1IBKJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1ibkJ00
4KYZA 5A2QU 4GKJJ 3D3CJ 4X64J 1XNQJ 3IMQJ 3R2DJ 2UUBJ 3JAMU 4DR7J 2F4VJ 4NEZA 4V1Ak 1XMQJ 4DV0J 2UXBJ 4DUZJ 3J80U 4DR2J 2MEWA 2UU9J 2KL8A 3W1YC 4JI8J 4B3RJ 4LF5J 4DR5J 1IBMJ 4JI4J 4B3MJ 2UXDJ 2E5LJ 4NXMJ 3T1YJ 4DV7J 4LF4J 1HNXJ 5LM7E 4DR6J 4X66J 4AQYJ 2UUAJ 4DUYJ 1XNRJ 4JI7J 1N36J 4LF9J 4LF7J 4NXNJ 3R2CJ 4JI0J 4DV4J 4DR1J 1IBLJ 4YY3J 5IT9U 1HNWJ 4GKKJ 4LFCJ 4OX9J 1FJGJ 1J5EJ 4HHUA 3D3BJ 5FLXU 5BR8J 4NEYA 4DV1J 4LF8J 2KVQE 4DV3J 4KHPJ 4JI5J 4DR4J 4DR3J 1I94J 2MQ8A 1N34J 2ZM6J 4JI6J 4LFBJ 2MTLA 5AJ3J 1HNZJ 1XMOJ 2UXCJ 5LMUJ 4JYAJ 4K0KJ 2UUCJ 4YHHJ 4JI3J 4RJVA 3T1HJ 4X65J 4PWWA 4X62J 1N32J 3J7AN 1HR0J 5LMNJ 1IBKJ 4DV6J 3J81U 4JI2J 4DV2J 2VQEJ 2VQFJ 4LFAJ 2HHHJ 4B3SJ 1N33J 4B3TJ 4JV5J 4LF6J 5IWAJ 3OTOJ 4JI1J 4DV5J 4KY3A
chains in the Genus database with same CATH superfamily
1MROB 3M9NB 1IKVA 1WKJA 2HQGA 2ASYA 1CS4B 5SZTA 4B3RJ 1NK9A 1U45A 2KFZA 1M5PC 3HI9A 4JB8B 4LF4J 3EDRB 2AD9A 3EVOA 4F3QA 1U8SA 3QT5A 4AL6A 1NAQA 1BQNA 2BE2B 5AXLA 4F4KA 5IT9U 5KT4A 3NAIA 4OLPA 3ZZPA 2HS4A 1LW2B 4ZVPB 4ED5A 1A7GE 1Y5NB 2AJ0A 3IC1A 3ADAC 4O3QA 1SKWA 4PXEA 4ZCIA 5E7OB 5JMNA 4JI6J 4CO4A 2IDEA 3TR5A 2V8VA 1HKAA 2GHPA 1FJCA 3W64A 3CCTA 3VV2B 2IIHA 2VG5B 4KO0A 3G6ES 4J9QA 3OTDA 4NYOA 4FS2A 2YNIB 1EETB 1S6QA 3DRYA 1S1UB 2XO7A 2XEXA 3JTNA 3N5FA 1P6TA 3MR5A 2DGTA 4Y6IA 5E3PA 4ZHRB 2AMCB 4DFMA 3EXCX 3X1LB 3KNAA 3T6BA 3B78A 2OH2A 2MZSA 5MLCV 2ILZA 2HZVA 3BR8A 1HWLA 1YHQS 1RWNB 1DZ5A 1U0HA 2HQCA 1CJTB 3B4MA 2W2PP 3DMJB 4P2XA 4BC9A 1RCOB 4PPZA 1N5VA 1B7YB 5H1SV 1AXQA 4BWJA 4ANCA 4I7FA 2NPIA 2W25A 2COLA 3DOLA 3SQGB 1HQEB 4B02A 5ETLA 4TY8B 5D15A 3OHAA 2E7XA 3CF5Q 2B5JA 4DR3J 1K47A 1VYAA 2ZHOA 4YB6A 1JLFB 3A8EA 3QRQA 3MEKA 4KH0B 4WFBQ 1M5VC 2HNYB 2XSJA 4DV1F 1FDNA 1X5SA 2FY8A 3I55S 4EO6A 2MQPA 5LSRA 3CD7A 5C42A 1YZ6A 4JI1J 4MAKA 1HNZF 2F8EX 1G4CA 1ZZFA 2IDLA 5GAHI 4ECQA 3AH6A 1GQEA 3GFZA 3R7SB 4RZRA 3HZEA 3LOUA 2VBWA 3T1YJ 2DHAA 2YKNB 5DRKA 1KNZA 4QYZK 2NLWA 5K8OA 2PN6A 3CD5A 2F9DA 5CCLA 3OTOF 3CT9A 1C1BA 3PHEA 5M2UA 2UUBF 1RTJA 3MPDA 2V2ZA 1VQ9S 3GLJA 4CLPA 2DO0A 4WFNQ 1NH7A 1RWUA 5AXKA 3PKYA 3EM1A 4ELVA 3ENWA 3PR4A 1GMWA 1QAXA 1X4HA 4ETZA 3UDEA 4DSJA 5ETNA 3P6YC 1JLBB 3SCJE 2HBYB 3G82A 2XMAA 1Q8IA 1M5OC 4ZVOB 2CPZA 3OL9A 4P75A 3VZIA 2WOMB 1XMBA 3D1OA 1I3OB 1OSDA 5C25A 2ZH4A 4ECXA 1AB8A 2Q1LA 3K57A 2V8PA 4ECWA 1SB6A 1S9GB 3K89A 5CYJA 3M8QB 5DZ7A 2IJFA 2LLZA 5CABA 3BF4A 4LBIA 4A8KA 1RA6A 3CJKB 1MMDA 3IS9A 4CO3A 2R3VA 1PBAA 3BV8A 2CPEA 2W7PA 1XMQF 1VQ4S 4QW8A 3CCUS 1PG5B 1Q82T 2IAJA 5E0OA 4DR5F 1LEOA 3OVBA 3W8PA 3R27A 2GNKA 4F2SA 4LF8J 5KFWA 2HVHA 1B0VA 4ELTA 1I94J 4MJKA 1TU0B 3FCHA 1BC6A 2VPXB 4O0IA 4Y65A 1ZETA 4O4RA 3DLKB 3MAAA 2BJ1A 4C4WA 2F1FA 2EG2A 2A0FB 1ZOTA 1IM4A 1C4AA 3EVWA 1B99A 2C3OA 2DGVA 1ZAXA 1J27A 4V19J 5J2PB 4RNOA 2QL5B 4FNHA 3RB3A 1NJXA 1YRUA 5C24A 5ADZA 5A0YA 3NCPA 4TN2A 4X4PA 1S0NA 3V5RA 3AOCA 1RHQB 2BM0A 1CJKA 2DHGA 4J9VA 3MAQA 4MKYA 5HMWA 1FK9A 2YBVA 2QSWA 3GG0A 1K8AT 3QRRA 1DRZA 4WJBA 4IRDA 1FCAA 3IG1A 4NLUA 1QAJA 5E3QA 2KKHA 6FD1A 3RJMB 4N8NA 2PI4A 1AUSL 1LWCA 3MEDB 4QR1A 3G9CA 1NO8A 2CG4A 1QUVA 4FF4A 2HNDA 4IDKA 1RHJB 3EICA 4GKKF 4ZVSB 5M2PA 1IKYA 1X4EA 2UV8G 4WBFA 2X51A 3V4MA 2HVDA 4E8UA 3RYLA 2DNQA 2MQ8A 3OR1A 4ES2A 1H98A 4PYDA 1CJUA 2QA1A 3ZTQA 2LEPA 3IM9A 2BKOA 3M2RB 4YHHJ 4TLQA 3UD3P 3M4XA 2J7WA 2V2VA 1ZTWA 1PAUB 1HBNB 5LJ5Y 4LFAJ 5KFCA 1KHWA 2E1PA 3TA1A 2GJFA 1X5OA 2XMUA 3EGZA 2YVSA 3PCOB 2VV5A 4H4OB 4ZS6A 4PG7A 3TARA 2GVDA 3HM9A 1WF0A 3M32B 2XLIA 1FWLA 1QE1A 2N3LA 2MJUA 3O2IA 3U02A 4P10A 4ZDNA 2Z56B 1K1QA 3U27A 4ERDA 2RILA 3RUBL 4DQRA 1WC4A 4DV4J 1T7PA 2ZH8A 4FS1A 1RTHA 3QJJA 4USKA 2ZE2A 5K8PA 4Q2MA 1D09B 4C7QA 2DR6A 2OLWA 1N56A 3HK2A 2QA4S 2VZ9A 4USVA 3EGWB 1YI2S 5GAGI 2IPOB 5I42A 4KKOA 3TRGA 1GMUA 3KHHA 1FTRA 1BHNA 1R27B 4TU9A 3EGNA 1QY7A 2R2UA 1KD1T 2B9XA 1UKUA 2D9PA 1V6HA 2B9WA 2HHPA 4W4MA 1TAUA 4GKJJ 1KSPA 4K4ZA 1B4SA 3NLCA 3M2VB 3PYEA 5IV4A 1ICEB 3G96A 1TV6A 4MK9A 1ZS6A 3VTIA 2OAUA 4YDDB 6AT1B 3HO1A 4NI2A 5LL6d 4B9LA 1RT6A 4DLEA 4PKDB 3KLFB 2R2SA 2J0QD 1M1KT 3Q24A 1ZBTA 4ETXA 2BW2A 2J6TA 3NGDA 2QLJB 1ZZNA 4NYZA 2VH7A 5D0HA 3PY8A 3GE9A 5DDOC 3CGIA 2EEYA 2JC1A 4URGA 3GJTB 1BLUA 2IBOA 2CZ9A 1B64A 3PZPA 1O5JA 2DRAA 2JOQA 1DTTA 1RZMA 2WVBA 4NZ7A 3I0RA 4F0MA 3NS7B 3IRWP 2FUG9 3FSIA 3GZ7A 2UVVA 1N34F 4UQTA 2IRYA 3MMAA 3QZ7A 2K1RB 1T02A 2CJXB 3HSGA 2G0CA 3WBZA 5IWAF 1WC5A 2LDIA 1Q1KA 4C3KA 2CRLA 3NL0A 4DPYA 2MKSA 1AFIA 1GNKA 4ZPBA 4USTA 3POTB 1TMMA 1EP4A 1M5SA 2J5AA 3QBCA 4USJC 1S6PA 2OPRB 1O8BA 1RB0A 3KFWX 3MCNA 1GMVA 2ACMA 4KPCA 5H9FK 4C0HA 1RAAB 2ASDA 1HWKA 3SIPB 1WORA 4KV8B 1U1PA 3QO9A 2LQ8A 3AODA 3KLGB 5KOXA 5K14B 4JBCA 1NRKA 3TOQA 4RWWA 2MYFA 5L38A 1B3TA 3FSYA 4DS5A 1RAOA 2YWWA 2GQQA 3NS5A 3OJSA 2PA8D 3WX8A 1R89A 2G2OA 3G8SA 4B9NA 2DBBA 1G1XA 2ZD1A 4RLEA 4G6VB 1BY9A 2UUCF 2OO4A 2RRBA 3D7SB 1KONA 1L3TA 1YJWS 3Q8QB 1WC1A 4EI2A 2MQNA 4CO2A 1YLXA 4I64A 5HBMA 2D41A 2DTJA 2GA7A 4RW9B 5BYQA 2QMXA 4CTAA 1WJ9A 1XMOF 1UVLA 1XNQJ 5LMUF 1KRPA 3LP2A 1HPZB 3OFGA 4DLGA 5HVGA 2YXLA 4KH1B 2R4FA 1JJ4A 1PIEA 1YBUA 4U7UD 4NZ6A 4IG0B 2UUAJ 1GXLA 3QAUA 4DXLA 3T9NA 4Q44A 4OJGA 5GMKa 3CNQP 2ADBA 5HI7A 4ES3A 1Q5VA 1Q8BA 2HNZB 4OI6A 1E6VA 1E6YB 3DHXA 5GAEU 3DLEA 2L9WA 4ZVGA 3RAMA 2GQ2A 3DFEA 3TJAA 2PFFB 4HEA9 4KGKA 5ETOA 4IH5A 1VHFA 3GONA 1Y0HA 1S10A 5GADI 1TTHB 4JOUA 4B9MA 2WVFA 1G6BA 3LP1A 3M1VB 3ZZUA 2RDJA 4JI3J 1YK9A 2GGPA 4W92B 1IQTA 2OUGA 4YMEA 2YX4A 2XQCA 2KT5A 3MEEB 4HACB 4DV2J 4ED6A 1OY6A 2E7VA 1ZA2B 2H1YA 2E1MC 3Q8YA 3HVTB 4LRCA 5KG6A 3I6PA 1FX4A 2GV1A 1WI6A 2W24A 2UVWA 3JTPA 4JI8J 2XLKA 3S8SA 3HHDA 4I6AA 2KRBA 1ZM9A 2BDPA 5H9FJ 4OX7A 4HTIA 3MTJA 4ENOA 4B3TF 2XHWA 3DOMA 1MROA 1VK8A 1V3SA 2F5GA 2QEXS 1FHTA 1CS4A 3P5TL 4Y28C 3HVRA 4RBVA 3PW4A 2CPIA 2HBZB 4JI4F 4F8RA 4RKUC 1NK4A 3CSKA 1S5ZA 3R1HA 2KH9A 2BE2A 3QFWA 1LWFB 2GO9A 2V4JB 2NUHA 3SQOP 9ATCB 1HLWA 2W8KA 3ITHB 3PYDA 4N77A 3GV7B 3I31A 1RU1A 1N52B 1A0OB 1KVIA 4CLYA 4CYUB 1IKWB 4UOCA 3DC2A 2FJBB 3K58A 4IG3B 1NPKA 4C11A 1M1HA 4ZVHA 2VG5A 1RWWB 5DGAA 2MKYA 1SL2A 2XNRA 2YNIA 4C8OA 1YRXA 4X62F 2PC6A 3HSJA 2VHGA 3RB6A 1EETA 3ZZZA 1TKDA 3CJ8A 2DGSA 4WYLA 2RE1A 5LM7E 4LF6F 2AJFE 1HD0A 3M05A 1HL6A 3NY0A 3UCUP 4MFBB 2MSTA 1QAIA 5IOLA 1EX8A 4WP8A 1MW7A 3J7A1 3ZXWA 8RUCA 4R25A 1FXLA 2FLLA 1JKHB 3MR7A 2MZRA 1CJTA 3QNWB 1GXTA 2K8GA 3IFEA 3DMJA 3R5GA 3GPAA 1WELA 3QRPA 4OYOA 1IKXB 4RW4B 2MSSA 4ICLB 2CQ2A 3A3OB 4ER8A 2RRNA 3SQGA 1HQEA 4TY8A 1REVB 1CBKA 1P9QC 2CPYA 2WW8A 2HZAA 4ECRA 1FT8A 3CDUA 4WP9A 1SC6A 2DGUA 2LXUA 3T5LA 2RQKA 2D3UA 3D3CJ 1FRKA 2L3MA 3KKFA 3RBXA 2JLFA 4J9LA 1TFWA 2MZ1A 2W8LA 1NNDA 4DPWA 5D8HB 1S49A 3EMTA 3MM8A 2V8GA 1DURA 2L08A 3BREA 2ZVSA 3C15B 4R5PB 3D1HA 4LF5F 4UUXA 1HNXJ 1H74A 3FBCA 1NU4A 2XULA 2UVUA 5JJBA 2WRMA 1B70B 3W7BA 1D8YA 1KHVA 1Y3KA 1ZTTA 4GKKJ 1C2PA 2BKNA 2YKNA 2ZH3A 1ELOA 3I5AA 1F60B 3HZGA 2DGXA 2OELA 4JI5J 2NSCA 1VHIA 4DBQA 3BPSP 2MTLA 1IM6A 2H54B 1XWLA 5D4PA 3Q86A 1S97A 1SXLA 2W7OA 5AXMA 4EUVA 5I3UB 2HHQA 1NHKL 3G8QA 3HSDA 4Y3CA 1BE4A 3WC0A 4RUCA 4WF9Q 1JLBA 3R7BB 3MAHA 4WP3A 4DL2A 4UTGA 4U95A 2OD6A 4ZPAA 5HAOA 3KDNA 2E7WA 2WOMA 5KG0A 2RJZA 2ZH6A 1M5KC 1N5TA 2LU1A 4FYVB 2MQQA 1Q7YT 5CD4H 1VJWA 5B7WA 5D0RA 3CDEA 3MUVP 1TKXB 1S9GA 4AXIA 2UXBF 3AXKA 4B17A 1T3OA 3MPWA 1EHWA 2AGPA 3M8QA 3GYNA 3RR7A 2CQBA 1SKUB 3JS9A 4U7UK 1M0SA 3UN3A 4LR9A 5CA5A 1Q7LB 3ILJA 4J9UE 3R1LA 3NBPB 1YQHA 3DRXA 5DQIA 3TQ1A 4WKYA 3QATA 4CLTA 1BWEA 5IC4B 5HJYA 2AYGA 2CQ0A 1PBUA 1WOPA 5L1LA 1FTCA 1KC8T 1HI8A 1V3RA 2OMLA 3OXGA 2SXLA 5KT7A 4A8MP 2JLGA 2OPSB 1N4LA 1UETA 5AT1B 2R7TA 3U7JA 2WTFA 5FIIA 4ED2A 2GMLA 2CKWA 3DLKA 5IFMA 2CPJA 1IJFB 5KFUA 4YDXA 3UQSA 4RNFA 4DS4A 5L46A 3QSIA 4Q0BB 1NSQA 3OL7A 2JFKA 1SH2A 3CDWA 7FD1A 2MY8A 2Z30B 3DU5A 2DXDA 5KFJA 3U1LA 4IRCA 5B08A 3KLIB 3OFFA 5LJ3Y 4X4TA 3GIKA 3UO0A 5F8LA 1NKEA 3JYTB 4CLLA 4KTQA 2W9BB 3VR1A 1JNZB 3PG9A 1GTEA 3SBMA 2MQMA 1RBOB 4AQYF 1Y4ZB 1FRMA 3LANA 4G1PA 5ETSA 4USUA 2CZ4A 5HQLA 4KGMA 3U1MA 4RBUA 1RWMB 1UJ4A 3FVYA 4F50A 3V6DA 2HURA 2QLXA 3LPEA 4DF8A 1RAHB 2ADCA 3Q89A 5MAOA 3J81U 2NQPA 4PQAA 4PUOA 1LW0A 3BPDA 1VQ5S 5IWAJ 2VONA 2XMKA 2DGOA 3M2RA 1OJ4A 5F8MA 3IMQJ 3IRXB 2QYGA 1HBNA 5ETTA 1VBZA 3TI0A 1WEXA 4G65A 2CDRB 2BJEA 4LT6A 2YKPA 5F8IA 4C8LA 3DNCA 3KDOA 3MZIA 4H4OA 4Y2MA 4LF2A 1U47A 1SKSA 3QJPA 5KFHA 4PG8A 2J9DE 3M32A 4URSA 4RW6B 3H40A 1RSCA 2B56A 1SC3B 3OQ2A 1RAIB 2DCUB 4ZP9A 1NK5A 3CPWR 5F0UA 2HFUA 3CCSS 4KQZA 4LSNA 1SL0A 5F8JA 2XTJP 3FFIB 3QGIA 2ZEJA 1N6QB 1HNWF 2DY1A 2UUCJ 1LFPA 3D54A 2F8HA 1NZAA 3WX4A 1EARA 2HS3A 4OI1A 4J7CA 3KLEA 5DLGA 2HPUA 1ULRA 2XCPA 2HQFA 4KT0C 4NCAA 2DNYA 3FGVA 3SSSA 2VUGA 1S0VA 3SEOA 4WZQA 4TXSA 3N6LA 4HT7A 3QMQA 2BZ2A 1R6VA 4PXCA 2V94A 2QE5A 4U8YA 3PFEA 1Y5IB 4DFJA 4M5MA 1H72C 3LGHA 1KQGB 5FD1A 2DR9A 3I87A 1C1CB 1U1RA 1VRTB 2IYGA 1N88A 1Y7PA 1LFWA 4ZCMA 2LA4A 4H4MB 1HMVA 2ZDPA 2AF6A 1FFWB 2G9OA 2KVQE 1IN0A 2R7SA 2GC8A 2HK3A 2X7IA 2HHSA 3AB2B 3OTBA 4LF7F 3M8YA 4LUBA 4RW8B 2ZVIA 2DEIA 3CDAA 2YNFB 3VQSA 2X1FA 1VQNS 5CYMB 4QIFA 2EK6A 2OPPB 4A8SA 1IBKJ 4F36A 3DDIA 3RBEA 2JH3A 4ZITA 1N48A 3PTWA 1UEUA 4HL9A 4LFBF 3IXQA 2XI2A 3ZZ0A 2DEJA 3TZWA 2ZZNA 4IOCQ 1FKPA 3MPUB 4Z2XA 2I1RA 1QAYA 2A1BA 4KHRA 3J80U 4CIOA 4DF4A 1HR0F 3HDSA 3Q83A 4M95A 2VQEF 1HNIB 3MM7B 1MMLA 2M3DA 2A6OA 2E1CA 1D0EA 1FF2A 2VD3A 3GCWP 3POTA 3TA2A 4L3NA 1GFWB 3OUYB 4NXMF 1PC5A 3KK2B 3QJLA 3RRHA 3RZAA 1TFYA 3GWCA 2BRLA 1EQMA 1LK5A 2YH0A 4KV8A 2KFNA 4R0JA 4M5LA 1MWYA 4YOEA 2DK2A 3KLGA 5K14A 1S0MA 1F2GA 1VQ6S 5AXNA 4F3MA 1T3NA 4NLSA 4OX9F 4Q43A 2IYIA 1QD1A 4DL7A 1DARA 3D5MA 3DRPB 2HHHJ 2HEKA 1FI4A 2R8JA 1TP7A 1P8GA 2UXCF 4KIAA 4USWA 2WZ1A 1VBYA 4BDPA 3CCRS 3RAQA 2QMUB 3B82A 3NCRA 4RW9A 1RUSA 4B9UA 3RRKA 3CJQA 3WZ0A 4QYRA 2FHOB 1NK0A 4MYUA 2IJRA 3J7YI 1X5PA 3DLBA 4IQXA 3BYRA 2XY5A 2EC2A 2XZDB 4ZPCA 3W60A 1RYSA 4IG0A 4QQBA 4KPYA 1HWJA 3TAMB 1OPZA 2WHOA 4NE9C 4YB7A 2K7JA 4F25A 4NLGA 2HNZA 4PYAA 1S6UA 2LP4A 1PCAA 2U1AA 3ZNUA 4O4GB 4MMOA 1V9OA 2BYCA 1K0VA 2HQDA 4ZA1A 4X65J 3LGNA 5HMXA 4DSFA 4EBEA 2VQFJ 1HYSB 3W2WB 4EU0A 3UWTA 3HHLB 2X1GA 5HMZA 3M1VA 4J37A 2ZFHA 4AD6A 3GP9A 2AZ1A 2E44A 2GJIA 4DG1B 4HACA 1SH0A 4PEOA 3T19A 4LF5J 2ZH1A 2QJ3A 1KDNA 4C8MA 3C46A 3DYAB 2E1RA 1KFDA 2Y3YA 3QYYA 5F9LA 4EWTA 4C48A 5DDPC 3HVTA 1S1VB 3W5YA 3JQMA 3DI6B 2BR0A 2HYIB 4WXOA 2EWHA 1ZYQA 4DV7F 