3QIPB

Structure of hiv-1 reverse transcriptase in complex with an rnase h inhibitor and nevirapine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
425
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Binding Analysis of Pyrimidinol Carboxylic Acid and N-Hydroxy Quinazolinedione HIV-1 RNase H Inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse HIV-1 reverse transcriptase p66
total genus 115
structure length 402
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3qipB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3qipB03
1JXLA 4KFBB 2OPPB 3V6JA 5J2MB 4ZVEA 1HQEA 4R5PB 3JYTA 2FJVA 5KT7A 1HNVA 1JLBB 4RW9B 1QE1A 3I5AA 4URGA 1U09A 2XC9A 4EBDA 5KFDA 1RYSA 1RT4A 2FVSA 4NZ0A 3QLHB 1XR6A 1N6QA 3HVAA 2XI3A 3DRSB 1S1TA 3QO9A 5DQGA 2UVUA 3H5YA 4B3OA 2JC1A 1UWBB 4KO0A 4KBIA 3LANA 3G6XA 3CJ2A 1TV6A 5DLFA 4NLGA 2ASJA 1C1CB 2YNFA 2WOMA 4RZRA 3DI6A 1HNIA 4IR9A 1SV5B 3MTKA 3V4IB 4IRDA 3KLIA 1FK9A 4H4MA 4QW9A 1S9EB 4ID5A 5J2NB 3MEEB 3H40A 4ZHRB 4ZVHA 1TL1B 4QWBA 1DTQA 4PQUB 3C6UA 1JLCA 5F8LA 2R2SA 4TY8A 3RAQA 4MH8A 1HMVA 4O4GA 5EDWA 2YNGA 4I7FB 3GV7B 3D5MA 1C0UA 4GC6A 2VG6B 4WE1B 3QIDA 2C22A 5EWEA 4O44A 4Y3CA 5JUMA 3M9MB 2BANB 2ZD1A 5KFTA 5DG8A 3T5JA 5KG0A 3NL0A 4RNNA 1HARA 4OL8A 4RW6A 4I2PB 3LP0B 2HAIA 3PW7A 3M8QB 1RT2B 1QUVA 2D3ZA 2FJWA 2HWHA 4QWAA 4WFXA 2W9BB 2HMIB 2BQRA 1TVRB 5KFLA 3V4IA 4ED8A 3OHAA 1TL3B 3BGRA 2FLNA 3N6MA 4KE5A 5KG6A 4RU9A 5J2NA 2AQ4A 1DTTB 4LQ3A 4ECRA 1TL1A 3MR5A 1TKZA 3BJYA 2JEGA 1JLCB 5KFNA 1HMVB 4O4GB 4K4YA 3FFIA 3H5UA 2UVVA 1IKXA 2I5JA 5KFWA 4ICLA 2WONB 4NCGA 3KHRA 3FDSA 1RTIA 4J9KA 2QV6A 4Q8FA 2R2TA 3LP0A 4Q0BB 2J6TA 4O4RA 4XPEA 3MECB 3T5LA 4G1QA 3JYTB 2BQ3A 3T5KA 4K4VA 2IC3B 4NYZA 1TVRA 1BQMA 1TL3A 3BGRB 2ILZA 1RT4B 1RDRA 3Q8SB 5L1LA 2UVWA 4NLTA 4WZMA 2BRLA 5T14A 5KFAA 3M8PA 4IQXA 3D28A 3OHBA 4IH5A 3CJ5A 4TN2A 3DLGA 3MFIA 1TKXA 4IKAA 2HNZA 4R8UB 1DLOA 5KFCA 1C1CA 4JV2A 3RAXA 2FVRA 5CYMB 5DGAA 4K4TA 2B6AB 5KG7A 4J9LA 4J9RA 1R0AB 2AU0A 5HBMA 3NAIA 4ID5B 2OPRA 2W7PA 4ZHRA 2HNDA 5J2QA 1T3NA 1BQMB 2JLEA 2ALZA 1S97A 1C0UB 4EBEA 2V4RA 2VG6A 4WE1A 3SFGA 2E9ZA 4FBTA 1FKOA 3RB4A 1C1BA 3H4BA 3V6KA 1K1SA 3KK2B 2WRMA 5KFBA 1RA7A 1JLAB 5L1IA 2BE2A 2XWYA 4QW8A 1S9FA 3DYAA 4ZVFA 1S0NA 5K14B 3V6HA 5KFEA 4RNHA 1HQUA 3KK1B 1DTTA 4RNMA 3KLHB 1JLGA 1MU2A 1OS5A 2AWZA 1S4FA 2C28A 3KLEB 3GIIA 3PW0A 3V81A 4EBCA 1LWEA 1GX5A 2UUTA 1IKWB 2FVQA 3OL6A 2W8KA 3UDLA 2C2RA 4ICLB 1S1XB 4KV8A 3FQKA 4TYAA 1HPZB 4M94A 3DRPB 4H4OB 2GIQA 2JC0A 4IFVA 3NKYA 3TAMA 4Q43A 1TQLA 1Z4UA 5KT6A 1JX4A 4JV1A 3NMAA 4X2BA 4ZVGA 4K4WA 1S9GB 1EETA 4G1QB 4TQRA 2CJQA 4PUOB 2IC3A 1HQEB 1RTJB 5KFQA 3FSIA 2YKNA 3NGDA 4KAIA 1RT3A 4O3RA 4QWCA 1K1QA 5D3GA 4RW8A 2B5JB 3LAMA 3MEGB 4IH7A 4O3QA 2ASLA 2J6UA 4F4WA 1N5YB 4MK9A 5KFUA 4RUAA 3DLKB 3MEDB 1S10A 3V6DA 1S1XA 4KV8B 1DLOB 4KO0B 4H4OA 3FRZA 2IMWP 1IKVA 4I2QA 2BR0A 4O3NA 4EEYA 2WOMB 2W7OA 2OH2A 3I0RA 5FDLB 4EYHB 4WZQA 2AX0A 1TKTB 2YNIB 3PW4A 2HNDB 4LQ9A 3HVTB 1S9EA 4ED6A 4DL3A 2GC8A 1C0TA 5DQIA 3MEEA 5F9NA 4J9QA 4DL5A 2JEIA 3ISND 5D3GB 2RF2A 2ILYA 4NRUA 1JIHA 2B5JA 2D7SA 3EZUA 5L1JA 3KJVA 5F8MA 4URQU 3IS9B 4ZP6A 4NLUA 4F4ZA 1C1BB 3PW5A 3BSAA 1S1WB 1CSJA 4NLWA 3V6DB 3IGNA 2IAJB 5F9LA 1REVB 5J1EB 1JLAA 3UPFA 4M95A 2BE2B 5KT2A 1JLBA 1VRTA 2OPQB 2RKIA 4ECUA 3QIPB 3CIZA 3I0RB 3DOKB 1LW2B 5FDLA 1S48A 4ZP8A 4J9SA 3PVXA 4K4ZA 1SH2A 1MU2B 5KFJA 1IKYA 4EO6A 3V81B 4ZMMA 4FS1A 5F8GA 4B3OB 3KJVB 3CWJA 2R8HA 1IKXB 2I5JB 5HLFB 3ICLA 2VA2A 1S1VA 3UQSA 1JLFB 4J9NA 4IFYA 2FLPA 3KMQA 1HNIB 4EO8A 4K4XA 4IR1A 1RTHA 4Q45A 1SV5A 5J1EA 3I5CA 5JXSA 3JSMA 3MR6A 4PUOA 4FS2A 3Q8PB 5I3UA 1RTJA 2VG5A 1RT3B 1NHVA 3M9OB 3QIPA 3MR3A 1DTQB 4PQUA 3H59A 4JUZA 3DLEA 4TY8B 1LWFB 3IG1B 3DDKA 2YNGB 3LALA 4I7FA 3NAHA 3ITHA 5J2PB 4RUCA 4ECQA 2C2EA 5C25B 3M8PB 4ZPBA 1VRUB 3DM2B 1T05A 1KLMA 3DOLA 4HYKA 3KNAA 4K4SA 1JLQA 4RW6B 5CYQB 1QAIA 2BQUA 1IKVB 3M8QA 4U6PA 2HNZB 2XCPA 3H98A 4LSNB 3PR4A 2AGQA 2YKMA 4QPXA 3KMSA 1LW0A 2B43A 5KFXA 3JSMB 1RT6A 5DGBA 2VG7B 4U7CA 1ZTWA 2VG5B 1R0AA 1NHUA 3DRRB 3T5HA 2OPRB 3UR0A 4WFYA 3OL7A 4ED2A 2AGOA 3GIJA 2R2RA 2RF2B 3C6TA 4K4UA 1LWFA 3IG1A 5KFHA 2AGPA 5C24A 4O3PA 3QGGA 4H54A 3IRXA 5KFSA 1S1WA 1SH0A 1FKOB 2E9RX 2IAJA 4J9OA 4EYIB 5CYQA 2WCXA 4Q0BA 2W8LA 1T03A 5C42B 4IH6A 2IM1A 3EPGA 2GIRA 2QE5A 1S0MA 4HKQA 3G86A 3N6NA 1JLEA 2OPQA 2RKIB 1D1UA 1S6QB 1LW2A 4ECYA 4MIBA 4DL6A 3BQ1A 4ED0A 2R8JA 3I0SA 4RNOA 1HQUB 3PJXA 3OLAA 1N56A 4QWDA 3KLHA 1RA6A 4IRCA 3KLFA 2IM3A 4MKAA 1JKHA 3QGIA 4GC7A 4NLYA 1RTDB 4ZP9A 1TKXB 4WFZA 4ED1A 4QWEA 3DRPA 4YR2A 3TVKA 4IFYB 4IRKA 3TAMB 5HROB 1RTHB 4ECXA 4RW7A 2B6AA 5DG7A 2EC0A 1T03B 5C42A 2XCAA 5KFFA 4F50A 3NBPA 4G3IA 4RW9A 3H5XA 1SUQB 2E9TA 4RW4B 2YKNB 1S6PB 3DLEB 4MFBB 5KFRA 3Q8QB 5L1KA 3I0SB 1S1UB 1N4LA 3CVKA 3MFHA 4WYLA 1N6QB 4WXOA 5KT4A 2DPIA 1S1TB 3QO9B 4ED3A 3BR9A 4URSA 3PR5B 1KLMB 3DOLB 3KK3B 4YMEA 4ECTA 3KK2A 1JLQB 3OL9A 3DLKA 3BQ0A 3CJ4A 4ZP7A 2W9CA 3KOAA 2YNFB 4DG1B 5HP1B 1J5OB 4I2QB 2YKMB 1BQNB 2ZE2B 3MR2A 1LW0B 1GX6A 5KFKA 4NLDA 2FVPA 1N48A 1LWCB 2XI2A 3NBPB 3KK1A 2YNIA 1SUQA 1T94A 