3QIPB

Structure of hiv-1 reverse transcriptase in complex with an rnase h inhibitor and nevirapine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
425
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse HIV-1 reverse transcriptase p66
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 115
structure length 402
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qipB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB03
2IC3B 1RAJA 2VG5A 5KFSA 2AQ4A 4K4VA 4QWBA 1TP7A 4Q0BB 3LP0B 3CJ2A 2IC3A 4ED1A 4TXSA 4PUOB 4MH8A 4DL5A 4EBCA 4Q0BA 3LP0A 3DLKB 2ILZA 3DDKA 4PUOA 5KFLA 1RT2B 1HARA 3LP1B 4XPCA 3CJ5A 3DLKA 3MEDB 3D28A 3NKYA 4ECWA 5JXSA 1RT2A 3LP1A 3RAXA 1S49A 2AGOA 2DPIA 3I5CA 1ZTTA 3CDUA 3CDEA 3IGNA 4RW8B 2BRKA 1S1XB 1TKZB 3KLIB 2IBKA 1KLMB 1T05B 5KG1A 5KT5A 4IFVB 4RW8A 3EPGA 4HYKA 4ECUA 1S1XA 1TKZA 3KLIA 4ED6A 1T05A 4NLWA 2UVRA 4IFVA 4NRTA 4PQUB 4NLUA 4J9QA 2O5DA 2XGPA 1C0TB 2FVQA 3NMAA 3GYNA 1C0TA 5KFUA 3IRXB 3T1AA 3T19A 3KK3B 4KB7A 3IRXA 5F8IA 3QGGA 3FFIB 3KK3A 4NZ0A 4IRDA 4EYIB 3DM2B 1JLAB 1RT4B 3FFIA 4IOBA 3OLBA 4ED2A 1HMVB 3DM2A 3H59A 2F8EX 4URSA 2R2RA 1JLAA 4QW8A 1QUVA 3DRPB 1RTDA 1HMVA 3PJXA 2YNIB 2GIRA 3PJWA 5KT6A 3Q8PB 2YNIA 5KFNA 2C28A 4YQWA 1C1CA 4ZPDA 4NLQA 3KK1B 5F8HA 5C25B 2WONA 4ECSA 5C25A 2V0NA 3IN5A 3T5JA 2FLNA 4NLTA 3FRZA 1FKOA 1S1TB 2RDJA 4ED0A 4JV2A 1TKTA 3OL8A 2HWIA 1S1TA 2BE2B 1K1SA 2D41A 1ZETA 4IR9A 3MECB 2J6SA 4FBUA 4OL8A 2BE2A 2HWHA 4F4ZA 3MECA 4B3OB 4ZP7A 5KFYA 4O4GB 5KG6A 4B3OA 2RF2B 3DLGB 1OS5A 4LQ9A 2AU0A 3G6VA 4O4GA 3SI8A 2RF2A 3DLGA 3EZUA 2R2TA 4JV1A 3V4IB 5KG5A 3T5HA 3GQCA 3G6YA 5EWEA 3TAMB 3V4IA 3PZPA 5FDLA 3GIIA 2VA3A 4MK8A 1S10A 3ICLA 2OPPB 4FBTA 3RBDA 2E9ZA 4PWDB 2IJNA 2OPPA 4ZP9A 3G6XA 4ECRA 2C2DA 3PW4A 1S9EA 4PWDA 5D3GB 2GIQA 4DL4A 4O3PA 4TYAA 4YMEA 2ASLA 4JUZA 2JEJA 3DI6B 3LALA 4XO0A 4WZQA 1HQEB 2OPRA 3DI6A 2JEIA 2FVPA 4ICLB 3HVWA 2XCAA 3KMSA 1Z4UA 5KFCA 2ALZA 1QAIA 3MEEB 4ICLA 2FJXA 2R8JA 2ZKUA 4NCGA 4NLXA 1RT3B 3MEEA 1J5OB 3PR4A 2FLLA 3E01A 3NBPB 1RT3A 1RDRA 1J5OA 3OL7A 4MFBB 1RT5A 5KFFA 3QZ8A 5KFJA 3M9MB 3GV8B 4MFBA 1RYSA 4J9MA 5KFMA 1W25A 3V6KA 5J1EB 4RZRA 3GV5B 2IAJB 5J2QA 3OHBA 5J1EA 3QYYA 3MF5A 2EC0A 4TN2A 1RTIB 2IAJA 3NAHA 1TV6B 1RTIA 5CYMB 3OSPA 1TV6A 1LWEB 3KNAA 2RDIA 5KFEA 5DG9A 3OL9A 4RW6B 4IRKA 1ZTWA 2WB4A 3RBEA 3DRRB 1LWEA 3UPFA 4X2BA 1UWBB 5HROB 1RT1B 2D3UA 3DRRA 4O4RA 2JEFA 1UWBA 4K4SA 5DQHA 5HROA 1BQMB 1RT1A 2W9AA 4EEYA 3BSCA 1JXLA 1QE1B 1BQMA 4GC7A 1QE1A 4F4WA 4K4ZA 2OPSA 3H5XA 4ECQA 3LANA 3JSMB 3MEGB 4KKOB 4XPEA 1RT7B 2YKMB 3JSMA 1U09A 3MEGA 4KKOA 2FJVA 2XGQA 2IM1A 1RT7A 2YKMA 4EBDA 4NLGA 3H2LA 4O3QA 2W9BB 5JUMA 4KAIA 2WRMA 3UQSA 2WOMB 5HBMB 2CKWA 4K4XA 5F8GA 3KLVA 4H4MB 3LAMA 2WOMA 5HBMA 2D3ZA 4R8UB 2FLPA 2OH2A 4H4MA 4R8UA 3GIMA 5KFHA 2D7SA 3NGDA 1XR6A 3MEDA 5C24B 4ECTA 4ZP6A 5F8MA 5C24A 4WFYA 4RNHA 1SH3A 3NL0A 4IG0B 3KHGA 4TLRA 3KK2B 1KHWA 1KLMA 3RB4A 1RT6B 4IG0A 2HAIA 3CIZA 3KK2A 3JYTB 4RNOA 1RT6A 4IH7A 2ILYA 4PQUA 3JYTA 4KHRA 4TY8B 1RTJB 4Q43A 1S1UB 2W8LA 1RTJA 1S1UA 1CSJA 4K4TA 2BQ3A 4RU9A 4O3SA 1EP4B 2DPJA 3RAQA 1T03B 1EP4A 1RT4A 3T5KA 2XC9A 4NLPA 5C5JA 1T03A 1JX4A 1S0OA 4EO6A 3DRPA 1S4FA 3BSAA 4I7FB 2R2SA 2UVUA 4IRCA 4I7FA 2R8HA 3CO9A 3PW5A 3PR5B 4ED8A 2OPQB 1LWFB 2VG7B 5KFQA 4O44B 3N6LA 3KK1A 1MMLA 4ID5B 4DG1B 2QV6A 2OPQA 1LWFA 2VG7A 4NLYA 4O44A 2FJWA 5HP1B 4NLRA 4DG1A 4ID5A 5KG2A 1C0UB 4MIBA 5HP1A 3KOAA 1IKYB 1C0UA 3IS9B 1FKPB 4NYZA 2ASDA 1DTQB 3CDWA 1IKYA 3IS9A 5KFZA 3G86A 1DTQA 5KFIA 4MIAA 4ZHRB 1NHUA 3IGVA 2BRLA 4QWEA 3BQ1A 1NNDA 1RTHB 2JC1A 4ZHRA 2YNGB 2ZE2B 1S48A 5L9XA 4KV8B 3KLHB 1RTHA 3MFIA 2ZE2A 3N6NA 2J6UA 4KV8A 3KLHA 1LWCB 1YVFA 5J2NB 4U6PA 1LWCA 3HVTB 3TAMA 5J2NA 4G1QB 3HVTA 4ZPBA 1LW2B 3MR3A 4G1QA 2R8IA 1TL3B 1LW2A 5J2MB 3H5SA 4WFZA 1S1VB 1XR5A 3FQLA 4LSLB 5D3GA 4ZVGA 5KFOA 3I5AA 3M8PB 5J2MA 2ATLA 1S1VA 4KSEB 4Y2CA 3H98A 3GIJA 4LSLA 4JV0A 4K4YA 1I6JA 4F4XA 3M8PA 3QZ7A 4J9LA 4GC6A 5KFAA 1HQEA 4NLVA 3VQSA 1TKXB 3QLHB 4LSNB 3QIDA 4QW9A 3KHRA 2WK4A 4R0EA 1TKXA 3QLHA 4LSNA 2IM3A 5DLGA 1N6QB 3NBPA 1N6QA 4EYHB 5KFWA 5DQIA 2FVRA 4J9KA 3PVXA 4NLOA 1TL1B 5C42B 1HYSB 3UDLA 3GV7B 1TL1A 3I0SB 4URQU 1K1QA 3BR9A 1JKHB 3V81B 3DLEB 3I0SA 4QWDA 2ASJA 1JKHA 3V81A 4Q45A 3DLEA 1D0EA 2YNFB 5CYMA 5KT7A 5KFVA 2YNFA 1DLOB 4RW6A 4IDKB 1DLOA 4WYWA 1C1BB 4IDKA 3IG1B 4MKBA 3OSNA 4MKAA 1C1BA 1EETB 1VRUB 3IG1A 2HNYB 3V6JA 1EETA 1VRUA 4KFBB 2HNYA 4ECZA 4ED7A 4IH5A 4KFBA 1JLFB 3BQ0A 5F8NA 4Q8EA 4G3IA 3DOKB 5HLFB 3I5BA 3PW7A 1JLFA 2R8KA 3N6MA 1S6PB 3DOKA 4R5PB 5HLFA 3CWJA 4O3OA 1GX5A 4NRUA 1S6PA 1HNIB 2XWYA 4R5PA 5KT4A 3KHLA 2UUWA 4LQ3A 2W9BA 2HNZB 3ITHB 3H4BA 4K50A 3RB0A 5KFGA 2HNZA 3ITHA 1JLCB 5KFTA 3M8QB 1JLCA 2JLEA 3QO9B 1JLGB 3ISNC 3Q8SB 1VRTB 4K4WA 3M8QA 3QO9A 4ED3A 1JLGA 4EBEA 1VRTA 5KFBA 3OLAA 3RB6A 4I2QB 2WTFA 4URGA 1SH0A 1RA7A 4I2QA 1JLQB 2BQUA 3ISND 5L1KA 3KLFB 2WCXA 3TVKA 3M9NB 1JIHA 2UVVA 1JLQA 1S9GB 4Y3CA 4RW9B 4ZMMA 3KLFA 1N5YB 2RKIB 2AX1A 1S9GA 4RW9A 2FVCA 4IFYB 1N5YA 4RUAA 3T5LA 2RKIA 3OL6A 1N4LA 5KG7A 5L1JA 5KG4A 4IFYA 4WXWA 4RNMA 4ECYA 