3QIPB

Structure of hiv-1 reverse transcriptase in complex with an rnase h inhibitor and nevirapine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
425
structure length
402
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
molecule keywords Reverse HIV-1 reverse transcriptase p66
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 115
structure length 402
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qipB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB03
4K4YA 2D7SA 1HMVA 3H5UA 1UWBA 4RNOA 2W7OA 4ZMMA 4O3PA 4EYHB 1S9EA 3DRRA 4NRTA 5D3GA 1Z4UA 1BQMA 4ID5B 5C42B 4PUOA 2V0NA 1RT5B 4G1QA 5DGBA 5L1LA 3QYYA 2VG6A 3KLHA 2RKIA 2HNYA 4NLDA 2XGQA 5KFNA 3NAIA 4G3IA 3GV7B 5L9XA 3LP0B 4ZP9A 4TN2A 3GIIA 2YKMA 2FVQA 4ZVGA 3EPGA 3T5LA 2B43A 3DOLA 1C0UA 3BGRB 3KLFB 3LALA 5CYMB 4ED7A 5KG4A 5KFOA 3E51A 1XR6A 2XGPA 2ZE2B 5K14A 3NKYA 5EUHA 2ILYA 5KT2A 1RT1A 1IM4A 3EZUA 3H2LA 4WYWA 3Q8PB 1RT4B 3M9MB 2CJQA 3H5YA 4ECQA 2VG5B 2WK4A 4MIBA 4HKQA 1DTTA 1QE1B 1KHWA 3DMJB 5CYQB 2E9RX 2RF2B 1OS5A 1EP4A 2YNGB 5DQGA 1JKHA 4LQ9A 4ECVA 2WB4A 1EETB 4WXOA 4NCGB 1DTQA 1HYSA 3C6TA 3T5HA 4NLTA 1S97A 4NLYA 2YNIA 4KV8B 1VRUA 4ECTA 3V6JA 4RW9A 1HQUB 4DG1B 4ZP6A 5KFAA 2W9CB 3PW5A 4M94A 2YNHA 5KFQA 4OL8A 1XR5A 5F8HA 4J9OA 4B3OB 3MTKA 3KHRA 2GIRA 1HNVA 2J6SA 2R2TA 2WONB 1J5OB 3V6HA 2OPQB 4DL4A 2C2EA 1IKWA 3ITHB 3RB0A 3QIDA 2OPRB 4FS1A 4IDKA 3KNAA 3QO9B 4H4MB 2JLEA 1HPZB 4LSNA 4J9LA 4HYKA 2AGPA 5KFHA 4X2BA 5C25B 3E01B 3H40A 3DLEA 5J2NA 3CJ2A 1SH2A 3MR2A 2BANB 1VRTB 4QWEA 1SH3A 3HVTA 4IQXA 5KFEA 2R8KA 3KJVA 2UVWA 3DLKB 4YR3A 4FS2A 5KFWA 4R8UB 5HBMA 1S6QB 3BSAA 3IS9B 4ZHRA 2IA6A 5FDLA 2BE2B 4TY9A 4DEZA 4WFZA 5F8LA 1S1VB 3KLVA 4EBCA 1SV5A 1FK9A 1N5YA 4WZQA 4MH8A 5J2PB 3MFIA 1RT3B 4RW8B 4PWDA 3ISND 1YVFA 5KG1A 1FKOB 1GX6A 4R0EA 3KK2A 1JLAA 1T05A 3MEEB 3QLHA 4KFBA 4MK9A 1RTIB 3TQ1A 1SUQB 4ZVHA 3UPFA 2FVRA 3LANA 3PHEA 4IKAA 4Y2CA 3KHGA 4O3RA 3GILA 2C22A 4K4UA 2ASDA 1S9GB 3T1AA 4WZMA 2FVPA 2JEIA 1JLBA 4RUAA 4NLRA 3UQSA 4RNFA 3M9OB 3TVKA 2OH2A 4NLUA 3GIJA 4I2PA 4FBUA 2D3UA 4ECXA 1TKTB 3BR9A 2IM0A 4NZ0A 1REVB 2FVSA 1QUVA 1RA7A 5F9LA 4ED8A 3RBDA 4Y34A 2ASLA 5KFLA 2ZD1A 1LWCA 2FJVA 1TL1B 2IC3A 4U6PA 4RW4A 4XPEA 3DRSB 3PR4A 1S4FA 3SFGA 1TKXA 1IKXB 2RDIA 3NL0A 4Y3CA 3V81A 4YMEA 2FJXA 3PVXA 3H98A 4ZVEA 2FLPA 3QZ7A 5DGAA 3RAXA 4QWBA 3OLBA 5C42A 3KLEA 1S49A 5KFFA 5DLFA 1JLFA 3C6UA 1S6PB 1BQNA 1TVRB 3CVKA 5KG5A 1S0MA 3IN5A 2HMIB 3GYNA 4J9KA 1KLMA 3V4IA 4O3SA 1RAJA 5J2MB 3I0RA 3D5MA 3KLFA 3QIPB 4ECZA 5CYMA 4URGA 3MR5A 2HWHA 2ZE2A 1DLOA 2R2UA 4PQUB 1IKVB 5KFBA 3JSMB 4ZPBA 1RT4A 4ZPDA 2YKNB 2HNDB 3M8PB 2HNZA 3N6LA 4RW6A 4Q0BA 1RA6A 4URSA 5KFPA 5C24B 4H4OA 3KK1A 4WXWA 3DOKB 1RTDA 5CYQA 2YNGA 3MEGA 2OPSB 5HLFA 2W9BB 2I5JA 5EWGA 3KK3B 1LW2B 4NCGA 4RNMA 1RTHA 2IM3A 3DRPB 4ED1A 3MECA 4O44A 2ILZA 3CDEA 4KV8A 2ATLA 3OSNA 4I2QB 3PR5B 4NYZA 1HQUA 4DG1A 5JUMA 4IG0B 1KHVA 2W9CA 4Q45A 4J9QA 1C1CA 2EC0A 1ZTWA 4R5PB 1HQEB 1TL3B 4IR1A 1FKPB 1RT6B 1S1XA 1N6QB 1JLEB 3NBPB 5F8IA 2WONA 4RW7B 5DQIA 3I5BA 1RTJA 4IFYB 3ITHA 2GIQA 1TKZB 3MR3A 2R8HA 5J1EA 3BQ2A 1QAJA 4KKOB 1HPZA 4ZP7A 4LSLA 3JYTB 3N6MA 5HP1B 5KT3A 5C25A 3SFUA 4TY8B 4J9SA 2XWYA 2B6AB 3DLGB 1S1WB 2YNFB 1K1QA 1RDRA 1IKYB 4M95A 4IFVB 1N4LA 3NAHA 2JEGA 4MFBB 5KG3A 3V6KA 2WOMB 1MU2B 1JLQA 3HHKA 3IGVA 3FSIA 4R8UA 2UUWA 5EDWA 1S6QA 1ZETA 1HMVB 1S10A 1UWBB 2BE2A 3G86A 4WFXA 3V6DA 3FFIA 1S1VA 2BRKA 4ECWA 2VA3A 1S9EB 1T03A 4Q8EA 3DRRB 3PJWA 4MIAA 3IG1B 1BQMB 4F4YA 1RT3A 1LW0A 2B5JA 2AQ4A 3KLGA 4F4ZA 4NRUA 1FKOA 2VG6B 3LAMA 4DL7A 2RKIB 4EEYA 2HNYB 3D28A 3M8QB 2W8LA 5J2QA 4KO0B 4MKBA 2C2RA 3UDLA 3RBEA 3CJ5A 1TV6B 1HNIA 4O4GA 3CIZA 4TQSA 3H4DA 1C0UB 5I42A 1N48A 5KFVA 2F8EX 3IRXA 3CWJA 4F4WA 4IH7A 5K14B 4RZRA 4GC6A 3DDKA 4IH6A 4ED2A 1JX4A 1JXLA 4ZVFA 3MF5A 4ZPCA 1TKTA 1ZTTA 3H5SA 2HWIA 4ICLA 4XPCA 4O3OA 3KMSA 1S1UB 1C2PA 4ECSA 4TQRA 1EP4B 3H4BA 4ECRA 1JKHB 1IKXA 4IG3A 1C0TA 2VG7B 3TAMA 1NHUA 3MEDB 5KG6A 5KT7A 2IAJA 4EO8A 4DL2A 3PW0A 1DTQB 1HYSB 3H5XA 4KE5A 2YNIB 3ISNC 1VRUB 5EWFA 4Q44A 4RNHA 3G6VA 1JLCA 4RW9B 4KB7A 3MFHA 1S6PA 3I0SA 4I7FA 3DM2A 2GC8A 2V4QA 2J6TA 1JLGA 4GC7A 4EBDA 2YNHB 2QE5A 5I3UA 3PW2A 5J2MA 3LP2A 4K4ZA 5F9NA 5KFRA 4NLOA 2FVCA 5KG2A 1NHVA 5KFXA 4QWDA 1HARA 3GV8B 3KOAA 4RUCA 2ASJA 2R8JA 3OHBA 2OPPA 1R0AA 1W25A 3FRZA 1RT2A 4LSNB 3LAKA 3OL8A 5HROB 4NLXA 3DLEB 1S1TB 5J2NB 2YKNA 2HNDA 2XI3A 3Q8SB 1MMLA 2C2DA 3LP1B 4YR0A 4ZPAA 5KFDA 3DYAB 4ECYA 1RT7B 3KJVB 3GV5B 1S0OA 4K4SA 1RYRA 5EWEA 4ID5A 5F8GA 1N56A 1RT5A 5KFGA 2BRLA 5HBMB 4NLSA 5L1JA 4ZHRB 5FDLB 5F8NA 3KK3A 3CDWA 1D0EA 1SV5B 2R8IA 3LP0A 3BQ1A 3I5CA 3DRPA 5KFZA 2J6UA 2V9WA 1NNDA 3BGRA 4PWDB 2IJFA 4TLRA 3T5KA 3GIMA 4NLVA 3T5JA 3RB6A 3KK2B 4IR9A 1JLAB 1T05B 3QLHB 4KFBB 2JEJA 4LQ3A 4IRCA 2FJWA 2D41A 4KHMA 4J9RA 3KLIB 4IRKA 1RT6A 1N6QA 4NLWA 2FLLA 4RW7A 3PJXA 2VG5A 2R8GA 3QGHA 1QE1A 3OSPA 1S48A 3DMJA 3BSCA 1JLBB 3HVWA 2RF2A 3EPIA 4KKOA 3FQKA 5HP1A 4NLQA 1EETA 4IRDA 1IKYA 1JIHA 3RB4A 2UVUA 2WHOA 3DI6B 2E9TA 1LWCB 2AX1A 2XI2A 2IC3B 5KFJA 5KG7A 3QGIA 4QW9A 2AU0A 1TKXB 