3HVTA 3C6UB 3C6TB 4IOBA 1C0TB 2RDJA 5KFGA 1IKWA 5F8IA 4J9PA 2J6SA 4JV0A 4O3OA 1HPZA 1EP4B 4YP3A 3T19A 4O44B 3KHLA 4IFVB 4ECZA 2BANA 2ZD1B 4R0EA 3QGHA 2R8IA 2R8GA 2V0NA 1QAJA 1S0OA 4MKBA 1S9GA 1EETB 4DG1A 5HP1A 1J5OA 2W9BA 2HMIA 1JLEB 1D0EA 1S6QA 3LP1A 5C5JA 3BSNA 3RBDA 1VRTB 2JEJA 4Y34A 2V4QA 1WNEA 4O3SA 3H2LA 1NNDA 3QLHA 4Q8EA 3MEGA 4PWDA 4NLRA 4YQWA 4F4XA 3CDEA 1TKZB 5KFVA 3BSCA 5KFMA 5DG9A 1IKYB 4TYBA 4J9MA 2RDIA 4NLXA 4DEZA 5EUHA 1JKHB 2IBKA 3VQSA 3MEDA 1HYSA 1RYRA 1EP4A 2WHOA 1RT7B 4TLRA 5F8JA 2C2DA 4ECSA 5HROA 3PHEA 1JLFA 3PW2A 4DL2A 4RW7B 1IM4A 3KLIB 5F8NA 2AX1A 3OL8A 3LAKA 1TKTA 2D41A 2W9AA 4RW4A 2D3UA 3LP1B 1S6PA 3CDUA 2WTFA 3CJ0A 1S1UA 3TQ1A 1SH3A 2XGPA 3GV8B 4PWDB 2IJFA 4LSLA 4YR3A 3OSNA 3ISNC 2ZKUA 3IS9A 3EPIA 3OLBA 1KHWA 2O5DA 3LP2B 3DLGB 1VRUA 3DM2A 1T05B 2XGQA 1REVA 1RT7A 3PJWA 5I42B 2IM0A 3QZ7A 3QZ8A 1ZETA 5CYMA 4IG0A 2HNYA 4LSNA 3BREA 3GYNA 2IM2A 3GQCA 3E01A 3DOKA 1LWCA 3SI8A 4DL7A 2V9WA 1ZTTA 1FKPA 4TY9A 5J2QB 2WB4A 5KG3A 3DRRA 3HKWA 3BQ2A 2IJNA 3FFIB 1XR5A 5DQHA 3GIKA 3HHKA 3I5BA 3GV5B 5HLFA 4ECWA 2R8KA 1S1VB 3KLGB 3IRXB 3CO9A 2ATLA 1YVFA 3Q8RB 5KG5A 2HWIA 3MECA 2WK4A 4KFBA 2OPPA 2UUWA 3CDWA 4NLSA 4Y2CA 5J2MA 5KFOA 4ECVA 4ZPCA 2DPJA 2FLLA 1KHVA 5EWFA 2YNHB 4IG0B 5I3UB 4IDKB 2HNYB 2IA6A 3DYAB 3CJ3A 4YR0A 5K14A 2BRKA 4NLQA 4MK7A 5KG2A 5KFZA 1FKPB 4KHRA 3ITHB 5J2PA 4ED7A 3KLEA 5C25A 2OPSB 1LWEB 2CKWA 4IG3A 4KKOB 4XO0A 3KLFB 5KG4A 1HYSB 4R8UA 3OSPA 3MF5A 1UWBA 1TV6B 4XPCA 1RT5A 3DMJA 3KLGA 3GIMA 5KFPA 3M9NB 3SFUA 1RT1B 4MIAA 5KT5A 4KSEB 3H5SA 4WXWA 3KLVA 4NLVA 5HBMB 5EWGA 1RT6B 4KHMA 4F4YA 2YNHA 1FK9B 4H4MB 2VG7A 4IDKA 3E51A 3RB6A 5KG1A 3QYYA 4RW8B 4TXSA 4WYWA 2FJXA 4MFBA 5L9XA 4Q44A 4LSLB 3KHGA 2I1RA 3GILA 3IN5A 3BSOA 4ZPDA 1RAJA 5C24B 2OPSA 1N5YA 3RB3A 4IG3B 4KKOA 4NRTA 3LP2A 4FBUA 3HVWA 4NLPA 1W25A 3KK3A 4Y2AA 5KFYA 1MMLA 3H4DA 4I2PA 5I42A 4ZPAA 2W9CB 3G6YA 3IGVA 1XR7A 1RT5B 3DMJB 1RT2A 4R5PA 1RT1A 4TQSA 1HNVB 4K50A 1QE1B 1BQNA 2ZE2A 3FQLA 3E01B 2ASDA 3N6LA 1C2PA 3G6VA 2UVRA 5KT3A 4MK8A 1JLGB 4NLOA 2FVCA 3RBEA 1TP7A 3DRSA 5F8HA 3KHHA 2F8EX 4KB7A 4DL4A 3T1AA 3PZPA 5DLGA 2VA3A 2R2UA 1RTDA 4RNFA 2WONA 4NCGB 1S49A 5KFIA 2JEFA 1I6JA 1RTIB 3DI6B 3RB0A
chains in the Genus database with same CATH superfamily
1IQZA 5I4MA 3SBMA 4YDDB 3UFCX 2J8AA 4BWMA 4DXLA 2DNGA 3JSYA 4X66F 2KTQA 2J76E 2LQBA 2VPWB 4HH1A 4DFPA 3NNHA 4C8ZA 4FPRA 1JLBB 4RW9B 1RWKB 4KTQA 3I5AA 1EJ7L 2CJXB 4QIFA 4URGA 1XNRJ 3BEGB 2O66A 1AZSA 1LOUA 3B82A 3QLHB 2F63A 1CBKA 1FE4A 2NSCA 4DR2J 1NMEB 4CLZA 1UFWA 2JC1A 2CADA 2MZSA 4KO0A 1FJCA 3HMJG 3LANA 1U48A 1ROFA 3CJ2A 3X1LB 2ASJA 1C1CB 1T9WA 2MY7A 3DI6A 2VBZA 1HNIA 3IC1A 8AT1B 5D0RA 1SV5B 3MAHA 1FXRA 5EX3A 4IRDA 3KKFA 1HNWJ 4H4MA 2PI5A 2JOQA 2GHVC 2LP4A 3TR5A 3QAUA 4Y65A 2KG0A 4KPCA 3OV7A 1JLCA 1SBRA 2FHOB 4OYMA 3MUMP 3RAQA 3VAMA 1M5OC 2XMKA 3DGPB 5IT4A 1HNXJ 3P5TL 3UD4P 2C3YA 2VG6B 1TAQA 2GIFA 4AL7A 4XTTA 4O44A 2XTJP 4Y3CA 1XNRF 3M9MB 2BANB 1ICEB 3GSDA 5ETTA 3RYLA 2W4PA 4MIWA 5KFTA 1VCTA 1V6HA 2GHPA 4RW6A 2V2KA 4I68A 3LP0B 2HAIA 3D1HA 3JB9k 1ELOA 1QD1A 4B3MJ 1ZBTA 1B0PA 3MAAB 4DX8H 1YZ6A 5DDOC 4P9SA 5DZ7A 3T9ZA 4DZDA 2HLTA 3OHAA 2K1RB 3K57A 2A10A 4IO1A 4ETXA 2E5JA 1GAOA 2Z8QA 1TMJA 3NEKA 3UCGA 6FDRA 3UNGC 1JLCB 1RUSA 2JEGA 1IR0A 3OTBA 5KFNA 2DK2A 3D6FB 3HSDA 5JMNA 3BYRA 3K8VA 3H5UA 4CO2A 1IKXA 3PV8A 4ICLA 2DRDA 2OI2A 2WVBA 3L7OA 3EZ5A 3DDIA 1SL0A 2HGMA 2KRRA 2QV6A 4Q8FA 2HHQA 3TP2A 2F9DA 2R2TA 3TWZA 3LP0A 3ZZOA 2WBRA 5M2PA 4O4RA 4C4WA 3NGUA 3EZOA 2F8HA 3QT5A 1F5BA 1SB6A 5F0UA 3JYTB 5JVGQ 1SJQA 3CJTA 3T5KA 3RW6A 2IC3B 3MPWA 1U02A 1WSRA 4NZ6A 4NYZA 1CJTA 2ZH8A 1BQMA 2OSQA 4ZVOB 2CQ2A 5L1LA 1KFSA 4NLTA 2Y1IA 3EX7B 1N8RT 3CNQP 2UVWA 4R0JA 1FVQA 3FEYB 1E6VB 3KJNB 2LU2A 3NY0A 4RWWA 3OHBA 2GA7A 2LEBA 3PX0A 2J0XA 1RHRB 3MOZA 3TA0A 3TEGA 2DRAA 2EKNA 2GZOA 3KXDA 2HNZA 3BGLA 4CO0A 1GMVA 3WDOA 2VIHA 2VC1A 3BYPA 3H42A 2KJVA 1QTNB 3PCOB 2N7YA 1WHYA 5D78A 1NK9A 1WC3A 3S01A 3GZ7A 1HHTP 2MKJA 4U7UK 1R0AB 2UUCF 3KMQA 3NS5A 4ID5B 2OPRA 2ADBA 2W7PA 1GMWD 2MPUA 5E2QA 2HNDA 1R7IA 1T3NA 4CLYA 1BQMB 2JLEA 1WDDA 1ZOTA 1SC3B 1C0UB 1X31C 4J37A 4G6VB 2XNQA 3SSSA 2C3PA 4OJGA 2V4RA 1KN6A 3DU5A 3K8WA 2B8PA 3NGRA 3V6KA 2R7XA 3GFHA 3KK2B 2A2DA 3N0VA 4L76A 4JI4J 1J27A 5LOQA 2L9WA 2HZVA 2FIUA 3LWLA 1RA7A 1JLAB 5A2QU 5L1IA 4QIGA 2XWYA 2MMYA 1HBNA 2XMMA 1AB8A 3QWUA 4ZVFA 3ZZUA 4DPYA 1QVGR 5KFEA 2XZTB 4PKDB 1FD8A 5D0EA 2QA4G 2NXCA 3D7SB 4N8NA 1HQUA 4RNHA 1VGYA 4F26A 1RAHB 4RNMA 4NI2A 2XS7A 5IM0A 1MU2A 1MROA 2OEKA 1IBLF 2OELA 5BYQA 4N5SA 4JV5F 2W8KA 3OL6A 2HHSA 1VI7A 3FQKA 4KV8A 3ZTSA 2HYIB 3UO0A 2ERRA 1G3OA 4IFVA 2BUNA 2D1CA 2JC0A 4Y0FA 4Q43A 5KT6A 4TU8A 3IBFB 5ETVA 3MD1A 1RKJA 2AV5A 2IRYA 1EKRA 1J5EF 2KO1A 4PUOB 2M3DA 1ULRA 5KFQA 3FSIA 4FF4A 4LFAF 2ZZTA 2B56A 3J7AN 4EZ9A 3K5MA 3OVBA 3D54A 1HWIA 4LR7A 4F0HA 4CLPA 3MEGB 3ZNUA 1U7LA 5HK4A 4IH7A 4O3QA 3M30A 2ASLA 4QCLA 2AJ1A 2J6UA 2Q3PA 4UOHA 2KH9A 1PC5A 1RWVB 4QR0A 4ZCLA 3DLKB 2YY3A 4RUAA 4KV8B 1WKKA 1CULA 2QSFA 1CG2A 1RBOB 2JWNA 2P2CB 3FRZA 6AT1B 3Q22A 5M2UA 4DR1F 4EEYA 3MCSA 2PMHA 4N56A 