4IR1A 4TY8A 2JC0A 3EPIA 5J2PB 1SV5B 5KT2A 3D5MA 5J2PA 1SV5A 5KFDA 2HNDB 1DTTB 1T94A 4Y34A 3DMJB 4J9OA 2QE5A 3MR2A 2HNDA 1DTTA 5I42B 3C6UB 3UR0A 3HKWA 3DMJA 5EWGA 1BQNB 4J9SA 5I42A 4ECVA 3C6UA 2IJFA 4DL2A 5DGAA 1BQNA 5F9NA 3QGIA 1TQLA 4ZP8A 5KFKA 4I2PB 2W9CB 4J9PA 4I2PA 3Q8RB 1S1WB 2W9CA 2FVSA 3SFUA 2IM2A 4NLDA 1N56A 3H4DA 1S1WA 3BQ2A 4WXOA 5EUHA 1FK9B 5KFRA 3CJ0A 5T14A 1FK9A 4RW4B 4QWAA 1RTDB 1FKPA 4IG3B 2CJQA 4RW4A 4ECXA 4IG3A 1S0MA 4F50A 2YNHB 3H40A 1T3NA 3H5UA 5L1LA 2J6TA 1C1CB 1IKWB 2YNHA 4O3RA 2BANB 4ZPCA 1XR7A 1S97A 2W8KA 1C2PA 1IKWA 2WONB 2YNGA 4U7CA 2BANA 2R2UA 5KFPA 3V6HA 4MK7A 1FKOB 1HNVB 2E9TA 1TKTB 2VG6B 1HNVA 4WFXA 3TQ1A 3SFGA 2GC8A 1S9FA 3V6DB 2VG6A 2UUTA 1HQUB 2JEGA 4KE5A 1JLBB 3V6DA 3KJVB 1HQUA 2I5JB 4KO0B 3BREA 1TL3A 2W7OA 3RB3A 1JLBA 3KLGB 5KG0A 2IMWP 3KJVA 5L1IA 4F4YA 1LW0B 2I5JA 4KO0A 1RA6A 3KLGA 4YR3A 5DG7A 1LW0A 2AX0A 4YR2A 2AGPA 2BR0A 4Y2AA 2W7PA 2AWZA 4RW7B 1IKXB 3DYAB 3GILA 1S6QB 3DOLB 4ZVHA 3MR5A 5FDLB 3I0RB 4RW7A 4TQRA 4NLSA 1IKXA 3DYAA 4WYLA 4RNNA 1S6QA 3DOLA 3OHAA 1KHVA 4DL7A 3I0RA 3BSOA 1IKVB 1SUQB 1D1UA 3H5YA 5KFXA 1S9EB 4ZPAA 3MFHA 1IKVA 1SUQA 1N48A 1JLEB 3Q8QB 2E9RX 2V4RA 4KBIA 1JLEA 3BGRB 4DEZA 2OPRB 4DL6A 2R8GA 5C42A 1HYSA 3KHHA 3BGRA 2C2EA 3LAKA 3C6TB 5EWFA 4QWCA 2XCPA 5CYQB 3HHKA 2XI2A 1MU2B 4NCGB 3C6TA 1SH2A 4M94A 3MR6A 2WHOA 5F8LA 5CYQA 4Q44A 3E01B 2IA6A 4WZMA 1MU2A 1WNEA 3M9OB 1RT5B 5KG3A 4MK9A 3QGHA 1R0AB 1NHVA 4QPXA 4EO8A 4DL3A 1R0AA 1IM4A 4RNFA 2I1RA 4O3NA 4RUCA 3GIKA 5J2QB 4IKAA 3PHEA 2ZD1B 4HKQA 4WE1B 3PW0A 2ZD1A 4WE1A 3LP2B 5K14B 3NAIA 4H4OB 4YR0A 3CVKA 4IH6A 3LP2A 3FSIA 5K14A 4ZVEA 5DG8A 2V4QA 3FDSA 2YKNB 4K4UA 4H4OA 5KT3A 1TVRB 5F8JA 4FS2A 3KLEB 2AGQA 1S0NA 2YKNA 3HVAA 1HNIA 4J9NA 1TVRA 2C22A 3KLEA 4H54A 2HMIB 2B43A 4Q8FA 1QAJA 2B5JB 3QIPB 1GX6A 2HMIA 3CJ3A 2C2RA 2B5JA 3QIPA 2OPSB 3BJYA 2B6AB 4IQXA 2XI3A 2V9WA 4M95A 2VA2A 5DLFA 3PW2A 3FQKA 1HPZB 3KMQA 2B6AA 5F9LA 3MTKA 3BSNA 3DRSB 4TY9A 1HPZA 5DQGA 3CJ4A 5EDWA 2BQRA 1REVB 5DGBA 3DRSA 4KHMA 5I3UB 4TYBA 4TQSA 1REVA 1RYRA 5I3UA 2UVWA 4ZVFA 4J9RA 3E51A 4FS1A 4YP3A 2VG5B 2IM0A
chains in the Genus database with same CATH superfamily
3Q8VA 2GJ2A 1NZAA 3L4BC 1RT2B 1O5JA 2QL5B 4Z7CA 2ATCB 3WQPA 2W4CA 3MAHA 1S1XA 1C0TB 5ETKA 3IRXB 3T1AA 1RSCA 1U0HA 3FFIB 4U7UD 1RT4B 3D0GE 4OHVA 3DRPB 1TELA 3I4PA 3PX6A 2MQNA 2VB6A 3NG8A 3T5JA 2FZGB 3OL8A 2NXEA 2ZC3A 2YVSA 1XMBA 3C3LA 4JV1A 3UN5A 1Q79A 5B0BA 3ILOA 4P71A 4KHPF 1UW4A 3GR1A 3MOZA 2IVYA 3FZ2A 2BOPA 1U8WA 2JEJA 3C19A 3TQEA 2XZTB 2W1BA 2I8EA 3MM9A 4F02A 1RBLA 3A8IA 4PG7A 3FMBA 1BQXA 4DPUA 4MFBB 3D4JA 2WVFA 2X1AA 3SDEB 3B4DA 3KDOA 1Q8IA 2GVZA 2XMKA 5D0RA 2V2KA 4X62J 1RT1A 5GADU 3UWTA 3M05A 3K8VA 1BQMA 3TRGA 3CE8A 3MM6B 4NI2A 3WIVA 2D69A 1IJEB 4NXMF 3TVYA 4OJGA 2CKWA 1KQGB 2D3ZA 4R8UB 5A8RB 4JI6F 3JAMY 2D7SA 1U1NA 1RADB 3WX4A 2FPHX 2HVEA 5D0GA 3PYEA 2XY6A 2VPZB 5LMNJ 3K57A 4B3RJ 2IVFB 4CLZA 2IBOA 1R7IA 4DV6F 1FX4A 4WU3A 1F0XA 4JI3F 2XZDB 2VZ9A 3CO9A 1XJWB 2RRAA 2ZWPA 1LXNA 4C3MA 2XY5A 1IKYA 2OSRA 1DTQA 2HFUA 2WW4A 2P9CA 5F0UA 2KHDA 4ZHRA 2MHNA 2DXDA 3SV4A 1TK0A 3HKZD 2RS8A 3GG0A 1SKUB 1U6ZA 1SQFA 1FJCA 5LSLA 2LP4A 3K5LA 2K1RA 5ETMA 4DR7F 1U47A 1FWKA 4J9KA 3BYRA 4G1IA 3ET6B 3NLCA 2YPZA 1VRUB 4QR2A 4LRAA 2LYVA 4FN5A 3BQ0A 4LRBA 3CJTA 4R5PB 4HDHA 1NSKL 4J90A 2VBWA 1JLCA 3QNWB 4C3LA 4C8LA 1SH0A 3MMCB 3KLFB 3R5BA 4RUAA 4X65J 4IR1A 2CWKA 4ETXA 4USKA 2CQ2A 2QO3A 5HMXA 2AMCB 4CO3A 4Y34A 2QE5A 3GONA 1DTTA 4UOFA 3LGMA 1T7PA 3Q8UA 1B0PA 2RNEA 4DBQA 1N56A 4DV2F 1WDTA 4RW4B 2DH7A 1MROB 3PKMA 4DV1F 3H40A 4O3RA 2AKWB 4NPOA 2E1CA 3V6HA 5A2QU 4ELUA 1UAWA 2VPWB 2GC8A 3V6DB 2F9JA 1HQUB 2HHTA 1JLBB 2JLFA 2DCUB 1CQNA 2AX0A 2M8HA 3D67A 2AWZA 1AT1B 2RE1A 2EFQA 4NLSA 3VV2B 2E5LJ 5K8NA 3J7YI 2EKNA 1D1UA 3EDRB 3H5YA 3EVMA 5A6WA 3PX0A 3QJJA 2PD1A 1PC5A 4ZCLA 2XNRA 1FJGF 4ZDNA 4LBPA 3PHEA 4YS2A 3ILJA 4P2SA 3QATA 5EX3A 2GS8A 5CZVA 1N0UA 3KLEA 4H54A 4X4TA 2HMIB 4JI1J 4HT7A 5GMEA 5FIIA 1IQZA 2CDRB 3I56S 3FQKA 1SJ3P 3BSNA 1VC6A 3GSDA 5IT9Y 5I3UB 4TQSA 1U2RA 1REVA 4I4BA 4P2FA 2VG5B 4IO9Q 2DK2A 4Q0BB 1X4BA 1R8PA 2B56A 2RHSB 4DCOB 3C46A 3FCVA 1JK9B 3VVUA 3Q2TC 5DZ6A 1WOOA 2AGOA 3IGNA 1NPPA 5KT5A 1VQPS 4NRTA 3DGPB 2MGZA 3UD4P 4B3SJ 3T19A 1JNZB 1O51A 4C0HA 3D0HE 4P6QA 3G8SA 2EW9A 1GH8A 3W63A 4ZJLA 5KT6A 2L08A 2W25A 2X3DA 2YQ1A 2WONA 1N36J 3IN5A 4OYPA 3BS9A 3DLJA 2WSFC 4B3OA 1YI2S 4CCHA 3SI8A 4DR3J 1F2GA 1WI8A 3RBDA 4C98A 4PWDA 2DKOB 2Y8WA 1PYOB 1VYAA 7FDRA 4AL5A 2Q66A 1EZZB 2YWEA 4BC9A 1RDRA 1J5OA 2EXUA 4DR2F 4F4AA 3R5DA 3KXDA 1F6TA 4YFUA 4FVCA 2EC0A 4KH1B 1RTIA 2VD3A 2XMJA 2JEFA 4K4SA 4Y2IA 1NUEA 2VFSA 2XMMA 3BKUA 4GC7A 4K0KJ 4IQMA 1Q8BA 1V5VA 2MQ8A 1UJ5A 1RQ0A 4F0MA 4EBDA 4A8SA 2B9EA 2LEAA 5HBMB 4K4XA 2RILA 2QEXS 4QIVA 3HZEA 3Q22A 5KFHA 4RUHA 1NSPA 2DHAA 4WFYA 3LUYA 4DDFA 3W7BA 4IG0B 4PZVA 5CQGA 2XZWA 4YHHF 1WC5A 1BY9A 5I4MA 2J5AA 2HG4A 1U6BA 4E0DA 1T03A 1YJUA 4EO6A 3SCJE 4F0HA 2DGVA 5D77A 3TZYA 2GQQA 4OX9J 3KK1A 4ID5B 4HH0A 4ER8A 4DG1A 1NEEA 4F2RA 1C0UA 2ASDA 3MM7A 2MKKA 3RW7A 1CLFA 1DQAA 3WC0A 2YNGB 3SIPB 4U6PA 