1JJ2R 2KO1A 3PIPQ 1N36F 1RT3B 1U02A 1R43A 1RXOB 1X4FA 3GB0A 5HVFA 8AT1B 2PA3A 4J9KA 2JC0A 3Q8SB 1NJIT 1EAYC 4RL1A 1N32J 1LWFA 2V4JA 4J9OA 1R0BG 1VS3A 5F8HA 3MM5B 3ITHA 5LSOA 2F4FA 1LWXA 4ZN1A 4YEAA 3M6UA 1VQOS 1CQMA 1WHXA 1K44A 2F4VJ 4H54A 3GYXB 4DR2J 1TKTA 3IR6B 1J5OB 4XPEA 2J6UA 4IG3A 5BJRA 4QWDA 2EFPA 4EGLA 1O0PA 3QGPA 4RO0A 3TP2A 3HKZD 3K5OA 1MU2B 3ET6A 4Z7CA 4CH1A 4MKVA 2LECA 4OI2A 4XPCA 4PWDB 3NEKA 4ZOSA 2RQMA 4FDFA 2VC1A 2XMVA 2RS8A 1KOOA 1U6FA 5B0FA 4LBPA 3R5CA 2B4PA 2NYHA 3HHLC 4JI7F 4F04B 1JKHA 2JL9A 4ECSA 4C98A 2H5EA 4G1IA 2QV6A 1RADB 1IKXA 2QO3A 2IHR1 3JSRA 1JWWA 3GCXP 4DCPB 4ICLA 4MIBA 1CLFA 1BQXA 4JV5J 2O1PA 1KOHA 4AL7A 2F7VA 1UPPA 3PYFA 2LEAA 4HYKA 4F4AA 2C3UA 2KG0A 2BX6A 1DTQA 4KRWA 1CULB 1YTYA 2BABA 2E5LJ 2RRAA 2QA2A 2C3PA 4GO7X 4OV6A 3MM9B 3E3XA 3DRRA 4IOAQ 2L48A 3BB5A 4IO1A 3N28A 3BO4A 3C15A 2W7AA 1MN7A 3LTOA 3SCKE 1C0TB 1CEZA 1RTDA 2O67A 4FXDA 4C8ZA 2HQIA 3H4BA 2DISA 1NHUA 4CH0S 1ZPVA 2A10A 1KQSR 1KEKA 2DGWA 1TR0A 1VCTA 3TAPA 4EO8A 3CO0P 1FJGF 2IJNA 2CVIA 2HWIA 1UZHA 4GVBB 1LNQA 2BOAA 4OV1A 1PAEX 4F4XA 4Q8FA 4ZP6A 1NXIA 3R9LA 2KB2A 2R7VA 3M8RA 1HHQA 2QIFA 3N6MA 5CHCB 3CB4A 1DY3A 3NMAA 1DLOB 5HATA 1W25A 5I3UA 2UU9J 3BSNA 2Z2ZA 1JXLA 1RP5A 1YJ9S 3GFXA 1R8PA 1S77D 2HWTA 5J2MB 3OTEA 4CLFA 2NXEA 5D77A 4UOHA 2DITA 2B4UA 3LALA 2MZTA 4P2MA 2B51A 3SFGA 1WEYA 2ZH7A 2K06A 3C8YA 3FEXB 4UUWA 4F67A 2F8MA 3BBBA 5T7LB 4ECVA 5JVHQ 2L9DA 1G2EA 1LXNA 1YITS 1TKXA 1EJ7L 4LF9F 1Q53A 1TKZB 1WD6A 3BBCA 3FMWA 3O8WA 4K4SA 4QWBA 2WW4A 3PVXA 1NH8A 2IM3A 3KUEA 1NPRA 4JV2A 2DNGA 3DM2B 2RQ4A 1J2VA 2M88A 1VMBA 2WCXA 3HJVA 1UP1A 3BEGB 1NUEA 1UFKA 1VOMA 4HLBA 3H98A 2LFVA 3T1AA 3MWBA 1X5TA 1RT2A 3MHYA 4PWUA 2OPSA 2AX0A 2RNEA 5KFBA 2BUNA 1HBMB 3H5YA 3EZUA 1ZPWX 2HRYA 3W5XA 3NNAA 3PW0A 5ETPA 3SSQA 4DR6J 5A8KB 2HG4A 1UW4A 2HGLA 1GTHA 2PIIA 2DO4A 4Q0BA 4F4WA 5D3GA 3QSYB 2FJWA 4K4UA 2R7QA 3G6XA 3FCVA 2YNHA 4P52A 2E9RX 3MEGA 3QIPA 1RAFB 3TUJC 2CNKB 4WYWA 3VGUA 1WWHA 1HHTP 3JYTA 1SV5B 3KK1B 4TLRA 1VQSA 2W9BA 2XYHB 3UR0A 1Q78A 3RB4A 4M5GA 4L6V3 2QSFA 3Q23A 3MMCB 1UVIA 1HIYA 4WIQA 3RRGA 1URNA 1WKLA 1N33J 1KFSA 4J9MA 3RR8A 4DV5J 5LOQA 1H3DA 3HFZB 4FYWB 2GMJA 2DY9A 3UCGA 3D0IE 4F4ZA 4QPXA 5KFTA 2GHWA 3BH7B 1L5UA 2CQ1A 3D9BA 4JI2F 2DB1A 3AB4B 4CH7A 1U1OA 1H2TZ 1HARA 3IRXA 4DUYJ 1VRUB 5EDWA 4K5SA 5IV3A 3GSDA 2R7XA 4A48A 2BJ3A 3W65A 4LFCJ 5E41A 3M8WA 1NKCA 2GIQA 1S59A 3CCVS 1FEEA 1HQUB 2XNQA 1RWVB 1RTZA 4O44B 1UW9A 1OO0B 4RWXA 2Y8WA 1QDUB 4YY3F 3G86A 2I5JA 2J7UA 1DHMA 3CJRA 2PT0A 2GX8A 2P6SA 3J81Y 3ZC4A 4OYPA 3GYGA 5LMNJ 2NCKL 2XWXA 4DV3F 3B54A 1F3VA 1FRLA 4C9DA 3RG6A 3K5LA 3FFIA 4FPIA 3D28A 4DMZA 1AT1B 1IR2A 3O1LA 4DV0J 4CM0A 5T14A 2WVEA 1VQKS 1SIWB 3MTKA 2MKKA 2GVZA 1HI0P 2QZ8A 2VG7A 3PDNA 1YBAA 3DLHA 5DG7A 4ZN3A 4IFVB 4MTPA 2C42A 4CCHA 4K4XA 5KFDA 5B0CA 2BANB 2M4MA 4TVAB 3N4WA 2W4DA 3R3TA 4CM2A 1FWPA 4AYBD 2HHXA 3GJQB 2WBRA 1VRTA 4RR5A 3JQJA 4H4MA 1AYEA 1K73T 3F0NA 3J7YU 3TX0A 2DH8A 3D2WA 2XS5A 2FHJD 3E51A 4MK7A 3CJ2A 2MLYA 2LQ5A 2R2TA 2KN4A 2Z2YB 3AQPA 1U6BA 1IQZA 1VLOA 3HX9A 4RW8A 1NK8A 1R0AA 4YP3A 2YNFA 4X64J 1TMJA 5CYMA 2JNJA 1RWKB 2YWHA 4WFZA 3EPGA 2YQ0A 4K4VA 3OJUA 2OPPA 2VFUA 1UZDA 1WI8A 5AE3A 1T05B 1VBKA 3UNYA 1RBLA 3NXZA 4FVCA 4ZVEA 2WVCA 2UXDF 2KZZA 2V6AA 3MR3A 3MPYA 1D3WA 2YKOA 4YQWA 4J9PA 4IYQA 4B9VA 4N8OA 4JI0J 2FVRA 1XR5A 1NEEA 2AJ4A 2YWGA 2BJ8A 1HNIA 2CJYB 3P96A 4DQQA 3HKWA 4RU2A 4X4UA 4AL5A 3W2VB 3LP0A 2DXEA 3PJWA 2UVRA 2OEKA 3BM7A 2BRKA 4LMZA 2QGFB 2PMZD 3TVZA 2BJDA 3OUYA 5G4DA 3KK2A 1RHMB 3G6VA 2D1CA 5D4LA 1X4BA 4PWWA 3THPA 5KT2A 4DPOA 4M5IA 4TQRA 2FLOA 3NNCA 2DNZA 2DNHA 2FQQB 3CWJA 1JX4A 2BV3A 4X4SA 3M6XA 4Q7AA 3VHQA 2NXCA 3CULA 5T41A 7FDRA 3J80Y 3M8ZA 5DM6Q 1YIJS 4ES1A 3DRPA 3CC7S 3MR6A 4NLPA 2LVWA 4J90A 3BGRB 2A18A 4NLVA 3AXMA 4DL0C 1RT7B 1JLEB 5HMYA 2KFYA 2AP6A 2DT9A 2G2YA 1S1TB 1OY8A 3P3DA 1T9YA 4YR2A 5DLFA 3DKDA 5LT5A 4IUFA 2Q3PA 3MURP 3EX7B 1RKIA 4OX6A 1KVKA 5AJ3J 5KFQA 1HBOB 2RDDA 4ZLLA 5M2RA 3C66A 4ANEA 4O0NA 3GIMA 2H9ZA 2ZWPA 1FRJA 3TAMA 5BR8F 1SC1B 3W61A 4QR2A 3OXLA 1KLMB 3EE3A 5J2QB 4O4GA 1CC7A 3DHWC 5I4MA 2IA6A 3BSAA 2ZJPQ 1FVSA 4AUKA 5J1PA 4RX6A 2QMWA 1IR1A 1IBCB 1RGVA 3ONQA 4DFPA 3W2WA 3TANA 4AT1B 3KXDA 3HHLA 4DI6A 4NLWA 3Q22A 2I2YA 3M7VA 1SQEA 2YWKA 5B09A 5CYQA 1PYSB 1Y9OA 3HJFA 4UW2A 4DG1A 4LRDA 3L4BC 1AZSA 4ZPVR 2PE8A 3DYAA 1U25A 3JTOA 2XWYA 3M30B 5GVQA 1CJVB 4NOHA 3Q0AA 5KOWA 3UD5A 3T41A 4CLWA 2RU3A 4EBDA 1TVRB 2B3TB 2MKJA 1PSDA 1P27B 1KP6A 1UAWA 1YWXA 1YZ7A 1U6ZA 3DI6A 1Q0NA 2XY6A 2OGUA 1IJEB 1UVMA 2V8HA 1N5YB 4YR0A 1RT5B 3SCIE 1GEHA 3AA8A 1UPMB 1RT3A 2NXJA 5GAEI 1NDCA 4DR4F 1U2CA 2BJ7A 4OZJA 3KMSA 2CQHA 2YNGB 3RGIA 3BDPA 1FRXA 1FESA 4NEZA 5KFMA 4ALZA 5L1JA 3HPOA 2AJQA 3ELHA 5L9NA 2LCWA 4B3MJ 4NMXA 3I4PA 2JX2A 3JSBA 1NK7A 3IBWA 3EZOA 2CQPA 1KWMA 1CG2A 1Y11A 3BKUA 2YQ3A 2YWEA 4BWMA 2LQJA 2P2CB 5KFIA 2WONB 2HMIB 4NCGB 2QTWA 1DAXA 2AGOA 1DQAA 3D6HB 1WOSA 2C2RA 2XG8A 5FDLA 3ZTOA 2BVZA 2DJWA 1MU2A 2QT7A 3VAKA 1XNRF 3HHLD 4KHPF 4NLXA 3EYZA 4PWDA 4QW9A 5HN0A 2EK1A 2GFFA 3D1QA 2X3GA 2P8IA 1HWUA 2ZHBA 2C2KB 1FKOA 3MMJA 2NXUA 3EUNA 1C0UA 2IM2A 4N56A 2AYMA 3HHKA 4KFBA 4ED8A 1JK9B 3C2PA 5JUMA 2J7KA 2FHKA 4ZLNA 1RLCL 3C14B 5DGBA 3LA0A 4RW7B 3NNHA 3FQLA 1HBUA 5CCMA 1X0PA 2O66A 3H2VE 3H90A 3I9ZA 4I69A 1JQGA 4HDHA 4KAIA 1H38A 1IBMJ 3PJXA 2ZOMA 5KG1A 5C7PA 1X7VA 3FCWA 4YFUA 2R8KA 3IAM9 4KE5A 1RI7A 3L7PA 4NLRA 3WIVA 5B0GA 3GIIA 2JEJA 1CULA 4PZVA 1U49A 2AIRB 2MLZA 4UOFA 5ETRA 2GO8A 4OZ1A 5KFLA 1S48A 3FRZA 4EFAC 4USMA 1MSWD 3CD6S 4DX6A 4CQ1A 2XZWA 2ZKTA 4Y34A 4J9NA 1JXEA 3ETOA 5EGYA 2MY7A 4DU7A 3WIUA 1RTIB 5KAKA 1N0UA 2FYXA 5C42B 4K4YA 1YDLA 4P9SA 5KFYA 8ATCB 1U1NA 2AHOB 3PO5A 2AEJA 3MD3A 4GVBA 1MNEA 3IO1A 1Y00A 5K20B 2XMTA 3DU6A 1EKSA 2HRUA 4OJ3A 5I3PA 1NPPA 2HFNA 4R8UB 3F56A 2C1EB 1VC0A 1DLOA 1C1BB 1S9EB 3L7OA 1I1GA 3SDEA 1NB7A 5KG5A 2JSXA 3TUZC 2HW3A 2NS1B 2AJ1A 3CE8A 3W5ZA 1WF1A 3L9ZA 5J2MA 1J5EJ 2MGZB 1NSPA 1U1LA 2XBPA 4LF4F 1D9AA 5HLFB 3WC2A 4NLTA 3NMRA 3CJSA 5CD4A 3O3LA 1JIHA 1OQ3A 5T7LA 4LSLA 4FVMA 3G82B 4OMFG 3RTVA 3M6WA 3BN7A 5DM7Q 4QYZJ 2D9OA 3VAIA 2YX7A 1LQ9A 1U2FA 3PRVA 1FJEB 3A13A 2MDAA 4JI6F 2XO6A 3BQ0A 1NSAA 5E3CA 1S72S 1PJ6A 3LAKA 2LQ9A 3Q2TC 2YY3A 1RJJA 3DM2A 1PILA 2FGCA 3VAGA 1UFWA 1Q16B 4NYPA 2KYZA 5BXIA 2EKNA 2NPFA 3NGKA 3RW7A 2HLUA 1BD6A 1KTQA 2BACA 4WFAQ 2JEFA 1FJ7A 4C8KA 2PEHA 2OEMA 2OSRA 2FB0A 3CCZA 1FERA 1BMQB 3HT3A 2P5VA 4NXNJ 1APSA 1HBMA 1LK7A 3H20A 3TZXA 3ULHA 1VQ7S 5A8KA 4AFFA 4OHZA 1T94A 4X4NA 1SJ3P 5A8RB 2QX0A 2QYCA 2NR0A 3FRYA 5ETMA 3IN5A 1OY9A 1Z4UA 3OXFA 3ZTRA 2UP1A 2Z2MA 4F0KA 2CWXA 4DFKA 4ZP8A 1EQ0A 1JXVA 1XERA 3E01A 5KFAA 5KTQA 4NLYA 3MAAB 4ILMA 2F63A 2FZGB 3GIJA 3RBZA 4WFYA 3EGVA 1OYEA 4DR3F 3J7Z5 4RUAA 1SV5A 2ASLA 4B3SJ 3NWRA 4DWIA 1N8RT 2HVEA 1H2VZ 1KQKA 4KYZA 4C6AA 5A2QU 1ZH5A 5ITHA 3NGUA 3HD1A 3MMCA 5KFRA 2N82B 3BGLA 3CCMS 4WE1B 1T03B 1Q8KA 3AHPA 3KJFB 1T9UA 1FK9B 2UXDJ 2RF2A 1TK5A 4M63A 3N6NA 4JI1F 3M9MB 3IG1B 3MXHP 2U2FA 3EZ5A 4XAKA 5B0AA 2YKMB 2FGOA 3BYPA 2HNDB 4IDKB 3ENVA 1S1XB 2PMWA 4DL3A 3T1YF 1C4CA 1VRUA 1IKYB 2WVDA 1HNVA 1OPIA 3T3FA 4C0OC 4JP8A 1BQMB 1T11A 1Q4RA 2XMWA 1SQFA 2I6WA 1Z2LA 2M7SA 4DL4A 1CJUB 9RUBA 2WSCC 4K0KJ 2X1AA 4JYAF 1ZM3A 3NOGA 1HQUA 2L9NA 4FXWA 2R7OA 2V4RA 1XTZA 2N7CA 1EKRA 2C3YA 2DHHA 1NJZA 3A8KA 3R2DJ 3DDKA 4DR7J 1FNXH 3AY0A 3RU0A 2VICA 4KHMA 3LWLA 1UTAA 3M2UB 4LRBA 2VG6B 2CADA 2FVCA 4XK8C 5IZHA 5DG8A 4FN5A 3RAXA 2WSFC 1RHUB 4X66J 2XMMA 4M5HA 2ATLA 1RWPB 1H6KX 3HULA 2CQGA 4FYYB 1YSJA 2IM0A 3NKYA 1BUXA 4DOZA 1AW0A 3UVJB 3MFIA 3C3LA 1IWAA 1BXNA 2ALYB 3DGPB 1UCNA 3F73A 2QFJA 3GIRA 3HLUA 4P71A 2ABYA 1NZ8A 2BANA 4IH7A 2I9SA 5C2GA 3OFEA 3OSPA 2HFZA 1ZAWA 4A8QA 4LF8F 2ZNZA 3VAJA 2ACYA 3PNIA 3KLHA 1SKRA 4EBCA 1I94F 4RUHA 3VGVA 3KJVA 1Z1ZA 2PEBA 3TQEA 3DGVA 2KHCA 1T9TA 1RU2A 3ENAA 1WC0A 1PO6A 1JLAA 1WHWA 2XS7A 1WTBA 1RAGB 1GX5A 1RT6B 4LIWA 4NX9A 2CPDA 2ROEA 4FF3A 1LXJA 1HWIA 1TQLA 2VA3A 1T05A 2XGPA 1H0HB 1WSVA 3M8SA 2IBKA 2ZBPA 3FBBA 2AWZA 4BCAA 4FYDA 3VCDA 2ROGA 5J1EB 3THTA 4WFXA 2HWHA 1D9DA 3IWNC 3A4TA 2E29A 4PQUB 2ZOFA 4ZLJA 2M0GB 2JEIA 4OHVA 1TL4A 3GV5B 3CJ3A 2RUGA 4I2QB 2OMOA 3W2VA 4CLUA 4K5RA 2OTJS 5AE1A 1B0PA 5AE2A 2W1BA 3MMAB 1NCLA 1WG5A 4OZ0A 3KTQA 3PR5B 1S0OA 2I0XA 2EKYA 2KI2A 1EP4B 2MQOA 4LFAF 3BSCA 1S6PB 2CJKA 3G2XA 5KFVA 1PJ5A 2YPYA 1HW9A 2H48B 4N5SA 4O3OA 1F5CA 3QO9B 1FNMA 1TL1A 4HVZA 1TUVA 5ETKA 1L3SA 4CNYA 3NG8A 4DV1J 1DFDA 2BOPA 1WHVA 4KHPJ 1JLEA 3C6TA 2IMOA 3A3NB 1X9MA 1RT4B 1S1TA 4IR9A 1HNZJ 4DCJB 3D66A 4DV4F 3GILA 3TEGA 5KFNA 1ZAVA 2BE7D 2HIQA 2J0WA 5F3ZA 4HHHA 1L3UA 1H2UX 2VDHA 1MWQA 3IBCB 2JEGA 1HBOA 4M5NA 3L7UA 2CQDA 5HBMB 3A8IA 3JXOA 3OTOJ 1KN6A 1Q95G 4CTAB 2UUBJ 2QLFB 2BQRA 3QGHA 2BW7A 1UWBB 1SVDA 1KLMA 2FPHX 5KFFA 2RAQA 5HK4A 4TY9A 5J2QA 4TKTA 1YX2A 2KDOA 4OZLA 2VJUA 1QLNA 4GKJF 4DQSA 1VBXA 1Y10A 1GAOA 1NDKA 4PG5A 1G7CB 4ZLPA 3V4IB 4OYAA 1LW2A 4J5OA 3PXGa 4DSLA 1E6VB 3GFHA 4DZDA 3IM8A 3ZTSA 4KSEB 2W01A 2FJEB 1TELA 4K4WA 5CAAA 4OFZA 3M30A 4DL6A 2LXIA 1ZA1B 4OZNA 1TVRA 1S1UA 1FA0A 3LQVA 3VAHA 4WZMA 1Q8LA 3P8BB 2Z2LA 1JLCB 2FLPA 2VL1A 4G1QB 4ZHRA 2R9LA 1N5YA 1RT5A 3CXCR 4V1Ak 1XMQJ 2W2NP 2VPWB 4MKBA 1NSKL 4ZVFA 3F41A 2MJNA 1RWXB 4DR5J 2AW0A 3FBEA 1U09A 3GJSB 3TYTA 2G4BA 4HI1A 1WF2A 2VFVA 3DOMB 3KK3B 1U4BA 3DXSX 5EX3A 3FUYA 5GMDA 3KWMA 2Q66A 1LWEB 5L8RC 2XM3A 4DPXA 1YG0A 4OYWA 3BBFA 4ZJQA 1OMSA 2XS2A 2RS2A 2KZMA 1IR0A 4I4BA 4U7CA 2ZJRQ 1JLFA 2WONA 2HMIA 4EYIB 4NCGA 5IQ6A 4Z37A 2R7UA 1M90T 4QJVA 4TQSA 3OR2B 2HNYA 4UQGA 1FE4A 1SH3A 2Z8QA 2J8SA 4NRTA 4OI4A 1S6OA 2V2QA 3D67A 3D4JA 4E98A 2OD4A 2VFRA 2XLJA 4DSIA 3V6HA 4C11B 5KFGA 4OJ1A 4LF1A 1K9MT 2DHXA 1WUUA 4GMKA 4YB5A 4NMLA 4M5JA 3LGMA 3LPYA 3OLAA 2V0NA 4EYHB 2CDQA 1ITPA 3DLJA 1VIOA 1TZ0A 3C14A 3MGJA 4LRAA 3ZNJ1 3M8PB 4RW7A 2W9AA 3MF5A 5C2CA 5F0WA 2FZCB 1VQPS 3L95X 1XNQF 4UY85 1EZZB 2V69A 3BQ1A 1SJ1A 5L9XA 3R2CJ 3TJ8A 1YJRA 4FF1A 2FZKB 2CQ3A 2H5JB 2FJVA 3HHNB 3H5SA 3U1NA 3H4DA 1KR4A 2MKHA 4FBTA 1A6LA 2Z4PA 4D3GA 2UUAF 3BH6B 4A8WA 4HR2A 4CDIA 3QLHB 5L1KA 2ILYA 3UD4P 5KG4A 2OI2A 4I2PB 2MLXA 2BQ3A 2AU0A 2EFNA 4IRKA 1HD1A 4KJIA 2GQCA 2IC3B 4DPUA 3FC9A 3CJ0A 2AGQA 4OZ2A 1WG4A 1LKZA 4LQ3A 3S7RA 1FWKA 3K8VA 1RTIA 4JI3F 1REGX 2Y9HA 4WK1A 4D3HA 3MM8B 4NRUA 2QN6B 4DV2F 2DIUA 3CJ5A 1F9FA 3CJKA 2YKQA 1NHVA 3H8YA 1ZM4A 4XDCA 4FP9A 2V8DA 2ATCB 2XY7A 4OZ5A 4JI8F 2V2KA 2H4WB 4R8UA 2ALZA 4I1TA 