2DNLA 2DGQA 3I0RA 3ILLA 3WHIA 4CLLA 4DV4J 2QLXA 1M5VC 4B9LA 4Y2KA 4LQ9A 4UZBA 4LF6J 3KNAA 1F9EB 1C0TA 1Q8IA 2GC8A 5BYRA 2M88A 3EZUA 4S0MA 4B3SF 1JB0C 5HI7A 3R8YA 2JHEA 4JI5F 3IS9B 1FWKA 3MWBA 4ES2A 1C1BB 1FHTA 3HHNB 3PW5A 3BSAA 2AYEA 5D15A 4DCPB 1UMJA 5IC4B 3SQGB 1NK4A 2HRUA 3WZ0A 5B0DA 1NK5A 2BE2B 2N82B 1QDUB 2QX0A 2QYCA 1UETA 3OFFA 3SCJE 4CDIA 2OPQB 2LEPA 2LMIA 3QIPB 3CIZA 3I0RB 1S48A 3S7RA 2OAUA 2CPIA 3HHLA 4BHQA 3PVXA 2XMTA 2V94A 4WK3A 1XMQF 4EO6A 1U8SA 3V81B 3NS7B 2PMZD 3CUNA 2IVFB 1Y5LB 4USJC 3M8ZA 4C8KA 2ZDPA 1D3WA 3AQPA 2IY5B 1RI7A 1RWMB 2P6SA 3VF0B 2XY5A 2ZZNA 2W2NP 1RZMA 2CIMA 1UA1A 4J9NA 2GQ2A 3PX6A 2FLPA 1HR0J 1BWEA 1H2TZ 4K4XA 5I3QA 1NK6A 4DWIA 4CYUB 3P45B 4WKYA 5JXSA 2CDRB 5C2CA 4FS2A 2MDAA 1RTJA 1EQMA 2R7QA 5D4NA 1F2GA 1AXQA 1RT3B 3D6TB 3TRGA 5DDQC 1VR6A 1H0HB 3QIPA 3MR3A 2ZEJA 1DTQB 4M63A 2H3EB 3FNNA 1RP5A 3DLEA 3H8YA 3IG1B 3HHLB 4RBVA 4TY8B 5I3PA 4I7FA 5LL6d 3ITHA 5J2PB 2BZ2A 2FJEB 2XMJA 4DX5A 4I6WA 3FVYA 5FD1A 4ELVA 1NEEA 1XIQA 1VRUB 2R42A 2ACMA 3PTWA 1KLMA 4HYKA 2HVIA 5J1PA 3ENQA 2OEMA 1IKVB 1Y11A 1PYTA 3EVOA 5CYJA 2ASYA 4U6PA 4WU3A 3PR4A 3DU6A 2M7SA 2EG2A 1P6TA 2ATCB 3D0HE 4UW2A 4DS4A 4CYUA 1FT8A 2J7KA 3KMSA 4DSIA 3TNVA 3UVJA 1BD6A 3T5HA 3DKDA 1NHUA 3EXYA 1RAIB 1TMMA 2NS1B 3GIJA 4C8YA 2R2RA 2RF2B 3RBZA 4DQSA 4GKJF 3IG1A 4PXEA 2KG1A 5KFHA 2F7VA 4JI0J 1I94F 5C24A 4O3PA 1C4AA 3B4MA 3J81Y 1FKOB 2HBRB 4J9OA 4F8RA 1RAEB 1GMWA 2HRTA 2BYCA 2WCXA 1S79A 4YS2A 2P9EA 2ZUGA 2IM1A 4IH6A 1CLFA 2QE5A 1D8YA 2BVZA 2J9DE 4HKQA 1URNA 4DR3F 1JLEA 2RKIB 4N8OA 4DF4A 2E1AA 1XMOJ 2J0WA 3N5BA 1LW2A 1RWXB 2QMUB 4FKXA 5SUHA 4ECYA 1UVLA 1RHQB 2QGFB 3UN2A 3UVJB 3BQ1A 3HK2A 3BO3A 4JYAF 2HHVA 2DB1A 2Q79A 2B3TB 4DPOA 2HS0A 3KLHA 1RA6A 2BJDA 3KLFA 4FN5A 2KVQE 4CLWA 3IO1A 1M5SA 1RBAA 2HHXA 2Y8WA 4YR2A 1XNQJ 3VAHA 4IRKA 3TAMB 3QSIA 1NB2A 1RTHB 2GQCA 1PJ7A 4RW7A 2B6AA 3CIMA 3O3LA 3SQOP 4ZDNA 2OMLA 1VHFA 1YJRA 1YX2A 3NBPA 2H51B 1VK8A 3HI9A 5A8RB 3QRPA 3LW5C 2YKNB 4MFBB 2CNOB 3Q8QB 2C3MA 2ALYB 2JH3A 1S1UB 2ZBCA 2PA8D 4OZ2A 5K20B 1N6QB 2DPIA 2DGWA 4ILLA 3P49B 1S1TB 4IQXA 3GLJA 1Y9OA 2GCFA 4FVCA 4KPYA 4ECTA 3W63A 2F4VF 2AT1B 2E5GA 1JLQB 2V63A 1R8PA 4M5DB 3R5BA 4LT6A 2YNFB 3KOAA 1BGXT 5HP1B 2MQOA 3CF5Q 4DV7J 1FWPA 2GQQA 2BDPA 1W2IA 1BQNB 2YPZA 3J81U 3MR2A 1YI2S 2W01A 2H5IB 2QSWA 2C2KB 2AYGA 3TUZC 1LWCB 3NBPB 2DHHA 3KK1A 1T94A 1SC6A 5DDRC 3HVTA 1IUJA 2CZ9A 1Q95G 1RK8A 4FYWB 4K59A 1U2CA 5GAGI 1O51A 1NZ8A 3KTQA 5F8IA 4Z7YA 5E3PA 4O3OA 4C11A 1QJHA 2E44A 1Y5NB 2DIVA 2E29A 3PXGa 2R8GA 4DR7F 4J9UE 3M7VA 1Q8KA 1RCOB 1NLKL 5HP1A 3QFWA 2UXDF 1GTHA 2MJNA 2RIJA 1D0EA 2ZC3A 1S6QA 2JVRA 3LP1A 2P9GA 2PD1A 2WVFA 3BSNA 4JI2J 2JEJA 1RABB 2DD8S 3BBFA 3PACA 2V8DA 1WNEA 4C0HA 1YIJS 3QLHA 2GJFA 4DV0F 4YQWA 2A3JA 1IBKF 2UXCJ 2HQIA 5D6GA 4JI5J 1TKZB 1RAAB 1S4EA 3BSCA 2G0IA 5KFVA 4J9MA 2RDIA 4NLXA 2XMAA 1QM9A 1RAGB 3VQSA 4C3MA 3LF0A 1HYSA 1AFIA 2GMLA 2ZOMA 1VLOA 4ES3A 4LF6F 5IWAJ 5IQ6A 3W9JA 2K3IA 4P2SA 1F5AA 1HW8A 1UEKA 5LSLA 3VAGA 2HHWA 3NRBA 4W90B 1G1XA 4C0OC 1MLAA 2CVEA 2QL9B 1IBKJ 1TKTA 2D41A 3JQMA 3SXLA 4D3GA 2UXCF 3UCUP 1V3RA 3LP1B 5H9FK 1XMBA 2V2ZA 1KONA 3GJSB 3SEOA 3E2EA 2XLKA 4OYIA 2IJFA 4YR3A 4LSLA 3B8HA 1U0HB 2UXDJ 4BDPA 2XB2D 4NA3A 1SVDA 3W60A 2QFIA 1A7GE 2HPUA 1NDLA 4L72B 3DLBA 1T05B 3M8WA 1JJCB 3OR1A 3EGWB 5CAAA 4LFBF 2CXEA 2PSZA 2RNEA 3KDNA 5I42B 1S99A 2MTLA 3MZIA 2MB0B 2YKOA 1BLUA 2LA4A 2MKKA 4WKRA 1JNRB 3BREA 3MMAB 2F8MA 2IM2A 2YX1A 2V69A 4KC5A 5DJBA 3VAFA 3J7ZT 1IR2A 2CQBA 5AT1B 4X65F 1ZTTA 1N33F 2HSEB 3AXMA 1FKPA 2J9DA 2QRRA 5J2QB 1B4SA 4TY9A 3DRRA 4XAKA 4PXCA 2LQ9A 5T7LA 3BQ2A 1HLWA 3AQOA 5B08A 1XR5A 4CH7A 4DPXA 3OXFA 2CQ3A 4L6V3 4F2SA 5G0RB 3OBIA 1WC6A 4KGMA 1M5KC 3I5BA 5HLFA 2EK1A 4NYOA 1BXNA 2HQFA 3R6GB 1YVFA 2R4FA 2X1BA 2YQ1A 3ELHA 1IWGA 2WK4A 1L5UA 3MUVP 1N0VC 3GG1A 3FCHA 1RU1A 1YBUA 2JRSA 4NLSA 4PABA 5KFOA 2IYGA 2YNHB 2EFOA 4IDKB 4JI4F 3JAMU 4D3HA 3NMRA 5K14A 2YBVA 2NQPA 2KYZA 1VDHA 3W5ZA 2BX6A 8RUCA 1NJWA 4A8MP 1FKPB 1WOSA 1CS4B 1Q86T 5C25A 1N54B 5T7LB 3LGNA 1L3TA 4IG3A 4KKOB 4XO0A 1KQKA 4CLFA 2RDDA 3K89A 4FNIA 2O67A 3VTIA 3R7SB 2KKHA 3K7RA 4F3OA 3UDVA 3M9NB 5B0AA 2ZBRA 4MKYA 4MIAA 3JQKA 3H5SA 3FJ2A 2CZ4A 4WXWA 2IJRA 3CCRS 2MZ1A 5EWGA 4GMKA 2HHHF 1LXNA 4KHMA 2YNHA 4H4MB 1UW9A 2VG7A 4LRAA 1F3VA 4IDKA 2FHMA 4X4RA 4JYAJ 2FHKA 1PSDA 5KG1A 1VBXA 1TR0A 1RXOB 2J0SD 3IN5A 3AOAA 1DHMA 2KHCA 4ZPDA 3TAQA 1WHVA 4RL1A 2VC0A 3R5CA 2JFDA 2J8SA 2DGSA 4IG3B 4KKOA 2Z2ZA 4NRTA 4UOCA 3HVWA 3SCKE 3CCJS 2N7CA 4LF5J 3U1NA 3KK3A 3PM9A 4Y2AA 5KFYA 3TVZA 4UY85 5FJ4A 3MMJA 1D9AA 4LBPA 2ZOFA 3G6YA 1WF1A 2RRAA 1UCNA 4JI0F 4TQSA 3HHLC 4GKJJ 4DS5A 4K50A 1QE1B 2ZE2A 1HWKA 5ETRA 3E01B 2QLBB 3G6VA 1C2PA 1BE4A 4E2FB 2ASDA 4KQZA 1HI0P 5KT3A 1RSCA 5IM0B 3CJ8A 3FEXB 2FLOA 1TP7A 1Q8BA 3DRSA 1I51B 1MMNA 2VPZB 1UFLA 1W26A 3AJDA 3M6WA 4DU7A 4KB7A 3CC2S 4DL4A 1KNZA 3T1AA 2VA3A 3OVSA 1FFSB 5LM7E 1VQYA 2R2UA 2E1CA 4L73A 1S49A 5KFIA 1VQMS 3A3NB 3W5YA 3K5PA 3FRYA 3MCOA 4B9VA 4KFBB 1N88A 1CC8A 3TA1A 3V6JA 2OFHX 5IXUA 1O5JA 3JTOA 1NJYA 5KT7A 3JYTA 2Q6BA 4M8LA 4IQMA 4OZ0A 5D4OA 5A8WA 2HGNA 