3PV8A 3W62A 3PM9A 3PYGA 4WP8A 2RRNA 1XR5A 2V2QA 3M8PB 3GIJA 4K4YA 5KOXA 3ZZYA 2WK4A 1Y11A 4LSNA 3E3XA 2N4CA 1BGXT 1L5UA 3TZWA 5KFWA 2HVDA 1TL1B 4V19J 4URQU 2EPIA 3RR8A 4B9TA 1JKHA 3HT3A 5ETQA 3W60A 3PKYA 1C1BA 3SSSA 1MSWD 4ES1A 2OI2A 4QIFA 2UU9F 3N6MA 5LMUF 3OR2A 1N0VC 3GFYA 2HNZA 4C6AA 1KOOA 4X4PA 2MSTA 2R7RA 2XBPA 2BJEA 2KZZA 4C4WA 3IBFB 1JLQA 1N5YB 1N33F 2DR6A 4F25A 3OL6A 2DNRA 3KFWX 2DNZA 2C2MB 2YWKA 2G0IA 3D5MA 3F44A 1FE0A 2HNDB 4RPFA 3ZZRA 2JVRA 3UR0A 2P6TA 2E7XA 2GVDB 3FBBA 1QSYA 4I2PB 1RHMB 4ZVSB 4WXOA 5E3QA 5GAGU 3PACA 2O66A 1WKLA 1R6YA 5E3RA 3OUYA 1IKWB 3GFXA 2APOA 2PIIA 9ATCB 1LQ9A 2M7SA 3D7SB 4OJHA 3SFGA 3OR1B 4TNOA 2OAUA 1WF2A 4F4YA 5L1IA 3HFZB 3KG0A 3CGIA 3B6BA 3F73A 4RX6A 1QLNA 1IKVB 1IBMF 1EX8A 1YJTA 3RW6A 1TL7A 2LA4A 3F41A 1FTRA 3OXGA 4LF5J 5CYQA 2CVIA 2CQIA 1R0AB 4G1PA 1XNRF 4U96A 1FO1A 2O67A 4RUCA 1JJ4A 4ZVPB 1F9EB 1KLNA 3NAIA 1U1QA 4FNIA 2JH3A 1SJ1A 4Q8FA 4FYVB 2H65B 2B6AA 3GJSB 4CLWA 4CTAB 3MPVA 5KAKA 1QY7A 1TP7A 5AE3A 2ILZA 3OTOF 1NH7A 2OFGX 1WHVA 3UVJB 3E2EA 1HNZJ 3TNVA 3HP6A 4RU2A 4RW8A 3ZZTA 4ELVA 1VOMA 2VPXB 3FBEA 4LR9A 3M30A 5F8IA 1FHTA 3G8TA 4AE5A 2YNIA 4YQWA 4CO2A 4NLQA 1OYDA 4CYUB 1FEEA 5C25A 4YEAA 3G87A 2MKCA 3QQCD 2AU0A 3S8SA 3PX4A 2MMYA 3EZUA 2WAQD 2DIVA 1EKSA 3TAMB 4U8YA 1VR6A 1Y10A 3HHLC 3G6XA 4X4QA 1HBUB 3EZOA 4XAKA 5KFCA 4ICLA 2LECA 1RU1A 4R0JA 1RABB 5KFFA 2XMVA 1AFIA 2LVWA 1KVIA 4HT5A 5KFEA 2WB4A 1Y4ZB 1Y9OA 2MHEA 3PYFA 4K4ZA 2Z30B 3LPYA 2OPSA 4HACA 5K5MA 3CJKA 1HI8A 2IDLA 2R7VA 4KGXB 1RT7B 3MEGA 5F3ZA 1N34F 3H2LA 2V50A 5F41A 2WOMA 3Q0AA 1H7WA 2V8PA 3NGDA 5C24B 2QGFB 3M2UA 4J7CA 1CJVA 2F3JA 3ZTSA 4ZVRB 4CO1A 5EGYA 1L3VA 1RWPB 4KHRA 1RTJA 4IUFA 4C7QA 1CSJA 2WVBA 2BQ3A 1CS4A 1RT4A 2XC9A 4B9LA 3DRPA 2BM1A 4NZ7A 4ETZA 3PW5A 5LXRA 4F7VA 4DSIA 2UUBJ 5FLXU 2CG8A 4GO7X 3HSZA 1K8AT 3IS9B 2V69A 2UXDJ 2LQ8A 4KV8B 2FC8A 2YY3A 4AL6A 1TMMA 2GGPA 3BKTA 3UN2A 2Z56B 4WFZA 4QR1A 4LSLA 2B9YA 3HSJA 5M2PA 3U7JA 1R27B 2G0CA 2Z2ZA 2RU3A 3QLHB 2QFIA 4HLBA 1N6QB 4Q2MA 3W2VB 4JI5F 1VRQC 3IR7B 1Y5NB 1JXVA 2I0XA 2B4VA 4B3MF 3H42A 1CC8A 1DLOB 3HD1A 2W2MP 1YWXA 1ACMB 2XHCA 2KFNA 4Q8EA 4AXJA 2OIHA 3CXCR 1SB6A 3AB4B 4K8RA 2KDOA 3BDPA 1U25A 4KHPJ 4K4WA 2DBBA 3L95X 4ED3A 5J1PA 1VRTA 2HFNA 4EK2A 4CIOA 4OX8A 4URGA 2GMLA 4I2QA 2BQUA 3SSQA 2POKA 1F5CA 2F63A 3O8WA 3FC9A 2JC0A 5EHHA 1AUDA 2AW0A 3MPYA 1UKUA 4DSLA 3C6UA 2DJWA 2CPJA 3T1YF 2CPDA 3MMBA 1GMWA 2OEJA 2RB7A 3HHLA 1PAUB 3BQ2A 3RG6A 3SXLA 2L3MA 4ECXA 1F3FA 4ATNA 1S0MA 2RHQB 1C1CB 1SBRA 2B4UA 2CYYA 1XR7A 1KD1T 3MTJA 2EK6A 2K7JA 3QT8A 2UUTA 2JEGA 4JI6J 2UVVA 1Q7YT 4OV6A 2AGPA 2XM3A 4TQRA 3OHAA 4OZ0A 3R7BB 3BB5A 4KBIA 2VBXA 2R8GA 4DV6J 4RUBA 2C2EA 2XCPA 4JI3J 2PEHA 2XYGB 2Y3YA 2LXFA 1UFLA 2ZWOA 2X1BA 4ILMA 2OHDA 2BJ8A 3DHXA 5BXIA 2YQ3A 3CD5A 2EFVA 3CVKA 3FDSA 4C8MA 3T6JA 4ANEA 1HR0F 4DL0C 2GHPA 2C3PA 4W92B 1S57A 2OO4A 2FY1A 1RAJA 4HDGA 3CJ2A 2A1BA 4PUOB 2N4DA 3LP0A 4GMKA 4A48A 4L6V3 2JRSA 4DR7J 2V34A 4ZLNA 2ZOMA 2Q3PA 2XY7A 2HFVA 1DBDA 3ZZUA 4Y2KA 3QJLA 2J0XA 3JAMU 1N5SA 4ZPTR 2BJ1A 4ED2A 1JLAB 2M70A 3M2RB 2KM8C 2AF6A 1NAQA 3UDCA 2GQ2A 4DSFA 1B3TA 3HX9A 4UW2A 4ZPDA 4DQSA 2DGWA 1FRLA 4I1TA 4JV2A 2DHXA 4B3TJ 2J6SA 3GR0A 2BM0A 2Q6CA 3NGTA 1RWUA 2JFKA 2RF2A 4NCAA 1URNA 2R2TA 3BDEA 2DY9A 1NK5A 3T5HA 2D9OA 4RBVA 1X4EA 1VQNS 1YK9A 3PZPA 4FKXA 4F2SA 3A3PB 2E9ZA 3D1OA 2HVHA 4ECRA 2AEJA 2Y1LB 2C3OA 2GIQA 4JUZA 3C8YA 1Q7LB 4NLXA 4I69A 5HQMA 2VUGA 2LU1A 5J1EA 4TN2A 4PCQA 3MDFA 1X9SA 3TEHB 1KVKA 2C1EB 2N7CA 3DRRA 1VHIA 2OUGA 1X0PA 1LKZA 2F4VF 4C9DA 3MMAB 4I6WA 1U09A 2FC9A 1W26A 2YKMA 2W9BB 5ETRA 2XMUA 1U1PA 1ULRA 1T9XA 3PRBA 1Y5LB 1XR6A 5F8MA 1V5IB 2UV8G 4DV7F 3JYTA 2CPIA 3JQMA 2CQ3A 4K4TA 1EP4B 2CQ4A 2QMXA 1Q8LA 3RAQA 1OSCA 1S0OA 1NDPA 4HR2A 1S4FA 4FVMA 3VF0B 1I51B 3NCPA 4C8OA 1K0TA 5HP1A 2M4MA 2VBZA 1XERA 3THPA 3HK2A 4F26A 2ZE2B 3M32A 3EDQB 5HMYA 2FHJD 2YH0A 2YWHA 2JFDA 3MR3A 4FF4A 1VQ8S 2L9DA 1LW2A 4Y2CA 3H98A 4PEOA 1YITS 1UVLA 3TUZC 1CJTB 4K59A 5A8KA 1U1RA 2H5JB 2GQCA 1K1QA 2W2OP 3UO0A 4E8UA 1X7VA 3AAWB 4IDKB 1RWMB 2FLOA 3MPWA 4TVAB 4Y6IA 1EETA 4OI1A 2HNYA 4X66J 4NA2A 4G3IA 1RBOB 2DYAA 1Y5IB 3HF5A 4UQGA 2CDQA 1TTHB 2CG4A 1HNIB 1RB0A 3BR8A 1EHWA 4USHA 4DR6J 3JSBA 1JLGB 3ISNC 2QLXA 3ZTRA 4HHJA 3AJ1A 4JI2J 3NCRA 4ZCKA 4V1Ak 4ES2A 2QA2A 4OZ2A 4DCPB 2H3EB 2P9EA 4WXWA 1U1KA 1MWYA 1VQKS 2MQMA 4DR2J 1T9VA 1F2HA 1HWKA 1FJ7A 4U8VA 4JYAF 1NJZA 2ZUGA 2BMBA 4PG5A 1XEZA 1RHQB 3CCSS 1YBTA 4LT6A 5LJ5Y 2RQMA 4H4KA 1ZBTA 3N28A 3VGUA 5IZHA 1FRMA 5L8RC 2YNGA 2BANA 2E9TA 4LIWA 1C4AA 5MLCV 1HKAA 4E2FB 2XTJP 3MHYA 2I5JB 3WX8A 2X1GA 5E33A 2LEPA 4M5DB 2J0QD 1ZAVA 1B99A 3SEOA 5KFXA 4USTA 1SUQA 3Q8QB 1H2UX 1KTVA 3C6TB 1NKCA 2XI2A 5A8WA 1SH2A 2HRTA 3IRWP 3M9OB 1RK8A 5IQQA 4RNFA 5E7OB 2GO9A 2YX4A 3THVA 3UCZP 2EFOA 2P9GA 2NSBA 1TVRB 3GLJA 2B43A 1D9FA 4N7TA 2HHPA 1KFDA 5DLFA 3PW2A 4FYDA 3G4SS 1HPZA 2RS2A 4UZCA 4ZVFA 4LF9J 3ZZPA 1F60B 2H9ZA 3TR5A 1SIZA 1ZAWA 4L72B 3DLKB 4Z7YA 3CJ5A 2VODA 3I6PA 2CVEA 1S49A 3MCMA 2DPIA 1U48A 4KJIA 2CJYB 1TKZA 1UZDA 2CIMA 4U67Q 3NMAA 3D54A 3NS7B 3KK3A 1FRKA 2FJBB 3OLBA 