5KFCA 2XC9A 3PW4A 2W7PA 3KMQA 2AX0A 3BREA 3CJ4A 3V81B 5DLGA 2W8KA 2UUTA 2QV6A 2HAIA 5KFTA 4B3OA 3IG1A 4EO6A 1LWFB 4Y2AA 2ALZA 1J5OA 3KLEB 2OPQA 1QAIA 4NLGA 1C1BB 4DL6A 2OPRA 1JLFB 3C6UB 1CSJA 1LWEB 1BQNB 2DPJA 3M8QA 3QO9A 4H4MA 4WE1B 2IM2A 2JEFA 3I5AA 4KO0A 4H54A 1KLMB 3V4IB 4YR2A 3E01A 3NGDA 2UVVA 3T19A 4EBEA 4NLPA 1TV6A 2BANA 1VRTA 2IM1A 4JV2A 3I0RB 3QZ8A 5F8MA 4TYAA 3KHLA 3DLKA 4U7CA 2UVRA 1DLOB 3IS9A 2BQUA 1RYSA 2AWZA 3M9NB 2DPIA 2XCPA 2I1RA 2HNZB 4MK7A 4RW6B 4Q0BB 2V4RA 4H4OB 3KK1B 5D3GB 3CJ0A 4FBTA 5J2PA 1D1UA 1RTDB 4RW8A 4PUOB 3H59A 1S1UA 4G1QB 4IOBA 4TXSA 3MEGB 3KLHB 5HLFB 2JC1A 2I5JB 2VG7A 5KT4A 3MEEA 3MEDA 1RTIA 2JC0A 1SUQA 5KFYA 2BQRA 3CJ3A 1RTHB 2FLNA 4JV1A 2YKMB 5KFIA 2VA2A 3MECB 4O44B 1S9GA 3DOLB 4QPXA 1TQLA 4K4WA 2BQ3A 3KHHA 2E9ZA 4YQWA 1C1CB 5DG8A 3QGGA 4F50A 2RDJA 1RT1B 1T94A 2AGQA 5C5JA 3BJYA 4K4TA 4O4RA 1S1XB 4ED6A 3Q8RB 1REVA 5KFMA 1RTJB 3RB3A 1DTTB 4ECUA 2IMWP 5J1EB 1TL1A 4ED0A 3G6YA 3DRSA 4F4XA 4K4VA 4LSLB 5JXSA 4QWAA 5HROA 1S1TA 1S0NA 4QW8A 2WTFA 3LP1A 3C6TB 2D3ZA 3DYAA 3FDSA 4KSEB 1WNEA 1RT7A 1JLQB 2IBKA 2C28A 3OL6A 3Q8QB 1XR7A 1TVRA 3BQ0A 3V6DB 3FFIB 2HMIA 5L1IA 5KFUA 1T03B 2WCXA 5L1KA 1HNVB 4JUZA 1LW0B 2B5JB 2XCAA 4RU9A 3QIPA 3KLGB 3RAQA 1IKWB 5KFKA 2IJNA 4IDKB 1SH0A 3UR0A 2O5DA 5KG0A 4PQUA 5J2QB 4ZP8A 1IKVA 3JSMA 3PZPA 1I6JA 3KLIA 3CDUA 3M8PA 1HNIB 4O4GB 3CO9A 4XO0A 3HVTB 3HKWA 3ICLA 5I42B 4J9MA 4DL5A 4MK8A 5C24A 4TYBA 2WRMA 3DOKA 3OLAA 3BSOA 3IRXB 4JV0A 5KT5A 3GIKA 3VQSA 4QWCA 2ZKUA 1U09A 2OPSA 2W9BA 4EYIB 4IH5A 1S9FA 5DG9A 1LW2A 1FK9B 1N5YB 3G6XA 4WFYA 4ICLB 4K4XA 1T3NA 3DI6A 4I2QA 2CKWA 3OHAA 3NMAA 4IG0A 5KT6A 3HVAA 3OL9A 4IG3B 4ED3A 4MKAA 2AGOA 3MR6A 4KHRA 1C0TB 4R5PA 3TAMB 4RNNA 1HQEA 1TL3A 2IAJB 4YP3A 4KAIA 2R2RA 1FKPA 4WYLA 4J9PA 3NBPA 1JLEA 1LWFA 5T14A 5DQHA 3PW7A 2BR0A 2R2SA 4K50A 1JLCB 4IFYA 1C1BA 1K1SA 3FQLA 1TKZA 3SI8A 3I0SB 1LWEA 4I7FB 3DM2B 4Q8FA 4Q43A 1JLGB 4WE1A 4URQU 4DL3A 3JYTA 4I2PB 5I3UB 4KBIA 4O3QA 4TY8A 4O3NA 2W9AA 5DG7A 2B6AA 3DLGA 3LP2B 3OL7A 1S1WA 2YNFA 3N6NA 5F8JA 4IFVA 3BSNA 4MFBA 1TP7A 3IGNA 1GX5A 2WOMA 1MU2A 3GQCA 5KFSA 2ZD1B 2OPPB 1R0AB 1RT2B 4RW4B 4J9NA
chains in the Genus database with same CATH superfamily
1ZA1B 3IBCB 2VG6A 4CI0B 4FXVA 2DIVA 3ZO7A 3DOLA 3N28A 3TX8A 3E51A 2DIUA 2CJQA 1XN9A 2YQ3A 2CUYA 4OZ2A 2M5YA 4FYXB 1T8EA 4NOHA 3VALA 1HQUB 1CC7A 2MEWA 1U1NA 3T1YJ 5L39A 4EU0A 4B3OB 2GIRA 4ELVA 2RS8A 3V6HA 3KNAA 4I1TA 5IV4A 2R7TA 5J2NA 2LEBA 2BANB 4A8XA 3TVYA 4UW2A 1K9MT 1NHKL 4KTQA 3KLVA 5HQMA 2MQ8A 5KG1A 1MWZA 5AXMA 3B4DA 3MZIA 4CLKA 4NYPA 3UW1A 4K4UA 1JLBA 3TVKA 4ZJLA 2NYIA 2Y1IA 3CCJS 3C66A 1TL5A 1TL1B 3P96A 2R9LA 3BS9A 4UY85 2ROEA 2DNOA 4RPFA 2QLFB 3H25A 2HHPA 1D09B 2MKKA 2F8HA 2JJ4D 2BYCA 2BBEA 2GVZA 3I0RA 1HBUA 5CYMA 2ZE2A 2F65A 2HNZA 4Q0BA 2ZBIA 3C16B 3H0PA 1M5HA 1NK7A 5FD1A 2WVFA 5G4DA 2GJIA 2XMMA 3G9CA 5A2QU 2LECA 4LBIA 1X4EA 3AAWB 2WONA 1PKUA 2XULA 1EQ0A 3FBBA 5A0YB 3SFUA 3R3TA 3DGVA 4U9RA 2EI5A 1RDRA 4M95A 1VISA 2DNZA 5KG3A 3MOJB 1QD1A 1MU2B 2BABA 4X65F 5EDWA 1UL3A 1S9EB 2GMHA 3ZFVA 3T1YF 2XMAA 1PYTA 2VFSA 4W98A 3NLCA 1KVJA 4BLGA 1KONA 3M8SA 3PFEA 1WF0A 5B0FA 4NZ7A 3IRXA 3DDKA 1U0HA 2DRDA 3OBIA 3R7NB 1GQEA 4XPCA 1NJIT 1OQ3A 3NNAA 2I8EA 3TAMA 5KG6A 3HULA 1RP5A 3TX0A 5H9EJ 3ADAC 4KB7A 3HSGA 3W62A 1OY9A 2QE5A 5F9NA 3CD6S 3OJSA 3BKFA 3CCUS 1NRKA 2M8HA 3D6MB 4K4SA 4ZKAA 5FDLB 1SBRA 5FLXU 3I5CA 5KFZA 1U0SA 4TLRA 2DO0A 2LXFA 3KK2B 4IR9A 1W26A 1PJ6A 3CDBA 3PO4A 3EX7B 4ZN3A 2RF2A 4WFNQ 4NX9A 3W1YC 3D4JA 2VQFJ 2UVUA 4QW9A 4C48A 3J7A1 1Y5NB 3CJ4A 2XEXA 4MYUA 1U1OA 1G2EA 4BCAA 1QAIA 4KO0A 1T9WA 3DGPB 2P9EA 3OVSA 3J7ZT 4U7CA 4ID8A 1V3RA 1FF2A 3HXMA 1UEKA 1KC8T 5JVGQ 5D3GB 5B08A 5ETTA 4U7UK 3DOMB 4DR2J 1UVIA 4TNOA 1V5VA 1KNZA 2RT3A 1ROFA 2R7WA 4JI8F 4A4JA 2IY5B 3GP9A 3EVWA 4WTYA 3GSIA 4MTPA 1IR0A 3S01A 1DTTB 1P1LA 3G6YA 4LJMA 4R0JA 4QWAA 1HFEL 1S1TA 1WELA 2IBKA 3AB2B 1NSKL 3B6BA 2EFQA 3QIPA 4RU9A 2AYGA 2E44A 2ATCB 1U6FA 3PNIA 3TAPA 5D6GA 1HNIB 4DL5A 2AW0A 4ED5A 2IJRA 2YPYA 4KPYA 5GMDA 1CJKB 5A8KB 1TUGB 2ZNZA 1X4BA 3D1HA 1KWMA 4DFMA 3H20A 1FJEB 4KHRA 1C0TB 3AXKA 4CYUA 2IAJB 3M4XA 4NPOA 1SC4B 4OI0A 3NBPA 2E5GA 3S8SA 1I5OB 3K8WA 3KJFB 4IFYA 5HJYA 4Z7YA 5I3UB 1WG5A 2B6AA 3OL7A 2YNFA 4IFVA 3IGNA 2VQFF 2ZD1B 3CCTA 2W7OA 4C11B 2CPDA 3QFWA 4B9NA 4JV5J 4B9UA 3EDQB 4P71A 4JI6J 2EFVA 3CC2S 3QYYA 1S7HA 3KKFA 4OLOA 3DU6A 2YKMA 2B43A 1RKIA 3NKYA 2YKOA 2DEIA 4A8MP 3H2LA 2YWEA 3WHIA 2VG5B 3AH6A 1JKHA 4UF4A 4DR2F 3ENWA 4PWWA 4A8QA 5EX0A 1CQNA 2ZFHA 4DR6J 4OHXA 4OJ1A 1RWVB 4KGXB 2OFGX 1RWNB 2HQGA 4BS2A 3ZNJ1 5C7PA 4Q2MA 2BV3A 1Q7YT 1BY9A 4UY8T 1X5PA 3EGZA 1YBTA 3HVTA 2DNPA 4KRWA 2BDPA 2HZVA 3KG1A 1TMJA 2IHR1 2RHSB 3MFIA 1RT3B 3BGOP 4GO7X 4JI5J 1SKWA 1SUQB 3LANA 2HGLA 3GILA 3EYZA 4FVMA 3T1AA 4X4PA 5KTQA 1DY3A 2UZAA 4KGZB 5LJ5Y 3TUZC 3SCIE 3DRSB 4O0IA 1JK9B 5CABA 2GMLA 4L76A 1OYEA 2HG4A 5C42A 1OPIA 2KDOA 3QQCD 5A8WB 3IN5A 2RUGA 4BWMA 4ECZA 1YZ6A 2CJ9A 3GE9A 3C19A 3CD0A 1I51B 1RA6A 4JV5F 4JI6F 5HLFA 4X84A 2OAUA 2UUCJ 4KV8A 1RWPB 4KT0C 2GGPB 2EKNA 1FKPB 7FD1A 1ZYQA 1HHQA 4GKJJ 5GAHU 