3FMBA 5B0BA 1LW2B 2L08A 3NGRA 4LT6A 2XM3A 5L1KA 3IR6B 2HZVA 3KK2B 3WX8A 2CNOB 4OI6A 3QSYB 3SFGA 5EN1A 4BS2A 4HH1A 2QYCA 2CPZA 3H90A 5H9EJ 1K73T 2ASJA 5EX0A 3NGSA 3QJJA 2KKHA 3P49B 2FGOA 2GIRA 1IKXA 4CO1A 4DV0J 2XNQA 5KAKA 4TYBA 3NGKA 5KG3A 1RT6A 3ZZ0A 2V8GA 3VGVA 2LEBA 1OPIA 4X4UA 2EW9A 2POKA 4OLOA 1TFYA 4USHA 3KJVA 2OPPA 5SZTA 4L3NA 2PGCA 2I5JB 2HLTA 4NRTA 1PSDA 4OX9J 3KNGA 2MKHA 4NWBA 2CJQA 5DDOC 1G6BA 2C2ZB 5KFIA 3I96A 3VALA 2N3OA 4WP9A 1GMWA 4DCPB 4KGXB 1HNWF 2MQ8A 4C8NA 4C8YA 3VWSA 5K20B 3D0HE 5LSRA 3ZNUA 1DAXA 4YN3B 2C3OA 2CQDA 5AJ3J 4B3RF 2YKMB 4WF9Q 3M8PA 3C15B 3GU0A 2DGXA 2FJAB 3GIIA 1WD6A 3Q2TC 3F41A 3W61A 4IR1A 4LF5F 2GHPA 3UN2A 3ZNJ1 3NMRA 2CZ4A 4P52A 2LEAA 1U25A 5L1LA 3HHLC 4GO5X 1SKSA 2HVZA 2ZH3A 2EBGA 2HVDA 3DXBA 4I56A 1M5SA 3BH6B 4B08A 5F9NA 5LSLA 2AWZA 1QAJA 2OUGA 2YNGB 3KDOA 2GMHA 2R7SA 2L3MA 1FK9A 3B78A 3CJ5A 4DPOA 2M8HA 3GZ7A 2YKPA 2H9ZA 1JQGA 1WG4A 2D74B 1SH0A 3MMBB 2NPIA 3BQ0A 5C25B 4WIIA 2F4VJ 1T9XA 4FYVB 5HROB 4DR1F 3OXGA 1ZBTA 3NEKA 5DM7Q 4NRUA 1RHUB 3DLHA 3L95X 2U2FA 2OELA 1U2FA 4YUDA 4A8QA 1I51B 2VG7B 1NSPA 2FJDB 4R8UB 4N8OA 4PG8A 2J76E 5I3QA 2GS8A 2VG6B 1YITS 1AFIA 4C0HA 4YHHJ 3MPVA 5J1PA 4NLGA 4CCHA 4IO1A 3CO9A 1NDCA 5M2PA 2ZH5A 1BE4A 1RBAA 3R6LB 2JEIA 3OHBA 4I67A 2JDJA 1R89A 2ERRA 1VQKS 1IKVA 2PMWA 3ET6A 3GV7B 3W3SA 3R1HA 2XWXA 3H7HB 1QVFR 3M6VA 2R7QA 3C6TB 2FLLA 2CJBA 3RW7A 3FBFA 2RS2A 5A6PA 4QR0A 4WKYA 1N34J 1WUUA 1HNZF 2VBYA 4R0JA 5I42A 3PO5A 3DRRA 5C24B 1IBKF 3CD5A 2CUYA 1EJ7L 3T5JA 2K3KA 1HL6A 2JLFA 4F26A 1OJ4A 2YH0A 1HHQA 1JJ4A 1CPZA 3G86A 4B9VA 1MLAA 3O6QA 4B9UA 4DMZA 1HW9A 2VONA 2IRUA 1EQ0A 4TXSA 4RWXA 2Z58B 4X66J 1SV5A 2OSQA 2RAQA 3BREA 1RHMB 1J2VA 2FJEB 4QW8A 3KUHA 2UXCF 2XSFA 4DF4A 4WTOB 4N47A 3FBBA 3H2LA 4Q2LA 4ZVGA 5GAEU 4FNHA 1K0TA 2RIJA 3MM6A 3NGDA 1IKYB 3AOAA 1CS4B 4USUA 2YX7A 4F02A 3B82A 3SQGB 2XNRA 4FS2A 2CQPA 4KIAA 3NMAA 4CO4A 4ED3A 3TUJC 5IT0A 4BLGA 3SXLA 1WOOA 4MYTA 4USWA 1NHKL 1N5TA 1O5JA 3WIUA 4WPAA 1RWPB 4PR6A 2WB1D 4DV0F 3M8ZA 4ZLLA 2JSXA 2LQJA 2RE1A 4I68A 1JB0C 3UN3A 2E1CA 3BB5A 1T94A 2LQ9A 2ZH7A 2DNZA 1X7VA 2OHDA 2MZRA 3PX6A 2P8IA 3OPKA 1CJTB 1UPPA 2GX8A 2VL1A 2E66A 1FWPA 4OX9F 2ZITA 2QT7A 1VBZA 3R7SB 4F04B 2MKJA 4WK3A 4DN0A 4DV5J 1TAQA 2AIRB 1KQKA 2O1PA 5JJBA 4J9KA 3ILLA 2PN6A 3ZTRA 1JWWA 1FHTA 1CJVA 4N41A 3H2VE 1REVB 3J81U 4DFJA 2XMVA 3N5BA 1F60B 8RUCA 5AJ3F 1Q4RA 1JLAA 2A18A 2XO7A 3JTNA 1RHJB 3LP1B 4C6AA 1C1CB 3DMJB 5KTQA 2BJ3A 1MG7A 4QWDA 4PG4A 4GVBA 4DSJA 5J2MA 3GJQB 2OPSA 1LWCB 4F4ZA 1MWYA 3DLKB 1R0AB 3MZIA 1T11A 2J0XA 2JL9A 2MEWA 5K8NA 3LUYA 1T03B 4CO5A 1DJ0A 1R8AA 2DGQA 5KFEA 1SJQA 3GYNA 1FDDA 2K3IA 2C2OB 4KQZA 2VBWA 4M5MA 1PIEA 1V6HA 1VQ7S 1NU4A 2ALZA 3S1TA 3HKWA 3UDEA 4P74A 5F0WA 1WF2A 1JK9B 2MSTA 2FGCA 3AOCA 3BYPA 4FF1A 4OYBA 1OMSA 4G1IA 3OR1A 1NSKL 3KLFB 1S59A 3QAEA 2LECA 4IQMA 3D9BA 1S76D 3BDEA 2HWHA 4N56A 4KHRA 2KFZA 1VRTA 4OYWA 1Q16B 3M1VA 3OL8A 3V6JA 2F4VF 4MT1A 3RZAA 4ETXA 1FXDA 4ZPBA 2UVUA 3P8BB 1UMJA 2BBEA 5HK4A 2BE2B 2AJFE 1VQ9S 1WC3A 5AXLA 4EBCA 1TV6A 3IRWP 2QLWA 1U47A 2KFYA 4YHHF 2VBZA 2RHQB 3OUYB 4NLVA 4IG0B 5K14B 5LSOA 4C4WA 5EUHA 3H25A 4DL7A 1FJ7A 2OO4A 4N76A 3U27A 2FD2A 3NNHA 5K5MA 3PR4A 2LXFA 3C3LA 5KFHA 4F4AA 5KFJA 3MD3A 3QIPB 1U8SA 2AX0A 1F3FA 1N34F 2KVQE 2P2CB 1RTJB 3PRBA 3SIPB 4Q5VA 2QG9B 2KHDA 2HIQA 2GJIA 2B43A 1YZ7A 2RH3A 3HI9A 2E9RX 4IR9A 2YY3A 4RJVA 4A8WA 2RT3A 3HJVA 4IH7A 3E3XA 3LAMA 3BGUA 4M5LA 2ZH2A 3QATA 2L41A 2L9DA 3SV4A 4QJVA 2MTLA 4LR8A 3OBIA 2W24A 4ECYA 1YRTA 1VS3A 4BC9A 3EMTA 3BZQA 1WC4A 4X66F 2Y1JA 4FF3A 4FKXA 1Y7PA 5HVGA 4I6YA 3W66A 5KFUA 4ECUA 2UUCJ 1D0EA 2G13A 3ZZOA 3PV8A 4C8MA 1KTVA 3H2UB 2Y9HA 2ZH6A 4RBUA 1X9MA 1WEXA 2NPFA 2QL5B 1FTCA 3DYAA 3SQOP 4EBDA 5C2GA 1KVKA 2HKEA 1OIAA 1T9YA 2AZ1A 3OXLA 1FKOB 1L3VA 3UR3C 1VDHA 2HHPA 2CZVC 3ONQA 2ZZMA 2AW0A 1RAFB 4MKVA 2QZ8A 3AQOA 1S6QB 3EDQB 4AYBD 1BLUA 3H98A 1HWKA 1A7GE 2EC2A 1R3NA 4K5SA 3GWCA 5KFNA 5HMZA 1IWGA 2PFDA 8ATCB 1RACB 3FCWA 1HWLA 3I0RA 3P6YC 3KLIB 3CW2C 1P9QC 4IFVA 2V2QA 4M95A 3Q8UA 1C0TB 3PW2A 1WHVA 4Z2XA 2D41A 2CA9A 2KRBA 1FTRA 2C3PA 2W7PA 2XQCA 1T9UA 5A8RB 4DEZA 3GG1A 4DU8A 1NZAA 2BQUA 2GMLA 4V19J 4DV5F 2DNOA 3MM5B 3C16A 4L6V3 3RU0A 4UY8T 1SB6A 3QZ8A 2XYPB 3BSAA 3J80Y 1FKAF 5J2NA 4ID8A 4OZNA 1H0HB 1X4GA 1WNEA 1S6UA 4LR7A 3R6GB 5L1JA 5KG4A 1KWMA 4E0DA 5KFSA 1TUVA 4UT4A 1KQSR 4P2SA 4NCGB 4DI6A 2CWXA 3PZPA 1NM2A 3R5DA 3JYTB 3TW0A 1C2PA 4BCAA 1J5OA 3LWLA 1FKPA 2B8QA 4DS5A 3TA1A 2MKSA 1IM4A 1FNXH 4AXIA 1IVZA 3ISNC 4MMOA 4XK8C 3M2UA 3BV8A 1YIJS 3EYZA 4HR2A 2ZVIA 2Y1RI 4QQBA 2MKIA 2DGVA 5IV3A 4CIOA 2NSCA 4AD6A 2AF6A 1FVSA 3TVKA 4CP5A 5B0DA 1F2GA 2NXJA 5IQQA 1WOSA 2F63A 4CH1A 3V6KA 1QE1B 4WFYA 4QWBA 2CQBA 4L76A 3PKMA 2IM1A 4NLPA 3CMQA 1WELA 4RW6A 1T8EA 4F25A 2BABA 5BYQA 4ANCA 2V5HG 4OJHA 4DG1A 2WVEA 5KFTA 1F2HA 3MMCA 1WF0A 2FPHX 5KFZA 3HSZA 1HQEB 3DC2A 1FRXA 4LSNB 2B51A 3MM9B 7FD1A 4ILLA 1AUDA 1R31A 3OVAA 4CRJA 4DQSA 1DLOA 1HD0A 5C2CA 1WHWA 5F0UA 1LOUA 3D28A 4C11A 4JBCA 5B0CA 4U8YA 3BN7A 3K8WA 4ZVSB 3CDEA 3SCJE 4DV7J 4RUHA 5CAAA 2ROGA 3FQLA 1ZM4A 1QVGR 2QSFA 3EXYA 4PXEA 5AE1A 4PG6A 1UPMB 5HL7Q 3TZWA 1NB2A 1S0VA 2FZGB 3RBZA 2QA2A 1K1QA 1VQ8S 5D77A 3NGUA 4RKUC 1DURA 5HLFB 2DH7A 2I9SA 5ETLA 4NI2B 3M9NB 4HT7A 1N5YA 1AZSA 2DIUA 1IQZA 1HI0P 1FA0A 4P7TA 5LJ3Y 2MZ1A 4DV2J 3HFKA 5IM0A 1UEUA 4CH7A 1VBYA 4ZP9A 4ZK7M 4G1QB 4IQXA 2XMTA 1RGVA 1VMBA 3Q8SB 4C8LA 2IHR1 3MMAA 4LMZA 2L9NA 2B9YA 4ICLB 2UUCF 2W4DA 1U1QA 3NCQA 1HBUA 1I6JA 3KLHA 2C2RA 5F8GA 1JLGA 1MN9A 2VPYB 1Q95G 2CPFA 4WKRA 3OJUA 1SUQB 1X5PA 2DNKA 3JSMB 4F3QA 2CVEA 4KV8A 2JZ5A 1K44A 3OFEA 1UFKA 2OMOA 3UPFA 2BE9B 4WZMA 2QMXA 1QSYA 3D54A 2RD5C 4AUKA 3N5FA 2HHSA 4FYWB 1UWBA 4TY8B 1CJKA 4IG3B 1B0PA 1NCLA 4NLDA 4NZ6A 1X5TA 2AYMA 2IJRA 1FO1A 3N6MA 1APSA 2HHUA 2FLPA 4KY3A 1N33J 2DRDA 2WHOA 3DU5A 1XNQJ 4DCOB 2VJUA 5F8LA 2YNHA 5L8RC 2CQHA 5E3RA 4UQGA 3AY0A 1RADB 4Z7YA 4MK8A 1GXUA 2R2UA 1EETA 5HANA 4X4QA 2QFIA 4YR0A 3ISND 2ABYA 2KVIA 2M9KA 3OW2R 3PCOB 3OQ2A 4M94A 4OHXA 4USVA 1P9YA 2ZH9A 5DDPC 3T41A 1OYEA 2PI4A 2XO6A 2KH9A 5H9FK 1U7LA 3ITHA 1XQIA 1RT3A 3DOKB 3BM7A 3PTWA 4HDGA 1NSAA 5C42A 4D3HA 3UWTA 2KZMA 5BJRA 4TQSA 3M6WA 3TQ1A 4UOFA 4I7FA 4O23A 1Q7YT 3MEGB 1WC1A 1FD2A 1SKWA 1P27B 4JP8A 1GMVA 1LW2A 3TA2A 3AJ2A 4ZMMA 3FDSA 2DR7A 2SXLA 5HMXA 1HWIA 4F8RA 3DOLB 1RWVB 3SV3A 4KGVB 4Q45A 3KK2A 3EE3A 4R25A 5F3ZA 3VAJA 1NHUA 6AT1B 3N9UC 1Y5LB 2H4WB 1Z1ZA 2HK3A 3R5BA 3BR9A 3EVMA 4RW9B 4F36A 4YB5A 4F4KA 1VK8A 3SSSA 4RZRA 2PT0A 2QMUB 4WE1B 2C2NA 4IRKA 3C6UB 1N5QA 3IG1A 1FFGB 5LT5A 5AE2A 2HFSA 1RU2A 3LPEA 3BO3A 1KLMB 2JX2A 4OFZA 1WC6A 4PXBA 1BQNB 1VQ4S 4WFAQ 4LF7J 3NL0A 1ROFA 1QAIA 2K06A 5CYQA 1RWWB 1VQPS 4J91A 4FBUA 4LUBA 5LXRA 5FDLB 1RCOB 1KQGB 1EIYB 1RAJA 2BJ7A 2I5JA 3Q8QB 4OZ0A 4DR4J 2PA3A 4NLSA 2W01A 3DDIA 2IPOB 1RWOB 1TK8A 4CLSA 5L1IA 3CCJS 2CYYA 1Y00A 2LQBA 1GT8A 2B4PA 2CQ4A 4J5OA 3UD5A 4A8MP 3N6LA 4TVAB 2FHMA 3IWXA 4ZN1A 2HHVA 4Y2IA 2YKMA 3KG4A 1M1KT 2GQ2A 2HQIA 4DV7F 2COLA 1OO0B 1H2UX 1C0UA 4DV6J 5A2QY 2CQ2A 4ILRA 5CZXA 5J2QB 1FJGJ 3GIJA 2KXFA 4XAKA 1KSPA 1RHKB 1MMNA 1W25A 3QGIA 4ZVFA 2D9OA 4URSA 2IBOA 3ADAC 2HWIA 5CH7B 2FY1A 3CIZA 4OV1A 5AXKA 2UV8A 2DKOB 2V4RA 1HYSB 1LFPA 1IR1A 5DO2A 4O44B 1Y3KA 1RTHB 4F3OA 1VIOA 4DV2F 3LH2S 1IWAA 3EZUA 3R97A 1X60A 5KT6A 1NJZA 2E1PA 1T9VA 1NHVA 4OYXA 3KHLA 1Q78A 3JAMY 4QW9A 4TN2A 4DL5A 3MMBA 1JMTA 3TJAA 5DETA 3H20A 2HBRB 4PQUB 2QE5A 3OHAA 2XEXA 2OTLS 2ZHAA 3IS9B 4IKAA 2HIYA 4W98A 3MUTP 5IQ6A 4A48A 4ERDA 4ID5B 5HROA 2XI2A 4LBIA 3W5YA 2HBQB 4K2XA 3MCNA 3LTOA 2VG7A 4F0MA 4R8UA 1CQMA 4EYIB 2NLWA 3ZC4A 4RNHA 3W63A 2KU7A 4ZVEA 3FRYA 3CNQP 1T9WA 2W4CA 3HPOA 4P75A 2LCWA 3MOZA 1HBNB 1NPKA 3SSQA 1VGYA 2JLEA 3GSDA 2Q66A 3P5BP 2VDIA 2UXBJ 5KG6A 4KGKA 4B3SJ 4M5IA 1N33F 3TOQA 2H5IB 5B0FA 3NKYA 2IVFB 3FSYA 3HT0A 1TZ0A 5A76A 4OZ2A 2F9JA 4LRBA 5GAHI 5F3TA 4NCAA 4WP8A 4ZDNA 5C24A 2ZUAA 2VJVA 2GAGC 4X2BA 3ZXWA 1ZZFA 3VQTA 2KI2A 3TANA 2WSEC 2X7IA 2G1DA 5GADI 3V6DB 4MKAA 1M5KC 1BD6A 2XMAA 1KVJA 1HA1A 4HI1A 1M5PC 2PO4A 5K8MA 1JNRB 2B0GA 3SYZA 1HNXJ 1NBEB 1TL7A 1UEVA 2B5JB 2R7RA 2W9BB 4DSEA 3Q8VA 4B9TA 3M2RA 2FDNA 2Z0GA 2MMYA 3NWGA 3I55S 3RAXA 4HACB 4ZJLA 3V81B 5AXMA 2CJ9A 1CS4A 1UKUA 5CZVA 5G0RB 4GKJJ 3SQGA 1E6YB 1JJ2R 2K2PA 3MDFA 4USMA 2J0QD 2PFFB 2DCUB 1R7IA 2K8GA 5FJ4A 2V0NA 1TKZB 1VIXA 1QSLA 5DDQC 5A8WB 5KFPA 3H5XA 1FDBA 5HP1A 2YVSA 1WG1A 2HEKA 1WTFA 2ZE2B 3MM8B 4JV2A 2W8LA 4Q0BB 3THVA 4MYUA 3NXZA 4LF7F 2OP5A 1B99A 1HIYA 1G3OA 3RTVA 3CT9A 5CCMA 4RW7B 3V5RA 4EU0A 3ZTOA 