4QW8A 3GIRA 1SL1A 5LMUJ 2CQGA 2XYHB 3DCAA 2B8QA 4QU6A 1P1TA 2VOPA 1IBLJ 4OL8A 4DR1J 3EYZA 1GFWB 2HHHF 3ONQA 1RWXB 4KGVB 4P73A 4GO5X 1I94F 3ILLA 4LRDA 2E44A 2MZ1A 2IRXA 3ZFVA 3RJMB 3I82A 1KRPA 2KN4A 2RUGA 3R5GA 4NOHA 3C15B 4NMXA 1FF2A 4TU9A 3OL7A 4DWIA 4J9MA 3DRYA 1S77D 3D6TB 4N56A 2GAGC 1KQKA 5THWA 3D6HB 2QLFB 3LGNA 2N82B 4L76A 3OSPA 4CLSA 1LWEB 4OZ3A 5GVQA 4X2BA 1VDHA 2QZ8A 2DCLA 3BSCA 3RBXA 2B0GA 2DIUA 3JSMA 3BKFA 4KKOA 4CTAA 1GTHA 5F8GA 1U4BA 4X64F 4PG6A 5F0WA 3J7YU 3OT9A 1R8AA 1NK7A 9RUBA 3KHGA 1MN7A 2HAIA 3W8GA 4RNOA 2OTJS 2NREA 1YJVA 1Z2ZA 1H74A 1HW8A 1TU0B 5H9FK 4I7FA 1YRUA 3GCXP 2QLWA 5HVGA 1R6VA 1FNMA 1HHQA 2BUNA 4A8QA 4MIBA 1DQ9A 3ENQA 1GXTA 3P6YC 3KDNA 3G86A 3QSYB 1YJNS 3VZHA 1NHUA 1Q95G 3IGVA 3ZZ0A 3AA8A 3TAMA 5J2NA 2VV5A 1R8HA 5IV3A 1DY3A 3OTOJ 2ATLA 2ZZTA 4KSEB 1WOSA 5G4DA 3CCRS 2R7QA 3C16A 2DNKA 4LF2A 4JV5J 1B4SA 2HHWA 3JQKA 3OTCA 5K8PA 4LF6F 5DQIA 2U2FA 2DNHA 3J7Z5 3UDLA 3FVYA 4USWA 3CT9A 4WKYA 1IBCB 4DLGA 4A8WA 2YNFA 4DX6A 4ZKAA 1CJUA 3AXKA 5KOWA 1PO6A 4GKJJ 3VALA 2KJWA 1SJQA 3RUBL 3OVAA 1B0TA 4IYQA 1S6PA 4XTTA 4ANDA 2ZHBA 1SC1B 3GSIA 4Y28C 4KYZA 2WCXA 3M9NB 3H2UB 1S9GB 4CP5A 1VQSA 2RKIA 2FIUA 1N4LA 5KG7A 3Q89A 2A2DA 4MT1A 1T94A 4OI3A 5ETOA 4WFBQ 2PMWA 4NX9A 2IJFA 5DGAA 3FCWA 1TQLA 4EU0A 3ZZOA 1S1WB 2FVSA 4WKRA 5IS2A 1Y00A 3K5PA 2RVJA 2K2PA 4QWAA 2ZJQQ 4V19X 1ZOTA 1ITPA 1XMQJ 2ZBPA 3JTNA 2IYIA 2ZBCA 1MNEA 1WKKA 2CPEA 4WP3A 4A8MP 2Q43A 1R43A 2AD9A 2V6AA 3BREA 3L7OA 2VHGA 1RA6A 4FF2A 1L3KA 2FQQB 4PG8A 3NNCA 3IA0A 5BYRA 3SCIE 3I0RB 3CDBA 2MZRA 4N8NA 1IWGA 3FMWA 4NMLA 3P45B 3TA1A 3W2VA 2V4RA 4DEZA 5IC4B 3CCMS 1HNXF 2HVZA 2GFFA 3DOMB 2XEXA 2FD2A 3WC2A 2N3OA 3TARA 2LLZA 3CDAA 3RGIA 1VLYA 2ASYA 2I38A 2ZD1A 1U2FA 1HBMB 2ZC4A 2FTRA 3HI9A 1X5OA 4CLKA 2J8AA 3CJ3A 2UV8A 1UVIA 2DNLA 3N5FA 1WKJA 2F8MA 4J9RA 3MD3A 4YP3A 3MUMP 2WVEA 2CRLA 4K4VA 2KG0A 3TZXA 4M5GA 2BZ2A 4DR5J 2DGOA 3LP1A 3P49B 2BRKA 4Y00A 4ECUA 3NL0A 3LQVA 2DR8A 4B3MJ 4B9UA 3BGFA 2YWWA 2NPFA 3DM2B 1UP1A 5IQ6A 3AOCA 1UL3A 2LMIA 1HMVA 5DO2A 3PJWA 3IM8A 2UZAA 4DV4F 2C28A 1C1CA 2LQBA 5HMZA 4ITSA 1S1TA 4FBUA 3HHDA 1AB8A 2I9SA 4O4GB 3DLGB 1YRXA 3PFEA 4L3KA 5EWEA 2WVDA 3AB2B 2OPPB 4A8OA 2IJNA 3FBFA 4YDXA 4YMEA 4UUXA 3TX8A 5CCLA 4B17A 2KXFA 3T1YJ 3ZNUA 3G9CA 3PR4A 1RT3B 3GTYX 3AH6A 3FSYA 1REGX 4K5SA 5LM7E 4OI0A 3OL9A 1PAEX 4IRKA 1UWBA 1JXLA 2CNKB 1QE1A 1KQSR 2XNQA 3NWRA 3LANA 4AQYF 1X4HA 4O3QA 1FRXA 1FXRA 1SPBP 2BDPA 3UNGC 3K58A 2GHVC 1NJIT 3OV7A 3W65A 4RNHA 3M6XA 2MJNA 2F1FA 3CMQA 1MW7A 2PI4A 3FK4A 1EKRA 2QN6B 3O6QA 4JI8F 2HHUA 1D8YA 3P96A 3OVBA 1H38A 1FCAA 4OZNA 3NCQA 1LWFB 5CYJA 2Z4PA 3S7RA 1NSAA 3AJDA 4C2MA 4NXNF 3FBCA 4OYAA 1HR0J 1DARA 4DUYJ 2HRYA 1NNDA 2G4BA 2ZZNA 3W64A 1LK7A 3X3UA 3CJRA 5HANA 2JVOA 2FUG9 4N47A 3NGRA 1S1VB 3O1LA 1MMDA 3QT5A 3QZ7A 5KFAA 3EGVA 1VS3A 3VQSA 3E8OA 3QIDA 1KKHA 3KJFB 1F9FA 1UVNA 1NMEB 1NKBA 1XN9A 3I4HX 1AZSB 2BE7D 5D0EA 5DDRC 1HYSB 3DLEB 3I0SA 3V81A 1X9WA 2G2ZA 5KFVA 1KN6A 2AEFA 5GMDA 2GJIA 1UFWA 4KFBB 1VIOA 3PNIA 3I5BA 1JLFA 4DSKA 1X4GA 5HLFA 3HD2A 4NRUA 2ZH6A 3CW2C 1OPZA 2W9BA 2VBYA 3H4BA 3R1LA 2VQEJ 3RB0A 3QO9B 3OJSA 3HFVA 3GPAA 3EGZA 1WC0A 1RA7A 3D66A 4EMDA 3R27A 1VIXA 2AJ4A 2KT3A 1PGZA 1FDDA 5KFDA 5I42B 3C14A 4J9SA 4DL2A 3K59A 3QGIA 5KFKA 5CHCB 2O01C 3Q8RB 2B3TB 1M5PC 3ZO7A 4BHQA 1HA1A 5RUBA 2F4VJ 4IG3B 2AYGA 1M5VC 4F50A 3P3DA 1WC6A 2PGCA 5AJ3F 4USMA 4DF4A 4OYOA 4MK7A 1FKOB 4GKKJ 1AROP 1LNQA 3KJVB 3RB3A 1M5KC 3KLGB 2YWFA 2HZCA 1S6QA 3BGUA 1WC4A 2D9PA 2A18A 2IHR1 4EUVA 3SZ2A 3G82B 3AOAA 1T9UA 2JHEA 4QWCA 2KHCA 4WWSA 1NZ8A 3TJ9A 4M94A 1KDNA 3OTBA 1F3VA 1ZM3A 4F3OA 4PYDA 1WSVA 1JJ2R 4H4OB 1PJ6A 4DPOA 4KPCA 3PIPQ 1HNIA 5CAAA 2XSJB 1T3OA 4FYYB 2OMOA 2BKOA 3BJYA 4N77A 2GHWA 5F9LA 2Z2MA 3PIOQ 4TY9A 4RJVA 2YBVA 4TYBA 2ZM6J 3E51A 4FS1A 4CQ1A 4JI0F 4ED1A 3ENAA 2CQCA 1YKWA 5IWAF 4UF4A 2VICA 5HK4A 4F36A 3CDUA 2OD6A 4USVA 3AODA 5KG1A 3J7AN 4IFVB 2UVRA 5LJ3Y 3KLIA 3MZIA 2UUCF 4NLUA 4Q5VA 2XGPA 4MYUA 2OEKA 4IRDA 2YTCA 2YXLA 3SQGB 2XYPB 4N76A 2VQFJ 3QRRA 5AE2A 2BW2A 3AD7C 1GK8A 2V0NA 2PO4A 2BE2B 3DGVA 4IR9A 4LMZA 5KFYA 1OS5A 3FGVA 4LQ9A 4U95A 3EICA 1RBAA 3HDSA 1Q53A 5H9EK 4X4UA 1OSDA 2DY1A 5K8MA 3G96A 3EVWA 2LKZA 2ASLA 2BE9B 3VHQA 2CJAA 3OVSA 4WZQA 1SJ4P 2XCAA 2DITA 1Z4UA 4JYAJ 3MEEB 2V4JA 1Q5YA 2CXEA 3CD0A 3QRQA 2NUUG 1W25A 3EJMA 4YB5A 2IAJB 4LF4F 3BPSP 5FJ4A 3DXBA 2KFZA 1TV6B 3OD2A 2XLIA 4U7UK 5DG9A 1IUJA 3GE9A 1WOPA 2PI5A 3D1QA 5D4PA 4WU2A 4XPEA 1VQ7S 1BWVA 4KAIA 1NJWA 1J5EF 3O2IA 1T95A 4H4MA 1S4EA 1W2IA 3DKDA 1ZZNA 2Z58B 3LF0A 5E3AA 3PRDA 2OELA 5JVHQ 4NEZA 4FYWB 3AOBA 2ERRA 4ALZA 2DPJA 1LWXA 3MAQA 3BSAA 4DFMA 2R2SA 1D3WA 1IVZA 3PR5B 5KFQA 4O44B 3SV3A 2OPQA 4NLRA 3R3TA 3VAJA 2AZ3A 4ZVQB 3MD1A 1N5TA 2UXBF 4QWEA 2FDNA 4RR5A 4DUZF 3I32A 4ILRA 3KLHA 2J6UA 4X84A 3HVTB 4G1QA 3O3LA 3P4UB 4XDDA 3N79A 4OZ1A 5J2MB 4DV5F 3I5AA 2JWNA 4MKYA 4BS2A 3MURP 4LVNP 5D6GA 3T1HJ 1T9YA 1SVDA 3A1YG 1A0OB 1PIEA 4ZLLA 1HD0A 3GV7B 3DHWC 4GVBA 2ASJA 3HT0A 2E5GA 4X4VA 2D3OR 4DQRA 2X51A 3M8SA 5A6PA 4OYXA 5IM0B 4CLYA 1RZMA 4ECZA 2BV3A 5F8NA 1LEOA 3M6VA 1LV5A 