2B9YA 3VALA 2KXHA 2J6SA 1S9EA 4XTTA 5JVGQ 1JMTA 3UR3C 2E5HA 2HIYA 3AT1B 5A6WA 4JYAJ 2C3MA 1G3OA 2MGZA 5HLFA 2CJQA 1U1QA 4HI2A 4PCQA 2OEJA 2V34A 5J2PA 2ZBRA 1F6TA 2XSFA 2ZC4A 3P4UB 4C97A 3FEZA 2WB1D 2A6MA 4RNHA 2APOA 3H59A 3BSOA 2QC3A 2ROPA 3Q8RB 1WNEA 3VAFA 5LXRA 4TNOA 3AD8C 1YJTA 2MQLA 3MI7X 1S57A 1YJUA 3FZ2A 4MT1A 1X31C 1N5QA 3MEDA 1FD8A 2BM1A 3O6QA 3MUMP 3I96A 2GIRA 5L1IA 2DKOB 4Q8EA 2VU5A 2G0IA 2VFSA 4DUTA 3RBDA 4Z7YA 4ZCLA 1VJQA 4IH6A 4Y00A 2CUYA 1N34J 2CQIA 5K9FA 3OVAA 2C2DA 3ISNC 3UNGC 3MECB 4ZPDA 1N54B 1F3FA 4ZVRB 5A8RA 2QA4G 1SIZA 2HGMA 3AOBA 1RBAA 3HD2A 1GX6A 3OPKA 4ZJLA 2JVOA 1X4DA 3MCSA 3J7ZT 1H7WA 5ETQA 3CD0A 2H4YB 3SXLA 2AEMA 3IP0A 4ZMMA 3H7HB 3A12A 5DZ6A 3PW2A 2H65B 2ZBCA 3TUIC 3AA9A 5F8NA 1RDRA 1GMWD 3SCLE 4WE1A 2EI5A 1T03A 3UW1A 1YVFA 3OD2A 4IOBA 4DX5A 3FKBA 3R6LB 2J0XA 4QPTA 1D8ZA 1UA0A 1HNXF 1MWZA 4W90B 2VC0A 3H5XA 1JLQB 3H0PA 2EW9A 5C5JA 1R8HA 2YKMA 3BJYA 4OHXA 1P1LA 1XMOJ 1S1XA 4M5DB 2V68A 5LMUJ 3BGOP 1UVKA 2R8IA 3V6DB 4BBYA 1Y5LB 2ZZTA 2LU2A 1PKUA 2AYEA 4ECYA 1BQMA 2Y0SD 4JI5F 4BC7A 1RACB 5A2QY 3ZZOA 5IT0A 4Q45A 2KHDA 4PUOB 1LW0B 2EG1A 5EWEA 1YJNS 2KRRA 3M2VA 1XJWB 4O3NA 1I6JA 1VDHA 1V5IB 1X8DA 2H51B 3US5A 2IY5B 1FEHA 3IR7B 3FK4A 3S01A 1VRQC 3QZ8A 2V9KA 3KLFA 5CXTA 2EXUA 2RQCA 3C19A 3G6YA 2JLEA 1TK0A 1SUQB 4YS2A 5IM0B 3M2UA 2I8EA 4TU7A 2IA0A 2EFVA 5KFZA 4CO1A 4X2BA 2HHUA 2VG6A 5DDRC 5LXYA 1UVNA 5KT3A 2FHMA 4P74A 3H5UA 4QIGA 3V6KA 2FVSA 3QT7A 4LSNB 1W26A 3UVJA 2ZC3A 2J9EA 2OP5A 2DNKA 1X9SA 4RPFA 5KFOA 5KG2A 1IWGA 3T5KA 2QFIA 3DGPA 2B9EA 1TL7B 2OPQB 4RNNA 4TYBA 3PYGA 3KLEB 4ZIVA 3MOJB 1U1KA 1JLGB 4AE5A 2GMHA 4USHA 2RU9A 2K1RA 4B3TJ 4WKRA 1KKHA 4H4KC 4NPOA 1H7XA 5HL7Q 2R8HA 3R8YA 2V9WA 4WTOB 2KL8A 1BGXT 3PV8A 4ZJOA 4JI4J 2GJ2A 2OPRA 3CVKA 4ED1A 4PPDA 2CXEA 4DN0A 1QSSA 5D4NA 2M9KA 3OT9A 2C2ZB 2B8PA 4ZVTB 3TZZA 4O23A 4DR1F 1HMVB 4EK2A 2CJAA 2JFDA 3R5JB 4A46A 2AEFA 1SL1A 3LF0A 3P49B 3HT0A 2ZM6F 1L3VA 2M2BA 2WAQD 1JJCB 1CPZA 3DLGB 5LSLA 2AV5A 3E8OA 5J1EA 4J9RA 3NCQA 4RJVA 2Y1JA 3OFHA 3IAS9 4X62J 3OTCA 4OZ3A 4C8YA 4PQUA 4FZVA 4DEZA 4LF6J 2HZCA 4X4RA 1XQIA 4I2QA 4Y2KA 1HPZA 1FRIA 2VB6A 5EWGA 4ECUA 5H9EK 3NP5A 2VBYA 4ZPTR 2KXFA 1FKPB 2X1BA 1F5BA 2HGNA 4IO9Q 2YPZA 3QT8A 4F4YA 3CW2C 2XMJA 4ZK7M 1UA1A 2D69A 2E5IA 2BBEA 3T5HA 4KGVB 2H5IB 1E6YA 2MB0B 3ENQA 1YKWA 2R7WA 3OHBA 2RHSB 3HFKA 4I67A 3P45B 2FTRA 4X4OA 4LVNP 1JNRB 1T95A 2H3EB 3GQCA 1WDDA 5J2NB 3M9OB 3NGSA 4OIXA 3R7NB 1GH8A 3IBFB 2JVRA 1R8AA 3MEEA 1CQNA 3MMBB 1RT4A 2DNNA 2VODA 4A8FA 2IRUA 3V81B 3CJTA 4OYMA 2V67A 3FEYB 3GJRB 2E66A 2DNMA 4LREA 3QFHA 1BWVA 4ID5B 2VFTA 1P1TA 4B3OB 1VQMS 3G8TA 1TL3B 2VBXA 4K7QA 4G3IA 3PX4A 2B0GA 2KXNB 3CDBA 3HHEA 3K59A 1UWBA 3V6JA 1RT1B 4QR0A 2E9ZA 5HVHA 4CWBA 4M1KA 4NLOA 1I5OB 1VC6A 1MG7A 1XC9A 2ZHAA 3CCWA 3K5NA 4DL5A 3V4IA 1KS2A 3A8JA 5HP1B 3C6UB 3EPIA 1H73A 3GFYA 2E5JA 3DRSB 4P7VA 1SI9A 3CC4S 2DH9A 3BKTA 1WG1A 4HDGA 3ILLA 2P9CA 2HLTA 2NUUG 3R6GB 2K3KA 1S7IA 4CYUA 5ETVA 2Q79A 1IKWA 1NKBA 2LA6A 4K50A 5H9EJ 5HQMA 5KFXA 2G13A 4DU8A 1V5VA 2VKZG 3I5CA 3UI3A 2UXBJ 4DUZF 3PACA 1U0SA 1IBKF 4WIIA 1TK8A 1JLCA 2KYXA 4L76A 2DD8S 3E2EA 3L09A 4G1QA 4ELUA 4MFBA 2YX1A 5L39A 3BN4A 1VI7A 3JB9k 4X4QA 2DNPA 4KBIA 3QWPA 1IBLF 3UN2A 1HW8A 3ZTPA 2YTCA 4CRJA 2EPIA 4IFYB 4C3LA 3KK3A 4RW4A 2FJAB 3OL6A 3KG1A 2J9CA 1MN9A 5GAHU 2W2MP 2XYPB 5F3TA 1LWEA 2KVIA 4KGXB 4K8RA 3WQPA 2CPFA 4PG6A 1REVA 3GU0A 2PD1A 2QL9B 1FFSB 5KG3A 1FVQA 2ZUGA 3T1HF 1W7WA 1SBRA 3CEDA 3KHRA 2HVZA 4DV6F 5J1NA 2ZKUA 2R7RA 3BR9A 3TA0A 4QWAA 3OR2A 1LOUA 1F0XA 3PEHA 1RLDA 4R5PA 3UCZP 1B0TA 2MEWA 1NBEB 2ZH2A 4CO0A 1TKTB 2MZJA 3AD9C 2E5GA 1FXRA 3EVMA 4HH0A 2HHHF 3AD7C 1X60A 4AQYJ 3DOKB 3OSNA 4OJHA 1DQ8A 3ET6B 1QVFR 1RA7A 1S4EA 3F44A 3T9ZA 5DJBA 3Q8UA 2ZNYA 3SSRA 2N7YA 3M8PA 1RHKB 2PI5A 2MPUA 4UY8T 3CJ4A 1S99A 2RUSA 2FLNA 4L3KA 2OFHX 5IT9Y 1WDTA 4E0DA 1QVGR 3N01A 2C2OB 3GR0A 3V2UC 2UV8A 4MH8A 2RKIB 1IVZA 4DSKA 2POKA 1RHRB 4GC7A 4FXVA 1S4FA 5HANA 2CAJA 3QLHA 4KY3A 1HQ2A 1FFGB 2C2NA 2DPJA 2R42A 3JAMU 2RIJA 4I2PA 4P6QA 4QWEA 4X65F 2ZZMA 2IC3A 4FKXA 1DTQB 4RUBA 2VQFF 3AAWB 3QGGA 2O5DA 3DRRB 1WHYA 3CMQA 4M94A 4NWBA 3PX6A 1UWAA 5HROB 3SI8A 1TUGB 2DHSA 4WPAA 3R5AA 1HNWJ 2D3ZA 3LAMA 3RB0A 2FC8A 4QIWD 2HQ3A 1RTDB 3P5BP 3NBPA 3C16B 2CJ9A 3PW7A 1T0TV 2N4DA 3KG4A 4YB1P 4DX7A 3LW5C 4L74A 3HVWA 4NLDA 4PR6A 3VZHA 3CIZA 2V4QA 3OLBA 2VOOA 2Z57B 2FVQA 3NOCA 1T8EA 3DXBA 1R8BA 2HVIA 3FBFA 4KC5A 3KMQA 1WEZA 4L75A 5FJ4A 3HVAA 3N79A 2XB2D 1VC5A 4FYXB 2GCFA 1RABB 1N32F 4JV1A 1WSRA 3PRBA 2G0JA 2EFGA 4WU3A 3UDLA 3DLLQ 2VPZB 4P73A 3KLIA 3CC2S 4PRFA 1F9HA 3FNNA 4MYTA 4LF7J 2XHCA 4QIEA 3PFOA 3MD1A 2F4VF 3M6VA 5KT5A 1X9WA 3HMJG 1SJRA 3SZ2A 4DR2F 3OVSA 3HF5A 4U9RA 4ECTA 3CCES 2D7SA 1DJ0A 4PABA 3UE2A 3W63A 2A2DA 4MIWA 4S0MA 4LIRA 2UUTA 4A8OA 5JXSA 2R8GA 1XIQA 2VJVA 4LFBJ 5E33A 3X3UA 4CNZA 3ISND 5RUBA 2DGQA 5IC6B 4EEYA 1RYRA 2AKWB 2B7CB 2WK4A 1HR0J 4NA3A 2VQEJ 4ILRA 1U2RA 1VK3A 2VASA 3MECA 2HBRB 2PDAA 4WCEQ 4AXJA 5IS2A 1NMEB 2ZDOA 1SJ4P 1Q86T 1RT2B 2NYIA 1QTMA 2NSBA 2FHJA 6FDRA 2J0SD 4ED4A 2D3OR 4Q2LA 1UMJA 4NLQA 4Y2IA 2VDIA 2KT3A 4NXMJ 5GAGU 4JV5F 2B8QA 4XIUA 3KNGA 4C8NA 3VGTA 3TUPA 1HA1A 1GK8A 4BHQA 4P7TA 4DR1J 4DCOB 2PFDA 4C2MA 1FDDA 4UZBA 1UL3A 4RW6A 5D3GB 4P72A 3S1TA 4OX9J 1O6XA 4N7TA 3W9JA 2M8HA 3ISZA 3TVKA 5A8WB 1XN9A 5FLXU 3TJ9A 1S1WB 2OTLS 2E5LF 4ED0A 2YNHB 3IGVA 1FRHA 2IVYA 1RAJA 2J8AA 3MEGB 3QIPB 2I38A 2FVPA 4H4KA 2ZM6J 3B8HA 2BXJA 3D0HE 2VIHA 4ED7A 1N6QA 2UXCJ 4QU6A 3JSMB 5KFKA 2ZWOA 1JLQA 1KTVA 4K4TA 2W4PA 4MK8A 4M5DA 2QRRA 4X84A 5DG9A 1FO1A 2K7KA 2O01C 3IGNA 4F3OA 2MZQA 4I56A 2CZVC 3WHIA 2L41A 3Q2SC 4ZVQB 1MLAA 4L73A 2A3JA 2D74B 4OI0A 2OSQA 4F02A 2DH7A 4CLZA 1C1CA 3I0SB 2C2EA 3JSYA 2HAFA 3FJ2A 1XR7A 2CFXA 2UU9F 1AROP 3BGUA 3FMBA 2W2QP 5CH7B 4EZ9A 4CO5A 5KT6A 2ZOGA 2XCAA 4J91A 2CQ4A 4DQIA 1SUQA 2K3IA 1RCXB 5IM0A 3D6MB 3L3CA 1D1UA 2JZ5A 1O51A 1P9YA 2G1DA 2I5JB 2B43A 2JHEA 2CG8A 5G0RB 2M70A 2C22A 2CIMA 1Q81T 2BMBA 3SV3A 1I51B 3KJNB 1NJWA 4P2SA 2B6AB 3VWSA 2MKCA 3MDFA 2HKEA 1TL7A 4LSZB 2OPQA 2RDIA 4ED3A 1JLGA 3MR2A 3OV7A 4NL5A 3MM7A 2GVZB 2HRTA 3ZZTA 4DV7J 2VG7B 1N36J 2E1AA 3EXYA 3THVA 3H42A 2XC9A 3I82A 4HH1A 2DRBA 4C0BA 2GS8A 4I68A 2XZTB 3D6FB 2KJVA 4DR6F 2Y8YA 4MIAA 2JRSA 4FBUA 3K8WA 3PHTA 4M5KA 3TAQA 4OYIA 3PX0A 3A3PB 2ERRA 1VQLS 2X3DA 2WB4A 4EZ6A 2FDNA 3DLGA 3BO2A 1UJ5A 1R0AB 3B4DA 1S79A 2DR8A 1WC3A 1OIAA 4DUZJ 1AFJA 1JJHA 1HFEL 1N33F 5K8MA 2GHVC 3QWUA 1R8CA 4DV5F 1UJ6A 4JI7J 4DZ6A 5GADU 3VAMA 4LR8A 3K0JA 1IBLJ 3BQ2A 3MUTP 4MKAA 1VGYA 1YJ7A 4ZIWA 3LP0B 4HHJA 4DUYF 5D6GA 1N0VC 3KOAA 1SJQA 2F65A 4OYXA 4TYAA 2HBQB 3DCAA 4OL8A 3R97A 4LFCF 3VGSA 1T9WA 2IMWP 3T1HJ 4UF4A 4DV6J 4DX8H 1HYSA 2W2OP 3UDVA 1HI1A 4U67Q 1SJFA 2P6TA 1PYTA 3NGRA 2MHNA 5J2NA 1WKKA 3FSXA 3TEHB 3IWLA 3K2YA 3RW6A 2OHDA 2IM1A 3MMBA 2DR5A 4NA2A 5LMNF 4B9SA 2LXFA 2ZJQQ 3V81A 5BYSA 2CQCA 2M52A 1KBRA 2J9DA 3MCOA 5DQHA 4ID5A 1S1VA 2W9CB 3DDNA 4B3OA 3PO4A 4DV0F 3MM6B 2EVZA 1TL3A 5A6PA 4N76A 1FJGJ 2AX1A 4PXBA 1U1MA 3AQOA 2QLWA 1SC4B 2KT2A 3KLVA 1CC8A 4E2FB 2CA9A 3ETMA 4KGZB 4CZCA 3GTYX 4ZP7A 1RT1A 4O3SA 4RNMA 2DNOA 4DSEA 5DS7A 2WSEC 2HSEB 3GSIA 3G87A 5BYRA 3ZZYA 1R0CB 1Z2ZA 3KHLA 3OW2R 1R31A 4K2XA 4ZCKA 3SYZA 4QWCA 1IKVB 3D0GE 4F2RA 5HQ8A 5HP1A 3C6UA 4HKQA 3MM5A 1YJVA 3DRSA 2RSQA 3Q8PB 3OBIA 4UOGA 4LR7A 1WC6A 5DDQC 2OKQA 5IT4A 4OHYA 1FD2A 3BKFA 1BQNB 1J5OA 5EN1A 1XK8A 4FF2A 2AT1B 5F8GA 4RBTA 3N9UC 1GXUA 1SCJB 1TUWA 1U8WA 4TU8A 1VFJA 4Q5VA 2K2PA 1S76D 4X64F 4LF9J 2Q6BA 3BS9A 1RWOB 5CYQB 2B7BB 4CP5A 2AZ3A 1Y3JA 1AZSB 4HHUA 7AT1B 1NB2A 1Q5YA 5E5NA 2LKZA 5K8NA 3QAEA 4KO0B 3QT6A 2W4CA 3G4SS 5KFSA 3H2UB 1RAEB 2VF3A 3W8GA 2ZITA 1B7FA 1OWXA 1LV5A 1S6QB 2HHTA 4JI0F 1X4AA 2BQUA 1AUDA 2DXFA 2HFVA 4PAAA 1F9EB 5B0BA 3CCJS 4IFYA 1F1BB 4ZKAA 1KQFB 4K2JA 4YR3A 2XGQA 3TX8A 4Y2AA 3ILOA 1VLYA 1U0HB 2ZUAA 1DQ9A 4OI3A 2BA9A 3IR5B 2V5HG 3B6BA 5KFEA 3G71S 2CWKA 1NDPA 3GV8B 1OSCA 4EMDA 4U96A 2HHWA 2CNOB 3NWGA 4I7FB 1M5HA 3MM9A 4OYBA 1PJ7A 3W9IA 3DOLB 1XR6A 3SV4A 2HHVA 4GO5X 2B5JB 3UFCX 4BS2A 2UUWA 4USIA 4UZCA 2HFSA 2C2MB 1C0TA 3T6JA 1QSYA 3CCQS 2IFXA 1QM9A 3SMZA 4DJBA 3DOKA 1JB0C 1X4CA 3NGTA 5IQQA 2VA2A 1HHSA 2XSJB 3LO3A 2ZBQA 3HFVA 5FDLB 4WU2A 5F9NA 1D9FA 2G2ZA 3MCMA 1FX2A 1W2BR 2Z58B 1K0TA 3LUYA 3O5TB 2HAIA 4HT5A 3QIDA 2GIFA 2BKPA 4W98A 2NXNA 1FKOB 4LVOP 4OLOA 1C0UB 4JI2J 4KFBB 5U47A 5AJ3F 2RKIA 2Y1IA 2YWFA 3EJMA 1OYDA 5D78A 1HBUB 2F3JA 3UDCA 1DBDA 4CI0B 2E9TA 2DYAA 3KUGA 4JV0A 1RTJB 4CT8A 4LJMA 4RU9A 2FC9A 2ZBIA 2KJWA 3AJDA 4B3RF 2YH1A 4XDDA 1R6YA 4NCBA 1QJHA 3K17A 3GR1A 2DNRA 2P9EA 4ATNA 4LRFA 3O44A 2DCLA 3NRBA 5THWA 3VVTA 1TL5A 2IVMA 4NASA 2A2CA 4A4JA 1PGZA 4YY3J 3CO9A 3NS6A 2F40A 3A1YG 2N3OA 2KM8B 3BGFA 4WK3A 2MMYA 2VBZA 3EDQB 2PO4A 1ROFA 4DV3J 2O3DA 3MOZA 3W62A 1IXKA 1TKZA 4IQMA 3R5DA 2GW8A 5HROA 1ACMB 4LQ9A 2P9GA 3TWZA 3CMES 4BLGA 2RH3A 4DDFA 1WACA 5SUHA 3AFGA 2DNLA 4DN9A 5C25B 2DRDA 4V19X 2PGCA 1FE0A 3PIOQ 3C16A 4IKAA 1WTFA 1S7HA 1FXDA 2RT3A 1XEZA 3I9V9 1X4GA 3JAMY 4QOTA 2KG1A 4J9SA 3HXMA 3BDEA 3IS9B 4B08A 3FQKA 3TVYA 4U6PA 2IAJB 4URQU 1RKJA 3MFHA 3SFUA 1YRTA 5B0EA 2R2RA 1WOOA 1ZM2A 3H2LA 4C3MA 4DQPA 4Y2CA 4ID8A 3SDEB 4F0HA 1NK6A 4WTYA 2QLBB 4I0WA 3JQKA 5EX0A 4B3MF 1S12A 4UT4A 2HFOA 3PJ9A 3ZZRA 1VQYA 2UZAA 3KK1A 2FY1A 1QUPA 5F41A 2D3O1 1NM2A 2EC0A 5C24B 5A0YB 4LSLB 4NA1A 2Z0GA 1UVJA 1CJKB 4N47A 2YQ1A 1W2IA 3K7RA 3Q8VA 4O3RA 2KM8C 3OL8A 1LWCB 1S9FA 4YN3B 5HJXA 3PKMA 4B9TA 4K59A 4PG4A 4Y0FA 3AJ2A 5D4OA 2ASJA 4WWSA 2XI3A 4IR1A 3GMGA 4JUZA 2KTQA 3QPIA 1OS5A 2DR7A 1Q79A 3FDSA 3D6TB 5E3AA 2ZH9A 1K1SA 3OR1B 3QQCD 5DETA 2YKAA 1NJYA 2HS0A 3HCXA 1IBMF 3D3BJ 4A8XA 3ZFVA 1SQGA 3PM9A 4FKYA 4FPRA 3LH2S 4O44A 4GC6A 1GT8A 4QIVA 3VF0B 5DQGA 4WXWA 4DPTA 2DIVA 1AA1B 2CYYA 4CLKA 2IRXA 5A8WA 1IUJA 2N4CA 1EB0A 3E01B 1S1WA 4OQJA 3TZYA 3J7AN 2Y1LB 2CVEA 1EIYB 2GVDB 1CSJA 3VQTA 4P2FA 2RD5C 5B0DA 1FKAF 1QE1B 3JSMA 5D0EA 3W3SA 4OYZA 4CLSA 3WDOA 4ECZA 3PEJA 1VIXA 3KG0A 1RTHB 4F26A 2CJBA 3CTRA 2LYVA 3CUNA 1M1GA 2ZE2B 3KYLA 2RF2B 3EWGA 2OJ3A 3GG1A 2RVJA 3AJ1A 1URRA 2CNLB 4IFVA 5FLXY 5I42B 2C28A 4KKOB 4O3PA 3KJQB 4XO0A 2KU7A 5BR8J 2CNNB 3N0VA 2ZH5A 3I0SA 1HNVB 2EFOA 2GAHC 2OFGX 3LWMA 2LQBA 2AYBA 3HSZA 2Q6CA 2MXYA 4LBHA 3ZO7A 1VQ8S 2JWNA 4QZVB 1F2HA 1RISA 1J5EF 2MHEA 1L3KA 2FD2A 2Q43A 2VOPA 2GAGC 1TV6B 1N5SA 2G1HA 4NI2B 3CMAS 1PYOB 2EBEA 2JJ4D 3R5BA 3VVUA 5G0RA 2QG9B 3W66A 2M8DB 1SPBP 5K5MA 3IA0A 5GMEA 3MPVA 2CPHA 4OHWA 1X0FA 3UN5A 3DN9A 2FJXA 3PRDA 1R7IA 2B4OA 2NZCA 2PMHA 2IVFB 2B6AA 2RB7A 2NREA 3ICLA 3CCLS 2VKRA 3K5MA 4QBUA 1QTNB 2OIHA 1A9NB 1FDBA 1VISA 2BE9B 1RK8A 3ILIA 5IXUA 2EFQA 1DTTB 2B4VA 3T5JA 3I0RB 4I6YA 1YBTA 4ANDA 4DR4J 3W9HA 3D68A 3K5PA 2M5YA 5CZVA 4L72B 5D0GA 4NXNF 3TNVA 3BO3A 1OQ6A 4A47A 5CQGA 4YHHF 1KLNA 2DVIA 1T9XA 3KLHB 3TO8A 4HTJA 2XYGB 4ILLA 2HK2A 4R0EA 2GZOA 5HO4A 2QL7B 3KJVB 3CIMA 2J76E 5HSPA 1U24A 2BJ9A 2AJ2A 3HP6A 3W1YC 2MKIA 1QSLA 5A76A 1V3ZA 2RHQB 1MMNA 3BGRA 1JLAB 3H25A 4A8YA 4B3SF 3NAHA 1XNRJ 1RT7A 5E2QA 1UFLA 2WBMA 1PC4A 1NLKL 2JDJA 2BEFA 3PW5A 2EBGA 1T9VA 2ZD1B 1R3NA 4U8VA 3KUHA 4NEYA 5EHHA 5KFPA 2CPXA 1YGYA 1U48A 2V63A 5E3RA 1KVJA 2V50A 4FNIA 4ZVUB 4PXDA 3I32A 1U26A 4X4VA 2LMIA 3LP2B 4F7VA 4YUDA 5CZXA 4ZPWR 3I5BA 3AOAA 3FZBA 1UEKA 1NDLA 5EWFA 5I3QA 1F5AA 4K0KF 5KG7A 2FJDB 4M8LA 4N41A 5EUHA 2VPYB 4GRSA 2Y0BB 3I4HX 4OX8A 4CT9A 2DPIA 3DLEB 4KB7A 4ITSA 4KR0B 3KHGA 2Y1RI 3I56S 5DO2A 1XBWA 3BZQA 1RE1B 4DR7F 2F9JA 3J81j 2LDYA 1RQ0A 1TL1B 1U7LA 3N5BA 1CJVA 3LP1B 3IWXA 4X66F 2GGPB 2W9CA 3C6TB 4QCLA 2RMLA 3TW0A 2FIUA 3MM6A 1VR6A 3UPFA 4I6WA 4DHVA 1CVJA 1FDAA 1UEVA 2AQ4A 4GVLA 3S6EA 4QU7A 2LEBA 1FNOA 1TAQA 4NZ0A 2PSZA 2NZ4A 2YNGA
