3QIPB

Structure of hiv-1 reverse transcriptase in complex with an rnase h inhibitor and nevirapine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
425
structure length
402
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse HIV-1 reverse transcriptase p66
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 115
structure length 402
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qipB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB03
4NLRA 3DMJA 5KFZA 4J9MA 1JIHA 2IM2A 3PVXA 4K4TA 4URSA 4H4OA 4IQXA 3H2LA 1RTHB 1IKXB 3C6UB 1EETB 4RW6B 1RT4B 4KKOB 1S9EA 1RAJA 1VRTA 3DLEB 3DRRB 4ZP9A 1RA7A 1IKWB 4ZP6A 1JLGA 1XR6A 3Q8QB 5L1JA 1SV5B 3MF5A 2WOMA 1TV6B 5KFLA 4IH5A 4JV2A 5C42B 1T03A 3Q8SB 1T3NA 3CJ5A 4ZMMA 2IC3B 3DOKA 4B3OA 4ED6A 4XPCA 5I3UB 1K1QA 3GV5B 4K4VA 4EO6A 5F8LA 2AWZA 1S1XB 2W9CA 3ICLA 4MH8A 4KAIA 3SFUA 1N48A 4F4XA 3DLKB 2HWHA 3PW0A 1S9FA 3M8QA 3DLGB 2HNDB 4IOBA 3G86A 4DL6A 5HP1A 4WXWA 1QAJA 4I7FB 3CJ4A 2HMIB 2ZD1B 2BRKA 4I2PA 1ZTWA 3MR5A 5HLFA 5KG7A 1KHWA 2YNGA 1HQUA 3SI8A 4QWDA 2D3ZA 1JLEB 4NLVA 4EYIB 5KFNA 4KBIA 3ISNC 1DTQA 1EP4A 1S1VB 4TY8A 5KT5A 2AGQA 4IRKA 4URGA 4PWDB 4H54A 2YNIB 2HNZA 5KG0A 4WE1A 4ECXA 2IA6A 2IJNA 3MFIA 1HMVB 1FK9B 1RT2B 1CSJA 3PZPA 5KFGA 2W8KA 1HNVA 3KLVA 4TY9A 4ZHRA 1IKXA 3C6UA 4RW6A 3H4DA 1RT4A 4KKOA 2C28A 2WTFA 3DLEA 3DRRA 2IM0A 4ZVEA 5J2NB 3GV7B 2V4QA 2BRLA 1RT5A 3BSCA 1SV5A 5EWEA 3C6TA 3V81B 4I2QB 4WFZA 4Q43A 2V0NA 4MKAA 4KSEB 3OL8A 3DI6B 2IC3A 2R8HA 2D3UA 2E9TA 4ZVFA 5I3UA 4LQ9A 1U09A 5DLFA 2UVWA 1S1XA 3GIKA 5EDWA 1LW2B 3MECB 4IKAA 3T5KA 2C2DA 4K4ZA 2I1RA 5KFMA 3DLGA 2WCXA 3CVKA 1RA6A 5KFJA 1IKVA 2HNDA 3M9MB 2C22A 2GIRA 4EO8A 4TQSA 4M94A 4IRDA 1MU2B 5KFYA 4YP3A 5KG4A 3LP1B 4ZP7A 5KG6A 2FVCA 4IDKB 1WNEA 2UVRA 3HHKA 2D41A 3KHLA 4FS1A 2B5JB 1JLFA 3DDKA 3LALA 4WYLA 5KT2A 3LP2A 4IFYB 3H98A 1HPZA 4ED8A 3GIIA 3V6DB 1RTIB 2XC9A 2AGOA 2WRMA 4RW7A 3BR9A 2YNIA 1SH0A 1C0UB 4ICLA 4NLSA 4K4XA 4NLQA 1JLAA 1S1WB 2VG7B 1DTTB 2HAIA 2FVSA 3HVTA 1HMVA 1FK9A 4NLWA 2WK4A 3T19A 2JC1A 1N4LA 2VA3A 4TYAA 1DLOB 5DQIA 4EBEA 3DOKB 3E01B 2ZE2A 3OLBA 2OPPB 1LWEA 5J2NA 5L1IA 4ECSA 5C25A 3H5UA 5KFBA 3OSNA 3DOLA 1T94A 4U7CA 3BSOA 3V81A 4J9QA 2WHOA 1C2PA 4QWEA 3I5BA 3FFIA 4NYZA 4ID5B 3DI6A 1BQMA 3GIJA 2CJQA 3BQ0A 3NAIA 3QGIA 4K4YA 3RB0A 4I2PB 4KV8B 5HLFB 3NKYA 2AU0A 1LW2A 2IAJB 1TQLA 4Y3CA 3MEEB 3KLGB 5KG2A 3D28A 2R8IA 5DQHA 2UUTA 5KFTA 4ECUA 3RBEA 1RT6B 4DL2A 2W8LA 2JEFA 4O3RA 4ED7A 4TY8B 4NLDA 3I0RB 4YQWA 3DYAA 2HNZB 1MU2A 4WE1B 3GYNA 3LP1A 4IDKA 3GQCA 2ZKUA 4ED2A 2HNYB 1S6PB 1HNVB 2B5JA 5KFWA 4ECVA 4Q8FA 4ZHRB 5F8IA 1HQEB 3PW5A 4IFYA 4ECTA 3CJ2A 3IGVA 4DL3A 2RDIA 4O3PA 2J6UA 1FKOA 3V6DA 1RTIA 3LP0B 1C0UA 1RT5B 5KFDA 3PHEA 2VG7A 1S1WA 2YKMA 1DTTA 3C6TB 5DG9A 4ED0A 4IRCA 3V6JA 4RUCA 1DLOA 3FQKA 4R5PB 1RT3A 1S1UA 3TQ1A 3QGHA 3IS9B 1T05A 4DG1B 1TP7A 4NLTA 4QPXA 3MR6A 3UQSA 3E01A 4R8UB 5KFUA 2OPPA 3KK2B 1TKZB 3OHBA 3KHGA 1C0TB 2ASLA 4DEZA 4RZRA 3OLAA 2R2RA 5KG1A 2V9WA 1TL1A 2JEJA 3H40A 3BJYA 5HBMB 1GX6A 5KG3A 4ID5A 1IKVB 2W9BB 4Q45A 2ASJA 5F8JA 4F4ZA 5KT7A 1W25A 3G6YA 3M9OB 4F4YA 2YKNB 5KFCA 3CO9A 2VG5B 4YMEA 4KV8A 2IM3A 5DGAA 3G6VA 1LWCB 2IAJA 5D3GB 2C2RA 3MEEA 3KLGA 3TVKA 1JLFB 1C1CA 1D0EA 4ECZA 3MTKA 2IMWP 1HARA 1RT6A 3LP2B 5DQGA 1HPZB 3PW2A 3GILA 4WZMA 3TAMA 1UWBB 2XGQA 4RW7B 3I0RA 1K1SA 4ZVHA 4ICLB 1JLAB 5F9NA 4NLGA 1BQNA 3HVTB 5J2PA 2HNYA 1KLMB 1S6PA 4XO0A 1HNIB 4O4GB 4ZPAA 4Q44A 3Q8PB 3H59A 1HQEA 3NL0A 1RT1A 1J5OB 4DL5A 4URQU 2FVQA 3N6NA 3KHRA 3PW4A 3LP0A 1TKXB 2ZE2B 2FLLA 4ECRA 1LWEB 1SUQA 5C25B 4MK9A 5F9LA 3DOLB 3KLFA 1N5YB 3KJVB 2UVUA 3FFIB 3DRPB 4R5PA 4NZ0A 3FRZA 3IS9A 1BQMB 4DG1A 2R8KA 5I42B 4JUZA 4DL7A 4R8UA 3MR2A 4M95A 2BR0A 3KK2A 1TKZA 3FSIA 4MK7A 5K14B 1C0TA 4QW8A 1NNDA 1Z4UA 4F50A 4J9KA 4IR9A 5HBMA 2W9BA 2BQUA 1QAIA 2WB4A 3KLIA 1RDRA 3CJ0A 4LSLB 1NHUA 4RW8B 2IM1A 4NLXA 4Y2AA 4WXOA 5KT4A 3H5XA 3FQLA 2YKNA 3DYAB 2VG5A 4MKBA 4QWCA 4IR1A 1LWCA 4NRTA 5D3GA 4O3SA 3OL9A 3QYYA 4TLRA 4ED1A 4WYWA 4ZPCA 3VQSA 3QLHA 3KLHB 1FKOB 3QGGA 3KNAA 1UWBA 4GC7A 2OPRB 4ZPBA 2FJWA 3G6XA 2V4RA 4KO0A 4O44A 3BSNA 4J9RA 2YKMB 1TKTA 1TL3B 1KLMA 3HVWA 1HNIA 4O4GA 1JLBB 3DM2B 4TN2A 4F4WA 1RT3B 1S1UB 4IFVB 5HROA 4ZP8A 1T05B 5DG8A 2J6SA 4X2BA 4MFBB 1J5OA 2C2EA 4LSNA 1TKXA 5KFEA 3H5YA 1JKHB 3RBDA 1FKPB 3CDWA 5DGBA 2OPQB 2R2UA 4RUAA 4ED3A 1REVB 3IGNA 1RT7B 1N5YA 4J9LA 1TL1B 3KJVA 3V4IB 3GV8B 3DRPA 4K50A 4WFYA 4RNFA 1GX5A 1S9GB 5J2MB 3BREA 3BSAA 3IG1A 5I42A 4RW9B 3E51A 5FDLA 4FBTA 5L1LA 2B6AB 3ITHA 5CYQB 5KFVA 2ILZA 5K14A 1S0MA 4J9OA 2UVVA 5KFHA 3QIPB 5F8NA 1C1CB 3DRSA 2W7PA 4LSLA 3UR0A 4RW8A 4JV1A 4Q0BB 2B43A 3TAMB 4IG0B 5DG7A 3RB6A 4RNHA 3N6LA 3SFGA 2YNHB 1JLQA 3PW7A 1BQNB 3I5AA 3HVAA 2FJVA 5J2PB 3CJ3A 2BQRA 1OS5A 3UDLA 4ECYA 1RT1B 3KLHA 4H4MA 4LQ3A 3BGRB 2IJFA 2OPRA 5J2QB 1ZTTA 5KFIA 1SUQB 4RNNA 2BE2B 3EPGA 2DPJA 3JSMB 1RTDB 3KLFB 4IG3B 1TL3A 4G1QB 3MR3A 3EZUA 1JLBA 2RF2A 5EUHA 3DM2A 2FLPA 3NGDA 4IFVA 2F8EX 4DL4A 3KMSA 4O4RA 1N56A 4MFBA 5CYMB 5C24B 2JLEA 3NBPB 4MIAA 2AQ4A 2WONA 4K4WA 3OHAA 4EYHB 1JKHA 1RYRA 1S1TB 