1RKIA 1GX5A 4FZVA 2VFUA 5KT4A 1IBKF 3ITHB 1UEVA 1LFWA 5KFGA 1I94J 3M8QB 1U0SA 5C2CA 1QAXA 3UNYA 2HURA 4UY85 2HK3A 3VAKA 4JB8B 1YLXA 3TVKA 3HPOA 4RW9A 4ID8A 3R2CJ 4AT1B 2QMUB 1KVJA 1N88A 1U8SA 5L1JA 5KG4A 1X4FA 3TJAA 3TUJC 5J2PB 1SV5B 1AXQA 1S76D 3MR2A 5EWGA 1E6VB 3DRXA 3RZAA 2OP5A 3CC2S 1ZA2B 2W9CB 1Y3JA 1R8BA 4QOTA 5T14A 2ADBA 1FK9A 2FHOB 1RTDB 2CJQA 1T3NA 4I67A 4WFNQ 1C2PA 4U7CA 4CWBA 2ZBQA 3TJ8A 3JSYA 1HNVA 2NSCA 2VG6A 1HBOA 4X64J 1YBAA 4PXBA 3VTIA 5MAOA 2YX7A 4QIEA 3NRBA 3IWLA 3DOLA 4DL7A 3CMAS 2CJ9A 2P2CB 1EJ7L 3M6UA 5G0RA 1JLEB 1N52B 3BGRB 1MU2B 4YOEA 4QR0A 1I3OB 2GNKA 4QZVB 1NHVA 5DETA 3BGLA 1RGVA 1VQLS 4WE1A 2CUYA 1L3SA 2BYCA 4YR0A 3M2VB 2XMAA 2H1YA 5KT3A 2B8PA 4DX8H 1QAJA 4HH1A 1RCXB 2C2RA 3IR5B 2B5JA 3OXFA 2V9KA 2RH3A 3QFWA 4ERDA 3DRSB 2Y1JA 5DGBA 4FYXB 2MY7A 4TU8A 3ZXWA 5HO4A 2RAQA 4DL5A 2DEIA 4OJ1A 5ETVA 3RYLA 4XPCA 2V8VA 3RAXA 4LF6J 1G7CB 1S1XB 2NPIA 2YPYA 2OGUA 3MAAA 4C48A 4DS5A 4OYIA 1U0HB 2QFJA 2EG2A 2ZVSA 4I64A 1SL2A 3AFGA 2HPUA 2F8EX 4B9NA 1A9NB 2QSWA 4LFCJ 3Q8PB 2A10A 4DR4J 4NE9C 5IT0A 2VDIA 1PYSB 4PG4A 3RRKA 1NB2A 2HWHA 5DM6Q 3MECA 2XS5A 1K73T 2FZKB 3GJTB 3V4IA 2P6SA 2L41A 3D6MB 4ZS6A 3MEKA 2L9WA 4ZP9A 3W2WB 1NPKA 3ZNJ1 5D3GB 2IA0A 1Q0NA 4TYAA 3KG1A 4XO0A 3DI6A 2FVPA 3MM9B 2A6MA 5LMNF 2GA7A 4B3RF 3QZ8A 3CJSA 3M9MB 4F4KA 3NAHA 5CYMB 2GVZB 2RDIA 2LQ9A 2D3UA 1RT1B 2J0WA 3DLHA 1CJKB 5DQHA 5HROA 1BQMB 4G6VB 1TUGB 3BGOP 2GAHC 4NI2B 3D68A 1H0HB 3H5XA 5A76A 2FJDB 3IBCB 2MTLA 2KRRA 2D1CA 2WRMA 3I9V9 2MDAA 3LAMA 3POTA 2GW8A 3IBWA 1TUWA 4JI4J 3W1YC 1TK8A 3MXHP 4XK8C 4L73A 1RT6A 2L48A 4TY8B 1X4CA 2DNOA 3FJ2A 1NKEA 1YBUA 1JJHA 2DISA 1S1UA 2C2NA 4O3SA 1DHMA 1M1HA 3UFCX 3SBMA 4HEA9 4WIIA 2ZVIA 4ZVUB 2X7IA 3OPKA 2BKPA 3FSXA 1K9MT 1IKYB 1DTQB 3CDWA 4ZHRB 2QG9B 3GFZA 4F3QA 2FY8A 1RTHA 1LWCA 1V3RA 5E3CA 4B9VA 5KFOA 3FEYB 1VQ5S 4KGMA 3GG1A 4QW9A 4X65F 1TKXA 2K1RB 4C8ZA 2ZZMA 2ALYB 3RRHA 3VAIA 2GZOA 4DQIA 1S7IA 3MCOA 5T7LA 4MIWA 4WYWA 2FJEB 2R7WA 2KT2A 1X0FA 2DNMA 1BLUA 3BV8A 3DOKA 2B7BB 3HCXA 3NY0A 2VIHA 4OI6A 1OO0B 5U47A 1JLCB 1RI7A 2HS4A 5IXUA 3I87A 5KFBA 3KJNB 5B7WA 2LXIA 1KP6A 4ZMMA 2E5LF 2V5HG 1KQFB 1YJ7A 4RNMA 4YB6A 2EWHA 1CULB 1DTTB 3MM8B 3K17A 3DMJA 1T9TA 4ECVA 1FNXH 3CJ0A 2R7UA 2J7UA 1T02A 4AQYJ 5L1LA 1S97A 4DPXA 2X3GA 2RD5C 4J5OA 5HI7A 3F0NA 1HL6A 3KUGA 1XC9A 1ZPWX 2QA4S 3GWCA 4RW7A 4FS2A 3A4TA 3DYAA 4RNNA 1VGYA 2AIRB 1HLWA 1XMOJ 3MWBA 3QAUA 2CPYA 2NXJA 2KVIA 5LL6d 1HYSA 2W24A 3QWPA 3E01B 1WSRA 4CH7A 4B3SF 1WNEA 4DSJA 1Q16B 3PRVA 3Q8YA 5IV4A 1VLOA 4CO0A 2RQCA 4QYZK 4NXNJ 2CQ0A 1VBXA 3OTEA 3V4MA 5K14A 2KFYA 2DD8S 3KLEB 2YKNA 3HVAA 5C7PA 3M8RA 1SC4B 1YSJA 4F0KA 3QIPA 1U1OA 4FF3A 3VGTA 1U1LA 1DJ0A 1GMVA 1REVB 3BF4A 1X5TA 2CZ9A 1GEHA 2DH8A 2IC3A 3DLBA 1TL4A 3NNHA 3MEDB 2NXNA 4N8OA 1H2TZ 1UPPA 1F5AA 1T05A 5KFUA 2KI2A 3FUYA 3QGGA 4NZ0A 4C11A 4JI7J 4URSA 1HBNA 3PJXA 4LSZB 4RKUC 2M3DA 1H7XA 4ZIVA 4K0KF 1FKOA 2WVCA 2ZJRQ 4B3OB 4ES3A 4MYTA 1UMJA 3NXZA 1WF0A 3MUVP 2MKIA 4MK8A 2MLZA 3CCJS 1KS2A 2GCFA 8AT1B 1A6LA 4PWDB 3PY8A 3CULA 2DNNA 4GVLA 1FRHA 4PWUA 3UD3P 1KSPA 1ELOA 1QTMA 2DR9A 1PC4A 1J5OB 4M8LA 3TZZA 4NCBA 3I9ZA 3NOGA 3OHBA 3MF5A 1RTIB 3C2PA 3A8EA 3GMGA 2OJ3A 2EK1A 2IYGA 1NDCA 4I68A 3K5NA 3TX0A 3L09A 3HXMA 2ZH3A 1H73A 1FA0A 1NPRA 1FFSB 5JUMA 5BYSA 1FXLA 2JSXA 4UOGA 4KY3A 3KJQB 1S12A 2V94A 4ECTA 4ZP6A 3M7VA 1YG0A 2LU2A 4NA1A 4J9UE 2JX2A 3PEJA 2V2ZA 1PBUA 3KK2A 1NCLA 2ILYA 3FNNA 3B78A 1WEYA 6FD1A 1T03B 2LEBA 4LREA 2P5VA 3U1LA 1N5QA 1APSA 3N4WA 2QLBB 4DG1B 2VG7A 4NLYA 1C0UB 2C2KB 4PAAA 3VR1A 2KVQE 5KFIA 3ZTOA 2EBEA 4DCJB 3D0IE 3MFIA 3M1VA 3N6NA 1YVFA 3EUNA 4OZJA 4ZVTB 1HI0P 1TL3B 1N54B 1I6JA 2KU7A 4LSNB 2H48B 3MGJA 1DFDA 3KHRA 3K5OA 4QYRA 2UUCJ 4LR8A 2ZEJA 3R6GB 2HHXA 4RLEA 4ENOA 4NYOA 3UDEA 4M5KA 2K3IA 2OLWA 2ROGA 1JKHB 1C1BB 1T8EA 3OSNA 2DRAA 3IG1A 4I6YA 3TEGA 3OR2B 2F40A 5E3PA 2HNZB 5K8OA 1YX2A 4FXDA 5GAHU 4J37A 1S5ZA 1R31A 1VQMS 3P8BB 1H72C 1JLQB 4ZLPA 4G65A 2FHKA 3S01A 3ISZA 1CC7A 2MQQA 4IFYA 1UVKA 3TA0A 4Z2XA 1VI7A 1VQ4S 2PDAA 4LF4J 4LF5F 1BQNA 2VFVA 4L3NA 2BJDA 2XWXA 3SFUA 4DQPA 2MZTA 2E66A 4WP9A 1WHWA 3OUYB 2RIJA 5B0DA 2YNHA 1J5EJ 3AY0A 4ZA1A 1ZA1B 3TO8A 4WFXA 3TQ1A 2KXHA 2ZH1A 2ZBRA 1FVSA 3FCHA 4KO0A 2UUAJ 4PKDB 1LW0A 4ZVHA 3CO0P 1IKXA 5FD1A 4WK1A 4EZ9A 4DS4A 1G6BA 4RL1A 1XK8A 2MPUA 2HQDA 1HNZF 1U6FA 4DV3J 3RTVA 3TWZA 4ZLJA 5IOLA 5CYQB 2X1FA 4NCGB 3RBZA 1GXUA 1CBKA 2BX6A 3ZZZA 4MK9A 3QGHA 3W61A 1SKWA 1Y3KA 1Q81T 1ICEB 4DF8A 4O3NA 2XQCA 1IXKA 4QPTA 5HVHA 1E6YA 2UXBJ 3LP2A 2V4QA 1PYTA 4RWXA 2KZMA 4MJKA 4DUZJ 3H0PA 2HS0A 1YDLA 2B6AB 5I3PA 3ULHA 2BQRA 1WG4A 4DV5J 1PCAA 3VAGA 2CZ4A 4QJVA 3K5MA 1IR0A 4TKTA 4QWBA 4LF8J 2M8DB 3ILIA 4FXWA 2ZHAA 1ZZFA 2AHOB 4F3MA 1RT2A 4QU7A 4RW8B 2RQ4A 2B4PA 1E6VA 4W98A 4J9QA 1NDLA 2FVQA 1M5OC 1C0TA 3M30B 3IRXA 3FFIA 3R9LA 1QUVA 1RTDA 2YNIB 1VBKA 1EB0A 2JL9A 4P9SA 1QJHA 5F8HA 4LFAJ 5C25B 1IBKJ 3V5RA 2UP1A 4DQQA 1OMSA 1H3DA 1K1SA 3NS6A 1ZETA 2VU5A 4F4ZA 2DNQA 1BWEA 3CMES 1PJ7A 3UR3C 1X4DA 2H5EA 4RWWA 3ICLA 4UQTA 1HD1A 4DL4A 3RRGA 1LFPA 5B0CA 2I2YA 1M5HA 2R3VA 4ICLB 1WDDA 