chains in the Genus database with same CATH topology
4KYZA 5A2QU 4GKJJ 3D3CJ 4X64J 1XNQJ 3IMQJ 3R2DJ 2UUBJ 3JAMU 4DR7J 2F4VJ 4NEZA 4V1Ak 1XMQJ 4DV0J 2UXBJ 4DUZJ 3J80U 4DR2J 2MEWA 2UU9J 2KL8A 3W1YC 4JI8J 4B3RJ 4LF5J 4DR5J 1IBMJ 4JI4J 4B3MJ 2UXDJ 2E5LJ 4NXMJ 3T1YJ 4DV7J 4LF4J 1HNXJ 5LM7E 4DR6J 4X66J 4AQYJ 2UUAJ 4DUYJ 1XNRJ 4JI7J 1N36J 4LF9J 4LF7J 4NXNJ 3R2CJ 4JI0J 4DV4J 4DR1J 1IBLJ 4YY3J 5IT9U 1HNWJ 4GKKJ 4LFCJ 4OX9J 1FJGJ 1J5EJ 4HHUA 3D3BJ 5FLXU 5BR8J 4NEYA 4DV1J 4LF8J 2KVQE 4DV3J 4KHPJ 4JI5J 4DR4J 4DR3J 1I94J 2MQ8A 1N34J 2ZM6J 4JI6J 4LFBJ 2MTLA 5AJ3J 1HNZJ 1XMOJ 2UXCJ 5LMUJ 4JYAJ 4K0KJ 2UUCJ 4YHHJ 4JI3J 4RJVA 3T1HJ 4X65J 4PWWA 4X62J 1N32J 3J7AN 1HR0J 5LMNJ 1IBKJ 4DV6J 3J81U 4JI2J 4DV2J 2VQEJ 2VQFJ 4LFAJ 2HHHJ 4B3SJ 1N33J 4B3TJ 4JV5J 4LF6J 5IWAJ 3OTOJ 4JI1J 4DV5J 4KY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYZ A;  5A2Q U;  4GKJ J;  3D3C J;  4X64 J;  1XNQ J;  3IMQ J;  3R2D J;  2UUB J;  3JAM U;  4DR7 J;  2F4V J;  4NEZ A;  4V1A k;  1XMQ J;  4DV0 J;  2UXB J;  4DUZ J;  3J80 U;  4DR2 J;  2MEW A;  2UU9 J;  2KL8 A;  3W1Y C;  4JI8 J;  4B3R J;  4LF5 J;  4DR5 J;  1IBM J;  4JI4 J;  4B3M J;  2UXD J;  2E5L J;  4NXM J;  3T1Y J;  4DV7 J;  4LF4 J;  1HNX J;  5LM7 E;  4DR6 J;  4X66 J;  4AQY J;  2UUA J;  4DUY J;  1XNR J;  4JI7 J;  1N36 J;  4LF9 J;  4LF7 J;  4NXN J;  3R2C J;  4JI0 J;  4DV4 J;  4DR1 J;  1IBL J;  4YY3 J;  5IT9 U;  1HNW J;  4GKK J;  4LFC J;  4OX9 J;  1FJG J;  1J5E J;  4HHU A;  3D3B J;  5FLX U;  5BR8 J;  4NEY A;  4DV1 J;  4LF8 J;  2KVQ E;  4DV3 J;  4KHP J;  4JI5 J;  4DR4 J;  4DR3 J;  1I94 J;  2MQ8 A;  1N34 J;  2ZM6 J;  4JI6 J;  4LFB J;  2MTL A;  5AJ3 J;  1HNZ J;  1XMO J;  2UXC J;  5LMU J;  4JYA J;  4K0K J;  2UUC J;  4YHH J;  4JI3 J;  4RJV A;  3T1H J;  4X65 J;  4PWW A;  4X62 J;  1N32 J;  3J7A N;  1HR0 J;  5LMN J;  1IBK J;  4DV6 J;  3J81 U;  4JI2 J;  4DV2 J;  2VQE J;  2VQF J;  4LFA J;  2HHH J;  4B3S J;  1N33 J;  4B3T J;  4JV5 J;  4LF6 J;  5IWA J;  3OTO J;  4JI1 J;  4DV5 J;  4KY3 A; 
#chains in the Genus database with same CATH topology
 1MRO B;  3M9N B;  1IKV A;  1WKJ A;  2HQG A;  2ASY A;  1CS4 B;  5SZT A;  4B3R J;  1NK9 A;  1U45 A;  2KFZ A;  1M5P C;  3HI9 A;  4JB8 B;  4LF4 J;  3EDR B;  2AD9 A;  3EVO A;  4F3Q A;  1U8S A;  3QT5 A;  4AL6 A;  1NAQ A;  1BQN A;  2BE2 B;  5AXL A;  4F4K A;  5IT9 U;  5KT4 A;  3NAI A;  4OLP A;  3ZZP A;  2HS4 A;  1LW2 B;  4ZVP B;  4ED5 A;  1A7G E;  1Y5N B;  2AJ0 A;  3IC1 A;  3ADA C;  4O3Q A;  1SKW A;  4PXE A;  4ZCI A;  5E7O B;  5JMN A;  4JI6 J;  4CO4 A;  2IDE A;  3TR5 A;  2V8V A;  1HKA A;  2GHP A;  1FJC A;  3W64 A;  3CCT A;  3VV2 B;  2IIH A;  2VG5 B;  4KO0 A;  3G6E S;  4J9Q A;  3OTD A;  4NYO A;  4FS2 A;  2YNI B;  1EET B;  1S6Q A;  3DRY A;  1S1U B;  2XO7 A;  2XEX A;  3JTN A;  3N5F A;  1P6T A;  3MR5 A;  2DGT A;  4Y6I A;  5E3P A;  4ZHR B;  2AMC B;  4DFM A;  3EXC X;  3X1L B;  3KNA A;  3T6B A;  3B78 A;  2OH2 A;  2MZS A;  5MLC V;  2ILZ A;  2HZV A;  3BR8 A;  1HWL A;  1YHQ S;  1RWN B;  1DZ5 A;  1U0H A;  2HQC A;  1CJT B;  3B4M A;  2W2P P;  3DMJ B;  4P2X A;  4BC9 A;  1RCO B;  4PPZ A;  1N5V A;  1B7Y B;  5H1S V;  1AXQ A;  4BWJ A;  4ANC A;  4I7F A;  2NPI A;  2W25 A;  2COL A;  3DOL A;  3SQG B;  1HQE B;  4B02 A;  5ETL A;  4TY8 B;  5D15 A;  3OHA A;  2E7X A;  3CF5 Q;  2B5J A;  4DR3 J;  1K47 A;  1VYA A;  2ZHO A;  4YB6 A;  1JLF B;  3A8E A;  3QRQ A;  3MEK A;  4KH0 B;  4WFB Q;  1M5V C;  2HNY B;  2XSJ A;  4DV1 F;  1FDN A;  1X5S A;  2FY8 A;  3I55 S;  4EO6 A;  2MQP A;  5LSR A;  3CD7 A;  5C42 A;  1YZ6 A;  4JI1 J;  4MAK A;  1HNZ F;  2F8E X;  1G4C A;  1ZZF A;  2IDL A;  5GAH I;  4ECQ A;  3AH6 A;  1GQE A;  3GFZ A;  3R7S B;  4RZR A;  3HZE A;  3LOU A;  2VBW A;  3T1Y J;  2DHA A;  2YKN B;  5DRK A;  1KNZ A;  4QYZ K;  2NLW A;  5K8O A;  2PN6 A;  3CD5 A;  2F9D A;  5CCL A;  3OTO F;  3CT9 A;  1C1B A;  3PHE A;  5M2U A;  2UUB F;  1RTJ A;  3MPD A;  2V2Z A;  1VQ9 S;  3GLJ A;  4CLP A;  2DO0 A;  4WFN Q;  1NH7 A;  1RWU A;  5AXK A;  3PKY A;  3EM1 A;  4ELV A;  3ENW A;  3PR4 A;  1GMW A;  1QAX A;  1X4H A;  4ETZ A;  3UDE A;  4DSJ A;  5ETN A;  3P6Y C;  1JLB B;  3SCJ E;  2HBY B;  3G82 A;  2XMA A;  1Q8I A;  1M5O C;  4ZVO B;  2CPZ A;  3OL9 A;  4P75 A;  3VZI A;  2WOM B;  1XMB A;  3D1O A;  1I3O B;  1OSD A;  5C25 A;  2ZH4 A;  4ECX A;  1AB8 A;  2Q1L A;  3K57 A;  2V8P A;  4ECW A;  1SB6 A;  1S9G B;  3K89 A;  5CYJ A;  3M8Q B;  5DZ7 A;  2IJF A;  2LLZ A;  5CAB A;  3BF4 A;  4LBI A;  4A8K A;  1RA6 A;  3CJK B;  1MMD A;  3IS9 A;  4CO3 A;  2R3V A;  1PBA A;  3BV8 A;  2CPE A;  2W7P A;  1XMQ F;  1VQ4 S;  4QW8 A;  3CCU S;  1PG5 B;  1Q82 T;  2IAJ A;  5E0O A;  4DR5 F;  1LEO A;  3OVB A;  3W8P A;  3R27 A;  2GNK A;  4F2S A;  4LF8 J;  5KFW A;  2HVH A;  1B0V A;  4ELT A;  1I94 J;  4MJK A;  1TU0 B;  3FCH A;  1BC6 A;  2VPX B;  4O0I A;  4Y65 A;  1ZET A;  4O4R A;  3DLK B;  3MAA A;  2BJ1 A;  4C4W A;  2F1F A;  2EG2 A;  2A0F B;  1ZOT A;  1IM4 A;  1C4A A;  3EVW A;  1B99 A;  2C3O A;  2DGV A;  1ZAX A;  1J27 A;  4V19 J;  5J2P B;  4RNO A;  2QL5 B;  4FNH A;  3RB3 A;  1NJX A;  1YRU A;  5C24 A;  5ADZ A;  5A0Y A;  3NCP A;  4TN2 A;  4X4P A;  1S0N A;  3V5R A;  3AOC A;  1RHQ B;  2BM0 A;  1CJK A;  2DHG A;  4J9V A;  3MAQ A;  4MKY A;  5HMW A;  1FK9 A;  2YBV A;  2QSW A;  3GG0 A;  1K8A T;  3QRR A;  1DRZ A;  4WJB A;  4IRD A;  1FCA A;  3IG1 A;  4NLU A;  1QAJ A;  5E3Q A;  2KKH A;  6FD1 A;  3RJM B;  4N8N A;  2PI4 A;  1AUS L;  1LWC A;  3MED B;  4QR1 A;  3G9C A;  1NO8 A;  2CG4 A;  1QUV A;  4FF4 A;  2HND A;  4IDK A;  1RHJ B;  3EIC A;  4GKK F;  4ZVS B;  5M2P A;  1IKY A;  1X4E A;  2UV8 G;  4WBF A;  2X51 A;  3V4M A;  2HVD A;  4E8U A;  3RYL A;  2DNQ A;  2MQ8 A;  3OR1 A;  4ES2 A;  1H98 A;  4PYD A;  1CJU A;  2QA1 A;  3ZTQ A;  2LEP A;  3IM9 A;  2BKO A;  3M2R B;  4YHH J;  4TLQ A;  3UD3 P;  3M4X A;  2J7W A;  2V2V A;  1ZTW A;  1PAU B;  1HBN B;  5LJ5 Y;  4LFA J;  5KFC A;  1KHW A;  2E1P A;  3TA1 A;  2GJF A;  1X5O A;  2XMU A;  3EGZ A;  2YVS A;  3PCO B;  2VV5 A;  4H4O B;  4ZS6 A;  4PG7 A;  3TAR A;  2GVD A;  3HM9 A;  1WF0 A;  3M32 B;  2XLI A;  1FWL A;  1QE1 A;  2N3L A;  2MJU A;  3O2I A;  3U02 A;  4P10 A;  4ZDN A;  2Z56 B;  1K1Q A;  3U27 A;  4ERD A;  2RIL A;  3RUB L;  4DQR A;  1WC4 A;  4DV4 J;  1T7P A;  2ZH8 A;  4FS1 A;  1RTH A;  3QJJ A;  4USK A;  2ZE2 A;  5K8P A;  4Q2M A;  1D09 B;  4C7Q A;  2DR6 A;  2OLW A;  1N56 A;  3HK2 A;  2QA4 S;  2VZ9 A;  4USV A;  3EGW B;  1YI2 S;  5GAG I;  2IPO B;  5I42 A;  4KKO A;  3TRG A;  1GMU A;  3KHH A;  1FTR A;  1BHN A;  1R27 B;  4TU9 A;  3EGN A;  1QY7 A;  2R2U A;  1KD1 T;  2B9X A;  1UKU A;  2D9P A;  1V6H A;  2B9W A;  2HHP A;  4W4M A;  1TAU A;  4GKJ J;  1KSP A;  4K4Z A;  1B4S A;  3NLC A;  3M2V B;  3PYE A;  5IV4 A;  1ICE B;  3G96 A;  1TV6 A;  4MK9 A;  1ZS6 A;  3VTI A;  2OAU A;  4YDD B;  6AT1 B;  3HO1 A;  4NI2 A;  5LL6 d;  4B9L A;  1RT6 A;  4DLE A;  4PKD B;  3KLF B;  2R2S A;  2J0Q D;  1M1K T;  3Q24 A;  1ZBT A;  4ETX A;  2BW2 A;  2J6T A;  3NGD A;  2QLJ B;  1ZZN A;  4NYZ A;  2VH7 A;  5D0H A;  3PY8 A;  3GE9 A;  5DDO C;  3CGI A;  2EEY A;  2JC1 A;  4URG A;  3GJT B;  1BLU A;  2IBO A;  2CZ9 A;  1B64 A;  3PZP A;  1O5J A;  2DRA A;  2JOQ A;  1DTT A;  1RZM A;  2WVB A;  4NZ7 A;  3I0R A;  4F0M A;  3NS7 B;  3IRW P;  2FUG 9;  3FSI A;  3GZ7 A;  2UVV A;  1N34 F;  4UQT A;  2IRY A;  3MMA A;  3QZ7 A;  2K1R B;  1T02 A;  2CJX B;  3HSG A;  2G0C A;  3WBZ A;  5IWA F;  1WC5 A;  2LDI A;  1Q1K A;  4C3K A;  2CRL A;  3NL0 A;  4DPY A;  2MKS A;  1AFI A;  1GNK A;  4ZPB A;  4UST A;  3POT B;  1TMM A;  1EP4 A;  1M5S A;  2J5A A;  3QBC A;  4USJ C;  1S6P A;  2OPR B;  1O8B A;  1RB0 A;  3KFW X;  3MCN A;  1GMV A;  2ACM A;  4KPC A;  5H9F K;  4C0H A;  1RAA B;  2ASD A;  1HWK A;  3SIP B;  1WOR A;  4KV8 B;  1U1P A;  3QO9 A;  2LQ8 A;  3AOD A;  3KLG B;  5KOX A;  5K14 B;  4JBC A;  1NRK A;  3TOQ A;  4RWW A;  2MYF A;  5L38 A;  1B3T A;  3FSY A;  4DS5 A;  1RAO A;  2YWW A;  2GQQ A;  3NS5 A;  3OJS A;  2PA8 D;  3WX8 A;  1R89 A;  2G2O A;  3G8S A;  4B9N A;  2DBB A;  1G1X A;  2ZD1 A;  4RLE A;  4G6V B;  1BY9 A;  2UUC F;  2OO4 A;  2RRB A;  3D7S B;  1KON A;  1L3T A;  1YJW S;  3Q8Q B;  1WC1 A;  4EI2 A;  2MQN A;  4CO2 A;  1YLX A;  4I64 A;  5HBM A;  2D41 A;  2DTJ A;  2GA7 A;  4RW9 B;  5BYQ A;  2QMX A;  4CTA A;  1WJ9 A;  1XMO F;  1UVL A;  1XNQ J;  5LMU F;  1KRP A;  3LP2 A;  1HPZ B;  3OFG A;  4DLG A;  5HVG A;  2YXL A;  4KH1 B;  2R4F A;  1JJ4 A;  1PIE A;  1YBU A;  4U7U D;  4NZ6 A;  4IG0 B;  2UUA J;  1GXL A;  3QAU A;  4DXL A;  3T9N A;  4Q44 A;  4OJG A;  5GMK a;  3CNQ P;  2ADB A;  5HI7 A;  4ES3 A;  1Q5V A;  1Q8B A;  2HNZ B;  4OI6 A;  1E6V A;  1E6Y B;  3DHX A;  5GAE U;  3DLE A;  2L9W A;  4ZVG A;  3RAM A;  2GQ2 A;  3DFE A;  3TJA A;  2PFF B;  4HEA 9;  4KGK A;  5ETO A;  4IH5 A;  1VHF A;  3GON A;  1Y0H A;  1S10 A;  5GAD I;  1TTH B;  4JOU A;  4B9M A;  2WVF A;  1G6B A;  3LP1 A;  3M1V B;  3ZZU A;  2RDJ A;  4JI3 J;  1YK9 A;  2GGP A;  4W92 B;  1IQT A;  2OUG A;  4YME A;  2YX4 A;  2XQC A;  2KT5 A;  3MEE B;  4HAC B;  4DV2 J;  4ED6 A;  1OY6 A;  2E7V A;  1ZA2 B;  2H1Y A;  2E1M