2VD3A 1KVIA 2OTJS 1UVIA 2WZ1A 2E7WA 1PJ7A 4DV3J 1WTBA 4DR4F 3MEDB 4IDKA 2FB0A 1XJWB 1FF2A 2X1FA 4U7UK 3G6YA 3M32A 5GMDA 4G65A 1TL3B 4RX6A 4PKDB 1AW0A 1VI7A 2BJ8A 3HHNB 3QMQA 4JUZA 2CPIA 6FDRA 3MAQA 2E5HA 1LWXA 3A8JA 3ZO7A 3LP1A 4CO3A 5J1EB 1C1CA 4N77A 4B9LA 2QLBB 1UP1A 4DV6F 2D9PA 1Y9OA 5F8MA 4P71A 3MD1A 5H9FJ 1FJGF 4YP3A 4H54A 3W8PA 1S10A 4ECQA 2R8JA 4K0KJ 1LWCA 2IDLA 4I4BA 1B70B 3DLKA 1R0AA 3KDNA 3OLAA 2F1FA 1T03A 2BEFA 4R0EA 1ZZNA 1U6ZA 3HZGA 1U2CA 5DRKA 5KG7A 3U7JA 1HWJA 2LQ8A 1T9TA 1YZ6A 1SL2A 1QTNB 1TK5A 4P72A 4EI2A 4NYPA 1FRJA 1J27A 4ECXA 1TU0B 4OYIA 1NK4A 1DY3A 4P9SA 3KLFA 4ECWA 2DNLA 2DO0A 3CIMA 5IC4B 4Z7CA 2KL8A 2YTCA 2DYAA 2LU1A 1D3WA 2RQKA 4LRCA 4UTGA 4ZCMA 3VAKA 3J7A1 1DTQA 2BE2A 1TKDA 3VR1A 2ILYA 3FC9A 3OTDA 1RT7B 3G82B 3Q8YA 4TQRA 2V9KA 3W8GA 3UQSA 2HNZA 1ZAXA 4ZPVR 5JVGQ 5K14A 2GGPB 4NOHA 4B3OB 1M5OC 3AB2B 3G6VA 4I69A 4NMXA 2E5JA 2UXBF 2HPUA 3TAPA 4RNMA 4B3SF 3KMSA 2V4JB 4DFMA 2E5IA 4AL5A 5DJBA 2OD6A 1A9NB 2RKIB 1WC0A 4IH5A 3RAQA 5T14A 1ZYQA 2AJ1A 2L9WA 3SBMA 3PJWA 3CJQA 1Q8LA 3QIPA 2VFVA 2GMJA 1UVKA 4K4ZA 1IJFB 1RLCL 2J9DA 2DY9A 1RTJA 3KK1B 1QAXA 3W62A 1T95A 3RBDA 3DRSA 1SJ4P 2WK4A 2Y8YA 2ZKTA 4RBVA 3FEXB 1VQ6S 4PPZA 4TLQA 4ELTA 3KTQA 5D0GA 4BC7A 5B0EA 4QCLA 1Z4UA 2QA4S 2ACMA 3UW1A 2KG0A 1FE0A 1NKCA 3POTB 1M5VC 4K4SA 3AXKA 1HNXF 4LJMA 3U1NA 2DB1A 4Q44A 2N82B 1SC3B 5IXUA 5F8IA 5DM6Q 3M05A 8AT1B 1BQMB 2WBRA 1NPRA 1FRIA 2QEXS 1FKOA 5ETKA 1JXEA 1S4EA 3RRKA 2WRMA 4I2PA 4PCQA 2RUGA 1IR0A 4GKJF 5ETTA 3E01B 2DHAA 1UVJA 2BOPA 3VTIA 2V68A 3MTJA 3HD2A 1VOMA 3VZHA 1S6QA 3HF5A 4DPXA 2VA2A 4DQIA 1GX6A 1M1HA 4UUXA 4Y0FA 3BYRA 1ZPWX 3V4IA 4CTAB 1UWAA 3KLIA 4J9UE 1BQXA 4IUFA 4EWTA 3T1HJ 3M8RA 1KOHA 2V67A 2XS2A 3CDAA 4C97A 2VOPA 4U6PA 3GFHA 1C0TA 1K1SA 4QIFA 1DQAA 4ENOA 1OQ3A 3IAM9 3D3CJ 4DV3F 2VQEJ 1GH8A 4PZVA 5A8RA 2ASYA 3DM2B 4XO0A 3IWLA 3W9JA 3MM5A 1CEZA 1S97A 3OSPA 4XPEA 2J7KA 3MAAB 3NS7B 4DLEA 1S1WA 1WKLA 2IM0A 1B3TA 1R6YA 3SEOA 1T02A 3CCMS 3K2YA 1HBOB 2KG1A 1MSWD 4ZCIA 3L3CA 1WKKA 4YMEA 2LA4A 3F56A 4NCGA 4DFPA 2UVRA 3EDRB 4PXDA 3JYTA 4K0KF 3N6NA 1TR0A 3M8YA 1O0PA 2E5GA 3D5MA 2CQ3A 3CF5Q 3D4JA 1RHQB 2PIIA 4DL6A 3R2DJ 3T5HA 1EX8A 5DS7A 5E3PA 2K1RA 3MGJA 3CCES 3EVOA 4NYZA 3X1LB 5BXIA 3AOBA 1GTHA 3Q23A 1NXIA 1R6VA 3HXMA 3H4BA 3DLBA 2ZC3A 2W1BA 5THWA 4LF8J 3H4DA 4WFBQ 4DSFA 2GC8A 2C28A 2CXEA 1ULRA 4QU7A 3CD7A 2R7OA 1JLQB 2YWFA 2J6UA 3KWMA 3KHHA 3J81j 4RW8B 3DLGB 1BUXA 5D6GA 2F4FA 1U24A 4AFFA 3PVXA 2M5YA 3MECB 3CD6S 4FYDA 4I1TA 2XCAA 1QM9A 2VV5A 2HHWA 5HMWA 3HHKA 1HQEA 3CCRS 3MR5A 2XLKA 4QIGA 4QR2A 2FJWA 4U7CA 4LSNA 1I1GA 1M5HA 3MM9A 1S1TB 3WBZA 4QOTA 3T6BA 2ZD1B 3N28A 3HM9A 1FFWB 2ZJRQ 4PWWA 4B9NA 2BMBA 3B4MA 1N54B 3BEGB 1X4AA 3GCXP 4MKBA 4DX8H 5KT7A 3CCLS 1IKWB 2HBZB 2MJUA 3K5OA 2BA9A 4M63A 2HG4A 3IP0A 5ETSA 4FYYB 1Y11A 2ZWOA 3ZZRA 4BWMA 3RR8A 3R9LA 2JVOA 4DV1J 5EGYA 1YSJA 3NGTA 4KH0B 3HD1A 4J9QA 3C8YA 2C3UA 1WORA 1H7XA 2AJ2A 5HLFA 2QFJA 1N56A 3SFUA 3FRZA 4NI2A 3UDVA 1NK8A 2KT2A 2V69A 5IT4A 4EYHB 1GAOA 2CDRB 1UEKA 4RBTA 3A3NB 1YJNS 2XC9A 4LF1A 3IC1A 1UW9A 3H5SA 2YX4A 2J7UA 1WSRA 4F4XA 2KJVA 3QRQA 3EPIA 2BQ3A 4LF2A 4G1QA 3IO1A 3KFWX 3ETOA 4X65J 4LBPA 3AFGA 1U49A 3NCPA 4ICLA 2DHHA 1F9FA 3MR7A 5SUHA 3T3FA 3AD8C 2J8SA 2IDEA 1Q7LB 4G1PA 4DQQA 3FCHA 1OSDA 2OH2A 1WACA 2GAHC 3LANA 1SBRA 4J9VA 2XS5A 1H6KX 3JSMA 2MYFA 2WW8A 5ETVA 2V63A 4YB7A 5E5NA 4ZPAA 3FBCA 2C22A 2LA6A 4I6AA 2MSSA 2KHCA 3D0IE 2ZC4A 4C48A 3ENQA 5DZ6A 3QLHB 3MOJB 2Z2YB 3OTBA 4IG3A 3T1HF 1M1GA 2IC3B 1JLBA 5EHHA 4I6WA 3PYEA 2NREA 2BVZA 4NLWA 2VQEF 4ZVOB 3W7BA 3R27A 4H4KA 2MZSA 3HVTA 3D6MB 2PMZD 1FX4A 2VHGA 4N8NA 3SMZA 4LR9A 3GLJA 1EKRA 3I56S 3U1LA 4LQ3A 3BGRB 1YGYA 1N48A 3MHYA 4DF8A 2XSJA 1RWUA 3PYGA 4RUCA 1WEYA 1Z2LA 4ZCKA 3CC4S 3OFFA 3CDWA 1X9WA 3DOKA 2HRYA 3K5MA 2YKAA 2IA6A 4AL6A 2DHXA 2Z56B 4B02A 4HYKA 4OL8A 2APOA 4QBUA 2RRAA 2AKWB 2XHWA 3D3BJ 3MEGA 1IKXB 4NA2A 4F3MA 3W2WB 4ED5A 3LGMA 2NZ4A 2EBEA 4ZITA 4XTTA 3KHRA 1VC6A 4ZVTB 2QX0A 2UV8G 1JLCB 2ZFHA 1H3DA 3EGNA 4DX7A 1DFDA 3M6UA 2OPQA 2WSCC 4KGZB 5CYMB 5GAHU 2F3JA 4CLUA 2JRSA 4KPCA 4LF8F 3C6UA 4ES2A 3DDKA 2DR8A 2HHQA 4DX6A 3LGHA 2YWWA 4UUWA 2Q6CA 4YB1P 1QLNA 5GADU 3VVTA 3QO9A 1L3SA 1QSSA 3M8PB 5FDLA 4B9MA 3K5NA 2WTFA 1SC6A 3PX4A 3DN9A 2HFVA 4QWEA 2BRLA 3UI3A 3Q86A 2CQCA 1URRA 2BJDA 1G1XA 2CQ0A 3LWMA 3T5LA 1UVMA 2X1GA 4F7VA 1P1LA 2DEIA 5DDRC 1JJCB 1CSJA 1FFSB 1X4EA 2D3UA 1KQFB 4H4MA 2LXIA 4U95A 3NG8A 4R5PB 4EUVA 1U1PA 2M2BA 1TUWA 2FIUA 1FK9B 4JV0A 2ASLA 4ZP6A 3NRBA 1RT4A 3FJ2A 5J2QA 3FKBA 4DR3J 4DSIA 3RB0A 4DV1F 1XTZA 5IZHA 1MWQA 4QIEA 1BMQB 1TL4A 5LOQA 2JEJA 3ILJA 5DGBA 3IM9A 4O3OA 2DXEA 4ZHRB 1OY8A 2XS7A 3UO0A 4CLZA 1YWXA 1LK7A 1HR0J 2ILZA 2E9ZA 4QYZK 3PJ9A 4EK2A 1L3KA 2RQMA 1RCXB 1FDNA 2E7VA 4O44A 4B3MJ 1RTHA 3OD2A 1KONA 1F9HA 1XK8A 3JQMA 1HHSA 1S7HA 1RBOB 2JC1A 3HSDA 3TEGA 4DS4A 4X65F 1NK7A 1JKHB 2Q43A 3DKDA 4IYQA 2OIHA 4RW4B 3MR2A 4USTA 3BS9A 5E3CA 4LF4J 2Z4PA 2WONB 3N79A 3IS9A 2GCFA 3ET6B 1N52B 5KFMA 3I32A 3RJMB 4ID5A 2P5VA 4KC5A 9RUBA 1NZ8A 2H5JB 2IMWP 2BRKA 1A6LA 3GCWP 3FBEA 3OJSA 1PO6A 5BYSA 1RXOB 3EZ5A 1C4AA 2KDOA 4WFZA 3BGFA 5I42B 4UZCA 4YDDB 1TK0A 1U1MA 3I87A 1OQ6A 4JI6J 1HBNA 3H0PA 4GMKA 4ZPCA 1IBCB 4Y2MA 2DGOA 3CJ8A 1QD1A 3BBBA 3O2IA 4GC6A 4DSKA 1W26A 2ZEJA 1GEHA 2D3O1 1S0OA 1MNEA 4J9RA 3NNCA 3T5KA 4TU9A 2DNYA 4Y2KA 1FX2A 3QRPA 2YNFA 3AXMA 1FEEA 3ENWA 3TR5A 2X1AA 4ECSA 2J9CA 1LW0A 2HHHJ 4EEYA 2M4MA 4MIWA 1HMVB 1Y10A 2B7CB 4YEAA 2W4PA 3FK4A 2V50A 3M6XA 3D2WA 3J7AN 3V6DA 1CG2A 1NDLA 1V3ZA 5T7LA 1CJUA 4ZCLA 2VQFJ 2IIHA 2FJXA 1NUEA 4MH8A 4DCJB 1LWEA 4J37A 2IFXA 2FC9A 4K4YA 2B5JA 1YJRA 3OSNA 2YWEA 4EO8A 2QIFA 3HLUA 2MDAA 4NLTA 4CLPA 2XZTB 1FWLA 4HACA 2W7AA 4M5NA 3NOGA 2QLXA 1AB8A 4ZKAA 1U09A 1C1BA 3EGWB 3PHEA 1VRQC 2HURA 2IA0A 3VGSA 2XY5A 4F4WA 3OVSA 1NKBA 5HI7A 2HNDB 4M5JA 1U1NA 4AE5A 3IAS9 1VQOS 2YNIB 1TKZA 2FHKA 5A8WA 1MU2A 2H1YA 2O67A 1QAYA 5HJXA 3LA0A 3MM8A 5HQMA 1RYRA 1CJVB 2G2YA 3GJSB 3PIOQ 1HW8A 2ZNYA 3VAMA 1H74A 1JLAB 4DOZA 4OYMA 2MZQA 3A8EA 4EGLA 4RW7A 2W7OA 1FRHA 1UZDA 4AT1B 4L72B 4PG5A 2B9EA 5A8KB 2HMIA 3MEDA 1IR2A 1RT2B 4GVBB 3CJ0A 1DZ5A 2DXDA 4Y00A 4AQYJ 2JH3A 2CRLA 2EPIA 2UUBJ 3QAUA 4IRDA 4G3IA 4DPUA 2WOMB 1SQGA 5C5JA 2CVIA 3ZZYA 3FEYB 5HO4A 3H40A 5E41A 3D68A 3HFZB 3H5YA 2RU9A 3HKZD 2BOAA 1PAEX 3ZZTA 3HO1A 3UE2A 3KLVA 5D0HA 5M2RA 3NNAA 1EQMA 4EO6A 4FBTA 4DR3F 4FZVA 1W7WA 4ZPWR 4FNIA 4KH1B 5E7OB 1X4HA 3QJPA 1YBAA 3TI0A 2ZOGA 4NA3A 4P6QA 1P6TA 2BANB 4NXMJ 3AAWB 1HR0F 4LVOP 1KKHA 1RKIA 4PYAA 2OI2A 4U7UD 3GTYX 2XBPA 1I94J 4B3MF 4NMLA 3BSCA 2JWNA 2KN4A 2UZAA 3MM7B 3KKFA 3ELHA 3M2VB 1TV6B 4WZQA 7AT1B 1NB7A 3MEEA 3DRYA 4CI0B 2QGFB 2HSEB 1BWVA 2ZDPA 3I4PA 3TARA 1JJHA 1JLEA 3CMAS 4KHPJ 1RABB 4LF4F 4Q7AA 4UQTA 2F40A 3CCSS 5IFMA 2Y0BB 2DJWA 1S1VB 2FVSA 2RB7A 2P6SA 2M8DB 1GXTA 2ATLA 1PYTA 5FLXU 1U1LA 3C46A 4RU2A 5L46A 3DGPB 3IA0A 2W8KA 1LWFB 1IXKA 2VASA 1EZZB 1YJTA 5F8JA 4DSLA 4LRAA 4L3KA 3OLBA 1RT7A 3LW5C 3G82A 1FDAA 3HULA 2GVZB 1VISA 2H54B 1N6QA 2KXHA 1RAHB 3OL6A 2AV5A 2U1AA 1RE1B 2G2OA 4JI6F 2GGPA 2BW2A 1NK0A 4B3OA 3BSOA 3PDNA 4NCBA 3GR1A 5EDWA 3FFIB 1S1UB 1U02A 4IOCQ 1ZOTA 3T9ZA 3HVRA 3DU6A 3Q24A 4E2FB 1JIHA 2VOOA 2JFDA 3GR0A 2HAFA 1L3TA 1ITPA 5KFKA 3OR2B 2XMUA 3B8HA 3HHLB 3A3PB 3B54A 1AXQA 2G2ZA 3VVUA 2G9OA 3KK1A 2DT9A 2HHHF 1SPBP 2C2MB 3TP2A 1ZTWA 2DIVA 4EZ6A 1B7FA 3DYAB 2ZOFA 4OZ5A 2DNPA 3P5TL 5GAGI 1CULB 4HKQA 2KYXA 2K7JA 2AX1A 3KYLA 3K17A 2HVHA 1TUGB 4K59A 3CDUA 1HD1A 1S6PB 3C14B 2VQFF 4UF4A 4Y65A 3L9ZA 2EFNA 4QYZJ 4KKOA 2AGPA 3R5CA 3CJ3A 3KLEB 3TX8A 4CZCA 4OYPA 1WWHA 3KUEA 3GILA 4KTQA 4LRFA 3TVYA 1RTDB 3FGVA 2CPEA 1BQMA 4O4RA 5ETNA 4M8LA 1UJ4A 1XN9A 1S0MA 2KT3A 4M1KA 5KG5A 2Y0SD 3E01A 4RU9A 4PPDA 2D3ZA 1TQLA 2WB4A 3AB4B 2W2MP 2DTJA 2KTQA 3SSRA 5ETOA 3C66A 5D0RA 3JXOA 3G96A 4CH0S 4BDPA 1FD8A 1N0VC 3B6BA 1S99A 1VFJA 1IQTA 2DVIA 5D8HB 4PWDA 4PAAA 2HS0A 2NXEA 1RLDA 4CQ1A 4JYAJ 3DM2A 3MAHA 2YWKA 2ALYB 4AQYF 2XLJA 1J5OB 1FKPB 2UUBF 5IC6B 2Z30B 4DL0C 2Y1LB 3MPWA 3W5ZA 4I2QB 3G8TA 3M2UB 3PW4A 2RDIA 2RRBA 2DR5A 4CNZA 1HBOA 4ETZA 3KOAA 1Q5YA 2A3JA 2W9CB 3SCLE 3G8SA 2HZAA 2OKQA 2GQQA 2GIFA 3T6JA 1B0VA 2DNRA 3B4DA 3JSYA 5HATA 2WAQD 3RGIA 2Q1LA 2C42A 4NXNJ 4HT5A 4NXMF 2R4FA 1KDNA 1DQ8A 1RTIB 1SVDA 3QT8A 4CT9A 3EVWA 1I94F 4RW6B 2CFXA 2YQ1A 2MZJA 1IUJA 1X4DA 3RB4A 4DUYJ 1T7PA 3BF4A 1ACMB 2DNGA 5ITHA 3IN5A 2XCPA 4KHPF 4ZLNA 2NSBA 4WYWA 2IRXA 1HBMA 3L7PA 2RRNA 2R7VA 5KFRA 4ANEA 4KAIA 2PEHA 4RW8A 3R5AA 2NYHA 1RK8A 9ATCB 3DLGA 3DRPA 3DNCA 3I6PA 2OAUA 3MECA 