1JLCB 1FKPA 4Y34A 1IKYB 2OPSB 2OPQA 5KT6A 1IM4A 1S97A 1REVA 2BQ3A 1YVFA 1RT7A 3QZ7A 3OSPA 2JC0A 3V4IA 3QIDA 5JXSA 1S4FA 2ALZA 4J9PA 4TQRA 3KLIB 1I6JA 1HYSA 3PJXA 1TVRA 1S9GA 3IRXB 5J2MA 1NHVA 3MFHA 3I5CA 1R0AA 4RW9A 4IH6A 2XGPA 2E9RX 2B6AA 5CYQA 2FLNA 3HKWA 2AX0A 2GIQA 3KK3B 1KHVA 2W9AA 2J6TA 4G3IA 3Q8RB 2VG6B 5T14A 2JEIA 4J9SA 4PQUA 5EWFA 3V6HA 3QIPA 2FVPA 4QWBA 3QLHB 5KFKA 4K4SA 4ECQA 4Q0BA 4IG0A 4KB7A 4JV0A 1S0OA 5KFRA 4KO0B 4O44B 2D7SA 1LW0B 2YNHA 1TKTB 4WFXA 3FDSA 4NRUA 3MEDB 5C5JA 3KHHA 5DLGA 3T5HA 3KK1B 3CIZA 5HROB 4O3OA 4RW4B 1QUVA 2RDJA 2RKIA 3BGRA 4LSNB 2FJXA 2ATLA 5J2QA 4NLPA 2VA2A 4KFBB 2BE2A 4QWAA 1XR7A 4EBCA 3JSMA 1RTDA 3CDUA 5KFSA 2YNFA 3PR5B 4MK8A 4IG3A 3LAKA 4G1QA 1VRUA 4PUOA 1S49A 5J1EB 4FBUA 3I0SB 4ECWA 3BQ1A 4K4UA 4ZVGA 1N6QB 3IG1B 5CYMA 5C24A 3NBPA 1RYSA 5FDLB 3ITHB 2OH2A 1RTJB 3JYTB 1S1TA 1JLCA 3PJWA 1C1BB 1IKYA 2OPSA 4RNMA 3GIMA 3V6KA 2EC0A 5JUMA 3MEGB 3DRSB 1RTHA 2ILYA 4Y2CA 1EETA 2BANB 2I5JB 3IRXA 4TXSA 1D1UA 1IKWA 5KT3A 1QE1B 4NCGB 3EPIA 3NMAA 4TYBA 3OL6A 4NLOA 3IN5A 1SH3A 1JLQB 1JXLA 1TV6A 3KK3A 4FS2A 3QO9B 2O5DA 2JEGA 2VG6A 3CWJA 5C42A 3LAMA 4WZQA 5F8MA 5L9XA 1LWFB 2R2TA 4O3NA 4EBDA 2R8JA 3M8PB 5KFQA 4H4MB 5EWGA 3KLEB 5F8HA 3CDEA 2QE5A 4J9NA 4HYKA 2E9ZA 4OL8A 2XI2A 3DLKA 1LW0A 1ZETA 3MEDA 2UUWA 3T5JA 1S6QB 2RF2B 3H4BA 2XWYA 3KK1A 1SH2A 2GC8A 2W7OA 4I7FA 4R0EA 4RW4A 2XI3A 2HMIA 1MMLA 2ZD1A 2AX1A 2CKWA 3DMJB 2XCPA 2WONB 4NLUA 4O3QA 4KFBA 4RNOA 4H4OB 1JLEA 3RB4A 3H5SA 2XCAA 5J1EA 2FVRA 1S1VA 1HYSB 2QV6A 4MIBA 3I0SA 2ASDA 2AGPA 1S9EB 1TVRB 1VRTB 4NLYA 3LANA 4PWDA 1N6QA 4QW9A 3D5MA 1JLGB 1R0AB 5KG5A 3NAHA 1JX4A 4YR0A 2WOMB 3BQ2A 1RTJA 3JYTA 2R8GA 1C1BA 1RT2A 3QZ8A 3MEGA 1T03B 4PQUB 3RAXA 3UPFA 3T1AA 5KFXA 4ZPDA 4B3OB 5F8GA 3OL7A 3M9NB 2DPIA 4YR3A 2BANA 1S0NA 2I5JA 5L1KA 3KOAA 3ISND 1QE1A 4NCGA 4HKQA 5KFOA 2W9CB 4IH7A 5KFPA 4I2QA 3M8QB 3QO9A 4GC6A 5KFFA 3T5LA 2HWIA 4Q8EA 1LWFA 5HP1B 1S10A 3M8PA 4KE5A 2RKIB 3KMQA 4U6PA 3KLEA 2R2SA 3N6MA 4KHRA 5KFAA 3PR4A 3RAQA 3MECA 2YNGB 4XPEA 4RU9A 1HQUB 2YNFB 1S48A 4KHMA 1XR5A 1VRUB 1S6QA 4PUOB 1DTQB 1EP4B 3RB3A 4EEYA 4YR2A 2IBKA
chains in the Genus database with same CATH superfamily
4CO3A 2BJDA 3TO8A 4IQXA 4DZDA 2Z4PA 3DLEB 2UU9F 3HD1A 4ED6A 2E1PA 2ROGA 3G71S 5LMNF 2QIFA 4OV6A 3ULHA 3ONQA 4GVBB 1ZTWA 2PA3A 2Q43A 4PG4A 2KM8B 2IJNA 1FK9B 3RAMA 3PZPA 1WKKA 3W60A 1UP1A 2CZ9A 3UVJA 3VVUA 4B3MJ 4YFUA 1U09A 2EG1A 4WP9A 4IKAA 3I9V9 2B7CB 5L39A 2WCXA 2F1FA 2C3YA 2HGLA 2QA4S 4G1PA 2FVCA 3GCXP 1YK9A 1Q81T 5KT2A 2GX8A 3BR9A 4K4XA 3FK4A 2HAIA 4J37A 1HMVA 3M2VB 4TYAA 2KYXA 2Y0SD 2Y0BB 1U47A 3V81A 2GO8A 4HH1A 2LQ8A 1KVKA 3I5BA 2JVOA 3OUYB 3GSDA 1BQMA 4A46A 3GIJA 1RAOA 1VIXA 2X1GA 2AU0A 4DL2A 5LOQA 2CG8A 4NLDA 4LF4J 1MU2A 4LR8A 3FCVA 3CC2S 1T9UA 5B0CA 2RDIA 2VBWA 4OYZA 3MMAB 4MJKA 3UWTA 1SVDA 2FZCB 2HVEA 1WEYA 2LECA 3UQSA 5CCMA 3OLAA 2Z56B 3BJYA 2CPYA 1H2UX 5AXKA 4F4ZA 1N34J 3MPUB 3G9CA 3A1YG 1D9DA 1Y9OA 1FTRA 2RQMA 1JLAB 5LJ5Y 4O4GB 1FRXA 4DL5A 3RRHA 2YY3A 5CHCB 3GZ7A 1AB8A 1SUQA 4YN3B 2AEFA 2K8GA 4ZCIA 1DQ8A 2BR0A 3CT9A 3O5TB 2GHVC 3CJ0A 2GZOA 1JWWA 4OYOA 4B9VA 4BDPA 4USHA 1HWJA 4J9RA 2YKMB 2CQ1A 2M2BA 2HWTA 4TN2A 2J6SA 4MFBB 4LSNA 2E5JA 3E51A 5FDLA 1FRLA 5G4DA 2VUGA 2BDPA 3FBEA 3QIPB 4EUVA 3UR0A 3BS9A 1FD2A 3ILIA 1B0VA 3FBBA 4B9SA 1HR0F 1D09B 1RT1B 2DR8A 2O3DA 2AKWB 1RTDB 2DCLA 1X7VA 2YTCA 3CO0P 3DM2A 6AT1B 4O4RA 1ZZNA 4K4WA 1RYRA 1RT7A 1HYSA 2PMHA 3F44A 5EWFA 3N01A 3MM7A 4BHQA 4NRUA 2V2ZA 4A47A 5A8RA 4O3OA 5C2CA 1MW7A 1IBLF 2EBGA 3CDUA 5KFSA 1AYEA 4PUOA 2X1AA 4ECWA 4ZVGA 3JYTB 2Z8QA 1BC6A 2CQGA 1RTHA 2I5JB 3HXMA 1QLNA 1IKWA 1TL5A 3GR1A 2A0FB 4P74A 3QO9B 5L46A 2BACA 2KTQA 2AP6A 4HYKA 2XI2A 1PGZA 4LF8J 4OHZA 1FDAA 4WP8A 2MTLA 3ENQA 2GC8A 4LF5F 2ZD1A 4NLUA 3N0VA 2Q1LA 1U1PA 1UW4A 3AOCA 4JI1F 1QAXA 2FHJD 4ANCA 2I9SA 3D5MA 4CLPA 1JX4A 1N36J 1M5PC 3MEGA 1T03B 2RQ4A 5KFXA 1VK3A 2H3EB 2MZQA 5K8OA 2ADBA 3ISND 3PHTA 4JYAF 4I2QA 4G6VB 3ENWA 4B3MF 5DJBA 2JFDA 1CULA 2VOOA 2VC0A 1FERA 4RU9A 1HBUB 2K3IA 2YNFB 4QYZJ 2VFSA 3EM1A 2QL7B 2ZNYA 5G0RA 4CLUA 1PILA 2VF3A 4GMKA 4NI2B 2G0JA 5L1JA 1F5CA 3ZNUA 1TV6B 1XTZA 1T02A 1NDLA 2HRTA 2MJUA 5HQLA 3UFCX 4EO6A 2GS8A 4UOFA 2W9CA 3SFUA 3PW0A 1S9FA 3M8QA 3OQ2A 4R25A 3G86A 3OFGA 3FZ2A 3P5BP 1JJCB 5HLFA 4M5NA 3D0HE 1MNEA 2ROEA 4H54A 3PY8A 3MFIA 3S7RA 4C8ZA 4N56A 2ZBIA 3J80Y 1FRMA 3NXZA 3M8WA 4ZLNA 1LXJA 4KSEB 1S77D 3EGWB 1YGYA 3I6PA 1NPKA 4DS5A 3MAHA 2VHGA 1IKVA 1N34F 4JOUA 2WVBA 5KFYA 3LP1B 5K9FA 2D41A 3RR7A 1E6YA 2BJ8A 2ZH1A 3ET6A 3CW2C 2OD6A 5AJ3J 1SH0A 3HHLC 5AE3A 1EARA 2KZMA 4LFBF 4B9NA 5C25A 3H5UA 1UPPA 5B0EA 5A8WA 3DOMA 4ZK7M 2X3DA 2GA7A 1T7PA 2E7VA 3DYAA 2HNZB 2AJ0A 3DLJA 4B3TJ 4K5RA 4F3OA 2AZ3A 3JS9A 4Q8FA 4ZHRB 1HBNA 3CJ2A 4DL3A 4A48A 2Q6CA 1QTMA 2U1AA 3TUIC 4FVMA 3EJMA 1NK6A 3G6VA 1UJ5A 1C1CA 2QLWA 3KWMA 4ECZA 3CC7S 1FF2A 4I4BA 2GVZA 3W8PA 3HVTB 1H72C 1F6TA 3NLCA 2AMCB 1UW9A 1T11A 2FY1A 1FDNA 1RCOB 2BXJA 3HI9A 3BDEA 1F60B 3W8GA 3KK2A 1Y7PA 4QYZK 4L73A 1RHUB 1XMOF 4QWCA 1QVGR 3QYYA 2PDAA 1BWVA 2OPRB 2QFJA 3DNCA 4HI1A 4QOTA 1TKTA 1KLMA 