3BH6B 1SCJB 3NBPB 4OHYA 3LH2S 1D8ZA 1JMTA 4MFBA 2Q6BA 3FKBA 2LA6A 2CJXB 2QMWA 1P9QC 1UVMA 1Z1ZA 3TUIC 3SDEA 2DXEA 3KNAA 1FX2A 2HEKA 3M2VA 3RBEA 2DT9A 2UUBF 3JB9k 1SI9A 1S7HA 2LQ5A 1RAEB 2UXDF 4HACB 3GCWP 2NS1B 3CJKB 2HBQB 1W7WA 3MM6A 3MEGB 5L9NA 4OHXA 2IM1A 1U26A 4DFKA 3BO2A 3UQSA 7AT1B 2WOMB 1VFJA 3D6FB 4DUTA 4R8UA 3R7SB 4BLGA 5A8RA 2NUHA 4ZCIA 4ZITA 3M2UB 2DHHA 3J7ZT 2H54B 4MKVA 1CJVB 1NK4A 3SCLE 2R7OA 4B02A 2AYBA 4IH7A 1GAOA 4C8NA 1RTJB 1IJFB 1WG1A 1HHTP 1CS4B 3R6LB 4M5JA 5CZXA 4ZN3A 1MMLA 1FE4A 4MAKA 5KG2A 1WI6A 2W2PP 3BQ1A 1FFGB 4NXMJ 2IRYA 2GGPB 1NDKA 4L74A 3W2WA 1LXJA 4LSLB 5D3GA 3K0JA 4DFPA 4F4XA 4J9LA 2VOOA 2QT7A 3W5ZA 2BJ7A 2R7SA 2J7KA 2HS3A 3HJFA 4EYHB 2FVRA 2ZDOA 4KRWA 3PVXA 4P74A 1NSQA 2J9EA 4QWDA 2DGQA 2CPHA 5CYMA 3ET6A 1TR0A 2G0JA 2NR0A 1FESA 2DXFA 4MKBA 1CJKA 2P8IA 4M5IA 1VRUA 1RLDA 4ED7A 4CLUA 1CPZA 4R5PA 2VH7A 4K50A 4FPRA 3MCSA 4XDCA 1VRTB 4DI6A 4I2QB 2WSEC 4FP9A 5HVFA 3MMCA 2Y1IA 3KLFA 4ECYA 4TY8A 2ZH9A 3UCGA 2WW8A 3QT6A 1HIYA 3C6UB 1S72S 1NHKL 5SZTA 3MMBB 1RXOB 4KIAA 1KBRA 3HHLB 3CCVS 1WTBA 1SJRA 3H2VE 1B7FA 5KFRA 5EX0A 3LWLA 1RHKB 4RW4A 1B70B 1MROA 1HHSA 5KFPA 3HMJG 3G6ES 2KTQA 2NQPA 2M2BA 3V6DA 2KH9A 1HQUA 2W7OA 1JLBA 4C97A 2V2VA 1RKJA 5FDLB 3R8YA 2MJUA 4PR6A 4DPWA 2E9RX 2ZITA 1MWQA 3KHHA 1UTAA 1M90T 2Z2LA 4H4KC 2IA6A 1N32F 3VCDA 3Q24A 4ZJOA 3PDNA 5HJXA 2K7KA 2AJ1A 4DV2J 4HKQA 1CEZA 2V67A 2G1DA 4TLQA 3T9ZA 3NGKA 3AXMA 4DV1J 4DZ6A 4W4MA 4USIA 2HMIA 2ROPA 3MI7X 1OY6A 2PMZD 4B3TF 4DN9A 1X5SA 2ABYA 3SQOP 4OYMA 3B8HA 3CD7A 4M5MA 5I3UA 2JOQA 5AT1B 2VG5A 2AQ4A 4KPYA 3GYXB 3LP0B 2BW7A 4EBCA 4Q0BA 2ZH5A 3OTDA 1NRKA 1CULA 1XTZA 3I5CA 2M52A 4BCAA 3MM8A 2IBKA 1RWWB 1WORA 1RHUB 3DGPA 1I1GA 5B08A 1FJGJ 1GTEA 4DU7A 4KB7A 2AYEA 2F4FA 3KUEA 1VJQA 1NO8A 4K7QA 5KFNA 1J2VA 4NLTA 1UA1A 2D41A 5CXTA 4OHZA 2RF2B 2VC0A 1KTQA 2ZFHA 2W2QP 4B9MA 1RHRB 5B0EA 3GQCA 1NK0A 3MUTP 4W90B 3WHIA 4XIUA 2MEWA 2IJRA 1GMWD 4C0OC 4AD6A 5DM7Q 4OQJA 3W66A 4P2MA 3HHLD 1HQEB 5CD4A 2PT0A 1QAIA 3D3BJ 2ZKUA 3E01A 1FWLA 1K44A 2QL7B 3HHEA 2MKJA 5KFMA 5J1EB 3GV5B 3NGUA 3AD9C 2MZSA 4ILLA 1SC6A 3ETOA 2DGXA 5DDPC 1KONA 1Q82T 4RW6B 3AQOA 3DRRB 5SUHA 3FEZA 3U02A 1AA1B 2HFOA 4LRFA 2PA3A 1FKAF 3TA2A 2IIHA 1UETA 1WEXA 4A8FA 2YKMB 2UXCF 4JOUA 4NLGA 2FLPA 5HBMA 2B9XA 3GIMA 4D3HA 3ZTQA 5AE1A 3HO1A 3R5CA 3MEDA 1JNRB 4YB1P 1HQ2A 4IG0A 3R97A 3CIZA 3JYTB 2PEBA 5A0YB 4Y2MA 4CNYA 4PYAA 2MQOA 3EVOA 1FD8A 2EC2A 3MPDA 2M9KA 1MMNA 1KFSA 1P6TA 2M5YA 2UVUA 3D2WA 4ED8A 2PMHA 5BYQA 3N6LA 3PJ9A 1WWHA 3SYZA 5HP1B 2EG1A 4ID5A 4USUA 2DNPA 2XHWA 4NYZA 5HATA 4X66F 2BRLA 3M32B 2JC1A 4HL9A 2CPFA 1MLAA 4DR6F 2QRRA 3DC2A 3EM1A 2HWTA 1LW2B 4DMZA 4JI2F 3TUPA 2DHGA 2HQIA 3T9NA 3R5AA 4JV0A 4DSEA 3M8PA 4LIRA 4PXEA 5L38A 1RAIB 1WEZA 3ETMA 4YHHJ 5A8KB 4AUKA 4P7TA 2HYIB 5HSPA 5C42B 1TL1A 3QGPA 3S1TA 2OTLS 3QJPA 5HJYA 2YKPA 1TFWA 1EETB 3SMZA 2HNYB 3A3NB 1Q86T 2AJ2A 2MKYA 1TUVA 4OV1A 3CCQS 4GRSA 3PW7A 2R8KA 2ZH4A 3AT1B 4PPZA 1MG7A 5BR8F 2JJ4D 4Y0FA 2HRUA 1M0SA 2KM8B 5L46A 3OLAA 4OX6A 2Z2YB 5L1KA 4RBUA 2IFXA 3HSDA 2LFVA 1N5YA 2VL1A 4OX7A 2HQGA 2MLYA 2O3DA 1TKDA 2KYXA 3U1MA 2HNDA 2DRBA 3W9IA 3MMJA 2DGSA 2FHMA 2GVDA 1D9DA 1Y0HA 4I2PA 3H4DA 3A12A 1L3TA 3THTA 4FPIA 3OFHA 2HHQA 2BANB 2UU9J 3W9HA 1IKWA 1K0VA 5B0AA 3PFOA 2RUSA 1S9FA 1SQEA 4D3GA 1TL3A 5CA5A 3OR1A 2IMWP 3UDVA 4LF9F 2OSQA 2XB2D 1N33J 4ZK7M 1ZH5A 3QRPA 4FDFA 1SUQB 1S9EB 1IKVA 2F9DA 1MN9A 2YKAA 3C66A 2ZH8A 4A4JA 5A8WB 3NP5A 4CRJA 2J9DA 4WZMA 2IDEA 3AA9A 1RT5B 2R9LA 4QPXA 3CJ8A 4NYPA 1YZ7A 1R0AA 5GAEI 1LOUA 2I1RA 3Q2SC 1ROFA 2MYFA 3W9JA 3SCKE 3PW0A 1GMUA 3WDOA 2AJFE 2EI5A 2AGQA 4NZ6A 3CC7S 2H51B 1IBLF 4IQXA 1HPZB 3K7RA 1KC8T 5D4LA 4DR1F 1NBEB 2PSZA 4UT4A 4OIXA 4ZVOB 2UVWA 2CJKA 1U1MA 2IM0A 2RT3A 4MH8A 3TYTA 5KFLA 5B09A 1IBMJ 4ECWA 3BN4A 1BMQB 3UVJA 2ACYA 2MXYA 3CDEA 1YZ6A 4AXIA 1TKZB 4HYKA 3MOJB 4ZOSA 4WF9Q 1U45A 2HAFA 2V68A 2MKSA 3O44A 1A7GE 3KK3B 3VZIA 1XNRJ 2V8HA 1RLCL 4M5NA 3T3FA 2DHSA 2XG8A 4ECSA 4CYUA 2RDJA 1M1GA 2NZ4A 2R4FA 3DDNA 2XO7A 2ROEA 2MB0B 3D1HA 2HZAA 4YUDA 5B0GA 5H9FJ 3GIIA 1Q78A 5HQLA 2C2DA 2EFGA 2QA4G 3PW4A 1HBUA 1X31C 3KKFA 2ALZA 4NCGA 2FLLA 1PSDA 4M5HA 1HWLA 3KWMA 3TAQA 2WBRA 1YJRA 4RZRA 3FZBA 4OLPA 4ZJQA 2HLUA 4KQZA 1DRZA 1V6HA 1XNQF 3L3CA 2VDHA 3IMQJ 3EZ5A 2CQ1A 1TZ0A 1PILA 4A47A 1Q4RA 3O5TB 1ZAXA 1R89A 2Z8QA 1S59A 4CLLA 3JSMB 1SL0A 4KKOB 3EGNA 1RT7A 2ZOGA 1UJ4A 1VISA 3BO4A 4AL7A 3A3OB 5C24A 4X4NA 2JZ5A 2FZCB 4JV5F 2E7WA 3KUHA 2VJUA 3T5KA 4NLPA 1JX4A 4I7FB 4UOHA 3BZQA 2KYZA 8ATCB 2WZ1A 4Q7AA 4JP8A 2DB1A 3EGWB 1IM6A 4YB7A 1NK9A 4GKJF 2VF3A 3BO3A 3IS9A 3QPIA 4EI2A 4N5SA 4UY8T 5ETSA 4KV8A 2CNOB 1N34J 2RDDA 1BHNA 5J2NB 4OMFG 4Z37A 1FWPA 1B0VA 1KWMA 3CSKA 3UN3A 3J80Y 1RAOA 1VQ6S 3N01A 2B51A 3C16B 4R0EA 1XBWA 3QLHA 2W01A 2PN6A 1S6UA 2YKQA 3NBPA 4OFZA 1N6QA 3BEGB 1RTZA 3DN9A 3D3CJ 3PTWA 3OFEA 3VVTA 1RUSA 1VC5A 2YNFB 1WHYA 3H90A 1CJUB 1DLOA 5D4NA 4FNHA 3V6JA 1BXNA 1XMQF 3CCWA 1VK8A 1S6PB 1SXLA 4NASA 3CPWR 5JVGQ 2Y9HA 4NL5A 2KL8A 3K89A 4K5RA 3ISND 4Y3CA 2RKIB 3B4MA 2A2CA 4OI4A 1NH8A 3JS9A 3NGSA 1WHXA 2BEFA 4J9OA 2EEYA 