C;  3Q8Y A;  3HVT B;  4LRC A;  5KG6 A;  3I6P A;  1FX4 A;  2GV1 A;  1WI6 A;  2W24 A;  2UVW A;  3JTP A;  4JI8 J;  2XLK A;  3S8S A;  3HHD A;  4I6A A;  2KRB A;  1ZM9 A;  2BDP A;  5H9F J;  4OX7 A;  4HTI A;  3MTJ A;  4ENO A;  4B3T F;  2XHW A;  3DOM A;  1MRO A;  1VK8 A;  1V3S A;  2F5G A;  2QEX S;  1FHT A;  1CS4 A;  3P5T L;  4Y28 C;  3HVR A;  4RBV A;  3PW4 A;  2CPI A;  2HBZ B;  4JI4 F;  4F8R A;  4RKU C;  1NK4 A;  3CSK A;  1S5Z A;  3R1H A;  2KH9 A;  2BE2 A;  3QFW A;  1LWF B;  2GO9 A;  2V4J B;  2NUH A;  3SQO P;  9ATC B;  1HLW A;  2W8K A;  3ITH B;  3PYD A;  4N77 A;  3GV7 B;  3I31 A;  1RU1 A;  1N52 B;  1A0O B;  1KVI A;  4CLY A;  4CYU B;  1IKW B;  4UOC A;  3DC2 A;  2FJB B;  3K58 A;  4IG3 B;  1NPK A;  4C11 A;  1M1H A;  4ZVH A;  2VG5 A;  1RWW B;  5DGA A;  2MKY A;  1SL2 A;  2XNR A;  2YNI A;  4C8O A;  1YRX A;  4X62 F;  2PC6 A;  3HSJ A;  2VHG A;  3RB6 A;  1EET A;  3ZZZ A;  1TKD A;  3CJ8 A;  2DGS A;  4WYL A;  2RE1 A;  5LM7 E;  4LF6 F;  2AJF E;  1HD0 A;  3M05 A;  1HL6 A;  3NY0 A;  3UCU P;  4MFB B;  2MST A;  1QAI A;  5IOL A;  1EX8 A;  4WP8 A;  1MW7 A;  3J7A 1;  3ZXW A;  8RUC A;  4R25 A;  1FXL A;  2FLL A;  1JKH B;  3MR7 A;  2MZR A;  1CJT A;  3QNW B;  1GXT A;  2K8G A;  3IFE A;  3DMJ A;  3R5G A;  3GPA A;  1WEL A;  3QRP A;  4OYO A;  1IKX B;  4RW4 B;  2MSS A;  4ICL B;  2CQ2 A;  3A3O B;  4ER8 A;  2RRN A;  3SQG A;  1HQE A;  4TY8 A;  1REV B;  1CBK A;  1P9Q C;  2CPY A;  2WW8 A;  2HZA A;  4ECR A;  1FT8 A;  3CDU A;  4WP9 A;  1SC6 A;  2DGU A;  2LXU A;  3T5L A;  2RQK A;  2D3U A;  3D3C J;  1FRK A;  2L3M A;  3KKF A;  3RBX A;  2JLF A;  4J9L A;  1TFW A;  2MZ1 A;  2W8L A;  1NND A;  4DPW A;  5D8H B;  1S49 A;  3EMT A;  3MM8 A;  2V8G A;  1DUR A;  2L08 A;  3BRE A;  2ZVS A;  3C15 B;  4R5P B;  3D1H A;  4LF5 F;  4UUX A;  1HNX J;  1H74 A;  3FBC A;  1NU4 A;  2XUL A;  2UVU A;  5JJB A;  2WRM A;  1B70 B;  3W7B A;  1D8Y A;  1KHV A;  1Y3K A;  1ZTT A;  4GKK J;  1C2P A;  2BKN A;  2YKN A;  2ZH3 A;  1ELO A;  3I5A A;  1F60 B;  3HZG A;  2DGX A;  2OEL A;  4JI5 J;  2NSC A;  1VHI A;  4DBQ A;  3BPS P;  2MTL A;  1IM6 A;  2H54 B;  1XWL A;  5D4P A;  3Q86 A;  1S97 A;  1SXL A;  2W7O A;  5AXM A;  4EUV A;  5I3U B;  2HHQ A;  1NHK L;  3G8Q A;  3HSD A;  4Y3C A;  1BE4 A;  3WC0 A;  4RUC A;  4WF9 Q;  1JLB A;  3R7B B;  3MAH A;  4WP3 A;  4DL2 A;  4UTG A;  4U95 A;  2OD6 A;  4ZPA A;  5HAO A;  3KDN A;  2E7W A;  2WOM A;  5KG0 A;  2RJZ A;  2ZH6 A;  1M5K C;  1N5T A;  2LU1 A;  4FYV B;  2MQQ A;  1Q7Y T;  5CD4 H;  1VJW A;  5B7W A;  5D0R A;  3CDE A;  3MUV P;  1TKX B;  1S9G A;  4AXI A;  2UXB F;  3AXK A;  4B17 A;  1T3O A;  3MPW A;  1EHW A;  2AGP A;  3M8Q A;  3GYN A;  3RR7 A;  2CQB A;  1SKU B;  3JS9 A;  4U7U K;  1M0S A;  3UN3 A;  4LR9 A;  5CA5 A;  1Q7L B;  3ILJ A;  4J9U E;  3R1L A;  3NBP B;  1YQH A;  3DRX A;  5DQI A;  3TQ1 A;  4WKY A;  3QAT A;  4CLT A;  1BWE A;  5IC4 B;  5HJY A;  2AYG A;  2CQ0 A;  1PBU A;  1WOP A;  5L1L A;  1FTC A;  1KC8 T;  1HI8 A;  1V3R A;  2OML A;  3OXG A;  2SXL A;  5KT7 A;  4A8M P;  2JLG A;  2OPS B;  1N4L A;  1UET A;  5AT1 B;  2R7T A;  3U7J A;  2WTF A;  5FII A;  4ED2 A;  2GML A;  2CKW A;  3DLK A;  5IFM A;  2CPJ A;  1IJF B;  5KFU A;  4YDX A;  3UQS A;  4RNF A;  4DS4 A;  5L46 A;  3QSI A;  4Q0B B;  1NSQ A;  3OL7 A;  2JFK A;  1SH2 A;  3CDW A;  7FD1 A;  2MY8 A;  2Z30 B;  3DU5 A;  2DXD A;  5KFJ A;  3U1L A;  4IRC A;  5B08 A;  3KLI B;  3OFF A;  5LJ3 Y;  4X4T A;  3GIK A;  3UO0 A;  5F8L A;  1NKE A;  3JYT B;  4CLL A;  4KTQ A;  2W9B B;  3VR1 A;  1JNZ B;  3PG9 A;  1GTE A;  3SBM A;  2MQM A;  1RBO B;  4AQY F;  1Y4Z B;  1FRM A;  3LAN A;  4G1P A;  5ETS A;  4USU A;  2CZ4 A;  5HQL A;  4KGM A;  3U1M A;  4RBU A;  1RWM B;  1UJ4 A;  3FVY A;  4F50 A;  3V6D A;  2HUR A;  2QLX A;  3LPE A;  4DF8 A;  1RAH B;  2ADC A;  3Q89 A;  5MAO A;  3J81 U;  2NQP A;  4PQA A;  4PUO A;  1LW0 A;  3BPD A;  1VQ5 S;  5IWA J;  2VON A;  2XMK A;  2DGO A;  3M2R A;  1OJ4 A;  5F8M A;  3IMQ J;  3IRX B;  2QYG A;  1HBN A;  5ETT A;  1VBZ A;  3TI0 A;  1WEX A;  4G65 A;  2CDR B;  2BJE A;  4LT6 A;  2YKP A;  5F8I A;  4C8L A;  3DNC A;  3KDO A;  3MZI A;  4H4O A;  4Y2M A;  4LF2 A;  1U47 A;  1SKS A;  3QJP A;  5KFH A;  4PG8 A;  2J9D E;  3M32 A;  4URS A;  4RW6 B;  3H40 A;  1RSC A;  2B56 A;  1SC3 B;  3OQ2 A;  1RAI B;  2DCU B;  4ZP9 A;  1NK5 A;  3CPW R;  5F0U A;  2HFU A;  3CCS S;  4KQZ A;  4LSN A;  1SL0 A;  5F8J A;  2XTJ P;  3FFI B;  3QGI A;  2ZEJ A;  1N6Q B;  1HNW F;  2DY1 A;  2UUC J;  1LFP A;  3D54 A;  2F8H A;  1NZA A;  3WX4 A;  1EAR A;  2HS3 A;  4OI1 A;  4J7C A;  3KLE A;  5DLG A;  2HPU A;  1ULR A;  2XCP A;  2HQF A;  4KT0 C;  4NCA A;  2DNY A;  3FGV A;  3SSS A;  2VUG A;  1S0V A;  3SEO A;  4WZQ A;  4TXS A;  3N6L A;  4HT7 A;  3QMQ A;  2BZ2 A;  1R6V A;  4PXC A;  2V94 A;  2QE5 A;  4U8Y A;  3PFE A;  1Y5I B;  4DFJ A;  4M5M A;  1H72 C;  3LGH A;  1KQG B;  5FD1 A;  2DR9 A;  3I87 A;  1C1C B;  1U1R A;  1VRT B;  2IYG A;  1N88 A;  1Y7P A;  1LFW A;  4ZCM A;  2LA4 A;  4H4M B;  1HMV A;  2ZDP A;  2AF6 A;  1FFW B;  2G9O A;  2KVQ E;  1IN0 A;  2R7S A;  2GC8 A;  2HK3 A;  2X7I A;  2HHS A;  3AB2 B;  3OTB A;  4LF7 F;  3M8Y A;  4LUB A;  4RW8 B;  2ZVI A;  2DEI A;  3CDA A;  2YNF B;  3VQS A;  2X1F A;  1VQN S;  5CYM B;  4QIF A;  2EK6 A;  2OPP B;  4A8S A;  1IBK J;  4F36 A;  3DDI A;  3RBE A;  2JH3 A;  4ZIT A;  1N48 A;  3PTW A;  1UEU A;  4HL9 A;  4LFB F;  3IXQ A;  2XI2 A;  3ZZ0 A;  2DEJ A;  3TZW A;  2ZZN A;  4IOC Q;  1FKP A;  3MPU B;  4Z2X A;  2I1R A;  1QAY A;  2A1B A;  4KHR A;  3J80 U;  4CIO A;  4DF4 A;  1HR0 F;  3HDS A;  3Q83 A;  4M95 A;  2VQE F;  1HNI B;  3MM7 B;  1MML A;  2M3D A;  2A6O A;  2E1C A;  1D0E A;  1FF2 A;  2VD3 A;  3GCW P;  3POT A;  3TA2 A;  4L3N A;  1GFW B;  3OUY B;  4NXM F;  1PC5 A;  3KK2 B;  3QJL A;  3RRH A;  3RZA A;  1TFY A;  3GWC A;  2BRL A;  1EQM A;  1LK5 A;  2YH0 A;  4KV8 A;  2KFN A;  4R0J A;  4M5L A;  1MWY A;  4YOE A;  2DK2 A;  3KLG A;  5K14 A;  1S0M A;  1F2G A;  1VQ6 S;  5AXN A;  4F3M A;  1T3N A;  4NLS A;  4OX9 F;  4Q43 A;  2IYI A;  1QD1 A;  4DL7 A;  1DAR A;  3D5M A;  3DRP B;  2HHH J;  2HEK A;  1FI4 A;  2R8J A;  1TP7 A;  1P8G A;  2UXC F;  4KIA A;  4USW A;  2WZ1 A;  1VBY A;  4BDP A;  3CCR S;  3RAQ A;  2QMU B;  3B82 A;  3NCR A;  4RW9 A;  1RUS A;  4B9U A;  3RRK A;  3CJQ A;  3WZ0 A;  4QYR A;  2FHO B;  1NK0 A;  4MYU A;  2IJR A;  3J7Y I;  1X5P A;  3DLB A;  4IQX A;  3BYR A;  2XY5 A;  2EC2 A;  2XZD B;  4ZPC A;  3W60 A;  1RYS A;  4IG0 A;  4QQB A;  4KPY A;  1HWJ A;  3TAM B;  1OPZ A;  2WHO A;  4NE9 C;  4YB7 A;  2K7J A;  4F25 A;  4NLG A;  2HNZ A;  4PYA A;  1S6U A;  2LP4 A;  1PCA A;  2U1A A;  3ZNU A;  4O4G B;  4MMO A;  1V9O A;  2BYC A;  1K0V A;  2HQD A;  4ZA1 A;  4X65 J;  3LGN A;  5HMX A;  4DSF A;  4EBE A;  2VQF J;  1HYS B;  3W2W B;  4EU0 A;  3UWT A;  3HHL B;  2X1G A;  5HMZ A;  3M1V A;  4J37 A;  2ZFH A;  4AD6 A;  3GP9 A;  2AZ1 A;  2E44 A;  2GJI A;  4DG1 B;  4HAC A;  1SH0 A;  4PEO A;  3T19 A;  4LF5 J;  2ZH1 A;  2QJ3 A;  1KDN A;  4C8M A;  3C46 A;  3DYA B;  2E1R A;  1KFD A;  2Y3Y A;  3QYY A;  5F9L A;  4EWT A;  4C48 A;  5DDP C;  3HVT A;  1S1V B;  3W5Y A;  3JQM A;  3DI6 B;  2BR0 A;  2HYI B;  4WXO A;  2EWH A;  1ZYQ A;  4DV7 F;  1JJ2 R;  2KO1 A;  3PIP Q;  1N36 F;  1RT3 B;  1U02 A;  1R43 A;  1RXO B;  1X4F A;  3GB0 A;  5HVF A;  8AT1 B;  2PA3 A;  4J9K A;  2JC0 A;  3Q8S B;  1NJI T;  1EAY C;  4RL1 A;  1N32 J;  1LWF A;  2V4J A;  4J9O A;  1R0B G;  1VS3 A;  5F8H A;  3MM5 B;  3ITH A;  5LSO A;  2F4F A;  1LWX A;  4ZN1 A;  4YEA A;  3M6U A;  1VQO S;  1CQM A;  1WHX A;  1K44 A;  2F4V J;  4H54 A;  3GYX B;  4DR2 J;  1TKT A;  3IR6 B;  1J5O B;  4XPE A;  2J6U A;  4IG3 A;  5BJR A;  4QWD A;  2EFP A;  4EGL A;  1O0P A;  3QGP A;  4RO0 A;  3TP2 A;  3HKZ D;  3K5O A;  1MU2 B;  3ET6 A;  4Z7C A;  4CH1 A;  4MKV A;  2LEC A;  4OI2 A;  4XPC A;  4PWD B;  3NEK A;  4ZOS A;  2RQM A;  4FDF A;  2VC1 A;  2XMV A;  2RS8 A;  1KOO A;  1U6F A;  5B0F A;  4LBP A;  3R5C A;  2B4P A;  2NYH A;  3HHL C;  4JI7 F;  4F04 B;  1JKH A;  2JL9 A;  4ECS A;  4C98 A;  2H5E A;  4G1I A;  2QV6 A;  1RAD B;  1IKX A;  2QO3 A;  2IHR 1;  3JSR A;  1JWW A;  3GCX P;  4DCP B;  4ICL A;  4MIB A;  1CLF A;  1BQX A;  4JV5 J;  2O1P A;  1KOH A;  4AL7 A;  2F7V A;  1UPP A;  3PYF A;  2LEA A;  4HYK A;  4F4A A;  2C3U A;  2KG0 A;  2BX6 A;  1DTQ A;  4KRW A;  1CUL B;  1YTY A;  2BAB A;  2E5L J;  2RRA A;  2QA2 A;  2C3P A;  4GO7 X;  4OV6 A;  3MM9 B;  3E3X A;  3DRR A;  4IOA Q;  2L48 A;  3BB5 A;  4IO1 A;  3N28 A;  3BO4 A;  3C15 A;  2W7A A;  1MN7 A;  3LTO A;  3SCK E;  1C0T B;  1CEZ A;  1RTD A;  2O67 A;  4FXD A;  4C8Z A;  2HQI A;  3H4B A;  2DIS A;  1NHU A;  4CH0 S;  1ZPV A;  2A10 A;  1KQS R;  1KEK A;  2DGW A;  1TR0 A;  1VCT A;  3TAP A;  4EO8 A;  3CO0 P;  1FJG F;  2IJN A;  2CVI A;  2HWI A;  1UZH A;  4GVB B;  1LNQ A;  2BOA A;  4OV1 A;  1PAE X;  4F4X A;  4Q8F A;  4ZP6 A;  1NXI A;  3R9L A;  2KB2 A;  2R7V A;  3M8R A;  1HHQ A;  2QIF A;  3N6M A;  5CHC B;  3CB4 A;  1DY3 A;  3NMA A;  1DLO B;  5HAT A;  1W25 A;  5I3U A;  2UU9 J;  3BSN A;  2Z2Z A;  1JXL A;  1RP5 A;  1YJ9 S;  3GFX A;  1R8P A;  1S77 D;  2HWT A;  5J2M B;  3OTE A;  4CLF A;  2NXE A;  5D77 A;  4UOH A;  2DIT A;  2B4U A;  3LAL A;  2MZT A;  4P2M A;  2B51 A;  3SFG A;  1WEY A;  2ZH7 A;  2K06 A;  3C8Y A;  3FEX B;  4UUW A;  4F67 A;  2F8M A;  3BBB A;  5T7L B;  4ECV A;  5JVH Q;  2L9D A;  1G2E A;  1LXN A;  1YIT S;  1TKX A;  1EJ7 L;  4LF9 F;  1Q53 A;  1TKZ B;  1WD6 A;  3BBC A;  3FMW A;  3O8W A;  4K4S A;  4QWB A;  2WW4 A;  3PVX A;  1NH8 A;  2IM3 A;  3KUE A;  1NPR A;  4JV2 A;  2DNG A;  3DM2 B;  2RQ4 A;  1J2V A;  2M88 A;  1VMB A;  2WCX A;  3HJV A;  1UP1 A;  3BEG B;  1NUE A;  1UFK A;  1VOM A;  4HLB A;  3H98 A;  2LFV A;  3T1A A;  3MWB A;  1X5T A;  1RT2 A;  3MHY A;  4PWU A;  2OPS A;  2AX0 A;  2RNE A;  5KFB A;  2BUN A;  1HBM B;  3H5Y A;  3EZU A;  1ZPW X;  2HRY A;  3W5X A;  3NNA A;  3PW0 A;  5ETP A;  3SSQ A;  4DR6 J;  5A8K B;  2HG4 A;  1UW4 A;  2HGL A;  1GTH A;  2PII A;  2DO4 A;  4Q0B A;  4F4W A;  5D3G A;  3QSY B;  2FJW A;  4K4U A;  2R7Q A;  3G6X A;  3FCV A;  2YNH A;  4P52 A;  2E9R X;  3MEG A;  3QIP A;  1RAF B;  3TUJ C;  2CNK B;  4WYW A;  3VGU A;  1WWH A;  1HHT P;  3JYT A;  1SV5 B;  3KK1 B;  4TLR A;  1VQS A;  2W9B A;  2XYH B;  3UR0 A;  1Q78 A;  3RB4 A;  4M5G A;  4L6V 3;  2QSF A;  3Q23 A;  3MMC B;  1UVI A;  1HIY A;  4WIQ A;  3RRG