2R3VA 3QWUA 4HEA9 2V2KA 3RB3A 2CPHA 2E5LJ 1YBUA 3CJ2A 5LMUJ 3M8QA 2Z2ZA 4UZBA 1SIWB 3OFGA 2BR0A 4F0KA 3GJTB 2RJZA 3FCVA 1TTHB 3UD3P 2Y1IA 1HNIB 3EUNA 2ZD1A 2LU2A 1RAGB 1S9GB 1IKWA 4WFNQ 4NYOA 2OEMA 3V6HA 2VF3A 4HHHA 1Q82T 5E3QA 2RU3A 3EPGA 4MFBB 4ED6A 2VB6A 4O4GA 3MMAB 4FDFA 3NS6A 1M90T 1SQFA 1N88A 4C3LA 2HGNA 4KSEB 3ZZUA 1HBUB 3KLHB 3O5TB 1SJ3P 2CPJA 2KYZA 3OTCA 3BKTA 2MY7A 2ZBIA 2L48A 2O5DA 5A0YB 1SCJB 3QQCD 5LL6d 3E8OA 3CTRA 1NAQA 1WJ9A 1YRXA 2OGUA 4FS1A 2V6AA 4MTPA 3RRGA 1VQMS 3UNYA 1TMMA 4MIBA 5DG8A 4FYXB 1XEZA 2MGZB 4KV8B 1OY9A 3GQCA 3J7ZT 4DR7J 3UNGC 3RYLA 4KPYA 3F0NA 2LFVA 3Q2SC 4RLEA 1CJKB 1FRLA 1UZHA 3D7SB 2XTJP 2AEMA 4HVZA 3MURP 4D3GA 5L9XA 3RRHA 4ES3A 1IJEB 4XDCA 3P45B 1RA7A 3VAIA 4WK1A 2C2EA 2DPJA 3LP0B 2DGSA 2EC0A 2JEFA 2ADCA 1S6OA 2QYGA 3Q83A 2AJ4A 3BQ2A 1RTZA 2K7KA 1Q8IA 1EETB 2EFVA 2EWHA 2VBXA 4OI0A 1NDPA 3DRXA 1TMJA 1VQLS 3EICA 4RNOA 3QLHA 2J9EA 2DH8A 1DTTA 2IC3A 1RB0A 2M52A 4K4XA 2XLIA 4OHVA 2V2ZA 5U47A 3BH7B 4YFUA 3MPDA 3R7NB 3KJQB 5AXNA 2M7SA 3NBPB 4JYAF 2XYGB 2A10A 4I7FB 5LJ5Y 2RDDA 4Y2CA 3BJYA 3WQPA 2UU9J 2BE7D 3S7RA 2X51A 3QNWB 3BGRA 2VG5B 2DK2A 2ZZNA 4MIAA 2PD1A 1CLFA 3MCOA 4EFAC 2HVIA 3JS9A 1V3RA 3PX0A 1QUVA 3I0SB 2LEPA 1XMOJ 3RAMA 3ENAA 2A1BA 3QGPA 3IG1B 2VDHA 3SCKE 4F67A 3QBCA 3TJ9A 2ZUGA 5D4PA 1XNRJ 2HLUA 1HLWA 1S48A 4NXNF 3W2WA 3D66A 1GX5A 4TLRA 1UVNA 2IJNA 2E1AA 1U45A 3QWPA 5CYQB 4OHZA 1JLFB 4XDDA 3GJRB 3VAHA 2G0JA 3QFWA 3UVJB 5DG9A 2CJYB 2CNKB 2H51B 1JLCA 4C7QA 4LIWA 4DUYF 3PW7A 3R7BB 4PUOB 2MB0B 5BYRA 5CYMA 1TKTB 5HQ8A 3CJRA 4LSZB 1H98A 2IYIA 1XMQJ 1RYSA 2MQOA 2LKZA 3Q89A 5T41A 1YTYA 1XR6A 3O1LA 2MQMA 4URGA 3W2VB 2YX1A 2MHEA 4UOCA 1AA1B 2DRAA 2J6SA 1QDUB 1BHNA 1D09B 3G8QA 1IBMJ 3TZZA 4C8ZA 4DUZJ 5D3GA 1C0UB 3N01A 2FY8A 1ZPVA 4ELVA 5G4DA 2E5LF 5LMUF 4CLWA 1R8PA 2QMWA 5J2PB 3OL7A 2I6WA 4OJ1A 1HKAA 3HK2A 4AL7A 5RUBA 1X4FA 1KN6A 1LNQA 1YQHA 2OLWA 1S72S 4RUAA 4DQPA 1T3OA 4A8OA 4ZIWA 2EK6A 4PEOA 2ZH1A 2VFSA 4R5PA 2AYBA 1VC5A 2C3YA 4ALZA 4FF2A 4ECTA 2XMWA 2N4DA 3BDPA 3NAHA 3CCZA 2YKNB 2HZCA 4A47A 3MCSA 1SJFA 4KT0C 3X3UA 2ROPA 2QSWA 3DXSX 1RQ0A 1R8HA 5B0GA 2F8MA 2ZJQQ 4M5GA 4ZHRA 2AD9A 2MKYA 1U1KA 3H59A 1EP4B 1UFLA 1H72C 2VFRA 5F8NA 4ZIVA 1OS5A 2YPZA 2JLGA 4DR7F 2JFKA 4ZVPB 2IVYA 3KNAA 1JKHA 4N7TA 1KP6A 4OYZA 3D6HB 1D8ZA 4RW4A 4ZVHA 5M2UA 3R8YA 2WONA 2GHVC 3OV7A 5KG1A 3NY0A 2GZOA 2X3GA 3DCAA 4JI7J 2RHSB 2MQNA 4EMDA 3SI8A 2XG8A 2DNNA 1P8GA 1YKWA 2EEYA 3EGZA 1OY6A 4DWIA 4DL3A 3HMJG 2WVDA 3MFHA 2NXUA 4X4PA 4LFAJ 2YKOA 1DHMA 1VQYA 3HJFA 2R9LA 2YWHA 3ULHA 3S8SA 2EFQA 3GYGA 5E2QA 4ZLJA 2Y3YA 1GTEA 4URQU 3Q22A 3M8WA 4KR0B 3AJ1A 1QTMA 3DI6B 2B4UA 1PJ5A 1LV5A 4CM2A 4ECVA 3C15A 4UOHA 1WDTA 2BV3A 2A6OA 3GIKA 5FD1A 2QL7B 2ZBRA 5DLGA 4JI2J 3NS5A 4ZPTR 1KTQA 1T3NA 1NNDA 3RUBL 1TL7B 2XY6A 2XMKA 2R8IA 1T05B 2FZKB 2AZ3A 4QR1A 2UU9F 4WWSA 3M2RB 2FVRA 3PIPQ 3PW5A 1G4CA 1V3SA 1HMVA 4JI3J 1TL1B 2YNGA 1KD1T 1RP5A 4YB6A 3LP2B 1T0TV 5CD4A 2EKNA 3KLGB 1U0HB 4ES1A 4I0WA 3VGUA 4X4NA 1UTAA 3GYXB 4LQ9A 1XMOF 2YH1A 1N36J 3PEJA 3HP6A 2BKPA 2CKWA 1KBRA 2DITA 5HP1B 3PRDA
chains in the Genus database with same CATH topology
2EXUA 1NPRA 2XHCA 3LPEA 2LQ8A 4ZN1A 2OUGA 3EWGA 1M1HA 1M1GA 2K06A 3QQCD 4ZN3A 1NZ8A 1NPPA 3P8BB 3H7HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXU A;  1NPR A;  2XHC A;  3LPE A;  2LQ8 A;  4ZN1 A;  2OUG A;  3EWG A;  1M1H A;  1M1G A;  2K06 A;  3QQC D;  4ZN3 A;  1NZ8 A;  1NPP A;  3P8B B;  3H7H B; 
#chains in the Genus database with same CATH topology
 3KJF B;  1XNR F;  4KB7 A;  4ED8 A;  4WU2 A;  5C25 A;  1NSQ A;  1VBK A;  4LIR A;  2DEJ A;  4NE9 C;  3K5P A;  5CQG A;  4OJG A;  2Z2M A;  2DGU A;  2LDY A;  4FVC A;  1EAR A;  2GO9 A;  2P9E A;  1S79 A;  2XMM A;  2ASD A;  2H48 B;  4IDK B;  3HHL D;  4KO0 B;  2VG6 A;  3AOD A;  3TO8 A;  4QPT A;  2HND A;  4RR5 A;  5B7W A;  2YNI A;  3ZZP A;  1XMQ F;  3M32 B;  3CJK B;  2CZ9 A;  5LMN J;  1V5V A;  4QYR A;  3TZY A;  5GAG U;  4ECZ A;  2NCK L;  4ED0 A;  4X4S A;  1U0S A;  5MLC V;  2PSZ A;  1S1X B;  3WC2 A;  4IH6 A;  5AT1 B;  2BW7 A;  1V5I B;  1IBM F;  3GMG A;  3G4S S;  3C6T A;  2LDI A;  1LXJ A;  5KFF A;  4DUZ F;  1XNQ F;  3R3T A;  1YJU A;  4FXW A;  5A8K A;  1B64 A;  3I31 A;  4DXL A;  1RT2 A;  4CLF A;  4RPF A;  4S0M A;  1U1O A;  3LPY A;  3ZTQ A;  2IMO A;  1NK6 A;  2QC3 A;  2WOM A;  4KYZ A;  1X4B A;  4JI8 J;  2ZM6 J;  2DIS A;  3W1Y C;  2EFP A;  3KK3 B;  4TNO A;  1ELO A;  1L3U A;  3OTO J;  3MMJ A;  4YQW A;  3VAF A;  4OZ1 A;  5JUM A;  2IBK A;  4O3P A;  1UJ6 A;  2J9D E;  3AA9 A;  2XY7 A;  3L7U A;  3L7O A;  1LK5 A;  1VK3 A;  4O3S A;  5E3A A;  5B0A A;  2GNK A;  4ZLP A;  4P73 A;  4QIV A;  1KLN A;  1NRK A;  1NK5 A;  3BGL A;  4M5D B;  3A13 A;  1ARO P;  2BAN A;  4LRD A;  5L39 A;  3MR3 A;  3TUZ C;  1IKY A;  3I82 A;  4YR2 A;  4M5K A;  3MM7 A;  3DLE B;  2ZZT A;  1DTQ B;  4WIQ A;  3M2V A;  2CAD A;  4YY3 J;  3MR6 A;  2X1B A;  1HAR A;  3CJS A;  3QFH A;  2B8P A;  1Q8B A;  2HNZ B;  1PAU B;  1BWE A;  1AUS L;  3GFX A;  3LO3 A;  1A0O B;  4C8K A;  2FLO A;  4LFC J;  1S1V A;  4QPX A;  1KEK A;  2VIH A;  4ZJO A;  4JI7 F;  2KFN A;  3K57 A;  4OZ3 A;  3T1Y J;  2QTW A;  1VC0 A;  4TYA A;  3DGP A;  5K9F A;  1LWF A;  2XMJ A;  1CJT A;  4OIX A;  1RUS A;  3PR5 B;  4LFA F;  3BR8 A;  2V9W A;  3VGT A;  1FNO A;  2VIC A;  1TVR B;  3GB0 A;  1ZAV A;  2GVZ A;  1J5E J;  1SXL A;  2YWG A;  3ENV A;  3GIM A;  5EWG A;  3J7Y U;  1REV A;  1AFJ A;  1U2R A;  1Y3J A;  3DRS B;  2UVV A;  3FFI A;  4HHJ A;  3N4W A;  1ZM2 A;  1RI7 A;  1S1U A;  3RW6 A;  3PKY A;  1TKX B;  2VUG A;  1U26 A;  2JOQ A;  1O6X A;  1K0V A;  4BHQ A;  4A46 A;  3DMJ A;  2M70 A;  4UW2 A;  1K8A T;  2B4V A;  1UFW A;  3OR2 A;  5CXT A;  4OHW A;  1VQS A;  3I5A A;  5GME A;  3HHL A;  4JI2 F;  2CNN B;  4X4R A;  4USJ C;  2GV1 A;  2XGP A;  5CHC B;  1MML A;  1FJC A;  1R8C A;  3UR0 A;  2HHT A;  2GVD B;  3HX9 A;  2NZC A;  4K4W A;  2VH7 A;  3FVY A;  1UA0 A;  1BC6 A;  4JI3 F;  2RQ4 A;  4GRS A;  1SJR A;  2UUW A;  3DOM B;  1CUL A;  2CQ1 A;  1TFW A;  3QZ7 A;  3GSI A;  4I2P B;  1S6P A;  3K7R A;  3C14 A;  3UCZ P;  1N5V A;  4NLO A;  5ETM A;  1N36 F;  4FXD A;  3KLE A;  2BZ2 A;  1Q0N A;  3WZ0 A;  4K4V A;  1SQE A;  2RNE A;  3HHE A;  2I0X A;  2MLX A;  3K58 A;  3V4I B;  1OWX A;  4WFX A;  1RTD A;  4GC7 A;  1W2I A;  3H42 A;  1NPP A;  2B6A B;  4DR5 J;  3MI7 X;  3TVZ A;  2MKC A;  2GIQ A;  2FYX A;  2R8G A;  1X4C A;  2V34 A;  2Q6B A;  2BAC A;  3P4U B;  1SKR A;  1ZAW A;  1G7C B;  2CQG A;  3LAK A;  1CQN A;  1IBL J;  3PXG a;  2CDQ A;  1HQU B;  2QRR A;  4A8Y A;  2HYI B;  3IGV A;  3W9H A;  4H4K C;  4A8S A;  4NLY A;  3OUY A;  1RAO A;  5ETP A;  2VC1 A;  4USI A;  5LMN F;  2ACY A;  4IG0 A;  3I5B A;  2HHX A;  1Q1K A;  4EZ9 A;  1NME B;  2ZH4 A;  3QYY A;  1S1W B;  2BUN A;  2VC0 A;  4O0N A;  4NA1 A;  3UDL A;  4CYU B;  2RUS A;  5EWF A;  2CJX B;  1PKU A;  4J9O A;  2P9G A;  3CCT A;  2AYE A;  2HFU A;  3L4B C;  2IJF A;  2GHW A;  5K8O A;  3ICL A;  4ILM A;  1URN A;  2A6M A;  1YRU A;  4HTI A;  3T1A A;  1MRO B;  2IAJ B;  3MUV P;  2PMH A;  1H38 A;  4O0I A;  3NOC A;  2PDA A;  4DU7 A;  2VPX B;  4JI8 F;  2ZM6 F;  2ZVS A;  1ZM3 A;  2R7T A;  4I2Q A;  2HRU A;  3OTO F;  1MN7 A;  4LSL B;  2RF2 B;  1YJ7 A;  2K1R B;  2RSQ A;  2BXJ A;  3G6E S;  1F5C A;  5FLX Y;  3TAQ A;  3BKU A;  4OQJ A;  2CAJ A;  4K8R A;  2W9C A;  2F9D A;  2AQ4 A;  1PBA A;  5I3U B;  4OJ3 A;  3TWZ A;  5GVQ A;  1OYD A;  5JMN A;  3HFV A;  4FVM A;  1PG5 B;  1V9O A;  3I5C A;  4OX6 A;  4NAS A;  3PHT A;  2V4Q A;  2R7U A;  5HVH A;  2Z2L A;  3D6F B;  2WBM A;  1X5S A;  1MW7 A;  3IWN C;  4OI1 A;  1RTI A;  3AT1 B;  5B08 A;  3DLL Q;  2GA7 A;  2BDP A;  3OT9 A;  4DPW A;  4FF4 A;  2DGW A;  4PRF A;  2H3E B;  5EWE A;  1SJ1 A;  3PW0 A;  4OZJ A;  4WBF A;  3EX7 B;  3LAL A;  2E1M C;  1KNZ A;  2DBB A;  4M5H A;  4CLY A;  4YY3 F;  3WHI A;  5L9N A;  2WW4 A;  2W2N P;  2CNL B;  3THP A;  2MJN A;  2FVP A;  4LFC F;  5IS2 A;  1N32 J;  5D15 A;  3O44 A;  3FZB A;  3T1Y F;  2CG8 A;  2KT5 A;  3PAC A;  4Q8F A;  3O8W A;  4RNF A;  3HVW A;  4QZV B;  1YHQ S;  3OVB A;  4PWU A;  3T9N A;  1NK9 A;  3Q8R B;  5KFQ A;  1H7W A;  4C3K A;  2I38 A;  2DXF A;  2LYV A;  5HQL A;  2AYG A;  1F5B A;  4V19 X;  1J5E F;  2CPX A;  1NLK L;  2JNJ A;  3U02 A;  2AGO A;  2B7B B;  1NH7 A;  1CVJ A;  1HNI A;  1RAE B;  4JI1 J;  4FP9 A;  4DZD A;  2JVR A;  1UET A;  2EFO A;  5A6W A;  5E33 A;  3TAM B;  1S9G A;  2AMC B;  4TU8 A;  1FRM A;  4NX9 A;  1SIZ A;  1RSC A;  2MY8 A;  5F9L A;  1X31 