3UD5A 4JI5J 3CUNA 1AUSL 1GNKA 3VAHA 2BJ3A 5E41A 3Q83A 1EAYC 3PHTA 1GT8A 1FERA 2AJQA 3IXQA 1TKTB 3K2YA 1J27A 5KTQA 4EGLA 4WPAA 2DGTA 3I31A 2U1AA 4CNZA 1S79A 5KG0A 4ED4A 2FJAB 1X8DA 4Y2AA 2W7PA 3G8QA 2HGMA 1XQIA 3IFEA 3PXGa 4CO4A 4DR5F 4ZPAA 3MFHA 2ZKTA 2E29A 4CM0A 4DHVA 1WUUA 1FDNA 4DL6A 3J81Y 3QSIA 2DR5A 1BC6A 3TANA 1NJYA 1LK5A 3NOCA 4P10A 5H1SV 2ZD1B 1RAHB 3UW1A 4FF1A 1VBYA 3EX7B 4IH6A 3FSIA 2COLA 1Q5VA 2ZH2A 1S0NA 2HGLA 2DO4A 4OYZA 4BWMA 2AV5A 3LO3A 3CJ4A 5EN1A 4KHMA 2R42A 4O0IA 4KGZB 1HNWF 3UE2A 3CCZA 3DDKA 3EXYA 4PUOA 5M2UA 3D28A 3LP1B 3NKYA 4P75A 1RWNB 2Q79A 2E5IA 4CO5A 3CCTA 3W5XA 1ZTTA 2YH1A 2JLGA 1KLMB 2FHJA 2G1HA 2CQHA 3EPGA 3OJUA 4WK3A 2HLTA 1Y7PA 2W4PA 1OIAA 1YRTA 3GYNA 2KKHA 2W2NP 3T6BA 3EXCX 2LQJA 1HMVB 3H59A 5DZ7A 1JLAA 3D9BA 3M2RA 2L9NA 2GIRA 4B08A 2VASA 3NWGA 3WBZA 2FLNA 3FRZA 3TI0A 1S1TB 4HTJA 4K2XA 1YQHA 2CAJA 2F5GA 4NWBA 1QSSA 5KG6A 2RQKA 3G6VA 1CQMA 4O23A 5FDLA 2EFPA 2VA3A 4L75A 2BXJA 3IO1A 3LALA 2JEIA 1QTNB 3VAFA 2FJXA 1AYEA 1PJ5A 1AFJA 2ZJPQ 1QDUB 1UCNA 5KFJA 1RYSA 2CZVC 1N5VA 4PWWA 3QYYA 2E5JA 1OQ3A 1T9WA 2GV1A 1UWBB 1QE1B 5M2RA 1W2BR 2AP6A 2MY8A 1WELA 4AYBD 3MMAA 4DUYF 4HHHA 1O0PA 1U2CA 4UOCA 2QIFA 4DV0F 1RWKB 2Q1LA 3OFFA 1XIQA 2DNYA 4KR0B 4BWJA 1SKRA 3TW0A 2AYMA 3UCUP 1F5BA 4Q43A 1N32J 4P72A 2W8LA 2XMWA 1EP4A 4UTGA 4WFAQ 2CPZA 4IRCA 2R8HA 2BJ9A 4LVOP 2FJWA 5E0OA 2QLJB 3LWMA 3EE3A 1S48A 2QYGA 2LCWA 2ZE2A 2VQEF 3M8YA 4X4RA 1UW9A 5AXLA 4NA3A 4USJC 3DU6A 1DURA 2IVMA 1JQGA 3FQLA 3LA0A 1WC1A 1HQEA 4YY3F 5DLGA 1CJTA 2EBGA 3G2XA 4DV7J 2XSFA 5D0HA 4WCEQ 2A3JA 3I0SB 2QC3A 3BR9A 3V81B 4C8KA 3CF5Q 1U7LA 2JDJA 4RW6A 4MTPA 2DO0A 4IDKA 4EFAC 1R0CB 2C42A 2KJVA 2A0FB 1FI4A 4M1KA 1JLFB 1BD6A 5HLFB 4LFBF 3RU0A 4O3OA 2XWYA 4LQ3A 1QSLA 4GKKF 3EMTA 4CLTA 3Q8SB 3VGSA 1JLGA 5K9FA 4EBEA 2NCKL 1TAUA 4DPTA 2KRBA 5A0YA 2VC1A 3HLUA 2MLXA 3C14B 2YX1A 2QA1A 5DRKA 2DVIA 2VFRA 4ZP8A 1ZS6A 4J9PA 5CABA 2PC6A 5BJRA 5EUHA 3VGVA 4M63A 3JTOA 2E1MC 4WBFA 1NB7A 5GADI 1FFWB 2UXCJ 2R2UA 2CQBA 1C4CA 2ZHOA 2EFNA 2QSFA 2V8DA 5J1NA 3LW5C 2I5JA 4YR3A 1X5PA 2ZM6F 5I3QA 1S6QB 2RSQA 5D15A 4FKYA 1MWZA 4M5DA 5ADZA 2NYHA 2HQFA 1NM2A 3M8ZA 1QD1A 4WIQA 2MZQA 2OPRB 1V3ZA 1RHJB 5C42A 2PE8A 3I55S 3HHKA 1SKSA 3MR6A 3C6TA 1WACA 5KG3A 8RUCA 2IPOB 3M6WA 5H9EJ 3SSRA 3NS5A 5J2QB 4IKAA 5IC6B 4ELTA 2BOAA 2VQFF 2DH9A 4ZVEA 5F8JA 1TVRA 2C22A 2R7XA 5K20B 3ENVA 4I6AA 5EDWA 5AXMA 1CG2A 2VPYB 5IT9U 1HARA 3DLKA 4ZIWA 5JXSA 2Y8YA 4DJBA 2BVZA 3KLIB 2WB1D 1S0VA 4PQUB 2IRUA 1IR2A 1EARA 3F56A 5DJBA 4LF7F 4UUWA 2K3KA 3LOUA 4I56A 1P9YA 2HFZA 1FVQA 3VWSA 3M4XA 4OZ5A 4P2XA 5BR8J 4PABA 2VJVA 3HM9A 3AHPA 2HWIA 5CCMA 1YJ9S 5LSRA 4ZP7A 2W7AA 4HTIA 2CFXA 5JJBA 4CH1A 2CWXA 1RU2A 3B82A 2EKYA 1S9EA 4O3PA 1OJ4A 2M88A 4C8YA 2V4JB 3DLLQ 1JWWA 2R8JA 2HFSA 1RT5A 1VMBA 2ZUAA 3IWNC 1JJCB 3C15A 1OPIA 4LBHA 3QFHA 1U49A 1TMJA 1VQYA 2G2YA 2GMHA 1H2VZ 1LWEA 3UPFA 1WG5A 3WZ0A 2H4YB 2RMLA 2C3MA 2W9AA 4EEYA 4PPDA 3PYDA 4BDPA 1GXLA 2QL9B 2HHHJ 2MSSA 5F3TA 4C0BA 1T11A 4H4MB 2OH2A 2XS2A 2KT5A 2WSCC 1HWJA 1I5OB 1SH3A 3T1HF 3OW2R 2CNLB 1ZM2A 4UZBA 1ZM4A 1OQ6A 2XULA 1Q1KA 2ZOFA 4ZN1A 2E1AA 3KNGA 4KH0B 3IR6B 4DOZA 2OPQB 2QV6A 2RRBA 2M0GB 2CADA 2QTWA 1FKPB 3H7HB 3R2DJ 3KLHB 3MPUB 2NXUA 3Q23A 4G1QB 4ZPBA 3MM5B 4QIWD 4WTYA 4P7VA 3J7A1 5DDQC 2A6OA 2B9WA 2OD4A 1UJ6A 1RAAB 1TL5A 5D8HB 2GMJA 4GVBB 2E5HA 1R0BG 1RP5A 2B7CB 5T41A 3KTQA 1BUXA 1D0EA 3H25A 1QAYA 4K2JA 3J81j 4MKAA 1WJ9A 1S99A 2BABA 3A8KA 2BKNA 4IH5A 1ZPVA 4S0MA 4QCLA 3GZ7A 3KG4A 3CB4A 1TAQA 3RB6A 2CNNB 1HWUA 3B54A 2C2ZB 1JIHA 4RW9B 3AD8C 2EVZA 1S9GA 4YN3B 4ED5A 2HSEB 4KT0C 7FD1A 1OYEA 1SIWB 3FEXB 4ANCA 1R8CA 4A8XA 3NMRA 4N41A 2VFTA 3HKWA 3CEDA 1P1LA 1XNQJ 1L3UA 3TOQA 2XS7A 1VQ9S 4BC7A 4NLDA 2N3LA 1ZYQA 3GJRB 1S1WA 3BN7A 1FK9B 3HZGA 4IO1A 4X4OA 1KR4A 4ZPCA 1VQOS 2W8KA 3JQJA 4A46A 4X62F 2VKRA 1HNVB 1DZ5A 3WIUA 2VG6B 2YWGA 3TVZA 1HBOB 2NXCA 2KO1A 2HBRB 1XWLA 1IN0A 2LDYA 2GJFA 3ADAC 2BR0A 4OLOA 4CI0B 3GILA 3DOLB 3DU5A 1QVFR 4WYLA 1YHQS 3I0RA 1VCTA 3BSOA 5G0RB 4P52A 1N48A 3FRYA 2RJZA 4AFFA 3GJQB 1FTCA 3DOMA 2WHOA 1IM4A 5ETPA 1FDBA 4WE1B 4LFCF 4DR4F 2HGNA 4IOAQ 2FYXA 2G2OA 5DG8A 1HBMA 4K4UA 5L39A 2MZJA 3PCOB 2B5JB 1GX6A 3MTKA 3MCNA 3LTOA 3S6EA 1PBAA 1SJFA 1G3OA 1PKUA 1IR1A 1VK3A 2KG1A 3L7PA 3LGHA 2J8SA 3Q86A 3MAAB 4A8KA 1HNXJ 2MQPA 4NLWA 2DGUA 4EYIB 5A2QY 4IOBA 3HVRA 2H5IB 3DM2A 4O0NA 1N8RT 1RWOB 4KTQA 3R5JB 2J9DE 4ED0A 1TKTA 1UEKA 3CCUS 3MECB 1WD6A 4MMOA 2YQ0A 3GU0A 4M5LA 4O4GA 3NEKA 4CLPA 3DLGA 3V4IB 5KG5A 4CT8A 2E7VA 4F67A 4JI4F 3N9UC 2OPPA 2DEJA 4CZCA 3M8WA 1UPMB 3DI6B 3HSGA 6AT1B 3HVWA 3KMSA 2GX8A 3J80U 3IM9A 1RT3A 3GV8B 3V6KA 4RBTA 3PO4A 2C3YA 5DDOC 2BACA 2QJ3A 2VKZG 1SC3B 4DV4J 1ZTWA 1QVGR 3IC1A 2CPXA 5HROB 5GAGI 3R7NB 4PRFA 2FGOA 4F8RA 1KNZA 4F4WA 2Y0BB 4DZDA 3OBIA 2RU9A 5C2GA 2J76E 1PG5B 4DXLA 1RACB 2HHSA 3POTB 3U27A 4CM2A 2LDIA 4TLRA 1KLMA 1RT6B 2ZNYA 1HI1A 1S6OA 1S1UB 2F65A 5HN0A 1B64A 5JMNA 5GAEU 2HW3A 2MQLA 5LT5A 1FRJA 2N7YA 4ZCMA 2E1PA 4LUBA 1LWFA 3KOAA 3N0VA 5ETLA 1HW9A 4DU8A 2XO6A 5GMKa 5KFZA 3ZC4A 4MIAA 1RTHB 5L9XA 1JXEA 2AEMA 3EWGA 