A;  1URN A;  1WKL A;  1N33 J;  1KFS A;  4J9M A;  3RR8 A;  4DV5 J;  5LOQ A;  1H3D A;  3HFZ B;  4FYW B;  2GMJ A;  2DY9 A;  3UCG A;  3D0I E;  4F4Z A;  4QPX A;  5KFT A;  2GHW A;  3BH7 B;  1L5U A;  2CQ1 A;  3D9B A;  4JI2 F;  2DB1 A;  3AB4 B;  4CH7 A;  1U1O A;  1H2T Z;  1HAR A;  3IRX A;  4DUY J;  1VRU B;  5EDW A;  4K5S A;  5IV3 A;  3GSD A;  2R7X A;  4A48 A;  2BJ3 A;  3W65 A;  4LFC J;  5E41 A;  3M8W A;  1NKC A;  2GIQ A;  1S59 A;  3CCV S;  1FEE A;  1HQU B;  2XNQ A;  1RWV B;  1RTZ A;  4O44 B;  1UW9 A;  1OO0 B;  4RWX A;  2Y8W A;  1QDU B;  4YY3 F;  3G86 A;  2I5J A;  2J7U A;  1DHM A;  3CJR A;  2PT0 A;  2GX8 A;  2P6S A;  3J81 Y;  3ZC4 A;  4OYP A;  3GYG A;  5LMN J;  2NCK L;  2XWX A;  4DV3 F;  3B54 A;  1F3V A;  1FRL A;  4C9D A;  3RG6 A;  3K5L A;  3FFI A;  4FPI A;  3D28 A;  4DMZ A;  1AT1 B;  1IR2 A;  3O1L A;  4DV0 J;  4CM0 A;  5T14 A;  2WVE A;  1VQK S;  1SIW B;  3MTK A;  2MKK A;  2GVZ A;  1HI0 P;  2QZ8 A;  2VG7 A;  3PDN A;  1YBA A;  3DLH A;  5DG7 A;  4ZN3 A;  4IFV B;  4MTP A;  2C42 A;  4CCH A;  4K4X A;  5KFD A;  5B0C A;  2BAN B;  2M4M A;  4TVA B;  3N4W A;  2W4D A;  3R3T A;  4CM2 A;  1FWP A;  4AYB D;  2HHX A;  3GJQ B;  2WBR A;  1VRT A;  4RR5 A;  3JQJ A;  4H4M A;  1AYE A;  1K73 T;  3F0N A;  3J7Y U;  3TX0 A;  2DH8 A;  3D2W A;  2XS5 A;  2FHJ D;  3E51 A;  4MK7 A;  3CJ2 A;  2MLY A;  2LQ5 A;  2R2T A;  2KN4 A;  2Z2Y B;  3AQP A;  1U6B A;  1IQZ A;  1VLO A;  3HX9 A;  4RW8 A;  1NK8 A;  1R0A A;  4YP3 A;  2YNF A;  4X64 J;  1TMJ A;  5CYM A;  2JNJ A;  1RWK B;  2YWH A;  4WFZ A;  3EPG A;  2YQ0 A;  4K4V A;  3OJU A;  2OPP A;  2VFU A;  1UZD A;  1WI8 A;  5AE3 A;  1T05 B;  1VBK A;  3UNY A;  1RBL A;  3NXZ A;  4FVC A;  4ZVE A;  2WVC A;  2UXD F;  2KZZ A;  2V6A A;  3MR3 A;  3MPY A;  1D3W A;  2YKO A;  4YQW A;  4J9P A;  4IYQ A;  4B9V A;  4N8O A;  4JI0 J;  2FVR A;  1XR5 A;  1NEE A;  2AJ4 A;  2YWG A;  2BJ8 A;  1HNI A;  2CJY B;  3P96 A;  4DQQ A;  3HKW A;  4RU2 A;  4X4U A;  4AL5 A;  3W2V B;  3LP0 A;  2DXE A;  3PJW A;  2UVR A;  2OEK A;  3BM7 A;  2BRK A;  4LMZ A;  2QGF B;  2PMZ D;  3TVZ A;  2BJD A;  3OUY A;  5G4D A;  3KK2 A;  1RHM B;  3G6V A;  2D1C A;  5D4L A;  1X4B A;  4PWW A;  3THP A;  5KT2 A;  4DPO A;  4M5I A;  4TQR A;  2FLO A;  3NNC A;  2DNZ A;  2DNH A;  2FQQ B;  3CWJ A;  1JX4 A;  2BV3 A;  4X4S A;  3M6X A;  4Q7A A;  3VHQ A;  2NXC A;  3CUL A;  5T41 A;  7FDR A;  3J80 Y;  3M8Z A;  5DM6 Q;  1YIJ S;  4ES1 A;  3DRP A;  3CC7 S;  3MR6 A;  4NLP A;  2LVW A;  4J90 A;  3BGR B;  2A18 A;  4NLV A;  3AXM A;  4DL0 C;  1RT7 B;  1JLE B;  5HMY A;  2KFY A;  2AP6 A;  2DT9 A;  2G2Y A;  1S1T B;  1OY8 A;  3P3D A;  1T9Y A;  4YR2 A;  5DLF A;  3DKD A;  5LT5 A;  4IUF A;  2Q3P A;  3MUR P;  3EX7 B;  1RKI A;  4OX6 A;  1KVK A;  5AJ3 J;  5KFQ A;  1HBO B;  2RDD A;  4ZLL A;  5M2R A;  3C66 A;  4ANE A;  4O0N A;  3GIM A;  2H9Z A;  2ZWP A;  1FRJ A;  3TAM A;  5BR8 F;  1SC1 B;  3W61 A;  4QR2 A;  3OXL A;  1KLM B;  3EE3 A;  5J2Q B;  4O4G A;  1CC7 A;  3DHW C;  5I4M A;  2IA6 A;  3BSA A;  2ZJP Q;  1FVS A;  4AUK A;  5J1P A;  4RX6 A;  2QMW A;  1IR1 A;  1IBC B;  1RGV A;  3ONQ A;  4DFP A;  3W2W A;  3TAN A;  4AT1 B;  3KXD A;  3HHL A;  4DI6 A;  4NLW A;  3Q22 A;  2I2Y A;  3M7V A;  1SQE A;  2YWK A;  5B09 A;  5CYQ A;  1PYS B;  1Y9O A;  3HJF A;  4UW2 A;  4DG1 A;  4LRD A;  3L4B C;  1AZS A;  4ZPV R;  2PE8 A;  3DYA A;  1U25 A;  3JTO A;  2XWY A;  3M30 B;  5GVQ A;  1CJV B;  4NOH A;  3Q0A A;  5KOW A;  3UD5 A;  3T41 A;  4CLW A;  2RU3 A;  4EBD A;  1TVR B;  2B3T B;  2MKJ A;  1PSD A;  1P27 B;  1KP6 A;  1UAW A;  1YWX A;  1YZ7 A;  1U6Z A;  3DI6 A;  1Q0N A;  2XY6 A;  2OGU A;  1IJE B;  1UVM A;  2V8H A;  1N5Y B;  4YR0 A;  1RT5 B;  3SCI E;  1GEH A;  3AA8 A;  1UPM B;  1RT3 A;  2NXJ A;  5GAE I;  1NDC A;  4DR4 F;  1U2C A;  2BJ7 A;  4OZJ A;  3KMS A;  2CQH A;  2YNG B;  3RGI A;  3BDP A;  1FRX A;  1FES A;  4NEZ A;  5KFM A;  4ALZ A;  5L1J A;  3HPO A;  2AJQ A;  3ELH A;  5L9N A;  2LCW A;  4B3M J;  4NMX A;  3I4P A;  2JX2 A;  3JSB A;  1NK7 A;  3IBW A;  3EZO A;  2CQP A;  1KWM A;  1CG2 A;  1Y11 A;  3BKU A;  2YQ3 A;  2YWE A;  4BWM A;  2LQJ A;  2P2C B;  5KFI A;  2WON B;  2HMI B;  4NCG B;  2QTW A;  1DAX A;  2AGO A;  1DQA A;  3D6H B;  1WOS A;  2C2R A;  2XG8 A;  5FDL A;  3ZTO A;  2BVZ A;  2DJW A;  1MU2 A;  2QT7 A;  3VAK A;  1XNR F;  3HHL D;  4KHP F;  4NLX A;  3EYZ A;  4PWD A;  4QW9 A;  5HN0 A;  2EK1 A;  2GFF A;  3D1Q A;  2X3G A;  2P8I A;  1HWU A;  2ZHB A;  2C2K B;  1FKO A;  3MMJ A;  2NXU A;  3EUN A;  1C0U A;  2IM2 A;  4N56 A;  2AYM A;  3HHK A;  4KFB A;  4ED8 A;  1JK9 B;  3C2P A;  5JUM A;  2J7K A;  2FHK A;  4ZLN A;  1RLC L;  3C14 B;  5DGB A;  3LA0 A;  4RW7 B;  3NNH A;  3FQL A;  1HBU A;  5CCM A;  1X0P A;  2O66 A;  3H2V E;  3H90 A;  3I9Z A;  4I69 A;  1JQG A;  4HDH A;  4KAI A;  1H38 A;  1IBM J;  3PJX A;  2ZOM A;  5KG1 A;  5C7P A;  1X7V A;  3FCW A;  4YFU A;  2R8K A;  3IAM 9;  4KE5 A;  1RI7 A;  3L7P A;  4NLR A;  3WIV A;  5B0G A;  3GII A;  2JEJ A;  1CUL A;  4PZV A;  1U49 A;  2AIR B;  2MLZ A;  4UOF A;  5ETR A;  2GO8 A;  4OZ1 A;  5KFL A;  1S48 A;  3FRZ A;  4EFA C;  4USM A;  1MSW D;  3CD6 S;  4DX6 A;  4CQ1 A;  2XZW A;  2ZKT A;  4Y34 A;  4J9N A;  1JXE A;  3ETO A;  5EGY A;  2MY7 A;  4DU7 A;  3WIU A;  1RTI B;  5KAK A;  1N0U A;  2FYX A;  5C42 B;  4K4Y A;  1YDL A;  4P9S A;  5KFY A;  8ATC B;  1U1N A;  2AHO B;  3PO5 A;  2AEJ A;  3MD3 A;  4GVB A;  1MNE A;  3IO1 A;  1Y00 A;  5K20 B;  2XMT A;  3DU6 A;  1EKS A;  2HRU A;  4OJ3 A;  5I3P A;  1NPP A;  2HFN A;  4R8U B;  3F56 A;  2C1E B;  1VC0 A;  1DLO A;  1C1B B;  1S9E B;  3L7O A;  1I1G A;  3SDE A;  1NB7 A;  5KG5 A;  2JSX A;  3TUZ C;  2HW3 A;  2NS1 B;  2AJ1 A;  3CE8 A;  3W5Z A;  1WF1 A;  3L9Z A;  5J2M A;  1J5E J;  2MGZ B;  1NSP A;  1U1L A;  2XBP A;  4LF4 F;  1D9A A;  5HLF B;  3WC2 A;  4NLT A;  3NMR A;  3CJS A;  5CD4 A;  3O3L A;  1JIH A;  1OQ3 A;  5T7L A;  4LSL A;  4FVM A;  3G82 B;  4OMF G;  3RTV A;  3M6W A;  3BN7 A;  5DM7 Q;  4QYZ J;  2D9O A;  3VAI A;  2YX7 A;  1LQ9 A;  1U2F A;  3PRV A;  1FJE B;  3A13 A;  2MDA A;  4JI6 F;  2XO6 A;  3BQ0 A;  1NSA A;  5E3C A;  1S72 S;  1PJ6 A;  3LAK A;  2LQ9 A;  3Q2T C;  2YY3 A;  1RJJ A;  3DM2 A;  1PIL A;  2FGC A;  3VAG A;  1UFW A;  1Q16 B;  4NYP A;  2KYZ A;  5BXI A;  2EKN A;  2NPF A;  3NGK A;  3RW7 A;  2HLU A;  1BD6 A;  1KTQ A;  2BAC A;  4WFA Q;  2JEF A;  1FJ7 A;  4C8K A;  2PEH A;  2OEM A;  2OSR A;  2FB0 A;  3CCZ A;  1FER A;  1BMQ B;  3HT3 A;  2P5V A;  4NXN J;  1APS A;  1HBM A;  1LK7 A;  3H20 A;  3TZX A;  3ULH A;  1VQ7 S;  5A8K A;  4AFF A;  4OHZ A;  1T94 A;  4X4N A;  1SJ3 P;  5A8R B;  2QX0 A;  2QYC A;  2NR0 A;  3FRY A;  5ETM A;  3IN5 A;  1OY9 A;  1Z4U A;  3OXF A;  3ZTR A;  2UP1 A;  2Z2M A;  4F0K A;  2CWX A;  4DFK A;  4ZP8 A;  1EQ0 A;  1JXV A;  1XER A;  3E01 A;  5KFA A;  5KTQ A;  4NLY A;  3MAA B;  4ILM A;  2F63 A;  2FZG B;  3GIJ A;  3RBZ A;  4WFY A;  3EGV A;  1OYE A;  4DR3 F;  3J7Z 5;  4RUA A;  1SV5 A;  2ASL A;  4B3S J;  3NWR A;  4DWI A;  1N8R T;  2HVE A;  1H2V Z;  1KQK A;  4KYZ A;  4C6A A;  5A2Q U;  1ZH5 A;  5ITH A;  3NGU A;  3HD1 A;  3MMC A;  5KFR A;  2N82 B;  3BGL A;  3CCM S;  4WE1 B;  1T03 B;  1Q8K A;  3AHP A;  3KJF B;  1T9U A;  1FK9 B;  2UXD J;  2RF2 A;  1TK5 A;  4M63 A;  3N6N A;  4JI1 F;  3M9M B;  3IG1 B;  3MXH P;  2U2F A;  3EZ5 A;  4XAK A;  5B0A A;  2YKM B;  2FGO A;  3BYP A;  2HND B;  4IDK B;  3ENV A;  1S1X B;  2PMW A;  4DL3 A;  3T1Y F;  1C4C A;  1VRU A;  1IKY B;  2WVD A;  1HNV A;  1OPI A;  3T3F A;  4C0O C;  4JP8 A;  1BQM B;  1T11 A;  1Q4R A;  2XMW A;  1SQF A;  2I6W A;  1Z2L A;  2M7S A;  4DL4 A;  1CJU B;  9RUB A;  2WSC C;  4K0K J;  2X1A A;  4JYA F;  1ZM3 A;  3NOG A;  1HQU A;  2L9N A;  4FXW A;  2R7O A;  2V4R A;  1XTZ A;  2N7C A;  1EKR A;  2C3Y A;  2DHH A;  1NJZ A;  3A8K A;  3R2D J;  3DDK A;  4DR7 J;  1FNX H;  3AY0 A;  3RU0 A;  2VIC A;  4KHM A;  3LWL A;  1UTA A;  3M2U B;  4LRB A;  2VG6 B;  2CAD A;  2FVC A;  4XK8 C;  5IZH A;  5DG8 A;  4FN5 A;  3RAX A;  2WSF C;  1RHU B;  4X66 J;  2XMM A;  4M5H A;  2ATL A;  1RWP B;  1H6K X;  3HUL A;  2CQG A;  4FYY B;  1YSJ A;  2IM0 A;  3NKY A;  1BUX A;  4DOZ A;  1AW0 A;  3UVJ B;  3MFI A;  3C3L A;  1IWA A;  1BXN A;  2ALY B;  3DGP B;  1UCN A;  3F73 A;  2QFJ A;  3GIR A;  3HLU A;  4P71 A;  2ABY A;  1NZ8 A;  2BAN A;  4IH7 A;  2I9S A;  5C2G A;  3OFE A;  3OSP A;  2HFZ A;  1ZAW A;  4A8Q A;  4LF8 F;  2ZNZ A;  3VAJ A;  2ACY A;  3PNI A;  3KLH A;  1SKR A;  4EBC A;  1I94 F;  4RUH A;  3VGV A;  3KJV A;  1Z1Z A;  2PEB A;  3TQE A;  3DGV A;  2KHC A;  1T9T A;  1RU2 A;  3ENA A;  1WC0 A;  1PO6 A;  1JLA A;  1WHW A;  2XS7 A;  1WTB A;  1RAG B;  1GX5 A;  1RT6 B;  4LIW A;  4NX9 A;  2CPD A;  2ROE A;  4FF3 A;  1LXJ A;  1HWI A;  1TQL A;  2VA3 A;  1T05 A;  2XGP A;  1H0H B;  1WSV A;  3M8S A;  2IBK A;  2ZBP A;  3FBB A;  2AWZ A;  4BCA A;  4FYD A;  3VCD A;  2ROG A;  5J1E B;  3THT A;  4WFX A;  2HWH A;  1D9D A;  3IWN C;  3A4T A;  2E29 A;  4PQU B;  2ZOF A;  4ZLJ A;  2M0G B;  2JEI A;  4OHV A;  1TL4 A;  3GV5 B;  3CJ3 A;  2RUG A;  4I2Q B;  2OMO A;  3W2V A;  4CLU A;  4K5R A;  2OTJ S;  5AE1 A;  1B0P A;  5AE2 A;  2W1B A;  3MMA B;  1NCL A;  1WG5 A;  4OZ0 A;  3KTQ A;  3PR5 B;  1S0O A;  2I0X A;  2EKY A;  2KI2 A;  1EP4 B;  2MQO A;  4LFA F;  3BSC A;  1S6P B;  2CJK A;  3G2X A;  5KFV A;  1PJ5 A;  2YPY A;  1HW9 A;  2H48 B;  4N5S A;  4O3O A;  1F5C A;  3QO9 B;  1FNM A;  1TL1 A;  4HVZ A;  1TUV A;  5ETK A;  1L3S A;  4CNY A;  3NG8 A;  4DV1 J;  1DFD A;  2BOP A;  1WHV A;  4KHP J;  1JLE A;  3C6T A;  2IMO A;  3A3N B;  1X9M A;  1RT4 B;  1S1T A;  4IR9 A;  1HNZ J;  4DCJ B;  3D66 A;  4DV4 F;  3GIL A;  3TEG A;  5KFN A;  1ZAV A;  2BE7 D;  2HIQ A;  2J0W A;  5F3Z A;  4HHH A;  1L3U A;  1H2U X;  2VDH A;  1MWQ A;  3IBC B;  2JEG A;  1HBO A;  4M5N A;  3L7U A;  2CQD A;  5HBM B;  3A8I A;  3JXO A;  3OTO J;  1KN6 A;  1Q95 G;  4CTA B;  2UUB J;  2QLF B;  2BQR A;  3QGH A;  2BW7 A;  1UWB B;  1SVD A;  1KLM A;  2FPH X;  5KFF A;  2RAQ A;  5HK4 A;  4TY9 A;  5J2Q A;  4TKT A;  1YX2 A;  2KDO A;  4OZL A;  2VJU A;  1QLN A;  4GKJ F;  4DQS A;  1VBX A;  1Y10 A;  1GAO A;  1NDK A;  4PG5 A;  1G7C B;  4ZLP A;  3V4I B;  4OYA A;  1LW2 A;  4J5O A;  3PXG a;  4DSL A;  1E6V B;  3GFH A;  4DZD A;  3IM8 A;  3ZTS A;  4KSE B;  2W01 A;  2FJE B;  1TEL A;  4K4W A;  5CAA A;  4OFZ A;  3M30 A;  4DL6 A;  2LXI A;  1ZA1 B;  4OZN A;  1TVR A;  1S1U A;  1FA0 