C;  4WCE Q;  3S6E A;  4FPR A;  1YLX A;  3W65 A;  4MFB A;  2QA4 G;  3I9V 9;  3JTO A;  1HFE L;  3WC0 A;  2KB2 A;  3CC2 S;  2RIL A;  1CBK A;  3GV8 B;  2V8V A;  2B4O A;  1FRK A;  2CQI A;  4TKT A;  2HK2 A;  3CUL A;  3M30 B;  4C3M A;  3JQJ A;  3QPI A;  4DPT A;  3PG9 A;  4DLG A;  2NS1 B;  5A0Y A;  4B3T J;  4IOA Q;  5HBM B;  3BKF A;  2C3M A;  4L75 A;  4OI3 A;  2N7C A;  5IT9 U;  1UW4 A;  3IRX B;  2QL9 B;  1EHW A;  1S4F A;  5KFO A;  3CVK A;  3CD0 A;  2MGZ A;  3MPU B;  1FE4 A;  3GFY A;  1XR7 A;  2XZW A;  3GG0 A;  2N3L A;  2JHE A;  4L73 A;  1U6F A;  4IFY B;  3CCW A;  4H4O B;  1RZM A;  3EXC X;  3M8S A;  2KM8 C;  3MTK A;  4QIW D;  1RT5 B;  2R7W A;  4ZJQ A;  4PQA A;  1FXL A;  4LRE A;  3R2C J;  3P96 A;  4DR5 F;  1QE1 A;  3CJT A;  1G2E A;  1JLB B;  3EJM A;  4LF9 J;  2EVZ A;  4J9P A;  3CUN A;  1FJE B;  3QT7 A;  2OML A;  1IBL F;  3TYT A;  3LP0 A;  3GIR A;  5DLF A;  2D69 A;  3HVT B;  3SCI E;  2FJB B;  4LVN P;  4C0O C;  2MQQ A;  4Y6I A;  5EX3 A;  1S57 A;  1LEO A;  2CWK A;  2PI5 A;  2EXU A;  1HNV B;  1RDR A;  1PYO B;  4GKK J;  4DL4 A;  3R1L A;  4HHU A;  4CNY A;  1VRU B;  3SDE B;  2XSJ B;  4AND A;  1S49 A;  5F8H A;  1Y4Z B;  2XI3 A;  2FZC B;  2HQC A;  1GXL A;  1PIL A;  2ZOM A;  3TUP A;  4A8F A;  4OHY A;  3NBP A;  2DR6 A;  5D4O A;  2FVQ A;  1REG X;  4PYD A;  4JI5 J;  1S9E B;  4DV4 J;  5KOW A;  4X62 J;  5HMY A;  1KFD A;  3TZX A;  1B7Y B;  1PC5 A;  3WDO A;  2JJ4 D;  2YKQ A;  5GMK a;  1HWU A;  1AYE A;  1RKJ A;  4USK A;  2VG5 A;  4CO0 A;  1EB0 A;  1S9F A;  1WC5 A;  5FII A;  4ZVQ B;  1HPZ B;  1Y5N B;  5DZ7 A;  4K7Q A;  1E6V B;  3G2X A;  3US5 A;  4BBY A;  3E2E A;  3CB4 A;  2HFZ A;  2OPQ B;  4ITS A;  5DQI A;  1WSV A;  4K50 A;  3I0S A;  4NLX A;  2D7S A;  2RML A;  3AD7 C;  4HDH A;  2Z8Q A;  5AE3 A;  4WP3 A;  4CT8 A;  1R0C B;  4DQR A;  2DY1 A;  4CM0 A;  3K89 A;  2VPZ B;  2HGL A;  2ZH8 A;  4OV6 A;  1JLF A;  1SUQ A;  3NCR A;  2OJ3 A;  3UVJ A;  3QO9 B;  4CLL A;  1VJQ A;  3A3O B;  5KFC A;  3V2U C;  4E8U A;  4KJI A;  1U1R A;  4NZ7 A;  3HSG A;  3CGI A;  5JVH Q;  4PUO A;  1RT1 B;  3D1O A;  3FQK A;  1VLY A;  4KFB B;  1TKT A;  1Q5V A;  4ATN A;  2DNH A;  4DX5 A;  2X3D A;  2FHJ D;  2F65 A;  1X9S A;  4DUT A;  3HCX A;  4TY8 A;  3LOU A;  2A2D A;  3SZ2 A;  4NLU A;  1XBW A;  1VHF A;  2HW3 A;  1N32 F;  2BM0 A;  3VV2 B;  3IR5 B;  3W2V A;  1AT1 B;  1K9M T;  2KXN B;  2ZBC A;  4F0H A;  4H4M B;  2J0W A;  2IM3 A;  2OPR B;  3MCM A;  4P2X A;  2BKN A;  1WOP A;  3DLJ A;  1B4S A;  4WYL A;  1KHW A;  2EI5 A;  1RT4 B;  4G6V B;  4IRC A;  5J2P A;  1N4L A;  2HNY B;  3V4M A;  1VHI A;  2DNQ A;  4WJB A;  2JEG A;  3QRR A;  2XWY A;  1YJW S;  2YXL A;  3AD9 C;  4CWB A;  2HWT A;  1JXL A;  4ZS6 A;  2D1C A;  4JI1 F;  1F6T A;  1RWN B;  4O3N A;  2F8H A;  2KJW A;  4FKY A;  1KRP A;  1LQ9 A;  4YR3 A;  4X4O A;  2YPY A;  5KFA A;  1NH8 A;  2AGQ A;  2R2S A;  4LFB J;  1YJV A;  3JB9 k;  2QJ3 A;  5B09 A;  1O51 A;  2BM1 A;  1EKS A;  2F5G A;  1H2V Z;  1VYA A;  4DL2 A;  2OFH X;  2YKN A;  1FEH A;  2AEF A;  4YDX A;  4JI0 J;  2E7X A;  2HQ3 A;  2I1R A;  3S01 A;  4QU6 A;  1S7I A;  2P9C A;  3PM9 A;  1NDK A;  4ED4 A;  4O3Q A;  1NJY A;  1RT6 B;  2J6T A;  1FNM A;  3DOL A;  3A8K A;  4B3T F;  2BJ1 A;  1UA1 A;  3U1M A;  2UXD J;  3KJV B;  1EP4 A;  3CDB A;  2OPP B;  2LXU A;  3ZFV A;  3NAI A;  4RW9 A;  4NEY A;  3CCQ S;  3P3D A;  3PYF A;  1GNK A;  2UVW A;  2FVC A;  4WE1 A;  1CC7 A;  5ETR A;  5LXY A;  3FUY A;  3A12 A;  2KM8 B;  4NPO A;  2BYC A;  1Y5I B;  1KLM A;  1BQN A;  5HN0 A;  4P10 A;  1RBL A;  5L38 A;  3PEH A;  4CDI A;  4LF9 F;  3QGG A;  3KXD A;  1FCA A;  4DJB A;  4P7V A;  2XHC A;  3DGV A;  1SL1 A;  4DFK A;  2FTR A;  3IFE A;  1F3V A;  2NQP A;  4Q2M A;  3PYD A;  2F7V A;  4FXV A;  1Q81 T;  1F5A A;  3AJD A;  4X64 J;  2YNF B;  1XWL A;  1HI8 A;  2OD4 A;  2VKR A;  1X5O A;  2ZBP A;  4K5R A;  3TQE A;  2QA1 A;  1LW0 B;  2G1H A;  2ZWP A;  3G71 S;  2AEJ A;  4GKK F;  2C2K B;  3TRG A;  1YBT A;  5CA5 A;  2HQF A;  3IMQ J;  4NLR A;  3DI6 A;  5T7L B;  3HHD A;  2F8E X;  1CJU B;  4ZP8 A;  5J1N A;  4XIU A;  1H73 A;  2VOD A;  1LWE B;  4JI5 F;  2CJK A;  1SC1 B;  2BQR A;  4DV4 F;  2WCX A;  2R7X A;  3QSI A;  1RWM B;  1WG5 A;  2FHJ A;  2IVM A;  5HJY A;  4X62 F;  3F73 A;  4YOE A;  1T05 A;  5KT2 A;  4X4V A;  2B56 A;  1ZM9 A;  4ZVU B;  2CIM A;  1TL1 A;  2XZD B;  1Q8K A;  3LP2 A;  4LBH A;  1HYS A;  4XPC A;  4FN5 A;  5IWA J;  2ATC B;  2YQ3 A;  2AHO B;  3CE8 A;  2NR0 A;  1Y0H A;  1C1B B;  3KLG A;  1U0H A;  2A2C A;  3TNV A;  2NUH A;  2NYI A;  2Q79 A;  5JXS A;  4KE5 A;  3KUG A;  3PFE A;  2HAI A;  2DCL A;  1MU2 B;  3QT6 A;  4HI2 A;  6FD1 A;  2V8H A;  4PQU A;  1TP7 A;  1B0T A;  3NLC A;  4B9S A;  1IKV B;  2D3O R;  2QN6 B;  3K0J A;  1FI4 A;  3K8V A;  4MAK A;  4DN9 A;  4MJK A;  3CWJ A;  5HVF A;  4OX7 A;  4OX8 A;  2HMI B;  4KO0 A;  3TA0 A;  4U96 A;  2CPD A;  1DRZ A;  3DRR B;  4U67 Q;  3MXH P;  3OTE A;  3QGH A;  3CJK A;  1TL5 A;  5D78 A;  1BXN A;  1P1T A;  3ZTS A;  2NXN A;  3C19 A;  4Y28 C;  3CED A;  3RBE A;  2EKY A;  3TEH B;  2J8A A;  1PBU A;  1KOO A;  1S1X A;  2C2D A;  1DAR A;  2UP1 A;  1FVQ A;  4ZPD A;  4J7C A;  4N5S A;  5H1S V;  4L74 A;  5BR8 J;  2MHN A;  3BPS P;  1SKU B;  1SV5 B;  3IBF B;  3BO2 A;  4HL9 A;  3DDN A;  2HGM A;  3PJX A;  4OYO A;  2AT1 B;  2E44 A;  1PGZ A;  3TJ8 A;  5LM7 E;  2ROE A;  1H2T Z;  2KO1 A;  4NEZ A;  5HAO A;  2R2T A;  1O8B A;  3FZ2 A;  3MM6 B;  3KK3 A;  2CJA A;  3BGO P;  3G87 A;  1PJ6 A;  1UAW A;  1VR6 A;  3VQS A;  1MWZ A;  3MF5 A;  4LFB F;  4KHM A;  3IR7 B;  1RJJ A;  3EGV A;  2Y8W A;  4I64 A;  2Q3P A;  1QUP A;  2B3T B;  4CLT A;  2JC0 A;  1IM6 A;  3MEE B;  3CPW R;  2HS4 A;  2OEJ A;  4RO0 A;  4JI0 F;  1JLE B;  2MQP A;  1SH2 A;  3HZE A;  4W90 B;  2W9B A;  3QID A;  4JOU A;  2R2R A;  1I5O B;  3CME S;  2VKZ G;  3IM8 A;  4PXC A;  2HQD A;  1RWK B;  4M5D A;  2M88 A;  4HTJ A;  1D8Y A;  4TU7 A;  4ED7 A;  3V81 A;  2UXD F;  1FT8 A;  4DBQ A;  5DGA A;  4EBE A;  5HSP A;  5G0R A;  1SL0 A;  1E6Y A;  2R8K A;  1FXR A;  3DLE A;  4PAB A;  5KFY A;  3IGN A;  2ZHO A;  1RIS A;  2EG2 A;  2J7W A;  1N6Q B;  4J90 A;  1S0N A;  1R27 B;  2ZE2 A;  1X8D A;  3BPD A;  2WVF A;  4Q0B A;  1XC9 A;  2H5E A;  1LXN A;  3JQK A;  3BBF A;  4CO2 A;  4JV5 J;  3JSB A;  1HI1 A;  2DD8 S;  5D4L A;  3KG1 A;  4QWA A;  1D9F A;  3D6T B;  2DO4 A;  5IOL A;  3MWB A;  2DNM A;  4C9D A;  1N0U A;  3GPA A;  2FQQ B;  2DGT A;  1Q79 A;  5J2M B;  3W60 A;  1YK9 A;  1TVR A;  2OPS B;  2P6T A;  4X64 F;  1NKE A;  3O3L A;  2BX6 A;  3NP5 A;  4Q43 A;  2V2V A;  5ADZ A;  4Y34 A;  1WF1 A;  3EM1 A;  1GK8 A;  1TL3 A;  5I3P A;  1WHX A;  2DRB A;  2VFU A;  4ZP7 A;  1I3O B;  3K59 A;  3W9I A;  4GVL A;  4DR2 J;  2WVC A;  4HLB A;  2ZDO A;  3H5U A;  5KFD A;  1TKX A;  3EZO A;  5J1E A;  1JX4 A;  1NO8 A;  2PA8 D;  1NEE A;  4KKO B;  4J9L A;  3BN4 A;  3OR1 B;  2IYG A;  3QT5 A;  3VAG A;  2J0S D;  2AU0 A;  7FDR A;  3GV5 B;  3E51 A;  5KG0 A;  3IXQ A;  4QWC A;  1WDD A;  3J80 U;  4WTY A;  2N4C A;  2CPY A;  1VRT B;  3M1V B;  4JB8 B;  2FLN A;  2GVD A;  2N7Y A;  4P2F A;  2GJF A;  4KBI A;  4OYA A;  1SH3 A;  3J81 Y;  2FHO B;  5IWA F;  3DOM A;  2XYH B;  4JI4 J;  3PRV A;  1VCT A;  3THT A;  2W25 A;  3CSK A;  3M7V A;  4O3R A;  4C8O A;  4RNN A;  4F2R A;  1YJ9 S;  3K5L A;  2FUG 9;  3RR7 A;  1R0B G;  5CCL A;  1QY7 A;  5K8P A;  3HDS A;  2H65 B;  2O66 A;  2I8E A;  3UN5 A;  2H4Y B;  1U48 A;  2MXY A;  1PC4 A;  2B6A A;  1LKZ A;  3OFH A;  3T19 A;  1XMB A;  3ZZZ A;  5GAE I;  3OL9 A;  4PWD B;  1CC8 A;  2W2Q P;  2E9T A;  1X0P A;  2MPU A;  1N8R T;  2UUT A;  1TEL A;  3GP9 A;  4BWJ A;  1HQU A;  1X0F A;  2G0I A;  3VF0 B;  2GFF A;  1XR5 A;  1RWX B;  4NLQ A;  4C2M A;  2BKO A;  3VHQ A;  2MLZ A;  4F4Y A;  1Z2Z A;  1W2B R;  4A8K A;  4DR6 J;  3DHW C;  1JXV A;  1NJI T;  4KRW A;  4W4M A;  2V8P A;  3Q8P B;  3QJL A;  2AJQ A;  3ETM A;  4CYU A;  3MFI A;  5IV4 A;  1ZTT A;  1NJX A;  1HHT P;  1KR4 A;  2BJ9 A;  2V4J A;  5KFG A;  3BSN A;  2RKI A;  4OZL A;  4V1A k;  2UUA J;  5BR8 F;  3AHP A;  1F9E B;  5DQG A;  3JTP A;  1D9D A;  2NXC A;  5MAO A;  2FC8 A;  1MRO A;  2OFG X;  4ED2 A;  2IAJ A;  4K4T A;  3DFE A;  4ELU A;  5CAB A;  3CC7 S;  2BJE A;  2AP6 A;  3NWR A;  2MLY A;  4DDF A;  3IBC B;  3D1Q A;  3D0G E;  2KRR A;  4J9M A;  5H9E K;  3GON A;  3FSX A;  4LSL A;  2RF2 A;  2IY5 B;  1ICE B;  2YQ0 A;  3ISZ A;  4A4J A;  3TX0 A;  5KFW A;  4A8X A;  1S5Z A;  1ZA2 B;  1R43 A;  2QLJ B;  3ILI A;  1XER A;  3KJN B;  2QV6 A;  5I3U A;  3POT A;  