3MR3A 3VWSA 5C25A 1I1GA 4UUXA 1K1QA 1IKYB 2FHOB 2BKPA 1WD6A 3LO3A 4R8UA 1ZETA 1IM6A 2BE2A 3MOZA 4DR6F 3J7YU 3RW7A 3M2UA 1LW0A 2B5JA 4CT8A 3SSRA 2R3VA 5KFVA 4NMXA 2DVIA 1FVSA 2IVMA 4ZVFA 5BR8J 3VF0B 2RILA 4ICLA 4MYTA 3QT6A 1CJTA 4G1IA 4JI5F 5LMUJ 4K5SA 1U47A 1XTZA 4X4SA 2I38A 5KFXA 4LF8J 4LSNB 1VLOA 3QAEA 4B9LA 1CLFA 1RBLA 1MMLA 1Y0HA 3KJVB 4LRBA 1RYRA 2KKHA 3SSSA 7FDRA 3R5CA 4PG8A 2E1PA 4DFKA 3UE2A 1JLAB 1JJ4A 2JEJA 4DPUA 3FCHA 1H72C 2G4BA 5CCMA 3BGFA 2HQCA 2QLJB 1Q0NA 3M30B 1NK0A 2UUCF 1S99A 2AX1A 2DO4A 3ILIA 1M1GA 2JOQA 1CJUB 2DNLA 4DPTA 1J5OA 3CC4S 1AUDA 4ERDA 3QO9A 4H4MA 2F9JA 4DS4A 1YBUA 4UQGA 2HIQA 3M2RB 2QMWA 3PXGa 2BQUA 1H74A 3I9ZA 5G0RA 3EXYA 5J2PA 1FWLA 1XWLA 2DB1A 4TXSA 5AXNA 3QJJA 4DR3J 1KS2A 1TFWA 1RWMB 2CWXA 2VQEF 2E9ZA 3M2VA 2AGQA 1VBYA 1S1XB 4ED6A 1VQOS 4ANEA 1RBOB 5J1EB 4EK2A 1UW4A 3T41A 2OTLS 2JDJA 1EKRA 5HMYA 1Y5LB 2W25A 2CFXA 4MJKA 4X4NA 1IKWB 3O44A 5KFKA 1FDAA 1X4HA 4LF8F 1TZ0A 2MQMA 2Z57B 1N34F 3CO9A 4XO0A 1Q79A 1QAYA 2GQCA 3DI6A 4HT7A 4IG0A 2H4WB 3BPSP 4HHHA 1JXEA 6FDRA 1Q86T 3W64A 2I2YA 1K1SA 3JYTA 1NMEB 5DG7A 1Q53A 4QJVA 3L09A 4YUDA 4K4YA 2DRAA 2XB2D 4O3PA 3R5AA 2MKIA 2CQHA 1Z4UA 1RT5B 2VB6A 1MSWD 4DV1J 3M6UA 2IRUA 2V2ZA 1RCXB 4Y2MA 1FNOA 1B7FA 2LP4A 3ONQA 3TUPA 2MLYA 5KFOA 4LR7A 1ZPWX 4M5IA 3MCSA 1OS5A 2B56A 1UFWA 2H1YA 2R4FA 3OTOJ 3O6QA 4DR3F 4RW9A 1QM9A 4JI1J 1ZAWA 4DLEA 2VHGA 3I6PA 1PAEX 2JLEA 3D54A 2CJAA 3MR2A 2N4CA 4A8WA 4OX9J 5THWA 4K5RA 1JWWA 3MUVP 3OV7A 3P8BB 2WVCA 3RRKA 3UPFA 3ET6A 1CS4A 1MN9A 2GQQA 2IDLA 4XDDA 2OH2A 4KH1B 2D3UA 1ZS6A 3VVTA 3AQPA 2LXUA 1QDUB 4LF4J 4MAKA 2IC3A 1IKXB 2RDIA 4F25A 2DHHA 4KPCA 2HFZA 3NY0A 4F3OA 2COLA 2M4MA 3GJTB 3GYNA 3D5MA 3FCVA 4C3MA 3MR5A 1ITPA 2XC9A 1RT4A 2QA4G 3N6LA 3PY8A 2H5EA 5CYQA 3OUYA 2ZZMA 2MLXA 2I5JA 2E5LJ 3PG9A 4DV1F 4RNMA 2K06A 2Y0SD 4OI2A 2ROPA 4R5PB 1SJ4P 1FEHA 3I31A 1RTJA 2R8HA 2GZOA 3JAMU 4JP8A 4ZP7A 1HNZJ 4LSLA 5KT3A 2R7UA 3BKTA 3UR3C 3W2VA 3OTOF 4MFBB 4WFXA 3V6DA 4JI1F 1Y3JA 2XMUA 3PTWA 3W5ZA 2VU5A 3KJQB 4I68A 1I94F 3ZZPA 2FJAB 4K2JA 3H5SA 2KT3A 3KMSA 1WWHA 1F9EB 5CH7B 4DJBA 5ETQA 4DL2A 1WJ9A 1LFPA 5D0RA 2E7WA 2JVRA 4ILLA 2IMOA 2UUAF 3UWTA 5IWAJ 1T95A 2V67A 4K4ZA 2FHJA 4FF1A 1RT2A 4LF4F 1M5KC 3OL8A 1R31A 5EHHA 2HNDA 3IAM9 1K0TA 2OKQA 2HGMA 1UP1A 4N77A 5LOQA 1XEZA 5IC6B 1NO8A 1NNDA 3GIMA 3VGSA 4OZJA 3IAS9 1FESA 3OSPA 4FZVA 1B64A 2E5LF 3M6XA 4Y2IA 1HBMA 3O3LA 2R7RA 4B3OA 3NMRA 3RAMA 4DDFA 3PDNA 3CPWR 3CCZA 2BANA 4HL9A 1OSDA 4JI0F 4K0KJ 2FTRA 1JNZB 1V9OA 2LDIA 4H4OB 3KK1B 3CJ0A 3H59A 4RU2A 1TAUA 1LQ9A 3MMAB 4ZVPB 3CJ3A 4JV1A 3QGGA 1BD6A 3W65A 3R5GA 1FE4A 2C2NA 1TL1A 1P9YA 4CO0A 3C6TB 2HS3A 1SIZA 1CJVB 4ZN1A 4CT9A 5IWAF 4OZ0A 1GK8A 2XCAA 1RE1B 4IDKB 5KG0A 2KG0A 3KTQA 4OZLA 3C16A 5GMKa 3RZAA 1FK9B 1BMQB 1DJ0A 1MLAA 4P2MA 4P2XA 3OL9A 3AFGA 3PW7A 1UA1A 4I7FB 2PEHA 4Q43A 3LA0A 1FJGJ 4NMLA 2EFOA 4Z2XA 3BSNA 1TP7A 1MU2A 2GV1A 3KNGA 2ZH9A 4RUBA 5IT4A 2RB7A 3EXCX 3EGVA 1S9EA 4DSEA 4PUOA 4ZPVR 4GMKA 3KLHA 3TO8A 3GV7B 2DJWA 3T5LA 4RBTA 3LALA 3QT7A 1N36J 1RT1A 3EZUA 1WTFA 3M9MB 4QIEA 4HKQA 5D4NA 4YN3B 1PILA 3HLUA 3CT9A 1DQAA 4NCGB 1HNXJ 1U25A 4NLYA 1MW7A 4DG1B 2W9CB 1U26A 4M94A 2M7SA 4OL8A 5CXTA 2OEMA 4J9OA 1R7IA 3MDFA 1NJYA 1MWQA 2DNNA 5DDOC 4NE9C 5H9FJ 5GVQA 5FDLA 4LR8A 3ZTQA 1FE0A 1YZ7A 1FVQA 3KK2A 6AT1B 3KHGA 1WDTA 1GEHA 3CMQA 3K5PA 1S76D 4FBUA 3LQVA 4ECXA 1XK8A 1XNRJ 4DSJA 2GAGC 2QL7B 2PEBA 2DGTA 3QZ7A 3RAXA 4YB1P 2H5IB 2AP6A 4F26A 3PX4A 4EFAC 4O3SA 1T9TA 5DM7Q 5J2MB 1FJGF 1AB8A 1VJQA 2GQ2A 2QG9B 3MM6B 1VIOA 2R2UA 2H5JB 2YKNB 3JQMA 4P6QA 3GPAA 1X9SA 3EVMA 3HHLC 3KK3B 1PBUA 3TZXA 1FKAF 1Y3KA 4ZDNA 1RABB 1N36F 1JLEB 2GIQA 2R7VA 3CCLS 2Q1LA 4LBHA 4J9SA 2XWYA 2AT1B 2C2OB 2LYVA 2VA3A 2BRKA 1KOHA 4Q8EA 1FNXH 4OV6A 4KJIA 5U47A 4MKBA 2ZZNA 1HNIA 2ZBPA 1JXLA 3IBFB 3MWBA 3OXFA 5A8KA 4O3OA 2G2OA 1M1KT 3IFEA 1C0TA 2IAJA 3U7JA 3BGUA 3MCOA 2YNHB 3DXBA 5I3UA 1F5AA 3IBWA 3AHPA 1XNRF 1W25A 3G2XA 4C8OA 1D8YA 5GAGI 3V5RA 4X4QA 3I87A 3T9NA 4USTA 1QAXA 3CJQA 3NCRA 3J80U 3RB6A 2RAQA 1X8DA 5DZ6A 1AFJA 1SKUB 1RT6A 1HBOB 2G2YA 2VG5A 1RAEB 1HW9A 5HP1A 3HJFA 4NLQA 3HO1A 4IRDA 2WHOA 2LVWA 4CCHA 2FZCB 2UXCJ 2QX0A 3FCWA 3AD8C 2DPJA 1BQNB 4N47A 3QJPA 4Y6IA 3QZ8A 2BEFA 2ZH8A 5LXRA 2UVRA 3Q22A 2AWZA 2GMJA 2V4RA 2AHOB 4EZ9A 3CD5A 2RS2A 1RTDB 2OIHA 1HWJA 1HA1A 1SUQA 2MQOA 4C6AA 1GNKA 4O44B 4WP3A 2W2OP 4I0WA 4DPOA 2V50A 1PJ7A 2KRBA 4DF8A 5CAAA 1ACMB 5CZXA 3KYLA 1O51A 2IMWP 3DRSA 2K8GA 5HROA 4B9SA 2RQMA 3AQOA 2PT0A 1ZM2A 3TZYA 4YOEA 2YX4A 1ZZNA 4TLQA 4X66J 5A8WA 2RRNA 1LOUA 5B0BA 1JB0C 1VHIA 5I42B 1N88A 4TYBA 3T9ZA 4DQRA 2MZRA 1M0SA 4W90B 4DV4J 2RIJA 3W2WA 3F0NA 2GGPA 4PEOA 4OQJA 4J9PA 1FKPA 3FSYA 1LWFA 2GA7A 2NSCA 2J7UA 3OT9A 4DL3A 2IVYA 4CNYA 2QL9B 3VCDA 2BE7D 1VQKS 3TOQA 1IXKA 2AZ3A 3OFEA 4DV7J 2KYXA 2UXCF 2MGZA 3AODA 3EDRB 4Y65A 3MM8B 5L1LA 3AOBA 2XGQA 3VAGA 3NAIA 3BO4A 2QC3A 3G8SA 2PMWA 2C1EB 4DX7A 1OY6A 1NJWA 5L8RC 1UAWA 4ECQA 5GADI 2NCKL 1WOSA 2E9RX 3VGUA 4CM2A 2YNGB 1IBCB 3Q8VA 2HPUA 1CPZA 2QIFA 4C0HA 2HHHJ 3WDOA 2ZWPA 2IFXA 1GMUA 2AEFA 3MAAA 2OPQB 2CQ0A 3EUNA 1KN6A 