3CE8A 1X7VA 1QE1A 3JSRA 4A8YA 1U09A 5AXNA 5KFDA 3ZTPA 4Y2IA 4FXDA 2FVSA 2Q43A 1MSWD 2PC6A 1XR6A 4YB7A 2BW2A 3DRSB 2OUGA 1N5VA 3QPIA 4KHPJ 1VJWA 2LDIA 3H5YA 3L4BC 4ZPWR 1UWBB 4F7VA 4KBIA 5LSOA 2VU5A 5DETA 2HS4A 2VPYB 1BY9A 3POTA 3PNIA 4KGXB 1WELA 4DV6F 5DLFA 2QN6B 1HBMA 2RMLA 3IXQA 1X9MA 4IUFA 4FYXB 2XZDB 2BA9A 2BMBA 2D9PA 3V4IB 1TUGB 3MTKA 4FYYB 1B3TA 1ZPWX 2HWTA 2RHQB 3PRDA 4QW9A 5A8WB 2JFKA 4ID5A 4ZVHA 2OFGX 4PQUB 2OJ3A 3G71S 2V8PA 1DQ9A 2MGZA 3C15B 5A8KA 4F2RA 2W2OP 2XMUA 1C0UA 3D5MA 4B9UA 1GMUA 2QMXA 3QIDA 5U47A 1YJTA 1RWPB 3LPYA 3B78A 3IBWA 3LUYA 4X64J 2POKA 4CO3A 5KG0A 5ADZA 4RNNA 1HARA 3UI3A 2DHAA 1CQNA 3M8QB 2ZDOA 3F0NA 1QUVA 5LMNJ 4TU9A 2B9XA 3A8KA 3R2CJ 2HMIB 3HULA 3BN4A 1M0SA 3AA8A 4B3SJ 2R7SA 3V4IA 4P75A 4OYBA 3N6MA 2FZGB 3NCPA 1RU2A 4BC9A 3PIPQ 4U7UD 3AJ2A 3VWSA 2VZ9A 2IVYA 3BJYA 3GTYX 5HANA 4QIVA 2BJ7A 2WW8A 2VJVA 2MGZB 5A6WA 3QJJA 2CPHA 5CD4H 3CW2C 3FFIA 2HEKA 2UUAJ 1SKWA 5GAHU 1N36J 4I64A 1YGYA 1RTIA 2Z30B 3FDSA 4J9KA 1T8EA 3D1QA 3TI0A 4AD6A 2EKYA 4DSLA 1VC6A 1REGX 3V4MA 4XPEA 2XSJA 3MM6A 3N79A 1HWUA 2RE1A 3QRQA 1ZAWA 2DNHA 2NSBA 4P71A 5LXYA 4ZLLA 2XNRA 4K4VA 2FC8A 4ZJQA 2ILZA 2MQMA 1RT4B 3RJMB 5AE3A 3MR7A 1NB7A 2H4WB 2BRLA 4PG8A 1FE0A 5T14A 4WFBQ 3M30B 1J5EJ 3DGVA 1N5TA 1QTMA 1TUVA 1TUWA 4HVZA 4TN2A 1OY9A 2CQ4A 4LREA 3MFIA 1TKXA 1SKUB 2D3O1 1L3UA 3UE2A 4JV2A 2G2YA 4USHA 3U1MA 4DV1F 2FVRA 5E7OB 5CYMB 1WTBA 1B0VA 1WWHA 4K2XA 3TZYA 3VV2B 4AUKA 5DGAA 1DQAA 3DXSX 4HACB 2DHSA 4UQGA 3OXLA 4ZHRA 2BEFA 5A2QY 2DXEA 3D3BJ 3GP9A 3A8IA 4ANDA 3PIOQ 4B3RF 2AJQA 2AIRB 2KT2A 3KWMA 2N3LA 2G0CA 2RU9A 2K2PA 4ED4A 1TK0A 3K59A 4WE1A 4CLUA 1DY3A 4FBTA 4FXWA 2CNLB 2JDJA 3OR2A 3H0PA 1FKOA 4ALZA 5LMNF 1C1BA 2K3KA 4F0KA 1K1SA 3H4BA 4DN0A 4IYQA 4LF4J 1X4HA 3VAIA 2XLIA 1PO6A 4X64F 4LJMA 7AT1B 4JI8J 3P4UB 3PO4A 2ZNZA 1DAXA 3DN9A 4I69A 2Z58B 2BE2A 4YN3B 1S9FA 2G9OA 2O01C 3O8WA 3T41A 4DUTA 1FCAA 2BXJA 1SJ1A 3MOJB 3MM5A 4WBFA 2XSFA 3PEJA 1NM2A 2BQ3A 3TANA 3KLHB 1JLGA 1CJVB 1J2VA 2AWZA 3G82B 4JOUA 2CQHA 2QC3A 3KLEB 2E1MC 4NZ7A 1PGZA 1EIYB 3V81A 4L3KA 1FESA 4ZN3A 2VDIA 3ILOA 4ZPVR 1VOMA 3SFGA 1PCAA 1U45A 2DGTA 4H4OB 2GIQA 3AAWB 3EDRB 3IWLA 3TAMA 1ZS6A 3IWXA 1TQLA 1Z4UA 4MJKA 2KXFA 3JSBA 5HO4A 4DV6J 4JV1A 1Y0HA 2CQ0A 2HKEA 4PYDA 4ZVGA 1RWUA 5ETMA 3CMAS 3AXKA 5IS2A 2CJQA 2QA4S 5LXRA 1S76D 4USWA 1RTJB 3DC2A 2F40A 2YKNA 3NGDA 3NGSA 1RT3A 2HBQB 4KGVB 2LXFA 1WC4A 5K5MA 3I87A 4QWCA 1U1PA 2HHUA 4ZJLA 1H6KX 4RW8A 2I9SA 4F4AA 3PRVA 2MY8A 3TX0A 2DHGA 1N5YB 1EKSA 1WI6A 3H20A 4MKVA 5KFUA 1FJGF 3MEDB 2CQIA 4K5RA 5B0GA 4EFAC 2HVZA 4X4PA 5IT0A 1S10A 4K0KJ 4H4OA 3PHTA 2IMWP 1IKVA 1KVKA 2IA0A 2AYMA 2NZCA 2VICA 1Y10A 4P73A 5HMWA 2BE9B 2KT5A 1HFEL 5HMXA 2W7OA 1S6UA 4DSEA 2OH2A 1PJ6A 2X3GA 4OYXA 4C97A 4C98A 2XBPA 1U6FA 4BLGA 4EYHB 3W64A 1UVMA 2AX0A 2C2ZB 4NOHA 4LF4F 4ED6A 3HVTB 1FRJA 4K0KF 3BKTA 5DQIA 3MEEA 1RHMB 4DL5A 2QIFA 1FJGJ 2HVHA 2RF2A 3QWPA 3VGVA 2D7SA 1WG4A 3KJVA 4Y28C 2Q66A 2CG8A 2V8VA 2W7AA 4QR1A 4URQU 4ZP6A 1NK0A 2LXUA 4OHXA 1F0XA 1R31A 2YX7A 5DDPC 3MPUB 2HFUA 4F4ZA 5H9EJ 3TUPA 4B3RJ 2BM0A 4CH0S 4NLWA 4W4MA 3BM7A 3IGNA 1Q81T 1N52B 2F9JA 1REVB 3W3SA 5J1EB 1HWLA 1VYAA 1XJWB 1RTZA 4DPTA 4M95A 4PG6A 4Y00A 1UP1A 3FCWA 3R5DA 3DXBA 3PYDA 3QGPA 3SZ2A 2RKIA 3A3PB 3BPDA 3C66A 1LW2B 4K4ZA 1DFDA 1RGVA 1N34F 1WSVA 1OIAA 4LSZB 3H2UB 3I6PA 2M8HA 4RO0A 2HHHJ 4ZMMA 1FEHA 1ZAXA 2UV8G 1X5PA 3M6UA 7FD1A 5CCLA 4B3OB 3KJVB 4LR8A 1YJ7A 1FEEA 2FDNA 2R8HA 3QT7A 2I5JB 4QYRA 2XO6A 2VA2A 1GNKA 1S1VA 2ZVIA 5HJXA 1S72S 1AUDA 4LF7J 1NPKA 5EHHA 1RTHA 2RVJA 4ZCMA 4Q45A 5J1EA 3HKZD 3I5CA 2FZKB 1VQLS 3JSMA 4YB1P 2EBGA 3Q8PB 4RWXA 1VQPS 2APOA 2L3MA 5K8OA 4A8KA 2YWWA 2UVRA 2YTCA 3O5TB 2XLJA 3H59A 3ZZRA 5DG8A 3V2UC 4ELUA 4GVBA 4OI0A 2YNGB 3LALA 1ZZFA 2G0JA 2MLZA 2LEAA 1SPBP 4Z2XA 2RUSA 4RUCA 3CULA 2VUGA 3BZQA 4TKTA 3M8PB 1SL1A 1HKAA 4ZPBA 1T05A 1OSDA 2WAQD 1JLQA 3MAQA 3CC7S 1YJUA 4DFKA 1FNMA 3SCLE 2XS5A 3FBCA 3QQCD 3T3FA 1KP6A 3QT8A 3M8SA 2MKCA 1ZYQA 2MHNA 2RAQA 1KRPA 1G6BA 1U6BA 4YY3F 4HTIA 3JSMB 3OQ2A 2KI2A 2ZBQA 5K8PA 2KB2A 1CC7A 1ZTWA 3DRRB 2AGOA 4ED2A 4J7CA 4WFYA 2C1EB 1RHJB 1HNZF 4OYOA 4GVBB 3ZNJ1 2AGPA 1HI1A 5KFSA 1S1WA 1MG7A 1SH0A 1UVKA 2HIQA 4MT1A 2IAJA 4DMZA 4EYIB 4LFBJ 3US5A 2AEMA 2VHGA 4Q0BA 2VOOA 4DX7A 2V50A 2BKPA 2DIUA 5C42B 2HK2A 3Q24A 4C48A 3N6NA 3BBBA 1D1UA 2ROEA 1S6QB 1QAXA 2NREA 3RAMA 4ZLPA 1P9YA 4MIBA 3OLBA 1HA1A 4ED0A 3I0SA 2IHR1 3TEHB 4ZLJA 4RNOA 1ITPA 3N5FA 4QPTA 2GGPA 1N56A 2XWXA 3L7PA 2UUAF 2RJZA 1HQ2A 3GONA 4B9TA 4IRCA 3W65A 2CYYA 1ACMB 3BO4A 5D4LA 2IPOB 3LWMA 1RTDB 2V5HG 5C7PA 3KG0A 1X4BA 3MTJA 2MZQA 3EVMA 5IOLA 2ZH6A 2Y8YA 2YX4A 3KYLA 1SJFA 3H90A 4ZJOA 1BMQB 3KDOA 2OD6A 2N4CA 4J9VA 2OLWA 2R7OA 1DJ0A 2LECA 5H9EK 5C42A 4LRBA 2VH7A 4FNHA 5KFFA 3GCXP 4F50A 3NGTA 4RW9A 4DV0J 3BGUA 2RUGA 1SUQB 4UUXA 3H5XA 2GFFA 3X3UA 1F9HA 2DITA 2K7KA 1RLDA 3VGTA 5HN0A 5LT5A 5L1KA 3ULHA 2KYXA 3I0SB 2QZ8A 2Z0GA 3CVKA 2DCUB 4ANEA 5KT4A 1PAUB 4ZCKA 1FRIA 1JXEA 2HFZA 3LO3A 5IT9Y 2D74B 3PR5B 4DLGA 3DOLB 3KK3B 1HIYA 2MXYA 2KM8B 3VVUA 2FQQB 3OR1B 1NDPA 1PG5B 4DG1B 1SC1B 2L9DA 4BC7A 2CWXA 