1SC4 B;  4ZVR B;  4LF6 J;  2RVJ A;  2HVE A;  1GFW B;  1DQ9 A;  4F50 A;  1NJW A;  3I0R B;  1HBM B;  3PNI A;  4IFV B;  3M9O B;  2VU5 A;  4TY9 A;  1VJW A;  3N0V A;  2O01 C;  1U8W A;  2ZHB A;  3AA8 A;  1ZET A;  3DRP B;  5I4M A;  3G6X A;  1YG0 A;  1FES A;  3CJ4 A;  5ETQ A;  4X84 A;  1YDL A;  2GO8 A;  3M8Q B;  4RWW A;  1UL3 A;  3C16 B;  4CLK A;  1ZA1 B;  4Y2A A;  5F41 A;  2AJ0 A;  4J9S A;  4CTA A;  2GQC A;  1HQ2 A;  4ZA1 A;  5J2N B;  2HRT A;  4MK7 A;  2ZNZ A;  4C0B A;  4JV5 F;  3HVA A;  3BO4 A;  2CG4 A;  2LVW A;  2R8H A;  2GW8 A;  2EK1 A;  3FSI A;  3MUM P;  1PYS B;  3BQ1 A;  4MK9 A;  4X4T A;  3KHG A;  2C1E B;  2YBV A;  2PEB A;  3LQV A;  2OEK A;  4W92 B;  4O4G B;  4K2J A;  3KG0 A;  5KFV A;  1IN0 A;  1JNZ B;  4DPY A;  2M3D A;  5DG7 A;  1K47 A;  3UFC X;  2WSF C;  3ZTP A;  3MAA A;  2RDJ A;  4C98 A;  1F0X A;  3H8Y A;  2DH9 A;  2HQG A;  1QJH A;  4ZN3 A;  3MEK A;  4DR2 F;  2KZZ A;  1VQ5 S;  2W2O P;  5CYJ A;  2RS8 A;  3TAM A;  2W2P P;  1GMU A;  4U8V A;  3I4H X;  4OMF G;  4U9R A;  4DZ6 A;  4DHV A;  4IOB A;  3RBX A;  1D1U A;  3RB6 A;  3A1Y G;  3M9M B;  4PG7 A;  1RA6 A;  2IM2 A;  1BGX T;  2VZ9 A;  2EG1 A;  2E29 A;  3M30 A;  4ER8 A;  3J7Y I;  2VPW B;  1XIQ A;  3A8I A;  5HBM A;  1SI9 A;  3W64 A;  4JI4 F;  3AH6 A;  3IRX A;  5D0E A;  4DG1 B;  1ZS6 A;  4E98 A;  2PC6 A;  2LQ5 A;  3MMC B;  2FJV A;  4Y3C A;  4ECR A;  1S77 D;  3G9C A;  2A0F B;  3BBC A;  4IFY A;  4KGM A;  2NUU G;  4H4O A;  1OPZ A;  2G4B A;  1Q86 T;  1HNW J;  1KS2 A;  1JLQ A;  4UY8 5;  1RT5 A;  2B9W A;  1DLO B;  2MZT A;  3CXC R;  2HS3 A;  5KOX A;  3FMW A;  1DTT B;  3KMQ A;  5CD4 H;  4C11 B;  3VCD A;  1OSC A;  2HBY B;  5KT4 A;  4ED1 A;  1WI6 A;  2RQC A;  4B3R J;  2W9A A;  1UVL A;  2XB2 D;  1N5S A;  5DQH A;  2R42 A;  2XGQ A;  3CCU S;  5D4N A;  4GO7 X;  2DHG A;  4LF5 J;  3MPY A;  3VZI A;  3D67 A;  4UOG A;  2LLZ A;  1Q53 A;  3HSJ A;  3A4T A;  1WEZ A;  3CCV S;  4DR6 F;  4F2S A;  2J5A A;  3HT3 A;  1S1T A;  1VLO A;  3PO4 A;  3L09 A;  4OI2 A;  3R5G A;  1F1B B;  2M0G B;  1HNV A;  1YI2 S;  1N5Y B;  5KT3 A;  1AZS B;  2HFO A;  2LP4 A;  4B17 A;  1WHY A;  1VRU A;  1KHV A;  3SDE A;  2WVB A;  3EWG A;  5IM0 B;  2UUA F;  1WI8 A;  1YVF A;  1DBD A;  4WXW A;  3LF0 A;  4HH0 A;  3R5J B;  3IBW A;  3J7Z 5;  1FER A;  1GMW D;  3M4X A;  1S9E A;  4YS2 A;  4RL1 A;  1VQN S;  5KFL A;  4RUB A;  1YX2 A;  1JLG B;  3UCU P;  4NL5 A;  3ILO A;  2B9X A;  1TAU A;  4DR1 J;  2XUL A;  3AQP A;  2V94 A;  5KFB A;  1HPZ A;  1FWK A;  3CO0 P;  2Z57 B;  4ZOS A;  3Q0A A;  5A2Q U;  2ADB A;  4WXO A;  1E6V A;  1KFS A;  2I2Y A;  2GJ2 A;  2EFG A;  5KFX A;  3C2P A;  3FNN A;  4LF6 F;  2IRY A;  1C4C A;  3DHX A;  1U4B A;  3F44 A;  2O3D A;  2QLF B;  3GE9 A;  1UWB B;  2QO3 A;  3LGN A;  5E0O A;  3W5X A;  4FPI A;  1L5U A;  4OLP A;  3UDC A;  3TUI C;  3UD4 P;  3JSR A;  2V8D A;  3UCG A;  4MKY A;  1KC8 T;  1ZH5 A;  2MQL A;  1S12 A;  1PCA A;  4Q8E A;  1LFW A;  5D3G B;  3I9Z A;  2VFT A;  2HFN A;  4IO9 Q;  3GFZ A;  4J9N A;  2DPI A;  1MMD A;  3D1H A;  3JAM U;  1RT1 A;  2DHS A;  5KG2 A;  2G0C A;  2ZJP Q;  2YNH B;  2LMI A;  4OI4 A;  1HNZ J;  4KFB A;  2ZBQ A;  5KT5 A;  1IBK J;  1D9A A;  5C7P A;  4P2M A;  1EAY C;  3PFO A;  4AXJ A;  2MKK A;  1GQE A;  2E1R A;  1VBX A;  2OSR A;  3WX4 A;  4Z37 A;  4WU3 A;  3ITH B;  1RT3 B;  4K4U A;  3RG6 A;  2ZKU A;  2OPR A;  1UCN A;  4NZ0 A;  5C42 B;  4JV1 A;  3FEZ A;  5IT9 Y;  2PE8 A;  3WIV A;  1RAI B;  1RU1 A;  1R8B A;  2VA3 A;  1WKJ A;  1U6B A;  1BY9 A;  2HNY A;  3OXF A;  2DR9 A;  1RHR B;  1UJ5 A;  1M0S A;  2UXC J;  1RAA B;  3PY8 A;  3FMB A;  5B0B A;  1LW2 B;  2L08 A;  3NGR A;  4LT6 A;  2XM3 A;  5L1K A;  3IR6 B;  2HZV A;  3KK2 B;  3WX8 A;  2CNO B;  4OI6 A;  3QSY B;  3SFG A;  5EN1 A;  4BS2 A;  4HH1 A;  2QYC A;  2CPZ A;  3H90 A;  5H9E J;  1K73 T;  2ASJ A;  5EX0 A;  3NGS A;  3QJJ A;  2KKH A;  3P49 B;  2FGO A;  2GIR A;  1IKX A;  4CO1 A;  4DV0 J;  2XNQ A;  5KAK A;  4TYB A;  3NGK A;  5KG3 A;  1RT6 A;  3ZZ0 A;  2V8G A;  3VGV A;  2LEB A;  1OPI A;  4X4U A;  2EW9 A;  2POK A;  4OLO A;  1TFY A;  4USH A;  3KJV A;  2OPP A;  5SZT A;  4L3N A;  2PGC A;  2I5J B;  2HLT A;  4NRT A;  1PSD A;  4OX9 J;  3KNG A;  2MKH A;  4NWB A;  2CJQ A;  5DDO C;  1G6B A;  2C2Z B;  5KFI A;  3I96 A;  3VAL A;  2N3O A;  4WP9 A;  1GMW A;  4DCP B;  4KGX B;  1HNW F;  2MQ8 A;  4C8N A;  4C8Y A;  3VWS A;  5K20 B;  3D0H E;  5LSR A;  3ZNU A;  1DAX A;  4YN3 B;  2C3O A;  2CQD A;  5AJ3 J;  4B3R F;  2YKM B;  4WF9 Q;  3M8P A;  3C15 B;  3GU0 A;  2DGX A;  2FJA B;  3GII A;  1WD6 A;  3Q2T C;  3F41 A;  3W61 A;  4IR1 A;  4LF5 F;  2GHP A;  3UN2 A;  3ZNJ 1;  3NMR A;  2CZ4 A;  4P52 A;  2LEA A;  1U25 A;  5L1L A;  3HHL C;  4GO5 X;  1SKS A;  2HVZ A;  2ZH3 A;  2EBG A;  2HVD A;  3DXB A;  4I56 A;  1M5S A;  3BH6 B;  4B08 A;  5F9N A;  5LSL A;  2AWZ A;  1QAJ A;  2OUG A;  2YNG B;  3KDO A;  2GMH A;  2R7S A;  2L3M A;  1FK9 A;  3B78 A;  3CJ5 A;  4DPO A;  2M8H A;  3GZ7 A;  2YKP A;  2H9Z A;  1JQG A;  1WG4 A;  2D74 B;  1SH0 A;  3MMB B;  2NPI A;  3BQ0 A;  5C25 B;  4WII A;  2F4V J;  1T9X A;  4FYV B;  5HRO B;  4DR1 F;  3OXG A;  1ZBT A;  3NEK A;  5DM7 Q;  4NRU A;  1RHU B;  3DLH A;  3L95 X;  2U2F A;  2OEL A;  1U2F A;  4YUD A;  4A8Q A;  1I51 B;  2VG7 B;  1NSP A;  2FJD B;  4R8U B;  4N8O A;  4PG8 A;  2J76 E;  5I3Q A;  2GS8 A;  2VG6 B;  1YIT S;  1AFI A;  4C0H A;  4YHH J;  3MPV A;  5J1P A;  4NLG A;  4CCH A;  4IO1 A;  3CO9 A;  1NDC A;  5M2P A;  2ZH5 A;  1BE4 A;  1RBA A;  3R6L B;  2JEI A;  3OHB A;  4I67 A;  2JDJ A;  1R89 A;  2ERR A;  1VQK S;  1IKV A;  2PMW A;  3ET6 A;  3GV7 B;  3W3S A;  3R1H A;  2XWX A;  3H7H B;  1QVF R;  3M6V A;  2R7Q A;  3C6T B;  2FLL A;  2CJB A;  3RW7 A;  3FBF A;  2RS2 A;  5A6P A;  4QR0 A;  4WKY A;  1N34 J;  1WUU A;  1HNZ F;  2VBY A;  4R0J A;  5I42 A;  3PO5 A;  3DRR A;  5C24 B;  1IBK F;  3CD5 A;  2CUY A;  1EJ7 L;  3T5J A;  2K3K A;  1HL6 A;  2JLF A;  4F26 A;  1OJ4 A;  2YH0 A;  1HHQ A;  1JJ4 A;  1CPZ A;  3G86 A;  4B9V A;  1MLA A;  3O6Q A;  4B9U A;  4DMZ A;  1HW9 A;  2VON A;  2IRU A;  1EQ0 A;  4TXS A;  4RWX A;  2Z58 B;  4X66 J;  1SV5 A;  2OSQ A;  2RAQ A;  3BRE A;  1RHM B;  1J2V A;  2FJE B;  4QW8 A;  3KUH A;  2UXC F;  2XSF A;  4DF4 A;  4WTO B;  4N47 A;  3FBB A;  3H2L A;  4Q2L A;  4ZVG A;  5GAE U;  4FNH A;  1K0T A;  2RIJ A;  3MM6 A;  3NGD A;  1IKY B;  3AOA A;  1CS4 B;  4USU A;  2YX7 A;  4F02 A;  3B82 A;  3SQG B;  2XNR A;  4FS2 A;  2CQP A;  4KIA A;  3NMA A;  4CO4 A;  4ED3 A;  3TUJ C;  5IT0 A;  4BLG A;  3SXL A;  1WOO A;  4MYT A;  4USW A;  1NHK L;  1N5T A;  1O5J A;  3WIU A;  4WPA A;  1RWP B;  4PR6 A;  2WB1 D;  4DV0 F;  3M8Z A;  4ZLL A;  2JSX A;  2LQJ A;  2RE1 A;  4I68 A;  1JB0 C;  3UN3 A;  2E1C A;  3BB5 A;  1T94 A;  2LQ9 A;  2ZH7 A;  2DNZ A;  1X7V A;  2OHD A;  2MZR A;  3PX6 A;  2P8I A;  3OPK A;  1CJT B;  1UPP A;  2GX8 A;  2VL1 A;  2E66 A;  1FWP A;  4OX9 F;  2ZIT A;  2QT7 A;  1VBZ A;  3R7S B;  4F04 B;  2MKJ A;  4WK3 A;  4DN0 A;  4DV5 J;  1TAQ A;  2AIR B;  1KQK A;  2O1P A;  5JJB A;  4J9K A;  3ILL A;  2PN6 A;  3ZTR A;  1JWW A;  1FHT A;  1CJV A;  4N41 A;  3H2V E;  1REV B;  3J81 U;  4DFJ A;  2XMV A;  3N5B A;  1F60 B;  8RUC A;  5AJ3 F;  1Q4R A;  1JLA A;  2A18 A;  2XO7 A;  3JTN A;  1RHJ B;  3LP1 B;  4C6A A;  1C1C B;  3DMJ B;  5KTQ A;  2BJ3 A;  1MG7 A;  4QWD A;  4PG4 A;  4GVB A;  4DSJ A;  5J2M A;  3GJQ B;  2OPS A;  1LWC B;  4F4Z A;  1MWY A;  3DLK B;  1R0A B;  3MZI A;  1T11 A;  2J0X A;  2JL9 A;  2MEW A;  5K8N A;  3LUY A;  1T03 B;  4CO5 A;  1DJ0 A;  1R8A A;  2DGQ A;  5KFE A;  1SJQ A;  3GYN A;  1FDD A;  2K3I A;  2C2O B;  4KQZ A;  2VBW A;  4M5M A;  1PIE A;  1V6H A;  1VQ7 S;  1NU4 A;  2ALZ A;  3S1T A;  3HKW A;  3UDE A;  4P74 A;  5F0W A;  1WF2 A;  1JK9 B;  2MST A;  2FGC A;  3AOC A;  3BYP A;  4FF1 A;  4OYB A;  1OMS A;  4G1I A;  3OR1 A;  1NSK L;  3KLF B;  1S59 A;  3QAE A;  2LEC A;  4IQM A;  3D9B A;  1S76 D;  3BDE A;  2HWH A;  4N56 A;  4KHR A;  2KFZ A;  1VRT A;  4OYW A;  1Q16 B;  3M1V A;  3OL8 A;  3V6J A;  2F4V F;  4MT1 A;  3RZA A;  4ETX A;  1FXD A;  4ZPB A;  2UVU A;  3P8B B;  1UMJ A;  2BBE A;  5HK4 A;  2BE2 B;  2AJF E;  1VQ9 S;  1WC3 A;  5AXL A;  4EBC A;  1TV6 A;  3IRW P;  2QLW A;  1U47 A;  2KFY A;  4YHH F;  2VBZ A;  2RHQ B;  3OUY B;  4NLV A;  4IG0 B;  5K14 B;  5LSO A;  4C4W A;  5EUH A;  3H25 A;  4DL7 A;  1FJ7 A;  2OO4 A;  4N76 A;  3U27 A;  2FD2 A;  3NNH A;  5K5M A;  3PR4 A;  2LXF A;  3C3L A;  5KFH A;  4F4A A;  5KFJ A;  3MD3 A;  3QIP B;  1U8S A;  2AX0 A;  1F3F A;  1N34 