4LSNA 4IQXA 4ZLJA 3KJVA 4ZCLA 4USKA 5H9EK 4TY9A 4X66F 1NSQA 3IA0A 1S1VB 4EBCA 1N32J 2Q6CA 3OFHA 2R7SA 5D0HA 3D2WA 1JLAA 3MEEB 4M5JA 1G4CA 3HFZB 1PSDA 2C22A 1IQTA 1KFDA 4ZCIA 2D69A 2DT9A 1Z2LA 1SKSA 3WBZA 4C97A 3M30A 4ITSA 3MPDA 1N0VC 4DV4F 4WJBA 4PAAA 5JVHQ 4L73A 1CJUA 2FJXA 1DARA 1ZAVA 3TZZA 5AXLA 1KVKA 5KFFA 4HEA9 1X5SA 4DWIA 1FWKA 1RAJA 2B4PA 3M2RA 1FTRA 3AA9A 1UMJA 4ETZA 4DV7F 5AE2A 4J37A 2DRBA 2DGOA 1DAXA 2HYIB 1J2VA 3D7SB 4DFPA 2O66A 1SQEA 2RRAA 1NDCA 2ATLA 3OTCA 3F56A 1S12A 2E1RA 4P7VA 2D1CA 1S1XA 1N6QB 1YJ9S 5J1EA 5BYSA 1KOOA 2K1RB 3Q86A 1AROP 4L75A 9ATCB 4WKYA 3HHKA 2HHHF 3G86A 2PA8D 2CPJA 4WTOB 3DRRB 2YX7A 1D8ZA 2VFRA 1YLXA 2W8LA 2ADCA 4HLBA 4O0NA 1TV6B 3CIZA 4C8MA 1T9VA 1JJHA 1SL2A 2F8EX 3R1LA 2EFPA 1TKTA 4DR7J 3TW0A 3NGUA 2NXJA 1N32F 4WK3A 3MEDB 4OI6A 4KE5A 1V3SA 2Q66A 2IYGA 2ZITA 3OR2B 3PKMA 1HI0P 1NPPA 4USHA 4NCBA 3ZTRA 1TK8A 4CDIA 1Q8IA 5HN0A 2ASJA 1BLUA 2XTJP 1MN7A 3LP1B 4QYZJ 1RT7B 2FUG9 2VUGA 1RT5A 5A76A 1U2FA 1SV5B 3IWNC 2VBZA 2NPIA 3KDNA 5L9NA 4B3TJ 5B0EA 2GNKA 2W2NP 4J9RA 5ETKA 1UVJA 4CZCA 2MZ1A 1SJRA 2BJDA 3FQKA 3D68A 1HWLA 3CJKB 2DNQA 3W9IA 1NM2A 3BZQA 5E3AA 5KFCA 1KFSA 4ETXA 1RAAB 3IG1A 5F41A 4E2FB 3SYZA 2V69A 4WE1B 3V4IB 3T19A 3W8GA 4QBUA 2QGFB 1RYSA 3M9NB 3NNHA 1MNEA 5AE3A 1L3VA 2Y8WA 3PHTA 3ZZUA 5KFYA 1MROB 4K8RA 2AYMA 4K4WA 1ZH5A 3CB4A 2XYHB 1KQFB 3Q8RB 4DR7F 3D6FB 4ZJOA 1TAQA 1IJFB 1YBAA 2QSFA 1DURA 2FYXA 3DRXA 2DD8S 2XLIA 2E1MC 2OHDA 1HNWJ 3BQ0A 2FGOA 3AB4B 4JI4J 2XZDB 2ZM6J 2B7CB 4F4AA 2E5JA 4ZP8A 4DQSA 3PZPA 2YXLA 1SKRA 2BJ9A 3ZZOA 3JTOA 1WC5A 2BJ7A 4HR2A 2L3MA 4WFYA 2ABYA 5HJXA 3R5JB 2CKWA 3UDEA 4B3TF 4IR1A 2V8HA 5J1NA 2V4JA 4R5PA 4RNNA 2C3OA 1FFWB 3CMAS 4NI2B 2HS4A 3I0SB 2N7CA 2N3OA 3QT5A 4I2PB 1VS3A 4B3RJ 1R6VA 4MFBA 1SC1B 4DSKA 2CVEA 1R0AB 4RW4B 1UEUA 4EYHB 3CCVS 2OMOA 3QAUA 2NUHA 2K7KA 4G1QA 4USUA 1DFDA 4NLDA 1HL6A 4C8KA 2ZDPA 2LQ5A 4B08A 2BJ8A 3Q8YA 5KG4A 1XR6A 5EUHA 5KT2A 2RJZA 1FCAA 2IYIA 4WWSA 3DHWC 1CVJA 5DQGA 3QSYB 1WHWA 2ZC3A 5IT9U 1Z1ZA 4I6AA 4N56A 4LF7F 4ZP6A 3PW5A 1Q4RA 3P6YC 1LNQA 4OYZA 3KHRA 2ZWOA 3GLJA 2VOPA 4FS1A 5A6WA 2W24A 1NDLA 4QR2A 1BGXT 1HNWF 4LR9A 2IRYA 1S6QB 2RU3A 3ILOA 2BKNA 1B0PA 3HK2A 4JI4F 2JRSA 4DV0J 3HKZD 2ZM6F 2ZVSA 1FKOB 1TR0A 2FVRA 2Z30B 3M8WA 2FVPA 4RUAA 3SCKE 2OD6A 1O5JA 3RBDA 4DV5F 4U6PA 1D9DA 1RGVA 1FRXA 2V68A 2V2KA 1PC5A 4PR6A 4OMFG 4ZVEA 2FLPA 1HBNA 3CJRA 1S49A 2GVDA 2WBMA 4UOGA 2HK3A 5E5NA 4XIUA 3LTOA 1NK8A 2CIMA 3K57A 4B3RF 1YJUA 4CLLA 4DU7A 5KFBA 3JSMB 2EEYA 1VQ5S 4PXDA 3D0HE 4H4OA 3KK1A 1FRMA 2L9DA 3UD5A 1XBWA 1K0VA 1LW2B 2UU9J 3BPDA 4DCOB 3CDEA 2Y9HA 2KT5A 2NXCA 3VTIA 3PYFA 4J9QA 2PI5A 4USVA 5F8IA 5DQIA 5BJRA 3ITHA 4LMZA 5T7LB 1KDNA 3OVBA 3R2CJ 3M7VA 1N5TA 2OUGA 2BKOA 1YRXA 3W5YA 1HMVB 2H3EB 2ZH3A 4QPTA 2BUNA 1Y11A 2H48B 2YKPA 2FZGB 1NEEA 2QL5B 2QEXS 3VAKA 4Z37A 2ZOGA 3UDLA 3RBEA 1T9YA 2Z4PA 1N48A 1EAYC 4B9TA 4IH7A 1JX4A 1MMNA 4Q5VA 1VC6A 4DV0F 4ECSA 4ECRA 3H4BA 2Z2LA 3HHLB 4EO8A 5AT1B 4I7FA 2OSQA 4ILRA 1EARA 2J6TA 2WZ1A 1IN0A 2XS7A 3MMCA 1EZZB 1SI9A 3G82B 1S77D 3HSJA 2AJ1A 3MD1A 3L3CA 3DLEB 1RAFB 3DYAB 4DFJA 1JMTA 5F8GA 2JNJA 2CG8A 4ANDA 1YX2A 2V9WA 2ZOFA 4KFBB 2HBZB 3KLIB 2VFTA 1NZAA 1WEYA 2F4VJ 4PYDA 2VD3A 2BX6A 1WSVA 4DSIA 3VV2B 1RAHB 4NZ6A 3N0VA 3J81Y 3SV4A 2UU9F 4M5DB 4CLZA 3MPVA 2CRLA 2VFUA 2QV6A 4K2XA 2HFOA 1FJ7A 3JQKA 4FF3A 1WHYA 1JLFB 1A0OB 3K2YA 3JSBA 5F8MA 4TYAA 3KHLA 2QJ3A 1SC3B 5ETSA 4U8VA 2YBVA 2B4OA 1G7CB 1VLYA 2Z8QA 2VKZG 1GFWB 1RWWB 3A3OB 1NZ8A 2C3MA 1S6OA 4V1Ak 3MECB 4AL7A 1B4SA 2MQQA 1RQ0A 1N54B 4J7CA 3DN9A 1B7YB 4U95A 3FDSA 2HS0A 2P9GA 1VOMA 3ENAA 1X4FA 4JUZA 4Y0FA 3MM6A 1Y9OA 3UR0A 2QSWA 1IBLJ 3PJ9A 2IA6A 4RJVA 3BO3A 2X51A 1RAGB 5HVGA 2LXIA 1RAIB 1N5YB 3G6XA 1Q8KA 4K4XA 3ZTSA 2M8DB 2EC2A 2W1BA 2GW8A 3UDVA 1RKJA 3CW2C 4WFBQ 3M32B 1NK4A 1JLEA 4PXBA 4D3GA 4KH0B 2F4VF 3G8QA 2JFKA 1JLGB 2XBPA 3VAIA 2O01C 2XS2A 4YB7A 1VQ4S 2CNNB 2A3JA 4NA2A 2FY8A 2D7SA 2G1HA 3A3NB 1HI1A 5JJBA 2G0JA 3HDSA 1H7WA 2HQ3A 4NA3A 4MIWA 3IWXA 3M05A 3Q2TC 1HD0A 1N52B 5ETVA 2X3GA 2NZ4A 3POTB 5E3RA 1U24A 1KTQA 4ZK7M 4X4UA 2YNHA 3X1LB 1XR5A 1U4BA 2ZOMA 3W9HA 2L48A 2ACYA 4HYKA 4F67A 1WG1A 2R8KA 3US5A 5A6PA 4DEZA 2WB1D 1PYOB 1ZPVA 4P2SA 1ELOA 2VJVA 2FB0A 4FKYA 2RQCA 2VZ9A 2KRRA 1IBLF 4U96A 3TA1A 1D3WA 4CLSA 5GAEU 4CLYA 2UV8A 1R43A 3CMES 3NGKA 2OELA 5DDQC 4Y34A 1RACB 4KGMA 3HD2A 2DY9A 1Q78A 1QTNB 4Y28C 2G0IA 5B09A 2EG2A 3BV8A 1S6PB 3DLLQ 1BQNA 3VVUA 3ZZRA 2EK1A 5E3PA 4XDCA 4C0OC 4I69A 5DRKA 3C15B 4ZPBA 4UTGA 3DOKB 1RTDA 5ETOA 1LK5A 1H38A 1LWXA 4DZ6A 2KH9A 1PYSB 4OYWA 4LFCJ 2IM3A 3DRPB 4O44A 1FX4A 3K5OA 4DU8A 1N5QA 4RLEA 3RJMB 4Q45A 1Y5IB 4RW7B 4U8YA 1HPZA 3N6MA 2XZWA 5GAGU 4M5MA 1ZZFA 3AY0A 2YH1A 2KXNB 3AT1B 1YSJA 3IO1A 5K8OA 2MXYA 4B9VA 1C4CA 3PIOQ 3M8QB 1U6ZA 2YWGA 2FHJD 2V5HG 3SQGB 5I42A 2EPIA 1OO0B 4F4WA 5K14B 2HRYA 3SMZA 3MF5A 1YK9A 3N5FA 1SJ1A 3GJRB 1S1UB 4ZVTB 1EP4B 4QCLA 3I9V9 5E41A 2FY1A 1DTQB 3ISNC 1PGZA 3CF5Q 2XMKA 4ZCKA 1X7VA 2C3YA 4QQBA 3PW2A 2HHSA 4NLOA 2VODA 2FVCA 1GMWD 2CYYA 4FVCA 3SXLA 3AOAA 4DUYJ 1XJWB 4ECYA 2NQPA 1S0OA 2EKYA 5HBMB 1FEEA 