A;  3LQV A;  3VAH A;  4WZM A;  1Q8L A;  3P8B B;  2Z2L A;  1JLC B;  2FLP A;  2VL1 A;  4G1Q B;  4ZHR A;  2R9L A;  1N5Y A;  1RT5 A;  3CXC R;  4V1A k;  1XMQ J;  2W2N P;  2VPW B;  4MKB A;  1NSK L;  4ZVF A;  3F41 A;  2MJN A;  1RWX B;  4DR5 J;  2AW0 A;  3FBE A;  1U09 A;  3GJS B;  3TYT A;  2G4B A;  4HI1 A;  1WF2 A;  2VFV A;  3DOM B;  3KK3 B;  1U4B A;  3DXS X;  5EX3 A;  3FUY A;  5GMD A;  3KWM A;  2Q66 A;  1LWE B;  5L8R C;  2XM3 A;  4DPX A;  1YG0 A;  4OYW A;  3BBF A;  4ZJQ A;  1OMS A;  2XS2 A;  2RS2 A;  2KZM A;  1IR0 A;  4I4B A;  4U7C A;  2ZJR Q;  1JLF A;  2WON A;  2HMI A;  4EYI B;  4NCG A;  5IQ6 A;  4Z37 A;  2R7U A;  1M90 T;  4QJV A;  4TQS A;  3OR2 B;  2HNY A;  4UQG A;  1FE4 A;  1SH3 A;  2Z8Q A;  2J8S A;  4NRT A;  4OI4 A;  1S6O A;  2V2Q A;  3D67 A;  3D4J A;  4E98 A;  2OD4 A;  2VFR A;  2XLJ A;  4DSI A;  3V6H A;  4C11 B;  5KFG A;  4OJ1 A;  4LF1 A;  1K9M T;  2DHX A;  1WUU A;  4GMK A;  4YB5 A;  4NML A;  4M5J A;  3LGM A;  3LPY A;  3OLA A;  2V0N A;  4EYH B;  2CDQ A;  1ITP A;  3DLJ A;  1VIO A;  1TZ0 A;  3C14 A;  3MGJ A;  4LRA A;  3ZNJ 1;  3M8P B;  4RW7 A;  2W9A A;  3MF5 A;  5C2C A;  5F0W A;  2FZC B;  1VQP S;  3L95 X;  1XNQ F;  4UY8 5;  1EZZ B;  2V69 A;  3BQ1 A;  1SJ1 A;  5L9X A;  3R2C J;  3TJ8 A;  1YJR A;  4FF1 A;  2FZK B;  2CQ3 A;  2H5J B;  2FJV A;  3HHN B;  3H5S A;  3U1N A;  3H4D A;  1KR4 A;  2MKH A;  4FBT A;  1A6L A;  2Z4P A;  4D3G A;  2UUA F;  3BH6 B;  4A8W A;  4HR2 A;  4CDI A;  3QLH B;  5L1K A;  2ILY A;  3UD4 P;  5KG4 A;  2OI2 A;  4I2P B;  2MLX A;  2BQ3 A;  2AU0 A;  2EFN A;  4IRK A;  1HD1 A;  4KJI A;  2GQC A;  2IC3 B;  4DPU A;  3FC9 A;  3CJ0 A;  2AGQ A;  4OZ2 A;  1WG4 A;  1LKZ A;  4LQ3 A;  3S7R A;  1FWK A;  3K8V A;  1RTI A;  4JI3 F;  1REG X;  2Y9H A;  4WK1 A;  4D3H A;  3MM8 B;  4NRU A;  2QN6 B;  4DV2 F;  2DIU A;  3CJ5 A;  1F9F A;  3CJK A;  2YKQ A;  1NHV A;  3H8Y A;  1ZM4 A;  4XDC A;  4FP9 A;  2V8D A;  2ATC B;  2XY7 A;  4OZ5 A;  4JI8 F;  2V2K A;  2H4W B;  4R8U A;  2ALZ A;  4I1T A;  2B9Y A;  3VAL A;  2KXH A;  2J6S A;  1S9E A;  4XTT A;  5JVG Q;  1JMT A;  3UR3 C;  2E5H A;  2HIY A;  3AT1 B;  5A6W A;  4JYA J;  2C3M A;  1G3O A;  2MGZ A;  5HLF A;  2CJQ A;  1U1Q A;  4HI2 A;  4PCQ A;  2OEJ A;  2V34 A;  5J2P A;  2ZBR A;  1F6T A;  2XSF A;  2ZC4 A;  3P4U B;  4C97 A;  3FEZ A;  2WB1 D;  2A6M A;  4RNH A;  2APO A;  3H59 A;  3BSO A;  2QC3 A;  2ROP A;  3Q8R B;  1WNE A;  3VAF A;  5LXR A;  4TNO A;  3AD8 C;  1YJT A;  2MQL A;  3MI7 X;  1S57 A;  1YJU A;  3FZ2 A;  4MT1 A;  1X31 C;  1N5Q A;  3MED A;  1FD8 A;  2BM1 A;  3O6Q A;  3MUM P;  3I96 A;  2GIR A;  5L1I A;  2DKO B;  4Q8E A;  2VU5 A;  2G0I A;  2VFS A;  4DUT A;  3RBD A;  4Z7Y A;  4ZCL A;  1VJQ A;  4IH6 A;  4Y00 A;  2CUY A;  1N34 J;  2CQI A;  5K9F A;  3OVA A;  2C2D A;  3ISN C;  3UNG C;  3MEC B;  4ZPD A;  1N54 B;  1F3F A;  4ZVR B;  5A8R A;  2QA4 G;  1SIZ A;  2HGM A;  3AOB A;  1RBA A;  3HD2 A;  1GX6 A;  3OPK A;  4ZJL A;  2JVO A;  1X4D A;  3MCS A;  3J7Z T;  1H7W A;  5ETQ A;  3CD0 A;  2H4Y B;  3SXL A;  2AEM A;  3IP0 A;  4ZMM A;  3H7H B;  3A12 A;  5DZ6 A;  3PW2 A;  2H65 B;  2ZBC A;  3TUI C;  3AA9 A;  5F8N A;  1RDR A;  1GMW D;  3SCL E;  4WE1 A;  2EI5 A;  1T03 A;  3UW1 A;  1YVF A;  3OD2 A;  4IOB A;  4DX5 A;  3FKB A;  3R6L B;  2J0X A;  4QPT A;  1D8Z A;  1UA0 A;  1HNX F;  1MWZ A;  4W90 B;  2VC0 A;  3H5X A;  1JLQ B;  3H0P A;  2EW9 A;  5C5J A;  1R8H A;  2YKM A;  3BJY A;  4OHX A;  1P1L A;  1XMO J;  1S1X A;  4M5D B;  2V68 A;  5LMU J;  3BGO P;  1UVK A;  2R8I A;  3V6D B;  4BBY A;  1Y5L B;  2ZZT A;  2LU2 A;  1PKU A;  2AYE A;  4ECY A;  1BQM A;  2Y0S D;  4JI5 F;  4BC7 A;  1RAC B;  5A2Q Y;  3ZZO A;  5IT0 A;  4Q45 A;  2KHD A;  4PUO B;  1LW0 B;  2EG1 A;  5EWE A;  1YJN S;  2KRR A;  3M2V A;  1XJW B;  4O3N A;  1I6J A;  1VDH A;  1V5I B;  1X8D A;  2H51 B;  3US5 A;  2IY5 B;  1FEH A;  3IR7 B;  3FK4 A;  3S01 A;  1VRQ C;  3QZ8 A;  2V9K A;  3KLF A;  5CXT A;  2EXU A;  2RQC A;  3C19 A;  3G6Y A;  2JLE A;  1TK0 A;  1SUQ B;  4YS2 A;  5IM0 B;  3M2U A;  2I8E A;  4TU7 A;  2IA0 A;  2EFV A;  5KFZ A;  4CO1 A;  4X2B A;  2HHU A;  2VG6 A;  5DDR C;  5LXY A;  1UVN A;  5KT3 A;  2FHM A;  4P74 A;  3H5U A;  4QIG A;  3V6K A;  2FVS A;  3QT7 A;  4LSN B;  1W26 A;  3UVJ A;  2ZC3 A;  2J9E A;  2OP5 A;  2DNK A;  1X9S A;  4RPF A;  5KFO A;  5KG2 A;  1IWG A;  3T5K A;  2QFI A;  3DGP A;  2B9E A;  1TL7 B;  2OPQ B;  4RNN A;  4TYB A;  3PYG A;  3KLE B;  4ZIV A;  3MOJ B;  1U1K A;  1JLG B;  4AE5 A;  2GMH A;  4USH A;  2RU9 A;  2K1R A;  4B3T J;  4WKR A;  1KKH A;  4H4K C;  4NPO A;  1H7X A;  5HL7 Q;  2R8H A;  3R8Y A;  2V9W A;  4WTO B;  2KL8 A;  1BGX T;  3PV8 A;  4ZJO A;  4JI4 J;  2GJ2 A;  2OPR A;  3CVK A;  4ED1 A;  4PPD A;  2CXE A;  4DN0 A;  1QSS A;  5D4N A;  2M9K A;  3OT9 A;  2C2Z B;  2B8P A;  4ZVT B;  3TZZ A;  4O23 A;  4DR1 F;  1HMV B;  4EK2 A;  2CJA A;  2JFD A;  3R5J B;  4A46 A;  2AEF A;  1SL1 A;  3LF0 A;  3P49 B;  3HT0 A;  2ZM6 F;  1L3V A;  2M2B A;  2WAQ D;  1JJC B;  1CPZ A;  3DLG B;  5LSL A;  2AV5 A;  3E8O A;  5J1E A;  4J9R A;  3NCQ A;  4RJV A;  2Y1J A;  3OFH A;  3IAS 9;  4X62 J;  3OTC A;  4OZ3 A;  4C8Y A;  4PQU A;  4FZV A;  4DEZ A;  4LF6 J;  2HZC A;  4X4R A;  1XQI A;  4I2Q A;  4Y2K A;  1HPZ A;  1FRI A;  2VB6 A;  5EWG A;  4ECU A;  5H9E K;  3NP5 A;  2VBY A;  4ZPT R;  2KXF A;  1FKP B;  2X1B A;  1F5B A;  2HGN A;  4IO9 Q;  2YPZ A;  3QT8 A;  4F4Y A;  3CW2 C;  2XMJ A;  4ZK7 M;  1UA1 A;  2D69 A;  2E5I A;  2BBE A;  3T5H A;  4KGV B;  2H5I B;  1E6Y A;  2MB0 B;  3ENQ A;  1YKW A;  2R7W A;  3OHB A;  2RHS B;  3HFK A;  4I67 A;  3P45 B;  2FTR A;  4X4O A;  4LVN P;  1JNR B;  1T95 A;  2H3E B;  3GQC A;  1WDD A;  5J2N B;  3M9O B;  3NGS A;  4OIX A;  3R7N B;  1GH8 A;  3IBF B;  2JVR A;  1R8A A;  3MEE A;  1CQN A;  3MMB B;  1RT4 A;  2DNN A;  2VOD A;  4A8F A;  2IRU A;  3V81 B;  3CJT A;  4OYM A;  2V67 A;  3FEY B;  3GJR B;  2E66 A;  2DNM A;  4LRE A;  3QFH A;  1BWV A;  4ID5 B;  2VFT A;  1P1T A;  4B3O B;  1VQM S;  3G8T A;  1TL3 B;  2VBX A;  4K7Q A;  4G3I A;  3PX4 A;  2B0G A;  2KXN B;  3CDB A;  3HHE A;  3K59 A;  1UWB A;  3V6J A;  1RT1 B;  4QR0 A;  2E9Z A;  5HVH A;  4CWB A;  4M1K A;  4NLO A;  1I5O B;  1VC6 A;  1MG7 A;  1XC9 A;  2ZHA A;  3CCW A;  3K5N A;  4DL5 A;  3V4I A;  1KS2 A;  3A8J A;  5HP1 B;  3C6U B;  3EPI A;  1H73 A;  3GFY A;  2E5J A;  3DRS B;  4P7V A;  1SI9 A;  3CC4 S;  2DH9 A;  3BKT A;  1WG1 A;  4HDG A;  3ILL A;  2P9C A;  2HLT A;  2NUU G;  3R6G B;  2K3K A;  1S7I A;  4CYU A;  5ETV A;  2Q79 A;  1IKW A;  1NKB A;  2LA6 A;  4K50 A;  5H9E J;  5HQM A;  5KFX A;  2G13 A;  4DU8 A;  1V5V A;  2VKZ G;  3I5C A;  3UI3 A;  2UXB J;  4DUZ F;  3PAC A;  1U0S A;  1IBK F;  4WII A;  1TK8 A;  1JLC A;  2KYX A;  4L76 A;  2DD8 S;  3E2E A;  3L09 A;  4G1Q A;  4ELU A;  4MFB A;  2YX1 A;  5L39 A;  3BN4 A;  1VI7 A;  3JB9 k;  4X4Q A;  2DNP A;  4KBI A;  3QWP A;  1IBL F;  3UN2 A;  1HW8 A;  3ZTP A;  2YTC A;  4CRJ A;  2EPI A;  4IFY B;  4C3L A;  3KK3 A;  4RW4 A;  2FJA B;  3OL6 A;  3KG1 A;  2J9C A;  1MN9 A;  5GAH U;  2W2M P;  2XYP B;  5F3T A;  1LWE A;  2KVI A;  4KGX B;  4K8R A;  3WQP A;  2CPF A;  4PG6 A;  1REV A;  3GU0 A;  2PD1 A;  2QL9 B;  1FFS B;  5KG3 A;  1FVQ A;  2ZUG A;  3T1H F;  1W7W A;  1SBR A;  3CED A;  3KHR A;  2HVZ A;  4DV6 F;  5J1N A;  2ZKU A;  2R7R A;  3BR9 A;  3TA0 A;  4QWA A;  3OR2 A;  1LOU A;  1F0X A;  3PEH A;  1RLD A;  4R5P A;  3UCZ P;  1B0T A;  2MEW A;  1NBE B;  2ZH2 A;  4CO0 A;  1TKT B;  2MZJ A;  3AD9 C;  2E5G A;  1FXR A;  3EVM A;  4HH0 A;  2HHH F;  3AD7 C;  1X60 A;  4AQY J;  3DOK B;  3OSN A;  4OJH A;  1DQ8 A;  3ET6 B;  1QVF R;  1RA7 A;  1S4E A;  3F44 A;  3T9Z A;  5DJB A;  3Q8U A;  2ZNY A;  3SSR A;  2N7Y A;  3M8P A;  1RHK B;  2PI5 A;  2MPU A;  4UY8 T;  3CJ4 A;  1S99 A;  2RUS A;  2FLN A;  4L3K A;  2OFH X;  5IT9 Y;  1WDT A;  4E0D A;  1QVG R;  3N01 A;  2C2O B;  3GR0 A;  3V2U C;  2UV8 A;  4MH8 A;  2RKI B;  1IVZ A;  4DSK A;  2POK A;  1RHR B;  4GC7 A;  4FXV A;  1S4F A;  5HAN A;  2CAJ A;  3QLH A;  4KY3 A;  1HQ2 A;  1FFG B;  2C2N A;  2DPJ A;  2R42 A;  3JAM U;  2RIJ A;  4I2P A;  4P6Q A;  4QWE A;  4X65 F;  2ZZM A;  2IC3 A;  4FKX A;  1DTQ B;  4RUB A;  2VQF F;  3AAW B;  3QGG A;  2O5D A;  3DRR B;  1WHY A;  3CMQ A;  4M94 A;  4NWB A;  3PX6 A;  1UWA A;  5HRO B;  3SI8 A;  1TUG B;  2DHS A;  4WPA A;  3R5A A;  1HNW J;  2D3Z A;  3LAM A;  3RB0 A;  2FC8 A;  4QIW D;  2HQ3 A;  1RTD B;  3P5B P;  3NBP A;  3C16 B;  2CJ9 A;  3PW7 A;  1T0T V;  2N4D A;  3KG4 A;  4YB1 P;  4DX7 A;  3LW5 C;  4L74 A;  3HVW A;  4NLD A;  4PR6 A;  3VZH A;  3CIZ A;  2V4Q A;  3OLB A;  2VOO A;  2Z57 B;  2FVQ A;  3NOC A;  1T8E A;  3DXB A;  1R8B A;  2HVI A;  3FBF A;  4KC5 A;  3KMQ A;  1WEZ A;  4L75 A;  5FJ4 A;  3HVA A;  3N79 A;  2XB2 D;  1VC5 A;  4FYX B;  2GCF A;  1RAB B;  1N32 F;  4JV1 A;  1WSR A;  3PRB A;  2G0J A;  2EFG A;  4WU3 A;  3UDL A;  3DLL Q;  2VPZ B;  4P73 A;  3KLI A;  3CC2 S;  4PRF A;  1F9H A;  3FNN A;  4MYT A;  4LF7 J;  2XHC A;  4QIE A;  3PFO A;  3MD1 A;  2F4V F;  3M6V A;  5KT5 A;  1X9W A;  3HMJ G;  1SJR A;  3SZ2 A;  4DR2 F;  3OVS A;  3HF5 A;  4U9R A;  4ECT A;  3CCE S;  2D7S A;  1DJ0 A;  4PAB A;  3UE2 A;  3W63 A;  2A2D A;  4MIW A;  4S0M A;  4LIR A;  2UUT A;  4A8O A;  5JXS A;  2R8G A;  1XIQ A;  2VJV A;  4LFB J;  5E33 A;  3X3U A;  4CNZ A;  3ISN D;  5RUB A;  2DGQ A;  5IC6 B;  4EEY A;  1RYR A;  2AKW B;  2B7C B;  2WK4 A;  1HR0 J;  4NA3 A;  2VQE J;  4ILR A;  1U2R A;  1VK3 A;  2VAS A;  3MEC A;  2HBR B;  2PDA A;  4WCE Q;  4AXJ A;  5IS2 A;  1NME B;  2ZDO A;  1SJ4 P;  1Q86 T;  1RT2 B;  2NYI A;  1QTM A;  2NSB A;  2FHJ A;  6FDR A;  2J0S D;  4ED4 A;  2D3O R;  4Q2L A;  1UMJ A;  4NLQ A;  4Y2I A;  2VDI A;  2KT3 A;  4NXM J;  5GAG U;  4JV5 F;  2B8Q A;  4XIU A;  3KNG A;  4C8N A;  3VGT A;  3TUP A;  1HA1 A;  1GK8 A;  4BHQ A;  4P7T A;  4DR1 J;  4DCO B;  2PFD A;  4C2M A;  1FDD A;  4UZB A;  1UL3 A;  4RW6 A;  5D3G B;  4P72 A;  3S1T A;  4OX9 J;  1O6X A;  4N7T A;  3W9J A;  2M8H A;  3ISZ A;  3TVK A;  5A8W B;  1XN9 A;  5FLX U;  3TJ9 A;  1S1W B;  2OTL S;  2E5L F;  4ED0 A;  2YNH B;  3IGV A;  1FRH A;  2IVY A;  1RAJ A;  2J8A A;  3MEG B;  3QIP B;  2I38 A;  2FVP A;  4H4K A;  2ZM6 J;  3B8H A;  2BXJ A;  3D0H E;  2VIH A;  4ED7 A;  1N6Q A;  2UXC J;  4QU6 A;  3JSM B;  5KFK A;  2ZWO A;  1JLQ A;  1KTV A;  4K4T A;  2W4P A;  4MK8 A;  4M5D A;  2QRR A;  4X84 A;  5DG9 A;  1FO1 A;  2K7K