F;  2KVQ E;  2P2C B;  1RTJ B;  3PRB A;  3SIP B;  4Q5V A;  2QG9 B;  2KHD A;  2HIQ A;  2GJI A;  2B43 A;  1YZ7 A;  2RH3 A;  3HI9 A;  2E9R X;  4IR9 A;  2YY3 A;  4RJV A;  4A8W A;  2RT3 A;  3HJV A;  4IH7 A;  3E3X A;  3LAM A;  3BGU A;  4M5L A;  2ZH2 A;  3QAT A;  2L41 A;  2L9D A;  3SV4 A;  4QJV A;  2MTL A;  4LR8 A;  3OBI A;  2W24 A;  4ECY A;  1YRT A;  1VS3 A;  4BC9 A;  3EMT A;  3BZQ A;  1WC4 A;  4X66 F;  2Y1J A;  4FF3 A;  4FKX A;  1Y7P A;  5HVG A;  4I6Y A;  3W66 A;  5KFU A;  4ECU A;  2UUC J;  1D0E A;  2G13 A;  3ZZO A;  3PV8 A;  4C8M A;  1KTV A;  3H2U B;  2Y9H A;  2ZH6 A;  4RBU A;  1X9M A;  1WEX A;  2NPF A;  2QL5 B;  1FTC A;  3DYA A;  3SQO P;  4EBD A;  5C2G A;  1KVK A;  2HKE A;  1OIA A;  1T9Y A;  2AZ1 A;  3OXL A;  1FKO B;  1L3V A;  3UR3 C;  1VDH A;  2HHP A;  2CZV C;  3ONQ A;  2ZZM A;  2AW0 A;  1RAF B;  4MKV A;  2QZ8 A;  3AQO A;  1S6Q B;  3EDQ B;  4AYB D;  1BLU A;  3H98 A;  1HWK A;  1A7G E;  2EC2 A;  1R3N A;  4K5S A;  3GWC A;  5KFN A;  5HMZ A;  1IWG A;  2PFD A;  8ATC B;  1RAC B;  3FCW A;  1HWL A;  3I0R A;  3P6Y C;  3KLI B;  3CW2 C;  1P9Q C;  4IFV A;  2V2Q A;  4M95 A;  3Q8U A;  1C0T B;  3PW2 A;  1WHV A;  4Z2X A;  2D41 A;  2CA9 A;  2KRB A;  1FTR A;  2C3P A;  2W7P A;  2XQC A;  1T9U A;  5A8R B;  4DEZ A;  3GG1 A;  4DU8 A;  1NZA A;  2BQU A;  2GML A;  4V19 J;  4DV5 F;  2DNO A;  3MM5 B;  3C16 A;  4L6V 3;  3RU0 A;  4UY8 T;  1SB6 A;  3QZ8 A;  2XYP B;  3BSA A;  3J80 Y;  1FKA F;  5J2N A;  4ID8 A;  4OZN A;  1H0H B;  1X4G A;  1WNE A;  1S6U A;  4LR7 A;  3R6G B;  5L1J A;  5KG4 A;  1KWM A;  4E0D A;  5KFS A;  1TUV A;  4UT4 A;  1KQS R;  4P2S A;  4NCG B;  4DI6 A;  2CWX A;  3PZP A;  1NM2 A;  3R5D A;  3JYT B;  3TW0 A;  1C2P A;  4BCA A;  1J5O A;  3LWL A;  1FKP A;  2B8Q A;  4DS5 A;  3TA1 A;  2MKS A;  1IM4 A;  1FNX H;  4AXI A;  1IVZ A;  3ISN C;  4MMO A;  4XK8 C;  3M2U A;  3BV8 A;  1YIJ S;  3EYZ A;  4HR2 A;  2ZVI A;  2Y1R I;  4QQB A;  2MKI A;  2DGV A;  5IV3 A;  4CIO A;  2NSC A;  4AD6 A;  2AF6 A;  1FVS A;  3TVK A;  4CP5 A;  5B0D A;  1F2G A;  2NXJ A;  5IQQ A;  1WOS A;  2F63 A;  4CH1 A;  3V6K A;  1QE1 B;  4WFY A;  4QWB A;  2CQB A;  4L76 A;  3PKM A;  2IM1 A;  4NLP A;  3CMQ A;  1WEL A;  4RW6 A;  1T8E A;  4F25 A;  2BAB A;  5BYQ A;  4ANC A;  2V5H G;  4OJH A;  4DG1 A;  2WVE A;  5KFT A;  1F2H A;  3MMC A;  1WF0 A;  2FPH X;  5KFZ A;  3HSZ A;  1HQE B;  3DC2 A;  1FRX A;  4LSN B;  2B51 A;  3MM9 B;  7FD1 A;  4ILL A;  1AUD A;  1R31 A;  3OVA A;  4CRJ A;  4DQS A;  1DLO A;  1HD0 A;  5C2C A;  1WHW A;  5F0U A;  1LOU A;  3D28 A;  4C11 A;  4JBC A;  5B0C A;  4U8Y A;  3BN7 A;  3K8W A;  4ZVS B;  3CDE A;  3SCJ E;  4DV7 J;  4RUH A;  5CAA A;  2ROG A;  3FQL A;  1ZM4 A;  1QVG R;  2QSF A;  3EXY A;  4PXE A;  5AE1 A;  4PG6 A;  1UPM B;  5HL7 Q;  3TZW A;  1NB2 A;  1S0V A;  2FZG B;  3RBZ A;  2QA2 A;  1K1Q A;  1VQ8 S;  5D77 A;  3NGU A;  4RKU C;  1DUR A;  5HLF B;  2DH7 A;  2I9S A;  5ETL A;  4NI2 B;  3M9N B;  4HT7 A;  1N5Y A;  1AZS A;  2DIU A;  1IQZ A;  1HI0 P;  1FA0 A;  4P7T A;  5LJ3 Y;  2MZ1 A;  4DV2 J;  3HFK A;  5IM0 A;  1UEU A;  4CH7 A;  1VBY A;  4ZP9 A;  4ZK7 M;  4G1Q B;  4IQX A;  2XMT A;  1RGV A;  1VMB A;  3Q8S B;  4C8L A;  2IHR 1;  3MMA A;  4LMZ A;  2L9N A;  2B9Y A;  4ICL B;  2UUC F;  2W4D A;  1U1Q A;  3NCQ A;  1HBU A;  1I6J A;  3KLH A;  2C2R A;  5F8G A;  1JLG A;  1MN9 A;  2VPY B;  1Q95 G;  2CPF A;  4WKR A;  3OJU A;  1SUQ B;  1X5P A;  2DNK A;  3JSM B;  4F3Q A;  2CVE A;  4KV8 A;  2JZ5 A;  1K44 A;  3OFE A;  1UFK A;  2OMO A;  3UPF A;  2BE9 B;  4WZM A;  2QMX A;  1QSY A;  3D54 A;  2RD5 C;  4AUK A;  3N5F A;  2HHS A;  4FYW B;  1UWB A;  4TY8 B;  1CJK A;  4IG3 B;  1B0P A;  1NCL A;  4NLD A;  4NZ6 A;  1X5T A;  2AYM A;  2IJR A;  1FO1 A;  3N6M A;  1APS A;  2HHU A;  2FLP A;  4KY3 A;  1N33 J;  2DRD A;  2WHO A;  3DU5 A;  1XNQ J;  4DCO B;  2VJU A;  5F8L A;  2YNH A;  5L8R C;  2CQH A;  5E3R A;  4UQG A;  3AY0 A;  1RAD B;  4Z7Y A;  4MK8 A;  1GXU A;  2R2U A;  1EET A;  5HAN A;  4X4Q A;  2QFI A;  4YR0 A;  3ISN D;  2ABY A;  2KVI A;  2M9K A;  3OW2 R;  3PCO B;  3OQ2 A;  4M94 A;  4OHX A;  4USV A;  1P9Y A;  2ZH9 A;  5DDP C;  3T41 A;  1OYE A;  2PI4 A;  2XO6 A;  2KH9 A;  5H9F K;  1U7L A;  3ITH A;  1XQI A;  1RT3 A;  3DOK B;  3BM7 A;  3PTW A;  4HDG A;  1NSA A;  5C42 A;  4D3H A;  3UWT A;  2KZM A;  5BJR A;  4TQS A;  3M6W A;  3TQ1 A;  4UOF A;  4I7F A;  4O23 A;  1Q7Y T;  3MEG B;  1WC1 A;  1FD2 A;  1SKW A;  1P27 B;  4JP8 A;  1GMV A;  1LW2 A;  3TA2 A;  3AJ2 A;  4ZMM A;  3FDS A;  2DR7 A;  2SXL A;  5HMX A;  1HWI A;  4F8R A;  3DOL B;  1RWV B;  3SV3 A;  4KGV B;  4Q45 A;  3KK2 A;  3EE3 A;  4R25 A;  5F3Z A;  3VAJ A;  1NHU A;  6AT1 B;  3N9U C;  1Y5L B;  2H4W B;  1Z1Z A;  2HK3 A;  3R5B A;  3BR9 A;  3EVM A;  4RW9 B;  4F36 A;  4YB5 A;  4F4K A;  1VK8 A;  3SSS A;  4RZR A;  2PT0 A;  2QMU B;  4WE1 B;  2C2N A;  4IRK A;  3C6U B;  1N5Q A;  3IG1 A;  1FFG B;  5LT5 A;  5AE2 A;  2HFS A;  1RU2 A;  3LPE A;  3BO3 A;  1KLM B;  2JX2 A;  4OFZ A;  1WC6 A;  4PXB A;  1BQN B;  1VQ4 S;  4WFA Q;  4LF7 J;  3NL0 A;  1ROF A;  1QAI A;  2K06 A;  5CYQ A;  1RWW B;  1VQP S;  4J91 A;  4FBU A;  4LUB A;  5LXR A;  5FDL B;  1RCO B;  1KQG B;  1EIY B;  1RAJ A;  2BJ7 A;  2I5J A;  3Q8Q B;  4OZ0 A;  4DR4 J;  2PA3 A;  4NLS A;  2W01 A;  3DDI A;  2IPO B;  1RWO B;  1TK8 A;  4CLS A;  5L1I A;  3CCJ S;  2CYY A;  1Y00 A;  2LQB A;  1GT8 A;  2B4P A;  2CQ4 A;  4J5O A;  3UD5 A;  4A8M P;  3N6L A;  4TVA B;  2FHM A;  3IWX A;  4ZN1 A;  2HHV A;  4Y2I A;  2YKM A;  3KG4 A;  1M1K T;  2GQ2 A;  2HQI A;  4DV7 F;  2COL A;  1OO0 B;  1H2U X;  1C0U A;  4DV6 J;  5A2Q Y;  2CQ2 A;  4ILR A;  5CZX A;  5J2Q B;  1FJG J;  3GIJ A;  2KXF A;  4XAK A;  1KSP A;  1RHK B;  1MMN A;  1W25 A;  3QGI A;  4ZVF A;  2D9O A;  4URS A;  2IBO A;  3ADA C;  2HWI A;  5CH7 B;  2FY1 A;  3CIZ A;  4OV1 A;  5AXK A;  2UV8 A;  2DKO B;  2V4R A;  1HYS B;  1LFP A;  1IR1 A;  5DO2 A;  4O44 B;  1Y3K A;  1RTH B;  4F3O A;  1VIO A;  4DV2 F;  3LH2 S;  1IWA A;  3EZU A;  3R97 A;  1X60 A;  5KT6 A;  1NJZ A;  2E1P A;  1T9V A;  1NHV A;  4OYX A;  3KHL A;  1Q78 A;  3JAM Y;  4QW9 A;  4TN2 A;  4DL5 A;  3MMB A;  1JMT A;  3TJA A;  5DET A;  3H20 A;  2HBR B;  4PQU B;  2QE5 A;  3OHA A;  2XEX A;  2OTL S;  2ZHA A;  3IS9 B;  4IKA A;  2HIY A;  4W98 A;  3MUT P;  5IQ6 A;  4A48 A;  4ERD A;  4ID5 B;  5HRO A;  2XI2 A;  4LBI A;  3W5Y A;  2HBQ B;  4K2X A;  3MCN A;  3LTO A;  2VG7 A;  4F0M A;  4R8U A;  1CQM A;  4EYI B;  2NLW A;  3ZC4 A;  4RNH A;  3W63 A;  2KU7 A;  4ZVE A;  3FRY A;  3CNQ P;  1T9W A;  2W4C A;  3HPO A;  4P75 A;  2LCW A;  3MOZ A;  1HBN B;  1NPK A;  3SSQ A;  1VGY A;  2JLE A;  3GSD A;  2Q66 A;  3P5B P;  2VDI A;  2UXB J;  5KG6 A;  4KGK A;  4B3S J;  4M5I A;  1N33 F;  3TOQ A;  2H5I B;  5B0F A;  3NKY A;  2IVF B;  3FSY A;  3HT0 A;  1TZ0 A;  5A76 A;  4OZ2 A;  2F9J A;  4LRB A;  5GAH I;  5F3T A;  4NCA A;  4WP8 A;  4ZDN A;  5C24 A;  2ZUA A;  2VJV A;  2GAG C;  4X2B A;  3ZXW A;  1ZZF A;  3VQT A;  2KI2 A;  3TAN A;  2WSE C;  2X7I A;  2G1D A;  5GAD I;  3V6D B;  4MKA A;  1M5K C;  1BD6 A;  2XMA A;  1KVJ A;  1HA1 A;  4HI1 A;  1M5P C;  2PO4 A;  5K8M A;  1JNR B;  2B0G A;  3SYZ A;  1HNX J;  1NBE B;  1TL7 A;  1UEV A;  2B5J B;  2R7R A;  2W9B B;  4DSE A;  3Q8V A;  4B9T A;  3M2R A;  2FDN A;  2Z0G A;  2MMY A;  3NWG A;  3I55 S;  3RAX A;  4HAC B;  4ZJL A;  3V81 B;  5AXM A;  2CJ9 A;  1CS4 A;  1UKU A;  5CZV A;  5G0R B;  4GKJ J;  3SQG A;  1E6Y B;  1JJ2 R;  2K2P A;  3MDF A;  4USM A;  2J0Q D;  2PFF B;  2DCU B;  1R7I A;  2K8G A;  5FJ4 A;  2V0N A;  1TKZ B;  1VIX A;  1QSL A;  5DDQ C;  5A8W B;  5KFP A;  3H5X A;  1FDB A;  5HP1 A;  2YVS A;  1WG1 A;  2HEK A;  1WTF A;  2ZE2 B;  3MM8 B;  4JV2 A;  2W8L A;  4Q0B B;  3THV A;  4MYU A;  3NXZ A;  4LF7 F;  2OP5 A;  1B99 A;  1HIY A;  1G3O A;  3RTV A;  3CT9 A;  5CCM A;  4RW7 B;  3V5R A;  4EU0 A;  3ZTO A;  2VD3 A;  1KVI A;  2OTJ S;  1UVI A;  2WZ1 A;  2E7W A;  1PJ7 A;  4DV3 J;  1WTB A;  4DR4 F;  3MED B;  4IDK A;  2FB0 A;  1XJW B;  1FF2 A;  2X1F A;  4U7U K;  3G6Y A;  3M32 A;  5GMD A;  4G65 A;  1TL3 B;  4RX6 A;  4PKD B;  1AW0 A;  1VI7 A;  2BJ8 A;  3HHN B;  3QMQ A;  4JUZ A;  2CPI A;  6FDR A;  3MAQ A;  2E5H A;  1LWX A;  3A8J A;  3ZO7 A;  3LP1 A;  4CO3 A;  5J1E B;  1C1C A;  4N77 A;  4B9L A;  2QLB B;  1UP1 A;  4DV6 F;  2D9P A;  1Y9O A;  5F8M A;  4P71 A;  3MD1 A;  5H9F J;  1FJG F;  4YP3 A;  4H54 A;  3W8P A;  1S10 A;  4ECQ A;  2R8J A;  4K0K J;  1LWC A;  2IDL A;  4I4B A;  1B70 B;  3DLK A;  1R0A A;  3KDN A;  3OLA A;  2F1F A;  