2KG1A 5F8NA 2QTWA 4OX8A 4KQZA 4NLVA 2CPIA 3U27A 1ICEB 3NCPA 4K7QA 3QT8A 1S48A 7AT1B 5D4PA 4KGKA 4C98A 4LFCF 4IOCQ 1RISA 2JHEA 2J9DA 3BREA 2UXDJ 2G9OA 2BJ1A 4DX6A 3V2UC 2OPQA 4DL6A 1LWEB 1WORA 3FC9A 4YR2A 1HLWA 3U1MA 4NLPA 2M2BA 2BMBA 2EFGA 1P8GA 2A6OA 4QR0A 3H90A 1DLOB 1RU2A 4W92B 1F2HA 2H65B 3O1LA 6FD1A 4FBTA 3PX6A 1D1UA 3ZC4A 1T7PA 2VG7A 3MEEA 5H9FK 1NSAA 1RTHB 5LMNJ 3DOLB 2MZQA 2HZAA 2ZJRQ 4IYQA 4F50A 1T94A 2NXEA 1GH8A 1VRQC 3DXSX 4F4XA 1U1QA 2WSEC 4KGVB 4KSEB 4DQQA 3BBFA 2PMZD 3EGNA 1LK7A 1QSYA 2MHEA 4OYXA 4NEZA 5B7WA 3KLGB 5H1SV 1SJQA 4DUYF 1KTVA 5GADU 1RU1A 4IO1A 1HW8A 1FNMA 4F04B 1FT8A 1G6BA 4UOCA 2L41A 1E6VA 2DNHA 2QYCA 5HATA 2K1RA 2W9AA 3LP2B 2GO9A 3QRQA 1U49A 2HFNA 5HANA 4R0EA 4IKAA 2KO1A 2HBYB 3H5UA 3UN2A 3DRYA 2EVZA 1RWOB 4UT4A 2UXDF 3DRRA 1UZHA 3GG1A 4OYIA 2CPYA 4YEAA 1Q95G 2XYGB 3GIIA 2GVZB 1HBUB 2X7IA 5CYMB 3KDOA 1FHTA 2ZE2B 1IM4A 4L74A 4K59A 4OX7A 2MPUA 2KJVA 1VBZA 2WVBA 2HVIA 5MLCV 8ATCB 4QU7A 2DHGA 3T5HA 1VQ7S 1Q5YA 3M6WA 4ECTA 2J9CA 2Q3PA 1X4CA 2HHUA 3OR2A 5F8HA 4TU9A 1NH7A 1HNVA 4RO0A 2J6SA 2WONB 4DL4A 2QZ8A 1M5SA 2CQ1A 2B4VA 1AA1B 5LSOA 4FS2A 4BC9A 1SV5A 2AJ0A 3Q23A 4ALZA 4RW8B 3GCXP 1ZOTA 2RH3A 1VQYA 4HHUA 4O3RA 1EJ7L 4NLRA 3UQSA 4NCAA 3GIJA 1WSRA 4DSFA 1X9WA 4ED8A 1HWKA 3CJKA 3NS6A 2ASLA 2B8PA 1YIJS 3NRBA 1XQIA 1RWXB 2KM8C 3H98A 5DLFA 1TVRB 2KXHA 1S0MA 3V4IA 2D74B 3NWGA 4GO5X 2FC8A 4PQUB 3KUGA 3BKUA 3MAHA 1EKSA 1JJCB 4URSA 4CO1A 4R25A 2W9BB 2HRUA 4P7TA 2BA9A 3SIPB 1MROA 4FF4A 2X1AA 3Q8UA 2AV5A 1CEZA 3RR7A 4S0MA 1VBKA 2H51B 1U2CA 3BQ2A 4OHYA 1S1WB 2W4DA 1S10A 1FI4A 4NYOA 2OO4A 4DR4J 1PG5B 2B9WA 2K3IA 3LAMA 4KO0B 4CP5A 1MG7A 1F1BB 4B17A 1F3VA 2FGCA 3Q24A 2Z2ZA 2IIHA 4DPWA 4AFFA 1ZM9A 2O3DA 4PKDB 5HVHA 1C2PA 1SQFA 1JJ2R 3NGRA 1NHUA 3GFXA 3N4WA 2QYGA 4NI2A 5EWFA 1VIXA 1D9FA 2W2PP 3I0SA 2V4QA 3RW6A 4IQMA 3C14B 3HT3A 4RUCA 1VFJA 1R0AA 3LPEA 2DNMA 4U67Q 1S1TB 1HD1A 1WC4A 4C9DA 4LFBJ 3VAJA 3GZ7A 1RHJB 4RBUA 4ZHRB 2B9YA 4G65A 4HVZA 4B3SJ 4J91A 2GAHC 4ZLPA 1U8SA 1TL7B 3QNWB 4KKOA 1GTHA 1R0CB 2MQLA 2CQPA 4FYVB 4ZIVA 2MJUA 3OR1B 3ZZZA 1VK8A 3QGIA 3KMQA 2QRRA 4N76A 4Y2AA 4ZVRB 4NLGA 1B0TA 4X4TA 3I5AA 2E7VA 1KD1T 4ZJQA 4F02A 2APOA 2C3UA 4M63A 5IFMA 4CIOA 3WX4A 2YKMB 4P73A 3M6VA 1RI7A 4FNIA 1ZAXA 5CZVA 5L46A 1NK5A 2VC0A 1X0PA 4ED0A 1LEOA 3UCGA 4K4VA 2YQ0A 1RLCL 1SL1A 5BYQA 4QIVA 1URRA 2BZ2A 3Q8QB 5L1KA 3MR7A 3TANA 4DLGA 2HRTA 3JSMA 3HVTB 1AW0A 1HWUA 4LFBF 3BSOA 5JMNA 4QWCA 3W7BA 3BDEA 2LLZA 1LW2A 3J7YI 3LF0A 3AD9C 3DU5A 4Y00A 4B3SF 1FRJA 2C2KB 1FDBA 3SZ2A 2HSEB 1JLCB 1C1BA 5T7LA 4LF5J 2KN4A 2B0GA 3UD4P 5KFSA 2MKSA 1HMVA 4NASA 2MLZA 4ZMMA 3TP2A 3QMQA 3I4PA 5C42B 1H2UX 3PRBA 1AZSA 2AIRB 4TN2A 2FDNA 1W2IA 1VDHA 4L72B 3CC7S 3GFYA 5LT5A 2Y1JA 3P5TL 4CLFA 5CD4H 3WX8A 1X31C 2LA4A 3K5LA 1Q82T 4KV8B 2KFNA 3S7RA 1FRLA 1R8AA 1V6HA 2MDAA 2KFZA 2CNKB 3KUHA 2CQ3A 1QUPA 5C25B 3DLEA 3QWPA 2JFDA 1SH3A 3L9ZA 4R8UB 2BE2B 1NUEA 1NDKA 2RD5C 1HI8A 4C3KA 3NCQA 4MH8A 3M2UB 4OI3A 1GX6A 3WC2A 4KFBA 4Y2CA 5E3QA 3DLHA 4QYZK 2WSCC 5IXUA 1S72S 3KWMA 1REGX 2FVSA 4WK1A 4M5DA 5KFLA 2G2ZA 4XPEA 3HHNB 1S4FA 4FYWB 1V5IB 1UJ6A 4ZVQB 3OLBA 5L38A 2BM1A 1JLFA 3R7BB 4PXCA 1RHKB 4CO2A 3VAHA 3KLFA 3G4SS 3I82A 2OGUA 4LF5F 3GR1A 4URGA 2WW4A 4DS5A 4L6V3 5ETLA 3H42A 1W2BR 2HVDA 4OZNA 3LWLA 2DHSA 4EWTA 4X62J 1N8RT 4OI4A 3IM9A 3MECA 4LVOP 4I2QB 2YWKA 2E1CA 1WEZA 3DKDA 1CQMA 1S0VA 4F4KA 3D3CJ 4PYAA 4GKJF 1TKZB 2JLFA 1YRUA 4LFAJ 3KXDA 4MKYA 3NAHA 3MAQA 3V6KA 5HMZA 2YTCA 5BYRA 4YHHJ 1N5SA 3P5BP 1VC0A 3CSKA 2DGXA 4OYMA 2A1BA 4NRUA 3TR5A 3D28A 2DHAA 4AD6A 1AXQA 3A8EA 5DDPC 3SDEA 1C0UB 4GKKJ 2GFFA 1UVLA 3FJ2A 2GHPA 3RG6A 5BR8F 2H4YB 5G0RB 5FIIA 5HQ8A 3EZOA 3EWGA 3PW0A 5LMUF 3M32A 3HCXA 4Q44A 2KI2A 1JLGA 4DPYA 4GC7A 3M2VB 3QPIA 2B3TB 5ETRA 3AD7C 1BHNA 5T41A 4LRFA 4N41A 2W4PA 4LT6A 1IBKJ 1KBRA 4DR5J 5EWEA 5KFGA 2BRLA 2BW7A 1D0EA 3MMBB 4PWDB 1E6YA 2V6AA 2ZJPQ 2RE1A 2MTLA 1TUWA 4OHWA 5ADZA 4BDPA 5IM0B 5D4OA 4LBPA 1TFYA 3POTA 3EPIA 1NCLA 4WKRA 3UD3P 3QRPA 3RB4A 2XMTA 1SJFA 3DI6B 2Y1RI 5DLGA 4BWJA 2XNQA 4AYBD 3R6LB 2VASA 4EO6A 3FBCA 2PD1A 3KLEB 4CO5A 2QA1A 2XMJA 3UVJA 2KZZA 4JI3J 2XZTB 4YHHF 4RW6B 3IRWP 3F73A 2CJXB 2WAQD 3L7UA 1HHTP 2X1GA 3HT0A 4ELUA 2PA3A 5HQLA 4GKKF 3HD1A 1FXDA 1EX8A 4K4TA 2CXEA 2AJ4A 4F0MA 2P5VA 5LSLA 2DH9A 4JBCA 3PX0A 2FD2A 4OYBA 4WP9A 2C28A 3MHYA 1FDDA 3GFZA 3FBEA 5L1IA 5KFUA 1T03B 2YY3A 1R0BG 2QMXA 2ZH2A 4WCEQ 5J2QB 2A10A 1I6JA 3C15A 1IBKF 3DOKA 2PDAA 3OTBA 1L3SA 4YDDB 1OQ6A 2QLWA 3NMAA 5KT6A 3OTDA 4ED3A 3MR6A 3SV3A 4USJC 2R2RA 4WYLA 3RU0A 3EVOA 4J9VA 4K50A 4CO3A 3MCNA 1GT8A 5FJ4A 5K5MA 1XMQJ 2YVSA 3CDAA 3FGVA 1WI8A 1ULRA 3GQCA 2OPPB 1A9NB 1M5OC 2ZHBA 1R89A 4NRTA 5IV3A 5DGBA 3HVRA 1RADB 1O6XA 2V2VA 5KFNA 4UZCA 4ZVGA 4DUZJ 5M2RA 1LXJA 2XGPA 2CQIA 1VK3A 5K14A 4D3HA 1RT4B 4JI3F 5HO4A 2A6MA 2CZVC 5CYQB 1FERA 1FFSB 1EP4A 3GTYX 3OUYB 4USIA 1RHRB 1DTQA 4M5LA 4ZS6A 2ZBCA 2AJ2A 1FRKA 2R2TA 1PO6A 1SVDA 2VL1A 1KSPA 1X4DA 2AGPA 1YG0A 2A18A 4I6WA 2QA2A 3D1QA 2POKA 5KFEA 2V8DA 3LWMA 2UVWA 1UFKA 5KFWA 4OX9F 5HBMA 1UVMA 1DRZA 2F1FA 4WZQA 4PPDA 4G1PA 2PC6A 3BN7A 