2E1RA 2W2MP 4ZLLA 3H2VE 2J9DA 4KHPJ 4FXDA 5KFEA 1CC8A 2OELA 3HKZD 5E3QA 1GX5A 2XS5A 4A8FA 3FZBA 4PXBA 4ZLPA 5KFHA 1Q7LB 4B3RJ 3UDVA 4DV3J 2CQ4A 3ELHA 4RBVA 4DV4J 4Y2IA 4DSIA 2W25A 1UPMB 2M88A 4MTPA 3MMCB 4H4MA 2E5IA 1GFWB 2DGQA 4LF8F 3KLFB 1NZ8A 3EDQB 5EUHA 1YRUA 3VGSA 2Z57B 1JKHA 4DQPA 1WC1A 1TVRA 2PGCA 1RWKB 1V3RA 4K4SA 3OW2R 1NDPA 3NP5A 4QIEA 2DHSA 5HROB 5K8MA 3BGRA 3R6GB 2BE2A 2ZH4A 3PR5B 5DM7Q 2XO6A 1B3TA 2IVFB 2FHMA 4LVNP 2BJ1A 3QT8A 2DIUA 1MSWD 3MURP 3QT7A 2DTJA 2BJEA 2JH3A 2R2TA 4F4AA 2XZWA 1Y10A 3IWNC 3H4BA 3FKBA 3GJTB 4NZ6A 1VQKS 2K2PA 2XS7A 1HI8A 1JLEA 4OX8A 1B0TA 3NNHA 2FVRA 2QV6A 4DV0F 4PWDA 3GIRA 4P7VA 3LOUA 4OZJA 1XK8A 2ZJQQ 3OBIA 3ZZ0A 5BXIA 3O1LA 2MJNA 3PYFA 2LQJA 2XB2D 3T1AA 5K20B 5DZ6A 3S01A 2L48A 3ETOA 1N32J 3F73A 4KE5A 1L3UA 1X0FA 3RZAA 3MECA 3R5JB 1Y5LB 1K47A 2EEYA 2F3JA 4C4WA 3THVA 2KXNB 4CO2A 2KXHA 3R1HA 5AJ3F 4ZVQB 1SQEA 3CCQS 1JNZB 4U8VA 2HPUA 2LDYA 4I64A 2EVZA 2M52A 3KJFB 4B3OA 1IWGA 1K1QA 4P10A 2QEXS 4K4VA 2NXNA 3CCJS 2MQNA 5F0WA 1RHRB 3O3LA 5HP1A 1QAJA 4HACB 2QFIA 1WEXA 3DU5A 4NLVA 2VDHA 3HD2A 4IRKA 5ITHA 1RT2B 3HZGA 1N33J 3C6UA 4KKOA 4ZVEA 4NASA 1SV5A 1IVZA 2GNKA 2DR5A 4RBUA 2IPOB 1PBAA 2LDIA 3T3FA 5DDQC 4C0BA 5M2RA 2E5HA 4WU3A 2PI4A 3K59A 5JVGQ 1OMSA 4RO0A 1R43A 1WNEA 2BKPA 2HGNA 3GFHA 3GSIA 2HW3A 4UY85 2MQPA 3HHLA 2RQCA 1NSAA 3PNIA 2LYVA 4OHWA 2CPFA 1T94A 2WHOA 1HWKA 5ETVA 1YZ6A 4K4YA 2HBRB 4KV8B 2OUGA 3KLGB 3M2UB 3IMQJ 1T9VA 4JI2J 3P4UB 5DS7A 4ZPWR 1NU4A 1P6TA 3A3NB 4CTAB 2M5YA 1DTTA 2V8VA 1P9YA 2OAUA 1VLYA 2A2CA 2VPXB 3CDAA 4OYWA 2PC6A 4RUHA 1TKZB 3ENVA 1W2IA 3BM7A 2ASJA 1W25A 3EWGA 2JJ4D 2CA9A 4FYVB 2IFXA 4UZCA 5DQGA 4B3RF 4WZMA 1UVIA 4FF4A 2BE9B 1BQNA 4DV4F 3CJSA 2MQMA 5GAGU 3NL0A 1X4HA 3DLBA 2P9GA 1OWXA 3T1YF 2E5LJ 2KB2A 4DPUA 1NJZA 4JUZA 1VDHA 4IOAQ 3PACA 3KUHA 1F9FA 2IM1A 4L76A 2ZZNA 2VG5A 1ZAXA 4NRTA 1FNXH 2HQIA 5M2UA 2OSRA 3GONA 4F4WA 1IWAA 2GGPA 1T05B 4P73A 3OFEA 2DRBA 4YUDA 2OFGX 3CDWA 2NPIA 1RWUA 3IGNA 1ZPWX 5E7OB 1NB7A 4JI4J 3DRPA 2KI2A 1U26A 4RNFA 3BKTA 4WTOB 4C6AA 4FBTA 1RBAA 1UEVA 5KFVA 1QUPA 1BD6A 2UVVA 4DZ6A 3LA0A 1JLQA 3PW7A 3CPWR 1O51A 1OY6A 2KDOA 2IJFA 2CQBA 3UD5A 2Q66A 4BLGA 1JLBA 4QPTA 5E3PA 1FKPA 1UZHA 3QRQA 5BYSA 2Z2MA 3CJ8A 1AZSB 5JMNA 3CTRA 3FNNA 4KO0B 1N32F 2YNHA 3FDSA 1FXRA 2YPZA 1MROB 5A8KB 3UNGC 5H9EJ 1AFJA 1TUGB 1V5VA 4KFBB 4QWAA 3JSMA 4MK8A 1NUEA 2ZITA 3OXFA 5J1EB 1RWNB 1S6OA 3OR2A 3WX8A 3ZTSA 1N6QB 3MD1A 3TAPA 2BKNA 2QJ3A 1C1BB 2ZM6J 4LRDA 3IRXA 4OX9J 2CDQA 5KT3A 4DQQA 3TJ8A 3UN3A 1U1RA 3IRWP 1HBOA 4YY3J 3J7A1 3M8PB 3EUNA 5KFQA 4ILMA 2XWYA 2DT9A 2ACYA 4DSKA 2AX1A 1QDUB 4GRSA 7FDRA 2VFUA 2AGPA 1S9EB 1R0AB 4ZA1A 3H42A 3W66A 3R6LB 1WC5A 4OFZA 4C48A 1R8HA 2YX7A 1OPZA 5GAGI 1GNKA 1UMJA 1ZM3A 3PX4A 1XNQJ 4J90A 3QBCA 3IR6B 1AW0A 2AYBA 2OLWA 1CJVB 5K8NA 4X4OA 2AEJA 5KOWA 2QL5B 2XS2A 1P27B 2CQ3A 2QRRA 3I82A 3H2LA 5DDRC 2ZFHA 4ZP9A 3Q8QB 2Z2LA 2LCWA 2F9JA 4TU9A 3RBXA 3MF5A 4X4SA 2CJAA 2UXCJ 3HK2A 5IQQA 1VIOA 4MH8A 1KVIA 3EGVA 4BWMA 4I7FB 2UZAA 3THTA 1APSA 2BYCA 1DTQA 1S1VB 4TU7A 2AGQA 2CJKA 1KFSA 4FYWB 4JI2F 2E7WA 4ECXA 4WE1A 1M1HA 1IJEB 3A3PB 4P2FA 2K7KA 4X4VA 4HI2A 4USVA 4ZOSA 1RT4A 2RIJA 4PG8A 2XY5A 4WP3A 3OL8A 2XM3A 4P71A 2UVWA 2ZBCA 2HHTA 1KQSR 3DLGA 2MHNA 5KFJA 2A2DA 3NWGA 1B4SA 1J27A 4ITSA 3MM9B 2W1BA 1BHNA 3LALA 4IFYB 3H98A 2BZ2A 2KM8C 1RWMB 2AGOA 3HFKA 3MTJA 4KC5A 1FFGB 4NLWA 3T19A 2VA3A 2F40A 1HA1A 2I8EA 3VV2B 2E5LF 1HBMA 3T6BA 2CJYB 2XMUA 1GAOA 5H9EK 2F65A 2DGSA 4JI8F 3EGNA 1LW2A 1VJWA 3N4WA 1LNQA 3A8IA 3D6MB 4OJGA 4F67A 5B0AA 2HK2A 1GXLA 3AOBA 3MM5B 3UE2A 2PT0A 4ECVA 3PX0A 3VAHA 2FC9A 4LBIA 4DR6J 4WFNQ 2ZZMA 3PO4A 4R5PB 3ETMA 3E01A 2XNRA 2OPPA 3P5TL 1NKCA 2BJ9A 4JI4F 4NL5A 3W64A 5ETMA 4M63A 4O0IA 1ICEB 2HHPA 2L3MA 3TAMA 4OI6A 4OHVA 1BQXA 2DNNA 5IZHA 2H65B 3TWZA 1TKXB 2ZE2B 1DAXA 4LBPA 5E3CA 1S59A 2CIMA 2R8KA 3DGPA 3QQCD 1U8WA 2EG2A 4U7UD 4DX5A 1F5AA 3CCRS 3VF0B 1U1LA 5HJXA 3ZZOA 4WYWA 3QSYB 2A3JA 2RH3A 1WG4A 1EKSA 1QSLA 2MZJA 2B3TB 4RUAA 4J9LA 2BBEA 1YJ9S 1S9GB 5CZVA 2B6AB 4QR0A 5K14A 3ZO7A 2YKOA 3WDOA 4A8MP 2CPJA 4OX9F 4Y2KA 4F25A 3FVYA 1WC4A 3UDLA 1FD8A 3KLHA 4LQ3A 2LEBA 1KONA 4RNNA 5HAOA 1TL3A 2FB0A 1YX2A 4PPDA 8RUCA 5CYMB 2EK1A 3C16B 3I9ZA 5LXRA 1CBKA 3CXCR 2HHQA 2Z0GA 1X5TA 4ZVUB 2DXFA 1NO8A 3HSJA 2FUG9 2VG6B 3HLUA 1SJ3P 2H54B 4ECQA 2CDRB 3KHHA 4Q2MA 4KQZA 4YDDB 2RSQA 3AJ1A 2FC8A 3C19A 1VRUA 3BQ1A 3UD4P 2XQCA 4X4QA 3V6KA 3B78A 1OIAA 4ZCMA 3OT9A 2B9YA 4G65A 4NLOA 2UXCF 3D68A 1FRKA 3FBCA 5ETNA 4NCAA 5E2QA 3IR5B 1CG2A 2ZOGA 5LSLA 2M3DA 4USWA 4M5IA 3AH6A 2PA8D 5IS2A 4FP9A 4MYUA 1V6HA 3BO4A 4NA2A 2FQQB 4UOCA 5F8GA 3OL7A 4YR3A 2BANA 2NZCA 3MM8B 1U48A 1LKZA 2POKA 2P9EA 2XSFA 2MHEA 2LQ5A 1QD1A 4RWXA 3H25A 2HKEA 2W4DA 4DUYF 4K5SA 4NYOA 3SCIE 1IKXB 3DRRB 3CJQA 1KD1T 2UP1A 3MM6B 5KFLA 3R5BA 2VZ9A 3HVRA 3I87A 4YS2A 3N28A 5GMDA 4LIRA 3T1HJ 4MAKA 1SPBP 2HMIB 2MKJA 3MMBB 3MCSA 1WF2A 4KBIA 3TJ9A 4DX6A 3L7OA 3QSIA 5KFGA 4TY9A 1U1OA 1AFIA 1UVNA 2GAHC 3DLEA 1RT5A 4LRCA 2GJIA 4V1Ak 2G13A 1DJ0A 4F2RA 2JZ5A 4GO7X 1RHKB 1R0CB 4TVAB 2AZ1A 4M94A 5CXTA 3MGJA 5ETPA 