1RHKB 2CQDA 2YKMB 2ZE2B 3ILJA 1LW0B 3TOQA 3UD5A 3CCWA 4ZIVA 2B7CB 2CRLA 2FVPA 2F65A 2XI2A 3UDEA 4IOCQ 2YNIA 1SUQA 4X4SA 1JJHA 3C6TB 4IOBA 3QATA 1NH8A 1RWOB 1PILA 2CQ1A 2UZAA 4KT0C 1X5SA 4DR5J 1IKWA 1ZZNA 4LF9F 4J9PA 2J6SA 3P8BB 2FPHX 2P9CA 1HPZA 4YP3A 4DV7F 4O44B 3CMQA 5EN1A 4QZVB 3D6MB 2BANA 4ECZA 2R8IA 3QGHA 3PKYA 1VQ8S 1JJ4A 3LQVA 4HLBA 3TO8A 2IFXA 2V9KA 4MKBA 1WEXA 1UVNA 1XERA 4O0IA 1S9GA 1EETB 2CZVC 4DG1A 1RAOA 5CZXA 1T9TA 2KL8A 3FSXA 3MAAA 3J81j 3I9V9 3K5NA 5EGYA 5LMUJ 2AYBA 3HFKA 3RBDA 2QA1A 3LOUA 4YHHF 3CTRA 3FBFA 4M5GA 4O3SA 3H2LA 1DZ5A 1PC4A 2OSRA 4CP5A 1NJXA 1HWJA 1U2FA 2B0GA 1SI9A 3M8RA 1IKYB 4TYBA 4H4KC 4RBTA 1S0VA 2YKPA 1JKHB 1HHQA 1O0PA 4ZCIA 4M5MA 3GFZA 4A46A 3PFOA 4YDXA 1U1KA 1RYRA 2WHOA 4KRWA 1T7PA 2X1GA 4EZ6A 4XDDA 2PIIA 2DNQA 4ECSA 1YRXA 5HROA 1HW9A 1F6TA 2B51A 4ED5A 3P5BP 3OTDA 2VQEJ 2M2BA 4AT1B 1Q8LA 4DV3F 1Q53A 2A2CA 2AX1A 3LAKA 1A0OB 2OTJS 4RW4A 1NUEA 2D3UA 2KDOA 5HVHA 1S6PA 3CDUA 4A48A 1JJ2R 2NZ4A 4N47A 3AD8C 1NCLA 2FB0A 2U1AA 3AJ1A 3CJ0A 4LF5F 4O23A 1WC5A 3GV8B 1DARA 1VBYA 3OSNA 2MSTA 3ADAC 2XULA 1D9DA 2VD3A 4CLSA 3I82A 3EPIA 2W4CA 2FJBB 3IR7B 2B9WA 1LEOA 1ZM3A 2Y3YA 3C14B 3DM2A 4NA1A 4X65J 4X4QA 3KJQB 3PJWA 2W2QP 4P6QA 1WOPA 1HD0A 1FX4A 1TL7B 4EU0A 3TQEA 3GYNA 2LFVA 3M2VA 1EZZB 2Z57B 3E01A 3DOKA 4OZJA 3SI8A 1YK9A 3ZZ0A 3T1YJ 3QNWB 1FJEB 2ZVSA 1XN9A 2WB4A 2B4UA 2XMWA 4LF2A 3TJ8A 3FFIB 5B0EA 3ZTOA 1DQ8A 3SIPB 4DCOB 1VQ7S 3OTCA 4DLEA 4M5NA 3HHKA 3D67A 4NCAA 3JS9A 2R9LA 2MZTA 4FKYA 3DCAA 3MMBA 5BR8J 2XY7A 2QLFB 2ATLA 2W2MP 5KG5A 2CJAA 2HWIA 2XSJB 4KFBA 2UUWA 3MM6B 4YB6A 2BV3A 1P9QC 2V9WA 5HQMA 4M5HA 1R8AA 4KH1B 5EWFA 1TL7A 2DGOA 1M1GA 5I3UB 1UEUA 1UWAA 2NXEA 2FUG9 1FX2A 2RD5C 4GRSA 5D77A 4WP9A 4YR0A 2DGUA 4IO9Q 1ZM4A 3M1VB 1U6ZA 3VALA 4MK7A 2VFTA 1U4BA 4C2MA 4GO7X 3RG6A 2OPSB 1Q5YA 4LF1A 2CKWA 3ISZA 3RTVA 5CH7B 1Q78A 4U8YA 5DM6Q 5KG4A 5AJ3F 5GMEA 3OSPA 1UWBA 1N33J 8ATCB 1T3OA 4ZVPB 1JK9B 1RT5A 3DMJA 5FLXU 1S0MA 4ZA1A 5KT5A 1JXVA 4KSEB 3PJ9A 3VAKA 4HACA 5C2GA 2VFRA 2ROGA 1RT6B 1HL6A 2CFXA 4DSFA 3AH6A 3FBEA 2ZWPA 3E51A 4P52A 2IDLA 3RB6A 3G9CA 1NSAA 3L95X 1UJ5A 3M1VA 4PEOA 1X9SA 4C8OA 3QYYA 4WYWA 3KHGA 3D6HB 4Q44A 2I1RA 3BSOA 3C15A 5A8KB 3OR2B 3CCSS 2OPSA 4OI1A 3HX9A 4CT8A 4KJIA 2WW4A 1IM6A 2OIHA 3TW0A 4CLTA 1VQOS 1WEZA 5DRKA 5KTQA 4DV5F 1CULB 1UFKA 4ZPAA 1HD1A 2LXIA 4CNZA 4ZITA 5AJ3J 1RT5B 3DMJB 4UZCA 3W8GA 4KHPF 4R5PA 2FHJD 5HL7Q 2C3UA 1HNVB 2HIYA 3SMZA 2CG4A 2KU7A 2G1HA 2CWKA 2VBWA 3M32A 1WHXA 3AB2B 1JLGB 1CJVA 4MK8A 2UUBF 4NCBA 3RBEA 2FVCA 3IAM9 2EVZA 3TYTA 4DV4F 2DR6A 4ILRA 5F8HA 3HD1A 3BDEA 5HATA 3U27A 1WF0A 1Y7PA 1PKUA 2J0QD 4DX6A 4USKA 1WORA 2DH7A 4C7QA 3MURP 2JEFA 3DLHA 2M52A 1YTYA 1RTIB 4JI1F 4JI6J 4F36A 1R3NA 7FDRA 3A12A 3SQGA 5J2MB 1RB0A 4M5IA 2L41A 3DHWC 3W1YC 4V19J 4R5PB 4X62J 1UL3A 4A8WA 1HNVA 3LGHA 3WBZA 2CJBA 5KAKA 2NXJA 3FCVA 4K5SA 3I55S 2Z56B 1NKCA 1XNQF 2YQ3A 1R89A 2H1YA 2CNKB 1RT4A 1LV5A 4LFAJ 4FDFA 1JMTA 1B70B 2KFYA 3HLUA 1VISA 1K0TA 2AD9A 3PRBA 3QO9A 1SQFA 1ZAVA 2CPDA 5DQGA 2UVUA 2DR7A 4OIXA 1Q0NA 1UJ4A 3RR8A 3KG4A 1MN7A 1TZ0A 3HT0A 3BO2A 3C2PA 3R1LA 3VZHA 4NLGA 1K9MT 3TVYA 4G65A 3EICA 1G4CA 2FY1A 3ZO7A 2GMHA 2HGLA 2QA2A 2D3OR 4IR9A 4JV5J 1CEZA 1FXDA 3KLIA 3TZWA 1GQEA 3R97A 4IOAQ 4UF4A 1VK3A 5MAOA 3MEEB 3OFGA 4ZHRB 4ATNA 1DTQA 3C6UA 5F8LA 2R2SA 4TY8A 2X1AA 4O4GA 2MSSA 3U02A 4I7FB 5EDWA 1U1MA 4GC6A 2YVSA 4WE1B 2VQEF 4DV3J 2C22A 3FUYA 5EWEA 1K8AT 2ZD1A 4HH0A 4LRDA 3T5JA 1U1OA 4FPIA 5A0YA 4OL8A 3W5XA 4USTA 3PW7A 1SL2A 1RWNB 1EB0A 4KY3A 4E0DA 2E1PA 2FGCA 2FJWA 1FTCA 1RHUB 2VV5A 4Q2MA 4QWAA 4HL9A 1VQNS 2W9BB 2P6TA 3M6VA 2HZCA 2VB6A 3DHXA 2FLNA 4RUBA 1TL3B 1EX8A 3DOMA 4FF3A 3MMCA 4KE5A 2DNMA 3JQJA 1Q1KA 1OQ6A 5KG6A 3G96A 2AQ4A 4LQ3A 2AF6A 2YWEA 2E66A 2V34A 3G82A 3J80U 3SV4A 1L3VA 3CD6S 4O4GB 5GAEU 2UVVA 2Y1LB 2I5JA 1B7YB 2WONB 5THWA 3EGVA 1HBUB 4LR9A 1HBOA 3UNYA 3PY8A 3CGIA 1XMOF 1NU4A 2KT3A 2MQLA 3SSQA 3T5LA 1XTZA 3GU0A 2VFSA 2XMVA 2YPYA 1HR0F 2PGCA 1UJ6A 5KOWA 1KVIA 1TL3A 3DOMB 3PYFA 3U1LA 1RDRA 4LF8F 2PO4A 1ZA1B 3M05A 4FXVA 4HEA9 2Y0BB 2I6WA 3M8PA 3KFWX 2WSEC 1P1TA 3FMBA 4C6AA 3D28A 1VMBA 3NP5A 4OV1A 4J5OA 5A76A 3CJ5A 3DLGA 2MKIA 2BKOA 4BCAA 3PYGA 4IKAA 1NH7A 3O44A 5KFCA 3CCLS 1HBUA 2GW8A 1HBOB 2ZBIA 1KOOA 4OLPA 4NXMJ 4K4TA 2B6AB 3WX4A 5SZTA 3RRGA 4NASA 1N0UA 2VKZG 3CJKA 1TK5A 1KR4A 2X3DA 3NAIA 2LDYA 2VPXB 4LRFA 3Q8UA 3DLJA 2P8IA 2RB7A 2ALZA 5GAGU 3ET6B 3OW2R 2DCLA 4EBEA 2MEWA 3A8EA 1VJQA 1NHKL 4Z37A 4NX9A 2E9ZA 1EQ0A 3UW1A 4GO5X 3ETOA 1X4GA 2OTLS 1YRUA 3GR0A 1VQ9S 3DNCA 1X8DA 2GJIA 5LJ3Y 2DGXA 2HZAA 2LLZA 1NJZA 2K8GA 3ETMA 3DYAA 3M2RA 1S0NA 1H98A 1L3KA 3A4TA 4NYPA 3CJKB 3MCNA 3VHQA 3ZFVA 4DV5J 4USUA 3KK1B 1DTTA 2HURA 3IR6B 2H65B 4FF2A 2DNYA 5CA5A 2HQ3A 3PW0A 1HNWF 5HMZA 1LWEA 2B7BB 3ENAA 3ET6A 3VGUA 2C2RA 3EWGA 3UDLA 1S1XB 4TYAA 4C11B 4RU2A 4M94A 2BJ3A 5CABA 4NWBA 1IVZA 1Z2LA 1BUXA 3WX8A 3IRWP 1OQ3A 2L48A 1JX4A 3GE9A 1WG5A 3PFEA 4LBHA 1I1GA 2G13A 3MM8B 1YWXA 2GS8A 1E6YB 1F9FA 4CM0A 4G1QB 4TQRA 4RJVA 4RPFA 5HQLA 2QLJB 1D9FA 3TX8A 1HQEB 1FD2A 1KTVA 1XEZA 2HFSA 2ZC4A 3AA9A 4CZCA 1R27B 