3TQ1A 2PFDA 3PHEA 1Y7PA 5KOWA 2P2CB 1Y00A 2J8AA 4A8KA 4WBFA 1RA7A 1K73T 1KQKA 4A8SA 5IC4B 2F3JA 4F3MA 4FNHA 5MAOA 2BE9B 2OLWA 2F40A 4AT1B 2RSQA 1XMQF 3RRHA 2P8IA 2GS8A 2V8PA 4F2RA 1DLOA 4KR0B 2M70A 4ZPDA 2HNDB 5EGYA 1WKKA 1GMWA 2ZKTA 2F63A 2OPSB 2JX2A 4P10A 3CULA 1RTHA 3JS9A 3A13A 4DUZF 3PR5B 1HQUA 1RAOA 3AJDA 1TL3B 4H4KA 2X1FA 2VKRA 2VBWA 3GB0A 1QAJA 3A8IA 1HNZF 2RMLA 2HFUA 2VBXA 1N4LA 2WOMB 4X65J 1OPZA 3IGVA 3ENVA 1HBMB 5E33A 4ECWA 3M8RA 2KM8B 2AQ4A 3KLGA 2KHDA 4QU6A 2HNYB 3GJSB 2FIUA 2Y3YA 4I64A 4FKXA 3QFHA 3OQ2A 4GVLA 1FA0A 3CWJA 3KUEA 2NS1B 2HWIA 3ZTOA 2LKZA 2IPOB 3H5XA 2YNIB 2V34A 4RNHA 3G6VA 1WC6A 3MFHA 3LP2A 3GV8B 4LVNP 1HR0J 3OXGA 3LAKA 1XMOJ 4NLXA 4N8OA 1F2GA 1NPKA 2VBYA 3FZBA 3Q89A 2J6UA 3FEYB 3D0GE 2IJFA 4HI2A 3S6EA 4KC5A 3SQOP 4X4OA 4B3MJ 3SCLE 1S6UA 2R8GA 3ULHA 5A0YA 3R5DA 1JIHA 1PC4A 4AL6A 3TZWA 1LWCB 3NOGA 1YHQS 1TKXB 2HAIA 4MKVA 1VQSA 4ZIWA 2ALZA 2CDRB 1X4AA 1SPBP 1UEVA 4DPXA 1VC5A 3CCES 1KLMB 2MY8A 2UVVA 1NXIA 4EBEA 3N5BA 1R8PA 4K0KF 3D6TB 4EMDA 3PV8A 3KJNB 1LXNA 2F7VA 3M8ZA 3GG0A 4RW8A 4PUOB 4CTAB 4M5GA 4EI2A 3KLHB 1X9MA 4JI8J 1TQLA 3T1HJ 1C1CB 4UQTA 4CNZA 1RT1B 4O4RA 2G13A 3UFCX 2NLWA 1AT1B 4E98A 5JXSA 4ILMA 4I4BA 2YX1A 1S0NA 2CQBA 3CCWA 4ZVSB 1H73A 3DC2A 3WIUA 2WSFC 1U48A 2YKAA 1NKCA 4OHVA 1TVRA 1J27A 4RL1A 4WFAQ 3PEJA 4JOUA 2AZ1A 3PM9A 1HR0F 1SH0A 4PQUA 2Z58B 1GXUA 1XMOF 3CDUA 2CQ4A 1UVKA 3ICLA 1RB0A 4FXDA 2W9BA 3ILLA 4IH5A 1T3NA 3BF4A 1GMVA 3OHAA 2ZHOA 3HVAA 3P3DA 2VDHA 4MKAA 3BO2A 4C8ZA 4RKUC 4N7TA 2BR0A 4UZBA 2ZHAA 4B3MF 1KR4A 4Q8FA 3H8YA 4QIGA 1S1WA 3DGPA 1VI7A 2VH7A 3N01A 1VQMS 3U02A 3MCMA 5D3GA 2YH0A 4DXLA 1U45A 3DOMA 5D4LA 1Q1KA 2KHCA 3LP0B 4ZP9A 4N5SA 3EGWB 2FVQA 3EPGA 1PCAA 3WC0A 2YKQA 4YB6A 4C8YA 2FJDB 2DH8A 1DTTA 1PJ5A 2E29A 2DTJA 3PKYA 4ECVA 1GXLA 4C8NA 1TMMA 4PPZA 4BHQA 2HHTA 1HNXF 3V6JA 3EICA 2KYZA 2HEKA 3FUYA 3T1HF 2ASYA 3ETMA 2C2EA 2GO8A 3C14A 1BUXA 3IWLA 4P52A 3E01B 3C3LA 1FRHA 2DHXA 2GJ2A 4OZ1A 1SL0A 4ZHRA 3B78A 1CJKA 3JB9k 1X4GA 5F0UA 3D66A 1JQGA 1UWAA 3MM7B 4OJHA 1RTIB 1FRIA 1S9GB 1TL7A 3UNGC 4C0BA 2Z56B 3NS5A 2L9NA 3M9OB 3BR9A 4PZVA 3MPUB 2ZD1A 4DI6A 2JSXA 3OR1A 3PR4A 4Y3CA 1R8CA 4C11A 2EWHA 1U1PA 2LMIA 5DGAA 2LQJA 3H2UB 2MB0B 4LF1A 5E7OB 2UUBJ 2HWHA 5A2QY 2EBGA 2J9DE 2NSBA 3M8PB 3VGTA 2WVDA 3LGNA 1DQ8A 3CJSA 1WHXA 5EWGA 5HI7A 2DCUB 1BWVA 3OSNA 1WC3A 4NYZA 4PG6A 2LQBA 4XK8C 5ETMA 1YJ7A 4QR1A 1RT6B 2I6WA 3MXHP 3HZEA 4AQYJ 1Y10A 1IJEB 2HHQA 5HP1B 1RWUA 1IQZA 3AJ2A 2HHVA 1WACA 1NB2A 2CPXA 1HWIA 1RT3A 3MM9B 4F4ZA 2HIYA 3CNQP 2RKIB 5M2PA 1WC1A 1XERA 1SQGA 3UI3A 1G1XA 3CJ5A 2HLUA 1L3TA 2XMWA 1WTBA 2XSJB 5CQGA 1HQ2A 3D3BJ 4HDGA 3R1HA 1JLCA 3UN5A 4EBDA 2V8VA 4WU2A 1DBDA 3KOAA 5FLXY 1H6KX 3FRZA 5ETNA 3PRVA 5C2GA 5HROB 3Q8SB 4V19J 3HI9A 4QIWD 3EM1A 3CDWA 2XYPB 3BQ1A 3R8YA 4ANCA 2KFYA 2J7KA 1FDNA 1RTZA 2UUBF 3QLHB 3EMTA 2AYBA 4IRCA 4KHMA 3RGIA 4OLPA 2FZKB 2CJYB 3QGHA 2XO6A 1KEKA 3HVWA 4QZVB 4B9MA 2X3DA 2IA0A 1IKYA 1NSPA 5CCLA 4CH0S 3W2WB 5I3PA 2CAJA 5KAKA 1PIEA 3IMQJ 3V81B 5KFTA 2E66A 1LWFB 2G0CA 2A0FB 4I67A 4AQYF 2MYFA 3D0IE 2KB2A 4JV2A 2HQFA 3ZZ0A 4A8OA 2PO4A 2XCPA 1BC6A 2MGZB 1RWKB 2GHWA 2MKCA 3I32A 4NEYA 3BGLA 3D6HB 4FYYB 2VQEJ 4F36A 5DO2A 4DCPB 4YQWA 3PIPQ 2PFFB 4F0HA 3HSZA 5KFMA 1FO1A 4P72A 1IBMJ 2EG1A 1D9AA 5LL6d 2D3ZA 2HFVA 2O1PA 2Q43A 3IR5B 4DV2J 3E2EA 2RQ4A 3MAAB 5LXYA 2XHCA 3PYDA 3NXZA 2ZVIA 1EB0A 1N34J 1Q8LA 1DHMA 3DCAA 4PQAA 1S5ZA 2DR9A 3OLAA 3VQSA 3NP5A 3W66A 4HACB 3G87A 5KOXA 4I2QA 2XY7A 4IG3B 1SXLA 1A6LA 1U02A 1APSA 2CWKA 5DQHA 1TKZA 5HAOA 4URQU 2CQCA 1H7XA 3OFGA 2HKEA 2HBRB 3LH2S 1IR1A 4ID5B 1YITS 2V9KA 4ER8A 2KXFA 4GVBB 1C0UA 1M5PC 4ED7A 4F7VA 5CA5A 3TEGA 3ZZTA 1V3ZA 2F4FA 3NG8A 4CH7A 2WK4A 1QE1B 3DMJB 3HJVA 1B0VA 3RBXA 1LV5A 3OXLA 1EETB 1EIYB 1S97A 1Q8BA 4DF4A 3TJ8A 1OWXA 4LSZB 1IKWA 2OPRB 1IBMF 2AYEA 4J9LA 2CNOB 3H40A 1VRTB 1VHFA 5LSRA 2CZ9A 2VC1A 1T9XA 2XSFA 4JYAJ 2XS5A 3MMBA 4ZITA 4DV2F 2LQ8A 5E0OA 1NK9A 4PWDA 4OYPA 3C2PA 3FMBA 5IM0A 1FD2A 3TVZA 4NLUA 4C2MA 1TKTB 4NZ0A 2KT2A 3E3XA 2LU1A 2UV8G 4YMEA 1NAQA 3KLEA 1K8AT 3CVKA 2ZBRA 1XNQJ 1L3UA 2CJBA 2MZTA 4OYOA 4I6YA 1KRPA 4RW6A 2XNRA 2ZH4A 1KQGB 2J5AA 4HTIA 3D67A 4DUTA 3ISZA 4ED1A 1H0HB 2ILZA 3NWRA 3P4UB 3BN4A 2XHWA 2DK2A 1CULB 2M3DA 3R2DJ 1BQXA 3I5BA 3UDCA 4X4VA 4TY8B 3DLGB 1OSCA 2P9CA 3P45B 2DNGA 1YJVA 5A8RB 3JXOA 3FSIA 1W7WA 3AA8A 1UWBB 3TI0A 1T03A 2RVJA 4WIQA 3IG1B 3U1LA 2B9XA 1I94J 5J2QA 4RWWA 3SBMA 4CRJA 1VCTA 3GONA 2YWHA 5AE1A 5HL7Q 4LRAA 4GC6A 1NH8A 3R9LA 4JYAF 2QN6B 4A8FA 1IKXA 3IC1A 1NU4A 5KT7A 3B8HA 2EBEA 3JQJA 2HLTA 1HYSB 1ZA2B 1WKJA 2V2QA 3JTPA 3LPYA 2UUAJ 4HHJA 4CLPA 2LU2A 3GSDA 1B70B 3TA2A 4PWUA 2R8JA 2RQKA 1YTYA 2OPPA 3NS7B 2XI3A 2MKJA 1N56A 5L1JA 1NK6A 4AL5A 1IWGA 4TKTA 1XNQF 3T5KA 2NREA 3FMWA 3T5JA 3Q2SC 1UA0A 4CLTA 1T05B 1CC8A 1K44A 2OD4A 3BEGB 4BC7A 1F9HA 3BSCA 2AD9A 3TJ9A 3WQPA 1WF1A 2Y1LB 1FTCA 5KG7A 5M2UA 2BM0A 4DV3J 1PAUB 2W7PA 2V4JB 1RUSA 3CEDA 2IBOA 3J81U 3C6UB 3M1VB 2LA6A 4DR1J 2MQPA 4JI7J 4JI0J 3CD7A 3NOCA 3KG0A 3PYGA 2P6SA 3PYEA 4DCJB 4G1QB 3MEGB 5K9FA 2FLNA 2VA2A 3AOCA 2ZNYA 5AXKA 