3D67A 4ZP7A 2GQCA 2UVRA 1Q82T 3DDKA 2V8PA 2ZVIA 4ZVTB 4WYLA 4E8UA 1GQEA 5F41A 1C0UB 2L9DA 1FK9A 1DLOB 3TA0A 1QSSA 2YVSA 2PN6A 2J76E 1GTHA 5L9NA 2ZBQA 3KUEA 1PC4A 2MSTA 5KG2A 4ECUA 2W8LA 4ERDA 3BGOP 4L74A 1A7GE 3BN4A 3SZ2A 2RQKA 5LSRA 2B56A 4NLTA 3IS9B 4EI2A 5CCLA 1YI2S 2K3KA 4C8LA 4DEZA 3BKFA 2V9WA 1RBOB 3U1NA 3PIOQ 2FHJA 2YKNB 4YMEA 2F4VJ 4CYUB 1HARA 3LP2B 3PW2A 1HW8A 4DSEA 2E1CA 2DR7A 2XGQA 4ICLB 1IQTA 3JQJA 2PEBA 4BS2A 3Q8PB 1HNIB 2FYXA 5GVQA 2RHQB 3MMAA 1UKUA 1RE1B 3UDEA 1FRIA 4DXLA 4MK7A 3VWSA 1X9WA 2KU7A 2V50A 2RNEA 2R3VA 1H74A 3OL9A 2L9NA 4ES1A 2PFFB 2EFNA 2MYFA 3BO2A 3C2PA 3QGGA 8ATCB 3RYLA 3MHYA 3CD6S 1FEHA 4O4GA 3S1TA 2VBZA 4TKTA 1JXVA 1TR0A 3QRRA 3BREA 2KG1A 1N52B 4LJMA 2P2CB 1CS4A 4DN9A 3C8YA 4LF6J 3R1LA 4DFKA 1T9TA 2J9DE 4Q0BB 2ZC3A 2GAGC 4FPIA 4PZVA 1FWKA 3TJAA 2MKYA 1B99A 4WKRA 4IG3B 3WQPA 2M8HA 2AF6A 1LFWA 1SJ1A 4MFBA 2ABYA 2AQ4A 1PBUA 1OPIA 3PG9A 1YVFA 3OSPA 3I55S 5JXSA 3CCUS 3JTOA 1M1KT 4LFCF 3QIPA 1KN6A 1I5OB 1S0OA 2J7WA 1NPRA 4ED5A 1RXOB 4F3MA 3KK1B 4PPZA 4RW4B 1YJ7A 1RTDA 2BV3A 1KS2A 2GIFA 1RYSA 1ZH5A 3GIMA 3PJWA 1H7WA 2FGOA 3EMTA 4DN0A 4YEAA 1T8EA 4N8OA 3LQVA 1QE1B 5CH7B 2JEGA 2D1CA 4K8RA 2G0CA 2E9ZA 3OV7A 2R7VA 2UUWA 2ZEJA 3CNQP 2B9WA 3DMJB 2ZJRQ 4I1TA 3M8RA 4ZPTR 4QW9A 5KG5A 1ZM2A 2OO4A 2WOMB 3JYTA 3UPFA 7AT1B 4A8XA 1XEZA 2I5JA 3AODA 3GFZA 1F3FA 4OHYA 3QO9A 4WFBQ 1PAEX 4MKVA 4CWBA 3QWPA 2CFXA 3CD0A 1U45A 1AUDA 4GKKJ 4M5DB 4YB5A 2YWGA 4A8SA 4AE5A 4JI3J 1FRJA 2OHDA 4OI4A 3K5PA 5SZTA 1WOOA 3DKDA 1EETB 3R7BB 1GK8A 4I67A 4OYMA 1MWYA 1T03A 4XPCA 5I3UB 2YQ1A 1S1XB 2EKNA 4F4XA 2HWHA 1WEZA 2A10A 5D4LA 4LBHA 3Q8UA 3CJ4A 4C8OA 3MR5A 1V3ZA 4DR1J 1HBUA 2D3ZA 4UQGA 4OV1A 3HO1A 3ZNJ1 1S6UA 2RUSA 4OZ1A 1KOHA 2LXFA 1S57A 2LFVA 1U0SA 3K5LA 4DV6J 2GFFA 1V3SA 1AROP 1FA0A 5HMYA 3B4MA 2QT7A 5IWAJ 4EO8A 3Q2TC 1NK9A 1X4FA 5KG6A 1E6VB 2F4VF 1WSRA 4ELUA 3TP2A 2ZHBA 2ZH2A 2UXDF 4RW7A 3PXGa 2HHVA 1B7YB 2WK4A 4KRWA 2FIUA 1TAQA 5L8RC 2DNKA 4JI7F 3OLBA 5J1PA 3KDNA 3DOLA 3IP0A 5BR8J 1AUSL 3QPIA 4ID5B 3PFOA 2CJQA 1U6ZA 1TQLA 2Q3PA 2NREA 4WF9Q 1IBMF 4ED4A 2KO1A 3D1HA 3LP1A 3GYGA 5KFWA 3OJUA 1VBKA 1HQEB 3CCMS 3NCPA 1NSQA 4DV5F 3U27A 1SL1A 3DFEA 4X62J 4A8KA 2XSJB 4DV2J 1YLXA 1R8BA 2C2RA 3GPAA 2ZWPA 3PYEA 1FHTA 4CT9A 4UY8T 4JI6J 3GILA 3FCWA 1UWBB 2VBXA 5A2QY 1PJ5A 2OSQA 1FDDA 5LT5A 5K5MA 2IIHA 1J5OB 4URQU 2FLLA 5F9LA 2HG4A 2ZH9A 2MQOA 3KJVB 1SL2A 2EBEA 4FNIA 1BQMB 1BMQB 3G96A 3I56S 5LMUF 4DL7A 1LK5A 3PKMA 4M5MA 3RW7A 4EWTA 1RDRA 4RW8B 1WSVA 3BV8A 4MMOA 1DBDA 4RU2A 1FX2A 4GKJF 3Q8VA 5T7LA 2DXEA 3GMGA 3TZZA 3H5YA 4ZKAA 3V4IB 2N82B 1KR4A 3BSAA 4OZ0A 5CYQB 2WZ1A 3MOZA 1RAAB 4AFFA 2ADCA 4IG0B 3UN5A 3RRKA 3RRGA 3CMAS 3DXBA 3HULA 5IV4A 2OPRA 1NJXA 1SUQB 1VQLS 1Q5VA 2GMLA 1WUUA 3KMSA 5C24B 5FJ4A 3RTVA 2A6MA 7FD1A 5LJ3Y 4RX6A 1ELOA 4HLBA 3AQPA 2UUCF 2VIHA 3KK3B 4F8RA 2JEIA 2FVPA 2MDAA 2MGZB 1LW0B 2DR6A 2VC1A 4E0DA 2EW9A 3OXLA 1RWPB 3MCMA 3MMCA 4LSNB 2VODA 3ZZPA 2QA4G 2XY7A 5FDLB 2N3LA 2HSEB 2OH2A 2LVWA 1CQMA 3FC9A 1YBAA 1O8BA 5SUHA 2RE1A 2C3MA 3QFWA 1UJ4A 2HLTA 3IN5A 2CPDA 3JQKA 4KGKA 5F8MA 2GO9A 3HJVA 1ZBTA 1UFWA 1FJ7A 2WSCC 2DR9A 1VHFA 4AL7A 2HFZA 4ELTA 1F2GA 3K17A 2FJEB 2D9PA 1SKSA 3DXSX 3QMQA 1HYSB 4MIBA 1CPZA 1VLOA 4NLYA 3W7BA 1LK7A 4YR0A 2VASA 4WKYA 2DY1A 2RJZA 4NMXA 5B0GA 4LMZA 1NPPA 2OKQA 5L1KA 5LMNJ 1IR1A 5KFPA 4CH7A 3T5LA 1D8ZA 2R7WA 1S10A 3KMQA 4KHRA 3LGHA 5H1SV 2YNGB 1HQUB 2V4JB 4KHMA 4ETZA 1XR5A 4PUOB 5IWAF 5E5NA 2DHGA 1T9XA 4EU0A 1RABB 4CIOA 1WKJA 2VKRA 1RTHB 4RW6B 4ZP6A 1IKWB 3CJ5A 2RRAA 1RLDA 3OFHA 2HBYB 2YWFA 4C3KA 1TFYA 2HNDB 4DL6A 5IC6B 4WXWA 1OYEA 5JJBA 1AXQA 2ZD1B 4I2PA 5LM7E 1KHWA 3M1VB 2IVMA 3GJSB 1UZDA 2I6WA 3GR0A 2DY9A 2LP4A 2VFTA 4QYRA 3K8WA 2WTFA 2NSBA 1VQ8S 2NR0A 3C6TA 4I2QB 4P75A 1AT1B 3LTOA 2V68A 1RLCL 4X62F 3RU0A 2MMYA 4DV2F 2M9KA 2LKZA 2GIRA 3CJKB 3OVBA 4HACA 1I3OB 1JK9B 1FRHA 1D9AA 3HHKA 5G0RB 4JI6F 4FKXA 3O8WA 4NLQA 3AD9C 5B08A 3QJPA 4ZJLA 3SSRA 4N41A 3O44A 2VH7A 5HLFB 4Y3CA 1WWHA 4O3RA 3A8EA 4LF2A 3QAEA 1FKOA 2DXDA 3J7ZT 4NX9A 3W2VB 1VQ4S 5FD1A 5KFDA 5B7WA 4ED0A 1Y3KA 4BC9A 1L3VA 2CNLB 4DG1B 4C0HA 1ZAWA 2AJFE 2J7KA 2ASLA 2HK3A 1TL1A 5HATA 5DDPC 1IKVB 4C98A 4HR2A 2CPXA 4KV8A 1NSPA 5D3GB 3KLGA 4ALZA 1X4DA 1SKRA 3BDPA 2R9LA 3M2UA 1X4AA 5BYRA 2AHOB 5CD4H 3LO3A 4B3SJ 2G2ZA 4NLGA 2ZDPA 4U9RA 2CQHA 2KZZA 2BKOA 1CJTB 4DFMA 1HWIA 3TUPA 3ZXWA 3DC2A 5C25B 2CYYA 4B9UA 3M2RA 1DY3A 4I68A 1TKZA 3DOMB 4FPRA 4FF3A 4CLKA 5AE1A 3G8SA 4J9KA 1ZZFA 2BQUA 2MZSA 2KN4A 4WXOA 2DEJA 3FQLA 3DYAB 4IR1A 4UQTA 3QLHA 4KIAA 2C3OA 4RR5A 3H7HB 2MB0B 4FDFA 4IFVB 4ZP8A 2J8SA 1P8GA 2XZDB 4JV5J 4P2XA 4AT1B 4WFYA 4CO5A 2KFZA 5DRKA 1GMWA 2ILZA 1C1CB 3EE3A 2OP5A 3AHPA 2QLFB 2P9CA 2JOQA 3L7PA 3SV3A 1IBLJ 4QZVB 2DPJA 4DL4A 1N56A 4MIAA 3OHAA 4Y34A 2Q79A 5EX3A 2DH7A 3OTOF 4KGZB 4U95A 2GIQA 2W9AA 2ZH6A 2HS4A 5KFKA 2HQFA 1LXNA 3BPDA 1NMEB 4LVOP 5HMZA 1TKTB 4DR4J 2I0XA 1SJQA 1WHYA 4LF5J 2ZUAA 2QYCA 3SCKE 4USIA 4JI1J 2W2OP 4FBUA 4ZVRB 2RU9A 1SQFA 3W9JA 4QIGA 1L5UA 1KBRA 4CLLA 4Y2CA 4NCGB 4JYAJ 3FRYA 2CAJA 4WZQA 2HGMA 1FJEB 4CLSA 4H4MB 3S8SA 5EWGA 