1T03 A;  2BEF A;  4R0E A;  1ZZN A;  1U6Z A;  3HZG A;  1U2C A;  5DRK A;  5KG7 A;  3U7J A;  1HWJ A;  2LQ8 A;  1T9T A;  1YZ6 A;  1SL2 A;  1QTN B;  1TK5 A;  4P72 A;  4EI2 A;  4NYP A;  1FRJ A;  1J27 A;  4ECX A;  1TU0 B;  4OYI A;  1NK4 A;  1DY3 A;  4P9S A;  3KLF A;  4ECW A;  2DNL A;  2DO0 A;  3CIM A;  5IC4 B;  4Z7C A;  2KL8 A;  2YTC A;  2DYA A;  2LU1 A;  1D3W A;  2RQK A;  4LRC A;  4UTG A;  4ZCM A;  3VAK A;  3J7A 1;  1DTQ A;  2BE2 A;  1TKD A;  3VR1 A;  2ILY A;  3FC9 A;  3OTD A;  1RT7 B;  3G82 B;  3Q8Y A;  4TQR A;  2V9K A;  3W8G A;  3UQS A;  2HNZ A;  1ZAX A;  4ZPV R;  5JVG Q;  5K14 A;  2GGP B;  4NOH A;  4B3O B;  1M5O C;  3AB2 B;  3G6V A;  4I69 A;  4NMX A;  2E5J A;  2UXB F;  2HPU A;  3TAP A;  4RNM A;  4B3S F;  3KMS A;  2V4J B;  4DFM A;  2E5I A;  4AL5 A;  5DJB A;  2OD6 A;  1A9N B;  2RKI B;  1WC0 A;  4IH5 A;  3RAQ A;  5T14 A;  1ZYQ A;  2AJ1 A;  2L9W A;  3SBM A;  3PJW A;  3CJQ A;  1Q8L A;  3QIP A;  2VFV A;  2GMJ A;  1UVK A;  4K4Z A;  1IJF B;  1RLC L;  2J9D A;  2DY9 A;  1RTJ A;  3KK1 B;  1QAX A;  3W62 A;  1T95 A;  3RBD A;  3DRS A;  1SJ4 P;  2WK4 A;  2Y8Y A;  2ZKT A;  4RBV A;  3FEX B;  1VQ6 S;  4PPZ A;  4TLQ A;  4ELT A;  3KTQ A;  5D0G A;  4BC7 A;  5B0E A;  4QCL A;  1Z4U A;  2QA4 S;  2ACM A;  3UW1 A;  2KG0 A;  1FE0 A;  1NKC A;  3POT B;  1M5V C;  4K4S A;  3AXK A;  1HNX F;  4LJM A;  3U1N A;  2DB1 A;  4Q44 A;  2N82 B;  1SC3 B;  5IXU A;  5F8I A;  5DM6 Q;  3M05 A;  8AT1 B;  1BQM B;  2WBR A;  1NPR A;  1FRI A;  2QEX S;  1FKO A;  5ETK A;  1JXE A;  1S4E A;  3RRK A;  2WRM A;  4I2P A;  4PCQ A;  2RUG A;  1IR0 A;  4GKJ F;  5ETT A;  3E01 B;  2DHA A;  1UVJ A;  2BOP A;  3VTI A;  2V68 A;  3MTJ A;  3HD2 A;  1VOM A;  3VZH A;  1S6Q A;  3HF5 A;  4DPX A;  2VA2 A;  4DQI A;  1GX6 A;  1M1H A;  4UUX A;  4Y0F A;  3BYR A;  1ZPW X;  3V4I A;  4CTA B;  1UWA A;  3KLI A;  4J9U E;  1BQX A;  4IUF A;  4EWT A;  3T1H J;  3M8R A;  1KOH A;  2V67 A;  2XS2 A;  3CDA A;  4C97 A;  2VOP A;  4U6P A;  3GFH A;  1C0T A;  1K1S A;  4QIF A;  1DQA A;  4ENO A;  1OQ3 A;  3IAM 9;  3D3C J;  4DV3 F;  2VQE J;  1GH8 A;  4PZV A;  5A8R A;  2ASY A;  3DM2 B;  4XO0 A;  3IWL A;  3W9J A;  3MM5 A;  1CEZ A;  1S97 A;  3OSP A;  4XPE A;  2J7K A;  3MAA B;  3NS7 B;  4DLE A;  1S1W A;  1WKL A;  2IM0 A;  1B3T A;  1R6Y A;  3SEO A;  1T02 A;  3CCM S;  3K2Y A;  1HBO B;  2KG1 A;  1MSW D;  4ZCI A;  3L3C A;  1WKK A;  4YME A;  2LA4 A;  3F56 A;  4NCG A;  4DFP A;  2UVR A;  3EDR B;  4PXD A;  3JYT A;  4K0K F;  3N6N A;  1TR0 A;  3M8Y A;  1O0P A;  2E5G A;  3D5M A;  2CQ3 A;  3CF5 Q;  3D4J A;  1RHQ B;  2PII A;  4DL6 A;  3R2D J;  3T5H A;  1EX8 A;  5DS7 A;  5E3P A;  2K1R A;  3MGJ A;  3CCE S;  3EVO A;  4NYZ A;  3X1L B;  5BXI A;  3AOB A;  1GTH A;  3Q23 A;  1NXI A;  1R6V A;  3HXM A;  3H4B A;  3DLB A;  2ZC3 A;  2W1B A;  5THW A;  4LF8 J;  3H4D A;  4WFB Q;  4DSF A;  2GC8 A;  2C28 A;  2CXE A;  1ULR A;  4QU7 A;  3CD7 A;  2R7O A;  1JLQ B;  2YWF A;  2J6U A;  3KWM A;  3KHH A;  3J81 j;  4RW8 B;  3DLG B;  1BUX A;  5D6G A;  2F4F A;  1U24 A;  4AFF A;  3PVX A;  2M5Y A;  3MEC B;  3CD6 S;  4FYD A;  4I1T A;  2XCA A;  1QM9 A;  2VV5 A;  2HHW A;  5HMW A;  3HHK A;  1HQE A;  3CCR S;  3MR5 A;  2XLK A;  4QIG A;  4QR2 A;  2FJW A;  4U7C A;  4LSN A;  1I1G A;  1M5H A;  3MM9 A;  1S1T B;  3WBZ A;  4QOT A;  3T6B A;  2ZD1 B;  3N28 A;  3HM9 A;  1FFW B;  2ZJR Q;  4PWW A;  4B9N A;  2BMB A;  3B4M A;  1N54 B;  3BEG B;  1X4A A;  3GCX P;  4MKB A;  4DX8 H;  5KT7 A;  3CCL S;  1IKW B;  2HBZ B;  2MJU A;  3K5O A;  2BA9 A;  4M63 A;  2HG4 A;  3IP0 A;  5ETS A;  4FYY B;  1Y11 A;  2ZWO A;  3ZZR A;  4BWM A;  3RR8 A;  3R9L A;  2JVO A;  4DV1 J;  5EGY A;  1YSJ A;  3NGT A;  4KH0 B;  3HD1 A;  4J9Q A;  3C8Y A;  2C3U A;  1WOR A;  1H7X A;  2AJ2 A;  5HLF A;  2QFJ A;  1N56 A;  3SFU A;  3FRZ A;  4NI2 A;  3UDV A;  1NK8 A;  2KT2 A;  2V69 A;  5IT4 A;  4EYH B;  1GAO A;  2CDR B;  1UEK A;  4RBT A;  3A3N B;  1YJN S;  2XC9 A;  4LF1 A;  3IC1 A;  1UW9 A;  3H5S A;  2YX4 A;  2J7U A;  1WSR A;  4F4X A;  2KJV A;  3QRQ A;  3EPI A;  2BQ3 A;  4LF2 A;  4G1Q A;  3IO1 A;  3KFW X;  3ETO A;  4X65 J;  4LBP A;  3AFG A;  1U49 A;  3NCP A;  4ICL A;  2DHH A;  1F9F A;  3MR7 A;  5SUH A;  3T3F A;  3AD8 C;  2J8S A;  2IDE A;  1Q7L B;  4G1P A;  4DQQ A;  3FCH A;  1OSD A;  2OH2 A;  1WAC A;  2GAH C;  3LAN A;  1SBR A;  4J9V A;  2XS5 A;  1H6K X;  3JSM A;  2MYF A;  2WW8 A;  5ETV A;  2V63 A;  4YB7 A;  5E5N A;  4ZPA A;  3FBC A;  2C22 A;  2LA6 A;  4I6A A;  2MSS A;  2KHC A;  3D0I E;  2ZC4 A;  4C48 A;  3ENQ A;  5DZ6 A;  3QLH B;  3MOJ B;  2Z2Y B;  3OTB A;  4IG3 A;  3T1H F;  1M1G A;  2IC3 B;  1JLB A;  5EHH A;  4I6W A;  3PYE A;  2NRE A;  2BVZ A;  4NLW A;  2VQE F;  4ZVO B;  3W7B A;  3R27 A;  4H4K A;  2MZS A;  3HVT A;  3D6M B;  2PMZ D;  1FX4 A;  2VHG A;  4N8N A;  3SMZ A;  4LR9 A;  3GLJ A;  1EKR A;  3I56 S;  3U1L A;  4LQ3 A;  3BGR B;  1YGY A;  1N48 A;  3MHY A;  4DF8 A;  2XSJ A;  1RWU A;  3PYG A;  4RUC A;  1WEY A;  1Z2L A;  4ZCK A;  3CC4 S;  3OFF A;  3CDW A;  1X9W A;  3DOK A;  2HRY A;  3K5M A;  2YKA A;  2IA6 A;  4AL6 A;  2DHX A;  2Z56 B;  4B02 A;  4HYK A;  4OL8 A;  2APO A;  4QBU A;  2RRA A;  2AKW B;  2XHW A;  3D3B J;  3MEG A;  1IKX B;  4NA2 A;  4F3M A;  3W2W B;  4ED5 A;  3LGM A;  2NZ4 A;  2EBE A;  4ZIT A;  4XTT A;  3KHR A;  1VC6 A;  4ZVT B;  2QX0 A;  2UV8 G;  1JLC B;  2ZFH A;  1H3D A;  3EGN A;  4DX7 A;  1DFD A;  3M6U A;  2OPQ A;  2WSC C;  4KGZ B;  5CYM B;  5GAH U;  2F3J A;  4CLU A;  2JRS A;  4KPC A;  4LF8 F;  3C6U A;  4ES2 A;  3DDK A;  2DR8 A;  2HHQ A;  4DX6 A;  3LGH A;  2YWW A;  4UUW A;  2Q6C A;  4YB1 P;  1QLN A;  5GAD U;  3VVT A;  3QO9 A;  1L3S A;  1QSS A;  3M8P B;  5FDL A;  4B9M A;  3K5N A;  2WTF A;  1SC6 A;  3PX4 A;  3DN9 A;  2HFV A;  4QWE A;  2BRL A;  3UI3 A;  3Q86 A;  2CQC A;  1URR A;  2BJD A;  1G1X A;  2CQ0 A;  3LWM A;  3T5L A;  1UVM A;  2X1G A;  4F7V A;  1P1L A;  2DEI A;  5DDR C;  1JJC B;  1CSJ A;  1FFS B;  1X4E A;  2D3U A;  1KQF B;  4H4M A;  2LXI A;  4U95 A;  3NG8 A;  4R5P B;  4EUV A;  1U1P A;  2M2B A;  1TUW A;  2FIU A;  1FK9 B;  4JV0 A;  2ASL A;  4ZP6 A;  3NRB A;  1RT4 A;  3FJ2 A;  5J2Q A;  3FKB A;  4DR3 J;  4DSI A;  3RB0 A;  4DV1 F;  1XTZ A;  5IZH A;  1MWQ A;  4QIE A;  1BMQ B;  1TL4 A;  5LOQ A;  2JEJ A;  3ILJ A;  5DGB A;  3IM9 A;  4O3O A;  2DXE A;  4ZHR B;  1OY8 A;  2XS7 A;  3UO0 A;  4CLZ A;  1YWX A;  1LK7 A;  1HR0 J;  2ILZ A;  2E9Z A;  4QYZ K;  3PJ9 A;  4EK2 A;  1L3K A;  2RQM A;  1RCX B;  1FDN A;  2E7V A;  4O44 A;  4B3M J;  1RTH A;  3OD2 A;  1KON A;  1F9H A;  1XK8 A;  3JQM A;  1HHS A;  1S7H A;  1RBO B;  2JC1 A;  3HSD A;  3TEG A;  4DS4 A;  4X65 F;  1NK7 A;  1JKH B;  2Q43 A;  3DKD A;  4IYQ A;  2OIH A;  4RW4 B;  3MR2 A;  4UST A;  3BS9 A;  5E3C A;  4LF4 J;  2Z4P A;  2WON B;  3N79 A;  3IS9 A;  2GCF A;  3ET6 B;  1N52 B;  5KFM A;  3I32 A;  3RJM B;  4ID5 A;  2P5V A;  4KC5 A;  9RUB A;  1NZ8 A;  2H5J B;  2IMW P;  2BRK A;  1A6L A;  3GCW P;  3FBE A;  3OJS A;  1PO6 A;  5BYS A;  1RXO B;  3EZ5 A;  1C4A A;  2KDO A;  4WFZ A;  3BGF A;  5I42 B;  4UZC A;  4YDD B;  1TK0 A;  1U1M A;  3I87 A;  1OQ6 A;  4JI6 J;  1HBN A;  3H0P A;  4GMK A;  4ZPC A;  1IBC B;  4Y2M A;  2DGO A;  3CJ8 A;  1QD1 A;  3BBB A;  3O2I A;  4GC6 A;  4DSK A;  1W26 A;  2ZEJ A;  1GEH A;  2D3O 1;  1S0O A;  1MNE A;  4J9R A;  3NNC A;  3T5K A;  4TU9 A;  2DNY A;  4Y2K A;  1FX2 A;  3QRP A;  2YNF A;  3AXM A;  1FEE A;  3ENW A;  3TR5 A;  2X1A A;  4ECS A;  2J9C A;  1LW0 A;  2HHH J;  4EEY A;  2M4M A;  4MIW A;  1HMV B;  1Y10 A;  2B7C B;  4YEA A;  2W4P A;  3FK4 A;  2V50 A;  3M6X A;  3D2W A;  3J7A N;  3V6D A;  1CG2 A;  1NDL A;  1V3Z A;  5T7L A;  1CJU A;  4ZCL A;  2VQF J;  2IIH A;  2FJX A;  1NUE A;  4MH8 A;  4DCJ B;  1LWE A;  4J37 A;  2IFX A;  2FC9 A;  4K4Y A;  2B5J A;  1YJR A;  3OSN A;  2YWE A;  4EO8 A;  2QIF A;  3HLU A;  2MDA A;  4NLT A;  4CLP A;  2XZT B;  1FWL A;  4HAC A;  2W7A A;  4M5N A;  3NOG A;  2QLX A;  1AB8 A;  4ZKA A;  1U09 A;  1C1B A;  3EGW B;  3PHE A;  1VRQ C;  2HUR A;  2IA0 A;  3VGS A;  2XY5 A;  4F4W A;  3OVS A;  1NKB A;  5HI7 A;  2HND B;  4M5J A;  1U1N A;  4AE5 A;  3IAS 9;  1VQO S;  2YNI B;  1TKZ A;  2FHK A;  5A8W A;  1MU2 A;  2H1Y A;  2O67 A;  1QAY A;  5HJX A;  3LA0 A;  3MM8 A;  5HQM A;  1RYR A;  1CJV B;  2G2Y A;  3GJS B;  3PIO Q;  1HW8 A;  2ZNY A;  3VAM A;  1H74 A;  1JLA B;  4DOZ A;  4OYM A;  2MZQ A;  3A8E A;  4EGL A;  4RW7 A;  2W7O A;  1FRH A;  1UZD A;  4AT1 B;  4L72 B;  4PG5 A;  2B9E A;  5A8K B;  2HMI A;  3MED A;  1IR2 A;  1RT2 B;  4GVB