2VJUA 3KHHA 3BJYA 3K89A 4QIFA 3ETOA 1A7GE 4XTTA 1YJWS 4O23A 3OTEA 2MSSA 3FFIB 3B54A 5IZHA 4YS2A 4USWA 2AF6A 3RAQA 2IJNA 3GIRA 4DHVA 2O5DA 4DOZA 4DV6J 4A47A 4AXJA 5KT5A 3GIKA 2OPSA 2ZUGA 1QSSA 1YI2S 1WEXA 2OI2A 3CJ8A 4CQ1A 4OFZA 4NXNJ 1TL3A 4ES2A 3TJAA 1KP6A 2ZUAA 2L9WA 3SI8A 2M9KA 1NKEA 4O3NA 3MGJA 1WOOA 2GHVC 2WOMA 3HHLD 4RNOA 2RDDA 4DV3F 2HVHA 2YWFA 3THVA 3E8OA 1HBNB 3QSIA 1QTMA 2GVDB 2HNYA 3DLJA 3IR6B 4UOFA 3MMAA 4EZ6A 4DR1F 4JI7F 2AEJA 3A8JA 1RCOB 3BGRB 2F5GA 1TU0B 2W4CA 1Q5VA 1KQSR 4WYWA 3VQTA 2DITA 4LQ9A 4WXOA 3C6TA 2YNIA 2CVIA 1CJVA 2F8MA 1LFWA 3ITHB 3RB0A 3QIDA 5IQ6A 4IDKA 3PEHA 1CBKA 1XMBA 3CJ2A 4DQPA 4J90A 3DLKB 4FYDA 4DX5A 1TKDA 1FK9A 3SSQA 1H3DA 1JXVA 4P74A 4WF9Q 2J0WA 3W60A 4DV6F 2XMVA 4RNFA 2D9PA 5CHCB 3QJLA 1REVB 1LWCA 2QT7A 1TKXA 4NXNF 4X4RA 2HMIB 4J9KA 1KLMA 2L08A 3MMCB 2F9DA 2FC9A 1YJNS 2UP1A 3DFEA 1IKVB 3CXCR 4JI2J 5KFPA 2HQDA 2FHMA 2Y8YA 4CTAA 3F44A 5D8HB 4NCGA 2VF3A 3JAMY 2Q6BA 4DG1A 2W9CA 3OJUA 1C1CA 3G6ES 2W2MP 2E7XA 2X1BA 5HMXA 1FXRA 2DBBA 1WUUA 1OIAA 3BDPA 3QBCA 1GXTA 3MUMP 1IUJA 3IR7B 3DNCA 5HK4A 4F0KA 1EHWA 4UOHA 1BQMB 2AJFE 2RUSA 4ZVOB 2R42A 4DL7A 4EEYA 2BJ3A 2W7AA 1XC9A 2GIFA 4RZRA 1UKUA 3TYTA 3GJQB 2OEJA 4TQRA 2CA9A 3TWZA 3D9BA 1X60A 1VRUB 4GRSA 4WP8A 3R7SB 1N0UA 5J2MA 3M8YA 3TQEA 4C7QA 2HVZA 4ELTA 3ILJA 5HMWA 2YKNA 2IRXA 4YR0A 4ZPAA 3S1TA 3KK3A 4LF9J 4P2FA 3LP0A 1ZBTA 1VQNS 2LQ9A 2D41A 4IRKA 4ATNA 4NLWA 4P9SA 1WI6A 4JI2F 3CTRA 3NGSA 2CPEA 1R8HA 3K8VA 2XI2A 1B99A 2KVQE 1Y4ZB 2W8KA 3DDIA 4ENOA 5GAEI 2DCLA 4TU7A 2ERRA 2CJKA 4P75A 3GFHA 3E01A 4C8LA 1ZM4A 1U1MA 4LIRA 3W3SA 2O67A 5D15A 4MK7A 1WOPA 2FJBB 1VMBA 2ZC4A 3O5TB 2PE8A 3L7PA 4IOBA 3UN3A 2JC1A 2ZEJA 3MM7A 1RTIA 1S9GA 2HAFA 2BACA 1VR6A 2M88A 4DMZA 4PG4A 2RDJA 2W01A 1TTHB 4E0DA 2EFNA 3THPA 1F5CA 1LKZA 4V19X 4OZ3A 1UJ5A 1WNEA 2DY1A 1JLQB 3OL6A 1XR7A 2N7YA 2DNRA 1FD8A 3L95X 3JSRA 3GR0A 1RHQB 2U1AA 4J5OA 2A2CA 1NDPA 1AFIA 2RNEA 2VOOA 3M8PA 4O4GB 1HBOA 3C46A 2WRMA 4KY3A 1U09A 1T0TV 1S9FA 4LF9F 2GJFA 1R3NA 2NXNA 2J0SD 2XY6A 1KKHA 3RUBL 4KAIA 3PO5A 3PFOA 2R2SA 3VAFA 3GWCA 3DM2B 3HFKA 5F8JA 5B0DA 2OSRA 3VZHA 2VPXB 3CO0P 3LUYA 2CPZA 4HDHA 2J76E 2WVEA 2P6TA 2CDQA 3MM9A 3HX9A 4USMA 2RKIA 2VICA 4IUFA 3TUIC 1VBXA 2ILYA 3Q8PB 2IDEA 5AJ3J 2XSJA 5K8PA 3H5YA 4MIBA 2AKWB 1UPPA 2DR7A 2WB4A 3A12A 1NJZA 1P6TA 3ENQA 5F3TA 2BW2A 2K3KA 3T6JA 3MTKA 1VQLS 3MM5B 1YRTA 2D3OR 1HPZB 1BWEA 4LREA 2YQ1A 2DEJA 4YR3A 3H7HB 2ZH1A 2OMLA 3IS9B 5F8LA 4OV1A 4ES3A 1YVFA 3IP0A 4FXWA 3QLHA 1MWYA 4RUHA 2Z2YB 2LCWA 2CZ4A 3A1YG 5EX3A 2MY7A 2DXFA 2ROGA 2E1AA 2BOAA 5F9LA 2C42A 2FJVA 5SUHA 2ZJQQ 3V81A 2CQGA 2AMCB 4LRCA 3MM8A 2Q79A 3AXMA 1J5EJ 3I56S 1BXNA 3HM9A 4B02A 2DR8A 3LOUA 1RBAA 2KVIA 2MHNA 5C24B 4WXWA 4LF6J 1U2RA 1VQPS 3FSXA 4HH1A 2J7WA 3ZTPA 4A46A 2YNGA 1KHVA 3T6BA 1HQEB 2XG8A 2B8QA 5AJ3F 1BE4A 4RBVA 5D0EA 3C8YA 1HHSA 2DH7A 4N8NA 1S1VA 1TL4A 2FQQB 2VG6B 1YJTA 2V63A 4FPRA 3X3UA 2RHQB 3PRDA 1VYAA 1FJCA 2J0XA 4IH6A 5DS7A 1ZTTA 3IXQA 2FLOA 4HACA 1Z2ZA 3RR8A 1RLDA 3G96A 2VDIA 4IG3A 3FKBA 2VG7B 4YY3J 4C4WA 3K7RA 4M8LA 2HHWA 5IT0A 2MZJA 4BBYA 3WIVA 4AUKA 2GC8A 1WG4A 3BH7B 4X64J 3BYPA 4HH0A 1NHVA 2NZCA 3R6GB 1L3KA 2XM3A 3D1OA 4YDXA 5J2NB 1KVIA 2C2DA 1EQMA 3KG4A 3J80Y 3O2IA 5KFDA 4ID5A 4ZA1A 3K59A 1OYDA 2QMUB 2BVZA 1J5EF 2R8IA 4GVBA 3MPYA 4ZOSA 2ZH7A 2OP5A 1N6QA 1NPRA 3PJXA 1QE1A 3DMJA 4LF6F 1JLBB 2M0GB 1WDDA 2NXUA 2N3LA 3FK4A 1EETA 4EUVA 2DR6A 3WZ0A 1U8WA 4WPAA 4LIWA 1E6VB 3QWUA 2HK2A 4QOTA 2OPRA 1QSLA 2IM2A 2JEFA 3NGDA 1TV6A 1VRTA 2PMHA 3I0RB 1HKAA 2XQCA 4DL0C 1H98A 3HHEA 2HNZB 4Q0BB 4PXEA 4TVAB 3PCOB 2MJNA 1N5VA 3MEDA 1R6YA 2V8GA 3VAMA 5LMNF 3UCZP 4QPXA 2AEMA 3K0JA 5DG8A 2M52A 1NLKL 2GX8A 4FF2A 2EW9A 1UZDA 3RB3A 4WIIA 4ECUA 2NPFA 2K2PA 3BM7A 4AE5A 4HI1A 2DXDA 2N4DA 2R7QA 4YY3F 1Q81T 3LP1A 1H2TZ 1F60B 1RT7A 3UO0A 2HBQB 5D77A 2VPZB 2V94A 2JWNA 3GCWP 2WCXA 4X64F 1HNVB 1M5VC 3BR8A 2H9ZA 2EK6A 3MURP 2QLBB 5C2CA 2K7JA 3IRXB 4JV0A 1X5TA 3J7AN 1QLNA 1U0HB 1U7LA 3NNCA 1RJJA 3TARA 1T11A 3HPOA 4H4KC 3W8PA 3TAMB 1CULA 2E5IA 4C3LA 1YQHA 3VGVA 3BBBA 3BYRA 2D3O1 4WE1A 1OY8A 5F3ZA 4KBIA 4TY8A 2PI4A 3DLGA 4HT5A 5LJ3Y 4L3KA 5A8RA 3I4HX 2R7XA 3TUJC 1UWBA 4M1KA 2BOPA 2JH3A 2PSZA 2CNLB 4YB5A 2I0XA 4OX6A 3TNVA 3P49B 5L9XA 3SCJE 4NA1A 1URNA 4I56A 2FJEB 5BXIA 3F41A 3H2VE 2DGSA 2EXUA 1KHWA 2RF2B 3B82A 4YFUA 1VQ9S 1HYSA 1QJHA 1F3FA 2D9OA 4LF7J 3U1NA 4PABA 3CUNA 4ZPTR 5KFQA 1IWAA 3HSDA 3K58A 2GCFA 2VONA 1S57A 5SZTA 5KFHA 3LW5C 4LUBA 1SH2A 2LDYA 4QWEA 2R7OA 3VHQA 3OD2A 2AJQA 3BSAA 1OMSA 3RBZA 3TEHB 1VJWA 2FPHX 3FNNA 3OVAA 2MZSA 1M1HA 1T3OA 5EN1A 2A2DA 2OJ3A 3I55S 4DSLA 3G8TA 1Q16B 5D0GA 1T05A 2HGNA 3RRGA 1NBEB 3HMJG 5IS2A 3ZNUA 4KHPJ 2DGUA 4I2PA 2HVEA 2IM0A 4DV5J 1SB6A 4RW4A 3SFGA 1F0XA 1GAOA 1GTEA 2PIIA 3K5MA 3PVXA 2J8SA 4FPIA 2JLGA 4QWBA 3C6UA 3M1VA 5GMEA 3GMGA 2ALYB 5DZ7A 3BH6B 1O0PA 1SJ3P 2CQ2A 2XWXA 3QIPB 1OJ4A 1N33J 3L7OA 1C4AA 4IO9Q 4ZPWR 3I96A 3MEGA 1UVNA 4CWBA 3MUTP 3K5NA 2EC0A 1X0FA 3TA0A 4CYUB 4DBQA 1YWXA 1U1RA 3NBPB 4IFYB 4OJGA 4KKOB 1NKBA 2MKHA 2B6AB 2YNFB 3TAQA 3A3PB 4IFVB 1K47A 2B7BB 1S6QA 3W61A 