4F7VA 2RD5C 1V9OA 2B8QA 1S6QB 1MROA 1PO6A 2WAQD 4AXJA 3TZWA 5IC4B 1RHQB 4TU8A 4KFBA 4H4OB 1WF0A 2XCAA 5J1EA 4ES3A 2VPYB 2Y1LB 1TVRB 1N6QA 1JLGB 4PRFA 1ZYQA 1C1BA 2HFUA 3RAXA 1HIYA 4NZ7A 2CJBA 4GC6A 4OLPA 2KT3A 3M8PA 2HQGA 4KGMA 2R2SA 4XPEA 1IR0A 3C3LA 1N5TA 4RLEA 2ASYA 4NLRA 1FWPA 3Q83A 3NWRA 3ZFVA 3CGIA 1SXLA 2LQ9A 1S9EA 1U1MA 1XR6A 3UR3C 5AT1B 3DOKA 1ZA1B 2KHCA 4DPYA 2QMXA 2HURA 2AWZA 2DH8A 3HCXA 1XIQA 2K1RA 1J5EJ 3PEJA 1JLEB 5KFNA 4WFAQ 4PWDB 1CJVA 3RJMB 2JL9A 5J2NB 4LFBJ 3BSCA 4KY3A 3B82A 4WFZA 4JB8B 4CP5A 2R8HA 1VYAA 2XULA 2NCKL 3J80U 3MECB 1LV5A 2C2DA 2N3OA 5ETRA 3M9MB 4CLZA 4CO4A 2D9OA 4TQSA 2PIIA 4PKDB 3PX6A 3KHLA 1H2TZ 3V6DB 4B3SF 4FF1A 3K2YA 2A6OA 5M2PA 1JJ4A 1VMBA 4Q7AA 1LWEA 2HVHA 5KFBA 1LFPA 4QWEA 3SEOA 3VGVA 3RBEA 1RT6B 4A8YA 3MEKA 4NOHA 1N54B 2HFSA 2V2KA 4N8NA 1KFDA 4IFYA 3G87A 1WD6A 3MUTP 4RJVA 5CYJA 4RUCA 1F3VA 1RT3A 1C0TB 4JV5F 1GEHA 5KG3A 1JB0C 1FNMA 4Q45A 3UI3A 4PG5A 1XMOJ 5DGAA 4KGXB 1LWCB 4DR2F 4RWWA 2LXIA 5F9NA 3M8SA 1KQFB 3EZ5A 2J7UA 4EZ9A 2C2MB 4R5PA 3EXYA 3FRZA 3TVZA 4C11B 2J0XA 3FGVA 4RBTA 2PI5A 5E33A 2DGWA 2FPHX 3KLIA 5IQ6A 3H90A 1IBCB 4DHVA 4O3SA 3HFVA 3TVYA 4OI1A 5ETSA 4KH0B 4QR1A 5GAHU 1X4BA 4O44A 1BUXA 4L3NA 4DR4F 4X2BA 1TKXA 1P9QC 5CA5A 1PJ6A 2BW7A 3PCOB 3IG1A 4ETXA 4RW9B 2EC2A 2HVDA 3HM9A 2XMAA 4MT1A 4RNHA 1BQNB 1BXNA 3CC4S 1NKEA 3RR8A 1RGVA 5J2QB 1ZTTA 3A8JA 3VHQA 5BYQA 4G1QB 5THWA 3NCQA 4EYHB 2PD1A 1S97A 2CNNB 4OMFG 3THPA 4AQYF 5CABA 1S9GA 4IH6A 2B6AA 1R27B 3SBMA 3Q8RB 1NXIA 3E3XA 2Z58B 4DS4A 1M5KC 3H20A 1FX4A 1VQPS 4NCBA 3CIZA 3A4TA 2GGPB 1QUVA 3I96A 1CEZA 4NLPA 3KG4A 1YJWS 2VA2A 3GG0A 3A13A 1C4CA 2J9EA 1VC0A 4NEZA 2RU3A 1NDKA 2KYZA 3EYZA 4RUBA 4DV0J 5AXMA 5CYMA 1RTJB 2RT3A 3IFEA 2VD3A 3WX4A 1D1UA 2KHDA 2H5JB 2HIYA 1JLQB 1SIZA 2VG6A 4PAAA 5C42A 3LAMA 4C8MA 3M32B 1U4BA 4K7QA 1YRXA 1UTAA 3HPOA 1J5EF 4K0KF 4DQSA 3L4BC 3O2IA 1XBWA 5E41A 3QZ8A 4WK3A 4OZLA 1U8SA 3M9NB 2OGUA 2LEPA 4IH7A 4N47A 5DZ7A 5KFFA 1MN7A 2HWIA 1Y11A 2W4PA 4AYBD 1S48A 3OR1A 4UUWA 4DF4A 2O66A 1G7CB 5KFZA 1N5QA 1JIHA 2M8DB 1FEEA 2IDLA 1LWXA 1RA7A 2VQFJ 2X3GA 3HHEA 3QJJA 1HBOB 4K59A 2IC3B 5GAHI 2R7TA 1N48A 2OEMA 2Z2ZA 5BJRA 2BM0A 4Y0FA 2JX2A 1H6KX 3G8QA 2DNQA 3TX0A 4EYIB 3D0IE 4TY8A 5KT5A 5B0BA 2IA6A 5KAKA 1HNVA 2Y8WA 3VVTA 1IKXA 3DRRA 1FVQA 4ES2A 1F5BA 3DI6B 3POTB 4P7TA 2C42A 4LQ9A 3T9ZA 3GIKA 1Q53A 1RKIA 1TUVA 5KFMA 1RA6A 1WI8A 4X4RA 1NEEA 3HFZB 3MMBA 4IDKB 3TAQA 4ED8A 4KR0B 1HPZA 1RTIB 3ZC4A 2KG0A 2DHAA 2HFNA 2FVSA 1WI6A 2HBQB 3ZZZA 5H9FJ 4PWUA 4M1KA 3M30B 4M8LA 4I6WA 3KUGA 3UNYA 1Q8IA 5ETLA 2PE8A 3LPEA 1KLNA 1X8DA 1YKWA 3H2UB 1N0VC 2IAJB 1DRZA 2MKKA 5IM0A 2Y3YA 4WE1B 5ETTA 3GQCA 2HNYB 3NMRA 3IGVA 3LP0B 2YKAA 1C0UA 4CM2A 3T1YJ 4IRCA 4DR7J 3GJQB 1DLOA 3FQKA 1S1UA 4ZJQA 4QPXA 2JEJA 2YWKA 3H40A 5HBMB 3N79A 1EZZB 3CO9A 2V6AA 2NUUG 1NK7A 2M4MA 1Q1KA 2H4WB 1NK4A 1F1BB 1U1NA 1CJUA 4ZPAA 4QU6A 4J9UE 3QRPA 2VQEJ 3PRDA 2FVQA 3PW4A 4ECRA 3CMES 1YZ7A 1HBMB 3IS9A 2WW4A 5I42B 2H9ZA 1B7FA 1FFWB 1H38A 5D0GA 1ROFA 4F50A 4LT6A 1SC6A 1MG7A 4PYAA 2YKNA 4MKBA 2CG4A 5D6GA 2MEWA 2ZH3A 2OD4A 4ZPCA 3G2XA 4CYUA 3PJ9A 3CCLS 5HO4A 3MUMP 2MKSA 1UETA 3FSXA 1HNIA 4DV1J 4LRAA 4FYDA 4ZCLA 2DHHA 1D9FA 1T95A 2EI5A 3R7NB 3NY0A 5L1LA 3CEDA 3D9BA 3DRSA 2EFVA 2BA9A 4Y00A 4F4KA 3TAMB 2NXUA 5KTQA 3D66A 3RB6A 2FJVA 1OS5A 1U6FA 3FCHA 4J91A 5A6PA 2RS2A 2OTJS 1ACMB 1YJUA 4DCJB 2RF2A 2BUNA 3C14B 3DHWC 1JLCB 5KT6A 2OPSB 1XMQJ 2BQ3A 4OZ2A 3AT1B 4Y6IA 2AIRB 3HKWA 2LU2A 4ANEA 3IM8A 3NGKA 3ENAA 4Q0BA 2ZOMA 3TNVA 3I32A 5H9FK 3GWCA 2EPIA 1N5SA 2ATLA 5A76A 1XWLA 4FVCA 1VHIA 1XR7A 4DUTA 4IG3A 4DF8A 3JSBA 1P1LA 3I0SB 2DH9A 4K4UA 3M4XA 1MMNA 3T6JA 3W63A 4LF7J 1Q0NA 3QGPA 2VQFF 3B6BA 2P6SA 2CQ2A 2O5DA 5JVHQ 3UCGA 3KLEB 4DQRA 4J9NA 2QC3A 3DLKA 3L95X 3T41A 4AUKA 2ZH8A 3KK1A 1SH2A 4RW4A 3DRXA 1RZMA 3RB4A 2E5GA 4PR6A 4KTQA 1SBRA 3C15B 3BR8A 5ETQA 3MI7X 2DPIA 1URRA 2XY6A 1RWXB 4CRJA 1QE1A 2HHXA 4EMDA 2G0IA 3AXKA 4DJBA 4J9VA 2AJ2A 5KOXA 3CE8A 3EDRB 1VRUB 5D0RA 6FDRA 2VB6A 2KH9A 3KYLA 3DMJA 4J9MA 1NK8A 3AQOA 3PVXA 1EQMA 4X64F 3FBFA 2GVDB 3R27A 2QA1A 4X65F 3W61A 2WOMA 3K57A 2U2FA 1Q8BA 4OIXA 3SCJE 3GV5B 1IN0A 1UCNA 1NCLA 2G1DA 3CUNA 3G6ES 1S4EA 5D78A 4PWWA 1HHTP 5KG7A 1SB6A 3F56A 4CQ1A 1O0PA 4QWDA 4OYAA 1SKWA 3BEGB 3DN9A 2C2OB 3P96A 3GV7B 2W2PP 1RK8A 4DR7F 3S6EA 1KDNA 4X66J 2YPYA 5I3UA 5DLFA 5IT4A 1S1XA 3TARA 4JI8J 4K4ZA 1VQ6S 3WZ0A 3KG1A 3PEHA 1Q95G 4DV7F 3TEGA 4IRDA 2BVZA 2WB1D 5DDOC 2O01C 2SXLA 4FS1A 2B5JB 2XMJA 1UAWA 2N4CA 3FUYA 3CCVS 1S1WB 1X4CA 5IOLA 4HDGA 4DBQA 4C8YA 2VQEF 1A6LA 2QSWA 3OSNA 1W26A 3FFIA 1KNZA 2DK2A 3BQ0A 1KTQA 3NKYA 4QIWD 3V5RA 1PYOB 2DGUA 5KFTA 2CZVC 4V19J 1EX8A 3I0RB 4YQWA 3UCUP 2WSFC 2ZKUA 1E6VA 1DFDA 1JXEA 5F8IA 2J6UA 1RB0A 2C1EB 1RT5B 5HANA 3G4SS 3JAMU 4DV1F 1RJJA 2GQQA 2ZWOA 3MR6A 4R8UB 4YB7A 2RRBA 2CVEA 3VAJA 4ID5A 2G2YA 2FHKA 3T9NA 4A4JA 2AV5A 1YJTA 5KFCA 4HHHA 1NKBA 2B4OA 2CWKA 3AJDA 4FNHA 3OJSA 4E2FB 3VQTA 4IOCQ 1GXTA 3OXGA 4QR2A 2KJWA 5J2PA 3PYDA 1HQEA 3KHRA 3P8BB 3QFHA 1B64A 1RHJB 2KJVA 1FJCA 2CVIA 3RUBL 3IO1A 4U67Q 4M95A 4DUZF 1XMQF 2MXYA 