2W1BA 4UT4A 3ZTQA 3S1TA 2B5JB 2EXUA 3LAMA 3SDEA 4FYDA 5G4DA 2R7TA 3GJRB 2O3DA 2EW9A 1T95A 2JNJA 4MK9A 1MMDA 4DN9A 1SXLA 2DXDA 4DBQA 2AEFA 1QLNA 1X60A 3V6DA 1S1XA 1R0BG 3EMTA 1DLOB 4OZ3A 2RU3A 4CH1A 1O6XA 4ZVUB 2Z2LA 3R5JB 1U25A 3GJQB 4NL5A 4QYZK 2DKOB 2HBYB 2WOMB 5E3CA 1FRKA 3MM8A 2B8QA 1UTAA 4A8OA 1E6YA 3CXCR 1KQFB 1URRA 5FDLB 1TAUA 4DQPA 2A1BA 3I56S 4DR1J 3MEKA 1TKTB 2YNIB 3QT6A 3PW4A 1S9EA 1TL5A 5JVHQ 5HSPA 5FIIA 2DEIA 4J9QA 4CNYA 5F9NA 4ERDA 2JEIA 2ROPA 1C4CA 1Y00A 2ILYA 3D68A 2B5JA 3GB0A 1M1HA 4WIQA 1UVJA 3C3LA 4HI2A 3N28A 1RISA 1U0HA 1QUPA 2VL1A 2F3JA 1H73A 2OMOA 3TAPA 4B3TJ 1ZA2B 4M5LA 4NE9C 3EGZA 1S1WB 1KS2A 3T1YF 1AW0A 3V6DB 2IAJB 2EFPA 3MD3A 5F9LA 2RRNA 1FKAF 4N77A 4L3NA 2EBEA 1V3SA 2E7XA 1HI8A 1D09B 3GYGA 2WB1D 4OHWA 2R7VA 4QJVA 1JLBA 3QAEA 2H48B 2HRYA 4ECUA 1M5PC 1Q7YT 5FDLA 4ZP8A 2IVMA 2J6TA 4J9SA 2V2QA 1SH2A 2YKQA 1KKHA 1GH8A 1O8BA 4OX9J 1XQIA 5KFJA 1IKYA 4DR3J 2GGPB 5B0CA 4OMFG 4OYZA 4FS1A 5F8GA 3K5OA 2KZMA 3KG1A 3G2XA 2OO4A 5G0RA 1AYEA 2FYXA 4Q7AA 3CWJA 1QVFR 2FD2A 2QL7B 5HLFB 2DO4A 2YWFA 1WUUA 2CPZA 3BGOP 3CJRA 3CD0A 2YKAA 1HNIB 3P3DA 4EO8A 1WC1A 2EC2A 2AJFE 3UD3P 1SV5A 4DOZA 4YOEA 2OHDA 1OPIA 4DPWA 3MR6A 2CQGA 2LQJA 1FNOA 2VG5A 2Q1LA 3A8JA 3UN3A 4CTAB 4USMA 3CCES 5GMKa 1KC8T 3QJPA 2KZZA 3MM9A 1X0FA 3IWNC 4A8QA 4I67A 2DISA 4P72A 2DH9A 3DDKA 3FK4A 3NAHA 2E7VA 2NYIA 1CS4A 3W61A 2FGOA 1IJEB 5C25B 2YWKA 1PBUA 2HHTA 4MYUA 1UZDA 2CPEA 2IBOA 1KWMA 2UU9J 2W2PP 5DZ6A 3DM2B 3CD7A 3DOLA 2DH8A 5HAOA 4RW6B 5CYQB 1QAIA 3L3CA 2BQUA 4ITSA 4Z7CA 4OZ1A 2XCPA 1D8ZA 2YH1A 3H98A 2XY6A 2ZFHA 5E33A 4F4KA 4UY8T 1TU0B 2AGQA 3C8YA 2YKMA 1AA1B 4LBIA 1LW0A 4QPXA 5KFXA 4X84A 2K1RA 1LFPA 4U7CA 2VG7B 2QLWA 2C2NA 2VG5B 4CTAA 3UR0A 2PEBA 2LCWA 4DHVA 3OL7A 4KGKA 3JTNA 4ER8A 3T1HJ 2AHOB 1NO8A 3C6TA 3RR7A 1T02A 1U24A 3HSJA 4K4UA 2CA9A 4UQTA 3RB3A 3QGGA 4B9MA 1X4AA 4H54A 1SC4B 2IIHA 1V9OA 2JSXA 3I96A 1Y4ZB 4UOFA 2E9RX 2I8EA 5ETPA 5CYQA 4E98A 4JI3F 1S77D 1DRZA 1F5CA 3HDSA 2GIRA 1PBAA 2QG9B 3R27A 1RKIA 3ZXWA 2H9ZA 4EGLA 1Y3KA 5L9NA 1Y5IB 4OJ1A 3OJSA 1H2VZ 4KYZA 4C0BA 5IV3A 3PJXA 3WC0A 2VASA 3L7UA 2Z4PA 5KOXA 3G8QA 2AKWB 3D3CJ 5HVFA 1JKHA 4X4OA 4ZP9A 1OY8A 4WFZA 1TTHB 2Y1RI 4QWEA 3DRPA 5CXTA 4WU2A 4JBCA 4IFYB 2AZ3A 2CQCA 2M0GB 2WSCC 2UV8A 3HF5A 5HROB 2CQPA 3UWTA 5AXMA 1G7CB 2ADCA 2NPFA 4C3LA 2EC0A 3BH6B 3R9LA 1OSCA 1AFJA 2XCAA 4A8SA 1YITS 4G3IA 4RW4B 4KR0B 3GG0A 1FO1A 1S6PB 1CJKA 1FRXA 2GAGC 1N4LA 3MFHA 4WYLA 5D8HB 4JP8A 2N4DA 3BKUA 3SSRA 3ZZTA 3QRRA 6FD1A 3R2DJ 4HT7A 4K7QA 3BR9A 3GSIA 3J7Z5 2Q6CA 1VC5A 2BOAA 3OFHA 3BGFA 2ZH3A 3KK2A 1XWLA 2AEJA 3IM9A 4DV1J 1ZM2A 2FY8A 1PYSB 3C14A 3CJ4A 3POTB 1UPPA 4F02A 2X1FA 5CQGA 4DR6J 3GCWP 3MPDA 1TFWA 4DCJB 1HBMB 1J5OB 4I2QB 1S7HA 1RWWB 3JXOA 2XYPB 2ZKTA 2K7JA 3CD5A 1GX6A 5KFKA 1BHNA 2DRBA 1YSJA 3M32B 1F2HA 3M2VB 4NLDA 1YJWS 1IBMF 1N48A 2UP1A 3W2WA 2E7WA 4X4TA 4CI0B 3CSKA 3W66A 3EJMA 4LF9J 2CPYA 3R7NB 4EI2A 5KFGA 1N32J 1T11A 4B9NA 2V68A 3CJQA 4Y6IA 1H7XA 3FGVA 4JV0A 2ZNYA 1U8WA 2MKHA 1EP4B 5E5NA 3T19A 2DO0A 4OX9F 4IFVB 9RUBA 3Q0AA 1HNZJ 1WHWA 2AJ0A 2DVIA 3MMBB 2V0NA 2LU1A 3TJAA 3ZC4A 1YRTA 1QAJA 3O6QA 4ID8A 1S0OA 4X4VA 2DEJA 2BOPA 2RILA 1J5OA 1DBDA 2HMIA 5E3RA 4F3MA 1IBLJ 3BR8A 1YG0A 5C5JA 4XK8C 1KEKA 3A13A 1VRTB 2KJWA 4DQIA 1UZHA 4Y34A 2FJAB 4E8UA 2DR9A 4Q8EA 1NNDA 3ZTRA 3MEGA 4PWDA 4NLRA 4F4XA 3RW7A 1Q82T 2AP6A 5AE2A 5KFMA 5D4PA 4DEZA 3GR1A 2IBKA 2OGUA 3BPSP 2MQPA 4QIWD 4Y2MA 4ZIWA 3MDFA 1EP4A 2IRUA 1RACB 5F8JA 1FERA 3WIVA 2EEYA 2HLUA 3PHEA 1YQHA 1JLFA 1R8CA 3F41A 3WIUA 4NPOA 4OI6A 4DL2A 1OMSA 3KLIB 4QU6A 1T0TV 1VQ5S 2W9AA 1WOOA 1GT8A 2V8GA 1Z2ZA 3EXCX 5E41A 3CMES 4LF7F 1JQGA 3HHDA 2OEJA 2BW7A 1UAWA 1X5OA 3B6BA 4OHVA 2D9OA 5GAEI 4RBUA 4UOGA 2WTFA 2UUCJ 2B9EA 3O2IA 1SH3A 3R5AA 3G4SS 3OXGA 3TQ1A 4PWDB 2Y9HA 3AT1B 3NGKA 1X0PA 3ISNC 3E8OA 3GMGA 3H7HB 3IS9A 3NXZA 1NKEA 1ZPVA 2O5DA 2HW3A 1FF2A 2WZ1A 1U26A 3DDNA 4DZ6A 4CWBA 5BJRA 1N34J 1QSYA 1T9XA 2CUYA 4DR4F 2G4BA 2HK3A 3QZ8A 3K0JA 3TZXA 5CYMA 4IG0A 1N32F 4LSNA 1WTFA 4PXBA 2RS8A 4N76A 4DL7A 5ITHA 4PWUA 1KQSR 1F60B 2QL5B 2SXLA 2RQCA 5KG3A 3QSYB 2QEXS 1I94J 2IJNA 3FMWA 5DQHA 1KOHA 2QYGA 2XQCA 1H74A 2ZH7A 4QOTA 3GIKA 1U47A 4U9RA 4RUHA 4DR6F 4ECWA 3AODA 2R8KA 1YKWA 3TUJC 3ONQA 3KLGB 3IRXB 1VRQC 3CO9A 4CO1A 4L75A 2ZH5A 1H38A 2ZH4A 3CDWA 2FLLA 3GFYA 3H2VE 4Y2CA 5J2MA 4QIEA 4ECVA 1KHVA 3IFEA 4IG0B 5FLXY 1FDAA 2IA6A 2DNZA 3HZEA 3BV8A 3RBXA 4GVLA 1NK8A 1LKZA 3MM5B 4NEZA 2ZH1A 1N5QA 3I4PA 5GMDA 3HPOA 2YH0A 5KFZA 3FBBA 2Y1JA 3ITHB 5J2PA 2MJUA 3KLEA 2CVIA 3FZ2A 1X4EA 3Q8YA 5L8RC 4ANCA 1X4CA 3FC9A 1Q16B 1VQSA 1WKJA 1WF2A 2MZRA 4XPCA 3CDAA 3GV5B 3KLGA 2EK6A 4F04B 3SFUA 5KFPA 4V19X 3KLVA 4NLVA 3Q86A 1DURA 4C8NA 1OJ4A 3T6BA 3VCDA 4F4YA 4DI6A 4QBUA 3J7YU 3PG9A 2R7RA 1UA0A 3JTPA 2KFNA 1RE1B 4NXNJ 1B64A 3HXMA 1ZM9A 2GX8A 4RW8B 2FJXA 1FDDA 1WJ9A 2C2OB 3DRYA 3QBCA 4M5JA 1PJ5A 2EFVA 4TU7A 2VBXA 2DNNA 1RAJA 5C24B 3Q8VA 3A3OB 5DS7A 3HT3A 1N5YA 1SQEA 2ZJQQ 1PAEX 3CCUS 4DQQA 2J5AA 3LP2A 2JX2A 5IV4A 1APSA 3N01A 4NMLA 4DU8A 4LF8J 2ZM6F 3HO1A 1MN9A 4YB5A 3CCMS 1LQ9A 2Z2YB 4HTJA 2W9CB 1XR7A 4CQ1A 