A;  2O01 C;  3IGN A;  4F3O A;  2MZQ A;  4I56 A;  2CZV C;  3WHI A;  2L41 A;  3Q2S C;  4ZVQ B;  1MLA A;  4L73 A;  2A3J A;  2D74 B;  4OI0 A;  2OSQ A;  4F02 A;  2DH7 A;  4CLZ A;  1C1C A;  3I0S B;  2C2E A;  3JSY A;  2HAF A;  3FJ2 A;  1XR7 A;  2CFX A;  2UU9 F;  1ARO P;  3BGU A;  3FMB A;  2W2Q P;  5CH7 B;  4EZ9 A;  4CO5 A;  5KT6 A;  2ZOG A;  2XCA A;  4J91 A;  2CQ4 A;  4DQI A;  1SUQ A;  2K3I A;  1RCX B;  5IM0 A;  3D6M B;  3L3C A;  1D1U A;  2JZ5 A;  1O51 A;  1P9Y A;  2G1D A;  2I5J B;  2B43 A;  2JHE A;  2CG8 A;  5G0R B;  2M70 A;  2C22 A;  2CIM A;  1Q81 T;  2BMB A;  3SV3 A;  1I51 B;  3KJN B;  1NJW A;  4P2S A;  2B6A B;  3VWS A;  2MKC A;  3MDF A;  2HKE A;  1TL7 A;  4LSZ B;  2OPQ A;  2RDI A;  4ED3 A;  1JLG A;  3MR2 A;  3OV7 A;  4NL5 A;  3MM7 A;  2GVZ B;  2HRT A;  3ZZT A;  4DV7 J;  2VG7 B;  1N36 J;  2E1A A;  3EXY A;  3THV A;  3H42 A;  2XC9 A;  3I82 A;  4HH1 A;  2DRB A;  4C0B A;  2GS8 A;  4I68 A;  2XZT B;  3D6F B;  2KJV A;  4DR6 F;  2Y8Y A;  4MIA A;  2JRS A;  4FBU A;  3K8W A;  3PHT A;  4M5K A;  3TAQ A;  4OYI A;  3PX0 A;  3A3P B;  2ERR A;  1VQL S;  2X3D A;  2WB4 A;  4EZ6 A;  2FDN A;  3DLG A;  3BO2 A;  1UJ5 A;  1R0A B;  3B4D A;  1S79 A;  2DR8 A;  1WC3 A;  1OIA A;  4DUZ J;  1AFJ A;  1JJH A;  1HFE L;  1N33 F;  5K8M A;  2GHV C;  3QWU A;  1R8C A;  4DV5 F;  1UJ6 A;  4JI7 J;  4DZ6 A;  5GAD U;  3VAM A;  4LR8 A;  3K0J A;  1IBL J;  3BQ2 A;  3MUT P;  4MKA A;  1VGY A;  1YJ7 A;  4ZIW A;  3LP0 B;  4HHJ A;  4DUY F;  5D6G A;  1N0V C;  3KOA A;  1SJQ A;  2F65 A;  4OYX A;  4TYA A;  2HBQ B;  3DCA A;  4OL8 A;  3R97 A;  4LFC F;  3VGS A;  1T9W A;  2IMW P;  3T1H J;  4UF4 A;  4DV6 J;  4DX8 H;  1HYS A;  2W2O P;  3UDV A;  1HI1 A;  4U67 Q;  1SJF A;  2P6T A;  1PYT A;  3NGR A;  2MHN A;  5J2N A;  1WKK A;  3FSX A;  3TEH B;  3IWL A;  3K2Y A;  3RW6 A;  2OHD A;  2IM1 A;  3MMB A;  2DR5 A;  4NA2 A;  5LMN F;  4B9S A;  2LXF A;  2ZJQ Q;  3V81 A;  5BYS A;  2CQC A;  2M52 A;  1KBR A;  2J9D A;  3MCO A;  5DQH A;  4ID5 A;  1S1V A;  2W9C B;  3DDN A;  4B3O A;  3PO4 A;  4DV0 F;  3MM6 B;  2EVZ A;  1TL3 A;  5A6P A;  4N76 A;  1FJG J;  2AX1 A;  4PXB A;  1U1M A;  3AQO A;  2QLW A;  1SC4 B;  2KT2 A;  3KLV A;  1CC8 A;  4E2F B;  2CA9 A;  3ETM A;  4KGZ B;  4CZC A;  3GTY X;  4ZP7 A;  1RT1 A;  4O3S A;  4RNM A;  2DNO A;  4DSE A;  5DS7 A;  2WSE C;  2HSE B;  3GSI A;  3G87 A;  5BYR A;  3ZZY A;  1R0C B;  1Z2Z A;  3KHL A;  3OW2 R;  1R31 A;  4K2X A;  4ZCK A;  3SYZ A;  4QWC A;  1IKV B;  3D0G E;  4F2R A;  5HQ8 A;  5HP1 A;  3C6U A;  4HKQ A;  3MM5 A;  1YJV A;  3DRS A;  2RSQ A;  3Q8P B;  3OBI A;  4UOG A;  4LR7 A;  1WC6 A;  5DDQ C;  2OKQ A;  5IT4 A;  4OHY A;  1FD2 A;  3BKF A;  1BQN B;  1J5O A;  5EN1 A;  1XK8 A;  4FF2 A;  2AT1 B;  5F8G A;  4RBT A;  3N9U C;  1GXU A;  1SCJ B;  1TUW A;  1U8W A;  4TU8 A;  1VFJ A;  4Q5V A;  2K2P A;  1S76 D;  4X64 F;  4LF9 J;  2Q6B A;  3BS9 A;  1RWO B;  5CYQ B;  2B7B B;  4CP5 A;  2AZ3 A;  1Y3J A;  1AZS B;  4HHU A;  7AT1 B;  1NB2 A;  1Q5Y A;  5E5N A;  2LKZ A;  5K8N A;  3QAE A;  4KO0 B;  3QT6 A;  2W4C A;  3G4S S;  5KFS A;  3H2U B;  1RAE B;  2VF3 A;  3W8G A;  2ZIT A;  1B7F A;  1OWX A;  1LV5 A;  1S6Q B;  2HHT A;  4JI0 F;  1X4A A;  2BQU A;  1AUD A;  2DXF A;  2HFV A;  4PAA A;  1F9E B;  5B0B A;  3CCJ S;  4IFY A;  1F1B B;  4ZKA A;  1KQF B;  4K2J A;  4YR3 A;  2XGQ A;  3TX8 A;  4Y2A A;  3ILO A;  1VLY A;  1U0H B;  2ZUA A;  1DQ9 A;  4OI3 A;  2BA9 A;  3IR5 B;  2V5H G;  3B6B A;  5KFE A;  3G71 S;  2CWK A;  1NDP A;  3GV8 B;  1OSC A;  4EMD A;  4U96 A;  2HHW A;  2CNO B;  3NWG A;  4I7F B;  1M5H A;  3MM9 A;  4OYB A;  1PJ7 A;  3W9I A;  3DOL B;  1XR6 A;  3SV4 A;  2HHV A;  4GO5 X;  2B5J B;  3UFC X;  4BS2 A;  2UUW A;  4USI A;  4UZC A;  2HFS A;  2C2M B;  1C0T A;  3T6J A;  1QSY A;  3CCQ S;  2IFX A;  1QM9 A;  3SMZ A;  4DJB A;  3DOK A;  1JB0 C;  1X4C A;  3NGT A;  5IQQ A;  2VA2 A;  1HHS A;  2XSJ B;  3LO3 A;  2ZBQ A;  3HFV A;  5FDL B;  4WU2 A;  5F9N A;  1D9F A;  2G2Z A;  3MCM A;  1FX2 A;  1W2B R;  2Z58 B;  1K0T A;  3LUY A;  3O5T B;  2HAI A;  4HT5 A;  3QID A;  2GIF A;  2BKP A;  4W98 A;  2NXN A;  1FKO B;  4LVO P;  4OLO A;  1C0U B;  4JI2 J;  4KFB B;  5U47 A;  5AJ3 F;  2RKI A;  2Y1I A;  2YWF A;  3EJM A;  1OYD A;  5D78 A;  1HBU B;  2F3J A;  3UDC A;  1DBD A;  4CI0 B;  2E9T A;  2DYA A;  3KUG A;  4JV0 A;  1RTJ B;  4CT8 A;  4LJM A;  4RU9 A;  2FC9 A;  2ZBI A;  2KJW A;  3AJD A;  4B3R F;  2YH1 A;  4XDD A;  1R6Y A;  4NCB A;  1QJH A;  3K17 A;  3GR1 A;  2DNR A;  2P9E A;  4ATN A;  4LRF A;  3O44 A;  2DCL A;  3NRB A;  5THW A;  3VVT A;  1TL5 A;  2IVM A;  4NAS A;  2A2C A;  4A4J A;  1PGZ A;  4YY3 J;  3CO9 A;  3NS6 A;  2F40 A;  3A1Y G;  2N3O A;  2KM8 B;  3BGF A;  4WK3 A;  2MMY A;  2VBZ A;  3EDQ B;  2PO4 A;  1ROF A;  4DV3 J;  2O3D A;  3MOZ A;  3W62 A;  1IXK A;  1TKZ A;  4IQM A;  3R5D A;  2GW8 A;  5HRO A;  1ACM B;  4LQ9 A;  2P9G A;  3TWZ A;  3CME S;  4BLG A;  2RH3 A;  4DDF A;  1WAC A;  5SUH A;  3AFG A;  2DNL A;  4DN9 A;  5C25 B;  2DRD A;  4V19 X;  2PGC A;  1FE0 A;  3PIO Q;  3C16 A;  4IKA A;  1WTF A;  1S7H A;  1FXD A;  2RT3 A;  1XEZ A;  3I9V 9;  1X4G A;  3JAM Y;  4QOT A;  2KG1 A;  4J9S A;  3HXM A;  3BDE A;  3IS9 B;  4B08 A;  3FQK A;  3TVY A;  4U6P A;  2IAJ B;  4URQ U;  1RKJ A;  3MFH A;  3SFU A;  1YRT A;  5B0E A;  2R2R A;  1WOO A;  1ZM2 A;  3H2L A;  4C3M A;  4DQP A;  4Y2C A;  4ID8 A;  3SDE B;  4F0H A;  1NK6 A;  4WTY A;  2QLB B;  4I0W A;  3JQK A;  5EX0 A;  4B3M F;  1S12 A;  4UT4 A;  2HFO A;  3PJ9 A;  3ZZR A;  1VQY A;  2UZA A;  3KK1 A;  2FY1 A;  1QUP A;  5F41 A;  2D3O 1;  1NM2 A;  2EC0 A;  5C24 B;  5A0Y B;  4LSL B;  4NA1 A;  2Z0G A;  1UVJ A;  1CJK B;  4N47 A;  2YQ1 A;  1W2I A;  3K7R A;  3Q8V A;  4O3R A;  2KM8 C;  3OL8 A;  1LWC B;  1S9F A;  4YN3 B;  5HJX A;  3PKM A;  4B9T A;  4K59 A;  4PG4 A;  4Y0F A;  3AJ2 A;  5D4O A;  2ASJ A;  4WWS A;  2XI3 A;  4IR1 A;  3GMG A;  4JUZ A;  2KTQ A;  3QPI A;  1OS5 A;  2DR7 A;  1Q79 A;  3FDS A;  3D6T B;  5E3A A;  2ZH9 A;  1K1S A;  3OR1 B;  3QQC D;  5DET A;  2YKA A;  1NJY A;  2HS0 A;  3HCX A;  1IBM F;  3D3B J;  4A8X A;  3ZFV A;  1SQG A;  3PM9 A;  4FKY A;  4FPR A;  3LH2 S;  4O44 A;  4GC6 A;  1GT8 A;  4QIV A;  3VF0 B;  5DQG A;  4WXW A;  4DPT A;  2DIV A;  1AA1 B;  2CYY A;  4CLK A;  2IRX A;  5A8W A;  1IUJ A;  2N4C A;  1EB0 A;  3E01 B;  1S1W A;  4OQJ A;  3TZY A;  3J7A N;  2Y1L B;  2CVE A;  1EIY B;  2GVD B;  1CSJ A;  3VQT A;  4P2F A;  2RD5 C;  5B0D A;  1FKA F;  1QE1 B;  3JSM A;  5D0E A;  3W3S A;  4OYZ A;  4CLS A;  3WDO A;  4ECZ A;  3PEJ A;  1VIX A;  3KG0 A;  1RTH B;  4F26 A;  2CJB A;  3CTR A;  2LYV A;  3CUN A;  1M1G A;  2ZE2 B;  3KYL A;  2RF2 B;  3EWG A;  2OJ3 A;  3GG1 A;  2RVJ A;  3AJ1 A;  1URR A;  2CNL B;  4IFV A;  5FLX Y;  5I42 B;  2C28 A;  4KKO B;  4O3P A;  3KJQ B;  4XO0 A;  2KU7 A;  5BR8 J;  2CNN B;  3N0V A;  2ZH5 A;  3I0S A;  1HNV B;  2EFO A;  2GAH C;  2OFG X;  3LWM A;  2LQB A;  2AYB A;  3HSZ A;  2Q6C A;  2MXY A;  4LBH A;  3ZO7 A;  1VQ8 S;  2JWN A;  4QZV B;  1F2H A;  1RIS A;  1J5E F;  2MHE A;  1L3K A;  2FD2 A;  2Q43 A;  2VOP A;  2GAG C;  1TV6 B;  1N5S A;  2G1H A;  4NI2 B;  3CMA S;  1PYO B;  2EBE A;  2JJ4 D;  3R5B A;  3VVU A;  5G0R A;  2QG9 B;  3W66 A;  2M8D B;  1SPB P;  5K5M A;  3IA0 A;  5GME A;  3MPV A;  2CPH A;  4OHW A;  1X0F A;  3UN5 A;  3DN9 A;  2FJX A;  3PRD A;  1R7I A;  2B4O A;  2NZC A;  2PMH A;  2IVF B;  2B6A A;  2RB7 A;  2NRE A;  3ICL A;  3CCL S;  2VKR A;  3K5M A;  4QBU A;  1QTN B;  2OIH A;  1A9N B;  1FDB A;  1VIS A;  2BE9 B;  1RK8 A;  3ILI A;  5IXU A;  2EFQ A;  1DTT B;  2B4V A;  3T5J A;  3I0R B;  4I6Y A;  1YBT A;  4AND A;  4DR4 J;  3W9H A;  3D68 A;  3K5P A;  2M5Y A;  5CZV A;  4L72 B;  5D0G A;  4NXN F;  3TNV A;  3BO3 A;  1OQ6 A;  4A47 A;  5CQG A;  4YHH F;  1KLN A;  2DVI A;  1T9X A;  3KLH B;  3TO8 A;  4HTJ A;  2XYG B;  4ILL A;  2HK2 A;  4R0E A;  2GZO A;  5HO4 A;  2QL7 B;  3KJV B;  3CIM A;  2J76 E;  5HSP A;  1U24 A;  2BJ9 A;  2AJ2 A;  3HP6 A;  3W1Y C;  2MKI A;  1QSL A;  5A76 A;  1V3Z A;  2RHQ B;  1MMN A;  3BGR A;  1JLA B;  3H25 A;  4A8Y A;  4B3S F;  3NAH A;  1XNR J;  1RT7 A;  5E2Q A;  1UFL A;  2WBM A;  1PC4 A;  1NLK L;  2JDJ A;  2BEF A;  3PW5 A;  2EBG A;  1T9V A;  2ZD1 B;  1R3N A;  4U8V A;  3KUH A;  4NEY A;  5EHH A;  5KFP A;  2CPX A;  1YGY A;  1U48 A;  2V63 A;  5E3R A;  1KVJ A;  2V50 A;  4FNI A;  4ZVU B;  4PXD A;  3I32 A;  1U26 A;  4X4V A;  2LMI A;  3LP2 B;  4F7V A;  4YUD A;  5CZX A;  4ZPW R;  3I5B A;  3AOA A;  3FZB A;  1UEK A;  1NDL A;  5EWF A;  5I3Q A;  1F5A A;  4K0K F;  5KG7 A;  2FJD B;  4M8L A;  4N41 A;  5EUH A;  2VPY B;  4GRS A;  2Y0B B;  3I4H X;  4OX8 A;  4CT9 A;  2DPI A;  3DLE B;  4KB7 A;  4ITS A;  4KR0 B;  3KHG A;  2Y1R I;  3I56 S;  5DO2 A;  1XBW A;  3BZQ A;  1RE1 B;  4DR7 F;  2F9J A;  3J81 j;  2LDY A;  1RQ0 A;  1TL1 B;  1U7L A;  3N5B A;  1CJV A;  3LP1 B;  3IWX A;  4X66 F;  2GGP B;  2W9C A;  3C6T B;  4QCL A;  2RML A;  3TW0 A;  2FIU A;  3MM6 A;  1VR6 A;  3UPF A;  4I6W A;  4DHV A;  1CVJ A;  1FDA A;  1UEV A;  2AQ4 A;  4GVL A;  3S6E A;  4QU7 A;  2LEB A;  1FNO A;  1TAQ A;  4NZ0 A;  2PSZ A;  2NZ4 A;  2YNG A; 
#chains in the Genus database with same CATH homology
 4KYZ A;  5A2Q U;  4GKJ J;  3D3C J;  4X64 J;  1XNQ J;  3IMQ J;  3R2D J;  2UUB J;  3JAM U;  4DR7 J;  2F4V J;  4NEZ A;  4V1A k;  1XMQ J;  4DV0 J;  2UXB J;  4DUZ J;  3J80 U;  4DR2 J;  2MEW A;  2UU9 J;  2KL8 A;  3W1Y C;  4JI8 J;  4B3R J;  4LF5 J;  4DR5 J;  1IBM J;  4JI4 J;  4B3M J;  2UXD J;  2E5L J;  4NXM J;  3T1Y J;  4DV7 J;  4LF4 J;  1HNX J;  5LM7 E;  4DR6 J;  4X66 J;  4AQY J;  2UUA J;  4DUY J;  1XNR J;  4JI7 J;  1N36 J;  4LF9 J;  4LF7 J;  4NXN J;  3R2C J;  4JI0 J;  4DV4 J;  4DR1 J;  1IBL J;  4YY3 J;  5IT9 U;  1HNW J;  4GKK J;  4LFC J;  4OX9 J;  1FJG J;  1J5E J;  4HHU A;  3D3B J;  5FLX U;  5BR8 J;  4NEY A;  4DV1 J;  4LF8 J;  2KVQ E;  4DV3 J;  4KHP J;  4JI5 J;  4DR4 J;  4DR3 J;  1I94 J;  2MQ8 A;  1N34 J;  2ZM6 J;  4JI6 J;  4LFB J;  2MTL A;  5AJ3 J;  1HNZ J;  1XMO J;  2UXC J;  5LMU J;  4JYA J;  4K0K J;  2UUC J;  4YHH J;  4JI3 J;  4RJV A;  3T1H J;  4X65 J;  4PWW A;  4X62 J;  1N32 J;  3J7A N;  1HR0 J;  5LMN J;  1IBK J;  4DV6 J;  3J81 U;  4JI2 J;  4DV2 J;  2VQE J;  2VQF J;  4LFA J;  2HHH J;  4B3S J;  1N33 J;  4B3T J;  4JV5 J;  4LF6 J;  5IWA J;  3OTO J;  4JI1 J;  4DV5 J;  4KY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...