1FVSA 3M7VA 2IYGA 2XSJA 4OYIA 3DDIA 2MSSA 3KNGA 3WIVA 1UWBA 3CD5A 2FJWA 1HFEL 3KFWX 3JSRA 1ZOTA 5ADZA 4OZ5A 4Z37A 1J5OA 2UUBF 2DRAA 1XNRF 3VGUA 2R2UA 1REVB 4IQMA 4ZN1A 3FMWA 1D8YA 3KJVA 2AJ1A 5B0DA 4XDCA 4NXMF 3ITHA 4LF7F 2QGFB 4UOHA 3VAFA 1NBEB 1RHMB 4RW8A 4V19X 2VONA 1HD0A 1RQ0A 3N6LA 2ACMA 2L9WA 1RCXB 2CJ9A 4DX8H 4QIVA 4ECYA 3PYGA 1NRKA 5GADU 1YQHA 2F8EX 2EXUA 2JLEA 1TUWA 4GO5X 2WONA 2XMKA 1F2HA 2LU1A 3V4IA 2ALZA 2I38A 1KSPA 4TQRA 2VOPA 1GMVA 4NA3A 1FJGF 2ZOFA 5CYQA 3CDBA 2AX0A 3MAAB 4IUFA 4IG0A 4DSLA 1FWLA 2ZUGA 3EX7B 2QLJB 1X9SA 1D3WA 2ZVSA 2R7RA 2N7YA 2RKIA 4DOZA 3TUZC 4B08A 2HS3A 1VQSA 1WTFA 1U2FA 3OFFA 4F04B 3WHIA 1EQ0A 1WHXA 5C24A 4MIWA 1CS4B 1RAGB 3DGVA 2DNMA 4P52A 1IJFB 4USMA 1CLFA 2XLKA 3J7Z5 3OTEA 3KK3A 1EAYC 3CWJA 2XNQA 4O3NA 5IT0A 5CD4A 3R5DA 2MGZA 4OL8A 3F41A 1LW0A 4DUYJ 4WK1A 3ILLA 4L3KA 5GMKa 4FXVA 2CKWA 2XCPA 2H5IB 4ELVA 2DKOB 2CPZA 1L3KA 4W92B 3JB9k 3ZZYA 1Y5NB 1Q78A 3B4DA 3GU0A 3PRBA 1J2VA 2R8GA 2E1AA 3CSKA 1U0HA 3KOAA 1VISA 1KQKA 4X66F 2O1PA 5KFAA 1DHMA 1RAEB 3RB3A 4EEYA 3JAMY 3IWXA 1HQ2A 3W2WB 3BH7B 2MQQA 2ZH5A 2YXLA 1RAJA 3LPYA 4IH5A 4JV2A 1T3NA 4CLFA 4ZMMA 3AB4B 1T3OA 3JTNA 2YKPA 4F2SA 1FFSB 4PABA 2CQDA 2BRKA 3DDNA 2BOAA 4ZLJA 2YNGA 1HQUA 2YWWA 2V4JA 4WU2A 3ISNC 3V2UC 1VI7A 4WCEQ 2MKCA 3WC2A 2VDIA 2D69A 4RW6A 4DI6A 1YIJS 3LWMA 1Q86T 1X0PA 2V0NA 2D3UA 5GADI 3VALA 2DHXA 4DCPB 2HNDA 2B4UA 3D6HB 1FI4A 1XERA 1JLFA 1Q8KA 2GHWA 1X4GA 3M1VA 2VPWB 2HHHJ 4OYPA 2VG7B 2RHSB 4FKYA 2DBBA 1N4LA 3D1QA 5DQIA 2LA6A 1A9NB 1ZAVA 3BBCA 4ECSA 3N5BA 3BSOA 2X1BA 4NYZA 2ERRA 3LWLA 3MEEB 1UEKA 1T9WA 2R8IA 1KQGB 3OTBA 3CJKA 1LOUA 1WHVA 3MWBA 3M6UA 2DNPA 2DGTA 3PW5A 3SQGA 3IC1A 3EVWA 1X31C 3TQ1A 3QGHA 2NLWA 2IHR1 2V67A 4CCHA 2R2RA 1YJVA 2DGOA 3HHNB 3DCAA 2W9BB 3W3SA 1R31A 3M9OB 2H51B 3TVKA 3MTKA 4LF4F 4RW7B 3IAM9 4H4KC 4WIQA 2DNOA 3FSYA 1YBUA 2COLA 1JQGA 3IXQA 4KPYA 3W2VA 1NB2A 3W5ZA 1TL4A 3DOLB 2RAQA 4DG1A 1RAFB 3HJFA 4Y65A 3FSIA 2ATCB 1R89A 1FKAF 4Q2LA 5IT9U 2WB4A 4LSLB 5KT4A 1Q4RA 3SCLE 4N5SA 3ZTQA 5D3GA 4ED1A 3H0PA 3WBZA 3TZXA 4DFPA 1I51B 3VCDA 3G6XA 1BE4A 5FIIA 2JFKA 2G9OA 1TKDA 1CJTA 3AD7C 5DG8A 1HNZJ 5HSPA 2OPQB 1Q16B 1NDCA 3L3CA 1M1GA 1RP5A 5J2MB 2JLGA 1FCAA 5T41A 1TU0B 3NGRA 4LFCJ 5F8NA 2WBRA 2LMIA 2HRUA 4Q5VA 2XYHB 5DG7A 3SFGA 3I5AA 3CJ3A 4R0JA 3PTWA 4N7TA 3EPGA 1EIYB 1FO1A 4N77A 4IFVA 4RL1A 1IKYB 5D15A 2HAFA 3IA0A 1OQ3A 4KYZA 2HHUA 2F4FA 1ULRA 4P2MA 1JJ2R 4PQUA 4USJC 4L75A 3G82B 5KFRA 5T7LB 2CRLA 3D3BJ 3FEZA 3W9IA 2J5AA 3HP6A 4EBCA 1WC3A 3M6WA 2Z30B 5HN0A 2D3OR 3K89A 1IXKA 4BBYA 2DGVA 2F5GA 2QYGA 2EFGA 1JXLA 1SH3A 4ID8A 2QA2A 4FS2A 4U96A 4XTTA 4C3MA 4EBDA 1CQNA 1X9MA 2QLBB 3R7SB 3SMZA 2H5EA 1JMTA 4GVBA 5D4PA 2HZCA 1PC5A 1MN9A 3VAGA 2DNHA 4JP8A 2RS8A 4PCQA 2ASDA 4NMLA 1VRTB 3NAHA 3BQ2A 1S76D 1RWOB 2CWXA 2ZKTA 2YKQA 2V5HG 4NCGA 1X4EA 1Y5IB 3AJ2A 1RBLA 4FYXB 3D3CJ 4ZPVR 1TAUA 4NE9C 2NZ4A 3OPKA 2WSEC 1S6QA 1EP4B 2EK6A 4S0MA 2V2QA 5A0YB 1HL6A 3M6XA 4B17A 4H4OA 1P1TA 2HHHF 4ZDNA 1JLGA 1N36F 4CI0B 2V8DA 3K58A 3M2VA 2JLFA 4NEYA 2D3O1 2YWEA 4KGVB 1CJKB 1Q7YT 4O23A 4LRFA 1Z2LA 2CNOB 3OUYA 4MYTA 3PIPQ 1WF1A 2OFHX 2UXDJ 4URGA 4I0WA 2DEIA 2YNIB 5KG0A 1YITS 2V8GA 4M5KA 4QIFA 4CLYA 2C28A 3IBCB 4JI7J 5IT9Y 4BCAA 2JDJA 3BN7A 5HJYA 2KVQE 1PCAA 1WOSA 3IBFB 4L6V3 5EDWA 2YX4A 3PKYA 1H0HB 2FY8A 1TL7B 3CVKA 4HH0A 3NEKA 5A6WA 1IBMJ 1VS3A 4CH1A 2XYGB 1RWVB 3D54A 3GYXB 5D4NA 1GXUA 4QQBA 4NPOA 2VU5A 3BO3A 2GQ2A 1JLAA 2HQ3A 3NNCA 3N9UC 4DV5J 5J2NA 1C2PA 3AD8C 4I2PB 3QJLA 1K0VA 2UUTA 2KRBA 3K0JA 2HVIA 2QX0A 4K2XA 3GYNA 2AT1B 1S6PB 2YBVA 1RKJA 2L41A 3V6DA 1JJHA 2CUYA 2YKMA 3C6TB 5DG9A 2DO4A 4W90B 1HHSA 2FZKB 1HNZF 2C3UA 3H8YA 4WTYA 5LMUJ 4KH1B 1UVMA 5EHHA 4YHHJ 1TFWA 2V9KA 4OJ3A 1RWWB 2KT5A 5LL6d 1RT6A 4AD6A 4GKJJ 4ZVHA 2B8PA 4H4KA 4B3TF 1HLWA 3H59A 3P6YC 5HL7Q 1RT1A 3N6NA 1ZM4A 3NS7B 5A2QU 1N5YB 3DRYA 1U1QA 2X7IA 3Q2SC 2D74B 4DCOB 2Z2YB 1EHWA 1C0TA 1NNDA 2QTWA 3M05A 1R6VA 5DM6Q 2PMZD 3EICA 1NHUA 3H5XA 1LWCA 1SKUB 1HW9A 4CZCA 3CJTA 1FKOB 4ZPBA 4DPOA 1VBYA 3HVWA 2E66A 2RB7A 2PFDA 1DQ9A 2JRSA 3CCZA 2DNGA 3SDEB 1TL1B 5B09A 1PG5B 4DMZA 2CZ4A 4C11A 2UUCJ 2C2ZB 1FTCA 2PEHA 4C0OC 3L9ZA 3BGUA 3F0NA 1YJRA 4M5JA 2HQCA 6FD1A 3HVAA 1H3DA 2HFVA 5CZXA 2DISA 4I6YA 1S5ZA 4F36A 1G1XA 3I31A 5KFIA 1A0OB 2GJ2A 4DX7A 3J7YU 3VAMA 3K8VA 1WDTA 1EKRA 3EZUA 3NGDA 3M2RB 4KHPF 3NBPB 1S1TB 2OMOA 1IM4A 2JC0A 3QIDA 2DYAA 3PJXA 2C3PA 1VFJA 4RW9A 2XGPA 2J6TA 4UTGA 4F26A 5LXYA 4QWBA 3QLHB 4DV3F 3GTYX 2R7UA 1L3SA 4DR5J 2V8HA 2VICA 2D7SA 1NM2A 2JSXA 3MEDB 3T5HA 2DO0A 1VK8A 3CULA 4LR9A 2RDJA 4X4PA 2HHWA 5J2QA 3W5YA 1UJ6A 2YNFA 3D0GE 3LAKA 4G1QA 1BLUA 3BYPA 3V4MA 1S49A 2BJ3A 2KKHA 2V63A 4DQIA 3HF5A 2GJFA 3OVAA 2EC0A 3CCES 4NI2A 2WVDA 4TYBA 1TV6A 2Y1IA 2DGXA 3RW6A 3ZTRA 1LWFB 1AA1B 2R8JA 2OMLA 2XEXA 2ZDOA 2XWXA 1M5HA 4C8NA 4C7QA 2NSCA 2OJ3A 1WG5A 4DPTA 1MMLA 3J81U 5F0UA 4O3QA 3PRVA 4M5HA 4PG7A 3H5SA 3LANA 9RUBA 3UDCA 1G3OA 1TMJA 1RTJA 1RAIB 1S0NA 5C2GA 1VQOS 1XN9A 3M8YA 2ALYB 4U6PA 2HIQA 3JSYA 3CD7A 3M32A 2BMBA 4PXDA 1XJWB 4ZIVA 3AY0A 3GE9A 2DNYA 2HQDA 1GMUA 4URSA 4CNYA 