5GAHI 1HNWJ 3TAPA 1LWCB 4JI1F 3ENWA 3HULA 4PXCA 3BBCA 2R8IA 3K8WA 4JBCA 4LF1A 4KGKA 3HFKA 4ZVGA 1S1VA 1VHFA 4GC6A 5B0FA 1TKXB 4DLEA 2IY5B 3IAM9 2HK2A 2E1RA 2DRDA 3GYGA 1D09B 3OXLA 1RWVB 1AZSA 5LOQA 4NLOA 4JI8J 1UVJA 4Q45A 3A8JA 3DLEA 3GB0A 5KT7A 5T7LB 1X60A 1U02A 3J81U 1UA0A 4EWTA 2ZBIA 2FB0A 4KFBA 3L7UA 3DOKB 3CWJA 2ZH7A 1N36F 2K8GA 1FJEB 2HBZB 1ZM9A 5KFTA 1H98A 3QO9A 5D78A 4DR3F 5IFMA 4QYZJ 3V2UC 3W5YA 2AX1A 1WF1A 2FVCA 3T5LA 3QT7A 4HVZA 1XMOF 3A13A 3EPIA 2Z0GA 4RO0A 5KT2A 2HHVA 3BBFA 3CTRA 1R3NA 2K06A 3DMJB 4OYWA 3BBBA 5I42A 1JB0C 2MGZB 1NK6A 3HJVA 5IT4A 1B7YB 4IG3A 3H5UA 1O6XA 2WONB 3OFGA 1OY9A 3JTPA 4DV0J 1DQ8A 1SQGA 3R1HA 1FT8A 4QIGA 4YDDB 4DFJA 3KJVA 2I6WA 3KLGA 4TU7A 1GQEA 5D4OA 4RW7B 2HIQA 1EQ0A 3DYAB 5CD4H 5HQ8A 4BBYA 2PA8D 4PQAA 3DXSX 2HVIA 5ITHA 3W3SA 2PFDA 3G82A 4U9RA 4CH0S 2NLWA 4OZLA 1G1XA 5EWFA 1VC0A 2NZCA 3IAS9 4LJMA 4EO8A 4DL3A 4JI7F 3P5BP 2B4OA 3GIKA 4F04B 4HI2A 1HWIA 2Y1RI 5K14B 2HQCA 4PXDA 3NNAA 2XLJA 2YKNB 2LXUA 4H4OA 4OX9F 2F7VA 4J9NA 4OI2A 5AJ3J 3X1LB 1IWAA 1F9HA 3QIPB 4X4SA 2KXNB 2XSJA 3CD6S 2XI3A 5E2QA 4M95A 2V9WA 4HHUA 2VA2A 2W4DA 5DQGA 2R7TA 1FD2A 2ZNZA 1RYRA 3MR7A 3CC4S 2ACMA 2IC3B 5KFSA 1RAGB 2C2OB 1URRA 4TXSA 5AXNA 4YY3J 3G71S 5LSOA 1TK5A 2HQ3A 3QWUA 1T05B 2ADCA 4ED6A 1S10A 4IFVA 2HBYB 2O5DA 4DX7A 3BPDA 3LPEA 3QMQA 4C11B 3ZTPA 5LXYA 3TP2A 2G13A 1HBNB 2R2RA 4J9VA 3SQGA 2QX0A 4LFBJ 3KK1B 2QYCA 3CCES 3MM7B 2Y0SD 3U1NA 2CQPA 2BE2A 4IOCQ 5ETTA 2SXLA 2KB2A 1M1KT 1P8GA 3G6YA 3PEHA 4KC5A 2H4WB 4Y65A 4JI0J 4FBTA 3QAEA 4R25A 3OQ2A 5IWAJ 3T41A 2Z57B 1UWAA 3CCLS 2JNJA 2OPRA 2AZ1A 2OKQA 5E5NA 3MEEA 5CH7B 5J2QA 2YKOA 2IAJA 2D74B 2F8HA 2HZVA 1TV6A 3QBCA 2MKHA 2V8GA 2XLKA 4O4RA 3I96A 2V63A 1IQTA 4CT9A 1NU4A 2IMOA 2FGCA 1RCOB 4ECQA 1YIJS 1O8BA 3US5A 3DFEA 2FJVA 2XGQA 1CVJA 1X4AA 3KLVA 1RISA 4ZPVR 3DNCA 3CIMA 4A8YA 3VQTA 2BBEA 3BM7A 1F1BB 4OJ3A 2C3UA 1HFEL 1QUPA 3KK2B 1KHWA 4DPYA 1RE1B 3RB4A 3P5TL 4QBUA 1FXDA 4PQUA 4OYBA 1FNOA 3HHNB 5AXKA 2AJ0A 2HIYA 4RU9A 5HL7Q 3CJQA 3CNQP 3ELHA 3BYPA 1WTFA 5C5JA 4CDIA 4DN0A 2VG7B 4C3KA 4O44A 1FEHA 1FDAA 1KOHA 4B9SA 2WBMA 2D3O1 2GIFA 3M1VB 2CA9A 1RAFB 1G2EA 2NYIA 1RJJA 3HVTA 1AW0A 4EZ6A 3H5SA 3GFHA 2DR7A 1YGYA 5J2MA 2OMLA 3L9ZA 4FXVA 4NLVA 2HKEA 2IM3A 1BE4A 3AQPA 4LF7J 2AT1B 2CQDA 1NK8A 1TL7B 1KEKA 4WJBA 2BA9A 1G4CA 1YJWS 2XMTA 1EIYB 3IG1B 5IM0A 4Q2LA 1V9OA 5DS7A 1P27B 1UFKA 4ZPWR 3KHLA 2UUWA 1OWXA 1Q8KA 3ITHA 4LR7A 1T0TV 2JLEA 1V3SA 3M8QA 2J0SD 2UUAF 2J7WA 1NLKL 2WTFA 1K47A 1UZHA 4WTOB 3N5BA 4IFYB 1VJWA 2OFHX 5J2PA 1NJXA 1SV5A 5ETNA 1U24A 2J9CA 4DV3F 5FLXY 2VONA 3GP9A 4I0WA 2DTJA 1OY8A 1BQNB 4LRCA 2G9OA 2OEMA 5F9NA 4J91A 5HMWA 4DX5A 1TFYA 2W9CA 2IM2A 4HI1A 1VBZA 4OHWA 3PG9A 1FKPA 2YNHB 2J6TA 3W8PA 4E98A 1X9MA 1EQMA 1NXIA 3RAMA 4KE5A 4KO0B 3MM5A 4CLFA 1LW0B 3IWXA 5HAOA 3AJ2A 5DG7A 4YR2A 3KYLA 3PO5A 1M5SA 1IKXB 3IP0A 3MR5A 4LF8F 2DNGA 1KHVA 4LBIA 1D9AA 3RR7A 1Z2LA 3BH7B 3JSRA 3DDIA 1JLEA 3BGRA 3LAKA 1FRIA 1UEUA 5F8LA 4Q44A 1MU2A 6FDRA 1YTYA 3H8YA 2PFFB 2GO8A 1E6YB 2ZDPA 3LP2B 3UI3A 4LFAF 3VAMA 4QQBA 2CJBA 4NEYA 1QM9A 2OPSB 1H6KX 1DAXA 3KMQA 3H20A 3JXOA 3DRSA 1WC3A 2O1PA
chains in the Genus database with same CATH topology
1SIZA 2DH8A 2IC3A 2GJ2A 1NZAA 3DLBA 1ZAWA 4L72B 3DLKB 3DDKA 3EXYA 4PUOA 5M2UA 1TL4A 1RT2B 3LP1B 1O5JA 3CJ5A 3D28A 2Q79A 3MEDB 3NKYA 2VODA 2E5IA 3I6PA 2CVEA 3CCTA 1S49A 4N8OA 4CO5A 2DPIA 1ZTTA 1H2TZ 2YH1A 1U48A 2JLGA 2W4CA 3MAHA 4KJIA 1KLMB 1F5AA 2FHJA 2CQHA 3EPGA 1S1XA 1TKZA 3OJUA 1T05A 4WK3A 2CIMA 2HLTA 4U67Q 1C0TB 1Y7PA 2W4PA 1OIAA 3NMAA 1YRTA 3GYNA 3D54A 5KFUA 2KKHA 2KI2A 3IRXB 3T1AA 3T6BA 3QGGA 3FFIB 3KK3A 4NZ0A 4C11A 1RT4B 1FRKA 3EXCX 2FJBB 3D0GE 3OLBA 2LQJA 1HMVB 4QW8A 3H59A 4URSA 4OHVA 1JLAA 1HBNA 3DRPB 3M2RA 2L9NA 3PJXA 2GIRA 4RKUC 2VASA 4B08A 3I4PA 3PX6A 2MQNA 1SL1A 2M3DA 3NWGA 3WBZA 1H7XA 2VB6A 2CQGA 3NG8A 3DCAA 4QU6A 3T5JA 2FLNA 1P1TA 3FRZA 3TI0A 1FKOA 1S1TB 4K0KF 4HTJA 4K2XA 3OL8A 2ZJRQ 2VOPA 1YQHA 4NWBA 4OL8A 4B3OB 1QSSA 5KG6A 2ZC3A 4ES3A 4MYTA 2RQKA 2YVSA 3EYZA 3G6VA 1CQMA 1XMBA 3C3LA 2HHHF 1UMJA 4JV1A 3ONQA 1Q79A 1WF0A 5B0BA 4GO5X 3MUVP 4O23A 5FDLA 2EFPA 2MKIA 4MK8A 1I94F 2VA3A 4KHPF 3CCJS 1UW4A 1KS2A 2E44A 2GCFA 1A6LA 2IVYA 3GR1A 3FZ2A 3MOZA 2MZ1A 2BOPA 2IRXA 3ZFVA 4PWDB 2BXJA 3PY8A 3CULA 2DNNA 3IO1A 2JEJA 3I82A 1FRHA 4PWUA 1KRPA 3LALA 3UD3P 2JEIA 1KSPA 2I8EA 3VAFA 1ELOA 3MM9A 1QTMA 2FJXA 4F02A 1AFJA 2KN4A 4PG7A 2ZJPQ 2DR9A 1PC4A 3FMBA 1J5OB 4M8LA 2RUGA 1BQXA 4NCBA 4NOHA 3OL7A 4TU9A 1FF2A 4MFBB 5KFJA 3I9ZA 4DWIA 1RYSA 2CZVC 4J9MA 3DRYA 1N5VA 3OHBA 3QYYA 3MF5A 1S77D 4N56A 1RTIB 1KQKA 5THWA 2X1AA 3SDEB 2E5JA 1OQ3A 3C2PA 3A8EA 3B4DA 3GMGA 3LGNA 2N82B 3OSPA 2OJ3A 1LWEB 1Q8IA 2GV1A 5GVQA 4X2BA 1UWBB 2QZ8A 2XMKA 2EK1A 2DCLA 2V2KA 2IYGA 1RT1A 5GADU 3BSCA 3M05A 1QE1B 3UWTA 5M2RA 3K8VA 1BQMA 2B0GA 1W2BR 2AP6A 4I68A 2MY8A 1WELA 3TRGA 3CE8A 3MM6B 3K5NA 3L09A 3HXMA 4AYBD 1IJEB 3MMAA 4DUYF 2DIUA 2ZH3A 3JSMA 1FA0A 4KKOA 4NXMF 3TVYA 4CTAA 1O0PA 4OJGA 5JUMA 5BYSA 2CKWA 1GTHA 2QIFA 4UOCA 1FXLA 5F8GA 2JSXA 1KQGB 4DV0F 2D3ZA 4R8UB 1U4BA 4X64F 5A8RB