5M2RA 2EI5A 4DPUA 1VQ6S 2JL9A 2Y0SD 3FQLA 2R3VA 1P8GA 2GMJA 3MMCB 4HI1A 4OV6A 5IQQA 3GWCA 4I4BA 3G87A 5ETQA 2LQ5A 2ZJRQ 3GIRA 1H3DA 3B4DA 3KHHA 5IT9U 2EFQA 2WVEA 3R5GA 2B4PA 4NEYA 5DLGA 4X66J 3PZPA 3HSGA 2VOPA 2PA3A 2WONA 3L09A 1I6JA 4DL0C 1WDTA 2AJ4A 4USIA 2KRBA 3RUBL 2XG8A 4P2FA 2OPPB 4PG5A 5ETSA 3AOBA 1JXLA 2UU9F 3HM9A 2IDEA 3J7YI 2KM8C 1KLNA 4ZVEA 1HQEA 5HQ8A 2FJVA 2DNRA 3Q89A 3OJUA 1UEVA 3IAS9 1LK7A 1VHIA 2XC9A 2QT7A 1B99A 2VF3A 1KBRA 2ZOGA 5HVGA 2H4YB 4EBDA 1RYSA 2J9EA 2E5IA 4NZ0A 3HVAA 5CHCB 1N6QA 3VGSA 2XI3A 3D0GE 1S1TA 1X5TA 3WQPA 5GAHI 5E3QA 1JNZB 4B3OA 2V67A 3MCMA 1XC9A 2CPFA 3P6YC 2VQFJ 4PPDA 3G6XA 4BS2A 1TV6A 4F3QA 1BC6A 4HHHA 3ENVA 2RH3A 2YNFA 2WOMA 4U95A 4RZRA 5L39A 1XK8A 2HFVA 3JAMY 1YJ9S 2DNKA 5IZHA 1MWZA 2WSFC 4HR2A 1W2BR 3OD2A 5CD4A 1FK9A 1R6YA 2C2MB 3AY0A 4B08A 1UKUA 1NRKA 3T6JA 1S9EB 4CT9A 1WG1A 5J2NB 1Q7LB 3HFVA 4HT5A 3H40A 4ZVRB 1TL1B 5A6PA 4QWBA 2KFZA 1KFDA 1AUSL 2L08A 2VFVA 2D69A 2W25A 4MH8A 1HMVA 3W62A 5HMYA 2YNGA 1N36F 4OHYA 3GV7B 1CVJA 4X4NA 2AJ2A 4CRJA 3TA2A 1U1NA 5JUMA 3TARA 4DF8A 2NXUA 4I2PB 3HJFA 4B3TF 3BBCA 2B4VA 2GHWA 1RT2B 2D3ZA 3G8SA 2HWHA 3D1OA 4WFXA 1RQ0A 1SIZA 2C3OA 2NLWA 2BQRA 2CAJA 2EFGA 2LKZA 1TVRB 5KFLA 4DJBA 4ED8A 3BGRA 2KVIA 4DDFA 4O0NA 4AQYF 1WI8A 2DR5A 1R6VA 4RU9A 4ZLNA 5J2NA 4TLQA 1DTTB 4RR5A 4JI2F 4DV2J 1TL1A 3MR5A 3MUTP 1TKZA 4ECRA 2AW0A 2RRBA 3NNAA 1A9NB 1HMVB 4K4YA 4JUZA 4LFCF 2VBYA 3HJVA 1V5IB 5KFWA 4DUZF 4NCGA 2FZCB 1SIWB 4WK1A 3KHRA 3HVRA 1S59A 4FVMA 2UUBJ 4ZVSB 2WBMA 1P1LA 2XYGB 4ES1A 3LTOA 4QYZJ 2VKRA 1FFWB 4Q0BB 4AE5A 5F3ZA 4WFAQ 3MECB 1Y3JA 2ZH9A 4G1QA 2WVCA 3EYZA 3J80Y 3OTEA 3W7BA 3MM9B 1TVRA 2DBBA 2RS2A 2E5LF 4Q5VA 4GKKF 3BGRB 2MZJA 3CCQS 3OUYA 3Q8SB 1AZSB 5B09A 3C16B 4WZMA 3CCZA 1OWXA 3SDEB 1KDNA 1S5ZA 2W24A 2PDAA 3LA0A 5KFAA 4EWTA 5J1NA 3NG8A 4AXIA 1F1BB 4P7VA 3OT9A 2G2ZA 1AROP 2MKSA 2E5HA 4IH5A 1VIXA 1VBZA 3RZAA 2E1RA 3LGMA 4R8UB 1DLOA 4DUYF 1C1CA 1YZ7A 1YHQS 4AL5A 4JB8B 3RAXA 1FTRA 3OVAA 3ZZYA 1MWQA 2M70A 3HHLD 3BB5A 5HJYA 4DUZJ 3DLLQ 2F4VJ 4LFCJ 2EPIA 3MMAA 2A18A 2ZITA 5KG7A 2ZH2A 3UDCA 4J9RA 4J9LA 5HBMA 5E0OA 2AU0A 1SQGA 4JI7F 1SKSA 1RADB 4OX8A 4ILMA 5J2QA 1I3OB 2ACYA 2H54B 2HQGA 3UCZP 2MQQA 2EFNA 4AXJA 1TFYA 1S97A 3CB4A 2F4FA 2IRXA 3LPEA 2VG6A 1FNXH 2V4JB 1NK7A 4L74A 2AMCB 1Q5VA 1LWXA 2MLXA 3EGNA 4U67Q 3CPWR 3RB4A 4NA2A 1QY7A 4FP9A 4U96A 2HFOA 1R43A 2WRMA 3IM8A 3KJFB 4UTGA 2WVDA 4ZK7M 3U7JA 5KFBA 1AT1B 4BWJA 1FDNA 2DNPA 5ETOA 3W2VA 4XDCA 2DXFA 1K47A 4WP3A 3Q2SC 4DSKA 4QW8A 4OX6A 3DRXA 5K14B 4PXDA 3V6HA 3D9BA 3P96A 4PG4A 1OYDA 5BR8F 1SJ3P 1YDLA 2UXBF 1OS5A 3M2UB 2C28A 4QU7A 1S4FA 1LFWA 3GIIA 2YWGA 4EBCA 4J91A 1GX5A 1NPPA 2UUTA 1IKWB 2FVQA 1OO0B 2PMWA 2RQKA 5T41A 4A8FA 4ICLB 4A47A 1HPZB 4WCEQ 3DRPB 4W92B 1VIOA 3NKYA 2G2OA 3NMAA 4F0MA 2EG1A 3NCQA 1V3ZA 4X2BA 1U1RA 2CJ9A 2QO3A 4K4WA 1S9GB 1EETA 4OJ3A 3S8SA 2LVWA 4ZKAA 2M5YA 2L9NA 1ZH5A 2IC3A 4F25A 5BYSA 3C46A 4O3RA 1CJTB 2XS2A 3MPYA 4KAIA 1VQKS 1QAYA 4WJBA 1K1QA 5D3GA 2MQNA 5F3TA 1NKBA 1TKDA 1OY6A 1E6VA 4PZVA 2X51A 4F4WA 2ABYA 2NPIA 4M1KA 1IR1A 1IQTA 4V1Ak 1VLYA 3M8YA 1HHSA 4KO0B 3UN5A 2V6AA 4LMZA 3MGJA 2M4MA 4I2QA 3OTOJ 2BR0A 4O3NA 2XHCA 2EWHA 2HAFA 1U0SA 3NLCA 2GAHC 3NL0A 2CNNB 5E3AA 4WZQA 1YLXA 3CO0P 3R7BB 4HDGA 3OTOF 4WTOB 2HNDB 4DL3A 3OPKA 5JJBA 3ISND 5D3GB 4NRUA 1R8BA 5L1JA 1JIHA 3E3XA 5F8MA 4K8RA 2DY9A 1FA0A 2HBZB 3DGPA 5GVQA 4NLUA 3G8TA 4QR2A 2R7WA 3CJSA 4OI3A 2ZHOA 2K06A 4YHHJ 1CSJA 2M9KA 5L38A 1EHWA 2ZHBA 5LMUF 3OFEA 4CO4A 5B7WA 4RKUC 2QFJA 3HCXA 3TZZA 1JLAA 3UPFA 4EK2A 2P5VA 5KT2A 1HBNB 2XO7A 3M4XA 3THPA 1VRTA 3ZZPA 2MYFA 1XMQJ 2XM3A 4WF9Q 2I0XA 2X7IA 3DOKB 3TUIC 2NCKL 1KQGB 1PIEA 3QFHA 4DUYJ 1MU2B 1GXUA 1MROB 1VS3A 2BE7D 4I6AA 1G2EA 5DM7Q 2JZ5A 3EE3A 1SCJB 1GK8A 4ETZA 1MNEA 4OYWA 2DTJA 2OD4A 1FDBA 4ZVQB 3NCRA 4ED1A 4JI3J 1IKXB 1KTQA 3ICLA 1U2RA 5B0BA 1SKRA 3UQSA 2UXBJ 1JLFB 4IFYA 2DT9A 2PFDA 2KXHA 3PYEA 4B17A 2V2VA 4IR1A 2YXLA 2ZZMA 4C9DA 1PYOB 4PPZA 1U1LA 2M8DB 3F73A 4EMDA 3SCIE 3BH7B 3PX4A 4PUOA 4OZ5A 1SJ4P 5I3UA 2B4OA 2XEXA 5AXKA 3VZIA 5K8NA 3H25A 4DFJA 5GADI 1NHVA 4OQJA 5IWAF 3M9OB 5IC6B 4PQUA 2KHDA 4OI4A 1CJKB 1LWFB 1CPZA 2C2EA 4X62F 2JVOA 2R7UA 4ECQA 4AL6A 2GNKA 2QTWA 3CC4S 3AOCA 2PI4A 2PFFB 2O1PA 3QMQA 3W9HA 4K4SA 4JI6F 4JI1J 1UPMB 3BS9A 3M8QA 2HNZB 4JI7J 3BN7A 4U8VA 1YBTA 5H9FJ 4LSNB 2BJ9A 2U2FA 2ZWOA 1X4FA 4RX6A 1M1KT 4TNOA 3Q23A 2B43A 3CEDA 3Q2TC 4P10A 1RT6A 3DFEA 1K44A 2MKYA 5H1SV 5DGBA 3KUHA 1TL4A 1R0AA 1RCXB 3D2WA 1VQ4S 3MXHP 4DR7J 2OPRB 3W2WB 5MLCV 2VFUA 3K2YA 1M5HA 4MYTA 1I5OB 1LWFA 4LIWA 1B7FA 2ZBPA 4OI2A 1GFWB 1H2UX 4PAAA 1GTEA 1SJRA 3I31A 3IRXA 4A8XA 5AXLA 4PYAA 2F1FA 3I4HX 2MHEA 3F56A 3W9IA 4DR4J 2E5LJ 1NBEB 1WD6A 1WKLA 2W8LA 1T03A 3EPGA 1NDCA 3G86A 2OPQA 3EUNA 3EVWA 4C8MA 2BJ8A 1GXLA 2A6MA 2BJEA 3AD7C 4DL6A 1NDKA 3BKFA 2VQFF 2R8JA 1X9WA 3MM7A 1HQUB 2MLYA 3OLAA 1QSSA 5AE1A 2HVEA 4NI2B 4QWDA 2NUUG 3L9ZA 3MPVA 2J7UA 3NOGA 3PDNA 4C8LA 2IM3A 4G1PA 4MKAA 4CM2A 3EDQB 2BBEA 2DR8A 3PKMA 3AD9C 3W8PA 1VC0A 3ZZZA 2GVZA 3QGIA 4NLYA 5LJ5Y 4DV2F 1TKXB 1V5VA 2J9CA 4PR6A 3RRKA 4GC7A 2W4DA 4AQYJ 