5E3AA 3UVJB 2LXUA 2B9EA 3Q8SB 2N4DA 5HQ8A 2F7VA 4I69A 2P5VA 4DR3J 1DZ5A 1FDBA 4IOBA 2AJ4A 2F8MA 3SSQA 1RADB 5B0FA 2AW0A 4RPFA 1M5VC 3TR5A 2HNZA 4ZJOA 1HMVB 1CSJA 1R7IA 2W8KA 3KLVA 4ZHRA 2FTRA 4Z7YA 3H4DA 2IM0A 2WVFA 2V4QA 1HWUA 5E3RA 3V81B 4ANDA 3U02A 4LFAJ 3B54A 2RILA 2IC3A 4NXNJ 3J7YI 3JTPA 3TQEA 1NAQA 3LGNA 5CAAA 2DVIA 1YHQS 4YHHF 1MU2B 2B4PA 4F0MA 4PXCA 1S7IA 4XK8C 2AEMA 3OVSA 2Y1JA 1U2CA 2XC9A 2NS1B 1HHQA 3GJRB 2HYIB 3HVTA 2MY7A 3ZTPA 1UWAA 3DOKB 1N33F 3D1OA 3MPVA 2NYIA 4FYYB 1WKLA 3TA2A 4CLTA 1SJRA 3DI6A 3POTA 2UV8G 4UZBA 2LEAA 1CVJA 2K1RB 4N76A 5IXUA 5EX0A 2JEFA 4WWSA 3A3OB 3SYZA 4IDKA 3NG8A 1TZ0A 1FE4A 3ADAC 4ECTA 2P6TA 2CQIA 1RTIA 3MAQA 3ZZTA 1TP7A 2QLXA 3M30A 3KHGA 5HVFA 2B51A 2AYMA 2DNZA 1S12A 2IAJA 3W9HA 2MPUA 1K1SA 1VRQC 1GMWD 4GVLA 2HNYA 2OI2A 1PYTA 3LP0A 1LWEB 1PSDA 4OX7A 1TELA 3OTDA 3KLFA 1NK0A 2F63A 2UVUA 5U47A 1OSDA 3R97A 2BOPA 1OO0B 4C3LA 5HBMA 3BBBA 2AJQA 1DQAA 2CPEA 3QT6A 4TLRA 2NXEA 2YWHA 3VQSA 2YX1A 3J81Y 1ZA2B 4DR5F 2R7QA 2DJWA 2J9CA 3CMQA 3BSNA 3DM2B 1WELA 1RT3B 5HROA 1FE0A 3AXMA 1RT7B 3GV8B 3OTOJ 5I42A 3KG0A 4F3QA 3N5FA 1GT8A 1U49A 2XZTB 3MPYA 3MM7B 2X51A 1ZPVA 3Q24A 5A8RB 5LSOA 1TMMA 2ZHAA 4Z7CA 2XMWA 2ZC4A 2EWHA 2E7XA 1YRTA 1YTYA 4TLQA 3EGZA 3KLIB 5D4OA 2IY5B 1ITPA 3MFHA 1OYDA 3V6HA 2MLZA 4O44B 4Y2MA 4QU7A 3O6QA 3EVMA 2W4CA 1SQGA 2HZAA 3JQMA 1MMDA 1U1KA 2NYHA 2DNRA 4F0HA 4OZNA 3IG1B 4HHUA 2AD9A 1B0PA 3C14A 2KFNA 1JLCA 2OPSA 5JUMA 3KTQA 3MEGB 2HFOA 3MCNA 1F0XA 2ILYA 2XMVA 4EFAC 1VR6A 4TXSA 3MPWA 3NGSA 3NMAA 3OL6A 1HD1A 4DSJA 1CULB 5L9XA 4OZ3A 3DLHA 4A8QA 1R0BG 5I3QA 4B9TA 2BE7D 2W7AA 4DR3F 1NSKL 1VQ5S 1VGYA 2XI3A 4PQAA 2LA4A 3HSGA 2VPZB 1K9MT 4A8OA 2J0QD 3I0SA 4QJVA 4OJ1A 2OTLS 1VBXA 4AL5A 2ZM6F 5HK4A 1RT2A 1PKUA 4ZPDA 3TZYA 3A12A 3FMBA 2V69A 2W9CB 3M8QB 2M0GB 1TK8A 4LFAF 4YY3F 3QWUA 3DU6A 1MLAA 4NXNF 2LLZA 4BC7A 3TOQA 5HMWA 3TA1A 3KLEA 3PR4A 3RAQA 3E2EA 3HSDA 5IV3A 1M5OC 3BPSP 2IM2A 2RVJA 5D0EA 1NJWA 4OHXA 1Z2ZA 4KT0C 1UVLA 1KKHA 4J9PA 2CJXB 2ZBPA 1T0TV 3NNAA 5IFMA 3R2CJ 3C15A 5HMXA 5C42B 3L7UA 1QY7A 2FJDB 4DL0C 3BH6B 5CQGA 4C2MA 1EB0A 5D0HA 1UA1A 3AA8A 5E0OA 1NH8A 2DCUB 1WOPA 1XNQF 3GB0A 1E6YB 4AXIA 3ET6B 2BW2A 3G8TA 4CT8A 1NZAA 2EKYA 3FEXB 3OTCA 1WG1A 4CO0A 3W62A 2GVDA 4CTAA 5RUBA 5EWEA 1B70B 4Q43A 4U8YA 2QMUB 2MZTA 1U25A 2HZVA 2E9TA 4ZVFA 1HI1A 1YG0A 5A8WB 2NXJA 1QJHA 3VGTA 1LEOA 3OR1B 4USUA 3SSSA 2C22A 3BKUA 3VR1A 4EK2A 3CIMA 2UUAJ 4MKYA 1KTVA 1HBNB 5HI7A 4IO9Q 4NLSA 2BM1A 3TRGA 2JC1A 2IRYA 2XTJP 4EBEA 3GFXA 1FESA 2R7OA 4W4MA 4U7CA 1G4CA 3VZIA 1RU1A 1Z1ZA 3CJRA 4LSZB 1UFKA 3QGIA 2WBMA 3D28A 4DR2J 3NOGA 3ZTOA 4TY8B 2GVZB 2UXBJ 3R2DJ 1HNVB 2B5JA 1S0VA 3BBFA 1NH7A 1S1WA 3U1LA 2JVRA 3V6JA 1RAHB 1T05A 1R8PA 3KK2B 4B9LA 2R7SA 4RZRA 4C8KA 2OIHA 2HHSA 1BWEA 3HZEA 1JNRB 3HDSA 2JWNA 3QATA 1WACA 3KDOA 5KT7A 1RSCA 1WORA 2B4VA 4CO1A 5DETA 1VQ7S 2IMWP 1HPZB 3I0RA 5ETKA 1KLMB 3HSZA 4DR6F 3KKFA 3M8ZA 4YB6A 4R8UA 3MR2A 4QW8A 1N0UA 1NK5A 3LF0A 5DO2A 5IM0B 4LUBA 2YQ3A 1AZSA 1KC8T 4GC7A 2V4RA 4KO0A 3I4PA 1S1UB 1PIEA 2XMTA 5A8KA 2RMLA 2C2EA 2MQ8A 2V34A 1JKHB 5DGBA 4ED3A 2UV8A 1BGXT 2EFQA 4AQYJ 2CADA 4W98A 4OYBA 1HNWJ 1HI0P 4CH0S 1R8AA 4CM0A 1SJFA 4F0KA 1CJUB 2XLJA 3BGRB 3JXOA 1QAYA 2BE2B 3NOCA 2VJVA 4X84A 5EN1A 1QM9A 2L08A 5ETOA 4DPWA 1REVA 4DU7A 3BGLA 1V5IB 1R0AA 2NXCA 1KHVA 4ENOA 2G4BA 3A8KA 3AA9A 3EZOA 2QZ8A 2QMWA 1R6YA 3J7AN 4X4NA 4Y28C 3K5NA 3HMJG 4K0KJ 4PXEA 3MPDA 3DLLQ 2JNJA 1F9EB 4RNMA 2FDNA 1K44A 3DRSB 4KJIA 4E98A 2CNKB 4P6QA 3MAAA 1TTHB 1DARA 3R5AA 3KXDA 1M90T 3D6FB 3GLJA 5F8HA 2QE5A 1O5JA 2AYGA 1MWZA 2RF2B 3X3UA 4I7FA 1YDLA 4HT7A 1N5VA 4D3GA 2KL8A 3TUJC 2GMJA 4J7CA 1S1VA 4OI3A 4OLOA 1VQMS 4JI5J 4I56A 4B3OB 4X4UA 4ZCKA 2VV5A 2XYPB 1PAUB 3QAUA 2FJAB 2XMMA 2O67A 1CC7A 2R7XA 3CCSS 4Q8EA 5HP1B 4ZVOB 3K5MA 3X1LB 1SIWB 3N6MA 4OX6A 4PG6A 3HT0A 4QBUA 2N7CA 1YJNS 1VCTA 3LH2S 2IBKA 2B7BB 2UUAF 3MM9A 1FNOA 4A8WA 3C6UB 2FGCA 5I4MA 4KKOB 1QVFR 4OI2A 1SV5B 4HTJA 1IBKJ 3TX8A 3ICLA 4KAIA 4LRBA 5K8PA 1VJQA 3DLKB 4ZVPB 2QO3A 2IYIA 1HKAA 2W2NP 2P8IA 4XDDA 4YB1P 3SI8A 3CB4A 3MCOA 4ATNA 3QNWB 4IYQA 2UXBF 1K8AT 3MM5A 3HHLB 3L09A 3W2WA 2XLIA 1FXDA 5AXNA 4DSFA 3TW0A 2YQ0A 1RI7A 3Q0AA 2NQPA 3T1HF 3R8YA 1M0SA 2MQLA 3KJQB 4YP3A 2JHEA 3MXHP 3Q89A 1FT8A 3BGFA 3GIIA 4DLGA 4NA1A 4D3HA 3ZZRA 1DTTB 2A1BA 2MKIA 4G1IA 2DB1A 1VOMA 2ZE2A 1RUSA 1KRPA 4FZVA 4P9SA 3W5XA 1SC4B 2IJRA 2H4YB 3NAIA 3SXLA 3UN2A 2Y8YA 5DQHA 3GCWP 2PSZA 1MWQA 2CPIA 5F3ZA 2XG8A 3NGUA 2GV1A 3MD3A 4O3PA 2VG7A 4XIUA 1XQIA 2IRUA 2NUHA 2H1YA 3OHBA 5KG1A 1GX6A 1PJ7A 3G6YA 3MOJB 2VG5B 2E1MC 3MEEA 1HNWF 1D0EA 3R5GA 4Q44A 4XO0A 5J1NA 3TANA 2HEKA 3NS5A 4JBCA 2VFRA 1IR2A 3FFIB 3DRPB 4UT4A 2IVYA 4CNZA 3PV8A 3AOAA 3C16A 4M5LA 4UF4A 1H2VZ 1URNA 1Z4UA 3BB5A 4IR9A 2W9BA 4LF1A 4RKUC 2GMHA 1TK5A 3LGMA 2C2KB 5FLXU 4FF2A 1UVJA 2VJUA 4I6AA 1TK0A 4JI0J 2PMWA 1QSYA 3VZHA 1JLBB 3P45B 1I1GA 3CCWA 2CQ0A 2Y9HA 4ZS6A 1FKPB 2AYEA 2RUGA 1F9HA 2IRXA 4K50A 1X60A 1S0MA 1PYSB 2QG9B 4HVZA 2HBZB 2W7PA 4LSLA 4JV1A 2E29A 2B43A 4C97A 4YOEA 8AT1B 2CXEA 2YNHB 4L72B 2KRRA 5J2PB 3Q23A 2XBPA 1SC1B 