1RK8A 2QFIA 3FFIA 1UJ4A 3PJWA 3W9JA 4MIAA 2ZDOA 2DNYA 4F4YA 4DR4F 3IM8A 1FKOA 3ZZYA 2JZ5A 2XLJA 2LEPA 1S59A 2C2RA 3N79A 4TQSA 1VQ6S 5D78A 3KFWX 2OEKA 2HQIA 4CH1A 3Q83A 2VPYB 2MQNA 4ZPCA 4OZ5A 4NL5A 2H54B 1X5OA 3FEXB 1M90T 1JKHB 4Q7AA 2HZCA 2HFSA 1SCJB 2RRBA 1DZ5A 4WU3A 3MPWA 1S79A 4KHPF 2QLXA 5KFRA 1VQ8S 4QWDA 3V4MA 5B0CA 5GAHI 3OHBA 2B9EA 4XAKA 4DN9A 2C2ZB 2VFVA 1NJXA 5RUBA 5B0AA 3GV5B 1NB7A 3OW2R 4NLSA 2Z0GA 1IVZA 3NGTA 1F9FA 3N9UC 4J9UE 3Q0AA 3BGRA 1I3OB 3EJMA 3QRRA 2MKYA 1N33F 4LQ3A 5F0WA 2FJWA 4CO4A 2FLLA 3T3FA 5J1PA 5ETPA 2BJEA 1U1KA 4F8RA 1T02A 4FN5A 2YWWA 3L4BC 2VV5A 2CG4A 2VIHA 4Q2LA 5KFJA 4FP9A 5B0GA 2AU0A 3PW4A 2AX0A 2UUTA 1C1BB 1CSJA 5DETA 2IM1A 2KTQA 2DGWA 2CADA 3DLKA 2DPIA 2I1RA 3HHDA 4FDFA 1QVFR 5HLFB 1UCNA 3HHLA 2JC0A 2BQRA 1AZSB 5I3QA 2BQ3A 2DGQA 2ADBA 2ZH6A 4LF2A 5C5JA 1WC0A 3W5XA 1REVA 3G82A 4NXMJ 3FRYA 3FZ2A 4QW8A 3W63A 3DYAA 2YPZA 3THTA 1RZMA 4OJ3A 3J81j 1H2VZ 2HMIA 4HTJA 3PACA 3CJTA 1LW0B 2B5JB 5DDRC 3GU0A 2HWTA 1IKVA 3KLIA 3CIMA 2ACMA 1DQ9A 4J9MA 1P9QC 4RR5A 4G6VB 4LRDA 4ICLB 1CJTB 2LEAA 1TUVA 4ZLLA 2AGOA 1YDLA 3HFVA 1AYEA 4YP3A 2NYHA 5T14A 4OHZA 3A8KA 3K17A 3FQLA 5IQQA 5E2QA 4O3QA 4OIXA 2DYAA 2B4UA 1YJRA 1GX5A 4CLWA 5ITHA 5I4MA 2U2FA 1MMDA 1FWPA 3JTNA 1BQMA 2V0NA 1VGYA 2SXLA 3DHXA 4G3IA 2KZMA 3AJ1A 3MEKA 2QA4S 3CCQS 3R27A 4ZLNA 1RSCA 3KLFB 4IOAQ 4F2SA 5IT9Y 9RUBA 1P1TA 2ZBQA 3DLBA 4OI1A 3FEZA 2QFJA 2OTJS 1R8BA 3MI7X 4NLTA 2HURA 1VRUA 5KFAA 8AT1B 1J5OB 3JSYA 2J9EA 4NXMF 4RWXA 4X2BA 3QO9B 4H4MB 5DM6Q 4PRFA 4AXIA 3ELHA 3MD3A 1JNRB 2LFVA 4PG7A 2Z2MA 4WFZA 5HSPA 3UNYA 2VPWB 1N5YA 4DN0A 5HVFA 3FVYA 5J2PB 3ISND 1UFLA 3ZXWA 2CPHA 1QVGR 4MK9A 4ZVHA 1F5BA 2ASDA 2G1DA 3SDEB 4WZMA 3BBCA 2JEIA 3O8WA 2WW8A 1QUVA 2CQDA 4UUWA 4DX8H 2DR5A 1UTAA 2MMYA 4E8UA 3NL0A 4F3QA 5KG5A 2DGVA 1HIYA 3HZGA 1WKLA 4M5NA 5LM7E 2DNKA 3DDNA 2UXBJ 1WHVA 1SC6A 3CCMS 1Q7LB 2DKOB 4X62F 1TELA 4JB8B 1E6YB 3EE3A 5JUMA 4IG0B 1WF2A 1ZTWA 3LGMA 1QY7A 1KLNA 4CM0A 3QGPA 3RTVA 2RU9A 4Y2KA 4Z7CA 3JYTB 1FFGB 2QO3A 2JEGA 2C3PA 4LFAF 2WBRA 1YKWA 3HP6A 1JLQA 2UUWA 5K8NA 2MSTA 4U7UD 2E5HA 3CE8A 4MT1A 4OYAA 3OPKA 4PG5A 4O4GA 3UVJB 1B3TA 3H4DA 2KL8A 1S7IA 1P27B 3NEKA 4CLUA 4ED2A 1XIQA 2NR0A 1U1LA 5CYJA 2JVOA 4DZDA 1IR2A 1T9UA 2XY5A 4RW9B 1S6PA 3DM2A 3LGHA 1CG2A 4W4MA 5KG2A 1HARA 1F6TA 4ZVUB 2I9SA 4A8YA 3BB5A 4DR5F 1U6BA 3VR1A 1TK5A 1RXOB 4QYRA 1TK0A 3HF5A 3DRPA 4KYZA 1UPMB 2HW3A 2DISA 1ZM3A 2BXJA 4KIAA 2UXBF 4RW7A 1SIWB 3ET6B 1G3OA 1CS4B 1L5UA 3R97A 4ZCMA 3GYGA 8RUCA 2E9TA 2IC3B 3G71S 3VZIA 5DJBA 3MTJA 3MM5A 3CGIA 3M8QA 4H54A 3SEOA 3SQGA 2KU7A 3UCUP 3IS9A 4M5KA 1S1UA 2I5JB 1R27B 5KT4A 2PGCA 2N82B 5K20B 4ED4A 5KFIA 3CCRS 3QATA 3A4TA 2NUUG 3MMJA 3R5BA 4TU8A 2PN6A 1UETA 3EZ5A 2J0QD 2HHXA 1RTJB 3GYXB 4LSLB 5K8MA 2C2MB 3B4MA 2WTFA 4NWBA 1YGYA 1S4EA 3W2VB 5IOLA 3J7Z5 5E3CA 2CPFA 2OFHX 3V6DB 4ES1A 1FXLA 2W2QP 4RX6A 2B51A 2JL9A 2XLKA 2Y0BB 2ZH5A 3HKWA 2FHKA 2XO7A 4MK8A 5C24A 2ZKUA 4A48A 4EYIB 5DG9A 2IVFB 1AUSL 4DQIA 3OFFA 1PBAA 3TRGA 4EGLA 3RYLA 2ZZTA 1HQEA 1UW9A 4M5HA 1RHUB 5CD4A 2KJWA 3CCSS 4L3NA 4PCQA 1LWEA 4MMOA 1FX2A 1O8BA 3N6NA 2DXEA 3FBFA 1RHMB 1RT2B 4J9NA
chains in the Genus database with same CATH topology
1HMVA 3HHLD 3OFEA 4RNOA 4DV3F 4ZMMA 2HVHA 2YWFA 3TP2A 3QMQA 3THVA 2KYXA 2UXCF 2MGZA 3E8OA 3I4PA 1HBNB 1QTMA 4Y65A 5C42B 3MM8B 1H2UX 5L1LA 3PRBA 2VG6A 2HNYA 2XGQA 3DLJA 3VAGA 3IR6B 4CI0B 3NAIA 4FXVA 2DIVA 3MMAA 4EZ6A 4DR1F 4TN2A 4JI7F 3BO4A 3DOLA 2FDNA 3BGRB 3G8SA 3N28A 1W2IA 2W4CA 4L72B 3TX8A 3E51A 1KQSR 3CC7S 3GFYA 2DIUA 5LT5A 4WYWA 2Y1JA 1NJWA 5L8RC 1UAWA 2CJQA 3P5TL 4ECQA 1XN9A 2YQ3A 5GADI 5CD4H 3VQTA 2E9RX 2DITA 2M5YA 2YNGB 4LQ9A 4WXOA 2LA4A 1T8EA 3C6TA 4NOHA 2HPUA 3K5LA 1Q82T 2QIFA 1CPZA 2YNIA 4KV8B 2CVIA 4C0HA 2KFNA 3VALA 1HQUB 3WDOA 1CC7A 2F8MA 3S7RA 1U1NA 2IFXA 1FRLA 1R8AA 5L39A 4EU0A 4B3OB 2GIRA 1LFWA 4ELVA 2RS8A 3V6HA 2OPQB 1V6HA 3ITHB 2MDAA 3QIDA 5IQ6A 3RB0A 2KFZA 2CQ0A 3EUNA 4IDKA 3KNAA 4LSNA 1KN6A 4I1TA 3PEHA 2CQ3A 1QUPA 5C25B 1XMBA 3DLEA 5J2NA 3CJ2A 2JFDA 3QWPA 2LEBA 2R7TA 2BANB 1SH3A 4IQXA 4A8XA 4DQPA 3TVYA 3KJVA 4UW2A 3DLKB 4ZCLA 1K9MT 4FYDA 4R8UB 1TKDA 4KTQA 4TY9A 2BE2B 4X66F 3IA0A 1S1VB 3KLVA 4EBCA 1FK9A 2RD5C 1HI8A 4C3KA 3SSQA 3NCQA 4X2BA 4MH8A 3M2UB 2Q6CA 1H3DA 4OI3A 3OFHA 5KG1A 1GX6A 2R7SA 3D2WA 1MWZA 3WC2A 1JLAA 4WF9Q 3MEEB 4KFBA 5AXMA 3B4DA 3MZIA 4Y2CA 4NYPA 1PSDA 3UW1A 2J0WA 2C22A 4K4UA 5E3QA 1IQTA 4DV6F 1KFDA 3DLHA 2XMVA 1JLBA 4ZCIA 4RNFA 2WSCC 2D9PA 2DT9A 5CHCB 3TVKA 5IXUA 1S72S 1Z2LA 3KWMA 1SKSA 3WBZA 4C97A 3M30A 4ITSA 3QJLA 1REVB 2FVSA 4WK1A 1N0VC 2NYIA 2Y1IA 3CCJS 4M5DA 3C66A 5KFLA 4DV4F 1LWCA 1TL5A 1TL1B 4WJBA 3P96A 4XPEA 3HHNB 1S4FA 2QT7A 2R9LA 5JVHQ 3BS9A 1TKXA 4UY85 2ROEA 2DNOA 4NXNF 2FJXA 1DARA 3H25A 1ZAVA 5AXLA 2HHPA 1UJ6A 3OLBA 5KFFA 5L38A 4X4RA 2MKKA 2BM1A 1JLFA 2F8HA 2JJ4D 2BYCA 4HEA9 1X5SA 4DWIA 2HMIB 2BBEA 4J9KA 1KLMA 4PXCA 1RAJA 2L08A 4CO2A 3VAHA 3MMCB 3I0RA 2F9DA 2FC9A 3KLFA 3G4SS 1YJNS 2B4PA 1HBUA 3I82A 4LF5F 5CYMA 3GR1A 4URGA 2UP1A 3M2RA 1FTRA 2ZE2A 3DFEA 4DS5A 3AA9A 1IKVB 1UMJA 4L6V3 4ETZA 2HNZA 4DV7F