B;  3CJ0 A;  1DZ5 A;  2DXD A;  4Y00 A;  4AQY J;  2JH3 A;  2CRL A;  2EPI A;  2UUB J;  3QAU A;  4IRD A;  4G3I A;  4DPU A;  2WOM B;  1SQG A;  5C5J A;  2CVI A;  3ZZY A;  3FEY B;  5HO4 A;  3H40 A;  5E41 A;  3D68 A;  3HFZ B;  3H5Y A;  2RU9 A;  3HKZ D;  2BOA A;  1PAE X;  3ZZT A;  3HO1 A;  3UE2 A;  3KLV A;  5D0H A;  5M2R A;  3NNA A;  1EQM A;  4EO6 A;  4FBT A;  4DR3 F;  4FZV A;  1W7W A;  4ZPW R;  4FNI A;  4KH1 B;  5E7O B;  1X4H A;  3QJP A;  1YBA A;  3TI0 A;  2ZOG A;  4NA3 A;  4P6Q A;  1P6T A;  2BAN B;  4NXM J;  3AAW B;  1HR0 F;  4LVO P;  1KKH A;  1RKI A;  4PYA A;  2OI2 A;  4U7U D;  3GTY X;  2XBP A;  1I94 J;  4B3M F;  4NML A;  3BSC A;  2JWN A;  2KN4 A;  2UZA A;  3MM7 B;  3KKF A;  3ELH A;  3M2V B;  1TV6 B;  4WZQ A;  7AT1 B;  1NB7 A;  3MEE A;  3DRY A;  4CI0 B;  2QGF B;  2HSE B;  1BWV A;  2ZDP A;  3I4P A;  3TAR A;  1JJH A;  1JLE A;  3CMA S;  4KHP J;  1RAB B;  4LF4 F;  4Q7A A;  4UQT A;  2F40 A;  3CCS S;  5IFM A;  2Y0B B;  2DJW A;  1S1V B;  2FVS A;  2RB7 A;  2P6S A;  2M8D B;  1GXT A;  2ATL A;  1PYT A;  5FLX U;  1U1L A;  3C46 A;  4RU2 A;  5L46 A;  3DGP B;  3IA0 A;  2W8K A;  1LWF B;  1IXK A;  2VAS A;  1EZZ B;  1YJT A;  5F8J A;  4DSL A;  4LRA A;  4L3K A;  3OLB A;  1RT7 A;  3LW5 C;  3G82 A;  1FDA A;  3HUL A;  2GVZ B;  1VIS A;  2H54 B;  1N6Q A;  2KXH A;  1RAH B;  3OL6 A;  2AV5 A;  2U1A A;  1RE1 B;  2G2O A;  4JI6 F;  2GGP A;  2BW2 A;  1NK0 A;  4B3O A;  3BSO A;  3PDN A;  4NCB A;  3GR1 A;  5EDW A;  3FFI B;  1S1U B;  1U02 A;  4IOC Q;  1ZOT A;  3T9Z A;  3HVR A;  3DU6 A;  3Q24 A;  4E2F B;  1JIH A;  2VOO A;  2JFD A;  3GR0 A;  2HAF A;  1L3T A;  1ITP A;  5KFK A;  3OR2 B;  2XMU A;  3B8H A;  3HHL B;  3A3P B;  3B54 A;  1AXQ A;  2G2Z A;  3VVU A;  2G9O A;  3KK1 A;  2DT9 A;  2HHH F;  1SPB P;  2C2M B;  3TP2 A;  1ZTW A;  2DIV A;  4EZ6 A;  1B7F A;  3DYA B;  2ZOF A;  4OZ5 A;  2DNP A;  3P5T L;  5GAG I;  1CUL B;  4HKQ A;  2KYX A;  2K7J A;  2AX1 A;  3KYL A;  3K17 A;  2HVH A;  1TUG B;  4K59 A;  3CDU A;  1HD1 A;  1S6P B;  3C14 B;  2VQF F;  4UF4 A;  4Y65 A;  3L9Z A;  2EFN A;  4QYZ J;  4KKO A;  2AGP A;  3R5C A;  3CJ3 A;  3KLE B;  3TX8 A;  4CZC A;  4OYP A;  1WWH A;  3KUE A;  3GIL A;  4KTQ A;  4LRF A;  3TVY A;  1RTD B;  3FGV A;  2CPE A;  1BQM A;  4O4R A;  5ETN A;  4M8L A;  1UJ4 A;  1XN9 A;  1S0M A;  2KT3 A;  4M1K A;  5KG5 A;  2Y0S D;  3E01 A;  4RU9 A;  4PPD A;  2D3Z A;  1TQL A;  2WB4 A;  3AB4 B;  2W2M P;  2DTJ A;  2KTQ A;  3SSR A;  5ETO A;  3C66 A;  5D0R A;  3JXO A;  3G96 A;  4CH0 S;  4BDP A;  1FD8 A;  1N0V C;  3B6B A;  1S99 A;  1VFJ A;  1IQT A;  2DVI A;  5D8H B;  4PWD A;  4PAA A;  2HS0 A;  2NXE A;  1RLD A;  4CQ1 A;  4JYA J;  3DM2 A;  3MAH A;  2YWK A;  2ALY B;  4AQY F;  2XLJ A;  1J5O B;  1FKP B;  2UUB F;  5IC6 B;  2Z30 B;  4DL0 C;  2Y1L B;  3MPW A;  3W5Z A;  4I2Q B;  3G8T A;  3M2U B;  3PW4 A;  2RDI A;  2RRB A;  2DR5 A;  4CNZ A;  1HBO A;  4ETZ A;  3KOA A;  1Q5Y A;  2A3J A;  2W9C B;  3SCL E;  3G8S A;  2HZA A;  2OKQ A;  2GQQ A;  2GIF A;  3T6J A;  1B0V A;  2DNR A;  3B4D A;  3JSY A;  5HAT A;  2WAQ D;  3RGI A;  2Q1L A;  2C42 A;  4NXN J;  4HT5 A;  4NXM F;  2R4F A;  1KDN A;  1DQ8 A;  1RTI B;  1SVD A;  3QT8 A;  4CT9 A;  3EVW A;  1I94 F;  4RW6 B;  2CFX A;  2YQ1 A;  2MZJ A;  1IUJ A;  1X4D A;  3RB4 A;  4DUY J;  1T7P A;  3BF4 A;  1ACM B;  2DNG A;  5ITH A;  3IN5 A;  2XCP A;  4KHP F;  4ZLN A;  2NSB A;  4WYW A;  2IRX A;  1HBM A;  3L7P A;  2RRN A;  2R7V A;  5KFR A;  4ANE A;  4KAI A;  2PEH A;  4RW8 A;  3R5A A;  2NYH A;  1RK8 A;  9ATC B;  3DLG A;  3DRP A;  3DNC A;  3I6P A;  2OAU A;  3MEC A;  2R3V A;  3QWU A;  4HEA 9;  2V2K A;  3RB3 A;  2CPH A;  2E5L J;  1YBU A;  3CJ2 A;  5LMU J;  3M8Q A;  2Z2Z A;  4UZB A;  1SIW B;  3OFG A;  2BR0 A;  4F0K A;  3GJT B;  2RJZ A;  3FCV A;  1TTH B;  3UD3 P;  2Y1I A;  1HNI B;  3EUN A;  2ZD1 A;  2LU2 A;  1RAG B;  1S9G B;  1IKW A;  4WFN Q;  4NYO A;  2OEM A;  3V6H A;  2VF3 A;  4HHH A;  1Q82 T;  5E3Q A;  2RU3 A;  3EPG A;  4MFB B;  4ED6 A;  2VB6 A;  4O4G A;  3MMA B;  4FDF A;  3NS6 A;  1M90 T;  1SQF A;  1N88 A;  4C3L A;  2HGN A;  4KSE B;  3ZZU A;  1HBU B;  3KLH B;  3O5T B;  1SJ3 P;  2CPJ A;  2KYZ A;  3OTC A;  3BKT A;  2MY7 A;  2ZBI A;  2L48 A;  2O5D A;  5A0Y B;  1SCJ B;  3QQC D;  5LL6 d;  3E8O A;  3CTR A;  1NAQ A;  1WJ9 A;  1YRX A;  2OGU A;  4FS1 A;  2V6A A;  4MTP A;  3RRG A;  1VQM S;  3UNY A;  1TMM A;  4MIB A;  5DG8 A;  4FYX B;  1XEZ A;  2MGZ B;  4KV8 B;  1OY9 A;  3GQC A;  3J7Z T;  4DR7 J;  3UNG C;  3RYL A;  4KPY A;  3F0N A;  2LFV A;  3Q2S C;  4RLE A;  1CJK B;  1FRL A;  1UZH A;  3D7S B;  2XTJ P;  2AEM A;  4HVZ A;  3MUR P;  4D3G A;  5L9X A;  3RRH A;  4ES3 A;  1IJE B;  4XDC A;  3P45 B;  1RA7 A;  3VAI A;  4WK1 A;  2C2E A;  2DPJ A;  3LP0 B;  2DGS A;  2EC0 A;  2JEF A;  2ADC A;  1S6O A;  2QYG A;  3Q83 A;  2AJ4 A;  3BQ2 A;  1RTZ A;  2K7K A;  1Q8I A;  1EET B;  2EFV A;  2EWH A;  2VBX A;  4OI0 A;  1NDP A;  3DRX A;  1TMJ A;  1VQL S;  3EIC A;  4RNO A;  3QLH A;  2J9E A;  2DH8 A;  1DTT A;  2IC3 A;  1RB0 A;  2M52 A;  4K4X A;  2XLI A;  4OHV A;  2V2Z A;  5U47 A;  3BH7 B;  4YFU A;  3MPD A;  3R7N B;  3KJQ B;  5AXN A;  2M7S A;  3NBP B;  4JYA F;  2XYG B;  2A10 A;  4I7F B;  5LJ5 Y;  2RDD A;  4Y2C A;  3BJY A;  3WQP A;  2UU9 J;  2BE7 D;  3S7R A;  2X51 A;  3QNW B;  3BGR A;  2VG5 B;  2DK2 A;  2ZZN A;  4MIA A;  2PD1 A;  1CLF A;  3MCO A;  4EFA C;  2HVI A;  3JS9 A;  1V3R A;  3PX0 A;  1QUV A;  3I0S B;  2LEP A;  1XMO J;  3RAM A;  3ENA A;  2A1B A;  3QGP A;  3IG1 B;  2VDH A;  3SCK E;  4F67 A;  3QBC A;  3TJ9 A;  2ZUG A;  5D4P A;  1XNR J;  2HLU A;  1HLW A;  1S48 A;  4NXN F;  3W2W A;  3D66 A;  1GX5 A;  4TLR A;  1UVN A;  2IJN A;  2E1A A;  1U45 A;  3QWP A;  5CYQ B;  4OHZ A;  1JLF B;  4XDD A;  3GJR B;  3VAH A;  2G0J A;  3QFW A;  3UVJ B;  5DG9 A;  2CJY B;  2CNK B;  2H51 B;  1JLC A;  4C7Q A;  4LIW A;  4DUY F;  3PW7 A;  3R7B B;  4PUO B;  2MB0 B;  5BYR A;  5CYM A;  1TKT B;  5HQ8 A;  3CJR A;  4LSZ B;  1H98 A;  2IYI A;  1XMQ J;  1RYS A;  2MQO A;  2LKZ A;  3Q89 A;  5T41 A;  1YTY A;  1XR6 A;  3O1L A;  2MQM A;  4URG A;  3W2V B;  2YX1 A;  2MHE A;  4UOC A;  1AA1 B;  2DRA A;  2J6S A;  1QDU B;  1BHN A;  1D09 B;  3G8Q A;  1IBM J;  3TZZ A;  4C8Z A;  4DUZ J;  5D3G A;  1C0U B;  3N01 A;  2FY8 A;  1ZPV A;  4ELV A;  5G4D A;  2E5L F;  5LMU F;  4CLW A;  1R8P A;  2QMW A;  5J2P B;  3OL7 A;  2I6W A;  4OJ1 A;  1HKA A;  3HK2 A;  4AL7 A;  5RUB A;  1X4F A;  1KN6 A;  1LNQ A;  1YQH A;  2OLW A;  1S72 S;  4RUA A;  4DQP A;  1T3O A;  4A8O A;  4ZIW A;  2EK6 A;  4PEO A;  2ZH1 A;  2VFS A;  4R5P A;  2AYB A;  1VC5 A;  2C3Y A;  4ALZ A;  4FF2 A;  4ECT A;  2XMW A;  2N4D A;  3BDP A;  3NAH A;  3CCZ A;  2YKN B;  2HZC A;  4A47 A;  3MCS A;  1SJF A;  4KT0 C;  3X3U A;  2ROP A;  2QSW A;  3DXS X;  1RQ0 A;  1R8H A;  5B0G A;  2F8M A;  2ZJQ Q;  4M5G A;  4ZHR A;  2AD9 A;  2MKY A;  1U1K A;  3H59 A;  1EP4 B;  1UFL A;  1H72 C;  2VFR A;  5F8N A;  4ZIV A;  1OS5 A;  2YPZ A;  2JLG A;  4DR7 F;  2JFK A;  4ZVP B;  2IVY A;  3KNA A;  1JKH A;  4N7T A;  1KP6 A;  4OYZ A;  3D6H B;  1D8Z A;  4RW4 A;  4ZVH A;  5M2U A;  3R8Y A;  2WON A;  2GHV C;  3OV7 A;  5KG1 A;  3NY0 A;  2GZO A;  2X3G A;  3DCA A;  4JI7 J;  2RHS B;  2MQN A;  4EMD A;  3SI8 A;  2XG8 A;  2DNN A;  1P8G A;  1YKW A;  2EEY A;  3EGZ A;  1OY6 A;  4DWI A;  4DL3 A;  3HMJ G;  2WVD A;  3MFH A;  2NXU A;  4X4P A;  4LFA J;  2YKO A;  1DHM A;  1VQY A;  3HJF A;  2R9L A;  2YWH A;  3ULH A;  3S8S A;  2EFQ A;  3GYG A;  5E2Q A;  4ZLJ A;  2Y3Y A;  1GTE A;  4URQ U;  3Q22 A;  3M8W A;  4KR0 B;  3AJ1 A;  1QTM A;  3DI6 B;  2B4U A;  1PJ5 A;  1LV5 A;  4CM2 A;  4ECV A;  3C15 A;  4UOH A;  1WDT A;  2BV3 A;  2A6O A;  3GIK A;  5FD1 A;  2QL7 B;  2ZBR A;  5DLG A;  4JI2 J;  3NS5 A;  4ZPT R;  1KTQ A;  1T3N A;  1NND A;  3RUB L;  1TL7 B;  2XY6 A;  2XMK A;  2R8I A;  1T05 B;  2FZK B;  2AZ3 A;  4QR1 A;  2UU9 F;  4WWS A;  3M2R B;  2FVR A;  3PIP Q;  3PW5 A;  1G4C A;  1V3S A;  1HMV A;  4JI3 J;  1TL1 B;  2YNG A;  1KD1 T;  1RP5 A;  4YB6 A;  3LP2 B;  1T0T V;  5CD4 A;  2EKN A;  3KLG B;  1U0H B;  4ES1 A;  4I0W A;  3VGU A;  4X4N A;  1UTA A;  3GYX B;  4LQ9 A;  1XMO F;  2YH1 A;  1N36 J;  3PEJ A;  3HP6 A;  2BKP A;  2CKW A;  1KBR A;  2DIT A;  5HP1 B;  3PRD A; 
#chains in the Genus database with same CATH homology
 2EXU A;  1NPR A;  2XHC A;  3LPE A;  2LQ8 A;  4ZN1 A;  2OUG A;  3EWG A;  1M1H A;  1M1G A;  2K06 A;  3QQC D;  4ZN3 A;  1NZ8 A;  1NPP A;  3P8B B;  3H7H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...