4FN5A 3JSMB 4HTIA 3MR3A 3OR2B 3QT5A 1Y0HA 2OPQA 1WJ9A 5L38A 3QZ7A 2QSFA 2MKHA 1S4FA 4ZVSB 1I6JA 3IRXB 5J2MA 1NHVA 4JI5F 4BWJA 2FLNA 5T14A 2XHWA 4J9SA 3U7JA 4LF6F 3GG1A 1U2RA 1FXLA 2I2YA 1G2EA 4KB7A 4JV0A 3MM8A 4LF9J 1UL3A 3HX9A 3HHLD 1WDDA 5DLGA 4YDXA 2F9DA 1ZM9A 3LW5C 3RGIA 4DDFA 4HT5A 9ATCB 3MUVP 3CF5Q 2FLOA 3ITHB 1OQ6A 1VBZA 1IKYA 3DHXA 2ZJPQ 3IWLA 3VAIA 5AXLA 2BABA 1GH8A 3Q86A 1GTEA 1IBKF 2KFYA 3MM6A 2ZHOA 3WIUA 1OY8A 2M70A 1U24A 3D7SB 3G82A 1L3TA 3C66A 2IMOA 1X5SA 3E8OA 4LR7A 3D6TB 3T5JA 1S72S 4R0EA 1SCJB 2HMIA 2WONB 4K2JA 4X64J 1S79A 3W1YC 4X65J 1Q79A 2DNLA 2IBOA 4B02A 3W65A 3B8HA 2ZBRA 3FEYB 5F3TA 4O0NA 2YH0A 3ILOA 2GW8A 2RKIB 1UVKA 1UA0A 5GAEU 2RDDA 2XO7A 1H7XA 3BYRA 3ZZUA 2FZGB 3P49B 1DTQB 2IA0A 3EXCX 4OQJA 3RG6A 2CQCA 4K4TA 2G2OA 2J0WA 1NLKL 1BY9A 1RT4B 1VRTA 1Q8LA 1U02A 1SJ4P 2FJBB 2ROPA 5F8LA 4HDHA 1VQYA 3P3DA 1RISA 4EZ6A 1S99A 2YH1A 3DLGB 1KWMA 4ILRA 4DV7J 4GKKF 3OD2A 1H73A 2C2NA 3KJNB 3R9LA 3RBZA 4CLWA 2F8HA 1EP4A 1KEKA 3GP9A 4JI3F 2J8AA 1WTBA 5A0YA 1U0HB 1KP6A 2A18A 2BRLA 2ZH7A 1XMBA 1VC6A 4MKAA 2GHPA 4PEOA 4UW2A 3MR7A 1UFLA 2KXFA 4P72A 1REGX 4WIIA 5FLXY 2VBYA 1CJKA 4DPXA 1LW2B 1KVJA 3VTIA 3T5KA 1I94J 2I1RA 3D2WA 4WPAA 2DIVA 2H48B 1RU2A 4AL6A 2BEFA 1HNXJ 5KG4A 4DR1F 3EVOA 3LP2A 1HWLA 4USTA 2R42A 2WRMA 2MLYA 4X4TA 2YNIA 2K06A 4ICLA 5I3PA 4ZITA 2UU9J 1KOOA 1OSCA 1UEUA 1SL0A 1X5OA 1WC0A 3FJ2A 3E01B 2OPPB 5L1IA 1NJYA 1C4AA 3NS6A 2W01A 4J9QA 4DV6F 2VL1A 4J5OA 3NGTA 1RTZA 4CDIA 1U6BA 4UUXA 2R4FA 3UD3P 3RB0A 2KVIA 2MY8A 2OEJA 2PO4A 1S7HA 4HEA9 3SQOP 1TL7A 4ILLA 4ED7A 3PO5A 4ER8A 4DFJA 2ZZTA 4ED2A 1ZS6A 4ZN3A 3TYTA 4USKA 4U7UK 4DU8A 3AFGA 3NRBA 2B0GA 4JI0F 2B9XA 3PHEA 3AAWB 1QTNB 1O6XA 4C9DA 4P2SA 3DGPB 5KFUA 5D8HB 4DUZJ 5BR8F 2CPHA 5F8JA 2X1FA 2FHOB 4F4YA 1NHKL 2IM3A 3U1MA 1W7WA 2OEKA 1JLFB 3MZIA 1X5PA 3SIPB 3ISZA 1YWXA 3AB2B 5HQMA 4LIWA 1NJIT 1S6PA 1WHWA 4DLEA 4Z2XA 2UUBJ 1Q5YA 2V2VA 1XNRJ 4MK9A 1T9YA 3IR7B 1IQZA 2G1HA 4WBFA 1G6BA 1WC6A 4NZ0A 3UCZP 4TNOA 4NXMJ 4OJHA 5GAEI 5K14B 4FXWA 5MLCV 3MDFA 2BJ7A 4HL9A 3R3TA 1QAIA 3WC0A 4NLXA 4Y2AA 1IUJA 5HVGA 3IAS9 5C7PA 3C46A 2EFPA 2NPFA 2ZNZA 3GFYA 3SQGB 3KLHB 5HVHA 2HS0A 3KNAA 4KPCA 2CQPA 3US5A 4LF9F 2DITA 1TL3B 4DWIA 2BX6A 3TI0A 1DURA 3R5CA 4NWBA 1IM6A 3RBDA 2MZRA 1LQ9A 2XHCA 3UW1A 1N5YA 2Q6BA 2HVZA 2VFVA 2IDEA 5MAOA 2J0SD 4PYDA 4B9MA 1FJGJ 3PDNA 1OJ4A 1VC5A 1SI9A 4J9OA 1W2BR 4EGLA 5EGYA 3MMJA 3J81j 2FD2A 5AE2A 1XC9A 2WW8A 2V94A 2BQRA 1VQNS 2APOA 2WVEA 2FLPA 5D77A 3SDEA 1Y4ZB 3SV4A 1N88A 3I5CA 2VKZG 2E9RX 3TEHB 4G3IA 1M5SA 2WVCA 2RRNA 4ZIWA 4LREA 1R8CA 2Y1RI 4WFXA 5C5JA 2HRYA 3CCTA 2LQBA 3NCRA 3HT3A 4QCLA 1N8RT 2FJXA 3ILJA 4OI0A 1R3NA 3PFEA 4M5DA 2MZ1A 3IBWA 4M5GA 1U7LA 2M7SA 3NBPA 1Y00A 2KT2A 2QN6B 5GMEA 1S1TA 3UO0A 2W24A 1OY9A 4UOGA 1EETA 2BANB 3LUYA 3Q22A 3EPIA 4F02A 4IO1A 1K73T 1HR0J 2QL9B 2W2QP 3CDEA 1VQ9S 1YSJA 2EFOA 2DD8S 2DRDA 3D4JA 1ZETA 3MEDA 1YBTA 2K7JA 2MLXA 2W7OA 2HLUA 3K7RA 4RNOA 2E44A 3IM9A 4XAKA 1EJ7L 3BF4A 3Q8YA 4WJBA 3HHDA 3VAKA 4PQUB 4HHJA 1H98A 4NYPA 1SC3B 3BZQA 3I4HX 1K0TA 4HKQA 5KFOA 3K5OA 2GCFA 1LWFA 3PM9A 1Y3JA 4OYXA 1I94F 1RACB 3M6VA 4YR2A 1HNXF
chains in the Genus database with same CATH topology
2DNYA 5KFZA 1N5QA 2BJDA 4CO3A 1JIHA 2M8DB 4URSA 1FEEA 3SCIE 3TO8A 4IQXA 2Z4PA 1IKXB 4CNYA 3DLEB 3DRRB 1RA7A 2UU9F 2X3GA 1KD1T 3HHEA 2UP1A 5E3AA 3MM6B 5KFLA 2LXUA 3QJJA 3R5BA 3Q8SB 1HBOB 4K59A 2IC3B 4ED6A 2N4DA 5GAHI 2VZ9A 3HVRA 2ROGA 5HQ8A 2F7VA 3I87A 4I69A 3G71S 2P5VA 5LMNF 2QIFA 1DZ5A 1FDBA 1N48A 2R7TA 3N28A 3ULHA 5BJRA 4LIRA 4IOBA 3ONQA 2AJ4A 2BM0A 4MAKA 4Y0FA 2HMIB 2JX2A 2F8MA 2MKJA 1ZTWA 3MMBB 2PA3A 3MCSA 1H6KX 2Q43A 3G8QA 3SSQA 2DNQA 4PG4A 4EYIB 1WF2A 4KBIA 5B0FA 3D0IE 2KM8B 4TY8A 2AW0A 5KT5A 1M5VC 3TR5A 2HNZA 5B0BA 2IA6A 4NYOA 2IJNA 3L7OA 1HMVB 1FK9B 1CSJA 3RAMA 5KAKA 3PZPA 1R7IA 5KFGA 1HNVA 3KLVA 2W8KA 4TY9A 1U1OA 4ZHRA 2FTRA 1AFIA 1IKXA 1UVNA 3H4DA 1UP1A 3DLEA 3DRRA 2IM0A 2V4QA 1HWUA 1RT5A 1FVQA 5E3RA 4ES2A 3V81B 2GJIA 3U02A 4YFUA 1F5BA 3DI6B 2IC3A 2RILA 3POTB 4P7TA 2C42A 4LQ9A 1U09A 3T9ZA 2EG1A 3J7YI 3JTPA 2G13A 3GIKA 4IKAA 1NAQA 1DJ0A 1Q53A 1RKIA 2B7CB 2JZ5A 1TUVA 3I9V9 3LGNA 5L39A 5KFMA 4F2RA 2WCXA 4GO7X 1RA6A 2F1FA 2C3YA 2DVIA 1WI8A 2HGLA 1YHQS 4YHHF 2QA4S 4X4RA 4M94A 1NEEA 3MGJA 4G1PA 5CXTA 1MU2B 2B4PA 4ZP7A 3MMBA 2FVCA 4IDKB 1Q81T 2GQCA 4PXCA 1Q82T 2UVRA 4XK8C 3DDKA 3TAQA 4WYLA 5KT2A 4E8UA 3OVSA 4KR0B 4ED8A 1HPZA 2Y1JA 1GQEA 2XC9A 1RTIB 2NS1B 5F41A 3ZC4A 2KG0A 2GX8A 2DHAA 3BR9A 1C0UB 4K4XA 2HFNA 2L9DA 2HAIA 4J37A 2HYIB 2FVSA 1WI6A 3HVTA 1HMVA 1FK9A 3M2VB 2MY7A 3ZZZA 4TYAA 5H9FJ 2KYXA 1DLOB 4PWUA 4M1KA 2Y0SD 3DOKB 3M30B 1N33F 3D1OA 3MPVA 3TA0A 1QSSA 4M8LA 4I6WA 2NYIA 1Q8IA 1U47A 2PE8A 2YVSA 3V81A 2GO8A 4HH1A 3TA2A 1KLNA 1SJRA 2PN6A 2JVOA 2J76E 3I5BA 1X8DA 3GSDA 3OUYB 3DI6A 1BQMA 1GTHA 4A46A 3H2UB 2UV8G 1PC4A 3POTA 5L9NA 3GIJA 2MSTA 1N0VC 2LEAA 1CVJA 1VIXA 2X1GA 2AU0A 2IAJB 2K1RB 5KG2A 1DRZA 4N76A 4ECUA 5IXUA 5EX0A 2MKKA 2W8LA 4DL2A 2JEFA 4ERDA 4NLDA 5IM0A 1MU2A 4WE1B 3SYZA 4IDKA 3GQCA 3NG8A 3CC2S 2HNYB 1TZ0A 1FE4A 3NMRA 4ECTA 5B0CA