3TVKA 1FFGB 4I0WA 4ZS6A 5BXIA 2MQ8A 1A6LA 2CPXA 4ECXA 1L3SA 2COLA 4N7TA 5CCMA 5DG7A 4LRCA 1RBLA 1T03B 2NYHA 4YEAA 3WC2A 4B9SA 4WIIA 2GJ2A 4PCQA 1EAYC 3N9UC 2N3OA 2E9TA 1P27B 3SYZA 3DLEB 5KFRA 1CJUA 3MM7B 4WXOA 5RUBA 2J7WA 2PE8A 3QO9B 4I56A 4ED3A 2XHWA 1K73T 4URSA 1QSLA 3HZGA 1KLMB 1H72C 1MW7A 2GO9A 4YMEA 3RRHA 3OL9A 2GVZB 3DLKA 2QMWA 3D66A 3GJTB 4ZP7A 4QQBA 2W9CA 3BQ0A 4OFZA 3NNCA 1JWWA 4MMOA 3MI7X 3N4WA 1T9UA 3NWGA 4PRFA 3D0IE 2V8HA 2YQ0A 4I1TA 1VFJA 3VAJA 2YWHA 1GEHA 3BF4A 1T9VA 3HD2A 4OHZA 4AFFA 3PO5A 2OKQA 5CZVA 4ZPTR 3C6UB 4CCHA 2HQDA 4NXMF 1C0TB 1LNQA 5K8MA 3HHEA 2C42A 4HHJA 1FRLA 2CJYB 3HP6A 2PN6A 1CJUB 2RDJA 1IBCB 2Z2MA 1NSKL 2ZUAA 4UUWA 5GADU 3HSZA 2CDQA 3KHLA 5B0FA 2ZD1B 4R0EA 4NXNF 3R6LB 5A0YB 4OZLA 1BWVA 5DO2A 3ILIA 2DJWA 2DY1A 3NOCA 4KH0B 3KNGA 1YBAA 2HVDA 1JLEB 2W9BA 2G1DA 3GYXB 5ETNA 4A4JA 4OX7A 2JLFA 1NPRA 2A0FB 3CDBA 4H4KA 4WWSA 3UR3C 2V4QA 3VQTA 1FRHA 1IXKA 1Q4RA 2GO8A 3CDEA 2XYHB 3CT9A 5DG9A 2HG4A 3C19A 4PG7A 1GXTA 1OYEA 4ENOA 4B3MF 3QJLA 5D0HA 5EUHA 3VR1A 3MEDA 1IJFB 4PWWA 1KSPA 2B9YA 3HFZB 4KIAA 4TVAB 5EX0A 1RT7B 4TLRA 4R25A 3K5LA 4NMXA 2C2DA 1YJNS 1R8HA 2HQCA 4P2MA 2HS3A 3PW2A 4RW7B 4K2JA 3K58A 3G6ES 1IM4A 3K17A 4OYAA 5D0GA 1NSQA 1F3FA 1TK8A 1HNXF 3OL8A 4ZVTB 5F8NA 1CQMA 2A6OA 2RQ4A 5A8RA 4DSJA 3FZBA 1WC0A 2ZM6J 2ZHAA 4X4UA 1VBKA 3FKBA 4EUVA 1S1UA 2F5GA 5L46A 1KD1T 1LXJA 2XGPA 3J7A1 2VDHA 1IN0A 1FWLA 2CPJA 2IYIA 2ZKUA 1IWAA 1FRMA 2PT0A 2FHJA 2BABA 2OP5A 2H5EA 3I32A 1KHWA 3PEHA 3Q83A 4KGZB 1YJVA 1X4DA 3LP2B 3DLGB 1N5SA 3NS6A 1VRUA 4OJHA 4ZOSA 5F41A 4M5DA 2QJ3A 2JJ4D 2KXNB 2XGQA 1REVA 1RT7A 2RSQA 2IM0A 4OLOA 3QZ7A 1ZETA 3CCTA 1U1QA 3IR5B 4YUDA 2HNYA 4DR2F 3GQCA 1XBWA 4CIOA 4DR5F 4WTYA 2DNOA 2PEHA 1Q79A 3IA0A 2XZWA 1LK5A 2LQ8A 4CO5A 2I38A 1LWCA 3KUEA 1Z1ZA 3GPAA 4M5KA 3T1HF 1NAQA 4G1IA 2CJKA 4GKKJ 3HKWA 4F67A 4CLKA 2DYAA 1R0CB 1RAFB 1WEYA 3TJ9A 3GFXA 5ETLA 3BDPA 4I6YA 4ELTA 4B02A 4W98A 4WP8A 4P74A 1S1VB 1FI4A 3ENWA 3FSYA 3SV3A 3THVA 3Q8RB 1WACA 3MECA 4PQAA 2NR0A 2OPPA 2VODA 2HHPA 2DPJA 1NZAA 4ZPCA 2FC9A 4MTPA 3RGIA 4AYBD 2HNYB 4JI8F 3DYAB 3CJ3A 3M2RB 3D4JA 3V5RA 2JLGA 2BRKA 3OUYB 3S6EA 1M90T 4NLQA 4DQRA 1BQXA 3C16A 4USVA 1S57A 2IMOA 4FYVB 1KVJA 2HFNA 2NXNA 1FXLA 5KG2A 4C3KA 4KHRA 2VONA 2FTRA 1NXIA 2GVDA 4ZN1A 4ED7A 4YFUA 4OZNA 1LWEB 1U49A 3KLFB 4LVOP 1H7WA 1HYSB 4R8UA 2BKNA 3MF5A 2BACA 1FVSA 3IBCB 1W7WA 2H5JB 4MAKA 4DFMA 1TV6B 2NUHA 3GIMA 2LYVA 3CCVS 1RT1B 3AB4B 3R1HA 2FJDB 4FZVA 4WPAA 3T9NA 3FEZA 5LSRA 5HBMB 2DHXA 3O1LA 1FK9B 2RQMA 2LA6A 3IP0A 1FJ7A 1K0VA 1B0TA 1NSPA 2BM1A 3KUGA 4LVNP 1UW4A 1RJJA 3A1YG 4P7TA 4TXSA 4MFBA 5L9XA 3VVTA 4LSLB 2V4JA 4WFNQ 3GILA 3THTA 2GVDB 3IMQJ 2GV1A 2I2YA 3R3TA 1S12A 4J90A 4FBUA 4NLPA 1W25A 3AFGA 3EM1A 3NWRA 1MMLA 3H4DA 4I2PA 5I42A 3F44A 4Q2LA 3W2VB 1IBMJ 3IGVA 5IFMA 1RT2A 3LH2S 1NJIT 1RT1A 1S6OA 3M6XA 1BQNA 4XIUA 2RHSB 3MHYA 3N6LA 4HDHA 4LIRA 4OYPA 4P2XA 3RU0A 2VJUA 1S7IA 1EARA 3M2UA 1TELA 9ATCB 4NLOA 5ETKA 4FF1A 5K9FA 2AZ1A 2RT3A 3AHPA 5F0WA 4YY3J 3B54A 2F8EX 4BBYA 4HHUA 2ZJPQ 3I9ZA 2BJ1A 2DGVA 4RLEA 1RTDA 2KN4A 4RNFA 1UVIA 4NCGB 1T9YA 4LUBA 4N41A 1RLCL 1OPZA 3DI6B 1MWYA 3RB0A
chains in the Genus database with same CATH topology
1IQZA 5I4MA 4YDDB 3UFCX 2J8AA 4BWMA 4X66F 2DNGA 3JSYA 2KTQA 2J76E 2LQBA 2VPWB 4HH1A 4DFPA 3NNHA 4C8ZA 4FPRA 1JLBB 4RW9B 4KTQA 3I5AA 4URGA 4QIFA 3BEGB 2O66A 1LOUA 3B82A 3QLHB 1FE4A 2NSCA 1UFWA 2JC1A 2MZSA 4KO0A 1FJCA 3HMJG 3LANA 1U48A 1ROFA 3CJ2A 3X1LB 2ASJA 1C1CB 2MY7A 3DI6A 2VBZA 1HNIA 3IC1A 1SV5B 3MAHA 1FXRA 5EX3A 4IRDA 3KKFA 4H4MA 2PI5A 2JOQA 2GHVC 3TR5A 3QAUA 4Y65A 2KG0A 3OV7A 1JLCA 1SBRA 2FHOB 3MUMP 3RAQA 1M5OC 3VAMA 2XMKA 5IT4A 3P5TL 3UD4P 2C3YA 2VG6B 1TAQA 4AL7A 4O44A 1XNRF 4Y3CA 3M9MB 2BANB 3GSDA 3RYLA 5KFTA 2W4PA 4MIWA 5DG8A 2GHPA 1V6HA 4I68A 4RW6A 2V2KA 3JB9k 3LP0B 2HAIA 3D1HA 1ELOA 1ZBTA 1B0PA 4DX8H 5DDOC 3OHAA 3T9ZA 2HLTA 2K1RB 3K57A 2A10A 4IO1A 4ETXA 2E5JA 1GAOA 2Z8QA 3UCGA 6FDRA 3UNGC 1JLCB 2JEGA 1IR0A 3OTBA 5KFNA 2DK2A 3K8VA 4CO2A 3H5UA 1IKXA 3PV8A 4ICLA 3L7OA 3EZ5A 1SL0A 2HGMA 2KRRA 2QV6A 4Q8FA 2HHQA 3TP2A 2F9DA 2R2TA 3ZZOA 3LP0A 5M2PA 2WBRA 4C4WA 4O4RA 2F8HA 5JVGQ 1F5BA 1SB6A 5F0UA 3JYTB 1SJQA 3T5KA 3RW6A 2IC3B 3MPWA 4NZ6A 4NYZA 2ZH8A 1BQMA 2OSQA 2CQ2A 5L1LA 1KFSA 4NLTA 2Y1IA 3EX7B 1N8RT 2UVWA 4R0JA 1FVQA 3FEYB 1E6VB 2LU2A 4RWWA 3OHBA 2GA7A 2LEBA 3PX0A 2J0XA 3MOZA 3TA0A 2DRAA 4CO0A 2HNZA 3BGLA 3WDOA 2VC1A 2KJVA 2N7YA 1WHYA 5D78A 1NK9A 3S01A 3GZ7A 1HHTP 2MKJA 4U7UK 1R0AB 2UUCF 3NS5A 4ID5B 2OPRA 2ADBA 2W7PA 2MPUA 5E2QA 2HNDA 1R7IA 1T3NA 1BQMB 2JLEA 1ZOTA 1C0UB 4J37A 4G6VB 2XNQA 3SSSA 2C3PA 4OJGA 2V4RA 1KN6A 3DU5A 3K8WA 3V6KA 2R7XA 3GFHA 3KK2B 2A2DA 3N0VA 2L9WA 2FIUA 3LWLA 1RA7A 1JLAB 5L1IA 4QIGA 2XWYA 2MMYA 1HBNA 2XMMA 4ZVFA 3QWUA 3ZZUA 1QVGR 5KFEA 2QA4G 4PKDB 1FD8A 4N8NA 2XS7A 4RNHA 1HQUA 4F26A 1VGYA 4RNMA 5IM0A 1MU2A 1MROA 1IBLF 5BYQA 4N5SA 4JV5F 2W8KA 3OL6A 2HHSA 1VI7A 3FQKA 4KV8A 2HYIB 2ERRA 2JC0A 1G3OA 4IFVA 2BUNA 2D1CA 4Y0FA 4Q43A 5KT6A 4TU8A 3MD1A 1RKJA 2AV5A 2IRYA 1J5EF 2KO1A 4PUOB 2M3DA 1ULRA 5KFQA 3FSIA 4FF4A 4LFAF 2B56A